3PUVA

Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
371
structure length
371
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of the maltose transporter during ATP hydrolysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/transport protein
molecule keywords Maltose-binding periplasmic protein
total genus 103
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3puvA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3puvA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3puvA01
4JCVE 3B60A 3RWOA 3N6RA 1JR3A 1H9MA 1A1VA 3WY9A 4ON9A 1R2QA 2ORVA 2IX1A 3EAQA 4Q4HA 4OHYA 2C9CA 3UMSA 3I8XA 1GM5A 5JEAJ 3M4YA 1P6XA 2JA8G 4E07A 4K81B 1F5NA 4FCWA 1GUSA 1KI1A 3CC2A 4NL4H 4FXPA 1UE7A 5SZIA 2QL6A 1UBGA 3SHFA 1F48A 1OJLA 3X1WA 2KHIA 2CBZA 4B3BA 4TTPA 1P5ZB 3VR1A 3PEVA 3EZ9A 1RW4A 2ZI7A 1ZC4A 5GVRA 1FUUA 1PH9A 1CR0A 1NKSA 1XMIA 4IFBA 3VU9B 2R92G 4Q1FA 2Z6KC 1NF3A 4KODA 1R0XA 2Q2HA 1W5TA 1R8SA 2J9RA 2JASA 4LF4Q 1G51A 1K8AC 3LX5A 4C30A 1A5TA 1O7IA 2XSZA 1EWHA 1WB9A 1NVXQ 3QI2A 4C3IH 2GNOA 1G291 2QA5A 4QGHA 4ZIRB 1TF7A 3MLEA 4FWIB 1W36B 4RZ2A 4HIKA 4YMUA 3AP3A 1E2FA 2UU9Q 1XRJA 2RGNA 2W6IA 2IUSA 1FZQA 2XEXA 5IWAL 4GOPB 4C2TA 1OFHA 1W2BA 2CQOA 2CJWB 3SJAA 1E2MA 2DPXA 3OEHA 1BDOA 4KFUA 1B9MA 1YQTA 4A76A 4Q7LA 4QGGA 4DNTB 4AKIA 1AN0A 4A3EG 4JI0Q 4LFAL 2BBOA 2QMUA 2NO7A 2F4VL 1XEXA 2ZI6A 4QHYA 2CWPA 1U8ZA 4TQ9A 3T15A 4DLXA 4CEJB 5L3RA 2Z5FA 4NYIR 1R0YA 1E6CA 2NGRA 1EIYB 2W6JD 1E9DA 3N2IA 1KJYA 4WA7A 4OQNA 3UMFA 5K8TA 4DR2L 4NYIQ 1SR3A 2C99A 4R98A 2PNHA 4EJSB 4AI6A 2I0QA 2IHYA 2W6JA 2ZRHA 4BXXG 2IS4A 2I3BA 3IQWA 1N8RC 4M9ZA 4QG7A 4OQMA 2N3SA 4Y7NH 1COWD 2E76C 4JI7L 1U94A 1EFWA 1CBUA 2QQEA 1PZNA 3U4ZA 1UDXA 3K9NA 4DC9A 4PPGA 1ZD9A 3U9SA 2C95A 1N6KA 4WAUA 3NBHB 4EUNA 2P5TB 4OO1H 2IT1A 4GP6A 3I4NH 4TQUS 1TNDA 2FU5C 3OZXA 3OEED 1CKNB 4M21A 4DSNA 4LSGA 3VKHA 4NCIA 2HT1A 1ZM9A 1ZRHA 3BH6A 3K1JA 1CXZA 4IVPA 4L9SA 1IQPA 1E9AA 2YVUA 3T1YQ 2UXDQ 1TU3A 5AJ3Q 4AYXA 1JJCB 1LY1A 3WRXC 1H8ED 4QM7A 3OW7A 2DFTA 1OLOA 2WPDD 3NG1A 3AVYA 1KZGB 2A5FA 4PHGA 2R62A 4KITB 1HUQA 2XNDA 3MFYA 1KI2A 4A8JB 4XJXA 4UXJA 1YZTA 2LCFA 3H1TA 4LHVA 4TWZA 1M74A 5IYDH 2A6EC 1EUJA 2G3YA 4JOIA 3A1TA 1W5SA 3KLWA 1YZQA 2NIPA 1E2JA 1JMCA 4KI0A 1QVGA 3F2BA 3TUIC 3WBJA 4ZDKA 4C0QC 3QNUA 2ZRNA 2IYZA 4KKTA 4U00A 1RYFA 2O8EB 3DKPA 2HQLA 5FBRB 2ZJ2A 3CONA 2ZQ5A 2D5DA 2J59A 2P6UA 3TQCA 3BFVA 3U3OA 4M22A 1VYUA 2ZXUA 5FUYA 3THYA 2OFOA 3AF3A 3EZ7A 3CKLA 2A5GA 1WFQA 1A7JA 3VKWA 4R7ZA 1N32Q 3L7ZC 2VW9A 1A0IA 1XCMA 2WAXA 3NH9A 4IFDH 2A78A 1KO5A 2VQFL 2VF7A 1CEEA 1W36D 2UUBL 1QDEA 3O8RA 2QBYA 4H1VA 4V0MA 3KFUA 4A3DG 4UNRA 4NB3A 1KO7A 4DLTA 1P16A 4AIMA 1VQ9A 1XNJA 5GAGC 4TMXA 2EVBA 2ZVPX 3CMEA 2IX3A 3G71A 2WV9A 1VQMA 4GZLA 4RFVA 3KDSE 4C9BA 4NONA 2OBMA 3I2ZA 1CR1A 3DL0A 3RNLA 4E5UA 4LOAA 1NN0A 3QF4B 5GQOA 1ZC3A 4JSYA 2DR3A 4A0GA 2OZEA 3DM5A 1Q44A 4DV7L 1US8A 2QEQA 1VCMA 2BJVA 1FP6A 1WA5A 4A3DH 2FSHA 2KI5A 2ODWA 2A1AA 2PBRA 2HXYA 3JC66 4PZ6A 3C14C 5FTKA 1DS6A 3GEHA 2VSFA 4CIDA 2ZRIA 3C16C 3W5IA 2EWWA 4E09A 1YZ6A 5KNBA 1KMHA 3CRQA 4UY8C 3ZVNA 1Z7TA 4ZDWA 2AXNA 1OE0A 4IFDG 4JBJA 4DR6L 1VG0B 2XTNA 2GXQA 2BVNA 3KJGA 4U5XA 2P6RA 5M5WH 1PH1A 3CR8A 2EYQA 3BJUA 3FFAA 2RHMA 4X62Q 1R5OA 1CULC 2HF8A 1CJUC 4KAXA 5TMPA 1VQOA 4C0KA 3CPEA 2JK8A 1P60A 2IS2A 3GDEA 2GWHA 5JRZA 4A93H 3BG3A 1KL9A 3OFND 3HOVH 4A3LH 4XVQA 2GZDA 2IYQA 1NMYA 3GTMH 1WOCA 2PT5A 4Q4AA 4TMKA 4BRUA 2R7FA 2BV3A 3VR2A 3PO2H 2WAQG 3LBIA 2OILA 3FOZA 4V03A 1GNPA 2IYSA 3QVUA 2QP9X 2EFCB 1E32A 1IXSB 3G0HA 4B3RQ 3UWOA 4JBMA 2Z6VA 5H70A 3OYYA 4UPAA 1C1YA 2ZSDA 2MFIA 2I5HA 3B1WA 2E2JH 1KKMA 2JATA 2YWGA 5JCPA 4DV7Q 1ESNA 1XD9A 1ZNXA 3CD6A 4B3GA 1K3RA 4A36A 2PI2E 4DKXA 2G1JA 3J80i 5P21A 3AB9A 3L43A 2F9LA 2J7PD 2ORIA 3TS2A 3I4NG 5JWHA 1YNXA 4DV6Q 4IDOA 5HKKD 2XTZA 5KSYA 2DN8A 3EC2A 2N78A 4QL5A 4JV5L 3AP2A 3M1IA 2H1LA 1RJ9B 1VQ6A 3MJRA 4M1MA 3SS8A 4BQSA 3RZOH 2D4HA 3QUSA 1HR0Q 3QKSA 3SHWA 4APVA 1EGAA 2VZAA 1NJIC 4FINA 3W8RA 1VMAA 2IXGA 2JAQA 3HYTA 3U6KA 2H16A 5FUVA 4L5QA 2NN6I 2UXBL 1BKDR 2JA7G 2K14A 1YEZA 2CL0X 3IILA 2DFLA 2RMKA 4HAUA 2XOKA 1UBEA 4HUQA 5DH9A 3VFDA 3K8YA 5FOSA 2ZT9C 5C18A 5FBVB 2A9KA 3TR5A 4OI2A 2B6HA 2WWHA 2X2EA 3B5JA 2ZTEA 1KSGA 1ZBDA 2NZJA 3K9GA 4P3YA 2IYWA 3GJ4A 1QF9A 3W1GA 1I4DD 2ASBA 2E2HH 4W5HA 1BS1A 4US2R 1XJVA 3KJIA 1BH2A 2CCGA 3DZDA 4LNQA 3NH6A 2MSEB 4LI0A 4JOIC 1HZBA 4G3XA 2NVTH 2IYTA 1MKYA 2BMEA 4DJTA 1GUNA 2K33A 5BR8L 1H8EA 2V4ZA 5EJEA 4TZ6A 4GLXA 4TL8A 4Q19A 4EQ6A 3KKPA 2QT0A 3Q3JB 4V0ME 4QBFA 1VQPA 3U44A 1D9ZA 1H8HA 1GDDA 1XD8A 4JYBA 3CPWA 5KPDA 4B2LA 3I5XA 1Z47A 2EFGA 3BORA 4DRZA 4NXMQ 1S40A 3V00A 3KQUA 1NIJA 1ZYUA 1JB7A 3IEVA 5LB4A 4DZZA 2DNCA 1SULA 1T0JB 4TYPA 1CKOA 5JJKA 3EN2A 1K9MC 4JI8Q 1Z6AA 4HAZA 3SQWA 4YXWA 4DV0Q 3EWSA 2V3CC 3SQXA 4RCZA 3TR0A 5L8VA 4PC1A 5HR5A 1Z6HA 1J90A 3L0IB 1UM8A 2ZTCA 3H0GG 1P4SA 4KBFA 2YKGA 4V0NA 1G21E 4LYHA 1K8GA 2QE7A 1ZNZA 4YMSA 4EPTA 2ZAOA 1UFQA 5TV2A 3SFVA 4GZYC 2O0KA 2KWIA 1L7VC 2XNSA 2ZRLA 4KO8A 1CRQA 3FHWA 2QGNA 1LYLA 3D3QA 4DV3Q 3HDTA 1E0JA 3EXAA 3MG9A 2CKZB 4NYJR 4X8OA 3WRYC 2BA1A 3CC4A 2AR7A 4Y0VA 3WYGA 4AH6A 4R4CA 1OHHA 4WZAE 2KE5A 3KJPA 3O47A 1L1OC 4PAOA 3WNDA 4YMTA 1ZVQA 5FTMA 4PHFA 1NG9A 5CDFA 2VP5A 1NMFA 3MWLA 5CM9C 4EAQA 1Q3HA 2WKRA 3LAWA 5GJVC 2GK7A 4NMMA 3TSZA 5FH9A 3T1VA 4IDQA 4OQLA 4XWAA 1XDBA 2CL6X 3H15A 1G3RA 3K0AA 1DAIA 1GD7A 4JYCA 2RAPA 3KXIA 1BVSA 5FL7D 4ZKEA 3RS0A 3CX6A 3GEEA 1KI4A 3GTLH 4WZ6A 2WP8J 4AURA 4JI4Q 1E1QD 3PIOA 2EYUA 3TS0A 5JRJA 2G9NA 5FLMH 1JR3E 4JT4A 4OI4A 2ZJOA 3KQHA 2ZU0C 5BR8Q 3A1UA 1NVVR 2XJ9A 1OFIA 2FEOA 2YOHA 5K36G 2LXKA 1JJGA 1YR9A 3A4MA 2HXSA 3QKTA 1KIMA 1MO5A 4BGDA 5JEEA 3HPRA 1W4CA 3OIYA 4IDNA 4AYBE 4IXMA 5AUQA 2YV5A 2LKDA 3O8BA 1YIJA 2Z4RA 2EJFC 4KJZA 2YJTD 5SZKB 3RVBA 2ZANA 5J5CA 4DLWA 1CSQA 3B82A 1UPTA 3CCEA 3GFPA 1JECA 4Q18A 1OV4A 5IT9c 1ANKA 1XD2B 1A6XA 1AE2A 3HKZE 1AK2A 1XMVA 5FLMG 3CQZH 2VTKA 2W0MA 2GJ8A 1EFHA 2P6NA 1E4YA 2UXCQ 3KF6B 1KOFA 4DUZL 1G3MA 2C5LA 1XB2A 2GEVA 1M1YE 3CNOA 4JT2A 4JJKA 2RGCA 2KCTA 2A68C 2Q2TA 1F6BA 1PVOA 1J5EL 1VHTA 3FDIA 3KL4A 1KI9A 2JLSA 1GKUB 1G8HA 1RRCA 2B8FA 1XJ0A 2VH5R 1H9KA 2IYUA 3E2IA 3DDCA 1XZPA 2NO9A 5FBQB 2GVAA 2FFAA 1YBYA 3QQ5A 2A2ZA 1HPCA 3VU9A 3FMIA 3U7HB 2X8AA 2CNWD 1IBLL 4GN3B 1E9CA 2W6ID 4X65Q 1F3OA 4FIDA 4D4MA 4A92A 5J4HA 5JECA 1CJMA 1XCPA 1VQAA 2EQBA 4LWZA 3VAAA 3WMFA 3J81j 4Q7MB 4ESHA 2NVQH 2WB1G 5CB6A 3GLFB 1KI3A 1QVAA 4A15A 1VTKA 2AL7A 5J4YA 4OO1G 1DD2A 1WE2A 5KHOC 1N6LA 3STBC 1JXMA 3CPJB 1Q7YC 4JLJA 3B7GA 2D0PA 3HOWG 2H17A 4UNQA 1DAKA 2Q8IB 2PL3A 3CF5A 1NRJB 1GRQA 1HNXL 1XBTA 2J0UB 4PSVA 3I73A 4GDFA 2ZJAA 2GXUA 2P3SA 1JJ2A 2WWYA 2O5IC 3ZIAD 2N49A 2WWWA 3ONWA 3QPVA 3ZD6A 2YZ2A 3KUDA 4OKSA 1T3SA 2LSSA 3QIAA 1HE8B 1JNYA 3M4PA 1UEIA 2OAQ1 3GJ5A 4HEJA 4B32A 2R6AA 1UE6A 4RD4A 3KZ1E 4A3GH 1N6OA 1N6NA 4FCVA 3GPLA 2BM1A 3UPUA 2D0OA 2ZTDA 2CLDX 3L82B 4B3SL 2YC4C 3TUJC 4OGQC 5DHAA 1EOVA 1SXJA 1FFHA 1ZIPA 4X6AH 4KYUA 4Q9IA 3U3RA 4M1OA 1I94Q 4HATA 4A3KG 5LMUL 2GZAA 2YINC 2N1BA 1MKHA 3FKIH 4M1TA 2EFEB 4PZYA 1OYWA 3ZDQA 4WJ4A 1X65A 4BBRH 1XWIA 3P32A 1FP7A 2A5JA 1IBMQ 2FWRA 3NC1C 4CW7A 1Q1QA 5KSZA 4ZCLA 2FPLA 2CCKA 4B47A 3QPWA 2EDGA 2DUDA 2CVFA 3JZAA 4PXAA 4M9QA 1Y8OB 1G7SA 1ZUIA 2ZS9A 4II7A 4PO9A 2YOGA 1F60A 3LBNA 5BN5A 1LUZA 1R9TH 3PO3G 2MSCB 1IYJB 2RHDA 3C7KA 1AS2A 1XTIA 1LM0A 1WDTA 3KTAB 2RGDA 1R6BX 2QSZA 3MWJA 3P4XA 5CITA 5F98A 1HNWQ 3B1ZA 4YLGA 3W6NA 5FJ8H 3BJIC 3CM0A 4P74A 4OWTB 1QZGA 4OHZA 5B58C 2IYRA 3BAFA 1VF5C 3HJNA 5UKDA 3WNCA 5G3YA 5L3SA 3A8JE 4B3RL 4BPBA 2G1KA 1DO0A 1Z08A 2B21A 4HLCA 3U60B 4OHVA 5A5GA 1UDWA 1E79A 3I62A 1F2UB 3FHTA 2PJZA 3GLFE 1NLFA 1NSTA 1OKKD 1SHZA 4OX9Q 3LVRE 4X64Q 1CJKC 3UE1A 3OEEA 1ONLA 2RHSB 2GETA 1IBLQ 4QC2A 1G3UA 3W6OA 3ZZTA 4AC9A 4POFA 2L15A 5L3VA 3FKQA 4Q4JA 4F92B 3FMOB 1JR6A 2B92A 3NE5B 1ZNYA 5FR1A 1QHHB 3U4QA 1VECA 4ZKDA 4C0HA 3CMAA 2Z43A 3EIQA 4AQYL 3P1JA 1IL2A 3KB1A 4ME3A 4URVR 1QVFA 1BOFA 4N0DA 3ULLA 3CH5A 4WXRA 3U4VA 2J46A 4Q48A 4A3FH 1CSPA 2ERYA 2A5DA 1CFMA 2GVDC 1SMYC 2HUPA 3AVVA 2EXDA 5L3QB 4JLPA 2MMGA 4HUTA 4DVGA 3LQQA 2E8GA 1KD1C 3HOVG 1T4GA 5CM8B 4A6XA 1JPJA 2I4IA 4HSEA 5JFGA 2HLDA 2Q2IA 2OXRA 3NBXX 2CCZA 4TLEA 4QIWE 3JAMc 2X77A 1GOTA 1Z5ZA 4ACBA 1OXTA 2CHQA 1QHYA 4B3FX 4DCUA 4OQXA 1KI7A 4PPNA 2BBSA 3X1YA 1XMSA 3E70C 1E2QA 1BBWA 1G4AE 821PA 4JL8A 3ZJYC 1GTVA 4O0MA 1AGPA 4ZDIA 3GJ6A 1E1QA 1W4AA 4LFBL 1H9SB 3ERSX 1N6RA 5FPKA 1LW7A 3T12A 3T53B 4GN4B 1W4BA 2FJUA 2QI9C 4B3TL 2WWIA 1DELA 4GRAA 5M04A 4QFMA 3SZRA 4ESVA 3MSXA 1WYDA 4D0NA 4OX9L 4P4SB 3RR5A 4IPDA 3RYTC 2UUBQ 1S9HA 1T6NA 1YJ5A 3FPAA 4TKOB 1TF2A 2WJHA 2GZHA 4IRUB 3CCSA 1IN5A 5EUQB 2ERXA 1Q1ZA 2OLJA 4BUJA 5EXXA 5M5XH 1DVRA 4XVRA 5EE9A 3P4YA 2BE5D 4QJFA 5IDVA 2B63G 5C3EH 4LF6Q 1JALA 3OTOL 3PENA 2VUMH 3PG5A 5K8IA 1T5EA 1FX0A 2DBYA 1PUJA 2IXFA 1Z6XA 2JA5G 3SDZA 2F52A 4CVNA 4JYAL 1CJTC 1SZPA 5FLXc 3D0FA 3IPYA 4DDWA 1YITA 1KK1A 2GCPA 2XAUA 4OWWB 2IW3A 2VQEQ 2ZSBA 5D3MA 4DXAA 3JVUA 4JZKA 4JMPA 3THXB 3FMCA 2G6BA 4LDJA 3A0JA 3TMKA 1KAOA 2FSGA 3VR6A 4QJ4A 4M1WA 2OG2A 1VIAA 2VEDA 4PO8A 4QOSA 4HAWA 4AYBG 4Q03A 4F4CA 4CEHB 5J4VA 1NE3A 3CNNA 1CP2A 4DWJA 5A0FA 4D25A 1IYUA 2JLRA 2QPAA 5C0XH 4GOXA 1D5CA 4TQAA 1PH2A 5EP2A 4DDTA 3PEYA 2BBTA 3LY5A 3LWNA 3K0EA 4A3JH 2UUAL 4NH0A 1G6HA 4LYAA 5F3WB 4B3SQ 3U61B 2OBNA 1ZP6A 4DK0A 2FDCA 1JEDA 1OXXK 3S2DH 3HOXG 5IYDG 2OFWA 2PT7A 1IW7D 3HKSA 4DR7L 1L4YA 3GLIB 2VQSA 4Y0AA 1E2IA 2JIZD 1SHKA 1TWHH 2F3IA 1J8MF 4YMVA 1IYVA 1NLYA 5HCIA 1V1QA 4R2HA 1FQKA 1EESA 1PFSA 5HCNA 2GESA 3HKZG 1S2MA 2IC5A 1KDTA 3CF0A 4AWXA 5CB8A 1NY5A 1WXQA 4KXFB 4O25A 1MRSA 1MABB 2AK3A 4DSUA 1P9RA 1K5GA 1HNWL 1GHJA 3SU8A 3T5GA 2QTFA 4ACAA 2OCAA 1I94L 4NHOA 1NVWQ 4IOJA 3NELA 1KRTA 1MO4A 1N0UA 3PV0A 3CW2C 1E7ZA 1SVMA 2GBLA 3AF1A 1GL7A 3U58A 1G5PA 3L0PA 4TLBA 4A3BG 1DTSA 2VHTA 3AP1A 3QBTA 3TAUA 2JIZA 4DT1A 4ABYA 3HOXH 2V6IA 4HUQB 5G41A 2ZUCA 3IDQA 1VHLA 5IY0A 3AF0A 1G18A 4B75A 2WTUA 2WJVA 5LMNL 2UUAQ 5E4FA 1JAIA 2E9SA 1UF9A 2D3WA 1QJOA 1U98A 4TYQA 1R10A 1Z0FA 4DR6Q 2NO6A 3GFOA 4KFRA 4LJAA 1PH3A 1IN7A 1X6OA 2Y0SG 1V8QA 3PUVA 1QRAA 3K7UC 4TT3D 1CF4A 2NZ8A 4MRSA 1OB2A 4C0BA 2RGBA 5KO2A 3AYHB 3A6PC 1OF1A 1N2CE 1GVPA 4JBWA 4ZI3A 1B70B 1DO2A 2B7CA 2ZYTX 4AY2A 2K5VA 1DGSA 3M0EA 5C46F 1NNEA 3KKOA 1Z07A 1Z0DA 3VDYA 1BO6A 4X62L 1KAGA 4JVNA 4UXIA 4KLNA 1TL7C 5L3SB 2ECKA 1N6HA 3PUYA 2Q3FA 4HDCA 1XJCA 2MMCA 5HY6A 4AIIA 4DEYA 5BYJA 4PAMA 4I7ZC 4LJ4A 5FOWA 4XTCS 5F2EA 4HZUB 2O8BB 3PCOB 3G6EA 1D9XA 1IAQA 4YCWA 1M7BA 2DWOA 4L5RC 4JI5L 2IXEA 1Q86C 3AEZA 3KJEA 3QXSA 4FN5A 2ZRDA 4MITA 2OCPA 3E9IA 2F55A 1VQ4A 4NXNL 3A7AB 1NIPA 5DISB 2FE4A 2RGGA 4LBWA 2VQEL 1GL6A 1FOEB 2KBNA 1TQ4A 1RIFA 4Z1MD 2GAAA 2WJIA 1GO3E 1N9WA 4EJSC 4R71A 3AKDA 3C15C 1BYIA 3B1VA 2PMKA 5FBLB 1DOAA 3OPOA 4ARZA 4PFSA 3U3JA 2A30A 3K9LA 1O87A 1Q0UA 2O8DB 3TQYA 2QMHA 1QZXA 4EFLA 2QP3A 2QU8A 3QKRB 1TX4B 3K0AB 1LS1A 4PO1A 3QY0A 3RRNA 1EYGA 4DV5Q 4QJ5A 4LK2A 2OT3B 1NN3A 4TLAA 4GKJL 2WIBA 1Q8KA 2IWRA 5F9HA 4BY7H 4TVAB 1E9EA 2W0SA 1Z63A 1L1OA 1QHSA 5FPTA 1K83H 1DADA 3LNNA 3GLHB 3UDIA 1BBUA 2OUKA 3GFTA 3KOJA 4B6FA 1D2EA 4BFWA 2PZEA 3OAAD 4PHHA 1RRPA 1YU9A 3K0CA 4A3FG 3OE7A 4CF7A 4G5RA 1H95A 2ZRFA 1CLUA 2OSBA 5LPNA 3HPQA 2JCSA 2P2LA 1O7LA 4OI0A 1S3GA 4A8JC 1TPZA 2K75A 2VP4A 2FX3A 4EJSA 1E3PA 3ULJA 3FPPA 4HIOA 5A35A 2WWFA 3AUXA 4C0JA 4Q21A 5JS8A 4DHEA 5EE1A 2K7VA 3JVVA 4GFDA 4PC6A 1ZMXA 3T1HQ 3ZVRA 1VCIA 1S1MA 2FMXA 2QA4A 2ANBA 4HR7B 5DO9A 1LV7A 1CTQA 4UQOA 1NKTA 1XMQQ 1LFDB 4OK5A 4YHHL 1X3FA 2ODEA 2ID0A 2DGYA 4YQFA 1A4RA 1OIXA 1SXJC 3I72A 4LUOA 4MGYR 5SZHB 3IBYA 4JLOA 4BZXA 5FPSA 4F7WA 2R9VA 3GJ3A 1K8RA 4XSHA 2JLYA 3F8TA 2FSFA 5CYOA 2JA6H 3Q5EA 1FNNA 1Q90A 3G48A 3CXCA 4HJ7A 3K8AA 1KAWA 4YDSA 3BC1A 1E2PA 5GROA 4MYCA 5IYBH 1QHGA 1PUIA 4DNIA 4KN4C 1YRAA 2QSYA 4CGZA 2YU9H 3AVQA 4HDOB 1E22A 3RS2A 2IYVA 5DYIA 4ZCIA 4UP9A 5HGQA 1U2RA 1EK0A 1XPRA 3O8DA 2DB3A 3IKJA 2ZUDA 4D0LB 1UEBA 1AS3A 2GCNA 2WOJA 5DGXA 1XXHE 2R7ZG 1X8KA 2QQ0A 1VF7A 4GZMA 4KFSA 4GLVB 1SMXA 3CCLA 5C4XG 1BIFA 1XJQA 1R7RA 1C4OA 2CHGA 2K5UA 2OHFA 4LJYA 1CI3M 4E03A 4PZLA 1KHIA 1AQYA 3EZFA 5IP9H 1FTSA 3KQLA 2VUMG 1E0SA 1S3SA 1KJZA 2GBLC 4BA2I 4GI7A 4LGMA 4A2WA 2EJMA 2PCFB 1Z06A 2FN4A 3CZPA 3OF5A 3EIVA 2HJVA 5G40A 2DHRA 4DEXA 4RKEA 5JZVA 2WICA 3AEVA 3A58B 1EQQA 4B34A 1X8LA 3RABA 3SJBA 1G64A 1P9WA 4I99A 4NPHA 4A3JG 1OT3A 4BXXH 2RB4A 4RD3A 4K0KQ 3T51B 3WXMA 1PMRA 2CCJA 3BH0A 1S72A 2XXAA 4AYWA 1XTDA 2BCJQ 4UJ3A 3NDBB 2QG6A 4IJHA 1P2TA 4DK6C 4DCVA 4TL7A 1XMOL 1LS6A 4AD8A 3OW2A 2OM2A 3A1SA 3B13B 2O5JC 1YRBA 2A6HD 1MOZA 1ZM4A 4M4SA 3VA7A 1NMGA 2H8KA 3K7AH 5FR2A 2EWVA 2XNDD 1RPZA 5D3QA 4DKAC 1VG9B 5JWOA 3K0CC 1Q20A 1Y8NB 3QG1A 4NXML 1N5JA 4W7SA 2KSQA 3GLGB 4D80A 3D8BA 1Y1WH 3SJZA 1C0AA 4MKHA 2V6JA 3BBPA 3EZ6A 4KU4A 3I7FA 4DK3C 3M4QA 2JA5H 3IIKA 3THWA 3DHWC 1CU1A 3Q72A 4PQRA 5G3ZA 1HTWA 3SYLA 4XSGA 1WF3A 4I1OA 2XGJA 4GKJQ 2ONKA 2QGZA 1FQJA 1SVKA 3OEHD 4G0NA 4IQZA 1XD2A 3IRBA 1XU4A 4B33A 1J5EQ 4FMBB 2QY9A 3PSIA 1ETUA 4JSTA 1VQIA 2D62A 1G5RA 2YWFA 4I1UA 4RZXA 1XX6A 2DNEA 3JZMA 1RRFA 2PX3A 3ZQJA 1KQSA 4JKIA 1XTRA 5EAYA 4G5GA 4Q4AB 3SR0A 2K5NA 4HJAA 3N70A 3RS5A 2BMFA 1KDOA 3UG6A 4A6PA 4BLQA 5JEAH 4HIDA 4A3MG 1HY3A 1NVUQ 2F1RA 2O5VA 1KSHA 3I8SA 3QEOA 6Q21A 3GLFA 1G6PA 2Q9AA 4QGFA 1E9BA 3FHOA 1UKZA 4DSOA 4IOAA 2F1IA 1Y14B 1RE0A 2FOLA 2NG1A 1ZKOA 3B6EA 4JLKA 4BFUA 3A4NA 2ASEA 3FVQA 4XD7D 1MRNA 1T91A 1W2HA 2PCLA 1GVNB 2W83A 3ZGXA 3KKNA 1HZ9A 1VQFA 3C8UA 1DPFA 4JI4L 4A3IH 1X55A 5IYCH 4GNXB 4LUZA 1E2HA 4A3MH 2QF7A 1R0ZA 4B3CA 3PF5A 1K0RA 1OIWA 4OK6A 3PUXA 4H0LC 4QL3A 3SOPA 2PCJA 3TSWA 4D4KA 2B3GA 4WIAA 3M9BA 4DB2A 1I3QH 2C35B 2R6CA 1I6VC 1D8LA 3CUEF 1E0AA 3KJOA 5BW8A 1C9KA 2VRWA 3QKSB 2XSZD 2VHQA 1KXLA 4B73A 2ZEJA 2ZRCA 4Q4HB 1S3OA 4P75A 3GP8A 1VCNA 4KHZA 4KMUC 1QHIA 1W44A 4H13C 5D3MB 3GLGE 1WJJA 4B44A 1JAHA 4A3BH 1EX7A 2VLIA 4G5SA 1S9DA 4RD2A 4XOIA 2MO0A 1HQCA 1ZNWA 4A9AA 2QBYB 2FGKA 3ZD7A 1WBBA 4HJ5A 3NHBA 4H1UA 3REFA 5C4GB 5DNYB 4QKQA 1Y3AA 2ZJRA 3AV0B 4UNPA 1WBDA 3B8HA 1QUQB 1YJNA 1Y69U 3WBKA 4JI1Q 3QJYA 1E2GA 2GKSA 2HHHL 2A7QA 3R20A 3BERA 4EPRA 2GTPA 1D2MA 1E9FA 1LTLA 1VQ8A 2ZE6A 3OIVA 4G1UC 3B85A 1KY3A 2CWAA 1YJWA 3CPHA 2XGTA 4JBYA 4LC1A 3CNLA 1W0JA 1GRRA 2GILA 2WPDA 4RD0A 2X19A 3D7MA 1UEJA 3IO5A 1ZUNB 1TAGA 4PC2A 4FW9A 1G17A 2KCCA 2GCOA 1KSFX 1XEFA 1IBRA 2QM7A 5JLJA 2CE2X 3TRFA 5L3QA 1NP6A 2NZHA 2QGQA 1R8QA 5ELXA 4P72A 2JLUA 3RANA 2PEYA 1W47A 2HT6A 2A69C 1PLJA 4YY3Q 2WMOB 4YWLA 1E69A 5HE8A 1E2NA 3GJ7A 2QRZA 4YONB 3LLMA 1XMQL 1FUKA 2V54A 3DM3A 1X9NA 2HV8A 1LTQA 4CRWB 3LXRA 3NXSA 4A3LG 2O8CA 4D4JA 1FJGL 2FV8A 4PMWA 2QPTA 4DR5Q 1MO6A 1IOZA 3IGFA 2HF9A 1SVWA 2O8FA 1HT2E 1DAEA 4LCBA 4I81A 1U99A 3C5HA 4DV3L 3LV8A 2ZI5A 1A82A 2GVZC 1K8MA 2ODNA 4TN1A 1XPUA 4RZUA 3P26A 2BM0A 2FF7A 1EFUA 1N0WA 2C9YA 5DHFA 4NP6A 5EP4A 3ASZA 2PZFA 4NYMR 3S1AA 1FMLA 4B2IA 3K70C 3GTOH 4QJ3A 4G5QA 2ZREA 1IY0A 1RJ9A 2C78A 3IIMA 1OH5A 1WI5A 1VG1A 4LJ9A 2AHOA 4ZCMA 4QBHA 3X2SA 2FFBA 3U4QB 1WCV1 2XJ4A 2R6FA 2R7DA 2ZE5A 1IW7C 4YWMA 4Q9KA 3WNBA 2FA9A 2PPBC 3BZCA 1KJWA 2JQOA 4OWXB 2GEUA 3QBVA 4US0R 5DN6D 4HB2A 1UJ2A 1YZGA 4X8HA 2NMVA 1A62A 1EIFA 3MMPA 2KHJA 4HLUC 4BLRA 1MR3F 4PSKA 1MH1A 1VQGA 4LZZA 4Q9JA 3TVTA 1RIPA 3FYHA 1I4LD 3J81i 1T5LA 2VSOA 3HYRA 4C2UA 1MV5A 3M3YH 4R4IA 5M3MH 4RCYA 3W1BA 4UNNA 1A2BA 5CIQA 5FOXA 2GCOB 5EUMA 4B35A 4X8MA 4FI3C 4V02A 2GDJA 1SVIA 1P73A 4OONA 5KNCA 4A3CH 2XITA 3BE4A 4K0KL 1HT1E 2MNAA 2C77A 3AM1A 5BQ5A 3E0EA 4F93B 221PA 1PH5A 4JV5Q 2FFQA 2J45A 4OL0A 1X3GA 4IEIA 3MGCA 1IJEA 1YZUA 4DNRB 1E2VA 1HZCA 3S24A 4O2LA 4J0QA 4HAYA 4Q66C 3ZJYA 1ELOA 3CAMA 1Q46A 4Q9LA 4KHPQ 3HGBA 4JI3Q 1KSJA 2IEYA 3NIBA 2HYDA 4MYUA 1N34Q 1U9IC 4LW1A 2VYFA 2ZR0A 4Q4JB 1JT8A 3AVTA 2WFWA 3QXCA 4GNXC 3NKVA 4S2EA 1UWVA 4DR3Q 2IF0A 1E2LA 3KKQA 1II9A 5DSZA 4JIMA 4JS0A 2JLZA 1W3SA 1M7HA 2XX3A 3MD0A 1GKIA 1X86B 1D6JA 1UKVY 3A8KE 1GP2A 2HLDD 3EC1A 621PA 3QF4A 5LMUQ 2QTHA 2K50A 3DMDA 2R6GA 4BECA 4LV6A 3UIEA 3VNVA 1ZUHA 5KDLA 2ZYVX 1VQBA 2R6DA 5M3FG 2AWNA 4EPWA 4X65L 4Q9HA 4Q7KA 4A3EH 3GEIA 4OK3A 4V0KA 1KKLA 3JAMi 4P71A 1IN6A 1NBMA 4IJMA 4URWR 4A0FA 2ZR7A 2UU9L 4ZO4A 4TYYA 3OTOQ 4C2MH 1V9PA 4A3KH 1N0VC 1KK0A 4FMDF 2A6HC 1WCMG 5IP7H 4KVAA 4QBIA 3RAPR 3U5ZB 4CEJA 1W0JD 2YNMA 1BMFA 5M3FH 2E5LL 3OE7D 1S8FA 3W34A 1P2VA 1W48A 1N34L 5JEAG 2FH5B 2YWHA 2PI2A 4A75A 1VQ7A 3T1YL 3U50C 2UXDL 3A1VA 4W5WA 1XCGB 4DLRA 4QM6A 1PH4A 2AHOB 2V9PA 3IO3A 4LHYA 5JJLA 1AIPA 2REOA 3TE6A 1FMJA 2BJWA 2CJWA 3B78A 4WBSA 2OTJA 1PA6A 1W49A 3WP0A 2BMJA 3REGA 1HEIA 5FOUA 2W2TA 1H9JA 3HOUG 1ODFA 3A7LA 2ES2A 3C41J 3STBD 3H2YA 4R4QA 3GTQH 3PXGA 1XXHB 4RFSB 3MAAC 1ZM2A 3EG5A 5F9FA 4BBSH 2OQKA 4QGAA 5TDHA 4R4TA 1Y63A 2JJ2A 3TJZA 2VA8A 3NC0C 4JI7Q 3EPHA 3THXA 3MXUA 5DI3A 4LBYA 4LF5Q 1KMHB 1XNQQ 4BZPA 4L8JA 1OTCA 1U0HC 2V7QD 2FXQA 4RSGA 4AKEA 1B23P 4YMWA 4IPGA 1LF0A 5FTLA 2AXPA 3GJXC 4JL5A 3S1AB 5FJ8G 1KGDA 2ZUBA 4TSFA 5CK4A 2AD1A 3ZZUA 5LD2C 3U7FB 3K70B 5FFMA 1UKEA 3TKLA 3RSOA 1RZ3A 4LYFA 3EPLA 3I4MG 1KDPA 1E2KA 3O8CA 2WKPA 1E3MA 3J81k 3MJHA 2H18A 2BIFA 2VPPA 1GUTA 2CK3A 4IOCA 4LK1C 4OBEA 2FNAA 1PYBA 1FJGQ 3AQ4A 5BXQC 3S17H 3I4OA 1L0WA 2FZLA 1RFLA 5BN4A 1G4UR 4DUGA 4XTRA 5ELNA 3GMTA 3RHFA 2QN6A 4M9SA 4P4UA 1CKMA 1EFRD 1Y8PB 2VQFQ 3CCUA 2YOFA 5JEDA 3SI7A 4LFCL 2AUKA 1NVVQ 1Z83A 1ZU4A 5KUTA 3K9HA 3CH4B 4MGKR 2OWOA 3Q7PA 3A4LA 2JLWA 4C0AC 2QZ4A 1GG2A 4LJ8A 2C2HA 4B6EA 4ARZB 1SKYE 4DUYL 2AKWB 3KYHC 1M2OB 1Z6YA 2IK8A 2P0EA 3IIJA 3OIUA 4KV9A 1P7CA 4LF5L 1T3HA 2CE7A 5B64A 4LBVA 1WRBA 3LDAA 4OHWA 2V4DA 2JEAI 1QUQA 2ZJBA 1LVGA 3GO5A 3H86A 3GLIA 1E98A 4LBZA 4NCHA 3SYNA 2D2FA 2QORA 3T1OA 4BLPA 1XTSA 1YZNA 4Z8YA 2E5LQ 3R9WA 1FNMA 1N32L 1Z28A 4LUVA 3MEFA 3NEMA 2OTLA 2F3RA 3IHWA 3FFBA 4NYMQ 3AF2A 2WVJA 4ZPXA 3ECCA 2X1VA 2EJGC 5IWAQ 1VQCA 2QROA 2WJJA 1VQJA 5TARA 2HIXA 1U8YA 5LMNW 2PMDA 4DUGD 1PHJA 3DVLA 3TREA 4TMWA 3H0KA 3NBFA 1UAAA 4BLTA 5IP9G 2R65A 2NN6G 3AFQA 4BASA 2IL1A 3FP9A 3AFPA 4DV4Q 2OE2A 4GP7A 4B3ML 4C3HH 4G7ZC 5JHGB 3ADBA 4MYTA 3ZLJA 2OEPA 1AQUA 4ERNA 2L0XA 1VQEA 2RKOA 4PQFA 4BFXA 2CFMA 4FMCB 2GA8A 1KNQA 1W0KA 5EZ6B 2Q2UA 3TNFA 4I1SA 1SKQA 2DFNA 2YYZA 4RY2A 4GOKA 2Q3HA 2VSXA 3RLFA 1YHNA 2HCJB 2QE7D 3GTGH 2B29A 2J1LA 1NJFA 4HAXA 2WKQA 3A1WA 4KBGA 4M9XA 3PFIA 4ITRC 4MYHA 4AG6A 1EWQA 3J81c 3CCVA 5E7NA 2R93G 1ZU5A 5EE0A 4DV1L 4DR4L 1HYQA 3LRPA 3BH7A 3EW9A 3TEHB 2JA9A 1DAFA 1GRNA 3LFUA 2GEDA 5FOVA 1XPOA 1DEKA 4D82A 5E7IA 1KYIA 1G16A 2J87A 4OHXA 1N33L 2G0TA 1IY2A 4DLUA 3KFVA 1GFIA 1RL2A 4R4OA 4A3GG 2PH1A 1JQJC 3LH5A 3LLUA 3M6AA 3ZZ0A 4EFMA 2D2CC 4CYMA 4FWTA 3S15H 3QXJA 4P0TA 2V8OA 4FMCF 5J3BA 2AN9A 4P4TA 1GIAA 3H4MA 4WVFA 4A0RA 3LVQE 2ZE7A 1U5KA 4LPKA 5IHPA 1X6VA 3IPXA 3OIWA 2XOKD 4IVQA 3MUFA 2XXAB 4LRWA 2IUUA 4LJ7A 1DARA 2ZAMA 2PMZE 4QQBX 1G7TA 2PQAB 1TTTA 4ALPA 1GSIA 2OLKA 1AE3A 3AKEA 3UDGA 1TF5A 1YHBA 2IHBA 4TMZA 4B43A 5JCZA 1Z6GA 4L16A 4BY7G 3EWAA 2AK2A 2VY3A 1NLZA 1YKSA 4OJQA 4W5JA 4A82A 5DYGA 3PEWA 3T35A 2Z0SA 4Z8XA 1S0UA 4JVMA 2CNWA 4ILEA 4BFVA 4HI0E 1G1MA 2RGNC 1FVIA 3LA6A 4JBXA 4OXPA 1RVDA 4CEIA 4NZYA 3LXXA 4PAQA 4LUCA 2WJYA 3FHCB 5ANRB 3KF8B 1BMFD 3HFZB 4PC7A 3ICQB 3GJ8A 3RRYA 1UBFA 1Z8FA 3TZUA 3S1QH 4QRHA 4RZ3A 4WXPA 2GHIA 2REBA 5C0XJ 4DR7Q 1QVRA 1AS0A 2C04A 2JGNA 1ESMA 2QAGC 3F3YA 3UG7A 1Z2CA 4X8LA 3WHLA 3ER0A 4LV8B 1HNZL 2R92H 2HYIC 2G0NA 3FGNA 4A0HA 1GUAA 2ZM6Q 2BC9A 1D7QA 2BEKA 2BCGY 3CWZA 3QXXA 4PZZA 2ZYWX 3PIRA 5EZ5A 5C44G 1T8TA 1VKJA 1W2GA 2CK3D 3L8ZA 3K53A 5CYPA 4DSTA 3U6BA 2JLXA 2JE6I 4GMXA 4GT1A 4GPTA 2Q9CA 3OFNA 3UKDA 5HZKA 4C7OB 2KENA 4MTNA 1Z0JA 4Q00A 4RJLA 2ANCA 1OXUA 1NL3A 3TSOA 3A8IE 4F4JA 2C9OA 2IYXA 2ZS8A 4JLMA 3HOUH 2ODBA 3UK6A 1L8QA 3ETLA 4C0LA 4KLZA 3R7WB 2CHVA 1IXRC 3RN5A 1ZAKA 4IJLA 1KI8A 4BLOA 3T06B 4KKSA 4DV4L 2HIVA 4C0SA 5KSOA 4QXAA 4B3MQ 5CDFE 4LC0A 3K0FB 5FL7A 3ZVLA 3AVPA 4JLNA 2D7CA 1Q21A 4LJZC 3L2OB 2IBMA 1Q57A 2ZJZA 4LF6L 2J0VA 3RDPA 3GLHE 4PX9A 4Z54A 5E95A 2BKEA 3PJRA 2J7PA 4YY3L 4TMTA 3P20A 2I5LX 2JA7H 4MRRA 1E24A 4Q1AA 2J7KA 5EXPA 4IOKA 4IO9A 2CLCX 4NDZA 3AUYA 1NN5A 4IHQA 2ORWA 3ND8A 4GS3A 3PITA 4B74A 4OO1I 4TTRA 1XMJA 4BRWA 3UDFA 1JEEA 1G8PA 3T61A 2CLSA 5TB5A 4RMFA 2A3RA 3T34A 4JI2L 4C4PA 2G83A 3NENA 4DR2Q 2F3TA 4DR1L 2JEOA 4JI8L 5H1SE 3BFXA 3KUCA 1W1WA 4BFSA 2V1XA 1OH8A 4DV1Q 4DR4Q 1E1RD 4HLUA 3V9PA 3NEYA 4HAVA 4IFDJ 4JI1L 3RNUA 1II8A 1HZAA 1LNZA 1ZJ6A 4JKYA 1TQDA 2QEXA 1ZCBA 5FUWA 4O3MA 2O8FB 1KIXA 2AMCB 2UUCQ 1Z2AA 3T1QA 1F2TB 4RD1A 3HOYG 1O78A 2FZ4A 1FL9A 4NXNQ 2G88A 3WP1B 4RVCA 2ZJPA 3RZDH 4PTLA 3S14H 3HWSA 3M4OH 2UXCL 1YNJC 1FYCA 2QM8A 4JLAA 2P65A 3DOEA 1SXJE 2F1MA 3A5ZB 2O0HA 2F9MA 4A3CG 5SZJA 2GJ9A 2HEIA 1W46A 4HLQB 3I3SR 4HB3A 3S1RH 1HE1C 1XEXB 3QVVA 4B3XA 2ZSEA 5FI0B 1OHHD 2C98A 1YVDA 2WOOA 1NY4A 2GXAA 1H8HD 4DAMA 3RLNA 1JJVA 2DFKB 2CEAA 1W0KD 2Z6KA 3VR4A 5EE5B 1JPNA 4P73A 2I1VB 3AVXA 2LXJA 1DXMA 5JI3E 1ASZA 1G6OA 4BFYA 1HQMC 4HJ8A 1GWNA 4D26A 4JI0L 4IFDI 1XFAA 4EQ6B 4MGIR 2IX0A 5K36H 3HU1A 1FTNA 1P61B 2LWIA 3S16H 4C3ZA 1KO1A 1D2NA 1E96A 2ZJ8A 3ICEA 1TQ2A 3NVAA 4L5BA 2J5XA 1SFOH 2VF8A 2JA8H 1XF9A 2OO7A 2O8EA 4GNXA 3R9XA 1HNZQ 4BBRG 1NBWA 1Q81C 4MRNA 3UXMA 4B48A 1T8UA 1GJXA 1VDZA 2MQHA 1QZHA 1X1RA 2PX0A 3BRWD 3MCAA 1SXJB 1TQ6A 3KQNA 3DZ8A 4AYTA 2GK6A 4XD7A 3PIPA 1J2JA 3BB1A 5EXSA 4GOPA 3CF2A 5EP3A 3FE2A 3HU3A 4JI2Q 3KLRA 4C3JH 2JDIA 2ZRMA 2XTIA 4D0GA 2N8NA 1WMSA 2AKYA 4GMDA 4AK9A 1E1TA 1VS0A 1NY6A 1SXJD 4IPCA 4RD6A 2ZJQA 4V0OA 4O2DA 4URXR 5CLQA 1W36C 3RC3A 1E1RA 1Q3TA 1SQ5A 5E3HA 1CKEA 4BWYA 1H65A 1J6QA 4L15A 4LPSA 2EQSA 4GOPC 1K6MA 4HYYA 4DLZA 2ZE8A 4K46A 4MDFA 2NZOA 4D81A 1TKWB 2A19A 1M6NA 3VX3A 4QNRA 3CC7A 4UKDA 4G7OC 2OXCA 4EX5A 1ZM7A 3UATA 2F4VQ 1DBSA 3MWKA 4H44C 2FG5A 2UKDA 3EASA 1VPLA 3G82C 3FMFA 3HP1A 4JLDA 2VL6A 4PZ7A 4JBKA 1L1OB 2AKAB 5FI1B 3ZS9A 3X1DA 5J4KA 1RYHA 4D2IA 2IYYA 2XTMA 4KFTA 1XMOQ 5BN3A 4Q1DA 4JI6Q 1YR8A 2XZLA 4PANA 1AZTA 1I6HH 4DK1A 1R5NA 3IUYA 2Q9BA 3SNHA 1TWAH 4GL2A 1Z0KA 2W58A 4FMDB 2WMNB 4S35A 4B2PA 3BD9A 4EIWA 2BWJA 4U02A 1KI6B 3CB4A 1SN8A 3IBGA 4JVLA 4M1KA 1UADA 5AUPB 1DAGA 3TW4A 5C2JB 5K8UA 1U0JA 4LF4L 4MQBA 3AGPA 4HDQB 2E74C 3Q8DA 4O2RA 3SEAA 3DEFA 1IZ6A 3QXHA 1B9NA 1ZYRC 4PC3A 1OH7A 2ZPTX 2C8VA 5EP1A 3CCJA 4Q1EA 1MIUA 1S1CA 5H1YA 1E4VA 1EFRA 4BEJA 3CLVA 3GTJH 1XP8A 4MNOA 4MH0R 2O8BA 1RRGA 4DB4A 1KC8C 3BXZA 4WZBE 2ZJYA 3RS3A 3UE0A 4QNMA 5FUXA 3HU2A 2NQ2C 3W6PA 3RN2A 1XNRQ 1J8YF 4Q01A 2WWGA 1Z29A 3I55A 4A93G 1EFTA 5IE8A 3N5CA 4NTZA 3LBHA 1AJEA 1KO8A 1VYTA 4Z1MA 2RF4A 4IOLA 4G5OA 2C03A 2KBFA 3F1ZA 1TEXA 4LF7L 2ZTSA 4TSFD 5DI3B 2W00A 1VQHA 3T1HL 2ATVA 3BOSA 3X1XA 1T9HA 3S1MH 2BEJA 5KU1A 1NMZA 3LO5A 3VTKA 2GVBA 1VG8A 3EPKA 4LJ5A 4GLAC 3SJCA 3GLHA 1C9OA 1LF5A 3LW8A 1II8B 4IDHA 3AH8A 2RCNA 3I4MH 2RGEA 3P27A 2HCBA 3U2QA 3FKSD 3FMPB 3VHXA 3I32A 1GNRA 4TL9A 4YXWD 1V43A 4KVGA 4UP8A 4PSAA 1FX0B 3BZKA 4BFZA 1N6IA 5DE3A 1PJRA 721PA 3V4RA 1GHKA 1BYUA 1IM2A 2X2FA 2ZVQX 3FTQA 4YDHB 2GJKA 2JJ8A 3ULPA 4JK1C 1FR3A 4EPYA 3J7ZC 5GADC 5GAHC 3GTKH 4FD2A 4LX0A 2ZRGA 5B57C 4URYR 5LB2A 3QENA 2JDID 4TYWA 1Z9FA 1E2EA 2BA0A 2JJ1A 2O52A 1HV8A 3WMGA 3BIFA 2OESA 2UUCL 1E2ZA 4DLYA 3T5DA 4BZQA 3NEJA 1FL0A 5B2ZA 1QG4A 2J0QA 3LW7A 5AJ3L 1OYYA 1DCZA 5M3MG 1JQLB 4LHWA 4P4SA 1OFUX 1WQ1R 3N2EA 3H0GH 5H8WA 3PR1A 5HPYB 4DPGA 1ZW6A 1IBKQ 3WDNA 3K0SA 4F38A 1UKYA 3FWYA 3Q7QA 4Q1CA 5J40A 5K8LA 3ADCA 4DAYB 1DG1G 4M8NE 5FTNA 3KXKA 3TLXA 3LWUA 4WJ3M 1GKYA 3WHKA 1J7KA 2V1UA 3A37A 3CRKC 2Z0MA 4DIDA 3X1ZA 3UDXA 1VIYA 4R2IA 4PQYA 4BLSA 1NJGA 1QHHA 1ZD8A 421PA 3B2EA 1PH6A 1R0WA 3V4FA 4ASUA 1CUKA 1SROA 4H9GA 4NYJQ 1N25A 1ZINA 2NTYC 2ZIAA 1G8GA 3VR5A 4A2QA 1CJVC 2DYKA 3E1SA 1X3EA 3OAAA 5KNDA 2BKUA 2VS1A 3L2PA 2DWPA 4KCGA 1KO4A 3BFKA 2K5HA 2GXSA 3SFZA 4XIGS 3KQKA 4LFBQ 1YHAA 4PR0A 3TRZA 3CRRA 3T56B 5GJWC 1OSNA 5C0XG 3WYAA 2V1CC 3SGIA 1IONA 1KHTA 1YNNC 1OXSC 3IFTA 4MZ9A 1COWA 2DCUA 2PEZA 2CVHA 1IHUA 2RH5A 1L2FA 2VHJA 2WSMA 1P8LA 4I4LA 1E9RA 4L4UA 5TVKA 3BK7A 5ELOA 3IHLA 3KB2A 3TBKA 4FDBA 2R93H 2WB1E 1TUIA 2SHKA 4GN5A 3NBYC 3OHMA 3VHLB 4CDGA 4DCSA 1YVCA 1E94E 2GRJA 5AR1A 2IEZA 1SVOA 4NU0A 4R9UC 2VP2A 4UNSA 2VL7A 4POAA 4BE7B 4XH9B 1HH4A 3FKSA 3KDFB 2O0JA 3BGWA 4XWOA 3HR8A 3A5UA 5CLLA 1CKNA 1TWCH 2Z4SA 2E75C 3W90A 4GKKQ 5G53C 4D4LA 5JHHB 2MO1A 2XZPA 3C5CA 1YZKA 1J99A 1ZM3A 4NE2A 2QPOA 3A36A 3WWVA 4URUR 4EFNA 5LBIA 1CIPA 1HCZA 1Q12A 2H5XA 2B63H 3R8FA 3PUWA 2YTXA 4B76A 5DI9A 4JLVA 2ALYB 4LFCQ 3R7WA 3VMFA 3ZH9B 2PQAA 1MJEA 3HR7A 3ZYCA 2VP0A 2QTVB 1WP9A 1EQRA 3AKYA 4P33A 3TIFA 5HE9A 3I56A 2Y8EA 1C7YA 3QE0A 1XNQL 2FPKA 1CS4C 4IKEA 2ZJ5A 4N1AA 4TLDA 4B71A 5AJWA 2B8TA 3CWQA 1NI3A 1T5IA 1Z22A 1VQ5A 3PCRB 3Q8XB 1ZCAA 4US1R 1VQNA 1R4AA 4Q5IA 1JE5A 3UANA 1I2DA 1KZ7B 1QHXA 3BB3A 4RKFA 2GJSA 3Q85A 1JBKA 4POGA 5HTKA 3GLGA 4KLKA 3WMEA 5EE3A 3I61A 5DN6A 3EIEA 5AJYA 3ZS8A 3AKCA 2OAP1 5LDDC 1RKBA 2ZR9A 4LFAQ 2R44A 4AG5A 3U44B 3DM9B 3EPJA 1VQDA 3F2DA 4M1SA 2QP4A 1PH8A 3KFXA 1M90C 2UXBQ 1JR3D 3B1YA 4OYHA 2TMKA 2CW0C 2QRNA 1TADA 1YZLA 2V55B 5H68A 4CEIB 3DO6A 1X56A 1N6PA 2PLFA 2PNRC 1L2TA 2F7SA 1N5KA 2VP9A 3K09C 2EIFA 1G19A 3U7EB 1GUOA 2XB4A 3CZQA 3SBDA 3GD7A 2Q0HA 1Q1BA 3BS4A 4OQFA 1TU2B 1N33Q 3NWJA 4TMVA 2O8CB 2MSDB 1KY2A 2I1QA 4IFEA 2ZI4A 2NO1A 1O3YA 2E87A 2F6RA 3EA0A 5KTYA 1CRPA 1U0LA 3DOFA 4W9MC 4DR3L 2AWOA 4H02A 4L5SA 2P5SA 3D31A 1K73C 1Y1VH 1G41A 4NPSA 1E99A 1IBKL 3RRZA 4XWKA 2H7VA 2FEMA 2FFHA 3KF6A 3CCMA 3VKGA 5GADl 3CRVA 2CXXA 4G01B 2UZ3A 5CJPA 2J0SA 3QF7A 5M5YH 2JXMB 2YTYA 2WSSD 2F43B 1AA9A 1OFTA 1U9IA 4CT4B 5AUOB 2REXB 2GJAA 4GOJA 1OXVA 3HOZH 2WJGA 2H57A 2VO1A 3E9HA 4UXHA 3BU2A 4MKIA 5FPYA 4X66Q 1OIVA 2Q3MA 1EFCA 3PO3H 1V5WA 1VCOA 2ZI9A 3W8NA 5GVSA 2QAJA 2AUJD 3CRLC 1QVCA 1TWGH 2QENA 1GKHA 2GF9A 3NHAA 3THYB 3OESA 4JI3L 1EXMA 4Z51A 1KTVA 1DAMA 3W5JA 4E22A 3THWB 2OQ0A 4A8JA 3H3VI 1EG7A 1QG2A 4HLDA 2ZU6A 1TXYA 2BOVA 2EFHB 2CL7X 4ASUD 4LY6A 3BDOA 1KI6A 3EX7C 1TMKA 2WWXA 2BH2A 1HQYE 1SE8A 4TL6A 2VHCA 3DPUA 3GJ0A 3LX8A 4GSYA 4BFTA 4K8OA 2K52A 2OCEA 4CZ2A 4MKGA 1OH6A 2B7BA 2ZRBA 1SVLA 3CX8A 5IF9A 3S1NH 4MRPA 2RHQB 4DDUA 1SKYB 1P2SA 4YCVA 2GF0A 5KOYA 2XB2A 1VYVA 2IWHA 3SN6A 3F0TA 4YHHQ 3ADDA 5DLQE 4DUZQ 1Y1WG 5LD2B 4QGUA 3VX4A 2ZRPA 3EZ2A 3U7GA 1P3JA 4N0EA 3FKIG 1NG1A 5A4JA 2A69D 1X1SA 4LJ6A 2JJ1D 5FL3A 2WM9B 4DV0L 5IK2A 4B3DA 1IJFA 1EX6A 2WIAA 3J80c 3I4LA 5J4LA 2XZOA 2DY1A 1M34E 3H84A 2ZROA 2ZM6L 1YE8A 2UZIR 3J7A5 2LKCA 4RG1A 4MDEA 1IN8A 2IS6A 1OB5A 1S96A 4GBMA 3WYFA 1L4UA 3B6YA 2IYLD 1PH7A 1AGRA 4GKKL 1NMXA 3AB3A 3TGPA 3CCRA 5DLQC 1XEWY 3ADKA 3EA5A 5CJ2A 4QY7A 3TQFA 1JJ7A 4PZ8A 3PVSA 4AKHA 4DCNA 1G7RA 1XZQA 3SYKA 4NCKA 1GL9B 3ZIAA 3CBQA 4DV2L 1JI0A 1AM4D 1JXOA 4IEEA 4D6PA 1QHNA 3QOFA 5AJXA 1HR0L 3QEJA 4F91B 4M0LA 1DAHA 1G5TA 1I4TD 4NKRA 1M8PA 1Z0IA 5AWFC 4C7OA 4LWCA 1SGWA 2A6ED 3D6TB 1P72A 3LQRA 4LF9L 2R8RA 2VHUA 4DR1Q 2FPMA 1SRUA 4JJZA 2W2VA 5C44H 1G9XA 5C4XH 4LF8Q 4X64L 1KRSA 3D4RA 1YJ9A 3ASYA 3F5FA 5KYKA 1H9RA 3NTUA 2F1HA 2WBLC 2BDOA 4HJ9A 1IXZA 3QKRA 4TZ0A 2JLVA 1HNXQ 5GJBA 2ZI3A 3B9QA 4JVSB 2QAGA 2VP6A 4EKDA 2VNUD 4TYNA 3W3AA 1KDRA 1Z0AA 3SBEA 4M53A 1M7GA 3EBEA 4JI5Q 2A8VA 1ONBA 2NOAA 2VIIA 2ZM5A 2I5MX 4BY1G 4B3TQ 2KBEA 2WHXA 1X3SA 4V0LA 5AK0A 1GZSA 4F4IA 4DCTA 1PYSB 4G7HC 4MKFA 2ZSFA 1Q82C 3CCQA 5IT5A 1I5FA 3LGJA 3K0XA 2IHEA 2K4KA 4EQ5A 1J70A 3CW2A 4TTQA 4DBLC 2YTVA 3KKMA 2RGAA 1HH2P 2J0UA 2F43A 1ASYA 1LACA 3PGZA 2AD5A 1HR0W 4DV2Q 1IN4A 1E2WA 1F2TA 2ZYUX 1A63A 1NBME 4BY1H 3IQXA 1RC8A 4P32A 5C0XI 2E1RA 4DV5L 3RWMB 4X66L 2DWQA 3C4JA 5E7JA 4QHTA 2B8GA 2OV2A 4KKUA 1N36L 2NPFA 1GITA 1Z3IX 3I92A 2D2EA 3MWYW 3L0OA 5EQTA 5J47A 2YHSA 4A2PA 3GQBA 5KDOA 3CRMA 4Q4LA 3TVDA 3BB4A 2R7ZH 3CRW1 3KXLA 1HJPA 3VQTA 3GLIE 2KA7A 5AUNB 4LV5B 3K81C 4KYIB 1G3IA 1MABA 1XTQA 2ZSAA 4EPXA 2O8DA 2NVXH 5C3EG 1QBKC 4I1VA 2ATWA 1UE5A 2YC2C 5HZHA 2E2IH 1LB1B 3RRMA 4IVRA 5AJVB 5TY0A 1NBMD 1KK3A 1MO3A 1N5LA 2B8WA 2OCYC 3R9IA 3I5YA 4Q02A 1TEVA 4LHXA 3R8CA 3CP0A 3CR7A 2CDNA 4IDPA 5C1BA 2BDTA 3IEUA 4DLSA 5JBQA 1UE1A 2BE5C 1CR2A 3PUZA 3CIOA 4JI6L 4AKGA 1II0A 2PZGA 3B1XA 4YCUA 1VQLA 4HB4A 3T1TA 3TW8B 1D8TA 3S2HH 2F1JA 3K80C 3VR3A 3AGQA 4LHZA 4YC7A 5JMTA 1YR7A 1W7AA 2D7DA 5EXTA 4O0AA 4DV6L 4IPHA 2H92A 4KHPL 1NTGA 1IY1A 4MRVA 4QHSA 4MUAA 1S4QA 2IS1A 4WOPA 3AVUA 4LF8L 1T3LA 2QMOA 5BWMA 2FGJA 3ZQ6A 2NVYH 4ZV4A 2ZRAA 1FW6A 1FPMA 4RCNA 2P67A 2AFHE 3SE0A 4J15A 1N36Q 3EARA 5KSPA 5BYKA 5JI2E 1ZIOA 5JS7A 3A74A 3PEUA 1SLJA 4BA1I 3NBZC 4CEHA 3TUZC 2ATXA 1E9SA 3ND9A 3QSYA 3PQCA 1GUGA 5JSZA 2WZQA 5LMNQ 2C96A 3LD9A 3AF4A 4NBSA 3M85A 1X54A 2KJQA 2N42A 1A8VA 2Z83A 4PHTA 5E7MA 4OJKA 3RSLA 3AVOA 3UWKA 5FBWB 4PV1C 4P31A 1P75A 3DLLA 2K32A 2L5TA 3VNUA 3W9YA 4Q47A 4M1YA 2RGXA 2QNRA 1KNXA 4QBGB 3K70D 1ZD1A 2BHRA 3W5OA 2W2XA 4FCTA 5GAEC 3HOYH 3TK1A 5B30A 4HB0A 4A4DA 2IF2A 4DDVA 4URZR 3LNCA 4DT1B 3NDPA 2HHHQ 3ZVMA 1EWRA 1HTPA 1XTKA 1IXRA 1Q1EA 5FTJA 4PPFA 4HZIA 1PLLA 4JYAQ 3L0SA 3QPUA 5FOTA 1T0HB 2IA5A 3G4SA 2ZETA 1DE0A 1M1KC 4L8GA 2BMDA 2ZRKA 5FPHA 3U3KA 2PJRA 1GILA 3U3MA 4CT5A 3K09A 4M2LA 4LYJA 3HOZG 1KK2A 4MGZR 4N3NA 2Y0SE 4MA4A 1H9SA 4R1JA 4LF9Q 3K0FA 1PLKA 5CIWA 2ZS7A 3RS7A 1AZSC 3H3VH 2KB0A 3RC8A 3OOCA 4L9WA 3THOA 2HJGA 1E2DA 4EDHA 1OW3B 3B9PA 5KPJA 1HA3A 4U7DA 4XVUA 3CO5A 2QAGB 2KCMA 2H5EA 4JC0A 1G20E 2AFIE 5C4MA 3M7NA 4YWKA 4DUYQ 3GTPH 121PA 4OI1A 1OPXA 1GAJA 2OFXA 3CPFA 5HKKA 1Y1VG 2IHFA 1E1OA 4Q1BA 5JJIA 1B0UA 1WCMH 1CR4A 5IP7G 4A1FA 1BKBA 1LABA 4JL6A 2BBWA 1N5IA 4EPVA 4KN7C 8OHMA 3H94A 4DIEA 2IY5B 3MRSA 5DIFA 3HOWH 1EWIA 2OCBA 2V7QA 2WAYA 5JWRA 2EFDB 2NO0A 4KSBA 2JJQA 1U81A 4UP7A 4KSCA 2N46A 3EIHA 1FGUA 1KMQA 3RS4A 1E79D 1U90A 3A8TA 3MXNB 2BH8A 4L5TA 4DR5L 1E0KA 2D74A 2EW1A 1TUEA 2G77B 3PO2G 3DXJC 1K5DA 2JJ2D 2OBLA 4JG2A 1G8FA 4PPQA 2R2AA 4HIMA 3EQLC 1I2MA 2J3EA 4TT3A 4NCNA 2PLRA 3QG5A 3AQQA 4BBSG 1NN1A 2Q6TA 521PA 3TAHA 3BWDD 1TWFH 4Y52H 1A2KC 2CMKA 1N3BA 2FSIA 3E5HA 3DKVA 1F2UA 3DMNA 4DLVA 1SVSA 1XXHA 4RFSA 3RLOA 2JEBI 1K8OA 2JLQA 4NCJA 5IK2D 1B8AA 2WAQE 1US8B 1YR6A 3AVWA 2QMEA 1NSFA 2HDNB 3KJHA 1DG3A 4JLBA 3Q5DA 1W4RA 4TLCA 4BEBA 3UMRA 2A5YB 1VQKA 1P62B 3CX7A 1CTMA 2JA6G 3QKUA 5JSZB 1PV4A 5GJCA 3KTAA 1AKEA 1OKKA 2EU8A 4AQYQ 3Q9LA 4WW0A 1UBCA 1Z6TA 3SC3A 1AKYA 5AJZA 1XNRL 2NN6H 1YHQA 1TU4A 2QT1A 5C4JH 1XTJA 1HURA 3CF6R 2JA1A 2QUZA 1B7YB 3GCGA 4IXNA 1IBML 5KDDA 2GAOA 3F2CA 2WSSA 2GN5A 1JB1A 2AX4A 4IOMA 3TH5A 4ZIRA 5IRCD 1GNQA 4A4IA 2EVWX 2NPIA 3W3ZB 5IYBG 1YI2A 1U8AA 3I1FA 4HZUA 4GNKA 4IW3B 2ZRJA 1G7CA 4MUBA 2VBCA 1AH9A 5TXGA 1X8JA 1G3QA 2Q21A 3FB4A 4ZI2A 2J41A 1R5BA 5CK5A 1P9NA 3KX2A 2A68D 1I50H 2YWEA 2IUTA 3L8YA 1Q22A 2LMCB 1XEWX 2ONJA 1P2UA 3KDFA 2ZITA 2D06A 4ZDJA 4PG3A 1MJCA 1G8YA 4Q7JB 3G5UA 2UVQA 5IYCG 4A3IG 3PF4A 1MT0A 4LF7Q 4UJ5A
chains in the Genus database with same CATH superfamily
3UCXA 1VL1A 2EG5A 1JLLB 3N6RA 1KIAA 4D8UA 1AQJA 3JPYA 3TIXB 1QQ7A 3D4WA 5KWEA 1F8XA 3I8XA 3UMSA 1FDUA 1DMSA 4DBZA 4OSPA 4E07A 1EY7A 1NOIA 2V7EA 5CV7A 4Y6RA 5ILGA 4TXNA 1Y9DA 2XUHA 2GHQA 4FXPA 4N0PA 4RGBA 4UM9B 3HU5A 1XOIA 2OD2A 2VNHA 1FP4A 1F48A 2I6TA 2YCBA 3KVYA 5CXSA 3U49A 3H99A 1KTKA 1ZC4A 4QTXA 2PUBA 4WY2A 1HFKA 4YPVA 1XMIA 3ZOZA 5BSEA 2R92G 2X3YA 3GLRA 4Q1FA 2QG4A 3JY6A 1F7UA 4KODA 1EFDN 2J9RA 3NNSA 5CFPA 2MYPA 4XR4A 4J0FA 4LF4Q 3VXKA 3NWPA 3LX6A 4CCYA 3LX5A 3HYSA 2KYRA 2XSZA 4FTWA 1NVXQ 1VJ1A 1Q1GA 1V7ZA 2VZLA 4FX5A 3CWCA 4WKGA 4ZIRB 3BSYA 1EAMA 1TF7A 4YTEA 3HVRA 1W36B 4EHJA 1WW2A 4CL2A 1JQYD 4YMUA 2BI8A 3S7ZA 1KJIA 1JDTA 2IUSA 1FZQA 1COZA 4RTPA 2WFAA 4CF6A 3SQLA 1PDWA 3TSCA 1W2BA 3U7JA 2CJWB 4AJ2A 1Q0PA 2DPXA 2QCPX 1TWCB 4WLUA 3CVVA 1VSBA 5LQAA 4MTKA 1YQTA 4YRTA 4A76A 4Q7LA 3G0GA 2IELA 3UKJA 1ZSVA 4AKIA 1SYEA 4A3EG 1L7BA 2OGUA 1SBIA 1JIIA 2XWBF 4X9XA 1QV7A 4LFAL 2WZCA 4OGGA 2ZI6A 2LTAA 5ICGA 5BSUA 1YFKA 2V6MA 1DQZA 2H2IA 3ONVA 3T15A 5CA1F 4NYIR 1N7GA 3ICCA 3KK7A 3L8HA 1BUVT 1HLFA 3P9YA 4AICA 4AI6A 2I0QA 2HWWA 3JQ8A 2AE1A 3IQWA 1N8RC 4AXBA 4BP3A 4OQMA 3PMFA 2N3SA 2V3VA 3WRYA 5L7YA 2TSSA 3RSHA 3F73A 1EEHA 1PZNA 2GLXA 2AX3A 4H1HA 3U4ZA 5EJ6A 1XDGA 4O3FA 3PC8A 5A4KA 2HRDA 4RWSC 3U9SA 1N6KA 5IODA 2QW7A 3AOGA 1XZDA 3T4AC 2ZTUA 3FDTA 1KMIY 4XB6B 1NQTA 3HKDB 5ECWA 3I4NH 1TNDA 5EJ9A 1WXXA 2B1JA 2FU5C 3OEED 4PAWA 1SZCA 4ZT5A 4LSGA 4X61A 4YUYA 1B2TA 3VKHA 1H0KA 2I66A 2JFYA 1H2BA 3BH6A 1CXZA 1VOTA 1C8VB 1II3A 4OAOA 5A7HA 4WCDA 4UTRA 2YVUA 3T1YQ 3KWMA 2CFCA 3LPDA 3MK31 4BNYA 4BN5A 4D8TA 1T5DX 2P8JA 2BM8A 2VLBA 3NG1A 2DFTA 2VNAA 3DW3X 4PHCA 1KZGB 4L8YA 4WINA 3GZJA 3B9BA 2OHIA 3MJVA 4PHGA 4UBMA 4RHUA 4TMYA 5CV5A 3RS9A 3MFYA 1H1DA 1NFFA 4GYKA 1T4MA 2B2NA 4IIXA 2C7BA 5JVH3 2BFEA 2Y3IA 3PD0A 4RKQA 4R7TA 4RGYA 4YO7A 1KLUD 1MHWC 4KAAA 3WQQA 2O2YA 1YZTA 1VFNA 3H1TA 4TWZA 4JP5A 5IYDH 1HA6A 2CYCA 2IEAA 2X8JA 2PVSA 2WHPB 1MAVA 1JKXA 5F12A 3BICA 2FW8A 4AF7A 4NMLA 2L19A 3TUIC 4ML3A 4MAFA 3LDHA 3QNUA 4MI1A 4ZDKA 1PGOA 1LLQA 3LOPA 1GR1A 1S5CD 3FGZA 4ZI7A 2ZJ2A 4AZTA 2ZQ5A 2Z56A 5SV2A 3D8HA 1PAUA 3G7UA 4M0EA 2N1MA 3GVHA 4DAVA 4Y18A 3U3OA 2FW6A 3VJRA 4OD0A 3THYA 2HPAA 3PC7A 3EZ7A 2A5GA 3VZRA 4I6GA 4R7ZA 4I14A 3TSSA 3L7ZC 3MB8A 4UCFA 5EPOA 4JGBA 2A78A 4ALMA 1KO5A 4A3MB 3M3YB 5DNVA 1QC5B 4CHTA 1JEJA 2QBYA 2IP1A 4S2UA 2GZ3A 4V0MA 2AQ8A 5F1PA 4NB3A 1KO7A 5B1HA 1P16A 4RVOA 1R4NB 1EFPA 1ML3A 2GH1A 2NAFA 2X76A 2ZVPX 4RA9A 4FQ7A 1TK3A 4DMKA 1AOXA 1V1JA 3P2EA 5DBOA 1J06A 2Q41A 4GZLA 4ZQBA 1LK5A 3COVA 1L1QA 3V2HA 5IM4A 1K7XB 1Q0QA 2OBMA 1PW7A 2OOSA 3M1LA 2O1EA 2FR8C 2VFAA 3C3CA 3VSCA 2X41A 1Q6ZA 2B2TC 3GHHA 3QLUA 4K8RB 1E59A 2DR3A 3DDZX 3EBLA 3EQZA 4QRDA 5KAPA 4A0GA 5JNUA 3AOEC 4F4JA 1EWCA 3NHLA 1W34A 1PZJD 1VCMA 4L0QA 2NSHA 1FP6A 1WA5A 4A3DH 2P3OA 2PBRA 3DHNA 3HUUA 1GADO 4KJNA 3C14C 4MV4A 4YDQA 1DS6A 1YQEA 3LK7A 4CIDA 2G80A 2H4OA 3HY6A 3HM2A 3ZVNA 1Z7TA 3A31A 4ZDWA 5CVEA 3CLRD 8AT1A 4UUPA 1SC9A 1JTFA 5HVNA 3FM9A 1HOTA 2ZWIA 1ZI6A 3L84A 2EYQA 4TRRA 3UQYS 3EGXB 3BJUA 3DL2A 2GPBA 4X62Q 5EJWA 1CULC 1R5OA 2HF8A 3IIEA 2XCSB 4KAXA 5TMPA 3DNFA 4X65B 2XOEA 1UANA 4OO3A 2IS2A 3HVUA 4JHLA 3GDEA 2GWHA 4ND5A 3SVLA 1P29A 4BO3A 3DD1A 3GC6A 4A3LH 4Q4AA 1U1IA 2PT5A 2YXLA 2HMVA 5EIFA 1BRMA 5F2DA 2A0XA 2EAUA 2WAQG 1DXQA 4LKRA 4RULA 2YJNA 4JASB 5TMBA 1UAYA 1UC8A 4EG5A 5IAKA 1QYCA 3QLTA 2DSTA 1E32A 3DJFA 4DDMA 4R8MA 3T41A 3C6YA 4B2YA 2OZPA 2XVAA 4B3RQ 2Z6VA 1ZD4A 4G0ZA 1T2EA 1QIFA 4HXYA 2MFIA 2A4MA 2H48A 3R5FA 3VH1A 2I5HA 4CG2A 4KD4A 3DMTC 3L1KA 4HCJA 1ESNA 1VJRA 4JNCA 3EZNA 4QXQA 3BA1A 3ETHA 4A36A 2EX1A 2PI2E 4NU5A 4RV9A 1PVVA 1QHEA 3AB9A 3HNRA 2M00A 3L43A 4PZEA 4IX9A 4E7PA 1FB5A 4QZVA 5JWHA 2JI4A 4IDOA 5KSYA 1HRKA 2DEUA 2B20A 3K2IA 1VBMA 4H60A 2RHJA 1L5HA 2N78A 2R8YA 3AP2A 3M1IA 1RJ9B 1SR8A 5IEJA 1BWRA 4MQEA 4EI7A 3RRFA 2B69A 1XP5A 4P08A 2B4QA 1NJIC 4FINA 4U63A 4X1OA 3OURA 4HDRA 2IXGA 3LKBA 4NICA 3AYXB 5FUVA 4ETMA 4L5QA 1TUBB 3AILA 4WFN3 3BDCA 3WO1A 4IZ8A 2JA7G 1BKDR 1CUIA 1OAOA 2M32A 2Z8YM 4QQKA 1U1FA 4RHTA 3SLGA 3TDKA 3VFDA 3RC7A 2JGMA 1JVBA 5ELEA 2ZT9C 1OTYA 1KMNA 1Y1PA 2DUJA 2R00A 1OGYA 3DDWA 2LCQA 1RCUA 4OI2A 1U7TA 3C4QA 4R3WA 4RMGA 3WAGA 3K9CA 3C1OA 4ESEA 1VKHA 4KXMA 1I0ZA 5LL6P 3I5AA 3L7DA 2IYWA 1CHNA 1C4QA 3MTSA 4NABA 2RONA 4W5HA 3SYTA 3U4DA 5CXQA 4PQXA 1XJVA 1M0WA 2D0PB 2PVCA 3KJIA 5EOVA 1I0LA 1F3LA 1ECLA 1T9BA 1SYGA 5LLTA 3NQ41 4GPAA 1MIOA 3FI0A 1LSOA 3HA7A 4X45A 2IYTA 4H6PA 4NULA 2BMEA 4BKOA 1E4OA 1H8EA 1T43A 2DQKA 2A67A 3F5QA 4TL8A 3CTPA 4ZAXA 1T9ZA 2NTVA 2PX8A 3K4PA 1U2EA 5C3EB 3KKPA 3PSAA 4QE3A 3VZBA 4DABA 3J7TA 2GI4A 2ZVJA 2JI6A 3FCEA 3BWXA 1Z47A 2C42A 3EOBI 4DRZA 2QLLA 2ZCVA 1JHVA 1S40A 1C9NA 1V7PC 2GN0A 4H7FA 4JDPA 4KIJA 3C2PA 1G5FA 2DPMA 3B6MA 4JI2B 4RSRA 3DDNA 1I4QA 1GPWB 1W9MA 2JGFA 4DZZA 1SULA 2R6JA 4HR7A 3OU7A 4P92A 3V46A 4YT2A 2LS01 2BKAA 3NJRA 3A6HA 1JA1A 1X1AA 4WESB 5DYNA 4KO4S 2IPKD 3SE7A 2RSNA 4TV8F 3WK5A 2K04A 4YXWA 5AKHA 5ALNA 4EYGA 2P9EA 4O8CA 3S2EA 3UC9A 3UQZA 2XCRB 1Z6HA 1J90A 5AHXA 5A71A 2Z3WA 1P4SA 4KBFA 1DC5A 2A0UA 1MAHA 1UOQA 3GRKA 4L5CA 4F5WA 1W59A 1K8GA 2Q6LA 3VH3A 3GRCA 1ZNZA 2V7VA 4TRDA 1EE2A 1LK7A 2JGDB 2ZAGA 5LL6X 3CEHA 5TV2A 3SFVA 4D9MA 3Q15C 4LN1A 4KO8A 1Y1QA 4MP6A 5F73A 2QGNA 3NATA 4DDWA 3WRYC 3MG9A 1RM0A 2CKZB 1M6VA 3EUAA 2YN0A 1SB9A 2GN9A 4P2GA 3MBOA 4R4CA 1DJPA 1OHHA 4WZAE 2KE5A 4X7BA 2GSWA 4M88A 1Z74A 2I8CA 4JQZA 3WTCA 5JMTA 1EDDA 1M2FA 1ZVQA 2AFIA 3MRVA 1PKEA 5HKLA 2PM8A 5CB4A 5CM9C 4I5GA 3MCWA 2OMEA 1SXGA 2PX2A 3PYLA 3Q41A 4BNVA 2BP7B 3LAWA 1E1DA 2AJTA 1OFGA 2C61A 2SICE 5GJVC 1YF3A 4NE7A 4B9WA 1VIVA 3P2IA 4XWAA 2E4YA 5BR8B 1BBXC 3GEGA 3N7AA 1E1YA 4OIMA 1UBHS 5E2AA 3NLLA 1TLLA 4CL8A 3E7FA 4WZ6A 2WP8J 4AURA 3PIOA 4BL5A 1G42A 3MEHA 3PHGA 1JR3E 5D2CA 5AK3A 1SA0B 4CNQA 4FXKC 2QRMA 5BR8Q 4FJ1A 4EL0A 3BL8A 3IKLA 3A1UA 4MUJA 2PW5A 1NVVR 2GYWA 1OFIA 2FEOA 4E4RA 2LXKA 5K36G 1YR9A 4ZJUA 5B5SA 5AW3A 5EKKA 2KECA 4BGDA 2POQX 1IG3A 4IMRA 1W4CA 5GAJA 3WGMA 5AUQA 4TVSA 2Y1EA 2LKDA 3ETGA 4JDUA 1YIJA 3UM9A 5B6PA 3K0SA 2YJTD 3EK2A 3NTQA 2NUBA 4EI8A 4B3HA 4Q18A 1OV4A 4BQOA 2HU8A 4GICA 1VE3A 4IY1A 4E15A 4LRTB 1A6XA 3C6ZA 2R79A 1WAMA 3WLAA 3CQZH 3M6IA 3HSSA 2W0MA 2GJ8A 1ZEMA 4UHEA 2WJ3A 1HTLD 1BHJA 5G0WA 2CLKB 4Y6SA 2PNJA 4C88A 1G3MA 1JDUA 2YV2A 1V7QA 1BE6A 1XB2A 2GEVA 1OZGA 2H0QA 3CJTA 3CNOA 3M9WA 2C58A 2YR0A 4L9AA 3P9NA 4RDHA 3FAZA 4UUNA 3VR6H 1A4UA 1YS9A 5IF9A 3HXMA 3TSYA 3GMIA 4FEYA 3FDIA 1W87A 5AESA 4R01A 3GNTA 1FYWA 4L4SA 1GKUB 1G8HA 2NXJA 2Q1TA 4V0RA 2C3YA 1OLUB 1MX1A 1EEFD 3TCKA 5A62A 4BJ1A 1XZPA 3AW8A 5DW0A 5LMZA 1ULUA 2FFAA 1TJ5A 2OV1A 3W0LB 1L8AA 1GO2A 2HSEA 3FMIA 2Z95A 4HN4B 3G2NA 3KD3A 2CKDA 2IZ5A 2BR5A 2K87A 4X65Q 4D4MA 5J4HA 4A92A 5JECA 4ZAGA 1CJMA 1D5ZC 1DEAA 4TWIA 1PRTD 1VQAA 4QPDA 3KJNA 3H6MA 2A92A 3A1DA 3IUSA 3I23A 4PSUA 2NVQH 1ZK2A 5CT8A 3I53A 4J1QA 2GKOA 1QVAA 5H9VA 3TRKA 3TGWA 3ZHUA 2VPIA 3HDQA 5J4YA 1Y5NA 2QTAA 5C53B 1N6LA 2JFWA 4L7QA 4G5YA 1Z5NA 4DCCA 1RZUA 4QREA 2Q8IB 3TOCA 3CF5A 2O2EA 4MCAA 2ET6A 4G0UA 1HNXL 2J0UB 4C1NA 5KIXA 1MP0A 4IKPA 4PSVA 5IIFA 2XZTA 1X32A 2P3SA 1XYGA 2ZJAA 3KT6A 5KYUB 3R9XB 2WWYA 2N49A 5EIAA 3ONWA 3ZD6A 2YZ2A 3KUDA 4LOHA 1D09A 3UAWA 5I45A 1T3SA 4N3BA 1WW8A 4Y2JA 3WGJA 3I4NB 2OAQ1 3PGMA 2OYRA 3STXA 1X9IA 3G8YA 3L7YA 4A3GH 1N6OA 2G09A 2WLSA 4OXIA 3DLAA 5LL6S 4HS9A 3GPLA 3ZGVA 2ZCUA 1JLSA 3UPUA 1XR3A 3WOHA 3CVOA 1KS9A 2ZRQA 4FS8A 4K9NA 4M76B 4TRNA 4YJ2F 3TUJC 1E5LA 1SXJA 2RAVA 3U3RA 2Q4EA 1O6CA 4M1OA 3VSEA 2GZAA 4PLYA 1MKHA 3BGIA 2EFEB 1OYWA 2B39A 2PS1A 1DBVO 4WJ4A 1SY7A 2G9HD 2X8WA 3IKMB 3G2QA 5JC8A 1IBMQ 1Q1QA 1J8VA 4KQMA 2UZ0A 4R2JA 2B99A 3QPWA 2DUDA 4JT9A 1CF9A 2CVFA 3VNRA 3JZAA 2PKCA 1JR2A 1LWOA 2AMFA 4M9QA 1G7SA 1XCBA 3COPA 1PEAA 3JATB 1U63A 1ZUIA 4L63B 2FETA 4NPCA 4HT3B 2I2DA 4TLEA 3PO3G 1NWHA 4FF1A 1M8AA 1LQUA 2INGX 2QD2A 3BIXA 3KTAB 2NXEA 1ZK4A 3FPFA 3MWJA 1JR4A 3R3VA 4PZUA 5CITA 5AKLA 4HVCA 1R6AA 4CDFC 1SOWA 4GX2A 3MS4A 4BQIA 3W6NA 5FJ8H 2MP1A 2VHYA 4P74A 1AHIA 3DBIA 3KR2A 1HXHA 4FSHA 4I50A 4BO5A 4F3NA 3BMCB 1BF4A 4LF6B 4B87A 1HHVA 2Z2IA 5AVTA 1N7JA 2O2CA 3A8JE 4B3RL 2MYUA 4I2VA 5BSRA 1DIRA 3STWA 1Z08A 4QUCA 4DYHA 3U60B 3OKFA 3GI1A 1O6BA 5TEWA 5A5FA 1RYBA 1F2UB 1MRZA 2A14A 1IZ8A 2R1VB 1SPXA 1NLFA 2H0AA 4HNTA 5HUHA 2MYTA 4OX9Q 5INTA 3CVYA 1CJKC 3UJCA 3OEEA 4B3MB 1WU8A 2CJPA 1IBLQ 2OO5A 1SFRA 3W6OA 4POFA 3ESYA 1TAQA 4AJPA 4BMVA 2F3SA 1RXVA 3SQMA 2UXBB 3BQNB 1F2DA 1S2IA 5LDHA 2P9JA 1JR6A 3VDQA 3D3NA 1VECA 3M7IA 1FFXB 1HEYA 1XTPA 2Z43A 4E11A 3L6EA 3ORSA 4E51A 2JBAA 3V4PB 1S01A 3PJEA 2DTDA 1BOFA 1EM6A 2IYEA 4URVR 3HBLA 3ULLA 3TRJA 3RUIA 3MM4A 4GVXA 3SKYA 1QNKA 4WESA 1CFMA 2I78A 3JQDA 1KQNA 3DH0A 4BRSA 2EXDA 3AVVA 5L3QB 4YXFA 3IMEA 1NNLA 2YZKA 3I1JA 5D51S 1WXIA 1VMDA 3PHJA 5JVDF 5ENZA 3LHIA 3LKVA 4BBZA 3LUPA 4GR4A 3HOVG 5DP2A 1IOVA 1XC7A 4C2AA 3TX2A 2I4IA 1A69A 1VRCA 2HLDA 3L7AA 4FKBA 3L9XA 4NY1A 4B3FX 3JAMc 1Y6JA 3VVCA 5H9WA 1OXTA 3TDMA 1QHYA 3BCHA 4PPNA 1IG0A 1NPTO 1YDFA 3DPIA 3TP5A 1VSVA 1XMSA 4JL8A 4O0MA 3ETEA 3U7FB 1E1QA 1W4AA 2Q0SA 2VB2X 5IAJA 5FPKA 3OLVA 1RQGA 5LYJB 1Z13A 5DWDA 3V4VB 1FYVA 3R0QA 4Z86A 3MSXA 2NNLD 4IGFA 4P4SB 1DI0A 3TI7A 1X1QA 1YJ5A 1U0FA 3M33A 3ZR4B 3O8LA 1XJ5A 1A2QA 1YJBA 1QV9A 4U5QA 4ID3A 2ERXA 3VDXA 3TE7A 4CUKA 5A3QA 1DVRA 3V05A 1H05A 4EARA 2B63G 1JALA 1ZIYA 2A3NA 1T9GS 3PENA 5K8IA 3PG5A 1BROA 3PZRA 1FX0A 1VA4A 4KXLA 2IXFA 4BOYA 3COSA 2JA5G 3UMYA 2F52A 1MC5A 4CVNA 3IPYA 2WU0A 3AU8A 5FLXc 5AT1A 4G4GA 4NS1A 1JEQB 2XAUA 4MQFB 3WHPA 3Q7IA 4FGWA 2E3JA 2VQEQ 2OV4A 5GPBA 1EFLA 4O4JF 4JMPA 3FMCA 5ALIA 5MGNA 3CO0S 1YB7A 3A0JA 2Z57A 1SOAA 4NCAA 2Q8NA 2YWDA 2OG2A 3NZEA 2H1RA 5EZYF 4HAWA 1TVXA 1L5QA 1ZHFA 4F4CA 2P11A 3GN1A 2AT1A 3ORFA 3JRWA 2JLRA 2QPAA 4CG1A 1D5CA 1E0BA 2XQFA 3OZVA 5EP2A 4ZXPA 3PEYA 1DEOA 4GRIA 3HS3A 2J4DA 1QH9A 2OBFA 4I6JA 3EMVA 3VBEA 1G6HA 3REOA 4B3SQ 2DOKA 4ZO8A 1AKRA 3BRQA 1R27A 4K05A 3KQVA 1PDVA 3TSAA 5HJ5A 1PGQA 3NBMA 4HOYA 3UH1A 2FDCA 2I1WA 1DJMA 2L1BA 3S2DH 2Z2XA 1JI3A 4QUAA 5ENVA 2OFWA 4F5YA 1WB4A 1MEOA 2PH3A 3O7MA 1IW7D 3FLEA 3PKJA 3LUHA 4C5CA 4IQFA 3GLIB 2XUKA