3PUVA

Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
371
structure length
371
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transport protein
molecule keywords Maltose-binding periplasmic protein
publication title Snapshots of the maltose transporter during ATP hydrolysis.
pubmed doi rcsb
source organism Escherichia coli
total genus 103
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3puvA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3puvA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3puvA01
4HI0E 4JBXA 3W5OA 3P27A 4A9AA 5F9HA 1A62A 3ZGXA 1Y1VH 2C9OA 1D2EA 2RGXA 4X65Q 4RFVA 3GTKH 2W6JD 4MUAA 4OQLA 1VQ6A 2ZJAA 4YC7A 3U3RA 2GZHA 5JHGB 3PGZA 4Q7KA 3SFVA 5LMNL 1QBKC 3IQXA 1KRTA 1GITA 1P2SA 4C0JA 4DV0L 2VS1A 1J6QA 4P74A 5IT9c 3HWSA 5TVKA 4EPVA 4Z51A 4DIDA 3A6PC 3AVWA 4DT1B 2H1LA 5GJCA 5IP7G 2QM7A 3PQCA 3I72A 2FPMA 3CF5A 4Y52H 5C4XG 3V00A 4JVSB 2ORWA 1E2ZA 3WP0A 1E79D 1U9IA 2PX0A 2OILA 4DUZL 4YCWA 3I4MG 2QGZA 1NF3A 3LRPA 3OZXA 3WP1B 2GETA 1FW6A 4C7OA 1L1OA 1W5TA 2DPXA 5LMNQ 1D8LA 3LXXA 1K5DA 5ELOA 3CCRA 4TWZA 1V8QA 3R9XA 4M1SA 4S35A 2A5DA 1XMIA 1OB2A 3TSOA 4WXPA 1H9JA 3R9WA 1E2MA 1PH1A 4K8OA 3DO6A 5C3EH 4DXAA 4HYYA 1TU4A 4RCYA 4OONA 2CLCX 2QROA 3RHFA 2BMDA 2P2LA 2WSMA 2JLRA 2ZUDA 4ZI3A 4DUZQ 4A3KG 4OO1I 1ZUNB 4JG2A 1YITA 4B3TQ 2WSSD 4TTQA 4A0HA 1KJZA 4D4KA 2WKRA 1I50H 4Q4JA 5H68A 1W0JA 4LYJA 5JWRA 5JWOA 4FXPA 3KXKA 2NPFA 4EAQA 2DN8A 4R7ZA 1QHHA 1D2MA 4NYJQ 1A5TA 2QORA 4JBMA 2MO0A 3S1QH 2QQEA 4B33A 2FSIA 1YU9A 3PUVA 1EYGA 1RVDA 1JBKA 2Q0HA 2Q3MA 1TWHH 2QUZA 4HZIA 4Q21A 3LLUA 3VHLB 1S9HA 3AVUA 4Q4JB 4A92A 4QKQA 4BLOA 5JZVA 2OFOA 3FHCB 4BFWA 5KSOA 4QNRA 3HOZH 2BDOA 2FDCA 1KDPA 2IS4A 4Q4AA 5LB4A 4YWMA 5C44H 1GKHA 1BOFA 1KDRA 3L8ZA 2VQFL 1WBDA 3GFPA 1I4LD 1U5KA 1Z5ZA 4A3IG 2OWOA 1RFLA 1KY2A 3MG9A 4JOIC 3RLOA 1J8YF 2PZGA 1N33Q 2B8TA 1HNZL 3I62A 4I99A 2IK8A 2PCLA 3AYHB 2PZEA 5M3MG 2OAQ1 3ZIAD 3MFYA 4BZQA 5L3SA 2XXAB 1DAHA 1VIYA 3FYHA 4MQBA 3CCVA 3LQRA 5M04A 3O8CA 4HAWA 4KU4A 4TLDA 3ZS9A 1CUKA 1PLJA 2PEZA 1EOVA 2GF9A 1VQKA 5BYJA 3TZUA 2A5FA 4F93B 1KSJA 1RYFA 2VQFQ 1P9RA 2JLSA 3BS4A 3MGCA 5TXGA 5JSZB 1PZNA 3EG5A 4MKGA 4QQBX 1GFIA 2J87A 3TUZC 4YMUA 3FGNA 1P62B 5CIQA 1Q81C 2UXCL 2XGTA 2ZR0A 3AV0B 4R9UC 1HNZQ 5FI0B 5BQ5A 4C2TA 4C3IH 1S2MA 3L2OB 3K0SA 2OBNA 3BJIC 2CHVA 3T5DA 2D7DA 1UEJA 2B92A 2E75C 2OZEA 3ZJYA 5L3SB 3K80C 1E9AA 1RIPA 1NY4A 1XJCA 4M53A 4GOJA 4XD7D 3U6KA 3THYA 4BRWA 5JEAG 1XNQL 4FCTA 1COWD 3CBQA 1MO6A 1L2FA 3K70B 1EFCA 4TLBA 3TAHA 3BOSA 5C2JB 1B9MA 4JLKA 2CDNA 2NO6A 5L8VA 5G53C 4DLWA 4AQYL 5G3ZA 5TARA 1GL6A 3S15H 4N3NA 4DK3C 1ASYA 1Q82C 1CBUA 1KMHA 2UXCQ 2NO9A 1Q46A 5JS7A 5FR2A 1SROA 3TQFA 4G1UC 1Z6AA 3U7HB 2GJ9A 3HR8A 4TMXA 3WYGA 4JMPA 1VTKA 4QGHA 1L8QA 4B3RL 2ERYA 4WA7A 4OI0A 4LUVA 4A3GH 3I32A 2FEOA 1XNQQ 3FDIA 4A15A 4D25A 2K4KA 4I1VA 1UBCA 2K5UA 4KVAA 1XB2A 3U60B 4L5QA 4AQYQ 3MUFA 4B3SQ 1UBEA 3PCRB 4EJSB 4O2RA 1AQYA 1NMXA 4CEHB 4F38A 2J7PD 4Q7MB 4BFXA 4B74A 3ADKA 1A7JA 3G4SA 3KKNA 4AYWA 4IPHA 3GJ5A 1J5EQ 3E9IA 4BY7H 4B3RQ 1SVSA 1W4RA 3LBHA 1HV8A 4B3BA 4LJZC 2XTIA 1E94E 2DYKA 4HB0A 4ZI2A 4R4QA 1H8HD 3A7LA 1JQLB 1NBWA 2JA5H 5IHPA 3IEUA 4YQFA 3IEVA 1T5IA 4JLVA 2C5LA 1LTQA 2BBOA 3KL4A 4KFUA 2CLDX 4A8JB 3GJ0A 2FMXA 4NPHA 1A2KC 3CH5A 1HCZA 3P26A 4UP9A 3U4QA 4IOLA 1GL7A 1KTVA 4TL7A 3GLGA 4YXWA 1AZSC 3DMDA 1UEIA 3WRYC 2OTLA 2RF4A 1D2NA 3PEYA 3KQLA 1N36L 2MMGA 5G3YA 1UBFA 4U7DA 1KK1A 1X1SA 1KNQA 1CKNB 4HUQA 4DR7L 4KFSA 2AKYA 3BH6A 2GCNA 2WWWA 1CF4A 1KIMA 4E03A 3EPLA 1FX0A 3AF4A 2K7VA 2QAGB 1MIUA 2CKZB 1XPUA 3NH9A 4LUZA 4C0AC 5DN6D 1FNMA 3F8TA 1CLUA 1NY5A 2QMOA 2VP5A 5CDFA 1YRAA 1KI6A 3VKGA 3P32A 4ZIRB 2IW3A 4AY2A 2OEPA 3C4JA 1N36Q 1ZM9A 3GMTA 2CE7A 2XOKA 3O8RA 4QC2A 4BLQA 3TS2A 2KI5A 4X62Q 5AUNB 1HJPA 1YJ5A 1ZNZA 2WJYA 4MNOA 4IDQA 4C0SA 4LF7Q 1YKSA 4ESHA 1GHJA 1B7YB 3PEVA 3M85A 3LO5A 3KJPA 4ZV4A 3CB4A 4JSTA 4TYPA 2BKUA 2ZI3A 4ZO4A 4A4DA 5F98A 2R7ZH 1XEXB 3RRNA 4DUYL 3D7MA 1ZMXA 2IWHA 1KMQA 3THXA 2JA6H 3EZ9A 3TE6A 1PJRA 2J46A 1SXJD 5GJWC 2BM0A 2QP9X 1T3LA 2WIAA 3E70C 4FINA 3M4OH 4LV8B 1HTWA 3VX4A 3K0CC 4LHXA 4B32A 5C44G 1E96A 4O3MA 3BFKA 2KE5A 2ZSBA 1HT2E 4A3FH 5IYCH 1HNWQ 2JE6I 2ZRKA 5DI3A 4YWKA 3WYFA 2QTVB 2DFNA 4FIDA 5KSYA 5JEEA 2UVQA 4DUYQ 3TSWA 3CNLA 2IYVA 1IBLL 4LFCL 3M4YA 2F9MA 1E6CA 5K8IA 2VP0A 4MA4A 5J4VA 4JBWA 5JFGA 1HZCA 3PIPA 3ER0A 1HQCA 2R6AA 4EPRA 2VO1A 3A1WA 1CR2A 2WWHA 1L4YA 2CJWA 2ZYTX 2RGGA 1XPOA 3LAWA 2J0QA 2WOOA 1X9NA 1XMSA 2IX1A 1XD8A 3CRVA 2D2EA 2FZLA 5IE8A 1NBMD 2A78A 2FFBA 3HPRA 4G3XA 4BWYA 5CB6A 2A6EC 1EIYB 1W2HA 3OW2A 3LX8A 4LFCQ 2NO1A 1DAGA 3BWDD 3DDCA 4L5BA 3OE7A 1E9RA 2KCTA 1XMVA 1MO4A 2FA9A 1AA9A 3H2YA 4DV6L 3KQNA 2V8OA 2FZ4A 1SVKA 1I2DA 3U3OA 1XJVA 1OYYA 4BECA 1YZGA 1II0A 3K0XA 3KKOA 4PQYA 4POGA 3TBKA 3GTPH 1FJGQ 2CJWB 1IJEA 4HLQB 1D5CA 4TL6A 421PA 1J99A 4LK2A 4E22A 4DR5L 1QVFA 1S9DA 2EWVA 4DLTA 5GAHC 4NHOA 3GCGA 1E2IA 4ACBA 3V4FA 1AKYA 2J41A 1AS2A 3FB4A 1FUUA 2WJGA 1GSIA 3KLWA 1Q0UA 4DLUA 4CF7A 1U94A 521PA 4TMZA 2GNOA 4QRHA 4OI2A 5FI1B 2FX3A 2GN5A 1G5PA 4KAXA 4OK5A 5HE9A 3WYAA 5E7MA 1E2LA 3J80i 3AVYA 1PH5A 2ODWA 3KYHC 1QVGA 3OW7A 1Q21A 5EUMA 4BXXG 2CW0C 1R0ZA 1VQDA 3PO3G 4DV3L 1NVVR 3BBPA 3NIBA 3RWOA 2F52A 1Y8PB 1YZLA 5FBQB 2XZOA 2B63G 2R92G 1W5SA 1AGRA 2JDIA 2OV2A 4FWIB 1YHQA 2IYTA 2ATWA 5HY6A 2JA1A 2WWYA 1SR3A 4DR2Q 4LJ5A 1ZM2A 4M1MA 2V1CC 221PA 3VR1A 2QQ0A 1VQ8A 1X54A 2JA5G 2QAGC 1H9KA 4DKAC 1XPRA 1VQJA 3SJBA 3N2IA 3CW2A 3GLIB 4WJ3M 1HNXL 1OFTA 4DV3Q 1G17A 4JI6L 3IILA 2K5NA 1EWRA 2GK7A 1N6PA 1H9MA 1SVMA 2WKQA 1BO6A 1IY2A 3J81c 3W3ZB 1R0XA 4GP7A 3IIKA 5F3WB 4EFLA 2YWHA 3T1TA 2EW1A 3R8FA 4I81A 4LYAA 2OSBA 1CKEA 4UP7A 3VQTA 3UDGA 1E0SA 1XEWY 2GILA 2GZAA 3G5UA 2JA8H 4GT1A 4DB4A 3W1BA 4LF6L 2A68C 1HNXQ 3CRRA 1IN7A 5FJ8H 3NE5B 1E2HA 1Q7YC 1KDTA 2VHUA 1I4TD 2VA8A 3CR7A 5HE8A 4IVPA 1WCMG 5J40A 1I94L 3MXUA 2ODBA 1UE7A 3VAAA 3OEED 1TPZA 4YWLA 2BA1A 1IHUA 4JI0Q 3QPWA 2IT1A 4P33A 3ICQB 1R0WA 1MABA 4TYYA 3U7EB 1FQKA 3RN2A 4LV6A 2B8FA 4PX9A 2R7ZG 3LNNA 1A8VA 1E32A 2E5LL 5HPYB 1H95A 3IFTA 3HOVH 5M3FH 1I94Q 4X8MA 3UDIA 4YY3L 4TN1A 4LHZA 2BOVA 3HKSA 1IJFA 3B1XA 1OB5A 2ZR9A 4IXMA 1OHHA 3EAQA 1VQMA 1Z6GA 1HY3A 1NMZA 1N0VC 2J9RA 2R6CA 2Z0SA 4PQRA 5FTKA 3PEWA 5IYCG 3DM3A 3U50C 2FFQA 1G21E 2VP2A 3GLHE 3CCLA 2ASEA 4GOKA 5EP3A 3SS8A 4Q9JA 3A8KE 2ECKA 1LV7A 3H3VI 1SLJA 2QPTA 3PG5A 1VQOA 1U8ZA 1UE5A 4P4SB 2A30A 4Q9HA 4YY3Q 2Q9AA 3BD9A 3AH8A 1ZW6A 1IYUA 4KLNA 1FL0A 4PPQA 4DZZA 2FSGA 3GJXC 3FKIG 2EYQA 2V6JA 4CIDA 1OLOA 3BH7A 1IXSB 2OXCA 3CWZA 4UNSA 5IYDH 4BY1H 1UE1A 2ZJQA 3NTUA 1QHIA 4LHWA 1G3QA 3FHWA 1OE0A 4BRUA 1X86B 2QT1A 1JE5A 4GBMA 2REXB 1NNEA 1II8A 4A3CG 2PL3A 4JK1C 4RD2A 2GVBA 3LWUA 2NTYC 3NWJA 2FN4A 2VPPA 3OPOA 3UE0A 1ZD8A 2YZ2A 3NC0C 3OIUA 4DB2A 1CJVC 1G7RA 4LJYA 4WZBE 3J7ZC 1XP8A 1RPZA 3R7WB 5KNDA 4OHVA 4YLGA 4PHHA 4TMVA 3WMGA 1H8EA 3SHWA 4W9MC 2PQAB 2XTZA 1E2VA 2WPDD 1DADA 1CSQA 2JJ2D 2JLZA 2IYWA 3EZ7A 3PUYA 2VHJA 3FVQA 2N3SA 4M2LA 4NYIQ 3T12A 4KMUC 3HOWH 4JYAL 1F2TB 4G7OC 1NVXQ 2IUSA 3K8AA 3I7FA 3MWKA 4LSGA 3OYYA 1E2QA 1LS6A 1BH2A 2VZAA 3DL0A 3U7GA 5JJKA 4G0NA 3FFAA 3KKPA 3E5HA 4HR7B 2N49A 1M6NA 1N9WA 2CWAA 2IBMA 2D2FA 3HOXH 2YTXA 4PANA 4QM6A 1NIJA 3BZCA 3QNUA 3HOYH 4EX5A 1IN4A 1O7LA 1A0IA 1KI7A 1M2OB 2BWJA 2DR3A 4Q4HA 5FOTA 3UWKA 4GKKQ 4DCSA 3TUJC 3CPEA 3N70A 3TJZA 4DVGA 5AJWA 1NN1A 1I2MA 5FBVB 4JYAQ 1KO7A 2O8FA 3L7ZC 1Z08A 4M22A 1JT8A 3B9PA 3V9PA 1XZQA 3KTAB 3LNCA 4AIIA 2GVAA 1US8B 5JRZA 4QHYA 2MSCB 4HLUC 1KJYA 2Q8IB 2RMKA 4GSYA 4S2EA 2YWFA 2PI2E 1OKKD 3JZAA 3AFPA 3U2QA 5CB8A 2J0UA 1PHJA 3PJRA 4PAQA 3ZS8A 3AKYA 5JEAJ 1XMQL 5FPYA 2W2TA 5E3HA 3HGBA 2V4ZA 3MWYW 4Q9IA 3FMFA 5BR8L 4C0LA 3WMEA 1R5BA 1F2UB 3RS5A 3PCOB 4YMVA 1E2EA 1CR0A 2XSZD 2AK3A 2CCKA 3KJEA 4M1YA 3T1QA 4JI8Q 1CULC 4B3MQ 3ZVLA 4K0KL 2CL7X 2ZJ5A 5K36H 1Z0DA 3HFZB 2R7FA 1VQ9A 2FFAA 3MRSA 3I4OA 1J2JA 3UK6A 4IVRA 2J5XA 1NMYA 1OIXA 1XD2B 3RS4A 2R65A 2ZS8A 4YMTA 2PZFA 1O7IA 1NKTA 2QMUA 2KSQA 1XMQQ 4QFMA 2GZDA 2WICA 5EZ5A 2E2JH 5BR8Q 1GVNB 3PXGA 2KBNA 2EJGC 1AKEA 2FEMA 3P4XA 3PIRA 4KCGA 5A35A 4JLJA 4BUJA 2ES2A 3F1ZA 2HJVA 4EUNA 1LS1A 2ZXUA 4K0KQ 1T8UA 4DSUA 4F4JA 1KL9A 2C9CA 1TAGA 4PAMA 4FCVA 1DS6A 1RIFA 5JBQA 3BZKA 2UXDQ 1YZQA 1XTJA 4LW1A 2A5JA 5KHOC 2GXAA 1QG2A 3OAAD 2ZE5A 3TRFA 5FLXc 3CRQA 1E7ZA 3NKVA 4MGKR 3EZ2A 2P0EA 4LJ9A 2GKSA 3T34A 1U8YA 1D8TA 3EWSA 2UZ3A 2EFEB 1GZSA 3G6EA 3QKRA 3PUZA 1KAOA 3NBYC 4NU0A 2CK3D 2OFWA 3CNNA 4IEEA 5HTKA 5LB2A 1E0JA 5JS8A 2B7CA 4BFZA 2AWNA 2FH5B 3Q72A 2QNRA 3HDTA 4KJZA 2VYFA 3KJIA 3A5ZB 3VR3A 3LGJA 1N34L 1SGWA 2FOLA 3T1YQ 2FV8A 2WWIA 4KLKA 3C15C 4JL5A 1P60A 1HZ9A 1RRFA 1DELA 1DVRA 1R6BX 4GS3A 4PPFA 4OL0A 4EIWA 3H1TA 721PA 3GJ8A 3QG1A 2YOHA 4LBYA 1DXMA 2O0HA 5JMTA 2BE5D 3CWQA 3SNHA 3A1UA 1D9ZA 1DEKA 4TKOB 2PT5A 5GAGC 4DV2L 1IQPA 4L8GA 2XNDD 3DMNA 5EZ6B 1KOFA 2HYIC 2R8RA 2A6ED 2R7DA 3AF3A 2ALYB 3AQQA 4RY2A 1HQYE 1M74A 1SXJE 3CRMA 4GN4B 5H1SE 3RRYA 2A8VA 2NN6H 1U90A 4WBSA 1VQNA 2WMOB 2VF7A 4ARZB 5HZKA 5IYDG 1KKMA 3MD0A 4I7ZC 1FOEB 1C9OA 4BY1G 1N34Q 4TL8A 3RDPA 4QJ3A 4NE2A 1QVCA 4ZDJA 1E9SA 3U9SA 2MSDB 3S1MH 2HF9A 2KCCA 3LH5A 4I1OA 3VDYA 1EFHA 3U44A 5AJ3L 5EQTA 5H70A 2GBLA 3EC2A 5KU1A 1ZUIA 2QAJA 4DV2Q 4DV4L 1S3GA 2JEOA 3K8YA 1ZNYA 3K9GA 2C77A 1Y8OB 4XOIA 4H13C 2QPOA 4M1WA 3X1ZA 3CD6A 3PFIA 2CL6X 4GZYC 1X1RA 1HH4A 3DZDA 4JI7L 5E7IA 1W48A 1VQ7A 4AC9A 5IRCD 3L8YA 1G4UR 4YCUA 1JEEA 4C30A 4BLTA 1QVAA 4Z8XA 1DD2A 2EQSA 1QG4A 4LDJA 1RKBA 4QY7A 1SKYB 3HOWG 1NBME 1VQLA 2ZM6L 4RFSA 4DHEA 1YR7A 1G291 1ZBDA 3OIYA 4DV4Q 2G77B 3P4YA 2BVNA 4UY8C 1W47A 4A2WA 1DPFA 3F3YA 5TV2A 1K73C 1BIFA 5JLJA 2X8AA 1Q3HA 5FOVA 3A5UA 3BB4A 1R2QA 1WFQA 4QIWE 1VG0B 1G7SA 3HOYG 3WBKA 4EJSC 1A6XA 2HQLA 4PO8A 1OXVA 3L0SA 2RHDA 1TUIA 2OUKA 4LFAQ 1TQ4A 1S1MA 1YI2A 3PVSA 4HIDA 1SXJC 2JJ1D 5L3RA 4A3JH 1DTSA 2G0NA 4JJZA 4PHTA 3CCQA 1Y63A 1BMFD 2FSHA 4EQ6A 1P2UA 4HB2A 2QBYB 1Z07A 1T9HA 4KITB 2B8GA 2YC4C 4JLMA 1JR3D 1G8HA 2XB2A 5GJBA 1VDZA 1XXHB 4C9BA 3C14C 3I2ZA 3Q8XB 4B34A 4GZLA 4TSFA 3KDFA 2FFHA 2HCBA 3CRKC 4P71A 1Q1QA 1PA6A 4G5GA 4QJFA 2E9SA 2RGBA 3B2EA 4BQSA 1KK3A 2V4DA 1TL7C 1HR0Q 2YYZA 1NN0A 4K81B 3A1VA 3MWJA 1X56A 4UQOA 2FG5A 1DAKA 3P1JA 1CR4A 2HF8A 5K36G 1FVIA 4ZDWA 1P2VA 2NO7A 3MAAC 3ZQ6A 2IS6A 2GEDA 3EA5A 4US2R 4I4LA 2B21A 3A8TA 1E2FA 2BBTA 2VSOA 5FTNA 3SE0A 2O8DB 4X65L 4HJAA 4QM7A 3QPVA 2NIPA 4K46A 1YHNA 2I5LX 1EWQA 4UNQA 1QHGA 1HR0W 3BORA 4C2UA 1SN8A 5C4JH 4BFUA 3W3AA 2E8GA 1MJEA 4A3DG 1E1RA 2QG6A 2YVUA 4URUR 5FL7D 2K14A 1Q3TA 4AD8A 1SKYE 2WTUA 3S17H 2R9VA 4KFTA 4Q7LA 3J81k 4DT1A 1UADA 1YVDA 2AMCB 1CS4C 2JA9A 3RSLA 1LB1B 4D0NA 4A0RA 1CSPA 1XEWX 3DZ8A 1K3RA 3FPPA 1R8QA 1HA3A 3UMSA 4YMWA 4HEJA 1QHYA 4GNXB 2CWPA 4HDOB 4ILEA 2GJSA 2AK2A 4W5HA 3TREA 1IAQA 5C0XH 5DI9A 1P72A 1E3MA 3CRLC 5FPSA 4OWTB 1SVWA 3LXRA 4IDPA 4CEJB 3JC66 621PA 3SYNA 2Q2TA 2NZJA 2B29A 4O2DA 1GNRA 3C5HA 5CYOA 3W8NA 4HIOA 5TMPA 2ZUCA 3PEUA 4N1AA 1SE8A 3A0JA 4BA1I 2F3IA 1VCMA 2OG2A 3B1WA 4WIAA 1KRSA 4B3TL 1XXHE 1Z0JA 4TT3A 3T1VA 2DB3A 2VH5R 4IOAA 1G6PA 3N5CA 3SGIA 2VSFA 2YC2C 2WWXA 2PCJA 4HIKA 1B23P 1UDXA 2O8EB 1Q22A 1UAAA 1LVGA 3GLFE 2YTVA 1UF9A 1PFSA 1WA5A 1G19A 4DUGA 2A6HD 4JVNA 2CQOA 1KNXA 5AK0A 3PO2H 4G5RA 4JI1Q 2O8CB 1PMRA 4JI5L 1H9RA 1UKYA 4AI6A 4CZ2A 1OT3A 4JBJA 3RZDH 2HLDD 3S1AB 3S14H 2PMDA 2UUCL 2VIIA 3GFTA 1M7BA 5UKDA 3NBXX 4OBEA 1K5GA 3T35A 1W0KD 2OBMA 4KFRA 3OE7D 4HAVA 2J7KA 2EFDB 3S24A 2G3YA 4RZ3A 5KYKA 2K52A 1MH1A 3AKEA 3KKMA 1I3QH 1F3OA 1NKSA 2DWQA 1KO5A 3NEJA 4PPGA 2DHRA 1NJIC 2HJGA 4EFMA 4JI5Q 4OHYA 2UKDA 5FR1A 1N33L 1E0AA 3EZ6A 4Q9KA 2BHRA 2E1RA 2AUKA 2ZRBA 4LWZA 1T3HA 2PJRA 2UUCQ 1G3MA 4PPNA 2JIZA 2VP9A 1P6XA 2XXAA 5EAYA 1LF5A 1NLZA 4UJ5A 4Q1FA 5FFMA 2Q2UA 4RMFA 2ZRPA 1J70A 2ANBA 4US0R 5TDHA 2JATA 3IPXA 2PEYA 5JSZA 4B44A 2AXNA 1YZNA 3A74A 1BYUA 3OFND 4FMDF 1WP9A 4A3JG 1QDEA 5IK2A 3RS7A 1EIFA 2QSZA 5FUWA 4GOPC 3AF0A 3CPJB 3D3QA 3EIQA 4LJ8A 1VCIA 4KKSA 3J81i 1YR8A 5A4JA 3UPUA 3QXCA 4ME3A 1KJWA 3BB1A 1Z6TA 1VF5C 2I4IA 3A8JE 2IYQA 5IY0A 1GJXA 2Z6KA 1IY0A 2VHCA 4I1UA 4L4UA 4US1R 1G1MA 1ZIPA 3QIAA 1VQCA 5GAEC 1EXMA 3AEZA 1VIAA 4JLOA 4KV9A 3EPHA 4KYIB 3QXSA 5FOXA 3CLVA 4MZ9A 1KI4A 3QKUA 4QBFA 1XX6A 3FKSD 4KI0A 4PFSA 3KFVA 4RCZA 4UXHA 5DHFA 1CRPA 4DDTA 1G3UA 4D4MA 4AYXA 2BJWA 2Q3HA 1IXRA 4P4UA 2QA5A 2C35B 1MKHA 4OO1H 2BH8A 4GLAC 1CRQA 2G6BA 1YZUA 5FLMH 5HR5A 2W58A 2CMKA 3HJNA 4QJ4A 4QXAA 2NZOA 4RZ2A 4KHPL 3U61B 1GAJA 2ZJ2A 1W7AA 4GNXC 3SQXA 3KDSE 2E2HH 3B85A 3QOFA 3CCSA 3WDNA 3JVVA 4QGGA 3NDBB 1KO4A 4B3SL 2NQ2C 2O8BB 3G82C 3I4LA 3MEFA 4XTCS 3W5JA 2BH2A 3NC1C 2OCBA 3CF2A 4EJSA 1T0JB 1QZXA 4CEHA 4MYTA 4EPWA 1SULA 3A4MA 1OPXA 1E9FA 1CJMA 1E1QA 1UDWA 2I1VB 3B7GA 5DISB 3CPWA 5GADl 1GKUB 4RJLA 5HGQA 1J5EL 2C2HA 3UANA 1CTQA 5DH9A 3UXMA 3KJOA 1Y1VG 4IQZA 2C98A 1IL2A 5HKKD 4KHPQ 3KF8B 3MJHA 2J3EA 3JZMA 2WJJA 5BWMA 2VTKA 3AQ4A 2AKAB 4Z54A 2F6RA 1G6OA 1VHTA 4A8JA 1ZM4A 2EIFA 3K53A 4OQNA 4BFTA 4ZCMA 2YTYA 5C0XG 1E2GA 1JNYA 3QVVA 4BASA 3GJ7A 1TQ2A 4J15A 4HAXA 1FR3A 4LX0A 1W2BA 1P61B 2AR7A 4JLPA 3TK1A 4HDQB 4IJLA 2FNAA 3OEHA 4LBWA 121PA 1CKNA 4GFDA 4LF5L 1N5JA 1Z06A 4Z1MA 2ZI4A 4DLSA 4MUBA 2ZAMA 2OLKA 4LRWA 2D3WA 1XEFA 1TF2A 1UM8A 4AG6A 821PA 2OE2A 4JBKA 1G64A 4ZDIA 3I1FA 2QAGA 3EX7C 1JAIA 4IVQA 4OYHA 2IYLD 2AKWB 3A36A 4IHQA 4LJ6A 4IOMA 3H0KA 4D26A 3AVXA 4XVUA 2QZ4A 1BKDR 4LV5B 2D0OA 1S96A 4F7WA 3TVDA 2PMZE 5GROA 2CXXA 4ZIRA 3B9QA 1SHZA 3LBIA 1GUNA 2F1HA 5C3EG 4Y7NH 4X62L 3PO2G 1XNJA 1VHLA 2W0SA 1KAGA 4LF7L 4LF5Q 1DAEA 1S8FA 3G0HA 1KSFX 1VQBA 2ZJBA 3Q5EA 1L1OC 1XWIA 2ZRMA 2OCYC 4BZPA 2P3SA 1RRCA 4TYWA 4GLVB 4B76A 1RZ3A 1XEXA 1E24A 1RE0A 3PV0A 3MLEA 5TB5A 4B2PA 3OHMA 2Z83A 1KZ7B 2CNWD 3OIVA 1PV4A 1M7HA 1ZNWA 2XAUA 2Q2IA 2GJ8A 2NG1A 3JAMc 1TQ6A 2ZRFA 2FE4A 4TLAA 4TMWA 3GTOH 2BIFA 2CHGA 4MGIR 3HP1A 5ELNA 4Q1DA 4JYCA 3NVAA 3T51B 3VR2A 1HNWL 2E87A 2QEXA 3EQLC 5E7NA 1H8ED 1KI1A 1YHAA 1EFRD 4DAMA 2X2EA 4LHYA 1AJEA 2NVQH 2GEVA 3WNBA 4CT5A 3IO5A 3GQBA 5FPTA 5FH9A 3ONWA 4PHGA 4TQ9A 1HE1C 3HOZG 3U7FB 2JLWA 4P32A 4WXRA 3U3JA 1X8JA 1S3SA 3IRBA 1X6VA 1LUZA 3VX3A 4KSCA 2QF7A 1OXSC 5FBLB 1AE2A 5AJVB 3U58A 4LF4L 3GTGH 4L15A 2EFGA 5CLLA 3BJUA 4BLSA 4LHVA 3S16H 3K0AA 4NYJR 4OQXA 2W6JA 4IPCA 2XNSA 2W6ID 3I8XA 3IIMA 2Z6VA 1U0LA 3NBHB 1H9SB 3CZQA 2NVYH 3PUWA 3A1SA 4M21A 4TVAB 5FPHA 3RC3A 3M0EA 1BBWA 3X1DA 1X8LA 2W2VA 4NL4H 1UEBA 4U02A 5AJXA 2KCMA 5GADC 2PJZA 3CKLA 1Z6XA 3H15A 2BEKA 5C4GB 5KTYA 3GP8A 1FJGL 3QUSA 1CFMA 3EWAA 3IIJA 5KOYA 4LF4Q 3K0AB 1S3OA 2BE5C 1XDBA 2AXPA 3I55A 4JLDA 1E79A 2F1RA 4DK6C 4MRRA 1W3SA 2YNMA 4FN5A 3T1HQ 3RLFA 4CW7A 1X3GA 2RHSB 5KPJA 1FFHA 2G83A 1E22A 1OV4A 2MNAA 4OJQA 4FMDB 5FTLA 3DLLA 4IDOA 1YBYA 2HXYA 3SJCA 4Q19A 4LYHA 4LGMA 1P4SA 5D3MB 4B3XA 3M6AA 2Z4RA 1YEZA 2UZIR 2V7QD 3KQUA 1W4CA 1GRNA 2QEQA 1Q8KA 2RGAA 1RJ9A 2N78A 2DCUA 3GLFB 1P7CA 4URZR 2A69D 1JR3E 1LYLA 2FSFA 3LLMA 2Z0MA 4V02A 4TTRA 1LTLA 1A1VA 3SJAA 3I56A 2REBA 2WSSA 2YHSA 3VFDA 3NEYA 1N0UA 2QE7D 2ZRIA 3IDQA 3AUXA 1Q1EA 4V0NA 3FMPB 2UU9L 1Z2AA 4TLCA 3SU8A 1LFDB 4YONB 2I5HA 4A76A 2JEBI 1F48A 3WY9A 4DR2L 4A3GG 1RJ9B 1Z6HA 1VPLA 1XCPA 2IYSA 4ABYA 2VHTA 4G7ZC 1OXTA 1II9A 1XZPA 1ZU4A 4M4SA 5JCPA 3PSIA 2QP3A 1X6OA 2ZSAA 3EBEA 1Q20A 3GLIA 2CHQA 3ICEA 3RS0A 3SYLA 3OTOL 1IN6A 1JJGA 3KXLA 3AF2A 5SZJA 2BC9A 2H7VA 2J59A 4X6AH 1C9KA 2UU9Q 1G8GA 1Z0KA 4JKYA 3GTJH 4A3LH 2BM1A 4BY7G 1ODFA 2QSYA 4G5OA 4NP6A 3ZH9B 4ZCIA 5KDOA 2F55A 2V9PA 2GEUA 3R8CA 3GLHB 2MFIA 3TQCA 2C78A 3KF6B 4DLZA 2IS2A 3THWA 1OJLA 5DSZA 4HLUA 4HJ9A 4RZUA 3KFUA 1JI0A 2QGQA 2H92A 3BIFA 3EC1A 1N5KA 5FPKA 2H17A 2C8VA 1V9PA 2RGNC 5L3VA 4QGUA 3L82B 1CR1A 1D9XA 3OTOQ 5GQOA 3IKJA 3UWOA 1VECA 2MO1A 4B35A 3ZIAA 3NHAA 3AKDA 2MMCA 4B3DA 3CCUA 3TNFA 3SHFA 1ESNA 1D7QA 1H65A 3GEEA 5FBWB 1C0AA 4OHWA 2DBYA 4JI0L 1G5TA 4IRUB 4PO9A 4RD6A 4RSGA 3THWB 3VKHA 3DOEA 1Z83A 2QA4A 5E95A 4ZKEA 1WB9A 1EG7A 2GESA 1R9TH 1E1TA 3H0GH 4A75A 1NJFA 2WMNB 4DDVA 1FMLA 2ZREA 5CJ2A 1WDTA 3GPLA 2WP8J 2ZRLA 5CJPA 4DR3L 3HYRA 3I73A 4LY6A 1K0RA 1VQ4A 2JCSA 2IYYA 2RKOA 1E98A 1ZU5A 3HOUH 4QOSA 3D31A 2ZE8A 4BA2I 4DDWA 5F2EA 2P5TB 1YR6A 4XD7A 2WAQG 1EWHA 1KY3A 2F3TA 4LZZA 3RANA 1G7CA 1GWNA 5AJZA 1COWA 1ZM3A 4B3GA 4KKUA 1XCGB 5F9FA 1X65A 1VQHA 4KYUA 5JRJA 4NXNL 4BLPA 1MKYA 3FFBA 4RCNA 3B1VA 3DM5A 2F43B 1GUTA 2B7BA 3UMRA 4JC0A 1V5WA 3QQ5A 4Q18A 1Y8NB 1VKJA 2JA6G 4V0KA 3DHWC 3R9IA 4DR3Q 1F6BA 3KQHA 1GOTA 4MKFA 2K32A 4MRVA 4P4SA 3BU2A 1YR9A 2C95A 1KIXA 3L0OA 1E4VA 4R2IA 2PI2A 4EPXA 5B57C 2GXSA 4UNNA 2VLIA 4E5UA 1XBTA 4M0LA 4A3FG 1HT1E 3U6BA 3FHTA 3KOJA 4P0TA 4NXNQ 1VQIA 4P75A 1Z0FA 3PIOA 1KD1C 2GJAA 3CIOA 1FGUA 4IFEA 4UKDA 1IBMQ 4FDBA 4KN7C 2XITA 2AL7A 1TX4B 4JI2Q 3K9LA 2J7PA 4AG5A 4B48A 1ZNXA 5AUPB 2C99A 4EKDA 2XTMA 4PO1A 4A0GA 3NXSA 1SHKA 1ONLA 3IHLA 2HHHQ 3ADCA 3T06B 1XNRL 2XX3A 1Q44A 3R7WA 3RC8A 2FXQA 1H8HA 4C0KA 1SKQA 3W9YA 1VG8A 2PQAA 3CNOA 1JJCB 1WQ1R 2VQSA 2FGJA 4LJAA 4CGZA 3BB3A 3QG5A 2JEAI 2NVTH 2IHEA 3AUYA 3O8BA 1GHKA 5DIFA 1Y1WH 1VCOA 4B47A 4TYNA 5JI3E 2A3RA 2A6HC 1F2TA 1TKWB 1VQGA 4P72A 4X64Q 2GTPA 4A3BH 4ITRC 2VUMH 3N6RA 1JMCA 3W8RA 4A6PA 3CQZH 1AS0A 1ZIOA 3MSXA 1XNRQ 3RZOH 4H1UA 4QJ5A 4UP8A 1CU1A 3NBZC 1Q57A 1OFIA 4X66Q 2QMHA 1G8PA 1T4GA 5AJYA 4ASUD 3TKLA 4DDUA 2UUAQ 1W36C 2ODNA 4UNRA 1NVUQ 1M8PA 4GKKL 2OLJA 3CMAA 1N8RC 2JJQA 1OIWA 5CIWA 2ONKA 3UDXA 1R0YA 2OBLA 4G01B 4LJ4A 3RVBA 3SEAA 2QM8A 1AM4D 3BFVA 3OF5A 4EPTA 2VQEQ 1KSGA 2ZJPA 3T56B 4RD3A 3SQWA 1WI5A 3KTAA 1US8A 4F4CA 3BFXA 4CEIB 1OFHA 3K0FB 2OCAA 2Z5FA 4GKJL 3UMFA 5IWAL 2IF2A 2Q6TA 3LWNA 3STBC 1PH8A 5GJVC 4CDGA 2CCGA 3QKSA 1G5RA 1ZD9A 2IXEA 4IPGA 4DR1L 3DKVA 5FBRB 3M9BA 1OF1A 2CCZA 1HEIA 1F2UA 4A3LG 4D0LB 3B1ZA 3W5IA 4JI8L 2C03A 4B3ML 3QENA 4XWOA 4AKIA 1SXJA 1XMJA 4P3YA 2HT6A 3W6NA 3CCEA 4IFBA 3H3VH 1N6IA 3AP2A 3QE0A 4OJKA 3RS2A 4JS0A 3EPKA 3FOZA 4XTRA 4GKJQ 5IWAQ 1YVCA 1XD2A 3QKSB 5LMUL 4KBGA 4C0QC 1KYIA 2W00A 1B8AA 1R7RA 3AVPA 1GUSA 3FMCA 1TF5A 4DR1Q 1B9NA 1XU4A 4NMMA 3RS3A 2H16A 1CJTC 1VG1A 4EPYA 1PH7A 1FMJA 4HLDA 1Y69U 1SXJB 3FKQA 5ANRB 2YU9H 2REOA 1VYTA 1M1KC 2AHOB 4URWR 4DCNA 1KSHA 4B73A 2B8WA 2UXDL 4GL2A 4EDHA 1N3BA 2ZRDA 4A0FA 2ZRJA 2JA8G 4B6FA 5LMUQ 3H0GG 4GN3B 3PF5A 5FJ8G 2ZT9C 1DAMA 1RRGA 2IUTA 3OESA 4C2MH 1NBMA 1QZGA 5SZHB 3QF7A 3TQYA 4NCIA 1EQQA 1E2NA 4Q7JB 1EFTA 2BBWA 2RB4A 3K0EA 3RWMB 1E3PA 3ULLA 2CVHA 2GJKA 1QJOA 1IN8A 5C0XJ 2ZROA 1Q90A 4UPAA 1W0JD 2WVJA 3U3KA 2CEAA 2HEIA 1E2KA 2I5MX 3T1YL 1FTSA 2NO0A 1KI3A 5SZKB 4MGYR 3VMFA 3B6EA 4XWKA 4G5QA 1YJNA 1VCNA 2PNHA 2ZRHA 3K7AH 3HOVG 2O5VA 5M3FG 2QY9A 3NEMA 1EUJA 1HE8B 3H86A 4HSEA 1T5LA 4JLNA 3GJ6A 3AVOA 3BDOA 1EQRA 2OTJA 3Q8DA 1KGDA 3CONA 2HV8A 2H5EA 5DYIA 4ARZA 1OXUA 1NSFA 1KK2A 1MOZA 1FUKA 1P9WA 2PLFA 4QG7A 3SI7A 1OH6A 1FPMA 2GCOB 2DWOA 2R93H 4DIEA 5M5XH 5HCIA 3QF4B 2QMEA 1AQUA 1K8MA 2BA0A 1K83H 1FP6A 5TY0A 1S72A 2WB1G 1NLYA 3HYTA 4HB4A 2ONJA 3T61A 1JJ2A 1MRNA 3C16C 3QJYA 4C4PA 3FWYA 1GNPA 4LF9Q 3KUDA 5IP7H 1EFWA 1TQDA 4JI4Q 3L43A 4Q66C 2BCJQ 3AEVA 3J80c 1OXXK 5KUTA 3E0EA 4BLRA 4DNTB 1GRQA 4Q01A 2EJFC 3FMOB 1KZGB 4A4IA 3K09C 2X77A 4HAUA 3F2BA 5G40A 3UATA 4DC9A 1RC8A 4A3BG 2VUMG 1L0WA 2RH5A 1ZC4A 2ZAOA 2LXJA 3IBGA 3A7AB 1K9MC 1ZAKA 2OESA 1KI8A 2PNRC 5K8TA 1TUEA 2FJUA 2K33A 4HLCA 2G1KA 1AS3A 1P9NA 5BN5A 1C7YA 4JZKA 2AFHE 1SMYC 1E2WA 4LFAL 2AX4A 2ZJRA 2RGEA 3CUEF 1Z7TA 1VQPA 3D8BA 3KUCA 4LF8L 2FF7A 1G9XA 4MH0R 4CRWB 3M4PA 4A3KH 1SVLA 2P6UA 4JLAA 4M9ZA 4P4TA 1A4RA 1LM0A 3T1OA 2QBYA 2KBEA 2DUDA 3IPYA 3OEEA 3LD9A 4Q03A 3TAUA 1ZUHA 4MKIA 1E4YA 3HOXG 2VW9A 5D3QA 5H1YA 5ELXA 3M1IA 1UPTA 1Q1ZA 3KKQA 4ZPXA 3SDZA 3Q85A 1IW7D 5GVRA 1N32Q 3TW8B 1XXHA 2BMEA 3ZZTA 3F2DA 4TYQA 3ADBA 4OWWB 4XWAA 2C04A 4BFSA 5LPNA 3ZD6A 2PPBC 4LF8Q 3W34A 2IHBA 2JLYA 2QRZA 4APVA 1HR0L 4JOIA 1WCV1 3E1SA 4W7SA 1EESA 2BDTA 4NYIR 3U4ZA 3GLFA 5E4FA 3H94A 2L0XA 2WFWA 1QHNA 4PQFA 2PX3A 4BEBA 4A36A 1UKEA 2EXDA 1ZVQA 3TS0A 3VU9A 3ADDA 2IUUA 2KBFA 3GJ3A 1U81A 1GVPA 1TXYA 2O8DA 2WJHA 4QL5A 3S2HH 4IFDH 1QHXA 3J7A5 4HZUB 4XSGA 4G5SA 5SZIA 5JHHB 4ZCLA 1KO8A 2B3GA 3AP1A 4A3IH 2X1VA 2ZYVX 5C0XI 4GNKA 5DYGA 1KI2A 4Q1AA 3JAMi 3A37A 3VNVA 4Y0VA 4GN5A 3HU2A 4IJMA 1MRSA 4YXWD 2BMJA 4GOPB 5M3MH 2VP4A 3VU9B 3DXJC 3EW9A 4J0QA 1KXLA 5HCNA 4JCVE 2HXSA 3CPFA 2K75A 1DG3A 4JKIA 4KLZA 1OH7A 1Z6YA 1ZJ6A 2QI9C 1QUQB 1TWGH 3EASA 1DO2A 4JYBA 2UUBL 3QEOA 2D0PA 1A82A 4UNPA 1GNQA 2QPAA 2C9YA 4XH9B 1R10A 2WAQE 4XJXA 3E2IA 4ZKDA 4GNXA 3B1YA 2ZS7A 1SVOA 2PMKA 2W0MA 5KSPA 2CFMA 5FUYA 4EQ5A 2C96A 2LKCA 2GK6A 2FU5C 4LC0A 2A69C 4GRAA 3MCAA 1YRBA 4PSKA 3S1NH 2HCJB 3U4VA 2GRJA 1W1WA 1TF7A 1MT0A 4CEJA 2V3CC 3RAPR 1UKZA 1EFUA 1LF0A 1BBUA 2XOKD 1NI3A 3LX5A 1B0UA 1PLLA 2WPDA 1GG2A 4JVLA 2UUBQ 3BH0A 2QU8A 3VNUA 4OWXB 2R44A 4ON9A 5LBIA 1ZD1A 2JJ2A 2ANCA 3OOCA 2ATXA 2QRNA 1D6JA 5P21A 2ZJOA 5EXPA 1W4BA 2ZTCA 4KSBA 4D4JA 1N5IA 3UG6A 2O8EA 1AE3A 4H9GA 1WRBA 3GD7A 5IDVA 3I5YA 4A3EH 1AH9A 2MSEB 1N6HA 2FPKA 2QN6A 4QBIA 4A1FA 4E07A 5EJEA 1NG1A 5L3QB 1ZCAA 4DBLC 4JI1L 4C3JH 3AP3A 2CLSA 2ZSEA 3HU3A 2R93G 1UJ2A 4MITA 4DRZA 5J4KA 2O8CA 2NZ8A 3K81C 1M7GA 4AH6A 1L2TA 2H8KA 2XJ9A 4BE7B 2F1IA 4QHTA 3S1AA 4LCBA 1NE3A 4N0DA 4TMKA 2DNEA 1TWFH 1S1CA 2Q21A 4DV7L 1TU2B 2P65A 4NPSA 1JB1A 1SVIA 2F1JA 3HPQA 2AD5A 2QGNA 4M8NE 2NN6G 1PH4A 3P20A 3CRW1 3GTLH 1OKKA 3EZFA 2F7SA 4C0HA 3PENA 2IYXA 3QSYA 3TRZA 4URVR 3HKZG 3TLXA 1FTNA 1GUAA 1QRAA 4BFYA 1V1QA 3QXHA 1C4OA 1QF9A 4AKGA 3D4RA 5EXTA 1VS0A 4B2LA 4LI0A 3K9NA 1PH2A 4JSYA 4JVMA 1W36D 2HYDA 2VBCA 2WAXA 3QXXA 2P6NA 1N6LA 3LDAA 2QL6A 2XSZA 4H1VA 4JT4A 4L9SA 5DGXA 4OQMA 2J45A 4DV7Q 2SHKA 3B78A 4DPGA 4DV0Q 1LACA 1NN5A 2J0VA 2ZU0C 4MRSA 4BZXA 1TEXA 4NDZA 2ODEA 2JLUA 2PCFB 4DR4L 5LD2C 4BGDA 4YCVA 2DFLA 4D82A 1VYVA 1N6NA 2GBLC 1IBRA 4RD0A 3ECCA 4GP6A 2HIVA 5J5CA 4X8LA 3STBD 1KKLA 4DLYA 5LMNW 4C7OB 1L1OB 1O87A 4M9SA 3EIHA 1ESMA 3CXCA 1JXMA 4HAZA 4A3MH 3SOPA 3TR0A 4P31A 2GXUA 2YJTD 2H18A 3V4RA 4QGAA 4FMCB 3IUYA 3W90A 1TTTA 2RCNA 4V0ME 2XZPA 2ZRAA 4TQAA 4DR4Q 2XB4A 1G7TA 3OAAA 3K0CA 3LBNA 4MYHA 1PUJA 2E2IH 1XFAA 2ZRNA 2ID0A 1U99A 3FP9A 3Q7PA 3T53B 1WE2A 3SR0A 2WJIA 2ZRCA 4DK1A 2ZI9A 2OHFA 4KVGA 5BN4A 2D4HA 2IC5A 3DM9B 5EE5B 3K9HA 4IKEA 2CK3A 2JDID 2L15A 4NKRA 4HATA 4UJ3A 2AD1A 1NMGA 1CI3M 2KWIA 1AGPA 4JJKA 2AFIE 1QHHB 5EE3A 4IFDG 4DAYB 1FNNA 4OK6A 3AB9A 4WAUA 2K50A 1FQJA 1G41A 2O8BA 1LNZA 4DKXA 1W44A 4H02A 3GEIA 1YNXA 3F2CA 1DAIA 1KO1A 1ZCBA 2P6RA 1LW7A 4HDCA 3BERA 4NTZA 5AWFC 3MJRA 3ZLJA 2XNDA 3VKWA 4CT4B 1EX7A 4ERNA 3TVTA 1C1YA 1G3IA 2IYRA 4X8HA 2QENA 3BK7A 4PC6A 1IONA 4IDHA 1E9CA 4Q4AB 4IOJA 3TUIC 5JEDA 5LDDC 3RYTC 4UXIA 1VMAA 2O5IC 2IEYA 1G3RA 4YDSA 4LC1A 4OXPA 1NIPA 1TMKA 2AN9A 3S2DH 2VNUD 4GMXA 4BBRH 2GVDC 4D2IA 3LQQA 4RKEA 1XJQA 1IOZA 1CKOA 2JASA 2WM9B 4POFA 5J4HA 1G8FA 2ZQ5A 3SYKA 1KAWA 1QVRA 2Q3FA 1K8GA 3MWLA 1M34E 3REGA 5FTJA 4YHHL 5E7JA 2D74A 2ZUBA 2RHMA 3NH6A 3TR5A 2RGDA 3CC2A 1J7KA 1BYIA 3KJGA 2H5XA 1E2PA 2WKPA 4PSVA 1GUOA 4PZ8A 5DNYB 3EPJA 1VG9B 2IL1A 1NVVQ 3CM0A 3H84A 3QXJA 3WRXC 1JR6A 3THOA 1N5LA 4PZZA 3QI2A 2HT1A 2FPLA 4IDNA 3TW4A 4A93H 1IYJB 1U0HC 4NCJA 1S0UA 1G4AE 2GHIA 2EFCB 1YNJC 1S4QA 3A58B 3O8DA 4BEJA 1X3SA 4YHHQ 4A3EG 2A7QA 3GDEA 2GAAA 4OQFA 1GD7A 5EP1A 1JQJC 2H57A 1V43A 3VHXA 3THYB 1OHHD 4LPKA 4NH0A 2WJVA 2GA8A 4DSOA 2JJ8A 2WB1E 2ZSDA 4BBSH 3W6OA 1DAFA 4LPSA 3GTMH 1X3FA 2BBSA 2A19A 1G51A 1XJ0A 2JJ1A 2XJ4A 3DOFA 4BXXH 1U98A 1KMHB 4Q1BA 4AWXA 3PO3H 1KHIA 1YE8A 3DKPA 2RGNA 3U3MA 2GF0A 4DNRB 1BMFA 4Q47A 1WBBA 4Q9LA 1ZKOA 3AVQA 3Q5DA 5KDLA 1N6OA 4LUCA 4WZ6A 4U00A 4IW3B 5CK4A 2B63H 2R92H 2GVZC 3K7UC 2JLXA 1HZBA 1JR3A 3E9HA 1IZ6A 1TU3A 1U9IC 4C0BA 3RRMA 3A8IE 4O0AA 1YJWA 1JXOA 5EXSA 1K8AC 5J47A 3IQWA 1Y3AA 5GVSA 4PG3A 3NELA 1EX6A 4R4OA 2LCFA 1FZQA 1F5NA 2DNCA 1SFOH 2PBRA 4IXNA 4V0OA 1NTGA 2Z4SA 4R2HA 3RLNA 3SBDA 4IO9A 1UE6A 1EGAA 2Z43A 3L0IB 3QVUA 5IP9H 4AYBG 2OCPA 4PR0A 3ZVRA 4R71A 1SMXA 3KB2A 1E9DA 1VF7A 1ETUA 1P75A 1QHSA 1IM2A 1Z28A 3LV8A 3KJHA 1HZAA 4IJHA 3GTQH 4R1JA 1M90C 2Y0SE 2EYUA 4ACAA 1H9SA 3ASZA 2OCEA 1EK0A 1K8OA 5FL7A 1XTRA 1CP2A 5KO2A 4Q00A 3U4QB 4A3MG 3D6TB 3QBTA 4Q5IA 3GLGB 2V54A 2JAQA 3I92A 5FOUA 1WCMH 1NP6A 2G88A 4A2PA 4DEYA 4PC2A 4PXAA 1YZKA 2QTFA 4JIMA 1OYWA 4QNMA 4E09A 4TLEA 2K5HA 4HUQB 2W83A 4HJ5A 3T1HL 2I3BA 1CJKC 4Q1CA 1G20E 2DGYA 4DR7Q 3BAFA 4W5WA 1FX0B 2Q2HA 3KZ1E 4W5JA 2ZE6A 3NENA 1AK2A 4II7A 3ZZUA 3ULJA 5D3MA 1KI6B 1GRRA 1Z63A 1DE0A 1A63A 1PUIA 5CM9C 3ETLA 3PR1A 2VL7A 1CKMA 5J3BA 5EP4A 5FUXA 4B3CA 3B6YA 3ZQJA 1YZTA 2LMCB 3A4LA 3ZZ0A 3VA7A 2NGRA 2ZI6A 1JEDA 3EA0A 2O0JA 2RHQB 4L8JA 4JL8A 4PTLA 4L5TA 3UKDA 3RN5A 3CCJA 1Z8FA 4XIGS 3KB1A 3LVRE 4FI3C 5DHAA 3X2SA 5KDDA 2V1UA 3THXB 4OO1G 2YWGA 4CYMA 1YNNC 4AIMA 5FLMG 2Z6KC 2EFHB 3LA6A 2QP4A 4V0LA 4MRPA 5M5WH 2R2AA 4DR6L 3K70C 2VHQA 4KO8A 2F4VL 1OTCA 4POAA 3FKIH 1J90A 4NYMQ 5CITA 3PITA 1X3EA 3J81j 2GAOA 5CLQA 4BBRG 3WBJA 2BKEA 1GKIA 2WHXA 5DI3B 1E69A 2IYZA 3S1RH 1IXRC 2HLDA 2OQ0A 4NXML 3ZJYC 3RNLA 5CK5A 2DFTA 1Q12A 1IBLQ 1BS1A 1W0KA 4KN4C 1HTPA 1JAHA 1N25A 2W2XA 2E76C 2KA7A 4A3CH 3DPUA 3ZDQA 3GLGE 4DR6Q 2FWRA 3GLHA 1KI9A 3SN6A 4A82A 3KF6A 2JLVA 2F4VQ 4G7HC 4WW0A 1XTQA 3EN2A 3I3SR 1U2RA 3KLRA 5FOSA 2ZTSA 1T5EA 4A93G 2ZU6A 2NVXH 4TQUS 1ZM7A 1W36B 1KK0A 5FOWA 1K6MA 3AM1A 1NJGA 3K1JA 1XMOL 4NXMQ 2A5YB 2IHYA 4URYR 3QKTA 3Q7QA 1IW7C 4GDFA 4AK9A 5CDFE 2G0TA 3IO3A 5FL3A 4DV6Q 5FUVA 4DLRA 5K8LA 2EJMA 3CX8A 4BBSG 1BKBA 2OXRA 1PLKA 4A8JC 2WWGA 3JVUA 3OFNA 4DSNA 4F4IA 4DR5Q 2ZR7A 4ESVA 3AGPA 1NY6A 4QBHA 2NOAA 3ZYCA 4PC1A 1GO3E 2YV5A 1T6NA 3HKZE 1XMOQ 1Q1BA 3AFQA 1IXZA 1E9BA 2ZPTX 4KODA 4RD4A 4DWJA 3CZPA 5EE0A 1DARA 3CX7A 2EVBA 1VQEA 2JGNA 3CH4B 4M9XA 1X8KA 4OHXA 4B43A 3LW8A 2KHIA 3EIEA 2IHFA 1VQFA 3TMKA 4CVNA 2NPIA 5H8WA 1ZRHA 2CL0X 4KXFB 4YDHB 2P67A 4PZ6A 2BV3A 2WZQA 5JECA 1GUGA 1E0KA 1GILA 2F43A 2V6IA 3FKSA 2JXMB 4JI3L 3ASYA 3HR7A 4LJ7A 1O78A 1JJVA 1W4AA 2YOGA 4NZYA 1Z47A 1Z9FA 3DVLA 1ZYRC 3KQKA 3CCMA 5EP2A 2ZIAA 5JI2E 5KNCA 4H0LC 4KHZA 2JLQA 5IP9G 5JCZA 1ELOA 4PV1C 4PC7A 1I6VC 3B8HA 1X55A 2A1AA 1CIPA 1YJ9A 2GDJA 3GFOA 1ZP6A 4GPTA 2NZHA 4GZMA 5DE3A 2F3RA 1HH2P 1JALA 2JQOA 3CC7A 2DY1A 5KPDA 3AGQA 1WXQA 1HPCA 1IBML 4OX9L 4NONA 3FHOA 4HUTA 5B64A 1DO0A 3WNCA 2IXGA 4D4LA 4JI3Q 2J1LA 4HB3A 4JI2L 4N0EA 5K8UA 3B82A 2NMVA 2ZVPX 5C46F 3ZVNA 1Z0IA 1TADA 4JI6Q 1B70B 1AIPA 3QPUA 4JV5L 1UFQA 4O0MA 4UXJA 4PZLA 3TSZA 2FGKA 2KB0A 5C1BA 4FW9A 4YMSA 2HHHL 3AKCA 2AUJD 2R62A 3BXZA 4JT2A 4DCUA 5FTMA 3WXMA 4NB3A 2Y8EA 5HKKA 2D5DA 1R5OA 4PZYA 3M4QA 1P2TA 2HIXA 4DNIA 1U0JA 4OX9Q 5JJLA 2BJVA 2MQHA 3X1XA 3KXIA 4LF6Q 3DEFA 2IF0A 1XCMA 2ZM5A 3VR6A 4R4IA 4L16A 3RRZA 3T5GA 4D80A 4X64L 2LWIA 4JV5Q 2IS1A 1OSNA 1XTSA 4DV5L 1QZHA 1T0HB 1IYVA 3KFXA 4IOCA 2DWPA 1IBKL 4X66L 2JK8A 2VL6A 1P3JA 2UUAL 1OFUX 3GJ4A 1MABB 2VSXA 2K5VA 4TSFD 3M7NA 1WYDA 2IXFA 4LK1C 4P73A 3C7KA 2ORVA 2VQEL 3QEJA 3GLIE 2E5LQ 3ZD7A 2F9LA 2TMKA 1T3SA 3X1YA 2CE2X 4DV5Q 2WBLC 4LFBL 5BW8A 1JPJA 3K09A 1IBKQ 4CEIA 3AB3A 2GCPA 1SRUA 3K0FA 1BDOA 3LVQE 4O25A 1KC8C 1GIAA 3UIEA 5JJIA 1G16A 1XF9A 2UXBL 4X8OA 2QTHA 1NSTA 1ONBA 1NMFA 4GI7A 4DEXA 3WWVA 2BMFA 2ZI7A 1DCZA 1P16A 5DN6A 5EUQB 1NRJB 2IA5A 2CNWA 3BGWA 3MMPA 1E1RD 4LUOA 3I61A 4AYTA 1DGSA 4NCHA 4Q02A 2ZYUX 4LFBQ 1LABA 3VR4A 5EE9A 2KJQA 5IYBH 3N2EA 4PSAA 1VYUA 2VF8A 3W6PA 1RYHA 3WMFA 4D6PA 1IN5A 2ZEJA 4IPDA 4XVRA 1CXZA 2ZE7A 4DCVA 2CCJA 1CJUC 3VR5A 2WWFA 2ZTDA 3QBVA 4TTPA 4PMWA 4MTNA 4AURA 2KENA 2UXBQ 1WJJA 4DK0A 1EFRA 4NYMR 4AKHA 4IFDJ 4JL6A 3PF4A 5AUOB 4MKHA 4NBSA 1E2DA 1K8RA 5B30A 3F5FA 1WOCA 5CYPA 1HUQA 1II8B 3U5ZB 1TWAH 4M1TA 4R4TA 2N46A 1WMSA 1W49A 2AHOA 4O2LA 4HJ8A 5KNBA 3ERSX 1Y14B 1Z2CA 2YINC 3VTKA 5B58C 5C4MA 4GLXA 1SQ5A 3UG7A 4FWTA 4FD2A 3SJZA 1E9EA 2RGCA 1S40A 2W6IA 2XZLA 2V55B 3KX2A 1PH9A 2A9KA 1N0WA 3TEHB 3SC3A 1MO5A 4TT3D 1I6HH 4GOXA 4BPBA 4MDEA 1NN3A 1Z29A 3G71A 4U5XA 3Q9LA 3CR8A 2LXKA 2CVFA 4QL3A 5M5YH 3B60A 2V1XA 2PT7A 1BVSA 1MV5A 2Q9CA 2X19A 4OK3A 3H4MA 4DUGD 1A2BA 3CW2C 5J4YA 4TMTA 1FL9A 5DO9A 2RAPA 3I4NH 2WAYA 4LYFA 4M1KA 2IX3A 1E1OA 5EE1A 2XGJA 2WOJA 4Q4HB 1NVWQ 3CC4A 4WZAE 1GTVA 4AYBE 1W2GA 1XD9A 1ASZA 2OAP1 3CX6A 3WNDA 2PH1A 4OGQC 3HOUG 5IT5A 4Z8YA 4B6EA 2EQBA 2NN6I 1UBGA 2O8FB 2JA7H 3L2PA 2R6FA 1GKYA 2V7QA 3A1TA 4RZXA 3FPAA 3O47A 1RW4A 4LBVA 1CTMA 4PC3A 3WHLA 4A6XA 2VP6A 2I0QA 4OI1A 1CEEA 4WJ4A 1VQ5A 1O3YA 1P73A 5DLQE 4DJTA 1M1YE 4OI4A 3CO5A 2J0UB 5IF9A 3I5XA 2O0KA 4Q1EA 1I5FA 2O5JC 1EWIA 1G8YA 2VY3A 2GCOA 2WIBA 2A5GA 2ZSFA 3NG1A 4WOPA 1NLFA 3QF4A 2QE7A 4C3HH 2ORIA 2ZS9A 3ND9A 5C18A 4XSHA 4F92B 2B6HA 3REFA 2EVWX 1HURA 1RL2A 2JIZD 4A3DH 2ZJYA 3B5JA 1IY1A 3RABA 2ZITA 3TIFA 1PYSB 4LF9L 1XTDA 1DBSA 4JI4L 1G6HA 3C8UA 3FTQA 4RD1A 2EDGA 4ALPA 4WVFA 3RSOA 4MYUA 5G41A 2D62A 1P8LA 2EWWA 2P5SA 1PH3A 5KSZA 5EXXA 1JECA 1DG1G 3BE4A 5IK2D 3NBFA 1MO3A 1YZ6A 3CMEA 3CPHA 2HDNB 4IEIA 4C3ZA 2ERXA 3M3YH 3RNUA 3MXNB 4LWCA 3ND8A 1N6KA 3L0PA 2IX0A 2R6DA 4Y0AA 2D06A 3NDPA 4D0GA 4MRNA 5A5GA 1I4DD 5AUQA 1MJCA 3EXAA 3ZVMA 1YQTA 1G18A 1VQAA 5J4LA 3K70D 4XVQA 5C4XH 4B71A 1RRPA 4B75A 1Y1WG 1ZC3A 3I8SA 2ZVQX 3BRWD 3AF1A 2PLRA 3I4MH 4QHSA 4DV1L 3UDFA 2ASBA 2WV9A 5DLQC 4EFNA 4FMCF 3QKRB 2J0SA 4B2IA 4A2QA 4DCTA 1Z22A 2CBZA 3CP0A 4TL9A 2ZRGA 3UE1A 2LKDA 1JB7A 4F91B 2G1JA 4IFDI 3G48A 4TZ6A 2F1MA 1JPNA 3Q3JB 2GXQA 1XTKA 4PAOA 1N32L 2ZI5A 3OIWA 4FMBB 3PUXA 1E2JA 2EU8A 2OT3B 3FMIA 3T15A 3C5CA 4URXR 5HZHA 1L7VC 4B3FX 4FCWA 1J8MF 2GWHA 4OHZA 4KBFA 1Q86C 4RG1A 1GM5A 4DV1Q 3HU1A 2ZTEA 1E1QD 2OO7A 5IYBG 4R98A 4OKSA 4NCNA 1PYBA 2Y0SG 4MYCA 4NCKA 4JBYA 2IEZA 1R5NA 4HJ7A 3BC1A 4M1OA 4KKTA 1DOAA 2I1QA 4JLBA 1E99A 1OIVA 4HZUA 4H44C 3CAMA 4PZ7A 1UKVY 4DLVA 5LD2B 1LY1A 2DFKB 3U44B 1FYCA 4D81A 4DSTA 2D2CC 5AJ3Q 1YIJA 4L5RC 3FE2A 2L5TA 3LW7A 1N2CE 4RVCA 1MR3F 4GOPA 4HIMA 1T91A 2AWOA 2VEDA 2OQKA 1AN0A 5BN3A 1KHTA 1NL3A 3C41J 4LBZA 3SFZA 5BYKA 3NHBA 2KHJA 1R8SA 4MDFA 2VRWA 3W1GA 3OEHD 1SZPA 3RR5A 3CF0A 1N6RA 4Z1MD 1QUQA 3D0FA 1OH5A 4JI7Q 1HQMC 2YKGA 2ZYWX 4IOKA 4V03A 2N42A 3F0TA 1JJ7A 3IBYA 4AKEA 1OW3B 5A0FA 1GDDA 4RFSB 2YOFA 3IGFA 1F60A 2ATVA 1XRJA 2ZM6Q 4HAYA 1PH6A 2YWEA 1NG9A 1ZINA 3IHWA 1L4UA 2OFXA 2QT0A 1Z3IX 3CF6R 4LOAA 2D7CA 3GO5A 1ZYUA 2LSSA 1TEVA 1Z0AA 3I4NG 1FP7A 2X2FA 2ZJ8A 3LY5A 6Q21A 3TGPA 4ZDKA 4L5SA 3LFUA 4I1SA 4BFVA 5B2ZA 1W46A 3AVTA 1GP2A 1GL9B 1P5ZB 4M9QA 4Q4LA 2XEXA 5AR1A 3EARA 3BG3A 4QGFA 2N1BA 3X1WA 3SBEA 2R6GA 1WF3A 2ZJZA 1TNDA 2JA7G 2OM2A 2E74C 4EQ6B 1ANKA 4V0MA 2A68D 3WHKA 3GEHA 3AVVA 1UWVA 3B13B 2ZETA 4MGZR 2N8NA 1XTIA 1PVOA 1TWCH 4RKFA 4L9WA 5CM8B 4GMDA 2G9NA 4LNQA 4ASUA 5L3QA 1OH8A 5JEAH 5BXQC 2IY5B 2BEJA 1AZTA 1KQSA 2XTNA 3TH5A 2Q9BA 3ULPA 3R20A 4PHFA 2BCGY 3KDFB 2ZANA 4QBGB 4R4CA 1HYQA 2HUPA 4TZ0A 5JWHA 4Q48A 1U8AA 2O52A 3EIVA 3QY0A 2A2ZA 8OHMA 3A4NA 1R4AA 2IYUA 3SZRA 2IWRA 1T8TA 1KDOA 1YHBA 4DLXA
chains in the Genus database with same CATH superfamily
4JBXA 1UWCA 4RFVA 2QK4A 2JBWA 5IARA 3U3RA 4QARA 4QATA 4C0JA 5IT9c 4DBZA 3CZMA 1T2EA 4JVSB 3UCXA 3ZV6A 4RHXA 3JASB 4A0FA 4DUZL 1R9TB 1HORA 3Q8KA 3D54D 3NOXA 1ZMBA 3LXXA 4FEYA 4KNVA 1ZL2A 3IVXA 3RAJA 1XN4A 3J7AV 2GUGA 5EVCA 3OM1A 1TA9A 1I1OA 4JA2A 5JCOA 3R7LA 4Q4JA 2A73B 4CUKA 5REQB 5A6SB 3JPYA 1WZIA 1RMYA 3V4SA 1S4ZA 2VPXA 2VPYA 4K05A 2VPWA 4URHA 2GD0A 3BILA 2VQ6A 2SCUB 4Y9RA 3DWEX 3PRYA 2XQIA 1DC5A 3K2EA 3V6LA 2ID4A 1NJ5A 5I6YA 1GTSA 2XXAB 4YCSA 3AILA 4NH4A 5JSZB 1F06A 4MCIA 4RY0A 1EIHA 4NVRA 5BQ5A 1LXCA 4X3SA 4MV5A 1DAOA 1TIKA 2D7DA 1SM4A 1NY4A 4GOJA 3THYA 2P9TA 1COWD 1CY6A 1EFCA 4V0SA 4WERA 4LZWA 1W6UA 4EQOA 4BAUA 2J5RA 2K4KA 4I1VA 5EQDA 3VBCA 3PNQA 4L6CA 4Z53A 5L4SA 3D8GA 1PP4A 2I4RA 2HTFA 4EYEA 4H0NA 3KKEA 3LFTA 4EECA 5LBUA 3PQ3A 2BZ0A 3BJRA 3DG9A 2Q1YA 4TL7A 3ONNA 3UAWA 3CURA 5F5LA 3TPFA 1RAHA 2AKYA 1ZMOA 2CKZB 2P75A 3L7IA 5DGIA 5CDFA 4C3HB 3JQEA 5EESA 1TGYA 2OEPA 1N36Q 1BS2A 2VUSA 4CL3A 3L79A 2KI5A 4LF7Q 1YKSA 1Z4OA 1ZMXA 3D7SA 3QQPA 4MW0A 2HSWA 1LPPA 3HB4X 2WIAA 3M4OH 4O3MA 1ONOA 3PUHA 1V5IA 3ZTWA 4C43A 4FIDA 4LFCL 5ED4A 5HJ2A 1U9YA 3W5SA 1HQCA 1I4RA 2OK7A 5CBPA 1XPOA 4TKUA 3O31A 3DMTC 4EB0A 2IZ7A 3CRVA 2JIOA 2A78A 2LKVA 1JLKA 2OCLA 4AECA 4HEQA 1MO4A 2V8OA 2FZ4A 3LWDA 3ZX4A 2Q5CA 1NI4A 1IJEA 4OQYA 2EWVA 3FTPA 3UAVA 1GSIA 5K99A 1CF9A 521PA 4R0NA 4GPBA 5KYNA 2FX3A 3D2LA 3PE6A 3FUXA 1Z45A 3K9BA 4OXNA 1NVVR 2O2YA 3Q15C 1YHQA 5FNVB 4DR2Q 4ZV9A 4TXMA 1JFFB 2ZK7A 4QYSA 1JU4A 1IY2A 3SDSA 3QLVC 1R9JA 3WK8A 3LMKA 3L05A 2WTNA 1U04A 2GZAA 3G5UA 2QNBA 2W98A 1IN7A 4H1TA 4PSCA 1Q7YC 2CVQA 4E1AA 3NM5A 4JENA 4BE9A 3IE0A 2MHVA 5LKRA 5T4FA 3RPEA 2ZRQA 1L8OA 1FQKA 4XQCA 5LA6B 2R7ZG 4BCDA 3G85A 1H2ZA 5EWLA 1J5PA 2R6CA 4OEMB 5IYCG 1V1PB 3H5TA 3A8KE 4RW0A 2QPTA 4MVXA 3BD9A 3BZUA 1FL0A 3E0JA 3PGJA 4D9BA 1V3QE 5IYDH 5CV8A 3CJTA 2I6FA 1N5MA 3U49A 3RR2A 1UJCA 2XMGA 4JK1C 3TDNA 2XLCA 4K26A 4DB2A 3G6WA 4PHHA 4RPHA 2PQAB 3I0MA 2MT9A 4RF5A 3DW1X 3PUYA 3GJSA 2N3SA 1VI6A 3O8RA 4HGOA 1MMFB 1S3IA 3FFAA 3WHPA 1M6NA 1GPDG 5BOSA 4IP0A 4M55A 3UWKA 4ODIA 3D8RA 1KWGA 1NC3A 1MZPA 2P40A 4Z4QA 3A27A 4GSYA 3JZAA 3F9IA 2NZ2A 5EZYB 3ZZ1A 1LPMA 3KUXA 1CULC 1SVNA 3MRSA 1XMXA 1PFNA 2GCEA 4QFCA 2BZSA 3QEKA 4MUMA 4EUNA 1F9SA 3CUYA 4QBKA 5A7GA 4CETA 6PFKA 1YZQA 2A5JA 3TRFA 3OAAD 1P4RA 3C8MA 3C2PA 1U8YA 1ET6A 4UBIA 2EFEB 3ADPA 1Q0SA 3K1ZA 3AEKA 1KAOA 2FX5A 3OCXA 4IEEA 4NENB 4HAIA 1QP4A 5AI8A 1GJRA 1S5ED 2FR1A 4EAAA 5JMTA 2JGDB 4TKOB 4DV2L 2N88A 3DMNA 3HSYA 3L3OC 5HP4A 4BZZA 3Q0IA 4H4DA 1U8TA 4TL8A 1K3BC 1BOOA 5M29A 1BXGB 3NSWA 2DBVO 4RPKA 3GFBA 2GBLA 3I52A 4BVHA 5BWOA 1W1IA 1HEYA 3MCTA 1WXGA 1V8PA 2FETA 2CH4W 4DHEA 1YR7A 5EJIA 2K5QA 2R7ZB 3TFQA 3L1JA 4IHJB 1KORA 5JLJA 1OBOA 2R79A 4BVKA 2W43A 2DMRA 1W29A 3DTVB 1Y63A 4KN8A 4PG6A 1EVYA 1T9HA 2ZXEA 1EZ1A 1G8HA 1VDZA 5F76A 3Q8XB 1FFXB 2DJFC 1MU0A 1CHNA 4I08A 2FQ1A 5IVDA 4K81B 1T2DA 5KYUB 2IS6A 4OLAA 3TQTA 4YECA 4DEVA 4EY3A 2JCBA 1VHQA 1IQRA 1YCGA 5CLFA 2YVUA 4XLLA 1P5FA 1BWQA 4JKOA 1EM6A 5EIXA 3BMQA 1LB1B 4D0NA 1ISJA 4FW8A 1HA3A 3ETCA 3VAZA 4QNNA 5L40A 3TREA 4QTZA 4CEJB 4Z5XA 2GYUA 5H4GA 4O2DA 3TLJA 4N1AA 3KB6A 1Z3CA 2B25A 1KFCB 2DWUA 4IOAA 5LN1A 1G6PA 4D0RA 3QUTA 2P2SA 2J3KA 1ZVVA 1KXZA 3K8QA 4JBJA 3CKKA 1G8ZD 1K5GA 4KFRA 2PHZA 2B2TA 1KQOA 5KYKA 3NEJA 2DHRA 4N54A 1G3MA 5AW1A 4C76A 4OVKA 4YAGA 4NEGA 1U2GC 1TVKB 2LBPA 3A74A 2V0NA 4IALA 1EIFA 3RUDA 3J81i 4TRRA 1S02A 2B5VA 4LCJA 5KYWB 2KPOA 3A8JE 1NFRA 4US1R 3JCZA 5GAEC 1WM1A 1YIAA 1NONA 3BRWA 1RI4A 3FKSD 4RHRA 1KPHA 3MAGA 3W4IA 1QNFA 5GWXA 3SQXA 4GNXC 3JVVA 2BGIA 3KK7A 2F0MA 3E18A 3ZWDA 2Y71A 5EIHA 2Y1CA 3TE7A 3S5JA 1J5EL 3JQPA 3S2EA 4XX0A 3KF8B 2HD4A 2LIVA 4BCCA 1TGVA 1RYEA 1E3DA 1O8CA 5A2GA 1H2FA 4M38A 3QJ5A 4DC0A 4LOLA 4MYRA 3PNBA 1RXVA 5B7NA 2VUHB 2OE2A 1K7SN 1QXSA 4X61A 4LJ6A 4XVUA 1GCGA 3R4VA 1KDAA 3BDCA 1BXRA 1J8FA 3G7NA 4HMQA 5DM73 1SUIA 2OBYA 2Z83A 2QVCA 3AK4A 4Q0FA 4FJ1A 2GJ8A 5IYZF 3ZHYA 1HT3A 1B1ZA 4ZCSA 1PQPA 2XF2A 1EFRD 3KQTA 1IG3A 1SFRA 2P1RA 4RDHA 3IO5A 2JKYA 3GP3A 3U7FB 2JLWA 3RC7A 5G0SA 1VIMA 2E5FA 1ZWKA 5EI5A 3PXUA 2GPJA 2W6ID 5C4XB 4AWAA 3H4IA 5IUNC 2BGWA 2Q99A 3GP8A 1FJGL 4FM9A 4YNBA 4YAJA 2RHSB 3LS2A 4FGZA 4PNPA 1GRNA 5IOCA 5ALKA 4TTRA 1LTLA 1BH6A 2AW3A 1A1VA 2A74C 3NR2A 1N0UA 2G9QA 4AQ7A 1P8AA 2REQA 1RJ9B 1X1CA 1XCPA 5GP1A 1C9DB 2C5SA 3I0ZA 2P68A 4INPA 3O74A 3KXLA 2OF1A 4MR9A 5AFWA 4IH4A 4JKYA 4B6JA 1CCWA 3TQCA 3DDOA 1OASA 3VYRB 5L3VA 4C1NI 3GVHA 3OTOQ 3OPXA 4TS3A 2O8VA 3EBLA 3DEHA 1LT4D 1H4QA 5KQPA 3EY4A 3P2MA 4W9RA 3GZNA 4YDQA 4GGMX 4DDVA 4FJ0A 1DTWA 1H5UA 1A9ZA 2FZCA 3WFZA 4QOSA 3O2NA 2WF7A 1DOLA 4R8MA 3K5IA 4DGSA 3FDFA 2AG0A 1VLLA 1G5FA 4JJFA 1AOXA 2GXSA 1XBTA 4M0LA 2AQKA 5K09A 1LDEA 5LP6B 3PIOA 2BR5A 1CEQA 3T4PA 2ZXPA 2HMUA 1SYBA 3U0BA 4U6NA 2HMAA 3RAGA 3O9VA 2OKCA 1T29A 2HHHQ 3OPNA 3QE3A 3PJGA 2O2LD 1T43A 1QS0B 4TYNA 3VSDA 5DIFA 2GZSA 1MFZA 3WDSA 1NP3A 3ZDYB 5DK4A 3CLTD 3I3OA 1ECCA 2UZ0A 1E1NA 1ESEA 5IX8A 1LBQA 1MZVA 1G4HA 2PUBA 3FNIA 1XQWA 3K4HA 5EBDA 5H3LA 1JWUD 2Q5HA 1NVTA 1FFEA 3DHYA 3M49A 4XWOA 1RJTA 3BSFA 4YUWA 5IDYA 4OJKA 3HCPA 1XD2A 3ZJ4A 1KYIA 1GUSA 4GVPA 2HA3A 1B9NA 2H16A 1PH7A 4URWR 5CXSA 2DETA 3U4GA 5EJ4A 4IGAA 3A9TA 1Z8NA 4RVNA 5SZHB 2LY7A 1PKEA 2ZROA 4YIKA 2WVJA 1OZAA 5M5BA 3T1YL 3D81A 5JNWA 1UIRA 2A88A 2ZRHA 2QY9A 5M3FG 1RXUA 1P9OA 2OO3A 1L4HA 1UDAA 2LRHA 5IDQA 5BSTA 4KP7A 5KU7A 4MZDA 1OCEA 2ACWA 2D3TA 4J07A 2I7XA 4M60A 2BA0A 2RIPA 3UJ9A 2X5XA 1EFWA 4NQZA 2E6UX 2NUAB 3STVA 1KETA 4J6FA 3K09C 4A4IA 4P08A 1TUEA 2R0QC 3PDCA 3LHIA 4PZEA 4MI3A 3VYUA 4F60A 5BRAA 3PR3A 2ZBVA 4OHKA 2V7BA 4J29A 2IV2X 2B5WA 4KUHA 1GTZA 2AEFA 2H85A 1E4YA 5LLTA 2VW9A 2J3IA 5GVRA 5T4BA 4OSEA 4FXOA 3ND5A 1JFLA 3ZCVA 1SUDA 2VPIA 1M6YA 3QP9A 3MWEB 4QL5A 3J7A5 3ESAA 4G5SA 1U28C 4WORA 5E2AA 3LTNC 3AR8A 2BTQA 4X20B 1C7EA 1XGKA 4OP3A 3SHLA 1CQIB 4JYBA 5JCJD 3B1YA 5KSPA 1JT2A 3S1NH 1BXTA 3SM3A 3CO0S 3TOVA 2QMZA 4BGVA 4X00A 1EFUA 3LX5A 2JARA 3CT4A 1ISPA 5ALSA 2ATXA 3AOGA 4Q24A 2WT9A 4QOFA 1FDOA 1G8MA 4A1FA 5B5SA 4O6VA 2O8CA 3MUNA 2ZLBA 3S1AA 4LCBA 4R1SA 1DIRA 2QZZA 2P65A 4NOJA 2FW1A 3HPQA 4L6IA 3P9CA 5IXYA 4RPCA 3IL8A 3MLBA 4PVCA 4IJ5A 1XX8A 2AYZA 1N6LA 3LDAA 3BX1A 1O77A 1KZ1A 1YI0A 2FEPA 2DFLA 2PR7A 3WA6A 5JMOA 4HCJA 3TLYA 5M3FB 1IDOA 2XT6A 3NJ8A 3TXAA 3DULA 4F6RB 4V0ME 3VNRA 3UAGA 2NUTA 4C2AA 2EKDA 3NWPA 1YNOA 2YXNA 4UJ3A 5A62A 1QHHB 2YXEA 2EFYA 4FKMA 1S2NA 3GV3A 3JALA 3F7OA 4NCXA 5JEDA 4IOJA 1G3RA 4YGXB 3ZE9A 2JASA 2ZQ5A 5IBCA 2UUAB 4D56A 2Y0DA 2XUGA 2HT1A 4IDNA 1IU9A 2HF2A 1L7OA 4TWBA 3F7NA 3EZGA 4ZRDA 2H57A 1TECE 1V43A 4Y3UA 2A19A 3DOFA 2WJ6A 2HU5A 1LT5D 4LNUA 2GVZC 1XZGA 2WIIB 2HQ1A 5EN4A 2XNAC 2LCFA 4BVBA 1VXRA 3QVTA 4L51A 2ID7A 4ZQHA 3MRVA 1WW2A 3CHYA 2P11A 4R1JA 2V6MA 2A0WA 2B61A 4EGCB 4IZOA 3T7CA 3BE8A 2QUHA 2B2UA 3H2HA 4EUFA 4ZK6A 2A9JA 2NUCA 4BNGA 4X24A 1OYWA 1TVCA 3VAYA 5D65A 1AKUA 3H8JA 3I9V1 3ZZUA 3O26A 1PDOA 1J6UA 2LMCB 2EJVA 3M6LA 1GGHA 4L5TA 3CCJA 2Z4TA 5B7GA 4OO1G 3PHJA 3G2JA 4JI4B 2Z08A 5AK3A 1E69A 5CCXA 1PJZA 4EP1A 3AI7A 4H3SA 4TMFA 2W2XA 3VYWA 2CXHA 3PMFA 4KUGA 1W35A 1M9NA 3EN2A 2FYTA 2NTJA 3FVWA 3K1JA 4A3JB 1CP3A 1ZCFA 4KXNA 1F8FA 2CLMB 3LKVA 2YFHA 1ZPDA 3AFQA 1NZJA 2O2JA 4KXFB 5E1MA 3MC1A 2P67A 3LXUX 5L7TA 4PZ6A 1QV7A 1Z25A 1NF9A 4LJ7A 1P1BA 4PRKA 1ZH0A 2B20A 1FXUA 3CCMA 2JLQA 1T5TA 2GR9A 4XM2A 1SJED 2JQOA 5EVJA 2AUMA 2JFBA 3FNBA 3AKCA 1N2JA 4DCUA 3ZWYA 2X41A 3KYCA 2JBAB 1U0JA 4BV2A 4MLDA 2G4LA 1SUFA 3HO1A 3GRYA 4X1IA 3F46A 1FLVA 1W88B 1CQVA 5BP7A 2K7ZA 1GQQA 1O9HA 1J39A 1Q3KA 4JXJA 1T2CA 4OG2A 2CE2X 2X7HA 2BKXA 2YWCA 1N5OX 1BDOA 2GBIA 2XDQA 4ZC1A 4X8OA 2Q9UA 4PLVA 1Y1KE 1CK4A 3SCZA 1N2GA 2YV1A 3O38A 1V2HE 3FEWX 1VYUA 4P3OA 4B4VA 2ZTDA 3FX2A 3WLQA 5D5HA 5GV8A 2R6JA 1WOCA 1II8B 4BKQA 3CVXA 4BUCA 2XT0A 2ZB8A 3LUFA 4C1NK 4JJ4A 5JOBA 4LZNA 5IAGA 1I6HH 1PNOA 4HXGA 2PGNA 4INOA 3B60A 3A56A 4R9SA 5AK4A 2C5HA 3H2JA 4DUGD 1A2BA 1E1MA 3DCYA 4G2TA 2PAFA 5CMLA 2W5UA 2NN6I 3L2PA 2V5VA 1EFPA 3WHLA 1CTMA 4GQIA 3TG8A 2GH1A 1XQXA 1VQ5A 3X2EA 5E9QA 4D9HA 4GYJA 5IF9A 1CZOA 2I67A 1VBMA 4W82A 2NZWA 4RYDA 2XXBA 4ZQFA 2YJZA 4P93A 1ULSA 2EWWA 4IIXA 4AJLA 5KSZA 3CEAA 1BGXT 2Z8YM 3MXNB 4Z2AA 4F5YA 3SEBA 1I4DD 1YQTA 1LT3D 1R4NA 1UM9A 3EJWA 5C1OA 4XVQA 1JXQA 2X13A 1CIJA 4KE9A 1M2JA 3QEAZ 1CUVA 3CP0A 3LZ6A 3Q3JB 1MN6A 3IFDA 4CDEC 1V1RA 3HU1A 3R9KA 4BQEA 3VJLA 3BC1A 2FZGA 4DG9A 2XWJI 1QO0D 2QN3A 1PVDA 2DKNA 2Z3WA 1N2CE 4HIMA 2P2YA 4UU1A 2DVMA 3UGKA 4R01A 4F4FA 2JGMA 3GPBA 1V25A 4TZKA 3UTDA 2WB4A 4LOAA 5JD6A 2VH2A 3BG3A 4QGFA 4IPTA 1WF3A 2B37A 1TNDA 2XWSA 1Y8RB 2WF8A 1OWMA 2WP0A 2IY5B 2XTNA 2ZUEA 3VDXA 2F0GA 3NGXA 5DBIA 4EHBA 4P84A 4EKDA 3GP7A 4HEDA 2W6JD 2WSBA 2ZJAA 1RXIA 5KTNA 5HKLA 4DV0L 3FDTA 1SZCA 1IWPB 1UQTA 3AVWA 3LQ4A 3LIIA 2QTMA 5LOVA 2E7ZA 5SYAA 1Q1GA 3KYBA 1VBKA 3NQ41 4S35A 4YUXA 1X7DA 2C54A 2MCFA 1K8ZB 1Y6ZA 3G8CA 1GLGA 3K2QA 4TTQA 3R5TA 1E77A 4NPCA 2NVBA 1TZCA 4LYJA 5FV7A 4QUIA 4DAYA 2FSIA 4UUPA 1EYGA 2RK3A 1F2YA 1TWHH 3LLUA 5IVHA 2DOKA 2WB1B 5C44H 5AKXA 2A92A 3GFPA 1FFYA 1U5KA 3PCTA 1WQ4A 1LSSA 3OCYA 1HNZL 3S2IA 2IK8A 4FYKA 4TLDA 2POCA 4BJ6A 2FG6C 2VQFQ 4IWYA 1PZFA 3GEGA 3PKJA 2XYPA 4S1TA 2HMWA 1ACMA 1IBKB 1NPYA 2JJYA 1JQEA 2PPVA 3BEDA 1Z82A 4MB0A 5C2JB 1EYZA 2CDNA 2IDJA 3EUWA 1GL6A 3J80L 3C74A 3JR3A 1Q82C 1OX4A 3ZHSA 4R1OA 3TQFA 3DWQA 4G1UC 3HRKA 4M46A 4UTXA 4HTHA 2CLIB 2ERYA 2Q7XA 2FEOA 4O63O 1H0KA 1N0IA 3DMPA 1M1XB 3EGVA 5L4LA 2XQJA 2J3JA 2IE8A 3ORSA 4RHFA 1I4GA 4X1OA 2C5LA 4NBRA 5C8YF 4BBPA 2CLDX 1VMDA 3V48A 3B7WA 1UEIA 3WRYC 4UEQA 5I4KA 3BH6A 4NK4A 3RFVA 2ATCA 1FNMA 4QQFA 4KMMA 1WXHA 2FPWA 5EZSA 1ZHOA 1TAUA 2DECA 3C1FA 1XNGA 4CLRB 3BD6A 4JSTA 4QB4A 4MUJA 1R5JA 3THXA 1K4YA 1PJRA 1LLFA 2MYNA 2BM0A 3NNSA 1T3LA 4UHBA 4W8OA 4HADA 1DCTA 1BX0A 3L5KA 5DI3A 4JIGA 3U37A 2DFNA 4U7JA 1U7OA 5JUWA 2DGDA 2QZPA 4F1WA 5K8IA 3DWAA 1TTPB 1NR7A 1H23A 4I3FA 2PU7A 3BYYB 1P4JA 4MSUA 3AUJB 5EMJA 1DAGA 3DDCA 5J2TA 3HZRA 1FQWA 1ODTC 1II0A 1D5CA 4G25A 4RO0A 1P7YA 4ACBA 1I7PA 4OI2A 1JHOA 1O1YA 2KM1A 3H2BA 4FVTA 2F52A 1YZLA 1NR5A 2JDIA 2NAPA 1Y4AE 1PJCA 1G21B 1X54A 1XPRA 1E5VA 1TWGB 2YRXA