1N33L

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position at the a site with paromomycin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
total genus 12
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1n33L00
5C0XG 4A3EG 4OXPA 2WAQE 4OWXB 4DV5L 4LUVA 1HZ9A 1QVFA 3PIPA 4BBSH 2UXCQ 1KQSA 2MFIA 5LMNW 2D0PA 1HZCA 3RZOH 1HNZL 4GN4B 1S3OA 2OQKA 3EIVA 1KAWA 1CUKA 3HKSA 3KLWA 3G4SA 2LXKA 4LF7Q 3CD6A 5IY0A 1X54A 4GOPB 1Q1EA 3D0FA 2WB1E 1VQIA 4JBJA 2LSSA 4PZ7A 1A8VA 4QY7A 1JJ2A 3I4OA 2BH2A 3S17H 2VQFQ 4DR7L 4XTCS 5IT9c 2Q2TA 1VCIA 3M4OH 3S1RH 1VQ7A 2CQOA 4NXMQ 2UXBL 5FJ8H 1AE2A 1TWHH 1VQHA 5IYDG 3A5ZB 4Y7NH 3CCQA 4A3IH 1L0WA 4DV5Q 3F8TA 1PH7A 4JI5Q 3FKIG 5FLMG 4POGA 3KJOA 3U50C 2LXJA 4DK6C 3I55A 3HKZE 4GS3A 1NMFA 2CFMA 4ME3A 4AIMA 4X65Q 3CXCA 4DUZL 5GROA 5GAGC 1B8AA 1E7ZA 3KDFA 4OWTB 4LF5L 1K3RA 4H02A 1RIPA 3CCJA 3RLOA 1GVPA 1TWCH 4DR7Q 2HHHQ 2BA1A 5GAEC 2UXDL 4A3KG 1E24A 2JA7H 2Q2IA 4LF4Q 4BY7H 2UXBQ 1GD7A 3KYHC 1VQMA 3PF5A 1AH9A 1TXYA 1EQQA 2B29A 4WJ4A 1BBWA 4P74A 1WCMG 1KRTA 2VQEL 3UDFA 3G6EA 4PZ6A 4JI4L 1O7IA 5C0XJ 3CAMA 4DR1L 2F4VL 1K83H 1A63A 4DUZQ 1V43A 1XMQL 1XNQL 4NPSA 3A0JA 1PH6A 4JOIA 1VQAA 3I4MH 4JCVE 1N34L 4LF6L 1HZAA 4P72A 1L1OC 4HJ7A 4LF5Q 1Y1VG 3I4NG 4IFDG 4QJFA 2E2IH 4A3EH 1SR3A 1GKHA 4EX5A 1VQKA 5IYCG 4IOAA 1J5EL 4GLAC 2E5LL 4DV1L 4KHZA 4OWWB 3E0EA 4GNXA 3AEVA 1VQPA 2Z0SA 2KENA 4A3DG 2YTVA 2VQEQ 1NBWA 3RN5A 4JI4Q 4LFAL 4DR1Q 4X6AH 1V9PA 1I50H 4KI0A 3E9HA 4UP9A 5M3FG 4B3SQ 1RL2A 2R93G 1XMQQ 2R7DA 4BBRG 2K50A 1XNQQ 2VUMG 1Q1BA 2I5MX 1L1OB 4HIOA 1U0LA 3CC7A 4A3GH 3H3VH 3GTKH 4KHPL 2DGYA 5IWAL 3TREA 1KRSA 1WJJA 2JQOA 3GTLH 3S14H 4P71A 2ZJPA 3U4ZA 2R92H 3PCOB 4OONA 4L5RC 4JI0Q 4YCUA 2E5LQ 5IE8A 4DV1Q 1VQEA 2H5XA 3M9BA 5FLMH 1IZ6A 4LF4L 1KIXA 3M3YH 4B3RQ 1CSQA 1K8AC 5C3EH 2PI2E 5LMNL 4HJ8A 1SFOH 2A1AA 1W3SA 1YJWA 4K0KL 1HR0W 3BZKA 3OYYA 3MEFA 2MQHA 3GTGH 3B6YA 2VY3A 3L0OA 4LFAQ 3UDGA 1EYGA 4GKJL 4JBKA 2RHSB 2Y0SG 4JC0A 1BBUA 4QIWE 4IPDA 4DAMA 5IYBG 1OXUA 4R4QA 2OWOA 1K0RA 4A3KH 3CMAA 1PH2A 2AWNA 2BA0A 3NEMA 1OXVA 4XIGS 5IWAQ 3F2CA 4DV0L 4A3JH 2VS1A 3J80c 2CCZA 4A4IA 4A93G 3ZJYC 3AFQA 4JI3L 2ALYB 3CPFA 3DLLA 4IFDJ 2VZAA 4JI2Q 1WCMH 2ATWA 2ZJQA 4DPGA 4BA2I 4L5TA 3HOWG 2CKZB 3TS2A 3VDYA 5M3MG 2KCMA 2EIFA 1NY4A 3NENA 2ASBA 4DV7L 4A3BG 4GKJQ 4IPCA 5HY6A 2QGQA 1NTGA 1C0AA 5M5WH 1MJCA 2YTXA 4C2MH 1M90C 2JA5G 1QUQB 1Y1VH 2B63G 3I4NH 5BR8L 1U5KA 2IX1A 2R7ZH 1HJPA 3STBC 3HOYG 4DV0Q 5IYCH 1X56A 1MKHA 1VQBA 1NMGA 1WOCA 3KDFB 4JOIC 1C7YA 2IY5B 4DV2Q 3STBD 5IP9G 2NZOA 3FP9A 5J3BA 1PVOA 2OTLA 1FGUA 2HIXA 3W5OA 1IBML 4AYBG 5JEAG 4L5SA 5M3FH 1IXRA 5IP7G 1Z47A 1YEZA 1I3QH 3RLFA 5JJIA 2R93H 2K5VA 2WAQG 4LF8L 2VUMH 3S24A 5AJ3Q 4DV7Q 4GNXC 3CCSA 1Z9FA 4DK3C 2UUBL 3BZCA 5C4XH 3HOZH 1XNRL 3PSIA 1YITA 4TVAB 5BR8Q 3S15H 1OXSC 2ZM6L 2EQSA 2Q2UA 4HJ5A 1XJVA 1QUQA 3KF8B 1HNZQ 3PF4A 3S1QH 1I94L 2NVXH 2WB1G 1IBKL 1K8GA 3ICEA 3UE0A 3M4PA 1EOVA 2K5HA 5LMUL 1W2BA 1FL0A 1PH3A 1G6PA 1FJGL 3ERSX 1PA6A 4QL5A 1E1TA 1KC8C 1CKMA 2N3SA 4GNXB 2HT1A 5IYBH 4A3FG 2KCTA 2N78A 2NN6G 2K75A 3HOVH 2NZHA 2UUBQ 2AWOA 4GN5A 3I56A 3H15A 2YTYA 1VQJA 4AH6A 5C4JH 4YHHL 1Y1WH 3ER0A 3HKZG 2K52A 5C44G 1GO3E 1FVIA 2ZM6Q 1OXXK 1WI5A 5ELNA 1GM5A 4YY3L 1VQLA 2A8VA 3TQYA 1D8LA 1J6QA 1Q46A 2F52A 1BVSA 4LUOA 2NN6I 4R4TA 1SMXA 3W1GA 1SN8A 5M3MH 3PUXA 4LFBL 3A74A 3L7ZC 4C3IH 4DKAC 1NJIC 4JV5L 1FJGQ 4TQUS 3J80i 1YZ6A 1Q7YC 2Z6KA 2NVQH 2RF4A 2GVBA 2NVTH 2UXDQ 1CSPA 4IJHA 1EIFA 4HJ9A 2JA5H 1EWIA 1OXTA 5HGQA 3DM3A 4MNOA 2B63H 3T1HL 1QZHA 3K8AA 4NXNL 5JEAJ 3HOXG 3G48A 3HOYH 2XTIA 4JG2A 1XPRA 4IO9A 1PFSA 3J81i 4PG3A 5IP9H 2F4VQ 2B3GA 3ULLA 3OW2A 4GN3B 1YJNA 1PH4A 1OTCA 3G71A 3WWVA 1VS0A 4DR5L 2IX0A 1I5FA 1NE3A 2XGTA 4AQYL 2E2JH 2I0QA 1KXLA 4MZ9A 4LFBQ 1G291 3K7AH 2JA9A 3GO5A 4EQ5A 5IP7H 5H1SE 1A0IA 1N34Q 4B3TL 4LF6Q 1IL2A 2IHEA 4A3MG 1PH9A 1N33L 2FXQA 3CC4A 3NELA 5IYDH 4OX9L 2UU9L 1WFQA 4O0AA 3T1HQ 1X3FA 4DR2L 1J5EQ 4IPGA 4LUZA 4NXNQ 3FKIH 2ID0A 4DR6L 3LGJA 1X3EA 2VW9A 3CPWA 4LFCL 2JA6G 1Q82C 2YYZA 1IBLL 1B7YB 1M1KC 3PGZA 3RNUA 3U58A 1ASYA 1XMOL 4DR5Q 1Q81C 5FLXc 4R4OA 1N36L 1EUJA 1BKBA 3H0GG 4JI1L 4B3TQ 5EAYA 4JI8L 2EXDA 4JI7L 4KHPQ 4X66L 3UDXA 1PH1A 1SRUA 4YWLA 4DR3L 1PHJA 3GTPH 4R1JA 4OX9Q 2UU9Q 3K80C 4X62L 2MNAA 3HOUG 1Q8KA 1V1QA 2JE6I 4DR2Q 5C44H 3GTJH 1K9MC 2UUCL 3I2ZA 1DGSA 2JK8A 3W1BA 3F1ZA 3I7FA 1MIUA 1YBYA 3RN2A 1HNXL 1S72A 2R7FA 1ASZA 4DR6Q 5LMNQ 4LFCQ 2I5LX 4DUYL 4JI6L 3PO3G 4K0KQ 1H95A 1UEBA 2DUDA 2NVYH 1VQ6A 4J15A 3NBHB 5M5XH 2JA7G 3J81j 2QEXA 2V1CC 2JJQA 1XMOQ 2PMZE 3L2PA 1PV4A 2JEBI 4PMWA 4JI1Q 4JI7Q 5GAHC 1KL9A 3D31A 4ALPA 2PQAA 4DAYB 3RZDH 2YU9H 2AKWB 4UPAA 3HOXH 4Y52H 4UP7A 3CCMA 4JI3Q 1JMCA 3J7A5 4A3DH 3CCEA 1VQ8A 4GLXA 1HNWL 3M4QA 2UUCQ 2Z6KC 2VQFL 4DNIA 1HNXQ 4FDBA 1L2FA 4YWMA 3CCVA 2HIVA 4DUYQ 2IT1A 1XPOA 4JI6Q 3T1YL 4BBRH 1JJCB 1UE7A 4YCWA 1X9NA 1HNWQ 4GLVB 1UWVA 3CCLA 4LW1A 4JI5L 4A3MH 3U4VA 2WP8J 1EIYB 2KHJA 4X65L 3GTMH 4O2DA 2GVAA 1YVCA 1VQNA 3EN2A 2KHIA 3E9IA 5C0XI 4APVA 3GD7A 2RHQB 4A76A 1R9TH 3GDEA 4UP8A 1CKNA 2ES2A 2JA6H 4OO1G 2CWPA 4A3LG 2HHHL 1XTDA 3PUZA 3BU2A 4HIKA 1IYJB 1X6OA 2KBNA 1IBMQ 3ULPA 4A3GG 1VQFA 3F2DA 1Q86C 4LWCA 4DV3L 3GTQH 3T1YQ 4LF8Q 2HQLA 2R92G 1LUZA 1VQOA 3UDIA 1K73C 1LTLA 1N9WA 2A19A 3H0GH 3RR5A 4DV4L 4OO1I 1XNRQ 3PV0A 5GQOA 3S1MH 4B3ML 3JAMc 3H3VI 1PH5A 4A3CG 5E7NA 4BY1G 5C3EG 3CCUA 4A93H 1B70B 4NB3A 4POFA 1YNXA 5M5YH 4A75A 3MXNB 1E1OA 5DLQE 2UUAL 3HOUH 3S2HH 3F2BA 1I94Q 3AQQA 1HH2P 2OCEA 3HOWH 3CP0A 4L5QA 2OTJA 3CCRA 1IBKQ 5K36G 2JEAI 3PO2G 3AFPA 3PO3H 5LMUQ 3M7NA 1WYDA 4JBWA 2ZJRA 1TWFH 4YCVA 2K14A 4GOPA 1VQ9A 2JA8G 3S1NH 1HR0L 1TWGH 1N32L 4A3BH 4A3JG 4IOCA 2D62A 1C9OA 2IHFA 2K5NA 2N49A 4DV3Q 2ZTDA 1SE8A 3ULJA 3PIOA 2QA4A 4BXXG 2AMCB 3S2DH 1PYBA 4DV4Q 1MJEA 3TRZA 4B3MQ 4YHHQ 4DV6L 4P75A 3JC66 4B3SL 4R4CA 1E22A 1UE6A 4YY3Q 1LM0A 4X64L 4C3JH 4C3HH 3CF5A 4JYAL 2UUAQ 1G51A 2PI2A 3GTOH 1P16A 3FHWA 3CQZH 5JJLA 1E3PA 4QQBX 1EFWA 4YWKA 1VQ4A 4BBSG 1YHAA 3BJUA 4JV5Q 1I6HH 2R7ZG 1N32Q 1D7QA 2GN5A 3PUVA 1HR0Q 4IPHA 2ZTCA 4JI0L 2PNHA 4JBMA 3SGIA 5ELOA 3UE1A 3OTOL 4RMFA 4B3RL 4LF9L 2E2HH 1Y14B 2D0OA 1AE3A 2AHOB 1QVGA 4IFDI 1JT8A 1TWAH 2WFWA 2BH8A 1CKOA 3CC2A 2VNUD 4DV6Q 1S40A 4X64Q 1YHBA 2CWAA 1EQRA 2VL6A 4JYAQ 3KOJA 5FJ8G 1YJ9A 4A3LH 1PH8A 3PUWA 1YHQA 2Y0SE 1A62A 2Q2HA 3S16H 4GKKL 4AQYQ 4IJLA 5C4XG 1VQDA 4P73A 2RCNA 2PQAB 4A3IG 3HOZG 5GADC 3IRBA 4HIDA 1YI2A 1UE1A 5JJKA 1PYSB 4A3FH 1N33Q 3PUYA 4DR4L 4JI2L 3EBEA 1P8LA 4MTNA 3OTOQ 1QVCA 4A3CH 4LF9Q 4BY1H 3KF6B 3AYHB 3Q8DA 2N8NA 4WJ3M 4KLKA 2MO0A 2YV5A 3CW2C 1X65A 3HFZB 1IBLQ 1QZGA 1VQGA 4PZ8A 2OQ0A 1SLJA 1T9HA 2F3IA 3K81C 4BY7G 3KJPA 3PO2H 1N8RC 1JE5A 1X55A 1JB7A 2UXCL 4HJAA 2C35B 3JAMi 2JA8H 3HOVG 4GKKQ 1LYLA 1JJGA 4QGUA 1YIJA 1N36Q 1Y1WG 4LNQA 3K0XA 1VQ5A 1L1OA 3K7UC 4UY8C 4JI8Q 3RLNA 4HIMA 4X66Q 3CMEA 1CKNB 1KHIA 3A5UA 4DV2L 2R6GA 2MO1A 4DR3Q 4LF7L 4BXXH 4DR4Q 3M85A 1VQCA 2E8GA 4X62Q 3TEHB 3J7ZC 1UE5A 1XPUA 4GOPC 2I5HA 1Q12A 2K4KA 4RG1A 1SROA 3I4MG 3KFUA 4R4IA 1KD1C 3TS0A 1HZBA 2L15A 4NXML 2ZTEA 4AYBE 3J81c 3KF6A 5AJ3L 1X3GA 4BA1I
chains in the Genus database with same CATH superfamily
4A3EG 4BBSB 1HZ9A 4OEMB 4PNYA 1V1PB 4WRDA 1QNKA 1S3OA 3EIVA 1WVLA 3HKSA 3G4SA 2LXKA 1X54A 1A6XA 4JBJA 1VQIA 4PZ7A 1A8VA 3S1RB 2Q2TA 1TWHB 4LK1C 3M4OH 2CQOA 3V05A 5EQ0A 1JQYD 1SYDA 4Z9CB 1BO0A 4JI5Q 3EROA 4DK6C 4GS3A 2CFMA 1TY0A 4DUZL 3E0JA 4PMCA 1U4LA 4OIKA 3VA7A 1E7ZA 4HSPA 1M8AA 4H02A 1WTRA 1RIPA 3W3AA 2N88A 5GAEC 2F0UA 2F4IA 5I2XA 5IT9E 4BY7H 3PF5A 1AH9A 1EQQA 5JVH3 3L9AX 4F7XA 2B2TC 1R4QB 2VQEL 3G6EA 4PZ6A 1Z6HA 1JB3A 4DU9A 2PO4A 2Z4HA 1V43A 2ZXPA 1XMQL 1XNQL 1PH6A 4JOIA 3KF8A 4H0LC 3I4MH 3Q24A 3H3VC 3DWAA 1RTOA 4LF6L 4P72A 4ZKBB 1EQTA 4HJ7A 3I4NG 2E2IB 1SYBA 1STHA 1GKHA 4N8FA 4GLAC 1EYAA 4HN7A 4OWWB 4EQPA 2F0OA 5I6WA 1NBWA 1PRTB 3RN5A 1F9SA 4B3SQ 3E9HA 1CZGA 1BNZA 5JOBA 2R7DA 3GTKB 1NR2A 1Q1BA 3CC7A 1EIGA 3KBGA 4QUFA 1XTCD 2CW0C 3SDZA 2J7ZA 1WJJA 1D2BA 1BQQT 1L0XB 3GTLH 1LTBD 3S14H 1HXYD 2F0FA 3HGBA 5IE8A 1VQEA 1IZ6A 1NSNS 4H44C 4B3RQ 1CSQA 2PI2E 1YJWA 2BDNA 2K28A 4GKJL 3R8BA 5DNFA 2Y0SG 3K6OA 4N8X1 4DAMA 2NTSA 5ELCA 1IHZA 2AWNA 2BA0A 3NEMA 1OXVA 2CCZA 5C4HA 3OMGA 4A4IA 5D3IB 4A93G 3ZJYC 2ALYB 4FF4A 1LTSD 3DEOA 1TU2B 3T16A 3VA5A 1WCMH 4DPGA 3QOJA 4RKLA 3DUZA 2EIFA 2C9OA 1NY4A 1HQRD 2SEBD 4MIUA 2E74C 5M5WB 4Q0FA 3I4NB 4A3BG 3BDOA 5FKAC 3H09A 3NWSA 1MJCA 2WKDA 4K8IA 3NXWA 4C56C 2A74C 2EE1A 1HJPA 2RVLA 3STBC 3VR3A 3HZXA 3HOYG 2ICEC 4DNTB 1LT4D 3J80E 2BE5D 5IP9G 1GUWA 1FGUA 1PDQA 5C6AA 1K8MA 1IBML 2EYHA 4AYBG 1MD2D 1I3QH 2K5WA 2K5VA 1WTOA 5AJ3Q 5AFWA 5A2QL 3K59A 2UUBL 3S15B 4DGZA 1E0BA 3VYTA 4PV1C 2EQSA 3QR8A 4HJ5A 1XJVA 1KLGD 2KEEA 1ILPA 3VYRA 2A6HD 4R8IA 5ELFA 1I94L 1YNJD 2NVXH 3M4PA 2A5HA 2K5HA 1FL0A 5JAVA 2Y0SB 1SYCA 2KCTA 1Y1WB 2NN6G 2K75A 3UI2A 4RH6A 1U4MA 1DJRD 2A8VA 1OXXK 4MTKA 3TN2A 5I9PA 3TQYA 4LUOA 1HPCA 4R4TA 5L37A 1SMXA 5M3MH 3W2DA 1CHPD 3A74A 1NJIC 4JV5L 3J80i 2PMZB 1PTOF 1K0SA 2G5DA 4FVMA 1CSPA 2GA4B 4G57A 1EWIA 5HGQA 3DM3A 4MNOA 4FXGC 4UDUC 3HOYB 5I4DA 3HOXG 3KLSA 4JG2A 4NDXA 4QMGA 1PFSA 3E5SA 3VR5A 2F0EA 3J81i 1BCPD 2D2CC 3OIQA 4DK0A 3OW2A 4GN3B 1PH4A 1BF4A 1OTCA 3WWVA 1VS0A 4HTHA 3K7AB 3S9WA 1I5FA 1NE3A 3OSOA 1G291 1LLRD 4EQ5A 4LF6Q 1IL2A 1D1IA 2EY2A 1N33L 3QJYA 3NELA 5IYDH 5E3FA 4O1NA 1LTGD 4KN7C 4LFCL 1B7YB 1L0YB 1IW7D 4DN4M 1ASYA 3J7AV 2L5TA 1ET9A 5FLXc 1LTAD 5A2QE 5EKIA 2HDMA 1EIHA 4JI1L 3BVZA 5CV6A 2XVSA 1UAPA 1PH1A 1SRUA 2K01A 4TKOB 2L9HA 4R1JA 3K80C 4FXKC 1W6JA 4DR2Q 4K5XA 1K9MC 4C1NK 3RN2A 3F1ZA 3GTMH 1MIUA 1NR4A 1DONA 5KIXA 1SNMA 4B08A 2F0IA 1H9SA 3NBHB 3P1HA 4XT1B 3AU7A 3HOXB 2ENBA 4A3DB 2YU9H 2AKWB 4Y52H 3CCMA 4C3JG 1JMCA 1KNEA 2F0HA 3CCEA 2UUCQ 2R3ZA 4DNIA 2F0TA 1HNXQ 4FDBA 4BBRB 4IUQA 5C5LA 4E6IA 3CCVA 3CU7A 1FNUA 4JI6Q 1X9NA 1JJCB 1UE7A 4O42A 4XXEA 4GLVB 1AP0A 3CCLA 1U9RA 4XYOA 4FF3A 3OWEB 1EIYB 4DNRB 2KHJA 2M2LA 5JPNC 4X65L 3GD7A 4A76A 4CJ1B 1R9TH 2Q8TA 4N9PA 1ET6A 1XTDA 3PUZA 4HIKA 1IYJB 1IBMQ 4FF2A 2EYFA 4LWCA 4R9WA 3MA2B 3T1YQ 1LUZA 1VQOA 3S1MB 1LTLA 1N9WA 1SNQA 1F9PA 4RCOA 3MWYW 4BY1G 3S2HB 1B70B 3EVQA 4I7AA 4POFA 1G91A 3MXNB 5DLQE 2UUAL 3HOWB 1V1PA 1I94Q 4CGYB 3CP0A 1S5BD 2J4XA 1TWGB 1WYDA 4X3UA 2K1BA 1HR0L 2JP1A 4ME5A 1C9OA 2IHFA 2K5NA 4DV3Q 1DOMA 2ZTDA 3ULJA 4BXXG 2B39A 4NMZA 2AUKA 3S2DH 1PXUA 4B3MQ 3NQIA 2MHVA 2QCPX 3JC66 3JAME 4R4CA 1E22A 3GTOB 3CF5A 1A2TA 4IUPA 2J0TD 3CQZH 2AQ3B 1X32A 1I6HB 1EFWA 1QNUA 5C3WA 4JV5Q 5CBEE 3U9OA 3SGIA 4LF9L 1QE6A 2AHOB 2DY7A 4CKEA 1JT8A 4OL7A 1SNDA 3CC2A 1SYGA 1UNSA 3KLRA 3OHXC 1S40A 5D65A 4X64Q 3ND8A 5IGEA 2CWAA 1O7ZA 4EGVA 4JYAQ 1VMCA 1EY4A 3PUWA 1A62A 1EY9A 1VQDA 2RCNA 4A3IG 5GADC 1WTVA 3A8KE 4QUCA 1PYSB 2B2UC 1WTHA 1N33Q 1Z7TA 2EYJA 2IPKD 3GTJB 4JI2L 4BY1B 1DCZA 1P8LA 2XSCA 1NAPA 1S5CD 1QVCA 4K6DA 1F2MA 3KF6B 2BOSA 1B53A 2N8NA 1V1OA 1X65A 4QCLA 2KEDA 2OQ0A 4DA2A 4KV6A 2O5JC 3K81C 1XX8A 2LFNA 2C35B 2OXPA 3JAMi 1AFPA 1LYLA 3T51B 2P5ZX 1WD0A 1EY7A 2XRSD 4HIMA 1CKNB 2Z9HA 4DR4Q 3M85A 2A6EC 3SHLA 3C46A 2KCCA 1WTQA 1D5ZC 3LWUA 2O2LD 1X3GA 5IODA 3J7YW 5C0XG 4OXPA 2F03A 5CBAE 3QG1A 5LMNW 1BDOA 2D0PA 3RZOH 3D8GA 5IGDA 1HNZL 4GN4B 3M7GA 1DOKA 2B2VA 4M8AA 3KLWA 3LX0A 3CD6A 5IY0A 5I9OA 1HA5A 4KKTA 1Q1EA 3S17H 2LSSA 5G3LF 4QY7A 2BH2A 3I4OA 4XTCS 3A7LA 2VB2X 1VQ7A 2I07B 1RODA 2KA7A 4A3IB 3SK8A 3BYTB 5IYDG 3A5ZB 4Y7NH 1ENAA 1IYUA 1PTOD 3F8TA 5A35A 5FLMG 3HKZE 1NMFA 4X65Q 1SJHD 5GROA 1STAA 2PNRC 1B8AA 2F0SA 4OWTB 1SYEA 3PO3B 1I6VC 4QIWB 1S5ED 3CCJA 2JA7B 1BOSA 1TWCH 4DR7Q 4K5VA 4HCEA 2Q2IA 2KCNA 3IKJA 1PTOH 3KYHC 4MHEA 1VQMA 1TXYA 2X6GA 4P74A 1LT3D 5F2DA 1KRTA 4OHJA 3UDFA 1O7IA 1Y69U 1GUNA 1TKWB 1MHWC 4FXDA 1VQAA 1HFNA 4RWSC 1I4RA 3N52A 4BWGB 1HZAA 3FEWX 1ESRA 3C2PA 2PW5A 2XNAC 4LF5Q 4IFDG 4C1NI 2PZTA 4KY7A 1CT1D 2L1BA 2F0NA 4RFBA 3E0EA 4U68A 3SEBA 1VQPA 4OIJA 5EKLA 1STEA 2F3VA 2YTVA 2CQAA 4X6AH 1I50H 1B3QA 4KI0A 5M3FG 1RL2A 4A3GB 3LWEA 2R93G 2F0PA 1QILA 2K50A 2Q8IB 2VUMG 1G6ZA 4HIOA 3NTKA 3OOCA 2ZJPA 1STNA 3U4ZA 2R92H 4YCUA 4IALA 2AQ2B 3T4AC 4JK1C 4DV1Q 5NUCA 1SFOB 3M3YH 1VF5C 2XRQD 4LF4L 4FO2A 1K8AC 5C3EH 3GTGB 3KUPA 4HJ8A 1W3SA 1HR0W 1STGA 3BZKA 3MEFA 3B6YA 4LFAQ 3UDGA 4KD3A 5CMDA 2RHSB 1EZ6A 4IPDA 3QO2A 1OXUA 3IFTA 4A3JB 2OWOA 4A3KH 3Q22A 3NP8A 5IWAQ 1VDZA 3F2CA 1FD7D 3AFQA 1SNOA 5E4WC 1I4QA 5BN4A 4IQZA 2VZAA 4JI2Q 1T5XD 1TIID 5T1GA 4GZYC 3NENA 1O78A 3NTHA 5HY6A 2QGQA 1NTGA 1X3PA 1E2VA 4C2MH 1Y1VH 2R7ZB 2IX1A 4FNFA 5ISRA 1X56A 5IYCH 3KDFB 4V190 3K5NA 1EYDA 2NZOA 5J3BA 3BDCA 1DZ1A 1HUNA 5M3FB 2SDFA 4CDFC 3FVQA 2R93B 5JEAG 2VUMB 1D5MC 5JJIA 3MEHA 3RLFA 4QB4A 4LF8L 5C4XB 5CR3A 1QCBD 4DV7Q 4GNXC 2A6HC 3HOZH 1XNRL 4X3TA 3PSIA 3NBHA 5BR8Q 2Q2UA 1JCKB 3S1QB 1QUQA 1HNZQ 5FO7B 1FNVA 5LHY1 1G8ZD 3NQTA 1W2BA 3ERSX 4ZAIA 4QL5A 2D5DA 1SYFA 2N3SA 3CRKC 1EL0A 2FJ2A 3HOVB 5IYBH 3FRPB 1TS3A 2HUGA 5C4JB 4DAVA 2NZHA 5FLXL 3Q0AA 3I56A 2TSSA 3CHBD 3HKZG 3VR4A 5ELNA 3T53B 1XYIA 1D8LA 2F0MA 5EGTA 4CKCA 1BVSA 3BG3A 3TMEA 2NVQB 4C3IH 2KECA 5DEHA 2VB3X 4TQUS 4A3EB 1F2ZA 2NVTH 2GVBA 1TS2A 2EVBA 1F2YA 2K5QA 1EIFA 4IJHA 4HJ9A 2JA5H 1OXTA 2B63H 1QZHA 4K6LA 3K8AA 1BCPC 2XTIA 1LT5D 3K5LA 4IO9A 2LMCB 1YJNA 3A8IE 2XGTA 2I0QA 1SNCA 2FFKB 1KXLA 4MZ9A 4LFBQ 3MZ5A 5IP7H 2IHEA 2FXQA 1U4RA 1CFMA 2QILA 3SK4A 4DR2L 4IPGA 4LUZA 1IW7C 3FKIH 3GV3A 5IIFA 5LL6S 2JA6G 1Q82C 1MSGA 1PRTF 1M1KC 3RNUA 4KK7A 1JWMD 5JVG3 4DR5Q 1Q81C 2VXWA 4R4OA 1N36L 3H0GG 1BKBA 2IL8A 2F0WA 2H4OA 4DR3L 1PHJA 3GTPH 3HKZB 2UU9Q 1BBXC 3HOUG 1Q8KA 1V1QA 5C44H 3GTJH 2UUCL 3I2ZA 3C1FA 2MPMA 1HNXL 4LF4Q 1ASZA 2NVYB 2R7FA 2B2WC 1CZWA 1H95A 4JI6L 4J15A 4G7ZC 5M5XH 5G3LD 1GHJA 5KNBA 1HTLD 3ND9A 1XMOQ 3K5OA 3L2PA 2JEBI 5GAHC 3HG9A 3PMFA 1RCVD 3RZDH 3F2UA 1EEID 2MP1A 4K8JA 2RDHA 3J7A5 4GLXA 2Z6KC 3URYA 5JPMC 2F0LA 1A3VA 3T1YL 3IFDA 1RKNA 3R93A 1LO5D 1UWVA 3GV6A 3I91A 4LW1A 4A3MH 4HMIA 1HTPA 1D5XC 4J6HA 1FNWA 3SK6A 3R2TA 4O2DA 5D14A 3BVGA 5KYLA 1VQNA 5E4XA 2KHIA 4K14A 5C0XI 4APVA 2JA6B 4UAIA 4ZUJA 2E2DC 1H9RA 3GDEA 1CKNA 2CWPA 1BR9A 4A3LG 1HNWQ 2H1EA 4OELB 3ULPA 1Y8PB 1VQFA 3F2DA 1Q86C 4DV3L 1UUPA 3GTQH 3H0GB 4LF8Q 2HQLA 2R92G 2L11A 1QB5D 1SMYD 2A19A 3RR5A 3A55A 4OO1I 4A93B 1XNRQ 3PV0A 4B3ML 5I6YA 3H3VI 3HOUB 5C3EG 1WD1A 4KD4A 4NB3A 5M5YH 1E1OA 4WFN3 3HP3A 3F2BA 1TVXA 1HH2P 1TWFB 2JEAI 5EPLA 3PO2G 3PO3H 4A3BB 1VQ9A 2K14A 1AEXA 4ODGA 2N49A 4M1UB 3PIOA 2QA4A 2AMCB 2WINB 1PYBA 4DV4Q 2OT2A 4RGNA 5CV5A 4J8QA 1MJEA 3TRZA 4P75A 1CTMA 4IUUA 1UE6A 4X64L 4C3HH 4JYAL 2E2JB 1C48A 2C5CA 4AYBB 2WIIB 4G7HC 4EQOA 1E3PA 4YWKA 1VQ4A 1LABA 1YHAA 3BJUA 2B8FA 3R3OA 2GN5A 2ICIA 2ZTCA 4JI0L 2PNHA 3MTSA 2NYZD 4EVOA 3QWNA 2E2HH 1EQVA 2D0OA 4IFDI 4CDEC 1TWAH 5DAUA 1JWSD 3S16B 1YHBA 1EQRA 2VL6A 4HAEA 1T5EA 5CC4A 1PH8A 2Q2HA 1B9MA 3HOZG 4P73A 2WACA 4HIDA 1YI2A 4A3FH 3DEPA 2XIWA 2PW7A 4DR4L 2CW0D 1WTPA 2EZVA 4MTNA 1SDFA 3SVMA 3OTOQ 4A3CH 4HSVA 3I90A 2D9UA 4KLKA 2B2TA 3TP8A 3PO2B 1A2UA 4XT3B 2F3IA 4BY7G 1JE5A 1JB7A 1WTXA 2JA8H 4TSSA 1JJGA 1SE2A 1N36Q 1VQ5A 4KKSA 3K7UC 4KJOA 1KHIA 3BDLA 3R2IA 5FO9B 2DNEA 2MO1A 4DR3Q 2NZ1D 3A8JE 3FPPA 3J7ZC 1UE5A 4GOPC 2I5HA 2K4KA 3I4MG 5C3XA 3KFUA 4C3IG 4IN3A 1RJTA 3LNNA 3TS0A 1HZBA 5LL6X 4XQJA 3J81c 4BA1I 2WAQE 4OWXB 3D4RA 2NWGA 4LUVA 1ZYRC 2I46A 3PIPA 4BBSH 1EYCA 2MFIA 1HZCA 1S4ZA 1MI2A 4JW0A 1I4XA 1KDBA 2A68C 2OQKA 4KHVA 4LF7Q 1JOKA 3D0FA 1QVFA 3M4OB 4DR7L 2FMMA 3S1RH 3G7LA 1PTOC 5FJ8H 1TWHH 2KJXA 1L0WA 4DV5Q 1PH7A 4F8MA 3FKIG 4POGA 5C5MA 1STYA 3U50C 3AMUA 2RQXA 4ME3A 4AIMA 4ULLA 3KDFA 5EBCA 3NTIA 1K3RA 4LF5L 3S1NB 5IGFA 4N9TA 4BY7B 2UXDL 3NE5B 5EJWA 1DD2A 2UXBQ 2MUYA 1SSOA 2BDOA 3V96A 4WJ4A 1BBWA 2HQEA 1KAAA 1WCMG 2ZXRA 3CAMA 4C3JB 1FR3A 3I4MB 4K2KA 4NPSA 3A0JA 3I72A 2RKSA 4JCVE 1N34L 1PRTD 1L1OC 2NB0A 2B2YC 4CKBA 1O7YA 2E2IH 4A3EH 2CH4A 1ICFB 4ZCKA 4EX5A 1VQKA 4IOAA 1J5EL 4DV1L 4KHZA 4R8NA 2PPBC 3TZUA 3AEVA 2Z0SA 3IAYA 1JOQA 1H9KA 3TSSA 4JI4Q 4LFAL 4DR1Q 4F88A 1V9PA 4UP9A 3SK5A 3Q23A 4HCSA 3VR6A 2I5MX 3VR2A 1U0LA 3GTKH 1GXDC 3S14B 2DGYA 5IWAL 3TREA 2JQOA 1SXTA 4KKUA 4PQXA 4L5RC 3DHQA 4JI0Q 2E5LQ 1VF7A 2H5XA 1GUTA 3HEJA 4ABNA 4XQNA 2PZUA 2QDLA 4K0KL 5J1ZA 3OYYA 2EJMA 2MQHA 2VY3A 4JBKA 2SOBA 4V0BA 1BBUA 3TP5A 1CA6A 2RCFA 3CMAA 1PH2A 1QWYA 2JN4A 3L3OC 2MGSA 4JI3L 1WCMB 2JSOA 2L55A 3DLLA 1K8OA 5CORA 4BA2I 4L5TA 3TS2A 2CKZB 3C1EA 5M3MG 2KCMA 3T56B 4MN3A 3ZYYX 2ASBA 4DV7L 4LMQD 4IPCA 1C0AA 5M5WH 2YTXA 3QIAA 1M90C 3I4NH 5K5PA 2L12A 3EA6A 2N55A 5BR8L 4ID6A 1U5KA 4Q5VA 3RD4A 5D3DA 4DV0Q 2IX3A 4JOIC 1C7YA 4G7OC 1JICA 3FP9A 1PVOA 2OTLA 1CI3M 1I3QB 1R4PB 2KVMA 5DM73 3MXPA 2KUMA 1Z47A 1YEZA 2WAQG 4RKBA 1Z9FA 5FO8B 4DK3C 3NBIA 3PQIA 3BZCA 3K57A 1YITA 3S15H 1OXSC 1GHKA 2NVXB 1B50A 2BCOA 1A3TA 2V4DA 3HS0C 4S3SA 1AZQA 1JORA 3P7JA 3ICEA 1IBKL 1JOOA 1EOVA 5LMUL 1PH3A 5T1IA 2EXZA 1DM0B 1KC8C 1CKMA 4GNXB 2HT1A 1XXGA 4A3FG 2N78A 4QF4A 1J8IA 4GN5A 3H15A 2CVRA 2YTYA 1Y1WH 3T13A 4AH6A 2K52A 1A3UA 1GO3E 1K83B 5KGUA 1WI5A 2ZM6Q 1GM5A 4YY3L 1GJXA 1J6QA 1Q46A 5M3MB 1B1ZA 1EY8A 1RD9D 2NN6I 3W1GA 4LFBL 1SN8A 3NUCA 1FJGQ 1YZ6A 3WOFA 1Q7YC 4L6TB 2UXDQ 2ZT9C 2KQ3A 4KJNA 3BS1A 1HA6A 3G48A 3HOYH 5M9OA 2CHBD 2EYMA 4UHVA 4PG3A 5IP9H 2B3GA 3ULLA 1HUMA 3G71A 4DXGA 5KEEA 3M4YA 4DR5L 2IX0A 1AW7A 2E2JH 4AQYL 2WAQB 3K7AH 1N34Q 5H1SE 1A0IA 3CKIB 1PH9A 1YNND 1KDCA 2UU9L 1O7LA 5CV4A 1BCPB 3T1HQ 1X3FA 1J5EQ 4NXNQ 2ID0A 3LGJA 1X3EA 3CPWA 3H6MA 1IBLL 2YYZA 5J39A 4ZUIA 2SNMA 2PZWA 2X69A 5FK9C 3PGZA 3FDTA 3U58A 2QEJC 4IZ8A 2DN8A 1XMOL 1FGBD 1EUJA 4LAAA 4B3TQ 5EAYA 2EXDA 4X66L 2NTTA 3UDXA 4YWLA 1SAPA 3H91A 4ZRZA 4FF1A 4OX9Q 4X62L 2MNAA 3GTMB 2DY8A 2JE6I 3TP7A 1DGSA 2JK8A 3W1BA 3I7FA 4DR6Q 1S72A 2PCFB 4DF7A 1OO9B 4K0KQ 1VQ6A 5TSSA 4RAUC 2QEXA 2V1CC 3P20A 2K05A 3I4LA 5EBDA 2L4NA 2PMZE 3DWQA 2XWBB 4PMWA 2BE5C 3I73A 4JI7Q 2YU9B 5CV9A 3D31A 4ALPA 4DAYB 3HOXH 4UP7A 1SJED 4JI3Q 4A3DH 1II3A 1VQ8A 1JWUD 1HNWL 3M4QA 2VQFL 1EFID 1L2FA 2HIVA 4DUYQ 2JYOA 4JPBW 4BBRH 4YCWA 1PZKD 1PMRA 1RHPA 3U4VA 1YNJC 4ZQ3A 2LY7A 3WOEA 2GVAA 1R9TB 3EN2A 2B2UA 2RHQB 1J9OA 2G9HD 4UP8A 4NKLA 2ES2A 2HHHL 3BU2A 1M4VA 2KBNA 1SMYC 3J7AF 1LACA 1C4QA 5KNDA 1F77A 2AUJD 3UDIA 3EFXD 1PLFA 4DV4L 3OW7A 5GQOA 3S1MH 3IL8A 2AQ1B 4HR7B 3MFYA 5E7NA 3CCUA 2K04A 4A75A 1YNXA 3S2HH 3AQQA 3HOWH 2OCEA 1ONLA 2FHTA 3CCRA 1RF2D 1IBKQ 1EEFD 3AFPA 5LMUQ 2OF1A 3S1NH 3V2TA 1TWGH 1ZEQX 2B8GA 3OIPA 1LTRD 2WV6D 2D62A 3S2DB 4K2LA 2OEOA 1RTNA 1SE3A 3NHHA 4ZK9B 1HCZA 5I2YA 3J80L 3QOLA 2EYOA 3G6JB 2O4XA 4YY3Q 1LM0A 2A69D 4C3JH 3CQZB 2F3WA 3K58A 1G51A 2PI2A 2Z8LA 4X3KA 3GTOH 1P16A 3FHWA 5JJLA 3MXNA 2F0GA 1KLUD 4NW2A 4QQBX 3VYUA 2Z4IA 4B9XA 1I6HH 1N32Q 1D7QA 3J81L 3PUVA 4IPHA 1D6EC 2HDLA 4JBMA 4ZLTF 5ELOA 1MBYA 3UE1A 4JVZA 3OTOL 1HFGA 4RMFA 4LJZC 2WKCA 1B3AA 2Z6BA 1AE3A 3ONAB 5HURA 2BH8A 1CKOA 2VNUD 3OWFA 4DK1A 4DV6Q 1B2TA 3KOJA 1YJ9A 5CV7A 3Q6SA 1ICWA 4WORA 4AQYQ 2PQAB 1ESFA 3IRBA 4H13C 1UE1A 5JJKA 3PUYA 2EYLA 3EBEA 3QB3A 3HRZC 4BY1H 2PYKA 2F1MA 2RDGA 2MO0A 2YV5A 3CW2C 3HFZB 5ELEA 1IBLQ 4WJWA 1QZGA 3ERQA 3MVVA 4PZ8A 1QG7A 5CV8A 1T9HA 1B9NA 3KJPA 1G2TA 4HJAA 4GKKQ 3NK9A 3D3RA 1TS4A 4ZKCB 1ML0D 3A56A 5FLXE 3K0XA 1YIJA 1Y1WG 4UY8C 3RLNA 2IJ0A 4X66Q 3CMEA 3FPUB 3A5UA 4DV2L 4BXXH 2R6GA 4LF7L 5FOBB 4X62Q 3TEHB 1EOTA 2K33A 1Q12A 1SROA 4R4IA 1TY2A 2ZTEA 1STBA 4CDDC 3KF6A 1IYVA 1CK1A 4DV5L 1VMPA 3RZOB 2UXCQ 1KQSA 5IGGA 3O13A 1XWEA 1KAWA 1CUKA 1JE4A 1K3BC 1V8QA 4KY5A 3S17B 4GOPB 1B44D 1Y8OB 2WB1E 1JJ2A 3PIO3 1HHVA 2VQFQ 3RMHA 5IT9c 1VCIA 4NXMQ 2UXBL 1IL8A 2HD3A 4Y7NB 1AE2A 1VQHA 3J81E 3CCQA 4A3IH 2M00A 1PYWD 2K5DA 1F9RA 3KJOA 2LXJA 3I55A 3I70A 2E76C 3CXCA 3PO3G 3D6CA 5GAGC 1ZKOA 1TWCB 2K6AA 4I65A 1KDAA 3RLOA 1EWHA 1GVPA 3MHBA 2HHHQ 2BA1A 1PTOB 4A3KG 1E24A 1ZXTA 2JA7H 1GD7A 2B29A 1E2WA 3A7AB 1EZ8A 5EPKA 1X3QA 3TP6A 4JI4L 5C0XJ 4DR1L 2F4VL 1K83H 1PRTC 1A63A 4DUZQ 3EJIA 1I4HA 1PZJD 2F0QA 1ENFA 1Y1VG 4TRDA 4QJFA 2QF7A 5C0XH 1SR3A 5EKKA 1S5DD 1F9QA 5IYCG 3AB9A 1TS5A 3NSWA 2E5LL 1I4PA 2EJGC 4GNXA 2KENA 4YIJA 4A3DG 1I50B 2A73B 2VQEQ 3DWPA 3C3LA 5KYIA 3DMUA 2EY5A 1FYCA 3E6ZX 1XMQQ 4BBRG 1XNQQ 4OO1H 1L1OB 1KNAA 1EU4A 1LTID 1PFBA 3DM1A 3H3VH 4A3GH 4KHPL 3TZDA 2R92B 2B2VC 2PQEA 1KRSA 2F0KA 2RA4A 4P71A 3PCOB 4OONA 3M3YB 3SR1A 5C3EB 3M9BA 2K32A 5FLMH 1TT2A 1KIXA 5LMNL 1SFOH 2A1AA 3PIP3 2MJ8A 1EU3A 3GTGH 2IW3A 3L0OA 1EYGA 2NUCA 1NNXA 1LTTD 4JC0A 3KBXA 4QIWE 5K36H 4A3KB 5IYBG 3MC0B 4R4QA 3VYSA 1K0RA 4DV0L 4XIGS 3H94A 4A3JH 2VS1A 1I4GA 3J80c 3CPFA 4IFDJ 2ATWA 2ZJQA 3JAML 4L8JA 3HOWG 3VDYA 4XQQA 1DOLA 2EY6A 4IUNA 3BZDB 1U4PA 4C2MB 2EYPA 1CA5A 4GKJQ 1Y1VB 5IOCA 2JA5G 2B63G 1QUQB 4IFDH 4RGMA 2R7ZH 4RA8A 2F0JA 1SNPA 1Q90A 3KLSX 1MKHA 1VQBA 1NMGA 1WOCA 4P2CB 4DV2Q 2IY5B 3STBD 2JXMB 2HIXA 3W5OA 4ILWA 4L5SA 5M3FH 1IXRA 5IP7G 2R93H 3BYYB 2VUMH 3S24A 5IGCA 3HOZB 3CCSA 4NP5A 1PFNA 4DAPA 2X6LA 1E2ZA 5C4XH 4TVAB 1H9JA 2ZM6L 4OGQC 4EQNA 4L63B 3KF8B 3PF4A 3S1QH 4BS9A 2WB1G 1SEBD 1K8GA 2NBFA 4IUVA 3UE0A 4DAYA 5COYA 1G6PA 4B9WA 1FJGL 4U673 1PA6A 1E1TA 5KNCA 4X3SA 2B2WA 1DYQA 3HOVH 2UUBQ 2AWOA 1VQJA 5C4JH 4YHHL 1GOZA 3ER0A 5C44G 1VQLA 1FVIA 4CHTB 3K0YA 2F52A 1O80A 1IKMA 1SE4A 1NCVA 4C3IB 2EY1A 3PUXA 3L7ZC 2NVTB 4DKAC 2L0CA 2NVQH 2Z6KA 2JA5B 2RF4A 2B63B 3K5MA 4ZYSA 3SXHA 3T1HL 1KTKA 3SE0A 4NXNL 5JEAJ 5HGTA 2M9VA 1W6KA 1HQMC 4CJ0B 4H7BA 1XPRA 4RHRA 1C8CA 2F4VQ 3MFGA 2LS01 4F87A 1Q8IA 1YNNC 5JEAH 2JA9A 2RBMA 3GO5A 4B3TL 3GTLB 4A3MG 1PZID 3CC4A 2Q8RE 4OX9L 5ELBA 1WFQA 4O0AA 3FKIB 3RUZA 1MGSA 4CBVA 1AN8A 4DR6L 2QDBA 1A15A 3CRLC 2VW9A 2WB1B 1GUOA 1RDPD 3KK7A 2DJFC 2DJGC 1NUCA 4JI7L 4KHPQ 1CHQD 4JI8L 3GTPB 2LKVA 5CYUA 2SNSA 3E3XA 5C44B 4IUTA 2HCCA 2XWJB 3I8ZA 1ILQA 4DXFA 1YBYA 5LMNQ 4LFCQ 2I5LX 4DUYL 5M5XB 1WTWA 1AZPA 1UEAB 1EWCA 5JJZA 1UEBA 2DUDA 2NVYH 4XDXA 2JA7G 3J81j 2RDFA 2G9DA 2QW7A 2F0DA 2ZXOA 2JJQA 1Q3LA 3MXGA 3N6RA 4KTAA 1PV4A 1HRJA 2K7VA 4JI1Q 2EOTA 3RZDB 5EPJA 1KL9A 2PQAA 4UPAA 2RSOA 4C3HG 5ELDA 1EY6A 3OMCA 3GQBA 4XYQA 4YWMA 3NPPA 1BXTA 1XPOA 2IT1A 5J22A 5E1FA 1GUGA 4KN4C 4A3MB 4JI5L 1Y8NB 3D4DA 5BN3A 3I3CA 4I7ZC 2WP8J 2EJFC 3P75A 4K5WA 3TBIB 1ZYRD 2IWHA 1YVCA 3E9IA 1TQOA 2A68D 2JA6H 1S5FD 4OO1G 4CJ2C 4A3GG 1X6OA 2EPBA 3OPOA 3GTQB 4KY6A 1H9MA 1BUVT 1K73C 3H0GH 1EY5A 3MXUA 5CGKA 2E75C 3JAMc 5M5YB 1PH5A 4A3CG 4FP5D 4A93H 2DNCA 3MAQA 1CM9A 2R61A 3HOUH 1CQVA 4KMUC 3A54A 4RGOS 2OTJA 2FMCA 4L5QA 5K36G 1SBBB 1F2LA 3M7NA 4JBWA 1MSHA 4CDCC 1TWFH 2ZJRA 4YCVA 4GOPA 2JA8G 1N32L 1QJOA 1EY0A 4A3BH 4A3JG 4IOCA 1SE8A 1ENCA 1QOHA 2A69C 3X3MA 3U9SA 3ITPA 1LV9A 3FMCA 4YHHQ 4C3HB 4DV6L 4B3SL 1D1KA 2CH4W 2XN9C 5IGBA 2F0VA 4J1MA 2UUAQ 1JC7A 4HEDA 3TDQA 1K28A 1DXMA 2TMPA 1IKLA 2RSNA 1B4OA 4BBSG 2R7ZG 4IURA 1HR0Q 4HMJA 2FINB 2E2HB 2EDGA 4B3RL 1TWAB 1Y14B 1QVGA 2K03A 1H9SB 3WDNA 2WFWA 1CQFA 5KRUA 5BN5A 3D6WA 3DXJC 5FJ8G 4A3LH 2KOLA 1YHQA 2Y0SE 3S16H 4GKKL 1KABA 4IJLA 4RCNA 5C4XG 5IT9L 4A3FB 1JR0D 2NN6H 2O5IC 2HCIA 1BCPF 1TR5A 4LF9Q 1GUSA 3EQLC 4PMBA 3AYHB 3Q8DA 4WJ3M 3D4WA 1VQGA 3BVMA 3X3NA 1SLJA 5C4ZA 2JA8B 3PO2H 1N8RC 1X55A 5DM63 2UXCL 3HOVG 4RHSA 3GP7A 2QKIC 4RGTA 4QGUA 4LNQA 4FYDA 1L1OA 2B2YA 4JI8Q 1G2SA 1PFMA 4G4KA 1VQCA 2E8GA 1LT6D 1XPUA 3NWTA 2Z1CA 4RG1A 1KD1C 2A6ED 2KHSA 2L15A 4NXML 4AYBE 5AJ3L 4DFAA
chains in the Genus database with same CATH topology
5C0XG 4A3EG 4OXPA 2WAQE 4OWXB 4DV5L 4LUVA 1HZ9A 1QVFA 3PIPA 4BBSH 2UXCQ 1KQSA 2MFIA 5LMNW 2D0PA 1HZCA 3RZOH 1HNZL 4GN4B 1S3OA 2OQKA 3EIVA 1KAWA 1CUKA 3HKSA 3KLWA 3G4SA 2LXKA 4LF7Q 3CD6A 5IY0A 1X54A 4GOPB 1Q1EA 3D0FA 2WB1E 1VQIA 4JBJA 2LSSA 4PZ7A 1A8VA 4QY7A 1JJ2A 3I4OA 2BH2A 3S17H 2VQFQ 4DR7L 4XTCS 5IT9c 2Q2TA 1VCIA 3M4OH 3S1RH 1VQ7A 2CQOA 4NXMQ 2UXBL 5FJ8H 1AE2A 1TWHH 1VQHA 5IYDG 3A5ZB 4Y7NH 3CCQA 4A3IH 1L0WA 4DV5Q 3F8TA 1PH7A 4JI5Q 3FKIG 5FLMG 4POGA 3KJOA 3U50C 2LXJA 4DK6C 3I55A 3HKZE 4GS3A 1NMFA 2CFMA 4ME3A 4AIMA 4X65Q 3CXCA 4DUZL 5GROA 5GAGC 1B8AA 1E7ZA 3KDFA 4OWTB 4LF5L 1K3RA 4H02A 1RIPA 3CCJA 3RLOA 1GVPA 1TWCH 4DR7Q 2HHHQ 2BA1A 5GAEC 2UXDL 4A3KG 1E24A 2JA7H 2Q2IA 4LF4Q 4BY7H 2UXBQ 1GD7A 3KYHC 1VQMA 3PF5A 1AH9A 1TXYA 1EQQA 2B29A 4WJ4A 1BBWA 4P74A 1WCMG 1KRTA 2VQEL 3UDFA 3G6EA 4PZ6A 4JI4L 1O7IA 5C0XJ 3CAMA 4DR1L 2F4VL 1K83H 1A63A 4DUZQ 1V43A 1XMQL 1XNQL 4NPSA 3A0JA 1PH6A 4JOIA 1VQAA 3I4MH 4JCVE 1N34L 4LF6L 1HZAA 4P72A 1L1OC 4HJ7A 4LF5Q 1Y1VG 3I4NG 4IFDG 4QJFA 2E2IH 4A3EH 1SR3A 1GKHA 4EX5A 1VQKA 5IYCG 4IOAA 1J5EL 4GLAC 2E5LL 4DV1L 4KHZA 4OWWB 3E0EA 4GNXA 3AEVA 1VQPA 2Z0SA 2KENA 4A3DG 2YTVA 2VQEQ 1NBWA 3RN5A 4JI4Q 4LFAL 4DR1Q 4X6AH 1V9PA 1I50H 4KI0A 3E9HA 4UP9A 5M3FG 4B3SQ 1RL2A 2R93G 1XMQQ 2R7DA 4BBRG 2K50A 1XNQQ 2VUMG 1Q1BA 2I5MX 1L1OB 4HIOA 1U0LA 3CC7A 4A3GH 3H3VH 3GTKH 4KHPL 2DGYA 5IWAL 3TREA 1KRSA 1WJJA 2JQOA 3GTLH 3S14H 4P71A 2ZJPA 3U4ZA 2R92H 3PCOB 4OONA 4L5RC 4JI0Q 4YCUA 2E5LQ 5IE8A 4DV1Q 1VQEA 2H5XA 3M9BA 5FLMH 1IZ6A 4LF4L 1KIXA 3M3YH 4B3RQ 1CSQA 1K8AC 5C3EH 2PI2E 5LMNL 4HJ8A 1SFOH 2A1AA 1W3SA 1YJWA 4K0KL 1HR0W 3BZKA 3OYYA 3MEFA 2MQHA 3GTGH 3B6YA 2VY3A 3L0OA 4LFAQ 3UDGA 1EYGA 4GKJL 4JBKA 2RHSB 2Y0SG 4JC0A 1BBUA 4QIWE 4IPDA 4DAMA 5IYBG 1OXUA 4R4QA 2OWOA 1K0RA 4A3KH 3CMAA 1PH2A 2AWNA 2BA0A 3NEMA 1OXVA 4XIGS 5IWAQ 3F2CA 4DV0L 4A3JH 2VS1A 3J80c 2CCZA 4A4IA 4A93G 3ZJYC 3AFQA 4JI3L 2ALYB 3CPFA 3DLLA 4IFDJ 2VZAA 4JI2Q 1WCMH 2ATWA 2ZJQA 4DPGA 4BA2I 4L5TA 3HOWG 2CKZB 3TS2A 3VDYA 5M3MG 2KCMA 2EIFA 1NY4A 3NENA 2ASBA 4DV7L 4A3BG 4GKJQ 4IPCA 5HY6A 2QGQA 1NTGA 1C0AA 5M5WH 1MJCA 2YTXA 4C2MH 1M90C 2JA5G 1QUQB 1Y1VH 2B63G 3I4NH 5BR8L 1U5KA 2IX1A 2R7ZH 1HJPA 3STBC 3HOYG 4DV0Q 5IYCH 1X56A 1MKHA 1VQBA 1NMGA 1WOCA 3KDFB 4JOIC 1C7YA 2IY5B 4DV2Q 3STBD 5IP9G 2NZOA 3FP9A 5J3BA 1PVOA 2OTLA 1FGUA 2HIXA 3W5OA 1IBML 4AYBG 5JEAG 4L5SA 5M3FH 1IXRA 5IP7G 1Z47A 1YEZA 1I3QH 3RLFA 5JJIA 2R93H 2K5VA 2WAQG 4LF8L 2VUMH 3S24A 5AJ3Q 4DV7Q 4GNXC 3CCSA 1Z9FA 4DK3C 2UUBL 3BZCA 5C4XH 3HOZH 1XNRL 3PSIA 1YITA 4TVAB 5BR8Q 3S15H 1OXSC 2ZM6L 2EQSA 2Q2UA 4HJ5A 1XJVA 1QUQA 3KF8B 1HNZQ 3PF4A 3S1QH 1I94L 2NVXH 2WB1G 1IBKL 1K8GA 3ICEA 3UE0A 3M4PA 1EOVA 2K5HA 5LMUL 1W2BA 1FL0A 1PH3A 1G6PA 1FJGL 3ERSX 1PA6A 4QL5A 1E1TA 1KC8C 1CKMA 2N3SA 4GNXB 2HT1A 5IYBH 4A3FG 2KCTA 2N78A 2NN6G 2K75A 3HOVH 2NZHA 2UUBQ 2AWOA 4GN5A 3I56A 3H15A 2YTYA 1VQJA 4AH6A 5C4JH 4YHHL 1Y1WH 3ER0A 3HKZG 2K52A 5C44G 1GO3E 1FVIA 2ZM6Q 1OXXK 1WI5A 5ELNA 1GM5A 4YY3L 1VQLA 2A8VA 3TQYA 1D8LA 1J6QA 1Q46A 2F52A 1BVSA 4LUOA 2NN6I 4R4TA 1SMXA 3W1GA 1SN8A 5M3MH 3PUXA 4LFBL 3A74A 3L7ZC 4C3IH 4DKAC 1NJIC 4JV5L 1FJGQ 4TQUS 3J80i 1YZ6A 1Q7YC 2Z6KA 2NVQH 2RF4A 2GVBA 2NVTH 2UXDQ 1CSPA 4IJHA 1EIFA 4HJ9A 2JA5H 1EWIA 1OXTA 5HGQA 3DM3A 4MNOA 2B63H 3T1HL 1QZHA 3K8AA 4NXNL 5JEAJ 3HOXG 3G48A 3HOYH 2XTIA 4JG2A 1XPRA 4IO9A 1PFSA 3J81i 4PG3A 5IP9H 2F4VQ 2B3GA 3ULLA 3OW2A 4GN3B 1YJNA 1PH4A 1OTCA 3G71A 3WWVA 1VS0A 4DR5L 2IX0A 1I5FA 1NE3A 2XGTA 4AQYL 2E2JH 2I0QA 1KXLA 4MZ9A 4LFBQ 1G291 3K7AH 2JA9A 3GO5A 4EQ5A 5IP7H 5H1SE 1A0IA 1N34Q 4B3TL 4LF6Q 1IL2A 2IHEA 4A3MG 1PH9A 1N33L 2FXQA 3CC4A 3NELA 5IYDH 4OX9L 2UU9L 1WFQA 4O0AA 3T1HQ 1X3FA 4DR2L 1J5EQ 4IPGA 4LUZA 4NXNQ 3FKIH 2ID0A 4DR6L 3LGJA 1X3EA 2VW9A 3CPWA 4LFCL 2JA6G 1Q82C 2YYZA 1IBLL 1B7YB 1M1KC 3PGZA 3RNUA 3U58A 1ASYA 1XMOL 4DR5Q 1Q81C 5FLXc 4R4OA 1N36L 1EUJA 1BKBA 3H0GG 4JI1L 4B3TQ 5EAYA 4JI8L 2EXDA 4JI7L 4KHPQ 4X66L 3UDXA 1PH1A 1SRUA 4YWLA 4DR3L 1PHJA 3GTPH 4R1JA 4OX9Q 2UU9Q 3K80C 4X62L 2MNAA 3HOUG 1Q8KA 1V1QA 2JE6I 4DR2Q 5C44H 3GTJH 1K9MC 2UUCL 3I2ZA 1DGSA 2JK8A 3W1BA 3F1ZA 3I7FA 1MIUA 1YBYA 3RN2A 1HNXL 1S72A 2R7FA 1ASZA 4DR6Q 5LMNQ 4LFCQ 2I5LX 4DUYL 4JI6L 3PO3G 4K0KQ 1H95A 1UEBA 2DUDA 2NVYH 1VQ6A 4J15A 3NBHB 5M5XH 2JA7G 3J81j 2QEXA 2V1CC 2JJQA 1XMOQ 2PMZE 3L2PA 1PV4A 2JEBI 4PMWA 4JI1Q 4JI7Q 5GAHC 1KL9A 3D31A 4ALPA 2PQAA 4DAYB 3RZDH 2YU9H 2AKWB 4UPAA 3HOXH 4Y52H 4UP7A 3CCMA 4JI3Q 1JMCA 3J7A5 4A3DH 3CCEA 1VQ8A 4GLXA 1HNWL 3M4QA 2UUCQ 2Z6KC 2VQFL 4DNIA 1HNXQ 4FDBA 1L2FA 4YWMA 3CCVA 2HIVA 4DUYQ 2IT1A 1XPOA 4JI6Q 3T1YL 4BBRH 1JJCB 1UE7A 4YCWA 1X9NA 1HNWQ 4GLVB 1UWVA 3CCLA 4LW1A 4JI5L 4A3MH 3U4VA 2WP8J 1EIYB 2KHJA 4X65L 3GTMH 4O2DA 2GVAA 1YVCA 1VQNA 3EN2A 2KHIA 3E9IA 5C0XI 4APVA 3GD7A 2RHQB 4A76A 1R9TH 3GDEA 4UP8A 1CKNA 2ES2A 2JA6H 4OO1G 2CWPA 4A3LG 2HHHL 1XTDA 3PUZA 3BU2A 4HIKA 1IYJB 1X6OA 2KBNA 1IBMQ 3ULPA 4A3GG 1VQFA 3F2DA 1Q86C 4LWCA 4DV3L 3GTQH 3T1YQ 4LF8Q 2HQLA 2R92G 1LUZA 1VQOA 3UDIA 1K73C 1LTLA 1N9WA 2A19A 3H0GH 3RR5A 4DV4L 4OO1I 1XNRQ 3PV0A 5GQOA 3S1MH 4B3ML 3JAMc 3H3VI 1PH5A 4A3CG 5E7NA 4BY1G 5C3EG 3CCUA 4A93H 1B70B 4NB3A 4POFA 1YNXA 5M5YH 4A75A 3MXNB 1E1OA 5DLQE 2UUAL 3HOUH 3S2HH 3F2BA 1I94Q 3AQQA 1HH2P 2OCEA 3HOWH 3CP0A 4L5QA 2OTJA 3CCRA 1IBKQ 5K36G 2JEAI 3PO2G 3AFPA 3PO3H 5LMUQ 3M7NA 1WYDA 4JBWA 2ZJRA 1TWFH 4YCVA 2K14A 4GOPA 1VQ9A 2JA8G 3S1NH 1HR0L 1TWGH 1N32L 4A3BH 4A3JG 4IOCA 2D62A 1C9OA 2IHFA 2K5NA 2N49A 4DV3Q 2ZTDA 1SE8A 3ULJA 3PIOA 2QA4A 4BXXG 2AMCB 3S2DH 1PYBA 4DV4Q 1MJEA 3TRZA 4B3MQ 4YHHQ 4DV6L 4P75A 3JC66 4B3SL 4R4CA 1E22A 1UE6A 4YY3Q 1LM0A 4X64L 4C3JH 4C3HH 3CF5A 4JYAL 2UUAQ 1G51A 2PI2A 3GTOH 1P16A 3FHWA 3CQZH 5JJLA 1E3PA 4QQBX 1EFWA 4YWKA 1VQ4A 4BBSG 1YHAA 3BJUA 4JV5Q 1I6HH 2R7ZG 1N32Q 1D7QA 2GN5A 3PUVA 1HR0Q 4IPHA 2ZTCA 4JI0L 2PNHA 4JBMA 3SGIA 5ELOA 3UE1A 3OTOL 4RMFA 4B3RL 4LF9L 2E2HH 1Y14B 2D0OA 1AE3A 2AHOB 1QVGA 4IFDI 1JT8A 1TWAH 2WFWA 2BH8A 1CKOA 3CC2A 2VNUD 4DV6Q 1S40A 4X64Q 1YHBA 2CWAA 1EQRA 2VL6A 4JYAQ 3KOJA 5FJ8G 1YJ9A 4A3LH 1PH8A 3PUWA 1YHQA 2Y0SE 1A62A 2Q2HA 3S16H 4GKKL 4AQYQ 4IJLA 5C4XG 1VQDA 4P73A 2RCNA 2PQAB 4A3IG 3HOZG 5GADC 3IRBA 4HIDA 1YI2A 1UE1A 5JJKA 1PYSB 4A3FH 1N33Q 3PUYA 4DR4L 4JI2L 3EBEA 1P8LA 4MTNA 3OTOQ 1QVCA 4A3CH 4LF9Q 4BY1H 3KF6B 3AYHB 3Q8DA 2N8NA 4WJ3M 4KLKA 2MO0A 2YV5A 3CW2C 1X65A 3HFZB 1IBLQ 1QZGA 1VQGA 4PZ8A 2OQ0A 1SLJA 1T9HA 2F3IA 3K81C 4BY7G 3KJPA 3PO2H 1N8RC 1JE5A 1X55A 1JB7A 2UXCL 4HJAA 2C35B 3JAMi 2JA8H 3HOVG 4GKKQ 1LYLA 1JJGA 4QGUA 1YIJA 1N36Q 1Y1WG 4LNQA 3K0XA 1VQ5A 1L1OA 3K7UC 4UY8C 4JI8Q 3RLNA 4HIMA 4X66Q 3CMEA 1CKNB 1KHIA 3A5UA 4DV2L 2R6GA 2MO1A 4DR3Q 4LF7L 4BXXH 4DR4Q 3M85A 1VQCA 2E8GA 4X62Q 3TEHB 3J7ZC 1UE5A 1XPUA 4GOPC 2I5HA 1Q12A 2K4KA 4RG1A 1SROA 3I4MG 3KFUA 4R4IA 1KD1C 3TS0A 1HZBA 2L15A 4NXML 2ZTEA 4AYBE 3J81c 3KF6A 5AJ3L 1X3GA 4BA1I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C0X G;  4A3E G;  4OXP A;  2WAQ E;  4OWX B;  4DV5 L;  4LUV A;  1HZ9 A;  1QVF A;  3PIP A;  4BBS H;  2UXC Q;  1KQS A;  2MFI A;  5LMN W;  2D0P A;  1HZC A;  3RZO H;  1HNZ L;  4GN4 B;  1S3O A;  2OQK A;  3EIV A;  1KAW A;  1CUK A;  3HKS A;  3KLW A;  3G4S A;  2LXK A;  4LF7 Q;  3CD6 A;  5IY0 A;  1X54 A;  4GOP B;  1Q1E A;  3D0F A;  2WB1 E;  1VQI A;  4JBJ A;  2LSS A;  4PZ7 A;  1A8V A;  4QY7 A;  1JJ2 A;  3I4O A;  2BH2 A;  3S17 H;  2VQF Q;  4DR7 L;  4XTC S;  5IT9 c;  2Q2T A;  1VCI A;  3M4O H;  3S1R H;  1VQ7 A;  2CQO A;  4NXM Q;  2UXB L;  5FJ8 H;  1AE2 A;  1TWH H;  1VQH A;  5IYD G;  3A5Z B;  4Y7N H;  3CCQ A;  4A3I H;  1L0W A;  4DV5 Q;  3F8T A;  1PH7 A;  4JI5 Q;  3FKI G;  5FLM G;  4POG A;  3KJO A;  3U50 C;  2LXJ A;  4DK6 C;  3I55 A;  3HKZ E;  4GS3 A;  1NMF A;  2CFM A;  4ME3 A;  4AIM A;  4X65 Q;  3CXC A;  4DUZ L;  5GRO A;  5GAG C;  1B8A A;  1E7Z A;  3KDF A;  4OWT B;  4LF5 L;  1K3R A;  4H02 A;  1RIP A;  3CCJ A;  3RLO A;  1GVP A;  1TWC H;  4DR7 Q;  2HHH Q;  2BA1 A;  5GAE C;  2UXD L;  4A3K G;  1E24 A;  2JA7 H;  2Q2I A;  4LF4 Q;  4BY7 H;  2UXB Q;  1GD7 A;  3KYH C;  1VQM A;  3PF5 A;  1AH9 A;  1TXY A;  1EQQ A;  2B29 A;  4WJ4 A;  1BBW A;  4P74 A;  1WCM G;  1KRT A;  2VQE L;  3UDF A;  3G6E A;  4PZ6 A;  4JI4 L;  1O7I A;  5C0X J;  3CAM A;  4DR1 L;  2F4V L;  1K83 H;  1A63 A;  4DUZ Q;  1V43 A;  1XMQ L;  1XNQ L;  4NPS A;  3A0J A;  1PH6 A;  4JOI A;  1VQA A;  3I4M H;  4JCV E;  1N34 L;  4LF6 L;  1HZA A;  4P72 A;  1L1O C;  4HJ7 A;  4LF5 Q;  1Y1V G;  3I4N G;  4IFD G;  4QJF A;  2E2I H;  4A3E H;  1SR3 A;  1GKH A;  4EX5 A;  1VQK A;  5IYC G;  4IOA A;  1J5E L;  4GLA C;  2E5L L;  4DV1 L;  4KHZ A;  4OWW B;  3E0E A;  4GNX A;  3AEV A;  1VQP A;  2Z0S A;  2KEN A;  4A3D G;  2YTV A;  2VQE Q;  1NBW A;  3RN5 A;  4JI4 Q;  4LFA L;  4DR1 Q;  4X6A H;  1V9P A;  1I50 H;  4KI0 A;  3E9H A;  4UP9 A;  5M3F G;  4B3S Q;  1RL2 A;  2R93 G;  1XMQ Q;  2R7D A;  4BBR G;  2K50 A;  1XNQ Q;  2VUM G;  1Q1B A;  2I5M X;  1L1O B;  4HIO A;  1U0L A;  3CC7 A;  4A3G H;  3H3V H;  3GTK H;  4KHP L;  2DGY A;  5IWA L;  3TRE A;  1KRS A;  1WJJ A;  2JQO A;  3GTL H;  3S14 H;  4P71 A;  2ZJP A;  3U4Z A;  2R92 H;  3PCO B;  4OON A;  4L5R C;  4JI0 Q;  4YCU A;  2E5L Q;  5IE8 A;  4DV1 Q;  1VQE A;  2H5X A;  3M9B A;  5FLM H;  1IZ6 A;  4LF4 L;  1KIX A;  3M3Y H;  4B3R Q;  1CSQ A;  1K8A C;  5C3E H;  2PI2 E;  5LMN L;  4HJ8 A;  1SFO H;  2A1A A;  1W3S A;  1YJW A;  4K0K L;  1HR0 W;  3BZK A;  3OYY A;  3MEF A;  2MQH A;  3GTG H;  3B6Y A;  2VY3 A;  3L0O A;  4LFA Q;  3UDG A;  1EYG A;  4GKJ L;  4JBK A;  2RHS B;  2Y0S G;  4JC0 A;  1BBU A;  4QIW E;  4IPD A;  4DAM A;  5IYB G;  1OXU A;  4R4Q A;  2OWO A;  1K0R A;  4A3K H;  3CMA A;  1PH2 A;  2AWN A;  2BA0 A;  3NEM A;  1OXV A;  4XIG S;  5IWA Q;  3F2C A;  4DV0 L;  4A3J H;  2VS1 A;  3J80 c;  2CCZ A;  4A4I A;  4A93 G;  3ZJY C;  3AFQ A;  4JI3 L;  2ALY B;  3CPF A;  3DLL A;  4IFD J;  2VZA A;  4JI2 Q;  1WCM H;  2ATW A;  2ZJQ A;  4DPG A;  4BA2 I;  4L5T A;  3HOW G;  2CKZ B;  3TS2 A;  3VDY A;  5M3M G;  2KCM A;  2EIF A;  1NY4 A;  3NEN A;  2ASB A;  4DV7 L;  4A3B G;  4GKJ Q;  4IPC A;  5HY6 A;  2QGQ A;  1NTG A;  1C0A A;  5M5W H;  1MJC A;  2YTX A;  4C2M H;  1M90 C;  2JA5 G;  1QUQ B;  1Y1V H;  2B63 G;  3I4N H;  5BR8 L;  1U5K A;  2IX1 A;  2R7Z H;  1HJP A;  3STB C;  3HOY G;  4DV0 Q;  5IYC H;  1X56 A;  1MKH A;  1VQB A;  1NMG A;  1WOC A;  3KDF B;  4JOI C;  1C7Y A;  2IY5 B;  4DV2 Q;  3STB D;  5IP9 G;  2NZO A;  3FP9 A;  5J3B A;  1PVO A;  2OTL A;  1FGU A;  2HIX A;  3W5O A;  1IBM L;  4AYB G;  5JEA G;  4L5S A;  5M3F H;  1IXR A;  5IP7 G;  1Z47 A;  1YEZ A;  1I3Q H;  3RLF A;  5JJI A;  2R93 H;  2K5V A;  2WAQ G;  4LF8 L;  2VUM H;  3S24 A;  5AJ3 Q;  4DV7 Q;  4GNX C;  3CCS A;  1Z9F A;  4DK3 C;  2UUB L;  3BZC A;  5C4X H;  3HOZ H;  1XNR L;  3PSI A;  1YIT A;  4TVA B;  5BR8 Q;  3S15 H;  1OXS C;  2ZM6 L;  2EQS A;  2Q2U A;  4HJ5 A;  1XJV A;  1QUQ A;  3KF8 B;  1HNZ Q;  3PF4 A;  3S1Q H;  1I94 L;  2NVX H;  2WB1 G;  1IBK L;  1K8G A;  3ICE A;  3UE0 A;  3M4P A;  1EOV A;  2K5H A;  5LMU L;  1W2B A;  1FL0 A;  1PH3 A;  1G6P A;  1FJG L;  3ERS X;  1PA6 A;  4QL5 A;  1E1T A;  1KC8 C;  1CKM A;  2N3S A;  4GNX B;  2HT1 A;  5IYB H;  4A3F G;  2KCT A;  2N78 A;  2NN6 G;  2K75 A;  3HOV H;  2NZH A;  2UUB Q;  2AWO A;  4GN5 A;  3I56 A;  3H15 A;  2YTY A;  1VQJ A;  4AH6 A;  5C4J H;  4YHH L;  1Y1W H;  3ER0 A;  3HKZ G;  2K52 A;  5C44 G;  1GO3 E;  1FVI A;  2ZM6 Q;  1OXX K;  1WI5 A;  5ELN A;  1GM5 A;  4YY3 L;  1VQL A;  2A8V A;  3TQY A;  1D8L A;  1J6Q A;  1Q46 A;  2F52 A;  1BVS A;  4LUO A;  2NN6 I;  4R4T A;  1SMX A;  3W1G A;  1SN8 A;  5M3M H;  3PUX A;  4LFB L;  3A74 A;  3L7Z C;  4C3I H;  4DKA C;  1NJI C;  4JV5 L;  1FJG Q;  4TQU S;  3J80 i;  1YZ6 A;  1Q7Y C;  2Z6K A;  2NVQ H;  2RF4 A;  2GVB A;  2NVT H;  2UXD Q;  1CSP A;  4IJH A;  1EIF A;  4HJ9 A;  2JA5 H;  1EWI A;  1OXT A;  5HGQ A;  3DM3 A;  4MNO A;  2B63 H;  3T1H L;  1QZH A;  3K8A A;  4NXN L;  5JEA J;  3HOX G;  3G48 A;  3HOY H;  2XTI A;  4JG2 A;  1XPR A;  4IO9 A;  1PFS A;  3J81 i;  4PG3 A;  5IP9 H;  2F4V Q;  2B3G A;  3ULL A;  3OW2 A;  4GN3 B;  1YJN A;  1PH4 A;  1OTC A;  3G71 A;  3WWV A;  1VS0 A;  4DR5 L;  2IX0 A;  1I5F A;  1NE3 A;  2XGT A;  4AQY L;  2E2J H;  2I0Q A;  1KXL A;  4MZ9 A;  4LFB Q;  1G29 1;  3K7A H;  2JA9 A;  3GO5 A;  4EQ5 A;  5IP7 H;  5H1S E;  1A0I A;  1N34 Q;  4B3T L;  4LF6 Q;  1IL2 A;  2IHE A;  4A3M G;  1PH9 A;  1N33 L;  2FXQ A;  3CC4 A;  3NEL A;  5IYD H;  4OX9 L;  2UU9 L;  1WFQ A;  4O0A A;  3T1H Q;  1X3F A;  4DR2 L;  1J5E Q;  4IPG A;  4LUZ A;  4NXN Q;  3FKI H;  2ID0 A;  4DR6 L;  3LGJ A;  1X3E A;  2VW9 A;  3CPW A;  4LFC L;  2JA6 G;  1Q82 C;  2YYZ A;  1IBL L;  1B7Y B;  1M1K C;  3PGZ A;  3RNU A;  3U58 A;  1ASY A;  1XMO L;  4DR5 Q;  1Q81 C;  5FLX c;  4R4O A;  1N36 L;  1EUJ A;  1BKB A;  3H0G G;  4JI1 L;  4B3T Q;  5EAY A;  4JI8 L;  2EXD A;  4JI7 L;  4KHP Q;  4X66 L;  3UDX A;  1PH1 A;  1SRU A;  4YWL A;  4DR3 L;  1PHJ A;  3GTP H;  4R1J A;  4OX9 Q;  2UU9 Q;  3K80 C;  4X62 L;  2MNA A;  3HOU G;  1Q8K A;  1V1Q A;  2JE6 I;  4DR2 Q;  5C44 H;  3GTJ H;  1K9M C;  2UUC L;  3I2Z A;  1DGS A;  2JK8 A;  3W1B A;  3F1Z A;  3I7F A;  1MIU A;  1YBY A;  3RN2 A;  1HNX L;  1S72 A;  2R7F A;  1ASZ A;  4DR6 Q;  5LMN Q;  4LFC Q;  2I5L X;  4DUY L;  4JI6 L;  3PO3 G;  4K0K Q;  1H95 A;  1UEB A;  2DUD A;  2NVY H;  1VQ6 A;  4J15 A;  3NBH B;  5M5X H;  2JA7 G;  3J81 j;  2QEX A;  2V1C C;  2JJQ A;  1XMO Q;  2PMZ E;  3L2P A;  1PV4 A;  2JEB I;  4PMW A;  4JI1 Q;  4JI7 Q;  5GAH C;  1KL9 A;  3D31 A;  4ALP A;  2PQA A;  4DAY B;  3RZD H;  2YU9 H;  2AKW B;  4UPA A;  3HOX H;  4Y52 H;  4UP7 A;  3CCM A;  4JI3 Q;  1JMC A;  3J7A 5;  4A3D H;  3CCE A;  1VQ8 A;  4GLX A;  1HNW L;  3M4Q A;  2UUC Q;  2Z6K C;  2VQF L;  4DNI A;  1HNX Q;  4FDB A;  1L2F A;  4YWM A;  3CCV A;  2HIV A;  4DUY Q;  2IT1 A;  1XPO A;  4JI6 Q;  3T1Y L;  4BBR H;  1JJC B;  1UE7 A;  4YCW A;  1X9N A;  1HNW Q;  4GLV B;  1UWV A;  3CCL A;  4LW1 A;  4JI5 L;  4A3M H;  3U4V A;  2WP8 J;  1EIY B;  2KHJ A;  4X65 L;  3GTM H;  4O2D A;  2GVA A;  1YVC A;  1VQN A;  3EN2 A;  2KHI A;  3E9I A;  5C0X I;  4APV A;  3GD7 A;  2RHQ B;  4A76 A;  1R9T H;  3GDE A;  4UP8 A;  1CKN A;  2ES2 A;  2JA6 H;  4OO1 G;  2CWP A;  4A3L G;  2HHH L;  1XTD A;  3PUZ A;  3BU2 A;  4HIK A;  1IYJ B;  1X6O A;  2KBN A;  1IBM Q;  3ULP A;  4A3G G;  1VQF A;  3F2D A;  1Q86 C;  4LWC A;  4DV3 L;  3GTQ H;  3T1Y Q;  4LF8 Q;  2HQL A;  2R92 G;  1LUZ A;  1VQO A;  3UDI A;  1K73 C;  1LTL A;  1N9W A;  2A19 A;  3H0G H;  3RR5 A;  4DV4 L;  4OO1 I;  1XNR Q;  3PV0 A;  5GQO A;  3S1M H;  4B3M L;  3JAM c;  3H3V I;  1PH5 A;  4A3C G;  5E7N A;  4BY1 G;  5C3E G;  3CCU A;  4A93 H;  1B70 B;  4NB3 A;  4POF A;  1YNX A;  5M5Y H;  4A75 A;  3MXN B;  1E1O A;  5DLQ E;  2UUA L;  3HOU H;  3S2H H;  3F2B A;  1I94 Q;  3AQQ A;  1HH2 P;  2OCE A;  3HOW H;  3CP0 A;  4L5Q A;  2OTJ A;  3CCR A;  1IBK Q;  5K36 G;  2JEA I;  3PO2 G;  3AFP A;  3PO3 H;  5LMU Q;  3M7N A;  1WYD A;  4JBW A;  2ZJR A;  1TWF H;  4YCV A;  2K14 A;  4GOP A;  1VQ9 A;  2JA8 G;  3S1N H;  1HR0 L;  1TWG H;  1N32 L;  4A3B H;  4A3J G;  4IOC A;  2D62 A;  1C9O A;  2IHF A;  2K5N A;  2N49 A;  4DV3 Q;  2ZTD A;  1SE8 A;  3ULJ A;  3PIO A;  2QA4 A;  4BXX G;  2AMC B;  3S2D H;  1PYB A;  4DV4 Q;  1MJE A;  3TRZ A;  4B3M Q;  4YHH Q;  4DV6 L;  4P75 A;  3JC6 6;  4B3S L;  4R4C A;  1E22 A;  1UE6 A;  4YY3 Q;  1LM0 A;  4X64 L;  4C3J H;  4C3H H;  3CF5 A;  4JYA L;  2UUA Q;  1G51 A;  2PI2 A;  3GTO H;  1P16 A;  3FHW A;  3CQZ H;  5JJL A;  1E3P A;  4QQB X;  1EFW A;  4YWK A;  1VQ4 A;  4BBS G;  1YHA A;  3BJU A;  4JV5 Q;  1I6H H;  2R7Z G;  1N32 Q;  1D7Q A;  2GN5 A;  3PUV A;  1HR0 Q;  4IPH A;  2ZTC A;  4JI0 L;  2PNH A;  4JBM A;  3SGI A;  5ELO A;  3UE1 A;  3OTO L;  4RMF A;  4B3R L;  4LF9 L;  2E2H H;  1Y14 B;  2D0O A;  1AE3 A;  2AHO B;  1QVG A;  4IFD I;  1JT8 A;  1TWA H;  2WFW A;  2BH8 A;  1CKO A;  3CC2 A;  2VNU D;  4DV6 Q;  1S40 A;  4X64 Q;  1YHB A;  2CWA A;  1EQR A;  2VL6 A;  4JYA Q;  3KOJ A;  5FJ8 G;  1YJ9 A;  4A3L H;  1PH8 A;  3PUW A;  1YHQ A;  2Y0S E;  1A62 A;  2Q2H A;  3S16 H;  4GKK L;  4AQY Q;  4IJL A;  5C4X G;  1VQD A;  4P73 A;  2RCN A;  2PQA B;  4A3I G;  3HOZ G;  5GAD C;  3IRB A;  4HID A;  1YI2 A;  1UE1 A;  5JJK A;  1PYS B;  4A3F H;  1N33 Q;  3PUY A;  4DR4 L;  4JI2 L;  3EBE A;  1P8L A;  4MTN A;  3OTO Q;  1QVC A;  4A3C H;  4LF9 Q;  4BY1 H;  3KF6 B;  3AYH B;  3Q8D A;  2N8N A;  4WJ3 M;  4KLK A;  2MO0 A;  2YV5 A;  3CW2 C;  1X65 A;  3HFZ B;  1IBL Q;  1QZG A;  1VQG A;  4PZ8 A;  2OQ0 A;  1SLJ A;  1T9H A;  2F3I A;  3K81 C;  4BY7 G;  3KJP A;  3PO2 H;  1N8R C;  1JE5 A;  1X55 A;  1JB7 A;  2UXC L;  4HJA A;  2C35 B;  3JAM i;  2JA8 H;  3HOV G;  4GKK Q;  1LYL A;  1JJG A;  4QGU A;  1YIJ A;  1N36 Q;  1Y1W G;  4LNQ A;  3K0X A;  1VQ5 A;  1L1O A;  3K7U C;  4UY8 C;  4JI8 Q;  3RLN A;  4HIM A;  4X66 Q;  3CME A;  1CKN B;  1KHI A;  3A5U A;  4DV2 L;  2R6G A;  2MO1 A;  4DR3 Q;  4LF7 L;  4BXX H;  4DR4 Q;  3M85 A;  1VQC A;  2E8G A;  4X62 Q;  3TEH B;  3J7Z C;  1UE5 A;  1XPU A;  4GOP C;  2I5H A;  1Q12 A;  2K4K A;  4RG1 A;  1SRO A;  3I4M G;  3KFU A;  4R4I A;  1KD1 C;  3TS0 A;  1HZB A;  2L15 A;  4NXM L;  2ZTE A;  4AYB E;  3J81 c;  3KF6 A;  5AJ3 L;  1X3G A;  4BA1 I; 
#chains in the Genus database with same CATH topology
 4A3E G;  4BBS B;  1HZ9 A;  4OEM B;  4PNY A;  1V1P B;  4WRD A;  1QNK A;  1S3O A;  3EIV A;  1WVL A;  3HKS A;  3G4S A;  2LXK A;  1X54 A;  1A6X A;  4JBJ A;  1VQI A;  4PZ7 A;  1A8V A;  3S1R B;  2Q2T A;  1TWH B;  4LK1 C;  3M4O H;  2CQO A;  3V05 A;  5EQ0 A;  1JQY D;  1SYD A;  4Z9C B;  1BO0 A;  4JI5 Q;  3ERO A;  4DK6 C;  4GS3 A;  2CFM A;  1TY0 A;  4DUZ L;  3E0J A;  4PMC A;  1U4L A;  4OIK A;  3VA7 A;  1E7Z A;  4HSP A;  1M8A A;  4H02 A;  1WTR A;  1RIP A;  3W3A A;  2N88 A;  5GAE C;  2F0U A;  2F4I A;  5I2X A;  5IT9 E;  4BY7 H;  3PF5 A;  1AH9 A;  1EQQ A;  5JVH 3;  3L9A X;  4F7X A;  2B2T C;  1R4Q B;  2VQE L;  3G6E A;  4PZ6 A;  1Z6H A;  1JB3 A;  4DU9 A;  2PO4 A;  2Z4H A;  1V43 A;  2ZXP A;  1XMQ L;  1XNQ L;  1PH6 A;  4JOI A;  3KF8 A;  4H0L C;  3I4M H;  3Q24 A;  3H3V C;  3DWA A;  1RTO A;  4LF6 L;  4P72 A;  4ZKB B;  1EQT A;  4HJ7 A;  3I4N G;  2E2I B;  1SYB A;  1STH A;  1GKH A;  4N8F A;  4GLA C;  1EYA A;  4HN7 A;  4OWW B;  4EQP A;  2F0O A;  5I6W A;  1NBW A;  1PRT B;  3RN5 A;  1F9S A;  4B3S Q;  3E9H A;  1CZG A;  1BNZ A;  5JOB A;  2R7D A;  3GTK B;  1NR2 A;  1Q1B A;  3CC7 A;  1EIG A;  3KBG A;  4QUF A;  1XTC D;  2CW0 C;  3SDZ A;  2J7Z A;  1WJJ A;  1D2B A;  1BQQ T;  1L0X B;  3GTL H;  1LTB D;  3S14 H;  1HXY D;  2F0F A;  3HGB A;  5IE8 A;  1VQE A;  1IZ6 A;  1NSN S;  4H44 C;  4B3R Q;  1CSQ A;  2PI2 E;  1YJW A;  2BDN A;  2K28 A;  4GKJ L;  3R8B A;  5DNF A;  2Y0S G;  3K6O A;  4N8X 1;  4DAM A;  2NTS A;  5ELC A;  1IHZ A;  2AWN A;  2BA0 A;  3NEM A;  1OXV A;  2CCZ A;  5C4H A;  3OMG A;  4A4I A;  5D3I B;  4A93 G;  3ZJY C;  2ALY B;  4FF4 A;  1LTS D;  3DEO A;  1TU2 B;  3T16 A;  3VA5 A;  1WCM H;  4DPG A;  3QOJ A;  4RKL A;  3DUZ A;  2EIF A;  2C9O A;  1NY4 A;  1HQR D;  2SEB D;  4MIU A;  2E74 C;  5M5W B;  4Q0F A;  3I4N B;  4A3B G;  3BDO A;  5FKA C;  3H09 A;  3NWS A;  1MJC A;  2WKD A;  4K8I A;  3NXW A;  4C56 C;  2A74 C;  2EE1 A;  1HJP A;  2RVL A;  3STB C;  3VR3 A;  3HZX A;  3HOY G;  2ICE C;  4DNT B;  1LT4 D;  3J80 E;  2BE5 D;  5IP9 G;  1GUW A;  1FGU A;  1PDQ A;  5C6A A;  1K8M A;  1IBM L;  2EYH A;  4AYB G;  1MD2 D;  1I3Q H;  2K5W A;  2K5V A;  1WTO A;  5AJ3 Q;  5AFW A;  5A2Q L;  3K59 A;  2UUB L;  3S15 B;  4DGZ A;  1E0B A;  3VYT A;  4PV1 C;  2EQS A;  3QR8 A;  4HJ5 A;  1XJV A;  1KLG D;  2KEE A;  1ILP A;  3VYR A;  2A6H D;  4R8I A;  5ELF A;  1I94 L;  1YNJ D;  2NVX H;  3M4P A;  2A5H A;  2K5H A;  1FL0 A;  5JAV A;  2Y0S B;  1SYC A;  2KCT A;  1Y1W B;  2NN6 G;  2K75 A;  3UI2 A;  4RH6 A;  1U4M A;  1DJR D;  2A8V A;  1OXX K;  4MTK A;  3TN2 A;  5I9P A;  3TQY A;  4LUO A;  1HPC A;  4R4T A;  5L37 A;  1SMX A;  5M3M H;  3W2D A;  1CHP D;  3A74 A;  1NJI C;  4JV5 L;  3J80 i;  2PMZ B;  1PTO F;  1K0S A;  2G5D A;  4FVM A;  1CSP A;  2GA4 B;  4G57 A;  1EWI A;  5HGQ A;  3DM3 A;  4MNO A;  4FXG C;  4UDU C;  3HOY B;  5I4D A;  3HOX G;  3KLS A;  4JG2 A;  4NDX A;  4QMG A;  1PFS A;  3E5S A;  3VR5 A;  2F0E A;  3J81 i;  1BCP D;  2D2C C;  3OIQ A;  4DK0 A;  3OW2 A;  4GN3 B;  1PH4 A;  1BF4 A;  1OTC A;  3WWV A;  1VS0 A;  4HTH A;  3K7A B;  3S9W A;  1I5F A;  1NE3 A;  3OSO A;  1G29 1;  1LLR D;  4EQ5 A;  4LF6 Q;  1IL2 A;  1D1I A;  2EY2 A;  1N33 L;  3QJY A;  3NEL A;  5IYD H;  5E3F A;  4O1N A;  1LTG D;  4KN7 C;  4LFC L;  1B7Y B;  1L0Y B;  1IW7 D;  4DN4 M;  1ASY A;  3J7A V;  2L5T A;  1ET9 A;  5FLX c;  1LTA D;  5A2Q E;  5EKI A;  2HDM A;  1EIH A;  4JI1 L;  3BVZ A;  5CV6 A;  2XVS A;  1UAP A;  1PH1 A;  1SRU A;  2K01 A;  4TKO B;  2L9H A;  4R1J A;  3K80 C;  4FXK C;  1W6J A;  4DR2 Q;  4K5X A;  1K9M C;  4C1N K;  3RN2 A;  3F1Z A;  3GTM H;  1MIU A;  1NR4 A;  1DON A;  5KIX A;  1SNM A;  4B08 A;  2F0I A;  1H9S A;  3NBH B;  3P1H A;  4XT1 B;  3AU7 A;  3HOX B;  2ENB A;  4A3D B;  2YU9 H;  2AKW B;  4Y52 H;  3CCM A;  4C3J G;  1JMC A;  1KNE A;  2F0H A;  3CCE A;  2UUC Q;  2R3Z A;  4DNI A;  2F0T A;  1HNX Q;  4FDB A;  4BBR B;  4IUQ A;  5C5L A;  4E6I A;  3CCV A;  3CU7 A;  1FNU A;  4JI6 Q;  1X9N A;  1JJC B;  1UE7 A;  4O42 A;  4XXE A;  4GLV B;  1AP0 A;  3CCL A;  1U9R A;  4XYO A;  4FF3 A;  3OWE B;  1EIY B;  4DNR B;  2KHJ A;  2M2L A;  5JPN C;  4X65 L;  3GD7 A;  4A76 A;  4CJ1 B;  1R9T H;  2Q8T A;  4N9P A;  1ET6 A;  1XTD A;  3PUZ A;  4HIK A;  1IYJ B;  1IBM Q;  4FF2 A;  2EYF A;  4LWC A;  4R9W A;  3MA2 B;  3T1Y Q;  1LUZ A;  1VQO A;  3S1M B;  1LTL A;  1N9W A;  1SNQ A;  1F9P A;  4RCO A;  3MWY W;  4BY1 G;  3S2H B;  1B70 B;  3EVQ A;  4I7A A;  4POF A;  1G91 A;  3MXN B;  5DLQ E;  2UUA L;  3HOW B;  1V1P A;  1I94 Q;  4CGY B;  3CP0 A;  1S5B D;  2J4X A;  1TWG B;  1WYD A;  4X3U A;  2K1B A;  1HR0 L;  2JP1 A;  4ME5 A;  1C9O A;  2IHF A;  2K5N A;  4DV3 Q;  1DOM A;  2ZTD A;  3ULJ A;  4BXX G;  2B39 A;  4NMZ A;  2AUK A;  3S2D H;  1PXU A;  4B3M Q;  3NQI A;  2MHV A;  2QCP X;  3JC6 6;  3JAM E;  4R4C A;  1E22 A;  3GTO B;  3CF5 A;  1A2T A;  4IUP A;  2J0T D;  3CQZ H;  2AQ3 B;  1X32 A;  1I6H B;  1EFW A;  1QNU A;  5C3W A;  4JV5 Q;  5CBE E;  3U9O A;  3SGI A;  4LF9 L;  1QE6 A;  2AHO B;  2DY7 A;  4CKE A;  1JT8 A;  4OL7 A;  1SND A;  3CC2 A;  1SYG A;  1UNS A;  3KLR A;  3OHX C;  1S40 A;  5D65 A;  4X64 Q;  3ND8 A;  5IGE A;  2CWA A;  1O7Z A;  4EGV A;  4JYA Q;  1VMC A;  1EY4 A;  3PUW A;  1A62 A;  1EY9 A;  1VQD A;  2RCN A;  4A3I G;  5GAD C;  1WTV A;  3A8K E;  4QUC A;  1PYS B;  2B2U C;  1WTH A;  1N33 Q;  1Z7T A;  2EYJ A;  2IPK D;  3GTJ B;  4JI2 L;  4BY1 B;  1DCZ A;  1P8L A;  2XSC A;  1NAP A;  1S5C D;  1QVC A;  4K6D A;  1F2M A;  3KF6 B;  2BOS A;  1B53 A;  2N8N A;  1V1O A;  1X65 A;  4QCL A;  2KED A;  2OQ0 A;  4DA2 A;  4KV6 A;  2O5J C;  3K81 C;  1XX8 A;  2LFN A;  2C35 B;  2OXP A;  3JAM i;  1AFP A;  1LYL A;  3T51 B;  2P5Z X;  1WD0 A;  1EY7 A;  2XRS D;  4HIM A;  1CKN B;  2Z9H A;  4DR4 Q;  3M85 A;  2A6E C;  3SHL A;  3C46 A;  2KCC A;  1WTQ A;  1D5Z C;  3LWU A;  2O2L D;  1X3G A;  5IOD A;  3J7Y W;  5C0X G;  4OXP A;  2F03 A;  5CBA E;  3QG1 A;  5LMN W;  1BDO A;  2D0P A;  3RZO H;  3D8G A;  5IGD A;  1HNZ L;  4GN4 B;  3M7G A;  1DOK A;  2B2V A;  4M8A A;  3KLW A;  3LX0 A;  3CD6 A;  5IY0 A;  5I9O A;  1HA5 A;  4KKT A;  1Q1E A;  3S17 H;  2LSS A;  5G3L F;  4QY7 A;  2BH2 A;  3I4O A;  4XTC S;  3A7L A;  2VB2 X;  1VQ7 A;  2I07 B;  1ROD A;  2KA7 A;  4A3I B;  3SK8 A;  3BYT B;  5IYD G;  3A5Z B;  4Y7N H;  1ENA A;  1IYU A;  1PTO D;  3F8T A;  5A35 A;  5FLM G;  3HKZ E;  1NMF A;  4X65 Q;  1SJH D;  5GRO A;  1STA A;  2PNR C;  1B8A A;  2F0S A;  4OWT B;  1SYE A;  3PO3 B;  1I6V C;  4QIW B;  1S5E D;  3CCJ A;  2JA7 B;  1BOS A;  1TWC H;  4DR7 Q;  4K5V A;  4HCE A;  2Q2I A;  2KCN A;  3IKJ A;  1PTO H;  3KYH C;  4MHE A;  1VQM A;  1TXY A;  2X6G A;  4P74 A;  1LT3 D;  5F2D A;  1KRT A;  4OHJ A;  3UDF A;  1O7I A;  1Y69 U;  1GUN A;  1TKW B;  1MHW C;  4FXD A;  1VQA A;  1HFN A;  4RWS C;  1I4R A;  3N52 A;  4BWG B;  1HZA A;  3FEW X;  1ESR A;  3C2P A;  2PW5 A;  2XNA C;  4LF5 Q;  4IFD G;  4C1N I;  2PZT A;  4KY7 A;  1CT1 D;  2L1B A;  2F0N A;  4RFB A;  3E0E A;  4U68 A;  3SEB A;  1VQP A;  4OIJ A;  5EKL A;  1STE A;  2F3V A;  2YTV A;  2CQA A;  4X6A H;  1I50 H;  1B3Q A;  4KI0 A;  5M3F G;  1RL2 A;  4A3G B;  3LWE A;  2R93 G;  2F0P A;  1QIL A;  2K50 A;  2Q8I B;  2VUM G;  1G6Z A;  4HIO A;  3NTK A;  3OOC A;  2ZJP A;  1STN A;  3U4Z A;  2R92 H;  4YCU A;  4IAL A;  2AQ2 B;  3T4A C;  4JK1 C;  4DV1 Q;  5NUC A;  1SFO B;  3M3Y H;  1VF5 C;  2XRQ D;  4LF4 L;  4FO2 A;  1K8A C;  5C3E H;  3GTG B;  3KUP A;  4HJ8 A;  1W3S A;  1HR0 W;  1STG A;  3BZK A;  3MEF A;  3B6Y A;  4LFA Q;  3UDG A;  4KD3 A;  5CMD A;  2RHS B;  1EZ6 A;  4IPD A;  3QO2 A;  1OXU A;  3IFT A;  4A3J B;  2OWO A;  4A3K H;  3Q22 A;  3NP8 A;  5IWA Q;  1VDZ A;  3F2C A;  1FD7 D;  3AFQ A;  1SNO A;  5E4W C;  1I4Q A;  5BN4 A;  4IQZ A;  2VZA A;  4JI2 Q;  1T5X D;  1TII D;  5T1G A;  4GZY C;  3NEN A;  1O78 A;  3NTH A;  5HY6 A;  2QGQ A;  1NTG A;  1X3P A;  1E2V A;  4C2M H;  1Y1V H;  2R7Z B;  2IX1 A;  4FNF A;  5ISR A;  1X56 A;  5IYC H;  3KDF B;  4V19 0;  3K5N A;  1EYD A;  2NZO A;  5J3B A;  3BDC A;  1DZ1 A;  1HUN A;  5M3F B;  2SDF A;  4CDF C;  3FVQ A;  2R93 B;  5JEA G;  2VUM B;  1D5M C;  5JJI A;  3MEH A;  3RLF A;  4QB4 A;  4LF8 L;  5C4X B;  5CR3 A;  1QCB D;  4DV7 Q;  4GNX C;  2A6H C;  3HOZ H;  1XNR L;  4X3T A;  3PSI A;  3NBH A;  5BR8 Q;  2Q2U A;  1JCK B;  3S1Q B;  1QUQ A;  1HNZ Q;  5FO7 B;  1FNV A;  5LHY 1;  1G8Z D;  3NQT A;  1W2B A;  3ERS X;  4ZAI A;  4QL5 A;  2D5D A;  1SYF A;  2N3S A;  3CRK C;  1EL0 A;  2FJ2 A;  3HOV B;  5IYB H;  3FRP B;  1TS3 A;  2HUG A;  5C4J B;  4DAV A;  2NZH A;  5FLX L;  3Q0A A;  3I56 A;  2TSS A;  3CHB D;  3HKZ G;  3VR4 A;  5ELN A;  3T53 B;  1XYI A;  1D8L A;  2F0M A;  5EGT A;  4CKC A;  1BVS A;  3BG3 A;  3TME A;  2NVQ B;  4C3I H;  2KEC A;  5DEH A;  2VB3 X;  4TQU S;  4A3E B;  1F2Z A;  2NVT H;  2GVB A;  1TS2 A;  2EVB A;  1F2Y A;  2K5Q A;  1EIF A;  4IJH A;  4HJ9 A;  2JA5 H;  1OXT A;  2B63 H;  1QZH A;  4K6L A;  3K8A A;  1BCP C;  2XTI A;  1LT5 D;  3K5L A;  4IO9 A;  2LMC B;  1YJN A;  3A8I E;  2XGT A;  2I0Q A;  1SNC A;  2FFK B;  1KXL A;  4MZ9 A;  4LFB Q;  3MZ5 A;  5IP7 H;  2IHE A;  2FXQ A;  1U4R A;  1CFM A;  2QIL A;  3SK4 A;  4DR2 L;  4IPG A;  4LUZ A;  1IW7 C;  3FKI H;  3GV3 A;  5IIF A;  5LL6 S;  2JA6 G;  1Q82 C;  1MSG A;  1PRT F;  1M1K C;  3RNU A;  4KK7 A;  1JWM D;  5JVG 3;  4DR5 Q;  1Q81 C;  2VXW A;  4R4O A;  1N36 L;  3H0G G;  1BKB A;  2IL8 A;  2F0W A;  2H4O A;  4DR3 L;  1PHJ A;  3GTP H;  3HKZ B;  2UU9 Q;  1BBX C;  3HOU G;  1Q8K A;  1V1Q A;  5C44 H;  3GTJ H;  2UUC L;  3I2Z A;  3C1F A;  2MPM A;  1HNX L;  4LF4 Q;  1ASZ A;  2NVY B;  2R7F A;  2B2W C;  1CZW A;  1H95 A;  4JI6 L;  4J15 A;  4G7Z C;  5M5X H;  5G3L D;  1GHJ A;  5KNB A;  1HTL D;  3ND9 A;  1XMO Q;  3K5O A;  3L2P A;  2JEB I;  5GAH C;  3HG9 A;  3PMF A;  1RCV D;  3RZD H;  3F2U A;  1EEI D;  2MP1 A;  4K8J A;  2RDH A;  3J7A 5;  4GLX A;  2Z6K C;  3URY A;  5JPM C;  2F0L A;  1A3V A;  3T1Y L;  3IFD A;  1RKN A;  3R93 A;  1LO5 D;  1UWV A;  3GV6 A;  3I91 A;  4LW1 A;  4A3M H;  4HMI A;  1HTP A;  1D5X C;  4J6H A;  1FNW A;  3SK6 A;  3R2T A;  4O2D A;  5D14 A;  3BVG A;  5KYL A;  1VQN A;  5E4X A;  2KHI A;  4K14 A;  5C0X I;  4APV A;  2JA6 B;  4UAI A;  4ZUJ A;  2E2D C;  1H9R A;  3GDE A;  1CKN A;  2CWP A;  1BR9 A;  4A3L G;  1HNW Q;  2H1E A;  4OEL B;  3ULP A;  1Y8P B;  1VQF A;  3F2D A;  1Q86 C;  4DV3 L;  1UUP A;  3GTQ H;  3H0G B;  4LF8 Q;  2HQL A;  2R92 G;  2L11 A;  1QB5 D;  1SMY D;  2A19 A;  3RR5 A;  3A55 A;  4OO1 I;  4A93 B;  1XNR Q;  3PV0 A;  4B3M L;  5I6Y A;  3H3V I;  3HOU B;  5C3E G;  1WD1 A;  4KD4 A;  4NB3 A;  5M5Y H;  1E1O A;  4WFN 3;  3HP3 A;  3F2B A;  1TVX A;  1HH2 P;  1TWF B;  2JEA I;  5EPL A;  3PO2 G;  3PO3 H;  4A3B B;  1VQ9 A;  2K14 A;  1AEX A;  4ODG A;  2N49 A;  4M1U B;  3PIO A;  2QA4 A;  2AMC B;  2WIN B;  1PYB A;  4DV4 Q;  2OT2 A;  4RGN A;  5CV5 A;  4J8Q A;  1MJE A;  3TRZ A;  4P75 A;  1CTM A;  4IUU A;  1UE6 A;  4X64 L;  4C3H H;  4JYA L;  2E2J B;  1C48 A;  2C5C A;  4AYB B;  2WII B;  4G7H C;  4EQO A;  1E3P A;  4YWK A;  1VQ4 A;  1LAB A;  1YHA A;  3BJU A;  2B8F A;  3R3O A;  2GN5 A;  2ICI A;  2ZTC A;  4JI0 L;  2PNH A;  3MTS A;  2NYZ D;  4EVO A;  3QWN A;  2E2H H;  1EQV A;  2D0O A;  4IFD I;  4CDE C;  1TWA H;  5DAU A;  1JWS D;  3S16 B;  1YHB A;  1EQR A;  2VL6 A;  4HAE A;  1T5E A;  5CC4 A;  1PH8 A;  2Q2H A;  1B9M A;  3HOZ G;  4P73 A;  2WAC A;  4HID A;  1YI2 A;  4A3F H;  3DEP A;  2XIW A;  2PW7 A;  4DR4 L;  2CW0 D;  1WTP A;  2EZV A;  4MTN A;  1SDF A;  3SVM A;  3OTO Q;  4A3C H;  4HSV A;  3I90 A;  2D9U A;  4KLK A;  2B2T A;  3TP8 A;  3PO2 B;  1A2U A;  4XT3 B;  2F3I A;  4BY7 G;  1JE5 A;  1JB7 A;  1WTX A;  2JA8 H;  4TSS A;  1JJG A;  1SE2 A;  1N36 Q;  1VQ5 A;  4KKS A;  3K7U C;  4KJO A;  1KHI A;  3BDL A;  3R2I A;  5FO9 B;  2DNE A;  2MO1 A;  4DR3 Q;  2NZ1 D;  3A8J E;  3FPP A;  3J7Z C;  1UE5 A;  4GOP C;  2I5H A;  2K4K A;  3I4M G;  5C3X A;  3KFU A;  4C3I G;  4IN3 A;  1RJT A;  3LNN A;  3TS0 A;  1HZB A;  5LL6 X;  4XQJ A;  3J81 c;  4BA1 I;  2WAQ E;  4OWX B;  3D4R A;  2NWG A;  4LUV A;  1ZYR C;  2I46 A;  3PIP A;  4BBS H;  1EYC A;  2MFI A;  1HZC A;  1S4Z A;  1MI2 A;  4JW0 A;  1I4X A;  1KDB A;  2A68 C;  2OQK A;  4KHV A;  4LF7 Q;  1JOK A;  3D0F A;  1QVF A;  3M4O B;  4DR7 L;  2FMM A;  3S1R H;  3G7L A;  1PTO C;  5FJ8 H;  1TWH H;  2KJX A;  1L0W A;  4DV5 Q;  1PH7 A;  4F8M A;  3FKI G;  4POG A;  5C5M A;  1STY A;  3U50 C;  3AMU A;  2RQX A;  4ME3 A;  4AIM A;  4ULL A;  3KDF A;  5EBC A;  3NTI A;  1K3R A;  4LF5 L;  3S1N B;  5IGF A;  4N9T A;  4BY7 B;  2UXD L;  3NE5 B;  5EJW A;  1DD2 A;  2UXB Q;  2MUY A;  1SSO A;  2BDO A;  3V96 A;  4WJ4 A;  1BBW A;  2HQE A;  1KAA A;  1WCM G;  2ZXR A;  3CAM A;  4C3J B;  1FR3 A;  3I4M B;  4K2K A;  4NPS A;  3A0J A;  3I72 A;  2RKS A;  4JCV E;  1N34 L;  1PRT D;  1L1O C;  2NB0 A;  2B2Y C;  4CKB A;  1O7Y A;  2E2I H;  4A3E H;  2CH4 A;  1ICF B;  4ZCK A;  4EX5 A;  1VQK A;  4IOA A;  1J5E L;  4DV1 L;  4KHZ A;  4R8N A;  2PPB C;  3TZU A;  3AEV A;  2Z0S A;  3IAY A;  1JOQ A;  1H9K A;  3TSS A;  4JI4 Q;  4LFA L;  4DR1 Q;  4F88 A;  1V9P A;  4UP9 A;  3SK5 A;  3Q23 A;  4HCS A;  3VR6 A;  2I5M X;  3VR2 A;  1U0L A;  3GTK H;  1GXD C;  3S14 B;  2DGY A;  5IWA L;  3TRE A;  2JQO A;  1SXT A;  4KKU A;  4PQX A;  4L5R C;  3DHQ A;  4JI0 Q;  2E5L Q;  1VF7 A;  2H5X A;  1GUT A;  3HEJ A;  4ABN A;  4XQN A;  2PZU A;  2QDL A;  4K0K L;  5J1Z A;  3OYY A;  2EJM A;  2MQH A;  2VY3 A;  4JBK A;  2SOB A;  4V0B A;  1BBU A;  3TP5 A;  1CA6 A;  2RCF A;  3CMA A;  1PH2 A;  1QWY A;  2JN4 A;  3L3O C;  2MGS A;  4JI3 L;  1WCM B;  2JSO A;  2L55 A;  3DLL A;  1K8O A;  5COR A;  4BA2 I;  4L5T A;  3TS2 A;  2CKZ B;  3C1E A;  5M3M G;  2KCM A;  3T56 B;  4MN3 A;  3ZYY X;  2ASB A;  4DV7 L;  4LMQ D;  4IPC A;  1C0A A;  5M5W H;  2YTX A;  3QIA A;  1M90 C;  3I4N H;  5K5P A;  2L12 A;  3EA6 A;  2N55 A;  5BR8 L;  4ID6 A;  1U5K A;  4Q5V A;  3RD4 A;  5D3D A;  4DV0 Q;  2IX3 A;  4JOI C;  1C7Y A;  4G7O C;  1JIC A;  3FP9 A;  1PVO A;  2OTL A;  1CI3 M;  1I3Q B;  1R4P B;  2KVM A;  5DM7 3;  3MXP A;  2KUM A;  1Z47 A;  1YEZ A;  2WAQ G;  4RKB A;  1Z9F A;  5FO8 B;  4DK3 C;  3NBI A;  3PQI A;  3BZC A;  3K57 A;  1YIT A;  3S15 H;  1OXS C;  1GHK A;  2NVX B;  1B50 A;  2BCO A;  1A3T A;  2V4D A;  3HS0 C;  4S3S A;  1AZQ A;  1JOR A;  3P7J A;  3ICE A;  1IBK L;  1JOO A;  1EOV A;  5LMU L;  1PH3 A;  5T1I A;  2EXZ A;  1DM0 B;  1KC8 C;  1CKM A;  4GNX B;  2HT1 A;  1XXG A;  4A3F G;  2N78 A;  4QF4 A;  1J8I A;  4GN5 A;  3H15 A;  2CVR A;  2YTY A;  1Y1W H;  3T13 A;  4AH6 A;  2K52 A;  1A3U A;  1GO3 E;  1K83 B;  5KGU A;  1WI5 A;  2ZM6 Q;  1GM5 A;  4YY3 L;  1GJX A;  1J6Q A;  1Q46 A;  5M3M B;  1B1Z A;  1EY8 A;  1RD9 D;  2NN6 I;  3W1G A;  4LFB L;  1SN8 A;  3NUC A;  1FJG Q;  1YZ6 A;  3WOF A;  1Q7Y C;  4L6T B;  2UXD Q;  2ZT9 C;  2KQ3 A;  4KJN A;  3BS1 A;  1HA6 A;  3G48 A;  3HOY H;  5M9O A;  2CHB D;  2EYM A;  4UHV A;  4PG3 A;  5IP9 H;  2B3G A;  3ULL A;  1HUM A;  3G71 A;  4DXG A;  5KEE A;  3M4Y A;  4DR5 L;  2IX0 A;  1AW7 A;  2E2J H;  4AQY L;  2WAQ B;  3K7A H;  1N34 Q;  5H1S E;  1A0I A;  3CKI B;  1PH9 A;  1YNN D;  1KDC A;  2UU9 L;  1O7L A;  5CV4 A;  1BCP B;  3T1H Q;  1X3F A;  1J5E Q;  4NXN Q;  2ID0 A;  3LGJ A;  1X3E A;  3CPW A;  3H6M A;  1IBL L;  2YYZ A;  5J39 A;  4ZUI A;  2SNM A;  2PZW A;  2X69 A;  5FK9 C;  3PGZ A;  3FDT A;  3U58 A;  2QEJ C;  4IZ8 A;  2DN8 A;  1XMO L;  1FGB D;  1EUJ A;  4LAA A;  4B3T Q;  5EAY A;  2EXD A;  4X66 L;  2NTT A;  3UDX A;  4YWL A;  1SAP A;  3H91 A;  4ZRZ A;  4FF1 A;  4OX9 Q;  4X62 L;  2MNA A;  3GTM B;  2DY8 A;  2JE6 I;  3TP7 A;  1DGS A;  2JK8 A;  3W1B A;  3I7F A;  4DR6 Q;  1S72 A;  2PCF B;  4DF7 A;  1OO9 B;  4K0K Q;  1VQ6 A;  5TSS A;  4RAU C;  2QEX A;  2V1C C;  3P20 A;  2K05 A;  3I4L A;  5EBD A;  2L4N A;  2PMZ E;  3DWQ A;  2XWB B;  4PMW A;  2BE5 C;  3I73 A;  4JI7 Q;  2YU9 B;  5CV9 A;  3D31 A;  4ALP A;  4DAY B;  3HOX H;  4UP7 A;  1SJE D;  4JI3 Q;  4A3D H;  1II3 A;  1VQ8 A;  1JWU D;  1HNW L;  3M4Q A;  2VQF L;  1EFI D;  1L2F A;  2HIV A;  4DUY Q;  2JYO A;  4JPB W;  4BBR H;  4YCW A;  1PZK D;  1PMR A;  1RHP A;  3U4V A;  1YNJ C;  4ZQ3 A;  2LY7 A;  3WOE A;  2GVA A;  1R9T B;  3EN2 A;  2B2U A;  2RHQ B;  1J9O A;  2G9H D;  4UP8 A;  4NKL A;  2ES2 A;  2HHH L;  3BU2 A;  1M4V A;  2KBN A;  1SMY C;  3J7A F;  1LAC A;  1C4Q A;  5KND A;  1F77 A;  2AUJ D;  3UDI A;  3EFX D;  1PLF A;  4DV4 L;  3OW7 A;  5GQO A;  3S1M H;  3IL8 A;  2AQ1 B;  4HR7 B;  3MFY A;  5E7N A;  3CCU A;  2K04 A;  4A75 A;  1YNX A;  3S2H H;  3AQQ A;  3HOW H;  2OCE A;  1ONL A;  2FHT A;  3CCR A;  1RF2 D;  1IBK Q;  1EEF D;  3AFP A;  5LMU Q;  2OF1 A;  3S1N H;  3V2T A;  1TWG H;  1ZEQ X;  2B8G A;  3OIP A;  1LTR D;  2WV6 D;  2D62 A;  3S2D B;  4K2L A;  2OEO A;  1RTN A;  1SE3 A;  3NHH A;  4ZK9 B;  1HCZ A;  5I2Y A;  3J80 L;  3QOL A;  2EYO A;  3G6J B;  2O4X A;  4YY3 Q;  1LM0 A;  2A69 D;  4C3J H;  3CQZ B;  2F3W A;  3K58 A;  1G51 A;  2PI2 A;  2Z8L A;  4X3K A;  3GTO H;  1P16 A;  3FHW A;  5JJL A;  3MXN A;  2F0G A;  1KLU D;  4NW2 A;  4QQB X;  3VYU A;  2Z4I A;  4B9X A;  1I6H H;  1N32 Q;  1D7Q A;  3J81 L;  3PUV A;  4IPH A;  1D6E C;  2HDL A;  4JBM A;  4ZLT F;  5ELO A;  1MBY A;  3UE1 A;  4JVZ A;  3OTO L;  1HFG A;  4RMF A;  4LJZ C;  2WKC A;  1B3A A;  2Z6B A;  1AE3 A;  3ONA B;  5HUR A;  2BH8 A;  1CKO A;  2VNU D;  3OWF A;  4DK1 A;  4DV6 Q;  1B2T A;  3KOJ A;  1YJ9 A;  5CV7 A;  3Q6S A;  1ICW A;  4WOR A;  4AQY Q;  2PQA B;  1ESF A;  3IRB A;  4H13 C;  1UE1 A;  5JJK A;  3PUY A;  2EYL A;  3EBE A;  3QB3 A;  3HRZ C;  4BY1 H;  2PYK A;  2F1M A;  2RDG A;  2MO0 A;  2YV5 A;  3CW2 C;  3HFZ B;  5ELE A;  1IBL Q;  4WJW A;  1QZG A;  3ERQ A;  3MVV A;  4PZ8 A;  1QG7 A;  5CV8 A;  1T9H A;  1B9N A;  3KJP A;  1G2T A;  4HJA A;  4GKK Q;  3NK9 A;  3D3R A;  1TS4 A;  4ZKC B;  1ML0 D;  3A56 A;  5FLX E;  3K0X A;  1YIJ A;  1Y1W G;  4UY8 C;  3RLN A;  2IJ0 A;  4X66 Q;  3CME A;  3FPU B;  3A5U A;  4DV2 L;  4BXX H;  2R6G A;  4LF7 L;  5FOB B;  4X62 Q;  3TEH B;  1EOT A;  2K33 A;  1Q12 A;  1SRO A;  4R4I A;  1TY2 A;  2ZTE A;  1STB A;  4CDD C;  3KF6 A;  1IYV A;  1CK1 A;  4DV5 L;  1VMP A;  3RZO B;  2UXC Q;  1KQS A;  5IGG A;  3O13 A;  1XWE A;  1KAW A;  1CUK A;  1JE4 A;  1K3B C;  1V8Q A;  4KY5 A;  3S17 B;  4GOP B;  1B44 D;  1Y8O B;  2WB1 E;  1JJ2 A;  3PIO 3;  1HHV A;  2VQF Q;  3RMH A;  5IT9 c;  1VCI A;  4NXM Q;  2UXB L;  1IL8 A;  2HD3 A;  4Y7N B;  1AE2 A;  1VQH A;  3J81 E;  3CCQ A;  4A3I H;  2M00 A;  1PYW D;  2K5D A;  1F9R A;  3KJO A;  2LXJ A;  3I55 A;  3I70 A;  2E76 C;  3CXC A;  3PO3 G;  3D6C A;  5GAG C;  1ZKO A;  1TWC B;  2K6A A;  4I65 A;  1KDA A;  3RLO A;  1EWH A;  1GVP A;  3MHB A;  2HHH Q;  2BA1 A;  1PTO B;  4A3K G;  1E24 A;  1ZXT A;  2JA7 H;  1GD7 A;  2B29 A;  1E2W A;  3A7A B;  1EZ8 A;  5EPK A;  1X3Q A;  3TP6 A;  4JI4 L;  5C0X J;  4DR1 L;  2F4V L;  1K83 H;  1PRT C;  1A63 A;  4DUZ Q;  3EJI A;  1I4H A;  1PZJ D;  2F0Q A;  1ENF A;  1Y1V G;  4TRD A;  4QJF A;  2QF7 A;  5C0X H;  1SR3 A;  5EKK A;  1S5D D;  1F9Q A;  5IYC G;  3AB9 A;  1TS5 A;  3NSW A;  2E5L L;  1I4P A;  2EJG C;  4GNX A;  2KEN A;  4YIJ A;  4A3D G;  1I50 B;  2A73 B;  2VQE Q;  3DWP A;  3C3L A;  5KYI A;  3DMU A;  2EY5 A;  1FYC A;  3E6Z X;  1XMQ Q;  4BBR G;  1XNQ Q;  4OO1 H;  1L1O B;  1KNA A;  1EU4 A;  1LTI D;  1PFB A;  3DM1 A;  3H3V H;  4A3G H;  4KHP L;  3TZD A;  2R92 B;  2B2V C;  2PQE A;  1KRS A;  2F0K A;  2RA4 A;  4P71 A;  3PCO B;  4OON A;  3M3Y B;  3SR1 A;  5C3E B;  3M9B A;  2K32 A;  5FLM H;  1TT2 A;  1KIX A;  5LMN L;  1SFO H;  2A1A A;  3PIP 3;  2MJ8 A;  1EU3 A;  3GTG H;  2IW3 A;  3L0O A;  1EYG A;  2NUC A;  1NNX A;  1LTT D;  4JC0 A;  3KBX A;  4QIW E;  5K36 H;  4A3K B;  5IYB G;  3MC0 B;  4R4Q A;  3VYS A;  1K0R A;  4DV0 L;  4XIG S;  3H94 A;  4A3J H;  2VS1 A;  1I4G A;  3J80 c;  3CPF A;  4IFD J;  2ATW A;  2ZJQ A;  3JAM L;  4L8J A;  3HOW G;  3VDY A;  4XQQ A;  1DOL A;  2EY6 A;  4IUN A;  3BZD B;  1U4P A;  4C2M B;  2EYP A;  1CA5 A;  4GKJ Q;  1Y1V B;  5IOC A;  2JA5 G;  2B63 G;  1QUQ B;  4IFD H;  4RGM A;  2R7Z H;  4RA8 A;  2F0J A;  1SNP A;  1Q90 A;  3KLS X;  1MKH A;  1VQB A;  1NMG A;  1WOC A;  4P2C B;  4DV2 Q;  2IY5 B;  3STB D;  2JXM B;  2HIX A;  3W5O A;  4ILW A;  4L5S A;  5M3F H;  1IXR A;  5IP7 G;  2R93 H;  3BYY B;  2VUM H;  3S24 A;  5IGC A;  3HOZ B;  3CCS A;  4NP5 A;  1PFN A;  4DAP A;  2X6L A;  1E2Z A;  5C4X H;  4TVA B;  1H9J A;  2ZM6 L;  4OGQ C;  4EQN A;  4L63 B;  3KF8 B;  3PF4 A;  3S1Q H;  4BS9 A;  2WB1 G;  1SEB D;  1K8G A;  2NBF A;  4IUV A;  3UE0 A;  4DAY A;  5COY A;  1G6P A;  4B9W A;  1FJG L;  4U67 3;  1PA6 A;  1E1T A;  5KNC A;  4X3S A;  2B2W A;  1DYQ A;  3HOV H;  2UUB Q;  2AWO A;  1VQJ A;  5C4J H;  4YHH L;  1GOZ A;  3ER0 A;  5C44 G;  1VQL A;  1FVI A;  4CHT B;  3K0Y A;  2F52 A;  1O80 A;  1IKM A;  1SE4 A;  1NCV A;  4C3I B;  2EY1 A;  3PUX A;  3L7Z C;  2NVT B;  4DKA C;  2L0C A;  2NVQ H;  2Z6K A;  2JA5 B;  2RF4 A;  2B63 B;  3K5M A;  4ZYS A;  3SXH A;  3T1H L;  1KTK A;  3SE0 A;  4NXN L;  5JEA J;  5HGT A;  2M9V A;  1W6K A;  1HQM C;  4CJ0 B;  4H7B A;  1XPR A;  4RHR A;  1C8C A;  2F4V Q;  3MFG A;  2LS0 1;  4F87 A;  1Q8I A;  1YNN C;  5JEA H;  2JA9 A;  2RBM A;  3GO5 A;  4B3T L;  3GTL B;  4A3M G;  1PZI D;  3CC4 A;  2Q8R E;  4OX9 L;  5ELB A;  1WFQ A;  4O0A A;  3FKI B;  3RUZ A;  1MGS A;  4CBV A;  1AN8 A;  4DR6 L;  2QDB A;  1A15 A;  3CRL C;  2VW9 A;  2WB1 B;  1GUO A;  1RDP D;  3KK7 A;  2DJF C;  2DJG C;  1NUC A;  4JI7 L;  4KHP Q;  1CHQ D;  4JI8 L;  3GTP B;  2LKV A;  5CYU A;  2SNS A;  3E3X A;  5C44 B;  4IUT A;  2HCC A;  2XWJ B;  3I8Z A;  1ILQ A;  4DXF A;  1YBY A;  5LMN Q;  4LFC Q;  2I5L X;  4DUY L;  5M5X B;  1WTW A;  1AZP A;  1UEA B;  1EWC A;  5JJZ A;  1UEB A;  2DUD A;  2NVY H;  4XDX A;  2JA7 G;  3J81 j;  2RDF A;  2G9D A;  2QW7 A;  2F0D A;  2ZXO A;  2JJQ A;  1Q3L A;  3MXG A;  3N6R A;  4KTA A;  1PV4 A;  1HRJ A;  2K7V A;  4JI1 Q;  2EOT A;  3RZD B;  5EPJ A;  1KL9 A;  2PQA A;  4UPA A;  2RSO A;  4C3H G;  5ELD A;  1EY6 A;  3OMC A;  3GQB A;  4XYQ A;  4YWM A;  3NPP A;  1BXT A;  1XPO A;  2IT1 A;  5J22 A;  5E1F A;  1GUG A;  4KN4 C;  4A3M B;  4JI5 L;  1Y8N B;  3D4D A;  5BN3 A;  3I3C A;  4I7Z C;  2WP8 J;  2EJF C;  3P75 A;  4K5W A;  3TBI B;  1ZYR D;  2IWH A;  1YVC A;  3E9I A;  1TQO A;  2A68 D;  2JA6 H;  1S5F D;  4OO1 G;  4CJ2 C;  4A3G G;  1X6O A;  2EPB A;  3OPO A;  3GTQ B;  4KY6 A;  1H9M A;  1BUV T;  1K73 C;  3H0G H;  1EY5 A;  3MXU A;  5CGK A;  2E75 C;  3JAM c;  5M5Y B;  1PH5 A;  4A3C G;  4FP5 D;  4A93 H;  2DNC A;  3MAQ A;  1CM9 A;  2R61 A;  3HOU H;  1CQV A;  4KMU C;  3A54 A;  4RGO S;  2OTJ A;  2FMC A;  4L5Q A;  5K36 G;  1SBB B;  1F2L A;  3M7N A;  4JBW A;  1MSH A;  4CDC C;  1TWF H;  2ZJR A;  4YCV A;  4GOP A;  2JA8 G;  1N32 L;  1QJO A;  1EY0 A;  4A3B H;  4A3J G;  4IOC A;  1SE8 A;  1ENC A;  1QOH A;  2A69 C;  3X3M A;  3U9S A;  3ITP A;  1LV9 A;  3FMC A;  4YHH Q;  4C3H B;  4DV6 L;  4B3S L;  1D1K A;  2CH4 W;  2XN9 C;  5IGB A;  2F0V A;  4J1M A;  2UUA Q;  1JC7 A;  4HED A;  3TDQ A;  1K28 A;  1DXM A;  2TMP A;  1IKL A;  2RSN A;  1B4O A;  4BBS G;  2R7Z G;  4IUR A;  1HR0 Q;  4HMJ A;  2FIN B;  2E2H B;  2EDG A;  4B3R L;  1TWA B;  1Y14 B;  1QVG A;  2K03 A;  1H9S B;  3WDN A;  2WFW A;  1CQF A;  5KRU A;  5BN5 A;  3D6W A;  3DXJ C;  5FJ8 G;  4A3L H;  2KOL A;  1YHQ A;  2Y0S E;  3S16 H;  4GKK L;  1KAB A;  4IJL A;  4RCN A;  5C4X G;  5IT9 L;  4A3F B;  1JR0 D;  2NN6 H;  2O5I C;  2HCI A;  1BCP F;  1TR5 A;  4LF9 Q;  1GUS A;  3EQL C;  4PMB A;  3AYH B;  3Q8D A;  4WJ3 M;  3D4W A;  1VQG A;  3BVM A;  3X3N A;  1SLJ A;  5C4Z A;  2JA8 B;  3PO2 H;  1N8R C;  1X55 A;  5DM6 3;  2UXC L;  3HOV G;  4RHS A;  3GP7 A;  2QKI C;  4RGT A;  4QGU A;  4LNQ A;  4FYD A;  1L1O A;  2B2Y A;  4JI8 Q;  1G2S A;  1PFM A;  4G4K A;  1VQC A;  2E8G A;  1LT6 D;  1XPU A;  3NWT A;  2Z1C A;  4RG1 A;  1KD1 C;  2A6E D;  2KHS A;  2L15 A;  4NXM L;  4AYB E;  5AJ3 L;  4DFA A; 
#chains in the Genus database with same CATH homology
 5C0X G;  4A3E G;  4OXP A;  2WAQ E;  4OWX B;  4DV5 L;  4LUV A;  1HZ9 A;  1QVF A;  3PIP A;  4BBS H;  2UXC Q;  1KQS A;  2MFI A;  5LMN W;  2D0P A;  1HZC A;  3RZO H;  1HNZ L;  4GN4 B;  1S3O A;  2OQK A;  3EIV A;  1KAW A;  1CUK A;  3HKS A;  3KLW A;  3G4S A;  2LXK A;  4LF7 Q;  3CD6 A;  5IY0 A;  1X54 A;  4GOP B;  1Q1E A;  3D0F A;  2WB1 E;  1VQI A;  4JBJ A;  2LSS A;  4PZ7 A;  1A8V A;  4QY7 A;  1JJ2 A;  3I4O A;  2BH2 A;  3S17 H;  2VQF Q;  4DR7 L;  4XTC S;  5IT9 c;  2Q2T A;  1VCI A;  3M4O H;  3S1R H;  1VQ7 A;  2CQO A;  4NXM Q;  2UXB L;  5FJ8 H;  1AE2 A;  1TWH H;  1VQH A;  5IYD G;  3A5Z B;  4Y7N H;  3CCQ A;  4A3I H;  1L0W A;  4DV5 Q;  3F8T A;  1PH7 A;  4JI5 Q;  3FKI G;  5FLM G;  4POG A;  3KJO A;  3U50 C;  2LXJ A;  4DK6 C;  3I55 A;  3HKZ E;  4GS3 A;  1NMF A;  2CFM A;  4ME3 A;  4AIM A;  4X65 Q;  3CXC A;  4DUZ L;  5GRO A;  5GAG C;  1B8A A;  1E7Z A;  3KDF A;  4OWT B;  4LF5 L;  1K3R A;  4H02 A;  1RIP A;  3CCJ A;  3RLO A;  1GVP A;  1TWC H;  4DR7 Q;  2HHH Q;  2BA1 A;  5GAE C;  2UXD L;  4A3K G;  1E24 A;  2JA7 H;  2Q2I A;  4LF4 Q;  4BY7 H;  2UXB Q;  1GD7 A;  3KYH C;  1VQM A;  3PF5 A;  1AH9 A;  1TXY A;  1EQQ A;  2B29 A;  4WJ4 A;  1BBW A;  4P74 A;  1WCM G;  1KRT A;  2VQE L;  3UDF A;  3G6E A;  4PZ6 A;  4JI4 L;  1O7I A;  5C0X J;  3CAM A;  4DR1 L;  2F4V L;  1K83 H;  1A63 A;  4DUZ Q;  1V43 A;  1XMQ L;  1XNQ L;  4NPS A;  3A0J A;  1PH6 A;  4JOI A;  1VQA A;  3I4M H;  4JCV E;  1N34 L;  4LF6 L;  1HZA A;  4P72 A;  1L1O C;  4HJ7 A;  4LF5 Q;  1Y1V G;  3I4N G;  4IFD G;  4QJF A;  2E2I H;  4A3E H;  1SR3 A;  1GKH A;  4EX5 A;  1VQK A;  5IYC G;  4IOA A;  1J5E L;  4GLA C;  2E5L L;  4DV1 L;  4KHZ A;  4OWW B;  3E0E A;  4GNX A;  3AEV A;  1VQP A;  2Z0S A;  2KEN A;  4A3D G;  2YTV A;  2VQE Q;  1NBW A;  3RN5 A;  4JI4 Q;  4LFA L;  4DR1 Q;  4X6A H;  1V9P A;  1I50 H;  4KI0 A;  3E9H A;  4UP9 A;  5M3F G;  4B3S Q;  1RL2 A;  2R93 G;  1XMQ Q;  2R7D A;  4BBR G;  2K50 A;  1XNQ Q;  2VUM G;  1Q1B A;  2I5M X;  1L1O B;  4HIO A;  1U0L A;  3CC7 A;  4A3G H;  3H3V H;  3GTK H;  4KHP L;  2DGY A;  5IWA L;  3TRE A;  1KRS A;  1WJJ A;  2JQO A;  3GTL H;  3S14 H;  4P71 A;  2ZJP A;  3U4Z A;  2R92 H;  3PCO B;  4OON A;  4L5R C;  4JI0 Q;  4YCU A;  2E5L Q;  5IE8 A;  4DV1 Q;  1VQE A;  2H5X A;  3M9B A;  5FLM H;  1IZ6 A;  4LF4 L;  1KIX A;  3M3Y H;  4B3R Q;  1CSQ A;  1K8A C;  5C3E H;  2PI2 E;  5LMN L;  4HJ8 A;  1SFO H;  2A1A A;  1W3S A;  1YJW A;  4K0K L;  1HR0 W;  3BZK A;  3OYY A;  3MEF A;  2MQH A;  3GTG H;  3B6Y A;  2VY3 A;  3L0O A;  4LFA Q;  3UDG A;  1EYG A;  4GKJ L;  4JBK A;  2RHS B;  2Y0S G;  4JC0 A;  1BBU A;  4QIW E;  4IPD A;  4DAM A;  5IYB G;  1OXU A;  4R4Q A;  2OWO A;  1K0R A;  4A3K H;  3CMA A;  1PH2 A;  2AWN A;  2BA0 A;  3NEM A;  1OXV A;  4XIG S;  5IWA Q;  3F2C A;  4DV0 L;  4A3J H;  2VS1 A;  3J80 c;  2CCZ A;  4A4I A;  4A93 G;  3ZJY C;  3AFQ A;  4JI3 L;  2ALY B;  3CPF A;  3DLL A;  4IFD J;  2VZA A;  4JI2 Q;  1WCM H;  2ATW A;  2ZJQ A;  4DPG A;  4BA2 I;  4L5T A;  3HOW G;  2CKZ B;  3TS2 A;  3VDY A;  5M3M G;  2KCM A;  2EIF A;  1NY4 A;  3NEN A;  2ASB A;  4DV7 L;  4A3B G;  4GKJ Q;  4IPC A;  5HY6 A;  2QGQ A;  1NTG A;  1C0A A;  5M5W H;  1MJC A;  2YTX A;  4C2M H;  1M90 C;  2JA5 G;  1QUQ B;  1Y1V H;  2B63 G;  3I4N H;  5BR8 L;  1U5K A;  2IX1 A;  2R7Z H;  1HJP A;  3STB C;  3HOY G;  4DV0 Q;  5IYC H;  1X56 A;  1MKH A;  1VQB A;  1NMG A;  1WOC A;  3KDF B;  4JOI C;  1C7Y A;  2IY5 B;  4DV2 Q;  3STB D;  5IP9 G;  2NZO A;  3FP9 A;  5J3B A;  1PVO A;  2OTL A;  1FGU A;  2HIX A;  3W5O A;  1IBM L;  4AYB G;  5JEA G;  4L5S A;  5M3F H;  1IXR A;  5IP7 G;  1Z47 A;  1YEZ A;  1I3Q H;  3RLF A;  5JJI A;  2R93 H;  2K5V A;  2WAQ G;  4LF8 L;  2VUM H;  3S24 A;  5AJ3 Q;  4DV7 Q;  4GNX C;  3CCS A;  1Z9F A;  4DK3 C;  2UUB L;  3BZC A;  5C4X H;  3HOZ H;  1XNR L;  3PSI A;  1YIT A;  4TVA B;  5BR8 Q;  3S15 H;  1OXS C;  2ZM6 L;  2EQS A;  2Q2U A;  4HJ5 A;  1XJV A;  1QUQ A;  3KF8 B;  1HNZ Q;  3PF4 A;  3S1Q H;  1I94 L;  2NVX H;  2WB1 G;  1IBK L;  1K8G A;  3ICE A;  3UE0 A;  3M4P A;  1EOV A;  2K5H A;  5LMU L;  1W2B A;  1FL0 A;  1PH3 A;  1G6P A;  1FJG L;  3ERS X;  1PA6 A;  4QL5 A;  1E1T A;  1KC8 C;  1CKM A;  2N3S A;  4GNX B;  2HT1 A;  5IYB H;  4A3F G;  2KCT A;  2N78 A;  2NN6 G;  2K75 A;  3HOV H;  2NZH A;  2UUB Q;  2AWO A;  4GN5 A;  3I56 A;  3H15 A;  2YTY A;  1VQJ A;  4AH6 A;  5C4J H;  4YHH L;  1Y1W H;  3ER0 A;  3HKZ G;  2K52 A;  5C44 G;  1GO3 E;  1FVI A;  2ZM6 Q;  1OXX K;  1WI5 A;  5ELN A;  1GM5 A;  4YY3 L;  1VQL A;  2A8V A;  3TQY A;  1D8L A;  1J6Q A;  1Q46 A;  2F52 A;  1BVS A;  4LUO A;  2NN6 I;  4R4T A;  1SMX A;  3W1G A;  1SN8 A;  5M3M H;  3PUX A;  4LFB L;  3A74 A;  3L7Z C;  4C3I H;  4DKA C;  1NJI C;  4JV5 L;  1FJG Q;  4TQU S;  3J80 i;  1YZ6 A;  1Q7Y C;  2Z6K A;  2NVQ H;  2RF4 A;  2GVB A;  2NVT H;  2UXD Q;  1CSP A;  4IJH A;  1EIF A;  4HJ9 A;  2JA5 H;  1EWI A;  1OXT A;  5HGQ A;  3DM3 A;  4MNO A;  2B63 H;  3T1H L;  1QZH A;  3K8A A;  4NXN L;  5JEA J;  3HOX G;  3G48 A;  3HOY H;  2XTI A;  4JG2 A;  1XPR A;  4IO9 A;  1PFS A;  3J81 i;  4PG3 A;  5IP9 H;  2F4V Q;  2B3G A;  3ULL A;  3OW2 A;  4GN3 B;  1YJN A;  1PH4 A;  1OTC A;  3G71 A;  3WWV A;  1VS0 A;  4DR5 L;  2IX0 A;  1I5F A;  1NE3 A;  2XGT A;  4AQY L;  2E2J H;  2I0Q A;  1KXL A;  4MZ9 A;  4LFB Q;  1G29 1;  3K7A H;  2JA9 A;  3GO5 A;  4EQ5 A;  5IP7 H;  5H1S E;  1A0I A;  1N34 Q;  4B3T L;  4LF6 Q;  1IL2 A;  2IHE A;  4A3M G;  1PH9 A;  1N33 L;  2FXQ A;  3CC4 A;  3NEL A;  5IYD H;  4OX9 L;  2UU9 L;  1WFQ A;  4O0A A;  3T1H Q;  1X3F A;  4DR2 L;  1J5E Q;  4IPG A;  4LUZ A;  4NXN Q;  3FKI H;  2ID0 A;  4DR6 L;  3LGJ A;  1X3E A;  2VW9 A;  3CPW A;  4LFC L;  2JA6 G;  1Q82 C;  2YYZ A;  1IBL L;  1B7Y B;  1M1K C;  3PGZ A;  3RNU A;  3U58 A;  1ASY A;  1XMO L;  4DR5 Q;  1Q81 C;  5FLX c;  4R4O A;  1N36 L;  1EUJ A;  1BKB A;  3H0G G;  4JI1 L;  4B3T Q;  5EAY A;  4JI8 L;  2EXD A;  4JI7 L;  4KHP Q;  4X66 L;  3UDX A;  1PH1 A;  1SRU A;  4YWL A;  4DR3 L;  1PHJ A;  3GTP H;  4R1J A;  4OX9 Q;  2UU9 Q;  3K80 C;  4X62 L;  2MNA A;  3HOU G;  1Q8K A;  1V1Q A;  2JE6 I;  4DR2 Q;  5C44 H;  3GTJ H;  1K9M C;  2UUC L;  3I2Z A;  1DGS A;  2JK8 A;  3W1B A;  3F1Z A;  3I7F A;  1MIU A;  1YBY A;  3RN2 A;  1HNX L;  1S72 A;  2R7F A;  1ASZ A;  4DR6 Q;  5LMN Q;  4LFC Q;  2I5L X;  4DUY L;  4JI6 L;  3PO3 G;  4K0K Q;  1H95 A;  1UEB A;  2DUD A;  2NVY H;  1VQ6 A;  4J15 A;  3NBH B;  5M5X H;  2JA7 G;  3J81 j;  2QEX A;  2V1C C;  2JJQ A;  1XMO Q;  2PMZ E;  3L2P A;  1PV4 A;  2JEB I;  4PMW A;  4JI1 Q;  4JI7 Q;  5GAH C;  1KL9 A;  3D31 A;  4ALP A;  2PQA A;  4DAY B;  3RZD H;  2YU9 H;  2AKW B;  4UPA A;  3HOX H;  4Y52 H;  4UP7 A;  3CCM A;  4JI3 Q;  1JMC A;  3J7A 5;  4A3D H;  3CCE A;  1VQ8 A;  4GLX A;  1HNW L;  3M4Q A;  2UUC Q;  2Z6K C;  2VQF L;  4DNI A;  1HNX Q;  4FDB A;  1L2F A;  4YWM A;  3CCV A;  2HIV A;  4DUY Q;  2IT1 A;  1XPO A;  4JI6 Q;  3T1Y L;  4BBR H;  1JJC B;  1UE7 A;  4YCW A;  1X9N A;  1HNW Q;  4GLV B;  1UWV A;  3CCL A;  4LW1 A;  4JI5 L;  4A3M H;  3U4V A;  2WP8 J;  1EIY B;  2KHJ A;  4X65 L;  3GTM H;  4O2D A;  2GVA A;  1YVC A;  1VQN A;  3EN2 A;  2KHI A;  3E9I A;  5C0X I;  4APV A;  3GD7 A;  2RHQ B;  4A76 A;  1R9T H;  3GDE A;  4UP8 A;  1CKN A;  2ES2 A;  2JA6 H;  4OO1 G;  2CWP A;  4A3L G;  2HHH L;  1XTD A;  3PUZ A;  3BU2 A;  4HIK A;  1IYJ B;  1X6O A;  2KBN A;  1IBM Q;  3ULP A;  4A3G G;  1VQF A;  3F2D A;  1Q86 C;  4LWC A;  4DV3 L;  3GTQ H;  3T1Y Q;  4LF8 Q;  2HQL A;  2R92 G;  1LUZ A;  1VQO A;  3UDI A;  1K73 C;  1LTL A;  1N9W A;  2A19 A;  3H0G H;  3RR5 A;  4DV4 L;  4OO1 I;  1XNR Q;  3PV0 A;  5GQO A;  3S1M H;  4B3M L;  3JAM c;  3H3V I;  1PH5 A;  4A3C G;  5E7N A;  4BY1 G;  5C3E G;  3CCU A;  4A93 H;  1B70 B;  4NB3 A;  4POF A;  1YNX A;  5M5Y H;  4A75 A;  3MXN B;  1E1O A;  5DLQ E;  2UUA L;  3HOU H;  3S2H H;  3F2B A;  1I94 Q;  3AQQ A;  1HH2 P;  2OCE A;  3HOW H;  3CP0 A;  4L5Q A;  2OTJ A;  3CCR A;  1IBK Q;  5K36 G;  2JEA I;  3PO2 G;  3AFP A;  3PO3 H;  5LMU Q;  3M7N A;  1WYD A;  4JBW A;  2ZJR A;  1TWF H;  4YCV A;  2K14 A;  4GOP A;  1VQ9 A;  2JA8 G;  3S1N H;  1HR0 L;  1TWG H;  1N32 L;  4A3B H;  4A3J G;  4IOC A;  2D62 A;  1C9O A;  2IHF A;  2K5N A;  2N49 A;  4DV3 Q;  2ZTD A;  1SE8 A;  3ULJ A;  3PIO A;  2QA4 A;  4BXX G;  2AMC B;  3S2D H;  1PYB A;  4DV4 Q;  1MJE A;  3TRZ A;  4B3M Q;  4YHH Q;  4DV6 L;  4P75 A;  3JC6 6;  4B3S L;  4R4C A;  1E22 A;  1UE6 A;  4YY3 Q;  1LM0 A;  4X64 L;  4C3J H;  4C3H H;  3CF5 A;  4JYA L;  2UUA Q;  1G51 A;  2PI2 A;  3GTO H;  1P16 A;  3FHW A;  3CQZ H;  5JJL A;  1E3P A;  4QQB X;  1EFW A;  4YWK A;  1VQ4 A;  4BBS G;  1YHA A;  3BJU A;  4JV5 Q;  1I6H H;  2R7Z G;  1N32 Q;  1D7Q A;  2GN5 A;  3PUV A;  1HR0 Q;  4IPH A;  2ZTC A;  4JI0 L;  2PNH A;  4JBM A;  3SGI A;  5ELO A;  3UE1 A;  3OTO L;  4RMF A;  4B3R L;  4LF9 L;  2E2H H;  1Y14 B;  2D0O A;  1AE3 A;  2AHO B;  1QVG A;  4IFD I;  1JT8 A;  1TWA H;  2WFW A;  2BH8 A;  1CKO A;  3CC2 A;  2VNU D;  4DV6 Q;  1S40 A;  4X64 Q;  1YHB A;  2CWA A;  1EQR A;  2VL6 A;  4JYA Q;  3KOJ A;  5FJ8 G;  1YJ9 A;  4A3L H;  1PH8 A;  3PUW A;  1YHQ A;  2Y0S E;  1A62 A;  2Q2H A;  3S16 H;  4GKK L;  4AQY Q;  4IJL A;  5C4X G;  1VQD A;  4P73 A;  2RCN A;  2PQA B;  4A3I G;  3HOZ G;  5GAD C;  3IRB A;  4HID A;  1YI2 A;  1UE1 A;  5JJK A;  1PYS B;  4A3F H;  1N33 Q;  3PUY A;  4DR4 L;  4JI2 L;  3EBE A;  1P8L A;  4MTN A;  3OTO Q;  1QVC A;  4A3C H;  4LF9 Q;  4BY1 H;  3KF6 B;  3AYH B;  3Q8D A;  2N8N A;  4WJ3 M;  4KLK A;  2MO0 A;  2YV5 A;  3CW2 C;  1X65 A;  3HFZ B;  1IBL Q;  1QZG A;  1VQG A;  4PZ8 A;  2OQ0 A;  1SLJ A;  1T9H A;  2F3I A;  3K81 C;  4BY7 G;  3KJP A;  3PO2 H;  1N8R C;  1JE5 A;  1X55 A;  1JB7 A;  2UXC L;  4HJA A;  2C35 B;  3JAM i;  2JA8 H;  3HOV G;  4GKK Q;  1LYL A;  1JJG A;  4QGU A;  1YIJ A;  1N36 Q;  1Y1W G;  4LNQ A;  3K0X A;  1VQ5 A;  1L1O A;  3K7U C;  4UY8 C;  4JI8 Q;  3RLN A;  4HIM A;  4X66 Q;  3CME A;  1CKN B;  1KHI A;  3A5U A;  4DV2 L;  2R6G A;  2MO1 A;  4DR3 Q;  4LF7 L;  4BXX H;  4DR4 Q;  3M85 A;  1VQC A;  2E8G A;  4X62 Q;  3TEH B;  3J7Z C;  1UE5 A;  1XPU A;  4GOP C;  2I5H A;  1Q12 A;  2K4K A;  4RG1 A;  1SRO A;  3I4M G;  3KFU A;  4R4I A;  1KD1 C;  3TS0 A;  1HZB A;  2L15 A;  4NXM L;  2ZTE A;  4AYB E;  3J81 c;  3KF6 A;  5AJ3 L;  1X3G A;  4BA1 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...