1N33L

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position at the a site with paromomycin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
124
structure length
124
Chain Sequence
b'PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 12
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1n33L00
2PQAA 4R4CA 1BBWA 2UXCQ 3G4SA 2JA6H 4KHPL 1YVCA 4PZ7A 1CUKA 1HZCA 4UP9A 3ZJYC 2UXCL 1PH4A 4IFDG 1WJJA 3H0GG 2UUBL 1C0AA 4BBSG 1Q82C 1KL9A 1I5FA 3A0JA 1NBWA 5GADC 1VS0A 5ELNA 3T1HQ 1N32Q 2IHFA 2ATWA 3S1MH 4GKKQ 1Y1VG 3NBHB 4A3JG 4P75A 1L1OC 1YJ9A 4JG2A 3PV0A 3T1HL 4GKKL 1E22A 5IYCH 2KCMA 1PA6A 4GN5A 3RN5A 1YJWA 1NMFA 3AFPA 3S16H 1PHJA 3F1ZA 2HHHL 2YV5A 4JC0A 3M85A 4NXNQ 3KLWA 2NVTH 1PH5A 4JI1Q 4LWCA 2JJQA 1R9TH 4DR7L 2KHJA 2RHSB 4NXNL 2JK8A 1L0WA 3OTOQ 3UDFA 1J5EL 4LF7Q 2GVAA 4POFA 1FJGL 1E24A 3GTLH 1XTDA 2CWAA 2K5HA 1VQIA 4H02A 4A3LG 2MO0A 4UP7A 4DV1Q 1PYBA 2B3GA 2F52A 3W1BA 1L2FA 4A4IA 4LF7L 4PG3A 1VQBA 4P72A 1ASYA 3CC4A 2CCZA 2E8GA 5GAEC 1YHAA 3E9IA 4OXPA 1HH2P 4X65Q 4JI3Q 2RF4A 1CSQA 1I6HH 2ASBA 2E5LQ 4L5QA 4A75A 1YNXA 1XMQL 2NVQH 2CFMA 1VQ9A 2LXKA 3HKSA 4AIMA 4DV0Q 2UU9L 2OQ0A 3EN2A 4DR4L 1WCMG 4YY3Q 4JI6Q 3GTOH 2GN5A 1OXUA 3NEMA 4DV0L 2JA7H 1A8VA 3H0GH 1VQPA 2E2IH 1PFSA 4BA1I 3CC7A 4A3EG 4DK3C 4YY3L 2Q2IA 2DUDA 2Z6KA 3ICEA 3K8AA 1GO3E 1MKHA 4OWWB 2VS1A 3ULLA 3A5UA 3I56A 5AJ3Q 1GM5A 2NVXH 4IFDI 2QGQA 2PI2A 3U4VA 5IT9c 3STBC 1ASZA 3FKIG 5M5XH 4GOPB 4BXXH 3W5OA 2JA8H 1QUQA 5AJ3L 3KJOA 4UY8C 4A3BH 3HOZH 4JI0L 1A63A 1GD7A 1RIPA 5J3BA 1DGSA 2AWOA 1J6QA 5H1SE 4YCWA 1SLJA 1Q86C 1EIYB 1G51A 1N33Q 4L5RC 2R92G 4AQYL 1X55A 2MO1A 1XNRQ 1VQCA 4PZ6A 2OQKA 1V1QA 2MNAA 4GNXB 1B70B 1N33L 1GKHA 3T1YQ 1XNRL 2JA6G 4OO1G 1S3OA 1Q8KA 3E0EA 1UEBA 2K75A 3TQYA 1HZ9A 3S14H 1U0LA 2D0PA 4GLXA 5C44H 4JI2Q 2ZTDA 3T1YL 3U4ZA 1JJGA 1IBLQ 1M90C 5IE8A 3CMAA 4MNOA 4GN4B 3VDYA 3PF5A 4JI2L 4LF8Q 1CKNA 1KAWA 2UXBQ 1QZGA 4LF8L 3PUVA 4DUZL 5IYCG 4OWTB 1EQRA 2VL6A 4HIKA 2EIFA 1X6OA 4IO9A 2OTLA 4LF9Q 4QIWE 4BBRH 5GROA 1WCMH 4DKAC 2PMZE 1KD1C 2KCTA 2NN6G 3NENA 2VQFL 4UPAA 2WAQG 4A3EH 3K7UC 4ALPA 4KI0A 3L2PA 5LMNQ 3TREA 1Q81C 1W3SA 4JOIA 3CPFA 2GVBA 3D31A 3GDEA 1KQSA 1AE2A 4JI7Q 1K83H 4A3GH 5C4XG 3M7NA 1I50H 4JYAQ 5LMNL 3KDFB 3F2BA 4IPGA 2K14A 3I4MH 2IX0A 3FKIH 4JI7L 4B3RL 2PNHA 3CCUA 1UE1A 1L1OA 4JYAL 2I5HA 2ES2A 2R7FA 3JAMi 3GTMH 2I5MX 4JBWA 2IHEA 5LMUQ 1VQAA 2I0QA 2UUAL 1W2BA 3PO2H 4LF6Q 3FHWA 3M9BA 3PSIA 3E9HA 3HOUH 1UE6A 4DV7Q 3S1QH 4JI8L 3GTQH 4K0KL 1QVCA 3RLOA 5C4JH 5HY6A 1L1OB 5LMNW 1VQOA 4DUYQ 2N49A 4IPCA 4GLAC 2JA7G 1BKBA 3I4OA 1YIJA 2K50A 1O7IA 4Y7NH 3PGZA 4OO1I 5GAHC 3CP0A 4R1JA 4A93H 5M3MH 1WOCA 5FJ8G 1X9NA 1JJCB 3KF6A 4O0AA 1FL0A 1EIFA 4NB3A 4YWMA 4NXMQ 2N3SA 1N32L 1IBKQ 4KHZA 4DR6Q 4HJ7A 1VQHA 2JA8G 3K81C 3CF5A 3HOZG 1TWFH 1VQGA 4NXML 1YZ6A 1FVIA 3TEHB 3UE1A 1XNQQ 2R6GA 1XJVA 2AKWB 1XMOQ 4X64Q 2K5NA 4DAMA 1JJ2A 1X65A 3KF6B 2DGYA 2E2JH 4QQBX 1XNQL 4IPDA 4GS3A 3UDGA 1PVOA 1XMOL 4JBMA 2BH2A 3ERSX 2WB1G 3HKZG 4JI1L 1UWVA 3HOYH 5C4XH 5C44G 3OTOL 4LFAQ 4DR3Q 4LFCQ 4JV5Q 3UDXA 5DLQE 2NN6I 1NE3A 4OX9Q 1E3PA 2R7ZH 3HKZE 2WB1E 3G71A 4DV1L 4JBKA 4LFCL 2OWOA 4IFDJ 5IP7H 1BVSA 1SN8A 2F4VQ 1IL2A 1YHBA 5JJKA 3GD7A 3M4PA 1TWCH 5M5WH 4IOCA 3PCOB 3RZDH 5C0XG 1K9MC 4X65L 4JI3L 2F4VL 3K7AH 1WI5A 4IPHA 5JEAG 4DV6Q 1MJCA 2E5LL 3B6YA 4BBRG 4LFBQ 1XPRA 4GOPA 2YYZA 3U58A 3K0XA 4DV6L 2BA1A 1N36Q 2V1CC 3KJPA 1NTGA 1X3FA 3S24A 4LFBL 4KLKA 4JI5Q 4HIOA 1HJPA 1CSPA 3CCVA 1OXSC 2JA5G 2QA4A 4JI6L 2IX1A 4A3DH 3J81c 3EIVA 5FJ8H 4C3JH 1WYDA 4A3GG 3STBD 4GNXA 1K8AC 2KENA 2YTXA 3AEVA 3I4MG 4TQUS 1MIUA 1VQEA 1QZHA 3LGJA 5FLMH 2VQEQ 4GKJQ 3EBEA 1HR0Q 2R93H 3ER0A 3HFZB 4X6AH 2D62A 1S72A 2MFIA 2HIXA 3KYHC 4GKJL 2LSSA 1HR0L 1G6PA 2VY3A 4DV4Q 1SR3A 3CCMA 5GAGC 4JI4Q 5E7NA 3CCEA 3PO2G 3A74A 5BR8Q 3HOXH 1UE5A 1E7ZA 3HOUG 4DV4L 5BR8L 2VUMG 2A8VA 1Y14B 2A19A 2CKZB 5C0XJ 1X54A 5JEAJ 3MXNB 1VQ6A 2ID0A 3HOWH 2AHOB 1VQ7A 2JQOA 4A93G 5M3MG 2OCEA 3AFQA 3I7FA 1EYGA 4B3MQ 3J80c 1IBLL 1KIXA 1HR0W 3S15H 2OTJA 1A0IA 4A3FH 2B63H 2K4KA 2VNUD 5HGQA 1E1TA 1G291 4FDBA 2YU9H 5IP9H 2UXBL 2K5VA 3CCQA 2KHIA 3S2HH 3S1NH 1T9HA 3CD6A 3KDFA 4DV5Q 4LW1A 1XPUA 3FP9A 1JB7A 2BH8A 5C0XI 1X3GA 2WP8J 3Q8DA 3F2DA 4LF9L 1LTLA 1KC8C 3A5ZB 4DV5L 4DAYB 2ZJPA 4DNIA 1PH6A 4HJ8A 2JA5H 3PF4A 2FXQA 5JJLA 4BA2I 1KRSA 2ZM6Q 3OYYA 3HOYG 3OW2A 3RZOH 2YTVA 5IYBG 4DR7Q 1AE3A 1PH7A 2A1AA 1I3QH 3GTKH 1EQQA 1VQMA 3PO3H 2R7ZG 3ULJA 5JJIA 4R4QA 3PIPA 3D0FA 5IP7G 4Y52H 3TRZA 1SROA 2JA9A 2LXJA 2NZOA 3J7ZC 1PH8A 4A3BG 4UP8A 3I2ZA 1A62A 1Q12A 1HNWQ 2C35B 1VQ5A 1E1OA 5LMUL 1VQFA 4DR2Q 1B8AA 1KXLA 2BA0A 4LF6L 1HNWL 2VZAA 3BZKA 2VUMH 4X66Q 3PUYA 5C3EH 4GLVB 4YWLA 4DR2L 4DV7L 1V9PA 4DR1Q 1N34Q 1HZAA 2ZTEA 3MEFA 3HOVH 1S40A 1VCIA 3UE0A 1VQLA 2E2HH 2JEAI 4A3DG 4DUYL 3PUXA 4DR1L 1D8LA 2XTIA 4BY7G 2HIVA 2YTYA 3L7ZC 1I94Q 4J15A 5M3FG 1YJNA 4A3CH 1YI2A 1EWIA 3L0OA 3IRBA 4AYBE 5FLMG 2WFWA 2R93G 3NELA 1TWGH 1SE8A 2D0OA 1Q1BA 3WWVA 1EUJA 3CPWA 4HJ9A 1IBKL 4DR6L 1Y1WH 1CKOA 2UUBQ 3CMEA 4OWXB 2EXDA 3RR5A 2EQSA 3CQZH 3HOXG 1SMXA 4X62Q 4DV3Q 2HQLA 1QVGA 4JOIC 3PUWA 3GTGH 2Q2HA 4X64L 3GTJH 2ZJRA 4BY1H 2IY5B 1EOVA 3KOJA 5IYDG 3BZCA 4X62L 4DV3L 1JT8A 2PQAB 4EQ5A 5IYBH 5IWAQ 2Z0SA 2Y0SG 4YCUA 1PV4A 1JE5A 3TS0A 1PH9A 3HOWG 1VQKA 1RL2A 2UUCQ 1OTCA 3GTPH 4A76A 3RNUA 5IWAL 1HNXQ 2HHHQ 4DR3L 4LFAL 4JV5L 2Y0SE 4OX9L 2UUCL 4A3FG 1C9OA 1UE7A 3J81j 2B63G 2L15A 2H5XA 1HNXL 4LF4Q 4IJLA 1SRUA 4O2DA 4DPGA 1LYLA 1YBYA 1J5EQ 4A3KH 1VQ8A 3H3VH 1YHQA 1B7YB 1FJGQ 5IP9G 1OXXK 2K52A 5K36G 4LF4L 1XPOA 1NY4A 4LNQA 1MJEA 4YWKA 2KBNA 1KRTA 3H3VI 1N9WA 1TXYA 1CKMA 3J81i 1YITA 1PYSB 2CWPA 4XTCS 4QL5A 2Q2UA 3UDIA 4YCVA 1TWAH 1Q1EA 5M5YH 1N36L 2RCNA 4BY7H 4P73A 1NJIC 2N8NA 4JI5L 5M3FH 1XMQQ 3CW2C 3CXCA 3DM3A 3W1GA 4YHHQ 1HZBA 3CCRA 4A3IG 3PO3G 4A3MH 3BU2A 2ALYB 1K3RA 3CAMA 3DLLA 3ULPA 1K0RA 2UU9Q 5ELOA 4DV2Q 4YHHL 4DR4Q 3I55A 1AH9A 4LF5Q 2VQEL 1QVFA 1IBMQ 4RMFA 3F2CA 4DV2L 3GO5A 1LM0A 2MQHA 2R7DA 4LF5L 5GQOA 4MZ9A 1Q7YC 1IBML 1P8LA 3AQQA 3RLNA 5IY0A 3TS2A 2ZJQA 4JI4L 1K73C 4PMWA 4BBSH 2UXDQ 4P71A 3BJUA 1VQNA 4PZ8A 3G48A 2ZTCA 2XGTA 4XIGS 5C3EG 5IYDH 3RLFA 1Y1VH 4DK6C 2F3IA 3RN2A 4A3JH 1PH3A 4JI0Q 3HOVG 2UXDL 1U5KA 3J80i 4ME3A 4C3HH 1WFQA 3JC66 4POGA 1P16A 5EAYA 4AQYQ 2VW9A 1GVPA 3KF8B 3CC2A 1N8RC 3CCLA 1HNZQ 4R4IA 2QEXA 4A3CG 4B3ML 4HIMA 4LUZA 1BBUA 1VQ4A 3I4NH 1IXRA 1HNZL 1X3EA 2AMCB 4GOPC 1LUZA 1JMCA 3KFUA 1EFWA 1Y1WG 3PUZA 4LUVA 5FLXc 2CQOA 1NMGA 1V43A 1SFOH 1QUQB 2PI2E 1Q46A 1M1KC 4A3LH 1OXTA 4OONA 3SGIA 3M4QA 2Z6KC 3U50C 2HT1A 4QJFA 3K80C 1C7YA 4EX5A 4BY1G 4JBJA 4GNXC 4P74A 3S17H 4IOAA 3F8TA 3H15A 1X56A 4DUZQ 3AYHB 2JE6I 1OXVA 4A3IH 3M4OH 1IZ6A 4R4OA 2ZM6L 4NPSA 3J7A5 4APVA 2N78A 4RG1A 4AH6A 4B3SQ 3M3YH 3S2DH 1KHIA 4GN3B 4JCVE 3S1RH 2I5LX 4L5TA 4LUOA 1Z9FA 4HJ5A 4B3SL 4BXXG 2VQFQ 4A3KG 2B29A 1CKNB 4IJHA 1PH2A 3PIOA 4DR5Q 4HIDA 2AWNA 4HJAA 1PH1A 4L5SA 1FGUA 4WJ4A 4B3TQ 1VQDA 4QGUA 3CCSA 2NZHA 4DR5L 4B3RQ 4C2MH 1VQJA 2RHQB 1IYJB 1TWHH 4B3TL 2WAQE 4X66L 1D7QA 4AYBG 4C3IH 2Q2TA 1N34L 4TVAB 3I4NG 1H95A 2UUAQ 1K8GA 4MTNA 1Z47A 4R4TA 4QY7A 2IT1A 2NVYH 3CCJA 2R92H 2JEBI 4A3MG 4WJ3M 3JAMc 4JI8Q 4K0KQ 1I94L 3G6EA 4KHPQ 1YEZA
chains in the Genus database with same CATH superfamily
1SNCA 3OWFA 3G4SA 4I65A 2L5TA 1SNDA 1CUKA 4XQNA 1HZCA 4UP9A 2F0JA 5KRUA 2UXCL 4CBVA 2UUBL 2B8GA 4P2CB 1KL9A 1NBWA 1N32Q 1JOKA 2IHFA 1RHPA 3NXWA 2ENBA 1JB3A 2VB3X 1Y1VB 3N6RA 2L4NA 1TS4A 3P75A 1E22A 3FDTA 3I72A 5IYCH 3RN5A 1NMFA 4K5XA 2H1EA 3NPPA 1SMYD 2NVTH 1SSOA 2DNCA 4ZKBB 2KHJA 2RHSB 1CZWA 2I07B 4NXNL 4POFA 1E24A 4H13C 1VQIA 4DV1Q 4X3SA 1LTBD 3VA5A 1BO0A 2F0WA 3W1BA 2RBMA 1ASYA 4K6DA 3S17B 4XT1B 4OXPA 2B2VA 2E5LQ 1RTNA 4A75A 1YNXA 2CFMA 3MXGA 4KV6A 3S1RB 2B2TA 2UU9L 3EN2A 4CHTB 4DR4L 4YY3Q 1AW7A 4KY5A 1OXUA 1WCMB 2EJFC 1U4MA 1A8VA 3H0GH 4A3EG 5EKKA 4TSSA 1GO3E 3A5UA 2PYKA 4IFDI 3U4VA 4C2MB 1FD7D 3I73A 3W5OA 1QUQA 1A63A 3FKIB 3HOZH 4C3IB 1GD7A 1RD9D 4OEMB 3H6MA 2MPMA 4CDCC 2AWOA 1A2UA 1G51A 1X55A 2CW0D 2MO1A 4KK7A 2R92B 2OQKA 1GKHA 1K28A 1U0LA 5C44H 5C4JB 2ZTDA 3T1YL 2F3VA 3U4ZA 1JCKB 1A3TA 1SYCA 1IYUA 4MNOA 3AU7A 3VDYA 3RUZA 3QG1A 2BDOA 3TMEA 1QZGA 2SNSA 4NMZA 1BCPC 3PUVA 2MGSA 2F0KA 2LS01 3K5OA 4OWTB 1X6OA 4LF9Q 1PXUA 1B53A 4BBRH 2L0CA 3V05A 4K14A 3NP8A 2VQFL 2WAQG 2B8FA 2HCCA 3K7UC 4KI0A 1ZXTA 3L2PA 4ALPA 3SDZA 1W3SA 4JOIA 3M7NA 1I50H 4EGVA 4DAVA 4G7HC 3KDFB 4IPGA 1H9RA 3QOJA 2IX0A 2KHSA 1UE1A 1NR2A 1LABA 2N88A 4JYAL 2R7FA 2I5MX 3I90A 1VQAA 1YNND 1IKLA 4LF6Q 1JWUD 4JI8L 4RGTA 1AFPA 5HY6A 5LMNW 1B3QA 4DUYQ 1WTRA 3KBGA 4GLAC 5IGCA 2RVLA 1O7IA 5EPJA 4MN3A 1DOKA 4V190 1FL0A 1EY7A 3OSOA 2Z9HA 2DNEA 2AQ1B 3K81C 3DEOA 1TWFH 3HOZB 1WTWA 1XNQQ 2QCPX 2R6GA 3J7AV 1XJVA 1CK1A 4IPDA 5ELCA 1G91A 2DN8A 4I7ZC 4JBMA 3HOYH 5C4XH 3OTOL 4LFAQ 1EY4A 4DR3Q 4HMIA 2EY6A 2NN6I 1KNEA 5C44B 5D3DA 2D9UA 1ZYRC 4O1NA 5IP7H 1BVSA 2F4VQ 1IL2A 3M4PA 4RWSC 1TWCH 3A8KE 1SMYC 1S5BD 3SVMA 4X65L 1WI5A 4KY6A 2YU9B 1MJCA 1TS3A 3B6YA 2NTSA 1ICWA 4BBRB 1I4RA 2V1CC 1F2LA 4KLKA 3ND9A 5J39A 3EIVA 3MHBA 1WYDA 3STBD 4GNXA 3IL8A 2YTXA 2WKCA 1MIUA 2HUGA 1QZHA 2VQEQ 5FLMH 4XXEA 3ER0A 3HFZB 3PIO3 1XYIA 2HIXA 4GKJL 1OO9B 1X3PA 1HR0L 1QB5D 1VMPA 1SR3A 2VY3A 3D4DA 4KY7A 5C5LA 3CCMA 4DV4Q 3PO2G 4QB4A 1E7ZA 3BYYB 4X3KA 4BS9A 2TSSA 3VYUA 4MHEA 1Y14B 2A19A 2A8VA 1BCPB 1D5MC 2ID0A 3OIPA 2JXMB 4A93G 1Z7TA 2OCEA 3AFQA 4B3MQ 1BDOA 4ZCKA 4A3FH 2VNUD 5HGQA 1G291 2CW0C 3TN2A 3S2HH 2KHIA 1DXMA 1TWFB 1T9HA 1TWGB 2PMZB 3T13A 1XPUA 1JC7A 4B08A 2WP8J 3F2DA 1UNSA 4DAYB 2ZJPA 1EYCA 3H94A 4JK1C 4BA2I 3Q24A 3FRPB 3OYYA 5EKLA 1LTRD 3HOYB 2A1AA 3KLRA 1I3QH 1SJED 1CA5A 3GTKH 1VQMA 3ULJA 4WORA 1WD1A 4CKCA 1IW7D 1PTOC 3TRZA 5I4DA 4PMCA 2G5DA 5AFWA 1HNWQ 4A3BB 2K5WA 5LMUL 1VQFA 1WTXA 3VR5A 2DY8A 4ZRZA 1KXLA 3A55A 2VZAA 4X66Q 4YWLA 1HQMC 2ZTEA 3A7AB 2NTTA 3PUXA 3BVZA 5K5PA 2XTIA 4DR1L 3I3CA 2YTYA 3JAME 1YJNA 1WTVA 1V1OA 1EWIA 3IRBA 2QILA 3R93A 1EWHA 1YNNC 2R93G 1S5CD 1HCZA 2MUYA 2D0OA 3WWVA 4HJ9A 4FXGC 3CMEA 3RR5A 3VR4A 3HOXG 3SK8A 4X62Q 4DV3Q 4KHVA 1PTOH 1QVGA 4PMBA 2Q2HA 4X64L 1B9NA 5EPLA 4BY1H 3KOJA 3P1HA 2HCIA 5IYBH 5IWAQ 2Y0SG 1EOTA 2UUCQ 1S5ED 3DM1A 2G9DA 5KGUA 4JV5L 1C9OA 2B63G 2H5XA 1HNXL 4A3FB 2E75C 1J5EQ 2BE5D 4A3KH 2EZVA 1FJGQ 2K52A 1ET9A 5K36G 5J22A 1XPOA 1NY4A 4HTHA 3S2HB 1C4QA 2KBNA 1KRTA 1D5XC 2K6AA 2A6ED 2Q2UA 4QL5A 3TP5A 5M5YH 1TWAH 1EFID 1Q1EA 2RCNA 4BY7H 4P73A 3J7AF 4G57A 3T4AC 3PO3G 1HZBA 2E74C 1I3QB 1K3RA 2EXZA 4A3IB 4HR7B 4DV2Q 4YHHL 2GA4B 4LF5Q 1EWCA 2CH4A 5FOBB 5I2XA 1STHA 2IPKD 1IBML 1BXTA 1K73C 4BBSH 4PZ8A 2ZTCA 5IT9E 5IYDH 2F3IA 4UHVA 2UXDL 3R2IA 4ME3A 4U68A 4C3HH 4C3IG 3JC66 1P16A 2VW9A 2EE1A 4CKEA 1N8RC 1HNZQ 1JWMD 2F0PA 1PYWD 4CDFC 5CBAE 1IXRA 1X3EA 1PRTC 1LUZA 5C6AA 1EFWA 1Y1WG 1SFOH 5E4WC 1TS2A 4KD4A 2NUCA 4A3LH 3M4QA 2HT1A 5CV5A 1NCVA 1GUNA 4BY1B 2AQ3B 1Z6HA 3H15A 4DUZQ 3AYHB 1C48A 3M4OH 1IZ6A 1GUGA 4NPSA 3UI2A 4GN3B 1AP0A 4LUOA 1Z9FA 4B3SL 1LV9A 4M1UB 4KJNA 2NBFA 1L0XB 2B29A 4A3KB 5DM73 4BWGB 2FMMA 3T53B 3TDQA 3MAQA 1VQDA 1STBA 3Q0AA 1O78A 4CDDC 4B3TL 2WAQE 1KABA 2Q2TA 1DOLA 2MP1A 1N34L 4AYBB 1TWAB 5M5YB 2CVRA 1TR5A 5L37A 2JEBI 1IW7C 4EQPA 1M4VA 2ICEC 3JAMc 3BDOA 3VYTA 3R8BA 4K0KQ 3G6EA 2PQAA 1BBWA 2NVQB 2X69A 4KHPL 1YVCA 4OIJA 1IKMA 1WJJA 1ESRA 3H0GG 3LWEA 1C0AA 1I5FA 4BBSB 3T1HQ 5ELNA 2RDFA 2ATWA 4GKKQ 3Q22A 3NBHB 4A3JG 3SK6A 3CHBD 4NP5A 1I4GA 3PV0A 3MVVA 1LT4D 4C3HB 1GUOA 1PA6A 1PHJA 3X3MA 1K0SA 2YV5A 4JC0A 2BDNA 1NNXA 5CORA 4H44C 1PH5A 2NN6H 2JK8A 4JW0A 1O80A 4LK1C 4LF7Q 1SFOB 3D4RA 4H02A 5F2DA 1JR0D 2ZT9C 3FEWX 2A69C 1VQBA 4P72A 1LO5D 5I9PA 5GAEC 1BQQT 1CFMA 3HG9A 1EU4A 5EPKA 5CBEE 4L5QA 4DGZA 1XMQL 4CKBA 2BE5C 1VQ9A 4AIMA 3D3RA 2QDLA 2OQ0A 4XYOA 1ILPA 3V96A 2GN5A 3NEMA 4K8JA 2JA7H 5E4XA 4BA1I 3CC7A 4YY3L 1KDBA 4OWWB 4HSPA 2VS1A 3I91A 2NVXH 1PDQA 2PI2A 4IUTA 4KMUC 5EJWA 5IT9c 3U9OA 1GHKA 2L1BA 1PRTB 2L11A 3KJOA 1BUVT 4K6LA 3SK5A 4JI0L 2K32A 5J3BA 1J6QA 1HFNA 4RCNA 1EEID 5CV8A 1SYBA 4NKLA 1Q90A 1XNRQ 4L6TB 2RKSA 2MJ8A 2PPBC 4G7OC 3C2PA 3ZYYX 3V2TA 3FPUB 2JA6G 2A68D 1C8CA 4OO1G 1Q8KA 3GTQB 1UEBA 2DY7A 1JJGA 1IBLQ 1CTMA 1SNQA 4Y7NB 4LF8Q 1CQVA 1CKNA 1LTSD 2O2LD 4HMJA 2VB2X 4EVOA 1TVXA 5CV9A 1IYVA 3MTSA 1E2WA 4HIKA 3H91A 4ZKCB 1F9SA 2OT2A 2F0MA 1TT2A 2OF1A 1WCMH 3CRLC 3PMFA 3IAYA 2KCTA 4UPAA 2F0NA 1EEFD 4KKTA 4XQQA 5LMNQ 4JI7Q 1AH9A 5C4XG 1K83H 2AUKA 2EVBA 3FKIH 4B3RL 1CZGA 3CCUA 1Y8NB 3KBXA 2I5HA 2ES2A 3JAMi 4JBWA 2EY5A 3PSIA 1PZJD 3HOUH 1UE6A 4DXFA 3S1QH 1QVCA 3RLOA 3GQBA 5C4JH 2LY7A 1VQOA 1FGBD 1BKBA 4I7AA 1YIJA 2K50A 4IURA 2JA7B 3LNNA 5GAHC 1ET6A 4R1JA 3EQLC 1X9NA 1BCPF 1EIFA 2NVXB 4NB3A 4YWMA 4NXMQ 2N3SA 3FPPA 1IBKQ 4DR6Q 4XDXA 2JA8G 2V4DA 3CF5A 1HFGA 2KECA 4XT3B 1S4ZA 3L9AX 2K5NA 1JJ2A 3W3AA 4KN4C 1XNQL 1DZ1A 5CGKA 3UDGA 4GS3A 4RFBA 3JAML 2JSOA 2BH2A 1STNA 2WB1G 4JI1L 4R8IA 3HKZB 3MC0B 4LFCQ 4FF3A 1E3PA 3HKZE 1O7LA 4K5WA 3G71A 4JBKA 2SNMA 2OWOA 2JP1A 1AEXA 5M5WH 4HN7A 1RDPD 5FO7B 4JI3L 2F4VL 4IPHA 3EJIA 4LFBQ 4K8IA 4KJOA 4DA2A 1XPRA 3K0XA 1GUSA 1B1ZA 3OOCA 3S24A 5KEEA 1TKWB 2IX1A 1KLGD 1OXSC 4JI6L 2A5HA 4C3JH 4A3GG 2PCFB 4K2LA 3U9SA 1K83B 3AEVA 3I4MG 1QOHA 1VQEA 1QG7A 2D62A 4RKBA 3SXHA 3MWYW 5E7NA 4KKUA 4CDEC 1B50A 4DV4L 3EVQA 3HOUB 2XN9C 3HEJA 3S1QB 2QEJC 3C1EA 5T1IA 1EY8A 5C0XJ 1X54A 2VUMB 5JEAJ 3MXNB 5LL6X 1VQ6A 1U4PA 2F4IA 1H9JA 5M3MG 4R8NA 3QIAA 2XWBB 1ENFA 1X32A 1A0IA 1GXDC 1E1TA 3F2UA 2YU9H 5IP9H 5C0XH 2UXBL 2K5VA 5IT9L 3NHHA 5JEAH 3CCQA 3DXJC 3S1NH 3R3OA 3CD6A 3KDFA 4DV5Q 4LW1A 2NYZD 1XWEA 2E76C 2A68C 3FP9A 1JB7A 1X3GA 3Q8DA 4OL7A 2C5CA 5G3LF 4HJ8A 2JA5H 5JJLA 1KRSA 4J8QA 3OW2A 5IYBG 1STGA 2EJGC 1AE3A 1STAA 4RAUC 3HP3A 4B9WA 5FO8B 3DWAA 4ABNA 1EQQA 2R7ZG 5JJIA 3PIPA 3D0FA 1SROA 2JA9A 3J7ZC 4FF1A 4FO2A 3J80L 4UP8A 1A62A 1Q12A 1LTID 1MD2D 3A7LA 5M5WB 1E1OA 1ILQA 2F0QA 2PZWA 1HNWL 3BZKA 2EYPA 5C3EH 3PUYA 4FYDA 4DV7L 2K03A 3HOVH 3MEFA 4DXGA 2QW7A 1S40A 1VCIA 1EY5A 4ILWA 2E2HH 4A3DG 1D8LA 4BY7G 2XVSA 3K57A 1F77A 4J15A 4C3JB 4A3CH 1XTCD 5DEHA 5M3FB 3L0OA 3NELA 5LL6S 4CGYB 1TWGH 1Q1BA 3CPWA 2UUBQ 4OWXB 2HQEA 2F03A 4PV1C 1EYDA 2HQLA 1EQVA 3PUWA 3K5LA 5JVG3 2IY5B 1EOVA 5IYDG 4X62L 3BZCA 4DV3L 1JT8A 1MBYA 2R61A 3HOWG 2FINB 2IWHA 5EQ0A 3GTPH 1PTOF 2K7VA 4TKOB 5IWAL 2B2UC 2JN4A 2QF7A 4OX9L 1VF5C 2UUCL 5KYIA 1VDZA 1DJRD 1HTLD 1VQ8A 4DPGA 4LF4Q 4YIJA 4A3BH 4BXXH 1YHQA 3OHXC 3I4NB 3ITPA 4FP5D 4LNQA 1MJEA 1WD0A 2DJFC 3S1NB 4YWKA 3H3VI 2EYJA 2CWPA 4XTCS 4RGMA 1N36L 2JA5B 1G6ZA 4DK0A 2N8NA 4JI5L 2SDFA 3CW2C 1D1IA 3EA6A 2ALYB 3DLLA 2UU9Q 1K0RA 3MFYA 3S2DB 5ELOA 4DR4Q 4HEDA 5ELDA 4FXKC 1EQTA 1SYGA 4DV2L 1LM0A 4LF5L 3QWNA 1G2SA 4JI4L 3X3NA 3BJUA 2F0DA 3NQTA 1V1PA 4ZAIA 5CV6A 5C3EB 1PH3A 1O7ZA 3HOVB 4N9PA 1WFQA 2E2HB 1SBBB 3DHQA 3CC2A 3OPOA 4R4IA 4DAYA 4LUZA 1V1PB 1HNZL 2XRSD 4GOPC 4WJWA 1HUNA 2CQOA 1NMGA 1K3BC 2RSOA 4ZUJA 2PO4A 1M1KC 3H09A 5J1ZA 2F0UA 4OONA 2Z6KC 5T1GA 4QJFA 2WINB 1LT5D 1CA6A 4EX5A 3K5MA 4G4KA 1ICFB 2SEBD 3E0JA 4MTKA 4E6IA 1JOQA 1OXVA 2FJ2A 4A3IH 4R4OA 2ZM6L 3J7A5 3M3YH 4RG1A 3VR2A 5COYA 2PQEA 4AH6A 3GTPB 2I5LX 1Y69U 1Q3LA 2VQFQ 4DF7A 1ZEQX 1WVLA 1PH2A 1XX8A 1NUCA 4DR5Q 1D6EC 2AWNA 1PH1A 2K1BA 3TP8A 2RHQB 4F8MA 2PW5A 1X3QA 3VR6A 4TVAB 3GV6A 1Z47A 2Q8RE 4QY7A 2IT1A 2A6HD 2B2UA 1JE4A 4A3MG 2XSCA 2O5IC 1EU3A 1PRTF 4JI8Q 1E2VA 1I94L 1RODA 5IGEA 3N52A 3NWTA 4FVMA 3T56B 2F0SA 4X3UA 4PZ7A 2FMCA 1PH4A 3ND8A 5GADC 1VS0A 1Y1VG 4P75A 5CC4A 1L1OC 1YJ9A 4JG2A 3T1HL 2RDHA 3MXPA 4GKKL 2EYOA 4GN5A 4FNFA 4LJZC 1YJWA 3AMUA 5I6YA 2HHHL 3HGBA 2KCCA 2KUMA 3KLWA 4LWCA 4Z9CB 4DR7L 3OTOQ 2JYOA 3GTLH 2GVAA 1XTDA 2K5HA 1PYBA 2F52A 2DJGC 4LF7L 2K28A 4PG3A 2B39A 4G7ZC 1YHAA 3E9IA 4XQJA 4X65Q 1CSQA 5BN3A 1SEBD 5CV4A 2NVQH 1F2MA 3M3YB 1EY6A 2LXKA 1EZ6A 4J1MA 4DV0Q 5JOBA 4QUFA 3VA7A 1WCMG 3MXUA 3GTOH 4IFDH 1VQPA 2E2IH 1SJHD 4A3EB 2Z6KA 3ICEA 1MKHA 3PIP3 3ULLA 5AJ3Q 1FYCA 5ELFA 2EYMA 2F0VA 3STBC 3FKIG 4GOPB 4C1NK 1DGSA 4WFN3 3QB3A 4YCWA 2F0OA 2R92G 1EIYB 3GTMB 1N33Q 4L5RC 2F0TA 4AQYL 3TP6A 1KTKA 4X3TA 4PZ6A 1V1QA 1B70B 4ULLA 1EIGA 1XNRL 2Z4HA 4ODGA 1FR3A 1S3OA 3E0EA 2O4XA 2K75A 1STEA 1HZ9A 3TQYA 2D0PA 5CR3A 4GLXA 4JI2Q 3BDCA 3M4YA 4H7BA 3J80E 1G8ZD 1ONLA 4LAAA 3DMUA 3PF5A 4IUNA 1HQRD 2Q8TA 3D8GA 4LF8L 1HXYD 2G9HD 1JWSD 3TSSA 5IYCG 2PZTA 2K05A 2OTLA 2EIFA 1AN8A 3G7LA 5D65A 5GROA 1WTOA 4DKAC 1KD1C 3QOLA 3NENA 1TY2A 3TREA 2WAQB 5JPNC 3GTLB 3CPFA 3D31A 3GDEA 1KQSA 1AE2A 2E2DC 5LMNL 3F2BA 5CV7A 4JI7L 2PNHA 4XYQA 1L1OA 1CHPD 5LMUQ 5EKIA 3BDLA 5EGTA 1PFMA 2UUAL 1U4LA 3TZDA 1W2BA 3PO2H 3FHWA 1MSGA 3E9HA 3NBHA 4QMGA 3GTQH 4RKLA 1L1OB 5HURA 1LT6D 3GTOB 4IPCA 3I4OA 4Y7NH 2K5QA 2M2LA 4OO1I 2E2IB 3H3VC 4A93H 1WOCA 4O0AA 3C3LA 1N32L 3R2TA 4KHZA 4HJ7A 1VQHA 3HOZG 1VQGA 4NXML 1YZ6A 1I4QA 3UE1A 1CQFA 2AKWB 2XRQD 1XMOQ 1LT3D 4X64Q 2B2YC 4ID6A 1X65A 4QQBX 3DWPA 1H9KA 3ERSX 4N8X1 1UWVA 4IUUA 2M00A 5C44G 2F0EA 4JV5Q 4DV1L 4DNTB 4L8JA 4LFCL 2EY2A 1PZID 3CU7A 5JJKA 1R4QB 1W6KA 4OHJA 1SYFA 1A6XA 1UEAB 1B44D 5C0XG 3RZDH 1TS5A 5JEAG 2LFNA 1SE3A 4DV6Q 1NSNS 1B9MA 1GOZA 2E5LL 3HZXA 2H4OA 4BBRG 4ZLTF 5C4HA 1KLUD 3OMCA 1F2YA 3KJPA 3HRZC 1X3FA 2F0FA 4LFBL 1CSPA 2JA5G 1I6VC 2QA4A 1JOOA 2A6EC 1MSHA 3FVQA 5FJ8H 1ZKOA 3TP7A 2CHBD 1K8AC 2KENA 3E5SA 5M9OA 3LX0A 3LGJA 1EL0A 3S9WA 2R93H 4KTAA 1S72A 2MFIA 2M9VA 2LSSA 3WDNA 1G6PA 4C56C 5GAGC 2HDLA 5BR8Q 3HOXH 3PO2B 1CHQD 3VYRA 1HA6A 5FO9B 2K5DA 1EIHA 2K01A 2CKZB 2AHOB 1F9RA 3I8ZA 2B2VC 2KQ3A 3I7FA 1EYGA 3J80c 3KK7A 1HRJA 4A93B 4HCSA 1HR0W 1G2TA 1BCPD 2B63H 4K5VA 4DN4M 2NZ1D 4FDBA 3QR8A 5K36H 5JPMC 4LF9L 2ICIA 2EYLA 3L3OC 1DONA 4DV5L 1PH6A 2FXQA 2RDGA 3HOYG 1Q8IA 1PH7A 1HA5A 2X6GA 3PO3H 1SDFA 4FF2A 5A2QE 1W6JA 3NTKA 1XXGA 5IP7G 4Y52H 2LXJA 2NZOA 4A3BG 3URYA 2C35B 1VQ5A 2RA4A 4CJ2C 3RZDB 2CQAA 4DR2Q 1B8AA 1E2ZA 2B2YA 1J9OA 1FNWA 1H9SA 4LF6L 2VUMH 3IFTA 5IGFA 4GLVB 1HHVA 1N34Q 3MFGA 1K8MA 3UE0A 2JEAI 4DUYL 3KUPA 1MI2A 3NQIA 3OMGA 1BNZA 1CM9A 1YI2A 1H9SB 5FLMG 2WFWA 2EYHA 1SNMA 1SE8A 2R93B 1EUJA 4DNRB 2B2WC 2KEEA 5KIXA 5I6WA 1Y1WH 1CKOA 3CQZH 1SMXA 5DNFA 3HOXB 4JOIC 3K0YA 2EY1A 2BCOA 2Z0SA 4YCUA 1S5FD 4EQOA 1ZYRD 2Y0SB 1RL2A 5KNCA 1VQKA 4A76A 2IL8A 2XWJB 4DR3L 4LFAL 2KA7A 2Y0SE 4GZYC 2PW7A 4A3FG 1UE7A 2L15A 1ENAA 1SRUA 2B63B 1YBYA 4RA8A 5BN5A 1TY0A 4HSVA 1IHZA 4LF4L 5CYUA 3IKJA 1LTGD 1H9MA 2F0IA 1FNUA 1TXYA 3IFDA 4IZ8A 2FFKB 5G3LD 1HTPA 1RF2D 3SEBA 1NJIC 5M3FH 1XMQQ 3CXCA 4A3IG 3BU2A 3PO3B 4DK1A 1GUWA 3I55A 4QUCA 3MXNA 1VMCA 5I9OA 2VQEL 1QVFA 2ZXPA 4RGNA 2Z6BA 4ME5A 3F2CA 5C4ZA 3GO5A 1KDAA 2F1MA 1ML0D 2R7DA 4MZ9A 1PLFA 3KF8A 1P8LA 5IY0A 3RLNA 2ZJQA 4PMWA 4P71A 5HGTA 1VQNA 3G48A 2XGTA 1T5XD 4DK6C 4A3JH 3RN2A 1A15A 1QNUA 4V0BA 4JI0Q 3J80i 1BBXC 5EAYA 1GVPA 3KF8B 3CCLA 1WTPA 3CRKC 5IGBA 4B3ML 3A54A 3I4NH 1I4PA 2AMCB 4PQXA 3KFUA 5JVH3 1F9PA 1V43A 1QUQB 4KD3A 1MGSA 1Y1WB 1Q46A 1OXTA 2N55A 3CQZB 3K80C 4BY1G 4GNXC 2R3ZA 4IOAA 3F8TA 2Q8IB 1NR4A 3I4LA 2X6LA 4O42A 3S2DH 4APVA 1PTOD 4RHSA 4N9TA 1KHIA 4JCVE 3TBIB 5EBCA 4ZUIA 4L5TA 2PZUA 3ERQA 4K2KA 2WIIB 4A3KG 4JPBW 2B2WA 4IJHA 4QCLA 4RGOS 2NVTB 3LWUA 4HIDA 2P5ZX 4WJ4A 3I70A 2J7ZA 4S3SA 3GV3A 2NZHA 4DR5L 4B3RQ 2HDMA 5FLXL 3E3XA 1IYJB 1TWHH 1D7QA 4OELB 4X66L 4AYBG 1B4OA 2NB0A 1H95A 5E1FA 1EZ8A 4MTNA 1SNPA 1D2BA 5BN4A 2NVYH 3CCJA 4IQZA 1YEZA 2J4XA 1DM0B 4R4CA 2UXCQ 2JA6H 1Y8OB 4OO1H 3ZJYC 5ELBA 2K04A 1KDCA 3M7GA 4IFDG 4BBSG 3Q23A 1Q82C 3H0GB 1EY9A 3A0JA 1RKNA 3QO2A 3WOEA 3S1MH 4IN3A 2EJMA 2TMPA 3NWSA 1TU2B 4A3JB 4C3HG 5ISRA 2KCMA 4PNYA 3BS1A 1S5DD 3AFPA 3S16H 3F1ZA 3MEHA 3MZ5A 3M85A 4NXNQ 5DAUA 4JI1Q 1DOMA 2JJQA 1R9TH 1J5EL 1L0WA 3OWEB 3UDFA 2RQXA 1FJGL 5ELEA 2CWAA 5C5MA 4A3LG 2MO0A 4UP7A 1UUPA 2B3GA 3OW7A 1EY0A 1L2FA 4A4IA 1R4PB 2QKIC 3CC4A 2CCZA 2E8GA 1HH2P 2BOSA 4EQNA 5LHY1 2RF4A 4JI3Q 1I6HH 2ASBA 5FK9C 2F0GA 2D2CC 3NTHA 1YNJD 4RH6A 3HKSA 4U673 4OIKA 4JI6Q 1SE2A 4DV0L 2NWGA 3J81E 5JAVA 3K59A 1PFSA 4DK3C 3D4WA 2Q2IA 2DUDA 1QILA 4DU9A 3K8AA 2RSNA 3NBIA 3VR3A 3I56A 1GM5A 2QGQA 2A73B 1I50B 1ASZA 5M5XH 2EDGA 1JORA 1TWHB 2JA8H 5AJ3L 4UY8C 3SR1A 2F0LA 1RIPA 3EFXD 5H1SE 1Q86C 1SLJA 1QNKA 1SAPA 2NVYB 1II3A 1VQCA 1PRTD 1L0YB 4GNXB 1BOSA 2MNAA 3E6ZX 1N33L 3T1YQ 1WTQA 2JA6B 1M90C 4QF4A 5IE8A 1CI3M 1SE4A 3CMAA 3A8JE 4GN4B 4JI2L 1V8QA 1KAWA 2UXBQ 3S1MB 4IUPA 4QIWB 4DUZL 3J7YW 2KVMA 2VL6A 4IO9A 4QIWE 2D5DA 3S16B 2FHTA 4HAEA 2PMZE 3GP7A 4F87A 2NN6G 4A3EH 1R9TB 2EPBA 2WACA 1Q81C 3KLSA 2GVBA 1U9RA 4A3GH 4B9XA 4JYAQ 5C4XB 2K14A 5JJZA 3I4MH 1DD2A 4F7XA 4RCOA 2IX3A 1ENCA 3GTMH 1RTOA 2IHEA 2I0QA 1I6HB 3M9BA 1TWCB 1T5EA 4DV7Q 1KAAA 1M8AA 1QCBD 4K0KL 1B3AA 1LTTD 3A56A 4JVZA 1SNOA 5A2QL 3C46A 2N49A 1JICA 2WV6D 2JA7G 1TQOA 3PGZA 3CP0A 3PQIA 5M3MH 5FJ8G 1JJCB 2O5JC 3KF6A 2HD3A 4ZQ3A 2PNRC 3SK4A 4J6HA 2L9HA 4LMQD 5M5XB 2L55A 2JA8B 1DCZA 1STYA 1FVIA 5E3FA 3TEHB 4CJ0B 1PMRA 2IW3A 4DAMA 3KF6B 2E2JH 2DGYA 1RCVD 1PVOA 1XMOL 3HKZG 2A69D 2WB1B 3P7JA 3UDXA 5DLQE 1NE3A 4TRDA 4OX9Q 2R7ZH 1ESFA 2ZXOA 2WB1E 4KKSA 4N8FA 4IFDJ 1SN8A 1YHBA 3GD7A 3G6JB 1SYEA 4IOCA 3PCOB 1K9MC 3K7AH 4ZYSA 3FMCA 3K6OA 5IGDA 1D1KA 4GOPA 2YYZA 3U58A 1FNVA 1LTAD 4DV6L 2BA1A 1N36Q 4FF4A 1NTGA 3VYSA 4JI5Q 1F2ZA 1HJPA 4HIOA 3CCVA 4A3DH 2MHVA 3W2DA 3J81c 1PFBA 1VF7A 4HCEA 1GHJA 2KOLA 2EOTA 1QJOA 1PZKD 4A3GB 4TQUS 3GTKB 1B2TA 3I4MB 4GKJQ 3EBEA 3BG3A 1HR0Q 4X6AH 1YNJC 4IALA 3SHLA 3KYHC 1A2TA 3C1FA 4FXDA 5C3XA 4JI4Q 1LACA 2WKDA 3CCEA 1UAPA 3A74A 1I4HA 1UE5A 2EYFA 3DEPA 3HOUG 3DWQA 3O13A 5BR8L 2VUMG 3EROA 3D6CA 1AZQA 3T51B 3HOWH 1VQ7A 4NW2A 1JQYD 2JQOA 1K8OA 5IGGA 1IBLL 2VXWA 1KIXA 4DAPA 5M3MB 3S15H 2OTJA 1SYDA 2J0TD 2K4KA 3MA2B 5FLXE 1BR9A 3D6WA 5C3WA 2IJ0A 5KNBA 3NTIA 1GUTA 3NE5B 2I46A 2BH8A 5C0XI 5FKAC 1LTLA 3BVMA 3RMHA 1KC8C 1E0BA 3A5ZB 2E2JB 4DNIA 5IODA 1GJXA 1PTOB 2ZM6Q 3RZOH 2YTVA 1KNAA 5KNDA 4M8AA 3CKIB 3BZDB 2R7ZB 4R4QA 2QDBA 1PH8A 1HPCA 2KJXA 4F88A 3K58A 4L63B 3I2ZA 3TZUA 1CT1D 4CJ1B 3K7AB 2BA0A 3KLSX 5D3IB 4H0LC 3BVGA 4RHRA 4DR2L 1V9PA 4DR1Q 1HZAA 5NUCA 3A8IE 3AB9A 1VQLA 4A3DB 2HIVA 4C3JG 3L7ZC 4WRDA 1I94Q 4BY7B 2OEOA 5M3FG 2LKVA 3NUCA 3NSWA 2Z1CA 2A6HC 4AYBE 2CH4W 1F9QA 3Q6SA 1I4XA 1LLRD 1IBKL 4DR6L 4MIUA 2EXDA 2EQSA 1TIID 5IIFA 1WTHA 3GTGH 2Z4IA 3GTJH 2ZJRA 2SOBA 1U4RA 2PQAB 4EQ5A 2XNAC 5TSSA 3T16A 5IOCA 1PV4A 1JE5A 3TS0A 1PH9A 1EYAA 5CMDA 1OTCA 3HOWB 3OIQA 3RNUA 2HHHQ 4KN7C 2AQ2B 5KYLA 1HNXQ 1A3UA 4IUQA 1A3VA 3J81j 4NDXA 4UAIA 3S14H 3PF4A 3S15B 4IJLA 4O2DA 4DR7Q 3I4NG 1LYLA 3H3VH 2K33A 1B7YB 5IP9G 1OXXK 3ONAB 5I2YA 1J8IA 2A74C 1N9WA 2ZXRA 1CKMA 3J81i 4C1NI 1YITA 1PYSB 3UDIA 4YCVA 1MHWC 5A35A 3RZOB 2LMCB 3DM3A 1NAPA 3W1GA 4YHHQ 3CCRA 1DYQA 4A3MH 3M4OB 2Z8LA 3CAMA 3ULPA 2AUJD 1IBMQ 4RMFA 2MQHA 5GQOA 1Q7YC 2RCFA 4UDUC 3AQQA 3TS2A 3WOFA 2UXDQ 2C9OA 4XIGS 5C3EG 3BYTB 1QWYA 3RLFA 1Y1VH 3HOVG 1BF4A 1U5KA 1SXTA 4POGA 2F0HA 4AQYQ 2QEXA 4A3CG 4DFAA 3J81L 5EBDA 4HIMA 1BBUA 1VQ4A 2B2TC 1JMCA 4IUVA 3PUZA 4LUVA 5FLXc 1RJTA 2PI2E 3U50C 3SGIA 1PFNA 4OGQC 1C7YA 2XIWA 3S17H 4JBJA 4P74A 3GTGB 3GTJB 3RD4A 1X56A 2JE6I 3HS0C 3QJYA 4R9WA 1IL8A 1Y8PB 2N78A 4B3SQ 1D5ZC 3P20A 3S1RH 3NK9A 2F3WA 2KEDA 3SE0A 5DM63 3DUZA 4HJ5A 5D14A 4BXXG 1HUMA 3S14B 1CKNB 3PIOA 4HJAA 4L5SA 1O7YA 1FGUA 4B3TQ 4QGUA 3CCSA 4Q5VA 4C2MH 1VQJA 2KCNA 2OXPA 4C3IH 4ZK9B 3K5NA 2UUAQ 1K8GA 4R4TA 1AZPA 2R92H 4WJ3M 2L12A 4Q0FA 4KHPQ 4A3MB 1QE6A 1EQRA
chains in the Genus database with same CATH topology
2PQAA 4R4CA 1BBWA 2UXCQ 3G4SA 2JA6H 4KHPL 1YVCA 4PZ7A 1CUKA 1HZCA 4UP9A 3ZJYC 2UXCL 1PH4A 4IFDG 1WJJA 3H0GG 2UUBL 1C0AA 4BBSG 1Q82C 1KL9A 1I5FA 3A0JA 1NBWA 5GADC 1VS0A 5ELNA 3T1HQ 1N32Q 2IHFA 2ATWA 3S1MH 4GKKQ 1Y1VG 3NBHB 4A3JG 4P75A 1L1OC 1YJ9A 4JG2A 3PV0A 3T1HL 4GKKL 1E22A 5IYCH 2KCMA 1PA6A 4GN5A 3RN5A 1YJWA 1NMFA 3AFPA 3S16H 1PHJA 3F1ZA 2HHHL 2YV5A 4JC0A 3M85A 4NXNQ 3KLWA 2NVTH 1PH5A 4JI1Q 4LWCA 2JJQA 1R9TH 4DR7L 2KHJA 2RHSB 4NXNL 2JK8A 1L0WA 3OTOQ 3UDFA 1J5EL 4LF7Q 2GVAA 4POFA 1FJGL 1E24A 3GTLH 1XTDA 2CWAA 2K5HA 1VQIA 4H02A 4A3LG 2MO0A 4UP7A 4DV1Q 1PYBA 2B3GA 2F52A 3W1BA 1L2FA 4A4IA 4LF7L 4PG3A 1VQBA 4P72A 1ASYA 3CC4A 2CCZA 2E8GA 5GAEC 1YHAA 3E9IA 4OXPA 1HH2P 4X65Q 4JI3Q 2RF4A 1CSQA 1I6HH 2ASBA 2E5LQ 4L5QA 4A75A 1YNXA 1XMQL 2NVQH 2CFMA 1VQ9A 2LXKA 3HKSA 4AIMA 4DV0Q 2UU9L 2OQ0A 3EN2A 4DR4L 1WCMG 4YY3Q 4JI6Q 3GTOH 2GN5A 1OXUA 3NEMA 4DV0L 2JA7H 1A8VA 3H0GH 1VQPA 2E2IH 1PFSA 4BA1I 3CC7A 4A3EG 4DK3C 4YY3L 2Q2IA 2DUDA 2Z6KA 3ICEA 3K8AA 1GO3E 1MKHA 4OWWB 2VS1A 3ULLA 3A5UA 3I56A 5AJ3Q 1GM5A 2NVXH 4IFDI 2QGQA 2PI2A 3U4VA 5IT9c 3STBC 1ASZA 3FKIG 5M5XH 4GOPB 4BXXH 3W5OA 2JA8H 1QUQA 5AJ3L 3KJOA 4UY8C 4A3BH 3HOZH 4JI0L 1A63A 1GD7A 1RIPA 5J3BA 1DGSA 2AWOA 1J6QA 5H1SE 4YCWA 1SLJA 1Q86C 1EIYB 1G51A 1N33Q 4L5RC 2R92G 4AQYL 1X55A 2MO1A 1XNRQ 1VQCA 4PZ6A 2OQKA 1V1QA 2MNAA 4GNXB 1B70B 1N33L 1GKHA 3T1YQ 1XNRL 2JA6G 4OO1G 1S3OA 1Q8KA 3E0EA 1UEBA 2K75A 3TQYA 1HZ9A 3S14H 1U0LA 2D0PA 4GLXA 5C44H 4JI2Q 2ZTDA 3T1YL 3U4ZA 1JJGA 1IBLQ 1M90C 5IE8A 3CMAA 4MNOA 4GN4B 3VDYA 3PF5A 4JI2L 4LF8Q 1CKNA 1KAWA 2UXBQ 1QZGA 4LF8L 3PUVA 4DUZL 5IYCG 4OWTB 1EQRA 2VL6A 4HIKA 2EIFA 1X6OA 4IO9A 2OTLA 4LF9Q 4QIWE 4BBRH 5GROA 1WCMH 4DKAC 2PMZE 1KD1C 2KCTA 2NN6G 3NENA 2VQFL 4UPAA 2WAQG 4A3EH 3K7UC 4ALPA 4KI0A 3L2PA 5LMNQ 3TREA 1Q81C 1W3SA 4JOIA 3CPFA 2GVBA 3D31A 3GDEA 1KQSA 1AE2A 4JI7Q 1K83H 4A3GH 5C4XG 3M7NA 1I50H 4JYAQ 5LMNL 3KDFB 3F2BA 4IPGA 2K14A 3I4MH 2IX0A 3FKIH 4JI7L 4B3RL 2PNHA 3CCUA 1UE1A 1L1OA 4JYAL 2I5HA 2ES2A 2R7FA 3JAMi 3GTMH 2I5MX 4JBWA 2IHEA 5LMUQ 1VQAA 2I0QA 2UUAL 1W2BA 3PO2H 4LF6Q 3FHWA 3M9BA 3PSIA 3E9HA 3HOUH 1UE6A 4DV7Q 3S1QH 4JI8L 3GTQH 4K0KL 1QVCA 3RLOA 5C4JH 5HY6A 1L1OB 5LMNW 1VQOA 4DUYQ 2N49A 4IPCA 4GLAC 2JA7G 1BKBA 3I4OA 1YIJA 2K50A 1O7IA 4Y7NH 3PGZA 4OO1I 5GAHC 3CP0A 4R1JA 4A93H 5M3MH 1WOCA 5FJ8G 1X9NA 1JJCB 3KF6A 4O0AA 1FL0A 1EIFA 4NB3A 4YWMA 4NXMQ 2N3SA 1N32L 1IBKQ 4KHZA 4DR6Q 4HJ7A 1VQHA 2JA8G 3K81C 3CF5A 3HOZG 1TWFH 1VQGA 4NXML 1YZ6A 1FVIA 3TEHB 3UE1A 1XNQQ 2R6GA 1XJVA 2AKWB 1XMOQ 4X64Q 2K5NA 4DAMA 1JJ2A 1X65A 3KF6B 2DGYA 2E2JH 4QQBX 1XNQL 4IPDA 4GS3A 3UDGA 1PVOA 1XMOL 4JBMA 2BH2A 3ERSX 2WB1G 3HKZG 4JI1L 1UWVA 3HOYH 5C4XH 5C44G 3OTOL 4LFAQ 4DR3Q 4LFCQ 4JV5Q 3UDXA 5DLQE 2NN6I 1NE3A 4OX9Q 1E3PA 2R7ZH 3HKZE 2WB1E 3G71A 4DV1L 4JBKA 4LFCL 2OWOA 4IFDJ 5IP7H 1BVSA 1SN8A 2F4VQ 1IL2A 1YHBA 5JJKA 3GD7A 3M4PA 1TWCH 5M5WH 4IOCA 3PCOB 3RZDH 5C0XG 1K9MC 4X65L 4JI3L 2F4VL 3K7AH 1WI5A 4IPHA 5JEAG 4DV6Q 1MJCA 2E5LL 3B6YA 4BBRG 4LFBQ 1XPRA 4GOPA 2YYZA 3U58A 3K0XA 4DV6L 2BA1A 1N36Q 2V1CC 3KJPA 1NTGA 1X3FA 3S24A 4LFBL 4KLKA 4JI5Q 4HIOA 1HJPA 1CSPA 3CCVA 1OXSC 2JA5G 2QA4A 4JI6L 2IX1A 4A3DH 3J81c 3EIVA 5FJ8H 4C3JH 1WYDA 4A3GG 3STBD 4GNXA 1K8AC 2KENA 2YTXA 3AEVA 3I4MG 4TQUS 1MIUA 1VQEA 1QZHA 3LGJA 5FLMH 2VQEQ 4GKJQ 3EBEA 1HR0Q 2R93H 3ER0A 3HFZB 4X6AH 2D62A 1S72A 2MFIA 2HIXA 3KYHC 4GKJL 2LSSA 1HR0L 1G6PA 2VY3A 4DV4Q 1SR3A 3CCMA 5GAGC 4JI4Q 5E7NA 3CCEA 3PO2G 3A74A 5BR8Q 3HOXH 1UE5A 1E7ZA 3HOUG 4DV4L 5BR8L 2VUMG 2A8VA 1Y14B 2A19A 2CKZB 5C0XJ 1X54A 5JEAJ 3MXNB 1VQ6A 2ID0A 3HOWH 2AHOB 1VQ7A 2JQOA 4A93G 5M3MG 2OCEA 3AFQA 3I7FA 1EYGA 4B3MQ 3J80c 1IBLL 1KIXA 1HR0W 3S15H 2OTJA 1A0IA 4A3FH 2B63H 2K4KA 2VNUD 5HGQA 1E1TA 1G291 4FDBA 2YU9H 5IP9H 2UXBL 2K5VA 3CCQA 2KHIA 3S2HH 3S1NH 1T9HA 3CD6A 3KDFA 4DV5Q 4LW1A 1XPUA 3FP9A 1JB7A 2BH8A 5C0XI 1X3GA 2WP8J 3Q8DA 3F2DA 4LF9L 1LTLA 1KC8C 3A5ZB 4DV5L 4DAYB 2ZJPA 4DNIA 1PH6A 4HJ8A 2JA5H 3PF4A 2FXQA 5JJLA 4BA2I 1KRSA 2ZM6Q 3OYYA 3HOYG 3OW2A 3RZOH 2YTVA 5IYBG 4DR7Q 1AE3A 1PH7A 2A1AA 1I3QH 3GTKH 1EQQA 1VQMA 3PO3H 2R7ZG 3ULJA 5JJIA 4R4QA 3PIPA 3D0FA 5IP7G 4Y52H 3TRZA 1SROA 2JA9A 2LXJA 2NZOA 3J7ZC 1PH8A 4A3BG 4UP8A 3I2ZA 1A62A 1Q12A 1HNWQ 2C35B 1VQ5A 1E1OA 5LMUL 1VQFA 4DR2Q 1B8AA 1KXLA 2BA0A 4LF6L 1HNWL 2VZAA 3BZKA 2VUMH 4X66Q 3PUYA 5C3EH 4GLVB 4YWLA 4DR2L 4DV7L 1V9PA 4DR1Q 1N34Q 1HZAA 2ZTEA 3MEFA 3HOVH 1S40A 1VCIA 3UE0A 1VQLA 2E2HH 2JEAI 4A3DG 4DUYL 3PUXA 4DR1L 1D8LA 2XTIA 4BY7G 2HIVA 2YTYA 3L7ZC 1I94Q 4J15A 5M3FG 1YJNA 4A3CH 1YI2A 1EWIA 3L0OA 3IRBA 4AYBE 5FLMG 2WFWA 2R93G 3NELA 1TWGH 1SE8A 2D0OA 1Q1BA 3WWVA 1EUJA 3CPWA 4HJ9A 1IBKL 4DR6L 1Y1WH 1CKOA 2UUBQ 3CMEA 4OWXB 2EXDA 3RR5A 2EQSA 3CQZH 3HOXG 1SMXA 4X62Q 4DV3Q 2HQLA 1QVGA 4JOIC 3PUWA 3GTGH 2Q2HA 4X64L 3GTJH 2ZJRA 4BY1H 2IY5B 1EOVA 3KOJA 5IYDG 3BZCA 4X62L 4DV3L 1JT8A 2PQAB 4EQ5A 5IYBH 5IWAQ 2Z0SA 2Y0SG 4YCUA 1PV4A 1JE5A 3TS0A 1PH9A 3HOWG 1VQKA 1RL2A 2UUCQ 1OTCA 3GTPH 4A76A 3RNUA 5IWAL 1HNXQ 2HHHQ 4DR3L 4LFAL 4JV5L 2Y0SE 4OX9L 2UUCL 4A3FG 1C9OA 1UE7A 3J81j 2B63G 2L15A 2H5XA 1HNXL 4LF4Q 4IJLA 1SRUA 4O2DA 4DPGA 1LYLA 1YBYA 1J5EQ 4A3KH 1VQ8A 3H3VH 1YHQA 1B7YB 1FJGQ 5IP9G 1OXXK 2K52A 5K36G 4LF4L 1XPOA 1NY4A 4LNQA 1MJEA 4YWKA 2KBNA 1KRTA 3H3VI 1N9WA 1TXYA 1CKMA 3J81i 1YITA 1PYSB 2CWPA 4XTCS 4QL5A 2Q2UA 3UDIA 4YCVA 1TWAH 1Q1EA 5M5YH 1N36L 2RCNA 4BY7H 4P73A 1NJIC 2N8NA 4JI5L 5M3FH 1XMQQ 3CW2C 3CXCA 3DM3A 3W1GA 4YHHQ 1HZBA 3CCRA 4A3IG 3PO3G 4A3MH 3BU2A 2ALYB 1K3RA 3CAMA 3DLLA 3ULPA 1K0RA 2UU9Q 5ELOA 4DV2Q 4YHHL 4DR4Q 3I55A 1AH9A 4LF5Q 2VQEL 1QVFA 1IBMQ 4RMFA 3F2CA 4DV2L 3GO5A 1LM0A 2MQHA 2R7DA 4LF5L 5GQOA 4MZ9A 1Q7YC 1IBML 1P8LA 3AQQA 3RLNA 5IY0A 3TS2A 2ZJQA 4JI4L 1K73C 4PMWA 4BBSH 2UXDQ 4P71A 3BJUA 1VQNA 4PZ8A 3G48A 2ZTCA 2XGTA 4XIGS 5C3EG 5IYDH 3RLFA 1Y1VH 4DK6C 2F3IA 3RN2A 4A3JH 1PH3A 4JI0Q 3HOVG 2UXDL 1U5KA 3J80i 4ME3A 4C3HH 1WFQA 3JC66 4POGA 1P16A 5EAYA 4AQYQ 2VW9A 1GVPA 3KF8B 3CC2A 1N8RC 3CCLA 1HNZQ 4R4IA 2QEXA 4A3CG 4B3ML 4HIMA 4LUZA 1BBUA 1VQ4A 3I4NH 1IXRA 1HNZL 1X3EA 2AMCB 4GOPC 1LUZA 1JMCA 3KFUA 1EFWA 1Y1WG 3PUZA 4LUVA 5FLXc 2CQOA 1NMGA 1V43A 1SFOH 1QUQB 2PI2E 1Q46A 1M1KC 4A3LH 1OXTA 4OONA 3SGIA 3M4QA 2Z6KC 3U50C 2HT1A 4QJFA 3K80C 1C7YA 4EX5A 4BY1G 4JBJA 4GNXC 4P74A 3S17H 4IOAA 3F8TA 3H15A 1X56A 4DUZQ 3AYHB 2JE6I 1OXVA 4A3IH 3M4OH 1IZ6A 4R4OA 2ZM6L 4NPSA 3J7A5 4APVA 2N78A 4RG1A 4AH6A 4B3SQ 3M3YH 3S2DH 1KHIA 4GN3B 4JCVE 3S1RH 2I5LX 4L5TA 4LUOA 1Z9FA 4HJ5A 4B3SL 4BXXG 2VQFQ 4A3KG 2B29A 1CKNB 4IJHA 1PH2A 3PIOA 4DR5Q 4HIDA 2AWNA 4HJAA 1PH1A 4L5SA 1FGUA 4WJ4A 4B3TQ 1VQDA 4QGUA 3CCSA 2NZHA 4DR5L 4B3RQ 4C2MH 1VQJA 2RHQB 1IYJB 1TWHH 4B3TL 2WAQE 4X66L 1D7QA 4AYBG 4C3IH 2Q2TA 1N34L 4TVAB 3I4NG 1H95A 2UUAQ 1K8GA 4MTNA 1Z47A 4R4TA 4QY7A 2IT1A 2NVYH 3CCJA 2R92H 2JEBI 4A3MG 4WJ3M 3JAMc 4JI8Q 4K0KQ 1I94L 3G6EA 4KHPQ 1YEZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PQA A;  4R4C A;  1BBW A;  2UXC Q;  3G4S A;  2JA6 H;  4KHP L;  1YVC A;  4PZ7 A;  1CUK A;  1HZC A;  4UP9 A;  3ZJY C;  2UXC L;  1PH4 A;  4IFD G;  1WJJ A;  3H0G G;  2UUB L;  1C0A A;  4BBS G;  1Q82 C;  1KL9 A;  1I5F A;  3A0J A;  1NBW A;  5GAD C;  1VS0 A;  5ELN A;  3T1H Q;  1N32 Q;  2IHF A;  2ATW A;  3S1M H;  4GKK Q;  1Y1V G;  3NBH B;  4A3J G;  4P75 A;  1L1O C;  1YJ9 A;  4JG2 A;  3PV0 A;  3T1H L;  4GKK L;  1E22 A;  5IYC H;  2KCM A;  1PA6 A;  4GN5 A;  3RN5 A;  1YJW A;  1NMF A;  3AFP A;  3S16 H;  1PHJ A;  3F1Z A;  2HHH L;  2YV5 A;  4JC0 A;  3M85 A;  4NXN Q;  3KLW A;  2NVT H;  1PH5 A;  4JI1 Q;  4LWC A;  2JJQ A;  1R9T H;  4DR7 L;  2KHJ A;  2RHS B;  4NXN L;  2JK8 A;  1L0W A;  3OTO Q;  3UDF A;  1J5E L;  4LF7 Q;  2GVA A;  4POF A;  1FJG L;  1E24 A;  3GTL H;  1XTD A;  2CWA A;  2K5H A;  1VQI A;  4H02 A;  4A3L G;  2MO0 A;  4UP7 A;  4DV1 Q;  1PYB A;  2B3G A;  2F52 A;  3W1B A;  1L2F A;  4A4I A;  4LF7 L;  4PG3 A;  1VQB A;  4P72 A;  1ASY A;  3CC4 A;  2CCZ A;  2E8G A;  5GAE C;  1YHA A;  3E9I A;  4OXP A;  1HH2 P;  4X65 Q;  4JI3 Q;  2RF4 A;  1CSQ A;  1I6H H;  2ASB A;  2E5L Q;  4L5Q A;  4A75 A;  1YNX A;  1XMQ L;  2NVQ H;  2CFM A;  1VQ9 A;  2LXK A;  3HKS A;  4AIM A;  4DV0 Q;  2UU9 L;  2OQ0 A;  3EN2 A;  4DR4 L;  1WCM G;  4YY3 Q;  4JI6 Q;  3GTO H;  2GN5 A;  1OXU A;  3NEM A;  4DV0 L;  2JA7 H;  1A8V A;  3H0G H;  1VQP A;  2E2I H;  1PFS A;  4BA1 I;  3CC7 A;  4A3E G;  4DK3 C;  4YY3 L;  2Q2I A;  2DUD A;  2Z6K A;  3ICE A;  3K8A A;  1GO3 E;  1MKH A;  4OWW B;  2VS1 A;  3ULL A;  3A5U A;  3I56 A;  5AJ3 Q;  1GM5 A;  2NVX H;  4IFD I;  2QGQ A;  2PI2 A;  3U4V A;  5IT9 c;  3STB C;  1ASZ A;  3FKI G;  5M5X H;  4GOP B;  4BXX H;  3W5O A;  2JA8 H;  1QUQ A;  5AJ3 L;  3KJO A;  4UY8 C;  4A3B H;  3HOZ H;  4JI0 L;  1A63 A;  1GD7 A;  1RIP A;  5J3B A;  1DGS A;  2AWO A;  1J6Q A;  5H1S E;  4YCW A;  1SLJ A;  1Q86 C;  1EIY B;  1G51 A;  1N33 Q;  4L5R C;  2R92 G;  4AQY L;  1X55 A;  2MO1 A;  1XNR Q;  1VQC A;  4PZ6 A;  2OQK A;  1V1Q A;  2MNA A;  4GNX B;  1B70 B;  1N33 L;  1GKH A;  3T1Y Q;  1XNR L;  2JA6 G;  4OO1 G;  1S3O A;  1Q8K A;  3E0E A;  1UEB A;  2K75 A;  3TQY A;  1HZ9 A;  3S14 H;  1U0L A;  2D0P A;  4GLX A;  5C44 H;  4JI2 Q;  2ZTD A;  3T1Y L;  3U4Z A;  1JJG A;  1IBL Q;  1M90 C;  5IE8 A;  3CMA A;  4MNO A;  4GN4 B;  3VDY A;  3PF5 A;  4JI2 L;  4LF8 Q;  1CKN A;  1KAW A;  2UXB Q;  1QZG A;  4LF8 L;  3PUV A;  4DUZ L;  5IYC G;  4OWT B;  1EQR A;  2VL6 A;  4HIK A;  2EIF A;  1X6O A;  4IO9 A;  2OTL A;  4LF9 Q;  4QIW E;  4BBR H;  5GRO A;  1WCM H;  4DKA C;  2PMZ E;  1KD1 C;  2KCT A;  2NN6 G;  3NEN A;  2VQF L;  4UPA A;  2WAQ G;  4A3E H;  3K7U C;  4ALP A;  4KI0 A;  3L2P A;  5LMN Q;  3TRE A;  1Q81 C;  1W3S A;  4JOI A;  3CPF A;  2GVB A;  3D31 A;  3GDE A;  1KQS A;  1AE2 A;  4JI7 Q;  1K83 H;  4A3G H;  5C4X G;  3M7N A;  1I50 H;  4JYA Q;  5LMN L;  3KDF B;  3F2B A;  4IPG A;  2K14 A;  3I4M H;  2IX0 A;  3FKI H;  4JI7 L;  4B3R L;  2PNH A;  3CCU A;  1UE1 A;  1L1O A;  4JYA L;  2I5H A;  2ES2 A;  2R7F A;  3JAM i;  3GTM H;  2I5M X;  4JBW A;  2IHE A;  5LMU Q;  1VQA A;  2I0Q A;  2UUA L;  1W2B A;  3PO2 H;  4LF6 Q;  3FHW A;  3M9B A;  3PSI A;  3E9H A;  3HOU H;  1UE6 A;  4DV7 Q;  3S1Q H;  4JI8 L;  3GTQ H;  4K0K L;  1QVC A;  3RLO A;  5C4J H;  5HY6 A;  1L1O B;  5LMN W;  1VQO A;  4DUY Q;  2N49 A;  4IPC A;  4GLA C;  2JA7 G;  1BKB A;  3I4O A;  1YIJ A;  2K50 A;  1O7I A;  4Y7N H;  3PGZ A;  4OO1 I;  5GAH C;  3CP0 A;  4R1J A;  4A93 H;  5M3M H;  1WOC A;  5FJ8 G;  1X9N A;  1JJC B;  3KF6 A;  4O0A A;  1FL0 A;  1EIF A;  4NB3 A;  4YWM A;  4NXM Q;  2N3S A;  1N32 L;  1IBK Q;  4KHZ A;  4DR6 Q;  4HJ7 A;  1VQH A;  2JA8 G;  3K81 C;  3CF5 A;  3HOZ G;  1TWF H;  1VQG A;  4NXM L;  1YZ6 A;  1FVI A;  3TEH B;  3UE1 A;  1XNQ Q;  2R6G A;  1XJV A;  2AKW B;  1XMO Q;  4X64 Q;  2K5N A;  4DAM A;  1JJ2 A;  1X65 A;  3KF6 B;  2DGY A;  2E2J H;  4QQB X;  1XNQ L;  4IPD A;  4GS3 A;  3UDG A;  1PVO A;  1XMO L;  4JBM A;  2BH2 A;  3ERS X;  2WB1 G;  3HKZ G;  4JI1 L;  1UWV A;  3HOY H;  5C4X H;  5C44 G;  3OTO L;  4LFA Q;  4DR3 Q;  4LFC Q;  4JV5 Q;  3UDX A;  5DLQ E;  2NN6 I;  1NE3 A;  4OX9 Q;  1E3P A;  2R7Z H;  3HKZ E;  2WB1 E;  3G71 A;  4DV1 L;  4JBK A;  4LFC L;  2OWO A;  4IFD J;  5IP7 H;  1BVS A;  1SN8 A;  2F4V Q;  1IL2 A;  1YHB A;  5JJK A;  3GD7 A;  3M4P A;  1TWC H;  5M5W H;  4IOC A;  3PCO B;  3RZD H;  5C0X G;  1K9M C;  4X65 L;  4JI3 L;  2F4V L;  3K7A H;  1WI5 A;  4IPH A;  5JEA G;  4DV6 Q;  1MJC A;  2E5L L;  3B6Y A;  4BBR G;  4LFB Q;  1XPR A;  4GOP A;  2YYZ A;  3U58 A;  3K0X A;  4DV6 L;  2BA1 A;  1N36 Q;  2V1C C;  3KJP A;  1NTG A;  1X3F A;  3S24 A;  4LFB L;  4KLK A;  4JI5 Q;  4HIO A;  1HJP A;  1CSP A;  3CCV A;  1OXS C;  2JA5 G;  2QA4 A;  4JI6 L;  2IX1 A;  4A3D H;  3J81 c;  3EIV A;  5FJ8 H;  4C3J H;  1WYD A;  4A3G G;  3STB D;  4GNX A;  1K8A C;  2KEN A;  2YTX A;  3AEV A;  3I4M G;  4TQU S;  1MIU A;  1VQE A;  1QZH A;  3LGJ A;  5FLM H;  2VQE Q;  4GKJ Q;  3EBE A;  1HR0 Q;  2R93 H;  3ER0 A;  3HFZ B;  4X6A H;  2D62 A;  1S72 A;  2MFI A;  2HIX A;  3KYH C;  4GKJ L;  2LSS A;  1HR0 L;  1G6P A;  2VY3 A;  4DV4 Q;  1SR3 A;  3CCM A;  5GAG C;  4JI4 Q;  5E7N A;  3CCE A;  3PO2 G;  3A74 A;  5BR8 Q;  3HOX H;  1UE5 A;  1E7Z A;  3HOU G;  4DV4 L;  5BR8 L;  2VUM G;  2A8V A;  1Y14 B;  2A19 A;  2CKZ B;  5C0X J;  1X54 A;  5JEA J;  3MXN B;  1VQ6 A;  2ID0 A;  3HOW H;  2AHO B;  1VQ7 A;  2JQO A;  4A93 G;  5M3M G;  2OCE A;  3AFQ A;  3I7F A;  1EYG A;  4B3M Q;  3J80 c;  1IBL L;  1KIX A;  1HR0 W;  3S15 H;  2OTJ A;  1A0I A;  4A3F H;  2B63 H;  2K4K A;  2VNU D;  5HGQ A;  1E1T A;  1G29 1;  4FDB A;  2YU9 H;  5IP9 H;  2UXB L;  2K5V A;  3CCQ A;  2KHI A;  3S2H H;  3S1N H;  1T9H A;  3CD6 A;  3KDF A;  4DV5 Q;  4LW1 A;  1XPU A;  3FP9 A;  1JB7 A;  2BH8 A;  5C0X I;  1X3G A;  2WP8 J;  3Q8D A;  3F2D A;  4LF9 L;  1LTL A;  1KC8 C;  3A5Z B;  4DV5 L;  4DAY B;  2ZJP A;  4DNI A;  1PH6 A;  4HJ8 A;  2JA5 H;  3PF4 A;  2FXQ A;  5JJL A;  4BA2 I;  1KRS A;  2ZM6 Q;  3OYY A;  3HOY G;  3OW2 A;  3RZO H;  2YTV A;  5IYB G;  4DR7 Q;  1AE3 A;  1PH7 A;  2A1A A;  1I3Q H;  3GTK H;  1EQQ A;  1VQM A;  3PO3 H;  2R7Z G;  3ULJ A;  5JJI A;  4R4Q A;  3PIP A;  3D0F A;  5IP7 G;  4Y52 H;  3TRZ A;  1SRO A;  2JA9 A;  2LXJ A;  2NZO A;  3J7Z C;  1PH8 A;  4A3B G;  4UP8 A;  3I2Z A;  1A62 A;  1Q12 A;  1HNW Q;  2C35 B;  1VQ5 A;  1E1O A;  5LMU L;  1VQF A;  4DR2 Q;  1B8A A;  1KXL A;  2BA0 A;  4LF6 L;  1HNW L;  2VZA A;  3BZK A;  2VUM H;  4X66 Q;  3PUY A;  5C3E H;  4GLV B;  4YWL A;  4DR2 L;  4DV7 L;  1V9P A;  4DR1 Q;  1N34 Q;  1HZA A;  2ZTE A;  3MEF A;  3HOV H;  1S40 A;  1VCI A;  3UE0 A;  1VQL A;  2E2H H;  2JEA I;  4A3D G;  4DUY L;  3PUX A;  4DR1 L;  1D8L A;  2XTI A;  4BY7 G;  2HIV A;  2YTY A;  3L7Z C;  1I94 Q;  4J15 A;  5M3F G;  1YJN A;  4A3C H;  1YI2 A;  1EWI A;  3L0O A;  3IRB A;  4AYB E;  5FLM G;  2WFW A;  2R93 G;  3NEL A;  1TWG H;  1SE8 A;  2D0O A;  1Q1B A;  3WWV A;  1EUJ A;  3CPW A;  4HJ9 A;  1IBK L;  4DR6 L;  1Y1W H;  1CKO A;  2UUB Q;  3CME A;  4OWX B;  2EXD A;  3RR5 A;  2EQS A;  3CQZ H;  3HOX G;  1SMX A;  4X62 Q;  4DV3 Q;  2HQL A;  1QVG A;  4JOI C;  3PUW A;  3GTG H;  2Q2H A;  4X64 L;  3GTJ H;  2ZJR A;  4BY1 H;  2IY5 B;  1EOV A;  3KOJ A;  5IYD G;  3BZC A;  4X62 L;  4DV3 L;  1JT8 A;  2PQA B;  4EQ5 A;  5IYB H;  5IWA Q;  2Z0S A;  2Y0S G;  4YCU A;  1PV4 A;  1JE5 A;  3TS0 A;  1PH9 A;  3HOW G;  1VQK A;  1RL2 A;  2UUC Q;  1OTC A;  3GTP H;  4A76 A;  3RNU A;  5IWA L;  1HNX Q;  2HHH Q;  4DR3 L;  4LFA L;  4JV5 L;  2Y0S E;  4OX9 L;  2UUC L;  4A3F G;  1C9O A;  1UE7 A;  3J81 j;  2B63 G;  2L15 A;  2H5X A;  1HNX L;  4LF4 Q;  4IJL A;  1SRU A;  4O2D A;  4DPG A;  1LYL A;  1YBY A;  1J5E Q;  4A3K H;  1VQ8 A;  3H3V H;  1YHQ A;  1B7Y B;  1FJG Q;  5IP9 G;  1OXX K;  2K52 A;  5K36 G;  4LF4 L;  1XPO A;  1NY4 A;  4LNQ A;  1MJE A;  4YWK A;  2KBN A;  1KRT A;  3H3V I;  1N9W A;  1TXY A;  1CKM A;  3J81 i;  1YIT A;  1PYS B;  2CWP A;  4XTC S;  4QL5 A;  2Q2U A;  3UDI A;  4YCV A;  1TWA H;  1Q1E A;  5M5Y H;  1N36 L;  2RCN A;  4BY7 H;  4P73 A;  1NJI C;  2N8N A;  4JI5 L;  5M3F H;  1XMQ Q;  3CW2 C;  3CXC A;  3DM3 A;  3W1G A;  4YHH Q;  1HZB A;  3CCR A;  4A3I G;  3PO3 G;  4A3M H;  3BU2 A;  2ALY B;  1K3R A;  3CAM A;  3DLL A;  3ULP A;  1K0R A;  2UU9 Q;  5ELO A;  4DV2 Q;  4YHH L;  4DR4 Q;  3I55 A;  1AH9 A;  4LF5 Q;  2VQE L;  1QVF A;  1IBM Q;  4RMF A;  3F2C A;  4DV2 L;  3GO5 A;  1LM0 A;  2MQH A;  2R7D A;  4LF5 L;  5GQO A;  4MZ9 A;  1Q7Y C;  1IBM L;  1P8L A;  3AQQ A;  3RLN A;  5IY0 A;  3TS2 A;  2ZJQ A;  4JI4 L;  1K73 C;  4PMW A;  4BBS H;  2UXD Q;  4P71 A;  3BJU A;  1VQN A;  4PZ8 A;  3G48 A;  2ZTC A;  2XGT A;  4XIG S;  5C3E G;  5IYD H;  3RLF A;  1Y1V H;  4DK6 C;  2F3I A;  3RN2 A;  4A3J H;  1PH3 A;  4JI0 Q;  3HOV G;  2UXD L;  1U5K A;  3J80 i;  4ME3 A;  4C3H H;  1WFQ A;  3JC6 6;  4POG A;  1P16 A;  5EAY A;  4AQY Q;  2VW9 A;  1GVP A;  3KF8 B;  3CC2 A;  1N8R C;  3CCL A;  1HNZ Q;  4R4I A;  2QEX A;  4A3C G;  4B3M L;  4HIM A;  4LUZ A;  1BBU A;  1VQ4 A;  3I4N H;  1IXR A;  1HNZ L;  1X3E A;  2AMC B;  4GOP C;  1LUZ A;  1JMC A;  3KFU A;  1EFW A;  1Y1W G;  3PUZ A;  4LUV A;  5FLX c;  2CQO A;  1NMG A;  1V43 A;  1SFO H;  1QUQ B;  2PI2 E;  1Q46 A;  1M1K C;  4A3L H;  1OXT A;  4OON A;  3SGI A;  3M4Q A;  2Z6K C;  3U50 C;  2HT1 A;  4QJF A;  3K80 C;  1C7Y A;  4EX5 A;  4BY1 G;  4JBJ A;  4GNX C;  4P74 A;  3S17 H;  4IOA A;  3F8T A;  3H15 A;  1X56 A;  4DUZ Q;  3AYH B;  2JE6 I;  1OXV A;  4A3I H;  3M4O H;  1IZ6 A;  4R4O A;  2ZM6 L;  4NPS A;  3J7A 5;  4APV A;  2N78 A;  4RG1 A;  4AH6 A;  4B3S Q;  3M3Y H;  3S2D H;  1KHI A;  4GN3 B;  4JCV E;  3S1R H;  2I5L X;  4L5T A;  4LUO A;  1Z9F A;  4HJ5 A;  4B3S L;  4BXX G;  2VQF Q;  4A3K G;  2B29 A;  1CKN B;  4IJH A;  1PH2 A;  3PIO A;  4DR5 Q;  4HID A;  2AWN A;  4HJA A;  1PH1 A;  4L5S A;  1FGU A;  4WJ4 A;  4B3T Q;  1VQD A;  4QGU A;  3CCS A;  2NZH A;  4DR5 L;  4B3R Q;  4C2M H;  1VQJ A;  2RHQ B;  1IYJ B;  1TWH H;  4B3T L;  2WAQ E;  4X66 L;  1D7Q A;  4AYB G;  4C3I H;  2Q2T A;  1N34 L;  4TVA B;  3I4N G;  1H95 A;  2UUA Q;  1K8G A;  4MTN A;  1Z47 A;  4R4T A;  4QY7 A;  2IT1 A;  2NVY H;  3CCJ A;  2R92 H;  2JEB I;  4A3M G;  4WJ3 M;  3JAM c;  4JI8 Q;  4K0K Q;  1I94 L;  3G6E A;  4KHP Q;  1YEZ A; 
#chains in the Genus database with same CATH topology
 1SNC A;  3OWF A;  3G4S A;  4I65 A;  2L5T A;  1SND A;  1CUK A;  4XQN A;  1HZC A;  4UP9 A;  2F0J A;  5KRU A;  2UXC L;  4CBV A;  2UUB L;  2B8G A;  4P2C B;  1KL9 A;  1NBW A;  1N32 Q;  1JOK A;  2IHF A;  1RHP A;  3NXW A;  2ENB A;  1JB3 A;  2VB3 X;  1Y1V B;  3N6R A;  2L4N A;  1TS4 A;  3P75 A;  1E22 A;  3FDT A;  3I72 A;  5IYC H;  3RN5 A;  1NMF A;  4K5X A;  2H1E A;  3NPP A;  1SMY D;  2NVT H;  1SSO A;  2DNC A;  4ZKB B;  2KHJ A;  2RHS B;  1CZW A;  2I07 B;  4NXN L;  4POF A;  1E24 A;  4H13 C;  1VQI A;  4DV1 Q;  4X3S A;  1LTB D;  3VA5 A;  1BO0 A;  2F0W A;  3W1B A;  2RBM A;  1ASY A;  4K6D A;  3S17 B;  4XT1 B;  4OXP A;  2B2V A;  2E5L Q;  1RTN A;  4A75 A;  1YNX A;  2CFM A;  3MXG A;  4KV6 A;  3S1R B;  2B2T A;  2UU9 L;  3EN2 A;  4CHT B;  4DR4 L;  4YY3 Q;  1AW7 A;  4KY5 A;  1OXU A;  1WCM B;  2EJF C;  1U4M A;  1A8V A;  3H0G H;  4A3E G;  5EKK A;  4TSS A;  1GO3 E;  3A5U A;  2PYK A;  4IFD I;  3U4V A;  4C2M B;  1FD7 D;  3I73 A;  3W5O A;  1QUQ A;  1A63 A;  3FKI B;  3HOZ H;  4C3I B;  1GD7 A;  1RD9 D;  4OEM B;  3H6M A;  2MPM A;  4CDC C;  2AWO A;  1A2U A;  1G51 A;  1X55 A;  2CW0 D;  2MO1 A;  4KK7 A;  2R92 B;  2OQK A;  1GKH A;  1K28 A;  1U0L A;  5C44 H;  5C4J B;  2ZTD A;  3T1Y L;  2F3V A;  3U4Z A;  1JCK B;  1A3T A;  1SYC A;  1IYU A;  4MNO A;  3AU7 A;  3VDY A;  3RUZ A;  3QG1 A;  2BDO A;  3TME A;  1QZG A;  2SNS A;  4NMZ A;  1BCP C;  3PUV A;  2MGS A;  2F0K A;  2LS0 1;  3K5O A;  4OWT B;  1X6O A;  4LF9 Q;  1PXU A;  1B53 A;  4BBR H;  2L0C A;  3V05 A;  4K14 A;  3NP8 A;  2VQF L;  2WAQ G;  2B8F A;  2HCC A;  3K7U C;  4KI0 A;  1ZXT A;  3L2P A;  4ALP A;  3SDZ A;  1W3S A;  4JOI A;  3M7N A;  1I50 H;  4EGV A;  4DAV A;  4G7H C;  3KDF B;  4IPG A;  1H9R A;  3QOJ A;  2IX0 A;  2KHS A;  1UE1 A;  1NR2 A;  1LAB A;  2N88 A;  4JYA L;  2R7F A;  2I5M X;  3I90 A;  1VQA A;  1YNN D;  1IKL A;  4LF6 Q;  1JWU D;  4JI8 L;  4RGT A;  1AFP A;  5HY6 A;  5LMN W;  1B3Q A;  4DUY Q;  1WTR A;  3KBG A;  4GLA C;  5IGC A;  2RVL A;  1O7I A;  5EPJ A;  4MN3 A;  1DOK A;  4V19 0;  1FL0 A;  1EY7 A;  3OSO A;  2Z9H A;  2DNE A;  2AQ1 B;  3K81 C;  3DEO A;  1TWF H;  3HOZ B;  1WTW A;  1XNQ Q;  2QCP X;  2R6G A;  3J7A V;  1XJV A;  1CK1 A;  4IPD A;  5ELC A;  1G91 A;  2DN8 A;  4I7Z C;  4JBM A;  3HOY H;  5C4X H;  3OTO L;  4LFA Q;  1EY4 A;  4DR3 Q;  4HMI A;  2EY6 A;  2NN6 I;  1KNE A;  5C44 B;  5D3D A;  2D9U A;  1ZYR C;  4O1N A;  5IP7 H;  1BVS A;  2F4V Q;  1IL2 A;  3M4P A;  4RWS C;  1TWC H;  3A8K E;  1SMY C;  1S5B D;  3SVM A;  4X65 L;  1WI5 A;  4KY6 A;  2YU9 B;  1MJC A;  1TS3 A;  3B6Y A;  2NTS A;  1ICW A;  4BBR B;  1I4R A;  2V1C C;  1F2L A;  4KLK A;  3ND9 A;  5J39 A;  3EIV A;  3MHB A;  1WYD A;  3STB D;  4GNX A;  3IL8 A;  2YTX A;  2WKC A;  1MIU A;  2HUG A;  1QZH A;  2VQE Q;  5FLM H;  4XXE A;  3ER0 A;  3HFZ B;  3PIO 3;  1XYI A;  2HIX A;  4GKJ L;  1OO9 B;  1X3P A;  1HR0 L;  1QB5 D;  1VMP A;  1SR3 A;  2VY3 A;  3D4D A;  4KY7 A;  5C5L A;  3CCM A;  4DV4 Q;  3PO2 G;  4QB4 A;  1E7Z A;  3BYY B;  4X3K A;  4BS9 A;  2TSS A;  3VYU A;  4MHE A;  1Y14 B;  2A19 A;  2A8V A;  1BCP B;  1D5M C;  2ID0 A;  3OIP A;  2JXM B;  4A93 G;  1Z7T A;  2OCE A;  3AFQ A;  4B3M Q;  1BDO A;  4ZCK A;  4A3F H;  2VNU D;  5HGQ A;  1G29 1;  2CW0 C;  3TN2 A;  3S2H H;  2KHI A;  1DXM A;  1TWF B;  1T9H A;  1TWG B;  2PMZ B;  3T13 A;  1XPU A;  1JC7 A;  4B08 A;  2WP8 J;  3F2D A;  1UNS A;  4DAY B;  2ZJP A;  1EYC A;  3H94 A;  4JK1 C;  4BA2 I;  3Q24 A;  3FRP B;  3OYY A;  5EKL A;  1LTR D;  3HOY B;  2A1A A;  3KLR A;  1I3Q H;  1SJE D;  1CA5 A;  3GTK H;  1VQM A;  3ULJ A;  4WOR A;  1WD1 A;  4CKC A;  1IW7 D;  1PTO C;  3TRZ A;  5I4D A;  4PMC A;  2G5D A;  5AFW A;  1HNW Q;  4A3B B;  2K5W A;  5LMU L;  1VQF A;  1WTX A;  3VR5 A;  2DY8 A;  4ZRZ A;  1KXL A;  3A55 A;  2VZA A;  4X66 Q;  4YWL A;  1HQM C;  2ZTE A;  3A7A B;  2NTT A;  3PUX A;  3BVZ A;  5K5P A;  2XTI A;  4DR1 L;  3I3C A;  2YTY A;  3JAM E;  1YJN A;  1WTV A;  1V1O A;  1EWI A;  3IRB A;  2QIL A;  3R93 A;  1EWH A;  1YNN C;  2R93 G;  1S5C D;  1HCZ A;  2MUY A;  2D0O A;  3WWV A;  4HJ9 A;  4FXG C;  3CME A;  3RR5 A;  3VR4 A;  3HOX G;  3SK8 A;  4X62 Q;  4DV3 Q;  4KHV A;  1PTO H;  1QVG A;  4PMB A;  2Q2H A;  4X64 L;  1B9N A;  5EPL A;  4BY1 H;  3KOJ A;  3P1H A;  2HCI A;  5IYB H;  5IWA Q;  2Y0S G;  1EOT A;  2UUC Q;  1S5E D;  3DM1 A;  2G9D A;  5KGU A;  4JV5 L;  1C9O A;  2B63 G;  2H5X A;  1HNX L;  4A3F B;  2E75 C;  1J5E Q;  2BE5 D;  4A3K H;  2EZV A;  1FJG Q;  2K52 A;  1ET9 A;  5K36 G;  5J22 A;  1XPO A;  1NY4 A;  4HTH A;  3S2H B;  1C4Q A;  2KBN A;  1KRT A;  1D5X C;  2K6A A;  2A6E D;  2Q2U A;  4QL5 A;  3TP5 A;  5M5Y H;  1TWA H;  1EFI D;  1Q1E A;  2RCN A;  4BY7 H;  4P73 A;  3J7A F;  4G57 A;  3T4A C;  3PO3 G;  1HZB A;  2E74 C;  1I3Q B;  1K3R A;  2EXZ A;  4A3I B;  4HR7 B;  4DV2 Q;  4YHH L;  2GA4 B;  4LF5 Q;  1EWC A;  2CH4 A;  5FOB B;  5I2X A;  1STH A;  2IPK D;  1IBM L;  1BXT A;  1K73 C;  4BBS H;  4PZ8 A;  2ZTC A;  5IT9 E;  5IYD H;  2F3I A;  4UHV A;  2UXD L;  3R2I A;  4ME3 A;  4U68 A;  4C3H H;  4C3I G;  3JC6 6;  1P16 A;  2VW9 A;  2EE1 A;  4CKE A;  1N8R C;  1HNZ Q;  1JWM D;  2F0P A;  1PYW D;  4CDF C;  5CBA E;  1IXR A;  1X3E A;  1PRT C;  1LUZ A;  5C6A A;  1EFW A;  1Y1W G;  1SFO H;  5E4W C;  1TS2 A;  4KD4 A;  2NUC A;  4A3L H;  3M4Q A;  2HT1 A;  5CV5 A;  1NCV A;  1GUN A;  4BY1 B;  2AQ3 B;  1Z6H A;  3H15 A;  4DUZ Q;  3AYH B;  1C48 A;  3M4O H;  1IZ6 A;  1GUG A;  4NPS A;  3UI2 A;  4GN3 B;  1AP0 A;  4LUO A;  1Z9F A;  4B3S L;  1LV9 A;  4M1U B;  4KJN A;  2NBF A;  1L0X B;  2B29 A;  4A3K B;  5DM7 3;  4BWG B;  2FMM A;  3T53 B;  3TDQ A;  3MAQ A;  1VQD A;  1STB A;  3Q0A A;  1O78 A;  4CDD C;  4B3T L;  2WAQ E;  1KAB A;  2Q2T A;  1DOL A;  2MP1 A;  1N34 L;  4AYB B;  1TWA B;  5M5Y B;  2CVR A;  1TR5 A;  5L37 A;  2JEB I;  1IW7 C;  4EQP A;  1M4V A;  2ICE C;  3JAM c;  3BDO A;  3VYT A;  3R8B A;  4K0K Q;  3G6E A;  2PQA A;  1BBW A;  2NVQ B;  2X69 A;  4KHP L;  1YVC A;  4OIJ A;  1IKM A;  1WJJ A;  1ESR A;  3H0G G;  3LWE A;  1C0A A;  1I5F A;  4BBS B;  3T1H Q;  5ELN A;  2RDF A;  2ATW A;  4GKK Q;  3Q22 A;  3NBH B;  4A3J G;  3SK6 A;  3CHB D;  4NP5 A;  1I4G A;  3PV0 A;  3MVV A;  1LT4 D;  4C3H B;  1GUO A;  1PA6 A;  1PHJ A;  3X3M A;  1K0S A;  2YV5 A;  4JC0 A;  2BDN A;  1NNX A;  5COR A;  4H44 C;  1PH5 A;  2NN6 H;  2JK8 A;  4JW0 A;  1O80 A;  4LK1 C;  4LF7 Q;  1SFO B;  3D4R A;  4H02 A;  5F2D A;  1JR0 D;  2ZT9 C;  3FEW X;  2A69 C;  1VQB A;  4P72 A;  1LO5 D;  5I9P A;  5GAE C;  1BQQ T;  1CFM A;  3HG9 A;  1EU4 A;  5EPK A;  5CBE E;  4L5Q A;  4DGZ A;  1XMQ L;  4CKB A;  2BE5 C;  1VQ9 A;  4AIM A;  3D3R A;  2QDL A;  2OQ0 A;  4XYO A;  1ILP A;  3V96 A;  2GN5 A;  3NEM A;  4K8J A;  2JA7 H;  5E4X A;  4BA1 I;  3CC7 A;  4YY3 L;  1KDB A;  4OWW B;  4HSP A;  2VS1 A;  3I91 A;  2NVX H;  1PDQ A;  2PI2 A;  4IUT A;  4KMU C;  5EJW A;  5IT9 c;  3U9O A;  1GHK A;  2L1B A;  1PRT B;  2L11 A;  3KJO A;  1BUV T;  4K6L A;  3SK5 A;  4JI0 L;  2K32 A;  5J3B A;  1J6Q A;  1HFN A;  4RCN A;  1EEI D;  5CV8 A;  1SYB A;  4NKL A;  1Q90 A;  1XNR Q;  4L6T B;  2RKS A;  2MJ8 A;  2PPB C;  4G7O C;  3C2P A;  3ZYY X;  3V2T A;  3FPU B;  2JA6 G;  2A68 D;  1C8C A;  4OO1 G;  1Q8K A;  3GTQ B;  1UEB A;  2DY7 A;  1JJG A;  1IBL Q;  1CTM A;  1SNQ A;  4Y7N B;  4LF8 Q;  1CQV A;  1CKN A;  1LTS D;  2O2L D;  4HMJ A;  2VB2 X;  4EVO A;  1TVX A;  5CV9 A;  1IYV A;  3MTS A;  1E2W A;  4HIK A;  3H91 A;  4ZKC B;  1F9S A;  2OT2 A;  2F0M A;  1TT2 A;  2OF1 A;  1WCM H;  3CRL C;  3PMF A;  3IAY A;  2KCT A;  4UPA A;  2F0N A;  1EEF D;  4KKT A;  4XQQ A;  5LMN Q;  4JI7 Q;  1AH9 A;  5C4X G;  1K83 H;  2AUK A;  2EVB A;  3FKI H;  4B3R L;  1CZG A;  3CCU A;  1Y8N B;  3KBX A;  2I5H A;  2ES2 A;  3JAM i;  4JBW A;  2EY5 A;  3PSI A;  1PZJ D;  3HOU H;  1UE6 A;  4DXF A;  3S1Q H;  1QVC A;  3RLO A;  3GQB A;  5C4J H;  2LY7 A;  1VQO A;  1FGB D;  1BKB A;  4I7A A;  1YIJ A;  2K50 A;  4IUR A;  2JA7 B;  3LNN A;  5GAH C;  1ET6 A;  4R1J A;  3EQL C;  1X9N A;  1BCP F;  1EIF A;  2NVX B;  4NB3 A;  4YWM A;  4NXM Q;  2N3S A;  3FPP A;  1IBK Q;  4DR6 Q;  4XDX A;  2JA8 G;  2V4D A;  3CF5 A;  1HFG A;  2KEC A;  4XT3 B;  1S4Z A;  3L9A X;  2K5N A;  1JJ2 A;  3W3A A;  4KN4 C;  1XNQ L;  1DZ1 A;  5CGK A;  3UDG A;  4GS3 A;  4RFB A;  3JAM L;  2JSO A;  2BH2 A;  1STN A;  2WB1 G;  4JI1 L;  4R8I A;  3HKZ B;  3MC0 B;  4LFC Q;  4FF3 A;  1E3P A;  3HKZ E;  1O7L A;  4K5W A;  3G71 A;  4JBK A;  2SNM A;  2OWO A;  2JP1 A;  1AEX A;  5M5W H;  4HN7 A;  1RDP D;  5FO7 B;  4JI3 L;  2F4V L;  4IPH A;  3EJI A;  4LFB Q;  4K8I A;  4KJO A;  4DA2 A;  1XPR A;  3K0X A;  1GUS A;  1B1Z A;  3OOC A;  3S24 A;  5KEE A;  1TKW B;  2IX1 A;  1KLG D;  1OXS C;  4JI6 L;  2A5H A;  4C3J H;  4A3G G;  2PCF B;  4K2L A;  3U9S A;  1K83 B;  3AEV A;  3I4M G;  1QOH A;  1VQE A;  1QG7 A;  2D62 A;  4RKB A;  3SXH A;  3MWY W;  5E7N A;  4KKU A;  4CDE C;  1B50 A;  4DV4 L;  3EVQ A;  3HOU B;  2XN9 C;  3HEJ A;  3S1Q B;  2QEJ C;  3C1E A;  5T1I A;  1EY8 A;  5C0X J;  1X54 A;  2VUM B;  5JEA J;  3MXN B;  5LL6 X;  1VQ6 A;  1U4P A;  2F4I A;  1H9J A;  5M3M G;  4R8N A;  3QIA A;  2XWB B;  1ENF A;  1X32 A;  1A0I A;  1GXD C;  1E1T A;  3F2U A;  2YU9 H;  5IP9 H;  5C0X H;  2UXB L;  2K5V A;  5IT9 L;  3NHH A;  5JEA H;  3CCQ A;  3DXJ C;  3S1N H;  3R3O A;  3CD6 A;  3KDF A;  4DV5 Q;  4LW1 A;  2NYZ D;  1XWE A;  2E76 C;  2A68 C;  3FP9 A;  1JB7 A;  1X3G A;  3Q8D A;  4OL7 A;  2C5C A;  5G3L F;  4HJ8 A;  2JA5 H;  5JJL A;  1KRS A;  4J8Q A;  3OW2 A;  5IYB G;  1STG A;  2EJG C;  1AE3 A;  1STA A;  4RAU C;  3HP3 A;  4B9W A;  5FO8 B;  3DWA A;  4ABN A;  1EQQ A;  2R7Z G;  5JJI A;  3PIP A;  3D0F A;  1SRO A;  2JA9 A;  3J7Z C;  4FF1 A;  4FO2 A;  3J80 L;  4UP8 A;  1A62 A;  1Q12 A;  1LTI D;  1MD2 D;  3A7L A;  5M5W B;  1E1O A;  1ILQ A;  2F0Q A;  2PZW A;  1HNW L;  3BZK A;  2EYP A;  5C3E H;  3PUY A;  4FYD A;  4DV7 L;  2K03 A;  3HOV H;  3MEF A;  4DXG A;  2QW7 A;  1S40 A;  1VCI A;  1EY5 A;  4ILW A;  2E2H H;  4A3D G;  1D8L A;  4BY7 G;  2XVS A;  3K57 A;  1F77 A;  4J15 A;  4C3J B;  4A3C H;  1XTC D;  5DEH A;  5M3F B;  3L0O A;  3NEL A;  5LL6 S;  4CGY B;  1TWG H;  1Q1B A;  3CPW A;  2UUB Q;  4OWX B;  2HQE A;  2F03 A;  4PV1 C;  1EYD A;  2HQL A;  1EQV A;  3PUW A;  3K5L A;  5JVG 3;  2IY5 B;  1EOV A;  5IYD G;  4X62 L;  3BZC A;  4DV3 L;  1JT8 A;  1MBY A;  2R61 A;  3HOW G;  2FIN B;  2IWH A;  5EQ0 A;  3GTP H;  1PTO F;  2K7V A;  4TKO B;  5IWA L;  2B2U C;  2JN4 A;  2QF7 A;  4OX9 L;  1VF5 C;  2UUC L;  5KYI A;  1VDZ A;  1DJR D;  1HTL D;  1VQ8 A;  4DPG A;  4LF4 Q;  4YIJ A;  4A3B H;  4BXX H;  1YHQ A;  3OHX C;  3I4N B;  3ITP A;  4FP5 D;  4LNQ A;  1MJE A;  1WD0 A;  2DJF C;  3S1N B;  4YWK A;  3H3V I;  2EYJ A;  2CWP A;  4XTC S;  4RGM A;  1N36 L;  2JA5 B;  1G6Z A;  4DK0 A;  2N8N A;  4JI5 L;  2SDF A;  3CW2 C;  1D1I A;  3EA6 A;  2ALY B;  3DLL A;  2UU9 Q;  1K0R A;  3MFY A;  3S2D B;  5ELO A;  4DR4 Q;  4HED A;  5ELD A;  4FXK C;  1EQT A;  1SYG A;  4DV2 L;  1LM0 A;  4LF5 L;  3QWN A;  1G2S A;  4JI4 L;  3X3N A;  3BJU A;  2F0D A;  3NQT A;  1V1P A;  4ZAI A;  5CV6 A;  5C3E B;  1PH3 A;  1O7Z A;  3HOV B;  4N9P A;  1WFQ A;  2E2H B;  1SBB B;  3DHQ A;  3CC2 A;  3OPO A;  4R4I A;  4DAY A;  4LUZ A;  1V1P B;  1HNZ L;  2XRS D;  4GOP C;  4WJW A;  1HUN A;  2CQO A;  1NMG A;  1K3B C;  2RSO A;  4ZUJ A;  2PO4 A;  1M1K C;  3H09 A;  5J1Z A;  2F0U A;  4OON A;  2Z6K C;  5T1G A;  4QJF A;  2WIN B;  1LT5 D;  1CA6 A;  4EX5 A;  3K5M A;  4G4K A;  1ICF B;  2SEB D;  3E0J A;  4MTK A;  4E6I A;  1JOQ A;  1OXV A;  2FJ2 A;  4A3I H;  4R4O A;  2ZM6 L;  3J7A 5;  3M3Y H;  4RG1 A;  3VR2 A;  5COY A;  2PQE A;  4AH6 A;  3GTP B;  2I5L X;  1Y69 U;  1Q3L A;  2VQF Q;  4DF7 A;  1ZEQ X;  1WVL A;  1PH2 A;  1XX8 A;  1NUC A;  4DR5 Q;  1D6E C;  2AWN A;  1PH1 A;  2K1B A;  3TP8 A;  2RHQ B;  4F8M A;  2PW5 A;  1X3Q A;  3VR6 A;  4TVA B;  3GV6 A;  1Z47 A;  2Q8R E;  4QY7 A;  2IT1 A;  2A6H D;  2B2U A;  1JE4 A;  4A3M G;  2XSC A;  2O5I C;  1EU3 A;  1PRT F;  4JI8 Q;  1E2V A;  1I94 L;  1ROD A;  5IGE A;  3N52 A;  3NWT A;  4FVM A;  3T56 B;  2F0S A;  4X3U A;  4PZ7 A;  2FMC A;  1PH4 A;  3ND8 A;  5GAD C;  1VS0 A;  1Y1V G;  4P75 A;  5CC4 A;  1L1O C;  1YJ9 A;  4JG2 A;  3T1H L;  2RDH A;  3MXP A;  4GKK L;  2EYO A;  4GN5 A;  4FNF A;  4LJZ C;  1YJW A;  3AMU A;  5I6Y A;  2HHH L;  3HGB A;  2KCC A;  2KUM A;  3KLW A;  4LWC A;  4Z9C B;  4DR7 L;  3OTO Q;  2JYO A;  3GTL H;  2GVA A;  1XTD A;  2K5H A;  1PYB A;  2F52 A;  2DJG C;  4LF7 L;  2K28 A;  4PG3 A;  2B39 A;  4G7Z C;  1YHA A;  3E9I A;  4XQJ A;  4X65 Q;  1CSQ A;  5BN3 A;  1SEB D;  5CV4 A;  2NVQ H;  1F2M A;  3M3Y B;  1EY6 A;  2LXK A;  1EZ6 A;  4J1M A;  4DV0 Q;  5JOB A;  4QUF A;  3VA7 A;  1WCM G;  3MXU A;  3GTO H;  4IFD H;  1VQP A;  2E2I H;  1SJH D;  4A3E B;  2Z6K A;  3ICE A;  1MKH A;  3PIP 3;  3ULL A;  5AJ3 Q;  1FYC A;  5ELF A;  2EYM A;  2F0V A;  3STB C;  3FKI G;  4GOP B;  4C1N K;  1DGS A;  4WFN 3;  3QB3 A;  4YCW A;  2F0O A;  2R92 G;  1EIY B;  3GTM B;  1N33 Q;  4L5R C;  2F0T A;  4AQY L;  3TP6 A;  1KTK A;  4X3T A;  4PZ6 A;  1V1Q A;  1B70 B;  4ULL A;  1EIG A;  1XNR L;  2Z4H A;  4ODG A;  1FR3 A;  1S3O A;  3E0E A;  2O4X A;  2K75 A;  1STE A;  1HZ9 A;  3TQY A;  2D0P A;  5CR3 A;  4GLX A;  4JI2 Q;  3BDC A;  3M4Y A;  4H7B A;  3J80 E;  1G8Z D;  1ONL A;  4LAA A;  3DMU A;  3PF5 A;  4IUN A;  1HQR D;  2Q8T A;  3D8G A;  4LF8 L;  1HXY D;  2G9H D;  1JWS D;  3TSS A;  5IYC G;  2PZT A;  2K05 A;  2OTL A;  2EIF A;  1AN8 A;  3G7L A;  5D65 A;  5GRO A;  1WTO A;  4DKA C;  1KD1 C;  3QOL A;  3NEN A;  1TY2 A;  3TRE A;  2WAQ B;  5JPN C;  3GTL B;  3CPF A;  3D31 A;  3GDE A;  1KQS A;  1AE2 A;  2E2D C;  5LMN L;  3F2B A;  5CV7 A;  4JI7 L;  2PNH A;  4XYQ A;  1L1O A;  1CHP D;  5LMU Q;  5EKI A;  3BDL A;  5EGT A;  1PFM A;  2UUA L;  1U4L A;  3TZD A;  1W2B A;  3PO2 H;  3FHW A;  1MSG A;  3E9H A;  3NBH A;  4QMG A;  3GTQ H;  4RKL A;  1L1O B;  5HUR A;  1LT6 D;  3GTO B;  4IPC A;  3I4O A;  4Y7N H;  2K5Q A;  2M2L A;  4OO1 I;  2E2I B;  3H3V C;  4A93 H;  1WOC A;  4O0A A;  3C3L A;  1N32 L;  3R2T A;  4KHZ A;  4HJ7 A;  1VQH A;  3HOZ G;  1VQG A;  4NXM L;  1YZ6 A;  1I4Q A;  3UE1 A;  1CQF A;  2AKW B;  2XRQ D;  1XMO Q;  1LT3 D;  4X64 Q;  2B2Y C;  4ID6 A;  1X65 A;  4QQB X;  3DWP A;  1H9K A;  3ERS X;  4N8X 1;  1UWV A;  4IUU A;  2M00 A;  5C44 G;  2F0E A;  4JV5 Q;  4DV1 L;  4DNT B;  4L8J A;  4LFC L;  2EY2 A;  1PZI D;  3CU7 A;  5JJK A;  1R4Q B;  1W6K A;  4OHJ A;  1SYF A;  1A6X A;  1UEA B;  1B44 D;  5C0X G;  3RZD H;  1TS5 A;  5JEA G;  2LFN A;  1SE3 A;  4DV6 Q;  1NSN S;  1B9M A;  1GOZ A;  2E5L L;  3HZX A;  2H4O A;  4BBR G;  4ZLT F;  5C4H A;  1KLU D;  3OMC A;  1F2Y A;  3KJP A;  3HRZ C;  1X3F A;  2F0F A;  4LFB L;  1CSP A;  2JA5 G;  1I6V C;  2QA4 A;  1JOO A;  2A6E C;  1MSH A;  3FVQ A;  5FJ8 H;  1ZKO A;  3TP7 A;  2CHB D;  1K8A C;  2KEN A;  3E5S A;  5M9O A;  3LX0 A;  3LGJ A;  1EL0 A;  3S9W A;  2R93 H;  4KTA A;  1S72 A;  2MFI A;  2M9V A;  2LSS A;  3WDN A;  1G6P A;  4C56 C;  5GAG C;  2HDL A;  5BR8 Q;  3HOX H;  3PO2 B;  1CHQ D;  3VYR A;  1HA6 A;  5FO9 B;  2K5D A;  1EIH A;  2K01 A;  2CKZ B;  2AHO B;  1F9R A;  3I8Z A;  2B2V C;  2KQ3 A;  3I7F A;  1EYG A;  3J80 c;  3KK7 A;  1HRJ A;  4A93 B;  4HCS A;  1HR0 W;  1G2T A;  1BCP D;  2B63 H;  4K5V A;  4DN4 M;  2NZ1 D;  4FDB A;  3QR8 A;  5K36 H;  5JPM C;  4LF9 L;  2ICI A;  2EYL A;  3L3O C;  1DON A;  4DV5 L;  1PH6 A;  2FXQ A;  2RDG A;  3HOY G;  1Q8I A;  1PH7 A;  1HA5 A;  2X6G A;  3PO3 H;  1SDF A;  4FF2 A;  5A2Q E;  1W6J A;  3NTK A;  1XXG A;  5IP7 G;  4Y52 H;  2LXJ A;  2NZO A;  4A3B G;  3URY A;  2C35 B;  1VQ5 A;  2RA4 A;  4CJ2 C;  3RZD B;  2CQA A;  4DR2 Q;  1B8A A;  1E2Z A;  2B2Y A;  1J9O A;  1FNW A;  1H9S A;  4LF6 L;  2VUM H;  3IFT A;  5IGF A;  4GLV B;  1HHV A;  1N34 Q;  3MFG A;  1K8M A;  3UE0 A;  2JEA I;  4DUY L;  3KUP A;  1MI2 A;  3NQI A;  3OMG A;  1BNZ A;  1CM9 A;  1YI2 A;  1H9S B;  5FLM G;  2WFW A;  2EYH A;  1SNM A;  1SE8 A;  2R93 B;  1EUJ A;  4DNR B;  2B2W C;  2KEE A;  5KIX A;  5I6W A;  1Y1W H;  1CKO A;  3CQZ H;  1SMX A;  5DNF A;  3HOX B;  4JOI C;  3K0Y A;  2EY1 A;  2BCO A;  2Z0S A;  4YCU A;  1S5F D;  4EQO A;  1ZYR D;  2Y0S B;  1RL2 A;  5KNC A;  1VQK A;  4A76 A;  2IL8 A;  2XWJ B;  4DR3 L;  4LFA L;  2KA7 A;  2Y0S E;  4GZY C;  2PW7 A;  4A3F G;  1UE7 A;  2L15 A;  1ENA A;  1SRU A;  2B63 B;  1YBY A;  4RA8 A;  5BN5 A;  1TY0 A;  4HSV A;  1IHZ A;  4LF4 L;  5CYU A;  3IKJ A;  1LTG D;  1H9M A;  2F0I A;  1FNU A;  1TXY A;  3IFD A;  4IZ8 A;  2FFK B;  5G3L D;  1HTP A;  1RF2 D;  3SEB A;  1NJI C;  5M3F H;  1XMQ Q;  3CXC A;  4A3I G;  3BU2 A;  3PO3 B;  4DK1 A;  1GUW A;  3I55 A;  4QUC A;  3MXN A;  1VMC A;  5I9O A;  2VQE L;  1QVF A;  2ZXP A;  4RGN A;  2Z6B A;  4ME5 A;  3F2C A;  5C4Z A;  3GO5 A;  1KDA A;  2F1M A;  1ML0 D;  2R7D A;  4MZ9 A;  1PLF A;  3KF8 A;  1P8L A;  5IY0 A;  3RLN A;  2ZJQ A;  4PMW A;  4P71 A;  5HGT A;  1VQN A;  3G48 A;  2XGT A;  1T5X D;  4DK6 C;  4A3J H;  3RN2 A;  1A15 A;  1QNU A;  4V0B A;  4JI0 Q;  3J80 i;  1BBX C;  5EAY A;  1GVP A;  3KF8 B;  3CCL A;  1WTP A;  3CRK C;  5IGB A;  4B3M L;  3A54 A;  3I4N H;  1I4P A;  2AMC B;  4PQX A;  3KFU A;  5JVH 3;  1F9P A;  1V43 A;  1QUQ B;  4KD3 A;  1MGS A;  1Y1W B;  1Q46 A;  1OXT A;  2N55 A;  3CQZ B;  3K80 C;  4BY1 G;  4GNX C;  2R3Z A;  4IOA A;  3F8T A;  2Q8I B;  1NR4 A;  3I4L A;  2X6L A;  4O42 A;  3S2D H;  4APV A;  1PTO D;  4RHS A;  4N9T A;  1KHI A;  4JCV E;  3TBI B;  5EBC A;  4ZUI A;  4L5T A;  2PZU A;  3ERQ A;  4K2K A;  2WII B;  4A3K G;  4JPB W;  2B2W A;  4IJH A;  4QCL A;  4RGO S;  2NVT B;  3LWU A;  4HID A;  2P5Z X;  4WJ4 A;  3I70 A;  2J7Z A;  4S3S A;  3GV3 A;  2NZH A;  4DR5 L;  4B3R Q;  2HDM A;  5FLX L;  3E3X A;  1IYJ B;  1TWH H;  1D7Q A;  4OEL B;  4X66 L;  4AYB G;  1B4O A;  2NB0 A;  1H95 A;  5E1F A;  1EZ8 A;  4MTN A;  1SNP A;  1D2B A;  5BN4 A;  2NVY H;  3CCJ A;  4IQZ A;  1YEZ A;  2J4X A;  1DM0 B;  4R4C A;  2UXC Q;  2JA6 H;  1Y8O B;  4OO1 H;  3ZJY C;  5ELB A;  2K04 A;  1KDC A;  3M7G A;  4IFD G;  4BBS G;  3Q23 A;  1Q82 C;  3H0G B;  1EY9 A;  3A0J A;  1RKN A;  3QO2 A;  3WOE A;  3S1M H;  4IN3 A;  2EJM A;  2TMP A;  3NWS A;  1TU2 B;  4A3J B;  4C3H G;  5ISR A;  2KCM A;  4PNY A;  3BS1 A;  1S5D D;  3AFP A;  3S16 H;  3F1Z A;  3MEH A;  3MZ5 A;  3M85 A;  4NXN Q;  5DAU A;  4JI1 Q;  1DOM A;  2JJQ A;  1R9T H;  1J5E L;  1L0W A;  3OWE B;  3UDF A;  2RQX A;  1FJG L;  5ELE A;  2CWA A;  5C5M A;  4A3L G;  2MO0 A;  4UP7 A;  1UUP A;  2B3G A;  3OW7 A;  1EY0 A;  1L2F A;  4A4I A;  1R4P B;  2QKI C;  3CC4 A;  2CCZ A;  2E8G A;  1HH2 P;  2BOS A;  4EQN A;  5LHY 1;  2RF4 A;  4JI3 Q;  1I6H H;  2ASB A;  5FK9 C;  2F0G A;  2D2C C;  3NTH A;  1YNJ D;  4RH6 A;  3HKS A;  4U67 3;  4OIK A;  4JI6 Q;  1SE2 A;  4DV0 L;  2NWG A;  3J81 E;  5JAV A;  3K59 A;  1PFS A;  4DK3 C;  3D4W A;  2Q2I A;  2DUD A;  1QIL A;  4DU9 A;  3K8A A;  2RSN A;  3NBI A;  3VR3 A;  3I56 A;  1GM5 A;  2QGQ A;  2A73 B;  1I50 B;  1ASZ A;  5M5X H;  2EDG A;  1JOR A;  1TWH B;  2JA8 H;  5AJ3 L;  4UY8 C;  3SR1 A;  2F0L A;  1RIP A;  3EFX D;  5H1S E;  1Q86 C;  1SLJ A;  1QNK A;  1SAP A;  2NVY B;  1II3 A;  1VQC A;  1PRT D;  1L0Y B;  4GNX B;  1BOS A;  2MNA A;  3E6Z X;  1N33 L;  3T1Y Q;  1WTQ A;  2JA6 B;  1M90 C;  4QF4 A;  5IE8 A;  1CI3 M;  1SE4 A;  3CMA A;  3A8J E;  4GN4 B;  4JI2 L;  1V8Q A;  1KAW A;  2UXB Q;  3S1M B;  4IUP A;  4QIW B;  4DUZ L;  3J7Y W;  2KVM A;  2VL6 A;  4IO9 A;  4QIW E;  2D5D A;  3S16 B;  2FHT A;  4HAE A;  2PMZ E;  3GP7 A;  4F87 A;  2NN6 G;  4A3E H;  1R9T B;  2EPB A;  2WAC A;  1Q81 C;  3KLS A;  2GVB A;  1U9R A;  4A3G H;  4B9X A;  4JYA Q;  5C4X B;  2K14 A;  5JJZ A;  3I4M H;  1DD2 A;  4F7X A;  4RCO A;  2IX3 A;  1ENC A;  3GTM H;  1RTO A;  2IHE A;  2I0Q A;  1I6H B;  3M9B A;  1TWC B;  1T5E A;  4DV7 Q;  1KAA A;  1M8A A;  1QCB D;  4K0K L;  1B3A A;  1LTT D;  3A56 A;  4JVZ A;  1SNO A;  5A2Q L;  3C46 A;  2N49 A;  1JIC A;  2WV6 D;  2JA7 G;  1TQO A;  3PGZ A;  3CP0 A;  3PQI A;  5M3M H;  5FJ8 G;  1JJC B;  2O5J C;  3KF6 A;  2HD3 A;  4ZQ3 A;  2PNR C;  3SK4 A;  4J6H A;  2L9H A;  4LMQ D;  5M5X B;  2L55 A;  2JA8 B;  1DCZ A;  1STY A;  1FVI A;  5E3F A;  3TEH B;  4CJ0 B;  1PMR A;  2IW3 A;  4DAM A;  3KF6 B;  2E2J H;  2DGY A;  1RCV D;  1PVO A;  1XMO L;  3HKZ G;  2A69 D;  2WB1 B;  3P7J A;  3UDX A;  5DLQ E;  1NE3 A;  4TRD A;  4OX9 Q;  2R7Z H;  1ESF A;  2ZXO A;  2WB1 E;  4KKS A;  4N8F A;  4IFD J;  1SN8 A;  1YHB A;  3GD7 A;  3G6J B;  1SYE A;  4IOC A;  3PCO B;  1K9M C;  3K7A H;  4ZYS A;  3FMC A;  3K6O A;  5IGD A;  1D1K A;  4GOP A;  2YYZ A;  3U58 A;  1FNV A;  1LTA D;  4DV6 L;  2BA1 A;  1N36 Q;  4FF4 A;  1NTG A;  3VYS A;  4JI5 Q;  1F2Z A;  1HJP A;  4HIO A;  3CCV A;  4A3D H;  2MHV A;  3W2D A;  3J81 c;  1PFB A;  1VF7 A;  4HCE A;  1GHJ A;  2KOL A;  2EOT A;  1QJO A;  1PZK D;  4A3G B;  4TQU S;  3GTK B;  1B2T A;  3I4M B;  4GKJ Q;  3EBE A;  3BG3 A;  1HR0 Q;  4X6A H;  1YNJ C;  4IAL A;  3SHL A;  3KYH C;  1A2T A;  3C1F A;  4FXD A;  5C3X A;  4JI4 Q;  1LAC A;  2WKD A;  3CCE A;  1UAP A;  3A74 A;  1I4H A;  1UE5 A;  2EYF A;  3DEP A;  3HOU G;  3DWQ A;  3O13 A;  5BR8 L;  2VUM G;  3ERO A;  3D6C A;  1AZQ A;  3T51 B;  3HOW H;  1VQ7 A;  4NW2 A;  1JQY D;  2JQO A;  1K8O A;  5IGG A;  1IBL L;  2VXW A;  1KIX A;  4DAP A;  5M3M B;  3S15 H;  2OTJ A;  1SYD A;  2J0T D;  2K4K A;  3MA2 B;  5FLX E;  1BR9 A;  3D6W A;  5C3W A;  2IJ0 A;  5KNB A;  3NTI A;  1GUT A;  3NE5 B;  2I46 A;  2BH8 A;  5C0X I;  5FKA C;  1LTL A;  3BVM A;  3RMH A;  1KC8 C;  1E0B A;  3A5Z B;  2E2J B;  4DNI A;  5IOD A;  1GJX A;  1PTO B;  2ZM6 Q;  3RZO H;  2YTV A;  1KNA A;  5KND A;  4M8A A;  3CKI B;  3BZD B;  2R7Z B;  4R4Q A;  2QDB A;  1PH8 A;  1HPC A;  2KJX A;  4F88 A;  3K58 A;  4L63 B;  3I2Z A;  3TZU A;  1CT1 D;  4CJ1 B;  3K7A B;  2BA0 A;  3KLS X;  5D3I B;  4H0L C;  3BVG A;  4RHR A;  4DR2 L;  1V9P A;  4DR1 Q;  1HZA A;  5NUC A;  3A8I E;  3AB9 A;  1VQL A;  4A3D B;  2HIV A;  4C3J G;  3L7Z C;  4WRD A;  1I94 Q;  4BY7 B;  2OEO A;  5M3F G;  2LKV A;  3NUC A;  3NSW A;  2Z1C A;  2A6H C;  4AYB E;  2CH4 W;  1F9Q A;  3Q6S A;  1I4X A;  1LLR D;  1IBK L;  4DR6 L;  4MIU A;  2EXD A;  2EQS A;  1TII D;  5IIF A;  1WTH A;  3GTG H;  2Z4I A;  3GTJ H;  2ZJR A;  2SOB A;  1U4R A;  2PQA B;  4EQ5 A;  2XNA C;  5TSS A;  3T16 A;  5IOC A;  1PV4 A;  1JE5 A;  3TS0 A;  1PH9 A;  1EYA A;  5CMD A;  1OTC A;  3HOW B;  3OIQ A;  3RNU A;  2HHH Q;  4KN7 C;  2AQ2 B;  5KYL A;  1HNX Q;  1A3U A;  4IUQ A;  1A3V A;  3J81 j;  4NDX A;  4UAI A;  3S14 H;  3PF4 A;  3S15 B;  4IJL A;  4O2D A;  4DR7 Q;  3I4N G;  1LYL A;  3H3V H;  2K33 A;  1B7Y B;  5IP9 G;  1OXX K;  3ONA B;  5I2Y A;  1J8I A;  2A74 C;  1N9W A;  2ZXR A;  1CKM A;  3J81 i;  4C1N I;  1YIT A;  1PYS B;  3UDI A;  4YCV A;  1MHW C;  5A35 A;  3RZO B;  2LMC B;  3DM3 A;  1NAP A;  3W1G A;  4YHH Q;  3CCR A;  1DYQ A;  4A3M H;  3M4O B;  2Z8L A;  3CAM A;  3ULP A;  2AUJ D;  1IBM Q;  4RMF A;  2MQH A;  5GQO A;  1Q7Y C;  2RCF A;  4UDU C;  3AQQ A;  3TS2 A;  3WOF A;  2UXD Q;  2C9O A;  4XIG S;  5C3E G;  3BYT B;  1QWY A;  3RLF A;  1Y1V H;  3HOV G;  1BF4 A;  1U5K A;  1SXT A;  4POG A;  2F0H A;  4AQY Q;  2QEX A;  4A3C G;  4DFA A;  3J81 L;  5EBD A;  4HIM A;  1BBU A;  1VQ4 A;  2B2T C;  1JMC A;  4IUV A;  3PUZ A;  4LUV A;  5FLX c;  1RJT A;  2PI2 E;  3U50 C;  3SGI A;  1PFN A;  4OGQ C;  1C7Y A;  2XIW A;  3S17 H;  4JBJ A;  4P74 A;  3GTG B;  3GTJ B;  3RD4 A;  1X56 A;  2JE6 I;  3HS0 C;  3QJY A;  4R9W A;  1IL8 A;  1Y8P B;  2N78 A;  4B3S Q;  1D5Z C;  3P20 A;  3S1R H;  3NK9 A;  2F3W A;  2KED A;  3SE0 A;  5DM6 3;  3DUZ A;  4HJ5 A;  5D14 A;  4BXX G;  1HUM A;  3S14 B;  1CKN B;  3PIO A;  4HJA A;  4L5S A;  1O7Y A;  1FGU A;  4B3T Q;  4QGU A;  3CCS A;  4Q5V A;  4C2M H;  1VQJ A;  2KCN A;  2OXP A;  4C3I H;  4ZK9 B;  3K5N A;  2UUA Q;  1K8G A;  4R4T A;  1AZP A;  2R92 H;  4WJ3 M;  2L12 A;  4Q0F A;  4KHP Q;  4A3M B;  1QE6 A;  1EQR A; 
#chains in the Genus database with same CATH homology
 2PQA A;  4R4C A;  1BBW A;  2UXC Q;  3G4S A;  2JA6 H;  4KHP L;  1YVC A;  4PZ7 A;  1CUK A;  1HZC A;  4UP9 A;  3ZJY C;  2UXC L;  1PH4 A;  4IFD G;  1WJJ A;  3H0G G;  2UUB L;  1C0A A;  4BBS G;  1Q82 C;  1KL9 A;  1I5F A;  3A0J A;  1NBW A;  5GAD C;  1VS0 A;  5ELN A;  3T1H Q;  1N32 Q;  2IHF A;  2ATW A;  3S1M H;  4GKK Q;  1Y1V G;  3NBH B;  4A3J G;  4P75 A;  1L1O C;  1YJ9 A;  4JG2 A;  3PV0 A;  3T1H L;  4GKK L;  1E22 A;  5IYC H;  2KCM A;  1PA6 A;  4GN5 A;  3RN5 A;  1YJW A;  1NMF A;  3AFP A;  3S16 H;  1PHJ A;  3F1Z A;  2HHH L;  2YV5 A;  4JC0 A;  3M85 A;  4NXN Q;  3KLW A;  2NVT H;  1PH5 A;  4JI1 Q;  4LWC A;  2JJQ A;  1R9T H;  4DR7 L;  2KHJ A;  2RHS B;  4NXN L;  2JK8 A;  1L0W A;  3OTO Q;  3UDF A;  1J5E L;  4LF7 Q;  2GVA A;  4POF A;  1FJG L;  1E24 A;  3GTL H;  1XTD A;  2CWA A;  2K5H A;  1VQI A;  4H02 A;  4A3L G;  2MO0 A;  4UP7 A;  4DV1 Q;  1PYB A;  2B3G A;  2F52 A;  3W1B A;  1L2F A;  4A4I A;  4LF7 L;  4PG3 A;  1VQB A;  4P72 A;  1ASY A;  3CC4 A;  2CCZ A;  2E8G A;  5GAE C;  1YHA A;  3E9I A;  4OXP A;  1HH2 P;  4X65 Q;  4JI3 Q;  2RF4 A;  1CSQ A;  1I6H H;  2ASB A;  2E5L Q;  4L5Q A;  4A75 A;  1YNX A;  1XMQ L;  2NVQ H;  2CFM A;  1VQ9 A;  2LXK A;  3HKS A;  4AIM A;  4DV0 Q;  2UU9 L;  2OQ0 A;  3EN2 A;  4DR4 L;  1WCM G;  4YY3 Q;  4JI6 Q;  3GTO H;  2GN5 A;  1OXU A;  3NEM A;  4DV0 L;  2JA7 H;  1A8V A;  3H0G H;  1VQP A;  2E2I H;  1PFS A;  4BA1 I;  3CC7 A;  4A3E G;  4DK3 C;  4YY3 L;  2Q2I A;  2DUD A;  2Z6K A;  3ICE A;  3K8A A;  1GO3 E;  1MKH A;  4OWW B;  2VS1 A;  3ULL A;  3A5U A;  3I56 A;  5AJ3 Q;  1GM5 A;  2NVX H;  4IFD I;  2QGQ A;  2PI2 A;  3U4V A;  5IT9 c;  3STB C;  1ASZ A;  3FKI G;  5M5X H;  4GOP B;  4BXX H;  3W5O A;  2JA8 H;  1QUQ A;  5AJ3 L;  3KJO A;  4UY8 C;  4A3B H;  3HOZ H;  4JI0 L;  1A63 A;  1GD7 A;  1RIP A;  5J3B A;  1DGS A;  2AWO A;  1J6Q A;  5H1S E;  4YCW A;  1SLJ A;  1Q86 C;  1EIY B;  1G51 A;  1N33 Q;  4L5R C;  2R92 G;  4AQY L;  1X55 A;  2MO1 A;  1XNR Q;  1VQC A;  4PZ6 A;  2OQK A;  1V1Q A;  2MNA A;  4GNX B;  1B70 B;  1N33 L;  1GKH A;  3T1Y Q;  1XNR L;  2JA6 G;  4OO1 G;  1S3O A;  1Q8K A;  3E0E A;  1UEB A;  2K75 A;  3TQY A;  1HZ9 A;  3S14 H;  1U0L A;  2D0P A;  4GLX A;  5C44 H;  4JI2 Q;  2ZTD A;  3T1Y L;  3U4Z A;  1JJG A;  1IBL Q;  1M90 C;  5IE8 A;  3CMA A;  4MNO A;  4GN4 B;  3VDY A;  3PF5 A;  4JI2 L;  4LF8 Q;  1CKN A;  1KAW A;  2UXB Q;  1QZG A;  4LF8 L;  3PUV A;  4DUZ L;  5IYC G;  4OWT B;  1EQR A;  2VL6 A;  4HIK A;  2EIF A;  1X6O A;  4IO9 A;  2OTL A;  4LF9 Q;  4QIW E;  4BBR H;  5GRO A;  1WCM H;  4DKA C;  2PMZ E;  1KD1 C;  2KCT A;  2NN6 G;  3NEN A;  2VQF L;  4UPA A;  2WAQ G;  4A3E H;  3K7U C;  4ALP A;  4KI0 A;  3L2P A;  5LMN Q;  3TRE A;  1Q81 C;  1W3S A;  4JOI A;  3CPF A;  2GVB A;  3D31 A;  3GDE A;  1KQS A;  1AE2 A;  4JI7 Q;  1K83 H;  4A3G H;  5C4X G;  3M7N A;  1I50 H;  4JYA Q;  5LMN L;  3KDF B;  3F2B A;  4IPG A;  2K14 A;  3I4M H;  2IX0 A;  3FKI H;  4JI7 L;  4B3R L;  2PNH A;  3CCU A;  1UE1 A;  1L1O A;  4JYA L;  2I5H A;  2ES2 A;  2R7F A;  3JAM i;  3GTM H;  2I5M X;  4JBW A;  2IHE A;  5LMU Q;  1VQA A;  2I0Q A;  2UUA L;  1W2B A;  3PO2 H;  4LF6 Q;  3FHW A;  3M9B A;  3PSI A;  3E9H A;  3HOU H;  1UE6 A;  4DV7 Q;  3S1Q H;  4JI8 L;  3GTQ H;  4K0K L;  1QVC A;  3RLO A;  5C4J H;  5HY6 A;  1L1O B;  5LMN W;  1VQO A;  4DUY Q;  2N49 A;  4IPC A;  4GLA C;  2JA7 G;  1BKB A;  3I4O A;  1YIJ A;  2K50 A;  1O7I A;  4Y7N H;  3PGZ A;  4OO1 I;  5GAH C;  3CP0 A;  4R1J A;  4A93 H;  5M3M H;  1WOC A;  5FJ8 G;  1X9N A;  1JJC B;  3KF6 A;  4O0A A;  1FL0 A;  1EIF A;  4NB3 A;  4YWM A;  4NXM Q;  2N3S A;  1N32 L;  1IBK Q;  4KHZ A;  4DR6 Q;  4HJ7 A;  1VQH A;  2JA8 G;  3K81 C;  3CF5 A;  3HOZ G;  1TWF H;  1VQG A;  4NXM L;  1YZ6 A;  1FVI A;  3TEH B;  3UE1 A;  1XNQ Q;  2R6G A;  1XJV A;  2AKW B;  1XMO Q;  4X64 Q;  2K5N A;  4DAM A;  1JJ2 A;  1X65 A;  3KF6 B;  2DGY A;  2E2J H;  4QQB X;  1XNQ L;  4IPD A;  4GS3 A;  3UDG A;  1PVO A;  1XMO L;  4JBM A;  2BH2 A;  3ERS X;  2WB1 G;  3HKZ G;  4JI1 L;  1UWV A;  3HOY H;  5C4X H;  5C44 G;  3OTO L;  4LFA Q;  4DR3 Q;  4LFC Q;  4JV5 Q;  3UDX A;  5DLQ E;  2NN6 I;  1NE3 A;  4OX9 Q;  1E3P A;  2R7Z H;  3HKZ E;  2WB1 E;  3G71 A;  4DV1 L;  4JBK A;  4LFC L;  2OWO A;  4IFD J;  5IP7 H;  1BVS A;  1SN8 A;  2F4V Q;  1IL2 A;  1YHB A;  5JJK A;  3GD7 A;  3M4P A;  1TWC H;  5M5W H;  4IOC A;  3PCO B;  3RZD H;  5C0X G;  1K9M C;  4X65 L;  4JI3 L;  2F4V L;  3K7A H;  1WI5 A;  4IPH A;  5JEA G;  4DV6 Q;  1MJC A;  2E5L L;  3B6Y A;  4BBR G;  4LFB Q;  1XPR A;  4GOP A;  2YYZ A;  3U58 A;  3K0X A;  4DV6 L;  2BA1 A;  1N36 Q;  2V1C C;  3KJP A;  1NTG A;  1X3F A;  3S24 A;  4LFB L;  4KLK A;  4JI5 Q;  4HIO A;  1HJP A;  1CSP A;  3CCV A;  1OXS C;  2JA5 G;  2QA4 A;  4JI6 L;  2IX1 A;  4A3D H;  3J81 c;  3EIV A;  5FJ8 H;  4C3J H;  1WYD A;  4A3G G;  3STB D;  4GNX A;  1K8A C;  2KEN A;  2YTX A;  3AEV A;  3I4M G;  4TQU S;  1MIU A;  1VQE A;  1QZH A;  3LGJ A;  5FLM H;  2VQE Q;  4GKJ Q;  3EBE A;  1HR0 Q;  2R93 H;  3ER0 A;  3HFZ B;  4X6A H;  2D62 A;  1S72 A;  2MFI A;  2HIX A;  3KYH C;  4GKJ L;  2LSS A;  1HR0 L;  1G6P A;  2VY3 A;  4DV4 Q;  1SR3 A;  3CCM A;  5GAG C;  4JI4 Q;  5E7N A;  3CCE A;  3PO2 G;  3A74 A;  5BR8 Q;  3HOX H;  1UE5 A;  1E7Z A;  3HOU G;  4DV4 L;  5BR8 L;  2VUM G;  2A8V A;  1Y14 B;  2A19 A;  2CKZ B;  5C0X J;  1X54 A;  5JEA J;  3MXN B;  1VQ6 A;  2ID0 A;  3HOW H;  2AHO B;  1VQ7 A;  2JQO A;  4A93 G;  5M3M G;  2OCE A;  3AFQ A;  3I7F A;  1EYG A;  4B3M Q;  3J80 c;  1IBL L;  1KIX A;  1HR0 W;  3S15 H;  2OTJ A;  1A0I A;  4A3F H;  2B63 H;  2K4K A;  2VNU D;  5HGQ A;  1E1T A;  1G29 1;  4FDB A;  2YU9 H;  5IP9 H;  2UXB L;  2K5V A;  3CCQ A;  2KHI A;  3S2H H;  3S1N H;  1T9H A;  3CD6 A;  3KDF A;  4DV5 Q;  4LW1 A;  1XPU A;  3FP9 A;  1JB7 A;  2BH8 A;  5C0X I;  1X3G A;  2WP8 J;  3Q8D A;  3F2D A;  4LF9 L;  1LTL A;  1KC8 C;  3A5Z B;  4DV5 L;  4DAY B;  2ZJP A;  4DNI A;  1PH6 A;  4HJ8 A;  2JA5 H;  3PF4 A;  2FXQ A;  5JJL A;  4BA2 I;  1KRS A;  2ZM6 Q;  3OYY A;  3HOY G;  3OW2 A;  3RZO H;  2YTV A;  5IYB G;  4DR7 Q;  1AE3 A;  1PH7 A;  2A1A A;  1I3Q H;  3GTK H;  1EQQ A;  1VQM A;  3PO3 H;  2R7Z G;  3ULJ A;  5JJI A;  4R4Q A;  3PIP A;  3D0F A;  5IP7 G;  4Y52 H;  3TRZ A;  1SRO A;  2JA9 A;  2LXJ A;  2NZO A;  3J7Z C;  1PH8 A;  4A3B G;  4UP8 A;  3I2Z A;  1A62 A;  1Q12 A;  1HNW Q;  2C35 B;  1VQ5 A;  1E1O A;  5LMU L;  1VQF A;  4DR2 Q;  1B8A A;  1KXL A;  2BA0 A;  4LF6 L;  1HNW L;  2VZA A;  3BZK A;  2VUM H;  4X66 Q;  3PUY A;  5C3E H;  4GLV B;  4YWL A;  4DR2 L;  4DV7 L;  1V9P A;  4DR1 Q;  1N34 Q;  1HZA A;  2ZTE A;  3MEF A;  3HOV H;  1S40 A;  1VCI A;  3UE0 A;  1VQL A;  2E2H H;  2JEA I;  4A3D G;  4DUY L;  3PUX A;  4DR1 L;  1D8L A;  2XTI A;  4BY7 G;  2HIV A;  2YTY A;  3L7Z C;  1I94 Q;  4J15 A;  5M3F G;  1YJN A;  4A3C H;  1YI2 A;  1EWI A;  3L0O A;  3IRB A;  4AYB E;  5FLM G;  2WFW A;  2R93 G;  3NEL A;  1TWG H;  1SE8 A;  2D0O A;  1Q1B A;  3WWV A;  1EUJ A;  3CPW A;  4HJ9 A;  1IBK L;  4DR6 L;  1Y1W H;  1CKO A;  2UUB Q;  3CME A;  4OWX B;  2EXD A;  3RR5 A;  2EQS A;  3CQZ H;  3HOX G;  1SMX A;  4X62 Q;  4DV3 Q;  2HQL A;  1QVG A;  4JOI C;  3PUW A;  3GTG H;  2Q2H A;  4X64 L;  3GTJ H;  2ZJR A;  4BY1 H;  2IY5 B;  1EOV A;  3KOJ A;  5IYD G;  3BZC A;  4X62 L;  4DV3 L;  1JT8 A;  2PQA B;  4EQ5 A;  5IYB H;  5IWA Q;  2Z0S A;  2Y0S G;  4YCU A;  1PV4 A;  1JE5 A;  3TS0 A;  1PH9 A;  3HOW G;  1VQK A;  1RL2 A;  2UUC Q;  1OTC A;  3GTP H;  4A76 A;  3RNU A;  5IWA L;  1HNX Q;  2HHH Q;  4DR3 L;  4LFA L;  4JV5 L;  2Y0S E;  4OX9 L;  2UUC L;  4A3F G;  1C9O A;  1UE7 A;  3J81 j;  2B63 G;  2L15 A;  2H5X A;  1HNX L;  4LF4 Q;  4IJL A;  1SRU A;  4O2D A;  4DPG A;  1LYL A;  1YBY A;  1J5E Q;  4A3K H;  1VQ8 A;  3H3V H;  1YHQ A;  1B7Y B;  1FJG Q;  5IP9 G;  1OXX K;  2K52 A;  5K36 G;  4LF4 L;  1XPO A;  1NY4 A;  4LNQ A;  1MJE A;  4YWK A;  2KBN A;  1KRT A;  3H3V I;  1N9W A;  1TXY A;  1CKM A;  3J81 i;  1YIT A;  1PYS B;  2CWP A;  4XTC S;  4QL5 A;  2Q2U A;  3UDI A;  4YCV A;  1TWA H;  1Q1E A;  5M5Y H;  1N36 L;  2RCN A;  4BY7 H;  4P73 A;  1NJI C;  2N8N A;  4JI5 L;  5M3F H;  1XMQ Q;  3CW2 C;  3CXC A;  3DM3 A;  3W1G A;  4YHH Q;  1HZB A;  3CCR A;  4A3I G;  3PO3 G;  4A3M H;  3BU2 A;  2ALY B;  1K3R A;  3CAM A;  3DLL A;  3ULP A;  1K0R A;  2UU9 Q;  5ELO A;  4DV2 Q;  4YHH L;  4DR4 Q;  3I55 A;  1AH9 A;  4LF5 Q;  2VQE L;  1QVF A;  1IBM Q;  4RMF A;  3F2C A;  4DV2 L;  3GO5 A;  1LM0 A;  2MQH A;  2R7D A;  4LF5 L;  5GQO A;  4MZ9 A;  1Q7Y C;  1IBM L;  1P8L A;  3AQQ A;  3RLN A;  5IY0 A;  3TS2 A;  2ZJQ A;  4JI4 L;  1K73 C;  4PMW A;  4BBS H;  2UXD Q;  4P71 A;  3BJU A;  1VQN A;  4PZ8 A;  3G48 A;  2ZTC A;  2XGT A;  4XIG S;  5C3E G;  5IYD H;  3RLF A;  1Y1V H;  4DK6 C;  2F3I A;  3RN2 A;  4A3J H;  1PH3 A;  4JI0 Q;  3HOV G;  2UXD L;  1U5K A;  3J80 i;  4ME3 A;  4C3H H;  1WFQ A;  3JC6 6;  4POG A;  1P16 A;  5EAY A;  4AQY Q;  2VW9 A;  1GVP A;  3KF8 B;  3CC2 A;  1N8R C;  3CCL A;  1HNZ Q;  4R4I A;  2QEX A;  4A3C G;  4B3M L;  4HIM A;  4LUZ A;  1BBU A;  1VQ4 A;  3I4N H;  1IXR A;  1HNZ L;  1X3E A;  2AMC B;  4GOP C;  1LUZ A;  1JMC A;  3KFU A;  1EFW A;  1Y1W G;  3PUZ A;  4LUV A;  5FLX c;  2CQO A;  1NMG A;  1V43 A;  1SFO H;  1QUQ B;  2PI2 E;  1Q46 A;  1M1K C;  4A3L H;  1OXT A;  4OON A;  3SGI A;  3M4Q A;  2Z6K C;  3U50 C;  2HT1 A;  4QJF A;  3K80 C;  1C7Y A;  4EX5 A;  4BY1 G;  4JBJ A;  4GNX C;  4P74 A;  3S17 H;  4IOA A;  3F8T A;  3H15 A;  1X56 A;  4DUZ Q;  3AYH B;  2JE6 I;  1OXV A;  4A3I H;  3M4O H;  1IZ6 A;  4R4O A;  2ZM6 L;  4NPS A;  3J7A 5;  4APV A;  2N78 A;  4RG1 A;  4AH6 A;  4B3S Q;  3M3Y H;  3S2D H;  1KHI A;  4GN3 B;  4JCV E;  3S1R H;  2I5L X;  4L5T A;  4LUO A;  1Z9F A;  4HJ5 A;  4B3S L;  4BXX G;  2VQF Q;  4A3K G;  2B29 A;  1CKN B;  4IJH A;  1PH2 A;  3PIO A;  4DR5 Q;  4HID A;  2AWN A;  4HJA A;  1PH1 A;  4L5S A;  1FGU A;  4WJ4 A;  4B3T Q;  1VQD A;  4QGU A;  3CCS A;  2NZH A;  4DR5 L;  4B3R Q;  4C2M H;  1VQJ A;  2RHQ B;  1IYJ B;  1TWH H;  4B3T L;  2WAQ E;  4X66 L;  1D7Q A;  4AYB G;  4C3I H;  2Q2T A;  1N34 L;  4TVA B;  3I4N G;  1H95 A;  2UUA Q;  1K8G A;  4MTN A;  1Z47 A;  4R4T A;  4QY7 A;  2IT1 A;  2NVY H;  3CCJ A;  2R92 H;  2JEB I;  4A3M G;  4WJ3 M;  3JAM c;  4JI8 Q;  4K0K Q;  1I94 L;  3G6E A;  4KHP Q;  1YEZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...