1JJGA

Solution structure of myxoma virus protein m156r
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
102
structure length
102
Chain Sequence
b'MTVIKPSSRPRPRKNKNIKVNTYRTSAMDLSPGSVHEGIVYFKDGIFKVRLLGYEGHECILLDYLNYRQDTLDRLKERLVGRVIKTRVVRADGLYVDLRRFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M156R
publication title Myxoma virus immunomodulatory protein M156R is a structural mimic of eukaryotic translation initiation factor eIF2alpha.
pubmed doi rcsb
source organism Myxoma virus (strain lausanne)
molecule tags Viral protein
total genus 8
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2001-07-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1jjgA00
1YHBA 3UDXA 4EX5A 3OTOL 1LUZA 4L5SA 4A76A 3CQZH 4R4QA 3S16H 1RL2A 2F3IA 3EBEA 2E2JH 4KHZA 2UXDQ 1UEBA 3A5UA 2NN6G 3BZKA 2K52A 1X56A 2VS1A 4PZ6A 3K0XA 2ZM6L 5M3FG 2ID0A 3J7A5 1AH9A 3E9HA 3I4OA 5IYCG 1WCMH 4DV3L 4C3HH 5FJ8G 1VQ5A 3HOVH 5JJLA 2HIXA 2RHQB 1UE5A 3NELA 1YNXA 1PV4A 3PSIA 1KAWA 3FKIG 3HOXH 5C0XI 3PO2G 3UE1A 1JJCB 3DM3A 3I4MG 4L5TA 4HJ7A 2UU9Q 1O7IA 2OQKA 3U50C 1XJVA 2R93H 3GTJH 2WFWA 1K9MC 3KJPA 1E7ZA 1NBWA 1Q8KA 4MZ9A 3CCMA 4HJ5A 4A3JG 4A3GG 1VCIA 2D0OA 3HOZG 2ZJPA 3KYHC 2B63H 2UXDL 1GO3E 2R7FA 1G51A 1NTGA 2N3SA 2E8GA 2XGTA 2DGYA 1IZ6A 4H02A 3GTMH 4L5QA 2AKWB 2N8NA 4ALPA 1I5FA 4QL5A 5IP7H 3S2DH 4DR5L 1MKHA 2JEAI 2OTLA 3HOWG 4A3KH 1Y1WH 3PV0A 2IHEA 1Q1EA 4TVAB 2UU9L 4K0KQ 3ZJYC 1YEZA 4B3RQ 3KF6B 1IBMQ 2Q2UA 1NE3A 2WAQE 2YV5A 4P75A 4DR7Q 2EXDA 1M90C 3IRBA 4AQYQ 4QJFA 2E2HH 4A3DG 3GO5A 1DGSA 4BBRH 3CCRA 3M4OH 1L1OB 1A62A 4A4IA 2QEXA 3HOYH 2H5XA 1T9HA 1X9NA 2WAQG 4A3EH 4DR2Q 2CWPA 1S3OA 1KRTA 3RZOH 1PA6A 3CPWA 1X3GA 1SROA 4IOCA 1HZAA 1UE1A 1CKNA 4IFDJ 4DPGA 1Q1BA 4GNXC 4A93H 1HNZQ 5HY6A 4K0KL 2ZTDA 5C3EH 4B3RL 1IBML 4DR7L 3RN2A 4QY7A 1TWCH 2F4VQ 4P73A 1R9TH 4AQYL 1J5EQ 2RCNA 4GNXA 3JAMi 3HFZB 2ZJRA 3J80i 4DR3Q 1JT8A 2OQ0A 2K14A 3A0JA 1Q82C 5LMUQ 1Q86C 4GS3A 3CMEA 2RF4A 1QZHA 1KXLA 2MFIA 1XPOA 1OXTA 2VQFQ 4A3CH 1GD7A 4DR2L 3B6YA 4LF9Q 3TQYA 3L7ZC 1G6PA 2Q2TA 4DV0Q 1G291 4BY1G 4YCWA 3GTPH 4AYBE 2ASBA 3CF5A 1HNZL 2VUMG 2GVAA 2K5NA 3STBD 2R7ZG 5FLXc 4QIWE 2WB1E 4R4OA 4DKAC 1EQQA 1YVCA 1SR3A 1GKHA 1E1OA 4GLVB 3JC66 3CCSA 1KIXA 2F4VL 4BBSH 1K83H 4RG1A 2CCZA 3S1MH 1J5EL 4DR3L 4Y52H 4AYBG 4DV7Q 3BJUA 2JA7H 5LMUL 3L0OA 3TS0A 1OXXK 4JI1Q 2WB1G 5GAHC 2KCTA 5IY0A 4HIMA 2VQFL 4DK6C 3JAMc 5GADC 3J80c 2EIFA 3CCJA 4LF9L 1BBWA 2Z6KC 4LF8Q 2JE6I 1L0WA 4R4IA 3ULLA 1HZ9A 3UE0A 1PH6A 3G71A 2Z0SA 4DV0L 3A5ZB 4C2MH 1JE5A 3EIVA 3CC2A 1B7YB 1WJJA 2BH2A 1A8VA 4GKJQ 4NPSA 3ULPA 4OWTB 3MEFA 3OYYA 1XTDA 4IJHA 4NXMQ 2Z6KA 4OO1I 1U0LA 2N78A 2R92G 4GOPB 1GM5A 1PH7A 4P74A 1ASYA 1XPUA 4WJ4A 3MXNB 4POFA 1L2FA 3PUXA 4DV7L 2E2IH 2MQHA 1SFOH 1FVIA 2JA6G 2NZHA 4JI1L 3CCLA 4IPDA 1KRSA 2JA6H 4JI0Q 2I5LX 3A74A 3PUYA 5C4XG 4LF8L 1CSPA 3G48A 5IP9G 4DAMA 3H15A 4OWWB 2YTYA 3K7AH 3PF4A 4X64Q 1VQFA 2PQAA 5M5YH 3GTLH 1JMCA 1PH9A 5IT9c 4IO9A 1TWHH 1V1QA 2UUBQ 4GKJL 5M3FH 3E0EA 3H0GG 4UP8A 5C0XG 1TWFH 1PH8A 5J3BA 1KD1C 4LF4Q 4AIMA 5IYCH 3BZCA 2VL6A 1I3QH 5FJ8H 4JBMA 2IX1A 2AHOB 1C7YA 2KENA 3D0FA 1V9PA 1YITA 4DV4Q 1IXRA 1I94Q 1E24A 3FKIH 1OTCA 3PO2H 1M1KC 1VQKA 4LFBQ 3TREA 2BA1A 1VQJA 3PUZA 4JI0L 1N33Q 1Q46A 3I4MH 1VQHA 2K5VA 3AFQA 1H95A 1VQPA 4IPHA 5GQOA 4JI5Q 4ME3A 4X64L 1Q7YC 2OTJA 4A3JH 1LYLA 1EFWA 1ASZA 5H1SE 4A3GH 3NENA 3HOZH 2B3GA 1XMQQ 3RNUA 3RLFA 3T1YL 1HR0Q 3GTQH 2UUBL 3M7NA 4PZ8A 3I55A 4IJLA 5FLMG 2A8VA 2K5HA 1KQSA 1K8GA 4X66Q 4LF4L 4HIOA 1BBUA 1VQ8A 3AEVA 4BXXG 1PYSB 1FGUA 4PMWA 1VS0A 3RZDH 1UE6A 4DV4L 1I94L 3I56A 3H3VH 1X6OA 2ZJQA 4LFBL 2IT1A 3HOWH 3CCEA 2OCEA 1HNXQ 3CD6A 2GVBA 1N33L 2I5HA 1MJEA 1Q81C 1JB7A 1CSQA 4DAYB 1EIFA 4A3LG 1K3RA 1YIJA 4NXML 1HNWQ 1EYGA 2ZTCA 4JI5L 3I4NG 3DLLA 1KC8C 4C3JH 5JJKA 1B70B 1YHAA 3Q8DA 3U58A 4X65Q 1NY4A 1XMQL 2F52A 1AE3A 4P71A 1QUQB 1VQCA 4EQ5A 1HR0L 4LFCQ 4A3DH 1IYJB 1Y14B 4X66L 3K7UC 3I2ZA 2VQEQ 4DR6Q 1PYBA 1VQ4A 4LUVA 1VQLA 3HKZE 1EOVA 1WYDA 3J81j 4QGUA 4JI3Q 1NJIC 3AFPA 1C9OA 4JOIC 5DLQE 5BR8Q 3CXCA 2D0PA 1X55A 4DV6Q 4GLXA 4A3FG 4A3MG 4Y7NH 2E5LQ 2VNUD 4WJ3M 1HNXL 3AYHB 4P72A 3CW2C 5HGQA 2V1CC 1EIYB 3HKZG 2ES2A 1HNWL 1Z9FA 2VY3A 3G6EA 2MO0A 3KF8B 4X65L 2YTXA 4R4CA 2MNAA 3PO3G 3RLNA 3PCOB 1PH4A 1D7QA 1PFSA 4JCVE 4LFCL 4HJ8A 1A63A 1YHQA 1YBYA 1HR0W 1LTLA 4DR6L 5M3MG 2WP8J 2VQEL 4A3IG 4JV5Q 3CMAA 2IY5B 5JJIA 2PQAB 4JI3L 4OONA 3PF5A 4BY7G 3W1BA 2UUCQ 4OX9Q 3EN2A 3J7ZC 3PIPA 1UWVA 1NMGA 4OWXB 5BR8L 4DV2Q 3GTGH 4OO1G 1HJPA 4DV6L 2E5LL 3HOUG 4DR4Q 2B29A 1Q12A 2NVTH 2UXCQ 3GD7A 4BY1H 2D62A 3CPFA 1VQDA 3ER0A 2VUMH 3S1NH 1E3PA 2R7ZH 2AWOA 4DV5Q 1PH3A 2QA4A 2JA8G 2A1AA 3M9BA 4X6AH 2Q2IA 3KDFA 5C4JH 2K50A 1N9WA 5JEAG 1K8AC 1Y1VG 3CAMA 1N36Q 5EAYA 1L1OC 3CCUA 4JV5L 1C0AA 5C0XJ 5IYDG 1I50H 1P8LA 2JA9A 5ELNA 4IFDI 3KF6A 2EQSA 2UUCL 1P16A 4YY3Q 4DV1Q 2I0QA 4OX9L 1VQ7A 4KHPQ 4DUZQ 2NVYH 4DV2L 1YJWA 5GROA 3OW2A 5IYBG 4JI2Q 1QVFA 4JI7Q 2IHFA 4BA1I 2NVQH 5C44G 2MO1A 1FL0A 3L2PA 4DR4L 4YCVA 5M5WH 4DK3C 1RIPA 2DUDA 1YI2A 3GDEA 3OTOQ 1QZGA 2UXCL 1KHIA 1BVSA 2HT1A 1N8RC 2NVXH 4UPAA 1I6HH 4DV5L 2A19A 3LGJA 5GAGC 4LF6Q 1Z47A 2JA5G 1V43A 2JEBI 4LF5Q 4A3BG 4LW1A 2NZOA 3M85A 3U4ZA 2R92H 2HHHQ 2CFMA 3GTOH 2ZTEA 3F2DA 4X62Q 4DNIA 1N36L 1IBKQ 3I7FA 3D31A 1CKOA 1HH2P 1SE8A 2LSSA 2YYZA 4YY3L 4DV1L 4KHPL 5C4XH 1VQIA 3F8TA 4DUZL 4LWCA 1OXVA 5IP9H 3FP9A 4JI2L 4JI7L 4IOAA 4HIKA 1CKNB 4GKKQ 5IWAQ 2UXBQ 4JYAQ 1WCMG 2C35B 4XIGS 3HOVG 1VQ6A 1VQBA 5IE8A 4LUOA 2JJQA 4PG3A 4IPCA 3H0GH 4LF6L 2NN6I 4LF5L 1X54A 3TEHB 3HOXG 4GLAC 3PUVA 2L15A 4YWKA 2HHHL 1W2BA 3F2CA 4GNXB 4X62L 2CQOA 2I5MX 4YWMA 4JI6Q 1IBKL 4DUYQ 1FJGQ 3U4VA 2R93G 3ICEA 2ALYB 4DR5Q 1TXYA 4JG2A 2FXQA 4GN5A 2BH8A 2B63G 2KBNA 3NBHB 5LMNQ 4GKKL 2UXBL 5IWAL 3CCQA 1PVOA 2KHIA 2GN5A 4JYAL 4OXPA 2YTVA 2IX0A 4MNOA 3F2BA 1EWIA 4DR1Q 3S2HH 5FLMH 3PIOA 3PUWA 5AJ3Q 5IP7G 4B3SQ 2OWOA 1CKMA 3CC7A 1PH5A 4A75A 4GOPC 4A3KG 1Y1WG 4BA2I 3KFUA 4BXXH 3BU2A 3KJOA 4JI6L 4B3TQ 1QVCA 4DUYL 1FJGL 1D8LA 1K0RA 3VDYA 1AE2A 3H3VI 1EQRA 3KDFB 4TQUS 1U5KA 1N34Q 3RN5A 3W5OA 3K80C 1VQMA 4YHHQ 1HZBA 4GOPA 4A3LH 1OXSC 1XPRA 1HZCA 4JBJA 4BBRG 3I4NH 5LMNL 4LF7Q 3NEMA 2VW9A 1VQAA 1TWGH 1IBLQ 1OXUA 3HOYG 3ERSX 4NB3A 4LNQA 4LFAQ 4O2DA 4DR1L 4A3EG 4NXNQ 1CUKA 4L5RC 5AJ3L 3S15H 4FDBA 1N32Q 4B3SL 4UP7A 1YZ6A 1XNQQ 1X3EA 2K4KA 4O0AA 4UP9A 3S24A 3RLOA 1VQNA 4YCUA 3S1RH 2UUAQ 3TRZA 4A93G 3AQQA 1W3SA 3CC4A 2K75A 4B3TL 5JEAJ 3RR5A 3UDIA 4A3FH 1IL2A 4JOIA 4A3MH 4QQBX 1E1TA 1UE7A 2LXKA 1X3FA 5C3EG 4POGA 5E7NA 4JBKA 3J81i 1YJNA 1N34L 3ULJA 3S1QH 1NMFA 3HKSA 2AMCB 1A0IA 4YHHL 3S17H 1LM0A 1X65A 1BKBA 2PI2E 4B3MQ 2R7DA 1WOCA 2RHSB 4HJ9A 4LF7L 1EUJA 4XTCS 4JI8Q 5LMNW 1IBLL 2ATWA 3M4QA 5K36G 3PO3H 2LXJA 4HJAA 2XTIA 1PHJA 4LFAL 1JJ2A 2PNHA 4R4TA 4NXNL 4A3CG 4R1JA 4HIDA 3M3YH 4IPGA 5M3MH 4A3IH 1N32L 1XNQL 3E9IA 3TS2A 2Y0SE 4APVA 4UY8C 4BY7H 1VQOA 1XMOQ 1SMXA 2UUAL 2KCMA 2Q2HA 2R6GA 3UDFA 4YWLA 4AH6A 2YU9H 3HOUH 4JI4Q 4KI0A 1GVPA 1SN8A 3G4SA 3PGZA 2AWNA 3S14H 1TWAH 3T1HQ 1VQ9A 1XNRQ 4BBSG 2Y0SG 1MIUA 4GN3B 4B3ML 2JA8H 3KLWA 1SLJA 5ELOA 2JA7G 4JI8L 5M5XH 4C3IH 3J81c 1QVGA 1WFQA 1VQEA 3STBC 1VQGA 4JBWA 4IFDG 1MJCA 3KOJA 2HIVA 3T1YQ 1Y1VH 1J6QA 2CKZB 1L1OA 2KHJA 2N49A 3SGIA 3WWVA 2CWAA 5IYDH 1XMOL 3K8AA 4JC0A 3F1ZA 3GTKH 1WI5A 2BA0A 1QUQA 5IYBH 3UDGA 2PMZE 4JI4L 5C44H 2ZM6Q 1K73C 2JK8A 3W1GA 3T1HL 4DV3Q 3K81C 1XNRL 2QGQA 1E22A 2HQLA 4LUZA 3M4PA 3CP0A 1YJ9A 1PH1A 1S72A 3FHWA 1B8AA 4RMFA 2JA5H 4A3BH 4GN4B 1S40A 4PZ7A 4J15A 5GAEC 1JJGA 1KL9A 1SRUA 2JQOA 2VZAA 4KLKA 3CCVA 4MTNA 2PI2A 1PH2A
chains in the Genus database with same CATH superfamily
3G6JB 2EYLA 1WCMB 2F0LA 3E3XA 4L5SA 3HOVB 2A6HD 3I91A 3S16H 3EJIA 3D3RA 3EBEA 4KHZA 1SNQA 1UEBA 2P5ZX 2UXDQ 2NN6G 3BZKA 4L63B 2KA7A 1WTWA 4K6DA 4DV3L 4C3HH 5KNBA 3E6ZX 1VQ5A 2HIXA 1UE5A 3GTJB 5C0XI 4S3SA 2K04A 5CV8A 3I4MG 1O7IA 4TSSA 1CZGA 2R93H 4L6TB 1PZKD 5FLXL 1K9MC 4CDCC 1PTOC 1Q8KA 4HJ5A 1VCIA 2D0OA 3HOZG 3N6RA 3VR3A 4CJ2C 2ZJPA 1GO3E 4X3UA 1SNDA 5JPMC 3GTMH 1B3AA 3TDQA 2AKWB 4ALPA 1MBYA 5IP7H 4NW2A 4MIUA 4KN4C 1LT6D 2D5DA 3HOWG 2A69D 2IHEA 3OWEB 3M4OB 5C6AA 4K0KQ 2RCFA 3ZJYC 3ZYYX 4C3JG 4B3RQ 1H9RA 1IBMQ 4CHTB 2EXDA 5AFWA 1M90C 1F2MA 2QCPX 4AQYQ 4BBRH 3BZDB 4EQPA 2EYMA 2QEXA 3G7LA 2B8FA 3EVQA 5DM73 4XT1B 2CWPA 3CPWA 1SROA 1HZAA 2CQAA 4DPGA 1Q1BA 1RKNA 4GNXC 2A74C 1HNZQ 1EY7A 5IT9L 4XXEA 3RN2A 2F4VQ 1EY8A 3OIQA 1J5EQ 2X6GA 3J80i 3K5MA 2K14A 4B08A 2IPKD 1I4QA 2RF4A 1QE6A 1I4PA 1XPOA 1OXTA 4ODGA 4A3CH 4LF9Q 3Q23A 3TQYA 3X3NA 3NBHA 2Y0SB 4BBSB 1I4RA 3MEHA 3GTPH 1STGA 4RGMA 5FLXc 5J22A 3K5NA 4R4OA 1EQQA 1SR3A 4GLVB 5EPLA 1K83H 3S1MH 1GHJA 4TKOB 4DV7Q 1D1IA 3BJUA 2JA7H 4IFDH 4JI1Q 5EPJA 2KCTA 2L5TA 3JAMc 3IFTA 4EVOA 3KBXA 4J6HA 2JN4A 4R4IA 2Z0SA 3OMGA 1JE5A 3EIVA 3D6WA 1CA6A 2K03A 2BH2A 4OWTB 2C9OA 5JOBA 1U0LA 3A7LA 2XRQD 4GOPB 3T13A 4P74A 3TZDA 2L12A 4C56C 1EY0A 1H9MA 4FYDA 1L2FA 5M5YB 2NZHA 3GTLB 1ESRA 1PDQA 4JI0Q 3A74A 1Z6HA 5M3FB 4QUFA 3K7AH 1RHPA 2YTYA 2DY8A 1SNOA 2PQAA 3ND9A 1JMCA 5IT9c 1TVXA 1TWHH 3FKIB 2NN6H 3MVVA 4UP8A 3H0GG 4NXML 2IWHA 1KD1C 3BZCA 1PRTB 4JBMA 2AHOB 3OMCA 1JWUD 3D0FA 4DV4Q 4A3JB 1I94Q 1JR0D 1SSOA 1DD2A 2HDLA 3PUZA 3BS1A 3I4MH 3S2DB 3V2TA 1CHPD 1E2VA 4IPHA 1EYAA 2PZWA 3PQIA 1EFWA 2I07B 3RZDB 3HOZH 4BWGB 3RNUA 3GTQH 4IJLA 1KQSA 1AEXA 1VQ8A 4BXXG 3J81L 2MGSA 3H3VH 4LFBL 2IT1A 3HOWH 3CCEA 2GVBA 1JICA 1N33L 3BDCA 3DWQA 1CSQA 4DAYB 1XXGA 1K3RA 1HNWQ 2KEDA 4JI5L 4C3JH 4DNRB 3GV3A 4X65Q 4QMGA 2F52A 1S4ZA 4HN7A 4Y7NB 2K5WA 1Y14B 4DR6Q 3K7UC 5I6YA 3NSWA 4ULLA 3D4DA 3QG1A 5HURA 4K6LA 1C9OA 4ZKBB 4JOIC 1RTOA 4A3MG 1X55A 2E5LQ 2K5QA 5D3IB 2FINB 3U9OA 3CW2C 5HGQA 2V1CC 1EIYB 4H0LC 2AUKA 3DWAA 4IURA 3G6EA 2MO0A 4F87A 2YTXA 2Q8TA 3RLNA 2MJ8A 3PCOB 1RTNA 4HJ8A 1YHQA 1YBYA 3HZXA 2EYFA 5CYUA 5JJIA 1BCPF 2PQAB 1TT2A 3S1NB 2UUCQ 3U9SA 3GTGH 1HJPA 4DV6L 3HOUG 1ZXTA 3K5LA 2LMCB 2NVTH 1EZ8A 1LO5D 3CPFA 2F0VA 3NP8A 1K28A 4MTKA 2QA4A 3SXHA 3KLRA 2NVYB 5C4JH 5EKIA 1Y1VG 1N36Q 4KY5A 4G4KA 5IGBA 5M5WB 3FVQA 1QWYA 1DM0B 1S5CD 1I50H 4IFDI 1EQTA 1S5ED 1I6HB 4DV1Q 4KHPQ 1BCPC 2MUYA 1YJWA 3OW2A 5G3LF 4BA1I 2R92B 2MO1A 3L2PA 3GTOB 1QZGA 1KHIA 2NYZD 4IUPA 1PTOH 1BR9A 2A19A 5C5MA 4A3BG 2BE5D 4WRDA 1YNJD 1G91A 1AFPA 3F2DA 3LWUA 1CZWA 1MSHA 4DXGA 5JVH3 2EXZA 2K7VA 1WTPA 3H09A 4XDXA 5CMDA 1H9JA 3SHLA 1BNZA 3TP7A 2SEBD 5E3FA 5JAVA 4GKKQ 4RHRA 3AU7A 4JYAQ 3LNNA 4K2LA 3H0GH 2NN6I 1X54A 4K14A 3TEHB 4K8IA 4GLAC 4YWKA 2L15A 3Q24A 2CQOA 2F0IA 3IL8A 4DUYQ 2CH4W 1FJGQ 4ZUIA 2NZ1D 1HPCA 2FXQA 1Y8PB 2B63G 3T4AC 1I6VC 3QIAA 2KCCA 1DJRD 1G2TA 1SE4A 4N8X1 1X3QA 3BDLA 3GQBA 3PIOA 2OWOA 1CKMA 4DFAA 1CTMA 4A3KG 5FLXE 1Y1WG 4BA2I 4BXXH 2RVLA 2WACA 1WTHA 4B3TQ 2A68C 3EFXD 1STEA 2Z1CA 1B9MA 3H3VI 2AQ3B 3AB9A 1U5KA 3S15B 4XYOA 4YHHQ 4JW0A 1OXSC 4ZQ3A 3MXNA 5LMNL 4LF7Q 3NEMA 4LNQA 4A3EG 4NXNQ 1CUKA 2PO4A 5AJ3L 1ENCA 1PRTD 2B2UA 4HTHA 2K4KA 4YCUA 3AQQA 4E6IA 2Z8LA 4IUNA 3RR5A 4A3MH 1UE7A 1X3FA 5C3EG 3SK5A 1N34L 5M3MB 1XTCD 1X65A 4A3IB 1A15A 1SYDA 3P1HA 4XTCS 2LXJA 4HJAA 2XTIA 4LFAL 1NSNS 2HUGA 1JJ2A 1B9NA 5D65A 4RCNA 5M9OA 1XNQL 5IT9E 4APVA 1DOMA 2F0NA 1JOQA 2UUAL 2JA8B 3DEPA 1STHA 5C4ZA 4RHSA 3C3LA 2YU9H 3HOUH 2K5DA 3G4SA 4CJ1B 1TWAH 3T1HQ 1XNRQ 4JK1C 4B3ML 3KLWA 5M5XH 1BCPD 4JBWA 2AQ1B 1KLGD 3QB3A 1Y1VH 5C44B 5I4DA 2JYOA 1J6QA 1L1OA 1FD7D 2CWAA 1CT1D 1ZKOA 2F3VA 3K8AA 1WI5A 2BA0A 1TS2A 3HP3A 1W6JA 2H1EA 2XWBB 2NTTA 4DV3Q 2QGQA 3BVZA 1YJ9A 1PH1A 4HCSA 3DUZA 1S72A 1ZEQX 2AQ2B 4A3BH 4J15A 2E2JB 4KLKA 5EBCA 4K5VA 1KABA 2SNSA 1LUZA 3CRLC 4A76A 3CQZH 3KF8A 5IOCA 2F3IA 1OO9B 2A6HC 3HOXB 5TSSA 4IUUA 1EY9A 2ZM6L 1S5BD 1STYA 1AH9A 3I4OA 2J4XA 1SJED 5IYCG 2JP1A 4LJZC 1AW7A 3NELA 2LS01 1YNXA 1KAWA 2XNAC 3D8GA 1EYDA 1L0YB 3MC0B 1SXTA 4HJ7A 3U50C 1E7ZA 3CCMA 3KYHC 5FO7B 2B63H 1JORA 3FMCA 4B9WA 2E8GA 2DGYA 4PQXA 2CHBD 4F88A 2N8NA 5I9OA 3S2DH 2F0GA 4QCLA 3I72A 2OTLA 4A3KH 1Y1WH 3PV0A 1Q1EA 3CHBD 1K0SA 1TIID 3HOYB 1CFMA 4RGTA 2WAQE 2YV5A 4DF7A 3A56A 3RZOB 2E2HH 3J81E 1L1OB 1WTQA 4A93B 1F9RA 1T9HA 1SEBD 4A3EH 1GUGA 2RQXA 4ZKCB 1X3GA 1TS5A 1TWCB 4IOCA 1R9TB 1D5MC 1G2SA 3D6CA 5CC4A 3NTKA 2EPBA 5C3EH 2KVMA 2Q8RE 4DR7L 4QY7A 1SYFA 1X32A 4M1UB 1D1KA 1JT8A 4GNXA 3JAMi 1LACA 2D9UA 1Q82C 5T1IA 3CMEA 1KXLA 1ICFB 2HCCA 5C4HA 1VMPA 3L7ZC 1G6PA 1LTSD 2WKDA 3I90A 2DY7A 1G291 4AYBE 2ASBA 3CF5A 2VUMG 3NTHA 2GVAA 4DKAC 1D5XC 1KIXA 3CCSA 1Y8NB 3FRPB 4FO2A 2ZT9C 4FXGC 5KNDA 3TS0A 2WB1G 4HIMA 4DK6C 4YIJA 1BBWA 1BUVT 2Z6KC 2MHVA 3R2TA 4DV0L 1LT3D 3A5ZB 4C2MH 1B7YB 1F2YA 4QUCA 1SFOB 3ULPA 1ET9A 4NXMQ 1XTDA 3T51B 2JA6B 1PH7A 4ZCKA 3A8JE 1TS3A 4POFA 2TMPA 4MN3A 3TP8A 1BBXC 3CCLA 5C4XG 1IW7D 1TWFB 3N52A 2OF1A 1CSPA 3G48A 5KNCA 4U68A 5L37A 3NUCA 1O7YA 1I3QB 3PF4A 5E4XA 1HTLD 2EYPA 3QOJA 1Y8OB 3VYTA 3PO2B 2R61A 4IUTA 2PZTA 1PVOA 3VYRA 5IYCH 3BYYB 4HMIA 1DCZA 5D3DA 3VA7A 1VF7A 1V9PA 1YITA 4A3GB 1OTCA 3DXJC 2J7ZA 1VQKA 4LFBQ 1KNAA 1N33Q 1Q46A 1VQHA 1H95A 2F0WA 1VQPA 2X6LA 2Z4IA 3R3OA 1WTRA 4JI5Q 2HCIA 4X64L 1Q7YC 1LYLA 4IUVA 4OEMB 4G7ZC 3NENA 3O13A 2UUBL 3I55A 4RKBA 4G7OC 1SNCA 3K5OA 5KYIA 2L55A 1X3PA 1ZYRD 4PMWA 1VS0A 1X6OA 2ZJQA 3CD6A 4KV6A 4A3DB 1MJEA 3EA6A 4HSVA 1EIFA 2FHTA 4A3LG 1YIJA 3I4NG 5JJKA 3Q8DA 2WAQB 1UAPA 3U58A 1R4QB 2K05A 1XMQL 2G5DA 1QUQB 3QJYA 1HR0L 1IYJB 4X66L 3C2PA 3HKZE 1EOVA 1WYDA 3CKIB 3OPOA 2ZXRA 2EYHA 3AFPA 3SE0A 2D0PA 5LL6S 4DV6Q 4GLXA 2VNUD 1KLUD 4P72A 2F0TA 1SNMA 1VMCA 1AP0A 1EYCA 2F1MA 2RSNA 1H9KA 2MNAA 2Q8IB 4JCVE 4JVZA 4Z9CB 1TU2B 4BY1B 3CMAA 4BY7G 1QNKA 4OONA 3PF5A 2R7ZB 2ENBA 3EN2A 3UI2A 2GA4B 3J7ZC 3Q6SA 2F0KA 3PIPA 4OWXB 1NMGA 1IKMA 4KJNA 4U673 2B29A 1H9SA 1VQDA 3ER0A 4AYBB 2VUMH 1E3PA 2ZXPA 1QB5D 1PH3A 4OIKA 2A1AA 2WV6D 3FPPA 2Q2IA 4C3IG 1MSGA 2K50A 1EY6A 1N9WA 3R8BA 2B2WA 2NVQB 1F9QA 2KOLA 2KCNA 5EAYA 1C0AA 2JA9A 2NVXB 3KF6A 2EQSA 2E2IB 4OX9L 1BXTA 3C1EA 3I73A 3VR6A 2F3WA 1SE2A 4DR4L 4OO1G 3HRZC 1YI2A 1RIPA 2DUDA 3J7AF 2MPMA 1LTAD 5EGTA 1QNUA 3VYUA 1CQVA 4UPAA 4DV5L 2JA5G 2JEBI 2NZOA 3IAYA 5CV6A 2BE5C 1FNWA 3U4ZA 1YNJC 1GOZA 2C5CA 3I7FA 1RODA 1CKOA 4FF4A 1KAAA 1SE8A 4ABNA 2ICEC 1VQIA 5C4XH 1VF5C 3FP9A 4JI7L 4HIKA 5C5LA 2V4DA 1WCMG 4RGOS 1F77A 4XIGS 1PZID 1FNVA 3HOVG 5ELEA 1VQBA 5IE8A 2JJQA 1RD9D 4PG3A 2F0SA 1PXUA 2HHHL 4XQQA 3F2CA 4X62L 3C46A 1IBKL 2F0PA 2PZUA 3U4VA 2H4OA 4DR5Q 4JG2A 4GZYC 4KTAA 2B39A 3NBHB 3SK4A 5LMNQ 5IWAL 3CCQA 3D4RA 5EQ0A 1EWCA 1EWIA 5IGCA 3S2HH 1PRTF 3PUWA 5AJ3Q 1JB3A 3CC7A 1PH5A 4GOPC 3V05A 4JI6L 1TWGB 1PFBA 1QVCA 1D8LA 3VDYA 1AE2A 2A5HA 1G6ZA 1N34Q 3RN5A 2QW7A 4A3LH 1XPRA 1HZCA 3I4NH 1CK1A 1VQAA 1OXUA 1Q8IA 1CM9A 4LFAQ 4A3FB 4KN7C 1CQFA 4L5RC 2QDLA 4N8FA 1AZQA 4UP7A 4XYQA 1XNQQ 4O0AA 3DEOA 3RLOA 1PRTC 3HKZB 3TBIB 3S1RH 2UUAQ 3TRZA 1W3SA 2K75A 4G57A 3UDIA 1WD1A 2LXKA 3PO3B 4KK7A 4POGA 4JBKA 1STBA 3S1QH 1A6XA 1U9RA 3ULJA 5HGTA 2K01A 3M3YB 3KLSA 3S17H 1A0IA 1LM0A 4B3MQ 1BKBA 2R7DA 1WOCA 2RHSB 4RAUC 2NBFA 2ATWA 2KUMA 3I3CA 3VR2A 4H7BA 4RWSC 4HIDA 3S14B 5F2DA 1N32L 4BY7H 3VR4A 4FF3A 2KCMA 4YWLA 1SN8A 3Q0AA 4F7XA 2AWNA 1VQ9A 4BBSG 2Y0SG 1T5EA 5EKKA 5ELOA 4DU9A 2CW0D 1BOSA 4JI8L 3J81c 4C3IH 1QVGA 1SYBA 3GTKB 3STBC 3OIPA 4IUQA 1MJCA 2CKZB 2DN8A 3F1ZA 3ERQA 3ONAB 4HCEA 2ZM6Q 4OO1H 3DMUA 3W1GA 4FXKC 4NMZA 4CDFC 2O5IC 3CP0A 1IYVA 3FHWA 1B8AA 4RMFA 2JA5H 5I6WA 3S16B 1I4HA 4PZ7A 2HD3A 1KL9A 1JJGA 4IN3A 2JQOA 2VZAA 1RF2D 3T1YL 1VQMA 2XVSA 3UDXA 3LWEA 4C3HB 4R4QA 1K8MA 5CR3A 1TQOA 3A5UA 3L3OC 4PZ6A 5M3FG 1PYWD 1QG7A 2ID0A 3J7A5 5LHY1 1WCMH 1A2UA 3HOVH 2RHQB 2R93B 3FKIG 3UE1A 4PNYA 1O7LA 1JJCB 2RSOA 3DM3A 1U4RA 4L5TA 4UAIA 2G9DA 2OQKA 4ZK9B 5K5PA 5A2QL 2QILA 3GTJH 1AN8A 3GTMB 3KJPA 1NBWA 5FO8B 4A3JG 5CGKA 1F2LA 4K5XA 4MHEA 3VR5A 1NTGA 3H94A 2XGTA 3OWFA 1EOTA 2O4XA 4L5QA 5C3XA 5IODA 4DR5L 4KMUC 3TSSA 1MKHA 4I7ZC 4ZAIA 4TVAB 5EKLA 4BBRB 1WTOA 2UU9L 1YEZA 4RGNA 1NE3A 4DR7Q 3IRBA 4CGYB 2RBMA 4K5WA 3R93A 2M00A 3NWTA 5BN5A 3GO5A 3CCRA 3M4OH 1ILQA 2EOTA 1F9SA 4A4IA 3FEWX 2H5XA 1B3QA 1X9NA 2ICIA 3MZ5A 1PA6A 3R2IA 4DN4M 1CKNA 3D4WA 3DM1A 4ZRZA 1EU4A 5E1FA 4LMQD 1EEID 2PYKA 1EFID 2CH4A 2G9HD 4I65A 4FF1A 1DXMA 4IALA 1SE3A 2OQ0A 4ILWA 2OEOA 1DYQA 2DJFC 4CKCA 1Q86C 4GS3A 3GTPB 1QZHA 1SYCA 1GD7A 1SMYD 2B2YA 4DR2L 5ELCA 3T53B 2Q2TA 1K83B 3S1MB 4DV0Q 4FF2A 4DXFA 5I2XA 2F4IA 1SYEA 2JA7B 2K5NA 3STBD 1SBBB 1ESFA 1YVCA 2LFNA 1GKHA 2L1BA 1E1OA 1FYCA 4BBSH 4DR3L 1YNND 3BVGA 1U4PA 5LMUL 4QIWB 3L0OA 2L11A 5J1ZA 1HQRD 5GAHC 1I4XA 1IKLA 1SJHD 2VQFL 2K1BA 2EIFA 3BYTB 2IL8A 3BDOA 1K3BC 4KD3A 1HZ9A 1PH6A 2QKIC 1B44D 3MHBA 1UNSA 3CC2A 1WJJA 1A8VA 4NPSA 1ENFA 3MEFA 3MWYW 4IJHA 2Z6KA 1M8AA 2X69A 4CKBA 4OO1I 2R92G 1GM5A 4WJ4A 1XPUA 1UUPA 3MXNB 4RA8A 1ICWA 3HGBA 3K7AB 1R4PB 3PUXA 2E2IH 1FVIA 5ELBA 1LABA 1TWHB 1KRSA 4LF8L 4DAMA 1IW7C 2OT2A 3H15A 4OWWB 4DNTB 4X64Q 2EY5A 3NXWA 5M5YH 1FR3A 3GTLH 2NWGA 3MAQA 1PH9A 4IO9A 2TSSA 2B2TC 2UUBQ 4GKJL 1LTRD 5M3FH 1PH8A 1JC7A 5E4WC 5KGUA 1QILA 4AIMA 3I4MB 3SK8A 1M4VA 1Q90A 2IX1A 1C7YA 2KENA 3EROA 2DJGC 3F2UA 1HQMC 3GP7A 3FKIH 3NBIA 5C0XH 3HOZB 1M1KC 2RDHA 3TREA 2BA1A 3GTQB 1VQJA 2K5VA 2DNCA 4OIJA 5GQOA 4ME3A 1AZPA 1O80A 2OTJA 3ND8A 4A3JH 5JVG3 5H1SE 2R3ZA 1STNA 2B3GA 3SK6A 3W2DA 1XMQQ 1HR0Q 4PZ8A 4WORA 2A8VA 2K5HA 5IGEA 3HOWB 4X66Q 4LF4L 4HIOA 1BBUA 1NR2A 1LTID 1O7ZA 1PYSB 1FGUA 1T5XD 3RZDH 1UE6A 1ZYRC 4C3JB 2Z4HA 1B1ZA 2I5HA 1HA6A 2JXMB 2F0HA 2ZTCA 4F8MA 3DLLA 2M9VA 5D14A 2EY1A 1ONLA 3RMHA 4KKUA 4EQ5A 3P7JA 3TN2A 2B2UC 1D5ZC 3RD4A 3ITPA 4QGUA 3J80E 1A3UA 1PFMA 1NJIC 1FGBD 1RDPD 3EQLC 4Y7NH 4WJ3M 1HNXL 2E2DC 5EBDA 2JSOA 1S5FD 4K2KA 2ES2A 1B53A 4G7HC 2BCOA 3SDZA 3KF8B 4R4CA 3K0YA 1SYGA 3GTGB 3BVMA 1PH4A 4N9TA 4LFCL 2K28A 2L4NA 4ZYSA 1LTLA 4HEDA 5M3MG 2WP8J 2VQEL 4A3IG 2IY5B 2NVTB 5FOBB 3MTSA 3A55A 4JI3L 3W1BA 4OX9Q 2QF7A 1UWVA 5BR8L 5IGFA 3NPPA 4DR4Q 5C4JB 2WKCA 1U4LA 2D62A 3S1NH 2AWOA 4DV5Q 2JA8G 1I50B 2QDBA 5CBEE 1K8AC 5IGDA 1L1OC 4JV5L 4DGZA 5C0XJ 1IHZA 1P8LA 4Y52H 2EY2A 1PTOB 1P16A 2I0QA 1VQ7A 2VB2X 2NVYH 1I4GA 4DV2L 5GROA 4JI7Q 2I46A 1EZ6A 5C44G 1XX8A 1FL0A 4YCVA 5M5WH 2UXCL 3OTOQ 1BVSA 2HT1A 1N8RC 1I6HH 4V0BA 1NUCA 1B4OA 3LGJA 5GAGC 1Z47A 3MFGA 4LW1A 1JOOA 4TRDA 2R92H 3H91A 1PFNA 2HHHQ 2CFMA 3GTOH 3KUPA 4DNIA 4X62Q 2BDNA 1IBKQ 1JE4A 3MXPA 3D31A 4C1NI 2LSSA 4YY3L 1V1PA 4OGQC 3H0GB 4DUZL 1QCBD 1OXVA 4LWCA 3K59A 4JI2L 1PTOF 4IOAA 1C48A 1VDZA 5IWAQ 4PMBA 2C35B 4WJWA 1CA5A 1Y69U 4ZLTF 4LUOA 4LF6L 4LF5L 3HOXG 4H44C 4UHVA 1DOLA 4OHJA 1W2BA 2O2LD 4GNXB 4HR7B 2I5MX 4EGVA 1L0XB 2K6AA 2WIIB 4JI6Q 1DOKA 3ICEA 2ALYB 1TXYA 2BH8A 1KDBA 4CKEA 2F0EA 1WD0A 2UXBL 2GN5A 2KHIA 3VA5A 2YTVA 2IX0A 4MNOA 2A6EC 1STAA 3F2BA 4RFBA 4LAAA 1Q3LA 5A2QE 3FDTA 1HTPA 3VYSA 1A3TA 1IYUA 1TKWB 3JAML 4DAPA 1MHWC 3K80C 4GOPA 1IL8A 2NUCA 4JBJA 4XQJA 2VW9A 2MP1A 3HOYG 3ERSX 4NB3A 4N9PA 2E76C 4O2DA 4A3MB 4L8JA 4DR1L 2K32A 3S15H 1N32Q 1GXDC 4B3SL 1VQNA 4UP9A 3S24A 2Z6BA 4A93G 2VB3X 1IL2A 5JEAJ 1F2ZA 4JOIA 4QQBX 1E1TA 4HSPA 4KD4A 5E7NA 3J81i 2EYJA 1YJNA 1NMFA 2PI2E 4J1MA 4J8QA 1IBLL 4JI8Q 5LMNW 5K36G 3M4QA 2RKSA 4XT3B 1V1PB 2YU9B 2CVRA 3E0JA 4ID6A 4I7AA 4R4TA 3HOUB 4IPGA 2B2VC 5M3MH 4A3IH 1K8OA 3A7AB 1TWAB 3TS2A 1W6KA 4UY8C 1TY0A 4RCOA 1SMXA 2PPBC 2Q2HA 3M4YA 2PW7A 1Z7TA 3UDFA 4AH6A 5M5XB 4FXDA 1GVPA 3PGZA 1LV9A 1Y1VB 2JA8H 4KKTA 4NDXA 1BDOA 1VQEA 1VQGA 2CW0C 4QF4A 3T1YQ 4B9XA 1C4QA 3NTIA 4DAYA 2KHJA 3WWVA 4XQNA 4RKLA 4CBVA 3CU7A 1XMOL 2B8GA 1MI2A 4JC0A 2EJMA 4A3BB 3UDGA 2PMZE 4JI4L 2F0FA 5C44H 3K58A 2JK8A 1UEAB 2HQLA 4LUZA 5DEHA 3M4PA 1LT4D 2KJXA 3CQZB 3QR8A 2KQ3A 4GN4B 5GAEC 3RUZA 1SRUA 5T1GA 4MTNA 2JA6G 2PI2A 1EU3A 1YHBA 2N88A 4EX5A 3OTOL 1RL2A 2IJ0A 3FPUB 2E2JH 1HFGA 5IIFA 2K52A 1X56A 2VS1A 3K0XA 3I4LA 3E9HA 1EEFD 3K6OA 5FJ8G 5JPNC 5JJLA 1QOHA 1PV4A 4DK0A 3PSIA 3HOXH 3PO2G 4NP5A 3LX0A 5EPKA 2B63B 1KNEA 2UU9Q 1O78A 1XJVA 2KEEA 2A6ED 1PTOD 2WFWA 5BN4A 4MZ9A 3WOEA 5KRUA 4A3GG 5J39A 2UXDL 4IZ8A 1LT5D 2R7FA 1G51A 4A3KB 2N3SA 1Y1WB 1H9SB 4R8NA 3OSOA 1IZ6A 4H02A 4HAEA 2XRSD 2EJGC 2PNRC 3L9AX 4C1NK 3J80L 1I5FA 4QL5A 1ML0D 3HEJA 2JEAI 2E2HB 3HG9A 3QO2A 3TP6A 5FK9C 3KF6B 2Q2UA 4P75A 4A3EB 3J7AV 2KHSA 3P20A 4QJFA 4A3DG 1DGSA 1HHVA 2F0MA 1A62A 3HOYH 1B2TA 1GUOA 2RA4A 1NR4A 1B50A 2WAQG 4DR2Q 5C3EB 1BCPB 1S3OA 1PLFA 1KRTA 3RZOH 5ELFA 2BDOA 1UE1A 1LTTD 4IFDJ 1D6EC 4A93H 1RJTA 4QB4A 5HY6A 4K0KL 2ZTDA 2F0UA 2RDGA 2FFKB 4B3RL 1IBML 1TWCH 4KY7A 4P73A 1R9TH 4AQYL 3Q22A 1PZJD 2RCNA 3HFZB 2XN9C 3QWNA 2ZJRA 4DR3Q 1BF4A 3A0JA 5K36H 5LMUQ 1GUNA 2O5JC 2MFIA 2VQFQ 2DNEA 3B6YA 1EWHA 1SMYC 1HXYD 2EE1A 5COYA 4BY1G 4YCWA 3A8IE 4K8JA 2EVBA 1HNZL 1GHKA 2R7ZG 2J0TD 5ELDA 4X3TA 4QIWE 2WB1E 1J8IA 2EZVA 2K33A 1ILPA 3JC66 2F4VL 5CORA 4RG1A 2CCZA 2B2WC 5FKAC 1J5EL 4PMCA 1LLRD 4AYBG 4C2MB 4EQOA 1YNNC 3KLSX 3MFYA 1OXXK 1CI3M 2RDFA 5IY0A 3I8ZA 4CDDC 5GADC 3J80c 3CCJA 1C8CA 4LF9L 1V8QA 4LF8Q 2JE6I 1L0WA 3ULLA 3UE0A 3G71A 4NKLA 1JCKB 2PMZB 4GKJQ 2HDMA 3OYYA 2XWJB 2N78A 3PIP3 3V96A 1ASYA 2A73B 2F03A 4DV7L 2MQHA 1SFOH 1TY2A 4JI1L 1S5DD 4IPDA 2OXPA 3WDNA 2JA6H 2I5LX 3PUYA 3GV6A 5IP9G 1JQYD 2WINB 1SNPA 2FJ2A 1VQFA 3WOFA 4DA2A 5IGGA 3CRKC 3HS0C 1V1QA 3SVMA 1XYIA 3OOCA 3E0EA 5C0XG 1TWFH 5J3BA 3URYA 4LF4Q 2VL6A 5I9PA 1I3QH 5FJ8H 1WTXA 1NAPA 5FO9B 1IXRA 1E24A 2B2TA 3OW7A 3PO2H 4JI0L 3AFQA 4DAVA 2SOBA 1ASZA 4A3GH 2IW3A 3PMFA 3RLFA 2EJFC 3M7NA 5FLMG 1K8GA 2SNMA 4OELB 5ISRA 5KYLA 1TS4A 3AEVA 4WFN3 3W3AA 1ENAA 4DV4L 1I94L 3I56A 1DONA 3MXGA 1G8ZD 1HNXQ 2OCEA 2PW5A 3SR1A 1Q81C 1JB7A 3S9WA 1EYGA 3NWSA 1KC8C 1B70B 1YHAA 1PMRA 4BS9A 1NY4A 5JJZA 3TMEA 1AE3A 4P71A 1VQCA 4A3DH 4LFCQ 1NCVA 2VQEQ 3I2ZA 1E2WA 1PYBA 1VQ4A 4LUVA 1VQLA 3JAME 4JI3Q 3J81j 4ZUJA 3A8KE 3DWPA 5DNFA 2L9HA 4KHVA 5BR8Q 5DLQE 4FP5D 3CXCA 4A3FG 3AYHB 3IKJA 3HKZG 1HNWL 2SDFA 4FNFA 1Z9FA 2VY3A 3NHHA 1ET6A 4X65L 3PO3G 1LTBD 1D7QA 1PFSA 1A63A 1HR0W 1A3VA 4DR6L 4JV5Q 2LKVA 1V1OA 1EIHA 5KEEA 2VUMB 1II3A 2F0JA 4ME5A 1E0BA 1WTVA 4DV2Q 3M7GA 2XIWA 2E5LL 4KJOA 5C3WA 4PV1C 3QOLA 1Q12A 2UXCQ 2EYOA 3GD7A 4BY1H 3DHQA 2R7ZH 3TP5A 2WB1B 3M9BA 4X6AH 1FNUA 2D2CC 3KDFA 4CJ0B 5JEAG 3CAMA 4JPBW 1HRJA 3CCUA 1QJOA 2LY7A 2PCFB 5IYDG 1RCVD 5ELNA 3NE5B 4O42A 2UUCL 4YY3Q 3MXUA 4DUZQ 1QVFA 4OL7A 4JI2Q 5IYBG 2NVQH 2IHFA 3NK9A 3J7YW 4DK3C 3GDEA 1HFNA 4O1NA 4R9WA 2NVXH 1HCZA 4LF6Q 1V43A 3KBGA 4LF5Q 3M85A 5C4XB 2ZTEA 1N36L 2FMCA 1HH2P 1LTGD 1SAPA 2N55A 2YYZA 3P75A 4DV1L 4KHPL 1GUWA 3F8TA 2E75C 5IP9H 4X3KA 1CKNB 2UXBQ 1XWEA 5G3LD 4C3HG 1BQQT 3OHXC 5CV4A 1VQ6A 4IPCA 2XSCA 4LK1C 3PUVA 1HUMA 2QEJC 3C1FA 2EY6A 3IFDA 4YWMA 2NTSA 1EQVA 4DK1A 1JWMD 2R93G 2E74C 5CV5A 1GUTA 1BO0A 3A54A 3S2HB 4GN5A 5NUCA 1GUSA 2KBNA 1JWSD 4GKKL 1SDFA 4JYAL 4OXPA 3T56B 5I2YA 1DZ1A 1KDCA 5LL6X 4DR1Q 5FLMH 2NB0A 5IP7G 1KTKA 4B3SQ 4UDUC 4A75A 3KFUA 2A68D 3BU2A 3I4NB 3KJOA 2FMMA 4DUYL 2KECA 1FJGL 1K0RA 5A35A 1EQRA 3KDFB 4TQUS 3W5OA 1HZBA 4P2CB 3NQIA 2A69C 4BBRG 1TWGH 2VXWA 1EY4A 3S1RB 4RH6A 1IBLQ 4V190 2F0OA 1GJXA 2F0QA 1MGSA 3BG3A 4FDBA 4Q5VA 3S1QB 1YZ6A 1HA5A 1X3EA 3S17B 4R8IA 3PIO3 5EJWA 1U4MA 2IX3A 3CC4A 4B3TL 5KIXA 5BN3A 4A3FH 2HQEA 1EL0A 1A2TA 3E5SA 2M2LA 3I70A 3HKSA 2AMCB 4YHHL 2EDGA 1F9PA 4HJ9A 4BY7B 4LF7L 1HUNA 1CHQD 1EUJA 3PO3H 1PHJA 4KY6A 4HMJA 3H3VC 2B2YC 2PNHA 4NXNL 4Q0FA 4R1JA 5CV7A 2Z9HA 3M3YH 4A3CG 3E9IA 2Y0SE 1WVLA 1VQOA 1XMOQ 3TZUA 2AUJD 5CBAE 3NQTA 2R6GA 1E2ZA 4C3IB 1J9OA 4JI4Q 4CDEC 4KI0A 2B2VA 1MD2D 4FVMA 3S14H 3MA2B 2ZXOA 1D2BA 1MIUA 2BOSA 4GN3B 1SLJA 1EIGA 2JA7G 4IFDG 1WFQA 4IQZA 3AMUA 3T16A 3KOJA 2HIVA 5JEAH 4X3SA 5DM63 2N49A 2L0CA 3SGIA 1JOKA 5IYDH 4EQNA 2F0DA 1EY5A 3GTKH 2JA5B 1QUQA 5IYBH 5DAUA 2PQEA 3X3MA 1K73C 1TR5A 4KKSA 3T1HL 3K81C 1XNRL 1E22A 1KDAA 3H6MA 1S40A 4M8AA 4H13C 3SEBA 3KK7A 5CV9A 1NNXA 3CCVA 1PH2A 3K57A
chains in the Genus database with same CATH topology
1YHBA 3UDXA 4EX5A 3OTOL 1LUZA 4L5SA 4A76A 3CQZH 4R4QA 3S16H 1RL2A 2F3IA 3EBEA 2E2JH 4KHZA 2UXDQ 1UEBA 3A5UA 2NN6G 3BZKA 2K52A 1X56A 2VS1A 4PZ6A 3K0XA 2ZM6L 5M3FG 2ID0A 3J7A5 1AH9A 3E9HA 3I4OA 5IYCG 1WCMH 4DV3L 4C3HH 5FJ8G 1VQ5A 3HOVH 5JJLA 2HIXA 2RHQB 1UE5A 3NELA 1YNXA 1PV4A 3PSIA 1KAWA 3FKIG 3HOXH 5C0XI 3PO2G 3UE1A 1JJCB 3DM3A 3I4MG 4L5TA 4HJ7A 2UU9Q 1O7IA 2OQKA 3U50C 1XJVA 2R93H 3GTJH 2WFWA 1K9MC 3KJPA 1E7ZA 1NBWA 1Q8KA 4MZ9A 3CCMA 4HJ5A 4A3JG 4A3GG 1VCIA 2D0OA 3HOZG 2ZJPA 3KYHC 2B63H 2UXDL 1GO3E 2R7FA 1G51A 1NTGA 2N3SA 2E8GA 2XGTA 2DGYA 1IZ6A 4H02A 3GTMH 4L5QA 2AKWB 2N8NA 4ALPA 1I5FA 4QL5A 5IP7H 3S2DH 4DR5L 1MKHA 2JEAI 2OTLA 3HOWG 4A3KH 1Y1WH 3PV0A 2IHEA 1Q1EA 4TVAB 2UU9L 4K0KQ 3ZJYC 1YEZA 4B3RQ 3KF6B 1IBMQ 2Q2UA 1NE3A 2WAQE 2YV5A 4P75A 4DR7Q 2EXDA 1M90C 3IRBA 4AQYQ 4QJFA 2E2HH 4A3DG 3GO5A 1DGSA 4BBRH 3CCRA 3M4OH 1L1OB 1A62A 4A4IA 2QEXA 3HOYH 2H5XA 1T9HA 1X9NA 2WAQG 4A3EH 4DR2Q 2CWPA 1S3OA 1KRTA 3RZOH 1PA6A 3CPWA 1X3GA 1SROA 4IOCA 1HZAA 1UE1A 1CKNA 4IFDJ 4DPGA 1Q1BA 4GNXC 4A93H 1HNZQ 5HY6A 4K0KL 2ZTDA 5C3EH 4B3RL 1IBML 4DR7L 3RN2A 4QY7A 1TWCH 2F4VQ 4P73A 1R9TH 4AQYL 1J5EQ 2RCNA 4GNXA 3JAMi 3HFZB 2ZJRA 3J80i 4DR3Q 1JT8A 2OQ0A 2K14A 3A0JA 1Q82C 5LMUQ 1Q86C 4GS3A 3CMEA 2RF4A 1QZHA 1KXLA 2MFIA 1XPOA 1OXTA 2VQFQ 4A3CH 1GD7A 4DR2L 3B6YA 4LF9Q 3TQYA 3L7ZC 1G6PA 2Q2TA 4DV0Q 1G291 4BY1G 4YCWA 3GTPH 4AYBE 2ASBA 3CF5A 1HNZL 2VUMG 2GVAA 2K5NA 3STBD 2R7ZG 5FLXc 4QIWE 2WB1E 4R4OA 4DKAC 1EQQA 1YVCA 1SR3A 1GKHA 1E1OA 4GLVB 3JC66 3CCSA 1KIXA 2F4VL 4BBSH 1K83H 4RG1A 2CCZA 3S1MH 1J5EL 4DR3L 4Y52H 4AYBG 4DV7Q 3BJUA 2JA7H 5LMUL 3L0OA 3TS0A 1OXXK 4JI1Q 2WB1G 5GAHC 2KCTA 5IY0A 4HIMA 2VQFL 4DK6C 3JAMc 5GADC 3J80c 2EIFA 3CCJA 4LF9L 1BBWA 2Z6KC 4LF8Q 2JE6I 1L0WA 4R4IA 3ULLA 1HZ9A 3UE0A 1PH6A 3G71A 2Z0SA 4DV0L 3A5ZB 4C2MH 1JE5A 3EIVA 3CC2A 1B7YB 1WJJA 2BH2A 1A8VA 4GKJQ 4NPSA 3ULPA 4OWTB 3MEFA 3OYYA 1XTDA 4IJHA 4NXMQ 2Z6KA 4OO1I 1U0LA 2N78A 2R92G 4GOPB 1GM5A 1PH7A 4P74A 1ASYA 1XPUA 4WJ4A 3MXNB 4POFA 1L2FA 3PUXA 4DV7L 2E2IH 2MQHA 1SFOH 1FVIA 2JA6G 2NZHA 4JI1L 3CCLA 4IPDA 1KRSA 2JA6H 4JI0Q 2I5LX 3A74A 3PUYA 5C4XG 4LF8L 1CSPA 3G48A 5IP9G 4DAMA 3H15A 4OWWB 2YTYA 3K7AH 3PF4A 4X64Q 1VQFA 2PQAA 5M5YH 3GTLH 1JMCA 1PH9A 5IT9c 4IO9A 1TWHH 1V1QA 2UUBQ 4GKJL 5M3FH 3E0EA 3H0GG 4UP8A 5C0XG 1TWFH 1PH8A 5J3BA 1KD1C 4LF4Q 4AIMA 5IYCH 3BZCA 2VL6A 1I3QH 5FJ8H 4JBMA 2IX1A 2AHOB 1C7YA 2KENA 3D0FA 1V9PA 1YITA 4DV4Q 1IXRA 1I94Q 1E24A 3FKIH 1OTCA 3PO2H 1M1KC 1VQKA 4LFBQ 3TREA 2BA1A 1VQJA 3PUZA 4JI0L 1N33Q 1Q46A 3I4MH 1VQHA 2K5VA 3AFQA 1H95A 1VQPA 4IPHA 5GQOA 4JI5Q 4ME3A 4X64L 1Q7YC 2OTJA 4A3JH 1LYLA 1EFWA 1ASZA 5H1SE 4A3GH 3NENA 3HOZH 2B3GA 1XMQQ 3RNUA 3RLFA 3T1YL 1HR0Q 3GTQH 2UUBL 3M7NA 4PZ8A 3I55A 4IJLA 5FLMG 2A8VA 2K5HA 1KQSA 1K8GA 4X66Q 4LF4L 4HIOA 1BBUA 1VQ8A 3AEVA 4BXXG 1PYSB 1FGUA 4PMWA 1VS0A 3RZDH 1UE6A 4DV4L 1I94L 3I56A 3H3VH 1X6OA 2ZJQA 4LFBL 2IT1A 3HOWH 3CCEA 2OCEA 1HNXQ 3CD6A 2GVBA 1N33L 2I5HA 1MJEA 1Q81C 1JB7A 1CSQA 4DAYB 1EIFA 4A3LG 1K3RA 1YIJA 4NXML 1HNWQ 1EYGA 2ZTCA 4JI5L 3I4NG 3DLLA 1KC8C 4C3JH 5JJKA 1B70B 1YHAA 3Q8DA 3U58A 4X65Q 1NY4A 1XMQL 2F52A 1AE3A 4P71A 1QUQB 1VQCA 4EQ5A 1HR0L 4LFCQ 4A3DH 1IYJB 1Y14B 4X66L 3K7UC 3I2ZA 2VQEQ 4DR6Q 1PYBA 1VQ4A 4LUVA 1VQLA 3HKZE 1EOVA 1WYDA 3J81j 4QGUA 4JI3Q 1NJIC 3AFPA 1C9OA 4JOIC 5DLQE 5BR8Q 3CXCA 2D0PA 1X55A 4DV6Q 4GLXA 4A3FG 4A3MG 4Y7NH 2E5LQ 2VNUD 4WJ3M 1HNXL 3AYHB 4P72A 3CW2C 5HGQA 2V1CC 1EIYB 3HKZG 2ES2A 1HNWL 1Z9FA 2VY3A 3G6EA 2MO0A 3KF8B 4X65L 2YTXA 4R4CA 2MNAA 3PO3G 3RLNA 3PCOB 1PH4A 1D7QA 1PFSA 4JCVE 4LFCL 4HJ8A 1A63A 1YHQA 1YBYA 1HR0W 1LTLA 4DR6L 5M3MG 2WP8J 2VQEL 4A3IG 4JV5Q 3CMAA 2IY5B 5JJIA 2PQAB 4JI3L 4OONA 3PF5A 4BY7G 3W1BA 2UUCQ 4OX9Q 3EN2A 3J7ZC 3PIPA 1UWVA 1NMGA 4OWXB 5BR8L 4DV2Q 3GTGH 4OO1G 1HJPA 4DV6L 2E5LL 3HOUG 4DR4Q 2B29A 1Q12A 2NVTH 2UXCQ 3GD7A 4BY1H 2D62A 3CPFA 1VQDA 3ER0A 2VUMH 3S1NH 1E3PA 2R7ZH 2AWOA 4DV5Q 1PH3A 2QA4A 2JA8G 2A1AA 3M9BA 4X6AH 2Q2IA 3KDFA 5C4JH 2K50A 1N9WA 5JEAG 1K8AC 1Y1VG 3CAMA 1N36Q 5EAYA 1L1OC 3CCUA 4JV5L 1C0AA 5C0XJ 5IYDG 1I50H 1P8LA 2JA9A 5ELNA 4IFDI 3KF6A 2EQSA 2UUCL 1P16A 4YY3Q 4DV1Q 2I0QA 4OX9L 1VQ7A 4KHPQ 4DUZQ 2NVYH 4DV2L 1YJWA 5GROA 3OW2A 5IYBG 4JI2Q 1QVFA 4JI7Q 2IHFA 4BA1I 2NVQH 5C44G 2MO1A 1FL0A 3L2PA 4DR4L 4YCVA 5M5WH 4DK3C 1RIPA 2DUDA 1YI2A 3GDEA 3OTOQ 1QZGA 2UXCL 1KHIA 1BVSA 2HT1A 1N8RC 2NVXH 4UPAA 1I6HH 4DV5L 2A19A 3LGJA 5GAGC 4LF6Q 1Z47A 2JA5G 1V43A 2JEBI 4LF5Q 4A3BG 4LW1A 2NZOA 3M85A 3U4ZA 2R92H 2HHHQ 2CFMA 3GTOH 2ZTEA 3F2DA 4X62Q 4DNIA 1N36L 1IBKQ 3I7FA 3D31A 1CKOA 1HH2P 1SE8A 2LSSA 2YYZA 4YY3L 4DV1L 4KHPL 5C4XH 1VQIA 3F8TA 4DUZL 4LWCA 1OXVA 5IP9H 3FP9A 4JI2L 4JI7L 4IOAA 4HIKA 1CKNB 4GKKQ 5IWAQ 2UXBQ 4JYAQ 1WCMG 2C35B 4XIGS 3HOVG 1VQ6A 1VQBA 5IE8A 4LUOA 2JJQA 4PG3A 4IPCA 3H0GH 4LF6L 2NN6I 4LF5L 1X54A 3TEHB 3HOXG 4GLAC 3PUVA 2L15A 4YWKA 2HHHL 1W2BA 3F2CA 4GNXB 4X62L 2CQOA 2I5MX 4YWMA 4JI6Q 1IBKL 4DUYQ 1FJGQ 3U4VA 2R93G 3ICEA 2ALYB 4DR5Q 1TXYA 4JG2A 2FXQA 4GN5A 2BH8A 2B63G 2KBNA 3NBHB 5LMNQ 4GKKL 2UXBL 5IWAL 3CCQA 1PVOA 2KHIA 2GN5A 4JYAL 4OXPA 2YTVA 2IX0A 4MNOA 3F2BA 1EWIA 4DR1Q 3S2HH 5FLMH 3PIOA 3PUWA 5AJ3Q 5IP7G 4B3SQ 2OWOA 1CKMA 3CC7A 1PH5A 4A75A 4GOPC 4A3KG 1Y1WG 4BA2I 3KFUA 4BXXH 3BU2A 3KJOA 4JI6L 4B3TQ 1QVCA 4DUYL 1FJGL 1D8LA 1K0RA 3VDYA 1AE2A 3H3VI 1EQRA 3KDFB 4TQUS 1U5KA 1N34Q 3RN5A 3W5OA 3K80C 1VQMA 4YHHQ 1HZBA 4GOPA 4A3LH 1OXSC 1XPRA 1HZCA 4JBJA 4BBRG 3I4NH 5LMNL 4LF7Q 3NEMA 2VW9A 1VQAA 1TWGH 1IBLQ 1OXUA 3HOYG 3ERSX 4NB3A 4LNQA 4LFAQ 4O2DA 4DR1L 4A3EG 4NXNQ 1CUKA 4L5RC 5AJ3L 3S15H 4FDBA 1N32Q 4B3SL 4UP7A 1YZ6A 1XNQQ 1X3EA 2K4KA 4O0AA 4UP9A 3S24A 3RLOA 1VQNA 4YCUA 3S1RH 2UUAQ 3TRZA 4A93G 3AQQA 1W3SA 3CC4A 2K75A 4B3TL 5JEAJ 3RR5A 3UDIA 4A3FH 1IL2A 4JOIA 4A3MH 4QQBX 1E1TA 1UE7A 2LXKA 1X3FA 5C3EG 4POGA 5E7NA 4JBKA 3J81i 1YJNA 1N34L 3ULJA 3S1QH 1NMFA 3HKSA 2AMCB 1A0IA 4YHHL 3S17H 1LM0A 1X65A 1BKBA 2PI2E 4B3MQ 2R7DA 1WOCA 2RHSB 4HJ9A 4LF7L 1EUJA 4XTCS 4JI8Q 5LMNW 1IBLL 2ATWA 3M4QA 5K36G 3PO3H 2LXJA 4HJAA 2XTIA 1PHJA 4LFAL 1JJ2A 2PNHA 4R4TA 4NXNL 4A3CG 4R1JA 4HIDA 3M3YH 4IPGA 5M3MH 4A3IH 1N32L 1XNQL 3E9IA 3TS2A 2Y0SE 4APVA 4UY8C 4BY7H 1VQOA 1XMOQ 1SMXA 2UUAL 2KCMA 2Q2HA 2R6GA 3UDFA 4YWLA 4AH6A 2YU9H 3HOUH 4JI4Q 4KI0A 1GVPA 1SN8A 3G4SA 3PGZA 2AWNA 3S14H 1TWAH 3T1HQ 1VQ9A 1XNRQ 4BBSG 2Y0SG 1MIUA 4GN3B 4B3ML 2JA8H 3KLWA 1SLJA 5ELOA 2JA7G 4JI8L 5M5XH 4C3IH 3J81c 1QVGA 1WFQA 1VQEA 3STBC 1VQGA 4JBWA 4IFDG 1MJCA 3KOJA 2HIVA 3T1YQ 1Y1VH 1J6QA 2CKZB 1L1OA 2KHJA 2N49A 3SGIA 3WWVA 2CWAA 5IYDH 1XMOL 3K8AA 4JC0A 3F1ZA 3GTKH 1WI5A 2BA0A 1QUQA 5IYBH 3UDGA 2PMZE 4JI4L 5C44H 2ZM6Q 1K73C 2JK8A 3W1GA 3T1HL 4DV3Q 3K81C 1XNRL 2QGQA 1E22A 2HQLA 4LUZA 3M4PA 3CP0A 1YJ9A 1PH1A 1S72A 3FHWA 1B8AA 4RMFA 2JA5H 4A3BH 4GN4B 1S40A 4PZ7A 4J15A 5GAEC 1JJGA 1KL9A 1SRUA 2JQOA 2VZAA 4KLKA 3CCVA 4MTNA 2PI2A 1PH2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YHB A;  3UDX A;  4EX5 A;  3OTO L;  1LUZ A;  4L5S A;  4A76 A;  3CQZ H;  4R4Q A;  3S16 H;  1RL2 A;  2F3I A;  3EBE A;  2E2J H;  4KHZ A;  2UXD Q;  1UEB A;  3A5U A;  2NN6 G;  3BZK A;  2K52 A;  1X56 A;  2VS1 A;  4PZ6 A;  3K0X A;  2ZM6 L;  5M3F G;  2ID0 A;  3J7A 5;  1AH9 A;  3E9H A;  3I4O A;  5IYC G;  1WCM H;  4DV3 L;  4C3H H;  5FJ8 G;  1VQ5 A;  3HOV H;  5JJL A;  2HIX A;  2RHQ B;  1UE5 A;  3NEL A;  1YNX A;  1PV4 A;  3PSI A;  1KAW A;  3FKI G;  3HOX H;  5C0X I;  3PO2 G;  3UE1 A;  1JJC B;  3DM3 A;  3I4M G;  4L5T A;  4HJ7 A;  2UU9 Q;  1O7I A;  2OQK A;  3U50 C;  1XJV A;  2R93 H;  3GTJ H;  2WFW A;  1K9M C;  3KJP A;  1E7Z A;  1NBW A;  1Q8K A;  4MZ9 A;  3CCM A;  4HJ5 A;  4A3J G;  4A3G G;  1VCI A;  2D0O A;  3HOZ G;  2ZJP A;  3KYH C;  2B63 H;  2UXD L;  1GO3 E;  2R7F A;  1G51 A;  1NTG A;  2N3S A;  2E8G A;  2XGT A;  2DGY A;  1IZ6 A;  4H02 A;  3GTM H;  4L5Q A;  2AKW B;  2N8N A;  4ALP A;  1I5F A;  4QL5 A;  5IP7 H;  3S2D H;  4DR5 L;  1MKH A;  2JEA I;  2OTL A;  3HOW G;  4A3K H;  1Y1W H;  3PV0 A;  2IHE A;  1Q1E A;  4TVA B;  2UU9 L;  4K0K Q;  3ZJY C;  1YEZ A;  4B3R Q;  3KF6 B;  1IBM Q;  2Q2U A;  1NE3 A;  2WAQ E;  2YV5 A;  4P75 A;  4DR7 Q;  2EXD A;  1M90 C;  3IRB A;  4AQY Q;  4QJF A;  2E2H H;  4A3D G;  3GO5 A;  1DGS A;  4BBR H;  3CCR A;  3M4O H;  1L1O B;  1A62 A;  4A4I A;  2QEX A;  3HOY H;  2H5X A;  1T9H A;  1X9N A;  2WAQ G;  4A3E H;  4DR2 Q;  2CWP A;  1S3O A;  1KRT A;  3RZO H;  1PA6 A;  3CPW A;  1X3G A;  1SRO A;  4IOC A;  1HZA A;  1UE1 A;  1CKN A;  4IFD J;  4DPG A;  1Q1B A;  4GNX C;  4A93 H;  1HNZ Q;  5HY6 A;  4K0K L;  2ZTD A;  5C3E H;  4B3R L;  1IBM L;  4DR7 L;  3RN2 A;  4QY7 A;  1TWC H;  2F4V Q;  4P73 A;  1R9T H;  4AQY L;  1J5E Q;  2RCN A;  4GNX A;  3JAM i;  3HFZ B;  2ZJR A;  3J80 i;  4DR3 Q;  1JT8 A;  2OQ0 A;  2K14 A;  3A0J A;  1Q82 C;  5LMU Q;  1Q86 C;  4GS3 A;  3CME A;  2RF4 A;  1QZH A;  1KXL A;  2MFI A;  1XPO A;  1OXT A;  2VQF Q;  4A3C H;  1GD7 A;  4DR2 L;  3B6Y A;  4LF9 Q;  3TQY A;  3L7Z C;  1G6P A;  2Q2T A;  4DV0 Q;  1G29 1;  4BY1 G;  4YCW A;  3GTP H;  4AYB E;  2ASB A;  3CF5 A;  1HNZ L;  2VUM G;  2GVA A;  2K5N A;  3STB D;  2R7Z G;  5FLX c;  4QIW E;  2WB1 E;  4R4O A;  4DKA C;  1EQQ A;  1YVC A;  1SR3 A;  1GKH A;  1E1O A;  4GLV B;  3JC6 6;  3CCS A;  1KIX A;  2F4V L;  4BBS H;  1K83 H;  4RG1 A;  2CCZ A;  3S1M H;  1J5E L;  4DR3 L;  4Y52 H;  4AYB G;  4DV7 Q;  3BJU A;  2JA7 H;  5LMU L;  3L0O A;  3TS0 A;  1OXX K;  4JI1 Q;  2WB1 G;  5GAH C;  2KCT A;  5IY0 A;  4HIM A;  2VQF L;  4DK6 C;  3JAM c;  5GAD C;  3J80 c;  2EIF A;  3CCJ A;  4LF9 L;  1BBW A;  2Z6K C;  4LF8 Q;  2JE6 I;  1L0W A;  4R4I A;  3ULL A;  1HZ9 A;  3UE0 A;  1PH6 A;  3G71 A;  2Z0S A;  4DV0 L;  3A5Z B;  4C2M H;  1JE5 A;  3EIV A;  3CC2 A;  1B7Y B;  1WJJ A;  2BH2 A;  1A8V A;  4GKJ Q;  4NPS A;  3ULP A;  4OWT B;  3MEF A;  3OYY A;  1XTD A;  4IJH A;  4NXM Q;  2Z6K A;  4OO1 I;  1U0L A;  2N78 A;  2R92 G;  4GOP B;  1GM5 A;  1PH7 A;  4P74 A;  1ASY A;  1XPU A;  4WJ4 A;  3MXN B;  4POF A;  1L2F A;  3PUX A;  4DV7 L;  2E2I H;  2MQH A;  1SFO H;  1FVI A;  2JA6 G;  2NZH A;  4JI1 L;  3CCL A;  4IPD A;  1KRS A;  2JA6 H;  4JI0 Q;  2I5L X;  3A74 A;  3PUY A;  5C4X G;  4LF8 L;  1CSP A;  3G48 A;  5IP9 G;  4DAM A;  3H15 A;  4OWW B;  2YTY A;  3K7A H;  3PF4 A;  4X64 Q;  1VQF A;  2PQA A;  5M5Y H;  3GTL H;  1JMC A;  1PH9 A;  5IT9 c;  4IO9 A;  1TWH H;  1V1Q A;  2UUB Q;  4GKJ L;  5M3F H;  3E0E A;  3H0G G;  4UP8 A;  5C0X G;  1TWF H;  1PH8 A;  5J3B A;  1KD1 C;  4LF4 Q;  4AIM A;  5IYC H;  3BZC A;  2VL6 A;  1I3Q H;  5FJ8 H;  4JBM A;  2IX1 A;  2AHO B;  1C7Y A;  2KEN A;  3D0F A;  1V9P A;  1YIT A;  4DV4 Q;  1IXR A;  1I94 Q;  1E24 A;  3FKI H;  1OTC A;  3PO2 H;  1M1K C;  1VQK A;  4LFB Q;  3TRE A;  2BA1 A;  1VQJ A;  3PUZ A;  4JI0 L;  1N33 Q;  1Q46 A;  3I4M H;  1VQH A;  2K5V A;  3AFQ A;  1H95 A;  1VQP A;  4IPH A;  5GQO A;  4JI5 Q;  4ME3 A;  4X64 L;  1Q7Y C;  2OTJ A;  4A3J H;  1LYL A;  1EFW A;  1ASZ A;  5H1S E;  4A3G H;  3NEN A;  3HOZ H;  2B3G A;  1XMQ Q;  3RNU A;  3RLF A;  3T1Y L;  1HR0 Q;  3GTQ H;  2UUB L;  3M7N A;  4PZ8 A;  3I55 A;  4IJL A;  5FLM G;  2A8V A;  2K5H A;  1KQS A;  1K8G A;  4X66 Q;  4LF4 L;  4HIO A;  1BBU A;  1VQ8 A;  3AEV A;  4BXX G;  1PYS B;  1FGU A;  4PMW A;  1VS0 A;  3RZD H;  1UE6 A;  4DV4 L;  1I94 L;  3I56 A;  3H3V H;  1X6O A;  2ZJQ A;  4LFB L;  2IT1 A;  3HOW H;  3CCE A;  2OCE A;  1HNX Q;  3CD6 A;  2GVB A;  1N33 L;  2I5H A;  1MJE A;  1Q81 C;  1JB7 A;  1CSQ A;  4DAY B;  1EIF A;  4A3L G;  1K3R A;  1YIJ A;  4NXM L;  1HNW Q;  1EYG A;  2ZTC A;  4JI5 L;  3I4N G;  3DLL A;  1KC8 C;  4C3J H;  5JJK A;  1B70 B;  1YHA A;  3Q8D A;  3U58 A;  4X65 Q;  1NY4 A;  1XMQ L;  2F52 A;  1AE3 A;  4P71 A;  1QUQ B;  1VQC A;  4EQ5 A;  1HR0 L;  4LFC Q;  4A3D H;  1IYJ B;  1Y14 B;  4X66 L;  3K7U C;  3I2Z A;  2VQE Q;  4DR6 Q;  1PYB A;  1VQ4 A;  4LUV A;  1VQL A;  3HKZ E;  1EOV A;  1WYD A;  3J81 j;  4QGU A;  4JI3 Q;  1NJI C;  3AFP A;  1C9O A;  4JOI C;  5DLQ E;  5BR8 Q;  3CXC A;  2D0P A;  1X55 A;  4DV6 Q;  4GLX A;  4A3F G;  4A3M G;  4Y7N H;  2E5L Q;  2VNU D;  4WJ3 M;  1HNX L;  3AYH B;  4P72 A;  3CW2 C;  5HGQ A;  2V1C C;  1EIY B;  3HKZ G;  2ES2 A;  1HNW L;  1Z9F A;  2VY3 A;  3G6E A;  2MO0 A;  3KF8 B;  4X65 L;  2YTX A;  4R4C A;  2MNA A;  3PO3 G;  3RLN A;  3PCO B;  1PH4 A;  1D7Q A;  1PFS A;  4JCV E;  4LFC L;  4HJ8 A;  1A63 A;  1YHQ A;  1YBY A;  1HR0 W;  1LTL A;  4DR6 L;  5M3M G;  2WP8 J;  2VQE L;  4A3I G;  4JV5 Q;  3CMA A;  2IY5 B;  5JJI A;  2PQA B;  4JI3 L;  4OON A;  3PF5 A;  4BY7 G;  3W1B A;  2UUC Q;  4OX9 Q;  3EN2 A;  3J7Z C;  3PIP A;  1UWV A;  1NMG A;  4OWX B;  5BR8 L;  4DV2 Q;  3GTG H;  4OO1 G;  1HJP A;  4DV6 L;  2E5L L;  3HOU G;  4DR4 Q;  2B29 A;  1Q12 A;  2NVT H;  2UXC Q;  3GD7 A;  4BY1 H;  2D62 A;  3CPF A;  1VQD A;  3ER0 A;  2VUM H;  3S1N H;  1E3P A;  2R7Z H;  2AWO A;  4DV5 Q;  1PH3 A;  2QA4 A;  2JA8 G;  2A1A A;  3M9B A;  4X6A H;  2Q2I A;  3KDF A;  5C4J H;  2K50 A;  1N9W A;  5JEA G;  1K8A C;  1Y1V G;  3CAM A;  1N36 Q;  5EAY A;  1L1O C;  3CCU A;  4JV5 L;  1C0A A;  5C0X J;  5IYD G;  1I50 H;  1P8L A;  2JA9 A;  5ELN A;  4IFD I;  3KF6 A;  2EQS A;  2UUC L;  1P16 A;  4YY3 Q;  4DV1 Q;  2I0Q A;  4OX9 L;  1VQ7 A;  4KHP Q;  4DUZ Q;  2NVY H;  4DV2 L;  1YJW A;  5GRO A;  3OW2 A;  5IYB G;  4JI2 Q;  1QVF A;  4JI7 Q;  2IHF A;  4BA1 I;  2NVQ H;  5C44 G;  2MO1 A;  1FL0 A;  3L2P A;  4DR4 L;  4YCV A;  5M5W H;  4DK3 C;  1RIP A;  2DUD A;  1YI2 A;  3GDE A;  3OTO Q;  1QZG A;  2UXC L;  1KHI A;  1BVS A;  2HT1 A;  1N8R C;  2NVX H;  4UPA A;  1I6H H;  4DV5 L;  2A19 A;  3LGJ A;  5GAG C;  4LF6 Q;  1Z47 A;  2JA5 G;  1V43 A;  2JEB I;  4LF5 Q;  4A3B G;  4LW1 A;  2NZO A;  3M85 A;  3U4Z A;  2R92 H;  2HHH Q;  2CFM A;  3GTO H;  2ZTE A;  3F2D A;  4X62 Q;  4DNI A;  1N36 L;  1IBK Q;  3I7F A;  3D31 A;  1CKO A;  1HH2 P;  1SE8 A;  2LSS A;  2YYZ A;  4YY3 L;  4DV1 L;  4KHP L;  5C4X H;  1VQI A;  3F8T A;  4DUZ L;  4LWC A;  1OXV A;  5IP9 H;  3FP9 A;  4JI2 L;  4JI7 L;  4IOA A;  4HIK A;  1CKN B;  4GKK Q;  5IWA Q;  2UXB Q;  4JYA Q;  1WCM G;  2C35 B;  4XIG S;  3HOV G;  1VQ6 A;  1VQB A;  5IE8 A;  4LUO A;  2JJQ A;  4PG3 A;  4IPC A;  3H0G H;  4LF6 L;  2NN6 I;  4LF5 L;  1X54 A;  3TEH B;  3HOX G;  4GLA C;  3PUV A;  2L15 A;  4YWK A;  2HHH L;  1W2B A;  3F2C A;  4GNX B;  4X62 L;  2CQO A;  2I5M X;  4YWM A;  4JI6 Q;  1IBK L;  4DUY Q;  1FJG Q;  3U4V A;  2R93 G;  3ICE A;  2ALY B;  4DR5 Q;  1TXY A;  4JG2 A;  2FXQ A;  4GN5 A;  2BH8 A;  2B63 G;  2KBN A;  3NBH B;  5LMN Q;  4GKK L;  2UXB L;  5IWA L;  3CCQ A;  1PVO A;  2KHI A;  2GN5 A;  4JYA L;  4OXP A;  2YTV A;  2IX0 A;  4MNO A;  3F2B A;  1EWI A;  4DR1 Q;  3S2H H;  5FLM H;  3PIO A;  3PUW A;  5AJ3 Q;  5IP7 G;  4B3S Q;  2OWO A;  1CKM A;  3CC7 A;  1PH5 A;  4A75 A;  4GOP C;  4A3K G;  1Y1W G;  4BA2 I;  3KFU A;  4BXX H;  3BU2 A;  3KJO A;  4JI6 L;  4B3T Q;  1QVC A;  4DUY L;  1FJG L;  1D8L A;  1K0R A;  3VDY A;  1AE2 A;  3H3V I;  1EQR A;  3KDF B;  4TQU S;  1U5K A;  1N34 Q;  3RN5 A;  3W5O A;  3K80 C;  1VQM A;  4YHH Q;  1HZB A;  4GOP A;  4A3L H;  1OXS C;  1XPR A;  1HZC A;  4JBJ A;  4BBR G;  3I4N H;  5LMN L;  4LF7 Q;  3NEM A;  2VW9 A;  1VQA A;  1TWG H;  1IBL Q;  1OXU A;  3HOY G;  3ERS X;  4NB3 A;  4LNQ A;  4LFA Q;  4O2D A;  4DR1 L;  4A3E G;  4NXN Q;  1CUK A;  4L5R C;  5AJ3 L;  3S15 H;  4FDB A;  1N32 Q;  4B3S L;  4UP7 A;  1YZ6 A;  1XNQ Q;  1X3E A;  2K4K A;  4O0A A;  4UP9 A;  3S24 A;  3RLO A;  1VQN A;  4YCU A;  3S1R H;  2UUA Q;  3TRZ A;  4A93 G;  3AQQ A;  1W3S A;  3CC4 A;  2K75 A;  4B3T L;  5JEA J;  3RR5 A;  3UDI A;  4A3F H;  1IL2 A;  4JOI A;  4A3M H;  4QQB X;  1E1T A;  1UE7 A;  2LXK A;  1X3F A;  5C3E G;  4POG A;  5E7N A;  4JBK A;  3J81 i;  1YJN A;  1N34 L;  3ULJ A;  3S1Q H;  1NMF A;  3HKS A;  2AMC B;  1A0I A;  4YHH L;  3S17 H;  1LM0 A;  1X65 A;  1BKB A;  2PI2 E;  4B3M Q;  2R7D A;  1WOC A;  2RHS B;  4HJ9 A;  4LF7 L;  1EUJ A;  4XTC S;  4JI8 Q;  5LMN W;  1IBL L;  2ATW A;  3M4Q A;  5K36 G;  3PO3 H;  2LXJ A;  4HJA A;  2XTI A;  1PHJ A;  4LFA L;  1JJ2 A;  2PNH A;  4R4T A;  4NXN L;  4A3C G;  4R1J A;  4HID A;  3M3Y H;  4IPG A;  5M3M H;  4A3I H;  1N32 L;  1XNQ L;  3E9I A;  3TS2 A;  2Y0S E;  4APV A;  4UY8 C;  4BY7 H;  1VQO A;  1XMO Q;  1SMX A;  2UUA L;  2KCM A;  2Q2H A;  2R6G A;  3UDF A;  4YWL A;  4AH6 A;  2YU9 H;  3HOU H;  4JI4 Q;  4KI0 A;  1GVP A;  1SN8 A;  3G4S A;  3PGZ A;  2AWN A;  3S14 H;  1TWA H;  3T1H Q;  1VQ9 A;  1XNR Q;  4BBS G;  2Y0S G;  1MIU A;  4GN3 B;  4B3M L;  2JA8 H;  3KLW A;  1SLJ A;  5ELO A;  2JA7 G;  4JI8 L;  5M5X H;  4C3I H;  3J81 c;  1QVG A;  1WFQ A;  1VQE A;  3STB C;  1VQG A;  4JBW A;  4IFD G;  1MJC A;  3KOJ A;  2HIV A;  3T1Y Q;  1Y1V H;  1J6Q A;  2CKZ B;  1L1O A;  2KHJ A;  2N49 A;  3SGI A;  3WWV A;  2CWA A;  5IYD H;  1XMO L;  3K8A A;  4JC0 A;  3F1Z A;  3GTK H;  1WI5 A;  2BA0 A;  1QUQ A;  5IYB H;  3UDG A;  2PMZ E;  4JI4 L;  5C44 H;  2ZM6 Q;  1K73 C;  2JK8 A;  3W1G A;  3T1H L;  4DV3 Q;  3K81 C;  1XNR L;  2QGQ A;  1E22 A;  2HQL A;  4LUZ A;  3M4P A;  3CP0 A;  1YJ9 A;  1PH1 A;  1S72 A;  3FHW A;  1B8A A;  4RMF A;  2JA5 H;  4A3B H;  4GN4 B;  1S40 A;  4PZ7 A;  4J15 A;  5GAE C;  1JJG A;  1KL9 A;  1SRU A;  2JQO A;  2VZA A;  4KLK A;  3CCV A;  4MTN A;  2PI2 A;  1PH2 A; 
#chains in the Genus database with same CATH topology
 3G6J B;  2EYL A;  1WCM B;  2F0L A;  3E3X A;  4L5S A;  3HOV B;  2A6H D;  3I91 A;  3S16 H;  3EJI A;  3D3R A;  3EBE A;  4KHZ A;  1SNQ A;  1UEB A;  2P5Z X;  2UXD Q;  2NN6 G;  3BZK A;  4L63 B;  2KA7 A;  1WTW A;  4K6D A;  4DV3 L;  4C3H H;  5KNB A;  3E6Z X;  1VQ5 A;  2HIX A;  1UE5 A;  3GTJ B;  5C0X I;  4S3S A;  2K04 A;  5CV8 A;  3I4M G;  1O7I A;  4TSS A;  1CZG A;  2R93 H;  4L6T B;  1PZK D;  5FLX L;  1K9M C;  4CDC C;  1PTO C;  1Q8K A;  4HJ5 A;  1VCI A;  2D0O A;  3HOZ G;  3N6R A;  3VR3 A;  4CJ2 C;  2ZJP A;  1GO3 E;  4X3U A;  1SND A;  5JPM C;  3GTM H;  1B3A A;  3TDQ A;  2AKW B;  4ALP A;  1MBY A;  5IP7 H;  4NW2 A;  4MIU A;  4KN4 C;  1LT6 D;  2D5D A;  3HOW G;  2A69 D;  2IHE A;  3OWE B;  3M4O B;  5C6A A;  4K0K Q;  2RCF A;  3ZJY C;  3ZYY X;  4C3J G;  4B3R Q;  1H9R A;  1IBM Q;  4CHT B;  2EXD A;  5AFW A;  1M90 C;  1F2M A;  2QCP X;  4AQY Q;  4BBR H;  3BZD B;  4EQP A;  2EYM A;  2QEX A;  3G7L A;  2B8F A;  3EVQ A;  5DM7 3;  4XT1 B;  2CWP A;  3CPW A;  1SRO A;  1HZA A;  2CQA A;  4DPG A;  1Q1B A;  1RKN A;  4GNX C;  2A74 C;  1HNZ Q;  1EY7 A;  5IT9 L;  4XXE A;  3RN2 A;  2F4V Q;  1EY8 A;  3OIQ A;  1J5E Q;  2X6G A;  3J80 i;  3K5M A;  2K14 A;  4B08 A;  2IPK D;  1I4Q A;  2RF4 A;  1QE6 A;  1I4P A;  1XPO A;  1OXT A;  4ODG A;  4A3C H;  4LF9 Q;  3Q23 A;  3TQY A;  3X3N A;  3NBH A;  2Y0S B;  4BBS B;  1I4R A;  3MEH A;  3GTP H;  1STG A;  4RGM A;  5FLX c;  5J22 A;  3K5N A;  4R4O A;  1EQQ A;  1SR3 A;  4GLV B;  5EPL A;  1K83 H;  3S1M H;  1GHJ A;  4TKO B;  4DV7 Q;  1D1I A;  3BJU A;  2JA7 H;  4IFD H;  4JI1 Q;  5EPJ A;  2KCT A;  2L5T A;  3JAM c;  3IFT A;  4EVO A;  3KBX A;  4J6H A;  2JN4 A;  4R4I A;  2Z0S A;  3OMG A;  1JE5 A;  3EIV A;  3D6W A;  1CA6 A;  2K03 A;  2BH2 A;  4OWT B;  2C9O A;  5JOB A;  1U0L A;  3A7L A;  2XRQ D;  4GOP B;  3T13 A;  4P74 A;  3TZD A;  2L12 A;  4C56 C;  1EY0 A;  1H9M A;  4FYD A;  1L2F A;  5M5Y B;  2NZH A;  3GTL B;  1ESR A;  1PDQ A;  4JI0 Q;  3A74 A;  1Z6H A;  5M3F B;  4QUF A;  3K7A H;  1RHP A;  2YTY A;  2DY8 A;  1SNO A;  2PQA A;  3ND9 A;  1JMC A;  5IT9 c;  1TVX A;  1TWH H;  3FKI B;  2NN6 H;  3MVV A;  4UP8 A;  3H0G G;  4NXM L;  2IWH A;  1KD1 C;  3BZC A;  1PRT B;  4JBM A;  2AHO B;  3OMC A;  1JWU D;  3D0F A;  4DV4 Q;  4A3J B;  1I94 Q;  1JR0 D;  1SSO A;  1DD2 A;  2HDL A;  3PUZ A;  3BS1 A;  3I4M H;  3S2D B;  3V2T A;  1CHP D;  1E2V A;  4IPH A;  1EYA A;  2PZW A;  3PQI A;  1EFW A;  2I07 B;  3RZD B;  3HOZ H;  4BWG B;  3RNU A;  3GTQ H;  4IJL A;  1KQS A;  1AEX A;  1VQ8 A;  4BXX G;  3J81 L;  2MGS A;  3H3V H;  4LFB L;  2IT1 A;  3HOW H;  3CCE A;  2GVB A;  1JIC A;  1N33 L;  3BDC A;  3DWQ A;  1CSQ A;  4DAY B;  1XXG A;  1K3R A;  1HNW Q;  2KED A;  4JI5 L;  4C3J H;  4DNR B;  3GV3 A;  4X65 Q;  4QMG A;  2F52 A;  1S4Z A;  4HN7 A;  4Y7N B;  2K5W A;  1Y14 B;  4DR6 Q;  3K7U C;  5I6Y A;  3NSW A;  4ULL A;  3D4D A;  3QG1 A;  5HUR A;  4K6L A;  1C9O A;  4ZKB B;  4JOI C;  1RTO A;  4A3M G;  1X55 A;  2E5L Q;  2K5Q A;  5D3I B;  2FIN B;  3U9O A;  3CW2 C;  5HGQ A;  2V1C C;  1EIY B;  4H0L C;  2AUK A;  3DWA A;  4IUR A;  3G6E A;  2MO0 A;  4F87 A;  2YTX A;  2Q8T A;  3RLN A;  2MJ8 A;  3PCO B;  1RTN A;  4HJ8 A;  1YHQ A;  1YBY A;  3HZX A;  2EYF A;  5CYU A;  5JJI A;  1BCP F;  2PQA B;  1TT2 A;  3S1N B;  2UUC Q;  3U9S A;  3GTG H;  1HJP A;  4DV6 L;  3HOU G;  1ZXT A;  3K5L A;  2LMC B;  2NVT H;  1EZ8 A;  1LO5 D;  3CPF A;  2F0V A;  3NP8 A;  1K28 A;  4MTK A;  2QA4 A;  3SXH A;  3KLR A;  2NVY B;  5C4J H;  5EKI A;  1Y1V G;  1N36 Q;  4KY5 A;  4G4K A;  5IGB A;  5M5W B;  3FVQ A;  1QWY A;  1DM0 B;  1S5C D;  1I50 H;  4IFD I;  1EQT A;  1S5E D;  1I6H B;  4DV1 Q;  4KHP Q;  1BCP C;  2MUY A;  1YJW A;  3OW2 A;  5G3L F;  4BA1 I;  2R92 B;  2MO1 A;  3L2P A;  3GTO B;  1QZG A;  1KHI A;  2NYZ D;  4IUP A;  1PTO H;  1BR9 A;  2A19 A;  5C5M A;  4A3B G;  2BE5 D;  4WRD A;  1YNJ D;  1G91 A;  1AFP A;  3F2D A;  3LWU A;  1CZW A;  1MSH A;  4DXG A;  5JVH 3;  2EXZ A;  2K7V A;  1WTP A;  3H09 A;  4XDX A;  5CMD A;  1H9J A;  3SHL A;  1BNZ A;  3TP7 A;  2SEB D;  5E3F A;  5JAV A;  4GKK Q;  4RHR A;  3AU7 A;  4JYA Q;  3LNN A;  4K2L A;  3H0G H;  2NN6 I;  1X54 A;  4K14 A;  3TEH B;  4K8I A;  4GLA C;  4YWK A;  2L15 A;  3Q24 A;  2CQO A;  2F0I A;  3IL8 A;  4DUY Q;  2CH4 W;  1FJG Q;  4ZUI A;  2NZ1 D;  1HPC A;  2FXQ A;  1Y8P B;  2B63 G;  3T4A C;  1I6V C;  3QIA A;  2KCC A;  1DJR D;  1G2T A;  1SE4 A;  4N8X 1;  1X3Q A;  3BDL A;  3GQB A;  3PIO A;  2OWO A;  1CKM A;  4DFA A;  1CTM A;  4A3K G;  5FLX E;  1Y1W G;  4BA2 I;  4BXX H;  2RVL A;  2WAC A;  1WTH A;  4B3T Q;  2A68 C;  3EFX D;  1STE A;  2Z1C A;  1B9M A;  3H3V I;  2AQ3 B;  3AB9 A;  1U5K A;  3S15 B;  4XYO A;  4YHH Q;  4JW0 A;  1OXS C;  4ZQ3 A;  3MXN A;  5LMN L;  4LF7 Q;  3NEM A;  4LNQ A;  4A3E G;  4NXN Q;  1CUK A;  2PO4 A;  5AJ3 L;  1ENC A;  1PRT D;  2B2U A;  4HTH A;  2K4K A;  4YCU A;  3AQQ A;  4E6I A;  2Z8L A;  4IUN A;  3RR5 A;  4A3M H;  1UE7 A;  1X3F A;  5C3E G;  3SK5 A;  1N34 L;  5M3M B;  1XTC D;  1X65 A;  4A3I B;  1A15 A;  1SYD A;  3P1H A;  4XTC S;  2LXJ A;  4HJA A;  2XTI A;  4LFA L;  1NSN S;  2HUG A;  1JJ2 A;  1B9N A;  5D65 A;  4RCN A;  5M9O A;  1XNQ L;  5IT9 E;  4APV A;  1DOM A;  2F0N A;  1JOQ A;  2UUA L;  2JA8 B;  3DEP A;  1STH A;  5C4Z A;  4RHS A;  3C3L A;  2YU9 H;  3HOU H;  2K5D A;  3G4S A;  4CJ1 B;  1TWA H;  3T1H Q;  1XNR Q;  4JK1 C;  4B3M L;  3KLW A;  5M5X H;  1BCP D;  4JBW A;  2AQ1 B;  1KLG D;  3QB3 A;  1Y1V H;  5C44 B;  5I4D A;  2JYO A;  1J6Q A;  1L1O A;  1FD7 D;  2CWA A;  1CT1 D;  1ZKO A;  2F3V A;  3K8A A;  1WI5 A;  2BA0 A;  1TS2 A;  3HP3 A;  1W6J A;  2H1E A;  2XWB B;  2NTT A;  4DV3 Q;  2QGQ A;  3BVZ A;  1YJ9 A;  1PH1 A;  4HCS A;  3DUZ A;  1S72 A;  1ZEQ X;  2AQ2 B;  4A3B H;  4J15 A;  2E2J B;  4KLK A;  5EBC A;  4K5V A;  1KAB A;  2SNS A;  1LUZ A;  3CRL C;  4A76 A;  3CQZ H;  3KF8 A;  5IOC A;  2F3I A;  1OO9 B;  2A6H C;  3HOX B;  5TSS A;  4IUU A;  1EY9 A;  2ZM6 L;  1S5B D;  1STY A;  1AH9 A;  3I4O A;  2J4X A;  1SJE D;  5IYC G;  2JP1 A;  4LJZ C;  1AW7 A;  3NEL A;  2LS0 1;  1YNX A;  1KAW A;  2XNA C;  3D8G A;  1EYD A;  1L0Y B;  3MC0 B;  1SXT A;  4HJ7 A;  3U50 C;  1E7Z A;  3CCM A;  3KYH C;  5FO7 B;  2B63 H;  1JOR A;  3FMC A;  4B9W A;  2E8G A;  2DGY A;  4PQX A;  2CHB D;  4F88 A;  2N8N A;  5I9O A;  3S2D H;  2F0G A;  4QCL A;  3I72 A;  2OTL A;  4A3K H;  1Y1W H;  3PV0 A;  1Q1E A;  3CHB D;  1K0S A;  1TII D;  3HOY B;  1CFM A;  4RGT A;  2WAQ E;  2YV5 A;  4DF7 A;  3A56 A;  3RZO B;  2E2H H;  3J81 E;  1L1O B;  1WTQ A;  4A93 B;  1F9R A;  1T9H A;  1SEB D;  4A3E H;  1GUG A;  2RQX A;  4ZKC B;  1X3G A;  1TS5 A;  1TWC B;  4IOC A;  1R9T B;  1D5M C;  1G2S A;  3D6C A;  5CC4 A;  3NTK A;  2EPB A;  5C3E H;  2KVM A;  2Q8R E;  4DR7 L;  4QY7 A;  1SYF A;  1X32 A;  4M1U B;  1D1K A;  1JT8 A;  4GNX A;  3JAM i;  1LAC A;  2D9U A;  1Q82 C;  5T1I A;  3CME A;  1KXL A;  1ICF B;  2HCC A;  5C4H A;  1VMP A;  3L7Z C;  1G6P A;  1LTS D;  2WKD A;  3I90 A;  2DY7 A;  1G29 1;  4AYB E;  2ASB A;  3CF5 A;  2VUM G;  3NTH A;  2GVA A;  4DKA C;  1D5X C;  1KIX A;  3CCS A;  1Y8N B;  3FRP B;  4FO2 A;  2ZT9 C;  4FXG C;  5KND A;  3TS0 A;  2WB1 G;  4HIM A;  4DK6 C;  4YIJ A;  1BBW A;  1BUV T;  2Z6K C;  2MHV A;  3R2T A;  4DV0 L;  1LT3 D;  3A5Z B;  4C2M H;  1B7Y B;  1F2Y A;  4QUC A;  1SFO B;  3ULP A;  1ET9 A;  4NXM Q;  1XTD A;  3T51 B;  2JA6 B;  1PH7 A;  4ZCK A;  3A8J E;  1TS3 A;  4POF A;  2TMP A;  4MN3 A;  3TP8 A;  1BBX C;  3CCL A;  5C4X G;  1IW7 D;  1TWF B;  3N52 A;  2OF1 A;  1CSP A;  3G48 A;  5KNC A;  4U68 A;  5L37 A;  3NUC A;  1O7Y A;  1I3Q B;  3PF4 A;  5E4X A;  1HTL D;  2EYP A;  3QOJ A;  1Y8O B;  3VYT A;  3PO2 B;  2R61 A;  4IUT A;  2PZT A;  1PVO A;  3VYR A;  5IYC H;  3BYY B;  4HMI A;  1DCZ A;  5D3D A;  3VA7 A;  1VF7 A;  1V9P A;  1YIT A;  4A3G B;  1OTC A;  3DXJ C;  2J7Z A;  1VQK A;  4LFB Q;  1KNA A;  1N33 Q;  1Q46 A;  1VQH A;  1H95 A;  2F0W A;  1VQP A;  2X6L A;  2Z4I A;  3R3O A;  1WTR A;  4JI5 Q;  2HCI A;  4X64 L;  1Q7Y C;  1LYL A;  4IUV A;  4OEM B;  4G7Z C;  3NEN A;  3O13 A;  2UUB L;  3I55 A;  4RKB A;  4G7O C;  1SNC A;  3K5O A;  5KYI A;  2L55 A;  1X3P A;  1ZYR D;  4PMW A;  1VS0 A;  1X6O A;  2ZJQ A;  3CD6 A;  4KV6 A;  4A3D B;  1MJE A;  3EA6 A;  4HSV A;  1EIF A;  2FHT A;  4A3L G;  1YIJ A;  3I4N G;  5JJK A;  3Q8D A;  2WAQ B;  1UAP A;  3U58 A;  1R4Q B;  2K05 A;  1XMQ L;  2G5D A;  1QUQ B;  3QJY A;  1HR0 L;  1IYJ B;  4X66 L;  3C2P A;  3HKZ E;  1EOV A;  1WYD A;  3CKI B;  3OPO A;  2ZXR A;  2EYH A;  3AFP A;  3SE0 A;  2D0P A;  5LL6 S;  4DV6 Q;  4GLX A;  2VNU D;  1KLU D;  4P72 A;  2F0T A;  1SNM A;  1VMC A;  1AP0 A;  1EYC A;  2F1M A;  2RSN A;  1H9K A;  2MNA A;  2Q8I B;  4JCV E;  4JVZ A;  4Z9C B;  1TU2 B;  4BY1 B;  3CMA A;  4BY7 G;  1QNK A;  4OON A;  3PF5 A;  2R7Z B;  2ENB A;  3EN2 A;  3UI2 A;  2GA4 B;  3J7Z C;  3Q6S A;  2F0K A;  3PIP A;  4OWX B;  1NMG A;  1IKM A;  4KJN A;  4U67 3;  2B29 A;  1H9S A;  1VQD A;  3ER0 A;  4AYB B;  2VUM H;  1E3P A;  2ZXP A;  1QB5 D;  1PH3 A;  4OIK A;  2A1A A;  2WV6 D;  3FPP A;  2Q2I A;  4C3I G;  1MSG A;  2K50 A;  1EY6 A;  1N9W A;  3R8B A;  2B2W A;  2NVQ B;  1F9Q A;  2KOL A;  2KCN A;  5EAY A;  1C0A A;  2JA9 A;  2NVX B;  3KF6 A;  2EQS A;  2E2I B;  4OX9 L;  1BXT A;  3C1E A;  3I73 A;  3VR6 A;  2F3W A;  1SE2 A;  4DR4 L;  4OO1 G;  3HRZ C;  1YI2 A;  1RIP A;  2DUD A;  3J7A F;  2MPM A;  1LTA D;  5EGT A;  1QNU A;  3VYU A;  1CQV A;  4UPA A;  4DV5 L;  2JA5 G;  2JEB I;  2NZO A;  3IAY A;  5CV6 A;  2BE5 C;  1FNW A;  3U4Z A;  1YNJ C;  1GOZ A;  2C5C A;  3I7F A;  1ROD A;  1CKO A;  4FF4 A;  1KAA A;  1SE8 A;  4ABN A;  2ICE C;  1VQI A;  5C4X H;  1VF5 C;  3FP9 A;  4JI7 L;  4HIK A;  5C5L A;  2V4D A;  1WCM G;  4RGO S;  1F77 A;  4XIG S;  1PZI D;  1FNV A;  3HOV G;  5ELE A;  1VQB A;  5IE8 A;  2JJQ A;  1RD9 D;  4PG3 A;  2F0S A;  1PXU A;  2HHH L;  4XQQ A;  3F2C A;  4X62 L;  3C46 A;  1IBK L;  2F0P A;  2PZU A;  3U4V A;  2H4O A;  4DR5 Q;  4JG2 A;  4GZY C;  4KTA A;  2B39 A;  3NBH B;  3SK4 A;  5LMN Q;  5IWA L;  3CCQ A;  3D4R A;  5EQ0 A;  1EWC A;  1EWI A;  5IGC A;  3S2H H;  1PRT F;  3PUW A;  5AJ3 Q;  1JB3 A;  3CC7 A;  1PH5 A;  4GOP C;  3V05 A;  4JI6 L;  1TWG B;  1PFB A;  1QVC A;  1D8L A;  3VDY A;  1AE2 A;  2A5H A;  1G6Z A;  1N34 Q;  3RN5 A;  2QW7 A;  4A3L H;  1XPR A;  1HZC A;  3I4N H;  1CK1 A;  1VQA A;  1OXU A;  1Q8I A;  1CM9 A;  4LFA Q;  4A3F B;  4KN7 C;  1CQF A;  4L5R C;  2QDL A;  4N8F A;  1AZQ A;  4UP7 A;  4XYQ A;  1XNQ Q;  4O0A A;  3DEO A;  3RLO A;  1PRT C;  3HKZ B;  3TBI B;  3S1R H;  2UUA Q;  3TRZ A;  1W3S A;  2K75 A;  4G57 A;  3UDI A;  1WD1 A;  2LXK A;  3PO3 B;  4KK7 A;  4POG A;  4JBK A;  1STB A;  3S1Q H;  1A6X A;  1U9R A;  3ULJ A;  5HGT A;  2K01 A;  3M3Y B;  3KLS A;  3S17 H;  1A0I A;  1LM0 A;  4B3M Q;  1BKB A;  2R7D A;  1WOC A;  2RHS B;  4RAU C;  2NBF A;  2ATW A;  2KUM A;  3I3C A;  3VR2 A;  4H7B A;  4RWS C;  4HID A;  3S14 B;  5F2D A;  1N32 L;  4BY7 H;  3VR4 A;  4FF3 A;  2KCM A;  4YWL A;  1SN8 A;  3Q0A A;  4F7X A;  2AWN A;  1VQ9 A;  4BBS G;  2Y0S G;  1T5E A;  5EKK A;  5ELO A;  4DU9 A;  2CW0 D;  1BOS A;  4JI8 L;  3J81 c;  4C3I H;  1QVG A;  1SYB A;  3GTK B;  3STB C;  3OIP A;  4IUQ A;  1MJC A;  2CKZ B;  2DN8 A;  3F1Z A;  3ERQ A;  3ONA B;  4HCE A;  2ZM6 Q;  4OO1 H;  3DMU A;  3W1G A;  4FXK C;  4NMZ A;  4CDF C;  2O5I C;  3CP0 A;  1IYV A;  3FHW A;  1B8A A;  4RMF A;  2JA5 H;  5I6W A;  3S16 B;  1I4H A;  4PZ7 A;  2HD3 A;  1KL9 A;  1JJG A;  4IN3 A;  2JQO A;  2VZA A;  1RF2 D;  3T1Y L;  1VQM A;  2XVS A;  3UDX A;  3LWE A;  4C3H B;  4R4Q A;  1K8M A;  5CR3 A;  1TQO A;  3A5U A;  3L3O C;  4PZ6 A;  5M3F G;  1PYW D;  1QG7 A;  2ID0 A;  3J7A 5;  5LHY 1;  1WCM H;  1A2U A;  3HOV H;  2RHQ B;  2R93 B;  3FKI G;  3UE1 A;  4PNY A;  1O7L A;  1JJC B;  2RSO A;  3DM3 A;  1U4R A;  4L5T A;  4UAI A;  2G9D A;  2OQK A;  4ZK9 B;  5K5P A;  5A2Q L;  2QIL A;  3GTJ H;  1AN8 A;  3GTM B;  3KJP A;  1NBW A;  5FO8 B;  4A3J G;  5CGK A;  1F2L A;  4K5X A;  4MHE A;  3VR5 A;  1NTG A;  3H94 A;  2XGT A;  3OWF A;  1EOT A;  2O4X A;  4L5Q A;  5C3X A;  5IOD A;  4DR5 L;  4KMU C;  3TSS A;  1MKH A;  4I7Z C;  4ZAI A;  4TVA B;  5EKL A;  4BBR B;  1WTO A;  2UU9 L;  1YEZ A;  4RGN A;  1NE3 A;  4DR7 Q;  3IRB A;  4CGY B;  2RBM A;  4K5W A;  3R93 A;  2M00 A;  3NWT A;  5BN5 A;  3GO5 A;  3CCR A;  3M4O H;  1ILQ A;  2EOT A;  1F9S A;  4A4I A;  3FEW X;  2H5X A;  1B3Q A;  1X9N A;  2ICI A;  3MZ5 A;  1PA6 A;  3R2I A;  4DN4 M;  1CKN A;  3D4W A;  3DM1 A;  4ZRZ A;  1EU4 A;  5E1F A;  4LMQ D;  1EEI D;  2PYK A;  1EFI D;  2CH4 A;  2G9H D;  4I65 A;  4FF1 A;  1DXM A;  4IAL A;  1SE3 A;  2OQ0 A;  4ILW A;  2OEO A;  1DYQ A;  2DJF C;  4CKC A;  1Q86 C;  4GS3 A;  3GTP B;  1QZH A;  1SYC A;  1GD7 A;  1SMY D;  2B2Y A;  4DR2 L;  5ELC A;  3T53 B;  2Q2T A;  1K83 B;  3S1M B;  4DV0 Q;  4FF2 A;  4DXF A;  5I2X A;  2F4I A;  1SYE A;  2JA7 B;  2K5N A;  3STB D;  1SBB B;  1ESF A;  1YVC A;  2LFN A;  1GKH A;  2L1B A;  1E1O A;  1FYC A;  4BBS H;  4DR3 L;  1YNN D;  3BVG A;  1U4P A;  5LMU L;  4QIW B;  3L0O A;  2L11 A;  5J1Z A;  1HQR D;  5GAH C;  1I4X A;  1IKL A;  1SJH D;  2VQF L;  2K1B A;  2EIF A;  3BYT B;  2IL8 A;  3BDO A;  1K3B C;  4KD3 A;  1HZ9 A;  1PH6 A;  2QKI C;  1B44 D;  3MHB A;  1UNS A;  3CC2 A;  1WJJ A;  1A8V A;  4NPS A;  1ENF A;  3MEF A;  3MWY W;  4IJH A;  2Z6K A;  1M8A A;  2X69 A;  4CKB A;  4OO1 I;  2R92 G;  1GM5 A;  4WJ4 A;  1XPU A;  1UUP A;  3MXN B;  4RA8 A;  1ICW A;  3HGB A;  3K7A B;  1R4P B;  3PUX A;  2E2I H;  1FVI A;  5ELB A;  1LAB A;  1TWH B;  1KRS A;  4LF8 L;  4DAM A;  1IW7 C;  2OT2 A;  3H15 A;  4OWW B;  4DNT B;  4X64 Q;  2EY5 A;  3NXW A;  5M5Y H;  1FR3 A;  3GTL H;  2NWG A;  3MAQ A;  1PH9 A;  4IO9 A;  2TSS A;  2B2T C;  2UUB Q;  4GKJ L;  1LTR D;  5M3F H;  1PH8 A;  1JC7 A;  5E4W C;  5KGU A;  1QIL A;  4AIM A;  3I4M B;  3SK8 A;  1M4V A;  1Q90 A;  2IX1 A;  1C7Y A;  2KEN A;  3ERO A;  2DJG C;  3F2U A;  1HQM C;  3GP7 A;  3FKI H;  3NBI A;  5C0X H;  3HOZ B;  1M1K C;  2RDH A;  3TRE A;  2BA1 A;  3GTQ B;  1VQJ A;  2K5V A;  2DNC A;  4OIJ A;  5GQO A;  4ME3 A;  1AZP A;  1O80 A;  2OTJ A;  3ND8 A;  4A3J H;  5JVG 3;  5H1S E;  2R3Z A;  1STN A;  2B3G A;  3SK6 A;  3W2D A;  1XMQ Q;  1HR0 Q;  4PZ8 A;  4WOR A;  2A8V A;  2K5H A;  5IGE A;  3HOW B;  4X66 Q;  4LF4 L;  4HIO A;  1BBU A;  1NR2 A;  1LTI D;  1O7Z A;  1PYS B;  1FGU A;  1T5X D;  3RZD H;  1UE6 A;  1ZYR C;  4C3J B;  2Z4H A;  1B1Z A;  2I5H A;  1HA6 A;  2JXM B;  2F0H A;  2ZTC A;  4F8M A;  3DLL A;  2M9V A;  5D14 A;  2EY1 A;  1ONL A;  3RMH A;  4KKU A;  4EQ5 A;  3P7J A;  3TN2 A;  2B2U C;  1D5Z C;  3RD4 A;  3ITP A;  4QGU A;  3J80 E;  1A3U A;  1PFM A;  1NJI C;  1FGB D;  1RDP D;  3EQL C;  4Y7N H;  4WJ3 M;  1HNX L;  2E2D C;  5EBD A;  2JSO A;  1S5F D;  4K2K A;  2ES2 A;  1B53 A;  4G7H C;  2BCO A;  3SDZ A;  3KF8 B;  4R4C A;  3K0Y A;  1SYG A;  3GTG B;  3BVM A;  1PH4 A;  4N9T A;  4LFC L;  2K28 A;  2L4N A;  4ZYS A;  1LTL A;  4HED A;  5M3M G;  2WP8 J;  2VQE L;  4A3I G;  2IY5 B;  2NVT B;  5FOB B;  3MTS A;  3A55 A;  4JI3 L;  3W1B A;  4OX9 Q;  2QF7 A;  1UWV A;  5BR8 L;  5IGF A;  3NPP A;  4DR4 Q;  5C4J B;  2WKC A;  1U4L A;  2D62 A;  3S1N H;  2AWO A;  4DV5 Q;  2JA8 G;  1I50 B;  2QDB A;  5CBE E;  1K8A C;  5IGD A;  1L1O C;  4JV5 L;  4DGZ A;  5C0X J;  1IHZ A;  1P8L A;  4Y52 H;  2EY2 A;  1PTO B;  1P16 A;  2I0Q A;  1VQ7 A;  2VB2 X;  2NVY H;  1I4G A;  4DV2 L;  5GRO A;  4JI7 Q;  2I46 A;  1EZ6 A;  5C44 G;  1XX8 A;  1FL0 A;  4YCV A;  5M5W H;  2UXC L;  3OTO Q;  1BVS A;  2HT1 A;  1N8R C;  1I6H H;  4V0B A;  1NUC A;  1B4O A;  3LGJ A;  5GAG C;  1Z47 A;  3MFG A;  4LW1 A;  1JOO A;  4TRD A;  2R92 H;  3H91 A;  1PFN A;  2HHH Q;  2CFM A;  3GTO H;  3KUP A;  4DNI A;  4X62 Q;  2BDN A;  1IBK Q;  1JE4 A;  3MXP A;  3D31 A;  4C1N I;  2LSS A;  4YY3 L;  1V1P A;  4OGQ C;  3H0G B;  4DUZ L;  1QCB D;  1OXV A;  4LWC A;  3K59 A;  4JI2 L;  1PTO F;  4IOA A;  1C48 A;  1VDZ A;  5IWA Q;  4PMB A;  2C35 B;  4WJW A;  1CA5 A;  1Y69 U;  4ZLT F;  4LUO A;  4LF6 L;  4LF5 L;  3HOX G;  4H44 C;  4UHV A;  1DOL A;  4OHJ A;  1W2B A;  2O2L D;  4GNX B;  4HR7 B;  2I5M X;  4EGV A;  1L0X B;  2K6A A;  2WII B;  4JI6 Q;  1DOK A;  3ICE A;  2ALY B;  1TXY A;  2BH8 A;  1KDB A;  4CKE A;  2F0E A;  1WD0 A;  2UXB L;  2GN5 A;  2KHI A;  3VA5 A;  2YTV A;  2IX0 A;  4MNO A;  2A6E C;  1STA A;  3F2B A;  4RFB A;  4LAA A;  1Q3L A;  5A2Q E;  3FDT A;  1HTP A;  3VYS A;  1A3T A;  1IYU A;  1TKW B;  3JAM L;  4DAP A;  1MHW C;  3K80 C;  4GOP A;  1IL8 A;  2NUC A;  4JBJ A;  4XQJ A;  2VW9 A;  2MP1 A;  3HOY G;  3ERS X;  4NB3 A;  4N9P A;  2E76 C;  4O2D A;  4A3M B;  4L8J A;  4DR1 L;  2K32 A;  3S15 H;  1N32 Q;  1GXD C;  4B3S L;  1VQN A;  4UP9 A;  3S24 A;  2Z6B A;  4A93 G;  2VB3 X;  1IL2 A;  5JEA J;  1F2Z A;  4JOI A;  4QQB X;  1E1T A;  4HSP A;  4KD4 A;  5E7N A;  3J81 i;  2EYJ A;  1YJN A;  1NMF A;  2PI2 E;  4J1M A;  4J8Q A;  1IBL L;  4JI8 Q;  5LMN W;  5K36 G;  3M4Q A;  2RKS A;  4XT3 B;  1V1P B;  2YU9 B;  2CVR A;  3E0J A;  4ID6 A;  4I7A A;  4R4T A;  3HOU B;  4IPG A;  2B2V C;  5M3M H;  4A3I H;  1K8O A;  3A7A B;  1TWA B;  3TS2 A;  1W6K A;  4UY8 C;  1TY0 A;  4RCO A;  1SMX A;  2PPB C;  2Q2H A;  3M4Y A;  2PW7 A;  1Z7T A;  3UDF A;  4AH6 A;  5M5X B;  4FXD A;  1GVP A;  3PGZ A;  1LV9 A;  1Y1V B;  2JA8 H;  4KKT A;  4NDX A;  1BDO A;  1VQE A;  1VQG A;  2CW0 C;  4QF4 A;  3T1Y Q;  4B9X A;  1C4Q A;  3NTI A;  4DAY A;  2KHJ A;  3WWV A;  4XQN A;  4RKL A;  4CBV A;  3CU7 A;  1XMO L;  2B8G A;  1MI2 A;  4JC0 A;  2EJM A;  4A3B B;  3UDG A;  2PMZ E;  4JI4 L;  2F0F A;  5C44 H;  3K58 A;  2JK8 A;  1UEA B;  2HQL A;  4LUZ A;  5DEH A;  3M4P A;  1LT4 D;  2KJX A;  3CQZ B;  3QR8 A;  2KQ3 A;  4GN4 B;  5GAE C;  3RUZ A;  1SRU A;  5T1G A;  4MTN A;  2JA6 G;  2PI2 A;  1EU3 A;  1YHB A;  2N88 A;  4EX5 A;  3OTO L;  1RL2 A;  2IJ0 A;  3FPU B;  2E2J H;  1HFG A;  5IIF A;  2K52 A;  1X56 A;  2VS1 A;  3K0X A;  3I4L A;  3E9H A;  1EEF D;  3K6O A;  5FJ8 G;  5JPN C;  5JJL A;  1QOH A;  1PV4 A;  4DK0 A;  3PSI A;  3HOX H;  3PO2 G;  4NP5 A;  3LX0 A;  5EPK A;  2B63 B;  1KNE A;  2UU9 Q;  1O78 A;  1XJV A;  2KEE A;  2A6E D;  1PTO D;  2WFW A;  5BN4 A;  4MZ9 A;  3WOE A;  5KRU A;  4A3G G;  5J39 A;  2UXD L;  4IZ8 A;  1LT5 D;  2R7F A;  1G51 A;  4A3K B;  2N3S A;  1Y1W B;  1H9S B;  4R8N A;  3OSO A;  1IZ6 A;  4H02 A;  4HAE A;  2XRS D;  2EJG C;  2PNR C;  3L9A X;  4C1N K;  3J80 L;  1I5F A;  4QL5 A;  1ML0 D;  3HEJ A;  2JEA I;  2E2H B;  3HG9 A;  3QO2 A;  3TP6 A;  5FK9 C;  3KF6 B;  2Q2U A;  4P75 A;  4A3E B;  3J7A V;  2KHS A;  3P20 A;  4QJF A;  4A3D G;  1DGS A;  1HHV A;  2F0M A;  1A62 A;  3HOY H;  1B2T A;  1GUO A;  2RA4 A;  1NR4 A;  1B50 A;  2WAQ G;  4DR2 Q;  5C3E B;  1BCP B;  1S3O A;  1PLF A;  1KRT A;  3RZO H;  5ELF A;  2BDO A;  1UE1 A;  1LTT D;  4IFD J;  1D6E C;  4A93 H;  1RJT A;  4QB4 A;  5HY6 A;  4K0K L;  2ZTD A;  2F0U A;  2RDG A;  2FFK B;  4B3R L;  1IBM L;  1TWC H;  4KY7 A;  4P73 A;  1R9T H;  4AQY L;  3Q22 A;  1PZJ D;  2RCN A;  3HFZ B;  2XN9 C;  3QWN A;  2ZJR A;  4DR3 Q;  1BF4 A;  3A0J A;  5K36 H;  5LMU Q;  1GUN A;  2O5J C;  2MFI A;  2VQF Q;  2DNE A;  3B6Y A;  1EWH A;  1SMY C;  1HXY D;  2EE1 A;  5COY A;  4BY1 G;  4YCW A;  3A8I E;  4K8J A;  2EVB A;  1HNZ L;  1GHK A;  2R7Z G;  2J0T D;  5ELD A;  4X3T A;  4QIW E;  2WB1 E;  1J8I A;  2EZV A;  2K33 A;  1ILP A;  3JC6 6;  2F4V L;  5COR A;  4RG1 A;  2CCZ A;  2B2W C;  5FKA C;  1J5E L;  4PMC A;  1LLR D;  4AYB G;  4C2M B;  4EQO A;  1YNN C;  3KLS X;  3MFY A;  1OXX K;  1CI3 M;  2RDF A;  5IY0 A;  3I8Z A;  4CDD C;  5GAD C;  3J80 c;  3CCJ A;  1C8C A;  4LF9 L;  1V8Q A;  4LF8 Q;  2JE6 I;  1L0W A;  3ULL A;  3UE0 A;  3G71 A;  4NKL A;  1JCK B;  2PMZ B;  4GKJ Q;  2HDM A;  3OYY A;  2XWJ B;  2N78 A;  3PIP 3;  3V96 A;  1ASY A;  2A73 B;  2F03 A;  4DV7 L;  2MQH A;  1SFO H;  1TY2 A;  4JI1 L;  1S5D D;  4IPD A;  2OXP A;  3WDN A;  2JA6 H;  2I5L X;  3PUY A;  3GV6 A;  5IP9 G;  1JQY D;  2WIN B;  1SNP A;  2FJ2 A;  1VQF A;  3WOF A;  4DA2 A;  5IGG A;  3CRK C;  3HS0 C;  1V1Q A;  3SVM A;  1XYI A;  3OOC A;  3E0E A;  5C0X G;  1TWF H;  5J3B A;  3URY A;  4LF4 Q;  2VL6 A;  5I9P A;  1I3Q H;  5FJ8 H;  1WTX A;  1NAP A;  5FO9 B;  1IXR A;  1E24 A;  2B2T A;  3OW7 A;  3PO2 H;  4JI0 L;  3AFQ A;  4DAV A;  2SOB A;  1ASZ A;  4A3G H;  2IW3 A;  3PMF A;  3RLF A;  2EJF C;  3M7N A;  5FLM G;  1K8G A;  2SNM A;  4OEL B;  5ISR A;  5KYL A;  1TS4 A;  3AEV A;  4WFN 3;  3W3A A;  1ENA A;  4DV4 L;  1I94 L;  3I56 A;  1DON A;  3MXG A;  1G8Z D;  1HNX Q;  2OCE A;  2PW5 A;  3SR1 A;  1Q81 C;  1JB7 A;  3S9W A;  1EYG A;  3NWS A;  1KC8 C;  1B70 B;  1YHA A;  1PMR A;  4BS9 A;  1NY4 A;  5JJZ A;  3TME A;  1AE3 A;  4P71 A;  1VQC A;  4A3D H;  4LFC Q;  1NCV A;  2VQE Q;  3I2Z A;  1E2W A;  1PYB A;  1VQ4 A;  4LUV A;  1VQL A;  3JAM E;  4JI3 Q;  3J81 j;  4ZUJ A;  3A8K E;  3DWP A;  5DNF A;  2L9H A;  4KHV A;  5BR8 Q;  5DLQ E;  4FP5 D;  3CXC A;  4A3F G;  3AYH B;  3IKJ A;  3HKZ G;  1HNW L;  2SDF A;  4FNF A;  1Z9F A;  2VY3 A;  3NHH A;  1ET6 A;  4X65 L;  3PO3 G;  1LTB D;  1D7Q A;  1PFS A;  1A63 A;  1HR0 W;  1A3V A;  4DR6 L;  4JV5 Q;  2LKV A;  1V1O A;  1EIH A;  5KEE A;  2VUM B;  1II3 A;  2F0J A;  4ME5 A;  1E0B A;  1WTV A;  4DV2 Q;  3M7G A;  2XIW A;  2E5L L;  4KJO A;  5C3W A;  4PV1 C;  3QOL A;  1Q12 A;  2UXC Q;  2EYO A;  3GD7 A;  4BY1 H;  3DHQ A;  2R7Z H;  3TP5 A;  2WB1 B;  3M9B A;  4X6A H;  1FNU A;  2D2C C;  3KDF A;  4CJ0 B;  5JEA G;  3CAM A;  4JPB W;  1HRJ A;  3CCU A;  1QJO A;  2LY7 A;  2PCF B;  5IYD G;  1RCV D;  5ELN A;  3NE5 B;  4O42 A;  2UUC L;  4YY3 Q;  3MXU A;  4DUZ Q;  1QVF A;  4OL7 A;  4JI2 Q;  5IYB G;  2NVQ H;  2IHF A;  3NK9 A;  3J7Y W;  4DK3 C;  3GDE A;  1HFN A;  4O1N A;  4R9W A;  2NVX H;  1HCZ A;  4LF6 Q;  1V43 A;  3KBG A;  4LF5 Q;  3M85 A;  5C4X B;  2ZTE A;  1N36 L;  2FMC A;  1HH2 P;  1LTG D;  1SAP A;  2N55 A;  2YYZ A;  3P75 A;  4DV1 L;  4KHP L;  1GUW A;  3F8T A;  2E75 C;  5IP9 H;  4X3K A;  1CKN B;  2UXB Q;  1XWE A;  5G3L D;  4C3H G;  1BQQ T;  3OHX C;  5CV4 A;  1VQ6 A;  4IPC A;  2XSC A;  4LK1 C;  3PUV A;  1HUM A;  2QEJ C;  3C1F A;  2EY6 A;  3IFD A;  4YWM A;  2NTS A;  1EQV A;  4DK1 A;  1JWM D;  2R93 G;  2E74 C;  5CV5 A;  1GUT A;  1BO0 A;  3A54 A;  3S2H B;  4GN5 A;  5NUC A;  1GUS A;  2KBN A;  1JWS D;  4GKK L;  1SDF A;  4JYA L;  4OXP A;  3T56 B;  5I2Y A;  1DZ1 A;  1KDC A;  5LL6 X;  4DR1 Q;  5FLM H;  2NB0 A;  5IP7 G;  1KTK A;  4B3S Q;  4UDU C;  4A75 A;  3KFU A;  2A68 D;  3BU2 A;  3I4N B;  3KJO A;  2FMM A;  4DUY L;  2KEC A;  1FJG L;  1K0R A;  5A35 A;  1EQR A;  3KDF B;  4TQU S;  3W5O A;  1HZB A;  4P2C B;  3NQI A;  2A69 C;  4BBR G;  1TWG H;  2VXW A;  1EY4 A;  3S1R B;  4RH6 A;  1IBL Q;  4V19 0;  2F0O A;  1GJX A;  2F0Q A;  1MGS A;  3BG3 A;  4FDB A;  4Q5V A;  3S1Q B;  1YZ6 A;  1HA5 A;  1X3E A;  3S17 B;  4R8I A;  3PIO 3;  5EJW A;  1U4M A;  2IX3 A;  3CC4 A;  4B3T L;  5KIX A;  5BN3 A;  4A3F H;  2HQE A;  1EL0 A;  1A2T A;  3E5S A;  2M2L A;  3I70 A;  3HKS A;  2AMC B;  4YHH L;  2EDG A;  1F9P A;  4HJ9 A;  4BY7 B;  4LF7 L;  1HUN A;  1CHQ D;  1EUJ A;  3PO3 H;  1PHJ A;  4KY6 A;  4HMJ A;  3H3V C;  2B2Y C;  2PNH A;  4NXN L;  4Q0F A;  4R1J A;  5CV7 A;  2Z9H A;  3M3Y H;  4A3C G;  3E9I A;  2Y0S E;  1WVL A;  1VQO A;  1XMO Q;  3TZU A;  2AUJ D;  5CBA E;  3NQT A;  2R6G A;  1E2Z A;  4C3I B;  1J9O A;  4JI4 Q;  4CDE C;  4KI0 A;  2B2V A;  1MD2 D;  4FVM A;  3S14 H;  3MA2 B;  2ZXO A;  1D2B A;  1MIU A;  2BOS A;  4GN3 B;  1SLJ A;  1EIG A;  2JA7 G;  4IFD G;  1WFQ A;  4IQZ A;  3AMU A;  3T16 A;  3KOJ A;  2HIV A;  5JEA H;  4X3S A;  5DM6 3;  2N49 A;  2L0C A;  3SGI A;  1JOK A;  5IYD H;  4EQN A;  2F0D A;  1EY5 A;  3GTK H;  2JA5 B;  1QUQ A;  5IYB H;  5DAU A;  2PQE A;  3X3M A;  1K73 C;  1TR5 A;  4KKS A;  3T1H L;  3K81 C;  1XNR L;  1E22 A;  1KDA A;  3H6M A;  1S40 A;  4M8A A;  4H13 C;  3SEB A;  3KK7 A;  5CV9 A;  1NNX A;  3CCV A;  1PH2 A;  3K57 A; 
#chains in the Genus database with same CATH homology
 1YHB A;  3UDX A;  4EX5 A;  3OTO L;  1LUZ A;  4L5S A;  4A76 A;  3CQZ H;  4R4Q A;  3S16 H;  1RL2 A;  2F3I A;  3EBE A;  2E2J H;  4KHZ A;  2UXD Q;  1UEB A;  3A5U A;  2NN6 G;  3BZK A;  2K52 A;  1X56 A;  2VS1 A;  4PZ6 A;  3K0X A;  2ZM6 L;  5M3F G;  2ID0 A;  3J7A 5;  1AH9 A;  3E9H A;  3I4O A;  5IYC G;  1WCM H;  4DV3 L;  4C3H H;  5FJ8 G;  1VQ5 A;  3HOV H;  5JJL A;  2HIX A;  2RHQ B;  1UE5 A;  3NEL A;  1YNX A;  1PV4 A;  3PSI A;  1KAW A;  3FKI G;  3HOX H;  5C0X I;  3PO2 G;  3UE1 A;  1JJC B;  3DM3 A;  3I4M G;  4L5T A;  4HJ7 A;  2UU9 Q;  1O7I A;  2OQK A;  3U50 C;  1XJV A;  2R93 H;  3GTJ H;  2WFW A;  1K9M C;  3KJP A;  1E7Z A;  1NBW A;  1Q8K A;  4MZ9 A;  3CCM A;  4HJ5 A;  4A3J G;  4A3G G;  1VCI A;  2D0O A;  3HOZ G;  2ZJP A;  3KYH C;  2B63 H;  2UXD L;  1GO3 E;  2R7F A;  1G51 A;  1NTG A;  2N3S A;  2E8G A;  2XGT A;  2DGY A;  1IZ6 A;  4H02 A;  3GTM H;  4L5Q A;  2AKW B;  2N8N A;  4ALP A;  1I5F A;  4QL5 A;  5IP7 H;  3S2D H;  4DR5 L;  1MKH A;  2JEA I;  2OTL A;  3HOW G;  4A3K H;  1Y1W H;  3PV0 A;  2IHE A;  1Q1E A;  4TVA B;  2UU9 L;  4K0K Q;  3ZJY C;  1YEZ A;  4B3R Q;  3KF6 B;  1IBM Q;  2Q2U A;  1NE3 A;  2WAQ E;  2YV5 A;  4P75 A;  4DR7 Q;  2EXD A;  1M90 C;  3IRB A;  4AQY Q;  4QJF A;  2E2H H;  4A3D G;  3GO5 A;  1DGS A;  4BBR H;  3CCR A;  3M4O H;  1L1O B;  1A62 A;  4A4I A;  2QEX A;  3HOY H;  2H5X A;  1T9H A;  1X9N A;  2WAQ G;  4A3E H;  4DR2 Q;  2CWP A;  1S3O A;  1KRT A;  3RZO H;  1PA6 A;  3CPW A;  1X3G A;  1SRO A;  4IOC A;  1HZA A;  1UE1 A;  1CKN A;  4IFD J;  4DPG A;  1Q1B A;  4GNX C;  4A93 H;  1HNZ Q;  5HY6 A;  4K0K L;  2ZTD A;  5C3E H;  4B3R L;  1IBM L;  4DR7 L;  3RN2 A;  4QY7 A;  1TWC H;  2F4V Q;  4P73 A;  1R9T H;  4AQY L;  1J5E Q;  2RCN A;  4GNX A;  3JAM i;  3HFZ B;  2ZJR A;  3J80 i;  4DR3 Q;  1JT8 A;  2OQ0 A;  2K14 A;  3A0J A;  1Q82 C;  5LMU Q;  1Q86 C;  4GS3 A;  3CME A;  2RF4 A;  1QZH A;  1KXL A;  2MFI A;  1XPO A;  1OXT A;  2VQF Q;  4A3C H;  1GD7 A;  4DR2 L;  3B6Y A;  4LF9 Q;  3TQY A;  3L7Z C;  1G6P A;  2Q2T A;  4DV0 Q;  1G29 1;  4BY1 G;  4YCW A;  3GTP H;  4AYB E;  2ASB A;  3CF5 A;  1HNZ L;  2VUM G;  2GVA A;  2K5N A;  3STB D;  2R7Z G;  5FLX c;  4QIW E;  2WB1 E;  4R4O A;  4DKA C;  1EQQ A;  1YVC A;  1SR3 A;  1GKH A;  1E1O A;  4GLV B;  3JC6 6;  3CCS A;  1KIX A;  2F4V L;  4BBS H;  1K83 H;  4RG1 A;  2CCZ A;  3S1M H;  1J5E L;  4DR3 L;  4Y52 H;  4AYB G;  4DV7 Q;  3BJU A;  2JA7 H;  5LMU L;  3L0O A;  3TS0 A;  1OXX K;  4JI1 Q;  2WB1 G;  5GAH C;  2KCT A;  5IY0 A;  4HIM A;  2VQF L;  4DK6 C;  3JAM c;  5GAD C;  3J80 c;  2EIF A;  3CCJ A;  4LF9 L;  1BBW A;  2Z6K C;  4LF8 Q;  2JE6 I;  1L0W A;  4R4I A;  3ULL A;  1HZ9 A;  3UE0 A;  1PH6 A;  3G71 A;  2Z0S A;  4DV0 L;  3A5Z B;  4C2M H;  1JE5 A;  3EIV A;  3CC2 A;  1B7Y B;  1WJJ A;  2BH2 A;  1A8V A;  4GKJ Q;  4NPS A;  3ULP A;  4OWT B;  3MEF A;  3OYY A;  1XTD A;  4IJH A;  4NXM Q;  2Z6K A;  4OO1 I;  1U0L A;  2N78 A;  2R92 G;  4GOP B;  1GM5 A;  1PH7 A;  4P74 A;  1ASY A;  1XPU A;  4WJ4 A;  3MXN B;  4POF A;  1L2F A;  3PUX A;  4DV7 L;  2E2I H;  2MQH A;  1SFO H;  1FVI A;  2JA6 G;  2NZH A;  4JI1 L;  3CCL A;  4IPD A;  1KRS A;  2JA6 H;  4JI0 Q;  2I5L X;  3A74 A;  3PUY A;  5C4X G;  4LF8 L;  1CSP A;  3G48 A;  5IP9 G;  4DAM A;  3H15 A;  4OWW B;  2YTY A;  3K7A H;  3PF4 A;  4X64 Q;  1VQF A;  2PQA A;  5M5Y H;  3GTL H;  1JMC A;  1PH9 A;  5IT9 c;  4IO9 A;  1TWH H;  1V1Q A;  2UUB Q;  4GKJ L;  5M3F H;  3E0E A;  3H0G G;  4UP8 A;  5C0X G;  1TWF H;  1PH8 A;  5J3B A;  1KD1 C;  4LF4 Q;  4AIM A;  5IYC H;  3BZC A;  2VL6 A;  1I3Q H;  5FJ8 H;  4JBM A;  2IX1 A;  2AHO B;  1C7Y A;  2KEN A;  3D0F A;  1V9P A;  1YIT A;  4DV4 Q;  1IXR A;  1I94 Q;  1E24 A;  3FKI H;  1OTC A;  3PO2 H;  1M1K C;  1VQK A;  4LFB Q;  3TRE A;  2BA1 A;  1VQJ A;  3PUZ A;  4JI0 L;  1N33 Q;  1Q46 A;  3I4M H;  1VQH A;  2K5V A;  3AFQ A;  1H95 A;  1VQP A;  4IPH A;  5GQO A;  4JI5 Q;  4ME3 A;  4X64 L;  1Q7Y C;  2OTJ A;  4A3J H;  1LYL A;  1EFW A;  1ASZ A;  5H1S E;  4A3G H;  3NEN A;  3HOZ H;  2B3G A;  1XMQ Q;  3RNU A;  3RLF A;  3T1Y L;  1HR0 Q;  3GTQ H;  2UUB L;  3M7N A;  4PZ8 A;  3I55 A;  4IJL A;  5FLM G;  2A8V A;  2K5H A;  1KQS A;  1K8G A;  4X66 Q;  4LF4 L;  4HIO A;  1BBU A;  1VQ8 A;  3AEV A;  4BXX G;  1PYS B;  1FGU A;  4PMW A;  1VS0 A;  3RZD H;  1UE6 A;  4DV4 L;  1I94 L;  3I56 A;  3H3V H;  1X6O A;  2ZJQ A;  4LFB L;  2IT1 A;  3HOW H;  3CCE A;  2OCE A;  1HNX Q;  3CD6 A;  2GVB A;  1N33 L;  2I5H A;  1MJE A;  1Q81 C;  1JB7 A;  1CSQ A;  4DAY B;  1EIF A;  4A3L G;  1K3R A;  1YIJ A;  4NXM L;  1HNW Q;  1EYG A;  2ZTC A;  4JI5 L;  3I4N G;  3DLL A;  1KC8 C;  4C3J H;  5JJK A;  1B70 B;  1YHA A;  3Q8D A;  3U58 A;  4X65 Q;  1NY4 A;  1XMQ L;  2F52 A;  1AE3 A;  4P71 A;  1QUQ B;  1VQC A;  4EQ5 A;  1HR0 L;  4LFC Q;  4A3D H;  1IYJ B;  1Y14 B;  4X66 L;  3K7U C;  3I2Z A;  2VQE Q;  4DR6 Q;  1PYB A;  1VQ4 A;  4LUV A;  1VQL A;  3HKZ E;  1EOV A;  1WYD A;  3J81 j;  4QGU A;  4JI3 Q;  1NJI C;  3AFP A;  1C9O A;  4JOI C;  5DLQ E;  5BR8 Q;  3CXC A;  2D0P A;  1X55 A;  4DV6 Q;  4GLX A;  4A3F G;  4A3M G;  4Y7N H;  2E5L Q;  2VNU D;  4WJ3 M;  1HNX L;  3AYH B;  4P72 A;  3CW2 C;  5HGQ A;  2V1C C;  1EIY B;  3HKZ G;  2ES2 A;  1HNW L;  1Z9F A;  2VY3 A;  3G6E A;  2MO0 A;  3KF8 B;  4X65 L;  2YTX A;  4R4C A;  2MNA A;  3PO3 G;  3RLN A;  3PCO B;  1PH4 A;  1D7Q A;  1PFS A;  4JCV E;  4LFC L;  4HJ8 A;  1A63 A;  1YHQ A;  1YBY A;  1HR0 W;  1LTL A;  4DR6 L;  5M3M G;  2WP8 J;  2VQE L;  4A3I G;  4JV5 Q;  3CMA A;  2IY5 B;  5JJI A;  2PQA B;  4JI3 L;  4OON A;  3PF5 A;  4BY7 G;  3W1B A;  2UUC Q;  4OX9 Q;  3EN2 A;  3J7Z C;  3PIP A;  1UWV A;  1NMG A;  4OWX B;  5BR8 L;  4DV2 Q;  3GTG H;  4OO1 G;  1HJP A;  4DV6 L;  2E5L L;  3HOU G;  4DR4 Q;  2B29 A;  1Q12 A;  2NVT H;  2UXC Q;  3GD7 A;  4BY1 H;  2D62 A;  3CPF A;  1VQD A;  3ER0 A;  2VUM H;  3S1N H;  1E3P A;  2R7Z H;  2AWO A;  4DV5 Q;  1PH3 A;  2QA4 A;  2JA8 G;  2A1A A;  3M9B A;  4X6A H;  2Q2I A;  3KDF A;  5C4J H;  2K50 A;  1N9W A;  5JEA G;  1K8A C;  1Y1V G;  3CAM A;  1N36 Q;  5EAY A;  1L1O C;  3CCU A;  4JV5 L;  1C0A A;  5C0X J;  5IYD G;  1I50 H;  1P8L A;  2JA9 A;  5ELN A;  4IFD I;  3KF6 A;  2EQS A;  2UUC L;  1P16 A;  4YY3 Q;  4DV1 Q;  2I0Q A;  4OX9 L;  1VQ7 A;  4KHP Q;  4DUZ Q;  2NVY H;  4DV2 L;  1YJW A;  5GRO A;  3OW2 A;  5IYB G;  4JI2 Q;  1QVF A;  4JI7 Q;  2IHF A;  4BA1 I;  2NVQ H;  5C44 G;  2MO1 A;  1FL0 A;  3L2P A;  4DR4 L;  4YCV A;  5M5W H;  4DK3 C;  1RIP A;  2DUD A;  1YI2 A;  3GDE A;  3OTO Q;  1QZG A;  2UXC L;  1KHI A;  1BVS A;  2HT1 A;  1N8R C;  2NVX H;  4UPA A;  1I6H H;  4DV5 L;  2A19 A;  3LGJ A;  5GAG C;  4LF6 Q;  1Z47 A;  2JA5 G;  1V43 A;  2JEB I;  4LF5 Q;  4A3B G;  4LW1 A;  2NZO A;  3M85 A;  3U4Z A;  2R92 H;  2HHH Q;  2CFM A;  3GTO H;  2ZTE A;  3F2D A;  4X62 Q;  4DNI A;  1N36 L;  1IBK Q;  3I7F A;  3D31 A;  1CKO A;  1HH2 P;  1SE8 A;  2LSS A;  2YYZ A;  4YY3 L;  4DV1 L;  4KHP L;  5C4X H;  1VQI A;  3F8T A;  4DUZ L;  4LWC A;  1OXV A;  5IP9 H;  3FP9 A;  4JI2 L;  4JI7 L;  4IOA A;  4HIK A;  1CKN B;  4GKK Q;  5IWA Q;  2UXB Q;  4JYA Q;  1WCM G;  2C35 B;  4XIG S;  3HOV G;  1VQ6 A;  1VQB A;  5IE8 A;  4LUO A;  2JJQ A;  4PG3 A;  4IPC A;  3H0G H;  4LF6 L;  2NN6 I;  4LF5 L;  1X54 A;  3TEH B;  3HOX G;  4GLA C;  3PUV A;  2L15 A;  4YWK A;  2HHH L;  1W2B A;  3F2C A;  4GNX B;  4X62 L;  2CQO A;  2I5M X;  4YWM A;  4JI6 Q;  1IBK L;  4DUY Q;  1FJG Q;  3U4V A;  2R93 G;  3ICE A;  2ALY B;  4DR5 Q;  1TXY A;  4JG2 A;  2FXQ A;  4GN5 A;  2BH8 A;  2B63 G;  2KBN A;  3NBH B;  5LMN Q;  4GKK L;  2UXB L;  5IWA L;  3CCQ A;  1PVO A;  2KHI A;  2GN5 A;  4JYA L;  4OXP A;  2YTV A;  2IX0 A;  4MNO A;  3F2B A;  1EWI A;  4DR1 Q;  3S2H H;  5FLM H;  3PIO A;  3PUW A;  5AJ3 Q;  5IP7 G;  4B3S Q;  2OWO A;  1CKM A;  3CC7 A;  1PH5 A;  4A75 A;  4GOP C;  4A3K G;  1Y1W G;  4BA2 I;  3KFU A;  4BXX H;  3BU2 A;  3KJO A;  4JI6 L;  4B3T Q;  1QVC A;  4DUY L;  1FJG L;  1D8L A;  1K0R A;  3VDY A;  1AE2 A;  3H3V I;  1EQR A;  3KDF B;  4TQU S;  1U5K A;  1N34 Q;  3RN5 A;  3W5O A;  3K80 C;  1VQM A;  4YHH Q;  1HZB A;  4GOP A;  4A3L H;  1OXS C;  1XPR A;  1HZC A;  4JBJ A;  4BBR G;  3I4N H;  5LMN L;  4LF7 Q;  3NEM A;  2VW9 A;  1VQA A;  1TWG H;  1IBL Q;  1OXU A;  3HOY G;  3ERS X;  4NB3 A;  4LNQ A;  4LFA Q;  4O2D A;  4DR1 L;  4A3E G;  4NXN Q;  1CUK A;  4L5R C;  5AJ3 L;  3S15 H;  4FDB A;  1N32 Q;  4B3S L;  4UP7 A;  1YZ6 A;  1XNQ Q;  1X3E A;  2K4K A;  4O0A A;  4UP9 A;  3S24 A;  3RLO A;  1VQN A;  4YCU A;  3S1R H;  2UUA Q;  3TRZ A;  4A93 G;  3AQQ A;  1W3S A;  3CC4 A;  2K75 A;  4B3T L;  5JEA J;  3RR5 A;  3UDI A;  4A3F H;  1IL2 A;  4JOI A;  4A3M H;  4QQB X;  1E1T A;  1UE7 A;  2LXK A;  1X3F A;  5C3E G;  4POG A;  5E7N A;  4JBK A;  3J81 i;  1YJN A;  1N34 L;  3ULJ A;  3S1Q H;  1NMF A;  3HKS A;  2AMC B;  1A0I A;  4YHH L;  3S17 H;  1LM0 A;  1X65 A;  1BKB A;  2PI2 E;  4B3M Q;  2R7D A;  1WOC A;  2RHS B;  4HJ9 A;  4LF7 L;  1EUJ A;  4XTC S;  4JI8 Q;  5LMN W;  1IBL L;  2ATW A;  3M4Q A;  5K36 G;  3PO3 H;  2LXJ A;  4HJA A;  2XTI A;  1PHJ A;  4LFA L;  1JJ2 A;  2PNH A;  4R4T A;  4NXN L;  4A3C G;  4R1J A;  4HID A;  3M3Y H;  4IPG A;  5M3M H;  4A3I H;  1N32 L;  1XNQ L;  3E9I A;  3TS2 A;  2Y0S E;  4APV A;  4UY8 C;  4BY7 H;  1VQO A;  1XMO Q;  1SMX A;  2UUA L;  2KCM A;  2Q2H A;  2R6G A;  3UDF A;  4YWL A;  4AH6 A;  2YU9 H;  3HOU H;  4JI4 Q;  4KI0 A;  1GVP A;  1SN8 A;  3G4S A;  3PGZ A;  2AWN A;  3S14 H;  1TWA H;  3T1H Q;  1VQ9 A;  1XNR Q;  4BBS G;  2Y0S G;  1MIU A;  4GN3 B;  4B3M L;  2JA8 H;  3KLW A;  1SLJ A;  5ELO A;  2JA7 G;  4JI8 L;  5M5X H;  4C3I H;  3J81 c;  1QVG A;  1WFQ A;  1VQE A;  3STB C;  1VQG A;  4JBW A;  4IFD G;  1MJC A;  3KOJ A;  2HIV A;  3T1Y Q;  1Y1V H;  1J6Q A;  2CKZ B;  1L1O A;  2KHJ A;  2N49 A;  3SGI A;  3WWV A;  2CWA A;  5IYD H;  1XMO L;  3K8A A;  4JC0 A;  3F1Z A;  3GTK H;  1WI5 A;  2BA0 A;  1QUQ A;  5IYB H;  3UDG A;  2PMZ E;  4JI4 L;  5C44 H;  2ZM6 Q;  1K73 C;  2JK8 A;  3W1G A;  3T1H L;  4DV3 Q;  3K81 C;  1XNR L;  2QGQ A;  1E22 A;  2HQL A;  4LUZ A;  3M4P A;  3CP0 A;  1YJ9 A;  1PH1 A;  1S72 A;  3FHW A;  1B8A A;  4RMF A;  2JA5 H;  4A3B H;  4GN4 B;  1S40 A;  4PZ7 A;  4J15 A;  5GAE C;  1JJG A;  1KL9 A;  1SRU A;  2JQO A;  2VZA A;  4KLK A;  3CCV A;  4MTN A;  2PI2 A;  1PH2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...