3GTOH

Backtracked rna polymerase ii complex with 15mer rna
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
total genus 16
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3gtoH00
5M5YH 4JI4L 3CPFA 2N3SA 4DK3C 2ALYB 2JA5H 2MO1A 4DV6L 1VQHA 2JA6H 2WAQG 4MNOA 1SROA 4JI8L 4X65Q 1E24A 2BH8A 3STBD 5JEAG 5GAHC 1YITA 2B3GA 4GOPB 1X9NA 1PH1A 3RNUA 4JBKA 1QUQB 1I3QH 4IFDJ 4UY8C 4JYAL 2D62A 4BBSG 4KHPQ 2DGYA 1K3RA 4HJAA 4HJ5A 3K81C 3RLNA 3FP9A 1C7YA 2PI2A 4DAMA 1FL0A 1X3GA 5IWAL 2JA5G 3GTMH 3CCQA 1N32L 4YCUA 4HJ7A 4LF4Q 2JA6G 3HKZE 2UXCL 1J5EL 4R4IA 3MEFA 2K50A 4PG3A 4DR7Q 4GS3A 2OCEA 2ZTEA 2UU9Q 3SGIA 1I94L 4JI7L 4GLAC 1T9HA 2GVAA 5GROA 2CWAA 1X3FA 2AMCB 4MTNA 3J81j 4IPGA 2IY5B 5HGQA 4LUZA 3CP0A 5IT9c 1SFOH 1IBKL 5FLXc 4LF9Q 1PH6A 3GTPH 1YHBA 3J7A5 4AQYQ 4TVAB 3PCOB 1KL9A 3RR5A 5C0XI 1PYSB 5IYCH 2HT1A 4APVA 2WB1E 1K8GA 1QVCA 1P8LA 4LFCQ 2Q2HA 2VUMH 1OXVA 4DUZQ 2UUCQ 4BXXH 1HR0L 1UE5A 4JBWA 1RIPA 4DR1Q 3TS0A 1XNRL 4DR6Q 4JC0A 4R4QA 1YJ9A 1NMGA 5IYCG 1HNWQ 2VS1A 3U4VA 4OWWB 1AH9A 3CCSA 2PNHA 3GTGH 4NXML 5JJLA 1WOCA 1HNXQ 1JB7A 2VUMG 1E1TA 4LUOA 2AWNA 2ZJPA 3H3VH 4IFDG 3AQQA 2R7DA 1BBWA 5AJ3L 2ZJRA 3TQYA 4DV1L 2JEBI 2MQHA 2QEXA 2F3IA 3G6EA 4DV3Q 1OXTA 3G48A 4A3LG 2E8GA 1SN8A 2HHHL 4DV7Q 4LFBL 4DR2L 3ZJYC 3ERSX 2VZAA 4C2MH 4HIMA 4LW1A 1B7YB 2NN6I 4HIDA 4OO1G 2CFMA 4K0KQ 2F4VQ 4B3SQ 1SMXA 2D0OA 2A1AA 3AFQA 3K7AH 3KJOA 1W3SA 1KC8C 1VQCA 3F2CA 2ZTCA 4JI3L 3STBC 3FHWA 1A0IA 1L1OA 5J3BA 1Q12A 1YEZA 1MKHA 5JEAJ 1JJCB 2N49A 3CQZH 4B3ML 1Y1WH 1JT8A 2Z0SA 3PO2H 4GNXB 1VQDA 4DV0Q 3BJUA 4PZ8A 4DR5L 1WYDA 1YVCA 4GN4B 3GD7A 1PYBA 4AYBE 3CF5A 4JI1L 4JI2L 3HOZH 1AE3A 4YHHQ 3S1RH 2QGQA 3HFZB 4JV5L 2UXBL 1N36Q 2AWOA 2YYZA 1V1QA 1LYLA 4MZ9A 3PUYA 1WFQA 1YJNA 1PV4A 4DV2Q 1HZ9A 3NENA 4DR4L 1I50H 4QQBX 1Y1WG 4LF7L 3PO2G 1O7IA 4LF5Q 1X54A 1VQ6A 3CMAA 3HOZG 2ES2A 1SE8A 1EWIA 2BA1A 4HIKA 1EQQA 1E3PA 4IO9A 3UE1A 3PO3H 2K4KA 3EN2A 2UXDL 4DV4Q 1C0AA 4LNQA 1Z9FA 4L5QA 2Q2TA 3CCLA 4GKKQ 1YIJA 2OTJA 1AE2A 1MJCA 2VY3A 2IX0A 4LF6Q 2GVBA 3T1YQ 3TS2A 2D0PA 4FDBA 4LFAQ 3OTOL 3G4SA 2YTYA 4C3JH 1VQAA 1S40A 4X64Q 3CC2A 5FLMH 2JQOA 5M5WH 1V9PA 4YWKA 1N34Q 5LMNQ 3PO3G 1PH3A 4Y52H 4P75A 5HY6A 2BA0A 3K8AA 4QIWE 2UUBL 2F52A 2IX1A 2N78A 3T1HL 1VQ4A 1PH5A 4POGA 1N9WA 1OXXK 3BU2A 1CKOA 4IPCA 1QZGA 1L1OB 3E9HA 2E5LQ 1ASYA 4JI0L 2K5VA 4RG1A 1R9TH 4JBMA 5FLMG 4JI5L 1VQFA 2K5NA 1Q1EA 4QY7A 4EX5A 4YWLA 2LSSA 2VQFQ 1XNQL 1GD7A 2NVQH 4UP7A 4OONA 2VQEL 1W2BA 1Q8KA 3JAMi 1GO3E 1B70B 4C3IH 2ZM6L 1VQJA 3A74A 2NVTH 1VQPA 3EIVA 1K9MC 4UP8A 3RZOH 4X65L 3HKSA 4KLKA 5DLQE 1VQNA 1Q82C 4B3TL 4NPSA 1X55A 1J5EQ 1X56A 2VW9A 3PIOA 4L5SA 4BBRH 1S72A 3K7UC 1KD1C 4BY7H 4ALPA 1NMFA 4JI7Q 1HZBA 4A3FH 3U50C 4OWTB 3J81c 2K5HA 4Y7NH 3D31A 4IJHA 4IOAA 2NZOA 3KF6A 4DKAC 3PIPA 2E2JH 1IBKQ 1WI5A 2B29A 2JA8H 2JJQA 3M7NA 1Q81C 1PH9A 2UU9L 2Q2IA 3A0JA 1TWHH 4HJ9A 5C0XG 3W1GA 4BBRG 1KHIA 4GKJL 3HKZG 4OX9Q 2CQOA 2ID0A 3IRBA 5IE8A 3CCJA 4P71A 4DR3L 4PZ7A 1CSPA 2YTVA 5EAYA 1TWGH 3KJPA 1SLJA 4AQYL 1X65A 4A3KH 4LF9L 3I55A 5C3EG 1EYGA 3PSIA 2E2IH 1N33Q 1D7QA 3U4ZA 2VNUD 2HIVA 2JA8G 4JCVE 4A3DH 3M9BA 4A3LH 3HOYH 1XJVA 1G6PA 1XPUA 2K14A 3DLLA 1KQSA 3MXNB 3TRZA 1CSQA 1HH2P 3ER0A 4LFCL 4GLVB 4L5RC 1FJGL 4B3RQ 4DUZL 5LMNW 3F8TA 3KDFA 2UUCL 1U5KA 3S24A 1YZ6A 4DR1L 4A3KG 1VS0A 2BH2A 4DR6L 4LF8Q 2WB1G 3CW2C 2NZHA 4A3DG 2VL6A 3CCRA 1SR3A 4JI6Q 1K83H 1SRUA 1VQIA 5C4JH 5M3FH 1XMOL 1Q7YC 3HOUH 4OXPA 3HOYG 4DV1Q 1XPRA 3GDEA 1GKHA 2A19A 4DV5Q 3ULLA 1HNXL 1IBML 1CKMA 4OWXB 1OXUA 1VQ5A 1KRSA 3B6YA 2IHEA 1QVFA 1D8LA 4LFBQ 1FVIA 4R4OA 3ULJA 2JA7H 1C9OA 5GAEC 3GTLH 2NN6G 4DV3L 4X62L 1HNZQ 3RLOA 3GTJH 2R7ZG 3HOUG 5M3FG 3KF6B 2OTLA 4DV7L 4A3FG 4X6AH 2KCMA 3CCEA 1PHJA 5GADC 4K0KL 2F4VL 4NXNQ 1PH4A 3S1NH 1BVSA 1YJWA 4B3SL 2JA7G 1XTDA 4LUVA 3CPWA 2KHJA 4A3JH 1VQ9A 2DUDA 5ELNA 5JJIA 1V43A 4JI2Q 2R7FA 3L2PA 3I4OA 2I0QA 3S1MH 4DUYQ 4DNIA 1TWFH 2EXDA 2RF4A 2R92H 3UE0A 3AYHB 2CWPA 4YY3Q 1VQEA 1PH7A 4GNXC 4DV0L 4XIGS 5LMUQ 4GN3B 1PA6A 1B8AA 2JE6I 1K73C 4A3GH 1HZAA 1DGSA 3KDFB 4DR4Q 4WJ3M 3F2DA 4A3JG 4IPHA 5BR8L 3J80i 1N36L 2PI2E 1VQBA 4P73A 1A8VA 4X66Q 2R92G 1P16A 4AYBG 4DV2L 1XMQL 1VQ7A 2UXDQ 1JJGA 1YBYA 4O2DA 2IT1A 3JC66 3RN2A 5C0XJ 2B63H 1L0WA 3ICEA 3TEHB 1KXLA 1IBLL 1IXRA 2UUAQ 4A3GG 2A8VA 2OQ0A 4UP9A 2RCNA 5E7NA 3RLFA 2OQKA 3NEMA 3UDFA 3UDIA 3GO5A 5C4XH 2K52A 4R4TA 3I2ZA 1Y14B 2WAQE 4DV4L 2WFWA 2CCZA 3GTOH 4GKKL 3CXCA 3A5UA 2YV5A 5IYBH 1BBUA 2NVXH 3KF8B 4JI8Q 4LF6L 1Q1BA 3CC7A 3T1YL 1I5FA 5M5XH 2UUBQ 4JI4Q 4LFAL 5H1SE 2B63G 4X64L 1Z47A 4R4CA 4DV6Q 3T1HQ 4A3EH 3S15H 2PMZE 2XTIA 1NTGA 4JI0Q 4QGUA 1I6HH 2AHOB 1CUKA 1FGUA 1WCMH 3CCVA 3TREA 3U58A 1N34L 5IP9H 4A75A 4BY7G 2LXKA 5C4XG 2HQLA 4JBJA 4J15A 3PUXA 4JYAQ 1VQKA 3DM3A 1TXYA 5IYBG 4GN5A 3KLWA 1N8RC 3HOVH 2OWOA 3HOWH 2C35B 1L1OC 2E5LL 1PVOA 4QL5A 3S1QH 1MIUA 2Y0SG 4PMWA 1EOVA 5IWAQ 1N32Q 4GOPC 3PV0A 2ZM6Q 4A3EG 3W5OA 1K8AC 2PQAA 4BA1I 3F2BA 2VQFL 2UXCQ 3EBEA 3UDGA 1VQMA 1UE6A 1WCMG 4KHPL 5IP9G 2K75A 4B3TQ 1OXSC 1I94Q 4XTCS 1BKBA 3W1BA 4L5TA 3I56A 2H5XA 4DK6C 1M1KC 1J6QA 3RZDH 3HOVG 5C3EH 4LF4L 2YTXA 1YNXA 3E9IA 4IJLA 4P74A 4YCWA 2ATWA 3J7ZC 1KIXA 3HOWG 1U0LA 2Z6KC 1UWVA 4O0AA 3PF4A 1EQRA 3PGZA 4DR7L 3BZCA 4A93H 1Y1VH 1UEBA 2RHQB 1PFSA 3UDXA 3OW2A 3AEVA 4JG2A 3KFUA 1A62A 4H02A 3I4MH 1E7ZA 5JJKA 4TQUS 4BY1H 3S16H 4A76A 1KAWA 2EQSA 3NELA 3CMEA 3S2HH 4GKJQ 2ASBA 2QA4A 4DR3Q 1EIFA 1HR0Q 1NJIC 1EUJA 1XNRQ 1Y1VG 4A93G 3K0XA 2JK8A 5C44H 3ULPA 3LGJA 2R6GA 3E0EA 3I4MG 2GN5A 4OX9L 2KCTA 4BY1G 4EQ5A 3M3YH 2R93H 1NE3A 4A3BH 4GNXA 4NXMQ 1Q46A 4IOCA 3AFPA 4JOIC 4POFA 4P72A 5M3MH 1FJGQ 4AIMA 1N33L 3WWVA 2R7ZH 5AJ3Q 1L2FA 4C3HH 3GTKH 1HNWL 1VQGA 3CCUA 3CD6A 1A63A 1G291 2JA9A 2RHSB 5C44G 1KRTA 2WP8J 3M4PA 2KBNA 1YHQA 2PQAB 5GQOA 1XMOQ 4IFDI 3H15A 4B3RL 2R93G 1K0RA 2HHHQ 5GAGC 2MO0A 4DR2Q 3S17H 4A3BG 1IBMQ 4KHZA 2FXQA 5M3MG 2MNAA 1VQOA 4LF8L 3GTQH 1UE1A 3PUWA 2E2HH 3J80c 3G71A 4BXXG 4JI6L 4YWMA 4KI0A 3CC4A 3K80C 1TWAH 1XPOA 1S3OA 4LWCA 3J81i 1EFWA 4X62Q 3I7FA 3NBHB 3S14H 4PZ6A 1CKNA 3KOJA 4YCVA 4DV5L 1LUZA 1E1OA 4AH6A 1Q86C 4JI3Q 3H3VI 1GVPA 4OO1I 1TWCH 1QVGA 3HOXH 4GLXA 3KYHC 4A3IH 2I5HA 4A4IA 1X3EA 3FKIH 2ZJQA 1YI2A 4B3MQ 1YHAA 1HNZL 4BA2I 4WJ4A 1HJPA 1JMCA 3PF5A 1LM0A 4DR5Q 1JJ2A 2Q2UA 4JI1Q 3PUZA 1GM5A 5IYDH 3Q8DA 2L15A 2CKZB 3RN5A 1VQLA 3S2DH 1PH8A 2UXBQ 2IHFA 2JEAI 3I4NH 4JV5Q 1ASZA 1LTLA 4NXNL 4DAYB 3HOXG 1VCIA 4A3IG 4GOPA 3FKIG 1NBWA 1QUQA 2AKWB 1MJEA 1HZCA 4LF7Q 3CAMA 5ELOA 1E22A 1NY4A 2I5LX 2KENA 4R1JA 2XGTA 3JAMc 4YHHL 4IPDA 5K36G 1WJJA 1UE7A 1HR0W 1H95A 5IY0A 4HIOA 5IYDG 1JE5A 1RL2A 4DUYL 3VDYA 4QJFA 1OTCA 5BR8Q 3I4NG 3BZKA 3H0GH 3OYYA 4YY3L 2Z6KA 2KHIA 5FJ8H 4LF5L 5LMUL 3M4OH 1XMQQ 3M85A 4HJ8A 3OTOQ 5IP7H 3CCMA 1IZ6A 2LXJA 4ME3A 3A5ZB 4DPGA 1IBLQ 3L0OA 4A3CH 3F1ZA 4X66L 1EIYB 4A3MH 1X6OA 1QZHA 2MFIA 3H0GG 1CKNB 5FJ8G 1G51A 3D0FA 2UUAL 1PH2A 1IL2A 5LMNL 1IYJB 2EIFA 1M90C 5IP7G 4UPAA 4JI5Q 3PUVA 4RMFA 3M4QA 4NB3A 2ZTDA 1VQ8A 2YU9H 1XNQQ 2I5MX 4A3CG 4BBSH 2NVYH 3L7ZC 2VQEQ 2Y0SE 2V1CC 2N8NA 2HIXA 4A3MG 4JOIA
chains in the Genus database with same CATH superfamily
4XQQA 5M5YH 4A3BB 1XTCD 4DK3C 5D3DA 2MO1A 1S5FD 2BDNA 4MNOA 1EOTA 4C3HB 1E24A 3NP8A 5GAHC 2B3GA 3FPPA 1JOOA 4GOPB 2WINB 4KHPQ 1K3RA 4HJAA 4HJ5A 1WD0A 3K81C 1C7YA 1U4RA 2Q8RE 1X3GA 2PZWA 4NKLA 3CCQA 4HJ7A 2JA6G 2UXCL 1EYDA 4BS9A 1G91A 4DR7Q 1IKMA 4L6TB 1QCBD 3SGIA 1T9HA 2GVAA 2CWAA 3NHHA 1X32A 1H9SA 4MTNA 1O80A 2IY5B 5IT9c 5FLXc 1HFGA 5I4DA 1YHBA 3MXUA 1FR3A 3MXGA 1O7ZA 1FGBD 2EPBA 5EJWA 3RR5A 3TP5A 3PIO3 1PYSB 5IYCH 2PPBC 2HT1A 4APVA 2WB1E 2AQ2B 4ZK9B 1QVCA 2L0CA 3S2DB 1LTTD 1II3A 4LFCQ 3PIP3 2N88A 3TS0A 4DR6Q 5CMDA 2LFNA 2A6HC 1KLGD 3A56A 1HNWQ 3CCSA 2PNHA 1L0XB 2VUMG 3FPUB 1GXDC 5KEEA 4IFDG 4NP5A 5CV9A 5FLXL 3TQYA 2JEBI 2F3IA 5I6YA 2OEOA 1HA5A 2EY1A 5JVG3 1NR2A 1SN8A 2HHHL 1CZWA 2L4NA 1GOZA 4C2MH 2IX3A 4LW1A 1ESFA 2NN6I 4A3MB 4OO1G 1WTPA 4K0KQ 1H9SB 4B3SQ 2AQ1B 2WAQB 2M2LA 4K2LA 4KD4A 1LTGD 2E75C 4RFBA 3KJOA 1W3SA 2BE5C 2K33A 4Q5VA 2EJFC 1PTOB 2O2LD 2PW5A 5M5YB 2Z0SA 4GNXB 4PZ8A 3BYYB 1WYDA 1XX8A 4ZUJA 4FF3A 2QEJC 1AE3A 3E5SA 2AUKA 2PW7A 3IL8A 4JV5L 4MZ9A 3PUYA 1WFQA 3QB3A 3K57A 1XXGA 4DR4L 5IGFA 1I4XA 3PO2G 4LF5Q 1X54A 3CMAA 1D5MC 1VDZA 3HOZG 3PO3H 5JVH3 2K4KA 3R2IA 5KIXA 4L5QA 3CCLA 2OTJA 1AE2A 2M00A 4LF6Q 3TS2A 2XWJB 3TP8A 1S40A 4X64Q 3CC2A 2G9HD 1V9PA 4YWKA 5LMNQ 1B44D 3CRLC 1HUNA 4P75A 2F52A 2FMCA 2SNMA 1QE6A 4L8JA 3D3RA 1VQ4A 2IX1A 3OWEB 1N9WA 3BU2A 4WRDA 4X3KA 4JW0A 4JBMA 1F2YA 1Q1EA 4YWLA 2LSSA 4OONA 1E2ZA 3LNNA 2XWBB 1STHA 2JN4A 3A74A 5C6AA 5A2QL 3J7AV 2B2WA 1X56A 2F0WA 4PNYA 1S72A 1VMCA 1KD1C 2VB3X 5FO7B 3U50C 4DK0A 3J81c 3D31A 1ML0D 3KF6A 3EROA 4IUUA 2B29A 2JJQA 3M7NA 1HPCA 5KYIA 2UU9L 3A0JA 1I4PA 4X3TA 1AW7A 3W1GA 2CQOA 5IODA 4A3FG 3CCJA 1YIJA 3KJPA 5EAYA 1TWGH 3BDLA 3I55A 1EYGA 1D7QA 4N9PA 2O5IC 2JA8G 3FEWX 1BR9A 1XJVA 3NBIA 1HCZA 1NAPA 2RDGA 3MEHA 2F03A 1HH2P 3TRZA 4L5RC 1HUMA 4GLVB 3I70A 1FJGL 4B3RQ 3F8TA 2UUCL 1U5KA 4MN3A 3S24A 2L1BA 1F9QA 1VS0A 1K83H 1SRUA 1VQIA 3SVMA 1XMOL 3HOUH 1XPRA 1SYGA 1GKHA 3C3LA 3PO3B 2A19A 1BCPF 1CKMA 4HR7B 1TS5A 4OWXB 1TU2B 1KRSA 3OWFA 1VQ5A 1QVFA 2B2UC 5C5LA 3ULJA 3UI2A 5CBAE 5GAEC 1HNZQ 4LMQD 5M3FG 3KF6B 4R8NA 2QDBA 1PHJA 1EY5A 2F4VL 4NXNQ 2EE1A 4HAEA 1HXYD 1YJWA 2JA7G 3CPWA 3OW7A 2DUDA 2I07B 2N55A 1V43A 1BXTA 3I4OA 3L2PA 2I0QA 3QG1A 1TKWB 3HOVB 4GN3B 1B8AA 4A3GH 2B2VC 2WACA 4DR4Q 1NNXA 3J80i 4P73A 1LABA 3HKZB 1VQ7A 4DV2L 3U9SA 5IT9E 5EBCA 3U9OA 3TEHB 1IXRA 4QB4A 4UP9A 2DY8A 5E7NA 4R4TA 3I2ZA 1Y14B 1PXUA 2WFWA 4EQOA 2YV5A 3K6OA 5IYBH 2A6EC 5ELCA 3T1YL 4LFAL 5M5XH 2B63G 5H1SE 1Z47A 3X3NA 4HCEA 4QGUA 2AHOB 4RGOS 4KV6A 1N34L 3TREA 5IP9H 1LT4D 4DXGA 3NTKA 4BY7G 3JAML 1PTOF 3QJYA 5C4XG 1WTOA 4JYAQ 1VQKA 1HTLD 1X3PA 1G6ZA 3HOWH 1L1OC 1Y8PB 3J80E 1MIUA 2Y0SG 4PMWA 2PQAA 2F0SA 4ZCKA 5J1ZA 2VQFL 1WCMG 3N52A 4QF4A 3HOUB 1TS4A 1Z6HA 2K75A 2DNEA 3I56A 4L5TA 4FXKC 1M1KC 1LT6D 3D4WA 4QUFA 3RZDH 4LF4L 3NTHA 1YNXA 4OGQC 1UWVA 4H7BA 1S5CD 1EQRA 1LT5D 1DD2A 3OW2A 1BF4A 1A62A 1DOLA 3NQIA 1ZXTA 3BVZA 4PMBA 2F0MA 3OIQA 4V190 4K5WA 4KY6A 1RTNA 3Q23A 3CMEA 1IYVA 1JWMD 1HR0Q 3FKIB 1XNRQ 2OXPA 2QDLA 2QILA 1FNVA 3I4MG 2A68D 2GN5A 2VB2X 4OX9L 3M3YH 2BOSA 4ZRZA 3VA7A 4NXMQ 4AYBB 1FJGQ 1EY9A 4AIMA 1N33L 1SBBB 5AJ3Q 4K5XA 3CD6A 2L55A 4A3GB 1F9RA 2KBNA 2ZT9C 2PQAB 4CKCA 1XMOQ 4TKOB 3VR6A 4IFDI 1K0RA 2MO0A 4MIUA 4DR2Q 3S17H 4A3BG 2KECA 1SYDA 2CVRA 2FXQA 4LF8L 1VQOA 3GTQH 1UE1A 3G71A 4C3HG 4JI6L 5HGTA 3NPPA 3M4OB 4LWCA 3J81i 4RKBA 3S14H 4PZ6A 1CKNA 2K05A 4YCVA 1U4PA 4FO2A 3OSOA 2EJGC 4OO1I 3HOXH 4GLXA 2KHSA 1JC7A 2I5HA 4A4IA 2JSOA 1YI2A 5M5XB 1HJPA 2NWGA 1PMRA 4QIWB 2EYLA 2PQEA 3FMCA 1SYCA 3I4LA 4JI1Q 1GM5A 3RN5A 2L15A 1EEFD 1ICWA 1KAAA 1PRTB 1ASZA 1LTLA 1EIHA 3HOWB 4DU9A 3BDOA 2E74C 4TRDA 2KA7A 4FVMA 4IPDA 1WJJA 3IAYA 5IY0A 5IYDG 4KK7A 1JE5A 1RL2A 3VDYA 4QJFA 3BZKA 3R3OA 1MGSA 3OYYA 4J6HA 3J81E 3ND8A 3KBGA 4DNRB 3RZDB 2A6HD 2L9HA 1PYWD 3CCMA 1CHPD 4OEMB 3T51B 2KEEA 3L0OA 2DJGC 4A3CH 3NUCA 3T4AC 3F1ZA 1HQRD 1B53A 3MA2B 2HDLA 1CKNB 5FJ8G 3SXHA 3D0FA 5JEAH 1WTVA 1ESRA 4IQZA 2ZTDA 1B9NA 2Y0SE 1YNNC 5C3WA 2AQ3B 4JI8L 5JJLA 4A3MG 5JOBA 1SDFA 5CV7A 4JI4L 3CPFA 2JA5H 4DV6L 1VQHA 2WAQG 1SROA 4X65Q 2BE5D 2BH8A 3D6CA 2PCFB 5ELFA 1XYIA 1CI3M 5JJZA 3FP9A 2PI2A 4DAMA 3S17B 3GTMH 4RGNA 4LF4Q 4K6LA 1Q90A 4ILWA 3MEFA 4CDFC 4GS3A 3Q0AA 4ZAIA 1I94L 4GLAC 3S14B 2AMCB 3SK8A 3DM1A 5HGQA 4LUZA 1SFOH 5EKIA 3HOXB 1PH6A 2HUGA 5I9OA 3J7A5 4S3SA 4AQYQ 4TVAB 1KL9A 1CTMA 3EFXD 1TR5A 4FF2A 4RAUC 1TT2A 3C46A 2IPKD 4DUZQ 1DYQA 3VYSA 3OIPA 4M8AA 5KYLA 1JWSD 4JC0A 1NMGA 5IYCG 3NWTA 2VS1A 3T16A 4DGZA 1AH9A 3TP6A 3P20A 1Q3LA 1JB7A 1TY0A 1E1TA 1A3VA 2AWNA 3H3VH 5A35A 2QEXA 4DV3Q 3G6EA 1OXTA 2O4XA 2J4XA 4IZ8A 1UUPA 2VZAA 3VYTA 4HIMA 3SEBA 5DM63 4R9WA 4KTAA 2D0OA 3AFQA 1K28A 3A54A 5E4XA 1KC8C 1VQCA 3STBC 4JI3L 4N8FA 1A0IA 1XWEA 2MGSA 5J3BA 1JJCB 3G6JB 4PQXA 4B3ML 1Y1WH 1RF2D 5EPKA 2JA5B 1BBXC 3BJUA 4DR5L 1F2ZA 1YVCA 3CF5A 4JI2L 1PYBA 1CA5A 2HCCA 3S9WA 1UAPA 4FF1A 3HFZB 5ELEA 5IGDA 4RA8A 1N36Q 2YYZA 1UNSA 4JPBW 4RCNA 3NENA 2WKCA 1I50H 3A8KE 4LF7L 3QR8A 3GTMB 1KDBA 1QNUA 1SE8A 1EWIA 1E3PA 4IO9A 4RKLA 5CGKA 2Q2TA 4GKKQ 3DWPA 4X3SA 2GVBA 1S5ED 3OTOL 4C3JH 4Q0FA 3NQTA 4KKUA 5FLMH 2JQOA 3OHXC 5M5WH 3I72A 2X69A 3PO3G 3DWAA 5HY6A 2BA0A 3VR2A 1EY8A 3SK5A 3E9HA 1SNDA 2F4IA 2M9VA 4JI5L 1VQFA 5KNCA 1PRTF 4GZYC 5C4HA 2XVSA 4C3IH 1PFNA 1VQJA 3EA6A 2NVTH 2HD3A 1VQPA 2LKVA 2EYHA 1GJXA 3RZOH 3BVGA 4KLKA 5DLQE 1EY4A 4XYQA 4G7ZC 4K8JA 1X55A 2VW9A 5C0XH 4L5SA 3K7UC 2X6LA 4ALPA 1HZBA 1BCPC 1NSNS 4OWTB 2K5HA 4Y7NH 2NZOA 5D3IB 1STNA 1VMPA 5EGTA 2K01A 1Q81C 1SE3A 1ZKOA 4HJ9A 1HA6A 3W2DA 1D5ZC 1IHZA 1KHIA 2PYKA 2Z6BA 5TSSA 3HKZG 3A55A 4LF9L 1I4GA 4PZ7A 4A3KH 1JOQA 2E2IH 3PSIA 1Y1WB 4A3DH 3LX0A 1G6PA 1XPUA 3DLLA 3I91A 2A6ED 2F0HA 3ER0A 3W3AA 4NW2A 4ABNA 3K5NA 5KNDA 3R2TA 5ELBA 3BS1A 4DR1L 4L63B 2R92B 1C4QA 3NE5B 1I50B 1WD1A 4HN7A 2VL6A 3CCRA 1SR3A 3R93A 5C4JH 3GDEA 2Z1CA 2SEBD 4DV5Q 5L37A 1I4RA 1HNXL 1EQTA 4ZLTF 1OXUA 3GTLH 4H44C 4C3JB 2RA4A 3HOUG 5M5WB 2OTLA 2KCCA 4DV7L 4CGYB 4X6AH 2AUJD 3VA5A 2KCMA 2Z8LA 5GADC 5I6WA 1EEID 3S1NH 4N9TA 4LUVA 1BQQT 4A3JH 1VQ9A 5ELNA 2EYFA 3ND9A 4ZKCB 4JI2Q 4DUYQ 4DNIA 2RKSA 2EXDA 2RF4A 4KJOA 2EYOA 3K58A 4C3IB 4GNXC 2NVTB 4DV0L 4XIGS 3T13A 3RZOB 5C3XA 1GUWA 2F0KA 5LL6S 4X66Q 1XMQL 4AYBG 1RD9D 1YBYA 3JC66 4Y7NB 1AN8A 1L0WA 2B8GA 4A3GG 2A8VA 3EVQA 1SMYC 1ONLA 4DV4L 2EDGA 2CCZA 3CXCA 1JB3A 4B9WA 2DN8A 4XXEA 3S16B 1I5FA 4A3KB 4ULLA 3S15H 1MBYA 1SNMA 2PMZE 1NTGA 1O7LA 2WB1B 2E2IB 1CUKA 4A3DB 3CCVA 2HQLA 1SYBA 1SNCA 4JBJA 4H13C 3DM3A 1TXYA 5IYBG 3HOVH 4MHEA 1NCVA 1N8RC 4F87A 3DXJC 2C35B 2E5LL 1EOVA 3BG3A 3PV0A 4WFN3 1K8AC 3F2BA 2UXCQ 1EL0A 3EBEA 3UDGA 1VQMA 5IP9G 5C4JB 4HSPA 1BKBA 3W1BA 4DK1A 4HMIA 2H5XA 1G8ZD 3HOWG 2RDFA 4YCWA 2ATWA 4HEDA 3PF4A 5LHY1 1U4MA 3GTLB 1UEBA 2RDHA 5CBEE 1DZ1A 3MZ5A 2A73B 1KAWA 2EQSA 3NELA 5KNBA 1ZYRC 5IGCA 4CBVA 1HRJA 1EIFA 5KGUA 3S1NB 4HMJA 1NJIC 1EUJA 1QG7A 1ICFB 4DAYA 4A3JB 4KN4C 1FYCA 2KCTA 4EQ5A 2CW0C 1BOSA 4PV1C 3K59A 2A74C 3AFPA 3HG9A 4U68A 2F0DA 1SNOA 1YNND 5JPMC 1RKNA 1YHQA 2JXMB 1EWCA 2F0UA 2HHHQ 5GAGC 3VR5A 1AP0A 3BYTB 1C8CA 3X3MA 1EYCA 2CH4A 2MNAA 4IUNA 2EJMA 4YWMA 4KI0A 1XPOA 2B2WC 4B9XA 1EFWA 3TDQA 4ID6A 2ZXPA 2NZ1D 3KYHC 4A3IH 1U9RA 3RD4A 2G5DA 2ZJQA 1X3EA 3FKIH 4K5VA 3J7YW 1YHAA 1WTHA 4BA2I 5K36H 4CDDC 3PF5A 1PLFA 3S15B 1JJ2A 3PUZA 3Q8DA 4IUQA 2CKZB 1PH8A 5FO9B 3QIAA 1B3AA 3I4NH 1GUSA 3TSSA 5G3LD 4JV5Q 4DAYB 3HOXG 1VCIA 1A2UA 2AKWB 3CAMA 1MD2D 1NY4A 3JAMc 4YHHL 2KENA 4EVOA 1H95A 2DNCA 3DMUA 5FLXE 1ENCA 4YY3L 3P7JA 1Q8IA 1TS3A 2KHIA 5LMUL 3M4OH 1XMQQ 2LY7A 5CYUA 2LXJA 1FD7D 4EQNA 1DM0B 4RGMA 4KY5A 1X6OA 2MFIA 3RMHA 1G51A 1HFNA 2F0NA 2UUAL 2EIFA 4UPAA 2F0IA 4FXGC 3PUVA 2F1MA 4NMZA 2YU9H 4A3CG 2I5MX 2RSNA 4BBSH 1K0SA 2NVYH 2LMCB 2JYOA 2PZUA 2HIXA 2K7VA 3K5LA 3KLRA 2N3SA 3PMFA 5DNFA 2ALYB 5T1IA 1LTRD 1SEBD 3STBD 1PH1A 5JEAG 1X9NA 3RNUA 1LACA 4UY8C 2E76C 2DJFC 4ZYSA 1NR4A 4G57A 3RLNA 2F0VA 4XQNA 5IWAL 2JA5G 1N32L 4YCUA 1EU3A 2B2TA 1U4LA 2G9DA 2K50A 1B4OA 2OCEA 1RDPD 2ZTEA 2UU9Q 2D2CC 3J81j 3V96A 4ZKBB 2MP1A 3CP0A 1IBKL 4A3IB 4CJ0B 1SJHD 2EYMA 1BUVT 2SOBA 3AU7A 1IW7C 3PCOB 1SE4A 1DCZA 2LS01 2EY6A 3K7AB 3I3CA 2CH4W 3Q6SA 3ITPA 1P8LA 1H9JA 2Q2HA 4P2CB 3I4NB 1OXVA 2UUCQ 1F77A 4KHVA 1E2WA 1J8IA 1RIPA 4X3UA 3VYRA 1CZGA 1EZ8A 2V4DA 5J22A 4R4QA 3L3OC 4DFAA 4J1MA 3Q22A 1H9RA 1CM9A 1LLRD 3P1HA 1STAA 5A2QE 4LAAA 5K5PA 1M4VA 3GTGH 1WOCA 2K03A 4LUOA 2ZJPA 2R7DA 3DUZA 2ZJRA 4KKSA 4XYOA 1JOKA 4I65A 3G48A 3NXWA 4A3LG 1SNQA 4XQJA 1PFMA 1STBA 3BVMA 3ERSX 3ZJYC 1B7YB 2CFMA 2F4VQ 4O42A 3HZXA 2MUYA 1EQVA 1SE2A 1BCPD 3FHWA 4KY7A 2YU9B 4BBSB 2NVYB 5JEAJ 2K04A 2N49A 1M8AA 3MHBA 1CT1D 1KTKA 1CA6A 1W6JA 1LTBD 4GN4B 5EPLA 3GD7A 2ICIA 3SR1A 5IGBA 4YHHQ 3S1RH 4WJWA 2QGQA 2UXBL 1PRTC 5FKAC 2AWOA 2NB0A 1YJNA 1PV4A 4DV2Q 1HZ9A 4CKBA 3K0YA 1Y1WG 2Z4IA 3V05A 1O7IA 3URYA 2F0JA 3TZUA 2BA1A 5EQ0A 3T56B 2RCFA 3UE1A 1AFPA 3EN2A 1C0AA 1Z9FA 4IUPA 2VY3A 1MJCA 4BWGB 2IX0A 2Z4HA 3T1YQ 2D0PA 2XRSD 4LFAQ 5EKLA 1S4ZA 2Z9HA 1N34Q 1E2VA 4Y52H 3VYUA 3K8AA 3NTIA 2IW3A 1EIGA 2N78A 3T1HL 3CHBD 4IPCA 1OXXK 4JI0L 1QZGA 2K5VA 4C3JG 3MXNA 4RG1A 2IWHA 5FLMG 2K5NA 4EX5A 2VQFQ 2Q8TA 1XNQL 1GD7A 2B8FA 3H94A 2VQEL 3I90A 4EQPA 3I73A 4LK1C 3JAMi 1GO3E 3GTGB 2ZM6L 1EYAA 1K9MC 4UP8A 1VQNA 4B3TL 2B2YC 2IJ0A 4KKTA 3PIOA 4BBRH 3QWNA 3OMCA 5M3FB 1B9MA 2A69C 1PFBA 3D4DA 1JORA 4C3IG 4IJHA 4DKAC 3PIPA 1EY7A 2E2JH 1IBKQ 1PH9A 4LJZC 4CDEC 4FYDA 2Q2IA 4C1NI 1TWHH 3MXPA 1TQOA 2Q8IB 5C0XG 1B2TA 1PZKD 1B1ZA 1JE4A 4GKJL 5E4WC 4QCLA 4OX9Q 3H91A 2YTVA 4HSVA 1SLJA 1N33Q 3JAME 4A3LH 1SMYD 3M9BA 3TN2A 3HOYH 2L5TA 4RCOA 4I7AA 1CHQD 1KQSA 4KD3A 3MXNB 3S1RB 1CSQA 4PMCA 4LFCL 2NTSA 1D1IA 3KDFA 2QF7A 1YZ6A 1TWFB 2DY7A 3MFYA 4A3KG 4DR6L 4LF8Q 2NN6H 2WB1G 3CW2C 2NZHA 4A3DG 2F0EA 3D6WA 4JI6Q 1Q7YC 2FHTA 5DEHA 1ET9A 2F0PA 5M9OA 2IHEA 5CORA 1C9OA 3GV3A 1MSGA 3GTJH 4YIJA 1H9MA 2XIWA 2L12A 3KF8A 1YNJC 1AEXA 2WV6D 2BDOA 1V1OA 3HGBA 5J39A 3CCEA 3GTOB 4K0KL 1PH4A 3EJIA 3IFDA 1BVSA 4B3SL 4DAPA 2KHJA 2D5DA 2R7FA 3T53B 2VXWA 3S1MH 1ZYRD 2R92H 5JAVA 4QMGA 3UE0A 1QNKA 2CWPA 1PH7A 3QOLA 3I8ZA 3DEPA 2K6AA 1JICA 3KDFB 1R4PB 3VR4A 4UHVA 3NSWA 1VF7A 4A3JG 1IKLA 2CW0D 5BR8L 3KK7A 1J9OA 3H09A 1VQBA 4BBRB 1EY6A 5KRUA 4O2DA 3RN2A 5C0XJ 5C3EB 1KXLA 3SE0A 1F9SA 2E2JB 2QKIC 3UDIA 1TWHB 3GO5A 2K52A 2WAQE 3A5UA 2NVXH 1BBUA 3KF8B 4JI8Q 4LF6L 1Q1BA 3QOJA 4JI4Q 3NWSA 1DOMA 1OO9B 2MHVA 4X64L 4DV6Q 1SYFA 3T1HQ 4A3EH 3K5MA 4JI0Q 1FGUA 3U58A 5JPNC 3HOYB 1K8OA 5IOCA 4J15A 1WVLA 3PUXA 1ZEQX 2F0LA 3KLWA 5IGEA 2EY2A 5T1GA 1PVOA 4QL5A 3S1QH 1TY2A 4OIJA 4GOPC 2ZM6Q 4B08A 1UE6A 2KQ3A 2R7ZB 4MTKA 5CV5A 4B3TQ 3GQBA 1I94Q 4JK1C 4F7XA 5CV6A 1DJRD 1J6QA 3RUZA 3HOVG 3H6MA 3H3VC 4P74A 5C4ZA 1KIXA 2Z6KC 3NBHA 4O0AA 1BCPB 3V2TA 4A93H 1Y1VH 2RHQB 3UDXA 1PFSA 4C56C 3AEVA 3GTJB 5JJKA 1E7ZA 2K32A 3TBIB 4BY1H 3S16H 1HQMC 1KLUD 5FK9C 2I46A 3S2HH 4GKJQ 5F2DA 2ASBA 1PZJD 2KUMA 2JK8A 5C44H 2F0TA 5I9PA 3WOEA 2R93H 1RJTA 1A15A 2ICEC 1NE3A 3S1MB 4GNXA 1Q46A 4IOCA 4POFA 4JOIC 2SDFA 1Y8NB 4P72A 5M3MH 1AZPA 3GTKH 2F3WA 1VQGA 3CCUA 1G291 1L0YB 2JA9A 1KRTA 2B39A 4CJ1B 2WP8J 1KABA 3M4PA 4B3RL 3H15A 1B3QA 1TVXA 2WKDA 4KHZA 2E2HH 3J80c 4BXXG 4NDXA 5IT9L 3CC4A 1ET6A 3K80C 3KLSA 1TWAH 1S3OA 3NBHB 3SDZA 3KOJA 1LUZA 1E1OA 4AH6A 4JI3Q 3H3VI 1GVPA 1Z7TA 1TWCH 1QVGA 2FMMA 1CFMA 2NVXB 4M1UB 5G3LF 4IN3A 4B3MQ 1DOKA 1HNZL 4WJ4A 1A3TA 3OPOA 4A3EB 1LM0A 4DR5Q 5IGGA 4ZQ3A 1PTOC 4DN4M 4NXNL 2SNSA 1JR0D 3E6ZX 1IW7D 4A3IG 5CV8A 3FKIG 1QUQA 1MJEA 3DEOA 4LF7Q 3S1QB 5ELOA 5K36G 4R1JA 3J80L 3E3XA 5COYA 5EKKA 4KMUC 1LTID 4XT3B 1NUCA 1OTCA 5BR8Q 3I4NG 5D14A 3H0GH 4K14A 1D5XC 1FNWA 1DXMA 3ZYYX 3KBXA 1MSHA 3NK9A 3OTOQ 1JQYD 2C9OA 1D2BA 5IP7H 4ME3A 4A93B 1Y1VB 3A5ZB 3F2UA 3AB9A 4BY1B 2J7ZA 2HDMA 4RH6A 1O78A 3S2HB 1PH2A 1IL2A 1IYJB 1M90C 4JI5Q 3M4QA 4NB3A 5C44B 1VQ8A 3L7ZC 2NUCA 2MJ8A 2V1CC 1GUTA 2N8NA 1Y69U 1KDCA 2R93B 5NUCA 1CQFA 1I4HA 5M3MB 4DXFA 2JA6H 4ME5A 2IL8A 1YITA 4FP5D 4JBKA 3GTKB 2A5HA 1QUQB 1I3QH 4EGVA 4IFDJ 4JYAL 1K8MA 2D62A 4DAVA 4BBSG 2B2UA 2DGYA 1LTAD 1SNPA 2RBMA 1FL0A 3HKZE 1J5EL 2E2HB 4R4IA 4HCSA 1PRTD 4PG3A 1TWAB 1QILA 4JI7L 5EBDA 5GROA 1X3FA 3TP7A 4IPGA 3MTSA 3D8GA 1TWCB 4LF9Q 3GTPH 4C2MB 5C0XI 1BDOA 4K6DA 1X3QA 1ENFA 2NYZD 1K8GA 2VUMH 5I2XA 4IFDH 1Y8OB 2B2VA 4BXXH 1HR0L 1UE5A 4JBWA 4DR1Q 1XNRL 2NBFA 3DHQA 1YJ9A 2K1BA 2F0QA 3U4VA 4OWWB 4FF4A 2MPMA 4G7OC 4NXML 1ILQA 1HNXQ 3H0GB 3AQQA 4OO1H 1BBWA 2XN9C 5AJ3L 3LWUA 4E6IA 3J81L 1A2TA 4DV1L 2MQHA 3GV6A 4F88A 3FDTA 2E8GA 1V1PA 4DV7Q 4LFBL 4DR2L 1RHPA 4HIDA 4G7HC 1IYUA 3P75A 1V8QA 2F0OA 1SMXA 2A1AA 3K7AH 1LTSD 2C5CA 2QW7A 2A69D 3F2CA 2ZTCA 1RTOA 2KVMA 1L1OA 1RCVD 2H4OA 1Q12A 1YEZA 3OMGA 1MKHA 3FVQA 2PMZB 3CQZH 2R61A 5C5MA 1C48A 1T5XD 1BNZA 4R8IA 3PO2H 1JT8A 1MI2A 1VQDA 4DV0Q 2TMPA 2JA6B 4AYBE 3HOZH 4JI1L 1H9KA 3TZDA 1STEA 4KJNA 3WOFA 2X6GA 4IURA 1I3QB 5FOBB 1HTPA 1LYLA 1V1QA 3C2PA 1QWYA 4FXDA 1GUOA 1G2TA 5HURA 2KCNA 4RHSA 5BN4A 4QQBX 1ENAA 2P5ZX 1W6KA 4N8X1 4ODGA 2ES2A 1TIID 4HIKA 1EQQA 1GUGA 2UXDL 4DV4Q 3R8BA 4LNQA 5AFWA 3O13A 2K5DA 1F2MA 1V1PB 3CRKC 2NTTA 4FDBA 3GTPB 3G4SA 2YTYA 4V0BA 1VQAA 3ONAB 2OT2A 4H0LC 2R3ZA 3SK6A 2TSSA 1PH3A 1I6VC 2KJXA 3M7GA 4QIWE 2UUBL 5FO8B 2EVBA 4ZUIA 1PH5A 2VUMB 4POGA 1HHVA 1CKOA 1L1OB 2E5LQ 4TSSA 4UAIA 1ASYA 1TWGB 1YNJD 3BZDB 1R9TH 1IL8A 4QY7A 1A6XA 2NVQH 4UP7A 1W2BA 4IUVA 1Q8KA 4FNFA 4OIKA 1B70B 5ELDA 4I7ZC 3MFGA 3EIVA 3LWEA 3A8IE 4X65L 3HKSA 2RSOA 1Q82C 4NPSA 1WTRA 1BO0A 1J5EQ 3MVVA 3QO2A 3N6RA 3A8JE 4CDCC 1K83B 2HQEA 1NMFA 4JI7Q 4A3FH 1EY0A 1GHJA 1CQVA 4IOAA 3TMEA 4QUCA 4XDXA 3HEJA 2JA8H 1WI5A 3G7LA 3IFTA 4RGTA 5E3FA 4BBRG 1QJOA 2ID0A 3IRBA 5CC4A 5IE8A 4P71A 4DR3L 1CSPA 1SSOA 3E0JA 4AQYL 1LT3D 1X65A 3CQZB 3FRPB 5CR3A 2ZXOA 5C3EG 3U4ZA 3PO2B 2HIVA 2VNUD 4JCVE 1QB5D 3HOZB 1JWUD 2K14A 2QCPX 1AZQA 4DUZL 5LMNW 4K8IA 3A7LA 2CHBD 2BH2A 2RVLA 3CKIB 3KUPA 5M3FH 3HOYG 4OXPA 4DV1Q 5LL6X 4RWSC 5I2YA 3KLSX 3ULLA 1IBML 3B6YA 4LFBQ 1D8LA 1FVIA 3ERQA 4R4OA 2JA7H 2NN6G 4DV3L 4X62L 3MAQA 5D65A 2KOLA 3RLOA 3SHLA 2R7ZG 2EY5A 1A3UA 1SAPA 2EZVA 3IKJA 4OHJA 2B2TC 2HCIA 1LO5D 5DM73 2XRQD 2EYPA 2H1EA 4U673 1XTDA 1R9TB 1EWHA 5JJIA 4DF7A 2NVQB 2EYJA 1TWFH 3AYHB 4CJ2C 3MWYW 1VQEA 4YY3Q 1DONA 3J7AF 1MHWC 2CQAA 5LMUQ 1PA6A 2JE6I 1K73C 2B2YA 4WJ3M 1HZAA 1DGSA 3F2DA 4IPHA 3HRZC 1PZID 5EPJA 1N36L 2PI2E 1SYEA 1A8VA 2R92G 1P16A 2PNRC 1JJGA 2UXDQ 4A3FB 2IT1A 2B63H 1WTXA 1EU4A 3ICEA 2EOTA 2PO4A 1IBLL 1S5DD 2UUAQ 2JA8B 2OQ0A 3RLFA 2RCNA 2OQKA 3NEMA 3PQIA 3UDFA 1VQ6A 4BY7H 5C4XH 3GTOH 1STGA 4GKKL 5BN3A 3CC7A 1STYA 2UUBQ 2F0FA 1T5EA 4R4CA 2K5WA 2FINB 4OL7A 1FNUA 2F3VA 2XTIA 3D4RA 1I6HH 1WCMH 1PDQA 5CV4A 1E0BA 4A75A 2K28A 2LXKA 3M4YA 4GN5A 3AMUA 2GA4B 2OWOA 5IIFA 3M3YB 1EFID 2PZTA 5IWAQ 1N32Q 3DWQA 4A3EG 3W5OA 4BA1I 2ZXRA 3SK4A 1PTOD 2KEDA 4CKEA 4KHPL 1OXSC 1GHKA 4XTCS 4DK6C 3CU7A 5C3EH 2YTXA 4IJLA 3E9IA 3J7ZC 5DAUA 1U0LA 4DR7L 3PGZA 3BZCA 2JA7B 4Z9CB 3GTQB 2BCOA 4JG2A 3KFUA 4H02A 3I4MH 4TQUS 1UEAB 2JP1A 4A76A 3L9AX 1KDAA 4O1NA 2J0TD 2QA4A 4DR3Q 2D9UA 4A93G 1Y1VG 4J8QA 3K0XA 3ULPA 3LGJA 1KNAA 2R6GA 2XNAC 3E0EA 1JCKB 4BY1G 3OOCA 4A3BH 4C1NK 2FFKB 4UDUC 1ILPA 3WWVA 4WORA 2L11A 1L2FA 2R7ZH 4C3HH 1SJED 1HNWL 5BN5A 1LV9A 1A63A 1S5BD 1TS2A 2FJ2A 2RHSB 4IUTA 5C44G 1R4QB 4JVZA 5GQOA 2F0GA 2R93G 3MC0B 3C1FA 1IBMQ 5M3MG 2B63B 3PUWA 3C1EA 3BDCA 4G4KA 2WIIB 2EXZA 4X62Q 3I7FA 3K5OA 4DV5L 4BY7B 1Q86C 5C4XB 2O5JC 2K5QA 1K3BC 1VF5C 4RHRA 2ENBA 2E2DC 2Y0SB 4KN7C 1QOHA 1JMCA 1SXTA 1I6HB 1WCMB 2Q2UA 5E1FA 5IYDH 1VQLA 4DA2A 4DNTB 1D6EC 4HTHA 2OF1A 3HP3A 2IHFA 2JEAI 3S2DH 1WTQA 2UXBQ 1F2LA 4OELB 4GOPA 1D1KA 1NBWA 1HZCA 2XSCA 1E22A 2I5LX 2XGTA 1EZ6A 1UE7A 1HR0W 4HIOA 4DUYL 5ISRA 1CK1A 1F9PA 2Z6KA 4K2KA 2RQXA 5FJ8H 4LF5L 1GUNA 1KNEA 3M85A 4HJ8A 1IZ6A 3WDNA 1B50A 3Q24A 4DPGA 1IBLQ 3HS0C 4IALA 3I4MB 1WTWA 4X66L 1EIYB 3GP7A 1RODA 4A3MH 1QZHA 2A68C 3H0GG 3EQLC 3VR3A 1G2SA 1SFOB 4F8MA 5LMNL 5IP7G 1I4QA 4CHTB 4RMFA 1O7YA 1XNQQ 2VQEQ 4XT1B 1PTOH 3A7AB 4JOIA
chains in the Genus database with same CATH topology
5M5YH 4JI4L 3CPFA 2N3SA 4DK3C 2ALYB 2JA5H 2MO1A 4DV6L 1VQHA 2JA6H 2WAQG 4MNOA 1SROA 4JI8L 4X65Q 1E24A 2BH8A 3STBD 5JEAG 5GAHC 1YITA 2B3GA 4GOPB 1X9NA 1PH1A 3RNUA 4JBKA 1QUQB 1I3QH 4IFDJ 4UY8C 4JYAL 2D62A 4BBSG 4KHPQ 2DGYA 1K3RA 4HJAA 4HJ5A 3K81C 3RLNA 3FP9A 1C7YA 2PI2A 4DAMA 1FL0A 1X3GA 5IWAL 2JA5G 3GTMH 3CCQA 1N32L 4YCUA 4HJ7A 4LF4Q 2JA6G 3HKZE 2UXCL 1J5EL 4R4IA 3MEFA 2K50A 4PG3A 4DR7Q 4GS3A 2OCEA 2ZTEA 2UU9Q 3SGIA 1I94L 4JI7L 4GLAC 1T9HA 2GVAA 5GROA 2CWAA 1X3FA 2AMCB 4MTNA 3J81j 4IPGA 2IY5B 5HGQA 4LUZA 3CP0A 5IT9c 1SFOH 1IBKL 5FLXc 4LF9Q 1PH6A 3GTPH 1YHBA 3J7A5 4AQYQ 4TVAB 3PCOB 1KL9A 3RR5A 5C0XI 1PYSB 5IYCH 2HT1A 4APVA 2WB1E 1K8GA 1QVCA 1P8LA 4LFCQ 2Q2HA 2VUMH 1OXVA 4DUZQ 2UUCQ 4BXXH 1HR0L 1UE5A 4JBWA 1RIPA 4DR1Q 3TS0A 1XNRL 4DR6Q 4JC0A 4R4QA 1YJ9A 1NMGA 5IYCG 1HNWQ 2VS1A 3U4VA 4OWWB 1AH9A 3CCSA 2PNHA 3GTGH 4NXML 5JJLA 1WOCA 1HNXQ 1JB7A 2VUMG 1E1TA 4LUOA 2AWNA 2ZJPA 3H3VH 4IFDG 3AQQA 2R7DA 1BBWA 5AJ3L 2ZJRA 3TQYA 4DV1L 2JEBI 2MQHA 2QEXA 2F3IA 3G6EA 4DV3Q 1OXTA 3G48A 4A3LG 2E8GA 1SN8A 2HHHL 4DV7Q 4LFBL 4DR2L 3ZJYC 3ERSX 2VZAA 4C2MH 4HIMA 4LW1A 1B7YB 2NN6I 4HIDA 4OO1G 2CFMA 4K0KQ 2F4VQ 4B3SQ 1SMXA 2D0OA 2A1AA 3AFQA 3K7AH 3KJOA 1W3SA 1KC8C 1VQCA 3F2CA 2ZTCA 4JI3L 3STBC 3FHWA 1A0IA 1L1OA 5J3BA 1Q12A 1YEZA 1MKHA 5JEAJ 1JJCB 2N49A 3CQZH 4B3ML 1Y1WH 1JT8A 2Z0SA 3PO2H 4GNXB 1VQDA 4DV0Q 3BJUA 4PZ8A 4DR5L 1WYDA 1YVCA 4GN4B 3GD7A 1PYBA 4AYBE 3CF5A 4JI1L 4JI2L 3HOZH 1AE3A 4YHHQ 3S1RH 2QGQA 3HFZB 4JV5L 2UXBL 1N36Q 2AWOA 2YYZA 1V1QA 1LYLA 4MZ9A 3PUYA 1WFQA 1YJNA 1PV4A 4DV2Q 1HZ9A 3NENA 4DR4L 1I50H 4QQBX 1Y1WG 4LF7L 3PO2G 1O7IA 4LF5Q 1X54A 1VQ6A 3CMAA 3HOZG 2ES2A 1SE8A 1EWIA 2BA1A 4HIKA 1EQQA 1E3PA 4IO9A 3UE1A 3PO3H 2K4KA 3EN2A 2UXDL 4DV4Q 1C0AA 4LNQA 1Z9FA 4L5QA 2Q2TA 3CCLA 4GKKQ 1YIJA 2OTJA 1AE2A 1MJCA 2VY3A 2IX0A 4LF6Q 2GVBA 3T1YQ 3TS2A 2D0PA 4FDBA 4LFAQ 3OTOL 3G4SA 2YTYA 4C3JH 1VQAA 1S40A 4X64Q 3CC2A 5FLMH 2JQOA 5M5WH 1V9PA 4YWKA 1N34Q 5LMNQ 3PO3G 1PH3A 4Y52H 4P75A 5HY6A 2BA0A 3K8AA 4QIWE 2UUBL 2F52A 2IX1A 2N78A 3T1HL 1VQ4A 1PH5A 4POGA 1N9WA 1OXXK 3BU2A 1CKOA 4IPCA 1QZGA 1L1OB 3E9HA 2E5LQ 1ASYA 4JI0L 2K5VA 4RG1A 1R9TH 4JBMA 5FLMG 4JI5L 1VQFA 2K5NA 1Q1EA 4QY7A 4EX5A 4YWLA 2LSSA 2VQFQ 1XNQL 1GD7A 2NVQH 4UP7A 4OONA 2VQEL 1W2BA 1Q8KA 3JAMi 1GO3E 1B70B 4C3IH 2ZM6L 1VQJA 3A74A 2NVTH 1VQPA 3EIVA 1K9MC 4UP8A 3RZOH 4X65L 3HKSA 4KLKA 5DLQE 1VQNA 1Q82C 4B3TL 4NPSA 1X55A 1J5EQ 1X56A 2VW9A 3PIOA 4L5SA 4BBRH 1S72A 3K7UC 1KD1C 4BY7H 4ALPA 1NMFA 4JI7Q 1HZBA 4A3FH 3U50C 4OWTB 3J81c 2K5HA 4Y7NH 3D31A 4IJHA 4IOAA 2NZOA 3KF6A 4DKAC 3PIPA 2E2JH 1IBKQ 1WI5A 2B29A 2JA8H 2JJQA 3M7NA 1Q81C 1PH9A 2UU9L 2Q2IA 3A0JA 1TWHH 4HJ9A 5C0XG 3W1GA 4BBRG 1KHIA 4GKJL 3HKZG 4OX9Q 2CQOA 2ID0A 3IRBA 5IE8A 3CCJA 4P71A 4DR3L 4PZ7A 1CSPA 2YTVA 5EAYA 1TWGH 3KJPA 1SLJA 4AQYL 1X65A 4A3KH 4LF9L 3I55A 5C3EG 1EYGA 3PSIA 2E2IH 1N33Q 1D7QA 3U4ZA 2VNUD 2HIVA 2JA8G 4JCVE 4A3DH 3M9BA 4A3LH 3HOYH 1XJVA 1G6PA 1XPUA 2K14A 3DLLA 1KQSA 3MXNB 3TRZA 1CSQA 1HH2P 3ER0A 4LFCL 4GLVB 4L5RC 1FJGL 4B3RQ 4DUZL 5LMNW 3F8TA 3KDFA 2UUCL 1U5KA 3S24A 1YZ6A 4DR1L 4A3KG 1VS0A 2BH2A 4DR6L 4LF8Q 2WB1G 3CW2C 2NZHA 4A3DG 2VL6A 3CCRA 1SR3A 4JI6Q 1K83H 1SRUA 1VQIA 5C4JH 5M3FH 1XMOL 1Q7YC 3HOUH 4OXPA 3HOYG 4DV1Q 1XPRA 3GDEA 1GKHA 2A19A 4DV5Q 3ULLA 1HNXL 1IBML 1CKMA 4OWXB 1OXUA 1VQ5A 1KRSA 3B6YA 2IHEA 1QVFA 1D8LA 4LFBQ 1FVIA 4R4OA 3ULJA 2JA7H 1C9OA 5GAEC 3GTLH 2NN6G 4DV3L 4X62L 1HNZQ 3RLOA 3GTJH 2R7ZG 3HOUG 5M3FG 3KF6B 2OTLA 4DV7L 4A3FG 4X6AH 2KCMA 3CCEA 1PHJA 5GADC 4K0KL 2F4VL 4NXNQ 1PH4A 3S1NH 1BVSA 1YJWA 4B3SL 2JA7G 1XTDA 4LUVA 3CPWA 2KHJA 4A3JH 1VQ9A 2DUDA 5ELNA 5JJIA 1V43A 4JI2Q 2R7FA 3L2PA 3I4OA 2I0QA 3S1MH 4DUYQ 4DNIA 1TWFH 2EXDA 2RF4A 2R92H 3UE0A 3AYHB 2CWPA 4YY3Q 1VQEA 1PH7A 4GNXC 4DV0L 4XIGS 5LMUQ 4GN3B 1PA6A 1B8AA 2JE6I 1K73C 4A3GH 1HZAA 1DGSA 3KDFB 4DR4Q 4WJ3M 3F2DA 4A3JG 4IPHA 5BR8L 3J80i 1N36L 2PI2E 1VQBA 4P73A 1A8VA 4X66Q 2R92G 1P16A 4AYBG 4DV2L 1XMQL 1VQ7A 2UXDQ 1JJGA 1YBYA 4O2DA 2IT1A 3JC66 3RN2A 5C0XJ 2B63H 1L0WA 3ICEA 3TEHB 1KXLA 1IBLL 1IXRA 2UUAQ 4A3GG 2A8VA 2OQ0A 4UP9A 2RCNA 5E7NA 3RLFA 2OQKA 3NEMA 3UDFA 3UDIA 3GO5A 5C4XH 2K52A 4R4TA 3I2ZA 1Y14B 2WAQE 4DV4L 2WFWA 2CCZA 3GTOH 4GKKL 3CXCA 3A5UA 2YV5A 5IYBH 1BBUA 2NVXH 3KF8B 4JI8Q 4LF6L 1Q1BA 3CC7A 3T1YL 1I5FA 5M5XH 2UUBQ 4JI4Q 4LFAL 5H1SE 2B63G 4X64L 1Z47A 4R4CA 4DV6Q 3T1HQ 4A3EH 3S15H 2PMZE 2XTIA 1NTGA 4JI0Q 4QGUA 1I6HH 2AHOB 1CUKA 1FGUA 1WCMH 3CCVA 3TREA 3U58A 1N34L 5IP9H 4A75A 4BY7G 2LXKA 5C4XG 2HQLA 4JBJA 4J15A 3PUXA 4JYAQ 1VQKA 3DM3A 1TXYA 5IYBG 4GN5A 3KLWA 1N8RC 3HOVH 2OWOA 3HOWH 2C35B 1L1OC 2E5LL 1PVOA 4QL5A 3S1QH 1MIUA 2Y0SG 4PMWA 1EOVA 5IWAQ 1N32Q 4GOPC 3PV0A 2ZM6Q 4A3EG 3W5OA 1K8AC 2PQAA 4BA1I 3F2BA 2VQFL 2UXCQ 3EBEA 3UDGA 1VQMA 1UE6A 1WCMG 4KHPL 5IP9G 2K75A 4B3TQ 1OXSC 1I94Q 4XTCS 1BKBA 3W1BA 4L5TA 3I56A 2H5XA 4DK6C 1M1KC 1J6QA 3RZDH 3HOVG 5C3EH 4LF4L 2YTXA 1YNXA 3E9IA 4IJLA 4P74A 4YCWA 2ATWA 3J7ZC 1KIXA 3HOWG 1U0LA 2Z6KC 1UWVA 4O0AA 3PF4A 1EQRA 3PGZA 4DR7L 3BZCA 4A93H 1Y1VH 1UEBA 2RHQB 1PFSA 3UDXA 3OW2A 3AEVA 4JG2A 3KFUA 1A62A 4H02A 3I4MH 1E7ZA 5JJKA 4TQUS 4BY1H 3S16H 4A76A 1KAWA 2EQSA 3NELA 3CMEA 3S2HH 4GKJQ 2ASBA 2QA4A 4DR3Q 1EIFA 1HR0Q 1NJIC 1EUJA 1XNRQ 1Y1VG 4A93G 3K0XA 2JK8A 5C44H 3ULPA 3LGJA 2R6GA 3E0EA 3I4MG 2GN5A 4OX9L 2KCTA 4BY1G 4EQ5A 3M3YH 2R93H 1NE3A 4A3BH 4GNXA 4NXMQ 1Q46A 4IOCA 3AFPA 4JOIC 4POFA 4P72A 5M3MH 1FJGQ 4AIMA 1N33L 3WWVA 2R7ZH 5AJ3Q 1L2FA 4C3HH 3GTKH 1HNWL 1VQGA 3CCUA 3CD6A 1A63A 1G291 2JA9A 2RHSB 5C44G 1KRTA 2WP8J 3M4PA 2KBNA 1YHQA 2PQAB 5GQOA 1XMOQ 4IFDI 3H15A 4B3RL 2R93G 1K0RA 2HHHQ 5GAGC 2MO0A 4DR2Q 3S17H 4A3BG 1IBMQ 4KHZA 2FXQA 5M3MG 2MNAA 1VQOA 4LF8L 3GTQH 1UE1A 3PUWA 2E2HH 3J80c 3G71A 4BXXG 4JI6L 4YWMA 4KI0A 3CC4A 3K80C 1TWAH 1XPOA 1S3OA 4LWCA 3J81i 1EFWA 4X62Q 3I7FA 3NBHB 3S14H 4PZ6A 1CKNA 3KOJA 4YCVA 4DV5L 1LUZA 1E1OA 4AH6A 1Q86C 4JI3Q 3H3VI 1GVPA 4OO1I 1TWCH 1QVGA 3HOXH 4GLXA 3KYHC 4A3IH 2I5HA 4A4IA 1X3EA 3FKIH 2ZJQA 1YI2A 4B3MQ 1YHAA 1HNZL 4BA2I 4WJ4A 1HJPA 1JMCA 3PF5A 1LM0A 4DR5Q 1JJ2A 2Q2UA 4JI1Q 3PUZA 1GM5A 5IYDH 3Q8DA 2L15A 2CKZB 3RN5A 1VQLA 3S2DH 1PH8A 2UXBQ 2IHFA 2JEAI 3I4NH 4JV5Q 1ASZA 1LTLA 4NXNL 4DAYB 3HOXG 1VCIA 4A3IG 4GOPA 3FKIG 1NBWA 1QUQA 2AKWB 1MJEA 1HZCA 4LF7Q 3CAMA 5ELOA 1E22A 1NY4A 2I5LX 2KENA 4R1JA 2XGTA 3JAMc 4YHHL 4IPDA 5K36G 1WJJA 1UE7A 1HR0W 1H95A 5IY0A 4HIOA 5IYDG 1JE5A 1RL2A 4DUYL 3VDYA 4QJFA 1OTCA 5BR8Q 3I4NG 3BZKA 3H0GH 3OYYA 4YY3L 2Z6KA 2KHIA 5FJ8H 4LF5L 5LMUL 3M4OH 1XMQQ 3M85A 4HJ8A 3OTOQ 5IP7H 3CCMA 1IZ6A 2LXJA 4ME3A 3A5ZB 4DPGA 1IBLQ 3L0OA 4A3CH 3F1ZA 4X66L 1EIYB 4A3MH 1X6OA 1QZHA 2MFIA 3H0GG 1CKNB 5FJ8G 1G51A 3D0FA 2UUAL 1PH2A 1IL2A 5LMNL 1IYJB 2EIFA 1M90C 5IP7G 4UPAA 4JI5Q 3PUVA 4RMFA 3M4QA 4NB3A 2ZTDA 1VQ8A 2YU9H 1XNQQ 2I5MX 4A3CG 4BBSH 2NVYH 3L7ZC 2VQEQ 2Y0SE 2V1CC 2N8NA 2HIXA 4A3MG 4JOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M5Y H;  4JI4 L;  3CPF A;  2N3S A;  4DK3 C;  2ALY B;  2JA5 H;  2MO1 A;  4DV6 L;  1VQH A;  2JA6 H;  2WAQ G;  4MNO A;  1SRO A;  4JI8 L;  4X65 Q;  1E24 A;  2BH8 A;  3STB D;  5JEA G;  5GAH C;  1YIT A;  2B3G A;  4GOP B;  1X9N A;  1PH1 A;  3RNU A;  4JBK A;  1QUQ B;  1I3Q H;  4IFD J;  4UY8 C;  4JYA L;  2D62 A;  4BBS G;  4KHP Q;  2DGY A;  1K3R A;  4HJA A;  4HJ5 A;  3K81 C;  3RLN A;  3FP9 A;  1C7Y A;  2PI2 A;  4DAM A;  1FL0 A;  1X3G A;  5IWA L;  2JA5 G;  3GTM H;  3CCQ A;  1N32 L;  4YCU A;  4HJ7 A;  4LF4 Q;  2JA6 G;  3HKZ E;  2UXC L;  1J5E L;  4R4I A;  3MEF A;  2K50 A;  4PG3 A;  4DR7 Q;  4GS3 A;  2OCE A;  2ZTE A;  2UU9 Q;  3SGI A;  1I94 L;  4JI7 L;  4GLA C;  1T9H A;  2GVA A;  5GRO A;  2CWA A;  1X3F A;  2AMC B;  4MTN A;  3J81 j;  4IPG A;  2IY5 B;  5HGQ A;  4LUZ A;  3CP0 A;  5IT9 c;  1SFO H;  1IBK L;  5FLX c;  4LF9 Q;  1PH6 A;  3GTP H;  1YHB A;  3J7A 5;  4AQY Q;  4TVA B;  3PCO B;  1KL9 A;  3RR5 A;  5C0X I;  1PYS B;  5IYC H;  2HT1 A;  4APV A;  2WB1 E;  1K8G A;  1QVC A;  1P8L A;  4LFC Q;  2Q2H A;  2VUM H;  1OXV A;  4DUZ Q;  2UUC Q;  4BXX H;  1HR0 L;  1UE5 A;  4JBW A;  1RIP A;  4DR1 Q;  3TS0 A;  1XNR L;  4DR6 Q;  4JC0 A;  4R4Q A;  1YJ9 A;  1NMG A;  5IYC G;  1HNW Q;  2VS1 A;  3U4V A;  4OWW B;  1AH9 A;  3CCS A;  2PNH A;  3GTG H;  4NXM L;  5JJL A;  1WOC A;  1HNX Q;  1JB7 A;  2VUM G;  1E1T A;  4LUO A;  2AWN A;  2ZJP A;  3H3V H;  4IFD G;  3AQQ A;  2R7D A;  1BBW A;  5AJ3 L;  2ZJR A;  3TQY A;  4DV1 L;  2JEB I;  2MQH A;  2QEX A;  2F3I A;  3G6E A;  4DV3 Q;  1OXT A;  3G48 A;  4A3L G;  2E8G A;  1SN8 A;  2HHH L;  4DV7 Q;  4LFB L;  4DR2 L;  3ZJY C;  3ERS X;  2VZA A;  4C2M H;  4HIM A;  4LW1 A;  1B7Y B;  2NN6 I;  4HID A;  4OO1 G;  2CFM A;  4K0K Q;  2F4V Q;  4B3S Q;  1SMX A;  2D0O A;  2A1A A;  3AFQ A;  3K7A H;  3KJO A;  1W3S A;  1KC8 C;  1VQC A;  3F2C A;  2ZTC A;  4JI3 L;  3STB C;  3FHW A;  1A0I A;  1L1O A;  5J3B A;  1Q12 A;  1YEZ A;  1MKH A;  5JEA J;  1JJC B;  2N49 A;  3CQZ H;  4B3M L;  1Y1W H;  1JT8 A;  2Z0S A;  3PO2 H;  4GNX B;  1VQD A;  4DV0 Q;  3BJU A;  4PZ8 A;  4DR5 L;  1WYD A;  1YVC A;  4GN4 B;  3GD7 A;  1PYB A;  4AYB E;  3CF5 A;  4JI1 L;  4JI2 L;  3HOZ H;  1AE3 A;  4YHH Q;  3S1R H;  2QGQ A;  3HFZ B;  4JV5 L;  2UXB L;  1N36 Q;  2AWO A;  2YYZ A;  1V1Q A;  1LYL A;  4MZ9 A;  3PUY A;  1WFQ A;  1YJN A;  1PV4 A;  4DV2 Q;  1HZ9 A;  3NEN A;  4DR4 L;  1I50 H;  4QQB X;  1Y1W G;  4LF7 L;  3PO2 G;  1O7I A;  4LF5 Q;  1X54 A;  1VQ6 A;  3CMA A;  3HOZ G;  2ES2 A;  1SE8 A;  1EWI A;  2BA1 A;  4HIK A;  1EQQ A;  1E3P A;  4IO9 A;  3UE1 A;  3PO3 H;  2K4K A;  3EN2 A;  2UXD L;  4DV4 Q;  1C0A A;  4LNQ A;  1Z9F A;  4L5Q A;  2Q2T A;  3CCL A;  4GKK Q;  1YIJ A;  2OTJ A;  1AE2 A;  1MJC A;  2VY3 A;  2IX0 A;  4LF6 Q;  2GVB A;  3T1Y Q;  3TS2 A;  2D0P A;  4FDB A;  4LFA Q;  3OTO L;  3G4S A;  2YTY A;  4C3J H;  1VQA A;  1S40 A;  4X64 Q;  3CC2 A;  5FLM H;  2JQO A;  5M5W H;  1V9P A;  4YWK A;  1N34 Q;  5LMN Q;  3PO3 G;  1PH3 A;  4Y52 H;  4P75 A;  5HY6 A;  2BA0 A;  3K8A A;  4QIW E;  2UUB L;  2F52 A;  2IX1 A;  2N78 A;  3T1H L;  1VQ4 A;  1PH5 A;  4POG A;  1N9W A;  1OXX K;  3BU2 A;  1CKO A;  4IPC A;  1QZG A;  1L1O B;  3E9H A;  2E5L Q;  1ASY A;  4JI0 L;  2K5V A;  4RG1 A;  1R9T H;  4JBM A;  5FLM G;  4JI5 L;  1VQF A;  2K5N A;  1Q1E A;  4QY7 A;  4EX5 A;  4YWL A;  2LSS A;  2VQF Q;  1XNQ L;  1GD7 A;  2NVQ H;  4UP7 A;  4OON A;  2VQE L;  1W2B A;  1Q8K A;  3JAM i;  1GO3 E;  1B70 B;  4C3I H;  2ZM6 L;  1VQJ A;  3A74 A;  2NVT H;  1VQP A;  3EIV A;  1K9M C;  4UP8 A;  3RZO H;  4X65 L;  3HKS A;  4KLK A;  5DLQ E;  1VQN A;  1Q82 C;  4B3T L;  4NPS A;  1X55 A;  1J5E Q;  1X56 A;  2VW9 A;  3PIO A;  4L5S A;  4BBR H;  1S72 A;  3K7U C;  1KD1 C;  4BY7 H;  4ALP A;  1NMF A;  4JI7 Q;  1HZB A;  4A3F H;  3U50 C;  4OWT B;  3J81 c;  2K5H A;  4Y7N H;  3D31 A;  4IJH A;  4IOA A;  2NZO A;  3KF6 A;  4DKA C;  3PIP A;  2E2J H;  1IBK Q;  1WI5 A;  2B29 A;  2JA8 H;  2JJQ A;  3M7N A;  1Q81 C;  1PH9 A;  2UU9 L;  2Q2I A;  3A0J A;  1TWH H;  4HJ9 A;  5C0X G;  3W1G A;  4BBR G;  1KHI A;  4GKJ L;  3HKZ G;  4OX9 Q;  2CQO A;  2ID0 A;  3IRB A;  5IE8 A;  3CCJ A;  4P71 A;  4DR3 L;  4PZ7 A;  1CSP A;  2YTV A;  5EAY A;  1TWG H;  3KJP A;  1SLJ A;  4AQY L;  1X65 A;  4A3K H;  4LF9 L;  3I55 A;  5C3E G;  1EYG A;  3PSI A;  2E2I H;  1N33 Q;  1D7Q A;  3U4Z A;  2VNU D;  2HIV A;  2JA8 G;  4JCV E;  4A3D H;  3M9B A;  4A3L H;  3HOY H;  1XJV A;  1G6P A;  1XPU A;  2K14 A;  3DLL A;  1KQS A;  3MXN B;  3TRZ A;  1CSQ A;  1HH2 P;  3ER0 A;  4LFC L;  4GLV B;  4L5R C;  1FJG L;  4B3R Q;  4DUZ L;  5LMN W;  3F8T A;  3KDF A;  2UUC L;  1U5K A;  3S24 A;  1YZ6 A;  4DR1 L;  4A3K G;  1VS0 A;  2BH2 A;  4DR6 L;  4LF8 Q;  2WB1 G;  3CW2 C;  2NZH A;  4A3D G;  2VL6 A;  3CCR A;  1SR3 A;  4JI6 Q;  1K83 H;  1SRU A;  1VQI A;  5C4J H;  5M3F H;  1XMO L;  1Q7Y C;  3HOU H;  4OXP A;  3HOY G;  4DV1 Q;  1XPR A;  3GDE A;  1GKH A;  2A19 A;  4DV5 Q;  3ULL A;  1HNX L;  1IBM L;  1CKM A;  4OWX B;  1OXU A;  1VQ5 A;  1KRS A;  3B6Y A;  2IHE A;  1QVF A;  1D8L A;  4LFB Q;  1FVI A;  4R4O A;  3ULJ A;  2JA7 H;  1C9O A;  5GAE C;  3GTL H;  2NN6 G;  4DV3 L;  4X62 L;  1HNZ Q;  3RLO A;  3GTJ H;  2R7Z G;  3HOU G;  5M3F G;  3KF6 B;  2OTL A;  4DV7 L;  4A3F G;  4X6A H;  2KCM A;  3CCE A;  1PHJ A;  5GAD C;  4K0K L;  2F4V L;  4NXN Q;  1PH4 A;  3S1N H;  1BVS A;  1YJW A;  4B3S L;  2JA7 G;  1XTD A;  4LUV A;  3CPW A;  2KHJ A;  4A3J H;  1VQ9 A;  2DUD A;  5ELN A;  5JJI A;  1V43 A;  4JI2 Q;  2R7F A;  3L2P A;  3I4O A;  2I0Q A;  3S1M H;  4DUY Q;  4DNI A;  1TWF H;  2EXD A;  2RF4 A;  2R92 H;  3UE0 A;  3AYH B;  2CWP A;  4YY3 Q;  1VQE A;  1PH7 A;  4GNX C;  4DV0 L;  4XIG S;  5LMU Q;  4GN3 B;  1PA6 A;  1B8A A;  2JE6 I;  1K73 C;  4A3G H;  1HZA A;  1DGS A;  3KDF B;  4DR4 Q;  4WJ3 M;  3F2D A;  4A3J G;  4IPH A;  5BR8 L;  3J80 i;  1N36 L;  2PI2 E;  1VQB A;  4P73 A;  1A8V A;  4X66 Q;  2R92 G;  1P16 A;  4AYB G;  4DV2 L;  1XMQ L;  1VQ7 A;  2UXD Q;  1JJG A;  1YBY A;  4O2D A;  2IT1 A;  3JC6 6;  3RN2 A;  5C0X J;  2B63 H;  1L0W A;  3ICE A;  3TEH B;  1KXL A;  1IBL L;  1IXR A;  2UUA Q;  4A3G G;  2A8V A;  2OQ0 A;  4UP9 A;  2RCN A;  5E7N A;  3RLF A;  2OQK A;  3NEM A;  3UDF A;  3UDI A;  3GO5 A;  5C4X H;  2K52 A;  4R4T A;  3I2Z A;  1Y14 B;  2WAQ E;  4DV4 L;  2WFW A;  2CCZ A;  3GTO H;  4GKK L;  3CXC A;  3A5U A;  2YV5 A;  5IYB H;  1BBU A;  2NVX H;  3KF8 B;  4JI8 Q;  4LF6 L;  1Q1B A;  3CC7 A;  3T1Y L;  1I5F A;  5M5X H;  2UUB Q;  4JI4 Q;  4LFA L;  5H1S E;  2B63 G;  4X64 L;  1Z47 A;  4R4C A;  4DV6 Q;  3T1H Q;  4A3E H;  3S15 H;  2PMZ E;  2XTI A;  1NTG A;  4JI0 Q;  4QGU A;  1I6H H;  2AHO B;  1CUK A;  1FGU A;  1WCM H;  3CCV A;  3TRE A;  3U58 A;  1N34 L;  5IP9 H;  4A75 A;  4BY7 G;  2LXK A;  5C4X G;  2HQL A;  4JBJ A;  4J15 A;  3PUX A;  4JYA Q;  1VQK A;  3DM3 A;  1TXY A;  5IYB G;  4GN5 A;  3KLW A;  1N8R C;  3HOV H;  2OWO A;  3HOW H;  2C35 B;  1L1O C;  2E5L L;  1PVO A;  4QL5 A;  3S1Q H;  1MIU A;  2Y0S G;  4PMW A;  1EOV A;  5IWA Q;  1N32 Q;  4GOP C;  3PV0 A;  2ZM6 Q;  4A3E G;  3W5O A;  1K8A C;  2PQA A;  4BA1 I;  3F2B A;  2VQF L;  2UXC Q;  3EBE A;  3UDG A;  1VQM A;  1UE6 A;  1WCM G;  4KHP L;  5IP9 G;  2K75 A;  4B3T Q;  1OXS C;  1I94 Q;  4XTC S;  1BKB A;  3W1B A;  4L5T A;  3I56 A;  2H5X A;  4DK6 C;  1M1K C;  1J6Q A;  3RZD H;  3HOV G;  5C3E H;  4LF4 L;  2YTX A;  1YNX A;  3E9I A;  4IJL A;  4P74 A;  4YCW A;  2ATW A;  3J7Z C;  1KIX A;  3HOW G;  1U0L A;  2Z6K C;  1UWV A;  4O0A A;  3PF4 A;  1EQR A;  3PGZ A;  4DR7 L;  3BZC A;  4A93 H;  1Y1V H;  1UEB A;  2RHQ B;  1PFS A;  3UDX A;  3OW2 A;  3AEV A;  4JG2 A;  3KFU A;  1A62 A;  4H02 A;  3I4M H;  1E7Z A;  5JJK A;  4TQU S;  4BY1 H;  3S16 H;  4A76 A;  1KAW A;  2EQS A;  3NEL A;  3CME A;  3S2H H;  4GKJ Q;  2ASB A;  2QA4 A;  4DR3 Q;  1EIF A;  1HR0 Q;  1NJI C;  1EUJ A;  1XNR Q;  1Y1V G;  4A93 G;  3K0X A;  2JK8 A;  5C44 H;  3ULP A;  3LGJ A;  2R6G A;  3E0E A;  3I4M G;  2GN5 A;  4OX9 L;  2KCT A;  4BY1 G;  4EQ5 A;  3M3Y H;  2R93 H;  1NE3 A;  4A3B H;  4GNX A;  4NXM Q;  1Q46 A;  4IOC A;  3AFP A;  4JOI C;  4POF A;  4P72 A;  5M3M H;  1FJG Q;  4AIM A;  1N33 L;  3WWV A;  2R7Z H;  5AJ3 Q;  1L2F A;  4C3H H;  3GTK H;  1HNW L;  1VQG A;  3CCU A;  3CD6 A;  1A63 A;  1G29 1;  2JA9 A;  2RHS B;  5C44 G;  1KRT A;  2WP8 J;  3M4P A;  2KBN A;  1YHQ A;  2PQA B;  5GQO A;  1XMO Q;  4IFD I;  3H15 A;  4B3R L;  2R93 G;  1K0R A;  2HHH Q;  5GAG C;  2MO0 A;  4DR2 Q;  3S17 H;  4A3B G;  1IBM Q;  4KHZ A;  2FXQ A;  5M3M G;  2MNA A;  1VQO A;  4LF8 L;  3GTQ H;  1UE1 A;  3PUW A;  2E2H H;  3J80 c;  3G71 A;  4BXX G;  4JI6 L;  4YWM A;  4KI0 A;  3CC4 A;  3K80 C;  1TWA H;  1XPO A;  1S3O A;  4LWC A;  3J81 i;  1EFW A;  4X62 Q;  3I7F A;  3NBH B;  3S14 H;  4PZ6 A;  1CKN A;  3KOJ A;  4YCV A;  4DV5 L;  1LUZ A;  1E1O A;  4AH6 A;  1Q86 C;  4JI3 Q;  3H3V I;  1GVP A;  4OO1 I;  1TWC H;  1QVG A;  3HOX H;  4GLX A;  3KYH C;  4A3I H;  2I5H A;  4A4I A;  1X3E A;  3FKI H;  2ZJQ A;  1YI2 A;  4B3M Q;  1YHA A;  1HNZ L;  4BA2 I;  4WJ4 A;  1HJP A;  1JMC A;  3PF5 A;  1LM0 A;  4DR5 Q;  1JJ2 A;  2Q2U A;  4JI1 Q;  3PUZ A;  1GM5 A;  5IYD H;  3Q8D A;  2L15 A;  2CKZ B;  3RN5 A;  1VQL A;  3S2D H;  1PH8 A;  2UXB Q;  2IHF A;  2JEA I;  3I4N H;  4JV5 Q;  1ASZ A;  1LTL A;  4NXN L;  4DAY B;  3HOX G;  1VCI A;  4A3I G;  4GOP A;  3FKI G;  1NBW A;  1QUQ A;  2AKW B;  1MJE A;  1HZC A;  4LF7 Q;  3CAM A;  5ELO A;  1E22 A;  1NY4 A;  2I5L X;  2KEN A;  4R1J A;  2XGT A;  3JAM c;  4YHH L;  4IPD A;  5K36 G;  1WJJ A;  1UE7 A;  1HR0 W;  1H95 A;  5IY0 A;  4HIO A;  5IYD G;  1JE5 A;  1RL2 A;  4DUY L;  3VDY A;  4QJF A;  1OTC A;  5BR8 Q;  3I4N G;  3BZK A;  3H0G H;  3OYY A;  4YY3 L;  2Z6K A;  2KHI A;  5FJ8 H;  4LF5 L;  5LMU L;  3M4O H;  1XMQ Q;  3M85 A;  4HJ8 A;  3OTO Q;  5IP7 H;  3CCM A;  1IZ6 A;  2LXJ A;  4ME3 A;  3A5Z B;  4DPG A;  1IBL Q;  3L0O A;  4A3C H;  3F1Z A;  4X66 L;  1EIY B;  4A3M H;  1X6O A;  1QZH A;  2MFI A;  3H0G G;  1CKN B;  5FJ8 G;  1G51 A;  3D0F A;  2UUA L;  1PH2 A;  1IL2 A;  5LMN L;  1IYJ B;  2EIF A;  1M90 C;  5IP7 G;  4UPA A;  4JI5 Q;  3PUV A;  4RMF A;  3M4Q A;  4NB3 A;  2ZTD A;  1VQ8 A;  2YU9 H;  1XNQ Q;  2I5M X;  4A3C G;  4BBS H;  2NVY H;  3L7Z C;  2VQE Q;  2Y0S E;  2V1C C;  2N8N A;  2HIX A;  4A3M G;  4JOI A; 
#chains in the Genus database with same CATH topology
 4XQQ A;  5M5Y H;  4A3B B;  1XTC D;  4DK3 C;  5D3D A;  2MO1 A;  1S5F D;  2BDN A;  4MNO A;  1EOT A;  4C3H B;  1E24 A;  3NP8 A;  5GAH C;  2B3G A;  3FPP A;  1JOO A;  4GOP B;  2WIN B;  4KHP Q;  1K3R A;  4HJA A;  4HJ5 A;  1WD0 A;  3K81 C;  1C7Y A;  1U4R A;  2Q8R E;  1X3G A;  2PZW A;  4NKL A;  3CCQ A;  4HJ7 A;  2JA6 G;  2UXC L;  1EYD A;  4BS9 A;  1G91 A;  4DR7 Q;  1IKM A;  4L6T B;  1QCB D;  3SGI A;  1T9H A;  2GVA A;  2CWA A;  3NHH A;  1X32 A;  1H9S A;  4MTN A;  1O80 A;  2IY5 B;  5IT9 c;  5FLX c;  1HFG A;  5I4D A;  1YHB A;  3MXU A;  1FR3 A;  3MXG A;  1O7Z A;  1FGB D;  2EPB A;  5EJW A;  3RR5 A;  3TP5 A;  3PIO 3;  1PYS B;  5IYC H;  2PPB C;  2HT1 A;  4APV A;  2WB1 E;  2AQ2 B;  4ZK9 B;  1QVC A;  2L0C A;  3S2D B;  1LTT D;  1II3 A;  4LFC Q;  3PIP 3;  2N88 A;  3TS0 A;  4DR6 Q;  5CMD A;  2LFN A;  2A6H C;  1KLG D;  3A56 A;  1HNW Q;  3CCS A;  2PNH A;  1L0X B;  2VUM G;  3FPU B;  1GXD C;  5KEE A;  4IFD G;  4NP5 A;  5CV9 A;  5FLX L;  3TQY A;  2JEB I;  2F3I A;  5I6Y A;  2OEO A;  1HA5 A;  2EY1 A;  5JVG 3;  1NR2 A;  1SN8 A;  2HHH L;  1CZW A;  2L4N A;  1GOZ A;  4C2M H;  2IX3 A;  4LW1 A;  1ESF A;  2NN6 I;  4A3M B;  4OO1 G;  1WTP A;  4K0K Q;  1H9S B;  4B3S Q;  2AQ1 B;  2WAQ B;  2M2L A;  4K2L A;  4KD4 A;  1LTG D;  2E75 C;  4RFB A;  3KJO A;  1W3S A;  2BE5 C;  2K33 A;  4Q5V A;  2EJF C;  1PTO B;  2O2L D;  2PW5 A;  5M5Y B;  2Z0S A;  4GNX B;  4PZ8 A;  3BYY B;  1WYD A;  1XX8 A;  4ZUJ A;  4FF3 A;  2QEJ C;  1AE3 A;  3E5S A;  2AUK A;  2PW7 A;  3IL8 A;  4JV5 L;  4MZ9 A;  3PUY A;  1WFQ A;  3QB3 A;  3K57 A;  1XXG A;  4DR4 L;  5IGF A;  1I4X A;  3PO2 G;  4LF5 Q;  1X54 A;  3CMA A;  1D5M C;  1VDZ A;  3HOZ G;  3PO3 H;  5JVH 3;  2K4K A;  3R2I A;  5KIX A;  4L5Q A;  3CCL A;  2OTJ A;  1AE2 A;  2M00 A;  4LF6 Q;  3TS2 A;  2XWJ B;  3TP8 A;  1S40 A;  4X64 Q;  3CC2 A;  2G9H D;  1V9P A;  4YWK A;  5LMN Q;  1B44 D;  3CRL C;  1HUN A;  4P75 A;  2F52 A;  2FMC A;  2SNM A;  1QE6 A;  4L8J A;  3D3R A;  1VQ4 A;  2IX1 A;  3OWE B;  1N9W A;  3BU2 A;  4WRD A;  4X3K A;  4JW0 A;  4JBM A;  1F2Y A;  1Q1E A;  4YWL A;  2LSS A;  4OON A;  1E2Z A;  3LNN A;  2XWB B;  1STH A;  2JN4 A;  3A74 A;  5C6A A;  5A2Q L;  3J7A V;  2B2W A;  1X56 A;  2F0W A;  4PNY A;  1S72 A;  1VMC A;  1KD1 C;  2VB3 X;  5FO7 B;  3U50 C;  4DK0 A;  3J81 c;  3D31 A;  1ML0 D;  3KF6 A;  3ERO A;  4IUU A;  2B29 A;  2JJQ A;  3M7N A;  1HPC A;  5KYI A;  2UU9 L;  3A0J A;  1I4P A;  4X3T A;  1AW7 A;  3W1G A;  2CQO A;  5IOD A;  4A3F G;  3CCJ A;  1YIJ A;  3KJP A;  5EAY A;  1TWG H;  3BDL A;  3I55 A;  1EYG A;  1D7Q A;  4N9P A;  2O5I C;  2JA8 G;  3FEW X;  1BR9 A;  1XJV A;  3NBI A;  1HCZ A;  1NAP A;  2RDG A;  3MEH A;  2F03 A;  1HH2 P;  3TRZ A;  4L5R C;  1HUM A;  4GLV B;  3I70 A;  1FJG L;  4B3R Q;  3F8T A;  2UUC L;  1U5K A;  4MN3 A;  3S24 A;  2L1B A;  1F9Q A;  1VS0 A;  1K83 H;  1SRU A;  1VQI A;  3SVM A;  1XMO L;  3HOU H;  1XPR A;  1SYG A;  1GKH A;  3C3L A;  3PO3 B;  2A19 A;  1BCP F;  1CKM A;  4HR7 B;  1TS5 A;  4OWX B;  1TU2 B;  1KRS A;  3OWF A;  1VQ5 A;  1QVF A;  2B2U C;  5C5L A;  3ULJ A;  3UI2 A;  5CBA E;  5GAE C;  1HNZ Q;  4LMQ D;  5M3F G;  3KF6 B;  4R8N A;  2QDB A;  1PHJ A;  1EY5 A;  2F4V L;  4NXN Q;  2EE1 A;  4HAE A;  1HXY D;  1YJW A;  2JA7 G;  3CPW A;  3OW7 A;  2DUD A;  2I07 B;  2N55 A;  1V43 A;  1BXT A;  3I4O A;  3L2P A;  2I0Q A;  3QG1 A;  1TKW B;  3HOV B;  4GN3 B;  1B8A A;  4A3G H;  2B2V C;  2WAC A;  4DR4 Q;  1NNX A;  3J80 i;  4P73 A;  1LAB A;  3HKZ B;  1VQ7 A;  4DV2 L;  3U9S A;  5IT9 E;  5EBC A;  3U9O A;  3TEH B;  1IXR A;  4QB4 A;  4UP9 A;  2DY8 A;  5E7N A;  4R4T A;  3I2Z A;  1Y14 B;  1PXU A;  2WFW A;  4EQO A;  2YV5 A;  3K6O A;  5IYB H;  2A6E C;  5ELC A;  3T1Y L;  4LFA L;  5M5X H;  2B63 G;  5H1S E;  1Z47 A;  3X3N A;  4HCE A;  4QGU A;  2AHO B;  4RGO S;  4KV6 A;  1N34 L;  3TRE A;  5IP9 H;  1LT4 D;  4DXG A;  3NTK A;  4BY7 G;  3JAM L;  1PTO F;  3QJY A;  5C4X G;  1WTO A;  4JYA Q;  1VQK A;  1HTL D;  1X3P A;  1G6Z A;  3HOW H;  1L1O C;  1Y8P B;  3J80 E;  1MIU A;  2Y0S G;  4PMW A;  2PQA A;  2F0S A;  4ZCK A;  5J1Z A;  2VQF L;  1WCM G;  3N52 A;  4QF4 A;  3HOU B;  1TS4 A;  1Z6H A;  2K75 A;  2DNE A;  3I56 A;  4L5T A;  4FXK C;  1M1K C;  1LT6 D;  3D4W A;  4QUF A;  3RZD H;  4LF4 L;  3NTH A;  1YNX A;  4OGQ C;  1UWV A;  4H7B A;  1S5C D;  1EQR A;  1LT5 D;  1DD2 A;  3OW2 A;  1BF4 A;  1A62 A;  1DOL A;  3NQI A;  1ZXT A;  3BVZ A;  4PMB A;  2F0M A;  3OIQ A;  4V19 0;  4K5W A;  4KY6 A;  1RTN A;  3Q23 A;  3CME A;  1IYV A;  1JWM D;  1HR0 Q;  3FKI B;  1XNR Q;  2OXP A;  2QDL A;  2QIL A;  1FNV A;  3I4M G;  2A68 D;  2GN5 A;  2VB2 X;  4OX9 L;  3M3Y H;  2BOS A;  4ZRZ A;  3VA7 A;  4NXM Q;  4AYB B;  1FJG Q;  1EY9 A;  4AIM A;  1N33 L;  1SBB B;  5AJ3 Q;  4K5X A;  3CD6 A;  2L55 A;  4A3G B;  1F9R A;  2KBN A;  2ZT9 C;  2PQA B;  4CKC A;  1XMO Q;  4TKO B;  3VR6 A;  4IFD I;  1K0R A;  2MO0 A;  4MIU A;  4DR2 Q;  3S17 H;  4A3B G;  2KEC A;  1SYD A;  2CVR A;  2FXQ A;  4LF8 L;  1VQO A;  3GTQ H;  1UE1 A;  3G71 A;  4C3H G;  4JI6 L;  5HGT A;  3NPP A;  3M4O B;  4LWC A;  3J81 i;  4RKB A;  3S14 H;  4PZ6 A;  1CKN A;  2K05 A;  4YCV A;  1U4P A;  4FO2 A;  3OSO A;  2EJG C;  4OO1 I;  3HOX H;  4GLX A;  2KHS A;  1JC7 A;  2I5H A;  4A4I A;  2JSO A;  1YI2 A;  5M5X B;  1HJP A;  2NWG A;  1PMR A;  4QIW B;  2EYL A;  2PQE A;  3FMC A;  1SYC A;  3I4L A;  4JI1 Q;  1GM5 A;  3RN5 A;  2L15 A;  1EEF D;  1ICW A;  1KAA A;  1PRT B;  1ASZ A;  1LTL A;  1EIH A;  3HOW B;  4DU9 A;  3BDO A;  2E74 C;  4TRD A;  2KA7 A;  4FVM A;  4IPD A;  1WJJ A;  3IAY A;  5IY0 A;  5IYD G;  4KK7 A;  1JE5 A;  1RL2 A;  3VDY A;  4QJF A;  3BZK A;  3R3O A;  1MGS A;  3OYY A;  4J6H A;  3J81 E;  3ND8 A;  3KBG A;  4DNR B;  3RZD B;  2A6H D;  2L9H A;  1PYW D;  3CCM A;  1CHP D;  4OEM B;  3T51 B;  2KEE A;  3L0O A;  2DJG C;  4A3C H;  3NUC A;  3T4A C;  3F1Z A;  1HQR D;  1B53 A;  3MA2 B;  2HDL A;  1CKN B;  5FJ8 G;  3SXH A;  3D0F A;  5JEA H;  1WTV A;  1ESR A;  4IQZ A;  2ZTD A;  1B9N A;  2Y0S E;  1YNN C;  5C3W A;  2AQ3 B;  4JI8 L;  5JJL A;  4A3M G;  5JOB A;  1SDF A;  5CV7 A;  4JI4 L;  3CPF A;  2JA5 H;  4DV6 L;  1VQH A;  2WAQ G;  1SRO A;  4X65 Q;  2BE5 D;  2BH8 A;  3D6C A;  2PCF B;  5ELF A;  1XYI A;  1CI3 M;  5JJZ A;  3FP9 A;  2PI2 A;  4DAM A;  3S17 B;  3GTM H;  4RGN A;  4LF4 Q;  4K6L A;  1Q90 A;  4ILW A;  3MEF A;  4CDF C;  4GS3 A;  3Q0A A;  4ZAI A;  1I94 L;  4GLA C;  3S14 B;  2AMC B;  3SK8 A;  3DM1 A;  5HGQ A;  4LUZ A;  1SFO H;  5EKI A;  3HOX B;  1PH6 A;  2HUG A;  5I9O A;  3J7A 5;  4S3S A;  4AQY Q;  4TVA B;  1KL9 A;  1CTM A;  3EFX D;  1TR5 A;  4FF2 A;  4RAU C;  1TT2 A;  3C46 A;  2IPK D;  4DUZ Q;  1DYQ A;  3VYS A;  3OIP A;  4M8A A;  5KYL A;  1JWS D;  4JC0 A;  1NMG A;  5IYC G;  3NWT A;  2VS1 A;  3T16 A;  4DGZ A;  1AH9 A;  3TP6 A;  3P20 A;  1Q3L A;  1JB7 A;  1TY0 A;  1E1T A;  1A3V A;  2AWN A;  3H3V H;  5A35 A;  2QEX A;  4DV3 Q;  3G6E A;  1OXT A;  2O4X A;  2J4X A;  4IZ8 A;  1UUP A;  2VZA A;  3VYT A;  4HIM A;  3SEB A;  5DM6 3;  4R9W A;  4KTA A;  2D0O A;  3AFQ A;  1K28 A;  3A54 A;  5E4X A;  1KC8 C;  1VQC A;  3STB C;  4JI3 L;  4N8F A;  1A0I A;  1XWE A;  2MGS A;  5J3B A;  1JJC B;  3G6J B;  4PQX A;  4B3M L;  1Y1W H;  1RF2 D;  5EPK A;  2JA5 B;  1BBX C;  3BJU A;  4DR5 L;  1F2Z A;  1YVC A;  3CF5 A;  4JI2 L;  1PYB A;  1CA5 A;  2HCC A;  3S9W A;  1UAP A;  4FF1 A;  3HFZ B;  5ELE A;  5IGD A;  4RA8 A;  1N36 Q;  2YYZ A;  1UNS A;  4JPB W;  4RCN A;  3NEN A;  2WKC A;  1I50 H;  3A8K E;  4LF7 L;  3QR8 A;  3GTM B;  1KDB A;  1QNU A;  1SE8 A;  1EWI A;  1E3P A;  4IO9 A;  4RKL A;  5CGK A;  2Q2T A;  4GKK Q;  3DWP A;  4X3S A;  2GVB A;  1S5E D;  3OTO L;  4C3J H;  4Q0F A;  3NQT A;  4KKU A;  5FLM H;  2JQO A;  3OHX C;  5M5W H;  3I72 A;  2X69 A;  3PO3 G;  3DWA A;  5HY6 A;  2BA0 A;  3VR2 A;  1EY8 A;  3SK5 A;  3E9H A;  1SND A;  2F4I A;  2M9V A;  4JI5 L;  1VQF A;  5KNC A;  1PRT F;  4GZY C;  5C4H A;  2XVS A;  4C3I H;  1PFN A;  1VQJ A;  3EA6 A;  2NVT H;  2HD3 A;  1VQP A;  2LKV A;  2EYH A;  1GJX A;  3RZO H;  3BVG A;  4KLK A;  5DLQ E;  1EY4 A;  4XYQ A;  4G7Z C;  4K8J A;  1X55 A;  2VW9 A;  5C0X H;  4L5S A;  3K7U C;  2X6L A;  4ALP A;  1HZB A;  1BCP C;  1NSN S;  4OWT B;  2K5H A;  4Y7N H;  2NZO A;  5D3I B;  1STN A;  1VMP A;  5EGT A;  2K01 A;  1Q81 C;  1SE3 A;  1ZKO A;  4HJ9 A;  1HA6 A;  3W2D A;  1D5Z C;  1IHZ A;  1KHI A;  2PYK A;  2Z6B A;  5TSS A;  3HKZ G;  3A55 A;  4LF9 L;  1I4G A;  4PZ7 A;  4A3K H;  1JOQ A;  2E2I H;  3PSI A;  1Y1W B;  4A3D H;  3LX0 A;  1G6P A;  1XPU A;  3DLL A;  3I91 A;  2A6E D;  2F0H A;  3ER0 A;  3W3A A;  4NW2 A;  4ABN A;  3K5N A;  5KND A;  3R2T A;  5ELB A;  3BS1 A;  4DR1 L;  4L63 B;  2R92 B;  1C4Q A;  3NE5 B;  1I50 B;  1WD1 A;  4HN7 A;  2VL6 A;  3CCR A;  1SR3 A;  3R93 A;  5C4J H;  3GDE A;  2Z1C A;  2SEB D;  4DV5 Q;  5L37 A;  1I4R A;  1HNX L;  1EQT A;  4ZLT F;  1OXU A;  3GTL H;  4H44 C;  4C3J B;  2RA4 A;  3HOU G;  5M5W B;  2OTL A;  2KCC A;  4DV7 L;  4CGY B;  4X6A H;  2AUJ D;  3VA5 A;  2KCM A;  2Z8L A;  5GAD C;  5I6W A;  1EEI D;  3S1N H;  4N9T A;  4LUV A;  1BQQ T;  4A3J H;  1VQ9 A;  5ELN A;  2EYF A;  3ND9 A;  4ZKC B;  4JI2 Q;  4DUY Q;  4DNI A;  2RKS A;  2EXD A;  2RF4 A;  4KJO A;  2EYO A;  3K58 A;  4C3I B;  4GNX C;  2NVT B;  4DV0 L;  4XIG S;  3T13 A;  3RZO B;  5C3X A;  1GUW A;  2F0K A;  5LL6 S;  4X66 Q;  1XMQ L;  4AYB G;  1RD9 D;  1YBY A;  3JC6 6;  4Y7N B;  1AN8 A;  1L0W A;  2B8G A;  4A3G G;  2A8V A;  3EVQ A;  1SMY C;  1ONL A;  4DV4 L;  2EDG A;  2CCZ A;  3CXC A;  1JB3 A;  4B9W A;  2DN8 A;  4XXE A;  3S16 B;  1I5F A;  4A3K B;  4ULL A;  3S15 H;  1MBY A;  1SNM A;  2PMZ E;  1NTG A;  1O7L A;  2WB1 B;  2E2I B;  1CUK A;  4A3D B;  3CCV A;  2HQL A;  1SYB A;  1SNC A;  4JBJ A;  4H13 C;  3DM3 A;  1TXY A;  5IYB G;  3HOV H;  4MHE A;  1NCV A;  1N8R C;  4F87 A;  3DXJ C;  2C35 B;  2E5L L;  1EOV A;  3BG3 A;  3PV0 A;  4WFN 3;  1K8A C;  3F2B A;  2UXC Q;  1EL0 A;  3EBE A;  3UDG A;  1VQM A;  5IP9 G;  5C4J B;  4HSP A;  1BKB A;  3W1B A;  4DK1 A;  4HMI A;  2H5X A;  1G8Z D;  3HOW G;  2RDF A;  4YCW A;  2ATW A;  4HED A;  3PF4 A;  5LHY 1;  1U4M A;  3GTL B;  1UEB A;  2RDH A;  5CBE E;  1DZ1 A;  3MZ5 A;  2A73 B;  1KAW A;  2EQS A;  3NEL A;  5KNB A;  1ZYR C;  5IGC A;  4CBV A;  1HRJ A;  1EIF A;  5KGU A;  3S1N B;  4HMJ A;  1NJI C;  1EUJ A;  1QG7 A;  1ICF B;  4DAY A;  4A3J B;  4KN4 C;  1FYC A;  2KCT A;  4EQ5 A;  2CW0 C;  1BOS A;  4PV1 C;  3K59 A;  2A74 C;  3AFP A;  3HG9 A;  4U68 A;  2F0D A;  1SNO A;  1YNN D;  5JPM C;  1RKN A;  1YHQ A;  2JXM B;  1EWC A;  2F0U A;  2HHH Q;  5GAG C;  3VR5 A;  1AP0 A;  3BYT B;  1C8C A;  3X3M A;  1EYC A;  2CH4 A;  2MNA A;  4IUN A;  2EJM A;  4YWM A;  4KI0 A;  1XPO A;  2B2W C;  4B9X A;  1EFW A;  3TDQ A;  4ID6 A;  2ZXP A;  2NZ1 D;  3KYH C;  4A3I H;  1U9R A;  3RD4 A;  2G5D A;  2ZJQ A;  1X3E A;  3FKI H;  4K5V A;  3J7Y W;  1YHA A;  1WTH A;  4BA2 I;  5K36 H;  4CDD C;  3PF5 A;  1PLF A;  3S15 B;  1JJ2 A;  3PUZ A;  3Q8D A;  4IUQ A;  2CKZ B;  1PH8 A;  5FO9 B;  3QIA A;  1B3A A;  3I4N H;  1GUS A;  3TSS A;  5G3L D;  4JV5 Q;  4DAY B;  3HOX G;  1VCI A;  1A2U A;  2AKW B;  3CAM A;  1MD2 D;  1NY4 A;  3JAM c;  4YHH L;  2KEN A;  4EVO A;  1H95 A;  2DNC A;  3DMU A;  5FLX E;  1ENC A;  4YY3 L;  3P7J A;  1Q8I A;  1TS3 A;  2KHI A;  5LMU L;  3M4O H;  1XMQ Q;  2LY7 A;  5CYU A;  2LXJ A;  1FD7 D;  4EQN A;  1DM0 B;  4RGM A;  4KY5 A;  1X6O A;  2MFI A;  3RMH A;  1G51 A;  1HFN A;  2F0N A;  2UUA L;  2EIF A;  4UPA A;  2F0I A;  4FXG C;  3PUV A;  2F1M A;  4NMZ A;  2YU9 H;  4A3C G;  2I5M X;  2RSN A;  4BBS H;  1K0S A;  2NVY H;  2LMC B;  2JYO A;  2PZU A;  2HIX A;  2K7V A;  3K5L A;  3KLR A;  2N3S A;  3PMF A;  5DNF A;  2ALY B;  5T1I A;  1LTR D;  1SEB D;  3STB D;  1PH1 A;  5JEA G;  1X9N A;  3RNU A;  1LAC A;  4UY8 C;  2E76 C;  2DJF C;  4ZYS A;  1NR4 A;  4G57 A;  3RLN A;  2F0V A;  4XQN A;  5IWA L;  2JA5 G;  1N32 L;  4YCU A;  1EU3 A;  2B2T A;  1U4L A;  2G9D A;  2K50 A;  1B4O A;  2OCE A;  1RDP D;  2ZTE A;  2UU9 Q;  2D2C C;  3J81 j;  3V96 A;  4ZKB B;  2MP1 A;  3CP0 A;  1IBK L;  4A3I B;  4CJ0 B;  1SJH D;  2EYM A;  1BUV T;  2SOB A;  3AU7 A;  1IW7 C;  3PCO B;  1SE4 A;  1DCZ A;  2LS0 1;  2EY6 A;  3K7A B;  3I3C A;  2CH4 W;  3Q6S A;  3ITP A;  1P8L A;  1H9J A;  2Q2H A;  4P2C B;  3I4N B;  1OXV A;  2UUC Q;  1F77 A;  4KHV A;  1E2W A;  1J8I A;  1RIP A;  4X3U A;  3VYR A;  1CZG A;  1EZ8 A;  2V4D A;  5J22 A;  4R4Q A;  3L3O C;  4DFA A;  4J1M A;  3Q22 A;  1H9R A;  1CM9 A;  1LLR D;  3P1H A;  1STA A;  5A2Q E;  4LAA A;  5K5P A;  1M4V A;  3GTG H;  1WOC A;  2K03 A;  4LUO A;  2ZJP A;  2R7D A;  3DUZ A;  2ZJR A;  4KKS A;  4XYO A;  1JOK A;  4I65 A;  3G48 A;  3NXW A;  4A3L G;  1SNQ A;  4XQJ A;  1PFM A;  1STB A;  3BVM A;  3ERS X;  3ZJY C;  1B7Y B;  2CFM A;  2F4V Q;  4O42 A;  3HZX A;  2MUY A;  1EQV A;  1SE2 A;  1BCP D;  3FHW A;  4KY7 A;  2YU9 B;  4BBS B;  2NVY B;  5JEA J;  2K04 A;  2N49 A;  1M8A A;  3MHB A;  1CT1 D;  1KTK A;  1CA6 A;  1W6J A;  1LTB D;  4GN4 B;  5EPL A;  3GD7 A;  2ICI A;  3SR1 A;  5IGB A;  4YHH Q;  3S1R H;  4WJW A;  2QGQ A;  2UXB L;  1PRT C;  5FKA C;  2AWO A;  2NB0 A;  1YJN A;  1PV4 A;  4DV2 Q;  1HZ9 A;  4CKB A;  3K0Y A;  1Y1W G;  2Z4I A;  3V05 A;  1O7I A;  3URY A;  2F0J A;  3TZU A;  2BA1 A;  5EQ0 A;  3T56 B;  2RCF A;  3UE1 A;  1AFP A;  3EN2 A;  1C0A A;  1Z9F A;  4IUP A;  2VY3 A;  1MJC A;  4BWG B;  2IX0 A;  2Z4H A;  3T1Y Q;  2D0P A;  2XRS D;  4LFA Q;  5EKL A;  1S4Z A;  2Z9H A;  1N34 Q;  1E2V A;  4Y52 H;  3VYU A;  3K8A A;  3NTI A;  2IW3 A;  1EIG A;  2N78 A;  3T1H L;  3CHB D;  4IPC A;  1OXX K;  4JI0 L;  1QZG A;  2K5V A;  4C3J G;  3MXN A;  4RG1 A;  2IWH A;  5FLM G;  2K5N A;  4EX5 A;  2VQF Q;  2Q8T A;  1XNQ L;  1GD7 A;  2B8F A;  3H94 A;  2VQE L;  3I90 A;  4EQP A;  3I73 A;  4LK1 C;  3JAM i;  1GO3 E;  3GTG B;  2ZM6 L;  1EYA A;  1K9M C;  4UP8 A;  1VQN A;  4B3T L;  2B2Y C;  2IJ0 A;  4KKT A;  3PIO A;  4BBR H;  3QWN A;  3OMC A;  5M3F B;  1B9M A;  2A69 C;  1PFB A;  3D4D A;  1JOR A;  4C3I G;  4IJH A;  4DKA C;  3PIP A;  1EY7 A;  2E2J H;  1IBK Q;  1PH9 A;  4LJZ C;  4CDE C;  4FYD A;  2Q2I A;  4C1N I;  1TWH H;  3MXP A;  1TQO A;  2Q8I B;  5C0X G;  1B2T A;  1PZK D;  1B1Z A;  1JE4 A;  4GKJ L;  5E4W C;  4QCL A;  4OX9 Q;  3H91 A;  2YTV A;  4HSV A;  1SLJ A;  1N33 Q;  3JAM E;  4A3L H;  1SMY D;  3M9B A;  3TN2 A;  3HOY H;  2L5T A;  4RCO A;  4I7A A;  1CHQ D;  1KQS A;  4KD3 A;  3MXN B;  3S1R B;  1CSQ A;  4PMC A;  4LFC L;  2NTS A;  1D1I A;  3KDF A;  2QF7 A;  1YZ6 A;  1TWF B;  2DY7 A;  3MFY A;  4A3K G;  4DR6 L;  4LF8 Q;  2NN6 H;  2WB1 G;  3CW2 C;  2NZH A;  4A3D G;  2F0E A;  3D6W A;  4JI6 Q;  1Q7Y C;  2FHT A;  5DEH A;  1ET9 A;  2F0P A;  5M9O A;  2IHE A;  5COR A;  1C9O A;  3GV3 A;  1MSG A;  3GTJ H;  4YIJ A;  1H9M A;  2XIW A;  2L12 A;  3KF8 A;  1YNJ C;  1AEX A;  2WV6 D;  2BDO A;  1V1O A;  3HGB A;  5J39 A;  3CCE A;  3GTO B;  4K0K L;  1PH4 A;  3EJI A;  3IFD A;  1BVS A;  4B3S L;  4DAP A;  2KHJ A;  2D5D A;  2R7F A;  3T53 B;  2VXW A;  3S1M H;  1ZYR D;  2R92 H;  5JAV A;  4QMG A;  3UE0 A;  1QNK A;  2CWP A;  1PH7 A;  3QOL A;  3I8Z A;  3DEP A;  2K6A A;  1JIC A;  3KDF B;  1R4P B;  3VR4 A;  4UHV A;  3NSW A;  1VF7 A;  4A3J G;  1IKL A;  2CW0 D;  5BR8 L;  3KK7 A;  1J9O A;  3H09 A;  1VQB A;  4BBR B;  1EY6 A;  5KRU A;  4O2D A;  3RN2 A;  5C0X J;  5C3E B;  1KXL A;  3SE0 A;  1F9S A;  2E2J B;  2QKI C;  3UDI A;  1TWH B;  3GO5 A;  2K52 A;  2WAQ E;  3A5U A;  2NVX H;  1BBU A;  3KF8 B;  4JI8 Q;  4LF6 L;  1Q1B A;  3QOJ A;  4JI4 Q;  3NWS A;  1DOM A;  1OO9 B;  2MHV A;  4X64 L;  4DV6 Q;  1SYF A;  3T1H Q;  4A3E H;  3K5M A;  4JI0 Q;  1FGU A;  3U58 A;  5JPN C;  3HOY B;  1K8O A;  5IOC A;  4J15 A;  1WVL A;  3PUX A;  1ZEQ X;  2F0L A;  3KLW A;  5IGE A;  2EY2 A;  5T1G A;  1PVO A;  4QL5 A;  3S1Q H;  1TY2 A;  4OIJ A;  4GOP C;  2ZM6 Q;  4B08 A;  1UE6 A;  2KQ3 A;  2R7Z B;  4MTK A;  5CV5 A;  4B3T Q;  3GQB A;  1I94 Q;  4JK1 C;  4F7X A;  5CV6 A;  1DJR D;  1J6Q A;  3RUZ A;  3HOV G;  3H6M A;  3H3V C;  4P74 A;  5C4Z A;  1KIX A;  2Z6K C;  3NBH A;  4O0A A;  1BCP B;  3V2T A;  4A93 H;  1Y1V H;  2RHQ B;  3UDX A;  1PFS A;  4C56 C;  3AEV A;  3GTJ B;  5JJK A;  1E7Z A;  2K32 A;  3TBI B;  4BY1 H;  3S16 H;  1HQM C;  1KLU D;  5FK9 C;  2I46 A;  3S2H H;  4GKJ Q;  5F2D A;  2ASB A;  1PZJ D;  2KUM A;  2JK8 A;  5C44 H;  2F0T A;  5I9P A;  3WOE A;  2R93 H;  1RJT A;  1A15 A;  2ICE C;  1NE3 A;  3S1M B;  4GNX A;  1Q46 A;  4IOC A;  4POF A;  4JOI C;  2SDF A;  1Y8N B;  4P72 A;  5M3M H;  1AZP A;  3GTK H;  2F3W A;  1VQG A;  3CCU A;  1G29 1;  1L0Y B;  2JA9 A;  1KRT A;  2B39 A;  4CJ1 B;  2WP8 J;  1KAB A;  3M4P A;  4B3R L;  3H15 A;  1B3Q A;  1TVX A;  2WKD A;  4KHZ A;  2E2H H;  3J80 c;  4BXX G;  4NDX A;  5IT9 L;  3CC4 A;  1ET6 A;  3K80 C;  3KLS A;  1TWA H;  1S3O A;  3NBH B;  3SDZ A;  3KOJ A;  1LUZ A;  1E1O A;  4AH6 A;  4JI3 Q;  3H3V I;  1GVP A;  1Z7T A;  1TWC H;  1QVG A;  2FMM A;  1CFM A;  2NVX B;  4M1U B;  5G3L F;  4IN3 A;  4B3M Q;  1DOK A;  1HNZ L;  4WJ4 A;  1A3T A;  3OPO A;  4A3E B;  1LM0 A;  4DR5 Q;  5IGG A;  4ZQ3 A;  1PTO C;  4DN4 M;  4NXN L;  2SNS A;  1JR0 D;  3E6Z X;  1IW7 D;  4A3I G;  5CV8 A;  3FKI G;  1QUQ A;  1MJE A;  3DEO A;  4LF7 Q;  3S1Q B;  5ELO A;  5K36 G;  4R1J A;  3J80 L;  3E3X A;  5COY A;  5EKK A;  4KMU C;  1LTI D;  4XT3 B;  1NUC A;  1OTC A;  5BR8 Q;  3I4N G;  5D14 A;  3H0G H;  4K14 A;  1D5X C;  1FNW A;  1DXM A;  3ZYY X;  3KBX A;  1MSH A;  3NK9 A;  3OTO Q;  1JQY D;  2C9O A;  1D2B A;  5IP7 H;  4ME3 A;  4A93 B;  1Y1V B;  3A5Z B;  3F2U A;  3AB9 A;  4BY1 B;  2J7Z A;  2HDM A;  4RH6 A;  1O78 A;  3S2H B;  1PH2 A;  1IL2 A;  1IYJ B;  1M90 C;  4JI5 Q;  3M4Q A;  4NB3 A;  5C44 B;  1VQ8 A;  3L7Z C;  2NUC A;  2MJ8 A;  2V1C C;  1GUT A;  2N8N A;  1Y69 U;  1KDC A;  2R93 B;  5NUC A;  1CQF A;  1I4H A;  5M3M B;  4DXF A;  2JA6 H;  4ME5 A;  2IL8 A;  1YIT A;  4FP5 D;  4JBK A;  3GTK B;  2A5H A;  1QUQ B;  1I3Q H;  4EGV A;  4IFD J;  4JYA L;  1K8M A;  2D62 A;  4DAV A;  4BBS G;  2B2U A;  2DGY A;  1LTA D;  1SNP A;  2RBM A;  1FL0 A;  3HKZ E;  1J5E L;  2E2H B;  4R4I A;  4HCS A;  1PRT D;  4PG3 A;  1TWA B;  1QIL A;  4JI7 L;  5EBD A;  5GRO A;  1X3F A;  3TP7 A;  4IPG A;  3MTS A;  3D8G A;  1TWC B;  4LF9 Q;  3GTP H;  4C2M B;  5C0X I;  1BDO A;  4K6D A;  1X3Q A;  1ENF A;  2NYZ D;  1K8G A;  2VUM H;  5I2X A;  4IFD H;  1Y8O B;  2B2V A;  4BXX H;  1HR0 L;  1UE5 A;  4JBW A;  4DR1 Q;  1XNR L;  2NBF A;  3DHQ A;  1YJ9 A;  2K1B A;  2F0Q A;  3U4V A;  4OWW B;  4FF4 A;  2MPM A;  4G7O C;  4NXM L;  1ILQ A;  1HNX Q;  3H0G B;  3AQQ A;  4OO1 H;  1BBW A;  2XN9 C;  5AJ3 L;  3LWU A;  4E6I A;  3J81 L;  1A2T A;  4DV1 L;  2MQH A;  3GV6 A;  4F88 A;  3FDT A;  2E8G A;  1V1P A;  4DV7 Q;  4LFB L;  4DR2 L;  1RHP A;  4HID A;  4G7H C;  1IYU A;  3P75 A;  1V8Q A;  2F0O A;  1SMX A;  2A1A A;  3K7A H;  1LTS D;  2C5C A;  2QW7 A;  2A69 D;  3F2C A;  2ZTC A;  1RTO A;  2KVM A;  1L1O A;  1RCV D;  2H4O A;  1Q12 A;  1YEZ A;  3OMG A;  1MKH A;  3FVQ A;  2PMZ B;  3CQZ H;  2R61 A;  5C5M A;  1C48 A;  1T5X D;  1BNZ A;  4R8I A;  3PO2 H;  1JT8 A;  1MI2 A;  1VQD A;  4DV0 Q;  2TMP A;  2JA6 B;  4AYB E;  3HOZ H;  4JI1 L;  1H9K A;  3TZD A;  1STE A;  4KJN A;  3WOF A;  2X6G A;  4IUR A;  1I3Q B;  5FOB B;  1HTP A;  1LYL A;  1V1Q A;  3C2P A;  1QWY A;  4FXD A;  1GUO A;  1G2T A;  5HUR A;  2KCN A;  4RHS A;  5BN4 A;  4QQB X;  1ENA A;  2P5Z X;  1W6K A;  4N8X 1;  4ODG A;  2ES2 A;  1TII D;  4HIK A;  1EQQ A;  1GUG A;  2UXD L;  4DV4 Q;  3R8B A;  4LNQ A;  5AFW A;  3O13 A;  2K5D A;  1F2M A;  1V1P B;  3CRK C;  2NTT A;  4FDB A;  3GTP B;  3G4S A;  2YTY A;  4V0B A;  1VQA A;  3ONA B;  2OT2 A;  4H0L C;  2R3Z A;  3SK6 A;  2TSS A;  1PH3 A;  1I6V C;  2KJX A;  3M7G A;  4QIW E;  2UUB L;  5FO8 B;  2EVB A;  4ZUI A;  1PH5 A;  2VUM B;  4POG A;  1HHV A;  1CKO A;  1L1O B;  2E5L Q;  4TSS A;  4UAI A;  1ASY A;  1TWG B;  1YNJ D;  3BZD B;  1R9T H;  1IL8 A;  4QY7 A;  1A6X A;  2NVQ H;  4UP7 A;  1W2B A;  4IUV A;  1Q8K A;  4FNF A;  4OIK A;  1B70 B;  5ELD A;  4I7Z C;  3MFG A;  3EIV A;  3LWE A;  3A8I E;  4X65 L;  3HKS A;  2RSO A;  1Q82 C;  4NPS A;  1WTR A;  1BO0 A;  1J5E Q;  3MVV A;  3QO2 A;  3N6R A;  3A8J E;  4CDC C;  1K83 B;  2HQE A;  1NMF A;  4JI7 Q;  4A3F H;  1EY0 A;  1GHJ A;  1CQV A;  4IOA A;  3TME A;  4QUC A;  4XDX A;  3HEJ A;  2JA8 H;  1WI5 A;  3G7L A;  3IFT A;  4RGT A;  5E3F A;  4BBR G;  1QJO A;  2ID0 A;  3IRB A;  5CC4 A;  5IE8 A;  4P71 A;  4DR3 L;  1CSP A;  1SSO A;  3E0J A;  4AQY L;  1LT3 D;  1X65 A;  3CQZ B;  3FRP B;  5CR3 A;  2ZXO A;  5C3E G;  3U4Z A;  3PO2 B;  2HIV A;  2VNU D;  4JCV E;  1QB5 D;  3HOZ B;  1JWU D;  2K14 A;  2QCP X;  1AZQ A;  4DUZ L;  5LMN W;  4K8I A;  3A7L A;  2CHB D;  2BH2 A;  2RVL A;  3CKI B;  3KUP A;  5M3F H;  3HOY G;  4OXP A;  4DV1 Q;  5LL6 X;  4RWS C;  5I2Y A;  3KLS X;  3ULL A;  1IBM L;  3B6Y A;  4LFB Q;  1D8L A;  1FVI A;  3ERQ A;  4R4O A;  2JA7 H;  2NN6 G;  4DV3 L;  4X62 L;  3MAQ A;  5D65 A;  2KOL A;  3RLO A;  3SHL A;  2R7Z G;  2EY5 A;  1A3U A;  1SAP A;  2EZV A;  3IKJ A;  4OHJ A;  2B2T C;  2HCI A;  1LO5 D;  5DM7 3;  2XRQ D;  2EYP A;  2H1E A;  4U67 3;  1XTD A;  1R9T B;  1EWH A;  5JJI A;  4DF7 A;  2NVQ B;  2EYJ A;  1TWF H;  3AYH B;  4CJ2 C;  3MWY W;  1VQE A;  4YY3 Q;  1DON A;  3J7A F;  1MHW C;  2CQA A;  5LMU Q;  1PA6 A;  2JE6 I;  1K73 C;  2B2Y A;  4WJ3 M;  1HZA A;  1DGS A;  3F2D A;  4IPH A;  3HRZ C;  1PZI D;  5EPJ A;  1N36 L;  2PI2 E;  1SYE A;  1A8V A;  2R92 G;  1P16 A;  2PNR C;  1JJG A;  2UXD Q;  4A3F B;  2IT1 A;  2B63 H;  1WTX A;  1EU4 A;  3ICE A;  2EOT A;  2PO4 A;  1IBL L;  1S5D D;  2UUA Q;  2JA8 B;  2OQ0 A;  3RLF A;  2RCN A;  2OQK A;  3NEM A;  3PQI A;  3UDF A;  1VQ6 A;  4BY7 H;  5C4X H;  3GTO H;  1STG A;  4GKK L;  5BN3 A;  3CC7 A;  1STY A;  2UUB Q;  2F0F A;  1T5E A;  4R4C A;  2K5W A;  2FIN B;  4OL7 A;  1FNU A;  2F3V A;  2XTI A;  3D4R A;  1I6H H;  1WCM H;  1PDQ A;  5CV4 A;  1E0B A;  4A75 A;  2K28 A;  2LXK A;  3M4Y A;  4GN5 A;  3AMU A;  2GA4 B;  2OWO A;  5IIF A;  3M3Y B;  1EFI D;  2PZT A;  5IWA Q;  1N32 Q;  3DWQ A;  4A3E G;  3W5O A;  4BA1 I;  2ZXR A;  3SK4 A;  1PTO D;  2KED A;  4CKE A;  4KHP L;  1OXS C;  1GHK A;  4XTC S;  4DK6 C;  3CU7 A;  5C3E H;  2YTX A;  4IJL A;  3E9I A;  3J7Z C;  5DAU A;  1U0L A;  4DR7 L;  3PGZ A;  3BZC A;  2JA7 B;  4Z9C B;  3GTQ B;  2BCO A;  4JG2 A;  3KFU A;  4H02 A;  3I4M H;  4TQU S;  1UEA B;  2JP1 A;  4A76 A;  3L9A X;  1KDA A;  4O1N A;  2J0T D;  2QA4 A;  4DR3 Q;  2D9U A;  4A93 G;  1Y1V G;  4J8Q A;  3K0X A;  3ULP A;  3LGJ A;  1KNA A;  2R6G A;  2XNA C;  3E0E A;  1JCK B;  4BY1 G;  3OOC A;  4A3B H;  4C1N K;  2FFK B;  4UDU C;  1ILP A;  3WWV A;  4WOR A;  2L11 A;  1L2F A;  2R7Z H;  4C3H H;  1SJE D;  1HNW L;  5BN5 A;  1LV9 A;  1A63 A;  1S5B D;  1TS2 A;  2FJ2 A;  2RHS B;  4IUT A;  5C44 G;  1R4Q B;  4JVZ A;  5GQO A;  2F0G A;  2R93 G;  3MC0 B;  3C1F A;  1IBM Q;  5M3M G;  2B63 B;  3PUW A;  3C1E A;  3BDC A;  4G4K A;  2WII B;  2EXZ A;  4X62 Q;  3I7F A;  3K5O A;  4DV5 L;  4BY7 B;  1Q86 C;  5C4X B;  2O5J C;  2K5Q A;  1K3B C;  1VF5 C;  4RHR A;  2ENB A;  2E2D C;  2Y0S B;  4KN7 C;  1QOH A;  1JMC A;  1SXT A;  1I6H B;  1WCM B;  2Q2U A;  5E1F A;  5IYD H;  1VQL A;  4DA2 A;  4DNT B;  1D6E C;  4HTH A;  2OF1 A;  3HP3 A;  2IHF A;  2JEA I;  3S2D H;  1WTQ A;  2UXB Q;  1F2L A;  4OEL B;  4GOP A;  1D1K A;  1NBW A;  1HZC A;  2XSC A;  1E22 A;  2I5L X;  2XGT A;  1EZ6 A;  1UE7 A;  1HR0 W;  4HIO A;  4DUY L;  5ISR A;  1CK1 A;  1F9P A;  2Z6K A;  4K2K A;  2RQX A;  5FJ8 H;  4LF5 L;  1GUN A;  1KNE A;  3M85 A;  4HJ8 A;  1IZ6 A;  3WDN A;  1B50 A;  3Q24 A;  4DPG A;  1IBL Q;  3HS0 C;  4IAL A;  3I4M B;  1WTW A;  4X66 L;  1EIY B;  3GP7 A;  1ROD A;  4A3M H;  1QZH A;  2A68 C;  3H0G G;  3EQL C;  3VR3 A;  1G2S A;  1SFO B;  4F8M A;  5LMN L;  5IP7 G;  1I4Q A;  4CHT B;  4RMF A;  1O7Y A;  1XNQ Q;  2VQE Q;  4XT1 B;  1PTO H;  3A7A B;  4JOI A; 
#chains in the Genus database with same CATH homology
 5M5Y H;  4JI4 L;  3CPF A;  2N3S A;  4DK3 C;  2ALY B;  2JA5 H;  2MO1 A;  4DV6 L;  1VQH A;  2JA6 H;  2WAQ G;  4MNO A;  1SRO A;  4JI8 L;  4X65 Q;  1E24 A;  2BH8 A;  3STB D;  5JEA G;  5GAH C;  1YIT A;  2B3G A;  4GOP B;  1X9N A;  1PH1 A;  3RNU A;  4JBK A;  1QUQ B;  1I3Q H;  4IFD J;  4UY8 C;  4JYA L;  2D62 A;  4BBS G;  4KHP Q;  2DGY A;  1K3R A;  4HJA A;  4HJ5 A;  3K81 C;  3RLN A;  3FP9 A;  1C7Y A;  2PI2 A;  4DAM A;  1FL0 A;  1X3G A;  5IWA L;  2JA5 G;  3GTM H;  3CCQ A;  1N32 L;  4YCU A;  4HJ7 A;  4LF4 Q;  2JA6 G;  3HKZ E;  2UXC L;  1J5E L;  4R4I A;  3MEF A;  2K50 A;  4PG3 A;  4DR7 Q;  4GS3 A;  2OCE A;  2ZTE A;  2UU9 Q;  3SGI A;  1I94 L;  4JI7 L;  4GLA C;  1T9H A;  2GVA A;  5GRO A;  2CWA A;  1X3F A;  2AMC B;  4MTN A;  3J81 j;  4IPG A;  2IY5 B;  5HGQ A;  4LUZ A;  3CP0 A;  5IT9 c;  1SFO H;  1IBK L;  5FLX c;  4LF9 Q;  1PH6 A;  3GTP H;  1YHB A;  3J7A 5;  4AQY Q;  4TVA B;  3PCO B;  1KL9 A;  3RR5 A;  5C0X I;  1PYS B;  5IYC H;  2HT1 A;  4APV A;  2WB1 E;  1K8G A;  1QVC A;  1P8L A;  4LFC Q;  2Q2H A;  2VUM H;  1OXV A;  4DUZ Q;  2UUC Q;  4BXX H;  1HR0 L;  1UE5 A;  4JBW A;  1RIP A;  4DR1 Q;  3TS0 A;  1XNR L;  4DR6 Q;  4JC0 A;  4R4Q A;  1YJ9 A;  1NMG A;  5IYC G;  1HNW Q;  2VS1 A;  3U4V A;  4OWW B;  1AH9 A;  3CCS A;  2PNH A;  3GTG H;  4NXM L;  5JJL A;  1WOC A;  1HNX Q;  1JB7 A;  2VUM G;  1E1T A;  4LUO A;  2AWN A;  2ZJP A;  3H3V H;  4IFD G;  3AQQ A;  2R7D A;  1BBW A;  5AJ3 L;  2ZJR A;  3TQY A;  4DV1 L;  2JEB I;  2MQH A;  2QEX A;  2F3I A;  3G6E A;  4DV3 Q;  1OXT A;  3G48 A;  4A3L G;  2E8G A;  1SN8 A;  2HHH L;  4DV7 Q;  4LFB L;  4DR2 L;  3ZJY C;  3ERS X;  2VZA A;  4C2M H;  4HIM A;  4LW1 A;  1B7Y B;  2NN6 I;  4HID A;  4OO1 G;  2CFM A;  4K0K Q;  2F4V Q;  4B3S Q;  1SMX A;  2D0O A;  2A1A A;  3AFQ A;  3K7A H;  3KJO A;  1W3S A;  1KC8 C;  1VQC A;  3F2C A;  2ZTC A;  4JI3 L;  3STB C;  3FHW A;  1A0I A;  1L1O A;  5J3B A;  1Q12 A;  1YEZ A;  1MKH A;  5JEA J;  1JJC B;  2N49 A;  3CQZ H;  4B3M L;  1Y1W H;  1JT8 A;  2Z0S A;  3PO2 H;  4GNX B;  1VQD A;  4DV0 Q;  3BJU A;  4PZ8 A;  4DR5 L;  1WYD A;  1YVC A;  4GN4 B;  3GD7 A;  1PYB A;  4AYB E;  3CF5 A;  4JI1 L;  4JI2 L;  3HOZ H;  1AE3 A;  4YHH Q;  3S1R H;  2QGQ A;  3HFZ B;  4JV5 L;  2UXB L;  1N36 Q;  2AWO A;  2YYZ A;  1V1Q A;  1LYL A;  4MZ9 A;  3PUY A;  1WFQ A;  1YJN A;  1PV4 A;  4DV2 Q;  1HZ9 A;  3NEN A;  4DR4 L;  1I50 H;  4QQB X;  1Y1W G;  4LF7 L;  3PO2 G;  1O7I A;  4LF5 Q;  1X54 A;  1VQ6 A;  3CMA A;  3HOZ G;  2ES2 A;  1SE8 A;  1EWI A;  2BA1 A;  4HIK A;  1EQQ A;  1E3P A;  4IO9 A;  3UE1 A;  3PO3 H;  2K4K A;  3EN2 A;  2UXD L;  4DV4 Q;  1C0A A;  4LNQ A;  1Z9F A;  4L5Q A;  2Q2T A;  3CCL A;  4GKK Q;  1YIJ A;  2OTJ A;  1AE2 A;  1MJC A;  2VY3 A;  2IX0 A;  4LF6 Q;  2GVB A;  3T1Y Q;  3TS2 A;  2D0P A;  4FDB A;  4LFA Q;  3OTO L;  3G4S A;  2YTY A;  4C3J H;  1VQA A;  1S40 A;  4X64 Q;  3CC2 A;  5FLM H;  2JQO A;  5M5W H;  1V9P A;  4YWK A;  1N34 Q;  5LMN Q;  3PO3 G;  1PH3 A;  4Y52 H;  4P75 A;  5HY6 A;  2BA0 A;  3K8A A;  4QIW E;  2UUB L;  2F52 A;  2IX1 A;  2N78 A;  3T1H L;  1VQ4 A;  1PH5 A;  4POG A;  1N9W A;  1OXX K;  3BU2 A;  1CKO A;  4IPC A;  1QZG A;  1L1O B;  3E9H A;  2E5L Q;  1ASY A;  4JI0 L;  2K5V A;  4RG1 A;  1R9T H;  4JBM A;  5FLM G;  4JI5 L;  1VQF A;  2K5N A;  1Q1E A;  4QY7 A;  4EX5 A;  4YWL A;  2LSS A;  2VQF Q;  1XNQ L;  1GD7 A;  2NVQ H;  4UP7 A;  4OON A;  2VQE L;  1W2B A;  1Q8K A;  3JAM i;  1GO3 E;  1B70 B;  4C3I H;  2ZM6 L;  1VQJ A;  3A74 A;  2NVT H;  1VQP A;  3EIV A;  1K9M C;  4UP8 A;  3RZO H;  4X65 L;  3HKS A;  4KLK A;  5DLQ E;  1VQN A;  1Q82 C;  4B3T L;  4NPS A;  1X55 A;  1J5E Q;  1X56 A;  2VW9 A;  3PIO A;  4L5S A;  4BBR H;  1S72 A;  3K7U C;  1KD1 C;  4BY7 H;  4ALP A;  1NMF A;  4JI7 Q;  1HZB A;  4A3F H;  3U50 C;  4OWT B;  3J81 c;  2K5H A;  4Y7N H;  3D31 A;  4IJH A;  4IOA A;  2NZO A;  3KF6 A;  4DKA C;  3PIP A;  2E2J H;  1IBK Q;  1WI5 A;  2B29 A;  2JA8 H;  2JJQ A;  3M7N A;  1Q81 C;  1PH9 A;  2UU9 L;  2Q2I A;  3A0J A;  1TWH H;  4HJ9 A;  5C0X G;  3W1G A;  4BBR G;  1KHI A;  4GKJ L;  3HKZ G;  4OX9 Q;  2CQO A;  2ID0 A;  3IRB A;  5IE8 A;  3CCJ A;  4P71 A;  4DR3 L;  4PZ7 A;  1CSP A;  2YTV A;  5EAY A;  1TWG H;  3KJP A;  1SLJ A;  4AQY L;  1X65 A;  4A3K H;  4LF9 L;  3I55 A;  5C3E G;  1EYG A;  3PSI A;  2E2I H;  1N33 Q;  1D7Q A;  3U4Z A;  2VNU D;  2HIV A;  2JA8 G;  4JCV E;  4A3D H;  3M9B A;  4A3L H;  3HOY H;  1XJV A;  1G6P A;  1XPU A;  2K14 A;  3DLL A;  1KQS A;  3MXN B;  3TRZ A;  1CSQ A;  1HH2 P;  3ER0 A;  4LFC L;  4GLV B;  4L5R C;  1FJG L;  4B3R Q;  4DUZ L;  5LMN W;  3F8T A;  3KDF A;  2UUC L;  1U5K A;  3S24 A;  1YZ6 A;  4DR1 L;  4A3K G;  1VS0 A;  2BH2 A;  4DR6 L;  4LF8 Q;  2WB1 G;  3CW2 C;  2NZH A;  4A3D G;  2VL6 A;  3CCR A;  1SR3 A;  4JI6 Q;  1K83 H;  1SRU A;  1VQI A;  5C4J H;  5M3F H;  1XMO L;  1Q7Y C;  3HOU H;  4OXP A;  3HOY G;  4DV1 Q;  1XPR A;  3GDE A;  1GKH A;  2A19 A;  4DV5 Q;  3ULL A;  1HNX L;  1IBM L;  1CKM A;  4OWX B;  1OXU A;  1VQ5 A;  1KRS A;  3B6Y A;  2IHE A;  1QVF A;  1D8L A;  4LFB Q;  1FVI A;  4R4O A;  3ULJ A;  2JA7 H;  1C9O A;  5GAE C;  3GTL H;  2NN6 G;  4DV3 L;  4X62 L;  1HNZ Q;  3RLO A;  3GTJ H;  2R7Z G;  3HOU G;  5M3F G;  3KF6 B;  2OTL A;  4DV7 L;  4A3F G;  4X6A H;  2KCM A;  3CCE A;  1PHJ A;  5GAD C;  4K0K L;  2F4V L;  4NXN Q;  1PH4 A;  3S1N H;  1BVS A;  1YJW A;  4B3S L;  2JA7 G;  1XTD A;  4LUV A;  3CPW A;  2KHJ A;  4A3J H;  1VQ9 A;  2DUD A;  5ELN A;  5JJI A;  1V43 A;  4JI2 Q;  2R7F A;  3L2P A;  3I4O A;  2I0Q A;  3S1M H;  4DUY Q;  4DNI A;  1TWF H;  2EXD A;  2RF4 A;  2R92 H;  3UE0 A;  3AYH B;  2CWP A;  4YY3 Q;  1VQE A;  1PH7 A;  4GNX C;  4DV0 L;  4XIG S;  5LMU Q;  4GN3 B;  1PA6 A;  1B8A A;  2JE6 I;  1K73 C;  4A3G H;  1HZA A;  1DGS A;  3KDF B;  4DR4 Q;  4WJ3 M;  3F2D A;  4A3J G;  4IPH A;  5BR8 L;  3J80 i;  1N36 L;  2PI2 E;  1VQB A;  4P73 A;  1A8V A;  4X66 Q;  2R92 G;  1P16 A;  4AYB G;  4DV2 L;  1XMQ L;  1VQ7 A;  2UXD Q;  1JJG A;  1YBY A;  4O2D A;  2IT1 A;  3JC6 6;  3RN2 A;  5C0X J;  2B63 H;  1L0W A;  3ICE A;  3TEH B;  1KXL A;  1IBL L;  1IXR A;  2UUA Q;  4A3G G;  2A8V A;  2OQ0 A;  4UP9 A;  2RCN A;  5E7N A;  3RLF A;  2OQK A;  3NEM A;  3UDF A;  3UDI A;  3GO5 A;  5C4X H;  2K52 A;  4R4T A;  3I2Z A;  1Y14 B;  2WAQ E;  4DV4 L;  2WFW A;  2CCZ A;  3GTO H;  4GKK L;  3CXC A;  3A5U A;  2YV5 A;  5IYB H;  1BBU A;  2NVX H;  3KF8 B;  4JI8 Q;  4LF6 L;  1Q1B A;  3CC7 A;  3T1Y L;  1I5F A;  5M5X H;  2UUB Q;  4JI4 Q;  4LFA L;  5H1S E;  2B63 G;  4X64 L;  1Z47 A;  4R4C A;  4DV6 Q;  3T1H Q;  4A3E H;  3S15 H;  2PMZ E;  2XTI A;  1NTG A;  4JI0 Q;  4QGU A;  1I6H H;  2AHO B;  1CUK A;  1FGU A;  1WCM H;  3CCV A;  3TRE A;  3U58 A;  1N34 L;  5IP9 H;  4A75 A;  4BY7 G;  2LXK A;  5C4X G;  2HQL A;  4JBJ A;  4J15 A;  3PUX A;  4JYA Q;  1VQK A;  3DM3 A;  1TXY A;  5IYB G;  4GN5 A;  3KLW A;  1N8R C;  3HOV H;  2OWO A;  3HOW H;  2C35 B;  1L1O C;  2E5L L;  1PVO A;  4QL5 A;  3S1Q H;  1MIU A;  2Y0S G;  4PMW A;  1EOV A;  5IWA Q;  1N32 Q;  4GOP C;  3PV0 A;  2ZM6 Q;  4A3E G;  3W5O A;  1K8A C;  2PQA A;  4BA1 I;  3F2B A;  2VQF L;  2UXC Q;  3EBE A;  3UDG A;  1VQM A;  1UE6 A;  1WCM G;  4KHP L;  5IP9 G;  2K75 A;  4B3T Q;  1OXS C;  1I94 Q;  4XTC S;  1BKB A;  3W1B A;  4L5T A;  3I56 A;  2H5X A;  4DK6 C;  1M1K C;  1J6Q A;  3RZD H;  3HOV G;  5C3E H;  4LF4 L;  2YTX A;  1YNX A;  3E9I A;  4IJL A;  4P74 A;  4YCW A;  2ATW A;  3J7Z C;  1KIX A;  3HOW G;  1U0L A;  2Z6K C;  1UWV A;  4O0A A;  3PF4 A;  1EQR A;  3PGZ A;  4DR7 L;  3BZC A;  4A93 H;  1Y1V H;  1UEB A;  2RHQ B;  1PFS A;  3UDX A;  3OW2 A;  3AEV A;  4JG2 A;  3KFU A;  1A62 A;  4H02 A;  3I4M H;  1E7Z A;  5JJK A;  4TQU S;  4BY1 H;  3S16 H;  4A76 A;  1KAW A;  2EQS A;  3NEL A;  3CME A;  3S2H H;  4GKJ Q;  2ASB A;  2QA4 A;  4DR3 Q;  1EIF A;  1HR0 Q;  1NJI C;  1EUJ A;  1XNR Q;  1Y1V G;  4A93 G;  3K0X A;  2JK8 A;  5C44 H;  3ULP A;  3LGJ A;  2R6G A;  3E0E A;  3I4M G;  2GN5 A;  4OX9 L;  2KCT A;  4BY1 G;  4EQ5 A;  3M3Y H;  2R93 H;  1NE3 A;  4A3B H;  4GNX A;  4NXM Q;  1Q46 A;  4IOC A;  3AFP A;  4JOI C;  4POF A;  4P72 A;  5M3M H;  1FJG Q;  4AIM A;  1N33 L;  3WWV A;  2R7Z H;  5AJ3 Q;  1L2F A;  4C3H H;  3GTK H;  1HNW L;  1VQG A;  3CCU A;  3CD6 A;  1A63 A;  1G29 1;  2JA9 A;  2RHS B;  5C44 G;  1KRT A;  2WP8 J;  3M4P A;  2KBN A;  1YHQ A;  2PQA B;  5GQO A;  1XMO Q;  4IFD I;  3H15 A;  4B3R L;  2R93 G;  1K0R A;  2HHH Q;  5GAG C;  2MO0 A;  4DR2 Q;  3S17 H;  4A3B G;  1IBM Q;  4KHZ A;  2FXQ A;  5M3M G;  2MNA A;  1VQO A;  4LF8 L;  3GTQ H;  1UE1 A;  3PUW A;  2E2H H;  3J80 c;  3G71 A;  4BXX G;  4JI6 L;  4YWM A;  4KI0 A;  3CC4 A;  3K80 C;  1TWA H;  1XPO A;  1S3O A;  4LWC A;  3J81 i;  1EFW A;  4X62 Q;  3I7F A;  3NBH B;  3S14 H;  4PZ6 A;  1CKN A;  3KOJ A;  4YCV A;  4DV5 L;  1LUZ A;  1E1O A;  4AH6 A;  1Q86 C;  4JI3 Q;  3H3V I;  1GVP A;  4OO1 I;  1TWC H;  1QVG A;  3HOX H;  4GLX A;  3KYH C;  4A3I H;  2I5H A;  4A4I A;  1X3E A;  3FKI H;  2ZJQ A;  1YI2 A;  4B3M Q;  1YHA A;  1HNZ L;  4BA2 I;  4WJ4 A;  1HJP A;  1JMC A;  3PF5 A;  1LM0 A;  4DR5 Q;  1JJ2 A;  2Q2U A;  4JI1 Q;  3PUZ A;  1GM5 A;  5IYD H;  3Q8D A;  2L15 A;  2CKZ B;  3RN5 A;  1VQL A;  3S2D H;  1PH8 A;  2UXB Q;  2IHF A;  2JEA I;  3I4N H;  4JV5 Q;  1ASZ A;  1LTL A;  4NXN L;  4DAY B;  3HOX G;  1VCI A;  4A3I G;  4GOP A;  3FKI G;  1NBW A;  1QUQ A;  2AKW B;  1MJE A;  1HZC A;  4LF7 Q;  3CAM A;  5ELO A;  1E22 A;  1NY4 A;  2I5L X;  2KEN A;  4R1J A;  2XGT A;  3JAM c;  4YHH L;  4IPD A;  5K36 G;  1WJJ A;  1UE7 A;  1HR0 W;  1H95 A;  5IY0 A;  4HIO A;  5IYD G;  1JE5 A;  1RL2 A;  4DUY L;  3VDY A;  4QJF A;  1OTC A;  5BR8 Q;  3I4N G;  3BZK A;  3H0G H;  3OYY A;  4YY3 L;  2Z6K A;  2KHI A;  5FJ8 H;  4LF5 L;  5LMU L;  3M4O H;  1XMQ Q;  3M85 A;  4HJ8 A;  3OTO Q;  5IP7 H;  3CCM A;  1IZ6 A;  2LXJ A;  4ME3 A;  3A5Z B;  4DPG A;  1IBL Q;  3L0O A;  4A3C H;  3F1Z A;  4X66 L;  1EIY B;  4A3M H;  1X6O A;  1QZH A;  2MFI A;  3H0G G;  1CKN B;  5FJ8 G;  1G51 A;  3D0F A;  2UUA L;  1PH2 A;  1IL2 A;  5LMN L;  1IYJ B;  2EIF A;  1M90 C;  5IP7 G;  4UPA A;  4JI5 Q;  3PUV A;  4RMF A;  3M4Q A;  4NB3 A;  2ZTD A;  1VQ8 A;  2YU9 H;  1XNQ Q;  2I5M X;  4A3C G;  4BBS H;  2NVY H;  3L7Z C;  2VQE Q;  2Y0S E;  2V1C C;  2N8N A;  2HIX A;  4A3M G;  4JOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...