1JJGA

Solution structure of myxoma virus protein m156r
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
102
structure length
102
Chain Sequence
MTVIKPSSRPRPRKNKNIKVNTYRTSAMDLSPGSVHEGIVYFKDGIFKVRLLGYEGHECILLDYLNYRQDTLDRLKERLVGRVIKTRVVRADGLYVDLRRFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M156R
publication title Myxoma virus immunomodulatory protein M156R is a structural mimic of eukaryotic translation initiation factor eIF2alpha.
pubmed doi rcsb
source organism Myxoma virus (strain lausanne)
molecule tags Viral protein
total genus 8
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2001-07-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1jjgA00
2EXDA 2K4KA 5ELNA 3EIVA 3I4MH 3I4NG 4EX5A 4UY8C 1VQFA 2D0PA 2WAQE 4PZ8A 1XMOL 3HOYG 3B6YA 1Q81C 2Y0SE 4DV4L 1YZ6A 1G291 3KOJA 1VQPA 4B3TQ 4GNXA 4DV4Q 2JA9A 4P71A 3GD7A 3CMEA 2UUAL 2JE6I 2EIFA 2UU9L 3CCUA 2BH2A 1PV4A 1HNWL 2UUAQ 3NEMA 1TWGH 4P72A 1HNWQ 2N8NA 5M3MH 4A3EH 1PH3A 2NVYH 4RMFA 1E24A 2AMCB 4YWMA 3EN2A 1XJVA 4ALPA 4JBMA 4BXXG 4A3CH 2JQOA 1YJWA 3H3VI 5LMNQ 1QVGA 4GNXC 2CWAA 1SN8A 2YV5A 3TS2A 1K9MC 3HOYH 3GTMH 1JJ2A 1NE3A 5C4XH 3KF8B 3KFUA 1QUQB 4GKJL 1B7YB 1U0LA 1VQJA 2E8GA 4JBKA 1OXTA 1N34L 1CSQA 4GKJQ 5E7NA 5K36G 2KHIA 3BZCA 1EWIA 4KLKA 2K14A 4YWLA 1Y1VH 3UE0A 5JEAG 1AE2A 4DR4L 1PH9A 1HNXQ 3AEVA 2C35B 2V1CC 1A8VA 4NPSA 2GVAA 4DR4Q 3CCMA 1UE7A 2FXQA 5GAGC 3J7ZC 2PNHA 5FLMH 3KLWA 1FL0A 4R1JA 4O0AA 1J5EL 3HOWG 2VZAA 4LFBL 2HIVA 1JE5A 1YITA 3PUZA 1J5EQ 1SROA 4LF8L 1EIYB 2JA6G 4GN5A 4LFBQ 1L2FA 1J6QA 2Z6KC 3F8TA 1JB7A 4LUVA 4A3MG 1HR0L 1KQSA 4LF4L 4LF8Q 3F2BA 4IFDJ 4P74A 2HHHQ 1TWFH 4LF4Q 3S16H 1N32Q 1HR0Q 1K83H 2B3GA 2VL6A 3ULPA 1YI2A 4P75A 3NELA 3PUYA 2R7DA 1X3EA 5M3FH 4BBSG 3H3VH 1G6PA 4HIDA 4B3ML 2I5MX 2CCZA 2JA5G 2IHEA 4B3MQ 4A3JH 1FVIA 1NMGA 4NXNQ 1X55A 1VQ4A 4L5SA 4PZ6A 1SRUA 3RZDH 4BXXH 4JI7Q 4BA2I 3HOWH 4DV0L 1NJIC 2HT1A 5C4JH 4DV5Q 4UPAA 1LM0A 2ALYB 2JA8H 4DV0Q 3A5ZB 3HFZB 4HIKA 2DUDA 4C2MH 1HZBA 3NENA 4UP7A 5BR8Q 2OQKA 1VCIA 4A3MH 1SE8A 1V43A 4C3HH 1KIXA 3T1HL 1I94L 4LF6Q 2OTJA 1VQMA 2YU9H 2ZTEA 1K0RA 3FKIH 3AYHB 3T1HQ 3CAMA 1HH2P 3J80c 4APVA 3KF6A 3L2PA 1I3QH 1WI5A 1Y1WG 2N3SA 5EAYA 3JAMi 3CC2A 5IP7G 2KHJA 3CCVA 4H02A 1QVCA 1EIFA 2EQSA 2HQLA 4GLVB 1C0AA 4AYBG 3TS0A 4A3LH 1WFQA 2N78A 4IPHA 4A3FH 5IYCG 3CC4A 4JI2L 4IJHA 3S15H 3STBD 5IP9G 3E9HA 2GVBA 1X65A 2HIXA 4LF5L 1VQNA 2ATWA 2D62A 3KDFB 4BBRG 4LF5Q 3NBHB 2Q2HA 2E2IH 1FJGL 4NXML 4A3GG 3K8AA 1FJGQ 2A19A 4NXMQ 2AKWB 4OWXB 3CCRA 4L5RC 4LUZA 1QVFA 1AH9A 1JT8A 1WJJA 4DR3L 4HIOA 2ZM6L 3U4VA 4DR3Q 4GNXB 5JJKA 3H0GG 2ZM6Q 3CQZH 4DR2L 2OWOA 4B3SL 3HOUH 1UE1A 4DR2Q 4JOIA 1SR3A 5FJ8H 4B3SQ 2K50A 1LYLA 3GTGH 1Q46A 4J15A 3M3YH 2WB1G 4BBRH 4A3BH 4MTNA 4JYAL 1Q12A 3UDXA 1YJNA 4DV7L 3CPWA 1KL9A 4JI3L 4JYAQ 4DV7Q 3PV0A 4X62L 3G6EA 2PI2A 4HJ9A 4DUYQ 3CW2C 1IYJB 1VQGA 2OCEA 4IO9A 4JOIC 2GN5A 4OXPA 3W5OA 2Q2IA 3BZKA 5H1SE 3H15A 3AQQA 1R9TH 2R7ZH 2JEBI 3J81i 3VDYA 1XMOQ 1XMQL 3T1YL 1LUZA 1HR0W 3OYYA 4DR7L 5GAHC 1PH4A 3M85A 1XMQQ 3ZJYC 3T1YQ 4DR7Q 4IOAA 2I5LX 3I7FA 3M9BA 2UU9Q 3BJUA 1Q86C 4DPGA 1GM5A 3CCLA 4IPDA 2YTVA 3PCOB 4XIGS 5IE8A 3PO3G 4JI4L 3A5UA 1AE3A 3I4NH 4TQUS 1MJEA 1C9OA 1X6OA 2AWOA 1S72A 1H95A 4Y52H 2RCNA 3PIPA 3GTQH 3G4SA 2VW9A 4DNIA 4POFA 1YHBA 3UE1A 3OW2A 4QGUA 3S24A 3IRBA 2NZHA 3DM3A 4DV2L 2VS1A 5M5YH 1BVSA 1OXVA 2WFWA 5IYBG 4HIMA 4A75A 5C0XG 4A93G 3I2ZA 4OWTB 1N34Q 4IFDG 1HZAA 1S3OA 1A0IA 1VQAA 3MXNB 1KHIA 3CCEA 4FDBA 5GROA 3PO3H 2A1AA 2VQFL 1YBYA 3GTJH 3RN5A 1YNXA 5J3BA 3HOXG 3LGJA 2VQFQ 2F52A 4YCWA 3S1RH 4OO1I 2VNUD 5JJLA 4AYBE 1X54A 2PMZE 4LUOA 4DV1L 4XTCS 1OXXK 1IXRA 4AH6A 1K8GA 2R93H 4DV1Q 1IBLL 2R92G 4GN3B 3S1QH 4IPCA 1IBLQ 3S2HH 3U4ZA 3KF6B 3M4OH 2E2JH 4JI5L 4BA1I 1Q8KA 2QGQA 3KJPA 3GTLH 4LFAL 3J7A5 2D0OA 3S14H 4JI5Q 2RF4A 1T9HA 2CKZB 2KENA 1PFSA 2JA7G 1KD1C 1NTGA 1N36L 1WCMG 2NVTH 4BY1G 4OO1G 1N36Q 4PG3A 3DLLA 5DLQE 3PF5A 2K52A 4QJFA 2XTIA 1E3PA 2F3IA 1A62A 1W3SA 1E1OA 4PMWA 4JI8L 2JJQA 1Z9FA 1EQQA 2WAQG 5C3EG 3TREA 2R92H 1XNRL 1WYDA 4OX9L 1CKNA 2JA6H 2WB1E 3AFPA 1UWVA 1HNZL 2VUMG 3S2DH 4C3JH 3HKZG 4QY7A 2XGTA 3K0XA 1E1TA 4OX9Q 1NY4A 4AQYL 2LXKA 2UXBL 2CFMA 3CP0A 4AQYQ 1QZGA 1I50H 1OTCA 1I94Q 1HZCA 1OXSC 2K5VA 4R4OA 4YY3L 4HJAA 1YIJA 1VQ9A 4BBSH 1WCMH 4YY3Q 1LTLA 4JI1L 3SGIA 2JA5H 2JEAI 1MIUA 4A3IG 3KYHC 1PH6A 1HJPA 4QQBX 4GLAC 1FGUA 4WJ4A 4JI1Q 1PH2A 3ULJA 1JJCB 2NVXH 2NN6G 4JBJA 1VQCA 3F2CA 5C3EH 1ASYA 3HOVG 1Z47A 3JAMc 1IBML 3HOZG 2UUBL 4JI2Q 2OTLA 1XPUA 2Z0SA 1CKMA 3CCQA 2VUMH 1XTDA 3FP9A 1Q1EA 2UUBQ 1VQKA 3ERSX 2YYZA 1O7IA 1SLJA 4EQ5A 4HJ5A 5AJ3L 3PF4A 3M4QA 4MZ9A 4DR6L 1RL2A 3I55A 3TRZA 2A8VA 5AJ3Q 4B3RL 1Y1WH 3ULLA 3BU2A 2ZJPA 4B3RQ 2KCMA 5IP7H 4GOPA 1V1QA 1EYGA 3CCSA 2MO0A 1UE5A 3RLOA 3HOUG 3CF5A 3U58A 5IYCH 4K0KL 5IP9H 3I4OA 2NZOA 1XPRA 3OTOL 4K0KQ 4IPGA 4DAYB 3JC66 2E5LL 2Q2TA 2AHOB 1L1OA 3OTOQ 4DV3L 2RHSB 4A3GH 1WOCA 3U50C 3E9IA 4DV3Q 2ZTCA 4QIWE 4BY7G 3WWVA 3PUXA 5IT9c 4JI3Q 4UP9A 1D8LA 4X62Q 1TWAH 2ZTDA 1D7QA 4X66L 2MNAA 5ELOA 3CCJA 3I4MG 1YJ9A 1N33L 4YWKA 2BA0A 1IBKL 3H0GH 4X66Q 1VQDA 2BA1A 1N33Q 2DGYA 1B70B 1V9PA 2AWNA 3K7AH 2QEXA 1L1OC 1QZHA 5IWAL 4PZ7A 4JI0L 4DK6C 2H5XA 3RLFA 4JI0Q 3UDFA 2UUCL 2KBNA 2JK8A 5IWAQ 2PI2E 2UUCQ 2QA4A 5GADC 2YTXA 1PYSB 1OXUA 4JG2A 1KRSA 4DUZL 5M5WH 3J81c 1L0WA 5C0XI 4JV5L 4BY7H 4DUZQ 2F4VL 4IFDI 3GTOH 5M3MG 4JV5Q 3PUWA 1X3FA 2F4VQ 5HGQA 3S17H 4A3CG 1N9WA 2OQ0A 3A74A 4JI4Q 1P8LA 3M7NA 1YVCA 3K81C 2IY5B 2I0QA 3CMAA 4JC0A 4B3TL 1VQHA 3I56A 4LFCL 1EFWA 3KJOA 2B63G 4GKKL 1IZ6A 5C4XG 1B8AA 4GKKQ 4YHHL 4LFCQ 2PQAA 3HKZE 3GTKH 5JJIA 4YHHQ 4IOCA 1K8AC 4DV2Q 4O2DA 4DR5L 1PHJA 4GN4B 1KAWA 4P73A 1Y1VG 1TWHH 4DR5Q 3TQYA 3CPFA 5LMNL 1DGSA 1RIPA 1EUJA 1VQEA 1MKHA 2LSSA 2L15A 1PA6A 4DAMA 3S1MH 4X6AH 1CKNB 1PH8A 4LF9L 1TWCH 1Y14B 1P16A 2B63H 5FLMG 4LF9Q 2MFIA 4L5TA 3RLNA 1KXLA 1CSPA 2UXDL 4ME3A 4DR1L 5IYBH 3A0JA 1NMFA 5HY6A 2UXDQ 4DR1Q 4R4IA 1K3RA 2B29A 5GAEC 4A93H 3CXCA 2K75A 3RZOH 2R93G 1GD7A 4A76A 3S1NH 2YTYA 1HZ9A 5IY0A 4LFAQ 2IX1A 2Z6KA 3HOXH 1SFOH 1HNXL 5M3FG 2Q2UA 5FLXc 2I5HA 1X9NA 4LWCA 5IYDG 3GDEA 1JJGA 1CUKA 4A3JG 1PVOA 4L5QA 5LMUL 2BH8A 4C3IH 1UEBA 3RR5A 2LXJA 2NN6I 5LMUQ 1EQRA 1UE6A 1X56A 3GO5A 1Q1BA 2MO1A 4JI8Q 2Y0SG 1GO3E 3AFQA 3ER0A 3K7UC 3ICEA 5M5XH 1PH5A 2JA8G 2VY3A 3EBEA 1BKBA 4A4IA 1XNRQ 4DK3C 1M1KC 2HHHL 5C0XJ 1N32L 1PH1A 1HNZQ 3TEHB 1E22A 4YCUA 4GOPB 1VQ7A 4HJ8A 1QUQA 5C44G 1VQOA 2JA7H 2CQOA 4QL5A 5JEAJ 3FKIG 4LNQA 4DKAC 1I6HH 4JCVE 1G51A 4BY1H 2VQEL 2IX0A 3F1ZA 4NXNL 2ZJQA 3PO2G 5IYDH 2VQEQ 4MNOA 1C7YA 3W1BA 3W1GA 4RG1A 4JI7L 1YHQA 3CD6A 3M4PA 4DV5L 4A3LG 1L1OB 3FHWA 4A3FG 3MEFA 1VS0A 3PGZA 5BR8L 3HKSA 3J80i 4KI0A 1IBMQ 3UDGA 4LW1A 4LF6L 1PH7A 4A3DG 4WJ3M 4UP8A 1U5KA 2ASBA 5C44H 2ZJRA 3PSIA 3UDIA 4POGA 1ASZA 4DR6Q 1I5FA 3GTPH 2IT1A 1Q7YC 3PO2H 1X3GA 4X65L 4A3IH 1NBWA 3F2DA 4GLXA 4X65Q 1M90C 1A63A 2R6GA 1JMCA 1BBWA 1GVPA 2ES2A 2NVQH 2R7ZG 3RN2A 2N49A 2UXBQ 2WP8J 3J81j 3HOVH 4IJLA 3HOZH 1Q82C 1VQIA 5FJ8G 3L7ZC 1S40A 1MJCA 4R4QA 1KRTA 4Y7NH 1CKOA 1W2BA 1KC8C 2UXCL 4A3DH 4A3BG 1VQLA 2E5LQ 1E7ZA 4JBWA 4GOPC 2UXCQ 3D31A 5LMNW 4AIMA 2K5HA 4JI6L 4A3KG 3G48A 3STBC 4X64L 3PIOA 3CC7A 1XNQL 4JI6Q 2CWPA 4KHPL 4X64Q 1N8RC 1XNQQ 3RNUA 4KHPQ 1YEZA 1XPOA 4YCVA 2IHFA 2R7FA 1BBUA 2K5NA 2PQAB 4NB3A 1VQ5A 3G71A 2KCTA 4LF7L 1GKHA 2MQHA 1IBKQ 4OWWB 1VQ6A 4GS3A 1EOVA 4HJ7A 3E0EA 1VQBA 4LF7Q 1VQ8A 1K73C 1PYBA 2E2HH 3L0OA 4OONA 4R4TA 4TVAB 3Q8DA 2ID0A 5GQOA 3D0FA 4DV6L 1YHAA 3PUVA 3K80C 1TXYA 4DUYL 4DV6Q 4A3KH 4KHZA 4R4CA 4A3EG 3KDFA 1SMXA 1IL2A 2RHQB
chains in the Genus database with same CATH superfamily
4K8IA 3I70A 2K4KA 5ELNA 1TY0A 1K8OA 1TWAB 3I4NG 2F0FA 2D0PA 4PZ8A 3HOYG 3HOUB 3SK4A 1YZ6A 2AQ3B 3KOJA 4K5XA 1VQPA 4GNXA 1HUMA 1Y8PB 3HEJA 4B3TQ 4DV4Q 1EZ6A 2JA9A 4HR7B 2UUAL 2JE6I 2BH2A 3NEMA 4P72A 4O42A 5D65A 2NVYH 2GA4B 1JWUD 4ALPA 1E0BA 2IJ0A 5CV8A 1QVGA 2YV5A 5G3LD 2L11A 1NAPA 4IALA 3KF8B 2K7VA 2M2LA 1QUQB 1U0LA 5IT9E 1OXTA 2KHIA 4C1NK 2K14A 4XDXA 1HUNA 1H9JA 4DXGA 3I3CA 3NE5B 3FPPA 2V1CC 4NPSA 3S1MB 3NHHA 3KLWA 2XIWA 2ZT9C 1BCPF 4KY6A 4HSPA 1J5EL 3RMHA 1YITA 1EIYB 2HCIA 1DYQA 4LFBQ 2Z6KC 3X3NA 3C3LA 5CV6A 4LF4L 5I2YA 3F2BA 3NQIA 1HR0Q 2VL6A 4R9WA 3AMUA 1XYIA 5M3FH 3NQTA 1G6PA 4B3ML 2CCZA 1ONLA 1ENCA 3DWAA 3MXNA 1FVIA 4NXNQ 1STAA 4Z9CB 4I7ZC 1VQ4A 4L5SA 4C3IB 3HOWH 4DV0L 4HAEA 4DV5Q 1IYVA 2DUDA 2K1BA 3C1EA 3M7GA 4C2MH 4A3MH 1A3TA 1SE8A 1SSOA 1V43A 4C3HH 2OTJA 4LF6Q 1F9PA 2R93B 3OWEB 4NKLA 1JE4A 3CAMA 1U4PA 4APVA 4FP5D 2G9DA 3BDOA 4K8JA 1EOTA 2EJGC 5CYUA 2EYMA 3CC2A 4OHJA 1LACA 3N6RA 1QVCA 1B3AA 2D5DA 2LS01 5FKAC 3D6WA 4JI2L 2HD3A 3A7LA 4IPHA 5IYCG 3E9HA 1STGA 2HIXA 5C4JB 1VQNA 1CT1D 2D62A 3KDFB 3GV6A 1MSHA 4EGVA 1IYUA 2E2IH 3I73A 4NXML 4RHRA 1FJGQ 1DJRD 2YU9B 4OWXB 1STBA 4HIOA 2X6GA 3U4VA 1TIID 3CQZH 2OWOA 1D5MC 2WINB 4B3SQ 1SR3A 5FJ8H 2TSSA 1Q46A 1QNUA 4J15A 4BBRH 1TS4A 3NK9A 4MTNA 1YJNA 3CPWA 4JI3L 3PV0A 4PNYA 4X62L 3G6EA 4HJ9A 3GQBA 3CW2C 3QB3A 1VQGA 3A7AB 2GN5A 3W5OA 3GP7A 5H1SE 2F3VA 3Q6SA 3GTGB 1RKNA 4DR7L 4NMZA 1GUTA 3OMCA 1XMQQ 3ZJYC 1BQQT 5BN4A 2UU9Q 1GM5A 2F0EA 3CCLA 1UAPA 2YTVA 3PCOB 4A3KB 3PO3G 3A5UA 4TQUS 1MJEA 1ESFA 1C9OA 1HXYD 4Y52H 2D2CC 5BN3A 3PIPA 4OIJA 4DNIA 3UE1A 1I4RA 4R8IA 2NZHA 3DM3A 4DV2L 3K57A 1BVSA 1AZPA 4HIMA 4A75A 4OGQC 4HEDA 2PQEA 4EQNA 4FDBA 5FO7B 1S5ED 5GROA 4WRDA 4OO1I 4KHVA 4AYBE 2PMZE 4KTAA 3I4NB 1F2YA 3AB9A 4XTCS 4M8AA 3TZUA 1K8GA 5ELDA 4DV1Q 2HDLA 1TS5A 4IPCA 2FMCA 4FF1A 3U4ZA 3O13A 3KF6B 3FRPB 4BA1I 3S14H 3KJPA 2EYHA 2F0PA 4LFAL 4JI5Q 1RODA 1KD1C 2KECA 2NVTH 4BY1G 4OO1G 1N36Q 2K52A 2F03A 2XTIA 1A62A 1E1OA 4JI8L 1Z9FA 2R92H 1TR5A 1CKNA 2DNCA 2L1BA 2F3WA 3S1QB 2PZTA 2Z1CA 3S2HB 2UXBL 2LXKA 4FXGC 2CFMA 5C3WA 3GTLB 1VQ9A 4BBSH 1K83B 4QIWB 5CGKA 4KV6A 4L8JA 1LTLA 4JI1L 4RA8A 4XQNA 2JA5H 1MIUA 1PH6A 2JEAI 1HJPA 4KMUC 4GLAC 4WJ4A 4CDEC 1MHWC 4QUFA 2MUYA 1JJCB 2F0OA 3F2CA 1IHZA 1LTTD 3OHXC 3DUZA 1V1PB 5KNDA 2VUMH 1CKMA 1Q1EA 1AN8A 4HJ5A 1O7IA 3D6CA 3PF4A 1GHJA 2QCPX 2G9HD 3I55A 3TRZA 4XQQA 5AJ3Q 1D6EC 3BU2A 5EKIA 1TQOA 4FXKC 1EYGA 1J9OA 2G5DA 2NVXB 4K0KL 3I4OA 5LHY1 1SNOA 3OTOL 5EBDA 1JORA 4DV3L 1GXDC 2ZTCA 3WWVA 1EQVA 1D8LA 2ZTDA 3VR6A 1D7QA 4X66L 1YJ9A 1N33L 1VQDA 2DGYA 2AWNA 3K7AH 1QZHA 5IWAL 2NWGA 4XXEA 2NB0A 2H5XA 1CZWA 1SDFA 4BS9A 4JG2A 5C0XI 3GTOH 2KVMA 1KNEA 2XSCA 1QE6A 3K81C 1SMYC 1KABA 4B3TL 2B63G 4GKKL 3KJOA 1IZ6A 1E2WA 4ODGA 4LFCQ 3HKZE 4HMJA 1B50A 4YHHQ 4FF3A 5CV5A 1K8MA 3JAML 1I6VC 4O2DA 2Z8LA 4GN4B 3K6OA 2OF1A 1TWHH 3VR2A 3CPFA 3NPPA 3LNNA 1DGSA 1EUJA 3H91A 2LSSA 3VYUA 1PA6A 4LF9L 1PH8A 4LJZC 2A6EC 5KYIA 4ZAIA 2B39A 5IYBH 3A0JA 1NMFA 2MHVA 3GTKB 2K01A 4DR1Q 1JCKB 1F9QA 4A93H 3MFGA 4IFDH 1GD7A 1LTGD 5EPJA 1SFOH 3HOXH 5M3FG 2I5HA 3QOLA 1JJGA 4RCOA 5CV7A 3NBIA 2WKCA 3RR5A 3LX0A 1EQRA 5JJZA 1Q1BA 5CV4A 3K7UC 1GO3E 3ER0A 3W2DA 5IGFA 1QG7A 1PH5A 2BE5C 1EIHA 3KF8A 1HNZQ 5FO8B 4C3HG 4YCUA 1QUQA 4KK7A 5C44G 3IAYA 2CQOA 4LNQA 1I6HH 4DKAC 1GJXA 2VQEL 5IYDH 4NXNL 4QB4A 2B2TC 4RG1A 3VR5A 2F0TA 4DV5L 1MBYA 1L1OB 2B2UC 3HKSA 4KY7A 3UDGA 4LW1A 2M9VA 4LF6L 4UP8A 4RGOS 3V96A 2DNEA 3GTPH 1W6JA 1DONA 4CDDC 1LLRD 1TVXA 4A3IH 4N9TA 1JOOA 2B2VC 3F2DA 4BY1B 4X65Q 1JMCA 1BBWA 1GVPA 2ES2A 2NN6H 1TU2B 2N49A 1LV9A 3J81j 1Q82C 1VQIA 5FJ8G 1KRTA 4Y7NH 4TRDA 2FINB 3ONAB 2E5LQ 4UHVA 3KLSX 3D31A 3STBC 3BVZA 3PIOA 1CHPD 4RWSC 1A6XA 2NTTA 3RNUA 2IHFA 2K5NA 3KLRA 4XYQA 5FLXL 3R2IA 5IGCA 2R7ZH 2E75C 1GKHA 1VQBA 2C5CA 5DM63 1HA6A 1PYBA 4OONA 2QDLA 3Q8DA 1CHQD 5GQOA 1NR2A 4A3DB 1JOQA 4R4CA 3KDFA 2EXDA 5ELEA 4X3SA 3EIVA 4EX5A 2AQ1B 1WTQA 2Y0SE 1ILQA 3CMEA 3GD7A 2E2HB 1HNWL 2EIFA 2UU9L 5M3MH 5JVG3 4A3EH 4RMFA 4YWMA 2A6ED 1XJVA 3MAQA 4JBMA 4A3CH 2JQOA 3H3VI 3TZDA 1BBXC 4GNXC 1SN8A 3SDZA 3TS2A 3G7LA 3GTMH 1NE3A 1X3QA 5C4XH 2IW3A 1RHPA 1PFNA 2PPBC 4GKJL 1B7YB 3GV3A 5EGTA 3TP6A 3E6ZX 4KLKA 2NZ1D 3UE0A 5E4XA 2QKIC 2RCFA 2NVYB 1AE2A 3A8KE 3MA2B 4DR4L 2QF7A 4FNFA 2BE5D 2GVAA 3VA5A 3CCMA 5GAGC 2MP1A 1S5FD 3NBHA 4XQJA 1QOHA 3BDCA 4R1JA 2B63B 4O0AA 2VZAA 3VYRA 1JOKA 3BYTB 4LF8L 4GN5A 1AZQA 4IFDJ 4P74A 2O5IC 1TWFH 3S16H 4MTKA 3S1NB 1J8IA 3CKIB 3PUYA 2R7DA 4BBSG 4IZ8A 2VXWA 2JA5G 1SYDA 3MXUA 4A3JH 2A68C 2Q8RE 3RUZA 2EYPA 2K32A 1SRUA 3RZDH 1NJIC 4UPAA 1G2SA 1H9MA 3A5ZB 3HFZB 3KUPA 1EL0A 1AFPA 1VCIA 1HPCA 1VF7A 3T1HL 3EROA 4DA2A 1RF2D 2ZTEA 1K0RA 4XYOA 3FKIH 3AYHB 1HH2P 2K04A 3KF6A 3L2PA 1WI5A 1ESRA 2N3SA 5M3FB 3JAMi 3V2TA 2JYOA 2KHJA 4H02A 2EQSA 3TS0A 4M1UB 3ND9A 4A3LH 4A3FH 2N78A 3STBD 3T56B 1D2BA 3OW7A 3QWNA 4LF5Q 4FVMA 1HHVA 4DU9A 4C2MB 4RKBA 4C3HB 1SJHD 2A19A 5C44B 4JW0A 1PRTC 1AH9A 1HRJA 1SEBD 1T5EA 4DR3Q 4G4KA 5CBEE 2ZM6Q 4HMIA 4DR2Q 2K50A 1LYLA 4C1NI 2Q8IB 2AUKA 3M3YH 4JYAL 2FMMA 2K28A 2E2IB 1KL9A 1V1PA 4C56C 4DV7Q 2K03A 5IGDA 1O7YA 2XWJB 3BS1A 1QJOA 1RJTA 1UUPA 5K5PA 2Q2IA 3BZKA 3H15A 1BDOA 2PMZB 3CQZB 1GHKA 3A55A 3VDYA 3J7YW 1XMOQ 5KRUA 3FPUB 3T1YL 1LUZA 3OYYA 2PCFB 1FD7D 1PH4A 3M9BA 3BJUA 4IPDA 3P20A 2KCCA 4XIGS 5C6AA 1WTRA 3SHLA 3OMGA 3A54A 2O5JC 1R4PB 2VW9A 1PMRA 3H94A 1U4MA 2KOLA 4QGUA 2QW7A 1MI2A 3S24A 5IYBG 2LMCB 3SK8A 3BVMA 3IL8A 1EY0A 4BWGB 4A93G 3I2ZA 4OWTB 1N34Q 1LT4D 1HZAA 4IFDG 2WACA 3NTIA 3GTJH 3HOXG 1H9SB 2VQFQ 2IWHA 3S1RH 4FF2A 2Z9HA 1IXRA 4AH6A 5A2QL 1B9NA 3A8IE 4GN3B 1NR4A 1IBLQ 3ERQA 1G8ZD 3M4OH 3R93A 2E2JH 5C0XH 2A68D 3J7A5 5D14A 2XRQD 3BZDB 2KENA 1PFSA 2F0VA 3G6JB 1PFBA 1NTGA 1PTOH 1WCMG 4JVZA 2SNSA 1YNNC 1G91A 2MPMA 4PG3A 1H9KA 2WV6D 4QJFA 4RAUC 1IL8A 5C3EG 1YNJD 3TREA 1WYDA 1WTOA 2L9HA 2JA6H 2WB1E 3AFPA 1UWVA 1HNZL 3S2DH 4C3JH 4OX9Q 4QY7A 2XGTA 2CQAA 3DWQA 3OIPA 1NY4A 1EYAA 5ELCA 4AQYQ 1QZGA 1BO0A 1I50H 1FGBD 1I94Q 3S14B 2BDOA 4HJAA 4ME5A 1YIJA 3ND8A 4DXFA 4YY3Q 1B44D 3SGIA 3ZYYX 4A3IG 4H7BA 2NVTB 1FGUA 1JWSD 3HG9A 3L3OC 2NN6G 5KGUA 1F2MA 1ZKOA 3JAMc 1PRTD 2UUBL 2OTLA 3E5SA 1XPUA 3CCQA 3L9AX 1VQKA 2J7ZA 3ERSX 2YYZA 4EQ5A 3M4QA 2HDMA 3DEPA 4B3RL 5I4DA 1Y1WH 4BBSB 1GUOA 2ZJPA 1Y69U 1SYFA 5IP7H 1DM0B 2JA5B 4DGZA 5T1GA 1U4RA 1RCVD 4P2CB 3T13A 5ELBA 2DY8A 5IP9H 3PMFA 2NZOA 3SEBA 2L4NA 4IPGA 4DAYB 2E5LL 4K2KA 2AHOB 1L1OA 1XTCD 1HTPA 2RHSB 2V4DA 4BY7G 1CK1A 4QUCA 4UP9A 1TWAH 1PTOC 2MNAA 5ELOA 4JI0L 3RLFA 3UDFA 4K6DA 2PI2E 2UUCQ 4LAAA 3Q24A 4DUZL 5IODA 5M5WH 1SJED 4JV5L 3KK7A 1AW7A 5M3MG 3PUWA 1VF5C 1X3FA 2SNMA 2F4VQ 5HGQA 4A3CG 1HFNA 1B4OA 2OQ0A 1BCPB 4G57A 1FNWA 3K5LA 3A74A 4JI4Q 1P8LA 1YVCA 2IY5B 3CMAA 4JC0A 2CW0C 3I56A 5C4XG 3MTSA 2K5DA 1E2ZA 4IOCA 2C9OA 4F7XA 3OSOA 3MZ5A 2KCNA 1PZID 2R3ZA 2RSOA 5LL6X 3K5NA 3SE0A 1KAWA 2KEEA 4DR5Q 3OWFA 3GTOB 4MN3A 4K6LA 2OT2A 5G3LF 1SE3A 3IFTA 1RIPA 3NWSA 5E3FA 4DAMA 3S1MH 1Y14B 1WVLA 1ET6A 2X69A 4L5TA 3RLNA 1KXLA 1CSPA 2UXDL 4ME3A 1FYCA 5HY6A 5IOCA 3MXPA 1YNND 4DK1A 5GAEC 3RZOH 1KDAA 2H1EA 5IY0A 2IX1A 1KNAA 1TWHB 2Z6KA 5HURA 1CA6A 5FLXc 4G7ZC 1X9NA 4QCLA 4TSSA 5IT9L 1CUKA 1HTLD 1PDQA 4A3JG 3DEOA 3TN2A 3VYTA 5LMUL 4C3IH 1UEBA 3CC4A 5C5MA 1X56A 2F0WA 5E4WC 2VY3A 4RHSA 1BKBA 4L6TB 4A4IA 5HGTA 5C0XJ 3TEHB 4A93B 5JVH3 2NYZD 1VQOA 2JA7H 4QL5A 3ITPA 3FKIG 4RGMA 3J81L 1SFOB 3HOXB 2IX0A 3F1ZA 3PO2G 1BF4A 4MNOA 4V190 3W1BA 1II3A 3EQLC 3T16A 3CD6A 3M4PA 4A3LG 4A3FG 1VS0A 3PGZA 4CKCA 3J80i 2PW7A 1LT3D 4A3DG 4WJ3M 4NP5A 2B8FA 1PFMA 1U5KA 1LTSD 3PSIA 4DR6Q 1PZJD 3CRLC 1VMPA 5I9PA 1Q7YC 4I7AA 1WCMB 1M90C 3Q23A 1A63A 2R6GA 4Q0FA 2OEOA 2B2YC 2EY2A 2N88A 3HOVH 3LWUA 5C3EB 3K5MA 1S5DD 1MJCA 1S40A 2KQ3A 2LY7A 1B3QA 1PTOD 1F9RA 1EZ8A 2UXCL 1FNUA 4KN4C 4GOPC 5T1IA 1SBBB 4JI6L 3G48A 4X64L 2F0JA 1KDBA 3GTPB 4K5VA 1N8RC 1XNQQ 1RDPD 4A3IB 4KHPQ 1XPOA 4YCVA 3DXJC 1BBUA 2PQAB 1F77A 3G71A 2KCTA 1VQ6A 2MQHA 1IBKQ 1U9RA 1EOVA 4L63B 3E0EA 5DEHA 5C5LA 4LF7Q 3Q0AA 1K73C 1VQ8A 1SNQA 3QG1A 1A3VA 4TVAB 4Y7NB 4DV6L 1YHAA 4DK0A 3TSSA 5FK9C 4A3KH 4KHZA 2CW0D 4ZCKA 1SMXA 1IL2A 2RHQB 3NUCA 1ZXTA 4JK1C 1LTID 3I72A 3I4MH 2DY7A 1VQFA 1O7ZA 2WAQE 1XMOL 3B6YA 4LK1C 1Q81C 4DV4L 1G291 1IW7C 1TY2A 3R8BA 2EVBA 2EOTA 4MHEA 2UUAQ 1TWGH 4FF4A 1SYCA 1EQTA 2DJFC 4BY7B 1E24A 3FMCA 2P5ZX 2FJ2A 5KIXA 5LMNQ 2DJGC 2EY5A 1K9MC 3HOYH 1JJ2A 1M8AA 4ZKCB 1S5BD 5ELFA 3PIO3 3KFUA 4JBKA 1N34L 2FHTA 3DWPA 1D5XC 5E7NA 4X3KA 1EWIA 2JN4A 1MGSA 4YWLA 1Y1VH 4RGTA 4H44C 5BN5A 5M3MB 2PO4A 2C35B 3AEVA 1A8VA 1UE7A 2FXQA 3J7ZC 2PNHA 5FLMH 4CJ0B 3SK6A 1TWCB 4PMCA 3GTMB 3HOWG 5C4XB 3TP8A 1I4QA 1JE5A 2HIVA 3MFYA 1J5EQ 1SROA 2JA6G 4LFBL 1L2FA 3F8TA 4FO2A 4C3JG 1JB7A 4LUVA 4A3MG 1HR0L 4B9XA 3TMEA 2HHHQ 3V05A 2EY1A 4LF4Q 1N32Q 4CJ2C 1K83H 1YI2A 2F0NA 2I5MX 2F0KA 1CTMA 2IHEA 4B3MQ 1NMGA 3NXWA 1X55A 1H9SA 2KA7A 1WTVA 4JI7Q 4BA2I 2HT1A 1RTOA 2JA8H 4U68A 4DV0Q 1JC7A 3NENA 4UP7A 4CDFC 4CJ1B 1I94L 5CR3A 1KIXA 1VQMA 4ULLA 1FNVA 1SNMA 3J80c 1I3QH 1Y1WG 1HQRD 4CKBA 2A6HD 5IP7G 3EFXD 1K28A 1C0AA 3P7JA 2HQLA 4GLVB 2I07B 4A3JB 4AYBG 2MGSA 1CI3M 4H13C 1EY8A 1WFQA 3S15H 3RZDB 1ENAA 4IJHA 5IP9G 2GVBA 1B2TA 1X65A 4U673 2WKDA 2ATWA 1JR0D 4BBRG 2Q2HA 1V8QA 2JSOA 1FJGL 1I4XA 3QO2A 1XWEA 4NXMQ 2AKWB 3FKIB 4L5RC 1LTRD 1JT8A 5DM73 3PO2B 3HZXA 2LFNA 5JJKA 3CHBD 1D1IA 4B3SL 2NVQB 1PTOF 1ICFB 4JOIA 4A3FB 2VB2X 3R2TA 2PW5A 4QMGA 2L12A 1C4QA 2LKVA 4A3BH 3TDQA 4KD4A 1QWYA 3SXHA 5DAUA 1IW7D 1X3PA 4IO9A 3QR8A 3X3MA 5E1FA 1A2TA 1B1ZA 1UNSA 4HTHA 1R9TH 3T53B 2JEBI 1EEFD 3J81i 1WTPA 1XMQL 2K05A 1HR0W 5GAHC 1LT6D 3M85A 3M3YB 4DR7Q 1Q8IA 2F0GA 3I7FA 3WOEA 1DD2A 5DNFA 1Q86C 4DAYA 2QDBA 5IE8A 5C4HA 4JI4L 1X6OA 2NBFA 4HSVA 2RCNA 1SAPA 3GTQH 4UDUC 3BYYB 5M9OA 3OPOA 2VS1A 2O2LD 5M5YH 1OXVA 2WFWA 1Q90A 3DM1A 2OXPA 3U9SA 3QOJA 1A0IA 1F9SA 3BVGA 5A2QE 4TKOB 3PO3H 1YNXA 5J3BA 2F52A 4YCWA 4DAVA 1IKMA 1STYA 1X54A 4MIUA 4DV1L 1GUSA 5EJWA 3S9WA 2R92G 1CM9A 3VR3A 5K36H 5LL6S 4JI5L 1Q8KA 2QGQA 2D0OA 1T9HA 2CKZB 1F2ZA 2RF4A 2FFKB 5JEAH 2RDGA 2E2DC 2JA7G 2ENBA 3W3AA 1N36L 2F4IA 4RKLA 3DLLA 4YIJA 2H4OA 3PF5A 3S1RB 4PMWA 1W3SA 2WAQG 2A74C 2B2TA 2VUMG 4ZKBB 3HKZG 4NW2A 1E1TA 1Z6HA 3KBXA 3M4OB 3A8JE 1OTCA 1OXSC 1YNJC 2BDNA 2F0HA 2K5VA 3E0JA 4R4OA 5IGGA 1PTOB 4OO1H 1B9MA 3KYHC 4QQBX 4XT3B 4JI1Q 1PH2A 5EBCA 3ULJA 2IPKD 1QNKA 4KKUA 1SE4A 1VQCA 3HOVG 2BOSA 2B2VA 1V1OA 3HOWB 3IKJA 5I6YA 1XTDA 1X32A 2JA6B 4C3JB 1SLJA 4A3MB 5AJ3L 2ICEC 4EQOA 1RL2A 4DR6L 2R61A 4O1NA 3ULLA 2KCMA 2F1MA 1V1QA 2ZXPA 2KJXA 3CCSA 3I90A 2MO0A 1UE5A 3CF5A 1A2UA 3U58A 4N8FA 1TKWB 3MVVA 2Z6BA 1XPRA 4QF4A 4K0KQ 1AEXA 3OTOQ 4A3GH 1WOCA 3U50C 2RVLA 4DV3Q 1JB3A 5IT9c 1HFGA 3PUXA 3D8GA 2A5HA 3FVQA 1Y1WB 2KHSA 3I4MG 2BA0A 1IBKL 3H0GH 4X66Q 1N33Q 3MC0B 4AYBB 1SYBA 3KBGA 1L1OC 3PQIA 3N52A 2XWBB 1Z7TA 1TS2A 2F0QA 5IWAQ 5TSSA 3WDNA 1BXTA 1DOLA 2YTXA 4BBRB 1KRSA 1EU4A 3J81c 1L0WA 5EQ0A 4IFDI 2ICIA 1PZKD 5EKKA 3S17H 1SYGA 3J80L 2SEBD 3M7NA 2I0QA 3K59A 5JAVA 2A69C 1EFWA 4LFCL 2EZVA 1CA5A 4GKKQ 4YHHL 5F2DA 2PQAA 3T4AC 2KEDA 2F0MA 5I9OA 1K8AC 3MEHA 1PHJA 5EKLA 5M5WB 4IUTA 1SNPA 1Y1VG 5IGBA 1SYEA 3BG3A 5LMNL 3HP3A 1EY5A 2L15A 3SVMA 2ZXRA 2B63H 5FLMG 4IUNA 4LF9Q 4X3TA 4ABNA 4J6HA 1PXUA 2PZUA 2EPBA 4DR1L 1S4ZA 1DZ1A 4R4IA 1FR3A 2K75A 2EDGA 4A76A 4F87A 3S1NH 1H9RA 4ZRZA 5EPLA 4K2LA 2Q2UA 3FEWX 2E76C 2PNRC 4RCNA 5IYDG 4IURA 4K5WA 1PVOA 4L5QA 2IL8A 2BH8A 4OL7A 2LXJA 2NN6I 1UE6A 3LWEA 2MO1A 3J81E 2Y0SG 5M5XH 4KKTA 1O78A 1E2VA 3EBEA 2JA8G 1CQVA 1XNRQ 4DK3C 1KAAA 1M1KC 2HHHL 1N32L 4GOPB 1VQ7A 4ID6A 3PIP3 3RZOB 5JEAJ 4IUUA 4JCVE 1LTBD 1G51A 3I8ZA 2VQEQ 4JI7L 1YHQA 3FHWA 1A15A 3MEFA 1DXMA 1EYCA 4RFBA 2R92B 2Z4IA 4KI0A 1IBMQ 4CGYB 2EJFC 2HQEA 1PH7A 4CHTB 1SNDA 5C44H 2ZJRA 4POGA 2JA7B 1I5FA 2IT1A 3QJYA 5KYLA 4DNTB 4X65L 2SOBA 4GLXA 1VMCA 3RN2A 2R7ZG 2MJ8A 3HGBA 2WAQB 3HOZH 1STEA 3L7ZC 1Y8NB 4CBVA 1Q3LA 2RBMA 1O80A 1CKOA 1W2BA 1KC8C 2VUMB 3HKZB 4A3BG 4H0LC 3AU7A 3FDTA 3J7AF 5LMNW 4AIMA 3EA6A 1LTAD 1G2TA 2BCOA 5FO9B 2B2WA 1G6ZA 2JP1A 1YEZA 5IGEA 2R7FA 4DNRB 3HOUH 1VQ5A 4F88A 4HJ7A 4IUVA 3HOVB 5KNBA 4I65A 1TT2A 1S5CD 3K80C 1TXYA 3NTKA 2A69D 4A3EG 4WORA 3I4LA 2CHBD 1ET9A 3JAME 1LT5D 4UY8C 2RA4A 4G7OC 2KUMA 1JQYD 3K7AB 4OIKA 4WFN3 1O7LA 1GUWA 3IFDA 4P71A 4RGNA 4G7HC 3CCUA 1PV4A 1HNWQ 2N8NA 4PV1C 1PH3A 1BR9A 2AMCB 3EN2A 5CMDA 1YJWA 5CBAE 4WJWA 2CWAA 3I4MB 1NCVA 3C1FA 1AP0A 1GOZA 1HQMC 1VQJA 2E8GA 1TS3A 1CSQA 4GKJQ 2CVRA 5K36G 3F2UA 3BZCA 1GUGA 1TWGB 2D9UA 4DFAA 5JEAG 1EY4A 3A56A 2L0CA 5I2XA 1PH9A 1DCZA 1HNXQ 4DR4Q 3VYSA 3C2PA 5J39A 3BDLA 1FL0A 1SE2A 3HOYB 3P75A 3PUZA 2HUGA 1J6QA 1XX8A 4LF8Q 2R93H 1KQSA 1PLFA 2B3GA 3ULPA 4P75A 1Y1VB 4LMQD 3NELA 1X3EA 3CRKC 3H3VH 4PMBA 4HIDA 5KEEA 2TMPA 1I4HA 3J7AV 3NP8A 4PZ6A 1CFMA 2O4XA 3I91A 4BXXH 3NTHA 3K5OA 5C4JH 1JWMD 1LM0A 2ALYB 1D5ZC 2VB3X 5KNCA 4HIKA 1HZBA 3HS0C 5BR8Q 2OQKA 3M4YA 2YU9H 1I4PA 3T1HQ 1I6HB 4ZYSA 2XNAC 2Z4HA 5EAYA 3CCVA 3MWYW 1EIFA 1EWCA 1PRTF 1F2LA 3VA7A 1EWHA 3SR1A 3MHBA 3WOFA 5L37A 2Y0SB 4IN3A 4LF5L 2A6HC 1R4QB 4RH6A 2JA8B 1NUCA 3NBHB 4CDCC 5FLXE 1W6KA 3T51B 4A3GG 3K8AA 2ZXOA 3CCRA 1QVFA 4LUZA 4J8QA 1WJJA 1I3QB 4DR3L 2ZM6L 4GNXB 3H0GG 4DR2L 1QILA 1UE1A 4CKEA 1ML0D 3S15B 2EYLA 3GTGH 2WB1G 4HCSA 1Q12A 4ILWA 3UDXA 4DV7L 5JPMC 4JYAQ 1IKLA 1STNA 2PI2A 3D4RA 4DUYQ 1IYJB 2OCEA 3H3VC 4JOIC 5J1ZA 4OXPA 2F0UA 4FYDA 3AQQA 2R7ZB 4DN4M 4GZYC 2Q8TA 5JPNC 1WD0A 3T1YQ 4IOAA 2I5LX 4A3BB 4ZQ3A 2IX3A 4DPGA 1MD2D 2XRSD 2A73B 2L55A 4ZUIA 4B08A 1B53A 4XT1B 1WTHA 1AE3A 3I4NH 2AWOA 1S72A 1H95A 2EYJA 4V0BA 1A3UA 3K0YA 3G4SA 4POFA 1YHBA 1JICA 1R9TB 1L0YB 2L5TA 3OW2A 3IRBA 2F0SA 1T5XD 4K14A 5D3IB 1EY9A 5C0XG 1KDCA 1S3OA 5AFWA 1VQAA 3MXNB 3CCEA 1KHIA 2RKSA 4A3EB 2A1AA 2VQFL 1STHA 1YBYA 3RN5A 1UEAB 3HRZC 1NNXA 3LGJA 1EEID 5JJLA 2EJMA 2VNUD 2QILA 5FOBB 4LUOA 1C48A 4KY5A 1OXXK 3TBIB 3GTQB 4KJOA 2EYFA 1IBLL 1EY7A 3S1QH 1D1KA 3S2HH 3TP7A 5M5YB 2PYKA 3R3OA 3GTLH 1HA5A 4KKSA 1PRTB 5JOBA 1ICWA 3PO3B 3EJIA 1BCPC 5COYA 3H6MA 5CV9A 5DLQE 1E3PA 2F3IA 3D4WA 1LO5D 2JJQA 1WTXA 1HCZA 4DAPA 1EQQA 1XNRL 4OX9L 1KTKA 2RDFA 2J0TD 3K0XA 4AQYL 1PYWD 3CP0A 5IIFA 1ILPA 3S16B 1TWFB 1HZCA 4YY3L 1ZYRC 5CORA 1WCMH 4R8NA 1SXTA 5CC4A 1RTNA 2NVXH 4JBJA 1ASYA 1K0SA 5C3EH 4ZUJA 1Z47A 1IBML 3HOZG 4JI2Q 2Z0SA 2B2YA 3FP9A 2UUBQ 4JPBW 2EXZA 4DF7A 4MZ9A 2A8VA 4B3RQ 1BNZA 4GOPA 1QB5D 2EE1A 2CH4A 3RLOA 3VR4A 3P1HA 4N8X1 3HOUG 1NSNS 1C8CA 1KLGD 5IYCH 4EVOA 3JC66 2Q2TA 4ZK9B 2WIIB 2SDFA 3E9IA 3CU7A 4QIWE 4JI3Q 1RD9D 4X62Q 2I46A 4UAIA 3CCJA 1EFID 3C46A 4KJNA 1BOSA 4OELB 4YWKA 3SK5A 1Y8OB 2BA1A 1B70B 1V9PA 5D3DA 2QEXA 5C4ZA 4PZ7A 3H09A 4DK6C 1EU3A 4JI0Q 2UUCL 2KBNA 2JK8A 1ZEQX 1M4VA 2NUCA 2QA4A 5GADC 3J80E 2F0IA 2HCCA 1PYSB 1OXUA 1SMYD 4BY7H 4DUZQ 4A3GB 2F4VL 4JV5Q 2M00A 1N9WA 5C3XA 5I6WA 4IQZA 3U9OA 1GUNA 2K33A 3H0GB 1VQHA 4HCEA 1B8AA 2EY6A 2F0LA 3GTKH 2K5WA 4KN7C 5JJIA 4NDXA 2WB1B 4DV2Q 2RQXA 4DR5L 4P73A 3EVQA 1WTWA 3TQYA 1WD1A 3S17B 1MSGA 1VQEA 1MKHA 1CZGA 4X6AH 1CKNB 1TWCH 2PZWA 1P16A 2RDHA 4C3IG 4B9WA 1EYDA 3URYA 2MFIA 2JXMB 4FXDA 4Q5VA 2UXDQ 1BCPD 2EYOA 1K3RA 2B29A 3CXCA 2R93G 4OEMB 3KLSA 2YTYA 1HZ9A 2QEJC 4LFAQ 3NWTA 1HNXL 4HN7A 3GTJB 4LWCA 3GDEA 4J1MA 2DN8A 4PQXA 5LMUQ 4BXXG 3GO5A 4JI8Q 3ICEA 3AFQA 1ZYRD 2AUJD 3Q22A 1L0XB 4F8MA 2XN9C 1PH1A 1XXGA 1E22A 2B2UA 1SNCA 3QIAA 2E2JB 3MXGA 4HJ8A 2UXBQ 3D3RA 3RD4A 5NUCA 1I4GA 1EIGA 3DHQA 4BY1H 2ZJQA 2CH4W 4E6IA 2XVSA 1C7YA 3W1GA 5A35A 3UI2A 5J22A 1CQFA 1KLUD 5BR8L 4IUPA 5M5XB 5EPKA 3S2DB 3DMUA 4ZLTF 2J4XA 2ASBA 1DOMA 3UDIA 4KD3A 1I50B 1ASZA 3NSWA 1ENFA 3PO2H 1X3GA 1NBWA 3TP5A 4IUQA 3E3XA 2NVQH 1OO9B 2WP8J 2K5QA 1LABA 4IJLA 4EQPA 4S3SA 4R4QA 3K58A 4A3DH 1VQLA 1E7ZA 4JBWA 2UXCQ 4N9PA 5ISRA 2AQ2B 2K5HA 4A3KG 3CC7A 1XNQL 2B8GA 4JI6Q 2F0DA 2CWPA 1EY6A 4X3UA 2NTSA 4KHPL 2RSNA 4X64Q 3D4DA 1K3BC 4NB3A 4OWWB 4LF7L 4GS3A 1QCBD 3HOZB 2X6LA 2E2HH 3L0OA 3OIQA 4R4TA 2E74C 3OOCA 1DOKA 1VDZA 2ID0A 3D0FA 1BUVT 3PUVA 2B2WC 4DUYL 2N55A 4DV6Q 1U4LA 2K6AA
chains in the Genus database with same CATH topology
2EXDA 2K4KA 5ELNA 3EIVA 3I4MH 3I4NG 4EX5A 4UY8C 1VQFA 2D0PA 2WAQE 4PZ8A 1XMOL 3HOYG 3B6YA 1Q81C 2Y0SE 4DV4L 1YZ6A 1G291 3KOJA 1VQPA 4B3TQ 4GNXA 4DV4Q 2JA9A 4P71A 3GD7A 3CMEA 2UUAL 2JE6I 2EIFA 2UU9L 3CCUA 2BH2A 1PV4A 1HNWL 2UUAQ 3NEMA 1TWGH 4P72A 1HNWQ 2N8NA 5M3MH 4A3EH 1PH3A 2NVYH 4RMFA 1E24A 2AMCB 4YWMA 3EN2A 1XJVA 4ALPA 4JBMA 4BXXG 4A3CH 2JQOA 1YJWA 3H3VI 5LMNQ 1QVGA 4GNXC 2CWAA 1SN8A 2YV5A 3TS2A 1K9MC 3HOYH 3GTMH 1JJ2A 1NE3A 5C4XH 3KF8B 3KFUA 1QUQB 4GKJL 1B7YB 1U0LA 1VQJA 2E8GA 4JBKA 1OXTA 1N34L 1CSQA 4GKJQ 5E7NA 5K36G 2KHIA 3BZCA 1EWIA 4KLKA 2K14A 4YWLA 1Y1VH 3UE0A 5JEAG 1AE2A 4DR4L 1PH9A 1HNXQ 3AEVA 2C35B 2V1CC 1A8VA 4NPSA 2GVAA 4DR4Q 3CCMA 1UE7A 2FXQA 5GAGC 3J7ZC 2PNHA 5FLMH 3KLWA 1FL0A 4R1JA 4O0AA 1J5EL 3HOWG 2VZAA 4LFBL 2HIVA 1JE5A 1YITA 3PUZA 1J5EQ 1SROA 4LF8L 1EIYB 2JA6G 4GN5A 4LFBQ 1L2FA 1J6QA 2Z6KC 3F8TA 1JB7A 4LUVA 4A3MG 1HR0L 1KQSA 4LF4L 4LF8Q 3F2BA 4IFDJ 4P74A 2HHHQ 1TWFH 4LF4Q 3S16H 1N32Q 1HR0Q 1K83H 2B3GA 2VL6A 3ULPA 1YI2A 4P75A 3NELA 3PUYA 2R7DA 1X3EA 5M3FH 4BBSG 3H3VH 1G6PA 4HIDA 4B3ML 2I5MX 2CCZA 2JA5G 2IHEA 4B3MQ 4A3JH 1FVIA 1NMGA 4NXNQ 1X55A 1VQ4A 4L5SA 4PZ6A 1SRUA 3RZDH 4BXXH 4JI7Q 4BA2I 3HOWH 4DV0L 1NJIC 2HT1A 5C4JH 4DV5Q 4UPAA 1LM0A 2ALYB 2JA8H 4DV0Q 3A5ZB 3HFZB 4HIKA 2DUDA 4C2MH 1HZBA 3NENA 4UP7A 5BR8Q 2OQKA 1VCIA 4A3MH 1SE8A 1V43A 4C3HH 1KIXA 3T1HL 1I94L 4LF6Q 2OTJA 1VQMA 2YU9H 2ZTEA 1K0RA 3FKIH 3AYHB 3T1HQ 3CAMA 1HH2P 3J80c 4APVA 3KF6A 3L2PA 1I3QH 1WI5A 1Y1WG 2N3SA 5EAYA 3JAMi 3CC2A 5IP7G 2KHJA 3CCVA 4H02A 1QVCA 1EIFA 2EQSA 2HQLA 4GLVB 1C0AA 4AYBG 3TS0A 4A3LH 1WFQA 2N78A 4IPHA 4A3FH 5IYCG 3CC4A 4JI2L 4IJHA 3S15H 3STBD 5IP9G 3E9HA 2GVBA 1X65A 2HIXA 4LF5L 1VQNA 2ATWA 2D62A 3KDFB 4BBRG 4LF5Q 3NBHB 2Q2HA 2E2IH 1FJGL 4NXML 4A3GG 3K8AA 1FJGQ 2A19A 4NXMQ 2AKWB 4OWXB 3CCRA 4L5RC 4LUZA 1QVFA 1AH9A 1JT8A 1WJJA 4DR3L 4HIOA 2ZM6L 3U4VA 4DR3Q 4GNXB 5JJKA 3H0GG 2ZM6Q 3CQZH 4DR2L 2OWOA 4B3SL 3HOUH 1UE1A 4DR2Q 4JOIA 1SR3A 5FJ8H 4B3SQ 2K50A 1LYLA 3GTGH 1Q46A 4J15A 3M3YH 2WB1G 4BBRH 4A3BH 4MTNA 4JYAL 1Q12A 3UDXA 1YJNA 4DV7L 3CPWA 1KL9A 4JI3L 4JYAQ 4DV7Q 3PV0A 4X62L 3G6EA 2PI2A 4HJ9A 4DUYQ 3CW2C 1IYJB 1VQGA 2OCEA 4IO9A 4JOIC 2GN5A 4OXPA 3W5OA 2Q2IA 3BZKA 5H1SE 3H15A 3AQQA 1R9TH 2R7ZH 2JEBI 3J81i 3VDYA 1XMOQ 1XMQL 3T1YL 1LUZA 1HR0W 3OYYA 4DR7L 5GAHC 1PH4A 3M85A 1XMQQ 3ZJYC 3T1YQ 4DR7Q 4IOAA 2I5LX 3I7FA 3M9BA 2UU9Q 3BJUA 1Q86C 4DPGA 1GM5A 3CCLA 4IPDA 2YTVA 3PCOB 4XIGS 5IE8A 3PO3G 4JI4L 3A5UA 1AE3A 3I4NH 4TQUS 1MJEA 1C9OA 1X6OA 2AWOA 1S72A 1H95A 4Y52H 2RCNA 3PIPA 3GTQH 3G4SA 2VW9A 4DNIA 4POFA 1YHBA 3UE1A 3OW2A 4QGUA 3S24A 3IRBA 2NZHA 3DM3A 4DV2L 2VS1A 5M5YH 1BVSA 1OXVA 2WFWA 5IYBG 4HIMA 4A75A 5C0XG 4A93G 3I2ZA 4OWTB 1N34Q 4IFDG 1HZAA 1S3OA 1A0IA 1VQAA 3MXNB 1KHIA 3CCEA 4FDBA 5GROA 3PO3H 2A1AA 2VQFL 1YBYA 3GTJH 3RN5A 1YNXA 5J3BA 3HOXG 3LGJA 2VQFQ 2F52A 4YCWA 3S1RH 4OO1I 2VNUD 5JJLA 4AYBE 1X54A 2PMZE 4LUOA 4DV1L 4XTCS 1OXXK 1IXRA 4AH6A 1K8GA 2R93H 4DV1Q 1IBLL 2R92G 4GN3B 3S1QH 4IPCA 1IBLQ 3S2HH 3U4ZA 3KF6B 3M4OH 2E2JH 4JI5L 4BA1I 1Q8KA 2QGQA 3KJPA 3GTLH 4LFAL 3J7A5 2D0OA 3S14H 4JI5Q 2RF4A 1T9HA 2CKZB 2KENA 1PFSA 2JA7G 1KD1C 1NTGA 1N36L 1WCMG 2NVTH 4BY1G 4OO1G 1N36Q 4PG3A 3DLLA 5DLQE 3PF5A 2K52A 4QJFA 2XTIA 1E3PA 2F3IA 1A62A 1W3SA 1E1OA 4PMWA 4JI8L 2JJQA 1Z9FA 1EQQA 2WAQG 5C3EG 3TREA 2R92H 1XNRL 1WYDA 4OX9L 1CKNA 2JA6H 2WB1E 3AFPA 1UWVA 1HNZL 2VUMG 3S2DH 4C3JH 3HKZG 4QY7A 2XGTA 3K0XA 1E1TA 4OX9Q 1NY4A 4AQYL 2LXKA 2UXBL 2CFMA 3CP0A 4AQYQ 1QZGA 1I50H 1OTCA 1I94Q 1HZCA 1OXSC 2K5VA 4R4OA 4YY3L 4HJAA 1YIJA 1VQ9A 4BBSH 1WCMH 4YY3Q 1LTLA 4JI1L 3SGIA 2JA5H 2JEAI 1MIUA 4A3IG 3KYHC 1PH6A 1HJPA 4QQBX 4GLAC 1FGUA 4WJ4A 4JI1Q 1PH2A 3ULJA 1JJCB 2NVXH 2NN6G 4JBJA 1VQCA 3F2CA 5C3EH 1ASYA 3HOVG 1Z47A 3JAMc 1IBML 3HOZG 2UUBL 4JI2Q 2OTLA 1XPUA 2Z0SA 1CKMA 3CCQA 2VUMH 1XTDA 3FP9A 1Q1EA 2UUBQ 1VQKA 3ERSX 2YYZA 1O7IA 1SLJA 4EQ5A 4HJ5A 5AJ3L 3PF4A 3M4QA 4MZ9A 4DR6L 1RL2A 3I55A 3TRZA 2A8VA 5AJ3Q 4B3RL 1Y1WH 3ULLA 3BU2A 2ZJPA 4B3RQ 2KCMA 5IP7H 4GOPA 1V1QA 1EYGA 3CCSA 2MO0A 1UE5A 3RLOA 3HOUG 3CF5A 3U58A 5IYCH 4K0KL 5IP9H 3I4OA 2NZOA 1XPRA 3OTOL 4K0KQ 4IPGA 4DAYB 3JC66 2E5LL 2Q2TA 2AHOB 1L1OA 3OTOQ 4DV3L 2RHSB 4A3GH 1WOCA 3U50C 3E9IA 4DV3Q 2ZTCA 4QIWE 4BY7G 3WWVA 3PUXA 5IT9c 4JI3Q 4UP9A 1D8LA 4X62Q 1TWAH 2ZTDA 1D7QA 4X66L 2MNAA 5ELOA 3CCJA 3I4MG 1YJ9A 1N33L 4YWKA 2BA0A 1IBKL 3H0GH 4X66Q 1VQDA 2BA1A 1N33Q 2DGYA 1B70B 1V9PA 2AWNA 3K7AH 2QEXA 1L1OC 1QZHA 5IWAL 4PZ7A 4JI0L 4DK6C 2H5XA 3RLFA 4JI0Q 3UDFA 2UUCL 2KBNA 2JK8A 5IWAQ 2PI2E 2UUCQ 2QA4A 5GADC 2YTXA 1PYSB 1OXUA 4JG2A 1KRSA 4DUZL 5M5WH 3J81c 1L0WA 5C0XI 4JV5L 4BY7H 4DUZQ 2F4VL 4IFDI 3GTOH 5M3MG 4JV5Q 3PUWA 1X3FA 2F4VQ 5HGQA 3S17H 4A3CG 1N9WA 2OQ0A 3A74A 4JI4Q 1P8LA 3M7NA 1YVCA 3K81C 2IY5B 2I0QA 3CMAA 4JC0A 4B3TL 1VQHA 3I56A 4LFCL 1EFWA 3KJOA 2B63G 4GKKL 1IZ6A 5C4XG 1B8AA 4GKKQ 4YHHL 4LFCQ 2PQAA 3HKZE 3GTKH 5JJIA 4YHHQ 4IOCA 1K8AC 4DV2Q 4O2DA 4DR5L 1PHJA 4GN4B 1KAWA 4P73A 1Y1VG 1TWHH 4DR5Q 3TQYA 3CPFA 5LMNL 1DGSA 1RIPA 1EUJA 1VQEA 1MKHA 2LSSA 2L15A 1PA6A 4DAMA 3S1MH 4X6AH 1CKNB 1PH8A 4LF9L 1TWCH 1Y14B 1P16A 2B63H 5FLMG 4LF9Q 2MFIA 4L5TA 3RLNA 1KXLA 1CSPA 2UXDL 4ME3A 4DR1L 5IYBH 3A0JA 1NMFA 5HY6A 2UXDQ 4DR1Q 4R4IA 1K3RA 2B29A 5GAEC 4A93H 3CXCA 2K75A 3RZOH 2R93G 1GD7A 4A76A 3S1NH 2YTYA 1HZ9A 5IY0A 4LFAQ 2IX1A 2Z6KA 3HOXH 1SFOH 1HNXL 5M3FG 2Q2UA 5FLXc 2I5HA 1X9NA 4LWCA 5IYDG 3GDEA 1JJGA 1CUKA 4A3JG 1PVOA 4L5QA 5LMUL 2BH8A 4C3IH 1UEBA 3RR5A 2LXJA 2NN6I 5LMUQ 1EQRA 1UE6A 1X56A 3GO5A 1Q1BA 2MO1A 4JI8Q 2Y0SG 1GO3E 3AFQA 3ER0A 3K7UC 3ICEA 5M5XH 1PH5A 2JA8G 2VY3A 3EBEA 1BKBA 4A4IA 1XNRQ 4DK3C 1M1KC 2HHHL 5C0XJ 1N32L 1PH1A 1HNZQ 3TEHB 1E22A 4YCUA 4GOPB 1VQ7A 4HJ8A 1QUQA 5C44G 1VQOA 2JA7H 2CQOA 4QL5A 5JEAJ 3FKIG 4LNQA 4DKAC 1I6HH 4JCVE 1G51A 4BY1H 2VQEL 2IX0A 3F1ZA 4NXNL 2ZJQA 3PO2G 5IYDH 2VQEQ 4MNOA 1C7YA 3W1BA 3W1GA 4RG1A 4JI7L 1YHQA 3CD6A 3M4PA 4DV5L 4A3LG 1L1OB 3FHWA 4A3FG 3MEFA 1VS0A 3PGZA 5BR8L 3HKSA 3J80i 4KI0A 1IBMQ 3UDGA 4LW1A 4LF6L 1PH7A 4A3DG 4WJ3M 4UP8A 1U5KA 2ASBA 5C44H 2ZJRA 3PSIA 3UDIA 4POGA 1ASZA 4DR6Q 1I5FA 3GTPH 2IT1A 1Q7YC 3PO2H 1X3GA 4X65L 4A3IH 1NBWA 3F2DA 4GLXA 4X65Q 1M90C 1A63A 2R6GA 1JMCA 1BBWA 1GVPA 2ES2A 2NVQH 2R7ZG 3RN2A 2N49A 2UXBQ 2WP8J 3J81j 3HOVH 4IJLA 3HOZH 1Q82C 1VQIA 5FJ8G 3L7ZC 1S40A 1MJCA 4R4QA 1KRTA 4Y7NH 1CKOA 1W2BA 1KC8C 2UXCL 4A3DH 4A3BG 1VQLA 2E5LQ 1E7ZA 4JBWA 4GOPC 2UXCQ 3D31A 5LMNW 4AIMA 2K5HA 4JI6L 4A3KG 3G48A 3STBC 4X64L 3PIOA 3CC7A 1XNQL 4JI6Q 2CWPA 4KHPL 4X64Q 1N8RC 1XNQQ 3RNUA 4KHPQ 1YEZA 1XPOA 4YCVA 2IHFA 2R7FA 1BBUA 2K5NA 2PQAB 4NB3A 1VQ5A 3G71A 2KCTA 4LF7L 1GKHA 2MQHA 1IBKQ 4OWWB 1VQ6A 4GS3A 1EOVA 4HJ7A 3E0EA 1VQBA 4LF7Q 1VQ8A 1K73C 1PYBA 2E2HH 3L0OA 4OONA 4R4TA 4TVAB 3Q8DA 2ID0A 5GQOA 3D0FA 4DV6L 1YHAA 3PUVA 3K80C 1TXYA 4DUYL 4DV6Q 4A3KH 4KHZA 4R4CA 4A3EG 3KDFA 1SMXA 1IL2A 2RHQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EXD A;  2K4K A;  5ELN A;  3EIV A;  3I4M H;  3I4N G;  4EX5 A;  4UY8 C;  1VQF A;  2D0P A;  2WAQ E;  4PZ8 A;  1XMO L;  3HOY G;  3B6Y A;  1Q81 C;  2Y0S E;  4DV4 L;  1YZ6 A;  1G29 1;  3KOJ A;  1VQP A;  4B3T Q;  4GNX A;  4DV4 Q;  2JA9 A;  4P71 A;  3GD7 A;  3CME A;  2UUA L;  2JE6 I;  2EIF A;  2UU9 L;  3CCU A;  2BH2 A;  1PV4 A;  1HNW L;  2UUA Q;  3NEM A;  1TWG H;  4P72 A;  1HNW Q;  2N8N A;  5M3M H;  4A3E H;  1PH3 A;  2NVY H;  4RMF A;  1E24 A;  2AMC B;  4YWM A;  3EN2 A;  1XJV A;  4ALP A;  4JBM A;  4BXX G;  4A3C H;  2JQO A;  1YJW A;  3H3V I;  5LMN Q;  1QVG A;  4GNX C;  2CWA A;  1SN8 A;  2YV5 A;  3TS2 A;  1K9M C;  3HOY H;  3GTM H;  1JJ2 A;  1NE3 A;  5C4X H;  3KF8 B;  3KFU A;  1QUQ B;  4GKJ L;  1B7Y B;  1U0L A;  1VQJ A;  2E8G A;  4JBK A;  1OXT A;  1N34 L;  1CSQ A;  4GKJ Q;  5E7N A;  5K36 G;  2KHI A;  3BZC A;  1EWI A;  4KLK A;  2K14 A;  4YWL A;  1Y1V H;  3UE0 A;  5JEA G;  1AE2 A;  4DR4 L;  1PH9 A;  1HNX Q;  3AEV A;  2C35 B;  2V1C C;  1A8V A;  4NPS A;  2GVA A;  4DR4 Q;  3CCM A;  1UE7 A;  2FXQ A;  5GAG C;  3J7Z C;  2PNH A;  5FLM H;  3KLW A;  1FL0 A;  4R1J A;  4O0A A;  1J5E L;  3HOW G;  2VZA A;  4LFB L;  2HIV A;  1JE5 A;  1YIT A;  3PUZ A;  1J5E Q;  1SRO A;  4LF8 L;  1EIY B;  2JA6 G;  4GN5 A;  4LFB Q;  1L2F A;  1J6Q A;  2Z6K C;  3F8T A;  1JB7 A;  4LUV A;  4A3M G;  1HR0 L;  1KQS A;  4LF4 L;  4LF8 Q;  3F2B A;  4IFD J;  4P74 A;  2HHH Q;  1TWF H;  4LF4 Q;  3S16 H;  1N32 Q;  1HR0 Q;  1K83 H;  2B3G A;  2VL6 A;  3ULP A;  1YI2 A;  4P75 A;  3NEL A;  3PUY A;  2R7D A;  1X3E A;  5M3F H;  4BBS G;  3H3V H;  1G6P A;  4HID A;  4B3M L;  2I5M X;  2CCZ A;  2JA5 G;  2IHE A;  4B3M Q;  4A3J H;  1FVI A;  1NMG A;  4NXN Q;  1X55 A;  1VQ4 A;  4L5S A;  4PZ6 A;  1SRU A;  3RZD H;  4BXX H;  4JI7 Q;  4BA2 I;  3HOW H;  4DV0 L;  1NJI C;  2HT1 A;  5C4J H;  4DV5 Q;  4UPA A;  1LM0 A;  2ALY B;  2JA8 H;  4DV0 Q;  3A5Z B;  3HFZ B;  4HIK A;  2DUD A;  4C2M H;  1HZB A;  3NEN A;  4UP7 A;  5BR8 Q;  2OQK A;  1VCI A;  4A3M H;  1SE8 A;  1V43 A;  4C3H H;  1KIX A;  3T1H L;  1I94 L;  4LF6 Q;  2OTJ A;  1VQM A;  2YU9 H;  2ZTE A;  1K0R A;  3FKI H;  3AYH B;  3T1H Q;  3CAM A;  1HH2 P;  3J80 c;  4APV A;  3KF6 A;  3L2P A;  1I3Q H;  1WI5 A;  1Y1W G;  2N3S A;  5EAY A;  3JAM i;  3CC2 A;  5IP7 G;  2KHJ A;  3CCV A;  4H02 A;  1QVC A;  1EIF A;  2EQS A;  2HQL A;  4GLV B;  1C0A A;  4AYB G;  3TS0 A;  4A3L H;  1WFQ A;  2N78 A;  4IPH A;  4A3F H;  5IYC G;  3CC4 A;  4JI2 L;  4IJH A;  3S15 H;  3STB D;  5IP9 G;  3E9H A;  2GVB A;  1X65 A;  2HIX A;  4LF5 L;  1VQN A;  2ATW A;  2D62 A;  3KDF B;  4BBR G;  4LF5 Q;  3NBH B;  2Q2H A;  2E2I H;  1FJG L;  4NXM L;  4A3G G;  3K8A A;  1FJG Q;  2A19 A;  4NXM Q;  2AKW B;  4OWX B;  3CCR A;  4L5R C;  4LUZ A;  1QVF A;  1AH9 A;  1JT8 A;  1WJJ A;  4DR3 L;  4HIO A;  2ZM6 L;  3U4V A;  4DR3 Q;  4GNX B;  5JJK A;  3H0G G;  2ZM6 Q;  3CQZ H;  4DR2 L;  2OWO A;  4B3S L;  3HOU H;  1UE1 A;  4DR2 Q;  4JOI A;  1SR3 A;  5FJ8 H;  4B3S Q;  2K50 A;  1LYL A;  3GTG H;  1Q46 A;  4J15 A;  3M3Y H;  2WB1 G;  4BBR H;  4A3B H;  4MTN A;  4JYA L;  1Q12 A;  3UDX A;  1YJN A;  4DV7 L;  3CPW A;  1KL9 A;  4JI3 L;  4JYA Q;  4DV7 Q;  3PV0 A;  4X62 L;  3G6E A;  2PI2 A;  4HJ9 A;  4DUY Q;  3CW2 C;  1IYJ B;  1VQG A;  2OCE A;  4IO9 A;  4JOI C;  2GN5 A;  4OXP A;  3W5O A;  2Q2I A;  3BZK A;  5H1S E;  3H15 A;  3AQQ A;  1R9T H;  2R7Z H;  2JEB I;  3J81 i;  3VDY A;  1XMO Q;  1XMQ L;  3T1Y L;  1LUZ A;  1HR0 W;  3OYY A;  4DR7 L;  5GAH C;  1PH4 A;  3M85 A;  1XMQ Q;  3ZJY C;  3T1Y Q;  4DR7 Q;  4IOA A;  2I5L X;  3I7F A;  3M9B A;  2UU9 Q;  3BJU A;  1Q86 C;  4DPG A;  1GM5 A;  3CCL A;  4IPD A;  2YTV A;  3PCO B;  4XIG S;  5IE8 A;  3PO3 G;  4JI4 L;  3A5U A;  1AE3 A;  3I4N H;  4TQU S;  1MJE A;  1C9O A;  1X6O A;  2AWO A;  1S72 A;  1H95 A;  4Y52 H;  2RCN A;  3PIP A;  3GTQ H;  3G4S A;  2VW9 A;  4DNI A;  4POF A;  1YHB A;  3UE1 A;  3OW2 A;  4QGU A;  3S24 A;  3IRB A;  2NZH A;  3DM3 A;  4DV2 L;  2VS1 A;  5M5Y H;  1BVS A;  1OXV A;  2WFW A;  5IYB G;  4HIM A;  4A75 A;  5C0X G;  4A93 G;  3I2Z A;  4OWT B;  1N34 Q;  4IFD G;  1HZA A;  1S3O A;  1A0I A;  1VQA A;  3MXN B;  1KHI A;  3CCE A;  4FDB A;  5GRO A;  3PO3 H;  2A1A A;  2VQF L;  1YBY A;  3GTJ H;  3RN5 A;  1YNX A;  5J3B A;  3HOX G;  3LGJ A;  2VQF Q;  2F52 A;  4YCW A;  3S1R H;  4OO1 I;  2VNU D;  5JJL A;  4AYB E;  1X54 A;  2PMZ E;  4LUO A;  4DV1 L;  4XTC S;  1OXX K;  1IXR A;  4AH6 A;  1K8G A;  2R93 H;  4DV1 Q;  1IBL L;  2R92 G;  4GN3 B;  3S1Q H;  4IPC A;  1IBL Q;  3S2H H;  3U4Z A;  3KF6 B;  3M4O H;  2E2J H;  4JI5 L;  4BA1 I;  1Q8K A;  2QGQ A;  3KJP A;  3GTL H;  4LFA L;  3J7A 5;  2D0O A;  3S14 H;  4JI5 Q;  2RF4 A;  1T9H A;  2CKZ B;  2KEN A;  1PFS A;  2JA7 G;  1KD1 C;  1NTG A;  1N36 L;  1WCM G;  2NVT H;  4BY1 G;  4OO1 G;  1N36 Q;  4PG3 A;  3DLL A;  5DLQ E;  3PF5 A;  2K52 A;  4QJF A;  2XTI A;  1E3P A;  2F3I A;  1A62 A;  1W3S A;  1E1O A;  4PMW A;  4JI8 L;  2JJQ A;  1Z9F A;  1EQQ A;  2WAQ G;  5C3E G;  3TRE A;  2R92 H;  1XNR L;  1WYD A;  4OX9 L;  1CKN A;  2JA6 H;  2WB1 E;  3AFP A;  1UWV A;  1HNZ L;  2VUM G;  3S2D H;  4C3J H;  3HKZ G;  4QY7 A;  2XGT A;  3K0X A;  1E1T A;  4OX9 Q;  1NY4 A;  4AQY L;  2LXK A;  2UXB L;  2CFM A;  3CP0 A;  4AQY Q;  1QZG A;  1I50 H;  1OTC A;  1I94 Q;  1HZC A;  1OXS C;  2K5V A;  4R4O A;  4YY3 L;  4HJA A;  1YIJ A;  1VQ9 A;  4BBS H;  1WCM H;  4YY3 Q;  1LTL A;  4JI1 L;  3SGI A;  2JA5 H;  2JEA I;  1MIU A;  4A3I G;  3KYH C;  1PH6 A;  1HJP A;  4QQB X;  4GLA C;  1FGU A;  4WJ4 A;  4JI1 Q;  1PH2 A;  3ULJ A;  1JJC B;  2NVX H;  2NN6 G;  4JBJ A;  1VQC A;  3F2C A;  5C3E H;  1ASY A;  3HOV G;  1Z47 A;  3JAM c;  1IBM L;  3HOZ G;  2UUB L;  4JI2 Q;  2OTL A;  1XPU A;  2Z0S A;  1CKM A;  3CCQ A;  2VUM H;  1XTD A;  3FP9 A;  1Q1E A;  2UUB Q;  1VQK A;  3ERS X;  2YYZ A;  1O7I A;  1SLJ A;  4EQ5 A;  4HJ5 A;  5AJ3 L;  3PF4 A;  3M4Q A;  4MZ9 A;  4DR6 L;  1RL2 A;  3I55 A;  3TRZ A;  2A8V A;  5AJ3 Q;  4B3R L;  1Y1W H;  3ULL A;  3BU2 A;  2ZJP A;  4B3R Q;  2KCM A;  5IP7 H;  4GOP A;  1V1Q A;  1EYG A;  3CCS A;  2MO0 A;  1UE5 A;  3RLO A;  3HOU G;  3CF5 A;  3U58 A;  5IYC H;  4K0K L;  5IP9 H;  3I4O A;  2NZO A;  1XPR A;  3OTO L;  4K0K Q;  4IPG A;  4DAY B;  3JC6 6;  2E5L L;  2Q2T A;  2AHO B;  1L1O A;  3OTO Q;  4DV3 L;  2RHS B;  4A3G H;  1WOC A;  3U50 C;  3E9I A;  4DV3 Q;  2ZTC A;  4QIW E;  4BY7 G;  3WWV A;  3PUX A;  5IT9 c;  4JI3 Q;  4UP9 A;  1D8L A;  4X62 Q;  1TWA H;  2ZTD A;  1D7Q A;  4X66 L;  2MNA A;  5ELO A;  3CCJ A;  3I4M G;  1YJ9 A;  1N33 L;  4YWK A;  2BA0 A;  1IBK L;  3H0G H;  4X66 Q;  1VQD A;  2BA1 A;  1N33 Q;  2DGY A;  1B70 B;  1V9P A;  2AWN A;  3K7A H;  2QEX A;  1L1O C;  1QZH A;  5IWA L;  4PZ7 A;  4JI0 L;  4DK6 C;  2H5X A;  3RLF A;  4JI0 Q;  3UDF A;  2UUC L;  2KBN A;  2JK8 A;  5IWA Q;  2PI2 E;  2UUC Q;  2QA4 A;  5GAD C;  2YTX A;  1PYS B;  1OXU A;  4JG2 A;  1KRS A;  4DUZ L;  5M5W H;  3J81 c;  1L0W A;  5C0X I;  4JV5 L;  4BY7 H;  4DUZ Q;  2F4V L;  4IFD I;  3GTO H;  5M3M G;  4JV5 Q;  3PUW A;  1X3F A;  2F4V Q;  5HGQ A;  3S17 H;  4A3C G;  1N9W A;  2OQ0 A;  3A74 A;  4JI4 Q;  1P8L A;  3M7N A;  1YVC A;  3K81 C;  2IY5 B;  2I0Q A;  3CMA A;  4JC0 A;  4B3T L;  1VQH A;  3I56 A;  4LFC L;  1EFW A;  3KJO A;  2B63 G;  4GKK L;  1IZ6 A;  5C4X G;  1B8A A;  4GKK Q;  4YHH L;  4LFC Q;  2PQA A;  3HKZ E;  3GTK H;  5JJI A;  4YHH Q;  4IOC A;  1K8A C;  4DV2 Q;  4O2D A;  4DR5 L;  1PHJ A;  4GN4 B;  1KAW A;  4P73 A;  1Y1V G;  1TWH H;  4DR5 Q;  3TQY A;  3CPF A;  5LMN L;  1DGS A;  1RIP A;  1EUJ A;  1VQE A;  1MKH A;  2LSS A;  2L15 A;  1PA6 A;  4DAM A;  3S1M H;  4X6A H;  1CKN B;  1PH8 A;  4LF9 L;  1TWC H;  1Y14 B;  1P16 A;  2B63 H;  5FLM G;  4LF9 Q;  2MFI A;  4L5T A;  3RLN A;  1KXL A;  1CSP A;  2UXD L;  4ME3 A;  4DR1 L;  5IYB H;  3A0J A;  1NMF A;  5HY6 A;  2UXD Q;  4DR1 Q;  4R4I A;  1K3R A;  2B29 A;  5GAE C;  4A93 H;  3CXC A;  2K75 A;  3RZO H;  2R93 G;  1GD7 A;  4A76 A;  3S1N H;  2YTY A;  1HZ9 A;  5IY0 A;  4LFA Q;  2IX1 A;  2Z6K A;  3HOX H;  1SFO H;  1HNX L;  5M3F G;  2Q2U A;  5FLX c;  2I5H A;  1X9N A;  4LWC A;  5IYD G;  3GDE A;  1JJG A;  1CUK A;  4A3J G;  1PVO A;  4L5Q A;  5LMU L;  2BH8 A;  4C3I H;  1UEB A;  3RR5 A;  2LXJ A;  2NN6 I;  5LMU Q;  1EQR A;  1UE6 A;  1X56 A;  3GO5 A;  1Q1B A;  2MO1 A;  4JI8 Q;  2Y0S G;  1GO3 E;  3AFQ A;  3ER0 A;  3K7U C;  3ICE A;  5M5X H;  1PH5 A;  2JA8 G;  2VY3 A;  3EBE A;  1BKB A;  4A4I A;  1XNR Q;  4DK3 C;  1M1K C;  2HHH L;  5C0X J;  1N32 L;  1PH1 A;  1HNZ Q;  3TEH B;  1E22 A;  4YCU A;  4GOP B;  1VQ7 A;  4HJ8 A;  1QUQ A;  5C44 G;  1VQO A;  2JA7 H;  2CQO A;  4QL5 A;  5JEA J;  3FKI G;  4LNQ A;  4DKA C;  1I6H H;  4JCV E;  1G51 A;  4BY1 H;  2VQE L;  2IX0 A;  3F1Z A;  4NXN L;  2ZJQ A;  3PO2 G;  5IYD H;  2VQE Q;  4MNO A;  1C7Y A;  3W1B A;  3W1G A;  4RG1 A;  4JI7 L;  1YHQ A;  3CD6 A;  3M4P A;  4DV5 L;  4A3L G;  1L1O B;  3FHW A;  4A3F G;  3MEF A;  1VS0 A;  3PGZ A;  5BR8 L;  3HKS A;  3J80 i;  4KI0 A;  1IBM Q;  3UDG A;  4LW1 A;  4LF6 L;  1PH7 A;  4A3D G;  4WJ3 M;  4UP8 A;  1U5K A;  2ASB A;  5C44 H;  2ZJR A;  3PSI A;  3UDI A;  4POG A;  1ASZ A;  4DR6 Q;  1I5F A;  3GTP H;  2IT1 A;  1Q7Y C;  3PO2 H;  1X3G A;  4X65 L;  4A3I H;  1NBW A;  3F2D A;  4GLX A;  4X65 Q;  1M90 C;  1A63 A;  2R6G A;  1JMC A;  1BBW A;  1GVP A;  2ES2 A;  2NVQ H;  2R7Z G;  3RN2 A;  2N49 A;  2UXB Q;  2WP8 J;  3J81 j;  3HOV H;  4IJL A;  3HOZ H;  1Q82 C;  1VQI A;  5FJ8 G;  3L7Z C;  1S40 A;  1MJC A;  4R4Q A;  1KRT A;  4Y7N H;  1CKO A;  1W2B A;  1KC8 C;  2UXC L;  4A3D H;  4A3B G;  1VQL A;  2E5L Q;  1E7Z A;  4JBW A;  4GOP C;  2UXC Q;  3D31 A;  5LMN W;  4AIM A;  2K5H A;  4JI6 L;  4A3K G;  3G48 A;  3STB C;  4X64 L;  3PIO A;  3CC7 A;  1XNQ L;  4JI6 Q;  2CWP A;  4KHP L;  4X64 Q;  1N8R C;  1XNQ Q;  3RNU A;  4KHP Q;  1YEZ A;  1XPO A;  4YCV A;  2IHF A;  2R7F A;  1BBU A;  2K5N A;  2PQA B;  4NB3 A;  1VQ5 A;  3G71 A;  2KCT A;  4LF7 L;  1GKH A;  2MQH A;  1IBK Q;  4OWW B;  1VQ6 A;  4GS3 A;  1EOV A;  4HJ7 A;  3E0E A;  1VQB A;  4LF7 Q;  1VQ8 A;  1K73 C;  1PYB A;  2E2H H;  3L0O A;  4OON A;  4R4T A;  4TVA B;  3Q8D A;  2ID0 A;  5GQO A;  3D0F A;  4DV6 L;  1YHA A;  3PUV A;  3K80 C;  1TXY A;  4DUY L;  4DV6 Q;  4A3K H;  4KHZ A;  4R4C A;  4A3E G;  3KDF A;  1SMX A;  1IL2 A;  2RHQ B; 
#chains in the Genus database with same CATH topology
 4K8I A;  3I70 A;  2K4K A;  5ELN A;  1TY0 A;  1K8O A;  1TWA B;  3I4N G;  2F0F A;  2D0P A;  4PZ8 A;  3HOY G;  3HOU B;  3SK4 A;  1YZ6 A;  2AQ3 B;  3KOJ A;  4K5X A;  1VQP A;  4GNX A;  1HUM A;  1Y8P B;  3HEJ A;  4B3T Q;  4DV4 Q;  1EZ6 A;  2JA9 A;  4HR7 B;  2UUA L;  2JE6 I;  2BH2 A;  3NEM A;  4P72 A;  4O42 A;  5D65 A;  2NVY H;  2GA4 B;  1JWU D;  4ALP A;  1E0B A;  2IJ0 A;  5CV8 A;  1QVG A;  2YV5 A;  5G3L D;  2L11 A;  1NAP A;  4IAL A;  3KF8 B;  2K7V A;  2M2L A;  1QUQ B;  1U0L A;  5IT9 E;  1OXT A;  2KHI A;  4C1N K;  2K14 A;  4XDX A;  1HUN A;  1H9J A;  4DXG A;  3I3C A;  3NE5 B;  3FPP A;  2V1C C;  4NPS A;  3S1M B;  3NHH A;  3KLW A;  2XIW A;  2ZT9 C;  1BCP F;  4KY6 A;  4HSP A;  1J5E L;  3RMH A;  1YIT A;  1EIY B;  2HCI A;  1DYQ A;  4LFB Q;  2Z6K C;  3X3N A;  3C3L A;  5CV6 A;  4LF4 L;  5I2Y A;  3F2B A;  3NQI A;  1HR0 Q;  2VL6 A;  4R9W A;  3AMU A;  1XYI A;  5M3F H;  3NQT A;  1G6P A;  4B3M L;  2CCZ A;  1ONL A;  1ENC A;  3DWA A;  3MXN A;  1FVI A;  4NXN Q;  1STA A;  4Z9C B;  4I7Z C;  1VQ4 A;  4L5S A;  4C3I B;  3HOW H;  4DV0 L;  4HAE A;  4DV5 Q;  1IYV A;  2DUD A;  2K1B A;  3C1E A;  3M7G A;  4C2M H;  4A3M H;  1A3T A;  1SE8 A;  1SSO A;  1V43 A;  4C3H H;  2OTJ A;  4LF6 Q;  1F9P A;  2R93 B;  3OWE B;  4NKL A;  1JE4 A;  3CAM A;  1U4P A;  4APV A;  4FP5 D;  2G9D A;  3BDO A;  4K8J A;  1EOT A;  2EJG C;  5CYU A;  2EYM A;  3CC2 A;  4OHJ A;  1LAC A;  3N6R A;  1QVC A;  1B3A A;  2D5D A;  2LS0 1;  5FKA C;  3D6W A;  4JI2 L;  2HD3 A;  3A7L A;  4IPH A;  5IYC G;  3E9H A;  1STG A;  2HIX A;  5C4J B;  1VQN A;  1CT1 D;  2D62 A;  3KDF B;  3GV6 A;  1MSH A;  4EGV A;  1IYU A;  2E2I H;  3I73 A;  4NXM L;  4RHR A;  1FJG Q;  1DJR D;  2YU9 B;  4OWX B;  1STB A;  4HIO A;  2X6G A;  3U4V A;  1TII D;  3CQZ H;  2OWO A;  1D5M C;  2WIN B;  4B3S Q;  1SR3 A;  5FJ8 H;  2TSS A;  1Q46 A;  1QNU A;  4J15 A;  4BBR H;  1TS4 A;  3NK9 A;  4MTN A;  1YJN A;  3CPW A;  4JI3 L;  3PV0 A;  4PNY A;  4X62 L;  3G6E A;  4HJ9 A;  3GQB A;  3CW2 C;  3QB3 A;  1VQG A;  3A7A B;  2GN5 A;  3W5O A;  3GP7 A;  5H1S E;  2F3V A;  3Q6S A;  3GTG B;  1RKN A;  4DR7 L;  4NMZ A;  1GUT A;  3OMC A;  1XMQ Q;  3ZJY C;  1BQQ T;  5BN4 A;  2UU9 Q;  1GM5 A;  2F0E A;  3CCL A;  1UAP A;  2YTV A;  3PCO B;  4A3K B;  3PO3 G;  3A5U A;  4TQU S;  1MJE A;  1ESF A;  1C9O A;  1HXY D;  4Y52 H;  2D2C C;  5BN3 A;  3PIP A;  4OIJ A;  4DNI A;  3UE1 A;  1I4R A;  4R8I A;  2NZH A;  3DM3 A;  4DV2 L;  3K57 A;  1BVS A;  1AZP A;  4HIM A;  4A75 A;  4OGQ C;  4HED A;  2PQE A;  4EQN A;  4FDB A;  5FO7 B;  1S5E D;  5GRO A;  4WRD A;  4OO1 I;  4KHV A;  4AYB E;  2PMZ E;  4KTA A;  3I4N B;  1F2Y A;  3AB9 A;  4XTC S;  4M8A A;  3TZU A;  1K8G A;  5ELD A;  4DV1 Q;  2HDL A;  1TS5 A;  4IPC A;  2FMC A;  4FF1 A;  3U4Z A;  3O13 A;  3KF6 B;  3FRP B;  4BA1 I;  3S14 H;  3KJP A;  2EYH A;  2F0P A;  4LFA L;  4JI5 Q;  1ROD A;  1KD1 C;  2KEC A;  2NVT H;  4BY1 G;  4OO1 G;  1N36 Q;  2K52 A;  2F03 A;  2XTI A;  1A62 A;  1E1O A;  4JI8 L;  1Z9F A;  2R92 H;  1TR5 A;  1CKN A;  2DNC A;  2L1B A;  2F3W A;  3S1Q B;  2PZT A;  2Z1C A;  3S2H B;  2UXB L;  2LXK A;  4FXG C;  2CFM A;  5C3W A;  3GTL B;  1VQ9 A;  4BBS H;  1K83 B;  4QIW B;  5CGK A;  4KV6 A;  4L8J A;  1LTL A;  4JI1 L;  4RA8 A;  4XQN A;  2JA5 H;  1MIU A;  1PH6 A;  2JEA I;  1HJP A;  4KMU C;  4GLA C;  4WJ4 A;  4CDE C;  1MHW C;  4QUF A;  2MUY A;  1JJC B;  2F0O A;  3F2C A;  1IHZ A;  1LTT D;  3OHX C;  3DUZ A;  1V1P B;  5KND A;  2VUM H;  1CKM A;  1Q1E A;  1AN8 A;  4HJ5 A;  1O7I A;  3D6C A;  3PF4 A;  1GHJ A;  2QCP X;  2G9H D;  3I55 A;  3TRZ A;  4XQQ A;  5AJ3 Q;  1D6E C;  3BU2 A;  5EKI A;  1TQO A;  4FXK C;  1EYG A;  1J9O A;  2G5D A;  2NVX B;  4K0K L;  3I4O A;  5LHY 1;  1SNO A;  3OTO L;  5EBD A;  1JOR A;  4DV3 L;  1GXD C;  2ZTC A;  3WWV A;  1EQV A;  1D8L A;  2ZTD A;  3VR6 A;  1D7Q A;  4X66 L;  1YJ9 A;  1N33 L;  1VQD A;  2DGY A;  2AWN A;  3K7A H;  1QZH A;  5IWA L;  2NWG A;  4XXE A;  2NB0 A;  2H5X A;  1CZW A;  1SDF A;  4BS9 A;  4JG2 A;  5C0X I;  3GTO H;  2KVM A;  1KNE A;  2XSC A;  1QE6 A;  3K81 C;  1SMY C;  1KAB A;  4B3T L;  2B63 G;  4GKK L;  3KJO A;  1IZ6 A;  1E2W A;  4ODG A;  4LFC Q;  3HKZ E;  4HMJ A;  1B50 A;  4YHH Q;  4FF3 A;  5CV5 A;  1K8M A;  3JAM L;  1I6V C;  4O2D A;  2Z8L A;  4GN4 B;  3K6O A;  2OF1 A;  1TWH H;  3VR2 A;  3CPF A;  3NPP A;  3LNN A;  1DGS A;  1EUJ A;  3H91 A;  2LSS A;  3VYU A;  1PA6 A;  4LF9 L;  1PH8 A;  4LJZ C;  2A6E C;  5KYI A;  4ZAI A;  2B39 A;  5IYB H;  3A0J A;  1NMF A;  2MHV A;  3GTK B;  2K01 A;  4DR1 Q;  1JCK B;  1F9Q A;  4A93 H;  3MFG A;  4IFD H;  1GD7 A;  1LTG D;  5EPJ A;  1SFO H;  3HOX H;  5M3F G;  2I5H A;  3QOL A;  1JJG A;  4RCO A;  5CV7 A;  3NBI A;  2WKC A;  3RR5 A;  3LX0 A;  1EQR A;  5JJZ A;  1Q1B A;  5CV4 A;  3K7U C;  1GO3 E;  3ER0 A;  3W2D A;  5IGF A;  1QG7 A;  1PH5 A;  2BE5 C;  1EIH A;  3KF8 A;  1HNZ Q;  5FO8 B;  4C3H G;  4YCU A;  1QUQ A;  4KK7 A;  5C44 G;  3IAY A;  2CQO A;  4LNQ A;  1I6H H;  4DKA C;  1GJX A;  2VQE L;  5IYD H;  4NXN L;  4QB4 A;  2B2T C;  4RG1 A;  3VR5 A;  2F0T A;  4DV5 L;  1MBY A;  1L1O B;  2B2U C;  3HKS A;  4KY7 A;  3UDG A;  4LW1 A;  2M9V A;  4LF6 L;  4UP8 A;  4RGO S;  3V96 A;  2DNE A;  3GTP H;  1W6J A;  1DON A;  4CDD C;  1LLR D;  1TVX A;  4A3I H;  4N9T A;  1JOO A;  2B2V C;  3F2D A;  4BY1 B;  4X65 Q;  1JMC A;  1BBW A;  1GVP A;  2ES2 A;  2NN6 H;  1TU2 B;  2N49 A;  1LV9 A;  3J81 j;  1Q82 C;  1VQI A;  5FJ8 G;  1KRT A;  4Y7N H;  4TRD A;  2FIN B;  3ONA B;  2E5L Q;  4UHV A;  3KLS X;  3D31 A;  3STB C;  3BVZ A;  3PIO A;  1CHP D;  4RWS C;  1A6X A;  2NTT A;  3RNU A;  2IHF A;  2K5N A;  3KLR A;  4XYQ A;  5FLX L;  3R2I A;  5IGC A;  2R7Z H;  2E75 C;  1GKH A;  1VQB A;  2C5C A;  5DM6 3;  1HA6 A;  1PYB A;  4OON A;  2QDL A;  3Q8D A;  1CHQ D;  5GQO A;  1NR2 A;  4A3D B;  1JOQ A;  4R4C A;  3KDF A;  2EXD A;  5ELE A;  4X3S A;  3EIV A;  4EX5 A;  2AQ1 B;  1WTQ A;  2Y0S E;  1ILQ A;  3CME A;  3GD7 A;  2E2H B;  1HNW L;  2EIF A;  2UU9 L;  5M3M H;  5JVG 3;  4A3E H;  4RMF A;  4YWM A;  2A6E D;  1XJV A;  3MAQ A;  4JBM A;  4A3C H;  2JQO A;  3H3V I;  3TZD A;  1BBX C;  4GNX C;  1SN8 A;  3SDZ A;  3TS2 A;  3G7L A;  3GTM H;  1NE3 A;  1X3Q A;  5C4X H;  2IW3 A;  1RHP A;  1PFN A;  2PPB C;  4GKJ L;  1B7Y B;  3GV3 A;  5EGT A;  3TP6 A;  3E6Z X;  4KLK A;  2NZ1 D;  3UE0 A;  5E4X A;  2QKI C;  2RCF A;  2NVY B;  1AE2 A;  3A8K E;  3MA2 B;  4DR4 L;  2QF7 A;  4FNF A;  2BE5 D;  2GVA A;  3VA5 A;  3CCM A;  5GAG C;  2MP1 A;  1S5F D;  3NBH A;  4XQJ A;  1QOH A;  3BDC A;  4R1J A;  2B63 B;  4O0A A;  2VZA A;  3VYR A;  1JOK A;  3BYT B;  4LF8 L;  4GN5 A;  1AZQ A;  4IFD J;  4P74 A;  2O5I C;  1TWF H;  3S16 H;  4MTK A;  3S1N B;  1J8I A;  3CKI B;  3PUY A;  2R7D A;  4BBS G;  4IZ8 A;  2VXW A;  2JA5 G;  1SYD A;  3MXU A;  4A3J H;  2A68 C;  2Q8R E;  3RUZ A;  2EYP A;  2K32 A;  1SRU A;  3RZD H;  1NJI C;  4UPA A;  1G2S A;  1H9M A;  3A5Z B;  3HFZ B;  3KUP A;  1EL0 A;  1AFP A;  1VCI A;  1HPC A;  1VF7 A;  3T1H L;  3ERO A;  4DA2 A;  1RF2 D;  2ZTE A;  1K0R A;  4XYO A;  3FKI H;  3AYH B;  1HH2 P;  2K04 A;  3KF6 A;  3L2P A;  1WI5 A;  1ESR A;  2N3S A;  5M3F B;  3JAM i;  3V2T A;  2JYO A;  2KHJ A;  4H02 A;  2EQS A;  3TS0 A;  4M1U B;  3ND9 A;  4A3L H;  4A3F H;  2N78 A;  3STB D;  3T56 B;  1D2B A;  3OW7 A;  3QWN A;  4LF5 Q;  4FVM A;  1HHV A;  4DU9 A;  4C2M B;  4RKB A;  4C3H B;  1SJH D;  2A19 A;  5C44 B;  4JW0 A;  1PRT C;  1AH9 A;  1HRJ A;  1SEB D;  1T5E A;  4DR3 Q;  4G4K A;  5CBE E;  2ZM6 Q;  4HMI A;  4DR2 Q;  2K50 A;  1LYL A;  4C1N I;  2Q8I B;  2AUK A;  3M3Y H;  4JYA L;  2FMM A;  2K28 A;  2E2I B;  1KL9 A;  1V1P A;  4C56 C;  4DV7 Q;  2K03 A;  5IGD A;  1O7Y A;  2XWJ B;  3BS1 A;  1QJO A;  1RJT A;  1UUP A;  5K5P A;  2Q2I A;  3BZK A;  3H15 A;  1BDO A;  2PMZ B;  3CQZ B;  1GHK A;  3A55 A;  3VDY A;  3J7Y W;  1XMO Q;  5KRU A;  3FPU B;  3T1Y L;  1LUZ A;  3OYY A;  2PCF B;  1FD7 D;  1PH4 A;  3M9B A;  3BJU A;  4IPD A;  3P20 A;  2KCC A;  4XIG S;  5C6A A;  1WTR A;  3SHL A;  3OMG A;  3A54 A;  2O5J C;  1R4P B;  2VW9 A;  1PMR A;  3H94 A;  1U4M A;  2KOL A;  4QGU A;  2QW7 A;  1MI2 A;  3S24 A;  5IYB G;  2LMC B;  3SK8 A;  3BVM A;  3IL8 A;  1EY0 A;  4BWG B;  4A93 G;  3I2Z A;  4OWT B;  1N34 Q;  1LT4 D;  1HZA A;  4IFD G;  2WAC A;  3NTI A;  3GTJ H;  3HOX G;  1H9S B;  2VQF Q;  2IWH A;  3S1R H;  4FF2 A;  2Z9H A;  1IXR A;  4AH6 A;  5A2Q L;  1B9N A;  3A8I E;  4GN3 B;  1NR4 A;  1IBL Q;  3ERQ A;  1G8Z D;  3M4O H;  3R93 A;  2E2J H;  5C0X H;  2A68 D;  3J7A 5;  5D14 A;  2XRQ D;  3BZD B;  2KEN A;  1PFS A;  2F0V A;  3G6J B;  1PFB A;  1NTG A;  1PTO H;  1WCM G;  4JVZ A;  2SNS A;  1YNN C;  1G91 A;  2MPM A;  4PG3 A;  1H9K A;  2WV6 D;  4QJF A;  4RAU C;  1IL8 A;  5C3E G;  1YNJ D;  3TRE A;  1WYD A;  1WTO A;  2L9H A;  2JA6 H;  2WB1 E;  3AFP A;  1UWV A;  1HNZ L;  3S2D H;  4C3J H;  4OX9 Q;  4QY7 A;  2XGT A;  2CQA A;  3DWQ A;  3OIP A;  1NY4 A;  1EYA A;  5ELC A;  4AQY Q;  1QZG A;  1BO0 A;  1I50 H;  1FGB D;  1I94 Q;  3S14 B;  2BDO A;  4HJA A;  4ME5 A;  1YIJ A;  3ND8 A;  4DXF A;  4YY3 Q;  1B44 D;  3SGI A;  3ZYY X;  4A3I G;  4H7B A;  2NVT B;  1FGU A;  1JWS D;  3HG9 A;  3L3O C;  2NN6 G;  5KGU A;  1F2M A;  1ZKO A;  3JAM c;  1PRT D;  2UUB L;  2OTL A;  3E5S A;  1XPU A;  3CCQ A;  3L9A X;  1VQK A;  2J7Z A;  3ERS X;  2YYZ A;  4EQ5 A;  3M4Q A;  2HDM A;  3DEP A;  4B3R L;  5I4D A;  1Y1W H;  4BBS B;  1GUO A;  2ZJP A;  1Y69 U;  1SYF A;  5IP7 H;  1DM0 B;  2JA5 B;  4DGZ A;  5T1G A;  1U4R A;  1RCV D;  4P2C B;  3T13 A;  5ELB A;  2DY8 A;  5IP9 H;  3PMF A;  2NZO A;  3SEB A;  2L4N A;  4IPG A;  4DAY B;  2E5L L;  4K2K A;  2AHO B;  1L1O A;  1XTC D;  1HTP A;  2RHS B;  2V4D A;  4BY7 G;  1CK1 A;  4QUC A;  4UP9 A;  1TWA H;  1PTO C;  2MNA A;  5ELO A;  4JI0 L;  3RLF A;  3UDF A;  4K6D A;  2PI2 E;  2UUC Q;  4LAA A;  3Q24 A;  4DUZ L;  5IOD A;  5M5W H;  1SJE D;  4JV5 L;  3KK7 A;  1AW7 A;  5M3M G;  3PUW A;  1VF5 C;  1X3F A;  2SNM A;  2F4V Q;  5HGQ A;  4A3C G;  1HFN A;  1B4O A;  2OQ0 A;  1BCP B;  4G57 A;  1FNW A;  3K5L A;  3A74 A;  4JI4 Q;  1P8L A;  1YVC A;  2IY5 B;  3CMA A;  4JC0 A;  2CW0 C;  3I56 A;  5C4X G;  3MTS A;  2K5D A;  1E2Z A;  4IOC A;  2C9O A;  4F7X A;  3OSO A;  3MZ5 A;  2KCN A;  1PZI D;  2R3Z A;  2RSO A;  5LL6 X;  3K5N A;  3SE0 A;  1KAW A;  2KEE A;  4DR5 Q;  3OWF A;  3GTO B;  4MN3 A;  4K6L A;  2OT2 A;  5G3L F;  1SE3 A;  3IFT A;  1RIP A;  3NWS A;  5E3F A;  4DAM A;  3S1M H;  1Y14 B;  1WVL A;  1ET6 A;  2X69 A;  4L5T A;  3RLN A;  1KXL A;  1CSP A;  2UXD L;  4ME3 A;  1FYC A;  5HY6 A;  5IOC A;  3MXP A;  1YNN D;  4DK1 A;  5GAE C;  3RZO H;  1KDA A;  2H1E A;  5IY0 A;  2IX1 A;  1KNA A;  1TWH B;  2Z6K A;  5HUR A;  1CA6 A;  5FLX c;  4G7Z C;  1X9N A;  4QCL A;  4TSS A;  5IT9 L;  1CUK A;  1HTL D;  1PDQ A;  4A3J G;  3DEO A;  3TN2 A;  3VYT A;  5LMU L;  4C3I H;  1UEB A;  3CC4 A;  5C5M A;  1X56 A;  2F0W A;  5E4W C;  2VY3 A;  4RHS A;  1BKB A;  4L6T B;  4A4I A;  5HGT A;  5C0X J;  3TEH B;  4A93 B;  5JVH 3;  2NYZ D;  1VQO A;  2JA7 H;  4QL5 A;  3ITP A;  3FKI G;  4RGM A;  3J81 L;  1SFO B;  3HOX B;  2IX0 A;  3F1Z A;  3PO2 G;  1BF4 A;  4MNO A;  4V19 0;  3W1B A;  1II3 A;  3EQL C;  3T16 A;  3CD6 A;  3M4P A;  4A3L G;  4A3F G;  1VS0 A;  3PGZ A;  4CKC A;  3J80 i;  2PW7 A;  1LT3 D;  4A3D G;  4WJ3 M;  4NP5 A;  2B8F A;  1PFM A;  1U5K A;  1LTS D;  3PSI A;  4DR6 Q;  1PZJ D;  3CRL C;  1VMP A;  5I9P A;  1Q7Y C;  4I7A A;  1WCM B;  1M90 C;  3Q23 A;  1A63 A;  2R6G A;  4Q0F A;  2OEO A;  2B2Y C;  2EY2 A;  2N88 A;  3HOV H;  3LWU A;  5C3E B;  3K5M A;  1S5D D;  1MJC A;  1S40 A;  2KQ3 A;  2LY7 A;  1B3Q A;  1PTO D;  1F9R A;  1EZ8 A;  2UXC L;  1FNU A;  4KN4 C;  4GOP C;  5T1I A;  1SBB B;  4JI6 L;  3G48 A;  4X64 L;  2F0J A;  1KDB A;  3GTP B;  4K5V A;  1N8R C;  1XNQ Q;  1RDP D;  4A3I B;  4KHP Q;  1XPO A;  4YCV A;  3DXJ C;  1BBU A;  2PQA B;  1F77 A;  3G71 A;  2KCT A;  1VQ6 A;  2MQH A;  1IBK Q;  1U9R A;  1EOV A;  4L63 B;  3E0E A;  5DEH A;  5C5L A;  4LF7 Q;  3Q0A A;  1K73 C;  1VQ8 A;  1SNQ A;  3QG1 A;  1A3V A;  4TVA B;  4Y7N B;  4DV6 L;  1YHA A;  4DK0 A;  3TSS A;  5FK9 C;  4A3K H;  4KHZ A;  2CW0 D;  4ZCK A;  1SMX A;  1IL2 A;  2RHQ B;  3NUC A;  1ZXT A;  4JK1 C;  1LTI D;  3I72 A;  3I4M H;  2DY7 A;  1VQF A;  1O7Z A;  2WAQ E;  1XMO L;  3B6Y A;  4LK1 C;  1Q81 C;  4DV4 L;  1G29 1;  1IW7 C;  1TY2 A;  3R8B A;  2EVB A;  2EOT A;  4MHE A;  2UUA Q;  1TWG H;  4FF4 A;  1SYC A;  1EQT A;  2DJF C;  4BY7 B;  1E24 A;  3FMC A;  2P5Z X;  2FJ2 A;  5KIX A;  5LMN Q;  2DJG C;  2EY5 A;  1K9M C;  3HOY H;  1JJ2 A;  1M8A A;  4ZKC B;  1S5B D;  5ELF A;  3PIO 3;  3KFU A;  4JBK A;  1N34 L;  2FHT A;  3DWP A;  1D5X C;  5E7N A;  4X3K A;  1EWI A;  2JN4 A;  1MGS A;  4YWL A;  1Y1V H;  4RGT A;  4H44 C;  5BN5 A;  5M3M B;  2PO4 A;  2C35 B;  3AEV A;  1A8V A;  1UE7 A;  2FXQ A;  3J7Z C;  2PNH A;  5FLM H;  4CJ0 B;  3SK6 A;  1TWC B;  4PMC A;  3GTM B;  3HOW G;  5C4X B;  3TP8 A;  1I4Q A;  1JE5 A;  2HIV A;  3MFY A;  1J5E Q;  1SRO A;  2JA6 G;  4LFB L;  1L2F A;  3F8T A;  4FO2 A;  4C3J G;  1JB7 A;  4LUV A;  4A3M G;  1HR0 L;  4B9X A;  3TME A;  2HHH Q;  3V05 A;  2EY1 A;  4LF4 Q;  1N32 Q;  4CJ2 C;  1K83 H;  1YI2 A;  2F0N A;  2I5M X;  2F0K A;  1CTM A;  2IHE A;  4B3M Q;  1NMG A;  3NXW A;  1X55 A;  1H9S A;  2KA7 A;  1WTV A;  4JI7 Q;  4BA2 I;  2HT1 A;  1RTO A;  2JA8 H;  4U68 A;  4DV0 Q;  1JC7 A;  3NEN A;  4UP7 A;  4CDF C;  4CJ1 B;  1I94 L;  5CR3 A;  1KIX A;  1VQM A;  4ULL A;  1FNV A;  1SNM A;  3J80 c;  1I3Q H;  1Y1W G;  1HQR D;  4CKB A;  2A6H D;  5IP7 G;  3EFX D;  1K28 A;  1C0A A;  3P7J A;  2HQL A;  4GLV B;  2I07 B;  4A3J B;  4AYB G;  2MGS A;  1CI3 M;  4H13 C;  1EY8 A;  1WFQ A;  3S15 H;  3RZD B;  1ENA A;  4IJH A;  5IP9 G;  2GVB A;  1B2T A;  1X65 A;  4U67 3;  2WKD A;  2ATW A;  1JR0 D;  4BBR G;  2Q2H A;  1V8Q A;  2JSO A;  1FJG L;  1I4X A;  3QO2 A;  1XWE A;  4NXM Q;  2AKW B;  3FKI B;  4L5R C;  1LTR D;  1JT8 A;  5DM7 3;  3PO2 B;  3HZX A;  2LFN A;  5JJK A;  3CHB D;  1D1I A;  4B3S L;  2NVQ B;  1PTO F;  1ICF B;  4JOI A;  4A3F B;  2VB2 X;  3R2T A;  2PW5 A;  4QMG A;  2L12 A;  1C4Q A;  2LKV A;  4A3B H;  3TDQ A;  4KD4 A;  1QWY A;  3SXH A;  5DAU A;  1IW7 D;  1X3P A;  4IO9 A;  3QR8 A;  3X3M A;  5E1F A;  1A2T A;  1B1Z A;  1UNS A;  4HTH A;  1R9T H;  3T53 B;  2JEB I;  1EEF D;  3J81 i;  1WTP A;  1XMQ L;  2K05 A;  1HR0 W;  5GAH C;  1LT6 D;  3M85 A;  3M3Y B;  4DR7 Q;  1Q8I A;  2F0G A;  3I7F A;  3WOE A;  1DD2 A;  5DNF A;  1Q86 C;  4DAY A;  2QDB A;  5IE8 A;  5C4H A;  4JI4 L;  1X6O A;  2NBF A;  4HSV A;  2RCN A;  1SAP A;  3GTQ H;  4UDU C;  3BYY B;  5M9O A;  3OPO A;  2VS1 A;  2O2L D;  5M5Y H;  1OXV A;  2WFW A;  1Q90 A;  3DM1 A;  2OXP A;  3U9S A;  3QOJ A;  1A0I A;  1F9S A;  3BVG A;  5A2Q E;  4TKO B;  3PO3 H;  1YNX A;  5J3B A;  2F52 A;  4YCW A;  4DAV A;  1IKM A;  1STY A;  1X54 A;  4MIU A;  4DV1 L;  1GUS A;  5EJW A;  3S9W A;  2R92 G;  1CM9 A;  3VR3 A;  5K36 H;  5LL6 S;  4JI5 L;  1Q8K A;  2QGQ A;  2D0O A;  1T9H A;  2CKZ B;  1F2Z A;  2RF4 A;  2FFK B;  5JEA H;  2RDG A;  2E2D C;  2JA7 G;  2ENB A;  3W3A A;  1N36 L;  2F4I A;  4RKL A;  3DLL A;  4YIJ A;  2H4O A;  3PF5 A;  3S1R B;  4PMW A;  1W3S A;  2WAQ G;  2A74 C;  2B2T A;  2VUM G;  4ZKB B;  3HKZ G;  4NW2 A;  1E1T A;  1Z6H A;  3KBX A;  3M4O B;  3A8J E;  1OTC A;  1OXS C;  1YNJ C;  2BDN A;  2F0H A;  2K5V A;  3E0J A;  4R4O A;  5IGG A;  1PTO B;  4OO1 H;  1B9M A;  3KYH C;  4QQB X;  4XT3 B;  4JI1 Q;  1PH2 A;  5EBC A;  3ULJ A;  2IPK D;  1QNK A;  4KKU A;  1SE4 A;  1VQC A;  3HOV G;  2BOS A;  2B2V A;  1V1O A;  3HOW B;  3IKJ A;  5I6Y A;  1XTD A;  1X32 A;  2JA6 B;  4C3J B;  1SLJ A;  4A3M B;  5AJ3 L;  2ICE C;  4EQO A;  1RL2 A;  4DR6 L;  2R61 A;  4O1N A;  3ULL A;  2KCM A;  2F1M A;  1V1Q A;  2ZXP A;  2KJX A;  3CCS A;  3I90 A;  2MO0 A;  1UE5 A;  3CF5 A;  1A2U A;  3U58 A;  4N8F A;  1TKW B;  3MVV A;  2Z6B A;  1XPR A;  4QF4 A;  4K0K Q;  1AEX A;  3OTO Q;  4A3G H;  1WOC A;  3U50 C;  2RVL A;  4DV3 Q;  1JB3 A;  5IT9 c;  1HFG A;  3PUX A;  3D8G A;  2A5H A;  3FVQ A;  1Y1W B;  2KHS A;  3I4M G;  2BA0 A;  1IBK L;  3H0G H;  4X66 Q;  1N33 Q;  3MC0 B;  4AYB B;  1SYB A;  3KBG A;  1L1O C;  3PQI A;  3N52 A;  2XWB B;  1Z7T A;  1TS2 A;  2F0Q A;  5IWA Q;  5TSS A;  3WDN A;  1BXT A;  1DOL A;  2YTX A;  4BBR B;  1KRS A;  1EU4 A;  3J81 c;  1L0W A;  5EQ0 A;  4IFD I;  2ICI A;  1PZK D;  5EKK A;  3S17 H;  1SYG A;  3J80 L;  2SEB D;  3M7N A;  2I0Q A;  3K59 A;  5JAV A;  2A69 C;  1EFW A;  4LFC L;  2EZV A;  1CA5 A;  4GKK Q;  4YHH L;  5F2D A;  2PQA A;  3T4A C;  2KED A;  2F0M A;  5I9O A;  1K8A C;  3MEH A;  1PHJ A;  5EKL A;  5M5W B;  4IUT A;  1SNP A;  1Y1V G;  5IGB A;  1SYE A;  3BG3 A;  5LMN L;  3HP3 A;  1EY5 A;  2L15 A;  3SVM A;  2ZXR A;  2B63 H;  5FLM G;  4IUN A;  4LF9 Q;  4X3T A;  4ABN A;  4J6H A;  1PXU A;  2PZU A;  2EPB A;  4DR1 L;  1S4Z A;  1DZ1 A;  4R4I A;  1FR3 A;  2K75 A;  2EDG A;  4A76 A;  4F87 A;  3S1N H;  1H9R A;  4ZRZ A;  5EPL A;  4K2L A;  2Q2U A;  3FEW X;  2E76 C;  2PNR C;  4RCN A;  5IYD G;  4IUR A;  4K5W A;  1PVO A;  4L5Q A;  2IL8 A;  2BH8 A;  4OL7 A;  2LXJ A;  2NN6 I;  1UE6 A;  3LWE A;  2MO1 A;  3J81 E;  2Y0S G;  5M5X H;  4KKT A;  1O78 A;  1E2V A;  3EBE A;  2JA8 G;  1CQV A;  1XNR Q;  4DK3 C;  1KAA A;  1M1K C;  2HHH L;  1N32 L;  4GOP B;  1VQ7 A;  4ID6 A;  3PIP 3;  3RZO B;  5JEA J;  4IUU A;  4JCV E;  1LTB D;  1G51 A;  3I8Z A;  2VQE Q;  4JI7 L;  1YHQ A;  3FHW A;  1A15 A;  3MEF A;  1DXM A;  1EYC A;  4RFB A;  2R92 B;  2Z4I A;  4KI0 A;  1IBM Q;  4CGY B;  2EJF C;  2HQE A;  1PH7 A;  4CHT B;  1SND A;  5C44 H;  2ZJR A;  4POG A;  2JA7 B;  1I5F A;  2IT1 A;  3QJY A;  5KYL A;  4DNT B;  4X65 L;  2SOB A;  4GLX A;  1VMC A;  3RN2 A;  2R7Z G;  2MJ8 A;  3HGB A;  2WAQ B;  3HOZ H;  1STE A;  3L7Z C;  1Y8N B;  4CBV A;  1Q3L A;  2RBM A;  1O80 A;  1CKO A;  1W2B A;  1KC8 C;  2VUM B;  3HKZ B;  4A3B G;  4H0L C;  3AU7 A;  3FDT A;  3J7A F;  5LMN W;  4AIM A;  3EA6 A;  1LTA D;  1G2T A;  2BCO A;  5FO9 B;  2B2W A;  1G6Z A;  2JP1 A;  1YEZ A;  5IGE A;  2R7F A;  4DNR B;  3HOU H;  1VQ5 A;  4F88 A;  4HJ7 A;  4IUV A;  3HOV B;  5KNB A;  4I65 A;  1TT2 A;  1S5C D;  3K80 C;  1TXY A;  3NTK A;  2A69 D;  4A3E G;  4WOR A;  3I4L A;  2CHB D;  1ET9 A;  3JAM E;  1LT5 D;  4UY8 C;  2RA4 A;  4G7O C;  2KUM A;  1JQY D;  3K7A B;  4OIK A;  4WFN 3;  1O7L A;  1GUW A;  3IFD A;  4P71 A;  4RGN A;  4G7H C;  3CCU A;  1PV4 A;  1HNW Q;  2N8N A;  4PV1 C;  1PH3 A;  1BR9 A;  2AMC B;  3EN2 A;  5CMD A;  1YJW A;  5CBA E;  4WJW A;  2CWA A;  3I4M B;  1NCV A;  3C1F A;  1AP0 A;  1GOZ A;  1HQM C;  1VQJ A;  2E8G A;  1TS3 A;  1CSQ A;  4GKJ Q;  2CVR A;  5K36 G;  3F2U A;  3BZC A;  1GUG A;  1TWG B;  2D9U A;  4DFA A;  5JEA G;  1EY4 A;  3A56 A;  2L0C A;  5I2X A;  1PH9 A;  1DCZ A;  1HNX Q;  4DR4 Q;  3VYS A;  3C2P A;  5J39 A;  3BDL A;  1FL0 A;  1SE2 A;  3HOY B;  3P75 A;  3PUZ A;  2HUG A;  1J6Q A;  1XX8 A;  4LF8 Q;  2R93 H;  1KQS A;  1PLF A;  2B3G A;  3ULP A;  4P75 A;  1Y1V B;  4LMQ D;  3NEL A;  1X3E A;  3CRK C;  3H3V H;  4PMB A;  4HID A;  5KEE A;  2TMP A;  1I4H A;  3J7A V;  3NP8 A;  4PZ6 A;  1CFM A;  2O4X A;  3I91 A;  4BXX H;  3NTH A;  3K5O A;  5C4J H;  1JWM D;  1LM0 A;  2ALY B;  1D5Z C;  2VB3 X;  5KNC A;  4HIK A;  1HZB A;  3HS0 C;  5BR8 Q;  2OQK A;  3M4Y A;  2YU9 H;  1I4P A;  3T1H Q;  1I6H B;  4ZYS A;  2XNA C;  2Z4H A;  5EAY A;  3CCV A;  3MWY W;  1EIF A;  1EWC A;  1PRT F;  1F2L A;  3VA7 A;  1EWH A;  3SR1 A;  3MHB A;  3WOF A;  5L37 A;  2Y0S B;  4IN3 A;  4LF5 L;  2A6H C;  1R4Q B;  4RH6 A;  2JA8 B;  1NUC A;  3NBH B;  4CDC C;  5FLX E;  1W6K A;  3T51 B;  4A3G G;  3K8A A;  2ZXO A;  3CCR A;  1QVF A;  4LUZ A;  4J8Q A;  1WJJ A;  1I3Q B;  4DR3 L;  2ZM6 L;  4GNX B;  3H0G G;  4DR2 L;  1QIL A;  1UE1 A;  4CKE A;  1ML0 D;  3S15 B;  2EYL A;  3GTG H;  2WB1 G;  4HCS A;  1Q12 A;  4ILW A;  3UDX A;  4DV7 L;  5JPM C;  4JYA Q;  1IKL A;  1STN A;  2PI2 A;  3D4R A;  4DUY Q;  1IYJ B;  2OCE A;  3H3V C;  4JOI C;  5J1Z A;  4OXP A;  2F0U A;  4FYD A;  3AQQ A;  2R7Z B;  4DN4 M;  4GZY C;  2Q8T A;  5JPN C;  1WD0 A;  3T1Y Q;  4IOA A;  2I5L X;  4A3B B;  4ZQ3 A;  2IX3 A;  4DPG A;  1MD2 D;  2XRS D;  2A73 B;  2L55 A;  4ZUI A;  4B08 A;  1B53 A;  4XT1 B;  1WTH A;  1AE3 A;  3I4N H;  2AWO A;  1S72 A;  1H95 A;  2EYJ A;  4V0B A;  1A3U A;  3K0Y A;  3G4S A;  4POF A;  1YHB A;  1JIC A;  1R9T B;  1L0Y B;  2L5T A;  3OW2 A;  3IRB A;  2F0S A;  1T5X D;  4K14 A;  5D3I B;  1EY9 A;  5C0X G;  1KDC A;  1S3O A;  5AFW A;  1VQA A;  3MXN B;  3CCE A;  1KHI A;  2RKS A;  4A3E B;  2A1A A;  2VQF L;  1STH A;  1YBY A;  3RN5 A;  1UEA B;  3HRZ C;  1NNX A;  3LGJ A;  1EEI D;  5JJL A;  2EJM A;  2VNU D;  2QIL A;  5FOB B;  4LUO A;  1C48 A;  4KY5 A;  1OXX K;  3TBI B;  3GTQ B;  4KJO A;  2EYF A;  1IBL L;  1EY7 A;  3S1Q H;  1D1K A;  3S2H H;  3TP7 A;  5M5Y B;  2PYK A;  3R3O A;  3GTL H;  1HA5 A;  4KKS A;  1PRT B;  5JOB A;  1ICW A;  3PO3 B;  3EJI A;  1BCP C;  5COY A;  3H6M A;  5CV9 A;  5DLQ E;  1E3P A;  2F3I A;  3D4W A;  1LO5 D;  2JJQ A;  1WTX A;  1HCZ A;  4DAP A;  1EQQ A;  1XNR L;  4OX9 L;  1KTK A;  2RDF A;  2J0T D;  3K0X A;  4AQY L;  1PYW D;  3CP0 A;  5IIF A;  1ILP A;  3S16 B;  1TWF B;  1HZC A;  4YY3 L;  1ZYR C;  5COR A;  1WCM H;  4R8N A;  1SXT A;  5CC4 A;  1RTN A;  2NVX H;  4JBJ A;  1ASY A;  1K0S A;  5C3E H;  4ZUJ A;  1Z47 A;  1IBM L;  3HOZ G;  4JI2 Q;  2Z0S A;  2B2Y A;  3FP9 A;  2UUB Q;  4JPB W;  2EXZ A;  4DF7 A;  4MZ9 A;  2A8V A;  4B3R Q;  1BNZ A;  4GOP A;  1QB5 D;  2EE1 A;  2CH4 A;  3RLO A;  3VR4 A;  3P1H A;  4N8X 1;  3HOU G;  1NSN S;  1C8C A;  1KLG D;  5IYC H;  4EVO A;  3JC6 6;  2Q2T A;  4ZK9 B;  2WII B;  2SDF A;  3E9I A;  3CU7 A;  4QIW E;  4JI3 Q;  1RD9 D;  4X62 Q;  2I46 A;  4UAI A;  3CCJ A;  1EFI D;  3C46 A;  4KJN A;  1BOS A;  4OEL B;  4YWK A;  3SK5 A;  1Y8O B;  2BA1 A;  1B70 B;  1V9P A;  5D3D A;  2QEX A;  5C4Z A;  4PZ7 A;  3H09 A;  4DK6 C;  1EU3 A;  4JI0 Q;  2UUC L;  2KBN A;  2JK8 A;  1ZEQ X;  1M4V A;  2NUC A;  2QA4 A;  5GAD C;  3J80 E;  2F0I A;  2HCC A;  1PYS B;  1OXU A;  1SMY D;  4BY7 H;  4DUZ Q;  4A3G B;  2F4V L;  4JV5 Q;  2M00 A;  1N9W A;  5C3X A;  5I6W A;  4IQZ A;  3U9O A;  1GUN A;  2K33 A;  3H0G B;  1VQH A;  4HCE A;  1B8A A;  2EY6 A;  2F0L A;  3GTK H;  2K5W A;  4KN7 C;  5JJI A;  4NDX A;  2WB1 B;  4DV2 Q;  2RQX A;  4DR5 L;  4P73 A;  3EVQ A;  1WTW A;  3TQY A;  1WD1 A;  3S17 B;  1MSG A;  1VQE A;  1MKH A;  1CZG A;  4X6A H;  1CKN B;  1TWC H;  2PZW A;  1P16 A;  2RDH A;  4C3I G;  4B9W A;  1EYD A;  3URY A;  2MFI A;  2JXM B;  4FXD A;  4Q5V A;  2UXD Q;  1BCP D;  2EYO A;  1K3R A;  2B29 A;  3CXC A;  2R93 G;  4OEM B;  3KLS A;  2YTY A;  1HZ9 A;  2QEJ C;  4LFA Q;  3NWT A;  1HNX L;  4HN7 A;  3GTJ B;  4LWC A;  3GDE A;  4J1M A;  2DN8 A;  4PQX A;  5LMU Q;  4BXX G;  3GO5 A;  4JI8 Q;  3ICE A;  3AFQ A;  1ZYR D;  2AUJ D;  3Q22 A;  1L0X B;  4F8M A;  2XN9 C;  1PH1 A;  1XXG A;  1E22 A;  2B2U A;  1SNC A;  3QIA A;  2E2J B;  3MXG A;  4HJ8 A;  2UXB Q;  3D3R A;  3RD4 A;  5NUC A;  1I4G A;  1EIG A;  3DHQ A;  4BY1 H;  2ZJQ A;  2CH4 W;  4E6I A;  2XVS A;  1C7Y A;  3W1G A;  5A35 A;  3UI2 A;  5J22 A;  1CQF A;  1KLU D;  5BR8 L;  4IUP A;  5M5X B;  5EPK A;  3S2D B;  3DMU A;  4ZLT F;  2J4X A;  2ASB A;  1DOM A;  3UDI A;  4KD3 A;  1I50 B;  1ASZ A;  3NSW A;  1ENF A;  3PO2 H;  1X3G A;  1NBW A;  3TP5 A;  4IUQ A;  3E3X A;  2NVQ H;  1OO9 B;  2WP8 J;  2K5Q A;  1LAB A;  4IJL A;  4EQP A;  4S3S A;  4R4Q A;  3K58 A;  4A3D H;  1VQL A;  1E7Z A;  4JBW A;  2UXC Q;  4N9P A;  5ISR A;  2AQ2 B;  2K5H A;  4A3K G;  3CC7 A;  1XNQ L;  2B8G A;  4JI6 Q;  2F0D A;  2CWP A;  1EY6 A;  4X3U A;  2NTS A;  4KHP L;  2RSN A;  4X64 Q;  3D4D A;  1K3B C;  4NB3 A;  4OWW B;  4LF7 L;  4GS3 A;  1QCB D;  3HOZ B;  2X6L A;  2E2H H;  3L0O A;  3OIQ A;  4R4T A;  2E74 C;  3OOC A;  1DOK A;  1VDZ A;  2ID0 A;  3D0F A;  1BUV T;  3PUV A;  2B2W C;  4DUY L;  2N55 A;  4DV6 Q;  1U4L A;  2K6A A; 
#chains in the Genus database with same CATH homology
 2EXD A;  2K4K A;  5ELN A;  3EIV A;  3I4M H;  3I4N G;  4EX5 A;  4UY8 C;  1VQF A;  2D0P A;  2WAQ E;  4PZ8 A;  1XMO L;  3HOY G;  3B6Y A;  1Q81 C;  2Y0S E;  4DV4 L;  1YZ6 A;  1G29 1;  3KOJ A;  1VQP A;  4B3T Q;  4GNX A;  4DV4 Q;  2JA9 A;  4P71 A;  3GD7 A;  3CME A;  2UUA L;  2JE6 I;  2EIF A;  2UU9 L;  3CCU A;  2BH2 A;  1PV4 A;  1HNW L;  2UUA Q;  3NEM A;  1TWG H;  4P72 A;  1HNW Q;  2N8N A;  5M3M H;  4A3E H;  1PH3 A;  2NVY H;  4RMF A;  1E24 A;  2AMC B;  4YWM A;  3EN2 A;  1XJV A;  4ALP A;  4JBM A;  4BXX G;  4A3C H;  2JQO A;  1YJW A;  3H3V I;  5LMN Q;  1QVG A;  4GNX C;  2CWA A;  1SN8 A;  2YV5 A;  3TS2 A;  1K9M C;  3HOY H;  3GTM H;  1JJ2 A;  1NE3 A;  5C4X H;  3KF8 B;  3KFU A;  1QUQ B;  4GKJ L;  1B7Y B;  1U0L A;  1VQJ A;  2E8G A;  4JBK A;  1OXT A;  1N34 L;  1CSQ A;  4GKJ Q;  5E7N A;  5K36 G;  2KHI A;  3BZC A;  1EWI A;  4KLK A;  2K14 A;  4YWL A;  1Y1V H;  3UE0 A;  5JEA G;  1AE2 A;  4DR4 L;  1PH9 A;  1HNX Q;  3AEV A;  2C35 B;  2V1C C;  1A8V A;  4NPS A;  2GVA A;  4DR4 Q;  3CCM A;  1UE7 A;  2FXQ A;  5GAG C;  3J7Z C;  2PNH A;  5FLM H;  3KLW A;  1FL0 A;  4R1J A;  4O0A A;  1J5E L;  3HOW G;  2VZA A;  4LFB L;  2HIV A;  1JE5 A;  1YIT A;  3PUZ A;  1J5E Q;  1SRO A;  4LF8 L;  1EIY B;  2JA6 G;  4GN5 A;  4LFB Q;  1L2F A;  1J6Q A;  2Z6K C;  3F8T A;  1JB7 A;  4LUV A;  4A3M G;  1HR0 L;  1KQS A;  4LF4 L;  4LF8 Q;  3F2B A;  4IFD J;  4P74 A;  2HHH Q;  1TWF H;  4LF4 Q;  3S16 H;  1N32 Q;  1HR0 Q;  1K83 H;  2B3G A;  2VL6 A;  3ULP A;  1YI2 A;  4P75 A;  3NEL A;  3PUY A;  2R7D A;  1X3E A;  5M3F H;  4BBS G;  3H3V H;  1G6P A;  4HID A;  4B3M L;  2I5M X;  2CCZ A;  2JA5 G;  2IHE A;  4B3M Q;  4A3J H;  1FVI A;  1NMG A;  4NXN Q;  1X55 A;  1VQ4 A;  4L5S A;  4PZ6 A;  1SRU A;  3RZD H;  4BXX H;  4JI7 Q;  4BA2 I;  3HOW H;  4DV0 L;  1NJI C;  2HT1 A;  5C4J H;  4DV5 Q;  4UPA A;  1LM0 A;  2ALY B;  2JA8 H;  4DV0 Q;  3A5Z B;  3HFZ B;  4HIK A;  2DUD A;  4C2M H;  1HZB A;  3NEN A;  4UP7 A;  5BR8 Q;  2OQK A;  1VCI A;  4A3M H;  1SE8 A;  1V43 A;  4C3H H;  1KIX A;  3T1H L;  1I94 L;  4LF6 Q;  2OTJ A;  1VQM A;  2YU9 H;  2ZTE A;  1K0R A;  3FKI H;  3AYH B;  3T1H Q;  3CAM A;  1HH2 P;  3J80 c;  4APV A;  3KF6 A;  3L2P A;  1I3Q H;  1WI5 A;  1Y1W G;  2N3S A;  5EAY A;  3JAM i;  3CC2 A;  5IP7 G;  2KHJ A;  3CCV A;  4H02 A;  1QVC A;  1EIF A;  2EQS A;  2HQL A;  4GLV B;  1C0A A;  4AYB G;  3TS0 A;  4A3L H;  1WFQ A;  2N78 A;  4IPH A;  4A3F H;  5IYC G;  3CC4 A;  4JI2 L;  4IJH A;  3S15 H;  3STB D;  5IP9 G;  3E9H A;  2GVB A;  1X65 A;  2HIX A;  4LF5 L;  1VQN A;  2ATW A;  2D62 A;  3KDF B;  4BBR G;  4LF5 Q;  3NBH B;  2Q2H A;  2E2I H;  1FJG L;  4NXM L;  4A3G G;  3K8A A;  1FJG Q;  2A19 A;  4NXM Q;  2AKW B;  4OWX B;  3CCR A;  4L5R C;  4LUZ A;  1QVF A;  1AH9 A;  1JT8 A;  1WJJ A;  4DR3 L;  4HIO A;  2ZM6 L;  3U4V A;  4DR3 Q;  4GNX B;  5JJK A;  3H0G G;  2ZM6 Q;  3CQZ H;  4DR2 L;  2OWO A;  4B3S L;  3HOU H;  1UE1 A;  4DR2 Q;  4JOI A;  1SR3 A;  5FJ8 H;  4B3S Q;  2K50 A;  1LYL A;  3GTG H;  1Q46 A;  4J15 A;  3M3Y H;  2WB1 G;  4BBR H;  4A3B H;  4MTN A;  4JYA L;  1Q12 A;  3UDX A;  1YJN A;  4DV7 L;  3CPW A;  1KL9 A;  4JI3 L;  4JYA Q;  4DV7 Q;  3PV0 A;  4X62 L;  3G6E A;  2PI2 A;  4HJ9 A;  4DUY Q;  3CW2 C;  1IYJ B;  1VQG A;  2OCE A;  4IO9 A;  4JOI C;  2GN5 A;  4OXP A;  3W5O A;  2Q2I A;  3BZK A;  5H1S E;  3H15 A;  3AQQ A;  1R9T H;  2R7Z H;  2JEB I;  3J81 i;  3VDY A;  1XMO Q;  1XMQ L;  3T1Y L;  1LUZ A;  1HR0 W;  3OYY A;  4DR7 L;  5GAH C;  1PH4 A;  3M85 A;  1XMQ Q;  3ZJY C;  3T1Y Q;  4DR7 Q;  4IOA A;  2I5L X;  3I7F A;  3M9B A;  2UU9 Q;  3BJU A;  1Q86 C;  4DPG A;  1GM5 A;  3CCL A;  4IPD A;  2YTV A;  3PCO B;  4XIG S;  5IE8 A;  3PO3 G;  4JI4 L;  3A5U A;  1AE3 A;  3I4N H;  4TQU S;  1MJE A;  1C9O A;  1X6O A;  2AWO A;  1S72 A;  1H95 A;  4Y52 H;  2RCN A;  3PIP A;  3GTQ H;  3G4S A;  2VW9 A;  4DNI A;  4POF A;  1YHB A;  3UE1 A;  3OW2 A;  4QGU A;  3S24 A;  3IRB A;  2NZH A;  3DM3 A;  4DV2 L;  2VS1 A;  5M5Y H;  1BVS A;  1OXV A;  2WFW A;  5IYB G;  4HIM A;  4A75 A;  5C0X G;  4A93 G;  3I2Z A;  4OWT B;  1N34 Q;  4IFD G;  1HZA A;  1S3O A;  1A0I A;  1VQA A;  3MXN B;  1KHI A;  3CCE A;  4FDB A;  5GRO A;  3PO3 H;  2A1A A;  2VQF L;  1YBY A;  3GTJ H;  3RN5 A;  1YNX A;  5J3B A;  3HOX G;  3LGJ A;  2VQF Q;  2F52 A;  4YCW A;  3S1R H;  4OO1 I;  2VNU D;  5JJL A;  4AYB E;  1X54 A;  2PMZ E;  4LUO A;  4DV1 L;  4XTC S;  1OXX K;  1IXR A;  4AH6 A;  1K8G A;  2R93 H;  4DV1 Q;  1IBL L;  2R92 G;  4GN3 B;  3S1Q H;  4IPC A;  1IBL Q;  3S2H H;  3U4Z A;  3KF6 B;  3M4O H;  2E2J H;  4JI5 L;  4BA1 I;  1Q8K A;  2QGQ A;  3KJP A;  3GTL H;  4LFA L;  3J7A 5;  2D0O A;  3S14 H;  4JI5 Q;  2RF4 A;  1T9H A;  2CKZ B;  2KEN A;  1PFS A;  2JA7 G;  1KD1 C;  1NTG A;  1N36 L;  1WCM G;  2NVT H;  4BY1 G;  4OO1 G;  1N36 Q;  4PG3 A;  3DLL A;  5DLQ E;  3PF5 A;  2K52 A;  4QJF A;  2XTI A;  1E3P A;  2F3I A;  1A62 A;  1W3S A;  1E1O A;  4PMW A;  4JI8 L;  2JJQ A;  1Z9F A;  1EQQ A;  2WAQ G;  5C3E G;  3TRE A;  2R92 H;  1XNR L;  1WYD A;  4OX9 L;  1CKN A;  2JA6 H;  2WB1 E;  3AFP A;  1UWV A;  1HNZ L;  2VUM G;  3S2D H;  4C3J H;  3HKZ G;  4QY7 A;  2XGT A;  3K0X A;  1E1T A;  4OX9 Q;  1NY4 A;  4AQY L;  2LXK A;  2UXB L;  2CFM A;  3CP0 A;  4AQY Q;  1QZG A;  1I50 H;  1OTC A;  1I94 Q;  1HZC A;  1OXS C;  2K5V A;  4R4O A;  4YY3 L;  4HJA A;  1YIJ A;  1VQ9 A;  4BBS H;  1WCM H;  4YY3 Q;  1LTL A;  4JI1 L;  3SGI A;  2JA5 H;  2JEA I;  1MIU A;  4A3I G;  3KYH C;  1PH6 A;  1HJP A;  4QQB X;  4GLA C;  1FGU A;  4WJ4 A;  4JI1 Q;  1PH2 A;  3ULJ A;  1JJC B;  2NVX H;  2NN6 G;  4JBJ A;  1VQC A;  3F2C A;  5C3E H;  1ASY A;  3HOV G;  1Z47 A;  3JAM c;  1IBM L;  3HOZ G;  2UUB L;  4JI2 Q;  2OTL A;  1XPU A;  2Z0S A;  1CKM A;  3CCQ A;  2VUM H;  1XTD A;  3FP9 A;  1Q1E A;  2UUB Q;  1VQK A;  3ERS X;  2YYZ A;  1O7I A;  1SLJ A;  4EQ5 A;  4HJ5 A;  5AJ3 L;  3PF4 A;  3M4Q A;  4MZ9 A;  4DR6 L;  1RL2 A;  3I55 A;  3TRZ A;  2A8V A;  5AJ3 Q;  4B3R L;  1Y1W H;  3ULL A;  3BU2 A;  2ZJP A;  4B3R Q;  2KCM A;  5IP7 H;  4GOP A;  1V1Q A;  1EYG A;  3CCS A;  2MO0 A;  1UE5 A;  3RLO A;  3HOU G;  3CF5 A;  3U58 A;  5IYC H;  4K0K L;  5IP9 H;  3I4O A;  2NZO A;  1XPR A;  3OTO L;  4K0K Q;  4IPG A;  4DAY B;  3JC6 6;  2E5L L;  2Q2T A;  2AHO B;  1L1O A;  3OTO Q;  4DV3 L;  2RHS B;  4A3G H;  1WOC A;  3U50 C;  3E9I A;  4DV3 Q;  2ZTC A;  4QIW E;  4BY7 G;  3WWV A;  3PUX A;  5IT9 c;  4JI3 Q;  4UP9 A;  1D8L A;  4X62 Q;  1TWA H;  2ZTD A;  1D7Q A;  4X66 L;  2MNA A;  5ELO A;  3CCJ A;  3I4M G;  1YJ9 A;  1N33 L;  4YWK A;  2BA0 A;  1IBK L;  3H0G H;  4X66 Q;  1VQD A;  2BA1 A;  1N33 Q;  2DGY A;  1B70 B;  1V9P A;  2AWN A;  3K7A H;  2QEX A;  1L1O C;  1QZH A;  5IWA L;  4PZ7 A;  4JI0 L;  4DK6 C;  2H5X A;  3RLF A;  4JI0 Q;  3UDF A;  2UUC L;  2KBN A;  2JK8 A;  5IWA Q;  2PI2 E;  2UUC Q;  2QA4 A;  5GAD C;  2YTX A;  1PYS B;  1OXU A;  4JG2 A;  1KRS A;  4DUZ L;  5M5W H;  3J81 c;  1L0W A;  5C0X I;  4JV5 L;  4BY7 H;  4DUZ Q;  2F4V L;  4IFD I;  3GTO H;  5M3M G;  4JV5 Q;  3PUW A;  1X3F A;  2F4V Q;  5HGQ A;  3S17 H;  4A3C G;  1N9W A;  2OQ0 A;  3A74 A;  4JI4 Q;  1P8L A;  3M7N A;  1YVC A;  3K81 C;  2IY5 B;  2I0Q A;  3CMA A;  4JC0 A;  4B3T L;  1VQH A;  3I56 A;  4LFC L;  1EFW A;  3KJO A;  2B63 G;  4GKK L;  1IZ6 A;  5C4X G;  1B8A A;  4GKK Q;  4YHH L;  4LFC Q;  2PQA A;  3HKZ E;  3GTK H;  5JJI A;  4YHH Q;  4IOC A;  1K8A C;  4DV2 Q;  4O2D A;  4DR5 L;  1PHJ A;  4GN4 B;  1KAW A;  4P73 A;  1Y1V G;  1TWH H;  4DR5 Q;  3TQY A;  3CPF A;  5LMN L;  1DGS A;  1RIP A;  1EUJ A;  1VQE A;  1MKH A;  2LSS A;  2L15 A;  1PA6 A;  4DAM A;  3S1M H;  4X6A H;  1CKN B;  1PH8 A;  4LF9 L;  1TWC H;  1Y14 B;  1P16 A;  2B63 H;  5FLM G;  4LF9 Q;  2MFI A;  4L5T A;  3RLN A;  1KXL A;  1CSP A;  2UXD L;  4ME3 A;  4DR1 L;  5IYB H;  3A0J A;  1NMF A;  5HY6 A;  2UXD Q;  4DR1 Q;  4R4I A;  1K3R A;  2B29 A;  5GAE C;  4A93 H;  3CXC A;  2K75 A;  3RZO H;  2R93 G;  1GD7 A;  4A76 A;  3S1N H;  2YTY A;  1HZ9 A;  5IY0 A;  4LFA Q;  2IX1 A;  2Z6K A;  3HOX H;  1SFO H;  1HNX L;  5M3F G;  2Q2U A;  5FLX c;  2I5H A;  1X9N A;  4LWC A;  5IYD G;  3GDE A;  1JJG A;  1CUK A;  4A3J G;  1PVO A;  4L5Q A;  5LMU L;  2BH8 A;  4C3I H;  1UEB A;  3RR5 A;  2LXJ A;  2NN6 I;  5LMU Q;  1EQR A;  1UE6 A;  1X56 A;  3GO5 A;  1Q1B A;  2MO1 A;  4JI8 Q;  2Y0S G;  1GO3 E;  3AFQ A;  3ER0 A;  3K7U C;  3ICE A;  5M5X H;  1PH5 A;  2JA8 G;  2VY3 A;  3EBE A;  1BKB A;  4A4I A;  1XNR Q;  4DK3 C;  1M1K C;  2HHH L;  5C0X J;  1N32 L;  1PH1 A;  1HNZ Q;  3TEH B;  1E22 A;  4YCU A;  4GOP B;  1VQ7 A;  4HJ8 A;  1QUQ A;  5C44 G;  1VQO A;  2JA7 H;  2CQO A;  4QL5 A;  5JEA J;  3FKI G;  4LNQ A;  4DKA C;  1I6H H;  4JCV E;  1G51 A;  4BY1 H;  2VQE L;  2IX0 A;  3F1Z A;  4NXN L;  2ZJQ A;  3PO2 G;  5IYD H;  2VQE Q;  4MNO A;  1C7Y A;  3W1B A;  3W1G A;  4RG1 A;  4JI7 L;  1YHQ A;  3CD6 A;  3M4P A;  4DV5 L;  4A3L G;  1L1O B;  3FHW A;  4A3F G;  3MEF A;  1VS0 A;  3PGZ A;  5BR8 L;  3HKS A;  3J80 i;  4KI0 A;  1IBM Q;  3UDG A;  4LW1 A;  4LF6 L;  1PH7 A;  4A3D G;  4WJ3 M;  4UP8 A;  1U5K A;  2ASB A;  5C44 H;  2ZJR A;  3PSI A;  3UDI A;  4POG A;  1ASZ A;  4DR6 Q;  1I5F A;  3GTP H;  2IT1 A;  1Q7Y C;  3PO2 H;  1X3G A;  4X65 L;  4A3I H;  1NBW A;  3F2D A;  4GLX A;  4X65 Q;  1M90 C;  1A63 A;  2R6G A;  1JMC A;  1BBW A;  1GVP A;  2ES2 A;  2NVQ H;  2R7Z G;  3RN2 A;  2N49 A;  2UXB Q;  2WP8 J;  3J81 j;  3HOV H;  4IJL A;  3HOZ H;  1Q82 C;  1VQI A;  5FJ8 G;  3L7Z C;  1S40 A;  1MJC A;  4R4Q A;  1KRT A;  4Y7N H;  1CKO A;  1W2B A;  1KC8 C;  2UXC L;  4A3D H;  4A3B G;  1VQL A;  2E5L Q;  1E7Z A;  4JBW A;  4GOP C;  2UXC Q;  3D31 A;  5LMN W;  4AIM A;  2K5H A;  4JI6 L;  4A3K G;  3G48 A;  3STB C;  4X64 L;  3PIO A;  3CC7 A;  1XNQ L;  4JI6 Q;  2CWP A;  4KHP L;  4X64 Q;  1N8R C;  1XNQ Q;  3RNU A;  4KHP Q;  1YEZ A;  1XPO A;  4YCV A;  2IHF A;  2R7F A;  1BBU A;  2K5N A;  2PQA B;  4NB3 A;  1VQ5 A;  3G71 A;  2KCT A;  4LF7 L;  1GKH A;  2MQH A;  1IBK Q;  4OWW B;  1VQ6 A;  4GS3 A;  1EOV A;  4HJ7 A;  3E0E A;  1VQB A;  4LF7 Q;  1VQ8 A;  1K73 C;  1PYB A;  2E2H H;  3L0O A;  4OON A;  4R4T A;  4TVA B;  3Q8D A;  2ID0 A;  5GQO A;  3D0F A;  4DV6 L;  1YHA A;  3PUV A;  3K80 C;  1TXY A;  4DUY L;  4DV6 Q;  4A3K H;  4KHZ A;  4R4C A;  4A3E G;  3KDF A;  1SMX A;  1IL2 A;  2RHQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...