4OX9L

Crystal structure of the aminoglycoside resistance methyltransferase npma bound to the 30s ribosomal subunit
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title Molecular recognition and modification of the 30S ribosome by the aminoglycoside-resistance methyltransferase NpmA.
pubmed doi rcsb
source organism Escherichia coli
total genus 16
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ox9L00
2KENA 3OTOL 1EQQA 2ZTEA 3TQYA 1IBLL 3M4OH 4YWMA 4A3MG 5JJLA 4L5SA 2CWPA 2I0QA 2K4KA 2NN6I 3J7ZC 2OTLA 2Q2TA 1HJPA 2IY5B 4C2MH 4HJ7A 1UE7A 3L7ZC 4NXNL 4A3KH 3UDFA 1QVCA 4LUVA 1PH8A 3I4NG 3HOZH 4AQYL 2KCTA 4WJ4A 3T1HL 4DAMA 1Y1WH 1YIJA 4A3FH 3PUXA 1VQPA 3S2DH 2ZM6Q 4DR3L 1SN8A 4IPHA 4DR5Q 1HNWQ 1P8LA 3J81i 1OXSC 1GM5A 5IT9c 1DGSA 3LGJA 1X56A 4A3IH 1N34L 4A3BG 1J5EQ 4LF6L 1L0WA 3KDFB 4DR4Q 2WP8J 1LM0A 3CCLA 1FGUA 4X62L 2WB1G 4A3LH 4DR2Q 1IBML 4OX9Q 4JI0Q 5IYDH 1PYSB 4P75A 2R7FA 3J80i 1K8GA 2BA0A 1TWCH 1HZBA 4C3JH 1JT8A 3ULJA 1WYDA 5C3EH 1Q81C 1A8VA 2GVAA 1PH3A 4UY8C 1N32L 3RZDH 2L15A 1Q12A 3Q8DA 1B7YB 1SROA 1VQOA 1VQLA 2JA8G 3M9BA 1RIPA 3A74A 1UEBA 4YCUA 5FJ8H 4DNIA 4LUOA 4DV3Q 5LMNQ 1Q7YC 2R7ZG 2JA5G 1KC8C 4K0KQ 1VS0A 1K8AC 1J6QA 2F4VL 5JJKA 1VQIA 4LF9Q 1M90C 4X64Q 1HNZL 1XNQQ 4TVAB 3D0FA 1O7IA 1QUQB 1PH2A 1BBUA 4YWKA 3BZKA 1YZ6A 2ZTCA 2DUDA 4C3IH 1VQHA 3ERSX 3FHWA 1E22A 3RR5A 4GOPC 4DK6C 2UUAQ 3KYHC 4O2DA 5FLXc 4DV5Q 3H3VI 1IBKL 3AFPA 4OWXB 1OTCA 2E5LQ 4LF8Q 1VQ7A 4JI3Q 1G291 4HIDA 2YU9H 2Q2HA 4DPGA 3PIOA 3E0EA 1IL2A 3HOUG 4BBRG 3OTOQ 3PUYA 2UUBL 4A3CG 1I50H 2LXJA 1C0AA 4LF7L 1I94L 1GKHA 4KI0A 1YBYA 3HKZE 3KOJA 4NXNQ 2R92H 5IP7G 1HZAA 1X65A 3I7FA 3KF8B 4QJFA 4R1JA 4B3ML 1KD1C 3KFUA 2JA7G 4AQYQ 3T1HQ 2XGTA 4APVA 5M3FH 2E2HH 4TQUS 5GQOA 4JI4L 1WCMG 2K5NA 4DR3Q 4QGUA 3RN5A 2AKWB 3HOVG 1L1OC 1PH1A 2GVBA 1HNXL 2JEAI 2PI2A 4JYAL 3U58A 1MJEA 2QGQA 4C3HH 4A4IA 1KRSA 4LF6Q 1VQDA 2IHFA 2ATWA 3S1NH 4XIGS 2YYZA 3ER0A 4X62Q 4JCVE 4YHHL 1IBMQ 1CKMA 2A19A 3HOYG 1YEZA 3BJUA 2H5XA 1X55A 4GKKL 5ELOA 1A0IA 5JEAJ 5JJIA 1NMFA 3S1RH 1VQMA 3RN2A 1JJCB 2I5LX 3MEFA 4AIMA 5K36G 5GROA 1FL0A 2K5VA 1U5KA 4IPGA 4HIOA 4OWTB 1VQEA 1YHAA 4IJHA 3F2CA 4LWCA 5M5WH 2VQEL 2IHEA 1KL9A 2F4VQ 3HKSA 1XPUA 1FJGL 4PZ6A 5FLMH 4DV2L 1HNZQ 4JBKA 3KJPA 3GO5A 4RMFA 1W2BA 3CC2A 3CAMA 5DLQE 3GTPH 1TWFH 5C44G 1X9NA 4MZ9A 3RLOA 3OYYA 2B29A 1VCIA 1JE5A 3M7NA 4A3GH 5HY6A 1XTDA 2VNUD 3S16H 4L5RC 5M3MH 2HHHL 2VQFQ 4A93G 2WAQG 2QA4A 1E7ZA 2CKZB 4B3SL 4LFAL 1BBWA 4JG2A 1Z9FA 2HIVA 2LSSA 2Z0SA 1QUQA 5BR8Q 3PO3G 2N8NA 1G51A 1K83H 1PH5A 4LF5L 1VQGA 1VQJA 2Q2IA 3CCSA 2UUBQ 2B3GA 2VL6A 4DV1L 5EAYA 1VQ4A 4DK3C 4BBSG 3K7AH 3STBD 2NN6G 4GN4B 1I94Q 4LF7Q 3D31A 4NXML 2NVTH 1CKOA 3TREA 1CSQA 5E7NA 4GOPB 2R7DA 3RNUA 1YJ9A 4DR6Q 5AJ3L 1A63A 4HIKA 4B3MQ 2ALYB 4JI1L 5IP9G 3DM3A 1W3SA 2ZJPA 3CCUA 4IO9A 1VQKA 3STBC 3G48A 4BY7G 2LXKA 1HZCA 4JI4Q 1IXRA 5JEAG 1VQ6A 2Z6KC 1LTLA 3CW2C 3HOWH 1PV4A 4BXXG 1EIFA 4DV6L 2VUMH 2K75A 3GD7A 4IPCA 4PG3A 1HNXQ 4JYAQ 1X3EA 4JI5L 3DLLA 4R4TA 3T1YQ 1YI2A 1KXLA 4X66L 3M4PA 4GNXC 4YY3Q 1SE8A 4DUYL 4A3MH 3G71A 1JMCA 4DR7L 4XTCS 2UU9Q 3GTQH 2OQKA 3BZCA 4QL5A 2JA6G 4JOIC 1KAWA 3F2DA 4GKKQ 4R4IA 1WJJA 2RF4A 2YTYA 1VQ8A 4A75A 1K0RA 4OWWB 4KLKA 3G4SA 2B63G 4LFBL 1L1OB 4DAYB 3I2ZA 3W1BA 1XNRL 1Q1EA 2D62A 1Y1VG 2YV5A 2VQEQ 1QZHA 1Q1BA 2HQLA 1XMOL 3FP9A 4UPAA 1WFQA 1PA6A 1FJGQ 4DV2Q 3S1MH 4DV0Q 1KIXA 4JBJA 3U4VA 3HOXH 3GTJH 3G6EA 1IYJB 3CPWA 4ALPA 4JI7Q 2CFMA 2JJQA 3F2BA 3PIPA 3PUVA 3I4MG 3E9HA 3JAMi 5H1SE 1ASZA 1EYGA 1RL2A 4A3DG 2CWAA 3I4OA 4R4OA 3M4QA 1PYBA 1C7YA 1SFOH 1HR0Q 3A0JA 1XMQL 3J81c 2OCEA 4LFAQ 2A8VA 5IYCH 2WFWA 4YCWA 4QY7A 3GTGH 1Q82C 2JA8H 1LYLA 2ZJRA 1G6PA 3IRBA 4LF5Q 2D0OA 3A5UA 3GTLH 3BU2A 2R7ZH 2JA5H 4LF4L 4MNOA 3CMAA 2EXDA 3FKIG 1CUKA 3PV0A 3OW2A 4L5TA 1IBLQ 5IYBH 4R4CA 1XJVA 4BY1G 5AJ3Q 1D8LA 3S17H 1OXXK 3J80c 4JI1Q 2E2IH 3EN2A 1PH4A 2IX0A 5C4XG 1NBWA 1E24A 3L0OA 3CC4A 2K52A 3GTOH 3ZJYC 2Y0SE 4EQ5A 4JV5L 1YHBA 1E3PA 2K50A 4DV6Q 2FXQA 1X3GA 1YJNA 3RLNA 1PH7A 3PUWA 3I56A 4GN3B 4L5QA 3L2PA 4JI5Q 3HOUH 4GOPA 2PQAB 2JA9A 1JJGA 1N34Q 4X66Q 4GKJL 4DUYQ 1ASYA 4IOCA 1VQ5A 4DR7Q 4A3CH 1UE5A 2UXBL 5LMUL 4RG1A 1TWAH 1K73C 1LUZA 3U50C 2F52A 2AWNA 3NBHB 4JI6L 3HKZG 3W5OA 4KHZA 2RHSB 5GAGC 3PO2G 2JA7H 4LFBQ 2R93G 3KLWA 4AYBE 3GTMH 1E1TA 1XNRQ 1N32Q 1WCMH 4A3JG 1X6OA 2YTXA 3NELA 2BA1A 1KQSA 4HIMA 1PH6A 3CD6A 3KDFA 5LMNW 3HOVH 1Q86C 1XMOQ 4GNXB 1MJCA 4KHPL 3UDGA 1WOCA 3NENA 3KF6B 3J7A5 2VW9A 2BH8A 2NVYH 4UP8A 1XPOA 2UXDL 2UXCL 4WJ3M 5FLMG 3F8TA 3HOYH 3H0GG 1L1OA 3EBEA 2KCMA 4P73A 4BA1I 4EX5A 1HR0W 4DR6L 5GAHC 4JI2L 1VQCA 3I55A 4OX9L 4JI0L 1XMQQ 2MFIA 1HZ9A 4R4QA 1YVCA 1IBKQ 1PFSA 4DV4L 4A3EG 5HGQA 1X3FA 4P71A 2HT1A 2OWOA 4QIWE 1V43A 4GS3A 2BH2A 5GADC 2D0PA 1E1OA 4LF4Q 2AHOB 4OONA 2C35B 1VQAA 1WI5A 1OXTA 3CP0A 4LFCL 2MNAA 3CCRA 2ID0A 3F1ZA 4K0KL 4QQBX 1S3OA 4LNQA 5GAEC 4IOAA 1XNQL 1HH2P 1JB7A 4PZ7A 4HJ9A 3JC66 1S72A 1NMGA 1B8AA 1XPRA 4A3KG 4DR1L 4GLVB 4JV5Q 4A93H 1NY4A 1PHJA 1CKNB 3HOZG 2EIFA 4POFA 1Y1WG 4Y52H 1GO3E 4H02A 4A3FG 1Z47A 3PO3H 5IE8A 1N9WA 3KJOA 2JE6I 4GKJQ 1D7QA 2AWOA 3HFZB 3GTKH 3NEMA 4HJ8A 3UE0A 4BBSH 2RCNA 3RZOH 4YWLA 5LMUQ 4B3RL 2UXBQ 4JC0A 4A3IG 4YHHQ 1U0LA 1SRUA 5C0XJ 4JI6Q 1AH9A 2WB1E 3AFQA 5IP9H 3HOWG 3CCJA 2GN5A 3CCEA 4A3LG 1K9MC 3TS2A 4BY7H 2K5HA 2PQAA 5IYDG 3I4NH 3UE1A 2A1AA 3S24A 4FDBA 1I3QH 4AH6A 4HJ5A 2HIXA 4JI8L 2K14A 4BXXH 2QEXA 3K0XA 5C3EG 3W1GA 4KHPQ 1UE6A 2R6GA 3CMEA 4MTNA 1YJWA 3CQZH 5FJ8G 3EIVA 2Z6KA 4A3BH 2UXDQ 4LUZA 2UXCQ 1VQFA 3U4ZA 2PI2E 2KBNA 3HOXG 4ME3A 1K3RA 1JJ2A 2VY3A 3TRZA 1I6HH 1H95A 2KHIA 2JA6H 1EQRA 4JI2Q 3RLFA 1IZ6A 2OQ0A 1UWVA 4GNXA 3PGZA 2ES2A 2B63H 2IX1A 5C4JH 1NTGA 2HHHQ 4POGA 4DV4Q 3S2HH 3E9IA 4A76A 3KF6A 1I5FA 2MQHA 5M5XH 4B3SQ 4DUZL 3CCMA 1S40A 5IWAL 4JOIA 5IYCG 1Y1VH 1VQ9A 3AQQA 1TXYA 1N36L 4DV1Q 1VQNA 4X65L 4LFCQ 3PF5A 4B3TL 4BA2I 1EWIA 2EQSA 2N78A 3J81j 3M85A 2I5MX 4NXMQ 3S15H 1B70B 1PVOA 3B6YA 3UDXA 2PMZE 3H15A 1L2FA 2NZOA 5IYBG 5C0XG 2NVQH 2DGYA 1KRTA 3I4MH 1NE3A 5C0XI 2UUCL 3PCOB 1QVFA 4NPSA 4DR1Q 1NJIC 3PSIA 1N33L 2R92G 3H3VH 4A3DH 3AYHB 2ZJQA 1MIUA 1UE1A 1PH9A 4IFDJ 4GN5A 2YTVA 1OXUA 1KHIA 5M3FG 2OTJA 4P74A 4NB3A 2VQFL 5IY0A 3CXCA 1BKBA 2PNHA 1GD7A 2VS1A 3S14H 2MO0A 1V1QA 3CCVA 4BBRH 2ZTDA 4DV7L 4B3RQ 3FKIH 2RHQB 3K7UC 3TEHB 3SGIA 4IJLA 1Q8KA 1Y14B 4YCVA 3JAMc 2E2JH 3AEVA 1TWGH 2F3IA 5BR8L 4BY1H 4O0AA 1CKNA 1V9PA 3ULLA 1EUJA 4IPDA 2KHJA 5C4XH 4PZ8A 5IP7H 2I5HA 3ULPA 4GLXA 2CCZA 1EIYB 4JI8Q 3ICEA 1A62A 2CQOA 2Y0SG 4GLAC 1EFWA 3CF5A 4UP9A 5M5YH 1TWHH 2Q2UA 2ZM6L 2IT1A 2N49A 5ELNA 3WWVA 3PUZA 3CC7A 3CCQA 4DR5L 1HNWL 1YNXA 2JK8A 3T1YL 5J3BA 1C9OA 1J5EL 2XTIA 4YY3L 4DR4L 4HJAA 1YITA 1GVPA 2UU9L 3PO2H 3A5ZB 2JQOA 3UDIA 4UP7A 2R93H 4DR2L 4OO1G 1SMXA 4JBMA 3VDYA 4A3GG 4DUZQ 1X54A 2N3SA 2WAQE 4AYBG 4A3JH 2MO1A 5IWAQ 4IFDG 4OO1I 2AMCB 4JBWA 5M3MG 4IFDI 2ASBA 1CSPA 1MKHA 3K8AA 2E8GA 3K80C 4J15A 1BVSA 1N36Q 4X65Q 2NZHA 3K81C 4X6AH 3M3YH 4LW1A 4P72A 4B3TQ 2JEBI 4DV3L 1Q46A 5LMNL 4DV0L 3H0GH 1R9TH 5C44H 2UUCQ 4JI7L 1AE3A 4X64L 2NVXH 4LF9L 1AE2A 1N33Q 4Y7NH 1YHQA 3GDEA 3TS0A 1N8RC 1M1KC 1VQBA 1QVGA 2UUAL 4A3EH 4PMWA 1SLJA 1HR0L 1P16A 4DV5L 4DKAC 3S1QH 1FVIA 2V1CC 2VZAA 1QZGA 2E5LL 1OXVA 4LF8L 4JI3L 4DV7Q 1EOVA 3MXNB 2VUMG 3PF4A 3CPFA 4OXPA 1T9HA 1SR3A
chains in the Genus database with same CATH superfamily
2ZTEA 3SK6A 1DONA 2I0QA 1LT5D 3J7ZC 2IY5B 1SYGA 3KLSX 5CV7A 5FOBB 3UDFA 2E2IB 1PZKD 1SXTA 4A3DB 2KCTA 4IPHA 4DR5Q 3J81i 1EY9A 1OXSC 1MSHA 5IT9c 1X56A 1NUCA 1N34L 4TRDA 4EGVA 1MBYA 5I9PA 1FGUA 1TWGB 3HP3A 4CDCC 3K5NA 2R7FA 2NUCA 1K8GA 1HXYD 1JT8A 3ULJA 1WYDA 1A2UA 1Q81C 1PH3A 1B1ZA 1VQLA 2JA8G 5J1ZA 3CU7A 5FJ8H 4DV3Q 2R7ZG 2L12A 1BR9A 1KC8C 4HEDA 2F4VL 5JJKA 4LF9Q 1M90C 3QR8A 4X64Q 4YIJA 1HNZL 4ZKCB 1AEXA 3H91A 3BZKA 2ZTCA 1SNMA 4C3IH 2UUAQ 1E22A 1F2ZA 3SVMA 3L9AX 1IBKL 1JOQA 3D4DA 4LF8Q 3A7AB 1VQ7A 4A3JB 4HIDA 2Q2HA 3E0JA 2E74C 4BBRG 3HGBA 3H94A 4RHRA 1Q8IA 2LXJA 4LF7L 2O2LD 4N9PA 4KI0A 3HKZE 2R92H 1X65A 3NTIA 5C44B 1BNZA 2JA7G 3T1HQ 4Y7NB 2XGTA 2E2HH 1PRTC 1SDFA 1EYCA 3LX0A 2AKWB 3DM1A 2JEAI 1HNXL 3DEOA 4JYAL 3U58A 1MJEA 3DMUA 1RHPA 4C3HH 1ILQA 4EQPA 1F9QA 5JVG3 1EU4A 4JCVE 3HOYG 2A19A 3M4OB 4IUQA 5IIFA 1Y8OB 1TS4A 3A54A 1JORA 2I5LX 5GROA 2PO4A 4IJHA 5CV4A 3F2CA 4LWCA 3S2DB 2IJ0A 2D5DA 3J81E 3BS1A 4PZ6A 4XQJA 3LWEA 2F03A 3M7NA 1JE5A 5HY6A 2VNUD 3S16H 3NTKA 5M3MH 5E4XA 4U673 2WAQG 1EY7A 4RHSA 4LFAL 5I2XA 1GHJA 1WTXA 2N8NA 1K83H 4RWSC 3J7YW 2UUBQ 1VQ4A 4PQXA 4BBSG 4FXGC 2NN6G 1I94Q 3D31A 4NXML 3TREA 2R7DA 1XTCD 4JI1L 4RFBA 2F3VA 3DWAA 4BY7G 1HZCA 1IXRA 1DM0B 1HFGA 5CBAE 1X3EA 1D5ZC 3KF8A 3ITPA 1SE8A 1JMCA 4XTCS 2UU9Q 1AN8A 3KBXA 3GTQH 2OQKA 2YTYA 2XNAC 4KLKA 1SNPA 2O4XA 1SJHD 4DAYB 1B3QA 3I2ZA 4FF3A 1XNRL 1G2TA 1Q1EA 2XWBB 1E2VA 2D62A 5M3FB 3VR3A 1YNJC 3WOFA 5G3LF 2HQLA 1XMOL 5EBDA 3S1MH 4CKCA 4DV2Q 1SMYC 1Z6HA 3NPPA 4DV0Q 3U4VA 4ALPA 1QOHA 2JJQA 3MXGA 3PUVA 5KIXA 3I4MG 1QCBD 2VB3X 3OMGA 3SR1A 1G91A 4R4OA 1S5FD 2J4XA 1DYQA 2A8VA 1KTKA 2RDHA 2F0JA 4LF5Q 1CQFA 4RCNA 3K5MA 3BU2A 1C8CA 4ZAIA 4LF4L 3CMAA 3E5SA 2K28A 3S9WA 5IYBH 3S17H 2JYOA 4K8JA 3H0GB 3SK8A 2F0KA 1TKWB 1NBWA 1E24A 4FF1A 1PTOC 1ZYRC 2K52A 1Y69U 2EJFC 3ZJYC 3ONAB 4EQ5A 4A3GB 1IKLA 1E3PA 1LTGD 2FXQA 1YJNA 5C3WA 5DEHA 2AUKA 4GN3B 5EQ0A 2PQAB 3VYTA 5KNDA 2CH4W 1N34Q 4X66Q 2B2TC 1CA5A 2P5ZX 2PYKA 4DUYQ 4IOCA 4DR7Q 3J81L 3K59A 1FNVA 2D9UA 1A15A 1TWAH 1V1OA 2MGSA 1LUZA 2KA7A 2VB2X 5GAGC 2RHSB 3PO2G 1IYUA 1IKMA 1H9KA 1E1TA 1JR0D 4RGOS 3P7JA 3E6ZX 4HIMA 3CD6A 5LMNW 1MJCA 1WOCA 2QCPX 5I6WA 3X3MA 1WTQA 2BH8A 1XPOA 4UP8A 4V190 4WJ3M 1BBXC 1ILPA 4BA1I 4F7XA 5JAVA 3I55A 4OX9L 1XMQQ 2F0LA 4R4QA 2O5IC 1IBKQ 1PFSA 3MTSA 1X3FA 2HT1A 4QIWE 4GS3A 2BH2A 3WOEA 2D0PA 3W3AA 1OXTA 3CRKC 2MJ8A 5IGCA 1ENCA 5GAEC 4XT1B 3NWSA 3SK4A 3HOXB 1XNQL 1HCZA 3GTJB 4PZ7A 3DXJC 2R3ZA 2BE5D 4A3KG 1IW7C 3R2IA 3U9OA 1GUTA 2DJFC 3HOZG 2PZWA 2EIFA 2F0GA 5EPJA 2RSOA 1GO3E 1SFOB 3GP7A 2Q8TA 1Y8NB 3PO3H 3KJOA 3VYSA 1D7QA 3NEMA 1NNXA 2RCNA 4YWLA 5LMUQ 4B3RL 4JC0A 4A3IG 1K3BC 1S5CD 1U0LA 1SRUA 1I4PA 2LS01 1TR5A 1RCVD 4C56C 4H13C 4A3LG 3FPPA 2K5HA 3TBIB 1QILA 3I4NH 3UE1A 2A1AA 4AH6A 4HJ5A 2K14A 3K0XA 5C3EG 1ENAA 4KHPQ 5A35A 1HTLD 4MTNA 1YJWA 2UXDQ 3HOUB 4LUZA 2UXCQ 1IL8A 2B2WC 2PI2E 4WFN3 2KBNA 1JJ2A 2VY3A 4FNFA 1X32A 2JA6H 1JB3A 2PW7A 1QWYA 1KNEA 3Q0AA 4N8X1 4S3SA 4DV4Q 3Q22A 2MQHA 3A8JE 4ZUJA 4DUZL 1PFMA 1S40A 4E6IA 1WCMB 1Y1VH 1I6VC 3K5LA 1K8OA 4FP5D 4LFCQ 3VR6A 3PF5A 3C1EA 4NXMQ 1HQRD 3J81j 4KV6A 4NP5A 3TP5A 2ZXOA 2PMZE 3UDXA 2NZOA 5IYBG 2DGYA 2NVYB 5I2YA 2UUCL 4A3DH 3H3VH 1UE1A 4IFDJ 5FO9B 3BDOA 4ZCKA 5IY0A 2H1EA 2VS1A 2PNHA 1GD7A 4KKSA 1LACA 2KHSA 3K7UC 4IJLA 4YCVA 1TWGH 2F3IA 3R3OA 2RQXA 1CKNA 3ULLA 1EUJA 3OWEB 2KHJA 5IP7H 4PZ8A 2I5HA 3ULPA 1A62A 1TS2A 2DN8A 4A93B 4UP9A 3VA5A 2CVRA 1B44D 3E3XA 3PUZA 4DR5L 5LL6X 2JK8A 4N8FA 3T1YL 3VR4A 3GTKB 1F2MA 5DNFA 4QF4A 3RZOB 4HJAA 1AP0A 3NK9A 2B2TA 3D6WA 3UDIA 2CW0D 4UP7A 1MD2D 1SMXA 4A3JH 4IFDG 2WAQE 4AYBG 3BVZA 4OO1I 4EQOA 2J0TD 5K36H 1I3QB 3K80C 1N36Q 1F77A 4X65Q 4LW1A 4B3TQ 2JEBI 4JVZA 4DV3L 2OEOA 4A3BB 4LAAA 5C44H 4LF9L 1MSGA 4X64L 2K6AA 4HN7A 4Y7NH 1YHQA 4DNRB 1M1KC 1VQBA 2UUAL 1BF4A 2B63B 3S2HB 4DKAC 1FVIA 2V1CC 1QZGA 3HOWG 5M5XB 4LF8L 4DV7Q 2VUMG 1KABA 3FEWX 3OOCA 4MN3A 1B8AA 2TMPA 4DK1A 1EQQA 1MI2A 3M4OH 5JJLA 4A3MG 4L5SA 2CWPA 2K4KA 2NN6I 2V4DA 3S15B 1IHZA 1CTMA 3SHLA 1EY8A 1A6XA 3QWNA 1QVCA 4LUVA 3I4NG 2MUYA 4WJ4A 3T1HL 4DAMA 1YIJA 1ESRA 3S2DH 3PUXA 1EQTA 1SNOA 1HNWQ 1STAA 1DGSA 1J5EQ 4DR4Q 2NB0A 2WP8J 1HUNA 4J8QA 2WB1G 3K57A 4OX9Q 3OWFA 2EY5A 2PPBC 2K05A 4P75A 5C4XB 3J80i 1I4RA 2A6HD 2F0WA 4KY5A 3R8BA 4UY8C 1A8VA 2L15A 3TP7A 1EYAA 2L55A 4DN4M 3M9BA 3C1FA 1UEBA 5M5YB 4LUOA 3QJYA 2JA5G 1FR3A 1VS0A 1K8AC 1VQIA 2Z9HA 1XNQQ 4EQNA 1PH2A 1AFPA 1O7IA 4YWKA 1YZ6A 3ERSX 2B2WA 3RR5A 4GOPC 1W6JA 1BQQT 4O2DA 4DV5Q 2R93B 3IL8A 1OTCA 1D1KA 4JI3Q 1RODA 2X6GA 1ML0D 5BN4A 3MVVA 3SE0A 2Q8IB 3PUYA 2UUBL 3M3YB 4A3CG 1PTOF 1V1PA 2HDMA 3EROA 2A69D 2JXMB 1I94L 1C0AA 3KOJA 5IP7G 3G6JB 3I7FA 4R1JA 3KF8B 4QJFA 2NVXB 4AQYQ 2KVMA 4APVA 5M3FH 5ELBA 1O78A 2IW3A 4QGUA 3RN5A 3HOVG 1L1OC 3S1QB 2QGQA 3URYA 4A4IA 1KRSA 4LF6Q 2B2UA 5EKLA 1NR4A 4X62Q 4YHHL 1IBMQ 4OGQC 2RSNA 2G5DA 3FPUB 4FXKC 3RMHA 1A0IA 3HEJA 5JEAJ 1C4QA 4C2MB 1J8IA 1NMFA 1VQMA 5JOBA 1JJCB 5K36G 5D3IB 1U5KA 4ID6A 4HIOA 4M8AA 1F9PA 4A3FB 1AW7A 2MHVA 4KMUC 2OF1A 1XPUA 4DV2L 1FD7D 1ZKOA 3GV3A 2HD3A 3GO5A 1W2BA 3CC2A 1PFNA 1TWFH 5C44G 2C9OA 1JCKB 3RLOA 3OYYA 1KDAA 1VCIA 4A3GH 4L5RC 2LKVA 3MHBA 2QA4A 1BXTA 2CKZB 4JG2A 4C3JB 1ONLA 1Z9FA 2HIVA 5C3XA 2LSSA 2Z0SA 1QUQA 1PH5A 4LF5L 4HMJA 3CCSA 2B3GA 5CC4A 3F2UA 5IGFA 2F0VA 1DXMA 1BCPC 3DHQA 4HIKA 4B3MQ 5IP9G 4IO9A 3STBC 1KDCA 5JEAG 1VQ6A 1LTLA 4PV1C 1PV4A 2B2VC 2ZXPA 3GD7A 4IPCA 4PMBA 2BE5C 2K5WA 1EYDA 3T1YQ 2Z8LA 4X66L 3M4PA 4GNXC 3ERQA 4DUYL 3T51B 4DR7L 5T1IA 1U4PA 3BZCA 4I7ZC 4MTKA 4JOIC 1I50B 1M8AA 2F0EA 3PMFA 2QKIC 1WJJA 4R4IA 4A75A 4OWWB 4ZQ3A 3W1BA 3EFXD 2WV6D 1RF2D 3KK7A 3NE5B 1V8QA 3K0YA 3KLSA 1Q1BA 2L11A 4FO2A 1PA6A 1FJGQ 2A73B 3QG1A 3HOXH 3GTJH 3F2BA 3PIPA 5C5MA 3M4YA 1STHA 3JAMi 4NDXA 1EYGA 1RL2A 2CWAA 1C7YA 1SFOH 4G7HC 1STNA 1XMQL 3J81c 4QY7A 3LWUA 1SSOA 3IRBA 2XWJB 2K04A 4QB4A 4LMQD 3MA2B 5DM63 3I90A 3FKIG 1CUKA 3PV0A 1O80A 5E1FA 4BY1G 5AJ3Q 1D8LA 3SK5A 2I07B 3GTPB 5J22A 1EEID 1BOSA 1E2ZA 4RCOA 4DV6Q 1X3GA 2SEBD 3RLNA 5JPNC 1GHKA 4JI5Q 3L3OC 3HOUH 4GOPA 3H3VC 1UUPA 1LTSD 3MXPA 1G2SA 1VQ5A 3RUZA 2CHBD 5IODA 5LMUL 1PFBA 1STGA 5D3DA 4KHZA 2NVTB 5IT9E 4K6DA 4LFBQ 2B2YC 3KLWA 4AYBE 1WCMH 1X6OA 2NZ1D 1CZGA 2BA1A 4PNYA 4G7OC 3J80L 1VF7A 1J9OA 4KHPL 1ET6A 5I9OA 1X3QA 1JICA 2NVYH 2UXDL 2UXCL 3GV6A 4O1NA 3H0GG 1L1OA 3IFTA 4P73A 2KCMA 1W6KA 3CHBD 1GJXA 2KECA 5BN3A 1VQCA 5HURA 4HCSA 1HZ9A 3LNNA 4DV4L 2AQ1B 4A3EG 4XXEA 2A6ED 5EBCA 1V43A 1Y8PB 5JPMC 1A2TA 5GADC 4XYQA 2AHOB 5IGBA 2C35B 1EWCA 1WI5A 2MNAA 3CP0A 4LFCL 2ID0A 4K0KL 2EJGC 1KDBA 4QMGA 4HJ9A 3NXWA 3JC66 1PMRA 1NMGA 1A3TA 3JAME 4GLVB 4A93H 1NY4A 1CKNB 4HMIA 2RDGA 4Y52H 4IUTA 1FYCA 4GKJQ 2AWOA 3GTGB 3T4AC 3GTKH 4CJ0B 2JA8B 4HJ8A 2UXBQ 3RZOH 2RA4A 3C2PA 2R7ZB 4YHHQ 2L4NA 1PTOB 1G8ZD 2WB1E 1SYCA 1PZJD 1K9MC 2PW5A 1I3QH 3OHXC 5IGGA 4KHVA 4BXXH 3GTOB 2QEXA 3W1GA 2XVSA 1EY6A 5G3LD 2WINB 3HG9A 5FJ8G 3NWTA 4A3BH 4FYDA 4MHEA 1LT6D 1U4LA 3HOXG 2KOLA 1F2YA 4ZK9B 1IZ6A 1ENFA 2PMZB 1UWVA 4GNXA 2ES2A 3MZ5A 2PNRC 2B63H 4C3IG 1NTGA 5C4ZA 3S2HH 2EY2A 4XYOA 2JA7B 1I5FA 5M5XH 2M9VA 4JOIA 3GTMB 1EQVA 4M1UB 3NQTA 1N36L 4X65L 4B3TL 3QOJA 4KTAA 2RCFA 1PZID 2B8GA 3S15H 1DZ1A 1B70B 3B6YA 3R93A 3H15A 1NE3A 5C0XI 1RD9D 2R92G 1ET9A 3AYHB 1TWFB 1MIUA 2IPKD 1OXUA 2OTJA 4P74A 4NB3A 3CXCA 5FO7B 5CORA 3NUCA 3BDLA 3V2TA 4QUFA 4DV7L 2E75C 1DD2A 4C3HG 1B2TA 5EJWA 3FDTA 1SNQA 1GUNA 1S5BD 5C4XH 1K28A 3DWPA 2CCZA 1EIYB 1F9SA 5IGEA 2A69C 5FK9C 1A3VA 2Y0SG 4GLAC 1EFWA 5M5YH 3J7AF 2WAQB 3W2DA 2Q2UA 3AU7A 5FKAC 3WWVA 5ELNA 1HNWL 5I4DA 1C9OA 1J5EL 4BBSB 4YY3L 4DR4L 1YITA 2R93H 4G4KA 3MC0B 1SYBA 2EPBA 1B50A 3K6OA 4J1MA 2K01A 3JAML 1JE4A 2AMCB 5M3MG 4F88A 4K5VA 2IWHA 5COYA 3K81C 3M3YH 3U9SA 5FLXE 5AFWA 4KD3A 3CQZB 3R2TA 4KKTA 3SDZA 1AE3A 2NVXH 1AE2A 1N33Q 1STEA 4RGNA 3TS0A 1IYVA 1V1PB 3VA7A 1QVGA 1SLJA 5ELCA 1HR0L 1P16A 4DV5L 3S1QH 2VZAA 4JI3L 1SE3A 1YNND 1U4MA 3PF4A 1BCPF 3CPFA 1T9HA 1SR3A 5BR8Q 1WTPA 2KENA 1IBLL 4KKUA 1CK1A 1H9SA 2Q2TA 4BS9A 1STYA 1HQMC 4CJ1B 2KUMA 1WTHA 1UE7A 3L7ZC 5EKKA 4C2MH 3I4MB 2NVQB 2K32A 4AQYL 1TT2A 1Y1WH 4A3FH 1VQPA 2ZM6Q 1P8LA 1B3AA 1EEFD 1GM5A 2LFNA 2F0UA 3LGJA 4A3BG 2ZT9C 4LF6L 1L0WA 1HA5A 1TY0A 1LM0A 2E2JB 4X62L 5KYIA 4DR2Q 1IBML 4IUVA 5IYDH 1PYSB 2FFKB 2NYZD 1D2BA 1XWEA 2BA0A 4C3JH 1HZBA 1N32L 4OELB 1Q12A 1VQOA 1SROA 4JK1C 4ZRZA 5I6YA 3A74A 4DNIA 1Q7YC 1TWHB 2EE1A 5LMNQ 1K8MA 3I70A 4FF4A 4K0KQ 1J6QA 4DNTB 3TDQA 3D0FA 1QUQB 4NKLA 2JSOA 4ME5A 4B9WA 4OEMB 1VQHA 3DUZA 3FHWA 4JW0A 2IX3A 3PO2B 2PQEA 4OWXB 2E5LQ 3OMCA 1G291 1OO9B 2HCCA 2F0SA 3PIOA 3E0EA 4BWGB 3OTOQ 1GUWA 1I50H 5CV6A 1PXUA 2RDFA 1PRTF 1R9TB 4NXNQ 4H7BA 4L63B 4B3ML 2XIWA 3MXNA 3KFUA 4MIUA 4TQUS 4DR3Q 4I65A 1PH1A 2QDBA 2PI2A 1SYFA 4IURA 3NTHA 1E0BA 4QUCA 2IHFA 2ATWA 1B53A 3ER0A 1H9MA 1CM9A 1YEZA 3BJUA 1B9NA 1TQOA 1X55A 5JJIA 4A3KB 3RN2A 4AIMA 2WKCA 3HOZB 4OIJA 2DY7A 2K5VA 4IPGA 2LY7A 1UNSA 1YHAA 2QW7A 2EJMA 1KL9A 1GUOA 1FJGL 5FLMH 4JBKA 3KJPA 3J7AV 4A3IB 3A7LA 2F0PA 5DLQE 3GTPH 1DCZA 2A68D 1X9NA 4MZ9A 2B29A 2KEEA 2OT2A 5BN5A 1XTDA 2HHHL 5EPKA 3V05A 4B3SL 3QOLA 1TWCB 5C3EB 2QDLA 3PO3G 3RZDB 1VQGA 1LTTD 4DV1L 1JWSD 2A6EC 2XRSD 4GN4B 2O5JC 4DGZA 2NVTH 1CSQA 4GOPB 4DR6Q 1A63A 5AJ3L 2ALYB 4EVOA 2ZJPA 1W3SA 2J7ZA 3CCUA 1XYIA 1SBBB 1VQKA 3AB9A 3G48A 2FMCA 2LXKA 3KLRA 4ZYSA 4JI4Q 1HHVA 3KUPA 4WORA 1EL0A 1DOKA 4DV6L 2K75A 4CDDC 4JI5L 3DLLA 2YU9B 2VXWA 4K5WA 4DFAA 2GA4B 4YY3Q 3G71A 4K8IA 2D2CC 3G7LA 4G57A 5CV8A 4UDUC 1XXGA 2JA6G 3F2DA 4RGTA 2Z1CA 2F0QA 3OIPA 4GKKQ 2RF4A 3A8IE 1KAAA 1K0RA 5EPLA 4LFBL 3G4SA 4C1NI 1L1OB 4C3JG 1HFNA 1FNWA 2FMMA 4IUPA 1MHWC 1O7YA 1Y1VG 2VQEQ 3FP9A 1GXDC 3FRPB 4R9WA 1IYJB 3CPWA 2CFMA 5DAUA 3P20A 3E9HA 3S1NB 5H1SE 3D3RA 3MWYW 4RKLA 4A3DG 1EFID 3HKZB 3M4QA 3T56B 3A0JA 4X3UA 1HR0Q 5IYCH 2WFWA 1E2WA 1G6PA 3GTGH 2JA8H 4P2CB 1H9JA 3S1RB 3A5UA 2X69A 2R7ZH 3KBGA 1DOMA 1PTOH 1IBLQ 1PTOD 1HTPA 5M5WB 2AQ3B 5IGDA 3TP8A 3J80c 1WD0A 3EN2A 1PH4A 1QG7A 2IX0A 3L0OA 3GTOH 4B9XA 1FNUA 2DNEA 2Y0SE 3V96A 2L5TA 1YHBA 2NWGA 4AYBB 3QO2A 4K5XA 3PUWA 3I56A 4L5QA 1SNDA 3L2PA 1L0YB 2JA9A 1JJGA 4GKJL 3FVQA 1QJOA 1ASYA 1JOOA 1BCPB 1KLUD 2B39A 4JPBW 2UXBL 4FVMA 1XX8A 4G7ZC 1K73C 1F2LA 3K7AB 3PIO3 3U50C 1ZEQX 3W5OA 2JA7H 4IN3A 3TMEA 3CKIB 5M9OA 4KD4A 3GTMH 2L0CA 1N32Q 4A3JG 2YTXA 1PH6A 4WJWA 1Q86C 1Y1WB 4ILWA 4GNXB 2PCFB 3UDGA 3HOWB 2G9DA 1UEAB 2VUMB 5F2DA 4B08A 2R61A 3I8ZA 1CHPD 5FLMG 3F8TA 3HOYH 4L8JA 1II3A 4UHVA 3EBEA 3PQIA 2RKSA 5E3FA 4OO1H 4CBVA 5JVH3 1TVXA 4JI0L 2MFIA 5HGQA 2WACA 4P71A 2RVLA 2OWOA 4HTHA 4XT3B 1E1OA 1CZWA 4DF7A 4OONA 1VQAA 5KNBA 3F1ZA 4H0LC 5KRUA 1K0SA 1S3OA 1WD1A 4DXFA 1JB7A 1S72A 1XPRA 5D65A 4JV5Q 1PHJA 2N55A 1Q90A 4K2LA 1O7LA 4POFA 2KCCA 3TZDA 4H02A 2EYHA 1N9WA 1RJTA 3HFZB 4DA2A 1F9RA 1ICWA 3A8KE 4BBSH 2QILA 4OIKA 1C48A 2NN6H 4RKBA 3GTLB 2JA5B 2HUGA 4HSVA 1AH9A 2B8FA 4JI6Q 3AFQA 3C3LA 1DOLA 1YNNC 4PMCA 1PRTB 1R4QB 4BY7H 1PLFA 3IKJA 3ND8A 2N88A 1LLRD 3P75A 1WTVA 1UE6A 3NBHA 4R8IA 3CQZH 2MPMA 3RD4A 3SEBA 2XN9C 1K3RA 4C1NK 3I3CA 4JI2Q 4IZ8A 2OQ0A 3M7GA 2IX1A 2HHHQ 3WDNA 3KF6A 4B3SQ 1SYEA 5IYCG 2BDNA 4DK0A 1LTBD 5J39A 4GZYC 3EA6A 1TXYA 1TIID 1Q3LA 2CH4A 2DJGC 4DV1Q 1TS3A 3HOVB 3T53B 2F0NA 4TSSA 4BA2I 2EQSA 3M85A 3EQLC 4KJNA 1L2FA 3I4MH 2NVQH 2EY1A 2PZUA 2JP1A 4ZUIA 1JWUD 3PCOB 1HA6A 4NPSA 4DR1Q 3PSIA 1N33L 1SE4A 5EGTA 1H9SB 5M3FG 5TSSA 1JOKA 2VQFL 2EYMA 4CKBA 5KNCA 5L37A 1EOTA 3BVGA 1CQVA 1RDPD 3TEHB 4FXDA 1Q8KA 3AEVA 3JAMc 2E2JH 1NR2A 5BR8L 2EYOA 5DM73 2A74C 4IPDA 2F0OA 4I7AA 2EYFA 1JWMD 3H6MA 3ICEA 4JI8Q 3I4LA 4LJZC 2EDGA 3CF5A 2SNSA 1TWHH 1AZPA 2ZM6L 2IT1A 2N49A 3CC7A 3CCQA 4QIWB 1MGSA 1D5XC 4HSPA 1EIHA 1GVPA 3PO2H 2JQOA 4DR2L 4OO1G 4A3GG 4ULLA 4DAVA 2NTSA 2MO1A 5IWAQ 4JBWA 4IFDI 3BZDB 2ASBA 1MKHA 3K8AA 2CW0C 2NBFA 2Z6BA 2NZHA 5ELEA 1WTWA 3D4RA 1DJRD 1O7ZA 5LMNL 1S4ZA 1R9TH 1G6ZA 1JC7A 2DNCA 2HCIA 3BDCA 4JI7L 1H9RA 5CYUA 3GDEA 1I6HB 4H44C 5K5PA 4PMWA 2K5DA 4F87A 2EXZA 3NSWA 1SE2A 5C4JB 2A68C 4LK1C 1EIGA 2E5LL 3MXNB 3N6RA 3D6CA 3OPOA 4OXPA 2OXPA 1WTOA 3OTOL 3TQYA 4YWMA 3MFYA 2OTLA 1HJPA 2F0MA 3OSOA 4HJ7A 4NXNL 3SXHA 4A3KH 1PH8A 3HOZH 2JN4A 5C4HA 4DR3L 1SN8A 2G9HD 3OIQA 3S14B 4A3IH 3VYUA 4BBRB 3KDFB 2B2VA 3FKIB 3CCLA 4BY1B 4A3LH 4DU9A 4JI0Q 3BG3A 4KY6A 3Q6SA 2NTTA 2AUJD 1EY0A 1RTOA 1TWCH 5C3EH 2GVAA 3QIAA 1GUSA 3RZDH 3Q8DA 1B7YB 1I4QA 1RIPA 4UAIA 4YCUA 2A6HC 1UAPA 3NBIA 2F0FA 2F0DA 4TVAB 3MFGA 1BBUA 4K6LA 3HOYB 2DUDA 1I4GA 4OHJA 4DK6C 5IT9L 3KYHC 5FLXc 3PIP3 3H3VI 5D14A 3AFPA 5T1GA 4J6HA 2YU9H 4X3KA 2KQ3A 4DPGA 1IL2A 4Z9CB 3HOUG 4RH6A 1EY4A 4HCEA 3TZUA 1LTAD 2L9HA 1HRJA 3IFDA 1JQYD 1GKHA 1YBYA 4DR6L 1HZAA 3K58A 2C5CA 1KD1C 2FINB 1WTRA 3I73A 2F0TA 5GQOA 4JI4L 1WCMG 2K5NA 4WRDA 1AZQA 4FF2A 4A3EB 2F1MA 2GVBA 3HRZC 5CMDA 1VQDA 3ZYYX 1CI3M 3S1NH 4XIGS 2YYZA 3NP8A 4V0BA 1S5DD 1CKMA 1LTID 5KGUA 1LV9A 2H5XA 2XRQD 2EOTA 4GKKL 4KK7A 5ELOA 2EYJA 5KEEA 4BY7B 3S1RH 3MEFA 1FL0A 4OWTB 2A5HA 1VQEA 2B2YA 1BO0A 1HPCA 1STBA 5M5WH 4F8MA 2VQEL 2IHEA 3BYYB 5C6AA 5ISRA 3HKSA 2F4VQ 1HNZQ 2I46A 2M2LA 4RMFA 3BVMA 1CHQD 3CAMA 4Q5VA 4XDXA 5ELDA 4IFDH 1BUVT 1VMCA 4A93G 2VQFQ 4RGMA 1E7ZA 5JJZA 1BBWA 3T16A 1G51A 1BCPD 1VQJA 2Q2IA 1QB5D 2VL6A 4KN4C 5EAYA 4CGYB 4DK3C 3K7AH 3STBD 4LF7Q 2Z4HA 1CKOA 5E7NA 3RNUA 1YJ9A 1S5ED 4DXGA 2SNMA 5CR3A 3DM3A 1B4OA 2FJ2A 1A3UA 2TSSA 4C3IB 2AQ2B 2Z6KC 3CW2C 3HOWH 2K03A 2F4IA 4BXXG 1EIFA 2VUMH 1HNXQ 4PG3A 4CDEC 4JYAQ 5CV9A 1EZ6A 4R4TA 1LT3D 4QCLA 1YI2A 1KXLA 2SDFA 4A3MH 3VR2A 3MAQA 4QL5A 1KAWA 1VQ8A 5FO8B 2B63G 2R92B 2EYLA 1Z7TA 3DWQA 2E2HB 2YV5A 1QZHA 4HR7B 4IALA 4UPAA 1WFQA 3K5OA 5CGKA 1KIXA 4JBJA 4Q0FA 3G6EA 4C3HB 1WVLA 4JI7Q 4CKEA 1D6EC 1QNKA 2KCNA 1ASZA 1LO5D 3I4OA 1PYBA 3I72A 2F0IA 2OCEA 4LFAQ 4YCWA 3UI2A 1Q82C 1LYLA 2Y0SB 2LMCB 2K7VA 2ZXRA 1T5EA 4XQNA 2ZJRA 4R8NA 3HZXA 1TU2B 2D0OA 3GTLH 2JA5H 4MNOA 2EXDA 4N9TA 1KLGD 3OW2A 4L5TA 1SAPA 2PZTA 5C0XH 4R4CA 1XJVA 1OXXK 1PRTD 2E2DC 4JI1Q 2E2IH 1D5MC 2RBMA 5C4XG 1ESFA 3CC4A 2Z4IA 3FMCA 4KJOA 1ZXTA 4JV5L 1FGBD 2M00A 3GQBA 2K50A 4ODGA 1PH7A 3S16B 2B2UC 1TY2A 5M3MB 2BCOA 2E76C 3EVQA 1ICFB 1VMPA 2EVBA 5A2QE 4XQQA 4A3CH 1K83B 1UE5A 5FLXL 3VYRA 3OW7A 3TSSA 4RG1A 4JI6L 2F52A 2AWNA 3NBHB 3HKZG 1LT4D 1CT1D 2R93G 1VDZA 5ELFA 1XNRQ 3NELA 4X3TA 1KQSA 3KDFA 3TP6A 1EWHA 1QE6A 3HOVH 1M4VA 1XMOQ 1U4RA 3NENA 3BYTB 3KF6B 1CA6A 3J7A5 2VW9A 4NW2A 1QNUA 5E4WC 4DAYA 1SYDA 3EJIA 3I91A 2BDOA 3TN2A 4EX5A 1HR0W 5GAHC 4JI2L 3GTQB 2SOBA 4OL7A 2X6LA 1SEBD 4K2KA 1T5XD 1YVCA 1RKNA 5HGTA 2QEJC 4CHTB 3D8GA 2K1BA 3CRLC 2L1BA 3HS0C 2MP1A 1I4XA 4LF4Q 1NAPA 1U9RA 5IOCA 3CCRA 5KYLA 1L0XB 3C46A 4QQBX 3S1MB 4LNQA 3VR5A 4IOAA 1HH2P 2F0HA 3A55A 4DR1L 4KN7C 1Y1WG 2DY8A 1I4HA 4A3FG 1Z47A 3X3NA 5IE8A 2JE6I 1NSNS 3UE0A 5NUCA 5C5LA 2ICIA 5C0XJ 5IP9H 3CCJA 2GN5A 3CCEA 3S17B 3TS2A 3IAYA 3MXUA 2PQAA 1YNJD 5IYDG 3S24A 5JEAH 4FDBA 4IUUA 2HIXA 4JI8L 1SMYD 3O13A 2XSCA 3ND9A 1EY5A 2R6GA 3CMEA 3EIVA 2Z6KA 3NHHA 1VQFA 2QF7A 3U4ZA 1NCVA 2BOSA 4ME3A 1I6HH 3TRZA 1H95A 2KHIA 3DEPA 2IL8A 1D1IA 1EQRA 3RLFA 3D4WA 2EY6A 4HAEA 3PGZA 1TWAB 5C4JH 3Q24A 4POGA 3E9IA 3NQIA 4A76A 1EU3A 3CCMA 1HUMA 5IWAL 2ENBA 4CDFC 1VQ9A 4U68A 1GOZA 3AQQA 3N52A 1GUGA 1VQNA 1EWIA 1PVOA 2N78A 1ZYRD 4DAPA 2I5MX 5A2QL 5C0XG 1KRTA 4CJ2C 1EZ8A 1QVFA 1X3PA 1NJIC 2ZJQA 1PH9A 4GN5A 1CFMA 2YTVA 1KHIA 4ZKBB 1BKBA 3AMUA 3S14H 2EYPA 2MO0A 1V1QA 4X3SA 4BBRH 2ZTDA 3CCVA 4B3RQ 3FKIH 2RHQB 3SGIA 1Y14B 2KEDA 4BY1H 4O0AA 1B9MA 1V9PA 3Q23A 2K33A 3P1HA 5LHY1 1TS5A 4GLXA 1PYWD 1RTNA 2HDLA 1LABA 5CBEE 2CQOA 2FHTA 4K14A 1SJED 2Q8RE 2KJXA 3QB3A 2ICEC 1YNXA 2H4OA 3PO3B 4TKOB 5J3BA 4ZLTF 1BDOA 3MEHA 2XTIA 2UU9L 5LL6S 4A3MB 2F3WA 3A5ZB 4L6TB 1R4PB 2HQEA 4JBMA 3VDYA 4DUZQ 1X54A 2N3SA 4IQZA 2WIIB 3I4NB 2K5QA 1CSPA 1KNAA 2CQAA 4RAUC 2E8GA 4J15A 1BVSA 5CV5A 4NMZA 4X6AH 4P72A 2WKDA 4IUNA 1Q46A 1VF5C 4DV0L 1IW7D 3H0GH 3H09A 2UUCQ 4RA8A 3T13A 4ABNA 2WB1B 2JA6B 1N8RC 5EKIA 4KY7A 4O42A 4A3EH 3J80E 1SNCA 1LTRD 1OXVA 1EOVA 2EZVA 1Y1VB 1PDQA 3A56A
chains in the Genus database with same CATH topology
2KENA 3OTOL 1EQQA 2ZTEA 3TQYA 1IBLL 3M4OH 4YWMA 4A3MG 5JJLA 4L5SA 2CWPA 2I0QA 2K4KA 2NN6I 3J7ZC 2OTLA 2Q2TA 1HJPA 2IY5B 4C2MH 4HJ7A 1UE7A 3L7ZC 4NXNL 4A3KH 3UDFA 1QVCA 4LUVA 1PH8A 3I4NG 3HOZH 4AQYL 2KCTA 4WJ4A 3T1HL 4DAMA 1Y1WH 1YIJA 4A3FH 3PUXA 1VQPA 3S2DH 2ZM6Q 4DR3L 1SN8A 4IPHA 4DR5Q 1HNWQ 1P8LA 3J81i 1OXSC 1GM5A 5IT9c 1DGSA 3LGJA 1X56A 4A3IH 1N34L 4A3BG 1J5EQ 4LF6L 1L0WA 3KDFB 4DR4Q 2WP8J 1LM0A 3CCLA 1FGUA 4X62L 2WB1G 4A3LH 4DR2Q 1IBML 4OX9Q 4JI0Q 5IYDH 1PYSB 4P75A 2R7FA 3J80i 1K8GA 2BA0A 1TWCH 1HZBA 4C3JH 1JT8A 3ULJA 1WYDA 5C3EH 1Q81C 1A8VA 2GVAA 1PH3A 4UY8C 1N32L 3RZDH 2L15A 1Q12A 3Q8DA 1B7YB 1SROA 1VQOA 1VQLA 2JA8G 3M9BA 1RIPA 3A74A 1UEBA 4YCUA 5FJ8H 4DNIA 4LUOA 4DV3Q 5LMNQ 1Q7YC 2R7ZG 2JA5G 1KC8C 4K0KQ 1VS0A 1K8AC 1J6QA 2F4VL 5JJKA 1VQIA 4LF9Q 1M90C 4X64Q 1HNZL 1XNQQ 4TVAB 3D0FA 1O7IA 1QUQB 1PH2A 1BBUA 4YWKA 3BZKA 1YZ6A 2ZTCA 2DUDA 4C3IH 1VQHA 3ERSX 3FHWA 1E22A 3RR5A 4GOPC 4DK6C 2UUAQ 3KYHC 4O2DA 5FLXc 4DV5Q 3H3VI 1IBKL 3AFPA 4OWXB 1OTCA 2E5LQ 4LF8Q 1VQ7A 4JI3Q 1G291 4HIDA 2YU9H 2Q2HA 4DPGA 3PIOA 3E0EA 1IL2A 3HOUG 4BBRG 3OTOQ 3PUYA 2UUBL 4A3CG 1I50H 2LXJA 1C0AA 4LF7L 1I94L 1GKHA 4KI0A 1YBYA 3HKZE 3KOJA 4NXNQ 2R92H 5IP7G 1HZAA 1X65A 3I7FA 3KF8B 4QJFA 4R1JA 4B3ML 1KD1C 3KFUA 2JA7G 4AQYQ 3T1HQ 2XGTA 4APVA 5M3FH 2E2HH 4TQUS 5GQOA 4JI4L 1WCMG 2K5NA 4DR3Q 4QGUA 3RN5A 2AKWB 3HOVG 1L1OC 1PH1A 2GVBA 1HNXL 2JEAI 2PI2A 4JYAL 3U58A 1MJEA 2QGQA 4C3HH 4A4IA 1KRSA 4LF6Q 1VQDA 2IHFA 2ATWA 3S1NH 4XIGS 2YYZA 3ER0A 4X62Q 4JCVE 4YHHL 1IBMQ 1CKMA 2A19A 3HOYG 1YEZA 3BJUA 2H5XA 1X55A 4GKKL 5ELOA 1A0IA 5JEAJ 5JJIA 1NMFA 3S1RH 1VQMA 3RN2A 1JJCB 2I5LX 3MEFA 4AIMA 5K36G 5GROA 1FL0A 2K5VA 1U5KA 4IPGA 4HIOA 4OWTB 1VQEA 1YHAA 4IJHA 3F2CA 4LWCA 5M5WH 2VQEL 2IHEA 1KL9A 2F4VQ 3HKSA 1XPUA 1FJGL 4PZ6A 5FLMH 4DV2L 1HNZQ 4JBKA 3KJPA 3GO5A 4RMFA 1W2BA 3CC2A 3CAMA 5DLQE 3GTPH 1TWFH 5C44G 1X9NA 4MZ9A 3RLOA 3OYYA 2B29A 1VCIA 1JE5A 3M7NA 4A3GH 5HY6A 1XTDA 2VNUD 3S16H 4L5RC 5M3MH 2HHHL 2VQFQ 4A93G 2WAQG 2QA4A 1E7ZA 2CKZB 4B3SL 4LFAL 1BBWA 4JG2A 1Z9FA 2HIVA 2LSSA 2Z0SA 1QUQA 5BR8Q 3PO3G 2N8NA 1G51A 1K83H 1PH5A 4LF5L 1VQGA 1VQJA 2Q2IA 3CCSA 2UUBQ 2B3GA 2VL6A 4DV1L 5EAYA 1VQ4A 4DK3C 4BBSG 3K7AH 3STBD 2NN6G 4GN4B 1I94Q 4LF7Q 3D31A 4NXML 2NVTH 1CKOA 3TREA 1CSQA 5E7NA 4GOPB 2R7DA 3RNUA 1YJ9A 4DR6Q 5AJ3L 1A63A 4HIKA 4B3MQ 2ALYB 4JI1L 5IP9G 3DM3A 1W3SA 2ZJPA 3CCUA 4IO9A 1VQKA 3STBC 3G48A 4BY7G 2LXKA 1HZCA 4JI4Q 1IXRA 5JEAG 1VQ6A 2Z6KC 1LTLA 3CW2C 3HOWH 1PV4A 4BXXG 1EIFA 4DV6L 2VUMH 2K75A 3GD7A 4IPCA 4PG3A 1HNXQ 4JYAQ 1X3EA 4JI5L 3DLLA 4R4TA 3T1YQ 1YI2A 1KXLA 4X66L 3M4PA 4GNXC 4YY3Q 1SE8A 4DUYL 4A3MH 3G71A 1JMCA 4DR7L 4XTCS 2UU9Q 3GTQH 2OQKA 3BZCA 4QL5A 2JA6G 4JOIC 1KAWA 3F2DA 4GKKQ 4R4IA 1WJJA 2RF4A 2YTYA 1VQ8A 4A75A 1K0RA 4OWWB 4KLKA 3G4SA 2B63G 4LFBL 1L1OB 4DAYB 3I2ZA 3W1BA 1XNRL 1Q1EA 2D62A 1Y1VG 2YV5A 2VQEQ 1QZHA 1Q1BA 2HQLA 1XMOL 3FP9A 4UPAA 1WFQA 1PA6A 1FJGQ 4DV2Q 3S1MH 4DV0Q 1KIXA 4JBJA 3U4VA 3HOXH 3GTJH 3G6EA 1IYJB 3CPWA 4ALPA 4JI7Q 2CFMA 2JJQA 3F2BA 3PIPA 3PUVA 3I4MG 3E9HA 3JAMi 5H1SE 1ASZA 1EYGA 1RL2A 4A3DG 2CWAA 3I4OA 4R4OA 3M4QA 1PYBA 1C7YA 1SFOH 1HR0Q 3A0JA 1XMQL 3J81c 2OCEA 4LFAQ 2A8VA 5IYCH 2WFWA 4YCWA 4QY7A 3GTGH 1Q82C 2JA8H 1LYLA 2ZJRA 1G6PA 3IRBA 4LF5Q 2D0OA 3A5UA 3GTLH 3BU2A 2R7ZH 2JA5H 4LF4L 4MNOA 3CMAA 2EXDA 3FKIG 1CUKA 3PV0A 3OW2A 4L5TA 1IBLQ 5IYBH 4R4CA 1XJVA 4BY1G 5AJ3Q 1D8LA 3S17H 1OXXK 3J80c 4JI1Q 2E2IH 3EN2A 1PH4A 2IX0A 5C4XG 1NBWA 1E24A 3L0OA 3CC4A 2K52A 3GTOH 3ZJYC 2Y0SE 4EQ5A 4JV5L 1YHBA 1E3PA 2K50A 4DV6Q 2FXQA 1X3GA 1YJNA 3RLNA 1PH7A 3PUWA 3I56A 4GN3B 4L5QA 3L2PA 4JI5Q 3HOUH 4GOPA 2PQAB 2JA9A 1JJGA 1N34Q 4X66Q 4GKJL 4DUYQ 1ASYA 4IOCA 1VQ5A 4DR7Q 4A3CH 1UE5A 2UXBL 5LMUL 4RG1A 1TWAH 1K73C 1LUZA 3U50C 2F52A 2AWNA 3NBHB 4JI6L 3HKZG 3W5OA 4KHZA 2RHSB 5GAGC 3PO2G 2JA7H 4LFBQ 2R93G 3KLWA 4AYBE 3GTMH 1E1TA 1XNRQ 1N32Q 1WCMH 4A3JG 1X6OA 2YTXA 3NELA 2BA1A 1KQSA 4HIMA 1PH6A 3CD6A 3KDFA 5LMNW 3HOVH 1Q86C 1XMOQ 4GNXB 1MJCA 4KHPL 3UDGA 1WOCA 3NENA 3KF6B 3J7A5 2VW9A 2BH8A 2NVYH 4UP8A 1XPOA 2UXDL 2UXCL 4WJ3M 5FLMG 3F8TA 3HOYH 3H0GG 1L1OA 3EBEA 2KCMA 4P73A 4BA1I 4EX5A 1HR0W 4DR6L 5GAHC 4JI2L 1VQCA 3I55A 4OX9L 4JI0L 1XMQQ 2MFIA 1HZ9A 4R4QA 1YVCA 1IBKQ 1PFSA 4DV4L 4A3EG 5HGQA 1X3FA 4P71A 2HT1A 2OWOA 4QIWE 1V43A 4GS3A 2BH2A 5GADC 2D0PA 1E1OA 4LF4Q 2AHOB 4OONA 2C35B 1VQAA 1WI5A 1OXTA 3CP0A 4LFCL 2MNAA 3CCRA 2ID0A 3F1ZA 4K0KL 4QQBX 1S3OA 4LNQA 5GAEC 4IOAA 1XNQL 1HH2P 1JB7A 4PZ7A 4HJ9A 3JC66 1S72A 1NMGA 1B8AA 1XPRA 4A3KG 4DR1L 4GLVB 4JV5Q 4A93H 1NY4A 1PHJA 1CKNB 3HOZG 2EIFA 4POFA 1Y1WG 4Y52H 1GO3E 4H02A 4A3FG 1Z47A 3PO3H 5IE8A 1N9WA 3KJOA 2JE6I 4GKJQ 1D7QA 2AWOA 3HFZB 3GTKH 3NEMA 4HJ8A 3UE0A 4BBSH 2RCNA 3RZOH 4YWLA 5LMUQ 4B3RL 2UXBQ 4JC0A 4A3IG 4YHHQ 1U0LA 1SRUA 5C0XJ 4JI6Q 1AH9A 2WB1E 3AFQA 5IP9H 3HOWG 3CCJA 2GN5A 3CCEA 4A3LG 1K9MC 3TS2A 4BY7H 2K5HA 2PQAA 5IYDG 3I4NH 3UE1A 2A1AA 3S24A 4FDBA 1I3QH 4AH6A 4HJ5A 2HIXA 4JI8L 2K14A 4BXXH 2QEXA 3K0XA 5C3EG 3W1GA 4KHPQ 1UE6A 2R6GA 3CMEA 4MTNA 1YJWA 3CQZH 5FJ8G 3EIVA 2Z6KA 4A3BH 2UXDQ 4LUZA 2UXCQ 1VQFA 3U4ZA 2PI2E 2KBNA 3HOXG 4ME3A 1K3RA 1JJ2A 2VY3A 3TRZA 1I6HH 1H95A 2KHIA 2JA6H 1EQRA 4JI2Q 3RLFA 1IZ6A 2OQ0A 1UWVA 4GNXA 3PGZA 2ES2A 2B63H 2IX1A 5C4JH 1NTGA 2HHHQ 4POGA 4DV4Q 3S2HH 3E9IA 4A76A 3KF6A 1I5FA 2MQHA 5M5XH 4B3SQ 4DUZL 3CCMA 1S40A 5IWAL 4JOIA 5IYCG 1Y1VH 1VQ9A 3AQQA 1TXYA 1N36L 4DV1Q 1VQNA 4X65L 4LFCQ 3PF5A 4B3TL 4BA2I 1EWIA 2EQSA 2N78A 3J81j 3M85A 2I5MX 4NXMQ 3S15H 1B70B 1PVOA 3B6YA 3UDXA 2PMZE 3H15A 1L2FA 2NZOA 5IYBG 5C0XG 2NVQH 2DGYA 1KRTA 3I4MH 1NE3A 5C0XI 2UUCL 3PCOB 1QVFA 4NPSA 4DR1Q 1NJIC 3PSIA 1N33L 2R92G 3H3VH 4A3DH 3AYHB 2ZJQA 1MIUA 1UE1A 1PH9A 4IFDJ 4GN5A 2YTVA 1OXUA 1KHIA 5M3FG 2OTJA 4P74A 4NB3A 2VQFL 5IY0A 3CXCA 1BKBA 2PNHA 1GD7A 2VS1A 3S14H 2MO0A 1V1QA 3CCVA 4BBRH 2ZTDA 4DV7L 4B3RQ 3FKIH 2RHQB 3K7UC 3TEHB 3SGIA 4IJLA 1Q8KA 1Y14B 4YCVA 3JAMc 2E2JH 3AEVA 1TWGH 2F3IA 5BR8L 4BY1H 4O0AA 1CKNA 1V9PA 3ULLA 1EUJA 4IPDA 2KHJA 5C4XH 4PZ8A 5IP7H 2I5HA 3ULPA 4GLXA 2CCZA 1EIYB 4JI8Q 3ICEA 1A62A 2CQOA 2Y0SG 4GLAC 1EFWA 3CF5A 4UP9A 5M5YH 1TWHH 2Q2UA 2ZM6L 2IT1A 2N49A 5ELNA 3WWVA 3PUZA 3CC7A 3CCQA 4DR5L 1HNWL 1YNXA 2JK8A 3T1YL 5J3BA 1C9OA 1J5EL 2XTIA 4YY3L 4DR4L 4HJAA 1YITA 1GVPA 2UU9L 3PO2H 3A5ZB 2JQOA 3UDIA 4UP7A 2R93H 4DR2L 4OO1G 1SMXA 4JBMA 3VDYA 4A3GG 4DUZQ 1X54A 2N3SA 2WAQE 4AYBG 4A3JH 2MO1A 5IWAQ 4IFDG 4OO1I 2AMCB 4JBWA 5M3MG 4IFDI 2ASBA 1CSPA 1MKHA 3K8AA 2E8GA 3K80C 4J15A 1BVSA 1N36Q 4X65Q 2NZHA 3K81C 4X6AH 3M3YH 4LW1A 4P72A 4B3TQ 2JEBI 4DV3L 1Q46A 5LMNL 4DV0L 3H0GH 1R9TH 5C44H 2UUCQ 4JI7L 1AE3A 4X64L 2NVXH 4LF9L 1AE2A 1N33Q 4Y7NH 1YHQA 3GDEA 3TS0A 1N8RC 1M1KC 1VQBA 1QVGA 2UUAL 4A3EH 4PMWA 1SLJA 1HR0L 1P16A 4DV5L 4DKAC 3S1QH 1FVIA 2V1CC 2VZAA 1QZGA 2E5LL 1OXVA 4LF8L 4JI3L 4DV7Q 1EOVA 3MXNB 2VUMG 3PF4A 3CPFA 4OXPA 1T9HA 1SR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KEN A;  3OTO L;  1EQQ A;  2ZTE A;  3TQY A;  1IBL L;  3M4O H;  4YWM A;  4A3M G;  5JJL A;  4L5S A;  2CWP A;  2I0Q A;  2K4K A;  2NN6 I;  3J7Z C;  2OTL A;  2Q2T A;  1HJP A;  2IY5 B;  4C2M H;  4HJ7 A;  1UE7 A;  3L7Z C;  4NXN L;  4A3K H;  3UDF A;  1QVC A;  4LUV A;  1PH8 A;  3I4N G;  3HOZ H;  4AQY L;  2KCT A;  4WJ4 A;  3T1H L;  4DAM A;  1Y1W H;  1YIJ A;  4A3F H;  3PUX A;  1VQP A;  3S2D H;  2ZM6 Q;  4DR3 L;  1SN8 A;  4IPH A;  4DR5 Q;  1HNW Q;  1P8L A;  3J81 i;  1OXS C;  1GM5 A;  5IT9 c;  1DGS A;  3LGJ A;  1X56 A;  4A3I H;  1N34 L;  4A3B G;  1J5E Q;  4LF6 L;  1L0W A;  3KDF B;  4DR4 Q;  2WP8 J;  1LM0 A;  3CCL A;  1FGU A;  4X62 L;  2WB1 G;  4A3L H;  4DR2 Q;  1IBM L;  4OX9 Q;  4JI0 Q;  5IYD H;  1PYS B;  4P75 A;  2R7F A;  3J80 i;  1K8G A;  2BA0 A;  1TWC H;  1HZB A;  4C3J H;  1JT8 A;  3ULJ A;  1WYD A;  5C3E H;  1Q81 C;  1A8V A;  2GVA A;  1PH3 A;  4UY8 C;  1N32 L;  3RZD H;  2L15 A;  1Q12 A;  3Q8D A;  1B7Y B;  1SRO A;  1VQO A;  1VQL A;  2JA8 G;  3M9B A;  1RIP A;  3A74 A;  1UEB A;  4YCU A;  5FJ8 H;  4DNI A;  4LUO A;  4DV3 Q;  5LMN Q;  1Q7Y C;  2R7Z G;  2JA5 G;  1KC8 C;  4K0K Q;  1VS0 A;  1K8A C;  1J6Q A;  2F4V L;  5JJK A;  1VQI A;  4LF9 Q;  1M90 C;  4X64 Q;  1HNZ L;  1XNQ Q;  4TVA B;  3D0F A;  1O7I A;  1QUQ B;  1PH2 A;  1BBU A;  4YWK A;  3BZK A;  1YZ6 A;  2ZTC A;  2DUD A;  4C3I H;  1VQH A;  3ERS X;  3FHW A;  1E22 A;  3RR5 A;  4GOP C;  4DK6 C;  2UUA Q;  3KYH C;  4O2D A;  5FLX c;  4DV5 Q;  3H3V I;  1IBK L;  3AFP A;  4OWX B;  1OTC A;  2E5L Q;  4LF8 Q;  1VQ7 A;  4JI3 Q;  1G29 1;  4HID A;  2YU9 H;  2Q2H A;  4DPG A;  3PIO A;  3E0E A;  1IL2 A;  3HOU G;  4BBR G;  3OTO Q;  3PUY A;  2UUB L;  4A3C G;  1I50 H;  2LXJ A;  1C0A A;  4LF7 L;  1I94 L;  1GKH A;  4KI0 A;  1YBY A;  3HKZ E;  3KOJ A;  4NXN Q;  2R92 H;  5IP7 G;  1HZA A;  1X65 A;  3I7F A;  3KF8 B;  4QJF A;  4R1J A;  4B3M L;  1KD1 C;  3KFU A;  2JA7 G;  4AQY Q;  3T1H Q;  2XGT A;  4APV A;  5M3F H;  2E2H H;  4TQU S;  5GQO A;  4JI4 L;  1WCM G;  2K5N A;  4DR3 Q;  4QGU A;  3RN5 A;  2AKW B;  3HOV G;  1L1O C;  1PH1 A;  2GVB A;  1HNX L;  2JEA I;  2PI2 A;  4JYA L;  3U58 A;  1MJE A;  2QGQ A;  4C3H H;  4A4I A;  1KRS A;  4LF6 Q;  1VQD A;  2IHF A;  2ATW A;  3S1N H;  4XIG S;  2YYZ A;  3ER0 A;  4X62 Q;  4JCV E;  4YHH L;  1IBM Q;  1CKM A;  2A19 A;  3HOY G;  1YEZ A;  3BJU A;  2H5X A;  1X55 A;  4GKK L;  5ELO A;  1A0I A;  5JEA J;  5JJI A;  1NMF A;  3S1R H;  1VQM A;  3RN2 A;  1JJC B;  2I5L X;  3MEF A;  4AIM A;  5K36 G;  5GRO A;  1FL0 A;  2K5V A;  1U5K A;  4IPG A;  4HIO A;  4OWT B;  1VQE A;  1YHA A;  4IJH A;  3F2C A;  4LWC A;  5M5W H;  2VQE L;  2IHE A;  1KL9 A;  2F4V Q;  3HKS A;  1XPU A;  1FJG L;  4PZ6 A;  5FLM H;  4DV2 L;  1HNZ Q;  4JBK A;  3KJP A;  3GO5 A;  4RMF A;  1W2B A;  3CC2 A;  3CAM A;  5DLQ E;  3GTP H;  1TWF H;  5C44 G;  1X9N A;  4MZ9 A;  3RLO A;  3OYY A;  2B29 A;  1VCI A;  1JE5 A;  3M7N A;  4A3G H;  5HY6 A;  1XTD A;  2VNU D;  3S16 H;  4L5R C;  5M3M H;  2HHH L;  2VQF Q;  4A93 G;  2WAQ G;  2QA4 A;  1E7Z A;  2CKZ B;  4B3S L;  4LFA L;  1BBW A;  4JG2 A;  1Z9F A;  2HIV A;  2LSS A;  2Z0S A;  1QUQ A;  5BR8 Q;  3PO3 G;  2N8N A;  1G51 A;  1K83 H;  1PH5 A;  4LF5 L;  1VQG A;  1VQJ A;  2Q2I A;  3CCS A;  2UUB Q;  2B3G A;  2VL6 A;  4DV1 L;  5EAY A;  1VQ4 A;  4DK3 C;  4BBS G;  3K7A H;  3STB D;  2NN6 G;  4GN4 B;  1I94 Q;  4LF7 Q;  3D31 A;  4NXM L;  2NVT H;  1CKO A;  3TRE A;  1CSQ A;  5E7N A;  4GOP B;  2R7D A;  3RNU A;  1YJ9 A;  4DR6 Q;  5AJ3 L;  1A63 A;  4HIK A;  4B3M Q;  2ALY B;  4JI1 L;  5IP9 G;  3DM3 A;  1W3S A;  2ZJP A;  3CCU A;  4IO9 A;  1VQK A;  3STB C;  3G48 A;  4BY7 G;  2LXK A;  1HZC A;  4JI4 Q;  1IXR A;  5JEA G;  1VQ6 A;  2Z6K C;  1LTL A;  3CW2 C;  3HOW H;  1PV4 A;  4BXX G;  1EIF A;  4DV6 L;  2VUM H;  2K75 A;  3GD7 A;  4IPC A;  4PG3 A;  1HNX Q;  4JYA Q;  1X3E A;  4JI5 L;  3DLL A;  4R4T A;  3T1Y Q;  1YI2 A;  1KXL A;  4X66 L;  3M4P A;  4GNX C;  4YY3 Q;  1SE8 A;  4DUY L;  4A3M H;  3G71 A;  1JMC A;  4DR7 L;  4XTC S;  2UU9 Q;  3GTQ H;  2OQK A;  3BZC A;  4QL5 A;  2JA6 G;  4JOI C;  1KAW A;  3F2D A;  4GKK Q;  4R4I A;  1WJJ A;  2RF4 A;  2YTY A;  1VQ8 A;  4A75 A;  1K0R A;  4OWW B;  4KLK A;  3G4S A;  2B63 G;  4LFB L;  1L1O B;  4DAY B;  3I2Z A;  3W1B A;  1XNR L;  1Q1E A;  2D62 A;  1Y1V G;  2YV5 A;  2VQE Q;  1QZH A;  1Q1B A;  2HQL A;  1XMO L;  3FP9 A;  4UPA A;  1WFQ A;  1PA6 A;  1FJG Q;  4DV2 Q;  3S1M H;  4DV0 Q;  1KIX A;  4JBJ A;  3U4V A;  3HOX H;  3GTJ H;  3G6E A;  1IYJ B;  3CPW A;  4ALP A;  4JI7 Q;  2CFM A;  2JJQ A;  3F2B A;  3PIP A;  3PUV A;  3I4M G;  3E9H A;  3JAM i;  5H1S E;  1ASZ A;  1EYG A;  1RL2 A;  4A3D G;  2CWA A;  3I4O A;  4R4O A;  3M4Q A;  1PYB A;  1C7Y A;  1SFO H;  1HR0 Q;  3A0J A;  1XMQ L;  3J81 c;  2OCE A;  4LFA Q;  2A8V A;  5IYC H;  2WFW A;  4YCW A;  4QY7 A;  3GTG H;  1Q82 C;  2JA8 H;  1LYL A;  2ZJR A;  1G6P A;  3IRB A;  4LF5 Q;  2D0O A;  3A5U A;  3GTL H;  3BU2 A;  2R7Z H;  2JA5 H;  4LF4 L;  4MNO A;  3CMA A;  2EXD A;  3FKI G;  1CUK A;  3PV0 A;  3OW2 A;  4L5T A;  1IBL Q;  5IYB H;  4R4C A;  1XJV A;  4BY1 G;  5AJ3 Q;  1D8L A;  3S17 H;  1OXX K;  3J80 c;  4JI1 Q;  2E2I H;  3EN2 A;  1PH4 A;  2IX0 A;  5C4X G;  1NBW A;  1E24 A;  3L0O A;  3CC4 A;  2K52 A;  3GTO H;  3ZJY C;  2Y0S E;  4EQ5 A;  4JV5 L;  1YHB A;  1E3P A;  2K50 A;  4DV6 Q;  2FXQ A;  1X3G A;  1YJN A;  3RLN A;  1PH7 A;  3PUW A;  3I56 A;  4GN3 B;  4L5Q A;  3L2P A;  4JI5 Q;  3HOU H;  4GOP A;  2PQA B;  2JA9 A;  1JJG A;  1N34 Q;  4X66 Q;  4GKJ L;  4DUY Q;  1ASY A;  4IOC A;  1VQ5 A;  4DR7 Q;  4A3C H;  1UE5 A;  2UXB L;  5LMU L;  4RG1 A;  1TWA H;  1K73 C;  1LUZ A;  3U50 C;  2F52 A;  2AWN A;  3NBH B;  4JI6 L;  3HKZ G;  3W5O A;  4KHZ A;  2RHS B;  5GAG C;  3PO2 G;  2JA7 H;  4LFB Q;  2R93 G;  3KLW A;  4AYB E;  3GTM H;  1E1T A;  1XNR Q;  1N32 Q;  1WCM H;  4A3J G;  1X6O A;  2YTX A;  3NEL A;  2BA1 A;  1KQS A;  4HIM A;  1PH6 A;  3CD6 A;  3KDF A;  5LMN W;  3HOV H;  1Q86 C;  1XMO Q;  4GNX B;  1MJC A;  4KHP L;  3UDG A;  1WOC A;  3NEN A;  3KF6 B;  3J7A 5;  2VW9 A;  2BH8 A;  2NVY H;  4UP8 A;  1XPO A;  2UXD L;  2UXC L;  4WJ3 M;  5FLM G;  3F8T A;  3HOY H;  3H0G G;  1L1O A;  3EBE A;  2KCM A;  4P73 A;  4BA1 I;  4EX5 A;  1HR0 W;  4DR6 L;  5GAH C;  4JI2 L;  1VQC A;  3I55 A;  4OX9 L;  4JI0 L;  1XMQ Q;  2MFI A;  1HZ9 A;  4R4Q A;  1YVC A;  1IBK Q;  1PFS A;  4DV4 L;  4A3E G;  5HGQ A;  1X3F A;  4P71 A;  2HT1 A;  2OWO A;  4QIW E;  1V43 A;  4GS3 A;  2BH2 A;  5GAD C;  2D0P A;  1E1O A;  4LF4 Q;  2AHO B;  4OON A;  2C35 B;  1VQA A;  1WI5 A;  1OXT A;  3CP0 A;  4LFC L;  2MNA A;  3CCR A;  2ID0 A;  3F1Z A;  4K0K L;  4QQB X;  1S3O A;  4LNQ A;  5GAE C;  4IOA A;  1XNQ L;  1HH2 P;  1JB7 A;  4PZ7 A;  4HJ9 A;  3JC6 6;  1S72 A;  1NMG A;  1B8A A;  1XPR A;  4A3K G;  4DR1 L;  4GLV B;  4JV5 Q;  4A93 H;  1NY4 A;  1PHJ A;  1CKN B;  3HOZ G;  2EIF A;  4POF A;  1Y1W G;  4Y52 H;  1GO3 E;  4H02 A;  4A3F G;  1Z47 A;  3PO3 H;  5IE8 A;  1N9W A;  3KJO A;  2JE6 I;  4GKJ Q;  1D7Q A;  2AWO A;  3HFZ B;  3GTK H;  3NEM A;  4HJ8 A;  3UE0 A;  4BBS H;  2RCN A;  3RZO H;  4YWL A;  5LMU Q;  4B3R L;  2UXB Q;  4JC0 A;  4A3I G;  4YHH Q;  1U0L A;  1SRU A;  5C0X J;  4JI6 Q;  1AH9 A;  2WB1 E;  3AFQ A;  5IP9 H;  3HOW G;  3CCJ A;  2GN5 A;  3CCE A;  4A3L G;  1K9M C;  3TS2 A;  4BY7 H;  2K5H A;  2PQA A;  5IYD G;  3I4N H;  3UE1 A;  2A1A A;  3S24 A;  4FDB A;  1I3Q H;  4AH6 A;  4HJ5 A;  2HIX A;  4JI8 L;  2K14 A;  4BXX H;  2QEX A;  3K0X A;  5C3E G;  3W1G A;  4KHP Q;  1UE6 A;  2R6G A;  3CME A;  4MTN A;  1YJW A;  3CQZ H;  5FJ8 G;  3EIV A;  2Z6K A;  4A3B H;  2UXD Q;  4LUZ A;  2UXC Q;  1VQF A;  3U4Z A;  2PI2 E;  2KBN A;  3HOX G;  4ME3 A;  1K3R A;  1JJ2 A;  2VY3 A;  3TRZ A;  1I6H H;  1H95 A;  2KHI A;  2JA6 H;  1EQR A;  4JI2 Q;  3RLF A;  1IZ6 A;  2OQ0 A;  1UWV A;  4GNX A;  3PGZ A;  2ES2 A;  2B63 H;  2IX1 A;  5C4J H;  1NTG A;  2HHH Q;  4POG A;  4DV4 Q;  3S2H H;  3E9I A;  4A76 A;  3KF6 A;  1I5F A;  2MQH A;  5M5X H;  4B3S Q;  4DUZ L;  3CCM A;  1S40 A;  5IWA L;  4JOI A;  5IYC G;  1Y1V H;  1VQ9 A;  3AQQ A;  1TXY A;  1N36 L;  4DV1 Q;  1VQN A;  4X65 L;  4LFC Q;  3PF5 A;  4B3T L;  4BA2 I;  1EWI A;  2EQS A;  2N78 A;  3J81 j;  3M85 A;  2I5M X;  4NXM Q;  3S15 H;  1B70 B;  1PVO A;  3B6Y A;  3UDX A;  2PMZ E;  3H15 A;  1L2F A;  2NZO A;  5IYB G;  5C0X G;  2NVQ H;  2DGY A;  1KRT A;  3I4M H;  1NE3 A;  5C0X I;  2UUC L;  3PCO B;  1QVF A;  4NPS A;  4DR1 Q;  1NJI C;  3PSI A;  1N33 L;  2R92 G;  3H3V H;  4A3D H;  3AYH B;  2ZJQ A;  1MIU A;  1UE1 A;  1PH9 A;  4IFD J;  4GN5 A;  2YTV A;  1OXU A;  1KHI A;  5M3F G;  2OTJ A;  4P74 A;  4NB3 A;  2VQF L;  5IY0 A;  3CXC A;  1BKB A;  2PNH A;  1GD7 A;  2VS1 A;  3S14 H;  2MO0 A;  1V1Q A;  3CCV A;  4BBR H;  2ZTD A;  4DV7 L;  4B3R Q;  3FKI H;  2RHQ B;  3K7U C;  3TEH B;  3SGI A;  4IJL A;  1Q8K A;  1Y14 B;  4YCV A;  3JAM c;  2E2J H;  3AEV A;  1TWG H;  2F3I A;  5BR8 L;  4BY1 H;  4O0A A;  1CKN A;  1V9P A;  3ULL A;  1EUJ A;  4IPD A;  2KHJ A;  5C4X H;  4PZ8 A;  5IP7 H;  2I5H A;  3ULP A;  4GLX A;  2CCZ A;  1EIY B;  4JI8 Q;  3ICE A;  1A62 A;  2CQO A;  2Y0S G;  4GLA C;  1EFW A;  3CF5 A;  4UP9 A;  5M5Y H;  1TWH H;  2Q2U A;  2ZM6 L;  2IT1 A;  2N49 A;  5ELN A;  3WWV A;  3PUZ A;  3CC7 A;  3CCQ A;  4DR5 L;  1HNW L;  1YNX A;  2JK8 A;  3T1Y L;  5J3B A;  1C9O A;  1J5E L;  2XTI A;  4YY3 L;  4DR4 L;  4HJA A;  1YIT A;  1GVP A;  2UU9 L;  3PO2 H;  3A5Z B;  2JQO A;  3UDI A;  4UP7 A;  2R93 H;  4DR2 L;  4OO1 G;  1SMX A;  4JBM A;  3VDY A;  4A3G G;  4DUZ Q;  1X54 A;  2N3S A;  2WAQ E;  4AYB G;  4A3J H;  2MO1 A;  5IWA Q;  4IFD G;  4OO1 I;  2AMC B;  4JBW A;  5M3M G;  4IFD I;  2ASB A;  1CSP A;  1MKH A;  3K8A A;  2E8G A;  3K80 C;  4J15 A;  1BVS A;  1N36 Q;  4X65 Q;  2NZH A;  3K81 C;  4X6A H;  3M3Y H;  4LW1 A;  4P72 A;  4B3T Q;  2JEB I;  4DV3 L;  1Q46 A;  5LMN L;  4DV0 L;  3H0G H;  1R9T H;  5C44 H;  2UUC Q;  4JI7 L;  1AE3 A;  4X64 L;  2NVX H;  4LF9 L;  1AE2 A;  1N33 Q;  4Y7N H;  1YHQ A;  3GDE A;  3TS0 A;  1N8R C;  1M1K C;  1VQB A;  1QVG A;  2UUA L;  4A3E H;  4PMW A;  1SLJ A;  1HR0 L;  1P16 A;  4DV5 L;  4DKA C;  3S1Q H;  1FVI A;  2V1C C;  2VZA A;  1QZG A;  2E5L L;  1OXV A;  4LF8 L;  4JI3 L;  4DV7 Q;  1EOV A;  3MXN B;  2VUM G;  3PF4 A;  3CPF A;  4OXP A;  1T9H A;  1SR3 A; 
#chains in the Genus database with same CATH topology
 2ZTE A;  3SK6 A;  1DON A;  2I0Q A;  1LT5 D;  3J7Z C;  2IY5 B;  1SYG A;  3KLS X;  5CV7 A;  5FOB B;  3UDF A;  2E2I B;  1PZK D;  1SXT A;  4A3D B;  2KCT A;  4IPH A;  4DR5 Q;  3J81 i;  1EY9 A;  1OXS C;  1MSH A;  5IT9 c;  1X56 A;  1NUC A;  1N34 L;  4TRD A;  4EGV A;  1MBY A;  5I9P A;  1FGU A;  1TWG B;  3HP3 A;  4CDC C;  3K5N A;  2R7F A;  2NUC A;  1K8G A;  1HXY D;  1JT8 A;  3ULJ A;  1WYD A;  1A2U A;  1Q81 C;  1PH3 A;  1B1Z A;  1VQL A;  2JA8 G;  5J1Z A;  3CU7 A;  5FJ8 H;  4DV3 Q;  2R7Z G;  2L12 A;  1BR9 A;  1KC8 C;  4HED A;  2F4V L;  5JJK A;  4LF9 Q;  1M90 C;  3QR8 A;  4X64 Q;  4YIJ A;  1HNZ L;  4ZKC B;  1AEX A;  3H91 A;  3BZK A;  2ZTC A;  1SNM A;  4C3I H;  2UUA Q;  1E22 A;  1F2Z A;  3SVM A;  3L9A X;  1IBK L;  1JOQ A;  3D4D A;  4LF8 Q;  3A7A B;  1VQ7 A;  4A3J B;  4HID A;  2Q2H A;  3E0J A;  2E74 C;  4BBR G;  3HGB A;  3H94 A;  4RHR A;  1Q8I A;  2LXJ A;  4LF7 L;  2O2L D;  4N9P A;  4KI0 A;  3HKZ E;  2R92 H;  1X65 A;  3NTI A;  5C44 B;  1BNZ A;  2JA7 G;  3T1H Q;  4Y7N B;  2XGT A;  2E2H H;  1PRT C;  1SDF A;  1EYC A;  3LX0 A;  2AKW B;  3DM1 A;  2JEA I;  1HNX L;  3DEO A;  4JYA L;  3U58 A;  1MJE A;  3DMU A;  1RHP A;  4C3H H;  1ILQ A;  4EQP A;  1F9Q A;  5JVG 3;  1EU4 A;  4JCV E;  3HOY G;  2A19 A;  3M4O B;  4IUQ A;  5IIF A;  1Y8O B;  1TS4 A;  3A54 A;  1JOR A;  2I5L X;  5GRO A;  2PO4 A;  4IJH A;  5CV4 A;  3F2C A;  4LWC A;  3S2D B;  2IJ0 A;  2D5D A;  3J81 E;  3BS1 A;  4PZ6 A;  4XQJ A;  3LWE A;  2F03 A;  3M7N A;  1JE5 A;  5HY6 A;  2VNU D;  3S16 H;  3NTK A;  5M3M H;  5E4X A;  4U67 3;  2WAQ G;  1EY7 A;  4RHS A;  4LFA L;  5I2X A;  1GHJ A;  1WTX A;  2N8N A;  1K83 H;  4RWS C;  3J7Y W;  2UUB Q;  1VQ4 A;  4PQX A;  4BBS G;  4FXG C;  2NN6 G;  1I94 Q;  3D31 A;  4NXM L;  3TRE A;  2R7D A;  1XTC D;  4JI1 L;  4RFB A;  2F3V A;  3DWA A;  4BY7 G;  1HZC A;  1IXR A;  1DM0 B;  1HFG A;  5CBA E;  1X3E A;  1D5Z C;  3KF8 A;  3ITP A;  1SE8 A;  1JMC A;  4XTC S;  2UU9 Q;  1AN8 A;  3KBX A;  3GTQ H;  2OQK A;  2YTY A;  2XNA C;  4KLK A;  1SNP A;  2O4X A;  1SJH D;  4DAY B;  1B3Q A;  3I2Z A;  4FF3 A;  1XNR L;  1G2T A;  1Q1E A;  2XWB B;  1E2V A;  2D62 A;  5M3F B;  3VR3 A;  1YNJ C;  3WOF A;  5G3L F;  2HQL A;  1XMO L;  5EBD A;  3S1M H;  4CKC A;  4DV2 Q;  1SMY C;  1Z6H A;  3NPP A;  4DV0 Q;  3U4V A;  4ALP A;  1QOH A;  2JJQ A;  3MXG A;  3PUV A;  5KIX A;  3I4M G;  1QCB D;  2VB3 X;  3OMG A;  3SR1 A;  1G91 A;  4R4O A;  1S5F D;  2J4X A;  1DYQ A;  2A8V A;  1KTK A;  2RDH A;  2F0J A;  4LF5 Q;  1CQF A;  4RCN A;  3K5M A;  3BU2 A;  1C8C A;  4ZAI A;  4LF4 L;  3CMA A;  3E5S A;  2K28 A;  3S9W A;  5IYB H;  3S17 H;  2JYO A;  4K8J A;  3H0G B;  3SK8 A;  2F0K A;  1TKW B;  1NBW A;  1E24 A;  4FF1 A;  1PTO C;  1ZYR C;  2K52 A;  1Y69 U;  2EJF C;  3ZJY C;  3ONA B;  4EQ5 A;  4A3G B;  1IKL A;  1E3P A;  1LTG D;  2FXQ A;  1YJN A;  5C3W A;  5DEH A;  2AUK A;  4GN3 B;  5EQ0 A;  2PQA B;  3VYT A;  5KND A;  2CH4 W;  1N34 Q;  4X66 Q;  2B2T C;  1CA5 A;  2P5Z X;  2PYK A;  4DUY Q;  4IOC A;  4DR7 Q;  3J81 L;  3K59 A;  1FNV A;  2D9U A;  1A15 A;  1TWA H;  1V1O A;  2MGS A;  1LUZ A;  2KA7 A;  2VB2 X;  5GAG C;  2RHS B;  3PO2 G;  1IYU A;  1IKM A;  1H9K A;  1E1T A;  1JR0 D;  4RGO S;  3P7J A;  3E6Z X;  4HIM A;  3CD6 A;  5LMN W;  1MJC A;  1WOC A;  2QCP X;  5I6W A;  3X3M A;  1WTQ A;  2BH8 A;  1XPO A;  4UP8 A;  4V19 0;  4WJ3 M;  1BBX C;  1ILP A;  4BA1 I;  4F7X A;  5JAV A;  3I55 A;  4OX9 L;  1XMQ Q;  2F0L A;  4R4Q A;  2O5I C;  1IBK Q;  1PFS A;  3MTS A;  1X3F A;  2HT1 A;  4QIW E;  4GS3 A;  2BH2 A;  3WOE A;  2D0P A;  3W3A A;  1OXT A;  3CRK C;  2MJ8 A;  5IGC A;  1ENC A;  5GAE C;  4XT1 B;  3NWS A;  3SK4 A;  3HOX B;  1XNQ L;  1HCZ A;  3GTJ B;  4PZ7 A;  3DXJ C;  2R3Z A;  2BE5 D;  4A3K G;  1IW7 C;  3R2I A;  3U9O A;  1GUT A;  2DJF C;  3HOZ G;  2PZW A;  2EIF A;  2F0G A;  5EPJ A;  2RSO A;  1GO3 E;  1SFO B;  3GP7 A;  2Q8T A;  1Y8N B;  3PO3 H;  3KJO A;  3VYS A;  1D7Q A;  3NEM A;  1NNX A;  2RCN A;  4YWL A;  5LMU Q;  4B3R L;  4JC0 A;  4A3I G;  1K3B C;  1S5C D;  1U0L A;  1SRU A;  1I4P A;  2LS0 1;  1TR5 A;  1RCV D;  4C56 C;  4H13 C;  4A3L G;  3FPP A;  2K5H A;  3TBI B;  1QIL A;  3I4N H;  3UE1 A;  2A1A A;  4AH6 A;  4HJ5 A;  2K14 A;  3K0X A;  5C3E G;  1ENA A;  4KHP Q;  5A35 A;  1HTL D;  4MTN A;  1YJW A;  2UXD Q;  3HOU B;  4LUZ A;  2UXC Q;  1IL8 A;  2B2W C;  2PI2 E;  4WFN 3;  2KBN A;  1JJ2 A;  2VY3 A;  4FNF A;  1X32 A;  2JA6 H;  1JB3 A;  2PW7 A;  1QWY A;  1KNE A;  3Q0A A;  4N8X 1;  4S3S A;  4DV4 Q;  3Q22 A;  2MQH A;  3A8J E;  4ZUJ A;  4DUZ L;  1PFM A;  1S40 A;  4E6I A;  1WCM B;  1Y1V H;  1I6V C;  3K5L A;  1K8O A;  4FP5 D;  4LFC Q;  3VR6 A;  3PF5 A;  3C1E A;  4NXM Q;  1HQR D;  3J81 j;  4KV6 A;  4NP5 A;  3TP5 A;  2ZXO A;  2PMZ E;  3UDX A;  2NZO A;  5IYB G;  2DGY A;  2NVY B;  5I2Y A;  2UUC L;  4A3D H;  3H3V H;  1UE1 A;  4IFD J;  5FO9 B;  3BDO A;  4ZCK A;  5IY0 A;  2H1E A;  2VS1 A;  2PNH A;  1GD7 A;  4KKS A;  1LAC A;  2KHS A;  3K7U C;  4IJL A;  4YCV A;  1TWG H;  2F3I A;  3R3O A;  2RQX A;  1CKN A;  3ULL A;  1EUJ A;  3OWE B;  2KHJ A;  5IP7 H;  4PZ8 A;  2I5H A;  3ULP A;  1A62 A;  1TS2 A;  2DN8 A;  4A93 B;  4UP9 A;  3VA5 A;  2CVR A;  1B44 D;  3E3X A;  3PUZ A;  4DR5 L;  5LL6 X;  2JK8 A;  4N8F A;  3T1Y L;  3VR4 A;  3GTK B;  1F2M A;  5DNF A;  4QF4 A;  3RZO B;  4HJA A;  1AP0 A;  3NK9 A;  2B2T A;  3D6W A;  3UDI A;  2CW0 D;  4UP7 A;  1MD2 D;  1SMX A;  4A3J H;  4IFD G;  2WAQ E;  4AYB G;  3BVZ A;  4OO1 I;  4EQO A;  2J0T D;  5K36 H;  1I3Q B;  3K80 C;  1N36 Q;  1F77 A;  4X65 Q;  4LW1 A;  4B3T Q;  2JEB I;  4JVZ A;  4DV3 L;  2OEO A;  4A3B B;  4LAA A;  5C44 H;  4LF9 L;  1MSG A;  4X64 L;  2K6A A;  4HN7 A;  4Y7N H;  1YHQ A;  4DNR B;  1M1K C;  1VQB A;  2UUA L;  1BF4 A;  2B63 B;  3S2H B;  4DKA C;  1FVI A;  2V1C C;  1QZG A;  3HOW G;  5M5X B;  4LF8 L;  4DV7 Q;  2VUM G;  1KAB A;  3FEW X;  3OOC A;  4MN3 A;  1B8A A;  2TMP A;  4DK1 A;  1EQQ A;  1MI2 A;  3M4O H;  5JJL A;  4A3M G;  4L5S A;  2CWP A;  2K4K A;  2NN6 I;  2V4D A;  3S15 B;  1IHZ A;  1CTM A;  3SHL A;  1EY8 A;  1A6X A;  3QWN A;  1QVC A;  4LUV A;  3I4N G;  2MUY A;  4WJ4 A;  3T1H L;  4DAM A;  1YIJ A;  1ESR A;  3S2D H;  3PUX A;  1EQT A;  1SNO A;  1HNW Q;  1STA A;  1DGS A;  1J5E Q;  4DR4 Q;  2NB0 A;  2WP8 J;  1HUN A;  4J8Q A;  2WB1 G;  3K57 A;  4OX9 Q;  3OWF A;  2EY5 A;  2PPB C;  2K05 A;  4P75 A;  5C4X B;  3J80 i;  1I4R A;  2A6H D;  2F0W A;  4KY5 A;  3R8B A;  4UY8 C;  1A8V A;  2L15 A;  3TP7 A;  1EYA A;  2L55 A;  4DN4 M;  3M9B A;  3C1F A;  1UEB A;  5M5Y B;  4LUO A;  3QJY A;  2JA5 G;  1FR3 A;  1VS0 A;  1K8A C;  1VQI A;  2Z9H A;  1XNQ Q;  4EQN A;  1PH2 A;  1AFP A;  1O7I A;  4YWK A;  1YZ6 A;  3ERS X;  2B2W A;  3RR5 A;  4GOP C;  1W6J A;  1BQQ T;  4O2D A;  4DV5 Q;  2R93 B;  3IL8 A;  1OTC A;  1D1K A;  4JI3 Q;  1ROD A;  2X6G A;  1ML0 D;  5BN4 A;  3MVV A;  3SE0 A;  2Q8I B;  3PUY A;  2UUB L;  3M3Y B;  4A3C G;  1PTO F;  1V1P A;  2HDM A;  3ERO A;  2A69 D;  2JXM B;  1I94 L;  1C0A A;  3KOJ A;  5IP7 G;  3G6J B;  3I7F A;  4R1J A;  3KF8 B;  4QJF A;  2NVX B;  4AQY Q;  2KVM A;  4APV A;  5M3F H;  5ELB A;  1O78 A;  2IW3 A;  4QGU A;  3RN5 A;  3HOV G;  1L1O C;  3S1Q B;  2QGQ A;  3URY A;  4A4I A;  1KRS A;  4LF6 Q;  2B2U A;  5EKL A;  1NR4 A;  4X62 Q;  4YHH L;  1IBM Q;  4OGQ C;  2RSN A;  2G5D A;  3FPU B;  4FXK C;  3RMH A;  1A0I A;  3HEJ A;  5JEA J;  1C4Q A;  4C2M B;  1J8I A;  1NMF A;  1VQM A;  5JOB A;  1JJC B;  5K36 G;  5D3I B;  1U5K A;  4ID6 A;  4HIO A;  4M8A A;  1F9P A;  4A3F B;  1AW7 A;  2MHV A;  4KMU C;  2OF1 A;  1XPU A;  4DV2 L;  1FD7 D;  1ZKO A;  3GV3 A;  2HD3 A;  3GO5 A;  1W2B A;  3CC2 A;  1PFN A;  1TWF H;  5C44 G;  2C9O A;  1JCK B;  3RLO A;  3OYY A;  1KDA A;  1VCI A;  4A3G H;  4L5R C;  2LKV A;  3MHB A;  2QA4 A;  1BXT A;  2CKZ B;  4JG2 A;  4C3J B;  1ONL A;  1Z9F A;  2HIV A;  5C3X A;  2LSS A;  2Z0S A;  1QUQ A;  1PH5 A;  4LF5 L;  4HMJ A;  3CCS A;  2B3G A;  5CC4 A;  3F2U A;  5IGF A;  2F0V A;  1DXM A;  1BCP C;  3DHQ A;  4HIK A;  4B3M Q;  5IP9 G;  4IO9 A;  3STB C;  1KDC A;  5JEA G;  1VQ6 A;  1LTL A;  4PV1 C;  1PV4 A;  2B2V C;  2ZXP A;  3GD7 A;  4IPC A;  4PMB A;  2BE5 C;  2K5W A;  1EYD A;  3T1Y Q;  2Z8L A;  4X66 L;  3M4P A;  4GNX C;  3ERQ A;  4DUY L;  3T51 B;  4DR7 L;  5T1I A;  1U4P A;  3BZC A;  4I7Z C;  4MTK A;  4JOI C;  1I50 B;  1M8A A;  2F0E A;  3PMF A;  2QKI C;  1WJJ A;  4R4I A;  4A75 A;  4OWW B;  4ZQ3 A;  3W1B A;  3EFX D;  2WV6 D;  1RF2 D;  3KK7 A;  3NE5 B;  1V8Q A;  3K0Y A;  3KLS A;  1Q1B A;  2L11 A;  4FO2 A;  1PA6 A;  1FJG Q;  2A73 B;  3QG1 A;  3HOX H;  3GTJ H;  3F2B A;  3PIP A;  5C5M A;  3M4Y A;  1STH A;  3JAM i;  4NDX A;  1EYG A;  1RL2 A;  2CWA A;  1C7Y A;  1SFO H;  4G7H C;  1STN A;  1XMQ L;  3J81 c;  4QY7 A;  3LWU A;  1SSO A;  3IRB A;  2XWJ B;  2K04 A;  4QB4 A;  4LMQ D;  3MA2 B;  5DM6 3;  3I90 A;  3FKI G;  1CUK A;  3PV0 A;  1O80 A;  5E1F A;  4BY1 G;  5AJ3 Q;  1D8L A;  3SK5 A;  2I07 B;  3GTP B;  5J22 A;  1EEI D;  1BOS A;  1E2Z A;  4RCO A;  4DV6 Q;  1X3G A;  2SEB D;  3RLN A;  5JPN C;  1GHK A;  4JI5 Q;  3L3O C;  3HOU H;  4GOP A;  3H3V C;  1UUP A;  1LTS D;  3MXP A;  1G2S A;  1VQ5 A;  3RUZ A;  2CHB D;  5IOD A;  5LMU L;  1PFB A;  1STG A;  5D3D A;  4KHZ A;  2NVT B;  5IT9 E;  4K6D A;  4LFB Q;  2B2Y C;  3KLW A;  4AYB E;  1WCM H;  1X6O A;  2NZ1 D;  1CZG A;  2BA1 A;  4PNY A;  4G7O C;  3J80 L;  1VF7 A;  1J9O A;  4KHP L;  1ET6 A;  5I9O A;  1X3Q A;  1JIC A;  2NVY H;  2UXD L;  2UXC L;  3GV6 A;  4O1N A;  3H0G G;  1L1O A;  3IFT A;  4P73 A;  2KCM A;  1W6K A;  3CHB D;  1GJX A;  2KEC A;  5BN3 A;  1VQC A;  5HUR A;  4HCS A;  1HZ9 A;  3LNN A;  4DV4 L;  2AQ1 B;  4A3E G;  4XXE A;  2A6E D;  5EBC A;  1V43 A;  1Y8P B;  5JPM C;  1A2T A;  5GAD C;  4XYQ A;  2AHO B;  5IGB A;  2C35 B;  1EWC A;  1WI5 A;  2MNA A;  3CP0 A;  4LFC L;  2ID0 A;  4K0K L;  2EJG C;  1KDB A;  4QMG A;  4HJ9 A;  3NXW A;  3JC6 6;  1PMR A;  1NMG A;  1A3T A;  3JAM E;  4GLV B;  4A93 H;  1NY4 A;  1CKN B;  4HMI A;  2RDG A;  4Y52 H;  4IUT A;  1FYC A;  4GKJ Q;  2AWO A;  3GTG B;  3T4A C;  3GTK H;  4CJ0 B;  2JA8 B;  4HJ8 A;  2UXB Q;  3RZO H;  2RA4 A;  3C2P A;  2R7Z B;  4YHH Q;  2L4N A;  1PTO B;  1G8Z D;  2WB1 E;  1SYC A;  1PZJ D;  1K9M C;  2PW5 A;  1I3Q H;  3OHX C;  5IGG A;  4KHV A;  4BXX H;  3GTO B;  2QEX A;  3W1G A;  2XVS A;  1EY6 A;  5G3L D;  2WIN B;  3HG9 A;  5FJ8 G;  3NWT A;  4A3B H;  4FYD A;  4MHE A;  1LT6 D;  1U4L A;  3HOX G;  2KOL A;  1F2Y A;  4ZK9 B;  1IZ6 A;  1ENF A;  2PMZ B;  1UWV A;  4GNX A;  2ES2 A;  3MZ5 A;  2PNR C;  2B63 H;  4C3I G;  1NTG A;  5C4Z A;  3S2H H;  2EY2 A;  4XYO A;  2JA7 B;  1I5F A;  5M5X H;  2M9V A;  4JOI A;  3GTM B;  1EQV A;  4M1U B;  3NQT A;  1N36 L;  4X65 L;  4B3T L;  3QOJ A;  4KTA A;  2RCF A;  1PZI D;  2B8G A;  3S15 H;  1DZ1 A;  1B70 B;  3B6Y A;  3R93 A;  3H15 A;  1NE3 A;  5C0X I;  1RD9 D;  2R92 G;  1ET9 A;  3AYH B;  1TWF B;  1MIU A;  2IPK D;  1OXU A;  2OTJ A;  4P74 A;  4NB3 A;  3CXC A;  5FO7 B;  5COR A;  3NUC A;  3BDL A;  3V2T A;  4QUF A;  4DV7 L;  2E75 C;  1DD2 A;  4C3H G;  1B2T A;  5EJW A;  3FDT A;  1SNQ A;  1GUN A;  1S5B D;  5C4X H;  1K28 A;  3DWP A;  2CCZ A;  1EIY B;  1F9S A;  5IGE A;  2A69 C;  5FK9 C;  1A3V A;  2Y0S G;  4GLA C;  1EFW A;  5M5Y H;  3J7A F;  2WAQ B;  3W2D A;  2Q2U A;  3AU7 A;  5FKA C;  3WWV A;  5ELN A;  1HNW L;  5I4D A;  1C9O A;  1J5E L;  4BBS B;  4YY3 L;  4DR4 L;  1YIT A;  2R93 H;  4G4K A;  3MC0 B;  1SYB A;  2EPB A;  1B50 A;  3K6O A;  4J1M A;  2K01 A;  3JAM L;  1JE4 A;  2AMC B;  5M3M G;  4F88 A;  4K5V A;  2IWH A;  5COY A;  3K81 C;  3M3Y H;  3U9S A;  5FLX E;  5AFW A;  4KD3 A;  3CQZ B;  3R2T A;  4KKT A;  3SDZ A;  1AE3 A;  2NVX H;  1AE2 A;  1N33 Q;  1STE A;  4RGN A;  3TS0 A;  1IYV A;  1V1P B;  3VA7 A;  1QVG A;  1SLJ A;  5ELC A;  1HR0 L;  1P16 A;  4DV5 L;  3S1Q H;  2VZA A;  4JI3 L;  1SE3 A;  1YNN D;  1U4M A;  3PF4 A;  1BCP F;  3CPF A;  1T9H A;  1SR3 A;  5BR8 Q;  1WTP A;  2KEN A;  1IBL L;  4KKU A;  1CK1 A;  1H9S A;  2Q2T A;  4BS9 A;  1STY A;  1HQM C;  4CJ1 B;  2KUM A;  1WTH A;  1UE7 A;  3L7Z C;  5EKK A;  4C2M H;  3I4M B;  2NVQ B;  2K32 A;  4AQY L;  1TT2 A;  1Y1W H;  4A3F H;  1VQP A;  2ZM6 Q;  1P8L A;  1B3A A;  1EEF D;  1GM5 A;  2LFN A;  2F0U A;  3LGJ A;  4A3B G;  2ZT9 C;  4LF6 L;  1L0W A;  1HA5 A;  1TY0 A;  1LM0 A;  2E2J B;  4X62 L;  5KYI A;  4DR2 Q;  1IBM L;  4IUV A;  5IYD H;  1PYS B;  2FFK B;  2NYZ D;  1D2B A;  1XWE A;  2BA0 A;  4C3J H;  1HZB A;  1N32 L;  4OEL B;  1Q12 A;  1VQO A;  1SRO A;  4JK1 C;  4ZRZ A;  5I6Y A;  3A74 A;  4DNI A;  1Q7Y C;  1TWH B;  2EE1 A;  5LMN Q;  1K8M A;  3I70 A;  4FF4 A;  4K0K Q;  1J6Q A;  4DNT B;  3TDQ A;  3D0F A;  1QUQ B;  4NKL A;  2JSO A;  4ME5 A;  4B9W A;  4OEM B;  1VQH A;  3DUZ A;  3FHW A;  4JW0 A;  2IX3 A;  3PO2 B;  2PQE A;  4OWX B;  2E5L Q;  3OMC A;  1G29 1;  1OO9 B;  2HCC A;  2F0S A;  3PIO A;  3E0E A;  4BWG B;  3OTO Q;  1GUW A;  1I50 H;  5CV6 A;  1PXU A;  2RDF A;  1PRT F;  1R9T B;  4NXN Q;  4H7B A;  4L63 B;  4B3M L;  2XIW A;  3MXN A;  3KFU A;  4MIU A;  4TQU S;  4DR3 Q;  4I65 A;  1PH1 A;  2QDB A;  2PI2 A;  1SYF A;  4IUR A;  3NTH A;  1E0B A;  4QUC A;  2IHF A;  2ATW A;  1B53 A;  3ER0 A;  1H9M A;  1CM9 A;  1YEZ A;  3BJU A;  1B9N A;  1TQO A;  1X55 A;  5JJI A;  4A3K B;  3RN2 A;  4AIM A;  2WKC A;  3HOZ B;  4OIJ A;  2DY7 A;  2K5V A;  4IPG A;  2LY7 A;  1UNS A;  1YHA A;  2QW7 A;  2EJM A;  1KL9 A;  1GUO A;  1FJG L;  5FLM H;  4JBK A;  3KJP A;  3J7A V;  4A3I B;  3A7L A;  2F0P A;  5DLQ E;  3GTP H;  1DCZ A;  2A68 D;  1X9N A;  4MZ9 A;  2B29 A;  2KEE A;  2OT2 A;  5BN5 A;  1XTD A;  2HHH L;  5EPK A;  3V05 A;  4B3S L;  3QOL A;  1TWC B;  5C3E B;  2QDL A;  3PO3 G;  3RZD B;  1VQG A;  1LTT D;  4DV1 L;  1JWS D;  2A6E C;  2XRS D;  4GN4 B;  2O5J C;  4DGZ A;  2NVT H;  1CSQ A;  4GOP B;  4DR6 Q;  1A63 A;  5AJ3 L;  2ALY B;  4EVO A;  2ZJP A;  1W3S A;  2J7Z A;  3CCU A;  1XYI A;  1SBB B;  1VQK A;  3AB9 A;  3G48 A;  2FMC A;  2LXK A;  3KLR A;  4ZYS A;  4JI4 Q;  1HHV A;  3KUP A;  4WOR A;  1EL0 A;  1DOK A;  4DV6 L;  2K75 A;  4CDD C;  4JI5 L;  3DLL A;  2YU9 B;  2VXW A;  4K5W A;  4DFA A;  2GA4 B;  4YY3 Q;  3G71 A;  4K8I A;  2D2C C;  3G7L A;  4G57 A;  5CV8 A;  4UDU C;  1XXG A;  2JA6 G;  3F2D A;  4RGT A;  2Z1C A;  2F0Q A;  3OIP A;  4GKK Q;  2RF4 A;  3A8I E;  1KAA A;  1K0R A;  5EPL A;  4LFB L;  3G4S A;  4C1N I;  1L1O B;  4C3J G;  1HFN A;  1FNW A;  2FMM A;  4IUP A;  1MHW C;  1O7Y A;  1Y1V G;  2VQE Q;  3FP9 A;  1GXD C;  3FRP B;  4R9W A;  1IYJ B;  3CPW A;  2CFM A;  5DAU A;  3P20 A;  3E9H A;  3S1N B;  5H1S E;  3D3R A;  3MWY W;  4RKL A;  4A3D G;  1EFI D;  3HKZ B;  3M4Q A;  3T56 B;  3A0J A;  4X3U A;  1HR0 Q;  5IYC H;  2WFW A;  1E2W A;  1G6P A;  3GTG H;  2JA8 H;  4P2C B;  1H9J A;  3S1R B;  3A5U A;  2X69 A;  2R7Z H;  3KBG A;  1DOM A;  1PTO H;  1IBL Q;  1PTO D;  1HTP A;  5M5W B;  2AQ3 B;  5IGD A;  3TP8 A;  3J80 c;  1WD0 A;  3EN2 A;  1PH4 A;  1QG7 A;  2IX0 A;  3L0O A;  3GTO H;  4B9X A;  1FNU A;  2DNE A;  2Y0S E;  3V96 A;  2L5T A;  1YHB A;  2NWG A;  4AYB B;  3QO2 A;  4K5X A;  3PUW A;  3I56 A;  4L5Q A;  1SND A;  3L2P A;  1L0Y B;  2JA9 A;  1JJG A;  4GKJ L;  3FVQ A;  1QJO A;  1ASY A;  1JOO A;  1BCP B;  1KLU D;  2B39 A;  4JPB W;  2UXB L;  4FVM A;  1XX8 A;  4G7Z C;  1K73 C;  1F2L A;  3K7A B;  3PIO 3;  3U50 C;  1ZEQ X;  3W5O A;  2JA7 H;  4IN3 A;  3TME A;  3CKI B;  5M9O A;  4KD4 A;  3GTM H;  2L0C A;  1N32 Q;  4A3J G;  2YTX A;  1PH6 A;  4WJW A;  1Q86 C;  1Y1W B;  4ILW A;  4GNX B;  2PCF B;  3UDG A;  3HOW B;  2G9D A;  1UEA B;  2VUM B;  5F2D A;  4B08 A;  2R61 A;  3I8Z A;  1CHP D;  5FLM G;  3F8T A;  3HOY H;  4L8J A;  1II3 A;  4UHV A;  3EBE A;  3PQI A;  2RKS A;  5E3F A;  4OO1 H;  4CBV A;  5JVH 3;  1TVX A;  4JI0 L;  2MFI A;  5HGQ A;  2WAC A;  4P71 A;  2RVL A;  2OWO A;  4HTH A;  4XT3 B;  1E1O A;  1CZW A;  4DF7 A;  4OON A;  1VQA A;  5KNB A;  3F1Z A;  4H0L C;  5KRU A;  1K0S A;  1S3O A;  1WD1 A;  4DXF A;  1JB7 A;  1S72 A;  1XPR A;  5D65 A;  4JV5 Q;  1PHJ A;  2N55 A;  1Q90 A;  4K2L A;  1O7L A;  4POF A;  2KCC A;  3TZD A;  4H02 A;  2EYH A;  1N9W A;  1RJT A;  3HFZ B;  4DA2 A;  1F9R A;  1ICW A;  3A8K E;  4BBS H;  2QIL A;  4OIK A;  1C48 A;  2NN6 H;  4RKB A;  3GTL B;  2JA5 B;  2HUG A;  4HSV A;  1AH9 A;  2B8F A;  4JI6 Q;  3AFQ A;  3C3L A;  1DOL A;  1YNN C;  4PMC A;  1PRT B;  1R4Q B;  4BY7 H;  1PLF A;  3IKJ A;  3ND8 A;  2N88 A;  1LLR D;  3P75 A;  1WTV A;  1UE6 A;  3NBH A;  4R8I A;  3CQZ H;  2MPM A;  3RD4 A;  3SEB A;  2XN9 C;  1K3R A;  4C1N K;  3I3C A;  4JI2 Q;  4IZ8 A;  2OQ0 A;  3M7G A;  2IX1 A;  2HHH Q;  3WDN A;  3KF6 A;  4B3S Q;  1SYE A;  5IYC G;  2BDN A;  4DK0 A;  1LTB D;  5J39 A;  4GZY C;  3EA6 A;  1TXY A;  1TII D;  1Q3L A;  2CH4 A;  2DJG C;  4DV1 Q;  1TS3 A;  3HOV B;  3T53 B;  2F0N A;  4TSS A;  4BA2 I;  2EQS A;  3M85 A;  3EQL C;  4KJN A;  1L2F A;  3I4M H;  2NVQ H;  2EY1 A;  2PZU A;  2JP1 A;  4ZUI A;  1JWU D;  3PCO B;  1HA6 A;  4NPS A;  4DR1 Q;  3PSI A;  1N33 L;  1SE4 A;  5EGT A;  1H9S B;  5M3F G;  5TSS A;  1JOK A;  2VQF L;  2EYM A;  4CKB A;  5KNC A;  5L37 A;  1EOT A;  3BVG A;  1CQV A;  1RDP D;  3TEH B;  4FXD A;  1Q8K A;  3AEV A;  3JAM c;  2E2J H;  1NR2 A;  5BR8 L;  2EYO A;  5DM7 3;  2A74 C;  4IPD A;  2F0O A;  4I7A A;  2EYF A;  1JWM D;  3H6M A;  3ICE A;  4JI8 Q;  3I4L A;  4LJZ C;  2EDG A;  3CF5 A;  2SNS A;  1TWH H;  1AZP A;  2ZM6 L;  2IT1 A;  2N49 A;  3CC7 A;  3CCQ A;  4QIW B;  1MGS A;  1D5X C;  4HSP A;  1EIH A;  1GVP A;  3PO2 H;  2JQO A;  4DR2 L;  4OO1 G;  4A3G G;  4ULL A;  4DAV A;  2NTS A;  2MO1 A;  5IWA Q;  4JBW A;  4IFD I;  3BZD B;  2ASB A;  1MKH A;  3K8A A;  2CW0 C;  2NBF A;  2Z6B A;  2NZH A;  5ELE A;  1WTW A;  3D4R A;  1DJR D;  1O7Z A;  5LMN L;  1S4Z A;  1R9T H;  1G6Z A;  1JC7 A;  2DNC A;  2HCI A;  3BDC A;  4JI7 L;  1H9R A;  5CYU A;  3GDE A;  1I6H B;  4H44 C;  5K5P A;  4PMW A;  2K5D A;  4F87 A;  2EXZ A;  3NSW A;  1SE2 A;  5C4J B;  2A68 C;  4LK1 C;  1EIG A;  2E5L L;  3MXN B;  3N6R A;  3D6C A;  3OPO A;  4OXP A;  2OXP A;  1WTO A;  3OTO L;  3TQY A;  4YWM A;  3MFY A;  2OTL A;  1HJP A;  2F0M A;  3OSO A;  4HJ7 A;  4NXN L;  3SXH A;  4A3K H;  1PH8 A;  3HOZ H;  2JN4 A;  5C4H A;  4DR3 L;  1SN8 A;  2G9H D;  3OIQ A;  3S14 B;  4A3I H;  3VYU A;  4BBR B;  3KDF B;  2B2V A;  3FKI B;  3CCL A;  4BY1 B;  4A3L H;  4DU9 A;  4JI0 Q;  3BG3 A;  4KY6 A;  3Q6S A;  2NTT A;  2AUJ D;  1EY0 A;  1RTO A;  1TWC H;  5C3E H;  2GVA A;  3QIA A;  1GUS A;  3RZD H;  3Q8D A;  1B7Y B;  1I4Q A;  1RIP A;  4UAI A;  4YCU A;  2A6H C;  1UAP A;  3NBI A;  2F0F A;  2F0D A;  4TVA B;  3MFG A;  1BBU A;  4K6L A;  3HOY B;  2DUD A;  1I4G A;  4OHJ A;  4DK6 C;  5IT9 L;  3KYH C;  5FLX c;  3PIP 3;  3H3V I;  5D14 A;  3AFP A;  5T1G A;  4J6H A;  2YU9 H;  4X3K A;  2KQ3 A;  4DPG A;  1IL2 A;  4Z9C B;  3HOU G;  4RH6 A;  1EY4 A;  4HCE A;  3TZU A;  1LTA D;  2L9H A;  1HRJ A;  3IFD A;  1JQY D;  1GKH A;  1YBY A;  4DR6 L;  1HZA A;  3K58 A;  2C5C A;  1KD1 C;  2FIN B;  1WTR A;  3I73 A;  2F0T A;  5GQO A;  4JI4 L;  1WCM G;  2K5N A;  4WRD A;  1AZQ A;  4FF2 A;  4A3E B;  2F1M A;  2GVB A;  3HRZ C;  5CMD A;  1VQD A;  3ZYY X;  1CI3 M;  3S1N H;  4XIG S;  2YYZ A;  3NP8 A;  4V0B A;  1S5D D;  1CKM A;  1LTI D;  5KGU A;  1LV9 A;  2H5X A;  2XRQ D;  2EOT A;  4GKK L;  4KK7 A;  5ELO A;  2EYJ A;  5KEE A;  4BY7 B;  3S1R H;  3MEF A;  1FL0 A;  4OWT B;  2A5H A;  1VQE A;  2B2Y A;  1BO0 A;  1HPC A;  1STB A;  5M5W H;  4F8M A;  2VQE L;  2IHE A;  3BYY B;  5C6A A;  5ISR A;  3HKS A;  2F4V Q;  1HNZ Q;  2I46 A;  2M2L A;  4RMF A;  3BVM A;  1CHQ D;  3CAM A;  4Q5V A;  4XDX A;  5ELD A;  4IFD H;  1BUV T;  1VMC A;  4A93 G;  2VQF Q;  4RGM A;  1E7Z A;  5JJZ A;  1BBW A;  3T16 A;  1G51 A;  1BCP D;  1VQJ A;  2Q2I A;  1QB5 D;  2VL6 A;  4KN4 C;  5EAY A;  4CGY B;  4DK3 C;  3K7A H;  3STB D;  4LF7 Q;  2Z4H A;  1CKO A;  5E7N A;  3RNU A;  1YJ9 A;  1S5E D;  4DXG A;  2SNM A;  5CR3 A;  3DM3 A;  1B4O A;  2FJ2 A;  1A3U A;  2TSS A;  4C3I B;  2AQ2 B;  2Z6K C;  3CW2 C;  3HOW H;  2K03 A;  2F4I A;  4BXX G;  1EIF A;  2VUM H;  1HNX Q;  4PG3 A;  4CDE C;  4JYA Q;  5CV9 A;  1EZ6 A;  4R4T A;  1LT3 D;  4QCL A;  1YI2 A;  1KXL A;  2SDF A;  4A3M H;  3VR2 A;  3MAQ A;  4QL5 A;  1KAW A;  1VQ8 A;  5FO8 B;  2B63 G;  2R92 B;  2EYL A;  1Z7T A;  3DWQ A;  2E2H B;  2YV5 A;  1QZH A;  4HR7 B;  4IAL A;  4UPA A;  1WFQ A;  3K5O A;  5CGK A;  1KIX A;  4JBJ A;  4Q0F A;  3G6E A;  4C3H B;  1WVL A;  4JI7 Q;  4CKE A;  1D6E C;  1QNK A;  2KCN A;  1ASZ A;  1LO5 D;  3I4O A;  1PYB A;  3I72 A;  2F0I A;  2OCE A;  4LFA Q;  4YCW A;  3UI2 A;  1Q82 C;  1LYL A;  2Y0S B;  2LMC B;  2K7V A;  2ZXR A;  1T5E A;  4XQN A;  2ZJR A;  4R8N A;  3HZX A;  1TU2 B;  2D0O A;  3GTL H;  2JA5 H;  4MNO A;  2EXD A;  4N9T A;  1KLG D;  3OW2 A;  4L5T A;  1SAP A;  2PZT A;  5C0X H;  4R4C A;  1XJV A;  1OXX K;  1PRT D;  2E2D C;  4JI1 Q;  2E2I H;  1D5M C;  2RBM A;  5C4X G;  1ESF A;  3CC4 A;  2Z4I A;  3FMC A;  4KJO A;  1ZXT A;  4JV5 L;  1FGB D;  2M00 A;  3GQB A;  2K50 A;  4ODG A;  1PH7 A;  3S16 B;  2B2U C;  1TY2 A;  5M3M B;  2BCO A;  2E76 C;  3EVQ A;  1ICF B;  1VMP A;  2EVB A;  5A2Q E;  4XQQ A;  4A3C H;  1K83 B;  1UE5 A;  5FLX L;  3VYR A;  3OW7 A;  3TSS A;  4RG1 A;  4JI6 L;  2F52 A;  2AWN A;  3NBH B;  3HKZ G;  1LT4 D;  1CT1 D;  2R93 G;  1VDZ A;  5ELF A;  1XNR Q;  3NEL A;  4X3T A;  1KQS A;  3KDF A;  3TP6 A;  1EWH A;  1QE6 A;  3HOV H;  1M4V A;  1XMO Q;  1U4R A;  3NEN A;  3BYT B;  3KF6 B;  1CA6 A;  3J7A 5;  2VW9 A;  4NW2 A;  1QNU A;  5E4W C;  4DAY A;  1SYD A;  3EJI A;  3I91 A;  2BDO A;  3TN2 A;  4EX5 A;  1HR0 W;  5GAH C;  4JI2 L;  3GTQ B;  2SOB A;  4OL7 A;  2X6L A;  1SEB D;  4K2K A;  1T5X D;  1YVC A;  1RKN A;  5HGT A;  2QEJ C;  4CHT B;  3D8G A;  2K1B A;  3CRL C;  2L1B A;  3HS0 C;  2MP1 A;  1I4X A;  4LF4 Q;  1NAP A;  1U9R A;  5IOC A;  3CCR A;  5KYL A;  1L0X B;  3C46 A;  4QQB X;  3S1M B;  4LNQ A;  3VR5 A;  4IOA A;  1HH2 P;  2F0H A;  3A55 A;  4DR1 L;  4KN7 C;  1Y1W G;  2DY8 A;  1I4H A;  4A3F G;  1Z47 A;  3X3N A;  5IE8 A;  2JE6 I;  1NSN S;  3UE0 A;  5NUC A;  5C5L A;  2ICI A;  5C0X J;  5IP9 H;  3CCJ A;  2GN5 A;  3CCE A;  3S17 B;  3TS2 A;  3IAY A;  3MXU A;  2PQA A;  1YNJ D;  5IYD G;  3S24 A;  5JEA H;  4FDB A;  4IUU A;  2HIX A;  4JI8 L;  1SMY D;  3O13 A;  2XSC A;  3ND9 A;  1EY5 A;  2R6G A;  3CME A;  3EIV A;  2Z6K A;  3NHH A;  1VQF A;  2QF7 A;  3U4Z A;  1NCV A;  2BOS A;  4ME3 A;  1I6H H;  3TRZ A;  1H95 A;  2KHI A;  3DEP A;  2IL8 A;  1D1I A;  1EQR A;  3RLF A;  3D4W A;  2EY6 A;  4HAE A;  3PGZ A;  1TWA B;  5C4J H;  3Q24 A;  4POG A;  3E9I A;  3NQI A;  4A76 A;  1EU3 A;  3CCM A;  1HUM A;  5IWA L;  2ENB A;  4CDF C;  1VQ9 A;  4U68 A;  1GOZ A;  3AQQ A;  3N52 A;  1GUG A;  1VQN A;  1EWI A;  1PVO A;  2N78 A;  1ZYR D;  4DAP A;  2I5M X;  5A2Q L;  5C0X G;  1KRT A;  4CJ2 C;  1EZ8 A;  1QVF A;  1X3P A;  1NJI C;  2ZJQ A;  1PH9 A;  4GN5 A;  1CFM A;  2YTV A;  1KHI A;  4ZKB B;  1BKB A;  3AMU A;  3S14 H;  2EYP A;  2MO0 A;  1V1Q A;  4X3S A;  4BBR H;  2ZTD A;  3CCV A;  4B3R Q;  3FKI H;  2RHQ B;  3SGI A;  1Y14 B;  2KED A;  4BY1 H;  4O0A A;  1B9M A;  1V9P A;  3Q23 A;  2K33 A;  3P1H A;  5LHY 1;  1TS5 A;  4GLX A;  1PYW D;  1RTN A;  2HDL A;  1LAB A;  5CBE E;  2CQO A;  2FHT A;  4K14 A;  1SJE D;  2Q8R E;  2KJX A;  3QB3 A;  2ICE C;  1YNX A;  2H4O A;  3PO3 B;  4TKO B;  5J3B A;  4ZLT F;  1BDO A;  3MEH A;  2XTI A;  2UU9 L;  5LL6 S;  4A3M B;  2F3W A;  3A5Z B;  4L6T B;  1R4P B;  2HQE A;  4JBM A;  3VDY A;  4DUZ Q;  1X54 A;  2N3S A;  4IQZ A;  2WII B;  3I4N B;  2K5Q A;  1CSP A;  1KNA A;  2CQA A;  4RAU C;  2E8G A;  4J15 A;  1BVS A;  5CV5 A;  4NMZ A;  4X6A H;  4P72 A;  2WKD A;  4IUN A;  1Q46 A;  1VF5 C;  4DV0 L;  1IW7 D;  3H0G H;  3H09 A;  2UUC Q;  4RA8 A;  3T13 A;  4ABN A;  2WB1 B;  2JA6 B;  1N8R C;  5EKI A;  4KY7 A;  4O42 A;  4A3E H;  3J80 E;  1SNC A;  1LTR D;  1OXV A;  1EOV A;  2EZV A;  1Y1V B;  1PDQ A;  3A56 A; 
#chains in the Genus database with same CATH homology
 2KEN A;  3OTO L;  1EQQ A;  2ZTE A;  3TQY A;  1IBL L;  3M4O H;  4YWM A;  4A3M G;  5JJL A;  4L5S A;  2CWP A;  2I0Q A;  2K4K A;  2NN6 I;  3J7Z C;  2OTL A;  2Q2T A;  1HJP A;  2IY5 B;  4C2M H;  4HJ7 A;  1UE7 A;  3L7Z C;  4NXN L;  4A3K H;  3UDF A;  1QVC A;  4LUV A;  1PH8 A;  3I4N G;  3HOZ H;  4AQY L;  2KCT A;  4WJ4 A;  3T1H L;  4DAM A;  1Y1W H;  1YIJ A;  4A3F H;  3PUX A;  1VQP A;  3S2D H;  2ZM6 Q;  4DR3 L;  1SN8 A;  4IPH A;  4DR5 Q;  1HNW Q;  1P8L A;  3J81 i;  1OXS C;  1GM5 A;  5IT9 c;  1DGS A;  3LGJ A;  1X56 A;  4A3I H;  1N34 L;  4A3B G;  1J5E Q;  4LF6 L;  1L0W A;  3KDF B;  4DR4 Q;  2WP8 J;  1LM0 A;  3CCL A;  1FGU A;  4X62 L;  2WB1 G;  4A3L H;  4DR2 Q;  1IBM L;  4OX9 Q;  4JI0 Q;  5IYD H;  1PYS B;  4P75 A;  2R7F A;  3J80 i;  1K8G A;  2BA0 A;  1TWC H;  1HZB A;  4C3J H;  1JT8 A;  3ULJ A;  1WYD A;  5C3E H;  1Q81 C;  1A8V A;  2GVA A;  1PH3 A;  4UY8 C;  1N32 L;  3RZD H;  2L15 A;  1Q12 A;  3Q8D A;  1B7Y B;  1SRO A;  1VQO A;  1VQL A;  2JA8 G;  3M9B A;  1RIP A;  3A74 A;  1UEB A;  4YCU A;  5FJ8 H;  4DNI A;  4LUO A;  4DV3 Q;  5LMN Q;  1Q7Y C;  2R7Z G;  2JA5 G;  1KC8 C;  4K0K Q;  1VS0 A;  1K8A C;  1J6Q A;  2F4V L;  5JJK A;  1VQI A;  4LF9 Q;  1M90 C;  4X64 Q;  1HNZ L;  1XNQ Q;  4TVA B;  3D0F A;  1O7I A;  1QUQ B;  1PH2 A;  1BBU A;  4YWK A;  3BZK A;  1YZ6 A;  2ZTC A;  2DUD A;  4C3I H;  1VQH A;  3ERS X;  3FHW A;  1E22 A;  3RR5 A;  4GOP C;  4DK6 C;  2UUA Q;  3KYH C;  4O2D A;  5FLX c;  4DV5 Q;  3H3V I;  1IBK L;  3AFP A;  4OWX B;  1OTC A;  2E5L Q;  4LF8 Q;  1VQ7 A;  4JI3 Q;  1G29 1;  4HID A;  2YU9 H;  2Q2H A;  4DPG A;  3PIO A;  3E0E A;  1IL2 A;  3HOU G;  4BBR G;  3OTO Q;  3PUY A;  2UUB L;  4A3C G;  1I50 H;  2LXJ A;  1C0A A;  4LF7 L;  1I94 L;  1GKH A;  4KI0 A;  1YBY A;  3HKZ E;  3KOJ A;  4NXN Q;  2R92 H;  5IP7 G;  1HZA A;  1X65 A;  3I7F A;  3KF8 B;  4QJF A;  4R1J A;  4B3M L;  1KD1 C;  3KFU A;  2JA7 G;  4AQY Q;  3T1H Q;  2XGT A;  4APV A;  5M3F H;  2E2H H;  4TQU S;  5GQO A;  4JI4 L;  1WCM G;  2K5N A;  4DR3 Q;  4QGU A;  3RN5 A;  2AKW B;  3HOV G;  1L1O C;  1PH1 A;  2GVB A;  1HNX L;  2JEA I;  2PI2 A;  4JYA L;  3U58 A;  1MJE A;  2QGQ A;  4C3H H;  4A4I A;  1KRS A;  4LF6 Q;  1VQD A;  2IHF A;  2ATW A;  3S1N H;  4XIG S;  2YYZ A;  3ER0 A;  4X62 Q;  4JCV E;  4YHH L;  1IBM Q;  1CKM A;  2A19 A;  3HOY G;  1YEZ A;  3BJU A;  2H5X A;  1X55 A;  4GKK L;  5ELO A;  1A0I A;  5JEA J;  5JJI A;  1NMF A;  3S1R H;  1VQM A;  3RN2 A;  1JJC B;  2I5L X;  3MEF A;  4AIM A;  5K36 G;  5GRO A;  1FL0 A;  2K5V A;  1U5K A;  4IPG A;  4HIO A;  4OWT B;  1VQE A;  1YHA A;  4IJH A;  3F2C A;  4LWC A;  5M5W H;  2VQE L;  2IHE A;  1KL9 A;  2F4V Q;  3HKS A;  1XPU A;  1FJG L;  4PZ6 A;  5FLM H;  4DV2 L;  1HNZ Q;  4JBK A;  3KJP A;  3GO5 A;  4RMF A;  1W2B A;  3CC2 A;  3CAM A;  5DLQ E;  3GTP H;  1TWF H;  5C44 G;  1X9N A;  4MZ9 A;  3RLO A;  3OYY A;  2B29 A;  1VCI A;  1JE5 A;  3M7N A;  4A3G H;  5HY6 A;  1XTD A;  2VNU D;  3S16 H;  4L5R C;  5M3M H;  2HHH L;  2VQF Q;  4A93 G;  2WAQ G;  2QA4 A;  1E7Z A;  2CKZ B;  4B3S L;  4LFA L;  1BBW A;  4JG2 A;  1Z9F A;  2HIV A;  2LSS A;  2Z0S A;  1QUQ A;  5BR8 Q;  3PO3 G;  2N8N A;  1G51 A;  1K83 H;  1PH5 A;  4LF5 L;  1VQG A;  1VQJ A;  2Q2I A;  3CCS A;  2UUB Q;  2B3G A;  2VL6 A;  4DV1 L;  5EAY A;  1VQ4 A;  4DK3 C;  4BBS G;  3K7A H;  3STB D;  2NN6 G;  4GN4 B;  1I94 Q;  4LF7 Q;  3D31 A;  4NXM L;  2NVT H;  1CKO A;  3TRE A;  1CSQ A;  5E7N A;  4GOP B;  2R7D A;  3RNU A;  1YJ9 A;  4DR6 Q;  5AJ3 L;  1A63 A;  4HIK A;  4B3M Q;  2ALY B;  4JI1 L;  5IP9 G;  3DM3 A;  1W3S A;  2ZJP A;  3CCU A;  4IO9 A;  1VQK A;  3STB C;  3G48 A;  4BY7 G;  2LXK A;  1HZC A;  4JI4 Q;  1IXR A;  5JEA G;  1VQ6 A;  2Z6K C;  1LTL A;  3CW2 C;  3HOW H;  1PV4 A;  4BXX G;  1EIF A;  4DV6 L;  2VUM H;  2K75 A;  3GD7 A;  4IPC A;  4PG3 A;  1HNX Q;  4JYA Q;  1X3E A;  4JI5 L;  3DLL A;  4R4T A;  3T1Y Q;  1YI2 A;  1KXL A;  4X66 L;  3M4P A;  4GNX C;  4YY3 Q;  1SE8 A;  4DUY L;  4A3M H;  3G71 A;  1JMC A;  4DR7 L;  4XTC S;  2UU9 Q;  3GTQ H;  2OQK A;  3BZC A;  4QL5 A;  2JA6 G;  4JOI C;  1KAW A;  3F2D A;  4GKK Q;  4R4I A;  1WJJ A;  2RF4 A;  2YTY A;  1VQ8 A;  4A75 A;  1K0R A;  4OWW B;  4KLK A;  3G4S A;  2B63 G;  4LFB L;  1L1O B;  4DAY B;  3I2Z A;  3W1B A;  1XNR L;  1Q1E A;  2D62 A;  1Y1V G;  2YV5 A;  2VQE Q;  1QZH A;  1Q1B A;  2HQL A;  1XMO L;  3FP9 A;  4UPA A;  1WFQ A;  1PA6 A;  1FJG Q;  4DV2 Q;  3S1M H;  4DV0 Q;  1KIX A;  4JBJ A;  3U4V A;  3HOX H;  3GTJ H;  3G6E A;  1IYJ B;  3CPW A;  4ALP A;  4JI7 Q;  2CFM A;  2JJQ A;  3F2B A;  3PIP A;  3PUV A;  3I4M G;  3E9H A;  3JAM i;  5H1S E;  1ASZ A;  1EYG A;  1RL2 A;  4A3D G;  2CWA A;  3I4O A;  4R4O A;  3M4Q A;  1PYB A;  1C7Y A;  1SFO H;  1HR0 Q;  3A0J A;  1XMQ L;  3J81 c;  2OCE A;  4LFA Q;  2A8V A;  5IYC H;  2WFW A;  4YCW A;  4QY7 A;  3GTG H;  1Q82 C;  2JA8 H;  1LYL A;  2ZJR A;  1G6P A;  3IRB A;  4LF5 Q;  2D0O A;  3A5U A;  3GTL H;  3BU2 A;  2R7Z H;  2JA5 H;  4LF4 L;  4MNO A;  3CMA A;  2EXD A;  3FKI G;  1CUK A;  3PV0 A;  3OW2 A;  4L5T A;  1IBL Q;  5IYB H;  4R4C A;  1XJV A;  4BY1 G;  5AJ3 Q;  1D8L A;  3S17 H;  1OXX K;  3J80 c;  4JI1 Q;  2E2I H;  3EN2 A;  1PH4 A;  2IX0 A;  5C4X G;  1NBW A;  1E24 A;  3L0O A;  3CC4 A;  2K52 A;  3GTO H;  3ZJY C;  2Y0S E;  4EQ5 A;  4JV5 L;  1YHB A;  1E3P A;  2K50 A;  4DV6 Q;  2FXQ A;  1X3G A;  1YJN A;  3RLN A;  1PH7 A;  3PUW A;  3I56 A;  4GN3 B;  4L5Q A;  3L2P A;  4JI5 Q;  3HOU H;  4GOP A;  2PQA B;  2JA9 A;  1JJG A;  1N34 Q;  4X66 Q;  4GKJ L;  4DUY Q;  1ASY A;  4IOC A;  1VQ5 A;  4DR7 Q;  4A3C H;  1UE5 A;  2UXB L;  5LMU L;  4RG1 A;  1TWA H;  1K73 C;  1LUZ A;  3U50 C;  2F52 A;  2AWN A;  3NBH B;  4JI6 L;  3HKZ G;  3W5O A;  4KHZ A;  2RHS B;  5GAG C;  3PO2 G;  2JA7 H;  4LFB Q;  2R93 G;  3KLW A;  4AYB E;  3GTM H;  1E1T A;  1XNR Q;  1N32 Q;  1WCM H;  4A3J G;  1X6O A;  2YTX A;  3NEL A;  2BA1 A;  1KQS A;  4HIM A;  1PH6 A;  3CD6 A;  3KDF A;  5LMN W;  3HOV H;  1Q86 C;  1XMO Q;  4GNX B;  1MJC A;  4KHP L;  3UDG A;  1WOC A;  3NEN A;  3KF6 B;  3J7A 5;  2VW9 A;  2BH8 A;  2NVY H;  4UP8 A;  1XPO A;  2UXD L;  2UXC L;  4WJ3 M;  5FLM G;  3F8T A;  3HOY H;  3H0G G;  1L1O A;  3EBE A;  2KCM A;  4P73 A;  4BA1 I;  4EX5 A;  1HR0 W;  4DR6 L;  5GAH C;  4JI2 L;  1VQC A;  3I55 A;  4OX9 L;  4JI0 L;  1XMQ Q;  2MFI A;  1HZ9 A;  4R4Q A;  1YVC A;  1IBK Q;  1PFS A;  4DV4 L;  4A3E G;  5HGQ A;  1X3F A;  4P71 A;  2HT1 A;  2OWO A;  4QIW E;  1V43 A;  4GS3 A;  2BH2 A;  5GAD C;  2D0P A;  1E1O A;  4LF4 Q;  2AHO B;  4OON A;  2C35 B;  1VQA A;  1WI5 A;  1OXT A;  3CP0 A;  4LFC L;  2MNA A;  3CCR A;  2ID0 A;  3F1Z A;  4K0K L;  4QQB X;  1S3O A;  4LNQ A;  5GAE C;  4IOA A;  1XNQ L;  1HH2 P;  1JB7 A;  4PZ7 A;  4HJ9 A;  3JC6 6;  1S72 A;  1NMG A;  1B8A A;  1XPR A;  4A3K G;  4DR1 L;  4GLV B;  4JV5 Q;  4A93 H;  1NY4 A;  1PHJ A;  1CKN B;  3HOZ G;  2EIF A;  4POF A;  1Y1W G;  4Y52 H;  1GO3 E;  4H02 A;  4A3F G;  1Z47 A;  3PO3 H;  5IE8 A;  1N9W A;  3KJO A;  2JE6 I;  4GKJ Q;  1D7Q A;  2AWO A;  3HFZ B;  3GTK H;  3NEM A;  4HJ8 A;  3UE0 A;  4BBS H;  2RCN A;  3RZO H;  4YWL A;  5LMU Q;  4B3R L;  2UXB Q;  4JC0 A;  4A3I G;  4YHH Q;  1U0L A;  1SRU A;  5C0X J;  4JI6 Q;  1AH9 A;  2WB1 E;  3AFQ A;  5IP9 H;  3HOW G;  3CCJ A;  2GN5 A;  3CCE A;  4A3L G;  1K9M C;  3TS2 A;  4BY7 H;  2K5H A;  2PQA A;  5IYD G;  3I4N H;  3UE1 A;  2A1A A;  3S24 A;  4FDB A;  1I3Q H;  4AH6 A;  4HJ5 A;  2HIX A;  4JI8 L;  2K14 A;  4BXX H;  2QEX A;  3K0X A;  5C3E G;  3W1G A;  4KHP Q;  1UE6 A;  2R6G A;  3CME A;  4MTN A;  1YJW A;  3CQZ H;  5FJ8 G;  3EIV A;  2Z6K A;  4A3B H;  2UXD Q;  4LUZ A;  2UXC Q;  1VQF A;  3U4Z A;  2PI2 E;  2KBN A;  3HOX G;  4ME3 A;  1K3R A;  1JJ2 A;  2VY3 A;  3TRZ A;  1I6H H;  1H95 A;  2KHI A;  2JA6 H;  1EQR A;  4JI2 Q;  3RLF A;  1IZ6 A;  2OQ0 A;  1UWV A;  4GNX A;  3PGZ A;  2ES2 A;  2B63 H;  2IX1 A;  5C4J H;  1NTG A;  2HHH Q;  4POG A;  4DV4 Q;  3S2H H;  3E9I A;  4A76 A;  3KF6 A;  1I5F A;  2MQH A;  5M5X H;  4B3S Q;  4DUZ L;  3CCM A;  1S40 A;  5IWA L;  4JOI A;  5IYC G;  1Y1V H;  1VQ9 A;  3AQQ A;  1TXY A;  1N36 L;  4DV1 Q;  1VQN A;  4X65 L;  4LFC Q;  3PF5 A;  4B3T L;  4BA2 I;  1EWI A;  2EQS A;  2N78 A;  3J81 j;  3M85 A;  2I5M X;  4NXM Q;  3S15 H;  1B70 B;  1PVO A;  3B6Y A;  3UDX A;  2PMZ E;  3H15 A;  1L2F A;  2NZO A;  5IYB G;  5C0X G;  2NVQ H;  2DGY A;  1KRT A;  3I4M H;  1NE3 A;  5C0X I;  2UUC L;  3PCO B;  1QVF A;  4NPS A;  4DR1 Q;  1NJI C;  3PSI A;  1N33 L;  2R92 G;  3H3V H;  4A3D H;  3AYH B;  2ZJQ A;  1MIU A;  1UE1 A;  1PH9 A;  4IFD J;  4GN5 A;  2YTV A;  1OXU A;  1KHI A;  5M3F G;  2OTJ A;  4P74 A;  4NB3 A;  2VQF L;  5IY0 A;  3CXC A;  1BKB A;  2PNH A;  1GD7 A;  2VS1 A;  3S14 H;  2MO0 A;  1V1Q A;  3CCV A;  4BBR H;  2ZTD A;  4DV7 L;  4B3R Q;  3FKI H;  2RHQ B;  3K7U C;  3TEH B;  3SGI A;  4IJL A;  1Q8K A;  1Y14 B;  4YCV A;  3JAM c;  2E2J H;  3AEV A;  1TWG H;  2F3I A;  5BR8 L;  4BY1 H;  4O0A A;  1CKN A;  1V9P A;  3ULL A;  1EUJ A;  4IPD A;  2KHJ A;  5C4X H;  4PZ8 A;  5IP7 H;  2I5H A;  3ULP A;  4GLX A;  2CCZ A;  1EIY B;  4JI8 Q;  3ICE A;  1A62 A;  2CQO A;  2Y0S G;  4GLA C;  1EFW A;  3CF5 A;  4UP9 A;  5M5Y H;  1TWH H;  2Q2U A;  2ZM6 L;  2IT1 A;  2N49 A;  5ELN A;  3WWV A;  3PUZ A;  3CC7 A;  3CCQ A;  4DR5 L;  1HNW L;  1YNX A;  2JK8 A;  3T1Y L;  5J3B A;  1C9O A;  1J5E L;  2XTI A;  4YY3 L;  4DR4 L;  4HJA A;  1YIT A;  1GVP A;  2UU9 L;  3PO2 H;  3A5Z B;  2JQO A;  3UDI A;  4UP7 A;  2R93 H;  4DR2 L;  4OO1 G;  1SMX A;  4JBM A;  3VDY A;  4A3G G;  4DUZ Q;  1X54 A;  2N3S A;  2WAQ E;  4AYB G;  4A3J H;  2MO1 A;  5IWA Q;  4IFD G;  4OO1 I;  2AMC B;  4JBW A;  5M3M G;  4IFD I;  2ASB A;  1CSP A;  1MKH A;  3K8A A;  2E8G A;  3K80 C;  4J15 A;  1BVS A;  1N36 Q;  4X65 Q;  2NZH A;  3K81 C;  4X6A H;  3M3Y H;  4LW1 A;  4P72 A;  4B3T Q;  2JEB I;  4DV3 L;  1Q46 A;  5LMN L;  4DV0 L;  3H0G H;  1R9T H;  5C44 H;  2UUC Q;  4JI7 L;  1AE3 A;  4X64 L;  2NVX H;  4LF9 L;  1AE2 A;  1N33 Q;  4Y7N H;  1YHQ A;  3GDE A;  3TS0 A;  1N8R C;  1M1K C;  1VQB A;  1QVG A;  2UUA L;  4A3E H;  4PMW A;  1SLJ A;  1HR0 L;  1P16 A;  4DV5 L;  4DKA C;  3S1Q H;  1FVI A;  2V1C C;  2VZA A;  1QZG A;  2E5L L;  1OXV A;  4LF8 L;  4JI3 L;  4DV7 Q;  1EOV A;  3MXN B;  2VUM G;  3PF4 A;  3CPF A;  4OXP A;  1T9H A;  1SR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...