1N33L

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position at the a site with paromomycin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 12
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1n33L00
4KHPL 3CP0A 1Y14B 2MQHA 3T1HL 2E2HH 2ZJPA 4IFDI 1E22A 3ULLA 4GS3A 1X6OA 4DV4Q 1Q7YC 1N33L 4B3RL 1VQAA 1IBKQ 2JA8G 4LFCL 3PO2H 2QGQA 3S1MH 5M3MH 3BZKA 3RLFA 5IP7G 3DLLA 2YTYA 3S17H 4A3BH 1YHQA 2Q2HA 4LF6Q 4DR2L 1TWGH 3E9HA 4DV5L 2EIFA 3KLWA 4AQYQ 2CKZB 1TWAH 3AQQA 3W1BA 1PH7A 2D0PA 3L0OA 4BBSH 4JOIA 2IX1A 4JCVE 3OTOQ 4APVA 1K8GA 2A1AA 1I94L 3GTGH 2HHHL 4LFAQ 4DAYB 2LXJA 3BZCA 4JC0A 3CC2A 4DV2Q 3RN5A 1B70B 3PO2G 1JMCA 2PNHA 3FKIH 1ASZA 5M3MG 1A8VA 5AJ3L 4JYAL 4B3TQ 3GTJH 2IHEA 2JA9A 2RHQB 2C35B 1PFSA 5M5XH 1X9NA 3U4VA 4UP8A 3H15A 4X64L 4A3BG 4PMWA 4GNXB 2UXDL 1EIFA 4P72A 1PH4A 4TQUS 2KHIA 1SE8A 4GLVB 3S15H 4BBSG 4LF7L 1QZHA 4X62Q 5ELOA 1MKHA 4R4TA 2WP8J 2IT1A 5IE8A 4GKJQ 4JI3L 1FL0A 1NBWA 4JBKA 2UU9Q 3CF5A 2PMZE 2UXCL 1KL9A 2NZHA 2I0QA 4K0KL 4DR1L 2NVTH 1EIYB 4JV5Q 3FKIG 4MNOA 3UDGA 1BKBA 2MNAA 3T1HQ 2HT1A 4KHPQ 1VQOA 1P8LA 2E5LL 1N33Q 3UE1A 3TQYA 4B3RQ 4JI6L 1Q1BA 3D0FA 2NVXH 5BR8Q 1E3PA 5C0XJ 4H02A 3A5ZB 3A0JA 2BH8A 2AWOA 2KBNA 3S1NH 4DR2Q 5JEAG 1I3QH 1XPRA 4DV5Q 2JEBI 3AFQA 3HFZB 3M9BA 2B3GA 3FP9A 4JBJA 4R4IA 4GOPC 4JI4Q 1D7QA 1PV4A 1WI5A 1CKMA 5GADC 1XMOL 1YITA 1SRUA 1VS0A 2NVQH 3PUXA 3G71A 4JBWA 4DR3L 2ES2A 2JE6I 1HZAA 1I94Q 4POFA 3CW2C 1O7IA 2HHHQ 1YHAA 3A5UA 4C3JH 1J5EL 1K0RA 3OYYA 3VDYA 3S16H 2N3SA 3T1YL 1JJ2A 2UUAL 3MEFA 2K14A 3W1GA 5AJ3Q 1PH2A 4JYAQ 4DV1L 2DGYA 5HY6A 1QZGA 4IFDG 2UXBQ 4X64Q 3TS2A 1VQ4A 4JI5Q 3E9IA 3PUWA 3KJPA 4XTCS 2VZAA 4C2MH 3KFUA 1JT8A 3ER0A 5EAYA 4NXML 4JI8L 1UE6A 1G291 2H5XA 5E7NA 4DR4L 4LF7Q 4R1JA 1SN8A 2K75A 3PUZA 3JAMi 3RZDH 4JI3Q 3M4OH 2LXKA 3W5OA 1IZ6A 1K73C 1W3SA 1VQ5A 1GD7A 4K0KQ 1UE7A 2WB1E 1X65A 2IX0A 3K80C 1V43A 4YHHL 1MJEA 4GKKL 2OTJA 1VQHA 1CUKA 5IWAQ 4LUVA 1MIUA 4DV0L 1KRTA 2E5LQ 2E8GA 1M90C 2FXQA 3UDXA 1YHBA 2CQOA 4BA1I 4JI6Q 3S1QH 4NXNL 1KQSA 4X66L 5JJLA 1HR0W 4IJLA 1KD1C 3MXNB 4GNXA 4DV3L 1QVFA 1VQ9A 3PO3H 1MJCA 4JOIC 1E7ZA 1X3FA 2GVAA 1PHJA 2CCZA 2ZJQA 3EN2A 4UY8C 2VY3A 3DM3A 4O2DA 2JQOA 5HGQA 3NBHB 1AH9A 1OXXK 1CKOA 2CFMA 1YJNA 2R93H 2WB1G 4IOCA 3S24A 5C3EH 4DR3Q 3ZJYC 2ID0A 1Y1WH 3M7NA 4GLAC 4QL5A 2NN6I 1VQBA 1FVIA 1J5EQ 2K5NA 2OQKA 3CPFA 2OTLA 2ZM6L 4KHZA 3T1YQ 1W2BA 4J15A 2UUAQ 2YU9H 1L1OA 1UEBA 1LM0A 2K52A 2PI2E 4IPCA 4R4QA 4DV1Q 1IBML 4R4OA 1XNQL 3PO3G 3S2DH 1N32L 1C9OA 2NVYH 1VQDA 2LSSA 3ULPA 1K9MC 4YWKA 4NXMQ 1YVCA 4JI8Q 2F4VL 3GTMH 4DR4Q 1PYSB 2R93G 3CD6A 4A75A 4A3FH 5C3EG 1Y1WG 1KXLA 2KENA 3ICEA 5IYBH 4OXPA 5C4JH 3JC66 1WOCA 1XTDA 1NMGA 3RN2A 2I5MX 4YHHQ 2V1CC 4GKKQ 4HJ5A 5FLMH 3K7UC 5K36G 3BU2A 4X65L 5M5WH 3D31A 1Q82C 3KF6B 3J80i 3STBC 4DR7L 4X66Q 3ERSX 3HOUH 1B8AA 3NEMA 3CQZH 5FLXc 3F8TA 3PCOB 2MFIA 1EFWA 4DV7L 3CCUA 4IOAA 4A3FG 2R6GA 1QVCA 4QY7A 1WCMH 2K5HA 4LF9Q 4X6AH 4LFBL 5IYBG 4LF8L 3Q8DA 1I5FA 1N36Q 4JBMA 1HZ9A 4C3HH 2PQAA 5IP9H 2YV5A 2F52A 4JG2A 4OWWB 3U4ZA 5C4XH 5FLMG 4B3MQ 4A4IA 5LMUQ 3GO5A 1NE3A 2YTVA 4DR5Q 3OW2A 3PSIA 2L15A 2XGTA 2ZTDA 3CXCA 2Z0SA 3J80c 2ZM6Q 3HOUG 3GTLH 4UP9A 2ALYB 5IYCH 5C44H 3G4SA 1IBMQ 1XNQQ 3J7ZC 1K83H 1PA6A 2HIXA 2NZOA 1N32Q 1L1OB 4DK3C 1NJIC 4GN4B 4LFCQ 3K7AH 1WCMG 4UP7A 1Z9FA 3HKZE 2IHFA 5ELNA 4YCWA 4IJHA 3CCQA 4OONA 4YCVA 5IP9G 2EQSA 3TEHB 1VQFA 4KLKA 5C4XG 4IPDA 2ASBA 1IBLL 1OXUA 2N49A 3RR5A 2Q2IA 4YCUA 3PIPA 2VQEL 1V1QA 5IYCG 5C44G 4KI0A 4QJFA 4PZ7A 1FGUA 4PG3A 4X65Q 4GNXC 2UUBL 4QGUA 5LMNL 2NN6G 1A62A 1FJGL 1JJGA 2K5VA 4JI0L 3F2BA 4DUZL 2MO0A 1EWIA 1OXTA 3HKZG 4O0AA 4A76A 4LW1A 1K8AC 1IL2A 3TRZA 1EUJA 1Q1EA 4YY3L 1PH9A 1CSQA 1R9TH 2UXDQ 3L2PA 1CSPA 3GD7A 1EYGA 1HH2P 3K0XA 1HR0L 4LFBQ 3CCMA 1LTLA 3PUYA 2KCTA 4JI1L 1RIPA 2BH2A 4A3DG 1VQCA 4A3EH 4LF5L 4R4CA 1VQGA 4IFDJ 3PUVA 4HJ9A 3EIVA 2PQAB 2R92H 1AE2A 2CWAA 3HOXH 4BBRH 1L1OC 2UXCQ 4EX5A 3M4QA 3I55A 4A3LH 2AMCB 5LMNW 1HJPA 4DR1Q 5IYDH 1AE3A 3J81i 2RF4A 3KDFA 3KF6A 1CKNB 1U5KA 4MTNA 3F2CA 1PYBA 5GROA 3PV0A 1IBKL 3K81C 2BA1A 3M3YH 2JK8A 3RZOH 1VQNA 5JJIA 1S72A 2DUDA 3AFPA 2D62A 3S1RH 3U50C 1TWFH 1L0WA 4A3EG 4WJ4A 4HIKA 1H95A 3K8AA 4RG1A 2QEXA 2F3IA 3H0GH 2R92G 3HOXG 3AEVA 1V9PA 5DLQE 4BBRG 1QUQB 1PH8A 1IBLQ 1XMOQ 1OXSC 4RMFA 5C0XI 4A3LG 1YI2A 1B7YB 5IYDG 4OO1I 3ULJA 2VQEQ 3BJUA 3J81c 2JA7H 2Q2UA 1VQPA 2AHOB 3H3VI 2I5HA 2RHSB 1LYLA 5JJKA 2AWNA 4AIMA 4P74A 4OWTB 4BY1H 1I6HH 3RLOA 2RCNA 3KYHC 2Z6KA 4HIDA 1EOVA 2JA5H 1XMQL 4LUOA 1VQKA 3S14H 1X3GA 2ATWA 2AKWB 4OX9L 2R7DA 1YJWA 4MZ9A 4YY3Q 1BBWA 3H0GG 1HR0Q 1E24A 1VQMA 3HKSA 4DR6L 4B3SL 4JI7L 4JI1Q 4DK6C 4OWXB 3RLNA 4LF5Q 1X54A 1YIJA 4GKJL 4WJ3M 2D0OA 4IPHA 2JA7G 1GKHA 1VQ8A 4Y52H 4BY1G 4HJ7A 1WFQA 1Q12A 2CWPA 5M3FH 1TWHH 2JA5G 1A0IA 1LUZA 4Y7NH 1G51A 1UWVA 4UPAA 3GTPH 4DV0Q 3CMEA 4L5TA 2YTXA 3AYHB 1UE5A 1JB7A 4A93H 2Q2TA 1BVSA 3J7A5 3KDFB 4NXNQ 1IYJB 5BR8L 3CMAA 1SROA 3RNUA 4EQ5A 1NTGA 1Y1VH 3EBEA 3G6EA 2B29A 1GO3E 1DGSA 2BA0A 4P71A 4PZ6A 4DV3Q 1GM5A 2UUCL 3PF4A 1D8LA 2B63H 1Q46A 3UE0A 2VQFL 4A3CH 1VQEA 5GAGC 3NELA 3STBD 4JI4L 4POGA 1TXYA 3LGJA 1JJCB 4LWCA 1I50H 3CPWA 1BBUA 2QA4A 5IT9c 5M3FG 2VW9A 3G48A 4DUYL 1XJVA 1OTCA 4A3JH 1XPUA 3J81j 4A3KH 1G6PA 5GQOA 1N34L 3HOWH 3I7FA 1IXRA 4HIMA 3HOVH 4GOPB 3M4PA 5GAHC 4A93G 3CCLA 1TWCH 3B6YA 1CKNA 2JJQA 3F2DA 1X56A 3TS0A 1ASYA 1XMQQ 2K50A 3CAMA 1Y1VG 2K4KA 4JI2L 2I5LX 2UXBL 4L5RC 1SLJA 2WFWA 3H3VH 4DKAC 5H1SE 4JI5L 1M1KC 4OX9Q 5IY0A 1E1OA 2GVBA 4LF4L 2B63G 3GTOH 4A3CG 4QIWE 5M5YH 1Z47A 1PH3A 4DR6Q 4B3SQ 4JI7Q 4A3GH 2F4VQ 3GTKH 1UE1A 3FHWA 1N8RC 4DNIA 3S2HH 1QUQA 4PZ8A 4A3JG 3GTQH 1VQ7A 1Q8KA 4A3KG 1C7YA 2VNUD 1RL2A 2A8VA 3TREA 1YZ6A 4DV6L 3HOWG 3HOVG 3PGZA 4A3DH 4C3IH 1X3EA 1EQQA 5C0XG 1OXVA 1KC8C 4BA2I 1PVOA 1PH1A 4OO1G 5IWAL 4AYBE 3M85A 5JEAJ 1HNWL 4IO9A 1HNZL 4GLXA 1X55A 1XNRL 3WWVA 1VQIA 4A3MH 3HOZH 1N9WA 2OQ0A 4P73A 4HJAA 4DR7Q 3SGIA 1J6QA 1YEZA 4HJ8A 1GVPA 4GN3B 2MO1A 2KCMA 4A3GG 3KJOA 3CC7A 3E0EA 4LUZA 1HNXL 1NMFA 4DPGA 5FJ8H 4DV7Q 1HZBA 4NPSA 1KIXA 3CCEA 2JA6H 1SMXA 2VQFQ 4LF8Q 2PI2A 3GDEA 4NB3A 1EQRA 4DUYQ 4A3IH 1U0LA 3IRBA 3CCSA 2N78A 5GAEC 4L5SA 2R7ZH 3I4NH 1HZCA 1C0AA 2Z6KC 4AYBG 1SFOH 2N8NA 1N34Q 2WAQE 3HOYH 2KHJA 4YWMA 1Q86C 2JEAI 1WYDA 4A3MG 3HOZG 3U58A 2XTIA 2VUMH 3NENA 1VCIA 2E2IH 4JI2Q 4DV4L 2HQLA 2UUCQ 5FJ8G 2ZTCA 4LF4Q 1VQJA 2JA6G 1VQ6A 4BY7H 3A74A 4BXXH 3CCRA 4HIOA 1VQLA 2ZTEA 4A3IG 1K3RA 1YBYA 1JE5A 1KRSA 1T9HA 3I4OA 2E2JH 1NY4A 4TVAB 2YYZA 1KAWA 4LF6L 3I4NG 4P75A 2R7ZG 3KOJA 4AQYL 4DV6Q 3CCJA 1YNXA 3UDIA 2WAQG 2HIVA 3CCVA 3CC4A 3HOYG 4XIGS 3I56A 1KHIA 1A63A 4ME3A 3UDFA 3OTOL 2EXDA 4QQBX 4GOPA 2VUMG 1YJ9A 1S3OA 4LFAL 2OCEA 3F1ZA 1HNWQ 3I4MH 1HNZQ 4DV2L 2OWOA 2VS1A 2UUBQ 1FJGQ 4FDBA 4AH6A 2Y0SE 5LMNQ 1P16A 3PF5A 1XNRQ 4LNQA 4BY7G 4JI0Q 2R7FA 1E1TA 1WJJA 2VL6A 4DAMA 4DUZQ 4ALPA 4B3TL 4BXXG 2IY5B 3I2ZA 3L7ZC 1HNXQ 1XPOA 1S40A 1PH5A 1SR3A 2JA8H 3JAMc 1PH6A 4LF9L 5IP7H 1N36L 2GN5A 3PIOA 1L2FA 4X62L 4GN5A 4IPGA 4L5QA 2A19A 5J3BA 2UU9L 4B3ML 2ZJRA 5LMUL 3I4MG 4DR5L 1QVGA 1Q81C 3KF8B 2Y0SG 4YWLA 4JV5L
chains in the Genus database with same CATH superfamily
2MQHA 5CV5A 1RTNA 2O4XA 2K6AA 4IZ8A 3PO2H 3BVZA 5M3MH 3BZKA 3DLLA 2J4XA 4TKOB 2YTYA 4Y7NB 4KK7A 3GTPB 1PLFA 3MTSA 4ZLTF 4DR2L 4LF6Q 4AQYQ 1TS5A 3W1BA 1XTCD 2D0PA 3L0OA 3Q0AA 5CV8A 1CHQD 4APVA 3FPUB 3N52A 2B63B 2HHHL 1KLGD 2WV6D 4DV2Q 1B70B 2XSCA 1I50B 4C1NK 4K2KA 3FKIH 1A8VA 5AJ3L 5D14A 4A3JB 4A3KB 5C4XB 1X9NA 4A3BG 3U4VA 3H15A 3KK7A 2Z1CA 1NNXA 1EIFA 1PH4A 4TQUS 1SE8A 3S15H 2JYOA 4BBSG 2RDGA 4ABNA 4G4KA 4PQXA 5L37A 5ELOA 1MKHA 2A68C 4R4TA 2WP8J 3TZDA 3OSOA 5C4HA 1FL0A 2UU9Q 1U4PA 4ZUIA 1QCBD 4O1NA 2UXCL 2I0QA 4K0KL 4DR1L 3RMHA 1SYDA 1KDAA 1N33Q 3UE1A 4JI6L 1Q1BA 2L11A 2NVXH 1PRTF 4DXFA 2F0TA 5KNDA 3A0JA 4CDCC 3CU7A 5JEAG 1XPRA 3NBHA 2JEBI 3AFQA 3HFZB 3A8IE 4R4IA 3C46A 1D7QA 1WI5A 4QB4A 5GADC 1SRUA 4O42A 2NVQH 3PUXA 3G71A 1Z7TA 2JE6I 3KF8A 4POFA 1YHAA 2M2LA 1K0RA 3NE5B 3K5LA 2MHVA 5FO9B 3A56A 1SFOB 5HY6A 4QUFA 2UXBQ 2WAQB 3JAML 4FF1A 4JI5Q 4MIUA 4C2MH 3KFUA 4F7XA 3C2PA 3SE0A 4CKCA 3NK9A 1O7LA 5ELEA 3QIAA 2Z4HA 3PUZA 1K73C 4C3JG 4BY7B 1GD7A 1JOOA 1LACA 1CUKA 2PCFB 3GV3A 5FK9C 1YHBA 4JW0A 4NXNL 4FXKC 1RD9D 3MXNB 4DAVA 5CV7A 4V190 3I4MB 1SE4A 3PO3H 3QB3A 1SNMA 1X3FA 1ZKOA 2Y0SB 2CCZA 3BZDB 4O2DA 1TU2B 5HGQA 5IGDA 1NUCA 1WTXA 3OW7A 4DR3Q 5C3EH 1SAPA 3M7NA 4GLAC 4L6TB 1FVIA 2K5NA 2OQKA 3SK5A 2ZM6L 3T1YQ 4ODGA 1W2BA 1GUWA 2YU9H 1UEBA 1LM0A 1QOHA 1SDFA 1XNQL 5K36H 1F2ZA 2QDLA 1K9MC 4UHVA 4M8AA 2NUCA 1F77A 3I90A 1JICA 1PYSB 4WFN3 4A75A 3CD6A 2R93G 1Y1WG 4A93B 3ICEA 3PO2B 3VR4A 5IYBH 5C4JH 5M3MB 2OF1A 2I5MX 1V1PA 2V1CC 1EY7A 2ICIA 1CM9A 3D6WA 3DHQA 2B2UC 1CK1A 3J80i 4V0BA 4X66Q 5EQ0A 4CKEA 1LO5D 2MFIA 2H1EA 3CCUA 1WCMH 4YIJA 4LFBL 3FKIB 1N36Q 4JBMA 2B2WC 4X3TA 4C3HH 2L4NA 4RAUC 3U4ZA 2JN4A 4B3MQ 3OW2A 3PSIA 1ONLA 5LHY1 1PFBA 3CRLC 3HOUG 2ALYB 2A68D 5CMDA 2QW7A 2EJFC 2NZOA 1L1OB 2NN6H 2Q8TA 4DK3C 3MXNA 1Z9FA 1EQVA 1LTID 1PTOH 1X3QA 4YCVA 5IP9G 1ICFB 4A3MB 2SEBD 5C4XG 4IPDA 2F03A 2NVXB 1DCZA 4KY6A 5J1ZA 2K03A 3NXWA 1HTPA 5A35A 2MUYA 2A5HA 1FGUA 4PG3A 5KEEA 4GNXC 4QGUA 1UNSA 1A62A 1JJGA 1BQQT 2NVQB 2K5VA 3F2BA 3IL8A 4DUZL 1EWIA 2R7ZB 1K8AC 1I4GA 2O2LD 4TRDA 2EYMA 2UXDQ 3L2PA 1EYGA 1HR0L 3MFGA 4FP5D 4OGQC 2KCTA 1K8MA 2BH2A 3BG3A 4MN3A 4K8IA 3HOXH 4C2MB 1QNKA 3N6RA 4OHJA 1HJPA 4MTKA 4HTHA 2X6GA 3BYYB 2Z4IA 1MHWC 2RF4A 3KDFA 1CKNB 5ISRA 1CA6A 4F8MA 5GROA 3PV0A 2BA1A 2JK8A 5IIFA 2EE1A 3X3NA 1Y69U 2D62A 3S1RH 3TBIB 1L0WA 2KUMA 3T51B 1OO9B 2QEXA 2R92G 1KDBA 1TT2A 4P2CB 4JK1C 4A3LG 1JB3A 1YI2A 2DNCA 2R61A 3J81c 1V8QA 1VQPA 2RHSB 1DD2A 4K14A 3J81E 1EOVA 5T1GA 2EY1A 2JA5H 5C3EB 5CV9A 1XMQL 1O7ZA 1X3GA 4OX9L 1BBWA 5IGFA 1VQMA 3HKSA 4E6IA 4DR6L 4DK6C 1STEA 4IPHA 2EOTA 2JA7G 4Y52H 4HJ7A 1WFQA 1Q12A 2A74C 2HD3A 1XYIA 3CMEA 3I73A 5C4JB 1UE5A 1JB7A 2Q2TA 4F87A 3J7A5 4KMUC 3RNUA 4EQ5A 4RGMA 3I8ZA 2UUCL 2TMPA 4ZAIA 1BR9A 5NUCA 3WOFA 5GAGC 3NELA 1FR3A 1TXYA 3CPWA 1OTCA 5DNFA 4ZUJA 3J81j 4FXGC 5GQOA 3HOWH 1BCPF 1WCMB 5LL6X 4A93G 3CCLA 3B6YA 3BDCA 2QEJC 1CKNA 3TS0A 1X56A 3ND9A 4CKBA 2UXBL 4KN7C 3H3VH 2HDLA 4JI5L 5H1SE 1M1KC 4IUVA 5M5YH 4RGNA 4A3GH 4B3SQ 2F4VQ 1UE1A 5M9OA 1XXGA 1SYGA 1I4QA 3I70A 3GTQH 1Q8KA 4OIKA 1AZPA 1C7YA 4L63B 2VNUD 3HOVG 1PTOB 3PGZA 3PQIA 1SNDA 3I3CA 1EQQA 1KC8C 4AYBE 1LT5D 4RCOA 2QCPX 4RKBA 1VQIA 3HOZH 4P73A 4HJAA 4HJ8A 1J6QA 1GVPA 3A8KE 3NWSA 4GN3B 2MO1A 3KJOA 5EKLA 2WIIB 3FDTA 5FJ8H 4DV7Q 3CCEA 3S16B 1FGBD 3H6MA 4NB3A 4A3IH 1K28A 1CTMA 3IRBA 3J81L 2B2TA 1NR4A 3HOYH 3EFXD 1Q86C 1WYDA 4A3MG 3U58A 1EYAA 1R4QB 3RZDB 2XWJB 2IJ0A 3HOXB 2FINB 3C3LA 3TP7A 4LF4Q 2JA6G 2WB1B 1FD7D 1SXTA 3CCRA 1VQLA 2ZTEA 2F0IA 1YBYA 2PO4A 2E2JH 3HG9A 1G91A 2YYZA 2R7ZG 2K5QA 4N8FA 3UDIA 3K5MA 1I4PA 1O80A 4ME3A 3OTOL 2EXDA 3SK8A 1YNJD 2VUMG 1YJ9A 1S3OA 2OCEA 1D6EC 3F1ZA 2OWOA 2VS1A 5LMNQ 2KOLA 2EYLA 1ZYRC 1IL8A 5C5MA 2VL6A 4KD4A 3G6JB 3ERQA 2IY5B 3L7ZC 4EVOA 1HNXQ 1SR3A 1PH6A 1N36L 1GHJA 2GN5A 3TDQA 3QOJA 4IPGA 2B2YC 4L5QA 4B3ML 5COYA 4YWLA 3T1HL 2ZJPA 1E22A 2PQEA 1WTWA 1TY2A 2ZXPA 2JA8G 3FVQA 2QGQA 2PW5A 3S17H 1BCPB 2L5TA 3P20A 5CORA 5M5WB 4DV5L 4L8JA 2K32A 1PH7A 4HSPA 3CQZB 4XQNA 4WORA 2IX1A 4JCVE 2F0OA 1PFNA 4LFAQ 3J7AV 1QNUA 1BBXC 1JR0D 4B3TQ 2RHQB 3HOWB 2E74C 4IURA 4X64L 4PMWA 2UXDL 5KNBA 4LF7L 1QZHA 1K0SA 1Z6HA 5IE8A 5E4XA 1QILA 1NBWA 1B3QA 3K7AB 2PMZE 1CZGA 3O13A 1K3BC 1D5MC 4QIWB 3I72A 4A3GB 1A15A 1GUTA 4JV5Q 4KHPQ 4CHTB 1BKBA 2HT1A 3GTQB 2X6LA 1P8LA 2E5LL 2BDNA 4B3RQ 5KRUA 1QE6A 1LV9A 1F9SA 2F1MA 3K59A 3E5SA 1ENAA 4NP5A 2B8FA 2BH8A 4IFDH 1NSNS 3S1NH 3NWTA 2SNMA 3HOZB 3M9BA 2RDFA 4JBJA 4JI4Q 1SE3A 4JBWA 1I94Q 4KJOA 3A5UA 1J5EL 5TSSA 1AEXA 3VDYA 3K58A 3MEHA 2N3SA 4A3IB 5DAUA 2K14A 3W1GA 4JYAQ 1QZGA 3HOYB 1VQ4A 4I7AA 4OELB 3E9IA 2DN8A 1DJRD 1JT8A 3NQIA 4JI8L 1DOLA 5E7NA 1G291 2H5XA 1UEAB 1K8OA 4JI3Q 1SNCA 4Q0FA 2N55A 3K80C 1A2UA 1X65A 1V43A 4YHHL 2E2JB 1MJEA 4GKKL 5IWAQ 1NCVA 4DN4M 1SEBD 3H0GB 3S1QH 2MJ8A 1U4MA 4IJLA 1KD1C 1A3UA 2HDMA 1MJCA 2ZT9C 1E7ZA 4JOIC 2GVAA 3R93A 3EN2A 1ZYRD 2DNEA 5CYUA 3NBHB 3BS1A 2CFMA 1YJNA 4KY5A 2WB1G 3S24A 3ZJYC 2ID0A 3PIO3 2B2VA 4WRDA 1L0YB 2NN6I 1VQBA 2XIWA 4TSSA 3CPFA 2UUAQ 4H13C 1FNUA 4BWGB 4DV1Q 5D3DA 2PI2E 4ILWA 3TN2A 1C9OA 2NVYH 2LSSA 3PMFA 2DJGC 2OXPA 4NXMQ 3GTMH 2F4VL 1E2WA 4DR4Q 5C5LA 1J8IA 1BOSA 2HUGA 1KXLA 1BO0A 4OXPA 4HMIA 3JC66 4HCEA 3QJYA 3RN2A 2I07B 1HCZA 3TP8A 5FLMH 3K7UC 4X65L 1HPCA 4PMCA 1KTKA 1EIGA 3ERSX 1B8AA 3M4YA 5BN4A 5FLXc 1CQVA 3F8TA 4DA2A 3OPOA 4DV7L 4IOAA 4A3FG 4UDUC 4QY7A 5FLXE 3CHBD 4LF9Q 2NYZD 1HZ9A 4U673 4JG2A 1STYA 5ELCA 2WKCA 5EKIA 3VR2A 2YTVA 2XGTA 1CI3M 2ZTDA 2Z0SA 2WKDA 1SYBA 3GTLH 2SDFA 4RHRA 5IYCH 1IBMQ 2G9HD 4ZQ3A 1K83H 1PA6A 1ET6A 4ZKCB 2HIXA 1N32Q 4GN4B 1DXMA 4UP7A 2RQXA 4ZCKA 3K57A 2K7VA 5ELNA 4IJHA 3URYA 4OONA 3CCQA 3KBGA 3SK4A 4Z9CB 2E76C 3TEHB 3R3OA 2FMMA 4KLKA 2BDOA 2EXZA 2F0HA 1OXUA 2N49A 5IGBA 4YCUA 3SEBA 4LAAA 4KV6A 3S1NB 3VR5A 5C44G 1H9SB 1V1PB 1W6JA 3UI2A 5LMNL 2B8GA 1STNA 3HKZG 4QUCA 4LW1A 4A76A 3D3RA 1UUPA 3ND8A 1B1ZA 1CSQA 1R9TH 1PRTC 1HH2P 2N88A 1Q90A 4JI1L 1STBA 4K5VA 1VQCA 4A3EH 4LF5L 1JC7A 1GXDC 1VQGA 4IFDJ 5A2QE 4HJ9A 4FF4A 2CWAA 1L1OC 4DK1A 4EX5A 3OMGA 5LMNW 1Y8PB 1EU4A 3J81i 4DFAA 4IUPA 3M3YH 1HRJA 5JJIA 2DUDA 1JWUD 1TVXA 1TWFH 2VB3X 2QILA 3S1QB 4XXEA 1FNVA 4CDEC 5J39A 3AEVA 1V9PA 1PH8A 4BBRG 1QUQB 1IBLQ 1OXSC 5IYDG 3L3OC 1CHPD 3I4LA 2FMCA 4C56C 2VQEQ 1AFPA 3H3VI 1LABA 1LYLA 2AWNA 1I6HH 5F2DA 3RLOA 2RCNA 4HIDA 4LUOA 1HHVA 1EU3A 2R7DA 1YJWA 1BNZA 4YY3Q 2D5DA 3H0GG 1E24A 4IUQA 4JI7L 3P75A 3VR6A 4K8JA 4RA8A 1X54A 4Q5VA 2NVYB 5I6YA 1VQ8A 1MD2D 4BY1G 2HCIA 2CWPA 4ZKBB 5M3FH 2IWHA 1H9SA 1LUZA 2AUJD 1G51A 2CQAA 3KDFB 3TZUA 1IYJB 2NBFA 1SROA 1NTGA 1Y1VH 3EBEA 4DV3Q 4P71A 2BA0A 3PF4A 3VYUA 1TY0A 1D8LA 3FPPA 1VQEA 4JI4L 4POGA 1JJCB 4DUYL 1XJVA 1BBUA 2SOBA 4CBVA 4CDFC 5IGEA 4NW2A 1G6PA 1N34L 3M4PA 3S15B 5GAHC 2J0TD 1SJED 2F3VA 3OIPA 2Q8RE 4K6DA 5C0XH 4FF3A 1QJOA 1ASYA 2F0KA 2IL8A 4OO1H 1F9PA 3BDOA 4UAIA 4JI2L 4L5RC 2WFWA 2B63G 5JAVA 2ENBA 4KKUA 4A3CG 3TMEA 3GTLB 1H9JA 1F2MA 2KQ3A 3V96A 1K83B 1QUQA 4PZ8A 4A3JG 3KUPA 1VQ7A 4A3KG 1VMCA 1BXTA 4A3DH 4DF7A 4H0LC 4C3IH 1MI2A 2XVSA 5IWAL 1HNZL 3MHBA 1XNRL 1YNNC 1N9WA 2OQ0A 1WD0A 1PTOF 4JVZA 1T5XD 3CC7A 4DPGA 1HZBA 3VR3A 4HEDA 2VQFQ 1CT1D 1E2VA 4LF8Q 1GOZA 4CDDC 4FYDA 1PZKD 5EPLA 1HUNA 5GAEC 4ULLA 3I4NH 1HZCA 1U4LA 2Z6KC 1R9TB 1EYCA 1PZJD 1PRTD 2MPMA 1KABA 4YWMA 4A3EB 2XTIA 2RCFA 1VCIA 1X32A 4X3SA 2HQLA 3U9SA 2ZTCA 1D5ZC 1VQJA 2K5DA 1YNJC 1K3RA 3NTIA 5G3LF 4LF6L 4RH6A 2K33A 3M3YB 3KOJA 4AQYL 4DV6Q 3CCVA 2WAQG 2HIVA 3CC4A 1KHIA 2F0SA 1TWFB 2Z9HA 3PO3B 3MXPA 1EEID 3LNNA 3A8JE 1HNWQ 2HQEA 4DV2L 3D4WA 4FDBA 1GUOA 1FJGQ 1P16A 4BY7G 4JI0Q 2R7FA 1E1TA 1WJJA 4BXXG 4G7OC 2LY7A 3T53B 1XPOA 2C9OA 1G2SA 1PH5A 1I6HB 4LF9L 5ELBA 2YU9B 2QF7A 3MFYA 4G7ZC 4XYOA 4HSVA 4IN3A 3NTKA 2UU9L 2ZJRA 3I4MG 3GP7A 1QVGA 4LMQD 2I46A 2Y0SG 3CP0A 1EIHA 4DAPA 4IFDI 1LT4D 1X6OA 3SR1A 4DV4Q 1Q7YC 1N33L 1IBKQ 5M3FB 5IP7G 3RLFA 2JXMB 4A3BH 1WTVA 4CJ0B 1TWGH 3E9HA 3QG1A 4LK1C 2EIFA 3KLWA 2LFNA 2CKZB 3GV6A 1TWAH 3AQQA 2O5JC 4IUNA 1LT3D 4BBSH 1Y1VB 4J6HA 3GTGH 2EYOA 4XQJA 4DAYB 3BZCA 4JC0A 2EJMA 2IX3A 3A55A 3RN5A 5AFWA 3PO2G 3NP8A 2PNHA 4C3HB 1ENFA 4B9WA 5M3MG 1SYEA 2JA9A 1RHPA 5CGKA 4GNXB 2KHIA 2CH4W 1I4HA 3A7AB 4X62Q 3OIQA 5I9OA 4GKJQ 2VXWA 5I9PA 5KIXA 5JEAH 4JBKA 1HFNA 3CF5A 2F4IA 3DWAA 1HQRD 2NZHA 1O7YA 3FKIG 4MNOA 2K01A 1VQOA 1BCPC 3C1EA 3TQYA 4A3DB 2BCOA 3QR8A 4C3IB 5BR8Q 1E3PA 5C0XJ 4H02A 4HAEA 2B39A 3T13A 3K0YA 2B2UA 4AYBB 2AWOA 4DR2Q 1D1IA 1I3QH 1YNND 5ELDA 1S5DD 4GOPC 1PV4A 1CKMA 4NMZA 3VYRA 1VS0A 3SVMA 4DR3L 1EWHA 1D1KA 1STHA 2Q8IB 1HZAA 2B2WA 1O7IA 2HHHQ 4C3JH 2KEDA 3T1YL 1B3AA 3MEFA 1X3PA 5AJ3Q 1PH2A 4MHEA 1EEFD 1Q3LA 3ZYYX 3TS2A 3PUWA 2VZAA 5C4ZA 4XYQA 1UE6A 1LLRD 1SN8A 1PFMA 2K75A 3WOEA 3JAMi 1I4RA 3M4OH 2LXKA 3W5OA 1IZ6A 4EQPA 1E2ZA 1W3SA 4IUTA 4K0KQ 3S1RB 1UE7A 2WB1E 2IX0A 2K04A 4DAYA 1VQHA 4LUVA 2O5IC 2RA4A 1KRTA 3SDZA 2EYPA 4KKTA 4JI6Q 5CV4A 1EZ8A 1KQSA 4X66L 1DOMA 1EY5A 4GNXA 4DXGA 4DV3L 1QVFA 3IKJA 5FO7B 1PHJA 1PMRA 4R8IA 2JA5B 1AH9A 1B9NA 1CKOA 2R93H 4NKLA 3DMUA 4IOCA 1Y1WH 3I91A 3MVVA 1EY9A 5BN5A 2QKIC 4G7HC 2KHSA 1H9KA 3OHXC 1PXUA 5G3LD 3DWQA 2K52A 5EGTA 4R4QA 1WTHA 3S2DH 3PO3G 2SNSA 3DM1A 3ULPA 4DGZA 1H9RA 4XQQA 3T56B 1YVCA 2Z6BA 4F88A 1RTOA 5C3EG 1AN8A 2KENA 4ZK9B 1B2TA 1JCKB 3NTHA 2DJFC 4A3BB 1TWGB 4HR7B 5K36G 1TWAB 1Q82C 1S5FD 4BBSB 3KF6B 3T16A 3HOUH 2OEOA 3NEMA 3FRPB 5KYLA 3GTGB 1DONA 3PCOB 1QB5D 2R6GA 3Q6SA 5EKKA 1SNOA 2ZXRA 4X6AH 5IYBG 4LF8L 1I5FA 1ICWA 2EJGC 4K5WA 2PQAA 5IP9H 1U9RA 3LX0A 2F52A 2NTSA 4OWWB 1JWMD 4FXDA 5C4XH 3RD4A 4A4IA 5LMUQ 3GO5A 1NE3A 4DR5Q 5M5YB 3AB9A 2L15A 1V1OA 3CXCA 2ZM6Q 1SSOA 4DU9A 3G4SA 1XNQQ 3J7ZC 2PMZB 4WJWA 1NJIC 4LFCQ 3EQLC 1WCMG 3VYTA 3GQBA 3HKZE 2IHFA 4U68A 4YCWA 4HN7A 1ZXTA 4C3HG 1BCPD 2EQSA 1EY8A 1EQTA 2ASBA 2Q2IA 3HP3A 4OIJA 5K5PA 3PIPA 1V1QA 1B50A 3PIP3 4N8X1 1LTTD 4QJFA 4PZ7A 5DEHA 1FJGL 2AQ1B 2NN6G 3NHHA 4JI0L 1TKWB 3EROA 1JOQA 1OXTA 2C5CA 3TRZA 3S9WA 1Q1EA 4C3JB 2F0NA 1KAAA 1CSPA 2A6EC 3GD7A 5E3FA 3K0XA 4LFBQ 3NPPA 2EYHA 3CCMA 2XN9C 2FJ2A 4A3DG 1IW7C 1NAPA 3NSWA 3R8BA 2PNRC 3PUVA 5HGTA 2R92H 1AE2A 3I55A 2EVBA 4A3LH 1AE3A 5D3IB 1SBBB 1R4PB 1ZEQX 3KF6A 4HCSA 1PYBA 1IBKL 3K81C 2GA4B 1J9OA 1S72A 1A6XA 3AFPA 1LTBD 1H95A 3K8AA 3G7LA 5CBEE 3RZOH 2F0GA 1TR5A 2L12A 2EY6A 3HOXG 1XMOQ 5C0XI 2XRSD 4OO1I 1WTPA 3ULJA 2OT2A 1SMYC 3BJUA 2JA7H 3U9OA 1II3A 4M1UB 3ONAB 1ILPA 1E0BA 2R93B 3KLSX 4LJZC 1Y1WB 5T1IA 1VQKA 1EFID 1KNEA 3S14H 3NBIA 1M4VA 2AKWB 4MZ9A 5I6WA 1HR0Q 3W2DA 4B3SL 3CKIB 3RLNA 1TIID 3S2DB 4GKJL 4WJ3M 1C48A 2EYFA 5D65A 3S17B 1DM0B 1TWHH 2WACA 4KY7A 2JA5G 1A0IA 1UWVA 4DV0Q 3MWYW 4L5TA 1F2YA 4A93H 1BVSA 1SJHD 3OWEB 4KTAA 1MGSA 5BR8L 1EOTA 1UAPA 1WTQA 2B29A 1GO3E 1DGSA 1AZQA 4FF2A 1Q46A 3HRZC 2DY7A 3HOUB 3LGJA 3CRKC 4LWCA 2QA4A 2G5DA 3NQTA 5IT9c 2VW9A 2KCNA 1XPUA 3IAYA 3D6CA 3I7FA 1IXRA 4X3KA 3HOVH 5IT9E 5I2YA 1KNAA 2B2YA 5CR3A 1TWCH 2JJQA 1HFGA 1XMQQ 3IFTA 2K50A 3CAMA 5EBDA 4RCNA 1SLJA 2QDBA 3D4DA 4K5XA 4DKAC 4OX9Q 5IY0A 1E1OA 2GVBA 4LF4L 3GTOH 2LMCB 3VA7A 4DR6Q 2LKVA 3GTKH 4OL7A 1N8RC 3QO2A 1MBYA 3S2HH 1EY0A 1EWCA 1RL2A 1FYCA 2KCCA 4G57A 3TREA 3HOWG 4I65A 3TSSA 1OXVA 4BA2I 1PVOA 1PH1A 3M85A 3X3MA 1G6ZA 1X55A 2Z8LA 3WWVA 4A3MH 3T4AC 1C8CA 4DR7Q 3H09A 3SGIA 1YEZA 1HTLD 4A3GG 2KCMA 3E0EA 1XX8A 1HNXL 2UUCQ 1KIXA 2JA6H 1EL0A 2L0CA 1M8AA 1TS2A 2PI2A 1EQRA 2V4DA 3D8GA 1U0LA 4OEMB 2N78A 4L5SA 2R7ZH 1C0AA 2N8NA 2MGSA 2WAQE 2A6ED 5DM63 3HOZG 1RDPD 1IW7D 2VUMH 1WVLA 1MSGA 2E2IH 2R92B 5FJ8G 1SNQA 1VQ6A 3E0JA 1B9MA 3OMCA 4A3IG 5I2XA 1JE5A 2R3ZA 1NY4A 1LTAD 2EZVA 4P75A 1VF7A 2PZWA 1YNXA 3HOYG 2A69C 2VB2X 4XIGS 1A63A 4QQBX 3AMUA 1TQOA 4LFAL 3RZOB 4BS9A 2UUBQ 1LT6D 1IKMA 4AH6A 2Y0SE 3PF5A 1F9RA 4H44C 1S4ZA 5FLXL 4DAMA 4B3TL 4ALPA 2JA7B 1SMYD 1SE2A 3DUZA 3NUCA 2JA8H 3MXGA 2K05A 4IQZA 3P1HA 3K5OA 5IT9L 4CJ2C 3S14B 5J3BA 2A19A 5LMUL 4DR5L 1Q81C 1I6VC 2F0PA 4RKLA 3GTMB 3R2IA 2RSOA 4JV5L 4KHPL 4JPBW 1Y14B 2E2HH 1JORA 3ULLA 4GS3A 4B3RL 1VQAA 1MSHA 1QG7A 4LFCL 3S1MH 4QF4A 1TWHB 2L55A 3V2TA 3HGBA 1B53A 5DM73 1YHQA 2Q2HA 1IHZA 2WINB 4JOIA 3OTOQ 1K8GA 2A1AA 1I94L 1LTGD 3FEWX 1BF4A 2LXJA 4S3SA 3CC2A 2G9DA 4DNRB 1JMCA 5JVH3 1ASZA 2F0MA 1GUGA 2FHTA 4R9WA 2L9HA 3TP6A 3GTJH 4JYAL 2IHEA 5M5XH 2C35B 1PFSA 4UP8A 4EGVA 3K5NA 3HOVB 2KECA 5A2QL 5CV6A 1CZWA 4P72A 3K6OA 1HA6A 1RJTA 1TWCB 2B2TC 4GLVB 1RCVD 2NWGA 1HA5A 2IT1A 5EBCA 4JI3L 3GTOB 1PRTB 1KL9A 1ML0D 1SYCA 4XDXA 3GTKB 2NVTH 1EIYB 3UDGA 2MNAA 3T1HQ 5CC4A 3S2HB 3WDNA 1VMPA 3D0FA 4KN4C 4CJ1B 3ITPA 3A5ZB 3KBXA 2KBNA 1GHKA 4DV5Q 4IALA 1XWEA 2B3GA 3FP9A 2LS01 1LTRD 4PNYA 1XMOL 2EPBA 1YITA 1I4XA 1PDQA 2ES2A 3HEJA 4I7ZC 3CW2C 4ZYSA 1A2TA 2JA6B 5E1FA 4FNFA 2F0QA 3OYYA 3S16H 4EQOA 2UUAL 1JJ2A 5ELFA 3VYSA 4DV1L 2DGYA 4IFDG 4X64Q 3KJPA 4XTCS 4RWSC 3ER0A 5EAYA 1PTOC 4NXML 2VUMB 1STAA 2XRQD 1HUMA 4DR4L 4LF7Q 2E2IB 4XT3B 2FFKB 4R1JA 3SHLA 3RZDH 1VQ5A 3LWEA 2OTJA 2PZTA 5JOBA 1MIUA 4DK0A 4DV0L 2E5LQ 2E8GA 1M90C 2FXQA 3UDXA 1WTOA 2CQOA 4BA1I 2A69D 1HXYD 2F0EA 2RVLA 1HR0W 5JJLA 4PMBA 4KD3A 1VQ9A 3RUZA 2CW0C 2ZJQA 4UY8C 1F9QA 2VY3A 3DM3A 3HZXA 2JQOA 3BVGA 1OXXK 2KEEA 2JA8B 1S5BD 4QL5A 1J5EQ 1T5EA 2OTLA 4KHZA 1CQFA 2ZXOA 4J15A 4QMGA 2XWBB 1Q8IA 1L1OA 1IBML 1JE4A 3HS0C 4IPCA 3L9AX 4R4OA 1N32L 1VQDA 1SNPA 3MC0B 1BDOA 4YWKA 2CH4A 2PYKA 4RFBA 4JI8Q 2E2HB 1QWYA 3MZ5A 4A3FH 2M9VA 1AW7A 1STGA 3S1MB 2D9UA 1WOCA 1XTDA 1NMGA 4YHHQ 4GKKQ 4HJ5A 1ESRA 3BU2A 5M5WH 3D31A 3E3XA 4DR7L 1ENCA 3STBC 1TS3A 3CQZH 2F0VA 1EFWA 4ME5A 1QVCA 2RBMA 2K5HA 1CFMA 3Q8DA 1B4OA 5IODA 3GTJB 2F0DA 5M5XB 2YV5A 1O78A 5FLMG 2PZUA 1W6KA 1TS4A 1PZID 2BOSA 2KA7A 3Q24A 2EY2A 3J80c 3OWFA 4UP9A 5CBAE 5C44H 2K28A 1DZ1A 1G2TA 2NB0A 3EJIA 2F3WA 3J80E 2AQ2B 2CVRA 2RDHA 3K7AH 2NVTB 3QOLA 5EJWA 5EPKA 5IGCA 5IOCA 3DWPA 1VQFA 3AU7A 4KJNA 4XT1B 5HURA 1IBLL 1B44D 2K5WA 3RR5A 3OOCA 4HMJA 3SXHA 4QCLA 2VQEL 5IYCG 2F0LA 4KI0A 5FO8B 4X65Q 2H4OA 2UUBL 1WTRA 4K2LA 2KVMA 2F0UA 2MO0A 4O0AA 1IL2A 3I4NB 1EUJA 5KGUA 3H3VC 3FMCA 4YY3L 1PH9A 2JP1A 3TP5A 1LTLA 2B2VC 3PUYA 3V05A 1RIPA 1RKNA 1ESFA 4R4CA 2F0WA 2AQ3B 3C1FA 5BN3A 3EIVA 2PQAB 1IKLA 2F0FA 4BBRH 2UXCQ 3M4QA 1PTOD 2AMCB 4DR1Q 4FVMA 5IYDH 3IFDA 1KLUD 4J8QA 3EA6A 1G8ZD 1U5KA 4MTNA 5KYIA 4GZYC 3F2CA 1VQNA 3U50C 4C1NI 3D4RA 4A3EG 4WJ4A 4HIKA 4R8NA 4RG1A 2F3IA 3H0GH 1VF5C 5DLQE 2A6HC 4RMFA 1B7YB 1PYWD 1L0XB 1GJXA 2Q2UA 2AHOB 2I5HA 2CW0D 3VA5A 5JJKA 4AIMA 4P74A 4OWTB 3SK6A 4BY1H 3KYHC 2Z6KA 1LTSD 4FO2A 1D2BA 2ATWA 1Y8NB 4J1MA 2BE5C 2PPBC 4JI1Q 1VDZA 1GUNA 4OWXB 4LF5Q 1YIJA 2D0OA 1EZ6A 5J22A 1GKHA 1DOKA 1F2LA 1HQMC 1C4QA 1NR2A 3J80L 3EVQA 4DNTB 1FNWA 4A3FB 1ET9A 4Y7NH 4UPAA 3GTPH 3MXUA 2IPKD 2YTXA 1H9MA 3AYHB 2EYJA 4NXNQ 1RODA 3CMAA 4KKSA 3MAQA 3H91A 3G6EA 4PZ6A 1GM5A 3A54A 2TSSA 1JQYD 1CA5A 2B63H 3MA2B 3UE0A 4B08A 2VQFL 2L1BA 4A3CH 3STBD 3R2TA 1I50H 1A3TA 5M3FG 3G48A 1S5CD 4CGYB 1WD1A 3BVMA 4A3JH 3KLSA 4A3KH 3DXJC 4HIMA 4GOPB 5C6AA 2MP1A 1A3VA 3F2DA 3Q23A 1DYQA 5JJZA 1Y1VG 2K4KA 4N9TA 2I5LX 2J7ZA 2NZ1D 5C3XA 5JPNC 4QIWE 4X3UA 1Z47A 4B9XA 1PH3A 4JI7Q 5C44B 3DEOA 3FHWA 4DNIA 4RGOS 1S5ED 4KHVA 2A8VA 4RGTA 1YZ6A 4DV6L 3HKZB 2P5ZX 1X3EA 2RSNA 5C0XG 1EYDA 2DY8A 5EPJA 4OO1G 1IYUA 1I3QB 5JEAJ 1EY4A 4IO9A 1HNWL 4GLXA 1RF2D 3BYTB 5I4DA 1BUVT 5KNCA 3BDLA 2K1BA 5FOBB 4LUZA 1ILQA 1NMFA 1SYFA 4NPSA 1SMXA 2KJXA 3GDEA 3H94A 3LWUA 4DUYQ 1EY6A 2AUKA 4C3IG 3CCSA 1JWSD 2E75C 2XNAC 4AYBG 1SFOH 1N34Q 1KDCA 2KHJA 4PV1C 5IGGA 2JEAI 1GUSA 3NENA 4N9PA 3M4OB 5LL6S 1IYVA 4JI2Q 4DV4L 4BBRB 3M7GA 4BY7H 3A74A 4BXXH 2E2DC 5JVG3 2CHBD 4HIOA 5JPMC 1KRSA 3I4OA 1T9HA 4ZRZA 4TVAB 2JSOA 1KAWA 4K6LA 3I4NG 2HCCA 3CCJA 1AP0A 3DEPA 3I56A 3A7LA 3UDFA 2PW7A 2NTTA 4GOPA 5FKAC 3W3AA 3Q22A 3I4MH 1HNZQ 1XNRQ 1U4RA 2A6HD 3F2UA 4LNQA 5E4WC 4IUUA 2X69A 4DUZQ 2F0JA 3QWNA 2A73B 4RHSA 1JOKA 4H7BA 2ICEC 2EDGA 3I2ZA 1D5XC 1S40A 4BY1B 3JAMc 3KLRA 3J7YW 5IP7H 4ID6A 3PIOA 2D2CC 1L2FA 2EY5A 2RKSA 4X62L 3JAME 1Y8OB 4GN5A 4EQNA 3P7JA 2BE5D 3J7AF 5C3WA 2IW3A 3KF8B 3E6ZX 4NDXA 2M00A
chains in the Genus database with same CATH topology
4KHPL 3CP0A 1Y14B 2MQHA 3T1HL 2E2HH 2ZJPA 4IFDI 1E22A 3ULLA 4GS3A 1X6OA 4DV4Q 1Q7YC 1N33L 4B3RL 1VQAA 1IBKQ 2JA8G 4LFCL 3PO2H 2QGQA 3S1MH 5M3MH 3BZKA 3RLFA 5IP7G 3DLLA 2YTYA 3S17H 4A3BH 1YHQA 2Q2HA 4LF6Q 4DR2L 1TWGH 3E9HA 4DV5L 2EIFA 3KLWA 4AQYQ 2CKZB 1TWAH 3AQQA 3W1BA 1PH7A 2D0PA 3L0OA 4BBSH 4JOIA 2IX1A 4JCVE 3OTOQ 4APVA 1K8GA 2A1AA 1I94L 3GTGH 2HHHL 4LFAQ 4DAYB 2LXJA 3BZCA 4JC0A 3CC2A 4DV2Q 3RN5A 1B70B 3PO2G 1JMCA 2PNHA 3FKIH 1ASZA 5M3MG 1A8VA 5AJ3L 4JYAL 4B3TQ 3GTJH 2IHEA 2JA9A 2RHQB 2C35B 1PFSA 5M5XH 1X9NA 3U4VA 4UP8A 3H15A 4X64L 4A3BG 4PMWA 4GNXB 2UXDL 1EIFA 4P72A 1PH4A 4TQUS 2KHIA 1SE8A 4GLVB 3S15H 4BBSG 4LF7L 1QZHA 4X62Q 5ELOA 1MKHA 4R4TA 2WP8J 2IT1A 5IE8A 4GKJQ 4JI3L 1FL0A 1NBWA 4JBKA 2UU9Q 3CF5A 2PMZE 2UXCL 1KL9A 2NZHA 2I0QA 4K0KL 4DR1L 2NVTH 1EIYB 4JV5Q 3FKIG 4MNOA 3UDGA 1BKBA 2MNAA 3T1HQ 2HT1A 4KHPQ 1VQOA 1P8LA 2E5LL 1N33Q 3UE1A 3TQYA 4B3RQ 4JI6L 1Q1BA 3D0FA 2NVXH 5BR8Q 1E3PA 5C0XJ 4H02A 3A5ZB 3A0JA 2BH8A 2AWOA 2KBNA 3S1NH 4DR2Q 5JEAG 1I3QH 1XPRA 4DV5Q 2JEBI 3AFQA 3HFZB 3M9BA 2B3GA 3FP9A 4JBJA 4R4IA 4GOPC 4JI4Q 1D7QA 1PV4A 1WI5A 1CKMA 5GADC 1XMOL 1YITA 1SRUA 1VS0A 2NVQH 3PUXA 3G71A 4JBWA 4DR3L 2ES2A 2JE6I 1HZAA 1I94Q 4POFA 3CW2C 1O7IA 2HHHQ 1YHAA 3A5UA 4C3JH 1J5EL 1K0RA 3OYYA 3VDYA 3S16H 2N3SA 3T1YL 1JJ2A 2UUAL 3MEFA 2K14A 3W1GA 5AJ3Q 1PH2A 4JYAQ 4DV1L 2DGYA 5HY6A 1QZGA 4IFDG 2UXBQ 4X64Q 3TS2A 1VQ4A 4JI5Q 3E9IA 3PUWA 3KJPA 4XTCS 2VZAA 4C2MH 3KFUA 1JT8A 3ER0A 5EAYA 4NXML 4JI8L 1UE6A 1G291 2H5XA 5E7NA 4DR4L 4LF7Q 4R1JA 1SN8A 2K75A 3PUZA 3JAMi 3RZDH 4JI3Q 3M4OH 2LXKA 3W5OA 1IZ6A 1K73C 1W3SA 1VQ5A 1GD7A 4K0KQ 1UE7A 2WB1E 1X65A 2IX0A 3K80C 1V43A 4YHHL 1MJEA 4GKKL 2OTJA 1VQHA 1CUKA 5IWAQ 4LUVA 1MIUA 4DV0L 1KRTA 2E5LQ 2E8GA 1M90C 2FXQA 3UDXA 1YHBA 2CQOA 4BA1I 4JI6Q 3S1QH 4NXNL 1KQSA 4X66L 5JJLA 1HR0W 4IJLA 1KD1C 3MXNB 4GNXA 4DV3L 1QVFA 1VQ9A 3PO3H 1MJCA 4JOIC 1E7ZA 1X3FA 2GVAA 1PHJA 2CCZA 2ZJQA 3EN2A 4UY8C 2VY3A 3DM3A 4O2DA 2JQOA 5HGQA 3NBHB 1AH9A 1OXXK 1CKOA 2CFMA 1YJNA 2R93H 2WB1G 4IOCA 3S24A 5C3EH 4DR3Q 3ZJYC 2ID0A 1Y1WH 3M7NA 4GLAC 4QL5A 2NN6I 1VQBA 1FVIA 1J5EQ 2K5NA 2OQKA 3CPFA 2OTLA 2ZM6L 4KHZA 3T1YQ 1W2BA 4J15A 2UUAQ 2YU9H 1L1OA 1UEBA 1LM0A 2K52A 2PI2E 4IPCA 4R4QA 4DV1Q 1IBML 4R4OA 1XNQL 3PO3G 3S2DH 1N32L 1C9OA 2NVYH 1VQDA 2LSSA 3ULPA 1K9MC 4YWKA 4NXMQ 1YVCA 4JI8Q 2F4VL 3GTMH 4DR4Q 1PYSB 2R93G 3CD6A 4A75A 4A3FH 5C3EG 1Y1WG 1KXLA 2KENA 3ICEA 5IYBH 4OXPA 5C4JH 3JC66 1WOCA 1XTDA 1NMGA 3RN2A 2I5MX 4YHHQ 2V1CC 4GKKQ 4HJ5A 5FLMH 3K7UC 5K36G 3BU2A 4X65L 5M5WH 3D31A 1Q82C 3KF6B 3J80i 3STBC 4DR7L 4X66Q 3ERSX 3HOUH 1B8AA 3NEMA 3CQZH 5FLXc 3F8TA 3PCOB 2MFIA 1EFWA 4DV7L 3CCUA 4IOAA 4A3FG 2R6GA 1QVCA 4QY7A 1WCMH 2K5HA 4LF9Q 4X6AH 4LFBL 5IYBG 4LF8L 3Q8DA 1I5FA 1N36Q 4JBMA 1HZ9A 4C3HH 2PQAA 5IP9H 2YV5A 2F52A 4JG2A 4OWWB 3U4ZA 5C4XH 5FLMG 4B3MQ 4A4IA 5LMUQ 3GO5A 1NE3A 2YTVA 4DR5Q 3OW2A 3PSIA 2L15A 2XGTA 2ZTDA 3CXCA 2Z0SA 3J80c 2ZM6Q 3HOUG 3GTLH 4UP9A 2ALYB 5IYCH 5C44H 3G4SA 1IBMQ 1XNQQ 3J7ZC 1K83H 1PA6A 2HIXA 2NZOA 1N32Q 1L1OB 4DK3C 1NJIC 4GN4B 4LFCQ 3K7AH 1WCMG 4UP7A 1Z9FA 3HKZE 2IHFA 5ELNA 4YCWA 4IJHA 3CCQA 4OONA 4YCVA 5IP9G 2EQSA 3TEHB 1VQFA 4KLKA 5C4XG 4IPDA 2ASBA 1IBLL 1OXUA 2N49A 3RR5A 2Q2IA 4YCUA 3PIPA 2VQEL 1V1QA 5IYCG 5C44G 4KI0A 4QJFA 4PZ7A 1FGUA 4PG3A 4X65Q 4GNXC 2UUBL 4QGUA 5LMNL 2NN6G 1A62A 1FJGL 1JJGA 2K5VA 4JI0L 3F2BA 4DUZL 2MO0A 1EWIA 1OXTA 3HKZG 4O0AA 4A76A 4LW1A 1K8AC 1IL2A 3TRZA 1EUJA 1Q1EA 4YY3L 1PH9A 1CSQA 1R9TH 2UXDQ 3L2PA 1CSPA 3GD7A 1EYGA 1HH2P 3K0XA 1HR0L 4LFBQ 3CCMA 1LTLA 3PUYA 2KCTA 4JI1L 1RIPA 2BH2A 4A3DG 1VQCA 4A3EH 4LF5L 4R4CA 1VQGA 4IFDJ 3PUVA 4HJ9A 3EIVA 2PQAB 2R92H 1AE2A 2CWAA 3HOXH 4BBRH 1L1OC 2UXCQ 4EX5A 3M4QA 3I55A 4A3LH 2AMCB 5LMNW 1HJPA 4DR1Q 5IYDH 1AE3A 3J81i 2RF4A 3KDFA 3KF6A 1CKNB 1U5KA 4MTNA 3F2CA 1PYBA 5GROA 3PV0A 1IBKL 3K81C 2BA1A 3M3YH 2JK8A 3RZOH 1VQNA 5JJIA 1S72A 2DUDA 3AFPA 2D62A 3S1RH 3U50C 1TWFH 1L0WA 4A3EG 4WJ4A 4HIKA 1H95A 3K8AA 4RG1A 2QEXA 2F3IA 3H0GH 2R92G 3HOXG 3AEVA 1V9PA 5DLQE 4BBRG 1QUQB 1PH8A 1IBLQ 1XMOQ 1OXSC 4RMFA 5C0XI 4A3LG 1YI2A 1B7YB 5IYDG 4OO1I 3ULJA 2VQEQ 3BJUA 3J81c 2JA7H 2Q2UA 1VQPA 2AHOB 3H3VI 2I5HA 2RHSB 1LYLA 5JJKA 2AWNA 4AIMA 4P74A 4OWTB 4BY1H 1I6HH 3RLOA 2RCNA 3KYHC 2Z6KA 4HIDA 1EOVA 2JA5H 1XMQL 4LUOA 1VQKA 3S14H 1X3GA 2ATWA 2AKWB 4OX9L 2R7DA 1YJWA 4MZ9A 4YY3Q 1BBWA 3H0GG 1HR0Q 1E24A 1VQMA 3HKSA 4DR6L 4B3SL 4JI7L 4JI1Q 4DK6C 4OWXB 3RLNA 4LF5Q 1X54A 1YIJA 4GKJL 4WJ3M 2D0OA 4IPHA 2JA7G 1GKHA 1VQ8A 4Y52H 4BY1G 4HJ7A 1WFQA 1Q12A 2CWPA 5M3FH 1TWHH 2JA5G 1A0IA 1LUZA 4Y7NH 1G51A 1UWVA 4UPAA 3GTPH 4DV0Q 3CMEA 4L5TA 2YTXA 3AYHB 1UE5A 1JB7A 4A93H 2Q2TA 1BVSA 3J7A5 3KDFB 4NXNQ 1IYJB 5BR8L 3CMAA 1SROA 3RNUA 4EQ5A 1NTGA 1Y1VH 3EBEA 3G6EA 2B29A 1GO3E 1DGSA 2BA0A 4P71A 4PZ6A 4DV3Q 1GM5A 2UUCL 3PF4A 1D8LA 2B63H 1Q46A 3UE0A 2VQFL 4A3CH 1VQEA 5GAGC 3NELA 3STBD 4JI4L 4POGA 1TXYA 3LGJA 1JJCB 4LWCA 1I50H 3CPWA 1BBUA 2QA4A 5IT9c 5M3FG 2VW9A 3G48A 4DUYL 1XJVA 1OTCA 4A3JH 1XPUA 3J81j 4A3KH 1G6PA 5GQOA 1N34L 3HOWH 3I7FA 1IXRA 4HIMA 3HOVH 4GOPB 3M4PA 5GAHC 4A93G 3CCLA 1TWCH 3B6YA 1CKNA 2JJQA 3F2DA 1X56A 3TS0A 1ASYA 1XMQQ 2K50A 3CAMA 1Y1VG 2K4KA 4JI2L 2I5LX 2UXBL 4L5RC 1SLJA 2WFWA 3H3VH 4DKAC 5H1SE 4JI5L 1M1KC 4OX9Q 5IY0A 1E1OA 2GVBA 4LF4L 2B63G 3GTOH 4A3CG 4QIWE 5M5YH 1Z47A 1PH3A 4DR6Q 4B3SQ 4JI7Q 4A3GH 2F4VQ 3GTKH 1UE1A 3FHWA 1N8RC 4DNIA 3S2HH 1QUQA 4PZ8A 4A3JG 3GTQH 1VQ7A 1Q8KA 4A3KG 1C7YA 2VNUD 1RL2A 2A8VA 3TREA 1YZ6A 4DV6L 3HOWG 3HOVG 3PGZA 4A3DH 4C3IH 1X3EA 1EQQA 5C0XG 1OXVA 1KC8C 4BA2I 1PVOA 1PH1A 4OO1G 5IWAL 4AYBE 3M85A 5JEAJ 1HNWL 4IO9A 1HNZL 4GLXA 1X55A 1XNRL 3WWVA 1VQIA 4A3MH 3HOZH 1N9WA 2OQ0A 4P73A 4HJAA 4DR7Q 3SGIA 1J6QA 1YEZA 4HJ8A 1GVPA 4GN3B 2MO1A 2KCMA 4A3GG 3KJOA 3CC7A 3E0EA 4LUZA 1HNXL 1NMFA 4DPGA 5FJ8H 4DV7Q 1HZBA 4NPSA 1KIXA 3CCEA 2JA6H 1SMXA 2VQFQ 4LF8Q 2PI2A 3GDEA 4NB3A 1EQRA 4DUYQ 4A3IH 1U0LA 3IRBA 3CCSA 2N78A 5GAEC 4L5SA 2R7ZH 3I4NH 1HZCA 1C0AA 2Z6KC 4AYBG 1SFOH 2N8NA 1N34Q 2WAQE 3HOYH 2KHJA 4YWMA 1Q86C 2JEAI 1WYDA 4A3MG 3HOZG 3U58A 2XTIA 2VUMH 3NENA 1VCIA 2E2IH 4JI2Q 4DV4L 2HQLA 2UUCQ 5FJ8G 2ZTCA 4LF4Q 1VQJA 2JA6G 1VQ6A 4BY7H 3A74A 4BXXH 3CCRA 4HIOA 1VQLA 2ZTEA 4A3IG 1K3RA 1YBYA 1JE5A 1KRSA 1T9HA 3I4OA 2E2JH 1NY4A 4TVAB 2YYZA 1KAWA 4LF6L 3I4NG 4P75A 2R7ZG 3KOJA 4AQYL 4DV6Q 3CCJA 1YNXA 3UDIA 2WAQG 2HIVA 3CCVA 3CC4A 3HOYG 4XIGS 3I56A 1KHIA 1A63A 4ME3A 3UDFA 3OTOL 2EXDA 4QQBX 4GOPA 2VUMG 1YJ9A 1S3OA 4LFAL 2OCEA 3F1ZA 1HNWQ 3I4MH 1HNZQ 4DV2L 2OWOA 2VS1A 2UUBQ 1FJGQ 4FDBA 4AH6A 2Y0SE 5LMNQ 1P16A 3PF5A 1XNRQ 4LNQA 4BY7G 4JI0Q 2R7FA 1E1TA 1WJJA 2VL6A 4DAMA 4DUZQ 4ALPA 4B3TL 4BXXG 2IY5B 3I2ZA 3L7ZC 1HNXQ 1XPOA 1S40A 1PH5A 1SR3A 2JA8H 3JAMc 1PH6A 4LF9L 5IP7H 1N36L 2GN5A 3PIOA 1L2FA 4X62L 4GN5A 4IPGA 4L5QA 2A19A 5J3BA 2UU9L 4B3ML 2ZJRA 5LMUL 3I4MG 4DR5L 1QVGA 1Q81C 3KF8B 2Y0SG 4YWLA 4JV5L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHP L;  3CP0 A;  1Y14 B;  2MQH A;  3T1H L;  2E2H H;  2ZJP A;  4IFD I;  1E22 A;  3ULL A;  4GS3 A;  1X6O A;  4DV4 Q;  1Q7Y C;  1N33 L;  4B3R L;  1VQA A;  1IBK Q;  2JA8 G;  4LFC L;  3PO2 H;  2QGQ A;  3S1M H;  5M3M H;  3BZK A;  3RLF A;  5IP7 G;  3DLL A;  2YTY A;  3S17 H;  4A3B H;  1YHQ A;  2Q2H A;  4LF6 Q;  4DR2 L;  1TWG H;  3E9H A;  4DV5 L;  2EIF A;  3KLW A;  4AQY Q;  2CKZ B;  1TWA H;  3AQQ A;  3W1B A;  1PH7 A;  2D0P A;  3L0O A;  4BBS H;  4JOI A;  2IX1 A;  4JCV E;  3OTO Q;  4APV A;  1K8G A;  2A1A A;  1I94 L;  3GTG H;  2HHH L;  4LFA Q;  4DAY B;  2LXJ A;  3BZC A;  4JC0 A;  3CC2 A;  4DV2 Q;  3RN5 A;  1B70 B;  3PO2 G;  1JMC A;  2PNH A;  3FKI H;  1ASZ A;  5M3M G;  1A8V A;  5AJ3 L;  4JYA L;  4B3T Q;  3GTJ H;  2IHE A;  2JA9 A;  2RHQ B;  2C35 B;  1PFS A;  5M5X H;  1X9N A;  3U4V A;  4UP8 A;  3H15 A;  4X64 L;  4A3B G;  4PMW A;  4GNX B;  2UXD L;  1EIF A;  4P72 A;  1PH4 A;  4TQU S;  2KHI A;  1SE8 A;  4GLV B;  3S15 H;  4BBS G;  4LF7 L;  1QZH A;  4X62 Q;  5ELO A;  1MKH A;  4R4T A;  2WP8 J;  2IT1 A;  5IE8 A;  4GKJ Q;  4JI3 L;  1FL0 A;  1NBW A;  4JBK A;  2UU9 Q;  3CF5 A;  2PMZ E;  2UXC L;  1KL9 A;  2NZH A;  2I0Q A;  4K0K L;  4DR1 L;  2NVT H;  1EIY B;  4JV5 Q;  3FKI G;  4MNO A;  3UDG A;  1BKB A;  2MNA A;  3T1H Q;  2HT1 A;  4KHP Q;  1VQO A;  1P8L A;  2E5L L;  1N33 Q;  3UE1 A;  3TQY A;  4B3R Q;  4JI6 L;  1Q1B A;  3D0F A;  2NVX H;  5BR8 Q;  1E3P A;  5C0X J;  4H02 A;  3A5Z B;  3A0J A;  2BH8 A;  2AWO A;  2KBN A;  3S1N H;  4DR2 Q;  5JEA G;  1I3Q H;  1XPR A;  4DV5 Q;  2JEB I;  3AFQ A;  3HFZ B;  3M9B A;  2B3G A;  3FP9 A;  4JBJ A;  4R4I A;  4GOP C;  4JI4 Q;  1D7Q A;  1PV4 A;  1WI5 A;  1CKM A;  5GAD C;  1XMO L;  1YIT A;  1SRU A;  1VS0 A;  2NVQ H;  3PUX A;  3G71 A;  4JBW A;  4DR3 L;  2ES2 A;  2JE6 I;  1HZA A;  1I94 Q;  4POF A;  3CW2 C;  1O7I A;  2HHH Q;  1YHA A;  3A5U A;  4C3J H;  1J5E L;  1K0R A;  3OYY A;  3VDY A;  3S16 H;  2N3S A;  3T1Y L;  1JJ2 A;  2UUA L;  3MEF A;  2K14 A;  3W1G A;  5AJ3 Q;  1PH2 A;  4JYA Q;  4DV1 L;  2DGY A;  5HY6 A;  1QZG A;  4IFD G;  2UXB Q;  4X64 Q;  3TS2 A;  1VQ4 A;  4JI5 Q;  3E9I A;  3PUW A;  3KJP A;  4XTC S;  2VZA A;  4C2M H;  3KFU A;  1JT8 A;  3ER0 A;  5EAY A;  4NXM L;  4JI8 L;  1UE6 A;  1G29 1;  2H5X A;  5E7N A;  4DR4 L;  4LF7 Q;  4R1J A;  1SN8 A;  2K75 A;  3PUZ A;  3JAM i;  3RZD H;  4JI3 Q;  3M4O H;  2LXK A;  3W5O A;  1IZ6 A;  1K73 C;  1W3S A;  1VQ5 A;  1GD7 A;  4K0K Q;  1UE7 A;  2WB1 E;  1X65 A;  2IX0 A;  3K80 C;  1V43 A;  4YHH L;  1MJE A;  4GKK L;  2OTJ A;  1VQH A;  1CUK A;  5IWA Q;  4LUV A;  1MIU A;  4DV0 L;  1KRT A;  2E5L Q;  2E8G A;  1M90 C;  2FXQ A;  3UDX A;  1YHB A;  2CQO A;  4BA1 I;  4JI6 Q;  3S1Q H;  4NXN L;  1KQS A;  4X66 L;  5JJL A;  1HR0 W;  4IJL A;  1KD1 C;  3MXN B;  4GNX A;  4DV3 L;  1QVF A;  1VQ9 A;  3PO3 H;  1MJC A;  4JOI C;  1E7Z A;  1X3F A;  2GVA A;  1PHJ A;  2CCZ A;  2ZJQ A;  3EN2 A;  4UY8 C;  2VY3 A;  3DM3 A;  4O2D A;  2JQO A;  5HGQ A;  3NBH B;  1AH9 A;  1OXX K;  1CKO A;  2CFM A;  1YJN A;  2R93 H;  2WB1 G;  4IOC A;  3S24 A;  5C3E H;  4DR3 Q;  3ZJY C;  2ID0 A;  1Y1W H;  3M7N A;  4GLA C;  4QL5 A;  2NN6 I;  1VQB A;  1FVI A;  1J5E Q;  2K5N A;  2OQK A;  3CPF A;  2OTL A;  2ZM6 L;  4KHZ A;  3T1Y Q;  1W2B A;  4J15 A;  2UUA Q;  2YU9 H;  1L1O A;  1UEB A;  1LM0 A;  2K52 A;  2PI2 E;  4IPC A;  4R4Q A;  4DV1 Q;  1IBM L;  4R4O A;  1XNQ L;  3PO3 G;  3S2D H;  1N32 L;  1C9O A;  2NVY H;  1VQD A;  2LSS A;  3ULP A;  1K9M C;  4YWK A;  4NXM Q;  1YVC A;  4JI8 Q;  2F4V L;  3GTM H;  4DR4 Q;  1PYS B;  2R93 G;  3CD6 A;  4A75 A;  4A3F H;  5C3E G;  1Y1W G;  1KXL A;  2KEN A;  3ICE A;  5IYB H;  4OXP A;  5C4J H;  3JC6 6;  1WOC A;  1XTD A;  1NMG A;  3RN2 A;  2I5M X;  4YHH Q;  2V1C C;  4GKK Q;  4HJ5 A;  5FLM H;  3K7U C;  5K36 G;  3BU2 A;  4X65 L;  5M5W H;  3D31 A;  1Q82 C;  3KF6 B;  3J80 i;  3STB C;  4DR7 L;  4X66 Q;  3ERS X;  3HOU H;  1B8A A;  3NEM A;  3CQZ H;  5FLX c;  3F8T A;  3PCO B;  2MFI A;  1EFW A;  4DV7 L;  3CCU A;  4IOA A;  4A3F G;  2R6G A;  1QVC A;  4QY7 A;  1WCM H;  2K5H A;  4LF9 Q;  4X6A H;  4LFB L;  5IYB G;  4LF8 L;  3Q8D A;  1I5F A;  1N36 Q;  4JBM A;  1HZ9 A;  4C3H H;  2PQA A;  5IP9 H;  2YV5 A;  2F52 A;  4JG2 A;  4OWW B;  3U4Z A;  5C4X H;  5FLM G;  4B3M Q;  4A4I A;  5LMU Q;  3GO5 A;  1NE3 A;  2YTV A;  4DR5 Q;  3OW2 A;  3PSI A;  2L15 A;  2XGT A;  2ZTD A;  3CXC A;  2Z0S A;  3J80 c;  2ZM6 Q;  3HOU G;  3GTL H;  4UP9 A;  2ALY B;  5IYC H;  5C44 H;  3G4S A;  1IBM Q;  1XNQ Q;  3J7Z C;  1K83 H;  1PA6 A;  2HIX A;  2NZO A;  1N32 Q;  1L1O B;  4DK3 C;  1NJI C;  4GN4 B;  4LFC Q;  3K7A H;  1WCM G;  4UP7 A;  1Z9F A;  3HKZ E;  2IHF A;  5ELN A;  4YCW A;  4IJH A;  3CCQ A;  4OON A;  4YCV A;  5IP9 G;  2EQS A;  3TEH B;  1VQF A;  4KLK A;  5C4X G;  4IPD A;  2ASB A;  1IBL L;  1OXU A;  2N49 A;  3RR5 A;  2Q2I A;  4YCU A;  3PIP A;  2VQE L;  1V1Q A;  5IYC G;  5C44 G;  4KI0 A;  4QJF A;  4PZ7 A;  1FGU A;  4PG3 A;  4X65 Q;  4GNX C;  2UUB L;  4QGU A;  5LMN L;  2NN6 G;  1A62 A;  1FJG L;  1JJG A;  2K5V A;  4JI0 L;  3F2B A;  4DUZ L;  2MO0 A;  1EWI A;  1OXT A;  3HKZ G;  4O0A A;  4A76 A;  4LW1 A;  1K8A C;  1IL2 A;  3TRZ A;  1EUJ A;  1Q1E A;  4YY3 L;  1PH9 A;  1CSQ A;  1R9T H;  2UXD Q;  3L2P A;  1CSP A;  3GD7 A;  1EYG A;  1HH2 P;  3K0X A;  1HR0 L;  4LFB Q;  3CCM A;  1LTL A;  3PUY A;  2KCT A;  4JI1 L;  1RIP A;  2BH2 A;  4A3D G;  1VQC A;  4A3E H;  4LF5 L;  4R4C A;  1VQG A;  4IFD J;  3PUV A;  4HJ9 A;  3EIV A;  2PQA B;  2R92 H;  1AE2 A;  2CWA A;  3HOX H;  4BBR H;  1L1O C;  2UXC Q;  4EX5 A;  3M4Q A;  3I55 A;  4A3L H;  2AMC B;  5LMN W;  1HJP A;  4DR1 Q;  5IYD H;  1AE3 A;  3J81 i;  2RF4 A;  3KDF A;  3KF6 A;  1CKN B;  1U5K A;  4MTN A;  3F2C A;  1PYB A;  5GRO A;  3PV0 A;  1IBK L;  3K81 C;  2BA1 A;  3M3Y H;  2JK8 A;  3RZO H;  1VQN A;  5JJI A;  1S72 A;  2DUD A;  3AFP A;  2D62 A;  3S1R H;  3U50 C;  1TWF H;  1L0W A;  4A3E G;  4WJ4 A;  4HIK A;  1H95 A;  3K8A A;  4RG1 A;  2QEX A;  2F3I A;  3H0G H;  2R92 G;  3HOX G;  3AEV A;  1V9P A;  5DLQ E;  4BBR G;  1QUQ B;  1PH8 A;  1IBL Q;  1XMO Q;  1OXS C;  4RMF A;  5C0X I;  4A3L G;  1YI2 A;  1B7Y B;  5IYD G;  4OO1 I;  3ULJ A;  2VQE Q;  3BJU A;  3J81 c;  2JA7 H;  2Q2U A;  1VQP A;  2AHO B;  3H3V I;  2I5H A;  2RHS B;  1LYL A;  5JJK A;  2AWN A;  4AIM A;  4P74 A;  4OWT B;  4BY1 H;  1I6H H;  3RLO A;  2RCN A;  3KYH C;  2Z6K A;  4HID A;  1EOV A;  2JA5 H;  1XMQ L;  4LUO A;  1VQK A;  3S14 H;  1X3G A;  2ATW A;  2AKW B;  4OX9 L;  2R7D A;  1YJW A;  4MZ9 A;  4YY3 Q;  1BBW A;  3H0G G;  1HR0 Q;  1E24 A;  1VQM A;  3HKS A;  4DR6 L;  4B3S L;  4JI7 L;  4JI1 Q;  4DK6 C;  4OWX B;  3RLN A;  4LF5 Q;  1X54 A;  1YIJ A;  4GKJ L;  4WJ3 M;  2D0O A;  4IPH A;  2JA7 G;  1GKH A;  1VQ8 A;  4Y52 H;  4BY1 G;  4HJ7 A;  1WFQ A;  1Q12 A;  2CWP A;  5M3F H;  1TWH H;  2JA5 G;  1A0I A;  1LUZ A;  4Y7N H;  1G51 A;  1UWV A;  4UPA A;  3GTP H;  4DV0 Q;  3CME A;  4L5T A;  2YTX A;  3AYH B;  1UE5 A;  1JB7 A;  4A93 H;  2Q2T A;  1BVS A;  3J7A 5;  3KDF B;  4NXN Q;  1IYJ B;  5BR8 L;  3CMA A;  1SRO A;  3RNU A;  4EQ5 A;  1NTG A;  1Y1V H;  3EBE A;  3G6E A;  2B29 A;  1GO3 E;  1DGS A;  2BA0 A;  4P71 A;  4PZ6 A;  4DV3 Q;  1GM5 A;  2UUC L;  3PF4 A;  1D8L A;  2B63 H;  1Q46 A;  3UE0 A;  2VQF L;  4A3C H;  1VQE A;  5GAG C;  3NEL A;  3STB D;  4JI4 L;  4POG A;  1TXY A;  3LGJ A;  1JJC B;  4LWC A;  1I50 H;  3CPW A;  1BBU A;  2QA4 A;  5IT9 c;  5M3F G;  2VW9 A;  3G48 A;  4DUY L;  1XJV A;  1OTC A;  4A3J H;  1XPU A;  3J81 j;  4A3K H;  1G6P A;  5GQO A;  1N34 L;  3HOW H;  3I7F A;  1IXR A;  4HIM A;  3HOV H;  4GOP B;  3M4P A;  5GAH C;  4A93 G;  3CCL A;  1TWC H;  3B6Y A;  1CKN A;  2JJQ A;  3F2D A;  1X56 A;  3TS0 A;  1ASY A;  1XMQ Q;  2K50 A;  3CAM A;  1Y1V G;  2K4K A;  4JI2 L;  2I5L X;  2UXB L;  4L5R C;  1SLJ A;  2WFW A;  3H3V H;  4DKA C;  5H1S E;  4JI5 L;  1M1K C;  4OX9 Q;  5IY0 A;  1E1O A;  2GVB A;  4LF4 L;  2B63 G;  3GTO H;  4A3C G;  4QIW E;  5M5Y H;  1Z47 A;  1PH3 A;  4DR6 Q;  4B3S Q;  4JI7 Q;  4A3G H;  2F4V Q;  3GTK H;  1UE1 A;  3FHW A;  1N8R C;  4DNI A;  3S2H H;  1QUQ A;  4PZ8 A;  4A3J G;  3GTQ H;  1VQ7 A;  1Q8K A;  4A3K G;  1C7Y A;  2VNU D;  1RL2 A;  2A8V A;  3TRE A;  1YZ6 A;  4DV6 L;  3HOW G;  3HOV G;  3PGZ A;  4A3D H;  4C3I H;  1X3E A;  1EQQ A;  5C0X G;  1OXV A;  1KC8 C;  4BA2 I;  1PVO A;  1PH1 A;  4OO1 G;  5IWA L;  4AYB E;  3M85 A;  5JEA J;  1HNW L;  4IO9 A;  1HNZ L;  4GLX A;  1X55 A;  1XNR L;  3WWV A;  1VQI A;  4A3M H;  3HOZ H;  1N9W A;  2OQ0 A;  4P73 A;  4HJA A;  4DR7 Q;  3SGI A;  1J6Q A;  1YEZ A;  4HJ8 A;  1GVP A;  4GN3 B;  2MO1 A;  2KCM A;  4A3G G;  3KJO A;  3CC7 A;  3E0E A;  4LUZ A;  1HNX L;  1NMF A;  4DPG A;  5FJ8 H;  4DV7 Q;  1HZB A;  4NPS A;  1KIX A;  3CCE A;  2JA6 H;  1SMX A;  2VQF Q;  4LF8 Q;  2PI2 A;  3GDE A;  4NB3 A;  1EQR A;  4DUY Q;  4A3I H;  1U0L A;  3IRB A;  3CCS A;  2N78 A;  5GAE C;  4L5S A;  2R7Z H;  3I4N H;  1HZC A;  1C0A A;  2Z6K C;  4AYB G;  1SFO H;  2N8N A;  1N34 Q;  2WAQ E;  3HOY H;  2KHJ A;  4YWM A;  1Q86 C;  2JEA I;  1WYD A;  4A3M G;  3HOZ G;  3U58 A;  2XTI A;  2VUM H;  3NEN A;  1VCI A;  2E2I H;  4JI2 Q;  4DV4 L;  2HQL A;  2UUC Q;  5FJ8 G;  2ZTC A;  4LF4 Q;  1VQJ A;  2JA6 G;  1VQ6 A;  4BY7 H;  3A74 A;  4BXX H;  3CCR A;  4HIO A;  1VQL A;  2ZTE A;  4A3I G;  1K3R A;  1YBY A;  1JE5 A;  1KRS A;  1T9H A;  3I4O A;  2E2J H;  1NY4 A;  4TVA B;  2YYZ A;  1KAW A;  4LF6 L;  3I4N G;  4P75 A;  2R7Z G;  3KOJ A;  4AQY L;  4DV6 Q;  3CCJ A;  1YNX A;  3UDI A;  2WAQ G;  2HIV A;  3CCV A;  3CC4 A;  3HOY G;  4XIG S;  3I56 A;  1KHI A;  1A63 A;  4ME3 A;  3UDF A;  3OTO L;  2EXD A;  4QQB X;  4GOP A;  2VUM G;  1YJ9 A;  1S3O A;  4LFA L;  2OCE A;  3F1Z A;  1HNW Q;  3I4M H;  1HNZ Q;  4DV2 L;  2OWO A;  2VS1 A;  2UUB Q;  1FJG Q;  4FDB A;  4AH6 A;  2Y0S E;  5LMN Q;  1P16 A;  3PF5 A;  1XNR Q;  4LNQ A;  4BY7 G;  4JI0 Q;  2R7F A;  1E1T A;  1WJJ A;  2VL6 A;  4DAM A;  4DUZ Q;  4ALP A;  4B3T L;  4BXX G;  2IY5 B;  3I2Z A;  3L7Z C;  1HNX Q;  1XPO A;  1S40 A;  1PH5 A;  1SR3 A;  2JA8 H;  3JAM c;  1PH6 A;  4LF9 L;  5IP7 H;  1N36 L;  2GN5 A;  3PIO A;  1L2F A;  4X62 L;  4GN5 A;  4IPG A;  4L5Q A;  2A19 A;  5J3B A;  2UU9 L;  4B3M L;  2ZJR A;  5LMU L;  3I4M G;  4DR5 L;  1QVG A;  1Q81 C;  3KF8 B;  2Y0S G;  4YWL A;  4JV5 L; 
#chains in the Genus database with same CATH topology
 2MQH A;  5CV5 A;  1RTN A;  2O4X A;  2K6A A;  4IZ8 A;  3PO2 H;  3BVZ A;  5M3M H;  3BZK A;  3DLL A;  2J4X A;  4TKO B;  2YTY A;  4Y7N B;  4KK7 A;  3GTP B;  1PLF A;  3MTS A;  4ZLT F;  4DR2 L;  4LF6 Q;  4AQY Q;  1TS5 A;  3W1B A;  1XTC D;  2D0P A;  3L0O A;  3Q0A A;  5CV8 A;  1CHQ D;  4APV A;  3FPU B;  3N52 A;  2B63 B;  2HHH L;  1KLG D;  2WV6 D;  4DV2 Q;  1B70 B;  2XSC A;  1I50 B;  4C1N K;  4K2K A;  3FKI H;  1A8V A;  5AJ3 L;  5D14 A;  4A3J B;  4A3K B;  5C4X B;  1X9N A;  4A3B G;  3U4V A;  3H15 A;  3KK7 A;  2Z1C A;  1NNX A;  1EIF A;  1PH4 A;  4TQU S;  1SE8 A;  3S15 H;  2JYO A;  4BBS G;  2RDG A;  4ABN A;  4G4K A;  4PQX A;  5L37 A;  5ELO A;  1MKH A;  2A68 C;  4R4T A;  2WP8 J;  3TZD A;  3OSO A;  5C4H A;  1FL0 A;  2UU9 Q;  1U4P A;  4ZUI A;  1QCB D;  4O1N A;  2UXC L;  2I0Q A;  4K0K L;  4DR1 L;  3RMH A;  1SYD A;  1KDA A;  1N33 Q;  3UE1 A;  4JI6 L;  1Q1B A;  2L11 A;  2NVX H;  1PRT F;  4DXF A;  2F0T A;  5KND A;  3A0J A;  4CDC C;  3CU7 A;  5JEA G;  1XPR A;  3NBH A;  2JEB I;  3AFQ A;  3HFZ B;  3A8I E;  4R4I A;  3C46 A;  1D7Q A;  1WI5 A;  4QB4 A;  5GAD C;  1SRU A;  4O42 A;  2NVQ H;  3PUX A;  3G71 A;  1Z7T A;  2JE6 I;  3KF8 A;  4POF A;  1YHA A;  2M2L A;  1K0R A;  3NE5 B;  3K5L A;  2MHV A;  5FO9 B;  3A56 A;  1SFO B;  5HY6 A;  4QUF A;  2UXB Q;  2WAQ B;  3JAM L;  4FF1 A;  4JI5 Q;  4MIU A;  4C2M H;  3KFU A;  4F7X A;  3C2P A;  3SE0 A;  4CKC A;  3NK9 A;  1O7L A;  5ELE A;  3QIA A;  2Z4H A;  3PUZ A;  1K73 C;  4C3J G;  4BY7 B;  1GD7 A;  1JOO A;  1LAC A;  1CUK A;  2PCF B;  3GV3 A;  5FK9 C;  1YHB A;  4JW0 A;  4NXN L;  4FXK C;  1RD9 D;  3MXN B;  4DAV A;  5CV7 A;  4V19 0;  3I4M B;  1SE4 A;  3PO3 H;  3QB3 A;  1SNM A;  1X3F A;  1ZKO A;  2Y0S B;  2CCZ A;  3BZD B;  4O2D A;  1TU2 B;  5HGQ A;  5IGD A;  1NUC A;  1WTX A;  3OW7 A;  4DR3 Q;  5C3E H;  1SAP A;  3M7N A;  4GLA C;  4L6T B;  1FVI A;  2K5N A;  2OQK A;  3SK5 A;  2ZM6 L;  3T1Y Q;  4ODG A;  1W2B A;  1GUW A;  2YU9 H;  1UEB A;  1LM0 A;  1QOH A;  1SDF A;  1XNQ L;  5K36 H;  1F2Z A;  2QDL A;  1K9M C;  4UHV A;  4M8A A;  2NUC A;  1F77 A;  3I90 A;  1JIC A;  1PYS B;  4WFN 3;  4A75 A;  3CD6 A;  2R93 G;  1Y1W G;  4A93 B;  3ICE A;  3PO2 B;  3VR4 A;  5IYB H;  5C4J H;  5M3M B;  2OF1 A;  2I5M X;  1V1P A;  2V1C C;  1EY7 A;  2ICI A;  1CM9 A;  3D6W A;  3DHQ A;  2B2U C;  1CK1 A;  3J80 i;  4V0B A;  4X66 Q;  5EQ0 A;  4CKE A;  1LO5 D;  2MFI A;  2H1E A;  3CCU A;  1WCM H;  4YIJ A;  4LFB L;  3FKI B;  1N36 Q;  4JBM A;  2B2W C;  4X3T A;  4C3H H;  2L4N A;  4RAU C;  3U4Z A;  2JN4 A;  4B3M Q;  3OW2 A;  3PSI A;  1ONL A;  5LHY 1;  1PFB A;  3CRL C;  3HOU G;  2ALY B;  2A68 D;  5CMD A;  2QW7 A;  2EJF C;  2NZO A;  1L1O B;  2NN6 H;  2Q8T A;  4DK3 C;  3MXN A;  1Z9F A;  1EQV A;  1LTI D;  1PTO H;  1X3Q A;  4YCV A;  5IP9 G;  1ICF B;  4A3M B;  2SEB D;  5C4X G;  4IPD A;  2F03 A;  2NVX B;  1DCZ A;  4KY6 A;  5J1Z A;  2K03 A;  3NXW A;  1HTP A;  5A35 A;  2MUY A;  2A5H A;  1FGU A;  4PG3 A;  5KEE A;  4GNX C;  4QGU A;  1UNS A;  1A62 A;  1JJG A;  1BQQ T;  2NVQ B;  2K5V A;  3F2B A;  3IL8 A;  4DUZ L;  1EWI A;  2R7Z B;  1K8A C;  1I4G A;  2O2L D;  4TRD A;  2EYM A;  2UXD Q;  3L2P A;  1EYG A;  1HR0 L;  3MFG A;  4FP5 D;  4OGQ C;  2KCT A;  1K8M A;  2BH2 A;  3BG3 A;  4MN3 A;  4K8I A;  3HOX H;  4C2M B;  1QNK A;  3N6R A;  4OHJ A;  1HJP A;  4MTK A;  4HTH A;  2X6G A;  3BYY B;  2Z4I A;  1MHW C;  2RF4 A;  3KDF A;  1CKN B;  5ISR A;  1CA6 A;  4F8M A;  5GRO A;  3PV0 A;  2BA1 A;  2JK8 A;  5IIF A;  2EE1 A;  3X3N A;  1Y69 U;  2D62 A;  3S1R H;  3TBI B;  1L0W A;  2KUM A;  3T51 B;  1OO9 B;  2QEX A;  2R92 G;  1KDB A;  1TT2 A;  4P2C B;  4JK1 C;  4A3L G;  1JB3 A;  1YI2 A;  2DNC A;  2R61 A;  3J81 c;  1V8Q A;  1VQP A;  2RHS B;  1DD2 A;  4K14 A;  3J81 E;  1EOV A;  5T1G A;  2EY1 A;  2JA5 H;  5C3E B;  5CV9 A;  1XMQ L;  1O7Z A;  1X3G A;  4OX9 L;  1BBW A;  5IGF A;  1VQM A;  3HKS A;  4E6I A;  4DR6 L;  4DK6 C;  1STE A;  4IPH A;  2EOT A;  2JA7 G;  4Y52 H;  4HJ7 A;  1WFQ A;  1Q12 A;  2A74 C;  2HD3 A;  1XYI A;  3CME A;  3I73 A;  5C4J B;  1UE5 A;  1JB7 A;  2Q2T A;  4F87 A;  3J7A 5;  4KMU C;  3RNU A;  4EQ5 A;  4RGM A;  3I8Z A;  2UUC L;  2TMP A;  4ZAI A;  1BR9 A;  5NUC A;  3WOF A;  5GAG C;  3NEL A;  1FR3 A;  1TXY A;  3CPW A;  1OTC A;  5DNF A;  4ZUJ A;  3J81 j;  4FXG C;  5GQO A;  3HOW H;  1BCP F;  1WCM B;  5LL6 X;  4A93 G;  3CCL A;  3B6Y A;  3BDC A;  2QEJ C;  1CKN A;  3TS0 A;  1X56 A;  3ND9 A;  4CKB A;  2UXB L;  4KN7 C;  3H3V H;  2HDL A;  4JI5 L;  5H1S E;  1M1K C;  4IUV A;  5M5Y H;  4RGN A;  4A3G H;  4B3S Q;  2F4V Q;  1UE1 A;  5M9O A;  1XXG A;  1SYG A;  1I4Q A;  3I70 A;  3GTQ H;  1Q8K A;  4OIK A;  1AZP A;  1C7Y A;  4L63 B;  2VNU D;  3HOV G;  1PTO B;  3PGZ A;  3PQI A;  1SND A;  3I3C A;  1EQQ A;  1KC8 C;  4AYB E;  1LT5 D;  4RCO A;  2QCP X;  4RKB A;  1VQI A;  3HOZ H;  4P73 A;  4HJA A;  4HJ8 A;  1J6Q A;  1GVP A;  3A8K E;  3NWS A;  4GN3 B;  2MO1 A;  3KJO A;  5EKL A;  2WII B;  3FDT A;  5FJ8 H;  4DV7 Q;  3CCE A;  3S16 B;  1FGB D;  3H6M A;  4NB3 A;  4A3I H;  1K28 A;  1CTM A;  3IRB A;  3J81 L;  2B2T A;  1NR4 A;  3HOY H;  3EFX D;  1Q86 C;  1WYD A;  4A3M G;  3U58 A;  1EYA A;  1R4Q B;  3RZD B;  2XWJ B;  2IJ0 A;  3HOX B;  2FIN B;  3C3L A;  3TP7 A;  4LF4 Q;  2JA6 G;  2WB1 B;  1FD7 D;  1SXT A;  3CCR A;  1VQL A;  2ZTE A;  2F0I A;  1YBY A;  2PO4 A;  2E2J H;  3HG9 A;  1G91 A;  2YYZ A;  2R7Z G;  2K5Q A;  4N8F A;  3UDI A;  3K5M A;  1I4P A;  1O80 A;  4ME3 A;  3OTO L;  2EXD A;  3SK8 A;  1YNJ D;  2VUM G;  1YJ9 A;  1S3O A;  2OCE A;  1D6E C;  3F1Z A;  2OWO A;  2VS1 A;  5LMN Q;  2KOL A;  2EYL A;  1ZYR C;  1IL8 A;  5C5M A;  2VL6 A;  4KD4 A;  3G6J B;  3ERQ A;  2IY5 B;  3L7Z C;  4EVO A;  1HNX Q;  1SR3 A;  1PH6 A;  1N36 L;  1GHJ A;  2GN5 A;  3TDQ A;  3QOJ A;  4IPG A;  2B2Y C;  4L5Q A;  4B3M L;  5COY A;  4YWL A;  3T1H L;  2ZJP A;  1E22 A;  2PQE A;  1WTW A;  1TY2 A;  2ZXP A;  2JA8 G;  3FVQ A;  2QGQ A;  2PW5 A;  3S17 H;  1BCP B;  2L5T A;  3P20 A;  5COR A;  5M5W B;  4DV5 L;  4L8J A;  2K32 A;  1PH7 A;  4HSP A;  3CQZ B;  4XQN A;  4WOR A;  2IX1 A;  4JCV E;  2F0O A;  1PFN A;  4LFA Q;  3J7A V;  1QNU A;  1BBX C;  1JR0 D;  4B3T Q;  2RHQ B;  3HOW B;  2E74 C;  4IUR A;  4X64 L;  4PMW A;  2UXD L;  5KNB A;  4LF7 L;  1QZH A;  1K0S A;  1Z6H A;  5IE8 A;  5E4X A;  1QIL A;  1NBW A;  1B3Q A;  3K7A B;  2PMZ E;  1CZG A;  3O13 A;  1K3B C;  1D5M C;  4QIW B;  3I72 A;  4A3G B;  1A15 A;  1GUT A;  4JV5 Q;  4KHP Q;  4CHT B;  1BKB A;  2HT1 A;  3GTQ B;  2X6L A;  1P8L A;  2E5L L;  2BDN A;  4B3R Q;  5KRU A;  1QE6 A;  1LV9 A;  1F9S A;  2F1M A;  3K59 A;  3E5S A;  1ENA A;  4NP5 A;  2B8F A;  2BH8 A;  4IFD H;  1NSN S;  3S1N H;  3NWT A;  2SNM A;  3HOZ B;  3M9B A;  2RDF A;  4JBJ A;  4JI4 Q;  1SE3 A;  4JBW A;  1I94 Q;  4KJO A;  3A5U A;  1J5E L;  5TSS A;  1AEX A;  3VDY A;  3K58 A;  3MEH A;  2N3S A;  4A3I B;  5DAU A;  2K14 A;  3W1G A;  4JYA Q;  1QZG A;  3HOY B;  1VQ4 A;  4I7A A;  4OEL B;  3E9I A;  2DN8 A;  1DJR D;  1JT8 A;  3NQI A;  4JI8 L;  1DOL A;  5E7N A;  1G29 1;  2H5X A;  1UEA B;  1K8O A;  4JI3 Q;  1SNC A;  4Q0F A;  2N55 A;  3K80 C;  1A2U A;  1X65 A;  1V43 A;  4YHH L;  2E2J B;  1MJE A;  4GKK L;  5IWA Q;  1NCV A;  4DN4 M;  1SEB D;  3H0G B;  3S1Q H;  2MJ8 A;  1U4M A;  4IJL A;  1KD1 C;  1A3U A;  2HDM A;  1MJC A;  2ZT9 C;  1E7Z A;  4JOI C;  2GVA A;  3R93 A;  3EN2 A;  1ZYR D;  2DNE A;  5CYU A;  3NBH B;  3BS1 A;  2CFM A;  1YJN A;  4KY5 A;  2WB1 G;  3S24 A;  3ZJY C;  2ID0 A;  3PIO 3;  2B2V A;  4WRD A;  1L0Y B;  2NN6 I;  1VQB A;  2XIW A;  4TSS A;  3CPF A;  2UUA Q;  4H13 C;  1FNU A;  4BWG B;  4DV1 Q;  5D3D A;  2PI2 E;  4ILW A;  3TN2 A;  1C9O A;  2NVY H;  2LSS A;  3PMF A;  2DJG C;  2OXP A;  4NXM Q;  3GTM H;  2F4V L;  1E2W A;  4DR4 Q;  5C5L A;  1J8I A;  1BOS A;  2HUG A;  1KXL A;  1BO0 A;  4OXP A;  4HMI A;  3JC6 6;  4HCE A;  3QJY A;  3RN2 A;  2I07 B;  1HCZ A;  3TP8 A;  5FLM H;  3K7U C;  4X65 L;  1HPC A;  4PMC A;  1KTK A;  1EIG A;  3ERS X;  1B8A A;  3M4Y A;  5BN4 A;  5FLX c;  1CQV A;  3F8T A;  4DA2 A;  3OPO A;  4DV7 L;  4IOA A;  4A3F G;  4UDU C;  4QY7 A;  5FLX E;  3CHB D;  4LF9 Q;  2NYZ D;  1HZ9 A;  4U67 3;  4JG2 A;  1STY A;  5ELC A;  2WKC A;  5EKI A;  3VR2 A;  2YTV A;  2XGT A;  1CI3 M;  2ZTD A;  2Z0S A;  2WKD A;  1SYB A;  3GTL H;  2SDF A;  4RHR A;  5IYC H;  1IBM Q;  2G9H D;  4ZQ3 A;  1K83 H;  1PA6 A;  1ET6 A;  4ZKC B;  2HIX A;  1N32 Q;  4GN4 B;  1DXM A;  4UP7 A;  2RQX A;  4ZCK A;  3K57 A;  2K7V A;  5ELN A;  4IJH A;  3URY A;  4OON A;  3CCQ A;  3KBG A;  3SK4 A;  4Z9C B;  2E76 C;  3TEH B;  3R3O A;  2FMM A;  4KLK A;  2BDO A;  2EXZ A;  2F0H A;  1OXU A;  2N49 A;  5IGB A;  4YCU A;  3SEB A;  4LAA A;  4KV6 A;  3S1N B;  3VR5 A;  5C44 G;  1H9S B;  1V1P B;  1W6J A;  3UI2 A;  5LMN L;  2B8G A;  1STN A;  3HKZ G;  4QUC A;  4LW1 A;  4A76 A;  3D3R A;  1UUP A;  3ND8 A;  1B1Z A;  1CSQ A;  1R9T H;  1PRT C;  1HH2 P;  2N88 A;  1Q90 A;  4JI1 L;  1STB A;  4K5V A;  1VQC A;  4A3E H;  4LF5 L;  1JC7 A;  1GXD C;  1VQG A;  4IFD J;  5A2Q E;  4HJ9 A;  4FF4 A;  2CWA A;  1L1O C;  4DK1 A;  4EX5 A;  3OMG A;  5LMN W;  1Y8P B;  1EU4 A;  3J81 i;  4DFA A;  4IUP A;  3M3Y H;  1HRJ A;  5JJI A;  2DUD A;  1JWU D;  1TVX A;  1TWF H;  2VB3 X;  2QIL A;  3S1Q B;  4XXE A;  1FNV A;  4CDE C;  5J39 A;  3AEV A;  1V9P A;  1PH8 A;  4BBR G;  1QUQ B;  1IBL Q;  1OXS C;  5IYD G;  3L3O C;  1CHP D;  3I4L A;  2FMC A;  4C56 C;  2VQE Q;  1AFP A;  3H3V I;  1LAB A;  1LYL A;  2AWN A;  1I6H H;  5F2D A;  3RLO A;  2RCN A;  4HID A;  4LUO A;  1HHV A;  1EU3 A;  2R7D A;  1YJW A;  1BNZ A;  4YY3 Q;  2D5D A;  3H0G G;  1E24 A;  4IUQ A;  4JI7 L;  3P75 A;  3VR6 A;  4K8J A;  4RA8 A;  1X54 A;  4Q5V A;  2NVY B;  5I6Y A;  1VQ8 A;  1MD2 D;  4BY1 G;  2HCI A;  2CWP A;  4ZKB B;  5M3F H;  2IWH A;  1H9S A;  1LUZ A;  2AUJ D;  1G51 A;  2CQA A;  3KDF B;  3TZU A;  1IYJ B;  2NBF A;  1SRO A;  1NTG A;  1Y1V H;  3EBE A;  4DV3 Q;  4P71 A;  2BA0 A;  3PF4 A;  3VYU A;  1TY0 A;  1D8L A;  3FPP A;  1VQE A;  4JI4 L;  4POG A;  1JJC B;  4DUY L;  1XJV A;  1BBU A;  2SOB A;  4CBV A;  4CDF C;  5IGE A;  4NW2 A;  1G6P A;  1N34 L;  3M4P A;  3S15 B;  5GAH C;  2J0T D;  1SJE D;  2F3V A;  3OIP A;  2Q8R E;  4K6D A;  5C0X H;  4FF3 A;  1QJO A;  1ASY A;  2F0K A;  2IL8 A;  4OO1 H;  1F9P A;  3BDO A;  4UAI A;  4JI2 L;  4L5R C;  2WFW A;  2B63 G;  5JAV A;  2ENB A;  4KKU A;  4A3C G;  3TME A;  3GTL B;  1H9J A;  1F2M A;  2KQ3 A;  3V96 A;  1K83 B;  1QUQ A;  4PZ8 A;  4A3J G;  3KUP A;  1VQ7 A;  4A3K G;  1VMC A;  1BXT A;  4A3D H;  4DF7 A;  4H0L C;  4C3I H;  1MI2 A;  2XVS A;  5IWA L;  1HNZ L;  3MHB A;  1XNR L;  1YNN C;  1N9W A;  2OQ0 A;  1WD0 A;  1PTO F;  4JVZ A;  1T5X D;  3CC7 A;  4DPG A;  1HZB A;  3VR3 A;  4HED A;  2VQF Q;  1CT1 D;  1E2V A;  4LF8 Q;  1GOZ A;  4CDD C;  4FYD A;  1PZK D;  5EPL A;  1HUN A;  5GAE C;  4ULL A;  3I4N H;  1HZC A;  1U4L A;  2Z6K C;  1R9T B;  1EYC A;  1PZJ D;  1PRT D;  2MPM A;  1KAB A;  4YWM A;  4A3E B;  2XTI A;  2RCF A;  1VCI A;  1X32 A;  4X3S A;  2HQL A;  3U9S A;  2ZTC A;  1D5Z C;  1VQJ A;  2K5D A;  1YNJ C;  1K3R A;  3NTI A;  5G3L F;  4LF6 L;  4RH6 A;  2K33 A;  3M3Y B;  3KOJ A;  4AQY L;  4DV6 Q;  3CCV A;  2WAQ G;  2HIV A;  3CC4 A;  1KHI A;  2F0S A;  1TWF B;  2Z9H A;  3PO3 B;  3MXP A;  1EEI D;  3LNN A;  3A8J E;  1HNW Q;  2HQE A;  4DV2 L;  3D4W A;  4FDB A;  1GUO A;  1FJG Q;  1P16 A;  4BY7 G;  4JI0 Q;  2R7F A;  1E1T A;  1WJJ A;  4BXX G;  4G7O C;  2LY7 A;  3T53 B;  1XPO A;  2C9O A;  1G2S A;  1PH5 A;  1I6H B;  4LF9 L;  5ELB A;  2YU9 B;  2QF7 A;  3MFY A;  4G7Z C;  4XYO A;  4HSV A;  4IN3 A;  3NTK A;  2UU9 L;  2ZJR A;  3I4M G;  3GP7 A;  1QVG A;  4LMQ D;  2I46 A;  2Y0S G;  3CP0 A;  1EIH A;  4DAP A;  4IFD I;  1LT4 D;  1X6O A;  3SR1 A;  4DV4 Q;  1Q7Y C;  1N33 L;  1IBK Q;  5M3F B;  5IP7 G;  3RLF A;  2JXM B;  4A3B H;  1WTV A;  4CJ0 B;  1TWG H;  3E9H A;  3QG1 A;  4LK1 C;  2EIF A;  3KLW A;  2LFN A;  2CKZ B;  3GV6 A;  1TWA H;  3AQQ A;  2O5J C;  4IUN A;  1LT3 D;  4BBS H;  1Y1V B;  4J6H A;  3GTG H;  2EYO A;  4XQJ A;  4DAY B;  3BZC A;  4JC0 A;  2EJM A;  2IX3 A;  3A55 A;  3RN5 A;  5AFW A;  3PO2 G;  3NP8 A;  2PNH A;  4C3H B;  1ENF A;  4B9W A;  5M3M G;  1SYE A;  2JA9 A;  1RHP A;  5CGK A;  4GNX B;  2KHI A;  2CH4 W;  1I4H A;  3A7A B;  4X62 Q;  3OIQ A;  5I9O A;  4GKJ Q;  2VXW A;  5I9P A;  5KIX A;  5JEA H;  4JBK A;  1HFN A;  3CF5 A;  2F4I A;  3DWA A;  1HQR D;  2NZH A;  1O7Y A;  3FKI G;  4MNO A;  2K01 A;  1VQO A;  1BCP C;  3C1E A;  3TQY A;  4A3D B;  2BCO A;  3QR8 A;  4C3I B;  5BR8 Q;  1E3P A;  5C0X J;  4H02 A;  4HAE A;  2B39 A;  3T13 A;  3K0Y A;  2B2U A;  4AYB B;  2AWO A;  4DR2 Q;  1D1I A;  1I3Q H;  1YNN D;  5ELD A;  1S5D D;  4GOP C;  1PV4 A;  1CKM A;  4NMZ A;  3VYR A;  1VS0 A;  3SVM A;  4DR3 L;  1EWH A;  1D1K A;  1STH A;  2Q8I B;  1HZA A;  2B2W A;  1O7I A;  2HHH Q;  4C3J H;  2KED A;  3T1Y L;  1B3A A;  3MEF A;  1X3P A;  5AJ3 Q;  1PH2 A;  4MHE A;  1EEF D;  1Q3L A;  3ZYY X;  3TS2 A;  3PUW A;  2VZA A;  5C4Z A;  4XYQ A;  1UE6 A;  1LLR D;  1SN8 A;  1PFM A;  2K75 A;  3WOE A;  3JAM i;  1I4R A;  3M4O H;  2LXK A;  3W5O A;  1IZ6 A;  4EQP A;  1E2Z A;  1W3S A;  4IUT A;  4K0K Q;  3S1R B;  1UE7 A;  2WB1 E;  2IX0 A;  2K04 A;  4DAY A;  1VQH A;  4LUV A;  2O5I C;  2RA4 A;  1KRT A;  3SDZ A;  2EYP A;  4KKT A;  4JI6 Q;  5CV4 A;  1EZ8 A;  1KQS A;  4X66 L;  1DOM A;  1EY5 A;  4GNX A;  4DXG A;  4DV3 L;  1QVF A;  3IKJ A;  5FO7 B;  1PHJ A;  1PMR A;  4R8I A;  2JA5 B;  1AH9 A;  1B9N A;  1CKO A;  2R93 H;  4NKL A;  3DMU A;  4IOC A;  1Y1W H;  3I91 A;  3MVV A;  1EY9 A;  5BN5 A;  2QKI C;  4G7H C;  2KHS A;  1H9K A;  3OHX C;  1PXU A;  5G3L D;  3DWQ A;  2K52 A;  5EGT A;  4R4Q A;  1WTH A;  3S2D H;  3PO3 G;  2SNS A;  3DM1 A;  3ULP A;  4DGZ A;  1H9R A;  4XQQ A;  3T56 B;  1YVC A;  2Z6B A;  4F88 A;  1RTO A;  5C3E G;  1AN8 A;  2KEN A;  4ZK9 B;  1B2T A;  1JCK B;  3NTH A;  2DJF C;  4A3B B;  1TWG B;  4HR7 B;  5K36 G;  1TWA B;  1Q82 C;  1S5F D;  4BBS B;  3KF6 B;  3T16 A;  3HOU H;  2OEO A;  3NEM A;  3FRP B;  5KYL A;  3GTG B;  1DON A;  3PCO B;  1QB5 D;  2R6G A;  3Q6S A;  5EKK A;  1SNO A;  2ZXR A;  4X6A H;  5IYB G;  4LF8 L;  1I5F A;  1ICW A;  2EJG C;  4K5W A;  2PQA A;  5IP9 H;  1U9R A;  3LX0 A;  2F52 A;  2NTS A;  4OWW B;  1JWM D;  4FXD A;  5C4X H;  3RD4 A;  4A4I A;  5LMU Q;  3GO5 A;  1NE3 A;  4DR5 Q;  5M5Y B;  3AB9 A;  2L15 A;  1V1O A;  3CXC A;  2ZM6 Q;  1SSO A;  4DU9 A;  3G4S A;  1XNQ Q;  3J7Z C;  2PMZ B;  4WJW A;  1NJI C;  4LFC Q;  3EQL C;  1WCM G;  3VYT A;  3GQB A;  3HKZ E;  2IHF A;  4U68 A;  4YCW A;  4HN7 A;  1ZXT A;  4C3H G;  1BCP D;  2EQS A;  1EY8 A;  1EQT A;  2ASB A;  2Q2I A;  3HP3 A;  4OIJ A;  5K5P A;  3PIP A;  1V1Q A;  1B50 A;  3PIP 3;  4N8X 1;  1LTT D;  4QJF A;  4PZ7 A;  5DEH A;  1FJG L;  2AQ1 B;  2NN6 G;  3NHH A;  4JI0 L;  1TKW B;  3ERO A;  1JOQ A;  1OXT A;  2C5C A;  3TRZ A;  3S9W A;  1Q1E A;  4C3J B;  2F0N A;  1KAA A;  1CSP A;  2A6E C;  3GD7 A;  5E3F A;  3K0X A;  4LFB Q;  3NPP A;  2EYH A;  3CCM A;  2XN9 C;  2FJ2 A;  4A3D G;  1IW7 C;  1NAP A;  3NSW A;  3R8B A;  2PNR C;  3PUV A;  5HGT A;  2R92 H;  1AE2 A;  3I55 A;  2EVB A;  4A3L H;  1AE3 A;  5D3I B;  1SBB B;  1R4P B;  1ZEQ X;  3KF6 A;  4HCS A;  1PYB A;  1IBK L;  3K81 C;  2GA4 B;  1J9O A;  1S72 A;  1A6X A;  3AFP A;  1LTB D;  1H95 A;  3K8A A;  3G7L A;  5CBE E;  3RZO H;  2F0G A;  1TR5 A;  2L12 A;  2EY6 A;  3HOX G;  1XMO Q;  5C0X I;  2XRS D;  4OO1 I;  1WTP A;  3ULJ A;  2OT2 A;  1SMY C;  3BJU A;  2JA7 H;  3U9O A;  1II3 A;  4M1U B;  3ONA B;  1ILP A;  1E0B A;  2R93 B;  3KLS X;  4LJZ C;  1Y1W B;  5T1I A;  1VQK A;  1EFI D;  1KNE A;  3S14 H;  3NBI A;  1M4V A;  2AKW B;  4MZ9 A;  5I6W A;  1HR0 Q;  3W2D A;  4B3S L;  3CKI B;  3RLN A;  1TII D;  3S2D B;  4GKJ L;  4WJ3 M;  1C48 A;  2EYF A;  5D65 A;  3S17 B;  1DM0 B;  1TWH H;  2WAC A;  4KY7 A;  2JA5 G;  1A0I A;  1UWV A;  4DV0 Q;  3MWY W;  4L5T A;  1F2Y A;  4A93 H;  1BVS A;  1SJH D;  3OWE B;  4KTA A;  1MGS A;  5BR8 L;  1EOT A;  1UAP A;  1WTQ A;  2B29 A;  1GO3 E;  1DGS A;  1AZQ A;  4FF2 A;  1Q46 A;  3HRZ C;  2DY7 A;  3HOU B;  3LGJ A;  3CRK C;  4LWC A;  2QA4 A;  2G5D A;  3NQT A;  5IT9 c;  2VW9 A;  2KCN A;  1XPU A;  3IAY A;  3D6C A;  3I7F A;  1IXR A;  4X3K A;  3HOV H;  5IT9 E;  5I2Y A;  1KNA A;  2B2Y A;  5CR3 A;  1TWC H;  2JJQ A;  1HFG A;  1XMQ Q;  3IFT A;  2K50 A;  3CAM A;  5EBD A;  4RCN A;  1SLJ A;  2QDB A;  3D4D A;  4K5X A;  4DKA C;  4OX9 Q;  5IY0 A;  1E1O A;  2GVB A;  4LF4 L;  3GTO H;  2LMC B;  3VA7 A;  4DR6 Q;  2LKV A;  3GTK H;  4OL7 A;  1N8R C;  3QO2 A;  1MBY A;  3S2H H;  1EY0 A;  1EWC A;  1RL2 A;  1FYC A;  2KCC A;  4G57 A;  3TRE A;  3HOW G;  4I65 A;  3TSS A;  1OXV A;  4BA2 I;  1PVO A;  1PH1 A;  3M85 A;  3X3M A;  1G6Z A;  1X55 A;  2Z8L A;  3WWV A;  4A3M H;  3T4A C;  1C8C A;  4DR7 Q;  3H09 A;  3SGI A;  1YEZ A;  1HTL D;  4A3G G;  2KCM A;  3E0E A;  1XX8 A;  1HNX L;  2UUC Q;  1KIX A;  2JA6 H;  1EL0 A;  2L0C A;  1M8A A;  1TS2 A;  2PI2 A;  1EQR A;  2V4D A;  3D8G A;  1U0L A;  4OEM B;  2N78 A;  4L5S A;  2R7Z H;  1C0A A;  2N8N A;  2MGS A;  2WAQ E;  2A6E D;  5DM6 3;  3HOZ G;  1RDP D;  1IW7 D;  2VUM H;  1WVL A;  1MSG A;  2E2I H;  2R92 B;  5FJ8 G;  1SNQ A;  1VQ6 A;  3E0J A;  1B9M A;  3OMC A;  4A3I G;  5I2X A;  1JE5 A;  2R3Z A;  1NY4 A;  1LTA D;  2EZV A;  4P75 A;  1VF7 A;  2PZW A;  1YNX A;  3HOY G;  2A69 C;  2VB2 X;  4XIG S;  1A63 A;  4QQB X;  3AMU A;  1TQO A;  4LFA L;  3RZO B;  4BS9 A;  2UUB Q;  1LT6 D;  1IKM A;  4AH6 A;  2Y0S E;  3PF5 A;  1F9R A;  4H44 C;  1S4Z A;  5FLX L;  4DAM A;  4B3T L;  4ALP A;  2JA7 B;  1SMY D;  1SE2 A;  3DUZ A;  3NUC A;  2JA8 H;  3MXG A;  2K05 A;  4IQZ A;  3P1H A;  3K5O A;  5IT9 L;  4CJ2 C;  3S14 B;  5J3B A;  2A19 A;  5LMU L;  4DR5 L;  1Q81 C;  1I6V C;  2F0P A;  4RKL A;  3GTM B;  3R2I A;  2RSO A;  4JV5 L;  4KHP L;  4JPB W;  1Y14 B;  2E2H H;  1JOR A;  3ULL A;  4GS3 A;  4B3R L;  1VQA A;  1MSH A;  1QG7 A;  4LFC L;  3S1M H;  4QF4 A;  1TWH B;  2L55 A;  3V2T A;  3HGB A;  1B53 A;  5DM7 3;  1YHQ A;  2Q2H A;  1IHZ A;  2WIN B;  4JOI A;  3OTO Q;  1K8G A;  2A1A A;  1I94 L;  1LTG D;  3FEW X;  1BF4 A;  2LXJ A;  4S3S A;  3CC2 A;  2G9D A;  4DNR B;  1JMC A;  5JVH 3;  1ASZ A;  2F0M A;  1GUG A;  2FHT A;  4R9W A;  2L9H A;  3TP6 A;  3GTJ H;  4JYA L;  2IHE A;  5M5X H;  2C35 B;  1PFS A;  4UP8 A;  4EGV A;  3K5N A;  3HOV B;  2KEC A;  5A2Q L;  5CV6 A;  1CZW A;  4P72 A;  3K6O A;  1HA6 A;  1RJT A;  1TWC B;  2B2T C;  4GLV B;  1RCV D;  2NWG A;  1HA5 A;  2IT1 A;  5EBC A;  4JI3 L;  3GTO B;  1PRT B;  1KL9 A;  1ML0 D;  1SYC A;  4XDX A;  3GTK B;  2NVT H;  1EIY B;  3UDG A;  2MNA A;  3T1H Q;  5CC4 A;  3S2H B;  3WDN A;  1VMP A;  3D0F A;  4KN4 C;  4CJ1 B;  3ITP A;  3A5Z B;  3KBX A;  2KBN A;  1GHK A;  4DV5 Q;  4IAL A;  1XWE A;  2B3G A;  3FP9 A;  2LS0 1;  1LTR D;  4PNY A;  1XMO L;  2EPB A;  1YIT A;  1I4X A;  1PDQ A;  2ES2 A;  3HEJ A;  4I7Z C;  3CW2 C;  4ZYS A;  1A2T A;  2JA6 B;  5E1F A;  4FNF A;  2F0Q A;  3OYY A;  3S16 H;  4EQO A;  2UUA L;  1JJ2 A;  5ELF A;  3VYS A;  4DV1 L;  2DGY A;  4IFD G;  4X64 Q;  3KJP A;  4XTC S;  4RWS C;  3ER0 A;  5EAY A;  1PTO C;  4NXM L;  2VUM B;  1STA A;  2XRQ D;  1HUM A;  4DR4 L;  4LF7 Q;  2E2I B;  4XT3 B;  2FFK B;  4R1J A;  3SHL A;  3RZD H;  1VQ5 A;  3LWE A;  2OTJ A;  2PZT A;  5JOB A;  1MIU A;  4DK0 A;  4DV0 L;  2E5L Q;  2E8G A;  1M90 C;  2FXQ A;  3UDX A;  1WTO A;  2CQO A;  4BA1 I;  2A69 D;  1HXY D;  2F0E A;  2RVL A;  1HR0 W;  5JJL A;  4PMB A;  4KD3 A;  1VQ9 A;  3RUZ A;  2CW0 C;  2ZJQ A;  4UY8 C;  1F9Q A;  2VY3 A;  3DM3 A;  3HZX A;  2JQO A;  3BVG A;  1OXX K;  2KEE A;  2JA8 B;  1S5B D;  4QL5 A;  1J5E Q;  1T5E A;  2OTL A;  4KHZ A;  1CQF A;  2ZXO A;  4J15 A;  4QMG A;  2XWB B;  1Q8I A;  1L1O A;  1IBM L;  1JE4 A;  3HS0 C;  4IPC A;  3L9A X;  4R4O A;  1N32 L;  1VQD A;  1SNP A;  3MC0 B;  1BDO A;  4YWK A;  2CH4 A;  2PYK A;  4RFB A;  4JI8 Q;  2E2H B;  1QWY A;  3MZ5 A;  4A3F H;  2M9V A;  1AW7 A;  1STG A;  3S1M B;  2D9U A;  1WOC A;  1XTD A;  1NMG A;  4YHH Q;  4GKK Q;  4HJ5 A;  1ESR A;  3BU2 A;  5M5W H;  3D31 A;  3E3X A;  4DR7 L;  1ENC A;  3STB C;  1TS3 A;  3CQZ H;  2F0V A;  1EFW A;  4ME5 A;  1QVC A;  2RBM A;  2K5H A;  1CFM A;  3Q8D A;  1B4O A;  5IOD A;  3GTJ B;  2F0D A;  5M5X B;  2YV5 A;  1O78 A;  5FLM G;  2PZU A;  1W6K A;  1TS4 A;  1PZI D;  2BOS A;  2KA7 A;  3Q24 A;  2EY2 A;  3J80 c;  3OWF A;  4UP9 A;  5CBA E;  5C44 H;  2K28 A;  1DZ1 A;  1G2T A;  2NB0 A;  3EJI A;  2F3W A;  3J80 E;  2AQ2 B;  2CVR A;  2RDH A;  3K7A H;  2NVT B;  3QOL A;  5EJW A;  5EPK A;  5IGC A;  5IOC A;  3DWP A;  1VQF A;  3AU7 A;  4KJN A;  4XT1 B;  5HUR A;  1IBL L;  1B44 D;  2K5W A;  3RR5 A;  3OOC A;  4HMJ A;  3SXH A;  4QCL A;  2VQE L;  5IYC G;  2F0L A;  4KI0 A;  5FO8 B;  4X65 Q;  2H4O A;  2UUB L;  1WTR A;  4K2L A;  2KVM A;  2F0U A;  2MO0 A;  4O0A A;  1IL2 A;  3I4N B;  1EUJ A;  5KGU A;  3H3V C;  3FMC A;  4YY3 L;  1PH9 A;  2JP1 A;  3TP5 A;  1LTL A;  2B2V C;  3PUY A;  3V05 A;  1RIP A;  1RKN A;  1ESF A;  4R4C A;  2F0W A;  2AQ3 B;  3C1F A;  5BN3 A;  3EIV A;  2PQA B;  1IKL A;  2F0F A;  4BBR H;  2UXC Q;  3M4Q A;  1PTO D;  2AMC B;  4DR1 Q;  4FVM A;  5IYD H;  3IFD A;  1KLU D;  4J8Q A;  3EA6 A;  1G8Z D;  1U5K A;  4MTN A;  5KYI A;  4GZY C;  3F2C A;  1VQN A;  3U50 C;  4C1N I;  3D4R A;  4A3E G;  4WJ4 A;  4HIK A;  4R8N A;  4RG1 A;  2F3I A;  3H0G H;  1VF5 C;  5DLQ E;  2A6H C;  4RMF A;  1B7Y B;  1PYW D;  1L0X B;  1GJX A;  2Q2U A;  2AHO B;  2I5H A;  2CW0 D;  3VA5 A;  5JJK A;  4AIM A;  4P74 A;  4OWT B;  3SK6 A;  4BY1 H;  3KYH C;  2Z6K A;  1LTS D;  4FO2 A;  1D2B A;  2ATW A;  1Y8N B;  4J1M A;  2BE5 C;  2PPB C;  4JI1 Q;  1VDZ A;  1GUN A;  4OWX B;  4LF5 Q;  1YIJ A;  2D0O A;  1EZ6 A;  5J22 A;  1GKH A;  1DOK A;  1F2L A;  1HQM C;  1C4Q A;  1NR2 A;  3J80 L;  3EVQ A;  4DNT B;  1FNW A;  4A3F B;  1ET9 A;  4Y7N H;  4UPA A;  3GTP H;  3MXU A;  2IPK D;  2YTX A;  1H9M A;  3AYH B;  2EYJ A;  4NXN Q;  1ROD A;  3CMA A;  4KKS A;  3MAQ A;  3H91 A;  3G6E A;  4PZ6 A;  1GM5 A;  3A54 A;  2TSS A;  1JQY D;  1CA5 A;  2B63 H;  3MA2 B;  3UE0 A;  4B08 A;  2VQF L;  2L1B A;  4A3C H;  3STB D;  3R2T A;  1I50 H;  1A3T A;  5M3F G;  3G48 A;  1S5C D;  4CGY B;  1WD1 A;  3BVM A;  4A3J H;  3KLS A;  4A3K H;  3DXJ C;  4HIM A;  4GOP B;  5C6A A;  2MP1 A;  1A3V A;  3F2D A;  3Q23 A;  1DYQ A;  5JJZ A;  1Y1V G;  2K4K A;  4N9T A;  2I5L X;  2J7Z A;  2NZ1 D;  5C3X A;  5JPN C;  4QIW E;  4X3U A;  1Z47 A;  4B9X A;  1PH3 A;  4JI7 Q;  5C44 B;  3DEO A;  3FHW A;  4DNI A;  4RGO S;  1S5E D;  4KHV A;  2A8V A;  4RGT A;  1YZ6 A;  4DV6 L;  3HKZ B;  2P5Z X;  1X3E A;  2RSN A;  5C0X G;  1EYD A;  2DY8 A;  5EPJ A;  4OO1 G;  1IYU A;  1I3Q B;  5JEA J;  1EY4 A;  4IO9 A;  1HNW L;  4GLX A;  1RF2 D;  3BYT B;  5I4D A;  1BUV T;  5KNC A;  3BDL A;  2K1B A;  5FOB B;  4LUZ A;  1ILQ A;  1NMF A;  1SYF A;  4NPS A;  1SMX A;  2KJX A;  3GDE A;  3H94 A;  3LWU A;  4DUY Q;  1EY6 A;  2AUK A;  4C3I G;  3CCS A;  1JWS D;  2E75 C;  2XNA C;  4AYB G;  1SFO H;  1N34 Q;  1KDC A;  2KHJ A;  4PV1 C;  5IGG A;  2JEA I;  1GUS A;  3NEN A;  4N9P A;  3M4O B;  5LL6 S;  1IYV A;  4JI2 Q;  4DV4 L;  4BBR B;  3M7G A;  4BY7 H;  3A74 A;  4BXX H;  2E2D C;  5JVG 3;  2CHB D;  4HIO A;  5JPM C;  1KRS A;  3I4O A;  1T9H A;  4ZRZ A;  4TVA B;  2JSO A;  1KAW A;  4K6L A;  3I4N G;  2HCC A;  3CCJ A;  1AP0 A;  3DEP A;  3I56 A;  3A7L A;  3UDF A;  2PW7 A;  2NTT A;  4GOP A;  5FKA C;  3W3A A;  3Q22 A;  3I4M H;  1HNZ Q;  1XNR Q;  1U4R A;  2A6H D;  3F2U A;  4LNQ A;  5E4W C;  4IUU A;  2X69 A;  4DUZ Q;  2F0J A;  3QWN A;  2A73 B;  4RHS A;  1JOK A;  4H7B A;  2ICE C;  2EDG A;  3I2Z A;  1D5X C;  1S40 A;  4BY1 B;  3JAM c;  3KLR A;  3J7Y W;  5IP7 H;  4ID6 A;  3PIO A;  2D2C C;  1L2F A;  2EY5 A;  2RKS A;  4X62 L;  3JAM E;  1Y8O B;  4GN5 A;  4EQN A;  3P7J A;  2BE5 D;  3J7A F;  5C3W A;  2IW3 A;  3KF8 B;  3E6Z X;  4NDX A;  2M00 A; 
#chains in the Genus database with same CATH homology
 4KHP L;  3CP0 A;  1Y14 B;  2MQH A;  3T1H L;  2E2H H;  2ZJP A;  4IFD I;  1E22 A;  3ULL A;  4GS3 A;  1X6O A;  4DV4 Q;  1Q7Y C;  1N33 L;  4B3R L;  1VQA A;  1IBK Q;  2JA8 G;  4LFC L;  3PO2 H;  2QGQ A;  3S1M H;  5M3M H;  3BZK A;  3RLF A;  5IP7 G;  3DLL A;  2YTY A;  3S17 H;  4A3B H;  1YHQ A;  2Q2H A;  4LF6 Q;  4DR2 L;  1TWG H;  3E9H A;  4DV5 L;  2EIF A;  3KLW A;  4AQY Q;  2CKZ B;  1TWA H;  3AQQ A;  3W1B A;  1PH7 A;  2D0P A;  3L0O A;  4BBS H;  4JOI A;  2IX1 A;  4JCV E;  3OTO Q;  4APV A;  1K8G A;  2A1A A;  1I94 L;  3GTG H;  2HHH L;  4LFA Q;  4DAY B;  2LXJ A;  3BZC A;  4JC0 A;  3CC2 A;  4DV2 Q;  3RN5 A;  1B70 B;  3PO2 G;  1JMC A;  2PNH A;  3FKI H;  1ASZ A;  5M3M G;  1A8V A;  5AJ3 L;  4JYA L;  4B3T Q;  3GTJ H;  2IHE A;  2JA9 A;  2RHQ B;  2C35 B;  1PFS A;  5M5X H;  1X9N A;  3U4V A;  4UP8 A;  3H15 A;  4X64 L;  4A3B G;  4PMW A;  4GNX B;  2UXD L;  1EIF A;  4P72 A;  1PH4 A;  4TQU S;  2KHI A;  1SE8 A;  4GLV B;  3S15 H;  4BBS G;  4LF7 L;  1QZH A;  4X62 Q;  5ELO A;  1MKH A;  4R4T A;  2WP8 J;  2IT1 A;  5IE8 A;  4GKJ Q;  4JI3 L;  1FL0 A;  1NBW A;  4JBK A;  2UU9 Q;  3CF5 A;  2PMZ E;  2UXC L;  1KL9 A;  2NZH A;  2I0Q A;  4K0K L;  4DR1 L;  2NVT H;  1EIY B;  4JV5 Q;  3FKI G;  4MNO A;  3UDG A;  1BKB A;  2MNA A;  3T1H Q;  2HT1 A;  4KHP Q;  1VQO A;  1P8L A;  2E5L L;  1N33 Q;  3UE1 A;  3TQY A;  4B3R Q;  4JI6 L;  1Q1B A;  3D0F A;  2NVX H;  5BR8 Q;  1E3P A;  5C0X J;  4H02 A;  3A5Z B;  3A0J A;  2BH8 A;  2AWO A;  2KBN A;  3S1N H;  4DR2 Q;  5JEA G;  1I3Q H;  1XPR A;  4DV5 Q;  2JEB I;  3AFQ A;  3HFZ B;  3M9B A;  2B3G A;  3FP9 A;  4JBJ A;  4R4I A;  4GOP C;  4JI4 Q;  1D7Q A;  1PV4 A;  1WI5 A;  1CKM A;  5GAD C;  1XMO L;  1YIT A;  1SRU A;  1VS0 A;  2NVQ H;  3PUX A;  3G71 A;  4JBW A;  4DR3 L;  2ES2 A;  2JE6 I;  1HZA A;  1I94 Q;  4POF A;  3CW2 C;  1O7I A;  2HHH Q;  1YHA A;  3A5U A;  4C3J H;  1J5E L;  1K0R A;  3OYY A;  3VDY A;  3S16 H;  2N3S A;  3T1Y L;  1JJ2 A;  2UUA L;  3MEF A;  2K14 A;  3W1G A;  5AJ3 Q;  1PH2 A;  4JYA Q;  4DV1 L;  2DGY A;  5HY6 A;  1QZG A;  4IFD G;  2UXB Q;  4X64 Q;  3TS2 A;  1VQ4 A;  4JI5 Q;  3E9I A;  3PUW A;  3KJP A;  4XTC S;  2VZA A;  4C2M H;  3KFU A;  1JT8 A;  3ER0 A;  5EAY A;  4NXM L;  4JI8 L;  1UE6 A;  1G29 1;  2H5X A;  5E7N A;  4DR4 L;  4LF7 Q;  4R1J A;  1SN8 A;  2K75 A;  3PUZ A;  3JAM i;  3RZD H;  4JI3 Q;  3M4O H;  2LXK A;  3W5O A;  1IZ6 A;  1K73 C;  1W3S A;  1VQ5 A;  1GD7 A;  4K0K Q;  1UE7 A;  2WB1 E;  1X65 A;  2IX0 A;  3K80 C;  1V43 A;  4YHH L;  1MJE A;  4GKK L;  2OTJ A;  1VQH A;  1CUK A;  5IWA Q;  4LUV A;  1MIU A;  4DV0 L;  1KRT A;  2E5L Q;  2E8G A;  1M90 C;  2FXQ A;  3UDX A;  1YHB A;  2CQO A;  4BA1 I;  4JI6 Q;  3S1Q H;  4NXN L;  1KQS A;  4X66 L;  5JJL A;  1HR0 W;  4IJL A;  1KD1 C;  3MXN B;  4GNX A;  4DV3 L;  1QVF A;  1VQ9 A;  3PO3 H;  1MJC A;  4JOI C;  1E7Z A;  1X3F A;  2GVA A;  1PHJ A;  2CCZ A;  2ZJQ A;  3EN2 A;  4UY8 C;  2VY3 A;  3DM3 A;  4O2D A;  2JQO A;  5HGQ A;  3NBH B;  1AH9 A;  1OXX K;  1CKO A;  2CFM A;  1YJN A;  2R93 H;  2WB1 G;  4IOC A;  3S24 A;  5C3E H;  4DR3 Q;  3ZJY C;  2ID0 A;  1Y1W H;  3M7N A;  4GLA C;  4QL5 A;  2NN6 I;  1VQB A;  1FVI A;  1J5E Q;  2K5N A;  2OQK A;  3CPF A;  2OTL A;  2ZM6 L;  4KHZ A;  3T1Y Q;  1W2B A;  4J15 A;  2UUA Q;  2YU9 H;  1L1O A;  1UEB A;  1LM0 A;  2K52 A;  2PI2 E;  4IPC A;  4R4Q A;  4DV1 Q;  1IBM L;  4R4O A;  1XNQ L;  3PO3 G;  3S2D H;  1N32 L;  1C9O A;  2NVY H;  1VQD A;  2LSS A;  3ULP A;  1K9M C;  4YWK A;  4NXM Q;  1YVC A;  4JI8 Q;  2F4V L;  3GTM H;  4DR4 Q;  1PYS B;  2R93 G;  3CD6 A;  4A75 A;  4A3F H;  5C3E G;  1Y1W G;  1KXL A;  2KEN A;  3ICE A;  5IYB H;  4OXP A;  5C4J H;  3JC6 6;  1WOC A;  1XTD A;  1NMG A;  3RN2 A;  2I5M X;  4YHH Q;  2V1C C;  4GKK Q;  4HJ5 A;  5FLM H;  3K7U C;  5K36 G;  3BU2 A;  4X65 L;  5M5W H;  3D31 A;  1Q82 C;  3KF6 B;  3J80 i;  3STB C;  4DR7 L;  4X66 Q;  3ERS X;  3HOU H;  1B8A A;  3NEM A;  3CQZ H;  5FLX c;  3F8T A;  3PCO B;  2MFI A;  1EFW A;  4DV7 L;  3CCU A;  4IOA A;  4A3F G;  2R6G A;  1QVC A;  4QY7 A;  1WCM H;  2K5H A;  4LF9 Q;  4X6A H;  4LFB L;  5IYB G;  4LF8 L;  3Q8D A;  1I5F A;  1N36 Q;  4JBM A;  1HZ9 A;  4C3H H;  2PQA A;  5IP9 H;  2YV5 A;  2F52 A;  4JG2 A;  4OWW B;  3U4Z A;  5C4X H;  5FLM G;  4B3M Q;  4A4I A;  5LMU Q;  3GO5 A;  1NE3 A;  2YTV A;  4DR5 Q;  3OW2 A;  3PSI A;  2L15 A;  2XGT A;  2ZTD A;  3CXC A;  2Z0S A;  3J80 c;  2ZM6 Q;  3HOU G;  3GTL H;  4UP9 A;  2ALY B;  5IYC H;  5C44 H;  3G4S A;  1IBM Q;  1XNQ Q;  3J7Z C;  1K83 H;  1PA6 A;  2HIX A;  2NZO A;  1N32 Q;  1L1O B;  4DK3 C;  1NJI C;  4GN4 B;  4LFC Q;  3K7A H;  1WCM G;  4UP7 A;  1Z9F A;  3HKZ E;  2IHF A;  5ELN A;  4YCW A;  4IJH A;  3CCQ A;  4OON A;  4YCV A;  5IP9 G;  2EQS A;  3TEH B;  1VQF A;  4KLK A;  5C4X G;  4IPD A;  2ASB A;  1IBL L;  1OXU A;  2N49 A;  3RR5 A;  2Q2I A;  4YCU A;  3PIP A;  2VQE L;  1V1Q A;  5IYC G;  5C44 G;  4KI0 A;  4QJF A;  4PZ7 A;  1FGU A;  4PG3 A;  4X65 Q;  4GNX C;  2UUB L;  4QGU A;  5LMN L;  2NN6 G;  1A62 A;  1FJG L;  1JJG A;  2K5V A;  4JI0 L;  3F2B A;  4DUZ L;  2MO0 A;  1EWI A;  1OXT A;  3HKZ G;  4O0A A;  4A76 A;  4LW1 A;  1K8A C;  1IL2 A;  3TRZ A;  1EUJ A;  1Q1E A;  4YY3 L;  1PH9 A;  1CSQ A;  1R9T H;  2UXD Q;  3L2P A;  1CSP A;  3GD7 A;  1EYG A;  1HH2 P;  3K0X A;  1HR0 L;  4LFB Q;  3CCM A;  1LTL A;  3PUY A;  2KCT A;  4JI1 L;  1RIP A;  2BH2 A;  4A3D G;  1VQC A;  4A3E H;  4LF5 L;  4R4C A;  1VQG A;  4IFD J;  3PUV A;  4HJ9 A;  3EIV A;  2PQA B;  2R92 H;  1AE2 A;  2CWA A;  3HOX H;  4BBR H;  1L1O C;  2UXC Q;  4EX5 A;  3M4Q A;  3I55 A;  4A3L H;  2AMC B;  5LMN W;  1HJP A;  4DR1 Q;  5IYD H;  1AE3 A;  3J81 i;  2RF4 A;  3KDF A;  3KF6 A;  1CKN B;  1U5K A;  4MTN A;  3F2C A;  1PYB A;  5GRO A;  3PV0 A;  1IBK L;  3K81 C;  2BA1 A;  3M3Y H;  2JK8 A;  3RZO H;  1VQN A;  5JJI A;  1S72 A;  2DUD A;  3AFP A;  2D62 A;  3S1R H;  3U50 C;  1TWF H;  1L0W A;  4A3E G;  4WJ4 A;  4HIK A;  1H95 A;  3K8A A;  4RG1 A;  2QEX A;  2F3I A;  3H0G H;  2R92 G;  3HOX G;  3AEV A;  1V9P A;  5DLQ E;  4BBR G;  1QUQ B;  1PH8 A;  1IBL Q;  1XMO Q;  1OXS C;  4RMF A;  5C0X I;  4A3L G;  1YI2 A;  1B7Y B;  5IYD G;  4OO1 I;  3ULJ A;  2VQE Q;  3BJU A;  3J81 c;  2JA7 H;  2Q2U A;  1VQP A;  2AHO B;  3H3V I;  2I5H A;  2RHS B;  1LYL A;  5JJK A;  2AWN A;  4AIM A;  4P74 A;  4OWT B;  4BY1 H;  1I6H H;  3RLO A;  2RCN A;  3KYH C;  2Z6K A;  4HID A;  1EOV A;  2JA5 H;  1XMQ L;  4LUO A;  1VQK A;  3S14 H;  1X3G A;  2ATW A;  2AKW B;  4OX9 L;  2R7D A;  1YJW A;  4MZ9 A;  4YY3 Q;  1BBW A;  3H0G G;  1HR0 Q;  1E24 A;  1VQM A;  3HKS A;  4DR6 L;  4B3S L;  4JI7 L;  4JI1 Q;  4DK6 C;  4OWX B;  3RLN A;  4LF5 Q;  1X54 A;  1YIJ A;  4GKJ L;  4WJ3 M;  2D0O A;  4IPH A;  2JA7 G;  1GKH A;  1VQ8 A;  4Y52 H;  4BY1 G;  4HJ7 A;  1WFQ A;  1Q12 A;  2CWP A;  5M3F H;  1TWH H;  2JA5 G;  1A0I A;  1LUZ A;  4Y7N H;  1G51 A;  1UWV A;  4UPA A;  3GTP H;  4DV0 Q;  3CME A;  4L5T A;  2YTX A;  3AYH B;  1UE5 A;  1JB7 A;  4A93 H;  2Q2T A;  1BVS A;  3J7A 5;  3KDF B;  4NXN Q;  1IYJ B;  5BR8 L;  3CMA A;  1SRO A;  3RNU A;  4EQ5 A;  1NTG A;  1Y1V H;  3EBE A;  3G6E A;  2B29 A;  1GO3 E;  1DGS A;  2BA0 A;  4P71 A;  4PZ6 A;  4DV3 Q;  1GM5 A;  2UUC L;  3PF4 A;  1D8L A;  2B63 H;  1Q46 A;  3UE0 A;  2VQF L;  4A3C H;  1VQE A;  5GAG C;  3NEL A;  3STB D;  4JI4 L;  4POG A;  1TXY A;  3LGJ A;  1JJC B;  4LWC A;  1I50 H;  3CPW A;  1BBU A;  2QA4 A;  5IT9 c;  5M3F G;  2VW9 A;  3G48 A;  4DUY L;  1XJV A;  1OTC A;  4A3J H;  1XPU A;  3J81 j;  4A3K H;  1G6P A;  5GQO A;  1N34 L;  3HOW H;  3I7F A;  1IXR A;  4HIM A;  3HOV H;  4GOP B;  3M4P A;  5GAH C;  4A93 G;  3CCL A;  1TWC H;  3B6Y A;  1CKN A;  2JJQ A;  3F2D A;  1X56 A;  3TS0 A;  1ASY A;  1XMQ Q;  2K50 A;  3CAM A;  1Y1V G;  2K4K A;  4JI2 L;  2I5L X;  2UXB L;  4L5R C;  1SLJ A;  2WFW A;  3H3V H;  4DKA C;  5H1S E;  4JI5 L;  1M1K C;  4OX9 Q;  5IY0 A;  1E1O A;  2GVB A;  4LF4 L;  2B63 G;  3GTO H;  4A3C G;  4QIW E;  5M5Y H;  1Z47 A;  1PH3 A;  4DR6 Q;  4B3S Q;  4JI7 Q;  4A3G H;  2F4V Q;  3GTK H;  1UE1 A;  3FHW A;  1N8R C;  4DNI A;  3S2H H;  1QUQ A;  4PZ8 A;  4A3J G;  3GTQ H;  1VQ7 A;  1Q8K A;  4A3K G;  1C7Y A;  2VNU D;  1RL2 A;  2A8V A;  3TRE A;  1YZ6 A;  4DV6 L;  3HOW G;  3HOV G;  3PGZ A;  4A3D H;  4C3I H;  1X3E A;  1EQQ A;  5C0X G;  1OXV A;  1KC8 C;  4BA2 I;  1PVO A;  1PH1 A;  4OO1 G;  5IWA L;  4AYB E;  3M85 A;  5JEA J;  1HNW L;  4IO9 A;  1HNZ L;  4GLX A;  1X55 A;  1XNR L;  3WWV A;  1VQI A;  4A3M H;  3HOZ H;  1N9W A;  2OQ0 A;  4P73 A;  4HJA A;  4DR7 Q;  3SGI A;  1J6Q A;  1YEZ A;  4HJ8 A;  1GVP A;  4GN3 B;  2MO1 A;  2KCM A;  4A3G G;  3KJO A;  3CC7 A;  3E0E A;  4LUZ A;  1HNX L;  1NMF A;  4DPG A;  5FJ8 H;  4DV7 Q;  1HZB A;  4NPS A;  1KIX A;  3CCE A;  2JA6 H;  1SMX A;  2VQF Q;  4LF8 Q;  2PI2 A;  3GDE A;  4NB3 A;  1EQR A;  4DUY Q;  4A3I H;  1U0L A;  3IRB A;  3CCS A;  2N78 A;  5GAE C;  4L5S A;  2R7Z H;  3I4N H;  1HZC A;  1C0A A;  2Z6K C;  4AYB G;  1SFO H;  2N8N A;  1N34 Q;  2WAQ E;  3HOY H;  2KHJ A;  4YWM A;  1Q86 C;  2JEA I;  1WYD A;  4A3M G;  3HOZ G;  3U58 A;  2XTI A;  2VUM H;  3NEN A;  1VCI A;  2E2I H;  4JI2 Q;  4DV4 L;  2HQL A;  2UUC Q;  5FJ8 G;  2ZTC A;  4LF4 Q;  1VQJ A;  2JA6 G;  1VQ6 A;  4BY7 H;  3A74 A;  4BXX H;  3CCR A;  4HIO A;  1VQL A;  2ZTE A;  4A3I G;  1K3R A;  1YBY A;  1JE5 A;  1KRS A;  1T9H A;  3I4O A;  2E2J H;  1NY4 A;  4TVA B;  2YYZ A;  1KAW A;  4LF6 L;  3I4N G;  4P75 A;  2R7Z G;  3KOJ A;  4AQY L;  4DV6 Q;  3CCJ A;  1YNX A;  3UDI A;  2WAQ G;  2HIV A;  3CCV A;  3CC4 A;  3HOY G;  4XIG S;  3I56 A;  1KHI A;  1A63 A;  4ME3 A;  3UDF A;  3OTO L;  2EXD A;  4QQB X;  4GOP A;  2VUM G;  1YJ9 A;  1S3O A;  4LFA L;  2OCE A;  3F1Z A;  1HNW Q;  3I4M H;  1HNZ Q;  4DV2 L;  2OWO A;  2VS1 A;  2UUB Q;  1FJG Q;  4FDB A;  4AH6 A;  2Y0S E;  5LMN Q;  1P16 A;  3PF5 A;  1XNR Q;  4LNQ A;  4BY7 G;  4JI0 Q;  2R7F A;  1E1T A;  1WJJ A;  2VL6 A;  4DAM A;  4DUZ Q;  4ALP A;  4B3T L;  4BXX G;  2IY5 B;  3I2Z A;  3L7Z C;  1HNX Q;  1XPO A;  1S40 A;  1PH5 A;  1SR3 A;  2JA8 H;  3JAM c;  1PH6 A;  4LF9 L;  5IP7 H;  1N36 L;  2GN5 A;  3PIO A;  1L2F A;  4X62 L;  4GN5 A;  4IPG A;  4L5Q A;  2A19 A;  5J3B A;  2UU9 L;  4B3M L;  2ZJR A;  5LMU L;  3I4M G;  4DR5 L;  1QVG A;  1Q81 C;  3KF8 B;  2Y0S G;  4YWL A;  4JV5 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...