1N33L

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position at the a site with paromomycin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 12
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1n33L00
4QGUA 4A3LG 1OXUA 3F2CA 4OWWB 4LWCA 5C44H 3JC66 1IBKQ 1VQFA 3CPWA 3U4ZA 1Q46A 4DR1L 1CSQA 4A3KG 4R4CA 3NENA 2QEXA 5IP9G 3J80c 3EN2A 1E24A 3J81j 1PH6A 5LMNQ 1VQEA 3EBEA 1SN8A 4X64Q 1U0LA 3RN2A 1A62A 2JA7H 4L5SA 1YNXA 1P8LA 2R7FA 2Y0SE 4GKKL 1TWAH 3K80C 1NBWA 2JJQA 3DLLA 1XMOQ 1IBLL 3H3VI 3OTOL 1YEZA 4JOIC 3W1GA 1A8VA 4JOIA 5M3MH 3UE0A 1IYJB 1PH9A 4LF5L 2JA8H 3GTQH 3GTPH 1X3EA 4LF9Q 1TWFH 1X3FA 5BR8L 2EXDA 3G6EA 5IYCG 2ALYB 1CKMA 1D8LA 3K7UC 4OONA 3HOYH 4APVA 1HNZL 1G291 1BBUA 1EYGA 3D31A 3J81i 3EIVA 1QZGA 1PV4A 1QVCA 2D62A 1WOCA 2ZJPA 3CCMA 1YHAA 5IE8A 1ASZA 4C3HH 5JJIA 2JA7G 5IT9c 3S14H 3I2ZA 1K8AC 4JC0A 4BY1H 4DV4Q 1KXLA 1X56A 3H0GH 4DV5Q 2B63G 3JAMc 3CCVA 4OO1I 5FLXc 4HJ5A 3TRZA 2ID0A 1GVPA 2YYZA 1T9HA 5M3FG 1Y14B 2BA1A 3W1BA 4DKAC 1XTDA 3CMAA 2JA6H 2JA8G 2K50A 1TWCH 5J3BA 4P71A 5GAGC 4A75A 2UXBL 3PSIA 1YHBA 2UUAQ 3FP9A 2QGQA 4JI3Q 2R6GA 4DUYL 1MIUA 3S1RH 4NPSA 5LMUL 4DV2L 3T1YL 3KYHC 2AWOA 4QY7A 4ALPA 4DUZL 2OCEA 3ICEA 4A3JH 2VNUD 4JYAL 2CWAA 4JI2Q 1FGUA 4HJ7A 1Q86C 5M5YH 1PA6A 1ASYA 2UXBQ 3I4NG 1PVOA 4DV2Q 1PH2A 4O2DA 3PO3G 4GN4B 2IX0A 2E5LL 2F52A 3U58A 1YJ9A 4UP7A 2KENA 4DUZQ 1LTLA 1N33Q 4LUVA 3E9IA 2IY5B 4BY1G 4LFAL 1VQ4A 5C0XI 2BA0A 1XPRA 3H0GG 2A1AA 3I7FA 3S15H 3H15A 1TWGH 1Q82C 2Z0SA 1WCMG 4EQ5A 1X54A 1DGSA 2PNHA 2JA6G 4A3GH 4TVAB 4LFAQ 4JV5L 4A3FG 3GTKH 4QL5A 4GN5A 3KLWA 4A4IA 5C3EG 2I5LX 3CW2C 1SE8A 3PUXA 4YY3L 1EIFA 1HZ9A 4DV1L 4DV0L 2ZM6L 1L0WA 4JI6L 1HH2P 3G4SA 4IPDA 4GLXA 5C0XJ 3GTMH 2ZTEA 1B7YB 4R4IA 2GVAA 1W2BA 2VUMG 3STBD 1OXSC 3K81C 4IJLA 5M5XH 4DV1Q 1LUZA 4NB3A 4DR7L 3T1HQ 2K75A 2ATWA 1GO3E 1PYBA 4JI5Q 4A3GG 3PUZA 4NXNL 1FJGQ 3GO5A 2NVQH 4GS3A 4GN3B 2XGTA 1N36Q 2JQOA 1S72A 4K0KL 2VL6A 4KI0A 2HT1A 2N49A 2LXKA 1EUJA 2C35B 5IYBH 4JBMA 1J6QA 3J80i 3ZJYC 1UE5A 1JJ2A 1HJPA 4IPCA 4LF6Q 5IWAL 4JI0L 1Y1WH 1HR0W 3M7NA 2UXCL 1G51A 1VQAA 3G71A 3M3YH 1VQPA 3ULPA 2CWPA 4PZ8A 4R4QA 1XNRL 1GM5A 1VQHA 1H95A 3PV0A 4DK6C 1IBKL 1IXRA 3TEHB 3ULJA 1NJIC 4GLVB 1UWVA 1EQRA 3LGJA 1PYSB 1VQOA 4LFCQ 2A19A 3I56A 5ELOA 2N3SA 4DV3Q 1CUKA 1X9NA 1VQ9A 1M90C 1XNRQ 4A93G 5IYBG 4JI8Q 3H3VH 4YCWA 5LMNL 4A3MH 4B3TQ 4ME3A 4X64L 2ASBA 1N9WA 2WB1G 1Z47A 3PF4A 3L7ZC 3GTJH 1VQGA 3VDYA 2HIVA 1Y1WG 3S1MH 2RHQB 4XTCS 3KF8B 3L0OA 3TQYA 3JAMi 1XMOL 2HHHQ 2MQHA 3HOVG 2WAQG 3KDFA 1HZBA 3PIPA 3RZDH 4JG2A 2RCNA 4AYBG 2VQEL 4IOAA 2K4KA 1YIJA 3RLOA 4LF9L 3NELA 2KCMA 4R4OA 2BH8A 4P72A 1KQSA 4NXML 4LUZA 3AFPA 3I4MG 3E0EA 3B6YA 4IFDI 4YHHQ 2VQEQ 2ZJQA 4KHZA 4IPHA 1KIXA 2NVYH 3GTGH 1IL2A 1AH9A 4LF7Q 3CCLA 5IYDH 3A5UA 1JT8A 4NXMQ 5C44G 4KHPQ 1PFSA 2K5VA 2ZJRA 2YV5A 1SFOH 5GQOA 4A3DH 1NE3A 3KDFB 1G6PA 4DV4L 4A3CH 4DV5L 2XTIA 1SMXA 2VS1A 5JEAJ 1N34Q 5C4XH 1BBWA 1QUQA 3OW2A 3NBHB 1WJJA 2K5NA 4GKJL 2AKWB 3I55A 2YU9H 1KL9A 3CF5A 1YJNA 2E2HH 3HOXH 2UUAL 1Q1BA 4HJ8A 4IFDJ 4JI3L 1I94L 1K0RA 2MNAA 5M3MG 4X65Q 4BXXH 2NVXH 4DK3C 4JI2L 1GD7A 3K8AA 1E7ZA 1VQLA 3HOWH 4OO1G 3A74A 5IYDG 4DV6Q 3HOYG 1Y1VH 2HIXA 3F2BA 2AMCB 2K52A 1QUQB 4P75A 3PIOA 1N33L 3KJPA 2R7ZH 4A3DG 1N8RC 1EIYB 4HIKA 2B3GA 2CQOA 2MFIA 4B3MQ 4LW1A 1Q12A 4LF4Q 1UE6A 4AQYL 3A5ZB 1OTCA 1VQ6A 2H5XA 1LM0A 3PUVA 3GDEA 3CC2A 1N32L 1E22A 3BJUA 5GAHC 3DM3A 2JEBI 2NN6I 3E9HA 1VQ8A 4P74A 1YZ6A 4DR6L 4BXXG 4AQYQ 1IBMQ 3J7ZC 1N32Q 2Z6KC 4YCVA 4OXPA 2Z6KA 2Q2HA 5C0XG 4P73A 3HOWG 4GKJQ 5HY6A 4X6AH 2E2JH 1Y1VG 2I0QA 1VS0A 4DR6Q 1D7QA 4A3JG 3IRBA 5FJ8H 2IHFA 3BZKA 4YWMA 1YITA 1K3RA 3AEVA 2F4VL 4YCUA 3T1HL 1PH8A 4XIGS 3RZOH 2WB1E 3PO2H 2YTYA 3I4MH 5E7NA 2UXDQ 3PGZA 4A3BH 4JI5L 4BY7H 4GOPC 1HZAA 2R92H 4GOPA 3CD6A 3M85A 1AE3A 1FJGL 1GKHA 4BBRH 2F4VQ 5DLQE 4BA1I 3CCJA 1NMGA 2WAQE 4IOCA 3RN5A 1N36L 2JA5H 1X6OA 4TQUS 1J5EL 2GVBA 3S2HH 1I94Q 2I5MX 2UU9L 2A8VA 4R4TA 4HIDA 5K36G 4LF6L 1KHIA 1HNXQ 1JJCB 5HGQA 1J5EQ 2K14A 1OXVA 2PI2E 3KF6A 4YWKA 3HKZG 1VCIA 3U4VA 3G48A 2VQFL 1OXTA 2UU9Q 4UP9A 2OWOA 3KJOA 1RIPA 1FVIA 4GOPB 2CCZA 4L5QA 3OYYA 3GD7A 3PO2G 1I50H 3STBC 2VQFQ 2JE6I 4A3BG 3KOJA 4KLKA 1UE7A 2R92G 4HJ9A 4QQBX 5LMNW 4X66Q 4Y52H 4BBRG 1XPOA 3HKSA 2K5HA 4LUOA 2JA5G 4DR5Q 4LFCL 1E1OA 4X62Q 2D0OA 4PZ6A 4DV3L 3S2DH 1HZCA 1VQCA 3M4PA 3BU2A 4JI8L 3UDGA 3TS0A 2KCTA 5C4JH 3KF6B 1VQIA 3CMEA 4B3TL 3J7A5 4A3LH 2CFMA 3HFZB 1WYDA 1PHJA 3RLNA 2AWNA 2MO0A 1SLJA 4Y7NH 4A3KH 1YI2A 4LF8Q 2HHHL 4BA2I 1AE2A 3PF5A 3F1ZA 1OXXK 2LSSA 5JJLA 1NMFA 3U50C 4JI1L 3I4OA 4MTNA 1NY4A 1B70B 3ERSX 2Q2TA 2JEAI 1XJVA 2PMZE 4B3SQ 3CXCA 4LFBQ 4DNIA 5IY0A 4YHHL 1QVGA 4JI1Q 3S17H 1VQMA 4JI7L 2KHJA 4H02A 4J15A 1I5FA 4UY8C 2EIFA 5GROA 1FL0A 1YBYA 1Q7YC 2UUCL 4LF7L 1VQBA 2AHOB 3M4QA 4KHPL 3CC7A 4EX5A 1HR0L 5IYCH 4OX9Q 1Q81C 3KFUA 4JI7Q 4JI4L 5JEAG 3ER0A 2NVTH 4C3IH 1SRUA 1YHQA 2UUCQ 2IX1A 3GTOH 1PH5A 1Q1EA 3CCUA 1N34L 1A63A 4A3MG 1HR0Q 5H1SE 2OTJA 4IFDG 1TWHH 4PZ7A 2LXJA 1L1OC 4JI4Q 4HIMA 1L1OA 3HOZH 4BBSH 3K7AH 3HOUH 4DR1Q 5ELNA 4MNOA 1QZHA 2B63H 2FXQA 1Q8KA 1C9OA 4X65L 1W3SA 2BH2A 2IHEA 1MJEA 3GTLH 1HNWL 1QVFA 5M3FH 1IZ6A 4UP8A 4DV6L 4A3EH 4GKKQ 1UE1A 4HJAA 1SR3A 3UE1A 1NTGA 3CPFA 1JMCA 2IT1A 2CKZB 4DAYB 1CSPA 3ULLA 1EQQA 1IBLQ 1CKNA 3OTOQ 4L5TA 1HNWQ 4LF5Q 4IO9A 1L1OB 2KBNA 1PH4A 2JA9A 4DV7L 4JBWA 2ZTCA 3L2PA 4DR3L 3NEMA 2N78A 5BR8Q 4GNXC 4B3ML 4GNXA 4LF4L 3I4NH 4AIMA 3S1NH 1V43A 1CKOA 4OWXB 1B8AA 3PO3H 1V1QA 1LYLA 3F8TA 1HNZQ 2ZTDA 3HKZE 3HOZG 3WWVA 3AQQA 1VQ7A 4BBSG 4A3CG 2EQSA 2NZOA 3HOUG 1X65A 3CCRA 4DV7Q 2PI2A 4DR3Q 5C4XG 2UXCQ 1K8GA 1KRSA 2F3IA 1IBML 2V1CC 1WCMH 4A3IH 1VQNA 3HOXG 2MO1A 2QA4A 1WI5A 1CKNB 3BZCA 3M9BA 3UDIA 1BVSA 4A3EG 4DR4L 2OQKA 4A3FH 1O7IA 3S16H 4LNQA 4O0AA 1S3OA 4A76A 1VQKA 2R93H 4DAMA 1EWIA 5EAYA 3W5OA 4GNXB 1P16A 2YTVA 1TXYA 2WP8J 5C3EH 4DR4Q 1KAWA 1C7YA 4WJ3M 3K0XA 2UXDL 4QJFA 1Z9FA 2NN6G 2D0PA 4AH6A 3CCQA 1UEBA 4DUYQ 5LMUQ 2I5HA 3T1YQ 3TREA 2R7ZG 1JJGA 5FLMH 2GN5A 2RF4A 3J81c 1RL2A 1E3PA 4JCVE 2VZAA 4UPAA 1KC8C 2Y0SG 1VQ5A 2VUMH 1C0AA 4JYAQ 2E8GA 3RLFA 4HIOA 1YJWA 1KD1C 2E5LQ 4JBKA 4IJHA 1I6HH 1MJCA 4A3IG 4C3JH 4C2MH 1X3GA 2JK8A 1L2FA 3MEFA 4AYBE 2R7DA 1HNXL 2OQ0A 2DUDA 2R93G 2PQAA 3CCSA 2ES2A 4WJ4A 1PH3A 3PUYA 2Q2UA 5GADC 1X55A 1MKHA 1K9MC 1U5KA 4JV5Q 5JJKA 4PMWA 3AFQA 4FDBA 4YWLA 5FJ8G 4QIWE 5FLMG 4GLAC 4X66L 2DGYA 5IP7H 4YY3Q 4DR5L 4DV0Q 2ZM6Q 1EFWA 3FKIH 1V9PA 4X62L 4JI6Q 3TS2A 4IPGA 1VQJA 5M5WH 4BY7G 1R9TH 2WFWA 2N8NA 2PQAB 2NZHA 1E1TA 1KRTA 1I3QH 4RG1A 3UDFA 3PCOB 3F2DA 3CCEA 1YVCA 4DPGA 4DR2L 4DR7Q 1M1KC 1XPUA 4LF8L 1K73C 3CAMA 2RHSB 1WFQA 4A93H 1XMQL 2UUBL 4NXNQ 4DR2Q 3S24A 4L5RC 3FHWA 5AJ3L 4K0KQ 4JBJA 3A0JA 4POFA 4B3SL 2VW9A 4R1JA 4LFBL 3PUWA 1K83H 3MXNB 5IP9H 3CC4A 1XMQQ 2UUBQ 4OWTB 3AYHB 3RR5A 5IP7G 1PH1A 3RNUA 4B3RL 3HOVH 4RMFA 3FKIG 1VQDA 1PH7A 1JB7A 1XNQL 5AJ3Q 1S40A 3CQZH 1SROA 2L15A 2VY3A 5IWAQ 4MZ9A 2E2IH 2Q2IA 4JI0Q 3S1QH 1EOVA 4POGA 4OX9L 1BKBA 5GAEC 4B3RQ 3Q8DA 2YTXA 1XNQQ 3SGIA 1JE5A 2HQLA 2OTLA 2B29A 3D0FA 3UDXA 3M4OH 4PG3A 3CP0A 2KHIA 1A0IA
chains in the Genus database with same CATH superfamily
1E2VA 3I91A 5ELEA 4NP5A 4OWWB 5FOBB 1D6EC 3CPWA 1U4RA 3U4ZA 4KD3A 4DR1L 1CSQA 1QOHA 3Q6SA 1TY0A 3NENA 2LY7A 1HFNA 2A73B 3RN2A 4FF1A 1A62A 2A6HD 5K5PA 4IUUA 5I9OA 4L5SA 1YNXA 3CKIB 3K80C 4ILWA 2RBMA 1VDZA 3DLLA 2O5IC 5IOCA 4JOIA 5IGGA 2JA8H 3GTPH 5M5WB 4IQZA 4LF9Q 1AW7A 1X3FA 2FHTA 5IYCG 4OONA 1HNZL 3D31A 1PV4A 4I65A 1QZGA 3NTKA 4N8FA 2ZJPA 1T5EA 1YHAA 1DJRD 2F0UA 1ASZA 1PMRA 4C3HH 2JA7G 5IT9c 1H9RA 1Y8OB 2WB1B 2QDLA 2KCCA 1X56A 2KECA 4DV5Q 2B63G 2XVSA 3H3VC 4OO1I 5FLXc 1Y1WB 5CV9A 1GVPA 5M3FG 3SEBA 3W1BA 1JWSD 3LWEA 1ILQA 2XNAC 1ESRA 4AYBB 1TT2A 5GAGC 5C0XH 2UXBL 2UUAQ 2EE1A 2LKVA 2R6GA 3BDLA 1Q90A 2K04A 4DUZL 5FKAC 3I73A 4QMGA 3I4MB 2E2DC 1PA6A 3ERQA 1Q86C 4JYAL 2F3WA 1PH2A 2F52A 2PNRC 2KENA 5C44B 3E9IA 3NBIA 5I2YA 2BA0A 3H0GG 3IKJA 3BVZA 3I7FA 4KKUA 4QCLA 1Q82C 1KNEA 1U4PA 1KDBA 2PNHA 4TVAB 4LFAQ 3GTKH 2Q8IB 1VF5C 1TWAB 4GN5A 2X6LA 3KLWA 5C3EG 2A6EC 3PUXA 1SYCA 1L0WA 3G4SA 3T51B 2B2UA 5LL6S 4CDDC 4GLXA 3E0JA 1BF4A 2JSOA 2EZVA 3NTHA 2VUMG 2OF1A 1ENAA 4YIJA 1JOKA 5C4XB 1WD1A 1PYBA 1KDAA 4KI0A 2N49A 2H1EA 3C3LA 3GV3A 3M7GA 1LTBD 3HOWB 5IWAL 4JI0L 1V1PA 1Y1WH 1KDCA 1LTID 3M7NA 2F0NA 3G71A 5BN4A 3SK4A 2Z8LA 2EPBA 2NWGA 1IBKL 3DHQA 4RGOS 1UWVA 1EQRA 4KY6A 1F2YA 2A19A 2EYHA 1X9NA 1GJXA 1CUKA 1XNRQ 5LMNL 4X64L 4CJ1B 1N9WA 1IYVA 3I90A 1FD7D 3L7ZC 1S4ZA 1ZYRC 2WKCA 1I6VC 1EY9A 3JAMi 3HOVG 2WAQG 1B9NA 4J1MA 4CKEA 2VQEL 3PO2B 3NELA 2BH8A 1TVXA 2F0MA 4NXML 3NQIA 3FVQA 2JA5B 1Q3LA 1IL2A 5IYDH 3A5UA 2HDLA 2K5VA 2F0HA 3OW7A 5GQOA 1TR5A 3KDFB 1EYAA 4WJWA 5C3XA 1J8IA 5KGUA 2VS1A 5C4XH 3OW2A 5EBDA 3NBHB 4GKJL 1V8QA 3I55A 1KL9A 5CORA 4IFDJ 1I94L 1DYQA 3JAME 4BXXH 4TRDA 4X65Q 2NVXH 5EQ0A 1ENFA 4DK3C 5KEEA 2ZXRA 4CJ0B 4HCSA 1E7ZA 5IGFA 3HOWH 3OWFA 1PDQA 3HOYG 1QUQB 4P75A 1N33L 3A56A 2K5WA 1DXMA 4ZLTF 1BR9A 3OWEB 1VQ6A 3PUVA 3VR5A 2F0LA 1E22A 5E4WC 2RDFA 4CDCC 4C1NI 5GAHC 2RKSA 4DR6L 1IBMQ 2Z6KC 2HCIA 3V2TA 3UI2A 4X6AH 2A6ED 2E74C 1D7QA 3VR3A 2IHFA 4IN3A 4YWMA 1YITA 3AEVA 3GTGB 4YCUA 3T1HL 2A68C 4C3IB 1EIHA 5CC4A 3PO2H 1MBYA 2EYFA 4F7XA 1HZAA 3CD6A 4GOPA 3M85A 1AE3A 4X3KA 4KK7A 1FJGL 3RN5A 3I72A 5IGBA 4IOCA 2WAQE 1N36L 2JA5H 1X6OA 2L5TA 2IPKD 3WOFA 4BWGB 5CGKA 3S2HH 4XQNA 5BN5A 2UU9L 2A8VA 3OMCA 3HOXB 5K36G 3EVQA 1HNXQ 2RVLA 1OXVA 2PI2E 4YWKA 2VQFL 3HKZG 2Z4IA 3C1FA 1OXTA 3KJOA 1M8AA 1RIPA 1FVIA 3H91A 2CCZA 4L5QA 3GD7A 1I50H 5G3LD 3STBC 4NMZA 4HMIA 4A3BG 3KOJA 2R92G 1F9QA 2Z4HA 5LMNW 3FDTA 1DCZA 2K5HA 4DR5Q 4F88A 1E1OA 2D0OA 5KYLA 1VQCA 4H0LC 2EYLA 4JI8L 5KYIA 1RKNA 2NB0A 4B3TL 3KF6B 3CMEA 4A3IB 4A3LH 3HFZB 4CGYB 4KKTA 5JEAH 3A8JE 3EROA 2PYKA 2HHHL 2E76C 4BA2I 1AE2A 3MC0B 4X3UA 3F1ZA 1OXXK 2F0TA 1ZYRD 2PMZE 1SAPA 1STGA 4DNIA 5EBCA 5IY0A 2B2VC 2EIFA 1JE4A 1BCPB 1VQBA 2AHOB 3CC7A 4EX5A 1HR0L 1E2ZA 1EWCA 2XSCA 4PQXA 2PZWA 5EGTA 4C2MB 3KFUA 4C3IH 1SRUA 2IX1A 4IURA 1BBXC 1Q1EA 1B3AA 2OTJA 1TS3A 4IFDG 3TMEA 4PZ7A 4JI4Q 4HIMA 5JVH3 3TP8A 5IGEA 2Z1CA 3NUCA 1JCKB 2BH2A 1MJEA 1JB3A 3DWAA 3J7YW 3FKIB 2EJFC 4GKKQ 1SR3A 1LABA 2CVRA 2IT1A 1EQQA 1CSPA 3ULLA 1IBLQ 3OTOQ 2ZXOA 1L1OB 1LT5D 1PH4A 2JA9A 2NN6H 3NEMA 4GNXC 1BDOA 1V43A 4ZAIA 3HKZE 4BBSG 4A3CG 3W3AA 1EY8A 1VQ7A 2EQSA 1TS4A 1X65A 1SYGA 3CCRA 3BYTB 4DR3Q 1K8GA 2F3IA 1WCMH 4A3IH 2LMCB 1VQNA 1WI5A 4DR4L 2EJMA 3UDIA 1BVSA 2CW0C 2OQKA 4A3FH 4LNQA 2HUGA 3WDNA 1VQKA 2E2IB 2G9DA 3P75A 1P16A 1KAWA 5I6YA 3DWPA 3K0XA 5C6AA 2UXDL 4QJFA 3CCQA 1UEBA 3T1YQ 2L4NA 3AU7A 4RH6A 2RF4A 3J81c 2A68D 1E3PA 5NUCA 1B3QA 1RHPA 2Y0SG 1KC8C 3KK7A 2E8GA 4DGZA 4K2KA 3BS1A 1KD1C 1TWHB 3TP7A 2ENBA 2VXWA 1I6HH 1MJCA 2BE5C 1X3GA 4C2MH 4HMJA 1Z7TA 4CDEC 5A35A 1CTMA 3A8IE 4R8IA 5C4HA 3GTLB 3MXGA 2Q2UA 5M3MB 1WTPA 4JV5Q 2J0TD 1TWFB 4PMWA 1B1ZA 2XIWA 4YWLA 5FJ8G 4QIWE 3FEWX 3JAML 2DGYA 2ZM6Q 3FKIH 3URYA 1IHZA 3MXNA 4BY7G 3PO3B 2PQAB 1F77A 1E1TA 3OPOA 1X3QA 2R61A 3MXPA 4BY1B 1QJOA 1KTKA 5IODA 1STHA 2RHSB 1WFQA 4A93H 5JPNC 1HQRD 1BCPC 3S24A 4K0KQ 1EY7A 4JBJA 3A0JA 4POFA 4C56C 4B3SL 4QUCA 5IP9H 3CC4A 1UAPA 4OWTB 3RNUA 1WTQA 4RMFA 1XNQL 1S40A 2BCOA 1SROA 2E2IH 4MZ9A 3H6MA 2Q2IA 2FMMA 5I6WA 3Q8DA 2YTXA 3NP8A 3SGIA 5J1ZA 4QF4A 3D0FA 3UDXA 1QE6A 2EYPA 3S15B 3CP0A 2KHIA 1A0IA 3OHXC 3VYRA 3F2CA 4A3GB 3TN2A 5EKIA 1CHPD 2CH4W 4A3KG 4R4CA 2QEXA 3EN2A 3NWTA 3J81j 3PIP3 1VQEA 3EBEA 3K5LA 2Y0SE 1P8LA 1TU2B 1NBWA 4O1NA 1YNJC 2JJQA 1LT4D 1XMOQ 3FPPA 1SNQA 4LF5L 5M3MH 1PH9A 3GTQH 1TWFH 3D6WA 2EXDA 5EKLA 3G6EA 4OO1H 3K7UC 1I3QB 4APVA 1BBUA 2QEJC 3BVMA 3EQLC 1EZ6A 1MD2D 3I70A 1K8AC 4JC0A 4BY1H 1SJED 1KXLA 3BYYB 2QF7A 1C4QA 2YYZA 3RD4A 4DF7A 1Y14B 1DOLA 2WV6D 2JA8G 1CZGA 2K50A 4P71A 3CQZB 4JI3Q 3BDOA 1MIUA 4NPSA 4V0BA 5LMUL 4ULLA 4QY7A 3PIO3 3J80L 3TZDA 2OCEA 2EY1A 1F9PA 4A3JH 1JR0D 2RCFA 1FGUA 1ASYA 3I4NG 4GN4B 2E5LL 4UP7A 1LTLA 4I7AA 4LUVA 4UDUC 1SYBA 4LFAL 1VQ4A 2A1AA 4CHTB 3S15H 2Z0SA 2BE5D 1X54A 1PTOF 1MSHA 3IAYA 1KLGD 4A3GH 3RZDB 3K6OA 4QL5A 2KEEA 5C3WA 2L9HA 1SBBB 1SE8A 4YY3L 1HZ9A 1S5BD 3GTPB 4DV0L 4JI6L 1HH2P 2NVYB 3L3OC 3MXUA 3GTMH 2F0SA 3G6JB 1CA5A 2GVAA 4L6TB 1W2BA 2JXMB 5M5XH 1DZ1A 2JN4A 4V190 4A3DB 4TKOB 4ME5A 5JJZA 5KNDA 1GO3E 3I4LA 3I8ZA 4C3HB 4K8JA 3HEJA 3A55A 3OOCA 4NXNL 2F0GA 4GN3B 2JQOA 2VL6A 2HT1A 1EUJA 1BCPD 2C35B 3K5MA 1AN8A 1F2ZA 1J6QA 1ICFB 1FYCA 1JJ2A 5CR3A 4LF6Q 1I4GA 1CFMA 1A3UA 3QJYA 1VQAA 3M3YH 1VQPA 1H9SB 4R4QA 1XNRL 1GM5A 4L63B 5LL6X 1EU3A 4DK6C 1NJIC 4GLVB 4XT1B 1PYSB 4LFCQ 4DV3Q 3I56A 5ELOA 3H3VH 1U4LA 4ME3A 2ASBA 4RCOA 2WB1G 3GTKB 4N9PA 1VQGA 2F0DA 1Z6HA 2HIVA 1Y1WG 3HG9A 3KDFA 1HZBA 3RZDH 2RCNA 4AYBG 2FINB 3D8GA 1YNJD 2KCMA 4R4OA 3NBHA 4LUZA 1F2MA 4ZKBB 3I4MG 1JQYD 3B6YA 4IFDI 1U4MA 1EY0A 4IPHA 4KHZA 2NVYH 3SHLA 2PZUA 3VR6A 5C44G 2ZJRA 4EQNA 4A3DH 4DV4L 4K6LA 5JEAJ 1QUQA 2PCFB 5COYA 1XYIA 1DM0B 1WJJA 2IWHA 5IT9E 1Q1BA 4HJ8A 2QDBA 2MNAA 5FLXE 4JI2L 4J6HA 1BXTA 1VQLA 1A15A 5IYDG 1FNWA 1EFID 2HIXA 3HRZC 2RDGA 1G91A 5C4JB 2R7ZH 3CRLC 2B2YC 3KJPA 3IFTA 2B2TA 1EIYB 2SOBA 4KY5A 5CV7A 3QWNA 4B3MQ 4LW1A 1MHWC 4RKLA 2K6AA 2MJ8A 3A5ZB 2H5XA 1LM0A 1KABA 3L9AX 1IL8A 3BJUA 1IKLA 3DM3A 4DXFA 5F2DA 2D2CC 2HDMA 4P74A 5EKKA 4BXXG 3EFXD 1HHVA 3J7ZC 3MA2B 3S17B 3CRKC 4P73A 3HOWG 2SEBD 1WVLA 2I0QA 1IYUA 2AUJD 1SMYC 3I3CA 3ND8A 3GTOB 4XIGS 2IX3A 4MIUA 2WB1E 2YTYA 1LT6D 2ICEC 5E1FA 5KNBA 5E4XA 3PGZA 4JI5L 3D3RA 2M2LA 4HSPA 2F4VQ 1NMGA 4TQUS 4LMQD 2GVBA 5L37A 3J7AF 3G7LA 1KHIA 2ICIA 1JJCB 1J5EQ 1NAPA 3AB9A 3KF6A 4J8QA 2OWOA 3H09A 2NVXB 2J4XA 3OYYA 4KMUC 3PO2G 1A6XA 5BN3A 2RA4A 5EPJA 2JE6I 1UE7A 4RGTA 4X66Q 1XPOA 4FF3A 1A2TA 2JA5G 1B53A 1IKMA 3QG1A 3M4PA 3BU2A 4C1NK 1STNA 5C4JH 3TS0A 2PQEA 1PHJA 4K8IA 1DONA 1GUOA 3RLNA 2AWNA 3A8KE 4NDXA 1K8OA 2CQAA 1D5MC 3EJIA 3S9WA 3VR2A 2E75C 3PF5A 5JJLA 4B08A 2Q2TA 4RA8A 3TP5A 2JEAI 4LFBQ 5IIFA 4YHHL 4ZKCB 2VUMB 3S17H 2MPMA 2KHJA 1HTLD 1I5FA 5GROA 4LF7L 1YBYA 2JP1A 3N52A 5CYUA 4KHPL 2XWBB 4IUNA 5IYCH 3NPPA 1Q81C 3LWUA 4HAEA 5JEAG 2K5QA 1B4OA 4JI4L 3GTOH 4R8NA 2KEDA 3S2HB 1N34L 1A63A 4A3MG 3X3NA 1S5ED 2LXJA 3SE0A 1L1OA 4JVZA 4DR1Q 3MFYA 1DOKA 4MNOA 2BDNA 3RUZA 2B63H 2G9HD 5C4ZA 1WTVA 2K05A 5M3FH 1QVFA 1I50B 4DV6L 1UE1A 4IZ8A 1NTGA 3K59A 2D9UA 4L5TA 5I9PA 4IO9A 4C3IG 2XN9C 1PRTC 2ZTCA 4JBWA 3L2PA 4DR3L 4LF4L 1GUTA 3S1NH 1CKOA 2RQXA 1HNZQ 3WWVA 3AQQA 4O42A 2NZOA 4FXKC 4DV7Q 4NW2A 2UXCQ 4ZUJA 1KRSA 2V1CC 3D6CA 4KN7C 4N8X1 3HOXG 3HOVB 1AEXA 1CKNB 4F87A 2HQEA 5EAYA 4GNXB 1TXYA 5C3EH 2OT2A 4WJ3M 2NN6G 2D0PA 4AH6A 1SYFA 4KKSA 4WORA 2BDOA 1GUNA 4MN3A 2F4IA 4UPAA 1VQ5A 2VUMH 3BDCA 4JYAQ 2IW3A 4HIOA 2AQ1B 1O7ZA 4JBKA 4A3IG 3Q24A 2DY8A 2PQAA 2QILA 4WJ4A 1PFNA 3PUYA 1ZEQX 1X55A 1K3BC 1BOSA 3MWYW 5IT9L 5EPLA 1QWYA 2EYMA 1MGSA 3AFQA 5D3DA 5FLXL 1SJHD 5KIXA 2NZ1D 4DU9A 2MUYA 1SE2A 4X62L 1EOTA 2ZT9C 1PRTF 4IPGA 1R9TH 2L55A 3DEOA 2WFWA 1E2WA 3S14B 3PCOB 2H4OA 5KRUA 1YVCA 1ESFA 1XPUA 1LTSD 4LF8L 3CAMA 4IUTA 1B44D 1GUWA 1WCMB 3D4DA 1NR4A 5C5MA 4MHEA 2A69C 2JA6B 4DR2Q 1TWCB 4A3FB 3HZXA 2NTSA 4PMCA 4R1JA 1K8MA 3R93A 3S1RB 1K83H 1RCVD 3A7AB 1XMQQ 2UUBQ 1HPCA 2G5DA 4K6DA 3FKIG 1PH7A 3HOVH 4RHRA 3DUZA 2MP1A 5IWAQ 2L15A 4JI0Q 1SNMA 1EOVA 4XQJA 4OX9L 1BKBA 4DN4M 5GAEC 4B3RQ 2B2WC 2OTLA 1JE5A 2HQLA 3M4OH 1TWGB 1I6HB 2R3ZA 3HS0C 4LWCA 1NUCA 1IBKQ 1LV9A 1VQFA 1Q46A 1STEA 1CT1D 1W6KA 5IP9G 3J80c 4H44C 3SK8A 5LMNQ 4HSVA 4X64Q 3M4YA 1CHQD 1S5CD 3P20A 3MVVA 3W1GA 4JOIC 1C8CA 4CBVA 1O78A 3HGBA 5LHY1 5BR8L 2RDHA 5T1GA 3DEPA 2ALYB 1D8LA 3HOYH 3F2UA 3T4AC 3QOJA 1ET9A 3J81i 3EIVA 1QVCA 2K32A 2D62A 4DFAA 3SXHA 4A93B 2AQ2B 5JJIA 3S14H 1ENCA 2C9OA 3NE5B 2ID0A 1T9HA 4GKJQ 2JA6H 1XTDA 2PW5A 1TWCH 5D14A 3Q0AA 4A75A 3FP9A 3S1RH 4DUYL 3C1EA 1I94Q 5CMDA 4ALPA 1K0SA 2EJGC 1QG7A 2F1MA 2VNUD 4HJ7A 4DV2Q 3PO3G 4FNFA 2IX0A 3VA5A 1YJ9A 2EY5A 5TSSA 1N33Q 2N55A 3J81E 1CA6A 4BY1G 1XPRA 2DN8A 3MZ5A 1TWGH 3NQTA 3S1MB 1DGSA 4B9WA 2F03A 1AZPA 1B9MA 3SR1A 1H9KA 4HTHA 5K36H 4A4IA 2B39A 3BZDB 3CW2C 1O7YA 4JW0A 3GTQB 1SNOA 1UUPA 1SXTA 2B2UC 3QOLA 5C0XJ 1ILPA 2ZTEA 1B7YB 4R4IA 3STBD 4DV1Q 1PXUA 2Z9HA 4NB3A 4DR7L 3T1HQ 1CZWA 2K75A 4I7ZC 1M4VA 1UNSA 1LT3D 2P5ZX 4A3GG 2EOTA 1PTOH 3PUZA 3PMFA 1FJGQ 1H9SA 1RD9D 4GS3A 1WTOA 3VYTA 1N36Q 1D1IA 3OMGA 2WACA 1SNPA 1NNXA 1YNNC 3FMCA 2Q8TA 5IYBH 5FK9C 3ZJYC 1UE5A 3KBGA 3HP3A 1Y1VB 1HR0W 4A3JB 1WTXA 1CI3M 2L12A 3V05A 2K7VA 2AUKA 1BO0A 1VQHA 3PV0A 3IFDA 1KLUD 2IJ0A 5HURA 1IXRA 2F0VA 3LGJA 5EPKA 1RODA 2N3SA 4KHVA 1M90C 4JI8Q 1V1OA 4B3TQ 2I07B 3GQBA 3TZUA 3VYSA 3ONAB 1Z47A 3PF4A 1WD0A 3E6ZX 2E2JB 1JWUD 1PTOC 3S1MH 2RHQB 3KF8B 3L0OA 3TQYA 2HHHQ 1R4QB 2MQHA 1CK1A 4IOAA 4LF9L 3GTMB 4P72A 1IW7C 3KLSX 5M5XB 2K5DA 4DK1A 3E0EA 1SNCA 4BBRB 1KIXA 3CCLA 1JT8A 1JOOA 1J9OA 1PFSA 1SFOH 4QB4A 4A3CH 4RGMA 4DV5L 2XTIA 3FRPB 2XRQD 2A6HC 2O4XA 2K5NA 3D4RA 2YU9H 1TQOA 2E2HH 2UUAL 3CHBD 4GZYC 3MTSA 4KV6A 2CW0D 4RFBA 3M3YB 1D5ZC 1RTOA 3A7LA 1GD7A 3NXWA 3K8AA 4DNTB 3S2DB 1FR3A 2EDGA 1Y1VH 2L11A 4XT3B 2F0KA 2K52A 4S3SA 4A3DG 5FO7B 4U673 1N8RC 1SDFA 1Y69U 3DWQA 1JICA 4WRDA 4G7OC 1JOQA 4C3HG 4FXDA 2N88A 1UE6A 2CH4A 3SVMA 3VA7A 2LFNA 3GDEA 3PQIA 4R9WA 2JEBI 2NN6I 5T1IA 4B9XA 4AQYQ 1F9SA 1PZKD 1N32Q 4YCVA 4OXPA 2Z6KA 5C0XG 4ZRZA 2E2JH 1VF7A 1PZID 1VS0A 5JOBA 2KHSA 5FJ8H 3RZOH 1K3RA 2F4VL 3KLRA 5CV4A 3NWSA 1PH8A 2UXDQ 5E7NA 4ZK9B 4BY7H 5I4DA 4GOPC 5DM73 1CM9A 4BBRH 3HOZB 4BA1I 3CCJA 1RJTA 3HOUB 2JYOA 1J5EL 5FO9B 3N6RA 2V4DA 4LAAA 4A3EB 1VCIA 1A2UA 3U4VA 1STYA 3H94A 4OIJA 3VR4A 1O80A 2KJXA 3DMUA 4KLKA 4QQBX 4HJ9A 1NR2A 2F0EA 2R7ZB 4Y52H 1I4HA 3HKSA 1RDPD 2K01A 3S2DH 4PZ6A 4IUVA 4IALA 4IUQA 2CFMA 2LS01 3SK5A 1SLJA 4A3KH 2R93B 1G2TA 4UHVA 5JAVA 1X32A 2LSSA 1PTOD 4MTNA 1NY4A 2Q8RE 1HXYD 4B3SQ 4PNYA 1TKWB 3QIAA 4P2CB 2VB2X 4JI1Q 1Y8PB 2B2VA 4UY8C 3NHHA 1FL0A 1Q7YC 3WOEA 3M4QA 1FNVA 4C3JB 4HCEA 4JI7Q 3QB3A 1SE4A 3ER0A 4OHJA 2NVTH 2UUCQ 2DY7A 1XXGA 2X6GA 3CCUA 5H1SE 4XDXA 3HOZH 1PZJD 4CKCA 3HOUH 2DNCA 5ELNA 2RSOA 1PLFA 3IL8A 2FXQA 1Q8KA 5ELBA 4X65L 1W3SA 3W2DA 3T53B 1IZ6A 4UP8A 5ELDA 4A3EH 4HJAA 3UE1A 3CPFA 4HN7A 4DAYB 1HNWQ 1CKNA 3KUPA 4LF5Q 4RWSC 2KBNA 4M8AA 1VMPA 4DV7L 2KA7A 2N78A 3I4NH 2AQ3B 4GNXA 2UXCL 1LYLA 3QO2A 2FMCA 2NUCA 1HQMC 1TS2A 2PI2A 1Y8NB 1F2LA 5C4XG 2KCNA 1IBML 2C5CA 1A3TA 2QA4A 3M9BA 3BZCA 2WIIB 1LTTD 4A76A 1S3OA 3MHBA 1STAA 2R93H 1WTWA 1PRTB 1OO9B 3W5OA 2ZXPA 5IGCA 4JPBW 4KN4C 3X3MA 1JWMD 5LMUQ 2I5HA 1HFGA 3TREA 5FLMH 2GN5A 1RL2A 1C0AA 1TIID 1B50A 3U9SA 1YJWA 2E5LQ 4IJHA 4C3JH 2JK8A 4DA2A 2JA7B 4AYBE 1HNXL 4JK1C 2OQ0A 2DUDA 2B63B 2ES2A 4G7HC 5CV5A 5GADC 2K1BA 5M3FB 1K9MC 4WFN3 1U5KA 2X69A 5JJKA 1H9JA 1DOMA 2VB3X 3V96A 2PPBC 5IP7H 4YY3Q 4DR5L 4DV0Q 4JI6Q 3TS2A 5M5WH 3S1NB 4PV1C 3U9OA 1HTPA 1QCBD 1KRTA 2KVMA 3UDFA 5DNFA 3CCEA 4DR2L 1M1KC 3H0GB 1K73C 2GA4B 1GUSA 1XMQL 2UUBL 3RMHA 4NXNQ 5HGTA 1WTRA 3FHWA 4L5RC 4CKBA 2NBFA 2Z6BA 3LNNA 1EEFD 4LK1C 5C3EB 3RR5A 4B3RL 2SDFA 5AJ3Q 5M5YB 1X3PA 4TSSA 2EYJA 2EVBA 3I4MH 1VMCA 3MEHA 4IJLA 4QGUA 1ZKOA 1OXUA 2F0QA 4A3LG 5C44H 3JC66 2HCCA 3K57A 4FXGC 1EQTA 5M9OA 1EWHA 1E24A 5D65A 1PH6A 3D4WA 1SN8A 1U0LA 2JA7H 3T13A 1PFMA 4GKKL 2R7FA 1TWAH 4CJ2C 1I4PA 4OGQC 1SYDA 1IBLL 3H3VI 2K28A 3OTOL 3CU7A 1YEZA 1A8VA 3UE0A 1IYJB 1X3EA 1BNZA 1R9TB 1STBA 1XX8A 2MGSA 2F0PA 2FFKB 1CKMA 1L0YB 1XWEA 1G291 2OEOA 1EYGA 5I2XA 5A2QE 2NVQB 2QW7A 4M1UB 4L8JA 1WOCA 3E5SA 5D3IB 3CCMA 5IE8A 2KQ3A 4RKBA 5CBAE 4XXEA 3I2ZA 4IUPA 4DV4Q 1HUNA 1S5DD 3H0GH 1SEBD 1K83B 3JAMc 3CCVA 4HJ5A 2F0OA 3TRZA 4FYDA 5G3LF 3NK9A 2BA1A 2WAQB 4DKAC 3CMAA 4N9TA 5J3BA 4KD4A 4XQQA 3PSIA 1YHBA 2QGQA 3KBXA 2J7ZA 4DV2L 3T1YL 3KYHC 2AWOA 3R8BA 3ICEA 3M4OB 3DM1A 2CWAA 4JI2Q 2UXBQ 5M5YH 4KJOA 1ONLA 3R3OA 1PVOA 3J7AV 1SMYD 4O2DA 3U58A 4DUZQ 5ISRA 1A3VA 4A3MB 3ITPA 4OEMB 1I4RA 5JPMC 2IY5B 3OSOA 5C0XI 4Q0FA 3GTJB 1SSOA 3ND9A 4RHSA 3E3XA 3H15A 1WCMG 4EQ5A 1DD2A 2JA6G 4JV5L 4A3FG 1G2SA 4K2LA 4X3TA 1RTNA 5AFWA 2I5LX 2BOSA 1ZXTA 1H9MA 1EIFA 2F0FA 4DV1L 2ZM6L 4IPDA 5DEHA 3HOYB 3ZYYX 1LTGD 1ML0D 1AFPA 1OXSC 1I4XA 3K81C 1LUZA 5JVG3 4EQOA 2PMZB 2ATWA 1AP0A 4H7BA 1NCVA 2PW7A 1D1KA 4K5WA 4JI5Q 3GO5A 2NVQH 2XGTA 3C2PA 4K0KL 1S72A 2LXKA 4XYQA 4JBMA 3DXJC 3J80i 5J39A 1R4PB 2F0JA 1HJPA 4IPCA 1GOZA 4OL7A 2SNSA 1EZ8A 2A5HA 3GV6A 4RGNA 4Z9CB 1ET6A 1G51A 2F3VA 4DNRB 3ULPA 2CWPA 3KF8A 4PZ8A 4DXGA 1H95A 3OIQA 1LACA 4OIKA 3TEHB 4Q5VA 2WKDA 3ULJA 1TY2A 1VQOA 4ZQ3A 1HA6A 1VQ9A 1PFBA 5FO8B 2NTTA 4A93G 1HA5A 2XRSD 2DJFC 5IYBG 1V1PB 4YCWA 4A3MH 2XWJB 4K5XA 2B8GA 2O2LD 5ELCA 4KJNA 3GTJH 4U68A 5IGDA 1QNUA 2DNEA 3VDYA 3TSSA 1EYCA 1QB5D 2KOLA 4XTCS 1XMOL 1MSGA 3HKZB 3J80E 3PIPA 4JG2A 2K4KA 2RSNA 3RLOA 1YIJA 1I4QA 2K03A 1KQSA 4A3BB 3T16A 1RF2D 3AFPA 2R92B 4K14A 3C46A 1W6JA 4YHHQ 2VQEQ 2ZJQA 3GTGH 1EU4A 1AH9A 1HRJA 4LF7Q 4QUFA 2QKIC 4NXMQ 1UEAB 2M00A 2O5JC 4KHPQ 1PTOB 2YV5A 1PRTD 2M9VA 1NE3A 1G6PA 4CDFC 2L0CA 1SMXA 1LO5D 4F8MA 1N34Q 1BBWA 1LTRD 1BQQT 2QCPX 3R2TA 3P1HA 2AKWB 4UAIA 3CF5A 1YJNA 3HOXH 3Q22A 4JI3L 1K0RA 1QNKA 4EGVA 5M3MG 3O13A 3P7JA 4OO1G 3A74A 5CV8A 4DV6Q 3F2BA 2AMCB 2EY2A 1Q8IA 3PIOA 2B2YA 2B2TC 4HIKA 2B3GA 2CQOA 4QIWB 2MFIA 2F0IA 4Y7NB 1Q12A 1L0XB 4LF4Q 4AQYL 1OTCA 1EL0A 1EY6A 3CC2A 1N32L 2SNMA 1EYDA 1AZQA 3E9HA 1VQ8A 1YZ6A 2HD3A 4NKLA 4FP5D 4BS9A 2Q2HA 1LTAD 5HY6A 4ZCKA 1Y1VG 2PZTA 4DR6Q 4KTAA 1QILA 1LLRD 4MTKA 4A3JG 3IRBA 5EJWA 3BZKA 3QR8A 5C5LA 2FJ2A 3KLSA 4A3BH 1SFOB 5KNCA 2R92H 1JC7A 1GKHA 4BBSB 5DLQE 3SDZA 3SK6A 5A2QL 3K7AB 4XYOA 1SE3A 1EIGA 2I5MX 4E6IA 4R4TA 2YU9B 2EYOA 2E2HB 4HIDA 4LF6L 5HGQA 1XTCD 4FF2A 2K14A 2A69D 4EQPA 2MHVA 2UU9Q 3G48A 4EVOA 1D2BA 4UP9A 3K5OA 4GOPB 2A74C 1T5XD 1WTHA 2VQFQ 4ODGA 4BBRG 2Y0SB 4LUOA 4LFCL 3BVGA 4X62Q 4DV3L 1HZCA 1NSNS 3UDGA 2KCTA 1VQIA 3J7A5 1SNDA 1WYDA 1BUVT 2MO0A 3FPUB 1EY4A 3S16B 1D5XC 4RCNA 2K33A 4Y7NH 1YI2A 4LF8Q 1U9RA 4DAPA 4IFDH 1KAAA 2NYZD 1NMFA 4OELB 4JI1L 3I4OA 3U50C 2L1BA 1B70B 3ERSX 1XJVA 4PMBA 3CXCA 4HR7B 3RZOB 1QVGA 1VQMA 1S5FD 4JI7L 4H02A 4J15A 2UUCL 4BY7B 4RAUC 4OX9Q 1II3A 1O7LA 1YHQA 5E3FA 1CQFA 3K0YA 1F9RA 1EQVA 1PH5A 4DAYA 1B2TA 1HR0Q 1TWHH 1EY5A 1L1OC 3AMUA 4ID6A 1FGBD 4BBSH 3K7AH 4FF4A 4ZUIA 1QZHA 1C9OA 2EXZA 4FO2A 4H13C 2EY6A 2IHEA 4KY7A 4X3SA 5DAUA 3GTLH 1HNWL 3NSWA 2D5DA 1JMCA 2CKZB 2CHBD 2F0WA 4ZYSA 1SYEA 4B3ML 5BR8Q 5DM63 4AIMA 3PO3H 4OWXB 1B8AA 1V1QA 3F8TA 3HOZG 2ZTDA 3Q23A 3HOUG 1BCPF 4A3KB 5CV6A 1GUGA 2MO1A 3GP7A 1PYWD 4A3EG 1O7IA 3S16H 4O0AA 4DAMA 1EWIA 3K5NA 4G57A 3S1QB 2YTVA 2WP8J 1TS5A 4DR4Q 2B8FA 1C7YA 2KUMA 2TSSA 1GHJA 1Z9FA 4DUYQ 3K58A 2R7ZG 1JJGA 1K28A 4K5VA 4JCVE 2VZAA 2NVTB 2PO4A 3EA6A 3BG3A 3RLFA 2DJGC 3NTIA 3MFGA 3LX0A 5J22A 1L2FA 3MEFA 3VYUA 3OIPA 2R7DA 4DAVA 1MI2A 4LJZC 2OXPA 2R93G 3CCSA 1PH3A 4G7ZC 1MKHA 1YNND 2JA8B 2IL8A 1JORA 4FDBA 5FLMG 4GLAC 4G4KA 4X66L 5ELFA 3T56B 4DK0A 1EFWA 1CQVA 1V9PA 1E0BA 1FNUA 3R2IA 1VQJA 3I4NB 2N8NA 2NZHA 4C3JG 1HCZA 2TMPA 1I3QH 4RG1A 1ICWA 3F2DA 4DPGA 4DR7Q 3A54A 1KNAA 3J81L 4HEDA 5AJ3L 1GHKA 3TBIB 2VW9A 4FVMA 4LFBL 3PUWA 3MAQA 3MXNB 3AYHB 5IP7G 1PH1A 5CBEE 1JB7A 1VQDA 3TDQA 4ABNA 3CQZH 2I46A 1G6ZA 2VY3A 1G8ZD 3S1QH 4POGA 1HUMA 3TP6A 1IW7D 1C48A 1XNQQ 2B2WA 2B29A 4PG3A 1GXDC 2WINB 1EEID
chains in the Genus database with same CATH topology
4QGUA 4A3LG 1OXUA 3F2CA 4OWWB 4LWCA 5C44H 3JC66 1IBKQ 1VQFA 3CPWA 3U4ZA 1Q46A 4DR1L 1CSQA 4A3KG 4R4CA 3NENA 2QEXA 5IP9G 3J80c 3EN2A 1E24A 3J81j 1PH6A 5LMNQ 1VQEA 3EBEA 1SN8A 4X64Q 1U0LA 3RN2A 1A62A 2JA7H 4L5SA 1YNXA 1P8LA 2R7FA 2Y0SE 4GKKL 1TWAH 3K80C 1NBWA 2JJQA 3DLLA 1XMOQ 1IBLL 3H3VI 3OTOL 1YEZA 4JOIC 3W1GA 1A8VA 4JOIA 5M3MH 3UE0A 1IYJB 1PH9A 4LF5L 2JA8H 3GTQH 3GTPH 1X3EA 4LF9Q 1TWFH 1X3FA 5BR8L 2EXDA 3G6EA 5IYCG 2ALYB 1CKMA 1D8LA 3K7UC 4OONA 3HOYH 4APVA 1HNZL 1G291 1BBUA 1EYGA 3D31A 3J81i 3EIVA 1QZGA 1PV4A 1QVCA 2D62A 1WOCA 2ZJPA 3CCMA 1YHAA 5IE8A 1ASZA 4C3HH 5JJIA 2JA7G 5IT9c 3S14H 3I2ZA 1K8AC 4JC0A 4BY1H 4DV4Q 1KXLA 1X56A 3H0GH 4DV5Q 2B63G 3JAMc 3CCVA 4OO1I 5FLXc 4HJ5A 3TRZA 2ID0A 1GVPA 2YYZA 1T9HA 5M3FG 1Y14B 2BA1A 3W1BA 4DKAC 1XTDA 3CMAA 2JA6H 2JA8G 2K50A 1TWCH 5J3BA 4P71A 5GAGC 4A75A 2UXBL 3PSIA 1YHBA 2UUAQ 3FP9A 2QGQA 4JI3Q 2R6GA 4DUYL 1MIUA 3S1RH 4NPSA 5LMUL 4DV2L 3T1YL 3KYHC 2AWOA 4QY7A 4ALPA 4DUZL 2OCEA 3ICEA 4A3JH 2VNUD 4JYAL 2CWAA 4JI2Q 1FGUA 4HJ7A 1Q86C 5M5YH 1PA6A 1ASYA 2UXBQ 3I4NG 1PVOA 4DV2Q 1PH2A 4O2DA 3PO3G 4GN4B 2IX0A 2E5LL 2F52A 3U58A 1YJ9A 4UP7A 2KENA 4DUZQ 1LTLA 1N33Q 4LUVA 3E9IA 2IY5B 4BY1G 4LFAL 1VQ4A 5C0XI 2BA0A 1XPRA 3H0GG 2A1AA 3I7FA 3S15H 3H15A 1TWGH 1Q82C 2Z0SA 1WCMG 4EQ5A 1X54A 1DGSA 2PNHA 2JA6G 4A3GH 4TVAB 4LFAQ 4JV5L 4A3FG 3GTKH 4QL5A 4GN5A 3KLWA 4A4IA 5C3EG 2I5LX 3CW2C 1SE8A 3PUXA 4YY3L 1EIFA 1HZ9A 4DV1L 4DV0L 2ZM6L 1L0WA 4JI6L 1HH2P 3G4SA 4IPDA 4GLXA 5C0XJ 3GTMH 2ZTEA 1B7YB 4R4IA 2GVAA 1W2BA 2VUMG 3STBD 1OXSC 3K81C 4IJLA 5M5XH 4DV1Q 1LUZA 4NB3A 4DR7L 3T1HQ 2K75A 2ATWA 1GO3E 1PYBA 4JI5Q 4A3GG 3PUZA 4NXNL 1FJGQ 3GO5A 2NVQH 4GS3A 4GN3B 2XGTA 1N36Q 2JQOA 1S72A 4K0KL 2VL6A 4KI0A 2HT1A 2N49A 2LXKA 1EUJA 2C35B 5IYBH 4JBMA 1J6QA 3J80i 3ZJYC 1UE5A 1JJ2A 1HJPA 4IPCA 4LF6Q 5IWAL 4JI0L 1Y1WH 1HR0W 3M7NA 2UXCL 1G51A 1VQAA 3G71A 3M3YH 1VQPA 3ULPA 2CWPA 4PZ8A 4R4QA 1XNRL 1GM5A 1VQHA 1H95A 3PV0A 4DK6C 1IBKL 1IXRA 3TEHB 3ULJA 1NJIC 4GLVB 1UWVA 1EQRA 3LGJA 1PYSB 1VQOA 4LFCQ 2A19A 3I56A 5ELOA 2N3SA 4DV3Q 1CUKA 1X9NA 1VQ9A 1M90C 1XNRQ 4A93G 5IYBG 4JI8Q 3H3VH 4YCWA 5LMNL 4A3MH 4B3TQ 4ME3A 4X64L 2ASBA 1N9WA 2WB1G 1Z47A 3PF4A 3L7ZC 3GTJH 1VQGA 3VDYA 2HIVA 1Y1WG 3S1MH 2RHQB 4XTCS 3KF8B 3L0OA 3TQYA 3JAMi 1XMOL 2HHHQ 2MQHA 3HOVG 2WAQG 3KDFA 1HZBA 3PIPA 3RZDH 4JG2A 2RCNA 4AYBG 2VQEL 4IOAA 2K4KA 1YIJA 3RLOA 4LF9L 3NELA 2KCMA 4R4OA 2BH8A 4P72A 1KQSA 4NXML 4LUZA 3AFPA 3I4MG 3E0EA 3B6YA 4IFDI 4YHHQ 2VQEQ 2ZJQA 4KHZA 4IPHA 1KIXA 2NVYH 3GTGH 1IL2A 1AH9A 4LF7Q 3CCLA 5IYDH 3A5UA 1JT8A 4NXMQ 5C44G 4KHPQ 1PFSA 2K5VA 2ZJRA 2YV5A 1SFOH 5GQOA 4A3DH 1NE3A 3KDFB 1G6PA 4DV4L 4A3CH 4DV5L 2XTIA 1SMXA 2VS1A 5JEAJ 1N34Q 5C4XH 1BBWA 1QUQA 3OW2A 3NBHB 1WJJA 2K5NA 4GKJL 2AKWB 3I55A 2YU9H 1KL9A 3CF5A 1YJNA 2E2HH 3HOXH 2UUAL 1Q1BA 4HJ8A 4IFDJ 4JI3L 1I94L 1K0RA 2MNAA 5M3MG 4X65Q 4BXXH 2NVXH 4DK3C 4JI2L 1GD7A 3K8AA 1E7ZA 1VQLA 3HOWH 4OO1G 3A74A 5IYDG 4DV6Q 3HOYG 1Y1VH 2HIXA 3F2BA 2AMCB 2K52A 1QUQB 4P75A 3PIOA 1N33L 3KJPA 2R7ZH 4A3DG 1N8RC 1EIYB 4HIKA 2B3GA 2CQOA 2MFIA 4B3MQ 4LW1A 1Q12A 4LF4Q 1UE6A 4AQYL 3A5ZB 1OTCA 1VQ6A 2H5XA 1LM0A 3PUVA 3GDEA 3CC2A 1N32L 1E22A 3BJUA 5GAHC 3DM3A 2JEBI 2NN6I 3E9HA 1VQ8A 4P74A 1YZ6A 4DR6L 4BXXG 4AQYQ 1IBMQ 3J7ZC 1N32Q 2Z6KC 4YCVA 4OXPA 2Z6KA 2Q2HA 5C0XG 4P73A 3HOWG 4GKJQ 5HY6A 4X6AH 2E2JH 1Y1VG 2I0QA 1VS0A 4DR6Q 1D7QA 4A3JG 3IRBA 5FJ8H 2IHFA 3BZKA 4YWMA 1YITA 1K3RA 3AEVA 2F4VL 4YCUA 3T1HL 1PH8A 4XIGS 3RZOH 2WB1E 3PO2H 2YTYA 3I4MH 5E7NA 2UXDQ 3PGZA 4A3BH 4JI5L 4BY7H 4GOPC 1HZAA 2R92H 4GOPA 3CD6A 3M85A 1AE3A 1FJGL 1GKHA 4BBRH 2F4VQ 5DLQE 4BA1I 3CCJA 1NMGA 2WAQE 4IOCA 3RN5A 1N36L 2JA5H 1X6OA 4TQUS 1J5EL 2GVBA 3S2HH 1I94Q 2I5MX 2UU9L 2A8VA 4R4TA 4HIDA 5K36G 4LF6L 1KHIA 1HNXQ 1JJCB 5HGQA 1J5EQ 2K14A 1OXVA 2PI2E 3KF6A 4YWKA 3HKZG 1VCIA 3U4VA 3G48A 2VQFL 1OXTA 2UU9Q 4UP9A 2OWOA 3KJOA 1RIPA 1FVIA 4GOPB 2CCZA 4L5QA 3OYYA 3GD7A 3PO2G 1I50H 3STBC 2VQFQ 2JE6I 4A3BG 3KOJA 4KLKA 1UE7A 2R92G 4HJ9A 4QQBX 5LMNW 4X66Q 4Y52H 4BBRG 1XPOA 3HKSA 2K5HA 4LUOA 2JA5G 4DR5Q 4LFCL 1E1OA 4X62Q 2D0OA 4PZ6A 4DV3L 3S2DH 1HZCA 1VQCA 3M4PA 3BU2A 4JI8L 3UDGA 3TS0A 2KCTA 5C4JH 3KF6B 1VQIA 3CMEA 4B3TL 3J7A5 4A3LH 2CFMA 3HFZB 1WYDA 1PHJA 3RLNA 2AWNA 2MO0A 1SLJA 4Y7NH 4A3KH 1YI2A 4LF8Q 2HHHL 4BA2I 1AE2A 3PF5A 3F1ZA 1OXXK 2LSSA 5JJLA 1NMFA 3U50C 4JI1L 3I4OA 4MTNA 1NY4A 1B70B 3ERSX 2Q2TA 2JEAI 1XJVA 2PMZE 4B3SQ 3CXCA 4LFBQ 4DNIA 5IY0A 4YHHL 1QVGA 4JI1Q 3S17H 1VQMA 4JI7L 2KHJA 4H02A 4J15A 1I5FA 4UY8C 2EIFA 5GROA 1FL0A 1YBYA 1Q7YC 2UUCL 4LF7L 1VQBA 2AHOB 3M4QA 4KHPL 3CC7A 4EX5A 1HR0L 5IYCH 4OX9Q 1Q81C 3KFUA 4JI7Q 4JI4L 5JEAG 3ER0A 2NVTH 4C3IH 1SRUA 1YHQA 2UUCQ 2IX1A 3GTOH 1PH5A 1Q1EA 3CCUA 1N34L 1A63A 4A3MG 1HR0Q 5H1SE 2OTJA 4IFDG 1TWHH 4PZ7A 2LXJA 1L1OC 4JI4Q 4HIMA 1L1OA 3HOZH 4BBSH 3K7AH 3HOUH 4DR1Q 5ELNA 4MNOA 1QZHA 2B63H 2FXQA 1Q8KA 1C9OA 4X65L 1W3SA 2BH2A 2IHEA 1MJEA 3GTLH 1HNWL 1QVFA 5M3FH 1IZ6A 4UP8A 4DV6L 4A3EH 4GKKQ 1UE1A 4HJAA 1SR3A 3UE1A 1NTGA 3CPFA 1JMCA 2IT1A 2CKZB 4DAYB 1CSPA 3ULLA 1EQQA 1IBLQ 1CKNA 3OTOQ 4L5TA 1HNWQ 4LF5Q 4IO9A 1L1OB 2KBNA 1PH4A 2JA9A 4DV7L 4JBWA 2ZTCA 3L2PA 4DR3L 3NEMA 2N78A 5BR8Q 4GNXC 4B3ML 4GNXA 4LF4L 3I4NH 4AIMA 3S1NH 1V43A 1CKOA 4OWXB 1B8AA 3PO3H 1V1QA 1LYLA 3F8TA 1HNZQ 2ZTDA 3HKZE 3HOZG 3WWVA 3AQQA 1VQ7A 4BBSG 4A3CG 2EQSA 2NZOA 3HOUG 1X65A 3CCRA 4DV7Q 2PI2A 4DR3Q 5C4XG 2UXCQ 1K8GA 1KRSA 2F3IA 1IBML 2V1CC 1WCMH 4A3IH 1VQNA 3HOXG 2MO1A 2QA4A 1WI5A 1CKNB 3BZCA 3M9BA 3UDIA 1BVSA 4A3EG 4DR4L 2OQKA 4A3FH 1O7IA 3S16H 4LNQA 4O0AA 1S3OA 4A76A 1VQKA 2R93H 4DAMA 1EWIA 5EAYA 3W5OA 4GNXB 1P16A 2YTVA 1TXYA 2WP8J 5C3EH 4DR4Q 1KAWA 1C7YA 4WJ3M 3K0XA 2UXDL 4QJFA 1Z9FA 2NN6G 2D0PA 4AH6A 3CCQA 1UEBA 4DUYQ 5LMUQ 2I5HA 3T1YQ 3TREA 2R7ZG 1JJGA 5FLMH 2GN5A 2RF4A 3J81c 1RL2A 1E3PA 4JCVE 2VZAA 4UPAA 1KC8C 2Y0SG 1VQ5A 2VUMH 1C0AA 4JYAQ 2E8GA 3RLFA 4HIOA 1YJWA 1KD1C 2E5LQ 4JBKA 4IJHA 1I6HH 1MJCA 4A3IG 4C3JH 4C2MH 1X3GA 2JK8A 1L2FA 3MEFA 4AYBE 2R7DA 1HNXL 2OQ0A 2DUDA 2R93G 2PQAA 3CCSA 2ES2A 4WJ4A 1PH3A 3PUYA 2Q2UA 5GADC 1X55A 1MKHA 1K9MC 1U5KA 4JV5Q 5JJKA 4PMWA 3AFQA 4FDBA 4YWLA 5FJ8G 4QIWE 5FLMG 4GLAC 4X66L 2DGYA 5IP7H 4YY3Q 4DR5L 4DV0Q 2ZM6Q 1EFWA 3FKIH 1V9PA 4X62L 4JI6Q 3TS2A 4IPGA 1VQJA 5M5WH 4BY7G 1R9TH 2WFWA 2N8NA 2PQAB 2NZHA 1E1TA 1KRTA 1I3QH 4RG1A 3UDFA 3PCOB 3F2DA 3CCEA 1YVCA 4DPGA 4DR2L 4DR7Q 1M1KC 1XPUA 4LF8L 1K73C 3CAMA 2RHSB 1WFQA 4A93H 1XMQL 2UUBL 4NXNQ 4DR2Q 3S24A 4L5RC 3FHWA 5AJ3L 4K0KQ 4JBJA 3A0JA 4POFA 4B3SL 2VW9A 4R1JA 4LFBL 3PUWA 1K83H 3MXNB 5IP9H 3CC4A 1XMQQ 2UUBQ 4OWTB 3AYHB 3RR5A 5IP7G 1PH1A 3RNUA 4B3RL 3HOVH 4RMFA 3FKIG 1VQDA 1PH7A 1JB7A 1XNQL 5AJ3Q 1S40A 3CQZH 1SROA 2L15A 2VY3A 5IWAQ 4MZ9A 2E2IH 2Q2IA 4JI0Q 3S1QH 1EOVA 4POGA 4OX9L 1BKBA 5GAEC 4B3RQ 3Q8DA 2YTXA 1XNQQ 3SGIA 1JE5A 2HQLA 2OTLA 2B29A 3D0FA 3UDXA 3M4OH 4PG3A 3CP0A 2KHIA 1A0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QGU A;  4A3L G;  1OXU A;  3F2C A;  4OWW B;  4LWC A;  5C44 H;  3JC6 6;  1IBK Q;  1VQF A;  3CPW A;  3U4Z A;  1Q46 A;  4DR1 L;  1CSQ A;  4A3K G;  4R4C A;  3NEN A;  2QEX A;  5IP9 G;  3J80 c;  3EN2 A;  1E24 A;  3J81 j;  1PH6 A;  5LMN Q;  1VQE A;  3EBE A;  1SN8 A;  4X64 Q;  1U0L A;  3RN2 A;  1A62 A;  2JA7 H;  4L5S A;  1YNX A;  1P8L A;  2R7F A;  2Y0S E;  4GKK L;  1TWA H;  3K80 C;  1NBW A;  2JJQ A;  3DLL A;  1XMO Q;  1IBL L;  3H3V I;  3OTO L;  1YEZ A;  4JOI C;  3W1G A;  1A8V A;  4JOI A;  5M3M H;  3UE0 A;  1IYJ B;  1PH9 A;  4LF5 L;  2JA8 H;  3GTQ H;  3GTP H;  1X3E A;  4LF9 Q;  1TWF H;  1X3F A;  5BR8 L;  2EXD A;  3G6E A;  5IYC G;  2ALY B;  1CKM A;  1D8L A;  3K7U C;  4OON A;  3HOY H;  4APV A;  1HNZ L;  1G29 1;  1BBU A;  1EYG A;  3D31 A;  3J81 i;  3EIV A;  1QZG A;  1PV4 A;  1QVC A;  2D62 A;  1WOC A;  2ZJP A;  3CCM A;  1YHA A;  5IE8 A;  1ASZ A;  4C3H H;  5JJI A;  2JA7 G;  5IT9 c;  3S14 H;  3I2Z A;  1K8A C;  4JC0 A;  4BY1 H;  4DV4 Q;  1KXL A;  1X56 A;  3H0G H;  4DV5 Q;  2B63 G;  3JAM c;  3CCV A;  4OO1 I;  5FLX c;  4HJ5 A;  3TRZ A;  2ID0 A;  1GVP A;  2YYZ A;  1T9H A;  5M3F G;  1Y14 B;  2BA1 A;  3W1B A;  4DKA C;  1XTD A;  3CMA A;  2JA6 H;  2JA8 G;  2K50 A;  1TWC H;  5J3B A;  4P71 A;  5GAG C;  4A75 A;  2UXB L;  3PSI A;  1YHB A;  2UUA Q;  3FP9 A;  2QGQ A;  4JI3 Q;  2R6G A;  4DUY L;  1MIU A;  3S1R H;  4NPS A;  5LMU L;  4DV2 L;  3T1Y L;  3KYH C;  2AWO A;  4QY7 A;  4ALP A;  4DUZ L;  2OCE A;  3ICE A;  4A3J H;  2VNU D;  4JYA L;  2CWA A;  4JI2 Q;  1FGU A;  4HJ7 A;  1Q86 C;  5M5Y H;  1PA6 A;  1ASY A;  2UXB Q;  3I4N G;  1PVO A;  4DV2 Q;  1PH2 A;  4O2D A;  3PO3 G;  4GN4 B;  2IX0 A;  2E5L L;  2F52 A;  3U58 A;  1YJ9 A;  4UP7 A;  2KEN A;  4DUZ Q;  1LTL A;  1N33 Q;  4LUV A;  3E9I A;  2IY5 B;  4BY1 G;  4LFA L;  1VQ4 A;  5C0X I;  2BA0 A;  1XPR A;  3H0G G;  2A1A A;  3I7F A;  3S15 H;  3H15 A;  1TWG H;  1Q82 C;  2Z0S A;  1WCM G;  4EQ5 A;  1X54 A;  1DGS A;  2PNH A;  2JA6 G;  4A3G H;  4TVA B;  4LFA Q;  4JV5 L;  4A3F G;  3GTK H;  4QL5 A;  4GN5 A;  3KLW A;  4A4I A;  5C3E G;  2I5L X;  3CW2 C;  1SE8 A;  3PUX A;  4YY3 L;  1EIF A;  1HZ9 A;  4DV1 L;  4DV0 L;  2ZM6 L;  1L0W A;  4JI6 L;  1HH2 P;  3G4S A;  4IPD A;  4GLX A;  5C0X J;  3GTM H;  2ZTE A;  1B7Y B;  4R4I A;  2GVA A;  1W2B A;  2VUM G;  3STB D;  1OXS C;  3K81 C;  4IJL A;  5M5X H;  4DV1 Q;  1LUZ A;  4NB3 A;  4DR7 L;  3T1H Q;  2K75 A;  2ATW A;  1GO3 E;  1PYB A;  4JI5 Q;  4A3G G;  3PUZ A;  4NXN L;  1FJG Q;  3GO5 A;  2NVQ H;  4GS3 A;  4GN3 B;  2XGT A;  1N36 Q;  2JQO A;  1S72 A;  4K0K L;  2VL6 A;  4KI0 A;  2HT1 A;  2N49 A;  2LXK A;  1EUJ A;  2C35 B;  5IYB H;  4JBM A;  1J6Q A;  3J80 i;  3ZJY C;  1UE5 A;  1JJ2 A;  1HJP A;  4IPC A;  4LF6 Q;  5IWA L;  4JI0 L;  1Y1W H;  1HR0 W;  3M7N A;  2UXC L;  1G51 A;  1VQA A;  3G71 A;  3M3Y H;  1VQP A;  3ULP A;  2CWP A;  4PZ8 A;  4R4Q A;  1XNR L;  1GM5 A;  1VQH A;  1H95 A;  3PV0 A;  4DK6 C;  1IBK L;  1IXR A;  3TEH B;  3ULJ A;  1NJI C;  4GLV B;  1UWV A;  1EQR A;  3LGJ A;  1PYS B;  1VQO A;  4LFC Q;  2A19 A;  3I56 A;  5ELO A;  2N3S A;  4DV3 Q;  1CUK A;  1X9N A;  1VQ9 A;  1M90 C;  1XNR Q;  4A93 G;  5IYB G;  4JI8 Q;  3H3V H;  4YCW A;  5LMN L;  4A3M H;  4B3T Q;  4ME3 A;  4X64 L;  2ASB A;  1N9W A;  2WB1 G;  1Z47 A;  3PF4 A;  3L7Z C;  3GTJ H;  1VQG A;  3VDY A;  2HIV A;  1Y1W G;  3S1M H;  2RHQ B;  4XTC S;  3KF8 B;  3L0O A;  3TQY A;  3JAM i;  1XMO L;  2HHH Q;  2MQH A;  3HOV G;  2WAQ G;  3KDF A;  1HZB A;  3PIP A;  3RZD H;  4JG2 A;  2RCN A;  4AYB G;  2VQE L;  4IOA A;  2K4K A;  1YIJ A;  3RLO A;  4LF9 L;  3NEL A;  2KCM A;  4R4O A;  2BH8 A;  4P72 A;  1KQS A;  4NXM L;  4LUZ A;  3AFP A;  3I4M G;  3E0E A;  3B6Y A;  4IFD I;  4YHH Q;  2VQE Q;  2ZJQ A;  4KHZ A;  4IPH A;  1KIX A;  2NVY H;  3GTG H;  1IL2 A;  1AH9 A;  4LF7 Q;  3CCL A;  5IYD H;  3A5U A;  1JT8 A;  4NXM Q;  5C44 G;  4KHP Q;  1PFS A;  2K5V A;  2ZJR A;  2YV5 A;  1SFO H;  5GQO A;  4A3D H;  1NE3 A;  3KDF B;  1G6P A;  4DV4 L;  4A3C H;  4DV5 L;  2XTI A;  1SMX A;  2VS1 A;  5JEA J;  1N34 Q;  5C4X H;  1BBW A;  1QUQ A;  3OW2 A;  3NBH B;  1WJJ A;  2K5N A;  4GKJ L;  2AKW B;  3I55 A;  2YU9 H;  1KL9 A;  3CF5 A;  1YJN A;  2E2H H;  3HOX H;  2UUA L;  1Q1B A;  4HJ8 A;  4IFD J;  4JI3 L;  1I94 L;  1K0R A;  2MNA A;  5M3M G;  4X65 Q;  4BXX H;  2NVX H;  4DK3 C;  4JI2 L;  1GD7 A;  3K8A A;  1E7Z A;  1VQL A;  3HOW H;  4OO1 G;  3A74 A;  5IYD G;  4DV6 Q;  3HOY G;  1Y1V H;  2HIX A;  3F2B A;  2AMC B;  2K52 A;  1QUQ B;  4P75 A;  3PIO A;  1N33 L;  3KJP A;  2R7Z H;  4A3D G;  1N8R C;  1EIY B;  4HIK A;  2B3G A;  2CQO A;  2MFI A;  4B3M Q;  4LW1 A;  1Q12 A;  4LF4 Q;  1UE6 A;  4AQY L;  3A5Z B;  1OTC A;  1VQ6 A;  2H5X A;  1LM0 A;  3PUV A;  3GDE A;  3CC2 A;  1N32 L;  1E22 A;  3BJU A;  5GAH C;  3DM3 A;  2JEB I;  2NN6 I;  3E9H A;  1VQ8 A;  4P74 A;  1YZ6 A;  4DR6 L;  4BXX G;  4AQY Q;  1IBM Q;  3J7Z C;  1N32 Q;  2Z6K C;  4YCV A;  4OXP A;  2Z6K A;  2Q2H A;  5C0X G;  4P73 A;  3HOW G;  4GKJ Q;  5HY6 A;  4X6A H;  2E2J H;  1Y1V G;  2I0Q A;  1VS0 A;  4DR6 Q;  1D7Q A;  4A3J G;  3IRB A;  5FJ8 H;  2IHF A;  3BZK A;  4YWM A;  1YIT A;  1K3R A;  3AEV A;  2F4V L;  4YCU A;  3T1H L;  1PH8 A;  4XIG S;  3RZO H;  2WB1 E;  3PO2 H;  2YTY A;  3I4M H;  5E7N A;  2UXD Q;  3PGZ A;  4A3B H;  4JI5 L;  4BY7 H;  4GOP C;  1HZA A;  2R92 H;  4GOP A;  3CD6 A;  3M85 A;  1AE3 A;  1FJG L;  1GKH A;  4BBR H;  2F4V Q;  5DLQ E;  4BA1 I;  3CCJ A;  1NMG A;  2WAQ E;  4IOC A;  3RN5 A;  1N36 L;  2JA5 H;  1X6O A;  4TQU S;  1J5E L;  2GVB A;  3S2H H;  1I94 Q;  2I5M X;  2UU9 L;  2A8V A;  4R4T A;  4HID A;  5K36 G;  4LF6 L;  1KHI A;  1HNX Q;  1JJC B;  5HGQ A;  1J5E Q;  2K14 A;  1OXV A;  2PI2 E;  3KF6 A;  4YWK A;  3HKZ G;  1VCI A;  3U4V A;  3G48 A;  2VQF L;  1OXT A;  2UU9 Q;  4UP9 A;  2OWO A;  3KJO A;  1RIP A;  1FVI A;  4GOP B;  2CCZ A;  4L5Q A;  3OYY A;  3GD7 A;  3PO2 G;  1I50 H;  3STB C;  2VQF Q;  2JE6 I;  4A3B G;  3KOJ A;  4KLK A;  1UE7 A;  2R92 G;  4HJ9 A;  4QQB X;  5LMN W;  4X66 Q;  4Y52 H;  4BBR G;  1XPO A;  3HKS A;  2K5H A;  4LUO A;  2JA5 G;  4DR5 Q;  4LFC L;  1E1O A;  4X62 Q;  2D0O A;  4PZ6 A;  4DV3 L;  3S2D H;  1HZC A;  1VQC A;  3M4P A;  3BU2 A;  4JI8 L;  3UDG A;  3TS0 A;  2KCT A;  5C4J H;  3KF6 B;  1VQI A;  3CME A;  4B3T L;  3J7A 5;  4A3L H;  2CFM A;  3HFZ B;  1WYD A;  1PHJ A;  3RLN A;  2AWN A;  2MO0 A;  1SLJ A;  4Y7N H;  4A3K H;  1YI2 A;  4LF8 Q;  2HHH L;  4BA2 I;  1AE2 A;  3PF5 A;  3F1Z A;  1OXX K;  2LSS A;  5JJL A;  1NMF A;  3U50 C;  4JI1 L;  3I4O A;  4MTN A;  1NY4 A;  1B70 B;  3ERS X;  2Q2T A;  2JEA I;  1XJV A;  2PMZ E;  4B3S Q;  3CXC A;  4LFB Q;  4DNI A;  5IY0 A;  4YHH L;  1QVG A;  4JI1 Q;  3S17 H;  1VQM A;  4JI7 L;  2KHJ A;  4H02 A;  4J15 A;  1I5F A;  4UY8 C;  2EIF A;  5GRO A;  1FL0 A;  1YBY A;  1Q7Y C;  2UUC L;  4LF7 L;  1VQB A;  2AHO B;  3M4Q A;  4KHP L;  3CC7 A;  4EX5 A;  1HR0 L;  5IYC H;  4OX9 Q;  1Q81 C;  3KFU A;  4JI7 Q;  4JI4 L;  5JEA G;  3ER0 A;  2NVT H;  4C3I H;  1SRU A;  1YHQ A;  2UUC Q;  2IX1 A;  3GTO H;  1PH5 A;  1Q1E A;  3CCU A;  1N34 L;  1A63 A;  4A3M G;  1HR0 Q;  5H1S E;  2OTJ A;  4IFD G;  1TWH H;  4PZ7 A;  2LXJ A;  1L1O C;  4JI4 Q;  4HIM A;  1L1O A;  3HOZ H;  4BBS H;  3K7A H;  3HOU H;  4DR1 Q;  5ELN A;  4MNO A;  1QZH A;  2B63 H;  2FXQ A;  1Q8K A;  1C9O A;  4X65 L;  1W3S A;  2BH2 A;  2IHE A;  1MJE A;  3GTL H;  1HNW L;  1QVF A;  5M3F H;  1IZ6 A;  4UP8 A;  4DV6 L;  4A3E H;  4GKK Q;  1UE1 A;  4HJA A;  1SR3 A;  3UE1 A;  1NTG A;  3CPF A;  1JMC A;  2IT1 A;  2CKZ B;  4DAY B;  1CSP A;  3ULL A;  1EQQ A;  1IBL Q;  1CKN A;  3OTO Q;  4L5T A;  1HNW Q;  4LF5 Q;  4IO9 A;  1L1O B;  2KBN A;  1PH4 A;  2JA9 A;  4DV7 L;  4JBW A;  2ZTC A;  3L2P A;  4DR3 L;  3NEM A;  2N78 A;  5BR8 Q;  4GNX C;  4B3M L;  4GNX A;  4LF4 L;  3I4N H;  4AIM A;  3S1N H;  1V43 A;  1CKO A;  4OWX B;  1B8A A;  3PO3 H;  1V1Q A;  1LYL A;  3F8T A;  1HNZ Q;  2ZTD A;  3HKZ E;  3HOZ G;  3WWV A;  3AQQ A;  1VQ7 A;  4BBS G;  4A3C G;  2EQS A;  2NZO A;  3HOU G;  1X65 A;  3CCR A;  4DV7 Q;  2PI2 A;  4DR3 Q;  5C4X G;  2UXC Q;  1K8G A;  1KRS A;  2F3I A;  1IBM L;  2V1C C;  1WCM H;  4A3I H;  1VQN A;  3HOX G;  2MO1 A;  2QA4 A;  1WI5 A;  1CKN B;  3BZC A;  3M9B A;  3UDI A;  1BVS A;  4A3E G;  4DR4 L;  2OQK A;  4A3F H;  1O7I A;  3S16 H;  4LNQ A;  4O0A A;  1S3O A;  4A76 A;  1VQK A;  2R93 H;  4DAM A;  1EWI A;  5EAY A;  3W5O A;  4GNX B;  1P16 A;  2YTV A;  1TXY A;  2WP8 J;  5C3E H;  4DR4 Q;  1KAW A;  1C7Y A;  4WJ3 M;  3K0X A;  2UXD L;  4QJF A;  1Z9F A;  2NN6 G;  2D0P A;  4AH6 A;  3CCQ A;  1UEB A;  4DUY Q;  5LMU Q;  2I5H A;  3T1Y Q;  3TRE A;  2R7Z G;  1JJG A;  5FLM H;  2GN5 A;  2RF4 A;  3J81 c;  1RL2 A;  1E3P A;  4JCV E;  2VZA A;  4UPA A;  1KC8 C;  2Y0S G;  1VQ5 A;  2VUM H;  1C0A A;  4JYA Q;  2E8G A;  3RLF A;  4HIO A;  1YJW A;  1KD1 C;  2E5L Q;  4JBK A;  4IJH A;  1I6H H;  1MJC A;  4A3I G;  4C3J H;  4C2M H;  1X3G A;  2JK8 A;  1L2F A;  3MEF A;  4AYB E;  2R7D A;  1HNX L;  2OQ0 A;  2DUD A;  2R93 G;  2PQA A;  3CCS A;  2ES2 A;  4WJ4 A;  1PH3 A;  3PUY A;  2Q2U A;  5GAD C;  1X55 A;  1MKH A;  1K9M C;  1U5K A;  4JV5 Q;  5JJK A;  4PMW A;  3AFQ A;  4FDB A;  4YWL A;  5FJ8 G;  4QIW E;  5FLM G;  4GLA C;  4X66 L;  2DGY A;  5IP7 H;  4YY3 Q;  4DR5 L;  4DV0 Q;  2ZM6 Q;  1EFW A;  3FKI H;  1V9P A;  4X62 L;  4JI6 Q;  3TS2 A;  4IPG A;  1VQJ A;  5M5W H;  4BY7 G;  1R9T H;  2WFW A;  2N8N A;  2PQA B;  2NZH A;  1E1T A;  1KRT A;  1I3Q H;  4RG1 A;  3UDF A;  3PCO B;  3F2D A;  3CCE A;  1YVC A;  4DPG A;  4DR2 L;  4DR7 Q;  1M1K C;  1XPU A;  4LF8 L;  1K73 C;  3CAM A;  2RHS B;  1WFQ A;  4A93 H;  1XMQ L;  2UUB L;  4NXN Q;  4DR2 Q;  3S24 A;  4L5R C;  3FHW A;  5AJ3 L;  4K0K Q;  4JBJ A;  3A0J A;  4POF A;  4B3S L;  2VW9 A;  4R1J A;  4LFB L;  3PUW A;  1K83 H;  3MXN B;  5IP9 H;  3CC4 A;  1XMQ Q;  2UUB Q;  4OWT B;  3AYH B;  3RR5 A;  5IP7 G;  1PH1 A;  3RNU A;  4B3R L;  3HOV H;  4RMF A;  3FKI G;  1VQD A;  1PH7 A;  1JB7 A;  1XNQ L;  5AJ3 Q;  1S40 A;  3CQZ H;  1SRO A;  2L15 A;  2VY3 A;  5IWA Q;  4MZ9 A;  2E2I H;  2Q2I A;  4JI0 Q;  3S1Q H;  1EOV A;  4POG A;  4OX9 L;  1BKB A;  5GAE C;  4B3R Q;  3Q8D A;  2YTX A;  1XNQ Q;  3SGI A;  1JE5 A;  2HQL A;  2OTL A;  2B29 A;  3D0F A;  3UDX A;  3M4O H;  4PG3 A;  3CP0 A;  2KHI A;  1A0I A; 
#chains in the Genus database with same CATH topology
 1E2V A;  3I91 A;  5ELE A;  4NP5 A;  4OWW B;  5FOB B;  1D6E C;  3CPW A;  1U4R A;  3U4Z A;  4KD3 A;  4DR1 L;  1CSQ A;  1QOH A;  3Q6S A;  1TY0 A;  3NEN A;  2LY7 A;  1HFN A;  2A73 B;  3RN2 A;  4FF1 A;  1A62 A;  2A6H D;  5K5P A;  4IUU A;  5I9O A;  4L5S A;  1YNX A;  3CKI B;  3K80 C;  4ILW A;  2RBM A;  1VDZ A;  3DLL A;  2O5I C;  5IOC A;  4JOI A;  5IGG A;  2JA8 H;  3GTP H;  5M5W B;  4IQZ A;  4LF9 Q;  1AW7 A;  1X3F A;  2FHT A;  5IYC G;  4OON A;  1HNZ L;  3D31 A;  1PV4 A;  4I65 A;  1QZG A;  3NTK A;  4N8F A;  2ZJP A;  1T5E A;  1YHA A;  1DJR D;  2F0U A;  1ASZ A;  1PMR A;  4C3H H;  2JA7 G;  5IT9 c;  1H9R A;  1Y8O B;  2WB1 B;  2QDL A;  2KCC A;  1X56 A;  2KEC A;  4DV5 Q;  2B63 G;  2XVS A;  3H3V C;  4OO1 I;  5FLX c;  1Y1W B;  5CV9 A;  1GVP A;  5M3F G;  3SEB A;  3W1B A;  1JWS D;  3LWE A;  1ILQ A;  2XNA C;  1ESR A;  4AYB B;  1TT2 A;  5GAG C;  5C0X H;  2UXB L;  2UUA Q;  2EE1 A;  2LKV A;  2R6G A;  3BDL A;  1Q90 A;  2K04 A;  4DUZ L;  5FKA C;  3I73 A;  4QMG A;  3I4M B;  2E2D C;  1PA6 A;  3ERQ A;  1Q86 C;  4JYA L;  2F3W A;  1PH2 A;  2F52 A;  2PNR C;  2KEN A;  5C44 B;  3E9I A;  3NBI A;  5I2Y A;  2BA0 A;  3H0G G;  3IKJ A;  3BVZ A;  3I7F A;  4KKU A;  4QCL A;  1Q82 C;  1KNE A;  1U4P A;  1KDB A;  2PNH A;  4TVA B;  4LFA Q;  3GTK H;  2Q8I B;  1VF5 C;  1TWA B;  4GN5 A;  2X6L A;  3KLW A;  5C3E G;  2A6E C;  3PUX A;  1SYC A;  1L0W A;  3G4S A;  3T51 B;  2B2U A;  5LL6 S;  4CDD C;  4GLX A;  3E0J A;  1BF4 A;  2JSO A;  2EZV A;  3NTH A;  2VUM G;  2OF1 A;  1ENA A;  4YIJ A;  1JOK A;  5C4X B;  1WD1 A;  1PYB A;  1KDA A;  4KI0 A;  2N49 A;  2H1E A;  3C3L A;  3GV3 A;  3M7G A;  1LTB D;  3HOW B;  5IWA L;  4JI0 L;  1V1P A;  1Y1W H;  1KDC A;  1LTI D;  3M7N A;  2F0N A;  3G71 A;  5BN4 A;  3SK4 A;  2Z8L A;  2EPB A;  2NWG A;  1IBK L;  3DHQ A;  4RGO S;  1UWV A;  1EQR A;  4KY6 A;  1F2Y A;  2A19 A;  2EYH A;  1X9N A;  1GJX A;  1CUK A;  1XNR Q;  5LMN L;  4X64 L;  4CJ1 B;  1N9W A;  1IYV A;  3I90 A;  1FD7 D;  3L7Z C;  1S4Z A;  1ZYR C;  2WKC A;  1I6V C;  1EY9 A;  3JAM i;  3HOV G;  2WAQ G;  1B9N A;  4J1M A;  4CKE A;  2VQE L;  3PO2 B;  3NEL A;  2BH8 A;  1TVX A;  2F0M A;  4NXM L;  3NQI A;  3FVQ A;  2JA5 B;  1Q3L A;  1IL2 A;  5IYD H;  3A5U A;  2HDL A;  2K5V A;  2F0H A;  3OW7 A;  5GQO A;  1TR5 A;  3KDF B;  1EYA A;  4WJW A;  5C3X A;  1J8I A;  5KGU A;  2VS1 A;  5C4X H;  3OW2 A;  5EBD A;  3NBH B;  4GKJ L;  1V8Q A;  3I55 A;  1KL9 A;  5COR A;  4IFD J;  1I94 L;  1DYQ A;  3JAM E;  4BXX H;  4TRD A;  4X65 Q;  2NVX H;  5EQ0 A;  1ENF A;  4DK3 C;  5KEE A;  2ZXR A;  4CJ0 B;  4HCS A;  1E7Z A;  5IGF A;  3HOW H;  3OWF A;  1PDQ A;  3HOY G;  1QUQ B;  4P75 A;  1N33 L;  3A56 A;  2K5W A;  1DXM A;  4ZLT F;  1BR9 A;  3OWE B;  1VQ6 A;  3PUV A;  3VR5 A;  2F0L A;  1E22 A;  5E4W C;  2RDF A;  4CDC C;  4C1N I;  5GAH C;  2RKS A;  4DR6 L;  1IBM Q;  2Z6K C;  2HCI A;  3V2T A;  3UI2 A;  4X6A H;  2A6E D;  2E74 C;  1D7Q A;  3VR3 A;  2IHF A;  4IN3 A;  4YWM A;  1YIT A;  3AEV A;  3GTG B;  4YCU A;  3T1H L;  2A68 C;  4C3I B;  1EIH A;  5CC4 A;  3PO2 H;  1MBY A;  2EYF A;  4F7X A;  1HZA A;  3CD6 A;  4GOP A;  3M85 A;  1AE3 A;  4X3K A;  4KK7 A;  1FJG L;  3RN5 A;  3I72 A;  5IGB A;  4IOC A;  2WAQ E;  1N36 L;  2JA5 H;  1X6O A;  2L5T A;  2IPK D;  3WOF A;  4BWG B;  5CGK A;  3S2H H;  4XQN A;  5BN5 A;  2UU9 L;  2A8V A;  3OMC A;  3HOX B;  5K36 G;  3EVQ A;  1HNX Q;  2RVL A;  1OXV A;  2PI2 E;  4YWK A;  2VQF L;  3HKZ G;  2Z4I A;  3C1F A;  1OXT A;  3KJO A;  1M8A A;  1RIP A;  1FVI A;  3H91 A;  2CCZ A;  4L5Q A;  3GD7 A;  1I50 H;  5G3L D;  3STB C;  4NMZ A;  4HMI A;  4A3B G;  3KOJ A;  2R92 G;  1F9Q A;  2Z4H A;  5LMN W;  3FDT A;  1DCZ A;  2K5H A;  4DR5 Q;  4F88 A;  1E1O A;  2D0O A;  5KYL A;  1VQC A;  4H0L C;  2EYL A;  4JI8 L;  5KYI A;  1RKN A;  2NB0 A;  4B3T L;  3KF6 B;  3CME A;  4A3I B;  4A3L H;  3HFZ B;  4CGY B;  4KKT A;  5JEA H;  3A8J E;  3ERO A;  2PYK A;  2HHH L;  2E76 C;  4BA2 I;  1AE2 A;  3MC0 B;  4X3U A;  3F1Z A;  1OXX K;  2F0T A;  1ZYR D;  2PMZ E;  1SAP A;  1STG A;  4DNI A;  5EBC A;  5IY0 A;  2B2V C;  2EIF A;  1JE4 A;  1BCP B;  1VQB A;  2AHO B;  3CC7 A;  4EX5 A;  1HR0 L;  1E2Z A;  1EWC A;  2XSC A;  4PQX A;  2PZW A;  5EGT A;  4C2M B;  3KFU A;  4C3I H;  1SRU A;  2IX1 A;  4IUR A;  1BBX C;  1Q1E A;  1B3A A;  2OTJ A;  1TS3 A;  4IFD G;  3TME A;  4PZ7 A;  4JI4 Q;  4HIM A;  5JVH 3;  3TP8 A;  5IGE A;  2Z1C A;  3NUC A;  1JCK B;  2BH2 A;  1MJE A;  1JB3 A;  3DWA A;  3J7Y W;  3FKI B;  2EJF C;  4GKK Q;  1SR3 A;  1LAB A;  2CVR A;  2IT1 A;  1EQQ A;  1CSP A;  3ULL A;  1IBL Q;  3OTO Q;  2ZXO A;  1L1O B;  1LT5 D;  1PH4 A;  2JA9 A;  2NN6 H;  3NEM A;  4GNX C;  1BDO A;  1V43 A;  4ZAI A;  3HKZ E;  4BBS G;  4A3C G;  3W3A A;  1EY8 A;  1VQ7 A;  2EQS A;  1TS4 A;  1X65 A;  1SYG A;  3CCR A;  3BYT B;  4DR3 Q;  1K8G A;  2F3I A;  1WCM H;  4A3I H;  2LMC B;  1VQN A;  1WI5 A;  4DR4 L;  2EJM A;  3UDI A;  1BVS A;  2CW0 C;  2OQK A;  4A3F H;  4LNQ A;  2HUG A;  3WDN A;  1VQK A;  2E2I B;  2G9D A;  3P75 A;  1P16 A;  1KAW A;  5I6Y A;  3DWP A;  3K0X A;  5C6A A;  2UXD L;  4QJF A;  3CCQ A;  1UEB A;  3T1Y Q;  2L4N A;  3AU7 A;  4RH6 A;  2RF4 A;  3J81 c;  2A68 D;  1E3P A;  5NUC A;  1B3Q A;  1RHP A;  2Y0S G;  1KC8 C;  3KK7 A;  2E8G A;  4DGZ A;  4K2K A;  3BS1 A;  1KD1 C;  1TWH B;  3TP7 A;  2ENB A;  2VXW A;  1I6H H;  1MJC A;  2BE5 C;  1X3G A;  4C2M H;  4HMJ A;  1Z7T A;  4CDE C;  5A35 A;  1CTM A;  3A8I E;  4R8I A;  5C4H A;  3GTL B;  3MXG A;  2Q2U A;  5M3M B;  1WTP A;  4JV5 Q;  2J0T D;  1TWF B;  4PMW A;  1B1Z A;  2XIW A;  4YWL A;  5FJ8 G;  4QIW E;  3FEW X;  3JAM L;  2DGY A;  2ZM6 Q;  3FKI H;  3URY A;  1IHZ A;  3MXN A;  4BY7 G;  3PO3 B;  2PQA B;  1F77 A;  1E1T A;  3OPO A;  1X3Q A;  2R61 A;  3MXP A;  4BY1 B;  1QJO A;  1KTK A;  5IOD A;  1STH A;  2RHS B;  1WFQ A;  4A93 H;  5JPN C;  1HQR D;  1BCP C;  3S24 A;  4K0K Q;  1EY7 A;  4JBJ A;  3A0J A;  4POF A;  4C56 C;  4B3S L;  4QUC A;  5IP9 H;  3CC4 A;  1UAP A;  4OWT B;  3RNU A;  1WTQ A;  4RMF A;  1XNQ L;  1S40 A;  2BCO A;  1SRO A;  2E2I H;  4MZ9 A;  3H6M A;  2Q2I A;  2FMM A;  5I6W A;  3Q8D A;  2YTX A;  3NP8 A;  3SGI A;  5J1Z A;  4QF4 A;  3D0F A;  3UDX A;  1QE6 A;  2EYP A;  3S15 B;  3CP0 A;  2KHI A;  1A0I A;  3OHX C;  3VYR A;  3F2C A;  4A3G B;  3TN2 A;  5EKI A;  1CHP D;  2CH4 W;  4A3K G;  4R4C A;  2QEX A;  3EN2 A;  3NWT A;  3J81 j;  3PIP 3;  1VQE A;  3EBE A;  3K5L A;  2Y0S E;  1P8L A;  1TU2 B;  1NBW A;  4O1N A;  1YNJ C;  2JJQ A;  1LT4 D;  1XMO Q;  3FPP A;  1SNQ A;  4LF5 L;  5M3M H;  1PH9 A;  3GTQ H;  1TWF H;  3D6W A;  2EXD A;  5EKL A;  3G6E A;  4OO1 H;  3K7U C;  1I3Q B;  4APV A;  1BBU A;  2QEJ C;  3BVM A;  3EQL C;  1EZ6 A;  1MD2 D;  3I70 A;  1K8A C;  4JC0 A;  4BY1 H;  1SJE D;  1KXL A;  3BYY B;  2QF7 A;  1C4Q A;  2YYZ A;  3RD4 A;  4DF7 A;  1Y14 B;  1DOL A;  2WV6 D;  2JA8 G;  1CZG A;  2K50 A;  4P71 A;  3CQZ B;  4JI3 Q;  3BDO A;  1MIU A;  4NPS A;  4V0B A;  5LMU L;  4ULL A;  4QY7 A;  3PIO 3;  3J80 L;  3TZD A;  2OCE A;  2EY1 A;  1F9P A;  4A3J H;  1JR0 D;  2RCF A;  1FGU A;  1ASY A;  3I4N G;  4GN4 B;  2E5L L;  4UP7 A;  1LTL A;  4I7A A;  4LUV A;  4UDU C;  1SYB A;  4LFA L;  1VQ4 A;  2A1A A;  4CHT B;  3S15 H;  2Z0S A;  2BE5 D;  1X54 A;  1PTO F;  1MSH A;  3IAY A;  1KLG D;  4A3G H;  3RZD B;  3K6O A;  4QL5 A;  2KEE A;  5C3W A;  2L9H A;  1SBB B;  1SE8 A;  4YY3 L;  1HZ9 A;  1S5B D;  3GTP B;  4DV0 L;  4JI6 L;  1HH2 P;  2NVY B;  3L3O C;  3MXU A;  3GTM H;  2F0S A;  3G6J B;  1CA5 A;  2GVA A;  4L6T B;  1W2B A;  2JXM B;  5M5X H;  1DZ1 A;  2JN4 A;  4V19 0;  4A3D B;  4TKO B;  4ME5 A;  5JJZ A;  5KND A;  1GO3 E;  3I4L A;  3I8Z A;  4C3H B;  4K8J A;  3HEJ A;  3A55 A;  3OOC A;  4NXN L;  2F0G A;  4GN3 B;  2JQO A;  2VL6 A;  2HT1 A;  1EUJ A;  1BCP D;  2C35 B;  3K5M A;  1AN8 A;  1F2Z A;  1J6Q A;  1ICF B;  1FYC A;  1JJ2 A;  5CR3 A;  4LF6 Q;  1I4G A;  1CFM A;  1A3U A;  3QJY A;  1VQA A;  3M3Y H;  1VQP A;  1H9S B;  4R4Q A;  1XNR L;  1GM5 A;  4L63 B;  5LL6 X;  1EU3 A;  4DK6 C;  1NJI C;  4GLV B;  4XT1 B;  1PYS B;  4LFC Q;  4DV3 Q;  3I56 A;  5ELO A;  3H3V H;  1U4L A;  4ME3 A;  2ASB A;  4RCO A;  2WB1 G;  3GTK B;  4N9P A;  1VQG A;  2F0D A;  1Z6H A;  2HIV A;  1Y1W G;  3HG9 A;  3KDF A;  1HZB A;  3RZD H;  2RCN A;  4AYB G;  2FIN B;  3D8G A;  1YNJ D;  2KCM A;  4R4O A;  3NBH A;  4LUZ A;  1F2M A;  4ZKB B;  3I4M G;  1JQY D;  3B6Y A;  4IFD I;  1U4M A;  1EY0 A;  4IPH A;  4KHZ A;  2NVY H;  3SHL A;  2PZU A;  3VR6 A;  5C44 G;  2ZJR A;  4EQN A;  4A3D H;  4DV4 L;  4K6L A;  5JEA J;  1QUQ A;  2PCF B;  5COY A;  1XYI A;  1DM0 B;  1WJJ A;  2IWH A;  5IT9 E;  1Q1B A;  4HJ8 A;  2QDB A;  2MNA A;  5FLX E;  4JI2 L;  4J6H A;  1BXT A;  1VQL A;  1A15 A;  5IYD G;  1FNW A;  1EFI D;  2HIX A;  3HRZ C;  2RDG A;  1G91 A;  5C4J B;  2R7Z H;  3CRL C;  2B2Y C;  3KJP A;  3IFT A;  2B2T A;  1EIY B;  2SOB A;  4KY5 A;  5CV7 A;  3QWN A;  4B3M Q;  4LW1 A;  1MHW C;  4RKL A;  2K6A A;  2MJ8 A;  3A5Z B;  2H5X A;  1LM0 A;  1KAB A;  3L9A X;  1IL8 A;  3BJU A;  1IKL A;  3DM3 A;  4DXF A;  5F2D A;  2D2C C;  2HDM A;  4P74 A;  5EKK A;  4BXX G;  3EFX D;  1HHV A;  3J7Z C;  3MA2 B;  3S17 B;  3CRK C;  4P73 A;  3HOW G;  2SEB D;  1WVL A;  2I0Q A;  1IYU A;  2AUJ D;  1SMY C;  3I3C A;  3ND8 A;  3GTO B;  4XIG S;  2IX3 A;  4MIU A;  2WB1 E;  2YTY A;  1LT6 D;  2ICE C;  5E1F A;  5KNB A;  5E4X A;  3PGZ A;  4JI5 L;  3D3R A;  2M2L A;  4HSP A;  2F4V Q;  1NMG A;  4TQU S;  4LMQ D;  2GVB A;  5L37 A;  3J7A F;  3G7L A;  1KHI A;  2ICI A;  1JJC B;  1J5E Q;  1NAP A;  3AB9 A;  3KF6 A;  4J8Q A;  2OWO A;  3H09 A;  2NVX B;  2J4X A;  3OYY A;  4KMU C;  3PO2 G;  1A6X A;  5BN3 A;  2RA4 A;  5EPJ A;  2JE6 I;  1UE7 A;  4RGT A;  4X66 Q;  1XPO A;  4FF3 A;  1A2T A;  2JA5 G;  1B53 A;  1IKM A;  3QG1 A;  3M4P A;  3BU2 A;  4C1N K;  1STN A;  5C4J H;  3TS0 A;  2PQE A;  1PHJ A;  4K8I A;  1DON A;  1GUO A;  3RLN A;  2AWN A;  3A8K E;  4NDX A;  1K8O A;  2CQA A;  1D5M C;  3EJI A;  3S9W A;  3VR2 A;  2E75 C;  3PF5 A;  5JJL A;  4B08 A;  2Q2T A;  4RA8 A;  3TP5 A;  2JEA I;  4LFB Q;  5IIF A;  4YHH L;  4ZKC B;  2VUM B;  3S17 H;  2MPM A;  2KHJ A;  1HTL D;  1I5F A;  5GRO A;  4LF7 L;  1YBY A;  2JP1 A;  3N52 A;  5CYU A;  4KHP L;  2XWB B;  4IUN A;  5IYC H;  3NPP A;  1Q81 C;  3LWU A;  4HAE A;  5JEA G;  2K5Q A;  1B4O A;  4JI4 L;  3GTO H;  4R8N A;  2KED A;  3S2H B;  1N34 L;  1A63 A;  4A3M G;  3X3N A;  1S5E D;  2LXJ A;  3SE0 A;  1L1O A;  4JVZ A;  4DR1 Q;  3MFY A;  1DOK A;  4MNO A;  2BDN A;  3RUZ A;  2B63 H;  2G9H D;  5C4Z A;  1WTV A;  2K05 A;  5M3F H;  1QVF A;  1I50 B;  4DV6 L;  1UE1 A;  4IZ8 A;  1NTG A;  3K59 A;  2D9U A;  4L5T A;  5I9P A;  4IO9 A;  4C3I G;  2XN9 C;  1PRT C;  2ZTC A;  4JBW A;  3L2P A;  4DR3 L;  4LF4 L;  1GUT A;  3S1N H;  1CKO A;  2RQX A;  1HNZ Q;  3WWV A;  3AQQ A;  4O42 A;  2NZO A;  4FXK C;  4DV7 Q;  4NW2 A;  2UXC Q;  4ZUJ A;  1KRS A;  2V1C C;  3D6C A;  4KN7 C;  4N8X 1;  3HOX G;  3HOV B;  1AEX A;  1CKN B;  4F87 A;  2HQE A;  5EAY A;  4GNX B;  1TXY A;  5C3E H;  2OT2 A;  4WJ3 M;  2NN6 G;  2D0P A;  4AH6 A;  1SYF A;  4KKS A;  4WOR A;  2BDO A;  1GUN A;  4MN3 A;  2F4I A;  4UPA A;  1VQ5 A;  2VUM H;  3BDC A;  4JYA Q;  2IW3 A;  4HIO A;  2AQ1 B;  1O7Z A;  4JBK A;  4A3I G;  3Q24 A;  2DY8 A;  2PQA A;  2QIL A;  4WJ4 A;  1PFN A;  3PUY A;  1ZEQ X;  1X55 A;  1K3B C;  1BOS A;  3MWY W;  5IT9 L;  5EPL A;  1QWY A;  2EYM A;  1MGS A;  3AFQ A;  5D3D A;  5FLX L;  1SJH D;  5KIX A;  2NZ1 D;  4DU9 A;  2MUY A;  1SE2 A;  4X62 L;  1EOT A;  2ZT9 C;  1PRT F;  4IPG A;  1R9T H;  2L55 A;  3DEO A;  2WFW A;  1E2W A;  3S14 B;  3PCO B;  2H4O A;  5KRU A;  1YVC A;  1ESF A;  1XPU A;  1LTS D;  4LF8 L;  3CAM A;  4IUT A;  1B44 D;  1GUW A;  1WCM B;  3D4D A;  1NR4 A;  5C5M A;  4MHE A;  2A69 C;  2JA6 B;  4DR2 Q;  1TWC B;  4A3F B;  3HZX A;  2NTS A;  4PMC A;  4R1J A;  1K8M A;  3R93 A;  3S1R B;  1K83 H;  1RCV D;  3A7A B;  1XMQ Q;  2UUB Q;  1HPC A;  2G5D A;  4K6D A;  3FKI G;  1PH7 A;  3HOV H;  4RHR A;  3DUZ A;  2MP1 A;  5IWA Q;  2L15 A;  4JI0 Q;  1SNM A;  1EOV A;  4XQJ A;  4OX9 L;  1BKB A;  4DN4 M;  5GAE C;  4B3R Q;  2B2W C;  2OTL A;  1JE5 A;  2HQL A;  3M4O H;  1TWG B;  1I6H B;  2R3Z A;  3HS0 C;  4LWC A;  1NUC A;  1IBK Q;  1LV9 A;  1VQF A;  1Q46 A;  1STE A;  1CT1 D;  1W6K A;  5IP9 G;  3J80 c;  4H44 C;  3SK8 A;  5LMN Q;  4HSV A;  4X64 Q;  3M4Y A;  1CHQ D;  1S5C D;  3P20 A;  3MVV A;  3W1G A;  4JOI C;  1C8C A;  4CBV A;  1O78 A;  3HGB A;  5LHY 1;  5BR8 L;  2RDH A;  5T1G A;  3DEP A;  2ALY B;  1D8L A;  3HOY H;  3F2U A;  3T4A C;  3QOJ A;  1ET9 A;  3J81 i;  3EIV A;  1QVC A;  2K32 A;  2D62 A;  4DFA A;  3SXH A;  4A93 B;  2AQ2 B;  5JJI A;  3S14 H;  1ENC A;  2C9O A;  3NE5 B;  2ID0 A;  1T9H A;  4GKJ Q;  2JA6 H;  1XTD A;  2PW5 A;  1TWC H;  5D14 A;  3Q0A A;  4A75 A;  3FP9 A;  3S1R H;  4DUY L;  3C1E A;  1I94 Q;  5CMD A;  4ALP A;  1K0S A;  2EJG C;  1QG7 A;  2F1M A;  2VNU D;  4HJ7 A;  4DV2 Q;  3PO3 G;  4FNF A;  2IX0 A;  3VA5 A;  1YJ9 A;  2EY5 A;  5TSS A;  1N33 Q;  2N55 A;  3J81 E;  1CA6 A;  4BY1 G;  1XPR A;  2DN8 A;  3MZ5 A;  1TWG H;  3NQT A;  3S1M B;  1DGS A;  4B9W A;  2F03 A;  1AZP A;  1B9M A;  3SR1 A;  1H9K A;  4HTH A;  5K36 H;  4A4I A;  2B39 A;  3BZD B;  3CW2 C;  1O7Y A;  4JW0 A;  3GTQ B;  1SNO A;  1UUP A;  1SXT A;  2B2U C;  3QOL A;  5C0X J;  1ILP A;  2ZTE A;  1B7Y B;  4R4I A;  3STB D;  4DV1 Q;  1PXU A;  2Z9H A;  4NB3 A;  4DR7 L;  3T1H Q;  1CZW A;  2K75 A;  4I7Z C;  1M4V A;  1UNS A;  1LT3 D;  2P5Z X;  4A3G G;  2EOT A;  1PTO H;  3PUZ A;  3PMF A;  1FJG Q;  1H9S A;  1RD9 D;  4GS3 A;  1WTO A;  3VYT A;  1N36 Q;  1D1I A;  3OMG A;  2WAC A;  1SNP A;  1NNX A;  1YNN C;  3FMC A;  2Q8T A;  5IYB H;  5FK9 C;  3ZJY C;  1UE5 A;  3KBG A;  3HP3 A;  1Y1V B;  1HR0 W;  4A3J B;  1WTX A;  1CI3 M;  2L12 A;  3V05 A;  2K7V A;  2AUK A;  1BO0 A;  1VQH A;  3PV0 A;  3IFD A;  1KLU D;  2IJ0 A;  5HUR A;  1IXR A;  2F0V A;  3LGJ A;  5EPK A;  1ROD A;  2N3S A;  4KHV A;  1M90 C;  4JI8 Q;  1V1O A;  4B3T Q;  2I07 B;  3GQB A;  3TZU A;  3VYS A;  3ONA B;  1Z47 A;  3PF4 A;  1WD0 A;  3E6Z X;  2E2J B;  1JWU D;  1PTO C;  3S1M H;  2RHQ B;  3KF8 B;  3L0O A;  3TQY A;  2HHH Q;  1R4Q B;  2MQH A;  1CK1 A;  4IOA A;  4LF9 L;  3GTM B;  4P72 A;  1IW7 C;  3KLS X;  5M5X B;  2K5D A;  4DK1 A;  3E0E A;  1SNC A;  4BBR B;  1KIX A;  3CCL A;  1JT8 A;  1JOO A;  1J9O A;  1PFS A;  1SFO H;  4QB4 A;  4A3C H;  4RGM A;  4DV5 L;  2XTI A;  3FRP B;  2XRQ D;  2A6H C;  2O4X A;  2K5N A;  3D4R A;  2YU9 H;  1TQO A;  2E2H H;  2UUA L;  3CHB D;  4GZY C;  3MTS A;  4KV6 A;  2CW0 D;  4RFB A;  3M3Y B;  1D5Z C;  1RTO A;  3A7L A;  1GD7 A;  3NXW A;  3K8A A;  4DNT B;  3S2D B;  1FR3 A;  2EDG A;  1Y1V H;  2L11 A;  4XT3 B;  2F0K A;  2K52 A;  4S3S A;  4A3D G;  5FO7 B;  4U67 3;  1N8R C;  1SDF A;  1Y69 U;  3DWQ A;  1JIC A;  4WRD A;  4G7O C;  1JOQ A;  4C3H G;  4FXD A;  2N88 A;  1UE6 A;  2CH4 A;  3SVM A;  3VA7 A;  2LFN A;  3GDE A;  3PQI A;  4R9W A;  2JEB I;  2NN6 I;  5T1I A;  4B9X A;  4AQY Q;  1F9S A;  1PZK D;  1N32 Q;  4YCV A;  4OXP A;  2Z6K A;  5C0X G;  4ZRZ A;  2E2J H;  1VF7 A;  1PZI D;  1VS0 A;  5JOB A;  2KHS A;  5FJ8 H;  3RZO H;  1K3R A;  2F4V L;  3KLR A;  5CV4 A;  3NWS A;  1PH8 A;  2UXD Q;  5E7N A;  4ZK9 B;  4BY7 H;  5I4D A;  4GOP C;  5DM7 3;  1CM9 A;  4BBR H;  3HOZ B;  4BA1 I;  3CCJ A;  1RJT A;  3HOU B;  2JYO A;  1J5E L;  5FO9 B;  3N6R A;  2V4D A;  4LAA A;  4A3E B;  1VCI A;  1A2U A;  3U4V A;  1STY A;  3H94 A;  4OIJ A;  3VR4 A;  1O80 A;  2KJX A;  3DMU A;  4KLK A;  4QQB X;  4HJ9 A;  1NR2 A;  2F0E A;  2R7Z B;  4Y52 H;  1I4H A;  3HKS A;  1RDP D;  2K01 A;  3S2D H;  4PZ6 A;  4IUV A;  4IAL A;  4IUQ A;  2CFM A;  2LS0 1;  3SK5 A;  1SLJ A;  4A3K H;  2R93 B;  1G2T A;  4UHV A;  5JAV A;  1X32 A;  2LSS A;  1PTO D;  4MTN A;  1NY4 A;  2Q8R E;  1HXY D;  4B3S Q;  4PNY A;  1TKW B;  3QIA A;  4P2C B;  2VB2 X;  4JI1 Q;  1Y8P B;  2B2V A;  4UY8 C;  3NHH A;  1FL0 A;  1Q7Y C;  3WOE A;  3M4Q A;  1FNV A;  4C3J B;  4HCE A;  4JI7 Q;  3QB3 A;  1SE4 A;  3ER0 A;  4OHJ A;  2NVT H;  2UUC Q;  2DY7 A;  1XXG A;  2X6G A;  3CCU A;  5H1S E;  4XDX A;  3HOZ H;  1PZJ D;  4CKC A;  3HOU H;  2DNC A;  5ELN A;  2RSO A;  1PLF A;  3IL8 A;  2FXQ A;  1Q8K A;  5ELB A;  4X65 L;  1W3S A;  3W2D A;  3T53 B;  1IZ6 A;  4UP8 A;  5ELD A;  4A3E H;  4HJA A;  3UE1 A;  3CPF A;  4HN7 A;  4DAY B;  1HNW Q;  1CKN A;  3KUP A;  4LF5 Q;  4RWS C;  2KBN A;  4M8A A;  1VMP A;  4DV7 L;  2KA7 A;  2N78 A;  3I4N H;  2AQ3 B;  4GNX A;  2UXC L;  1LYL A;  3QO2 A;  2FMC A;  2NUC A;  1HQM C;  1TS2 A;  2PI2 A;  1Y8N B;  1F2L A;  5C4X G;  2KCN A;  1IBM L;  2C5C A;  1A3T A;  2QA4 A;  3M9B A;  3BZC A;  2WII B;  1LTT D;  4A76 A;  1S3O A;  3MHB A;  1STA A;  2R93 H;  1WTW A;  1PRT B;  1OO9 B;  3W5O A;  2ZXP A;  5IGC A;  4JPB W;  4KN4 C;  3X3M A;  1JWM D;  5LMU Q;  2I5H A;  1HFG A;  3TRE A;  5FLM H;  2GN5 A;  1RL2 A;  1C0A A;  1TII D;  1B50 A;  3U9S A;  1YJW A;  2E5L Q;  4IJH A;  4C3J H;  2JK8 A;  4DA2 A;  2JA7 B;  4AYB E;  1HNX L;  4JK1 C;  2OQ0 A;  2DUD A;  2B63 B;  2ES2 A;  4G7H C;  5CV5 A;  5GAD C;  2K1B A;  5M3F B;  1K9M C;  4WFN 3;  1U5K A;  2X69 A;  5JJK A;  1H9J A;  1DOM A;  2VB3 X;  3V96 A;  2PPB C;  5IP7 H;  4YY3 Q;  4DR5 L;  4DV0 Q;  4JI6 Q;  3TS2 A;  5M5W H;  3S1N B;  4PV1 C;  3U9O A;  1HTP A;  1QCB D;  1KRT A;  2KVM A;  3UDF A;  5DNF A;  3CCE A;  4DR2 L;  1M1K C;  3H0G B;  1K73 C;  2GA4 B;  1GUS A;  1XMQ L;  2UUB L;  3RMH A;  4NXN Q;  5HGT A;  1WTR A;  3FHW A;  4L5R C;  4CKB A;  2NBF A;  2Z6B A;  3LNN A;  1EEF D;  4LK1 C;  5C3E B;  3RR5 A;  4B3R L;  2SDF A;  5AJ3 Q;  5M5Y B;  1X3P A;  4TSS A;  2EYJ A;  2EVB A;  3I4M H;  1VMC A;  3MEH A;  4IJL A;  4QGU A;  1ZKO A;  1OXU A;  2F0Q A;  4A3L G;  5C44 H;  3JC6 6;  2HCC A;  3K57 A;  4FXG C;  1EQT A;  5M9O A;  1EWH A;  1E24 A;  5D65 A;  1PH6 A;  3D4W A;  1SN8 A;  1U0L A;  2JA7 H;  3T13 A;  1PFM A;  4GKK L;  2R7F A;  1TWA H;  4CJ2 C;  1I4P A;  4OGQ C;  1SYD A;  1IBL L;  3H3V I;  2K28 A;  3OTO L;  3CU7 A;  1YEZ A;  1A8V A;  3UE0 A;  1IYJ B;  1X3E A;  1BNZ A;  1R9T B;  1STB A;  1XX8 A;  2MGS A;  2F0P A;  2FFK B;  1CKM A;  1L0Y B;  1XWE A;  1G29 1;  2OEO A;  1EYG A;  5I2X A;  5A2Q E;  2NVQ B;  2QW7 A;  4M1U B;  4L8J A;  1WOC A;  3E5S A;  5D3I B;  3CCM A;  5IE8 A;  2KQ3 A;  4RKB A;  5CBA E;  4XXE A;  3I2Z A;  4IUP A;  4DV4 Q;  1HUN A;  1S5D D;  3H0G H;  1SEB D;  1K83 B;  3JAM c;  3CCV A;  4HJ5 A;  2F0O A;  3TRZ A;  4FYD A;  5G3L F;  3NK9 A;  2BA1 A;  2WAQ B;  4DKA C;  3CMA A;  4N9T A;  5J3B A;  4KD4 A;  4XQQ A;  3PSI A;  1YHB A;  2QGQ A;  3KBX A;  2J7Z A;  4DV2 L;  3T1Y L;  3KYH C;  2AWO A;  3R8B A;  3ICE A;  3M4O B;  3DM1 A;  2CWA A;  4JI2 Q;  2UXB Q;  5M5Y H;  4KJO A;  1ONL A;  3R3O A;  1PVO A;  3J7A V;  1SMY D;  4O2D A;  3U58 A;  4DUZ Q;  5ISR A;  1A3V A;  4A3M B;  3ITP A;  4OEM B;  1I4R A;  5JPM C;  2IY5 B;  3OSO A;  5C0X I;  4Q0F A;  3GTJ B;  1SSO A;  3ND9 A;  4RHS A;  3E3X A;  3H15 A;  1WCM G;  4EQ5 A;  1DD2 A;  2JA6 G;  4JV5 L;  4A3F G;  1G2S A;  4K2L A;  4X3T A;  1RTN A;  5AFW A;  2I5L X;  2BOS A;  1ZXT A;  1H9M A;  1EIF A;  2F0F A;  4DV1 L;  2ZM6 L;  4IPD A;  5DEH A;  3HOY B;  3ZYY X;  1LTG D;  1ML0 D;  1AFP A;  1OXS C;  1I4X A;  3K81 C;  1LUZ A;  5JVG 3;  4EQO A;  2PMZ B;  2ATW A;  1AP0 A;  4H7B A;  1NCV A;  2PW7 A;  1D1K A;  4K5W A;  4JI5 Q;  3GO5 A;  2NVQ H;  2XGT A;  3C2P A;  4K0K L;  1S72 A;  2LXK A;  4XYQ A;  4JBM A;  3DXJ C;  3J80 i;  5J39 A;  1R4P B;  2F0J A;  1HJP A;  4IPC A;  1GOZ A;  4OL7 A;  2SNS A;  1EZ8 A;  2A5H A;  3GV6 A;  4RGN A;  4Z9C B;  1ET6 A;  1G51 A;  2F3V A;  4DNR B;  3ULP A;  2CWP A;  3KF8 A;  4PZ8 A;  4DXG A;  1H95 A;  3OIQ A;  1LAC A;  4OIK A;  3TEH B;  4Q5V A;  2WKD A;  3ULJ A;  1TY2 A;  1VQO A;  4ZQ3 A;  1HA6 A;  1VQ9 A;  1PFB A;  5FO8 B;  2NTT A;  4A93 G;  1HA5 A;  2XRS D;  2DJF C;  5IYB G;  1V1P B;  4YCW A;  4A3M H;  2XWJ B;  4K5X A;  2B8G A;  2O2L D;  5ELC A;  4KJN A;  3GTJ H;  4U68 A;  5IGD A;  1QNU A;  2DNE A;  3VDY A;  3TSS A;  1EYC A;  1QB5 D;  2KOL A;  4XTC S;  1XMO L;  1MSG A;  3HKZ B;  3J80 E;  3PIP A;  4JG2 A;  2K4K A;  2RSN A;  3RLO A;  1YIJ A;  1I4Q A;  2K03 A;  1KQS A;  4A3B B;  3T16 A;  1RF2 D;  3AFP A;  2R92 B;  4K14 A;  3C46 A;  1W6J A;  4YHH Q;  2VQE Q;  2ZJQ A;  3GTG H;  1EU4 A;  1AH9 A;  1HRJ A;  4LF7 Q;  4QUF A;  2QKI C;  4NXM Q;  1UEA B;  2M00 A;  2O5J C;  4KHP Q;  1PTO B;  2YV5 A;  1PRT D;  2M9V A;  1NE3 A;  1G6P A;  4CDF C;  2L0C A;  1SMX A;  1LO5 D;  4F8M A;  1N34 Q;  1BBW A;  1LTR D;  1BQQ T;  2QCP X;  3R2T A;  3P1H A;  2AKW B;  4UAI A;  3CF5 A;  1YJN A;  3HOX H;  3Q22 A;  4JI3 L;  1K0R A;  1QNK A;  4EGV A;  5M3M G;  3O13 A;  3P7J A;  4OO1 G;  3A74 A;  5CV8 A;  4DV6 Q;  3F2B A;  2AMC B;  2EY2 A;  1Q8I A;  3PIO A;  2B2Y A;  2B2T C;  4HIK A;  2B3G A;  2CQO A;  4QIW B;  2MFI A;  2F0I A;  4Y7N B;  1Q12 A;  1L0X B;  4LF4 Q;  4AQY L;  1OTC A;  1EL0 A;  1EY6 A;  3CC2 A;  1N32 L;  2SNM A;  1EYD A;  1AZQ A;  3E9H A;  1VQ8 A;  1YZ6 A;  2HD3 A;  4NKL A;  4FP5 D;  4BS9 A;  2Q2H A;  1LTA D;  5HY6 A;  4ZCK A;  1Y1V G;  2PZT A;  4DR6 Q;  4KTA A;  1QIL A;  1LLR D;  4MTK A;  4A3J G;  3IRB A;  5EJW A;  3BZK A;  3QR8 A;  5C5L A;  2FJ2 A;  3KLS A;  4A3B H;  1SFO B;  5KNC A;  2R92 H;  1JC7 A;  1GKH A;  4BBS B;  5DLQ E;  3SDZ A;  3SK6 A;  5A2Q L;  3K7A B;  4XYO A;  1SE3 A;  1EIG A;  2I5M X;  4E6I A;  4R4T A;  2YU9 B;  2EYO A;  2E2H B;  4HID A;  4LF6 L;  5HGQ A;  1XTC D;  4FF2 A;  2K14 A;  2A69 D;  4EQP A;  2MHV A;  2UU9 Q;  3G48 A;  4EVO A;  1D2B A;  4UP9 A;  3K5O A;  4GOP B;  2A74 C;  1T5X D;  1WTH A;  2VQF Q;  4ODG A;  4BBR G;  2Y0S B;  4LUO A;  4LFC L;  3BVG A;  4X62 Q;  4DV3 L;  1HZC A;  1NSN S;  3UDG A;  2KCT A;  1VQI A;  3J7A 5;  1SND A;  1WYD A;  1BUV T;  2MO0 A;  3FPU B;  1EY4 A;  3S16 B;  1D5X C;  4RCN A;  2K33 A;  4Y7N H;  1YI2 A;  4LF8 Q;  1U9R A;  4DAP A;  4IFD H;  1KAA A;  2NYZ D;  1NMF A;  4OEL B;  4JI1 L;  3I4O A;  3U50 C;  2L1B A;  1B70 B;  3ERS X;  1XJV A;  4PMB A;  3CXC A;  4HR7 B;  3RZO B;  1QVG A;  1VQM A;  1S5F D;  4JI7 L;  4H02 A;  4J15 A;  2UUC L;  4BY7 B;  4RAU C;  4OX9 Q;  1II3 A;  1O7L A;  1YHQ A;  5E3F A;  1CQF A;  3K0Y A;  1F9R A;  1EQV A;  1PH5 A;  4DAY A;  1B2T A;  1HR0 Q;  1TWH H;  1EY5 A;  1L1O C;  3AMU A;  4ID6 A;  1FGB D;  4BBS H;  3K7A H;  4FF4 A;  4ZUI A;  1QZH A;  1C9O A;  2EXZ A;  4FO2 A;  4H13 C;  2EY6 A;  2IHE A;  4KY7 A;  4X3S A;  5DAU A;  3GTL H;  1HNW L;  3NSW A;  2D5D A;  1JMC A;  2CKZ B;  2CHB D;  2F0W A;  4ZYS A;  1SYE A;  4B3M L;  5BR8 Q;  5DM6 3;  4AIM A;  3PO3 H;  4OWX B;  1B8A A;  1V1Q A;  3F8T A;  3HOZ G;  2ZTD A;  3Q23 A;  3HOU G;  1BCP F;  4A3K B;  5CV6 A;  1GUG A;  2MO1 A;  3GP7 A;  1PYW D;  4A3E G;  1O7I A;  3S16 H;  4O0A A;  4DAM A;  1EWI A;  3K5N A;  4G57 A;  3S1Q B;  2YTV A;  2WP8 J;  1TS5 A;  4DR4 Q;  2B8F A;  1C7Y A;  2KUM A;  2TSS A;  1GHJ A;  1Z9F A;  4DUY Q;  3K58 A;  2R7Z G;  1JJG A;  1K28 A;  4K5V A;  4JCV E;  2VZA A;  2NVT B;  2PO4 A;  3EA6 A;  3BG3 A;  3RLF A;  2DJG C;  3NTI A;  3MFG A;  3LX0 A;  5J22 A;  1L2F A;  3MEF A;  3VYU A;  3OIP A;  2R7D A;  4DAV A;  1MI2 A;  4LJZ C;  2OXP A;  2R93 G;  3CCS A;  1PH3 A;  4G7Z C;  1MKH A;  1YNN D;  2JA8 B;  2IL8 A;  1JOR A;  4FDB A;  5FLM G;  4GLA C;  4G4K A;  4X66 L;  5ELF A;  3T56 B;  4DK0 A;  1EFW A;  1CQV A;  1V9P A;  1E0B A;  1FNU A;  3R2I A;  1VQJ A;  3I4N B;  2N8N A;  2NZH A;  4C3J G;  1HCZ A;  2TMP A;  1I3Q H;  4RG1 A;  1ICW A;  3F2D A;  4DPG A;  4DR7 Q;  3A54 A;  1KNA A;  3J81 L;  4HED A;  5AJ3 L;  1GHK A;  3TBI B;  2VW9 A;  4FVM A;  4LFB L;  3PUW A;  3MAQ A;  3MXN B;  3AYH B;  5IP7 G;  1PH1 A;  5CBE E;  1JB7 A;  1VQD A;  3TDQ A;  4ABN A;  3CQZ H;  2I46 A;  1G6Z A;  2VY3 A;  1G8Z D;  3S1Q H;  4POG A;  1HUM A;  3TP6 A;  1IW7 D;  1C48 A;  1XNQ Q;  2B2W A;  2B29 A;  4PG3 A;  1GXD C;  2WIN B;  1EEI D; 
#chains in the Genus database with same CATH homology
 4QGU A;  4A3L G;  1OXU A;  3F2C A;  4OWW B;  4LWC A;  5C44 H;  3JC6 6;  1IBK Q;  1VQF A;  3CPW A;  3U4Z A;  1Q46 A;  4DR1 L;  1CSQ A;  4A3K G;  4R4C A;  3NEN A;  2QEX A;  5IP9 G;  3J80 c;  3EN2 A;  1E24 A;  3J81 j;  1PH6 A;  5LMN Q;  1VQE A;  3EBE A;  1SN8 A;  4X64 Q;  1U0L A;  3RN2 A;  1A62 A;  2JA7 H;  4L5S A;  1YNX A;  1P8L A;  2R7F A;  2Y0S E;  4GKK L;  1TWA H;  3K80 C;  1NBW A;  2JJQ A;  3DLL A;  1XMO Q;  1IBL L;  3H3V I;  3OTO L;  1YEZ A;  4JOI C;  3W1G A;  1A8V A;  4JOI A;  5M3M H;  3UE0 A;  1IYJ B;  1PH9 A;  4LF5 L;  2JA8 H;  3GTQ H;  3GTP H;  1X3E A;  4LF9 Q;  1TWF H;  1X3F A;  5BR8 L;  2EXD A;  3G6E A;  5IYC G;  2ALY B;  1CKM A;  1D8L A;  3K7U C;  4OON A;  3HOY H;  4APV A;  1HNZ L;  1G29 1;  1BBU A;  1EYG A;  3D31 A;  3J81 i;  3EIV A;  1QZG A;  1PV4 A;  1QVC A;  2D62 A;  1WOC A;  2ZJP A;  3CCM A;  1YHA A;  5IE8 A;  1ASZ A;  4C3H H;  5JJI A;  2JA7 G;  5IT9 c;  3S14 H;  3I2Z A;  1K8A C;  4JC0 A;  4BY1 H;  4DV4 Q;  1KXL A;  1X56 A;  3H0G H;  4DV5 Q;  2B63 G;  3JAM c;  3CCV A;  4OO1 I;  5FLX c;  4HJ5 A;  3TRZ A;  2ID0 A;  1GVP A;  2YYZ A;  1T9H A;  5M3F G;  1Y14 B;  2BA1 A;  3W1B A;  4DKA C;  1XTD A;  3CMA A;  2JA6 H;  2JA8 G;  2K50 A;  1TWC H;  5J3B A;  4P71 A;  5GAG C;  4A75 A;  2UXB L;  3PSI A;  1YHB A;  2UUA Q;  3FP9 A;  2QGQ A;  4JI3 Q;  2R6G A;  4DUY L;  1MIU A;  3S1R H;  4NPS A;  5LMU L;  4DV2 L;  3T1Y L;  3KYH C;  2AWO A;  4QY7 A;  4ALP A;  4DUZ L;  2OCE A;  3ICE A;  4A3J H;  2VNU D;  4JYA L;  2CWA A;  4JI2 Q;  1FGU A;  4HJ7 A;  1Q86 C;  5M5Y H;  1PA6 A;  1ASY A;  2UXB Q;  3I4N G;  1PVO A;  4DV2 Q;  1PH2 A;  4O2D A;  3PO3 G;  4GN4 B;  2IX0 A;  2E5L L;  2F52 A;  3U58 A;  1YJ9 A;  4UP7 A;  2KEN A;  4DUZ Q;  1LTL A;  1N33 Q;  4LUV A;  3E9I A;  2IY5 B;  4BY1 G;  4LFA L;  1VQ4 A;  5C0X I;  2BA0 A;  1XPR A;  3H0G G;  2A1A A;  3I7F A;  3S15 H;  3H15 A;  1TWG H;  1Q82 C;  2Z0S A;  1WCM G;  4EQ5 A;  1X54 A;  1DGS A;  2PNH A;  2JA6 G;  4A3G H;  4TVA B;  4LFA Q;  4JV5 L;  4A3F G;  3GTK H;  4QL5 A;  4GN5 A;  3KLW A;  4A4I A;  5C3E G;  2I5L X;  3CW2 C;  1SE8 A;  3PUX A;  4YY3 L;  1EIF A;  1HZ9 A;  4DV1 L;  4DV0 L;  2ZM6 L;  1L0W A;  4JI6 L;  1HH2 P;  3G4S A;  4IPD A;  4GLX A;  5C0X J;  3GTM H;  2ZTE A;  1B7Y B;  4R4I A;  2GVA A;  1W2B A;  2VUM G;  3STB D;  1OXS C;  3K81 C;  4IJL A;  5M5X H;  4DV1 Q;  1LUZ A;  4NB3 A;  4DR7 L;  3T1H Q;  2K75 A;  2ATW A;  1GO3 E;  1PYB A;  4JI5 Q;  4A3G G;  3PUZ A;  4NXN L;  1FJG Q;  3GO5 A;  2NVQ H;  4GS3 A;  4GN3 B;  2XGT A;  1N36 Q;  2JQO A;  1S72 A;  4K0K L;  2VL6 A;  4KI0 A;  2HT1 A;  2N49 A;  2LXK A;  1EUJ A;  2C35 B;  5IYB H;  4JBM A;  1J6Q A;  3J80 i;  3ZJY C;  1UE5 A;  1JJ2 A;  1HJP A;  4IPC A;  4LF6 Q;  5IWA L;  4JI0 L;  1Y1W H;  1HR0 W;  3M7N A;  2UXC L;  1G51 A;  1VQA A;  3G71 A;  3M3Y H;  1VQP A;  3ULP A;  2CWP A;  4PZ8 A;  4R4Q A;  1XNR L;  1GM5 A;  1VQH A;  1H95 A;  3PV0 A;  4DK6 C;  1IBK L;  1IXR A;  3TEH B;  3ULJ A;  1NJI C;  4GLV B;  1UWV A;  1EQR A;  3LGJ A;  1PYS B;  1VQO A;  4LFC Q;  2A19 A;  3I56 A;  5ELO A;  2N3S A;  4DV3 Q;  1CUK A;  1X9N A;  1VQ9 A;  1M90 C;  1XNR Q;  4A93 G;  5IYB G;  4JI8 Q;  3H3V H;  4YCW A;  5LMN L;  4A3M H;  4B3T Q;  4ME3 A;  4X64 L;  2ASB A;  1N9W A;  2WB1 G;  1Z47 A;  3PF4 A;  3L7Z C;  3GTJ H;  1VQG A;  3VDY A;  2HIV A;  1Y1W G;  3S1M H;  2RHQ B;  4XTC S;  3KF8 B;  3L0O A;  3TQY A;  3JAM i;  1XMO L;  2HHH Q;  2MQH A;  3HOV G;  2WAQ G;  3KDF A;  1HZB A;  3PIP A;  3RZD H;  4JG2 A;  2RCN A;  4AYB G;  2VQE L;  4IOA A;  2K4K A;  1YIJ A;  3RLO A;  4LF9 L;  3NEL A;  2KCM A;  4R4O A;  2BH8 A;  4P72 A;  1KQS A;  4NXM L;  4LUZ A;  3AFP A;  3I4M G;  3E0E A;  3B6Y A;  4IFD I;  4YHH Q;  2VQE Q;  2ZJQ A;  4KHZ A;  4IPH A;  1KIX A;  2NVY H;  3GTG H;  1IL2 A;  1AH9 A;  4LF7 Q;  3CCL A;  5IYD H;  3A5U A;  1JT8 A;  4NXM Q;  5C44 G;  4KHP Q;  1PFS A;  2K5V A;  2ZJR A;  2YV5 A;  1SFO H;  5GQO A;  4A3D H;  1NE3 A;  3KDF B;  1G6P A;  4DV4 L;  4A3C H;  4DV5 L;  2XTI A;  1SMX A;  2VS1 A;  5JEA J;  1N34 Q;  5C4X H;  1BBW A;  1QUQ A;  3OW2 A;  3NBH B;  1WJJ A;  2K5N A;  4GKJ L;  2AKW B;  3I55 A;  2YU9 H;  1KL9 A;  3CF5 A;  1YJN A;  2E2H H;  3HOX H;  2UUA L;  1Q1B A;  4HJ8 A;  4IFD J;  4JI3 L;  1I94 L;  1K0R A;  2MNA A;  5M3M G;  4X65 Q;  4BXX H;  2NVX H;  4DK3 C;  4JI2 L;  1GD7 A;  3K8A A;  1E7Z A;  1VQL A;  3HOW H;  4OO1 G;  3A74 A;  5IYD G;  4DV6 Q;  3HOY G;  1Y1V H;  2HIX A;  3F2B A;  2AMC B;  2K52 A;  1QUQ B;  4P75 A;  3PIO A;  1N33 L;  3KJP A;  2R7Z H;  4A3D G;  1N8R C;  1EIY B;  4HIK A;  2B3G A;  2CQO A;  2MFI A;  4B3M Q;  4LW1 A;  1Q12 A;  4LF4 Q;  1UE6 A;  4AQY L;  3A5Z B;  1OTC A;  1VQ6 A;  2H5X A;  1LM0 A;  3PUV A;  3GDE A;  3CC2 A;  1N32 L;  1E22 A;  3BJU A;  5GAH C;  3DM3 A;  2JEB I;  2NN6 I;  3E9H A;  1VQ8 A;  4P74 A;  1YZ6 A;  4DR6 L;  4BXX G;  4AQY Q;  1IBM Q;  3J7Z C;  1N32 Q;  2Z6K C;  4YCV A;  4OXP A;  2Z6K A;  2Q2H A;  5C0X G;  4P73 A;  3HOW G;  4GKJ Q;  5HY6 A;  4X6A H;  2E2J H;  1Y1V G;  2I0Q A;  1VS0 A;  4DR6 Q;  1D7Q A;  4A3J G;  3IRB A;  5FJ8 H;  2IHF A;  3BZK A;  4YWM A;  1YIT A;  1K3R A;  3AEV A;  2F4V L;  4YCU A;  3T1H L;  1PH8 A;  4XIG S;  3RZO H;  2WB1 E;  3PO2 H;  2YTY A;  3I4M H;  5E7N A;  2UXD Q;  3PGZ A;  4A3B H;  4JI5 L;  4BY7 H;  4GOP C;  1HZA A;  2R92 H;  4GOP A;  3CD6 A;  3M85 A;  1AE3 A;  1FJG L;  1GKH A;  4BBR H;  2F4V Q;  5DLQ E;  4BA1 I;  3CCJ A;  1NMG A;  2WAQ E;  4IOC A;  3RN5 A;  1N36 L;  2JA5 H;  1X6O A;  4TQU S;  1J5E L;  2GVB A;  3S2H H;  1I94 Q;  2I5M X;  2UU9 L;  2A8V A;  4R4T A;  4HID A;  5K36 G;  4LF6 L;  1KHI A;  1HNX Q;  1JJC B;  5HGQ A;  1J5E Q;  2K14 A;  1OXV A;  2PI2 E;  3KF6 A;  4YWK A;  3HKZ G;  1VCI A;  3U4V A;  3G48 A;  2VQF L;  1OXT A;  2UU9 Q;  4UP9 A;  2OWO A;  3KJO A;  1RIP A;  1FVI A;  4GOP B;  2CCZ A;  4L5Q A;  3OYY A;  3GD7 A;  3PO2 G;  1I50 H;  3STB C;  2VQF Q;  2JE6 I;  4A3B G;  3KOJ A;  4KLK A;  1UE7 A;  2R92 G;  4HJ9 A;  4QQB X;  5LMN W;  4X66 Q;  4Y52 H;  4BBR G;  1XPO A;  3HKS A;  2K5H A;  4LUO A;  2JA5 G;  4DR5 Q;  4LFC L;  1E1O A;  4X62 Q;  2D0O A;  4PZ6 A;  4DV3 L;  3S2D H;  1HZC A;  1VQC A;  3M4P A;  3BU2 A;  4JI8 L;  3UDG A;  3TS0 A;  2KCT A;  5C4J H;  3KF6 B;  1VQI A;  3CME A;  4B3T L;  3J7A 5;  4A3L H;  2CFM A;  3HFZ B;  1WYD A;  1PHJ A;  3RLN A;  2AWN A;  2MO0 A;  1SLJ A;  4Y7N H;  4A3K H;  1YI2 A;  4LF8 Q;  2HHH L;  4BA2 I;  1AE2 A;  3PF5 A;  3F1Z A;  1OXX K;  2LSS A;  5JJL A;  1NMF A;  3U50 C;  4JI1 L;  3I4O A;  4MTN A;  1NY4 A;  1B70 B;  3ERS X;  2Q2T A;  2JEA I;  1XJV A;  2PMZ E;  4B3S Q;  3CXC A;  4LFB Q;  4DNI A;  5IY0 A;  4YHH L;  1QVG A;  4JI1 Q;  3S17 H;  1VQM A;  4JI7 L;  2KHJ A;  4H02 A;  4J15 A;  1I5F A;  4UY8 C;  2EIF A;  5GRO A;  1FL0 A;  1YBY A;  1Q7Y C;  2UUC L;  4LF7 L;  1VQB A;  2AHO B;  3M4Q A;  4KHP L;  3CC7 A;  4EX5 A;  1HR0 L;  5IYC H;  4OX9 Q;  1Q81 C;  3KFU A;  4JI7 Q;  4JI4 L;  5JEA G;  3ER0 A;  2NVT H;  4C3I H;  1SRU A;  1YHQ A;  2UUC Q;  2IX1 A;  3GTO H;  1PH5 A;  1Q1E A;  3CCU A;  1N34 L;  1A63 A;  4A3M G;  1HR0 Q;  5H1S E;  2OTJ A;  4IFD G;  1TWH H;  4PZ7 A;  2LXJ A;  1L1O C;  4JI4 Q;  4HIM A;  1L1O A;  3HOZ H;  4BBS H;  3K7A H;  3HOU H;  4DR1 Q;  5ELN A;  4MNO A;  1QZH A;  2B63 H;  2FXQ A;  1Q8K A;  1C9O A;  4X65 L;  1W3S A;  2BH2 A;  2IHE A;  1MJE A;  3GTL H;  1HNW L;  1QVF A;  5M3F H;  1IZ6 A;  4UP8 A;  4DV6 L;  4A3E H;  4GKK Q;  1UE1 A;  4HJA A;  1SR3 A;  3UE1 A;  1NTG A;  3CPF A;  1JMC A;  2IT1 A;  2CKZ B;  4DAY B;  1CSP A;  3ULL A;  1EQQ A;  1IBL Q;  1CKN A;  3OTO Q;  4L5T A;  1HNW Q;  4LF5 Q;  4IO9 A;  1L1O B;  2KBN A;  1PH4 A;  2JA9 A;  4DV7 L;  4JBW A;  2ZTC A;  3L2P A;  4DR3 L;  3NEM A;  2N78 A;  5BR8 Q;  4GNX C;  4B3M L;  4GNX A;  4LF4 L;  3I4N H;  4AIM A;  3S1N H;  1V43 A;  1CKO A;  4OWX B;  1B8A A;  3PO3 H;  1V1Q A;  1LYL A;  3F8T A;  1HNZ Q;  2ZTD A;  3HKZ E;  3HOZ G;  3WWV A;  3AQQ A;  1VQ7 A;  4BBS G;  4A3C G;  2EQS A;  2NZO A;  3HOU G;  1X65 A;  3CCR A;  4DV7 Q;  2PI2 A;  4DR3 Q;  5C4X G;  2UXC Q;  1K8G A;  1KRS A;  2F3I A;  1IBM L;  2V1C C;  1WCM H;  4A3I H;  1VQN A;  3HOX G;  2MO1 A;  2QA4 A;  1WI5 A;  1CKN B;  3BZC A;  3M9B A;  3UDI A;  1BVS A;  4A3E G;  4DR4 L;  2OQK A;  4A3F H;  1O7I A;  3S16 H;  4LNQ A;  4O0A A;  1S3O A;  4A76 A;  1VQK A;  2R93 H;  4DAM A;  1EWI A;  5EAY A;  3W5O A;  4GNX B;  1P16 A;  2YTV A;  1TXY A;  2WP8 J;  5C3E H;  4DR4 Q;  1KAW A;  1C7Y A;  4WJ3 M;  3K0X A;  2UXD L;  4QJF A;  1Z9F A;  2NN6 G;  2D0P A;  4AH6 A;  3CCQ A;  1UEB A;  4DUY Q;  5LMU Q;  2I5H A;  3T1Y Q;  3TRE A;  2R7Z G;  1JJG A;  5FLM H;  2GN5 A;  2RF4 A;  3J81 c;  1RL2 A;  1E3P A;  4JCV E;  2VZA A;  4UPA A;  1KC8 C;  2Y0S G;  1VQ5 A;  2VUM H;  1C0A A;  4JYA Q;  2E8G A;  3RLF A;  4HIO A;  1YJW A;  1KD1 C;  2E5L Q;  4JBK A;  4IJH A;  1I6H H;  1MJC A;  4A3I G;  4C3J H;  4C2M H;  1X3G A;  2JK8 A;  1L2F A;  3MEF A;  4AYB E;  2R7D A;  1HNX L;  2OQ0 A;  2DUD A;  2R93 G;  2PQA A;  3CCS A;  2ES2 A;  4WJ4 A;  1PH3 A;  3PUY A;  2Q2U A;  5GAD C;  1X55 A;  1MKH A;  1K9M C;  1U5K A;  4JV5 Q;  5JJK A;  4PMW A;  3AFQ A;  4FDB A;  4YWL A;  5FJ8 G;  4QIW E;  5FLM G;  4GLA C;  4X66 L;  2DGY A;  5IP7 H;  4YY3 Q;  4DR5 L;  4DV0 Q;  2ZM6 Q;  1EFW A;  3FKI H;  1V9P A;  4X62 L;  4JI6 Q;  3TS2 A;  4IPG A;  1VQJ A;  5M5W H;  4BY7 G;  1R9T H;  2WFW A;  2N8N A;  2PQA B;  2NZH A;  1E1T A;  1KRT A;  1I3Q H;  4RG1 A;  3UDF A;  3PCO B;  3F2D A;  3CCE A;  1YVC A;  4DPG A;  4DR2 L;  4DR7 Q;  1M1K C;  1XPU A;  4LF8 L;  1K73 C;  3CAM A;  2RHS B;  1WFQ A;  4A93 H;  1XMQ L;  2UUB L;  4NXN Q;  4DR2 Q;  3S24 A;  4L5R C;  3FHW A;  5AJ3 L;  4K0K Q;  4JBJ A;  3A0J A;  4POF A;  4B3S L;  2VW9 A;  4R1J A;  4LFB L;  3PUW A;  1K83 H;  3MXN B;  5IP9 H;  3CC4 A;  1XMQ Q;  2UUB Q;  4OWT B;  3AYH B;  3RR5 A;  5IP7 G;  1PH1 A;  3RNU A;  4B3R L;  3HOV H;  4RMF A;  3FKI G;  1VQD A;  1PH7 A;  1JB7 A;  1XNQ L;  5AJ3 Q;  1S40 A;  3CQZ H;  1SRO A;  2L15 A;  2VY3 A;  5IWA Q;  4MZ9 A;  2E2I H;  2Q2I A;  4JI0 Q;  3S1Q H;  1EOV A;  4POG A;  4OX9 L;  1BKB A;  5GAE C;  4B3R Q;  3Q8D A;  2YTX A;  1XNQ Q;  3SGI A;  1JE5 A;  2HQL A;  2OTL A;  2B29 A;  3D0F A;  3UDX A;  3M4O H;  4PG3 A;  3CP0 A;  2KHI A;  1A0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...