1N33L

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position at the a site with paromomycin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 12
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1n33L00
2ATWA 5C4JH 1N33L 4OWTB 3IRBA 1X65A 2K4KA 3PIPA 1GD7A 1VQBA 2IHEA 2CCZA 1Y14B 3M4PA 2MQHA 4B3ML 4LUVA 4L5TA 4PZ8A 1I6HH 1WCMG 1XPOA 3PO2H 5AJ3L 3I7FA 3CAMA 1M1KC 2JA7H 2NN6I 4KHZA 1OXXK 4JI1Q 5M5WH 5LMNL 1IZ6A 1J6QA 2CQOA 4JBKA 2OTLA 1KC8C 3CW2C 4GKKQ 1X54A 2K52A 3PSIA 2MO0A 4A3CH 3A0JA 4DAMA 4NXNQ 1SN8A 1YITA 3KFUA 3CPFA 3FKIH 2A19A 1PH7A 1HR0W 4YY3L 2UXBQ 2NZHA 4C3IH 3PF4A 3PO3H 3KLWA 2LXJA 3GO5A 4B3SL 3RLOA 3KDFA 3HOYH 4DR4Q 3F1ZA 1NMGA 4A3MH 2I5LX 4LWCA 4JBMA 1LUZA 5M3MH 5C0XG 1QUQA 4DV0Q 3HKZG 5C0XI 5M3FG 3STBD 3OTOL 1EUJA 2K5NA 4P72A 4R4IA 2EQSA 4MZ9A 4LUOA 4YWLA 1CKOA 2K5VA 4LFCL 3U4VA 3T1HQ 1CSQA 4FDBA 3U58A 2Z6KC 5LMUL 2HHHQ 2UUCQ 1IL2A 2R93H 4JI3L 1L1OB 4JI7Q 1N32L 1VQ4A 1PV4A 3K7UC 4JV5L 1P16A 4BY1G 2YTVA 3ICEA 1HZAA 3PGZA 4IFDJ 3CCMA 3M85A 1WI5A 4X62Q 1E22A 3J81c 3ULLA 4YWMA 3HOXG 1YHQA 4A3GH 3PIOA 4DUZQ 3JAMc 1BBUA 2WAQE 1PH6A 4IPDA 4PMWA 4B3TQ 4BBRG 1T9HA 3CMAA 2UUAQ 5IT9c 2VS1A 3I4NH 2KHJA 3L7ZC 1C7YA 3J80i 3RR5A 4B3SQ 3I2ZA 3E9IA 4LF7L 2CWAA 1IBLQ 2GN5A 1TWGH 3E0EA 1E1TA 2R6GA 3F2CA 1JJ2A 2ID0A 4DR1Q 3RN2A 4LF8Q 1XNRL 3GTJH 3L2PA 2ES2A 2NVYH 3GDEA 1HNWQ 1VQOA 4L5SA 2B63H 5C3EH 1IBMQ 4DR4L 1V9PA 2ALYB 4O2DA 1EOVA 4A3FG 1DGSA 2D0OA 4UY8C 1NBWA 1C0AA 4OXPA 5J3BA 1D7QA 1QVCA 2Z6KA 2OQ0A 2E8GA 5IWAQ 1Y1WH 5JJIA 1YHBA 2NN6G 4JI0Q 3LGJA 2Q2HA 4GKKL 1YVCA 3PUVA 4LF9L 3CCEA 4DR7Q 1NTGA 3OW2A 3H3VH 2LSSA 3KJPA 3HOZH 5BR8Q 3CMEA 2F4VQ 3S17H 2LXKA 1GKHA 3UDFA 1K8GA 4LF8L 2PNHA 1QZGA 3M4OH 2RCNA 2NVQH 1U5KA 1A8VA 1X3FA 4DR3Q 4LF5Q 2A8VA 2DUDA 1VQDA 2YTXA 1VQJA 4KLKA 2PI2E 4A3EG 2JA6G 3K0XA 4IPGA 2JA9A 4P74A 5M3MG 1B7YB 1Y1VG 4AQYL 1PH8A 4OO1G 5JJKA 4JI7L 3KDFB 4GLVB 3S1RH 2VQEQ 4X65Q 1AE3A 2K5HA 1WFQA 4LUZA 5FLMG 3D0FA 4DR5Q 4BXXG 4MTNA 3DM3A 4AYBG 5C44G 5IYBG 2E2HH 4A3IH 1SFOH 2RHSB 3G6EA 4R4OA 5IYCG 2A1AA 4IOCA 3CP0A 2YU9H 2I5MX 1JT8A 1K73C 1HNZQ 1VQ6A 1L1OC 4HJAA 1KAWA 1XPRA 5LMUQ 1X3EA 1PH5A 5M5YH 3H3VI 5FJ8H 4DV6Q 5IP7G 3S2DH 4GN4B 2KBNA 4JI0L 4JG2A 1LYLA 3J80c 1NMFA 1MKHA 2QEXA 2XGTA 2PI2A 1VQ7A 4UP7A 2R92G 4JI2Q 2B3GA 4JI8Q 4RG1A 4PG3A 3BZKA 1MIUA 4HJ7A 4A3BH 4YWKA 2K50A 1EFWA 4LF4L 1UEBA 3CQZH 5ELOA 3KOJA 3K81C 2IHFA 5K36G 3FP9A 4OONA 5GAGC 3HOVH 2VZAA 3J7A5 5GADC 1CKMA 1N9WA 4DUYL 4H02A 1VQ5A 1OXVA 1PVOA 1Y1WG 3CCJA 1HZCA 2UXDL 4IO9A 4DR1L 2K75A 1XNRQ 3AFQA 3CCUA 1X55A 3EBEA 3TS2A 2Q2TA 3CD6A 1X3GA 3M3YH 2HIXA 2H5XA 3S24A 5IE8A 3AEVA 2VNUD 2D0PA 4BY7H 4YHHQ 2ZTCA 2UUAL 1I3QH 4XTCS 4A3CG 4GOPC 4AQYQ 4X66Q 2OWOA 4A3JG 3F2BA 3CCSA 1K3RA 2ZJPA 4A3EH 1SRUA 1R9TH 1ASZA 1E24A 1L0WA 4JI4L 3S1MH 4A3KG 3AQQA 4JBWA 4A3MG 4DV0L 3SGIA 1A63A 1EIFA 2R7ZH 4IFDI 1PH1A 1E3PA 4BA2I 4JV5Q 1HZBA 3VDYA 3F2DA 1SMXA 2RF4A 2JQOA 4JOIC 3CCLA 1PYSB 2VW9A 2WP8J 4GNXA 4GLAC 1JJCB 1SE8A 1K9MC 2WB1G 2WAQG 3HKSA 4LFBQ 1CKNA 3UDGA 1Q81C 1IYJB 1FL0A 3B6YA 2I5HA 4LF6Q 3PUXA 1MJEA 4MNOA 4NXMQ 1YIJA 4B3RL 2BA0A 1YHAA 1X6OA 4DV5L 2UU9Q 1XTDA 1VQ9A 1VQEA 4IOAA 2I0QA 4JI6Q 1X9NA 3GTOH 1N34L 3S15H 1TWCH 1KD1C 1G51A 3Q8DA 1G291 1W2BA 3I4NG 3J7ZC 1J5EL 3S16H 3HKZE 1Q1BA 4DV3L 1N8RC 2UU9L 1UWVA 3PF5A 1N36L 3TRZA 1FVIA 5H1SE 3RNUA 2YTYA 4ALPA 4GN5A 1YZ6A 2CWPA 2ZTEA 1HZ9A 1YEZA 3NEMA 2QGQA 1AE2A 4JI4Q 1GVPA 4POGA 4A93H 4YCWA 4L5RC 4A4IA 1RL2A 2Y0SG 4L5QA 2BH2A 2NVTH 1PYBA 4DV5Q 1YJWA 1XMOL 3TREA 3KF6B 1EIYB 1TWHH 3K80C 5M3FH 4Y52H 1V43A 2ZTDA 1D8LA 3HFZB 3EN2A 2K14A 1AH9A 1Q46A 2JA7G 4DR6Q 1VQLA 4P71A 3T1HL 4KI0A 3BJUA 4GOPA 1QVFA 4DR5L 3T1YL 4DK3C 4OO1I 3A74A 3A5UA 1QVGA 2IX0A 3CCQA 1FJGQ 2UXCQ 3KF8B 4EQ5A 1BVSA 1LTLA 3NBHB 4DUZL 1QUQB 2JA6H 2E2IH 1MJCA 1UE1A 2B29A 1KRSA 3OTOQ 3I4MH 1YJNA 4P73A 3K7AH 1E7ZA 3AFPA 5DLQE 1CUKA 2F4VL 3CCVA 3STBC 5JJLA 1PA6A 1CKNB 5C4XH 1I94L 1XNQL 4JYAL 4GLXA 1XPUA 2AKWB 3I56A 4DR3L 1B8AA 1K0RA 4QY7A 1E1OA 3G48A 3G71A 3OYYA 2EIFA 4X64Q 2BA1A 3W5OA 2JEBI 1XJVA 1VQHA 2PQAA 1L2FA 4DUYQ 1YJ9A 4J15A 4RMFA 4DV3Q 1WCMH 1YI2A 4LNQA 3PO2G 4KHPQ 4A3LH 4QIWE 5GQOA 4LF6L 2KCTA 5EAYA 1L1OA 3ULPA 3GTKH 1Q8KA 4BA1I 3PUYA 4DV1L 4LF4Q 2N49A 2GVAA 3RZDH 4BBSH 4GKJQ 2KENA 1A0IA 1I5FA 1I94Q 1HNZL 3ZJYC 4OWWB 1XNQQ 4K0KL 4DV4Q 4AIMA 1VQAA 1N33Q 1XMOQ 1OXTA 4PZ6A 2GVBA 1HR0L 4C3HH 4GN3B 5ELNA 2JE6I 2N3SA 5C3EG 2C35B 4A75A 4DR2L 3HOUH 1SLJA 4DR6L 3S1NH 1S3OA 5GAHC 2QA4A 4PZ7A 2YV5A 4R1JA 3GTQH 4K0KQ 3DLLA 3FHWA 2WFWA 3D31A 2N8NA 1VQMA 3GTGH 3KJOA 1A62A 4OWXB 4DV1Q 2JEAI 2F52A 3TEHB 1EQRA 4LFCQ 3HOZG 2D62A 4A76A 1NJIC 2VQEL 5IYCH 4JOIA 3UDIA 4EX5A 5IP9G 3KF6A 4HIMA 2ZM6Q 1Z47A 2PMZE 1KHIA 2UXDQ 1Q86C 3I4OA 5IP7H 2VQFL 2KCMA 4A3GG 3RZOH 3WWVA 4A3KH 2WB1E 4WJ4A 3J81i 1QZHA 4XIGS 2MNAA 1KQSA 3JAMi 1VQCA 3KYHC 1VS0A 3AYHB 4IJLA 3RLFA 1NY4A 4TVAB 5C4XG 3MEFA 4A3BG 1OTCA 3CPWA 3PUWA 2DGYA 2E5LQ 4IPHA 4JI5Q 3CC4A 1VQGA 3L0OA 2Q2UA 4IPCA 4JI8L 3I55A 4UP9A 3CF5A 1OXUA 4YY3Q 4JI2L 1S72A 1Q7YC 2JA8G 2PQAB 1IBLL 3T1YQ 4BY1H 1KRTA 2R7DA 4QJFA 4X62L 2JK8A 4C2MH 1PH2A 3UE0A 1FJGL 1K8AC 2UXCL 4GNXB 1JE5A 2KHIA 2JA5H 1KXLA 1VQ8A 1Q12A 5HY6A 1HNXQ 2R92H 1WJJA 3H15A 4DV2L 4ME3A 5FLXc 1IBKL 1B70B 3M9BA 1HR0Q 4DAYB 3E9HA 1EWIA 3PUZA 5HGQA 3S2HH 4KHPL 1O7IA 1VQNA 1S40A 4DPGA 2JJQA 2AWOA 1TXYA 1X56A 5BR8L 4Y7NH 1UE6A 4QGUA 3W1GA 4YHHL 1XMQL 3HOUG 4JI3Q 1PHJA 3PO3G 4GS3A 2B63G 2EXDA 4GKJL 5IYDG 2IT1A 4A3FH 1IBKQ 1VQPA 4IFDG 1SROA 1JMCA 4JI6L 4QL5A 1NE3A 5GAEC 1SR3A 2RHQB 1EQQA 1PH3A 4P75A 3S14H 3RLNA 3EIVA 3H0GH 4BXXH 1EYGA 3A5ZB 2BH8A 2HQLA 2L15A 2E5LL 1J5EQ 1VQIA 3J81j 5IP9H 4DV7Q 2E2JH 3S1QH 1G6PA 4NXNL 4LFAL 4DKAC 2Y0SE 5C0XJ 4A3JH 4GOPB 2NVXH 2UUBQ 4HIKA 1XMQQ 4LW1A 4HJ8A 2ZJRA 3HOWH 1TWFH 1K83H 4JI5L 4NXML 1ASYA 2AWNA 1HNWL 4LF9Q 4DR7L 4DNIA 1JJGA 5GROA 1Y1VH 5LMNW 3ER0A 4A3DG 5JEAG 1LM0A 4JBJA 3CC2A 1TWAH 2VL6A 3GTMH 3M4QA 4HJ9A 4X65L 4OX9Q 2OTJA 2VUMH 4NB3A 3U4ZA 3ERSX 4C3JH 4B3MQ 1IXRA 5FLMH 3NELA 4JC0A 2HIVA 3CXCA 2JA8H 4B3RQ 5IYBH 1CSPA 5AJ3Q 3BZCA 3HOVG 2FXQA 2MFIA 4R4QA 1M90C 1OXSC 2YYZA 1W3SA 1YBYA 5JEAJ 4DR2Q 4DV6L 2NZOA 4YCVA 1HNXL 1Q82C 1RIPA 2JA5G 4O0AA 3BU2A 3W1BA 4POFA 2Q2IA 2CKZB 4HIOA 4X66L 2IX1A 3UDXA 3CCRA 3GTLH 4B3TL 4A3LG 4DV4L 1N32Q 1N36Q 3JC66 2F3IA 1PH4A 1YNXA 2VY3A 3U50C 3G4SA 4OX9L 3ULJA 4LFAQ 1I50H 4APVA 1U0LA 2IY5B 1PFSA 1N34Q 1VCIA 3GTPH 1VQKA 1H95A 5IYDH 1C9OA 3FKIG 2ZJQA 1GM5A 4A93G 3I4MG 2UUBL 2UUCL 2OCEA 4X64L 4LF5L 2CFMA 4DK6C 3HOYG 2UXBL 1WOCA 1P8LA 3UE1A 4WJ3M 5E7NA 2MO1A 4HIDA 2OQKA 4IJHA 4DV7L 3TS0A 4LF7Q 3H0GG 1FGUA 1WYDA 4JCVE 4AH6A 1UE7A 2V1CC 1PH9A 1UE5A 4JYAQ 3RN5A 2VQFQ 2Z0SA 4JI1L 5LMNQ 3K8AA 2R93G 4GNXC 1GO3E 1V1QA 1IBML 4TQUS 2ZM6L 5C44H 3NENA 1JB7A 4BY7G 4X6AH 4A3IG 2N78A 4LFBL 2AMCB 3MXNB 3PCOB 3TQYA 5IWAL 4UP8A 4AYBE 3HOWG 5FJ8G 3HOXH 2ASBA 5M5XH 1Z9FA 1VQFA 4QQBX 2R7FA 4YCUA 4A3DH 5IY0A 2R7ZG 4NPSA 1BKBA 1HJPA 1Q1EA 1KIXA 2HHHL 2HT1A 2VUMG 3PV0A 4BBRH 3CC7A 4BBSG 4UPAA 2XTIA 3F8TA 4DV2Q 1KL9A 1BBWA 4R4CA 4R4TA 3GD7A 4HJ5A 3M7NA 1HH2P 2AHOB
chains in the Genus database with same CATH superfamily
3ND8A 2EYHA 5EQ0A 4TRDA 1X65A 2K4KA 1Y14B 2F0QA 3M4PA 2YU9B 2MQHA 4B3ML 1YNJD 1BF4A 2TMPA 2J7ZA 5KYIA 3X3NA 2DN8A 3I7FA 3CAMA 4FXGC 3K0YA 1RTNA 2JA7H 1K8OA 4JI1Q 5M5WH 5LMNL 1WTXA 2A6HD 1FD7D 1IZ6A 4PMBA 2CQOA 4JBKA 1DOMA 3CW2C 2RVLA 1K0SA 2MO0A 3SEBA 5KEEA 4NXNQ 2PO4A 3HG9A 3CPFA 2UXBQ 3K5MA 2LMCB 5CV7A 2CW0D 3PF4A 2LXJA 1NMGA 4LWCA 4DV0Q 2K1BA 3QG1A 5JVH3 1EUJA 2B2YC 3ITPA 4LFCL 1HFNA 4B3SL 2K5VA 4JK1C 3U58A 1QJOA 2R93H 4K6LA 1TWCB 4JI3L 4JI7Q 2CQAA 3K7UC 2QEJC 1HZAA 5DAUA 1HPCA 3CCMA 4X62Q 1E22A 4A3GH 2K5QA 3E0JA 3VR6A 4DUZQ 3QOJA 1BBUA 5EKIA 1ESRA 3J81L 4B3TQ 4BBRG 4L8JA 4XQJA 2VS1A 2KHJA 2X6LA 3J80i 4HTHA 3E9IA 1J8IA 1IBLQ 4TSSA 1TWGH 3E0EA 5C6AA 2R6GA 4LF8Q 3RN2A 3GTJH 2NVYH 1VQOA 2B63H 5CYUA 1MHWC 2N55A 3HOZB 1D7QA 4X3KA 4DR7Q 3GTQB 3VYUA 3OWEB 4OHJA 3OW2A 5EBDA 2WV6D 2LSSA 3CMEA 1EY6A 4DR3Q 3T56B 4X3TA 1V8QA 4C3HG 2JA8B 4KLKA 2PI2E 4IPGA 5KIXA 4AQYL 3JAME 3MVVA 1S5CD 3KDFB 4IUVA 2K5HA 3GTLB 1QE6A 1H9MA 4MTNA 3AMUA 3DM3A 5IYBG 1D1KA 1F9QA 2C5CA 2RHSB 3UI2A 4R4OA 1EYDA 2ZXRA 2YU9H 5JVG3 1EZ6A 3RD4A 1QCBD 1L1OC 1VQ6A 1PH5A 3S2DH 5M5YH 4DV6Q 3S1QB 1UNSA 4I65A 1EY4A 4GZYC 4BBRB 4UP7A 4JI8Q 3KLRA 4RG1A 5JPMC 3R8BA 1PTOF 1MIUA 1MSHA 4LF4L 1HQMC 5ELOA 1S5ED 2TSSA 4RKBA 5K36G 1XTCD 3PIP3 2XSCA 2EY1A 3FDTA 1VQ5A 2PW7A 3AFQA 3CCUA 3SDZA 3EBEA 1DOKA 5G3LF 1X3GA 1II3A 4HR7B 3M3YH 1BUVT 1IKMA 2H5XA 2A74C 1LLRD 1LT4D 2K5WA 3D6WA 4YHHQ 2ZTCA 1S5BD 1I3QH 4A3CG 4H0LC 4C3IG 1K3RA 1X32A 2ZJPA 4A3EH 1SRUA 1R9TH 5KYLA 2DNEA 2DNCA 4DV0L 4J6HA 1EIFA 2K01A 3NP8A 3J80E 1PH1A 4BA2I 4JV5Q 1BDOA 4KKSA 1SE2A 1EFID 2F0HA 1SE8A 5CMDA 2WB1G 3A8JE 1ILQA 4MN3A 4FYDA 4IUTA 1Q81C 3NPPA 1FL0A 4CKBA 4LF6Q 5FKAC 3PUXA 3CRKC 4KD4A 4MNOA 4NXMQ 3S17B 1V1OA 1X6OA 2JP1A 1STEA 3VR2A 4JI6Q 5I9PA 3KLSA 3PQIA 5EPKA 1WTPA 4Q5VA 3I4NG 3J7ZC 1CTMA 5JEAH 4KV6A 1N8RC 4I7ZC 3BVGA 2JYOA 1UWVA 3NWSA 1N36L 2O5JC 5H1SE 2YTYA 1ONLA 4ALPA 4ID6A 2ICIA 1TWFB 3BDOA 1HZ9A 3NEMA 4L63B 1J9OA 2JA6B 1K28A 2QGQA 3F2UA 4A4IA 5CV6A 3FEWX 2NVTH 4R9WA 4BY7B 1TWHH 5M3FH 1V43A 2ZTDA 3MEHA 4F88A 1D8LA 2LFNA 3A7LA 1SYEA 3MC0B 3T1HL 1Q3LA 3T1YL 1ICWA 4DFAA 2X69A 3HOWB 3A74A 1WD1A 2F0PA 5TSSA 3ERQA 1FJGQ 2UXCQ 4KN7C 1LTLA 1HFGA 2JA6H 1SYCA 1MJCA 2B29A 2PPBC 1AZQA 1PXUA 3K7AH 1SNQA 1CUKA 2F4VL 1BOSA 1MBYA 1F77A 3ZYYX 4LAAA 3C1FA 3I56A 1B8AA 4C2MB 3G48A 1SDFA 2BA1A 3MXUA 1XJVA 1L2FA 1YJ9A 4RMFA 4DV3Q 4B9XA 5D65A 4QIWE 4LF6L 5EAYA 3ULPA 2F0IA 3N52A 3PUYA 4LF4Q 3RZDH 4GKJQ 1CZGA 2KENA 3MZ5A 1XNQQ 4K0KL 5AFWA 4F8MA 2NVTB 4DV4Q 4AIMA 1XMOQ 4KK7A 4PZ6A 1EOTA 1U4PA 4GN3B 2N3SA 1S3OA 2QF7A 2K03A 2WFWA 3VR3A 1VQMA 1PDQA 4WRDA 4DV1Q 1HUMA 3TEHB 1EQRA 2HQEA 1NJIC 3HZXA 5IYCH 2F0FA 2VB2X 3GP7A 3KF6A 4IN3A 1Z47A 2PMZE 3TP7A 3K6OA 4QUFA 1I4RA 2VQFL 3WWVA 3MXGA 3J81i 1M4VA 4XIGS 2MNAA 1KQSA 1SBBB 1VQCA 1EEID 3MWYW 3MEFA 2Z8LA 1D5ZC 3CPWA 4IPHA 2K05A 2F3VA 4JI8L 4UP9A 2EY2A 1IBLL 3HOVB 1KABA 1RHPA 2WACA 3ND9A 3NHHA 2L9HA 2ICEC 1G2SA 1JE5A 5E4WC 5IODA 1VQ8A 1PZID 1Y1VB 5KNCA 3H15A 1SEBD 1IBKL 3M9BA 3S2HH 1I4PA 2A68C 4EQPA 3EQLC 4C3HB 2A5HA 3I4LA 1CA6A 3W1GA 4YHHL 3HOUG 4JI3Q 1PHJA 2B63G 4GKJL 2EXDA 2Q8RE 2HCIA 4AYBB 5CORA 2VB3X 5T1IA 5C44B 1G91A 4CKEA 1DYQA 3URYA 3EFXD 1NE3A 2IL8A 1EQQA 3DWPA 3A5ZB 1FNUA 5M3FB 3G7LA 1J5EQ 1VQIA 3J81j 3S1QH 2ZXOA 1G6PA 5JPNC 3I70A 3OPOA 5CV9A 5C0XJ 2UUBQ 1JCKB 2MPMA 1TWFH 3FRPB 4JI5L 1HNWL 5C4XB 1SNOA 1EY0A 1PMRA 3Q24A 4HSPA 2ZT9C 1LM0A 5JEAG 3CC2A 2VL6A 3GTMH 4HJ9A 3I91A 3U4ZA 3OHXC 3A8KE 5I6WA 4CDEC 3BDLA 5IT9E 3HOVG 4R4QA 1M90C 2YYZA 1W3SA 3NTIA 2NZOA 1HNXL 1RIPA 2JA5G 3BU2A 4A3LG 2CKZB 2SEBD 1ML0D 5CV8A 3S16B 3NBHA 1N32Q 1N36Q 4K8IA 2RBMA 2PZWA 3G4SA 4EQOA 3VYTA 3H91A 5M9OA 1I50H 5IGGA 2Z4HA 2M9VA 2WINB 3A54A 4DAVA 1VQKA 1E0BA 2AQ2B 5IYDH 1C9OA 4A93G 5I6YA 4V190 1CK1A 2WB1B 2CFMA 1ET9A 1P8LA 1H9SA 3G6JB 5DM73 4DV7L 2WAQB 1D2BA 3QR8A 5IOCA 4JCVE 1UE7A 3RN5A 4JI1L 5LMNQ 3K8AA 1V1QA 4PNYA 4TQUS 3NENA 4HCSA 4A3GB 3KLSX 4A3IG 3C3LA 4K2KA 2MJ8A 3PCOB 4UP8A 4AYBE 3HOWG 2CW0C 4JPBW 2F0NA 1VQFA 2FMMA 4BBSG 1RODA 5DM63 2XTIA 4DV2Q 1QOHA 4R4CA 4EVOA 5I2YA 3NXWA 2ATWA 3W2DA 5C4JH 4KN4C 1N33L 3IRBA 2H4OA 4FF1A 1VQBA 4BWGB 1GUSA 4KY5A 2AQ3B 4ZQ3A 5I2XA 3KUPA 4PZ8A 2R93B 1WCMG 3PO2H 2X6GA 5AJ3L 1ILPA 1M1KC 1BCPF 2F0WA 1W6KA 2XRSD 3K5OA 2Z6BA 1A6XA 1J6QA 2C9OA 1X54A 2O5IC 1JOKA 2DJGC 3GTOB 4KHVA 4G7OC 1EY9A 1B4OA 1TKWB 3KFUA 3FKIH 2A19A 3P7JA 4PV1C 3VA5A 4YY3L 1LT5D 1PH7A 2B63B 3MHBA 3KLWA 2NVYB 3RLOA 4A3MH 2I5LX 3H0GB 2B2WA 5I4DA 3HKZG 3FMCA 5M3FG 3STBD 5IIFA 4R4IA 2B2UC 4FDBA 2R61A 2HHHQ 5LMUL 3H09A 3HGBA 1PV4A 1P16A 4BY1G 1CHPD 1D1IA 4OL7A 3ICEA 1JQYD 1ZEQX 4IFDJ 2F0MA 1JC7A 4FNFA 3HOXG 3S2HB 1DXMA 5C4HA 1IYUA 1Z7TA 2WAQE 2BDNA 5C3WA 5A35A 2DY8A 3CMAA 3JAML 2UUAQ 1WTQA 3RR5A 4B3SQ 3SK8A 1MGSA 2GN5A 1JJ2A 5FLXL 1ENFA 3L2PA 2ES2A 3GDEA 2Z9HA 1IBMQ 4DR4L 1U4LA 4KMUC 1NAPA 1NBWA 1HTLD 2Z6KA 2L11A 2E8GA 1Y1WH 2NN6G 4JI0Q 1EL0A 4K6DA 3S14B 1FNVA 3KJPA 1PTOC 4RGMA 2F4VQ 3L9AX 3S17H 1DJRD 2LXKA 3UDFA 4LF8L 3M4OH 4A3JB 2CVRA 2NVQH 3A56A 1U5KA 1A8VA 3SXHA 2DUDA 1Z6HA 3ONAB 4A3EG 4K5XA 1A3TA 1SXTA 4JI7L 3S1RH 2E74C 4LUZA 4BXXG 1WFQA 2G9HD 3D0FA 3K7AB 1XXGA 2HCCA 4A3IH 5IYCG 4IOCA 3CP0A 1LTSD 1HNZQ 3SK6A 2XIWA 1EIGA 1SE4A 1AFPA 1LTRD 4JI0L 4DXFA 4CJ0B 2XGTA 2PI2A 3FVQA 2R92G 3DWAA 2B3GA 4JI2Q 1E2ZA 2PQEA 4G57A 4HJ7A 2K50A 5T1GA 3CQZH 3K81C 2EY5A 4OONA 5GAGC 2L1BA 2KEEA 3HOVH 1N9WA 5FLXE 4DUYL 2E2HB 1EU4A 1OXVA 1PVOA 1Y1WG 5JOBA 4F87A 1ZXTA 2UXDL 2K75A 2I46A 1X55A 2R92B 3FPPA 3N6RA 3CD6A 4K2LA 3S24A 3AEVA 1K3BC 4XTCS 4GOPC 3VR4A 4AQYQ 5FO7B 2OWOA 3P1HA 3CCSA 4Q0FA 4RCNA 1ASZA 1L0WA 3S1MH 4A3KG 4H44C 4A3MG 5C0XH 1JB3A 2R7ZH 2OF1A 1HZBA 3IAYA 3CCLA 2WP8J 4GNXA 4FP5D 1QNUA 2WAQG 2A6ED 3UDGA 1IYJB 4F7XA 2B2YA 3K58A 1LO5D 2BA0A 1YHAA 2EXZA 3TP6A 4E6IA 4DV5L 5D3IB 1VQ9A 1I3QB 1KLGD 2D5DA 1N34L 4QUCA 3S15H 1JE4A 1G51A 1VDZA 4OIJA 2PNRC 1HA6A 1G291 1J5EL 3HKZE 3TP8A 4IURA 4ZKCB 4GN5A 2CWPA 5KGUA 3GTPB 3TSSA 1AE2A 3HP3A 4OEMB 4UHVA 4FF3A 1RL2A 4L5QA 3M7GA 4DV5Q 1YJWA 3TREA 1AH9A 3VA7A 4DR6Q 1VQLA 1B50A 4P71A 1SSOA 3CRLC 4OO1I 2B2TC 3H94A 5LL6X 3CCQA 1WD0A 4HCEA 4DUZL 3OMCA 3SE0A 4XT1B 3OTOQ 3FPUB 1QILA 5C3XA 1YJNA 1TT2A 3MAQA 1E7ZA 2XN9C 3STBC 5JJLA 2RDGA 4IALA 1I94L 4GLXA 4O1NA 4JYAL 4CJ2C 2F3WA 1K0RA 5M5YB 2Y0SB 3G71A 1HQRD 4IUNA 3TBIB 5JAVA 3W5OA 3T4AC 4QB4A 1T5XD 5C3EB 2KCCA 2EZVA 1IHZA 1WCMH 1YI2A 4XYOA 4LNQA 4KHPQ 4XQQA 5GQOA 2KCTA 1EWCA 3SR1A 2L4NA 3I4NB 4BA1I 1HA5A 5FO9B 4BBSH 3I4MB 3P20A 1I5FA 1D5MC 1LACA 1VQAA 1BCPC 4Z9CB 1OXTA 2GVBA 1HR0L 1LV9A 5C3EG 1YNND 2C35B 1TWGB 5GAHC 2YV5A 3GTQH 2A73B 3DLLA 2N8NA 3GTGH 3KJOA 4CBVA 1TY2A 1A62A 4ODGA 3KBGA 1HTPA 2ZXPA 2JEAI 2F52A 4UDUC 1LTBD 2SNMA 4EX5A 2JSOA 4DAYA 2O4XA 4ZLTF 4I7AA 1VMPA 1STNA 3TN2A 4WJ4A 3R93A 1YNJC 2EYJA 3MTSA 3JAMi 4K8JA 3AYHB 4JW0A 4IJLA 1NY4A 4TVAB 4A3BG 3PUWA 3LX0A 3CC4A 3L0OA 1TS2A 2Q2UA 4A3MB 4JI2L 3TMEA 4BY1H 2R7DA 4U673 2XWJB 2L55A 1PH2A 2ENBA 4J1MA 1K8AC 2JA5H 2Z4IA 2KVMA 2Q8TA 1B9NA 2F0UA 4ME3A 5FLXc 3OWFA 1PLFA 1EWIA 5HGQA 4G7HC 4KHPL 1LTID 1O7IA 2L5TA 1S40A 1VQNA 4DPGA 4NMZA 5BR8L 2K6AA 1UE6A 3I90A 1SNPA 1QNKA 3PO3G 4BY1B 5COYA 2IT1A 4KJOA 5J22A 2B2WC 1IBKQ 4A3BB 1LT3D 2G5DA 4QF4A 1JMCA 2RSNA 2JXMB 4CKCA 2JA7B 1MI2A 1SR3A 2RHQB 3DEOA 3U9OA 3X3MA 1D5XC 1EEFD 2E2JH 1B44D 2RSOA 3EJIA 4DKAC 1KDCA 2D2CC 2Q8IB 2LKVA 1SFOB 1B9MA 3TZDA 2ZJRA 4HJ8A 4RFBA 4X3UA 1K83H 3OSOA 1ASYA 4K14A 4DR7L 3SK5A 3D4WA 5GROA 4DNTB 1Y1VH 5LMNW 1PFNA 1V1PA 3M4QA 1B3AA 4ZUIA 2OTJA 4NB3A 3HKZB 1I4HA 3NELA 2KCNA 1CSPA 1EY8A 4NW2A 1YBYA 4DV6L 4POFA 3M4YA 1CM9A 4B3TL 4DV4L 2RQXA 4BBSB 4CDFC 5JJZA 1PH4A 2VY3A 4RCOA 4RH6A 4APVA 1PRTD 1U0LA 2IY5B 5ELDA 2CH4A 2FMCA 2ZJQA 3I4MG 3RUZA 2UUBL 1EWHA 2OCEA 4X64L 4LF5L 2O2LD 1TR5A 3HOYG 4M8AA 4HIDA 5NUCA 3BYYB 1U9RA 1PH9A 2V1CC 1GJXA 2VQFQ 1SJHD 1GO3E 4N8X1 4N9PA 4ZYSA 3IFTA 2RCFA 2KOLA 5IGCA 1HXYD 1D6EC 5FJ8G 3HOXH 1EQVA 3GTKB 4QQBX 4YCUA 3S9WA 1KIXA 3PV0A 1KAAA 3F8TA 1SYGA 1KL9A 1BBWA 1QB5D 1I6HB 1U4MA 3V96A 1GD7A 2IHEA 3LWUA 1DONA 4B08A 1FNWA 5D14A 3IL8A 1O80A 2NN6H 2HDLA 4KHZA 1OXXK 1M8AA 2OTLA 3GV6A 1KC8C 4GKKQ 2CH4W 2EOTA 2K52A 3PO3B 3PSIA 3OMGA 3A0JA 1YITA 1BCPB 2NZHA 3MFGA 4WFN3 3PO3H 2WIIB 2HD3A 3KDFA 4IQZA 3HOYH 4DR4Q 1JICA 2QW7A 4KKTA 4JBMA 4R8NA 1LUZA 1VMCA 3QO2A 5C0XG 1WTOA 5ISRA 3OTOL 2EJMA 2K5NA 2KJXA 4P72A 1XYIA 4YWLA 2EQSA 3I3CA 4LUOA 4H13C 1CKOA 3TP5A 1CSQA 4B9WA 1IL2A 1SYDA 5G3LD 1IYVA 4JV5L 2YTVA 3Q0AA 3PGZA 1WI5A 1Q8IA 2PYKA 3ULLA 1EQTA 2L12A 3PIOA 1B53A 1PH6A 4IPDA 2F0SA 2QKIC 1F9SA 4HN7A 1TQOA 1B1ZA 4RAUC 3I4NH 1C7YA 1GHKA 5J39A 3D4RA 3I2ZA 4EGVA 4LF7L 3E3XA 1I4XA 2EJGC 2CWAA 5M3MB 3F2CA 4DR1Q 1XNRL 4ILWA 4S3SA 2QDBA 1Y8OB 5C3EH 1V9PA 5IGBA 4O2DA 4A3FG 1DGSA 1QVCA 5IWAQ 1YHBA 4KY7A 2Q2HA 1NUCA 3U9SA 2IX3A 4LF9L 3NSWA 3H3VH 1PRTC 1EYAA 5BR8Q 2B2VC 1NCVA 1GKHA 3I8ZA 1K8GA 2PNHA 2RCNA 4LF5Q 2A8VA 1VQJA 4EQNA 2JA6G 1HCZA 2XRQD 5M3MG 2EVBA 1B7YB 3AU7A 4OO1G 2EY6A 4MIUA 3SVMA 3E6ZX 4GLVB 5DEHA 2VQEQ 3KBXA 4X65Q 4DR5Q 1CHQD 2FFKB 3HOUB 2E2HH 2PMZB 4A3FB 1SFOH 2NVXB 2A1AA 1Y8NB 1K73C 4K0KQ 4HJAA 2FHTA 5LMUQ 3H3VI 5IP7G 1MKHA 3M3YB 3QOLA 4FO2A 4K5WA 5CBEE 4FXDA 3BZKA 5CR3A 4YWKA 1TS3A 3KOJA 2BOSA 2OT2A 3J7AV 2IHFA 3FP9A 1H9RA 3V05A 1CKMA 2F0LA 1QG7A 5C5LA 4H02A 1B2TA 4IO9A 4DR1L 1XNRQ 2Q2TA 2VXWA 4HEDA 2D0PA 5F2DA 4BY7H 2E2IB 1W6JA 1GUTA 3NBIA 1HUNA 4X66Q 3CHBD 4A3JG 2D9UA 4KJNA 1E24A 1IW7D 1PZKD 4JBWA 1A63A 2E76C 3VDYA 2F0EA 2JQOA 3A7AB 2VW9A 4C3JG 4GLAC 4XXEA 1K9MC 3TDQA 3HKSA 4LFBQ 1CKNA 1KDAA 4A93B 1L0XB 2MP1A 1FGBD 3B6YA 1JR0D 2MHVA 5EPLA 1YIJA 4OGQC 1XTDA 3KF8A 4IOAA 1HHVA 1KD1C 3Q8DA 4XYQA 5ELCA 3DEPA 1W2BA 1F9PA 1LTAD 3OOCA 3BZDB 4KD3A 1Q1BA 2F03A 3TRZA 1FVIA 3RNUA 4A3KB 1WTWA 5BN4A 4YIJA 5E3FA 2ZTEA 4DF7A 1YEZA 4MTKA 3DXJC 4A93H 4L5RC 2Y0SG 2BH2A 3QJYA 1F2LA 5C4JB 3KF6B 4Y52H 2K5DA 3EN2A 2K14A 4HMIA 5CV5A 1Q46A 2JA7G 3W3AA 3BJUA 4GOPA 5FK9C 1ZYRD 4PMCA 4FF4A 3A5UA 1NR2A 1GUOA 2IX0A 3T13A 4RGOS 3QWNA 4G7ZC 3KF8B 1A2UA 4EQ5A 3VYSA 3L3OC 1QUQB 4L6TB 4LJZC 2E2IH 3I4MH 2K04A 4P73A 2IW3A 2RA4A 1VF7A 1BO0A 3CCVA 1I6VC 1O7YA 3KK7A 4LK1C 1CKNB 3I73A 3R2TA 1XPUA 3H3VC 1SNMA 2NZ1D 4QY7A 1E1OA 4X64Q 3BVZA 3MXPA 1VQHA 1SE3A 4ZCKA 4N9TA 4A3LH 3T53B 2N49A 2GVAA 2F0JA 1I94Q 4OWWB 3ZJYC 3CU7A 2EYOA 1PZJD 1N33Q 1RJTA 3K5NA 4A75A 4DR2L 1STYA 3HOUH 1SLJA 1JOOA 4J8QA 1NR4A 2K32A 2F0KA 1DZ1A 5J1ZA 4R1JA 1I4QA 1STHA 2F0DA 3FHWA 5EKKA 3D31A 3J7YW 2JA5B 4HSVA 1PTOH 1IL8A 1K8MA 2D62A 1BR9A 1EY7A 3DM1A 5A2QL 2VQEL 1RKNA 1ZYRC 3WOFA 1KHIA 1Q86C 1DOLA 3I4OA 1IW7C 3T16A 5BN3A 3RZOH 4A3KH 1TS5A 2NYZD 2MUYA 5CGKA 1QZHA 4C3JB 1KTKA 2EE1A 1VS0A 3KYHC 5C4XG 3QB3A 1OTCA 2E5LQ 4MHEA 3GQBA 5BN5A 1CA5A 1O78A 4IPCA 3I55A 1JWUD 1OXUA 4DGZA 4YY3Q 1O7LA 3CF5A 1S72A 4DAPA 3C2PA 2JA8G 3HEJA 1RF2D 3T1YQ 3K5LA 1KRTA 5ELEA 1JORA 1GUNA 4X62L 1H9SB 1SYBA 1ET6A 3BS1A 4GNXB 2PCFB 2KHIA 1KXLA 1A2TA 1F9RA 1HNXQ 2R92H 4RKLA 1HR0Q 1A3VA 2JJQA 5ELBA 1TXYA 1X56A 2KUMA 4Y7NH 4QGUA 1XMQL 2B8GA 4GS3A 3LWEA 4DU9A 3NWTA 4OO1H 4HAEA 4DK1A 4FF2A 1TWAB 1VQPA 4IFDG 4H7BA 1SROA 4JI6L 3D3RA 4KTAA 4QL5A 5GAEC 1PH3A 4P75A 1WCMB 3EIVA 1EYGA 3MXNA 2BH8A 2EDGA 2L15A 3LNNA 5M5XB 4CHTB 3S15B 2KEDA 4NXNL 1F2ZA 4LFAL 2Y0SE 4P2CB 2NVXH 4HIKA 2BDOA 4A3IB 2EYPA 3CQZB 1XMQQ 3HOWH 3WOEA 1YNNC 2PZTA 1U4RA 2AWNA 4DNIA 1DM0B 3QIAA 4A3DG 3D4DA 1TWAH 2BE5D 1ENCA 4DXGA 2WKDA 4B3MQ 3J81E 1IXRA 4JC0A 2HIVA 5K36H 4ZK9B 3WDNA 5IYBH 5FO8B 1EY5A 3BZCA 2FXQA 1X3QA 2M2LA 1NSNS 3OIQA 2IPKD 4YCVA 1Q82C 1KDBA 2IX1A 3W1BA 4HIOA 2Q2IA 3CCRA 4JVZA 2F0VA 2NB0A 2R3ZA 3JC66 2H1EA 3H6MA 3U50C 2R7ZB 4LFAQ 1PTOD 1PFSA 2OEOA 5KNDA 5DNFA 4RHRA 4X3SA 3GTPH 2B2UA 1H95A 1E2WA 1SMYC 2UUCL 4XT3B 4DK6C 2UXBL 1WOCA 3UE1A 3C1EA 2XWBB 4WJ3M 1MD2D 2MO1A 4UAIA 3HS0C 4JYAQ 3NE5B 2E75C 1IBML 1KNEA 2B39A 3NTKA 4BY7G 5C44H 4KY6A 4X6AH 4NKLA 1JWSD 4LFBL 2AMCB 3MXNB 4IUQA 1STGA 1H9JA 5M5XH 3C46A 5IY0A 3NTHA 2R7ZG 4NPSA 1BKBA 1HJPA 1Q1EA 2HHHL 1F2MA 2HT1A 3T51B 4HJ5A 2EJFC 4RA8A 1O7ZA 2QILA 1HH2P 3GTKH 2AHOB 3HOYB 5CBAE 3IFDA 4RGTA 4OWTB 1C4QA 1WTVA 3PIPA 3Q22A 2CCZA 2K33A 5K5PA 2IWHA 1CI3M 4LUVA 4L5TA 1I6HH 4FXKC 5I9OA 1XPOA 2B2VA 2NBFA 2NN6I 4ZKBB 4OELB 3PO2B 1EU3A 2KA7A 1Y1WB 1S5DD 3S2DB 1LABA 4A3CH 4DAMA 1GHJA 1SN8A 1HR0W 5L37A 4WJWA 4C3IH 1UEAB 1KLUD 3GO5A 2NTTA 3F1ZA 3MFYA 1TY0A 5EBCA 5M3MH 1QUQA 3BG3A 4ME5A 4IFDH 5C0XI 4V0BA 4MZ9A 3T1HQ 3U4VA 2Z6KC 2UUCQ 2F4IA 2LY7A 1L1OB 1N32L 1VQ4A 1LTTD 5E4XA 3RZOB 4A3EB 1R9TB 4ZUJA 3M85A 3J81c 2SNSA 4YWMA 1YHQA 1EYCA 1E2VA 3JAMc 3SHLA 1BBXC 4PMWA 3J7AF 1T9HA 1JOQA 5IT9c 3L7ZC 3DMUA 5KNBA 1E1TA 5IGDA 2ID0A 2DJFC 2JN4A 1HNWQ 4L5SA 2ALYB 4UY8C 1EOVA 2D0OA 1C0AA 4QIWB 4OXPA 5J3BA 2OQ0A 1CZWA 2AUJD 2B8FA 1SNCA 5JJIA 3LGJA 4GKKL 1YVCA 3PUVA 4C1NK 3CCEA 1NTGA 2A69C 1AEXA 3S1NB 3HOZH 3BYTB 1MSGA 3HRZC 2PZUA 1CQFA 1QZGA 2J4XA 1UUPA 1X3FA 1VQDA 2YTXA 3K0XA 2JA9A 2K28A 1BXTA 4P74A 1Y1VG 1PH8A 5JJKA 2N88A 3GTGB 4PQXA 1TU2B 3MA2B 1AE3A 5FLMG 1CT1D 3K57A 3NQIA 1AW7A 4AYBG 5C44G 3HOXB 3G6EA 2I5MX 2Z1CA 1JT8A 3CKIB 1XPRA 1KAWA 1BCPD 1X3EA 5FJ8H 2E2JB 4GN4B 1C8CA 2KBNA 2F0OA 1B3QA 1LYLA 4JG2A 3J80c 1NMFA 4RGNA 2QEXA 1VQ7A 1RCVD 2DY7A 1STBA 4IUPA 4PG3A 4A3BH 1K83B 3A8IE 3P75A 2SDFA 1EFWA 2M00A 1T5EA 1UEBA 1A15A 1GUGA 1L0YB 4N8FA 2E2DC 2P5ZX 2VZAA 3J7A5 5GADC 1GUWA 2KECA 3CCJA 1HZCA 5E1FA 3TS2A 4QMGA 4C56C 1GXDC 2HIXA 5IE8A 2VNUD 1CFMA 2UUAL 2EYLA 3F2BA 2K7VA 2V4DA 2RDHA 4JI4L 3AQQA 3SGIA 4IFDI 1E3PA 1S5FD 3F2DA 1RDPD 1SMXA 2F1MA 2RF4A 4JOIC 1WTHA 1SAPA 1PYSB 1JJCB 5C5MA 3DHQA 5A2QE 4U68A 2I5HA 4NP5A 4NDXA 1MJEA 5LHY1 4B3RL 2OXPA 2UU9Q 2RKSA 1VQEA 5CV4A 2I0QA 3A55A 1X9NA 3GTOH 1TWCH 2IJ0A 1SJED 1DCZA 1AZPA 1HRJA 3GTMB 3S16H 3EVQA 3VYRA 4DV3L 4CGYB 1QWYA 4CJ1B 2UU9L 3PF5A 1FR3A 2LS01 3EROA 1YZ6A 4RWSC 4JI4Q 1GVPA 2MGSA 5HGTA 4POGA 4YCWA 1S4ZA 4IUUA 1PYWD 1PYBA 1XMOL 1EIYB 3K80C 1PRTB 2AQ1B 3HFZB 5M5WB 3R3OA 3E5SA 4KI0A 4WORA 1QVFA 4DR5L 1WTRA 4DK3C 4A3DB 3S1MB 1QVGA 3NUCA 1CQVA 5CC4A 1BVSA 1ENAA 3NBHB 3DWQA 1EZ8A 5ELFA 1UE1A 2EPBA 3RZDB 1KRSA 2VUMB 4KKUA 1TIID 2A69D 3AFPA 5DLQE 4ZRZA 4DNRB 1IKLA 1PA6A 5C4XH 1XNQL 2AKWB 4DR3L 2EYFA 3TZUA 1EIHA 2L0CA 3OYYA 2EIFA 2JEBI 2PQAA 4DUYQ 4J15A 1TVXA 5IT9L 3NK9A 3PO2G 3O13A 1R4PB 2QCPX 3AB9A 1L1OA 2A6HC 1Q8KA 2EYMA 4DV1L 3GV3A 4R8IA 3J80L 1A0IA 3IKJA 1HNZL 2SOBA 3DUZA 5EPJA 1X3PA 4C3HH 5ELNA 2JE6I 3SK4A 4DR6L 1V1PB 3S1NH 2QA4A 4PZ7A 2XVSA 1TWHB 1PFBA 4OWXB 1Y69U 2I07B 4XDXA 3HOZG 4LFCQ 4A76A 1TS4A 4RHSA 4JOIA 3UDIA 4CDCC 3PMFA 5IP9G 4HIMA 2ZM6Q 2UXDQ 4C3IB 1SNDA 3PIO3 5IP7H 4A3GG 3Q23A 2KCMA 2WB1E 4OIKA 4CDDC 4DA2A 3RLFA 4QCLA 1XX8A 2DGYA 4JI5Q 2A6EC 1VQGA 5IGFA 1Q7YC 2FJ2A 1G6ZA 2A68D 2PQAB 1SMYD 4QJFA 3VR5A 2JK8A 1KNAA 4C2MH 1RD9D 3UE0A 1ICFB 1FJGL 2UXCL 1PFMA 2WKCA 1AP0A 1I4GA 1Q12A 3D8GA 1R4QB 5HY6A 1WJJA 4DV2L 1A3UA 1B70B 1UAPA 2QDLA 5C4ZA 4DAYB 3E9HA 3PUZA 1XWEA 2AWOA 2F0TA 3OIPA 2RDFA 5FOBB 2NVQB 3M4OB 1H9KA 5IYDG 4A3FH 5EKLA 4DN4M 1FYCA 2FINB 3K59A 2AUKA 3NQTA 4M1UB 3S14H 4BXXH 1AN8A 3RLNA 3H0GH 2HQLA 2E5LL 2NUCA 4DV7Q 5IP9H 1LTGD 2CHBD 1WVLA 1ESFA 2KQ3A 4A3JH 4GOPB 4LW1A 4O42A 4NXML 4LF9Q 1JWMD 1JJGA 1Q90A 4BS9A 3ER0A 4DK0A 1G2TA 2PW5A 3S1RB 4JBJA 1VF5C 4X65L 4OX9Q 3EA6A 2VUMH 4C3JH 3ERSX 3V2TA 5FLMH 2JA8H 3CXCA 4B3RQ 4ZAIA 4C1NI 5AJ3Q 1STAA 2MFIA 1OXSC 4IZ8A 1NNXA 5EGTA 5JEAJ 5EJWA 4DR2Q 1ZKOA 1OO9B 4O0AA 2J0TD 3GTLH 4X66L 3UDXA 1Y8PB 2BE5C 1LT6D 2F3IA 1SYFA 1YNXA 3Q6SA 1BNZA 4HMJA 1PRTF 3R2IA 4OX9L 2G9DA 1F2YA 5LL6S 3ULJA 2BCOA 4TKOB 1N34Q 1VCIA 5HURA 4XQNA 1GOZA 1DD2A 3OW7A 3GTJB 1RTOA 3FKIG 5IGEA 1GM5A 2F0GA 2XNAC 2HUGA 5E7NA 3I72A 3TS0A 2OQKA 4IJHA 4LF7Q 5D3DA 3H0GG 1FGUA 1WYDA 3D6CA 3BVMA 4AH6A 1UE5A 2GA4B 5KRUA 3RMHA 2Z0SA 2R93G 4GNXC 2ZM6L 4ABNA 1JB7A 1C48A 2N78A 3BDCA 1BQQT 4G4KA 3TQYA 5IWAL 3FKIB 4LMQD 1G8ZD 1I50B 4Y7NB 2NTSA 2ASBA 1PTOB 1Z9FA 2R7FA 4K5VA 4A3DH 2KHSA 2NWGA 2VUMG 3CC7A 4BBRH 4ULLA 2B2TA 4UPAA 4R4TA 3M7NA 3GD7A 4FVMA 2HDMA
chains in the Genus database with same CATH topology
2ATWA 5C4JH 1N33L 4OWTB 3IRBA 1X65A 2K4KA 3PIPA 1GD7A 1VQBA 2IHEA 2CCZA 1Y14B 3M4PA 2MQHA 4B3ML 4LUVA 4L5TA 4PZ8A 1I6HH 1WCMG 1XPOA 3PO2H 5AJ3L 3I7FA 3CAMA 1M1KC 2JA7H 2NN6I 4KHZA 1OXXK 4JI1Q 5M5WH 5LMNL 1IZ6A 1J6QA 2CQOA 4JBKA 2OTLA 1KC8C 3CW2C 4GKKQ 1X54A 2K52A 3PSIA 2MO0A 4A3CH 3A0JA 4DAMA 4NXNQ 1SN8A 1YITA 3KFUA 3CPFA 3FKIH 2A19A 1PH7A 1HR0W 4YY3L 2UXBQ 2NZHA 4C3IH 3PF4A 3PO3H 3KLWA 2LXJA 3GO5A 4B3SL 3RLOA 3KDFA 3HOYH 4DR4Q 3F1ZA 1NMGA 4A3MH 2I5LX 4LWCA 4JBMA 1LUZA 5M3MH 5C0XG 1QUQA 4DV0Q 3HKZG 5C0XI 5M3FG 3STBD 3OTOL 1EUJA 2K5NA 4P72A 4R4IA 2EQSA 4MZ9A 4LUOA 4YWLA 1CKOA 2K5VA 4LFCL 3U4VA 3T1HQ 1CSQA 4FDBA 3U58A 2Z6KC 5LMUL 2HHHQ 2UUCQ 1IL2A 2R93H 4JI3L 1L1OB 4JI7Q 1N32L 1VQ4A 1PV4A 3K7UC 4JV5L 1P16A 4BY1G 2YTVA 3ICEA 1HZAA 3PGZA 4IFDJ 3CCMA 3M85A 1WI5A 4X62Q 1E22A 3J81c 3ULLA 4YWMA 3HOXG 1YHQA 4A3GH 3PIOA 4DUZQ 3JAMc 1BBUA 2WAQE 1PH6A 4IPDA 4PMWA 4B3TQ 4BBRG 1T9HA 3CMAA 2UUAQ 5IT9c 2VS1A 3I4NH 2KHJA 3L7ZC 1C7YA 3J80i 3RR5A 4B3SQ 3I2ZA 3E9IA 4LF7L 2CWAA 1IBLQ 2GN5A 1TWGH 3E0EA 1E1TA 2R6GA 3F2CA 1JJ2A 2ID0A 4DR1Q 3RN2A 4LF8Q 1XNRL 3GTJH 3L2PA 2ES2A 2NVYH 3GDEA 1HNWQ 1VQOA 4L5SA 2B63H 5C3EH 1IBMQ 4DR4L 1V9PA 2ALYB 4O2DA 1EOVA 4A3FG 1DGSA 2D0OA 4UY8C 1NBWA 1C0AA 4OXPA 5J3BA 1D7QA 1QVCA 2Z6KA 2OQ0A 2E8GA 5IWAQ 1Y1WH 5JJIA 1YHBA 2NN6G 4JI0Q 3LGJA 2Q2HA 4GKKL 1YVCA 3PUVA 4LF9L 3CCEA 4DR7Q 1NTGA 3OW2A 3H3VH 2LSSA 3KJPA 3HOZH 5BR8Q 3CMEA 2F4VQ 3S17H 2LXKA 1GKHA 3UDFA 1K8GA 4LF8L 2PNHA 1QZGA 3M4OH 2RCNA 2NVQH 1U5KA 1A8VA 1X3FA 4DR3Q 4LF5Q 2A8VA 2DUDA 1VQDA 2YTXA 1VQJA 4KLKA 2PI2E 4A3EG 2JA6G 3K0XA 4IPGA 2JA9A 4P74A 5M3MG 1B7YB 1Y1VG 4AQYL 1PH8A 4OO1G 5JJKA 4JI7L 3KDFB 4GLVB 3S1RH 2VQEQ 4X65Q 1AE3A 2K5HA 1WFQA 4LUZA 5FLMG 3D0FA 4DR5Q 4BXXG 4MTNA 3DM3A 4AYBG 5C44G 5IYBG 2E2HH 4A3IH 1SFOH 2RHSB 3G6EA 4R4OA 5IYCG 2A1AA 4IOCA 3CP0A 2YU9H 2I5MX 1JT8A 1K73C 1HNZQ 1VQ6A 1L1OC 4HJAA 1KAWA 1XPRA 5LMUQ 1X3EA 1PH5A 5M5YH 3H3VI 5FJ8H 4DV6Q 5IP7G 3S2DH 4GN4B 2KBNA 4JI0L 4JG2A 1LYLA 3J80c 1NMFA 1MKHA 2QEXA 2XGTA 2PI2A 1VQ7A 4UP7A 2R92G 4JI2Q 2B3GA 4JI8Q 4RG1A 4PG3A 3BZKA 1MIUA 4HJ7A 4A3BH 4YWKA 2K50A 1EFWA 4LF4L 1UEBA 3CQZH 5ELOA 3KOJA 3K81C 2IHFA 5K36G 3FP9A 4OONA 5GAGC 3HOVH 2VZAA 3J7A5 5GADC 1CKMA 1N9WA 4DUYL 4H02A 1VQ5A 1OXVA 1PVOA 1Y1WG 3CCJA 1HZCA 2UXDL 4IO9A 4DR1L 2K75A 1XNRQ 3AFQA 3CCUA 1X55A 3EBEA 3TS2A 2Q2TA 3CD6A 1X3GA 3M3YH 2HIXA 2H5XA 3S24A 5IE8A 3AEVA 2VNUD 2D0PA 4BY7H 4YHHQ 2ZTCA 2UUAL 1I3QH 4XTCS 4A3CG 4GOPC 4AQYQ 4X66Q 2OWOA 4A3JG 3F2BA 3CCSA 1K3RA 2ZJPA 4A3EH 1SRUA 1R9TH 1ASZA 1E24A 1L0WA 4JI4L 3S1MH 4A3KG 3AQQA 4JBWA 4A3MG 4DV0L 3SGIA 1A63A 1EIFA 2R7ZH 4IFDI 1PH1A 1E3PA 4BA2I 4JV5Q 1HZBA 3VDYA 3F2DA 1SMXA 2RF4A 2JQOA 4JOIC 3CCLA 1PYSB 2VW9A 2WP8J 4GNXA 4GLAC 1JJCB 1SE8A 1K9MC 2WB1G 2WAQG 3HKSA 4LFBQ 1CKNA 3UDGA 1Q81C 1IYJB 1FL0A 3B6YA 2I5HA 4LF6Q 3PUXA 1MJEA 4MNOA 4NXMQ 1YIJA 4B3RL 2BA0A 1YHAA 1X6OA 4DV5L 2UU9Q 1XTDA 1VQ9A 1VQEA 4IOAA 2I0QA 4JI6Q 1X9NA 3GTOH 1N34L 3S15H 1TWCH 1KD1C 1G51A 3Q8DA 1G291 1W2BA 3I4NG 3J7ZC 1J5EL 3S16H 3HKZE 1Q1BA 4DV3L 1N8RC 2UU9L 1UWVA 3PF5A 1N36L 3TRZA 1FVIA 5H1SE 3RNUA 2YTYA 4ALPA 4GN5A 1YZ6A 2CWPA 2ZTEA 1HZ9A 1YEZA 3NEMA 2QGQA 1AE2A 4JI4Q 1GVPA 4POGA 4A93H 4YCWA 4L5RC 4A4IA 1RL2A 2Y0SG 4L5QA 2BH2A 2NVTH 1PYBA 4DV5Q 1YJWA 1XMOL 3TREA 3KF6B 1EIYB 1TWHH 3K80C 5M3FH 4Y52H 1V43A 2ZTDA 1D8LA 3HFZB 3EN2A 2K14A 1AH9A 1Q46A 2JA7G 4DR6Q 1VQLA 4P71A 3T1HL 4KI0A 3BJUA 4GOPA 1QVFA 4DR5L 3T1YL 4DK3C 4OO1I 3A74A 3A5UA 1QVGA 2IX0A 3CCQA 1FJGQ 2UXCQ 3KF8B 4EQ5A 1BVSA 1LTLA 3NBHB 4DUZL 1QUQB 2JA6H 2E2IH 1MJCA 1UE1A 2B29A 1KRSA 3OTOQ 3I4MH 1YJNA 4P73A 3K7AH 1E7ZA 3AFPA 5DLQE 1CUKA 2F4VL 3CCVA 3STBC 5JJLA 1PA6A 1CKNB 5C4XH 1I94L 1XNQL 4JYAL 4GLXA 1XPUA 2AKWB 3I56A 4DR3L 1B8AA 1K0RA 4QY7A 1E1OA 3G48A 3G71A 3OYYA 2EIFA 4X64Q 2BA1A 3W5OA 2JEBI 1XJVA 1VQHA 2PQAA 1L2FA 4DUYQ 1YJ9A 4J15A 4RMFA 4DV3Q 1WCMH 1YI2A 4LNQA 3PO2G 4KHPQ 4A3LH 4QIWE 5GQOA 4LF6L 2KCTA 5EAYA 1L1OA 3ULPA 3GTKH 1Q8KA 4BA1I 3PUYA 4DV1L 4LF4Q 2N49A 2GVAA 3RZDH 4BBSH 4GKJQ 2KENA 1A0IA 1I5FA 1I94Q 1HNZL 3ZJYC 4OWWB 1XNQQ 4K0KL 4DV4Q 4AIMA 1VQAA 1N33Q 1XMOQ 1OXTA 4PZ6A 2GVBA 1HR0L 4C3HH 4GN3B 5ELNA 2JE6I 2N3SA 5C3EG 2C35B 4A75A 4DR2L 3HOUH 1SLJA 4DR6L 3S1NH 1S3OA 5GAHC 2QA4A 4PZ7A 2YV5A 4R1JA 3GTQH 4K0KQ 3DLLA 3FHWA 2WFWA 3D31A 2N8NA 1VQMA 3GTGH 3KJOA 1A62A 4OWXB 4DV1Q 2JEAI 2F52A 3TEHB 1EQRA 4LFCQ 3HOZG 2D62A 4A76A 1NJIC 2VQEL 5IYCH 4JOIA 3UDIA 4EX5A 5IP9G 3KF6A 4HIMA 2ZM6Q 1Z47A 2PMZE 1KHIA 2UXDQ 1Q86C 3I4OA 5IP7H 2VQFL 2KCMA 4A3GG 3RZOH 3WWVA 4A3KH 2WB1E 4WJ4A 3J81i 1QZHA 4XIGS 2MNAA 1KQSA 3JAMi 1VQCA 3KYHC 1VS0A 3AYHB 4IJLA 3RLFA 1NY4A 4TVAB 5C4XG 3MEFA 4A3BG 1OTCA 3CPWA 3PUWA 2DGYA 2E5LQ 4IPHA 4JI5Q 3CC4A 1VQGA 3L0OA 2Q2UA 4IPCA 4JI8L 3I55A 4UP9A 3CF5A 1OXUA 4YY3Q 4JI2L 1S72A 1Q7YC 2JA8G 2PQAB 1IBLL 3T1YQ 4BY1H 1KRTA 2R7DA 4QJFA 4X62L 2JK8A 4C2MH 1PH2A 3UE0A 1FJGL 1K8AC 2UXCL 4GNXB 1JE5A 2KHIA 2JA5H 1KXLA 1VQ8A 1Q12A 5HY6A 1HNXQ 2R92H 1WJJA 3H15A 4DV2L 4ME3A 5FLXc 1IBKL 1B70B 3M9BA 1HR0Q 4DAYB 3E9HA 1EWIA 3PUZA 5HGQA 3S2HH 4KHPL 1O7IA 1VQNA 1S40A 4DPGA 2JJQA 2AWOA 1TXYA 1X56A 5BR8L 4Y7NH 1UE6A 4QGUA 3W1GA 4YHHL 1XMQL 3HOUG 4JI3Q 1PHJA 3PO3G 4GS3A 2B63G 2EXDA 4GKJL 5IYDG 2IT1A 4A3FH 1IBKQ 1VQPA 4IFDG 1SROA 1JMCA 4JI6L 4QL5A 1NE3A 5GAEC 1SR3A 2RHQB 1EQQA 1PH3A 4P75A 3S14H 3RLNA 3EIVA 3H0GH 4BXXH 1EYGA 3A5ZB 2BH8A 2HQLA 2L15A 2E5LL 1J5EQ 1VQIA 3J81j 5IP9H 4DV7Q 2E2JH 3S1QH 1G6PA 4NXNL 4LFAL 4DKAC 2Y0SE 5C0XJ 4A3JH 4GOPB 2NVXH 2UUBQ 4HIKA 1XMQQ 4LW1A 4HJ8A 2ZJRA 3HOWH 1TWFH 1K83H 4JI5L 4NXML 1ASYA 2AWNA 1HNWL 4LF9Q 4DR7L 4DNIA 1JJGA 5GROA 1Y1VH 5LMNW 3ER0A 4A3DG 5JEAG 1LM0A 4JBJA 3CC2A 1TWAH 2VL6A 3GTMH 3M4QA 4HJ9A 4X65L 4OX9Q 2OTJA 2VUMH 4NB3A 3U4ZA 3ERSX 4C3JH 4B3MQ 1IXRA 5FLMH 3NELA 4JC0A 2HIVA 3CXCA 2JA8H 4B3RQ 5IYBH 1CSPA 5AJ3Q 3BZCA 3HOVG 2FXQA 2MFIA 4R4QA 1M90C 1OXSC 2YYZA 1W3SA 1YBYA 5JEAJ 4DR2Q 4DV6L 2NZOA 4YCVA 1HNXL 1Q82C 1RIPA 2JA5G 4O0AA 3BU2A 3W1BA 4POFA 2Q2IA 2CKZB 4HIOA 4X66L 2IX1A 3UDXA 3CCRA 3GTLH 4B3TL 4A3LG 4DV4L 1N32Q 1N36Q 3JC66 2F3IA 1PH4A 1YNXA 2VY3A 3U50C 3G4SA 4OX9L 3ULJA 4LFAQ 1I50H 4APVA 1U0LA 2IY5B 1PFSA 1N34Q 1VCIA 3GTPH 1VQKA 1H95A 5IYDH 1C9OA 3FKIG 2ZJQA 1GM5A 4A93G 3I4MG 2UUBL 2UUCL 2OCEA 4X64L 4LF5L 2CFMA 4DK6C 3HOYG 2UXBL 1WOCA 1P8LA 3UE1A 4WJ3M 5E7NA 2MO1A 4HIDA 2OQKA 4IJHA 4DV7L 3TS0A 4LF7Q 3H0GG 1FGUA 1WYDA 4JCVE 4AH6A 1UE7A 2V1CC 1PH9A 1UE5A 4JYAQ 3RN5A 2VQFQ 2Z0SA 4JI1L 5LMNQ 3K8AA 2R93G 4GNXC 1GO3E 1V1QA 1IBML 4TQUS 2ZM6L 5C44H 3NENA 1JB7A 4BY7G 4X6AH 4A3IG 2N78A 4LFBL 2AMCB 3MXNB 3PCOB 3TQYA 5IWAL 4UP8A 4AYBE 3HOWG 5FJ8G 3HOXH 2ASBA 5M5XH 1Z9FA 1VQFA 4QQBX 2R7FA 4YCUA 4A3DH 5IY0A 2R7ZG 4NPSA 1BKBA 1HJPA 1Q1EA 1KIXA 2HHHL 2HT1A 2VUMG 3PV0A 4BBRH 3CC7A 4BBSG 4UPAA 2XTIA 3F8TA 4DV2Q 1KL9A 1BBWA 4R4CA 4R4TA 3GD7A 4HJ5A 3M7NA 1HH2P 2AHOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ATW A;  5C4J H;  1N33 L;  4OWT B;  3IRB A;  1X65 A;  2K4K A;  3PIP A;  1GD7 A;  1VQB A;  2IHE A;  2CCZ A;  1Y14 B;  3M4P A;  2MQH A;  4B3M L;  4LUV A;  4L5T A;  4PZ8 A;  1I6H H;  1WCM G;  1XPO A;  3PO2 H;  5AJ3 L;  3I7F A;  3CAM A;  1M1K C;  2JA7 H;  2NN6 I;  4KHZ A;  1OXX K;  4JI1 Q;  5M5W H;  5LMN L;  1IZ6 A;  1J6Q A;  2CQO A;  4JBK A;  2OTL A;  1KC8 C;  3CW2 C;  4GKK Q;  1X54 A;  2K52 A;  3PSI A;  2MO0 A;  4A3C H;  3A0J A;  4DAM A;  4NXN Q;  1SN8 A;  1YIT A;  3KFU A;  3CPF A;  3FKI H;  2A19 A;  1PH7 A;  1HR0 W;  4YY3 L;  2UXB Q;  2NZH A;  4C3I H;  3PF4 A;  3PO3 H;  3KLW A;  2LXJ A;  3GO5 A;  4B3S L;  3RLO A;  3KDF A;  3HOY H;  4DR4 Q;  3F1Z A;  1NMG A;  4A3M H;  2I5L X;  4LWC A;  4JBM A;  1LUZ A;  5M3M H;  5C0X G;  1QUQ A;  4DV0 Q;  3HKZ G;  5C0X I;  5M3F G;  3STB D;  3OTO L;  1EUJ A;  2K5N A;  4P72 A;  4R4I A;  2EQS A;  4MZ9 A;  4LUO A;  4YWL A;  1CKO A;  2K5V A;  4LFC L;  3U4V A;  3T1H Q;  1CSQ A;  4FDB A;  3U58 A;  2Z6K C;  5LMU L;  2HHH Q;  2UUC Q;  1IL2 A;  2R93 H;  4JI3 L;  1L1O B;  4JI7 Q;  1N32 L;  1VQ4 A;  1PV4 A;  3K7U C;  4JV5 L;  1P16 A;  4BY1 G;  2YTV A;  3ICE A;  1HZA A;  3PGZ A;  4IFD J;  3CCM A;  3M85 A;  1WI5 A;  4X62 Q;  1E22 A;  3J81 c;  3ULL A;  4YWM A;  3HOX G;  1YHQ A;  4A3G H;  3PIO A;  4DUZ Q;  3JAM c;  1BBU A;  2WAQ E;  1PH6 A;  4IPD A;  4PMW A;  4B3T Q;  4BBR G;  1T9H A;  3CMA A;  2UUA Q;  5IT9 c;  2VS1 A;  3I4N H;  2KHJ A;  3L7Z C;  1C7Y A;  3J80 i;  3RR5 A;  4B3S Q;  3I2Z A;  3E9I A;  4LF7 L;  2CWA A;  1IBL Q;  2GN5 A;  1TWG H;  3E0E A;  1E1T A;  2R6G A;  3F2C A;  1JJ2 A;  2ID0 A;  4DR1 Q;  3RN2 A;  4LF8 Q;  1XNR L;  3GTJ H;  3L2P A;  2ES2 A;  2NVY H;  3GDE A;  1HNW Q;  1VQO A;  4L5S A;  2B63 H;  5C3E H;  1IBM Q;  4DR4 L;  1V9P A;  2ALY B;  4O2D A;  1EOV A;  4A3F G;  1DGS A;  2D0O A;  4UY8 C;  1NBW A;  1C0A A;  4OXP A;  5J3B A;  1D7Q A;  1QVC A;  2Z6K A;  2OQ0 A;  2E8G A;  5IWA Q;  1Y1W H;  5JJI A;  1YHB A;  2NN6 G;  4JI0 Q;  3LGJ A;  2Q2H A;  4GKK L;  1YVC A;  3PUV A;  4LF9 L;  3CCE A;  4DR7 Q;  1NTG A;  3OW2 A;  3H3V H;  2LSS A;  3KJP A;  3HOZ H;  5BR8 Q;  3CME A;  2F4V Q;  3S17 H;  2LXK A;  1GKH A;  3UDF A;  1K8G A;  4LF8 L;  2PNH A;  1QZG A;  3M4O H;  2RCN A;  2NVQ H;  1U5K A;  1A8V A;  1X3F A;  4DR3 Q;  4LF5 Q;  2A8V A;  2DUD A;  1VQD A;  2YTX A;  1VQJ A;  4KLK A;  2PI2 E;  4A3E G;  2JA6 G;  3K0X A;  4IPG A;  2JA9 A;  4P74 A;  5M3M G;  1B7Y B;  1Y1V G;  4AQY L;  1PH8 A;  4OO1 G;  5JJK A;  4JI7 L;  3KDF B;  4GLV B;  3S1R H;  2VQE Q;  4X65 Q;  1AE3 A;  2K5H A;  1WFQ A;  4LUZ A;  5FLM G;  3D0F A;  4DR5 Q;  4BXX G;  4MTN A;  3DM3 A;  4AYB G;  5C44 G;  5IYB G;  2E2H H;  4A3I H;  1SFO H;  2RHS B;  3G6E A;  4R4O A;  5IYC G;  2A1A A;  4IOC A;  3CP0 A;  2YU9 H;  2I5M X;  1JT8 A;  1K73 C;  1HNZ Q;  1VQ6 A;  1L1O C;  4HJA A;  1KAW A;  1XPR A;  5LMU Q;  1X3E A;  1PH5 A;  5M5Y H;  3H3V I;  5FJ8 H;  4DV6 Q;  5IP7 G;  3S2D H;  4GN4 B;  2KBN A;  4JI0 L;  4JG2 A;  1LYL A;  3J80 c;  1NMF A;  1MKH A;  2QEX A;  2XGT A;  2PI2 A;  1VQ7 A;  4UP7 A;  2R92 G;  4JI2 Q;  2B3G A;  4JI8 Q;  4RG1 A;  4PG3 A;  3BZK A;  1MIU A;  4HJ7 A;  4A3B H;  4YWK A;  2K50 A;  1EFW A;  4LF4 L;  1UEB A;  3CQZ H;  5ELO A;  3KOJ A;  3K81 C;  2IHF A;  5K36 G;  3FP9 A;  4OON A;  5GAG C;  3HOV H;  2VZA A;  3J7A 5;  5GAD C;  1CKM A;  1N9W A;  4DUY L;  4H02 A;  1VQ5 A;  1OXV A;  1PVO A;  1Y1W G;  3CCJ A;  1HZC A;  2UXD L;  4IO9 A;  4DR1 L;  2K75 A;  1XNR Q;  3AFQ A;  3CCU A;  1X55 A;  3EBE A;  3TS2 A;  2Q2T A;  3CD6 A;  1X3G A;  3M3Y H;  2HIX A;  2H5X A;  3S24 A;  5IE8 A;  3AEV A;  2VNU D;  2D0P A;  4BY7 H;  4YHH Q;  2ZTC A;  2UUA L;  1I3Q H;  4XTC S;  4A3C G;  4GOP C;  4AQY Q;  4X66 Q;  2OWO A;  4A3J G;  3F2B A;  3CCS A;  1K3R A;  2ZJP A;  4A3E H;  1SRU A;  1R9T H;  1ASZ A;  1E24 A;  1L0W A;  4JI4 L;  3S1M H;  4A3K G;  3AQQ A;  4JBW A;  4A3M G;  4DV0 L;  3SGI A;  1A63 A;  1EIF A;  2R7Z H;  4IFD I;  1PH1 A;  1E3P A;  4BA2 I;  4JV5 Q;  1HZB A;  3VDY A;  3F2D A;  1SMX A;  2RF4 A;  2JQO A;  4JOI C;  3CCL A;  1PYS B;  2VW9 A;  2WP8 J;  4GNX A;  4GLA C;  1JJC B;  1SE8 A;  1K9M C;  2WB1 G;  2WAQ G;  3HKS A;  4LFB Q;  1CKN A;  3UDG A;  1Q81 C;  1IYJ B;  1FL0 A;  3B6Y A;  2I5H A;  4LF6 Q;  3PUX A;  1MJE A;  4MNO A;  4NXM Q;  1YIJ A;  4B3R L;  2BA0 A;  1YHA A;  1X6O A;  4DV5 L;  2UU9 Q;  1XTD A;  1VQ9 A;  1VQE A;  4IOA A;  2I0Q A;  4JI6 Q;  1X9N A;  3GTO H;  1N34 L;  3S15 H;  1TWC H;  1KD1 C;  1G51 A;  3Q8D A;  1G29 1;  1W2B A;  3I4N G;  3J7Z C;  1J5E L;  3S16 H;  3HKZ E;  1Q1B A;  4DV3 L;  1N8R C;  2UU9 L;  1UWV A;  3PF5 A;  1N36 L;  3TRZ A;  1FVI A;  5H1S E;  3RNU A;  2YTY A;  4ALP A;  4GN5 A;  1YZ6 A;  2CWP A;  2ZTE A;  1HZ9 A;  1YEZ A;  3NEM A;  2QGQ A;  1AE2 A;  4JI4 Q;  1GVP A;  4POG A;  4A93 H;  4YCW A;  4L5R C;  4A4I A;  1RL2 A;  2Y0S G;  4L5Q A;  2BH2 A;  2NVT H;  1PYB A;  4DV5 Q;  1YJW A;  1XMO L;  3TRE A;  3KF6 B;  1EIY B;  1TWH H;  3K80 C;  5M3F H;  4Y52 H;  1V43 A;  2ZTD A;  1D8L A;  3HFZ B;  3EN2 A;  2K14 A;  1AH9 A;  1Q46 A;  2JA7 G;  4DR6 Q;  1VQL A;  4P71 A;  3T1H L;  4KI0 A;  3BJU A;  4GOP A;  1QVF A;  4DR5 L;  3T1Y L;  4DK3 C;  4OO1 I;  3A74 A;  3A5U A;  1QVG A;  2IX0 A;  3CCQ A;  1FJG Q;  2UXC Q;  3KF8 B;  4EQ5 A;  1BVS A;  1LTL A;  3NBH B;  4DUZ L;  1QUQ B;  2JA6 H;  2E2I H;  1MJC A;  1UE1 A;  2B29 A;  1KRS A;  3OTO Q;  3I4M H;  1YJN A;  4P73 A;  3K7A H;  1E7Z A;  3AFP A;  5DLQ E;  1CUK A;  2F4V L;  3CCV A;  3STB C;  5JJL A;  1PA6 A;  1CKN B;  5C4X H;  1I94 L;  1XNQ L;  4JYA L;  4GLX A;  1XPU A;  2AKW B;  3I56 A;  4DR3 L;  1B8A A;  1K0R A;  4QY7 A;  1E1O A;  3G48 A;  3G71 A;  3OYY A;  2EIF A;  4X64 Q;  2BA1 A;  3W5O A;  2JEB I;  1XJV A;  1VQH A;  2PQA A;  1L2F A;  4DUY Q;  1YJ9 A;  4J15 A;  4RMF A;  4DV3 Q;  1WCM H;  1YI2 A;  4LNQ A;  3PO2 G;  4KHP Q;  4A3L H;  4QIW E;  5GQO A;  4LF6 L;  2KCT A;  5EAY A;  1L1O A;  3ULP A;  3GTK H;  1Q8K A;  4BA1 I;  3PUY A;  4DV1 L;  4LF4 Q;  2N49 A;  2GVA A;  3RZD H;  4BBS H;  4GKJ Q;  2KEN A;  1A0I A;  1I5F A;  1I94 Q;  1HNZ L;  3ZJY C;  4OWW B;  1XNQ Q;  4K0K L;  4DV4 Q;  4AIM A;  1VQA A;  1N33 Q;  1XMO Q;  1OXT A;  4PZ6 A;  2GVB A;  1HR0 L;  4C3H H;  4GN3 B;  5ELN A;  2JE6 I;  2N3S A;  5C3E G;  2C35 B;  4A75 A;  4DR2 L;  3HOU H;  1SLJ A;  4DR6 L;  3S1N H;  1S3O A;  5GAH C;  2QA4 A;  4PZ7 A;  2YV5 A;  4R1J A;  3GTQ H;  4K0K Q;  3DLL A;  3FHW A;  2WFW A;  3D31 A;  2N8N A;  1VQM A;  3GTG H;  3KJO A;  1A62 A;  4OWX B;  4DV1 Q;  2JEA I;  2F52 A;  3TEH B;  1EQR A;  4LFC Q;  3HOZ G;  2D62 A;  4A76 A;  1NJI C;  2VQE L;  5IYC H;  4JOI A;  3UDI A;  4EX5 A;  5IP9 G;  3KF6 A;  4HIM A;  2ZM6 Q;  1Z47 A;  2PMZ E;  1KHI A;  2UXD Q;  1Q86 C;  3I4O A;  5IP7 H;  2VQF L;  2KCM A;  4A3G G;  3RZO H;  3WWV A;  4A3K H;  2WB1 E;  4WJ4 A;  3J81 i;  1QZH A;  4XIG S;  2MNA A;  1KQS A;  3JAM i;  1VQC A;  3KYH C;  1VS0 A;  3AYH B;  4IJL A;  3RLF A;  1NY4 A;  4TVA B;  5C4X G;  3MEF A;  4A3B G;  1OTC A;  3CPW A;  3PUW A;  2DGY A;  2E5L Q;  4IPH A;  4JI5 Q;  3CC4 A;  1VQG A;  3L0O A;  2Q2U A;  4IPC A;  4JI8 L;  3I55 A;  4UP9 A;  3CF5 A;  1OXU A;  4YY3 Q;  4JI2 L;  1S72 A;  1Q7Y C;  2JA8 G;  2PQA B;  1IBL L;  3T1Y Q;  4BY1 H;  1KRT A;  2R7D A;  4QJF A;  4X62 L;  2JK8 A;  4C2M H;  1PH2 A;  3UE0 A;  1FJG L;  1K8A C;  2UXC L;  4GNX B;  1JE5 A;  2KHI A;  2JA5 H;  1KXL A;  1VQ8 A;  1Q12 A;  5HY6 A;  1HNX Q;  2R92 H;  1WJJ A;  3H15 A;  4DV2 L;  4ME3 A;  5FLX c;  1IBK L;  1B70 B;  3M9B A;  1HR0 Q;  4DAY B;  3E9H A;  1EWI A;  3PUZ A;  5HGQ A;  3S2H H;  4KHP L;  1O7I A;  1VQN A;  1S40 A;  4DPG A;  2JJQ A;  2AWO A;  1TXY A;  1X56 A;  5BR8 L;  4Y7N H;  1UE6 A;  4QGU A;  3W1G A;  4YHH L;  1XMQ L;  3HOU G;  4JI3 Q;  1PHJ A;  3PO3 G;  4GS3 A;  2B63 G;  2EXD A;  4GKJ L;  5IYD G;  2IT1 A;  4A3F H;  1IBK Q;  1VQP A;  4IFD G;  1SRO A;  1JMC A;  4JI6 L;  4QL5 A;  1NE3 A;  5GAE C;  1SR3 A;  2RHQ B;  1EQQ A;  1PH3 A;  4P75 A;  3S14 H;  3RLN A;  3EIV A;  3H0G H;  4BXX H;  1EYG A;  3A5Z B;  2BH8 A;  2HQL A;  2L15 A;  2E5L L;  1J5E Q;  1VQI A;  3J81 j;  5IP9 H;  4DV7 Q;  2E2J H;  3S1Q H;  1G6P A;  4NXN L;  4LFA L;  4DKA C;  2Y0S E;  5C0X J;  4A3J H;  4GOP B;  2NVX H;  2UUB Q;  4HIK A;  1XMQ Q;  4LW1 A;  4HJ8 A;  2ZJR A;  3HOW H;  1TWF H;  1K83 H;  4JI5 L;  4NXM L;  1ASY A;  2AWN A;  1HNW L;  4LF9 Q;  4DR7 L;  4DNI A;  1JJG A;  5GRO A;  1Y1V H;  5LMN W;  3ER0 A;  4A3D G;  5JEA G;  1LM0 A;  4JBJ A;  3CC2 A;  1TWA H;  2VL6 A;  3GTM H;  3M4Q A;  4HJ9 A;  4X65 L;  4OX9 Q;  2OTJ A;  2VUM H;  4NB3 A;  3U4Z A;  3ERS X;  4C3J H;  4B3M Q;  1IXR A;  5FLM H;  3NEL A;  4JC0 A;  2HIV A;  3CXC A;  2JA8 H;  4B3R Q;  5IYB H;  1CSP A;  5AJ3 Q;  3BZC A;  3HOV G;  2FXQ A;  2MFI A;  4R4Q A;  1M90 C;  1OXS C;  2YYZ A;  1W3S A;  1YBY A;  5JEA J;  4DR2 Q;  4DV6 L;  2NZO A;  4YCV A;  1HNX L;  1Q82 C;  1RIP A;  2JA5 G;  4O0A A;  3BU2 A;  3W1B A;  4POF A;  2Q2I A;  2CKZ B;  4HIO A;  4X66 L;  2IX1 A;  3UDX A;  3CCR A;  3GTL H;  4B3T L;  4A3L G;  4DV4 L;  1N32 Q;  1N36 Q;  3JC6 6;  2F3I A;  1PH4 A;  1YNX A;  2VY3 A;  3U50 C;  3G4S A;  4OX9 L;  3ULJ A;  4LFA Q;  1I50 H;  4APV A;  1U0L A;  2IY5 B;  1PFS A;  1N34 Q;  1VCI A;  3GTP H;  1VQK A;  1H95 A;  5IYD H;  1C9O A;  3FKI G;  2ZJQ A;  1GM5 A;  4A93 G;  3I4M G;  2UUB L;  2UUC L;  2OCE A;  4X64 L;  4LF5 L;  2CFM A;  4DK6 C;  3HOY G;  2UXB L;  1WOC A;  1P8L A;  3UE1 A;  4WJ3 M;  5E7N A;  2MO1 A;  4HID A;  2OQK A;  4IJH A;  4DV7 L;  3TS0 A;  4LF7 Q;  3H0G G;  1FGU A;  1WYD A;  4JCV E;  4AH6 A;  1UE7 A;  2V1C C;  1PH9 A;  1UE5 A;  4JYA Q;  3RN5 A;  2VQF Q;  2Z0S A;  4JI1 L;  5LMN Q;  3K8A A;  2R93 G;  4GNX C;  1GO3 E;  1V1Q A;  1IBM L;  4TQU S;  2ZM6 L;  5C44 H;  3NEN A;  1JB7 A;  4BY7 G;  4X6A H;  4A3I G;  2N78 A;  4LFB L;  2AMC B;  3MXN B;  3PCO B;  3TQY A;  5IWA L;  4UP8 A;  4AYB E;  3HOW G;  5FJ8 G;  3HOX H;  2ASB A;  5M5X H;  1Z9F A;  1VQF A;  4QQB X;  2R7F A;  4YCU A;  4A3D H;  5IY0 A;  2R7Z G;  4NPS A;  1BKB A;  1HJP A;  1Q1E A;  1KIX A;  2HHH L;  2HT1 A;  2VUM G;  3PV0 A;  4BBR H;  3CC7 A;  4BBS G;  4UPA A;  2XTI A;  3F8T A;  4DV2 Q;  1KL9 A;  1BBW A;  4R4C A;  4R4T A;  3GD7 A;  4HJ5 A;  3M7N A;  1HH2 P;  2AHO B; 
#chains in the Genus database with same CATH topology
 3ND8 A;  2EYH A;  5EQ0 A;  4TRD A;  1X65 A;  2K4K A;  1Y14 B;  2F0Q A;  3M4P A;  2YU9 B;  2MQH A;  4B3M L;  1YNJ D;  1BF4 A;  2TMP A;  2J7Z A;  5KYI A;  3X3N A;  2DN8 A;  3I7F A;  3CAM A;  4FXG C;  3K0Y A;  1RTN A;  2JA7 H;  1K8O A;  4JI1 Q;  5M5W H;  5LMN L;  1WTX A;  2A6H D;  1FD7 D;  1IZ6 A;  4PMB A;  2CQO A;  4JBK A;  1DOM A;  3CW2 C;  2RVL A;  1K0S A;  2MO0 A;  3SEB A;  5KEE A;  4NXN Q;  2PO4 A;  3HG9 A;  3CPF A;  2UXB Q;  3K5M A;  2LMC B;  5CV7 A;  2CW0 D;  3PF4 A;  2LXJ A;  1NMG A;  4LWC A;  4DV0 Q;  2K1B A;  3QG1 A;  5JVH 3;  1EUJ A;  2B2Y C;  3ITP A;  4LFC L;  1HFN A;  4B3S L;  2K5V A;  4JK1 C;  3U58 A;  1QJO A;  2R93 H;  4K6L A;  1TWC B;  4JI3 L;  4JI7 Q;  2CQA A;  3K7U C;  2QEJ C;  1HZA A;  5DAU A;  1HPC A;  3CCM A;  4X62 Q;  1E22 A;  4A3G H;  2K5Q A;  3E0J A;  3VR6 A;  4DUZ Q;  3QOJ A;  1BBU A;  5EKI A;  1ESR A;  3J81 L;  4B3T Q;  4BBR G;  4L8J A;  4XQJ A;  2VS1 A;  2KHJ A;  2X6L A;  3J80 i;  4HTH A;  3E9I A;  1J8I A;  1IBL Q;  4TSS A;  1TWG H;  3E0E A;  5C6A A;  2R6G A;  4LF8 Q;  3RN2 A;  3GTJ H;  2NVY H;  1VQO A;  2B63 H;  5CYU A;  1MHW C;  2N55 A;  3HOZ B;  1D7Q A;  4X3K A;  4DR7 Q;  3GTQ B;  3VYU A;  3OWE B;  4OHJ A;  3OW2 A;  5EBD A;  2WV6 D;  2LSS A;  3CME A;  1EY6 A;  4DR3 Q;  3T56 B;  4X3T A;  1V8Q A;  4C3H G;  2JA8 B;  4KLK A;  2PI2 E;  4IPG A;  5KIX A;  4AQY L;  3JAM E;  3MVV A;  1S5C D;  3KDF B;  4IUV A;  2K5H A;  3GTL B;  1QE6 A;  1H9M A;  4MTN A;  3AMU A;  3DM3 A;  5IYB G;  1D1K A;  1F9Q A;  2C5C A;  2RHS B;  3UI2 A;  4R4O A;  1EYD A;  2ZXR A;  2YU9 H;  5JVG 3;  1EZ6 A;  3RD4 A;  1QCB D;  1L1O C;  1VQ6 A;  1PH5 A;  3S2D H;  5M5Y H;  4DV6 Q;  3S1Q B;  1UNS A;  4I65 A;  1EY4 A;  4GZY C;  4BBR B;  4UP7 A;  4JI8 Q;  3KLR A;  4RG1 A;  5JPM C;  3R8B A;  1PTO F;  1MIU A;  1MSH A;  4LF4 L;  1HQM C;  5ELO A;  1S5E D;  2TSS A;  4RKB A;  5K36 G;  1XTC D;  3PIP 3;  2XSC A;  2EY1 A;  3FDT A;  1VQ5 A;  2PW7 A;  3AFQ A;  3CCU A;  3SDZ A;  3EBE A;  1DOK A;  5G3L F;  1X3G A;  1II3 A;  4HR7 B;  3M3Y H;  1BUV T;  1IKM A;  2H5X A;  2A74 C;  1LLR D;  1LT4 D;  2K5W A;  3D6W A;  4YHH Q;  2ZTC A;  1S5B D;  1I3Q H;  4A3C G;  4H0L C;  4C3I G;  1K3R A;  1X32 A;  2ZJP A;  4A3E H;  1SRU A;  1R9T H;  5KYL A;  2DNE A;  2DNC A;  4DV0 L;  4J6H A;  1EIF A;  2K01 A;  3NP8 A;  3J80 E;  1PH1 A;  4BA2 I;  4JV5 Q;  1BDO A;  4KKS A;  1SE2 A;  1EFI D;  2F0H A;  1SE8 A;  5CMD A;  2WB1 G;  3A8J E;  1ILQ A;  4MN3 A;  4FYD A;  4IUT A;  1Q81 C;  3NPP A;  1FL0 A;  4CKB A;  4LF6 Q;  5FKA C;  3PUX A;  3CRK C;  4KD4 A;  4MNO A;  4NXM Q;  3S17 B;  1V1O A;  1X6O A;  2JP1 A;  1STE A;  3VR2 A;  4JI6 Q;  5I9P A;  3KLS A;  3PQI A;  5EPK A;  1WTP A;  4Q5V A;  3I4N G;  3J7Z C;  1CTM A;  5JEA H;  4KV6 A;  1N8R C;  4I7Z C;  3BVG A;  2JYO A;  1UWV A;  3NWS A;  1N36 L;  2O5J C;  5H1S E;  2YTY A;  1ONL A;  4ALP A;  4ID6 A;  2ICI A;  1TWF B;  3BDO A;  1HZ9 A;  3NEM A;  4L63 B;  1J9O A;  2JA6 B;  1K28 A;  2QGQ A;  3F2U A;  4A4I A;  5CV6 A;  3FEW X;  2NVT H;  4R9W A;  4BY7 B;  1TWH H;  5M3F H;  1V43 A;  2ZTD A;  3MEH A;  4F88 A;  1D8L A;  2LFN A;  3A7L A;  1SYE A;  3MC0 B;  3T1H L;  1Q3L A;  3T1Y L;  1ICW A;  4DFA A;  2X69 A;  3HOW B;  3A74 A;  1WD1 A;  2F0P A;  5TSS A;  3ERQ A;  1FJG Q;  2UXC Q;  4KN7 C;  1LTL A;  1HFG A;  2JA6 H;  1SYC A;  1MJC A;  2B29 A;  2PPB C;  1AZQ A;  1PXU A;  3K7A H;  1SNQ A;  1CUK A;  2F4V L;  1BOS A;  1MBY A;  1F77 A;  3ZYY X;  4LAA A;  3C1F A;  3I56 A;  1B8A A;  4C2M B;  3G48 A;  1SDF A;  2BA1 A;  3MXU A;  1XJV A;  1L2F A;  1YJ9 A;  4RMF A;  4DV3 Q;  4B9X A;  5D65 A;  4QIW E;  4LF6 L;  5EAY A;  3ULP A;  2F0I A;  3N52 A;  3PUY A;  4LF4 Q;  3RZD H;  4GKJ Q;  1CZG A;  2KEN A;  3MZ5 A;  1XNQ Q;  4K0K L;  5AFW A;  4F8M A;  2NVT B;  4DV4 Q;  4AIM A;  1XMO Q;  4KK7 A;  4PZ6 A;  1EOT A;  1U4P A;  4GN3 B;  2N3S A;  1S3O A;  2QF7 A;  2K03 A;  2WFW A;  3VR3 A;  1VQM A;  1PDQ A;  4WRD A;  4DV1 Q;  1HUM A;  3TEH B;  1EQR A;  2HQE A;  1NJI C;  3HZX A;  5IYC H;  2F0F A;  2VB2 X;  3GP7 A;  3KF6 A;  4IN3 A;  1Z47 A;  2PMZ E;  3TP7 A;  3K6O A;  4QUF A;  1I4R A;  2VQF L;  3WWV A;  3MXG A;  3J81 i;  1M4V A;  4XIG S;  2MNA A;  1KQS A;  1SBB B;  1VQC A;  1EEI D;  3MWY W;  3MEF A;  2Z8L A;  1D5Z C;  3CPW A;  4IPH A;  2K05 A;  2F3V A;  4JI8 L;  4UP9 A;  2EY2 A;  1IBL L;  3HOV B;  1KAB A;  1RHP A;  2WAC A;  3ND9 A;  3NHH A;  2L9H A;  2ICE C;  1G2S A;  1JE5 A;  5E4W C;  5IOD A;  1VQ8 A;  1PZI D;  1Y1V B;  5KNC A;  3H15 A;  1SEB D;  1IBK L;  3M9B A;  3S2H H;  1I4P A;  2A68 C;  4EQP A;  3EQL C;  4C3H B;  2A5H A;  3I4L A;  1CA6 A;  3W1G A;  4YHH L;  3HOU G;  4JI3 Q;  1PHJ A;  2B63 G;  4GKJ L;  2EXD A;  2Q8R E;  2HCI A;  4AYB B;  5COR A;  2VB3 X;  5T1I A;  5C44 B;  1G91 A;  4CKE A;  1DYQ A;  3URY A;  3EFX D;  1NE3 A;  2IL8 A;  1EQQ A;  3DWP A;  3A5Z B;  1FNU A;  5M3F B;  3G7L A;  1J5E Q;  1VQI A;  3J81 j;  3S1Q H;  2ZXO A;  1G6P A;  5JPN C;  3I70 A;  3OPO A;  5CV9 A;  5C0X J;  2UUB Q;  1JCK B;  2MPM A;  1TWF H;  3FRP B;  4JI5 L;  1HNW L;  5C4X B;  1SNO A;  1EY0 A;  1PMR A;  3Q24 A;  4HSP A;  2ZT9 C;  1LM0 A;  5JEA G;  3CC2 A;  2VL6 A;  3GTM H;  4HJ9 A;  3I91 A;  3U4Z A;  3OHX C;  3A8K E;  5I6W A;  4CDE C;  3BDL A;  5IT9 E;  3HOV G;  4R4Q A;  1M90 C;  2YYZ A;  1W3S A;  3NTI A;  2NZO A;  1HNX L;  1RIP A;  2JA5 G;  3BU2 A;  4A3L G;  2CKZ B;  2SEB D;  1ML0 D;  5CV8 A;  3S16 B;  3NBH A;  1N32 Q;  1N36 Q;  4K8I A;  2RBM A;  2PZW A;  3G4S A;  4EQO A;  3VYT A;  3H91 A;  5M9O A;  1I50 H;  5IGG A;  2Z4H A;  2M9V A;  2WIN B;  3A54 A;  4DAV A;  1VQK A;  1E0B A;  2AQ2 B;  5IYD H;  1C9O A;  4A93 G;  5I6Y A;  4V19 0;  1CK1 A;  2WB1 B;  2CFM A;  1ET9 A;  1P8L A;  1H9S A;  3G6J B;  5DM7 3;  4DV7 L;  2WAQ B;  1D2B A;  3QR8 A;  5IOC A;  4JCV E;  1UE7 A;  3RN5 A;  4JI1 L;  5LMN Q;  3K8A A;  1V1Q A;  4PNY A;  4TQU S;  3NEN A;  4HCS A;  4A3G B;  3KLS X;  4A3I G;  3C3L A;  4K2K A;  2MJ8 A;  3PCO B;  4UP8 A;  4AYB E;  3HOW G;  2CW0 C;  4JPB W;  2F0N A;  1VQF A;  2FMM A;  4BBS G;  1ROD A;  5DM6 3;  2XTI A;  4DV2 Q;  1QOH A;  4R4C A;  4EVO A;  5I2Y A;  3NXW A;  2ATW A;  3W2D A;  5C4J H;  4KN4 C;  1N33 L;  3IRB A;  2H4O A;  4FF1 A;  1VQB A;  4BWG B;  1GUS A;  4KY5 A;  2AQ3 B;  4ZQ3 A;  5I2X A;  3KUP A;  4PZ8 A;  2R93 B;  1WCM G;  3PO2 H;  2X6G A;  5AJ3 L;  1ILP A;  1M1K C;  1BCP F;  2F0W A;  1W6K A;  2XRS D;  3K5O A;  2Z6B A;  1A6X A;  1J6Q A;  2C9O A;  1X54 A;  2O5I C;  1JOK A;  2DJG C;  3GTO B;  4KHV A;  4G7O C;  1EY9 A;  1B4O A;  1TKW B;  3KFU A;  3FKI H;  2A19 A;  3P7J A;  4PV1 C;  3VA5 A;  4YY3 L;  1LT5 D;  1PH7 A;  2B63 B;  3MHB A;  3KLW A;  2NVY B;  3RLO A;  4A3M H;  2I5L X;  3H0G B;  2B2W A;  5I4D A;  3HKZ G;  3FMC A;  5M3F G;  3STB D;  5IIF A;  4R4I A;  2B2U C;  4FDB A;  2R61 A;  2HHH Q;  5LMU L;  3H09 A;  3HGB A;  1PV4 A;  1P16 A;  4BY1 G;  1CHP D;  1D1I A;  4OL7 A;  3ICE A;  1JQY D;  1ZEQ X;  4IFD J;  2F0M A;  1JC7 A;  4FNF A;  3HOX G;  3S2H B;  1DXM A;  5C4H A;  1IYU A;  1Z7T A;  2WAQ E;  2BDN A;  5C3W A;  5A35 A;  2DY8 A;  3CMA A;  3JAM L;  2UUA Q;  1WTQ A;  3RR5 A;  4B3S Q;  3SK8 A;  1MGS A;  2GN5 A;  1JJ2 A;  5FLX L;  1ENF A;  3L2P A;  2ES2 A;  3GDE A;  2Z9H A;  1IBM Q;  4DR4 L;  1U4L A;  4KMU C;  1NAP A;  1NBW A;  1HTL D;  2Z6K A;  2L11 A;  2E8G A;  1Y1W H;  2NN6 G;  4JI0 Q;  1EL0 A;  4K6D A;  3S14 B;  1FNV A;  3KJP A;  1PTO C;  4RGM A;  2F4V Q;  3L9A X;  3S17 H;  1DJR D;  2LXK A;  3UDF A;  4LF8 L;  3M4O H;  4A3J B;  2CVR A;  2NVQ H;  3A56 A;  1U5K A;  1A8V A;  3SXH A;  2DUD A;  1Z6H A;  3ONA B;  4A3E G;  4K5X A;  1A3T A;  1SXT A;  4JI7 L;  3S1R H;  2E74 C;  4LUZ A;  4BXX G;  1WFQ A;  2G9H D;  3D0F A;  3K7A B;  1XXG A;  2HCC A;  4A3I H;  5IYC G;  4IOC A;  3CP0 A;  1LTS D;  1HNZ Q;  3SK6 A;  2XIW A;  1EIG A;  1SE4 A;  1AFP A;  1LTR D;  4JI0 L;  4DXF A;  4CJ0 B;  2XGT A;  2PI2 A;  3FVQ A;  2R92 G;  3DWA A;  2B3G A;  4JI2 Q;  1E2Z A;  2PQE A;  4G57 A;  4HJ7 A;  2K50 A;  5T1G A;  3CQZ H;  3K81 C;  2EY5 A;  4OON A;  5GAG C;  2L1B A;  2KEE A;  3HOV H;  1N9W A;  5FLX E;  4DUY L;  2E2H B;  1EU4 A;  1OXV A;  1PVO A;  1Y1W G;  5JOB A;  4F87 A;  1ZXT A;  2UXD L;  2K75 A;  2I46 A;  1X55 A;  2R92 B;  3FPP A;  3N6R A;  3CD6 A;  4K2L A;  3S24 A;  3AEV A;  1K3B C;  4XTC S;  4GOP C;  3VR4 A;  4AQY Q;  5FO7 B;  2OWO A;  3P1H A;  3CCS A;  4Q0F A;  4RCN A;  1ASZ A;  1L0W A;  3S1M H;  4A3K G;  4H44 C;  4A3M G;  5C0X H;  1JB3 A;  2R7Z H;  2OF1 A;  1HZB A;  3IAY A;  3CCL A;  2WP8 J;  4GNX A;  4FP5 D;  1QNU A;  2WAQ G;  2A6E D;  3UDG A;  1IYJ B;  4F7X A;  2B2Y A;  3K58 A;  1LO5 D;  2BA0 A;  1YHA A;  2EXZ A;  3TP6 A;  4E6I A;  4DV5 L;  5D3I B;  1VQ9 A;  1I3Q B;  1KLG D;  2D5D A;  1N34 L;  4QUC A;  3S15 H;  1JE4 A;  1G51 A;  1VDZ A;  4OIJ A;  2PNR C;  1HA6 A;  1G29 1;  1J5E L;  3HKZ E;  3TP8 A;  4IUR A;  4ZKC B;  4GN5 A;  2CWP A;  5KGU A;  3GTP B;  3TSS A;  1AE2 A;  3HP3 A;  4OEM B;  4UHV A;  4FF3 A;  1RL2 A;  4L5Q A;  3M7G A;  4DV5 Q;  1YJW A;  3TRE A;  1AH9 A;  3VA7 A;  4DR6 Q;  1VQL A;  1B50 A;  4P71 A;  1SSO A;  3CRL C;  4OO1 I;  2B2T C;  3H94 A;  5LL6 X;  3CCQ A;  1WD0 A;  4HCE A;  4DUZ L;  3OMC A;  3SE0 A;  4XT1 B;  3OTO Q;  3FPU B;  1QIL A;  5C3X A;  1YJN A;  1TT2 A;  3MAQ A;  1E7Z A;  2XN9 C;  3STB C;  5JJL A;  2RDG A;  4IAL A;  1I94 L;  4GLX A;  4O1N A;  4JYA L;  4CJ2 C;  2F3W A;  1K0R A;  5M5Y B;  2Y0S B;  3G71 A;  1HQR D;  4IUN A;  3TBI B;  5JAV A;  3W5O A;  3T4A C;  4QB4 A;  1T5X D;  5C3E B;  2KCC A;  2EZV A;  1IHZ A;  1WCM H;  1YI2 A;  4XYO A;  4LNQ A;  4KHP Q;  4XQQ A;  5GQO A;  2KCT A;  1EWC A;  3SR1 A;  2L4N A;  3I4N B;  4BA1 I;  1HA5 A;  5FO9 B;  4BBS H;  3I4M B;  3P20 A;  1I5F A;  1D5M C;  1LAC A;  1VQA A;  1BCP C;  4Z9C B;  1OXT A;  2GVB A;  1HR0 L;  1LV9 A;  5C3E G;  1YNN D;  2C35 B;  1TWG B;  5GAH C;  2YV5 A;  3GTQ H;  2A73 B;  3DLL A;  2N8N A;  3GTG H;  3KJO A;  4CBV A;  1TY2 A;  1A62 A;  4ODG A;  3KBG A;  1HTP A;  2ZXP A;  2JEA I;  2F52 A;  4UDU C;  1LTB D;  2SNM A;  4EX5 A;  2JSO A;  4DAY A;  2O4X A;  4ZLT F;  4I7A A;  1VMP A;  1STN A;  3TN2 A;  4WJ4 A;  3R93 A;  1YNJ C;  2EYJ A;  3MTS A;  3JAM i;  4K8J A;  3AYH B;  4JW0 A;  4IJL A;  1NY4 A;  4TVA B;  4A3B G;  3PUW A;  3LX0 A;  3CC4 A;  3L0O A;  1TS2 A;  2Q2U A;  4A3M B;  4JI2 L;  3TME A;  4BY1 H;  2R7D A;  4U67 3;  2XWJ B;  2L55 A;  1PH2 A;  2ENB A;  4J1M A;  1K8A C;  2JA5 H;  2Z4I A;  2KVM A;  2Q8T A;  1B9N A;  2F0U A;  4ME3 A;  5FLX c;  3OWF A;  1PLF A;  1EWI A;  5HGQ A;  4G7H C;  4KHP L;  1LTI D;  1O7I A;  2L5T A;  1S40 A;  1VQN A;  4DPG A;  4NMZ A;  5BR8 L;  2K6A A;  1UE6 A;  3I90 A;  1SNP A;  1QNK A;  3PO3 G;  4BY1 B;  5COY A;  2IT1 A;  4KJO A;  5J22 A;  2B2W C;  1IBK Q;  4A3B B;  1LT3 D;  2G5D A;  4QF4 A;  1JMC A;  2RSN A;  2JXM B;  4CKC A;  2JA7 B;  1MI2 A;  1SR3 A;  2RHQ B;  3DEO A;  3U9O A;  3X3M A;  1D5X C;  1EEF D;  2E2J H;  1B44 D;  2RSO A;  3EJI A;  4DKA C;  1KDC A;  2D2C C;  2Q8I B;  2LKV A;  1SFO B;  1B9M A;  3TZD A;  2ZJR A;  4HJ8 A;  4RFB A;  4X3U A;  1K83 H;  3OSO A;  1ASY A;  4K14 A;  4DR7 L;  3SK5 A;  3D4W A;  5GRO A;  4DNT B;  1Y1V H;  5LMN W;  1PFN A;  1V1P A;  3M4Q A;  1B3A A;  4ZUI A;  2OTJ A;  4NB3 A;  3HKZ B;  1I4H A;  3NEL A;  2KCN A;  1CSP A;  1EY8 A;  4NW2 A;  1YBY A;  4DV6 L;  4POF A;  3M4Y A;  1CM9 A;  4B3T L;  4DV4 L;  2RQX A;  4BBS B;  4CDF C;  5JJZ A;  1PH4 A;  2VY3 A;  4RCO A;  4RH6 A;  4APV A;  1PRT D;  1U0L A;  2IY5 B;  5ELD A;  2CH4 A;  2FMC A;  2ZJQ A;  3I4M G;  3RUZ A;  2UUB L;  1EWH A;  2OCE A;  4X64 L;  4LF5 L;  2O2L D;  1TR5 A;  3HOY G;  4M8A A;  4HID A;  5NUC A;  3BYY B;  1U9R A;  1PH9 A;  2V1C C;  1GJX A;  2VQF Q;  1SJH D;  1GO3 E;  4N8X 1;  4N9P A;  4ZYS A;  3IFT A;  2RCF A;  2KOL A;  5IGC A;  1HXY D;  1D6E C;  5FJ8 G;  3HOX H;  1EQV A;  3GTK B;  4QQB X;  4YCU A;  3S9W A;  1KIX A;  3PV0 A;  1KAA A;  3F8T A;  1SYG A;  1KL9 A;  1BBW A;  1QB5 D;  1I6H B;  1U4M A;  3V96 A;  1GD7 A;  2IHE A;  3LWU A;  1DON A;  4B08 A;  1FNW A;  5D14 A;  3IL8 A;  1O80 A;  2NN6 H;  2HDL A;  4KHZ A;  1OXX K;  1M8A A;  2OTL A;  3GV6 A;  1KC8 C;  4GKK Q;  2CH4 W;  2EOT A;  2K52 A;  3PO3 B;  3PSI A;  3OMG A;  3A0J A;  1YIT A;  1BCP B;  2NZH A;  3MFG A;  4WFN 3;  3PO3 H;  2WII B;  2HD3 A;  3KDF A;  4IQZ A;  3HOY H;  4DR4 Q;  1JIC A;  2QW7 A;  4KKT A;  4JBM A;  4R8N A;  1LUZ A;  1VMC A;  3QO2 A;  5C0X G;  1WTO A;  5ISR A;  3OTO L;  2EJM A;  2K5N A;  2KJX A;  4P72 A;  1XYI A;  4YWL A;  2EQS A;  3I3C A;  4LUO A;  4H13 C;  1CKO A;  3TP5 A;  1CSQ A;  4B9W A;  1IL2 A;  1SYD A;  5G3L D;  1IYV A;  4JV5 L;  2YTV A;  3Q0A A;  3PGZ A;  1WI5 A;  1Q8I A;  2PYK A;  3ULL A;  1EQT A;  2L12 A;  3PIO A;  1B53 A;  1PH6 A;  4IPD A;  2F0S A;  2QKI C;  1F9S A;  4HN7 A;  1TQO A;  1B1Z A;  4RAU C;  3I4N H;  1C7Y A;  1GHK A;  5J39 A;  3D4R A;  3I2Z A;  4EGV A;  4LF7 L;  3E3X A;  1I4X A;  2EJG C;  2CWA A;  5M3M B;  3F2C A;  4DR1 Q;  1XNR L;  4ILW A;  4S3S A;  2QDB A;  1Y8O B;  5C3E H;  1V9P A;  5IGB A;  4O2D A;  4A3F G;  1DGS A;  1QVC A;  5IWA Q;  1YHB A;  4KY7 A;  2Q2H A;  1NUC A;  3U9S A;  2IX3 A;  4LF9 L;  3NSW A;  3H3V H;  1PRT C;  1EYA A;  5BR8 Q;  2B2V C;  1NCV A;  1GKH A;  3I8Z A;  1K8G A;  2PNH A;  2RCN A;  4LF5 Q;  2A8V A;  1VQJ A;  4EQN A;  2JA6 G;  1HCZ A;  2XRQ D;  5M3M G;  2EVB A;  1B7Y B;  3AU7 A;  4OO1 G;  2EY6 A;  4MIU A;  3SVM A;  3E6Z X;  4GLV B;  5DEH A;  2VQE Q;  3KBX A;  4X65 Q;  4DR5 Q;  1CHQ D;  2FFK B;  3HOU B;  2E2H H;  2PMZ B;  4A3F B;  1SFO H;  2NVX B;  2A1A A;  1Y8N B;  1K73 C;  4K0K Q;  4HJA A;  2FHT A;  5LMU Q;  3H3V I;  5IP7 G;  1MKH A;  3M3Y B;  3QOL A;  4FO2 A;  4K5W A;  5CBE E;  4FXD A;  3BZK A;  5CR3 A;  4YWK A;  1TS3 A;  3KOJ A;  2BOS A;  2OT2 A;  3J7A V;  2IHF A;  3FP9 A;  1H9R A;  3V05 A;  1CKM A;  2F0L A;  1QG7 A;  5C5L A;  4H02 A;  1B2T A;  4IO9 A;  4DR1 L;  1XNR Q;  2Q2T A;  2VXW A;  4HED A;  2D0P A;  5F2D A;  4BY7 H;  2E2I B;  1W6J A;  1GUT A;  3NBI A;  1HUN A;  4X66 Q;  3CHB D;  4A3J G;  2D9U A;  4KJN A;  1E24 A;  1IW7 D;  1PZK D;  4JBW A;  1A63 A;  2E76 C;  3VDY A;  2F0E A;  2JQO A;  3A7A B;  2VW9 A;  4C3J G;  4GLA C;  4XXE A;  1K9M C;  3TDQ A;  3HKS A;  4LFB Q;  1CKN A;  1KDA A;  4A93 B;  1L0X B;  2MP1 A;  1FGB D;  3B6Y A;  1JR0 D;  2MHV A;  5EPL A;  1YIJ A;  4OGQ C;  1XTD A;  3KF8 A;  4IOA A;  1HHV A;  1KD1 C;  3Q8D A;  4XYQ A;  5ELC A;  3DEP A;  1W2B A;  1F9P A;  1LTA D;  3OOC A;  3BZD B;  4KD3 A;  1Q1B A;  2F03 A;  3TRZ A;  1FVI A;  3RNU A;  4A3K B;  1WTW A;  5BN4 A;  4YIJ A;  5E3F A;  2ZTE A;  4DF7 A;  1YEZ A;  4MTK A;  3DXJ C;  4A93 H;  4L5R C;  2Y0S G;  2BH2 A;  3QJY A;  1F2L A;  5C4J B;  3KF6 B;  4Y52 H;  2K5D A;  3EN2 A;  2K14 A;  4HMI A;  5CV5 A;  1Q46 A;  2JA7 G;  3W3A A;  3BJU A;  4GOP A;  5FK9 C;  1ZYR D;  4PMC A;  4FF4 A;  3A5U A;  1NR2 A;  1GUO A;  2IX0 A;  3T13 A;  4RGO S;  3QWN A;  4G7Z C;  3KF8 B;  1A2U A;  4EQ5 A;  3VYS A;  3L3O C;  1QUQ B;  4L6T B;  4LJZ C;  2E2I H;  3I4M H;  2K04 A;  4P73 A;  2IW3 A;  2RA4 A;  1VF7 A;  1BO0 A;  3CCV A;  1I6V C;  1O7Y A;  3KK7 A;  4LK1 C;  1CKN B;  3I73 A;  3R2T A;  1XPU A;  3H3V C;  1SNM A;  2NZ1 D;  4QY7 A;  1E1O A;  4X64 Q;  3BVZ A;  3MXP A;  1VQH A;  1SE3 A;  4ZCK A;  4N9T A;  4A3L H;  3T53 B;  2N49 A;  2GVA A;  2F0J A;  1I94 Q;  4OWW B;  3ZJY C;  3CU7 A;  2EYO A;  1PZJ D;  1N33 Q;  1RJT A;  3K5N A;  4A75 A;  4DR2 L;  1STY A;  3HOU H;  1SLJ A;  1JOO A;  4J8Q A;  1NR4 A;  2K32 A;  2F0K A;  1DZ1 A;  5J1Z A;  4R1J A;  1I4Q A;  1STH A;  2F0D A;  3FHW A;  5EKK A;  3D31 A;  3J7Y W;  2JA5 B;  4HSV A;  1PTO H;  1IL8 A;  1K8M A;  2D62 A;  1BR9 A;  1EY7 A;  3DM1 A;  5A2Q L;  2VQE L;  1RKN A;  1ZYR C;  3WOF A;  1KHI A;  1Q86 C;  1DOL A;  3I4O A;  1IW7 C;  3T16 A;  5BN3 A;  3RZO H;  4A3K H;  1TS5 A;  2NYZ D;  2MUY A;  5CGK A;  1QZH A;  4C3J B;  1KTK A;  2EE1 A;  1VS0 A;  3KYH C;  5C4X G;  3QB3 A;  1OTC A;  2E5L Q;  4MHE A;  3GQB A;  5BN5 A;  1CA5 A;  1O78 A;  4IPC A;  3I55 A;  1JWU D;  1OXU A;  4DGZ A;  4YY3 Q;  1O7L A;  3CF5 A;  1S72 A;  4DAP A;  3C2P A;  2JA8 G;  3HEJ A;  1RF2 D;  3T1Y Q;  3K5L A;  1KRT A;  5ELE A;  1JOR A;  1GUN A;  4X62 L;  1H9S B;  1SYB A;  1ET6 A;  3BS1 A;  4GNX B;  2PCF B;  2KHI A;  1KXL A;  1A2T A;  1F9R A;  1HNX Q;  2R92 H;  4RKL A;  1HR0 Q;  1A3V A;  2JJQ A;  5ELB A;  1TXY A;  1X56 A;  2KUM A;  4Y7N H;  4QGU A;  1XMQ L;  2B8G A;  4GS3 A;  3LWE A;  4DU9 A;  3NWT A;  4OO1 H;  4HAE A;  4DK1 A;  4FF2 A;  1TWA B;  1VQP A;  4IFD G;  4H7B A;  1SRO A;  4JI6 L;  3D3R A;  4KTA A;  4QL5 A;  5GAE C;  1PH3 A;  4P75 A;  1WCM B;  3EIV A;  1EYG A;  3MXN A;  2BH8 A;  2EDG A;  2L15 A;  3LNN A;  5M5X B;  4CHT B;  3S15 B;  2KED A;  4NXN L;  1F2Z A;  4LFA L;  2Y0S E;  4P2C B;  2NVX H;  4HIK A;  2BDO A;  4A3I B;  2EYP A;  3CQZ B;  1XMQ Q;  3HOW H;  3WOE A;  1YNN C;  2PZT A;  1U4R A;  2AWN A;  4DNI A;  1DM0 B;  3QIA A;  4A3D G;  3D4D A;  1TWA H;  2BE5 D;  1ENC A;  4DXG A;  2WKD A;  4B3M Q;  3J81 E;  1IXR A;  4JC0 A;  2HIV A;  5K36 H;  4ZK9 B;  3WDN A;  5IYB H;  5FO8 B;  1EY5 A;  3BZC A;  2FXQ A;  1X3Q A;  2M2L A;  1NSN S;  3OIQ A;  2IPK D;  4YCV A;  1Q82 C;  1KDB A;  2IX1 A;  3W1B A;  4HIO A;  2Q2I A;  3CCR A;  4JVZ A;  2F0V A;  2NB0 A;  2R3Z A;  3JC6 6;  2H1E A;  3H6M A;  3U50 C;  2R7Z B;  4LFA Q;  1PTO D;  1PFS A;  2OEO A;  5KND A;  5DNF A;  4RHR A;  4X3S A;  3GTP H;  2B2U A;  1H95 A;  1E2W A;  1SMY C;  2UUC L;  4XT3 B;  4DK6 C;  2UXB L;  1WOC A;  3UE1 A;  3C1E A;  2XWB B;  4WJ3 M;  1MD2 D;  2MO1 A;  4UAI A;  3HS0 C;  4JYA Q;  3NE5 B;  2E75 C;  1IBM L;  1KNE A;  2B39 A;  3NTK A;  4BY7 G;  5C44 H;  4KY6 A;  4X6A H;  4NKL A;  1JWS D;  4LFB L;  2AMC B;  3MXN B;  4IUQ A;  1STG A;  1H9J A;  5M5X H;  3C46 A;  5IY0 A;  3NTH A;  2R7Z G;  4NPS A;  1BKB A;  1HJP A;  1Q1E A;  2HHH L;  1F2M A;  2HT1 A;  3T51 B;  4HJ5 A;  2EJF C;  4RA8 A;  1O7Z A;  2QIL A;  1HH2 P;  3GTK H;  2AHO B;  3HOY B;  5CBA E;  3IFD A;  4RGT A;  4OWT B;  1C4Q A;  1WTV A;  3PIP A;  3Q22 A;  2CCZ A;  2K33 A;  5K5P A;  2IWH A;  1CI3 M;  4LUV A;  4L5T A;  1I6H H;  4FXK C;  5I9O A;  1XPO A;  2B2V A;  2NBF A;  2NN6 I;  4ZKB B;  4OEL B;  3PO2 B;  1EU3 A;  2KA7 A;  1Y1W B;  1S5D D;  3S2D B;  1LAB A;  4A3C H;  4DAM A;  1GHJ A;  1SN8 A;  1HR0 W;  5L37 A;  4WJW A;  4C3I H;  1UEA B;  1KLU D;  3GO5 A;  2NTT A;  3F1Z A;  3MFY A;  1TY0 A;  5EBC A;  5M3M H;  1QUQ A;  3BG3 A;  4ME5 A;  4IFD H;  5C0X I;  4V0B A;  4MZ9 A;  3T1H Q;  3U4V A;  2Z6K C;  2UUC Q;  2F4I A;  2LY7 A;  1L1O B;  1N32 L;  1VQ4 A;  1LTT D;  5E4X A;  3RZO B;  4A3E B;  1R9T B;  4ZUJ A;  3M85 A;  3J81 c;  2SNS A;  4YWM A;  1YHQ A;  1EYC A;  1E2V A;  3JAM c;  3SHL A;  1BBX C;  4PMW A;  3J7A F;  1T9H A;  1JOQ A;  5IT9 c;  3L7Z C;  3DMU A;  5KNB A;  1E1T A;  5IGD A;  2ID0 A;  2DJF C;  2JN4 A;  1HNW Q;  4L5S A;  2ALY B;  4UY8 C;  1EOV A;  2D0O A;  1C0A A;  4QIW B;  4OXP A;  5J3B A;  2OQ0 A;  1CZW A;  2AUJ D;  2B8F A;  1SNC A;  5JJI A;  3LGJ A;  4GKK L;  1YVC A;  3PUV A;  4C1N K;  3CCE A;  1NTG A;  2A69 C;  1AEX A;  3S1N B;  3HOZ H;  3BYT B;  1MSG A;  3HRZ C;  2PZU A;  1CQF A;  1QZG A;  2J4X A;  1UUP A;  1X3F A;  1VQD A;  2YTX A;  3K0X A;  2JA9 A;  2K28 A;  1BXT A;  4P74 A;  1Y1V G;  1PH8 A;  5JJK A;  2N88 A;  3GTG B;  4PQX A;  1TU2 B;  3MA2 B;  1AE3 A;  5FLM G;  1CT1 D;  3K57 A;  3NQI A;  1AW7 A;  4AYB G;  5C44 G;  3HOX B;  3G6E A;  2I5M X;  2Z1C A;  1JT8 A;  3CKI B;  1XPR A;  1KAW A;  1BCP D;  1X3E A;  5FJ8 H;  2E2J B;  4GN4 B;  1C8C A;  2KBN A;  2F0O A;  1B3Q A;  1LYL A;  4JG2 A;  3J80 c;  1NMF A;  4RGN A;  2QEX A;  1VQ7 A;  1RCV D;  2DY7 A;  1STB A;  4IUP A;  4PG3 A;  4A3B H;  1K83 B;  3A8I E;  3P75 A;  2SDF A;  1EFW A;  2M00 A;  1T5E A;  1UEB A;  1A15 A;  1GUG A;  1L0Y B;  4N8F A;  2E2D C;  2P5Z X;  2VZA A;  3J7A 5;  5GAD C;  1GUW A;  2KEC A;  3CCJ A;  1HZC A;  5E1F A;  3TS2 A;  4QMG A;  4C56 C;  1GXD C;  2HIX A;  5IE8 A;  2VNU D;  1CFM A;  2UUA L;  2EYL A;  3F2B A;  2K7V A;  2V4D A;  2RDH A;  4JI4 L;  3AQQ A;  3SGI A;  4IFD I;  1E3P A;  1S5F D;  3F2D A;  1RDP D;  1SMX A;  2F1M A;  2RF4 A;  4JOI C;  1WTH A;  1SAP A;  1PYS B;  1JJC B;  5C5M A;  3DHQ A;  5A2Q E;  4U68 A;  2I5H A;  4NP5 A;  4NDX A;  1MJE A;  5LHY 1;  4B3R L;  2OXP A;  2UU9 Q;  2RKS A;  1VQE A;  5CV4 A;  2I0Q A;  3A55 A;  1X9N A;  3GTO H;  1TWC H;  2IJ0 A;  1SJE D;  1DCZ A;  1AZP A;  1HRJ A;  3GTM B;  3S16 H;  3EVQ A;  3VYR A;  4DV3 L;  4CGY B;  1QWY A;  4CJ1 B;  2UU9 L;  3PF5 A;  1FR3 A;  2LS0 1;  3ERO A;  1YZ6 A;  4RWS C;  4JI4 Q;  1GVP A;  2MGS A;  5HGT A;  4POG A;  4YCW A;  1S4Z A;  4IUU A;  1PYW D;  1PYB A;  1XMO L;  1EIY B;  3K80 C;  1PRT B;  2AQ1 B;  3HFZ B;  5M5W B;  3R3O A;  3E5S A;  4KI0 A;  4WOR A;  1QVF A;  4DR5 L;  1WTR A;  4DK3 C;  4A3D B;  3S1M B;  1QVG A;  3NUC A;  1CQV A;  5CC4 A;  1BVS A;  1ENA A;  3NBH B;  3DWQ A;  1EZ8 A;  5ELF A;  1UE1 A;  2EPB A;  3RZD B;  1KRS A;  2VUM B;  4KKU A;  1TII D;  2A69 D;  3AFP A;  5DLQ E;  4ZRZ A;  4DNR B;  1IKL A;  1PA6 A;  5C4X H;  1XNQ L;  2AKW B;  4DR3 L;  2EYF A;  3TZU A;  1EIH A;  2L0C A;  3OYY A;  2EIF A;  2JEB I;  2PQA A;  4DUY Q;  4J15 A;  1TVX A;  5IT9 L;  3NK9 A;  3PO2 G;  3O13 A;  1R4P B;  2QCP X;  3AB9 A;  1L1O A;  2A6H C;  1Q8K A;  2EYM A;  4DV1 L;  3GV3 A;  4R8I A;  3J80 L;  1A0I A;  3IKJ A;  1HNZ L;  2SOB A;  3DUZ A;  5EPJ A;  1X3P A;  4C3H H;  5ELN A;  2JE6 I;  3SK4 A;  4DR6 L;  1V1P B;  3S1N H;  2QA4 A;  4PZ7 A;  2XVS A;  1TWH B;  1PFB A;  4OWX B;  1Y69 U;  2I07 B;  4XDX A;  3HOZ G;  4LFC Q;  4A76 A;  1TS4 A;  4RHS A;  4JOI A;  3UDI A;  4CDC C;  3PMF A;  5IP9 G;  4HIM A;  2ZM6 Q;  2UXD Q;  4C3I B;  1SND A;  3PIO 3;  5IP7 H;  4A3G G;  3Q23 A;  2KCM A;  2WB1 E;  4OIK A;  4CDD C;  4DA2 A;  3RLF A;  4QCL A;  1XX8 A;  2DGY A;  4JI5 Q;  2A6E C;  1VQG A;  5IGF A;  1Q7Y C;  2FJ2 A;  1G6Z A;  2A68 D;  2PQA B;  1SMY D;  4QJF A;  3VR5 A;  2JK8 A;  1KNA A;  4C2M H;  1RD9 D;  3UE0 A;  1ICF B;  1FJG L;  2UXC L;  1PFM A;  2WKC A;  1AP0 A;  1I4G A;  1Q12 A;  3D8G A;  1R4Q B;  5HY6 A;  1WJJ A;  4DV2 L;  1A3U A;  1B70 B;  1UAP A;  2QDL A;  5C4Z A;  4DAY B;  3E9H A;  3PUZ A;  1XWE A;  2AWO A;  2F0T A;  3OIP A;  2RDF A;  5FOB B;  2NVQ B;  3M4O B;  1H9K A;  5IYD G;  4A3F H;  5EKL A;  4DN4 M;  1FYC A;  2FIN B;  3K59 A;  2AUK A;  3NQT A;  4M1U B;  3S14 H;  4BXX H;  1AN8 A;  3RLN A;  3H0G H;  2HQL A;  2E5L L;  2NUC A;  4DV7 Q;  5IP9 H;  1LTG D;  2CHB D;  1WVL A;  1ESF A;  2KQ3 A;  4A3J H;  4GOP B;  4LW1 A;  4O42 A;  4NXM L;  4LF9 Q;  1JWM D;  1JJG A;  1Q90 A;  4BS9 A;  3ER0 A;  4DK0 A;  1G2T A;  2PW5 A;  3S1R B;  4JBJ A;  1VF5 C;  4X65 L;  4OX9 Q;  3EA6 A;  2VUM H;  4C3J H;  3ERS X;  3V2T A;  5FLM H;  2JA8 H;  3CXC A;  4B3R Q;  4ZAI A;  4C1N I;  5AJ3 Q;  1STA A;  2MFI A;  1OXS C;  4IZ8 A;  1NNX A;  5EGT A;  5JEA J;  5EJW A;  4DR2 Q;  1ZKO A;  1OO9 B;  4O0A A;  2J0T D;  3GTL H;  4X66 L;  3UDX A;  1Y8P B;  2BE5 C;  1LT6 D;  2F3I A;  1SYF A;  1YNX A;  3Q6S A;  1BNZ A;  4HMJ A;  1PRT F;  3R2I A;  4OX9 L;  2G9D A;  1F2Y A;  5LL6 S;  3ULJ A;  2BCO A;  4TKO B;  1N34 Q;  1VCI A;  5HUR A;  4XQN A;  1GOZ A;  1DD2 A;  3OW7 A;  3GTJ B;  1RTO A;  3FKI G;  5IGE A;  1GM5 A;  2F0G A;  2XNA C;  2HUG A;  5E7N A;  3I72 A;  3TS0 A;  2OQK A;  4IJH A;  4LF7 Q;  5D3D A;  3H0G G;  1FGU A;  1WYD A;  3D6C A;  3BVM A;  4AH6 A;  1UE5 A;  2GA4 B;  5KRU A;  3RMH A;  2Z0S A;  2R93 G;  4GNX C;  2ZM6 L;  4ABN A;  1JB7 A;  1C48 A;  2N78 A;  3BDC A;  1BQQ T;  4G4K A;  3TQY A;  5IWA L;  3FKI B;  4LMQ D;  1G8Z D;  1I50 B;  4Y7N B;  2NTS A;  2ASB A;  1PTO B;  1Z9F A;  2R7F A;  4K5V A;  4A3D H;  2KHS A;  2NWG A;  2VUM G;  3CC7 A;  4BBR H;  4ULL A;  2B2T A;  4UPA A;  4R4T A;  3M7N A;  3GD7 A;  4FVM A;  2HDM A; 
#chains in the Genus database with same CATH homology
 2ATW A;  5C4J H;  1N33 L;  4OWT B;  3IRB A;  1X65 A;  2K4K A;  3PIP A;  1GD7 A;  1VQB A;  2IHE A;  2CCZ A;  1Y14 B;  3M4P A;  2MQH A;  4B3M L;  4LUV A;  4L5T A;  4PZ8 A;  1I6H H;  1WCM G;  1XPO A;  3PO2 H;  5AJ3 L;  3I7F A;  3CAM A;  1M1K C;  2JA7 H;  2NN6 I;  4KHZ A;  1OXX K;  4JI1 Q;  5M5W H;  5LMN L;  1IZ6 A;  1J6Q A;  2CQO A;  4JBK A;  2OTL A;  1KC8 C;  3CW2 C;  4GKK Q;  1X54 A;  2K52 A;  3PSI A;  2MO0 A;  4A3C H;  3A0J A;  4DAM A;  4NXN Q;  1SN8 A;  1YIT A;  3KFU A;  3CPF A;  3FKI H;  2A19 A;  1PH7 A;  1HR0 W;  4YY3 L;  2UXB Q;  2NZH A;  4C3I H;  3PF4 A;  3PO3 H;  3KLW A;  2LXJ A;  3GO5 A;  4B3S L;  3RLO A;  3KDF A;  3HOY H;  4DR4 Q;  3F1Z A;  1NMG A;  4A3M H;  2I5L X;  4LWC A;  4JBM A;  1LUZ A;  5M3M H;  5C0X G;  1QUQ A;  4DV0 Q;  3HKZ G;  5C0X I;  5M3F G;  3STB D;  3OTO L;  1EUJ A;  2K5N A;  4P72 A;  4R4I A;  2EQS A;  4MZ9 A;  4LUO A;  4YWL A;  1CKO A;  2K5V A;  4LFC L;  3U4V A;  3T1H Q;  1CSQ A;  4FDB A;  3U58 A;  2Z6K C;  5LMU L;  2HHH Q;  2UUC Q;  1IL2 A;  2R93 H;  4JI3 L;  1L1O B;  4JI7 Q;  1N32 L;  1VQ4 A;  1PV4 A;  3K7U C;  4JV5 L;  1P16 A;  4BY1 G;  2YTV A;  3ICE A;  1HZA A;  3PGZ A;  4IFD J;  3CCM A;  3M85 A;  1WI5 A;  4X62 Q;  1E22 A;  3J81 c;  3ULL A;  4YWM A;  3HOX G;  1YHQ A;  4A3G H;  3PIO A;  4DUZ Q;  3JAM c;  1BBU A;  2WAQ E;  1PH6 A;  4IPD A;  4PMW A;  4B3T Q;  4BBR G;  1T9H A;  3CMA A;  2UUA Q;  5IT9 c;  2VS1 A;  3I4N H;  2KHJ A;  3L7Z C;  1C7Y A;  3J80 i;  3RR5 A;  4B3S Q;  3I2Z A;  3E9I A;  4LF7 L;  2CWA A;  1IBL Q;  2GN5 A;  1TWG H;  3E0E A;  1E1T A;  2R6G A;  3F2C A;  1JJ2 A;  2ID0 A;  4DR1 Q;  3RN2 A;  4LF8 Q;  1XNR L;  3GTJ H;  3L2P A;  2ES2 A;  2NVY H;  3GDE A;  1HNW Q;  1VQO A;  4L5S A;  2B63 H;  5C3E H;  1IBM Q;  4DR4 L;  1V9P A;  2ALY B;  4O2D A;  1EOV A;  4A3F G;  1DGS A;  2D0O A;  4UY8 C;  1NBW A;  1C0A A;  4OXP A;  5J3B A;  1D7Q A;  1QVC A;  2Z6K A;  2OQ0 A;  2E8G A;  5IWA Q;  1Y1W H;  5JJI A;  1YHB A;  2NN6 G;  4JI0 Q;  3LGJ A;  2Q2H A;  4GKK L;  1YVC A;  3PUV A;  4LF9 L;  3CCE A;  4DR7 Q;  1NTG A;  3OW2 A;  3H3V H;  2LSS A;  3KJP A;  3HOZ H;  5BR8 Q;  3CME A;  2F4V Q;  3S17 H;  2LXK A;  1GKH A;  3UDF A;  1K8G A;  4LF8 L;  2PNH A;  1QZG A;  3M4O H;  2RCN A;  2NVQ H;  1U5K A;  1A8V A;  1X3F A;  4DR3 Q;  4LF5 Q;  2A8V A;  2DUD A;  1VQD A;  2YTX A;  1VQJ A;  4KLK A;  2PI2 E;  4A3E G;  2JA6 G;  3K0X A;  4IPG A;  2JA9 A;  4P74 A;  5M3M G;  1B7Y B;  1Y1V G;  4AQY L;  1PH8 A;  4OO1 G;  5JJK A;  4JI7 L;  3KDF B;  4GLV B;  3S1R H;  2VQE Q;  4X65 Q;  1AE3 A;  2K5H A;  1WFQ A;  4LUZ A;  5FLM G;  3D0F A;  4DR5 Q;  4BXX G;  4MTN A;  3DM3 A;  4AYB G;  5C44 G;  5IYB G;  2E2H H;  4A3I H;  1SFO H;  2RHS B;  3G6E A;  4R4O A;  5IYC G;  2A1A A;  4IOC A;  3CP0 A;  2YU9 H;  2I5M X;  1JT8 A;  1K73 C;  1HNZ Q;  1VQ6 A;  1L1O C;  4HJA A;  1KAW A;  1XPR A;  5LMU Q;  1X3E A;  1PH5 A;  5M5Y H;  3H3V I;  5FJ8 H;  4DV6 Q;  5IP7 G;  3S2D H;  4GN4 B;  2KBN A;  4JI0 L;  4JG2 A;  1LYL A;  3J80 c;  1NMF A;  1MKH A;  2QEX A;  2XGT A;  2PI2 A;  1VQ7 A;  4UP7 A;  2R92 G;  4JI2 Q;  2B3G A;  4JI8 Q;  4RG1 A;  4PG3 A;  3BZK A;  1MIU A;  4HJ7 A;  4A3B H;  4YWK A;  2K50 A;  1EFW A;  4LF4 L;  1UEB A;  3CQZ H;  5ELO A;  3KOJ A;  3K81 C;  2IHF A;  5K36 G;  3FP9 A;  4OON A;  5GAG C;  3HOV H;  2VZA A;  3J7A 5;  5GAD C;  1CKM A;  1N9W A;  4DUY L;  4H02 A;  1VQ5 A;  1OXV A;  1PVO A;  1Y1W G;  3CCJ A;  1HZC A;  2UXD L;  4IO9 A;  4DR1 L;  2K75 A;  1XNR Q;  3AFQ A;  3CCU A;  1X55 A;  3EBE A;  3TS2 A;  2Q2T A;  3CD6 A;  1X3G A;  3M3Y H;  2HIX A;  2H5X A;  3S24 A;  5IE8 A;  3AEV A;  2VNU D;  2D0P A;  4BY7 H;  4YHH Q;  2ZTC A;  2UUA L;  1I3Q H;  4XTC S;  4A3C G;  4GOP C;  4AQY Q;  4X66 Q;  2OWO A;  4A3J G;  3F2B A;  3CCS A;  1K3R A;  2ZJP A;  4A3E H;  1SRU A;  1R9T H;  1ASZ A;  1E24 A;  1L0W A;  4JI4 L;  3S1M H;  4A3K G;  3AQQ A;  4JBW A;  4A3M G;  4DV0 L;  3SGI A;  1A63 A;  1EIF A;  2R7Z H;  4IFD I;  1PH1 A;  1E3P A;  4BA2 I;  4JV5 Q;  1HZB A;  3VDY A;  3F2D A;  1SMX A;  2RF4 A;  2JQO A;  4JOI C;  3CCL A;  1PYS B;  2VW9 A;  2WP8 J;  4GNX A;  4GLA C;  1JJC B;  1SE8 A;  1K9M C;  2WB1 G;  2WAQ G;  3HKS A;  4LFB Q;  1CKN A;  3UDG A;  1Q81 C;  1IYJ B;  1FL0 A;  3B6Y A;  2I5H A;  4LF6 Q;  3PUX A;  1MJE A;  4MNO A;  4NXM Q;  1YIJ A;  4B3R L;  2BA0 A;  1YHA A;  1X6O A;  4DV5 L;  2UU9 Q;  1XTD A;  1VQ9 A;  1VQE A;  4IOA A;  2I0Q A;  4JI6 Q;  1X9N A;  3GTO H;  1N34 L;  3S15 H;  1TWC H;  1KD1 C;  1G51 A;  3Q8D A;  1G29 1;  1W2B A;  3I4N G;  3J7Z C;  1J5E L;  3S16 H;  3HKZ E;  1Q1B A;  4DV3 L;  1N8R C;  2UU9 L;  1UWV A;  3PF5 A;  1N36 L;  3TRZ A;  1FVI A;  5H1S E;  3RNU A;  2YTY A;  4ALP A;  4GN5 A;  1YZ6 A;  2CWP A;  2ZTE A;  1HZ9 A;  1YEZ A;  3NEM A;  2QGQ A;  1AE2 A;  4JI4 Q;  1GVP A;  4POG A;  4A93 H;  4YCW A;  4L5R C;  4A4I A;  1RL2 A;  2Y0S G;  4L5Q A;  2BH2 A;  2NVT H;  1PYB A;  4DV5 Q;  1YJW A;  1XMO L;  3TRE A;  3KF6 B;  1EIY B;  1TWH H;  3K80 C;  5M3F H;  4Y52 H;  1V43 A;  2ZTD A;  1D8L A;  3HFZ B;  3EN2 A;  2K14 A;  1AH9 A;  1Q46 A;  2JA7 G;  4DR6 Q;  1VQL A;  4P71 A;  3T1H L;  4KI0 A;  3BJU A;  4GOP A;  1QVF A;  4DR5 L;  3T1Y L;  4DK3 C;  4OO1 I;  3A74 A;  3A5U A;  1QVG A;  2IX0 A;  3CCQ A;  1FJG Q;  2UXC Q;  3KF8 B;  4EQ5 A;  1BVS A;  1LTL A;  3NBH B;  4DUZ L;  1QUQ B;  2JA6 H;  2E2I H;  1MJC A;  1UE1 A;  2B29 A;  1KRS A;  3OTO Q;  3I4M H;  1YJN A;  4P73 A;  3K7A H;  1E7Z A;  3AFP A;  5DLQ E;  1CUK A;  2F4V L;  3CCV A;  3STB C;  5JJL A;  1PA6 A;  1CKN B;  5C4X H;  1I94 L;  1XNQ L;  4JYA L;  4GLX A;  1XPU A;  2AKW B;  3I56 A;  4DR3 L;  1B8A A;  1K0R A;  4QY7 A;  1E1O A;  3G48 A;  3G71 A;  3OYY A;  2EIF A;  4X64 Q;  2BA1 A;  3W5O A;  2JEB I;  1XJV A;  1VQH A;  2PQA A;  1L2F A;  4DUY Q;  1YJ9 A;  4J15 A;  4RMF A;  4DV3 Q;  1WCM H;  1YI2 A;  4LNQ A;  3PO2 G;  4KHP Q;  4A3L H;  4QIW E;  5GQO A;  4LF6 L;  2KCT A;  5EAY A;  1L1O A;  3ULP A;  3GTK H;  1Q8K A;  4BA1 I;  3PUY A;  4DV1 L;  4LF4 Q;  2N49 A;  2GVA A;  3RZD H;  4BBS H;  4GKJ Q;  2KEN A;  1A0I A;  1I5F A;  1I94 Q;  1HNZ L;  3ZJY C;  4OWW B;  1XNQ Q;  4K0K L;  4DV4 Q;  4AIM A;  1VQA A;  1N33 Q;  1XMO Q;  1OXT A;  4PZ6 A;  2GVB A;  1HR0 L;  4C3H H;  4GN3 B;  5ELN A;  2JE6 I;  2N3S A;  5C3E G;  2C35 B;  4A75 A;  4DR2 L;  3HOU H;  1SLJ A;  4DR6 L;  3S1N H;  1S3O A;  5GAH C;  2QA4 A;  4PZ7 A;  2YV5 A;  4R1J A;  3GTQ H;  4K0K Q;  3DLL A;  3FHW A;  2WFW A;  3D31 A;  2N8N A;  1VQM A;  3GTG H;  3KJO A;  1A62 A;  4OWX B;  4DV1 Q;  2JEA I;  2F52 A;  3TEH B;  1EQR A;  4LFC Q;  3HOZ G;  2D62 A;  4A76 A;  1NJI C;  2VQE L;  5IYC H;  4JOI A;  3UDI A;  4EX5 A;  5IP9 G;  3KF6 A;  4HIM A;  2ZM6 Q;  1Z47 A;  2PMZ E;  1KHI A;  2UXD Q;  1Q86 C;  3I4O A;  5IP7 H;  2VQF L;  2KCM A;  4A3G G;  3RZO H;  3WWV A;  4A3K H;  2WB1 E;  4WJ4 A;  3J81 i;  1QZH A;  4XIG S;  2MNA A;  1KQS A;  3JAM i;  1VQC A;  3KYH C;  1VS0 A;  3AYH B;  4IJL A;  3RLF A;  1NY4 A;  4TVA B;  5C4X G;  3MEF A;  4A3B G;  1OTC A;  3CPW A;  3PUW A;  2DGY A;  2E5L Q;  4IPH A;  4JI5 Q;  3CC4 A;  1VQG A;  3L0O A;  2Q2U A;  4IPC A;  4JI8 L;  3I55 A;  4UP9 A;  3CF5 A;  1OXU A;  4YY3 Q;  4JI2 L;  1S72 A;  1Q7Y C;  2JA8 G;  2PQA B;  1IBL L;  3T1Y Q;  4BY1 H;  1KRT A;  2R7D A;  4QJF A;  4X62 L;  2JK8 A;  4C2M H;  1PH2 A;  3UE0 A;  1FJG L;  1K8A C;  2UXC L;  4GNX B;  1JE5 A;  2KHI A;  2JA5 H;  1KXL A;  1VQ8 A;  1Q12 A;  5HY6 A;  1HNX Q;  2R92 H;  1WJJ A;  3H15 A;  4DV2 L;  4ME3 A;  5FLX c;  1IBK L;  1B70 B;  3M9B A;  1HR0 Q;  4DAY B;  3E9H A;  1EWI A;  3PUZ A;  5HGQ A;  3S2H H;  4KHP L;  1O7I A;  1VQN A;  1S40 A;  4DPG A;  2JJQ A;  2AWO A;  1TXY A;  1X56 A;  5BR8 L;  4Y7N H;  1UE6 A;  4QGU A;  3W1G A;  4YHH L;  1XMQ L;  3HOU G;  4JI3 Q;  1PHJ A;  3PO3 G;  4GS3 A;  2B63 G;  2EXD A;  4GKJ L;  5IYD G;  2IT1 A;  4A3F H;  1IBK Q;  1VQP A;  4IFD G;  1SRO A;  1JMC A;  4JI6 L;  4QL5 A;  1NE3 A;  5GAE C;  1SR3 A;  2RHQ B;  1EQQ A;  1PH3 A;  4P75 A;  3S14 H;  3RLN A;  3EIV A;  3H0G H;  4BXX H;  1EYG A;  3A5Z B;  2BH8 A;  2HQL A;  2L15 A;  2E5L L;  1J5E Q;  1VQI A;  3J81 j;  5IP9 H;  4DV7 Q;  2E2J H;  3S1Q H;  1G6P A;  4NXN L;  4LFA L;  4DKA C;  2Y0S E;  5C0X J;  4A3J H;  4GOP B;  2NVX H;  2UUB Q;  4HIK A;  1XMQ Q;  4LW1 A;  4HJ8 A;  2ZJR A;  3HOW H;  1TWF H;  1K83 H;  4JI5 L;  4NXM L;  1ASY A;  2AWN A;  1HNW L;  4LF9 Q;  4DR7 L;  4DNI A;  1JJG A;  5GRO A;  1Y1V H;  5LMN W;  3ER0 A;  4A3D G;  5JEA G;  1LM0 A;  4JBJ A;  3CC2 A;  1TWA H;  2VL6 A;  3GTM H;  3M4Q A;  4HJ9 A;  4X65 L;  4OX9 Q;  2OTJ A;  2VUM H;  4NB3 A;  3U4Z A;  3ERS X;  4C3J H;  4B3M Q;  1IXR A;  5FLM H;  3NEL A;  4JC0 A;  2HIV A;  3CXC A;  2JA8 H;  4B3R Q;  5IYB H;  1CSP A;  5AJ3 Q;  3BZC A;  3HOV G;  2FXQ A;  2MFI A;  4R4Q A;  1M90 C;  1OXS C;  2YYZ A;  1W3S A;  1YBY A;  5JEA J;  4DR2 Q;  4DV6 L;  2NZO A;  4YCV A;  1HNX L;  1Q82 C;  1RIP A;  2JA5 G;  4O0A A;  3BU2 A;  3W1B A;  4POF A;  2Q2I A;  2CKZ B;  4HIO A;  4X66 L;  2IX1 A;  3UDX A;  3CCR A;  3GTL H;  4B3T L;  4A3L G;  4DV4 L;  1N32 Q;  1N36 Q;  3JC6 6;  2F3I A;  1PH4 A;  1YNX A;  2VY3 A;  3U50 C;  3G4S A;  4OX9 L;  3ULJ A;  4LFA Q;  1I50 H;  4APV A;  1U0L A;  2IY5 B;  1PFS A;  1N34 Q;  1VCI A;  3GTP H;  1VQK A;  1H95 A;  5IYD H;  1C9O A;  3FKI G;  2ZJQ A;  1GM5 A;  4A93 G;  3I4M G;  2UUB L;  2UUC L;  2OCE A;  4X64 L;  4LF5 L;  2CFM A;  4DK6 C;  3HOY G;  2UXB L;  1WOC A;  1P8L A;  3UE1 A;  4WJ3 M;  5E7N A;  2MO1 A;  4HID A;  2OQK A;  4IJH A;  4DV7 L;  3TS0 A;  4LF7 Q;  3H0G G;  1FGU A;  1WYD A;  4JCV E;  4AH6 A;  1UE7 A;  2V1C C;  1PH9 A;  1UE5 A;  4JYA Q;  3RN5 A;  2VQF Q;  2Z0S A;  4JI1 L;  5LMN Q;  3K8A A;  2R93 G;  4GNX C;  1GO3 E;  1V1Q A;  1IBM L;  4TQU S;  2ZM6 L;  5C44 H;  3NEN A;  1JB7 A;  4BY7 G;  4X6A H;  4A3I G;  2N78 A;  4LFB L;  2AMC B;  3MXN B;  3PCO B;  3TQY A;  5IWA L;  4UP8 A;  4AYB E;  3HOW G;  5FJ8 G;  3HOX H;  2ASB A;  5M5X H;  1Z9F A;  1VQF A;  4QQB X;  2R7F A;  4YCU A;  4A3D H;  5IY0 A;  2R7Z G;  4NPS A;  1BKB A;  1HJP A;  1Q1E A;  1KIX A;  2HHH L;  2HT1 A;  2VUM G;  3PV0 A;  4BBR H;  3CC7 A;  4BBS G;  4UPA A;  2XTI A;  3F8T A;  4DV2 Q;  1KL9 A;  1BBW A;  4R4C A;  4R4T A;  3GD7 A;  4HJ5 A;  3M7N A;  1HH2 P;  2AHO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...