4OX9L

Crystal structure of the aminoglycoside resistance methyltransferase npma bound to the 30s ribosomal subunit
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
124
structure length
124
Chain Sequence
b'PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Molecular recognition and modification of the 30S ribosome by the aminoglycoside-resistance methyltransferase NpmA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome/antibiotic
total genus 16
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ox9L00
1KL9A 3D31A 1Q1BA 3PIPA 1BBUA 4DK3C 1TWAH 2K4KA 1IYJB 2YTYA 1TWCH 1X54A 2I5LX 3M4QA 3CCEA 1N36L 4DR4Q 3F2DA 3HOUG 4JI8Q 1E1TA 4DR3L 4A3MH 2OQKA 4JI0Q 2A8VA 2D62A 1N32L 1Q12A 2WAQE 4OWXB 1NMFA 3S1RH 3ZJYC 3OTOL 1IBML 5M3MH 1N36Q 3AEVA 3M9BA 2WB1E 1XMOQ 4A3CH 3BJUA 2BH8A 2DGYA 4A3IG 1PV4A 4IO9A 1VCIA 3PGZA 3PV0A 1RIPA 4BY7H 4QQBX 2BA0A 1IBMQ 3OTOQ 5IYBG 2K14A 4OX9L 3H3VI 3TQYA 2UUBQ 3ER0A 1FGUA 2B29A 2F52A 4HJ7A 4NB3A 1HNZL 1QVCA 2JA6G 4A3MG 1VQJA 4DV7L 2ES2A 3M7NA 1Q1EA 1MJCA 3L0OA 4UP9A 1VQFA 3HOXH 1K8AC 1XMQL 4TQUS 5FLMH 1VQ8A 4P72A 4BXXG 5M3MG 1SE8A 3GO5A 1Q82C 1HNZQ 2IY5B 2F3IA 2NZOA 2ZM6Q 4DV7Q 2K50A 5C44H 3BZCA 1QUQA 2JQOA 1YJWA 1QZGA 2AWOA 2LXKA 1KAWA 2PI2A 3OYYA 4X64L 2XGTA 1XMQQ 4BY7G 1ASYA 3GD7A 4PZ8A 4UP8A 3CCQA 2YTVA 2Z0SA 1I6HH 4BY1H 1I5FA 1G51A 4GN3B 4JV5L 4DR5L 4JI2Q 4C2MH 4LF8Q 4H02A 1FL0A 1Y1VH 2MFIA 2OCEA 3HOXG 4HIDA 2WB1G 2HHHL 3HOWH 1VQDA 2JEAI 1DGSA 4Y7NH 4KLKA 4JI8L 2CWAA 2RF4A 2QA4A 2Z6KA 2KCMA 3U4ZA 5C44G 2HHHQ 1PH8A 3PUWA 3RR5A 3H15A 1EUJA 3KYHC 1PHJA 4DUYL 2JJQA 3KF6B 1KQSA 1P16A 1HNXQ 4LF9L 1Y1VG 3CCUA 3TREA 2OTJA 2Z6KC 3RLOA 4DV3Q 2E2JH 1HNWL 1XNQL 5HY6A 5C0XJ 3CMEA 5JJKA 1JT8A 3STBC 4C3IH 1SROA 1XTDA 4BBSG 4BBRG 2DUDA 4L5QA 3F8TA 3CF5A 2ID0A 3GTJH 1XNQQ 2HIVA 2K52A 3K80C 4X66L 3RLFA 1L0WA 4ALPA 4DPGA 3AFPA 1J5EQ 4HIOA 3G71A 1YITA 1UE7A 1N33L 4EQ5A 4A4IA 3A0JA 3UE1A 2GVAA 1X3GA 2ALYB 4X66Q 1X65A 4DR1L 2N49A 4YCVA 3IRBA 4B3ML 3J80i 2JA8H 1O7IA 4YY3L 2OWOA 3ULLA 4AYBE 1OXTA 4C3HH 1JJ2A 3GTGH 1K0RA 4OWTB 2NVXH 4A3CG 4JCVE 1V43A 4DR6L 1NY4A 3J81i 1IL2A 1YVCA 4J15A 1JJGA 2UU9L 3NBHB 1YZ6A 3J81j 1LUZA 3K7AH 3PUVA 3RZDH 2HT1A 3RZOH 1VQ5A 2CCZA 3PO2H 1WFQA 1GM5A 4A3BH 3M3YH 3HKZG 2IHFA 4IFDG 1UE5A 4YWMA 3I55A 3W1BA 2PMZE 2JA8G 4OXPA 3FKIH 3PSIA 2VZAA 5EAYA 2R7FA 2YYZA 3A5ZB 5IYDG 4GKJQ 4A93H 1VQ9A 1PH3A 2YTXA 3CC7A 4YHHL 4IFDI 4L5RC 2D0OA 4KI0A 2K5VA 5FLXc 3CCJA 1VQPA 1VQIA 1KIXA 2R92H 1JJCB 1OXXK 4DV2L 3CC2A 3S1NH 3HOYH 5IT9c 1YIJA 1HR0W 3KDFB 4O2DA 4TVAB 3DM3A 4L5TA 3CC4A 4AYBG 1TWHH 3NENA 3D0FA 4B3TL 3PUZA 1A63A 1MKHA 3W1GA 3TS2A 3J7ZC 1AH9A 1U0LA 1UEBA 3E9HA 4DUZQ 2CKZB 3H3VH 3NELA 1GKHA 4IJHA 2QEXA 4JI3Q 4B3TQ 4A93G 3CMAA 1E3PA 2K5HA 1G291 2A19A 2R92G 4LFCQ 3F2CA 1IBLQ 3HOYG 3RN2A 1PH6A 3U4VA 1U5KA 4JBWA 4EX5A 3BU2A 1XMOL 1CKNA 1KC8C 1NJIC 2N78A 4PZ6A 1GD7A 4DV5Q 4NXNL 3CQZH 1C0AA 3S15H 3I4MH 4GN5A 3S17H 4AQYL 4OONA 2UUBL 3RLNA 1VQKA 1I50H 5JJIA 4KHPL 2WP8J 3AQQA 2R6GA 4JI4Q 4Y52H 3CCLA 2VS1A 4NXNQ 2MO1A 4A3JH 1PH7A 3S2HH 2BH2A 4AQYQ 1EWIA 1L1OB 4KHPQ 4PG3A 4AH6A 4JI7L 2ZM6L 1D8LA 1KD1C 1WI5A 1CUKA 5C4XH 2KENA 4GNXB 5M5XH 3I4MG 1FVIA 4A3FH 5C4JH 3L2PA 2UXCQ 1YNXA 3CPWA 2UUAQ 3I7FA 4PMWA 4QGUA 2ZJRA 1PH9A 4JI7Q 1R9TH 4JI2L 4LF8L 1Y14B 1A0IA 5IWAL 2ZTDA 2FXQA 5GAGC 4JI5L 3E9IA 3JAMc 3SGIA 4GNXA 5K36G 1Q8KA 1Z9FA 3M4PA 4KHZA 3STBD 2YV5A 1N8RC 1ASZA 1XJVA 4LUZA 4A3DH 1E1OA 3EN2A 4A3EH 1VQOA 2JA7H 1YJ9A 5IWAQ 1OXUA 1Q81C 3AFQA 4BA1I 3UDGA 4JI5Q 1L1OC 5AJ3Q 5C4XG 2E8GA 5FLMG 1UE1A 5FJ8H 4A3FG 1EOVA 1IBKQ 3PUYA 3HFZB 4DV1L 2UUCQ 1VQHA 1M1KC 2RHQB 2NN6I 4GNXC 1VQMA 3GTMH 4GLVB 5IP7H 3TRZA 1LTLA 3CCRA 1HNXL 3KLWA 2EQSA 4NPSA 4DV3L 4DV1Q 1K73C 3GTPH 4BY1G 3S14H 3PUXA 5C3EH 4A3EG 1X3FA 1TXYA 2JA7G 4DV0Q 4POGA 4IOCA 4OO1I 4P74A 4GOPB 4JBKA 2LXJA 3HOWG 3I4NH 2EXDA 3K8AA 2K5NA 1D7QA 1IZ6A 3S1MH 1GO3E 4DV6L 4JI6Q 2RHSB 2NZHA 2D0PA 3KF6A 1CKMA 2ZTCA 5IYCH 1J5EL 3HKZE 1W2BA 4DR2Q 4GOPA 1OTCA 1EIYB 2F4VL 1A8VA 4GS3A 1MJEA 4P71A 1PFSA 4R4OA 1OXSC 4DV6Q 2I0QA 3KFUA 4X6AH 1EQRA 4L5SA 3PF5A 2F4VQ 1KXLA 4UPAA 3EBEA 1EQQA 3KF8B 3LGJA 1N34Q 1HR0L 2VL6A 4A3GH 1S3OA 1NE3A 3HKSA 4R4CA 2AMCB 4GOPC 4A3KH 2YU9H 3CCMA 4JBMA 2Q2HA 3S1QH 4GKKQ 2R93H 2AKWB 1FJGQ 4DR7L 5IP9H 4HJ9A 1HR0Q 1X6OA 4JYAL 2A1AA 3UDXA 2VQFQ 4X65L 1TWFH 2CQOA 1B8AA 3K81C 2UXDQ 4YWKA 2PQAB 1YJNA 1S40A 1PYSB 1SR3A 3GTQH 3M4OH 2R7DA 5BR8Q 1HZ9A 4DR7Q 3T1HL 2NVYH 3J7A5 4RG1A 2H5XA 4JYAQ 4LF6L 2EIFA 4X65Q 2LSSA 4GKJL 1TWGH 4JG2A 1AE3A 1PH2A 1VQLA 2JA5H 2HQLA 2JA9A 2MQHA 3RN5A 4LF5L 3T1HQ 2VW9A 1HZBA 5IP9G 4GLXA 4OWWB 4LF6Q 2Q2IA 2Q2TA 4YCWA 5M3FH 4X62L 3CAMA 1M90C 4BA2I 4YCUA 4LF5Q 2IT1A 2HIXA 1E7ZA 4NXML 4DKAC 1X56A 1WOCA 2WFWA 1XNRQ 4DUZL 1PH4A 5ELNA 3PO2G 5E7NA 4A3BG 4JI3L 4X62Q 1QVGA 2VY3A 4POFA 4IPCA 4NXMQ 4LFCL 3FKIG 1IBLL 1SLJA 2I5HA 2ZJQA 2CFMA 3KDFA 3W5OA 1C9OA 2VNUD 2ZJPA 1K83H 4XIGS 5M3FG 4MNOA 2R7ZH 4APVA 1N9WA 3HOZH 1YBYA 1VQ6A 3L7ZC 3PIOA 3T1YQ 4DV5L 5IYDH 3GTOH 4MZ9A 5J3BA 4FDBA 3S24A 5DLQE 1PH5A 1AE2A 2IHEA 5GAEC 3K7UC 1L2FA 1RL2A 2E5LQ 3GTKH 3U58A 2E2IH 1Y1WH 1I94Q 3CW2C 5M5WH 2KBNA 4JI4L 3DLLA 3CCVA 1W3SA 3HOUH 2B3GA 4LFBQ 4LWCA 4K0KL 5IE8A 2Y0SE 4QJFA 3HOZG 2R7ZG 3NEMA 4DK6C 1H95A 2ZTEA 4P73A 3MEFA 4K0KQ 4A3IH 4DV4Q 4DAYB 2PNHA 1A62A 2UXCL 1K9MC 3JAMi 1BKBA 2UUAL 1YHBA 5IYBH 4B3SL 4WJ3M 3CP0A 1Y1WG 1Z47A 4JBJA 1OXVA 2VQEQ 1YEZA 2MO0A 3TS0A 1NBWA 2JA6H 4LF7Q 1VS0A 5C0XI 1EYGA 3CD6A 1QVFA 4JOIC 3UDIA 1HH2P 1L1OA 4B3SQ 3TEHB 4XTCS 3PO3H 4QIWE 2AHOB 4BXXH 4IPDA 1V9PA 2V1CC 2IX0A 4IPHA 5AJ3L 4DR3Q 4A3JG 2NVQH 2GN5A 3ICEA 2OTLA 4IFDJ 5JJLA 5JEAG 3ERSX 1IBKL 1IXRA 2NN6G 1CSQA 2UUCL 1Q46A 4AIMA 3OW2A 2VUMH 4WJ4A 4HIKA 2Y0SG 4LFAL 1SN8A 4C3JH 3CCSA 4A76A 3F1ZA 2UXBL 1QUQB 4QL5A 1LYLA 4YWLA 1UWVA 1X9NA 2RCNA 3EIVA 3FHWA 3A5UA 3S16H 1NTGA 4OX9Q 3PO3G 2ASBA 3HOVH 2GVBA 4JC0A 4LFAQ 4OO1G 4DV0L 1HZCA 2C35B 2KHJA 2UXBQ 3AYHB 3H0GH 3GDEA 1GVPA 1C7YA 1B70B 5GROA 4JI0L 4A3DG 1VQ7A 2PI2E 2VUMG 4JI6L 3I2ZA 3K0XA 2WAQG 1G6PA 3RNUA 5M5YH 4IJLA 1XPRA 4DR2L 2IX1A 4HJ8A 4X64Q 5FJ8G 4LNQA 1SFOH 1WCMH 5GAHC 4IOAA 3UE0A 5IP7G 1K8GA 3HOVG 5ELOA 1BVSA 1NMGA 4DR5Q 1KHIA 4LUOA 4BBSH 1VQ4A 4JV5Q 5IY0A 4HJ5A 1N34L 1LM0A 2KCTA 3H0GG 4BBRH 1Q86C 2JE6I 2JK8A 1E22A 4B3RL 2E2HH 5C3EG 1XPOA 4UP7A 3UDFA 4GKKL 5LMNL 1J6QA 2BA1A 1FJGL 3I4NG 1SRUA 4P75A 1YHAA 3CXCA 4B3RQ 2VQFL 1WCMG 4DNIA 3F2BA 2B63H 1VQAA 5LMNQ 1PVOA 4LUVA 3VDYA 5IYCG 5BR8L 3WWVA 1X55A 3G6EA 1WJJA 2OQ0A 4DUYQ 1V1QA 4LF9Q 3I4OA 3JC66 1K3RA 3G4SA 1E24A 1HNWQ 4A75A 1HJPA 1I3QH 1EFWA 4A3GG 4UY8C 3KJPA 4GLAC 3GTLH 5GQOA 4O0AA 3BZKA 2PQAA 3G48A 4R4TA 4A3KG 1VQGA 4PZ7A 2K75A 2R93G 2B63G 1B7YB 5JEAJ 4A3LH 2AWNA 1N33Q 1XNRL 1MIUA 2I5MX 4RMFA 3M85A 2L15A 1HZAA 4MTNA 1UE6A 3E0EA 4B3MQ 4DR1Q 5LMNW 4DAMA 4IPGA 1JB7A 4YY3Q 2N3SA 4HIMA 1WYDA 1KRSA 3I56A 2Q2UA 4DR6Q 3J80c 1QZHA 1JMCA 2JA5G 3Q8DA 3B6YA 1BBWA 3T1YL 2UU9Q 1PH1A 4A3LG 3PCOB 3ULJA 2XTIA 4LW1A 3PF4A 2MNAA 4HJAA 4LF4L 3J81c 1SMXA 4JI1L 1VQEA 3U50C 2E5LL 1I94L 1PYBA 3CPFA 3S2DH 1JE5A 1VQCA 3A74A 5LMUL 3MXNB 5HGQA 1XPUA 4LFBL 4LF4Q 5GADC 4JI1Q 3KOJA 4R4IA 1YHQA 2CWPA 2JEBI 1T9HA 1X3EA 1KRTA 3ULPA 1S72A 1P8LA 1CSPA 4R1JA 4R4QA 4YHHQ 5LMUQ 1Q7YC 1N32Q 3KJOA 3FP9A 2UXDL 4DV2Q 4DV4L 1EIFA 2ATWA 4GN4B 2NVTH 1PA6A 1VQNA 1VQBA 5H1SE 4QY7A 1YI2A 4JOIA 2KHIA 2QGQA 1CKOA 2VQEL 4ME3A 4DR4L 2N8NA 5C0XG 1CKNB 4LF7L
chains in the Genus database with same CATH superfamily
2ENBA 1B50A 3S16B 5EJWA 5JPMC 3M4QA 2I5LX 3F2DA 1VMPA 1KNEA 2WAQE 4ZK9B 2AQ2B 4RHRA 1N36Q 3L3OC 1XMOQ 3BDCA 1PV4A 2DY8A 4IO9A 4DK0A 3E6ZX 4ZAIA 2UUBQ 1FGUA 4XQQA 1BCPD 4BBSB 4TQUS 5FLMH 1VQ8A 3TDQA 2E2HB 1PTOF 1HQRD 1UAPA 5KYIA 4DV7Q 1YJWA 2K50A 5C44H 1H9SA 1QUQA 1TT2A 2JQOA 3GD7A 3OWEB 4UP8A 2Z0SA 4GN3B 3K59A 2B63B 4DR5L 1F2MA 4JI2Q 4C2MH 1SE2A 4CGYB 4C3IB 4H02A 3T53B 2ZXRA 1DGSA 4KLKA 4ULLA 1PRTF 4IZ8A 3ERQA 3GTLB 5EPKA 3RR5A 4G7HC 1PHJA 1EUJA 3KYHC 3LNNA 5I2XA 4DUYL 5IOCA 3KF6B 1P16A 1Y1VG 3CCUA 3RLOA 5HY6A 5JJKA 1KDBA 4K5XA 4C1NI 1O7LA 2A68D 2H1EA 2NYZD 2HIVA 2K52A 3K80C 1GUWA 5D3IB 3RLFA 3VYSA 3AFPA 1UE7A 1YNJC 1N33L 1JE4A 1LTAD 5F2DA 3A8KE 3A0JA 4X66Q 1X3GA 4B3ML 4DR1L 1X65A 3CRLC 3S2DB 2EYMA 1O7IA 4YY3L 2OWOA 3KK7A 2Z4HA 1KAAA 3R3OA 5C3WA 1JCKB 4B08A 3R8BA 1CA5A 1T5EA 1JJGA 3SK6A 3J81j 3PUVA 5ELFA 2HT1A 3PO2H 4Z9CB 4HMJA 1BUVT 3M3YH 4IFDG 2LY7A 5FOBB 2B2WC 1UE5A 1LT6D 2B2VA 4NDXA 2PMZE 2JA8G 4OXPA 3FKIH 3MXUA 3C1EA 2YYZA 3VR4A 4XYOA 5FLXL 1PH3A 1TWCB 4L5RC 1JORA 3CC2A 5DM63 5T1GA 4F88A 2Z8LA 3DM3A 4B3TL 3MXNA 2F0GA 1MKHA 5EBDA 2EVBA 3W1GA 1ZYRC 3TS2A 3J7ZC 1UEBA 3E9HA 4BY7B 3S2HB 2QEXA 3H94A 1G291 1Q90A 3VYRA 2XVSA 1TIID 5C4XB 1PH6A 1U5KA 4JBWA 3EJIA 1XMOL 2WINB 1SMYD 4TRDA 2X6GA 3CQZH 3EA6A 1NNXA 1U4LA 2PNRC 2UUBL 3K5OA 3NHHA 4BY1B 2HUGA 1B4OA 4NXNQ 2VS1A 1DOMA 3HOWB 1L1OB 4AH6A 2JN4A 1KD1C 1RCVD 2KENA 4GNXB 3CPWA 3I7FA 4JI7Q 2DJFC 2CHBD 4JI2L 3ZYYX 4OO1H 1A0IA 5IWAL 3JAML 4JI5L 1EQTA 1Z9FA 1N8RC 1XJVA 3IL8A 4A3DH 3EN2A 2JA7H 2KVMA 3AFQA 4BA1I 1RHPA 1TY0A 5FLMG 4RCOA 1UE1A 5FJ8H 1TS3A 1EOVA 3HFZB 4DV1L 1M1KC 1HCZA 3TRZA 2NN6I 3GTMH 4GLVB 4OGQC 3KLWA 2A69C 1VMCA 1K73C 3K5LA 3S14H 3PIP3 4A3EG 3NUCA 2K5WA 4IOCA 3GTGB 4P74A 4C3HB 1ICFB 3BYTB 3I4NH 3K8AA 1O80A 2RCFA 4JI6Q 3KF6A 2F0QA 2PZWA 4DR2Q 1MJEA 4A3BB 4R4OA 2I0QA 1I4PA 4IURA 3AMUA 4A3GH 1HR0L 2PW7A 1S3OA 1EU4A 2SOBA 4HMIA 3CCMA 4JBMA 5EPLA 3S1QH 2R93H 4GKKQ 2F0KA 5CYUA 1CM9A 3S1NB 3DEOA 2ZT9C 2PCFB 3MFGA 1ILQA 3K81C 2PMZB 1B8AA 5EGTA 4YWKA 2KUMA 3GTQH 1PYSB 1RTOA 1SR3A 2R7DA 4DR7Q 1KNAA 2CQAA 1S4ZA 3CHBD 4OIJA 1MGSA 1K83B 3DWQA 3RN5A 2R7ZB 2F0UA 3T1HQ 5ELCA 5CBEE 1AW7A 5EBCA 5M3FH 4X62L 1CA6A 4YCUA 3DWPA 4WORA 2IT1A 1Y8NB 4DKAC 1X56A 5JOBA 1WOCA 5ELEA 3PO2G 1NUCA 4K8IA 1ESFA 3QOLA 1V1OA 2K6AA 4NXMQ 4ME5A 1CI3M 2JSOA 3FKIG 1C48A 1SLJA 2I5HA 1EY8A 1XWEA 2RDFA 1EWCA 2VNUD 2ZJPA 5FKAC 1YBYA 3T1YQ 5IYDH 4EGVA 4MZ9A 3GTOH 5J3BA 1HUMA 5DLQE 2IHEA 5C4JB 1SNQA 2E5LQ 2SNSA 1PTOH 2KBNA 4ZCKA 1W3SA 1HTLD 3RMHA 3NTHA 5T1IA 1EY7A 3NEMA 3NP8A 5FLXE 1D2BA 4K0KQ 2EY6A 2PNHA 1A62A 1LT3D 1JR0D 1YHBA 4FNFA 3T56B 4WRDA 1YEZA 4ZKCB 1NR2A 3I73A 2O2LD 5C0XI 4DAYA 1QVFA 1TQOA 1HH2P 1L1OA 3TEHB 3IFDA 3GTPB 4UDUC 1X3PA 4IPDA 1V9PA 5DNFA 5C3XA 2GN5A 5JJLA 2L5TA 1CSQA 1Q46A 2Y0SG 5BN3A 3NXWA 3CCSA 3TP6A 4IUUA 3MAQA 3A54A 1PFBA 4QUCA 4ID6A 4YWLA 4N9PA 4G4KA 2RCNA 3A5UA 1NTGA 3HZXA 1BCPB 4K5WA 4OX9Q 3NPPA 3HOVH 3PO3G 1IKMA 4JC0A 4OO1G 1HZCA 3HEJA 1HQMC 1ICWA 3GDEA 4CJ2C 4KTAA 4FXGC 5GROA 5IGDA 4A3DG 1VQ7A 2VUMG 4A3KB 4JI6L 5M5YH 2IX1A 4DR2L 4C3JG 1LTGD 1LT4D 5FJ8G 3OWFA 2K5QA 1WCMH 4IOAA 4RGOS 3UE0A 1BVSA 2WKCA 4LUOA 4HJ5A 1F9QA 4BBRH 1Q86C 2QCPX 3QR8A 4K8JA 3UDFA 4GKKL 2AQ3B 3I4NG 1STEA 1AZQA 1R4QB 2F0IA 4K2KA 4NP5A 3F2BA 1IW7D 2AQ1B 5G3LF 1X55A 1ET6A 3U9OA 1A3TA 3K58A 4CDEC 3HS0C 4LF9Q 3JC66 5BN5A 2X6LA 2F0VA 4G7OC 3G4SA 1HNWQ 2JXMB 4C1NK 1ENFA 1WTWA 2L1BA 4A3GG 2PW5A 5CC4A 3C2PA 3G48A 4PZ7A 2C5CA 5ELBA 3R93A 2R93G 2B63G 1B7YB 3HG9A 3OPOA 4WFN3 4KK7A 3BVGA 2AWNA 1MIUA 1STGA 1PTOD 2L15A 1HZAA 4K6LA 1WTRA 1F2LA 2E2IB 1Y1WB 3KBGA 5LMNW 5CBAE 4IPGA 1JB7A 1EEFD 3HOUB 4HIMA 1ML0D 3J80L 2DJGC 1QZHA 1JMCA 3B6YA 3T1YL 5C6AA 1TS4A 2WIIB 2MNAA 1PRTD 4F7XA 3FPUB 1SMXA 4QB4A 2E5LL 3SK8A 3LWEA 1CQVA 4QUFA 5GADC 3FEWX 3KOJA 4JI1Q 2JEBI 1KRTA 1S72A 4X3UA 1Q7YC 4R1JA 1CSPA 2XWJB 4YHHQ 2HD3A 3H91A 1N32Q 1NSNS 5IGGA 2UXDL 4DV2Q 1EZ6A 3NSWA 1EIFA 2NVQB 4DGZA 5H1SE 2F0DA 4JOIA 3V2TA 2KHIA 2QGQA 2TMPA 4ZLTF 4DR4L 5M5XH 3SXHA 5IYDG 1G2SA 4JI0L 2LS01 3D31A 2CW0D 2KCNA 2K4KA 4RA8A 2IJ0A 3V96A 4JI8Q 1E1TA 2D62A 5C44B 1MBYA 1NMFA 3ZJYC 3AEVA 4KKTA 3M9BA 2WB1E 2G9DA 4N9TA 1B3AA 3PV0A 2K14A 4OX9L 2ICIA 1SFOB 1CZGA 4A3MG 1VQJA 1A3UA 1LLRD 1WD0A 2EOTA 4UP9A 1U4MA 4P72A 5M3MG 1QOHA 1Q82C 2ZM6Q 4XT3B 1B9NA 3T16A 3BZCA 1EYCA 2LXKA 1KAWA 2A73B 4BY7G 3QJYA 3CCQA 1I6HH 3EQLC 1I5FA 3MEHA 1TVXA 3T51B 1Y1VH 1SYBA 1CK1A 4HIDA 3HOXG 2HHHL 1VQDA 2G9HD 3DHQA 1A3VA 1HUNA 4Y7NH 1MSGA 1W6KA 1SEBD 3EVQA 2KCMA 1YNJD 1BOSA 3PUWA 3OHXC 4CKCA 3SVMA 5FO7B 2D5DA 3SDZA 2JJQA 4LF9L 2HCCA 3MFYA 2Z6KC 2E2JH 3MVVA 1HNWL 1JT8A 5C0XJ 4KJNA 4ZQ3A 4BBRG 3I8ZA 3Q24A 3GTJH 1ZEQX 4DPGA 4DXFA 4HIOA 5CV7A 1YITA 4A4IA 5LL6X 1SYGA 2ALYB 1F9SA 4IFDH 3IRBA 3PQIA 2JA8H 3QB3A 3ULLA 4AYBE 1OXTA 2GA4B 1JJ2A 4OWTB 2NVXH 3J81i 2BE5D 1DOKA 2D2CC 3MA2B 1YVCA 2EJGC 4YIJA 1YZ6A 4C56C 1LUZA 5AFWA 3RZOH 2TSSA 3A56A 1VQ5A 2NVTB 1WFQA 2XSCA 2NBFA 2IHFA 4C3JB 1BNZA 5E4XA 4YWMA 3QG1A 1SE4A 4MN3A 4C3HG 4FF1A 3QO2A 2Q8IB 1S5FD 3A5ZB 2YTXA 3CC7A 4YHHL 1VQPA 5FLXc 3CCJA 2H4OA 2RVLA 1KIXA 1VQIA 3D3RA 1N32L 1JJCB 5I4DA 4DV2L 1RJTA 1S5CD 2OTJA 5IT9c 4H44C 1YIJA 1HR0W 3D6CA 1TU2B 1TWHH 4K2LA 3S9WA 3D0FA 3S1RB 2B2UC 1A63A 1S5BD 4QF4A 3IFTA 1AH9A 3H3VH 1E2WA 2CKZB 1GKHA 4B3TQ 3CMAA 1E3PA 1ENAA 1LTRD 2A19A 3F2CA 1IBLQ 4ODGA 3HOYG 3RN2A 2KOLA 2WB1B 5CGKA 3U4VA 4EX5A 2EYLA 3J80E 1CZWA 1X32A 4DV5Q 1C0AA 1LTTD 4GN5A 3S17H 5FO8B 3RLNA 4EVOA 1I50H 4KHPL 3AQQA 2R6GA 4A3JH 1K8OA 5JEAH 4RGMA 3TMEA 2ZM6L 1PZKD 2A69D 1BO0A 4PMWA 3S14B 4NMZA 3TP7A 3JAMc 3SGIA 1Q8KA 3P75A 3STBD 3AB9A 1E1OA 4A3EH 1GUSA 4RFBA 5IWAQ 1OXUA 2AUJD 4JI5Q 1L1OC 2JP1A 2NWGA 3PUYA 1VQHA 3BDLA 4GNXC 1JC7A 1RODA 5EKIA 4DV1Q 5C3EH 1ONLA 2EYOA 4POGA 3NWTA 4PNYA 4JBKA 2EXDA 4J8QA 5COYA 1JWSD 1CKMA 5IYCH 1W2BA 2HCIA 4GOPA 2K7VA 4RHSA 1CT1D 3K7AB 4P71A 3RZDB 4RGTA 3UI2A 2RDGA 2XRSD 5CV4A 1EY0A 4AYBB 3KLRA 1GHJA 1GUOA 4L5SA 1D5ZC 3G6JB 4UPAA 1SDFA 1KXLA 3KF8B 3LGJA 2VL6A 3D4RA 3BS1A 1NE3A 1F77A 3NQTA 4R4CA 1BF4A 4A93B 2Q2HA 2AKWB 1MD2D 2R92B 1HR0Q 4F87A 1EIHA 4JYAL 1PZID 3UDXA 4X65L 1TWFH 2CQOA 1YJNA 3M4OH 2OXPA 5BR8Q 1HZ9A 2A6ED 4LAAA 4RG1A 4IUQA 2EIFA 2LSSA 1TWGH 4CKEA 5KIXA 1AE3A 2D9UA 4CHTB 2HQLA 2JA5H 5C4HA 4LF5L 3URYA 1HZBA 4GLXA 1U9RA 3RUZA 1UNSA 4X3TA 4X3KA 2Q2TA 2RBMA 1E7ZA 1PTOB 2I46A 1M8AA 4G7ZC 3S15B 5E7NA 3I4MB 3TP8A 5ISRA 4X62Q 1QVGA 2VY3A 4IPCA 3A8IE 2B2TC 1IBLL 2ZJQA 2CFMA 2VXWA 3W5OA 2CVRA 3DMUA 4M1UB 3NWSA 4RKLA 4MNOA 2DY7A 4DAPA 2NZ1D 1PRTB 2R61A 2RQXA 4KY7A 3SR1A 4DV5L 1Q3LA 4FDBA 3S24A 2EZVA 1IL8A 1L2FA 1RL2A 4A3FB 3GTKH 3CW2C 5M5WH 1R9TB 3T4AC 2XIWA 2B3GA 2DNEA 4QJFA 1O7ZA 2PZUA 4O1NA 3HOZG 1H95A 2ZTEA 5I2YA 3MEFA 4A3IH 2OEOA 4DV4Q 1SNDA 4DAYB 1K9MC 4WJ3M 1Y8PB 1Y1WG 2MO0A 3HOVB 2JA6H 1LTSD 3CD6A 2EYJA 4JOIC 1HRJA 3UDIA 4HSVA 1WTQA 4XTCS 3PO3H 4BXXH 2A6HC 2KHSA 1K0SA 2RDHA 1LTID 2V1CC 2IX0A 5CV6A 4DR3Q 1JB3A 4A3JG 5JEAG 3ERSX 1IXRA 1AP0A 4WJ4A 1CQFA 2VUMH 3S1MB 1WCMB 4C3JH 1AFPA 3F1ZA 4IUTA 4XYQA 2UXBL 2F0NA 4QL5A 1DONA 3I90A 1UWVA 2SEBD 4J6HA 3EIVA 3FHWA 3S16H 3OSOA 1GJXA 5KEEA 3AYHB 1STAA 1GVPA 4X3SA 1ILPA 1KLGD 2YU9B 5E3FA 1G6PA 3RNUA 4IJLA 4N8FA 2IW3A 4X64Q 4BWGB 1TS2A 5GAHC 4MTKA 2FINB 1FYCA 4JPBW 4B9XA 4BBSH 4JV5Q 2EYHA 1VQ4A 1LM0A 1BCPC 1F2YA 5JAVA 2JE6I 1FNVA 2E2HH 5C3EG 5DM73 5IGCA 1K3BC 3E3XA 4PV1C 3C46A 4K5VA 1G91A 2B63H 3VDYA 5IYCG 5BR8L 1QJOA 3KF8A 3VYTA 1WJJA 1FGBD 1FNUA 1V1QA 3I4OA 2IPKD 1K3RA 1HFGA 1E24A 4A75A 4RAUC 1EFWA 2XN9C 4GLAC 3GTLH 3WOEA 4DU9A 3A8JE 5A2QE 4OEMB 1GUNA 1VQGA 4CJ0B 3DM1A 2BCOA 2B39A 3G7LA 2F0JA 2I5MX 3D6WA 4KY6A 3DEPA 2J0TD 5CV9A 2NTSA 4FXKC 1H9RA 4DAMA 4FF3A 1CFMA 1WYDA 4MHEA 2BDNA 2A68C 3J80c 2JA5G 2PYKA 1ZXTA 4R8IA 1YNND 2CH4A 4A3LG 2E74C 3PCOB 3ULJA 5FK9C 3VR6A 3X3MA 1SAPA 2E2DC 4BS9A 4F8MA 3S2DH 2F0MA 2KECA 3W3AA 4TKOB 4R4IA 1QNKA 2CWPA 1X3EA 2L12A 3SEBA 3ULPA 1WTXA 4K14A 4H7BA 3KJOA 1Z6HA 4DV4L 2ATWA 3L9AX 4GN4B 1PA6A 2QDBA 4KN7C 4FYDA 3QWNA 4L6TB 1YI2A 4S3SA 2FMMA 1LO5D 2UXDQ 2L11A 1CKNB 1K8MA 5EKLA 1Q1BA 3VR2A 4CDDC 3PIPA 1VDZA 2B8GA 1TWAH 1JOOA 1TWCH 1X54A 2F1MA 1WTPA 4DR4Q 4A3MH 4JI0Q 4DR3L 2VB3X 5IIFA 3H0GB 2NUCA 4OWXB 2ICEC 1IBML 1U4PA 4P2CB 3OTOL 3J81E 5M3MH 2MJ8A 1M4VA 3BJUA 2DGYA 1I6VC 4A3IG 1VCIA 3PGZA 1RIPA 4BY7H 4QQBX 4LMQD 3H3VI 3TQYA 3ER0A 3MXPA 2B29A 5TSSA 1JWUD 4NB3A 1HNZL 1QVCA 3LWUA 2JA6G 3M7NA 4RGNA 3HOXH 3OW7A 1VQFA 1K8AC 1XMQL 3IKJA 4BXXG 1SE8A 3GO5A 2Z6BA 2IY5B 1RKNA 2F3IA 2NZOA 4A3CG 1EU3A 3FDTA 2AWOA 2PI2A 4X64L 2EPBA 1LT5D 3PIO3 2XGTA 1ASYA 4PZ8A 5EKKA 4BY1H 4JV5L 2KQ3A 2MFIA 2WB1G 3HOWH 1R4PB 4HAEA 1JICA 2L9HA 3GTJB 2CWAA 2QA4A 1EY5A 3VR3A 3U4ZA 2FJ2A 2HHHQ 3BVMA 1B1ZA 1Q8IA 1XNQL 3CMEA 3OIPA 1XTDA 4BBSG 4EQOA 5JPNC 4ZRZA 5D3DA 3F8TA 3MC0B 3CF5A 3ONAB 5JJZA 2L55A 4J1MA 3SE0A 1J5EQ 3G71A 1I4GA 2QW7A 1SNCA 3UE1A 2GVAA 4EQNA 2N49A 4YCVA 4C3IG 2J7ZA 4DF7A 3GTGH 4C3HH 2B2WA 2K33A 3OMGA 2F0EA 5HURA 1A2UA 1IL2A 5J22A 1DYQA 3NBHB 4XT1B 2J4XA 5NUCA 5D65A 2CCZA 1MHWC 3MWYW 4A3BH 1C8CA 2EE1A 3I3CA 2K28A 1BR9A 1H9MA 2A5HA 2QDLA 3NK9A 1GHKA 2WACA 3OOCA 3O13A 1QWYA 2M9VA 2R7FA 4GKJQ 1LTBD 1VQ9A 5I6YA 2FMCA 5C5MA 1OXXK 3F2UA 3S1NH 3HOYH 2MP1A 2B2VC 3KDFB 4O2DA 4V0BA 4L5TA 4AYBG 4O42A 3CU7A 3NELA 4JI3Q 1S5DD 4KD4A 4A93G 3H6MA 2R92G 4LFCQ 2F0LA 4TSSA 3VA5A 1SE3A 1HXYD 1CKNA 1RD9D 1KC8C 2OF1A 4CDCC 3ND8A 4PZ6A 3HGBA 1GD7A 1VF5C 3BDOA 4AQYL 4OONA 3MXGA 1HTPA 2BDOA 5K5PA 4C2MB 3CCLA 1KDCA 2MO1A 3OIQA 1RTNA 3N52A 1SYDA 2HDLA 5C4ZA 2NN6H 4KHPQ 3TSSA 3I4MG 4HCSA 5C4JH 3L2PA 1PH9A 1G6ZA 3KUPA 1Y14B 1JOQA 2FXQA 5GAGC 2PPBC 5K36G 1ASZA 4LUZA 4JVZA 1F2ZA 1VQOA 4IALA 1UEAB 1YJ9A 2K32A 3UDGA 5AJ3Q 5C4XG 4DFAA 5CORA 2E8GA 4A3FG 1IBKQ 2UUCQ 5IP7H 4RWSC 1EIGA 4NKLA 1IKLA 1XTCD 1STYA 1STNA 1PXUA 3GTPH 4BY1G 3PUXA 1VF7A 3HKZB 3R2IA 5L37A 1X3FA 3OMCA 3Q23A 1XX8A 2E76C 3Q22A 4OO1I 4IN3A 4GOPB 2HQEA 1MSHA 2LXJA 1WTOA 3HOWG 2K5NA 1D7QA 3DXJC 1GO3E 4DV6L 1SJHD 2D0PA 3NBIA 2ZXPA 2ZTCA 1J5EL 2F4VL 1OTCA 1A8VA 2KCCA 1PLFA 3PO2B 1PFSA 1OXSC 3M3YB 1EQRA 3AU7A 1C4QA 2AUKA 3FKIB 4FXDA 3FPPA 3HP3A 3ITPA 2AMCB 3GQBA 4A3KH 3A7LA 2O5JC 1FJGQ 4UHVA 1X6OA 3RD4A 2A1AA 2VQFQ 2L0CA 1S40A 2PQAB 2QF7A 1BQQT 1HA5A 1ZYRD 4ZUIA 2NVYH 2H5XA 4JYAQ 4LF6L 2HDMA 4X65Q 4GKJL 1E0BA 1PH2A 1VQLA 2JA9A 3NBHA 1STHA 1V1PA 5J39A 3C3LA 5IP9G 4OWWB 3A55A 5CMDA 2Q2IA 1SYCA 3FVQA 4YCWA 3TBIB 3CAMA 1M90C 4LF5Q 2HIXA 2Z1CA 2SNMA 2WFWA 1XNRQ 3CQZB 1PH4A 5ELNA 4A3BG 4ZYSA 4JI3L 4POFA 4LFCL 4XXEA 4KKSA 3KDFA 3PMFA 1C9OA 2B2YA 1L0XB 4XIGS 3HOZH 1N9WA 1VQ6A 1ZKOA 5GAEC 1JOKA 3K7UC 2E2IH 1Y1WH 3PO3B 1I4RA 3HOUH 2PO4A 2K03A 2R7ZG 4KMUC 4A3DB 4P73A 2JA7B 2XNAC 2XRQD 1WTVA 1H9KA 2K01A 3NTIA 1NAPA 3JAMi 1PRTC 1BKBA 5IYBH 4B3SL 3CP0A 1Z47A 2FFKB 3GTMB 4RCNA 3TS0A 1B44D 2KJXA 4LF7Q 1VS0A 2F4IA 1EYGA 1LACA 3WOFA 4QIWE 2AHOB 4IUNA 5KGUA 2NVQH 5AJ3L 3CKIB 1QG7A 3I4NB 2NB0A 1IBKL 1DJRD 1HHVA 2NN6G 2UUCL 3FRPB 4AIMA 4FF2A 2KEEA 3C1FA 4LFAL 4A76A 4OELB 5CV8A 1KLUD 1X9NA 5KNDA 2CW0C 2ASBA 2N55A 1QB5D 2C35B 2KHJA 2UXBQ 4A3GB 2PI2E 3WDNA 3I2ZA 3K0XA 5A2QL 4FO2A 3S1QB 2R93B 1XPRA 3N6RA 1DM0B 1GUTA 4LNQA 1SFOH 2F03A 5IP7G 1K8GA 1SNMA 4HCEA 3GTQB 1NMGA 1KHIA 5IY0A 1LABA 2KCTA 3H0GG 5CV5A 4B3RL 5LMNL 1FJGL 3V05A 4JW0A 4IUVA 1L0YB 1SRUA 3K0YA 4P75A 4R9WA 2VQFL 5M3FB 1B2TA 2R3ZA 4JK1C 5ELDA 3J7AF 1SYEA 2EJFC 2EJMA 4FP5D 1HJPA 1I3QH 2EY5A 2F0OA 1B3QA 2PQEA 1NR4A 4O0AA 5GQOA 3BZKA 2PQAA 1HPCA 4A3KG 3R2TA 3K5NA 1EQVA 4A3LH 3Q0AA 2A74C 1AEXA 1EY6A 4CJ1B 3GTOB 1JWMD 1XNRL 1AN8A 3TZUA 3U9SA 3E0EA 3SK5A 2E75C 2N3SA 1KRSA 3I56A 1EY4A 4DR6Q 1CTMA 1BBWA 2F0TA 2UU9Q 4HTHA 2XTIA 4LW1A 3J81L 3PF4A 2Q8RE 4LF4L 3U50C 3CPFA 1PYBA 1A15A 1FD7D 1H9JA 1TWAB 1JE5A 4PMBA 3A74A 5LMUL 3DWAA 1DD2A 5HGQA 5CR3A 5IT9L 1XPUA 4A3MB 1YHQA 5J1ZA 4CKBA 1P8LA 4R4QA 2BE5C 1MI2A 3BG3A 5M3MB 5KNCA 2NTTA 3KLSX 5I9OA 5G3LD 2NVTH 2CH4W 1B9MA 4I65A 1VQBA 4QY7A 3P7JA 1CKOA 4ME3A 3E5SA 2WAQB 2N8NA 5C0XG 4CDFC 4OIKA 4LF7L 1E2ZA 1KL9A 4QIWB 1I4HA 1O7YA 2RKSA 1BBUA 3HOXB 2WKDA 4DK3C 1EYAA 1JQYD 1IYJB 2YTYA 4DNRB 3CCEA 1N36L 3HOUG 5A35A 2EXZA 2OQKA 2A8VA 4HSPA 1PFMA 1Q12A 4KV6A 3S1RH 4I7AA 2QKIC 3GP7A 4A3CH 2BH8A 5M5YB 3ND9A 1J8IA 2BA0A 1IBMQ 1SNOA 1FNWA 2JYOA 5IYBG 3OTOQ 3P20A 2F52A 4HJ7A 2QEJC 4DV7L 1QILA 2ES2A 5EPJA 1Q1EA 1MJCA 1ET9A 3L0OA 3T13A 4BBRB 1FR3A 1GXDC 4DNTB 1HNZQ 4WJWA 4KD3A 1QZGA 3CRKC 3OYYA 3Q6SA 1XMQQ 3M7GA 1F9RA 2YTVA 1G51A 3MTSA 3K5MA 4LF8Q 1FL0A 2OCEA 2WV6D 4ZKBB 2JEAI 4MIUA 2RF4A 1W6JA 1GUGA 2LFNA 2Z6KA 2EY1A 5C44G 3I70A 1J9OA 4Q0FA 1WVLA 1PH8A 5C5LA 2F0WA 1KTKA 3H15A 2ZXOA 2EYPA 1KQSA 1HNXQ 3X3NA 1PMRA 3TREA 1E2VA 4DV3Q 2XWBB 3STBC 2O4XA 1SROA 4C3IH 5EQ0A 2DUDA 4L5QA 4FF4A 2ID0A 1XNQQ 1CHQD 3LX0A 4X66L 1L0WA 4B9WA 4LJZC 3K57A 4ALPA 5FO9B 5I6WA 3GV6A 4EQPA 4EQ5A 4Q5VA 1STBA 3QIAA 1RF2D 4QMGA 3J80i 2RSNA 1HFNA 1K0RA 3H09A 3HOYB 4JCVE 1V43A 1BDOA 4DR6L 1NY4A 3NE5B 4J15A 3GV3A 2UU9L 2DNCA 1NCVA 1OO9B 3K7AH 3RZDH 1BCPF 1GM5A 1UUPA 3HKZG 1QE6A 2MPMA 5IGEA 3I55A 3P1HA 3W1BA 5M5XB 2B2UA 3PSIA 2VZAA 5EAYA 2IWHA 4A93H 4IFDI 2D0OA 2LMCB 2K5VA 4KI0A 2R92H 1I4XA 4TVAB 3CC4A 5DAUA 3NENA 3PUZA 4OHJA 1TY2A 2MUYA 3H3VC 4UAIA 1U0LA 2A6EC 4DUZQ 2Z4IA 4IJHA 4DA2A 2K5HA 2Z9HA 1SXTA 4I7ZC 1SJED 3M4YA 1XYIA 1F9PA 5IODA 2F3VA 3BU2A 3KLSA 3NTKA 1IHZA 2N78A 2B2YC 4NXNL 2F0PA 4V190 3S15H 1I4QA 3I4MH 1S5ED 1RDPD 2F3WA 1I6HB 1VQKA 5JJIA 4K6DA 2WP8J 1BXTA 4JI4Q 4Y52H 2KA7A 2Q8TA 1Y1VB 1PH7A 3S2HH 2BH2A 5K36H 5IT9E 4AQYQ 1CHPD 4KY5A 1EWIA 3BVZA 4L8JA 4Y7NB 1ENCA 2I07B 4PG3A 4JI7L 1D8LA 1EWHA 3IAYA 1WI5A 1CUKA 4OL7A 5C4XH 2IX3A 1FVIA 4A3FH 2UXCQ 1YNXA 2UUAQ 4QGUA 2ZJRA 1SMYC 1R9TH 3QOJA 4LF8L 2RA4A 2ZTDA 5IGBA 4GNXA 3E9IA 3M4PA 4KHZA 2K5DA 2YV5A 1D5MC 3TN2A 2E2JB 1PFNA 1II3A 1Q81C 4M8AA 4HR7B 4XQJA 2RHQB 1VQMA 4XQNA 4KJOA 2EY2A 1LTLA 3CCRA 1HNXL 4RKBA 2EQSA 2F0HA 4NPSA 4DV3L 5D14A 1G8ZD 2B8FA 5I9PA 1A6XA 1TXYA 3HRZC 2JA7G 4DV0Q 2JA8B 4ZUJA 2NVXB 1LV9A 1IZ6A 4N8X1 4G57A 3S1MH 1WTHA 5HGTA 1D1KA 5IGFA 2RHSB 2NZHA 1BBXC 1EYDA 3HKZE 1EIYB 4ABNA 4GS3A 2NVYB 1TR5A 4GZYC 3RZOB 5KNBA 3JAME 2FHTA 4DV6Q 3KFUA 4X6AH 2PZTA 3PF5A 4QCLA 2F4VQ 2V4DA 3EBEA 2M2LA 1EQQA 1N34Q 3SK4A 5KYLA 3HKSA 4H13C 2RSOA 3VA7A 4GOPC 2YU9H 1B53A 2K04A 4DR7L 5IP9H 1DOLA 4HJ9A 2G5DA 1PZJD 4H0LC 1TWHB 1D6EC 5E4WC 4U673 1V1PB 3T1HL 1PYWD 3J7A5 1ESRA 4IQZA 1U4RA 3I4LA 1T5XD 4JG2A 1DCZA 2MQHA 3A7AB 3HOZB 4IUPA 2VW9A 5JVH3 4LK1C 4LF6Q 1O78A 1K28A 2B2TA 5DEHA 2M00A 5KRUA 4BA2I 2DN8A 4NXML 4ILWA 4DUZL 3EROA 3VR5A 3S17B 3VYUA 1I50B 1KDAA 4A3JB 1K83H 5M3FG 2R7ZH 4APVA 2P5ZX 1EL0A 3L7ZC 3PIOA 4KKUA 1AE2A 1PH5A 3U58A 2SDFA 1I94Q 3I91A 4KHVA 4JI4L 3DLLA 3CCVA 4FVMA 1D5XC 4LFBQ 4LWCA 4K0KL 2IL8A 3FMCA 2Y0SE 5IE8A 2X69A 5M9OA 5LHY1 4PMCA 1V8QA 2MGSA 4DK6C 4A3EB 5JVG3 1YNNC 2UXCL 1Z7TA 2UUAL 4JBJA 1OXVA 2K1BA 2LKVA 1DXMA 3EFXD 2VQEQ 1Y69U 1KABA 1NBWA 3TP5A 4NW2A 4B3SQ 1EZ8A 1SSOA 4L63B 5C3EB 3MHBA 4IPHA 3ICEA 4IFDJ 2OTLA 1AZPA 2F0FA 1PDQA 3OW2A 4DAVA 4HIKA 1G2TA 2F0SA 1GOZA 1SN8A 1X3QA 1H9SB 1QUQB 1XXGA 1LYLA 1TKWB 1SYFA 2MHVA 2KEDA 2GVBA 4U68A 4LFAQ 4DV0L 3H0GH 1QCBD 1C7YA 1B70B 2L4NA 4E6IA 3J7YW 2WAQG 4HN7A 4RH6A 1SNPA 4HJ8A 1TWFB 1TS5A 3HOVG 5ELOA 3DUZA 4KN4C 3M4OB 4DR5Q 1N34L 3NQIA 1I3QB 1SBBB 1EOTA 2JK8A 1E22A 2C9OA 2N88A 3W2DA 1TWGB 1XPOA 4UP7A 5BN4A 2JA5B 1J6QA 2BA1A 3KBXA 1WD1A 4PQXA 4XDXA 1Y8OB 1YHAA 3CXCA 4B3RQ 1WCMG 4DNIA 1EY9A 2K05A 1VQAA 5LMNQ 3BYYB 4LUVA 1PVOA 1D1IA 3WWVA 3K6OA 3G6EA 2OQ0A 4HEDA 3BZDB 4DUYQ 2EDGA 2VB2X 3E0JA 4DXGA 2BOSA 1A2TA 4UY8C 3KJPA 4DN4M 4R4TA 2K75A 5JEAJ 1DZ1A 1N33Q 1HA6A 3I72A 3SHLA 4RMFA 3M85A 5E1FA 4MTNA 1UE6A 4B3MQ 3GTKB 4DR1Q 1IW7C 5LL6S 4DK1A 5M5WB 1QNUA 4CBVA 4YY3Q 2Q2UA 3Q8DA 1PH1A 3TZDA 4A3IB 4HJAA 3J81c 3D8GA 4JI1L 1VQEA 1I94L 1IYUA 2Y0SB 1VQCA 3MXNB 5C0XH 2JA6B 4LFBL 1EFID 4LF4Q 1PTOC 3J7AV 2A6HD 1T9HA 1NJIC 4R8NA 5LMUQ 1IYVA 1EEID 3D4WA 3FP9A 2QILA 1VQNA 3MZ5A 2EYFA 2VUMB 2VQEL 2OT2A 2O5IC 4JI8L 3D4DA
chains in the Genus database with same CATH topology
1KL9A 3D31A 1Q1BA 3PIPA 1BBUA 4DK3C 1TWAH 2K4KA 1IYJB 2YTYA 1TWCH 1X54A 2I5LX 3M4QA 3CCEA 1N36L 4DR4Q 3F2DA 3HOUG 4JI8Q 1E1TA 4DR3L 4A3MH 2OQKA 4JI0Q 2A8VA 2D62A 1N32L 1Q12A 2WAQE 4OWXB 1NMFA 3S1RH 3ZJYC 3OTOL 1IBML 5M3MH 1N36Q 3AEVA 3M9BA 2WB1E 1XMOQ 4A3CH 3BJUA 2BH8A 2DGYA 4A3IG 1PV4A 4IO9A 1VCIA 3PGZA 3PV0A 1RIPA 4BY7H 4QQBX 2BA0A 1IBMQ 3OTOQ 5IYBG 2K14A 4OX9L 3H3VI 3TQYA 2UUBQ 3ER0A 1FGUA 2B29A 2F52A 4HJ7A 4NB3A 1HNZL 1QVCA 2JA6G 4A3MG 1VQJA 4DV7L 2ES2A 3M7NA 1Q1EA 1MJCA 3L0OA 4UP9A 1VQFA 3HOXH 1K8AC 1XMQL 4TQUS 5FLMH 1VQ8A 4P72A 4BXXG 5M3MG 1SE8A 3GO5A 1Q82C 1HNZQ 2IY5B 2F3IA 2NZOA 2ZM6Q 4DV7Q 2K50A 5C44H 3BZCA 1QUQA 2JQOA 1YJWA 1QZGA 2AWOA 2LXKA 1KAWA 2PI2A 3OYYA 4X64L 2XGTA 1XMQQ 4BY7G 1ASYA 3GD7A 4PZ8A 4UP8A 3CCQA 2YTVA 2Z0SA 1I6HH 4BY1H 1I5FA 1G51A 4GN3B 4JV5L 4DR5L 4JI2Q 4C2MH 4LF8Q 4H02A 1FL0A 1Y1VH 2MFIA 2OCEA 3HOXG 4HIDA 2WB1G 2HHHL 3HOWH 1VQDA 2JEAI 1DGSA 4Y7NH 4KLKA 4JI8L 2CWAA 2RF4A 2QA4A 2Z6KA 2KCMA 3U4ZA 5C44G 2HHHQ 1PH8A 3PUWA 3RR5A 3H15A 1EUJA 3KYHC 1PHJA 4DUYL 2JJQA 3KF6B 1KQSA 1P16A 1HNXQ 4LF9L 1Y1VG 3CCUA 3TREA 2OTJA 2Z6KC 3RLOA 4DV3Q 2E2JH 1HNWL 1XNQL 5HY6A 5C0XJ 3CMEA 5JJKA 1JT8A 3STBC 4C3IH 1SROA 1XTDA 4BBSG 4BBRG 2DUDA 4L5QA 3F8TA 3CF5A 2ID0A 3GTJH 1XNQQ 2HIVA 2K52A 3K80C 4X66L 3RLFA 1L0WA 4ALPA 4DPGA 3AFPA 1J5EQ 4HIOA 3G71A 1YITA 1UE7A 1N33L 4EQ5A 4A4IA 3A0JA 3UE1A 2GVAA 1X3GA 2ALYB 4X66Q 1X65A 4DR1L 2N49A 4YCVA 3IRBA 4B3ML 3J80i 2JA8H 1O7IA 4YY3L 2OWOA 3ULLA 4AYBE 1OXTA 4C3HH 1JJ2A 3GTGH 1K0RA 4OWTB 2NVXH 4A3CG 4JCVE 1V43A 4DR6L 1NY4A 3J81i 1IL2A 1YVCA 4J15A 1JJGA 2UU9L 3NBHB 1YZ6A 3J81j 1LUZA 3K7AH 3PUVA 3RZDH 2HT1A 3RZOH 1VQ5A 2CCZA 3PO2H 1WFQA 1GM5A 4A3BH 3M3YH 3HKZG 2IHFA 4IFDG 1UE5A 4YWMA 3I55A 3W1BA 2PMZE 2JA8G 4OXPA 3FKIH 3PSIA 2VZAA 5EAYA 2R7FA 2YYZA 3A5ZB 5IYDG 4GKJQ 4A93H 1VQ9A 1PH3A 2YTXA 3CC7A 4YHHL 4IFDI 4L5RC 2D0OA 4KI0A 2K5VA 5FLXc 3CCJA 1VQPA 1VQIA 1KIXA 2R92H 1JJCB 1OXXK 4DV2L 3CC2A 3S1NH 3HOYH 5IT9c 1YIJA 1HR0W 3KDFB 4O2DA 4TVAB 3DM3A 4L5TA 3CC4A 4AYBG 1TWHH 3NENA 3D0FA 4B3TL 3PUZA 1A63A 1MKHA 3W1GA 3TS2A 3J7ZC 1AH9A 1U0LA 1UEBA 3E9HA 4DUZQ 2CKZB 3H3VH 3NELA 1GKHA 4IJHA 2QEXA 4JI3Q 4B3TQ 4A93G 3CMAA 1E3PA 2K5HA 1G291 2A19A 2R92G 4LFCQ 3F2CA 1IBLQ 3HOYG 3RN2A 1PH6A 3U4VA 1U5KA 4JBWA 4EX5A 3BU2A 1XMOL 1CKNA 1KC8C 1NJIC 2N78A 4PZ6A 1GD7A 4DV5Q 4NXNL 3CQZH 1C0AA 3S15H 3I4MH 4GN5A 3S17H 4AQYL 4OONA 2UUBL 3RLNA 1VQKA 1I50H 5JJIA 4KHPL 2WP8J 3AQQA 2R6GA 4JI4Q 4Y52H 3CCLA 2VS1A 4NXNQ 2MO1A 4A3JH 1PH7A 3S2HH 2BH2A 4AQYQ 1EWIA 1L1OB 4KHPQ 4PG3A 4AH6A 4JI7L 2ZM6L 1D8LA 1KD1C 1WI5A 1CUKA 5C4XH 2KENA 4GNXB 5M5XH 3I4MG 1FVIA 4A3FH 5C4JH 3L2PA 2UXCQ 1YNXA 3CPWA 2UUAQ 3I7FA 4PMWA 4QGUA 2ZJRA 1PH9A 4JI7Q 1R9TH 4JI2L 4LF8L 1Y14B 1A0IA 5IWAL 2ZTDA 2FXQA 5GAGC 4JI5L 3E9IA 3JAMc 3SGIA 4GNXA 5K36G 1Q8KA 1Z9FA 3M4PA 4KHZA 3STBD 2YV5A 1N8RC 1ASZA 1XJVA 4LUZA 4A3DH 1E1OA 3EN2A 4A3EH 1VQOA 2JA7H 1YJ9A 5IWAQ 1OXUA 1Q81C 3AFQA 4BA1I 3UDGA 4JI5Q 1L1OC 5AJ3Q 5C4XG 2E8GA 5FLMG 1UE1A 5FJ8H 4A3FG 1EOVA 1IBKQ 3PUYA 3HFZB 4DV1L 2UUCQ 1VQHA 1M1KC 2RHQB 2NN6I 4GNXC 1VQMA 3GTMH 4GLVB 5IP7H 3TRZA 1LTLA 3CCRA 1HNXL 3KLWA 2EQSA 4NPSA 4DV3L 4DV1Q 1K73C 3GTPH 4BY1G 3S14H 3PUXA 5C3EH 4A3EG 1X3FA 1TXYA 2JA7G 4DV0Q 4POGA 4IOCA 4OO1I 4P74A 4GOPB 4JBKA 2LXJA 3HOWG 3I4NH 2EXDA 3K8AA 2K5NA 1D7QA 1IZ6A 3S1MH 1GO3E 4DV6L 4JI6Q 2RHSB 2NZHA 2D0PA 3KF6A 1CKMA 2ZTCA 5IYCH 1J5EL 3HKZE 1W2BA 4DR2Q 4GOPA 1OTCA 1EIYB 2F4VL 1A8VA 4GS3A 1MJEA 4P71A 1PFSA 4R4OA 1OXSC 4DV6Q 2I0QA 3KFUA 4X6AH 1EQRA 4L5SA 3PF5A 2F4VQ 1KXLA 4UPAA 3EBEA 1EQQA 3KF8B 3LGJA 1N34Q 1HR0L 2VL6A 4A3GH 1S3OA 1NE3A 3HKSA 4R4CA 2AMCB 4GOPC 4A3KH 2YU9H 3CCMA 4JBMA 2Q2HA 3S1QH 4GKKQ 2R93H 2AKWB 1FJGQ 4DR7L 5IP9H 4HJ9A 1HR0Q 1X6OA 4JYAL 2A1AA 3UDXA 2VQFQ 4X65L 1TWFH 2CQOA 1B8AA 3K81C 2UXDQ 4YWKA 2PQAB 1YJNA 1S40A 1PYSB 1SR3A 3GTQH 3M4OH 2R7DA 5BR8Q 1HZ9A 4DR7Q 3T1HL 2NVYH 3J7A5 4RG1A 2H5XA 4JYAQ 4LF6L 2EIFA 4X65Q 2LSSA 4GKJL 1TWGH 4JG2A 1AE3A 1PH2A 1VQLA 2JA5H 2HQLA 2JA9A 2MQHA 3RN5A 4LF5L 3T1HQ 2VW9A 1HZBA 5IP9G 4GLXA 4OWWB 4LF6Q 2Q2IA 2Q2TA 4YCWA 5M3FH 4X62L 3CAMA 1M90C 4BA2I 4YCUA 4LF5Q 2IT1A 2HIXA 1E7ZA 4NXML 4DKAC 1X56A 1WOCA 2WFWA 1XNRQ 4DUZL 1PH4A 5ELNA 3PO2G 5E7NA 4A3BG 4JI3L 4X62Q 1QVGA 2VY3A 4POFA 4IPCA 4NXMQ 4LFCL 3FKIG 1IBLL 1SLJA 2I5HA 2ZJQA 2CFMA 3KDFA 3W5OA 1C9OA 2VNUD 2ZJPA 1K83H 4XIGS 5M3FG 4MNOA 2R7ZH 4APVA 1N9WA 3HOZH 1YBYA 1VQ6A 3L7ZC 3PIOA 3T1YQ 4DV5L 5IYDH 3GTOH 4MZ9A 5J3BA 4FDBA 3S24A 5DLQE 1PH5A 1AE2A 2IHEA 5GAEC 3K7UC 1L2FA 1RL2A 2E5LQ 3GTKH 3U58A 2E2IH 1Y1WH 1I94Q 3CW2C 5M5WH 2KBNA 4JI4L 3DLLA 3CCVA 1W3SA 3HOUH 2B3GA 4LFBQ 4LWCA 4K0KL 5IE8A 2Y0SE 4QJFA 3HOZG 2R7ZG 3NEMA 4DK6C 1H95A 2ZTEA 4P73A 3MEFA 4K0KQ 4A3IH 4DV4Q 4DAYB 2PNHA 1A62A 2UXCL 1K9MC 3JAMi 1BKBA 2UUAL 1YHBA 5IYBH 4B3SL 4WJ3M 3CP0A 1Y1WG 1Z47A 4JBJA 1OXVA 2VQEQ 1YEZA 2MO0A 3TS0A 1NBWA 2JA6H 4LF7Q 1VS0A 5C0XI 1EYGA 3CD6A 1QVFA 4JOIC 3UDIA 1HH2P 1L1OA 4B3SQ 3TEHB 4XTCS 3PO3H 4QIWE 2AHOB 4BXXH 4IPDA 1V9PA 2V1CC 2IX0A 4IPHA 5AJ3L 4DR3Q 4A3JG 2NVQH 2GN5A 3ICEA 2OTLA 4IFDJ 5JJLA 5JEAG 3ERSX 1IBKL 1IXRA 2NN6G 1CSQA 2UUCL 1Q46A 4AIMA 3OW2A 2VUMH 4WJ4A 4HIKA 2Y0SG 4LFAL 1SN8A 4C3JH 3CCSA 4A76A 3F1ZA 2UXBL 1QUQB 4QL5A 1LYLA 4YWLA 1UWVA 1X9NA 2RCNA 3EIVA 3FHWA 3A5UA 3S16H 1NTGA 4OX9Q 3PO3G 2ASBA 3HOVH 2GVBA 4JC0A 4LFAQ 4OO1G 4DV0L 1HZCA 2C35B 2KHJA 2UXBQ 3AYHB 3H0GH 3GDEA 1GVPA 1C7YA 1B70B 5GROA 4JI0L 4A3DG 1VQ7A 2PI2E 2VUMG 4JI6L 3I2ZA 3K0XA 2WAQG 1G6PA 3RNUA 5M5YH 4IJLA 1XPRA 4DR2L 2IX1A 4HJ8A 4X64Q 5FJ8G 4LNQA 1SFOH 1WCMH 5GAHC 4IOAA 3UE0A 5IP7G 1K8GA 3HOVG 5ELOA 1BVSA 1NMGA 4DR5Q 1KHIA 4LUOA 4BBSH 1VQ4A 4JV5Q 5IY0A 4HJ5A 1N34L 1LM0A 2KCTA 3H0GG 4BBRH 1Q86C 2JE6I 2JK8A 1E22A 4B3RL 2E2HH 5C3EG 1XPOA 4UP7A 3UDFA 4GKKL 5LMNL 1J6QA 2BA1A 1FJGL 3I4NG 1SRUA 4P75A 1YHAA 3CXCA 4B3RQ 2VQFL 1WCMG 4DNIA 3F2BA 2B63H 1VQAA 5LMNQ 1PVOA 4LUVA 3VDYA 5IYCG 5BR8L 3WWVA 1X55A 3G6EA 1WJJA 2OQ0A 4DUYQ 1V1QA 4LF9Q 3I4OA 3JC66 1K3RA 3G4SA 1E24A 1HNWQ 4A75A 1HJPA 1I3QH 1EFWA 4A3GG 4UY8C 3KJPA 4GLAC 3GTLH 5GQOA 4O0AA 3BZKA 2PQAA 3G48A 4R4TA 4A3KG 1VQGA 4PZ7A 2K75A 2R93G 2B63G 1B7YB 5JEAJ 4A3LH 2AWNA 1N33Q 1XNRL 1MIUA 2I5MX 4RMFA 3M85A 2L15A 1HZAA 4MTNA 1UE6A 3E0EA 4B3MQ 4DR1Q 5LMNW 4DAMA 4IPGA 1JB7A 4YY3Q 2N3SA 4HIMA 1WYDA 1KRSA 3I56A 2Q2UA 4DR6Q 3J80c 1QZHA 1JMCA 2JA5G 3Q8DA 3B6YA 1BBWA 3T1YL 2UU9Q 1PH1A 4A3LG 3PCOB 3ULJA 2XTIA 4LW1A 3PF4A 2MNAA 4HJAA 4LF4L 3J81c 1SMXA 4JI1L 1VQEA 3U50C 2E5LL 1I94L 1PYBA 3CPFA 3S2DH 1JE5A 1VQCA 3A74A 5LMUL 3MXNB 5HGQA 1XPUA 4LFBL 4LF4Q 5GADC 4JI1Q 3KOJA 4R4IA 1YHQA 2CWPA 2JEBI 1T9HA 1X3EA 1KRTA 3ULPA 1S72A 1P8LA 1CSPA 4R1JA 4R4QA 4YHHQ 5LMUQ 1Q7YC 1N32Q 3KJOA 3FP9A 2UXDL 4DV2Q 4DV4L 1EIFA 2ATWA 4GN4B 2NVTH 1PA6A 1VQNA 1VQBA 5H1SE 4QY7A 1YI2A 4JOIA 2KHIA 2QGQA 1CKOA 2VQEL 4ME3A 4DR4L 2N8NA 5C0XG 1CKNB 4LF7L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KL9 A;  3D31 A;  1Q1B A;  3PIP A;  1BBU A;  4DK3 C;  1TWA H;  2K4K A;  1IYJ B;  2YTY A;  1TWC H;  1X54 A;  2I5L X;  3M4Q A;  3CCE A;  1N36 L;  4DR4 Q;  3F2D A;  3HOU G;  4JI8 Q;  1E1T A;  4DR3 L;  4A3M H;  2OQK A;  4JI0 Q;  2A8V A;  2D62 A;  1N32 L;  1Q12 A;  2WAQ E;  4OWX B;  1NMF A;  3S1R H;  3ZJY C;  3OTO L;  1IBM L;  5M3M H;  1N36 Q;  3AEV A;  3M9B A;  2WB1 E;  1XMO Q;  4A3C H;  3BJU A;  2BH8 A;  2DGY A;  4A3I G;  1PV4 A;  4IO9 A;  1VCI A;  3PGZ A;  3PV0 A;  1RIP A;  4BY7 H;  4QQB X;  2BA0 A;  1IBM Q;  3OTO Q;  5IYB G;  2K14 A;  4OX9 L;  3H3V I;  3TQY A;  2UUB Q;  3ER0 A;  1FGU A;  2B29 A;  2F52 A;  4HJ7 A;  4NB3 A;  1HNZ L;  1QVC A;  2JA6 G;  4A3M G;  1VQJ A;  4DV7 L;  2ES2 A;  3M7N A;  1Q1E A;  1MJC A;  3L0O A;  4UP9 A;  1VQF A;  3HOX H;  1K8A C;  1XMQ L;  4TQU S;  5FLM H;  1VQ8 A;  4P72 A;  4BXX G;  5M3M G;  1SE8 A;  3GO5 A;  1Q82 C;  1HNZ Q;  2IY5 B;  2F3I A;  2NZO A;  2ZM6 Q;  4DV7 Q;  2K50 A;  5C44 H;  3BZC A;  1QUQ A;  2JQO A;  1YJW A;  1QZG A;  2AWO A;  2LXK A;  1KAW A;  2PI2 A;  3OYY A;  4X64 L;  2XGT A;  1XMQ Q;  4BY7 G;  1ASY A;  3GD7 A;  4PZ8 A;  4UP8 A;  3CCQ A;  2YTV A;  2Z0S A;  1I6H H;  4BY1 H;  1I5F A;  1G51 A;  4GN3 B;  4JV5 L;  4DR5 L;  4JI2 Q;  4C2M H;  4LF8 Q;  4H02 A;  1FL0 A;  1Y1V H;  2MFI A;  2OCE A;  3HOX G;  4HID A;  2WB1 G;  2HHH L;  3HOW H;  1VQD A;  2JEA I;  1DGS A;  4Y7N H;  4KLK A;  4JI8 L;  2CWA A;  2RF4 A;  2QA4 A;  2Z6K A;  2KCM A;  3U4Z A;  5C44 G;  2HHH Q;  1PH8 A;  3PUW A;  3RR5 A;  3H15 A;  1EUJ A;  3KYH C;  1PHJ A;  4DUY L;  2JJQ A;  3KF6 B;  1KQS A;  1P16 A;  1HNX Q;  4LF9 L;  1Y1V G;  3CCU A;  3TRE A;  2OTJ A;  2Z6K C;  3RLO A;  4DV3 Q;  2E2J H;  1HNW L;  1XNQ L;  5HY6 A;  5C0X J;  3CME A;  5JJK A;  1JT8 A;  3STB C;  4C3I H;  1SRO A;  1XTD A;  4BBS G;  4BBR G;  2DUD A;  4L5Q A;  3F8T A;  3CF5 A;  2ID0 A;  3GTJ H;  1XNQ Q;  2HIV A;  2K52 A;  3K80 C;  4X66 L;  3RLF A;  1L0W A;  4ALP A;  4DPG A;  3AFP A;  1J5E Q;  4HIO A;  3G71 A;  1YIT A;  1UE7 A;  1N33 L;  4EQ5 A;  4A4I A;  3A0J A;  3UE1 A;  2GVA A;  1X3G A;  2ALY B;  4X66 Q;  1X65 A;  4DR1 L;  2N49 A;  4YCV A;  3IRB A;  4B3M L;  3J80 i;  2JA8 H;  1O7I A;  4YY3 L;  2OWO A;  3ULL A;  4AYB E;  1OXT A;  4C3H H;  1JJ2 A;  3GTG H;  1K0R A;  4OWT B;  2NVX H;  4A3C G;  4JCV E;  1V43 A;  4DR6 L;  1NY4 A;  3J81 i;  1IL2 A;  1YVC A;  4J15 A;  1JJG A;  2UU9 L;  3NBH B;  1YZ6 A;  3J81 j;  1LUZ A;  3K7A H;  3PUV A;  3RZD H;  2HT1 A;  3RZO H;  1VQ5 A;  2CCZ A;  3PO2 H;  1WFQ A;  1GM5 A;  4A3B H;  3M3Y H;  3HKZ G;  2IHF A;  4IFD G;  1UE5 A;  4YWM A;  3I55 A;  3W1B A;  2PMZ E;  2JA8 G;  4OXP A;  3FKI H;  3PSI A;  2VZA A;  5EAY A;  2R7F A;  2YYZ A;  3A5Z B;  5IYD G;  4GKJ Q;  4A93 H;  1VQ9 A;  1PH3 A;  2YTX A;  3CC7 A;  4YHH L;  4IFD I;  4L5R C;  2D0O A;  4KI0 A;  2K5V A;  5FLX c;  3CCJ A;  1VQP A;  1VQI A;  1KIX A;  2R92 H;  1JJC B;  1OXX K;  4DV2 L;  3CC2 A;  3S1N H;  3HOY H;  5IT9 c;  1YIJ A;  1HR0 W;  3KDF B;  4O2D A;  4TVA B;  3DM3 A;  4L5T A;  3CC4 A;  4AYB G;  1TWH H;  3NEN A;  3D0F A;  4B3T L;  3PUZ A;  1A63 A;  1MKH A;  3W1G A;  3TS2 A;  3J7Z C;  1AH9 A;  1U0L A;  1UEB A;  3E9H A;  4DUZ Q;  2CKZ B;  3H3V H;  3NEL A;  1GKH A;  4IJH A;  2QEX A;  4JI3 Q;  4B3T Q;  4A93 G;  3CMA A;  1E3P A;  2K5H A;  1G29 1;  2A19 A;  2R92 G;  4LFC Q;  3F2C A;  1IBL Q;  3HOY G;  3RN2 A;  1PH6 A;  3U4V A;  1U5K A;  4JBW A;  4EX5 A;  3BU2 A;  1XMO L;  1CKN A;  1KC8 C;  1NJI C;  2N78 A;  4PZ6 A;  1GD7 A;  4DV5 Q;  4NXN L;  3CQZ H;  1C0A A;  3S15 H;  3I4M H;  4GN5 A;  3S17 H;  4AQY L;  4OON A;  2UUB L;  3RLN A;  1VQK A;  1I50 H;  5JJI A;  4KHP L;  2WP8 J;  3AQQ A;  2R6G A;  4JI4 Q;  4Y52 H;  3CCL A;  2VS1 A;  4NXN Q;  2MO1 A;  4A3J H;  1PH7 A;  3S2H H;  2BH2 A;  4AQY Q;  1EWI A;  1L1O B;  4KHP Q;  4PG3 A;  4AH6 A;  4JI7 L;  2ZM6 L;  1D8L A;  1KD1 C;  1WI5 A;  1CUK A;  5C4X H;  2KEN A;  4GNX B;  5M5X H;  3I4M G;  1FVI A;  4A3F H;  5C4J H;  3L2P A;  2UXC Q;  1YNX A;  3CPW A;  2UUA Q;  3I7F A;  4PMW A;  4QGU A;  2ZJR A;  1PH9 A;  4JI7 Q;  1R9T H;  4JI2 L;  4LF8 L;  1Y14 B;  1A0I A;  5IWA L;  2ZTD A;  2FXQ A;  5GAG C;  4JI5 L;  3E9I A;  3JAM c;  3SGI A;  4GNX A;  5K36 G;  1Q8K A;  1Z9F A;  3M4P A;  4KHZ A;  3STB D;  2YV5 A;  1N8R C;  1ASZ A;  1XJV A;  4LUZ A;  4A3D H;  1E1O A;  3EN2 A;  4A3E H;  1VQO A;  2JA7 H;  1YJ9 A;  5IWA Q;  1OXU A;  1Q81 C;  3AFQ A;  4BA1 I;  3UDG A;  4JI5 Q;  1L1O C;  5AJ3 Q;  5C4X G;  2E8G A;  5FLM G;  1UE1 A;  5FJ8 H;  4A3F G;  1EOV A;  1IBK Q;  3PUY A;  3HFZ B;  4DV1 L;  2UUC Q;  1VQH A;  1M1K C;  2RHQ B;  2NN6 I;  4GNX C;  1VQM A;  3GTM H;  4GLV B;  5IP7 H;  3TRZ A;  1LTL A;  3CCR A;  1HNX L;  3KLW A;  2EQS A;  4NPS A;  4DV3 L;  4DV1 Q;  1K73 C;  3GTP H;  4BY1 G;  3S14 H;  3PUX A;  5C3E H;  4A3E G;  1X3F A;  1TXY A;  2JA7 G;  4DV0 Q;  4POG A;  4IOC A;  4OO1 I;  4P74 A;  4GOP B;  4JBK A;  2LXJ A;  3HOW G;  3I4N H;  2EXD A;  3K8A A;  2K5N A;  1D7Q A;  1IZ6 A;  3S1M H;  1GO3 E;  4DV6 L;  4JI6 Q;  2RHS B;  2NZH A;  2D0P A;  3KF6 A;  1CKM A;  2ZTC A;  5IYC H;  1J5E L;  3HKZ E;  1W2B A;  4DR2 Q;  4GOP A;  1OTC A;  1EIY B;  2F4V L;  1A8V A;  4GS3 A;  1MJE A;  4P71 A;  1PFS A;  4R4O A;  1OXS C;  4DV6 Q;  2I0Q A;  3KFU A;  4X6A H;  1EQR A;  4L5S A;  3PF5 A;  2F4V Q;  1KXL A;  4UPA A;  3EBE A;  1EQQ A;  3KF8 B;  3LGJ A;  1N34 Q;  1HR0 L;  2VL6 A;  4A3G H;  1S3O A;  1NE3 A;  3HKS A;  4R4C A;  2AMC B;  4GOP C;  4A3K H;  2YU9 H;  3CCM A;  4JBM A;  2Q2H A;  3S1Q H;  4GKK Q;  2R93 H;  2AKW B;  1FJG Q;  4DR7 L;  5IP9 H;  4HJ9 A;  1HR0 Q;  1X6O A;  4JYA L;  2A1A A;  3UDX A;  2VQF Q;  4X65 L;  1TWF H;  2CQO A;  1B8A A;  3K81 C;  2UXD Q;  4YWK A;  2PQA B;  1YJN A;  1S40 A;  1PYS B;  1SR3 A;  3GTQ H;  3M4O H;  2R7D A;  5BR8 Q;  1HZ9 A;  4DR7 Q;  3T1H L;  2NVY H;  3J7A 5;  4RG1 A;  2H5X A;  4JYA Q;  4LF6 L;  2EIF A;  4X65 Q;  2LSS A;  4GKJ L;  1TWG H;  4JG2 A;  1AE3 A;  1PH2 A;  1VQL A;  2JA5 H;  2HQL A;  2JA9 A;  2MQH A;  3RN5 A;  4LF5 L;  3T1H Q;  2VW9 A;  1HZB A;  5IP9 G;  4GLX A;  4OWW B;  4LF6 Q;  2Q2I A;  2Q2T A;  4YCW A;  5M3F H;  4X62 L;  3CAM A;  1M90 C;  4BA2 I;  4YCU A;  4LF5 Q;  2IT1 A;  2HIX A;  1E7Z A;  4NXM L;  4DKA C;  1X56 A;  1WOC A;  2WFW A;  1XNR Q;  4DUZ L;  1PH4 A;  5ELN A;  3PO2 G;  5E7N A;  4A3B G;  4JI3 L;  4X62 Q;  1QVG A;  2VY3 A;  4POF A;  4IPC A;  4NXM Q;  4LFC L;  3FKI G;  1IBL L;  1SLJ A;  2I5H A;  2ZJQ A;  2CFM A;  3KDF A;  3W5O A;  1C9O A;  2VNU D;  2ZJP A;  1K83 H;  4XIG S;  5M3F G;  4MNO A;  2R7Z H;  4APV A;  1N9W A;  3HOZ H;  1YBY A;  1VQ6 A;  3L7Z C;  3PIO A;  3T1Y Q;  4DV5 L;  5IYD H;  3GTO H;  4MZ9 A;  5J3B A;  4FDB A;  3S24 A;  5DLQ E;  1PH5 A;  1AE2 A;  2IHE A;  5GAE C;  3K7U C;  1L2F A;  1RL2 A;  2E5L Q;  3GTK H;  3U58 A;  2E2I H;  1Y1W H;  1I94 Q;  3CW2 C;  5M5W H;  2KBN A;  4JI4 L;  3DLL A;  3CCV A;  1W3S A;  3HOU H;  2B3G A;  4LFB Q;  4LWC A;  4K0K L;  5IE8 A;  2Y0S E;  4QJF A;  3HOZ G;  2R7Z G;  3NEM A;  4DK6 C;  1H95 A;  2ZTE A;  4P73 A;  3MEF A;  4K0K Q;  4A3I H;  4DV4 Q;  4DAY B;  2PNH A;  1A62 A;  2UXC L;  1K9M C;  3JAM i;  1BKB A;  2UUA L;  1YHB A;  5IYB H;  4B3S L;  4WJ3 M;  3CP0 A;  1Y1W G;  1Z47 A;  4JBJ A;  1OXV A;  2VQE Q;  1YEZ A;  2MO0 A;  3TS0 A;  1NBW A;  2JA6 H;  4LF7 Q;  1VS0 A;  5C0X I;  1EYG A;  3CD6 A;  1QVF A;  4JOI C;  3UDI A;  1HH2 P;  1L1O A;  4B3S Q;  3TEH B;  4XTC S;  3PO3 H;  4QIW E;  2AHO B;  4BXX H;  4IPD A;  1V9P A;  2V1C C;  2IX0 A;  4IPH A;  5AJ3 L;  4DR3 Q;  4A3J G;  2NVQ H;  2GN5 A;  3ICE A;  2OTL A;  4IFD J;  5JJL A;  5JEA G;  3ERS X;  1IBK L;  1IXR A;  2NN6 G;  1CSQ A;  2UUC L;  1Q46 A;  4AIM A;  3OW2 A;  2VUM H;  4WJ4 A;  4HIK A;  2Y0S G;  4LFA L;  1SN8 A;  4C3J H;  3CCS A;  4A76 A;  3F1Z A;  2UXB L;  1QUQ B;  4QL5 A;  1LYL A;  4YWL A;  1UWV A;  1X9N A;  2RCN A;  3EIV A;  3FHW A;  3A5U A;  3S16 H;  1NTG A;  4OX9 Q;  3PO3 G;  2ASB A;  3HOV H;  2GVB A;  4JC0 A;  4LFA Q;  4OO1 G;  4DV0 L;  1HZC A;  2C35 B;  2KHJ A;  2UXB Q;  3AYH B;  3H0G H;  3GDE A;  1GVP A;  1C7Y A;  1B70 B;  5GRO A;  4JI0 L;  4A3D G;  1VQ7 A;  2PI2 E;  2VUM G;  4JI6 L;  3I2Z A;  3K0X A;  2WAQ G;  1G6P A;  3RNU A;  5M5Y H;  4IJL A;  1XPR A;  4DR2 L;  2IX1 A;  4HJ8 A;  4X64 Q;  5FJ8 G;  4LNQ A;  1SFO H;  1WCM H;  5GAH C;  4IOA A;  3UE0 A;  5IP7 G;  1K8G A;  3HOV G;  5ELO A;  1BVS A;  1NMG A;  4DR5 Q;  1KHI A;  4LUO A;  4BBS H;  1VQ4 A;  4JV5 Q;  5IY0 A;  4HJ5 A;  1N34 L;  1LM0 A;  2KCT A;  3H0G G;  4BBR H;  1Q86 C;  2JE6 I;  2JK8 A;  1E22 A;  4B3R L;  2E2H H;  5C3E G;  1XPO A;  4UP7 A;  3UDF A;  4GKK L;  5LMN L;  1J6Q A;  2BA1 A;  1FJG L;  3I4N G;  1SRU A;  4P75 A;  1YHA A;  3CXC A;  4B3R Q;  2VQF L;  1WCM G;  4DNI A;  3F2B A;  2B63 H;  1VQA A;  5LMN Q;  1PVO A;  4LUV A;  3VDY A;  5IYC G;  5BR8 L;  3WWV A;  1X55 A;  3G6E A;  1WJJ A;  2OQ0 A;  4DUY Q;  1V1Q A;  4LF9 Q;  3I4O A;  3JC6 6;  1K3R A;  3G4S A;  1E24 A;  1HNW Q;  4A75 A;  1HJP A;  1I3Q H;  1EFW A;  4A3G G;  4UY8 C;  3KJP A;  4GLA C;  3GTL H;  5GQO A;  4O0A A;  3BZK A;  2PQA A;  3G48 A;  4R4T A;  4A3K G;  1VQG A;  4PZ7 A;  2K75 A;  2R93 G;  2B63 G;  1B7Y B;  5JEA J;  4A3L H;  2AWN A;  1N33 Q;  1XNR L;  1MIU A;  2I5M X;  4RMF A;  3M85 A;  2L15 A;  1HZA A;  4MTN A;  1UE6 A;  3E0E A;  4B3M Q;  4DR1 Q;  5LMN W;  4DAM A;  4IPG A;  1JB7 A;  4YY3 Q;  2N3S A;  4HIM A;  1WYD A;  1KRS A;  3I56 A;  2Q2U A;  4DR6 Q;  3J80 c;  1QZH A;  1JMC A;  2JA5 G;  3Q8D A;  3B6Y A;  1BBW A;  3T1Y L;  2UU9 Q;  1PH1 A;  4A3L G;  3PCO B;  3ULJ A;  2XTI A;  4LW1 A;  3PF4 A;  2MNA A;  4HJA A;  4LF4 L;  3J81 c;  1SMX A;  4JI1 L;  1VQE A;  3U50 C;  2E5L L;  1I94 L;  1PYB A;  3CPF A;  3S2D H;  1JE5 A;  1VQC A;  3A74 A;  5LMU L;  3MXN B;  5HGQ A;  1XPU A;  4LFB L;  4LF4 Q;  5GAD C;  4JI1 Q;  3KOJ A;  4R4I A;  1YHQ A;  2CWP A;  2JEB I;  1T9H A;  1X3E A;  1KRT A;  3ULP A;  1S72 A;  1P8L A;  1CSP A;  4R1J A;  4R4Q A;  4YHH Q;  5LMU Q;  1Q7Y C;  1N32 Q;  3KJO A;  3FP9 A;  2UXD L;  4DV2 Q;  4DV4 L;  1EIF A;  2ATW A;  4GN4 B;  2NVT H;  1PA6 A;  1VQN A;  1VQB A;  5H1S E;  4QY7 A;  1YI2 A;  4JOI A;  2KHI A;  2QGQ A;  1CKO A;  2VQE L;  4ME3 A;  4DR4 L;  2N8N A;  5C0X G;  1CKN B;  4LF7 L; 
#chains in the Genus database with same CATH topology
 2ENB A;  1B50 A;  3S16 B;  5EJW A;  5JPM C;  3M4Q A;  2I5L X;  3F2D A;  1VMP A;  1KNE A;  2WAQ E;  4ZK9 B;  2AQ2 B;  4RHR A;  1N36 Q;  3L3O C;  1XMO Q;  3BDC A;  1PV4 A;  2DY8 A;  4IO9 A;  4DK0 A;  3E6Z X;  4ZAI A;  2UUB Q;  1FGU A;  4XQQ A;  1BCP D;  4BBS B;  4TQU S;  5FLM H;  1VQ8 A;  3TDQ A;  2E2H B;  1PTO F;  1HQR D;  1UAP A;  5KYI A;  4DV7 Q;  1YJW A;  2K50 A;  5C44 H;  1H9S A;  1QUQ A;  1TT2 A;  2JQO A;  3GD7 A;  3OWE B;  4UP8 A;  2Z0S A;  4GN3 B;  3K59 A;  2B63 B;  4DR5 L;  1F2M A;  4JI2 Q;  4C2M H;  1SE2 A;  4CGY B;  4C3I B;  4H02 A;  3T53 B;  2ZXR A;  1DGS A;  4KLK A;  4ULL A;  1PRT F;  4IZ8 A;  3ERQ A;  3GTL B;  5EPK A;  3RR5 A;  4G7H C;  1PHJ A;  1EUJ A;  3KYH C;  3LNN A;  5I2X A;  4DUY L;  5IOC A;  3KF6 B;  1P16 A;  1Y1V G;  3CCU A;  3RLO A;  5HY6 A;  5JJK A;  1KDB A;  4K5X A;  4C1N I;  1O7L A;  2A68 D;  2H1E A;  2NYZ D;  2HIV A;  2K52 A;  3K80 C;  1GUW A;  5D3I B;  3RLF A;  3VYS A;  3AFP A;  1UE7 A;  1YNJ C;  1N33 L;  1JE4 A;  1LTA D;  5F2D A;  3A8K E;  3A0J A;  4X66 Q;  1X3G A;  4B3M L;  4DR1 L;  1X65 A;  3CRL C;  3S2D B;  2EYM A;  1O7I A;  4YY3 L;  2OWO A;  3KK7 A;  2Z4H A;  1KAA A;  3R3O A;  5C3W A;  1JCK B;  4B08 A;  3R8B A;  1CA5 A;  1T5E A;  1JJG A;  3SK6 A;  3J81 j;  3PUV A;  5ELF A;  2HT1 A;  3PO2 H;  4Z9C B;  4HMJ A;  1BUV T;  3M3Y H;  4IFD G;  2LY7 A;  5FOB B;  2B2W C;  1UE5 A;  1LT6 D;  2B2V A;  4NDX A;  2PMZ E;  2JA8 G;  4OXP A;  3FKI H;  3MXU A;  3C1E A;  2YYZ A;  3VR4 A;  4XYO A;  5FLX L;  1PH3 A;  1TWC B;  4L5R C;  1JOR A;  3CC2 A;  5DM6 3;  5T1G A;  4F88 A;  2Z8L A;  3DM3 A;  4B3T L;  3MXN A;  2F0G A;  1MKH A;  5EBD A;  2EVB A;  3W1G A;  1ZYR C;  3TS2 A;  3J7Z C;  1UEB A;  3E9H A;  4BY7 B;  3S2H B;  2QEX A;  3H94 A;  1G29 1;  1Q90 A;  3VYR A;  2XVS A;  1TII D;  5C4X B;  1PH6 A;  1U5K A;  4JBW A;  3EJI A;  1XMO L;  2WIN B;  1SMY D;  4TRD A;  2X6G A;  3CQZ H;  3EA6 A;  1NNX A;  1U4L A;  2PNR C;  2UUB L;  3K5O A;  3NHH A;  4BY1 B;  2HUG A;  1B4O A;  4NXN Q;  2VS1 A;  1DOM A;  3HOW B;  1L1O B;  4AH6 A;  2JN4 A;  1KD1 C;  1RCV D;  2KEN A;  4GNX B;  3CPW A;  3I7F A;  4JI7 Q;  2DJF C;  2CHB D;  4JI2 L;  3ZYY X;  4OO1 H;  1A0I A;  5IWA L;  3JAM L;  4JI5 L;  1EQT A;  1Z9F A;  1N8R C;  1XJV A;  3IL8 A;  4A3D H;  3EN2 A;  2JA7 H;  2KVM A;  3AFQ A;  4BA1 I;  1RHP A;  1TY0 A;  5FLM G;  4RCO A;  1UE1 A;  5FJ8 H;  1TS3 A;  1EOV A;  3HFZ B;  4DV1 L;  1M1K C;  1HCZ A;  3TRZ A;  2NN6 I;  3GTM H;  4GLV B;  4OGQ C;  3KLW A;  2A69 C;  1VMC A;  1K73 C;  3K5L A;  3S14 H;  3PIP 3;  4A3E G;  3NUC A;  2K5W A;  4IOC A;  3GTG B;  4P74 A;  4C3H B;  1ICF B;  3BYT B;  3I4N H;  3K8A A;  1O80 A;  2RCF A;  4JI6 Q;  3KF6 A;  2F0Q A;  2PZW A;  4DR2 Q;  1MJE A;  4A3B B;  4R4O A;  2I0Q A;  1I4P A;  4IUR A;  3AMU A;  4A3G H;  1HR0 L;  2PW7 A;  1S3O A;  1EU4 A;  2SOB A;  4HMI A;  3CCM A;  4JBM A;  5EPL A;  3S1Q H;  2R93 H;  4GKK Q;  2F0K A;  5CYU A;  1CM9 A;  3S1N B;  3DEO A;  2ZT9 C;  2PCF B;  3MFG A;  1ILQ A;  3K81 C;  2PMZ B;  1B8A A;  5EGT A;  4YWK A;  2KUM A;  3GTQ H;  1PYS B;  1RTO A;  1SR3 A;  2R7D A;  4DR7 Q;  1KNA A;  2CQA A;  1S4Z A;  3CHB D;  4OIJ A;  1MGS A;  1K83 B;  3DWQ A;  3RN5 A;  2R7Z B;  2F0U A;  3T1H Q;  5ELC A;  5CBE E;  1AW7 A;  5EBC A;  5M3F H;  4X62 L;  1CA6 A;  4YCU A;  3DWP A;  4WOR A;  2IT1 A;  1Y8N B;  4DKA C;  1X56 A;  5JOB A;  1WOC A;  5ELE A;  3PO2 G;  1NUC A;  4K8I A;  1ESF A;  3QOL A;  1V1O A;  2K6A A;  4NXM Q;  4ME5 A;  1CI3 M;  2JSO A;  3FKI G;  1C48 A;  1SLJ A;  2I5H A;  1EY8 A;  1XWE A;  2RDF A;  1EWC A;  2VNU D;  2ZJP A;  5FKA C;  1YBY A;  3T1Y Q;  5IYD H;  4EGV A;  4MZ9 A;  3GTO H;  5J3B A;  1HUM A;  5DLQ E;  2IHE A;  5C4J B;  1SNQ A;  2E5L Q;  2SNS A;  1PTO H;  2KBN A;  4ZCK A;  1W3S A;  1HTL D;  3RMH A;  3NTH A;  5T1I A;  1EY7 A;  3NEM A;  3NP8 A;  5FLX E;  1D2B A;  4K0K Q;  2EY6 A;  2PNH A;  1A62 A;  1LT3 D;  1JR0 D;  1YHB A;  4FNF A;  3T56 B;  4WRD A;  1YEZ A;  4ZKC B;  1NR2 A;  3I73 A;  2O2L D;  5C0X I;  4DAY A;  1QVF A;  1TQO A;  1HH2 P;  1L1O A;  3TEH B;  3IFD A;  3GTP B;  4UDU C;  1X3P A;  4IPD A;  1V9P A;  5DNF A;  5C3X A;  2GN5 A;  5JJL A;  2L5T A;  1CSQ A;  1Q46 A;  2Y0S G;  5BN3 A;  3NXW A;  3CCS A;  3TP6 A;  4IUU A;  3MAQ A;  3A54 A;  1PFB A;  4QUC A;  4ID6 A;  4YWL A;  4N9P A;  4G4K A;  2RCN A;  3A5U A;  1NTG A;  3HZX A;  1BCP B;  4K5W A;  4OX9 Q;  3NPP A;  3HOV H;  3PO3 G;  1IKM A;  4JC0 A;  4OO1 G;  1HZC A;  3HEJ A;  1HQM C;  1ICW A;  3GDE A;  4CJ2 C;  4KTA A;  4FXG C;  5GRO A;  5IGD A;  4A3D G;  1VQ7 A;  2VUM G;  4A3K B;  4JI6 L;  5M5Y H;  2IX1 A;  4DR2 L;  4C3J G;  1LTG D;  1LT4 D;  5FJ8 G;  3OWF A;  2K5Q A;  1WCM H;  4IOA A;  4RGO S;  3UE0 A;  1BVS A;  2WKC A;  4LUO A;  4HJ5 A;  1F9Q A;  4BBR H;  1Q86 C;  2QCP X;  3QR8 A;  4K8J A;  3UDF A;  4GKK L;  2AQ3 B;  3I4N G;  1STE A;  1AZQ A;  1R4Q B;  2F0I A;  4K2K A;  4NP5 A;  3F2B A;  1IW7 D;  2AQ1 B;  5G3L F;  1X55 A;  1ET6 A;  3U9O A;  1A3T A;  3K58 A;  4CDE C;  3HS0 C;  4LF9 Q;  3JC6 6;  5BN5 A;  2X6L A;  2F0V A;  4G7O C;  3G4S A;  1HNW Q;  2JXM B;  4C1N K;  1ENF A;  1WTW A;  2L1B A;  4A3G G;  2PW5 A;  5CC4 A;  3C2P A;  3G48 A;  4PZ7 A;  2C5C A;  5ELB A;  3R93 A;  2R93 G;  2B63 G;  1B7Y B;  3HG9 A;  3OPO A;  4WFN 3;  4KK7 A;  3BVG A;  2AWN A;  1MIU A;  1STG A;  1PTO D;  2L15 A;  1HZA A;  4K6L A;  1WTR A;  1F2L A;  2E2I B;  1Y1W B;  3KBG A;  5LMN W;  5CBA E;  4IPG A;  1JB7 A;  1EEF D;  3HOU B;  4HIM A;  1ML0 D;  3J80 L;  2DJG C;  1QZH A;  1JMC A;  3B6Y A;  3T1Y L;  5C6A A;  1TS4 A;  2WII B;  2MNA A;  1PRT D;  4F7X A;  3FPU B;  1SMX A;  4QB4 A;  2E5L L;  3SK8 A;  3LWE A;  1CQV A;  4QUF A;  5GAD C;  3FEW X;  3KOJ A;  4JI1 Q;  2JEB I;  1KRT A;  1S72 A;  4X3U A;  1Q7Y C;  4R1J A;  1CSP A;  2XWJ B;  4YHH Q;  2HD3 A;  3H91 A;  1N32 Q;  1NSN S;  5IGG A;  2UXD L;  4DV2 Q;  1EZ6 A;  3NSW A;  1EIF A;  2NVQ B;  4DGZ A;  5H1S E;  2F0D A;  4JOI A;  3V2T A;  2KHI A;  2QGQ A;  2TMP A;  4ZLT F;  4DR4 L;  5M5X H;  3SXH A;  5IYD G;  1G2S A;  4JI0 L;  2LS0 1;  3D31 A;  2CW0 D;  2KCN A;  2K4K A;  4RA8 A;  2IJ0 A;  3V96 A;  4JI8 Q;  1E1T A;  2D62 A;  5C44 B;  1MBY A;  1NMF A;  3ZJY C;  3AEV A;  4KKT A;  3M9B A;  2WB1 E;  2G9D A;  4N9T A;  1B3A A;  3PV0 A;  2K14 A;  4OX9 L;  2ICI A;  1SFO B;  1CZG A;  4A3M G;  1VQJ A;  1A3U A;  1LLR D;  1WD0 A;  2EOT A;  4UP9 A;  1U4M A;  4P72 A;  5M3M G;  1QOH A;  1Q82 C;  2ZM6 Q;  4XT3 B;  1B9N A;  3T16 A;  3BZC A;  1EYC A;  2LXK A;  1KAW A;  2A73 B;  4BY7 G;  3QJY A;  3CCQ A;  1I6H H;  3EQL C;  1I5F A;  3MEH A;  1TVX A;  3T51 B;  1Y1V H;  1SYB A;  1CK1 A;  4HID A;  3HOX G;  2HHH L;  1VQD A;  2G9H D;  3DHQ A;  1A3V A;  1HUN A;  4Y7N H;  1MSG A;  1W6K A;  1SEB D;  3EVQ A;  2KCM A;  1YNJ D;  1BOS A;  3PUW A;  3OHX C;  4CKC A;  3SVM A;  5FO7 B;  2D5D A;  3SDZ A;  2JJQ A;  4LF9 L;  2HCC A;  3MFY A;  2Z6K C;  2E2J H;  3MVV A;  1HNW L;  1JT8 A;  5C0X J;  4KJN A;  4ZQ3 A;  4BBR G;  3I8Z A;  3Q24 A;  3GTJ H;  1ZEQ X;  4DPG A;  4DXF A;  4HIO A;  5CV7 A;  1YIT A;  4A4I A;  5LL6 X;  1SYG A;  2ALY B;  1F9S A;  4IFD H;  3IRB A;  3PQI A;  2JA8 H;  3QB3 A;  3ULL A;  4AYB E;  1OXT A;  2GA4 B;  1JJ2 A;  4OWT B;  2NVX H;  3J81 i;  2BE5 D;  1DOK A;  2D2C C;  3MA2 B;  1YVC A;  2EJG C;  4YIJ A;  1YZ6 A;  4C56 C;  1LUZ A;  5AFW A;  3RZO H;  2TSS A;  3A56 A;  1VQ5 A;  2NVT B;  1WFQ A;  2XSC A;  2NBF A;  2IHF A;  4C3J B;  1BNZ A;  5E4X A;  4YWM A;  3QG1 A;  1SE4 A;  4MN3 A;  4C3H G;  4FF1 A;  3QO2 A;  2Q8I B;  1S5F D;  3A5Z B;  2YTX A;  3CC7 A;  4YHH L;  1VQP A;  5FLX c;  3CCJ A;  2H4O A;  2RVL A;  1KIX A;  1VQI A;  3D3R A;  1N32 L;  1JJC B;  5I4D A;  4DV2 L;  1RJT A;  1S5C D;  2OTJ A;  5IT9 c;  4H44 C;  1YIJ A;  1HR0 W;  3D6C A;  1TU2 B;  1TWH H;  4K2L A;  3S9W A;  3D0F A;  3S1R B;  2B2U C;  1A63 A;  1S5B D;  4QF4 A;  3IFT A;  1AH9 A;  3H3V H;  1E2W A;  2CKZ B;  1GKH A;  4B3T Q;  3CMA A;  1E3P A;  1ENA A;  1LTR D;  2A19 A;  3F2C A;  1IBL Q;  4ODG A;  3HOY G;  3RN2 A;  2KOL A;  2WB1 B;  5CGK A;  3U4V A;  4EX5 A;  2EYL A;  3J80 E;  1CZW A;  1X32 A;  4DV5 Q;  1C0A A;  1LTT D;  4GN5 A;  3S17 H;  5FO8 B;  3RLN A;  4EVO A;  1I50 H;  4KHP L;  3AQQ A;  2R6G A;  4A3J H;  1K8O A;  5JEA H;  4RGM A;  3TME A;  2ZM6 L;  1PZK D;  2A69 D;  1BO0 A;  4PMW A;  3S14 B;  4NMZ A;  3TP7 A;  3JAM c;  3SGI A;  1Q8K A;  3P75 A;  3STB D;  3AB9 A;  1E1O A;  4A3E H;  1GUS A;  4RFB A;  5IWA Q;  1OXU A;  2AUJ D;  4JI5 Q;  1L1O C;  2JP1 A;  2NWG A;  3PUY A;  1VQH A;  3BDL A;  4GNX C;  1JC7 A;  1ROD A;  5EKI A;  4DV1 Q;  5C3E H;  1ONL A;  2EYO A;  4POG A;  3NWT A;  4PNY A;  4JBK A;  2EXD A;  4J8Q A;  5COY A;  1JWS D;  1CKM A;  5IYC H;  1W2B A;  2HCI A;  4GOP A;  2K7V A;  4RHS A;  1CT1 D;  3K7A B;  4P71 A;  3RZD B;  4RGT A;  3UI2 A;  2RDG A;  2XRS D;  5CV4 A;  1EY0 A;  4AYB B;  3KLR A;  1GHJ A;  1GUO A;  4L5S A;  1D5Z C;  3G6J B;  4UPA A;  1SDF A;  1KXL A;  3KF8 B;  3LGJ A;  2VL6 A;  3D4R A;  3BS1 A;  1NE3 A;  1F77 A;  3NQT A;  4R4C A;  1BF4 A;  4A93 B;  2Q2H A;  2AKW B;  1MD2 D;  2R92 B;  1HR0 Q;  4F87 A;  1EIH A;  4JYA L;  1PZI D;  3UDX A;  4X65 L;  1TWF H;  2CQO A;  1YJN A;  3M4O H;  2OXP A;  5BR8 Q;  1HZ9 A;  2A6E D;  4LAA A;  4RG1 A;  4IUQ A;  2EIF A;  2LSS A;  1TWG H;  4CKE A;  5KIX A;  1AE3 A;  2D9U A;  4CHT B;  2HQL A;  2JA5 H;  5C4H A;  4LF5 L;  3URY A;  1HZB A;  4GLX A;  1U9R A;  3RUZ A;  1UNS A;  4X3T A;  4X3K A;  2Q2T A;  2RBM A;  1E7Z A;  1PTO B;  2I46 A;  1M8A A;  4G7Z C;  3S15 B;  5E7N A;  3I4M B;  3TP8 A;  5ISR A;  4X62 Q;  1QVG A;  2VY3 A;  4IPC A;  3A8I E;  2B2T C;  1IBL L;  2ZJQ A;  2CFM A;  2VXW A;  3W5O A;  2CVR A;  3DMU A;  4M1U B;  3NWS A;  4RKL A;  4MNO A;  2DY7 A;  4DAP A;  2NZ1 D;  1PRT B;  2R61 A;  2RQX A;  4KY7 A;  3SR1 A;  4DV5 L;  1Q3L A;  4FDB A;  3S24 A;  2EZV A;  1IL8 A;  1L2F A;  1RL2 A;  4A3F B;  3GTK H;  3CW2 C;  5M5W H;  1R9T B;  3T4A C;  2XIW A;  2B3G A;  2DNE A;  4QJF A;  1O7Z A;  2PZU A;  4O1N A;  3HOZ G;  1H95 A;  2ZTE A;  5I2Y A;  3MEF A;  4A3I H;  2OEO A;  4DV4 Q;  1SND A;  4DAY B;  1K9M C;  4WJ3 M;  1Y8P B;  1Y1W G;  2MO0 A;  3HOV B;  2JA6 H;  1LTS D;  3CD6 A;  2EYJ A;  4JOI C;  1HRJ A;  3UDI A;  4HSV A;  1WTQ A;  4XTC S;  3PO3 H;  4BXX H;  2A6H C;  2KHS A;  1K0S A;  2RDH A;  1LTI D;  2V1C C;  2IX0 A;  5CV6 A;  4DR3 Q;  1JB3 A;  4A3J G;  5JEA G;  3ERS X;  1IXR A;  1AP0 A;  4WJ4 A;  1CQF A;  2VUM H;  3S1M B;  1WCM B;  4C3J H;  1AFP A;  3F1Z A;  4IUT A;  4XYQ A;  2UXB L;  2F0N A;  4QL5 A;  1DON A;  3I90 A;  1UWV A;  2SEB D;  4J6H A;  3EIV A;  3FHW A;  3S16 H;  3OSO A;  1GJX A;  5KEE A;  3AYH B;  1STA A;  1GVP A;  4X3S A;  1ILP A;  1KLG D;  2YU9 B;  5E3F A;  1G6P A;  3RNU A;  4IJL A;  4N8F A;  2IW3 A;  4X64 Q;  4BWG B;  1TS2 A;  5GAH C;  4MTK A;  2FIN B;  1FYC A;  4JPB W;  4B9X A;  4BBS H;  4JV5 Q;  2EYH A;  1VQ4 A;  1LM0 A;  1BCP C;  1F2Y A;  5JAV A;  2JE6 I;  1FNV A;  2E2H H;  5C3E G;  5DM7 3;  5IGC A;  1K3B C;  3E3X A;  4PV1 C;  3C46 A;  4K5V A;  1G91 A;  2B63 H;  3VDY A;  5IYC G;  5BR8 L;  1QJO A;  3KF8 A;  3VYT A;  1WJJ A;  1FGB D;  1FNU A;  1V1Q A;  3I4O A;  2IPK D;  1K3R A;  1HFG A;  1E24 A;  4A75 A;  4RAU C;  1EFW A;  2XN9 C;  4GLA C;  3GTL H;  3WOE A;  4DU9 A;  3A8J E;  5A2Q E;  4OEM B;  1GUN A;  1VQG A;  4CJ0 B;  3DM1 A;  2BCO A;  2B39 A;  3G7L A;  2F0J A;  2I5M X;  3D6W A;  4KY6 A;  3DEP A;  2J0T D;  5CV9 A;  2NTS A;  4FXK C;  1H9R A;  4DAM A;  4FF3 A;  1CFM A;  1WYD A;  4MHE A;  2BDN A;  2A68 C;  3J80 c;  2JA5 G;  2PYK A;  1ZXT A;  4R8I A;  1YNN D;  2CH4 A;  4A3L G;  2E74 C;  3PCO B;  3ULJ A;  5FK9 C;  3VR6 A;  3X3M A;  1SAP A;  2E2D C;  4BS9 A;  4F8M A;  3S2D H;  2F0M A;  2KEC A;  3W3A A;  4TKO B;  4R4I A;  1QNK A;  2CWP A;  1X3E A;  2L12 A;  3SEB A;  3ULP A;  1WTX A;  4K14 A;  4H7B A;  3KJO A;  1Z6H A;  4DV4 L;  2ATW A;  3L9A X;  4GN4 B;  1PA6 A;  2QDB A;  4KN7 C;  4FYD A;  3QWN A;  4L6T B;  1YI2 A;  4S3S A;  2FMM A;  1LO5 D;  2UXD Q;  2L11 A;  1CKN B;  1K8M A;  5EKL A;  1Q1B A;  3VR2 A;  4CDD C;  3PIP A;  1VDZ A;  2B8G A;  1TWA H;  1JOO A;  1TWC H;  1X54 A;  2F1M A;  1WTP A;  4DR4 Q;  4A3M H;  4JI0 Q;  4DR3 L;  2VB3 X;  5IIF A;  3H0G B;  2NUC A;  4OWX B;  2ICE C;  1IBM L;  1U4P A;  4P2C B;  3OTO L;  3J81 E;  5M3M H;  2MJ8 A;  1M4V A;  3BJU A;  2DGY A;  1I6V C;  4A3I G;  1VCI A;  3PGZ A;  1RIP A;  4BY7 H;  4QQB X;  4LMQ D;  3H3V I;  3TQY A;  3ER0 A;  3MXP A;  2B29 A;  5TSS A;  1JWU D;  4NB3 A;  1HNZ L;  1QVC A;  3LWU A;  2JA6 G;  3M7N A;  4RGN A;  3HOX H;  3OW7 A;  1VQF A;  1K8A C;  1XMQ L;  3IKJ A;  4BXX G;  1SE8 A;  3GO5 A;  2Z6B A;  2IY5 B;  1RKN A;  2F3I A;  2NZO A;  4A3C G;  1EU3 A;  3FDT A;  2AWO A;  2PI2 A;  4X64 L;  2EPB A;  1LT5 D;  3PIO 3;  2XGT A;  1ASY A;  4PZ8 A;  5EKK A;  4BY1 H;  4JV5 L;  2KQ3 A;  2MFI A;  2WB1 G;  3HOW H;  1R4P B;  4HAE A;  1JIC A;  2L9H A;  3GTJ B;  2CWA A;  2QA4 A;  1EY5 A;  3VR3 A;  3U4Z A;  2FJ2 A;  2HHH Q;  3BVM A;  1B1Z A;  1Q8I A;  1XNQ L;  3CME A;  3OIP A;  1XTD A;  4BBS G;  4EQO A;  5JPN C;  4ZRZ A;  5D3D A;  3F8T A;  3MC0 B;  3CF5 A;  3ONA B;  5JJZ A;  2L55 A;  4J1M A;  3SE0 A;  1J5E Q;  3G71 A;  1I4G A;  2QW7 A;  1SNC A;  3UE1 A;  2GVA A;  4EQN A;  2N49 A;  4YCV A;  4C3I G;  2J7Z A;  4DF7 A;  3GTG H;  4C3H H;  2B2W A;  2K33 A;  3OMG A;  2F0E A;  5HUR A;  1A2U A;  1IL2 A;  5J22 A;  1DYQ A;  3NBH B;  4XT1 B;  2J4X A;  5NUC A;  5D65 A;  2CCZ A;  1MHW C;  3MWY W;  4A3B H;  1C8C A;  2EE1 A;  3I3C A;  2K28 A;  1BR9 A;  1H9M A;  2A5H A;  2QDL A;  3NK9 A;  1GHK A;  2WAC A;  3OOC A;  3O13 A;  1QWY A;  2M9V A;  2R7F A;  4GKJ Q;  1LTB D;  1VQ9 A;  5I6Y A;  2FMC A;  5C5M A;  1OXX K;  3F2U A;  3S1N H;  3HOY H;  2MP1 A;  2B2V C;  3KDF B;  4O2D A;  4V0B A;  4L5T A;  4AYB G;  4O42 A;  3CU7 A;  3NEL A;  4JI3 Q;  1S5D D;  4KD4 A;  4A93 G;  3H6M A;  2R92 G;  4LFC Q;  2F0L A;  4TSS A;  3VA5 A;  1SE3 A;  1HXY D;  1CKN A;  1RD9 D;  1KC8 C;  2OF1 A;  4CDC C;  3ND8 A;  4PZ6 A;  3HGB A;  1GD7 A;  1VF5 C;  3BDO A;  4AQY L;  4OON A;  3MXG A;  1HTP A;  2BDO A;  5K5P A;  4C2M B;  3CCL A;  1KDC A;  2MO1 A;  3OIQ A;  1RTN A;  3N52 A;  1SYD A;  2HDL A;  5C4Z A;  2NN6 H;  4KHP Q;  3TSS A;  3I4M G;  4HCS A;  5C4J H;  3L2P A;  1PH9 A;  1G6Z A;  3KUP A;  1Y14 B;  1JOQ A;  2FXQ A;  5GAG C;  2PPB C;  5K36 G;  1ASZ A;  4LUZ A;  4JVZ A;  1F2Z A;  1VQO A;  4IAL A;  1UEA B;  1YJ9 A;  2K32 A;  3UDG A;  5AJ3 Q;  5C4X G;  4DFA A;  5COR A;  2E8G A;  4A3F G;  1IBK Q;  2UUC Q;  5IP7 H;  4RWS C;  1EIG A;  4NKL A;  1IKL A;  1XTC D;  1STY A;  1STN A;  1PXU A;  3GTP H;  4BY1 G;  3PUX A;  1VF7 A;  3HKZ B;  3R2I A;  5L37 A;  1X3F A;  3OMC A;  3Q23 A;  1XX8 A;  2E76 C;  3Q22 A;  4OO1 I;  4IN3 A;  4GOP B;  2HQE A;  1MSH A;  2LXJ A;  1WTO A;  3HOW G;  2K5N A;  1D7Q A;  3DXJ C;  1GO3 E;  4DV6 L;  1SJH D;  2D0P A;  3NBI A;  2ZXP A;  2ZTC A;  1J5E L;  2F4V L;  1OTC A;  1A8V A;  2KCC A;  1PLF A;  3PO2 B;  1PFS A;  1OXS C;  3M3Y B;  1EQR A;  3AU7 A;  1C4Q A;  2AUK A;  3FKI B;  4FXD A;  3FPP A;  3HP3 A;  3ITP A;  2AMC B;  3GQB A;  4A3K H;  3A7L A;  2O5J C;  1FJG Q;  4UHV A;  1X6O A;  3RD4 A;  2A1A A;  2VQF Q;  2L0C A;  1S40 A;  2PQA B;  2QF7 A;  1BQQ T;  1HA5 A;  1ZYR D;  4ZUI A;  2NVY H;  2H5X A;  4JYA Q;  4LF6 L;  2HDM A;  4X65 Q;  4GKJ L;  1E0B A;  1PH2 A;  1VQL A;  2JA9 A;  3NBH A;  1STH A;  1V1P A;  5J39 A;  3C3L A;  5IP9 G;  4OWW B;  3A55 A;  5CMD A;  2Q2I A;  1SYC A;  3FVQ A;  4YCW A;  3TBI B;  3CAM A;  1M90 C;  4LF5 Q;  2HIX A;  2Z1C A;  2SNM A;  2WFW A;  1XNR Q;  3CQZ B;  1PH4 A;  5ELN A;  4A3B G;  4ZYS A;  4JI3 L;  4POF A;  4LFC L;  4XXE A;  4KKS A;  3KDF A;  3PMF A;  1C9O A;  2B2Y A;  1L0X B;  4XIG S;  3HOZ H;  1N9W A;  1VQ6 A;  1ZKO A;  5GAE C;  1JOK A;  3K7U C;  2E2I H;  1Y1W H;  3PO3 B;  1I4R A;  3HOU H;  2PO4 A;  2K03 A;  2R7Z G;  4KMU C;  4A3D B;  4P73 A;  2JA7 B;  2XNA C;  2XRQ D;  1WTV A;  1H9K A;  2K01 A;  3NTI A;  1NAP A;  3JAM i;  1PRT C;  1BKB A;  5IYB H;  4B3S L;  3CP0 A;  1Z47 A;  2FFK B;  3GTM B;  4RCN A;  3TS0 A;  1B44 D;  2KJX A;  4LF7 Q;  1VS0 A;  2F4I A;  1EYG A;  1LAC A;  3WOF A;  4QIW E;  2AHO B;  4IUN A;  5KGU A;  2NVQ H;  5AJ3 L;  3CKI B;  1QG7 A;  3I4N B;  2NB0 A;  1IBK L;  1DJR D;  1HHV A;  2NN6 G;  2UUC L;  3FRP B;  4AIM A;  4FF2 A;  2KEE A;  3C1F A;  4LFA L;  4A76 A;  4OEL B;  5CV8 A;  1KLU D;  1X9N A;  5KND A;  2CW0 C;  2ASB A;  2N55 A;  1QB5 D;  2C35 B;  2KHJ A;  2UXB Q;  4A3G B;  2PI2 E;  3WDN A;  3I2Z A;  3K0X A;  5A2Q L;  4FO2 A;  3S1Q B;  2R93 B;  1XPR A;  3N6R A;  1DM0 B;  1GUT A;  4LNQ A;  1SFO H;  2F03 A;  5IP7 G;  1K8G A;  1SNM A;  4HCE A;  3GTQ B;  1NMG A;  1KHI A;  5IY0 A;  1LAB A;  2KCT A;  3H0G G;  5CV5 A;  4B3R L;  5LMN L;  1FJG L;  3V05 A;  4JW0 A;  4IUV A;  1L0Y B;  1SRU A;  3K0Y A;  4P75 A;  4R9W A;  2VQF L;  5M3F B;  1B2T A;  2R3Z A;  4JK1 C;  5ELD A;  3J7A F;  1SYE A;  2EJF C;  2EJM A;  4FP5 D;  1HJP A;  1I3Q H;  2EY5 A;  2F0O A;  1B3Q A;  2PQE A;  1NR4 A;  4O0A A;  5GQO A;  3BZK A;  2PQA A;  1HPC A;  4A3K G;  3R2T A;  3K5N A;  1EQV A;  4A3L H;  3Q0A A;  2A74 C;  1AEX A;  1EY6 A;  4CJ1 B;  3GTO B;  1JWM D;  1XNR L;  1AN8 A;  3TZU A;  3U9S A;  3E0E A;  3SK5 A;  2E75 C;  2N3S A;  1KRS A;  3I56 A;  1EY4 A;  4DR6 Q;  1CTM A;  1BBW A;  2F0T A;  2UU9 Q;  4HTH A;  2XTI A;  4LW1 A;  3J81 L;  3PF4 A;  2Q8R E;  4LF4 L;  3U50 C;  3CPF A;  1PYB A;  1A15 A;  1FD7 D;  1H9J A;  1TWA B;  1JE5 A;  4PMB A;  3A74 A;  5LMU L;  3DWA A;  1DD2 A;  5HGQ A;  5CR3 A;  5IT9 L;  1XPU A;  4A3M B;  1YHQ A;  5J1Z A;  4CKB A;  1P8L A;  4R4Q A;  2BE5 C;  1MI2 A;  3BG3 A;  5M3M B;  5KNC A;  2NTT A;  3KLS X;  5I9O A;  5G3L D;  2NVT H;  2CH4 W;  1B9M A;  4I65 A;  1VQB A;  4QY7 A;  3P7J A;  1CKO A;  4ME3 A;  3E5S A;  2WAQ B;  2N8N A;  5C0X G;  4CDF C;  4OIK A;  4LF7 L;  1E2Z A;  1KL9 A;  4QIW B;  1I4H A;  1O7Y A;  2RKS A;  1BBU A;  3HOX B;  2WKD A;  4DK3 C;  1EYA A;  1JQY D;  1IYJ B;  2YTY A;  4DNR B;  3CCE A;  1N36 L;  3HOU G;  5A35 A;  2EXZ A;  2OQK A;  2A8V A;  4HSP A;  1PFM A;  1Q12 A;  4KV6 A;  3S1R H;  4I7A A;  2QKI C;  3GP7 A;  4A3C H;  2BH8 A;  5M5Y B;  3ND9 A;  1J8I A;  2BA0 A;  1IBM Q;  1SNO A;  1FNW A;  2JYO A;  5IYB G;  3OTO Q;  3P20 A;  2F52 A;  4HJ7 A;  2QEJ C;  4DV7 L;  1QIL A;  2ES2 A;  5EPJ A;  1Q1E A;  1MJC A;  1ET9 A;  3L0O A;  3T13 A;  4BBR B;  1FR3 A;  1GXD C;  4DNT B;  1HNZ Q;  4WJW A;  4KD3 A;  1QZG A;  3CRK C;  3OYY A;  3Q6S A;  1XMQ Q;  3M7G A;  1F9R A;  2YTV A;  1G51 A;  3MTS A;  3K5M A;  4LF8 Q;  1FL0 A;  2OCE A;  2WV6 D;  4ZKB B;  2JEA I;  4MIU A;  2RF4 A;  1W6J A;  1GUG A;  2LFN A;  2Z6K A;  2EY1 A;  5C44 G;  3I70 A;  1J9O A;  4Q0F A;  1WVL A;  1PH8 A;  5C5L A;  2F0W A;  1KTK A;  3H15 A;  2ZXO A;  2EYP A;  1KQS A;  1HNX Q;  3X3N A;  1PMR A;  3TRE A;  1E2V A;  4DV3 Q;  2XWB B;  3STB C;  2O4X A;  1SRO A;  4C3I H;  5EQ0 A;  2DUD A;  4L5Q A;  4FF4 A;  2ID0 A;  1XNQ Q;  1CHQ D;  3LX0 A;  4X66 L;  1L0W A;  4B9W A;  4LJZ C;  3K57 A;  4ALP A;  5FO9 B;  5I6W A;  3GV6 A;  4EQP A;  4EQ5 A;  4Q5V A;  1STB A;  3QIA A;  1RF2 D;  4QMG A;  3J80 i;  2RSN A;  1HFN A;  1K0R A;  3H09 A;  3HOY B;  4JCV E;  1V43 A;  1BDO A;  4DR6 L;  1NY4 A;  3NE5 B;  4J15 A;  3GV3 A;  2UU9 L;  2DNC A;  1NCV A;  1OO9 B;  3K7A H;  3RZD H;  1BCP F;  1GM5 A;  1UUP A;  3HKZ G;  1QE6 A;  2MPM A;  5IGE A;  3I55 A;  3P1H A;  3W1B A;  5M5X B;  2B2U A;  3PSI A;  2VZA A;  5EAY A;  2IWH A;  4A93 H;  4IFD I;  2D0O A;  2LMC B;  2K5V A;  4KI0 A;  2R92 H;  1I4X A;  4TVA B;  3CC4 A;  5DAU A;  3NEN A;  3PUZ A;  4OHJ A;  1TY2 A;  2MUY A;  3H3V C;  4UAI A;  1U0L A;  2A6E C;  4DUZ Q;  2Z4I A;  4IJH A;  4DA2 A;  2K5H A;  2Z9H A;  1SXT A;  4I7Z C;  1SJE D;  3M4Y A;  1XYI A;  1F9P A;  5IOD A;  2F3V A;  3BU2 A;  3KLS A;  3NTK A;  1IHZ A;  2N78 A;  2B2Y C;  4NXN L;  2F0P A;  4V19 0;  3S15 H;  1I4Q A;  3I4M H;  1S5E D;  1RDP D;  2F3W A;  1I6H B;  1VQK A;  5JJI A;  4K6D A;  2WP8 J;  1BXT A;  4JI4 Q;  4Y52 H;  2KA7 A;  2Q8T A;  1Y1V B;  1PH7 A;  3S2H H;  2BH2 A;  5K36 H;  5IT9 E;  4AQY Q;  1CHP D;  4KY5 A;  1EWI A;  3BVZ A;  4L8J A;  4Y7N B;  1ENC A;  2I07 B;  4PG3 A;  4JI7 L;  1D8L A;  1EWH A;  3IAY A;  1WI5 A;  1CUK A;  4OL7 A;  5C4X H;  2IX3 A;  1FVI A;  4A3F H;  2UXC Q;  1YNX A;  2UUA Q;  4QGU A;  2ZJR A;  1SMY C;  1R9T H;  3QOJ A;  4LF8 L;  2RA4 A;  2ZTD A;  5IGB A;  4GNX A;  3E9I A;  3M4P A;  4KHZ A;  2K5D A;  2YV5 A;  1D5M C;  3TN2 A;  2E2J B;  1PFN A;  1II3 A;  1Q81 C;  4M8A A;  4HR7 B;  4XQJ A;  2RHQ B;  1VQM A;  4XQN A;  4KJO A;  2EY2 A;  1LTL A;  3CCR A;  1HNX L;  4RKB A;  2EQS A;  2F0H A;  4NPS A;  4DV3 L;  5D14 A;  1G8Z D;  2B8F A;  5I9P A;  1A6X A;  1TXY A;  3HRZ C;  2JA7 G;  4DV0 Q;  2JA8 B;  4ZUJ A;  2NVX B;  1LV9 A;  1IZ6 A;  4N8X 1;  4G57 A;  3S1M H;  1WTH A;  5HGT A;  1D1K A;  5IGF A;  2RHS B;  2NZH A;  1BBX C;  1EYD A;  3HKZ E;  1EIY B;  4ABN A;  4GS3 A;  2NVY B;  1TR5 A;  4GZY C;  3RZO B;  5KNB A;  3JAM E;  2FHT A;  4DV6 Q;  3KFU A;  4X6A H;  2PZT A;  3PF5 A;  4QCL A;  2F4V Q;  2V4D A;  3EBE A;  2M2L A;  1EQQ A;  1N34 Q;  3SK4 A;  5KYL A;  3HKS A;  4H13 C;  2RSO A;  3VA7 A;  4GOP C;  2YU9 H;  1B53 A;  2K04 A;  4DR7 L;  5IP9 H;  1DOL A;  4HJ9 A;  2G5D A;  1PZJ D;  4H0L C;  1TWH B;  1D6E C;  5E4W C;  4U67 3;  1V1P B;  3T1H L;  1PYW D;  3J7A 5;  1ESR A;  4IQZ A;  1U4R A;  3I4L A;  1T5X D;  4JG2 A;  1DCZ A;  2MQH A;  3A7A B;  3HOZ B;  4IUP A;  2VW9 A;  5JVH 3;  4LK1 C;  4LF6 Q;  1O78 A;  1K28 A;  2B2T A;  5DEH A;  2M00 A;  5KRU A;  4BA2 I;  2DN8 A;  4NXM L;  4ILW A;  4DUZ L;  3ERO A;  3VR5 A;  3S17 B;  3VYU A;  1I50 B;  1KDA A;  4A3J B;  1K83 H;  5M3F G;  2R7Z H;  4APV A;  2P5Z X;  1EL0 A;  3L7Z C;  3PIO A;  4KKU A;  1AE2 A;  1PH5 A;  3U58 A;  2SDF A;  1I94 Q;  3I91 A;  4KHV A;  4JI4 L;  3DLL A;  3CCV A;  4FVM A;  1D5X C;  4LFB Q;  4LWC A;  4K0K L;  2IL8 A;  3FMC A;  2Y0S E;  5IE8 A;  2X69 A;  5M9O A;  5LHY 1;  4PMC A;  1V8Q A;  2MGS A;  4DK6 C;  4A3E B;  5JVG 3;  1YNN C;  2UXC L;  1Z7T A;  2UUA L;  4JBJ A;  1OXV A;  2K1B A;  2LKV A;  1DXM A;  3EFX D;  2VQE Q;  1Y69 U;  1KAB A;  1NBW A;  3TP5 A;  4NW2 A;  4B3S Q;  1EZ8 A;  1SSO A;  4L63 B;  5C3E B;  3MHB A;  4IPH A;  3ICE A;  4IFD J;  2OTL A;  1AZP A;  2F0F A;  1PDQ A;  3OW2 A;  4DAV A;  4HIK A;  1G2T A;  2F0S A;  1GOZ A;  1SN8 A;  1X3Q A;  1H9S B;  1QUQ B;  1XXG A;  1LYL A;  1TKW B;  1SYF A;  2MHV A;  2KED A;  2GVB A;  4U68 A;  4LFA Q;  4DV0 L;  3H0G H;  1QCB D;  1C7Y A;  1B70 B;  2L4N A;  4E6I A;  3J7Y W;  2WAQ G;  4HN7 A;  4RH6 A;  1SNP A;  4HJ8 A;  1TWF B;  1TS5 A;  3HOV G;  5ELO A;  3DUZ A;  4KN4 C;  3M4O B;  4DR5 Q;  1N34 L;  3NQI A;  1I3Q B;  1SBB B;  1EOT A;  2JK8 A;  1E22 A;  2C9O A;  2N88 A;  3W2D A;  1TWG B;  1XPO A;  4UP7 A;  5BN4 A;  2JA5 B;  1J6Q A;  2BA1 A;  3KBX A;  1WD1 A;  4PQX A;  4XDX A;  1Y8O B;  1YHA A;  3CXC A;  4B3R Q;  1WCM G;  4DNI A;  1EY9 A;  2K05 A;  1VQA A;  5LMN Q;  3BYY B;  4LUV A;  1PVO A;  1D1I A;  3WWV A;  3K6O A;  3G6E A;  2OQ0 A;  4HED A;  3BZD B;  4DUY Q;  2EDG A;  2VB2 X;  3E0J A;  4DXG A;  2BOS A;  1A2T A;  4UY8 C;  3KJP A;  4DN4 M;  4R4T A;  2K75 A;  5JEA J;  1DZ1 A;  1N33 Q;  1HA6 A;  3I72 A;  3SHL A;  4RMF A;  3M85 A;  5E1F A;  4MTN A;  1UE6 A;  4B3M Q;  3GTK B;  4DR1 Q;  1IW7 C;  5LL6 S;  4DK1 A;  5M5W B;  1QNU A;  4CBV A;  4YY3 Q;  2Q2U A;  3Q8D A;  1PH1 A;  3TZD A;  4A3I B;  4HJA A;  3J81 c;  3D8G A;  4JI1 L;  1VQE A;  1I94 L;  1IYU A;  2Y0S B;  1VQC A;  3MXN B;  5C0X H;  2JA6 B;  4LFB L;  1EFI D;  4LF4 Q;  1PTO C;  3J7A V;  2A6H D;  1T9H A;  1NJI C;  4R8N A;  5LMU Q;  1IYV A;  1EEI D;  3D4W A;  3FP9 A;  2QIL A;  1VQN A;  3MZ5 A;  2EYF A;  2VUM B;  2VQE L;  2OT2 A;  2O5I C;  4JI8 L;  3D4D A; 
#chains in the Genus database with same CATH homology
 1KL9 A;  3D31 A;  1Q1B A;  3PIP A;  1BBU A;  4DK3 C;  1TWA H;  2K4K A;  1IYJ B;  2YTY A;  1TWC H;  1X54 A;  2I5L X;  3M4Q A;  3CCE A;  1N36 L;  4DR4 Q;  3F2D A;  3HOU G;  4JI8 Q;  1E1T A;  4DR3 L;  4A3M H;  2OQK A;  4JI0 Q;  2A8V A;  2D62 A;  1N32 L;  1Q12 A;  2WAQ E;  4OWX B;  1NMF A;  3S1R H;  3ZJY C;  3OTO L;  1IBM L;  5M3M H;  1N36 Q;  3AEV A;  3M9B A;  2WB1 E;  1XMO Q;  4A3C H;  3BJU A;  2BH8 A;  2DGY A;  4A3I G;  1PV4 A;  4IO9 A;  1VCI A;  3PGZ A;  3PV0 A;  1RIP A;  4BY7 H;  4QQB X;  2BA0 A;  1IBM Q;  3OTO Q;  5IYB G;  2K14 A;  4OX9 L;  3H3V I;  3TQY A;  2UUB Q;  3ER0 A;  1FGU A;  2B29 A;  2F52 A;  4HJ7 A;  4NB3 A;  1HNZ L;  1QVC A;  2JA6 G;  4A3M G;  1VQJ A;  4DV7 L;  2ES2 A;  3M7N A;  1Q1E A;  1MJC A;  3L0O A;  4UP9 A;  1VQF A;  3HOX H;  1K8A C;  1XMQ L;  4TQU S;  5FLM H;  1VQ8 A;  4P72 A;  4BXX G;  5M3M G;  1SE8 A;  3GO5 A;  1Q82 C;  1HNZ Q;  2IY5 B;  2F3I A;  2NZO A;  2ZM6 Q;  4DV7 Q;  2K50 A;  5C44 H;  3BZC A;  1QUQ A;  2JQO A;  1YJW A;  1QZG A;  2AWO A;  2LXK A;  1KAW A;  2PI2 A;  3OYY A;  4X64 L;  2XGT A;  1XMQ Q;  4BY7 G;  1ASY A;  3GD7 A;  4PZ8 A;  4UP8 A;  3CCQ A;  2YTV A;  2Z0S A;  1I6H H;  4BY1 H;  1I5F A;  1G51 A;  4GN3 B;  4JV5 L;  4DR5 L;  4JI2 Q;  4C2M H;  4LF8 Q;  4H02 A;  1FL0 A;  1Y1V H;  2MFI A;  2OCE A;  3HOX G;  4HID A;  2WB1 G;  2HHH L;  3HOW H;  1VQD A;  2JEA I;  1DGS A;  4Y7N H;  4KLK A;  4JI8 L;  2CWA A;  2RF4 A;  2QA4 A;  2Z6K A;  2KCM A;  3U4Z A;  5C44 G;  2HHH Q;  1PH8 A;  3PUW A;  3RR5 A;  3H15 A;  1EUJ A;  3KYH C;  1PHJ A;  4DUY L;  2JJQ A;  3KF6 B;  1KQS A;  1P16 A;  1HNX Q;  4LF9 L;  1Y1V G;  3CCU A;  3TRE A;  2OTJ A;  2Z6K C;  3RLO A;  4DV3 Q;  2E2J H;  1HNW L;  1XNQ L;  5HY6 A;  5C0X J;  3CME A;  5JJK A;  1JT8 A;  3STB C;  4C3I H;  1SRO A;  1XTD A;  4BBS G;  4BBR G;  2DUD A;  4L5Q A;  3F8T A;  3CF5 A;  2ID0 A;  3GTJ H;  1XNQ Q;  2HIV A;  2K52 A;  3K80 C;  4X66 L;  3RLF A;  1L0W A;  4ALP A;  4DPG A;  3AFP A;  1J5E Q;  4HIO A;  3G71 A;  1YIT A;  1UE7 A;  1N33 L;  4EQ5 A;  4A4I A;  3A0J A;  3UE1 A;  2GVA A;  1X3G A;  2ALY B;  4X66 Q;  1X65 A;  4DR1 L;  2N49 A;  4YCV A;  3IRB A;  4B3M L;  3J80 i;  2JA8 H;  1O7I A;  4YY3 L;  2OWO A;  3ULL A;  4AYB E;  1OXT A;  4C3H H;  1JJ2 A;  3GTG H;  1K0R A;  4OWT B;  2NVX H;  4A3C G;  4JCV E;  1V43 A;  4DR6 L;  1NY4 A;  3J81 i;  1IL2 A;  1YVC A;  4J15 A;  1JJG A;  2UU9 L;  3NBH B;  1YZ6 A;  3J81 j;  1LUZ A;  3K7A H;  3PUV A;  3RZD H;  2HT1 A;  3RZO H;  1VQ5 A;  2CCZ A;  3PO2 H;  1WFQ A;  1GM5 A;  4A3B H;  3M3Y H;  3HKZ G;  2IHF A;  4IFD G;  1UE5 A;  4YWM A;  3I55 A;  3W1B A;  2PMZ E;  2JA8 G;  4OXP A;  3FKI H;  3PSI A;  2VZA A;  5EAY A;  2R7F A;  2YYZ A;  3A5Z B;  5IYD G;  4GKJ Q;  4A93 H;  1VQ9 A;  1PH3 A;  2YTX A;  3CC7 A;  4YHH L;  4IFD I;  4L5R C;  2D0O A;  4KI0 A;  2K5V A;  5FLX c;  3CCJ A;  1VQP A;  1VQI A;  1KIX A;  2R92 H;  1JJC B;  1OXX K;  4DV2 L;  3CC2 A;  3S1N H;  3HOY H;  5IT9 c;  1YIJ A;  1HR0 W;  3KDF B;  4O2D A;  4TVA B;  3DM3 A;  4L5T A;  3CC4 A;  4AYB G;  1TWH H;  3NEN A;  3D0F A;  4B3T L;  3PUZ A;  1A63 A;  1MKH A;  3W1G A;  3TS2 A;  3J7Z C;  1AH9 A;  1U0L A;  1UEB A;  3E9H A;  4DUZ Q;  2CKZ B;  3H3V H;  3NEL A;  1GKH A;  4IJH A;  2QEX A;  4JI3 Q;  4B3T Q;  4A93 G;  3CMA A;  1E3P A;  2K5H A;  1G29 1;  2A19 A;  2R92 G;  4LFC Q;  3F2C A;  1IBL Q;  3HOY G;  3RN2 A;  1PH6 A;  3U4V A;  1U5K A;  4JBW A;  4EX5 A;  3BU2 A;  1XMO L;  1CKN A;  1KC8 C;  1NJI C;  2N78 A;  4PZ6 A;  1GD7 A;  4DV5 Q;  4NXN L;  3CQZ H;  1C0A A;  3S15 H;  3I4M H;  4GN5 A;  3S17 H;  4AQY L;  4OON A;  2UUB L;  3RLN A;  1VQK A;  1I50 H;  5JJI A;  4KHP L;  2WP8 J;  3AQQ A;  2R6G A;  4JI4 Q;  4Y52 H;  3CCL A;  2VS1 A;  4NXN Q;  2MO1 A;  4A3J H;  1PH7 A;  3S2H H;  2BH2 A;  4AQY Q;  1EWI A;  1L1O B;  4KHP Q;  4PG3 A;  4AH6 A;  4JI7 L;  2ZM6 L;  1D8L A;  1KD1 C;  1WI5 A;  1CUK A;  5C4X H;  2KEN A;  4GNX B;  5M5X H;  3I4M G;  1FVI A;  4A3F H;  5C4J H;  3L2P A;  2UXC Q;  1YNX A;  3CPW A;  2UUA Q;  3I7F A;  4PMW A;  4QGU A;  2ZJR A;  1PH9 A;  4JI7 Q;  1R9T H;  4JI2 L;  4LF8 L;  1Y14 B;  1A0I A;  5IWA L;  2ZTD A;  2FXQ A;  5GAG C;  4JI5 L;  3E9I A;  3JAM c;  3SGI A;  4GNX A;  5K36 G;  1Q8K A;  1Z9F A;  3M4P A;  4KHZ A;  3STB D;  2YV5 A;  1N8R C;  1ASZ A;  1XJV A;  4LUZ A;  4A3D H;  1E1O A;  3EN2 A;  4A3E H;  1VQO A;  2JA7 H;  1YJ9 A;  5IWA Q;  1OXU A;  1Q81 C;  3AFQ A;  4BA1 I;  3UDG A;  4JI5 Q;  1L1O C;  5AJ3 Q;  5C4X G;  2E8G A;  5FLM G;  1UE1 A;  5FJ8 H;  4A3F G;  1EOV A;  1IBK Q;  3PUY A;  3HFZ B;  4DV1 L;  2UUC Q;  1VQH A;  1M1K C;  2RHQ B;  2NN6 I;  4GNX C;  1VQM A;  3GTM H;  4GLV B;  5IP7 H;  3TRZ A;  1LTL A;  3CCR A;  1HNX L;  3KLW A;  2EQS A;  4NPS A;  4DV3 L;  4DV1 Q;  1K73 C;  3GTP H;  4BY1 G;  3S14 H;  3PUX A;  5C3E H;  4A3E G;  1X3F A;  1TXY A;  2JA7 G;  4DV0 Q;  4POG A;  4IOC A;  4OO1 I;  4P74 A;  4GOP B;  4JBK A;  2LXJ A;  3HOW G;  3I4N H;  2EXD A;  3K8A A;  2K5N A;  1D7Q A;  1IZ6 A;  3S1M H;  1GO3 E;  4DV6 L;  4JI6 Q;  2RHS B;  2NZH A;  2D0P A;  3KF6 A;  1CKM A;  2ZTC A;  5IYC H;  1J5E L;  3HKZ E;  1W2B A;  4DR2 Q;  4GOP A;  1OTC A;  1EIY B;  2F4V L;  1A8V A;  4GS3 A;  1MJE A;  4P71 A;  1PFS A;  4R4O A;  1OXS C;  4DV6 Q;  2I0Q A;  3KFU A;  4X6A H;  1EQR A;  4L5S A;  3PF5 A;  2F4V Q;  1KXL A;  4UPA A;  3EBE A;  1EQQ A;  3KF8 B;  3LGJ A;  1N34 Q;  1HR0 L;  2VL6 A;  4A3G H;  1S3O A;  1NE3 A;  3HKS A;  4R4C A;  2AMC B;  4GOP C;  4A3K H;  2YU9 H;  3CCM A;  4JBM A;  2Q2H A;  3S1Q H;  4GKK Q;  2R93 H;  2AKW B;  1FJG Q;  4DR7 L;  5IP9 H;  4HJ9 A;  1HR0 Q;  1X6O A;  4JYA L;  2A1A A;  3UDX A;  2VQF Q;  4X65 L;  1TWF H;  2CQO A;  1B8A A;  3K81 C;  2UXD Q;  4YWK A;  2PQA B;  1YJN A;  1S40 A;  1PYS B;  1SR3 A;  3GTQ H;  3M4O H;  2R7D A;  5BR8 Q;  1HZ9 A;  4DR7 Q;  3T1H L;  2NVY H;  3J7A 5;  4RG1 A;  2H5X A;  4JYA Q;  4LF6 L;  2EIF A;  4X65 Q;  2LSS A;  4GKJ L;  1TWG H;  4JG2 A;  1AE3 A;  1PH2 A;  1VQL A;  2JA5 H;  2HQL A;  2JA9 A;  2MQH A;  3RN5 A;  4LF5 L;  3T1H Q;  2VW9 A;  1HZB A;  5IP9 G;  4GLX A;  4OWW B;  4LF6 Q;  2Q2I A;  2Q2T A;  4YCW A;  5M3F H;  4X62 L;  3CAM A;  1M90 C;  4BA2 I;  4YCU A;  4LF5 Q;  2IT1 A;  2HIX A;  1E7Z A;  4NXM L;  4DKA C;  1X56 A;  1WOC A;  2WFW A;  1XNR Q;  4DUZ L;  1PH4 A;  5ELN A;  3PO2 G;  5E7N A;  4A3B G;  4JI3 L;  4X62 Q;  1QVG A;  2VY3 A;  4POF A;  4IPC A;  4NXM Q;  4LFC L;  3FKI G;  1IBL L;  1SLJ A;  2I5H A;  2ZJQ A;  2CFM A;  3KDF A;  3W5O A;  1C9O A;  2VNU D;  2ZJP A;  1K83 H;  4XIG S;  5M3F G;  4MNO A;  2R7Z H;  4APV A;  1N9W A;  3HOZ H;  1YBY A;  1VQ6 A;  3L7Z C;  3PIO A;  3T1Y Q;  4DV5 L;  5IYD H;  3GTO H;  4MZ9 A;  5J3B A;  4FDB A;  3S24 A;  5DLQ E;  1PH5 A;  1AE2 A;  2IHE A;  5GAE C;  3K7U C;  1L2F A;  1RL2 A;  2E5L Q;  3GTK H;  3U58 A;  2E2I H;  1Y1W H;  1I94 Q;  3CW2 C;  5M5W H;  2KBN A;  4JI4 L;  3DLL A;  3CCV A;  1W3S A;  3HOU H;  2B3G A;  4LFB Q;  4LWC A;  4K0K L;  5IE8 A;  2Y0S E;  4QJF A;  3HOZ G;  2R7Z G;  3NEM A;  4DK6 C;  1H95 A;  2ZTE A;  4P73 A;  3MEF A;  4K0K Q;  4A3I H;  4DV4 Q;  4DAY B;  2PNH A;  1A62 A;  2UXC L;  1K9M C;  3JAM i;  1BKB A;  2UUA L;  1YHB A;  5IYB H;  4B3S L;  4WJ3 M;  3CP0 A;  1Y1W G;  1Z47 A;  4JBJ A;  1OXV A;  2VQE Q;  1YEZ A;  2MO0 A;  3TS0 A;  1NBW A;  2JA6 H;  4LF7 Q;  1VS0 A;  5C0X I;  1EYG A;  3CD6 A;  1QVF A;  4JOI C;  3UDI A;  1HH2 P;  1L1O A;  4B3S Q;  3TEH B;  4XTC S;  3PO3 H;  4QIW E;  2AHO B;  4BXX H;  4IPD A;  1V9P A;  2V1C C;  2IX0 A;  4IPH A;  5AJ3 L;  4DR3 Q;  4A3J G;  2NVQ H;  2GN5 A;  3ICE A;  2OTL A;  4IFD J;  5JJL A;  5JEA G;  3ERS X;  1IBK L;  1IXR A;  2NN6 G;  1CSQ A;  2UUC L;  1Q46 A;  4AIM A;  3OW2 A;  2VUM H;  4WJ4 A;  4HIK A;  2Y0S G;  4LFA L;  1SN8 A;  4C3J H;  3CCS A;  4A76 A;  3F1Z A;  2UXB L;  1QUQ B;  4QL5 A;  1LYL A;  4YWL A;  1UWV A;  1X9N A;  2RCN A;  3EIV A;  3FHW A;  3A5U A;  3S16 H;  1NTG A;  4OX9 Q;  3PO3 G;  2ASB A;  3HOV H;  2GVB A;  4JC0 A;  4LFA Q;  4OO1 G;  4DV0 L;  1HZC A;  2C35 B;  2KHJ A;  2UXB Q;  3AYH B;  3H0G H;  3GDE A;  1GVP A;  1C7Y A;  1B70 B;  5GRO A;  4JI0 L;  4A3D G;  1VQ7 A;  2PI2 E;  2VUM G;  4JI6 L;  3I2Z A;  3K0X A;  2WAQ G;  1G6P A;  3RNU A;  5M5Y H;  4IJL A;  1XPR A;  4DR2 L;  2IX1 A;  4HJ8 A;  4X64 Q;  5FJ8 G;  4LNQ A;  1SFO H;  1WCM H;  5GAH C;  4IOA A;  3UE0 A;  5IP7 G;  1K8G A;  3HOV G;  5ELO A;  1BVS A;  1NMG A;  4DR5 Q;  1KHI A;  4LUO A;  4BBS H;  1VQ4 A;  4JV5 Q;  5IY0 A;  4HJ5 A;  1N34 L;  1LM0 A;  2KCT A;  3H0G G;  4BBR H;  1Q86 C;  2JE6 I;  2JK8 A;  1E22 A;  4B3R L;  2E2H H;  5C3E G;  1XPO A;  4UP7 A;  3UDF A;  4GKK L;  5LMN L;  1J6Q A;  2BA1 A;  1FJG L;  3I4N G;  1SRU A;  4P75 A;  1YHA A;  3CXC A;  4B3R Q;  2VQF L;  1WCM G;  4DNI A;  3F2B A;  2B63 H;  1VQA A;  5LMN Q;  1PVO A;  4LUV A;  3VDY A;  5IYC G;  5BR8 L;  3WWV A;  1X55 A;  3G6E A;  1WJJ A;  2OQ0 A;  4DUY Q;  1V1Q A;  4LF9 Q;  3I4O A;  3JC6 6;  1K3R A;  3G4S A;  1E24 A;  1HNW Q;  4A75 A;  1HJP A;  1I3Q H;  1EFW A;  4A3G G;  4UY8 C;  3KJP A;  4GLA C;  3GTL H;  5GQO A;  4O0A A;  3BZK A;  2PQA A;  3G48 A;  4R4T A;  4A3K G;  1VQG A;  4PZ7 A;  2K75 A;  2R93 G;  2B63 G;  1B7Y B;  5JEA J;  4A3L H;  2AWN A;  1N33 Q;  1XNR L;  1MIU A;  2I5M X;  4RMF A;  3M85 A;  2L15 A;  1HZA A;  4MTN A;  1UE6 A;  3E0E A;  4B3M Q;  4DR1 Q;  5LMN W;  4DAM A;  4IPG A;  1JB7 A;  4YY3 Q;  2N3S A;  4HIM A;  1WYD A;  1KRS A;  3I56 A;  2Q2U A;  4DR6 Q;  3J80 c;  1QZH A;  1JMC A;  2JA5 G;  3Q8D A;  3B6Y A;  1BBW A;  3T1Y L;  2UU9 Q;  1PH1 A;  4A3L G;  3PCO B;  3ULJ A;  2XTI A;  4LW1 A;  3PF4 A;  2MNA A;  4HJA A;  4LF4 L;  3J81 c;  1SMX A;  4JI1 L;  1VQE A;  3U50 C;  2E5L L;  1I94 L;  1PYB A;  3CPF A;  3S2D H;  1JE5 A;  1VQC A;  3A74 A;  5LMU L;  3MXN B;  5HGQ A;  1XPU A;  4LFB L;  4LF4 Q;  5GAD C;  4JI1 Q;  3KOJ A;  4R4I A;  1YHQ A;  2CWP A;  2JEB I;  1T9H A;  1X3E A;  1KRT A;  3ULP A;  1S72 A;  1P8L A;  1CSP A;  4R1J A;  4R4Q A;  4YHH Q;  5LMU Q;  1Q7Y C;  1N32 Q;  3KJO A;  3FP9 A;  2UXD L;  4DV2 Q;  4DV4 L;  1EIF A;  2ATW A;  4GN4 B;  2NVT H;  1PA6 A;  1VQN A;  1VQB A;  5H1S E;  4QY7 A;  1YI2 A;  4JOI A;  2KHI A;  2QGQ A;  1CKO A;  2VQE L;  4ME3 A;  4DR4 L;  2N8N A;  5C0X G;  1CKN B;  4LF7 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...