1JJGA

Solution structure of myxoma virus protein m156r
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
102
structure length
102
Chain Sequence
MTVIKPSSRPRPRKNKNIKVNTYRTSAMDLSPGSVHEGIVYFKDGIFKVRLLGYEGHECILLDYLNYRQDTLDRLKERLVGRVIKTRVVRADGLYVDLRRFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Myxoma virus immunomodulatory protein M156R is a structural mimic of eukaryotic translation initiation factor eIF2alpha.
pubmed doi rcsb
source organism Myxoma virus (strain lausanne)
molecule tags Viral protein
molecule keywords M156R
total genus 8
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2001-07-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1jjgA00
4A3CH 3NBHB 1KXLA 4LFBQ 3TS2A 2PQAA 5M3MH 1CKOA 2JA9A 4K0KQ 4OXPA 1HZCA 3M4OH 1A62A 2MO1A 2YTVA 3CP0A 4R1JA 1T9HA 4X6AH 5HGQA 4JBKA 5GAEC 3CC4A 1S3OA 1MKHA 1EFWA 1VQNA 1SN8A 2YV5A 4DR7L 1VQ5A 5C3EH 2K52A 4A4IA 4IFDI 1IZ6A 1UE1A 3FKIH 3M3YH 4A76A 1HNXL 4PG3A 1E7ZA 1MIUA 3HKZE 4JI8L 4JI7L 1IBMQ 1IBLL 3PUWA 3MEFA 4YCVA 1HZ9A 1K0RA 1Z9FA 2OCEA 1HR0Q 1HNZL 1PVOA 3AYHB 3CPFA 1OXSC 3BZCA 3EBEA 1UE6A 4YHHL 3CCJA 1PH2A 3I4MH 1I6HH 2UXCQ 3S1MH 3PGZA 1BBWA 1I3QH 1VCIA 2IY5B 2A19A 2RHQB 3KFUA 1YI2A 1YITA 1KQSA 2VY3A 3S16H 1VQJA 2AHOB 2IT1A 2JA8G 1AH9A 5JJIA 2E8GA 1Q81C 3S17H 1N32L 3UDGA 1YHAA 1A0IA 1X6OA 1N34Q 4B3SQ 3W5OA 1HZBA 1PH4A 4BBRG 1DGSA 4O2DA 1X3EA 4YWLA 3VDYA 3U4ZA 2CCZA 1PH7A 1VQCA 1G51A 1VS0A 2MFIA 2UXDQ 1IBKL 1E22A 1B7YB 4C3IH 2Y0SE 4X64Q 2AMCB 5JEAJ 1D8LA 1YBYA 4HIOA 2JEAI 4IPCA 3HOXG 2K50A 3RR5A 3M9BA 1PH8A 2ZJQA 4A3DG 5JJKA 4KI0A 2C35B 1FGUA 2K5HA 2NVQH 5FJ8H 2K75A 2Z6KC 3D31A 2R6GA 2VQFQ 3U50C 1JMCA 1Z47A 1VQHA 4JCVE 1XMQQ 2HIXA 1YIJA 2BA0A 2JA5G 1PA6A 4YCUA 1L1OA 5LMUQ 1SFOH 3CCVA 1IL2A 4R4TA 2MNAA 4YY3L 4JBWA 4HJAA 1XMOQ 3S24A 4C2MH 4TQUS 1OXTA 1VQIA 2ZJPA 3HOWG 3PO3G 3FP9A 2I5HA 4BBRH 5C4XH 4DR2Q 4P72A 4DR6Q 4DV1L 2N8NA 5M3MG 2GVBA 3K81C 4R4QA 1EWIA 3M85A 3S2DH 1TWAH 4A3GG 4NB3A 1Y1WH 1WCMG 1ASYA 2UU9Q 5IYBH 2Q2UA 1UEBA 5IP9G 3UDXA 3CW2C 3OW2A 5C3EG 3RN5A 4AYBE 3J81j 2UUCL 4JI0Q 4DV6L 4IFDG 3GTKH 3PF5A 4IPHA 3TS0A 1I50H 3STBD 5GAHC 1YJWA 2OTLA 4POFA 3K8AA 4IOAA 4K0KL 4JI1L 1U0LA 1Q7YC 3HOVH 4JYAL 4A3MG 4P74A 4A3BG 4DV0Q 1YJNA 1S40A 3G71A 2RHSB 1JJCB 5M5WH 1O7IA 3J81c 4GOPA 1EOVA 4A3LH 2OTJA 4YCWA 2RCNA 5BR8Q 4DR7Q 1N32Q 4C3HH 2JK8A 1CSQA 4XIGS 1J6QA 2K4KA 4HJ8A 3DM3A 3PUVA 2Q2HA 2WB1G 3L7ZC 4GKKL 4JI5Q 4LFBL 2A1AA 1WJJA 3W1BA 4GKKQ 5IP9H 1VQEA 2UXCL 2ZTEA 2AKWB 4BY7H 3U58A 4GS3A 3DLLA 3PCOB 3HKZG 4RG1A 4LW1A 2KCMA 1PYSB 4PMWA 3CMAA 5C44G 2K14A 1N9WA 4DUYL 4DR5L 2QGQA 4A3DH 1CKMA 4TVAB 1MJEA 1VQPA 3I4OA 1N36L 4DV4Q 1BBUA 1VQ6A 2R93G 4BXXG 2KENA 1NMGA 4UP7A 3CCUA 4GNXC 1G6PA 1L0WA 1XMOL 3S1QH 4A3IH 2B63G 4BA2I 3S1RH 2JA7H 2JA5H 4BA1I 3GTJH 4DR4L 4KHPL 2N49A 2WFWA 2K5NA 5DLQE 5C0XJ 1KC8C 2F4VQ 2D62A 1ASZA 1OXUA 5LMNW 1KD1C 2EIFA 3U4VA 3CXCA 1CKNB 2EXDA 2MO0A 3KOJA 2ZM6L 1GM5A 4OO1I 5C4JH 1E24A 1KRSA 2JQOA 2VQFL 2NVYH 1V9PA 2XTIA 3KF6B 4EX5A 3CCLA 3KDFA 4P73A 2RF4A 4GLXA 3F1ZA 4X62L 4A3FG 2ID0A 2IHEA 1M1KC 4IPDA 3FKIG 4YHHQ 4GKJQ 2UXDL 3UE0A 3OTOL 1HNZQ 2ZTDA 5HY6A 4JV5L 3S15H 5IP7G 5AJ3Q 2OQ0A 4QGUA 4LF8Q 3S1NH 2R93H 5IYCH 3E9IA 4LUVA 4JBMA 3RZDH 5IY0A 4NXMQ 3TEHB 4A93G 1C9OA 3HOVG 2CQOA 2YU9H 2LSSA 3M4QA 1HNWQ 2FXQA 2ZM6Q 4JI3Q 3L2PA 1Q12A 3CAMA 1FVIA 2VUMH 2N78A 3BZKA 3JAMi 3NENA 1SROA 2LXKA 3I4NG 4A3LG 4KHZA 3J7A5 3PF4A 2IX0A 4IO9A 2QEXA 4HJ7A 1PHJA 4DAMA 4LFAQ 1Y1WG 3IRBA 4GLAC 4HJ5A 1KAWA 1WCMH 3E0EA 1HH2P 2PI2A 2LXJA 3RLOA 5IYBG 4LF6Q 4OX9Q 2R7ZH 1N8RC 4B3TL 4A3FH 2BH2A 1XNQQ 4GNXB 1EQQA 2E2HH 4DV0L 2F52A 3RLFA 3BU2A 1EUJA 2VS1A 1LM0A 1E3PA 1P8LA 3PUXA 3SGIA 2QA4A 4B3TQ 5IYDH 3HOUH 3TREA 1PH9A 3I55A 2D0OA 3I7FA 1QZHA 4DUZQ 1HNXQ 3ULJA 5M3FH 3CMEA 1NY4A 2R7DA 1XNRL 2YTYA 1AE3A 2UUCQ 4JI0L 1X65A 4GN4B 3KYHC 4JOIC 4GOPB 1S72A 2D0PA 2VQEQ 4JC0A 5ELOA 3K7AH 4AH6A 1VQLA 3B6YA 2VUMG 4DK6C 1EIYB 4IJLA 1Y1VG 4DV5L 1PH1A 1B8AA 4PZ6A 3CCEA 1RIPA 4OONA 1Q1EA 4HIDA 1Q82C 4A3IG 3HKSA 1K8GA 2B63H 3CCSA 3A74A 1GKHA 4JI6Q 4PZ7A 5IE8A 1JE5A 1VQDA 4HIKA 4JI4Q 3K7UC 4A3KG 3HOWH 5C4XG 4B3MQ 4AQYL 3JC66 4UY8C 1SMXA 3KF8B 4A75A 3T1HL 3BJUA 3D0FA 1QUQB 4P71A 5IYDG 1XPRA 2IX1A 4GKJL 4KLKA 4JG2A 3M4PA 3ERSX 2CFMA 4UP9A 5E7NA 5M5YH 4DV3Q 4BY1G 1KL9A 4GNXA 3H3VH 1TWFH 1WOCA 3TRZA 3CCMA 5M3FG 2Q2TA 3ULLA 3UDIA 4JV5Q 4BXXH 1C7YA 4BBSH 1WI5A 2ES2A 5FLMG 2UU9L 4JI2Q 3I2ZA 1Y1VH 2VNUD 4HIMA 4JI2L 3CPWA 3CD6A 4LF5L 1VQ8A 1K3RA 4AQYQ 4LNQA 1V1QA 3T1HQ 1FL0A 3LGJA 1VQ7A 2IHFA 5GAGC 3E9HA 1SRUA 4X62Q 4NPSA 3J80c 2JJQA 4DR3L 3I4NH 2CWPA 3G4SA 4OWWB 2WB1E 1SR3A 4DKAC 1QUQA 3M7NA 4KHPQ 3KDFB 4AIMA 1CUKA 1YHBA 4OO1G 2OQKA 4MNOA 3GTGH 3G6EA 4H02A 4IOCA 3F2CA 4GN5A 1TWHH 2F4VL 3KJOA 1VQGA 3GDEA 1GD7A 2MQHA 4B3RQ 1L1OB 1N36Q 2AWNA 2F3IA 3HOUG 5M5XH 3PIPA 4JI5L 5FLMH 1IBML 5C44H 4B3SL 1Y14B 1GVPA 4A93H 4DV3L 3PUYA 3F2BA 2E2IH 4WJ3M 4IPGA 1X55A 1IBKQ 3H3VI 3KLWA 1HR0L 1IXRA 1B70B 1NMFA 4APVA 4LF9Q 1G291 2VZAA 1VQMA 1VQFA 2GN5A 1QVFA 2R92H 1BKBA 2I5MX 1PH6A 2DGYA 2NZOA 1MJCA 1YZ6A 2NVXH 2JA7G 2CWAA 3K0XA 1N33L 1X3GA 2E5LQ 1J5EQ 1I5FA 4LF7Q 1TWCH 2Z6KA 3PSIA 1UE5A 4DV2Q 1K8AC 3GTPH 3RLNA 5C0XG 3H0GH 3T1YQ 2UUBQ 5GQOA 4DV4L 3T1YL 3KJPA 2KCTA 1I94L 2UUBL 4AYBG 4L5RC 3J7ZC 1L1OC 1XNRQ 1A63A 5JJLA 2HHHQ 1FJGL 4FDBA 4RMFA 5LMNQ 3GTLH 4UPAA 3CQZH 1GO3E 5AJ3L 4LF9L 1PH5A 4GOPC 4OX9L 5LMNL 2JEBI 4PZ8A 1NBWA 1SLJA 2GVAA 1XNQL 1VQOA 4R4IA 3GTOH 2YTXA 4DAYB 1VQ4A 3AEVA 3HFZB 1TXYA 3PV0A 1H95A 5IP7H 2E2JH 2KHJA 2KHIA 4A3EG 4BBSG 4POGA 4A3CG 1EYGA 2V1CC 1K83H 4DNIA 3I56A 1Q8KA 2N3SA 4ME3A 4DV6Q 1QZGA 4JOIA 1Q46A 2UXBL 2ZJRA 4LF4Q 2DUDA 5IT9c 3CC7A 2L15A 3Q8DA 3NELA 4MZ9A 4A3KH 1M90C 5IWAQ 3ULPA 3AFPA 3KF6A 4R4OA 3EIVA 4LFCL 4A3JH 4DV7Q 2UUAQ 4L5QA 4BY1H 4DV1Q 4NXML 2NZHA 1YNXA 4IJHA 4DPGA 4OWTB 2R7ZG 2WAQG 4X65Q 4LUZA 3RZOH 2Y0SG 1VQKA 4LF5Q 1AE2A 3UDFA 4B3ML 4GLVB 3OYYA 4X65L 4DR1Q 1A8VA 1P16A 3STBC 4JBJA 1OXVA 2OWOA 1XMQL 4WJ4A 1JJGA 3G48A 3FHWA 1LYLA 2YYZA 1NTGA 3H15A 5LMUL 2ATWA 2I0QA 2ASBA 1JT8A 3RNUA 4QL5A 4ALPA 3GTMH 2NN6G 4DR4Q 3W1GA 4LF8L 2ZTCA 3ER0A 4DR2L 3PO2H 4JI6L 5GADC 1X9NA 2B3GA 2I5LX 1YVCA 5J3BA 1YEZA 2UUAL 4HJ9A 4LF7L 2JA6G 2R92G 3AQQA 3L0OA 1RL2A 2ALYB 3HOYH 1LUZA 1PFSA 4QQBX 4A3JG 1NE3A 1W2BA 4JI7Q 5H1SE 4QIWE 4NXNQ 4LF4L 1CKNA 3S2HH 1OTCA 3ZJYC 1QVGA 1YJ9A 4LF6L 4JI1Q 2B29A 2NVTH 5FJ8G 1FJGQ 2Z0SA 2A8VA 2HT1A 1W3SA 2PI2E 2Q2IA 4L5SA 4GN3B 2HQLA 4B3RL 1J5EL 4R4CA 1N33Q 4JI8Q 3CC2A 4UP8A 5IYCG 4DUZL 3S14H 3GD7A 3UE1A 1NJIC 3AFQA 2HIVA 2KBNA 4LUOA 1PYBA 4LFAL 1D7QA 4NXNL 1I94Q 1CSPA 1YHQA 3CCQA 2HHHL 3HOYG 1EQRA 4O0AA 1HZAA 4DV5Q 1UE7A 1XPUA 4A3GH 1XJVA 4Y7NH 2XGTA 4YWMA 1U5KA 3A5UA 3F8TA 1X56A 4JYAQ 2H5XA 3TQYA 5C0XI 5EAYA 3NEMA 3CF5A 3EN2A 4DV2L 2JE6I 3K80C 2E5LL 1EIFA 1E1OA 4X66Q 5JEAG 2VW9A 4P75A 4JI3L 3A5ZB 1HR0W 1E1TA 5BR8L 3A0JA 1PV4A 1VQAA 1IBLQ 3I4MG 2AWOA 3HOXH 4DR1L 4J15A 4L5TA 4OWXB 4EQ5A 3OTOQ 4YY3Q 2WP8J 2K5VA 1R9TH 3HOZG 1IYJB 2R7FA 4DR6L 2PMZE 2JA8H 3WWVA 1KRTA 4LFCQ 1V43A 3RN2A 4DV7L 1X54A 4JI4L 1HNWL 4Y52H 1X3FA 1SE8A 3PO2G 4QJFA 1L2FA 2EQSA 3PO3H 4DUYQ 4QY7A 2JA6H 3J81i 1N34L 5K36G 1VQBA 1JJ2A 4YWKA 1TWGH 1QVCA 4X64L 4BY7G 4DR3Q 1Q86C 3H0GG 4LWCA 1VQ9A 2VQEL 5GROA 1XPOA 2BH8A 3J80i 3GO5A 1C0AA 1LTLA 1KHIA 3PUZA 2PNHA 3CCRA 1OXXK 3GTQH 1K9MC 4IFDJ 2NN6I 1WYDA 4C3JH 1PH3A 1K73C 1KIXA 4XTCS 4DK3C 2PQAB 1JB7A 3ICEA 3HOZH 2BA1A 3F2DA 1UWVA 5ELNA 4X66L 2CKZB 1WFQA 4DR5Q 3PIOA 4A3MH 1HJPA 2VL6A 3JAMc 2UXBQ 1XTDA 4A3BH 2WAQE 5FLXc 4MTNA 1BVSA 3MXNB 4A3EH 1Q1BA 5IWAL
chains in the Genus database with same CATH superfamily
4HEDA 3CU7A 2PQAA 1CKOA 3HOZB 4K0KQ 2IJ0A 3M4OH 1RF2D 1SDFA 2MO1A 4H0LC 2YTVA 1S5CD 4R1JA 3A8IE 5FO9B 2F0HA 1WTOA 1Y1WB 3CC4A 1EFWA 2YV5A 1VQ5A 1UE1A 3FKIH 1F9RA 3M3YH 1E7ZA 4JI7L 1VDZA 3MEFA 1K0RA 2NUCA 1E0BA 1SFOB 3SR1A 4Z9CB 3TP6A 3BZCA 3I8ZA 1I6HH 3U9OA 3I4MH 4K14A 2EDGA 3HOWB 1VCIA 2IY5B 2A19A 3E0JA 3KLRA 5IT9L 2EJMA 3FKIB 1VQJA 2NN6H 1XTCD 3A54A 3NP8A 2JA8G 1AH9A 3S17H 1LTBD 4RHSA 4JVZA 3K58A 4O2DA 5COYA 3U4ZA 4DAPA 1VQCA 4ZK9B 2UXDQ 4CDDC 1B1ZA 2Y0SE 2AMCB 2J0TD 4OELB 1D8LA 2D5DA 3R2TA 5JEAJ 4OEMB 4KI0A 2C35B 4A3GB 2NVQH 5FJ8H 3D31A 3DWAA 2VQFQ 3U50C 5IGFA 2NVTB 2BA0A 3VR6A 2RQXA 1PA6A 1SFOH 1PRTD 2MNAA 1EIGA 4JBWA 3A8JE 3EVQA 1EYDA 4FNFA 4M8AA 1UEAB 5C4XH 4DR2Q 4P72A 2X6LA 2N8NA 4R4QA 1WTQA 1EWIA 3M85A 4RGOS 4NB3A 4A3GG 1WCMG 1ASYA 2UU9Q 2I46A 1EQVA 1EIHA 2V4DA 4DV6L 3GTKH 3PF5A 1I50H 5EKKA 1Q3LA 4POFA 1K8MA 4IOAA 2HD3A 1U4MA 1CQFA 4BS9A 5KYLA 3M7GA 4P74A 5EQ0A 1EY8A 1Y8OB 1ZEQX 2RHSB 2OTJA 4A3LH 1O7IA 1TY2A 1TWHB 2MPMA 3GTQB 1CTMA 2RCNA 3MVVA 4FP5D 4QF4A 3MFYA 1N32Q 5J39A 2ZXRA 1J6QA 3PUVA 1JICA 4JI5Q 2QKIC 2A1AA 2O4XA 2F0JA 3CHBD 4CJ0B 3PCOB 3HKZG 4BY7B 2K14A 1N9WA 4DUYL 4EQPA 2QGQA 1RCVD 4XYQA 1BBUA 3K59A 2R93G 2KENA 3MHBA 1XMOL 1HFGA 2F0DA 1ENCA 1MHWC 4BA2I 5EPLA 1DM0B 5FO8B 4BA1I 2JA5H 3DMUA 3NQIA 4Q0FA 1EY6A 2K5NA 5C0XJ 5I6WA 2NTTA 3KK7A 2EIFA 4OO1I 3KOJA 5C4JH 3QB3A 4EX5A 4ZYSA 2L4NA 2RF4A 2WV6D 3EQLC 4A3FG 4GKJQ 5A35A 3FKIG 4RH6A 4YHHQ 3UE0A 3OTOL 1G2SA 1U9RA 2R93H 1AFPA 1SYBA 4LUVA 3AB9A 4RGNA 3DWPA 5C5MA 3TEHB 1C9OA 3RZOB 2YU9H 2ZM6Q 1TY0A 3V96A 1EU3A 4JI3Q 1BBXC 1FVIA 2N78A 3I4NG 3PF4A 3A7AB 4IO9A 1S5BD 2QEXA 4DAMA 2Z8LA 1Y1WG 4GLAC 4HJ5A 1WCMH 1DCZA 1GOZA 1B3AA 1HH2P 2LXJA 3MFGA 3RLOA 4B3TL 4A3FH 4GNXB 2E2HH 2F52A 4DNRB 5IOCA 1DYQA 3PUXA 2QA4A 4MTKA 5IT9E 4DUZQ 4A3KB 3ULJA 1S4ZA 1BCPB 2NWGA 1AE3A 1X65A 2VQEQ 3K7AH 1X3PA 2C5CA 2VUMG 1G2TA 4IJLA 4OONA 3MXPA 1Q1EA 3S16B 4A3IG 1L0YB 4RFBA 3SK6A 2L9HA 5IE8A 3HOWH 2EYHA 3K7UC 4DA2A 4A3KG 4AQYL 3JC66 4BWGB 4UY8C 3SEBA 4A75A 3T1HL 3BJUA 4P71A 3OIQA 1D5ZC 3BDOA 5IYDG 3PO2B 2WINB 5M5YH 4JG2A 3LNNA 2CFMA 4DV3Q 1EYCA 1JB3A 1WD0A 4BY1G 3H3VH 1HPCA 4DK1A 5ELFA 3ULLA 3UDIA 1BF4A 2YU9B 4BBSH 1WI5A 1RHPA 2IW3A 3VYUA 5FLMG 2A69D 2GA4B 4XQJA 1Y1VH 2VNUD 5D65A 4HIMA 2FINB 2PPBC 3CD6A 4H7BA 4KD3A 1VQ8A 3NUCA 1K3RA 2TSSA 4LF5L 4LNQA 3EA6A 3T1HQ 1FL0A 3LGJA 1VQ7A 2IHFA 5FLXL 1KDCA 3G4SA 1H9MA 1CUKA 4OO1G 4MNOA 3GTGH 3G6EA 3T53B 3GDEA 1GD7A 5FO7B 4B3RQ 3CKIB 4J6HA 1N36Q 2F3IA 4Y7NB 2JA5B 2EY5A 4HCSA 3P1HA 3K7AB 4WJ3M 3S9WA 2EE1A 3PUYA 4I7AA 3IFTA 3KLWA 1NMFA 4APVA 1VMPA 3BDCA 3NBIA 1PH6A 1EOTA 3IFDA 1X3GA 1HTLD 1J5EQ 1KNAA 1QWYA 1UE5A 4CBVA 1K8AC 3GTPH 5C4XB 4K8JA 1WVLA 4IURA 3H0GH 1PFNA 5KEEA 2UUBL 3KJPA 1SE2A 3J7ZC 4RMFA 4F88A 2RBMA 3FVQA 4UPAA 5AJ3L 1GUSA 1B53A 1BCPC 3AEVA 3W3AA 3PV0A 1H95A 3SK5A 5HGTA 1FR3A 2FJ2A 1RTNA 3V05A 4A3FB 1QZGA 4ME3A 2N3SA 4DV6Q 1MSGA 1Q46A 3GV6A 3P7JA 1NAPA 3CC7A 4RCOA 3K0YA 4K5WA 3OPOA 3AFPA 3MXUA 3R2IA 3RZDB 3OMGA 2K33A 5FLXE 3S1NB 4L5QA 5CBAE 4BY1H 1YNXA 2R7ZG 5I6YA 3FDTA 2Y0SG 4LF5Q 4B3ML 4DR1Q 1WCMB 1ZYRC 3STBC 4JBJA 1OXVA 1EY9A 1XMQL 4OHJA 2R93B 1JWSD 3MC0B 1BR9A 1KABA 3BS1A 1NTGA 2KCNA 2F3VA 2ASBA 1GUWA 1MSHA 5CMDA 2E75C 1Y1VB 2EOTA 3J80L 3OW7A 5D3IB 3PO2H 5GADC 2I5LX 4IUTA 4AYBB 1CZGA 5I9PA 1ONLA 4QQBX 1SEBD 4QB4A 1PRTC 4PNYA 1JR0D 2Z4IA 2JXMB 4LF4L 4ZLTF 1CKNA 2JA7B 1VF7A 1YJ9A 4KN7C 4JI1Q 1F2MA 3DHQA 4Q5VA 4LF6L 5M9OA 1W3SA 2Q2IA 3TBIB 1G8ZD 1R4PB 3N52A 4B3RL 4R4CA 3BYYB 2R92B 4DUZL 3GD7A 1I4QA 2F0IA 4LUOA 4UAIA 4LFAL 2XWJB 1EQRA 3AU7A 4DV5Q 2XIWA 4Y7NH 2F0TA 4YWMA 3T16A 1U5KA 1Z6HA 4H13C 5EAYA 1RODA 3CF5A 3EN2A 2EY1A 2AUJD 3QOJA 2F0NA 4OO1H 1E1OA 4WJWA 4JI3L 1HR0W 3VYTA 5BR8L 3GTJB 1IBLQ 3A7LA 1JORA 1CZWA 4J15A 2FMMA 3VR4A 3RD4A 1LT6D 1L0XB 1JWUD 2KQ3A 1R9TH 3HOZG 2DY7A 2R7FA 1X3QA 4DR6L 3WWVA 2K7VA 1V43A 1V1OA 3RN2A 1K28A 1B9NA 3HOVB 2WIIB 4Y52H 1L2FA 4JK1C 2TMPA 1HQRD 4DFAA 4LWCA 3NTKA 2VQEL 5GROA 3MA2B 2BH8A 3J80i 1KHIA 2F0PA 5LL6X 3FEWX 1A15A 1PH3A 4DK3C 2MGSA 2PQAB 1JB7A 1DJRD 3Q6SA 1BCPF 5ELNA 4X66L 1BO0A 5G3LF 4K2KA 1XTDA 4A3BH 3MXNB 4X6AH 2WKCA 4DAYA 2L55A 3TS2A 4EQNA 4OXPA 1A62A 2QF7A 3BZDB 3CP0A 4G7HC 2B2TA 2B39A 1H9JA 5HGQA 4JBKA 1MKHA 4DR7L 1SN8A 2K52A 4IFDI 4A76A 4KKSA 1HNXL 4PG3A 2NYZD 1MIUA 3HKZE 3I72A 4JI8L 1PZID 1DD2A 3PUWA 4X3TA 1VF5C 4RGTA 3S1MB 4YCVA 1GUTA 1HZ9A 5CV5A 1KLGD 2OCEA 1PFMA 1TS3A 3AYHB 4YHHL 3CCJA 2UXCQ 2F0MA 3DEPA 4KJOA 4B9XA 4MN3A 4N9PA 3KFUA 1YI2A 1YITA 3SK4A 2VY3A 1ENFA 5KIXA 1S5ED 1V8QA 1Q81C 1TIID 4KY7A 5CYUA 4A3BB 3W5OA 1DGSA 4WFN3 1PH7A 1FD7D 1PMRA 5M3FB 4F7XA 2MFIA 3L9AX 1IBKL 1B7YB 4HTHA 1CI3M 1YBYA 3K5MA 3M9BA 3SVMA 2NTSA 3IL8A 4X3SA 4C3IB 2E2HB 5JOBA 3LWEA 2K05A 5BN5A 1ICFB 4JCVE 1XMQQ 3I4MB 4YCUA 5LMUQ 3CCVA 2EJGC 3S24A 4TQUS 3PIP3 1OXTA 1VQIA 4ULLA 4BBRH 4K8IA 4DV1L 1SMYD 2GVBA 4CKEA 1LO5D 4DU9A 1NR2A 4FYDA 1B3QA 4IZ8A 5IYBH 3HOXB 3RN5A 5AFWA 3J81j 2OTLA 3STBD 2KECA 4JI1L 3HOVH 1RJTA 4JYAL 4DV0Q 4TRDA 1YJNA 1S40A 1H9RA 3G71A 1EOVA 5BR8Q 4DR7Q 4C3HH 1SYCA 2BE5D 2JK8A 3L3OC 4J8QA 4FVMA 1AEXA 2Q2HA 1STAA 1LTGD 3W1BA 3SXHA 2ZTEA 2AKWB 2QEJC 4BY7H 3DLLA 1GJXA 1JE4A 1BCPD 1PYSB 3BVGA 3CMAA 5C44G 1EY4A 4PV1C 5JPNC 5A2QL 1AN8A 1CKMA 2HCCA 4FO2A 4K5XA 4TVAB 3I4OA 2F0UA 1NMGA 4UP7A 3CCUA 1NCVA 3T56B 3S1RH 3D4DA 3GTJH 1ML0D 4DR4L 2PW5A 2N49A 3DUZA 5DLQE 1KC8C 1BDOA 2D62A 1I3QB 5C0XH 1ASZA 2F4VQ 1R4QB 1KD1C 1RD9D 2EXDA 1GM5A 2ICIA 3NXWA 1HFNA 4GLXA 1AP0A 4NKLA 2ID0A 2IHEA 3I90A 4IPDA 4KY5A 2ZTDA 5HY6A 4JV5L 3S15H 2JP1A 5AJ3Q 3F2UA 4QGUA 3E9IA 4JBMA 3RZDH 4A93G 2LSSA 1F9PA 3M4QA 2FXQA 1QB5D 2DY8A 4KKUA 4FF2A 1Q12A 3TZUA 3BZKA 3JAMi 1SROA 2LXKA 4A3LG 3J7A5 3C1FA 4HJ7A 4LAAA 2F0QA 1KAWA 1FNUA 1N8RC 1EQQA 1JOOA 4DV0L 1GUOA 3RLFA 3SGIA 5IYDH 2SDFA 2K6AA 1PH9A 3MXNA 4P2CB 3S2HB 1HNXQ 2F0VA 1STBA 2KOLA 5M3FH 2EYMA 3CMEA 2R7DA 2HQEA 2YTYA 3HZXA 2JA6B 3KYHC 4JOIC 2D0PA 3HOYB 1VQLA 5C44B 1C8CA 3S17B 3B6YA 4DK6C 3NPPA 1A3TA 3D4RA 1C4QA 1ENAA 4PZ6A 1RIPA 1Q82C 1IKLA 5KYIA 2JN4A 2A6EC 3CCSA 2B2YC 3A74A 4JI6Q 4PZ7A 4HIKA 4JI4Q 5C4XG 5KGUA 1TWFB 2QCPX 3KF8B 3D0FA 1LABA 3NWTA 3VA7A 1YNND 2IL8A 3M4PA 1II3A 4KV6A 1WOCA 3ONAB 3CCMA 5M3FG 3TRZA 3RUZA 2RA4A 3H94A 3TMEA 4JV5Q 5JVH3 2LS01 1QNKA 2ES2A 2ZXOA 1OO9B 1SJED 4L8JA 1SNPA 3R8BA 5C4ZA 4JI2L 3D6WA 3CPWA 4ZKBB 4AQYQ 4HCEA 3C46A 4ZUJA 2EY6A 2L12A 5GAGC 3WOEA 2JJQA 4DR3L 2HCIA 3TP5A 1QUQA 1SYDA 2E2JB 1JC7A 2PZUA 1SNDA 1YHBA 4H02A 2PNRC 3F2CA 4ME5A 3KJOA 1VQGA 1SAPA 1IYUA 5CV9A 2MQHA 1L1OB 3X3MA 4PMBA 5C44H 1BOSA 1GVPA 1I4GA 4DV3L 4IPGA 4KMUC 1IBKQ 4G7ZC 5IIFA 1S5DD 4LF9Q 1G291 4XYOA 4IUUA 1VQFA 4MHEA 1TQOA 1YZ6A 2CHBD 2NVXH 2CWAA 2E5LQ 3QIAA 1B9MA 4LF7Q 1TWCH 4DV2Q 3NSWA 1SNMA 4A3JB 3V2TA 3T1YQ 1ILQA 5J1ZA 4C2MB 5GQOA 4DV4L 2KCTA 4A3IB 1A63A 3A56A 5LMNQ 5I4DA 2Z4HA 4OX9L 2B2UC 5LMNL 4PZ8A 2M9VA 3GTOH 2YTXA 3O13A 1LTRD 1JWMD 3I70A 4BBSG 4POGA 4A3CG 3S15B 1K83H 4DNIA 1Q8KA 1EQTA 1PYWD 2QILA 2ZJRA 4LF4Q 1F77A 3Q8DA 4MZ9A 3NELA 4A3KH 3C3LA 1G91A 3HG9A 2B8FA 1PTOF 4R4OA 4IN3A 3HOUB 2G5DA 5BN3A 3GTPB 1ET6A 2NZHA 4IJHA 2KEDA 3KLSX 4OWTB 4QUCA 4DPGA 1I4XA 2WAQG 3UDFA 4GLVB 1P16A 2E74C 4FXGC 2K5WA 1KDBA 2F0OA 1W6JA 3H15A 2I0QA 4C3HB 4V0BA 2QDBA 1LT4D 3GTMH 2A74C 3J7AF 1QNUA 2ZTCA 5M5YB 1LTSD 4CJ1B 4JI6L 1XXGA 1X9NA 1YVCA 5J3BA 4ID6A 3K5LA 1YEZA 2J4XA 2R92G 2JA6G 2L1BA 1A2UA 4FXDA 2ALYB 3J81L 3HOYH 4HMIA 2KJXA 3TP7A 1W2BA 1CHPD 2A5HA 5H1SE 3JAME 2A68D 2SNMA 3I4LA 1AZQA 1IL8A 3KLSA 2Z0SA 2A8VA 2ENBA 2R61A 2FMCA 2HQLA 1D5MC 4JI8Q 3CC2A 4L6TB 5I2XA 3UE1A 4FF3A 3AFQA 1I4HA 1HA5A 1I4RA 3HKZB 4TSSA 1D7QA 4NXNL 4XDXA 1TWGB 4A93B 1CSPA 2HHHL 1CFMA 1XPUA 3F8TA 1X56A 4JYAQ 3TQYA 5C0XI 5ELEA 3NEMA 2XSCA 4KTAA 2JE6I 3CQZB 1EIFA 1D1KA 4X66Q 4NW2A 2VW9A 3A5ZB 3A0JA 1H9SB 2AWOA 3HOXH 4DR1L 1LV9A 4RWSC 3OTOQ 4YY3Q 2K5VA 1TWCB 1IYJB 3GQBA 3ND8A 4A3DB 2PMZE 1KRTA 4ZQ3A 2A6ED 1RDPD 3K5NA 1HNWL 2IWHA 2EQSA 3PO3H 4QY7A 4LK1C 1GXDC 5TSSA 1D6EC 1PTOC 3QOLA 4CDFC 1O7YA 1TWGH 3FPUB 4X64L 1BQQT 1Q86C 1HUMA 1XPOA 2QW7A 1LTLA 2B2VA 2PNHA 3GTQH 1K9MC 4IFDJ 2NN6I 5JJZA 4C3JH 1K73C 1KIXA 3ICEA 2AQ3B 1D5XC 2Q8RE 2CKZB 4QIWB 2UXBQ 3PIOA 1YNJC 2VL6A 5CV7A 3JAMc 4MTNA 2A6HC 1BVSA 4CHTB 4QUFA 2J7ZA 3SE0A 1EZ6A 3HS0C 2K5DA 3NBHB 4ODGA 1CM9A 2O5IC 1LLRD 1HZCA 2K01A 2BDNA 5EPKA 3IKJA 5ISRA 1TR5A 5GAEC 4KY6A 1S3OA 1VQNA 1ESRA 2G9HD 4R9WA 3PQIA 5C3EH 4A4IA 1IZ6A 1HUNA 1GUGA 4E6IA 5C4HA 2JA8B 1X32A 2PZTA 3URYA 3WDNA 3VYSA 4L63B 2CW0D 1HR0Q 5IGCA 1PVOA 3EBEA 1OXSC 1UE6A 2XRSD 3QG1A 4K6LA 4B9WA 4G7OC 3PGZA 1KQSA 3S16H 4WRDA 1DOLA 4R8IA 2IT1A 3UDGA 1YHAA 2D9UA 1A0IA 1N34Q 4B3SQ 2ZT9C 3NTIA 5CR3A 1STGA 4BBRG 1PH4A 1QE6A 3VDYA 3LWUA 1VS0A 2FHTA 4PMCA 1HQMC 1MBYA 3A55A 3RR5A 1PH8A 2EJFC 3VR3A 1NSNS 1FGUA 2K5HA 3M4OB 2A73B 2Z6KC 2F0EA 3E5SA 3I73A 1Z47A 3TSSA 1ESFA 1GHKA 2SNSA 1YIJA 2JA5G 3ERQA 1IL2A 2VUMB 2SEBD 4EGVA 1CQVA 4C2MH 5EKLA 1F2ZA 2ZJPA 3PO3G 5CC4A 4DGZA 2AUKA 4DR6Q 5M3MG 3K81C 1F9QA 4XQNA 2XWBB 3G6JB 3NWSA 4IUQA 1SYGA 1PXUA 2Q2UA 5EKIA 1SSOA 1UEBA 3UDXA 4XXEA 2PYKA 4CJ2C 2F03A 3BVZA 4AYBE 1O78A 4IFDG 4IPHA 3TS0A 1TS5A 5T1GA 1U0LA 4A3MB 5IGGA 4A3MG 3N6RA 4N8X1 5ELBA 3H3VC 5M5WH 4BY1B 4YCWA 3OHXC 2K28A 2F0KA 2B8GA 2RDHA 4A3EH 1B50A 1CSQA 1HRJA 4HJ8A 1HTPA 3DM3A 1EEID 5G3LD 2LMCB 3NTHA 3L7ZC 5M3MB 2EZVA 2B2UA 4GKKQ 4HSVA 5IP9H 2UXCL 1LACA 2KEEA 2ICEC 4LW1A 4PMWA 3QR8A 1WTHA 4DR5L 1KTKA 2RSNA 3J7YW 1MJEA 1VQPA 1N36L 4DV4Q 4U68A 2K5QA 2G9DA 1Y8NB 4GNXC 1U4RA 2NZ1D 1G6PA 1L0WA 5BN4A 3S1QH 3SDZA 3QWNA 4A3IH 2JA7H 3P75A 4ILWA 1I4PA 1OXUA 4FF4A 3CXCA 1CKNB 2MO0A 2ZM6L 1DONA 2NVXB 1E24A 5DNFA 2VQFL 2PMZB 3H6MA 3KF6B 3KDFA 4DN4M 4P73A 4X62L 2Q8TA 1HNZQ 4A3EB 4LF8Q 3GV3A 3S1NH 4GZYC 5IYCH 5IY0A 4NXMQ 1JOKA 1WTXA 1PTOH 4YIJA 1HNWQ 3L2PA 3CAMA 2VUMH 4IQZA 3GTLB 1D2BA 4KHZA 1WD1A 1PHJA 3ITPA 5C3XA 4LFAQ 3IRBA 2Z1CA 2Z6BA 2HDMA 2C9OA 2PI2A 1EZ8A 4LF6Q 4OX9Q 5C6AA 2R7ZH 1ZXTA 3R93A 1EUJA 1LM0A 1E3PA 2LFNA 3HOUH 3I55A 2XVSA 2ZXPA 5IODA 3I7FA 1B2TA 3U9SA 1J9OA 5KRUA 2UUCQ 4JI0L 4GN4B 4X3UA 1K83B 3TDQA 4GOPB 1S72A 4JC0A 4S3SA 4AH6A 1PTOD 1TS2A 2AQ2B 1STNA 1EIYB 4DV5L 1Y1VG 5CV6A 4RCNA 3CCEA 4HIDA 2XRQD 1JOQA 1K8GA 2F0SA 1O7ZA 1JE5A 5CV8A 4B3MQ 2X69A 3WOFA 4CKCA 2N88A 4GKJL 4UP9A 5E7NA 3ZYYX 4KK7A 2Q2TA 1EY0A 1G6ZA 4BXXH 4H44C 1C7YA 4IUPA 2XN9C 2UU9L 2EYJA 1PRTB 3TN2A 3FMCA 3D3RA 1RKNA 4HMJA 1V1QA 4IUNA 3W2DA 1QOHA 3J80c 4I7ZC 1SRUA 4C3HG 4NPSA 4X62Q 3I4NH 2CWPA 4OWWB 3H91A 1SR3A 4DKAC 1O7LA 2VXWA 4GN5A 1IYVA 5E3FA 2AWNA 2L0CA 1EY5A 3HOUG 5M5XH 1KNEA 4JI5L 4B3SL 5KNBA 2A68C 3F2BA 3J80E 2E2IH 1X55A 2H4OA 3H3VI 1FNWA 1SXTA 3K6OA 3Q22A 1HR0L 1B70B 1CHQD 2CVRA 1VQMA 4RGMA 1U4PA 2GN5A 3NK9A 2R92H 1BKBA 2E76C 1NNXA 4DAVA 1MJCA 4ZRZA 5C5LA 5T1IA 5A2QE 3K0XA 2L5TA 3MAQA 1I5FA 2Z6KA 1ICWA 3PSIA 3RLNA 3OSOA 3A8KE 3I91A 3T1YL 1I94L 1L1OC 1XNRQ 1A6XA 5JJLA 4K5VA 1FJGL 3H0GB 1STHA 1PH5A 1UNSA 4GOPC 2JEBI 1SLJA 1IW7D 4UHVA 4R4IA 1PZJD 2NVQB 5DM63 3EJIA 3HFZB 1TXYA 2LY7A 4I65A 4A3EG 3EFXD 1SBBB 3MZ5A 3S1QB 2V1CC 1H9KA 3BVMA 2UXBL 2DUDA 5IT9c 1VMCA 5LHY1 1M90C 2K1BA 5DM73 3KF6A 2OEOA 2OXPA 3EROA 4RHRA 1Y8PB 3OOCA 1CT1D 1STYA 4DV7Q 4A3JH 5K36H 3SK8A 2B2YA 1SYEA 2EY2A 2F0GA 3NBHA 4KKTA 4PQXA 3K57A 3NHHA 5EBCA 3RZOH 1VQKA 2DNCA 1AE2A 3IAYA 4X65L 1F2YA 1A8VA 4BBSB 1JJGA 3G48A 1LYLA 4JW0A 2ATWA 3MTSA 3C2PA 1PZKD 3D8GA 3RNUA 4QL5A 4ALPA 3HEJA 4DR4Q 3W1GA 2EYOA 3ER0A 2NB0A 5JVG3 3M3YB 1HA6A 4KHVA 4IUVA 3K5OA 2UUAL 3AQQA 5E4XA 1RL2A 1V1PA 1LUZA 1PFSA 2F4IA 3MEHA 1NE3A 4A3JG 4QIWE 4OL7A 1HCZA 3T13A 1DOMA 3PMFA 1OTCA 3OIPA 3S2HH 1QVGA 1ET9A 2KHSA 2B29A 5FJ8G 3AMUA 2HT1A 2PO4A 4C3JB 3NE5B 2E2DC 2RSOA 4GN3B 1WTWA 1J5EL 3FPPA 2JSOA 3E3XA 4UP8A 3I4NB 2K04A 2RDFA 1BUVT 4ZCKA 4CDEC 1CA5A 2DJGC 1PYBA 2CQAA 5L37A 2EVBA 3HOYG 2LKVA 1PDQA 4O0AA 1HZAA 4A3GH 1UE7A 1XJVA 2BDOA 2XGTA 2NVYB 1WTVA 2A69C 2H5XA 1FGBD 2Q8IB 3K80C 5EJWA 4XT1B 5M5WB 1TKWB 3HGBA 1B44D 2SOBA 4P75A 2EYFA 1PV4A 4RA8A 4C1NI 2O2LD 3C1EA 4L5TA 4OWXB 3TP8A 1YNNC 1ILPA 2B2TC 3H09A 1JQYD 5CBEE 1KAAA 2KA7A 4LFCQ 5C3EB 1Q90A 1M4VA 4DV7L 2EYPA 1M8AA 1Y69U 4QJFA 2H1EA 4DF7A 2N55A 1I50B 3BG3A 4DUYQ 1N34L 4BBRB 3BYTB 4OGQC 1SNOA 1Z7TA 1JJ2A 1T5EA 4YWKA 2A6HD 1QVCA 4BY7G 1YNJD 5JEAH 1JCKB 4MIUA 3PUZA 1S5FD 3OMCA 2HUGA 4M1UB 4IFDH 4DXFA 3HOZH 1UWVA 1SNQA 4R8NA 1WFQA 3E6ZX 4DR5Q 3MXGA 1HJPA 4DK0A 4KD4A 5FLXc 4U673 1F9SA 1MGSA 5IWAL 4A3CH 2RKSA 1KXLA 4LFBQ 5M3MH 2JA9A 2F0FA 1T9HA 5CORA 1KLUD 2VB3X 4XQQA 1I6HB 2OF1A 4OIJA 1EWCA 2AQ1B 1IBMQ 1IBLL 1DXMA 1Z9FA 1D1IA 1HNZL 3CPFA 3CRLC 1PH2A 4NMZA 3S1MH 3LX0A 1BBWA 1I3QH 1LTID 2MJ8A 1SYFA 2L11A 2XNAC 2RHQB 3DWQA 2AHOB 1BNZA 5JJIA 2E8GA 3KBXA 1PRTF 1I6VC 4N9TA 1N32L 1X6OA 4RKLA 1HZBA 3D6CA 3BDLA 1X3EA 4YWLA 2KVMA 2CCZA 2CH4A 4C1NK 1G51A 1HHVA 1E22A 4C3IH 1A3UA 4X64Q 2M00A 2BCOA 4JPBW 4HIOA 2JEAI 4IPCA 5JAVA 3HOXG 2K50A 5IGDA 4A3DG 3J81E 2ZJQA 5JJKA 3RMHA 2O5JC 2K75A 2R6GA 4O42A 1JMCA 1VQHA 1RTOA 2HIXA 4F8MA 1L1OA 4R4TA 4YY3L 4HJAA 1XMOQ 1XX8A 3HOWG 3FP9A 2I5HA 4F87A 1PTOB 3S2DH 1TWAH 1Y1WH 4C3IG 3ND9A 2WAQB 2PW7A 5IP9G 3CW2C 3OW2A 5C3EG 1DZ1A 2F0WA 2UUCL 4JI0Q 4FXKC 4HN7A 2EYLA 5GAHC 1YJWA 3K8AA 4K0KL 2WACA 1Q7YC 2FFKB 4A3BG 1TU2B 1SMYC 1JJCB 3J81c 4GOPA 3KUPA 2QDLA 4XIGS 2K4KA 2HDLA 5I2YA 1K3BC 2WB1G 2BOSA 5HURA 4GKKL 4LFBL 1CA6A 1WJJA 2I07B 1EWHA 1HXYD 1VQEA 2KUMA 3U58A 4GS3A 2Z9HA 1TWAB 1XWEA 4RG1A 4V190 2R3ZA 2KCMA 1IW7C 4A3DH 2MUYA 1VQ6A 4BXXG 4C3JG 4FF1A 3J7AV 2B63G 4DNTB 1LT3D 4XT3B 3DEOA 4KHPL 2WFWA 3DXJC 5DEHA 5LMNW 1EYAA 3U4VA 5F2DA 3VA5A 1KRSA 2JQOA 3QJYA 3OWEB 4QCLA 2NVYH 1IHZA 1E2ZA 1QCBD 1V9PA 2XTIA 5CV4A 3CCLA 3F1ZA 1O80A 1U4LA 1M1KC 2DNEA 2UXDL 5JPMC 1E2VA 2PZWA 3T51B 5IP7G 2OQ0A 3S14B 1MD2D 3HOVG 2CQOA 2VB2X 1NR4A 3NENA 2E2IB 2IX0A 1IKMA 1GHJA 1CK1A 1GUNA 3E0EA 5I9OA 5IYBG 1XYIA 2BH2A 1XNQQ 1K8OA 3BU2A 1UUPA 2VS1A 1EU4A 1H9SA 1P8LA 4B3TQ 1SE4A 4K2LA 1AZPA 2EPBA 3TREA 2B63B 1TS4A 2D0OA 1QZHA 4WORA 5NUCA 3DM1A 1NY4A 5KNCA 1XNRL 5ELOA 3VR2A 4CGYB 4X3KA 1MI2A 1PH1A 3VR5A 1B8AA 3PIO3 3HKSA 2B63H 1GKHA 5ELDA 1VQDA 3GTGB 4LJZC 1SMXA 1XPRA 1QUQB 2IX1A 4KLKA 3ERSX 5EGTA 1KL9A 4GNXA 4CKBA 1TWFH 3GTMB 3D4WA 4OIKA 1EY7A 4LMQD 1LT5D 1EEFD 2K03A 4UDUC 4JI2Q 3I2ZA 2WKDA 1R9TB 3T4AC 2P5ZX 2IPKD 1TT2A 3E9HA 1C48A 3M7NA 2WB1E 2B2WA 4KHPQ 3KDFB 4AIMA 2OQKA 2F1MA 4IOCA 1TWHH 2F4VL 2R7ZB 4KJNA 3JAML 1K0SA 2X6GA 3MWYW 2NBFA 3PIPA 5FLMH 1IBML 1NUCA 1Y14B 4A93H 3HRZC 4O1NA 1IXRA 2VZAA 1QVFA 3SHLA 2I5MX 3KF8A 5D3DA 2DGYA 2NZOA 1J8IA 5C4JB 3TZDA 2JA7G 1PLFA 2EXZA 4QMGA 1N33L 2RVLA 3Q0AA 3Q24A 4ABNA 1TVXA 1QG7A 5C0XG 2UUBQ 5EBDA 1WTPA 4AYBG 4L5RC 3FRPB 5LL6S 4N8FA 4EVOA 2HHHQ 4FDBA 3GP7A 3GTLH 1ZYRD 3CQZH 1GO3E 3M4YA 4LF9L 1NBWA 2GVAA 1XNQL 1VQOA 4DAYB 1VQ4A 2DJFC 5IP7H 2E2JH 2KHJA 2KHIA 3QO2A 1EYGA 3GTOB 1STEA 2Y0SB 2F3WA 3I56A 1SNCA 1LTAD 5K5PA 2RCFA 4JOIA 5IGBA 2PQEA 4C56C 5D14A 4G4KA 2L15A 2BE5C 5IWAQ 4J1MA 3ULPA 3EIVA 4ZUIA 4LFCL 4KN4C 5FKAC 2MHVA 2UUAQ 4NXML 4DV1Q 3OWFA 4NDXA 2JYOA 4X65Q 4LUZA 2OWOA 3OYYA 4WJ4A 4HAEA 3FHWA 5CGKA 2YYZA 5LMUL 5FK9C 3P20A 1UAPA 1JT8A 4IALA 1DOKA 1B4OA 1QILA 1V1PB 2NN6G 4LF8L 2OT2A 5DAUA 4B08A 5FOBB 5C3WA 4DR2L 1F2LA 2B3GA 3UI2A 3G7LA 4ZAIA 4HJ9A 4LF7L 1ZKOA 5E4WC 3L0OA 3GTKB 2M2LA 1FNVA 2B2WC 3R3OA 4JI7Q 1QJOA 1FYCA 4NXNQ 3S1RB 3Q23A 1PFBA 3ZJYC 2NVTH 5J22A 1FJGQ 4DXGA 2PI2E 2CH4W 3HP3A 4L5SA 4EQOA 3KBGA 2PCFB 1N33Q 5IYCG 3S14H 1NJIC 1SE3A 2HIVA 4RKBA 4TKOB 2KBNA 1T5XD 1I94Q 4RAUC 1YHQA 3CCQA 4HR7B 5M5XB 1Q8IA 3A5UA 5ELCA 2RDGA 4DV2L 2E5LL 2K32A 5JEAG 1E1TA 2CW0C 1VQAA 3I4MG 1KDAA 1AW7A 4EQ5A 2WP8J 2F0LA 2DN8A 2JA8H 5IGEA 5KNDA 1X54A 4NP5A 4JI4L 4G57A 3I3CA 4HSPA 2MP1A 4K6DA 4ZKCB 1X3FA 1SE8A 3PO2G 3S2DB 1LTTD 4CDCC 2JA6H 1W6KA 3J81i 5K36G 1EL0A 1VQBA 2KCCA 2B2VC 5E1FA 1EFID 4DR3Q 3H0GG 1VQ9A 3PO3B 1E2WA 3VYRA 1WTRA 2IX3A 1BXTA 3GO5A 1C0AA 3X3NA 3CCRA 5EPJA 1OXXK 1A3VA 1WYDA 2WB1B 3CRKC 4XTCS 2BA1A 3F2DA 1A2TA 4A3MH 2WAQE 1SJHD 3NQTA 2D2CC 1Q1BA
chains in the Genus database with same CATH topology
4A3CH 3NBHB 1KXLA 4LFBQ 3TS2A 2PQAA 5M3MH 1CKOA 2JA9A 4K0KQ 4OXPA 1HZCA 3M4OH 1A62A 2MO1A 2YTVA 3CP0A 4R1JA 1T9HA 4X6AH 5HGQA 4JBKA 5GAEC 3CC4A 1S3OA 1MKHA 1EFWA 1VQNA 1SN8A 2YV5A 4DR7L 1VQ5A 5C3EH 2K52A 4A4IA 4IFDI 1IZ6A 1UE1A 3FKIH 3M3YH 4A76A 1HNXL 4PG3A 1E7ZA 1MIUA 3HKZE 4JI8L 4JI7L 1IBMQ 1IBLL 3PUWA 3MEFA 4YCVA 1HZ9A 1K0RA 1Z9FA 2OCEA 1HR0Q 1HNZL 1PVOA 3AYHB 3CPFA 1OXSC 3BZCA 3EBEA 1UE6A 4YHHL 3CCJA 1PH2A 3I4MH 1I6HH 2UXCQ 3S1MH 3PGZA 1BBWA 1I3QH 1VCIA 2IY5B 2A19A 2RHQB 3KFUA 1YI2A 1YITA 1KQSA 2VY3A 3S16H 1VQJA 2AHOB 2IT1A 2JA8G 1AH9A 5JJIA 2E8GA 1Q81C 3S17H 1N32L 3UDGA 1YHAA 1A0IA 1X6OA 1N34Q 4B3SQ 3W5OA 1HZBA 1PH4A 4BBRG 1DGSA 4O2DA 1X3EA 4YWLA 3VDYA 3U4ZA 2CCZA 1PH7A 1VQCA 1G51A 1VS0A 2MFIA 2UXDQ 1IBKL 1E22A 1B7YB 4C3IH 2Y0SE 4X64Q 2AMCB 5JEAJ 1D8LA 1YBYA 4HIOA 2JEAI 4IPCA 3HOXG 2K50A 3RR5A 3M9BA 1PH8A 2ZJQA 4A3DG 5JJKA 4KI0A 2C35B 1FGUA 2K5HA 2NVQH 5FJ8H 2K75A 2Z6KC 3D31A 2R6GA 2VQFQ 3U50C 1JMCA 1Z47A 1VQHA 4JCVE 1XMQQ 2HIXA 1YIJA 2BA0A 2JA5G 1PA6A 4YCUA 1L1OA 5LMUQ 1SFOH 3CCVA 1IL2A 4R4TA 2MNAA 4YY3L 4JBWA 4HJAA 1XMOQ 3S24A 4C2MH 4TQUS 1OXTA 1VQIA 2ZJPA 3HOWG 3PO3G 3FP9A 2I5HA 4BBRH 5C4XH 4DR2Q 4P72A 4DR6Q 4DV1L 2N8NA 5M3MG 2GVBA 3K81C 4R4QA 1EWIA 3M85A 3S2DH 1TWAH 4A3GG 4NB3A 1Y1WH 1WCMG 1ASYA 2UU9Q 5IYBH 2Q2UA 1UEBA 5IP9G 3UDXA 3CW2C 3OW2A 5C3EG 3RN5A 4AYBE 3J81j 2UUCL 4JI0Q 4DV6L 4IFDG 3GTKH 3PF5A 4IPHA 3TS0A 1I50H 3STBD 5GAHC 1YJWA 2OTLA 4POFA 3K8AA 4IOAA 4K0KL 4JI1L 1U0LA 1Q7YC 3HOVH 4JYAL 4A3MG 4P74A 4A3BG 4DV0Q 1YJNA 1S40A 3G71A 2RHSB 1JJCB 5M5WH 1O7IA 3J81c 4GOPA 1EOVA 4A3LH 2OTJA 4YCWA 2RCNA 5BR8Q 4DR7Q 1N32Q 4C3HH 2JK8A 1CSQA 4XIGS 1J6QA 2K4KA 4HJ8A 3DM3A 3PUVA 2Q2HA 2WB1G 3L7ZC 4GKKL 4JI5Q 4LFBL 2A1AA 1WJJA 3W1BA 4GKKQ 5IP9H 1VQEA 2UXCL 2ZTEA 2AKWB 4BY7H 3U58A 4GS3A 3DLLA 3PCOB 3HKZG 4RG1A 4LW1A 2KCMA 1PYSB 4PMWA 3CMAA 5C44G 2K14A 1N9WA 4DUYL 4DR5L 2QGQA 4A3DH 1CKMA 4TVAB 1MJEA 1VQPA 3I4OA 1N36L 4DV4Q 1BBUA 1VQ6A 2R93G 4BXXG 2KENA 1NMGA 4UP7A 3CCUA 4GNXC 1G6PA 1L0WA 1XMOL 3S1QH 4A3IH 2B63G 4BA2I 3S1RH 2JA7H 2JA5H 4BA1I 3GTJH 4DR4L 4KHPL 2N49A 2WFWA 2K5NA 5DLQE 5C0XJ 1KC8C 2F4VQ 2D62A 1ASZA 1OXUA 5LMNW 1KD1C 2EIFA 3U4VA 3CXCA 1CKNB 2EXDA 2MO0A 3KOJA 2ZM6L 1GM5A 4OO1I 5C4JH 1E24A 1KRSA 2JQOA 2VQFL 2NVYH 1V9PA 2XTIA 3KF6B 4EX5A 3CCLA 3KDFA 4P73A 2RF4A 4GLXA 3F1ZA 4X62L 4A3FG 2ID0A 2IHEA 1M1KC 4IPDA 3FKIG 4YHHQ 4GKJQ 2UXDL 3UE0A 3OTOL 1HNZQ 2ZTDA 5HY6A 4JV5L 3S15H 5IP7G 5AJ3Q 2OQ0A 4QGUA 4LF8Q 3S1NH 2R93H 5IYCH 3E9IA 4LUVA 4JBMA 3RZDH 5IY0A 4NXMQ 3TEHB 4A93G 1C9OA 3HOVG 2CQOA 2YU9H 2LSSA 3M4QA 1HNWQ 2FXQA 2ZM6Q 4JI3Q 3L2PA 1Q12A 3CAMA 1FVIA 2VUMH 2N78A 3BZKA 3JAMi 3NENA 1SROA 2LXKA 3I4NG 4A3LG 4KHZA 3J7A5 3PF4A 2IX0A 4IO9A 2QEXA 4HJ7A 1PHJA 4DAMA 4LFAQ 1Y1WG 3IRBA 4GLAC 4HJ5A 1KAWA 1WCMH 3E0EA 1HH2P 2PI2A 2LXJA 3RLOA 5IYBG 4LF6Q 4OX9Q 2R7ZH 1N8RC 4B3TL 4A3FH 2BH2A 1XNQQ 4GNXB 1EQQA 2E2HH 4DV0L 2F52A 3RLFA 3BU2A 1EUJA 2VS1A 1LM0A 1E3PA 1P8LA 3PUXA 3SGIA 2QA4A 4B3TQ 5IYDH 3HOUH 3TREA 1PH9A 3I55A 2D0OA 3I7FA 1QZHA 4DUZQ 1HNXQ 3ULJA 5M3FH 3CMEA 1NY4A 2R7DA 1XNRL 2YTYA 1AE3A 2UUCQ 4JI0L 1X65A 4GN4B 3KYHC 4JOIC 4GOPB 1S72A 2D0PA 2VQEQ 4JC0A 5ELOA 3K7AH 4AH6A 1VQLA 3B6YA 2VUMG 4DK6C 1EIYB 4IJLA 1Y1VG 4DV5L 1PH1A 1B8AA 4PZ6A 3CCEA 1RIPA 4OONA 1Q1EA 4HIDA 1Q82C 4A3IG 3HKSA 1K8GA 2B63H 3CCSA 3A74A 1GKHA 4JI6Q 4PZ7A 5IE8A 1JE5A 1VQDA 4HIKA 4JI4Q 3K7UC 4A3KG 3HOWH 5C4XG 4B3MQ 4AQYL 3JC66 4UY8C 1SMXA 3KF8B 4A75A 3T1HL 3BJUA 3D0FA 1QUQB 4P71A 5IYDG 1XPRA 2IX1A 4GKJL 4KLKA 4JG2A 3M4PA 3ERSX 2CFMA 4UP9A 5E7NA 5M5YH 4DV3Q 4BY1G 1KL9A 4GNXA 3H3VH 1TWFH 1WOCA 3TRZA 3CCMA 5M3FG 2Q2TA 3ULLA 3UDIA 4JV5Q 4BXXH 1C7YA 4BBSH 1WI5A 2ES2A 5FLMG 2UU9L 4JI2Q 3I2ZA 1Y1VH 2VNUD 4HIMA 4JI2L 3CPWA 3CD6A 4LF5L 1VQ8A 1K3RA 4AQYQ 4LNQA 1V1QA 3T1HQ 1FL0A 3LGJA 1VQ7A 2IHFA 5GAGC 3E9HA 1SRUA 4X62Q 4NPSA 3J80c 2JJQA 4DR3L 3I4NH 2CWPA 3G4SA 4OWWB 2WB1E 1SR3A 4DKAC 1QUQA 3M7NA 4KHPQ 3KDFB 4AIMA 1CUKA 1YHBA 4OO1G 2OQKA 4MNOA 3GTGH 3G6EA 4H02A 4IOCA 3F2CA 4GN5A 1TWHH 2F4VL 3KJOA 1VQGA 3GDEA 1GD7A 2MQHA 4B3RQ 1L1OB 1N36Q 2AWNA 2F3IA 3HOUG 5M5XH 3PIPA 4JI5L 5FLMH 1IBML 5C44H 4B3SL 1Y14B 1GVPA 4A93H 4DV3L 3PUYA 3F2BA 2E2IH 4WJ3M 4IPGA 1X55A 1IBKQ 3H3VI 3KLWA 1HR0L 1IXRA 1B70B 1NMFA 4APVA 4LF9Q 1G291 2VZAA 1VQMA 1VQFA 2GN5A 1QVFA 2R92H 1BKBA 2I5MX 1PH6A 2DGYA 2NZOA 1MJCA 1YZ6A 2NVXH 2JA7G 2CWAA 3K0XA 1N33L 1X3GA 2E5LQ 1J5EQ 1I5FA 4LF7Q 1TWCH 2Z6KA 3PSIA 1UE5A 4DV2Q 1K8AC 3GTPH 3RLNA 5C0XG 3H0GH 3T1YQ 2UUBQ 5GQOA 4DV4L 3T1YL 3KJPA 2KCTA 1I94L 2UUBL 4AYBG 4L5RC 3J7ZC 1L1OC 1XNRQ 1A63A 5JJLA 2HHHQ 1FJGL 4FDBA 4RMFA 5LMNQ 3GTLH 4UPAA 3CQZH 1GO3E 5AJ3L 4LF9L 1PH5A 4GOPC 4OX9L 5LMNL 2JEBI 4PZ8A 1NBWA 1SLJA 2GVAA 1XNQL 1VQOA 4R4IA 3GTOH 2YTXA 4DAYB 1VQ4A 3AEVA 3HFZB 1TXYA 3PV0A 1H95A 5IP7H 2E2JH 2KHJA 2KHIA 4A3EG 4BBSG 4POGA 4A3CG 1EYGA 2V1CC 1K83H 4DNIA 3I56A 1Q8KA 2N3SA 4ME3A 4DV6Q 1QZGA 4JOIA 1Q46A 2UXBL 2ZJRA 4LF4Q 2DUDA 5IT9c 3CC7A 2L15A 3Q8DA 3NELA 4MZ9A 4A3KH 1M90C 5IWAQ 3ULPA 3AFPA 3KF6A 4R4OA 3EIVA 4LFCL 4A3JH 4DV7Q 2UUAQ 4L5QA 4BY1H 4DV1Q 4NXML 2NZHA 1YNXA 4IJHA 4DPGA 4OWTB 2R7ZG 2WAQG 4X65Q 4LUZA 3RZOH 2Y0SG 1VQKA 4LF5Q 1AE2A 3UDFA 4B3ML 4GLVB 3OYYA 4X65L 4DR1Q 1A8VA 1P16A 3STBC 4JBJA 1OXVA 2OWOA 1XMQL 4WJ4A 1JJGA 3G48A 3FHWA 1LYLA 2YYZA 1NTGA 3H15A 5LMUL 2ATWA 2I0QA 2ASBA 1JT8A 3RNUA 4QL5A 4ALPA 3GTMH 2NN6G 4DR4Q 3W1GA 4LF8L 2ZTCA 3ER0A 4DR2L 3PO2H 4JI6L 5GADC 1X9NA 2B3GA 2I5LX 1YVCA 5J3BA 1YEZA 2UUAL 4HJ9A 4LF7L 2JA6G 2R92G 3AQQA 3L0OA 1RL2A 2ALYB 3HOYH 1LUZA 1PFSA 4QQBX 4A3JG 1NE3A 1W2BA 4JI7Q 5H1SE 4QIWE 4NXNQ 4LF4L 1CKNA 3S2HH 1OTCA 3ZJYC 1QVGA 1YJ9A 4LF6L 4JI1Q 2B29A 2NVTH 5FJ8G 1FJGQ 2Z0SA 2A8VA 2HT1A 1W3SA 2PI2E 2Q2IA 4L5SA 4GN3B 2HQLA 4B3RL 1J5EL 4R4CA 1N33Q 4JI8Q 3CC2A 4UP8A 5IYCG 4DUZL 3S14H 3GD7A 3UE1A 1NJIC 3AFQA 2HIVA 2KBNA 4LUOA 1PYBA 4LFAL 1D7QA 4NXNL 1I94Q 1CSPA 1YHQA 3CCQA 2HHHL 3HOYG 1EQRA 4O0AA 1HZAA 4DV5Q 1UE7A 1XPUA 4A3GH 1XJVA 4Y7NH 2XGTA 4YWMA 1U5KA 3A5UA 3F8TA 1X56A 4JYAQ 2H5XA 3TQYA 5C0XI 5EAYA 3NEMA 3CF5A 3EN2A 4DV2L 2JE6I 3K80C 2E5LL 1EIFA 1E1OA 4X66Q 5JEAG 2VW9A 4P75A 4JI3L 3A5ZB 1HR0W 1E1TA 5BR8L 3A0JA 1PV4A 1VQAA 1IBLQ 3I4MG 2AWOA 3HOXH 4DR1L 4J15A 4L5TA 4OWXB 4EQ5A 3OTOQ 4YY3Q 2WP8J 2K5VA 1R9TH 3HOZG 1IYJB 2R7FA 4DR6L 2PMZE 2JA8H 3WWVA 1KRTA 4LFCQ 1V43A 3RN2A 4DV7L 1X54A 4JI4L 1HNWL 4Y52H 1X3FA 1SE8A 3PO2G 4QJFA 1L2FA 2EQSA 3PO3H 4DUYQ 4QY7A 2JA6H 3J81i 1N34L 5K36G 1VQBA 1JJ2A 4YWKA 1TWGH 1QVCA 4X64L 4BY7G 4DR3Q 1Q86C 3H0GG 4LWCA 1VQ9A 2VQEL 5GROA 1XPOA 2BH8A 3J80i 3GO5A 1C0AA 1LTLA 1KHIA 3PUZA 2PNHA 3CCRA 1OXXK 3GTQH 1K9MC 4IFDJ 2NN6I 1WYDA 4C3JH 1PH3A 1K73C 1KIXA 4XTCS 4DK3C 2PQAB 1JB7A 3ICEA 3HOZH 2BA1A 3F2DA 1UWVA 5ELNA 4X66L 2CKZB 1WFQA 4DR5Q 3PIOA 4A3MH 1HJPA 2VL6A 3JAMc 2UXBQ 1XTDA 4A3BH 2WAQE 5FLXc 4MTNA 1BVSA 3MXNB 4A3EH 1Q1BA 5IWAL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3C H;  3NBH B;  1KXL A;  4LFB Q;  3TS2 A;  2PQA A;  5M3M H;  1CKO A;  2JA9 A;  4K0K Q;  4OXP A;  1HZC A;  3M4O H;  1A62 A;  2MO1 A;  2YTV A;  3CP0 A;  4R1J A;  1T9H A;  4X6A H;  5HGQ A;  4JBK A;  5GAE C;  3CC4 A;  1S3O A;  1MKH A;  1EFW A;  1VQN A;  1SN8 A;  2YV5 A;  4DR7 L;  1VQ5 A;  5C3E H;  2K52 A;  4A4I A;  4IFD I;  1IZ6 A;  1UE1 A;  3FKI H;  3M3Y H;  4A76 A;  1HNX L;  4PG3 A;  1E7Z A;  1MIU A;  3HKZ E;  4JI8 L;  4JI7 L;  1IBM Q;  1IBL L;  3PUW A;  3MEF A;  4YCV A;  1HZ9 A;  1K0R A;  1Z9F A;  2OCE A;  1HR0 Q;  1HNZ L;  1PVO A;  3AYH B;  3CPF A;  1OXS C;  3BZC A;  3EBE A;  1UE6 A;  4YHH L;  3CCJ A;  1PH2 A;  3I4M H;  1I6H H;  2UXC Q;  3S1M H;  3PGZ A;  1BBW A;  1I3Q H;  1VCI A;  2IY5 B;  2A19 A;  2RHQ B;  3KFU A;  1YI2 A;  1YIT A;  1KQS A;  2VY3 A;  3S16 H;  1VQJ A;  2AHO B;  2IT1 A;  2JA8 G;  1AH9 A;  5JJI A;  2E8G A;  1Q81 C;  3S17 H;  1N32 L;  3UDG A;  1YHA A;  1A0I A;  1X6O A;  1N34 Q;  4B3S Q;  3W5O A;  1HZB A;  1PH4 A;  4BBR G;  1DGS A;  4O2D A;  1X3E A;  4YWL A;  3VDY A;  3U4Z A;  2CCZ A;  1PH7 A;  1VQC A;  1G51 A;  1VS0 A;  2MFI A;  2UXD Q;  1IBK L;  1E22 A;  1B7Y B;  4C3I H;  2Y0S E;  4X64 Q;  2AMC B;  5JEA J;  1D8L A;  1YBY A;  4HIO A;  2JEA I;  4IPC A;  3HOX G;  2K50 A;  3RR5 A;  3M9B A;  1PH8 A;  2ZJQ A;  4A3D G;  5JJK A;  4KI0 A;  2C35 B;  1FGU A;  2K5H A;  2NVQ H;  5FJ8 H;  2K75 A;  2Z6K C;  3D31 A;  2R6G A;  2VQF Q;  3U50 C;  1JMC A;  1Z47 A;  1VQH A;  4JCV E;  1XMQ Q;  2HIX A;  1YIJ A;  2BA0 A;  2JA5 G;  1PA6 A;  4YCU A;  1L1O A;  5LMU Q;  1SFO H;  3CCV A;  1IL2 A;  4R4T A;  2MNA A;  4YY3 L;  4JBW A;  4HJA A;  1XMO Q;  3S24 A;  4C2M H;  4TQU S;  1OXT A;  1VQI A;  2ZJP A;  3HOW G;  3PO3 G;  3FP9 A;  2I5H A;  4BBR H;  5C4X H;  4DR2 Q;  4P72 A;  4DR6 Q;  4DV1 L;  2N8N A;  5M3M G;  2GVB A;  3K81 C;  4R4Q A;  1EWI A;  3M85 A;  3S2D H;  1TWA H;  4A3G G;  4NB3 A;  1Y1W H;  1WCM G;  1ASY A;  2UU9 Q;  5IYB H;  2Q2U A;  1UEB A;  5IP9 G;  3UDX A;  3CW2 C;  3OW2 A;  5C3E G;  3RN5 A;  4AYB E;  3J81 j;  2UUC L;  4JI0 Q;  4DV6 L;  4IFD G;  3GTK H;  3PF5 A;  4IPH A;  3TS0 A;  1I50 H;  3STB D;  5GAH C;  1YJW A;  2OTL A;  4POF A;  3K8A A;  4IOA A;  4K0K L;  4JI1 L;  1U0L A;  1Q7Y C;  3HOV H;  4JYA L;  4A3M G;  4P74 A;  4A3B G;  4DV0 Q;  1YJN A;  1S40 A;  3G71 A;  2RHS B;  1JJC B;  5M5W H;  1O7I A;  3J81 c;  4GOP A;  1EOV A;  4A3L H;  2OTJ A;  4YCW A;  2RCN A;  5BR8 Q;  4DR7 Q;  1N32 Q;  4C3H H;  2JK8 A;  1CSQ A;  4XIG S;  1J6Q A;  2K4K A;  4HJ8 A;  3DM3 A;  3PUV A;  2Q2H A;  2WB1 G;  3L7Z C;  4GKK L;  4JI5 Q;  4LFB L;  2A1A A;  1WJJ A;  3W1B A;  4GKK Q;  5IP9 H;  1VQE A;  2UXC L;  2ZTE A;  2AKW B;  4BY7 H;  3U58 A;  4GS3 A;  3DLL A;  3PCO B;  3HKZ G;  4RG1 A;  4LW1 A;  2KCM A;  1PYS B;  4PMW A;  3CMA A;  5C44 G;  2K14 A;  1N9W A;  4DUY L;  4DR5 L;  2QGQ A;  4A3D H;  1CKM A;  4TVA B;  1MJE A;  1VQP A;  3I4O A;  1N36 L;  4DV4 Q;  1BBU A;  1VQ6 A;  2R93 G;  4BXX G;  2KEN A;  1NMG A;  4UP7 A;  3CCU A;  4GNX C;  1G6P A;  1L0W A;  1XMO L;  3S1Q H;  4A3I H;  2B63 G;  4BA2 I;  3S1R H;  2JA7 H;  2JA5 H;  4BA1 I;  3GTJ H;  4DR4 L;  4KHP L;  2N49 A;  2WFW A;  2K5N A;  5DLQ E;  5C0X J;  1KC8 C;  2F4V Q;  2D62 A;  1ASZ A;  1OXU A;  5LMN W;  1KD1 C;  2EIF A;  3U4V A;  3CXC A;  1CKN B;  2EXD A;  2MO0 A;  3KOJ A;  2ZM6 L;  1GM5 A;  4OO1 I;  5C4J H;  1E24 A;  1KRS A;  2JQO A;  2VQF L;  2NVY H;  1V9P A;  2XTI A;  3KF6 B;  4EX5 A;  3CCL A;  3KDF A;  4P73 A;  2RF4 A;  4GLX A;  3F1Z A;  4X62 L;  4A3F G;  2ID0 A;  2IHE A;  1M1K C;  4IPD A;  3FKI G;  4YHH Q;  4GKJ Q;  2UXD L;  3UE0 A;  3OTO L;  1HNZ Q;  2ZTD A;  5HY6 A;  4JV5 L;  3S15 H;  5IP7 G;  5AJ3 Q;  2OQ0 A;  4QGU A;  4LF8 Q;  3S1N H;  2R93 H;  5IYC H;  3E9I A;  4LUV A;  4JBM A;  3RZD H;  5IY0 A;  4NXM Q;  3TEH B;  4A93 G;  1C9O A;  3HOV G;  2CQO A;  2YU9 H;  2LSS A;  3M4Q A;  1HNW Q;  2FXQ A;  2ZM6 Q;  4JI3 Q;  3L2P A;  1Q12 A;  3CAM A;  1FVI A;  2VUM H;  2N78 A;  3BZK A;  3JAM i;  3NEN A;  1SRO A;  2LXK A;  3I4N G;  4A3L G;  4KHZ A;  3J7A 5;  3PF4 A;  2IX0 A;  4IO9 A;  2QEX A;  4HJ7 A;  1PHJ A;  4DAM A;  4LFA Q;  1Y1W G;  3IRB A;  4GLA C;  4HJ5 A;  1KAW A;  1WCM H;  3E0E A;  1HH2 P;  2PI2 A;  2LXJ A;  3RLO A;  5IYB G;  4LF6 Q;  4OX9 Q;  2R7Z H;  1N8R C;  4B3T L;  4A3F H;  2BH2 A;  1XNQ Q;  4GNX B;  1EQQ A;  2E2H H;  4DV0 L;  2F52 A;  3RLF A;  3BU2 A;  1EUJ A;  2VS1 A;  1LM0 A;  1E3P A;  1P8L A;  3PUX A;  3SGI A;  2QA4 A;  4B3T Q;  5IYD H;  3HOU H;  3TRE A;  1PH9 A;  3I55 A;  2D0O A;  3I7F A;  1QZH A;  4DUZ Q;  1HNX Q;  3ULJ A;  5M3F H;  3CME A;  1NY4 A;  2R7D A;  1XNR L;  2YTY A;  1AE3 A;  2UUC Q;  4JI0 L;  1X65 A;  4GN4 B;  3KYH C;  4JOI C;  4GOP B;  1S72 A;  2D0P A;  2VQE Q;  4JC0 A;  5ELO A;  3K7A H;  4AH6 A;  1VQL A;  3B6Y A;  2VUM G;  4DK6 C;  1EIY B;  4IJL A;  1Y1V G;  4DV5 L;  1PH1 A;  1B8A A;  4PZ6 A;  3CCE A;  1RIP A;  4OON A;  1Q1E A;  4HID A;  1Q82 C;  4A3I G;  3HKS A;  1K8G A;  2B63 H;  3CCS A;  3A74 A;  1GKH A;  4JI6 Q;  4PZ7 A;  5IE8 A;  1JE5 A;  1VQD A;  4HIK A;  4JI4 Q;  3K7U C;  4A3K G;  3HOW H;  5C4X G;  4B3M Q;  4AQY L;  3JC6 6;  4UY8 C;  1SMX A;  3KF8 B;  4A75 A;  3T1H L;  3BJU A;  3D0F A;  1QUQ B;  4P71 A;  5IYD G;  1XPR A;  2IX1 A;  4GKJ L;  4KLK A;  4JG2 A;  3M4P A;  3ERS X;  2CFM A;  4UP9 A;  5E7N A;  5M5Y H;  4DV3 Q;  4BY1 G;  1KL9 A;  4GNX A;  3H3V H;  1TWF H;  1WOC A;  3TRZ A;  3CCM A;  5M3F G;  2Q2T A;  3ULL A;  3UDI A;  4JV5 Q;  4BXX H;  1C7Y A;  4BBS H;  1WI5 A;  2ES2 A;  5FLM G;  2UU9 L;  4JI2 Q;  3I2Z A;  1Y1V H;  2VNU D;  4HIM A;  4JI2 L;  3CPW A;  3CD6 A;  4LF5 L;  1VQ8 A;  1K3R A;  4AQY Q;  4LNQ A;  1V1Q A;  3T1H Q;  1FL0 A;  3LGJ A;  1VQ7 A;  2IHF A;  5GAG C;  3E9H A;  1SRU A;  4X62 Q;  4NPS A;  3J80 c;  2JJQ A;  4DR3 L;  3I4N H;  2CWP A;  3G4S A;  4OWW B;  2WB1 E;  1SR3 A;  4DKA C;  1QUQ A;  3M7N A;  4KHP Q;  3KDF B;  4AIM A;  1CUK A;  1YHB A;  4OO1 G;  2OQK A;  4MNO A;  3GTG H;  3G6E A;  4H02 A;  4IOC A;  3F2C A;  4GN5 A;  1TWH H;  2F4V L;  3KJO A;  1VQG A;  3GDE A;  1GD7 A;  2MQH A;  4B3R Q;  1L1O B;  1N36 Q;  2AWN A;  2F3I A;  3HOU G;  5M5X H;  3PIP A;  4JI5 L;  5FLM H;  1IBM L;  5C44 H;  4B3S L;  1Y14 B;  1GVP A;  4A93 H;  4DV3 L;  3PUY A;  3F2B A;  2E2I H;  4WJ3 M;  4IPG A;  1X55 A;  1IBK Q;  3H3V I;  3KLW A;  1HR0 L;  1IXR A;  1B70 B;  1NMF A;  4APV A;  4LF9 Q;  1G29 1;  2VZA A;  1VQM A;  1VQF A;  2GN5 A;  1QVF A;  2R92 H;  1BKB A;  2I5M X;  1PH6 A;  2DGY A;  2NZO A;  1MJC A;  1YZ6 A;  2NVX H;  2JA7 G;  2CWA A;  3K0X A;  1N33 L;  1X3G A;  2E5L Q;  1J5E Q;  1I5F A;  4LF7 Q;  1TWC H;  2Z6K A;  3PSI A;  1UE5 A;  4DV2 Q;  1K8A C;  3GTP H;  3RLN A;  5C0X G;  3H0G H;  3T1Y Q;  2UUB Q;  5GQO A;  4DV4 L;  3T1Y L;  3KJP A;  2KCT A;  1I94 L;  2UUB L;  4AYB G;  4L5R C;  3J7Z C;  1L1O C;  1XNR Q;  1A63 A;  5JJL A;  2HHH Q;  1FJG L;  4FDB A;  4RMF A;  5LMN Q;  3GTL H;  4UPA A;  3CQZ H;  1GO3 E;  5AJ3 L;  4LF9 L;  1PH5 A;  4GOP C;  4OX9 L;  5LMN L;  2JEB I;  4PZ8 A;  1NBW A;  1SLJ A;  2GVA A;  1XNQ L;  1VQO A;  4R4I A;  3GTO H;  2YTX A;  4DAY B;  1VQ4 A;  3AEV A;  3HFZ B;  1TXY A;  3PV0 A;  1H95 A;  5IP7 H;  2E2J H;  2KHJ A;  2KHI A;  4A3E G;  4BBS G;  4POG A;  4A3C G;  1EYG A;  2V1C C;  1K83 H;  4DNI A;  3I56 A;  1Q8K A;  2N3S A;  4ME3 A;  4DV6 Q;  1QZG A;  4JOI A;  1Q46 A;  2UXB L;  2ZJR A;  4LF4 Q;  2DUD A;  5IT9 c;  3CC7 A;  2L15 A;  3Q8D A;  3NEL A;  4MZ9 A;  4A3K H;  1M90 C;  5IWA Q;  3ULP A;  3AFP A;  3KF6 A;  4R4O A;  3EIV A;  4LFC L;  4A3J H;  4DV7 Q;  2UUA Q;  4L5Q A;  4BY1 H;  4DV1 Q;  4NXM L;  2NZH A;  1YNX A;  4IJH A;  4DPG A;  4OWT B;  2R7Z G;  2WAQ G;  4X65 Q;  4LUZ A;  3RZO H;  2Y0S G;  1VQK A;  4LF5 Q;  1AE2 A;  3UDF A;  4B3M L;  4GLV B;  3OYY A;  4X65 L;  4DR1 Q;  1A8V A;  1P16 A;  3STB C;  4JBJ A;  1OXV A;  2OWO A;  1XMQ L;  4WJ4 A;  1JJG A;  3G48 A;  3FHW A;  1LYL A;  2YYZ A;  1NTG A;  3H15 A;  5LMU L;  2ATW A;  2I0Q A;  2ASB A;  1JT8 A;  3RNU A;  4QL5 A;  4ALP A;  3GTM H;  2NN6 G;  4DR4 Q;  3W1G A;  4LF8 L;  2ZTC A;  3ER0 A;  4DR2 L;  3PO2 H;  4JI6 L;  5GAD C;  1X9N A;  2B3G A;  2I5L X;  1YVC A;  5J3B A;  1YEZ A;  2UUA L;  4HJ9 A;  4LF7 L;  2JA6 G;  2R92 G;  3AQQ A;  3L0O A;  1RL2 A;  2ALY B;  3HOY H;  1LUZ A;  1PFS A;  4QQB X;  4A3J G;  1NE3 A;  1W2B A;  4JI7 Q;  5H1S E;  4QIW E;  4NXN Q;  4LF4 L;  1CKN A;  3S2H H;  1OTC A;  3ZJY C;  1QVG A;  1YJ9 A;  4LF6 L;  4JI1 Q;  2B29 A;  2NVT H;  5FJ8 G;  1FJG Q;  2Z0S A;  2A8V A;  2HT1 A;  1W3S A;  2PI2 E;  2Q2I A;  4L5S A;  4GN3 B;  2HQL A;  4B3R L;  1J5E L;  4R4C A;  1N33 Q;  4JI8 Q;  3CC2 A;  4UP8 A;  5IYC G;  4DUZ L;  3S14 H;  3GD7 A;  3UE1 A;  1NJI C;  3AFQ A;  2HIV A;  2KBN A;  4LUO A;  1PYB A;  4LFA L;  1D7Q A;  4NXN L;  1I94 Q;  1CSP A;  1YHQ A;  3CCQ A;  2HHH L;  3HOY G;  1EQR A;  4O0A A;  1HZA A;  4DV5 Q;  1UE7 A;  1XPU A;  4A3G H;  1XJV A;  4Y7N H;  2XGT A;  4YWM A;  1U5K A;  3A5U A;  3F8T A;  1X56 A;  4JYA Q;  2H5X A;  3TQY A;  5C0X I;  5EAY A;  3NEM A;  3CF5 A;  3EN2 A;  4DV2 L;  2JE6 I;  3K80 C;  2E5L L;  1EIF A;  1E1O A;  4X66 Q;  5JEA G;  2VW9 A;  4P75 A;  4JI3 L;  3A5Z B;  1HR0 W;  1E1T A;  5BR8 L;  3A0J A;  1PV4 A;  1VQA A;  1IBL Q;  3I4M G;  2AWO A;  3HOX H;  4DR1 L;  4J15 A;  4L5T A;  4OWX B;  4EQ5 A;  3OTO Q;  4YY3 Q;  2WP8 J;  2K5V A;  1R9T H;  3HOZ G;  1IYJ B;  2R7F A;  4DR6 L;  2PMZ E;  2JA8 H;  3WWV A;  1KRT A;  4LFC Q;  1V43 A;  3RN2 A;  4DV7 L;  1X54 A;  4JI4 L;  1HNW L;  4Y52 H;  1X3F A;  1SE8 A;  3PO2 G;  4QJF A;  1L2F A;  2EQS A;  3PO3 H;  4DUY Q;  4QY7 A;  2JA6 H;  3J81 i;  1N34 L;  5K36 G;  1VQB A;  1JJ2 A;  4YWK A;  1TWG H;  1QVC A;  4X64 L;  4BY7 G;  4DR3 Q;  1Q86 C;  3H0G G;  4LWC A;  1VQ9 A;  2VQE L;  5GRO A;  1XPO A;  2BH8 A;  3J80 i;  3GO5 A;  1C0A A;  1LTL A;  1KHI A;  3PUZ A;  2PNH A;  3CCR A;  1OXX K;  3GTQ H;  1K9M C;  4IFD J;  2NN6 I;  1WYD A;  4C3J H;  1PH3 A;  1K73 C;  1KIX A;  4XTC S;  4DK3 C;  2PQA B;  1JB7 A;  3ICE A;  3HOZ H;  2BA1 A;  3F2D A;  1UWV A;  5ELN A;  4X66 L;  2CKZ B;  1WFQ A;  4DR5 Q;  3PIO A;  4A3M H;  1HJP A;  2VL6 A;  3JAM c;  2UXB Q;  1XTD A;  4A3B H;  2WAQ E;  5FLX c;  4MTN A;  1BVS A;  3MXN B;  4A3E H;  1Q1B A;  5IWA L; 
#chains in the Genus database with same CATH topology
 4HED A;  3CU7 A;  2PQA A;  1CKO A;  3HOZ B;  4K0K Q;  2IJ0 A;  3M4O H;  1RF2 D;  1SDF A;  2MO1 A;  4H0L C;  2YTV A;  1S5C D;  4R1J A;  3A8I E;  5FO9 B;  2F0H A;  1WTO A;  1Y1W B;  3CC4 A;  1EFW A;  2YV5 A;  1VQ5 A;  1UE1 A;  3FKI H;  1F9R A;  3M3Y H;  1E7Z A;  4JI7 L;  1VDZ A;  3MEF A;  1K0R A;  2NUC A;  1E0B A;  1SFO B;  3SR1 A;  4Z9C B;  3TP6 A;  3BZC A;  3I8Z A;  1I6H H;  3U9O A;  3I4M H;  4K14 A;  2EDG A;  3HOW B;  1VCI A;  2IY5 B;  2A19 A;  3E0J A;  3KLR A;  5IT9 L;  2EJM A;  3FKI B;  1VQJ A;  2NN6 H;  1XTC D;  3A54 A;  3NP8 A;  2JA8 G;  1AH9 A;  3S17 H;  1LTB D;  4RHS A;  4JVZ A;  3K58 A;  4O2D A;  5COY A;  3U4Z A;  4DAP A;  1VQC A;  4ZK9 B;  2UXD Q;  4CDD C;  1B1Z A;  2Y0S E;  2AMC B;  2J0T D;  4OEL B;  1D8L A;  2D5D A;  3R2T A;  5JEA J;  4OEM B;  4KI0 A;  2C35 B;  4A3G B;  2NVQ H;  5FJ8 H;  3D31 A;  3DWA A;  2VQF Q;  3U50 C;  5IGF A;  2NVT B;  2BA0 A;  3VR6 A;  2RQX A;  1PA6 A;  1SFO H;  1PRT D;  2MNA A;  1EIG A;  4JBW A;  3A8J E;  3EVQ A;  1EYD A;  4FNF A;  4M8A A;  1UEA B;  5C4X H;  4DR2 Q;  4P72 A;  2X6L A;  2N8N A;  4R4Q A;  1WTQ A;  1EWI A;  3M85 A;  4RGO S;  4NB3 A;  4A3G G;  1WCM G;  1ASY A;  2UU9 Q;  2I46 A;  1EQV A;  1EIH A;  2V4D A;  4DV6 L;  3GTK H;  3PF5 A;  1I50 H;  5EKK A;  1Q3L A;  4POF A;  1K8M A;  4IOA A;  2HD3 A;  1U4M A;  1CQF A;  4BS9 A;  5KYL A;  3M7G A;  4P74 A;  5EQ0 A;  1EY8 A;  1Y8O B;  1ZEQ X;  2RHS B;  2OTJ A;  4A3L H;  1O7I A;  1TY2 A;  1TWH B;  2MPM A;  3GTQ B;  1CTM A;  2RCN A;  3MVV A;  4FP5 D;  4QF4 A;  3MFY A;  1N32 Q;  5J39 A;  2ZXR A;  1J6Q A;  3PUV A;  1JIC A;  4JI5 Q;  2QKI C;  2A1A A;  2O4X A;  2F0J A;  3CHB D;  4CJ0 B;  3PCO B;  3HKZ G;  4BY7 B;  2K14 A;  1N9W A;  4DUY L;  4EQP A;  2QGQ A;  1RCV D;  4XYQ A;  1BBU A;  3K59 A;  2R93 G;  2KEN A;  3MHB A;  1XMO L;  1HFG A;  2F0D A;  1ENC A;  1MHW C;  4BA2 I;  5EPL A;  1DM0 B;  5FO8 B;  4BA1 I;  2JA5 H;  3DMU A;  3NQI A;  4Q0F A;  1EY6 A;  2K5N A;  5C0X J;  5I6W A;  2NTT A;  3KK7 A;  2EIF A;  4OO1 I;  3KOJ A;  5C4J H;  3QB3 A;  4EX5 A;  4ZYS A;  2L4N A;  2RF4 A;  2WV6 D;  3EQL C;  4A3F G;  4GKJ Q;  5A35 A;  3FKI G;  4RH6 A;  4YHH Q;  3UE0 A;  3OTO L;  1G2S A;  1U9R A;  2R93 H;  1AFP A;  1SYB A;  4LUV A;  3AB9 A;  4RGN A;  3DWP A;  5C5M A;  3TEH B;  1C9O A;  3RZO B;  2YU9 H;  2ZM6 Q;  1TY0 A;  3V96 A;  1EU3 A;  4JI3 Q;  1BBX C;  1FVI A;  2N78 A;  3I4N G;  3PF4 A;  3A7A B;  4IO9 A;  1S5B D;  2QEX A;  4DAM A;  2Z8L A;  1Y1W G;  4GLA C;  4HJ5 A;  1WCM H;  1DCZ A;  1GOZ A;  1B3A A;  1HH2 P;  2LXJ A;  3MFG A;  3RLO A;  4B3T L;  4A3F H;  4GNX B;  2E2H H;  2F52 A;  4DNR B;  5IOC A;  1DYQ A;  3PUX A;  2QA4 A;  4MTK A;  5IT9 E;  4DUZ Q;  4A3K B;  3ULJ A;  1S4Z A;  1BCP B;  2NWG A;  1AE3 A;  1X65 A;  2VQE Q;  3K7A H;  1X3P A;  2C5C A;  2VUM G;  1G2T A;  4IJL A;  4OON A;  3MXP A;  1Q1E A;  3S16 B;  4A3I G;  1L0Y B;  4RFB A;  3SK6 A;  2L9H A;  5IE8 A;  3HOW H;  2EYH A;  3K7U C;  4DA2 A;  4A3K G;  4AQY L;  3JC6 6;  4BWG B;  4UY8 C;  3SEB A;  4A75 A;  3T1H L;  3BJU A;  4P71 A;  3OIQ A;  1D5Z C;  3BDO A;  5IYD G;  3PO2 B;  2WIN B;  5M5Y H;  4JG2 A;  3LNN A;  2CFM A;  4DV3 Q;  1EYC A;  1JB3 A;  1WD0 A;  4BY1 G;  3H3V H;  1HPC A;  4DK1 A;  5ELF A;  3ULL A;  3UDI A;  1BF4 A;  2YU9 B;  4BBS H;  1WI5 A;  1RHP A;  2IW3 A;  3VYU A;  5FLM G;  2A69 D;  2GA4 B;  4XQJ A;  1Y1V H;  2VNU D;  5D65 A;  4HIM A;  2FIN B;  2PPB C;  3CD6 A;  4H7B A;  4KD3 A;  1VQ8 A;  3NUC A;  1K3R A;  2TSS A;  4LF5 L;  4LNQ A;  3EA6 A;  3T1H Q;  1FL0 A;  3LGJ A;  1VQ7 A;  2IHF A;  5FLX L;  1KDC A;  3G4S A;  1H9M A;  1CUK A;  4OO1 G;  4MNO A;  3GTG H;  3G6E A;  3T53 B;  3GDE A;  1GD7 A;  5FO7 B;  4B3R Q;  3CKI B;  4J6H A;  1N36 Q;  2F3I A;  4Y7N B;  2JA5 B;  2EY5 A;  4HCS A;  3P1H A;  3K7A B;  4WJ3 M;  3S9W A;  2EE1 A;  3PUY A;  4I7A A;  3IFT A;  3KLW A;  1NMF A;  4APV A;  1VMP A;  3BDC A;  3NBI A;  1PH6 A;  1EOT A;  3IFD A;  1X3G A;  1HTL D;  1J5E Q;  1KNA A;  1QWY A;  1UE5 A;  4CBV A;  1K8A C;  3GTP H;  5C4X B;  4K8J A;  1WVL A;  4IUR A;  3H0G H;  1PFN A;  5KEE A;  2UUB L;  3KJP A;  1SE2 A;  3J7Z C;  4RMF A;  4F88 A;  2RBM A;  3FVQ A;  4UPA A;  5AJ3 L;  1GUS A;  1B53 A;  1BCP C;  3AEV A;  3W3A A;  3PV0 A;  1H95 A;  3SK5 A;  5HGT A;  1FR3 A;  2FJ2 A;  1RTN A;  3V05 A;  4A3F B;  1QZG A;  4ME3 A;  2N3S A;  4DV6 Q;  1MSG A;  1Q46 A;  3GV6 A;  3P7J A;  1NAP A;  3CC7 A;  4RCO A;  3K0Y A;  4K5W A;  3OPO A;  3AFP A;  3MXU A;  3R2I A;  3RZD B;  3OMG A;  2K33 A;  5FLX E;  3S1N B;  4L5Q A;  5CBA E;  4BY1 H;  1YNX A;  2R7Z G;  5I6Y A;  3FDT A;  2Y0S G;  4LF5 Q;  4B3M L;  4DR1 Q;  1WCM B;  1ZYR C;  3STB C;  4JBJ A;  1OXV A;  1EY9 A;  1XMQ L;  4OHJ A;  2R93 B;  1JWS D;  3MC0 B;  1BR9 A;  1KAB A;  3BS1 A;  1NTG A;  2KCN A;  2F3V A;  2ASB A;  1GUW A;  1MSH A;  5CMD A;  2E75 C;  1Y1V B;  2EOT A;  3J80 L;  3OW7 A;  5D3I B;  3PO2 H;  5GAD C;  2I5L X;  4IUT A;  4AYB B;  1CZG A;  5I9P A;  1ONL A;  4QQB X;  1SEB D;  4QB4 A;  1PRT C;  4PNY A;  1JR0 D;  2Z4I A;  2JXM B;  4LF4 L;  4ZLT F;  1CKN A;  2JA7 B;  1VF7 A;  1YJ9 A;  4KN7 C;  4JI1 Q;  1F2M A;  3DHQ A;  4Q5V A;  4LF6 L;  5M9O A;  1W3S A;  2Q2I A;  3TBI B;  1G8Z D;  1R4P B;  3N52 A;  4B3R L;  4R4C A;  3BYY B;  2R92 B;  4DUZ L;  3GD7 A;  1I4Q A;  2F0I A;  4LUO A;  4UAI A;  4LFA L;  2XWJ B;  1EQR A;  3AU7 A;  4DV5 Q;  2XIW A;  4Y7N H;  2F0T A;  4YWM A;  3T16 A;  1U5K A;  1Z6H A;  4H13 C;  5EAY A;  1ROD A;  3CF5 A;  3EN2 A;  2EY1 A;  2AUJ D;  3QOJ A;  2F0N A;  4OO1 H;  1E1O A;  4WJW A;  4JI3 L;  1HR0 W;  3VYT A;  5BR8 L;  3GTJ B;  1IBL Q;  3A7L A;  1JOR A;  1CZW A;  4J15 A;  2FMM A;  3VR4 A;  3RD4 A;  1LT6 D;  1L0X B;  1JWU D;  2KQ3 A;  1R9T H;  3HOZ G;  2DY7 A;  2R7F A;  1X3Q A;  4DR6 L;  3WWV A;  2K7V A;  1V43 A;  1V1O A;  3RN2 A;  1K28 A;  1B9N A;  3HOV B;  2WII B;  4Y52 H;  1L2F A;  4JK1 C;  2TMP A;  1HQR D;  4DFA A;  4LWC A;  3NTK A;  2VQE L;  5GRO A;  3MA2 B;  2BH8 A;  3J80 i;  1KHI A;  2F0P A;  5LL6 X;  3FEW X;  1A15 A;  1PH3 A;  4DK3 C;  2MGS A;  2PQA B;  1JB7 A;  1DJR D;  3Q6S A;  1BCP F;  5ELN A;  4X66 L;  1BO0 A;  5G3L F;  4K2K A;  1XTD A;  4A3B H;  3MXN B;  4X6A H;  2WKC A;  4DAY A;  2L55 A;  3TS2 A;  4EQN A;  4OXP A;  1A62 A;  2QF7 A;  3BZD B;  3CP0 A;  4G7H C;  2B2T A;  2B39 A;  1H9J A;  5HGQ A;  4JBK A;  1MKH A;  4DR7 L;  1SN8 A;  2K52 A;  4IFD I;  4A76 A;  4KKS A;  1HNX L;  4PG3 A;  2NYZ D;  1MIU A;  3HKZ E;  3I72 A;  4JI8 L;  1PZI D;  1DD2 A;  3PUW A;  4X3T A;  1VF5 C;  4RGT A;  3S1M B;  4YCV A;  1GUT A;  1HZ9 A;  5CV5 A;  1KLG D;  2OCE A;  1PFM A;  1TS3 A;  3AYH B;  4YHH L;  3CCJ A;  2UXC Q;  2F0M A;  3DEP A;  4KJO A;  4B9X A;  4MN3 A;  4N9P A;  3KFU A;  1YI2 A;  1YIT A;  3SK4 A;  2VY3 A;  1ENF A;  5KIX A;  1S5E D;  1V8Q A;  1Q81 C;  1TII D;  4KY7 A;  5CYU A;  4A3B B;  3W5O A;  1DGS A;  4WFN 3;  1PH7 A;  1FD7 D;  1PMR A;  5M3F B;  4F7X A;  2MFI A;  3L9A X;  1IBK L;  1B7Y B;  4HTH A;  1CI3 M;  1YBY A;  3K5M A;  3M9B A;  3SVM A;  2NTS A;  3IL8 A;  4X3S A;  4C3I B;  2E2H B;  5JOB A;  3LWE A;  2K05 A;  5BN5 A;  1ICF B;  4JCV E;  1XMQ Q;  3I4M B;  4YCU A;  5LMU Q;  3CCV A;  2EJG C;  3S24 A;  4TQU S;  3PIP 3;  1OXT A;  1VQI A;  4ULL A;  4BBR H;  4K8I A;  4DV1 L;  1SMY D;  2GVB A;  4CKE A;  1LO5 D;  4DU9 A;  1NR2 A;  4FYD A;  1B3Q A;  4IZ8 A;  5IYB H;  3HOX B;  3RN5 A;  5AFW A;  3J81 j;  2OTL A;  3STB D;  2KEC A;  4JI1 L;  3HOV H;  1RJT A;  4JYA L;  4DV0 Q;  4TRD A;  1YJN A;  1S40 A;  1H9R A;  3G71 A;  1EOV A;  5BR8 Q;  4DR7 Q;  4C3H H;  1SYC A;  2BE5 D;  2JK8 A;  3L3O C;  4J8Q A;  4FVM A;  1AEX A;  2Q2H A;  1STA A;  1LTG D;  3W1B A;  3SXH A;  2ZTE A;  2AKW B;  2QEJ C;  4BY7 H;  3DLL A;  1GJX A;  1JE4 A;  1BCP D;  1PYS B;  3BVG A;  3CMA A;  5C44 G;  1EY4 A;  4PV1 C;  5JPN C;  5A2Q L;  1AN8 A;  1CKM A;  2HCC A;  4FO2 A;  4K5X A;  4TVA B;  3I4O A;  2F0U A;  1NMG A;  4UP7 A;  3CCU A;  1NCV A;  3T56 B;  3S1R H;  3D4D A;  3GTJ H;  1ML0 D;  4DR4 L;  2PW5 A;  2N49 A;  3DUZ A;  5DLQ E;  1KC8 C;  1BDO A;  2D62 A;  1I3Q B;  5C0X H;  1ASZ A;  2F4V Q;  1R4Q B;  1KD1 C;  1RD9 D;  2EXD A;  1GM5 A;  2ICI A;  3NXW A;  1HFN A;  4GLX A;  1AP0 A;  4NKL A;  2ID0 A;  2IHE A;  3I90 A;  4IPD A;  4KY5 A;  2ZTD A;  5HY6 A;  4JV5 L;  3S15 H;  2JP1 A;  5AJ3 Q;  3F2U A;  4QGU A;  3E9I A;  4JBM A;  3RZD H;  4A93 G;  2LSS A;  1F9P A;  3M4Q A;  2FXQ A;  1QB5 D;  2DY8 A;  4KKU A;  4FF2 A;  1Q12 A;  3TZU A;  3BZK A;  3JAM i;  1SRO A;  2LXK A;  4A3L G;  3J7A 5;  3C1F A;  4HJ7 A;  4LAA A;  2F0Q A;  1KAW A;  1FNU A;  1N8R C;  1EQQ A;  1JOO A;  4DV0 L;  1GUO A;  3RLF A;  3SGI A;  5IYD H;  2SDF A;  2K6A A;  1PH9 A;  3MXN A;  4P2C B;  3S2H B;  1HNX Q;  2F0V A;  1STB A;  2KOL A;  5M3F H;  2EYM A;  3CME A;  2R7D A;  2HQE A;  2YTY A;  3HZX A;  2JA6 B;  3KYH C;  4JOI C;  2D0P A;  3HOY B;  1VQL A;  5C44 B;  1C8C A;  3S17 B;  3B6Y A;  4DK6 C;  3NPP A;  1A3T A;  3D4R A;  1C4Q A;  1ENA A;  4PZ6 A;  1RIP A;  1Q82 C;  1IKL A;  5KYI A;  2JN4 A;  2A6E C;  3CCS A;  2B2Y C;  3A74 A;  4JI6 Q;  4PZ7 A;  4HIK A;  4JI4 Q;  5C4X G;  5KGU A;  1TWF B;  2QCP X;  3KF8 B;  3D0F A;  1LAB A;  3NWT A;  3VA7 A;  1YNN D;  2IL8 A;  3M4P A;  1II3 A;  4KV6 A;  1WOC A;  3ONA B;  3CCM A;  5M3F G;  3TRZ A;  3RUZ A;  2RA4 A;  3H94 A;  3TME A;  4JV5 Q;  5JVH 3;  2LS0 1;  1QNK A;  2ES2 A;  2ZXO A;  1OO9 B;  1SJE D;  4L8J A;  1SNP A;  3R8B A;  5C4Z A;  4JI2 L;  3D6W A;  3CPW A;  4ZKB B;  4AQY Q;  4HCE A;  3C46 A;  4ZUJ A;  2EY6 A;  2L12 A;  5GAG C;  3WOE A;  2JJQ A;  4DR3 L;  2HCI A;  3TP5 A;  1QUQ A;  1SYD A;  2E2J B;  1JC7 A;  2PZU A;  1SND A;  1YHB A;  4H02 A;  2PNR C;  3F2C A;  4ME5 A;  3KJO A;  1VQG A;  1SAP A;  1IYU A;  5CV9 A;  2MQH A;  1L1O B;  3X3M A;  4PMB A;  5C44 H;  1BOS A;  1GVP A;  1I4G A;  4DV3 L;  4IPG A;  4KMU C;  1IBK Q;  4G7Z C;  5IIF A;  1S5D D;  4LF9 Q;  1G29 1;  4XYO A;  4IUU A;  1VQF A;  4MHE A;  1TQO A;  1YZ6 A;  2CHB D;  2NVX H;  2CWA A;  2E5L Q;  3QIA A;  1B9M A;  4LF7 Q;  1TWC H;  4DV2 Q;  3NSW A;  1SNM A;  4A3J B;  3V2T A;  3T1Y Q;  1ILQ A;  5J1Z A;  4C2M B;  5GQO A;  4DV4 L;  2KCT A;  4A3I B;  1A63 A;  3A56 A;  5LMN Q;  5I4D A;  2Z4H A;  4OX9 L;  2B2U C;  5LMN L;  4PZ8 A;  2M9V A;  3GTO H;  2YTX A;  3O13 A;  1LTR D;  1JWM D;  3I70 A;  4BBS G;  4POG A;  4A3C G;  3S15 B;  1K83 H;  4DNI A;  1Q8K A;  1EQT A;  1PYW D;  2QIL A;  2ZJR A;  4LF4 Q;  1F77 A;  3Q8D A;  4MZ9 A;  3NEL A;  4A3K H;  3C3L A;  1G91 A;  3HG9 A;  2B8F A;  1PTO F;  4R4O A;  4IN3 A;  3HOU B;  2G5D A;  5BN3 A;  3GTP B;  1ET6 A;  2NZH A;  4IJH A;  2KED A;  3KLS X;  4OWT B;  4QUC A;  4DPG A;  1I4X A;  2WAQ G;  3UDF A;  4GLV B;  1P16 A;  2E74 C;  4FXG C;  2K5W A;  1KDB A;  2F0O A;  1W6J A;  3H15 A;  2I0Q A;  4C3H B;  4V0B A;  2QDB A;  1LT4 D;  3GTM H;  2A74 C;  3J7A F;  1QNU A;  2ZTC A;  5M5Y B;  1LTS D;  4CJ1 B;  4JI6 L;  1XXG A;  1X9N A;  1YVC A;  5J3B A;  4ID6 A;  3K5L A;  1YEZ A;  2J4X A;  2R92 G;  2JA6 G;  2L1B A;  1A2U A;  4FXD A;  2ALY B;  3J81 L;  3HOY H;  4HMI A;  2KJX A;  3TP7 A;  1W2B A;  1CHP D;  2A5H A;  5H1S E;  3JAM E;  2A68 D;  2SNM A;  3I4L A;  1AZQ A;  1IL8 A;  3KLS A;  2Z0S A;  2A8V A;  2ENB A;  2R61 A;  2FMC A;  2HQL A;  1D5M C;  4JI8 Q;  3CC2 A;  4L6T B;  5I2X A;  3UE1 A;  4FF3 A;  3AFQ A;  1I4H A;  1HA5 A;  1I4R A;  3HKZ B;  4TSS A;  1D7Q A;  4NXN L;  4XDX A;  1TWG B;  4A93 B;  1CSP A;  2HHH L;  1CFM A;  1XPU A;  3F8T A;  1X56 A;  4JYA Q;  3TQY A;  5C0X I;  5ELE A;  3NEM A;  2XSC A;  4KTA A;  2JE6 I;  3CQZ B;  1EIF A;  1D1K A;  4X66 Q;  4NW2 A;  2VW9 A;  3A5Z B;  3A0J A;  1H9S B;  2AWO A;  3HOX H;  4DR1 L;  1LV9 A;  4RWS C;  3OTO Q;  4YY3 Q;  2K5V A;  1TWC B;  1IYJ B;  3GQB A;  3ND8 A;  4A3D B;  2PMZ E;  1KRT A;  4ZQ3 A;  2A6E D;  1RDP D;  3K5N A;  1HNW L;  2IWH A;  2EQS A;  3PO3 H;  4QY7 A;  4LK1 C;  1GXD C;  5TSS A;  1D6E C;  1PTO C;  3QOL A;  4CDF C;  1O7Y A;  1TWG H;  3FPU B;  4X64 L;  1BQQ T;  1Q86 C;  1HUM A;  1XPO A;  2QW7 A;  1LTL A;  2B2V A;  2PNH A;  3GTQ H;  1K9M C;  4IFD J;  2NN6 I;  5JJZ A;  4C3J H;  1K73 C;  1KIX A;  3ICE A;  2AQ3 B;  1D5X C;  2Q8R E;  2CKZ B;  4QIW B;  2UXB Q;  3PIO A;  1YNJ C;  2VL6 A;  5CV7 A;  3JAM c;  4MTN A;  2A6H C;  1BVS A;  4CHT B;  4QUF A;  2J7Z A;  3SE0 A;  1EZ6 A;  3HS0 C;  2K5D A;  3NBH B;  4ODG A;  1CM9 A;  2O5I C;  1LLR D;  1HZC A;  2K01 A;  2BDN A;  5EPK A;  3IKJ A;  5ISR A;  1TR5 A;  5GAE C;  4KY6 A;  1S3O A;  1VQN A;  1ESR A;  2G9H D;  4R9W A;  3PQI A;  5C3E H;  4A4I A;  1IZ6 A;  1HUN A;  1GUG A;  4E6I A;  5C4H A;  2JA8 B;  1X32 A;  2PZT A;  3URY A;  3WDN A;  3VYS A;  4L63 B;  2CW0 D;  1HR0 Q;  5IGC A;  1PVO A;  3EBE A;  1OXS C;  1UE6 A;  2XRS D;  3QG1 A;  4K6L A;  4B9W A;  4G7O C;  3PGZ A;  1KQS A;  3S16 H;  4WRD A;  1DOL A;  4R8I A;  2IT1 A;  3UDG A;  1YHA A;  2D9U A;  1A0I A;  1N34 Q;  4B3S Q;  2ZT9 C;  3NTI A;  5CR3 A;  1STG A;  4BBR G;  1PH4 A;  1QE6 A;  3VDY A;  3LWU A;  1VS0 A;  2FHT A;  4PMC A;  1HQM C;  1MBY A;  3A55 A;  3RR5 A;  1PH8 A;  2EJF C;  3VR3 A;  1NSN S;  1FGU A;  2K5H A;  3M4O B;  2A73 B;  2Z6K C;  2F0E A;  3E5S A;  3I73 A;  1Z47 A;  3TSS A;  1ESF A;  1GHK A;  2SNS A;  1YIJ A;  2JA5 G;  3ERQ A;  1IL2 A;  2VUM B;  2SEB D;  4EGV A;  1CQV A;  4C2M H;  5EKL A;  1F2Z A;  2ZJP A;  3PO3 G;  5CC4 A;  4DGZ A;  2AUK A;  4DR6 Q;  5M3M G;  3K81 C;  1F9Q A;  4XQN A;  2XWB B;  3G6J B;  3NWS A;  4IUQ A;  1SYG A;  1PXU A;  2Q2U A;  5EKI A;  1SSO A;  1UEB A;  3UDX A;  4XXE A;  2PYK A;  4CJ2 C;  2F03 A;  3BVZ A;  4AYB E;  1O78 A;  4IFD G;  4IPH A;  3TS0 A;  1TS5 A;  5T1G A;  1U0L A;  4A3M B;  5IGG A;  4A3M G;  3N6R A;  4N8X 1;  5ELB A;  3H3V C;  5M5W H;  4BY1 B;  4YCW A;  3OHX C;  2K28 A;  2F0K A;  2B8G A;  2RDH A;  4A3E H;  1B50 A;  1CSQ A;  1HRJ A;  4HJ8 A;  1HTP A;  3DM3 A;  1EEI D;  5G3L D;  2LMC B;  3NTH A;  3L7Z C;  5M3M B;  2EZV A;  2B2U A;  4GKK Q;  4HSV A;  5IP9 H;  2UXC L;  1LAC A;  2KEE A;  2ICE C;  4LW1 A;  4PMW A;  3QR8 A;  1WTH A;  4DR5 L;  1KTK A;  2RSN A;  3J7Y W;  1MJE A;  1VQP A;  1N36 L;  4DV4 Q;  4U68 A;  2K5Q A;  2G9D A;  1Y8N B;  4GNX C;  1U4R A;  2NZ1 D;  1G6P A;  1L0W A;  5BN4 A;  3S1Q H;  3SDZ A;  3QWN A;  4A3I H;  2JA7 H;  3P75 A;  4ILW A;  1I4P A;  1OXU A;  4FF4 A;  3CXC A;  1CKN B;  2MO0 A;  2ZM6 L;  1DON A;  2NVX B;  1E24 A;  5DNF A;  2VQF L;  2PMZ B;  3H6M A;  3KF6 B;  3KDF A;  4DN4 M;  4P73 A;  4X62 L;  2Q8T A;  1HNZ Q;  4A3E B;  4LF8 Q;  3GV3 A;  3S1N H;  4GZY C;  5IYC H;  5IY0 A;  4NXM Q;  1JOK A;  1WTX A;  1PTO H;  4YIJ A;  1HNW Q;  3L2P A;  3CAM A;  2VUM H;  4IQZ A;  3GTL B;  1D2B A;  4KHZ A;  1WD1 A;  1PHJ A;  3ITP A;  5C3X A;  4LFA Q;  3IRB A;  2Z1C A;  2Z6B A;  2HDM A;  2C9O A;  2PI2 A;  1EZ8 A;  4LF6 Q;  4OX9 Q;  5C6A A;  2R7Z H;  1ZXT A;  3R93 A;  1EUJ A;  1LM0 A;  1E3P A;  2LFN A;  3HOU H;  3I55 A;  2XVS A;  2ZXP A;  5IOD A;  3I7F A;  1B2T A;  3U9S A;  1J9O A;  5KRU A;  2UUC Q;  4JI0 L;  4GN4 B;  4X3U A;  1K83 B;  3TDQ A;  4GOP B;  1S72 A;  4JC0 A;  4S3S A;  4AH6 A;  1PTO D;  1TS2 A;  2AQ2 B;  1STN A;  1EIY B;  4DV5 L;  1Y1V G;  5CV6 A;  4RCN A;  3CCE A;  4HID A;  2XRQ D;  1JOQ A;  1K8G A;  2F0S A;  1O7Z A;  1JE5 A;  5CV8 A;  4B3M Q;  2X69 A;  3WOF A;  4CKC A;  2N88 A;  4GKJ L;  4UP9 A;  5E7N A;  3ZYY X;  4KK7 A;  2Q2T A;  1EY0 A;  1G6Z A;  4BXX H;  4H44 C;  1C7Y A;  4IUP A;  2XN9 C;  2UU9 L;  2EYJ A;  1PRT B;  3TN2 A;  3FMC A;  3D3R A;  1RKN A;  4HMJ A;  1V1Q A;  4IUN A;  3W2D A;  1QOH A;  3J80 c;  4I7Z C;  1SRU A;  4C3H G;  4NPS A;  4X62 Q;  3I4N H;  2CWP A;  4OWW B;  3H91 A;  1SR3 A;  4DKA C;  1O7L A;  2VXW A;  4GN5 A;  1IYV A;  5E3F A;  2AWN A;  2L0C A;  1EY5 A;  3HOU G;  5M5X H;  1KNE A;  4JI5 L;  4B3S L;  5KNB A;  2A68 C;  3F2B A;  3J80 E;  2E2I H;  1X55 A;  2H4O A;  3H3V I;  1FNW A;  1SXT A;  3K6O A;  3Q22 A;  1HR0 L;  1B70 B;  1CHQ D;  2CVR A;  1VQM A;  4RGM A;  1U4P A;  2GN5 A;  3NK9 A;  2R92 H;  1BKB A;  2E76 C;  1NNX A;  4DAV A;  1MJC A;  4ZRZ A;  5C5L A;  5T1I A;  5A2Q E;  3K0X A;  2L5T A;  3MAQ A;  1I5F A;  2Z6K A;  1ICW A;  3PSI A;  3RLN A;  3OSO A;  3A8K E;  3I91 A;  3T1Y L;  1I94 L;  1L1O C;  1XNR Q;  1A6X A;  5JJL A;  4K5V A;  1FJG L;  3H0G B;  1STH A;  1PH5 A;  1UNS A;  4GOP C;  2JEB I;  1SLJ A;  1IW7 D;  4UHV A;  4R4I A;  1PZJ D;  2NVQ B;  5DM6 3;  3EJI A;  3HFZ B;  1TXY A;  2LY7 A;  4I65 A;  4A3E G;  3EFX D;  1SBB B;  3MZ5 A;  3S1Q B;  2V1C C;  1H9K A;  3BVM A;  2UXB L;  2DUD A;  5IT9 c;  1VMC A;  5LHY 1;  1M90 C;  2K1B A;  5DM7 3;  3KF6 A;  2OEO A;  2OXP A;  3ERO A;  4RHR A;  1Y8P B;  3OOC A;  1CT1 D;  1STY A;  4DV7 Q;  4A3J H;  5K36 H;  3SK8 A;  2B2Y A;  1SYE A;  2EY2 A;  2F0G A;  3NBH A;  4KKT A;  4PQX A;  3K57 A;  3NHH A;  5EBC A;  3RZO H;  1VQK A;  2DNC A;  1AE2 A;  3IAY A;  4X65 L;  1F2Y A;  1A8V A;  4BBS B;  1JJG A;  3G48 A;  1LYL A;  4JW0 A;  2ATW A;  3MTS A;  3C2P A;  1PZK D;  3D8G A;  3RNU A;  4QL5 A;  4ALP A;  3HEJ A;  4DR4 Q;  3W1G A;  2EYO A;  3ER0 A;  2NB0 A;  5JVG 3;  3M3Y B;  1HA6 A;  4KHV A;  4IUV A;  3K5O A;  2UUA L;  3AQQ A;  5E4X A;  1RL2 A;  1V1P A;  1LUZ A;  1PFS A;  2F4I A;  3MEH A;  1NE3 A;  4A3J G;  4QIW E;  4OL7 A;  1HCZ A;  3T13 A;  1DOM A;  3PMF A;  1OTC A;  3OIP A;  3S2H H;  1QVG A;  1ET9 A;  2KHS A;  2B29 A;  5FJ8 G;  3AMU A;  2HT1 A;  2PO4 A;  4C3J B;  3NE5 B;  2E2D C;  2RSO A;  4GN3 B;  1WTW A;  1J5E L;  3FPP A;  2JSO A;  3E3X A;  4UP8 A;  3I4N B;  2K04 A;  2RDF A;  1BUV T;  4ZCK A;  4CDE C;  1CA5 A;  2DJG C;  1PYB A;  2CQA A;  5L37 A;  2EVB A;  3HOY G;  2LKV A;  1PDQ A;  4O0A A;  1HZA A;  4A3G H;  1UE7 A;  1XJV A;  2BDO A;  2XGT A;  2NVY B;  1WTV A;  2A69 C;  2H5X A;  1FGB D;  2Q8I B;  3K80 C;  5EJW A;  4XT1 B;  5M5W B;  1TKW B;  3HGB A;  1B44 D;  2SOB A;  4P75 A;  2EYF A;  1PV4 A;  4RA8 A;  4C1N I;  2O2L D;  3C1E A;  4L5T A;  4OWX B;  3TP8 A;  1YNN C;  1ILP A;  2B2T C;  3H09 A;  1JQY D;  5CBE E;  1KAA A;  2KA7 A;  4LFC Q;  5C3E B;  1Q90 A;  1M4V A;  4DV7 L;  2EYP A;  1M8A A;  1Y69 U;  4QJF A;  2H1E A;  4DF7 A;  2N55 A;  1I50 B;  3BG3 A;  4DUY Q;  1N34 L;  4BBR B;  3BYT B;  4OGQ C;  1SNO A;  1Z7T A;  1JJ2 A;  1T5E A;  4YWK A;  2A6H D;  1QVC A;  4BY7 G;  1YNJ D;  5JEA H;  1JCK B;  4MIU A;  3PUZ A;  1S5F D;  3OMC A;  2HUG A;  4M1U B;  4IFD H;  4DXF A;  3HOZ H;  1UWV A;  1SNQ A;  4R8N A;  1WFQ A;  3E6Z X;  4DR5 Q;  3MXG A;  1HJP A;  4DK0 A;  4KD4 A;  5FLX c;  4U67 3;  1F9S A;  1MGS A;  5IWA L;  4A3C H;  2RKS A;  1KXL A;  4LFB Q;  5M3M H;  2JA9 A;  2F0F A;  1T9H A;  5COR A;  1KLU D;  2VB3 X;  4XQQ A;  1I6H B;  2OF1 A;  4OIJ A;  1EWC A;  2AQ1 B;  1IBM Q;  1IBL L;  1DXM A;  1Z9F A;  1D1I A;  1HNZ L;  3CPF A;  3CRL C;  1PH2 A;  4NMZ A;  3S1M H;  3LX0 A;  1BBW A;  1I3Q H;  1LTI D;  2MJ8 A;  1SYF A;  2L11 A;  2XNA C;  2RHQ B;  3DWQ A;  2AHO B;  1BNZ A;  5JJI A;  2E8G A;  3KBX A;  1PRT F;  1I6V C;  4N9T A;  1N32 L;  1X6O A;  4RKL A;  1HZB A;  3D6C A;  3BDL A;  1X3E A;  4YWL A;  2KVM A;  2CCZ A;  2CH4 A;  4C1N K;  1G51 A;  1HHV A;  1E22 A;  4C3I H;  1A3U A;  4X64 Q;  2M00 A;  2BCO A;  4JPB W;  4HIO A;  2JEA I;  4IPC A;  5JAV A;  3HOX G;  2K50 A;  5IGD A;  4A3D G;  3J81 E;  2ZJQ A;  5JJK A;  3RMH A;  2O5J C;  2K75 A;  2R6G A;  4O42 A;  1JMC A;  1VQH A;  1RTO A;  2HIX A;  4F8M A;  1L1O A;  4R4T A;  4YY3 L;  4HJA A;  1XMO Q;  1XX8 A;  3HOW G;  3FP9 A;  2I5H A;  4F87 A;  1PTO B;  3S2D H;  1TWA H;  1Y1W H;  4C3I G;  3ND9 A;  2WAQ B;  2PW7 A;  5IP9 G;  3CW2 C;  3OW2 A;  5C3E G;  1DZ1 A;  2F0W A;  2UUC L;  4JI0 Q;  4FXK C;  4HN7 A;  2EYL A;  5GAH C;  1YJW A;  3K8A A;  4K0K L;  2WAC A;  1Q7Y C;  2FFK B;  4A3B G;  1TU2 B;  1SMY C;  1JJC B;  3J81 c;  4GOP A;  3KUP A;  2QDL A;  4XIG S;  2K4K A;  2HDL A;  5I2Y A;  1K3B C;  2WB1 G;  2BOS A;  5HUR A;  4GKK L;  4LFB L;  1CA6 A;  1WJJ A;  2I07 B;  1EWH A;  1HXY D;  1VQE A;  2KUM A;  3U58 A;  4GS3 A;  2Z9H A;  1TWA B;  1XWE A;  4RG1 A;  4V19 0;  2R3Z A;  2KCM A;  1IW7 C;  4A3D H;  2MUY A;  1VQ6 A;  4BXX G;  4C3J G;  4FF1 A;  3J7A V;  2B63 G;  4DNT B;  1LT3 D;  4XT3 B;  3DEO A;  4KHP L;  2WFW A;  3DXJ C;  5DEH A;  5LMN W;  1EYA A;  3U4V A;  5F2D A;  3VA5 A;  1KRS A;  2JQO A;  3QJY A;  3OWE B;  4QCL A;  2NVY H;  1IHZ A;  1E2Z A;  1QCB D;  1V9P A;  2XTI A;  5CV4 A;  3CCL A;  3F1Z A;  1O80 A;  1U4L A;  1M1K C;  2DNE A;  2UXD L;  5JPM C;  1E2V A;  2PZW A;  3T51 B;  5IP7 G;  2OQ0 A;  3S14 B;  1MD2 D;  3HOV G;  2CQO A;  2VB2 X;  1NR4 A;  3NEN A;  2E2I B;  2IX0 A;  1IKM A;  1GHJ A;  1CK1 A;  1GUN A;  3E0E A;  5I9O A;  5IYB G;  1XYI A;  2BH2 A;  1XNQ Q;  1K8O A;  3BU2 A;  1UUP A;  2VS1 A;  1EU4 A;  1H9S A;  1P8L A;  4B3T Q;  1SE4 A;  4K2L A;  1AZP A;  2EPB A;  3TRE A;  2B63 B;  1TS4 A;  2D0O A;  1QZH A;  4WOR A;  5NUC A;  3DM1 A;  1NY4 A;  5KNC A;  1XNR L;  5ELO A;  3VR2 A;  4CGY B;  4X3K A;  1MI2 A;  1PH1 A;  3VR5 A;  1B8A A;  3PIO 3;  3HKS A;  2B63 H;  1GKH A;  5ELD A;  1VQD A;  3GTG B;  4LJZ C;  1SMX A;  1XPR A;  1QUQ B;  2IX1 A;  4KLK A;  3ERS X;  5EGT A;  1KL9 A;  4GNX A;  4CKB A;  1TWF H;  3GTM B;  3D4W A;  4OIK A;  1EY7 A;  4LMQ D;  1LT5 D;  1EEF D;  2K03 A;  4UDU C;  4JI2 Q;  3I2Z A;  2WKD A;  1R9T B;  3T4A C;  2P5Z X;  2IPK D;  1TT2 A;  3E9H A;  1C48 A;  3M7N A;  2WB1 E;  2B2W A;  4KHP Q;  3KDF B;  4AIM A;  2OQK A;  2F1M A;  4IOC A;  1TWH H;  2F4V L;  2R7Z B;  4KJN A;  3JAM L;  1K0S A;  2X6G A;  3MWY W;  2NBF A;  3PIP A;  5FLM H;  1IBM L;  1NUC A;  1Y14 B;  4A93 H;  3HRZ C;  4O1N A;  1IXR A;  2VZA A;  1QVF A;  3SHL A;  2I5M X;  3KF8 A;  5D3D A;  2DGY A;  2NZO A;  1J8I A;  5C4J B;  3TZD A;  2JA7 G;  1PLF A;  2EXZ A;  4QMG A;  1N33 L;  2RVL A;  3Q0A A;  3Q24 A;  4ABN A;  1TVX A;  1QG7 A;  5C0X G;  2UUB Q;  5EBD A;  1WTP A;  4AYB G;  4L5R C;  3FRP B;  5LL6 S;  4N8F A;  4EVO A;  2HHH Q;  4FDB A;  3GP7 A;  3GTL H;  1ZYR D;  3CQZ H;  1GO3 E;  3M4Y A;  4LF9 L;  1NBW A;  2GVA A;  1XNQ L;  1VQO A;  4DAY B;  1VQ4 A;  2DJF C;  5IP7 H;  2E2J H;  2KHJ A;  2KHI A;  3QO2 A;  1EYG A;  3GTO B;  1STE A;  2Y0S B;  2F3W A;  3I56 A;  1SNC A;  1LTA D;  5K5P A;  2RCF A;  4JOI A;  5IGB A;  2PQE A;  4C56 C;  5D14 A;  4G4K A;  2L15 A;  2BE5 C;  5IWA Q;  4J1M A;  3ULP A;  3EIV A;  4ZUI A;  4LFC L;  4KN4 C;  5FKA C;  2MHV A;  2UUA Q;  4NXM L;  4DV1 Q;  3OWF A;  4NDX A;  2JYO A;  4X65 Q;  4LUZ A;  2OWO A;  3OYY A;  4WJ4 A;  4HAE A;  3FHW A;  5CGK A;  2YYZ A;  5LMU L;  5FK9 C;  3P20 A;  1UAP A;  1JT8 A;  4IAL A;  1DOK A;  1B4O A;  1QIL A;  1V1P B;  2NN6 G;  4LF8 L;  2OT2 A;  5DAU A;  4B08 A;  5FOB B;  5C3W A;  4DR2 L;  1F2L A;  2B3G A;  3UI2 A;  3G7L A;  4ZAI A;  4HJ9 A;  4LF7 L;  1ZKO A;  5E4W C;  3L0O A;  3GTK B;  2M2L A;  1FNV A;  2B2W C;  3R3O A;  4JI7 Q;  1QJO A;  1FYC A;  4NXN Q;  3S1R B;  3Q23 A;  1PFB A;  3ZJY C;  2NVT H;  5J22 A;  1FJG Q;  4DXG A;  2PI2 E;  2CH4 W;  3HP3 A;  4L5S A;  4EQO A;  3KBG A;  2PCF B;  1N33 Q;  5IYC G;  3S14 H;  1NJI C;  1SE3 A;  2HIV A;  4RKB A;  4TKO B;  2KBN A;  1T5X D;  1I94 Q;  4RAU C;  1YHQ A;  3CCQ A;  4HR7 B;  5M5X B;  1Q8I A;  3A5U A;  5ELC A;  2RDG A;  4DV2 L;  2E5L L;  2K32 A;  5JEA G;  1E1T A;  2CW0 C;  1VQA A;  3I4M G;  1KDA A;  1AW7 A;  4EQ5 A;  2WP8 J;  2F0L A;  2DN8 A;  2JA8 H;  5IGE A;  5KND A;  1X54 A;  4NP5 A;  4JI4 L;  4G57 A;  3I3C A;  4HSP A;  2MP1 A;  4K6D A;  4ZKC B;  1X3F A;  1SE8 A;  3PO2 G;  3S2D B;  1LTT D;  4CDC C;  2JA6 H;  1W6K A;  3J81 i;  5K36 G;  1EL0 A;  1VQB A;  2KCC A;  2B2V C;  5E1F A;  1EFI D;  4DR3 Q;  3H0G G;  1VQ9 A;  3PO3 B;  1E2W A;  3VYR A;  1WTR A;  2IX3 A;  1BXT A;  3GO5 A;  1C0A A;  3X3N A;  3CCR A;  5EPJ A;  1OXX K;  1A3V A;  1WYD A;  2WB1 B;  3CRK C;  4XTC S;  2BA1 A;  3F2D A;  1A2T A;  4A3M H;  2WAQ E;  1SJH D;  3NQT A;  2D2C C;  1Q1B A; 
#chains in the Genus database with same CATH homology
 4A3C H;  3NBH B;  1KXL A;  4LFB Q;  3TS2 A;  2PQA A;  5M3M H;  1CKO A;  2JA9 A;  4K0K Q;  4OXP A;  1HZC A;  3M4O H;  1A62 A;  2MO1 A;  2YTV A;  3CP0 A;  4R1J A;  1T9H A;  4X6A H;  5HGQ A;  4JBK A;  5GAE C;  3CC4 A;  1S3O A;  1MKH A;  1EFW A;  1VQN A;  1SN8 A;  2YV5 A;  4DR7 L;  1VQ5 A;  5C3E H;  2K52 A;  4A4I A;  4IFD I;  1IZ6 A;  1UE1 A;  3FKI H;  3M3Y H;  4A76 A;  1HNX L;  4PG3 A;  1E7Z A;  1MIU A;  3HKZ E;  4JI8 L;  4JI7 L;  1IBM Q;  1IBL L;  3PUW A;  3MEF A;  4YCV A;  1HZ9 A;  1K0R A;  1Z9F A;  2OCE A;  1HR0 Q;  1HNZ L;  1PVO A;  3AYH B;  3CPF A;  1OXS C;  3BZC A;  3EBE A;  1UE6 A;  4YHH L;  3CCJ A;  1PH2 A;  3I4M H;  1I6H H;  2UXC Q;  3S1M H;  3PGZ A;  1BBW A;  1I3Q H;  1VCI A;  2IY5 B;  2A19 A;  2RHQ B;  3KFU A;  1YI2 A;  1YIT A;  1KQS A;  2VY3 A;  3S16 H;  1VQJ A;  2AHO B;  2IT1 A;  2JA8 G;  1AH9 A;  5JJI A;  2E8G A;  1Q81 C;  3S17 H;  1N32 L;  3UDG A;  1YHA A;  1A0I A;  1X6O A;  1N34 Q;  4B3S Q;  3W5O A;  1HZB A;  1PH4 A;  4BBR G;  1DGS A;  4O2D A;  1X3E A;  4YWL A;  3VDY A;  3U4Z A;  2CCZ A;  1PH7 A;  1VQC A;  1G51 A;  1VS0 A;  2MFI A;  2UXD Q;  1IBK L;  1E22 A;  1B7Y B;  4C3I H;  2Y0S E;  4X64 Q;  2AMC B;  5JEA J;  1D8L A;  1YBY A;  4HIO A;  2JEA I;  4IPC A;  3HOX G;  2K50 A;  3RR5 A;  3M9B A;  1PH8 A;  2ZJQ A;  4A3D G;  5JJK A;  4KI0 A;  2C35 B;  1FGU A;  2K5H A;  2NVQ H;  5FJ8 H;  2K75 A;  2Z6K C;  3D31 A;  2R6G A;  2VQF Q;  3U50 C;  1JMC A;  1Z47 A;  1VQH A;  4JCV E;  1XMQ Q;  2HIX A;  1YIJ A;  2BA0 A;  2JA5 G;  1PA6 A;  4YCU A;  1L1O A;  5LMU Q;  1SFO H;  3CCV A;  1IL2 A;  4R4T A;  2MNA A;  4YY3 L;  4JBW A;  4HJA A;  1XMO Q;  3S24 A;  4C2M H;  4TQU S;  1OXT A;  1VQI A;  2ZJP A;  3HOW G;  3PO3 G;  3FP9 A;  2I5H A;  4BBR H;  5C4X H;  4DR2 Q;  4P72 A;  4DR6 Q;  4DV1 L;  2N8N A;  5M3M G;  2GVB A;  3K81 C;  4R4Q A;  1EWI A;  3M85 A;  3S2D H;  1TWA H;  4A3G G;  4NB3 A;  1Y1W H;  1WCM G;  1ASY A;  2UU9 Q;  5IYB H;  2Q2U A;  1UEB A;  5IP9 G;  3UDX A;  3CW2 C;  3OW2 A;  5C3E G;  3RN5 A;  4AYB E;  3J81 j;  2UUC L;  4JI0 Q;  4DV6 L;  4IFD G;  3GTK H;  3PF5 A;  4IPH A;  3TS0 A;  1I50 H;  3STB D;  5GAH C;  1YJW A;  2OTL A;  4POF A;  3K8A A;  4IOA A;  4K0K L;  4JI1 L;  1U0L A;  1Q7Y C;  3HOV H;  4JYA L;  4A3M G;  4P74 A;  4A3B G;  4DV0 Q;  1YJN A;  1S40 A;  3G71 A;  2RHS B;  1JJC B;  5M5W H;  1O7I A;  3J81 c;  4GOP A;  1EOV A;  4A3L H;  2OTJ A;  4YCW A;  2RCN A;  5BR8 Q;  4DR7 Q;  1N32 Q;  4C3H H;  2JK8 A;  1CSQ A;  4XIG S;  1J6Q A;  2K4K A;  4HJ8 A;  3DM3 A;  3PUV A;  2Q2H A;  2WB1 G;  3L7Z C;  4GKK L;  4JI5 Q;  4LFB L;  2A1A A;  1WJJ A;  3W1B A;  4GKK Q;  5IP9 H;  1VQE A;  2UXC L;  2ZTE A;  2AKW B;  4BY7 H;  3U58 A;  4GS3 A;  3DLL A;  3PCO B;  3HKZ G;  4RG1 A;  4LW1 A;  2KCM A;  1PYS B;  4PMW A;  3CMA A;  5C44 G;  2K14 A;  1N9W A;  4DUY L;  4DR5 L;  2QGQ A;  4A3D H;  1CKM A;  4TVA B;  1MJE A;  1VQP A;  3I4O A;  1N36 L;  4DV4 Q;  1BBU A;  1VQ6 A;  2R93 G;  4BXX G;  2KEN A;  1NMG A;  4UP7 A;  3CCU A;  4GNX C;  1G6P A;  1L0W A;  1XMO L;  3S1Q H;  4A3I H;  2B63 G;  4BA2 I;  3S1R H;  2JA7 H;  2JA5 H;  4BA1 I;  3GTJ H;  4DR4 L;  4KHP L;  2N49 A;  2WFW A;  2K5N A;  5DLQ E;  5C0X J;  1KC8 C;  2F4V Q;  2D62 A;  1ASZ A;  1OXU A;  5LMN W;  1KD1 C;  2EIF A;  3U4V A;  3CXC A;  1CKN B;  2EXD A;  2MO0 A;  3KOJ A;  2ZM6 L;  1GM5 A;  4OO1 I;  5C4J H;  1E24 A;  1KRS A;  2JQO A;  2VQF L;  2NVY H;  1V9P A;  2XTI A;  3KF6 B;  4EX5 A;  3CCL A;  3KDF A;  4P73 A;  2RF4 A;  4GLX A;  3F1Z A;  4X62 L;  4A3F G;  2ID0 A;  2IHE A;  1M1K C;  4IPD A;  3FKI G;  4YHH Q;  4GKJ Q;  2UXD L;  3UE0 A;  3OTO L;  1HNZ Q;  2ZTD A;  5HY6 A;  4JV5 L;  3S15 H;  5IP7 G;  5AJ3 Q;  2OQ0 A;  4QGU A;  4LF8 Q;  3S1N H;  2R93 H;  5IYC H;  3E9I A;  4LUV A;  4JBM A;  3RZD H;  5IY0 A;  4NXM Q;  3TEH B;  4A93 G;  1C9O A;  3HOV G;  2CQO A;  2YU9 H;  2LSS A;  3M4Q A;  1HNW Q;  2FXQ A;  2ZM6 Q;  4JI3 Q;  3L2P A;  1Q12 A;  3CAM A;  1FVI A;  2VUM H;  2N78 A;  3BZK A;  3JAM i;  3NEN A;  1SRO A;  2LXK A;  3I4N G;  4A3L G;  4KHZ A;  3J7A 5;  3PF4 A;  2IX0 A;  4IO9 A;  2QEX A;  4HJ7 A;  1PHJ A;  4DAM A;  4LFA Q;  1Y1W G;  3IRB A;  4GLA C;  4HJ5 A;  1KAW A;  1WCM H;  3E0E A;  1HH2 P;  2PI2 A;  2LXJ A;  3RLO A;  5IYB G;  4LF6 Q;  4OX9 Q;  2R7Z H;  1N8R C;  4B3T L;  4A3F H;  2BH2 A;  1XNQ Q;  4GNX B;  1EQQ A;  2E2H H;  4DV0 L;  2F52 A;  3RLF A;  3BU2 A;  1EUJ A;  2VS1 A;  1LM0 A;  1E3P A;  1P8L A;  3PUX A;  3SGI A;  2QA4 A;  4B3T Q;  5IYD H;  3HOU H;  3TRE A;  1PH9 A;  3I55 A;  2D0O A;  3I7F A;  1QZH A;  4DUZ Q;  1HNX Q;  3ULJ A;  5M3F H;  3CME A;  1NY4 A;  2R7D A;  1XNR L;  2YTY A;  1AE3 A;  2UUC Q;  4JI0 L;  1X65 A;  4GN4 B;  3KYH C;  4JOI C;  4GOP B;  1S72 A;  2D0P A;  2VQE Q;  4JC0 A;  5ELO A;  3K7A H;  4AH6 A;  1VQL A;  3B6Y A;  2VUM G;  4DK6 C;  1EIY B;  4IJL A;  1Y1V G;  4DV5 L;  1PH1 A;  1B8A A;  4PZ6 A;  3CCE A;  1RIP A;  4OON A;  1Q1E A;  4HID A;  1Q82 C;  4A3I G;  3HKS A;  1K8G A;  2B63 H;  3CCS A;  3A74 A;  1GKH A;  4JI6 Q;  4PZ7 A;  5IE8 A;  1JE5 A;  1VQD A;  4HIK A;  4JI4 Q;  3K7U C;  4A3K G;  3HOW H;  5C4X G;  4B3M Q;  4AQY L;  3JC6 6;  4UY8 C;  1SMX A;  3KF8 B;  4A75 A;  3T1H L;  3BJU A;  3D0F A;  1QUQ B;  4P71 A;  5IYD G;  1XPR A;  2IX1 A;  4GKJ L;  4KLK A;  4JG2 A;  3M4P A;  3ERS X;  2CFM A;  4UP9 A;  5E7N A;  5M5Y H;  4DV3 Q;  4BY1 G;  1KL9 A;  4GNX A;  3H3V H;  1TWF H;  1WOC A;  3TRZ A;  3CCM A;  5M3F G;  2Q2T A;  3ULL A;  3UDI A;  4JV5 Q;  4BXX H;  1C7Y A;  4BBS H;  1WI5 A;  2ES2 A;  5FLM G;  2UU9 L;  4JI2 Q;  3I2Z A;  1Y1V H;  2VNU D;  4HIM A;  4JI2 L;  3CPW A;  3CD6 A;  4LF5 L;  1VQ8 A;  1K3R A;  4AQY Q;  4LNQ A;  1V1Q A;  3T1H Q;  1FL0 A;  3LGJ A;  1VQ7 A;  2IHF A;  5GAG C;  3E9H A;  1SRU A;  4X62 Q;  4NPS A;  3J80 c;  2JJQ A;  4DR3 L;  3I4N H;  2CWP A;  3G4S A;  4OWW B;  2WB1 E;  1SR3 A;  4DKA C;  1QUQ A;  3M7N A;  4KHP Q;  3KDF B;  4AIM A;  1CUK A;  1YHB A;  4OO1 G;  2OQK A;  4MNO A;  3GTG H;  3G6E A;  4H02 A;  4IOC A;  3F2C A;  4GN5 A;  1TWH H;  2F4V L;  3KJO A;  1VQG A;  3GDE A;  1GD7 A;  2MQH A;  4B3R Q;  1L1O B;  1N36 Q;  2AWN A;  2F3I A;  3HOU G;  5M5X H;  3PIP A;  4JI5 L;  5FLM H;  1IBM L;  5C44 H;  4B3S L;  1Y14 B;  1GVP A;  4A93 H;  4DV3 L;  3PUY A;  3F2B A;  2E2I H;  4WJ3 M;  4IPG A;  1X55 A;  1IBK Q;  3H3V I;  3KLW A;  1HR0 L;  1IXR A;  1B70 B;  1NMF A;  4APV A;  4LF9 Q;  1G29 1;  2VZA A;  1VQM A;  1VQF A;  2GN5 A;  1QVF A;  2R92 H;  1BKB A;  2I5M X;  1PH6 A;  2DGY A;  2NZO A;  1MJC A;  1YZ6 A;  2NVX H;  2JA7 G;  2CWA A;  3K0X A;  1N33 L;  1X3G A;  2E5L Q;  1J5E Q;  1I5F A;  4LF7 Q;  1TWC H;  2Z6K A;  3PSI A;  1UE5 A;  4DV2 Q;  1K8A C;  3GTP H;  3RLN A;  5C0X G;  3H0G H;  3T1Y Q;  2UUB Q;  5GQO A;  4DV4 L;  3T1Y L;  3KJP A;  2KCT A;  1I94 L;  2UUB L;  4AYB G;  4L5R C;  3J7Z C;  1L1O C;  1XNR Q;  1A63 A;  5JJL A;  2HHH Q;  1FJG L;  4FDB A;  4RMF A;  5LMN Q;  3GTL H;  4UPA A;  3CQZ H;  1GO3 E;  5AJ3 L;  4LF9 L;  1PH5 A;  4GOP C;  4OX9 L;  5LMN L;  2JEB I;  4PZ8 A;  1NBW A;  1SLJ A;  2GVA A;  1XNQ L;  1VQO A;  4R4I A;  3GTO H;  2YTX A;  4DAY B;  1VQ4 A;  3AEV A;  3HFZ B;  1TXY A;  3PV0 A;  1H95 A;  5IP7 H;  2E2J H;  2KHJ A;  2KHI A;  4A3E G;  4BBS G;  4POG A;  4A3C G;  1EYG A;  2V1C C;  1K83 H;  4DNI A;  3I56 A;  1Q8K A;  2N3S A;  4ME3 A;  4DV6 Q;  1QZG A;  4JOI A;  1Q46 A;  2UXB L;  2ZJR A;  4LF4 Q;  2DUD A;  5IT9 c;  3CC7 A;  2L15 A;  3Q8D A;  3NEL A;  4MZ9 A;  4A3K H;  1M90 C;  5IWA Q;  3ULP A;  3AFP A;  3KF6 A;  4R4O A;  3EIV A;  4LFC L;  4A3J H;  4DV7 Q;  2UUA Q;  4L5Q A;  4BY1 H;  4DV1 Q;  4NXM L;  2NZH A;  1YNX A;  4IJH A;  4DPG A;  4OWT B;  2R7Z G;  2WAQ G;  4X65 Q;  4LUZ A;  3RZO H;  2Y0S G;  1VQK A;  4LF5 Q;  1AE2 A;  3UDF A;  4B3M L;  4GLV B;  3OYY A;  4X65 L;  4DR1 Q;  1A8V A;  1P16 A;  3STB C;  4JBJ A;  1OXV A;  2OWO A;  1XMQ L;  4WJ4 A;  1JJG A;  3G48 A;  3FHW A;  1LYL A;  2YYZ A;  1NTG A;  3H15 A;  5LMU L;  2ATW A;  2I0Q A;  2ASB A;  1JT8 A;  3RNU A;  4QL5 A;  4ALP A;  3GTM H;  2NN6 G;  4DR4 Q;  3W1G A;  4LF8 L;  2ZTC A;  3ER0 A;  4DR2 L;  3PO2 H;  4JI6 L;  5GAD C;  1X9N A;  2B3G A;  2I5L X;  1YVC A;  5J3B A;  1YEZ A;  2UUA L;  4HJ9 A;  4LF7 L;  2JA6 G;  2R92 G;  3AQQ A;  3L0O A;  1RL2 A;  2ALY B;  3HOY H;  1LUZ A;  1PFS A;  4QQB X;  4A3J G;  1NE3 A;  1W2B A;  4JI7 Q;  5H1S E;  4QIW E;  4NXN Q;  4LF4 L;  1CKN A;  3S2H H;  1OTC A;  3ZJY C;  1QVG A;  1YJ9 A;  4LF6 L;  4JI1 Q;  2B29 A;  2NVT H;  5FJ8 G;  1FJG Q;  2Z0S A;  2A8V A;  2HT1 A;  1W3S A;  2PI2 E;  2Q2I A;  4L5S A;  4GN3 B;  2HQL A;  4B3R L;  1J5E L;  4R4C A;  1N33 Q;  4JI8 Q;  3CC2 A;  4UP8 A;  5IYC G;  4DUZ L;  3S14 H;  3GD7 A;  3UE1 A;  1NJI C;  3AFQ A;  2HIV A;  2KBN A;  4LUO A;  1PYB A;  4LFA L;  1D7Q A;  4NXN L;  1I94 Q;  1CSP A;  1YHQ A;  3CCQ A;  2HHH L;  3HOY G;  1EQR A;  4O0A A;  1HZA A;  4DV5 Q;  1UE7 A;  1XPU A;  4A3G H;  1XJV A;  4Y7N H;  2XGT A;  4YWM A;  1U5K A;  3A5U A;  3F8T A;  1X56 A;  4JYA Q;  2H5X A;  3TQY A;  5C0X I;  5EAY A;  3NEM A;  3CF5 A;  3EN2 A;  4DV2 L;  2JE6 I;  3K80 C;  2E5L L;  1EIF A;  1E1O A;  4X66 Q;  5JEA G;  2VW9 A;  4P75 A;  4JI3 L;  3A5Z B;  1HR0 W;  1E1T A;  5BR8 L;  3A0J A;  1PV4 A;  1VQA A;  1IBL Q;  3I4M G;  2AWO A;  3HOX H;  4DR1 L;  4J15 A;  4L5T A;  4OWX B;  4EQ5 A;  3OTO Q;  4YY3 Q;  2WP8 J;  2K5V A;  1R9T H;  3HOZ G;  1IYJ B;  2R7F A;  4DR6 L;  2PMZ E;  2JA8 H;  3WWV A;  1KRT A;  4LFC Q;  1V43 A;  3RN2 A;  4DV7 L;  1X54 A;  4JI4 L;  1HNW L;  4Y52 H;  1X3F A;  1SE8 A;  3PO2 G;  4QJF A;  1L2F A;  2EQS A;  3PO3 H;  4DUY Q;  4QY7 A;  2JA6 H;  3J81 i;  1N34 L;  5K36 G;  1VQB A;  1JJ2 A;  4YWK A;  1TWG H;  1QVC A;  4X64 L;  4BY7 G;  4DR3 Q;  1Q86 C;  3H0G G;  4LWC A;  1VQ9 A;  2VQE L;  5GRO A;  1XPO A;  2BH8 A;  3J80 i;  3GO5 A;  1C0A A;  1LTL A;  1KHI A;  3PUZ A;  2PNH A;  3CCR A;  1OXX K;  3GTQ H;  1K9M C;  4IFD J;  2NN6 I;  1WYD A;  4C3J H;  1PH3 A;  1K73 C;  1KIX A;  4XTC S;  4DK3 C;  2PQA B;  1JB7 A;  3ICE A;  3HOZ H;  2BA1 A;  3F2D A;  1UWV A;  5ELN A;  4X66 L;  2CKZ B;  1WFQ A;  4DR5 Q;  3PIO A;  4A3M H;  1HJP A;  2VL6 A;  3JAM c;  2UXB Q;  1XTD A;  4A3B H;  2WAQ E;  5FLX c;  4MTN A;  1BVS A;  3MXN B;  4A3E H;  1Q1B A;  5IWA L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...