3PUVA

Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
371
structure length
371
Chain Sequence
b'ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein
publication title Snapshots of the maltose transporter during ATP hydrolysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/transport protein
total genus 103
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3puvA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3puvA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3puvA01
5BYJA 1GILA 1JR3D 3NBFA 2RGCA 1JB1A 2QGZA 4JL8A 2VZAA 1U8AA 2ZE5A 4JI0L 3GLIB 3O8CA 3NXSA 4Q4HB 1RRPA 1W0KD 1GKHA 2ZREA 2VEDA 3BD9A 3RC8A 2H1LA 4MRPA 4EIWA 4QHSA 1BS1A 3MG9A 3NBHB 5JZVA 4GP6A 2AXPA 1HQMC 4A92A 1I2DA 5L3SB 3LA6A 5EXPA 3AEZA 1XEWY 1HQYE 2CE2X 2ERXA 3THYA 4IO9A 4WBSA 3LX8A 3K0FB 4JI3Q 3CONA 3OFND 4Q18A 4Z8YA 1E9DA 5C4XH 3T1YQ 4TQ9A 3UWOA 4U7DA 1P7CA 3X2SA 4D6PA 2OQKA 1J2JA 1DAEA 4WIAA 4FD2A 3C14C 1KAOA 1ZM4A 5SZJA 5GJBA 1X8JA 2WJVA 4Q21A 1UWVA 1RRGA 1H8HA 2PQAA 4IPGA 4JI6Q 2A5YB 4LBZA 3SZRA 1N6RA 3OEHD 1Q86C 2JIZA 1GUNA 2VUMG 1D2EA 1G5PA 4KVGA 4YDSA 2BBWA 4DR2L 4JI2L 3SBEA 5EE3A 3RC3A 2NN6I 5E7IA 5AUNB 1E2LA 4NHOA 1RJ9B 1S4QA 2KBNA 2GA8A 2IYZA 3FHOA 4WW0A 4DNIA 5IYDG 1TQ6A 5JWRA 1B8AA 1P2TA 2XZOA 4MQBA 4B3MQ 1X54A 5FPHA 1N5KA 1CKMA 2PT5A 5HCNA 5FPKA 2KA7A 4ACAA 1KO4A 3CCQA 2O5VA 2JA8H 1N5LA 4KJZA 4N3NA 4KO8A 4P3YA 1E79D 3I5XA 5BWMA 3PIRA 3I4OA 1ZIPA 2BMDA 2GKSA 2GK7A 2B7BA 4G1UC 4YMVA 2K75A 3KLRA 5FLMH 2G1JA 4B71A 4BRWA 4DPGA 3FKIG 4MGKR 3ER0A 4MTNA 2FZ4A 2EWVA 1F2UB 3AVXA 3CF2A 4MKFA 4BQSA 3CCSA 4ZKDA 1GKUB 3SNHA 1OB2A 1YHQA 1E4YA 4HB2A 3U44A 4CZ2A 1COWD 3TS2A 1HZBA 2IYXA 1HJPA 1I94L 5J4YA 1YZGA 4QBFA 4N0DA 3AVWA 1YITA 5BQ5A 3FMPB 3RZDH 1NTGA 3QXJA 1JALA 1E2FA 4BA2I 3F2BA 4TSFA 3Q85A 1Y14B 3BFXA 1LW7A 4IHQA 2YVUA 3QXXA 4D0GA 1EWIA 2PNHA 5GAGC 2QP9X 3D8BA 3QKRA 4JKIA 3B78A 2CNWD 2PH1A 3RRYA 4DEXA 4CEHA 3IO5A 2XXAA 3VR6A 4BXXH 2DFNA 2OBMA 4DHEA 3GLHA 3ADDA 2NIPA 1CJTC 2ZM6Q 2FSFA 3QBTA 3H3VH 3FP9A 1Z0IA 4JK1C 4A3DG 1E2JA 4OHZA 3QXSA 3NIBA 4X66Q 5AJZA 1JMCA 1T3HA 2WB1E 1HR0L 4MRVA 1PMRA 2ZEJA 2Q0HA 1IN7A 1IW7C 1R2QA 1LNZA 3GTOH 3X1XA 1ZM2A 1HY3A 4DLYA 5IK2D 4GNKA 1I4DD 3CRKC 4PHFA 3BRWD 4BFWA 3VHXA 2D7CA 2PZEA 2QMUA 1IXSB 4X8OA 1LY1A 5JWHA 4RSGA 5CK4A 2BDTA 4GNXC 1GITA 3ZVMA 4LK2A 2ZTDA 3MWKA 2AX4A 3OOCA 2ZSDA 1CFMA 2D0OA 2K32A 4KHPQ 3I4NG 1LFDB 2CWPA 2GESA 1EWRA 2QQEA 1CR1A 3OEEA 2WJYA 4NYIQ 1F60A 4EPVA 2FGJA 2QT0A 1XXHE 3C15C 1SMYC 3TNFA 1HH4A 2XEXA 2HDNB 3CW2A 3VKHA 1AZSC 5DI3B 1R4AA 3I4LA 4FCVA 3CRLC 4M9XA 3AP2A 2UXDL 1HYQA 1ODFA 1VG8A 3HPRA 3OAAA 1ZMXA 4AYXA 4BFYA 3THWA 3A8IE 4BEJA 1SVOA 1LV7A 4A3FH 2DWQA 3F5FA 3AB3A 4ZCLA 5KTYA 2UXBL 4QGGA 3ETLA 3EA5A 3TH5A 3HYTA 2K5NA 1WCMG 2C98A 3ICEA 5GAHC 4HAUA 4Q4LA 3W6PA 1K0RA 1GRRA 1TMKA 3B1WA 1W36B 1XTDA 3LWNA 2ONKA 4OK6A 2OUKA 2GRJA 2ZSFA 3BH6A 2ZIAA 1P2VA 1Q3HA 3AF3A 4DDVA 2GK6A 3A0JA 1DS6A 2ZYTX 3NELA 3FMCA 2L5TA 3B1XA 4TL6A 1U98A 5UKDA 2GXSA 4AIMA 4ALPA 4X62Q 4WJ4A 5AJXA 4JL6A 1Z0AA 1XPRA 1P4SA 2VH5R 4H1VA 4IDOA 4RCNA 1DEKA 2Z6VA 1YRBA 3LXRA 4Q4JB 2O8BB 1I3QH 4IVQA 1U94A 2BE5C 1XF9A 4M1KA 1NG9A 5HPYB 1CSPA 4DV2L 3J81j 3AEVA 1L0WA 1YR7A 1YJ9A 2FZLA 2O8FB 1HE1C 1HT1E 5ANRB 2F3IA 4B6FA 4LF9Q 1KQSA 3N2EA 1KRSA 2N3SA 2N8NA 5E4FA 1KY2A 4B3DA 1MKYA 5FUXA 2XOKD 3S14H 3KX2A 4TZ0A 4TLCA 1YZUA 2QF7A 4DLXA 3IEVA 4HI0E 3Q3JB 1ZU4A 3K70C 2OESA 4H13C 1E7ZA 2ZJPA 1JJ7A 4DR5L 4DUGD 1SFOH 1R5BA 3CRVA 2LXKA 2Q21A 1E24A 4YMSA 4P4UA 1DO0A 2ZJ8A 4IOCA 3TAUA 3PUXA 3WMEA 1E3MA 2KCTA 2IY5B 3B9PA 2A5GA 1UEIA 3I92A 5CB6A 4KV9A 3HKZE 4TMTA 3CWQA 3VQTA 1AE3A 2UXCL 2IEYA 4IOAA 1JR3A 2ZS8A 5C3EG 3IBGA 2IXFA 3KB1A 4GZYC 1MABA 3KJPA 1W0KA 2UUBQ 2G9NA 2BDOA 4US1R 2F55A 1QUQB 3JZAA 3CW2C 1KAGA 3W1GA 3PXGA 4DKXA 2G88A 1LM0A 1DOAA 2K5VA 1UF9A 221PA 2Z4RA 3I8SA 1BVSA 1IBMQ 3KDFA 1EFUA 1NNEA 2X19A 3LD9A 5CK5A 2QRZA 1T0HB 5DO9A 4GL2A 2R62A 3U7FB 2A69C 4XIGS 3J81k 2UUAL 3OFNA 2A5DA 3BB3A 4JMPA 1RKBA 1HNXL 2XGTA 3PO2G 1II0A 3I3SR 1FNMA 1PZNA 2PX3A 1H9SA 1PYBA 5IYBH 4LUOA 1IBKQ 1HV8A 2KWIA 3OEHA 4JI4L 4JT2A 4B3XA 3I61A 1Z47A 3BAFA 3TUIC 1TUIA 1ZBDA 1T6NA 2QTVB 1N5IA 3SR0A 4UJ3A 4MKHA 2VHJA 1NKSA 5BN5A 2ZRBA 3MUFA 4JVLA 1P6XA 3CPEA 4OQNA 2F7SA 1KO8A 1Y1VG 4DK3C 3E70C 2R6FA 5E7MA 1ZAKA 4OQFA 4Q7JB 2ZPTX 2J5XA 1XTIA 1WMSA 4K81B 3ZDQA 2VHQA 1XB2A 3N2IA 1E79A 2OO7A 2R6GA 1G51A 4MRRA 4PHGA 4ZIRB 2HCBA 4OGQC 3LVRE 2XTMA 3KKMA 1P9WA 1YZ6A 3PEVA 1GRQA 2IW3A 4KFTA 4HLDA 4PO1A 3UPUA 3CNNA 4A3BH 2VP2A 1SXJB 4CEJB 3GCGA 1KO1A 3FGNA 3T5GA 5DYIA 3BIFA 4A8JA 1N32Q 2ATVA 2EVWX 4DLUA 3EARA 4E03A 1COWA 5F3WB 3EIQA 3QPWA 5G40A 1E2KA 3AVQA 2J7KA 5EE0A 4DIEA 5H68A 2PZFA 4CRWB 1SMXA 1S72A 1PYSB 3CX6A 5KPDA 4HJ5A 4IPCA 4KMUC 4DCUA 1Q44A 2OLKA 4G7ZC 2ZVPX 1U2RA 4C0BA 3AQ4A 5CYOA 3AF4A 3I4MG 1YHAA 1G7RA 4LYJA 1G8GA 2OFOA 2V6JA 4V0MA 2P2LA 4A1FA 4EFLA 3WNCA 4XH9B 4EPYA 2CNWA 4O2DA 3L0PA 4L5TA 1JEDA 4TMWA 4DLSA 4IRUB 4I7ZC 1WXQA 3TAHA 3D3QA 3OIUA 4PC1A 5FI1B 2AWNA 5JS7A 3LLUA 4OQLA 3AQQA 4JI8Q 3KF8B 1LF0A 1NN0A 4JKYA 4NH0A 1NVXQ 3GLIA 5ELXA 2I1VB 2KCCA 1K83H 4HIMA 3KKPA 3RZOH 1K8GA 1AH9A 4Q4HA 2BWJA 2OEPA 5IK2A 1E0KA 4UQOA 1YJ5A 3BE4A 3SFZA 2D4HA 4B2PA 2BOVA 2R93H 2DBYA 4EQ6B 2NPFA 3TK1A 3H84A 1G20E 3WYAA 4HZUB 1Q46A 1ZYRC 3LQRA 3GJ4A 4BFVA 1G41A 4BBSH 1G6HA 3O8BA 4PZZA 3RS2A 4JYCA 4QGAA 4X65Q 4NPHA 4QL3A 4V0OA 4IFDI 5BR8Q 3W8RA 4GFDA 3K0FA 1OB5A 2P5TB 3L0SA 3TGPA 1XEXA 5H70A 4R2IA 3DPUA 4C2TA 1Z29A 2Q9BA 2ZYVX 3J81c 3UMRA 5EP4A 2EJGC 1PHJA 2Z0SA 1RE0A 3ZVLA 2GJAA 2OCYC 4DUYQ 1K5GA 1KMHB 6Q21A 2ATWA 2PJZA 1Q1QA 1G4AE 5C0XI 3QENA 1K8MA 3JZMA 3JAMc 1CKNB 2QM7A 2ZE7A 2WP8J 4DV7Q 4LDJA 3K7UC 4KXFB 4KLNA 4X8HA 4A2QA 2HJVA 3GLIE 4D26A 2V3CC 1FTNA 3S24A 3AF2A 3O8DA 1HPCA 1WA5A 5FOUA 1KDPA 2GXQA 4GKJQ 1Y63A 2W00A 1GSIA 1QVRA 4A8JC 4PO8A 4W5HA 1XZPA 3LV8A 2Q2HA 2OBLA 2ZRLA 1YVCA 2KB0A 1S40A 3H4MA 1KL9A 4JI5L 2ZSBA 2RGNA 4G01B 2D5DA 4BY7G 3EBEA 1V5WA 4YCUA 1ZUNB 3ZZ0A 1D9XA 1VECA 4HAZA 2JEBI 3RS4A 2J0VA 1MJCA 3DLLA 4C30A 5EJEA 5A35A 1GUTA 1Z08A 2QRNA 5DH9A 4KSCA 2IS2A 4LF7L 1G5TA 2P67A 4A9AA 4R1JA 3S16H 3BJIC 2C04A 3AGQA 4RD6A 3F1ZA 3RRZA 1WYDA 3OIVA 4WA7A 2MFIA 4TLDA 1EQRA 2VQSA 1D8LA 5CDFA 3CC4A 1O3YA 4TL8A 5EE1A 1VQDA 4DAMA 3S17H 2HHHQ 4AYBE 2GEUA 4PSVA 5M5YH 3REGA 4OO1I 2XOKA 1KDTA 3KJGA 1CLUA 1G8HA 2O5IC 1L4YA 4A76A 5KNDA 1EK0A 1H8ED 1A1VA 3AUXA 3X1WA 3UXMA 2CCZA 3QVUA 3FMOB 1VF5C 2IUUA 3RVBA 2H92A 4C2MH 3CBQA 4DJTA 4DUGA 2JA7H 1NMZA 3IDQA 4GLAC 2KBEA 2ZRIA 1E2NA 3QKSB 3J81i 1QVGA 4LPSA 3AVYA 2OFWA 2ZU0C 1IY0A 1J5EL 1NI3A 1OXVA 2FXQA 2CCGA 4D0NA 1SGWA 1FQKA 1QVFA 1DAHA 5FTMA 3WRXC 2WSMA 1E2WA 3EIVA 3TQYA 1A2KC 1W3SA 1N6IA 1OSNA 4W5WA 5LMNW 3ULPA 1BYIA 1Z83A 2C9YA 4DLRA 4P0TA 1TQ4A 3JAMi 1XJCA 4L9SA 2ID0A 4L5BA 4TTQA 4U5XA 4DR4L 2NO0A 5L8VA 2P6NA 1QHHB 4PQRA 5J4VA 1ZJ6A 3A4LA 3X1YA 3GLFA 2AFIE 3EZ9A 4ILEA 4IDHA 4QHTA 2Z5FA 4H0LC 4JLNA 4KI0A 3GTMH 3SQWA 5FUWA 1HTPA 3NHAA 3KXKA 4H9GA 1OFTA 4DV6Q 1E2PA 1SVWA 4LPKA 3W6OA 2GBLA 4UNSA 3RS5A 2XX3A 2Z0MA 4POAA 1DD2A 1M6NA 3GEIA 2KHJA 3CCMA 1G8YA 4P4TA 1SKQA 2FGKA 2BIFA 4MKGA 5CM8B 2W83A 4JLKA 4XTCS 2WOJA 4LFCQ 3QI2A 5E7NA 3ZD7A 4GLVB 3A6PC 1D7QA 2VHTA 1GHJA 5IYCH 4EX5A 3U58A 2J1LA 2HCJB 2YINC 1NIPA 4JOIA 2WZQA 3BK7A 3V00A 3VU9B 4C0KA 4HUTA 3ZJYA 5FJ8G 4NU0A 1F2TB 1F5NA 2DWOA 4XJXA 1PVOA 2RGNC 4LC1A 4DV1L 1W2BA 2GEVA 2RGDA 1DTSA 3U3JA 4B35A 3U3RA 1K6MA 2F4VL 2ZAMA 4RVCA 1KSHA 4A82A 4DV4L 1JAIA 2OG2A 2P6RA 4YMTA 2ODNA 4Q9KA 3G82C 1KNXA 3RNLA 5DNYB 1XTRA 4A8JB 4ARZA 5IP7G 1PH8A 3U61B 3AP1A 3QF4B 1AIPA 5LMNL 2KI5A 3LW7A 4TZ6A 4QIWE 3FHCB 3V4FA 2C99A 1Z0JA 1HZCA 1EUJA 4LWCA 1XMQL 2QAGA 1AE2A 2GNOA 4JT4A 3RSOA 1SVSA 2QPAA 3ECCA 4O2RA 1U9IA 3EPHA 3QUSA 1N2CE 3B85A 4TQAA 1FL9A 5EE9A 1SVLA 4POFA 1M1YE 4C3HH 2O8BA 4HDOB 4GSYA 4BEBA 1VMAA 2EQBA 3CAMA 3HOVH 2IYWA 2J0UB 5EXTA 1Q21A 1XTSA 5FOVA 3VNUA 2KJQA 2OWOA 4QM7A 1IXRA 1N5JA 1TPZA 1WQ1R 2C5LA 3WYGA 1UDWA 2G0NA 2GWHA 3UDGA 3H15A 3NH9A 4HB0A 4LV8B 3TW8B 1ZU5A 1VQOA 2F1MA 1CRQA 4BY1H 1G16A 1SZPA 2DFKB 5HCIA 2QAJA 5AJYA 1EOVA 4D2IA 4A3IG 1VQNA 2AUJD 1ZCAA 2B29A 5C44G 3UDXA 4LFAL 4HIOA 1XCGB 3BFKA 3I32A 3QQ5A 5FOXA 4RZ3A 3PEYA 1B7YB 1OIVA 2PLFA 2RKOA 2EFCB 2YNMA 4LV6A 1QHXA 1P5ZB 2IHYA 1GVNB 3CM0A 3N5CA 3TW4A 4EPRA 1YHBA 1OH7A 2GBLC 1CJMA 2B63H 4OWWB 5GADl 5TDHA 4DCTA 4QGUA 2WOOA 4UP9A 1II8B 2AN9A 4A2WA 5DIFA 2ZR7A 1QUQA 3B7GA 3LBHA 1KDOA 3EC2A 1NE3A 4MZ9A 1QJOA 2O8CB 4JOIC 2QY9A 2QSZA 3LDAA 3ZJYC 3HOYG 1JXMA 3QOFA 3UE0A 2C9OA 1J70A 1WP9A 3A1UA 621PA 2IT1A 1IXZA 1T8UA 4H44C 1YE8A 3CRQA 4M1OA 1PFSA 2YWHA 3L2PA 3NBYC 1JJ2A 1E1QD 1XNRL 4WZ6A 4IFDH 5KDLA 4DRZA 1PH3A 4RFSA 3I55A 4DR7L 4M1WA 3H3VI 4B3TL 4A93G 4LF6Q 2WJJA 3PF4A 2AD1A 3LAWA 4PQYA 4YCVA 3CPWA 2DYKA 3R7WB 3M9BA 2WPDD 4PC7A 2A1AA 3S1RH 5AUPB 4P33A 4YDHB 2VF7A 1DARA 2HUPA 1OIXA 2UZIR 3K9GA 1ZKOA 2QAGC 4A3CH 2XNDD 2JA5G 1P3JA 2OM2A 5IWAQ 3L82B 2I0QA 1U9IC 5FTJA 5K8IA 1G6PA 4JYAL 2GZDA 3MFYA 2YU9H 1FP7A 3FMFA 4JBYA 4CIDA 1SE8A 2MMCA 2RGGA 3KQUA 1GNQA 1S9HA 4KCGA 4ZIRA 2Q9AA 1GUGA 3IRBA 5FJ8H 1IXRC 2OHFA 2OCBA 3FWYA 1RRFA 1KJYA 3UMSA 1CSQA 2B7CA 4F92B 2VP4A 4ZDJA 1G8FA 3FDIA 4JSYA 3CD6A 1EG7A 2BEJA 1E9SA 5C4JH 3BZKA 4M1TA 2CKZB 1KTVA 4CF7A 2O0HA 1KOFA 3KDSE 1I50H 4BLTA 4M1SA 3SOPA 2CJWA 1US8A 2B21A 3VR4A 5IE8A 1FVIA 2E9SA 1BKDR 2DR3A 2A78A 3TMKA 1VQ6A 1AS3A 4RY2A 4B76A 4TYWA 4LFBL 4RZ2A 1DG3A 3TRZA 4TMZA 5FTLA 3S2HH 1NL3A 2Q2IA 3EXAA 3UDIA 3AH8A 3G5UA 4PPGA 4C0LA 4AH6A 1H8EA 5IRCD 1AN0A 1XWIA 4OO1H 4DK6C 1DVRA 1W5TA 2ZE6A 4EFNA 1L1OB 2VQEL 3G71A 2IF0A 4P32A 4GLXA 1QHSA 3SI7A 1Z6GA 4GP7A 3ZLJA 3K9HA 3W90A 3GFPA 721PA 3B82A 3I5YA 3QJYA 5JWOA 5AJ3L 3CRW1 3BWDD 3F8TA 2I5MX 3SJCA 1P9NA 1SXJE 4ASUA 1FW6A 2BH8A 3P4YA 1Q3TA 1W1WA 3F3YA 5J4HA 4JV5Q 5BW8A 1NN1A 3GPLA 4DV0Q 2NGRA 2QORA 2D7DA 4EQ6A 2RHDA 3UE1A 3IILA 5C44H 3PVSA 5DE3A 5L3QB 2E2HH 4I4LA 2VP0A 4R4TA 4HZUA 3C5HA 3CPHA 1K5DA 1R8SA 2RGAA 4B43A 4W7SA 4RD4A 1SROA 4LJ8A 5FTNA 1CU1A 5D3MA 2CLSA 4DVGA 1L2FA 4HB3A 1MOZA 3TVDA 2O8DB 3U5ZB 3BFVA 1YR9A 3QEOA 2OCEA 2YTXA 1FUUA 1A7JA 4LYFA 4TMKA 5EE5B 4LW1A 4KVAA 2CL0X 3T15A 2NO1A 2F1IA 1VQMA 3HU2A 4K0KL 1S2MA 3BH7A 1KMHA 4G3XA 2ZUDA 421PA 2NZ8A 2GJKA 1PH1A 1FQJA 3MSXA 3ND9A 1KD1C 4JLAA 4BRUA 1Z0KA 2J7PD 4BA1I 1XNQL 1R7RA 1Q90A 3HOXH 2IBMA 2ZE8A 4XSGA 1EWQA 1JECA 3R9IA 1YNNC 2ZRFA 4Q5IA 3CCVA 2B8GA 3O8RA 4G7OC 3AVVA 2D62A 4A93H 3NBZC 4LJ6A 1ZM9A 1XMOQ 1AS0A 3ADBA 3GLGB 1ZNXA 2IS6A 3IIJA 4QJ5A 1KHIA 5JHHB 4LBWA 4AYBG 1G7CA 4RFVA 1KI8A 4DT1A 3L8YA 2O8EB 4LF8L 1E2HA 3AVUA 4Q1FA 4B3SL 1E9CA 1G3MA 1W2HA 2Q3HA 1YZNA 4PX9A 4J15A 1EX6A 1YZLA 2BM0A 3HOWG 2UU9Q 2RB4A 1NBWA 1DAGA 4ITRC 4LRWA 3MEFA 1W48A 2ATXA 3B5JA 3KKOA 1IJFA 3SHWA 4EAQA 5JRZA 2JLSA 5LDDC 4KKSA 4GNXA 2JXMB 4JI3L 1ZM3A 1H9KA 2O52A 3QKTA 3T1YL 2HXYA 3Q9LA 1PH6A 3SS8A 1E2ZA 1D6JA 4GOKA 2JA6G 2VY3A 2WVJA 2ZJ5A 3MAAC 3H0GH 5FR2A 1UEJA 5JI2E 5JSZB 2QA4A 2CXXA 2LSSA 1OKKD 1BDOA 1D5CA 1T5LA 4JI6L 1Q57A 4A3LG 2W2TA 4JLBA 1PUJA 5M5XH 1E9FA 2FSGA 3WYFA 3QKSA 4JL5A 1JB7A 1YR6A 4HB4A 4NCKA 3GJ5A 5KSOA 2QN6A 4DR2Q 3MWJA 4DIDA 5C0XJ 3F2CA 3GO5A 5CLQA 1ZD8A 3NC0C 3ZH9B 5GAEC 3U4VA 4CEIB 4B3ML 2UVQA 3EIEA 1JJVA 5FH9A 3NEMA 1KC8C 4KYIB 1FL0A 2GVBA 4PAOA 4HLUA 1D9ZA 2OE2A 4HZIA 2GCNA 3PO3H 1MRNA 1R0WA 3PF5A 3I1FA 1NLYA 1XP8A 4IDNA 3QVVA 3VR5A 1VQCA 2Y8EA 1NVVR 4UP8A 1N33L 4PV1C 2QZ4A 1FPMA 2H57A 3UWKA 3D6TB 1VQFA 4QY7A 2NVTH 1Z5ZA 4YY3L 4D4JA 2J0SA 5CJ2A 4XWKA 1BBWA 4TYPA 5F9HA 1ZYUA 2E74C 2GZAA 3VHLB 4A3MG 2P3SA 4R7ZA 1B9MA 1PH2A 3KFUA 1IYUA 1UE1A 1N6HA 2WHXA 1FP6A 4E22A 5M3MH 1ONLA 2OSBA 5DSZA 2ZM5A 1J6QA 3HOUG 1E1QA 3Q7QA 4WVFA 1VCIA 4B3RQ 1DAKA 1VCNA 4MUAA 1KSFX 2JLZA 2R92G 1ZD1A 4DBLC 821PA 3VU9A 2E2IH 2V1UA 1XXHA 3K1JA 5GVSA 1F2TA 3U4QA 1BBUA 1M7BA 5IY0A 3X1ZA 3NG1A 5GQOA 2WPDA 4Q9JA 3B60A 2G6BA 4TYYA 1C0AA 1XTJA 1VQPA 3T1OA 2A7QA 2YHSA 4HIDA 2ZM6L 5JBQA 1Q1BA 2XNDA 4DR6L 1N25A 4OJQA 1FZQA 4CVNA 4Z8XA 2H7VA 3C16C 4IPDA 3B1YA 4X66L 1AJEA 4GOJA 4ON9A 1KK2A 1YZTA 3DDCA 3E5HA 3Q5EA 5TVKA 2QE7D 2QMHA 4UNNA 1Z7TA 3IGFA 2E1RA 1C9OA 1UFQA 2ZYUX 3QF4A 4Q7KA 4S35A 1M1KC 2PZGA 4YQFA 5BYKA 1VQLA 4PMWA 1AS2A 5E3HA 2YJTD 3THOA 1H9JA 5HKKD 1U90A 2B8TA 2WV9A 5KOYA 3LW8A 2BMJA 2BVNA 4MYTA 4XVQA 4D80A 1KI2A 4LHWA 4OI4A 2Q9CA 1P2SA 2C77A 1OF1A 4IEIA 4QBGB 4JLJA 4QJ4A 3B8HA 1QZXA 2CCJA 2VLIA 4RCYA 1IN6A 4A6PA 3U6BA 1CR4A 1E1TA 2Y0SE 1VTKA 3T1QA 2I3BA 4LF5Q 4BE7B 4KHPL 1N8RC 2B8WA 1IZ6A 2ZRKA 4JVMA 4BFUA 3CC2A 4FDBA 1IN8A 3OIYA 4AC9A 2ZRMA 4URVR 1KZGB 1RL2A 1XRJA 2WKRA 2AHOB 1RVDA 2IC5A 2ZI7A 3W5OA 1JQJC 4HLUC 1FJGQ 5KO2A 1JBKA 3LNCA 1UKYA 2PI2E 2HIXA 1U99A 3B6EA 4FN5A 2ZAOA 1Q22A 2GVAA 2NN6G 3NC1C 4Q4AB 2YC4C 3CH4B 1N3BA 2JLXA 2VUMH 3LLMA 5M04A 4TYNA 5M3FG 3TRFA 1TQDA 1X9NA 1O78A 4FWTA 4C4PA 1UE7A 1N34Q 2AXNA 2IX1A 2BJVA 3SEAA 3I62A 4BZXA 5IYDH 4IOKA 1OIWA 3RWMB 1JJCB 3CPFA 1CUKA 2QMEA 4OI0A 3NEYA 4P73A 5G3YA 2ZJ2A 1OFUX 1ZCBA 4DV5L 4QGFA 4YXWA 2ANCA 2OQ0A 4UNQA 2FSHA 4JI7Q 5EQTA 2VQFQ 2WJGA 4RZXA 1R0XA 2PJRA 2KCMA 4IJMA 5A5GA 4X62L 3OHMA 2J3EA 2YV5A 3HYRA 4HUQB 4KBFA 3A7AB 2JGNA 1VKJA 2K14A 3CB4A 3FKIH 4LK1C 4R4CA 4LZZA 3LNNA 2E5LL 1N0VC 1NN5A 2AKAB 3EZ2A 5JECA 1AK2A 1IY1A 1ZVQA 3K0AB 4QM6A 4DV2Q 3NDPA 2RHQB 4PPQA 2ZANA 2PLRA 1Q7YC 4LF9L 1FTSA 1E32A 2XITA 5ELNA 2PPBC 1LB1B 3R7WA 1X3FA 1P62B 2PCJA 4IQZA 1N6NA 4MDEA 3DVLA 1C1YA 1TWAH 3LRPA 1SLJA 3H86A 2J7PA 1EGAA 1NMYA 3KL4A 3RAPR 1NMFA 4Q66C 3S1MH 2MSEB 3RABA 4BZPA 3FVQA 1U0HC 4B2LA 5FOWA 1OXXK 2GJSA 4JLDA 1QHIA 5JMTA 4A3DH 1DGSA 4JBXA 2N42A 4ZKEA 4HSEA 3RSLA 1RYFA 4PR0A 2V1CC 4AKEA 2GEDA 2HJGA 1TQ2A 4Q1CA 5LMUQ 3CR7A 3FPPA 5HZKA 1SR3A 4BGDA 2OTJA 2K5HA 3UANA 1KK0A 4F4IA 2WICA 3AKEA 4TT3D 2EFHB 4A3EG 1TL7C 4DNTB 3R20A 4EQ5A 2MSCB 2JA9A 1NBMD 1IBML 2BBOA 2DGYA 2ZRAA 2F9LA 4UNPA 1CJUC 1TUEA 5JJIA 1KO5A 4H1UA 5L3RA 2VW9A 1FOEB 3AFPA 2ZQ5A 2UUAQ 4QG7A 2WIAA 2BC9A 3A8TA 4PAQA 3H1TA 3B2EA 1IBLQ 1XZQA 3Q72A 4F4CA 3GEEA 3ULJA 1K9MC 2EFDB 3UG6A 3I4NH 1Y1WG 2WKPA 4NYMR 3REFA 4CW7A 1E2MA 2GDJA 5LBIA 3C7KA 3UG7A 1UBCA 2ODEA 1L1OA 5IF9A 1IBKL 3NENA 1XDBA 2CVFA 4LJ5A 1W36D 4GOXA 3EWAA 4TVAB 3CX8A 2QROA 2JQOA 5JI3E 1X6VA 4LBVA 4KODA 4B74A 2N1BA 2ZYWX 4TL7A 2VYFA 5L3VA 1KO7A 3SYKA 1R0ZA 3TQFA 2QNRA 3GFOA 4NCNA 2K52A 5KUTA 4MRNA 4IDQA 1Q1EA 3I73A 1KI6A 1WCMH 3CPJB 2CW0C 4IFEA 4NMMA 3OW2A 1W44A 4BECA 4DDTA 3KTAB 2XSZD 2ZJZA 3DMNA 2ASBA 1AZTA 2WSSD 3M4YA 2BJWA 1UJ2A 2ASEA 3B13B 2PBRA 3DHWC 4TMVA 4Q9HA 4NONA 1M34E 1HE8B 5EP3A 5J3BA 1CTMA 2REXB 3U6KA 4XVUA 1OW3B 4U02A 3HOZG 2CFMA 1XU4A 4LBYA 3ULLA 1PH9A 5K36G 1GFIA 2YWEA 1XD2A 4BBRG 1AGRA 3AFQA 3SDZA 2R44A 4NCIA 4Z1MD 1ZM7A 3DM9B 1M8PA 4Q1DA 2AK3A 5J5CA 5H8WA 4GOPB 2VSXA 2MO0A 1TWGH 4GKKQ 5EZ6B 4GN5A 1EIYB 1F48A 3BGWA 1GM5A 1Q82C 4A15A 3OYYA 3OIWA 4HYYA 4ERNA 4HAWA 3TS0A 4LUVA 4HIKA 3NH6A 2CHGA 3WNBA 3QG1A 1T5IA 2VP9A 3M1IA 4B2IA 4UY8C 1NVVQ 2EIFA 3NTUA 1Y8OB 1YJWA 2RGXA 2B3GA 2C8VA 2DY1A 1Z3IX 3BERA 3QG5A 4GZMA 5LB2A 2QBYB 5FBRB 3DO6A 1H95A 2FJUA 1MO6A 1RZ3A 2R6CA 4B33A 5JEAJ 5JJLA 1KJZA 1XMJA 2JJ8A 1LYLA 1HT2E 4AI6A 4NPSA 1KI7A 1OT3A 3GLGA 1UAAA 4JI8L 4YCWA 1A62A 1TAGA 2QE7A 3GTLH 3D31A 5B2ZA 3R8FA 4D25A 4Y7NH 5L3SA 3TVTA 1J8MF 3AF1A 5EUMA 3RNUA 4LF4Q 1EFHA 1XCPA 2A9KA 2D2EA 3QKUA 4DLVA 4P74A 3UMFA 4IEEA 1L2TA 5HKKA 3KQNA 2VS1A 5C3EH 1TNDA 2WJIA 3IQXA 2WWYA 4M1YA 4DEYA 1L1OC 5AWFC 1Z07A 3SYNA 2HV8A 4X65L 3FYHA 3VNVA 2ES2A 3SQXA 1O87A 1O7LA 3CRMA 3A58B 3WWVA 4EPTA 2NZOA 1FX0B 1ZNYA 4PHTA 3PSIA 3CKLA 2BKEA 2AKYA 1YZKA 2GAOA 3BORA 1GP2A 1YVDA 2A30A 3T1HL 1FFHA 3U7GA 4D4KA 4ME3A 3D0FA 2GJ9A 1RJ9A 4QC2A 2DFTA 1HNWQ 5B64A 4HAYA 4XTRA 3AKDA 1X3GA 3SU8A 4BLPA 4A36A 1Q8KA 3GLGE 3K09A 3VAAA 3W8NA 4DV7L 3HPQA 4RCZA 1YBYA 1TWHH 2PMZE 2J45A 3PO2H 2BA1A 1GL6A 1UBGA 3QNUA 4FINA 4L8JA 4A0GA 3V4RA 4JVNA 2VF8A 1UE5A 3JC66 4DUZQ 2NPIA 4N0EA 4C3JH 5G41A 4CEIA 2REBA 4JLOA 4ESHA 2OTLA 2ALYB 4PSKA 1SXJD 2ZRJA 3AP3A 1F2UA 4US0R 5JRJA 4BFTA 4EFMA 1XFAA 3THXB 2CQOA 1VQEA 5LD2B 3VX3A 2OILA 3WRYC 1T3SA 2X1VA 2PT7A 1Y1VH 3MJRA 2FPKA 4K8OA 3H0KA 4KFRA 5KYKA 1S3SA 1P61B 4WOPA 4HDQB 2ZRDA 4Q1AA 4HDCA 2KE5A 1T4GA 4PZ8A 3IPXA 2HLDD 3RS3A 4MGZR 4JBMA 1YZQA 4P4SB 1CS4C 5C46F 1E2DA 2WB1G 2W2XA 3IFTA 4A3KG 3KLWA 1N0WA 3GTJH 3L0IB 1YRAA 1X65A 1A4RA 2G0TA 2IYYA 4Q9IA 3M7NA 4LV5B 5F9FA 1FYCA 3THYB 3ASZA 4IPHA 2QTHA 2HHHL 3WP0A 3T61A 3TQCA 2NMVA 1NLZA 1TEXA 1X1RA 3WDNA 2D0PA 1E99A 1ZC3A 4AWXA 1E96A 1R6BX 4G5QA 3M4OH 5FPSA 2ZR9A 1GUOA 2PQAB 1OYWA 3I4MH 2EJFC 1L7VC 1P73A 1WI5A 2AL7A 2X2EA 1W4RA 2R7ZG 3EZ6A 5FUYA 3U60B 5IT5A 4A3JG 5DYGA 3TIFA 2C2HA 4DDUA 5HGQA 1DXMA 1VQ4A 4OBEA 1A63A 1TF2A 4QHYA 2WTUA 2Y0SG 1U8YA 2XTNA 2OV2A 2IYLD 4KN7C 1I6HH 2B8FA 5A0FA 5DI9A 2N78A 2VP6A 1KI4A 1NN3A 4IKEA 1K8RA 1GUSA 2V4DA 1T91A 2OCAA 1CP2A 3VMFA 4DR4Q 4BFXA 2ORIA 1DO2A 3E2IA 3KOJA 4MYUA 1OFIA 4WZAE 1GOTA 1E1RD 2ZTSA 4IOLA 1MRSA 4PZYA 1VQKA 2Q8IB 3WP1B 1IHUA 1UKEA 1ZRHA 1UADA 2XJ4A 4OX9L 3K09C 3V9PA 3K0SA 5DI3A 1C4OA 1CULC 2V6IA 4NKRA 1NBMA 2HEIA 3GTQH 3GP8A 3FKSD 1GKIA 3EPKA 4A4DA 3U44B 2LMCB 4UJ5A 3LQQA 3Q5DA 1IAQA 2IHFA 2AHOA 4LFCL 2UKDA 1TTTA 3ZQJA 1FR3A 2G83A 1JXOA 2ZI3A 3HDTA 1GNRA 4Q1EA 5C0XG 3VR2A 2W58A 1GVPA 5E95A 1ESMA 1YKSA 4MITA 3ICQB 5FBLB 2IS1A 3QKRB 1GIAA 3W34A 2I4IA 2X8AA 4CEHB 4A3GG 1OXTA 2XXAB 1GNPA 2BCGY 1G7TA 2Z43A 4Q48A 3GLHB 3TR0A 4A0RA 2JLYA 2V8OA 4NTZA 3QPVA 2BV3A 1GAJA 1JQLB 4DB4A 2FA9A 3IIMA 4RJLA 2XGJA 2IF2A 1HNZQ 3CR8A 1PUIA 1GL7A 4MYCA 4DLWA 1V1QA 3S1AB 4ZCIA 1R9TH 4HJ9A 3ZD6A 2XSZA 1N36Q 3BB1A 4Q4JA 1E0SA 3A4NA 1NBME 1SN8A 2WSSA 1BO6A 1R5NA 5AR1A 4NYMQ 3K70B 2QA5A 3GTKH 4IJHA 3T35A 2O8FA 3AVOA 2IYUA 3FPAA 4V0NA 3U7EB 1HZAA 1XMQQ 4LNQA 4BY7H 5C1BA 3HKZG 2ZJAA 4JS0A 4KFUA 5KDDA 3DZDA 1VQ5A 3K0AA 4Z1MA 3E9HA 1TWCH 3PGZA 3OW7A 4G5GA 2ZS9A 2GN5A 2HIVA 3AYHB 4IJLA 1ASZA 2WAQE 1E2IA 1Z0FA 1ZD9A 3K81C 2OCPA 5CM9C 4C0HA 1YNJC 4R2HA 4D82A 1QHGA 4D81A 1KNQA 1DAIA 1N6LA 1OPXA 3NE5B 1S9DA 2BBTA 4OWTB 2ORVA 2JE6I 4GN4B 2WWWA 2XNSA 4F93B 4P71A 3AVTA 4PPFA 2PX0A 4G7HC 2MQHA 2Q2TA 1KIXA 2L0XA 5IP9G 2RGBA 3ZVRA 4OKSA 4A3KH 3WY9A 1RRCA 2JK8A 1P9RA 3TEHB 3BB4A 2FF7A 1Z2CA 2WBLC 3THWB 2SHKA 4X8MA 2A3RA 2ZUCA 1EESA 3OTOL 4UXJA 3VFDA 4DSOA 2OAP1 1VYUA 4YWKA 2W0SA 3S1NH 3SFVA 3PUZA 1R5OA 4QBHA 2AKWB 1LS1A 5JCZA 2HYIC 2WWFA 3UKDA 1CR0A 1ZNZA 4QOSA 5BN3A 4FMCB 5F2EA 2XB4A 3AM1A 2QPOA 2G77B 4DK1A 3ZIAD 5FR1A 4BLOA 2G3YA 1F3OA 4W9MC 1NJFA 1Z6AA 3LX5A 1IBRA 4MYHA 4C0SA 4LWZA 4C0QC 3T1VA 4O0AA 2VSFA 3GQBA 2K50A 4RZUA 4MRSA 3DMDA 3M6AA 1W36C 4PFSA 2ZUBA 4NXMQ 1CEEA 2X77A 1KAWA 4R4QA 1YJNA 1T0JB 4CDGA 1PA6A 1G9XA 5KPJA 3EZ7A 1EFCA 2TMKA 3WHKA 4DCNA 3ZS9A 1U0LA 1XNRQ 2BMFA 4L16A 4TN1A 5CITA 3M0EA 1VYVA 3GTGH 1EFTA 2G1KA 3C41J 4M21A 4XVRA 1D2MA 4LF6L 1XJ0A 3J7A5 4G0NA 3P27A 1VS0A 4Q03A 1CR2A 1XMVA 3DL0A 1GG2A 2VTKA 1YI2A 4PSAA 1A5TA 4URUR 3KUCA 3OF5A 1FMJA 2ZVQX 4JLMA 1XJQA 4V02A 2AFHE 3SC3A 2A8VA 4AKHA 4F38A 2DB3A 3GTPH 2D2CC 5H1YA 4V0LA 4URXR 1SHZA 5IWAL 1RW4A 2D3WA 1ZUIA 4JJZA 5FBQB 1S0UA 1GHKA 1VIAA 1TU4A 2CEAA 2GETA 2OZEA 3EZFA 2JEOA 1SXJA 3QE0A 4QXAA 1CKOA 2D74A 5CJPA 4CEJA 4JYAQ 1O7IA 3KJHA 2P5SA 2A5JA 5J40A 2QG6A 5JJKA 2X2FA 3EW9A 2EW1A 3EN2A 2ZRNA 3VKGA 5GJVC 4ZI2A 1W4BA 1JT8A 5C4XG 2IL1A 5IP7H 1QG4A 4IW3B 2PEZA 1WBBA 5EXSA 4AQYL 1P72A 3W1BA 2DHRA 4Q00A 3GDEA 1NKTA 2HLDA 4JYBA 1S1MA 5AUQA 3DM3A 3M4QA 3KF6B 4PO9A 4JI1Q 2A6ED 2E8GA 2H5XA 121PA 4GOPA 4JBKA 1T8TA 2Q6TA 2QM8A 2K4KA 1DAFA 4QBIA 3ND8A 2XZLA 3K9NA 1OJLA 3OE7D 3KDFB 2IHEA 1D2NA 2A5FA 1XEFA 4OWXB 2J0QA 2RF4A 3U9SA 1I4LD 4X64L 2UUCL 2AD5A 3MMPA 3UIEA 1E94E 1RC8A 1FNNA 2V55B 3CNLA 1OXSC 2JA8G 2FFBA 2MMGA 3ZQ6A 5ELOA 2FV8A 4HLQB 4I99A 3TKLA 1X3EA 4DXAA 4PZ7A 2WFWA 3F0TA 2GHIA 1L4UA 2VQEQ 3RN5A 5FLMG 4C7OB 2V7QD 2NVYH 4A3IH 4L5SA 4UXIA 8OHMA 5EUQB 1E22A 3F2DA 1UM8A 3HP1A 2F43B 2GCOB 1S1CA 3CCLA 3A4MA 5AJ3Q 4RD3A 5EP1A 3MLEA 4A0HA 4GT1A 4CT4B 3I72A 4DR1L 4PC2A 1Z63A 5DLQE 4X6AH 4M8NE 2PMKA 4JV5L 2BA0A 1AGPA 4LX0A 5AUOB 1W46A 3I8XA 4KYUA 1ZUHA 5C4GB 4TQUS 3L0OA 1JNYA 1SULA 4JG2A 3MRSA 2N49A 2KHIA 4DV3Q 1E1RA 2E76C 3IUYA 3TJZA 2NQ2C 3NDBB 3M3YH 2GF9A 4L4UA 2EVBA 4NXNQ 3N6RA 1B0UA 4EKDA 2GAAA 2WWHA 2DN8A 4JZKA 2H17A 4BXXG 2IYRA 1JEEA 1CKNA 3HOYH 3FKSA 4KKTA 1X3SA 1ZW6A 3L8ZA 4LUCA 4YMUA 1B9NA 4F91B 2IS4A 5HY6A 1AM4D 2W2VA 4K0KQ 4DR3Q 4ABYA 1OH5A 4BFSA 3RWOA 1OHHD 3BDOA 3CCRA 1SXJC 2OLJA 1X8LA 4BLSA 1JAHA 2EXDA 1P60A 2FNAA 2FFQA 1QBKC 1M90C 1IJEA 3I7FA 1M7GA 3J7ZC 5KNBA 2ERYA 1ESNA 2REOA 1VF7A 2Z83A 3HWSA 3VA7A 4LHVA 3RRNA 4JC0A 4C0JA 2JLVA 1KMQA 3A8KE 4YHHQ 1LACA 1ANKA 4MA4A 2ZRCA 3H94A 2CMKA 4YWMA 5DLQC 4JI0Q 1Y8NB 1XMIA 4AKIA 3EA0A 3HR7A 2FDCA 2PEYA 2IXGA 2PCLA 4G5SA 3C5CA 4RKFA 4AY2A 1GKYA 2JA5H 1G19A 1XMOL 1ZNWA 4GOPC 1E4VA 1N6OA 2ZROA 5FI0B 2QTFA 2C78A 2JLWA 5SZIA 2FX3A 3ZGXA 2JCSA 5JHGB 5JS8A 5K8UA 5KSPA 1EWHA 1G17A 3K7AH 3QXCA 4M53A 2A6HD 2Q3MA 1EFRD 1NVWQ 3DZ8A 3PR1A 4MUBA 4DZZA 2RHMA 4LF8Q 4P4SA 2MSDB 1NRJB 1OFHA 4NCHA 4B3SQ 1CJVC 3AUYA 5FBWB 4RG1A 2UU9L 3T53B 3HGBA 4IFDJ 1JI0A 1W0JD 2FN4A 3AF0A 3E9IA 2ANBA 2QMOA 1M2OB 3MWYW 5LB4A 3U2QA 1XBTA 2FPMA 3JVUA 5FBVB 3NHBA 4GI7A 3I2ZA 3KYHC 2B92A 4Q1BA 4A3FG 4AK9A 2JJ2D 1DG1G 1X55A 3W6NA 4TLEA 1XEXB 4OK5A 4LYHA 1KGDA 1SKYB 4HATA 4AKGA 4JI2Q 4PTLA 4LC0A 1W49A 2ZT9C 4LHYA 3EASA 5JEAG 3OZXA 1TF5A 4AYTA 3N70A 3C8UA 2DCUA 3L2OB 3P32A 5AK0A 3PIPA 2YTVA 4R9UC 1GO3E 4R4OA 4WXRA 4EDHA 1C7YA 2V4ZA 3KXIA 3K53A 3SJBA 5HR5A 1QHHA 5KU1A 4LI0A 3LXXA 3B1ZA 2WIBA 3PUVA 3RLFA 1E1OA 2DNCA 3EAQA 3DXJC 2C35B 2VA8A 1WRBA 1Z2AA 1KIMA 1HR0W 3FKQA 3IQWA 3KJOA 4O2LA 2MNAA 4KBGA 3M4PA 2JEAI 1GDDA 3K0EA 4MKIA 5EP2A 3PEWA 1NLFA 2IA5A 2XTZA 3GJ0A 3P4XA 1H65A 3ZIAA 4QL5A 2NVXH 3TUZC 1N33Q 2QU8A 3PG5A 4EUNA 4TL9A 3KQKA 1I94Q 1HA3A 5KHOC 5KSZA 1RPZA 1KKMA 4YY3Q 3PUYA 1IN4A 2ZRGA 1J7KA 2D2FA 4APVA 2CLDX 2OXRA 2AWOA 2FU5C 1CKEA 4M2LA 3KFVA 3NWJA 2JLUA 1Z6XA 1X86B 2VO1A 3GJ7A 4B3RL 4OK3A 3T34A 1SVIA 3KUDA 3JVVA 3VX4A 3WBKA 4B3BA 1M7HA 2JAQA 2R7FA 2NG1A 5GROA 5LD2C 3IKJA 1QRAA 2J41A 4JLPA 4FMDB 1GRNA 3LGJA 1KXLA 1XPUA 1VQ9A 4LSGA 2ZS7A 1JE5A 1BMFD 3MWLA 5E7JA 1MO3A 4UXHA 1E3PA 2PI2A 3GFTA 1DPFA 3EX7C 2IUSA 1DAMA 1HR0Q 1AKYA 3WBJA 4PPNA 2W6JD 1QF9A 2QEQA 2R6AA 1NY6A 4LJ9A 3SN6A 3Q8XB 4DR6Q 4XD7D 4DCVA 3CWZA 1JPJA 5J4KA 3S2DH 4P31A 1E9BA 4N1AA 1S8FA 4B32A 1Z0DA 1OV4A 1R0YA 3LBNA 3S1AA 2J9RA 1E2VA 1PH4A 4A6XA 3RLNA 3CF6R 4LJ4A 5GVRA 1P75A 2P6UA 2WAQG 3FB4A 3CCEA 3IIKA 1IY2A 1SVKA 2J0UA 4U00A 4KSBA 1YEZA 4QJFA 1J8YF 3S15H 1R8QA 4PZ6A 2HT1A 1Q0UA 3FTQA 3GLFB 2EYQA 1KY3A 1CI3M 3WMGA 4HJ7A 5IYBG 1EX7A 3A7LA 2PNRC 2LCFA 1WB9A 2ZR0A 4QQBX 3A1SA 4JBJA 3WNDA 2LKDA 4C2UA 3RN2A 4LF5L 3HOWH 3LWUA 1E6CA 1UKVY 3OE7A 3QF7A 2ZJQA 3GMTA 3WXMA 4OHWA 2UXDQ 2GXAA 1SRUA 4MGIR 2IK8A 4Q7LA 4DSUA 3CP0A 2HT6A 3GLHE 2F52A 2XAUA 4XWAA 1FMLA 2EU8A 4AYWA 1CRPA 2UXBQ 1FJGL 1A2BA 2PCFB 2CLCX 1AQUA 3GJXC 3BZCA 2JA6H 1G3IA 3KKNA 1PLJA 4S2EA 3CMAA 2QQ0A 5GJCA 2GVDC 1II8A 4A3LH 4KAXA 2V7QA 1V43A 2HF9A 2ZJOA 4B75A 3R9WA 5FL7D 1FUKA 1VCMA 2ZI6A 4A3BG 2O8CA 3Q8DA 1VPLA 5BN4A 2H18A 4G5RA 4PC6A 1N34L 3IBYA 1VQJA 4HJAA 3G6EA 2YOFA 3AKCA 4E09A 1KZ7B 2F6RA 1ETUA 1TKWB 5JEAH 4JJKA 2H5EA 2NTYC 3TREA 3FHTA 2FFHA 4ARZB 3A8JE 4PG3A 4L9WA 1G3QA 3T51B 3EIHA 1NSTA 3HJNA 4DV5Q 4GRAA 2JATA 4RKEA 5CIWA 4JI7L 2K7VA 2VQFL 5FOTA 4DDWA 2VPPA 1UPTA 1LVGA 2RGEA 2CCKA 2FOLA 2QAGB 4JSTA 2P65A 2C95A 3IPYA 2RAPA 1EIFA 4R4IA 2FWRA 4A4IA 4RD0A 4D4LA 4KN4C 3A37A 2E5LQ 1RIPA 4JVSB 4JCVE 4DSTA 2OAQ1 4Q01A 4A3MH 2CDNA 1M74A 5SZKB 3R9XA 2A2ZA 3LH5A 4DR5Q 1OHHA 3HOUH 3CF0A 1GTVA 2WAXA 3PIOA 2R92H 1YNXA 3U3OA 2F1HA 4XWOA 3I56A 1G3RA 3LO5A 2QP4A 2WM9B 3T06B 2E2JH 2EQSA 2R93G 2UXCQ 1TF7A 4R98A 2AMCB 3A1WA 2QUZA 3FOZA 2JLQA 3BBPA 3EPLA 4OQXA 4AG6A 5P21A 2EJMA 4BBSG 4AG5A 2UUBL 4Z51A 3KKQA 4LJAA 5DHAA 2XB2A 2A6EC 1G4UR 4G5OA 4KU4A 4QFMA 1UBEA 5B58C 4KKUA 1IOZA 1GD7A 5LMUL 1HZ9A 1GL9B 2OBNA 1L8QA 4OL0A 1BKBA 1EFRA 2YWFA 3Q7PA 4C3ZA 3AV0B 3AB9A 1QHNA 4BASA 3KF6A 3NKVA 4Q9LA 4YMWA 1CXZA 2KBFA 4MNOA 1W0JA 5LPNA 1WOCA 1I2MA 1HNXQ 3GD7A 2NVQH 4WJ3M 1HTWA 2JDID 1BOFA 1OKKA 3PV0A 3TE6A 3BJUA 3BS4A 2JJ2A 4FCWA 4L8GA 4LJYA 5DGXA 3QSYA 3UK6A 4JI4Q 3FE2A 4B44A 4IXMA 1IBLL 3KJEA 3ASYA 4RFSB 3T12A 4Y0VA 1NVUQ 3PCOB 1K8AC 4UPAA 2HYDA 1GZSA 2QPTA 4M4SA 3VTKA 4EPWA 1I5FA 2QT1A 2F9MA 3SE0A 3SGIA 1E9RA 1KI1A 3SJZA 4C7OA 4TLBA 4CGZA 4R71A 3CO5A 3FFBA 4PAMA 2K33A 1JR3E 5L3QA 1IYVA 2ZJRA 2F43A 2GCOA 4EJSB 2IUTA 2FPLA 2R9VA 4K46A 1KRTA 4TTRA 3KQHA 2VBCA 1UEBA 2NN6H 3H2YA 3G4SA 1VQGA 4GS3A 4OXPA 5EAYA 2IYVA 3AKYA 3P26A 5C4MA 2O8DA 5M3FH 2WMOB 2V1XA 1I4TD 4NCJA 3CNOA 2ZSEA 4KHZA 1N32L 1TWFH 3J80c 3PENA 5FFMA 5K8LA 5DN6D 2HF8A 2FEOA 2WWIA 2BMEA 1XEWX 4QJ3A 2CHQA 2QP3A 1OTCA 1RFLA 1YQTA 2O0KA 3CF5A 1IL2A 2J46A 2O0JA 4DK0A 3A1VA 3BXZA 3DKPA 3DOFA 4J0QA 1KSGA 3WHLA 1Z28A 3LVQE 4OI1A 4HJ8A 1VHLA 5TARA 1G7SA 5JEDA 5TB5A 2EYUA 3PCRB 2JA7G 1K8OA 4A75A 2CJWB 1US8B 2EFEB 4GKKL 2DWPA 3HU3A 4US2R 3TUJC 3QPUA 1F6BA 1XX6A 4FMBB 4FW9A 1BIFA 4QNMA 5CB8A 1EYGA 1KK1A 1ZP6A 1MIUA 5FL3A 4PC3A 3KQLA 1Y69U 5HTKA 1Y3AA 1E98A 1BMFA 4FWIB 1A82A 2V54A 2PL3A 4Z54A 1EXMA 2A6HC 5GADC 1V8QA 2DNEA 1Z6TA 4GPTA 3KB2A 2CE7A 5AJWA 4MDFA 5TXGA 1VG0B 2W6JA 3BU2A 1XTKA 3P1JA 3DM5A 3K0CA 4XD7A 2VHCA 2O8EA 2B6HA 2V9PA 2NO9A 4HR7B 5G3ZA 1LTLA 3K9LA 4DWJA 4XSHA 4OQMA 5HE8A 4GDFA 4P72A 2JLRA 4C0AC 5AJVB 3ZZTA 3A5ZB 2W0MA 2CL6X 4MGYR 2NO6A 1B70B 1HH2P 1DCZA 5BR8L 4LF4L 4HAVA 1GUAA 2WAYA 1PH5A 3HFZB 2IHBA 5D3QA 1N6PA 3QEJA 3STBD 3T1TA 4Q19A 5IYCG 3DKVA 2A68D 2L15A 3B6YA 2OT3B 2P0EA 2WWGA 4FMCF 1W4AA 5JSZA 1TADA 2FG5A 3TSOA 4DUYL 2ZJYA 4IXNA 1Z8FA 1TEVA 1WFQA 2W6ID 5D3MB 4DB2A 2ZITA 3EC1A 2F3RA 4V0ME 2FEMA 3DEFA 1VQ8A 1VQ7A 4A3EH 3J80i 4Y52H 3BOSA 3PJRA 1HEIA 4PZLA 3TSZA 1DBSA 3QBVA 3T1HQ 3CIOA 4KFSA 2RH5A 1OLOA 3UATA 1HNWL 1R10A 1VCOA 1P16A 1G3UA 2Q3FA 3PQCA 4EPXA 4GKJL 4IFBA 1XD9A 1ELOA 2GF0A 3MD0A 4Q7MB 5GJWC 2ZI5A 1BH2A 2R2AA 5JLJA 1OH8A 1EQQA 3A74A 2ZI9A 4M22A 1DADA 4ESVA 1Y1WH 4JIMA 2GVZC 3QXHA 3TSWA 4DUZL 4URYR 3EQLC 5FL7A 4POGA 4JI5Q 1NF3A 4NBSA 4NYJR 1WBDA 3TBKA 5FPTA 2DFLA 2BM1A 2IYSA 1WF3A 5DHFA 2AUKA 1K73C 2CK3D 3W5JA 1S3OA 3W3ZB 1N9WA 1PJRA 3G0HA 1XNJA 3MXNB 1AA9A 1JPNA 3GJ3A 3NEJA 3HOVG 4B3GA 2CWAA 4NE2A 3RLOA 5CIQA 4LF7Q 5EXXA 1VIYA 1IQPA 2HXSA 3ZYCA 1X1SA 4OHVA 2LKCA 5EZ5A 3RYTC 4D4MA 2BHRA 3U3KA 1GWNA 2AR7A 2FSIA 3HR8A 3RS0A 4OONA 4BY1G 1SKYE 2BBSA 2XJ9A 4LGMA 2LXJA 4DT1B 1UBFA 1YHNA 2QGQA 1CJKC 2QI9C 4I81A 4QKQA 3U50C 2QGNA 1MKHA 1VG9B 2GILA 4TMXA 3HOZH 2Z4SA 5FTKA 1B23P 5H1SE 1ONBA 3TZUA 1AQYA 5K36H 1LUZA 1MV5A 3RANA 1G64A 4BBRH 3CH5A 3K0CC 1MH1A 5C2JB 1G5RA 1YU9A 1H9MA 4GNXB 1FGUA 1ZC4A 4X8LA 4OYHA 4BZQA 5HZHA 4M9ZA 2B63G 3RDPA 3ZS8A 3LFUA 5FUVA 3T5DA 4ZDWA 2YTYA 1J5EQ 1ZIOA 1SQ5A 4O25A 1NSFA 1TU3A 3PUWA 1XCMA 3GJ6A 2Q2UA 4PHHA 4LHXA 2XZPA 3E1SA 4B3FX 5JEEA 4I1SA 1II9A 4ZPXA 1RIFA 4BFZA 4GN3B 4NDZA 2FH5B 4Y0AA 2BEKA 2IYTA 4YWLA 1D8TA 1SVMA 2IX3A 1P2UA 4ASUD 2IEZA 2PMDA 4YC7A 4ZDKA 4NP6A 2F3TA 2C03A 1IYJB 1DELA 1UDXA 4TT3A 1GJXA 4C3IH 4DAYB 4DV6L 1LS6A 1Q1ZA 1U5KA 4IFDG 2H8KA 3GJ8A 4ZI3A 1OYYA 5BXQC 1T9HA 3D4RA 4B34A 1V9PA 4CYMA 4OHYA 521PA 1XPOA 1AKEA 3OESA 1U8ZA 4GBMA 2BKUA 5CDFE 2MO1A 4IVPA 5TMPA 5KSYA 4LY6A 3SJAA 1A6XA 2CL7X 1P8LA 1KI9A 4OX9Q 4AIIA 3U3MA 3QY0A 4URZR 5FPYA 3BH0A 2JDIA 4P75A 1Z06A 1NMGA 3R8CA 4AD8A 4O3MA 4ZO4A 1NY5A 3KZ1E 1QZGA 2R8RA 3L43A 4FIDA 2ZTCA 5C18A 4LCBA 1H9RA 4A3CG 1VDZA 2ZSAA 1WDTA 1OXUA 1U81A 4LJ7A 4DV1Q 4Q4AA 1VQAA 2D06A 1S96A 4IDPA 4WZBE 4DC9A 4ZDIA 2F4VQ 1HURA 3VR3A 1VQBA 2ODWA 3CMEA 3CLVA 3KXLA 4LHZA 4ZCMA 4DV4Q 3IHLA 2JJ1D 1T3LA 1XXHB 3GEHA 3ONWA 2JA1A 2EFGA 3CRRA 3U4QB 4JBWA 2ZI4A 2KENA 3MXUA 4II7A 4W5JA 1PV4A 1E9AA 4NL4H 2ORWA 3LBIA 2ZU6A 1LABA 3FFAA 2OXCA 4LYAA 5KDOA 3OPOA 4C9BA 5LMNQ 1QZHA 4MH0R 3SBDA 5FOSA 3GLFE 1C9KA 2RMKA 4TTPA 4YONB 1HNZL 2F1RA 4HUQA 2ZXUA 2YWGA 2ZJBA 2YC2C 1KHTA 4GZLA 4DCSA 3K80C 3K8YA 4BUJA 2ODBA 1X56A 1N36L 3W3AA 5JFGA 3D7MA 3KFXA 1Z9FA 3P20A 2VNUD 1NIJA 3T56B 3VDYA 1XJVA 2BCJQ 4QNRA 4UP7A 4KLZA 5DN6A 1KI3A 3HU1A 3PITA 3TLXA 1IW7D 2FE4A 1NJIC 3L7ZC 3W5IA 1HUQA 2YOHA 4E5UA 2K5UA 1HQCA 4RMFA 4FI3C 4OO1G 1IM2A 1E2QA 3SYLA 3B9QA 1G291 1H8HD 2WMNB 3S1QH 2GCPA 1RYHA 2JIZD 4WXPA 3SHFA 4LFAQ 1ZINA 1J90A 2VHUA 2BH2A 2A19A 2Z6KA 1LF5A 1DE0A 1Q12A 4JLVA 5CLLA 4L5RC 4M0LA 4OHXA 5CYPA 4DSNA 1A8VA 1N6KA 2EWWA 2AK2A 1MR3F 4F7WA 1VQIA 2RHSB 4M1MA 5B57C 1YR8A 1UE6A 1MO4A 2LWIA 1G21E 2H16A 1X6OA 4URWR 3TR5A 1KSJA 2FMXA 2E75C 5M5WH 3OTOQ 4TYQA 1T5EA 2R7ZH 4LUZA 1G1MA 4HLCA 4B73A 2NZHA 4A3JH 4L5QA 1IONA 1ASYA 1PLLA 1N0UA 2YOGA 3A1TA 4OI2A 4V03A 4BPBA 2IYQA 3AVPA 3EG5A 4XOIA 1JR6A 3MJHA 1Q20A 4B48A 2QSYA 1VHTA 2ZRPA 3E0EA 2HQLA 2WWXA 1YIJA 1W5SA 1MT0A 4UNRA 3RRMA 2CBZA 1E0JA 1KK3A 1MO5A 3CZQA 5IHPA 3FMIA 3ADCA 4DR7Q 2WKQA 4ZV4A 3A5UA 4NXML 1G6OA 4B3TQ 1E9EA 1W4CA 4DKAC 4TSFD 3CXCA 1CF4A 4D0LB 2I5HA 2FFAA 2W6IA 1NP6A 2ONJA 2GTPA 1TXYA 3HOXG 2YKGA 2YYZA 1PH7A 4HEJA 2VIIA 1E0AA 1WE2A 1CTQA 5F98A 1VG1A 4IVRA 4Q02A 4WAUA 1EFWA 1HCZA 1J99A 1S3GA 1E69A 1U0JA 1W47A 3C4JA 3NBXX 2R6DA 4O0MA 1W7AA 2BE5D 3FHWA 2R65A 5TV2A 4RD1A 3EPJA 2VL6A 5TY0A 2IXEA 4DNRB 5HE9A 4B6EA 3G48A 1BYUA 4PXAA 1VQHA 4NYIR 4IOJA 3KTAA 5C0XH 5J4LA 4EJSA 5J47A 1E2GA 3ZVNA 4TKOB 3A36A 4UKDA 3K70D 4FMDF 1G8PA 4PANA 3CQZH 3X1DA 2J59A 1MABB 1JJGA 4A3GH 3K8AA 3W9YA 2XTIA 2CK3A 2VL7A 4M9QA 3U7HB 1NY4A 2UZ3A 3UDFA 3DOEA 4M9SA 5JCPA 1LTQA 1NMXA 2J87A 4I1UA 5A4JA 5SZHB 2R7DA 1K3RA 4KLKA 4A0FA 1QHYA 4AURA 4NB3A 2Z6KC 5KNCA 4LJZC 4H02A 3CCJA 5FLXc 1VYTA 3U4ZA 1NJGA 2VP5A 2ZRHA 1Y8PB 3H0GG 4AQYQ 1XD8A 4HAXA 5K8TA 3PFIA 2OFXA 4FXPA 5G53C 1A0IA 3CZPA 3OEED 4DLZA 3B1VA 4LFBQ 3O47A 3HKSA 4JI1L 1NG1A 1Z6YA 2NO7A 4GMXA 1QG2A 4I1OA 4B3CA 1KYIA 2DPXA 4F4JA 4Q47A 1OE0A 4PQFA 2I1QA 4B47A 2GZHA 4NYJQ 2C9CA 1OH6A 5IT9c 5IDVA 3NVAA 4KITB 3KJIA 1KKLA 2F1JA 3ADKA 2VSOA 3OAAD 2QBYA 1H9SB 3CX7A 4V0KA 4RD2A 2ZTEA 2RCNA 4BLQA 2IX0A 2WJHA 3IO3A 2IWHA 4X64Q 2A69D 2O5JC 2UUCQ 2C96A 2KSQA 3EWSA 4I1VA 3PO3G 2VRWA 1G18A 3BC1A 4E07A 3K0XA 3LY5A 1PLKA 2QL6A 1QDEA 3RS7A 3VR1A 4DV0L 2E87A 3STBC 5IP9H 2NZJA 1Z22A 2A68C 5DISB 3ERSX 1I6VC 1Z6HA 1XMSA 4OJKA 4L15A 2JJQA 3AGPA 1TU2B 1IN5A 2CHVA 4DR1Q 2IWRA 4QGHA 5M3MG 2QEXA 4TLAA 1KI6B 1FX0A 4BLRA 4TWZA 1XTQA 3ZZUA 3BG3A 3CCUA 4YXWD 3MCAA 2EDGA 4DV3L 3CUEF 5B30A 1WJJA 2GXUA 4YLGA 4BWYA 3MGCA 4FCTA 4GMDA 1QVCA 4NZYA 4NXNL 2ECKA 3PEUA 4EJSC 1XD2B 3RR5A 1E2EA 2N46A 3QIAA 2I5LX 4QRHA 4DLTA 3M85A 4DR3L 1CBUA 2QENA 1MJEA 3IEUA 2DUDA 1SHKA 1XNQQ 3VKWA 2ZETA 1CIPA 4LOAA 4A2PA 1W2GA 3WMFA 1TX4B 3CC7A 2YZ2A 2CVHA 2JJ1A 1QVAA 3THXA 3RHFA 1KDRA 1KJWA 2NOAA 1UKZA 1Q81C 1X8KA 2GJ8A 2JASA 4IOMA 3IHWA 4ACBA 4YHHL 4CT5A 1WCV1
chains in the Genus database with same CATH superfamily
1KBQA 1L4FA 2QGZA 1X1EA 3EQZA 1N1EA 1PXUA 3T4PA 2OCXA 1WTVA 2AXPA 4YT2A 1IJBA 2LCIA 4ZT7A 4HMPA 3IUQA 4JI3Q 3CONA 4YMIA 4U7DA 3UT5B 3KOZA 4YJHA 3WOEA 1WTPA 1GUNA 1ZXBA 4JI2L 5HFJA 5IYDG 1CM9A 1P2TA 1JJBA 1N5KA 1RLTA 3JR7A 3IR5A 2EP7A 3I4OA 4DXGA 1ZIPA 2GK7A 5H02A 5HDBB 3JQAA 1STAA 1SQ6A 5ESWA 2EWVA 1GKUB 3JYPA 4CZ2A 1Z5VA 1AF4A 2IYXA 3TJMA 1W4ZA 4IQ0A 3OQMA 2BD0A 3NR2A 1HUMA 4O2AF 1FYWA 3WLPA 1U7HA 1WD1A 1RJGA 2G6TA 1ZM2A 2CSXA 2DKFA 4NNJA 1D2GA 2PZEA 3PUJA 1B26A 4MPRA 1UXIA 3PD7A 1UQUA 3OEEA 4EPVA 5C5MA 5TQ0A 2VPXA 3PWZA 1WSBA 3MD9A 4TTTS 4Q93A 1W36B 2ONKA 2NU6B 4OYRA 1DS6A 1F4LA 1O9GA 3B1XA 1BGVA 4AIMA 4WJ4A 1B76A 1KYXA 1XDUA 1RTKA 4YRMA 3KVOA 5AI0A 4DV2L 1YJ9A 1FLVA 4DLBA 1HE1C 3TOSA 2E49A 4FDAA 3S14H 1K3FA 2DJGC 1ZU4A 1KEEA 4P4UA 4MVCA 1Y4AE 2VFAA 4KV9A 1O5OA 1WTAA 3WL6A 5I45A 5C3EG 4FYWA 2XY4A 3DBLB 3A7DA 4S12A 4HDNB 2WD9A 5ETJA 1PL7A 2EOTA 221PA 2GUWA 2Z4RA 2X8JA 2DQSA 4DBZA 3SXUA 1EFUA 1NNEA 3LHKA 4MHOA 1P0MA 4FGJA 2XGTA 4BC0A 2G36A 3X3MA 2BR5A 3K30A 2I99A 4BO0A 4RLFA 3D2LA 3VYUB 2QJOA 5AXAA 1DTEA 1X38A 3FBTA 4DLUA 3QPWA 4DIEA 4EEXA 2PZFA 2XRFA 5EHXA 1R6AA 3Q87B 2OO3A 4RV4A 3L6BA 2QAIA 4BQEA 4F5DA 4O2DA 3I45A 3TCNA 5E1BA 3D3QA 3Q10A 3E4DA 3HOZB 2C2MA 1OLXB 1K8GA 3EVTA 2BWJA 5TQ2B 1G20E 1XVLA 4BFVA 5KS2A 4QGAA 1FP4A 4IFDI 2HDHA 3K0FA 3L0SA 5JROA 3I9V6 3IB3A 1YZYA 3D6MA 1MIOB 6Q21A 1M2EA 1CY2A 3Q24A 3FGPA 4C3IB 4OSEA 3LL7A 1T9ZA 2JEZA 4DV7Q 3WRWA 3MHPA 3FKJA 4CN8A 1FTNA 2OCLA 3QNWA 5CFMA 3K2IA 1E89A 3RAJA 2ZJ1A 1YI8A 1V7CA 2NQ8A 2ZJ6A 1MXFA 1YVCA 2A0YA 2KB0A 4G01B 4LXUA 2IRWA 3HSKA 4L8FA 3VO1A 3RS4A 2JEBI 3GQVA 4FDUA 2Q5HA 1Z4IA 5ALSA 3DTTA 4KVFA 1X7DA 1O08A 3JWIA 3PU6A 2GEUA 1MVNA 4WK4B 3REGA 4V1CB 3ROEA 4A76A 3HUUA 2PMFA 4FB5A 3WLEA 2R97A 3C98A 2C2XA 1KEUA 2CCGA 2XUQA 1SGWA 3EIVA 1B74A 1OSNA 1SQFA 4KK3A 2NO0A 1EZZA 1QHHB 3A4LA 1PK8A 2KYRA 5IXSA 1XZFA 1PJ2A 5FKAC 1BVYF 4MUMA 4DUZB 3CCMA 2R7ZB 4ZVRA 2P9JA 2FI1A 1D7QA 5IYCH 3TYXA 2BGWA 3S4YA 2WZQA 4IMPA 2F8LA 4C0KA 4HUTA 4R2KA 1HHVA 2GEVA 4HCJA 3C1EA 1NQOA 4RVCA 2IH2A 3HEAA 4OP2A 4KGZA 4G9EA 4N8EA 2B39A 1WD7A 2YYSA 3BCRA 3O4HA 1AIPA 4AS2A 1HZCA 2ZQZA 3B6MA 1N2CE 5EE9A 5AM3A 3CAMA 1INLA 3QXGA 3BMNA 4DSZA 1UDWA 3UDGA 3HYLA 4HCEA 3L4EA 4CU2A 2BGRA 4R4JA 1PGQA 4DPMA 1YB5A 3HP7A 4DMFA 3UDXA 5FOXA 4HIOA 1WTOA 1E61A 2W2KA 4F3KA 3GVXA 1UQRA 4GPD1 3FUXA 1I9CA 4OUDB 4EKIA 3BGSA 4P82A 1Y8RB 1L5FA 3LBHA 3S2HB 3SVMA 2WAAA 3LDAA 3HOYG 1LT5D 3UE0A 9MHTA 4NJOA 1ZMOA 3NBYC 4BZZA 4LOLA 3K1YA 5CFPA 1MPXA 2BMWA 3ZUGA 4FX5A 3TL3A 2A1AA 3RC9A 4P98A 1FJXA 5AUPB 2IBSA 1OIXA 4AWAA 1Y6GA 1YUBA 3MFYA 1V11B 2IPXA 3V6LA 1QWOA 3W8EA 1IXRC 3FWYA 2GEKA 3CD6A 5I4CA 1QO0A 2XSCA 1KOFA 2ZIVB 2SNIE 2VRCD 4B08A 3B6IA 3EEIA 4Y9UA 4LFBL 1DJRD 3UDIA 5JJ5A 4GWLA 3BQ9A 1DVRA 3CISA 3DE4X 1N3IA 1MZPA 2PZLA 4P81A 4YB8A 3U7QA 1YF3A 3A6DA 4ASUA 3GPLA 4DV0Q 3JAKB 1XNRB 2RHDA 1SUPA 3T7JA 2CLHB 2KHSA 3ZE1B 2PHZA 1C0PA 5ER9A 1J49A 3VA5A 4B4DA 1KERA 2JL1A 1VJ5A 1ECGA 2DUUA 2ZRFA 3CCVA 4XQGA 3T3PB 2X9QA 3VSEA 4GPEA 1ZM9A 1XMOQ 1UZLA 2IS6A 7GPBA 1MJGA 3D8GA 5CV9A 1VL2A 3D7RA 1EX6A 1V4BA 5EGTA 2HXYA 2UYQA 1M54A 4P80A 1BDOA 1CZOA 4HXYA 5CA0B 1A3CA 1J4AA 4UHFA 4F4DA 5DRYA 2PX4A 2I46A 3EIEA 3WMXA 4IALA 3JD0A 2H57A 2WIDA 1WXEA 3GLKA 5F9HA 2MIIA 2IEDA 4YRLA 3KFUA 1IYUA 1AZLA 1ONLA 1CNEA 3BMQB 1XK7A 2O7VA 1V3VA 3HGMA 3OZIA 4YASA 1F2TA 2W6QA 3LE8A 2J3LA 2ZM6L 1CQIB 2H7VA 2E1RA 4H35A 1M1KC 5AHKA 5BYKA 1EL0A 1H9JA 2P1RA 5DB4A 5HTOA 4O4IB 4YRTA 2VRCA 1M2KA 1N8RC 1Z3CA 4AC9A 4D6YA 3W5OA 4KIGA 5M5BA 3TGWA 2HO4A 4BMZA 2YC4C 3TDNA 3FPUB 1X9NA 1O78A 3D3RA 3SEAA 3B3GA 2FW6A 2YJNA 3NYQA 1SO8A 3GOQA 3EJIA 2KCMA 1BN7A 2F0DA 1C41A 4R4CA 3I2HA 3L1JA 1P62B 5E6UA 5D51S 3QI7A 3KDPA 3DVLA 5CT4A 1TTHA 2ZSHA 1EGAA 5KHAA 3RAPR 2IHNA 3NATA 4Q66C 3D7NA 5DM63 2YWRA 4PNZA 4XJSA 4U6QA 4FHDA 1DLJA 4F9GA 2WICA 1WW3A 1YQXA 1E5XA 2Z09A 2HK9A 1LBTA 1MEOA 4NK4A 2DMRA 2ZQ5A 1Z8DA 1XZQA 1DB3A 3DAGA 2WKPA 3EF0A 3QGMA 1JFVA 5HVNA 2K28A 4LJ5A 3NENA 4XIIA 3IURA 2DFVA 3SYKA 5I5EA 4XYGA 1G0OA 5FADA 4IDQA 1C9NA 1WCMH 2VH2A 2R0QC 4DDTA 5CDSA 1M83A 2WSSD 2ZTLA 2PBRA 1M34E 3EXG2 2R4QA 4H7HA 3RNOA 5H8WA 2X13A 2VSXA 1YL6A 1TWGH 3H9GA 1VJ0A 3VPAA 2QYTA 1MU0A 1SD1A 2ZVJA 4I55F 2EIFA 1VIMA 5KYUB 1H95A 1MO6A 3FSJX 3OKPA 1YQUA 1MVLA 4JI8L 1A62A 3HCWA 2Y77A 2D2EA 3SQNA 2JA7B 3GNLA 5BNWA 4EELA 1JQEA 4MP8A 3PJDA 2YFKA 4KPYA 3T5BA 1ZN7A 1JAXA 4M1EA 1RJ9A 4Y9RA 3EMKA 2WU0A 3SU8A 4BLPA 3O90A 3K09A 2W37A 2J45A 3PO2H 4IICA 3DL4A 3QELA 3MPUA 4AUKA 2QUIA 4PSKA 2HBZA 5KAPA 4K9QA 3THXB 2CQOA 2P11A 3JAME 4QAQA 2X1HA 2FPKA 1L1EA 1YE3A 3BBLA 1ET6A 5BR1A 2Y67A 3QVLA 5IJXA 1X0XA 4ZV7A 2I4LA 2AN4A 5JAOA 5IZ4A 4Y6QA 1Q3KA 1QUEA 3COYA 1TIBA 5I9TA 4OHBA 1TEXA 2VVTA 4TSKA 5FUYA 5DNDA 4YRFA 4A3JG 4EZIA 2WTUA 2XTNA 3FHJA 1J0EA 5DI9A 2H6EA 4IKEA 1E6KA 2WABA 2XWJB 4OX9Y 4FNOA 1IHUA 2V6IA 2UZ1A 2LZ0A 2OV6A 3LQQA 3DFZA 1GEEA 3I53A 5AXCA 1ICWA 3NGMA 1X7XA 1OXTA 3LOQA 1G7TA 1KU0A 4RJLA 4L08A 4WKCA 4DDHA 1QYIA 2WSSA 3PLNA 1P4RA 3C6MA 3IERA 3FPAA 4XWWA 2B2WC 1J5EB 4JS0A 3ENZA 1J39A 1E2IA 3K81C 3H13A 1SY7A 2BBTA 4OWTB 2XNSA 4J6EA 2X7JA 4L6TB 1XEAA 3B38A 5BVHB 3DUWA 3PQ6A 4W7IA 2OAP1 3K4HA 4ZU3A 4QBHA 3UKDA 5F2EA 3WKBA 2GN2A 4NF2A 2HCRA 2M2IA 2F0MA 1SMKA 5KJFA 1W36C 3J80L 3I01A 2FQWA 3FIJA 4OXYA 4E46A 4X84A 2ZBEA 3J7A5 3OE1A 5M2QA 1CR2A 3ULKA 1K5PA 2B3TA 3K0KA 3D3KA 1KU6A 2D2CC 4JZYA 1GHKA 2OR3A 1TU4A 2BMVA 1CKOA 1WY5A 3Q3EA 1KQNA 3S29A 1AUPA 1JT8A 5CT9A 1JGTA 1XNHA 2EX1A 4A93B 2JB9A 2QM8A 4FYPA 3ND8A 1KXJA 2PRJA 4X64L 2AD5A 5ELOA 1E3IA 3LUJA 3F0TA 2VQEQ 3RN5A 1UM8A 2F43B 1TT7A 5B6IA 1S1CA 1XXLA 2ZB3A 4QB4A 5IMSA 3YASA 2FUG6 2G5PA 5C4GB 4TQUS 1N9KA 1HWYA 2VSYA 2ST1A 1ORHA 2PZTA 3SJUA 3N6RA 1OYOA 4PFJA 2IS4A 4JA2A 4K0KQ 3OQJA 4MDYA 2QSUA 3EN0A 3SEFA 2REOA 3THSA 4LHVA 3VA7A 3C97A 4YHHQ 3RSZA 4RY8A 1MB3A 4JBIA 4AKIA 3HDJA 3WO0A 2E2IB 4ENQA 2IXGA 3MTSA 4MV5A 3TECE 3K4QA 4BNJA 4YCBA 5BY2A 1XBTA 3NT5A 4A3FG 2C2YA 3S0JA 1S2NA 5FO7B 4LC0A 2ZT9C 4KLCA 3OZXA 3I1IA 4J29A 2JG3A 1LEHA 2ZYGA 1L5YA 4WN9A 3QLJA 4BP3A 1DBQA 2QV0A 3A25A 3K0EA 1YB1A 1ZRNA 3CVOA 2YHAA 1RQPA 3PDJA 5DSXA 1I94Q 3A6GA 1EGMB 3PUYA 1YACA 4APVA 5A3QA 3OHSX 3N53A 2XNHA 3BAZA 4FR0A 5LD2C 3UUWA 1IHYA 4UEWA 5EJGA 3MWLA 3DQPA 2GPTA 1ZSVA 3GFTA 4DN4M 3V05A 1J22A 1TAQA 5F9MA 1FBTA 1GTZA 1JU3A 4AMBA 2KUMA 3LBYA 3DP9A 4LOIA 3TP6A 1J8YF 2HT1A 5T8KC 4A3DB 3CS3A 5AKJA 2LKDA 3TLKA 1E6CA 3RIXA 3V9AA 4DSUA 2R8BA 2AS0A 2C92A 2EU8A 3TZEA 3IMKA 3KKNA 3O5AA 5GJCA 3STHA 2RFLA 2ZJOA 2ZI6A 1XTBA 3ELYA 4IV8A 4G5RA 4KR0A 3G6EA 1G3QA 2K7VA 1X7ZB 3JWPA 1SD2A 1R8JA 1W30A 3BIWA 4YCNA 4ZYTA 4KN4C 4Q01A 4J1TC 4A3MH 4NVRA 5EC8A 4ZT4A 4PE5B 5JAMA 1ODKA 3SMQA 4G65A 2XV1A 1JQDA 4CI0B 1Q2XA 5P21A 2PU5A 1NAIA 1JDZA 1N2SA 3LF2A 1ZJ5A 1EA7A 5B58C 1GNSA 4MWCA 3DBIA 4IJKA 3QYJA 3GJYA 4YMWA 4N7JA 4N5DA 2JI4A 4RS4A 2JDID 3L05A 5K9ZA 3QSYA 5DM70 2OZVA 5LBUA 3VR3D 1ODLA 1TMOA 3SE0A 1N1GA 5KC9A 2F8SA 1JZQA 4ZQ3A 2FPLA 4XX1A 2LVBA 3HB4X 3WG9A 4JLWA 2BGJA 3LX0A 3FDTA 2BMEA 2DUMA 4OI1A 4HJ8A 4AMGA 2EYUA 2EFEB 4XQCA 1F6BA 1KYWA 1Y7LA 2P8JA 1ZHOA 4C7XA 4MW7A 1MCZA 4F2DA 5CGKA 2QM0A 3VO8A 2Y9MB 1NSYA 3K0CA 3OWOA 2WI8A 2XCUA 1HTLD 4C0AC 3D6FA 1VJDA 1T1IA 4K14A 1JX6A 2W8BA 1XRNA 2FG5A 1QFZA 5EWMB 4DQUA 4A3EH 4Z1OA 2FF5A 3WAGA 1EE9A 5EZYB 4IFBA 1OH8A 1QTQA 2Z4IA 1ENFA 1H2XA 4E12A 3G17A 4JI5Q 1WV0A 1ATIA 3PRKE 1NWCA 2R6ZA 3TLMA 5CIQA 4K03A 6REQB 1GWNA 1ZI8A 1Y42X 1FRZA 1LZLA 4H31A 3TZUA 3RANA 1TGYA 1TT2A 2NSYA 1YFJA 5HIKA 4EYSA 5DW0A 1DQYA 1KYQA 1SHLA 4F2HA 1XCMA 2GNAA 2VUIB 3OZTA 2PD6A 1TY0A 5FD8A 1P2UA 4DXHA 2F3TA 1Q1ZA 4A3KB 5F21A 3OESA 3GDGA 4ZD6A 4XQJA 5KSYA 3FG9A 4AD8A 5FPYA 2JDIA 5H81A 1Z06A 3L43A 4ZQFA 1AHPA 2F4VQ 3VR3A 1VQBA 3CLVA 3OCUA 2A67A 1U0BB 1T3LA 2WFMA 2FCRA 3GTGB 1SU8A 2IIVA 4BVJA 1HNZL 1KARA 4DCSA 5FJIA 1QYRA 1NXXA 1IW7D 1WZUA 3TSSA 4L8WB 5B7PA 3W5IA 5PGMA 4RMFA 3OTWA 3SYLA 4HVLA 4LYYA 2FG7C 4DA8A 4P35A 1B1AA 2VHUA 2BYTA 1LGYA 1U8EA 3NXWA 1MR3F 3C85A 5LQDA 1WTWA 4URWR 1N2IA 3LHSA 1PLLA 2QTMA 3M3PA 1QP0A 1OA1A 2ZRPA 4G0QA 3E3NA 2P2YA 3RRMA 4D3ZA 3CZQA 2P5UA 2JIPA 3FUUA 5E4YA 2RBGA 1DG9A 5KWSA 4NH4A 4Y1RB 5F98A 3AR9A 1NDQA 2CZQA 4LGYA 1S3GA 3LPNA 5C5DA 4F3NA 5KU7A 3EHDA 3H11B 5A3RA 3M3YB 2O2EA 4DREA 3TSCA 10MHA 3TQQA 3C3YA 4UKDA 3F3KA 1U1EA 2J59A 4JJIA 5WRFA 2VL7A 3HBAA 3WWZA 2R1UA 4Q4CA 4E15A 3M5WA 4ZVPA 5FLXc 1VYTA 1A0IA 1XRSB 4HTFB 3PR3A 1DCKA 4Q47A 1KP2A 3DHYA 4NYJQ 5PNTA 2WKWA 3ADKA 1C3OB 2Q0QA 4CGYA 3PD1A 2IX0A 5IM4F 3T1OA 2ZYSA 2JVIA 4EAAA 3JARA 4LRTB 2IYEA 2E87A 4GKVA 1I6VC 5CMLA 3BXEA 4QMGA 2IWRA 2K7ZA 1PJTA 2E89A 5ADVA 1XMXA 4NZYA 2ZP1A 4E1VA 2YIDA 4NZ9A 1N9GA 2A1UA 1IIBA 1KVQA 3DM1A 1L8LA 1Y4DE 3DQQA 4NMZA 3EWIA 1A4UA 2VDRB 1RTTA 3RJTA 3BHJA 3AU8A 3NBFA 3I04A 5JS2A 4JI0L 2OVBA 3DWEX 3RC8A 2JGLA 3AEZA 3H0EA 3THYA 3R2IA 3A1EA 1E9DA 1P7CA 1J2JA 3SX4A 4EB8A 4WIAA 5FQOA 4L57A 4MVJM 2PQAA 4IPGA 4JI6Q 3C5EA 1EA5A 3TVYA 2BBWA 1EPUA 3DF7A 2IE0A 3LLSA 3FHOA 1B8AA 2AJCA 4KO8A 4AKTA 4YMVA 5FLMH 5AKGA 3MGKA 2QVCA 4QJIA 5C7IO 4QBFA 3R09A 2BRUA 1JIIA 3Q85A 5C51B 4X7BA 3URYA 4CEHA 2GAIA 3AEKA 1E0DA 3LWZA 1Z33A 5ESRA 3VYRA 3DAPA 1ZK4A 5B36A 2BE9A 1XC7A 1WUJS 4E6EA 4WBNF 4O08A 1NXVA 2QMUA 3RUPA 4EYGA 3DCJA 4RSGA 2LBPA 4TS1A 4CV2A 1R12A 1SBTA 4H18A 1FNUA 2GR9A 4N41A 2D0OA 2H1EA 3INYA 4PG5A 3NAGA 4C6SA 5BOSA 3EG9B 3C15C 1PFQA 2XECA 4GLJA 4YRIA 1GPAA 5I6DA 1LPPA 1L5GB 3QVGA 5ESDA 2H1VA 1DIOB 1TMKA 4GF5A 4C14A 3I2GA 5JO0A 2BGNA 1KBOA 1U98A 5UKDA 5HFAA 5DNVA 4RCNA 3T0IA 2E5FA 5DASA 3RBZA 4L28A 3FDZB 5DF1A 4MUJA 3LO8A 5IXYA 1YZUA 3GDFA 4HH4A 5TT1A 3WMEA 4GPZA 1IZ9A 3B9PA 4KYVA 2PJDA 2IXFA 2BR3A 5B3AA 3HHEA 1SOVA 4US1R 1CS0A 1EFVA 1LM0A 2JP1A 3DLPX 3OUTA 4HN9A 1CUCA 2Q2NA 2ETXA 4MQ4A 1KPIA 1T8WA 4HPJB 1CEQA 1QIFA 1MFZA 4JC4A 4BFLA 3WMWA 2VHJA 3QMMA 1P6XA 3TD6A 3PFNA 1D5XC 2J5XA 2F0TA 4N03A 4QUAA 4RZQA 3LVRE 3A14A 4R69A 3UPUA 3A6FA 4A3BH 2VNKA 2Y1OA 2FPGA 3CN9A 3WSTA 1Z18A 1BH6A 3TI7A 4UCWA 5H68A 5EJWA 2YY6A 1SMXA 1PYSB 3GEBA 4HJ5A 4ZYUA 5CYOA 4NNOA 1XX8A 2CNLA 2P2LA 4CMIB 4O4JF 3ONNA 1I4HA 1ISSA 3AQQA 4JKYA