3PUVA

Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
371
structure length
371
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of the maltose transporter during ATP hydrolysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/transport protein
molecule keywords Maltose-binding periplasmic protein
total genus 103
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3puvA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3puvA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3puvA01
4ARZA 4BFSA 2SHKA 4IXNA 4QRHA 4JI1L 3GTQH 2X2EA 1XEFA 4A92A 2ZI3A 5M5WH 4NDZA 5CDFE 4XTRA 4JYAL 1SE8A 2QA4A 3G4SA 1UADA 4B44A 4BY7G 1Z29A 3V4RA 4UPAA 4LZZA 5KPDA 2J0UB 1BKBA 2GF0A 4Q1DA 3OAAD 5C44H 4A3MG 2YWGA 4FMBB 4D4LA 5EP2A 3B7GA 3FB4A 4Q47A 1AZTA 2Y8EA 3CZPA 3ETLA 1ZCBA 3B1ZA 1Z47A 1BKDR 1DO2A 1E0KA 1YZ6A 2QP4A 2JA8H 3K80C 1W0KD 4P4TA 4JKYA 4RD3A 2V6IA 1X3EA 1YR8A 5CYOA 1Z83A 2F4VL 2VP2A 2HHHL 3S1MH 1G21E 2ZRCA 4TMXA 5CYPA 2JLXA 5KOYA 4R4QA 3G48A 1C7YA 4HI0E 4GZYC 1XZPA 1JNYA 4KLKA 1H8EA 1UFQA 4PZ8A 1KI3A 2PT5A 5EZ6B 3ZVMA 4A3EH 2Q9BA 3V4FA 1HH2P 4DUZQ 1RKBA 3GEHA 1X9NA 4LJZC 3RS4A 3CH5A 1SLJA 4RFSB 4HB3A 2AFIE 4LF8L 3OESA 5IF9A 3U2QA 4BLQA 1G8YA 2RGEA 2V6JA 1R7RA 5JWRA 1LYLA 3HU3A 2LWIA 1MKYA 4QKQA 2BC9A 1KL9A 4TMKA 5AUPB 1QVAA 4L9SA 4UXJA 1IBKL 1XWIA 4DV4L 1T5IA 4BFTA 1ZM4A 1Z5ZA 1US8A 5ELOA 1SFOH 2QQ0A 3SZRA 5A5GA 1YIJA 2A5FA 1YZQA 1ZUIA 2Z6KA 4JVNA 1YHBA 2P6UA 2RMKA 1M2OB 2D62A 4LUVA 4AURA 2FFHA 4JV5L 4JI5L 4IW3B 1WRBA 1DD2A 3ULJA 4A4IA 3OTOQ 1CFMA 2OCBA 3AP3A 4Q4JB 4DEYA 3GJ7A 4F4JA 4LWCA 2Q2IA 4JI8Q 1YZNA 4FIDA 4APVA 1SXJE 2FPMA 2QSYA 2MMGA 3FMOB 1X6VA 3GLGE 2WPDD 4JVLA 5FTKA 3ZGXA 2OCEA 3UDGA 1V8QA 5JMTA 1WQ1R 1K9MC 1CI3M 2AX4A 5A0FA 4A36A 1ZKOA 1M1KC 3I8XA 2B8FA 2XTIA 1HE1C 4YDHB 4OGQC 4EPYA 1QZHA 3B1YA 3FDIA 3M4QA 2K14A 5EUMA 3GTOH 1QZXA 3P4XA 4A8JA 1CKNB 4FMCB 4WZ6A 1E94E 4TTPA 4DUYL 3WNCA 4B3TL 1XEWX 2DFLA 3R9WA 2RGNA 2WWHA 3NBFA 4JI0Q 1M6NA 4N3NA 5CB6A 3A8IE 4US0R 1N34Q 3K9GA 4AIMA 1Y3AA 1OXXK 4L8GA 4B3ML 4H02A 4JLAA 1YJ5A 1VQHA 2WJIA 2KBEA 3A8JE 4DV6Q 4DV7L 2ZRAA 1W5TA 1KDOA 4C0SA 2PLFA 4XVUA 5IHPA 1S2MA 2XZPA 1FNNA 2ATVA 4DBLC 3VR5A 4BEJA 5CDFA 3U61B 4JIMA 1JT8A 2D0PA 4AKEA 4C0QC 1GKHA 1HY3A 4G0NA 4EKDA 2KHJA 2DB3A 4KBFA 1R0XA 1GRRA 2RHDA 2WIBA 5KUTA 4M9SA 1O78A 4POGA 4HIDA 4PMWA 4UNNA 1U8AA 4NU0A 5HE8A 4DV2Q 2BE5C 2W6JA 1CR1A 3FHOA 3LLMA 1NN5A 2NPFA 3B60A 1HQYE 2A5GA 3KXLA 3P27A 1FOEB 4JI3L 4DV5Q 3IEUA 3TR5A 3GLFB 2HCJB 4D6PA 2CXXA 4A3BH 2N49A 4MNOA 1SXJA 1UM8A 1VQPA 1XTIA 3EZ6A 2IS6A 4C2TA 1IL2A 2ES2A 2C8VA 2G88A 4AC9A 4OJQA 3AF2A 5TDHA 2Q2HA 1AK2A 2PMDA 4GNKA 1Q22A 3MJRA 1O87A 3NC1C 1DOAA 3AP2A 5DHFA 3QXHA 1P2UA 5AJXA 1R6BX 1GIAA 5J4KA 4CYMA 4H44C 4I1SA 4LF8Q 3CCSA 1K0RA 4KSCA 3RC3A 3FKIH 3VNUA 1LS6A 2REXB 2O8EB 1XNRQ 4DLTA 4JLBA 4X62Q 1R0YA 2FH5B 1K6MA 2PX0A 3U7HB 1VTKA 3BOSA 1XBTA 4GFDA 2DPXA 2VTKA 1X3GA 3M4PA 2F7SA 2BDOA 3CCMA 1F2UB 2VHJA 3M1IA 1GOTA 2ZRKA 3AGQA 4JJKA 2IT1A 1WBDA 1GRNA 4YHHL 4XJXA 4BFVA 1SMYC 4A8JB 3KUDA 2NGRA 1VG9B 4UJ3A 2V55B 1RJ9B 2A6ED 1DAKA 2ZJPA 2QA5A 1VQ9A 1Q12A 1P2VA 4IPDA 4DLUA 2I5MX 4IOMA 421PA 4KHPQ 3ZVRA 3U4VA 2GNOA 3K70D 1JR3A 1ZYUA 4LYJA 1TAGA 3PEVA 4FD2A 4A6PA 1QZGA 1OH5A 4JOIC 1PH9A 3CF6R 3LRPA 1Z0FA 1JQLB 2BM1A 2OILA 5DGXA 1W4AA 1QF9A 3HOZH 4JI5Q 4HZUA 1OV4A 1NVVR 4QQBX 3W6OA 4I81A 2PI2E 4KKSA 2QROA 2RGGA 4B43A 2Q0HA 4XWKA 3G6EA 2UKDA 3ZLJA 4B3GA 5JZVA 1MRNA 2JQOA 3UMRA 4YMSA 1Q81C 3EQLC 2VS1A 1NTGA 3FPPA 1VQ7A 1DARA 1IZ6A 1NN0A 2MSCB 2WJVA 2ZAOA 1E69A 2HCBA 3TW8B 3TBKA 1VKJA 1V1QA 5BXQC 2ZS7A 2WKPA 5JJKA 3A74A 1OH7A 5TB5A 4P74A 1BOFA 4RZ2A 3NENA 3GP8A 3DOEA 4C0LA 2EW1A 2J7KA 1DTSA 3QI2A 5C4XG 4OQMA 2V7QD 1G3MA 3HKZE 1UKZA 2IXGA 4TLEA 3PO3H 1LTQA 3FVQA 3TJZA 2F9MA 4JLVA 3J7ZC 1I4LD 2VEDA 4AH6A 4DR1L 4ERNA 3R8CA 3RLOA 1TQ6A 1KO5A 1X56A 2AWOA 2IYYA 4ACBA 2N3SA 1UE1A 2YYZA 3OW7A 2JA6H 2JAQA 2FV8A 3GLHB 4JBWA 3ZD7A 4O25A 1VQ8A 2D4HA 2C35B 1L4YA 4FN5A 4JLMA 1N3BA 5C2JB 3RN2A 5L3QB 1FMLA 3GJXC 2XOKD 4NZYA 2ZI9A 4QL5A 4CF7A 5IYCG 2K4KA 3GDEA 1N6KA 1JBKA 1WB9A 4HEJA 2YOHA 2CQOA 3I4NG 5IY0A 3P20A 1T3HA 4I7ZC 3SYLA 4JI1Q 5FTJA 3WP1B 1Z0DA 2ZSAA 4AYWA 3MGCA 4AWXA 2GAAA 4FCVA 1E3PA 1VHTA 2BH2A 2CK3D 5P21A 2FNAA 1PJRA 5KTYA 4X65L 3THOA 2XAUA 4RCZA 1P6XA 5FR1A 4C9BA 1VQEA 3QPWA 4LBWA 3WHKA 3LLUA 1DCZA 5C44G 2GXQA 1KKMA 3RS0A 3SYNA 1C4OA 2KHIA 1QHSA 5CJ2A 2CLSA 2R7DA 1U0LA 4LF7L 3CD6A 1AIPA 1T5EA 2DN8A 3HPRA 1CRPA 2AD5A 4LSGA 3SC3A 2JA1A 4A15A 3GTGH 2XGJA 1KXLA 1Q1QA 4CEIB 4A0HA 4GKJL 3PFIA 3MSXA 3NBYC 3T1TA 3FTQA 1YI2A 2NO0A 4LBVA 1Z6XA 2WWFA 1N33L 1VQCA 1VG0B 4Q4JA 5FBWB 4RG1A 1MJEA 4A3LH 1IBMQ 2Z6KC 5EZ5A 3EN2A 2CHQA 3QBTA 5LMNL 2QNRA 4KJZA 2P6NA 4QJ5A 4R98A 3VR2A 1DAEA 3H84A 4PPGA 1E96A 2EFCB 1T8TA 4B33A 1IJEA 1I6HH 3REGA 1DO0A 3OIWA 1NSFA 4L4UA 1OXUA 3E9IA 3O8CA 1KGDA 4R9UC 1HZAA 1QUQA 2K50A 1MR3F 3S1AA 1D9ZA 1GL7A 4WOPA 3OPOA 3U3JA 4DV0Q 3WBJA 1F60A 2A78A 5ELXA 2HJGA 3TE6A 4DRZA 1SVWA 1U5KA 5UKDA 3NBZC 3I4MH 4M53A 5D3MB 1A62A 2R92H 1B70B 1PZNA 3C14C 3QY0A 1GUTA 1PLKA 2QTVB 4R2IA 1I5FA 1N0UA 2WB1G 4MYHA 2YWEA 2QM8A 1L2FA 1VQDA 1S72A 1IN4A 1RYHA 1R9TH 2BH8A 1YQTA 2Z0MA 3U4QB 4G7OC 3LX5A 3QG1A 4BECA 4IQZA 2AWNA 3U44A 2QAGA 1PYSB 1HQMC 1U9IC 4GNXA 2Q9AA 3BGWA 4JSTA 1YBYA 3CX6A 3WRYC 4U7DA 3CF5A 3N2IA 3QXXA 4HAVA 4IJMA 3TNFA 1AJEA 1XD2B 2QU8A 2BE5D 3RS2A 4AKHA 3AFPA 4FCTA 1EESA 4KVGA 1XNRL 3UPUA 4LJYA 1B7YB 2D3WA 4HLCA 2BKEA 2DY1A 1W1WA 2O8FA 3T34A 3U50C 4MYUA 3HPQA 1TWHH 4PZ7A 2I1QA 2ONJA 4DHEA 4PQYA 4IEIA 1N2CE 4OO1H 2CHVA 3M0EA 1OIXA 4JC0A 2FOLA 4IDOA 5DHAA 2R44A 4TYWA 3OIYA 3PEYA 3OIUA 3FMCA 3PUVA 4PANA 5IK2D 1OB2A 4B2IA 5JJIA 4MUAA 5L3SB 2WWYA 1KD1C 3PVSA 4GOKA 1QVGA 1IQPA 4DUZL 3GD7A 3A4MA 1DAIA 2VRWA 1K8OA 1ZU5A 3DXJC 3F1ZA 4KHPL 4ZCMA 4AIIA 3DMDA 5FOVA 4HZIA 1UEIA 4XOIA 1NG1A 3CBQA 3QF4B 2IYXA 2O8EA 1LM0A 3NBHB 1X1RA 2NZJA 4M9XA 4BWYA 2AUKA 1KSJA 1S4QA 4F7WA 4AQYL 4O2RA 2F3IA 4CEIA 1TWCH 1X1SA 5GJBA 1WBBA 2VQSA 3PEUA 1CKEA 8OHMA 4NE2A 4DV2L 1JEEA 2IYTA 1NMGA 4NH0A 2MFIA 1PFSA 5JEAJ 3H2YA 4TLBA 3MD0A 1HE8B 1OFIA 2ZE5A 1H9SB 4RKEA 1ZNZA 2VO1A 2WV9A 4GBMA 1ZYRC 2OHFA 1CR2A 1OTCA 2IYLD 1UBEA 3KLWA 2PCLA 2CBZA 3KQUA 4CEJB 1PH8A 3BRWD 4DJTA 3AUXA 1ODFA 3CKLA 1FJGQ 1E0SA 3HDTA 3LDAA 4DLZA 4MH0R 2IHYA 3FE2A 4JG2A 1R5BA 4A3KH 5J4YA 4DC9A 4GKJQ 4MRVA 3AVWA 1VF7A 1ASZA 1HTPA 2K32A 2HXSA 1M7HA 1J2JA 2ZSBA 3GEIA 4JT2A 1IY2A 4A9AA 3KB1A 2QQEA 2ZTEA 2F52A 1IYUA 1JAIA 1N33Q 1KI6A 2DWQA 4OBEA 1KO1A 4JL6A 4YONB 3RRYA 4A8JC 1QHYA 3HR8A 4B6EA 1Q3HA 1E1QA 2RGNC 3MAAC 4DSNA 2FFBA 3CB4A 4EDHA 3KOJA 3PIPA 1RW4A 3QBVA 1WDTA 3S2HH 1G3IA 1N5IA 1N32Q 1MO5A 3A7LA 4AKGA 1G9XA 4ON9A 2L15A 3F5FA 3AVTA 4R4TA 1ANKA 1F6BA 4URZR 4DSOA 5JEDA 1E9AA 4A93G 1E6CA 4JBJA 3RVBA 1S9HA 1ZC4A 2NZ8A 3CR8A 3THYA 2YU9H 4KBGA 4B34A 1BDOA 2QZ4A 1E2LA 3LBIA 4TMTA 3PIRA 4Q7LA 3RDPA 4LJ6A 1CXZA 1PUIA 4QGGA 5EQTA 3MEFA 2TMKA 4EPXA 1XMQL 1W4BA 4V0OA 1NKSA 2F43B 2HV8A 2JEOA 2P2LA 4UP8A 4IKEA 4QIWE 2B29A 3JZMA 5KSYA 2VZAA 1D2NA 4YY3L 1EK0A 1R2QA 2DYKA 5K36G 3FGNA 3NH9A 1M7GA 4DR4L 2VP5A 4V0MA 4MUBA 1DG3A 4DDWA 1AQYA 4LYFA 4DXAA 4HAWA 2ALYB 3FP9A 2I1VB 2K5UA 4K8OA 1JJGA 4Z51A 3J81j 3OF5A 2CCJA 3D4RA 4LFCQ 1P60A 4GLXA 821PA 4K46A 2EJGC 3LV8A 1OXSC 4ESHA 5JFGA 3ZVLA 1X65A 4YMTA 3L0SA 2QF7A 3AH8A 2ANCA 3ZJYA 4IJHA 5BR8L 2ZJ8A 4NYIR 1CR4A 1C0AA 4M1MA 5GJCA 3T1QA 1KDPA 3KQHA 1E2KA 2GETA 3H1TA 5IP9H 1T3SA 4JYCA 1JXMA 3U7FB 3BFKA 1ZNYA 3I32A 4Q1CA 1RPZA 1M7BA 1A4RA 1NN1A 2Q9CA 5GJVC 3KJOA 2YC4C 3I56A 1HCZA 4HJ7A 4Q03A 3TGPA 2HIXA 5FPTA 3CRKC 1BS1A 1Q90A 3DL0A 1E98A 3UE0A 4O3MA 2GZDA 4NYJR 1DADA 2FXQA 1A1VA 1H9SA 3S17H 3TRFA 2BMEA 3FPAA 3K0AB 3WMGA 5FTNA 1UE7A 3E9HA 1XCMA 1CBUA 4HJ9A 1OPXA 1TF7A 2NVYH 3PIOA 3K1JA 3CUEF 1LUZA 4V02A 2E2HH 2NTYC 4A1FA 4F38A 3RABA 1P8LA 1NMXA 4GN5A 1EFHA 1F2TA 2VIIA 4HAUA 3HP1A 3ICEA 3L0IB 2QMOA 4RFSA 3CIOA 5SZIA 2ODWA 4JOIA 5A4JA 1R8QA 5HY6A 4A3BG 2A8VA 221PA 2J9RA 1WP9A 2AUJD 2ZTCA 2FPKA 2J46A 2H18A 1NRJB 2B3GA 3IQXA 1NY6A 2ZROA 1SMXA 4WXPA 4OQLA 2IYWA 5J4LA 3ADDA 1WFQA 4A3DG 4GL2A 1VQBA 1ZW6A 2DFTA 3GLHA 4HAYA 5FBRB 1Q20A 3UK6A 3AEZA 1CSQA 2ONKA 1D9XA 3RNLA 3S14H 1BBUA 2OFOA 1X86B 2NVQH 2OXCA 4HYYA 3SEAA 2B92A 2V4DA 2YNMA 3T5GA 4TTRA 2OTLA 3DZDA 1VQIA 5L3QA 3FHWA 3OFND 1TL7C 2RHMA 2K52A 4Q4AB 1GWNA 5TXGA 2BCJQ 1FJGL 3K09A 4YXWD 3S24A 4JI6L 2IS4A 5D3MA 3F2DA 4UNQA 3AF3A 4B76A 1JR6A 3SFZA 4RSGA 4BASA 2PQAB 4U5XA 1GKIA 2ATWA 3K0XA 2XSZA 3K70B 1HNZQ 2YJTD 4QGAA 3WYGA 2VP9A 4AYBE 3ZQ6A 3F8TA 4TWZA 5JSZB 3T56B 1G64A 4MGIR 1FQJA 1E0JA 1XCPA 2UXBQ 2VPPA 4X8LA 3H0GG 2PL3A 3LGJA 3I4NH 4R4OA 4A3GH 1P72A 3ZS9A 4IHQA 1HT2E 2JLZA 4GP6A 2UUAL 3I3SR 1T6NA 2JJQA 1GILA 2GJSA 4TLAA 3I5XA 2P3SA 4NCJA 3H15A 1QHXA 2C96A 3SGIA 4LWZA 5FPYA 1C1YA 5JI3E 2QRNA 2D06A 5CLQA 3SDZA 1U9IA 2ZJ2A 3CCQA 1M8PA 1UBGA 2KJQA 4C7OA 2WZQA 4P71A 4L5SA 2ZU0C 4V0ME 4BBRH 1W36B 1OFTA 4EAQA 2V1CC 3OEHA 1A0IA 1E2WA 1SVIA 1YZUA 2E1RA 1I94Q 5E7JA 5KSZA 4MTNA 5JEAG 3UE1A 1G4AE 4HLQB 4NYMQ 1E9EA 5GJWC 2CWAA 5HCIA 5AJ3L 4LFBL 3K0AA 3KDFA 1OXTA 1ZRHA 1FFHA 2E9SA 2JIZD 2FDCA 4K0KL 4URWR 1XU4A 3HKSA 1L7VC 4W5WA 1TPZA 4IOCA 1G4UR 1TUEA 3MCAA 1N6PA 4L8JA 1HNXL 4X62L 121PA 1G5TA 1E4VA 3HU2A 1PLJA 2LKDA 4UNSA 2CLDX 1I4DD 4US1R 3LWUA 4PAOA 4I1OA 2J0UA 3TMKA 2ZQ5A 2ZE7A 5C0XI 2KCTA 2UUCQ 2B7BA 2QP9X 1Z7TA 4I1UA 3BZCA 1MO3A 4B3XA 1Y63A 5FH9A 2EDGA 4QG7A 4DK6C 3N5CA 3CW2C 4RY2A 3QXCA 2K5HA 4MRRA 4A3MH 1YR9A 1FL0A 1F2TB 2GXSA 4FXPA 2YTXA 4KLZA 3TW4A 3NC0C 2CJWB 4UNPA 3U4QA 1JJVA 1FYCA 1N6HA 1ZIOA 3UKDA 4PG3A 5F9FA 3AKEA 1IXSB 1GUNA 4XIGS 2LXJA 1XJVA 1ZM7A 3DM9B 3UWKA 3GJ3A 4L9WA 4OXPA 5E7MA 5L3RA 4DT1A 3WMEA 4BFUA 1E2VA 4HIOA 1CF4A 1NJGA 3TIFA 1OXVA 1KIXA 4JV5Q 1G6PA 1S1CA 4V0KA 5D3QA 4D0GA 4AY2A 4GN3B 5JRZA 1ASYA 1N9WA 2GCNA 3MXNB 2JATA 4TYPA 4AG6A 4DIEA 2GN5A 3GTMH 2WWIA 4NMMA 1A82A 2A6HD 4ILEA 4IDNA 4Q19A 2VF8A 1QHGA 3U3MA 1B23P 1RE0A 2VL7A 2O8FB 5DH9A 3CCEA 1X8KA 4QGUA 3GLHE 5LB2A 4AKIA 3CF2A 1RZ3A 1PH3A 5JHGB 4DR6Q 1K83H 2AD1A 1SVSA 1XXHA 3STBC 4X66Q 3QVVA 3WBKA 2ORWA 2FA9A 2REBA 3THWA 2P67A 1AZSC 4IPCA 1ZM2A 4PHGA 3EIEA 5TY0A 4HIKA 1BIFA 4KFTA 1L1OA 1KRTA 4BFYA 2Q21A 2NIPA 3AUYA 3B9PA 2GJKA 4LY6A 4NCIA 1DGSA 5TVKA 2ORIA 2ZRIA 3TR0A 2ZRJA 5B64A 4B3TQ 4LUOA 3CNNA 1VS0A 3AKCA 3SNHA 1ZM9A 3QKTA 3F2BA 4KFSA 2A6EC 4LFCL 4GP7A 2WJHA 1COWA 2JIZA 1XTSA 1TF2A 1NMFA 2AR7A 1ZNXA 4Q4HB 3IDQA 2BIFA 1EG7A 1MJCA 2NO9A 3EASA 2F4VQ 5BYJA 3U5ZB 3JC66 2OBLA 3J81k 2OO7A 3T1YQ 2Q2TA 4NPHA 4BA2I 2OTJA 1QHIA 3VAAA 2WSSA 1V9PA 3ECCA 4JVSB 1XP8A 4EX5A 2ODBA 1N0VC 1HV8A 4ASUA 1CIPA 3QIAA 4DAYB 3VR4A 1CKNA 4O0AA 2ZUBA 1PUJA 2CL0X 3QQ5A 1IW7D 4OK3A 4M0LA 4LRWA 4HLUC 3W9YA 3L7ZC 2HLDD 3KL4A 5E95A 2REOA 2UUAQ 3A8KE 1NBMA 1RFLA 3C4JA 3KYHC 1EWHA 3HOVH 1II8B 3A1TA 4I99A 4P3YA 4RZUA 3FYHA 1EFUA 3HJNA 4D80A 5DO9A 3HOVG 1SVMA 2B8WA 3CWZA 3JAMi 2E75C 1X6OA 5F9HA 3GQBA 1JEDA 2J7PA 4ZO4A 3CC7A 3CX7A 3IO3A 5FBQB 3SHWA 3K81C 1NL3A 3K0CC 4URYR 4V0NA 4KKUA 1OYYA 1XTJA 2BBSA 2OFWA 2KENA 1HZ9A 4N0EA 3K0EA 2FEOA 4M8NE 3BJUA 5HZHA 3E5HA 3RZDH 2FU5C 4LK2A 1HT1E 1F3OA 1MIUA 1GVPA 4HUQA 1Q57A 4FMCF 3SBEA 1FTSA 4PC7A 4URXR 1H8HD 2ZYVX 1NBMD 1VDZA 3CRRA 1U2RA 1G19A 3AM1A 1PA6A 1VQGA 3HOYH 4B75A 1FW6A 4DVGA 3DM3A 1MV5A 4A3EG 1YHAA 2QT0A 1TQDA 4QHYA 4Y0AA 4GRAA 3K7UC 5C3EG 3S1QH 1IBML 5AJWA 5K8IA 2ZXUA 2ASBA 4ZDIA 2JLYA 1TEXA 1JAHA 1XTDA 2J0QA 3BIFA 2Z5FA 4UY8C 1NI3A 2WSSD 3QKUA 5B30A 2Z4RA 1DPFA 3EZ9A 2A5DA 1PH4A 1IM2A 4RCYA 3BD9A 2A1AA 1D2EA 2GCOA 3FOZA 3NEJA 3BWDD 1E9FA 5CIQA 3JVVA 3MJHA 1KDTA 2OUKA 4JBKA 4PX9A 2IEZA 2WOJA 3EIVA 4D0LB 2YINC 2F1RA 2AMCB 3QF4A 4TQ9A 1AE2A 4JI7L 2QENA 3ER0A 3GTPH 2F1HA 4DUGD 4BGDA 4LF5L 3PG5A 1UE5A 2A7QA 5IP7H 3GTJH 1LV7A 3CC4A 4YLGA 2OG2A 3Q5DA 2PZFA 1NE3A 2FMXA 4K81B 4M4SA 4B6FA 4KFUA 4HJAA 1V43A 1S8FA 2PJRA 5DN6A 3D31A 2ATXA 2OSBA 4R2HA 4MITA 4BBRG 1N32L 3AFQA 5JEEA 2CNWD 3BG3A 2IX0A 3F3YA 4OX9Q 2B6HA 3CPEA 2K5VA 1A2BA 4R4IA 3GMTA 5IYDG 4DDUA 4RD4A 3BFVA 2R6AA 1PH6A 1NBME 3I92A 3LFUA 4R7ZA 2KCCA 4NXML 1ZD1A 5DI3B 2I3BA 1O7IA 1N6OA 4QJFA 3G82C 3GJ8A 4CEHA 3A0JA 3LO5A 2K5NA 2VQEQ 1DAMA 4TVAB 1DVRA 2CE7A 5EXTA 2IWRA 4PSVA 3VFDA 4A75A 4RD0A 5KPJA 2WMNB 2J0SA 3W5JA 3CXCA 3L8ZA 2VA8A 2FE4A 2A3RA 4EJSA 1E2FA 4Q7JB 5FI1B 3FKSD 1GD7A 3I55A 2IS2A 1D8TA 1KY3A 3KJPA 1OYWA 3H4MA 2DNCA 1FX0B 1Z3IX 3T1HL 2FFQA 4HATA 5JS7A 4HAXA 1OB5A 1U0HC 2E74C 1YHQA 1AA9A 4RJLA 1NF3A 4ALPA 2PJZA 4XVQA 3TQCA 4EUNA 4LHZA 3Q9LA 2GZAA 4WBSA 3ADCA 1AS2A 2KCMA 2O52A 3EPKA 2XGTA 1YJWA 2R8RA 3GFPA 3A37A 5DLQC 4YWMA 5IT9c 2CCGA 3NVAA 4OK6A 4KAXA 5AWFC 2O8BB 2R92G 2ZEJA 1KQSA 4A3FG 2AXNA 4X64Q 4GT1A 1GSIA 2MSEB 4P31A 3WNBA 5J47A 4MGZR 2F55A 1UWVA 1L0WA 4A3FH 3GTKH 3CONA 4PHFA 3T1VA 4PQRA 3UXMA 1KK0A 4M1KA 1QHHB 2JLVA 3AVYA 2LSSA 1D2MA 3LBHA 5FPHA 3UDXA 3ZYCA 1JB1A 4KO8A 4TYQA 4A0FA 3FFBA 1XEWY 3EA5A 4DSTA 3MUFA 4Y0VA 1UDXA 1NP6A 2DBYA 2F3TA 1G5RA 1Q0UA 2BCGY 3BH7A 2ERXA 4RMFA 2OCPA 4Q02A 3SBDA 4C3ZA 2HJVA 1W2HA 4X66L 2YTYA 5FLMH 4PC6A 2LKCA 2G77B 1GVNB 4HLDA 3FKIG 1S3GA 1GP2A 3PJRA 4NPSA 2D7DA 2IY5B 1H8HA 2VP6A 2ZRHA 3K7AH 3IBGA 4IRUB 4C0HA 2IEYA 2ZRFA 3GLFE 3H3VH 1YZLA 4D0NA 4K0KQ 2IBMA 4WA7A 2NN6I 4ME3A 4GKKL 2FFAA 1CLUA 3RSLA 1X3FA 2QTHA 3LVQE 1Z63A 5IP9G 2OLJA 1B0UA 5ANRB 3KZ1E 3CF0A 4L16A 1HH4A 3CPJB 2GAOA 4X8MA 1NNEA 4G5OA 1NSTA 3EC1A 4KVAA 4NCNA 2E2JH 2BWJA 2OBMA 4NONA 3ZIAA 5AJZA 2QY9A 4V0LA 5AK0A 3U3RA 2RGAA 4ZDWA 3RC8A 5DI9A 3SYKA 2ZYTX 4F4CA 3U7GA 1A8VA 4TN1A 1D7QA 3BDOA 3IKJA 1T0HB 3OE7A 2GVZC 2BM0A 4DV0L 4G5SA 4GZMA 3QKSB 2X2FA 4H1VA 2H92A 4ZDKA 3CM0A 3IILA 3KKOA 2D2CC 3GEEA 4MGKR 2GCPA 2JLRA 4PPQA 4QHSA 5FOUA 1G7RA 2NMVA 2C99A 1Z0JA 2AK3A 1ESMA 3MG9A 2CVHA 4B73A 5GVSA 4H1UA 3CRQA 3EARA 3RSOA 3UWOA 4II7A 4NKRA 3K8AA 5KDOA 5FL7D 5BW8A 5F3WB 4DLYA 3QE0A 3NELA 4LHVA 1Z0IA 1FX0A 1SZPA 2FG5A 3Q3JB 5JWOA 5EE1A 4HIMA 1JJCB 4LF9L 3DKPA 4DR5Q 4D81A 1P9NA 1UF9A 3CQZH 2ZRPA 4YWLA 1W0JA 2FGKA 1Q1BA 4RD6A 2XXAA 1SHZA 5G41A 3MFYA 2ZRBA 1KI1A 4KN4C 2R6CA 2ZU6A 3AP1A 3HOYG 4D4JA 3VQTA 1Z6YA 3EA0A 1E2ZA 3GPLA 2I5LX 2K75A 1BYIA 4JBXA 1EFRD 3S16H 1ELOA 3OEED 4B32A 4M22A 4LF7Q 3W34A 1EXMA 3U7EB 3KXIA 1EFRA 2MNAA 4B3DA 4BZQA 4MYCA 2EFEB 1Y1VG 1HURA 5LBIA 5C18A 5J3BA 5KNDA 3EBEA 3PQCA 1OFUX 4M21A 3GLIE 1Z06A 4RCNA 4GNXB 2N46A 1W48A 1B8AA 1G1MA 4LFAL 2IF2A 1N5JA 4M1SA 3UMSA 1W3SA 3STBD 2GK6A 2GA8A 1W4CA 4OL0A 2JJ2D 3W6PA 1NIPA 1MT0A 1XD2A 2QPOA 2D74A 3B5JA 3KKQA 3KQNA 1W36D 5KNCA 2JE6I 1KNXA 2XEXA 1T0JB 1X55A 4JLPA 2B21A 4MKGA 3HR7A 5KSOA 4YCWA 4L5QA 1II9A 3RAPR 4KSBA 1GUOA 2AHOB 2JCSA 3A4NA 1E2JA 4KFRA 2QT1A 3LQRA 1MRSA 2HF9A 4JL5A 1S40A 4UXIA 5G53C 3U3KA 3M9BA 5B58C 1YITA 4B3RQ 1N5LA 2GBLC 3RRMA 2IC5A 3X1ZA 4B3BA 2O0JA 3PEWA 4HDOB 3B6EA 3GCGA 4OO1G 2VW9A 4PZZA 3W5OA 2R6DA 1E9SA 2YWFA 1SKYB 3MLEA 1VYTA 2DGYA 4IVQA 4CW7A 4BLOA 3BB1A 3AVVA 2W0MA 5GAGC 1EWRA 3WRXC 1AS3A 5DLQE 3EZFA 4A3LG 3W1BA 2D2FA 5FLXc 2CCZA 2B8TA 2H1LA 3FMIA 4GPTA 2C9YA 2YZ2A 3TAHA 2WP8J 2RKOA 2HT1A 1W4RA 2W2TA 1JPNA 4FINA 4A2PA 3I2ZA 3NIBA 4B2LA 4D26A 4A3KG 4GOPA 3A5UA 1XPRA 4HR7B 2QSZA 4Q9HA 5C4XH 1IBLQ 3TQYA 1DELA 4BA1I 1J99A 1KJYA 2Z83A 3ONWA 4WAUA 1D8LA 3F2CA 1G8HA 4E22A 2XX3A 1A2KC 1KK1A 3IQWA 4QL3A 2A69C 4KMUC 2UUBL 2BA0A 1BMFA 3M85A 2R62A 4LPSA 4JVMA 1AKYA 1LFDB 5E7NA 2G3YA 2AL7A 4Q5IA 4PO1A 4MKFA 2CLCX 3B9QA 2ZTDA 2G9NA 5DI3A 2F43A 2VF7A 4JYBA 3I4MG 1IXZA 5LMNW 3SHFA 2IYSA 2GBLA 4DLWA 1TWFH 2E76C 1EFWA 1N0WA 3RNUA 3B78A 1M1YE 2P5TB 4E09A 1CJKC 4TYNA 3Q5EA 4P32A 2QP3A 1Q21A 3PV0A 3ZZ0A 3X1YA 4DSUA 3T1YL 5IYCH 2BJVA 2G1KA 1ZUHA 2VUMG 2VHQA 3W1GA 2N42A 4HLUA 4R1JA 3X1WA 1B9MA 3C5HA 1CUKA 1E2EA 5M3MG 1R0ZA 2XJ4A 1M34E 4DR3L 1SHKA 2BV3A 1UE6A 2IUSA 1KK2A 1IXRC 1I2MA 2IXFA 5JWHA 1KHIA 2RGDA 1KZGB 2VHTA 2XB4A 4JK1C 5CM9C 2GCOB 4MRPA 2WSMA 4NYMR 1XPUA 1AH9A 4YCVA 1U8ZA 2VH5R 4Z8YA 4GOPC 4AI6A 1ZC3A 2ZRDA 2V9PA 3NEMA 3A5ZB 1S96A 1IBRA 3K0CA 5G3ZA 3ZZTA 4R71A 1G7TA 1KI4A 2XITA 1W44A 3TRZA 3C7KA 2XZOA 1I4TD 3WDNA 1NJIC 1JR3D 3KF8B 4FMDB 4PZYA 3KFXA 5EXSA 2ZJRA 1A63A 4HDCA 1CSPA 2PZEA 4OQFA 4RKFA 1OH6A 4POFA 2OESA 3AVUA 2YOGA 1GITA 1LACA 1HZBA 4M1WA 4G7ZC 3T1OA 3I61A 1GTVA 3FHTA 4OK5A 5C1BA 1AGRA 1Z22A 2VL6A 3B1VA 4M1OA 3IPXA 1VQOA 4TYYA 2O0KA 1P7CA 2O0HA 2WIAA 4L5RC 1KC8C 4S35A 4PZ6A 1IY1A 3KJHA 4A82A 2A5JA 4PO8A 3IFTA 2ZJ5A 2W6IA 5DIFA 5LDDC 1KRSA 1FTNA 1B9NA 1R10A 1HEIA 2EQBA 3E2IA 1YR7A 1AN0A 1E1RA 2QE7A 2ZS8A 4W5HA 2ZJZA 3MXUA 1RL2A 3HOZG 1D5CA 3EZ2A 3OE7D 1P4SA 3RHFA 3VKWA 5DSZA 4CEHB 2V4ZA 1VF5C 4XSHA 3RLFA 4TMVA 2KSQA 4KYIB 1YNXA 1H9RA 1ESNA 4MGYR 1GUAA 2V54A 4FI3C 3KF6A 1EX6A 2I5HA 2WOOA 3D7MA 3A8TA 4HUQB 4BXXG 2ECKA 4N1AA 3CRLC 1GHJA 2LXKA 2DR3A 2N78A 2C77A 3IBYA 3KKNA 4Q4AA 1PH1A 2Q3FA 4URUR 3CRVA 4H9GA 2K33A 3ZVNA 4LFBQ 2QAGC 2K7VA 1XTQA 3SN6A 3V9PA 4DR4Q 1KI7A 1XEXA 1Z0KA 2FPLA 3WYFA 3I7FA 1AM4D 4P4SA 4LJ7A 2UVQA 3PXGA 1PYBA 4EFLA 1FR3A 1ONLA 3CPFA 1SULA 5LPNA 1XZQA 1DAGA 1P62B 2WAQG 3HGBA 3AKYA 1CS4C 2CK3A 3R20A 4OI0A 3L2OB 4JBMA 2CL6X 4Q7KA 2JA9A 3EG5A 2ODEA 3FWYA 3PO3G 2WKQA 1T5LA 4QXAA 5J5CA 2QI9C 2A68D 1YHNA 2PLRA 4JLJA 1SXJD 2OLKA 1Z6AA 3WWVA 1SGWA 3HFZB 4F91B 1J6QA 2GWHA 2UXBL 3VDYA 2ZTSA 3A1UA 2B63H 2PI2A 2E5LL 3LNCA 1GZSA 2WFWA 2QN6A 2A68C 3QJYA 3J80i 4ARZB 2EJMA 4DV1L 5IP7G 1KJWA 4MKIA 1G17A 4EQ5A 3J81i 4A3IH 3BORA 2EQSA 4FWIB 2X1VA 4GMXA 1P5ZB 1CTMA 1WCV1 1QG4A 3D6TB 3J80c 4NYIQ 1CKMA 1P61B 1S0UA 1SKYE 1ZAKA 3A36A 4LGMA 4M2LA 4Q7MB 3RRZA 5M04A 1LY1A 1OHHD 4LHYA 4G5RA 1OT3A 2GESA 5CM8B 4E03A 2PQAA 4MA4A 1NLYA 1ZD9A 3M6AA 3KQKA 3K9LA 2XNSA 4DR7L 4PO9A 4WZBE 3OFNA 1EIYB 3RR5A 4LBZA 1E0AA 2A6HC 1LVGA 1PHJA 4AG5A 1T4GA 1K3RA 1LF0A 1RRPA 1XF9A 2QAJA 4B3SL 4IFDG 4GMDA 1LW7A 5M5XH 4NXNQ 1P16A 1E79D 2ERYA 3RLNA 3MRSA 2ZSFA 1KAWA 3BC1A 1G3RA 3GJ4A 3IUYA 1PH7A 4LDJA 4CT5A 1JE5A 1QG2A 2OQKA 1KNQA 2ZAMA 3CP0A 3CCLA 3DEFA 3LQQA 2O8CA 3SR0A 3HOUG 3VU9A 3PUYA 3CRW1 4BY1H 4DIDA 1J5EQ 4Q1BA 4RFVA 1DS6A 4IOKA 3LWNA 2MMCA 4Q9IA 2L5TA 3T61A 4Q9KA 5FOWA 3A4LA 4P0TA 3BZKA 4JCVE 1VQLA 3NDPA 2YC2C 4TL7A 1UBCA 4I1VA 3QOFA 1IN5A 1W36C 4A3JG 3ERSX 3AYHB 1NIJA 3L0PA 2FWRA 4TMWA 5IYBG 5LMUQ 2J1LA 4JI7Q 2ANBA 4QFMA 1LB1B 5FOXA 4GDFA 1G3QA 4IJLA 1YU9A 2BOVA 2JJ8A 1Y1VH 2RAPA 2ZRMA 2A9KA 1CRQA 3IIMA 5EE5B 3SQWA 3G5UA 1IOZA 1QHHA 4KXFB 1LNZA 2IX1A 2QPTA 4DEXA 3I73A 4DK1A 2W6ID 2KB0A 2NO7A 1Y8OB 2PNHA 2KA7A 1OLOA 1ZBDA 4HB4A 4M9ZA 4OHVA 4B3FX 4L5TA 3K9NA 5E4FA 1NY4A 1KMHB 1W0JD 2HF8A 2ZJBA 1E3MA 1S9DA 1XEXB 4Z54A 3LAWA 1T91A 1YZGA 2ZPTX 1EFCA 5H68A 4QBFA 4ZIRB 2UXCQ 1GM5A 1BYUA 4YHHQ 4EQ6B 2NZOA 2G0TA 4J15A 2I0QA 1YRBA 2IW3A 1Y1WG 2X19A 2IYUA 3E70C 4POAA 1ZJ6A 5HPYB 4D4MA 1WCMH 2QGNA 2MSDB 3OZXA 4PFSA 1UBFA 3QSYA 1G8PA 4F93B 3UDIA 2WWGA 3OYYA 4HJ5A 1FGUA 1UEJA 1E1QD 2FGJA 3H0KA 1HUQA 3U58A 1II0A 2Z6VA 3A1SA 4DT1B 5AR1A 4OHXA 4C0AC 3PUZA 5M5YH 2ZRLA 1FUKA 2QM7A 2KI5A 3E1SA 3P4YA 4OYHA 5FOTA 2ASEA 1HNWQ 2UXDQ 2UZIR 2ZETA 3UG6A 3SJZA 1TNDA 1WOCA 1RYFA 3EAQA 5EP1A 3AGPA 1I94L 4WVFA 4TZ6A 5IWAL 2XNDD 2RH5A 2FF7A 2YVUA 5A35A 1GNRA 2R7ZG 4LV8B 5HCNA 1A6XA 1QUQB 4BRWA 4Y7NH 1XJQA 2RB4A 4F4IA 1VG8A 3CLVA 4LI0A 4EFNA 5C4MA 1W0KA 5FL7A 1TX4B 3B85A 3X2SA 4Q1EA 2FN4A 5BN4A 1P2SA 4LV6A 5FTLA 2O8CB 3K9HA 1DAHA 4OHWA 3T53B 4DK3C 1IONA 1SKQA 3NEYA 1Q1ZA 3VX4A 4CT4B 1S3OA 1K8AC 3PUWA 1U90A 3X1DA 2Q2UA 5DYIA 5M3MH 4L5BA 1L1OB 1HTWA 2ZM6L 5GVRA 3T06B 2LMCB 1GKYA 3F0TA 1TUIA 3EC2A 4Q9JA 4TT3D 1GG2A 4E5UA 2PCJA 4D2IA 4DLRA 1Q7YC 4XD7D 4DCNA 4DB2A 3IHWA 3RRNA 2ZUCA 5L3VA 4BY7H 4B48A 1TTTA 3CZQA 4BBSH 3CCJA 1H95A 4OWTB 1PH5A 4KV9A 1VQJA 3THXB 1Q46A 4P73A 3I1FA 1GUSA 1ZVQA 3QVUA 3DPUA 4NXNL 2NVXH 1YRAA 2NO6A 2EXDA 4GOPB 1OIVA 3IO5A 4RD2A 5SZHB 5M3FH 2GJ9A 2JGNA 1OJLA 2A69D 5HR5A 2DWPA 2NN6G 2A2ZA 1KI6B 1PMRA 1N8RC 2ZJOA 3BB4A 3B82A 3SQXA 4XTCS 2VUMH 1FL9A 5EP3A 2H8KA 3FMFA 2GRJA 1N36Q 2PBRA 2AKAB 2ZVQX 3GJ0A 4G1UC 1CU1A 3WY9A 3CMAA 3ZDQA 2BBWA 3ASZA 3WP0A 4WJ4A 4NXMQ 2W00A 3OIVA 4QBGB 2GJ8A 1Q1EA 4Z1MA 1GAJA 4F92B 5TMPA 4QNRA 2J59A 1XFAA 4US2R 2EWWA 5HKKA 2A19A 2IHFA 2CCKA 2J0VA 4UNRA 1HR0Q 2IK8A 3AVXA 2OT3B 3H86A 1XDBA 2ZVPX 4IFBA 4X65Q 1N6RA 1UPTA 2PX3A 1GUGA 2JJ1A 3CX8A 2ZI4A 4JKIA 3K0SA 1US8B 3KLRA 1XB2A 2NPIA 2ZE8A 2N1BA 3TUJC 1GJXA 4EPTA 1OF1A 5EXPA 1E1OA 1P75A 1C9OA 3M4OH 4EPRA 5F98A 1OKKD 2HYDA 1GDDA 3IRBA 3AF1A 2QORA 3AB9A 2WAQE 1T9HA 2VSXA 2WM9B 1YVDA 1LS1A 5IK2A 2CKZB 3L2PA 2RHQB 2R2AA 2AXPA 4X64L 2OCAA 2PCFB 1KO8A 4LCBA 2CWPA 4Q01A 2FEMA 3RZOH 1FQKA 1ZD8A 3VMFA 1IBKQ 4C0JA 1VCNA 4BFZA 4MZ9A 2ZE6A 3C16C 3MWLA 4KODA 1RIFA 3R9IA 1E2MA 2EYUA 2NZHA 2BJWA 3I4LA 1FP7A 4JSYA 3BU2A 5C4JH 1CJTC 2JDID 3B6YA 1K73C 3B13B 5K8TA 4KN7C 3OEEA 1G20E 3RYTC 2V7QA 3EX7C 1UJ2A 2WICA 1ZINA 1CP2A 5FPSA 3H94A 1IYJB 2YOFA 2UXDL 2RGCA 5GQOA 2Z4SA 3LBNA 1LF5A 2GK7A 1A5TA 2RHSB 3S1NH 1NMYA 4OQXA 4X8HA 3WHLA 3C41J 3ZIAD 2Q8IB 5HKKD 3O8RA 3I4OA 1BO6A 1MABA 3T35A 1JJ7A 2F1IA 4BY1G 2IL1A 4DPGA 5KNBA 1K8MA 4OONA 1Q86C 1XRJA 2OZEA 2PEZA 3QXJA 4EFMA 1MOZA 3U6BA 4Q1FA 4WJ3M 4XSGA 4JLKA 4LJ9A 2BEKA 3BAFA 2H5XA 2GEDA 1W5SA 4IO9A 1DBSA 1Y69U 4A3JH 1CTQA 1WMSA 2E87A 3P26A 5EXXA 4BQSA 3THYB 4LYAA 3JZAA 4DCTA 1HJPA 4Z8XA 2JLQA 1VQMA 1XTKA 1E79A 1PVOA 1YKSA 5IRCD 2EFGA 4X6AH 3KX2A 3EZ7A 4PSAA 3VHXA 2CHGA 1XNQQ 1JECA 1XJCA 2FJUA 2ZSEA 4PPFA 2QMUA 3L0OA 3UG7A 3U6KA 3R9XA 2GDJA 3T1HQ 2PMKA 3ULLA 5C0XJ 1QVRA 2O5VA 3D8BA 5SZJA 5JRJA 3EPJA 3K0FA 2UU9L 2HEIA 3FFAA 4C2MH 1U8YA 3EIHA 2JEAI 1KSGA 1LABA 4LYHA 2ZM6Q 3VKGA 2H57A 2PH1A 2WJGA 1H8ED 2H7VA 4BBSG 4OHZA 4ZI3A 5AUOB 5LD2C 2YKGA 2FSGA 1EFTA 4OO1I 1FP6A 3HYRA 4TQAA 2QL6A 4JZKA 5KHOC 3GLFA 4LF5Q 2V1XA 1P73A 1R0WA 4JMPA 3THWB 1G5PA 2QEQA 4B74A 5JLJA 3HOUH 3E0EA 1VQ6A 2VNUD 1EQQA 2CW0C 4OWWB 3UMFA 2O8DB 2GVBA 3AKDA 1GL6A 5C0XG 4MYTA 1N5KA 3KDSE 4PTLA 4QGHA 5EJEA 4DV4Q 3TREA 1EQRA 1VCOA 3SOPA 3QNUA 5C0XH 1HZCA 1J7KA 1VQ5A 1U99A 2NQ2C 5JECA 1KAGA 4B3CA 2YWHA 1JQJC 3D3QA 5G3YA 3R7WA 1KYIA 3WXMA 3AV0B 3I62A 5C3EH 1TU3A 1XD8A 1KHTA 2W2XA 2WWXA 3LA6A 5EE3A 2YTVA 2E2IH 1VG1A 1XCGB 2ZITA 2J3EA 2J45A 4TT3A 1KMHA 1R5NA 3DDCA 4A0RA 1KO4A 4HB2A 1SR3A 3CMEA 3B2EA 1GNPA 1X54A 2GVAA 1IYVA 4B2PA 2GF9A 2C03A 2AHOA 4YY3Q 5GADl 2B8GA 1S3SA 2DNEA 1ZNWA 4PQFA 4ZCIA 4GOXA 3P32A 1YZTA 4XWAA 1TQ2A 4DR2Q 4KYUA 1XXHB 4C2UA 2ZR7A 1KTVA 4PAMA 3EPLA 2HHHQ 1N6IA 2D0OA 4YDSA 5FFMA 3ZZUA 1I50H 1KZ7B 4PC1A 4LF6Q 3PF4A 1NLZA 3QG5A 1OW3B 4JI4L 1SVLA 4LC1A 5SZKB 1NVUQ 1IAQA 5JCPA 3NG1A 3P1JA 2AN9A 2ORVA 2CDNA 2XNDA 5LMUL 2A30A 2O5JC 4U02A 4UQOA 2QTFA 1Y8NB 4WIAA 4DCVA 1AGPA 1YNNC 1KIMA 3T51B 2BVNA 2I4IA 1IY0A 3W90A 1RIPA 3MMPA 1GHKA 3QUSA 3OOCA 3S1RH 2IXEA 2FSHA 3VU9B 1O3YA 1YE8A 2J5XA 3Q85A 3TSWA 1ZMXA 3M4YA 3CNOA 4TL8A 2VHUA 4JI2Q 2JEBI 1HYQA 1MO6A 2XXAB 2OBNA 5C46F 4MRNA 4IFDH 3OW2A 2IYQA 2P0EA 2QUZA 3ZQJA 3ND8A 3TLXA 4DLVA 1XMOL 4TL6A 2IX3A 5DNYB 2QBYA 2UXCL 3V00A 4M1TA 3RWOA 2D7CA 4CEJA 4GNXC 3AB3A 1KSFX 3KXKA 3KJIA 3Q8DA 3T12A 2HUPA 3O8DA 5JJLA 5CITA 2R6FA 4FCWA 5F2EA 4TSFA 3TSOA 2H5EA 3B1XA 4TL9A 3MWJA 4IOAA 4PV1C 4OX9L 1AS0A 1HNXQ 1VCIA 3TVDA 2ZRNA 1Z08A 2GZHA 3K0FB 5EE0A 4DR5L 3SFVA 4A3CG 3RWMB 1EWIA 1PLLA 3AF0A 2OXRA 2Q3HA 2WPDA 4PPNA 1E2IA 4R4CA 1L8QA 3PGZA 3HOXH 1V5WA 1IN7A 1ZCAA 4GI7A 4AYBG 2ZI6A 1E1RD 1R4AA 1G18A 2QE7D 5IYBH 3R7WB 2BEJA 1E24A 2C04A 1J90A 2L0XA 5BYKA 5JSZA 1NBWA 3NDBB 2EFDB 2FSFA 1UAAA 2EIFA 1DE0A 4A0GA 3BB3A 4TSFD 3CCRA 1GRQA 2C95A 3N2EA 1NKTA 4P33A 4PR0A 5DISB 4B47A 2BA1A 1FPMA 2OV2A 4A2WA 3HYTA 4H13C 4DLXA 1OFHA 3QENA 3KQLA 1KI8A 1WE2A 2GXUA 2XTZA 2ZRGA 4JI6Q 1DAFA 1OIWA 1IHUA 4B3MQ 1RRGA 2BBOA 3B1WA 3IGFA 5JI2E 2ZR0A 4JLOA 4O2DA 3CO5A 4EIWA 3K53A 4OI1A 3GLIB 4QY7A 1NG9A 4KHZA 1DEKA 4ITRC 4A3IG 2FZ4A 3OAAA 2JLWA 4BUJA 2JXMB 1R5OA 1VYUA 4UP9A 1EOVA 2W58A 4LJAA 4PC2A 3W3AA 5TV2A 2RF4A 4Q48A 4TLCA 3HU1A 1TQ4A 2RGBA 3CAMA 1CJVC 2C2HA 4DR3Q 3S2DH 1E9RA 4U00A 5GROA 3GJ5A 4BE7B 3TK1A 5AUQA 2KE5A 4IPGA 1DXMA 1Z2AA 4GS3A 4DV3Q 1S1MA 2MQHA 3DLLA 2F1JA 1N6NA 4MRSA 4OQNA 5IDVA 3ZH9B 4YMVA 2YV5A 1OHHA 5FL3A 5EUQB 1FZQA 5CK5A 1EYGA 2QAGB 1X8JA 5KDDA 3A58B 4GSYA 2B7CA 3C15C 2WVJA 3RN5A 2ZJQA 2VP0A 4C3HH 4URVR 1N25A 2B63G 1G6OA 4A3GG 1ZP6A 4B35A 1Z07A 4KKTA 2J7PD 3S15H 2HQLA 2XSZD 1VHLA 1NMZA 3RS7A 2VY3A 4IFEA 1HQCA 2AFHE 5E7IA 5K36H 2DUDA 1FVIA 1ZIPA 3I72A 4YCUA 2E5LQ 2NO1A 4CZ2A 1U81A 1ONBA 1W47A 3GLGA 1TXYA 2GKSA 3S1AB 1AKEA 1E1TA 1G8FA 3AQ4A 2CJWA 3FKQA 2HLDA 1HR0W 1NVWQ 1EUJA 1VECA 5HGQA 3M3YH 4G01B 3QEOA 2JA7G 2BHRA 4P75A 2Q3MA 2UUBQ 5IE8A 1KO7A 3PCOB 3SS8A 4IFDI 2NN6H 4DZZA 2Y0SG 3CR7A 1I2DA 2P5SA 2KBNA 5EE9A 3TEHB 2XJ9A 1MH1A 1YNJC 5JEAH 2ZT9C 1M90C 5M3FG 2QGQA 2UZ3A 4KITB 3O8BA 4QOSA 3AVOA 4RZ3A 2BMFA 1K8RA 3PF5A 3FMPB 5FOSA 1U0JA 3TAUA 4IVPA 4DKXA 1TF5A 1G3UA 4A4DA 3ADKA 4ZDJA 2ZYUX 2QEXA 2W83A 2CVFA 3O47A 1HPCA 4QGFA 4Q9LA 5JCZA 521PA 4QBIA 4BFXA 5J40A 1ZM3A 4BZXA 1TWAH 2PZGA 3I8SA 4W7SA 1NVVQ 4V03A 3Q72A 4Q4HA 3NKVA 1YVCA 1Z6TA 1J70A 2R65A 2X8AA 4BFWA 3NH6A 4XWOA 4OI2A 2WJYA 3EIQA 2PEYA 4LW1A 1JALA 4LJ4A 5JBQA 1P9RA 1E9DA 4CRWB 3HOXG 2WHXA 4DNRB 1H9KA 3ZJYC 1D6JA 3CWQA 3EWSA 3FKSA 2DWOA 5CB8A 2EJFC 2ZR9A 5AJ3Q 2R9VA 1RJ9A 4JT4A 1RRFA 4G7HC 2OQ0A 3HOWG 3PO2G 2IHBA 3GLIA 1E9BA 3PSIA 3BFXA 4DUGA 4D4KA 5K8LA 3OTOL 3CCVA 3C8UA 4LNQA 3GO5A 4JBYA 3J81c 3ZS8A 4DB4A 1OKKA 3KTAB 3KDFB 1GL9B 2FSIA 2XZLA 2HDNB 2QG6A 3NHBA 4IDHA 3U9SA 2OE2A 3PITA 1KDRA 2JA5G 4LF6L 4EPVA 1IBLL 5H8WA 4A3DH 3NWJA 2ZANA 3TSZA 1WCMG 3FHCB 4ZKEA 2CNWA 1WJJA 5GAHC 4JJZA 4C3JH 1Y14B 1F5NA 1NLFA 3BS4A 5LMNQ 2ZUDA 4EJSC 3QKRA 1BMFD 2BMDA 1G291 2QMHA 3IEVA 4TQUS 4DAMA 2RCNA 1W2GA 1P3JA 4LC0A 1VQNA 2CEAA 2IA5A 1SVOA 4DCUA 4DR7Q 1TKWB 1HNZL 2JK8A 4JI0L 1U94A 2F6RA 1EX7A 1XMJA 2KBFA 3K8YA 4OKSA 4OWXB 5FJ8H 1SXJB 2EU8A 2C78A 3L82B 4GLVB 1R8SA 4B3SQ 2BMJA 1CJMA 2GEUA 5CIWA 4JI2L 2J41A 3W8RA 4CDGA 3TUZC 2R7FA 2OCYC 3DOFA 4Q21A 4DR6L 1H9MA 3JAMc 2W6JD 3NXSA 1TWGH 5CLLA 4BLTA 5EAYA 1E2GA 1XMOQ 5KU1A 4AD8A 1KJZA 3WNDA 2BKUA 3A7AB 1P2TA 3LXRA 1IW7C 2O8BA 3K09C 3CRMA 4Q00A 2RGXA 3THXA 3BBPA 1RRCA 1M74A 3ULPA 4G3XA 5KSPA 2XTNA 4Q1AA 4IXMA 5H1SE 3TZUA 4MQBA 4NCKA 3CCUA 2G0NA 2VQFQ 2JJ1D 3VX3A 1XX6A 3AVQA 1LTLA 2NOAA 4PHHA 1AE3A 1VCMA 3GFOA 4JLNA 5L8VA 1N6LA 1X8LA 2FZLA 1F2UA 4HAZA 4G5QA 4XD7A 4ZCLA 4BPBA 1MKHA 2HT6A 5DE3A 1BVSA 1YZKA 4E07A 3ASYA 4OJKA 2QBYB 5FI0B 4S2EA 4BLRA 3G71A 3HOWH 3M7NA 5GAEC 3L43A 4PHTA 5IYDH 2D5DA 1IN8A 4ZKDA 4RVCA 4DV1Q 2ZYWX 1TMKA 3DKVA 2CMKA 4C4PA 1Z0AA 3DVLA 1DG1G 5FTMA 5CK4A 3SJBA 1QJOA 3KKMA 1TU2B 2JJ2A 3LW7A 3BJIC 4X8OA 3QF7A 1E9CA 4HUTA 1I6VC 5JHHB 4ABYA 2UUCL 3NBXX 3CPHA 4NP6A 5J4VA 3SE0A 3VHLB 2WBLC 3KTAA 1XXHE 3ND9A 2VHCA 2OWOA 1XMSA 1Z2CA 4LF4L 4LBYA 1N36L 1UKYA 3JVUA 4LOAA 5IT5A 5DYGA 4DNTB 3QPVA 3I5YA 1AQUA 1QVCA 4M9QA 4FW9A 2GHIA 2Z43A 4ASUD 2DFNA 4DV3L 2V8OA 4G5GA 1ETUA 2CFMA 1MO4A 2G1JA 4IVRA 5B57C 1QHNA 1TEVA 2EVWX 4A93H 2QRZA 3J7A5 2IYZA 4IOJA 4ACAA 2R7ZH 2V3CC 1L4UA 1K5DA 2ZSDA 4QM6A 4PAQA 1QBKC 2OM2A 4XH9B 4LHXA 4QJ3A 1W2BA 2XOKA 3IIKA 3X1XA 2QPAA 3VTKA 2OAQ1 4WZAE 3DMNA 4Q4LA 4YMWA 1G8GA 4NTZA 2EYQA 5H70A 4BRUA 3VNVA 2JA5H 4M1YA 4KI0A 1JI0A 1ZUNB 1VIYA 4RD1A 1W49A 4NBSA 1SQ5A 2Y0SE 1E2NA 3DO6A 2F9LA 4IEEA 1TU4A 1VQFA 1GFIA 2JASA 1NY5A 2VLIA 1G7SA 2IS1A 2HIVA 2ZS9A 3NHAA 2DHRA 1A7JA 4DKAC 4ZIRA 2JA7H 1ZU4A 1YJNA 2XTMA 5L3SA 2IYVA 2JDIA 3PR1A 5FUWA 4TMZA 4ZPXA 5TARA 3G0HA 1W7AA 1UKEA 2R93G 3KJEA 4CIDA 1OE0A 2PMZE 5G40A 4AK9A 3H3VI 4DWJA 1VPLA 2HYIC 3U44B 1QRAA 3VR6A 4WXRA 1VMAA 3HWSA 2VBCA 3UATA 3Q8XB 4LK1C 1XNJA 4JLDA 4XVRA 2QMEA 4QC2A 6Q21A 1E2DA 1E4YA 1XD9A 3RANA 2C98A 1Y1WH 3LX8A 4P4UA 4LX0A 4NL4H 3GLGB 2AKYA 1CULC 1KMQA 2VYFA 3UIEA 1Q82C 4H0LC 4Q66C 2ZJAA 3LW8A 4ZI2A 3ZD6A 1XMIA 1EGAA 1VQ4A 4A6XA 1SVKA 4W9MC 1X3SA 2C9OA 4DDTA 1L1OC 2HXYA 1J8MF 2JLUA 2PT7A 3R8FA 4C0KA 1GKUB 1JMCA 1KK3A 1E2PA 4MKHA 5FBLB 5DN6D 2WTUA 2C9CA 1F48A 4EQ6A 1G6HA 4C7OB 1H65A 2ZI7A 2XB2A 3LD9A 4BLPA 4KLNA 1WA5A 3TH5A 4YWKA 3UANA 1XNQL 1XTRA 3QKSA 4NCHA 2ZM5A 4HB0A 4GOJA 3QEJA 3VKHA 2J87A 4FMDF 4IFDJ 2BDTA 2UU9Q 5HZKA 3HKZG 1COWD 2G6BA 1JJ2A 1UKVY 1TADA 1J5EL 4YMUA 2JLSA 1CR0A 4TLDA 1UDWA 2IWHA 4AYXA 2MO0A 1CJUC 1VQAA 2OEPA 2VSOA 2C5LA 2W2VA 3B8HA 3MWKA 3PCRB 1KI2A 3ADBA 1BBWA 1SRUA 5GADC 2IUTA 3DZ8A 1II8A 5LD2B 1MABB 5JS8A 2KWIA 2WAXA 4UP7A 4BZPA 5FLMG 3VR3A 3PUXA 5H1YA 1OSNA 2VSFA 2GXAA 1CEEA 5BN3A 4A76A 2Z0SA 4UXHA 4LPKA 3RS5A 3RS3A 1G51A 4QJ4A 1PV4A 2WWWA 1SN8A 3KB2A 3KFVA 3GJ6A 3CW2A 3NTUA 4P4SB 3TQFA 3A1WA 3SJAA 3W3ZB 4CVNA 5BWMA 3GFTA 1EIFA 5AUNB 3QPUA 4OI4A 3NE5B 2JA6G 4LUCA 4QBHA 4PSKA 2OFXA 1KY2A 1NVXQ 1Q8KA 2Q6TA 2AK2A 1KAOA 1WXQA 3AQQA 3KFUA 3LH5A 1Z6HA 3BH6A 3EWAA 2G83A 4BEBA 5KO2A 1C9KA 3DHWC 4LF9Q 3KF6B 1Q44A 3BERA 4YQFA 5FUYA 3U4ZA 1G16A 4LJ5A 2MO1A 2BBTA 5J4HA 3Q7PA 3KKPA 5FUVA 3CPWA 1JPJA 4DR2L 3W8NA 4JI3Q 4AQYQ 3T5DA 1OH8A 3OHMA 4D25A 4HSEA 4D82A 1WI5A 3QKRB 3VA7A 3IPYA 4YXWA 3UDFA 1Q3TA 4LJ8A 2WB1E 4O2LA 1NJFA 4IDQA 4TZ0A 2DCUA 1VQKA 5ELNA 2YHSA 2O8DA 4A3CH 3CH4B 1U98A 4JYAQ 4LV5B 1XMVA 5FPKA 2V1UA 1UEBA 2EWVA 3AF4A 4OHYA 1BH2A 4BLSA 3GTLH 3Q7QA 4FDBA 4NYJQ 3AEVA 1L2TA 1E2HA 3WYAA 4IPHA 2IYRA 1T3LA 2F1MA 2R93H 5KYKA 2ZI5A 5AJYA 4AYTA 4JS0A 2H16A 3MWYW 1Z6GA 3LXXA 2PPBC 4ESVA 2VQEL 3IIJA 1SROA 3N6RA 5B2ZA 3TS0A 4LFAQ 4PXAA 4B71A 3BK7A 3TKLA 721PA 4DNIA 1E99A 1KOFA 2D2EA 4DV6L 3KUCA 3U60B 3QXSA 1W46A 4DLSA 1E2QA 5BN5A 5FUXA 4W5JA 4Q18A 2IUUA 1SXJC 3U3OA 5HE9A 1EWQA 1Y8PB 1VYVA 3CNLA 3KJGA 1T8UA 3N70A 1JXOA 3W5IA 1XJ0A 2WAYA 4DDVA 1YJ9A 1IJFA 2AKWB 5CJPA 1JR3E 2NG1A 1P9WA 2P65A 3T15A 1WYDA 4DV7Q 4Y52H 1FNMA 3SJCA 2P6RA 3OEHD 3TUIC 2ZIAA 3BE4A 2N8NA 2ID0A 1YEZA 1Z28A 1GO3E 3IHLA 4C3IH 1G41A 2GVDC 4B3RL 3LVRE 1RC8A 2WKRA 2IF0A 4EJSB 3AVPA 4GLAC 2W0SA 2ODNA 2GILA 2GJAA 2IHEA 2WMOB 4A2QA 4TKOB 2ZJYA 3BXZA 1H9JA 2PNRC 1YR6A 5HTKA 2OAP1 2LCFA 1QVFA 4Z1MD 2CL7X 4WW0A 1XMQQ 2F3RA 1O7LA 4NHOA 1WF3A 3H0GH 3REFA 2NVTH 4FWTA 3D0FA 4JI8L 3PO2H 3ICQB 1E7ZA 1IN6A 4JL8A 4UKDA 5C4GB 4LHWA 4IOLA 3EXAA 4KU4A 621PA 2JA8G 1Z9FA 4IDPA 1FUUA 3K70C 3A6PC 3LNNA 4DV5L 2QGZA 5EP4A 1XPOA 3EPHA 4EPWA 1RVDA 2VQFL 4MDEA 4MDFA 1HNWL 3A1VA 4C30A 4DK0A 2X77A 3BH0A 3DM5A 4JI4Q 2R6GA 4L15A 5IWAQ 1KKLA 5FBVB 1HR0L 4HJ8A 2O5IC 4QM7A 1G7CA 2EFHB 3VR1A 5KDLA 4NB3A 5E3HA 4I4LA 2VP4A 5K8UA 4ZV4A 4DUYQ 2EVBA 3CC2A 4DR1Q 4BXXH 4GKKQ 2H17A 5BQ5A 4KCGA 2E8GA 5BR8Q 2CE2X 2GTPA 3TVTA 4GN4B 3EW9A 4HDQB 1Z8FA 1N34L 1KSHA 1VIAA 4J0QA 2FX3A 4N0DA 1NN3A 4RZXA 3W6NA 3WMFA 2A5YB 1PH2A 4HZUB 1HA3A 4YC7A 4PC3A 2DFKB 4O0MA 4DCSA 1K8GA 5FJ8G 1QDEA 4CGZA 4P72A 1GNQA 3TS2A 1IXRA 4QHTA 1JB7A 1J8YF 2ZREA 3SU8A 5LB4A 3L8YA 4UJ5A 4TTQA 3C5CA 1E32A 4LF4Q 2WJJA 5AJVB 1KI9A 5FR2A 4C0BA 1I3QH 4LUZA 2GEVA 3PENA 3LY5A 4QNMA 4GZLA 1CKOA 3SI7A 4PZLA 1K5GA 1FMJA 1E22A
chains in the Genus database with same CATH superfamily
1BWRA 1E58A 1M2EA 4PNHA 2SHKA 3ZWMA 4BNXA 1O7JA 4QRHA 3BDLA 2CVPA 2X6TA 3FAKA 3U39A 3X43A 3W1WA 5CDFE 3C1UA 2KJXA 4B9EA 1A8PA 2C2KA 3CLKA 2YRWA 4NVRA 4RV5A 1Y6JA 3ICVA 4HMPA 5AHXA 4CTNA 3Q8KA 1Z29A 2QVYX 3Q6NA 3LGSA 3W8EA 4RWEA 2LVBA 2Q49A 3HP7A 2AZMA 4AN1A 1FLDA 1BKBA 4A3MG 1CR6A 3QE2A 4G01B 3UUGA 4E3WA 3FB4A 1AZTA 4OXRA 1TA9A 4U6QA 3KJZA 1JP7A 1SBHA 2W2KB 2ICAA 2Y4NA 2JVKA 4OSEA 1YZ6A 1ZD3A 2QP4A 1W0KD 3QJGA 4P4TA 1D2CA 4UDYX 5CT6A 5JUWA 5A4AA 2C9BA 3GBVA 1SCQA 4DCJA 5CYPA 3RJ5A 3GA7A 2M98A 3BVPA 4IQ4A 4LSZA 1Y4AE 5CCDA 4YV0A 2JLXA 5AKEA 2EX0A 5IYZF 4HI0E 4G0UA 2JCYA 1UFQA 2PT5A 1KI3A 2FAXA 1F4VA 3QQPA 4J43A 4LN1A 2GN8A 2CLIB 5F52A 5LYJA 2VH2A 1RKBA 3GEHA 2QEJC 3BILA 1PZFA 6AT1A 1XR3A 2HL6A 4B7XA 5FIUA 3M9WA 4KTVE 4HB3A 2AFIE 4LF8L 4RFSB 5ECGC 3GCZA 1OY1A 3ECSA 3IURA 5FUMA 2VRCA 2RGEA 3CC8A 1PCXA 1R7RA 2V6JA 1AD2A 4TKVB 2WAOA 5LP6C 3VPGA 1W9HA 1JZSA 2LWIA 2BC9A 4DARA 2QDBA 5AUPB 2NXJA 1EUYA 1PR0A 3DFZA 5ICFA 1SCAA 4L9SA 5KJEA 4DV4L 4PICA 4NC9A 4UVEA 1JA0A 1ILPA 1AFPA 5A5GA 2QQ0A 2DPGA 1KARA 3CJQA 4EY8A 1YZQA 2LR0A 1SJED 2Z6KA 2BF4A 1T9GR 4JVNA 4H7DA 4Q24A 5FYDA 4OQYA 2RMKA 1QH8A 4PPYA 3ES9A 1EA5A 4JV5L 4JI5L 1ATZA 1IB6A 1F4PA 5BSVA 1DIRA 4A4IA 4OX9B 2H29A 4AULA 4DEYA 1JTVA 3MLBA 4F4JA 4RTLA 1YZNA 2IYFA 1VYHA 2H2AA 5C34B 4APVA 2QSYA 2YWXA 3L7KA 3MJEA 4LF7B 2QV0A 4U5QA 3REQB 4Y98A 5CVEA 2BR4A 2WPDD 1A7UA 1KEWA 5TSSA 4CFZA 1D5ZC 1VQ1A 3AHCA 2JA6B 3UDGA 2QZJA 3CNQS 3HKBA 2VPTA 5HA5A 5JVDF 2A1UB 4A36A 3QKWA 5EYPB 4S12A 1G63A 4MS1B 4E51A 4OGQC 1G0NA 1QZHA 1MO2A 2YQ5A 1GAQA 1R15A 3MW8A 3O4VA 2BKLA 3BL5A 4KXWA 3S2YA 5CDUA 5EUMA 2WU0A 1TRKA 1QZXA 3SPXA 4WZ6A 3NM5A 1E94E 4Q3EA 4RQBA 2JZCA 3QI7A 1NBIA 1TYAE 3GZNB 5FO0A 3NBFA 1E3DA 1CS0A 1E3QA 1N34Q 4GEGA 1KEEA 2IGBA 4L8GA 4WDRA 4WEOA 4ZUIA 4B3ML 3SXPA 3T4EA 1S5ED 1Z18A 4DV6Q 3IX7A 1W5TA 2BOSA 1KDOA 4JW0A 2QN7A 2ZBVA 3VI3B 3C5WP 3GZJA 2C7VA 4NBUA 4F3CA 4KY7A 3IESA 3Q22A 4IUVA 3QPAA 2QCPX 1FNNA 2GPAA 1FRQA 2PNFA 4UATA 4B4UA 3UOWA 4BEJA 4PBSA 5CDFA 3U61B 1H6CA 3FSRA 3R5TA 4G5XA 3F6SA 4ER5A 5HUJA 1DWUA 2F0LA 1VJGA 1F0YA 2H0RA 2DB3A 1K3TA 1JOKA 3KPUA 1JQ5A 4V1CA 2C2YA 5KUTA 1O78A 1YUMA 3MMXA 3QIVA 4HH1A 2ARKA 4W1PA 4CFYA 1TQOA 1L1EA 1HFNA 2VVTA 3FHOA 3LLMA 2P2CA 4NNPA 1F7UA 2ST1A 2NPFA 4XQQA 2YHUA 1IPEA 3D6UA 2Y92A 4XM0A 2Q1WA 2Y1DA 3AYXB 2I2DA 3IEUA 4R81A 3GLFB 1N8TA 4D45A 3MGGA 1AY0A 1PTKA 1Y1LA 2CXXA 3D5QA 3L8FA 4JUAA 2N49A 2LP4Y 3ZUGA 1CFJA 1YDMA 2QRPA 4FOLA 5MN6A 1E3LA 2O23A 1KBZA 1TT5A 3CEPB 1RKQA 3DVAA 3IULA 4MUXA 1DKMA 4AC9A 1RPAA 4OJQA 5EJ5A 1MXFA 3E5NA 3DBVO 3H1EA 3LQFA 3NC1C 3JWHA 5DHFA 1HLGA 1P2UA 3QXHA 3FTEA 1GIAA 3BVMA 2CUKA 2BMWA 1IK4A 1NR2A 3CCSA 3RC3A 2UZAA 3FZGA 3FKIH 2VNJA 2ZJ0A 1F77A 1XNRQ 3C7DB 5LZ5A 3RFXA 3DBLA 4X62Q 3ZG6A 3P2MA 2CHBD 3DAYA 3K1YA 4NAHA 3TD6A 3BK1A 3L0CA 3AFIA 5KNCD 1L4NA 2X0KA 4GFDA 2VTKA 2K7FA 2OBXA 1X3GA 3M4PA 2F7SA 1JDBB 1F2UB 1QHEA 2VHJA 4BMOB 5KVCA 2FFKB 3HM9A 1Z3CA 1FTGA 2IT1A 3AGQA 4AWAA 3VHQA 5DTEA 4YP1A 5CT8A 4XJXA 1J9OA 2H4FA 3S5JA 1UR5A 4K9MA 2NGRA 1X0XA 3TEJA 4YEDA 1PDOA 1JA1A 4UJ3A 2V55B 3P1HA 1EQUA 2HK6A 1FFCA 3C85A 2QA5A 3BTVA 3NVMB 1P2VA 4DLUA 1CS0B 2I5MX 4OLHA 421PA 4BBJA 5JV5A 2W5UA 4X91A 3K70D 2EOTA 2MP1A 1K5PA 2FP4A 3GVCA 2ADFA 4FD2A 4KO2S 4LYJA 5ESDA 5F73A 3X0DA 4A6PA 5BVHB 3KETA 2AS0A 3FUUA 2FVXA 1PH9A 3LO8A 3ESYA 4OMFG 3DPSA 2ZB3A 4H16A 1Y3CE 3LRPA 1Z0FA 2PD4A 2BM1A 4I14A 1QF9A 2DQZA 4ZAVA 1TKRA 2PAAA 1OV4A 3A6PC 4QQBX 2PI2E 3MINB 2RGGA 3Q10A 4KH1A 5JJCA 3O0TA 4QOFA 5BNWA 2Q0HA 1RC8A 3Q23A 5I9SA 4AJKA 2IP2A 5JZVA 1HTTA 3A4IA 4TYMA 5CH3A 1Q81C 3EQLC 2BE7A 1V2HE 2MSCB 2ZAOA 4C7BA 3ICPA 2HCBA 2A73B 3TBKA 3IR5A 1VKJA 3OE1A 3HQ4O 1AKQA 1FK8A 1H66A 1QVWA 2ZS7A 2VI5A 1J6UA 2C2MA 2MSNA 3HGTA 2EF0A 2TMDA 4HNQA 5IG2A 3NENA 3A1EA 3ZX5A 4C0LA 3DA8A 2J7KA 3IMCA 1J0BA 5FOQA 1LPNA 2IU4A 4UZEA 3TJZA 4UUAA 1FD7D 1UKZA 4HNVA 2NVOA 1DC3A 1KJ8A 4JLVA 4G4IA 1S4ZA 1I4LD 4RGBA 5LLSA 4D8VA 2V65A 4ERNA 3I6YA 3R8CA 1KO5A 1X56A 2IYYA 2PNJA 4ACBA 1NA5A 1W30A 2GN6A 2YW2A 1BGVA 2JVIA 3GLHB 2JA6H 2PV7A 4GE0A 4J6EA 4NU5A 4JBWA 3COYA 4O25A 5DRYA 2EYLA 4LOJA 4YRMA 2G17A 1Y6QA 1Q8IA 1EVZA 3IOCA 4K9PA 2WJ6A 3ZQ4A 4F9EA 2CXPA 5L3QB 3JRXA 1B26A 3QBDA 4E7OA 1FMLA 5DCUA 2XNAC 1CDOA 1UT8A 3DL7A 3QOXA 3H5IA 2HK7A 2YVKA 4NZYA 4QL5A 2W7TA 5IYCG 4BVHA 1J24A 2EBHX 1JBKA 1CERA 2H4XA 2QYHA 2YTZA 2YOHA 3EGDA 2J0TD 1PTJA 3N9IA 3RV3A 1UP4A 2C1XA 2OD9A 4ND6A 1RMYA 4R6WA 3VVBA 2QSUA 4AY6A 1T8RA 5IVIA 1C1XA 5ENVA 2R8XA 3WP1B 2O20A 3WLLA 1IBSA 2ZUSA 4HQNA 4ABNA 5H16A 2ZSAA 4AYWA 4RTNA 3D6CA 3DAPA 3MGCA 3T6KA 2AFRA 4YPVA 1QAOA 1VHTA 3ISVA 5P21A 3OBIA 4GXRA 3DBRB 4BV2A 4Z9FA 3T1HB 5FR1A 1VQEA 1W4ZA 3QPWA 4JAVC 1QC5B 2Q5FA 3LLUA 2X0NA 4DC1A 3HEMA 3RS0A 1GZUA 4GQBA 4II2A 1C4OA 1CW2B 1QHSA 3EFXD 2M32A 2R7DA 2UZ4A 3HPRA 2VYNA 4QNNA 4EG7A 1CRPA 2WP0A 4LKRA 1T5TA 4LSGA 3UUEA 3A56A 3H19A 2XGJA 2X0DA 2R97A 1KXLA 5ITZB 1FX1A 3MSXA 3T1TA 3D7SA 4LBVA 2NTNA 1T0BA 2WWFA 2OZPA 1VG0B 4Q4JA 1GQYA 4UTVA 5KVVA 4RHRA 4A3LH 3I34X 4PM4A 3PDCA 1LUAA 2Z6KC 5DCWA 5EZ5A 1AGXA 3WGZA 2AZXA 3QBTA 3SQLA 4EHHA 3TRHA 4Z3OA 4A3BB 2O0MA 5ESWA 1CQPA 3EZGA 4LSMA 4WCDA 4REQB 3VR2A 1GU1A 3H84A 1ZPDA 1OWOA 1E96A 5DWDA 3H13A 4HADA 4W1QA 4IUYA 3EIWA 4R40A 4B33A 4D74A 4MN3A 4BPRA 3OIWA 1NSFA 3DMRA 4X6YA 4IBOA 4DMCA 3NTHA 1FU8A 3ANTA 4FONA 3TDQA 2K50A 2KOLA 4DANA 2P2NA 1V7CA 4XJTA 4DV0Q 2BZSA 3L1JA 2HJGA 3TE6A 3I9KA 1U0GA 2NU7A 1XU7A 2WWTA 1EA7A 4D8UA 4GG1A 3HN2A 3I4MH 3IR7A 1QFZA 1U6KA 3L02A 1D0SA 4D9BA 5BUSA 2K01A 2J6CA 1C3EA 2E4YA 2NU8A 4RLQA 2HRDA 4I50B 2WB1G 1PO7A 1WR8A 4MYHA 4UE3S 2POCA 2QM8A 1VQDA 4JD5A 4L8YA 5AJHA 1YQTA 2Z0MA 4X8LA 3LX5A 1MB0A 1S5BD 1RXSA 1M8JA 1JICA 4HJRA 2QAGA 4OB7A 3U44A 2P9ZA 1PS9A 1WTOA 1Z0ZA 1HQMC 3PHCA 3T9BA 2VT6A 4O4HA 5TX7A 2UYQA 3NHUA 4PZ9A 3TGWA 1E8NA 1PR4A 3QXXA 1I2AA 2FPRA 4IJMA 1QOHA 4RGTA 2WTXA 3I0ZA 4HYTA 4YRAA 1JV2B 4LJSA 1CLEA 2FR8C 2BGRA 3GFQA 3OIGA 4QJBA 4OJTA 4EARA 4AKHA 3Q2OA 3V1YA 2PUHA 4NPCA 3D6HA 1ZKDA 3UPUA 5F2NA 2GI4A 1OBOA 3LXUX 5EKSA 3JAWB 3TOVA 1TFUA 3NIDB 3T34A 3U50C 3L79A 1TWHH 4PZ7A 4P98A 4DHEA 1TO6A 1VB5A 2WC1A 3BEDA 4IEIA 2CHVA 4L5YA 4PQYA 4YRFA 3UCFA 2FOLA 3C5EA 1GSOA 4X00A 2I4OA 2A84A 2I2FA 1PFMA 1AKMA 1UBJS 2X7JA 3NVDA 1B4OA 1E2UA 1XLTC 1VJRA 2VATA 3OOSA 4XGKA 2HLPA 1ZFNA 2YYSA 4TS3A 5AFWA 1DAIA 2VRWA 1CUGA 1Z6QA 2VJCA 4M1EA 1PQPA 4KNWA 3F1ZA 5CORA 3HXTA 2VDJA 3TR6A 2J4FA 1INLA 4KR9A 4IKPA 1G21A 3QFSA 1U9ZA 2XTJA 3ETHA 5EJWA 2XE6A 1UEIA 2GFHA 3GJTA 3MTEA 4GW3A 4UAJA 4XOIA 4CM9A 2FR0A 5ES4B 2O8EA 4L4YA 3NBHB 3B6KA 5K0FA 1R4PB 1R0SA 2YQZA 3NFRA 4IWYA 1KE1A 1WTPA 1E4EA 1S4QA 4PMBA 3A9VA 1YI8A 1TRHA 2V7TA 4RVSA 1MX5A 3MSCA 4WBNB 3K0YA 1H22A 1K0SA 3M2PA 5F2KA 1CKEA 1EVIA 3FNIA 4DIUA 2Z57A 5T4BA 1QQ5A 4LRXA 4ZVSA 2PN1A 2X4LA 3C3BA 3LT5A 4J76A 4NH0A 4TLBA 4UVHA 4X6UA 3FWZA 2WWVD 4DM4A 2CT8A 1HE8B 1OFIA 5HFAA 4RKEA 1JJAA 5TMDA 2IW1A 1XX8A 2OEOA 4J0EA 3SIXA 4ILWA 3HDHA 1ZYRC 1QS0A 4QEDA 2YN0A 4WNAA 5FNVB 5T1GA 1UBEA 4PBRA 4J2HA 1XQ6A 3GX1A 1D1SA 3MXTA 4KV6A 4DJTA 3GRFA 3KKKA 1Q1AA 3LDAA 3OM0A 3O9ZA 1UJNA 2IHYA 4RK7A 4WWHA 3NQTA 4A3KH 4D6XA 3OSUA 1IZ8A 3QHQA 5J4YA 2LDXA 3AVWA 4I5IA 4MV5A 3BYYB 1KEVA 2ZSBA 4JT2A 2QQEA 1XQWA 4H17A 4OGGA 4JQZA 2DWQA 3PFBA 2QWXA 3CEMA 1Q3HA 4INPA 2RGNC 4N8SA 3UENA 4CWAA 3PIPA 1PD0A 1RW4A 1V4BA 2Q3CA 1GUBA 3S2HH 1G3IA 1N5IA 1L8OA 1VE5A 1WDTA 4FGKA 4IEFB 4IHKA 3USES 2L15A 1VJ0A 1ZN2A 3WISA 4ENQA 1QVVA 4HXGA 1M8KA 5LNK1 4X93A 2ILVA 4A93G 2VNSA 5I01A 4X66B 1E6CA 3OU6A 3QE9Y 1S9HA 1ZC4A 1M66A 2HKIA 3CR8A 3THYA 3GA5A 3VM6A 2OK8A 5CX1A 4KBGA 4XRRA 1UDBA 4G4GA 2QXTA 2QZ4A 3LBIA 3GZ4A 1DZ1A 1UOQA 1DBIA 1DRUA 2EARA 2IRWA 3IP1A 3COZA 3V48A 4LXUA 1MC8A 2PKRA 1TKCA 4G0YA 5IJ0A 5CMDA 1NKSA 2F43B 3JWJA 4FEGA 2WIJA 4OH1A 1EIWA 3OA2A 3JZMA 4RADA 2VH1A 2VZAA 3FOCA 1XFDA 1RHPA 1I4RA 3HA3A 4YMHA 1QHFA 1WOYA 4DR4B 3FGNA 1LDBA 1GPDG 1VE6A 4XDXA 3KIPA 2AZ4A 4RXUA 4DCVA 4DR4L 5CDTA 1QIGA 1VPDA 3ANXA 3PKZA 1AQYA 1RHRA 1XPJA 4YRIA 3O0DA 3FP9A 3QVTA 1QCCA 4K8OA 1JJGA 3J81j 3CVJA 2TMPA 4OHBA 1SPXA 5KNLA 3LQ2A 1SCKA 5DN9A 1V1MB 1Z5WA 3OJCA 3T7JA 4RPGA 3SIWA 3QSGA 1JHVA 2C0PA 4PNPA 1PDWA 1GUYA 4ESHA 2QG4A 1Q95A 2XCUA 4MCAA 5EFOA 5JFGA 4RIEA 1CRWG 2C4HA 3L0SA 2QF7A 1IZ7A 4BNLA 3D6AA 3DLIA 1GPAA 1RBMA 1VBMA 4IJHA 3HNOA 5BR8L 1FS6A 1YS7A 1E63A 3PD0A 2WKDA 1MB4A 5GJCA 3TFOA 4RHTA 2WQZA 1QIKA 5AM1A 4BEWA 5IP9H 1T3SA 2D1YA 5AKHA 2IH4A 3U7FB 5MGBA 2JN4A 3IIEA 4GPBA 5H4HA 3IQIX 1A95A 1Q0TA 4C05A 3EBLA 1XVIA 3T94A 4EF5A 3VPFA 1NXXA 2V5VA 1W35A 2OHHA 3EXHC 3OD1A 5DDIP 3ZV7A 4EELA 3CVVA 1K66A 4JHLA 4LNAA 3KBOA 4WHMA 3U9TA 3W2HA 2JZNA 8OHMA 1QO7A 2VSQA 3CUSA 4MR9A 4DTCA 1M73E 3F5DA 1KC3A 5IW8A 4FD3A 5JCOC 4O3MA 4M7OA 3LUCA 4UHHA 5BWLA 1UK7A 2MSKA 5ECDA 2VTEA 1QCZA 1BC5A 1XCMA 1WSDA 1NXVA 1BVRA 3GMIA 4ARCA 1A3VA 2K2QB 3CUEF 3F49S 5JXWA 3N28A 3HVHA 4H3HB 4R7GA 1V6AA 4F38A 3DTYA 3RABA 4P5DA 5J1SB 1NMXA 4GN5A 1F2TA 1P5JA 1T2UA 2VIIA 3AJ9A 3K9BA 5KREA 3I90A 2C5AA 2QMOA 1TWGB 2AE2A 2YV4A 3CIOA 3FNRA 3ZEIA 4CKWA 1PJAA 4A3BG 1BSVA 3O1HB 5HBGA 2AUJD 3IQXA 2FPKA 2J46A 2B3GA 1SC3A 4Y0VA 1WFQA 4A3DG 1NDHA 2BHTA 4J49A 3ZE7A 2DFTA 3LHFA 4HAYA 3UK6A 4PWYA 3MRXA 4W7IA 1YCGA 1CSQA 1I24A 4OSOA 2B4QA 2OFOA 1X86B 2NVQH 2HRZA 2B92A 4NMLA 5BNFA 2I3ZA 3ID6C 1Z26A 2YWCA 4Q4AB 4P22A 4YXWD 3FCXA 3K09A 3VC7A 3T1YB 3K7AB 5K0LA 4C2AA 3F2DA 3GEBA 3I04M 2VHXA 3N8NA 4TZKA 4UNQA 3A6DA 4B6PA 2VUHB 4K9KA 2W6PA 5ALGA 3CRZA 2BI4A 3SC6A 4R2WA 1LA2A 1N34B 3OSOA 2YJTD 3GV3A 2PXCA 1GOZA 1H2EA 2VP9A 5CNJA 1NYLA 1H93A 3DMYA 5FJJA 5JSZB 4MGIR 4PCVA 4EEZA 1VHDA 2BGUA 2HHHB 2W70A 5JW6A 1E0JA 2F0WA 2UXBQ 2I6TA 2VPPA 1C4XA 3GP5A 3L49A 1KBOA 1ZOOA 4MEJA 4OXYA 3LGJA 3I4NH 1XCLA 2A8YA 1P72A 5KEIA 1NW5A 1XAJA 3QWAA 4D0SA 3WGJA 3FGOA 1DJRD 1SNQA 2UUAL 4TLAA 3RFVA 5K8CA 4EI9A 1IBKB 2P3SA 1GUZA 1QHXA 1YB1A 2C96A 3SGIA 1SYEA 2VA9A 3FTDA 3JR3A 5FPYA 3JWIA 4DQUA 2QRNA 2D06A 4DREA 2X6LA 3SDZA 4C3VA 1D09A 3PUKA 4P71A 4BQFA 4BBRH 4ITUA 4H7BA 2V1CC 1XNHA 1R9MA 3WKBA 4RGNA 1YUBA 1L5WA 2E1RA 1BW9A 2CVOA 2WR8A 1TOAA 3A6ZA 2UV8A 4WKNA 4AJEA 4MTNA 3UFBA