1JJGA

Solution structure of myxoma virus protein m156r
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
102
structure length
102
Chain Sequence
MTVIKPSSRPRPRKNKNIKVNTYRTSAMDLSPGSVHEGIVYFKDGIFKVRLLGYEGHECILLDYLNYRQDTLDRLKERLVGRVIKTRVVRADGLYVDLRRFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords M156R
publication title Myxoma virus immunomodulatory protein M156R is a structural mimic of eukaryotic translation initiation factor eIF2alpha.
pubmed doi rcsb
source organism Myxoma virus (strain lausanne)
total genus 8
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2001-07-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1jjgA00
1S40A 2VQFL 1K83H 4O2DA 3CPWA 4LFCL 3PF5A 1X56A 1Y1VH 4BXXG 1YI2A 1JMCA 2JA5H 1E1OA 1L1OA 2OTLA 1PH4A 2UU9Q 3CCLA 1UWVA 1X54A 3B6YA 4GOPB 3GTQH 1IBMQ 2LXKA 4A3GG 1WFQA 5GQOA 4UP8A 2EQSA 4DV1L 2HT1A 1YITA 1Y14B 2E2HH 1UE7A 3CMEA 1VQ6A 3I4MG 1Q46A 1N32Q 3GTOH 4TQUS 1FL0A 4QIWE 5DLQE 4B3ML 3W1BA 1QVCA 4POGA 3HOUG 4RMFA 4JCVE 2MQHA 1PA6A 4JI4L 4A3LG 2IY5B 3ICEA 1AH9A 3Q8DA 1HZBA 3HKZE 1S3OA 2NZHA 4H02A 4OO1I 1HNZL 3AFPA 3TEHB 1LYLA 3GTJH 1NTGA 3CCUA 1HNXQ 1EIYB 2CKZB 4JV5Q 1RL2A 4JI2Q 3HOVH 5C44H 2CWPA 5IWAL 4EQ5A 2PNHA 2ALYB 4AIMA 3CCVA 4HIKA 5C4XG 1BKBA 4IFDG 3AQQA 4KHZA 2F52A 4UPAA 2XTIA 1VQLA 2CWAA 3IRBA 1YJWA 3RZOH 4X6AH 1XNRL 1BBWA 2VQEL 4BXXH 2L15A 2JA9A 3J80i 4R4OA 4Y7NH 1NY4A 4YY3Q 2WAQG 1QUQA 1OTCA 2JEAI 4WJ4A 2WP8J 1VQBA 3I2ZA 4UP7A 1BVSA 1HNWQ 3I4MH 2HHHL 2JA6G 1VQEA 4LF7Q 4JI0L 4DNIA 4PMWA 1FJGL 2JE6I 1HH2P 1EUJA 3CD6A 3STBC 1JT8A 3PF4A 1YEZA 2YTYA 3UDFA 4GNXA 1XMOQ 1ASYA 4OXPA 1NMGA 4JOIA 4DV7Q 2D62A 1TWAH 1X3EA 4PZ8A 2ZM6Q 4KI0A 1N34Q 2I0QA 4R1JA 2ATWA 4DV3L 4JI5L 1MKHA 2VY3A 3CW2C 3UDIA 2WAQE 3A74A 4JI1L 4A3KG 2D0PA 1EQQA 4NXMQ 1E3PA 1YHBA 2NVQH 4DR4Q 5C4XH 1YHQA 5LMNQ 4A75A 3ULPA 1XPOA 4YWLA 4LNQA 3D31A 5JJLA 1CKOA 3S2DH 1P16A 5JEAG 4DR6L 1E24A 3DLLA 4A93G 3RLOA 3TS0A 1J5EL 4LF4L 2I5HA 2OWOA 3PV0A 3OTOQ 3T1YQ 5IYDG 1CKMA 1UEBA 1EQRA 2VZAA 1V43A 5IYCG 1OXTA 3I7FA 3H3VH 3M3YH 4J15A 2K5HA 4DPGA 1S72A 3U4VA 3PIOA 1VQPA 4BA1I 2JA6H 4HJ5A 1X55A 1KHIA 2A1AA 1V9PA 2I5MX 4HJAA 2PQAB 4P71A 5IT9c 3MXNB 1VQJA 3L7ZC 2ES2A 2UUBQ 1PH9A 1TWHH 3PO2G 5C3EG 4MNOA 2EXDA 2UUCQ 4DV6Q 1UE6A 1KL9A 1T9HA 4XTCS 1G291 2ID0A 5FJ8G 4AYBG 2UUAL 1XNQQ 1WJJA 4JI7Q 1C0AA 3CAMA 3F2BA 4BY7G 1EFWA 3PUZA 5IP9G 1VQFA 4JI6L 4X65L 3KF6A 1VQGA 2N49A 4DR2Q 1M1KC 4GKKL 3PSIA 3U58A 2RHQB 5IP7G 4DUYQ 4GOPA 2ZTDA 2H5XA 1CSQA 4A93H 5K36G 1N9WA 1N36Q 1VCIA 4AQYQ 4QGUA 3HOWG 5IYDH 2QEXA 2KBNA 4GN4B 2MO1A 2Q2TA 3HOZH 5M5WH 2OQKA 4AYBE 1PYSB 1VQNA 3FKIH 4IJLA 3AFQA 5LMNW 3I56A 3CCQA 2YTXA 4DAMA 4OO1G 4DUZL 4PZ7A 2KHJA 1NJIC 3HOXG 4OONA 3L0OA 4HIMA 1O7IA 5C0XJ 3EBEA 3CP0A 2C35B 3J81c 3KF6B 1E1TA 3PO2H 2UXCL 5C3EH 3E9IA 2AWOA 1U5KA 2BH8A 4JYAQ 4X62Q 5E7NA 5ELNA 5FLXc 5FJ8H 1GO3E 4C3IH 1I94Q 5EAYA 4ME3A 4IJHA 4JI8Q 4XIGS 4C3JH 5GAHC 3M7NA 3K7AH 5IP9H 4B3RL 5AJ3Q 4K0KL 4A3EG 4IOAA 3KLWA 2E2JH 2YU9H 3UE1A 1SRUA 3I4OA 1XMQL 1U0LA 2HIXA 4LF8L 4LFBL 2YTVA 1C7YA 5IP7H 4NXNL 4LF5L 1SLJA 3K81C 3PCOB 4DV0Q 4NPSA 1Q81C 3M4OH 1XJVA 3E9HA 1KD1C 2UXDL 1JE5A 3S16H 1E7ZA 5JJKA 3RN5A 4L5SA 2R7ZG 4X64Q 4P75A 3T1HL 4LW1A 1FGUA 3RZDH 4X66Q 3HKSA 3BJUA 1VQAA 3PIPA 3SGIA 2UU9L 4C3HH 1IBLQ 1IBML 2F4VQ 3ER0A 3TREA 2V1CC 5LMUQ 4L5RC 2JA7G 1L2FA 3HOXH 1XNRQ 2R92G 3F2CA 3PGZA 1HJPA 1N32L 3RR5A 4A3IG 4GKJQ 3CCJA 4B3SQ 3JAMc 1R9TH 2Q2HA 3U4ZA 3RNUA 4A3GH 1GKHA 1SROA 4LFAQ 2NVXH 1I3QH 4A4IA 4O0AA 3S24A 4DR1Q 1HNXL 1Q1BA 1PHJA 4QL5A 1SFOH 4JV5L 2KENA 4A3MG 4JI2L 2Z6KC 1Q1EA 2QGQA 4LUZA 1EIFA 2LSSA 3HOUH 3J81i 2AMCB 4A3LH 1I50H 4IO9A 4IPHA 1MIUA 4PG3A 4IOCA 2Z0SA 2R93G 4B3TQ 5GADC 3DM3A 1HZAA 3G6EA 2N3SA 1KAWA 1Q8KA 4GLVB 1Q86C 1UE5A 1PYBA 2K5VA 1OXXK 1WOCA 2AHOB 2N8NA 1MJCA 2KCTA 2PQAA 3KOJA 1PH2A 2JJQA 1YJNA 5C0XI 4DR7L 5BR8L 1YJ9A 1PH3A 4KHPQ 2EIFA 4YY3L 3KDFB 4GNXC 4UP9A 2DUDA 3GTLH 3S15H 1JJGA 2MO0A 1Q12A 2JA7H 1HNWL 4LF4Q 1AE3A 3K8AA 2R92H 2AKWB 4LF7L 4GN3B 3K0XA 1WYDA 1QZGA 4A3IH 1NMFA 3G4SA 4QY7A 2RF4A 2E5LQ 4MZ9A 5M3MG 3NEMA 1XMOL 3CF5A 2K5NA 4DV7L 4LUOA 5IYBG 2ZM6L 3KJOA 1N34L 2VL6A 2OQ0A 4A3MH 2IT1A 4YCUA 1D7QA 1VQMA 1Y1WG 2N78A 1IYJB 4TVAB 3G48A 3WWVA 4DV5Q 4A3FG 1PH1A 4DR4L 4LUVA 4DV2Q 2PI2E 1XTDA 2K50A 4R4QA 5ELOA 3G71A 5LMNL 3A5ZB 4ALPA 4OX9Q 3S1MH 3OYYA 1CUKA 4LF6Q 2R93H 1VQKA 2A8VA 3JAMi 1CKNB 1JJCB 4L5QA 3EN2A 4Y52H 3CC4A 1HR0Q 4LF9Q 4DR5Q 1A62A 3K7UC 4DV4Q 2MFIA 5M3FG 4JI6Q 4BBSG 3T1YL 2UXBQ 2Q2UA 1SMXA 4HIDA 3J7ZC 4A3KH 2K52A 3H15A 2JEBI 2RCNA 2R6GA 3FP9A 3LGJA 4DK6C 4QQBX 4JI3Q 1H95A 4OWWB 5M5XH 3S2HH 1EOVA 1TWGH 2GVAA 3GDEA 3CXCA 4KLKA 2DGYA 2HQLA 3I4NG 3TQYA 5M5YH 1HZCA 1Y1VG 1OXUA 1C9OA 3F8TA 4DR3Q 2VNUD 1PH7A 2RHSB 3KF8B 1J6QA 3H0GG 5IYCH 2IHEA 5M3MH 4YHHQ 2UUCL 1N33L 4DV6L 2E2IH 2ZJPA 4HIOA 1VQIA 1IZ6A 3F1ZA 1TWFH 5IYBH 1N8RC 1XNQL 2VW9A 3CPFA 4BBRG 1PH5A 1LUZA 2IX0A 1MJEA 1KQSA 1IBKQ 3E0EA 4JI7L 1Y1WH 2VQFQ 3UDGA 4LFCQ 2LXJA 3PUWA 4A3FH 1LTLA 3VDYA 3L2PA 2B63G 1YNXA 1TXYA 4DR2L 2GVBA 3A5UA 1PH6A 1VQDA 2K75A 4DV1Q 3ERSX 3NELA 4DUYL 2WB1G 1B7YB 4K0KQ 4A76A 1N36L 2XGTA 4AQYL 5M3FH 4IFDJ 4BBSH 1IL2A 4B3MQ 4BY7H 2KHIA 5H1SE 4JI4Q 1FVIA 1PFSA 3F2DA 3CC2A 3GTKH 4BA2I 1HNZQ 1L1OC 2UXDQ 4JBKA 5JJIA 3HKZG 3M4QA 1KRTA 2OCEA 1PVOA 3I4NH 1CSPA 5IWAQ 3T1HQ 4JBMA 3HOWH 1HR0W 1GD7A 2NN6I 1L0WA 1SN8A 3M4PA 4BY1G 5FLMG 2K4KA 2NVTH 2WB1E 3FHWA 1PV4A 1QVFA 3H0GH 4IPCA 4A3DG 3K80C 4JYAL 2ZTEA 3OW2A 4X62L 3CCSA 4EX5A 4BBRH 1I94L 2VUMG 3PO3G 3PUYA 3W1GA 5J3BA 1K0RA 4JI8L 3S14H 4AH6A 3CC7A 1NE3A 5AJ3L 2VQEQ 2B63H 1E22A 3J7A5 3S1QH 1G51A 2CFMA 4POFA 5C0XG 1WCMG 2YYZA 5GAGC 4IPGA 3D0FA 3KDFA 2HHHQ 4DV0L 3AYHB 4JI0Q 4P74A 1Z9FA 1FJGQ 5IY0A 1I5FA 3GD7A 4LWCA 2KCMA 1IXRA 3KYHC 4X64L 4A3EH 2NZOA 2ASBA 1L1OB 5JEAJ 4DAYB 4A3CG 4X66L 3ZJYC 3HOYG 1BBUA 3I55A 1IBLL 2ZTCA 4MTNA 2F4VL 4NB3A 1VQ4A 1AE2A 4DV3Q 1W3SA 1PH8A 5LMUL 2Z6KA 4JI5Q 1XPUA 3AEVA 2JK8A 1VQ5A 5C4JH 1B70B 4JG2A 4JI1Q 4P72A 2R7ZH 1VS0A 1WI5A 2D0OA 4GS3A 5FLMH 1X3FA 3NBHB 5BR8Q 4JBJA 3RN2A 4BY1H 2VUMH 3PO3H 4DR7Q 4A3DH 4WJ3M 4R4CA 4GKJL 1A63A 2AWNA 4B3SL 4R4IA 4DR6Q 2IX1A 4LFAL 3GTPH 1W2BA 4JOIC 1YZ6A 2B3GA 1CKNA 1LM0A 2BA0A 2GN5A 2I5LX 4OWTB 4DR1L 1J5EQ 2YV5A 3UDXA 4HJ8A 2QA4A 2MNAA 2Y0SG 1XPRA 3W5OA 1A8VA 4A3BG 4IFDI 3PUXA 1OXSC 1P8LA 1Z47A 1K8AC 1WCMH 1JJ2A 2ZJRA 2CCZA 4B3TL 1G6PA 3HFZB 1UE1A 3J81j 1ASZA 3PUVA 1GVPA 3ULJA 3EIVA 4A3JG 1KC8C 1NBWA 2JQOA 2A19A 2WFWA 4A3CH 1KRSA 1YBYA 1JB7A 4NXML 3H3VI 4DK3C 4YWKA 3CMAA 4KHPL 2PI2A 1QUQB 1B8AA 3CCEA 3HOYH 4RG1A 2R7DA 2BH2A 2ZJQA 2UUAQ 4GLXA 2Y0SE 5HY6A 4JBWA 3TS2A 1V1QA 1VQHA 3CQZH 3M9BA 3CCMA 4R4TA 1K73C 4IPDA 2VS1A 4X65Q 3OTOL 1Q7YC 2JA8G 3HOZG 1X9NA 3S1NH 4GNXB 1X6OA 4L5TA 1K9MC 4GKKQ 2F3IA 3STBD 1DGSA 3FKIG 2E5LL 1X65A 2NVYH 1K3RA 2HIVA 1KIXA 4QJFA 1RIPA 4FDBA 3GTGH 1VQCA 1M90C 4PZ6A 3U50C 4YCWA 3S1RH 1VQOA 3KFUA 1Q82C 1TWCH 2FXQA 3KJPA 4DV5L 4A3BH 2UUBL 4DV2L 5GROA 3BZKA 1N33Q 3GO5A 2JA5G 4OX9L 1VQ7A 1D8LA 3RLNA 1GM5A 4LF6L 1SR3A 3M85A 4GN5A 3UE0A 4DUZQ 3MEFA 2BA1A 4GOPC 1KXLA 5GAEC 4A3JH 1HR0L 4LF9L 4DR5L 2CQOA 1OXVA 4DV4L 4UY8C 1YVCA 2OTJA 1EWIA 1X3GA 2E8GA 2UXBL 2UXCQ 3JC66 1HZ9A 2NN6G 4DKAC 4C2MH 5IE8A 2B29A 4JI3L 4YWMA 4HJ7A 4GLAC 1QZHA 4HJ9A 1EYGA 3NENA 4P73A 2PMZE 1VQ9A 4B3RQ 3HOVG 3RLFA 5C44G 1K8GA 1I6HH 1YHAA 4YCVA 1YIJA 1QVGA 1A0IA 2K14A 3J80c 2JA8H 3S17H 2R7FA 3ULLA 4DR3L 1XMQQ 4OWXB 5HGQA 3BU2A 3CCRA 4LF8Q 4LFBQ 4YHHL 4JC0A 1VQ8A 4APVA 2Q2IA 4NXNQ 3TRZA 4LF5Q 1SE8A 3BZCA 2IHFA 1IBKL 3A0JA 3GTMH
chains in the Genus database with same CATH superfamily
3CPWA 4EQPA 4LFCL 1B3QA 5ELBA 4BXXG 4S3SA 2F0LA 1JMCA 1LTRD 2JA5H 1L1OA 5J39A 2OTLA 2UU9Q 3B6YA 4GOPB 2LXKA 1WFQA 4KD3A 4DV1L 2EQSA 1Y1VB 1Y14B 3E6ZX 1UE7A 5E4WC 1SE2A 2E2HH 5A2QL 4TQUS 1FL0A 4B3ML 2E74C 4FXKC 4A3LG 2MQHA 2IY5B 3E5SA 5D3IB 1SYFA 2RDHA 4IUNA 2NZHA 4H02A 4F87A 1LYLA 1BCPD 1STEA 1NR4A 4DAVA 4O1NA 3HOVH 2CWPA 1O7ZA 4AIMA 1G2TA 1DOKA 4KKUA 4HIKA 5C4XG 1JOOA 1SDFA 5C44B 4UPAA 5KGUA 3K5MA 3FRPB 3BVZA 1ESRA 4QIWB 1SYGA 4QF4A 2L15A 2JA9A 2NYZD 1D5XC 2SOBA 4Y7NH 3G6JB 4KKTA 5KNDA 2WP8J 2JA6G 2O4XA 4J6HA 2Z8LA 3H6MA 3STBC 1JT8A 3PF4A 4LAAA 2HCCA 3UDFA 2HUGA 1ASYA 4JOIA 2D62A 1DCZA 2XSCA 4KI0A 4R1JA 4DV3L 1HFNA 2B2YC 4KK7A 2RQXA 4JI1L 3A74A 5ELDA 4A3KG 2D0PA 3A56A 2NVQH 1TWAB 1CI3M 2EYJA 3ULPA 1QNKA 2EYOA 3D31A 1JOKA 3S2DH 4QUFA 3DLLA 5E4XA 5C4XB 4LF4L 5IYDG 2VZAA 5IYCG 4RGOS 5DEHA 4J15A 4DPGA 3PIOA 4EVOA 1VQPA 4FF4A 5CV7A 1C48A 2NBFA 3M3YB 3L7ZC 2ES2A 1PH9A 2JA6B 2K7VA 4MNOA 2EXDA 1HA5A 1IKMA 1J8IA 1T9HA 2UUAL 4AYBG 3TBIB 4C3IG 4JI7Q 1TT2A 5IP9G 2K6AA 1DZ1A 1VQGA 4DR2Q 3IKJA 1KLGD 2RHQB 5IP7G 4GOPA 2EVBA 3MFYA 2H5XA 1CSQA 4QGUA 4FO2A 5C4HA 3L9AX 2Q2TA 2IWHA 2Z4IA 1TR5A 3FKIH 4C3HG 1E2ZA 3L0OA 4OONA 2PYKA 4BS9A 2XNAC 3CP0A 1B9MA 3KF6B 3K5LA 3NP8A 3E9IA 2DNCA 2NUCA 4JYAQ 3TP5A 5E7NA 2XN9C 5FLXc 2B2WA 1GO3E 4I65A 3Q0AA 1PTOB 4JI8Q 4XIGS 3NXWA 2B2UA 5AJ3Q 3WOEA 3VYUA 4CDEC 4AYBB 4C3IB 4MN3A 2HIXA 2YTVA 1C7YA 3K81C 2E2JB 5K36H 1MI2A 1KD1C 2WIIB 4P75A 3A7LA 1FGUA 4RCOA 3RZDH 3BZDB 1LTTD 2M00A 2O2LD 2KJXA 1ICWA 3F2CA 3EJIA 3PGZA 1N32L 4C3HB 5JJZA 1EEFD 2PCFB 1OO9B 3JAMc 1R9TH 2F0FA 3BVGA 3NTKA 3EFXD 4O0AA 4DR1Q 1PHJA 1SFOH 4IALA 4JV5L 3EROA 2QGQA 1EIFA 2OF1A 2NVXB 1I3QB 1VMPA 1A2TA 5GADC 1KAWA 4CKEA 2F0QA 2K5VA 1OXXK 3KOJA 5CMDA 4DR7L 1YJ9A 2EIFA 4YY3L 3BS1A 1LABA 2MO0A 1Q12A 4LF4Q 2AKWB 3NE5B 1EYDA 4A3IH 3GTLB 2H1EA 1Q90A 5AFWA 3VYRA 3BG3A 1XMOL 1PZJD 3CF5A 1C4QA 5C4ZA 2OQ0A 5FLXL 2IT1A 2LKVA 4YCUA 4A3MH 2IX3A 2N78A 3VR4A 4TVAB 4A3FG 4DR4L 2JSOA 2PI2E 2K50A 5ELOA 4OX9Q 1EY4A 1CKNB 4L5QA 3QWNA 4LF9Q 3K7UC 2MFIA 3V05A 1LLRD 1V1OA 1JWSD 1R4QB 3J7ZC 1KDCA 3H15A 2RCNA 1LTSD 1BBXC 3D4DA 4CDCC 1KLUD 1TWGH 2GVAA 3CXCA 2XIWA 1I4XA 3U9OA 2HQLA 3TQYA 5M5YH 1ZEQX 1HZCA 1K3BC 2VNUD 4R8NA 4ME5A 2IX1A 3R3OA 4DV6L 3FDTA 2ZJPA 4HIOA 1VQIA 2KCCA 3TMEA 2HD3A 4G7OC 1PH5A 3E0EA 1Y1WH 2VQFQ 5EQ0A 2E2IB 1D5MC 1YNXA 2MJ8A 1H9MA 2IW3A 4WFN3 4N8FA 3I70A 3ERSX 3NELA 4DUYL 4A3FB 4NMZA 5M3FH 3A8IE 2A68D 4XT1B 4BBSH 4BY7H 4IFDJ 2KHIA 4R9WA 1FVIA 3CC2A 2JYOA 4JBKA 3HS0C 2B2WC 2OCEA 3WOFA 2IJ0A 3VR5A 5IT9E 2BOSA 3OSOA 4JBMA 5COYA 2NVTH 2K4KA 1QVFA 4IPCA 1JB3A 4KKSA 4C1NI 3OW2A 4X62L 4EX5A 1U9RA 1I94L 4OL7A 1DYQA 1WD0A 3CC7A 2VQEQ 2B63H 3E3XA 4FF1A 1PFBA 1G91A 3S14B 3PIO3 4DV0L 2K05A 1U4RA 4KHVA 1JWMD 4NW2A 3GD7A 5KYIA 3KYHC 1IXRA 2Q8RE 2B2VA 2NZOA 4A3EH 1M4VA 2PW5A 2ASBA 4X66L 2QF7A 1EWHA 2EJFC 1IBLL 2F4VL 2NWGA 4CKCA 4OGQC 2F4IA 3J81E 1VS0A 1HFGA 5FLMH 4DR7Q 2MHVA 4JBJA 1V8QA 1S5CD 3NWTA 2A73B 1J9OA 1ILQA 4GKJL 4F88A 4B3SL 5C4JB 2EXZA 1CZWA 4R4IA 3O13A 4DR6Q 2R7ZB 3GTPH 2RVLA 2B3GA 1CKNA 3M7GA 4OWTB 1J5EQ 2FMCA 4ZLTF 4IFDI 1PZKD 1P8LA 1Z47A 1JJ2A 3P7JA 4M8AA 3A8JE 2D2CC 3QJYA 1Y8NB 3SK8A 1HHVA 1GVPA 1EIHA 1NBWA 2WFWA 2R61A 1KRSA 4A3CH 4IURA 4CKBA 1JB7A 4NXML 4YWKA 3J80L 3CMAA 1QUQB 1CTMA 1EQVA 4GLXA 4HCSA 4JBWA 1K73C 3D3RA 3DWAA 2VS1A 1X9NA 2F3IA 3STBD 3FKIG 1NR2A 3K5OA 1K3RA 2HIVA 1SYDA 3BYYB 1IL8A 4OEMB 4QJFA 3N52A 4DNRB 4ZRZA 3GTGH 1VQCA 3S1RH 4YCWA 5I2XA 4FYDA 1BDOA 2UUBL 3OW7A 1EY6A 1G6ZA 1PZID 1TWCB 3UE0A 3MEFA 1BUVT 5D3DA 4A3JH 4DV4L 4UY8C 1HZ9A 2ZXRA 2WV6D 3BDOA 3LWUA 4C2MH 1A6XA 2B29A 2NZ1D 4YWMA 1EYGA 1QILA 3NPPA 2CH4W 3RLFA 2K33A 2QKIC 1YHAA 4RA8A 1B2TA 1U4PA 2K14A 4DR3L 1XMQQ 1D2BA 3CCRA 4LFBQ 2D9UA 4JC0A 4APVA 4LF5Q 3S17B 1X32A 4EGVA 3GTMH 4DNTB 3PF5A 2OEOA 1JE4A 1EY9A 1KAAA 1X56A 1YNJC 1YI2A 4K2KA 2MUYA 1E1OA 1TQOA 3CCLA 1PH4A 3GTQH 4FF2A 1K83B 5GQOA 4UP8A 4H0LC 1YITA 2PMZB 3CMEA 1XXGA 2NTSA 4DU9A 2C9OA 2ZT9C 1JORA 3W1BA 4IZ8A 4RMFA 1PA6A 4JI4L 1AH9A 3ICEA 5CV6A 1E2WA 2J7ZA 3HKZE 1HNZL 3GTOB 1NTGA 3CCUA 2K28A 1HNXQ 1EIYB 2O5IC 4HAEA 2CKZB 4JI2Q 1UEAB 1C8CA 5A35A 2PNHA 2ALYB 1ESFA 1QOHA 3CCVA 3GTJB 5IGEA 4IFDG 1H9KA 3AQQA 2A6ED 1VQLA 4DA2A 4QB4A 1BR9A 1TS4A 1X3QA 3P1HA 2B2VC 1HUMA 1M8AA 3J80i 4TSSA 1NY4A 1W6JA 3RZOB 1QUQA 2CH4A 5EGTA 4RHRA 1HNWQ 1EYAA 1PMRA 2HHHL 3I4MH 5NUCA 4PMWA 2G9HD 1YNNC 1HH2P 3CD6A 5E1FA 3AU7A 1CM9A 2EY6A 4DV7Q 1X3EA 2ZM6Q 3OPOA 4G57A 1WTRA 4XT3B 3ZYYX 2WAQE 4NXMQ 1EQQA 4HN7A 4ZK9B 1E0BA 2AQ2B 1TY0A 2KQ3A 1A3VA 1A3UA 1CKOA 1NNXA 1P16A 4N9PA 4A93G 3RLOA 3PV0A 2BDOA 1RHPA 1CKMA 1XWEA 1EQRA 4R8IA 1QJOA 3BDLA 2EE1A 1S72A 2K5HA 1WTXA 4XQJA 2R3ZA 1X55A 1KHIA 2A1AA 2I5MX 3MXNB 2UUBQ 1FGBD 1ENCA 2OT2A 4BWGB 1RJTA 1S5BD 5FJ8G 1WJJA 1QB5D 1JR0D 1TWHB 2F3WA 2IPKD 2SNSA 3SXHA 4BY7G 1VQFA 2FINB 3SDZA 5IGBA 4X65L 3Q22A 2N49A 1LT6D 1M1KC 3PSIA 3BVMA 5KNBA 5JEAH 4HSPA 1K28A 2ZTDA 4DFAA 1RTOA 1N36Q 1VCIA 4AQYQ 1B44D 3GP7A 4RH6A 5KYLA 3HOZH 5G3LD 4A93B 4FXGC 3P75A 3CCQA 4DAMA 2SDFA 3OIPA 4DUZL 4PZ7A 5M5WB 3HOXG 2EDGA 4HIMA 5C0XJ 2C35B 5ELFA 1S4ZA 3PO2H 2UXCL 5C3EH 1HCZA 2AWOA 5I6WA 2PZWA 5EAYA 5CC4A 1B4OA 1PXUA 4C3JH 4B3RL 2XWJB 4A3EG 2AQ1B 4XXEA 1DM0B 3TN2A 1SRUA 3K7AB 1B53A 1ET6A 1SLJA 1RD9D 3PCOB 2YU9B 1Q81C 1E7ZA 5JJKA 3KLSX 4X64Q 4OIJA 3T1HL 1S5FD 1TS2A 1BCPB 1DOLA 3M4OB 1EFID 4ULLA 1VQAA 3S16B 1VDZA 1SXTA 1IBML 4ZAIA 4OO1H 2EYPA 3TREA 2X6GA 1L2FA 2R92G 5I4DA 1S5DD 4IUUA 1ONLA 1SYEA 5EJWA 3CCJA 3HOXB 3I90A 4A3GH 3C1FA 4XYOA 4LFAQ 1A2UA 3NUCA 1QWYA 2KENA 2Z6KC 4FP5D 1Q1EA 3HOUH 2F3VA 3KBXA 2V4DA 4F7XA 1I50H 4IO9A 1MIUA 3FPPA 3HEJA 2R93G 1HZAA 3KUPA 2N3SA 3HRZC 3H94A 2F0JA 1UE5A 1WTVA 3MXNA 5C0XI 1WTWA 3CKIB 5BR8L 2F0VA 1DOMA 2KHSA 1CT1D 3EVQA 3VR6A 1DJRD 2JA7H 2PZTA 1HRJA 3K8AA 4LF7L 1BCPF 2RSNA 1MGSA 4DGZA 1NMFA 3G4SA 3S15B 4H13C 1O80A 4QMGA 1VF7A 1E2VA 2AUKA 4V190 4TRDA 4OIKA 3I91A 4ZUJA 1PDQA 3T4AC 1UNSA 3D8GA 5IYBG 2VL6A 1N34L 4FNFA 5I6YA 1VQMA 4DV5Q 1S5ED 5BN5A 4LUVA 4DV2Q 1F9PA 3G71A 5LMNL 1ZYRD 5JPMC 4IUVA 3SHLA 3EN2A 3CC4A 3S1MB 1LTBD 1GUSA 4X3SA 3T1YL 2R93B 2F0WA 2Q2UA 1SMXA 1SNMA 2QEJC 1RTNA 1CHPD 2JEBI 3FP9A 1A15A 4WJWA 4B08A 3LGJA 4DK6C 3QO2A 4OWWB 1EOVA 3GDEA 4A3KB 1SE4A 3H91A 1OXUA 5M5XB 3S2HB 4L6TB 3HGBA 2RHSB 1J6QA 3H0GG 1ML0D 4DK0A 1O78A 3DHQA 5M3MH 2UUCL 1IZ6A 3NTHA 1XNQL 3CPFA 4BBRG 2F0EA 3SVMA 2IX0A 2EYHA 1JOQA 4LFCQ 2LXJA 3VDYA 1TWFB 3L2PA 1SBBB 3A5UA 2RBMA 3AB9A 3K58A 2K75A 3C1EA 4DV1Q 2WB1G 1B7YB 2F1MA 3D6CA 2MGSA 4B3MQ 2IL8A 3GTKH 4BA2I 3ITPA 1L1OC 3D6WA 3HKZG 3M4QA 4KY7A 3MA2B 1VF5C 3I4NH 3T1HQ 1ENFA 3HOWH 1EY0A 4PNYA 4BY1G 4DAYA 1D6EC 2RSOA 3CRKC 1GUGA 1KNAA 3H0GB 1XYIA 3DM1A 4RWSC 1BQQT 4ID6A 1E22A 4BBRB 3J7A5 2H4OA 1QG7A 3HZXA 1PFMA 1WCMG 5C0XG 1ILPA 4IPGA 3D0FA 3AYHB 3SK6A 3PQIA 3S1QB 3DWPA 3CRLC 1ENAA 2CQAA 2A6HD 2WB1B 2RCFA 1YNJD 2FHTA 1VQ4A 1PTOF 1AE2A 4DV3Q 1AW7A 2X69A 5LMUL 3AEVA 4K5WA 4JG2A 4JI1Q 1D1KA 2VUMH 1X3FA 3NBHB 5BR8Q 3PO3H 1W6KA 3AMUA 4A3DH 4NDXA 4R4CA 1JICA 3ERQA 1W2BA 4JOIC 2BA0A 5CYUA 4BY1B 3X3MA 2WKDA 4HJ8A 2ENBA 1EY7A 3KLRA 2EY2A 2Y0SG 3W5OA 1K8AC 2CCZA 4B3TL 1O7LA 3HFZB 3VR2A 1ASZA 2SEBD 3ULJA 1WCMB 2JQOA 2A19A 4DXGA 1IYVA 1JCKB 4E6IA 1YBYA 4KHPL 3HOYH 2R7DA 1H9JA 2UUAQ 4OELB 5ISRA 3TS2A 1LO5D 2DJFC 5C3XA 4KV6A 3M9BA 4R4TA 4IPDA 3HOZG 1YNND 3S1NH 4GNXB 4F8MA 1I4GA 3CQZB 3JAME 2E5LL 1X65A 1PRTB 1AZQA 3ONAB 3OMCA 4CHTB 1TS5A 3DMUA 5ELEA 2NVYB 1VQOA 3KFUA 1F9QA 4A3BH 4I7ZC 3GV6A 5CR3A 2JA5G 4P2CB 1VQ7A 3RLNA 1GM5A 4LF6L 2Y0SB 3D4WA 1H9SA 5IGGA 4GOPC 1ET9A 2M9VA 4C3JG 1KXLA 1HR0L 4DR5L 1OXVA 1Y69U 1STHA 1RCVD 1EWIA 3W3AA 2UXBL 3JC66 3SE0A 1GOZA 5I9PA 5IE8A 4JI3L 1CHQD 2QILA 4HJ7A 4HJ9A 2DN8A 4P73A 3BDCA 3HOVG 1K8GA 4YCVA 3LX0A 1QVGA 2JA8H 1GUOA 3J80c 4KTAA 2R7FA 5HGQA 1BNZA 4EQOA 4YHHL 4XDXA 1I6HB 3BZCA 1IBKL 3G7LA 3A0JA 2ZXPA 1JQYD 2B2UC 1Y1VH 1WTHA 3CU7A 2TMPA 1PRTF 2K32A 2ICEC 4A3GG 5IGDA 3MZ5A 1GUWA 4I7AA 2TSSA 2NB0A 2JA5B 1N32Q 4QIWE 5EKLA 3HOUG 2X6LA 4JCVE 1U4MA 2NN6H 2EYLA 4KN4C 2E2HB 3NBHA 1S3OA 5TSSA 1Y8PB 4KJNA 3AFPA 3TEHB 2EY5A 2F0MA 3IFDA 4JV5Q 1T5XD 5C44H 4IN3A 1SNCA 5IWAL 3KLSA 4EQ5A 3TP8A 1FR3A 2PNRC 3HOVB 2F52A 2CVRA 2CWAA 2L4NA 2FMMA 1TU2B 1SEBD 2LY7A 1YJWA 1XNRL 1BBWA 5T1GA 4BXXH 5IT9L 2L12A 4YY3Q 1SJED 4QUCA 4UP7A 1BVSA 1VQEA 4JI0L 4DNIA 4Y7NB 1FJGL 2JE6I 5J22A 3FEWX 1EUJA 3H3VC 3OMGA 2A74C 1XTCD 1STNA 1YEZA 2YTYA 4GNXA 1XMOQ 5FK9C 4PZ8A 1TWAH 2L9HA 2I0QA 2ATWA 4JI5L 3CW2C 3UDIA 4DR4Q 1E3PA 5C4XH 1XPOA 4LNQA 4XQQA 5JJLA 3T56B 1PLFA 2NVQB 5JOBA 2E2DC 3IAYA 2OWOA 1V1PB 4H44C 1UEBA 3S2DB 1MSGA 1NSNS 3OOCA 4KJOA 3VA7A 1V43A 3H3VH 3M3YH 4JPBW 2JA6H 3MVVA 2JN4A 4HJ5A 1V9PA 2QDLA 3FMCA 4HJAA 4P71A 4OHJA 3I72A 3MFGA 2J4XA 1G8ZD 5IODA 3A54A 3E0JA 5IGCA 5LL6S 4DV6Q 1UE6A 5CV5A 1KDAA 1HA6A 1KL9A 2LS01 4XTCS 1G291 2ID0A 3CAMA 3MWYW 1SMYC 1EFWA 3C46A 4HR7B 1PTOC 1IKLA 2F0NA 1LTGD 4HTHA 4GKKL 2B8FA 4MIUA 4DUYQ 5EKKA 5K36G 1N9WA 4L8JA 3VYTA 3HOWG 5IYDH 2QEXA 2KBNA 5FO9B 4GN4B 1K8MA 1IHZA 2OQKA 4AYBE 4IJLA 3AFQA 3T16A 3U9SA 3MAQA 3I56A 5LMNW 1WTQA 2YTXA 2L5TA 1EZ8A 2F0PA 2KHJA 4O42A 2JP1A 1O7IA 3FKIB 3EBEA 1E1TA 3NK9A 1EIGA 2G9DA 1PTOH 2BH8A 5JAVA 1JC7A 4X62Q 4K6LA 1I94Q 1Z7TA 4C3IH 1B9NA 3MXPA 2PQEA 4ME3A 5FO7B 1CQVA 1SJHD 5IP9H 4K0KL 4IOAA 2E2JH 2NTTA 2EOTA 3PMFA 4K14A 1U0LA 1XX8A 4LF8L 5IP7H 4X3UA 4NXNL 2O5JC 2EYMA 2UXDL 4DV0Q 4NPSA 3E9HA 1F2MA 3RN5A 1WVLA 2P5ZX 4L5SA 2KEDA 4RCNA 1JWUD 5IGFA 1RF2D 4DN4M 4X66Q 4TKOB 3SGIA 2UU9L 4C3HH 5DNFA 1IBLQ 2F4VQ 4U673 3RMHA 2V1CC 3Q23A 3RZDB 1XNRQ 3IFTA 2KEEA 3RR5A 4A3IG 1STBA 3R93A 2EJGC 4GKJQ 4ZQ3A 4B3SQ 3RNUA 4XQNA 4UDUC 1GKHA 3K57A 1SROA 5KIXA 4C1NK 2L1BA 1I3QH 2NVXH 4A4IA 2PW7A 3S24A 1Q1BA 1IW7C 2L11A 4A3MG 1R9TB 4C56C 3SEBA 1V1PA 2LSSA 3J81i 4WORA 5JVG3 2Z0SA 4G7HC 3DM3A 1EY5A 1TIID 1CFMA 4GLVB 1AN8A 4N8X1 4NP5A 3KDFB 4GNXC 2DUDA 3GTLH 1JJGA 1I6VC 1PRTC 2B2YA 1A3TA 3K0XA 1EOTA 5HGTA 1WYDA 1I4QA 4DF7A 2RF4A 2EJMA 5CBAE 4G7ZC 2K5NA 4A3IB 3R2IA 4LUOA 5F2DA 3KJOA 4K6DA 4G4KA 1D7QA 1H9RA 1Y1WG 1IYJB 1CA6A 3G48A 1BOSA 1EQTA 3A5ZB 4A3MB 1SNQA 1CUKA 1VQKA 2A8VA 1FNVA 1A62A 4DV4Q 5M3FG 4BBSG 1GUNA 2K52A 3F2UA 4QQBX 4L63B 4KLKA 1RDPD 2B8GA 2OXPA 1Y1VG 2F0OA 2C5CA 1TWGB 4DR3Q 2JEAI 2E2IH 5M5YB 2K04A 4Q0FA 5A2QE 1MJEA 1KQSA 4JI7L 1UUPA 2Q8TA 3UDGA 3Q6SA 2L55A 4A3FH 3VYSA 2Z6BA 1HUNA 2B63G 1WTOA 4M1UB 4DR2L 1PH6A 1Y1WB 1VQDA 4CJ2C 4UHVA 2K01A 4K0KQ 2VXWA 3DWQA 1IL2A 1F77A 5H1SE 4JI4Q 2WKCA 1Y8OB 1PFSA 4CDDC 4U68A 2Q8IB 3F2DA 1SNPA 4HSVA 1HNZQ 5M3FB 4BBSB 4BY7B 2UXDQ 5JJIA 3GV3A 2N55A 1PVOA 1HQMC 1AFPA 2PO4A 1HPCA 1HR0W 4K8IA 1L0WA 1SN8A 3M4PA 5FLMG 1GHKA 3K80C 4JYAL 5KRUA 3CCSA 2DNEA 4ILWA 5E3FA 2NVTB 3PUYA 5CV4A 1F2YA 4RHSA 1K0RA 4JI8L 3UI2A 3S14H 4GZYC 4AH6A 3OWFA 5AJ3L 3ND8A 4X3KA 2BE5C 4K5XA 2CFMA 4POFA 5KNCA 5G3LF 3KDFA 2HHHQ 2KECA 4IUQA 2B63B 1ICFB 4NKLA 4P74A 1Z9FA 5IY0A 4LWCA 1STYA 4A3CG 5JEAJ 4DAYB 3ZJYC 1BBUA 5CORA 3I55A 3OIQA 2ZTCA 5I2YA 4A3EB 4NB3A 4ZYSA 1PH8A 4CDFC 3I8ZA 2XVSA 5C4JH 2R7ZH 1WI5A 2D0OA 4GS3A 1K0SA 1MSHA 3RN2A 1Q3LA 1A63A 4RKBA 2QW7A 5EBCA 3TP7A 1SAPA 1ZKOA 4DR1L 2YV5A 1HTLD 5FO8B 2QA4A 4ABNA 2MNAA 1FYCA 1XPRA 2EPBA 1A8VA 3SR1A 1EYCA 3GTPB 2A69C 1EU4A 2R92B 1G6PA 1IYUA 1UE1A 3PUVA 1KC8C 3EIVA 4A3JG 2RA4A 1LACA 4DK3C 3TDQA 2PI2A 2XRQD 3CCEA 4RG1A 5HY6A 2KUMA 2GA4B 1F9SA 4X65Q 3OTOL 1Q7YC 2I46A 1K9MC 4L5TA 1L0YB 3RD4A 1KIXA 4HMIA 1QE6A 1AP0A 1RIPA 2D5DA 3FPUB 2CW0C 1STGA 4PZ6A 1K8OA 1TWCH 4EQNA 4ZKCB 1PYWD 5GROA 1BXTA 3GO5A 3GTGB 4OX9L 3S1RB 3M85A 4GN5A 4DUZQ 4V0BA 1KTKA 3GQBA 1GJXA 1AEXA 3MXUA 4LF9L 3LNNA 2PPBC 1YVCA 1X3GA 2UXCQ 1CK1A 2JXMB 3R2TA 4A3JB 2K5WA 2KA7A 4N9TA 3A7AB 3NENA 3K59A 2PMZE 1VQ9A 4B3RQ 4RGNA 4UAIA 4C2MB 2E76C 3S17H 1A0IA 4LK1C 2Q2IA 1H9SB 2K03A 1SE8A 2IHFA 5C3WA 2EYFA 1S40A 2VQFL 2AQ3B 1K83H 2DJGC 4O2DA 1LTID 2EY1A 3C3LA 1SMYD 3SK4A 3HP3A 5LHY1 2A6EC 1PTOD 5K5PA 3NHHA 1UWVA 1X54A 3GTMB 1EU3A 1IBMQ 2VB2X 1VQ6A 3I4MG 1Q46A 3GTOH 3J7YW 1F2ZA 5DLQE 4POGA 3GTQB 1QVCA 4LJZC 3Q8DA 1HZBA 4Q5VA 1BO0A 4OO1I 4CJ0B 3GTJH 1LT3D 1RL2A 1CQFA 1Z6HA 2RDGA 5CBEE 1HXYD 1BKBA 3BYTB 4KHZA 3LWEA 3TSSA 1DONA 2XTIA 4RGTA 4DK1A 4RGMA 3HG9A 3IRBA 3WDNA 4KY5A 3RZOH 4X6AH 2VQEL 2LFNA 4R4OA 3HKZB 3S9WA 2WAQG 1OTCA 4WJ4A 1II3A 3I2ZA 1VQBA 5FLXE 4ZKBB 4LF7Q 1I4HA 3V96A 3KBGA 4HEDA 1GXDC 1TS3A 4J8QA 3I4MB 3MXGA 2J0TD 1EZ6A 4OXPA 1NMGA 4K5VA 5L37A 3QOLA 1N34Q 1D5ZC 1KNEA 1FD7D 4KY6A 1MKHA 2VY3A 4HMJA 3QR8A 1YHBA 2MP1A 2MPMA 1YHQA 5LMNQ 4A75A 4IFDH 4YWLA 2HQEA 5JEAG 4DR6L 1E24A 3TS0A 1J5EL 2HT1A 2I5HA 3URYA 3OTOQ 1I4PA 3T1YQ 1IW7D 5EPKA 1WTPA 2F0UA 1OXTA 3I7FA 4IQZA 4JW0A 4H7BA 3QOJA 2CHBD 3U4VA 5JPNC 4BA1I 5C5MA 2HCIA 2WAQB 1VMCA 2PQAB 5IT9c 1VQJA 1SE3A 2LMCB 1TWHH 3PO2G 5EKIA 5C3EG 2FJ2A 2UUCQ 4PV1C 4JK1C 1Q8IA 1XNQQ 1C0AA 3IL8A 3W2DA 1LT5D 3F2BA 3QG1A 5CGKA 1PRTD 1O7YA 4PMCA 1LTAD 3PUZA 1RKNA 4JI6L 3DXJC 3KF6A 2SNMA 3U58A 2BDNA 3NQIA 4A93H 1TY2A 3EQLC 1FNUA 3OHXC 2MO1A 5M5WH 3MTSA 1PYSB 2DY8A 4IUTA 1VQNA 1LT4D 1BCPC 4X3TA 5DM73 5FKAC 3JAML 4OO1G 3HOZB 5C6AA 1NJIC 2QCPX 3J81c 1U5KA 1HQRD 2F0KA 2K5DA 5ELNA 1SSOA 1MBYA 5FJ8H 3PO2B 1STAA 5C3EB 2ZXOA 4IJHA 5GAHC 3M7NA 3K7AH 1B3AA 3I73A 3KLWA 2YU9H 1F9RA 4FVMA 1SNDA 2M2LA 3UE1A 3I4OA 1XMQL 3DUZA 4C3JB 4LFBL 4LF5L 1G2SA 4CGYB 3M4OH 1XJVA 1JE5A 3S16H 2R7ZG 3D4RA 4LW1A 5BN3A 5J1ZA 2Z9HA 2F0HA 3HKSA 3BJUA 3PIPA 2BCOA 3NBIA 5EBDA 3ER0A 1I4RA 5IIFA 1RODA 5LMUQ 4L5RC 3I4LA 2JA7G 3HOXH 1HJPA 2E75C 3MHBA 4FF3A 2Q2HA 3U4ZA 2VB3X 4FXDA 5D14A 5DAUA 2A5HA 1HNXL 1EEID 4QL5A 4JI2L 4JVZA 4ZCKA 3J80E 4A3GB 1SYCA 4LUZA 4RAUC 4B9XA 2AMCB 4A3LH 4RFBA 4IPHA 4PG3A 4IOCA 2PZUA 4B3TQ 3HOUB 3G6EA 1I50B 1Q8KA 2XRSD 1Q86C 1PYBA 1WOCA 2B39A 2AHOB 2N8NA 1MJCA 2KCTA 1D1IA 2PQAA 1PH2A 4PMBA 2JJQA 1ZYRC 3CHBD 3SK5A 5IOCA 1YJNA 1PH3A 4KHPQ 2BE5D 3T13A 3A8KE 4UP9A 2I07B 2RKSA 4KD4A 3S15H 1HNWL 1BF4A 1DXMA 1AE3A 2R92H 4GN3B 1MHWC 1QZGA 3QB3A 4QY7A 3J7AF 2JA7B 2N88A 2E5LQ 3J81L 4MZ9A 1AZPA 5M3MG 3NEMA 1GHJA 4DV7L 2WINB 1CA5A 3P20A 2ZM6L 5KEEA 3T53B 2F03A 3WWVA 1PH1A 3NTIA 4R4QA 1XTDA 4ALPA 3S1MH 3OYYA 2R93H 4LF6Q 2B2TA 3JAMi 2F0DA 1JJCB 4Y52H 4RKLA 1HR0Q 4DR5Q 4JI6Q 1F2LA 1WD1A 2UXBQ 5DM63 4HIDA 3RUZA 4A3KH 5EPJA 2R6GA 2A69D 5HURA 4JI3Q 1H95A 2AUJD 2ICIA 5M5XH 3S2HH 3T51B 3MEHA 4DXFA 2DGYA 3I4NG 1B50A 3ND9A 1C9OA 3F8TA 1PH7A 3KF8B 5IYCH 5BN4A 2IHEA 4YHHQ 1N33L 3MC0B 3F1ZA 1TWFH 3Q24A 5IYBH 1N8RC 1FNWA 4LMQD 1NUCA 2VW9A 1IBKQ 1LUZA 5M3MB 2DY7A 3PUWA 1LTLA 1TXYA 5CV9A 2GVBA 4PQXA 3NQTA 3V2TA 4A76A 3FVQA 1N36L 2XGTA 4XYQA 4AQYL 2KCNA 1B1ZA 2CW0D 4IUPA 1ZXTA 2K5QA 5T1IA 1KABA 2G5DA 5M9OA 4MTKA 1MD2D 2QDBA 1KRTA 1CSPA 2A6HC 1QCBD 5IWAQ 3GTKB 1GD7A 1GUTA 2NN6I 4K2LA 2VUMG 1TVXA 3PO3G 2WB1E 3FHWA 4KMUC 1PV4A 3H0GH 4A3DG 3I4NB 2ZTEA 3HOWB 3TZDA 1QNUA 2FFKB 4BBRH 2Z1CA 3W1GA 5J3BA 1NE3A 2XWBB 5EPLA 4MHEA 4ODGA 1EY8A 3S1QH 1G51A 4CBVA 2YYZA 4B9WA 3K0YA 5GAGC 1SYBA 4JI0Q 1FJGQ 1LV9A 1HTPA 2KVMA 1DD2A 1I5FA 3DEPA 2KCMA 4X64L 1L1OB 5JVH3 5CV8A 3KK7A 3TP6A 3HOYG 1SFOB 3QIAA 3J7AV 5I9OA 1X3PA 4MTNA 1W3SA 4JI5Q 1XPUA 2Z6KA 2JK8A 1VQ5A 2HDMA 1B70B 2RDFA 3I3CA 4P72A 1NAPA 4ZUIA 3NWSA 4BY1H 4WJ3M 2AWNA 2WACA 5ELCA 4LFAL 3PO3B 2VUMB 1YZ6A 2I5LX 1LM0A 2GN5A 3TZUA 4A3DB 3H09A 3UDXA 5D65A 2EZVA 4A3BG 3PUXA 1OXSC 5C0XH 1WCMH 3R8BA 2ZJRA 4CJ1B 3J81j 3EA6A 3K6OA 1EWCA 5LL6X 1KDBA 3N6RA 1CZGA 3H3VI 5C5LA 4HCEA 1B8AA 3KF8A 2BH2A 2ZJQA 2Y0SE 3OWEB 1V1QA 1VQHA 3CQZH 3CCMA 3M4YA 3HOYB 2F0IA 5FOBB 1NCVA 3K5NA 3A55A 2JA8G 2K1BA 1X6OA 4GKKQ 2F0SA 2L0CA 1DGSA 2NVYH 2B2TC 3DEOA 3S1NB 2A68C 4FDBA 1M90C 1SNOA 3U50C 1Q82C 2FXQA 3KJPA 4DV5L 1PFNA 4DV2L 1N33Q 3BZKA 1D8LA 4DAPA 1SR3A 2F0TA 3PIP3 4A3BB 2BA1A 5GAEC 2OTJA 2CQOA 2E8GA 4QCLA 2NN6G 2Z4HA 4Z9CB 4DKAC 4KN7C 4K8JA 3L3OC 4J1MA 4YIJA 1QZHA 4GLAC 3X3NA 2F0GA 3VR3A 1L0XB 5C44G 1R4PB 1UAPA 3VA5A 1I6HH 1YIJA 2KOLA 3C2PA 2HDLA 3ULLA 1T5EA 4WRDA 4OWXB 1TKWB 3BU2A 4LF8Q 3TRZA 1VQ8A 4NXNQ 1U4LA 2JA8B 3NSWA 1EL0A
chains in the Genus database with same CATH topology
1S40A 2VQFL 1K83H 4O2DA 3CPWA 4LFCL 3PF5A 1X56A 1Y1VH 4BXXG 1YI2A 1JMCA 2JA5H 1E1OA 1L1OA 2OTLA 1PH4A 2UU9Q 3CCLA 1UWVA 1X54A 3B6YA 4GOPB 3GTQH 1IBMQ 2LXKA 4A3GG 1WFQA 5GQOA 4UP8A 2EQSA 4DV1L 2HT1A 1YITA 1Y14B 2E2HH 1UE7A 3CMEA 1VQ6A 3I4MG 1Q46A 1N32Q 3GTOH 4TQUS 1FL0A 4QIWE 5DLQE 4B3ML 3W1BA 1QVCA 4POGA 3HOUG 4RMFA 4JCVE 2MQHA 1PA6A 4JI4L 4A3LG 2IY5B 3ICEA 1AH9A 3Q8DA 1HZBA 3HKZE 1S3OA 2NZHA 4H02A 4OO1I 1HNZL 3AFPA 3TEHB 1LYLA 3GTJH 1NTGA 3CCUA 1HNXQ 1EIYB 2CKZB 4JV5Q 1RL2A 4JI2Q 3HOVH 5C44H 2CWPA 5IWAL 4EQ5A 2PNHA 2ALYB 4AIMA 3CCVA 4HIKA 5C4XG 1BKBA 4IFDG 3AQQA 4KHZA 2F52A 4UPAA 2XTIA 1VQLA 2CWAA 3IRBA 1YJWA 3RZOH 4X6AH 1XNRL 1BBWA 2VQEL 4BXXH 2L15A 2JA9A 3J80i 4R4OA 4Y7NH 1NY4A 4YY3Q 2WAQG 1QUQA 1OTCA 2JEAI 4WJ4A 2WP8J 1VQBA 3I2ZA 4UP7A 1BVSA 1HNWQ 3I4MH 2HHHL 2JA6G 1VQEA 4LF7Q 4JI0L 4DNIA 4PMWA 1FJGL 2JE6I 1HH2P 1EUJA 3CD6A 3STBC 1JT8A 3PF4A 1YEZA 2YTYA 3UDFA 4GNXA 1XMOQ 1ASYA 4OXPA 1NMGA 4JOIA 4DV7Q 2D62A 1TWAH 1X3EA 4PZ8A 2ZM6Q 4KI0A 1N34Q 2I0QA 4R1JA 2ATWA 4DV3L 4JI5L 1MKHA 2VY3A 3CW2C 3UDIA 2WAQE 3A74A 4JI1L 4A3KG 2D0PA 1EQQA 4NXMQ 1E3PA 1YHBA 2NVQH 4DR4Q 5C4XH 1YHQA 5LMNQ 4A75A 3ULPA 1XPOA 4YWLA 4LNQA 3D31A 5JJLA 1CKOA 3S2DH 1P16A 5JEAG 4DR6L 1E24A 3DLLA 4A93G 3RLOA 3TS0A 1J5EL 4LF4L 2I5HA 2OWOA 3PV0A 3OTOQ 3T1YQ 5IYDG 1CKMA 1UEBA 1EQRA 2VZAA 1V43A 5IYCG 1OXTA 3I7FA 3H3VH 3M3YH 4J15A 2K5HA 4DPGA 1S72A 3U4VA 3PIOA 1VQPA 4BA1I 2JA6H 4HJ5A 1X55A 1KHIA 2A1AA 1V9PA 2I5MX 4HJAA 2PQAB 4P71A 5IT9c 3MXNB 1VQJA 3L7ZC 2ES2A 2UUBQ 1PH9A 1TWHH 3PO2G 5C3EG 4MNOA 2EXDA 2UUCQ 4DV6Q 1UE6A 1KL9A 1T9HA 4XTCS 1G291 2ID0A 5FJ8G 4AYBG 2UUAL 1XNQQ 1WJJA 4JI7Q 1C0AA 3CAMA 3F2BA 4BY7G 1EFWA 3PUZA 5IP9G 1VQFA 4JI6L 4X65L 3KF6A 1VQGA 2N49A 4DR2Q 1M1KC 4GKKL 3PSIA 3U58A 2RHQB 5IP7G 4DUYQ 4GOPA 2ZTDA 2H5XA 1CSQA 4A93H 5K36G 1N9WA 1N36Q 1VCIA 4AQYQ 4QGUA 3HOWG 5IYDH 2QEXA 2KBNA 4GN4B 2MO1A 2Q2TA 3HOZH 5M5WH 2OQKA 4AYBE 1PYSB 1VQNA 3FKIH 4IJLA 3AFQA 5LMNW 3I56A 3CCQA 2YTXA 4DAMA 4OO1G 4DUZL 4PZ7A 2KHJA 1NJIC 3HOXG 4OONA 3L0OA 4HIMA 1O7IA 5C0XJ 3EBEA 3CP0A 2C35B 3J81c 3KF6B 1E1TA 3PO2H 2UXCL 5C3EH 3E9IA 2AWOA 1U5KA 2BH8A 4JYAQ 4X62Q 5E7NA 5ELNA 5FLXc 5FJ8H 1GO3E 4C3IH 1I94Q 5EAYA 4ME3A 4IJHA 4JI8Q 4XIGS 4C3JH 5GAHC 3M7NA 3K7AH 5IP9H 4B3RL 5AJ3Q 4K0KL 4A3EG 4IOAA 3KLWA 2E2JH 2YU9H 3UE1A 1SRUA 3I4OA 1XMQL 1U0LA 2HIXA 4LF8L 4LFBL 2YTVA 1C7YA 5IP7H 4NXNL 4LF5L 1SLJA 3K81C 3PCOB 4DV0Q 4NPSA 1Q81C 3M4OH 1XJVA 3E9HA 1KD1C 2UXDL 1JE5A 3S16H 1E7ZA 5JJKA 3RN5A 4L5SA 2R7ZG 4X64Q 4P75A 3T1HL 4LW1A 1FGUA 3RZDH 4X66Q 3HKSA 3BJUA 1VQAA 3PIPA 3SGIA 2UU9L 4C3HH 1IBLQ 1IBML 2F4VQ 3ER0A 3TREA 2V1CC 5LMUQ 4L5RC 2JA7G 1L2FA 3HOXH 1XNRQ 2R92G 3F2CA 3PGZA 1HJPA 1N32L 3RR5A 4A3IG 4GKJQ 3CCJA 4B3SQ 3JAMc 1R9TH 2Q2HA 3U4ZA 3RNUA 4A3GH 1GKHA 1SROA 4LFAQ 2NVXH 1I3QH 4A4IA 4O0AA 3S24A 4DR1Q 1HNXL 1Q1BA 1PHJA 4QL5A 1SFOH 4JV5L 2KENA 4A3MG 4JI2L 2Z6KC 1Q1EA 2QGQA 4LUZA 1EIFA 2LSSA 3HOUH 3J81i 2AMCB 4A3LH 1I50H 4IO9A 4IPHA 1MIUA 4PG3A 4IOCA 2Z0SA 2R93G 4B3TQ 5GADC 3DM3A 1HZAA 3G6EA 2N3SA 1KAWA 1Q8KA 4GLVB 1Q86C 1UE5A 1PYBA 2K5VA 1OXXK 1WOCA 2AHOB 2N8NA 1MJCA 2KCTA 2PQAA 3KOJA 1PH2A 2JJQA 1YJNA 5C0XI 4DR7L 5BR8L 1YJ9A 1PH3A 4KHPQ 2EIFA 4YY3L 3KDFB 4GNXC 4UP9A 2DUDA 3GTLH 3S15H 1JJGA 2MO0A 1Q12A 2JA7H 1HNWL 4LF4Q 1AE3A 3K8AA 2R92H 2AKWB 4LF7L 4GN3B 3K0XA 1WYDA 1QZGA 4A3IH 1NMFA 3G4SA 4QY7A 2RF4A 2E5LQ 4MZ9A 5M3MG 3NEMA 1XMOL 3CF5A 2K5NA 4DV7L 4LUOA 5IYBG 2ZM6L 3KJOA 1N34L 2VL6A 2OQ0A 4A3MH 2IT1A 4YCUA 1D7QA 1VQMA 1Y1WG 2N78A 1IYJB 4TVAB 3G48A 3WWVA 4DV5Q 4A3FG 1PH1A 4DR4L 4LUVA 4DV2Q 2PI2E 1XTDA 2K50A 4R4QA 5ELOA 3G71A 5LMNL 3A5ZB 4ALPA 4OX9Q 3S1MH 3OYYA 1CUKA 4LF6Q 2R93H 1VQKA 2A8VA 3JAMi 1CKNB 1JJCB 4L5QA 3EN2A 4Y52H 3CC4A 1HR0Q 4LF9Q 4DR5Q 1A62A 3K7UC 4DV4Q 2MFIA 5M3FG 4JI6Q 4BBSG 3T1YL 2UXBQ 2Q2UA 1SMXA 4HIDA 3J7ZC 4A3KH 2K52A 3H15A 2JEBI 2RCNA 2R6GA 3FP9A 3LGJA 4DK6C 4QQBX 4JI3Q 1H95A 4OWWB 5M5XH 3S2HH 1EOVA 1TWGH 2GVAA 3GDEA 3CXCA 4KLKA 2DGYA 2HQLA 3I4NG 3TQYA 5M5YH 1HZCA 1Y1VG 1OXUA 1C9OA 3F8TA 4DR3Q 2VNUD 1PH7A 2RHSB 3KF8B 1J6QA 3H0GG 5IYCH 2IHEA 5M3MH 4YHHQ 2UUCL 1N33L 4DV6L 2E2IH 2ZJPA 4HIOA 1VQIA 1IZ6A 3F1ZA 1TWFH 5IYBH 1N8RC 1XNQL 2VW9A 3CPFA 4BBRG 1PH5A 1LUZA 2IX0A 1MJEA 1KQSA 1IBKQ 3E0EA 4JI7L 1Y1WH 2VQFQ 3UDGA 4LFCQ 2LXJA 3PUWA 4A3FH 1LTLA 3VDYA 3L2PA 2B63G 1YNXA 1TXYA 4DR2L 2GVBA 3A5UA 1PH6A 1VQDA 2K75A 4DV1Q 3ERSX 3NELA 4DUYL 2WB1G 1B7YB 4K0KQ 4A76A 1N36L 2XGTA 4AQYL 5M3FH 4IFDJ 4BBSH 1IL2A 4B3MQ 4BY7H 2KHIA 5H1SE 4JI4Q 1FVIA 1PFSA 3F2DA 3CC2A 3GTKH 4BA2I 1HNZQ 1L1OC 2UXDQ 4JBKA 5JJIA 3HKZG 3M4QA 1KRTA 2OCEA 1PVOA 3I4NH 1CSPA 5IWAQ 3T1HQ 4JBMA 3HOWH 1HR0W 1GD7A 2NN6I 1L0WA 1SN8A 3M4PA 4BY1G 5FLMG 2K4KA 2NVTH 2WB1E 3FHWA 1PV4A 1QVFA 3H0GH 4IPCA 4A3DG 3K80C 4JYAL 2ZTEA 3OW2A 4X62L 3CCSA 4EX5A 4BBRH 1I94L 2VUMG 3PO3G 3PUYA 3W1GA 5J3BA 1K0RA 4JI8L 3S14H 4AH6A 3CC7A 1NE3A 5AJ3L 2VQEQ 2B63H 1E22A 3J7A5 3S1QH 1G51A 2CFMA 4POFA 5C0XG 1WCMG 2YYZA 5GAGC 4IPGA 3D0FA 3KDFA 2HHHQ 4DV0L 3AYHB 4JI0Q 4P74A 1Z9FA 1FJGQ 5IY0A 1I5FA 3GD7A 4LWCA 2KCMA 1IXRA 3KYHC 4X64L 4A3EH 2NZOA 2ASBA 1L1OB 5JEAJ 4DAYB 4A3CG 4X66L 3ZJYC 3HOYG 1BBUA 3I55A 1IBLL 2ZTCA 4MTNA 2F4VL 4NB3A 1VQ4A 1AE2A 4DV3Q 1W3SA 1PH8A 5LMUL 2Z6KA 4JI5Q 1XPUA 3AEVA 2JK8A 1VQ5A 5C4JH 1B70B 4JG2A 4JI1Q 4P72A 2R7ZH 1VS0A 1WI5A 2D0OA 4GS3A 5FLMH 1X3FA 3NBHB 5BR8Q 4JBJA 3RN2A 4BY1H 2VUMH 3PO3H 4DR7Q 4A3DH 4WJ3M 4R4CA 4GKJL 1A63A 2AWNA 4B3SL 4R4IA 4DR6Q 2IX1A 4LFAL 3GTPH 1W2BA 4JOIC 1YZ6A 2B3GA 1CKNA 1LM0A 2BA0A 2GN5A 2I5LX 4OWTB 4DR1L 1J5EQ 2YV5A 3UDXA 4HJ8A 2QA4A 2MNAA 2Y0SG 1XPRA 3W5OA 1A8VA 4A3BG 4IFDI 3PUXA 1OXSC 1P8LA 1Z47A 1K8AC 1WCMH 1JJ2A 2ZJRA 2CCZA 4B3TL 1G6PA 3HFZB 1UE1A 3J81j 1ASZA 3PUVA 1GVPA 3ULJA 3EIVA 4A3JG 1KC8C 1NBWA 2JQOA 2A19A 2WFWA 4A3CH 1KRSA 1YBYA 1JB7A 4NXML 3H3VI 4DK3C 4YWKA 3CMAA 4KHPL 2PI2A 1QUQB 1B8AA 3CCEA 3HOYH 4RG1A 2R7DA 2BH2A 2ZJQA 2UUAQ 4GLXA 2Y0SE 5HY6A 4JBWA 3TS2A 1V1QA 1VQHA 3CQZH 3M9BA 3CCMA 4R4TA 1K73C 4IPDA 2VS1A 4X65Q 3OTOL 1Q7YC 2JA8G 3HOZG 1X9NA 3S1NH 4GNXB 1X6OA 4L5TA 1K9MC 4GKKQ 2F3IA 3STBD 1DGSA 3FKIG 2E5LL 1X65A 2NVYH 1K3RA 2HIVA 1KIXA 4QJFA 1RIPA 4FDBA 3GTGH 1VQCA 1M90C 4PZ6A 3U50C 4YCWA 3S1RH 1VQOA 3KFUA 1Q82C 1TWCH 2FXQA 3KJPA 4DV5L 4A3BH 2UUBL 4DV2L 5GROA 3BZKA 1N33Q 3GO5A 2JA5G 4OX9L 1VQ7A 1D8LA 3RLNA 1GM5A 4LF6L 1SR3A 3M85A 4GN5A 3UE0A 4DUZQ 3MEFA 2BA1A 4GOPC 1KXLA 5GAEC 4A3JH 1HR0L 4LF9L 4DR5L 2CQOA 1OXVA 4DV4L 4UY8C 1YVCA 2OTJA 1EWIA 1X3GA 2E8GA 2UXBL 2UXCQ 3JC66 1HZ9A 2NN6G 4DKAC 4C2MH 5IE8A 2B29A 4JI3L 4YWMA 4HJ7A 4GLAC 1QZHA 4HJ9A 1EYGA 3NENA 4P73A 2PMZE 1VQ9A 4B3RQ 3HOVG 3RLFA 5C44G 1K8GA 1I6HH 1YHAA 4YCVA 1YIJA 1QVGA 1A0IA 2K14A 3J80c 2JA8H 3S17H 2R7FA 3ULLA 4DR3L 1XMQQ 4OWXB 5HGQA 3BU2A 3CCRA 4LF8Q 4LFBQ 4YHHL 4JC0A 1VQ8A 4APVA 2Q2IA 4NXNQ 3TRZA 4LF5Q 1SE8A 3BZCA 2IHFA 1IBKL 3A0JA 3GTMH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S40 A;  2VQF L;  1K83 H;  4O2D A;  3CPW A;  4LFC L;  3PF5 A;  1X56 A;  1Y1V H;  4BXX G;  1YI2 A;  1JMC A;  2JA5 H;  1E1O A;  1L1O A;  2OTL A;  1PH4 A;  2UU9 Q;  3CCL A;  1UWV A;  1X54 A;  3B6Y A;  4GOP B;  3GTQ H;  1IBM Q;  2LXK A;  4A3G G;  1WFQ A;  5GQO A;  4UP8 A;  2EQS A;  4DV1 L;  2HT1 A;  1YIT A;  1Y14 B;  2E2H H;  1UE7 A;  3CME A;  1VQ6 A;  3I4M G;  1Q46 A;  1N32 Q;  3GTO H;  4TQU S;  1FL0 A;  4QIW E;  5DLQ E;  4B3M L;  3W1B A;  1QVC A;  4POG A;  3HOU G;  4RMF A;  4JCV E;  2MQH A;  1PA6 A;  4JI4 L;  4A3L G;  2IY5 B;  3ICE A;  1AH9 A;  3Q8D A;  1HZB A;  3HKZ E;  1S3O A;  2NZH A;  4H02 A;  4OO1 I;  1HNZ L;  3AFP A;  3TEH B;  1LYL A;  3GTJ H;  1NTG A;  3CCU A;  1HNX Q;  1EIY B;  2CKZ B;  4JV5 Q;  1RL2 A;  4JI2 Q;  3HOV H;  5C44 H;  2CWP A;  5IWA L;  4EQ5 A;  2PNH A;  2ALY B;  4AIM A;  3CCV A;  4HIK A;  5C4X G;  1BKB A;  4IFD G;  3AQQ A;  4KHZ A;  2F52 A;  4UPA A;  2XTI A;  1VQL A;  2CWA A;  3IRB A;  1YJW A;  3RZO H;  4X6A H;  1XNR L;  1BBW A;  2VQE L;  4BXX H;  2L15 A;  2JA9 A;  3J80 i;  4R4O A;  4Y7N H;  1NY4 A;  4YY3 Q;  2WAQ G;  1QUQ A;  1OTC A;  2JEA I;  4WJ4 A;  2WP8 J;  1VQB A;  3I2Z A;  4UP7 A;  1BVS A;  1HNW Q;  3I4M H;  2HHH L;  2JA6 G;  1VQE A;  4LF7 Q;  4JI0 L;  4DNI A;  4PMW A;  1FJG L;  2JE6 I;  1HH2 P;  1EUJ A;  3CD6 A;  3STB C;  1JT8 A;  3PF4 A;  1YEZ A;  2YTY A;  3UDF A;  4GNX A;  1XMO Q;  1ASY A;  4OXP A;  1NMG A;  4JOI A;  4DV7 Q;  2D62 A;  1TWA H;  1X3E A;  4PZ8 A;  2ZM6 Q;  4KI0 A;  1N34 Q;  2I0Q A;  4R1J A;  2ATW A;  4DV3 L;  4JI5 L;  1MKH A;  2VY3 A;  3CW2 C;  3UDI A;  2WAQ E;  3A74 A;  4JI1 L;  4A3K G;  2D0P A;  1EQQ A;  4NXM Q;  1E3P A;  1YHB A;  2NVQ H;  4DR4 Q;  5C4X H;  1YHQ A;  5LMN Q;  4A75 A;  3ULP A;  1XPO A;  4YWL A;  4LNQ A;  3D31 A;  5JJL A;  1CKO A;  3S2D H;  1P16 A;  5JEA G;  4DR6 L;  1E24 A;  3DLL A;  4A93 G;  3RLO A;  3TS0 A;  1J5E L;  4LF4 L;  2I5H A;  2OWO A;  3PV0 A;  3OTO Q;  3T1Y Q;  5IYD G;  1CKM A;  1UEB A;  1EQR A;  2VZA A;  1V43 A;  5IYC G;  1OXT A;  3I7F A;  3H3V H;  3M3Y H;  4J15 A;  2K5H A;  4DPG A;  1S72 A;  3U4V A;  3PIO A;  1VQP A;  4BA1 I;  2JA6 H;  4HJ5 A;  1X55 A;  1KHI A;  2A1A A;  1V9P A;  2I5M X;  4HJA A;  2PQA B;  4P71 A;  5IT9 c;  3MXN B;  1VQJ A;  3L7Z C;  2ES2 A;  2UUB Q;  1PH9 A;  1TWH H;  3PO2 G;  5C3E G;  4MNO A;  2EXD A;  2UUC Q;  4DV6 Q;  1UE6 A;  1KL9 A;  1T9H A;  4XTC S;  1G29 1;  2ID0 A;  5FJ8 G;  4AYB G;  2UUA L;  1XNQ Q;  1WJJ A;  4JI7 Q;  1C0A A;  3CAM A;  3F2B A;  4BY7 G;  1EFW A;  3PUZ A;  5IP9 G;  1VQF A;  4JI6 L;  4X65 L;  3KF6 A;  1VQG A;  2N49 A;  4DR2 Q;  1M1K C;  4GKK L;  3PSI A;  3U58 A;  2RHQ B;  5IP7 G;  4DUY Q;  4GOP A;  2ZTD A;  2H5X A;  1CSQ A;  4A93 H;  5K36 G;  1N9W A;  1N36 Q;  1VCI A;  4AQY Q;  4QGU A;  3HOW G;  5IYD H;  2QEX A;  2KBN A;  4GN4 B;  2MO1 A;  2Q2T A;  3HOZ H;  5M5W H;  2OQK A;  4AYB E;  1PYS B;  1VQN A;  3FKI H;  4IJL A;  3AFQ A;  5LMN W;  3I56 A;  3CCQ A;  2YTX A;  4DAM A;  4OO1 G;  4DUZ L;  4PZ7 A;  2KHJ A;  1NJI C;  3HOX G;  4OON A;  3L0O A;  4HIM A;  1O7I A;  5C0X J;  3EBE A;  3CP0 A;  2C35 B;  3J81 c;  3KF6 B;  1E1T A;  3PO2 H;  2UXC L;  5C3E H;  3E9I A;  2AWO A;  1U5K A;  2BH8 A;  4JYA Q;  4X62 Q;  5E7N A;  5ELN A;  5FLX c;  5FJ8 H;  1GO3 E;  4C3I H;  1I94 Q;  5EAY A;  4ME3 A;  4IJH A;  4JI8 Q;  4XIG S;  4C3J H;  5GAH C;  3M7N A;  3K7A H;  5IP9 H;  4B3R L;  5AJ3 Q;  4K0K L;  4A3E G;  4IOA A;  3KLW A;  2E2J H;  2YU9 H;  3UE1 A;  1SRU A;  3I4O A;  1XMQ L;  1U0L A;  2HIX A;  4LF8 L;  4LFB L;  2YTV A;  1C7Y A;  5IP7 H;  4NXN L;  4LF5 L;  1SLJ A;  3K81 C;  3PCO B;  4DV0 Q;  4NPS A;  1Q81 C;  3M4O H;  1XJV A;  3E9H A;  1KD1 C;  2UXD L;  1JE5 A;  3S16 H;  1E7Z A;  5JJK A;  3RN5 A;  4L5S A;  2R7Z G;  4X64 Q;  4P75 A;  3T1H L;  4LW1 A;  1FGU A;  3RZD H;  4X66 Q;  3HKS A;  3BJU A;  1VQA A;  3PIP A;  3SGI A;  2UU9 L;  4C3H H;  1IBL Q;  1IBM L;  2F4V Q;  3ER0 A;  3TRE A;  2V1C C;  5LMU Q;  4L5R C;  2JA7 G;  1L2F A;  3HOX H;  1XNR Q;  2R92 G;  3F2C A;  3PGZ A;  1HJP A;  1N32 L;  3RR5 A;  4A3I G;  4GKJ Q;  3CCJ A;  4B3S Q;  3JAM c;  1R9T H;  2Q2H A;  3U4Z A;  3RNU A;  4A3G H;  1GKH A;  1SRO A;  4LFA Q;  2NVX H;  1I3Q H;  4A4I A;  4O0A A;  3S24 A;  4DR1 Q;  1HNX L;  1Q1B A;  1PHJ A;  4QL5 A;  1SFO H;  4JV5 L;  2KEN A;  4A3M G;  4JI2 L;  2Z6K C;  1Q1E A;  2QGQ A;  4LUZ A;  1EIF A;  2LSS A;  3HOU H;  3J81 i;  2AMC B;  4A3L H;  1I50 H;  4IO9 A;  4IPH A;  1MIU A;  4PG3 A;  4IOC A;  2Z0S A;  2R93 G;  4B3T Q;  5GAD C;  3DM3 A;  1HZA A;  3G6E A;  2N3S A;  1KAW A;  1Q8K A;  4GLV B;  1Q86 C;  1UE5 A;  1PYB A;  2K5V A;  1OXX K;  1WOC A;  2AHO B;  2N8N A;  1MJC A;  2KCT A;  2PQA A;  3KOJ A;  1PH2 A;  2JJQ A;  1YJN A;  5C0X I;  4DR7 L;  5BR8 L;  1YJ9 A;  1PH3 A;  4KHP Q;  2EIF A;  4YY3 L;  3KDF B;  4GNX C;  4UP9 A;  2DUD A;  3GTL H;  3S15 H;  1JJG A;  2MO0 A;  1Q12 A;  2JA7 H;  1HNW L;  4LF4 Q;  1AE3 A;  3K8A A;  2R92 H;  2AKW B;  4LF7 L;  4GN3 B;  3K0X A;  1WYD A;  1QZG A;  4A3I H;  1NMF A;  3G4S A;  4QY7 A;  2RF4 A;  2E5L Q;  4MZ9 A;  5M3M G;  3NEM A;  1XMO L;  3CF5 A;  2K5N A;  4DV7 L;  4LUO A;  5IYB G;  2ZM6 L;  3KJO A;  1N34 L;  2VL6 A;  2OQ0 A;  4A3M H;  2IT1 A;  4YCU A;  1D7Q A;  1VQM A;  1Y1W G;  2N78 A;  1IYJ B;  4TVA B;  3G48 A;  3WWV A;  4DV5 Q;  4A3F G;  1PH1 A;  4DR4 L;  4LUV A;  4DV2 Q;  2PI2 E;  1XTD A;  2K50 A;  4R4Q A;  5ELO A;  3G71 A;  5LMN L;  3A5Z B;  4ALP A;  4OX9 Q;  3S1M H;  3OYY A;  1CUK A;  4LF6 Q;  2R93 H;  1VQK A;  2A8V A;  3JAM i;  1CKN B;  1JJC B;  4L5Q A;  3EN2 A;  4Y52 H;  3CC4 A;  1HR0 Q;  4LF9 Q;  4DR5 Q;  1A62 A;  3K7U C;  4DV4 Q;  2MFI A;  5M3F G;  4JI6 Q;  4BBS G;  3T1Y L;  2UXB Q;  2Q2U A;  1SMX A;  4HID A;  3J7Z C;  4A3K H;  2K52 A;  3H15 A;  2JEB I;  2RCN A;  2R6G A;  3FP9 A;  3LGJ A;  4DK6 C;  4QQB X;  4JI3 Q;  1H95 A;  4OWW B;  5M5X H;  3S2H H;  1EOV A;  1TWG H;  2GVA A;  3GDE A;  3CXC A;  4KLK A;  2DGY A;  2HQL A;  3I4N G;  3TQY A;  5M5Y H;  1HZC A;  1Y1V G;  1OXU A;  1C9O A;  3F8T A;  4DR3 Q;  2VNU D;  1PH7 A;  2RHS B;  3KF8 B;  1J6Q A;  3H0G G;  5IYC H;  2IHE A;  5M3M H;  4YHH Q;  2UUC L;  1N33 L;  4DV6 L;  2E2I H;  2ZJP A;  4HIO A;  1VQI A;  1IZ6 A;  3F1Z A;  1TWF H;  5IYB H;  1N8R C;  1XNQ L;  2VW9 A;  3CPF A;  4BBR G;  1PH5 A;  1LUZ A;  2IX0 A;  1MJE A;  1KQS A;  1IBK Q;  3E0E A;  4JI7 L;  1Y1W H;  2VQF Q;  3UDG A;  4LFC Q;  2LXJ A;  3PUW A;  4A3F H;  1LTL A;  3VDY A;  3L2P A;  2B63 G;  1YNX A;  1TXY A;  4DR2 L;  2GVB A;  3A5U A;  1PH6 A;  1VQD A;  2K75 A;  4DV1 Q;  3ERS X;  3NEL A;  4DUY L;  2WB1 G;  1B7Y B;  4K0K Q;  4A76 A;  1N36 L;  2XGT A;  4AQY L;  5M3F H;  4IFD J;  4BBS H;  1IL2 A;  4B3M Q;  4BY7 H;  2KHI A;  5H1S E;  4JI4 Q;  1FVI A;  1PFS A;  3F2D A;  3CC2 A;  3GTK H;  4BA2 I;  1HNZ Q;  1L1O C;  2UXD Q;  4JBK A;  5JJI A;  3HKZ G;  3M4Q A;  1KRT A;  2OCE A;  1PVO A;  3I4N H;  1CSP A;  5IWA Q;  3T1H Q;  4JBM A;  3HOW H;  1HR0 W;  1GD7 A;  2NN6 I;  1L0W A;  1SN8 A;  3M4P A;  4BY1 G;  5FLM G;  2K4K A;  2NVT H;  2WB1 E;  3FHW A;  1PV4 A;  1QVF A;  3H0G H;  4IPC A;  4A3D G;  3K80 C;  4JYA L;  2ZTE A;  3OW2 A;  4X62 L;  3CCS A;  4EX5 A;  4BBR H;  1I94 L;  2VUM G;  3PO3 G;  3PUY A;  3W1G A;  5J3B A;  1K0R A;  4JI8 L;  3S14 H;  4AH6 A;  3CC7 A;  1NE3 A;  5AJ3 L;  2VQE Q;  2B63 H;  1E22 A;  3J7A 5;  3S1Q H;  1G51 A;  2CFM A;  4POF A;  5C0X G;  1WCM G;  2YYZ A;  5GAG C;  4IPG A;  3D0F A;  3KDF A;  2HHH Q;  4DV0 L;  3AYH B;  4JI0 Q;  4P74 A;  1Z9F A;  1FJG Q;  5IY0 A;  1I5F A;  3GD7 A;  4LWC A;  2KCM A;  1IXR A;  3KYH C;  4X64 L;  4A3E H;  2NZO A;  2ASB A;  1L1O B;  5JEA J;  4DAY B;  4A3C G;  4X66 L;  3ZJY C;  3HOY G;  1BBU A;  3I55 A;  1IBL L;  2ZTC A;  4MTN A;  2F4V L;  4NB3 A;  1VQ4 A;  1AE2 A;  4DV3 Q;  1W3S A;  1PH8 A;  5LMU L;  2Z6K A;  4JI5 Q;  1XPU A;  3AEV A;  2JK8 A;  1VQ5 A;  5C4J H;  1B70 B;  4JG2 A;  4JI1 Q;  4P72 A;  2R7Z H;  1VS0 A;  1WI5 A;  2D0O A;  4GS3 A;  5FLM H;  1X3F A;  3NBH B;  5BR8 Q;  4JBJ A;  3RN2 A;  4BY1 H;  2VUM H;  3PO3 H;  4DR7 Q;  4A3D H;  4WJ3 M;  4R4C A;  4GKJ L;  1A63 A;  2AWN A;  4B3S L;  4R4I A;  4DR6 Q;  2IX1 A;  4LFA L;  3GTP H;  1W2B A;  4JOI C;  1YZ6 A;  2B3G A;  1CKN A;  1LM0 A;  2BA0 A;  2GN5 A;  2I5L X;  4OWT B;  4DR1 L;  1J5E Q;  2YV5 A;  3UDX A;  4HJ8 A;  2QA4 A;  2MNA A;  2Y0S G;  1XPR A;  3W5O A;  1A8V A;  4A3B G;  4IFD I;  3PUX A;  1OXS C;  1P8L A;  1Z47 A;  1K8A C;  1WCM H;  1JJ2 A;  2ZJR A;  2CCZ A;  4B3T L;  1G6P A;  3HFZ B;  1UE1 A;  3J81 j;  1ASZ A;  3PUV A;  1GVP A;  3ULJ A;  3EIV A;  4A3J G;  1KC8 C;  1NBW A;  2JQO A;  2A19 A;  2WFW A;  4A3C H;  1KRS A;  1YBY A;  1JB7 A;  4NXM L;  3H3V I;  4DK3 C;  4YWK A;  3CMA A;  4KHP L;  2PI2 A;  1QUQ B;  1B8A A;  3CCE A;  3HOY H;  4RG1 A;  2R7D A;  2BH2 A;  2ZJQ A;  2UUA Q;  4GLX A;  2Y0S E;  5HY6 A;  4JBW A;  3TS2 A;  1V1Q A;  1VQH A;  3CQZ H;  3M9B A;  3CCM A;  4R4T A;  1K73 C;  4IPD A;  2VS1 A;  4X65 Q;  3OTO L;  1Q7Y C;  2JA8 G;  3HOZ G;  1X9N A;  3S1N H;  4GNX B;  1X6O A;  4L5T A;  1K9M C;  4GKK Q;  2F3I A;  3STB D;  1DGS A;  3FKI G;  2E5L L;  1X65 A;  2NVY H;  1K3R A;  2HIV A;  1KIX A;  4QJF A;  1RIP A;  4FDB A;  3GTG H;  1VQC A;  1M90 C;  4PZ6 A;  3U50 C;  4YCW A;  3S1R H;  1VQO A;  3KFU A;  1Q82 C;  1TWC H;  2FXQ A;  3KJP A;  4DV5 L;  4A3B H;  2UUB L;  4DV2 L;  5GRO A;  3BZK A;  1N33 Q;  3GO5 A;  2JA5 G;  4OX9 L;  1VQ7 A;  1D8L A;  3RLN A;  1GM5 A;  4LF6 L;  1SR3 A;  3M85 A;  4GN5 A;  3UE0 A;  4DUZ Q;  3MEF A;  2BA1 A;  4GOP C;  1KXL A;  5GAE C;  4A3J H;  1HR0 L;  4LF9 L;  4DR5 L;  2CQO A;  1OXV A;  4DV4 L;  4UY8 C;  1YVC A;  2OTJ A;  1EWI A;  1X3G A;  2E8G A;  2UXB L;  2UXC Q;  3JC6 6;  1HZ9 A;  2NN6 G;  4DKA C;  4C2M H;  5IE8 A;  2B29 A;  4JI3 L;  4YWM A;  4HJ7 A;  4GLA C;  1QZH A;  4HJ9 A;  1EYG A;  3NEN A;  4P73 A;  2PMZ E;  1VQ9 A;  4B3R Q;  3HOV G;  3RLF A;  5C44 G;  1K8G A;  1I6H H;  1YHA A;  4YCV A;  1YIJ A;  1QVG A;  1A0I A;  2K14 A;  3J80 c;  2JA8 H;  3S17 H;  2R7F A;  3ULL A;  4DR3 L;  1XMQ Q;  4OWX B;  5HGQ A;  3BU2 A;  3CCR A;  4LF8 Q;  4LFB Q;  4YHH L;  4JC0 A;  1VQ8 A;  4APV A;  2Q2I A;  4NXN Q;  3TRZ A;  4LF5 Q;  1SE8 A;  3BZC A;  2IHF A;  1IBK L;  3A0J A;  3GTM H; 
#chains in the Genus database with same CATH topology
 3CPW A;  4EQP A;  4LFC L;  1B3Q A;  5ELB A;  4BXX G;  4S3S A;  2F0L A;  1JMC A;  1LTR D;  2JA5 H;  1L1O A;  5J39 A;  2OTL A;  2UU9 Q;  3B6Y A;  4GOP B;  2LXK A;  1WFQ A;  4KD3 A;  4DV1 L;  2EQS A;  1Y1V B;  1Y14 B;  3E6Z X;  1UE7 A;  5E4W C;  1SE2 A;  2E2H H;  5A2Q L;  4TQU S;  1FL0 A;  4B3M L;  2E74 C;  4FXK C;  4A3L G;  2MQH A;  2IY5 B;  3E5S A;  5D3I B;  1SYF A;  2RDH A;  4IUN A;  2NZH A;  4H02 A;  4F87 A;  1LYL A;  1BCP D;  1STE A;  1NR4 A;  4DAV A;  4O1N A;  3HOV H;  2CWP A;  1O7Z A;  4AIM A;  1G2T A;  1DOK A;  4KKU A;  4HIK A;  5C4X G;  1JOO A;  1SDF A;  5C44 B;  4UPA A;  5KGU A;  3K5M A;  3FRP B;  3BVZ A;  1ESR A;  4QIW B;  1SYG A;  4QF4 A;  2L15 A;  2JA9 A;  2NYZ D;  1D5X C;  2SOB A;  4Y7N H;  3G6J B;  4KKT A;  5KND A;  2WP8 J;  2JA6 G;  2O4X A;  4J6H A;  2Z8L A;  3H6M A;  3STB C;  1JT8 A;  3PF4 A;  4LAA A;  2HCC A;  3UDF A;  2HUG A;  1ASY A;  4JOI A;  2D62 A;  1DCZ A;  2XSC A;  4KI0 A;  4R1J A;  4DV3 L;  1HFN A;  2B2Y C;  4KK7 A;  2RQX A;  4JI1 L;  3A74 A;  5ELD A;  4A3K G;  2D0P A;  3A56 A;  2NVQ H;  1TWA B;  1CI3 M;  2EYJ A;  3ULP A;  1QNK A;  2EYO A;  3D31 A;  1JOK A;  3S2D H;  4QUF A;  3DLL A;  5E4X A;  5C4X B;  4LF4 L;  5IYD G;  2VZA A;  5IYC G;  4RGO S;  5DEH A;  4J15 A;  4DPG A;  3PIO A;  4EVO A;  1VQP A;  4FF4 A;  5CV7 A;  1C48 A;  2NBF A;  3M3Y B;  3L7Z C;  2ES2 A;  1PH9 A;  2JA6 B;  2K7V A;  4MNO A;  2EXD A;  1HA5 A;  1IKM A;  1J8I A;  1T9H A;  2UUA L;  4AYB G;  3TBI B;  4C3I G;  4JI7 Q;  1TT2 A;  5IP9 G;  2K6A A;  1DZ1 A;  1VQG A;  4DR2 Q;  3IKJ A;  1KLG D;  2RHQ B;  5IP7 G;  4GOP A;  2EVB A;  3MFY A;  2H5X A;  1CSQ A;  4QGU A;  4FO2 A;  5C4H A;  3L9A X;  2Q2T A;  2IWH A;  2Z4I A;  1TR5 A;  3FKI H;  4C3H G;  1E2Z A;  3L0O A;  4OON A;  2PYK A;  4BS9 A;  2XNA C;  3CP0 A;  1B9M A;  3KF6 B;  3K5L A;  3NP8 A;  3E9I A;  2DNC A;  2NUC A;  4JYA Q;  3TP5 A;  5E7N A;  2XN9 C;  5FLX c;  2B2W A;  1GO3 E;  4I65 A;  3Q0A A;  1PTO B;  4JI8 Q;  4XIG S;  3NXW A;  2B2U A;  5AJ3 Q;  3WOE A;  3VYU A;  4CDE C;  4AYB B;  4C3I B;  4MN3 A;  2HIX A;  2YTV A;  1C7Y A;  3K81 C;  2E2J B;  5K36 H;  1MI2 A;  1KD1 C;  2WII B;  4P75 A;  3A7L A;  1FGU A;  4RCO A;  3RZD H;  3BZD B;  1LTT D;  2M00 A;  2O2L D;  2KJX A;  1ICW A;  3F2C A;  3EJI A;  3PGZ A;  1N32 L;  4C3H B;  5JJZ A;  1EEF D;  2PCF B;  1OO9 B;  3JAM c;  1R9T H;  2F0F A;  3BVG A;  3NTK A;  3EFX D;  4O0A A;  4DR1 Q;  1PHJ A;  1SFO H;  4IAL A;  4JV5 L;  3ERO A;  2QGQ A;  1EIF A;  2OF1 A;  2NVX B;  1I3Q B;  1VMP A;  1A2T A;  5GAD C;  1KAW A;  4CKE A;  2F0Q A;  2K5V A;  1OXX K;  3KOJ A;  5CMD A;  4DR7 L;  1YJ9 A;  2EIF A;  4YY3 L;  3BS1 A;  1LAB A;  2MO0 A;  1Q12 A;  4LF4 Q;  2AKW B;  3NE5 B;  1EYD A;  4A3I H;  3GTL B;  2H1E A;  1Q90 A;  5AFW A;  3VYR A;  3BG3 A;  1XMO L;  1PZJ D;  3CF5 A;  1C4Q A;  5C4Z A;  2OQ0 A;  5FLX L;  2IT1 A;  2LKV A;  4YCU A;  4A3M H;  2IX3 A;  2N78 A;  3VR4 A;  4TVA B;  4A3F G;  4DR4 L;  2JSO A;  2PI2 E;  2K50 A;  5ELO A;  4OX9 Q;  1EY4 A;  1CKN B;  4L5Q A;  3QWN A;  4LF9 Q;  3K7U C;  2MFI A;  3V05 A;  1LLR D;  1V1O A;  1JWS D;  1R4Q B;  3J7Z C;  1KDC A;  3H15 A;  2RCN A;  1LTS D;  1BBX C;  3D4D A;  4CDC C;  1KLU D;  1TWG H;  2GVA A;  3CXC A;  2XIW A;  1I4X A;  3U9O A;  2HQL A;  3TQY A;  5M5Y H;  1ZEQ X;  1HZC A;  1K3B C;  2VNU D;  4R8N A;  4ME5 A;  2IX1 A;  3R3O A;  4DV6 L;  3FDT A;  2ZJP A;  4HIO A;  1VQI A;  2KCC A;  3TME A;  2HD3 A;  4G7O C;  1PH5 A;  3E0E A;  1Y1W H;  2VQF Q;  5EQ0 A;  2E2I B;  1D5M C;  1YNX A;  2MJ8 A;  1H9M A;  2IW3 A;  4WFN 3;  4N8F A;  3I70 A;  3ERS X;  3NEL A;  4DUY L;  4A3F B;  4NMZ A;  5M3F H;  3A8I E;  2A68 D;  4XT1 B;  4BBS H;  4BY7 H;  4IFD J;  2KHI A;  4R9W A;  1FVI A;  3CC2 A;  2JYO A;  4JBK A;  3HS0 C;  2B2W C;  2OCE A;  3WOF A;  2IJ0 A;  3VR5 A;  5IT9 E;  2BOS A;  3OSO A;  4JBM A;  5COY A;  2NVT H;  2K4K A;  1QVF A;  4IPC A;  1JB3 A;  4KKS A;  4C1N I;  3OW2 A;  4X62 L;  4EX5 A;  1U9R A;  1I94 L;  4OL7 A;  1DYQ A;  1WD0 A;  3CC7 A;  2VQE Q;  2B63 H;  3E3X A;  4FF1 A;  1PFB A;  1G91 A;  3S14 B;  3PIO 3;  4DV0 L;  2K05 A;  1U4R A;  4KHV A;  1JWM D;  4NW2 A;  3GD7 A;  5KYI A;  3KYH C;  1IXR A;  2Q8R E;  2B2V A;  2NZO A;  4A3E H;  1M4V A;  2PW5 A;  2ASB A;  4X66 L;  2QF7 A;  1EWH A;  2EJF C;  1IBL L;  2F4V L;  2NWG A;  4CKC A;  4OGQ C;  2F4I A;  3J81 E;  1VS0 A;  1HFG A;  5FLM H;  4DR7 Q;  2MHV A;  4JBJ A;  1V8Q A;  1S5C D;  3NWT A;  2A73 B;  1J9O A;  1ILQ A;  4GKJ L;  4F88 A;  4B3S L;  5C4J B;  2EXZ A;  1CZW A;  4R4I A;  3O13 A;  4DR6 Q;  2R7Z B;  3GTP H;  2RVL A;  2B3G A;  1CKN A;  3M7G A;  4OWT B;  1J5E Q;  2FMC A;  4ZLT F;  4IFD I;  1PZK D;  1P8L A;  1Z47 A;  1JJ2 A;  3P7J A;  4M8A A;  3A8J E;  2D2C C;  3QJY A;  1Y8N B;  3SK8 A;  1HHV A;  1GVP A;  1EIH A;  1NBW A;  2WFW A;  2R61 A;  1KRS A;  4A3C H;  4IUR A;  4CKB A;  1JB7 A;  4NXM L;  4YWK A;  3J80 L;  3CMA A;  1QUQ B;  1CTM A;  1EQV A;  4GLX A;  4HCS A;  4JBW A;  1K73 C;  3D3R A;  3DWA A;  2VS1 A;  1X9N A;  2F3I A;  3STB D;  3FKI G;  1NR2 A;  3K5O A;  1K3R A;  2HIV A;  1SYD A;  3BYY B;  1IL8 A;  4OEM B;  4QJF A;  3N52 A;  4DNR B;  4ZRZ A;  3GTG H;  1VQC A;  3S1R H;  4YCW A;  5I2X A;  4FYD A;  1BDO A;  2UUB L;  3OW7 A;  1EY6 A;  1G6Z A;  1PZI D;  1TWC B;  3UE0 A;  3MEF A;  1BUV T;  5D3D A;  4A3J H;  4DV4 L;  4UY8 C;  1HZ9 A;  2ZXR A;  2WV6 D;  3BDO A;  3LWU A;  4C2M H;  1A6X A;  2B29 A;  2NZ1 D;  4YWM A;  1EYG A;  1QIL A;  3NPP A;  2CH4 W;  3RLF A;  2K33 A;  2QKI C;  1YHA A;  4RA8 A;  1B2T A;  1U4P A;  2K14 A;  4DR3 L;  1XMQ Q;  1D2B A;  3CCR A;  4LFB Q;  2D9U A;  4JC0 A;  4APV A;  4LF5 Q;  3S17 B;  1X32 A;  4EGV A;  3GTM H;  4DNT B;  3PF5 A;  2OEO A;  1JE4 A;  1EY9 A;  1KAA A;  1X56 A;  1YNJ C;  1YI2 A;  4K2K A;  2MUY A;  1E1O A;  1TQO A;  3CCL A;  1PH4 A;  3GTQ H;  4FF2 A;  1K83 B;  5GQO A;  4UP8 A;  4H0L C;  1YIT A;  2PMZ B;  3CME A;  1XXG A;  2NTS A;  4DU9 A;  2C9O A;  2ZT9 C;  1JOR A;  3W1B A;  4IZ8 A;  4RMF A;  1PA6 A;  4JI4 L;  1AH9 A;  3ICE A;  5CV6 A;  1E2W A;  2J7Z A;  3HKZ E;  1HNZ L;  3GTO B;  1NTG A;  3CCU A;  2K28 A;  1HNX Q;  1EIY B;  2O5I C;  4HAE A;  2CKZ B;  4JI2 Q;  1UEA B;  1C8C A;  5A35 A;  2PNH A;  2ALY B;  1ESF A;  1QOH A;  3CCV A;  3GTJ B;  5IGE A;  4IFD G;  1H9K A;  3AQQ A;  2A6E D;  1VQL A;  4DA2 A;  4QB4 A;  1BR9 A;  1TS4 A;  1X3Q A;  3P1H A;  2B2V C;  1HUM A;  1M8A A;  3J80 i;  4TSS A;  1NY4 A;  1W6J A;  3RZO B;  1QUQ A;  2CH4 A;  5EGT A;  4RHR A;  1HNW Q;  1EYA A;  1PMR A;  2HHH L;  3I4M H;  5NUC A;  4PMW A;  2G9H D;  1YNN C;  1HH2 P;  3CD6 A;  5E1F A;  3AU7 A;  1CM9 A;  2EY6 A;  4DV7 Q;  1X3E A;  2ZM6 Q;  3OPO A;  4G57 A;  1WTR A;  4XT3 B;  3ZYY X;  2WAQ E;  4NXM Q;  1EQQ A;  4HN7 A;  4ZK9 B;  1E0B A;  2AQ2 B;  1TY0 A;  2KQ3 A;  1A3V A;  1A3U A;  1CKO A;  1NNX A;  1P16 A;  4N9P A;  4A93 G;  3RLO A;  3PV0 A;  2BDO A;  1RHP A;  1CKM A;  1XWE A;  1EQR A;  4R8I A;  1QJO A;  3BDL A;  2EE1 A;  1S72 A;  2K5H A;  1WTX A;  4XQJ A;  2R3Z A;  1X55 A;  1KHI A;  2A1A A;  2I5M X;  3MXN B;  2UUB Q;  1FGB D;  1ENC A;  2OT2 A;  4BWG B;  1RJT A;  1S5B D;  5FJ8 G;  1WJJ A;  1QB5 D;  1JR0 D;  1TWH B;  2F3W A;  2IPK D;  2SNS A;  3SXH A;  4BY7 G;  1VQF A;  2FIN B;  3SDZ A;  5IGB A;  4X65 L;  3Q22 A;  2N49 A;  1LT6 D;  1M1K C;  3PSI A;  3BVM A;  5KNB A;  5JEA H;  4HSP A;  1K28 A;  2ZTD A;  4DFA A;  1RTO A;  1N36 Q;  1VCI A;  4AQY Q;  1B44 D;  3GP7 A;  4RH6 A;  5KYL A;  3HOZ H;  5G3L D;  4A93 B;  4FXG C;  3P75 A;  3CCQ A;  4DAM A;  2SDF A;  3OIP A;  4DUZ L;  4PZ7 A;  5M5W B;  3HOX G;  2EDG A;  4HIM A;  5C0X J;  2C35 B;  5ELF A;  1S4Z A;  3PO2 H;  2UXC L;  5C3E H;  1HCZ A;  2AWO A;  5I6W A;  2PZW A;  5EAY A;  5CC4 A;  1B4O A;  1PXU A;  4C3J H;  4B3R L;  2XWJ B;  4A3E G;  2AQ1 B;  4XXE A;  1DM0 B;  3TN2 A;  1SRU A;  3K7A B;  1B53 A;  1ET6 A;  1SLJ A;  1RD9 D;  3PCO B;  2YU9 B;  1Q81 C;  1E7Z A;  5JJK A;  3KLS X;  4X64 Q;  4OIJ A;  3T1H L;  1S5F D;  1TS2 A;  1BCP B;  1DOL A;  3M4O B;  1EFI D;  4ULL A;  1VQA A;  3S16 B;  1VDZ A;  1SXT A;  1IBM L;  4ZAI A;  4OO1 H;  2EYP A;  3TRE A;  2X6G A;  1L2F A;  2R92 G;  5I4D A;  1S5D D;  4IUU A;  1ONL A;  1SYE A;  5EJW A;  3CCJ A;  3HOX B;  3I90 A;  4A3G H;  3C1F A;  4XYO A;  4LFA Q;  1A2U A;  3NUC A;  1QWY A;  2KEN A;  2Z6K C;  4FP5 D;  1Q1E A;  3HOU H;  2F3V A;  3KBX A;  2V4D A;  4F7X A;  1I50 H;  4IO9 A;  1MIU A;  3FPP A;  3HEJ A;  2R93 G;  1HZA A;  3KUP A;  2N3S A;  3HRZ C;  3H94 A;  2F0J A;  1UE5 A;  1WTV A;  3MXN A;  5C0X I;  1WTW A;  3CKI B;  5BR8 L;  2F0V A;  1DOM A;  2KHS A;  1CT1 D;  3EVQ A;  3VR6 A;  1DJR D;  2JA7 H;  2PZT A;  1HRJ A;  3K8A A;  4LF7 L;  1BCP F;  2RSN A;  1MGS A;  4DGZ A;  1NMF A;  3G4S A;  3S15 B;  4H13 C;  1O80 A;  4QMG A;  1VF7 A;  1E2V A;  2AUK A;  4V19 0;  4TRD A;  4OIK A;  3I91 A;  4ZUJ A;  1PDQ A;  3T4A C;  1UNS A;  3D8G A;  5IYB G;  2VL6 A;  1N34 L;  4FNF A;  5I6Y A;  1VQM A;  4DV5 Q;  1S5E D;  5BN5 A;  4LUV A;  4DV2 Q;  1F9P A;  3G71 A;  5LMN L;  1ZYR D;  5JPM C;  4IUV A;  3SHL A;  3EN2 A;  3CC4 A;  3S1M B;  1LTB D;  1GUS A;  4X3S A;  3T1Y L;  2R93 B;  2F0W A;  2Q2U A;  1SMX A;  1SNM A;  2QEJ C;  1RTN A;  1CHP D;  2JEB I;  3FP9 A;  1A15 A;  4WJW A;  4B08 A;  3LGJ A;  4DK6 C;  3QO2 A;  4OWW B;  1EOV A;  3GDE A;  4A3K B;  1SE4 A;  3H91 A;  1OXU A;  5M5X B;  3S2H B;  4L6T B;  3HGB A;  2RHS B;  1J6Q A;  3H0G G;  1ML0 D;  4DK0 A;  1O78 A;  3DHQ A;  5M3M H;  2UUC L;  1IZ6 A;  3NTH A;  1XNQ L;  3CPF A;  4BBR G;  2F0E A;  3SVM A;  2IX0 A;  2EYH A;  1JOQ A;  4LFC Q;  2LXJ A;  3VDY A;  1TWF B;  3L2P A;  1SBB B;  3A5U A;  2RBM A;  3AB9 A;  3K58 A;  2K75 A;  3C1E A;  4DV1 Q;  2WB1 G;  1B7Y B;  2F1M A;  3D6C A;  2MGS A;  4B3M Q;  2IL8 A;  3GTK H;  4BA2 I;  3ITP A;  1L1O C;  3D6W A;  3HKZ G;  3M4Q A;  4KY7 A;  3MA2 B;  1VF5 C;  3I4N H;  3T1H Q;  1ENF A;  3HOW H;  1EY0 A;  4PNY A;  4BY1 G;  4DAY A;  1D6E C;  2RSO A;  3CRK C;  1GUG A;  1KNA A;  3H0G B;  1XYI A;  3DM1 A;  4RWS C;  1BQQ T;  4ID6 A;  1E22 A;  4BBR B;  3J7A 5;  2H4O A;  1QG7 A;  3HZX A;  1PFM A;  1WCM G;  5C0X G;  1ILP A;  4IPG A;  3D0F A;  3AYH B;  3SK6 A;  3PQI A;  3S1Q B;  3DWP A;  3CRL C;  1ENA A;  2CQA A;  2A6H D;  2WB1 B;  2RCF A;  1YNJ D;  2FHT A;  1VQ4 A;  1PTO F;  1AE2 A;  4DV3 Q;  1AW7 A;  2X69 A;  5LMU L;  3AEV A;  4K5W A;  4JG2 A;  4JI1 Q;  1D1K A;  2VUM H;  1X3F A;  3NBH B;  5BR8 Q;  3PO3 H;  1W6K A;  3AMU A;  4A3D H;  4NDX A;  4R4C A;  1JIC A;  3ERQ A;  1W2B A;  4JOI C;  2BA0 A;  5CYU A;  4BY1 B;  3X3M A;  2WKD A;  4HJ8 A;  2ENB A;  1EY7 A;  3KLR A;  2EY2 A;  2Y0S G;  3W5O A;  1K8A C;  2CCZ A;  4B3T L;  1O7L A;  3HFZ B;  3VR2 A;  1ASZ A;  2SEB D;  3ULJ A;  1WCM B;  2JQO A;  2A19 A;  4DXG A;  1IYV A;  1JCK B;  4E6I A;  1YBY A;  4KHP L;  3HOY H;  2R7D A;  1H9J A;  2UUA Q;  4OEL B;  5ISR A;  3TS2 A;  1LO5 D;  2DJF C;  5C3X A;  4KV6 A;  3M9B A;  4R4T A;  4IPD A;  3HOZ G;  1YNN D;  3S1N H;  4GNX B;  4F8M A;  1I4G A;  3CQZ B;  3JAM E;  2E5L L;  1X65 A;  1PRT B;  1AZQ A;  3ONA B;  3OMC A;  4CHT B;  1TS5 A;  3DMU A;  5ELE A;  2NVY B;  1VQO A;  3KFU A;  1F9Q A;  4A3B H;  4I7Z C;  3GV6 A;  5CR3 A;  2JA5 G;  4P2C B;  1VQ7 A;  3RLN A;  1GM5 A;  4LF6 L;  2Y0S B;  3D4W A;  1H9S A;  5IGG A;  4GOP C;  1ET9 A;  2M9V A;  4C3J G;  1KXL A;  1HR0 L;  4DR5 L;  1OXV A;  1Y69 U;  1STH A;  1RCV D;  1EWI A;  3W3A A;  2UXB L;  3JC6 6;  3SE0 A;  1GOZ A;  5I9P A;  5IE8 A;  4JI3 L;  1CHQ D;  2QIL A;  4HJ7 A;  4HJ9 A;  2DN8 A;  4P73 A;  3BDC A;  3HOV G;  1K8G A;  4YCV A;  3LX0 A;  1QVG A;  2JA8 H;  1GUO A;  3J80 c;  4KTA A;  2R7F A;  5HGQ A;  1BNZ A;  4EQO A;  4YHH L;  4XDX A;  1I6H B;  3BZC A;  1IBK L;  3G7L A;  3A0J A;  2ZXP A;  1JQY D;  2B2U C;  1Y1V H;  1WTH A;  3CU7 A;  2TMP A;  1PRT F;  2K32 A;  2ICE C;  4A3G G;  5IGD A;  3MZ5 A;  1GUW A;  4I7A A;  2TSS A;  2NB0 A;  2JA5 B;  1N32 Q;  4QIW E;  5EKL A;  3HOU G;  2X6L A;  4JCV E;  1U4M A;  2NN6 H;  2EYL A;  4KN4 C;  2E2H B;  3NBH A;  1S3O A;  5TSS A;  1Y8P B;  4KJN A;  3AFP A;  3TEH B;  2EY5 A;  2F0M A;  3IFD A;  4JV5 Q;  1T5X D;  5C44 H;  4IN3 A;  1SNC A;  5IWA L;  3KLS A;  4EQ5 A;  3TP8 A;  1FR3 A;  2PNR C;  3HOV B;  2F52 A;  2CVR A;  2CWA A;  2L4N A;  2FMM A;  1TU2 B;  1SEB D;  2LY7 A;  1YJW A;  1XNR L;  1BBW A;  5T1G A;  4BXX H;  5IT9 L;  2L12 A;  4YY3 Q;  1SJE D;  4QUC A;  4UP7 A;  1BVS A;  1VQE A;  4JI0 L;  4DNI A;  4Y7N B;  1FJG L;  2JE6 I;  5J22 A;  3FEW X;  1EUJ A;  3H3V C;  3OMG A;  2A74 C;  1XTC D;  1STN A;  1YEZ A;  2YTY A;  4GNX A;  1XMO Q;  5FK9 C;  4PZ8 A;  1TWA H;  2L9H A;  2I0Q A;  2ATW A;  4JI5 L;  3CW2 C;  3UDI A;  4DR4 Q;  1E3P A;  5C4X H;  1XPO A;  4LNQ A;  4XQQ A;  5JJL A;  3T56 B;  1PLF A;  2NVQ B;  5JOB A;  2E2D C;  3IAY A;  2OWO A;  1V1P B;  4H44 C;  1UEB A;  3S2D B;  1MSG A;  1NSN S;  3OOC A;  4KJO A;  3VA7 A;  1V43 A;  3H3V H;  3M3Y H;  4JPB W;  2JA6 H;  3MVV A;  2JN4 A;  4HJ5 A;  1V9P A;  2QDL A;  3FMC A;  4HJA A;  4P71 A;  4OHJ A;  3I72 A;  3MFG A;  2J4X A;  1G8Z D;  5IOD A;  3A54 A;  3E0J A;  5IGC A;  5LL6 S;  4DV6 Q;  1UE6 A;  5CV5 A;  1KDA A;  1HA6 A;  1KL9 A;  2LS0 1;  4XTC S;  1G29 1;  2ID0 A;  3CAM A;  3MWY W;  1SMY C;  1EFW A;  3C46 A;  4HR7 B;  1PTO C;  1IKL A;  2F0N A;  1LTG D;  4HTH A;  4GKK L;  2B8F A;  4MIU A;  4DUY Q;  5EKK A;  5K36 G;  1N9W A;  4L8J A;  3VYT A;  3HOW G;  5IYD H;  2QEX A;  2KBN A;  5FO9 B;  4GN4 B;  1K8M A;  1IHZ A;  2OQK A;  4AYB E;  4IJL A;  3AFQ A;  3T16 A;  3U9S A;  3MAQ A;  3I56 A;  5LMN W;  1WTQ A;  2YTX A;  2L5T A;  1EZ8 A;  2F0P A;  2KHJ A;  4O42 A;  2JP1 A;  1O7I A;  3FKI B;  3EBE A;  1E1T A;  3NK9 A;  1EIG A;  2G9D A;  1PTO H;  2BH8 A;  5JAV A;  1JC7 A;  4X62 Q;  4K6L A;  1I94 Q;  1Z7T A;  4C3I H;  1B9N A;  3MXP A;  2PQE A;  4ME3 A;  5FO7 B;  1CQV A;  1SJH D;  5IP9 H;  4K0K L;  4IOA A;  2E2J H;  2NTT A;  2EOT A;  3PMF A;  4K14 A;  1U0L A;  1XX8 A;  4LF8 L;  5IP7 H;  4X3U A;  4NXN L;  2O5J C;  2EYM A;  2UXD L;  4DV0 Q;  4NPS A;  3E9H A;  1F2M A;  3RN5 A;  1WVL A;  2P5Z X;  4L5S A;  2KED A;  4RCN A;  1JWU D;  5IGF A;  1RF2 D;  4DN4 M;  4X66 Q;  4TKO B;  3SGI A;  2UU9 L;  4C3H H;  5DNF A;  1IBL Q;  2F4V Q;  4U67 3;  3RMH A;  2V1C C;  3Q23 A;  3RZD B;  1XNR Q;  3IFT A;  2KEE A;  3RR5 A;  4A3I G;  1STB A;  3R93 A;  2EJG C;  4GKJ Q;  4ZQ3 A;  4B3S Q;  3RNU A;  4XQN A;  4UDU C;  1GKH A;  3K57 A;  1SRO A;  5KIX A;  4C1N K;  2L1B A;  1I3Q H;  2NVX H;  4A4I A;  2PW7 A;  3S24 A;  1Q1B A;  1IW7 C;  2L11 A;  4A3M G;  1R9T B;  4C56 C;  3SEB A;  1V1P A;  2LSS A;  3J81 i;  4WOR A;  5JVG 3;  2Z0S A;  4G7H C;  3DM3 A;  1EY5 A;  1TII D;  1CFM A;  4GLV B;  1AN8 A;  4N8X 1;  4NP5 A;  3KDF B;  4GNX C;  2DUD A;  3GTL H;  1JJG A;  1I6V C;  1PRT C;  2B2Y A;  1A3T A;  3K0X A;  1EOT A;  5HGT A;  1WYD A;  1I4Q A;  4DF7 A;  2RF4 A;  2EJM A;  5CBA E;  4G7Z C;  2K5N A;  4A3I B;  3R2I A;  4LUO A;  5F2D A;  3KJO A;  4K6D A;  4G4K A;  1D7Q A;  1H9R A;  1Y1W G;  1IYJ B;  1CA6 A;  3G48 A;  1BOS A;  1EQT A;  3A5Z B;  4A3M B;  1SNQ A;  1CUK A;  1VQK A;  2A8V A;  1FNV A;  1A62 A;  4DV4 Q;  5M3F G;  4BBS G;  1GUN A;  2K52 A;  3F2U A;  4QQB X;  4L63 B;  4KLK A;  1RDP D;  2B8G A;  2OXP A;  1Y1V G;  2F0O A;  2C5C A;  1TWG B;  4DR3 Q;  2JEA I;  2E2I H;  5M5Y B;  2K04 A;  4Q0F A;  5A2Q E;  1MJE A;  1KQS A;  4JI7 L;  1UUP A;  2Q8T A;  3UDG A;  3Q6S A;  2L55 A;  4A3F H;  3VYS A;  2Z6B A;  1HUN A;  2B63 G;  1WTO A;  4M1U B;  4DR2 L;  1PH6 A;  1Y1W B;  1VQD A;  4CJ2 C;  4UHV A;  2K01 A;  4K0K Q;  2VXW A;  3DWQ A;  1IL2 A;  1F77 A;  5H1S E;  4JI4 Q;  2WKC A;  1Y8O B;  1PFS A;  4CDD C;  4U68 A;  2Q8I B;  3F2D A;  1SNP A;  4HSV A;  1HNZ Q;  5M3F B;  4BBS B;  4BY7 B;  2UXD Q;  5JJI A;  3GV3 A;  2N55 A;  1PVO A;  1HQM C;  1AFP A;  2PO4 A;  1HPC A;  1HR0 W;  4K8I A;  1L0W A;  1SN8 A;  3M4P A;  5FLM G;  1GHK A;  3K80 C;  4JYA L;  5KRU A;  3CCS A;  2DNE A;  4ILW A;  5E3F A;  2NVT B;  3PUY A;  5CV4 A;  1F2Y A;  4RHS A;  1K0R A;  4JI8 L;  3UI2 A;  3S14 H;  4GZY C;  4AH6 A;  3OWF A;  5AJ3 L;  3ND8 A;  4X3K A;  2BE5 C;  4K5X A;  2CFM A;  4POF A;  5KNC A;  5G3L F;  3KDF A;  2HHH Q;  2KEC A;  4IUQ A;  2B63 B;  1ICF B;  4NKL A;  4P74 A;  1Z9F A;  5IY0 A;  4LWC A;  1STY A;  4A3C G;  5JEA J;  4DAY B;  3ZJY C;  1BBU A;  5COR A;  3I55 A;  3OIQ A;  2ZTC A;  5I2Y A;  4A3E B;  4NB3 A;  4ZYS A;  1PH8 A;  4CDF C;  3I8Z A;  2XVS A;  5C4J H;  2R7Z H;  1WI5 A;  2D0O A;  4GS3 A;  1K0S A;  1MSH A;  3RN2 A;  1Q3L A;  1A63 A;  4RKB A;  2QW7 A;  5EBC A;  3TP7 A;  1SAP A;  1ZKO A;  4DR1 L;  2YV5 A;  1HTL D;  5FO8 B;  2QA4 A;  4ABN A;  2MNA A;  1FYC A;  1XPR A;  2EPB A;  1A8V A;  3SR1 A;  1EYC A;  3GTP B;  2A69 C;  1EU4 A;  2R92 B;  1G6P A;  1IYU A;  1UE1 A;  3PUV A;  1KC8 C;  3EIV A;  4A3J G;  2RA4 A;  1LAC A;  4DK3 C;  3TDQ A;  2PI2 A;  2XRQ D;  3CCE A;  4RG1 A;  5HY6 A;  2KUM A;  2GA4 B;  1F9S A;  4X65 Q;  3OTO L;  1Q7Y C;  2I46 A;  1K9M C;  4L5T A;  1L0Y B;  3RD4 A;  1KIX A;  4HMI A;  1QE6 A;  1AP0 A;  1RIP A;  2D5D A;  3FPU B;  2CW0 C;  1STG A;  4PZ6 A;  1K8O A;  1TWC H;  4EQN A;  4ZKC B;  1PYW D;  5GRO A;  1BXT A;  3GO5 A;  3GTG B;  4OX9 L;  3S1R B;  3M85 A;  4GN5 A;  4DUZ Q;  4V0B A;  1KTK A;  3GQB A;  1GJX A;  1AEX A;  3MXU A;  4LF9 L;  3LNN A;  2PPB C;  1YVC A;  1X3G A;  2UXC Q;  1CK1 A;  2JXM B;  3R2T A;  4A3J B;  2K5W A;  2KA7 A;  4N9T A;  3A7A B;  3NEN A;  3K59 A;  2PMZ E;  1VQ9 A;  4B3R Q;  4RGN A;  4UAI A;  4C2M B;  2E76 C;  3S17 H;  1A0I A;  4LK1 C;  2Q2I A;  1H9S B;  2K03 A;  1SE8 A;  2IHF A;  5C3W A;  2EYF A;  1S40 A;  2VQF L;  2AQ3 B;  1K83 H;  2DJG C;  4O2D A;  1LTI D;  2EY1 A;  3C3L A;  1SMY D;  3SK4 A;  3HP3 A;  5LHY 1;  2A6E C;  1PTO D;  5K5P A;  3NHH A;  1UWV A;  1X54 A;  3GTM B;  1EU3 A;  1IBM Q;  2VB2 X;  1VQ6 A;  3I4M G;  1Q46 A;  3GTO H;  3J7Y W;  1F2Z A;  5DLQ E;  4POG A;  3GTQ B;  1QVC A;  4LJZ C;  3Q8D A;  1HZB A;  4Q5V A;  1BO0 A;  4OO1 I;  4CJ0 B;  3GTJ H;  1LT3 D;  1RL2 A;  1CQF A;  1Z6H A;  2RDG A;  5CBE E;  1HXY D;  1BKB A;  3BYT B;  4KHZ A;  3LWE A;  3TSS A;  1DON A;  2XTI A;  4RGT A;  4DK1 A;  4RGM A;  3HG9 A;  3IRB A;  3WDN A;  4KY5 A;  3RZO H;  4X6A H;  2VQE L;  2LFN A;  4R4O A;  3HKZ B;  3S9W A;  2WAQ G;  1OTC A;  4WJ4 A;  1II3 A;  3I2Z A;  1VQB A;  5FLX E;  4ZKB B;  4LF7 Q;  1I4H A;  3V96 A;  3KBG A;  4HED A;  1GXD C;  1TS3 A;  4J8Q A;  3I4M B;  3MXG A;  2J0T D;  1EZ6 A;  4OXP A;  1NMG A;  4K5V A;  5L37 A;  3QOL A;  1N34 Q;  1D5Z C;  1KNE A;  1FD7 D;  4KY6 A;  1MKH A;  2VY3 A;  4HMJ A;  3QR8 A;  1YHB A;  2MP1 A;  2MPM A;  1YHQ A;  5LMN Q;  4A75 A;  4IFD H;  4YWL A;  2HQE A;  5JEA G;  4DR6 L;  1E24 A;  3TS0 A;  1J5E L;  2HT1 A;  2I5H A;  3URY A;  3OTO Q;  1I4P A;  3T1Y Q;  1IW7 D;  5EPK A;  1WTP A;  2F0U A;  1OXT A;  3I7F A;  4IQZ A;  4JW0 A;  4H7B A;  3QOJ A;  2CHB D;  3U4V A;  5JPN C;  4BA1 I;  5C5M A;  2HCI A;  2WAQ B;  1VMC A;  2PQA B;  5IT9 c;  1VQJ A;  1SE3 A;  2LMC B;  1TWH H;  3PO2 G;  5EKI A;  5C3E G;  2FJ2 A;  2UUC Q;  4PV1 C;  4JK1 C;  1Q8I A;  1XNQ Q;  1C0A A;  3IL8 A;  3W2D A;  1LT5 D;  3F2B A;  3QG1 A;  5CGK A;  1PRT D;  1O7Y A;  4PMC A;  1LTA D;  3PUZ A;  1RKN A;  4JI6 L;  3DXJ C;  3KF6 A;  2SNM A;  3U58 A;  2BDN A;  3NQI A;  4A93 H;  1TY2 A;  3EQL C;  1FNU A;  3OHX C;  2MO1 A;  5M5W H;  3MTS A;  1PYS B;  2DY8 A;  4IUT A;  1VQN A;  1LT4 D;  1BCP C;  4X3T A;  5DM7 3;  5FKA C;  3JAM L;  4OO1 G;  3HOZ B;  5C6A A;  1NJI C;  2QCP X;  3J81 c;  1U5K A;  1HQR D;  2F0K A;  2K5D A;  5ELN A;  1SSO A;  1MBY A;  5FJ8 H;  3PO2 B;  1STA A;  5C3E B;  2ZXO A;  4IJH A;  5GAH C;  3M7N A;  3K7A H;  1B3A A;  3I73 A;  3KLW A;  2YU9 H;  1F9R A;  4FVM A;  1SND A;  2M2L A;  3UE1 A;  3I4O A;  1XMQ L;  3DUZ A;  4C3J B;  4LFB L;  4LF5 L;  1G2S A;  4CGY B;  3M4O H;  1XJV A;  1JE5 A;  3S16 H;  2R7Z G;  3D4R A;  4LW1 A;  5BN3 A;  5J1Z A;  2Z9H A;  2F0H A;  3HKS A;  3BJU A;  3PIP A;  2BCO A;  3NBI A;  5EBD A;  3ER0 A;  1I4R A;  5IIF A;  1ROD A;  5LMU Q;  4L5R C;  3I4L A;  2JA7 G;  3HOX H;  1HJP A;  2E75 C;  3MHB A;  4FF3 A;  2Q2H A;  3U4Z A;  2VB3 X;  4FXD A;  5D14 A;  5DAU A;  2A5H A;  1HNX L;  1EEI D;  4QL5 A;  4JI2 L;  4JVZ A;  4ZCK A;  3J80 E;  4A3G B;  1SYC A;  4LUZ A;  4RAU C;  4B9X A;  2AMC B;  4A3L H;  4RFB A;  4IPH A;  4PG3 A;  4IOC A;  2PZU A;  4B3T Q;  3HOU B;  3G6E A;  1I50 B;  1Q8K A;  2XRS D;  1Q86 C;  1PYB A;  1WOC A;  2B39 A;  2AHO B;  2N8N A;  1MJC A;  2KCT A;  1D1I A;  2PQA A;  1PH2 A;  4PMB A;  2JJQ A;  1ZYR C;  3CHB D;  3SK5 A;  5IOC A;  1YJN A;  1PH3 A;  4KHP Q;  2BE5 D;  3T13 A;  3A8K E;  4UP9 A;  2I07 B;  2RKS A;  4KD4 A;  3S15 H;  1HNW L;  1BF4 A;  1DXM A;  1AE3 A;  2R92 H;  4GN3 B;  1MHW C;  1QZG A;  3QB3 A;  4QY7 A;  3J7A F;  2JA7 B;  2N88 A;  2E5L Q;  3J81 L;  4MZ9 A;  1AZP A;  5M3M G;  3NEM A;  1GHJ A;  4DV7 L;  2WIN B;  1CA5 A;  3P20 A;  2ZM6 L;  5KEE A;  3T53 B;  2F03 A;  3WWV A;  1PH1 A;  3NTI A;  4R4Q A;  1XTD A;  4ALP A;  3S1M H;  3OYY A;  2R93 H;  4LF6 Q;  2B2T A;  3JAM i;  2F0D A;  1JJC B;  4Y52 H;  4RKL A;  1HR0 Q;  4DR5 Q;  4JI6 Q;  1F2L A;  1WD1 A;  2UXB Q;  5DM6 3;  4HID A;  3RUZ A;  4A3K H;  5EPJ A;  2R6G A;  2A69 D;  5HUR A;  4JI3 Q;  1H95 A;  2AUJ D;  2ICI A;  5M5X H;  3S2H H;  3T51 B;  3MEH A;  4DXF A;  2DGY A;  3I4N G;  1B50 A;  3ND9 A;  1C9O A;  3F8T A;  1PH7 A;  3KF8 B;  5IYC H;  5BN4 A;  2IHE A;  4YHH Q;  1N33 L;  3MC0 B;  3F1Z A;  1TWF H;  3Q24 A;  5IYB H;  1N8R C;  1FNW A;  4LMQ D;  1NUC A;  2VW9 A;  1IBK Q;  1LUZ A;  5M3M B;  2DY7 A;  3PUW A;  1LTL A;  1TXY A;  5CV9 A;  2GVB A;  4PQX A;  3NQT A;  3V2T A;  4A76 A;  3FVQ A;  1N36 L;  2XGT A;  4XYQ A;  4AQY L;  2KCN A;  1B1Z A;  2CW0 D;  4IUP A;  1ZXT A;  2K5Q A;  5T1I A;  1KAB A;  2G5D A;  5M9O A;  4MTK A;  1MD2 D;  2QDB A;  1KRT A;  1CSP A;  2A6H C;  1QCB D;  5IWA Q;  3GTK B;  1GD7 A;  1GUT A;  2NN6 I;  4K2L A;  2VUM G;  1TVX A;  3PO3 G;  2WB1 E;  3FHW A;  4KMU C;  1PV4 A;  3H0G H;  4A3D G;  3I4N B;  2ZTE A;  3HOW B;  3TZD A;  1QNU A;  2FFK B;  4BBR H;  2Z1C A;  3W1G A;  5J3B A;  1NE3 A;  2XWB B;  5EPL A;  4MHE A;  4ODG A;  1EY8 A;  3S1Q H;  1G51 A;  4CBV A;  2YYZ A;  4B9W A;  3K0Y A;  5GAG C;  1SYB A;  4JI0 Q;  1FJG Q;  1LV9 A;  1HTP A;  2KVM A;  1DD2 A;  1I5F A;  3DEP A;  2KCM A;  4X64 L;  1L1O B;  5JVH 3;  5CV8 A;  3KK7 A;  3TP6 A;  3HOY G;  1SFO B;  3QIA A;  3J7A V;  5I9O A;  1X3P A;  4MTN A;  1W3S A;  4JI5 Q;  1XPU A;  2Z6K A;  2JK8 A;  1VQ5 A;  2HDM A;  1B70 B;  2RDF A;  3I3C A;  4P72 A;  1NAP A;  4ZUI A;  3NWS A;  4BY1 H;  4WJ3 M;  2AWN A;  2WAC A;  5ELC A;  4LFA L;  3PO3 B;  2VUM B;  1YZ6 A;  2I5L X;  1LM0 A;  2GN5 A;  3TZU A;  4A3D B;  3H09 A;  3UDX A;  5D65 A;  2EZV A;  4A3B G;  3PUX A;  1OXS C;  5C0X H;  1WCM H;  3R8B A;  2ZJR A;  4CJ1 B;  3J81 j;  3EA6 A;  3K6O A;  1EWC A;  5LL6 X;  1KDB A;  3N6R A;  1CZG A;  3H3V I;  5C5L A;  4HCE A;  1B8A A;  3KF8 A;  2BH2 A;  2ZJQ A;  2Y0S E;  3OWE B;  1V1Q A;  1VQH A;  3CQZ H;  3CCM A;  3M4Y A;  3HOY B;  2F0I A;  5FOB B;  1NCV A;  3K5N A;  3A55 A;  2JA8 G;  2K1B A;  1X6O A;  4GKK Q;  2F0S A;  2L0C A;  1DGS A;  2NVY H;  2B2T C;  3DEO A;  3S1N B;  2A68 C;  4FDB A;  1M90 C;  1SNO A;  3U50 C;  1Q82 C;  2FXQ A;  3KJP A;  4DV5 L;  1PFN A;  4DV2 L;  1N33 Q;  3BZK A;  1D8L A;  4DAP A;  1SR3 A;  2F0T A;  3PIP 3;  4A3B B;  2BA1 A;  5GAE C;  2OTJ A;  2CQO A;  2E8G A;  4QCL A;  2NN6 G;  2Z4H A;  4Z9C B;  4DKA C;  4KN7 C;  4K8J A;  3L3O C;  4J1M A;  4YIJ A;  1QZH A;  4GLA C;  3X3N A;  2F0G A;  3VR3 A;  1L0X B;  5C44 G;  1R4P B;  1UAP A;  3VA5 A;  1I6H H;  1YIJ A;  2KOL A;  3C2P A;  2HDL A;  3ULL A;  1T5E A;  4WRD A;  4OWX B;  1TKW B;  3BU2 A;  4LF8 Q;  3TRZ A;  1VQ8 A;  4NXN Q;  1U4L A;  2JA8 B;  3NSW A;  1EL0 A; 
#chains in the Genus database with same CATH homology
 1S40 A;  2VQF L;  1K83 H;  4O2D A;  3CPW A;  4LFC L;  3PF5 A;  1X56 A;  1Y1V H;  4BXX G;  1YI2 A;  1JMC A;  2JA5 H;  1E1O A;  1L1O A;  2OTL A;  1PH4 A;  2UU9 Q;  3CCL A;  1UWV A;  1X54 A;  3B6Y A;  4GOP B;  3GTQ H;  1IBM Q;  2LXK A;  4A3G G;  1WFQ A;  5GQO A;  4UP8 A;  2EQS A;  4DV1 L;  2HT1 A;  1YIT A;  1Y14 B;  2E2H H;  1UE7 A;  3CME A;  1VQ6 A;  3I4M G;  1Q46 A;  1N32 Q;  3GTO H;  4TQU S;  1FL0 A;  4QIW E;  5DLQ E;  4B3M L;  3W1B A;  1QVC A;  4POG A;  3HOU G;  4RMF A;  4JCV E;  2MQH A;  1PA6 A;  4JI4 L;  4A3L G;  2IY5 B;  3ICE A;  1AH9 A;  3Q8D A;  1HZB A;  3HKZ E;  1S3O A;  2NZH A;  4H02 A;  4OO1 I;  1HNZ L;  3AFP A;  3TEH B;  1LYL A;  3GTJ H;  1NTG A;  3CCU A;  1HNX Q;  1EIY B;  2CKZ B;  4JV5 Q;  1RL2 A;  4JI2 Q;  3HOV H;  5C44 H;  2CWP A;  5IWA L;  4EQ5 A;  2PNH A;  2ALY B;  4AIM A;  3CCV A;  4HIK A;  5C4X G;  1BKB A;  4IFD G;  3AQQ A;  4KHZ A;  2F52 A;  4UPA A;  2XTI A;  1VQL A;  2CWA A;  3IRB A;  1YJW A;  3RZO H;  4X6A H;  1XNR L;  1BBW A;  2VQE L;  4BXX H;  2L15 A;  2JA9 A;  3J80 i;  4R4O A;  4Y7N H;  1NY4 A;  4YY3 Q;  2WAQ G;  1QUQ A;  1OTC A;  2JEA I;  4WJ4 A;  2WP8 J;  1VQB A;  3I2Z A;  4UP7 A;  1BVS A;  1HNW Q;  3I4M H;  2HHH L;  2JA6 G;  1VQE A;  4LF7 Q;  4JI0 L;  4DNI A;  4PMW A;  1FJG L;  2JE6 I;  1HH2 P;  1EUJ A;  3CD6 A;  3STB C;  1JT8 A;  3PF4 A;  1YEZ A;  2YTY A;  3UDF A;  4GNX A;  1XMO Q;  1ASY A;  4OXP A;  1NMG A;  4JOI A;  4DV7 Q;  2D62 A;  1TWA H;  1X3E A;  4PZ8 A;  2ZM6 Q;  4KI0 A;  1N34 Q;  2I0Q A;  4R1J A;  2ATW A;  4DV3 L;  4JI5 L;  1MKH A;  2VY3 A;  3CW2 C;  3UDI A;  2WAQ E;  3A74 A;  4JI1 L;  4A3K G;  2D0P A;  1EQQ A;  4NXM Q;  1E3P A;  1YHB A;  2NVQ H;  4DR4 Q;  5C4X H;  1YHQ A;  5LMN Q;  4A75 A;  3ULP A;  1XPO A;  4YWL A;  4LNQ A;  3D31 A;  5JJL A;  1CKO A;  3S2D H;  1P16 A;  5JEA G;  4DR6 L;  1E24 A;  3DLL A;  4A93 G;  3RLO A;  3TS0 A;  1J5E L;  4LF4 L;  2I5H A;  2OWO A;  3PV0 A;  3OTO Q;  3T1Y Q;  5IYD G;  1CKM A;  1UEB A;  1EQR A;  2VZA A;  1V43 A;  5IYC G;  1OXT A;  3I7F A;  3H3V H;  3M3Y H;  4J15 A;  2K5H A;  4DPG A;  1S72 A;  3U4V A;  3PIO A;  1VQP A;  4BA1 I;  2JA6 H;  4HJ5 A;  1X55 A;  1KHI A;  2A1A A;  1V9P A;  2I5M X;  4HJA A;  2PQA B;  4P71 A;  5IT9 c;  3MXN B;  1VQJ A;  3L7Z C;  2ES2 A;  2UUB Q;  1PH9 A;  1TWH H;  3PO2 G;  5C3E G;  4MNO A;  2EXD A;  2UUC Q;  4DV6 Q;  1UE6 A;  1KL9 A;  1T9H A;  4XTC S;  1G29 1;  2ID0 A;  5FJ8 G;  4AYB G;  2UUA L;  1XNQ Q;  1WJJ A;  4JI7 Q;  1C0A A;  3CAM A;  3F2B A;  4BY7 G;  1EFW A;  3PUZ A;  5IP9 G;  1VQF A;  4JI6 L;  4X65 L;  3KF6 A;  1VQG A;  2N49 A;  4DR2 Q;  1M1K C;  4GKK L;  3PSI A;  3U58 A;  2RHQ B;  5IP7 G;  4DUY Q;  4GOP A;  2ZTD A;  2H5X A;  1CSQ A;  4A93 H;  5K36 G;  1N9W A;  1N36 Q;  1VCI A;  4AQY Q;  4QGU A;  3HOW G;  5IYD H;  2QEX A;  2KBN A;  4GN4 B;  2MO1 A;  2Q2T A;  3HOZ H;  5M5W H;  2OQK A;  4AYB E;  1PYS B;  1VQN A;  3FKI H;  4IJL A;  3AFQ A;  5LMN W;  3I56 A;  3CCQ A;  2YTX A;  4DAM A;  4OO1 G;  4DUZ L;  4PZ7 A;  2KHJ A;  1NJI C;  3HOX G;  4OON A;  3L0O A;  4HIM A;  1O7I A;  5C0X J;  3EBE A;  3CP0 A;  2C35 B;  3J81 c;  3KF6 B;  1E1T A;  3PO2 H;  2UXC L;  5C3E H;  3E9I A;  2AWO A;  1U5K A;  2BH8 A;  4JYA Q;  4X62 Q;  5E7N A;  5ELN A;  5FLX c;  5FJ8 H;  1GO3 E;  4C3I H;  1I94 Q;  5EAY A;  4ME3 A;  4IJH A;  4JI8 Q;  4XIG S;  4C3J H;  5GAH C;  3M7N A;  3K7A H;  5IP9 H;  4B3R L;  5AJ3 Q;  4K0K L;  4A3E G;  4IOA A;  3KLW A;  2E2J H;  2YU9 H;  3UE1 A;  1SRU A;  3I4O A;  1XMQ L;  1U0L A;  2HIX A;  4LF8 L;  4LFB L;  2YTV A;  1C7Y A;  5IP7 H;  4NXN L;  4LF5 L;  1SLJ A;  3K81 C;  3PCO B;  4DV0 Q;  4NPS A;  1Q81 C;  3M4O H;  1XJV A;  3E9H A;  1KD1 C;  2UXD L;  1JE5 A;  3S16 H;  1E7Z A;  5JJK A;  3RN5 A;  4L5S A;  2R7Z G;  4X64 Q;  4P75 A;  3T1H L;  4LW1 A;  1FGU A;  3RZD H;  4X66 Q;  3HKS A;  3BJU A;  1VQA A;  3PIP A;  3SGI A;  2UU9 L;  4C3H H;  1IBL Q;  1IBM L;  2F4V Q;  3ER0 A;  3TRE A;  2V1C C;  5LMU Q;  4L5R C;  2JA7 G;  1L2F A;  3HOX H;  1XNR Q;  2R92 G;  3F2C A;  3PGZ A;  1HJP A;  1N32 L;  3RR5 A;  4A3I G;  4GKJ Q;  3CCJ A;  4B3S Q;  3JAM c;  1R9T H;  2Q2H A;  3U4Z A;  3RNU A;  4A3G H;  1GKH A;  1SRO A;  4LFA Q;  2NVX H;  1I3Q H;  4A4I A;  4O0A A;  3S24 A;  4DR1 Q;  1HNX L;  1Q1B A;  1PHJ A;  4QL5 A;  1SFO H;  4JV5 L;  2KEN A;  4A3M G;  4JI2 L;  2Z6K C;  1Q1E A;  2QGQ A;  4LUZ A;  1EIF A;  2LSS A;  3HOU H;  3J81 i;  2AMC B;  4A3L H;  1I50 H;  4IO9 A;  4IPH A;  1MIU A;  4PG3 A;  4IOC A;  2Z0S A;  2R93 G;  4B3T Q;  5GAD C;  3DM3 A;  1HZA A;  3G6E A;  2N3S A;  1KAW A;  1Q8K A;  4GLV B;  1Q86 C;  1UE5 A;  1PYB A;  2K5V A;  1OXX K;  1WOC A;  2AHO B;  2N8N A;  1MJC A;  2KCT A;  2PQA A;  3KOJ A;  1PH2 A;  2JJQ A;  1YJN A;  5C0X I;  4DR7 L;  5BR8 L;  1YJ9 A;  1PH3 A;  4KHP Q;  2EIF A;  4YY3 L;  3KDF B;  4GNX C;  4UP9 A;  2DUD A;  3GTL H;  3S15 H;  1JJG A;  2MO0 A;  1Q12 A;  2JA7 H;  1HNW L;  4LF4 Q;  1AE3 A;  3K8A A;  2R92 H;  2AKW B;  4LF7 L;  4GN3 B;  3K0X A;  1WYD A;  1QZG A;  4A3I H;  1NMF A;  3G4S A;  4QY7 A;  2RF4 A;  2E5L Q;  4MZ9 A;  5M3M G;  3NEM A;  1XMO L;  3CF5 A;  2K5N A;  4DV7 L;  4LUO A;  5IYB G;  2ZM6 L;  3KJO A;  1N34 L;  2VL6 A;  2OQ0 A;  4A3M H;  2IT1 A;  4YCU A;  1D7Q A;  1VQM A;  1Y1W G;  2N78 A;  1IYJ B;  4TVA B;  3G48 A;  3WWV A;  4DV5 Q;  4A3F G;  1PH1 A;  4DR4 L;  4LUV A;  4DV2 Q;  2PI2 E;  1XTD A;  2K50 A;  4R4Q A;  5ELO A;  3G71 A;  5LMN L;  3A5Z B;  4ALP A;  4OX9 Q;  3S1M H;  3OYY A;  1CUK A;  4LF6 Q;  2R93 H;  1VQK A;  2A8V A;  3JAM i;  1CKN B;  1JJC B;  4L5Q A;  3EN2 A;  4Y52 H;  3CC4 A;  1HR0 Q;  4LF9 Q;  4DR5 Q;  1A62 A;  3K7U C;  4DV4 Q;  2MFI A;  5M3F G;  4JI6 Q;  4BBS G;  3T1Y L;  2UXB Q;  2Q2U A;  1SMX A;  4HID A;  3J7Z C;  4A3K H;  2K52 A;  3H15 A;  2JEB I;  2RCN A;  2R6G A;  3FP9 A;  3LGJ A;  4DK6 C;  4QQB X;  4JI3 Q;  1H95 A;  4OWW B;  5M5X H;  3S2H H;  1EOV A;  1TWG H;  2GVA A;  3GDE A;  3CXC A;  4KLK A;  2DGY A;  2HQL A;  3I4N G;  3TQY A;  5M5Y H;  1HZC A;  1Y1V G;  1OXU A;  1C9O A;  3F8T A;  4DR3 Q;  2VNU D;  1PH7 A;  2RHS B;  3KF8 B;  1J6Q A;  3H0G G;  5IYC H;  2IHE A;  5M3M H;  4YHH Q;  2UUC L;  1N33 L;  4DV6 L;  2E2I H;  2ZJP A;  4HIO A;  1VQI A;  1IZ6 A;  3F1Z A;  1TWF H;  5IYB H;  1N8R C;  1XNQ L;  2VW9 A;  3CPF A;  4BBR G;  1PH5 A;  1LUZ A;  2IX0 A;  1MJE A;  1KQS A;  1IBK Q;  3E0E A;  4JI7 L;  1Y1W H;  2VQF Q;  3UDG A;  4LFC Q;  2LXJ A;  3PUW A;  4A3F H;  1LTL A;  3VDY A;  3L2P A;  2B63 G;  1YNX A;  1TXY A;  4DR2 L;  2GVB A;  3A5U A;  1PH6 A;  1VQD A;  2K75 A;  4DV1 Q;  3ERS X;  3NEL A;  4DUY L;  2WB1 G;  1B7Y B;  4K0K Q;  4A76 A;  1N36 L;  2XGT A;  4AQY L;  5M3F H;  4IFD J;  4BBS H;  1IL2 A;  4B3M Q;  4BY7 H;  2KHI A;  5H1S E;  4JI4 Q;  1FVI A;  1PFS A;  3F2D A;  3CC2 A;  3GTK H;  4BA2 I;  1HNZ Q;  1L1O C;  2UXD Q;  4JBK A;  5JJI A;  3HKZ G;  3M4Q A;  1KRT A;  2OCE A;  1PVO A;  3I4N H;  1CSP A;  5IWA Q;  3T1H Q;  4JBM A;  3HOW H;  1HR0 W;  1GD7 A;  2NN6 I;  1L0W A;  1SN8 A;  3M4P A;  4BY1 G;  5FLM G;  2K4K A;  2NVT H;  2WB1 E;  3FHW A;  1PV4 A;  1QVF A;  3H0G H;  4IPC A;  4A3D G;  3K80 C;  4JYA L;  2ZTE A;  3OW2 A;  4X62 L;  3CCS A;  4EX5 A;  4BBR H;  1I94 L;  2VUM G;  3PO3 G;  3PUY A;  3W1G A;  5J3B A;  1K0R A;  4JI8 L;  3S14 H;  4AH6 A;  3CC7 A;  1NE3 A;  5AJ3 L;  2VQE Q;  2B63 H;  1E22 A;  3J7A 5;  3S1Q H;  1G51 A;  2CFM A;  4POF A;  5C0X G;  1WCM G;  2YYZ A;  5GAG C;  4IPG A;  3D0F A;  3KDF A;  2HHH Q;  4DV0 L;  3AYH B;  4JI0 Q;  4P74 A;  1Z9F A;  1FJG Q;  5IY0 A;  1I5F A;  3GD7 A;  4LWC A;  2KCM A;  1IXR A;  3KYH C;  4X64 L;  4A3E H;  2NZO A;  2ASB A;  1L1O B;  5JEA J;  4DAY B;  4A3C G;  4X66 L;  3ZJY C;  3HOY G;  1BBU A;  3I55 A;  1IBL L;  2ZTC A;  4MTN A;  2F4V L;  4NB3 A;  1VQ4 A;  1AE2 A;  4DV3 Q;  1W3S A;  1PH8 A;  5LMU L;  2Z6K A;  4JI5 Q;  1XPU A;  3AEV A;  2JK8 A;  1VQ5 A;  5C4J H;  1B70 B;  4JG2 A;  4JI1 Q;  4P72 A;  2R7Z H;  1VS0 A;  1WI5 A;  2D0O A;  4GS3 A;  5FLM H;  1X3F A;  3NBH B;  5BR8 Q;  4JBJ A;  3RN2 A;  4BY1 H;  2VUM H;  3PO3 H;  4DR7 Q;  4A3D H;  4WJ3 M;  4R4C A;  4GKJ L;  1A63 A;  2AWN A;  4B3S L;  4R4I A;  4DR6 Q;  2IX1 A;  4LFA L;  3GTP H;  1W2B A;  4JOI C;  1YZ6 A;  2B3G A;  1CKN A;  1LM0 A;  2BA0 A;  2GN5 A;  2I5L X;  4OWT B;  4DR1 L;  1J5E Q;  2YV5 A;  3UDX A;  4HJ8 A;  2QA4 A;  2MNA A;  2Y0S G;  1XPR A;  3W5O A;  1A8V A;  4A3B G;  4IFD I;  3PUX A;  1OXS C;  1P8L A;  1Z47 A;  1K8A C;  1WCM H;  1JJ2 A;  2ZJR A;  2CCZ A;  4B3T L;  1G6P A;  3HFZ B;  1UE1 A;  3J81 j;  1ASZ A;  3PUV A;  1GVP A;  3ULJ A;  3EIV A;  4A3J G;  1KC8 C;  1NBW A;  2JQO A;  2A19 A;  2WFW A;  4A3C H;  1KRS A;  1YBY A;  1JB7 A;  4NXM L;  3H3V I;  4DK3 C;  4YWK A;  3CMA A;  4KHP L;  2PI2 A;  1QUQ B;  1B8A A;  3CCE A;  3HOY H;  4RG1 A;  2R7D A;  2BH2 A;  2ZJQ A;  2UUA Q;  4GLX A;  2Y0S E;  5HY6 A;  4JBW A;  3TS2 A;  1V1Q A;  1VQH A;  3CQZ H;  3M9B A;  3CCM A;  4R4T A;  1K73 C;  4IPD A;  2VS1 A;  4X65 Q;  3OTO L;  1Q7Y C;  2JA8 G;  3HOZ G;  1X9N A;  3S1N H;  4GNX B;  1X6O A;  4L5T A;  1K9M C;  4GKK Q;  2F3I A;  3STB D;  1DGS A;  3FKI G;  2E5L L;  1X65 A;  2NVY H;  1K3R A;  2HIV A;  1KIX A;  4QJF A;  1RIP A;  4FDB A;  3GTG H;  1VQC A;  1M90 C;  4PZ6 A;  3U50 C;  4YCW A;  3S1R H;  1VQO A;  3KFU A;  1Q82 C;  1TWC H;  2FXQ A;  3KJP A;  4DV5 L;  4A3B H;  2UUB L;  4DV2 L;  5GRO A;  3BZK A;  1N33 Q;  3GO5 A;  2JA5 G;  4OX9 L;  1VQ7 A;  1D8L A;  3RLN A;  1GM5 A;  4LF6 L;  1SR3 A;  3M85 A;  4GN5 A;  3UE0 A;  4DUZ Q;  3MEF A;  2BA1 A;  4GOP C;  1KXL A;  5GAE C;  4A3J H;  1HR0 L;  4LF9 L;  4DR5 L;  2CQO A;  1OXV A;  4DV4 L;  4UY8 C;  1YVC A;  2OTJ A;  1EWI A;  1X3G A;  2E8G A;  2UXB L;  2UXC Q;  3JC6 6;  1HZ9 A;  2NN6 G;  4DKA C;  4C2M H;  5IE8 A;  2B29 A;  4JI3 L;  4YWM A;  4HJ7 A;  4GLA C;  1QZH A;  4HJ9 A;  1EYG A;  3NEN A;  4P73 A;  2PMZ E;  1VQ9 A;  4B3R Q;  3HOV G;  3RLF A;  5C44 G;  1K8G A;  1I6H H;  1YHA A;  4YCV A;  1YIJ A;  1QVG A;  1A0I A;  2K14 A;  3J80 c;  2JA8 H;  3S17 H;  2R7F A;  3ULL A;  4DR3 L;  1XMQ Q;  4OWX B;  5HGQ A;  3BU2 A;  3CCR A;  4LF8 Q;  4LFB Q;  4YHH L;  4JC0 A;  1VQ8 A;  4APV A;  2Q2I A;  4NXN Q;  3TRZ A;  4LF5 Q;  1SE8 A;  3BZC A;  2IHF A;  1IBK L;  3A0J A;  3GTM H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...