3PUVA

Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
371
structure length
371
Chain Sequence
b'ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein
molecule tags Hydrolase/transport protein
source organism Escherichia coli
publication title Snapshots of the maltose transporter during ATP hydrolysis.
pubmed doi rcsb
total genus 103
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3puvA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3puvA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3puvA01
4NMMA 2VEDA 4QKQA 4X66L 2F4VL 5E4FA 2BOVA 2W83A 3OFND 2FOLA 3ZJYA 1TEVA 3A8JE 1PV4A 4OO1G 2PH1A 2D2EA 2O8BB 3KJPA 3ULLA 4LUZA 1Z6XA 1KJWA 5JJLA 4GZLA 4GNXB 3HP1A 1NI3A 3L43A 1E24A 3HYRA 4JL6A 4L9WA 3QF4A 4HLUC 3VTKA 1O78A 4M1KA 3GLGB 3EA0A 1IBLL 3LO5A 2ATVA 2ZR7A 4IOCA 2QE7A 4XIGS 4TTQA 2YWFA 4LBVA 1P60A 1KI8A 1U98A 5LB4A 5G41A 5EP1A 2XTMA 4DR4Q 4GNKA 3GLHE 2IYUA 1NVVQ 1J90A 4DEXA 3A5ZB 1Q90A 2JLSA 4OI4A 1JJGA 3ZZ0A 3TUIC 4TL6A 1ZUIA 2O5IC 4HUTA 1FYCA 4TMVA 1PH1A 3GJ0A 4HAUA 2NPIA 4B3TQ 1NVXQ 1GM5A 3OE7A 3K0SA 1RYHA 4P4UA 1RFLA 2C98A 2ZVPX 1JALA 3SS8A 4EAQA 3PV0A 5FUVA 3CZQA 2WFWA 4MH0R 4POFA 3TGPA 2ASEA 3TR0A 2G88A 2EWVA 2ZM6Q 3KJIA 3DOFA 4KJZA 4OI0A 2B8WA 4PSAA 4A3FG 4BBSG 2ZRKA 4RCYA 1Z0KA 4EPXA 2E5LQ 4DR5L 1KI6B 1Q22A 1VHLA 2QRZA 3EZ9A 4PC2A 2R6GA 1OXSC 3CMEA 1GL6A 2JASA 2ZUBA 4TLEA 4QY7A 2Q9CA 3MWJA 2J0QA 5CB8A 1R9TH 1HTPA 1TKWB 1G19A 5M5YH 2IK8A 4E03A 4PHHA 1G6OA 5K8IA 1G7RA 5IWAQ 1FPMA 2BM0A 4DXAA 2DPXA 4C2UA 1KDPA 2NO6A 4LHVA 3RRYA 1P62B 4ACAA 4YCVA 1QVGA 1TWCH 2FPMA 4ASUD 2OM2A 3BG3A 1E0SA 1UEBA 4LHWA 4MRNA 5ELNA 3M4YA 2E8GA 1IL2A 1CR2A 3DM9B 3MUFA 4V0ME 4P75A 1UBEA 2ZRFA 3THXA 1QUQA 1RIFA 2D0PA 3F2CA 3UWKA 4NE2A 3L7ZC 1R2QA 5IYDH 1JQJC 2R8RA 4A3MH 2CWPA 2FV8A 2A6ED 1KK3A 2HLDD 3BRWD 3KUCA 1SRUA 4Q9JA 1Z7TA 1QZXA 2XTNA 1GHKA 2NO1A 3HYTA 1MIUA 2O0HA 2KI5A 3T1QA 1VQIA 3ZS8A 4A3BH 3A7AB 3DXJC 1IY1A 1O7IA 2D4HA 2QA4A 4Z54A 4L5QA 3RR5A 1VG0B 3MRSA 5E3HA 1YJNA 2QT0A 1U0HC 2AUJD 5FJ8H 1JXOA 1Z29A 2C95A 2V7QA 4BFYA 1UDXA 4NYIQ 4PC6A 3NELA 4DLRA 5CJPA 4L8JA 4POGA 1CKNB 1GVNB 2GK7A 3F1ZA 2UUAQ 1EFWA 4A3JG 3T51B 4A3IH 1Q1BA 4LF6Q 1RC8A 3NEMA 1ONBA 2AN9A 1NBMA 2ZRHA 4G0NA 1E1RA 4IFBA 4MRRA 1GWNA 5EE5B 5JCPA 4MKFA 1G3UA 2EQBA 5L3QB 1P2TA 4W9MC 2F52A 3GTPH 5FLXc 2OBMA 3TUJC 4DIEA 5K8LA 3QSYA 1SULA 1ZM4A 1B70B 1M90C 1YE8A 2AKAB 3GEIA 2TMKA 5HE8A 3HOYG 2DWOA 1X56A 1PLJA 1IBLQ 1A82A 1R7RA 2O5JC 3OZXA 1Q0UA 2AXNA 5JWRA 3GPLA 1FJGQ 5IK2D 1G3QA 3K0AB 4FIDA 2WICA 1S2MA 1Z5ZA 4UXJA 5JEEA 2YVUA 3RN5A 5HKKA 1NMZA 3B13B 5M3FH 1W1WA 2OO7A 2WJJA 4JC0A 4Q4HA 1HQCA 3DMDA 1WYDA 2Q8IB 1G1MA 1Z47A 3PUYA 1HZCA 4HJAA 5C44G 2CL6X 3KJHA 4A3FH 4BBSH 2RGGA 4LUVA 4GPTA 4V0MA 4XTRA 421PA 2H8KA 3BFKA 4EKDA 4M2LA 5EQTA 4CEJA 1WP9A 2ANBA 3VHLB 2K5NA 3QKRA 3H15A 4JVLA 3ULPA 4M1SA 2KE5A 2N3SA 2GBLC 3CX6A 1T8UA 3VHXA 1IW7C 4LZZA 5AJ3L 1NN0A 4DV3Q 4B3MQ 1IM2A 2K5HA 4DK3C 3AEVA 3KQUA 3I62A 2WPDD 3GJ5A 1L1OB 3LXRA 4TMKA 4XD7A 2IC5A 3R9IA 3HOUG 1CJMA 2A19A 4QJ4A 4EFLA 3FMPB 3HU1A 4JLNA 2ZREA 3SC3A 3FPAA 4HB4A 4BEJA 4DRZA 5C18A 3U60B 2UU9L 5SZHB 2WJGA 1E2EA 3UANA 4M9XA 1DG3A 5SZJA 1SXJE 4UNRA 1FUKA 5FOUA 1E99A 4JI2L 1DAKA 2GTPA 5KDOA 4JI5L 4DV0L 2IHBA 4JOIA 3ADCA 4M0LA 3TSZA 2BC9A 3STBD 3K0CA 4X8LA 3RLNA 2F7SA 2OG2A 3QNUA 1MR3F 1O3YA 2JA6G 3M7NA 1HYQA 3SBDA 2QMOA 1RYFA 4AK9A 2F3IA 1QG2A 2PX0A 3B7GA 3TQFA 5HKKD 3BAFA 1OPXA 3Q7QA 3SU8A 3B1ZA 5AJVB 3DZDA 2VP2A 3A1WA 2ZTEA 4GNXA 3F2DA 2EYUA 4P32A 5G3YA 1VHTA 1TAGA 1TQ4A 1XFAA 3TVTA 3JAMi 2IYXA 2VP9A 1BO6A 3SOPA 5FPKA 5LMNW 3H86A 2WPDA 5EAYA 3SJBA 3VKWA 1RRFA 5IE8A 1IN8A 1K73C 3CF6R 3CQZH 4YWKA 2QM8A 3C15C 3NC0C 3KX2A 1MO3A 3B60A 3CPJB 4PAOA 5EXSA 1XXHB 3SNHA 1G16A 1I4TD 2OBNA 2ZSBA 1R0WA 3QI2A 4RKEA 1BYUA 1NN3A 2ZE6A 2CJWA 4PMWA 1ZUNB 2VQEL 1YR6A 4DR6L 1H9SB 1Z0IA 2WWGA 2J9RA 1Q1QA 4JL5A 5IYBG 2VF7A 1YNJC 4DB2A 1IXSB 2VP4A 2ONKA 4TL8A 1HH4A 2PI2A 4X66Q 2F4VQ 3CCEA 2IS2A 3K7AH 3GLGA 4LV6A 3T1YQ 1N6OA 3G0HA 3H1TA 1GKYA 4MUBA 2GJAA 4TMWA 1XMQQ 2GAAA 4NCJA 2PT5A 1OXUA 2IYTA 4PPQA 3GJ4A 1EG7A 2QPAA 1HZBA 4JV5L 1NLZA 1X54A 4NB3A 3L0OA 4ZV4A 3QIAA 2A2ZA 4NYMQ 1CKOA 4M8NE 3FYHA 1YZUA 1RIPA 4B74A 1FTSA 1LFDB 2AX4A 2GJ9A 4P33A 2ZXUA 4X62Q 2ZUCA 4DNIA 2BMFA 2HLDA 2I4IA 1SVSA 4BLTA 1W4RA 3GTGH 1G51A 1B23P 4BXXG 5FOTA 1KI3A 721PA 1JE5A 2IA5A 1GUAA 3RAPR 1GD7A 2JJ1D 3CCUA 1E2VA 2XNDA 4C0AC 2DWQA 3K9LA 5GAGC 4M9SA 3CXCA 4BY1H 4RD0A 2OTJA 3T5GA 2WTUA 2OCYC 2V8OA 3A1UA 1A63A 4POAA 4IOJA 2ZRBA 1UADA 2FPKA 4UKDA 4QJFA 5DI9A 5KYKA 2ZTCA 4Q47A 4DR2L 4KBFA 1XMJA 3IHWA 2OCAA 3CD6A 2A1AA 3CCJA 3EC1A 1VQ6A 2ZJAA 3FGNA 2G1KA 4DCUA 1TX4B 2MQHA 1E1TA 1XNQL 3SQWA 1SN8A 2I5MX 1P2SA 2YTXA 2R65A 4TSFD 1DAGA 2Z0SA 1I2DA 5K8TA 2F3RA 5FPSA 4QIWE 5DNYB 2WWYA 4Q4AA 3BORA 3VX3A 3ULJA 2BKEA 2CLSA 1PH5A 3QXHA 3KKNA 3CPFA 3PIRA 1QUQB 4KYIB 5LD2C 1OSNA 1FL0A 1FNMA 4DLTA 3BH6A 3A7LA 3FVQA 3CC4A 2QPTA 5BYKA 4DR3L 4TTPA 5IRCD 5C1BA 1SGWA 2ZRLA 3UIEA 4BZXA 3IIKA 2X2FA 1GO3E 4G5OA 1Z22A 3TRFA 1ZU4A 3AF0A 2C99A 4JI1Q 1G21E 1KHIA 1VQCA 3MJRA 3PQCA 1CLUA 3A6PC 1CKEA 4Q02A 4HEJA 4JBKA 1YITA 4G5QA 621PA 2A6EC 5KSPA 4HZUB 2JA7H 3CBQA 4JVNA 1NLFA 2V7QD 3OW2A 3QF4B 4LJ7A 1N0UA 1CR4A 3KYHC 4DSOA 3B1YA 2CJWB 1IN4A 4G5SA 2QMUA 3JVVA 1H9SA 2CE7A 4PZLA 4AG6A 3QBTA 3S16H 1Z2AA 3S17H 3U7EB 4GFDA 3W34A 1NMXA 4R71A 1GUOA 2WAQE 2VZAA 3M4OH 4XOIA 4EPTA 2BH8A 3GLHB 2AWNA 2QA5A 3NH9A 3S2HH 4WA7A 3WDNA 5AUQA 5FTJA 3N6RA 4IFDI 1OH7A 3T1YL 1P5ZB 1YZTA 3WNBA 4YONB 2A5FA 4JI2Q 4IVPA 1VPLA 1CEEA 2V1CC 4DV5Q 1B7YB 2NN6I 3LBNA 3U9SA 1X6OA 2NVQH 1LF5A 2GZHA 2ZSEA 3RHFA 2PI2E 3N70A 3WP1B 1KGDA 4ASUA 4H02A 4DSUA 1J8MF 4I1VA 4X8MA 4C7OA 5IP7G 2GN5A 1F3OA 1TQDA 4Q9HA 1Q21A 3QKUA 3IIMA 2QGQA 1JECA 1M34E 4A6XA 3K8AA 2V3CC 4Y7NH 5B58C 2IYZA 4P4TA 3X1XA 1AIPA 4AC9A 1OV4A 1E2ZA 3I4LA 3B9QA 1Q86C 3D7MA 3EWAA 1B8AA 2CLDX 1YJ9A 3NE5B 5DISB 1PH6A 1E4VA 2A5YB 5CK4A 1UEIA 5FR2A 3HOVH 3J81k 2HUPA 2R6FA 4V03A 1TPZA 4LYFA 5JMTA 3LA6A 3KDFA 2OWOA 2A7QA 2IS1A 3ZD6A 2G83A 1JBKA 3CM0A 2IBMA 3SJCA 1DADA 2OXCA 2FF7A 4MYHA 1A0IA 4L5SA 1N6IA 2JAQA 3AVWA 1WE2A 2W2VA 3RS3A 1CF4A 1E79A 1FGUA 1YZ6A 1TMKA 1E9DA 1XDBA 5JI3E 3THXB 2N78A 2BBWA 3DKVA 2REBA 3J7A5 4LJ6A 3QPUA 3GDEA 2B8FA 1KK2A 2ORIA 1VQLA 2GJ8A 2I1QA 4HSEA 4IJLA 3DPUA 3KXIA 1K8RA 2CCZA 2GXSA 1NVWQ 1Z08A 3Q8DA 4JBWA 3I2ZA 4JBMA 3QEJA 4LBZA 4PSVA 4ARZB 1VCMA 2GCPA 4GSYA 1VG9B 3K0EA 2DFKB 5DI3A 4DUGD 3KL4A 2XNSA 4NZYA 4OL0A 1L2TA 4YY3Q 5ELXA 4YQFA 2VPPA 1CSQA 3HOYH 1GUTA 5L3SA 3SYNA 3WXMA 2IUSA 3U4QB 2CHGA 2XZOA 3GJ6A 2C2HA 2JE6I 1T5LA 1WA5A 2ZRMA 1F2TA 4G3XA 4AWXA 3BS4A 3DVLA 4JT4A 2I3BA 1X6VA 4MGKR 4OWXB 1FJGL 4LWCA 1NKSA 2IXGA 1CIPA 1VCIA 4DK1A 3ICEA 4U00A 2K75A 4IJHA 4BASA 1EGAA 1CKMA 1SHKA 5DYGA 3SR0A 4AURA 1GUSA 3U7HB 2J0SA 4M9QA 4O0AA 3G48A 1FMJA 3QENA 2J1LA 3AF1A 5FL7A 3PUWA 3S24A 1P3JA 1S40A 4MYUA 1OB2A 1EIFA 2IXEA 3AKYA 3MAAC 1MJCA 4U7DA 2XZLA 3SBEA 1CS4C 1SE8A 3IGFA 1DCZA 4IPHA 4B34A 1OXXK 2J3EA 4HAXA 4MUAA 5FOXA 4PZYA 3RWOA 5LB2A 1J8YF 5EZ5A 2X8AA 4OHYA 1T9HA 1K6MA 2PQAA 2WWXA 2BBTA 2OHFA 5CLQA 1YHQA 3Q8XB 1OKKD 4OQMA 1CRPA 4ON9A 2FFHA 1YZGA 3VA7A 2ECKA 4KVAA 1G3IA 4NYIR 1NL3A 1NG9A 1YHAA 1NBME 4H1VA 1GKHA 1KO1A 2HT6A 4PO1A 3A4LA 2B92A 2O0KA 3FDIA 2QM7A 2XX3A 3X1DA 5M3MH 1TADA 3M4PA 4YC7A 4UPAA 2F9LA 4GMDA 2Q0HA 5FOSA 4MDFA 3ZQJA 1WBBA 2WAXA 4JV5Q 1T5IA 4BECA 1Y8NB 2Z4SA 5TMPA 3LX8A 4B44A 2X19A 3LW8A 2JLWA 1F2UA 2Y0SG 1N5KA 2NZ8A 3ZZUA 2EW1A 3FKSD 3EWSA 3ERSX 1E9SA 1ETUA 3AVTA 4OO1I 1ZNWA 4PQRA 2FEMA 4UNQA 3M9BA 5GJWC 3TW8B 4BLSA 5HR5A 4WVFA 3EAQA 4Q1DA 3PCOB 1N34Q 1KSJA 4RG1A 3CRRA 3EIEA 2ZRDA 4URXR 5J4VA 4B3FX 4NP6A 4JJZA 3W5IA 2CHVA 1IXRC 3KF6B 1C1YA 1X3SA 2D62A 2P0EA 1WCV1 4C3JH 4TQUS 1WOCA 4A3CG 2GCOB 4DLUA 2C78A 2FX3A 4QM6A 5BWMA 3S1QH 1W2HA 5FTKA 2Q3FA 4DJTA 4OXPA 5IP7H 2V1UA 1G4AE 2PJRA 3D3QA 121PA 3KFUA 3K0CC 3SI7A 4DWJA 2OAQ1 1N33Q 5KDDA 1I4DD 4JBJA 1OHHD 1OB5A 2JEBI 5DN6A 5LMUQ 1BMFD 5C0XG 3KXKA 5GQOA 1XNQQ 2EYQA 2ZPTX 3CNNA 1YKSA 3NDPA 4Q00A 1OFUX 1V43A 4XH9B 1CRQA 4BA1I 4RD1A 2XGJA 1GL7A 1H8ED 1G3RA 3FKQA 4NCHA 1IN5A 4PO8A 1EFRA 1DTSA 1Q20A 2HYDA 2GWHA 2KBEA 4ZO4A 2YOFA 3C5CA 3CRVA 1MO6A 2BEKA 3U3OA 4XWKA 4EJSC 3KQHA 1QHHB 4TLBA 1NIJA 4JLAA 1G17A 3EZ7A 5DO9A 5BW8A 1X65A 1GRQA 1N5LA 1IYUA 2DGYA 2QSZA 3CNLA 3MCAA 3CCRA 4KBGA 1CULC 3U61B 2A6HD 2R7FA 5H1YA 1AE3A 4LC1A 3K7UC 3IO5A 3W8NA 4F4CA 1T3LA 3KJOA 3BC1A 2HHHL 2ID0A 4TL9A 1E32A 1SHZA 3QG5A 4YXWD 4GN4B 4YCUA 4QHSA 5FL7D 2VTKA 1ZMXA 1LF0A 4XSHA 2IHEA 3SZRA 4Q1BA 3ZVNA 5DN6D 1LACA 5GADC 1KQSA 2J7PA 4Q1FA 3BB3A 3HDTA 4J0QA 2GXUA 2OXRA 3M6AA 5EZ6B 4ZIRA 1X3EA 3UG7A 2YYZA 4GKJQ 3QKRB 2E9SA 5JEAG 1UBFA 1M7HA 3C41J 1NE3A 5TDHA 2ANCA 1EWIA 1PH8A 3L0PA 1Z28A 2KCTA 1W0KA 2V6JA 5A0FA 3AVUA 2WV9A 3AB9A 4LF5Q 5C46F 3CMAA 3OE7D 4PTLA 3B8HA 4LFCQ 1M1KC 2ZRGA 3EIHA 2NOAA 3KXLA 1F48A 4RFVA 1QBKC 1CUKA 2ZSAA 3CPHA 4OYHA 4RFSB 1FR3A 3EIVA 4C3HH 1U8ZA 1XPOA 3TSOA 2R7DA 3IEVA 1KAWA 4QFMA 4CYMA 1IJEA 2QZ4A 4B3SQ 1UKEA 2RHDA 2EWWA 4P3YA 4URVR 3WRYC 2GILA 4LUOA 1R4AA 4BY1G 2HJVA 1JPJA 1E9CA 2YHSA 4UNNA 5AJWA 1E2LA 4OI1A 4JL8A 4Q9KA 4KLZA 3U58A 1N34L 1HT2E 3B1VA 3JZMA 3VU9B 1DELA 1E9EA 2ZYTX 4IDQA 5GJBA 2G3YA 2QAJA 4DLXA 3KOJA 1P6XA 3BFVA 3DDCA 1XJVA 1JR3A 4H1UA 1D2MA 1E1QD 3OHMA 5TV2A 1UWVA 3PUXA 1EWHA 4R2IA 4WZAE 5EUMA 1MT0A 2OZEA 4IJMA 4HB2A 5CDFE 1KIMA 4AYBG 3X1WA 1X8JA 4DV7L 2ONJA 4B71A 2F1RA 1YRAA 2IWHA 3HPRA 3SYLA 2RGEA 3NDBB 2Z6KA 4UP7A 1PH9A 3GLIB 2GVAA 1GVPA 2L5TA 3C7KA 1AM4D 2DBYA 2QAGA 4QBHA 4DSNA 1V9PA 3BU2A 3VR4A 2ZJBA 3NEYA 1E1QA 4AIIA 4RCNA 1JNYA 3I73A 3K1JA 1JR3D 2QL6A 1XCMA 1I2MA 4QGHA 1S3GA 1KAGA 3I1FA 2JJ8A 2FFAA 4Q7LA 5K8UA 3BJIC 2HEIA 4WZ6A 4JYAL 2F6RA 4LYAA 1BIFA 1S3OA 1IOZA 4BLOA 1KI7A 3I5YA 1ZM2A 1A6XA 1TNDA 2CMKA 3OAAA 2VL6A 2VUMH 1YNXA 1DS6A 4TT3D 3ECCA 2KCMA 1ASZA 5AR1A 4KSCA 1X8KA 2WKPA 3CWQA 4D26A 1OIVA 3W3ZB 1TF5A 5IYDG 5FUXA 2E1RA 2NZHA 3GJ8A 4XVUA 4G7ZC 2A3RA 3WMGA 4ZDWA 4YCWA 1JAIA 4LV8B 3SYKA 1R8QA 1FFHA 5J4YA 1G8PA 1YZLA 2FH5B 2FFQA 3CRLC 2V4DA 1N5JA 3B85A 3T53B 1AQYA 1II9A 5H1SE 1F2UB 2FSGA 2NG1A 3LWUA 1P72A 2Q9BA 5FI0B 1QHYA 3O8CA 4IFDH 2GJKA 2HHHQ 4KSBA 1KC8C 1JJ2A 1E2KA 3TZUA 5B30A 1ZM7A 2R9VA 3CCLA 5P21A 1Q8KA 2VA8A 5SZKB 2F9MA 3B6YA 4B3GA 3BDOA 3KF8B 2JA8G 1J99A 3ZYCA 1EQQA 4WXPA 2IHYA 1JAHA 4OK6A 5C0XH 1E22A 3ZVLA 2ZTDA 1BOFA 5FBRB 5GJCA 1GG2A 3W6NA 2QU8A 3BB1A 1WCMG 1VQPA 3K0FA 3VX4A 1WB9A 1EX7A 3M4QA 3BH7A 5CM9C 3J7ZC 3RS2A 2X77A 3MGCA 3MJHA 2DNEA 1G7TA 4LCBA 2ZS8A 2H16A 4P0TA 4CZ2A 2UZ3A 3TUZC 2GCNA 3IQXA 1XEWY 1VQDA 2C8VA 2DFLA 1KDOA 2ERYA 4IOMA 4JBXA 5DH9A 3AFPA 2NVTH 2IUTA 3D31A 4LFBL 4LJ5A 3TE6A 5M3FG 3TR5A 1MO4A 2J59A 4AD8A 1Y8PB 5IP9G 4QM7A 2FJUA 1W36B 2NO7A 2B6HA 1PH7A 1XTSA 2V1XA 5FUYA 3UE0A 4Q4LA 4C3ZA 4US2R 2R6CA 1G5RA 2A6HC 2PX3A 1SXJD 3AF2A 4L5BA 4V0KA 3Q7PA 3R9WA 5G3ZA 3IKJA 1YR8A 3QPVA 3ER0A 4PHFA 1SVWA 3FHCB 2IYYA 5JSZA 1YI2A 5JCZA 1Q82C 5K36G 2KENA 3BGWA 2GJSA 3GEEA 3TREA 4OI2A 1II8A 4X8HA 3GTQH 4Q1EA 4ZKEA 2FFBA 3RNLA 4CEIA 4I1UA 4TWZA 5BN5A 1G7SA 3OW7A 2YTVA 2JJ2D 2XAUA 3NENA 1BDOA 3FFBA 1I94Q 1Q44A 1XEXA 1QHHA 2CHQA 2XNDD 3H84A 1F6BA 1LUZA 4IEIA 4LJ8A 3W8RA 3X2SA 3SDZA 3R8FA 3I72A 1YBYA 4N1AA 4UXHA 3AVYA 4JI3L 3PITA 4US0R 2NO9A 3CF0A 1COWA 5BN3A 1EFRD 4NBSA 5E7MA 1H9MA 3MLEA 3MMPA 1K0RA 2GXAA 3IPXA 3U44A 2A78A 2RGAA 2O8EA 4GKKQ 4P73A 4JS0A 4RZ2A 4C0SA 4M9ZA 4JI6L 2VUMG 3H3VH 1UBCA 1I3QH 4HIMA 4YLGA 4Z51A 3HOZH 1EIYB 1T91A 5ANRB 1CJTC 4BRWA 4DV3L 1T3SA 4GOPA 1XNJA 1P75A 5FBQB 2BCJQ 3R20A 3T06B 4ZDKA 1ZD8A 4A3LG 2DY1A 5H8WA 3M85A 4LV5B 4N3NA 3QXXA 4TLDA 4YMWA 3AUYA 4CF7A 4TZ0A 1H9KA 4A3GG 4M53A 3ZDQA 1IHUA 4OJKA 3AF3A 3GMTA 1HQYE 2JIZA 1VMAA 2DFNA 5CYOA 3X1ZA 1J7KA 1HR0W 2E2IH 1UBGA 1XF9A 3FMFA 5EE1A 2OV2A 4MYCA 2DR3A 4BFZA 2XOKD 4A2WA 2JA5G 3P4XA 4OKSA 5E7JA 2K32A 1F60A 1ZC3A 2CE2X 3PIPA 2W00A 1P61B 2ZS9A 2ZYVX 3QOFA 4B47A 2IYSA 3UWOA 4TLCA 4XD7D 2LMCB 2JLVA 4LF9L 3GLIE 1KKLA 1ODFA 4B3DA 5J4KA 4AQYQ 3HOVG 4JYCA 1L7VC 4O2RA 4NONA 2VYFA 2QTHA 3KQKA 5A35A 1DAEA 4QNMA 5EE9A 1P9WA 4X6AH 1XEXB 3EW9A 2RHQB 1IXZA 5JBQA 2D3WA 1NMGA 2F1IA 1GP2A 2PNRC 2OQ0A 4NYJR 4HDOB 2VLIA 2QEXA 2Z83A 3FPPA 2EVBA 3PXGA 3EASA 4B2PA 3BJUA 2BEJA 4Z8XA 2IEZA 2Y0SE 3ZS9A 1S9HA 4A6PA 1FUUA 4KXFB 4CVNA 4FMCF 5JZVA 5LD2B 3IIJA 2XB4A 1R5NA 2I1VB 2OT3B 2ZJ5A 3K80C 4IOAA 2PCFB 2ODWA 2WSMA 2JA8H 1B9NA 2RGNA 5EE0A 3ZVMA 4ACBA 1ZAKA 4M22A 4K46A 1UEJA 2IWRA 1UPTA 2I5LX 4A36A 2D2FA 3HR8A 5JJIA 2DCUA 3KQLA 3LGJA 4QJ5A 3LRPA 4HUQB 4NXML 1TXYA 1EXMA 1E1OA 1YZNA 4MITA 3TK1A 3THYA 1ZNZA 1HCZA 2Z4RA 4C9BA 5AJYA 2BJVA 4MTNA 2K5VA 2R2AA 4LY6A 1MV5A 4FCVA 2C9OA 1E0AA 2IY5B 3S1RH 3J81i 2UUCQ 2R6AA 2ZJ2A 3ZD7A 4BZPA 4BQSA 2BDTA 1K83H 2FZ4A 2R6DA 5J4LA 3U7FB 1HZ9A 2JIZD 4NXNL 3V4FA 3VKHA 3TAUA 4TMZA 4KITB 1W2BA 4G01B 4QJ3A 2XTIA 1MKYA 3F3YA 2VQFQ 3TRZA 2HCJB 3AGQA 2ZJPA 1YR9A 1Z63A 1XEWX 2C5LA 1P2VA 4P71A 4EFNA 3K09C 3PO3G 3QVUA 4MKIA 4MRPA 5C4GB 3FKIG 4IDHA 3MSXA 4JLKA 5CDFA 1ZKOA 1N6HA 4JI1L 2FEOA 4IDPA 4L5RC 5FI1B 3P1JA 5BYJA 3ZLJA 3P32A 2LXKA 1PLKA 4Q7KA 4Q66C 2VHTA 2F43A 4XWAA 4D25A 2CK3A 4ZDIA 4IVQA 2E87A 1E98A 1A5TA 4LC0A 1LB1B 3Q5DA 3UDFA 3GO5A 2OTLA 1D9ZA 2QSYA 1R0ZA 4BPBA 4OWTB 1WQ1R 4EQ6B 4URUR 4WW0A 4Q19A 1Z6AA 3TEHB 1G18A 4BA2I 2VQSA 4P31A 5AJZA 1YVDA 3BWDD 4PZ6A 5M5XH 3C5HA 4E07A 4DR3Q 1JEEA 4PSKA 1ZCBA 4G7OC 4DR2Q 3FB4A 4NH0A 1TWFH 1VQHA 3NKVA 3TS0A 4LWZA 5J3BA 1U5KA 3GD7A 3C8UA 4Q7JB 1W0JD 3A8IE 2GF0A 4V0NA 1QZGA 1TU4A 3BE4A 4LF8L 4KVGA 1NNEA 2WHXA 1S0UA 1EX6A 2CVHA 1AE2A 1WMSA 3HR7A 1XTIA 4JT2A 4DT1A 4QOSA 4A0FA 2BCGY 2IYQA 4DDWA 5B64A 3KFVA 3SJAA 1KNXA 4B3RL 4F93B 2CWAA 4GLVB 4NPHA 4R4QA 4URYR 1E7ZA 4P72A 3E0EA 1XCPA 4KLKA 3UE1A 1W5SA 1COWD 3UMRA 1Q81C 3CCVA 1XD9A 4DR6Q 3LQQA 4QGAA 5AJXA 2IYWA 2PCJA 3DZ8A 3NEJA 4RJLA 1HY3A 4RD2A 3TAHA 1WF3A 4LDJA 4I99A 5L3RA 3PUVA 2XGTA 2ZJOA 3E9HA 3GJ7A 1CJUC 4X65Q 3QXSA 3TH5A 3ADDA 3PF5A 2I5HA 2OCEA 1VYUA 3ZH9B 4NTZA 1Y14B 1UE1A 2J0UA 3QY0A 3A36A 2GXQA 2X2EA 3SFVA 1QHIA 4B3ML 1KY2A 4IXMA 2A8VA 1ANKA 1IY0A 3CW2C 4A3DH 2OLJA 3TIFA 4GOPB 4KI0A 2K14A 2C9YA 5B2ZA 4TL7A 4NPSA 3I4MG 5IYBH 2YV5A 2W6JD 2QG6A 4JI8Q 2BJWA 3FOZA 2NVYH 4EDHA 1Z9FA 4F4IA 1XXHE 4P4SA 1JJCB 3FMOB 5AUPB 3TQYA 1VYTA 3VR2A 1NG1A 2UXBQ 1GKIA 3EG5A 3THOA 3WMEA 3L2OB 3W6OA 1OJLA 4AYXA 4LJ9A 3KFXA 3T1VA 3TVDA 2B21A 2A68C 4B6EA 2YZ2A 3U44B 4O3MA 4BBRH 1ZNYA 4ESHA 4GL2A 2JA6H 2RB4A 5C4MA 1SVOA 2A30A 4D2IA 2VSXA 2ZRJA 1XMIA 3DM3A 4UP8A 2FDCA 3L8YA 5K36H 4YMVA 4HIDA 2NQ2C 1Q1EA 2ZETA 4WZBE 5JWOA 1A8VA 2LWIA 4DV6Q 2IF0A 1OFIA 4JI6Q 2ZRNA 5F2EA 5F3WB 1TUEA 3S14H 5DHFA 1PH2A 5KSYA 2OE2A 1MABB 1VQ5A 1N6PA 2IW3A 4A8JB 3HOUH 1N0VC 1PMRA 3I55A 1TU3A 2XEXA 1KL9A 1R5OA 4CT5A 4YMSA 4DK6C 2CL0X 3PO2G 4U5XA 5IT5A 3K81C 2N1BA 1Y69U 1R8SA 5FPTA 1EFHA 4JI8L 4JBYA 2ZM5A 1CBUA 2ALYB 2IX1A 1G8FA 4Q21A 1OW3B 1XZQA 4W5HA 1KYIA 3QXJA 5EP3A 4C0LA 1M7GA 1KO4A 5LMNQ 2KA7A 1H8HD 1XMVA 4LK1C 5FOVA 4JI7Q 1T0HB 2XJ9A 4PPNA 4PR0A 3KLRA 1JT8A 1E2WA 1PA6A 4Z1MD 4CEHB 2BA1A 2UU9Q 2O8FA 1N6NA 1KSFX 2GEDA 4UXIA 1GAJA 3KKPA 821PA 5A4JA 4D82A 1G8YA 2C04A 4HZUA 1HUQA 5FUWA 1HURA 2RGBA 4AQYL 1MRNA 2NVXH 5KPJA 2YOGA 4ZCLA 4C2TA 2D06A 3KDSE 3UATA 2YU9H 4Q4HB 3RANA 4TT3A 1AK2A 1FMLA 2Q21A 1GL9B 3A37A 2G9NA 4DDTA 1RRCA 1OH6A 4JI0L 3T1OA 3EPHA 3KLWA 5JFGA 2UUAL 1Z0JA 5M3MG 3UMSA 4PC1A 3HJNA 4DDUA 2CL7X 4EJSB 2LXJA 4PO9A 3GLHA 4GZMA 3STBC 1VKJA 2VP6A 1OYYA 2W0MA 3F2BA 3KTAB 4WBSA 3X1YA 3FHTA 1K8OA 1P8LA 4DNRB 3UDXA 2GVZC 4D0GA 4TVAB 4KFUA 5JJKA 3ZQ6A 1HE1C 2ZTSA 1NY5A 4AI6A 4A3IG 1I5FA 1X1RA 4G5GA 4V0OA 5LDDC 4IW3B 2WKRA 2KWIA 2EVWX 4BZQA 5AK0A 5FPYA 4UJ5A 4Y0VA 3EA5A 4PC7A 1ZW6A 2WMNB 1Z83A 2J5XA 4HAYA 2E75C 2WAQG 2BIFA 1WJJA 3A5UA 4I1SA 5FTNA 5AUNB 1Y8OB 3OTOL 1VIAA 5JI2E 3RDPA 3LFUA 1HZAA 3K0XA 4BBRG 1M7BA 2BE5C 1E9FA 3BBPA 4L4UA 4D4MA 1KO7A 4QNRA 2PNHA 4ZKDA 4JK1C 5KSZA 3S1NH 4BRUA 4DK0A 2REOA 4EQ6A 4G1UC 2P2LA 1ZINA 4YMUA 1ZBDA 2EDGA 2WIBA 5IY0A 4PQFA 4A3MG 2IUUA 4LUCA 2CCGA 2REXB 3KB1A 3I4MH 4CIDA 1PH3A 1U94A 3AV0B 4Q4AB 3NBFA 2PMZE 6Q21A 5L3VA 5FPHA 4QHTA 4DSTA 5C3EH 2CCKA 4AYBE 2QAGB 2QP3A 1P9RA 1FOEB 1KZ7B 3C4JA 3NBZC 1VG8A 2UUBQ 1ZJ6A 2MMGA 3RZDH 4QG7A 1N8RC 4XVRA 2GZAA 4ERNA 1E4YA 2JJQA 1SVLA 1KMHA 1RJ9B 3IDQA 3I61A 3HU2A 3KZ1E 2QNRA 5EXTA 2DNCA 1HJPA 2PCLA 2OILA 1OXVA 1VDZA 1HEIA 2EIFA 4KHPQ 4GN3B 1II0A 1S1CA 2ZUDA 5DIFA 1EFTA 4DUYQ 4PX9A 1NMFA 4BWYA 4B73A 1KI2A 1XRJA 4RSGA 5J4HA 3WBKA 3ASZA 4D4LA 1QRAA 5TB5A 1RPZA 1K8GA 4RZXA 3BXZA 3VR1A 3AVVA 1SR3A 3U2QA 5FTLA 4K81B 3CLVA 4HZIA 4GLAC 4LK2A 3K70B 4YMTA 1OTCA 4ZCMA 2IL1A 3LVQE 1F2TB 2AUKA 3CO5A 4Q1AA 2HJGA 2HYIC 4L5TA 3RS4A 4B3CA 1U2RA 3ASYA 3CONA 4GN5A 3A1VA 1NMYA 4YXWA 1G5TA 1CR0A 2W6ID 2HDNB 3RSOA 4KMUC 4GP7A 2R93H 3SHWA 4GBMA 1SVKA 1TU2B 1OFTA 1E1RD 1PLLA 2FNAA 5LPNA 3H2YA 2WAYA 1LY1A 3S15H 3IQWA 4G5RA 4LYHA 2WSSA 3UPUA 4TYPA 3U3RA 2F1MA 5BR8Q 1VQ8A 1G7CA 4DKAC 2MO1A 2QN6A 3QPWA 4QC2A 5IDVA 5D3MA 1P73A 1OT3A 3WMFA 4ALPA 3CP0A 1N36Q 1ZU5A 1ZNXA 4F4JA 2PJZA 4X65L 3AFQA 3M1IA 2NMVA 2RGNC 2YINC 1IBRA 4OGQC 2ZEJA 2ZR9A 2GDJA 1XZPA 1QVAA 1PJRA 3EARA 3LH5A 4D80A 5G53C 1UKZA 4HB0A 4BFTA 1GUNA 5GJVC 1HH2P 3TQCA 4A75A 1LS1A 2VSFA 4PANA 4L16A 4JCVE 3T1HL 4A3EH 3LWNA 3MD0A 3QUSA 4MYTA 2Q2HA 3PO3H 1AN0A 4R1JA 1W44A 1XD8A 4IDNA 2OFOA 1SZPA 3N5CA 4S2EA 3TLXA 1X1SA 3OTOQ 4DLVA 1DO2A 1XTQA 2Z5FA 3E2IA 2QI9C 3BOSA 4A3KH 2ORWA 1MH1A 2JCSA 5HY6A 2QEQA 3ZZTA 2GAOA 4FCTA 2VIIA 1YHBA 3N2IA 4IDOA 2Q2TA 3SEAA 4A9AA 2XITA 3FKSA 1X3GA 2HXYA 5B57C 3ICQB 1D2NA 4L9SA 2AWOA 2N49A 4QXAA 1VQOA 2RMKA 1G4UR 3I32A 2NN6H 1AGPA 3U3KA 5FH9A 3AM1A 4UY8C 1VF7A 2DWPA 1S72A 1QZHA 2IYLD 4RY2A 2IXFA 1XTJA 4OK3A 3T5DA 1I6HH 1IBKQ 1N33L 4K8OA 4D4KA 2F1JA 4C0BA 3QKSA 3DMNA 3AVOA 3L8ZA 2D7CA 3BH0A 4KN7C 4A3CH 3A8TA 1R5BA 3RRNA 2O5VA 3EN2A 2OESA 3T1TA 2P5SA 4DUYL 3GFOA 3ONWA 4KV9A 3GTOH 4AY2A 1L8QA 2GEVA 3QE0A 2JLXA 2G0NA 4KODA 3U50C 4DV0Q 3BFXA 5CB6A 1E9BA 4MZ9A 2RGCA 5H70A 1L0WA 1T6NA 3AB3A 4PG3A 3QQ5A 5FTMA 1KMQA 1ESNA 1VQ9A 1QVRA 2PBRA 1HE8B 5FOWA 2PZGA 2YTYA 2ZITA 3CRW1 3BZKA 3K9NA 3W9YA 2MSDB 1N3BA 1N36L 3R7WB 2P6NA 3PJRA 4X64Q 3M3YH 2QGZA 4Q4JA 3P26A 2RH5A 3CCQA 2ZI7A 3GJXC 3W1BA 1IXRA 3GEHA 1D6JA 3OEEA 4ZI2A 3A0JA 2EFGA 2PZEA 3AYHB 2ZQ5A 1U81A 3GFTA 5DLQC 4BLQA 2B63H 2AFIE 4ZIRB 2BM1A 3VMFA 5CITA 2PEZA 2R44A 1VQKA 3B5JA 3FMCA 2K7VA 4UQOA 5FL3A 1D8LA 1WI5A 2AFHE 1U99A 4O2LA 2VS1A 4A4IA 5KSOA 3D4RA 1FQJA 1O87A 1W4BA 1R10A 3GLFE 3AQ4A 1XP8A 5DE3A 3LNNA 1E2PA 1Q7YC 1K9MC 1AS0A 1Y63A 2A69C 2VBCA 2ZT9C 3C16C 4WIAA 4AYTA 4NCNA 1GNPA 2FGJA 1NY4A 4FWTA 1ZM9A 3UDIA 4RCZA 4A3JH 4D81A 2AMCB 4JI0Q 1KY3A 4C0HA 3AP1A 5JRZA 1SXJC 4HAWA 2GBLA 4NCIA 4MGZR 2ZJ8A 2ZAOA 1R6BX 3Q3JB 4AKHA 4C0KA 5TVKA 5IF9A 4B33A 1NTGA 1LM0A 1H65A 5FJ8G 3OAAD 3WHKA 3WYAA 1Z6GA 2FSIA 4MA4A 3SJZA 2XB2A 4DAYB 3HOXG 3RLFA 2FWRA 4QGGA 1KDTA 1W7AA 2O8BA 4KKUA 3VKGA 1SFOH 4A3BG 1AKEA 3FKIH 3U4ZA 1E9RA 2EFCB 2WWFA 4HLQB 2IF2A 2AKWB 1GTVA 2Z43A 3F0TA 4TQAA 5DGXA 4JKYA 3EX7C 2HV8A 1RKBA 2B29A 1BVSA 2H17A 3CUEF 5IHPA 2IT1A 1UKYA 2AKYA 3AVQA 3EZFA 3EIQA 2FU5C 1Q12A 4DR4L 1E2MA 2ATXA 4GLXA 2WWIA 3VR3A 5IYCH 1GIAA 4JVMA 3GLFB 5GROA 1YEZA 1G291 4DV2Q 4HB3A 1NSFA 4IFDJ 4LPKA 1HNZL 1KNQA 4IRUB 2A68D 4GI7A 2LSSA 5JSZB 2O8FB 1YVCA 1XJQA 1R0YA 3NHAA 4B35A 4DPGA 1W48A 5HGQA 1H95A 1P2UA 3LLUA 4EPRA 3PENA 1MRSA 3PFIA 4Q18A 4D6PA 1SQ5A 1F5NA 2YKGA 1YU9A 1H8EA 4H9GA 2V9PA 2CDNA 3GTMH 1I4LD 2QRNA 3PF4A 3OOCA 3KDFB 4LF7Q 1RRPA 3O8BA 4BLRA 1TEXA 2KBFA 5EP2A 3B9PA 3I5XA 4LF8Q 3GFPA 4NXMQ 3EPLA 3RABA 4GKKL 2ZE8A 2O8EB 5C0XJ 1FNNA 3BD9A 3DKPA 4BUJA 1V8QA 2FZLA 1AZTA 3K9GA 1BH2A 4IFEA 2P5TB 4EPYA 3ND8A 3H0GH 2ODNA 1IBML 3OIYA 4JKIA 4OQFA 1GNRA 3UG6A 4A0HA 4OX9Q 3LAWA 2V54A 4IVRA 2K4KA 4JG2A 3AF4A 4FINA 1PUJA 3W3AA 1U8AA 2EU8A 3KQNA 2QQEA 2WMOB 3CPWA 2YNMA 4LGMA 2AK3A 2OFWA 2AHOA 2W6IA 2CLCX 4HIOA 2E2HH 2AR7A 3DO6A 4N0DA 2AXPA 4FXPA 2ZJZA 4L8GA 2Z6KC 4DV1Q 1HTWA 2XJ4A 3FP9A 1FX0A 3CR7A 1G6PA 1G3MA 3U6KA 4B76A 2BHRA 4OX9L 3T34A 1OIWA 4Y52H 1N6KA 4TSFA 4O2DA 2A5GA 3WY9A 5JHHB 4B3TL 3I8SA 3U4QA 5F98A 5EXPA 4TLAA 4Q48A 4GOKA 1Z0AA 3I4NG 4DT1B 1ZM3A 3PEVA 2AK2A 1KSHA 1VS0A 1GSIA 2RGDA 4FW9A 1C4OA 1NN5A 4D4JA 2DFTA 2FG5A 3EXAA 4AKEA 2JLRA 1PZNA 4XVQA 2GESA 4UJ3A 3QG1A 1BBUA 2HQLA 3FHWA 2ATWA 5J5CA 4DDVA 3BERA 5JHGB 1N2CE 3VAAA 3R9XA 1Z0DA 1KO8A 4KFTA 4C7OB 2BDOA 3K9HA 3TJZA 2WJIA 2GA8A 2BVNA 2MSEB 4MGIR 1X55A 4IQZA 1XTKA 2J87A 1ONLA 1GOTA 2ZJYA 2ZYWX 1D9XA 3Q85A 3CZPA 4LPSA 1TWHH 3LW7A 2ZJQA 8OHMA 4RZ3A 1IN6A 1CR1A 1ZRHA 4Q7MB 3M0EA 3OYYA 2JA1A 2P67A 1P9NA 2LKDA 4BFUA 4HJ5A 1Z6TA 1IJFA 1T3HA 3QKTA 1E2QA 2HXSA 2J7KA 3IILA 1JPNA 2UVQA 4MRSA 4DLZA 3REFA 2PT7A 4NYJQ 1LW7A 4HAVA 3IPYA 4F38A 1CTQA 1B0UA 2ZRIA 3Q72A 4JLMA 5GAEC 5J40A 1W36C 2A5DA 2PMKA 3EBEA 1W5TA 1VQGA 3H3VI 2IEYA 2B7BA 1BS1A 2WSSD 4DUGA 5JWHA 1CTMA 1UE7A 1I94L 1S9DA 5DSZA 4BFSA 4ZCIA 2SHKA 1ASYA 4RD3A 3S1MH 5CLLA 4RFSA 3OEHA 4LJYA 1XMOQ 2F3TA 4G7HC 1TWGH 1D8TA 3EZ2A 1A7JA 2F1HA 2PEYA 4X62L 1U90A 4PFSA 5TY0A 4GNXC 1T8TA 5LMUL 1L1OA 4UP9A 1H8HA 1ZC4A 4OHXA 4BY7G 4I4LA 4FD2A 4FMBB 4GP6A 1HT1E 3MWYW 3HOWH 2WKQA 3LBIA 4TMTA 2VHJA 1CFMA 1N6RA 3B6EA 1VECA 1C9KA 1KIXA 4M21A 1NKTA 1UDWA 1NIPA 2FGKA 2W58A 4M1TA 3WBJA 4RZUA 4R4IA 1M8PA 4KO8A 1OKKA 3PGZA 1TTTA 2ZIAA 1E69A 2WJYA 3AP2A 4D0LB 3CPEA 4TYWA 3T35A 2ZI3A 4KLNA 1JJVA 1CKNA 5KU1A 1ELOA 4YDHB 5HPYB 2VRWA 2QP9X 1ZUHA 4IPGA 2C9CA 3VDYA 5C4JH 1YR7A 3D8BA 3T12A 5E7NA 5A5GA 1Z8FA 5JEAH 3TMKA 2ZRCA 1CP2A 3LBHA 2GVDC 3QJYA 1I6VC 3H94A 4A3KG 1ZP6A 4FMDF 2XSZA 3UKDA 4IPCA 1HNXL 1GILA 1ZIPA 4A0GA 1N32L 1FQKA 1JB7A 3H4MA 4JI4Q 3HU3A 3LLMA 2IX3A 1AJEA 1U9IA 3JC66 1XXHA 3U4VA 4JVSB 2VQFL 3I4NH 1D2EA 2OBLA 1UAAA 2E76C 2VNUD 5HZHA 2JXMB 4R2HA 4DCNA 1EWRA 2WB1E 3CB4A 2KHJA 1Z6YA 1AKYA 5GAHC 4GOJA 4JLVA 4YHHQ 2XXAA 4ABYA 2LCFA 3U6BA 4QBIA 2G77B 3R8CA 3WRXC 4WXRA 4CRWB 3QVVA 4EIWA 4DHEA 3CC2A 3DLLA 1LNZA 3O8DA 4M1OA 1JB1A 4LI0A 5TARA 4E09A 2HT1A 4LNQA 4FMCB 3L82B 1FVIA 4B2IA 3ZJYC 1NLYA 4LJAA 3RC3A 4CEIB 2BMJA 4HATA 1FP7A 4GZYC 2HCBA 4EPWA 1VQAA 3AUXA 5JEDA 1H9JA 1Z3IX 5BN4A 4OHZA 2KBNA 3J81j 4A3EG 1W4AA 2VHQA 2ZRPA 1T0JB 4PPGA 3TNFA 3W90A 4HJ9A 1DGSA 5HCIA 3A1SA 2ZVQX 3GQBA 1JMCA 2KB0A 4DR7Q 3PEWA 5AJ3Q 1PHJA 3MXNB 1E79D 2H5EA 2ODEA 3IBGA 1NJIC 4LBYA 4DEYA 3G6EA 4OHWA 1VG1A 4Z8YA 5EXXA 3UDGA 1GJXA 1EOVA 3D0FA 3Q5EA 1GNQA 4DCTA 2EJMA 1U0JA 3NC1C 4W5WA 2OQKA 2UUCL 1PFSA 2VF8A 2W6JA 1KKMA 5C44H 4FI3C 4F7WA 1UFQA 4DR7L 1EFCA 1US8A 1YZKA 2NZOA 2PQAB 4IOKA 2C77A 4Q01A 1DOAA 1IW7D 2V4ZA 4QGFA 1VQJA 5KDLA 2VP5A 1X86B 5DLQE 2IYVA 2EJGC 2Q9AA 3K53A 1N25A 1Q57A 1VQBA 4HLCA 2D5DA 1XTDA 3CC7A 4H0LC 2KCCA 2DN8A 1SKQA 4PHTA 4LX0A 4Z1MA 2F55A 4JLPA 4KFRA 1C7YA 5LBIA 2NTYC 4LFAL 2OSBA 1PVOA 1YHNA 2WJHA 5FBWB 1OF1A 4DV7Q 3RWMB 1IYJB 2JK8A 2JJ1A 4A3GH 2BBSA 3K09A 3B2EA 2PPBC 1L2FA 3GTKH 1FTNA 1XD2A 4CEHA 5C4XH 1XNRL 3CWZA 1GKUB 4JJKA 4WOPA 1KI4A 2JA5H 4A2PA 2FE4A 2K5UA 1S3SA 4DB4A 5UKDA 1G8GA 4OK5A 4DV4Q 4KAXA 1RW4A 2JLZA 3SFZA 2MFIA 1SMXA 2N42A 2Q3HA 1FX0B 1KJYA 2P3SA 2ZU0C 5KTYA 1KHTA 4QGUA 1YQTA 1AZSC 1G41A 2O8DA 1JR3E 1IN7A 1NN1A 1T4GA 1LYLA 3ZIAA 3HKZE 4RMFA 1W0JA 3OPOA 3FWYA 2QBYA 2AL7A 1YZQA 2QF7A 3W5OA 3A58B 1SLJA 1L1OC 5C3EG 1DD2A 1SROA 2CQOA 1FL9A 4PC3A 1II8B 1IQPA 4KHPL 1G64A 1RVDA 1W49A 4JLOA 2ZE7A 1DAMA 1DAFA 2QAGC 4LHZA 1VQNA 2BKUA 2FA9A 5AUOB 2NIPA 1VYVA 4M1MA 1JR6A 2JQOA 4B32A 3RLOA 2R92G 1KK1A 3F8TA 4R9UC 1NRJB 4MGYR 5CM8B 4LF5L 3GCGA 3EPJA 3RZOH 2GKSA 2O0JA 2KJQA 1HQMC 1NF3A 3FTQA 1NY6A 3TBKA 3BIFA 2OFXA 2YOHA 3A74A 4BFWA 2JATA 2P65A 4PXAA 2IS4A 1MKHA 3R7WA 1DG1G 2C96A 1KD1C 2L15A 3LV8A 1V5WA 4Q4JB 1KO5A 3FFAA 1K5DA 2J41A 2JLUA 2FMXA 3G82C 2QTFA 2ZJRA 5CIWA 2GHIA 2QTVB 3FE2A 1Q3TA 1YJWA 3K70C 4JLJA 4A76A 1YIJA 3AP3A 2ZR0A 3S1AA 5CIQA 1Z06A 1XMOL 221PA 4I81A 2QE7D 4NYMR 2RHSB 1XNRQ 4Q9LA 1MOZA 2QT1A 3SN6A 3K0FB 1K3RA 3PVSA 1RZ3A 1J2JA 5BR8L 3CF2A 2E5LL 1E2HA 1KRSA 4LSGA 3H0GG 3NHBA 4LF6L 4JIMA 2ZM6L 2G0TA 4B75A 4Q9IA 1QHSA 1WCMH 1KJZA 5IP9H 1E2GA 1PUIA 1TF7A 2ZE5A 4C0QC 1GRNA 4YWLA 4Q5IA 1W36D 3OIUA 4LW1A 4Q03A 2CK3D 3AQQA 3C14C 3KTAA 3LDAA 4CDGA 5EJEA 1QG4A 2R62A 2ZSDA 4UNSA 1EESA 4EUNA 4URZR 4AYWA 4E22A 3NBXX 2ZI4A 4LHXA 5CK5A 5KOYA 5IT9c 4O0MA 1W2GA 5IWAL 3UXMA 3ADBA 4GOPC 5KNCA 1PYSB 1AH9A 2B7CA 4FDBA 4MNOA 3SQXA 4TYNA 2CNWA 3AKDA 4N0EA 2BBOA 3I8XA 1EYGA 4JYAQ 4IFDG 2WOOA 2FN4A 3DEFA 3DL0A 3MG9A 3THWA 2WP8J 2HF9A 2GCOA 4QL5A 5FLMG 4YY3L 4U02A 4LJZC 2CCJA 3W6PA 5JLJA 4R4OA 1GUGA 3E1SA 5FFMA 1MJEA 1EUJA 3P4YA 2YC2C 4C0JA 4LFBQ 3OESA 5JS7A 2DB3A 4XTCS 1C0AA 1GFIA 5IYCG 1GITA 2Q6TA 4JSYA 2VP0A 4ESVA 3T1HQ 4KYUA 2P6UA 2EQSA 3FHOA 2XZPA 4DKXA 4KKTA 1XWIA 2RHMA 4KKSA 4K0KL 2GEUA 4WJ4A 4PPFA 1PH4A 4HUQA 2WOJA 3LQRA 5SZIA 1CJKC 4RD4A 1DE0A 1WFQA 2BWJA 3G4SA 4QQBX 4A8JC 1J5EQ 2QPOA 3SE0A 1G8HA 1KI9A 1XTRA 1Q3HA 2WWHA 2XOKA 3W5JA 4CGZA 2JA7G 3D6TB 3OEHD 3RSLA 3IHLA 4V0LA 2UXCL 1LV7A 2ZI9A 2NZJA 1WRBA 2UXBL 2JDID 5CJ2A 2R7ZH 1IBKL 4JI4L 3NTUA 4PAMA 1E2JA 1S8FA 1XX6A 2ERXA 1LABA 4ILEA 4BFVA 1QHGA 4TZ6A 2X1VA 3CAMA 2CVFA 4B3RQ 1KDRA 5FBVB 4KN4C 3PIOA 2CFMA 1FZQA 3I56A 4DR1L 1TQ2A 2D2CC 4B3SL 1TF2A 2FSHA 2JEOA 3AKEA 3QF7A 2WBLC 4LRWA 1UF9A 4AH6A 3LVRE 3G5UA 1QVFA 2WVJA 4Q1CA 4A92A 2ES2A 4RVCA 4P4SB 1IZ6A 2KHIA 4OQXA 4KFSA 2VH5R 4LFCL 1KSGA 4B43A 2QY9A 2IX0A 4DR1Q 4HLUA 4M4SA 4MKHA 3CRQA 1S96A 1HPCA 1SMYC 3VR5A 1A2KC 3HOWG 2G6BA 4HYYA 1E6CA 3CH5A 5E7IA 2ZANA 1W3SA 4BY7H 3B78A 4QBFA 4TYYA 1XPUA 3LXXA 1NBMD 3Q9LA 5DHAA 2EJFC 4J15A 2VW9A 4LF4L 4HLDA 1G6HA 4LFAQ 2JJ2A 3BZCA 3E5HA 4FN5A 3KF6A 1K8MA 5DI3B 1XB2A 1Z2CA 4S35A 4HI0E 3AEZA 4DZZA 3MXUA 4IO9A 4V02A 4C2MH 3RS5A 3WYFA 3ZIAD 3GTLH 2IYRA 2H1LA 3WYGA 4I7ZC 2J45A 4AIMA 4M1YA 5HTKA 3NIBA 1WBDA 2K33A 1SVIA 1DAIA 4HJ7A 4JMPA 1SXJA 3E70C 4JI7L 1UJ2A 3NH6A 5G40A 1DVRA 3KKQA 5FBLB 2GVBA 4B48A 5KO2A 4GDFA 2RF4A 1EQRA 4JOIC 3JZAA 2J0VA 4JYBA 1IY2A 4YHHL 2ORVA 4WJ3M 1J6QA 5E95A 5H68A 3E9IA 4HDCA 4NXNQ 4OJQA 4B2LA 3J80c 3ND9A 3RRZA 4DIDA 2GK6A 2V6IA 2EFDB 1WDTA 4OQLA 3AVXA 2JA9A 2LKCA 2OCPA 3CKLA 3V00A 3GLIA 5JEAJ 2ZU6A 3PCRB 1E94E 3OF5A 4EFMA 4JLBA 3DOEA 2RGXA 5BQ5A 1NP6A 1ZD1A 4NCKA 2D0OA 2IHFA 4GS3A 1ZYUA 1A4RA 4DV6L 1JQLB 4DAMA 3VR6A 4MRVA 1E2IA 4TYQA 4OO1H 3SGIA 1CXZA 3LD9A 3NVAA 4GT1A 1EWQA 1E0JA 3A4NA 3UMFA 1GZSA 3K0AA 5TXGA 5F9FA 3CIOA 2O8CA 1V1QA 2YWEA 1S1MA 4W7SA 2DYKA 4F92B 1N9WA 3QKSB 3PSIA 1IAQA 2WJVA 4FCWA 2WWWA 1M74A 4BGDA 4DUZL 3LNCA 1E2FA 4CT4B 2PLFA 1QVCA 1E2DA 2QENA 2F43B 4LYJA 3VNVA 2W2XA 3KJGA 4QHYA 3MEFA 2ZSFA 1X3FA 2WB1G 3KKMA 1HNXQ 3TKLA 1JEDA 3WNDA 4A82A 1DPFA 4GKJL 1OIXA 2ODBA 1U8YA 3J81c 2CBZA 4A93H 1BYIA 2E2JH 1KAOA 3ADKA 1JJ7A 2UXCQ 4XJXA 3RN2A 1UM8A 1U9IC 4IKEA 3T61A 3IO3A 2WM9B 3UK6A 3ZVRA 1DXMA 4NDZA 3I4OA 4L15A 1XPRA 1QHNA 5LMNL 1XJCA 3S1AB 4MDEA 1DAHA 1DO0A 4C30A 2NPFA 2B8TA 1Z07A 2AD1A 3REGA 3IEUA 4IOLA 1KRTA 5HCNA 1QHXA 4D0NA 2R93G 3BK7A 3K70D 3GJ3A 2HF8A 3K8YA 3O47A 4ZI3A 1X8LA 5M5WH 1L4YA 4KCGA 4R98A 2ZAMA 1NJGA 3RRMA 1UKVY 1U0LA 2GZDA 2CXXA 1OXTA 3CF5A 4R4TA 1Y1VH 2MNAA 5KNDA 4HIKA 1XCGB 2DHRA 1E96A 2YJTD 4YWMA 2UKDA 3FMIA 1VQ7A 3HPQA 3AGPA 4MKGA 1FP6A 2N8NA 4URWR 2E74C 1ZYRC 4BE7B 1Q46A 2J46A 3V4RA 3LX5A 4ITRC 3S2DH 2D7DA 2OCBA 3TW4A 2O8DB 3CCSA 4EX5A 2QUZA 2XXAB 4KU4A 3THWB 2K50A 1N6LA 1E0KA 1Y3AA 5KNBA 4DV1L 1HNWL 3VFDA 1VCOA 1HR0Q 2B3GA 1ZIOA 3PUZA 2A9KA 4PQYA 3RVBA 3CRMA 4BEBA 2P6RA 2VY3A 1HNZQ 1ZVQA 4GOXA 1TUIA 4A3LH 4W5JA 1NSTA 2QP4A 4QRHA 2FXQA 1E9AA 1KI6A 3ETLA 1NVVR 1DEKA 4US1R 3AVPA 1OLOA 5L8VA 2B8GA 1XMSA 2PLRA 3OFNA 4NHOA 1HA3A 2RAPA 2KSQA 2BE5D 2YWHA 2WIAA 4IXNA 4LJ4A 2UZIR 2JGNA 2XSZD 3NG1A 1D7QA 4P74A 2AHOB 3J80i 2L0XA 1Z0FA 5C2JB 1FW6A 1CI3M 4YDSA 1Q1ZA 3IRBA 4DCSA 4DC9A 3WWVA 3I92A 2R92H 4JZKA 4ARZA 521PA 3GLFA 1AGRA 1M6NA 1DARA 4Y0AA 2HIVA 1G9XA 2BMDA 3AH8A 3CX8A 5D3MB 2O52A 3DHWC 1QDEA 3HOZG 1P4SA 1YJ5A 3EC2A 3KB2A 1XJ0A 2XTZA 1NVUQ 1T5EA 5CYPA 2H18A 4NL4H 5F9HA 4OWWB 1LTQA 1W0KD 1G5PA 1GRRA 1KTVA 1KZGB 1X9NA 3OEED 2G1JA 4DCVA 4TQ9A 2CKZB 1DBSA 1R0XA 1A1VA 1AA9A 3CH4B 3PR1A 4LBWA 1BMFA 4DVGA 4DV2L 3VQTA 2JLQA 2Q2UA 2WZQA 2B63G 1BKDR 2OAP1 3CX7A 1YNNC 1B9MA 2OEPA 4ME3A 3MWLA 1HV8A 5FLMH 5C4XG 1M2OB 2QGNA 2C03A 1CU1A 4ZPXA 3H0KA 1N0WA 1Y1WH 2H5XA 1RJ9A 4LHYA 3MFYA 2ZROA 5C0XI 3IBYA 1Y1VG 4C3IH 4OBEA 4PZ7A 2ZRAA 4DLWA 3EPKA 2IS6A 2GRJA 4DV5L 1JI0A 2JEAI 3L2PA 4PAQA 2OLKA 2BMEA 5KPDA 2QBYB 3EZ6A 4DV4L 2Q3MA 1BBWA 4JI5Q 3PEUA 3U3MA 4B6FA 5JRJA 4AKGA 1LTLA 1IONA 1L4UA 1HR0L 2VHCA 4XSGA 1OFHA 2FPLA 3B82A 2RCNA 3MWKA 3RS0A 4AG5A 3JAMc 1SKYE 1KI1A 3A4MA 1J5EL 2J7PD 3KKOA 1UE6A 3OIVA 2JLYA 2YC4C 5AWFC 3N2EA 4KHZA 1IBMQ 4XWOA 5KUTA 3G71A 1SXJB 2NO0A 4IEEA 1OH8A 4JSTA 4LF9Q 1KXLA 4FMDB 2H92A 3T56B 2GNOA 5FR1A 1Y1WG 2C35B 4QL3A 3PEYA 2HIXA 1W46A 3RC8A 5L3SB 1VQ4A 1WXQA 3PO2H 1I50H 3CRKC 4A93G 2GETA 3AKCA 3HWSA 4FWIB 4AKIA 3P20A 4BFXA 2V55B 3U3JA 5HZKA 4TMXA 1BKBA 1P16A 1RL2A 4EQ5A 2W0SA 3JVUA 3HFZB 1SVMA 1UE5A 1W4CA 2EXDA 4OQNA 3LY5A 5EE3A 1A2BA 3U5ZB 3CW2A 3CR8A 1VQEA 5EUQB 4E5UA 2CEAA 1MO5A 3THYB 4NKRA 1TQ6A 1XU4A 3HKSA 1OH5A 2MO0A 2CW0C 4DR5Q 3GTJH 3A8KE 2Y8EA 2A69D 3NBYC 3VU9A 1OHHA 2AD5A 4TKOB 3NBHB 4PZ8A 1XEFA 2O8CB 2NGRA 4WAUA 1SKYB 3F5FA 4A4DA 1S4QA 1RE0A 2K52A 3TSWA 2N46A 5DYIA 3HOXH 4DBLC 2GF9A 5HE9A 2Q2IA 4HR7B 1J70A 1W47A 5BXQC 3L0IB 4A3DG 2W2TA 1XBTA 4IPDA 3NXSA 2YWGA 1LVGA 1KMHB 3CNOA 4O25A 4II7A 4A0RA 3IFTA 1KOFA 3W1GA 3NWJA 3L0SA 4A2QA 3T15A 5GADl 4I1OA 1K5GA 3RYTC 1AS3A 3B1XA 4TN1A 5D3QA 1H9RA 1GDDA 1N5IA 4GMXA 1HNWQ 1OYWA 1CJVC 3EQLC 3QBVA 1TL7C 2MSCB 1M1YE 4LF4Q 2H7VA 4LOAA 2Z0MA 5EP4A 3I3SR 3SHFA 3WP0A 1E3PA 2QORA 1OE0A 2BA0A 1PYBA 1NJFA 4PHGA 5GVRA 1TWAH 1ESMA 2ZI6A 4HDQB 4EJSA 3U7GA 1VF5C 1C9OA 1E2NA 5L3QA 1Z6HA 2ASBA 3KUDA 4PV1C 4OHVA 4X8OA 3ZGXA 4X64L 1LS6A 4DUZQ 3TS2A 2ZS7A 3O8RA 4CW7A 4EPVA 3RNUA 1ZCAA 5ELOA 1VCNA 1MABA 2QROA 4A8JA 1EFUA 2RKOA 2JDIA 3V9PA 2I0QA 1YRBA 2VHUA 1NBWA 2OUKA 4A1FA 4DNTB 2QQ0A 4BXXH 2PZFA 3OIWA 1K8AC 4OONA 2BH2A 3QEOA 4DLYA 5M04A 4A15A 1IYVA 2QMEA 4F91B 3HGBA 2EFEB 4ZDJA 2H57A 1US8B 4HAZA 5GVSA 4PZZA 2DUDA 4JLDA 1RRGA 1ZD9A 2UXDL 2PL3A 1AQUA 3WHLA 1G20E 3GP8A 4GRAA 1QF9A 2ZYUX 1KK0A 2BV3A 4QBGB 3CCMA 4JI3Q 4RD6A 2VSOA 2MMCA 3GLGE 4R4CA 2UUBL 4B3BA 4CEJB 1GHJA 1N32Q 5JECA 2Z6VA 2UXDQ 5KHOC 1XD2B 1VQMA 3KJEA 1VTKA 5JS8A 2A5JA 3VNUA 2J0UB 4DLSA 2VQEQ 2NN6G 4M1WA 1QJOA 1P7CA 1CSPA 4K0KQ 1VQFA 4TTRA 2ZI5A 3PG5A 1AS2A 3P27A 1VIYA 2FSFA 2D74A 2VO1A 4BLPA 1JXMA 4C4PA 4H13C 2CNWD 1D5CA 4UNPA 1EK0A 5J47A 2VL7A 4B3XA 4RKFA 3I7FA 4R7ZA 4HJ8A 3RS7A 4H44C 3DM5A 4IHQA 2R7ZG 2PMDA 1E3MA 1XMQL 5IK2A 2QMHA 4LF7L 4MQBA 3HKZG 3BB4A 4APVA 2EFHB 3A1TA 3B1WA 3QXCA 4NU0A 3WNCA 1O7LA 3IUYA 1A62A
chains in the Genus database with same CATH superfamily
3N53A 2VEDA 4B3JA 4NZMA 3P8ZA 4U7WA 3WA7A 1JPUA 5E4FA 3NEAA 1QNLA 2AS0A 4FNAA 1H4VB 4B4UA 4PG7A 3ZJYA 4F6RB 2O2SA 3RZDB 3U48A 3DPIA 1G1AA 4D9JA 3KJPA 1XKTA 5DNUA 4RVGA 2HIAA 2BN4A 5JJLA 2EG5A 2Q1TA 1G2OA 4Z9AA 1W581 3QWBA 3L43A 3QF4A 2R25B 2OZLB 1P74A 3GLGB 2WUGA 3FF4A 2ATVA 8ATCA 3FPGA 3TTWA 1M2NA 1PR6A 1TYCA 4N39A 2V9ZA 2PZKA 1U98A 1WXWA 5KYYA 5EP1A 2WKDA 4QUJA 1LXCA 1XL0A 3TE7A 1GL3A 4DEXA 3PHJA 4RV5A 3CNQS 1ZUIA 2O5IC 2AQIA 2XBMA 1C1XA 1PH1A 2BL4A 1UBJS 1U2GA 2H48A 3K30A 4KY5A 2IIVA 2NPIA 4NNPA 1TWHB 4I65A 1NVXQ 3W78A 3DF9A 4C2BA 4UNRA 3K0SA 1RYHA 2G5CA 1TCVA 2C98A 4HGNA 4EJSC 2HW8A 4EAQA 4V38A 1WVIA 3MTIA 4R8SA 4MH0R 2JIOA 3PNMA 1ESRA 3TGPA 2G88A 4M38A 4OQPA 3H4VA 3KJIA 4KJZA 3RJ5A 2Y1KA 4Z4GA 1C3VA 3KAPA 2B8WA 3TRJA 4A3FG 1NUTA 4OMCA 4MDHA 3DVRX 4YRBA 4DR5L 1VHLA 3DAOA 2R6GA 4TLEA 4PWZA 1CP3A 2Q9CA 4Z3DA 3ORYA 1UPCA 3TKAA 1HTPA 3DKIA 1N9GB 1PBTA 2FQWA 4OXYA 4PHHA 3WLTA 4QO8A 1G6OA 4I1RA 4KQIA 5AKEA 2RDGA 1KYWA 1VGVA 3EVBA 1TM5E 1Z4JA 4R1MA 3UJHA 4DXAA 4PNEA 3R6LA 4LHVA 4C4SA 5K03A 3IOYA 4DJDC 1HA6A 1D0VA 4K05A 4CU5A 3IS3A 3I90A 2L9HA 2OM2A 1RM5A 3BG3A 5F3DA 2P2SA 4ASUD 5TIIA 5F2OA 4GAEA 1ECLA 3KQPA 3U56A 1CM9A 2E8GA 4HPJB 1JOQA 3IR7A 1DTEA 1UBEA 4XUEA 5TGZA 1ESDA 4RDCA 4NE2A 5DSTA 1R2QA 2KOLA 5IYDH 1JQJC 4B08A 1VKHA 2R8RA 2A6ED 1KK3A 2WA2A 2WHYA 4NAHA 4RQAA 1F9SA 5IULC 2QMQA 2Q2QA 1RQRA 2AX3A 1QZXA 2VT6A 4LRUA 3WI7A 1WDWB 2NO1A 1PJAA 4AJ4A 4UDUC 2O0HA 2RGUA 2DQKA 2D8MA 1EFAA 2WW8A 3H0GB 2KI5A 5IGEA 2VNKA 4OHBA 3A7AB 3DXJC 2IOHA 1O7IA 2P3QA 4P5DA 4P86A 3GLUA 4DV1B 1SOAA 2BGJA 2XKBA 3BIOA 3MRSA 4R54A 4X44A 5E3HA 1YJNA 4WKNA 5LKAA 1U0HC 2AUJD 3A9RA 1Z29A 3OQVA 3QFFA 4Q9NA 2O6HA 1UDXA 3NELA 2VJMA 1ZR4A 5IXYA 4POGA 2ECOA 2GK3A 2IHUA 2IDZA 2OVBA 1S7CA 4QELA 3TEJA 3KR0A 4F96A 3OT1A 3UT5B 2Y0PA 4BBSB 4I1PA 3W5HA 1Q1BA 3J7YW 3EULA 3NEMA 3KYJB 1C3OB 1DJPA 4G0NA 4IFBA 1MORA 1Y3FE 1GWNA 4AL4A 1G21A 3L02A 1WY7A 4K9DA 2QTCA 2W2OA 1XLTC 2WE7A 4RXMA 2BONA 5JTUA 2NUAB 3TUJC 4DIEA 3QSYA 2XZDA 5ED0A 5D85A 1G6KA 4Z1OA 1YE8A 5IUJC 1YL6A 3CF4A 2GERA 3FETA 3GEIA 5AM5A 5BMVA 2XE6A 4EH1A 3DAYA 3HOYG 1EXWA 1U7HA 2JCXA 5KWSA 1LRKA 1WW3A 3G1UA 1A82A 4L6AA 1Q7BA 2PUWA 3OZXA 1Q0UA 1Y82A 2YHIA 3V42A 3JQQA 2JA6B 3SICE 1XRPA 2V03A 1G3QA 4UW9A 1C4XA 4JJIA 3RSQA 2A4KA 4RS3A 1KQNA 1SFRA 1RWVA 1Z5ZA 3CV3A 4TXNA 3TIVA 4JA0A 4FGJA 4U7TB 1NMZA 1OWLA 4HQOA 4RH1A 4JC0A 4Q4HA 5ALEA 3GLRA 3ANNA 3O94A 3ABRB 5EMMA 3EZXA 1QV7A 4TWIA 5ALSA 5A3VA 2DQYA 2DGDA 3KJHA 4V0MA 4LJKA 4GPTA 421PA 4XTRA 2D2XA 2I46A 1C1HA 4UOEA 2J09A 4CEJA 3VHLB 5JH7F 3DP9A 3T3PB 1B8NA 1RFGE 2TECE 4M1SA 1EA5A 5IUKC 3QUAA 3D3RA 3QVWA 3SX2A 2XYVA 4LZZA 4ZJUA 4XIIA 4HX5A 4DV3Q 5DYTA 1E77A 1O95D 3AEVA 5LQJA 3SZLA 3LXRA 1L1OB 1JEYA 4CKCA 5TQ0B 4Q05A 2IC5A 3T0FA 4N76A 1YJAA 2B3DA 3ZY4A 3H2HA 2A19A 3LPMA 4DQ0A 1L3IA 3HU1A 2OQRA 2BGRA 4Y9SA 4HB4A 3U60B 2UU9L 1GPNA 5C0OE 3UANA 4C6TA 1DG3A 2C5EA 2B69A 1FUKA 5FOUA 2QY6A 5D01A 3DVAA 5KDOA 3D6NB 3STVA 3CN7A 1E1KA 2YQZA 3MRXA 5AVVA 3E18A 2IHBA 5LZ7A 3DP7A 1XI2A 1YB6A 3TSZA 2BZ1A 1QGYA 1W5BA 2ROQA 1E4EA 2IZOA 4UU8A 2I80A 3IMFA 3K0CA 3RLNA 3ROTA 1IXKA 1MR3F 1GGNA 3M7NA 3BMQA 5DGTA 5A2QE 3OLWA 4AK9A 4DADA 5AMXA 4ZTBA 3DB2A 1OPXA 4G0QA 1I01A 3FDZB 5AJVB 3SU8A 1WMDA 2VP2A 4Q4CA 3DL7A 1T36B 1EFVB 2GNPA 4IICA 5ALPA 2REQA 3LL4A 3VVBA 4GWGA 3QEBZ 5FPKA 1G2TA 2Q3JA 5EAYA 4QO7A 3HMQA 4HNQA 3IRUA 3CQZH 5L4LA 4RTOA 1A3VA 1D2RA 2OK8A 1KVUA 1UK9A 2VNSA 3A6EA 5FO8B 3KPWA 3KX2A 3PGXA 4ZGGA 2JEYA 1NJSA 3EMVA 2XCSB 3C6BA 4KO2S 3OX4A 4S1VA 4PMWA 1ZUNB 2AJCA 3K7AB 1M1XB 1YR6A 1H9SB 1S2NA 3PRKE 2WWGA 4KXQA 5EERA 5F2KA 1IUKA 1RP7A 3BD8A 2H1OA 4JL5A 3W04A 4DF3A 4DB2A 1RYYA 3OE1A 1IXSB 3NWTA 2VP4A 3BE8A 4RO0A 4EY5A 1T9CA 4X66Q 1UH5A 5K09A 4BKPA 2IS2A 2CSUA 4O1IA 1N6OA 2HREA 2OHOA 2Q4BA 5LA6B 3G0HA 3COZA 4ROSA 4TMWA 2YFKA 5E6SB 1G8JA 1A7KA 5FNVB 3G9QA 4LG1A 1RXIA 4MKRA 4R2LA 2YMMA 1EQAA 1D2GA 2ZXEA 1HZBA 2H5JA 4NB3A 5JYDA 5EMJA 3PSHA 3MCUA 3L0OA 2Y66A 1V5EA 4WNYA 2PMEA 3ESXA 1J8QA 4NYMQ 1CKOA 1ZK2A 4M8NE 5EIBC 4ADSG 1BMTA 2C29D 4B74A 3AHGA 2ZXUA 3EXIA 4X62Q 1CQZA 3PKIA 4Q39A 3D4WA 2HLDA 1PS9A 3KCQA 1STYA 2Y1EA 1QKJA 3KOZA 2Q5EA 4O42A 1KI3A 3VGPA 2LRHA 721PA 4QDUA 1XQYA 2IA5A 4N8EA 1RLOA 1AMOA 1ZCFA 2JJ1D 3I1IA 3CCUA 4CIAA 2DWQA 3I2JA 4M9SA 3LHDA 3VTZA 1EK2A 3UC5A 2K5WA 1T25A 1N2SA 5IBRA 1EUQA 1YK1A 1HETA 4JENA 1GSAA 2BFDA 4RPJA 3C5WP 4O1NA 2XNKA 2XRMA 2ZRBA 5FULA 5DI9A 5KOYA 4QJFA 4KBFA 2IBTA 4G25A 2AG0A 4DCUA 2JI7A 3FGNA 1KABA 1TX4B 2VJCA 4ZUIA 3ZW8A 3DVAB 4CV2A 4YREA 1BX0A 1SN8A 2BW0A 1A97A 1P2SA 1USGA 1ENAA 2YTXA 1AGXA 1QHEA 1DAGA 3E58A 1I2DA 3JQ9C 4TSFD 5F21A 5FPSA 5CFQA 5DNYB 1PK7A 2WWYA 4Q4AA 4S2UA 3BORA 5E6RB 3ZHSA 1NQWA 4B79A 2BKEA 3QXHA 3FCXA 1HYEA 3CPFA 3PIRA 1QUQB 1JTEA 4TV8B 1FL0A 4DLTA 3LZ6A 1W0CA 1T6BY 3O95A 4P2BA 2QPTA 5IRCD 4TTPA 4B81A 4KWTA 3HK2A 1YDEA 2SNMA 3DHQA 3TRFA 2QXYA 3N58A 2QTBA 3W1VA 3MJRA 4HFNA 4I4CA 2PBZA 2QUAA 4KGXA 4CJXA 3BJRA 1CLUA 4HEJA 4EM6A 1YITA 2HTEA 4KE7A 4CF3A 3H5RA 2A6EC 4YY3B 5BNTA 3IYLW 4HZUB 5B3JA 1ACJA 2RI0A 1RJFA 3CBQA 3PP8A 4JVNA 3OW2A 1MDFA 3QF4B 2QD1A 4Y6PA 5DU2A 3BKWA 4I9UA 1P4GA 3KYHC 5IVHA 1SD2A 4JQOA 5ALXA 1IN4A 3W4KA 2OMKA 2CE7A 4PZLA 2VK2A 3OZUA 4AG6A 5ITWA 1Z2AA 4NJMB 3S17H 2LXNA 1JSLA 4R1TA 5FLEX 4R71A 3LF2A 3VV2A 4EHLA 4EPTA 2VZAA 3CPSA 3SSNA 5KKNB 3TOZA 1N77A 4HDSB 4NRDA 3TX2A 4A15A 5FTJA 3S2HH 3BDVA 2VH2A 3N6RA 1P5ZB 3S1MB 4WCFA 2XMPA 5PGMA 1UBHS 3N76A 5AM3A 4B3HA 4TSKA 4H16A 3L1UA 4RHSA 2G07A 3MTGA 4DMKA 5DIZA 4NSNA 4KOAA 1TYEB 1X6OA 1LF5A 5COBA 5HFAA 1YE3A 2JI6A 1FD7D 2CBXA 2CZGA 4ASUA 3QX3A 4H02A 4GOMD 1L4GA 1OX6A 1Y5IA 3D6JA 5IP7G 1ADGA 1W8DA 2X4LA 3MB5A 3QLJA 1ZG3A 1W93A 3IIMA 1M34E 5NLLA 5REQA 3VR3D 4OXNA 4Y7NH 5B58C 1SUPA 5IKPA 3X1XA 4AC9A 2H06A 2G40A 2G4VA 5DM2A 4J0KA 2HY7A 2JS7A 3RTCA 3LOUA 3PD7A 4K9OA 4GMKA 5TRTA 2C2BA 3S3TA 5K01A 4OIKA 5CHYA 1E4VA 1EOTA 2A5YB 4U2CA 2WYWA 3VSCA 1QH1A 3C8ZA 3J81k 1FIUA 1TPZA 2WAMA 3LA6A 2A7QA 1V35A 3ZD6A 1DM0B 5HQTA 4JBIA 1QGUB 1J21A 1DADA 1U2EA 5KINB 2CBGA 1CF4A 1S4MA 2W2VA 1E79A 1T6YA 3AIIA 5JZMA 1HM5A 1TMKA 1E9DA 4G85A 8MHTA 2BBWA 2JGDA 2REBA 3S1SA 3QPUA 3GDEA 1XP5A 2XUPA 3PR3A 2AJBA 3HXLA 2I1QA 1VZ2A 1SEVA 4HSEA 4IJLA 4S0XA 5EWMB 3TDQA 5KNBD 2PKRA 2QDLA 2M6LA 3RSHA 4KUGA 2CCZA 3MD9A 2GXSA 5I9IA 1JHYA 1RHRA 1RQNA 1Z08A 4JBMA 2C61A 2IEIA 2HDOA 1MIOA 3QEJA 4QTYA 1T29A 4HAOA 2VDJA 2GCPA 2PUTA 1VSQA 3DTYA 2XQIA 1FS4A 2Q5FA 1PP4A 3I5AA 4NESA 3U13A 3RIEA 4EHAA 4OL0A 4PGAA 5D5HA 3RBZA 3UUFA 1I2BA 4EAAA 1WLYA 2PJDA 2VPPA 3AC0A 4GX0A 4MPDA 2ZIGA 5AOBA 1L5OA 3SYNA 1FNVA 2RDFA 2IUSA 4NX2A 1XHLA 1LDBA 1P81A 2Y6UA 2R48A 1K3FA 4YYZA 1WA5A 2ZRMA 1ILWA 1F2TA 1I3OA 1SXGA 3DVLA 5G1NA 4JI1B 4M8AA 2Z2XA 3NO4A 4LWCA 1XO1A 2IXGA 1CIPA 4DK1A 2WM3A 3ICEA 5DULA 2K75A 4IJHA 5JZ9A 1SHKA 5GV7A 3U7HB 5F1OA 4EW1A 2BGWA 2WK1A 2J0SA 3GJQA 3E2MA 2PRJA 3NP8A 1S40A 2A9JA 1IEWA 4X20A 4DPLA 1MJCA 4LTDA 4DOMA 2KMLA 5ESXA 1DCZA 3NTKA 3QW2A 3HNRA 1NDUA 5CC4A 2J3EA 1N75A 5GJCA 3HA5A 1T9HA 1PWEA 4HNRA 4Y2HA 3SIRA 3V8VA 1CZGA 3AB8A 2OHFA 4JB0A 1BKYA 4FOOA 2X3YA 5CLQA 5FO9B 5HSGA 5ALHA 1O5OA 4DR7B 1OUMA 3VA7A 2QVXX 4R9NA 4NYIR 4RGYA 2X9VA 3OKAA 2UDPA 3PHGA 1L0XB 1YHAA 4OU5A 5CVUA 3REQB 1NG9A 1KO1A 2RBKA 1WD0A 4KYVA 4YALA 3BAZA 2XX3A 1NAHA 2GRAA 2DWUA 3L1KA 3QMWA 1JIIA 4UPAA 2XBLA 4OAPA 5FOSA 5KREA 5ICMA 2QYOA 3V9AA 3ZQJA 5D84A 5JQGA 5KMGB 1M0EA 1KKUA 5K45A 2XYRA 4HWOA 3VHXB 3DXXA 3LRXA 2IY8A 2NSLA 4FFBB 2BUAA 1DIBA 3GPBA 4CMEA 3FKSD 2NAPA 1E9SA 4U2EA 4OO1I 2VAXA 2ZDHA 2ZBGA 1FFXA 1ZWKA 2R6ZA 2XR1A 2IPLA 3KR2A 4U2KA 1SVUA 5GJWC 3HEAA 1OBOA 4BLSA 4Q1DA 4F2WA 2RHHA 1KSJA 1N34Q 1ORHA 3GUYA 1IB0A 2ZRDA 3OP4A 1DOMA 4JJZA 3V7UA 1K2WA 2YCBA 2CHVA 4LYEA 1C1YA 1IXRC 1LTAD 2P0EA 2JBHA 1YT5A 4TQUS 1WOCA 4DLUA 3OTQA 1ISGA 1D1KA 1SFOB 1M1ZA 2FUKA 4LDAA 2ODAA 4ONEA 1D5WA 5BWMA 2GLXA 2QXUA 3DEKA 2XQJA 5FTKA 5JRDS 5KJCA 5CH3A 4ICIA 2NTSA 1FQOA 1DSSG 3SI7A 2OAQ1 1N33Q 5KDDA 3K9FC 3CVXA 1OHHD 3RNOA 4BFLA 5BSKA 1VXOA 2IEGA 5C0XG 2Z30A 5GQOA 1O94A 3KXKA 2ZPTX 1T36A 4XH9B 4HRXA 1OFUX 1V43A 2PWZA 1BJRE 4BJ3A 5CA0B 1GL7A 1H8ED 1G3RA 3A54A 4X3SA 2EEPA 1IHPA 4L27A 3R3ZA 4YRFA 4D9FA 4E6EA 5LQMA 2GWHA 1V1MA 2YOFA 1QDLB 2QUIA 3PB3A 4TXLA 1LPAB 4J75A 1U65A 4TZTA 1QHHB 1D2AA 1JKXA 1B42A 3ENNA 3I04A 5CLIA 4JMLA 4ZO9A 4MHTA 4HGZA 5DO9A 4F2DA 5JJCA 3CNLA 2DGYA 4UU0A 1SPBS 3MCAA 3A4IA 1CULC 5E0OA 3TZQA 1DKQA 1SQFA 2A6HD 1UPXA 3ITPA 3BC1A 4TL9A 1VL2A 3DV0A 2Y0SB 1E32A 4WZAA 1ZPDA 4ZQFA 1SHZA 3PX7A 4YXWD 5JNSA 4QHSA 1LO5D 4C3HB 1I9CA 4XSHA 1BSVA 2WD8A 1LFAA 1JB3A 4J43A 1LACA 2OHIA 3N9IA 5GADC 4E70A 4Q1FA 4UUOA 1SCUB 2V3VA 3QLUC 2H07A 1X3EA 3W3AH 2AF3C 5JEAG 3UENA 3I39X 1DRWA 1RWNA 5JCXA 1NE3A 4J16C 2A6PA 4HEQA 4PNPA 4GR9A 1ZMOA 5EHQA 1Z28A 2YMPA 2RHOA 4LF5Q 3DTVD 2J3JA 4M9RA 3RREA 4FFDA 1U7XA 3AW9A 3PSAA 4LFCQ 2VQ3A 2MWMA 1JOKA 4R2KA 2XD9A 3GXOA 5FK9C 2H1IA 1HFEL 2EYOA 2RG1A 2PRIA 3F47A 1CUKA 4MVWA 2BYTA 1G8ZD 3DMHA 4C3HH 2NZJA 1Z5GA 3B9BA 1XPOA 1QE0A 3IP9A 1EEHA 1KAWA 3IQEA 3JD2A 1NUSA 4QFMA 3S6JA 4MVJH 3VOSA 5I7HA 2QZ4A 3SKYA 1UJ4A 4B3SQ 5CCEA 4N5IX 2BE7A 1KRHA 4P3YA 3TQQA 1U1GA 2IUYA 2GILA 4N3BA 3WRYC 1JA9A 4OP3A 4BDSA 4TXJA 5D5PA 2B8JA 1KYYA 4K1XA 4A93B 2QMYA 5AJWA 1E2LA 3N52A 1B1CA 4BQQA 5JPMC 1CG6A 1KOJA 1NHGA 4HG2A 3R2TA 5EFZA 4H7JA 4CI9A 1PTOD 1S8AA 4UZSA 3JZMA 4PINA 2C0PA 3FYCA 1M1NB 5M3BA 1KWGA 2QMZA 3D8TA 1HDGO 3PPVA 1WTAA 3NBHA 1YC2A 5GJBA 2XUJA 4DLXA 4AZ0A 3VAYA 1N33B 4YRAA 5A4DA 2ON6A 2WUWE 3W2FA 5IVPA 2EL7A 5DCUA 1B93A 1XVAA 3DL4A 5D1NA 1Y34E 3D4PA 1TYBE 3PUXA 1A72A 1EFDN 1U02A 4JEIA 5EUMA 3ZBUA 1H1LB 2XB6A 4D0RA 1MT0A 2DBVO 4IJMA 4HB2A 4UHKA 4L74A 4AYBG 2C2MA 5IGGA 3QVOA 2RHBA 4B71A 1YRAA 3HPRA 3SYLA 3RVDA 4R8KA 3I8OA 4ZU3A 2GZ2A 4BKOA 1PH9A 3EISA 4WK4B 3QOLA 5AW3A 2RHWA 2DXIA 3E7XA 3HL4A 1FLVA 3ZBQA 2DP4E 1AM4D 1KZ1A 1T34A 2EBFX 2ZUUA 1DCMA 1GN9A 2R7KA 2CUTA 3BU2A 1DJQA 2ZJBA 3M1LA 4HXFB 8AT1A 2HDLA 1K6JA 2I4RA 2IW1A 4M86A 4N12A 5AXCA 2DHDA 2JCYA 1SJ9A 2RH8A 2JJYA 3IEKA 1DRVA 2FFAA 1CB7A 3NJ4A 3PXEA 2HEIA 4KMRA 3GG2A 4AFNA 1BS9A 1IDN1 2F6RA