3GTOH

Backtracked rna polymerase ii complex with 15mer rna
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 16
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3gtoH00
2Q2UA 1KD1C 2UUBQ 2MFIA 1I50H 3CAMA 2K4KA 3I4MG 5LMNL 4JOIC 2AKWB 3G71A 1MIUA 3S2DH 4NB3A 3J80c 4POGA 4LF5Q 4BXXH 1I6HH 1IBKQ 5FJ8G 1VQDA 2VW9A 1PH1A 3AYHB 1HJPA 5IYBG 2F4VQ 3BU2A 2JE6I 1K9MC 4L5TA 2R92H 3PV0A 3CCEA 1YI2A 1W2BA 1EWIA 1WFQA 2UUAL 3CW2C 4O0AA 2E5LL 4B3SL 1TWCH 1QUQB 4B3MQ 2UXCQ 5FLXc 5C0XJ 3VDYA 3OTOQ 1LM0A 3GD7A 3PIOA 3L2PA 1SN8A 4IPCA 4IPGA 1HNZL 5M3MH 1ASYA 2E2HH 1VQNA 1V9PA 3CXCA 2NVYH 4JBJA 5C44G 4GN4B 1Y1VG 2QGQA 4DR2Q 3JAMc 4C3HH 3M4QA 4JI1Q 1WCMH 2UU9Q 4JYAL 1Q1BA 2BA0A 1I94L 3DM3A 4BY7H 2JJQA 3I55A 4GKKQ 2LXJA 3NEMA 3H15A 4A93G 4DR6Q 5M3FG 2LSSA 4PZ6A 2A8VA 4A3GG 1PVOA 1SROA 1CUKA 1IZ6A 1NMFA 3T1HL 4A3JH 4DR5L 1TXYA 4XIGS 4A3FH 1XMQQ 5ELOA 2YV5A 4DV5Q 1VQAA 3E0EA 1VQ4A 1SR3A 3PSIA 4UP8A 4X62Q 4QJFA 3K7AH 4DV0L 1XPUA 2YTYA 5H1SE 3HOUG 1UE1A 2YYZA 3KDFB 3I56A 3T1YQ 2I5LX 3PO3H 3BZKA 5GADC 1J5EQ 1HH2P 2CWAA 3UE0A 2R6GA 3HKSA 4B3TQ 1KRSA 4LFAL 1NTGA 4JG2A 3PCOB 4FDBA 1E22A 4RG1A 1P8LA 3OW2A 4UY8C 1EUJA 2MO1A 2PI2E 4KHZA 1QVFA 1PV4A 4EX5A 5E7NA 3TS2A 2ZTCA 3NENA 1X9NA 4GNXC 4JI3L 4LFAQ 2NVQH 1CSPA 2VNUD 2VQFQ 2K52A 4O2DA 1LUZA 1BKBA 4YCVA 4DK3C 1N33Q 2UUCQ 5GAGC 3PUVA 1MJCA 4HIMA 3S15H 5J3BA 2NZOA 1JE5A 1G291 3CCMA 2HHHL 3Q8DA 3CCUA 2FXQA 1JB7A 2I5HA 3HKZE 3L7ZC 3GTKH 1FL0A 4X62L 1JT8A 3ULLA 3S1NH 4GN5A 4JI7Q 4IFDJ 3J80i 1KIXA 2OCEA 2WFWA 5GROA 2QA4A 1PH8A 5IP9H 4IFDI 4X66Q 2VQEQ 3TQYA 4GLVB 1YZ6A 3MXNB 1IBLL 4B3TL 3F8TA 2JQOA 2B3GA 1N34L 3CCQA 4JI0Q 2ATWA 3UDGA 3PO2G 3CMAA 3GTQH 1CKNB 1Q46A 1VQBA 3EBEA 3GO5A 4TQUS 3UDFA 1HNXQ 4LF6L 3IRBA 1PH9A 1QUQA 4LF8Q 1CKMA 3PIPA 4DV5L 2BH2A 4X65L 4OWWB 2BH8A 3H3VH 2JEBI 1PHJA 4A4IA 2VQFL 3RLFA 4UP9A 1PH3A 3NBHB 2GVBA 1GKHA 2OQ0A 3CQZH 3KDFA 2HHHQ 4A3BG 2WB1E 4IJLA 3JAMi 1JMCA 3HOUH 1IBML 4HJ7A 2UXDL 1Y14B 1YHAA 1VQKA 4X65Q 4L5SA 1EQQA 2DUDA 4BBRH 4YY3L 4JBMA 3M4PA 4BY1G 2VUMH 4GNXB 1Y1WH 1O7IA 2N8NA 4DR7Q 4WJ3M 4JI3Q 1K73C 1DGSA 2RHSB 4YHHQ 1HNZQ 2GVAA 4QL5A 5IP7G 1OTCA 1WYDA 1VQGA 1N34Q 4JI0L 1IBKL 3HOWG 1AE2A 2NVTH 4A93H 4BBSG 1IBLQ 3GTLH 4YCUA 4LFBL 2RHQB 4A3EH 4DV2L 2Z6KC 5EAYA 1VQPA 4YCWA 3U4ZA 2WAQG 4JI6L 4BY7G 1XPRA 2OTJA 4A75A 4C3IH 2UXBQ 4DV4Q 1C9OA 4JBKA 2Y0SG 2CFMA 1XNQL 5C4XG 2AWNA 3GTMH 1X3EA 3STBD 1YBYA 3F2DA 4DV3L 1FJGQ 1GM5A 4A3DG 3ER0A 1YIJA 5C3EG 3H0GG 3U4VA 4DV4L 4QGUA 1R9TH 1HR0W 1VQLA 3PF4A 4A3EG 1V43A 5C0XG 2YU9H 5M5XH 4BBSH 4DUYL 3S17H 1GD7A 1G6PA 4ME3A 4GOPA 4PG3A 3RLNA 5IP7H 1S3OA 1NMGA 3J7A5 3CC4A 3KF6B 1CKNA 4YHHL 2PI2A 3G48A 3LGJA 3H0GH 1PH6A 5C3EH 1XNRQ 4BBRG 5FJ8H 4DV1L 1N36L 4AIMA 4OXPA 1SMXA 1WI5A 4GOPC 3RN5A 4IJHA 1IL2A 5JJIA 3TREA 4PZ7A 5C4XH 4OX9L 2HIVA 1UE7A 3CP0A 2N3SA 3CPFA 2VQEL 4A3BH 2IX0A 1M90C 4P73A 4JI6Q 4C2MH 1KAWA 4LF6Q 2CWPA 1P16A 3HOXH 1EIYB 1I3QH 1VQEA 3HKZG 1C7YA 3GDEA 2K5VA 2PQAB 1KHIA 2PQAA 3EN2A 5DLQE 5IY0A 1EQRA 4GKJQ 3JC66 3MEFA 1Q82C 2Q2TA 2JA7G 3RLOA 1KQSA 1VCIA 2VY3A 1HNXL 1XMOL 4EQ5A 3FKIG 2I0QA 4GLXA 1I94Q 2NN6I 1KXLA 2Z6KA 3K80C 3PO2H 1KL9A 4BY1H 2VUMG 3B6YA 3K8AA 4GKJL 4LFCL 2R93G 2JK8A 1BVSA 5C4JH 4UPAA 3S24A 5GAEC 1BBWA 1XMQL 4AYBE 2E8GA 2UXDQ 4HJ5A 3ICEA 5M5WH 4GOPB 2NVXH 3CD6A 1QVCA 1X3FA 2R7ZG 1SRUA 3D31A 5C0XI 1A63A 2LXKA 2IX1A 1E1OA 4LUOA 1VQOA 4JYAQ 3BZCA 1KRTA 2UUAQ 4LF8L 3FP9A 2V1CC 2F52A 4PMWA 1PA6A 4JI4L 1BBUA 4YWLA 3L0OA 3CC2A 3TS0A 3W1BA 3PUWA 3K81C 4A3IG 2K50A 3E9HA 3PUXA 4TVAB 1B70B 1TWFH 3AFQA 4P72A 5IP9G 3A74A 4X66L 1ASZA 1L1OC 2QEXA 2MNAA 2E2JH 3HOYH 1OXUA 4NXMQ 4JBWA 4KHPQ 4X6AH 4HJ8A 2R7ZH 2H5XA 4A3KG 4OO1G 3ULPA 1QVGA 1J5EL 4YWKA 2VZAA 2WAQE 4HIKA 3PO3G 1L0WA 1YHBA 4LW1A 1EFWA 1VQCA 4A3MH 1IYJB 1YVCA 2PMZE 2C35B 2Y0SE 3BJUA 4R4CA 3F2CA 1OXTA 1YJNA 3G4SA 1TWAH 2VL6A 4LFBQ 3UDXA 1HR0Q 2K5HA 3GTJH 3M3YH 2I5MX 4A76A 3U50C 4JI5Q 3I4NH 2IY5B 3RN2A 2JEAI 3A0JA 2HQLA 4H02A 4JI8L 3ULJA 3KJOA 4IPDA 1TWHH 5M3FH 1PYBA 1YHQA 1PH2A 2OWOA 4B3RQ 1D7QA 1HR0L 4PZ8A 4DR7L 1M1KC 1U5KA 2IT1A 1SFOH 3HOXG 5JEAG 1VQ8A 4GNXA 1WCMG 5GQOA 5JJKA 1L1OB 4DR4L 5C44H 1K83H 3EIVA 4B3RL 1YJWA 5M3MG 1VQJA 4HJ9A 2A1AA 4KLKA 1KC8C 3PUZA 3CCJA 5AJ3Q 4JC0A 4ALPA 4APVA 4DR4Q 2BA1A 4AQYQ 4UP7A 4LF5L 4L5RC 4A3JG 3H3VI 4LF4Q 4R1JA 1X54A 4LF9L 1MJEA 3HOZH 4A3GH 3M4OH 2D62A 4MZ9A 1VQ5A 2XTIA 3KOJA 2R92G 1GVPA 2MQHA 2A19A 5IYBH 1VQMA 2DGYA 1NE3A 3S1QH 5LMUL 4MTNA 4A3DH 3UDIA 1Y1VH 2K5NA 4RMFA 4NXML 5IYDG 4HJAA 1Q7YC 1Q81C 2F3IA 5LMNQ 1S40A 3RNUA 3M9BA 2AHOB 4LF7L 3AEVA 4JI2Q 4X64Q 1TWGH 1RIPA 2KBNA 3UE1A 1VQ7A 4OO1I 3S2HH 1JJGA 2RCNA 3HOWH 3KF8B 1A62A 3KJPA 4GS3A 4NXNQ 3S14H 1YEZA 1X55A 4R4OA 1VQHA 2OTLA 3CF5A 1Y1WG 1Q1EA 2WP8J 4XTCS 2PNHA 3AQQA 1N9WA 1E24A 1WJJA 1HZCA 1NBWA 4DNIA 1A8VA 4DUYQ 1UE5A 1D8LA 4DAYB 1SLJA 1B7YB 3FHWA 2JA8G 4BXXG 1UE6A 5IE8A 1Q12A 5IWAQ 4A3LH 5FLMH 4IOAA 1RL2A 1NJIC 1U0LA 5LMNW 2Q2IA 3ZJYC 2NN6G 4YWMA 1X3GA 1X65A 3G6EA 3DLLA 1Q8KA 4DV3Q 3D0FA 3HOVH 3CMEA 3GTOH 4QIWE 4A3LG 5GAHC 4A3CG 1W3SA 3F1ZA 2JA5G 4GKKL 4WJ4A 3A5ZB 2ZM6L 2JA8H 3PUYA 2JA6H 2AWOA 3I4OA 2K14A 2ID0A 1PH7A 1N32L 4KI0A 4LF4L 3HFZB 1WOCA 3I7FA 1PYSB 2UXBL 4DR5Q 2YTXA 4IO9A 1PH5A 3CPWA 1HNWQ 4K0KQ 1AE3A 2ZTEA 4L5QA 4DAMA 3PF5A 4IFDG 1LYLA 3OYYA 2KENA 3J81c 1K8GA 2CKZB 1GO3E 2EQSA 4DV1Q 1NY4A 1N36Q 3I2ZA 1AH9A 4OX9Q 3K0XA 3RZOH 4P71A 4LWCA 1UWVA 1FJGL 5HGQA 2EIFA 4MNOA 4R4QA 1PFSA 4POFA 2Z0SA 3RR5A 4DV7L 4IOCA 2B63H 2JA9A 4DK6C 5IYDH 4AQYL 3KFUA 3S1MH 5IYCH 4J15A 5JEAJ 5K36G 1HZ9A 1I5FA 1JJCB 1VQIA 4P75A 4Y52H 1C0AA 1FGUA 4DUZL 3WWVA 1CSQA 3RZDH 2ZTDA 4LUVA 2ES2A 1XTDA 4GLAC 2ZJPA 4NPSA 4DR1Q 2ZJQA 2HIXA 5JJLA 3M7NA 3HOZG 4LFCQ 4QQBX 2K75A 2XGTA 4R4TA 2VS1A 4JOIA 2UUCL 4JCVE 4C3JH 2CCZA 4LF7Q 4HIOA 4DR6L 4JI7L 4BA2I 4KHPL 3PGZA 2WB1G 3KF6A 4P74A 4DV2Q 1QZGA 3GTPH 4DV6L 2UUBL 3E9IA 2D0OA 1OXSC 4A3FG 1QZHA 1XJVA 2OQKA 4DV7Q 5HY6A 3ERSX 4AYBG 1SE8A 4JI4Q 3CCRA 2R7DA 4OWTB 4JV5Q 3T1YL 4YY3Q 3I4NG 1OXXK 1Z47A 2GN5A 4DV6Q 3K7UC 4QY7A 3NELA 3U58A 1YNXA 2N78A 4AH6A 2B29A 4LUZA 2E5LQ 2IHEA 1Q86C 5ELNA 1K0RA 1N32Q 4A3MG 1K8AC 1EIFA 1IXRA 3T1HQ 1K3RA 2KCMA 4B3SQ 4DR3L 2B63G 2KHJA 2CQOA 1HZBA 4NXNL 3CCSA 2E2IH 3KLWA 4A3KH 1XPOA 1XNQQ 1FVIA 4IPHA 4DV0Q 3HOYG 2ASBA 2YTVA 2F4VL 2Q2HA 2RF4A 4LNQA 2ALYB 3F2BA 4DPGA 3M85A 2KHIA 3STBC 1LTLA 1OXVA 1VQFA 5IWAL 4A3IH 4K0KL 1G51A 1B8AA 4JI5L 1MKHA 2L15A 3A5UA 1JJ2A 3CCLA 4LF9Q 1V1QA 2NZHA 4BA1I 2N49A 1VQ9A 4HIDA 3OTOL 2JA6G 5IYCG 3J81i 4B3ML 2D0PA 3S16H 3SGIA 5BR8Q 2UXCL 4A3CH 4OONA 2ZM6Q 1L1OA 2MO0A 1XNRL 1XMOQ 1EOVA 1E7ZA 2KCTA 3W5OA 1IBMQ 3I4MH 1VS0A 4DKAC 5IT9c 4DR2L 3GTGH 1E1TA 1N33L 2UU9L 5FLMG 4DUZQ 4DR3Q 4DR1L 1VQ6A 2IHFA 3TRZA 1YJ9A 5BR8L 2ZJRA 1HNWL 4OWXB 4R4IA 5AJ3L 4JI2L 3TEHB 1CKOA 3J7ZC 3CC7A 3CCVA 2HT1A 1UEBA 1X6OA 1Z9FA 1L2FA 3KYHC 2R93H 2AMCB 2EXDA 4X64L 4JI8Q 1S72A 1X56A 1N8RC 5M5YH 1A0IA 1J6QA 3AFPA 3FKIH 2R7FA 1E3PA 3S1RH 1YITA 4Y7NH 1H95A 3J81j 1T9HA 2JA7H 4GN3B 4JV5L 3W1GA 2JA5H 1HZAA 5LMUQ 1PH4A 3HOVG 4JI1L 1EYGA
chains in the Genus database with same CATH superfamily
3I4MG 1I50H 2EXZA 5EPJA 5LMNL 4JOIC 3G71A 4CJ0B 2ZXRA 5ISRA 3AMUA 3HS0C 3ITPA 1I6HH 2RSOA 5LL6X 3I70A 5IYBG 4DXGA 3BU2A 4BY1B 2AQ3B 4NP5A 5IGFA 2VB2X 3PIO3 1EWIA 4O0AA 2E5LL 4U673 4EQPA 1QUQB 2UXCQ 1EL0A 1HA6A 2F0KA 3PIOA 3L2PA 1SN8A 4IPCA 3SK5A 1ASYA 1A2TA 2NVYH 1Y1VG 5EGTA 2NWGA 3P7JA 3NPPA 3JAMc 4JI1Q 2OXPA 1TKWB 3GTQB 2A69D 1R4PB 4XYOA 3NTKA 1S5FD 1BCPF 1LT4D 2J0TD 5ELOA 4DV5Q 1JE4A 3E0EA 2F0MA 3FKIB 3S1RB 4KN4C 4OIJA 4UP8A 4K2KA 1UE1A 3I56A 2I5LX 3PO3H 3BZKA 5GADC 1HPCA 4C3JG 2R6GA 4LFAL 1F9SA 4FDBA 1P8LA 2MO1A 1QVFA 3J7AF 1A3TA 2D2CC 5E7NA 1RD9D 1PRTD 1X9NA 4LFAQ 2PPBC 4QUCA 2VNUD 1T5EA 4O2DA 3CKIB 4YCVA 1PRTB 1TS4A 1CZWA 4C1NK 2MHVA 3PUVA 2LY7A 3S15H 3A55A 3R3OA 1JE5A 1G291 3L7ZC 3GTKH 4J6HA 1JR0D 3H0GB 2L55A 4GN5A 1KIXA 5ELBA 2IX3A 3GTLB 2VQEQ 4RH6A 4B3TL 3F8TA 2JQOA 2WAQB 1CKNB 2QF7A 3GTQH 4FYDA 1VF5C 1VQBA 3RMHA 1HNXQ 1OO9B 3VR4A 3IRBA 5T1IA 1F9RA 1TIID 2GVBA 2B2VC 4IJLA 4M8AA 2DUDA 1KTKA 3E0JA 3TBIB 2N8NA 1KLUD 2RQXA 4WJ3M 3C2PA 1AP0A 2GVAA 3I4LA 4A93H 2RHQB 4A3EH 4FP5D 2Z6KC 1WVLA 3I4MB 2OTJA 4C3IH 2D9UA 3GP7A 2EY6A 2AWNA 1GUGA 3A8IE 2CHBD 1BBXC 3ER0A 1YIJA 5C3EG 4RCOA 3E3XA 1SAPA 2Z9HA 1R9TH 3PF4A 2Z8LA 4A3EG 2YU9H 5C4HA 2A6EC 3RLNA 1F9QA 2EYOA 1NMGA 3CC4A 1CKNA 1BO0A 4DNTB 5IGBA 1PH6A 5C3EH 1DZ1A 4DV1L 1B9NA 4GOPC 5JJIA 1IL2A 1C4QA 3TREA 2HIVA 2N3SA 4I7ZC 5E4WC 2Z4HA 2CWPA 1P16A 2F3VA 4Y7NB 1VQEA 3HKZG 3ND8A 1C7YA 1N32Q 5DLQE 2DN8A 2VY3A 1XMOL 4EQ5A 3AU7A 2Q8TA 3B6YA 4KN7C 4XYQA 3W3AA 2R93G 2JK8A 1BVSA 5C4JH 4UPAA 3S24A 1BBWA 4WRDA 2UXDQ 4DU9A 4HJ5A 1MBYA 1W6JA 4A93B 3J81L 4GOPB 1GXDC 1SRUA 1E1OA 1SJED 3BZCA 4BWGB 1PA6A 4JI4L 3SK8A 1TQOA 1BOSA 4ZLTF 2EYPA 3E6ZX 5C6AA 2YU9B 1B70B 1TWFH 3AFQA 4OHJA 3A74A 1L1OC 3HOYH 4KHPQ 4ZCKA 1EEID 3A54A 1U4PA 3J80L 1J5EL 3KLRA 4XQQA 1S5BD 5IIFA 1EFWA 1Z6HA 5DEHA 4A3MH 2C35B 1BCPC 3BJUA 1D5ZC 1TWAH 5M5WB 3L9AX 3U50C 4DFAA 2B2UA 4Z9CB 3EFXD 4C56C 1YHQA 5COYA 5KNDA 2B2TA 3C46A 2FJ2A 1ZYRC 2RKSA 4PZ8A 1H9RA 1LT5D 1Q8IA 1VQ8A 1WCMG 5GQOA 4R8IA 3DWPA 1FGBD 3IL8A 2LMCB 5C4JB 1STAA 3A56A 5M3MG 1H9MA 1PLFA 4HJ9A 4UDUC 4IZ8A 5D65A 4JC0A 4APVA 1CK1A 5A35A 4LK1C 4LF5L 3H3VI 1DM0B 4LF9L 3K0YA 2OEOA 3KOJA 2A19A 3VR6A 2DGYA 1NE3A 4K8JA 2KHSA 4A3DH 1Y1VH 4NXML 3D6WA 3OW7A 2K04A 1S40A 3HOYB 4NKLA 2AHOB 4LF7L 2K03A 2HDLA 4JI2Q 1HXYD 1K8MA 4OL7A 3UE1A 3S2HH 3DWQA 4HN7A 2RCNA 2K7VA 2TSSA 3HZXA 3S2DB 3KK7A 2IL8A 3KJPA 4NXNQ 1YEZA 1VQHA 1Y1WG 3Q24A 1Q1EA 3RD4A 1SYCA 1N9WA 4ILWA 4DNIA 1HZCA 2B8FA 1A8VA 1LT6D 2CW0D 1UE5A 2JA8G 1B7YB 3FHWA 1B2TA 4MIUA 4A3LH 1X3GA 1X65A 1LTID 3D0FA 2DY8A 2VXWA 1DXMA 4A3GB 4GKKL 2ZM6L 2JA8H 1BXTA 4KY6A 1RODA 2K14A 2ID0A 1N32L 3L3OC 4DR5Q 1B9MA 4EQNA 1O78A 4IO9A 2RDHA 1UAPA 1EOTA 2IW3A 5JVH3 1K8GA 1WCMB 2EQSA 4DV1Q 1NY4A 1JWUD 3K0XA 1J8IA 4LWCA 1DYQA 4POFA 5HGQA 4DV7L 1X3QA 3S17B 4DK6C 4AQYL 1GUSA 4J15A 1HZ9A 1GUOA 2F0TA 4A3BB 1FGUA 3WWVA 5JJZA 1CSQA 1F2LA 3A8JE 4LUVA 1RTOA 1XTDA 2ZJQA 1TVXA 4NPSA 5JJLA 5C4ZA 2LKVA 4QIWB 4QQBX 3MHBA 2K75A 1WD0A 5HURA 1EYCA 4R4TA 1VMPA 3HOVB 4RGOS 3T4AC 1TWFB 3K6OA 3NK9A 3PGZA 3QO2A 3KF6A 1QZGA 3GTPH 2F4IA 4K8IA 4E6IA 3E9IA 5AFWA 1SBBB 5JAVA 3OOCA 5EPLA 5EBCA 1TY2A 5JVG3 1LV9A 4JV5Q 2F0NA 1ML0D 2GN5A 4QY7A 3NELA 1VMCA 1PFNA 2D5DA 4DXFA 2E5LQ 5ELNA 1K0RA 1AN8A 4A3MG 1IXRA 3NHHA 3T1HQ 3VYRA 5KIXA 3DMUA 3TN2A 2E2IH 3KLWA 3MZ5A 1WTRA 2RA4A 1XNQQ 3T53B 2O4XA 2QCPX 2ASBA 2YTVA 2F4VL 3MEHA 2SNMA 1WTWA 2L5TA 2FFKB 3M85A 3STBC 1LTLA 3HKZB 1VQFA 3OPOA 4L6TB 2XSCA 1JJ2A 1V1QA 3J80E 2RVLA 4K5VA 2N49A 3KLSA 5IYCG 2BDOA 2KEEA 3S16H 5BR8Q 2F0LA 4OONA 4Q5VA 3R8BA 1XNRL 1XMOQ 1E7ZA 3S9WA 4QB4A 1QNUA 1IBMQ 4DR2L 1Y8PB 1D1KA 1II3A 4HMJA 2RDGA 3TZDA 5FLMG 4DR1L 1VQ6A 2EYMA 2F0GA 2ZJRA 4OWXB 4R4IA 1HNWL 1X6OA 1QG7A 2R93H 1PRTF 2AMCB 2R3ZA 4X64L 1S72A 5C3EB 1J6QA 3AFPA 1E3PA 4KD4A 1T9HA 3W1GA 5ELDA 3FPUB 4WORA 4DA2A 2NZ1D 4CDCC 5D14A 1EYGA 2Q2UA 3MWYW 1KD1C 1CFMA 3CAMA 3R2IA 1VF7A 2EOTA 2AKWB 5CR3A 3HOWB 4NB3A 4POGA 4BXXH 2F0WA 1VQDA 3PO3B 3AYHB 1HJPA 2B2WC 2SNSA 4C2MB 5G3LF 1K9MC 1G91A 2M9VA 1W2BA 1ZKOA 3JAME 4B3SL 3Q22A 1TWCH 1MGSA 1CHPD 3NWSA 2PQEA 3VDYA 5M5YB 4JK1C 3GTOB 1ESRA 3BZDB 4IPGA 5M3MH 2E2HH 1VQNA 1V9PA 1EY0A 4FXDA 3CXCA 1QJOA 4JBJA 4GN4B 2QGQA 2ZXOA 4X3TA 1S5ED 1WCMH 4OIKA 1JQYD 2UU9Q 2JP1A 4JW0A 3DM3A 1S4ZA 4GKKQ 2I46A 2EYJA 3BDOA 1O7YA 1C8CA 4EGVA 5M3FG 2LSSA 4PZ6A 2A8VA 1PVOA 1AEXA 1IZ6A 1NMFA 4A3JH 4XIGS 3PSIA 5EQ0A 4DV0L 2YTYA 3HOUG 2XIWA 4CHTB 2WINB 1PTOC 2HD3A 2CWAA 2M2LA 3HKSA 4B3TQ 1KRSA 1NTGA 3H09A 3PCOB 3TP5A 4RG1A 3MFYA 1LTSD 2PI2E 2AQ2B 2F0PA 2F0VA 3TS2A 2NVTB 2ZTCA 3NENA 3VYUA 2EVBA 1I4QA 3U9OA 3P20A 1ILPA 1CSPA 1UEAB 1STEA 4N8X1 1BKBA 4N9PA 2KOLA 4HIMA 4J1MA 1D1IA 2RSNA 2K01A 2FXQA 4A3EB 4HAEA 1Y69U 2R92B 5M5XB 3G7LA 4IFDJ 2OCEA 2PYKA 5GROA 4IFDH 3DXJC 1AFPA 1E2WA 1HQRD 3MXNB 5KYIA 1SNCA 2Z6BA 2ATWA 4JI0Q 5C5LA 1SE3A 3CCQA 3MFGA 1Y1VB 3GO5A 1G6ZA 1PH9A 1QUQA 2Q8RE 3HOZB 1CKMA 2HCIA 4ZKCB 3PIPA 4DV5L 2BH2A 3VYTA 3HOXB 3RLFA 4UP9A 3NBHB 1GKHA 2OQ0A 3CQZH 3KDFA 4FF2A 2WB1E 3SK4A 3HOUH 2UXDL 1YHAA 2HQEA 2K5DA 1VQKA 4L5SA 4YY3L 4DGZA 4BY1G 2VUMH 4GNXB 4JI3Q 2RHSB 1BDOA 4QL5A 3EVQA 1IBKL 2NVTH 4IUNA 1W6KA 1IBLQ 4H0LC 4YCUA 3GTLH 1VQPA 4DV2L 1PFMA 4JI6L 2WAQG 1XPRA 4DV4Q 2H4OA 2CFMA 2PW5A 4ME5A 1D5MC 3GTMH 1LT3D 3STBD 1YBYA 3F2DA 1FJGQ 4RWSC 2NVQB 3H0GG 4DV4L 5M5XH 4BBSH 2G9HD 1GD7A 3MXUA 3H91A 4K2LA 4CGYB 2K05A 3S1MB 2FHTA 2R7ZB 3BS1A 4UHVA 2PI2A 2ZT9C 3ND9A 2F0QA 4AIMA 1SMXA 1Y8NB 5C4XH 4OX9L 1U4MA 3CRLC 4A3BH 1T5XD 2MP1A 3VR5A 1KAWA 3HOXH 1WTPA 1CA5A 1EU3A 3BDCA 2MJ8A 1KHIA 2KA7A 2KCCA 1EQRA 1GUWA 2AQ1B 3JC66 3HOUB 2JA7G 1NUCA 1KQSA 1VCIA 1HNXL 2I0QA 2AUJD 1KXLA 3QJYA 1R9TB 1Q90A 4GKJL 4LFCL 1GHKA 2K5WA 2RBMA 2PNRC 1XMQL 4AYBE 5IOCA 2F03A 4A3JB 4FF4A 4QMGA 1QVCA 1LTBD 3X3NA 2R7ZG 1WTXA 1G2TA 2IX1A 2N55A 5I6YA 4JYAQ 2UUAQ 3HGBA 3QOJA 1I4PA 4YWLA 1JB3A 3L0OA 3TS0A 4IALA 1D2BA 1LTAD 3K81C 2K50A 3E9HA 1AZQA 2NVYB 3G6JB 1ASZA 4X6AH 1I4HA 1OXUA 4NXMQ 4HJ8A 2R7ZH 2H5XA 1ZXTA 4CDDC 1WTVA 1QVGA 4FVMA 2WAQE 3I8ZA 5EKLA 3WOFA 3PO3G 1L0WA 1IHZA 4R4CA 3F2CA 1ET6A 2K5HA 3M3YH 3BVGA 3H3VC 4H02A 4WJWA 3ULJA 3KJOA 4B3RQ 1PH2A 5KEEA 4DR7L 1STYA 5JEAG 3HOXG 4GNXA 1K83H 3BYYB 3EIVA 2P5ZX 3LWEA 1EY8A 3S14B 5CV4A 4KLKA 3PUZA 5E4XA 3MVVA 4ALPA 1J9OA 3QG1A 4AQYQ 1YNJD 5CGKA 1RJTA 3CQZB 4R1JA 1X54A 4A3GH 3M4OH 2DJFC 4R9WA 2LFNA 4ZUJA 2XTIA 2K28A 2R92G 2NYZD 2VUMB 1B3AA 1STHA 3GTGB 1JORA 3NTHA 3SVMA 5IYBH 4O42A 1GJXA 4RHSA 4RMFA 4HJAA 4FO2A 5E1FA 3M9BA 3DEPA 3AEVA 4UAIA 1TWGH 5C5MA 3K5MA 1QNKA 2B39A 2EY1A 4CDFC 1XYIA 3IFDA 1PRTC 3DM1A 1PZJD 1XX8A 4CJ1B 1X55A 4RA8A 4BBRB 1PTOH 2NTTA 5CV7A 3OSOA 1SYBA 1E24A 2F3WA 3NWTA 2HUGA 1D8LA 2VB3X 1MSGA 4DAYB 3DHQA 5CYUA 5IE8A 1EEFD 2Q2IA 3WDNA 3G6EA 1EY6A 3HOVH 3CMEA 4QIWE 1Q3LA 4A3LG 4A3DB 1A2UA 3SDZA 3F1ZA 2JA5G 1EQVA 1K83B 5F2DA 5C4XB 3I4OA 4G4KA 4KI0A 3NUCA 1SFOB 3P1HA 3I7FA 4X3KA 2UXBL 1HNWQ 4HMIA 1K8OA 3TSSA 4CKCA 1LYLA 3M4OB 2FMCA 5FO8B 2CKZB 3Q6SA 3I2ZA 3KF8A 4TSSA 2KJXA 1FJGL 2EJMA 4R4QA 1KDAA 2JA9A 1H9JA 3VR2A 1SMYC 5JEAJ 3TP6A 1VQIA 5K36G 4DAYA 4P75A 3A7LA 4RAUC 2EYFA 2ZTDA 1ICWA 2PZTA 2JXMB 1F2MA 2ZJPA 3M7NA 1DD2A 3OMCA 4L63B 3C1EA 3X3MA 2ICEC 1LLRD 1EY5A 1KDCA 3PO2B 4HIOA 1QILA 1RKNA 4BA2I 4FXGC 4P74A 4GZYC 2NTSA 2JSOA 1HTPA 4A3FG 4AYBG 1NR4A 1TT2A 3CU7A 3NTIA 1STBA 2R7DA 4HSVA 1RTNA 3K7UC 3M3YB 1CZGA 4LUZA 4C3HG 2IHEA 2WIIB 5CV8A 2KCMA 4B3SQ 2B63G 4DR3L 2KHJA 2V4DA 4A3KH 2DNEA 1QCBD 1XPOA 4CBVA 1FVIA 4ZUIA 2A6HD 4DV0Q 3HOYG 2E76C 4LNQA 2ALYB 3F2BA 2BE5C 1OXVA 1XWEA 2Q8IB 5IWAL 4A3IH 2AUKA 1B8AA 5EPKA 3A5UA 3NBIA 2NZHA 2X69A 4I7AA 2B63B 1VQ9A 1ZYRD 2JA6G 4HCEA 4B3ML 2D0PA 3BYTB 1STGA 4LMQD 1SSOA 4C3HB 2ENBA 2ZM6Q 1EIGA 1L0YB 1TWHB 1PFBA 3W5OA 3GTGH 4PMBA 1N33L 4DR3Q 3CRKC 3TRZA 1YJ9A 1IW7C 1CKOA 3CC7A 4PMCA 3CCVA 1Z7TA 3KYHC 1Z9FA 5IT9L 1L2FA 4AYBB 1PTOD 1X56A 3N52A 5I9OA 2E2IB 2B2TC 3ERQA 4DF7A 3HG9A 2B2YC 4IUTA 3J81j 3FEWX 1MSHA 2Y0SB 2JA5H 2J7ZA 3OWEB 4RGTA 1PTOB 2UUBQ 2MFIA 1SE4A 3S2DH 3S16B 1IBKQ 5FJ8G 2VW9A 1PH1A 2PZWA 2F4VQ 4A3KB 3EQLC 4L5TA 4ZQ3A 3PV0A 3WOEA 1SEBD 3LX0A 1C48A 1YI2A 1GUTA 2FMMA 5C0XH 4B3MQ 1PDQA 4A3IB 5C0XJ 1ONLA 1HCZA 1LM0A 3GD7A 4KHVA 3UI2A 4X3SA 1JOQA 3U9SA 2E74C 5C44G 4DR2Q 4C3HH 3M4QA 2BA0A 1I94L 3I55A 3IKJA 3H15A 1F2ZA 4A93G 4DR6Q 1DONA 1QB5D 3TP7A 3GV3A 3T1HL 2XRQD 3MC0B 3OIPA 4A3FH 4QCLA 4ODGA 2YV5A 1VQAA 1VQ4A 4EVOA 1FNWA 4QJFA 4HCSA 5H1SE 1LABA 3KDFB 4CJ2C 5JPMC 1EWCA 2CQAA 4IUPA 1HH2P 1Y1WB 4C3IB 1E22A 1PYWD 3OW2A 3GV6A 4EX5A 3K58A 1SDFA 2Z4IA 2KUMA 4GNXC 4PV1C 3PIP3 2VQFQ 1V1PB 5HGTA 5D3IB 1LUZA 5K36H 2QEJC 1MJCA 4NMZA 4G57A 5J3BA 2CH4A 2NZOA 5I2YA 1CT1D 2HHHL 4K6LA 3Q8DA 1JB7A 2I5HA 1E2ZA 3HKZE 3NP8A 5CBEE 3J80i 4MN3A 2WFWA 2QA4A 3HRZC 5IP9H 4BS9A 1IBLL 2QDBA 2B3GA 1N34L 3PO2G 3UDGA 1SNPA 1X32A 3CMAA 4HTHA 3EBEA 4K6DA 3UDFA 3H6MA 4LF8Q 2C5CA 1TU2B 4DAVA 4XQNA 4X65L 2BH8A 2L12A 1TWGB 2JEBI 1PHJA 1GUNA 4OGQC 2HHHQ 4KJOA 2EPBA 1JMCA 4X65Q 4BBRH 4JBMA 3M4PA 2LS01 1Y1WH 3C3LA 4DR7Q 5I9PA 2FINB 5A2QL 1K73C 1CTMA 1HNZQ 1OTCA 1N34Q 1AE2A 4YCWA 4BY7G 1CM9A 3IAYA 4DK0A 1C9OA 4JBKA 4ZRZA 2Y0SG 5C4XG 1H9SB 4HSPA 2JA5B 4K5XA 1HR0W 4QGUA 4DN4M 2WACA 1V43A 1YNNC 1BF4A 4G7OC 1G6PA 2F0IA 4ME3A 5IP7H 2E2JB 3J7A5 2PO4A 2K1BA 1XTCD 3H0GH 2QW7A 4KY5A 5DM63 4BBRG 1N36L 3A8KE 4OXPA 5EJWA 4JVZA 1WI5A 2JA6B 4PZ7A 3CPFA 2F0UA 5ELCA 2IX0A 4JI6Q 1BR9A 4C2MH 1I3QH 5KRUA 1M4VA 2PQAB 2PQAA 3EN2A 5I2XA 1HUMA 2KCNA 1A6XA 2Q2TA 5K5PA 1MI2A 4LF6Q 4IUQA 3FKIG 1I94Q 3K80C 3PO2H 3OMGA 3MXPA 5GAEC 1KLGD 2E8GA 1FNUA 5JOBA 1EY4A 3LNNA 2NVXH 1V1OA 1A63A 2EDGA 1LO5D 4LUOA 5E3FA 1VQOA 1FD7D 1SNDA 3K57A 4PMWA 1QE6A 3JAML 1BBUA 3CC2A 1LTRD 4RFBA 1AZPA 3PUWA 3PUXA 5IP9G 3EJIA 4X66L 2MNAA 3RUZA 2E2JH 4JBWA 1WD1A 2Z1CA 4G7HC 4OO1G 2K5QA 4YWKA 4KKSA 3URYA 4HIKA 1VQCA 3K7AB 1YVCA 2PMZE 2Y0SE 3QIAA 1OXTA 3G4SA 2VL6A 4LFBQ 1QOHA 2I5MX 4A76A 1CI3M 4JI5Q 4TKOB 1I3QB 2KECA 2JEAI 3A0JA 4MTKA 2HQLA 2NB0A 2A73B 1TWHH 2OWOA 3Q0AA 1D7QA 1DCZA 3J7YW 1M1KC 1U5KA 4XT3B 3HP3A 1AW7A 4KJNA 5DM73 3VA7A 4DR4L 5C44H 1TS3A 1YJWA 3SE0A 3CHBD 3LWUA 2BA1A 2EY5A 5J39A 4LF4Q 1MJEA 3HOZH 3J81E 2EZVA 4MZ9A 3R93A 1VQ5A 1SNMA 1VQMA 1B3QA 3S1QH 5LMUL 2K5NA 2H1EA 2JA7B 1Q7YC 1Q81C 2ZXPA 2WKCA 4X64Q 3RZDB 1RIPA 1B44D 4OO1I 5CV6A 3T56B 1A3UA 3KF8B 1A62A 4V190 3S14H 2HCCA 2OTLA 3OWFA 3CF5A 5NUCA 3RZOB 2WP8J 2PNHA 3AQQA 4C3JB 1K28A 4DNRB 3PQIA 4BXXG 1SLJA 3PMFA 5KNBA 2PZUA 1YNND 5IWAQ 3DEOA 1TWAB 1RL2A 1NJIC 1U0LA 3ZJYC 2NN6H 4DV3Q 1EWHA 1Y8OB 1Q8KA 1PZKD 4RCNA 2J4XA 4A3CG 1W3SA 3I72A 2L4NA 2JA6H 1TY0A 5TSSA 3A7AB 4J8QA 1NSNS 5CBAE 2YTXA 3GQBA 3CPWA 2MUYA 4K0KQ 3I73A 3MAQA 1AE3A 3NQIA 4DAMA 4ABNA 4IFDG 3OYYA 2KENA 1N36Q 1JWSD 4OX9Q 1STNA 1UWVA 2EIFA 4MNOA 1PFSA 2Z0SA 1B1ZA 2A6ED 3RR5A 3O13A 2EYLA 3S15B 5IYDH 3S1MH 1HFNA 1I5FA 4KD3A 1JJCB 4ZAIA 4Y52H 1SYDA 1KABA 3RZDH 1EFID 1F77A 1A3VA 3D4DA 1IKMA 4GLAC 1ENFA 4XT1B 1EYAA 3HOZG 5CORA 4IUVA 4LFCQ 2CW0C 2XGTA 4JOIA 2VS1A 1IYUA 1A15A 3K59A 4F8MA 1E2VA 2CCZA 4C3JH 4RGMA 1CQFA 1VDZA 4DR6L 4JI7L 2TMPA 4KHPL 2WB1G 2SEBD 2UUBL 1JICA 3GTKB 1HFGA 2D0OA 1BCPD 1XJVA 1QZHA 1SE8A 5FK9C 1JC7A 1F9PA 3M7GA 4JI4Q 3CCRA 3SXHA 4OWTB 4KMUC 4YY3Q 3I4NG 1Z47A 1GOZA 5EBDA 2N78A 4AH6A 2B29A 1SJHD 1XXGA 2DNCA 1Q86C 2IJ0A 2F0HA 1K8AC 2O2LD 1K3RA 3NBHA 4K5WA 4KTAA 3CCSA 1TWCB 1EU4A 2B2UC 4OO1H 4RKBA 2Q2HA 4G7ZC 1SYFA 5G3LD 1O7ZA 4DPGA 2KHIA 4O1NA 5FO9B 1G51A 4JI5L 5J1ZA 1K3BC 2L15A 2PCFB 3CCLA 4LF9Q 3TZUA 2F0JA 4FXKC 3J81i 1SMYD 4HEDA 3SGIA 5DNFA 4A3CH 1I6HB 5M3FB 1L1OA 1KDBA 2K6AA 1EOVA 2KCTA 5LL6S 3I4MH 4DKAC 1HHVA 4DUZQ 5BR8L 4JI2L 3T51B 2L0CA 3TEHB 5BN3A 2HT1A 1UEBA 1U9RA 2EXDA 2C9OA 1A0IA 1E0BA 2R7FA 2QKIC 4Y7NH 1V1PA 5KGUA 1HZAA 1LACA 2KVMA 1R4QB 3HOVG 4JI1L 2K4KA 1SE2A 3SK6A 1EY7A 2F0SA 2A74C 2DJGC 1MIUA 1ESFA 3J80c 4PQXA 4LF5Q 1I6VC 2B2YA 1I4XA 3NE5B 2JE6I 2R92H 5FLXE 3CCEA 3TP8A 1WFQA 3NXWA 5T1GA 2UUAL 1UNSA 3CW2C 5KYLA 1RDPD 2EE1A 4P2CB 5FLXc 3J7AV 3OTOQ 4OELB 1YNJC 2KQ3A 1HNZL 3NSWA 2F1MA 2M00A 4JPBW 1I4RA 3DUZA 1HTLD 2EY2A 4JYAL 3K5OA 1Q1BA 1PTOF 3SEBA 4BY7H 2JJQA 2LXJA 3NEMA 1RCVD 3KBGA 4ULLA 4A3GG 3KUPA 1SROA 5C3WA 1CUKA 4B9XA 5CMDA 4Q0FA 5C3XA 4DR5L 1TXYA 1XMQQ 1SR3A 2XWJB 1PXUA 4X62Q 5BN4A 3K7AH 1XPUA 4QUFA 3DWAA 2YYZA 2IPKD 3T1YQ 1J5EQ 3UE0A 1NCVA 4F87A 5JEAH 4JG2A 4UY8C 2E2DC 1EUJA 4KHZA 1PV4A 1SYEA 3GTMB 4IURA 3C1FA 1KNEA 3BVMA 4JI3L 2NVQH 2B2VA 4M1UB 2K52A 5CV9A 4DK3C 1B4OA 1N33Q 1CA6A 2UUCQ 3MXGA 5GAGC 1HRJA 3ZYYX 3CCMA 3CCUA 1FL0A 4X62L 1FNVA 3ULLA 1JT8A 3S1NH 5KNCA 4JI7Q 1SYGA 4ZK9B 2RCFA 3D3RA 1PH8A 4IFDI 3R2TA 4X66Q 3TQYA 4GLVB 1YZ6A 5IGGA 1I4GA 1U4LA 2F0EA 1H9SA 4BY7B 3S2HB 1Q46A 5BN5A 5M3MB 2E2HB 4IN3A 4TQUS 4LF6L 3K5LA 5FOBB 1DJRD 4I65A 4OWWB 3H3VH 3VA5A 4A4IA 2JYOA 2VQFL 1PH3A 4CKBA 1EZ8A 5FLXL 4A3BG 2OF1A 4PNYA 3JAMi 2L1BA 1IBML 4HJ7A 3ONAB 1Y14B 1EQQA 4N9TA 2B8GA 1F2YA 2A68C 1O7IA 3NQTA 2L11A 1DGSA 4YHHQ 5IP7G 1WYDA 1VQGA 1O7LA 4JI0L 3HOWG 2JN4A 4BBSG 4C1NI 4LFBL 2MGSA 5EAYA 3U4ZA 4X3UA 4A75A 1BCPB 2BDNA 5ELFA 2UXBQ 1WTOA 5IGCA 1XNQL 3EROA 4F88A 5IGEA 5DAUA 1X3EA 2G9DA 4XQJA 4DV3L 1GM5A 4A3DG 4KK7A 2NBFA 2NVXB 2IWHA 4XDXA 3U4VA 1VQLA 3I3CA 3D4WA 4N8FA 3FVQA 2A68D 3VYSA 2RDFA 4K14A 5JPNC 3QR8A 5C0XG 2F0DA 4DUYL 3S17H 1WTHA 4GOPA 1BNZA 4PG3A 5EKKA 1S3OA 2XNAC 3K5NA 3KF6B 4YHHL 3G48A 3LGJA 5M9OA 4DAPA 1XNRQ 2A6HC 5FJ8H 2R61A 4U68A 3MA2B 5CC4A 4IJHA 4LJZC 3RN5A 2DY7A 1UE7A 2K32A 3CP0A 4FF3A 2VQEL 1M90C 4P73A 4C3IG 1EIYB 3GDEA 2K5VA 5IY0A 4GKJQ 1Q82C 3MEFA 2F0OA 3T13A 3RLOA 1ILQA 4GLXA 2NN6I 1KAAA 3BG3A 2Z6KA 2CVRA 1KL9A 4BY1H 2VUMG 3K8AA 2KEDA 4L8JA 4A3MB 3SR1A 3ICEA 2A69C 5M5WH 3FDTA 1DOKA 3CD6A 1X3FA 5LHY1 2EJFC 1D6EC 1PZID 3D31A 5C0XI 2LXKA 3FPPA 5C44B 1KRTA 4LF8L 3FP9A 2V1CC 2F52A 1G2SA 2MPMA 3D8GA 4A3FB 3GTPB 3I90A 2HDMA 4H7BA 3TDQA 4B08A 3W1BA 4A3IG 4LAAA 4TVAB 3TMEA 4P72A 2QEXA 2F0FA 3V96A 3BVZA 4V0BA 4A3KG 3Q23A 3ULPA 2VZAA 3S1QB 4BBSB 1CHQD 1EY9A 4MHEA 1YHBA 4LW1A 1SNOA 4R8NA 1IYJB 2SOBA 2X6GA 1YJNA 1K0SA 3UDXA 1HR0Q 3GTJH 2G5DA 4IUUA 2EJGC 4IQZA 3S1NB 2IY5B 3I4NH 2O5IC 3D6CA 4H13C 4HR7B 3RN2A 1NNXA 4JI8L 5M3FH 1ENAA 4RGNA 4IPDA 1PYBA 4ZYSA 5CV5A 1ZEQX 2A5HA 1HR0L 1JOOA 1JWMD 2IT1A 1SFOH 3EA6A 1HA5A 5JJKA 1L1OB 3F2UA 4B3RL 4TRDA 1JOKA 1VQJA 2BCOA 2A1AA 2O5JC 1KC8C 3E5SA 3CCJA 1IKLA 5AJ3Q 1IL8A 4ZKBB 1U4RA 5ELEA 2CH4W 5J22A 1HQMC 4UP7A 4L5RC 4A3JG 1B50A 3FRPB 1M8AA 4WFN3 2D62A 4B9WA 4KV6A 1JCKB 1GVPA 2MQHA 3W2DA 4EQOA 1IW7D 2XRSD 4MTNA 3UDIA 4QF4A 5IYDG 2F3IA 5L37A 1H9KA 5LMNQ 2JA8B 1SXTA 3RNUA 4ID6A 2KBNA 4KY7A 1VQ7A 1JJGA 4F7XA 1LTGD 1MHWC 1WTQA 4FF1A 1DOMA 3HOWH 4GS3A 3IFTA 4R4OA 2BE5D 1I50B 3QB3A 4XTCS 3AB9A 1WJJA 1NBWA 4DUYQ 3M4YA 3I4NB 5D3DA 4S3SA 1UE6A 1Q12A 2XN9C 5FLMH 4IOAA 5LMNW 4NW2A 4DR4Q 3DLLA 2NN6G 1L0XB 4YWMA 1FR3A 3KBXA 3GTOH 3OIQA 5GAHC 3MTSA 1EIHA 3SHLA 4FNFA 4WJ4A 3A5ZB 1S5DD 3PUYA 3V2TA 2AWOA 1NR2A 1PH7A 2ICIA 4LF4L 3HFZB 1WOCA 1PYSB 4DK1A 1BQQT 1S5CD 3D4RA 1ET9A 1PH5A 3I91A 2BOSA 2ZTEA 3KLSX 4L5QA 3PF5A 3J81c 2GA4B 4YIJA 1NAPA 4RKLA 1QWYA 1GO3E 1AH9A 3RZOH 4P71A 2B63H 4IOCA 1TR5A 2E75C 3QWNA 1TS5A 3KFUA 1GHJA 3FMCA 5IYCH 3QOLA 2I07B 1C0AA 4DUZL 1O80A 2NUCA 2ES2A 4XXEA 4DR1Q 2XWBB 3BDLA 2HIXA 1KNAA 1EZ6A 2WKDA 2PW7A 2WV6D 4NDXA 2PMZB 1EYDA 1RF2D 2UUCL 1X3PA 2EYHA 1ENCA 4JCVE 4LF7Q 4RHRA 2K33A 2OT2A 2L9HA 3VR3A 1B53A 4DV2Q 1SNQA 3V05A 4KKUA 3P75A 4DV6L 1ICFB 1OXSC 2OQKA 5IODA 4DV7Q 5HY6A 3ERSX 1PMRA 4H44C 3T1YL 1D5XC 1OXXK 4OEMB 5EKIA 4DV6Q 1EQTA 3U58A 1YNXA 3GTJB 5I4DA 3OHXC 1EIFA 2R93B 3T16A 4NXNL 2CQOA 1HZBA 1IYVA 1TS2A 4IPHA 5FKAC 2SDFA 2N88A 2RF4A 5A2QE 4CKEA 5FO7B 4K0KL 3N6RA 1MKHA 5IGDA 1FYCA 4BA1I 4HIDA 3OTOL 1CQVA 5IT9E 2UXCL 3H94A 3MXNA 2XVSA 2MO0A 1UUPA 1LTTD 4KKTA 1RHPA 1G8ZD 1VS0A 5IT9c 1E1TA 1V8QA 2QDLA 2UU9L 2IHFA 3HEJA 5AJ3L 4CDEC 3J7ZC 2QILA 4JI8Q 1N8RC 1DOLA 5M5YH 1HUNA 3FKIH 3S1RH 1H95A 2B2WA 1YITA 1BUVT 2WB1B 4JV5L 2JA7H 4GN3B 5I6WA 2X6LA 5LMUQ 1PH4A 1MD2D
chains in the Genus database with same CATH topology
2Q2UA 1KD1C 2UUBQ 2MFIA 1I50H 3CAMA 2K4KA 3I4MG 5LMNL 4JOIC 2AKWB 3G71A 1MIUA 3S2DH 4NB3A 3J80c 4POGA 4LF5Q 4BXXH 1I6HH 1IBKQ 5FJ8G 1VQDA 2VW9A 1PH1A 3AYHB 1HJPA 5IYBG 2F4VQ 3BU2A 2JE6I 1K9MC 4L5TA 2R92H 3PV0A 3CCEA 1YI2A 1W2BA 1EWIA 1WFQA 2UUAL 3CW2C 4O0AA 2E5LL 4B3SL 1TWCH 1QUQB 4B3MQ 2UXCQ 5FLXc 5C0XJ 3VDYA 3OTOQ 1LM0A 3GD7A 3PIOA 3L2PA 1SN8A 4IPCA 4IPGA 1HNZL 5M3MH 1ASYA 2E2HH 1VQNA 1V9PA 3CXCA 2NVYH 4JBJA 5C44G 4GN4B 1Y1VG 2QGQA 4DR2Q 3JAMc 4C3HH 3M4QA 4JI1Q 1WCMH 2UU9Q 4JYAL 1Q1BA 2BA0A 1I94L 3DM3A 4BY7H 2JJQA 3I55A 4GKKQ 2LXJA 3NEMA 3H15A 4A93G 4DR6Q 5M3FG 2LSSA 4PZ6A 2A8VA 4A3GG 1PVOA 1SROA 1CUKA 1IZ6A 1NMFA 3T1HL 4A3JH 4DR5L 1TXYA 4XIGS 4A3FH 1XMQQ 5ELOA 2YV5A 4DV5Q 1VQAA 3E0EA 1VQ4A 1SR3A 3PSIA 4UP8A 4X62Q 4QJFA 3K7AH 4DV0L 1XPUA 2YTYA 5H1SE 3HOUG 1UE1A 2YYZA 3KDFB 3I56A 3T1YQ 2I5LX 3PO3H 3BZKA 5GADC 1J5EQ 1HH2P 2CWAA 3UE0A 2R6GA 3HKSA 4B3TQ 1KRSA 4LFAL 1NTGA 4JG2A 3PCOB 4FDBA 1E22A 4RG1A 1P8LA 3OW2A 4UY8C 1EUJA 2MO1A 2PI2E 4KHZA 1QVFA 1PV4A 4EX5A 5E7NA 3TS2A 2ZTCA 3NENA 1X9NA 4GNXC 4JI3L 4LFAQ 2NVQH 1CSPA 2VNUD 2VQFQ 2K52A 4O2DA 1LUZA 1BKBA 4YCVA 4DK3C 1N33Q 2UUCQ 5GAGC 3PUVA 1MJCA 4HIMA 3S15H 5J3BA 2NZOA 1JE5A 1G291 3CCMA 2HHHL 3Q8DA 3CCUA 2FXQA 1JB7A 2I5HA 3HKZE 3L7ZC 3GTKH 1FL0A 4X62L 1JT8A 3ULLA 3S1NH 4GN5A 4JI7Q 4IFDJ 3J80i 1KIXA 2OCEA 2WFWA 5GROA 2QA4A 1PH8A 5IP9H 4IFDI 4X66Q 2VQEQ 3TQYA 4GLVB 1YZ6A 3MXNB 1IBLL 4B3TL 3F8TA 2JQOA 2B3GA 1N34L 3CCQA 4JI0Q 2ATWA 3UDGA 3PO2G 3CMAA 3GTQH 1CKNB 1Q46A 1VQBA 3EBEA 3GO5A 4TQUS 3UDFA 1HNXQ 4LF6L 3IRBA 1PH9A 1QUQA 4LF8Q 1CKMA 3PIPA 4DV5L 2BH2A 4X65L 4OWWB 2BH8A 3H3VH 2JEBI 1PHJA 4A4IA 2VQFL 3RLFA 4UP9A 1PH3A 3NBHB 2GVBA 1GKHA 2OQ0A 3CQZH 3KDFA 2HHHQ 4A3BG 2WB1E 4IJLA 3JAMi 1JMCA 3HOUH 1IBML 4HJ7A 2UXDL 1Y14B 1YHAA 1VQKA 4X65Q 4L5SA 1EQQA 2DUDA 4BBRH 4YY3L 4JBMA 3M4PA 4BY1G 2VUMH 4GNXB 1Y1WH 1O7IA 2N8NA 4DR7Q 4WJ3M 4JI3Q 1K73C 1DGSA 2RHSB 4YHHQ 1HNZQ 2GVAA 4QL5A 5IP7G 1OTCA 1WYDA 1VQGA 1N34Q 4JI0L 1IBKL 3HOWG 1AE2A 2NVTH 4A93H 4BBSG 1IBLQ 3GTLH 4YCUA 4LFBL 2RHQB 4A3EH 4DV2L 2Z6KC 5EAYA 1VQPA 4YCWA 3U4ZA 2WAQG 4JI6L 4BY7G 1XPRA 2OTJA 4A75A 4C3IH 2UXBQ 4DV4Q 1C9OA 4JBKA 2Y0SG 2CFMA 1XNQL 5C4XG 2AWNA 3GTMH 1X3EA 3STBD 1YBYA 3F2DA 4DV3L 1FJGQ 1GM5A 4A3DG 3ER0A 1YIJA 5C3EG 3H0GG 3U4VA 4DV4L 4QGUA 1R9TH 1HR0W 1VQLA 3PF4A 4A3EG 1V43A 5C0XG 2YU9H 5M5XH 4BBSH 4DUYL 3S17H 1GD7A 1G6PA 4ME3A 4GOPA 4PG3A 3RLNA 5IP7H 1S3OA 1NMGA 3J7A5 3CC4A 3KF6B 1CKNA 4YHHL 2PI2A 3G48A 3LGJA 3H0GH 1PH6A 5C3EH 1XNRQ 4BBRG 5FJ8H 4DV1L 1N36L 4AIMA 4OXPA 1SMXA 1WI5A 4GOPC 3RN5A 4IJHA 1IL2A 5JJIA 3TREA 4PZ7A 5C4XH 4OX9L 2HIVA 1UE7A 3CP0A 2N3SA 3CPFA 2VQEL 4A3BH 2IX0A 1M90C 4P73A 4JI6Q 4C2MH 1KAWA 4LF6Q 2CWPA 1P16A 3HOXH 1EIYB 1I3QH 1VQEA 3HKZG 1C7YA 3GDEA 2K5VA 2PQAB 1KHIA 2PQAA 3EN2A 5DLQE 5IY0A 1EQRA 4GKJQ 3JC66 3MEFA 1Q82C 2Q2TA 2JA7G 3RLOA 1KQSA 1VCIA 2VY3A 1HNXL 1XMOL 4EQ5A 3FKIG 2I0QA 4GLXA 1I94Q 2NN6I 1KXLA 2Z6KA 3K80C 3PO2H 1KL9A 4BY1H 2VUMG 3B6YA 3K8AA 4GKJL 4LFCL 2R93G 2JK8A 1BVSA 5C4JH 4UPAA 3S24A 5GAEC 1BBWA 1XMQL 4AYBE 2E8GA 2UXDQ 4HJ5A 3ICEA 5M5WH 4GOPB 2NVXH 3CD6A 1QVCA 1X3FA 2R7ZG 1SRUA 3D31A 5C0XI 1A63A 2LXKA 2IX1A 1E1OA 4LUOA 1VQOA 4JYAQ 3BZCA 1KRTA 2UUAQ 4LF8L 3FP9A 2V1CC 2F52A 4PMWA 1PA6A 4JI4L 1BBUA 4YWLA 3L0OA 3CC2A 3TS0A 3W1BA 3PUWA 3K81C 4A3IG 2K50A 3E9HA 3PUXA 4TVAB 1B70B 1TWFH 3AFQA 4P72A 5IP9G 3A74A 4X66L 1ASZA 1L1OC 2QEXA 2MNAA 2E2JH 3HOYH 1OXUA 4NXMQ 4JBWA 4KHPQ 4X6AH 4HJ8A 2R7ZH 2H5XA 4A3KG 4OO1G 3ULPA 1QVGA 1J5EL 4YWKA 2VZAA 2WAQE 4HIKA 3PO3G 1L0WA 1YHBA 4LW1A 1EFWA 1VQCA 4A3MH 1IYJB 1YVCA 2PMZE 2C35B 2Y0SE 3BJUA 4R4CA 3F2CA 1OXTA 1YJNA 3G4SA 1TWAH 2VL6A 4LFBQ 3UDXA 1HR0Q 2K5HA 3GTJH 3M3YH 2I5MX 4A76A 3U50C 4JI5Q 3I4NH 2IY5B 3RN2A 2JEAI 3A0JA 2HQLA 4H02A 4JI8L 3ULJA 3KJOA 4IPDA 1TWHH 5M3FH 1PYBA 1YHQA 1PH2A 2OWOA 4B3RQ 1D7QA 1HR0L 4PZ8A 4DR7L 1M1KC 1U5KA 2IT1A 1SFOH 3HOXG 5JEAG 1VQ8A 4GNXA 1WCMG 5GQOA 5JJKA 1L1OB 4DR4L 5C44H 1K83H 3EIVA 4B3RL 1YJWA 5M3MG 1VQJA 4HJ9A 2A1AA 4KLKA 1KC8C 3PUZA 3CCJA 5AJ3Q 4JC0A 4ALPA 4APVA 4DR4Q 2BA1A 4AQYQ 4UP7A 4LF5L 4L5RC 4A3JG 3H3VI 4LF4Q 4R1JA 1X54A 4LF9L 1MJEA 3HOZH 4A3GH 3M4OH 2D62A 4MZ9A 1VQ5A 2XTIA 3KOJA 2R92G 1GVPA 2MQHA 2A19A 5IYBH 1VQMA 2DGYA 1NE3A 3S1QH 5LMUL 4MTNA 4A3DH 3UDIA 1Y1VH 2K5NA 4RMFA 4NXML 5IYDG 4HJAA 1Q7YC 1Q81C 2F3IA 5LMNQ 1S40A 3RNUA 3M9BA 2AHOB 4LF7L 3AEVA 4JI2Q 4X64Q 1TWGH 1RIPA 2KBNA 3UE1A 1VQ7A 4OO1I 3S2HH 1JJGA 2RCNA 3HOWH 3KF8B 1A62A 3KJPA 4GS3A 4NXNQ 3S14H 1YEZA 1X55A 4R4OA 1VQHA 2OTLA 3CF5A 1Y1WG 1Q1EA 2WP8J 4XTCS 2PNHA 3AQQA 1N9WA 1E24A 1WJJA 1HZCA 1NBWA 4DNIA 1A8VA 4DUYQ 1UE5A 1D8LA 4DAYB 1SLJA 1B7YB 3FHWA 2JA8G 4BXXG 1UE6A 5IE8A 1Q12A 5IWAQ 4A3LH 5FLMH 4IOAA 1RL2A 1NJIC 1U0LA 5LMNW 2Q2IA 3ZJYC 2NN6G 4YWMA 1X3GA 1X65A 3G6EA 3DLLA 1Q8KA 4DV3Q 3D0FA 3HOVH 3CMEA 3GTOH 4QIWE 4A3LG 5GAHC 4A3CG 1W3SA 3F1ZA 2JA5G 4GKKL 4WJ4A 3A5ZB 2ZM6L 2JA8H 3PUYA 2JA6H 2AWOA 3I4OA 2K14A 2ID0A 1PH7A 1N32L 4KI0A 4LF4L 3HFZB 1WOCA 3I7FA 1PYSB 2UXBL 4DR5Q 2YTXA 4IO9A 1PH5A 3CPWA 1HNWQ 4K0KQ 1AE3A 2ZTEA 4L5QA 4DAMA 3PF5A 4IFDG 1LYLA 3OYYA 2KENA 3J81c 1K8GA 2CKZB 1GO3E 2EQSA 4DV1Q 1NY4A 1N36Q 3I2ZA 1AH9A 4OX9Q 3K0XA 3RZOH 4P71A 4LWCA 1UWVA 1FJGL 5HGQA 2EIFA 4MNOA 4R4QA 1PFSA 4POFA 2Z0SA 3RR5A 4DV7L 4IOCA 2B63H 2JA9A 4DK6C 5IYDH 4AQYL 3KFUA 3S1MH 5IYCH 4J15A 5JEAJ 5K36G 1HZ9A 1I5FA 1JJCB 1VQIA 4P75A 4Y52H 1C0AA 1FGUA 4DUZL 3WWVA 1CSQA 3RZDH 2ZTDA 4LUVA 2ES2A 1XTDA 4GLAC 2ZJPA 4NPSA 4DR1Q 2ZJQA 2HIXA 5JJLA 3M7NA 3HOZG 4LFCQ 4QQBX 2K75A 2XGTA 4R4TA 2VS1A 4JOIA 2UUCL 4JCVE 4C3JH 2CCZA 4LF7Q 4HIOA 4DR6L 4JI7L 4BA2I 4KHPL 3PGZA 2WB1G 3KF6A 4P74A 4DV2Q 1QZGA 3GTPH 4DV6L 2UUBL 3E9IA 2D0OA 1OXSC 4A3FG 1QZHA 1XJVA 2OQKA 4DV7Q 5HY6A 3ERSX 4AYBG 1SE8A 4JI4Q 3CCRA 2R7DA 4OWTB 4JV5Q 3T1YL 4YY3Q 3I4NG 1OXXK 1Z47A 2GN5A 4DV6Q 3K7UC 4QY7A 3NELA 3U58A 1YNXA 2N78A 4AH6A 2B29A 4LUZA 2E5LQ 2IHEA 1Q86C 5ELNA 1K0RA 1N32Q 4A3MG 1K8AC 1EIFA 1IXRA 3T1HQ 1K3RA 2KCMA 4B3SQ 4DR3L 2B63G 2KHJA 2CQOA 1HZBA 4NXNL 3CCSA 2E2IH 3KLWA 4A3KH 1XPOA 1XNQQ 1FVIA 4IPHA 4DV0Q 3HOYG 2ASBA 2YTVA 2F4VL 2Q2HA 2RF4A 4LNQA 2ALYB 3F2BA 4DPGA 3M85A 2KHIA 3STBC 1LTLA 1OXVA 1VQFA 5IWAL 4A3IH 4K0KL 1G51A 1B8AA 4JI5L 1MKHA 2L15A 3A5UA 1JJ2A 3CCLA 4LF9Q 1V1QA 2NZHA 4BA1I 2N49A 1VQ9A 4HIDA 3OTOL 2JA6G 5IYCG 3J81i 4B3ML 2D0PA 3S16H 3SGIA 5BR8Q 2UXCL 4A3CH 4OONA 2ZM6Q 1L1OA 2MO0A 1XNRL 1XMOQ 1EOVA 1E7ZA 2KCTA 3W5OA 1IBMQ 3I4MH 1VS0A 4DKAC 5IT9c 4DR2L 3GTGH 1E1TA 1N33L 2UU9L 5FLMG 4DUZQ 4DR3Q 4DR1L 1VQ6A 2IHFA 3TRZA 1YJ9A 5BR8L 2ZJRA 1HNWL 4OWXB 4R4IA 5AJ3L 4JI2L 3TEHB 1CKOA 3J7ZC 3CC7A 3CCVA 2HT1A 1UEBA 1X6OA 1Z9FA 1L2FA 3KYHC 2R93H 2AMCB 2EXDA 4X64L 4JI8Q 1S72A 1X56A 1N8RC 5M5YH 1A0IA 1J6QA 3AFPA 3FKIH 2R7FA 1E3PA 3S1RH 1YITA 4Y7NH 1H95A 3J81j 1T9HA 2JA7H 4GN3B 4JV5L 3W1GA 2JA5H 1HZAA 5LMUQ 1PH4A 3HOVG 4JI1L 1EYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q2U A;  1KD1 C;  2UUB Q;  2MFI A;  1I50 H;  3CAM A;  2K4K A;  3I4M G;  5LMN L;  4JOI C;  2AKW B;  3G71 A;  1MIU A;  3S2D H;  4NB3 A;  3J80 c;  4POG A;  4LF5 Q;  4BXX H;  1I6H H;  1IBK Q;  5FJ8 G;  1VQD A;  2VW9 A;  1PH1 A;  3AYH B;  1HJP A;  5IYB G;  2F4V Q;  3BU2 A;  2JE6 I;  1K9M C;  4L5T A;  2R92 H;  3PV0 A;  3CCE A;  1YI2 A;  1W2B A;  1EWI A;  1WFQ A;  2UUA L;  3CW2 C;  4O0A A;  2E5L L;  4B3S L;  1TWC H;  1QUQ B;  4B3M Q;  2UXC Q;  5FLX c;  5C0X J;  3VDY A;  3OTO Q;  1LM0 A;  3GD7 A;  3PIO A;  3L2P A;  1SN8 A;  4IPC A;  4IPG A;  1HNZ L;  5M3M H;  1ASY A;  2E2H H;  1VQN A;  1V9P A;  3CXC A;  2NVY H;  4JBJ A;  5C44 G;  4GN4 B;  1Y1V G;  2QGQ A;  4DR2 Q;  3JAM c;  4C3H H;  3M4Q A;  4JI1 Q;  1WCM H;  2UU9 Q;  4JYA L;  1Q1B A;  2BA0 A;  1I94 L;  3DM3 A;  4BY7 H;  2JJQ A;  3I55 A;  4GKK Q;  2LXJ A;  3NEM A;  3H15 A;  4A93 G;  4DR6 Q;  5M3F G;  2LSS A;  4PZ6 A;  2A8V A;  4A3G G;  1PVO A;  1SRO A;  1CUK A;  1IZ6 A;  1NMF A;  3T1H L;  4A3J H;  4DR5 L;  1TXY A;  4XIG S;  4A3F H;  1XMQ Q;  5ELO A;  2YV5 A;  4DV5 Q;  1VQA A;  3E0E A;  1VQ4 A;  1SR3 A;  3PSI A;  4UP8 A;  4X62 Q;  4QJF A;  3K7A H;  4DV0 L;  1XPU A;  2YTY A;  5H1S E;  3HOU G;  1UE1 A;  2YYZ A;  3KDF B;  3I56 A;  3T1Y Q;  2I5L X;  3PO3 H;  3BZK A;  5GAD C;  1J5E Q;  1HH2 P;  2CWA A;  3UE0 A;  2R6G A;  3HKS A;  4B3T Q;  1KRS A;  4LFA L;  1NTG A;  4JG2 A;  3PCO B;  4FDB A;  1E22 A;  4RG1 A;  1P8L A;  3OW2 A;  4UY8 C;  1EUJ A;  2MO1 A;  2PI2 E;  4KHZ A;  1QVF A;  1PV4 A;  4EX5 A;  5E7N A;  3TS2 A;  2ZTC A;  3NEN A;  1X9N A;  4GNX C;  4JI3 L;  4LFA Q;  2NVQ H;  1CSP A;  2VNU D;  2VQF Q;  2K52 A;  4O2D A;  1LUZ A;  1BKB A;  4YCV A;  4DK3 C;  1N33 Q;  2UUC Q;  5GAG C;  3PUV A;  1MJC A;  4HIM A;  3S15 H;  5J3B A;  2NZO A;  1JE5 A;  1G29 1;  3CCM A;  2HHH L;  3Q8D A;  3CCU A;  2FXQ A;  1JB7 A;  2I5H A;  3HKZ E;  3L7Z C;  3GTK H;  1FL0 A;  4X62 L;  1JT8 A;  3ULL A;  3S1N H;  4GN5 A;  4JI7 Q;  4IFD J;  3J80 i;  1KIX A;  2OCE A;  2WFW A;  5GRO A;  2QA4 A;  1PH8 A;  5IP9 H;  4IFD I;  4X66 Q;  2VQE Q;  3TQY A;  4GLV B;  1YZ6 A;  3MXN B;  1IBL L;  4B3T L;  3F8T A;  2JQO A;  2B3G A;  1N34 L;  3CCQ A;  4JI0 Q;  2ATW A;  3UDG A;  3PO2 G;  3CMA A;  3GTQ H;  1CKN B;  1Q46 A;  1VQB A;  3EBE A;  3GO5 A;  4TQU S;  3UDF A;  1HNX Q;  4LF6 L;  3IRB A;  1PH9 A;  1QUQ A;  4LF8 Q;  1CKM A;  3PIP A;  4DV5 L;  2BH2 A;  4X65 L;  4OWW B;  2BH8 A;  3H3V H;  2JEB I;  1PHJ A;  4A4I A;  2VQF L;  3RLF A;  4UP9 A;  1PH3 A;  3NBH B;  2GVB A;  1GKH A;  2OQ0 A;  3CQZ H;  3KDF A;  2HHH Q;  4A3B G;  2WB1 E;  4IJL A;  3JAM i;  1JMC A;  3HOU H;  1IBM L;  4HJ7 A;  2UXD L;  1Y14 B;  1YHA A;  1VQK A;  4X65 Q;  4L5S A;  1EQQ A;  2DUD A;  4BBR H;  4YY3 L;  4JBM A;  3M4P A;  4BY1 G;  2VUM H;  4GNX B;  1Y1W H;  1O7I A;  2N8N A;  4DR7 Q;  4WJ3 M;  4JI3 Q;  1K73 C;  1DGS A;  2RHS B;  4YHH Q;  1HNZ Q;  2GVA A;  4QL5 A;  5IP7 G;  1OTC A;  1WYD A;  1VQG A;  1N34 Q;  4JI0 L;  1IBK L;  3HOW G;  1AE2 A;  2NVT H;  4A93 H;  4BBS G;  1IBL Q;  3GTL H;  4YCU A;  4LFB L;  2RHQ B;  4A3E H;  4DV2 L;  2Z6K C;  5EAY A;  1VQP A;  4YCW A;  3U4Z A;  2WAQ G;  4JI6 L;  4BY7 G;  1XPR A;  2OTJ A;  4A75 A;  4C3I H;  2UXB Q;  4DV4 Q;  1C9O A;  4JBK A;  2Y0S G;  2CFM A;  1XNQ L;  5C4X G;  2AWN A;  3GTM H;  1X3E A;  3STB D;  1YBY A;  3F2D A;  4DV3 L;  1FJG Q;  1GM5 A;  4A3D G;  3ER0 A;  1YIJ A;  5C3E G;  3H0G G;  3U4V A;  4DV4 L;  4QGU A;  1R9T H;  1HR0 W;  1VQL A;  3PF4 A;  4A3E G;  1V43 A;  5C0X G;  2YU9 H;  5M5X H;  4BBS H;  4DUY L;  3S17 H;  1GD7 A;  1G6P A;  4ME3 A;  4GOP A;  4PG3 A;  3RLN A;  5IP7 H;  1S3O A;  1NMG A;  3J7A 5;  3CC4 A;  3KF6 B;  1CKN A;  4YHH L;  2PI2 A;  3G48 A;  3LGJ A;  3H0G H;  1PH6 A;  5C3E H;  1XNR Q;  4BBR G;  5FJ8 H;  4DV1 L;  1N36 L;  4AIM A;  4OXP A;  1SMX A;  1WI5 A;  4GOP C;  3RN5 A;  4IJH A;  1IL2 A;  5JJI A;  3TRE A;  4PZ7 A;  5C4X H;  4OX9 L;  2HIV A;  1UE7 A;  3CP0 A;  2N3S A;  3CPF A;  2VQE L;  4A3B H;  2IX0 A;  1M90 C;  4P73 A;  4JI6 Q;  4C2M H;  1KAW A;  4LF6 Q;  2CWP A;  1P16 A;  3HOX H;  1EIY B;  1I3Q H;  1VQE A;  3HKZ G;  1C7Y A;  3GDE A;  2K5V A;  2PQA B;  1KHI A;  2PQA A;  3EN2 A;  5DLQ E;  5IY0 A;  1EQR A;  4GKJ Q;  3JC6 6;  3MEF A;  1Q82 C;  2Q2T A;  2JA7 G;  3RLO A;  1KQS A;  1VCI A;  2VY3 A;  1HNX L;  1XMO L;  4EQ5 A;  3FKI G;  2I0Q A;  4GLX A;  1I94 Q;  2NN6 I;  1KXL A;  2Z6K A;  3K80 C;  3PO2 H;  1KL9 A;  4BY1 H;  2VUM G;  3B6Y A;  3K8A A;  4GKJ L;  4LFC L;  2R93 G;  2JK8 A;  1BVS A;  5C4J H;  4UPA A;  3S24 A;  5GAE C;  1BBW A;  1XMQ L;  4AYB E;  2E8G A;  2UXD Q;  4HJ5 A;  3ICE A;  5M5W H;  4GOP B;  2NVX H;  3CD6 A;  1QVC A;  1X3F A;  2R7Z G;  1SRU A;  3D31 A;  5C0X I;  1A63 A;  2LXK A;  2IX1 A;  1E1O A;  4LUO A;  1VQO A;  4JYA Q;  3BZC A;  1KRT A;  2UUA Q;  4LF8 L;  3FP9 A;  2V1C C;  2F52 A;  4PMW A;  1PA6 A;  4JI4 L;  1BBU A;  4YWL A;  3L0O A;  3CC2 A;  3TS0 A;  3W1B A;  3PUW A;  3K81 C;  4A3I G;  2K50 A;  3E9H A;  3PUX A;  4TVA B;  1B70 B;  1TWF H;  3AFQ A;  4P72 A;  5IP9 G;  3A74 A;  4X66 L;  1ASZ A;  1L1O C;  2QEX A;  2MNA A;  2E2J H;  3HOY H;  1OXU A;  4NXM Q;  4JBW A;  4KHP Q;  4X6A H;  4HJ8 A;  2R7Z H;  2H5X A;  4A3K G;  4OO1 G;  3ULP A;  1QVG A;  1J5E L;  4YWK A;  2VZA A;  2WAQ E;  4HIK A;  3PO3 G;  1L0W A;  1YHB A;  4LW1 A;  1EFW A;  1VQC A;  4A3M H;  1IYJ B;  1YVC A;  2PMZ E;  2C35 B;  2Y0S E;  3BJU A;  4R4C A;  3F2C A;  1OXT A;  1YJN A;  3G4S A;  1TWA H;  2VL6 A;  4LFB Q;  3UDX A;  1HR0 Q;  2K5H A;  3GTJ H;  3M3Y H;  2I5M X;  4A76 A;  3U50 C;  4JI5 Q;  3I4N H;  2IY5 B;  3RN2 A;  2JEA I;  3A0J A;  2HQL A;  4H02 A;  4JI8 L;  3ULJ A;  3KJO A;  4IPD A;  1TWH H;  5M3F H;  1PYB A;  1YHQ A;  1PH2 A;  2OWO A;  4B3R Q;  1D7Q A;  1HR0 L;  4PZ8 A;  4DR7 L;  1M1K C;  1U5K A;  2IT1 A;  1SFO H;  3HOX G;  5JEA G;  1VQ8 A;  4GNX A;  1WCM G;  5GQO A;  5JJK A;  1L1O B;  4DR4 L;  5C44 H;  1K83 H;  3EIV A;  4B3R L;  1YJW A;  5M3M G;  1VQJ A;  4HJ9 A;  2A1A A;  4KLK A;  1KC8 C;  3PUZ A;  3CCJ A;  5AJ3 Q;  4JC0 A;  4ALP A;  4APV A;  4DR4 Q;  2BA1 A;  4AQY Q;  4UP7 A;  4LF5 L;  4L5R C;  4A3J G;  3H3V I;  4LF4 Q;  4R1J A;  1X54 A;  4LF9 L;  1MJE A;  3HOZ H;  4A3G H;  3M4O H;  2D62 A;  4MZ9 A;  1VQ5 A;  2XTI A;  3KOJ A;  2R92 G;  1GVP A;  2MQH A;  2A19 A;  5IYB H;  1VQM A;  2DGY A;  1NE3 A;  3S1Q H;  5LMU L;  4MTN A;  4A3D H;  3UDI A;  1Y1V H;  2K5N A;  4RMF A;  4NXM L;  5IYD G;  4HJA A;  1Q7Y C;  1Q81 C;  2F3I A;  5LMN Q;  1S40 A;  3RNU A;  3M9B A;  2AHO B;  4LF7 L;  3AEV A;  4JI2 Q;  4X64 Q;  1TWG H;  1RIP A;  2KBN A;  3UE1 A;  1VQ7 A;  4OO1 I;  3S2H H;  1JJG A;  2RCN A;  3HOW H;  3KF8 B;  1A62 A;  3KJP A;  4GS3 A;  4NXN Q;  3S14 H;  1YEZ A;  1X55 A;  4R4O A;  1VQH A;  2OTL A;  3CF5 A;  1Y1W G;  1Q1E A;  2WP8 J;  4XTC S;  2PNH A;  3AQQ A;  1N9W A;  1E24 A;  1WJJ A;  1HZC A;  1NBW A;  4DNI A;  1A8V A;  4DUY Q;  1UE5 A;  1D8L A;  4DAY B;  1SLJ A;  1B7Y B;  3FHW A;  2JA8 G;  4BXX G;  1UE6 A;  5IE8 A;  1Q12 A;  5IWA Q;  4A3L H;  5FLM H;  4IOA A;  1RL2 A;  1NJI C;  1U0L A;  5LMN W;  2Q2I A;  3ZJY C;  2NN6 G;  4YWM A;  1X3G A;  1X65 A;  3G6E A;  3DLL A;  1Q8K A;  4DV3 Q;  3D0F A;  3HOV H;  3CME A;  3GTO H;  4QIW E;  4A3L G;  5GAH C;  4A3C G;  1W3S A;  3F1Z A;  2JA5 G;  4GKK L;  4WJ4 A;  3A5Z B;  2ZM6 L;  2JA8 H;  3PUY A;  2JA6 H;  2AWO A;  3I4O A;  2K14 A;  2ID0 A;  1PH7 A;  1N32 L;  4KI0 A;  4LF4 L;  3HFZ B;  1WOC A;  3I7F A;  1PYS B;  2UXB L;  4DR5 Q;  2YTX A;  4IO9 A;  1PH5 A;  3CPW A;  1HNW Q;  4K0K Q;  1AE3 A;  2ZTE A;  4L5Q A;  4DAM A;  3PF5 A;  4IFD G;  1LYL A;  3OYY A;  2KEN A;  3J81 c;  1K8G A;  2CKZ B;  1GO3 E;  2EQS A;  4DV1 Q;  1NY4 A;  1N36 Q;  3I2Z A;  1AH9 A;  4OX9 Q;  3K0X A;  3RZO H;  4P71 A;  4LWC A;  1UWV A;  1FJG L;  5HGQ A;  2EIF A;  4MNO A;  4R4Q A;  1PFS A;  4POF A;  2Z0S A;  3RR5 A;  4DV7 L;  4IOC A;  2B63 H;  2JA9 A;  4DK6 C;  5IYD H;  4AQY L;  3KFU A;  3S1M H;  5IYC H;  4J15 A;  5JEA J;  5K36 G;  1HZ9 A;  1I5F A;  1JJC B;  1VQI A;  4P75 A;  4Y52 H;  1C0A A;  1FGU A;  4DUZ L;  3WWV A;  1CSQ A;  3RZD H;  2ZTD A;  4LUV A;  2ES2 A;  1XTD A;  4GLA C;  2ZJP A;  4NPS A;  4DR1 Q;  2ZJQ A;  2HIX A;  5JJL A;  3M7N A;  3HOZ G;  4LFC Q;  4QQB X;  2K75 A;  2XGT A;  4R4T A;  2VS1 A;  4JOI A;  2UUC L;  4JCV E;  4C3J H;  2CCZ A;  4LF7 Q;  4HIO A;  4DR6 L;  4JI7 L;  4BA2 I;  4KHP L;  3PGZ A;  2WB1 G;  3KF6 A;  4P74 A;  4DV2 Q;  1QZG A;  3GTP H;  4DV6 L;  2UUB L;  3E9I A;  2D0O A;  1OXS C;  4A3F G;  1QZH A;  1XJV A;  2OQK A;  4DV7 Q;  5HY6 A;  3ERS X;  4AYB G;  1SE8 A;  4JI4 Q;  3CCR A;  2R7D A;  4OWT B;  4JV5 Q;  3T1Y L;  4YY3 Q;  3I4N G;  1OXX K;  1Z47 A;  2GN5 A;  4DV6 Q;  3K7U C;  4QY7 A;  3NEL A;  3U58 A;  1YNX A;  2N78 A;  4AH6 A;  2B29 A;  4LUZ A;  2E5L Q;  2IHE A;  1Q86 C;  5ELN A;  1K0R A;  1N32 Q;  4A3M G;  1K8A C;  1EIF A;  1IXR A;  3T1H Q;  1K3R A;  2KCM A;  4B3S Q;  4DR3 L;  2B63 G;  2KHJ A;  2CQO A;  1HZB A;  4NXN L;  3CCS A;  2E2I H;  3KLW A;  4A3K H;  1XPO A;  1XNQ Q;  1FVI A;  4IPH A;  4DV0 Q;  3HOY G;  2ASB A;  2YTV A;  2F4V L;  2Q2H A;  2RF4 A;  4LNQ A;  2ALY B;  3F2B A;  4DPG A;  3M85 A;  2KHI A;  3STB C;  1LTL A;  1OXV A;  1VQF A;  5IWA L;  4A3I H;  4K0K L;  1G51 A;  1B8A A;  4JI5 L;  1MKH A;  2L15 A;  3A5U A;  1JJ2 A;  3CCL A;  4LF9 Q;  1V1Q A;  2NZH A;  4BA1 I;  2N49 A;  1VQ9 A;  4HID A;  3OTO L;  2JA6 G;  5IYC G;  3J81 i;  4B3M L;  2D0P A;  3S16 H;  3SGI A;  5BR8 Q;  2UXC L;  4A3C H;  4OON A;  2ZM6 Q;  1L1O A;  2MO0 A;  1XNR L;  1XMO Q;  1EOV A;  1E7Z A;  2KCT A;  3W5O A;  1IBM Q;  3I4M H;  1VS0 A;  4DKA C;  5IT9 c;  4DR2 L;  3GTG H;  1E1T A;  1N33 L;  2UU9 L;  5FLM G;  4DUZ Q;  4DR3 Q;  4DR1 L;  1VQ6 A;  2IHF A;  3TRZ A;  1YJ9 A;  5BR8 L;  2ZJR A;  1HNW L;  4OWX B;  4R4I A;  5AJ3 L;  4JI2 L;  3TEH B;  1CKO A;  3J7Z C;  3CC7 A;  3CCV A;  2HT1 A;  1UEB A;  1X6O A;  1Z9F A;  1L2F A;  3KYH C;  2R93 H;  2AMC B;  2EXD A;  4X64 L;  4JI8 Q;  1S72 A;  1X56 A;  1N8R C;  5M5Y H;  1A0I A;  1J6Q A;  3AFP A;  3FKI H;  2R7F A;  1E3P A;  3S1R H;  1YIT A;  4Y7N H;  1H95 A;  3J81 j;  1T9H A;  2JA7 H;  4GN3 B;  4JV5 L;  3W1G A;  2JA5 H;  1HZA A;  5LMU Q;  1PH4 A;  3HOV G;  4JI1 L;  1EYG A; 
#chains in the Genus database with same CATH topology
 3I4M G;  1I50 H;  2EXZ A;  5EPJ A;  5LMN L;  4JOI C;  3G71 A;  4CJ0 B;  2ZXR A;  5ISR A;  3AMU A;  3HS0 C;  3ITP A;  1I6H H;  2RSO A;  5LL6 X;  3I70 A;  5IYB G;  4DXG A;  3BU2 A;  4BY1 B;  2AQ3 B;  4NP5 A;  5IGF A;  2VB2 X;  3PIO 3;  1EWI A;  4O0A A;  2E5L L;  4U67 3;  4EQP A;  1QUQ B;  2UXC Q;  1EL0 A;  1HA6 A;  2F0K A;  3PIO A;  3L2P A;  1SN8 A;  4IPC A;  3SK5 A;  1ASY A;  1A2T A;  2NVY H;  1Y1V G;  5EGT A;  2NWG A;  3P7J A;  3NPP A;  3JAM c;  4JI1 Q;  2OXP A;  1TKW B;  3GTQ B;  2A69 D;  1R4P B;  4XYO A;  3NTK A;  1S5F D;  1BCP F;  1LT4 D;  2J0T D;  5ELO A;  4DV5 Q;  1JE4 A;  3E0E A;  2F0M A;  3FKI B;  3S1R B;  4KN4 C;  4OIJ A;  4UP8 A;  4K2K A;  1UE1 A;  3I56 A;  2I5L X;  3PO3 H;  3BZK A;  5GAD C;  1HPC A;  4C3J G;  2R6G A;  4LFA L;  1F9S A;  4FDB A;  1P8L A;  2MO1 A;  1QVF A;  3J7A F;  1A3T A;  2D2C C;  5E7N A;  1RD9 D;  1PRT D;  1X9N A;  4LFA Q;  2PPB C;  4QUC A;  2VNU D;  1T5E A;  4O2D A;  3CKI B;  4YCV A;  1PRT B;  1TS4 A;  1CZW A;  4C1N K;  2MHV A;  3PUV A;  2LY7 A;  3S15 H;  3A55 A;  3R3O A;  1JE5 A;  1G29 1;  3L7Z C;  3GTK H;  4J6H A;  1JR0 D;  3H0G B;  2L55 A;  4GN5 A;  1KIX A;  5ELB A;  2IX3 A;  3GTL B;  2VQE Q;  4RH6 A;  4B3T L;  3F8T A;  2JQO A;  2WAQ B;  1CKN B;  2QF7 A;  3GTQ H;  4FYD A;  1VF5 C;  1VQB A;  3RMH A;  1HNX Q;  1OO9 B;  3VR4 A;  3IRB A;  5T1I A;  1F9R A;  1TII D;  2GVB A;  2B2V C;  4IJL A;  4M8A A;  2DUD A;  1KTK A;  3E0J A;  3TBI B;  2N8N A;  1KLU D;  2RQX A;  4WJ3 M;  3C2P A;  1AP0 A;  2GVA A;  3I4L A;  4A93 H;  2RHQ B;  4A3E H;  4FP5 D;  2Z6K C;  1WVL A;  3I4M B;  2OTJ A;  4C3I H;  2D9U A;  3GP7 A;  2EY6 A;  2AWN A;  1GUG A;  3A8I E;  2CHB D;  1BBX C;  3ER0 A;  1YIJ A;  5C3E G;  4RCO A;  3E3X A;  1SAP A;  2Z9H A;  1R9T H;  3PF4 A;  2Z8L A;  4A3E G;  2YU9 H;  5C4H A;  2A6E C;  3RLN A;  1F9Q A;  2EYO A;  1NMG A;  3CC4 A;  1CKN A;  1BO0 A;  4DNT B;  5IGB A;  1PH6 A;  5C3E H;  1DZ1 A;  4DV1 L;  1B9N A;  4GOP C;  5JJI A;  1IL2 A;  1C4Q A;  3TRE A;  2HIV A;  2N3S A;  4I7Z C;  5E4W C;  2Z4H A;  2CWP A;  1P16 A;  2F3V A;  4Y7N B;  1VQE A;  3HKZ G;  3ND8 A;  1C7Y A;  1N32 Q;  5DLQ E;  2DN8 A;  2VY3 A;  1XMO L;  4EQ5 A;  3AU7 A;  2Q8T A;  3B6Y A;  4KN7 C;  4XYQ A;  3W3A A;  2R93 G;  2JK8 A;  1BVS A;  5C4J H;  4UPA A;  3S24 A;  1BBW A;  4WRD A;  2UXD Q;  4DU9 A;  4HJ5 A;  1MBY A;  1W6J A;  4A93 B;  3J81 L;  4GOP B;  1GXD C;  1SRU A;  1E1O A;  1SJE D;  3BZC A;  4BWG B;  1PA6 A;  4JI4 L;  3SK8 A;  1TQO A;  1BOS A;  4ZLT F;  2EYP A;  3E6Z X;  5C6A A;  2YU9 B;  1B70 B;  1TWF H;  3AFQ A;  4OHJ A;  3A74 A;  1L1O C;  3HOY H;  4KHP Q;  4ZCK A;  1EEI D;  3A54 A;  1U4P A;  3J80 L;  1J5E L;  3KLR A;  4XQQ A;  1S5B D;  5IIF A;  1EFW A;  1Z6H A;  5DEH A;  4A3M H;  2C35 B;  1BCP C;  3BJU A;  1D5Z C;  1TWA H;  5M5W B;  3L9A X;  3U50 C;  4DFA A;  2B2U A;  4Z9C B;  3EFX D;  4C56 C;  1YHQ A;  5COY A;  5KND A;  2B2T A;  3C46 A;  2FJ2 A;  1ZYR C;  2RKS A;  4PZ8 A;  1H9R A;  1LT5 D;  1Q8I A;  1VQ8 A;  1WCM G;  5GQO A;  4R8I A;  3DWP A;  1FGB D;  3IL8 A;  2LMC B;  5C4J B;  1STA A;  3A56 A;  5M3M G;  1H9M A;  1PLF A;  4HJ9 A;  4UDU C;  4IZ8 A;  5D65 A;  4JC0 A;  4APV A;  1CK1 A;  5A35 A;  4LK1 C;  4LF5 L;  3H3V I;  1DM0 B;  4LF9 L;  3K0Y A;  2OEO A;  3KOJ A;  2A19 A;  3VR6 A;  2DGY A;  1NE3 A;  4K8J A;  2KHS A;  4A3D H;  1Y1V H;  4NXM L;  3D6W A;  3OW7 A;  2K04 A;  1S40 A;  3HOY B;  4NKL A;  2AHO B;  4LF7 L;  2K03 A;  2HDL A;  4JI2 Q;  1HXY D;  1K8M A;  4OL7 A;  3UE1 A;  3S2H H;  3DWQ A;  4HN7 A;  2RCN A;  2K7V A;  2TSS A;  3HZX A;  3S2D B;  3KK7 A;  2IL8 A;  3KJP A;  4NXN Q;  1YEZ A;  1VQH A;  1Y1W G;  3Q24 A;  1Q1E A;  3RD4 A;  1SYC A;  1N9W A;  4ILW A;  4DNI A;  1HZC A;  2B8F A;  1A8V A;  1LT6 D;  2CW0 D;  1UE5 A;  2JA8 G;  1B7Y B;  3FHW A;  1B2T A;  4MIU A;  4A3L H;  1X3G A;  1X65 A;  1LTI D;  3D0F A;  2DY8 A;  2VXW A;  1DXM A;  4A3G B;  4GKK L;  2ZM6 L;  2JA8 H;  1BXT A;  4KY6 A;  1ROD A;  2K14 A;  2ID0 A;  1N32 L;  3L3O C;  4DR5 Q;  1B9M A;  4EQN A;  1O78 A;  4IO9 A;  2RDH A;  1UAP A;  1EOT A;  2IW3 A;  5JVH 3;  1K8G A;  1WCM B;  2EQS A;  4DV1 Q;  1NY4 A;  1JWU D;  3K0X A;  1J8I A;  4LWC A;  1DYQ A;  4POF A;  5HGQ A;  4DV7 L;  1X3Q A;  3S17 B;  4DK6 C;  4AQY L;  1GUS A;  4J15 A;  1HZ9 A;  1GUO A;  2F0T A;  4A3B B;  1FGU A;  3WWV A;  5JJZ A;  1CSQ A;  1F2L A;  3A8J E;  4LUV A;  1RTO A;  1XTD A;  2ZJQ A;  1TVX A;  4NPS A;  5JJL A;  5C4Z A;  2LKV A;  4QIW B;  4QQB X;  3MHB A;  2K75 A;  1WD0 A;  5HUR A;  1EYC A;  4R4T A;  1VMP A;  3HOV B;  4RGO S;  3T4A C;  1TWF B;  3K6O A;  3NK9 A;  3PGZ A;  3QO2 A;  3KF6 A;  1QZG A;  3GTP H;  2F4I A;  4K8I A;  4E6I A;  3E9I A;  5AFW A;  1SBB B;  5JAV A;  3OOC A;  5EPL A;  5EBC A;  1TY2 A;  5JVG 3;  1LV9 A;  4JV5 Q;  2F0N A;  1ML0 D;  2GN5 A;  4QY7 A;  3NEL A;  1VMC A;  1PFN A;  2D5D A;  4DXF A;  2E5L Q;  5ELN A;  1K0R A;  1AN8 A;  4A3M G;  1IXR A;  3NHH A;  3T1H Q;  3VYR A;  5KIX A;  3DMU A;  3TN2 A;  2E2I H;  3KLW A;  3MZ5 A;  1WTR A;  2RA4 A;  1XNQ Q;  3T53 B;  2O4X A;  2QCP X;  2ASB A;  2YTV A;  2F4V L;  3MEH A;  2SNM A;  1WTW A;  2L5T A;  2FFK B;  3M85 A;  3STB C;  1LTL A;  3HKZ B;  1VQF A;  3OPO A;  4L6T B;  2XSC A;  1JJ2 A;  1V1Q A;  3J80 E;  2RVL A;  4K5V A;  2N49 A;  3KLS A;  5IYC G;  2BDO A;  2KEE A;  3S16 H;  5BR8 Q;  2F0L A;  4OON A;  4Q5V A;  3R8B A;  1XNR L;  1XMO Q;  1E7Z A;  3S9W A;  4QB4 A;  1QNU A;  1IBM Q;  4DR2 L;  1Y8P B;  1D1K A;  1II3 A;  4HMJ A;  2RDG A;  3TZD A;  5FLM G;  4DR1 L;  1VQ6 A;  2EYM A;  2F0G A;  2ZJR A;  4OWX B;  4R4I A;  1HNW L;  1X6O A;  1QG7 A;  2R93 H;  1PRT F;  2AMC B;  2R3Z A;  4X64 L;  1S72 A;  5C3E B;  1J6Q A;  3AFP A;  1E3P A;  4KD4 A;  1T9H A;  3W1G A;  5ELD A;  3FPU B;  4WOR A;  4DA2 A;  2NZ1 D;  4CDC C;  5D14 A;  1EYG A;  2Q2U A;  3MWY W;  1KD1 C;  1CFM A;  3CAM A;  3R2I A;  1VF7 A;  2EOT A;  2AKW B;  5CR3 A;  3HOW B;  4NB3 A;  4POG A;  4BXX H;  2F0W A;  1VQD A;  3PO3 B;  3AYH B;  1HJP A;  2B2W C;  2SNS A;  4C2M B;  5G3L F;  1K9M C;  1G91 A;  2M9V A;  1W2B A;  1ZKO A;  3JAM E;  4B3S L;  3Q22 A;  1TWC H;  1MGS A;  1CHP D;  3NWS A;  2PQE A;  3VDY A;  5M5Y B;  4JK1 C;  3GTO B;  1ESR A;  3BZD B;  4IPG A;  5M3M H;  2E2H H;  1VQN A;  1V9P A;  1EY0 A;  4FXD A;  3CXC A;  1QJO A;  4JBJ A;  4GN4 B;  2QGQ A;  2ZXO A;  4X3T A;  1S5E D;  1WCM H;  4OIK A;  1JQY D;  2UU9 Q;  2JP1 A;  4JW0 A;  3DM3 A;  1S4Z A;  4GKK Q;  2I46 A;  2EYJ A;  3BDO A;  1O7Y A;  1C8C A;  4EGV A;  5M3F G;  2LSS A;  4PZ6 A;  2A8V A;  1PVO A;  1AEX A;  1IZ6 A;  1NMF A;  4A3J H;  4XIG S;  3PSI A;  5EQ0 A;  4DV0 L;  2YTY A;  3HOU G;  2XIW A;  4CHT B;  2WIN B;  1PTO C;  2HD3 A;  2CWA A;  2M2L A;  3HKS A;  4B3T Q;  1KRS A;  1NTG A;  3H09 A;  3PCO B;  3TP5 A;  4RG1 A;  3MFY A;  1LTS D;  2PI2 E;  2AQ2 B;  2F0P A;  2F0V A;  3TS2 A;  2NVT B;  2ZTC A;  3NEN A;  3VYU A;  2EVB A;  1I4Q A;  3U9O A;  3P20 A;  1ILP A;  1CSP A;  1UEA B;  1STE A;  4N8X 1;  1BKB A;  4N9P A;  2KOL A;  4HIM A;  4J1M A;  1D1I A;  2RSN A;  2K01 A;  2FXQ A;  4A3E B;  4HAE A;  1Y69 U;  2R92 B;  5M5X B;  3G7L A;  4IFD J;  2OCE A;  2PYK A;  5GRO A;  4IFD H;  3DXJ C;  1AFP A;  1E2W A;  1HQR D;  3MXN B;  5KYI A;  1SNC A;  2Z6B A;  2ATW A;  4JI0 Q;  5C5L A;  1SE3 A;  3CCQ A;  3MFG A;  1Y1V B;  3GO5 A;  1G6Z A;  1PH9 A;  1QUQ A;  2Q8R E;  3HOZ B;  1CKM A;  2HCI A;  4ZKC B;  3PIP A;  4DV5 L;  2BH2 A;  3VYT A;  3HOX B;  3RLF A;  4UP9 A;  3NBH B;  1GKH A;  2OQ0 A;  3CQZ H;  3KDF A;  4FF2 A;  2WB1 E;  3SK4 A;  3HOU H;  2UXD L;  1YHA A;  2HQE A;  2K5D A;  1VQK A;  4L5S A;  4YY3 L;  4DGZ A;  4BY1 G;  2VUM H;  4GNX B;  4JI3 Q;  2RHS B;  1BDO A;  4QL5 A;  3EVQ A;  1IBK L;  2NVT H;  4IUN A;  1W6K A;  1IBL Q;  4H0L C;  4YCU A;  3GTL H;  1VQP A;  4DV2 L;  1PFM A;  4JI6 L;  2WAQ G;  1XPR A;  4DV4 Q;  2H4O A;  2CFM A;  2PW5 A;  4ME5 A;  1D5M C;  3GTM H;  1LT3 D;  3STB D;  1YBY A;  3F2D A;  1FJG Q;  4RWS C;  2NVQ B;  3H0G G;  4DV4 L;  5M5X H;  4BBS H;  2G9H D;  1GD7 A;  3MXU A;  3H91 A;  4K2L A;  4CGY B;  2K05 A;  3S1M B;  2FHT A;  2R7Z B;  3BS1 A;  4UHV A;  2PI2 A;  2ZT9 C;  3ND9 A;  2F0Q A;  4AIM A;  1SMX A;  1Y8N B;  5C4X H;  4OX9 L;  1U4M A;  3CRL C;  4A3B H;  1T5X D;  2MP1 A;  3VR5 A;  1KAW A;  3HOX H;  1WTP A;  1CA5 A;  1EU3 A;  3BDC A;  2MJ8 A;  1KHI A;  2KA7 A;  2KCC A;  1EQR A;  1GUW A;  2AQ1 B;  3JC6 6;  3HOU B;  2JA7 G;  1NUC A;  1KQS A;  1VCI A;  1HNX L;  2I0Q A;  2AUJ D;  1KXL A;  3QJY A;  1R9T B;  1Q90 A;  4GKJ L;  4LFC L;  1GHK A;  2K5W A;  2RBM A;  2PNR C;  1XMQ L;  4AYB E;  5IOC A;  2F03 A;  4A3J B;  4FF4 A;  4QMG A;  1QVC A;  1LTB D;  3X3N A;  2R7Z G;  1WTX A;  1G2T A;  2IX1 A;  2N55 A;  5I6Y A;  4JYA Q;  2UUA Q;  3HGB A;  3QOJ A;  1I4P A;  4YWL A;  1JB3 A;  3L0O A;  3TS0 A;  4IAL A;  1D2B A;  1LTA D;  3K81 C;  2K50 A;  3E9H A;  1AZQ A;  2NVY B;  3G6J B;  1ASZ A;  4X6A H;  1I4H A;  1OXU A;  4NXM Q;  4HJ8 A;  2R7Z H;  2H5X A;  1ZXT A;  4CDD C;  1WTV A;  1QVG A;  4FVM A;  2WAQ E;  3I8Z A;  5EKL A;  3WOF A;  3PO3 G;  1L0W A;  1IHZ A;  4R4C A;  3F2C A;  1ET6 A;  2K5H A;  3M3Y H;  3BVG A;  3H3V C;  4H02 A;  4WJW A;  3ULJ A;  3KJO A;  4B3R Q;  1PH2 A;  5KEE A;  4DR7 L;  1STY A;  5JEA G;  3HOX G;  4GNX A;  1K83 H;  3BYY B;  3EIV A;  2P5Z X;  3LWE A;  1EY8 A;  3S14 B;  5CV4 A;  4KLK A;  3PUZ A;  5E4X A;  3MVV A;  4ALP A;  1J9O A;  3QG1 A;  4AQY Q;  1YNJ D;  5CGK A;  1RJT A;  3CQZ B;  4R1J A;  1X54 A;  4A3G H;  3M4O H;  2DJF C;  4R9W A;  2LFN A;  4ZUJ A;  2XTI A;  2K28 A;  2R92 G;  2NYZ D;  2VUM B;  1B3A A;  1STH A;  3GTG B;  1JOR A;  3NTH A;  3SVM A;  5IYB H;  4O42 A;  1GJX A;  4RHS A;  4RMF A;  4HJA A;  4FO2 A;  5E1F A;  3M9B A;  3DEP A;  3AEV A;  4UAI A;  1TWG H;  5C5M A;  3K5M A;  1QNK A;  2B39 A;  2EY1 A;  4CDF C;  1XYI A;  3IFD A;  1PRT C;  3DM1 A;  1PZJ D;  1XX8 A;  4CJ1 B;  1X55 A;  4RA8 A;  4BBR B;  1PTO H;  2NTT A;  5CV7 A;  3OSO A;  1SYB A;  1E24 A;  2F3W A;  3NWT A;  2HUG A;  1D8L A;  2VB3 X;  1MSG A;  4DAY B;  3DHQ A;  5CYU A;  5IE8 A;  1EEF D;  2Q2I A;  3WDN A;  3G6E A;  1EY6 A;  3HOV H;  3CME A;  4QIW E;  1Q3L A;  4A3L G;  4A3D B;  1A2U A;  3SDZ A;  3F1Z A;  2JA5 G;  1EQV A;  1K83 B;  5F2D A;  5C4X B;  3I4O A;  4G4K A;  4KI0 A;  3NUC A;  1SFO B;  3P1H A;  3I7F A;  4X3K A;  2UXB L;  1HNW Q;  4HMI A;  1K8O A;  3TSS A;  4CKC A;  1LYL A;  3M4O B;  2FMC A;  5FO8 B;  2CKZ B;  3Q6S A;  3I2Z A;  3KF8 A;  4TSS A;  2KJX A;  1FJG L;  2EJM A;  4R4Q A;  1KDA A;  2JA9 A;  1H9J A;  3VR2 A;  1SMY C;  5JEA J;  3TP6 A;  1VQI A;  5K36 G;  4DAY A;  4P75 A;  3A7L A;  4RAU C;  2EYF A;  2ZTD A;  1ICW A;  2PZT A;  2JXM B;  1F2M A;  2ZJP A;  3M7N A;  1DD2 A;  3OMC A;  4L63 B;  3C1E A;  3X3M A;  2ICE C;  1LLR D;  1EY5 A;  1KDC A;  3PO2 B;  4HIO A;  1QIL A;  1RKN A;  4BA2 I;  4FXG C;  4P74 A;  4GZY C;  2NTS A;  2JSO A;  1HTP A;  4A3F G;  4AYB G;  1NR4 A;  1TT2 A;  3CU7 A;  3NTI A;  1STB A;  2R7D A;  4HSV A;  1RTN A;  3K7U C;  3M3Y B;  1CZG A;  4LUZ A;  4C3H G;  2IHE A;  2WII B;  5CV8 A;  2KCM A;  4B3S Q;  2B63 G;  4DR3 L;  2KHJ A;  2V4D A;  4A3K H;  2DNE A;  1QCB D;  1XPO A;  4CBV A;  1FVI A;  4ZUI A;  2A6H D;  4DV0 Q;  3HOY G;  2E76 C;  4LNQ A;  2ALY B;  3F2B A;  2BE5 C;  1OXV A;  1XWE A;  2Q8I B;  5IWA L;  4A3I H;  2AUK A;  1B8A A;  5EPK A;  3A5U A;  3NBI A;  2NZH A;  2X69 A;  4I7A A;  2B63 B;  1VQ9 A;  1ZYR D;  2JA6 G;  4HCE A;  4B3M L;  2D0P A;  3BYT B;  1STG A;  4LMQ D;  1SSO A;  4C3H B;  2ENB A;  2ZM6 Q;  1EIG A;  1L0Y B;  1TWH B;  1PFB A;  3W5O A;  3GTG H;  4PMB A;  1N33 L;  4DR3 Q;  3CRK C;  3TRZ A;  1YJ9 A;  1IW7 C;  1CKO A;  3CC7 A;  4PMC A;  3CCV A;  1Z7T A;  3KYH C;  1Z9F A;  5IT9 L;  1L2F A;  4AYB B;  1PTO D;  1X56 A;  3N52 A;  5I9O A;  2E2I B;  2B2T C;  3ERQ A;  4DF7 A;  3HG9 A;  2B2Y C;  4IUT A;  3J81 j;  3FEW X;  1MSH A;  2Y0S B;  2JA5 H;  2J7Z A;  3OWE B;  4RGT A;  1PTO B;  2UUB Q;  2MFI A;  1SE4 A;  3S2D H;  3S16 B;  1IBK Q;  5FJ8 G;  2VW9 A;  1PH1 A;  2PZW A;  2F4V Q;  4A3K B;  3EQL C;  4L5T A;  4ZQ3 A;  3PV0 A;  3WOE A;  1SEB D;  3LX0 A;  1C48 A;  1YI2 A;  1GUT A;  2FMM A;  5C0X H;  4B3M Q;  1PDQ A;  4A3I B;  5C0X J;  1ONL A;  1HCZ A;  1LM0 A;  3GD7 A;  4KHV A;  3UI2 A;  4X3S A;  1JOQ A;  3U9S A;  2E74 C;  5C44 G;  4DR2 Q;  4C3H H;  3M4Q A;  2BA0 A;  1I94 L;  3I55 A;  3IKJ A;  3H15 A;  1F2Z A;  4A93 G;  4DR6 Q;  1DON A;  1QB5 D;  3TP7 A;  3GV3 A;  3T1H L;  2XRQ D;  3MC0 B;  3OIP A;  4A3F H;  4QCL A;  4ODG A;  2YV5 A;  1VQA A;  1VQ4 A;  4EVO A;  1FNW A;  4QJF A;  4HCS A;  5H1S E;  1LAB A;  3KDF B;  4CJ2 C;  5JPM C;  1EWC A;  2CQA A;  4IUP A;  1HH2 P;  1Y1W B;  4C3I B;  1E22 A;  1PYW D;  3OW2 A;  3GV6 A;  4EX5 A;  3K58 A;  1SDF A;  2Z4I A;  2KUM A;  4GNX C;  4PV1 C;  3PIP 3;  2VQF Q;  1V1P B;  5HGT A;  5D3I B;  1LUZ A;  5K36 H;  2QEJ C;  1MJC A;  4NMZ A;  4G57 A;  5J3B A;  2CH4 A;  2NZO A;  5I2Y A;  1CT1 D;  2HHH L;  4K6L A;  3Q8D A;  1JB7 A;  2I5H A;  1E2Z A;  3HKZ E;  3NP8 A;  5CBE E;  3J80 i;  4MN3 A;  2WFW A;  2QA4 A;  3HRZ C;  5IP9 H;  4BS9 A;  1IBL L;  2QDB A;  2B3G A;  1N34 L;  3PO2 G;  3UDG A;  1SNP A;  1X32 A;  3CMA A;  4HTH A;  3EBE A;  4K6D A;  3UDF A;  3H6M A;  4LF8 Q;  2C5C A;  1TU2 B;  4DAV A;  4XQN A;  4X65 L;  2BH8 A;  2L12 A;  1TWG B;  2JEB I;  1PHJ A;  1GUN A;  4OGQ C;  2HHH Q;  4KJO A;  2EPB A;  1JMC A;  4X65 Q;  4BBR H;  4JBM A;  3M4P A;  2LS0 1;  1Y1W H;  3C3L A;  4DR7 Q;  5I9P A;  2FIN B;  5A2Q L;  1K73 C;  1CTM A;  1HNZ Q;  1OTC A;  1N34 Q;  1AE2 A;  4YCW A;  4BY7 G;  1CM9 A;  3IAY A;  4DK0 A;  1C9O A;  4JBK A;  4ZRZ A;  2Y0S G;  5C4X G;  1H9S B;  4HSP A;  2JA5 B;  4K5X A;  1HR0 W;  4QGU A;  4DN4 M;  2WAC A;  1V43 A;  1YNN C;  1BF4 A;  4G7O C;  1G6P A;  2F0I A;  4ME3 A;  5IP7 H;  2E2J B;  3J7A 5;  2PO4 A;  2K1B A;  1XTC D;  3H0G H;  2QW7 A;  4KY5 A;  5DM6 3;  4BBR G;  1N36 L;  3A8K E;  4OXP A;  5EJW A;  4JVZ A;  1WI5 A;  2JA6 B;  4PZ7 A;  3CPF A;  2F0U A;  5ELC A;  2IX0 A;  4JI6 Q;  1BR9 A;  4C2M H;  1I3Q H;  5KRU A;  1M4V A;  2PQA B;  2PQA A;  3EN2 A;  5I2X A;  1HUM A;  2KCN A;  1A6X A;  2Q2T A;  5K5P A;  1MI2 A;  4LF6 Q;  4IUQ A;  3FKI G;  1I94 Q;  3K80 C;  3PO2 H;  3OMG A;  3MXP A;  5GAE C;  1KLG D;  2E8G A;  1FNU A;  5JOB A;  1EY4 A;  3LNN A;  2NVX H;  1V1O A;  1A63 A;  2EDG A;  1LO5 D;  4LUO A;  5E3F A;  1VQO A;  1FD7 D;  1SND A;  3K57 A;  4PMW A;  1QE6 A;  3JAM L;  1BBU A;  3CC2 A;  1LTR D;  4RFB A;  1AZP A;  3PUW A;  3PUX A;  5IP9 G;  3EJI A;  4X66 L;  2MNA A;  3RUZ A;  2E2J H;  4JBW A;  1WD1 A;  2Z1C A;  4G7H C;  4OO1 G;  2K5Q A;  4YWK A;  4KKS A;  3URY A;  4HIK A;  1VQC A;  3K7A B;  1YVC A;  2PMZ E;  2Y0S E;  3QIA A;  1OXT A;  3G4S A;  2VL6 A;  4LFB Q;  1QOH A;  2I5M X;  4A76 A;  1CI3 M;  4JI5 Q;  4TKO B;  1I3Q B;  2KEC A;  2JEA I;  3A0J A;  4MTK A;  2HQL A;  2NB0 A;  2A73 B;  1TWH H;  2OWO A;  3Q0A A;  1D7Q A;  1DCZ A;  3J7Y W;  1M1K C;  1U5K A;  4XT3 B;  3HP3 A;  1AW7 A;  4KJN A;  5DM7 3;  3VA7 A;  4DR4 L;  5C44 H;  1TS3 A;  1YJW A;  3SE0 A;  3CHB D;  3LWU A;  2BA1 A;  2EY5 A;  5J39 A;  4LF4 Q;  1MJE A;  3HOZ H;  3J81 E;  2EZV A;  4MZ9 A;  3R93 A;  1VQ5 A;  1SNM A;  1VQM A;  1B3Q A;  3S1Q H;  5LMU L;  2K5N A;  2H1E A;  2JA7 B;  1Q7Y C;  1Q81 C;  2ZXP A;  2WKC A;  4X64 Q;  3RZD B;  1RIP A;  1B44 D;  4OO1 I;  5CV6 A;  3T56 B;  1A3U A;  3KF8 B;  1A62 A;  4V19 0;  3S14 H;  2HCC A;  2OTL A;  3OWF A;  3CF5 A;  5NUC A;  3RZO B;  2WP8 J;  2PNH A;  3AQQ A;  4C3J B;  1K28 A;  4DNR B;  3PQI A;  4BXX G;  1SLJ A;  3PMF A;  5KNB A;  2PZU A;  1YNN D;  5IWA Q;  3DEO A;  1TWA B;  1RL2 A;  1NJI C;  1U0L A;  3ZJY C;  2NN6 H;  4DV3 Q;  1EWH A;  1Y8O B;  1Q8K A;  1PZK D;  4RCN A;  2J4X A;  4A3C G;  1W3S A;  3I72 A;  2L4N A;  2JA6 H;  1TY0 A;  5TSS A;  3A7A B;  4J8Q A;  1NSN S;  5CBA E;  2YTX A;  3GQB A;  3CPW A;  2MUY A;  4K0K Q;  3I73 A;  3MAQ A;  1AE3 A;  3NQI A;  4DAM A;  4ABN A;  4IFD G;  3OYY A;  2KEN A;  1N36 Q;  1JWS D;  4OX9 Q;  1STN A;  1UWV A;  2EIF A;  4MNO A;  1PFS A;  2Z0S A;  1B1Z A;  2A6E D;  3RR5 A;  3O13 A;  2EYL A;  3S15 B;  5IYD H;  3S1M H;  1HFN A;  1I5F A;  4KD3 A;  1JJC B;  4ZAI A;  4Y52 H;  1SYD A;  1KAB A;  3RZD H;  1EFI D;  1F77 A;  1A3V A;  3D4D A;  1IKM A;  4GLA C;  1ENF A;  4XT1 B;  1EYA A;  3HOZ G;  5COR A;  4IUV A;  4LFC Q;  2CW0 C;  2XGT A;  4JOI A;  2VS1 A;  1IYU A;  1A15 A;  3K59 A;  4F8M A;  1E2V A;  2CCZ A;  4C3J H;  4RGM A;  1CQF A;  1VDZ A;  4DR6 L;  4JI7 L;  2TMP A;  4KHP L;  2WB1 G;  2SEB D;  2UUB L;  1JIC A;  3GTK B;  1HFG A;  2D0O A;  1BCP D;  1XJV A;  1QZH A;  1SE8 A;  5FK9 C;  1JC7 A;  1F9P A;  3M7G A;  4JI4 Q;  3CCR A;  3SXH A;  4OWT B;  4KMU C;  4YY3 Q;  3I4N G;  1Z47 A;  1GOZ A;  5EBD A;  2N78 A;  4AH6 A;  2B29 A;  1SJH D;  1XXG A;  2DNC A;  1Q86 C;  2IJ0 A;  2F0H A;  1K8A C;  2O2L D;  1K3R A;  3NBH A;  4K5W A;  4KTA A;  3CCS A;  1TWC B;  1EU4 A;  2B2U C;  4OO1 H;  4RKB A;  2Q2H A;  4G7Z C;  1SYF A;  5G3L D;  1O7Z A;  4DPG A;  2KHI A;  4O1N A;  5FO9 B;  1G51 A;  4JI5 L;  5J1Z A;  1K3B C;  2L15 A;  2PCF B;  3CCL A;  4LF9 Q;  3TZU A;  2F0J A;  4FXK C;  3J81 i;  1SMY D;  4HED A;  3SGI A;  5DNF A;  4A3C H;  1I6H B;  5M3F B;  1L1O A;  1KDB A;  2K6A A;  1EOV A;  2KCT A;  5LL6 S;  3I4M H;  4DKA C;  1HHV A;  4DUZ Q;  5BR8 L;  4JI2 L;  3T51 B;  2L0C A;  3TEH B;  5BN3 A;  2HT1 A;  1UEB A;  1U9R A;  2EXD A;  2C9O A;  1A0I A;  1E0B A;  2R7F A;  2QKI C;  4Y7N H;  1V1P A;  5KGU A;  1HZA A;  1LAC A;  2KVM A;  1R4Q B;  3HOV G;  4JI1 L;  2K4K A;  1SE2 A;  3SK6 A;  1EY7 A;  2F0S A;  2A74 C;  2DJG C;  1MIU A;  1ESF A;  3J80 c;  4PQX A;  4LF5 Q;  1I6V C;  2B2Y A;  1I4X A;  3NE5 B;  2JE6 I;  2R92 H;  5FLX E;  3CCE A;  3TP8 A;  1WFQ A;  3NXW A;  5T1G A;  2UUA L;  1UNS A;  3CW2 C;  5KYL A;  1RDP D;  2EE1 A;  4P2C B;  5FLX c;  3J7A V;  3OTO Q;  4OEL B;  1YNJ C;  2KQ3 A;  1HNZ L;  3NSW A;  2F1M A;  2M00 A;  4JPB W;  1I4R A;  3DUZ A;  1HTL D;  2EY2 A;  4JYA L;  3K5O A;  1Q1B A;  1PTO F;  3SEB A;  4BY7 H;  2JJQ A;  2LXJ A;  3NEM A;  1RCV D;  3KBG A;  4ULL A;  4A3G G;  3KUP A;  1SRO A;  5C3W A;  1CUK A;  4B9X A;  5CMD A;  4Q0F A;  5C3X A;  4DR5 L;  1TXY A;  1XMQ Q;  1SR3 A;  2XWJ B;  1PXU A;  4X62 Q;  5BN4 A;  3K7A H;  1XPU A;  4QUF A;  3DWA A;  2YYZ A;  2IPK D;  3T1Y Q;  1J5E Q;  3UE0 A;  1NCV A;  4F87 A;  5JEA H;  4JG2 A;  4UY8 C;  2E2D C;  1EUJ A;  4KHZ A;  1PV4 A;  1SYE A;  3GTM B;  4IUR A;  3C1F A;  1KNE A;  3BVM A;  4JI3 L;  2NVQ H;  2B2V A;  4M1U B;  2K52 A;  5CV9 A;  4DK3 C;  1B4O A;  1N33 Q;  1CA6 A;  2UUC Q;  3MXG A;  5GAG C;  1HRJ A;  3ZYY X;  3CCM A;  3CCU A;  1FL0 A;  4X62 L;  1FNV A;  3ULL A;  1JT8 A;  3S1N H;  5KNC A;  4JI7 Q;  1SYG A;  4ZK9 B;  2RCF A;  3D3R A;  1PH8 A;  4IFD I;  3R2T A;  4X66 Q;  3TQY A;  4GLV B;  1YZ6 A;  5IGG A;  1I4G A;  1U4L A;  2F0E A;  1H9S A;  4BY7 B;  3S2H B;  1Q46 A;  5BN5 A;  5M3M B;  2E2H B;  4IN3 A;  4TQU S;  4LF6 L;  3K5L A;  5FOB B;  1DJR D;  4I65 A;  4OWW B;  3H3V H;  3VA5 A;  4A4I A;  2JYO A;  2VQF L;  1PH3 A;  4CKB A;  1EZ8 A;  5FLX L;  4A3B G;  2OF1 A;  4PNY A;  3JAM i;  2L1B A;  1IBM L;  4HJ7 A;  3ONA B;  1Y14 B;  1EQQ A;  4N9T A;  2B8G A;  1F2Y A;  2A68 C;  1O7I A;  3NQT A;  2L11 A;  1DGS A;  4YHH Q;  5IP7 G;  1WYD A;  1VQG A;  1O7L A;  4JI0 L;  3HOW G;  2JN4 A;  4BBS G;  4C1N I;  4LFB L;  2MGS A;  5EAY A;  3U4Z A;  4X3U A;  4A75 A;  1BCP B;  2BDN A;  5ELF A;  2UXB Q;  1WTO A;  5IGC A;  1XNQ L;  3ERO A;  4F88 A;  5IGE A;  5DAU A;  1X3E A;  2G9D A;  4XQJ A;  4DV3 L;  1GM5 A;  4A3D G;  4KK7 A;  2NBF A;  2NVX B;  2IWH A;  4XDX A;  3U4V A;  1VQL A;  3I3C A;  3D4W A;  4N8F A;  3FVQ A;  2A68 D;  3VYS A;  2RDF A;  4K14 A;  5JPN C;  3QR8 A;  5C0X G;  2F0D A;  4DUY L;  3S17 H;  1WTH A;  4GOP A;  1BNZ A;  4PG3 A;  5EKK A;  1S3O A;  2XNA C;  3K5N A;  3KF6 B;  4YHH L;  3G48 A;  3LGJ A;  5M9O A;  4DAP A;  1XNR Q;  2A6H C;  5FJ8 H;  2R61 A;  4U68 A;  3MA2 B;  5CC4 A;  4IJH A;  4LJZ C;  3RN5 A;  2DY7 A;  1UE7 A;  2K32 A;  3CP0 A;  4FF3 A;  2VQE L;  1M90 C;  4P73 A;  4C3I G;  1EIY B;  3GDE A;  2K5V A;  5IY0 A;  4GKJ Q;  1Q82 C;  3MEF A;  2F0O A;  3T13 A;  3RLO A;  1ILQ A;  4GLX A;  2NN6 I;  1KAA A;  3BG3 A;  2Z6K A;  2CVR A;  1KL9 A;  4BY1 H;  2VUM G;  3K8A A;  2KED A;  4L8J A;  4A3M B;  3SR1 A;  3ICE A;  2A69 C;  5M5W H;  3FDT A;  1DOK A;  3CD6 A;  1X3F A;  5LHY 1;  2EJF C;  1D6E C;  1PZI D;  3D31 A;  5C0X I;  2LXK A;  3FPP A;  5C44 B;  1KRT A;  4LF8 L;  3FP9 A;  2V1C C;  2F52 A;  1G2S A;  2MPM A;  3D8G A;  4A3F B;  3GTP B;  3I90 A;  2HDM A;  4H7B A;  3TDQ A;  4B08 A;  3W1B A;  4A3I G;  4LAA A;  4TVA B;  3TME A;  4P72 A;  2QEX A;  2F0F A;  3V96 A;  3BVZ A;  4V0B A;  4A3K G;  3Q23 A;  3ULP A;  2VZA A;  3S1Q B;  4BBS B;  1CHQ D;  1EY9 A;  4MHE A;  1YHB A;  4LW1 A;  1SNO A;  4R8N A;  1IYJ B;  2SOB A;  2X6G A;  1YJN A;  1K0S A;  3UDX A;  1HR0 Q;  3GTJ H;  2G5D A;  4IUU A;  2EJG C;  4IQZ A;  3S1N B;  2IY5 B;  3I4N H;  2O5I C;  3D6C A;  4H13 C;  4HR7 B;  3RN2 A;  1NNX A;  4JI8 L;  5M3F H;  1ENA A;  4RGN A;  4IPD A;  1PYB A;  4ZYS A;  5CV5 A;  1ZEQ X;  2A5H A;  1HR0 L;  1JOO A;  1JWM D;  2IT1 A;  1SFO H;  3EA6 A;  1HA5 A;  5JJK A;  1L1O B;  3F2U A;  4B3R L;  4TRD A;  1JOK A;  1VQJ A;  2BCO A;  2A1A A;  2O5J C;  1KC8 C;  3E5S A;  3CCJ A;  1IKL A;  5AJ3 Q;  1IL8 A;  4ZKB B;  1U4R A;  5ELE A;  2CH4 W;  5J22 A;  1HQM C;  4UP7 A;  4L5R C;  4A3J G;  1B50 A;  3FRP B;  1M8A A;  4WFN 3;  2D62 A;  4B9W A;  4KV6 A;  1JCK B;  1GVP A;  2MQH A;  3W2D A;  4EQO A;  1IW7 D;  2XRS D;  4MTN A;  3UDI A;  4QF4 A;  5IYD G;  2F3I A;  5L37 A;  1H9K A;  5LMN Q;  2JA8 B;  1SXT A;  3RNU A;  4ID6 A;  2KBN A;  4KY7 A;  1VQ7 A;  1JJG A;  4F7X A;  1LTG D;  1MHW C;  1WTQ A;  4FF1 A;  1DOM A;  3HOW H;  4GS3 A;  3IFT A;  4R4O A;  2BE5 D;  1I50 B;  3QB3 A;  4XTC S;  3AB9 A;  1WJJ A;  1NBW A;  4DUY Q;  3M4Y A;  3I4N B;  5D3D A;  4S3S A;  1UE6 A;  1Q12 A;  2XN9 C;  5FLM H;  4IOA A;  5LMN W;  4NW2 A;  4DR4 Q;  3DLL A;  2NN6 G;  1L0X B;  4YWM A;  1FR3 A;  3KBX A;  3GTO H;  3OIQ A;  5GAH C;  3MTS A;  1EIH A;  3SHL A;  4FNF A;  4WJ4 A;  3A5Z B;  1S5D D;  3PUY A;  3V2T A;  2AWO A;  1NR2 A;  1PH7 A;  2ICI A;  4LF4 L;  3HFZ B;  1WOC A;  1PYS B;  4DK1 A;  1BQQ T;  1S5C D;  3D4R A;  1ET9 A;  1PH5 A;  3I91 A;  2BOS A;  2ZTE A;  3KLS X;  4L5Q A;  3PF5 A;  3J81 c;  2GA4 B;  4YIJ A;  1NAP A;  4RKL A;  1QWY A;  1GO3 E;  1AH9 A;  3RZO H;  4P71 A;  2B63 H;  4IOC A;  1TR5 A;  2E75 C;  3QWN A;  1TS5 A;  3KFU A;  1GHJ A;  3FMC A;  5IYC H;  3QOL A;  2I07 B;  1C0A A;  4DUZ L;  1O80 A;  2NUC A;  2ES2 A;  4XXE A;  4DR1 Q;  2XWB B;  3BDL A;  2HIX A;  1KNA A;  1EZ6 A;  2WKD A;  2PW7 A;  2WV6 D;  4NDX A;  2PMZ B;  1EYD A;  1RF2 D;  2UUC L;  1X3P A;  2EYH A;  1ENC A;  4JCV E;  4LF7 Q;  4RHR A;  2K33 A;  2OT2 A;  2L9H A;  3VR3 A;  1B53 A;  4DV2 Q;  1SNQ A;  3V05 A;  4KKU A;  3P75 A;  4DV6 L;  1ICF B;  1OXS C;  2OQK A;  5IOD A;  4DV7 Q;  5HY6 A;  3ERS X;  1PMR A;  4H44 C;  3T1Y L;  1D5X C;  1OXX K;  4OEM B;  5EKI A;  4DV6 Q;  1EQT A;  3U58 A;  1YNX A;  3GTJ B;  5I4D A;  3OHX C;  1EIF A;  2R93 B;  3T16 A;  4NXN L;  2CQO A;  1HZB A;  1IYV A;  1TS2 A;  4IPH A;  5FKA C;  2SDF A;  2N88 A;  2RF4 A;  5A2Q E;  4CKE A;  5FO7 B;  4K0K L;  3N6R A;  1MKH A;  5IGD A;  1FYC A;  4BA1 I;  4HID A;  3OTO L;  1CQV A;  5IT9 E;  2UXC L;  3H94 A;  3MXN A;  2XVS A;  2MO0 A;  1UUP A;  1LTT D;  4KKT A;  1RHP A;  1G8Z D;  1VS0 A;  5IT9 c;  1E1T A;  1V8Q A;  2QDL A;  2UU9 L;  2IHF A;  3HEJ A;  5AJ3 L;  4CDE C;  3J7Z C;  2QIL A;  4JI8 Q;  1N8R C;  1DOL A;  5M5Y H;  1HUN A;  3FKI H;  3S1R H;  1H95 A;  2B2W A;  1YIT A;  1BUV T;  2WB1 B;  4JV5 L;  2JA7 H;  4GN3 B;  5I6W A;  2X6L A;  5LMU Q;  1PH4 A;  1MD2 D; 
#chains in the Genus database with same CATH homology
 2Q2U A;  1KD1 C;  2UUB Q;  2MFI A;  1I50 H;  3CAM A;  2K4K A;  3I4M G;  5LMN L;  4JOI C;  2AKW B;  3G71 A;  1MIU A;  3S2D H;  4NB3 A;  3J80 c;  4POG A;  4LF5 Q;  4BXX H;  1I6H H;  1IBK Q;  5FJ8 G;  1VQD A;  2VW9 A;  1PH1 A;  3AYH B;  1HJP A;  5IYB G;  2F4V Q;  3BU2 A;  2JE6 I;  1K9M C;  4L5T A;  2R92 H;  3PV0 A;  3CCE A;  1YI2 A;  1W2B A;  1EWI A;  1WFQ A;  2UUA L;  3CW2 C;  4O0A A;  2E5L L;  4B3S L;  1TWC H;  1QUQ B;  4B3M Q;  2UXC Q;  5FLX c;  5C0X J;  3VDY A;  3OTO Q;  1LM0 A;  3GD7 A;  3PIO A;  3L2P A;  1SN8 A;  4IPC A;  4IPG A;  1HNZ L;  5M3M H;  1ASY A;  2E2H H;  1VQN A;  1V9P A;  3CXC A;  2NVY H;  4JBJ A;  5C44 G;  4GN4 B;  1Y1V G;  2QGQ A;  4DR2 Q;  3JAM c;  4C3H H;  3M4Q A;  4JI1 Q;  1WCM H;  2UU9 Q;  4JYA L;  1Q1B A;  2BA0 A;  1I94 L;  3DM3 A;  4BY7 H;  2JJQ A;  3I55 A;  4GKK Q;  2LXJ A;  3NEM A;  3H15 A;  4A93 G;  4DR6 Q;  5M3F G;  2LSS A;  4PZ6 A;  2A8V A;  4A3G G;  1PVO A;  1SRO A;  1CUK A;  1IZ6 A;  1NMF A;  3T1H L;  4A3J H;  4DR5 L;  1TXY A;  4XIG S;  4A3F H;  1XMQ Q;  5ELO A;  2YV5 A;  4DV5 Q;  1VQA A;  3E0E A;  1VQ4 A;  1SR3 A;  3PSI A;  4UP8 A;  4X62 Q;  4QJF A;  3K7A H;  4DV0 L;  1XPU A;  2YTY A;  5H1S E;  3HOU G;  1UE1 A;  2YYZ A;  3KDF B;  3I56 A;  3T1Y Q;  2I5L X;  3PO3 H;  3BZK A;  5GAD C;  1J5E Q;  1HH2 P;  2CWA A;  3UE0 A;  2R6G A;  3HKS A;  4B3T Q;  1KRS A;  4LFA L;  1NTG A;  4JG2 A;  3PCO B;  4FDB A;  1E22 A;  4RG1 A;  1P8L A;  3OW2 A;  4UY8 C;  1EUJ A;  2MO1 A;  2PI2 E;  4KHZ A;  1QVF A;  1PV4 A;  4EX5 A;  5E7N A;  3TS2 A;  2ZTC A;  3NEN A;  1X9N A;  4GNX C;  4JI3 L;  4LFA Q;  2NVQ H;  1CSP A;  2VNU D;  2VQF Q;  2K52 A;  4O2D A;  1LUZ A;  1BKB A;  4YCV A;  4DK3 C;  1N33 Q;  2UUC Q;  5GAG C;  3PUV A;  1MJC A;  4HIM A;  3S15 H;  5J3B A;  2NZO A;  1JE5 A;  1G29 1;  3CCM A;  2HHH L;  3Q8D A;  3CCU A;  2FXQ A;  1JB7 A;  2I5H A;  3HKZ E;  3L7Z C;  3GTK H;  1FL0 A;  4X62 L;  1JT8 A;  3ULL A;  3S1N H;  4GN5 A;  4JI7 Q;  4IFD J;  3J80 i;  1KIX A;  2OCE A;  2WFW A;  5GRO A;  2QA4 A;  1PH8 A;  5IP9 H;  4IFD I;  4X66 Q;  2VQE Q;  3TQY A;  4GLV B;  1YZ6 A;  3MXN B;  1IBL L;  4B3T L;  3F8T A;  2JQO A;  2B3G A;  1N34 L;  3CCQ A;  4JI0 Q;  2ATW A;  3UDG A;  3PO2 G;  3CMA A;  3GTQ H;  1CKN B;  1Q46 A;  1VQB A;  3EBE A;  3GO5 A;  4TQU S;  3UDF A;  1HNX Q;  4LF6 L;  3IRB A;  1PH9 A;  1QUQ A;  4LF8 Q;  1CKM A;  3PIP A;  4DV5 L;  2BH2 A;  4X65 L;  4OWW B;  2BH8 A;  3H3V H;  2JEB I;  1PHJ A;  4A4I A;  2VQF L;  3RLF A;  4UP9 A;  1PH3 A;  3NBH B;  2GVB A;  1GKH A;  2OQ0 A;  3CQZ H;  3KDF A;  2HHH Q;  4A3B G;  2WB1 E;  4IJL A;  3JAM i;  1JMC A;  3HOU H;  1IBM L;  4HJ7 A;  2UXD L;  1Y14 B;  1YHA A;  1VQK A;  4X65 Q;  4L5S A;  1EQQ A;  2DUD A;  4BBR H;  4YY3 L;  4JBM A;  3M4P A;  4BY1 G;  2VUM H;  4GNX B;  1Y1W H;  1O7I A;  2N8N A;  4DR7 Q;  4WJ3 M;  4JI3 Q;  1K73 C;  1DGS A;  2RHS B;  4YHH Q;  1HNZ Q;  2GVA A;  4QL5 A;  5IP7 G;  1OTC A;  1WYD A;  1VQG A;  1N34 Q;  4JI0 L;  1IBK L;  3HOW G;  1AE2 A;  2NVT H;  4A93 H;  4BBS G;  1IBL Q;  3GTL H;  4YCU A;  4LFB L;  2RHQ B;  4A3E H;  4DV2 L;  2Z6K C;  5EAY A;  1VQP A;  4YCW A;  3U4Z A;  2WAQ G;  4JI6 L;  4BY7 G;  1XPR A;  2OTJ A;  4A75 A;  4C3I H;  2UXB Q;  4DV4 Q;  1C9O A;  4JBK A;  2Y0S G;  2CFM A;  1XNQ L;  5C4X G;  2AWN A;  3GTM H;  1X3E A;  3STB D;  1YBY A;  3F2D A;  4DV3 L;  1FJG Q;  1GM5 A;  4A3D G;  3ER0 A;  1YIJ A;  5C3E G;  3H0G G;  3U4V A;  4DV4 L;  4QGU A;  1R9T H;  1HR0 W;  1VQL A;  3PF4 A;  4A3E G;  1V43 A;  5C0X G;  2YU9 H;  5M5X H;  4BBS H;  4DUY L;  3S17 H;  1GD7 A;  1G6P A;  4ME3 A;  4GOP A;  4PG3 A;  3RLN A;  5IP7 H;  1S3O A;  1NMG A;  3J7A 5;  3CC4 A;  3KF6 B;  1CKN A;  4YHH L;  2PI2 A;  3G48 A;  3LGJ A;  3H0G H;  1PH6 A;  5C3E H;  1XNR Q;  4BBR G;  5FJ8 H;  4DV1 L;  1N36 L;  4AIM A;  4OXP A;  1SMX A;  1WI5 A;  4GOP C;  3RN5 A;  4IJH A;  1IL2 A;  5JJI A;  3TRE A;  4PZ7 A;  5C4X H;  4OX9 L;  2HIV A;  1UE7 A;  3CP0 A;  2N3S A;  3CPF A;  2VQE L;  4A3B H;  2IX0 A;  1M90 C;  4P73 A;  4JI6 Q;  4C2M H;  1KAW A;  4LF6 Q;  2CWP A;  1P16 A;  3HOX H;  1EIY B;  1I3Q H;  1VQE A;  3HKZ G;  1C7Y A;  3GDE A;  2K5V A;  2PQA B;  1KHI A;  2PQA A;  3EN2 A;  5DLQ E;  5IY0 A;  1EQR A;  4GKJ Q;  3JC6 6;  3MEF A;  1Q82 C;  2Q2T A;  2JA7 G;  3RLO A;  1KQS A;  1VCI A;  2VY3 A;  1HNX L;  1XMO L;  4EQ5 A;  3FKI G;  2I0Q A;  4GLX A;  1I94 Q;  2NN6 I;  1KXL A;  2Z6K A;  3K80 C;  3PO2 H;  1KL9 A;  4BY1 H;  2VUM G;  3B6Y A;  3K8A A;  4GKJ L;  4LFC L;  2R93 G;  2JK8 A;  1BVS A;  5C4J H;  4UPA A;  3S24 A;  5GAE C;  1BBW A;  1XMQ L;  4AYB E;  2E8G A;  2UXD Q;  4HJ5 A;  3ICE A;  5M5W H;  4GOP B;  2NVX H;  3CD6 A;  1QVC A;  1X3F A;  2R7Z G;  1SRU A;  3D31 A;  5C0X I;  1A63 A;  2LXK A;  2IX1 A;  1E1O A;  4LUO A;  1VQO A;  4JYA Q;  3BZC A;  1KRT A;  2UUA Q;  4LF8 L;  3FP9 A;  2V1C C;  2F52 A;  4PMW A;  1PA6 A;  4JI4 L;  1BBU A;  4YWL A;  3L0O A;  3CC2 A;  3TS0 A;  3W1B A;  3PUW A;  3K81 C;  4A3I G;  2K50 A;  3E9H A;  3PUX A;  4TVA B;  1B70 B;  1TWF H;  3AFQ A;  4P72 A;  5IP9 G;  3A74 A;  4X66 L;  1ASZ A;  1L1O C;  2QEX A;  2MNA A;  2E2J H;  3HOY H;  1OXU A;  4NXM Q;  4JBW A;  4KHP Q;  4X6A H;  4HJ8 A;  2R7Z H;  2H5X A;  4A3K G;  4OO1 G;  3ULP A;  1QVG A;  1J5E L;  4YWK A;  2VZA A;  2WAQ E;  4HIK A;  3PO3 G;  1L0W A;  1YHB A;  4LW1 A;  1EFW A;  1VQC A;  4A3M H;  1IYJ B;  1YVC A;  2PMZ E;  2C35 B;  2Y0S E;  3BJU A;  4R4C A;  3F2C A;  1OXT A;  1YJN A;  3G4S A;  1TWA H;  2VL6 A;  4LFB Q;  3UDX A;  1HR0 Q;  2K5H A;  3GTJ H;  3M3Y H;  2I5M X;  4A76 A;  3U50 C;  4JI5 Q;  3I4N H;  2IY5 B;  3RN2 A;  2JEA I;  3A0J A;  2HQL A;  4H02 A;  4JI8 L;  3ULJ A;  3KJO A;  4IPD A;  1TWH H;  5M3F H;  1PYB A;  1YHQ A;  1PH2 A;  2OWO A;  4B3R Q;  1D7Q A;  1HR0 L;  4PZ8 A;  4DR7 L;  1M1K C;  1U5K A;  2IT1 A;  1SFO H;  3HOX G;  5JEA G;  1VQ8 A;  4GNX A;  1WCM G;  5GQO A;  5JJK A;  1L1O B;  4DR4 L;  5C44 H;  1K83 H;  3EIV A;  4B3R L;  1YJW A;  5M3M G;  1VQJ A;  4HJ9 A;  2A1A A;  4KLK A;  1KC8 C;  3PUZ A;  3CCJ A;  5AJ3 Q;  4JC0 A;  4ALP A;  4APV A;  4DR4 Q;  2BA1 A;  4AQY Q;  4UP7 A;  4LF5 L;  4L5R C;  4A3J G;  3H3V I;  4LF4 Q;  4R1J A;  1X54 A;  4LF9 L;  1MJE A;  3HOZ H;  4A3G H;  3M4O H;  2D62 A;  4MZ9 A;  1VQ5 A;  2XTI A;  3KOJ A;  2R92 G;  1GVP A;  2MQH A;  2A19 A;  5IYB H;  1VQM A;  2DGY A;  1NE3 A;  3S1Q H;  5LMU L;  4MTN A;  4A3D H;  3UDI A;  1Y1V H;  2K5N A;  4RMF A;  4NXM L;  5IYD G;  4HJA A;  1Q7Y C;  1Q81 C;  2F3I A;  5LMN Q;  1S40 A;  3RNU A;  3M9B A;  2AHO B;  4LF7 L;  3AEV A;  4JI2 Q;  4X64 Q;  1TWG H;  1RIP A;  2KBN A;  3UE1 A;  1VQ7 A;  4OO1 I;  3S2H H;  1JJG A;  2RCN A;  3HOW H;  3KF8 B;  1A62 A;  3KJP A;  4GS3 A;  4NXN Q;  3S14 H;  1YEZ A;  1X55 A;  4R4O A;  1VQH A;  2OTL A;  3CF5 A;  1Y1W G;  1Q1E A;  2WP8 J;  4XTC S;  2PNH A;  3AQQ A;  1N9W A;  1E24 A;  1WJJ A;  1HZC A;  1NBW A;  4DNI A;  1A8V A;  4DUY Q;  1UE5 A;  1D8L A;  4DAY B;  1SLJ A;  1B7Y B;  3FHW A;  2JA8 G;  4BXX G;  1UE6 A;  5IE8 A;  1Q12 A;  5IWA Q;  4A3L H;  5FLM H;  4IOA A;  1RL2 A;  1NJI C;  1U0L A;  5LMN W;  2Q2I A;  3ZJY C;  2NN6 G;  4YWM A;  1X3G A;  1X65 A;  3G6E A;  3DLL A;  1Q8K A;  4DV3 Q;  3D0F A;  3HOV H;  3CME A;  3GTO H;  4QIW E;  4A3L G;  5GAH C;  4A3C G;  1W3S A;  3F1Z A;  2JA5 G;  4GKK L;  4WJ4 A;  3A5Z B;  2ZM6 L;  2JA8 H;  3PUY A;  2JA6 H;  2AWO A;  3I4O A;  2K14 A;  2ID0 A;  1PH7 A;  1N32 L;  4KI0 A;  4LF4 L;  3HFZ B;  1WOC A;  3I7F A;  1PYS B;  2UXB L;  4DR5 Q;  2YTX A;  4IO9 A;  1PH5 A;  3CPW A;  1HNW Q;  4K0K Q;  1AE3 A;  2ZTE A;  4L5Q A;  4DAM A;  3PF5 A;  4IFD G;  1LYL A;  3OYY A;  2KEN A;  3J81 c;  1K8G A;  2CKZ B;  1GO3 E;  2EQS A;  4DV1 Q;  1NY4 A;  1N36 Q;  3I2Z A;  1AH9 A;  4OX9 Q;  3K0X A;  3RZO H;  4P71 A;  4LWC A;  1UWV A;  1FJG L;  5HGQ A;  2EIF A;  4MNO A;  4R4Q A;  1PFS A;  4POF A;  2Z0S A;  3RR5 A;  4DV7 L;  4IOC A;  2B63 H;  2JA9 A;  4DK6 C;  5IYD H;  4AQY L;  3KFU A;  3S1M H;  5IYC H;  4J15 A;  5JEA J;  5K36 G;  1HZ9 A;  1I5F A;  1JJC B;  1VQI A;  4P75 A;  4Y52 H;  1C0A A;  1FGU A;  4DUZ L;  3WWV A;  1CSQ A;  3RZD H;  2ZTD A;  4LUV A;  2ES2 A;  1XTD A;  4GLA C;  2ZJP A;  4NPS A;  4DR1 Q;  2ZJQ A;  2HIX A;  5JJL A;  3M7N A;  3HOZ G;  4LFC Q;  4QQB X;  2K75 A;  2XGT A;  4R4T A;  2VS1 A;  4JOI A;  2UUC L;  4JCV E;  4C3J H;  2CCZ A;  4LF7 Q;  4HIO A;  4DR6 L;  4JI7 L;  4BA2 I;  4KHP L;  3PGZ A;  2WB1 G;  3KF6 A;  4P74 A;  4DV2 Q;  1QZG A;  3GTP H;  4DV6 L;  2UUB L;  3E9I A;  2D0O A;  1OXS C;  4A3F G;  1QZH A;  1XJV A;  2OQK A;  4DV7 Q;  5HY6 A;  3ERS X;  4AYB G;  1SE8 A;  4JI4 Q;  3CCR A;  2R7D A;  4OWT B;  4JV5 Q;  3T1Y L;  4YY3 Q;  3I4N G;  1OXX K;  1Z47 A;  2GN5 A;  4DV6 Q;  3K7U C;  4QY7 A;  3NEL A;  3U58 A;  1YNX A;  2N78 A;  4AH6 A;  2B29 A;  4LUZ A;  2E5L Q;  2IHE A;  1Q86 C;  5ELN A;  1K0R A;  1N32 Q;  4A3M G;  1K8A C;  1EIF A;  1IXR A;  3T1H Q;  1K3R A;  2KCM A;  4B3S Q;  4DR3 L;  2B63 G;  2KHJ A;  2CQO A;  1HZB A;  4NXN L;  3CCS A;  2E2I H;  3KLW A;  4A3K H;  1XPO A;  1XNQ Q;  1FVI A;  4IPH A;  4DV0 Q;  3HOY G;  2ASB A;  2YTV A;  2F4V L;  2Q2H A;  2RF4 A;  4LNQ A;  2ALY B;  3F2B A;  4DPG A;  3M85 A;  2KHI A;  3STB C;  1LTL A;  1OXV A;  1VQF A;  5IWA L;  4A3I H;  4K0K L;  1G51 A;  1B8A A;  4JI5 L;  1MKH A;  2L15 A;  3A5U A;  1JJ2 A;  3CCL A;  4LF9 Q;  1V1Q A;  2NZH A;  4BA1 I;  2N49 A;  1VQ9 A;  4HID A;  3OTO L;  2JA6 G;  5IYC G;  3J81 i;  4B3M L;  2D0P A;  3S16 H;  3SGI A;  5BR8 Q;  2UXC L;  4A3C H;  4OON A;  2ZM6 Q;  1L1O A;  2MO0 A;  1XNR L;  1XMO Q;  1EOV A;  1E7Z A;  2KCT A;  3W5O A;  1IBM Q;  3I4M H;  1VS0 A;  4DKA C;  5IT9 c;  4DR2 L;  3GTG H;  1E1T A;  1N33 L;  2UU9 L;  5FLM G;  4DUZ Q;  4DR3 Q;  4DR1 L;  1VQ6 A;  2IHF A;  3TRZ A;  1YJ9 A;  5BR8 L;  2ZJR A;  1HNW L;  4OWX B;  4R4I A;  5AJ3 L;  4JI2 L;  3TEH B;  1CKO A;  3J7Z C;  3CC7 A;  3CCV A;  2HT1 A;  1UEB A;  1X6O A;  1Z9F A;  1L2F A;  3KYH C;  2R93 H;  2AMC B;  2EXD A;  4X64 L;  4JI8 Q;  1S72 A;  1X56 A;  1N8R C;  5M5Y H;  1A0I A;  1J6Q A;  3AFP A;  3FKI H;  2R7F A;  1E3P A;  3S1R H;  1YIT A;  4Y7N H;  1H95 A;  3J81 j;  1T9H A;  2JA7 H;  4GN3 B;  4JV5 L;  3W1G A;  2JA5 H;  1HZA A;  5LMU Q;  1PH4 A;  3HOV G;  4JI1 L;  1EYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...