3PUVA

Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
371
structure length
371
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein
publication title Snapshots of the maltose transporter during ATP hydrolysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/transport protein
total genus 103
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3puvA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3puvA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3puvA01
1EX6A 2OCEA 4BBSH 5L3SB 3QI2A 4RJLA 3LDAA 3N2EA 2ZI7A 2XITA 3RANA 1AM4D 1V1QA 3KQHA 1HY3A 1KJYA 4OK6A 3K0EA 3EBEA 521PA 3SJCA 4A3KH 2QA4A 3CC4A 1E9CA 1SVIA 2J41A 3CCJA 3DKPA 4JOIC 1TWHH 4QKQA 4N0EA 2YU9H 1E2VA 1KO1A 3EQLC 1WXQA 1YVDA 2CJWA 2HJVA 4JLVA 4M1OA 4LPSA 5EUQB 3SHWA 4OHXA 4DK3C 4HUQA 1B8AA 3EX7C 5GVSA 1SULA 3B13B 1C1YA 1H8HD 1DG1G 3AF3A 4JT4A 4ZIRA 4G3XA 8OHMA 5HKKA 3QF7A 1CSPA 2EYQA 2ZRHA 2QMOA 3RRYA 1K8RA 3AFQA 4A3FG 2OQKA 3S1MH 2BWJA 2GWHA 3TSOA 1Z6YA 4PC6A 2JLQA 1XTIA 5J3BA 2B8TA 4M1WA 1EIFA 5FLXc 2ZPTX 3FMPB 4KI0A 3NG1A 1GKHA 4A93H 1E2NA 2ZQ5A 1NI3A 2WBLC 2IYRA 1KGDA 2GXSA 3NBYC 4A0FA 1GKUB 1JECA 1WMSA 1LVGA 3ZZTA 1JNYA 2A2ZA 4MYUA 4OHWA 4RCZA 5EQTA 5J40A 1KDRA 2ZJAA 1X65A 2R8RA 1N36Q 2GZDA 2Q3FA 1OH6A 2A19A 4US1R 4KSCA 5JSZA 2ORWA 5FLMH 3K0CA 5C0XJ 4LF8L 2FGJA 4I4LA 4RMFA 4U5XA 2EIFA 1DG3A 2H16A 4P72A 4IOCA 2OZEA 4ON9A 4RY2A 4HIKA 1A0IA 2GCOB 1IJEA 5FI0B 2IWRA 2VUMG 1UEIA 5JRJA 2LKDA 2UUAQ 4LFAL 3OIWA 3J7A5 4LDJA 4ARZB 1FX0B 4Y52H 2UXBL 4YMUA 4P73A 2IBMA 3LWNA 4LCBA 2I3BA 3Q8XB 4APVA 2ZRLA 2YZ2A 3PEVA 4NU0A 3RHFA 1B9MA 2FFQA 2D0OA 2HT1A 2IHBA 2XOKA 1PMRA 2OXRA 3NBHB 4OO1I 2VF8A 5JJKA 3PITA 3REGA 3HOUH 2VHQA 3NBZC 3CAMA 2IXFA 3H15A 1HH4A 5LD2C 3CM0A 1NMXA 2QEQA 3A6PC 4IXMA 4M2LA 3U61B 1VQKA 2B8GA 2G0TA 5JI2E 3QKRA 1AA9A 1DAKA 1Z0FA 2FWRA 3I32A 1AKYA 1G3UA 3Q3JB 5JCPA 3TQYA 4ZDJA 2GVAA 3IEUA 4GP7A 2AFHE 2XTMA 3CR8A 3MWLA 4MA4A 1YHBA 4X8OA 3TK1A 3IHWA 1FQJA 1EIYB 4KHPL 4DR6L 4HAZA 3FHWA 1P16A 2V1CC 2G1KA 4B35A 2FG5A 4QGUA 1L1OA 4GMXA 1TTTA 1K8OA 1YHAA 2UXDQ 2JEOA 1TU2B 4JBWA 1QF9A 3I62A 3GLGE 2ATXA 3PUVA 4Q1DA 1WBBA 3EZFA 4HAUA 4LJAA 1MRSA 5JEAJ 1Z6HA 4ILEA 2B63H 3GTQH 1Q3TA 4PHGA 1NKSA 5JEDA 4PG3A 1H9JA 2W2VA 1KI6A 1G3IA 5IP7H 1VECA 2ZRDA 3ASZA 1HH2P 2J5XA 4W5HA 1NBWA 1RJ9A 1G8HA 4QGAA 1NLYA 2IX0A 2CL0X 2OV2A 4OWWB 4P74A 2ZSDA 3BB1A 4G0NA 4WJ4A 4LSGA 4LF7L 1Q82C 3CX6A 4DIEA 1R6BX 2C9OA 1GP2A 2W83A 2B7BA 2REOA 3B7GA 3U7EB 4ZCIA 2C96A 2C9CA 2HT6A 5C0XG 1YZUA 3B9PA 4Z54A 3A8KE 1SVSA 3ZJYA 3ICQB 2QMEA 3DEFA 1J7KA 3LLUA 5TVKA 2IW3A 1KSFX 1HPCA 3GJ6A 3PUZA 3HKZG 4JLDA 2I5LX 3A4NA 1EWQA 4GN5A 2EFHB 1OJLA 2HDNB 4DBLC 2FX3A 2VLIA 4LFBL 1FZQA 4GOKA 1G3MA 1YQTA 1FR3A 4IFDH 2B21A 3RLFA 2HF8A 4MZ9A 1DCZA 2VSOA 2J0UB 1TWGH 2JA9A 1GDDA 5B58C 4DCTA 3A1TA 1PZNA 3BRWD 3UMSA 3K09A 3GFTA 4ALPA 1GOTA 1Z08A 2C03A 3VA7A 1QHHA 3DOEA 3GMTA 3MJHA 4QHSA 3BZCA 4JIMA 3GLIA 4LJ5A 5ANRB 4A3GH 4PZYA 4AQYQ 1DTSA 2DR3A 2UXCQ 3BAFA 4TMVA 3KB2A 3EZ9A 1IL2A 4Q02A 3PEYA 2IC5A 4FDBA 2GVZC 3VDYA 3IDQA 4C0QC 4GNKA 5AUPB 2L5TA 4CRWB 2UUCL 4M8NE 1QZGA 2I0QA 4JLMA 2JA5G 2PCJA 3A4LA 1R0WA 3AVVA 1E98A 2WAQG 3D8BA 3W5OA 3T1HQ 5JS7A 5DHFA 3A7LA 2G6BA 2H92A 2WPDA 3BOSA 1XFAA 2X8AA 4XTCS 4DNRB 4PAQA 3ADBA 1XTDA 4HJ5A 4QL5A 1MO6A 2Q0HA 3FHTA 3QBVA 3RN2A 1LFDB 3UE1A 5HPYB 1S72A 2Z4SA 3CXCA 3AVYA 3ZYCA 2ZSEA 5J4YA 2B8FA 2EYUA 3ZDQA 3FMCA 4JJKA 5JWRA 2GZAA 4QRHA 3O47A 3TR5A 1NJIC 1D9ZA 3GLFA 1IJFA 2D2CC 4Q4HB 4GKKQ 1QHSA 1I2MA 5SZHB 3ZVLA 1R10A 1TQDA 4WA7A 3KUDA 1IHUA 3S2DH 5KO2A 3NC1C 1W2GA 2ZREA 1IN8A 2GJSA 1HT1E 1Q1EA 2CWPA 5LMUQ 4C2TA 4GOXA 5HE9A 4XJXA 2D5DA 1JEEA 2GBLC 1ELOA 5KUTA 2B92A 3BK7A 3Q85A 4LJ4A 4GLAC 4FCWA 3VHXA 1E9AA 1JPJA 4HZUA 2OXCA 3BZKA 1CR0A 1D2NA 5L3QB 1HQCA 1G4UR 3SR0A 1HJPA 4IDHA 1Y63A 2PJZA 2YVUA 3QVVA 2ZITA 3NH9A 4WW0A 1EESA 4LC1A 1KMHB 4TMKA 4HR7B 1CRPA 1E2FA 2EQSA 1GUGA 4LBVA 5IYDG 5KSZA 2ZR0A 3NWJA 4DZZA 4PZ7A 5K36H 1UFQA 3CW2A 3I92A 1GUSA 1GUTA 4LK1C 2WAQE 1YITA 2IEYA 1U98A 3I3SR 1OKKA 1EQRA 1Z83A 3DDCA 1E99A 2BBOA 5DNYB 3NDPA 2K5NA 1UBGA 4MUAA 4G7ZC 4GNXB 1N33Q 3HJNA 4Q18A 2BDTA 4JLPA 2WWHA 3B1ZA 4M22A 4BFSA 4Q1AA 3DZDA 4JI1L 1CS4C 1PYBA 5FTKA 1IONA 2IF2A 4EJSB 1P9RA 1TQ4A 4LY6A 3NXSA 3UDIA 4FI3C 2CVHA 5IK2D 2IHEA 1KRTA 1VQMA 4DR7Q 2GA8A 4NCJA 4X65Q 2BM1A 5TB5A 5F9FA 2QSZA 3CB4A 3M4YA 2WP8J 4NCNA 4YHHL 4OI4A 3U3RA 5KYKA 3CRQA 5KTYA 2XB4A 1KRSA 3CONA 2JLWA 2N42A 5GJBA 5LMNQ 2F9MA 4DV7Q 1G8PA 2HYIC 1S4QA 2X2EA 2YOGA 1E69A 2KENA 1YR9A 1YHNA 2IUUA 2RH5A 3PFIA 4IXNA 4A3LH 4QOSA 1X1RA 3OF5A 4F38A 3NEMA 3SJZA 3KJGA 4OBEA 2ZI6A 1GZSA 4CEJA 4B3RQ 1KI2A 4R71A 4S35A 5KDOA 1XNRQ 3BD9A 4LF5Q 4HEJA 2GAOA 2BC9A 4B74A 4TWZA 2R7ZG 1GL9B 4GKKL 1W1WA 3D6TB 5A0FA 4OL0A 2OWOA 3AF2A 4LV6A 2NN6H 3EAQA 3EIEA 3AQQA 3RRZA 5SZKB 3AGPA 4IOLA 1VQ4A 4RZXA 2WVJA 1KY3A 1XTRA 2OE2A 3N6RA 4A3MG 2MSCB 4HAYA 1JB1A 4WBSA 3DKVA 4DXAA 4LF6L 1YJNA 1S8FA 4PC1A 4JSYA 2O0KA 3SJAA 3VMFA 1NN0A 1W4BA 2W2XA 4DB4A 3B8HA 3WY9A 2ZI4A 2WKQA 4G5RA 4TLDA 4UXIA 1E1OA 4YLGA 4PQFA 5EZ6B 3MRSA 1KO7A 4B75A 1B23P 2CEAA 5IT9c 2G9NA 3BDOA 2CJWB 3UMRA 1DO2A 3GEEA 3K0XA 1BO6A 1QJOA 2ZE5A 4QGHA 4M9SA 3UWKA 1E0AA 2QL6A 1E6CA 4HUQB 4URZR 1YJ5A 3BB3A 1Y8OB 3ZD7A 2MO1A 4A3IH 4ZIRB 3HOWG 2ASEA 1Z0AA 3LH5A 2IT1A 4HDCA 3TMKA 5K8IA 1KC8C 3I4MH 4OI2A 1Y1VH 1TU3A 4RD4A 2KBEA 2JA7H 2GEVA 1ZCAA 3AF1A 3PCOB 1IYVA 3QENA 3T12A 3FFBA 5KNCA 3PR1A 2JA6G 2F3TA 5FR2A 1QUQA 1MOZA 4O0MA 3MXUA 5BN3A 4Q66C 4YONB 1KZ7B 5BW8A 1W0JA 3NBFA 2Q9BA 3M4OH 3QXHA 4LWZA 1OFUX 3MMPA 2NOAA 4GFDA 2DN8A 4R4QA 2ODWA 4YDHB 5J47A 5EP1A 3U4ZA 1SQ5A 4JI2L 3I4OA 5E95A 2QT1A 1J5EL 1QG4A 2VO1A 3M85A 3QG1A 2F1JA 4G01B 2WWYA 4DV2L 4BFVA 1BKDR 3QXSA 1WI5A 2BHRA 2VIIA 4Z8XA 4HUTA 4GP6A 4MITA 2QF7A 2NZOA 3TS0A 1CIPA 1EUJA 1XCGB 2Z4RA 3KL4A 2GVBA 1XTQA 3B82A 3AVWA 4L4UA 1X8LA 1PLKA 1Z6XA 2ALYB 2FFAA 2GDJA 3Q7QA 2NZHA 4DR5Q 1NF3A 1OT3A 3C41J 5CK4A 4W7SA 4X62Q 2NO6A 4BFYA 1PUIA 4AG5A 4C0HA 3GLGB 4YMTA 2A6HD 5FJ8H 3BG3A 2H17A 2QPOA 3KQNA 3HKSA 4H44C 1AQYA 1CTMA 1X3EA 1WA5A 2BEKA 3SJBA 4DUGD 1KYIA 1RRFA 2PZFA 4IHQA 1XJVA 3LVRE 4KXFB 1E9SA 1JI0A 5C0XI 3AB3A 1LS6A 3KKNA 1IM2A 1E0JA 4TVAB 5EXPA 1KAOA 3RDPA 4D80A 1RYHA 4AYXA 4DCUA 2OEPA 4CGZA 4B48A 3ULJA 1P2UA 3HOVH 2D3WA 2FA9A 3M4QA 3QG5A 4Q9IA 1U0HC 4C30A 4GZLA 5K8TA 4KFTA 2ZS7A 3GTGH 3QOFA 5A4JA 3W3ZB 4YMWA 3K70D 3FTQA 1DGSA 4IVRA 4UNNA 5IK2A 4DEYA 5GJVC 2WWFA 2E75C 4JL5A 3ER0A 1ZNZA 2SHKA 4OK5A 2A6EC 1VYUA 2B29A 1VCOA 2R2AA 5FBQB 4DIDA 4PQRA 1CTQA 4JV5L 1IBKQ 2CVFA 2GCOA 5FPHA 2IYSA 3RRMA 3KQLA 2NVXH 1YZKA 3DPUA 1N9WA 4YY3L 3OTOL 1L1OB 3F1ZA 2MSEB 2VP6A 4QC2A 4C0SA 3I4NH 4CF7A 4EAQA 3MFYA 3MG9A 1W5SA 1BYIA 2HUPA 1UE7A 1E79D 5F98A 1NTGA 4Q01A 3W6PA 1KSHA 2JATA 2ZRJA 3LRPA 2C98A 3N70A 3A74A 1JB7A 1OW3B 3W9YA 5C1BA 2D2FA 1KO8A 1OXVA 3U7FB 4BLPA 5FOUA 1VCNA 4FWTA 2Q2UA 3Q7PA 4KFUA 4MKIA 3L2PA 4ZI2A 3KUCA 1XMQL 1RL2A 2IA5A 4QGGA 4BEBA 3W1GA 1Z0DA 4KYIB 3B6EA 3L0OA 4PX9A 1WOCA 5HY6A 1VG9B 3L2OB 1KMQA 5TV2A 4JI7Q 1DAHA 1AQUA 3S16H 3R20A 3K81C 4A3JH 1VHTA 4JLOA 4QJ5A 4ZKDA 4K0KL 2ES2A 3AB9A 1XB2A 1C7YA 4BZPA 4DUYL 2A9KA 1GKIA 2C99A 5EXSA 1DELA 2AKAB 2P6UA 1FYCA 4R2IA 4BY7G 4MDEA 1Z2CA 1G1MA 3QNUA 4AI6A 2PX3A 2YJTD 1KO5A 4TMWA 3IFTA 5DO9A 5LB4A 1T8TA 2BDOA 3EG5A 3KB1A 5FPKA 4PC7A 2HXYA 1S40A 1O87A 3BFKA 3CUEF 3PQCA 5CYOA 4DR5L 3U44A 3T1OA 1ETUA 2WWXA 2JLUA 2DY1A 2A78A 1LABA 1NN3A 2VQEQ 1PH5A 4M9XA 1W4RA 4U7DA 3PG5A 4F91B 5KNBA 4UXJA 5ELXA 4BXXG 1GJXA 2VP9A 1TWFH 1TQ6A 3FMFA 1I6VC 4UNRA 5AJWA 3R8FA 2YOFA 3IBYA 4BA2I 3H86A 2KE5A 1E4VA 2ZIAA 2ERYA 4A2PA 1ZIPA 1P6XA 1VQAA 1XPRA 2QGNA 2KWIA 3VFDA 3OEEA 5C4GB 1M2OB 1N25A 1Q44A 3OHMA 3LQQA 1ZYUA 1S0UA 4UPAA 1T0HB 2OUKA 1E2DA 1X8KA 2KJQA 1IXRC 1T5EA 2J7PD 3SBDA 1VF7A 4LHVA 4P4TA 4PHTA 1KSGA 1GWNA 1TPZA 1PH4A 1G5TA 1TQ2A 2GF0A 2JA5H 3STBD 1AH9A 3ADKA 4IOKA 1E2PA 1U90A 4AD8A 4DRZA 1WDTA 2ZRCA 2A69C 2GXQA 4MKGA 2JA8G 1FMLA 4WZAE 3OOCA 4DK0A 2CHGA 4AG6A 2BBWA 4RG1A 4DUGA 121PA 2ATVA 1SXJC 2ZJ8A 3BC1A 3PV0A 1X56A 3CMAA 1P7CA 4C3HH 1KD1C 2J0UA 2OCBA 2ZYTX 4CT5A 5KOYA 5HR5A 1C9OA 3CPWA 3W3AA 3HYTA 4PSAA 1E2EA 2EVBA 1CR1A 3FOZA 2I4IA 3PO2G 2Q6TA 2OLKA 1W49A 4LYAA 4RVCA 1SMXA 1L8QA 2X77A 4OKSA 5EXTA 4R4OA 1UBCA 3FE2A 4RKEA 1E3MA 1VS0A 1KK1A 1T6NA 3O8RA 3EPLA 1D5CA 2VQFQ 1F2TA 4G7HC 2N8NA 1G3QA 1Z28A 1F48A 2HCJB 4HLQB 3SFVA 3RYTC 3UATA 4DR4Q 2BKUA 1U9IA 5A5GA 2XNDD 1VQFA 4TMXA 4RCNA 1II0A 5CB8A 4I1SA 4EPTA 1M7GA 1GHKA 4LBZA 4D0NA 1NE3A 1IOZA 1G18A 2YWGA 4IVPA 3AKYA 4QJFA 1M1KC 2QI9C 3PUYA 4BGDA 4OHYA 1ZUHA 2WSMA 2AL7A 5FBWB 1E79A 3V00A 3H2YA 4AH6A 5M3FG 1JJ2A 2K75A 2WJIA 4WAUA 1K83H 2VP2A 1KNQA 3SYKA 1EWRA 4GMDA 1VQHA 1DAIA 1ZNYA 2FF7A 2OFWA 3CKLA 3AUYA 3ZIAD 2ZJBA 4GRAA 4A3EG 1TMKA 1OXUA 2QMUA 5CYPA 3U2QA 3THYA 4P4SB 4JI6L 5IWAL 1QHGA 2WV9A 2D62A 2AR7A 1S1MA 3PF4A 1CLUA 2G83A 2ZYUX 3DHWC 3CPHA 4NHOA 2R6CA 3S1NH 3OIUA 4Q4JB 3QF4B 4BASA 4BLRA 2Q2IA 2ODNA 2ZE8A 5IDVA 2I5HA 4LJ8A 5LMNW 5EE3A 3WXMA 1QBKC 2ZJRA 3G71A 3LX5A 4HLDA 2CFMA 1JAIA 4KSBA 4B3XA 2G1JA 2ZU0C 2WOOA 3MWKA 2N49A 2UUBQ 3CRKC 3FHOA 1W36D 2O8CB 3VR4A 4FMCF 3NBXX 3OEHD 2ZTCA 3KDFA 1SMYC 4V03A 1XTKA 2OHFA 3W8RA 3U58A 1N5JA 4TLCA 3SQWA 4ACBA 3EWAA 1HV8A 2JJ8A 2D74A 3MGCA 2WZQA 4QBFA 2QAGC 5CDFA 3SYNA 5CB6A 4HB3A 4JYAL 4YQFA 3H4MA 1U0LA 4V0KA 1ONBA 4XWOA 1C9KA 2K5HA 2JIZD 2CHVA 3OFNA 4IEIA 2QQEA 2VSFA 4GL2A 4URVR 5KU1A 4OQMA 3SNHA 1G7TA 2YWEA 3BJUA 4DJTA 4CEJB 2CK3D 4B3TL 1E1TA 2EFCB 5EP2A 5K8LA 2ANCA 1O78A 1VQ8A 3X1ZA 1E1RD 1Q20A 1GILA 5A35A 4IPGA 1N2CE 3E70C 2PZEA 2PI2E 1Z63A 3SI7A 2C77A 2F1IA 3AM1A 2OCPA 2D4HA 3TSWA 2YTYA 4C7OB 1XX6A 1PVOA 2HEIA 2ODEA 1EFUA 4Y7NH 2ZAMA 3OZXA 1T3LA 5LDDC 4DSOA 1NJGA 1OIVA 5H1SE 1D6JA 2CL6X 2FN4A 4NZYA 2EWWA 2J7PA 2P6NA 4A3MH 4DEXA 2WJVA 2QNRA 3N2IA 4X8MA 1NVVQ 3CCRA 3VU9A 2ZM5A 1JJGA 1CKMA 3K7AH 1UE6A 4DV1L 2P0EA 2KBNA 1KI8A 3K0AA 3DMNA 3J81i 4OONA 4NCIA 3MUFA 5H68A 4GNXC 1UM8A 4JVMA 4B3ML 5IF9A 2GHIA 1EX7A 1UJ2A 3CNOA 4QQBX 2N46A 4PAMA 3I56A 1IN4A 1HYQA 2C78A 2XAUA 4DUZQ 3KFUA 1V8QA 5FUYA 3WYFA 5CDFE 2MMGA 4JI8Q 3L43A 4EJSC 3EZ6A 4DCNA 3H0KA 5HE8A 4BQSA 2LWIA 2CE2X 2WIAA 3AKDA 4HJAA 1CFMA 1GNRA 3QKSA 1FQKA 2IYXA 5P21A 1FP6A 3ZVRA 1RC8A 1M7HA 1NY4A 1YNXA 3FKIG 3CMEA 4D0LB 1SVOA 3EN2A 4TTPA 1GRNA 2IYUA 1UPTA 1NVWQ 3K0FA 4JI5L 2FEMA 4RZ3A 1II8A 1NSFA 3A5ZB 1XEWX 2ZRNA 2NVTH 2VTKA 4URYR 4DV4L 5J4HA 1OB5A 1Q86C 3WWVA 1CKNA 3LD9A 1FP7A 2K5VA 1ASZA 1G6OA 2NO9A 3AKEA 4AC9A 4C0KA 4EFMA 4DPGA 1Z6AA 4JLJA 4QFMA 4KMUC 3TJZA 2GTPA 3LNCA 1KI1A 3FPPA 1FJGQ 2ZI9A 1KL9A 5CIQA 3JAMc 3WMGA 2OBLA 4BUJA 3G0HA 1M34E 3SEAA 3ZIAA 3CWZA 3MXNB 4BFTA 4Q7LA 4X64Q 3PO3G 4DLZA 1E2WA 2XJ4A 1S9DA 1DADA 1IXSB 3HR8A 4BFZA 2F52A 1HE8B 1G6HA 3K9GA 4MYTA 4NYJQ 4B71A 1PH9A 1QVGA 1KQSA 4J15A 3NC0C 4M1KA 4LHWA 4O2LA 4DKXA 4DV3Q 1QRAA 2EW1A 2NO7A 3DL0A 3RABA 4DDWA 2J0SA 1DOAA 2AFIE 1SVLA 1G5RA 2PMKA 4GZYC 2W0SA 5B2ZA 4EPXA 3W5IA 3WBJA 1KKLA 1Z8FA 1XPOA 3ADDA 4HLCA 2DUDA 3ND8A 3OEHA 1IYJB 1WF3A 1Q21A 2CCKA 2WWGA 3OW7A 2XSZD 3UKDA 2BCJQ 2NO1A 3H1TA 4TYQA 4UJ5A 2ZRPA 4NYIR 3VR3A 2O0JA 1P4SA 3C5CA 3K9NA 5KSOA 4GDFA 1YBYA 1AJEA 5HZKA 3X1YA 1MKHA 3QXXA 1E9DA 2JIZA 4DLTA 1TAGA 3QXJA 3VHLB 1ONLA 2CQOA 1Z07A 1Y8PB 2FMXA 4B2PA 5C44H 1J70A 3G5UA 4HAVA 3KF8B 2H5XA 3GLGA 1A2KC 3EPKA 5EAYA 1DO0A 3LFUA 1UE5A 5G40A 3GDEA 1QVFA 3C7KA 1X86B 4LF9L 2QENA 2QN6A 4JYBA 2XXAA 3PCRB 1QVAA 1E1RA 3C16C 4BE7B 3K0CC 4ESVA 2GILA 3I55A 2A5YB 1E2LA 3D7MA 4X66L 1OV4A 1N34L 1CU1A 3BERA 3EC1A 2VP4A 1T9HA 5IYBG 2WMOB 2XNSA 2QP3A 4M4SA 1UKZA 1YRBA 1VQJA 3DVLA 5F2EA 4CDGA 4OI0A 4P75A 3VNUA 2E2IH 1X3SA 1YU9A 4DLUA 1D8TA 5E3HA 4TZ6A 1E96A 1WB9A 2FPKA 1KI7A 3CCLA 3RC8A 1JALA 4A3CG 2KBFA 1Q46A 3VX4A 5AJ3Q 4TQ9A 1OHHD 4DR2Q 3H0GG 1W48A 2ZAOA 3C14C 4L5BA 3I8XA 2O8DA 4LFCQ 5J4VA 3LVQE 3H3VI 2BV3A 2AKWB 2HJGA 3ZVMA 2F7SA 4JI4Q 4LX0A 2F4VQ 4XVQA 1RZ3A 1EXMA 3QJYA 3TNFA 2ZANA 1FJGL 2ZEJA 4II7A 4EIWA 2WKPA 1G16A 3QE0A 4TSFD 1CEEA 2EXDA 2ZI3A 1D7QA 3J7ZC 3LA6A 4J0QA 4ASUD 3U44B 2VZAA 1PLLA 2ZRGA 3IQWA 2DGYA 5C4MA 2GJKA 2OM2A 2VP0A 3UMFA 2GKSA 1QVRA 4O2DA 3CRW1 3EZ2A 2Z6KA 4I1OA 2FJUA 3KYHC 1T8UA 2EFDB 1OIWA 1N32Q 1R2QA 1Z0JA 4KBFA 3UG7A 4DLRA 2HIXA 1JT8A 3VKGA 4FINA 2CCZA 4FN5A 3TQCA 3T53B 4D4MA 4B47A 1A2BA 1GTVA 4TYPA 1L1OC 2ASBA 3HGBA 1LB1B 1YJ9A 2R92H 2IYQA 3B78A 3IPXA 1DPFA 3AF4A 4P4UA 5HGQA 1JEDA 1SHZA 4C9BA 1KK2A 2IYYA 4F4JA 4OO1H 2MNAA 1VQOA 3EPHA 4A3BH 1N36L 2GJAA 1M8PA 1WFQA 1E2MA 1W2HA 3WYGA 4TL6A 3CCEA 3AVQA 5JECA 5LPNA 3CC2A 4DLVA 5D3MB 2B6HA 4Q9HA 1H8HA 4URUR 4A92A 1GUAA 1XNQQ 4XH9B 1Z0IA 4LHXA 3R7WA 1ZNXA 1D2EA 2UUAL 2BM0A 4AURA 5DI3A 1I3QH 1CJKC 3S1QH 2YC4C 4MGZR 1O7LA 4HDQB 4P71A 4GKJQ 1EK0A 4KAXA 1EQQA 5FBLB 3FFAA 3T06B 3LBNA 2E5LQ 2MMCA 3A36A 5TMPA 3HOZG 4PHHA 1K5DA 4XSHA 4QJ3A 1Y1WH 3ZJYC 5CITA 1G5PA 3NTUA 4M1SA 5CIWA 2A30A 3TQFA 4TYYA 2YWFA 2RGAA 4E09A 3CPEA 4IQZA 4UP7A 2NVYH 4RD0A 1VQCA 3CPFA 3K70B 2QP9X 3FYHA 1F2TB 1IYUA 3TUZC 4L5RC 1H95A 2XSZA 3NHAA 3R9IA 2PT5A 4EFNA 4LUVA 3D31A 3A8IE 1G3RA 1F5NA 3UXMA 3VKHA 4NYMQ 5GROA 1XMOQ 5JBQA 3NEYA 4DV6Q 3C4JA 4ARZA 1HURA 4ZDKA 3W8NA 1DAGA 2HHHQ 1B0UA 1L2TA 1ZRHA 3KQKA 5JEAG 3K09C 1ANKA 3TIFA 4ABYA 2VF7A 2ECKA 1FVIA 1H9SA 2IS1A 2UXDL 1GKYA 1GRRA 3FKSD 1BBUA 5G41A 5JCZA 2BMEA 5KDDA 1SFOH 1CKEA 4PMWA 2R93G 1XJCA 1YZQA 5M5YH 3EIVA 3PUWA 1E1QD 1G19A 1WP9A 4QHYA 3TW4A 2FFHA 1JQJC 1ZC3A 2UZ3A 3THYB 5C3EG 1WYDA 2E74C 1IW7D 4A3EH 2BCGY 2DHRA 2WM9B 1NMZA 2CE7A 4OQFA 1N6PA 3GD7A 2XEXA 1SN8A 1SVMA 1YRAA 4DCVA 2W2TA 5CK5A 2E87A 4OQLA 4GN3B 5IP9H 1DE0A 1P2SA 2DFNA 2DFLA 2EWVA 5FTMA 3L8YA 5SZJA 3V9PA 2W00A 1NVVR 4RD2A 1GFIA 3CD6A 4ITRC 1ZIOA 3LW8A 1OHHA 3MLEA 4QHTA 2O5VA 4DLXA 2VW9A 2XTNA 3CRMA 3MSXA 1MABB 1Q22A 4TTQA 3U3JA 4BZQA 3HOYG 4KBGA 4Q7KA 5E7MA 5AUOB 2VHUA 4HI0E 3VKWA 1HNWQ 3A37A 4XOIA 4C2UA 1X1SA 4G5OA 3KDFB 1H8ED 1KDTA 2XJ9A 5FUXA 2PMZE 1KSJA 2FE4A 4K46A 2O8BA 1X55A 4HAWA 4TSFA 1SHKA 2V54A 1WJJA 4BECA 5DE3A 1YEZA 2ATWA 1UBEA 1QDEA 2KI5A 1BDOA 1N6NA 4KV9A 3AQ4A 5FPSA 2FNAA 1WCMH 2RHSB 2F1RA 4X8LA 3EZ7A 4IRUB 4D2IA 1KHIA 5FUWA 3R9WA 1Q57A 4DKAC 1N6RA 2QM7A 2K14A 4G7OC 1VDZA 4P4SA 4RKFA 1O7IA 4OXPA 2CLSA 4YMVA 2LXJA 4TYWA 1YZGA 4DSNA 3R9XA 4IJLA 4M1MA 1CJVC 2WKRA 1GVNB 3QF4A 2BJWA 3CX8A 4Q4JA 4AIIA 4B3FX 1T91A 3T1TA 1BBWA 4Q21A 3FHCB 4OHVA 3FP9A 3T15A 4UP8A 2WTUA 2J3EA 1RIFA 4Q1CA 1IY2A 1LM0A 4AQYL 4A8JA 3E9IA 2UXCL 1N6OA 3QIAA 3U9SA 4NMMA 1FOEB 1KK3A 1RRGA 3SZRA 3DM3A 4IEEA 1P5ZB 1FTNA 3CW2C 2FSGA 2UKDA 4BY1H 2C9YA 4PSKA 3VU9B 2D0PA 2C04A 2RGNA 2ZS8A 4A3DH 3I1FA 4XIGS 3T1HL 3K0AB 1QZXA 5H1YA 3WNBA 2RKOA 4NYJR 3P26A 5FFMA 2J46A 1HNZQ 1ZD9A 4B3BA 1KJWA 4UKDA 2EDGA 5FOXA 4MGKR 1VQDA 2FV8A 3GO5A 5EP4A 2V9PA 2O52A 1KDOA 3ZH9B 4EPYA 3U4QA 1P9WA 4Z8YA 3K0SA 1HNXQ 5EP3A 4O2RA 3SDZA 1JJCB 2ORVA 3I72A 3L8ZA 3TUIC 2AUKA 1BH2A 1GRQA 4DV0Q 3RNLA 1KIMA 1HUQA 3DM9B 1D2MA 3QKSB 3TLXA 1XZPA 4C7OA 4Q19A 2VL7A 3RS0A 4URXR 4DDVA 4GS3A 3NDBB 3K0FB 5LMUL 3QVUA 3U7HB 4A1FA 2FDCA 4XSGA 1II8B 5E7NA 1MO3A 2A1AA 2ZUCA 2I1QA 3Q9LA 1SGWA 3M3YH 4L15A 1CKNB 1BVSA 1N0WA 1S96A 4AKGA 5G3YA 1HE1C 2QA5A 3T56B 4C0BA 2QROA 4JLAA 2PZGA 2ZT9C 2LSSA 4H02A 1GL7A 4ZO4A 4Q9JA 5LB2A 4OWXB 1SR3A 2QTHA 5KSYA 3NE5B 1SZPA 2JLYA 1TXYA 1CJUC 1E1QA 1VQPA 4DCSA 4H13C 3ZS9A 1JJVA 3UE0A 1XPUA 4PANA 3I73A 1NIJA 3PEUA 4N3NA 3ZS8A 2P67A 3V4RA 4YDSA 5FTNA 4A3FH 1K73C 4DK6C 1JXOA 1Q1BA 4KKSA 1RPZA 4LYJA 5M5XH 1EFRD 1JXMA 5BR8Q 2IK8A 5IY0A 5JEEA 1E2KA 1K8AC 3AP1A 1E32A 1N5LA 1ZM7A 2IXGA 1NN1A 1N33L 1ZU5A 4B2LA 1W36B 4H9GA 4DLSA 1TNDA 5TDHA 4GOPA 4PAOA 1H8EA 5CM8B 1QHNA 2ZYVX 2ZJYA 1CJMA 1W47A 2REXB 1YNNC 1TX4B 1WQ1R 4B44A 3G4SA 2BMDA 4DR7L 4GLXA 3ONWA 1B9NA 4X65L 2Y8EA 2V3CC 2WOJA 3PVSA 1HQYE 4JK1C 4U00A 4LYFA 3ZVNA 1N5KA 2AK3A 2GJ9A 4OYHA 4CT4B 2VUMH 2A5DA 3QKUA 5LMNL 3KF6B 1OSNA 4LJ7A 1N0UA 4DV7L 1VQNA 4BBSG 1DS6A 1NLFA 2A69D 1XCMA 1R5BA 4TTRA 4CEIA 4NXMQ 1A82A 1UE1A 4GN4B 3EW9A 3VTKA 4A3KG 1SXJD 2H5EA 2XXAB 4DK1A 1QZHA 2ZJOA 3P4XA 4B3RL 1AS0A 4QJ4A 2H1LA 1XNRL 4LF5L 3QEOA 2A5FA 3FGNA 5GQOA 3Q72A 3B1XA 4YWLA 3TBKA 1UDXA 3F5FA 4DSTA 2WWWA 4JYCA 4F7WA 2PLRA 4JS0A 4IJMA 2IXEA 1CP2A 4MQBA 3U3KA 4GZMA 2KCMA 4A76A 2OSBA 4TL8A 4Q47A 2YWHA 4EUNA 4LWCA 4M1YA 3LO5A 1TEVA 1R9TH 2IX3A 4MRRA 2W58A 1TUIA 1OLOA 2A5JA 1Q7YC 4HATA 2JASA 4D4LA 2O8DB 1Y3AA 3TR0A 4A93G 1YJWA 2R62A 4K81B 1A63A 3H0GH 2IWHA 3KLWA 3TSZA 4YCWA 1OPXA 3SN6A 3UG6A 2LXKA 4Q4AB 4ME3A 1CR4A 2FXQA 5JJIA 3PXGA 5JS8A 2NTYC 2ZETA 2J7KA 2Q3HA 3KX2A 1T3SA 5AUQA 4EFLA 5EE0A 3I4LA 2PX0A 4Q1FA 5IT5A 5FLMG 1RW4A 1KHTA 4RD1A 1B70B 3WMFA 2PQAA 3GEIA 4PC3A 4IDNA 1CULC 3CF0A 4UP9A 4LUCA 4Q4LA 3LY5A 3U4VA 5HZHA 3GTKH 1XD9A 2WJGA 3IBGA 3TAHA 1YZ6A 4ZDWA 1G291 2RHMA 4D82A 1Z7TA 5GAEC 1XMIA 4NYMR 4NPSA 4L16A 4UQOA 2ZXUA 3UK6A 3HOXG 4DR3Q 4IFDJ 2BEJA 1XBTA 4V0NA 3KJHA 2DFTA 3B5JA 1EFHA 1E24A 4LV5B 5JJLA 4CZ2A 5JZVA 1SROA 4LF4Q 2N78A 3F3YA 5C0XH 5DYGA 2BH2A 2B7CA 3HOUG 3FVQA 4ZDIA 5GAGC 5JI3E 1AK2A 1GNPA 2MO0A 3AUXA 4YCUA 3GJ8A 3GJ5A 4DVGA 1KAGA 2RGDA 3SE0A 1BIFA 2PBRA 2DNCA 1VQEA 1Q8KA 4JI3Q 1PJRA 3QQ5A 4OQNA 3R7WB 1W0KD 4O3MA 3AP2A 3CQZH 2VPPA 5J4LA 5DI3B 3BH7A 4NYIQ 2GXUA 4X62L 2YC2C 3T5DA 4TN1A 1I2DA 2C35B 1ODFA 3P32A 3PSIA 2JEAI 1HA3A 4PPFA 2CDNA 1OTCA 5IYCG 5C4XG 4PZZA 2EU8A 4OQXA 4TMTA 1UKVY 3RR5A 1ZW6A 1PA6A 5HTKA 1HZAA 5FPTA 2CBZA 4LC0A 3BU2A 4H1VA 3K53A 5CM9C 2A8VA 2OCAA 3NELA 3L0SA 5AWFC 4BPBA 2B63G 2IUTA 3OE7D 2DYKA 3ZQJA 2UU9Q 2HXSA 3P4YA 3EC2A 4E22A 2HLDD 4MNOA 4UNSA 2GF9A 2KCCA 2QUZA 4G5QA 4EDHA 1U99A 5DH9A 4DV5Q 5FOWA 5IP7G 2X19A 4AK9A 3UPUA 2GEUA 1AGPA 2ZTSA 3NENA 4ZV4A 5D3MA 1E9RA 1FNMA 1E2JA 4DWJA 4YWKA 4C0JA 1R8SA 4TLBA 1G21E 1B7YB 3IO5A 4B34A 3PGZA 1IBKL 4PPNA 2Q21A 2A68D 5GJCA 3J81k 3I61A 2BE5D 4A9AA 1RRCA 1IN7A 1TADA 2XB2A 1CR2A 5JEAH 1H9SB 4MUBA 2CL7X 1M7BA 5JHGB 4LJYA 4JSTA 1IBLQ 5SZIA 2O0HA 4E07A 2KHIA 1W4CA 3U3MA 3K80C 5L3VA 4P31A 3VR5A 2PL3A 2E2JH 1XD2B 2FOLA 4PTLA 1TF5A 3JVUA 4XWAA 4GLVB 2NQ2C 2QORA 5TARA 3DMDA 3WP1B 1JR3D 4R1JA 2AHOB 4US2R 3GLHA 1G41A 1TWCH 4HSEA 4IFEA 4PO9A 4IFDG 1I6HH 1DXMA 3KKMA 2VHCA 1ESNA 2ZRIA 1R0YA 5FH9A 4AYBE 2RB4A 4AWXA 1UDWA 1W3SA 2A6HC 4HB0A 1NBMD 4G5SA 4KJZA 3H94A 5FOVA 1T5LA 3K9LA 4JI7L 2YNMA 3C5HA 1G64A 1MO5A 3D3QA 1SVWA 3HOYH 2JLXA 4R9UC 4RD6A 2O8BB 1II9A 1ZAKA 3P1JA 2I5MX 1F6BA 5EE9A 1MR3F 3B1VA 3IUYA 1GM5A 1S3GA 1SXJE 4IPHA 2G0NA 3J80c 3ZZUA 4JMPA 1JQLB 3TZUA 3K70C 1VQ7A 2JE6I 3WHLA 3TKLA 4XD7D 4B3DA 3V4FA 1NRJB 3AVTA 5IYDH 1U9IC 5BN5A 1NIPA 2CLCX 5JWHA 3GLHE 2VQEL 1Z6TA 3KXIA 3VNVA 3CF5A 1Y69U 1XTSA 3CPJB 1FW6A 3NVAA 2ZI5A 4NDZA 1W7AA 3IEVA 1E7ZA 3GJ3A 4UY8C 3F0TA 1YKSA 2A3RA 2ZROA 1K8GA 1IBMQ 3LXRA 3OIVA 2PI2A 4M1TA 1LV7A 4JI0Q 1U8ZA 1YZNA 1MABA 4GOJA 4LV8B 1NVUQ 1GNQA 2BA0A 2CKZB 1VQGA 2BMJA 3WBKA 4FCTA 5TXGA 3TUJC 2EVWX 2ZJ2A 4KN4C 2WWIA 3AVOA 3CRVA 3I5XA 4IDPA 4Q7MB 3AP3A 4RZUA 4WIAA 3THOA 4NXNQ 4KKTA 2PH1A 1MV5A 2D06A 3KQUA 1AKEA 1ZD8A 3F2DA 1SLJA 1W0KA 4UNPA 4WXPA 1TUEA 1G6PA 3SOPA 1XJQA 2V7QD 4A0RA 4B3SQ 1F2UB 4RFSA 5JWOA 621PA 1A6XA 1Z06A 1UEJA 721PA 2BA1A 2OFXA 2K5UA 4P33A 5FBRB 1BS1A 3GFPA 1GIAA 1IBLL 4POAA 4BBRG 3QEJA 3G82C 4O0AA 1PH1A 2V4DA 1H9RA 3U4QB 2QBYA 2KHJA 1S3OA 1AS2A 1GAJA 1L4UA 3SHFA 3J80i 4MTNA 3OAAD 4LGMA 5EUMA 2EFGA 2W0MA 3TREA 4HLUA 3OPOA 4V0LA 1R0ZA 3OE7A 2WJHA 4W5JA 1IZ6A 4KKUA 1UKYA 2JAQA 4EKDA 2XTIA 4DDUA 2R7ZH 2HLDA 3HP1A 3GTJH 1G7SA 4I99A 4TLEA 2VQFL 2R9VA 2D2EA 1WBDA 1NLZA 2F3RA 4D26A 4DR4L 1P2TA 1OF1A 2GK7A 3JZMA 1BMFD 2PLFA 4L9SA 2Q2HA 5BWMA 1XTJA 1V9PA 3FKQA 1KIXA 4TKOB 5JMTA 1E94E 3BJIC 2VP5A 3EARA 3WRXC 1IN6A 3JZAA 1ZM9A 3SU8A 3I7FA 4PPGA 3REFA 2AK2A 3ZGXA 4YCVA 4QGFA 1DEKA 2FZ4A 4BZXA 2AWOA 3TW8B 2OG2A 1HT2E 5BYJA 4AYTA 5JRZA 5M04A 2FH5B 4OJKA 5FPYA 5BYKA 1U0JA 4B43A 4HIDA 4PXAA 3HOWH 1MH1A 1RFLA 4HDOB 1W2BA 1TL7C 3HU1A 3ZQ6A 4LF8Q 2XTZA 3QPWA 4CIDA 4DAMA 4KYUA 1V43A 4HJ7A 1AE2A 3J81j 1A7JA 1ZUIA 2Z5FA 1LYLA 1KTVA 2D7CA 4PPQA 3CCVA 2PEZA 3STBC 2C8VA 2JA6H 4LFAQ 1HZCA 4LHYA 1MJCA 2PNHA 3CC7A 2WICA 3CRRA 2UXBQ 1M74A 4LPKA 4EX5A 5DSZA 4TYNA 1NBMA 1K8MA 2XNDA 4O25A 3TAUA 3ADCA 2V6IA 2QGZA 3RS5A 4A3LG 3BWDD 1NVXQ 2IHFA 2PMDA 4KLZA 1CJTC 3W5JA 1Q90A 5DLQE 4GOPB 1G7RA 2REBA 2ZSAA 2UUBL 1K6MA 2F1HA 1E9BA 5FTLA 4JOIA 1VTKA 2PCLA 5DI9A 3GCGA 4QNMA 3FDIA 4YC7A 1ZBDA 2IYWA 2LKCA 3CH4B 4EPWA 3RNUA 3PUXA 2JXMB 3KXKA 2NN6G 5KSPA 1W46A 2OCYC 2JLZA 4BRWA 2F55A 2OO7A 1XJ0A 1A8VA 1JR3E 1QG2A 2OAQ1 3MWJA 4CEIB 2DPXA 4U02A 3SGIA 4OX9Q 1CRQA 2ZTDA 2O8EB 2N3SA 2AUJD 4BEJA 2I1VB 4BFUA 4JBYA 1U8YA 2B8WA 4KHPQ 4DR6Q 3B1WA 5DYIA 5F9HA 2WB1E 2AN9A 4LHZA 5J4KA 3CWQA 2QT0A 4HB4A 4GT1A 1PLJA 1NBME 1ZMXA 2R44A 3KTAA 4Z1MD 1X9NA 3THWB 2JQOA 2OT3B 1P61B 2WMNB 3C15C 4MRSA 1TF7A 5KDLA 3SFZA 2AMCB 4A3IG 1SKQA 4DB2A 2R6DA 1OXTA 1NY6A 4OGQC 3I4MG 2JDID 2VHJA 4L9WA 4E5UA 1Y1VG 1OXSC 4B73A 4Q9KA 2JA7G 1YIJA 2UVQA 2E9SA 4RCYA 2HQLA 5FUVA 1KI4A 1O3YA 2V7QA 4UJ3A 5FTJA 3W6NA 2QGQA 4L5QA 1G7CA 4BA1I 1E0SA 1RRPA 3AVUA 4ZCMA 3HPQA 4HB2A 4LF7Q 1VKJA 3KF6A 2RF4A 4X8HA 5G3ZA 4IPCA 3TS2A 1E3PA 1WRBA 3KZ1E 2FEOA 2B3GA 1Y8NB 2W6JD 1IN5A 2RHQB 1U81A 3FMOB 5DGXA 2NMVA 1N5IA 2ZJ5A 1W36C 2CK3A 3MEFA 1X6VA 1V5WA 3MAAC 4R2HA 4RFVA 3RS7A 4A6XA 4NH0A 3OAAA 2PQAB 4DUZL 3U3OA 2K32A 5KNDA 3JAMi 2A5GA 4KVAA 4WXRA 1PYSB 2ZJQA 4JI8L 1D9XA 3MCAA 3RZDH 4I7ZC 1VQLA 3TEHB 3PIPA 1EFTA 1LF5A 3F8TA 3GTOH 2RGGA 1VG1A 3NH6A 4AY2A 4IPDA 4LFBQ 1QHIA 3S17H 2OBNA 1IBRA 1J99A 4JLNA 3M1IA 2EFEB 3T51B 2QRZA 2R65A 5M3MG 3X2SA 1J8YF 1GG2A 3ERSX 5EE5B 1H65A 4AKHA 2YHSA 2JEBI 4M9QA 1XRJA 1BMFA 2NPFA 5FJ8G 2WPDD 4YWMA 4P0TA 2YTXA 3BORA 2DBYA 5GADl 3HOXH 2K50A 1TU4A 4PQYA 3A8TA 3K8AA 2PNRC 1E2GA 2VRWA 1TEXA 3IGFA 4E03A 1S1CA 2IY5B 4Q4AA 3WDNA 2GAAA 3T35A 1XEXB 4P32A 4BY7H 1US8A 3AF0A 3HOVG 1DARA 1X3FA 2CCGA 1U8AA 2ZR7A 4TQUS 2ZTEA 3W90A 4A8JB 3AH8A 1CKOA 4D6PA 3CCMA 3GLIE 4ZCLA 3DXJC 2H8KA 3HDTA 4C3JH 1ZVQA 1G8FA 5G53C 4FIDA 4OWTB 3B2EA 1EWIA 1ZYRC 4IFDI 4X64L 1R7RA 4CEHB 1IY1A 2UUCQ 3NIBA 2XZLA 4OX9L 3OW2A 1FPMA 2GVDC 4C0LA 2GEDA 4F4CA 3T1YQ 2EQBA 1XDBA 2ZJZA 1L7VC 3X1XA 3WNDA 1E2IA 4H1UA 3E5HA 5C4XH 5IYCH 1ZJ6A 3TVDA 5CLLA 1T5IA 2IX1A 3I4NG 2IS2A 4BXXH 2CXXA 4DV3L 3AGQA 2GCPA 5D3QA 3AV0B 4DR1Q 1VHLA 5TY0A 1WE2A 4IVQA 2FPMA 2TMKA 4V0OA 2AD5A 3BGWA 4D0GA 2PT7A 2MSDB 1P75A 3RLNA 2IHYA 4LNQA 1MO4A 3HU2A 3OIYA 4I1UA 2R6GA 1R4AA 4F4IA 1CI3M 3M9BA 3IIJA 4RD3A 2BKEA 1LY1A 4P3YA 2YKGA 1Z9FA 2Z6KC 2V55B 3D0FA 1C4OA 2QG6A 4Y0VA 1XXHA 2DWOA 1CSQA 4MYCA 4PO8A 1OKKD 1A62A 2JK8A 4XTRA 4R7ZA 2ONKA 3CH5A 2JJQA 1ZNWA 3F2CA 4JLBA 1N6IA 5FR1A 5B30A 2J0VA 4LI0A 4A3JG 4POGA 2JA8H 1SXJB 2IYTA 2ZRMA 3TE6A 2CNWD 3H3VH 3PF5A 3B6YA 3IIKA 3ZZ0A 1SVKA 2ZSFA 4KVGA 1A1VA 1M1YE 2V4ZA 2ZVPX 4Z1MA 1AS3A 3EA0A 4EQ6A 5DN6D 5GVRA 2QAJA 2LMCB 1LF0A 4D81A 2GN5A 3PO2H 1TF2A 2Q2TA 3GLHB 4FXPA 2JDIA 3ECCA 3ETLA 3L82B 5FL7D 3CIOA 1VMAA 3M4PA 2C95A 4IDQA 5C4JH 1G51A 2FU5C 4HIMA 4G1UC 2BBSA 1MRNA 1G17A 421PA 4RSGA 1R0XA 1XXHE 5AJ3L 2RHDA 2V1UA 4DR2L 2ZSBA 4LFCL 1U5KA 1M6NA 1E0KA 1XEWY 4ZI3A 2Q9CA 4D25A 3AKCA 2W6JA 4D4JA 4NPHA 4Y0AA 1M90C 4FMCB 1VYTA 1LTLA 2Y0SG 4JI4L 3S24A 2F4VL 3UIEA 5F3WB 2DNEA 1P8LA 1X3GA 4JI1Q 5M3FH 1G4AE 1NN5A 1FL0A 3S14H 2VQSA 3E9HA 2K7VA 2AX4A 3B9QA 5HCIA 2FZLA 2RGCA 2F9LA 1XD2A 4JJZA 3T1QA 4AKEA 3RWOA 4C3ZA 221PA 2MFIA 1Q81C 2IF0A 3KXLA 2W6ID 2VSXA 3DLLA 2C5LA 2FSHA 2J45A 3DOFA 4I81A 5EZ5A 3RC3A 1N32L 4YHHQ 2AHOA 3I5YA 3T1YL 5EE1A 1DBSA 1EGAA 2J87A 2AWNA 1BYUA 5IHPA 4JVLA 4A2QA 4JBXA 1DAMA 4Z51A 2H7VA 5KPJA 1NG9A 3HWSA 3U60B 4Q5IA 2GBLA 1VIYA 4DR1L 3KFVA 3HR7A 2EJFC 3X1WA 1G8GA 2ZYWX 5AJZA 3S1AB 3GPLA 2XGTA 2R6FA 3UDXA 4NB3A 2FPLA 2V6JA 1HZBA 3HKZE 3G48A 2BOVA 4LK2A 3GTMH 3BB4A 5B57C 4KCGA 2ZUDA 1ZM2A 2QAGB 4WOPA 3A5UA 2NIPA 3RSOA 1ASYA 1X54A 4ASUA 3A8JE 3FB4A 4RFSB 1P3JA 1XNQL 3ASYA 2A7QA 1NKTA 4WZBE 1VIAA 1IXZA 4M53A 4LF6Q 1W0JD 1P60A 1W44A 2BJVA 1NL3A 2Z43A 2OTLA 3BS4A 3KKOA 1UAAA 2JGNA 3VR2A 1HTWA 4GKJL 2HV8A 4JVSB 5FI1B 5B64A 5L3RA 2E5LL 4IOAA 5C18A 5IE8A 1RIPA 1OH8A 2QBYB 4BBRH 1F60A 1BKBA 1HQMC 4QBGB 2Y0SE 4UNQA 2YINC 4LUOA 1KOFA 3TGPA 1T0JB 4JKIA 4KO8A 1A5TA 3K7UC 1CBUA 1MJEA 3WRYC 3A1VA 3LXXA 2ANBA 4NKRA 3ZD6A 4LYHA 1YZLA 3I2ZA 4M21A 2NN6I 4HAXA 2K33A 3A7AB 4IO9A 1JR6A 2VY3A 4HJ9A 3RS3A 3HPRA 3QBTA 5ELNA 3T1VA 4YMSA 4PV1C 3ICEA 1MIUA 3GLFE 2JA1A 3VAAA 2C2HA 2A6ED 4HJ8A 3NKVA 4ESHA 4MRNA 1XMOL 2JJ1D 3PEWA 4DV6L 2Q9AA 2CMKA 3CCUA 2CW0C 1F2UA 1GUOA 1YR8A 2HHHL 4DT1A 1ZP6A 3BE4A 1YNJC 2QZ4A 2PPBC 1N6LA 1XMVA 4TQAA 2CNWA 4C4PA 1PH8A 4PZ8A 1QVCA 3A1SA 4C2MH 4JI2Q 2RAPA 3CZQA 3E1SA 1F3OA 3OYYA 1JAHA 1J5EQ 4MGYR 4BLQA 3RSLA 3IO3A 1DD2A 1ZU4A 4DV2Q 2QY9A 4L8GA 5KHOC 2HYDA 2IUSA 2Z0SA 5DN6A 2UZIR 3AFPA 3RS2A 4PFSA 3SBEA 3Q5EA 3LBHA 3QY0A 1DAEA 3LV8A 3GJ7A 5FL7A 2ZJPA 1DAFA 4MKHA 4QXAA 1IAQA 2P2LA 4DDTA 2DFKB 2KA7A 2RGNC 4NE2A 3GJ4A 3IKJA 1KDPA 1T3HA 3QKTA 2O8FA 1FFHA 1NNEA 3FKIH 1U2RA 4BLTA 4BLSA 2P6RA 1GL6A 4OI1A 2ZE7A 1R8QA 1OH7A 5AUNB 1I50H 1VCIA 1N6HA 1Q3HA 1PH7A 4TLAA 2QP4A 4AYWA 1HNWL 1L4YA 1Q0UA 2CHQA 5AJXA 3U7GA 2F43A 3BFVA 2AD1A 2JLVA 1JJ7A 3FKSA 2FFBA 2J0QA 3CP0A 3CX7A 3IHLA 4CVNA 3LX8A 2QMHA 3NHBA 1TKWB 1YHQA 3GFOA 3QXCA 4KODA 4B3GA 4Q48A 1PFSA 3KLRA 4H0LC 4N0DA 2JJ2D 2W6IA 4MH0R 1R5NA 2Q8IB 4US0R 4HYYA 3VQTA 3QPUA 1L2FA 2J1LA 3PO3H 3U6KA 1XD8A 2XZOA 5GJWC 1ZKOA 2NZ8A 4JV5Q 4WJ3M 5DIFA 4FMDF 4A75A 2P3SA 1SKYE 2X2FA 1H9KA 4YY3Q 3OTOQ 1KI3A 1P62B 4QIWE 2Z83A 2BBTA 3KTAB 4JZKA 4LOAA 4W5WA 4Q9LA 3M0EA 3L0IB 1XWIA 4LBYA 2KSQA 1OYYA 2E76C 3BXZA 1P9NA 1P72A 1XNJA 3WMEA 3BH0A 5AJVB 1I5FA 2WJYA 4B2IA 1VYVA 1YR7A 4FMBB 2XGJA 2YYZA 2G3YA 2R6AA 5FBVB 1IW7C 2ZRBA 4MRPA 3AVXA 4EQ5A 2BVNA 3MJRA 2ZVQX 4FD2A 3TVTA 3QPVA 3EPJA 3WYAA 4KLNA 1XMQQ 3RLOA 1Z2AA 2QEXA 1YE8A 2WAYA 3THXB 4POFA 2L15A 4L8JA 1TWAH 4R4TA 3CNNA 4ERNA 4NP6A 4B6FA 1J6QA 3LAWA 2CWAA 1VQ6A 1HNZL 2AKYA 3EA5A 4JVNA 4K8OA 5L3SA 2O8EA 4B32A 3F2BA 4IJHA 4K0KQ 3DO6A 3GLIB 1H9MA 3ULLA 4DUYQ 4GOPC 3OEED 4QBHA 1K3RA 5JSZB 1K5GA 4IOMA 3CNLA 4B3CA 3C8UA 5LD2B 2IYLD 1KXLA 1YVCA 1HNXL 1KJZA 3EASA 2MQHA 5M5WH 1U94A 2WJJA 5JFGA 3THWA 1HR0Q 1OYWA 4DLYA 4BFXA 3Q5DA 4DV0L 1I4TD 1EYGA 3ZLJA 1HZ9A 1IY0A 2G77B 3KKQA 5IYBH 4KITB 4OJQA 1EOVA 5M3MH 1LS1A 1X8JA 4JC0A 4LZZA 1C0AA 1E4YA 2L0XA 4MKFA 3S15H 5BXQC 2VS1A 1OFHA 3CO5A 2FSFA 2JJ1A 1Q12A 3IRBA 4R4IA 4A3CH 1A4RA 1QHXA 1W4AA 2ZS9A 3AEVA 2D7DA 3JC66 3BBPA 3UANA 3L0PA 1GVPA 2QSYA 4BFWA 4EPVA 1Z47A 3HFZB 1COWD 2VEDA 3P20A 1NMFA 2VYFA 3CZPA 4GI7A 2GJ8A 5EXXA 4PHFA 4DHEA 3A1UA 4LUZA 1US8B 2EJMA 1GUNA 1G8YA 1LW7A 3DZ8A 3LBIA 2RGXA 1VF5C 2N1BA 4A2WA 4BRUA 3QKRB 5H70A 4L5SA 1YI2A 2ZRFA 1PV4A 3VR1A 4KHZA 2OTJA 3RZOH 5E4FA 2DWQA 1OFTA 3P27A 4M9ZA 3CR7A 2BH8A 2WHXA 1PH3A 4C3IH 3WNCA 1DVRA 3AEZA 3THXA 3K8YA 5BR8L 1RYFA 3E2IA 1GSIA 1XP8A 3GTLH 4F93B 2QM8A 3OESA 3A58B 1FX0A 5C44G 2F3IA 3G6EA 4DC9A 1ZM4A 3W34A 1SE8A 3LQRA 1K9MC 3RVBA 3MWYW 1GITA 5EJEA 2HIVA 5K8UA 5ELOA 4BLOA 3LGJA 1PUJA 5CJPA 2GXAA 4Q1BA 4QM6A 2K52A 1E22A 2P65A 1J90A 5FOTA 3T61A 1VQ5A 1ZM3A 3KOJA 3CRLC 1JE5A 4KU4A 1KI6B 4YXWD 3R8CA 4GPTA 4QL3A 1XEXA 4QY7A 1Z3IX 2AXPA 3GTPH 1XXHB 4GSYA 1P73A 2RMKA 3CBQA 2VHTA 4MDFA 1GO3E 1RJ9B 3LNNA 2BMFA 4FWIB 2JJ2A 4DNTB 2QE7D 1I94Q 2O5JC 3CLVA 3FMIA 4XVRA 3ND9A 4L5TA 3MD0A 1PH2A 3KKPA 2PCFB 3U50C 2FSIA 3HYRA 1XU4A 2V1XA 4QG7A 2O8CA 4CEHA 1IQPA 1FGUA 3H84A 4DSUA 4DAYB 4AYBG 1EFRA 4MYHA 1LACA 4NXML 1GD7A 2XX3A 1ZD1A 1HEIA 1AZTA 2CCJA 2OQ0A 1S9HA 3UDFA 1ZUNB 2ZM6Q 3HOZH 2OBMA 1LNZA 5GAHC 3T5GA 5H8WA 4JBJA 4EQ6B 2ZE6A 1KK0A 1D8LA 4JL6A 3SS8A 2QQ0A 1N8RC 1AZSC 4B76A 4LJ9A 4XWKA 4ZPXA 1J2JA 1HR0L 3AYHB 4JBKA 1VG8A 1FUKA 1N3BA 1AE3A 2CLDX 2QPAA 1PH6A 1SRUA 2WAXA 3RAPR 4WVFA 1VQIA 5DHAA 4A8JC 1FTSA 5CJ2A 1EWHA 3E0EA 3BFXA 5AK0A 2X1VA 1WCV1 3KJEA 4IKEA 1IXRA 4JI6Q 2NVQH 5IWAQ 4KLKA 1NY5A 1LTQA 3BIFA 5UKDA 1FNNA 3NEJA 3OFND 2XZPA 3CF2A 1X6OA 2ID0A 1E2ZA 2WSSD 2VNUD 4TT3D 2YTVA 4URWR 2GRJA 1CF4A 3W1BA 3HU3A 1NJFA 3K1JA 2R92G 1QHHB 2NO0A 2BIFA 4XVUA 3JVVA 3TRZA 3DM5A 1E9FA 4FW9A 1RVDA 1SXJA 4OO1G 1XF9A 4A3BG 3CCQA 2JLSA 2GK6A 3UWOA 2R93H 3O8CA 4V0MA 4IDOA 2V8OA 1RE0A 1NP6A 1HTPA 2ODBA 2RGEA 3LLMA 1KZGB 2GZHA 2NPIA 4JT2A 1OXXK 1Z0KA 2DB3A 1JPNA 1ZC4A 2GNOA 1P2VA 5C3EH 4Q03A 4JL8A 4JYAQ 3FWYA 1AN0A 3LWUA 2E1RA 4R98A 3UDGA 3IQXA 1VQ9A 4TZ0A 2QPTA 3N5CA 4LJ6A 4W9MC 4NTZA 1NG1A 3GJ0A 5DISB 4QNRA 4A15A 1E2QA 2ORIA 4ACAA 1UKEA 2IS6A 3IIMA 4LBWA 3FPAA 1PHJA 3X1DA 4DR3L 1NMGA 1KKMA 1VQBA 1COWA 1Y1WG 3KDSE 1AGRA 3PIRA 2VL6A 4LF4L 2J59A 4B3TQ 1G20E 5JHHB 5BQ5A 3U5ZB 3GLFB 4OHZA 4A4IA 4PZLA 2IL1A 4QM7A 3QSYA 3O8BA 4Q7JB 3KFXA 4V02A 1OB2A 2H57A 1EFCA 1KAWA 4A3GG 2QRNA 3BH6A 2VH5R 2F1MA 3T34A 1R5OA 4JI3L 2ERXA 5BN4A 4V0ME 1MT0A 1I94L 2GCNA 3EXAA 4FCVA 4OK3A 2DCUA 4A36A 1VPLA 1Z29A 1I4LD 1QHYA 4NONA 4NCHA 2QTVB 4IOJA 4KFRA 2GESA 2OLJA 1XMSA 4JLKA 2NG1A 3S2HH 2H18A 3I8SA 4DV1Q 3D4RA 1FMJA 1FUUA 2ZM6L 2PEYA 4HZUB 4NBSA 1AIPA 3LW7A 1XMJA 2NZJA 3GP8A 2JLRA 1ZCBA 3GJXC 3AVPA 1CXZA 4ZKEA 4B3MQ 3KJPA 5CLQA 3CCSA 1CUKA 1JMCA 4IW3B 4A4DA 1S2MA 1VCMA 5AJYA 3S1AA 1G9XA 2F6RA 4D4KA 2IS4A 2ZU6A 3S1RH 3M7NA 2UU9L 1T4GA 3L7ZC 3A1WA 2ONJA 4YXWA 4JKYA 1Z6GA 1Q1QA 3M6AA 4MGIR 1Z22A 3B85A 5HKKD 2IYZA 4NCKA 1KI9A 4DV5L 2VBCA 3VX3A 4PR0A 2OESA 4CW7A 4Q4HA 2EJGC 1N0VC 2QAGA 4RZ2A 1KY2A 3W6OA 2JCSA 2QE7A 4NL4H 4BWYA 1NSTA 5IP9G 1OFIA 4TL9A 2OILA 2ZR9A 1KNXA 1Q1ZA 4DT1B 3RN5A 5J5CA 2PJRA 1OIXA 4JI5Q 4DNIA 3KJIA 3VR6A 1YZTA 3WP0A 4A0HA 5C2JB 4DV4Q 4A0GA 3KJOA 3EIQA 1JBKA 4IFBA 4PO1A 3J81c 2FGKA 1Y14B 2KCTA 3GEHA 4N1AA 1HCZA 4UXHA 4R4CA 2DWPA 1W5TA 4CYMA 2OFOA 1I4DD 3B60A 5L3QA 1E2HA 4LW1A 3EWSA 4GBMA 4HIOA 2ZRKA 2O5IC 4LRWA 4A82A 1SKYB 5LBIA 3ULPA 1J8MF 1KMHA 4LJZC 1NMYA 1WCMG 1UBFA 3TRFA 2O8FB 5K36G 4JG2A 4FMDB 4G5GA 4X6AH 4MRVA 2R7FA 1LUZA 4PZ6A 1N6KA 4B6EA 5E7JA 1RKBA 4EPRA 1EG7A 3K9HA 2AXNA 3WHKA 3U6BA 2WSSA 4TT3A 5E7IA 2RGBA 1XEFA 2R7DA 4DLWA 2HCBA 1Z5ZA 1OH5A 2XOKD 1S3SA 2WIBA 4M0LA 2F43B 5AR1A 2HF9A 2J9RA 1VG0B 2WB1G 4QBIA 4S2EA 2LCFA 5C46F 5L8VA 4GNXA 1XZQA 4PC2A 4WZ6A 2NGRA 4HLUC 4AKIA 4JCVE 2E2HH 4JBMA 3A4MA 2YOHA 2E8GA 5KPDA 1GHJA 4Q1EA 4EJSA 1JR3A 1XCPA 3PJRA 3PIOA 1ESMA 5GADC 3SQXA 4BY1G 3RS4A 5FL3A 3Q8DA 3A0JA 1BOFA 1OE0A 2P5SA 2K4KA 4C0AC 4KFSA 4A3DG 3SYLA 5DLQC 4A6PA 2A68C 2QU8A 1ZINA 2BE5C 4KN7C 2Z6VA 5IRCD 3CF6R 2GETA 4Q00A 4TL7A 5FOSA 1K0RA 1IBML 2ZRAA 1UF9A 1KO4A 3GQBA 1UADA 2ZUBA 3IILA 4I1VA 4JI0L 2YV5A 4LF9Q 6Q21A 5HCNA 4B33A 3O8DA 2Q3MA 4HZIA 1FL9A 3TH5A 4F92B 3B1YA 4X66Q 1MKYA 2OAP1 1YR6A 3QUSA 1N34Q 2P5TB 2QTFA 2Z0MA 2WFWA 4AIMA 4NXNL 2IYVA 3IPYA 4PSVA 1QUQB 2KB0A 1UWVA 1HR0W 3EIHA 1L0WA 2RCNA 2VA8A 4XD7A 1UEBA 3RWMB 2G88A 4B3SL 2IEZA 3PENA 3SC3A 1E9EA 4TMZA 5JLJA 1EFWA 3RRNA 821PA
chains in the Genus database with same CATH superfamily
3L7CA 1FFXA 4R1SA 1WXGA 4YCNA 4WK0B 2PM8A 1M8KA 4B9WA 4EHIA 4QKQA 4D4LA 4PYJA 2PKEA 1B8AA 3TDNA 4YHBA 2WIDA 5H3LA 3TSOA 1ZHFA 2XGSA 2X7HA 4NDXA 4E3ZA 1PG0A 5AOAA 1XTIA 2BI4A 1OJ7A 4P1ZA 3NBYC 4OLJA 1GADO 1U8TA 2A2ZA 3FRIA 1ZEQX 2AR0A 5GAJA 4MTKA 1CG6A 1DG3A 2J30A 2C4UA 3BXXA 1UEIA 4MV6A 4U6NA 3ZX5A 2IU3A 4APVA 1PVDA 1H85A 3OP4A 2YZ2A 5AXDA 2FFQA 1R4NA 2J3JA 2B36A 3R9KA 1G8AA 2X9VA 3ZV6A 3D7SA 4M8AA 3TS1A 2FWRA 3TQYA 3IEUA 4P7FA 4URHA 2X4IA 3WKBA 4GR9A 2AN4A 1J8DA 2JEOA 2MIIA 2VRNA 1Z6HA 4RELA 4LRQA 4KYVA 4FYKA 2YY6A 3OCVA 5FYQA 2G04A 1JLLA 4QGAA 3JQAB 1YI8A 5IAEA 2C9OA 2C9CA 4EHFA 4GBJA 4C3UA 4EO9A 1SXQA 1RU3A 2HDNB 3IHTA 4TV8F 1SCUA 3I2KA 1G3MA 1SNQA 2Y1XA 1ULAA 1XZEA 2B21A 5BSVA 2O8VA 4F86A 1GDDA 2G08A 3L05A 3BRWD 4B5KA 4U4AA 4TPKA 5AI4A 1R64A 2DR3A 4O2AB 4WZBA 2VATA 4FDBA 4RH3A 2QD2A 1GGKA 4CRWB 4IIBA 1B2LA 4FGLA 1BJKA 4TWJA 5CVVA 3FHTA 1GU7A 1UQUA 5HPYB 5MHTA 1T34A 4NABA 1D9ZA 1U2TA 1I2MA 3DEHA 3UN1A 1O6ZA 4YV7A 3Q85A 4LJ4A 3GDGA 5L3QB 3R3YA 2H7YA 1C9NA 4Z4QA 2C58A 5KSZA 5D3DA 4PZ7A 2O1EA 5I7VA 1UBGA 1TIID 4PYQA 5I3ZA 3ABQB 3B3QA 5KAPA 3MS4A 3TLJA 4X65Q 4CU5A 1C7ZA 1A15A 4NCNA 1E69A 4RK5A 2C59A 2PUFA 4HGNA 4Y9RA 4OYLA 1TCAA 4KJXA 2BC9A 4TWZA 1K2VN 3ANMA 5BT9A 2VHEA 4MAFA 4UUNA 4DXAA 2J5RA 4ZD6A 1NN0A 1G6Q1 1ZHOA 1LSOA 3PDCA 3CVJA 1GVHA 4QGHA 3FKIB 3L5OA 4M99A 1Z0AA 4OGFA 2GEVA 3O95A 1I4HA 4KRXA 5FX2A 4RJKA 1DLJA 3MXUA 5BW8A 4R4QA 4BNNA 3NT2A 1XZFA 3ZHCA 1N5RA 1PQ4A 3MBKA 1NONA 2CH4A 3TFOA 2QF7A 4Y2HA 3AVWA 4EGCB 3C41J 4BC1A 4BFYA 4MI9A 1BGVA 1I30A 3HKSA 3S27A 2PZFA 4HWGA 3AB3A 4PWZA 3KKNA 2FFKB 4CM4B 3NDIA 4E5NA 3LT5A 1RYHA 1GFWA 1VHDA 3ULJA 5EA2A 2EY5A 3N58A 3W3ZB 3V55A 1AHPA 2CLEB 4D96A 1QG0A 4K9NA 1VYUA 5EJ8A 4UCFA 1YBAA 4C0SA 1GQYA 5I9IA 5CDHA 1OVMA 4TV8B 5FOUA 1XMQL 1VBNA 3I09A 2HF7A 3OZDA 3WC4A 2CMHA 3EGDA 4H0FA 5EEHA 4DTIA 1O95D 3K0KA 5EBCA 4UM9B 2BDOA 4B45A 2GNPA 3KJZA 4O4LA 4KVZA 4QDUA 2WINB 1TWFH 4BA2I 1X7ZB 3L92A 1UIMA 4FDVA 1ZWLA 3LUDA 2BFMA 4IGEA 5HFJA 3LHFA 3DJFA 1FQWA 5LZ4A 3CURA 5EZYA 2EQ5A 3IMGA 2ATVA 2HQBA 3PV0A 2ZYTX 2WUGA 3W3AA 3DAOA 3VZRA 1BEUB 3W6ZA 4RSRA 3RG8A 2N8NA 4MV3A 2F1OA 2O59A 5IGFA 5CV7A 1CVIA 4K6LA 3BDLA 5C3EB 3LOQA 1O6BA 1GO2A 5AW8A 2AL7A 5KMGA 1K27A 4AX8A 3PF4A 2GZSA 1IY9A 4PNEA 5LMNW 4E08A 2CFMA 1FFSA 3LY9A 3OP1A 5TQ2B 3A2KA 3MJFA 2D74A 4QBFA 4D5EA 1GGNA 4YQFA 4JGGA 5ALFA 5KCZA 4R01A 5T8KA 3HUEA 4MUGA 4MWEA 4N0MA 4EA7A 3HEMA 3HC7A 4CEJB 4ZCKA 4Q4DA 2FMFA 3WADA 4OB8A 4IPGA 1JG7A 2PI2E 1Z13A 2IDZA 3DE7X 4B8YA 1CJCA 4PLHA 4D0SA 2WIKA 2WJVA 3VU9A 3UUGA 4NCIA 5H68A 4B3ML 1HKHA 2JK0A 4EABA 3WYFA 2ZSJA 3TOCA 4DCNA 3E9QA 2B78A 1K7EB 1VKRA 3EQ6A 1UPTA 1V1JA 1QE6A 1DIHA 3K8ZA 4YP0A 1DSSG 5ELEA 3N87A 3OOHA 3RVPA 1SBYA 3WMGA 3KCNA 4Y98A 4K2LA 4JFAA 3FJYA 3G7UA 2CD9A 4M1KA 4LHWA 3TRJA 1NW7A 5LQMA 1Y9ZA 5JQGF 4AUMA 5LL6S 2CCKA 3PDJA 5JZBA 1BHJA 3OLVA 5KYLA 3N39C 3N05A 4QO8A 1MKHA 5BP7A 1VSUA 1VI2A 4GO1A 2P78A 1UE5A 2SNSA 5G40A 3I8OA 1ID1A 3NWBA 1E1RA 3DXFA 1Z5OA 4HRXA 5IYBG 1B42A 2Q46A 3ELUA 5E3HA 1D8TA 1DT5A 1WQ4A 1WB9A 3RC8A 4L6IA 4BB6A 3VX4A 2EJCA 1EZ6A 2PRSA 3TKYA 3SSAA 3PK0A 2BV3A 4L02A 2ZYSA 1LBEA 4JASB 1EUZA 2X1HA 5I9SA 4GKJB 2E5LB 2FJUA 3KYHC 2ECFA 2NT3A 2JS7A 2FQXA 1WUIS 1LB1B 3P9IA 2IYYA 1W1UA 3T38A 3OC0A 3ZY2A 3QVLA 1H9CA 4ZALA 4DV6B 4G8BA 4DLVA 3IP7A 3WSVA 1BNZA 4AURA 4CG0A 1SU7A 3P2KA 5LYYA 1T35A 2QTLA 4QMGA 4OOFA 2CY0A 2BFWA 3A9TA 3EGEA 4K87A 4G97A 3C6QA 1NXPA 2Y4OA 2VT2A 4KDEA 3WIOA 5JPIA 2WWRA 4AVYA 2VF7A 3AC0A 3QMMA 3P9KA 1T1SA 1HG1A 3VR6H 4KE9A 5JH7F 1ZC3A 5C3UA 2OBXA 2H54A 2O7SA 1PFVA 2RGYA 1F51E 5EPOA 4TTAA 5HIMA 2E87A 1Q15A 5M3FB 2W00A 1JSXA 1F0NA 4QHTA 5BQPA 1J2TA 2NSDA 4WCFC 4HI0E 3HKEA 2F8TA 3KDFB 3JASA 4TSFA 4X8LA 5AHRA 1Q57A 4RZQA 1TKAA 3CF4A 4YCSA 4YMVA 4IYRA 3WAGA 2IHKA 1O8BA 3LMKA 1BNCA 2WTUA 1LRJA 1CC1S 1EFID 3QELA 1WPGA 4OXRA 1E3SA 3K0AB 3KWJA 1F06A 5HA5A 1P9WA 3MB5A 1JJCB 3I72A 3Q7EA 3AJRA 2JD2A 5LMUL 3QVUA 4RM2A 3Q88A 1GGVA 1PRTD 1S96A 5JQGB 4YREA 4C0BA 2PZGA 2LSSA 3A4IA 4Q9JA 1ZOIA 1HDCA 2WHPB 1T1EA 2PSDA 4NXMB 5HGXA 5FTNA 4A3FH 4H1HA 1UWLA 2I54A 3AP1A 3M3HA 1EE2A 1TIKA 1XQ6A 1VJ5A 4LDRA 1ZM7A 3BVZA 1C7JA 1ISSA 4H9GA 3WGJA 1I4EB 1QHNA 3GUYA 4U8HA 3L8HA 1WQ1R 2OPBA 4JBHA 5B1YA 5BOSA 4AY3A 4U00A 2FSVA 2HLNA 3BN3A 1CA5A 1BW9B 4KSYA 3IDFA 1DKLA 1OFVA 3D2CA 1ECFA 3FUCA 5EMHA 3QYPA 2OCKA 4YWLA 2NZ1D 3ZGXA 5H0IA 2WINI 4TL8A 1R9TH 3HCOA 1SPXA 1Q7YC 3TR0A 2YNMD 3H0GH 3SN6A 3DWQA 5I9PA 3GIDA 2PX0A 4RF3A 3HGMA 2ENWA 5CB4A 2Z57A 4QU8A 2F4NA 4DQXA 3DGEC 4O3FA 4DR3Q 1Y8QA 3KJHA 3RZOB 2DFTA 3ZTTA 2B7CA 1J97A 2OFPA 4YCUA 2FQWA 3I4NB 2ZT7A 1C0PA 1WULS 3DL2A 1HA3A 1JMVA 4WKGA 4IH1A 4TMTA 3BMNA 3I9LA 2IXBA 1K63A 4LHEA 3OOSA 5JH7B 2ZK7A 1WBJB 1XZNA 3P4YA 2HLDD 4MNOA 3HCPA 2KCCA 1FRVA 1FFBA 3EBLA 2V59A 4RDIA 1FNMA 1E2JA 4MWGA 4CF4A 5FLEX 1KAAA 1LLFA 2A68D 1PFYA 2DQKA 5DK4A 4GEKA 4ZRDA 2E2JH 3JQGB 4J6FA 2QORA 1J39A 2VP3A 3NBUA 1UXOA 1YC2A 1TWCH 4JBIA 2VTVA 4JI0B 4EGFA 1JSZA 4C0XA 2LDXA 4XYGA 3HEJA 2W2OA 4HJRA 3K59A 2KEEA 2JAHA 1II9A 2R00A 1EDZA 4J7AA 1F6BA 5H7XA 4FQ7A 4E31A 3LT0A 4UTPA 3LGSA 2CLCX 5JWHA 4IH9A 3GJSA 3DBLB 3GLHE 3VNVA 3KXIA 3CF5A 2P4HX 2O20A 2Z8LA 1YKSA 2A3RA 3M4JA 5EPJA 1K06A 4V2UA 1FYWA 3PFWO 5TXGA 1V95A 1O95A 1ZO8A 4ZMSA 5HRUA 5JWOA 4EL0A 1Z06A 1BVUA 2QSJA 4RPGA 4BOYA 3QBJA 3EFBA 7REQB 4LF8B 1O0SA 4CM1A 1L4UA 3J80i 2XUQA 4N0QA 3OE7A 1IZ6A 2GZ2A 2WU1A 3IQHX 2R7ZH 4BX3A 1YH3A 3AIIA 4PN7A 2NUBA 2PHZA 3I83A 1KERA 1IFXA 4BNYA 1NVGA 1O6GA 4L9SA 4EQPA 2R48A 1C8VB 2WQZA 1BRMA 2PUBA 1P0CA 5G4LA 2ZTHA 5JCJD 1OLXA 3GFBA 4H35A 4B6JA 1TMGE 4RKBA 3GA5A 1QLWA 1WD1A 2C7GA 4MR9A 3TRIA 1IJBA 3STBC 3JATA 1KAMA 1PWHA 1E18A 4UD2A 4Y7NB 4UAIA 1Z73A 1PTJA 1G91A 1G7RA 5EHXA 1U3FA 4U1RA 3KYIB 5CR3A 3UZUA 4LXQA 10MHA 1A8VA 3L40A 1B8NA 5K9ZA 1U8YA 1TT5B 4DR6Q 1VP9A 3ABOB 5C8YF 1SAYA 2OL4A 2JDID 1L7OA 2DUMA 3R0XA 2E9SA 4V39A 3SJ7A 2QPLA 3B6IA 2R11A 2RJ3A 1WRBA 2MJLA 4F6LA 1X6VA 2UUCB 4BNWA 4GLJA 1OLUA 3KWMA 3TEHB 1GZHB 3S17H 1AMUA 1J99A 3X2SA 3T51B 3ITPA 1HWYA 3PIO3 3VNSA 4P0TA 4I4NA 4W5TA 1L9KA 4K86A 3T35A 2PGOA 2CXPA 1YUMA 4RDCA 3IFDA 2RCFA 4QRIA 1QIHA 1UWKA 4CQLA 2EQBA 1Y5RA 4FNGA 1PD0A 4ZRMA 1T5IA 4BXXH 1R6UA 2ZP1A 5BORA 3Q9SA 4I46A 1E3TA 2AF3C 1CY7A 2MSDB 1R4AA 4CLXA 2FSSA 2EW8A 2ZOSA 2V55B 2DWOA 4WERA 1YI0A 3PPWA 1Y1PA 2J4XA 5K3FA 3PRYA 1CFJA 3GLHB 3MRTA 5C4JH 3FPCA 5B58T 3L7BA 5EERA 1T15A 2J3KA 2ZSBA 1ZH8A 4ALNA 3IEXA 1M6NA 1RYEA 4D25A 4Y0AA 3OOWA 3S24A 5M34A 4ZVTA 5BN4B 1BFKA 2AX4A 3K58A 2MFIA 2NNWB 5JY6A 3L8EA 2DT5A 2J45A 4UDYX 2W48A 2GKGA 4WOJA 5EZ5A 4BIIA 1DBSA 1WZ2A 4U7FA 2PPLA 1XE3A 2ZYWX 2R6FA 5B36A 1FDTA 4IJ6A 3WIUA 3G48A 2ZQZA 4EVOA 1FFWA 5FO0A 3A8JE 4GVPA 5JXJA 4LF6Q 3KKKA 5EBDA 4Q3NA 2P4EA 5ICCA 4BBRH 1HQMC 2NU9B 3WLPA 1MJEA 3WRYC 2B4KA 3UTDA 3I2ZA 1JS1X 3CEMA 3A7AB 4IO9A 2FFJA 4KY5A 4HUJA 2Z8YA 4CTOA 4HJ8A 2HCIA 4ZTBA 2PPBC 4EUKA 2CNWA 3A6HA 4PZ8A 3CZQA 3BGDA 2RAPA 3PFFA 3RFTA 1RRMA 1F3OA 1WTWA 1VLZA 4UHCA 1T5DX 3PIIA 4MP3A 2RGNC 3GJ4A 5ALJA 1B3QA 5C8YB 2A9RA 2AD1A 2FUKA 2VC2B 3HSYA 4HO1X 3KLRA 4H0LC 5M04A 3AX6A 1NVTA 4L51A 4C1NA 3PO3H 4RMHA 4OFZA 4ETNA 2VDJA 4Q9LA 1NUAA 4UAJA 5DGDA 2E76C 4HEA1 2YYZA 2G3YA 3MF4A 4K88A 3AVXA 1UC4B 1GG9A 2ZVQX 1AXGA 1Z2AA 2QEXA 1HPLA 2L15A 4XYOA 2OLEA 3HNRA 3OPQA 2L12A 2YZNA 3CNLA 5ALQA 5DSTA 2WJJA 5LP6C 1HR0Q 2WZBA 2HMAA 4DV0L 2VDPB 5TGTA 3QNWA 3R5XA 4OJQA 5M3MH 4JLSA 1E4YA 1DCMA 3P0EA 3KLSA 4CJ1B 3SICE 3CZ9A 3KV3O 1RLIA 1PV4A 1WVGA 3GRVA 3R6WA 3HY6A 1LLCA 4WT7A 4C3IH 3AEZA 1KEPA 3W2EA 3TZEA 1I5OA 3A6FA 2F3IA 2E4WA 4DC9A 4J7UA 3HK2A 3G0DA 3NBHA 4MW2A 1UM9B 5JATA 3CRLC 4KU4A 1KI6B 4KHVA 3AK4A 1L6IA 1O94D 3K6KA 1GO3E 3P19A 4U673 1PJ2A 4BTVA 2O5JC 1JEYA 4WLFA 4XAQA 3OJCA 2F64A 3ROEA 1X38A 5CB0A 1S9HA 5ICFA 5DGCA 3UGKA 2OMEA 3H6GA 4B76A 4MW1A 1HR0L 5JXHA 1AE3A 1FTSA 1BF4A 5KB3A 2SEBD 4KK3A 1ZIDA 1V5EA 4BO6A 1X6OA 1TVXA 4QXRA 5DM73 3TRZA 3LWBA 3OWOA 1NUPA 1V9SA 2A92A 3Q5GA 3SHLA 4G4JA 3EF3A 4IO0A 1BCRA 2QPTA 3W4JA 3ZWMA 3EYAA 4ABNA 1YS6A 3IIMA 5LQKA 4PQEA 4DYHA 1MC5A 3KDSE 1HDOA 4B3TQ 2XBMA 3RUPA 4JOBA 3PNKA 4ZKBB 4V02A 1KAWA 3M5WA 5ICEA 3I04M 5HX7A 4OMUA 1Z15A 1KORA 4KNYA 1FFCA 1SELA 2D5IA 3LW7A 1PI3A 2QN2A 5BUQA 4XASA 2ZU6A 2WW8A 4RXTA 1Z6GA 4MGIR 1TEHA 1SUDA 1A0OA 3PLAE 1D7AA 1G66A 5EHNA 5J5CA 1DAPA 2GT1A 3BHJA 4LVNA 1YZTA 4A0HA 1GARA 1MN6A 4PW0A 1W6KA 2QXTA 2ZRKA 5IWCA 1KMHA 1JTFA 4E5DA 5K36G 3GPDG 3THRA 5C5EA 3WHKA 5D3IB 2GBIA 4DIOA 1R5JA 3AHDA 3E9YA 3MJTA 1R00A 1N34B 3G88A 2BHNA 1MCZA 3I90A 4GNXA 4MS1B 2O3JA 2PY6A 1DEAA 3CXUA 4Q1EA 3ME5A 4TRJA 3JR7A 3HRIA 4RTOA 3SQXA 2UAGA 1IHDA 5L4LA 1BOFA 6CHYA 2R6JA 4NJOA 3GRPA 3MT0A 2I78A 3E8XA 3IILA 4FFRA 1BAPA 2EG9A 4HZIA 1N2ZA 3H2IA 2QTFA 2Q5HA 5ECYA 2NLOA 2RCNA 2G88A 4B3SL 2XBUA 1SEPA 1RYZA 3TXYA 4OH1A 1KRHA 2HLPA 1STEA 4UM5A 4J1TA 1RJDA 3ESCA 5IUKC 4HUQA 1SULA 1C1YA 5DM70 3BYYB 3AF3A 3IQZA 3HCEA 3H6KA 4G23A 3Q2IA 2GWHA 3QLVC 2LV8A 1L4HA 5IC5A 5FBKA 3ZZTA 1JNYA 3ZDZB 3NASA 2DJFC 4BE4A 3D3RA 3UHJA 4KQXA 3MINB 3DBHA 4INZA 2W4QA 1A0IA 2HC9A 3C3XA 1XRRA 2ZPAA 2I3BA 3QU7A 3ZWOA 1PMRA 2NBFA 3WL5A 5JCJA 1DYQA 1NI4A 2HU2A 3G0CA 4G8CA 5KIXA 2B8GA 1GLGA 2PVSA 3QITA 2C4HA 4LYGA 4QGUA 1KRWA 1K8OA 1KAQA 3GLGE 4JR0A 2O06A 3OJWA 1MRSA 2QVYX 1PR9A 1Q3TA 3SYRA 1NOIA 4OEMB 1NQOA 4DPKA 2CSXA 2J5XA 4W5HA 4F2WA 4MSUA 3EG9A 4ZANA 1Q82C 5BSFA 1V9LA 3U7EB 3NALA 2CYBA 3SIRA 3FGPA 3UVEA 4JBNA 3T1HB 1T8PA 2VLIA 1IHYA 3CSUA 4IFDH 4KQWA 1VZ3A 4WQMA 2VLBA 3V7FA 1LNSA 1N7IA 1OPRA 4EYKA 1VKOA 4H6XA 4JIMA 2HA3A 2FPOA 3J7AC 1K9VF 1O58A 3BD7A 3CKIB 2VNHA 4XTCS 3ADBA 3GT3A 3L0YA 2EYUA 1B50A 5D2CA 3UOGA 4Q4HB 3P0IA 3S2DH 3PHLA 3ZHQA 4YECA 1MZVA 1QF6A 3M9LA 2QTVA 5IYZF 2P8JA 3GMDA 4HZUA 4A2CA 1O7JA 2PJZA 2YVUA 4B31A 4M8IA 2O2LD 4R31A 2V45A 4RQBA 1BGXT 5GM1A 2BM9A 1MHWC 2CHUA 5DNYB 3N75A 5G1NA 3TPZA 3VYRB 3K1YA 4L5IA 5A4IS 3B1ZA 4XGKA 1I10A 5DVZA 3GO4A 1VXRA 4NEHB 1JA0A 1AXEA 1XCBA 3KZNA 4FZ3A 3MXGA 2VJQA 4OI4A 5GJBA 2XB4A 3CONA 2MP1A 4DWVA 3G2MA 4XX0B 2WAOA 4C3VA 1DQYA 3GUCA 4WFQA 1O6CA 4P22A 1N2BA 1Z4OA 1JIIA 1TC1A 3G1UA 2IOFK 4RSMA 5LXTB