4OX9L

Crystal structure of the aminoglycoside resistance methyltransferase npma bound to the 30s ribosomal subunit
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Molecular recognition and modification of the 30S ribosome by the aminoglycoside-resistance methyltransferase NpmA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome/antibiotic
total genus 16
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ox9L00
5FLMG 1KXLA 1K73C 4AYBE 4KI0A 4GNXB 4A3BG 1A8VA 1D7QA 3RN5A 3B6YA 4X65L 3I56A 4A3FH 1OXTA 3PUWA 1QZGA 4DV0L 2JA8G 4GKKL 4TVAB 5M3MH 1QVGA 2Q2IA 1KAWA 2IX0A 2BA0A 2XTIA 3K7AH 4A93H 1KL9A 1AE3A 4X62Q 1VQKA 4R4QA 1VQEA 1JMCA 4QGUA 4A3EG 3S16H 2AMCB 1SLJA 3H3VI 1X6OA 3TS2A 1IBMQ 1SE8A 1IBLL 3HOZG 4GOPC 2XGTA 3UE0A 1L1OA 4QL5A 3W1BA 2N3SA 1EIFA 4X62L 2GVBA 5IYDH 1OXSC 3JC66 5H1SE 4A3FG 4LWCA 1L0WA 1NTGA 3I4NH 2IHFA 4O2DA 2LXKA 2BH2A 5M3MG 1E1OA 2MO0A 1IBML 2K14A 1U5KA 4OWTB 3GTQH 4BA1I 4BY1H 1CKMA 3ICEA 1WCMH 5LMNQ 4B3SQ 1TWFH 3PUZA 5GAHC 4MZ9A 4DR1L 5C0XJ 4AIMA 3GTMH 3CCMA 4L5TA 3WWVA 1P16A 1VQMA 2PI2A 3AYHB 4A3IG 1PFSA 4IJLA 5LMNL 4B3SL 1N33Q 2K4KA 4OO1I 2KHIA 3L7ZC 5K36G 1YJ9A 2C35B 3F2BA 3T1HQ 3MEFA 4DV7Q 2I5HA 4BY1G 4HJ5A 3HOVH 4YCUA 3I55A 3S17H 4P72A 1WCMG 3K0XA 3CC7A 1GD7A 4R4IA 2Z6KC 2EQSA 1CSQA 2QA4A 1YHAA 4LFBQ 4WJ3M 3T1HL 4MTNA 1GVPA 1FJGQ 4DV7L 2WB1G 4ALPA 3JAMc 2GN5A 2MQHA 2WAQE 4GNXA 3AEVA 3AFPA 1CUKA 4DV1Q 1G291 4JI0Q 1VQ4A 1YI2A 1I94Q 1HZCA 2PI2E 3CC2A 3AFQA 1BVSA 1LYLA 3KOJA 4A3GH 4LFBL 3E9HA 3TREA 5FJ8G 4L5QA 4B3MQ 3CQZH 4X66Q 4DUYL 1X3EA 4BBRG 3CCLA 5IYCG 4DV1L 4JI0L 3BJUA 5LMUL 1SROA 2D0OA 2NVXH 5J3BA 2JEBI 1YNXA 4K0KL 1Q82C 4B3ML 4X66L 4DR6Q 3M3YH 3AQQA 3M9BA 4AQYQ 1N36L 3S14H 1QUQB 1HH2P 4H02A 2OQ0A 3UDGA 2Q2TA 1PVOA 3CCEA 4A3GG 3F1ZA 1TWHH 1P8LA 1TXYA 1LTLA 1IL2A 3GDEA 1NMGA 4R4TA 1I3QH 2EXDA 2JA5G 3RLOA 3S2HH 4GOPB 2VL6A 1K9MC 1JJ2A 3GD7A 4DR6L 1CKOA 4X64Q 1MJCA 4X6AH 3M7NA 1MJEA 5BR8L 2LSSA 2IHEA 3H0GG 4YCVA 3W5OA 3F2DA 4LUVA 3U4ZA 4AH6A 3CCUA 2NN6G 4QJFA 4LFCQ 5JJLA 3BZCA 5DLQE 1VQHA 2VQFL 4DAYB 4DR4Q 3J81c 2ATWA 4PMWA 1HR0W 1XTDA 2K5HA 4JBJA 4L5SA 4A3DH 1G6PA 2UXCQ 4JOIA 3GTJH 2OTLA 4R4CA 3KLWA 2D0PA 4DR4L 1X56A 2R7ZH 5ELNA 2VNUD 4YY3Q 4JG2A 1BBWA 3GTPH 1Q46A 4LF6Q 1VCIA 3BZKA 1HNXL 2HT1A 2UXCL 4KLKA 3K81C 2WP8J 3PUXA 3M4OH 4A3CH 1TWAH 3PF4A 5JJIA 1S3OA 3CAMA 4R1JA 4OX9Q 2KBNA 4HJ7A 3RN2A 4YY3L 2AWNA 4JI2Q 4A3DG 3HKZG 1J5EQ 1N32L 2UXDL 2HQLA 4GS3A 4KHZA 3CCRA 3CP0A 1NBWA 3KDFB 1PHJA 1C7YA 4BBSH 1JT8A 1K8AC 1V9PA 3IRBA 3T1YQ 5M5XH 4AYBG 2V1CC 4OX9L 2IT1A 3ULPA 4DV5L 1VQGA 1RIPA 1YVCA 4YCWA 4A3JG 1N34L 1VQ8A 4JI2L 2ASBA 1D8LA 2HIVA 4A76A 1W2BA 2B29A 2VS1A 4A3CG 4EX5A 4RMFA 2ZJRA 1WI5A 2VY3A 4DR7Q 1K83H 2F3IA 4PZ6A 3FKIG 2CKZB 3CPWA 5IWAQ 5IYBH 1PH2A 3KF8B 4JI4Q 3D0FA 4BBSG 3KJPA 1HNWQ 1UE6A 4DR7L 4UP9A 3HOYH 4GOPA 4LF5Q 1PH9A 4OONA 1AH9A 3S1NH 1DGSA 1Q12A 4JBKA 4DR3Q 2NVTH 3L0OA 4DV6Q 4JI4L 3J80c 4LF5L 2UUCQ 1N9WA 2JA9A 3UDXA 1B8AA 2A8VA 1PH1A 3H3VH 4DV6L 2PNHA 4HJ8A 1QZHA 1M1KC 1U0LA 1Y1VH 2B3GA 2PQAB 3L2PA 2UUCL 4BY7H 4A93G 1VQNA 4JI8Q 4BXXH 3M4PA 2HHHQ 4JI3Q 4DKAC 2F4VQ 1MKHA 4A3LH 3ERSX 3HOXH 1PH3A 3I2ZA 4IPHA 1JE5A 2NZOA 2OTJA 5GROA 1S40A 5IYDG 2HHHL 2ZJPA 1OXXK 1Q1EA 3K8AA 4R4OA 4DR5Q 3GTKH 3S1MH 3I4NG 2Z6KA 1VQBA 1E1TA 4DV4Q 2UU9Q 3U4VA 4C3IH 2NVYH 3CCVA 3RLFA 3J7ZC 5M5WH 4BXXG 2LXJA 1YIJA 3EBEA 2WAQG 4O0AA 4A3LG 1L1OC 1XPUA 1QVCA 4DR5L 1N33L 2OCEA 1YJWA 3GTLH 3S2DH 4QQBX 1CKNA 2JEAI 2KHJA 3PO3H 4PZ7A 4P71A 1XNQQ 1X3GA 1CSPA 4OXPA 2R6GA 4TQUS 3CC4A 2E5LQ 1VQCA 1E24A 3U50C 4NXNQ 3S24A 1FJGL 4IFDI 3HOVG 2CQOA 1XNQL 1ASYA 1OXUA 1A62A 2KENA 1BBUA 2PMZE 3NBHB 3EIVA 5C4JH 1HZ9A 1I94L 2ZTDA 1EFWA 3PO2H 3G4SA 4JCVE 4NXNL 3KF6B 2VUMH 3DLLA 5M3FH 4DV3Q 1Y14B 2IX1A 1KIXA 2NVQH 3PO3G 2K5NA 1B7YB 1IBKQ 1PA6A 2ID0A 1Q1BA 2JA7H 4Y52H 4LF7Q 2D62A 2K75A 2UUBQ 4GN3B 2ES2A 3TQYA 1SFOH 1PH5A 3BU2A 1C0AA 4QY7A 4HIKA 1XNRQ 1IBKL 2AWOA 4A75A 5IE8A 4AQYL 1Y1WH 4LF7L 2NN6I 3RZOH 3PO2G 2QEXA 2VUMG 4A4IA 1A0IA 1H95A 4XIGS 3NEMA 5M3FG 4UP8A 1KC8C 1PH8A 4PZ8A 1XNRL 1Z9FA 2JA7G 1WOCA 1B70B 3E9IA 4LFAQ 4X64L 1YEZA 5C0XI 4DNIA 2JK8A 4ME3A 3UDFA 1X65A 3CPFA 4C3HH 1NMFA 1VQ7A 1VS0A 1LUZA 5JJKA 2YV5A 4LFCL 3F2CA 1R9TH 4A3MH 4LFAL 2NZHA 1Y1WG 3ULJA 4DK3C 2Q2HA 2FXQA 3A5UA 4IJHA 1HZAA 2VQEQ 2OWOA 1E7ZA 1XMQQ 4J15A 3GO5A 4P73A 1VQOA 4Y7NH 4DK6C 1Q86C 5IP9H 3G6EA 4IOCA 4DUZQ 4LF4Q 1L1OB 1XJVA 1L2FA 2Y0SE 4LUZA 1A63A 3A5ZB 3STBC 4LF6L 3M85A 1W3SA 2VQEL 1KRTA 1X9NA 1HZBA 1XMQL 1K0RA 4JBMA 4DPGA 4HIOA 2R7ZG 4BA2I 1JJGA 3PIPA 4JI5Q 4DUZL 4APVA 5GAGC 2Z0SA 5M5YH 1J5EL 4GKJQ 4KHPQ 3RNUA 4JI7Q 2DUDA 4DAMA 2YTYA 1EYGA 3JAMi 3CF5A 2IY5B 3T1YL 1X55A 1X54A 2KCTA 5IP9G 3J81j 3NENA 5EAYA 4JI5L 1V43A 5LMNW 1QUQA 1YHBA 4HIMA 1LM0A 1S72A 2VW9A 4POGA 2K50A 2E2IH 1C9OA 1KRSA 4GKJL 1VQFA 2R92H 3KFUA 1N8RC 1UE1A 4LUOA 5AJ3Q 2EIFA 4DR2Q 3RLNA 2H5XA 4OWXB 1VQPA 1PYSB 5IWAL 3OW2A 1PH4A 1VQ5A 2CCZA 1GO3E 2CWPA 1HR0Q 4GN4B 1YZ6A 4X65Q 1HNWL 1IZ6A 4IPCA 1I5FA 5AJ3L 4A3EH 3CXCA 1PH7A 4GKKQ 3PF5A 5IYBG 3UE1A 4DR3L 1PV4A 1HR0L 2R92G 3GTOH 3M4QA 4OWWB 3HOYG 4RG1A 3KJOA 3GTGH 3CCQA 1AE2A 5GAEC 3STBD 4YWKA 1SN8A 1IBLQ 1O7IA 4QIWE 1EQRA 5FLXc 2B63H 2MFIA 3H15A 2ALYB 2UXBQ 2UUAQ 3I4MH 3ER0A 1KD1C 5E7NA 4HJAA 2YTVA 4YHHQ 2YU9H 3PUVA 4EQ5A 3FHWA 4JI8L 3J81i 3PUYA 4JI3L 2F4VL 4JC0A 4A3IH 4C2MH 4C3JH 3KDFA 1TWCH 5GQOA 3NELA 3PIOA 1Y1VG 4DR1Q 2UUAL 4BY7G 2UXBL 1FL0A 2N49A 2OQKA 3F8TA 5IY0A 4YHHL 4P74A 2WFWA 3I4OA 4A3KH 2B63G 2ZTEA 3CCSA 3HOXG 1I6HH 5C4XH 4DV4L 4GLXA 1KHIA 2UU9L 3I4MG 4DV2Q 4NB3A 2I0QA 1WJJA 2R7FA 2JJQA 2RHQB 3U58A 1J6QA 1UWVA 4P75A 1KQSA 3A74A 3VDYA 1XMOQ 3S15H 1PYBA 2E2JH 3I7FA 4DV2L 2JA6H 4UY8C 4GLAC 1EIYB 3W1GA 4LNQA 4OO1G 3UDIA 1V1QA 4JI1Q 4A3KG 4IO9A 2K52A 4JBWA 1XMOL 1UEBA 5FJ8H 2E5LL 4IOAA 5IP7H 3KYHC 3HOWH 2JQOA 1WFQA 3HFZB 4HIDA 5C4XG 4BBRH 2KCMA 2RHSB 5IYCH 2Q2UA 2ZM6Q 2GVAA 4NXMQ 2QGQA 3HOUH 2MO1A 5C3EH 1GM5A 1FVIA 1VQAA 4JI1L 1MIUA 4DUYQ 4DV3L 4GLVB 3PSIA 1IXRA 1VQ9A 3OYYA 2JA6G 1Z47A 5JEAG 5ELOA 5LMUQ 2DGYA 1EUJA 1K3RA 2I5MX 4GN5A 4LW1A 2F52A 2ZM6L 2N78A 1IYJB 2PQAA 4NXML 1EOVA 2BA1A 2WB1E 4FDBA 3ULLA 4K0KQ 4IPDA 5IP7G 2JA5H 3HOWG 4IFDG 3SGIA 4GNXC 1RL2A 1UE7A 3G48A 5IT9c 1OTCA 3D31A 2CFMA 2A1AA 3S1RH 1N36Q 2UUBL 1OXVA 1YITA 3J80i 1E22A 3HOUG 3H0GH 1JJCB 1I50H 3PV0A 5C3EG 3OTOQ 1HNZQ 2AHOB 1VQ6A 3CW2C 4MNOA 1YHQA 3DM3A 4WJ4A 1SR3A 3CMEA 4JYAL 2YTXA 2R7DA 3LGJA 4NPSA 4JV5Q 2AKWB 1HJPA 4JI6Q 1G51A 5BR8Q 2ZTCA 1YJNA 1Q81C 4HJ9A 1NJIC 1TWGH 3OTOL 1HNZL 4IPGA 3FP9A 1BKBA 1ASZA 2VQFQ 4JV5L 1VQJA 2Y0SG 3RZDH 4JI6L 1FGUA 2VZAA 2BH8A 3HKSA 3K7UC 3Q8DA 1VQIA 3TS0A 3S1QH 2I5LX 1NY4A 2K5VA 3CD6A 2JE6I 3E0EA 1EQQA 1JB7A 3CCJA 1XPOA 4L5RC 2A19A 4LF8Q 4A3MG 5C0XG 2YYZA 5C44H 1HNXQ 4B3TQ 4POFA 1K8GA 4JYAQ 4LF4L 3K80C 4B3RQ 1VQDA 2RCNA 4UPAA 3TEHB 1E3PA 1Q7YC 4UP7A 2MNAA 3KF6A 5HGQA 1PH6A 1Q8KA 1N32Q 2UXDQ 4LF8L 1SRUA 3A0JA 3G71A 2CWAA 4A3JH 2R93H 4B3TL 2RF4A 1UE5A 4JOIC 3CMAA 1WYDA 4YWLA 4B3RL 1EWIA 1X3FA 1NE3A 5FLMH 2E2HH 2N8NA 3J7A5 4KHPL 1GKHA 2ZJQA 3FKIH 4DV5Q 4YWMA 1M90C 4JI7L 5GADC 3TRZA 4A3BH 5C44G 1N34Q 4LF9Q 5HY6A 2HIXA 2JA8H 4PG3A 1VQLA 3PCOB 3MXNB 4XTCS 3RR5A 5JEAJ 3PGZA 2L15A 3HKZE 2R93G 1T9HA 1CKNB 1QVFA 1SMXA 4DV0Q 4LF9L 2E8GA 3ZJYC 4DR2L 1XPRA 1YBYA 4IFDJ 3HOZH 3EN2A
chains in the Genus database with same CATH superfamily
5C5LA 5FLMG 4H0LC 4AYBE 4GNXB 4XXEA 1A6XA 1MSGA 3DMUA 4OIJA 3RN5A 3B6YA 5I6YA 4FF1A 3PUWA 3IAYA 1RHPA 4GKKL 5M3MH 2IX0A 3NWSA 3K7AH 4A93H 1BXTA 2F0IA 4X62Q 2XN9C 3ND8A 1JMCA 4A3EG 3R93A 5IGFA 2AQ1B 1SLJA 3TS2A 4FXKC 1IBMQ 4L63B 1EIFA 5IYDH 1OXSC 2PQEA 1EY0A 4LWCA 1WD1A 3KBXA 3Q0AA 4R8NA 3GTQH 1X3PA 4OWTB 3Q24A 3JAME 3ICEA 5LMNQ 1TWFH 3PUZA 3S9WA 3NBIA 3OHXC 5C0XJ 1GUOA 4AIMA 3CKIB 4XYOA 3CCMA 2PI2A 2Y0SB 2F0SA 3VR4A 1MSHA 4A3IG 1EY4A 5C3XA 4WJWA 3L7ZC 3OIPA 3T1HQ 1DOMA 4BY1G 4RGMA 1WTPA 1LT4D 1GD7A 4A3MB 1ENCA 1SDFA 4XT1B 2K28A 2QA4A 1PRTB 2IJ0A 4WJ3M 1FJGQ 1GVPA 5ELBA 4C1NI 1FGBD 2LFNA 3AEVA 3AFPA 1ZXTA 4Y7NB 2PI2E 1YI2A 3CC2A 3KOJA 2J0TD 2JN4A 2N55A 4BBRG 4DV1L 4JI0L 1PDQA 2P5ZX 2ZXRA 1D2BA 1LLRD 4B3ML 3M3YH 4AQYQ 4B9XA 1HH2P 2OQ0A 3CCEA 5IGCA 4ZYSA 4JW0A 2AUJD 2QDBA 4OIKA 2E2IB 2JA5G 4H13C 4GOPB 1K9MC 1JJ2A 4X6AH 3M7NA 2LSSA 1F9SA 4AH6A 4CDEC 3CCUA 3D8GA 2K32A 2VXWA 3TN2A 4GZYC 2RBMA 1BO0A 3K6OA 4A3DH 1E2WA 3I8ZA 2K04A 3I91A 3H6MA 2B2YC 1JOKA 4EQOA 3GTPH 3M4YA 3CHBD 4LF6Q 2HT1A 1HNXL 3GV6A 1QCBD 3FDTA 1I4RA 1HHVA 5AFWA 2YU9B 2AWNA 1STBA 3HKZG 2PMZB 2L5TA 4GS3A 1PHJA 3CP0A 3KDFB 3NQTA 1D1KA 4C2MB 2PZUA 1XWEA 4FO2A 4OX9L 4FYDA 3HRZC 1KABA 1WD0A 1N34L 3CU7A 2ASBA 2HIVA 2WV6D 3D4WA 1K8MA 4ZUIA 4RMFA 1I6HB 1WI5A 1SNOA 5C4XB 1F2MA 3SK5A 1WTOA 4HCEA 1TVXA 2H4OA 5A2QL 3TZDA 4BBSG 1BOSA 1UE6A 5FOBB 4UP9A 4KKSA 4DK0A 2JA6B 1TY0A 1AH9A 2B8FA 1O80A 2DJFC 4LF5L 2JA9A 3HOUB 1EY8A 2QILA 2A8VA 1H9KA 4DV6L 4HJ8A 1AFPA 2PQAB 2F0TA 3L2PA 1WVLA 2UUCL 1VQNA 4IALA 4JI8Q 1C48A 2HHHQ 5CR3A 1LTGD 4A3LH 1ILQA 2HUGA 1PH3A 3WOEA 1JE5A 2O2LD 3H0GB 5IGBA 2ZJPA 3SR1A 4DR5Q 3I4NG 2Z6KA 4DV4Q 3U4VA 2NVYH 3RLFA 1HPCA 3BYTB 3MAQA 1YIJA 1TWGB 2WAQG 4O0AA 1YJWA 3CRKC 4FNFA 4KTAA 5KNCA 3EVQA 2KHJA 3ND9A 4DAPA 1AW7A 1X3GA 2MPMA 1BCPB 1VQCA 5CMDA 3KF8A 2IWHA 5JOBA 1XNQL 1OXUA 1S5ED 1DCZA 5C4JH 3VYSA 4NXNL 1B44D 4X3SA 1TS4A 1B7YB 2ID0A 1CTMA 4B9WA 4A3JB 5I2XA 1O7LA 3VR6A 1QWYA 4GN3B 1CZGA 1EY9A 2FJ2A 4A3BB 4QB4A 4K6DA 1Y69U 5IE8A 1KNEA 2NN6I 1A0IA 4XIGS 4UP8A 1PH8A 1WOCA 5T1IA 4X64L 3TDQA 3UDFA 1X65A 2NBFA 2E76C 3MXPA 3BVZA 1VQ7A 5JJKA 2JSOA 1B9MA 2YV5A 4HSVA 1ZYRD 3K58A 3TP7A 3LX0A 5M9OA 5M3MB 2FXQA 4A93B 2K5WA 1HZAA 3K7AB 1E7ZA 1XMQQ 3GV3A 3GO5A 1VQOA 4LAAA 4IOCA 1XJVA 3MXUA 1LT6D 2Y0SE 2RDGA 3A5ZB 1JE4A 1KRTA 1X9NA 1EY7A 5KYIA 4JBMA 1NSNS 3NUCA 3J81L 4BA2I 5E3FA 5CYUA 2KCNA 5GAGC 3SDZA 2X6LA 5M5YH 3GTQB 4GKJQ 3RNUA 4DAMA 1SE4A 1TWFB 4C56C 3CF5A 3L3OC 1V43A 1JWMD 2A74C 1LM0A 4XQJA 1NUCA 1DONA 2WB1B 2R92H 3KFUA 2RDHA 1UE1A 1I4GA 3P75A 1VQPA 1VQ5A 1PYSB 1PH4A 1R4QB 2TSSA 3SHLA 1M8AA 4H7BA 5AJ3L 3A7LA 3NSWA 3CXCA 4GKKQ 2QKIC 4OGQC 1PV4A 3I73A 5EBCA 3GTOH 4OWWB 3HOYG 1AE2A 1L0YB 2B63H 5EKIA 1SSOA 3E0JA 1MI2A 1Y8PB 3ER0A 4IZ8A 3NHHA 2VUMB 3D6CA 2F4VL 4JC0A 4C3JH 1BCPF 3KDFA 1TWCH 2UUAL 3NELA 3M3YB 2JA7B 1PTOF 1YNNC 3TP5A 2E74C 4P74A 1B53A 1T5EA 1V1PB 2DNCA 4UHVA 1SFOB 3TMEA 4GLXA 1KHIA 1HA5A 3E3XA 2R7FA 2JJQA 2EDGA 4IUVA 1J6QA 1WTHA 4P75A 5LL6S 3S15H 1HFGA 2Z1CA 2E2JH 5KEEA 3Q23A 4DV2L 4OO1G 3HP3A 1V1QA 4JI1Q 4A3DB 1UEBA 5C4XG 2JQOA 3HFZB 4CKBA 2KCMA 3OSOA 2GVAA 1TQOA 1GM5A 4K8JA 3GTPB 3EFXD 2JA6G 3OMGA 5JEAG 4GN5A 1EUJA 1K3RA 2I5MX 2V4DA 4OHJA 2PQAA 4NXML 4G7ZC 3HOWG 4IFDG 3SGIA 4GNXC 1UE7A 3A8KE 2CFMA 3S1RH 1KLGD 1E22A 3HOUG 5C3EG 5G3LD 2NN6H 4MNOA 1YHQA 4WJ4A 1SR3A 3K5OA 4JYAL 1STGA 1HJPA 3QIAA 2ZTCA 4HJ9A 4OL7A 3OTOL 3G7LA 2KEDA 2NB0A 1WTVA 1QOHA 5J1ZA 3RZDH 4JI6L 2BH8A 5ELDA 1PLFA 4K2LA 2NYZD 2H1EA 1EQTA 2K5VA 4IN3A 3E0EA 5D3DA 3CCJA 4C3HG 1XPOA 1F2LA 3RMHA 5E1FA 2HCCA 5C0XG 2F0FA 1HNXQ 1JWUD 3I90A 1E3PA 3NXWA 4NMZA 1ICWA 1UE5A 3CMAA 3DWAA 4B3RL 2NWGA 3NP8A 4KHPL 2ZJQA 1N34Q 1PRTC 5J39A 4LF9Q 5HY6A 4ZK9B 2JA8H 4U673 1VQLA 1L0XB 3MFGA 2NVYB 3V2TA 2OXPA 1U4RA 1CKNB 1XYIA 1QVFA 1SMXA 2K7VA 4DR2L 1KXLA 2KEEA 1K0SA 4ODGA 4A3BG 4DN4M 1D7QA 3T13A 3I56A 1OXTA 5C6AA 1FNVA 4PMCA 1B3AA 4EVOA 1EQVA 3DWPA 4TVAB 1QVGA 3A7AB 1AE3A 1J8IA 1VQKA 4R4QA 4QGUA 1O7YA 1W6JA 5C4JB 4L6TB 4KD3A 1IBLL 1VMCA 2XRSD 2LS01 4CJ2C 4GOPC 3W1BA 3N6RA 4QL5A 2N3SA 1FYCA 4KN4C 1HUNA 2GVBA 4L8JA 5H1SE 1NTGA 5M3MG 2MO0A 2K14A 1XTCD 1CKMA 4KV6A 2L55A 1WCMH 3KLSX 5GAHC 3F2UA 5FLXL 1JOOA 2F0PA 5F2DA 1PFSA 3EA6A 4B3SL 3VYRA 1QB5D 2KHIA 5K36G 2C35B 2O5IC 4DV7Q 5D14A 2I5HA 3HOVH 3I55A 3MXNA 2QDLA 3K0XA 4HMIA 3CC7A 2K01A 2B2WA 2DNEA 3IL8A 4HMJA 4R8IA 5K5PA 1CSQA 1YHAA 2B2TC 1ZKOA 2LMCB 4N9PA 4Q5VA 2B2UA 2WB1G 1IL8A 4ALPA 2CW0C 4ZUJA 2GN5A 1SYGA 5CV9A 1G291 4XDXA 3D6WA 5D65A 1HZCA 3AFQA 4LFBL 1SMYC 3TREA 1GHJA 2F3WA 3CQZH 5A35A 4DUYL 3CCLA 5IGEA 5IYCG 2PO4A 1SROA 3IKJA 5J3BA 1YNXA 1A3VA 3NQIA 3H09A 1HFNA 5M5YB 1LT3D 2F4IA 4X66L 4DR6Q 3MWYW 1QUQB 2F03A 5DNFA 2SOBA 1P8LA 1IL2A 1I3QH 3RLOA 2R92B 4X64Q 1V8QA 1MJCA 3HS0C 2QEJC 3U4ZA 1VMPA 4PMBA 5E4XA 5IT9L 4RHRA 5JJLA 3BZCA 1VQHA 4OELB 4DR4Q 1PTOH 3J81c 1HR0W 2PZTA 4JBJA 2KUMA 3HOZB 2Q8TA 4YIJA 2UXCQ 4ZKCB 5I9OA 3GTOB 3KLWA 5D3IB 2R7ZH 2VNUD 4YY3Q 1GXDC 1YNJD 4JG2A 1BBWA 4G7OC 1A2TA 1VCIA 3J7AF 3K81C 1IW7D 4A3CH 1TWAH 3PF4A 5JJIA 3G6JB 3OPOA 2KBNA 4HJ7A 2OEOA 4JI2Q 4A3DG 1N32L 2WINB 3DWQA 2HQLA 1JT8A 1NBWA 2KJXA 1C7YA 3X3NA 3NTKA 1K8AC 4C3JB 1TWCB 4AYBG 2V1CC 4B08A 4DV5L 2A6HD 1BCPC 5L37A 1VQ8A 4YCWA 1D8LA 1W2BA 2B29A 2VS1A 4MIUA 2VY3A 1DOLA 1IYVA 3FKIG 5IGDA 2CKZB 3CPWA 4RAUC 1UEAB 4DK1A 5IYBH 4DGZA 3KF8B 1PH2A 1EEFD 4CDFC 3S15B 2E2JB 1EY6A 4DR7L 2EY5A 3VR5A 1DGSA 5BN3A 4JI4L 1SNDA 1V1OA 3DM1A 3J80c 4J6HA 4WFN3 4TRDA 3TP6A 1N9WA 1MGSA 2PZWA 3T51B 1LTID 2PNHA 1QZHA 2B3GA 2HQEA 4BY7H 2RQXA 5CV6A 4MHEA 4BXXH 3M4PA 5CV7A 2F4VQ 4N9TA 1VDZA 5LHY1 3HOXH 3V96A 1I4XA 4G7HC 1BCPD 3S1RB 1ENFA 2F0LA 3ITPA 3I70A 1PTOD 1S5FD 1OXXK 3MZ5A 4M8AA 4R4OA 1EZ6A 3R2TA 2LXJA 4LK1C 2EE1A 3EBEA 5FO9B 4A3LG 3Q22A 4TKOB 4XT3B 1N33L 3SVMA 1XPUA 2JXMB 1CKNA 3RZDB 3C1FA 3QG1A 4P71A 4OXPA 1ESFA 2F0QA 1UNSA 2EXZA 4K2KA 3FPPA 3U50C 4K5XA 5I4DA 1HQMC 1TS3A 1FD7D 1UUPA 2RVLA 2KENA 1BBUA 1SNPA 1HZ9A 2ZTDA 2HDLA 2VUMH 3KF6B 4RFBA 2EOTA 5FO7B 2EYMA 2JA7H 1JQYD 1DJRD 2AUKA 3SXHA 1SJED 3TQYA 1SFOH 3JAML 1C0AA 3U9OA 4HIKA 1A3UA 1RKNA 1IBKL 2B2UC 2AWOA 1JCKB 4A75A 4LF7L 3RZOH 2JA8B 4CJ1B 1DZ1A 1PYWD 4QUCA 4IQZA 1XNRL 4DNTB 3E9IA 1LTTD 1YEZA 4HCSA 1AN8A 4DNIA 4ME3A 1K83B 1VS0A 1LUZA 2C9OA 4LFCL 3F2CA 1Q90A 4LFAL 1CHPD 3UI2A 1LT5D 2IL8A 1CHQD 1SNQA 1CM9A 2OWOA 3C3LA 4WORA 4JVZA 4P73A 4DK6C 5IP9H 1L1OB 3A8JE 1ICFB 1IKLA 1L2FA 3SEBA 4LUZA 1C8CA 1ILPA 4H44C 2VQEL 4M1UB 1HZBA 3O13A 1K0RA 1GUGA 2R61A 3SK6A 4F7XA 3PIO3 1JJGA 4DUZL 3R3OA 1ONLA 2Z0SA 4O1NA 4KHPQ 1XXGA 2DUDA 1WCMB 2YTYA 1EYGA 4NP5A 1X55A 1X54A 2B2VA 5EAYA 2X6GA 4JI5L 5LMNW 1QUQA 4ABNA 1S72A 1C9OA 1F2ZA 1N8RC 4OEMB 2BCOA 3QO2A 4DR2Q 3DHQA 3RLNA 5IWAL 3HOVB 3D3RA 4GN4B 1HNWL 1IZ6A 4IPCA 1I5FA 3NTIA 4A3EH 1GJXA 1PH7A 2R92G 1HR0L 1QNUA 1SN8A 1IBLQ 4N8FA 5FLXc 2MFIA 3H15A 2VB2X 2ALYB 3CQZB 1HCZA 2UXBQ 3I4MH 1KD1C 2KHSA 5BN4A 3FHWA 3PO2B 1F77A 3PUYA 3OWEB 3SE0A 4A3IH 4IUQA 1Y1VG 1E2ZA 2F3VA 2L12A 2OQKA 4YHHL 2WFWA 3QWNA 5CBAE 2B63G 2ZTEA 1I3QB 1II3A 2F1MA 1LACA 1IYUA 3A74A 2O4XA 1XMOQ 1ZYRC 5CC4A 2MP1A 4C3IG 1PTOB 4F8MA 4UY8C 1EIYB 2XWBB 4MTKA 3UDIA 1WTXA 4JBWA 2EYFA 2E5LL 5IP7H 3AU7A 2XWJB 1WFQA 1EYCA 4BBRH 3H94A 2Q2UA 4BS9A 1JICA 3KUPA 1U9RA 2R7ZB 2QGQA 2MO1A 3EJIA 5EPJA 3OWFA 1FVIA 1VQAA 3LWUA 4DUYQ 4GLVB 3VR2A 1VQ9A 1TWAB 4DV3L 1PMRA 2ZM6L 5KRUA 1STHA 2PCFB 4V190 4FDBA 2EY2A 2B39A 4IPDA 2JA5H 1QG7A 1RL2A 3G48A 5IT9c 2UUBL 3D31A 3NWTA 1R4PB 2MHVA 1SXTA 1I50H 1HNZQ 2AHOB 1VQ6A 3CW2C 4I65A 3DM3A 5EPKA 1SNMA 2R7DA 3LGJA 4JV5Q 2AKWB 1G51A 1EWCA 2NZ1D 1M4VA 4IUTA 3ONAB 1ASZA 3EQLC 1A15A 1VQJA 2Y0SG 1FGUA 2VZAA 2EY6A 1VQIA 3QOLA 3CD6A 3OMCA 2O5JC 2JE6I 1D5ZC 1RTOA 1S5CD 4LF8Q 5C5MA 4A3MG 1CA6A 2F0JA 5C44H 2FINB 4POFA 3RD4A 1EZ8A 1K8GA 2RCNA 4KY6A 4UP7A 4BY7B 3KF6A 5HGQA 5BN5A 1N32Q 2DY8A 2CWAA 2DN8A 4B3TL 1QJOA 1WYDA 4YWLA 3HOXB 5KNDA 1X3FA 1NE3A 4G57A 3J7A5 1GKHA 4DV5Q 3R8BA 4JI7L 3GQBA 2Z9HA 2F0DA 1CQVA 1NAPA 1QE6A 3KK7A 2HIXA 1BNZA 3PCOB 3MXNB 4HN7A 4XTCS 3SK4A 2L15A 4A3KB 2WACA 1H9MA 1YBYA 3HOZH 3EN2A 4KI0A 1A8VA 4X65L 4A3FH 4ME5A 1QZGA 1MBYA 4ZAIA 2K5DA 4DV0L 2JA8G 1KAWA 2EVBA 2BA0A 2XTIA 3K5MA 3QR8A 1EYDA 1Z7TA 4KJOA 1IKMA 1G2SA 5IIFA 3H3VI 1SE8A 2EJGC 2XGTA 1GUWA 1L1OA 2DJGC 3NK9A 3MC0B 4X62L 3J80L 4DA2A 2MUYA 3I4NH 5EPLA 1E1OA 2EYPA 1IBML 1U5KA 2A68D 4DR1L 4PV1C 1TIID 3GTMH 4L5TA 3RZOB 1VQMA 2F0WA 2JP1A 2F0MA 5LMNL 5HGTA 1N33Q 4OO1I 1GHKA 1PZJD 1SEBD 3VA5A 3F2BA 4C1NK 1KAAA 2M9VA 5FK9C 2CVRA 1TR5A 1WCMG 1U4MA 2Z6KC 2EQSA 3LNNA 4P2CB 3K59A 3T1HL 4MTNA 1B1ZA 5CV8A 3JAMc 4EQPA 1CUKA 4DV1Q 3WDNA 5FO8B 4JI0Q 1VQ4A 1BVSA 1LYLA 4A3GH 1EIHA 5FJ8G 2PW5A 4L5QA 4B3MQ 4IURA 1OO9B 3BJUA 1VF5C 1JB3A 2JEBI 1TS2A 1RDPD 1RF2D 2LKVA 1Q82C 2NTSA 3AQQA 1N36L 3S14H 2Q2TA 4H02A 1KNAA 3F1ZA 1TWHH 1LTLA 3BVMA 1NMGA 3GDEA 4R4TA 2VL6A 2RA4A 3GD7A 1HTPA 3C1EA 3K0YA 1MJEA 5BR8L 3H0GG 4YCVA 1G8ZD 4LFCQ 5DLQE 2VQFL 4DAYB 2ATWA 4A3EB 4L5SA 5EKKA 1G6PA 4HTHA 4JOIA 3GTJH 2OTLA 4X3UA 1JORA 2K5QA 1LO5D 3GP7A 4QF4A 1EL0A 5ELNA 1FR3A 2R3ZA 1KDCA 4KLKA 2WP8J 3PUXA 3I4MB 1GUNA 3CAMA 4KY5A 1U4LA 4OX9Q 3RN2A 1AEXA 1FNWA 4R9WA 2UXDL 3CCRA 5ELCA 2BE5D 4A3IB 3IRBA 5CGKA 5CBEE 3KLSA 3CRLC 1VQGA 1RIPA 1YVCA 4A3JG 4F87A 5KIXA 4A3CG 4EX5A 1K83H 2F3IA 3HG9A 1LTBD 3IFDA 1E2VA 5IWAQ 1HA6A 3KJPA 1HNWQ 1STYA 5DEHA 3HOYH 4LF5Q 1VF7A 2IPKD 4OONA 1PH9A 3VA7A 3S1NH 1Q12A 2NVTH 4DV6Q 3S17B 4BBRB 2UUCQ 4CJ0B 1GUTA 3UDXA 3P20A 3H3VH 3FPUB 5ISRA 2I07B 4A93G 2F0OA 3MXGA 2EYHA 2QCPX 2JA5B 4RCNA 2XIWA 4CHTB 4IPHA 4CBVA 5C3WA 1WTWA 5DAUA 1BUVT 2NVXB 5IYDG 1I50B 2HHHL 3OIQA 4RH6A 1K8OA 1DM0B 3FEWX 1VQBA 1B9NA 1CT1D 4DU9A 3CCVA 5M5WH 4BXXG 2Z6BA 4OO1H 2WKCA 1L1OC 4DR5L 3E5SA 3GTLH 3S2DH 5C4ZA 4QQBX 2JEAI 3PO3H 2N88A 4PZ7A 1S5BD 1XNQQ 3NPPA 1CSPA 2R6GA 2RDFA 3K57A 3CC4A 4J8QA 2E5LQ 3A54A 4RWSC 1E24A 2NUCA 4NXNQ 3S24A 4HSPA 2CQOA 1YNJC 5EGTA 3BG3A 3OOCA 1ASYA 5JVG3 1A62A 3HKZB 1T5XD 3EIVA 3NBHB 5C44B 1I94L 1IW7C 1EFWA 3PO2H 3G4SA 4JCVE 2L4NA 4FF2A 3DLLA 1NNXA 5M3FH 4DV3Q 2IX1A 1KIXA 2NVQH 2K5NA 5JVH3 1I6VC 2AQ3B 2A69D 4UAIA 3E6ZX 5I9PA 2L1BA 2D62A 2K75A 2UUBQ 2ES2A 2A6HC 1G6ZA 3L9AX 3MA2B 1Y1WH 3T4AC 4I7ZC 2QEXA 2VUMG 4A4IA 1LABA 3VYTA 2J4XA 1KC8C 4XQNA 4PZ8A 2JA7G 4K5VA 1B70B 1DOKA 2EPBA 2B2YA 4C3HH 1NMFA 3BDOA 1D5MC 1H9SA 2E75C 4ULLA 1R9TH 5JPNC 1ESRA 4A3FB 1BDOA 3ULJA 1PFMA 4DK3C 5FKAC 4Q0FA 3P1HA 3ZYYX 2Z4HA 2EYOA 3MFYA 2KECA 4DF7A 3MTSA 1XMQL 2EJFC 3DEPA 5TSSA 3I4NB 5CV5A 4APVA 3J7AV 1J5EL 4JI7Q 1PTOC 1S4ZA 2KVMA 2WAQB 2HDMA 2IY5B 3T1YL 5IP9G 3LWEA 3GTMB 1EEID 4POGA 2K50A 3X3MA 4GKJL 4CGYB 4RA8A 3KLRA 1W6KA 3SK8A 4EGVA 5AJ3Q 4QCLA 2EIFA 2F0HA 4ILWA 2OF1A 2K33A 1O7ZA 4OWXB 3MEHA 2CCZA 2HCIA 4QMGA 1YZ6A 1SBBB 4X65Q 5IOCA 1RCVD 1AP0A 4DAYA 1EWHA 2IX3A 4FF3A 4DR3L 1TU2B 1HRJA 3M4QA 1A2UA 3GTGH 3KJOA 4FXDA 3A55A 2E2DC 3VYUA 1O7IA 4A3GB 2XNAC 1EQRA 1D6EC 4IUPA 2UUAQ 5E7NA 4HJAA 2YTVA 3PUVA 2A6ED 3J81i 4JI3L 3IFTA 4FP5D 5GQOA 3PIOA 4DR1Q 5CORA 3I72A 1JC7A 1FL0A 2N49A 5IY0A 3S14B 5K36H 4DXFA 1TWHB 2PYKA 5E4WC 4A3KH 3CCSA 1SYCA 3URYA 3I4MG 2UU9L 4DV2Q 4NB3A 1WJJA 5HURA 1UWVA 1KQSA 3FMCA 3DEOA 3VDYA 4N8X1 1PYBA 3W3AA 3I7FA 1DYQA 3BYYB 4GLAC 2CH4A 4HR7B 2D5DA 4NW2A 4IOAA 3GTJB 4HIDA 1B3QA 4KHVA 2RHSB 3QB3A 4JK1C 5IYCH 1KLUD 4NXMQ 1BF4A 4JI1L 1MIUA 3NE5B 2B2WC 3OYYA 1Z47A 2Q8IB 4LW1A 1IYJB 3ULLA 5IP7G 4JYAQ 2L11A 1OTCA 1N36Q 5COYA 1OXVA 3J80i 3OTOQ 3R2IA 2X69A 1Q8IA 2YTXA 2EYLA 4JI6Q 5BR8Q 5G3LF 4UDUC 1DD2A 1IHZA 2A73B 5DM73 1PZKD 4IPGA 5A2QE 2F0VA 1LV9A 2VQFQ 3HOYB 2F0UA 1SE3A 3Q8DA 2KCCA 3TS0A 3S1NB 1G91A 3S1QH 1F9PA 4JPBW 1NY4A 2NVTB 4KKTA 5JJZA 1EQQA 1S5DD 1JB7A 4I7AA 4F88A 4L5RC 4WRDA 2WKDA 5I6WA 1H9JA 1ET6A 3HEJA 3NBHA 2PNRC 2FMMA 4LF4L 4B3RQ 4UPAA 3TEHB 1PH6A 1Q7YC 5IGGA 2QF7A 2UXDQ 3BZDB 3A0JA 3D4RA 2JYOA 2R93H 2M00A 1SYDA 1SAPA 4ID6A 1EWIA 5FLMH 2N8NA 2EYJA 3T56B 3FKIH 4YWMA 1HXYD 4HEDA 5C44G 4X3TA 1FNUA 4PG3A 1LTAD 1O78A 1NR2A 2ZT9C 5M5WB 3PGZA 3ERQA 3HKZE 1B4OA 1D1IA 1T9HA 1B2TA 4LF9L 3GTLB 3S2DB 3ZJYC 1XPRA 2C5CA 1K73C 1DXMA 3PO3B 2SNSA 4DXGA 4BWGB 2L9HA 4DFAA 4K8IA 3BVGA 2Q2IA 1KL9A 1VQEA 3S16H 2AMCB 1X6OA 2ENBA 4RGTA 3HOWB 3HOZG 3UE0A 5M3FB 2NVQB 4Z9CB 3JC66 5C3EB 4A3FG 3DUZA 1Y8NB 1L0WA 2IHFA 4O2DA 2LXKA 1I4QA 3AB9A 4FXGC 2BH2A 1EU4A 4BA1I 4BY1H 2LY7A 3I4LA 4B3SQ 4MZ9A 4XYQA 4ZKBB 1Y1WB 1PRTF 3WWVA 1P16A 3AYHB 4C3JG 4IJLA 3VR3A 2K4KA 4U68A 1ML0D 1G2TA 1H9RA 4J1MA 1YJ9A 1WTRA 2BDNA 3MEFA 4FVMA 5JAVA 2KOLA 4HJ5A 5ELEA 2TMPA 4C3HB 4YCUA 3S17H 4P72A 1GUSA 4V0BA 1SYBA 1R9TB 4R4IA 2KA7A 2AQ2B 2M2LA 1CI3M 2EZVA 1CZWA 4LFBQ 4DV7L 1X3QA 2MQHA 2WAQE 4GNXA 1K28A 1I94Q 3TBIB 1BR9A 2Z4IA 1ENAA 3E9HA 3QOJA 4K6LA 4X66Q 1X3EA 1TKWB 3J81E 5LMUL 3MHBA 2D0OA 1SYFA 2NVXH 4X3KA 4RGNA 2B8GA 4K0KL 1E0BA 3M9BA 4S3SA 1TS5A 1PVOA 3UDGA 5KYLA 4A3GG 5EKLA 4DAVA 1TXYA 4QIWB 3S2HH 2E2HB 2EXDA 1RJTA 4DR6L 1CKOA 2IHEA 3W5OA 3F2DA 1NR4A 3QJYA 4LUVA 2NN6G 3V05A 4QJFA 1BQQT 4PMWA 1XTDA 2K5HA 3N52A 3K5NA 4KKUA 1RODA 4R4CA 4KD4A 1U4PA 2D0PA 3GTGB 1Q3LA 1X56A 3PQIA 4DR4L 1CK1A 1SYEA 1Q46A 3BZKA 4E6IA 2UXCL 3M4OH 5KNBA 1S3OA 4R1JA 2SDFA 2Q8RE 1I4HA 4YY3L 1J5EQ 1JWSD 4KHZA 4IUNA 4BBSH 3J80E 1V9PA 2A68C 2F0EA 3T1YQ 5M5XH 1K3BC 2IT1A 3ULPA 4LMQD 5CV4A 5ELFA 4JI2L 2XVSA 4A76A 1STNA 1WTQA 2ZJRA 4DR7Q 5EJWA 2OT2A 4PZ6A 1F9QA 1KDBA 2BOSA 4PNYA 4JI4Q 3D0FA 3T53B 1CFMA 4GOPA 1B50A 2B2VC 1AZQA 4KJNA 4JBKA 4DR3Q 3L0OA 2NTTA 3P7JA 4K5WA 2K03A 1B8AA 4LJZC 1PH1A 5IODA 3H91A 3OW7A 1M1KC 1U0LA 1Y1VH 3BDLA 4RGOS 4CKCA 1HUMA 4DNRB 4JI3Q 4DKAC 1MKHA 3TZUA 3NTHA 3ERSX 2RCFA 3I2ZA 3A8IE 1AZPA 2NZOA 2OTJA 5GROA 2A5HA 1Q1EA 3K8AA 2MJ8A 1SJHD 3GTKH 2D9UA 3S1MH 3T16A 1E1TA 3KBGA 2UU9Q 1H9SB 2B2TA 4C3IH 3K5LA 3J7ZC 2Z8LA 1HTLD 2D2CC 1QVCA 1KTKA 2OCEA 4IUUA 2ZXOA 1D5XC 2PW7A 2FFKB 4TQUS 3S1QB 4IFDI 1FJGL 3HOVG 3RUZA 2PMZE 2FMCA 1Y14B 3PO3G 4AYBB 1IBKQ 1PA6A 1Q1BA 5NUCA 2ZXPA 2R93B 3TSSA 4Y52H 4LF7Q 2BE5C 4EQNA 1PH5A 3BU2A 3W2DA 5JPMC 4QY7A 2ICIA 3FKIB 4RCOA 1XNRQ 2K05A 4AQYL 4PQXA 4O42A 4TSSA 1YNND 3FVQA 3PO2G 4ZQ3A 3I3CA 4KK7A 5T1GA 2QW7A 1H95A 3NEMA 5M3FG 2IW3A 1Z9FA 2HD3A 4LFAQ 3C46A 5C0XI 2JK8A 2RSNA 2G9DA 3CPFA 2SEBD 4A3MH 2NZHA 4KN7C 1EY5A 1Y1WG 2F0NA 2Q2HA 3A5UA 2F0GA 1A3TA 4IJHA 2VQEQ 4J15A 4Y7NH 3S16B 1Q86C 3G6EA 4RKLA 4DUZQ 4LF4Q 1A63A 3WOFA 3STBC 3AMUA 4LF6L 1Y8OB 3M85A 3BDCA 1W3SA 2DY7A 4DPGA 4HIOA 2R7ZG 1PZID 2EJMA 3PIPA 4JI5Q 1RTNA 2KQ3A 4BY1B 1EOTA 2SNMA 4ZLTF 1CA5A 3JAMi 1XX8A 2K1BA 2KCTA 3J81j 1S40A 3NENA 1CQFA 4HIMA 1YHBA 5FLXE 2VW9A 2XRQD 2E2IH 1KRSA 2CQAA 1VQFA 4XQQA 4CKEA 4LUOA 5I2YA 3HZXA 5DM63 1RD9D 2F0KA 2J7ZA 3Q6SA 2H5XA 3OW2A 1F2YA 1GO3E 2CWPA 4ZRZA 1HR0Q 3C2PA 1Z6HA 3A56A 3PF5A 5EQ0A 4NKLA 5IYBG 3PMFA 3UE1A 1NCVA 1F9RA 2RKSA 4RG1A 3CCQA 1BBXC 2VB3X 5GAEC 3STBD 4YWKA 1X32A 4QIWE 5LL6X 1QNKA 2A69C 4RHSA 4YHHQ 2YU9H 1ET9A 4EQ5A 4JI8L 4RKBA 4C2MH 1C4QA 2UXBL 4BY7G 3F8TA 3FRPB 1PXUA 3I4OA 1PRTD 3S2HB 3HOXG 1I6HH 1EU3A 5C4XH 4DV4L 4HAEA 3TP8A 2I0QA 2RHQB 3U58A 3J7YW 3H3VC 1EFID 2K6AA 1MHWC 5IT9E 2JA6H 4G4KA 4MN3A 5JEAH 1GOZA 3MVVA 3M7GA 3W1GA 4LNQA 2ICEC 4A3KG 4IO9A 2K52A 1XMOL 5FJ8H 3KYHC 1TY2A 3HOWH 4IFDH 1LTRD 3PIP3 2ZM6Q 3HOUH 5C4HA 5C3EH 2XSCA 3PSIA 1IXRA 3M4OB 5LMUQ 5ELOA 2DGYA 2F52A 2CH4W 2N78A 2EY1A 4QUFA 1EOVA 2BA1A 2WB1E 1QILA 5J22A 4K0KQ 1SNCA 4K14A 4FF4A 1PFBA 1STEA 4BBSB 2A1AA 1YITA 5M5XB 5KGUA 3H0GH 1JJCB 1LTSD 1STAA 3PV0A 3DXJC 1JR0D 3U9SA 1TT2A 4ZCKA 3CMEA 4NPSA 1YJNA 1Q81C 1KDAA 1NJIC 1TWGH 1HNZL 1I4PA 4KMUC 1SE2A 4CDCC 4CDDC 5C0XH 3FP9A 1BKBA 1V1PA 4JV5L 3HKSA 3K7UC 3EROA 2I5LX 1HQRD 1EIGA 2BDOA 3D4DA 1UAPA 1MD2D 2CW0D 2PPBC 1ZEQX 2A19A 2YYZA 4B3TQ 2CHBD 3HGBA 2FHTA 3K80C 1VQDA 1SMYD 1Y1VB 2MNAA 2A6EC 1Q8KA 3BS1A 4KY7A 4LF8L 1SRUA 3G71A 2G9HD 4A3JH 2B63B 2RF4A 1JOQA 4JOIC 1PFNA 1J9OA 2I46A 2E2HH 2WIIB 3TRZA 1M90C 4A3BH 2G5DA 5GADC 3GTKB 3S1MB 2L0CA 4C3IB 3RR5A 5JEAJ 2R93G 2RSOA 2GA4B 4DV0Q 2E8GA 4NDXA 1EYAA 5EBDA 4IFDJ 2MGSA
chains in the Genus database with same CATH topology
5FLMG 1KXLA 1K73C 4AYBE 4KI0A 4GNXB 4A3BG 1A8VA 1D7QA 3RN5A 3B6YA 4X65L 3I56A 4A3FH 1OXTA 3PUWA 1QZGA 4DV0L 2JA8G 4GKKL 4TVAB 5M3MH 1QVGA 2Q2IA 1KAWA 2IX0A 2BA0A 2XTIA 3K7AH 4A93H 1KL9A 1AE3A 4X62Q 1VQKA 4R4QA 1VQEA 1JMCA 4QGUA 4A3EG 3S16H 2AMCB 1SLJA 3H3VI 1X6OA 3TS2A 1IBMQ 1SE8A 1IBLL 3HOZG 4GOPC 2XGTA 3UE0A 1L1OA 4QL5A 3W1BA 2N3SA 1EIFA 4X62L 2GVBA 5IYDH 1OXSC 3JC66 5H1SE 4A3FG 4LWCA 1L0WA 1NTGA 3I4NH 2IHFA 4O2DA 2LXKA 2BH2A 5M3MG 1E1OA 2MO0A 1IBML 2K14A 1U5KA 4OWTB 3GTQH 4BA1I 4BY1H 1CKMA 3ICEA 1WCMH 5LMNQ 4B3SQ 1TWFH 3PUZA 5GAHC 4MZ9A 4DR1L 5C0XJ 4AIMA 3GTMH 3CCMA 4L5TA 3WWVA 1P16A 1VQMA 2PI2A 3AYHB 4A3IG 1PFSA 4IJLA 5LMNL 4B3SL 1N33Q 2K4KA 4OO1I 2KHIA 3L7ZC 5K36G 1YJ9A 2C35B 3F2BA 3T1HQ 3MEFA 4DV7Q 2I5HA 4BY1G 4HJ5A 3HOVH 4YCUA 3I55A 3S17H 4P72A 1WCMG 3K0XA 3CC7A 1GD7A 4R4IA 2Z6KC 2EQSA 1CSQA 2QA4A 1YHAA 4LFBQ 4WJ3M 3T1HL 4MTNA 1GVPA 1FJGQ 4DV7L 2WB1G 4ALPA 3JAMc 2GN5A 2MQHA 2WAQE 4GNXA 3AEVA 3AFPA 1CUKA 4DV1Q 1G291 4JI0Q 1VQ4A 1YI2A 1I94Q 1HZCA 2PI2E 3CC2A 3AFQA 1BVSA 1LYLA 3KOJA 4A3GH 4LFBL 3E9HA 3TREA 5FJ8G 4L5QA 4B3MQ 3CQZH 4X66Q 4DUYL 1X3EA 4BBRG 3CCLA 5IYCG 4DV1L 4JI0L 3BJUA 5LMUL 1SROA 2D0OA 2NVXH 5J3BA 2JEBI 1YNXA 4K0KL 1Q82C 4B3ML 4X66L 4DR6Q 3M3YH 3AQQA 3M9BA 4AQYQ 1N36L 3S14H 1QUQB 1HH2P 4H02A 2OQ0A 3UDGA 2Q2TA 1PVOA 3CCEA 4A3GG 3F1ZA 1TWHH 1P8LA 1TXYA 1LTLA 1IL2A 3GDEA 1NMGA 4R4TA 1I3QH 2EXDA 2JA5G 3RLOA 3S2HH 4GOPB 2VL6A 1K9MC 1JJ2A 3GD7A 4DR6L 1CKOA 4X64Q 1MJCA 4X6AH 3M7NA 1MJEA 5BR8L 2LSSA 2IHEA 3H0GG 4YCVA 3W5OA 3F2DA 4LUVA 3U4ZA 4AH6A 3CCUA 2NN6G 4QJFA 4LFCQ 5JJLA 3BZCA 5DLQE 1VQHA 2VQFL 4DAYB 4DR4Q 3J81c 2ATWA 4PMWA 1HR0W 1XTDA 2K5HA 4JBJA 4L5SA 4A3DH 1G6PA 2UXCQ 4JOIA 3GTJH 2OTLA 4R4CA 3KLWA 2D0PA 4DR4L 1X56A 2R7ZH 5ELNA 2VNUD 4YY3Q 4JG2A 1BBWA 3GTPH 1Q46A 4LF6Q 1VCIA 3BZKA 1HNXL 2HT1A 2UXCL 4KLKA 3K81C 2WP8J 3PUXA 3M4OH 4A3CH 1TWAH 3PF4A 5JJIA 1S3OA 3CAMA 4R1JA 4OX9Q 2KBNA 4HJ7A 3RN2A 4YY3L 2AWNA 4JI2Q 4A3DG 3HKZG 1J5EQ 1N32L 2UXDL 2HQLA 4GS3A 4KHZA 3CCRA 3CP0A 1NBWA 3KDFB 1PHJA 1C7YA 4BBSH 1JT8A 1K8AC 1V9PA 3IRBA 3T1YQ 5M5XH 4AYBG 2V1CC 4OX9L 2IT1A 3ULPA 4DV5L 1VQGA 1RIPA 1YVCA 4YCWA 4A3JG 1N34L 1VQ8A 4JI2L 2ASBA 1D8LA 2HIVA 4A76A 1W2BA 2B29A 2VS1A 4A3CG 4EX5A 4RMFA 2ZJRA 1WI5A 2VY3A 4DR7Q 1K83H 2F3IA 4PZ6A 3FKIG 2CKZB 3CPWA 5IWAQ 5IYBH 1PH2A 3KF8B 4JI4Q 3D0FA 4BBSG 3KJPA 1HNWQ 1UE6A 4DR7L 4UP9A 3HOYH 4GOPA 4LF5Q 1PH9A 4OONA 1AH9A 3S1NH 1DGSA 1Q12A 4JBKA 4DR3Q 2NVTH 3L0OA 4DV6Q 4JI4L 3J80c 4LF5L 2UUCQ 1N9WA 2JA9A 3UDXA 1B8AA 2A8VA 1PH1A 3H3VH 4DV6L 2PNHA 4HJ8A 1QZHA 1M1KC 1U0LA 1Y1VH 2B3GA 2PQAB 3L2PA 2UUCL 4BY7H 4A93G 1VQNA 4JI8Q 4BXXH 3M4PA 2HHHQ 4JI3Q 4DKAC 2F4VQ 1MKHA 4A3LH 3ERSX 3HOXH 1PH3A 3I2ZA 4IPHA 1JE5A 2NZOA 2OTJA 5GROA 1S40A 5IYDG 2HHHL 2ZJPA 1OXXK 1Q1EA 3K8AA 4R4OA 4DR5Q 3GTKH 3S1MH 3I4NG 2Z6KA 1VQBA 1E1TA 4DV4Q 2UU9Q 3U4VA 4C3IH 2NVYH 3CCVA 3RLFA 3J7ZC 5M5WH 4BXXG 2LXJA 1YIJA 3EBEA 2WAQG 4O0AA 4A3LG 1L1OC 1XPUA 1QVCA 4DR5L 1N33L 2OCEA 1YJWA 3GTLH 3S2DH 4QQBX 1CKNA 2JEAI 2KHJA 3PO3H 4PZ7A 4P71A 1XNQQ 1X3GA 1CSPA 4OXPA 2R6GA 4TQUS 3CC4A 2E5LQ 1VQCA 1E24A 3U50C 4NXNQ 3S24A 1FJGL 4IFDI 3HOVG 2CQOA 1XNQL 1ASYA 1OXUA 1A62A 2KENA 1BBUA 2PMZE 3NBHB 3EIVA 5C4JH 1HZ9A 1I94L 2ZTDA 1EFWA 3PO2H 3G4SA 4JCVE 4NXNL 3KF6B 2VUMH 3DLLA 5M3FH 4DV3Q 1Y14B 2IX1A 1KIXA 2NVQH 3PO3G 2K5NA 1B7YB 1IBKQ 1PA6A 2ID0A 1Q1BA 2JA7H 4Y52H 4LF7Q 2D62A 2K75A 2UUBQ 4GN3B 2ES2A 3TQYA 1SFOH 1PH5A 3BU2A 1C0AA 4QY7A 4HIKA 1XNRQ 1IBKL 2AWOA 4A75A 5IE8A 4AQYL 1Y1WH 4LF7L 2NN6I 3RZOH 3PO2G 2QEXA 2VUMG 4A4IA 1A0IA 1H95A 4XIGS 3NEMA 5M3FG 4UP8A 1KC8C 1PH8A 4PZ8A 1XNRL 1Z9FA 2JA7G 1WOCA 1B70B 3E9IA 4LFAQ 4X64L 1YEZA 5C0XI 4DNIA 2JK8A 4ME3A 3UDFA 1X65A 3CPFA 4C3HH 1NMFA 1VQ7A 1VS0A 1LUZA 5JJKA 2YV5A 4LFCL 3F2CA 1R9TH 4A3MH 4LFAL 2NZHA 1Y1WG 3ULJA 4DK3C 2Q2HA 2FXQA 3A5UA 4IJHA 1HZAA 2VQEQ 2OWOA 1E7ZA 1XMQQ 4J15A 3GO5A 4P73A 1VQOA 4Y7NH 4DK6C 1Q86C 5IP9H 3G6EA 4IOCA 4DUZQ 4LF4Q 1L1OB 1XJVA 1L2FA 2Y0SE 4LUZA 1A63A 3A5ZB 3STBC 4LF6L 3M85A 1W3SA 2VQEL 1KRTA 1X9NA 1HZBA 1XMQL 1K0RA 4JBMA 4DPGA 4HIOA 2R7ZG 4BA2I 1JJGA 3PIPA 4JI5Q 4DUZL 4APVA 5GAGC 2Z0SA 5M5YH 1J5EL 4GKJQ 4KHPQ 3RNUA 4JI7Q 2DUDA 4DAMA 2YTYA 1EYGA 3JAMi 3CF5A 2IY5B 3T1YL 1X55A 1X54A 2KCTA 5IP9G 3J81j 3NENA 5EAYA 4JI5L 1V43A 5LMNW 1QUQA 1YHBA 4HIMA 1LM0A 1S72A 2VW9A 4POGA 2K50A 2E2IH 1C9OA 1KRSA 4GKJL 1VQFA 2R92H 3KFUA 1N8RC 1UE1A 4LUOA 5AJ3Q 2EIFA 4DR2Q 3RLNA 2H5XA 4OWXB 1VQPA 1PYSB 5IWAL 3OW2A 1PH4A 1VQ5A 2CCZA 1GO3E 2CWPA 1HR0Q 4GN4B 1YZ6A 4X65Q 1HNWL 1IZ6A 4IPCA 1I5FA 5AJ3L 4A3EH 3CXCA 1PH7A 4GKKQ 3PF5A 5IYBG 3UE1A 4DR3L 1PV4A 1HR0L 2R92G 3GTOH 3M4QA 4OWWB 3HOYG 4RG1A 3KJOA 3GTGH 3CCQA 1AE2A 5GAEC 3STBD 4YWKA 1SN8A 1IBLQ 1O7IA 4QIWE 1EQRA 5FLXc 2B63H 2MFIA 3H15A 2ALYB 2UXBQ 2UUAQ 3I4MH 3ER0A 1KD1C 5E7NA 4HJAA 2YTVA 4YHHQ 2YU9H 3PUVA 4EQ5A 3FHWA 4JI8L 3J81i 3PUYA 4JI3L 2F4VL 4JC0A 4A3IH 4C2MH 4C3JH 3KDFA 1TWCH 5GQOA 3NELA 3PIOA 1Y1VG 4DR1Q 2UUAL 4BY7G 2UXBL 1FL0A 2N49A 2OQKA 3F8TA 5IY0A 4YHHL 4P74A 2WFWA 3I4OA 4A3KH 2B63G 2ZTEA 3CCSA 3HOXG 1I6HH 5C4XH 4DV4L 4GLXA 1KHIA 2UU9L 3I4MG 4DV2Q 4NB3A 2I0QA 1WJJA 2R7FA 2JJQA 2RHQB 3U58A 1J6QA 1UWVA 4P75A 1KQSA 3A74A 3VDYA 1XMOQ 3S15H 1PYBA 2E2JH 3I7FA 4DV2L 2JA6H 4UY8C 4GLAC 1EIYB 3W1GA 4LNQA 4OO1G 3UDIA 1V1QA 4JI1Q 4A3KG 4IO9A 2K52A 4JBWA 1XMOL 1UEBA 5FJ8H 2E5LL 4IOAA 5IP7H 3KYHC 3HOWH 2JQOA 1WFQA 3HFZB 4HIDA 5C4XG 4BBRH 2KCMA 2RHSB 5IYCH 2Q2UA 2ZM6Q 2GVAA 4NXMQ 2QGQA 3HOUH 2MO1A 5C3EH 1GM5A 1FVIA 1VQAA 4JI1L 1MIUA 4DUYQ 4DV3L 4GLVB 3PSIA 1IXRA 1VQ9A 3OYYA 2JA6G 1Z47A 5JEAG 5ELOA 5LMUQ 2DGYA 1EUJA 1K3RA 2I5MX 4GN5A 4LW1A 2F52A 2ZM6L 2N78A 1IYJB 2PQAA 4NXML 1EOVA 2BA1A 2WB1E 4FDBA 3ULLA 4K0KQ 4IPDA 5IP7G 2JA5H 3HOWG 4IFDG 3SGIA 4GNXC 1RL2A 1UE7A 3G48A 5IT9c 1OTCA 3D31A 2CFMA 2A1AA 3S1RH 1N36Q 2UUBL 1OXVA 1YITA 3J80i 1E22A 3HOUG 3H0GH 1JJCB 1I50H 3PV0A 5C3EG 3OTOQ 1HNZQ 2AHOB 1VQ6A 3CW2C 4MNOA 1YHQA 3DM3A 4WJ4A 1SR3A 3CMEA 4JYAL 2YTXA 2R7DA 3LGJA 4NPSA 4JV5Q 2AKWB 1HJPA 4JI6Q 1G51A 5BR8Q 2ZTCA 1YJNA 1Q81C 4HJ9A 1NJIC 1TWGH 3OTOL 1HNZL 4IPGA 3FP9A 1BKBA 1ASZA 2VQFQ 4JV5L 1VQJA 2Y0SG 3RZDH 4JI6L 1FGUA 2VZAA 2BH8A 3HKSA 3K7UC 3Q8DA 1VQIA 3TS0A 3S1QH 2I5LX 1NY4A 2K5VA 3CD6A 2JE6I 3E0EA 1EQQA 1JB7A 3CCJA 1XPOA 4L5RC 2A19A 4LF8Q 4A3MG 5C0XG 2YYZA 5C44H 1HNXQ 4B3TQ 4POFA 1K8GA 4JYAQ 4LF4L 3K80C 4B3RQ 1VQDA 2RCNA 4UPAA 3TEHB 1E3PA 1Q7YC 4UP7A 2MNAA 3KF6A 5HGQA 1PH6A 1Q8KA 1N32Q 2UXDQ 4LF8L 1SRUA 3A0JA 3G71A 2CWAA 4A3JH 2R93H 4B3TL 2RF4A 1UE5A 4JOIC 3CMAA 1WYDA 4YWLA 4B3RL 1EWIA 1X3FA 1NE3A 5FLMH 2E2HH 2N8NA 3J7A5 4KHPL 1GKHA 2ZJQA 3FKIH 4DV5Q 4YWMA 1M90C 4JI7L 5GADC 3TRZA 4A3BH 5C44G 1N34Q 4LF9Q 5HY6A 2HIXA 2JA8H 4PG3A 1VQLA 3PCOB 3MXNB 4XTCS 3RR5A 5JEAJ 3PGZA 2L15A 3HKZE 2R93G 1T9HA 1CKNB 1QVFA 1SMXA 4DV0Q 4LF9L 2E8GA 3ZJYC 4DR2L 1XPRA 1YBYA 4IFDJ 3HOZH 3EN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLM G;  1KXL A;  1K73 C;  4AYB E;  4KI0 A;  4GNX B;  4A3B G;  1A8V A;  1D7Q A;  3RN5 A;  3B6Y A;  4X65 L;  3I56 A;  4A3F H;  1OXT A;  3PUW A;  1QZG A;  4DV0 L;  2JA8 G;  4GKK L;  4TVA B;  5M3M H;  1QVG A;  2Q2I A;  1KAW A;  2IX0 A;  2BA0 A;  2XTI A;  3K7A H;  4A93 H;  1KL9 A;  1AE3 A;  4X62 Q;  1VQK A;  4R4Q A;  1VQE A;  1JMC A;  4QGU A;  4A3E G;  3S16 H;  2AMC B;  1SLJ A;  3H3V I;  1X6O A;  3TS2 A;  1IBM Q;  1SE8 A;  1IBL L;  3HOZ G;  4GOP C;  2XGT A;  3UE0 A;  1L1O A;  4QL5 A;  3W1B A;  2N3S A;  1EIF A;  4X62 L;  2GVB A;  5IYD H;  1OXS C;  3JC6 6;  5H1S E;  4A3F G;  4LWC A;  1L0W A;  1NTG A;  3I4N H;  2IHF A;  4O2D A;  2LXK A;  2BH2 A;  5M3M G;  1E1O A;  2MO0 A;  1IBM L;  2K14 A;  1U5K A;  4OWT B;  3GTQ H;  4BA1 I;  4BY1 H;  1CKM A;  3ICE A;  1WCM H;  5LMN Q;  4B3S Q;  1TWF H;  3PUZ A;  5GAH C;  4MZ9 A;  4DR1 L;  5C0X J;  4AIM A;  3GTM H;  3CCM A;  4L5T A;  3WWV A;  1P16 A;  1VQM A;  2PI2 A;  3AYH B;  4A3I G;  1PFS A;  4IJL A;  5LMN L;  4B3S L;  1N33 Q;  2K4K A;  4OO1 I;  2KHI A;  3L7Z C;  5K36 G;  1YJ9 A;  2C35 B;  3F2B A;  3T1H Q;  3MEF A;  4DV7 Q;  2I5H A;  4BY1 G;  4HJ5 A;  3HOV H;  4YCU A;  3I55 A;  3S17 H;  4P72 A;  1WCM G;  3K0X A;  3CC7 A;  1GD7 A;  4R4I A;  2Z6K C;  2EQS A;  1CSQ A;  2QA4 A;  1YHA A;  4LFB Q;  4WJ3 M;  3T1H L;  4MTN A;  1GVP A;  1FJG Q;  4DV7 L;  2WB1 G;  4ALP A;  3JAM c;  2GN5 A;  2MQH A;  2WAQ E;  4GNX A;  3AEV A;  3AFP A;  1CUK A;  4DV1 Q;  1G29 1;  4JI0 Q;  1VQ4 A;  1YI2 A;  1I94 Q;  1HZC A;  2PI2 E;  3CC2 A;  3AFQ A;  1BVS A;  1LYL A;  3KOJ A;  4A3G H;  4LFB L;  3E9H A;  3TRE A;  5FJ8 G;  4L5Q A;  4B3M Q;  3CQZ H;  4X66 Q;  4DUY L;  1X3E A;  4BBR G;  3CCL A;  5IYC G;  4DV1 L;  4JI0 L;  3BJU A;  5LMU L;  1SRO A;  2D0O A;  2NVX H;  5J3B A;  2JEB I;  1YNX A;  4K0K L;  1Q82 C;  4B3M L;  4X66 L;  4DR6 Q;  3M3Y H;  3AQQ A;  3M9B A;  4AQY Q;  1N36 L;  3S14 H;  1QUQ B;  1HH2 P;  4H02 A;  2OQ0 A;  3UDG A;  2Q2T A;  1PVO A;  3CCE A;  4A3G G;  3F1Z A;  1TWH H;  1P8L A;  1TXY A;  1LTL A;  1IL2 A;  3GDE A;  1NMG A;  4R4T A;  1I3Q H;  2EXD A;  2JA5 G;  3RLO A;  3S2H H;  4GOP B;  2VL6 A;  1K9M C;  1JJ2 A;  3GD7 A;  4DR6 L;  1CKO A;  4X64 Q;  1MJC A;  4X6A H;  3M7N A;  1MJE A;  5BR8 L;  2LSS A;  2IHE A;  3H0G G;  4YCV A;  3W5O A;  3F2D A;  4LUV A;  3U4Z A;  4AH6 A;  3CCU A;  2NN6 G;  4QJF A;  4LFC Q;  5JJL A;  3BZC A;  5DLQ E;  1VQH A;  2VQF L;  4DAY B;  4DR4 Q;  3J81 c;  2ATW A;  4PMW A;  1HR0 W;  1XTD A;  2K5H A;  4JBJ A;  4L5S A;  4A3D H;  1G6P A;  2UXC Q;  4JOI A;  3GTJ H;  2OTL A;  4R4C A;  3KLW A;  2D0P A;  4DR4 L;  1X56 A;  2R7Z H;  5ELN A;  2VNU D;  4YY3 Q;  4JG2 A;  1BBW A;  3GTP H;  1Q46 A;  4LF6 Q;  1VCI A;  3BZK A;  1HNX L;  2HT1 A;  2UXC L;  4KLK A;  3K81 C;  2WP8 J;  3PUX A;  3M4O H;  4A3C H;  1TWA H;  3PF4 A;  5JJI A;  1S3O A;  3CAM A;  4R1J A;  4OX9 Q;  2KBN A;  4HJ7 A;  3RN2 A;  4YY3 L;  2AWN A;  4JI2 Q;  4A3D G;  3HKZ G;  1J5E Q;  1N32 L;  2UXD L;  2HQL A;  4GS3 A;  4KHZ A;  3CCR A;  3CP0 A;  1NBW A;  3KDF B;  1PHJ A;  1C7Y A;  4BBS H;  1JT8 A;  1K8A C;  1V9P A;  3IRB A;  3T1Y Q;  5M5X H;  4AYB G;  2V1C C;  4OX9 L;  2IT1 A;  3ULP A;  4DV5 L;  1VQG A;  1RIP A;  1YVC A;  4YCW A;  4A3J G;  1N34 L;  1VQ8 A;  4JI2 L;  2ASB A;  1D8L A;  2HIV A;  4A76 A;  1W2B A;  2B29 A;  2VS1 A;  4A3C G;  4EX5 A;  4RMF A;  2ZJR A;  1WI5 A;  2VY3 A;  4DR7 Q;  1K83 H;  2F3I A;  4PZ6 A;  3FKI G;  2CKZ B;  3CPW A;  5IWA Q;  5IYB H;  1PH2 A;  3KF8 B;  4JI4 Q;  3D0F A;  4BBS G;  3KJP A;  1HNW Q;  1UE6 A;  4DR7 L;  4UP9 A;  3HOY H;  4GOP A;  4LF5 Q;  1PH9 A;  4OON A;  1AH9 A;  3S1N H;  1DGS A;  1Q12 A;  4JBK A;  4DR3 Q;  2NVT H;  3L0O A;  4DV6 Q;  4JI4 L;  3J80 c;  4LF5 L;  2UUC Q;  1N9W A;  2JA9 A;  3UDX A;  1B8A A;  2A8V A;  1PH1 A;  3H3V H;  4DV6 L;  2PNH A;  4HJ8 A;  1QZH A;  1M1K C;  1U0L A;  1Y1V H;  2B3G A;  2PQA B;  3L2P A;  2UUC L;  4BY7 H;  4A93 G;  1VQN A;  4JI8 Q;  4BXX H;  3M4P A;  2HHH Q;  4JI3 Q;  4DKA C;  2F4V Q;  1MKH A;  4A3L H;  3ERS X;  3HOX H;  1PH3 A;  3I2Z A;  4IPH A;  1JE5 A;  2NZO A;  2OTJ A;  5GRO A;  1S40 A;  5IYD G;  2HHH L;  2ZJP A;  1OXX K;  1Q1E A;  3K8A A;  4R4O A;  4DR5 Q;  3GTK H;  3S1M H;  3I4N G;  2Z6K A;  1VQB A;  1E1T A;  4DV4 Q;  2UU9 Q;  3U4V A;  4C3I H;  2NVY H;  3CCV A;  3RLF A;  3J7Z C;  5M5W H;  4BXX G;  2LXJ A;  1YIJ A;  3EBE A;  2WAQ G;  4O0A A;  4A3L G;  1L1O C;  1XPU A;  1QVC A;  4DR5 L;  1N33 L;  2OCE A;  1YJW A;  3GTL H;  3S2D H;  4QQB X;  1CKN A;  2JEA I;  2KHJ A;  3PO3 H;  4PZ7 A;  4P71 A;  1XNQ Q;  1X3G A;  1CSP A;  4OXP A;  2R6G A;  4TQU S;  3CC4 A;  2E5L Q;  1VQC A;  1E24 A;  3U50 C;  4NXN Q;  3S24 A;  1FJG L;  4IFD I;  3HOV G;  2CQO A;  1XNQ L;  1ASY A;  1OXU A;  1A62 A;  2KEN A;  1BBU A;  2PMZ E;  3NBH B;  3EIV A;  5C4J H;  1HZ9 A;  1I94 L;  2ZTD A;  1EFW A;  3PO2 H;  3G4S A;  4JCV E;  4NXN L;  3KF6 B;  2VUM H;  3DLL A;  5M3F H;  4DV3 Q;  1Y14 B;  2IX1 A;  1KIX A;  2NVQ H;  3PO3 G;  2K5N A;  1B7Y B;  1IBK Q;  1PA6 A;  2ID0 A;  1Q1B A;  2JA7 H;  4Y52 H;  4LF7 Q;  2D62 A;  2K75 A;  2UUB Q;  4GN3 B;  2ES2 A;  3TQY A;  1SFO H;  1PH5 A;  3BU2 A;  1C0A A;  4QY7 A;  4HIK A;  1XNR Q;  1IBK L;  2AWO A;  4A75 A;  5IE8 A;  4AQY L;  1Y1W H;  4LF7 L;  2NN6 I;  3RZO H;  3PO2 G;  2QEX A;  2VUM G;  4A4I A;  1A0I A;  1H95 A;  4XIG S;  3NEM A;  5M3F G;  4UP8 A;  1KC8 C;  1PH8 A;  4PZ8 A;  1XNR L;  1Z9F A;  2JA7 G;  1WOC A;  1B70 B;  3E9I A;  4LFA Q;  4X64 L;  1YEZ A;  5C0X I;  4DNI A;  2JK8 A;  4ME3 A;  3UDF A;  1X65 A;  3CPF A;  4C3H H;  1NMF A;  1VQ7 A;  1VS0 A;  1LUZ A;  5JJK A;  2YV5 A;  4LFC L;  3F2C A;  1R9T H;  4A3M H;  4LFA L;  2NZH A;  1Y1W G;  3ULJ A;  4DK3 C;  2Q2H A;  2FXQ A;  3A5U A;  4IJH A;  1HZA A;  2VQE Q;  2OWO A;  1E7Z A;  1XMQ Q;  4J15 A;  3GO5 A;  4P73 A;  1VQO A;  4Y7N H;  4DK6 C;  1Q86 C;  5IP9 H;  3G6E A;  4IOC A;  4DUZ Q;  4LF4 Q;  1L1O B;  1XJV A;  1L2F A;  2Y0S E;  4LUZ A;  1A63 A;  3A5Z B;  3STB C;  4LF6 L;  3M85 A;  1W3S A;  2VQE L;  1KRT A;  1X9N A;  1HZB A;  1XMQ L;  1K0R A;  4JBM A;  4DPG A;  4HIO A;  2R7Z G;  4BA2 I;  1JJG A;  3PIP A;  4JI5 Q;  4DUZ L;  4APV A;  5GAG C;  2Z0S A;  5M5Y H;  1J5E L;  4GKJ Q;  4KHP Q;  3RNU A;  4JI7 Q;  2DUD A;  4DAM A;  2YTY A;  1EYG A;  3JAM i;  3CF5 A;  2IY5 B;  3T1Y L;  1X55 A;  1X54 A;  2KCT A;  5IP9 G;  3J81 j;  3NEN A;  5EAY A;  4JI5 L;  1V43 A;  5LMN W;  1QUQ A;  1YHB A;  4HIM A;  1LM0 A;  1S72 A;  2VW9 A;  4POG A;  2K50 A;  2E2I H;  1C9O A;  1KRS A;  4GKJ L;  1VQF A;  2R92 H;  3KFU A;  1N8R C;  1UE1 A;  4LUO A;  5AJ3 Q;  2EIF A;  4DR2 Q;  3RLN A;  2H5X A;  4OWX B;  1VQP A;  1PYS B;  5IWA L;  3OW2 A;  1PH4 A;  1VQ5 A;  2CCZ A;  1GO3 E;  2CWP A;  1HR0 Q;  4GN4 B;  1YZ6 A;  4X65 Q;  1HNW L;  1IZ6 A;  4IPC A;  1I5F A;  5AJ3 L;  4A3E H;  3CXC A;  1PH7 A;  4GKK Q;  3PF5 A;  5IYB G;  3UE1 A;  4DR3 L;  1PV4 A;  1HR0 L;  2R92 G;  3GTO H;  3M4Q A;  4OWW B;  3HOY G;  4RG1 A;  3KJO A;  3GTG H;  3CCQ A;  1AE2 A;  5GAE C;  3STB D;  4YWK A;  1SN8 A;  1IBL Q;  1O7I A;  4QIW E;  1EQR A;  5FLX c;  2B63 H;  2MFI A;  3H15 A;  2ALY B;  2UXB Q;  2UUA Q;  3I4M H;  3ER0 A;  1KD1 C;  5E7N A;  4HJA A;  2YTV A;  4YHH Q;  2YU9 H;  3PUV A;  4EQ5 A;  3FHW A;  4JI8 L;  3J81 i;  3PUY A;  4JI3 L;  2F4V L;  4JC0 A;  4A3I H;  4C2M H;  4C3J H;  3KDF A;  1TWC H;  5GQO A;  3NEL A;  3PIO A;  1Y1V G;  4DR1 Q;  2UUA L;  4BY7 G;  2UXB L;  1FL0 A;  2N49 A;  2OQK A;  3F8T A;  5IY0 A;  4YHH L;  4P74 A;  2WFW A;  3I4O A;  4A3K H;  2B63 G;  2ZTE A;  3CCS A;  3HOX G;  1I6H H;  5C4X H;  4DV4 L;  4GLX A;  1KHI A;  2UU9 L;  3I4M G;  4DV2 Q;  4NB3 A;  2I0Q A;  1WJJ A;  2R7F A;  2JJQ A;  2RHQ B;  3U58 A;  1J6Q A;  1UWV A;  4P75 A;  1KQS A;  3A74 A;  3VDY A;  1XMO Q;  3S15 H;  1PYB A;  2E2J H;  3I7F A;  4DV2 L;  2JA6 H;  4UY8 C;  4GLA C;  1EIY B;  3W1G A;  4LNQ A;  4OO1 G;  3UDI A;  1V1Q A;  4JI1 Q;  4A3K G;  4IO9 A;  2K52 A;  4JBW A;  1XMO L;  1UEB A;  5FJ8 H;  2E5L L;  4IOA A;  5IP7 H;  3KYH C;  3HOW H;  2JQO A;  1WFQ A;  3HFZ B;  4HID A;  5C4X G;  4BBR H;  2KCM A;  2RHS B;  5IYC H;  2Q2U A;  2ZM6 Q;  2GVA A;  4NXM Q;  2QGQ A;  3HOU H;  2MO1 A;  5C3E H;  1GM5 A;  1FVI A;  1VQA A;  4JI1 L;  1MIU A;  4DUY Q;  4DV3 L;  4GLV B;  3PSI A;  1IXR A;  1VQ9 A;  3OYY A;  2JA6 G;  1Z47 A;  5JEA G;  5ELO A;  5LMU Q;  2DGY A;  1EUJ A;  1K3R A;  2I5M X;  4GN5 A;  4LW1 A;  2F52 A;  2ZM6 L;  2N78 A;  1IYJ B;  2PQA A;  4NXM L;  1EOV A;  2BA1 A;  2WB1 E;  4FDB A;  3ULL A;  4K0K Q;  4IPD A;  5IP7 G;  2JA5 H;  3HOW G;  4IFD G;  3SGI A;  4GNX C;  1RL2 A;  1UE7 A;  3G48 A;  5IT9 c;  1OTC A;  3D31 A;  2CFM A;  2A1A A;  3S1R H;  1N36 Q;  2UUB L;  1OXV A;  1YIT A;  3J80 i;  1E22 A;  3HOU G;  3H0G H;  1JJC B;  1I50 H;  3PV0 A;  5C3E G;  3OTO Q;  1HNZ Q;  2AHO B;  1VQ6 A;  3CW2 C;  4MNO A;  1YHQ A;  3DM3 A;  4WJ4 A;  1SR3 A;  3CME A;  4JYA L;  2YTX A;  2R7D A;  3LGJ A;  4NPS A;  4JV5 Q;  2AKW B;  1HJP A;  4JI6 Q;  1G51 A;  5BR8 Q;  2ZTC A;  1YJN A;  1Q81 C;  4HJ9 A;  1NJI C;  1TWG H;  3OTO L;  1HNZ L;  4IPG A;  3FP9 A;  1BKB A;  1ASZ A;  2VQF Q;  4JV5 L;  1VQJ A;  2Y0S G;  3RZD H;  4JI6 L;  1FGU A;  2VZA A;  2BH8 A;  3HKS A;  3K7U C;  3Q8D A;  1VQI A;  3TS0 A;  3S1Q H;  2I5L X;  1NY4 A;  2K5V A;  3CD6 A;  2JE6 I;  3E0E A;  1EQQ A;  1JB7 A;  3CCJ A;  1XPO A;  4L5R C;  2A19 A;  4LF8 Q;  4A3M G;  5C0X G;  2YYZ A;  5C44 H;  1HNX Q;  4B3T Q;  4POF A;  1K8G A;  4JYA Q;  4LF4 L;  3K80 C;  4B3R Q;  1VQD A;  2RCN A;  4UPA A;  3TEH B;  1E3P A;  1Q7Y C;  4UP7 A;  2MNA A;  3KF6 A;  5HGQ A;  1PH6 A;  1Q8K A;  1N32 Q;  2UXD Q;  4LF8 L;  1SRU A;  3A0J A;  3G71 A;  2CWA A;  4A3J H;  2R93 H;  4B3T L;  2RF4 A;  1UE5 A;  4JOI C;  3CMA A;  1WYD A;  4YWL A;  4B3R L;  1EWI A;  1X3F A;  1NE3 A;  5FLM H;  2E2H H;  2N8N A;  3J7A 5;  4KHP L;  1GKH A;  2ZJQ A;  3FKI H;  4DV5 Q;  4YWM A;  1M90 C;  4JI7 L;  5GAD C;  3TRZ A;  4A3B H;  5C44 G;  1N34 Q;  4LF9 Q;  5HY6 A;  2HIX A;  2JA8 H;  4PG3 A;  1VQL A;  3PCO B;  3MXN B;  4XTC S;  3RR5 A;  5JEA J;  3PGZ A;  2L15 A;  3HKZ E;  2R93 G;  1T9H A;  1CKN B;  1QVF A;  1SMX A;  4DV0 Q;  4LF9 L;  2E8G A;  3ZJY C;  4DR2 L;  1XPR A;  1YBY A;  4IFD J;  3HOZ H;  3EN2 A; 
#chains in the Genus database with same CATH topology
 5C5L A;  5FLM G;  4H0L C;  4AYB E;  4GNX B;  4XXE A;  1A6X A;  1MSG A;  3DMU A;  4OIJ A;  3RN5 A;  3B6Y A;  5I6Y A;  4FF1 A;  3PUW A;  3IAY A;  1RHP A;  4GKK L;  5M3M H;  2IX0 A;  3NWS A;  3K7A H;  4A93 H;  1BXT A;  2F0I A;  4X62 Q;  2XN9 C;  3ND8 A;  1JMC A;  4A3E G;  3R93 A;  5IGF A;  2AQ1 B;  1SLJ A;  3TS2 A;  4FXK C;  1IBM Q;  4L63 B;  1EIF A;  5IYD H;  1OXS C;  2PQE A;  1EY0 A;  4LWC A;  1WD1 A;  3KBX A;  3Q0A A;  4R8N A;  3GTQ H;  1X3P A;  4OWT B;  3Q24 A;  3JAM E;  3ICE A;  5LMN Q;  1TWF H;  3PUZ A;  3S9W A;  3NBI A;  3OHX C;  5C0X J;  1GUO A;  4AIM A;  3CKI B;  4XYO A;  3CCM A;  2PI2 A;  2Y0S B;  2F0S A;  3VR4 A;  1MSH A;  4A3I G;  1EY4 A;  5C3X A;  4WJW A;  3L7Z C;  3OIP A;  3T1H Q;  1DOM A;  4BY1 G;  4RGM A;  1WTP A;  1LT4 D;  1GD7 A;  4A3M B;  1ENC A;  1SDF A;  4XT1 B;  2K28 A;  2QA4 A;  1PRT B;  2IJ0 A;  4WJ3 M;  1FJG Q;  1GVP A;  5ELB A;  4C1N I;  1FGB D;  2LFN A;  3AEV A;  3AFP A;  1ZXT A;  4Y7N B;  2PI2 E;  1YI2 A;  3CC2 A;  3KOJ A;  2J0T D;  2JN4 A;  2N55 A;  4BBR G;  4DV1 L;  4JI0 L;  1PDQ A;  2P5Z X;  2ZXR A;  1D2B A;  1LLR D;  4B3M L;  3M3Y H;  4AQY Q;  4B9X A;  1HH2 P;  2OQ0 A;  3CCE A;  5IGC A;  4ZYS A;  4JW0 A;  2AUJ D;  2QDB A;  4OIK A;  2E2I B;  2JA5 G;  4H13 C;  4GOP B;  1K9M C;  1JJ2 A;  4X6A H;  3M7N A;  2LSS A;  1F9S A;  4AH6 A;  4CDE C;  3CCU A;  3D8G A;  2K32 A;  2VXW A;  3TN2 A;  4GZY C;  2RBM A;  1BO0 A;  3K6O A;  4A3D H;  1E2W A;  3I8Z A;  2K04 A;  3I91 A;  3H6M A;  2B2Y C;  1JOK A;  4EQO A;  3GTP H;  3M4Y A;  3CHB D;  4LF6 Q;  2HT1 A;  1HNX L;  3GV6 A;  1QCB D;  3FDT A;  1I4R A;  1HHV A;  5AFW A;  2YU9 B;  2AWN A;  1STB A;  3HKZ G;  2PMZ B;  2L5T A;  4GS3 A;  1PHJ A;  3CP0 A;  3KDF B;  3NQT A;  1D1K A;  4C2M B;  2PZU A;  1XWE A;  4FO2 A;  4OX9 L;  4FYD A;  3HRZ C;  1KAB A;  1WD0 A;  1N34 L;  3CU7 A;  2ASB A;  2HIV A;  2WV6 D;  3D4W A;  1K8M A;  4ZUI A;  4RMF A;  1I6H B;  1WI5 A;  1SNO A;  5C4X B;  1F2M A;  3SK5 A;  1WTO A;  4HCE A;  1TVX A;  2H4O A;  5A2Q L;  3TZD A;  4BBS G;  1BOS A;  1UE6 A;  5FOB B;  4UP9 A;  4KKS A;  4DK0 A;  2JA6 B;  1TY0 A;  1AH9 A;  2B8F A;  1O80 A;  2DJF C;  4LF5 L;  2JA9 A;  3HOU B;  1EY8 A;  2QIL A;  2A8V A;  1H9K A;  4DV6 L;  4HJ8 A;  1AFP A;  2PQA B;  2F0T A;  3L2P A;  1WVL A;  2UUC L;  1VQN A;  4IAL A;  4JI8 Q;  1C48 A;  2HHH Q;  5CR3 A;  1LTG D;  4A3L H;  1ILQ A;  2HUG A;  1PH3 A;  3WOE A;  1JE5 A;  2O2L D;  3H0G B;  5IGB A;  2ZJP A;  3SR1 A;  4DR5 Q;  3I4N G;  2Z6K A;  4DV4 Q;  3U4V A;  2NVY H;  3RLF A;  1HPC A;  3BYT B;  3MAQ A;  1YIJ A;  1TWG B;  2WAQ G;  4O0A A;  1YJW A;  3CRK C;  4FNF A;  4KTA A;  5KNC A;  3EVQ A;  2KHJ A;  3ND9 A;  4DAP A;  1AW7 A;  1X3G A;  2MPM A;  1BCP B;  1VQC A;  5CMD A;  3KF8 A;  2IWH A;  5JOB A;  1XNQ L;  1OXU A;  1S5E D;  1DCZ A;  5C4J H;  3VYS A;  4NXN L;  1B44 D;  4X3S A;  1TS4 A;  1B7Y B;  2ID0 A;  1CTM A;  4B9W A;  4A3J B;  5I2X A;  1O7L A;  3VR6 A;  1QWY A;  4GN3 B;  1CZG A;  1EY9 A;  2FJ2 A;  4A3B B;  4QB4 A;  4K6D A;  1Y69 U;  5IE8 A;  1KNE A;  2NN6 I;  1A0I A;  4XIG S;  4UP8 A;  1PH8 A;  1WOC A;  5T1I A;  4X64 L;  3TDQ A;  3UDF A;  1X65 A;  2NBF A;  2E76 C;  3MXP A;  3BVZ A;  1VQ7 A;  5JJK A;  2JSO A;  1B9M A;  2YV5 A;  4HSV A;  1ZYR D;  3K58 A;  3TP7 A;  3LX0 A;  5M9O A;  5M3M B;  2FXQ A;  4A93 B;  2K5W A;  1HZA A;  3K7A B;  1E7Z A;  1XMQ Q;  3GV3 A;  3GO5 A;  1VQO A;  4LAA A;  4IOC A;  1XJV A;  3MXU A;  1LT6 D;  2Y0S E;  2RDG A;  3A5Z B;  1JE4 A;  1KRT A;  1X9N A;  1EY7 A;  5KYI A;  4JBM A;  1NSN S;  3NUC A;  3J81 L;  4BA2 I;  5E3F A;  5CYU A;  2KCN A;  5GAG C;  3SDZ A;  2X6L A;  5M5Y H;  3GTQ B;  4GKJ Q;  3RNU A;  4DAM A;  1SE4 A;  1TWF B;  4C56 C;  3CF5 A;  3L3O C;  1V43 A;  1JWM D;  2A74 C;  1LM0 A;  4XQJ A;  1NUC A;  1DON A;  2WB1 B;  2R92 H;  3KFU A;  2RDH A;  1UE1 A;  1I4G A;  3P75 A;  1VQP A;  1VQ5 A;  1PYS B;  1PH4 A;  1R4Q B;  2TSS A;  3SHL A;  1M8A A;  4H7B A;  5AJ3 L;  3A7L A;  3NSW A;  3CXC A;  4GKK Q;  2QKI C;  4OGQ C;  1PV4 A;  3I73 A;  5EBC A;  3GTO H;  4OWW B;  3HOY G;  1AE2 A;  1L0Y B;  2B63 H;  5EKI A;  1SSO A;  3E0J A;  1MI2 A;  1Y8P B;  3ER0 A;  4IZ8 A;  3NHH A;  2VUM B;  3D6C A;  2F4V L;  4JC0 A;  4C3J H;  1BCP F;  3KDF A;  1TWC H;  2UUA L;  3NEL A;  3M3Y B;  2JA7 B;  1PTO F;  1YNN C;  3TP5 A;  2E74 C;  4P74 A;  1B53 A;  1T5E A;  1V1P B;  2DNC A;  4UHV A;  1SFO B;  3TME A;  4GLX A;  1KHI A;  1HA5 A;  3E3X A;  2R7F A;  2JJQ A;  2EDG A;  4IUV A;  1J6Q A;  1WTH A;  4P75 A;  5LL6 S;  3S15 H;  1HFG A;  2Z1C A;  2E2J H;  5KEE A;  3Q23 A;  4DV2 L;  4OO1 G;  3HP3 A;  1V1Q A;  4JI1 Q;  4A3D B;  1UEB A;  5C4X G;  2JQO A;  3HFZ B;  4CKB A;  2KCM A;  3OSO A;  2GVA A;  1TQO A;  1GM5 A;  4K8J A;  3GTP B;  3EFX D;  2JA6 G;  3OMG A;  5JEA G;  4GN5 A;  1EUJ A;  1K3R A;  2I5M X;  2V4D A;  4OHJ A;  2PQA A;  4NXM L;  4G7Z C;  3HOW G;  4IFD G;  3SGI A;  4GNX C;  1UE7 A;  3A8K E;  2CFM A;  3S1R H;  1KLG D;  1E22 A;  3HOU G;  5C3E G;  5G3L D;  2NN6 H;  4MNO A;  1YHQ A;  4WJ4 A;  1SR3 A;  3K5O A;  4JYA L;  1STG A;  1HJP A;  3QIA A;  2ZTC A;  4HJ9 A;  4OL7 A;  3OTO L;  3G7L A;  2KED A;  2NB0 A;  1WTV A;  1QOH A;  5J1Z A;  3RZD H;  4JI6 L;  2BH8 A;  5ELD A;  1PLF A;  4K2L A;  2NYZ D;  2H1E A;  1EQT A;  2K5V A;  4IN3 A;  3E0E A;  5D3D A;  3CCJ A;  4C3H G;  1XPO A;  1F2L A;  3RMH A;  5E1F A;  2HCC A;  5C0X G;  2F0F A;  1HNX Q;  1JWU D;  3I90 A;  1E3P A;  3NXW A;  4NMZ A;  1ICW A;  1UE5 A;  3CMA A;  3DWA A;  4B3R L;  2NWG A;  3NP8 A;  4KHP L;  2ZJQ A;  1N34 Q;  1PRT C;  5J39 A;  4LF9 Q;  5HY6 A;  4ZK9 B;  2JA8 H;  4U67 3;  1VQL A;  1L0X B;  3MFG A;  2NVY B;  3V2T A;  2OXP A;  1U4R A;  1CKN B;  1XYI A;  1QVF A;  1SMX A;  2K7V A;  4DR2 L;  1KXL A;  2KEE A;  1K0S A;  4ODG A;  4A3B G;  4DN4 M;  1D7Q A;  3T13 A;  3I56 A;  1OXT A;  5C6A A;  1FNV A;  4PMC A;  1B3A A;  4EVO A;  1EQV A;  3DWP A;  4TVA B;  1QVG A;  3A7A B;  1AE3 A;  1J8I A;  1VQK A;  4R4Q A;  4QGU A;  1O7Y A;  1W6J A;  5C4J B;  4L6T B;  4KD3 A;  1IBL L;  1VMC A;  2XRS D;  2LS0 1;  4CJ2 C;  4GOP C;  3W1B A;  3N6R A;  4QL5 A;  2N3S A;  1FYC A;  4KN4 C;  1HUN A;  2GVB A;  4L8J A;  5H1S E;  1NTG A;  5M3M G;  2MO0 A;  2K14 A;  1XTC D;  1CKM A;  4KV6 A;  2L55 A;  1WCM H;  3KLS X;  5GAH C;  3F2U A;  5FLX L;  1JOO A;  2F0P A;  5F2D A;  1PFS A;  3EA6 A;  4B3S L;  3VYR A;  1QB5 D;  2KHI A;  5K36 G;  2C35 B;  2O5I C;  4DV7 Q;  5D14 A;  2I5H A;  3HOV H;  3I55 A;  3MXN A;  2QDL A;  3K0X A;  4HMI A;  3CC7 A;  2K01 A;  2B2W A;  2DNE A;  3IL8 A;  4HMJ A;  4R8I A;  5K5P A;  1CSQ A;  1YHA A;  2B2T C;  1ZKO A;  2LMC B;  4N9P A;  4Q5V A;  2B2U A;  2WB1 G;  1IL8 A;  4ALP A;  2CW0 C;  4ZUJ A;  2GN5 A;  1SYG A;  5CV9 A;  1G29 1;  4XDX A;  3D6W A;  5D65 A;  1HZC A;  3AFQ A;  4LFB L;  1SMY C;  3TRE A;  1GHJ A;  2F3W A;  3CQZ H;  5A35 A;  4DUY L;  3CCL A;  5IGE A;  5IYC G;  2PO4 A;  1SRO A;  3IKJ A;  5J3B A;  1YNX A;  1A3V A;  3NQI A;  3H09 A;  1HFN A;  5M5Y B;  1LT3 D;  2F4I A;  4X66 L;  4DR6 Q;  3MWY W;  1QUQ B;  2F03 A;  5DNF A;  2SOB A;  1P8L A;  1IL2 A;  1I3Q H;  3RLO A;  2R92 B;  4X64 Q;  1V8Q A;  1MJC A;  3HS0 C;  2QEJ C;  3U4Z A;  1VMP A;  4PMB A;  5E4X A;  5IT9 L;  4RHR A;  5JJL A;  3BZC A;  1VQH A;  4OEL B;  4DR4 Q;  1PTO H;  3J81 c;  1HR0 W;  2PZT A;  4JBJ A;  2KUM A;  3HOZ B;  2Q8T A;  4YIJ A;  2UXC Q;  4ZKC B;  5I9O A;  3GTO B;  3KLW A;  5D3I B;  2R7Z H;  2VNU D;  4YY3 Q;  1GXD C;  1YNJ D;  4JG2 A;  1BBW A;  4G7O C;  1A2T A;  1VCI A;  3J7A F;  3K81 C;  1IW7 D;  4A3C H;  1TWA H;  3PF4 A;  5JJI A;  3G6J B;  3OPO A;  2KBN A;  4HJ7 A;  2OEO A;  4JI2 Q;  4A3D G;  1N32 L;  2WIN B;  3DWQ A;  2HQL A;  1JT8 A;  1NBW A;  2KJX A;  1C7Y A;  3X3N A;  3NTK A;  1K8A C;  4C3J B;  1TWC B;  4AYB G;  2V1C C;  4B08 A;  4DV5 L;  2A6H D;  1BCP C;  5L37 A;  1VQ8 A;  4YCW A;  1D8L A;  1W2B A;  2B29 A;  2VS1 A;  4MIU A;  2VY3 A;  1DOL A;  1IYV A;  3FKI G;  5IGD A;  2CKZ B;  3CPW A;  4RAU C;  1UEA B;  4DK1 A;  5IYB H;  4DGZ A;  3KF8 B;  1PH2 A;  1EEF D;  4CDF C;  3S15 B;  2E2J B;  1EY6 A;  4DR7 L;  2EY5 A;  3VR5 A;  1DGS A;  5BN3 A;  4JI4 L;  1SND A;  1V1O A;  3DM1 A;  3J80 c;  4J6H A;  4WFN 3;  4TRD A;  3TP6 A;  1N9W A;  1MGS A;  2PZW A;  3T51 B;  1LTI D;  2PNH A;  1QZH A;  2B3G A;  2HQE A;  4BY7 H;  2RQX A;  5CV6 A;  4MHE A;  4BXX H;  3M4P A;  5CV7 A;  2F4V Q;  4N9T A;  1VDZ A;  5LHY 1;  3HOX H;  3V96 A;  1I4X A;  4G7H C;  1BCP D;  3S1R B;  1ENF A;  2F0L A;  3ITP A;  3I70 A;  1PTO D;  1S5F D;  1OXX K;  3MZ5 A;  4M8A A;  4R4O A;  1EZ6 A;  3R2T A;  2LXJ A;  4LK1 C;  2EE1 A;  3EBE A;  5FO9 B;  4A3L G;  3Q22 A;  4TKO B;  4XT3 B;  1N33 L;  3SVM A;  1XPU A;  2JXM B;  1CKN A;  3RZD B;  3C1F A;  3QG1 A;  4P71 A;  4OXP A;  1ESF A;  2F0Q A;  1UNS A;  2EXZ A;  4K2K A;  3FPP A;  3U50 C;  4K5X A;  5I4D A;  1HQM C;  1TS3 A;  1FD7 D;  1UUP A;  2RVL A;  2KEN A;  1BBU A;  1SNP A;  1HZ9 A;  2ZTD A;  2HDL A;  2VUM H;  3KF6 B;  4RFB A;  2EOT A;  5FO7 B;  2EYM A;  2JA7 H;  1JQY D;  1DJR D;  2AUK A;  3SXH A;  1SJE D;  3TQY A;  1SFO H;  3JAM L;  1C0A A;  3U9O A;  4HIK A;  1A3U A;  1RKN A;  1IBK L;  2B2U C;  2AWO A;  1JCK B;  4A75 A;  4LF7 L;  3RZO H;  2JA8 B;  4CJ1 B;  1DZ1 A;  1PYW D;  4QUC A;  4IQZ A;  1XNR L;  4DNT B;  3E9I A;  1LTT D;  1YEZ A;  4HCS A;  1AN8 A;  4DNI A;  4ME3 A;  1K83 B;  1VS0 A;  1LUZ A;  2C9O A;  4LFC L;  3F2C A;  1Q90 A;  4LFA L;  1CHP D;  3UI2 A;  1LT5 D;  2IL8 A;  1CHQ D;  1SNQ A;  1CM9 A;  2OWO A;  3C3L A;  4WOR A;  4JVZ A;  4P73 A;  4DK6 C;  5IP9 H;  1L1O B;  3A8J E;  1ICF B;  1IKL A;  1L2F A;  3SEB A;  4LUZ A;  1C8C A;  1ILP A;  4H44 C;  2VQE L;  4M1U B;  1HZB A;  3O13 A;  1K0R A;  1GUG A;  2R61 A;  3SK6 A;  4F7X A;  3PIO 3;  1JJG A;  4DUZ L;  3R3O A;  1ONL A;  2Z0S A;  4O1N A;  4KHP Q;  1XXG A;  2DUD A;  1WCM B;  2YTY A;  1EYG A;  4NP5 A;  1X55 A;  1X54 A;  2B2V A;  5EAY A;  2X6G A;  4JI5 L;  5LMN W;  1QUQ A;  4ABN A;  1S72 A;  1C9O A;  1F2Z A;  1N8R C;  4OEM B;  2BCO A;  3QO2 A;  4DR2 Q;  3DHQ A;  3RLN A;  5IWA L;  3HOV B;  3D3R A;  4GN4 B;  1HNW L;  1IZ6 A;  4IPC A;  1I5F A;  3NTI A;  4A3E H;  1GJX A;  1PH7 A;  2R92 G;  1HR0 L;  1QNU A;  1SN8 A;  1IBL Q;  4N8F A;  5FLX c;  2MFI A;  3H15 A;  2VB2 X;  2ALY B;  3CQZ B;  1HCZ A;  2UXB Q;  3I4M H;  1KD1 C;  2KHS A;  5BN4 A;  3FHW A;  3PO2 B;  1F77 A;  3PUY A;  3OWE B;  3SE0 A;  4A3I H;  4IUQ A;  1Y1V G;  1E2Z A;  2F3V A;  2L12 A;  2OQK A;  4YHH L;  2WFW A;  3QWN A;  5CBA E;  2B63 G;  2ZTE A;  1I3Q B;  1II3 A;  2F1M A;  1LAC A;  1IYU A;  3A74 A;  2O4X A;  1XMO Q;  1ZYR C;  5CC4 A;  2MP1 A;  4C3I G;  1PTO B;  4F8M A;  4UY8 C;  1EIY B;  2XWB B;  4MTK A;  3UDI A;  1WTX A;  4JBW A;  2EYF A;  2E5L L;  5IP7 H;  3AU7 A;  2XWJ B;  1WFQ A;  1EYC A;  4BBR H;  3H94 A;  2Q2U A;  4BS9 A;  1JIC A;  3KUP A;  1U9R A;  2R7Z B;  2QGQ A;  2MO1 A;  3EJI A;  5EPJ A;  3OWF A;  1FVI A;  1VQA A;  3LWU A;  4DUY Q;  4GLV B;  3VR2 A;  1VQ9 A;  1TWA B;  4DV3 L;  1PMR A;  2ZM6 L;  5KRU A;  1STH A;  2PCF B;  4V19 0;  4FDB A;  2EY2 A;  2B39 A;  4IPD A;  2JA5 H;  1QG7 A;  1RL2 A;  3G48 A;  5IT9 c;  2UUB L;  3D31 A;  3NWT A;  1R4P B;  2MHV A;  1SXT A;  1I50 H;  1HNZ Q;  2AHO B;  1VQ6 A;  3CW2 C;  4I65 A;  3DM3 A;  5EPK A;  1SNM A;  2R7D A;  3LGJ A;  4JV5 Q;  2AKW B;  1G51 A;  1EWC A;  2NZ1 D;  1M4V A;  4IUT A;  3ONA B;  1ASZ A;  3EQL C;  1A15 A;  1VQJ A;  2Y0S G;  1FGU A;  2VZA A;  2EY6 A;  1VQI A;  3QOL A;  3CD6 A;  3OMC A;  2O5J C;  2JE6 I;  1D5Z C;  1RTO A;  1S5C D;  4LF8 Q;  5C5M A;  4A3M G;  1CA6 A;  2F0J A;  5C44 H;  2FIN B;  4POF A;  3RD4 A;  1EZ8 A;  1K8G A;  2RCN A;  4KY6 A;  4UP7 A;  4BY7 B;  3KF6 A;  5HGQ A;  5BN5 A;  1N32 Q;  2DY8 A;  2CWA A;  2DN8 A;  4B3T L;  1QJO A;  1WYD A;  4YWL A;  3HOX B;  5KND A;  1X3F A;  1NE3 A;  4G57 A;  3J7A 5;  1GKH A;  4DV5 Q;  3R8B A;  4JI7 L;  3GQB A;  2Z9H A;  2F0D A;  1CQV A;  1NAP A;  1QE6 A;  3KK7 A;  2HIX A;  1BNZ A;  3PCO B;  3MXN B;  4HN7 A;  4XTC S;  3SK4 A;  2L15 A;  4A3K B;  2WAC A;  1H9M A;  1YBY A;  3HOZ H;  3EN2 A;  4KI0 A;  1A8V A;  4X65 L;  4A3F H;  4ME5 A;  1QZG A;  1MBY A;  4ZAI A;  2K5D A;  4DV0 L;  2JA8 G;  1KAW A;  2EVB A;  2BA0 A;  2XTI A;  3K5M A;  3QR8 A;  1EYD A;  1Z7T A;  4KJO A;  1IKM A;  1G2S A;  5IIF A;  3H3V I;  1SE8 A;  2EJG C;  2XGT A;  1GUW A;  1L1O A;  2DJG C;  3NK9 A;  3MC0 B;  4X62 L;  3J80 L;  4DA2 A;  2MUY A;  3I4N H;  5EPL A;  1E1O A;  2EYP A;  1IBM L;  1U5K A;  2A68 D;  4DR1 L;  4PV1 C;  1TII D;  3GTM H;  4L5T A;  3RZO B;  1VQM A;  2F0W A;  2JP1 A;  2F0M A;  5LMN L;  5HGT A;  1N33 Q;  4OO1 I;  1GHK A;  1PZJ D;  1SEB D;  3VA5 A;  3F2B A;  4C1N K;  1KAA A;  2M9V A;  5FK9 C;  2CVR A;  1TR5 A;  1WCM G;  1U4M A;  2Z6K C;  2EQS A;  3LNN A;  4P2C B;  3K59 A;  3T1H L;  4MTN A;  1B1Z A;  5CV8 A;  3JAM c;  4EQP A;  1CUK A;  4DV1 Q;  3WDN A;  5FO8 B;  4JI0 Q;  1VQ4 A;  1BVS A;  1LYL A;  4A3G H;  1EIH A;  5FJ8 G;  2PW5 A;  4L5Q A;  4B3M Q;  4IUR A;  1OO9 B;  3BJU A;  1VF5 C;  1JB3 A;  2JEB I;  1TS2 A;  1RDP D;  1RF2 D;  2LKV A;  1Q82 C;  2NTS A;  3AQQ A;  1N36 L;  3S14 H;  2Q2T A;  4H02 A;  1KNA A;  3F1Z A;  1TWH H;  1LTL A;  3BVM A;  1NMG A;  3GDE A;  4R4T A;  2VL6 A;  2RA4 A;  3GD7 A;  1HTP A;  3C1E A;  3K0Y A;  1MJE A;  5BR8 L;  3H0G G;  4YCV A;  1G8Z D;  4LFC Q;  5DLQ E;  2VQF L;  4DAY B;  2ATW A;  4A3E B;  4L5S A;  5EKK A;  1G6P A;  4HTH A;  4JOI A;  3GTJ H;  2OTL A;  4X3U A;  1JOR A;  2K5Q A;  1LO5 D;  3GP7 A;  4QF4 A;  1EL0 A;  5ELN A;  1FR3 A;  2R3Z A;  1KDC A;  4KLK A;  2WP8 J;  3PUX A;  3I4M B;  1GUN A;  3CAM A;  4KY5 A;  1U4L A;  4OX9 Q;  3RN2 A;  1AEX A;  1FNW A;  4R9W A;  2UXD L;  3CCR A;  5ELC A;  2BE5 D;  4A3I B;  3IRB A;  5CGK A;  5CBE E;  3KLS A;  3CRL C;  1VQG A;  1RIP A;  1YVC A;  4A3J G;  4F87 A;  5KIX A;  4A3C G;  4EX5 A;  1K83 H;  2F3I A;  3HG9 A;  1LTB D;  3IFD A;  1E2V A;  5IWA Q;  1HA6 A;  3KJP A;  1HNW Q;  1STY A;  5DEH A;  3HOY H;  4LF5 Q;  1VF7 A;  2IPK D;  4OON A;  1PH9 A;  3VA7 A;  3S1N H;  1Q12 A;  2NVT H;  4DV6 Q;  3S17 B;  4BBR B;  2UUC Q;  4CJ0 B;  1GUT A;  3UDX A;  3P20 A;  3H3V H;  3FPU B;  5ISR A;  2I07 B;  4A93 G;  2F0O A;  3MXG A;  2EYH A;  2QCP X;  2JA5 B;  4RCN A;  2XIW A;  4CHT B;  4IPH A;  4CBV A;  5C3W A;  1WTW A;  5DAU A;  1BUV T;  2NVX B;  5IYD G;  1I50 B;  2HHH L;  3OIQ A;  4RH6 A;  1K8O A;  1DM0 B;  3FEW X;  1VQB A;  1B9N A;  1CT1 D;  4DU9 A;  3CCV A;  5M5W H;  4BXX G;  2Z6B A;  4OO1 H;  2WKC A;  1L1O C;  4DR5 L;  3E5S A;  3GTL H;  3S2D H;  5C4Z A;  4QQB X;  2JEA I;  3PO3 H;  2N88 A;  4PZ7 A;  1S5B D;  1XNQ Q;  3NPP A;  1CSP A;  2R6G A;  2RDF A;  3K57 A;  3CC4 A;  4J8Q A;  2E5L Q;  3A54 A;  4RWS C;  1E24 A;  2NUC A;  4NXN Q;  3S24 A;  4HSP A;  2CQO A;  1YNJ C;  5EGT A;  3BG3 A;  3OOC A;  1ASY A;  5JVG 3;  1A62 A;  3HKZ B;  1T5X D;  3EIV A;  3NBH B;  5C44 B;  1I94 L;  1IW7 C;  1EFW A;  3PO2 H;  3G4S A;  4JCV E;  2L4N A;  4FF2 A;  3DLL A;  1NNX A;  5M3F H;  4DV3 Q;  2IX1 A;  1KIX A;  2NVQ H;  2K5N A;  5JVH 3;  1I6V C;  2AQ3 B;  2A69 D;  4UAI A;  3E6Z X;  5I9P A;  2L1B A;  2D62 A;  2K75 A;  2UUB Q;  2ES2 A;  2A6H C;  1G6Z A;  3L9A X;  3MA2 B;  1Y1W H;  3T4A C;  4I7Z C;  2QEX A;  2VUM G;  4A4I A;  1LAB A;  3VYT A;  2J4X A;  1KC8 C;  4XQN A;  4PZ8 A;  2JA7 G;  4K5V A;  1B70 B;  1DOK A;  2EPB A;  2B2Y A;  4C3H H;  1NMF A;  3BDO A;  1D5M C;  1H9S A;  2E75 C;  4ULL A;  1R9T H;  5JPN C;  1ESR A;  4A3F B;  1BDO A;  3ULJ A;  1PFM A;  4DK3 C;  5FKA C;  4Q0F A;  3P1H A;  3ZYY X;  2Z4H A;  2EYO A;  3MFY A;  2KEC A;  4DF7 A;  3MTS A;  1XMQ L;  2EJF C;  3DEP A;  5TSS A;  3I4N B;  5CV5 A;  4APV A;  3J7A V;  1J5E L;  4JI7 Q;  1PTO C;  1S4Z A;  2KVM A;  2WAQ B;  2HDM A;  2IY5 B;  3T1Y L;  5IP9 G;  3LWE A;  3GTM B;  1EEI D;  4POG A;  2K50 A;  3X3M A;  4GKJ L;  4CGY B;  4RA8 A;  3KLR A;  1W6K A;  3SK8 A;  4EGV A;  5AJ3 Q;  4QCL A;  2EIF A;  2F0H A;  4ILW A;  2OF1 A;  2K33 A;  1O7Z A;  4OWX B;  3MEH A;  2CCZ A;  2HCI A;  4QMG A;  1YZ6 A;  1SBB B;  4X65 Q;  5IOC A;  1RCV D;  1AP0 A;  4DAY A;  1EWH A;  2IX3 A;  4FF3 A;  4DR3 L;  1TU2 B;  1HRJ A;  3M4Q A;  1A2U A;  3GTG H;  3KJO A;  4FXD A;  3A55 A;  2E2D C;  3VYU A;  1O7I A;  4A3G B;  2XNA C;  1EQR A;  1D6E C;  4IUP A;  2UUA Q;  5E7N A;  4HJA A;  2YTV A;  3PUV A;  2A6E D;  3J81 i;  4JI3 L;  3IFT A;  4FP5 D;  5GQO A;  3PIO A;  4DR1 Q;  5COR A;  3I72 A;  1JC7 A;  1FL0 A;  2N49 A;  5IY0 A;  3S14 B;  5K36 H;  4DXF A;  1TWH B;  2PYK A;  5E4W C;  4A3K H;  3CCS A;  1SYC A;  3URY A;  3I4M G;  2UU9 L;  4DV2 Q;  4NB3 A;  1WJJ A;  5HUR A;  1UWV A;  1KQS A;  3FMC A;  3DEO A;  3VDY A;  4N8X 1;  1PYB A;  3W3A A;  3I7F A;  1DYQ A;  3BYY B;  4GLA C;  2CH4 A;  4HR7 B;  2D5D A;  4NW2 A;  4IOA A;  3GTJ B;  4HID A;  1B3Q A;  4KHV A;  2RHS B;  3QB3 A;  4JK1 C;  5IYC H;  1KLU D;  4NXM Q;  1BF4 A;  4JI1 L;  1MIU A;  3NE5 B;  2B2W C;  3OYY A;  1Z47 A;  2Q8I B;  4LW1 A;  1IYJ B;  3ULL A;  5IP7 G;  4JYA Q;  2L11 A;  1OTC A;  1N36 Q;  5COY A;  1OXV A;  3J80 i;  3OTO Q;  3R2I A;  2X69 A;  1Q8I A;  2YTX A;  2EYL A;  4JI6 Q;  5BR8 Q;  5G3L F;  4UDU C;  1DD2 A;  1IHZ A;  2A73 B;  5DM7 3;  1PZK D;  4IPG A;  5A2Q E;  2F0V A;  1LV9 A;  2VQF Q;  3HOY B;  2F0U A;  1SE3 A;  3Q8D A;  2KCC A;  3TS0 A;  3S1N B;  1G91 A;  3S1Q H;  1F9P A;  4JPB W;  1NY4 A;  2NVT B;  4KKT A;  5JJZ A;  1EQQ A;  1S5D D;  1JB7 A;  4I7A A;  4F88 A;  4L5R C;  4WRD A;  2WKD A;  5I6W A;  1H9J A;  1ET6 A;  3HEJ A;  3NBH A;  2PNR C;  2FMM A;  4LF4 L;  4B3R Q;  4UPA A;  3TEH B;  1PH6 A;  1Q7Y C;  5IGG A;  2QF7 A;  2UXD Q;  3BZD B;  3A0J A;  3D4R A;  2JYO A;  2R93 H;  2M00 A;  1SYD A;  1SAP A;  4ID6 A;  1EWI A;  5FLM H;  2N8N A;  2EYJ A;  3T56 B;  3FKI H;  4YWM A;  1HXY D;  4HED A;  5C44 G;  4X3T A;  1FNU A;  4PG3 A;  1LTA D;  1O78 A;  1NR2 A;  2ZT9 C;  5M5W B;  3PGZ A;  3ERQ A;  3HKZ E;  1B4O A;  1D1I A;  1T9H A;  1B2T A;  4LF9 L;  3GTL B;  3S2D B;  3ZJY C;  1XPR A;  2C5C A;  1K73 C;  1DXM A;  3PO3 B;  2SNS A;  4DXG A;  4BWG B;  2L9H A;  4DFA A;  4K8I A;  3BVG A;  2Q2I A;  1KL9 A;  1VQE A;  3S16 H;  2AMC B;  1X6O A;  2ENB A;  4RGT A;  3HOW B;  3HOZ G;  3UE0 A;  5M3F B;  2NVQ B;  4Z9C B;  3JC6 6;  5C3E B;  4A3F G;  3DUZ A;  1Y8N B;  1L0W A;  2IHF A;  4O2D A;  2LXK A;  1I4Q A;  3AB9 A;  4FXG C;  2BH2 A;  1EU4 A;  4BA1 I;  4BY1 H;  2LY7 A;  3I4L A;  4B3S Q;  4MZ9 A;  4XYQ A;  4ZKB B;  1Y1W B;  1PRT F;  3WWV A;  1P16 A;  3AYH B;  4C3J G;  4IJL A;  3VR3 A;  2K4K A;  4U68 A;  1ML0 D;  1G2T A;  1H9R A;  4J1M A;  1YJ9 A;  1WTR A;  2BDN A;  3MEF A;  4FVM A;  5JAV A;  2KOL A;  4HJ5 A;  5ELE A;  2TMP A;  4C3H B;  4YCU A;  3S17 H;  4P72 A;  1GUS A;  4V0B A;  1SYB A;  1R9T B;  4R4I A;  2KA7 A;  2AQ2 B;  2M2L A;  1CI3 M;  2EZV A;  1CZW A;  4LFB Q;  4DV7 L;  1X3Q A;  2MQH A;  2WAQ E;  4GNX A;  1K28 A;  1I94 Q;  3TBI B;  1BR9 A;  2Z4I A;  1ENA A;  3E9H A;  3QOJ A;  4K6L A;  4X66 Q;  1X3E A;  1TKW B;  3J81 E;  5LMU L;  3MHB A;  2D0O A;  1SYF A;  2NVX H;  4X3K A;  4RGN A;  2B8G A;  4K0K L;  1E0B A;  3M9B A;  4S3S A;  1TS5 A;  1PVO A;  3UDG A;  5KYL A;  4A3G G;  5EKL A;  4DAV A;  1TXY A;  4QIW B;  3S2H H;  2E2H B;  2EXD A;  1RJT A;  4DR6 L;  1CKO A;  2IHE A;  3W5O A;  3F2D A;  1NR4 A;  3QJY A;  4LUV A;  2NN6 G;  3V05 A;  4QJF A;  1BQQ T;  4PMW A;  1XTD A;  2K5H A;  3N52 A;  3K5N A;  4KKU A;  1ROD A;  4R4C A;  4KD4 A;  1U4P A;  2D0P A;  3GTG B;  1Q3L A;  1X56 A;  3PQI A;  4DR4 L;  1CK1 A;  1SYE A;  1Q46 A;  3BZK A;  4E6I A;  2UXC L;  3M4O H;  5KNB A;  1S3O A;  4R1J A;  2SDF A;  2Q8R E;  1I4H A;  4YY3 L;  1J5E Q;  1JWS D;  4KHZ A;  4IUN A;  4BBS H;  3J80 E;  1V9P A;  2A68 C;  2F0E A;  3T1Y Q;  5M5X H;  1K3B C;  2IT1 A;  3ULP A;  4LMQ D;  5CV4 A;  5ELF A;  4JI2 L;  2XVS A;  4A76 A;  1STN A;  1WTQ A;  2ZJR A;  4DR7 Q;  5EJW A;  2OT2 A;  4PZ6 A;  1F9Q A;  1KDB A;  2BOS A;  4PNY A;  4JI4 Q;  3D0F A;  3T53 B;  1CFM A;  4GOP A;  1B50 A;  2B2V C;  1AZQ A;  4KJN A;  4JBK A;  4DR3 Q;  3L0O A;  2NTT A;  3P7J A;  4K5W A;  2K03 A;  1B8A A;  4LJZ C;  1PH1 A;  5IOD A;  3H91 A;  3OW7 A;  1M1K C;  1U0L A;  1Y1V H;  3BDL A;  4RGO S;  4CKC A;  1HUM A;  4DNR B;  4JI3 Q;  4DKA C;  1MKH A;  3TZU A;  3NTH A;  3ERS X;  2RCF A;  3I2Z A;  3A8I E;  1AZP A;  2NZO A;  2OTJ A;  5GRO A;  2A5H A;  1Q1E A;  3K8A A;  2MJ8 A;  1SJH D;  3GTK H;  2D9U A;  3S1M H;  3T16 A;  1E1T A;  3KBG A;  2UU9 Q;  1H9S B;  2B2T A;  4C3I H;  3K5L A;  3J7Z C;  2Z8L A;  1HTL D;  2D2C C;  1QVC A;  1KTK A;  2OCE A;  4IUU A;  2ZXO A;  1D5X C;  2PW7 A;  2FFK B;  4TQU S;  3S1Q B;  4IFD I;  1FJG L;  3HOV G;  3RUZ A;  2PMZ E;  2FMC A;  1Y14 B;  3PO3 G;  4AYB B;  1IBK Q;  1PA6 A;  1Q1B A;  5NUC A;  2ZXP A;  2R93 B;  3TSS A;  4Y52 H;  4LF7 Q;  2BE5 C;  4EQN A;  1PH5 A;  3BU2 A;  3W2D A;  5JPM C;  4QY7 A;  2ICI A;  3FKI B;  4RCO A;  1XNR Q;  2K05 A;  4AQY L;  4PQX A;  4O42 A;  4TSS A;  1YNN D;  3FVQ A;  3PO2 G;  4ZQ3 A;  3I3C A;  4KK7 A;  5T1G A;  2QW7 A;  1H95 A;  3NEM A;  5M3F G;  2IW3 A;  1Z9F A;  2HD3 A;  4LFA Q;  3C46 A;  5C0X I;  2JK8 A;  2RSN A;  2G9D A;  3CPF A;  2SEB D;  4A3M H;  2NZH A;  4KN7 C;  1EY5 A;  1Y1W G;  2F0N A;  2Q2H A;  3A5U A;  2F0G A;  1A3T A;  4IJH A;  2VQE Q;  4J15 A;  4Y7N H;  3S16 B;  1Q86 C;  3G6E A;  4RKL A;  4DUZ Q;  4LF4 Q;  1A63 A;  3WOF A;  3STB C;  3AMU A;  4LF6 L;  1Y8O B;  3M85 A;  3BDC A;  1W3S A;  2DY7 A;  4DPG A;  4HIO A;  2R7Z G;  1PZI D;  2EJM A;  3PIP A;  4JI5 Q;  1RTN A;  2KQ3 A;  4BY1 B;  1EOT A;  2SNM A;  4ZLT F;  1CA5 A;  3JAM i;  1XX8 A;  2K1B A;  2KCT A;  3J81 j;  1S40 A;  3NEN A;  1CQF A;  4HIM A;  1YHB A;  5FLX E;  2VW9 A;  2XRQ D;  2E2I H;  1KRS A;  2CQA A;  1VQF A;  4XQQ A;  4CKE A;  4LUO A;  5I2Y A;  3HZX A;  5DM6 3;  1RD9 D;  2F0K A;  2J7Z A;  3Q6S A;  2H5X A;  3OW2 A;  1F2Y A;  1GO3 E;  2CWP A;  4ZRZ A;  1HR0 Q;  3C2P A;  1Z6H A;  3A56 A;  3PF5 A;  5EQ0 A;  4NKL A;  5IYB G;  3PMF A;  3UE1 A;  1NCV A;  1F9R A;  2RKS A;  4RG1 A;  3CCQ A;  1BBX C;  2VB3 X;  5GAE C;  3STB D;  4YWK A;  1X32 A;  4QIW E;  5LL6 X;  1QNK A;  2A69 C;  4RHS A;  4YHH Q;  2YU9 H;  1ET9 A;  4EQ5 A;  4JI8 L;  4RKB A;  4C2M H;  1C4Q A;  2UXB L;  4BY7 G;  3F8T A;  3FRP B;  1PXU A;  3I4O A;  1PRT D;  3S2H B;  3HOX G;  1I6H H;  1EU3 A;  5C4X H;  4DV4 L;  4HAE A;  3TP8 A;  2I0Q A;  2RHQ B;  3U58 A;  3J7Y W;  3H3V C;  1EFI D;  2K6A A;  1MHW C;  5IT9 E;  2JA6 H;  4G4K A;  4MN3 A;  5JEA H;  1GOZ A;  3MVV A;  3M7G A;  3W1G A;  4LNQ A;  2ICE C;  4A3K G;  4IO9 A;  2K52 A;  1XMO L;  5FJ8 H;  3KYH C;  1TY2 A;  3HOW H;  4IFD H;  1LTR D;  3PIP 3;  2ZM6 Q;  3HOU H;  5C4H A;  5C3E H;  2XSC A;  3PSI A;  1IXR A;  3M4O B;  5LMU Q;  5ELO A;  2DGY A;  2F52 A;  2CH4 W;  2N78 A;  2EY1 A;  4QUF A;  1EOV A;  2BA1 A;  2WB1 E;  1QIL A;  5J22 A;  4K0K Q;  1SNC A;  4K14 A;  4FF4 A;  1PFB A;  1STE A;  4BBS B;  2A1A A;  1YIT A;  5M5X B;  5KGU A;  3H0G H;  1JJC B;  1LTS D;  1STA A;  3PV0 A;  3DXJ C;  1JR0 D;  3U9S A;  1TT2 A;  4ZCK A;  3CME A;  4NPS A;  1YJN A;  1Q81 C;  1KDA A;  1NJI C;  1TWG H;  1HNZ L;  1I4P A;  4KMU C;  1SE2 A;  4CDC C;  4CDD C;  5C0X H;  3FP9 A;  1BKB A;  1V1P A;  4JV5 L;  3HKS A;  3K7U C;  3ERO A;  2I5L X;  1HQR D;  1EIG A;  2BDO A;  3D4D A;  1UAP A;  1MD2 D;  2CW0 D;  2PPB C;  1ZEQ X;  2A19 A;  2YYZ A;  4B3T Q;  2CHB D;  3HGB A;  2FHT A;  3K80 C;  1VQD A;  1SMY D;  1Y1V B;  2MNA A;  2A6E C;  1Q8K A;  3BS1 A;  4KY7 A;  4LF8 L;  1SRU A;  3G71 A;  2G9H D;  4A3J H;  2B63 B;  2RF4 A;  1JOQ A;  4JOI C;  1PFN A;  1J9O A;  2I46 A;  2E2H H;  2WII B;  3TRZ A;  1M90 C;  4A3B H;  2G5D A;  5GAD C;  3GTK B;  3S1M B;  2L0C A;  4C3I B;  3RR5 A;  5JEA J;  2R93 G;  2RSO A;  2GA4 B;  4DV0 Q;  2E8G A;  4NDX A;  1EYA A;  5EBD A;  4IFD J;  2MGS A; 
#chains in the Genus database with same CATH homology
 5FLM G;  1KXL A;  1K73 C;  4AYB E;  4KI0 A;  4GNX B;  4A3B G;  1A8V A;  1D7Q A;  3RN5 A;  3B6Y A;  4X65 L;  3I56 A;  4A3F H;  1OXT A;  3PUW A;  1QZG A;  4DV0 L;  2JA8 G;  4GKK L;  4TVA B;  5M3M H;  1QVG A;  2Q2I A;  1KAW A;  2IX0 A;  2BA0 A;  2XTI A;  3K7A H;  4A93 H;  1KL9 A;  1AE3 A;  4X62 Q;  1VQK A;  4R4Q A;  1VQE A;  1JMC A;  4QGU A;  4A3E G;  3S16 H;  2AMC B;  1SLJ A;  3H3V I;  1X6O A;  3TS2 A;  1IBM Q;  1SE8 A;  1IBL L;  3HOZ G;  4GOP C;  2XGT A;  3UE0 A;  1L1O A;  4QL5 A;  3W1B A;  2N3S A;  1EIF A;  4X62 L;  2GVB A;  5IYD H;  1OXS C;  3JC6 6;  5H1S E;  4A3F G;  4LWC A;  1L0W A;  1NTG A;  3I4N H;  2IHF A;  4O2D A;  2LXK A;  2BH2 A;  5M3M G;  1E1O A;  2MO0 A;  1IBM L;  2K14 A;  1U5K A;  4OWT B;  3GTQ H;  4BA1 I;  4BY1 H;  1CKM A;  3ICE A;  1WCM H;  5LMN Q;  4B3S Q;  1TWF H;  3PUZ A;  5GAH C;  4MZ9 A;  4DR1 L;  5C0X J;  4AIM A;  3GTM H;  3CCM A;  4L5T A;  3WWV A;  1P16 A;  1VQM A;  2PI2 A;  3AYH B;  4A3I G;  1PFS A;  4IJL A;  5LMN L;  4B3S L;  1N33 Q;  2K4K A;  4OO1 I;  2KHI A;  3L7Z C;  5K36 G;  1YJ9 A;  2C35 B;  3F2B A;  3T1H Q;  3MEF A;  4DV7 Q;  2I5H A;  4BY1 G;  4HJ5 A;  3HOV H;  4YCU A;  3I55 A;  3S17 H;  4P72 A;  1WCM G;  3K0X A;  3CC7 A;  1GD7 A;  4R4I A;  2Z6K C;  2EQS A;  1CSQ A;  2QA4 A;  1YHA A;  4LFB Q;  4WJ3 M;  3T1H L;  4MTN A;  1GVP A;  1FJG Q;  4DV7 L;  2WB1 G;  4ALP A;  3JAM c;  2GN5 A;  2MQH A;  2WAQ E;  4GNX A;  3AEV A;  3AFP A;  1CUK A;  4DV1 Q;  1G29 1;  4JI0 Q;  1VQ4 A;  1YI2 A;  1I94 Q;  1HZC A;  2PI2 E;  3CC2 A;  3AFQ A;  1BVS A;  1LYL A;  3KOJ A;  4A3G H;  4LFB L;  3E9H A;  3TRE A;  5FJ8 G;  4L5Q A;  4B3M Q;  3CQZ H;  4X66 Q;  4DUY L;  1X3E A;  4BBR G;  3CCL A;  5IYC G;  4DV1 L;  4JI0 L;  3BJU A;  5LMU L;  1SRO A;  2D0O A;  2NVX H;  5J3B A;  2JEB I;  1YNX A;  4K0K L;  1Q82 C;  4B3M L;  4X66 L;  4DR6 Q;  3M3Y H;  3AQQ A;  3M9B A;  4AQY Q;  1N36 L;  3S14 H;  1QUQ B;  1HH2 P;  4H02 A;  2OQ0 A;  3UDG A;  2Q2T A;  1PVO A;  3CCE A;  4A3G G;  3F1Z A;  1TWH H;  1P8L A;  1TXY A;  1LTL A;  1IL2 A;  3GDE A;  1NMG A;  4R4T A;  1I3Q H;  2EXD A;  2JA5 G;  3RLO A;  3S2H H;  4GOP B;  2VL6 A;  1K9M C;  1JJ2 A;  3GD7 A;  4DR6 L;  1CKO A;  4X64 Q;  1MJC A;  4X6A H;  3M7N A;  1MJE A;  5BR8 L;  2LSS A;  2IHE A;  3H0G G;  4YCV A;  3W5O A;  3F2D A;  4LUV A;  3U4Z A;  4AH6 A;  3CCU A;  2NN6 G;  4QJF A;  4LFC Q;  5JJL A;  3BZC A;  5DLQ E;  1VQH A;  2VQF L;  4DAY B;  4DR4 Q;  3J81 c;  2ATW A;  4PMW A;  1HR0 W;  1XTD A;  2K5H A;  4JBJ A;  4L5S A;  4A3D H;  1G6P A;  2UXC Q;  4JOI A;  3GTJ H;  2OTL A;  4R4C A;  3KLW A;  2D0P A;  4DR4 L;  1X56 A;  2R7Z H;  5ELN A;  2VNU D;  4YY3 Q;  4JG2 A;  1BBW A;  3GTP H;  1Q46 A;  4LF6 Q;  1VCI A;  3BZK A;  1HNX L;  2HT1 A;  2UXC L;  4KLK A;  3K81 C;  2WP8 J;  3PUX A;  3M4O H;  4A3C H;  1TWA H;  3PF4 A;  5JJI A;  1S3O A;  3CAM A;  4R1J A;  4OX9 Q;  2KBN A;  4HJ7 A;  3RN2 A;  4YY3 L;  2AWN A;  4JI2 Q;  4A3D G;  3HKZ G;  1J5E Q;  1N32 L;  2UXD L;  2HQL A;  4GS3 A;  4KHZ A;  3CCR A;  3CP0 A;  1NBW A;  3KDF B;  1PHJ A;  1C7Y A;  4BBS H;  1JT8 A;  1K8A C;  1V9P A;  3IRB A;  3T1Y Q;  5M5X H;  4AYB G;  2V1C C;  4OX9 L;  2IT1 A;  3ULP A;  4DV5 L;  1VQG A;  1RIP A;  1YVC A;  4YCW A;  4A3J G;  1N34 L;  1VQ8 A;  4JI2 L;  2ASB A;  1D8L A;  2HIV A;  4A76 A;  1W2B A;  2B29 A;  2VS1 A;  4A3C G;  4EX5 A;  4RMF A;  2ZJR A;  1WI5 A;  2VY3 A;  4DR7 Q;  1K83 H;  2F3I A;  4PZ6 A;  3FKI G;  2CKZ B;  3CPW A;  5IWA Q;  5IYB H;  1PH2 A;  3KF8 B;  4JI4 Q;  3D0F A;  4BBS G;  3KJP A;  1HNW Q;  1UE6 A;  4DR7 L;  4UP9 A;  3HOY H;  4GOP A;  4LF5 Q;  1PH9 A;  4OON A;  1AH9 A;  3S1N H;  1DGS A;  1Q12 A;  4JBK A;  4DR3 Q;  2NVT H;  3L0O A;  4DV6 Q;  4JI4 L;  3J80 c;  4LF5 L;  2UUC Q;  1N9W A;  2JA9 A;  3UDX A;  1B8A A;  2A8V A;  1PH1 A;  3H3V H;  4DV6 L;  2PNH A;  4HJ8 A;  1QZH A;  1M1K C;  1U0L A;  1Y1V H;  2B3G A;  2PQA B;  3L2P A;  2UUC L;  4BY7 H;  4A93 G;  1VQN A;  4JI8 Q;  4BXX H;  3M4P A;  2HHH Q;  4JI3 Q;  4DKA C;  2F4V Q;  1MKH A;  4A3L H;  3ERS X;  3HOX H;  1PH3 A;  3I2Z A;  4IPH A;  1JE5 A;  2NZO A;  2OTJ A;  5GRO A;  1S40 A;  5IYD G;  2HHH L;  2ZJP A;  1OXX K;  1Q1E A;  3K8A A;  4R4O A;  4DR5 Q;  3GTK H;  3S1M H;  3I4N G;  2Z6K A;  1VQB A;  1E1T A;  4DV4 Q;  2UU9 Q;  3U4V A;  4C3I H;  2NVY H;  3CCV A;  3RLF A;  3J7Z C;  5M5W H;  4BXX G;  2LXJ A;  1YIJ A;  3EBE A;  2WAQ G;  4O0A A;  4A3L G;  1L1O C;  1XPU A;  1QVC A;  4DR5 L;  1N33 L;  2OCE A;  1YJW A;  3GTL H;  3S2D H;  4QQB X;  1CKN A;  2JEA I;  2KHJ A;  3PO3 H;  4PZ7 A;  4P71 A;  1XNQ Q;  1X3G A;  1CSP A;  4OXP A;  2R6G A;  4TQU S;  3CC4 A;  2E5L Q;  1VQC A;  1E24 A;  3U50 C;  4NXN Q;  3S24 A;  1FJG L;  4IFD I;  3HOV G;  2CQO A;  1XNQ L;  1ASY A;  1OXU A;  1A62 A;  2KEN A;  1BBU A;  2PMZ E;  3NBH B;  3EIV A;  5C4J H;  1HZ9 A;  1I94 L;  2ZTD A;  1EFW A;  3PO2 H;  3G4S A;  4JCV E;  4NXN L;  3KF6 B;  2VUM H;  3DLL A;  5M3F H;  4DV3 Q;  1Y14 B;  2IX1 A;  1KIX A;  2NVQ H;  3PO3 G;  2K5N A;  1B7Y B;  1IBK Q;  1PA6 A;  2ID0 A;  1Q1B A;  2JA7 H;  4Y52 H;  4LF7 Q;  2D62 A;  2K75 A;  2UUB Q;  4GN3 B;  2ES2 A;  3TQY A;  1SFO H;  1PH5 A;  3BU2 A;  1C0A A;  4QY7 A;  4HIK A;  1XNR Q;  1IBK L;  2AWO A;  4A75 A;  5IE8 A;  4AQY L;  1Y1W H;  4LF7 L;  2NN6 I;  3RZO H;  3PO2 G;  2QEX A;  2VUM G;  4A4I A;  1A0I A;  1H95 A;  4XIG S;  3NEM A;  5M3F G;  4UP8 A;  1KC8 C;  1PH8 A;  4PZ8 A;  1XNR L;  1Z9F A;  2JA7 G;  1WOC A;  1B70 B;  3E9I A;  4LFA Q;  4X64 L;  1YEZ A;  5C0X I;  4DNI A;  2JK8 A;  4ME3 A;  3UDF A;  1X65 A;  3CPF A;  4C3H H;  1NMF A;  1VQ7 A;  1VS0 A;  1LUZ A;  5JJK A;  2YV5 A;  4LFC L;  3F2C A;  1R9T H;  4A3M H;  4LFA L;  2NZH A;  1Y1W G;  3ULJ A;  4DK3 C;  2Q2H A;  2FXQ A;  3A5U A;  4IJH A;  1HZA A;  2VQE Q;  2OWO A;  1E7Z A;  1XMQ Q;  4J15 A;  3GO5 A;  4P73 A;  1VQO A;  4Y7N H;  4DK6 C;  1Q86 C;  5IP9 H;  3G6E A;  4IOC A;  4DUZ Q;  4LF4 Q;  1L1O B;  1XJV A;  1L2F A;  2Y0S E;  4LUZ A;  1A63 A;  3A5Z B;  3STB C;  4LF6 L;  3M85 A;  1W3S A;  2VQE L;  1KRT A;  1X9N A;  1HZB A;  1XMQ L;  1K0R A;  4JBM A;  4DPG A;  4HIO A;  2R7Z G;  4BA2 I;  1JJG A;  3PIP A;  4JI5 Q;  4DUZ L;  4APV A;  5GAG C;  2Z0S A;  5M5Y H;  1J5E L;  4GKJ Q;  4KHP Q;  3RNU A;  4JI7 Q;  2DUD A;  4DAM A;  2YTY A;  1EYG A;  3JAM i;  3CF5 A;  2IY5 B;  3T1Y L;  1X55 A;  1X54 A;  2KCT A;  5IP9 G;  3J81 j;  3NEN A;  5EAY A;  4JI5 L;  1V43 A;  5LMN W;  1QUQ A;  1YHB A;  4HIM A;  1LM0 A;  1S72 A;  2VW9 A;  4POG A;  2K50 A;  2E2I H;  1C9O A;  1KRS A;  4GKJ L;  1VQF A;  2R92 H;  3KFU A;  1N8R C;  1UE1 A;  4LUO A;  5AJ3 Q;  2EIF A;  4DR2 Q;  3RLN A;  2H5X A;  4OWX B;  1VQP A;  1PYS B;  5IWA L;  3OW2 A;  1PH4 A;  1VQ5 A;  2CCZ A;  1GO3 E;  2CWP A;  1HR0 Q;  4GN4 B;  1YZ6 A;  4X65 Q;  1HNW L;  1IZ6 A;  4IPC A;  1I5F A;  5AJ3 L;  4A3E H;  3CXC A;  1PH7 A;  4GKK Q;  3PF5 A;  5IYB G;  3UE1 A;  4DR3 L;  1PV4 A;  1HR0 L;  2R92 G;  3GTO H;  3M4Q A;  4OWW B;  3HOY G;  4RG1 A;  3KJO A;  3GTG H;  3CCQ A;  1AE2 A;  5GAE C;  3STB D;  4YWK A;  1SN8 A;  1IBL Q;  1O7I A;  4QIW E;  1EQR A;  5FLX c;  2B63 H;  2MFI A;  3H15 A;  2ALY B;  2UXB Q;  2UUA Q;  3I4M H;  3ER0 A;  1KD1 C;  5E7N A;  4HJA A;  2YTV A;  4YHH Q;  2YU9 H;  3PUV A;  4EQ5 A;  3FHW A;  4JI8 L;  3J81 i;  3PUY A;  4JI3 L;  2F4V L;  4JC0 A;  4A3I H;  4C2M H;  4C3J H;  3KDF A;  1TWC H;  5GQO A;  3NEL A;  3PIO A;  1Y1V G;  4DR1 Q;  2UUA L;  4BY7 G;  2UXB L;  1FL0 A;  2N49 A;  2OQK A;  3F8T A;  5IY0 A;  4YHH L;  4P74 A;  2WFW A;  3I4O A;  4A3K H;  2B63 G;  2ZTE A;  3CCS A;  3HOX G;  1I6H H;  5C4X H;  4DV4 L;  4GLX A;  1KHI A;  2UU9 L;  3I4M G;  4DV2 Q;  4NB3 A;  2I0Q A;  1WJJ A;  2R7F A;  2JJQ A;  2RHQ B;  3U58 A;  1J6Q A;  1UWV A;  4P75 A;  1KQS A;  3A74 A;  3VDY A;  1XMO Q;  3S15 H;  1PYB A;  2E2J H;  3I7F A;  4DV2 L;  2JA6 H;  4UY8 C;  4GLA C;  1EIY B;  3W1G A;  4LNQ A;  4OO1 G;  3UDI A;  1V1Q A;  4JI1 Q;  4A3K G;  4IO9 A;  2K52 A;  4JBW A;  1XMO L;  1UEB A;  5FJ8 H;  2E5L L;  4IOA A;  5IP7 H;  3KYH C;  3HOW H;  2JQO A;  1WFQ A;  3HFZ B;  4HID A;  5C4X G;  4BBR H;  2KCM A;  2RHS B;  5IYC H;  2Q2U A;  2ZM6 Q;  2GVA A;  4NXM Q;  2QGQ A;  3HOU H;  2MO1 A;  5C3E H;  1GM5 A;  1FVI A;  1VQA A;  4JI1 L;  1MIU A;  4DUY Q;  4DV3 L;  4GLV B;  3PSI A;  1IXR A;  1VQ9 A;  3OYY A;  2JA6 G;  1Z47 A;  5JEA G;  5ELO A;  5LMU Q;  2DGY A;  1EUJ A;  1K3R A;  2I5M X;  4GN5 A;  4LW1 A;  2F52 A;  2ZM6 L;  2N78 A;  1IYJ B;  2PQA A;  4NXM L;  1EOV A;  2BA1 A;  2WB1 E;  4FDB A;  3ULL A;  4K0K Q;  4IPD A;  5IP7 G;  2JA5 H;  3HOW G;  4IFD G;  3SGI A;  4GNX C;  1RL2 A;  1UE7 A;  3G48 A;  5IT9 c;  1OTC A;  3D31 A;  2CFM A;  2A1A A;  3S1R H;  1N36 Q;  2UUB L;  1OXV A;  1YIT A;  3J80 i;  1E22 A;  3HOU G;  3H0G H;  1JJC B;  1I50 H;  3PV0 A;  5C3E G;  3OTO Q;  1HNZ Q;  2AHO B;  1VQ6 A;  3CW2 C;  4MNO A;  1YHQ A;  3DM3 A;  4WJ4 A;  1SR3 A;  3CME A;  4JYA L;  2YTX A;  2R7D A;  3LGJ A;  4NPS A;  4JV5 Q;  2AKW B;  1HJP A;  4JI6 Q;  1G51 A;  5BR8 Q;  2ZTC A;  1YJN A;  1Q81 C;  4HJ9 A;  1NJI C;  1TWG H;  3OTO L;  1HNZ L;  4IPG A;  3FP9 A;  1BKB A;  1ASZ A;  2VQF Q;  4JV5 L;  1VQJ A;  2Y0S G;  3RZD H;  4JI6 L;  1FGU A;  2VZA A;  2BH8 A;  3HKS A;  3K7U C;  3Q8D A;  1VQI A;  3TS0 A;  3S1Q H;  2I5L X;  1NY4 A;  2K5V A;  3CD6 A;  2JE6 I;  3E0E A;  1EQQ A;  1JB7 A;  3CCJ A;  1XPO A;  4L5R C;  2A19 A;  4LF8 Q;  4A3M G;  5C0X G;  2YYZ A;  5C44 H;  1HNX Q;  4B3T Q;  4POF A;  1K8G A;  4JYA Q;  4LF4 L;  3K80 C;  4B3R Q;  1VQD A;  2RCN A;  4UPA A;  3TEH B;  1E3P A;  1Q7Y C;  4UP7 A;  2MNA A;  3KF6 A;  5HGQ A;  1PH6 A;  1Q8K A;  1N32 Q;  2UXD Q;  4LF8 L;  1SRU A;  3A0J A;  3G71 A;  2CWA A;  4A3J H;  2R93 H;  4B3T L;  2RF4 A;  1UE5 A;  4JOI C;  3CMA A;  1WYD A;  4YWL A;  4B3R L;  1EWI A;  1X3F A;  1NE3 A;  5FLM H;  2E2H H;  2N8N A;  3J7A 5;  4KHP L;  1GKH A;  2ZJQ A;  3FKI H;  4DV5 Q;  4YWM A;  1M90 C;  4JI7 L;  5GAD C;  3TRZ A;  4A3B H;  5C44 G;  1N34 Q;  4LF9 Q;  5HY6 A;  2HIX A;  2JA8 H;  4PG3 A;  1VQL A;  3PCO B;  3MXN B;  4XTC S;  3RR5 A;  5JEA J;  3PGZ A;  2L15 A;  3HKZ E;  2R93 G;  1T9H A;  1CKN B;  1QVF A;  1SMX A;  4DV0 Q;  4LF9 L;  2E8G A;  3ZJY C;  4DR2 L;  1XPR A;  1YBY A;  4IFD J;  3HOZ H;  3EN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...