4OX9L

Crystal structure of the aminoglycoside resistance methyltransferase npma bound to the 30s ribosomal subunit
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Molecular recognition and modification of the 30S ribosome by the aminoglycoside-resistance methyltransferase NpmA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome/antibiotic
total genus 16
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ox9L00
4QIWE 3HKZE 5GAEC 2VQFQ 1FGUA 4DR2L 5LMUL 4A4IA 5J3BA 5IP9H 4JI2L 1K3RA 1IBMQ 4BA2I 4A3IH 1NE3A 1B70B 4A3KH 5C3EG 2PQAB 2K14A 3U4ZA 1N33Q 4JI7Q 3D31A 3S17H 4JI1L 2NN6G 4BY1H 1BVSA 1XPRA 1VS0A 3CF5A 2PI2A 4UP9A 2UUBQ 3K8AA 2UUCQ 3PUZA 4IJLA 1TWHH 4POGA 2HIXA 2K5HA 1QUQA 1QVCA 1VQ6A 1HNWL 1Z9FA 5IP7G 1IBLL 2RF4A 3CCQA 5EAYA 1YZ6A 5HY6A 1SROA 4DV6L 4A3JG 4OO1I 3S1MH 1SR3A 4JI8L 5AJ3Q 4DV2Q 2CCZA 3RZOH 1YHAA 4LW1A 4LFBQ 1X9NA 3BJUA 2Q2TA 4OX9L 1I50H 1HZCA 3K7UC 1A0IA 4LF9Q 1XMQL 4IOAA 1M1KC 2R93H 3F1ZA 1NJIC 2HHHQ 3W1BA 2BA0A 3HOZG 1X3EA 2WAQG 3CP0A 1K0RA 4IJHA 4OO1G 3PO3H 4J15A 1E1TA 4JBWA 3L7ZC 2UXCL 4X6AH 3RN2A 1HZAA 4JI5L 1PA6A 3KYHC 1D8LA 4DNIA 1U5KA 4DR7Q 3H3VI 2JA6H 1GO3E 4P71A 1HH2P 2QGQA 2ZTEA 3EBEA 4IPCA 1UE7A 2AHOB 1IBKL 4BXXH 2PQAA 1C7YA 4JI3L 2WB1E 1AH9A 3UDGA 3JC66 3J80i 1LYLA 2JE6I 2AWOA 4QGUA 2UXDQ 4GN3B 1EIYB 4JI4Q 2CFMA 1E3PA 1VQHA 3CQZH 1HZ9A 1YVCA 2MO1A 4L5TA 3JAMi 4A76A 3L2PA 3A0JA 3HKSA 3CD6A 2ZM6Q 1SLJA 5DLQE 2VL6A 3F2DA 1JB7A 2Z6KA 2A8VA 5M3MG 1X65A 2K5NA 5IYCH 3I4MH 4A93G 4A3MG 4LF5L 1Y1VG 2OCEA 4GOPC 3KJPA 4YWKA 1OXVA 2R7FA 3OTOL 2NZHA 3W1GA 4LNQA 1H95A 4LFCL 1VQDA 4OXPA 4KHPL 5IY0A 1KD1C 3HOUH 2OQ0A 2B29A 4AIMA 1ASYA 3PF5A 4NXML 1LM0A 3E0EA 1V43A 5IWAL 2F3IA 2ZTDA 4OWXB 1G6PA 4XTCS 2AWNA 4PZ7A 4A3GH 1A62A 4A3FG 4B3RQ 4DAYB 2IX0A 4APVA 1E22A 4O0AA 4DR6L 1AE2A 3T1HQ 5GAHC 1Y1WH 1FVIA 1NY4A 3KF6B 4JCVE 4OWTB 1K8AC 2R6GA 2HQLA 1VQPA 4DV4L 1XMOQ 1WYDA 1FL0A 3CCEA 2VNUD 4A3EH 4B3SL 5GROA 5FLMG 2CWAA 2JA9A 3FP9A 5C3EH 1SE8A 1V9PA 4JI6Q 2UXBQ 4GNXC 3U4VA 1XPOA 4X62L 1N36Q 2JA7G 1L1OC 3PIOA 2KHJA 4MZ9A 4HJ9A 2F4VQ 4DV7L 3ICEA 1EUJA 5H1SE 3HFZB 4DR3Q 3FHWA 1I3QH 5M3FH 4B3ML 1X55A 1YHQA 3JAMc 4IOCA 4P72A 3F2CA 1QUQB 3B6YA 5IP7H 1K9MC 2JK8A 1X6OA 5JJKA 1E24A 4YY3Q 1NMGA 4DUZQ 1YNXA 4LF6Q 3GTQH 3J81i 2BH8A 2V1CC 4QY7A 1CKMA 4BBSH 1EFWA 1GM5A 1VQ7A 3H0GG 4DPGA 5JJLA 1VQEA 5M5XH 1LUZA 3CCUA 2UUCL 2UU9Q 3PUXA 4UY8C 3RNUA 3HOVH 4DV1L 2JJQA 1PH1A 1S3OA 2YTYA 4LUZA 3CC2A 2R92H 2E5LQ 1D7QA 3K81C 4X66Q 1PHJA 2IHFA 3BZCA 4YCVA 1MJEA 4A3BH 4HJ8A 4H02A 1CUKA 1YEZA 2L15A 4LFBL 5IYBG 2KCMA 4C3IH 3M9BA 3J7ZC 1XPUA 4DUYQ 1X3GA 4LFAL 3UDXA 3T1YQ 2RCNA 2C35B 5JEAG 2E2HH 1PYBA 3I4NH 1HNZL 4BY7G 2HHHL 4XIGS 1JMCA 3FKIH 4LF4Q 2MNAA 2OTLA 4L5RC 1EOVA 1Y14B 4WJ3M 3PUVA 4AQYQ 5IYDH 4DR5L 4HIMA 4DR1Q 4K0KQ 1X54A 2NZOA 2NVTH 1N34Q 3S1NH 3CW2C 4PMWA 4HIKA 4GN5A 1Q12A 3K7AH 2N78A 1X3FA 1IYJB 1KC8C 1ASZA 1BKBA 3D0FA 3EN2A 3DLLA 3CCJA 2JA5H 2HIVA 2VS1A 4GLAC 3M3YH 3RLOA 4A3MH 2VUMH 2I5MX 1KHIA 3OYYA 4IPGA 3RLNA 2B63G 2OTJA 2K75A 4Y7NH 1HNXQ 3J7A5 1PH3A 1K73C 1WCMG 1X56A 2E2IH 1CKNA 2UXDL 1Q86C 1UE1A 4DK3C 3CPWA 2LXKA 4ME3A 5C0XI 4GKKQ 4AYBE 2KENA 4IO9A 5LMNQ 1N32Q 2N8NA 3NBHB 1PVOA 4GLVB 1PH5A 2BA1A 5HGQA 1I94Q 1YBYA 4R4IA 2R7ZG 4IPHA 2R7DA 3MEFA 1TXYA 1KIXA 2YTVA 4LF8Q 1XNQL 2CKZB 3KLWA 2E8GA 3S14H 3AQQA 2K4KA 1UE6A 1WJJA 4GKJQ 1KAWA 1VQ8A 4IFDI 3M7NA 5C0XG 3HOYH 5M5YH 2BH2A 5C44G 3W5OA 1OXUA 2MO0A 3MXNB 4RMFA 1J6QA 1EWIA 2UUAL 2FXQA 3L0OA 2DGYA 2Y0SG 1K8GA 3CCVA 4P73A 2JA7H 4DR2Q 4QJFA 1E1OA 4MNOA 5LMUQ 1BBWA 3G48A 3T1HL 2N3SA 3PO2G 5FJ8H 1G291 1Q8KA 3PUWA 4X65L 2KBNA 1IZ6A 3HOWH 4A3CG 2VQEL 3I7FA 3AFPA 4JI0L 5C4XG 2JA8H 2D62A 1OTCA 3UE1A 4NXNL 4EX5A 4GOPA 5GAGC 4HIOA 4BBRH 3NENA 4LF7Q 3CPFA 1CSPA 2EQSA 2F52A 4R4OA 2UXBL 2MFIA 3GTLH 5JEAJ 1N9WA 1JT8A 2F4VL 5IP9G 1SN8A 4DR3L 4P75A 1VQFA 4YWMA 4A3IG 1QZGA 4A3KG 4DV6Q 1PH9A 2ZJQA 2ASBA 2KCTA 3I4OA 3CMAA 4C3JH 1YITA 4B3TL 4JI8Q 1JJGA 1EQQA 2EIFA 4A3DH 2I0QA 1RIPA 2A1AA 1HR0W 4DR4L 3HOXG 4YY3L 1VQOA 3UE0A 4DUZL 3VDYA 1SMXA 2ID0A 1J5EL 4OX9Q 5BR8Q 4LF6L 1UWVA 1L0WA 2NVYH 5E7NA 1EIFA 3OW2A 1QVFA 1XNRL 2IX1A 3LGJA 1P8LA 4JYAL 1C9OA 1NTGA 3IRBA 3S16H 3I56A 3NEMA 3HKZG 4X64L 4L5SA 4GNXA 1KL9A 1CKOA 3CCMA 1L1OA 4X66L 4DV5L 3GTGH 3ERSX 3PGZA 1JJ2A 1HJPA 3GTKH 4FDBA 3J80c 3KF8B 1O7IA 1OXXK 2WAQE 3BU2A 3RLFA 1IBKQ 2D0PA 4YCWA 3PIPA 4JI3Q 4JBMA 4EQ5A 2VQFL 2OQKA 4R4TA 3S1RH 1HR0Q 2ZJRA 4GN4B 1PH7A 2B63H 1JJCB 3PO3G 1IBML 4JV5Q 5C0XJ 4A3JH 5IE8A 2PMZE 3M4QA 1WCMH 3Q8DA 1N33L 4JBJA 4YCUA 4JI7L 2ES2A 4DR1L 1CKNB 2JA6G 5JJIA 3AYHB 1Q1EA 3GD7A 1XJVA 3TQYA 3OTOQ 1A8VA 4BXXG 3PF4A 4A3LG 2UUBL 3CCRA 1VQAA 4LFCQ 4DV3Q 4DV0Q 4WJ4A 3TS2A 3S24A 2AKWB 2MQHA 2ZTCA 1YJWA 1TWFH 4HIDA 3PCOB 1XTDA 1EQRA 1JE5A 1G51A 4GS3A 3HOZH 5IWAQ 1SRUA 1L2FA 1VQKA 2NVQH 5AJ3L 5IYCG 4RG1A 3I4MG 4DV2L 5K36G 1PV4A 3CXCA 4LWCA 1W2BA 2ATWA 1W3SA 4DR7L 4BA1I 4GLXA 1KXLA 4NB3A 5C44H 4JOIC 1I5FA 1TWCH 2RHSB 2H5XA 1I94L 4LF9L 5LMNW 3G4SA 3PV0A 3ER0A 3HOUG 4KI0A 3F8TA 2YV5A 3TREA 4B3SQ 2JEBI 4R4CA 2YU9H 5C4XH 2WB1G 4A3GG 3J81j 4X62Q 2A19A 1OXTA 3UDIA 4A93H 5M3MH 2K50A 2NN6I 3M85A 1Y1WG 1NMFA 4NPSA 4GOPB 1N8RC 4DV7Q 3H3VH 1Y1VH 3KFUA 1KRTA 3AFQA 1MIUA 1B8AA 1VQMA 4B3MQ 2WFWA 2QEXA 4HJAA 2IY5B 4A3EG 1PH4A 4P74A 3ULLA 1YJ9A 4JG2A 4JI4L 4OWWB 4C3HH 3J81c 3I2ZA 2K52A 3PUYA 1P16A 2EXDA 1WFQA 2ZM6L 3SGIA 1TWGH 1PH6A 1EYGA 3M4OH 4L5QA 5GADC 1IXRA 4LF7L 5ELOA 4YHHQ 1FJGQ 4HJ7A 1BBUA 5M3FG 3HOXH 4A3FH 1Q82C 1VQ9A 3AEVA 3RR5A 3UDFA 4QL5A 3RZDH 4DV1Q 4DK6C 1C0AA 2I5HA 5ELNA 3ZJYC 4DKAC 2LXJA 1I6HH 1DGSA 2AMCB 3ULPA 1YI2A 3A74A 3S2DH 5FLMH 4UPAA 1WI5A 4MTNA 4POFA 3A5UA 1HZBA 3STBD 4GNXB 4BBSG 2GVBA 3K0XA 3TEHB 1U0LA 4B3RL 1GKHA 1L1OB 4LFAQ 3GDEA 1SFOH 4R4QA 5BR8L 3HOVG 2E2JH 4PZ6A 4JI2Q 2R92G 1HNZQ 2CWPA 2Q2HA 3KDFA 5IT9c 4O2DA 3U58A 1XMOL 1Q81C 1UEBA 4AH6A 4IFDG 3ULJA 4A3BG 4DR5Q 4JI1Q 3CCLA 3E9HA 1VQ4A 1VQNA 4JI6L 2DUDA 1MKHA 4KHZA 4R1JA 3KF6A 1N36L 3GTOH 1A63A 1GD7A 1MJCA 1VQIA 2GVAA 3NELA 2HT1A 3STBC 3CMEA 2ALYB 3H0GH 1Q7YC 1IBLQ 3I4NG 2PI2E 3FKIG 1HNWQ 3GTJH 4A3LH 1AE3A 1HR0L 3S1QH 3DM3A 1V1QA 4C2MH 2Q2UA 4ALPA 3CAMA 1QZHA 4BY1G 1OXSC 1VQCA 2KHIA 3H15A 2VW9A 2JA5G 1LTLA 3S15H 3GTMH 1XMQQ 2WP8J 3CC7A 2VUMG 4QQBX 2Z6KC 3M4PA 2Z0SA 5GQOA 5IYBH 2GN5A 1XNQQ 4UP8A 1S72A 2OWOA 1GVPA 4KLKA 4DV3L 2UU9L 4DV0L 5M5WH 1NBWA 4BY7H 2VY3A 3CC4A 2XGTA 4Y52H 2E5LL 1IL2A 2I5LX 2UXCQ 3S2HH 1KRSA 1UE5A 3G6EA 4JI5Q 1B7YB 4LUVA 4JBKA 1M90C 5FLXc 3GTPH 2VZAA 3TS0A 2UUAQ 3BZKA 2R93G 3U50C 3PSIA 1Z47A 1VQJA 3EIVA 3GO5A 4IPDA 2IHEA 4DUYL 2YTXA 3T1YL 1TWAH 4PG3A 4X65Q 1YHBA 2VQEQ 4JI0Q 4LF4L 2Y0SE 4DAMA 1VCIA 3HOYG 4TQUS 2QA4A 4AQYL 4YWLA 4NXNQ 2CQOA 1PYSB 1WOCA 4LUOA 4K0KL 4OONA 1N34L 4LF5Q 1T9HA 1YJNA 1PFSA 2ZJPA 2R7ZH 1RL2A 4JV5L 4PZ8A 4KHPQ 4AYBG 5FJ8G 1E7ZA 2JQOA 3KOJA 3HOWG 1HNXL 4NXMQ 4A75A 2B3GA 4IFDJ 4HJ5A 2JA8G 1VQLA 1S40A 4B3TQ 1VQGA 4UP7A 4BBRG 3I55A 2NVXH 4JOIA 4GKKL 4DR4Q 1YIJA 1Q46A 5LMNL 1J5EQ 1PH8A 1N32L 3RN5A 2JEAI 4DR6Q 3CCSA 1VQBA 2K5VA 2D0OA 3K80C 2Q2IA 1PH2A 4YHHL 4DV4Q 1FJGL 4LF8L 1CSQA 1KQSA 1XNRQ 5C4JH 4JYAQ 2IT1A 3E9IA 1Q1BA 3G71A 3PO2H 4GKJL 4X64Q 3KJOA 4A3CH 2YYZA 3WWVA 3TRZA 4A3DG 4DV5Q 2LSSA 2RHQB 3KDFB 1K83H 2PNHA 4TVAB 5IYDG 3F2BA 1R9TH 1VQ5A 2N49A 3A5ZB 4JC0A 2XTIA 1QVGA
chains in the Genus database with same CATH superfamily
3VA7A 3KBGA 1SNMA 4CDDC 1PTOC 3LWUA 5J3BA 5IP9H 4JI2L 5C44B 1IBMQ 3SK5A 1TWCB 3K5LA 4A3KH 2PQAB 2PMZB 4FXGC 1CK1A 1ML0D 2NN6G 4BY1H 4KKUA 3ERQA 2YU9B 3Q24A 5C4XB 2AUJD 3K8AA 2UUCQ 2HDLA 2AQ2B 1QVCA 1HNWL 1IBLL 4DV6L 2A68C 4OO1I 5ELBA 4JI8L 1GUWA 3H09A 2CCZA 3RZOH 2JN4A 4C3HB 1LV9A 5I2XA 1HZCA 4LF9Q 3CHBD 1LTID 1M1KC 5EJWA 1FGBD 2HHHQ 2SEBD 5HURA 1KAAA 3BDCA 1EY9A 1ILQA 1E1TA 1EWCA 4ME5A 3KLSA 3L7ZC 4NKLA 4LK1C 2UXCL 1NR4A 1DONA 4JI5L 4DR7Q 2AQ3B 2QGQA 1UE7A 5E1FA 2L9HA 4BXXH 3S1MB 3S2DB 4JI3L 3UDGA 3J80i 1Q3LA 3CU7A 2AWOA 1F2MA 1STEA 4GN3B 2UXDQ 1E3PA 1F2YA 2MO1A 2CVRA 3L2PA 5I6YA 1SLJA 1JB7A 3I4MH 4KKSA 1WTRA 2F0QA 4LF5L 4GOPC 3OTOL 1SEBD 3JAML 2E75C 3SEBA 5IY0A 3GTOB 3KLSX 3E0EA 1TY2A 2F3IA 3H0GB 3OIQA 3JAME 1QG7A 2IWHA 5CBAE 4XTCS 1A62A 4C2MB 3LNNA 1E22A 2ZXPA 4O0AA 1AE2A 2L5TA 1FVIA 1H9SB 3KF6B 3BS1A 3S15B 1WYDA 2A6ED 1X3PA 2VNUD 1I4QA 1PTOB 1GHKA 4QUCA 3A8IE 5FLMG 4UHVA 1SE8A 1V9PA 4X62L 1IW7C 3HEJA 3MFYA 1L0XB 2F4VQ 1EUJA 1BCPB 3FHWA 5M3FH 4FF1A 4G7HC 1CM9A 3KLRA 2EJFC 1QUQB 1K9MC 2SNSA 5FO7B 2KQ3A 2O5IC 3GTQH 4QY7A 4A3EB 2PYKA 5JJLA 1LUZA 4ODGA 2UU9Q 4C3JG 3PUXA 3W2DA 1PH1A 2YTYA 3MVVA 2K7VA 3L3OC 2EYFA 1EEID 2PCFB 1V8QA 1CUKA 3SHLA 2KCMA 4C3IH 3UDXA 3K5NA 2RCNA 2E2HH 3I4NH 2J4XA 1UUPA 3NWSA 3FKIH 2PZTA 3F2UA 3VR5A 3PUVA 4DR1Q 1X54A 2NVTH 5C4JB 3CW2C 4PMWA 2WV6D 1X3FA 4IZ8A 4CHTB 1BKBA 3EN2A 2VB2X 3DLLA 4G7ZC 4GLAC 4JV5Q 1AP0A 1KHIA 3OYYA 3RLNA 4XXEA 2XNAC 4DK3C 3CPWA 4CDCC 4ME3A 2EJMA 4GKKQ 1E2ZA 2QDLA 2R7ZG 2EYHA 1WTVA 2R7DA 3MEFA 1PZJD 1TXYA 4LF8Q 1EY7A 2RDGA 3QJYA 3AQQA 3K7AB 2K4KA 1UE6A 1WJJA 4GKJQ 3IAYA 5I4DA 2BH2A 3A8KE 3MXNB 2MO0A 2UUAL 2FXQA 3L0OA 3HKZB 4CKCA 3TBIB 2JA7H 4QJFA 3T1HL 2F0PA 2NYZD 5FJ8H 4A3CG 1ENAA 3I7FA 1I50B 3GQBA 1EZ6A 2NTSA 4DFAA 1OTCA 2H1EA 3FMCA 3QG1A 3UE1A 4FYDA 4NXNL 4EX5A 1W6JA 3J80L 5GAGC 4HIOA 2F0MA 3BVGA 4KD4A 3NENA 5CBEE 3CPFA 1KNAA 3QOJA 4R4OA 2UXBL 5JEAJ 1N9WA 3J80E 5IP9G 3X3MA 1VQFA 5L37A 4A3KG 4DV6Q 3I4OA 3G7LA 1YITA 4JI8Q 1ZKOA 1EZ8A 1TS4A 2XSCA 1NUCA 4DR4L 4AYBB 5IYDH 3HOWB 4DUZL 3VDYA 2ID0A 2WINB 1Z6HA 2Z8LA 4LF6L 3A8JE 1UWVA 1L0WA 1UEAB 5EPKA 1C9OA 3IRBA 3H3VC 3I56A 1O7ZA 3NEMA 5IODA 4X64L 3D8GA 4GNXA 1KL9A 3CCMA 5FK9C 1L1OA 2QKIC 3GTGH 1L0YB 3GTKH 1O7IA 4ZRZA 1EYDA 3RLFA 3PIPA 4JI3Q 4DNTB 4EQ5A 3OHXC 2OQKA 2WB1B 4R4TA 4ZAIA 2VQFL 3S1RH 1PXUA 2ZJRA 3BVZA 1JJCB 1ET6A 4N8FA 2R61A 4A3JH 1WD1A 1PFBA 1N33L 2ES2A 1RKNA 2O5JC 3OTOQ 1A8VA 4BXXG 4FXDA 4FO2A 3CCRA 5LL6X 2AKWB 2MQHA 3H91A 2KA7A 4R8IA 1G51A 3HOZH 1VQKA 4OO1H 1JOQA 3I4MG 3MC0B 3CXCA 1K3BC 4GLXA 4NB3A 1PDQA 4P2CB 1I5FA 5LMNW 3PV0A 2Z6BA 3OMCA 3TREA 4BBSB 4R4CA 3NQTA 5M5XB 2MJ8A 1BCPD 4X62Q 1E0BA 1OXTA 3UDIA 5C4ZA 1N8RC 1FD7D 1Y1VH 2NVQB 1MIUA 1B8AA 1LT4D 1EL0A 2WFWA 4ULLA 5C3WA 4WORA 4JI4L 4ZK9B 3OOCA 2K52A 1P16A 2EXDA 3AB9A 1A2TA 3SGIA 3KUPA 1QB5D 1EYGA 1JWUD 4LF7L 5ELOA 1BBUA 1GUTA 5M3FG 4OIKA 2F4IA 5JVG3 3RZDH 3VR3A 4OEMB 2LXJA 1ZYRD 2VUMB 2CW0C 2AMCB 3ULPA 5KNBA 3A74A 4POFA 3R2TA 1O78A 1U0LA 1TIID 1SFOH 4R4QA 3K5OA 3TZDA 3D3RA 1TWGB 3U58A 4O2DA 1UEBA 1MSHA 2K04A 1NAPA 5FLXL 1YNNC 3I73A 3S14B 4JI6L 1SYBA 1II3A 4C3IG 3HRZC 3R3OA 4J8QA 4ZKBB 1MJCA 1A3UA 4DF7A 5FLXE 2HT1A 3MXGA 3CMEA 2ALYB 3T13A 3I4NG 3FKIG 3GTJH 2EZVA 5ISRA 2I46A 4A3LH 4H7BA 1HR0L 3ZYYX 5A2QL 4KK7A 3CAMA 2NBFA 3T56B 3C46A 1OXSC 2QCPX 3H15A 5FO9B 1TR5A 1XMQQ 2JA8B 3LWEA 5A2QE 2GN5A 2F0JA 1GVPA 3A56A 3EFXD 4DV3L 4BY7H 3CC4A 1SMYD 3GTLB 1KNEA 4EQNA 1UE5A 1IW7D 1F9SA 1M90C 2VZAA 2UUAQ 3BZKA 4C3JB 1SNPA 3PSIA 1HTPA 3G6JB 3GO5A 4DUYL 5EBDA 4F7XA 3T1YL 1TWAH 1QILA 1HA6A 4LF4L 2M9VA 3GTMB 2SDFA 1H9KA 1VCIA 4NXNQ 4AQYL 4YWLA 2EY5A 4K0KL 3V2TA 3S16B 5M5WB 5CV9A 1I4HA 5FJ8G 1E7ZA 2JQOA 3KOJA 5DAUA 4RA8A 1DOMA 1VQGA 4ZQ3A 3VR4A 4DR4Q 1YIJA 1JOKA 1PH8A 1N32L 2JEAI 2FFKB 3V05A 2A6HC 1VQBA 4HMJA 2WKCA 4KN7C 4Q0FA 3URYA 4DV4Q 1CSQA 1ET9A 3U9OA 3EROA 3G71A 3PO2H 3DMUA 2QDBA 4X64Q 2YYZA 4DAYA 2LSSA 1R9TH 5IYDG 3F2BA 1TWFB 2F0HA 4IUTA 4QIWE 1STHA 2WAQB 1Y8PB 4NP5A 2VQFQ 3HZXA 1FGUA 1S4ZA 4DK1A 2L0CA 3SK6A 3TDQA 1K3RA 4BA2I 4C1NK 1Q90A 2L4NA 5C3EG 3U4ZA 1N33Q 1EYCA 3J7YW 1BF4A 3D31A 3S17H 2RBMA 3O13A 2F0NA 4K5XA 1XPRA 2Q8TA 2QF7A 5J1ZA 3D4DA 3PUZA 5COYA 1B50A 1TWHH 1G2SA 1KDAA 2HIXA 2BOSA 5M3MB 5IP7G 4A93B 3CCQA 4A3JG 1CFMA 1CT1D 2EY6A 2G9HD 4JW0A 4LW1A 4LFBQ 3GV3A 2Z9HA 2F0VA 2RSOA 1X3QA 3VYRA 2R93H 3E6ZX 3HOZG 1K0RA 4OO1G 3PO3H 1PYWD 3AU7A 4FF2A 2F0EA 1HZAA 3KYHC 3L9AX 1D8LA 4P71A 1U9RA 2ZTEA 4IPCA 1IBKL 2AHOB 1C7YA 1AH9A 1JICA 2JE6I 4QGUA 1EIYB 4JI4Q 3CQZH 4L5TA 3JAMi 3QB3A 3A0JA 5DLQE 3F2DA 1X65A 1HRJA 5HGTA 1SNCA 3C2PA 4A3MG 1Y1VG 2DJGC 2OCEA 5EPLA 1STGA 3OW7A 2NZHA 1H95A 4LFCL 4RCNA 1LTSD 1WTOA 1KD1C 3HOUH 5CV8A 2B29A 4AIMA 1U4LA 1LM0A 4C1NI 2DN8A 3QO2A 2ZTDA 4OWXB 5KYLA 1G6PA 2AWNA 4PZ7A 3S1QB 3Q23A 4A3GH 4XYOA 2F3VA 2B2TA 4DXGA 4CDFC 5GAHC 1Y1WH 1TY0A 1ICWA 1OO9B 2NUCA 2R6GA 2HQLA 4B3SL 5GROA 5IGCA 1S5CD 4C56C 3ND9A 2DJFC 3FPUB 4JI6Q 4GNXC 1L1OC 4DNRB 3DWPA 1STAA 1H9RA 3S2HB 4DR3Q 3HFZB 1SE2A 1KLGD 2O4XA 3JAMc 1GUSA 5DM63 4P72A 3F2CA 3PQIA 3U9SA 2JK8A 1X6OA 1E24A 1HXYD 1I6VC 1NMGA 1BUVT 1YNXA 3J81i 5E4XA 1CKMA 1EFWA 1I4GA 1GM5A 1KDCA 3CCUA 2JYOA 3HOVH 4UY8C 3RNUA 4DV1L 4TKOB 1JCKB 1D7QA 3Q6SA 3TSSA 4XDXA 3BZCA 4A3BH 2F0DA 2MUYA 3I72A 3I70A 1YEZA 2MP1A 2L15A 2K1BA 2OF1A 4DUYQ 4LFAL 2NVXB 3T1YQ 4RCOA 2FINB 4BY7G 5JAVA 1AEXA 1JMCA 4LF4Q 3GTQB 2MNAA 4CGYB 4K8JA 1EOVA 4AQYQ 1UAPA 3KF8A 4K0KQ 1JQYD 1PZID 3S1NH 4GN5A 2N78A 4IUUA 4L63B 3K6OA 4Y52H 3RLOA 1SJED 1K83B 4IPGA 2TMPA 2K75A 4Y7NH 3J7A5 1PH3A 1WCMG 1X56A 2WKDA 2E2IH 2NWGA 1Q86C 1UE1A 1GOZA 2K05A 5IGBA 1EU3A 5C0XI 3H6MA 4PQXA 1N32Q 2N8NA 3QWNA 2E2HB 3NBHB 1BQQT 4GLVB 4A3IB 2BA1A 3VR2A 4R4IA 1XNQL 4ILWA 5KGUA 1WTPA 4IUVA 4EVOA 4FP5D 1KAWA 3D6WA 3SE0A 3M7NA 1T5EA 5M5YH 3W5OA 4RMFA 1EWIA 4CJ1B 1HFNA 2F0WA 2LFNA 3PO2G 1Q8KA 3PUWA 2J7ZA 2KBNA 1S5ED 3AFPA 2CH4W 4I65A 1K8MA 1HPCA 3NE5B 2EQSA 2F52A 3J7AV 1KDBA 3KK7A 1I4RA 5M9OA 1A3VA 2X69A 1JT8A 1YNJD 1PH9A 2JA6B 5BN5A 2M2LA 4B3TL 1JJGA 4A3DH 1A3TA 1RIPA 1QOHA 4N8X1 3HOXG 4YY3L 1STNA 1J5EL 4Z9CB 4MHEA 1G8ZD 5D3IB 2DNCA 2IX1A 3LGJA 4JYAL 1O7LA 2EYLA 2QILA 3P75A 4X66L 4DV5L 3LX0A 3DWQA 3ERSX 1JJ2A 2LMCB 4FDBA 3DHQA 3J80c 1OXXK 3BU2A 1IBKQ 2D0PA 4YCWA 3VYSA 4JBMA 4NDXA 4KY7A 4GN4B 2B63H 3PO3G 3NQIA 5KRUA 3MZ5A 2PMZE 3Q8DA 4YCUA 4DAPA 4JI7L 1CKNB 3S9WA 5JJIA 3AYHB 1JC7A 1Q1EA 1EEFD 2DNEA 1PRTF 2UUBL 4LFCQ 1JWSD 4B9XA 1IKMA 5C3EB 4DV0Q 3J81L 3PCOB 3GTKB 1AW7A 4GS3A 1SRUA 1I3QB 3HP3A 5AJ3L 4DV2L 1ICFB 4X3KA 1W3SA 3J81E 5E3FA 5C44H 1TWCH 2N55A 1I94L 4A3JB 5CYUA 3G4SA 1ENFA 3OSOA 1FNUA 3ER0A 3HOUG 3F8TA 4KTAA 4B3SQ 2JEBI 4UDUC 2YU9H 1D1IA 5C4XH 4A3GG 2R92B 1CI3M 2NN6I 1Y1WG 5KNCA 1NMFA 4GOPB 2HDMA 1TS5A 5IOCA 1U4MA 2IY5B 1XTCD 3EJIA 3SK4A 4O1NA 4C3HH 1PRTC 2NTTA 1WFQA 2ZM6L 1U4RA 3NTHA 1IXRA 4K5VA 3E5SA 1FJGQ 4YHHQ 4A3FH 1VQ9A 3AEVA 3UDFA 4QL5A 1RDPD 4DV1Q 4FF4A 3M3YB 4NW2A 4A3MB 1F9QA 1DGSA 4KV6A 1Y1VB 2N88A 1CA6A 3S2DH 4X3SA 4BS9A 1M4VA 4MTNA 2IPKD 3TEHB 4CBVA 4B3RL 4ID6A 4LFAQ 4YIJA 5BR8L 3HOVG 4PZ6A 4JI2Q 2FMMA 5C3XA 4JVZA 3KDFA 1XMOL 1Q81C 5ELDA 1Y8NB 4AH6A 4K6LA 4IFDG 4A3BG 2QW7A 1ZXTA 1RODA 5LHY1 1A63A 4R1JA 1N36L 3GTOH 3NK9A 4M1UB 2B39A 3HOYB 3T16A 3STBC 1HNWQ 1FNWA 1XXGA 3H0GH 4OIJA 2PI2E 1E2VA 4QUFA 1IBLQ 1AE3A 3DM3A 3QR8A 1KTKA 1V1QA 5EQ0A 4C2MH 2Q2UA 4ALPA 4BY1G 1VQCA 2KHIA 4K14A 2VW9A 3S15H 2OXPA 4K2KA 2WP8J 3V96A 3M4PA 4OL7A 5IYBH 1XNQQ 1JOOA 2RCFA 3MXPA 1S72A 5C5LA 4BBRB 4ZYSA 2VY3A 3E3XA 4XT3B 2I5LX 2UXCQ 3NHHA 3ND8A 1HFGA 4JI5Q 2A69C 2D9UA 2LS01 4CKEA 4LUVA 5FLXc 2SNMA 3TS0A 5T1GA 2IHEA 3P1HA 2YTXA 4FVMA 1HQMC 2B2TC 1RTNA 1MBYA 1MGSA 1SNOA 2Y0SE 2CQOA 4LUOA 1LO5D 1PRTB 1N34L 4LF5Q 3I8ZA 1YJNA 1SDFA 4BY7B 2ZJPA 1D5MC 3K57A 1RL2A 2BDNA 1LT6D 1HNXL 1ONLA 1DJRD 4HJ5A 1S40A 5ELCA 4B3TQ 4UP7A 3I55A 1Q46A 1LT5D 5C0XH 1J5EQ 2B2WA 3I91A 1PTOD 3I3CA 1WCMB 5CV6A 5C4JH 4OGQC 4PMBA 4JYAQ 1Q1BA 5FKAC 4DU9A 2TSSA 2NZ1D 5IIFA 3KJOA 3NUCA 4A3DG 1STBA 4DV5Q 2RHQB 1GXDC 1X32A 2BE5C 1CZGA 1H9SA 3KF6A 3DM1A 2HCIA 3HKZE 5GAEC 2A68D 1LT3D 1SYFA 5LMUL 4K2LA 4A4IA 4KY6A 1NE3A 1B70B 3SDZA 4JI7Q 1C48A 2G5DA 1SYCA 5JPMC 4JI1L 1BVSA 3W3AA 1VS0A 2PI2A 2UUBQ 4IJLA 4POGA 2K5HA 1QUQA 1VQ6A 1Z9FA 2RF4A 5HY6A 1YZ6A 3HGBA 1SROA 4L6TB 5DEHA 1SR3A 5AJ3Q 4DV2Q 5EKKA 5I6WA 1YHAA 3PIP3 1X9NA 3BJUA 1DOKA 1I50H 2Z4HA 3K7UC 2LKVA 4I7AA 3SR1A 2E74C 2JSOA 4IUPA 3S17B 4HSPA 4RGMA 3Q0AA 1IYVA 5C5MA 3HOXB 4J15A 4RGOS 3BYTB 3N6RA 5IGDA 1PA6A 5CV4A 5G3LF 1EY5A 2HCCA 2WB1E 1LYLA 1NSNS 2RDFA 4DN4M 1HZ9A 1YVCA 4A76A 2B2UA 1HQRD 2EPBA 5D14A 3HKSA 2ZM6Q 1XX8A 2KCNA 2EOTA 3GTPB 4EQPA 4YWKA 1OXVA 1B3AA 4LNQA 2PO4A 1B9MA 2K6AA 4KHPL 1J8IA 1PFNA 2OQ0A 4C3HG 1ASYA 3PF5A 4NXML 2K33A 3OPOA 1S5DD 1H9MA 5IWAL 3WOEA 2K5WA 5D65A 4A3FG 4B3RQ 2IX0A 4DR6L 3CQZB 3T1HQ 2ICEC 1NY4A 4JCVE 4OWTB 1GHJA 1K8AC 4FF3A 2F0SA 3BDLA 3CCEA 1XMOQ 3MXNA 4RWSC 2UXBQ 3U4VA 1XPOA 1DOLA 1N36Q 2X6LA 4U68A 2JA7G 3PIOA 1RF2D 2KHJA 2FMCA 2NN6H 4MZ9A 4XT1B 4HJ9A 5H1SE 2K32A 3BDOA 4XYQA 5IGGA 1YHQA 1LTBD 5JJZA 1JE4A 2RDHA 3I4LA 5JVH3 2ENBA 2KJXA 2A6EC 4DUZQ 4LF6Q 4XQNA 2BH8A 2V1CC 3IFDA 3IL8A 4BBSH 2RQXA 1AZQA 3H0GG 4DPGA 1VQEA 5M5XH 1QNKA 1XWEA 2UUCL 1WTQA 4LUZA 2R7ZB 1K0SA 3K81C 5JOBA 4B9WA 2IHFA 4YCVA 4IALA 5DNFA 1EYAA 1DCZA 5BN3A 5IYBG 1JWMD 3J7ZC 1X3GA 1SYGA 5E4WC 1HNZL 2HHHL 2XRSD 2OTLA 2F0UA 4L5RC 3K0YA 4WJ3M 1F2ZA 1Y14B 4DR5L 4HIMA 5KNDA 2NZOA 4TSSA 1N34Q 1JB3A 2EE1A 4I7ZC 1KC8C 1ASZA 1PFMA 2JA5H 4DR7L 2HIVA 2VS1A 1PVOA 2VUMH 2I5MX 5FO8B 1NCVA 1HNXQ 1LTAD 1K73C 2UXDL 2LXKA 4HCSA 3T53B 5ELFA 4IO9A 1GUGA 4OHJA 5HGQA 1YBYA 4CJ0B 4A3KB 3NXWA 1EQTA 3KLWA 4KMUC 2E8GA 3S14H 4BY1B 2Q8RE 4WRDA 4V190 3MA2B 1PZKD 1B53A 5C0XG 4Y7NB 4MN3A 1OXUA 1Y8OB 1J6QA 4F88A 1RCVD 2OEOA 2DGYA 2Y0SG 3CCVA 4P73A 1RTOA 4IQZA 3RZOB 3WOFA 5LMUQ 1BBWA 3G48A 2N3SA 1DZ1A 2CQAA 1G291 2JA8H 4PNYA 3OWFA 1QCBD 4EGVA 4XQQA 4LF7Q 4J1MA 1ESFA 3MEHA 3GTLH 2C9OA 2A5HA 4KY5A 2F4VL 2F0FA 1SN8A 2F0IA 2Z1CA 4P75A 2ZJQA 4YWMA 2ASBA 2KCTA 2PQEA 3CMAA 4C3JH 1MSGA 3DWAA 1FNVA 2I0QA 1HR0W 3TN2A 1VQOA 1AFPA 1SMXA 1TKWB 1R4QB 3D6CA 1A2UA 2NVYH 1MHWC 1QVFA 1XNRL 3I4MB 3IFTA 2G9DA 3TP6A 3VYUA 3S16H 3HKZG 4L5SA 3PGZA 2H4OA 1GUNA 1B9NA 4CJ2C 2IL8A 2WAQE 5EPJA 4ZLTF 2F0OA 1K8OA 1EWHA 1HR0Q 4A3DB 1SE4A 4QB4A 2L55A 2PW7A 5IE8A 4JBJA 4DR1L 1HTLD 2HUGA 4ABNA 5CMDA 1XJVA 3FEWX 2EYJA 4A3LG 5I9PA 1VQAA 4DV3Q 1SYEA 4HTHA 1EY8A 4WJ4A 3S24A 3SK8A 3E0JA 2NB0A 2KCCA 2ZTCA 1TWFH 1JE5A 4PMCA 5IWAQ 2B2VA 4HR7B 5M3FB 3ONAB 1W2BA 2ATWA 1KXLA 4BA1I 1WD0A 1F2LA 2OT2A 2RA4A 1S5BD 2YV5A 2EVBA 4EQOA 4HSVA 1Y69U 1EOTA 4RGTA 1HA5A 2WB1G 3NPPA 2K28A 3J81j 4MIUA 1E2WA 5M3MH 2K50A 4A93H 1KRTA 3AFQA 5IT9L 2FJ2A 1VQMA 2CW0D 2X6GA 2A73B 4P74A 1YJ9A 2PW5A 2EYPA 4C3IB 1HUMA 2CH4A 1B2TA 1I4XA 3J81c 3R8BA 5IT9E 3I4NB 3FKIB 1PH6A 3M4OH 4L5QA 5GADC 1LABA 1Q82C 1BCPC 1CZWA 1O7YA 2NVTB 3MWYW 3RR5A 4PV1C 1YNND 4U673 1F9PA 1C0AA 4ZCKA 5ELNA 3ZJYC 4DKAC 1I6HH 4B08A 1YI2A 1WI5A 1HZBA 4NMZA 4GNXB 4H13C 4BBSG 3K0XA 1SYDA 3RMHA 1CHPD 1GKHA 1L1OB 3GDEA 2ZXOA 4X3UA 2E2JH 1HNZQ 3MHBA 4S3SA 4DR5Q 4A3FB 2CHBD 4KJNA 3MAQA 3EVQA 1ZYRC 4KHZA 4H44C 2D5DA 1CHQD 2GVAA 3NELA 1Q7YC 1NNXA 2KUMA 1O80A 1NR2A 3S1QH 1B4OA 3VYTA 1QJOA 1BR9A 4ZUJA 2JA7B 3CKIB 1EU4A 2B2UC 2JA5G 1DM0B 4N9TA 2VUMG 1C4QA 2Z0SA 2MHVA 2OWOA 2XRQD 5G3LD 1NBWA 5JEAH 2E5LL 1W6KA 3S2HH 1KRSA 3G6EA 1B7YB 5K5PA 2B2YA 4JBKA 3T51B 2O2LD 2R93G 3U50C 2IX3A 1Z47A 1VQJA 1AN8A 3TZUA 2EY2A 4IPDA 3R2IA 1QE6A 3BYYB 5C4HA 3WDNA 4R8NA 2IJ0A 1SJHD 1G91A 4TQUS 3NSWA 2A6HD 1PYSB 1WOCA 1WTXA 5JPNC 1SMYC 3NTIA 5T1IA 4HAEA 3J7AF 1Z7TA 3T4AC 3GTGB 1GJXA 2EYOA 4G57A 4HEDA 4IFDJ 2JA8G 1VQLA 2RSNA 2L11A 3S1RB 2NVXH 4M8AA 4JOIA 3OWEB 5LMNL 4Q5VA 3RN5A 1RD9D 3A55A 1G2TA 2EYMA 3CCSA 1T5XD 2K5VA 2D0OA 1U4PA 3K80C 1HUNA 2Q2IA 1PH2A 4DAVA 1XNRQ 2F1MA 2IT1A 3E9IA 4DXFA 2HQEA 1A6XA 4G4KA 3WWVA 3TRZA 1B3QA 4L8JA 1SNDA 4K8IA 1AZPA 1K83H 1JR0D 2PNHA 3CRKC 4IURA 2N49A 5A35A 3A5ZB 4JC0A 3HOZB 1BXTA 4DR2L 4G7OC 4A3IH 2K14A 1B44D 2Y0SB 1BBXC 3RUZA 2JP1A 5CC4A 1EY0A 3CF5A 4UP9A 1F9RA 5J39A 3K58A 1LTTD 2ZXRA 5J22A 5EAYA 1BOSA 5NUCA 2F0TA 1JORA 3S1MH 1FYCA 3NTKA 3VA5A 1V1PA 4K5WA 2Q2TA 4OX9L 1A0IA 2F0GA 5EBCA 1XMQL 4IOAA 3F1ZA 3HG9A 1LACA 1NJIC 3W1BA 4GZYC 2BA0A 3Q22A 5D3DA 1X3EA 2HD3A 2WAQG 3CP0A 5LL6S 4IJHA 4JBWA 4X6AH 4LAAA 3RN2A 1IL8A 3RZDB 1PLFA 4DNIA 1U5KA 2PZWA 4MTKA 2JA6H 3H3VI 1KLUD 1GO3E 1LLRD 1HH2P 3EBEA 1RJTA 2PQAA 4O42A 3TP7A 3JC66 3TMEA 5I2YA 2KEDA 2CFMA 1UNSA 1TT2A 1VQHA 2XWJB 1SFOB 4X3TA 3CD6A 2VL6A 2A8VA 2Z6KA 4A93G 5M3MG 5IYCH 2K5NA 5K36H 1PTOH 5KEEA 2PPBC 3KJPA 2BDOA 5DM73 2R7FA 2JXMB 3W1GA 4TRDA 1VQDA 4OXPA 4F8MA 4JPBW 1V43A 3NBHA 2D2CC 4QCLA 4XQJA 3GTJB 2XIWA 4BWGB 4DAYB 4APVA 2AQ1B 2PZUA 3P20A 3EA6A 4QMGA 1VQPA 4DV4L 1VDZA 1FL0A 3C1EA 4A3EH 1B1ZA 4WJWA 1SSOA 2CWAA 2JA9A 3FP9A 2FHTA 5C3EH 2K03A 5I9OA 2VXWA 4DV7L 3ICEA 5KIXA 3BG3A 1I3QH 2A74C 2B8GA 1EQVA 4B3ML 1X55A 4IOCA 4ZKCB 1FR3A 3UI2A 1DXMA 3B6YA 2GA4B 5IP7H 1ZEQX 5JJKA 1D1KA 5CV7A 4DGZA 1TWAB 4YY3Q 2EJGC 1VQ7A 4OELB 4LMQD 1H9JA 4HCEA 2JJQA 3CC2A 1S3OA 2R92H 2E5LQ 5EGTA 4X66Q 1PHJA 4UAIA 1MJEA 1LTRD 1HCZA 2B2VC 4HJ8A 4ZUIA 4H02A 5C6AA 1EIHA 1D5XC 4LFBL 1VF7A 2I07B 3M9BA 1XPUA 2KHSA 2C35B 5JEAG 1PYBA 3NBIA 4XIGS 2XVSA 1A15A 2DY7A 1D6EC 4HIKA 1Q12A 3K7AH 3PO2B 1IYJB 3NWTA 4RKBA 2E76C 2KECA 3D0FA 5EKIA 1VMPA 3CCJA 4RH6A 3M3YH 2F0KA 4WFN3 4A3MH 1R9TB 1QNUA 2B63G 2OTJA 3D4WA 1G6ZA 3FVQA 5ELEA 1CKNA 4IN3A 1CA5A 4AYBE 2KENA 5LMNQ 3VR6A 2V4DA 1PH5A 1I94Q 4IPHA 3MXUA 3QIAA 1KIXA 2YTVA 4IUQA 4LJZC 2K01A 2CKZB 4CKBA 1SE3A 4RGNA 2XWBB 1EY6A 2JA5B 3OIPA 1VQ8A 1TWHB 5KYIA 4IFDI 3DUZA 3HOYH 5C44G 4QIWB 1K8GA 4DR2Q 1E1OA 1TQOA 4MNOA 3RD4A 3TP5A 2EDGA 2F3WA 3HOWH 2RKSA 4JK1C 4X65L 4FXKC 1IZ6A 5C4XG 2VQEL 4JI0L 3FPPA 2D62A 3SXHA 2R93B 4GOPA 1HHVA 4RAUC 3D4RA 4BBRH 2F03A 1CSPA 3I90A 3PO3B 2MFIA 3BVMA 3GV6A 4V0BA 1IYUA 4DR3L 4A3IG 1QZGA 2K5QA 2ZT9C 3C1FA 2IW3A 1EQQA 2Q8IB 2EIFA 2P5ZX 2MGSA 1ILPA 2A1AA 2XN9C 3AMUA 3UE0A 4OX9Q 5BR8Q 1TS2A 5E7NA 1EIFA 3OW2A 3NP8A 4RKLA 1P8LA 4DK0A 1NTGA 5IGFA 2WIIB 1YNJC 1CKOA 2EXZA 2KOLA 1SAPA 4KHVA 3DEPA 3HOUB 1HJPA 1D2BA 3KF8B 1EY4A 2B2YC 3C3LA 1BO0A 4A3GB 2B8FA 2RVLA 1PH7A 2K5DA 1IBML 1Y1WB 5C0XJ 1V1OA 1CTMA 1WCMH 3M4QA 2NVYB 1F77A 1WTHA 3MFGA 2JA6G 3GD7A 3TQYA 1CQFA 4QF4A 5IGEA 3PF4A 4KD3A 2E2DC 3TS2A 2KVMA 1YJWA 1TU2B 4HIDA 1XTDA 1EQRA 2LY7A 1SBBB 1L2FA 2NVQH 5CV5A 5IYCG 4RG1A 5K36G 1PV4A 4LWCA 1RHPA 5CORA 4K6DA 1BNZA 3M4YA 4JOIC 2RHSB 5BN4A 2M00A 2H5XA 4LF9L 3M7GA 1PRTD 4KI0A 2KEEA 4HN7A 3HS0C 3HOVB 3K5MA 1BDOA 3EQLC 2A19A 3QOLA 3M85A 4NPSA 3H3VH 4DV7Q 3KFUA 4A3BB 1XYIA 4B3MQ 3H94A 4HJAA 2QEXA 4A3EG 1PH4A 2ICIA 3ULLA 5CGKA 4JG2A 4E6IA 4OWWB 2R3ZA 3I2ZA 3PUYA 3X3NA 4H0LC 1LTGD 4RFBA 1TWGH 2SOBA 3R93A 1S5FD 3BZDB 4HJ7A 1TVXA 3HOXH 3GP7A 1IKLA 1MD2D 3S1NB 1WTWA 4DK6C 3FRPB 1D5ZC 2I5HA 2AUKA 3PMFA 4RHRA 5FLMH 4UPAA 3PIO3 3A5UA 3STBD 2E2IB 2GVBA 1C8CA 3K59A 3A7AB 4HMIA 2R92G 1ESRA 2CWPA 2Q2HA 5IT9c 3GTPH 3M4OB 3CRLC 3ULJA 4JI1Q 3P7JA 3CCLA 3E9HA 1DD2A 3IKJA 1VQ4A 1VQNA 2EY1A 2DUDA 1MKHA 4N9PA 2WACA 3SVMA 3TP8A 1GD7A 4F87A 1I6HB 1VQIA 5M5YB 1IHZA 2A69D 1WVLA 4RHSA 4KJOA 1CQVA 1I4PA 1VMCA 5EKLA 1QZHA 1MI2A 1K28A 2E2JB 1LTLA 3GTMH 3CC7A 2DY8A 4QQBX 2Z6KC 2VB3X 5GQOA 4UP8A 4KLKA 3N52A 1KABA 1R4PB 2UU9L 4DV0L 5M5WH 2XGTA 4KN4C 1IL2A 1STYA 3DXJC 1ENCA 3EIVA 4R9WA 2PNRC 5AFWA 4PG3A 4X65Q 1YHBA 2VQEQ 2Z4IA 4KKTA 4JI0Q 1EFID 4DAMA 3HOYG 2QA4A 1GUOA 3MTSA 2L12A 4OONA 1PTOF 5CR3A 2MPMA 5FOBB 1T9HA 1EIGA 1M8AA 1PFSA 2C5CA 3ITPA 2R7ZH 1J9OA 3FDTA 4JV5L 4PZ8A 4IUNA 4KHPQ 1DYQA 4AYBG 3HOWG 4CDEC 4NXMQ 4A75A 2B3GA 4FNFA 3DEOA 1BCPF 2BE5D 5F2DA 5TSSA 3KBXA 1SXTA 4DA2A 1VF5C 4BBRG 1TS3A 2J0TD 4GKKL 2L1BA 2BCOA 2B63B 3A7LA 4DR6Q 4J6HA 2B2WC 3A54A 1FJGL 4YHHL 1V1PB 1KQSA 4LF8L 1SNQA 2QEJC 1Q8IA 4GKJL 4A3CH 3OMGA 2F0LA 3KDFB 1VQ5A 4TVAB 4IFDH 1PMRA 2XTIA 1QVGA 1QWYA
chains in the Genus database with same CATH topology
4QIWE 3HKZE 5GAEC 2VQFQ 1FGUA 4DR2L 5LMUL 4A4IA 5J3BA 5IP9H 4JI2L 1K3RA 1IBMQ 4BA2I 4A3IH 1NE3A 1B70B 4A3KH 5C3EG 2PQAB 2K14A 3U4ZA 1N33Q 4JI7Q 3D31A 3S17H 4JI1L 2NN6G 4BY1H 1BVSA 1XPRA 1VS0A 3CF5A 2PI2A 4UP9A 2UUBQ 3K8AA 2UUCQ 3PUZA 4IJLA 1TWHH 4POGA 2HIXA 2K5HA 1QUQA 1QVCA 1VQ6A 1HNWL 1Z9FA 5IP7G 1IBLL 2RF4A 3CCQA 5EAYA 1YZ6A 5HY6A 1SROA 4DV6L 4A3JG 4OO1I 3S1MH 1SR3A 4JI8L 5AJ3Q 4DV2Q 2CCZA 3RZOH 1YHAA 4LW1A 4LFBQ 1X9NA 3BJUA 2Q2TA 4OX9L 1I50H 1HZCA 3K7UC 1A0IA 4LF9Q 1XMQL 4IOAA 1M1KC 2R93H 3F1ZA 1NJIC 2HHHQ 3W1BA 2BA0A 3HOZG 1X3EA 2WAQG 3CP0A 1K0RA 4IJHA 4OO1G 3PO3H 4J15A 1E1TA 4JBWA 3L7ZC 2UXCL 4X6AH 3RN2A 1HZAA 4JI5L 1PA6A 3KYHC 1D8LA 4DNIA 1U5KA 4DR7Q 3H3VI 2JA6H 1GO3E 4P71A 1HH2P 2QGQA 2ZTEA 3EBEA 4IPCA 1UE7A 2AHOB 1IBKL 4BXXH 2PQAA 1C7YA 4JI3L 2WB1E 1AH9A 3UDGA 3JC66 3J80i 1LYLA 2JE6I 2AWOA 4QGUA 2UXDQ 4GN3B 1EIYB 4JI4Q 2CFMA 1E3PA 1VQHA 3CQZH 1HZ9A 1YVCA 2MO1A 4L5TA 3JAMi 4A76A 3L2PA 3A0JA 3HKSA 3CD6A 2ZM6Q 1SLJA 5DLQE 2VL6A 3F2DA 1JB7A 2Z6KA 2A8VA 5M3MG 1X65A 2K5NA 5IYCH 3I4MH 4A93G 4A3MG 4LF5L 1Y1VG 2OCEA 4GOPC 3KJPA 4YWKA 1OXVA 2R7FA 3OTOL 2NZHA 3W1GA 4LNQA 1H95A 4LFCL 1VQDA 4OXPA 4KHPL 5IY0A 1KD1C 3HOUH 2OQ0A 2B29A 4AIMA 1ASYA 3PF5A 4NXML 1LM0A 3E0EA 1V43A 5IWAL 2F3IA 2ZTDA 4OWXB 1G6PA 4XTCS 2AWNA 4PZ7A 4A3GH 1A62A 4A3FG 4B3RQ 4DAYB 2IX0A 4APVA 1E22A 4O0AA 4DR6L 1AE2A 3T1HQ 5GAHC 1Y1WH 1FVIA 1NY4A 3KF6B 4JCVE 4OWTB 1K8AC 2R6GA 2HQLA 1VQPA 4DV4L 1XMOQ 1WYDA 1FL0A 3CCEA 2VNUD 4A3EH 4B3SL 5GROA 5FLMG 2CWAA 2JA9A 3FP9A 5C3EH 1SE8A 1V9PA 4JI6Q 2UXBQ 4GNXC 3U4VA 1XPOA 4X62L 1N36Q 2JA7G 1L1OC 3PIOA 2KHJA 4MZ9A 4HJ9A 2F4VQ 4DV7L 3ICEA 1EUJA 5H1SE 3HFZB 4DR3Q 3FHWA 1I3QH 5M3FH 4B3ML 1X55A 1YHQA 3JAMc 4IOCA 4P72A 3F2CA 1QUQB 3B6YA 5IP7H 1K9MC 2JK8A 1X6OA 5JJKA 1E24A 4YY3Q 1NMGA 4DUZQ 1YNXA 4LF6Q 3GTQH 3J81i 2BH8A 2V1CC 4QY7A 1CKMA 4BBSH 1EFWA 1GM5A 1VQ7A 3H0GG 4DPGA 5JJLA 1VQEA 5M5XH 1LUZA 3CCUA 2UUCL 2UU9Q 3PUXA 4UY8C 3RNUA 3HOVH 4DV1L 2JJQA 1PH1A 1S3OA 2YTYA 4LUZA 3CC2A 2R92H 2E5LQ 1D7QA 3K81C 4X66Q 1PHJA 2IHFA 3BZCA 4YCVA 1MJEA 4A3BH 4HJ8A 4H02A 1CUKA 1YEZA 2L15A 4LFBL 5IYBG 2KCMA 4C3IH 3M9BA 3J7ZC 1XPUA 4DUYQ 1X3GA 4LFAL 3UDXA 3T1YQ 2RCNA 2C35B 5JEAG 2E2HH 1PYBA 3I4NH 1HNZL 4BY7G 2HHHL 4XIGS 1JMCA 3FKIH 4LF4Q 2MNAA 2OTLA 4L5RC 1EOVA 1Y14B 4WJ3M 3PUVA 4AQYQ 5IYDH 4DR5L 4HIMA 4DR1Q 4K0KQ 1X54A 2NZOA 2NVTH 1N34Q 3S1NH 3CW2C 4PMWA 4HIKA 4GN5A 1Q12A 3K7AH 2N78A 1X3FA 1IYJB 1KC8C 1ASZA 1BKBA 3D0FA 3EN2A 3DLLA 3CCJA 2JA5H 2HIVA 2VS1A 4GLAC 3M3YH 3RLOA 4A3MH 2VUMH 2I5MX 1KHIA 3OYYA 4IPGA 3RLNA 2B63G 2OTJA 2K75A 4Y7NH 1HNXQ 3J7A5 1PH3A 1K73C 1WCMG 1X56A 2E2IH 1CKNA 2UXDL 1Q86C 1UE1A 4DK3C 3CPWA 2LXKA 4ME3A 5C0XI 4GKKQ 4AYBE 2KENA 4IO9A 5LMNQ 1N32Q 2N8NA 3NBHB 1PVOA 4GLVB 1PH5A 2BA1A 5HGQA 1I94Q 1YBYA 4R4IA 2R7ZG 4IPHA 2R7DA 3MEFA 1TXYA 1KIXA 2YTVA 4LF8Q 1XNQL 2CKZB 3KLWA 2E8GA 3S14H 3AQQA 2K4KA 1UE6A 1WJJA 4GKJQ 1KAWA 1VQ8A 4IFDI 3M7NA 5C0XG 3HOYH 5M5YH 2BH2A 5C44G 3W5OA 1OXUA 2MO0A 3MXNB 4RMFA 1J6QA 1EWIA 2UUAL 2FXQA 3L0OA 2DGYA 2Y0SG 1K8GA 3CCVA 4P73A 2JA7H 4DR2Q 4QJFA 1E1OA 4MNOA 5LMUQ 1BBWA 3G48A 3T1HL 2N3SA 3PO2G 5FJ8H 1G291 1Q8KA 3PUWA 4X65L 2KBNA 1IZ6A 3HOWH 4A3CG 2VQEL 3I7FA 3AFPA 4JI0L 5C4XG 2JA8H 2D62A 1OTCA 3UE1A 4NXNL 4EX5A 4GOPA 5GAGC 4HIOA 4BBRH 3NENA 4LF7Q 3CPFA 1CSPA 2EQSA 2F52A 4R4OA 2UXBL 2MFIA 3GTLH 5JEAJ 1N9WA 1JT8A 2F4VL 5IP9G 1SN8A 4DR3L 4P75A 1VQFA 4YWMA 4A3IG 1QZGA 4A3KG 4DV6Q 1PH9A 2ZJQA 2ASBA 2KCTA 3I4OA 3CMAA 4C3JH 1YITA 4B3TL 4JI8Q 1JJGA 1EQQA 2EIFA 4A3DH 2I0QA 1RIPA 2A1AA 1HR0W 4DR4L 3HOXG 4YY3L 1VQOA 3UE0A 4DUZL 3VDYA 1SMXA 2ID0A 1J5EL 4OX9Q 5BR8Q 4LF6L 1UWVA 1L0WA 2NVYH 5E7NA 1EIFA 3OW2A 1QVFA 1XNRL 2IX1A 3LGJA 1P8LA 4JYAL 1C9OA 1NTGA 3IRBA 3S16H 3I56A 3NEMA 3HKZG 4X64L 4L5SA 4GNXA 1KL9A 1CKOA 3CCMA 1L1OA 4X66L 4DV5L 3GTGH 3ERSX 3PGZA 1JJ2A 1HJPA 3GTKH 4FDBA 3J80c 3KF8B 1O7IA 1OXXK 2WAQE 3BU2A 3RLFA 1IBKQ 2D0PA 4YCWA 3PIPA 4JI3Q 4JBMA 4EQ5A 2VQFL 2OQKA 4R4TA 3S1RH 1HR0Q 2ZJRA 4GN4B 1PH7A 2B63H 1JJCB 3PO3G 1IBML 4JV5Q 5C0XJ 4A3JH 5IE8A 2PMZE 3M4QA 1WCMH 3Q8DA 1N33L 4JBJA 4YCUA 4JI7L 2ES2A 4DR1L 1CKNB 2JA6G 5JJIA 3AYHB 1Q1EA 3GD7A 1XJVA 3TQYA 3OTOQ 1A8VA 4BXXG 3PF4A 4A3LG 2UUBL 3CCRA 1VQAA 4LFCQ 4DV3Q 4DV0Q 4WJ4A 3TS2A 3S24A 2AKWB 2MQHA 2ZTCA 1YJWA 1TWFH 4HIDA 3PCOB 1XTDA 1EQRA 1JE5A 1G51A 4GS3A 3HOZH 5IWAQ 1SRUA 1L2FA 1VQKA 2NVQH 5AJ3L 5IYCG 4RG1A 3I4MG 4DV2L 5K36G 1PV4A 3CXCA 4LWCA 1W2BA 2ATWA 1W3SA 4DR7L 4BA1I 4GLXA 1KXLA 4NB3A 5C44H 4JOIC 1I5FA 1TWCH 2RHSB 2H5XA 1I94L 4LF9L 5LMNW 3G4SA 3PV0A 3ER0A 3HOUG 4KI0A 3F8TA 2YV5A 3TREA 4B3SQ 2JEBI 4R4CA 2YU9H 5C4XH 2WB1G 4A3GG 3J81j 4X62Q 2A19A 1OXTA 3UDIA 4A93H 5M3MH 2K50A 2NN6I 3M85A 1Y1WG 1NMFA 4NPSA 4GOPB 1N8RC 4DV7Q 3H3VH 1Y1VH 3KFUA 1KRTA 3AFQA 1MIUA 1B8AA 1VQMA 4B3MQ 2WFWA 2QEXA 4HJAA 2IY5B 4A3EG 1PH4A 4P74A 3ULLA 1YJ9A 4JG2A 4JI4L 4OWWB 4C3HH 3J81c 3I2ZA 2K52A 3PUYA 1P16A 2EXDA 1WFQA 2ZM6L 3SGIA 1TWGH 1PH6A 1EYGA 3M4OH 4L5QA 5GADC 1IXRA 4LF7L 5ELOA 4YHHQ 1FJGQ 4HJ7A 1BBUA 5M3FG 3HOXH 4A3FH 1Q82C 1VQ9A 3AEVA 3RR5A 3UDFA 4QL5A 3RZDH 4DV1Q 4DK6C 1C0AA 2I5HA 5ELNA 3ZJYC 4DKAC 2LXJA 1I6HH 1DGSA 2AMCB 3ULPA 1YI2A 3A74A 3S2DH 5FLMH 4UPAA 1WI5A 4MTNA 4POFA 3A5UA 1HZBA 3STBD 4GNXB 4BBSG 2GVBA 3K0XA 3TEHB 1U0LA 4B3RL 1GKHA 1L1OB 4LFAQ 3GDEA 1SFOH 4R4QA 5BR8L 3HOVG 2E2JH 4PZ6A 4JI2Q 2R92G 1HNZQ 2CWPA 2Q2HA 3KDFA 5IT9c 4O2DA 3U58A 1XMOL 1Q81C 1UEBA 4AH6A 4IFDG 3ULJA 4A3BG 4DR5Q 4JI1Q 3CCLA 3E9HA 1VQ4A 1VQNA 4JI6L 2DUDA 1MKHA 4KHZA 4R1JA 3KF6A 1N36L 3GTOH 1A63A 1GD7A 1MJCA 1VQIA 2GVAA 3NELA 2HT1A 3STBC 3CMEA 2ALYB 3H0GH 1Q7YC 1IBLQ 3I4NG 2PI2E 3FKIG 1HNWQ 3GTJH 4A3LH 1AE3A 1HR0L 3S1QH 3DM3A 1V1QA 4C2MH 2Q2UA 4ALPA 3CAMA 1QZHA 4BY1G 1OXSC 1VQCA 2KHIA 3H15A 2VW9A 2JA5G 1LTLA 3S15H 3GTMH 1XMQQ 2WP8J 3CC7A 2VUMG 4QQBX 2Z6KC 3M4PA 2Z0SA 5GQOA 5IYBH 2GN5A 1XNQQ 4UP8A 1S72A 2OWOA 1GVPA 4KLKA 4DV3L 2UU9L 4DV0L 5M5WH 1NBWA 4BY7H 2VY3A 3CC4A 2XGTA 4Y52H 2E5LL 1IL2A 2I5LX 2UXCQ 3S2HH 1KRSA 1UE5A 3G6EA 4JI5Q 1B7YB 4LUVA 4JBKA 1M90C 5FLXc 3GTPH 2VZAA 3TS0A 2UUAQ 3BZKA 2R93G 3U50C 3PSIA 1Z47A 1VQJA 3EIVA 3GO5A 4IPDA 2IHEA 4DUYL 2YTXA 3T1YL 1TWAH 4PG3A 4X65Q 1YHBA 2VQEQ 4JI0Q 4LF4L 2Y0SE 4DAMA 1VCIA 3HOYG 4TQUS 2QA4A 4AQYL 4YWLA 4NXNQ 2CQOA 1PYSB 1WOCA 4LUOA 4K0KL 4OONA 1N34L 4LF5Q 1T9HA 1YJNA 1PFSA 2ZJPA 2R7ZH 1RL2A 4JV5L 4PZ8A 4KHPQ 4AYBG 5FJ8G 1E7ZA 2JQOA 3KOJA 3HOWG 1HNXL 4NXMQ 4A75A 2B3GA 4IFDJ 4HJ5A 2JA8G 1VQLA 1S40A 4B3TQ 1VQGA 4UP7A 4BBRG 3I55A 2NVXH 4JOIA 4GKKL 4DR4Q 1YIJA 1Q46A 5LMNL 1J5EQ 1PH8A 1N32L 3RN5A 2JEAI 4DR6Q 3CCSA 1VQBA 2K5VA 2D0OA 3K80C 2Q2IA 1PH2A 4YHHL 4DV4Q 1FJGL 4LF8L 1CSQA 1KQSA 1XNRQ 5C4JH 4JYAQ 2IT1A 3E9IA 1Q1BA 3G71A 3PO2H 4GKJL 4X64Q 3KJOA 4A3CH 2YYZA 3WWVA 3TRZA 4A3DG 4DV5Q 2LSSA 2RHQB 3KDFB 1K83H 2PNHA 4TVAB 5IYDG 3F2BA 1R9TH 1VQ5A 2N49A 3A5ZB 4JC0A 2XTIA 1QVGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QIW E;  3HKZ E;  5GAE C;  2VQF Q;  1FGU A;  4DR2 L;  5LMU L;  4A4I A;  5J3B A;  5IP9 H;  4JI2 L;  1K3R A;  1IBM Q;  4BA2 I;  4A3I H;  1NE3 A;  1B70 B;  4A3K H;  5C3E G;  2PQA B;  2K14 A;  3U4Z A;  1N33 Q;  4JI7 Q;  3D31 A;  3S17 H;  4JI1 L;  2NN6 G;  4BY1 H;  1BVS A;  1XPR A;  1VS0 A;  3CF5 A;  2PI2 A;  4UP9 A;  2UUB Q;  3K8A A;  2UUC Q;  3PUZ A;  4IJL A;  1TWH H;  4POG A;  2HIX A;  2K5H A;  1QUQ A;  1QVC A;  1VQ6 A;  1HNW L;  1Z9F A;  5IP7 G;  1IBL L;  2RF4 A;  3CCQ A;  5EAY A;  1YZ6 A;  5HY6 A;  1SRO A;  4DV6 L;  4A3J G;  4OO1 I;  3S1M H;  1SR3 A;  4JI8 L;  5AJ3 Q;  4DV2 Q;  2CCZ A;  3RZO H;  1YHA A;  4LW1 A;  4LFB Q;  1X9N A;  3BJU A;  2Q2T A;  4OX9 L;  1I50 H;  1HZC A;  3K7U C;  1A0I A;  4LF9 Q;  1XMQ L;  4IOA A;  1M1K C;  2R93 H;  3F1Z A;  1NJI C;  2HHH Q;  3W1B A;  2BA0 A;  3HOZ G;  1X3E A;  2WAQ G;  3CP0 A;  1K0R A;  4IJH A;  4OO1 G;  3PO3 H;  4J15 A;  1E1T A;  4JBW A;  3L7Z C;  2UXC L;  4X6A H;  3RN2 A;  1HZA A;  4JI5 L;  1PA6 A;  3KYH C;  1D8L A;  4DNI A;  1U5K A;  4DR7 Q;  3H3V I;  2JA6 H;  1GO3 E;  4P71 A;  1HH2 P;  2QGQ A;  2ZTE A;  3EBE A;  4IPC A;  1UE7 A;  2AHO B;  1IBK L;  4BXX H;  2PQA A;  1C7Y A;  4JI3 L;  2WB1 E;  1AH9 A;  3UDG A;  3JC6 6;  3J80 i;  1LYL A;  2JE6 I;  2AWO A;  4QGU A;  2UXD Q;  4GN3 B;  1EIY B;  4JI4 Q;  2CFM A;  1E3P A;  1VQH A;  3CQZ H;  1HZ9 A;  1YVC A;  2MO1 A;  4L5T A;  3JAM i;  4A76 A;  3L2P A;  3A0J A;  3HKS A;  3CD6 A;  2ZM6 Q;  1SLJ A;  5DLQ E;  2VL6 A;  3F2D A;  1JB7 A;  2Z6K A;  2A8V A;  5M3M G;  1X65 A;  2K5N A;  5IYC H;  3I4M H;  4A93 G;  4A3M G;  4LF5 L;  1Y1V G;  2OCE A;  4GOP C;  3KJP A;  4YWK A;  1OXV A;  2R7F A;  3OTO L;  2NZH A;  3W1G A;  4LNQ A;  1H95 A;  4LFC L;  1VQD A;  4OXP A;  4KHP L;  5IY0 A;  1KD1 C;  3HOU H;  2OQ0 A;  2B29 A;  4AIM A;  1ASY A;  3PF5 A;  4NXM L;  1LM0 A;  3E0E A;  1V43 A;  5IWA L;  2F3I A;  2ZTD A;  4OWX B;  1G6P A;  4XTC S;  2AWN A;  4PZ7 A;  4A3G H;  1A62 A;  4A3F G;  4B3R Q;  4DAY B;  2IX0 A;  4APV A;  1E22 A;  4O0A A;  4DR6 L;  1AE2 A;  3T1H Q;  5GAH C;  1Y1W H;  1FVI A;  1NY4 A;  3KF6 B;  4JCV E;  4OWT B;  1K8A C;  2R6G A;  2HQL A;  1VQP A;  4DV4 L;  1XMO Q;  1WYD A;  1FL0 A;  3CCE A;  2VNU D;  4A3E H;  4B3S L;  5GRO A;  5FLM G;  2CWA A;  2JA9 A;  3FP9 A;  5C3E H;  1SE8 A;  1V9P A;  4JI6 Q;  2UXB Q;  4GNX C;  3U4V A;  1XPO A;  4X62 L;  1N36 Q;  2JA7 G;  1L1O C;  3PIO A;  2KHJ A;  4MZ9 A;  4HJ9 A;  2F4V Q;  4DV7 L;  3ICE A;  1EUJ A;  5H1S E;  3HFZ B;  4DR3 Q;  3FHW A;  1I3Q H;  5M3F H;  4B3M L;  1X55 A;  1YHQ A;  3JAM c;  4IOC A;  4P72 A;  3F2C A;  1QUQ B;  3B6Y A;  5IP7 H;  1K9M C;  2JK8 A;  1X6O A;  5JJK A;  1E24 A;  4YY3 Q;  1NMG A;  4DUZ Q;  1YNX A;  4LF6 Q;  3GTQ H;  3J81 i;  2BH8 A;  2V1C C;  4QY7 A;  1CKM A;  4BBS H;  1EFW A;  1GM5 A;  1VQ7 A;  3H0G G;  4DPG A;  5JJL A;  1VQE A;  5M5X H;  1LUZ A;  3CCU A;  2UUC L;  2UU9 Q;  3PUX A;  4UY8 C;  3RNU A;  3HOV H;  4DV1 L;  2JJQ A;  1PH1 A;  1S3O A;  2YTY A;  4LUZ A;  3CC2 A;  2R92 H;  2E5L Q;  1D7Q A;  3K81 C;  4X66 Q;  1PHJ A;  2IHF A;  3BZC A;  4YCV A;  1MJE A;  4A3B H;  4HJ8 A;  4H02 A;  1CUK A;  1YEZ A;  2L15 A;  4LFB L;  5IYB G;  2KCM A;  4C3I H;  3M9B A;  3J7Z C;  1XPU A;  4DUY Q;  1X3G A;  4LFA L;  3UDX A;  3T1Y Q;  2RCN A;  2C35 B;  5JEA G;  2E2H H;  1PYB A;  3I4N H;  1HNZ L;  4BY7 G;  2HHH L;  4XIG S;  1JMC A;  3FKI H;  4LF4 Q;  2MNA A;  2OTL A;  4L5R C;  1EOV A;  1Y14 B;  4WJ3 M;  3PUV A;  4AQY Q;  5IYD H;  4DR5 L;  4HIM A;  4DR1 Q;  4K0K Q;  1X54 A;  2NZO A;  2NVT H;  1N34 Q;  3S1N H;  3CW2 C;  4PMW A;  4HIK A;  4GN5 A;  1Q12 A;  3K7A H;  2N78 A;  1X3F A;  1IYJ B;  1KC8 C;  1ASZ A;  1BKB A;  3D0F A;  3EN2 A;  3DLL A;  3CCJ A;  2JA5 H;  2HIV A;  2VS1 A;  4GLA C;  3M3Y H;  3RLO A;  4A3M H;  2VUM H;  2I5M X;  1KHI A;  3OYY A;  4IPG A;  3RLN A;  2B63 G;  2OTJ A;  2K75 A;  4Y7N H;  1HNX Q;  3J7A 5;  1PH3 A;  1K73 C;  1WCM G;  1X56 A;  2E2I H;  1CKN A;  2UXD L;  1Q86 C;  1UE1 A;  4DK3 C;  3CPW A;  2LXK A;  4ME3 A;  5C0X I;  4GKK Q;  4AYB E;  2KEN A;  4IO9 A;  5LMN Q;  1N32 Q;  2N8N A;  3NBH B;  1PVO A;  4GLV B;  1PH5 A;  2BA1 A;  5HGQ A;  1I94 Q;  1YBY A;  4R4I A;  2R7Z G;  4IPH A;  2R7D A;  3MEF A;  1TXY A;  1KIX A;  2YTV A;  4LF8 Q;  1XNQ L;  2CKZ B;  3KLW A;  2E8G A;  3S14 H;  3AQQ A;  2K4K A;  1UE6 A;  1WJJ A;  4GKJ Q;  1KAW A;  1VQ8 A;  4IFD I;  3M7N A;  5C0X G;  3HOY H;  5M5Y H;  2BH2 A;  5C44 G;  3W5O A;  1OXU A;  2MO0 A;  3MXN B;  4RMF A;  1J6Q A;  1EWI A;  2UUA L;  2FXQ A;  3L0O A;  2DGY A;  2Y0S G;  1K8G A;  3CCV A;  4P73 A;  2JA7 H;  4DR2 Q;  4QJF A;  1E1O A;  4MNO A;  5LMU Q;  1BBW A;  3G48 A;  3T1H L;  2N3S A;  3PO2 G;  5FJ8 H;  1G29 1;  1Q8K A;  3PUW A;  4X65 L;  2KBN A;  1IZ6 A;  3HOW H;  4A3C G;  2VQE L;  3I7F A;  3AFP A;  4JI0 L;  5C4X G;  2JA8 H;  2D62 A;  1OTC A;  3UE1 A;  4NXN L;  4EX5 A;  4GOP A;  5GAG C;  4HIO A;  4BBR H;  3NEN A;  4LF7 Q;  3CPF A;  1CSP A;  2EQS A;  2F52 A;  4R4O A;  2UXB L;  2MFI A;  3GTL H;  5JEA J;  1N9W A;  1JT8 A;  2F4V L;  5IP9 G;  1SN8 A;  4DR3 L;  4P75 A;  1VQF A;  4YWM A;  4A3I G;  1QZG A;  4A3K G;  4DV6 Q;  1PH9 A;  2ZJQ A;  2ASB A;  2KCT A;  3I4O A;  3CMA A;  4C3J H;  1YIT A;  4B3T L;  4JI8 Q;  1JJG A;  1EQQ A;  2EIF A;  4A3D H;  2I0Q A;  1RIP A;  2A1A A;  1HR0 W;  4DR4 L;  3HOX G;  4YY3 L;  1VQO A;  3UE0 A;  4DUZ L;  3VDY A;  1SMX A;  2ID0 A;  1J5E L;  4OX9 Q;  5BR8 Q;  4LF6 L;  1UWV A;  1L0W A;  2NVY H;  5E7N A;  1EIF A;  3OW2 A;  1QVF A;  1XNR L;  2IX1 A;  3LGJ A;  1P8L A;  4JYA L;  1C9O A;  1NTG A;  3IRB A;  3S16 H;  3I56 A;  3NEM A;  3HKZ G;  4X64 L;  4L5S A;  4GNX A;  1KL9 A;  1CKO A;  3CCM A;  1L1O A;  4X66 L;  4DV5 L;  3GTG H;  3ERS X;  3PGZ A;  1JJ2 A;  1HJP A;  3GTK H;  4FDB A;  3J80 c;  3KF8 B;  1O7I A;  1OXX K;  2WAQ E;  3BU2 A;  3RLF A;  1IBK Q;  2D0P A;  4YCW A;  3PIP A;  4JI3 Q;  4JBM A;  4EQ5 A;  2VQF L;  2OQK A;  4R4T A;  3S1R H;  1HR0 Q;  2ZJR A;  4GN4 B;  1PH7 A;  2B63 H;  1JJC B;  3PO3 G;  1IBM L;  4JV5 Q;  5C0X J;  4A3J H;  5IE8 A;  2PMZ E;  3M4Q A;  1WCM H;  3Q8D A;  1N33 L;  4JBJ A;  4YCU A;  4JI7 L;  2ES2 A;  4DR1 L;  1CKN B;  2JA6 G;  5JJI A;  3AYH B;  1Q1E A;  3GD7 A;  1XJV A;  3TQY A;  3OTO Q;  1A8V A;  4BXX G;  3PF4 A;  4A3L G;  2UUB L;  3CCR A;  1VQA A;  4LFC Q;  4DV3 Q;  4DV0 Q;  4WJ4 A;  3TS2 A;  3S24 A;  2AKW B;  2MQH A;  2ZTC A;  1YJW A;  1TWF H;  4HID A;  3PCO B;  1XTD A;  1EQR A;  1JE5 A;  1G51 A;  4GS3 A;  3HOZ H;  5IWA Q;  1SRU A;  1L2F A;  1VQK A;  2NVQ H;  5AJ3 L;  5IYC G;  4RG1 A;  3I4M G;  4DV2 L;  5K36 G;  1PV4 A;  3CXC A;  4LWC A;  1W2B A;  2ATW A;  1W3S A;  4DR7 L;  4BA1 I;  4GLX A;  1KXL A;  4NB3 A;  5C44 H;  4JOI C;  1I5F A;  1TWC H;  2RHS B;  2H5X A;  1I94 L;  4LF9 L;  5LMN W;  3G4S A;  3PV0 A;  3ER0 A;  3HOU G;  4KI0 A;  3F8T A;  2YV5 A;  3TRE A;  4B3S Q;  2JEB I;  4R4C A;  2YU9 H;  5C4X H;  2WB1 G;  4A3G G;  3J81 j;  4X62 Q;  2A19 A;  1OXT A;  3UDI A;  4A93 H;  5M3M H;  2K50 A;  2NN6 I;  3M85 A;  1Y1W G;  1NMF A;  4NPS A;  4GOP B;  1N8R C;  4DV7 Q;  3H3V H;  1Y1V H;  3KFU A;  1KRT A;  3AFQ A;  1MIU A;  1B8A A;  1VQM A;  4B3M Q;  2WFW A;  2QEX A;  4HJA A;  2IY5 B;  4A3E G;  1PH4 A;  4P74 A;  3ULL A;  1YJ9 A;  4JG2 A;  4JI4 L;  4OWW B;  4C3H H;  3J81 c;  3I2Z A;  2K52 A;  3PUY A;  1P16 A;  2EXD A;  1WFQ A;  2ZM6 L;  3SGI A;  1TWG H;  1PH6 A;  1EYG A;  3M4O H;  4L5Q A;  5GAD C;  1IXR A;  4LF7 L;  5ELO A;  4YHH Q;  1FJG Q;  4HJ7 A;  1BBU A;  5M3F G;  3HOX H;  4A3F H;  1Q82 C;  1VQ9 A;  3AEV A;  3RR5 A;  3UDF A;  4QL5 A;  3RZD H;  4DV1 Q;  4DK6 C;  1C0A A;  2I5H A;  5ELN A;  3ZJY C;  4DKA C;  2LXJ A;  1I6H H;  1DGS A;  2AMC B;  3ULP A;  1YI2 A;  3A74 A;  3S2D H;  5FLM H;  4UPA A;  1WI5 A;  4MTN A;  4POF A;  3A5U A;  1HZB A;  3STB D;  4GNX B;  4BBS G;  2GVB A;  3K0X A;  3TEH B;  1U0L A;  4B3R L;  1GKH A;  1L1O B;  4LFA Q;  3GDE A;  1SFO H;  4R4Q A;  5BR8 L;  3HOV G;  2E2J H;  4PZ6 A;  4JI2 Q;  2R92 G;  1HNZ Q;  2CWP A;  2Q2H A;  3KDF A;  5IT9 c;  4O2D A;  3U58 A;  1XMO L;  1Q81 C;  1UEB A;  4AH6 A;  4IFD G;  3ULJ A;  4A3B G;  4DR5 Q;  4JI1 Q;  3CCL A;  3E9H A;  1VQ4 A;  1VQN A;  4JI6 L;  2DUD A;  1MKH A;  4KHZ A;  4R1J A;  3KF6 A;  1N36 L;  3GTO H;  1A63 A;  1GD7 A;  1MJC A;  1VQI A;  2GVA A;  3NEL A;  2HT1 A;  3STB C;  3CME A;  2ALY B;  3H0G H;  1Q7Y C;  1IBL Q;  3I4N G;  2PI2 E;  3FKI G;  1HNW Q;  3GTJ H;  4A3L H;  1AE3 A;  1HR0 L;  3S1Q H;  3DM3 A;  1V1Q A;  4C2M H;  2Q2U A;  4ALP A;  3CAM A;  1QZH A;  4BY1 G;  1OXS C;  1VQC A;  2KHI A;  3H15 A;  2VW9 A;  2JA5 G;  1LTL A;  3S15 H;  3GTM H;  1XMQ Q;  2WP8 J;  3CC7 A;  2VUM G;  4QQB X;  2Z6K C;  3M4P A;  2Z0S A;  5GQO A;  5IYB H;  2GN5 A;  1XNQ Q;  4UP8 A;  1S72 A;  2OWO A;  1GVP A;  4KLK A;  4DV3 L;  2UU9 L;  4DV0 L;  5M5W H;  1NBW A;  4BY7 H;  2VY3 A;  3CC4 A;  2XGT A;  4Y52 H;  2E5L L;  1IL2 A;  2I5L X;  2UXC Q;  3S2H H;  1KRS A;  1UE5 A;  3G6E A;  4JI5 Q;  1B7Y B;  4LUV A;  4JBK A;  1M90 C;  5FLX c;  3GTP H;  2VZA A;  3TS0 A;  2UUA Q;  3BZK A;  2R93 G;  3U50 C;  3PSI A;  1Z47 A;  1VQJ A;  3EIV A;  3GO5 A;  4IPD A;  2IHE A;  4DUY L;  2YTX A;  3T1Y L;  1TWA H;  4PG3 A;  4X65 Q;  1YHB A;  2VQE Q;  4JI0 Q;  4LF4 L;  2Y0S E;  4DAM A;  1VCI A;  3HOY G;  4TQU S;  2QA4 A;  4AQY L;  4YWL A;  4NXN Q;  2CQO A;  1PYS B;  1WOC A;  4LUO A;  4K0K L;  4OON A;  1N34 L;  4LF5 Q;  1T9H A;  1YJN A;  1PFS A;  2ZJP A;  2R7Z H;  1RL2 A;  4JV5 L;  4PZ8 A;  4KHP Q;  4AYB G;  5FJ8 G;  1E7Z A;  2JQO A;  3KOJ A;  3HOW G;  1HNX L;  4NXM Q;  4A75 A;  2B3G A;  4IFD J;  4HJ5 A;  2JA8 G;  1VQL A;  1S40 A;  4B3T Q;  1VQG A;  4UP7 A;  4BBR G;  3I55 A;  2NVX H;  4JOI A;  4GKK L;  4DR4 Q;  1YIJ A;  1Q46 A;  5LMN L;  1J5E Q;  1PH8 A;  1N32 L;  3RN5 A;  2JEA I;  4DR6 Q;  3CCS A;  1VQB A;  2K5V A;  2D0O A;  3K80 C;  2Q2I A;  1PH2 A;  4YHH L;  4DV4 Q;  1FJG L;  4LF8 L;  1CSQ A;  1KQS A;  1XNR Q;  5C4J H;  4JYA Q;  2IT1 A;  3E9I A;  1Q1B A;  3G71 A;  3PO2 H;  4GKJ L;  4X64 Q;  3KJO A;  4A3C H;  2YYZ A;  3WWV A;  3TRZ A;  4A3D G;  4DV5 Q;  2LSS A;  2RHQ B;  3KDF B;  1K83 H;  2PNH A;  4TVA B;  5IYD G;  3F2B A;  1R9T H;  1VQ5 A;  2N49 A;  3A5Z B;  4JC0 A;  2XTI A;  1QVG A; 
#chains in the Genus database with same CATH topology
 3VA7 A;  3KBG A;  1SNM A;  4CDD C;  1PTO C;  3LWU A;  5J3B A;  5IP9 H;  4JI2 L;  5C44 B;  1IBM Q;  3SK5 A;  1TWC B;  3K5L A;  4A3K H;  2PQA B;  2PMZ B;  4FXG C;  1CK1 A;  1ML0 D;  2NN6 G;  4BY1 H;  4KKU A;  3ERQ A;  2YU9 B;  3Q24 A;  5C4X B;  2AUJ D;  3K8A A;  2UUC Q;  2HDL A;  2AQ2 B;  1QVC A;  1HNW L;  1IBL L;  4DV6 L;  2A68 C;  4OO1 I;  5ELB A;  4JI8 L;  1GUW A;  3H09 A;  2CCZ A;  3RZO H;  2JN4 A;  4C3H B;  1LV9 A;  5I2X A;  1HZC A;  4LF9 Q;  3CHB D;  1LTI D;  1M1K C;  5EJW A;  1FGB D;  2HHH Q;  2SEB D;  5HUR A;  1KAA A;  3BDC A;  1EY9 A;  1ILQ A;  1E1T A;  1EWC A;  4ME5 A;  3KLS A;  3L7Z C;  4NKL A;  4LK1 C;  2UXC L;  1NR4 A;  1DON A;  4JI5 L;  4DR7 Q;  2AQ3 B;  2QGQ A;  1UE7 A;  5E1F A;  2L9H A;  4BXX H;  3S1M B;  3S2D B;  4JI3 L;  3UDG A;  3J80 i;  1Q3L A;  3CU7 A;  2AWO A;  1F2M A;  1STE A;  4GN3 B;  2UXD Q;  1E3P A;  1F2Y A;  2MO1 A;  2CVR A;  3L2P A;  5I6Y A;  1SLJ A;  1JB7 A;  3I4M H;  4KKS A;  1WTR A;  2F0Q A;  4LF5 L;  4GOP C;  3OTO L;  1SEB D;  3JAM L;  2E75 C;  3SEB A;  5IY0 A;  3GTO B;  3KLS X;  3E0E A;  1TY2 A;  2F3I A;  3H0G B;  3OIQ A;  3JAM E;  1QG7 A;  2IWH A;  5CBA E;  4XTC S;  1A62 A;  4C2M B;  3LNN A;  1E22 A;  2ZXP A;  4O0A A;  1AE2 A;  2L5T A;  1FVI A;  1H9S B;  3KF6 B;  3BS1 A;  3S15 B;  1WYD A;  2A6E D;  1X3P A;  2VNU D;  1I4Q A;  1PTO B;  1GHK A;  4QUC A;  3A8I E;  5FLM G;  4UHV A;  1SE8 A;  1V9P A;  4X62 L;  1IW7 C;  3HEJ A;  3MFY A;  1L0X B;  2F4V Q;  1EUJ A;  1BCP B;  3FHW A;  5M3F H;  4FF1 A;  4G7H C;  1CM9 A;  3KLR A;  2EJF C;  1QUQ B;  1K9M C;  2SNS A;  5FO7 B;  2KQ3 A;  2O5I C;  3GTQ H;  4QY7 A;  4A3E B;  2PYK A;  5JJL A;  1LUZ A;  4ODG A;  2UU9 Q;  4C3J G;  3PUX A;  3W2D A;  1PH1 A;  2YTY A;  3MVV A;  2K7V A;  3L3O C;  2EYF A;  1EEI D;  2PCF B;  1V8Q A;  1CUK A;  3SHL A;  2KCM A;  4C3I H;  3UDX A;  3K5N A;  2RCN A;  2E2H H;  3I4N H;  2J4X A;  1UUP A;  3NWS A;  3FKI H;  2PZT A;  3F2U A;  3VR5 A;  3PUV A;  4DR1 Q;  1X54 A;  2NVT H;  5C4J B;  3CW2 C;  4PMW A;  2WV6 D;  1X3F A;  4IZ8 A;  4CHT B;  1BKB A;  3EN2 A;  2VB2 X;  3DLL A;  4G7Z C;  4GLA C;  4JV5 Q;  1AP0 A;  1KHI A;  3OYY A;  3RLN A;  4XXE A;  2XNA C;  4DK3 C;  3CPW A;  4CDC C;  4ME3 A;  2EJM A;  4GKK Q;  1E2Z A;  2QDL A;  2R7Z G;  2EYH A;  1WTV A;  2R7D A;  3MEF A;  1PZJ D;  1TXY A;  4LF8 Q;  1EY7 A;  2RDG A;  3QJY A;  3AQQ A;  3K7A B;  2K4K A;  1UE6 A;  1WJJ A;  4GKJ Q;  3IAY A;  5I4D A;  2BH2 A;  3A8K E;  3MXN B;  2MO0 A;  2UUA L;  2FXQ A;  3L0O A;  3HKZ B;  4CKC A;  3TBI B;  2JA7 H;  4QJF A;  3T1H L;  2F0P A;  2NYZ D;  5FJ8 H;  4A3C G;  1ENA A;  3I7F A;  1I50 B;  3GQB A;  1EZ6 A;  2NTS A;  4DFA A;  1OTC A;  2H1E A;  3FMC A;  3QG1 A;  3UE1 A;  4FYD A;  4NXN L;  4EX5 A;  1W6J A;  3J80 L;  5GAG C;  4HIO A;  2F0M A;  3BVG A;  4KD4 A;  3NEN A;  5CBE E;  3CPF A;  1KNA A;  3QOJ A;  4R4O A;  2UXB L;  5JEA J;  1N9W A;  3J80 E;  5IP9 G;  3X3M A;  1VQF A;  5L37 A;  4A3K G;  4DV6 Q;  3I4O A;  3G7L A;  1YIT A;  4JI8 Q;  1ZKO A;  1EZ8 A;  1TS4 A;  2XSC A;  1NUC A;  4DR4 L;  4AYB B;  5IYD H;  3HOW B;  4DUZ L;  3VDY A;  2ID0 A;  2WIN B;  1Z6H A;  2Z8L A;  4LF6 L;  3A8J E;  1UWV A;  1L0W A;  1UEA B;  5EPK A;  1C9O A;  3IRB A;  3H3V C;  3I56 A;  1O7Z A;  3NEM A;  5IOD A;  4X64 L;  3D8G A;  4GNX A;  1KL9 A;  3CCM A;  5FK9 C;  1L1O A;  2QKI C;  3GTG H;  1L0Y B;  3GTK H;  1O7I A;  4ZRZ A;  1EYD A;  3RLF A;  3PIP A;  4JI3 Q;  4DNT B;  4EQ5 A;  3OHX C;  2OQK A;  2WB1 B;  4R4T A;  4ZAI A;  2VQF L;  3S1R H;  1PXU A;  2ZJR A;  3BVZ A;  1JJC B;  1ET6 A;  4N8F A;  2R61 A;  4A3J H;  1WD1 A;  1PFB A;  1N33 L;  2ES2 A;  1RKN A;  2O5J C;  3OTO Q;  1A8V A;  4BXX G;  4FXD A;  4FO2 A;  3CCR A;  5LL6 X;  2AKW B;  2MQH A;  3H91 A;  2KA7 A;  4R8I A;  1G51 A;  3HOZ H;  1VQK A;  4OO1 H;  1JOQ A;  3I4M G;  3MC0 B;  3CXC A;  1K3B C;  4GLX A;  4NB3 A;  1PDQ A;  4P2C B;  1I5F A;  5LMN W;  3PV0 A;  2Z6B A;  3OMC A;  3TRE A;  4BBS B;  4R4C A;  3NQT A;  5M5X B;  2MJ8 A;  1BCP D;  4X62 Q;  1E0B A;  1OXT A;  3UDI A;  5C4Z A;  1N8R C;  1FD7 D;  1Y1V H;  2NVQ B;  1MIU A;  1B8A A;  1LT4 D;  1EL0 A;  2WFW A;  4ULL A;  5C3W A;  4WOR A;  4JI4 L;  4ZK9 B;  3OOC A;  2K52 A;  1P16 A;  2EXD A;  3AB9 A;  1A2T A;  3SGI A;  3KUP A;  1QB5 D;  1EYG A;  1JWU D;  4LF7 L;  5ELO A;  1BBU A;  1GUT A;  5M3F G;  4OIK A;  2F4I A;  5JVG 3;  3RZD H;  3VR3 A;  4OEM B;  2LXJ A;  1ZYR D;  2VUM B;  2CW0 C;  2AMC B;  3ULP A;  5KNB A;  3A74 A;  4POF A;  3R2T A;  1O78 A;  1U0L A;  1TII D;  1SFO H;  4R4Q A;  3K5O A;  3TZD A;  3D3R A;  1TWG B;  3U58 A;  4O2D A;  1UEB A;  1MSH A;  2K04 A;  1NAP A;  5FLX L;  1YNN C;  3I73 A;  3S14 B;  4JI6 L;  1SYB A;  1II3 A;  4C3I G;  3HRZ C;  3R3O A;  4J8Q A;  4ZKB B;  1MJC A;  1A3U A;  4DF7 A;  5FLX E;  2HT1 A;  3MXG A;  3CME A;  2ALY B;  3T13 A;  3I4N G;  3FKI G;  3GTJ H;  2EZV A;  5ISR A;  2I46 A;  4A3L H;  4H7B A;  1HR0 L;  3ZYY X;  5A2Q L;  4KK7 A;  3CAM A;  2NBF A;  3T56 B;  3C46 A;  1OXS C;  2QCP X;  3H15 A;  5FO9 B;  1TR5 A;  1XMQ Q;  2JA8 B;  3LWE A;  5A2Q E;  2GN5 A;  2F0J A;  1GVP A;  3A56 A;  3EFX D;  4DV3 L;  4BY7 H;  3CC4 A;  1SMY D;  3GTL B;  1KNE A;  4EQN A;  1UE5 A;  1IW7 D;  1F9S A;  1M90 C;  2VZA A;  2UUA Q;  3BZK A;  4C3J B;  1SNP A;  3PSI A;  1HTP A;  3G6J B;  3GO5 A;  4DUY L;  5EBD A;  4F7X A;  3T1Y L;  1TWA H;  1QIL A;  1HA6 A;  4LF4 L;  2M9V A;  3GTM B;  2SDF A;  1H9K A;  1VCI A;  4NXN Q;  4AQY L;  4YWL A;  2EY5 A;  4K0K L;  3V2T A;  3S16 B;  5M5W B;  5CV9 A;  1I4H A;  5FJ8 G;  1E7Z A;  2JQO A;  3KOJ A;  5DAU A;  4RA8 A;  1DOM A;  1VQG A;  4ZQ3 A;  3VR4 A;  4DR4 Q;  1YIJ A;  1JOK A;  1PH8 A;  1N32 L;  2JEA I;  2FFK B;  3V05 A;  2A6H C;  1VQB A;  4HMJ A;  2WKC A;  4KN7 C;  4Q0F A;  3URY A;  4DV4 Q;  1CSQ A;  1ET9 A;  3U9O A;  3ERO A;  3G71 A;  3PO2 H;  3DMU A;  2QDB A;  4X64 Q;  2YYZ A;  4DAY A;  2LSS A;  1R9T H;  5IYD G;  3F2B A;  1TWF B;  2F0H A;  4IUT A;  4QIW E;  1STH A;  2WAQ B;  1Y8P B;  4NP5 A;  2VQF Q;  3HZX A;  1FGU A;  1S4Z A;  4DK1 A;  2L0C A;  3SK6 A;  3TDQ A;  1K3R A;  4BA2 I;  4C1N K;  1Q90 A;  2L4N A;  5C3E G;  3U4Z A;  1N33 Q;  1EYC A;  3J7Y W;  1BF4 A;  3D31 A;  3S17 H;  2RBM A;  3O13 A;  2F0N A;  4K5X A;  1XPR A;  2Q8T A;  2QF7 A;  5J1Z A;  3D4D A;  3PUZ A;  5COY A;  1B50 A;  1TWH H;  1G2S A;  1KDA A;  2HIX A;  2BOS A;  5M3M B;  5IP7 G;  4A93 B;  3CCQ A;  4A3J G;  1CFM A;  1CT1 D;  2EY6 A;  2G9H D;  4JW0 A;  4LW1 A;  4LFB Q;  3GV3 A;  2Z9H A;  2F0V A;  2RSO A;  1X3Q A;  3VYR A;  2R93 H;  3E6Z X;  3HOZ G;  1K0R A;  4OO1 G;  3PO3 H;  1PYW D;  3AU7 A;  4FF2 A;  2F0E A;  1HZA A;  3KYH C;  3L9A X;  1D8L A;  4P71 A;  1U9R A;  2ZTE A;  4IPC A;  1IBK L;  2AHO B;  1C7Y A;  1AH9 A;  1JIC A;  2JE6 I;  4QGU A;  1EIY B;  4JI4 Q;  3CQZ H;  4L5T A;  3JAM i;  3QB3 A;  3A0J A;  5DLQ E;  3F2D A;  1X65 A;  1HRJ A;  5HGT A;  1SNC A;  3C2P A;  4A3M G;  1Y1V G;  2DJG C;  2OCE A;  5EPL A;  1STG A;  3OW7 A;  2NZH A;  1H95 A;  4LFC L;  4RCN A;  1LTS D;  1WTO A;  1KD1 C;  3HOU H;  5CV8 A;  2B29 A;  4AIM A;  1U4L A;  1LM0 A;  4C1N I;  2DN8 A;  3QO2 A;  2ZTD A;  4OWX B;  5KYL A;  1G6P A;  2AWN A;  4PZ7 A;  3S1Q B;  3Q23 A;  4A3G H;  4XYO A;  2F3V A;  2B2T A;  4DXG A;  4CDF C;  5GAH C;  1Y1W H;  1TY0 A;  1ICW A;  1OO9 B;  2NUC A;  2R6G A;  2HQL A;  4B3S L;  5GRO A;  5IGC A;  1S5C D;  4C56 C;  3ND9 A;  2DJF C;  3FPU B;  4JI6 Q;  4GNX C;  1L1O C;  4DNR B;  3DWP A;  1STA A;  1H9R A;  3S2H B;  4DR3 Q;  3HFZ B;  1SE2 A;  1KLG D;  2O4X A;  3JAM c;  1GUS A;  5DM6 3;  4P72 A;  3F2C A;  3PQI A;  3U9S A;  2JK8 A;  1X6O A;  1E24 A;  1HXY D;  1I6V C;  1NMG A;  1BUV T;  1YNX A;  3J81 i;  5E4X A;  1CKM A;  1EFW A;  1I4G A;  1GM5 A;  1KDC A;  3CCU A;  2JYO A;  3HOV H;  4UY8 C;  3RNU A;  4DV1 L;  4TKO B;  1JCK B;  1D7Q A;  3Q6S A;  3TSS A;  4XDX A;  3BZC A;  4A3B H;  2F0D A;  2MUY A;  3I72 A;  3I70 A;  1YEZ A;  2MP1 A;  2L15 A;  2K1B A;  2OF1 A;  4DUY Q;  4LFA L;  2NVX B;  3T1Y Q;  4RCO A;  2FIN B;  4BY7 G;  5JAV A;  1AEX A;  1JMC A;  4LF4 Q;  3GTQ B;  2MNA A;  4CGY B;  4K8J A;  1EOV A;  4AQY Q;  1UAP A;  3KF8 A;  4K0K Q;  1JQY D;  1PZI D;  3S1N H;  4GN5 A;  2N78 A;  4IUU A;  4L63 B;  3K6O A;  4Y52 H;  3RLO A;  1SJE D;  1K83 B;  4IPG A;  2TMP A;  2K75 A;  4Y7N H;  3J7A 5;  1PH3 A;  1WCM G;  1X56 A;  2WKD A;  2E2I H;  2NWG A;  1Q86 C;  1UE1 A;  1GOZ A;  2K05 A;  5IGB A;  1EU3 A;  5C0X I;  3H6M A;  4PQX A;  1N32 Q;  2N8N A;  3QWN A;  2E2H B;  3NBH B;  1BQQ T;  4GLV B;  4A3I B;  2BA1 A;  3VR2 A;  4R4I A;  1XNQ L;  4ILW A;  5KGU A;  1WTP A;  4IUV A;  4EVO A;  4FP5 D;  1KAW A;  3D6W A;  3SE0 A;  3M7N A;  1T5E A;  5M5Y H;  3W5O A;  4RMF A;  1EWI A;  4CJ1 B;  1HFN A;  2F0W A;  2LFN A;  3PO2 G;  1Q8K A;  3PUW A;  2J7Z A;  2KBN A;  1S5E D;  3AFP A;  2CH4 W;  4I65 A;  1K8M A;  1HPC A;  3NE5 B;  2EQS A;  2F52 A;  3J7A V;  1KDB A;  3KK7 A;  1I4R A;  5M9O A;  1A3V A;  2X69 A;  1JT8 A;  1YNJ D;  1PH9 A;  2JA6 B;  5BN5 A;  2M2L A;  4B3T L;  1JJG A;  4A3D H;  1A3T A;  1RIP A;  1QOH A;  4N8X 1;  3HOX G;  4YY3 L;  1STN A;  1J5E L;  4Z9C B;  4MHE A;  1G8Z D;  5D3I B;  2DNC A;  2IX1 A;  3LGJ A;  4JYA L;  1O7L A;  2EYL A;  2QIL A;  3P75 A;  4X66 L;  4DV5 L;  3LX0 A;  3DWQ A;  3ERS X;  1JJ2 A;  2LMC B;  4FDB A;  3DHQ A;  3J80 c;  1OXX K;  3BU2 A;  1IBK Q;  2D0P A;  4YCW A;  3VYS A;  4JBM A;  4NDX A;  4KY7 A;  4GN4 B;  2B63 H;  3PO3 G;  3NQI A;  5KRU A;  3MZ5 A;  2PMZ E;  3Q8D A;  4YCU A;  4DAP A;  4JI7 L;  1CKN B;  3S9W A;  5JJI A;  3AYH B;  1JC7 A;  1Q1E A;  1EEF D;  2DNE A;  1PRT F;  2UUB L;  4LFC Q;  1JWS D;  4B9X A;  1IKM A;  5C3E B;  4DV0 Q;  3J81 L;  3PCO B;  3GTK B;  1AW7 A;  4GS3 A;  1SRU A;  1I3Q B;  3HP3 A;  5AJ3 L;  4DV2 L;  1ICF B;  4X3K A;  1W3S A;  3J81 E;  5E3F A;  5C44 H;  1TWC H;  2N55 A;  1I94 L;  4A3J B;  5CYU A;  3G4S A;  1ENF A;  3OSO A;  1FNU A;  3ER0 A;  3HOU G;  3F8T A;  4KTA A;  4B3S Q;  2JEB I;  4UDU C;  2YU9 H;  1D1I A;  5C4X H;  4A3G G;  2R92 B;  1CI3 M;  2NN6 I;  1Y1W G;  5KNC A;  1NMF A;  4GOP B;  2HDM A;  1TS5 A;  5IOC A;  1U4M A;  2IY5 B;  1XTC D;  3EJI A;  3SK4 A;  4O1N A;  4C3H H;  1PRT C;  2NTT A;  1WFQ A;  2ZM6 L;  1U4R A;  3NTH A;  1IXR A;  4K5V A;  3E5S A;  1FJG Q;  4YHH Q;  4A3F H;  1VQ9 A;  3AEV A;  3UDF A;  4QL5 A;  1RDP D;  4DV1 Q;  4FF4 A;  3M3Y B;  4NW2 A;  4A3M B;  1F9Q A;  1DGS A;  4KV6 A;  1Y1V B;  2N88 A;  1CA6 A;  3S2D H;  4X3S A;  4BS9 A;  1M4V A;  4MTN A;  2IPK D;  3TEH B;  4CBV A;  4B3R L;  4ID6 A;  4LFA Q;  4YIJ A;  5BR8 L;  3HOV G;  4PZ6 A;  4JI2 Q;  2FMM A;  5C3X A;  4JVZ A;  3KDF A;  1XMO L;  1Q81 C;  5ELD A;  1Y8N B;  4AH6 A;  4K6L A;  4IFD G;  4A3B G;  2QW7 A;  1ZXT A;  1ROD A;  5LHY 1;  1A63 A;  4R1J A;  1N36 L;  3GTO H;  3NK9 A;  4M1U B;  2B39 A;  3HOY B;  3T16 A;  3STB C;  1HNW Q;  1FNW A;  1XXG A;  3H0G H;  4OIJ A;  2PI2 E;  1E2V A;  4QUF A;  1IBL Q;  1AE3 A;  3DM3 A;  3QR8 A;  1KTK A;  1V1Q A;  5EQ0 A;  4C2M H;  2Q2U A;  4ALP A;  4BY1 G;  1VQC A;  2KHI A;  4K14 A;  2VW9 A;  3S15 H;  2OXP A;  4K2K A;  2WP8 J;  3V96 A;  3M4P A;  4OL7 A;  5IYB H;  1XNQ Q;  1JOO A;  2RCF A;  3MXP A;  1S72 A;  5C5L A;  4BBR B;  4ZYS A;  2VY3 A;  3E3X A;  4XT3 B;  2I5L X;  2UXC Q;  3NHH A;  3ND8 A;  1HFG A;  4JI5 Q;  2A69 C;  2D9U A;  2LS0 1;  4CKE A;  4LUV A;  5FLX c;  2SNM A;  3TS0 A;  5T1G A;  2IHE A;  3P1H A;  2YTX A;  4FVM A;  1HQM C;  2B2T C;  1RTN A;  1MBY A;  1MGS A;  1SNO A;  2Y0S E;  2CQO A;  4LUO A;  1LO5 D;  1PRT B;  1N34 L;  4LF5 Q;  3I8Z A;  1YJN A;  1SDF A;  4BY7 B;  2ZJP A;  1D5M C;  3K57 A;  1RL2 A;  2BDN A;  1LT6 D;  1HNX L;  1ONL A;  1DJR D;  4HJ5 A;  1S40 A;  5ELC A;  4B3T Q;  4UP7 A;  3I55 A;  1Q46 A;  1LT5 D;  5C0X H;  1J5E Q;  2B2W A;  3I91 A;  1PTO D;  3I3C A;  1WCM B;  5CV6 A;  5C4J H;  4OGQ C;  4PMB A;  4JYA Q;  1Q1B A;  5FKA C;  4DU9 A;  2TSS A;  2NZ1 D;  5IIF A;  3KJO A;  3NUC A;  4A3D G;  1STB A;  4DV5 Q;  2RHQ B;  1GXD C;  1X32 A;  2BE5 C;  1CZG A;  1H9S A;  3KF6 A;  3DM1 A;  2HCI A;  3HKZ E;  5GAE C;  2A68 D;  1LT3 D;  1SYF A;  5LMU L;  4K2L A;  4A4I A;  4KY6 A;  1NE3 A;  1B70 B;  3SDZ A;  4JI7 Q;  1C48 A;  2G5D A;  1SYC A;  5JPM C;  4JI1 L;  1BVS A;  3W3A A;  1VS0 A;  2PI2 A;  2UUB Q;  4IJL A;  4POG A;  2K5H A;  1QUQ A;  1VQ6 A;  1Z9F A;  2RF4 A;  5HY6 A;  1YZ6 A;  3HGB A;  1SRO A;  4L6T B;  5DEH A;  1SR3 A;  5AJ3 Q;  4DV2 Q;  5EKK A;  5I6W A;  1YHA A;  3PIP 3;  1X9N A;  3BJU A;  1DOK A;  1I50 H;  2Z4H A;  3K7U C;  2LKV A;  4I7A A;  3SR1 A;  2E74 C;  2JSO A;  4IUP A;  3S17 B;  4HSP A;  4RGM A;  3Q0A A;  1IYV A;  5C5M A;  3HOX B;  4J15 A;  4RGO S;  3BYT B;  3N6R A;  5IGD A;  1PA6 A;  5CV4 A;  5G3L F;  1EY5 A;  2HCC A;  2WB1 E;  1LYL A;  1NSN S;  2RDF A;  4DN4 M;  1HZ9 A;  1YVC A;  4A76 A;  2B2U A;  1HQR D;  2EPB A;  5D14 A;  3HKS A;  2ZM6 Q;  1XX8 A;  2KCN A;  2EOT A;  3GTP B;  4EQP A;  4YWK A;  1OXV A;  1B3A A;  4LNQ A;  2PO4 A;  1B9M A;  2K6A A;  4KHP L;  1J8I A;  1PFN A;  2OQ0 A;  4C3H G;  1ASY A;  3PF5 A;  4NXM L;  2K33 A;  3OPO A;  1S5D D;  1H9M A;  5IWA L;  3WOE A;  2K5W A;  5D65 A;  4A3F G;  4B3R Q;  2IX0 A;  4DR6 L;  3CQZ B;  3T1H Q;  2ICE C;  1NY4 A;  4JCV E;  4OWT B;  1GHJ A;  1K8A C;  4FF3 A;  2F0S A;  3BDL A;  3CCE A;  1XMO Q;  3MXN A;  4RWS C;  2UXB Q;  3U4V A;  1XPO A;  1DOL A;  1N36 Q;  2X6L A;  4U68 A;  2JA7 G;  3PIO A;  1RF2 D;  2KHJ A;  2FMC A;  2NN6 H;  4MZ9 A;  4XT1 B;  4HJ9 A;  5H1S E;  2K32 A;  3BDO A;  4XYQ A;  5IGG A;  1YHQ A;  1LTB D;  5JJZ A;  1JE4 A;  2RDH A;  3I4L A;  5JVH 3;  2ENB A;  2KJX A;  2A6E C;  4DUZ Q;  4LF6 Q;  4XQN A;  2BH8 A;  2V1C C;  3IFD A;  3IL8 A;  4BBS H;  2RQX A;  1AZQ A;  3H0G G;  4DPG A;  1VQE A;  5M5X H;  1QNK A;  1XWE A;  2UUC L;  1WTQ A;  4LUZ A;  2R7Z B;  1K0S A;  3K81 C;  5JOB A;  4B9W A;  2IHF A;  4YCV A;  4IAL A;  5DNF A;  1EYA A;  1DCZ A;  5BN3 A;  5IYB G;  1JWM D;  3J7Z C;  1X3G A;  1SYG A;  5E4W C;  1HNZ L;  2HHH L;  2XRS D;  2OTL A;  2F0U A;  4L5R C;  3K0Y A;  4WJ3 M;  1F2Z A;  1Y14 B;  4DR5 L;  4HIM A;  5KND A;  2NZO A;  4TSS A;  1N34 Q;  1JB3 A;  2EE1 A;  4I7Z C;  1KC8 C;  1ASZ A;  1PFM A;  2JA5 H;  4DR7 L;  2HIV A;  2VS1 A;  1PVO A;  2VUM H;  2I5M X;  5FO8 B;  1NCV A;  1HNX Q;  1LTA D;  1K73 C;  2UXD L;  2LXK A;  4HCS A;  3T53 B;  5ELF A;  4IO9 A;  1GUG A;  4OHJ A;  5HGQ A;  1YBY A;  4CJ0 B;  4A3K B;  3NXW A;  1EQT A;  3KLW A;  4KMU C;  2E8G A;  3S14 H;  4BY1 B;  2Q8R E;  4WRD A;  4V19 0;  3MA2 B;  1PZK D;  1B53 A;  5C0X G;  4Y7N B;  4MN3 A;  1OXU A;  1Y8O B;  1J6Q A;  4F88 A;  1RCV D;  2OEO A;  2DGY A;  2Y0S G;  3CCV A;  4P73 A;  1RTO A;  4IQZ A;  3RZO B;  3WOF A;  5LMU Q;  1BBW A;  3G48 A;  2N3S A;  1DZ1 A;  2CQA A;  1G29 1;  2JA8 H;  4PNY A;  3OWF A;  1QCB D;  4EGV A;  4XQQ A;  4LF7 Q;  4J1M A;  1ESF A;  3MEH A;  3GTL H;  2C9O A;  2A5H A;  4KY5 A;  2F4V L;  2F0F A;  1SN8 A;  2F0I A;  2Z1C A;  4P75 A;  2ZJQ A;  4YWM A;  2ASB A;  2KCT A;  2PQE A;  3CMA A;  4C3J H;  1MSG A;  3DWA A;  1FNV A;  2I0Q A;  1HR0 W;  3TN2 A;  1VQO A;  1AFP A;  1SMX A;  1TKW B;  1R4Q B;  3D6C A;  1A2U A;  2NVY H;  1MHW C;  1QVF A;  1XNR L;  3I4M B;  3IFT A;  2G9D A;  3TP6 A;  3VYU A;  3S16 H;  3HKZ G;  4L5S A;  3PGZ A;  2H4O A;  1GUN A;  1B9N A;  4CJ2 C;  2IL8 A;  2WAQ E;  5EPJ A;  4ZLT F;  2F0O A;  1K8O A;  1EWH A;  1HR0 Q;  4A3D B;  1SE4 A;  4QB4 A;  2L55 A;  2PW7 A;  5IE8 A;  4JBJ A;  4DR1 L;  1HTL D;  2HUG A;  4ABN A;  5CMD A;  1XJV A;  3FEW X;  2EYJ A;  4A3L G;  5I9P A;  1VQA A;  4DV3 Q;  1SYE A;  4HTH A;  1EY8 A;  4WJ4 A;  3S24 A;  3SK8 A;  3E0J A;  2NB0 A;  2KCC A;  2ZTC A;  1TWF H;  1JE5 A;  4PMC A;  5IWA Q;  2B2V A;  4HR7 B;  5M3F B;  3ONA B;  1W2B A;  2ATW A;  1KXL A;  4BA1 I;  1WD0 A;  1F2L A;  2OT2 A;  2RA4 A;  1S5B D;  2YV5 A;  2EVB A;  4EQO A;  4HSV A;  1Y69 U;  1EOT A;  4RGT A;  1HA5 A;  2WB1 G;  3NPP A;  2K28 A;  3J81 j;  4MIU A;  1E2W A;  5M3M H;  2K50 A;  4A93 H;  1KRT A;  3AFQ A;  5IT9 L;  2FJ2 A;  1VQM A;  2CW0 D;  2X6G A;  2A73 B;  4P74 A;  1YJ9 A;  2PW5 A;  2EYP A;  4C3I B;  1HUM A;  2CH4 A;  1B2T A;  1I4X A;  3J81 c;  3R8B A;  5IT9 E;  3I4N B;  3FKI B;  1PH6 A;  3M4O H;  4L5Q A;  5GAD C;  1LAB A;  1Q82 C;  1BCP C;  1CZW A;  1O7Y A;  2NVT B;  3MWY W;  3RR5 A;  4PV1 C;  1YNN D;  4U67 3;  1F9P A;  1C0A A;  4ZCK A;  5ELN A;  3ZJY C;  4DKA C;  1I6H H;  4B08 A;  1YI2 A;  1WI5 A;  1HZB A;  4NMZ A;  4GNX B;  4H13 C;  4BBS G;  3K0X A;  1SYD A;  3RMH A;  1CHP D;  1GKH A;  1L1O B;  3GDE A;  2ZXO A;  4X3U A;  2E2J H;  1HNZ Q;  3MHB A;  4S3S A;  4DR5 Q;  4A3F B;  2CHB D;  4KJN A;  3MAQ A;  3EVQ A;  1ZYR C;  4KHZ A;  4H44 C;  2D5D A;  1CHQ D;  2GVA A;  3NEL A;  1Q7Y C;  1NNX A;  2KUM A;  1O80 A;  1NR2 A;  3S1Q H;  1B4O A;  3VYT A;  1QJO A;  1BR9 A;  4ZUJ A;  2JA7 B;  3CKI B;  1EU4 A;  2B2U C;  2JA5 G;  1DM0 B;  4N9T A;  2VUM G;  1C4Q A;  2Z0S A;  2MHV A;  2OWO A;  2XRQ D;  5G3L D;  1NBW A;  5JEA H;  2E5L L;  1W6K A;  3S2H H;  1KRS A;  3G6E A;  1B7Y B;  5K5P A;  2B2Y A;  4JBK A;  3T51 B;  2O2L D;  2R93 G;  3U50 C;  2IX3 A;  1Z47 A;  1VQJ A;  1AN8 A;  3TZU A;  2EY2 A;  4IPD A;  3R2I A;  1QE6 A;  3BYY B;  5C4H A;  3WDN A;  4R8N A;  2IJ0 A;  1SJH D;  1G91 A;  4TQU S;  3NSW A;  2A6H D;  1PYS B;  1WOC A;  1WTX A;  5JPN C;  1SMY C;  3NTI A;  5T1I A;  4HAE A;  3J7A F;  1Z7T A;  3T4A C;  3GTG B;  1GJX A;  2EYO A;  4G57 A;  4HED A;  4IFD J;  2JA8 G;  1VQL A;  2RSN A;  2L11 A;  3S1R B;  2NVX H;  4M8A A;  4JOI A;  3OWE B;  5LMN L;  4Q5V A;  3RN5 A;  1RD9 D;  3A55 A;  1G2T A;  2EYM A;  3CCS A;  1T5X D;  2K5V A;  2D0O A;  1U4P A;  3K80 C;  1HUN A;  2Q2I A;  1PH2 A;  4DAV A;  1XNR Q;  2F1M A;  2IT1 A;  3E9I A;  4DXF A;  2HQE A;  1A6X A;  4G4K A;  3WWV A;  3TRZ A;  1B3Q A;  4L8J A;  1SND A;  4K8I A;  1AZP A;  1K83 H;  1JR0 D;  2PNH A;  3CRK C;  4IUR A;  2N49 A;  5A35 A;  3A5Z B;  4JC0 A;  3HOZ B;  1BXT A;  4DR2 L;  4G7O C;  4A3I H;  2K14 A;  1B44 D;  2Y0S B;  1BBX C;  3RUZ A;  2JP1 A;  5CC4 A;  1EY0 A;  3CF5 A;  4UP9 A;  1F9R A;  5J39 A;  3K58 A;  1LTT D;  2ZXR A;  5J22 A;  5EAY A;  1BOS A;  5NUC A;  2F0T A;  1JOR A;  3S1M H;  1FYC A;  3NTK A;  3VA5 A;  1V1P A;  4K5W A;  2Q2T A;  4OX9 L;  1A0I A;  2F0G A;  5EBC A;  1XMQ L;  4IOA A;  3F1Z A;  3HG9 A;  1LAC A;  1NJI C;  3W1B A;  4GZY C;  2BA0 A;  3Q22 A;  5D3D A;  1X3E A;  2HD3 A;  2WAQ G;  3CP0 A;  5LL6 S;  4IJH A;  4JBW A;  4X6A H;  4LAA A;  3RN2 A;  1IL8 A;  3RZD B;  1PLF A;  4DNI A;  1U5K A;  2PZW A;  4MTK A;  2JA6 H;  3H3V I;  1KLU D;  1GO3 E;  1LLR D;  1HH2 P;  3EBE A;  1RJT A;  2PQA A;  4O42 A;  3TP7 A;  3JC6 6;  3TME A;  5I2Y A;  2KED A;  2CFM A;  1UNS A;  1TT2 A;  1VQH A;  2XWJ B;  1SFO B;  4X3T A;  3CD6 A;  2VL6 A;  2A8V A;  2Z6K A;  4A93 G;  5M3M G;  5IYC H;  2K5N A;  5K36 H;  1PTO H;  5KEE A;  2PPB C;  3KJP A;  2BDO A;  5DM7 3;  2R7F A;  2JXM B;  3W1G A;  4TRD A;  1VQD A;  4OXP A;  4F8M A;  4JPB W;  1V43 A;  3NBH A;  2D2C C;  4QCL A;  4XQJ A;  3GTJ B;  2XIW A;  4BWG B;  4DAY B;  4APV A;  2AQ1 B;  2PZU A;  3P20 A;  3EA6 A;  4QMG A;  1VQP A;  4DV4 L;  1VDZ A;  1FL0 A;  3C1E A;  4A3E H;  1B1Z A;  4WJW A;  1SSO A;  2CWA A;  2JA9 A;  3FP9 A;  2FHT A;  5C3E H;  2K03 A;  5I9O A;  2VXW A;  4DV7 L;  3ICE A;  5KIX A;  3BG3 A;  1I3Q H;  2A74 C;  2B8G A;  1EQV A;  4B3M L;  1X55 A;  4IOC A;  4ZKC B;  1FR3 A;  3UI2 A;  1DXM A;  3B6Y A;  2GA4 B;  5IP7 H;  1ZEQ X;  5JJK A;  1D1K A;  5CV7 A;  4DGZ A;  1TWA B;  4YY3 Q;  2EJG C;  1VQ7 A;  4OEL B;  4LMQ D;  1H9J A;  4HCE A;  2JJQ A;  3CC2 A;  1S3O A;  2R92 H;  2E5L Q;  5EGT A;  4X66 Q;  1PHJ A;  4UAI A;  1MJE A;  1LTR D;  1HCZ A;  2B2V C;  4HJ8 A;  4ZUI A;  4H02 A;  5C6A A;  1EIH A;  1D5X C;  4LFB L;  1VF7 A;  2I07 B;  3M9B A;  1XPU A;  2KHS A;  2C35 B;  5JEA G;  1PYB A;  3NBI A;  4XIG S;  2XVS A;  1A15 A;  2DY7 A;  1D6E C;  4HIK A;  1Q12 A;  3K7A H;  3PO2 B;  1IYJ B;  3NWT A;  4RKB A;  2E76 C;  2KEC A;  3D0F A;  5EKI A;  1VMP A;  3CCJ A;  4RH6 A;  3M3Y H;  2F0K A;  4WFN 3;  4A3M H;  1R9T B;  1QNU A;  2B63 G;  2OTJ A;  3D4W A;  1G6Z A;  3FVQ A;  5ELE A;  1CKN A;  4IN3 A;  1CA5 A;  4AYB E;  2KEN A;  5LMN Q;  3VR6 A;  2V4D A;  1PH5 A;  1I94 Q;  4IPH A;  3MXU A;  3QIA A;  1KIX A;  2YTV A;  4IUQ A;  4LJZ C;  2K01 A;  2CKZ B;  4CKB A;  1SE3 A;  4RGN A;  2XWB B;  1EY6 A;  2JA5 B;  3OIP A;  1VQ8 A;  1TWH B;  5KYI A;  4IFD I;  3DUZ A;  3HOY H;  5C44 G;  4QIW B;  1K8G A;  4DR2 Q;  1E1O A;  1TQO A;  4MNO A;  3RD4 A;  3TP5 A;  2EDG A;  2F3W A;  3HOW H;  2RKS A;  4JK1 C;  4X65 L;  4FXK C;  1IZ6 A;  5C4X G;  2VQE L;  4JI0 L;  3FPP A;  2D62 A;  3SXH A;  2R93 B;  4GOP A;  1HHV A;  4RAU C;  3D4R A;  4BBR H;  2F03 A;  1CSP A;  3I90 A;  3PO3 B;  2MFI A;  3BVM A;  3GV6 A;  4V0B A;  1IYU A;  4DR3 L;  4A3I G;  1QZG A;  2K5Q A;  2ZT9 C;  3C1F A;  2IW3 A;  1EQQ A;  2Q8I B;  2EIF A;  2P5Z X;  2MGS A;  1ILP A;  2A1A A;  2XN9 C;  3AMU A;  3UE0 A;  4OX9 Q;  5BR8 Q;  1TS2 A;  5E7N A;  1EIF A;  3OW2 A;  3NP8 A;  4RKL A;  1P8L A;  4DK0 A;  1NTG A;  5IGF A;  2WII B;  1YNJ C;  1CKO A;  2EXZ A;  2KOL A;  1SAP A;  4KHV A;  3DEP A;  3HOU B;  1HJP A;  1D2B A;  3KF8 B;  1EY4 A;  2B2Y C;  3C3L A;  1BO0 A;  4A3G B;  2B8F A;  2RVL A;  1PH7 A;  2K5D A;  1IBM L;  1Y1W B;  5C0X J;  1V1O A;  1CTM A;  1WCM H;  3M4Q A;  2NVY B;  1F77 A;  1WTH A;  3MFG A;  2JA6 G;  3GD7 A;  3TQY A;  1CQF A;  4QF4 A;  5IGE A;  3PF4 A;  4KD3 A;  2E2D C;  3TS2 A;  2KVM A;  1YJW A;  1TU2 B;  4HID A;  1XTD A;  1EQR A;  2LY7 A;  1SBB B;  1L2F A;  2NVQ H;  5CV5 A;  5IYC G;  4RG1 A;  5K36 G;  1PV4 A;  4LWC A;  1RHP A;  5COR A;  4K6D A;  1BNZ A;  3M4Y A;  4JOI C;  2RHS B;  5BN4 A;  2M00 A;  2H5X A;  4LF9 L;  3M7G A;  1PRT D;  4KI0 A;  2KEE A;  4HN7 A;  3HS0 C;  3HOV B;  3K5M A;  1BDO A;  3EQL C;  2A19 A;  3QOL A;  3M85 A;  4NPS A;  3H3V H;  4DV7 Q;  3KFU A;  4A3B B;  1XYI A;  4B3M Q;  3H94 A;  4HJA A;  2QEX A;  4A3E G;  1PH4 A;  2ICI A;  3ULL A;  5CGK A;  4JG2 A;  4E6I A;  4OWW B;  2R3Z A;  3I2Z A;  3PUY A;  3X3N A;  4H0L C;  1LTG D;  4RFB A;  1TWG H;  2SOB A;  3R93 A;  1S5F D;  3BZD B;  4HJ7 A;  1TVX A;  3HOX H;  3GP7 A;  1IKL A;  1MD2 D;  3S1N B;  1WTW A;  4DK6 C;  3FRP B;  1D5Z C;  2I5H A;  2AUK A;  3PMF A;  4RHR A;  5FLM H;  4UPA A;  3PIO 3;  3A5U A;  3STB D;  2E2I B;  2GVB A;  1C8C A;  3K59 A;  3A7A B;  4HMI A;  2R92 G;  1ESR A;  2CWP A;  2Q2H A;  5IT9 c;  3GTP H;  3M4O B;  3CRL C;  3ULJ A;  4JI1 Q;  3P7J A;  3CCL A;  3E9H A;  1DD2 A;  3IKJ A;  1VQ4 A;  1VQN A;  2EY1 A;  2DUD A;  1MKH A;  4N9P A;  2WAC A;  3SVM A;  3TP8 A;  1GD7 A;  4F87 A;  1I6H B;  1VQI A;  5M5Y B;  1IHZ A;  2A69 D;  1WVL A;  4RHS A;  4KJO A;  1CQV A;  1I4P A;  1VMC A;  5EKL A;  1QZH A;  1MI2 A;  1K28 A;  2E2J B;  1LTL A;  3GTM H;  3CC7 A;  2DY8 A;  4QQB X;  2Z6K C;  2VB3 X;  5GQO A;  4UP8 A;  4KLK A;  3N52 A;  1KAB A;  1R4P B;  2UU9 L;  4DV0 L;  5M5W H;  2XGT A;  4KN4 C;  1IL2 A;  1STY A;  3DXJ C;  1ENC A;  3EIV A;  4R9W A;  2PNR C;  5AFW A;  4PG3 A;  4X65 Q;  1YHB A;  2VQE Q;  2Z4I A;  4KKT A;  4JI0 Q;  1EFI D;  4DAM A;  3HOY G;  2QA4 A;  1GUO A;  3MTS A;  2L12 A;  4OON A;  1PTO F;  5CR3 A;  2MPM A;  5FOB B;  1T9H A;  1EIG A;  1M8A A;  1PFS A;  2C5C A;  3ITP A;  2R7Z H;  1J9O A;  3FDT A;  4JV5 L;  4PZ8 A;  4IUN A;  4KHP Q;  1DYQ A;  4AYB G;  3HOW G;  4CDE C;  4NXM Q;  4A75 A;  2B3G A;  4FNF A;  3DEO A;  1BCP F;  2BE5 D;  5F2D A;  5TSS A;  3KBX A;  1SXT A;  4DA2 A;  1VF5 C;  4BBR G;  1TS3 A;  2J0T D;  4GKK L;  2L1B A;  2BCO A;  2B63 B;  3A7L A;  4DR6 Q;  4J6H A;  2B2W C;  3A54 A;  1FJG L;  4YHH L;  1V1P B;  1KQS A;  4LF8 L;  1SNQ A;  2QEJ C;  1Q8I A;  4GKJ L;  4A3C H;  3OMG A;  2F0L A;  3KDF B;  1VQ5 A;  4TVA B;  4IFD H;  1PMR A;  2XTI A;  1QVG A;  1QWY A; 
#chains in the Genus database with same CATH homology
 4QIW E;  3HKZ E;  5GAE C;  2VQF Q;  1FGU A;  4DR2 L;  5LMU L;  4A4I A;  5J3B A;  5IP9 H;  4JI2 L;  1K3R A;  1IBM Q;  4BA2 I;  4A3I H;  1NE3 A;  1B70 B;  4A3K H;  5C3E G;  2PQA B;  2K14 A;  3U4Z A;  1N33 Q;  4JI7 Q;  3D31 A;  3S17 H;  4JI1 L;  2NN6 G;  4BY1 H;  1BVS A;  1XPR A;  1VS0 A;  3CF5 A;  2PI2 A;  4UP9 A;  2UUB Q;  3K8A A;  2UUC Q;  3PUZ A;  4IJL A;  1TWH H;  4POG A;  2HIX A;  2K5H A;  1QUQ A;  1QVC A;  1VQ6 A;  1HNW L;  1Z9F A;  5IP7 G;  1IBL L;  2RF4 A;  3CCQ A;  5EAY A;  1YZ6 A;  5HY6 A;  1SRO A;  4DV6 L;  4A3J G;  4OO1 I;  3S1M H;  1SR3 A;  4JI8 L;  5AJ3 Q;  4DV2 Q;  2CCZ A;  3RZO H;  1YHA A;  4LW1 A;  4LFB Q;  1X9N A;  3BJU A;  2Q2T A;  4OX9 L;  1I50 H;  1HZC A;  3K7U C;  1A0I A;  4LF9 Q;  1XMQ L;  4IOA A;  1M1K C;  2R93 H;  3F1Z A;  1NJI C;  2HHH Q;  3W1B A;  2BA0 A;  3HOZ G;  1X3E A;  2WAQ G;  3CP0 A;  1K0R A;  4IJH A;  4OO1 G;  3PO3 H;  4J15 A;  1E1T A;  4JBW A;  3L7Z C;  2UXC L;  4X6A H;  3RN2 A;  1HZA A;  4JI5 L;  1PA6 A;  3KYH C;  1D8L A;  4DNI A;  1U5K A;  4DR7 Q;  3H3V I;  2JA6 H;  1GO3 E;  4P71 A;  1HH2 P;  2QGQ A;  2ZTE A;  3EBE A;  4IPC A;  1UE7 A;  2AHO B;  1IBK L;  4BXX H;  2PQA A;  1C7Y A;  4JI3 L;  2WB1 E;  1AH9 A;  3UDG A;  3JC6 6;  3J80 i;  1LYL A;  2JE6 I;  2AWO A;  4QGU A;  2UXD Q;  4GN3 B;  1EIY B;  4JI4 Q;  2CFM A;  1E3P A;  1VQH A;  3CQZ H;  1HZ9 A;  1YVC A;  2MO1 A;  4L5T A;  3JAM i;  4A76 A;  3L2P A;  3A0J A;  3HKS A;  3CD6 A;  2ZM6 Q;  1SLJ A;  5DLQ E;  2VL6 A;  3F2D A;  1JB7 A;  2Z6K A;  2A8V A;  5M3M G;  1X65 A;  2K5N A;  5IYC H;  3I4M H;  4A93 G;  4A3M G;  4LF5 L;  1Y1V G;  2OCE A;  4GOP C;  3KJP A;  4YWK A;  1OXV A;  2R7F A;  3OTO L;  2NZH A;  3W1G A;  4LNQ A;  1H95 A;  4LFC L;  1VQD A;  4OXP A;  4KHP L;  5IY0 A;  1KD1 C;  3HOU H;  2OQ0 A;  2B29 A;  4AIM A;  1ASY A;  3PF5 A;  4NXM L;  1LM0 A;  3E0E A;  1V43 A;  5IWA L;  2F3I A;  2ZTD A;  4OWX B;  1G6P A;  4XTC S;  2AWN A;  4PZ7 A;  4A3G H;  1A62 A;  4A3F G;  4B3R Q;  4DAY B;  2IX0 A;  4APV A;  1E22 A;  4O0A A;  4DR6 L;  1AE2 A;  3T1H Q;  5GAH C;  1Y1W H;  1FVI A;  1NY4 A;  3KF6 B;  4JCV E;  4OWT B;  1K8A C;  2R6G A;  2HQL A;  1VQP A;  4DV4 L;  1XMO Q;  1WYD A;  1FL0 A;  3CCE A;  2VNU D;  4A3E H;  4B3S L;  5GRO A;  5FLM G;  2CWA A;  2JA9 A;  3FP9 A;  5C3E H;  1SE8 A;  1V9P A;  4JI6 Q;  2UXB Q;  4GNX C;  3U4V A;  1XPO A;  4X62 L;  1N36 Q;  2JA7 G;  1L1O C;  3PIO A;  2KHJ A;  4MZ9 A;  4HJ9 A;  2F4V Q;  4DV7 L;  3ICE A;  1EUJ A;  5H1S E;  3HFZ B;  4DR3 Q;  3FHW A;  1I3Q H;  5M3F H;  4B3M L;  1X55 A;  1YHQ A;  3JAM c;  4IOC A;  4P72 A;  3F2C A;  1QUQ B;  3B6Y A;  5IP7 H;  1K9M C;  2JK8 A;  1X6O A;  5JJK A;  1E24 A;  4YY3 Q;  1NMG A;  4DUZ Q;  1YNX A;  4LF6 Q;  3GTQ H;  3J81 i;  2BH8 A;  2V1C C;  4QY7 A;  1CKM A;  4BBS H;  1EFW A;  1GM5 A;  1VQ7 A;  3H0G G;  4DPG A;  5JJL A;  1VQE A;  5M5X H;  1LUZ A;  3CCU A;  2UUC L;  2UU9 Q;  3PUX A;  4UY8 C;  3RNU A;  3HOV H;  4DV1 L;  2JJQ A;  1PH1 A;  1S3O A;  2YTY A;  4LUZ A;  3CC2 A;  2R92 H;  2E5L Q;  1D7Q A;  3K81 C;  4X66 Q;  1PHJ A;  2IHF A;  3BZC A;  4YCV A;  1MJE A;  4A3B H;  4HJ8 A;  4H02 A;  1CUK A;  1YEZ A;  2L15 A;  4LFB L;  5IYB G;  2KCM A;  4C3I H;  3M9B A;  3J7Z C;  1XPU A;  4DUY Q;  1X3G A;  4LFA L;  3UDX A;  3T1Y Q;  2RCN A;  2C35 B;  5JEA G;  2E2H H;  1PYB A;  3I4N H;  1HNZ L;  4BY7 G;  2HHH L;  4XIG S;  1JMC A;  3FKI H;  4LF4 Q;  2MNA A;  2OTL A;  4L5R C;  1EOV A;  1Y14 B;  4WJ3 M;  3PUV A;  4AQY Q;  5IYD H;  4DR5 L;  4HIM A;  4DR1 Q;  4K0K Q;  1X54 A;  2NZO A;  2NVT H;  1N34 Q;  3S1N H;  3CW2 C;  4PMW A;  4HIK A;  4GN5 A;  1Q12 A;  3K7A H;  2N78 A;  1X3F A;  1IYJ B;  1KC8 C;  1ASZ A;  1BKB A;  3D0F A;  3EN2 A;  3DLL A;  3CCJ A;  2JA5 H;  2HIV A;  2VS1 A;  4GLA C;  3M3Y H;  3RLO A;  4A3M H;  2VUM H;  2I5M X;  1KHI A;  3OYY A;  4IPG A;  3RLN A;  2B63 G;  2OTJ A;  2K75 A;  4Y7N H;  1HNX Q;  3J7A 5;  1PH3 A;  1K73 C;  1WCM G;  1X56 A;  2E2I H;  1CKN A;  2UXD L;  1Q86 C;  1UE1 A;  4DK3 C;  3CPW A;  2LXK A;  4ME3 A;  5C0X I;  4GKK Q;  4AYB E;  2KEN A;  4IO9 A;  5LMN Q;  1N32 Q;  2N8N A;  3NBH B;  1PVO A;  4GLV B;  1PH5 A;  2BA1 A;  5HGQ A;  1I94 Q;  1YBY A;  4R4I A;  2R7Z G;  4IPH A;  2R7D A;  3MEF A;  1TXY A;  1KIX A;  2YTV A;  4LF8 Q;  1XNQ L;  2CKZ B;  3KLW A;  2E8G A;  3S14 H;  3AQQ A;  2K4K A;  1UE6 A;  1WJJ A;  4GKJ Q;  1KAW A;  1VQ8 A;  4IFD I;  3M7N A;  5C0X G;  3HOY H;  5M5Y H;  2BH2 A;  5C44 G;  3W5O A;  1OXU A;  2MO0 A;  3MXN B;  4RMF A;  1J6Q A;  1EWI A;  2UUA L;  2FXQ A;  3L0O A;  2DGY A;  2Y0S G;  1K8G A;  3CCV A;  4P73 A;  2JA7 H;  4DR2 Q;  4QJF A;  1E1O A;  4MNO A;  5LMU Q;  1BBW A;  3G48 A;  3T1H L;  2N3S A;  3PO2 G;  5FJ8 H;  1G29 1;  1Q8K A;  3PUW A;  4X65 L;  2KBN A;  1IZ6 A;  3HOW H;  4A3C G;  2VQE L;  3I7F A;  3AFP A;  4JI0 L;  5C4X G;  2JA8 H;  2D62 A;  1OTC A;  3UE1 A;  4NXN L;  4EX5 A;  4GOP A;  5GAG C;  4HIO A;  4BBR H;  3NEN A;  4LF7 Q;  3CPF A;  1CSP A;  2EQS A;  2F52 A;  4R4O A;  2UXB L;  2MFI A;  3GTL H;  5JEA J;  1N9W A;  1JT8 A;  2F4V L;  5IP9 G;  1SN8 A;  4DR3 L;  4P75 A;  1VQF A;  4YWM A;  4A3I G;  1QZG A;  4A3K G;  4DV6 Q;  1PH9 A;  2ZJQ A;  2ASB A;  2KCT A;  3I4O A;  3CMA A;  4C3J H;  1YIT A;  4B3T L;  4JI8 Q;  1JJG A;  1EQQ A;  2EIF A;  4A3D H;  2I0Q A;  1RIP A;  2A1A A;  1HR0 W;  4DR4 L;  3HOX G;  4YY3 L;  1VQO A;  3UE0 A;  4DUZ L;  3VDY A;  1SMX A;  2ID0 A;  1J5E L;  4OX9 Q;  5BR8 Q;  4LF6 L;  1UWV A;  1L0W A;  2NVY H;  5E7N A;  1EIF A;  3OW2 A;  1QVF A;  1XNR L;  2IX1 A;  3LGJ A;  1P8L A;  4JYA L;  1C9O A;  1NTG A;  3IRB A;  3S16 H;  3I56 A;  3NEM A;  3HKZ G;  4X64 L;  4L5S A;  4GNX A;  1KL9 A;  1CKO A;  3CCM A;  1L1O A;  4X66 L;  4DV5 L;  3GTG H;  3ERS X;  3PGZ A;  1JJ2 A;  1HJP A;  3GTK H;  4FDB A;  3J80 c;  3KF8 B;  1O7I A;  1OXX K;  2WAQ E;  3BU2 A;  3RLF A;  1IBK Q;  2D0P A;  4YCW A;  3PIP A;  4JI3 Q;  4JBM A;  4EQ5 A;  2VQF L;  2OQK A;  4R4T A;  3S1R H;  1HR0 Q;  2ZJR A;  4GN4 B;  1PH7 A;  2B63 H;  1JJC B;  3PO3 G;  1IBM L;  4JV5 Q;  5C0X J;  4A3J H;  5IE8 A;  2PMZ E;  3M4Q A;  1WCM H;  3Q8D A;  1N33 L;  4JBJ A;  4YCU A;  4JI7 L;  2ES2 A;  4DR1 L;  1CKN B;  2JA6 G;  5JJI A;  3AYH B;  1Q1E A;  3GD7 A;  1XJV A;  3TQY A;  3OTO Q;  1A8V A;  4BXX G;  3PF4 A;  4A3L G;  2UUB L;  3CCR A;  1VQA A;  4LFC Q;  4DV3 Q;  4DV0 Q;  4WJ4 A;  3TS2 A;  3S24 A;  2AKW B;  2MQH A;  2ZTC A;  1YJW A;  1TWF H;  4HID A;  3PCO B;  1XTD A;  1EQR A;  1JE5 A;  1G51 A;  4GS3 A;  3HOZ H;  5IWA Q;  1SRU A;  1L2F A;  1VQK A;  2NVQ H;  5AJ3 L;  5IYC G;  4RG1 A;  3I4M G;  4DV2 L;  5K36 G;  1PV4 A;  3CXC A;  4LWC A;  1W2B A;  2ATW A;  1W3S A;  4DR7 L;  4BA1 I;  4GLX A;  1KXL A;  4NB3 A;  5C44 H;  4JOI C;  1I5F A;  1TWC H;  2RHS B;  2H5X A;  1I94 L;  4LF9 L;  5LMN W;  3G4S A;  3PV0 A;  3ER0 A;  3HOU G;  4KI0 A;  3F8T A;  2YV5 A;  3TRE A;  4B3S Q;  2JEB I;  4R4C A;  2YU9 H;  5C4X H;  2WB1 G;  4A3G G;  3J81 j;  4X62 Q;  2A19 A;  1OXT A;  3UDI A;  4A93 H;  5M3M H;  2K50 A;  2NN6 I;  3M85 A;  1Y1W G;  1NMF A;  4NPS A;  4GOP B;  1N8R C;  4DV7 Q;  3H3V H;  1Y1V H;  3KFU A;  1KRT A;  3AFQ A;  1MIU A;  1B8A A;  1VQM A;  4B3M Q;  2WFW A;  2QEX A;  4HJA A;  2IY5 B;  4A3E G;  1PH4 A;  4P74 A;  3ULL A;  1YJ9 A;  4JG2 A;  4JI4 L;  4OWW B;  4C3H H;  3J81 c;  3I2Z A;  2K52 A;  3PUY A;  1P16 A;  2EXD A;  1WFQ A;  2ZM6 L;  3SGI A;  1TWG H;  1PH6 A;  1EYG A;  3M4O H;  4L5Q A;  5GAD C;  1IXR A;  4LF7 L;  5ELO A;  4YHH Q;  1FJG Q;  4HJ7 A;  1BBU A;  5M3F G;  3HOX H;  4A3F H;  1Q82 C;  1VQ9 A;  3AEV A;  3RR5 A;  3UDF A;  4QL5 A;  3RZD H;  4DV1 Q;  4DK6 C;  1C0A A;  2I5H A;  5ELN A;  3ZJY C;  4DKA C;  2LXJ A;  1I6H H;  1DGS A;  2AMC B;  3ULP A;  1YI2 A;  3A74 A;  3S2D H;  5FLM H;  4UPA A;  1WI5 A;  4MTN A;  4POF A;  3A5U A;  1HZB A;  3STB D;  4GNX B;  4BBS G;  2GVB A;  3K0X A;  3TEH B;  1U0L A;  4B3R L;  1GKH A;  1L1O B;  4LFA Q;  3GDE A;  1SFO H;  4R4Q A;  5BR8 L;  3HOV G;  2E2J H;  4PZ6 A;  4JI2 Q;  2R92 G;  1HNZ Q;  2CWP A;  2Q2H A;  3KDF A;  5IT9 c;  4O2D A;  3U58 A;  1XMO L;  1Q81 C;  1UEB A;  4AH6 A;  4IFD G;  3ULJ A;  4A3B G;  4DR5 Q;  4JI1 Q;  3CCL A;  3E9H A;  1VQ4 A;  1VQN A;  4JI6 L;  2DUD A;  1MKH A;  4KHZ A;  4R1J A;  3KF6 A;  1N36 L;  3GTO H;  1A63 A;  1GD7 A;  1MJC A;  1VQI A;  2GVA A;  3NEL A;  2HT1 A;  3STB C;  3CME A;  2ALY B;  3H0G H;  1Q7Y C;  1IBL Q;  3I4N G;  2PI2 E;  3FKI G;  1HNW Q;  3GTJ H;  4A3L H;  1AE3 A;  1HR0 L;  3S1Q H;  3DM3 A;  1V1Q A;  4C2M H;  2Q2U A;  4ALP A;  3CAM A;  1QZH A;  4BY1 G;  1OXS C;  1VQC A;  2KHI A;  3H15 A;  2VW9 A;  2JA5 G;  1LTL A;  3S15 H;  3GTM H;  1XMQ Q;  2WP8 J;  3CC7 A;  2VUM G;  4QQB X;  2Z6K C;  3M4P A;  2Z0S A;  5GQO A;  5IYB H;  2GN5 A;  1XNQ Q;  4UP8 A;  1S72 A;  2OWO A;  1GVP A;  4KLK A;  4DV3 L;  2UU9 L;  4DV0 L;  5M5W H;  1NBW A;  4BY7 H;  2VY3 A;  3CC4 A;  2XGT A;  4Y52 H;  2E5L L;  1IL2 A;  2I5L X;  2UXC Q;  3S2H H;  1KRS A;  1UE5 A;  3G6E A;  4JI5 Q;  1B7Y B;  4LUV A;  4JBK A;  1M90 C;  5FLX c;  3GTP H;  2VZA A;  3TS0 A;  2UUA Q;  3BZK A;  2R93 G;  3U50 C;  3PSI A;  1Z47 A;  1VQJ A;  3EIV A;  3GO5 A;  4IPD A;  2IHE A;  4DUY L;  2YTX A;  3T1Y L;  1TWA H;  4PG3 A;  4X65 Q;  1YHB A;  2VQE Q;  4JI0 Q;  4LF4 L;  2Y0S E;  4DAM A;  1VCI A;  3HOY G;  4TQU S;  2QA4 A;  4AQY L;  4YWL A;  4NXN Q;  2CQO A;  1PYS B;  1WOC A;  4LUO A;  4K0K L;  4OON A;  1N34 L;  4LF5 Q;  1T9H A;  1YJN A;  1PFS A;  2ZJP A;  2R7Z H;  1RL2 A;  4JV5 L;  4PZ8 A;  4KHP Q;  4AYB G;  5FJ8 G;  1E7Z A;  2JQO A;  3KOJ A;  3HOW G;  1HNX L;  4NXM Q;  4A75 A;  2B3G A;  4IFD J;  4HJ5 A;  2JA8 G;  1VQL A;  1S40 A;  4B3T Q;  1VQG A;  4UP7 A;  4BBR G;  3I55 A;  2NVX H;  4JOI A;  4GKK L;  4DR4 Q;  1YIJ A;  1Q46 A;  5LMN L;  1J5E Q;  1PH8 A;  1N32 L;  3RN5 A;  2JEA I;  4DR6 Q;  3CCS A;  1VQB A;  2K5V A;  2D0O A;  3K80 C;  2Q2I A;  1PH2 A;  4YHH L;  4DV4 Q;  1FJG L;  4LF8 L;  1CSQ A;  1KQS A;  1XNR Q;  5C4J H;  4JYA Q;  2IT1 A;  3E9I A;  1Q1B A;  3G71 A;  3PO2 H;  4GKJ L;  4X64 Q;  3KJO A;  4A3C H;  2YYZ A;  3WWV A;  3TRZ A;  4A3D G;  4DV5 Q;  2LSS A;  2RHQ B;  3KDF B;  1K83 H;  2PNH A;  4TVA B;  5IYD G;  3F2B A;  1R9T H;  1VQ5 A;  2N49 A;  3A5Z B;  4JC0 A;  2XTI A;  1QVG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...