5IOCA

Crystal structure of staphylococcal nuclease variant delta+phs v66h/v99d at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMHENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMDNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V66H/V99D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5iocA00
4K8JA 4KHVA 5E3FA 3NK9A 4K6DA 3D6CA 2EYPA 4I65A 3DHQA 3NP8A 2EXZA 3NQTA 3U9OA 1STBA 2PZUA 5NUCA 3H6MA 5IGBA 1EY6A 2F3WA 4TRDA 2F3VA 5EKLA 5C3WA 5I6YA 3VA5A 3MHBA 5C4ZA 1RKNA 4ID6A 4QF4A 2EYJA 4RKLA 4QMGA 5CR3A 4PMBA 4K2LA 4PMCA 1STYA 3E5SA 1NUCA 3MVVA 5CC4A 2F0FA 5KRUA 5CV6A 4KD3A 3SK6A 1EQVA 2F0MA 4ZQ3A 2F0HA 3OMCA 1KDBA 4KY5A 1STGA 3T13A 2SOBA 5EGTA 5HURA 1SNOA 1JOKA 2NUCA 1SYDA 3QOLA 4K5VA 4KV6A 1SNMA 2PW7A 4R8NA 4QB4A 3D4DA 2QDBA 1ENAA 2EYLA 5DAUA 3OMGA 3PMFA 1JORA 4NKLA 1EYCA 4IALA 2LKVA 1KAAA 2ENBA 2OF1A 4N9TA 1SNCA 5IOCA 2F0KA 4ODGA 5JOBA 4EVOA 5IODA 1A3TA 1A3UA 1TQOA 3EVQA 3MZ5A 3SXHA 3C1EA 2F0NA 4ZUIA 4K5WA 5IGDA 1U9RA 1STHA 5KYIA 5CV4A 4KJOA 4KY7A 5C5LA 1A3VA 4ZUJA 5KYLA 3BDLA 3OSOA 2F0WA 5KGUA 2F0VA 4HTHA 3V2TA 4KD4A 1STNA 4K5XA 4KTAA 1KABA 1EY4A 1SNQA 3DMUA 1SYFA 4K2KA 4F7XA 5E1FA 3TP5A 2O4XA 1A2UA 1JOOA 4DFAA 4KJNA 3NXWA 4K14A 2F0OA 2KHSA 2WACA 4NP5A 5M9OA 3SK8A 3C1FA 1EY9A 1EY8A 2OXPA 3NUCA 4HMIA 3TMEA 2EYHA 2EY5A 1F2YA 4MIUA 2SNSA 5I6WA 1EZ6A 2F0GA 2HQEA 2F0JA 2RKSA 2F0UA 2PW5A 4IUNA 1EYAA 5CGKA 4RKBA 2M00A 4NMZA 1AEXA 1F2MA 1KDCA 3MEHA 3SK5A 3TP7A 1JOQA 4HMJA 1SYEA 4ME5A 5K5PA 3SK4A 5CV8A 2F0EA 4YIJA 1STAA 5JAVA 5KEEA 2EYFA 3P75A 4KY6A 5J39A 5KIXA 2F0IA 1NSNS 4N9PA 3D8GA 3MXPA 5CV9A 2PZWA 1II3A 5EKKA 2OEOA 3EROA 4B9WA 1A2TA 2F0LA 2EY2A 3D4WA 1F2ZA 3OWFA 4DF7A 2F0PA 5C6AA 4DGZA 4NDXA 4B9XA 5I9PA 4E6IA 3T16A 1ENCA 2F0SA 5C3XA 3QB3A 2PZTA 1SYCA 4K8IA 4DU9A 1EY5A 5CV5A 1SNPA 3P1HA 1KDAA 2EY1A 4PNYA 3TP8A 3LX0A 5IIFA 1EZ8A 2PYKA 3QOJA 3RUZA 3NHHA 3SHLA 2PQEA 4EQOA 1EY0A 5IGEA 4WRDA 4EQNA 3HEJA 5ISRA 5J22A 5I9OA 5C4HA 1EYDA 3TP6A 3HZXA 2EYOA 3EJIA 3ITPA 4G57A 5HGTA 1SNDA 4LAAA 2EY6A 5DEHA 5IGGA 3R3OA 5C5MA 4EQPA 3S9WA 1IHZA 4OL7A 4S3SA 5J1ZA 2RDFA 3BDCA 1TR5A 4F8MA 2F0DA 4J1MA 2F0QA 2SNMA 1SYGA 5IGFA 1TT2A 2EYMA 3ERQA 4H7BA 3SR1A 5CV7A 5IGCA 2KQ3A 2F0TA 1SYBA 4WORA 2RBMA 5F2DA 4J6HA 4IZ8A 1EY7A
chains in the Genus database with same CATH superfamily
1SE2A 4K6DA 1I94L 2UUCQ 1H9JA 5C3EB 3A54A 3PO3G 1VQKA 4HR7B 5JJIA 1UEAB 5EKIA 3H0GG 4OHJA 2YU9H 1BO0A 2YTXA 1RKNA 4R4IA 3HOZG 1EU3A 3KDFB 1YJWA 5M5WH 3S16B 1G291 4DKAC 3HOYB 4HAEA 3CD6A 4KY5A 2SOBA 4JBWA 1EIHA 1OXVA 1Y1VB 4DV4L 2ZXRA 1XPOA 2QKIC 2EIFA 2ENBA 1X32A 1PFSA 2Z8LA 4DK3C 1LTBD 2I46A 3JAML 5KNCA 3CCEA 3I3CA 1K28A 2I5HA 1Y1WB 2EXDA 5K36H 1QOHA 1TWAH 1Z7TA 2EZVA 3FPPA 1N34Q 2RHQB 4YWKA 1R4QB 2R92B 4MHEA 1D1IA 2B8FA 4JV5Q 4OELB 1VQ9A 3I90A 4K2KA 2CHBD 4QUFA 5IP9G 1C9OA 1PFMA 1YJ9A 1EY8A 4R9WA 3HG9A 3M4YA 3ER0A 1BQQT 5T1IA 1X3EA 1SMYD 1ZEQX 4F87A 4ME3A 2X69A 3S1QB 2BA1A 4IN3A 3MFYA 5FKAC 5J39A 1GKHA 1BR9A 4A3DG 4DAPA 3E9HA 4PZ6A 1VDZA 5JJLA 4LJZC 3EROA 4JBJA 4JI8Q 4HEDA 5JEAH 5IYCH 1S3OA 2UXBQ 5FO9B 4IUQA 1IBLL 3HKZB 4TQUS 3S1NH 2KCCA 4OO1H 4GLVB 2EY1A 4OEMB 1TKWB 1KRTA 4EQOA 1EY0A 3AYHB 5J22A 3M4OH 1Y69U 2N3SA 4LUVA 1UE6A 3PIOA 4K0KQ 4J15A 3IRBA 4BY7H 5ELCA 1K8AC 1WTWA 3S14H 4TSSA 5IGFA 1TT2A 4IUVA 3WOFA 4LFAL 5LMUQ 5FJ8G 5FLMG 5L37A 3TEHB 1AZPA 1YNXA 1YHQA 1IBMQ 1XJVA 1P16A 3H94A 4K8JA 5C0XH 4A3FB 4YHHL 3QJYA 1MBYA 3HKSA 1VF5C 2SDFA 4A3KB 3NBIA 1S5ED 1K73C 2PO4A 2PMZE 4MTNA 4BWGB 1RTNA 4C56C 3I91A 2WAQG 4JI6Q 1RCVD 3GTOB 3A5ZB 4H44C 4XQJA 2JK8A 3I4NG 1ML0D 1EEFD 3PUWA 3E6ZX 3ICEA 1K8MA 3Q6SA 2UXCQ 4YCVA 5G3LD 2VXWA 2XWJB 2K1BA 3OMGA 2B2UC 2VS1A 1W6KA 2EJFC 2YYZA 2D2CC 4CBVA 3I72A 3TREA 2LMCB 1QNKA 3HP3A 2Y0SE 1SDFA 2TMPA 4K5XA 4JI7Q 3PO3B 1Q12A 1CK1A 1HNXQ 3PQIA 2KHSA 1V8QA 1HCZA 1HZBA 4HMIA 4GN4B 3HOZB 1LLRD 1B3AA 4B3RQ 1MIUA 2XWBB 4C1NK 2E2JB 2MPMA 4GKKL 2IWHA 2LSSA 2VL6A 5IY0A 2UUCL 4DAYA 1F9RA 3TRZA 5EPLA 3BYYB 3IFDA 4Y7NH 4A93G 1I5FA 2F1MA 3DEOA 4AYBG 1HTLD 1D7QA 4DR2Q 2Q2UA 1NSNS 1PH1A 2K5QA 3QO2A 2E2IB 3ZJYC 1NJIC 1N36Q 3RZOH 2VQEQ 3S1MH 2PI2A 5IWAL 4CKBA 2F0SA 5C3XA 1HHVA 4K8IA 1PRTC 2JA6G 3Q0AA 5KNBA 5M3FB 4JBMA 5IYDH 2VUMG 5M3MH 1XNRQ 1VCIA 2WB1B 1XMQQ 5C5MA 5JAVA 2RDFA 3BDCA 4F8MA 3J7AV 1VMCA 2O2LD 3MXNA 4YY3Q 4DR3Q 2AWNA 3ERQA 5FOBB 1X6OA 4N8X1 3KBGA 3ERSX 2NBFA 4J6HA 4A3DB 3U50C 1OXUA 3L3OC 3IL8A 4BS9A 2EYPA 1Q7YC 2EXZA 5IP7G 2I07B 2PZUA 1EY6A 1PRTB 5C3WA 1C4QA 3E3XA 2OCEA 1N32Q 4MNOA 4OO1I 3CW2C 2RF4A 2R93B 4RHRA 1DZ1A 4GNXA 2WFWA 4A3MH 2NN6H 1EWCA 3MVVA 3FVQA 1S5FD 1VMPA 1FNWA 3MXGA 3S2HH 1JOKA 2R7FA 1Q1BA 2FMCA 1L0XB 4DV5Q 4JI8L 2NTSA 4DNRB 2I5LX 4X3TA 4K6LA 3U9SA 1JB7A 4EX5A 4DR1Q 2ICIA 1TWHH 1HQRD 1SAPA 3SGIA 4DV0L 1NR4A 5C0XI 3E9IA 1R9TH 1HNZL 2ALYB 3HOWB 4IPGA 2JA7G 4ALPA 2JSOA 3PUXA 2F0VA 4C3JG 4G7ZC 4JOIA 3TN2A 1K8GA 4DAYB 1B2TA 2NVYB 2NVQH 2ZTCA 1BBXC 2WAQB 1AFPA 4C3HB 2K5NA 2VZAA 1WI5A 2F0GA 1G91A 2DUDA 2HUGA 4HJ8A 3UI2A 3SK5A 3I4MG 3I4NB 4C2MH 1CT1D 1O78A 3K6OA 3DM3A 3P75A 5AFWA 5EBCA 1PA6A 3GTMH 2UXDL 1G6PA 4UP8A 4R4TA 4DV2Q 3A8IE 2F0LA 3Q8DA 4NDXA 1AH9A 1JR0D 2C9OA 4OWTB 1G2SA 2PNRC 1Q1EA 2H1EA 1HTPA 2K05A 2QCPX 1EY5A 3QOJA 2LS01 3MXNB 3HOXB 3U4ZA 3PF5A 2ZM6Q 4KI0A 3JAMc 4DAMA 4IQZA 2Z4IA 1JQYD 4X66Q 3J80L 5M3FH 3VR3A 2Q8IB 1AN8A 3W3AA 2B3GA 1I6HB 4DV6Q 3TZDA 4DV7Q 2IPKD 3SR1A 2WIIB 1FD7D 2CWAA 4AYBB 4X3UA 5IGCA 2MO0A 5EBDA 4GNXB 1GXDC 1FNUA 4IURA 4JOIC 3NK9A 4UY8C 5E7NA 4AH6A 2JJQA 4G7OC 1BNZA 1WOCA 4TRDA 3J7ZC 3KLSA 2N78A 2VQFL 4DR5Q 2WINB 3R2IA 1AE3A 1FNVA 3KBXA 4L8JA 2G5DA 4FF1A 2E5LL 5K36G 2NB0A 1Q82C 1K83B 2JA6B 4UP9A 2CQOA 2VUMB 4FDBA 5C4JB 1SNMA 1X3QA 3PCOB 2N88A 3OTOL 1N36L 4RMFA 1J5EQ 2HIXA 2EE1A 4NKLA 4DUZQ 4FXGC 2XGTA 3IFTA 5IOCA 1I3QH 1JWUD 1GUNA 4R4CA 4A3IB 2OWOA 1STHA 1GHJA 2MO1A 4M8AA 1HZ9A 2UUAL 3J81L 2A5HA 3K7UC 2KCMA 2FMMA 4KLKA 2NN6I 3H3VH 4JG2A 2K50A 2LFNA 5JEAG 5IYCG 5GQOA 1WTOA 1EYAA 1NCVA 1VF7A 3G6JB 1SN8A 2NVYH 3MEHA 4OO1G 2NZ1D 4I7AA 5I2XA 4FXKC 2MHVA 5A35A 5JPMC 3GTJH 4CJ1B 4LW1A 2A68C 3D8GA 3K5LA 1CQFA 1II3A 3CRLC 1IKLA 5I4DA 4BY7G 1EWHA 2RDGA 4JYAQ 1XXGA 2JE6I 4XDXA 4B3TL 3OIQA 1CA6A 2RHSB 3D31A 1N8RC 1ENCA 2X6LA 3S1RB 1SSOA 4LF7L 1I94Q 1PRTD 4ZCKA 5M5XB 3RD4A 5C0XG 1AW7A 5IGEA 3HEJA 3FP9A 1PMRA 2R3ZA 4N8FA 1GD7A 1HNWL 4G57A 1Q46A 4XQNA 1SNDA 2VB3X 5DEHA 4BBRB 4OL7A 1XMOL 4BA1I 3HOXH 5C3EG 2K5HA 4QGUA 3CQZH 4DV4Q 2HDLA 2HT1A 1ESFA 4U68A 1Z47A 1HZCA 4X64L 3HOYG 4P72A 2F3WA 3H09A 1BKBA 3S15B 5I6YA 4LUZA 3M85A 4G7HC 3ULJA 3R8BA 3GTGB 4LFBL 1XNQQ 1J9OA 2CCZA 2ZTEA 5CC4A 1JCKB 3QR8A 5D14A 1KAWA 2F0MA 1UE7A 2HIVA 1Z6HA 1VQ7A 3ONAB 4HSVA 4HIKA 4A75A 3KOJA 2E2HH 1J6QA 1BUVT 2EDGA 2GVAA 2YU9B 2I5MX 1O80A 4KN7C 1EQTA 2B39A 1EYCA 1FR3A 3QWNA 1X56A 3RMHA 1VQIA 4DK0A 3NWSA 2J4XA 5M5WB 2JA5H 3CKIB 2NVXH 1C7YA 3JC66 1NBWA 3LGJA 3L9AX 1MSHA 4GS3A 1DJRD 2QILA 3FRPB 1EQQA 1CKOA 1B9MA 3PF4A 3CC2A 1DD2A 4JC0A 4DFAA 2R7ZH 2F0OA 3D3RA 1IBLQ 4BXXH 1H9RA 1WCMH 1TWAB 2PW5A 3KDFA 4FF2A 5LL6X 2IT1A 1BXTA 1KLUD 3J7AF 5IYDG 3UE1A 2HCIA 1KHIA 1ASYA 2IHEA 2ZJPA 5M3MG 3HKZG 4HJAA 4QCLA 2Z6BA 3MXPA 4N9PA 3IKJA 3OHXC 2KEEA 1WD0A 4LFAQ 2FINB 2K5VA 4OIKA 3RLFA 2ZTDA 3PO2H 4JW0A 1PXUA 4E6IA 1MI2A 4YHHQ 1GO3E 1EEID 1NTGA 5IIFA 1O7YA 2Z4HA 3H3VI 2PQEA 1QJOA 5ISRA 2ES2A 1S5DD 2AHOB 3LNNA 4RWSC 2Q8TA 5A2QL 3S1RH 5ELEA 1GHKA 5M5XH 3U58A 2L15A 3R3OA 3S1NB 5J1ZA 4A3MG 2NN6G 4UP7A 1TR5A 2OTJA 4J1MA 1F9SA 4A3KG 2EYMA 1LTID 3VA7A 2MJ8A 1EY7A 4RH6A 3M4OB 4BBRH 4GOPA 3MC0B 1OO9B 3U9OA 2ZXOA 3AU7A 3NQTA 3S2DB 3CCMA 4RAUC 4BY7B 3S14B 5ELFA 1QNUA 5FLXc 5FO8B 3M7NA 4PMBA 1Y8NB 2BCOA 2H5XA 4RGNA 5CV6A 1HRJA 2QA4A 1CHQD 5KNDA 3S15H 1LACA 3I8ZA 1TS4A 2B8GA 1D8LA 1ZYRC 1VQ5A 4IOAA 3V05A 1TY0A 4YCUA 2O5IC 3CCJA 4GKKQ 2YV5A 4IPCA 1SLJA 1MJCA 1HZAA 4NXMQ 2XRQD 3URYA 2D5DA 1A3VA 3K7AB 4ZUJA 3I56A 1TVXA 1EU4A 2B29A 2XRSD 3NE5B 1DYQA 3PUZA 4MN3A 4XIGS 1NMFA 1YBYA 4K14A 5IWAQ 4ILWA 4GN3B 3J80c 2CVRA 3I55A 1PH5A 3C2PA 4C3IB 2SNSA 1IYUA 2QGQA 2RKSA 1B70B 2F0UA 3CPWA 3FKIH 1QVGA 4HMJA 1EYGA 2BA0A 4GOPC 4V190 1RD9D 2A68D 3BU2A 4CDEC 2DJFC 4L63B 4RCNA 4AQYL 3M9BA 1XNQL 3VR6A 1YIJA 4XYQA 1TWFH 2K32A 1JWSD 1XTDA 4A3BH 5M3FG 4QUCA 1WJJA 2AMCB 5ELOA 4Y7NB 1V43A 2PQAA 1TIID 2WB1G 5FLXE 3F8TA 4MZ9A 4DV3L 1WYDA 3LX0A 3TBIB 3F1ZA 4JI4L 1A0IA 4QIWE 1S72A 5CORA 1CHPD 5I9OA 3RZOB 5EPKA 4LF5L 3S1MB 4GOPB 4YWLA 1WTXA 3GTLH 1NNXA 3CC7A 5IYBH 2F0DA 2LY7A 2B2UA 1E2WA 3J81c 4UAIA 4IUTA 3D0FA 4XTCS 5M3MB 3KJPA 3N52A 2R93G 4DA2A 4HIMA 1HJPA 5J3BA 5IGBA 3K5OA 1E1OA 4DV0Q 1TS5A 2BDNA 3A55A 1HR0W 1D5XC 2WV6D 2XTIA 4RG1A 1HNZQ 3WWVA 4KHPQ 4IFDH 3DWAA 2K7VA 2XNAC 4PMCA 1VQPA 3S2DH 4RGOS 3OMCA 1CZGA 3KF6A 3FHWA 1S5CD 3P7JA 4JI2L 1XYIA 1DXMA 1UWVA 3HOWG 4A3MB 2DJGC 1HUNA 5JOBA 5G3LF 3S2HB 3C1EA 2CH4A 4IPDA 4WJ3M 5LMNW 2UXDQ 2K52A 4GLAC 4C3HG 5H1SE 1STEA 1DCZA 4KD4A 1OXTA 1TWHB 5E1FA 3TP5A 2KECA 2FFKB 1E22A 4LF8L 2H4OA 3A8JE 2CKZB 4POGA 4XT1B 3K7AH 2UUBL 3TMEA 1LABA 2EY5A 1R9TB 5TSSA 3G71A 1EZ6A 5D3DA 2FJ2A 4OGQC 1S4ZA 1B53A 1Q81C 4JPBW 1F2MA 3TP7A 2A6HC 1SYEA 4ME5A 1PH3A 3J81E 1PYBA 2FHTA 1HR0L 1STAA 3AFPA 1X55A 2PQAB 4C3IH 2NVQB 4P75A 1PH6A 2IW3A 1ET6A 2A19A 2HHHL 2JA8H 1LT3D 2J0TD 3GD7A 2N49A 1A2TA 1P8LA 4DF7A 3GTQH 2KA7A 3HOXG 3HOVH 4A3LH 3A7AB 2YTYA 4C2MB 1SYCA 1QUQB 2EJGC 3GTMB 1B7YB 2PYKA 4R4OA 2VQFQ 2X6GA 4OX9L 2GA4B 3VYSA 4JBKA 2D0OA 1KIXA 1EYDA 2E5LQ 4ABNA 4NXML 4L6TB 5LMNL 4ZRZA 4EQPA 1AE2A 3KLSX 2SNMA 4WFN3 4PZ7A 1EIGA 2XVSA 3OTOQ 1KL9A 1WD1A 1YHBA 3N6RA 3VYRA 2AQ1B 3D6CA 4I65A 4OWWB 3KF6B 1KQSA 2L5TA 4CDDC 2AQ3B 3MHBA 2JA5G 1YI2A 2EYJA 2B2YA 2UUAQ 1VQNA 3E5SA 2OQKA 3STBC 5IT9c 2DN8A 1PH7A 4JI5L 1F77A 1GUTA 3WOEA 1SNOA 1ZYRD 3G48A 2QEJC 4F88A 1NMGA 4A3IG 4RCOA 5AJ3L 4RFBA 1WCMG 4IALA 1TU2B 1W2BA 3Q22A 1SNCA 4A4IA 5C4XH 2F0KA 4I7ZC 4EQ5A 3T53B 1EFWA 1SROA 1A62A 3H3VC 2A69C 2E74C 5C44B 1QZHA 3OSOA 2KCNA 4HTHA 1VQ6A 4IFDI 3PV0A 3PUVA 4DNTB 4B3TQ 2O4XA 1I3QB 1D5ZC 2KCTA 3PO2G 4LF7Q 1F2YA 5EAYA 4RKBA 1E2VA 1FL0A 4IOCA 4IJLA 1KDCA 1B3QA 3VR2A 4DAVA 1CQVA 3IAYA 4GN5A 3AMUA 3GTPB 2YTVA 3HFZB 1HNWQ 1VQOA 4PZ8A 4KHPL 1XMOQ 1T9HA 1VQJA 2OEOA 4Z9CB 1QZGA 3GO5A 2B2YC 1CZWA 1I6VC 2R6GA 1I4PA 3OOCA 3CCSA 2EQSA 3BVMA 3GTJB 4DU9A 4X64Q 1SNPA 3FEWX 5IT9E 4BBRG 1G6ZA 4OWXB 1HA6A 1Y14B 3W5OA 3F2CA 2JEAI 2A1AA 1HFNA 4LFBQ 3TP6A 3ITPA 1M90C 5HGTA 3D4RA 4LF4L 4KK7A 2HCCA 3GDEA 2AUKA 2F0QA 1BCPF 4Y52H 2CQAA 3K0XA 1TWCH 4YWMA 1PH4A 1SYBA 5CMDA 1BOSA 4Q5VA 3NP8A 5FO7B 1MJEA 2Q2HA 4KHZA 3RLNA 4C1NI 1E0BA 2CWPA 1V1PA 2TSSA 3BJUA 2UU9L 1TS2A 2NWGA 3MTSA 4IJHA 3CQZB 4O2DA 5KRUA 3KF8B 4KD3A 2L4NA 3BDOA 3MFGA 2IY5B 5EJWA 1E1TA 1N33L 2NZOA 2BH2A 4M1UB 3B6YA 1T5XD 2PW7A 3AB9A 3L2PA 1UNSA 1PZJD 3NPPA 2ZT9C 3MEFA 1J8IA 5M5YH 2B63H 5BR8L 3PIP3 4DV1L 2L1BA 3OWEB 2E2HB 4UPAA 1Q86C 5CV4A 5KYLA 3NTIA 3KJOA 3BDLA 1STNA 1G2TA 1OXSC 1N9WA 1MSGA 4APVA 2JA5B 2NVXB 2WACA 3CHBD 5C44H 2OTLA 5DNFA 3K5MA 1EUJA 1RJTA 4IUUA 1V1OA 1JICA 2ASBA 1YNJC 5JJKA 2A6HD 1E2ZA 2A74C 5I2YA 3KYHC 3T51B 2WKDA 4YIJA 2R7ZB 2K6AA 4FXDA 1LYLA 4P74A 2F0IA 1WCMB 1JJGA 5E4WC 2AKWB 2EY2A 4DXFA 3ND8A 3KLWA 1I4RA 1O7ZA 5IYBG 3T1YL 3PSIA 1QILA 3GTPH 4B9XA 1QG7A 2DY8A 1B50A 3T16A 3RR5A 3JAME 1IBKL 1EZ8A 1K3RA 2Q8RE 1U4MA 3PO2B 1WVLA 2ATWA 1XPUA 2ZJQA 4IFDG 2L12A 5HGQA 4FF4A 4TKOB 4ULLA 5IGGA 1W3SA 3U4VA 1LTLA 5BN5A 1EWIA 1V1PB 1V9PA 5JEAJ 2RBMA 2P5ZX 4KHVA 1YNNC 3A8KE 2JA9A 1VQBA 5ELBA 5D3IB 3RZDH 1VQCA 2Y0SG 4QF4A 1A15A 1VQLA 5GAHC 3STBD 2ICEC 3F2DA 1I50H 1YZ6A 4R1JA 1STGA 1BBUA 1LTSD 2B2TA 1DOMA 1EQRA 3I2ZA 4OXPA 1X3PA 3DUZA 2EYLA 3HOUB 3PMFA 3TDQA 3J7YW 1JORA 5C0XJ 3M4PA 3FMCA 4GZYC 1KD1C 4PMWA 2A8VA 4N9TA 4DK1A 5IODA 3EVQA 3CMAA 2A69D 2Z0SA 3EBEA 1A63A 1U9RA 4O1NA 1KNAA 1SXTA 4AQYQ 1VQ8A 1TWGH 4HJ5A 1QE6A 4C3IG 1EIFA 1UEBA 2WAQE 4FP5D 2JA8G 1LT4D 2L55A 1X65A 1A2UA 4KJNA 1LTAD 3ULLA 2NVTH 3SK8A 2D62A 4MIUA 1XPRA 4DV3Q 1PDQA 3HOVG 5ELDA 5CGKA 2G9DA 2MFIA 4IUNA 1WFQA 1LV9A 4A93H 5IE8A 4JI4Q 1X3GA 3G7LA 5FK9C 3SK4A 3F2UA 3PIO3 1DOKA 1KTKA 3X3MA 3SDZA 3RN2A 4Q0FA 4LF5Q 1VQHA 2Z9HA 4BY1H 1PTOF 2JN4A 2M2LA 4LFCL 3X3NA 5CV9A 4X62L 3L0OA 1EIYB 4QQBX 1GUGA 2RCNA 1B9NA 1FVIA 3FKIB 4JI0L 4DGZA 1D1KA 4HIDA 4BA2I 1F2LA 3TS2A 2B2TC 4HN7A 2KEDA 4YCWA 4L5TA 1UUPA 2IHFA 1TWFB 1PFBA 5DM63 4A3BB 3DEPA 1IL8A 1HPCA 5GAEC 1IHZA 1PH9A 2KVMA 4JI2Q 4KN4C 1QVFA 4H7BA 1HFGA 1CKNB 5IP7H 2IJ0A 1I4HA 3NQIA 3NENA 3DHQA 1IW7C 4R4QA 3H6MA 3GTLB 2F3VA 1PYWD 5C4XG 1CFMA 4JI3L 2CW0C 1V1QA 2A6EC 1STYA 4HJ9A 1C0AA 4HSPA 2F4VL 1SFOH 4ZQ3A 1D6EC 2K75A 2PMZB 4V0BA 5EGTA 5GADC 4LF8Q 5JVH3 4CHTB 1JE5A 1GJXA 2UUBQ 2C35B 3D4DA 2B2VC 3T1HL 4P71A 4X65Q 1ENAA 3VDYA 4BBSH 1LT5D 2LKVA 2OF1A 4DNIA 2SEBD 1XTCD 4ODGA 4EVOA 1A3TA 2JA7H 5HY6A 1HR0Q 3T4AC 1KLGD 3AFQA 4RGMA 1HA5A 2FXQA 5IGDA 3HOUH 1LTTD 2HHHQ 1BVSA 4NW2A 2KJXA 2CH4W 1X54A 4KTAA 3DMUA 3NELA 1LTRD 1JOOA 1ZKOA 3DXJC 3I4OA 4NP5A 2Y0SB 3I4LA 1PYSB 1EFID 2ZJRA 3FDTA 1YNJD 3OPOA 3HRZC 2KOLA 2M00A 3NTKA 4RGTA 1G51A 4OX9Q 5CV8A 2RSOA 1FJGL 2F0EA 1X3FA 4KMUC 3A56A 2A73B 5LMNQ 1K0RA 2EPBA 3TS0A 1JJ2A 4LK1C 2RQXA 4LF6L 3M3YB 3E0EA 1VQGA 4NXNL 4B9WA 1Q8IA 3VR5A 4JK1C 1CI3M 5C6AA 1VS0A 3ZYYX 1ICFB 1K8OA 2VY3A 1GVPA 1GUOA 4A3JB 5T1GA 3RUZA 2JA8B 4XXEA 1DONA 1L0YB 1GUWA 4QL5A 4JI1L 3GTQB 1B44D 4X6AH 2V1CC 3GP7A 3PGZA 3HOVB 3BZKA 3H91A 4JI5Q 4UHVA 2DY7A 2VB2X 2E2DC 4LWCA 1I4XA 4QY7A 4L5QA 2JXMB 3VYUA 5AJ3Q 4P2CB 4WORA 1CSPA 1WTRA 1YNND 4IZ8A 3RLOA 5E3FA 2PPBC 3EA6A 1SEBD 2K14A 2PCFB 3FPUB 1B1ZA 3OW7A 4QJFA 1TS3A 4OONA 5EKLA 2B63G 3A5UA 2VW9A 4AIMA 5C4ZA 4DUYQ 2ZXPA 4XT3B 3CF5A 4G4KA 2ID0A 4ZKCB 2F0HA 1QUQA 1KDBA 4NB3A 1G8ZD 4KV6A 4K5VA 4LF9L 3GTKB 3J7A5 3DWQA 3A7LA 4A3EB 3NSWA 5C44G 1Z9FA 1LT6D 4LNQA 1O7IA 2BDOA 1WTPA 3R93A 3K80C 3BG3A 1T5EA 2K01A 3EQLC 1IXRA 3SXHA 1SBBB 4ZKBB 4CKEA 5KYIA 3J80E 1IYVA 1HXYD 5KGUA 3TQYA 1SNQA 4ZLTF 1H9MA 4L5RC 1SYFA 3AEVA 2JP1A 5C4XB 4JCVE 4WJ4A 2Z6KA 2OXPA 1WTVA 2MUYA 2F0JA 5CBAE 2LXJA 1JOQA 1ASZA 2EJMA 4KY6A 1BCPC 3M7GA 4LF4Q 1L1OA 1CUKA 2HQLA 4DR7L 5EKKA 4HIOA 2BH8A 1DOLA 1F9PA 3OWFA 1W6JA 1UAPA 4TVAB 5EPJA 1MD2D 4X65L 3M3YH 1GOZA 2B2WA 3P1HA 3SEBA 3TP8A 2E8GA 3EIVA 5EQ0A 3SHLA 3UDGA 4WRDA 2UU9Q 4B3ML 3E0JA 3A74A 3K0YA 3KLRA 2G9HD 1CTMA 4A3CH 1YVCA 1FGBD 5C3EH 4A3JH 3S9WA 1BCPB 4B3SL 1JWMD 1VQAA 1N33Q 4A3GB 1Y8PB 1A8VA 1A6XA 5CV7A 2F0TA 2Z1CA 3S16H 3HOYH 3NBHA 5CBEE 2HDMA 3CRKC 5DM73 2KBNA 1IW7D 5BR8Q 4PQXA 4DV1Q 3JAMi 2K4KA 3CP0A 2Z6KC 3UDXA 1I4QA 4DR4L 4DR6L 2CW0D 3K8AA 1EOVA 1Y1VH 4RKLA 2BOSA 4QMGA 1LO5D 2A6ED 4FVMA 1TWCB 2F0FA 1YHAA 3BVZA 1JB3A 3SK6A 4R8IA 3H0GB 4GLXA 1Y1WH 1QB5D 1SE4A 3ND9A 1ONLA 3J81j 2R92H 1L1OC 1CA5A 1E7ZA 2QDBA 2QW7A 1SRUA 1A3UA 1TQOA 4CJ2C 1Q8KA 3GTKH 4A3EH 2D0PA 2C5CA 2KHIA 4L5SA 4KJOA 2B2WC 3K5NA 3DLLA 2JQOA 4BY1G 4CKCA 1UE1A 3SE0A 4KKUA 3S1QH 3T1YQ 5M5YB 3BZDB 1JMCA 2B63B 1SJED 5BN3A 1EY9A 1IKMA 3K59A 2EYHA 2R7ZG 1PH2A 1S5BD 2IX1A 1L1OB 1IBKQ 4IPHA 4BXXG 2M9VA 1CSQA 2BE5C 3KFUA 3KF8A 1L2FA 4DN4M 1U4PA 5KEEA 3CCVA 5KIXA 1N34L 1M4VA 1U5KA 2K28A 3Q24A 4DUYL 1UE5A 4JV5L 1NR2A 2F0PA 1M1KC 1QCBD 4A76A 5I9PA 3O13A 3H15A 1B4OA 1KDAA 2GN5A 2I0QA 2KENA 5JJZA 3A0JA 3NEMA 3KUPA 4PG3A 4EQNA 1PV4A 4U673 3W1BA 2IX3A 1S40A 3D6WA 5C4HA 4A3FH 1SMXA 3NBHB 4H13C 4A3KH 3DWPA 1ICWA 2E75C 4S3SA 1PH8A 3HKZE 1H95A 4DPGA 2OT2A 1RTOA 4FYDA 3MAQA 3TZUA 1AP0A 2KQ3A 1U0LA 3K81C 2UXBL 3PUYA 1R4PB 3GTOH 2Q2IA 5LL6S 4A3GH 4FNFA 5D65A 1WTQA 2NZHA 4BBSG 1RODA 1TY2A 5COYA 5CR3A 3K58A 1OTCA 2Q2TA 1HQMC 4HCEA 4X3SA 1KC8C 1MKHA 3HOUG 3CMEA 4K0KL 1EQVA 1NAPA 3T13A 2K5DA 1ILQA 2HD3A 5DLQE 1EOTA 1JJCB 2DNCA 3S17B 5JVG3 3RZDB 5LMUL 1PZID 3W1GA 1IBML 3LWUA 3PO3H 1RL2A 3H0GH 3BZCA 5FLXL 1PTOC 1I50B 5A2QE 3MZ5A 1LTGD 1XWEA 2K04A 3HOZH 4ZUIA 2IX0A 1NE3A 1RIPA 1Y8OB 2DGYA 4KY7A 1VQ4A 2E2JH 4LFCQ 4X62Q 3CU7A 4CDFC 2MQHA 3F2BA 1KNEA 2D9UA 4JI6L 1LUZA 2F52A 4JI0Q 1VQDA 4GNXC 3NXWA 3MA2B 3G6EA 3NUCA 1RF2D 2E2IH 2UXCL 1H9KA 3EFXD 4ZAIA 1TWGB 3L7ZC 4ZK9B 4J8QA 5LHY1 4LUOA 3CCLA 2K33A 3HS0C 4RA8A 4KKSA 1PTOB 2EVBA 2J7ZA 3FKIG 1VQFA 1BCPD 2EYFA 1YEZA 2NVTB 1FYCA 3GV3A 1KRSA 3CXCA 2RCFA 1QWYA 5IP9H 4JI7L 4GKJQ 1F2ZA 1HNXL 3QG1A 1K9MC 4A93B 1BBWA 2XSCA 4A3BG 2GVBA 1HH2P 3EN2A 2PZTA 4BY1B 4B3RL 1HUMA 1Q90A 1MHWC 3NHHA 3VYTA 1VQMA 4JI3Q 2F03A 4A3DH 5GROA 2AWOA 2EYOA 1BF4A 2F4VQ 4DR2L 3KK7A 2N8NA 1L0WA 2R61A 1PFNA 3T1HQ 2R93H 1C48A 2VQEL 5F2DA 2OQ0A 1O7LA 1GUSA 4H02A 2WB1E 1I4GA 4EGVA 2QDLA 1DM0B 3BVGA 4ID6A 1PRTF 1XNRL 4K2LA 1XMQL 3CAMA 3WDNA 3LWEA 5FJ8H 5FLMH 3QOLA 4OIJA 3HOWH 4YY3L 3DM1A 4DR3L 1IL2A 2JYOA 1VQEA 2QEXA 5DAUA 1U4RA 2XIWA 1EL0A 2IL8A 1OXXK 1IYJB 3UE0A 1SFOB 3S17H 2DNEA 1FJGQ 4CJ0B 2F0NA 4CGYB 4C3HH 4IFDJ 1N32L 5C5LA 3VR4A 4X3KA 3BS1A 1QVCA 1CKNA 1FGUA 4LF6Q 3V2TA 2RDHA 2MNAA 4NXNQ 3I4NH 1PVOA 1KABA 1M8AA 4F7XA 1YJNA 3UDFA 3S24A 4BBSB 2F3IA 3RNUA 1X9NA 2JA7B 3ULPA 3C1FA 1D5MC 4DXGA 4DV5L 1AZQA 1CM9A 4C3JB 2BE5D 4MTKA 4DR1L 1AEXA 3GQBA 1SR3A 1SMYC 4FF3A 4JI1Q 3GV6A 2AUJD 4IUPA 1F9QA 3P20A 3V96A 1IZ6A 4DK6C 2PZWA 3J80i 4A3CG 3I4MB 4A3JG 3D4WA 3M4QA 1PTOH 4POFA 2R7DA 5BN4A 2L11A 3Q23A 2PI2E 2KUMA 5CV5A 1I6HH 1BDOA 1PZKD 4A3LG 2KHJA 2NYZD 3AQQA 2F4IA 4B08A 1GM5A 1XX8A 2K03A 3HZXA 1RDPD 1Y1VG 2PNHA 2EY6A 3CCRA 4H0LC 3I70A 2B2VA 4QIWB 4O42A 1B8AA 2JEBI 4LF9Q 4DV2L 1ENFA 3CPFA 1Y1WG 4WJWA 4KKTA 5E4XA 3OW2A 2MGSA 1K83H 1NY4A 2JA6H 2RSNA 2R92G 2VUMH 1STBA 3K57A 5NUCA 5C4JH 4LMQD 1H9SA 2AQ2B 3VA5A 4IO9A 1E3PA 4FO2A 2ZM6L 2WP8J 3J81i 4A3EG 1NUCA 4ZYSA 4AYBE 1U4LA 4X66L 4A3IH 5HURA 2NUCA 1SYDA 3NTHA 2CFMA 4R8NA 4DV6L 4GKJL 4DV7L 4QB4A 2MP1A 2V4DA 3CCQA 3T56B 3BYTB 3R2TA 1E24A 1YITA 1SJHD 2WKCA 1KAAA 4HJ7A 1ET9A 1PTOD 2RA4A 3G4SA 5JPNC 2E76C 3I73A 5IT9L 1DGSA 4K5WA 4DR5L 1JE4A 1KXLA 3NWTA 2O5JC 4DR7Q 4XQQA 2F0WA 3I7FA 3HGBA 1EY4A 4RHSA 1ESRA 5M9OA 4CDCC 2K5WA 4XYOA 5I6WA 4JVZA 1TXYA 1J5EL 2HQEA 4DUZL 2RVLA 5ELNA 4NMZA 3RN5A 4NPSA 1ILPA 1ZXTA 4B3MQ 5K5PA 1JC7A 1JT8A 3MXUA 3PIPA 3C3LA 3TSSA 1SE3A 4C3JH 4A3FG 4B3SQ 1CKMA 1Q3LA 1RHPA 2EOTA 2L9HA 1C8CA 1D2BA 3MWYW 4PV1C 2QF7A 1K0SA 4O0AA 3QB3A 5GAGC 3QIAA 3I4MH 4PNYA 4P73A 3CCUA 3OIPA 4DR4Q 4DR6Q 4A3GG 4HCSA 1SE8A 1MGSA 5CYUA 1PLFA 3CC4A 1WTHA 2NTTA 3EJIA 2VNUD 3OYYA 4LAAA 2XN9C 3W2DA 1LM0A 1K3BC 3UDIA 1SYGA 3SVMA 1PHJA 3C46A 1H9SB 2LXKA 3GTGH 2L0CA 2N55A 4JYAL 4UDUC
chains in the Genus database with same CATH topology
1SE2A 4K6DA 1H9JA 5C3EB 3A54A 4HR7B 1UEAB 5EKIA 4OHJA 1BO0A 1RKNA 1EU3A 3S16B 1G291 3HOYB 4HAEA 4KY5A 2SOBA 4JBWA 1EIHA 1OXVA 1Y1VB 2ZXRA 2QKIC 2ENBA 1X32A 2Z8LA 1LTBD 2I46A 3JAML 5KNCA 3I3CA 1Y1WB 5K36H 1QOHA 1Z7TA 2EZVA 3FPPA 1R4QB 2R92B 4MHEA 1D1IA 2B8FA 3I90A 4K2KA 2CHBD 4QUFA 1PFMA 1EY8A 4R9WA 3HG9A 3M4YA 1BQQT 5T1IA 1SMYD 1ZEQX 4F87A 3S1QB 2X69A 2BA1A 4IN3A 3MFYA 5FKAC 5J39A 1BR9A 4DAPA 1VDZA 4LJZC 3EROA 4HEDA 5JEAH 5FO9B 4IUQA 3HKZB 4TQUS 2KCCA 4OO1H 2EY1A 1TKWB 4EQOA 1EY0A 5J22A 1Y69U 5ELCA 1WTWA 4TSSA 5IGFA 1TT2A 4IUVA 3WOFA 1AZPA 3H94A 5C0XH 4K8JA 4A3FB 3QJYA 1MBYA 1VF5C 2SDFA 4A3KB 3NBIA 1S5ED 2PO4A 4BWGB 1RTNA 4C56C 3I91A 1RCVD 3GTOB 4H44C 4XQJA 1ML0D 1EEFD 3PUWA 3E6ZX 1K8MA 3Q6SA 5G3LD 2VXWA 2XWJB 2K1BA 3OMGA 2B2UC 1W6KA 2EJFC 2YYZA 2D2CC 4CBVA 3I72A 2LMCB 1QNKA 3HP3A 1SDFA 2TMPA 4K5XA 3PO3B 1Q12A 1CK1A 2KHSA 1V8QA 1HCZA 3HOZB 4HMIA 1LLRD 1B3AA 2XWBB 4C1NK 2E2JB 2MPMA 2IWHA 4DAYA 1F9RA 5EPLA 3BYYB 3IFDA 2F1MA 3DEOA 1HTLD 1NSNS 2K5QA 3QO2A 2E2IB 4CKBA 2F0SA 5C3XA 1HHVA 4K8IA 1PRTC 3Q0AA 5KNBA 5M3FB 1VCIA 2WB1B 5C5MA 5JAVA 2RDFA 3BDCA 4F8MA 3J7AV 1VMCA 2O2LD 3MXNA 2AWNA 3ERQA 5FOBB 3KBGA 2NBFA 4J6HA 4A3DB 1OXUA 3L3OC 3IL8A 4BS9A 2EYPA 2EXZA 2I07B 2PZUA 1EY6A 1PRTB 5C3WA 1C4QA 4OO1I 2R93B 4RHRA 1DZ1A 2NN6H 1EWCA 3MVVA 3FVQA 1S5FD 1VMPA 1FNWA 3MXGA 1JOKA 1Q1BA 2FMCA 1L0XB 2NTSA 4DNRB 4X3TA 4K6LA 3U9SA 2ICIA 1HQRD 1SAPA 1NR4A 5C0XI 3HOWB 2JSOA 3PUXA 2F0VA 4C3JG 4G7ZC 3TN2A 1B2TA 2NVYB 1BBXC 2WAQB 1AFPA 4C3HB 2F0GA 1G91A 2HUGA 3UI2A 3SK5A 3I4NB 1CT1D 1O78A 3K6OA 3P75A 5AFWA 5EBCA 3A8IE 2F0LA 4NDXA 1JR0D 2C9OA 1G2SA 2PNRC 1Q1EA 2H1EA 1HTPA 2K05A 2QCPX 1EY5A 3QOJA 2LS01 3HOXB 4KI0A 4IQZA 2Z4IA 1JQYD 3J80L 3VR3A 2Q8IB 1AN8A 3W3AA 1I6HB 3TZDA 2IPKD 3SR1A 2WIIB 1FD7D 4AYBB 4X3UA 5IGCA 5EBDA 1GXDC 1FNUA 4IURA 3NK9A 4G7OC 1BNZA 4TRDA 3KLSA 2WINB 3R2IA 1FNVA 3KBXA 4L8JA 4FF1A 5K36G 2NB0A 1K83B 2JA6B 2VUMB 5C4JB 1SNMA 1X3QA 2N88A 2EE1A 4NKLA 4FXGC 3IFTA 5IOCA 1JWUD 1GUNA 4A3IB 1STHA 1GHJA 4M8AA 3J81L 2A5HA 2FMMA 2NN6I 2LFNA 5JEAG 1WTOA 1EYAA 1NCVA 1VF7A 3G6JB 3MEHA 4OO1G 2NZ1D 5I2XA 4FXKC 2MHVA 5A35A 5JPMC 4CJ1B 2A68C 3D8GA 3K5LA 1CQFA 1II3A 3CRLC 1IKLA 5I4DA 1EWHA 2RDGA 4XDXA 1XXGA 2JE6I 3OIQA 1CA6A 3D31A 1ENCA 2X6LA 3S1RB 1SSOA 1PRTD 5M5XB 3RD4A 5C0XG 1AW7A 5IGEA 3HEJA 1PMRA 2R3ZA 4G57A 4XQNA 1SNDA 2VB3X 5DEHA 4BBRB 4OL7A 4BA1I 2HDLA 1ESFA 4U68A 1Z47A 2F3WA 3H09A 3S15B 5I6YA 3M85A 4G7HC 3R8BA 3GTGB 1J9OA 5CC4A 1JCKB 5D14A 2F0MA 1Z6HA 3ONAB 4HSVA 1BUVT 2EDGA 2YU9B 1O80A 4KN7C 1EQTA 2B39A 1EYCA 1FR3A 3QWNA 3RMHA 4DK0A 3NWSA 2J4XA 5M5WB 3CKIB 3L9AX 1MSHA 1DJRD 2QILA 3FRPB 1B9MA 1DD2A 4DFAA 2F0OA 3D3RA 1H9RA 1TWAB 2PW5A 4FF2A 5LL6X 2IT1A 1BXTA 1KLUD 3J7AF 2HCIA 4QCLA 4N9PA 3MXPA 3IKJA 3OHXC 2KEEA 1WD0A 2FINB 3RLFA 4OIKA 4E6IA 1PXUA 1MI2A 1EEID 5IIFA 1O7YA 2Z4HA 2PQEA 1QJOA 5ISRA 1S5DD 5A2QL 3LNNA 4RWSC 2Q8TA 5ELEA 1GHKA 3R3OA 3S1NB 5J1ZA 2NN6G 1TR5A 4J1MA 1F9SA 2EYMA 1LTID 3VA7A 2MJ8A 1EY7A 4RH6A 3M4OB 3MC0B 1OO9B 3U9OA 2ZXOA 3AU7A 3NQTA 3S2DB 4RAUC 4BY7B 3S14B 5ELFA 1QNUA 5FO8B 3M7NA 4PMBA 1Y8NB 2BCOA 4RGNA 5CV6A 1HRJA 1CHQD 5KNDA 1LACA 3I8ZA 1TS4A 2B8GA 1ZYRC 3V05A 1TY0A 2O5IC 2XRQD 3URYA 2D5DA 1A3VA 3K7AB 4ZUJA 1TVXA 1EU4A 2XRSD 3NE5B 1DYQA 3PUZA 4MN3A 4XIGS 4K14A 4ILWA 3C2PA 2CVRA 4C3IB 2SNSA 1IYUA 2RKSA 2F0UA 4HMJA 2BA0A 4V190 1RD9D 2A68D 4L63B 4RCNA 3VR6A 4XYQA 2K32A 1JWSD 4QUCA 4Y7NB 1V43A 1TIID 5FLXE 3LX0A 3TBIB 5CORA 1CHPD 5I9OA 3RZOB 5EPKA 3S1MB 1WTXA 2F0DA 2LY7A 2B2UA 1E2WA 4UAIA 4IUTA 4XTCS 5M3MB 3N52A 4DA2A 5IGBA 3K5OA 1TS5A 2BDNA 3A55A 1D5XC 2WV6D 4IFDH 3DWAA 2K7VA 2XNAC 4PMCA 4RGOS 3OMCA 1CZGA 1S5CD 3P7JA 1XYIA 1DXMA 4A3MB 1HUNA 5JOBA 5G3LF 3S2HB 3C1EA 4C3HG 1STEA 1DCZA 4KD4A 1OXTA 1TWHB 5E1FA 3TP5A 2KECA 2FFKB 2H4OA 3A8JE 4XT1B 3TMEA 1LABA 2EY5A 1R9TB 5TSSA 1EZ6A 5D3DA 2FJ2A 4OGQC 1S4ZA 1B53A 1F2MA 3TP7A 2A6HC 1SYEA 4ME5A 3J81E 2FHTA 1STAA 2NVQB 2IW3A 1ET6A 1LT3D 2J0TD 3GD7A 1A2TA 4DF7A 2KA7A 3A7AB 4C2MB 1SYCA 2EJGC 3GTMB 2PYKA 2X6GA 2GA4B 3VYSA 1EYDA 4ABNA 4L6TB 4ZRZA 4EQPA 3KLSX 2SNMA 4WFN3 1EIGA 2XVSA 1WD1A 3N6RA 3VYRA 2AQ1B 3D6CA 4I65A 2L5TA 2AQ3B 3MHBA 2EYJA 2B2YA 3E5SA 2DN8A 1F77A 1GUTA 3WOEA 1SNOA 1ZYRD 2QEJC 4F88A 4RCOA 4RFBA 4IALA 1TU2B 3Q22A 1SNCA 2F0KA 4I7ZC 3T53B 3H3VC 2A69C 2E74C 5C44B 3OSOA 2KCNA 4HTHA 4IFDI 3PV0A 3PUVA 4DNTB 2O4XA 1I3QB 1D5ZC 1F2YA 4RKBA 1E2VA 1KDCA 3VR2A 4DAVA 1CQVA 3IAYA 3AMUA 3GTPB 2OEOA 4Z9CB 3GO5A 2B2YC 1CZWA 1I6VC 2R6GA 1I4PA 3OOCA 3BVMA 3GTJB 4DU9A 1SNPA 3FEWX 5IT9E 1G6ZA 1HA6A 2JEAI 1HFNA 3TP6A 3ITPA 5HGTA 3D4RA 4KK7A 2HCCA 2AUKA 2F0QA 1BCPF 2CQAA 1SYBA 5CMDA 1BOSA 4Q5VA 3NP8A 5FO7B 4KHZA 4C1NI 1E0BA 2TSSA 1V1PA 1TS2A 2NWGA 3MTSA 3CQZB 5KRUA 4KD3A 2L4NA 3BDOA 3MFGA 5EJWA 4M1UB 1T5XD 2PW7A 3AB9A 1UNSA 1PZJD 3NPPA 2ZT9C 1J8IA 3PIP3 2L1BA 3OWEB 2E2HB 5CV4A 5KYLA 3NTIA 3BDLA 1STNA 1G2TA 1OXSC 1MSGA 2JA5B 2NVXB 2WACA 3CHBD 5DNFA 3K5MA 1RJTA 4IUUA 1V1OA 1JICA 1YNJC 2A6HD 1E2ZA 2A74C 5I2YA 3T51B 2WKDA 4YIJA 2R7ZB 2K6AA 4FXDA 2F0IA 1WCMB 5E4WC 2EY2A 4DXFA 3ND8A 1I4RA 1O7ZA 1QILA 4B9XA 1QG7A 2DY8A 1B50A 3T16A 3JAME 1EZ8A 2Q8RE 1U4MA 3PO2B 1WVLA 4IFDG 2L12A 4FF4A 4TKOB 4ULLA 5IGGA 5BN5A 1V1PB 5JEAJ 2RBMA 4KHVA 1YNNC 3A8KE 5ELBA 5D3IB 4QF4A 1A15A 2ICEC 1STGA 1LTSD 2B2TA 1DOMA 1X3PA 3DUZA 2EYLA 3HOUB 3PMFA 3TDQA 3J7YW 1JORA 5C0XJ 3FMCA 4GZYC 4PMWA 4N9TA 4DK1A 5IODA 3EVQA 2A69D 1U9RA 4O1NA 1KNAA 1SXTA 1QE6A 4C3IG 4FP5D 1LT4D 2L55A 1A2UA 4KJNA 1LTAD 3SK8A 2D62A 4MIUA 1PDQA 5ELDA 5CGKA 2G9DA 4IUNA 1LV9A 3G7LA 5FK9C 3SK4A 3F2UA 3PIO3 1DOKA 1KTKA 3X3MA 3SDZA 4Q0FA 1PTOF 2M2LA 3X3NA 5CV9A 1GUGA 1B9NA 3FKIB 4DGZA 1D1KA 4BA2I 1F2LA 2B2TC 4HN7A 2KEDA 1UUPA 1TWFB 1PFBA 5DM63 4A3BB 3DEPA 1IL8A 1HPCA 1IHZA 2KVMA 4KN4C 4H7BA 1HFGA 2IJ0A 1I4HA 3NQIA 3DHQA 1IW7C 3H6MA 3GTLB 2F3VA 1PYWD 1CFMA 2CW0C 2A6EC 1STYA 4HSPA 4ZQ3A 1D6EC 2PMZB 4V0BA 5EGTA 5JVH3 4CHTB 1GJXA 3D4DA 2B2VC 1ENAA 1LT5D 2LKVA 2OF1A 2SEBD 1XTCD 4ODGA 4EVOA 1A3TA 3T4AC 1KLGD 4RGMA 1HA5A 5IGDA 1LTTD 4NW2A 2KJXA 4KTAA 3DMUA 1LTRD 1JOOA 1ZKOA 3DXJC 4NP5A 2Y0SB 3I4LA 1EFID 3FDTA 1YNJD 3OPOA 3HRZC 2KOLA 2M00A 3NTKA 4RGTA 5CV8A 2RSOA 2F0EA 4KMUC 3A56A 2A73B 2EPBA 4LK1C 2RQXA 3M3YB 4B9WA 1Q8IA 3VR5A 4JK1C 1CI3M 5C6AA 3ZYYX 1K8OA 1GUOA 4A3JB 5T1GA 3RUZA 2JA8B 4XXEA 1DONA 1L0YB 1GUWA 3GTQB 1B44D 3GP7A 3HOVB 3H91A 2DY7A 2VB2X 2E2DC 1I4XA 2JXMB 3VYUA 4P2CB 4WORA 1WTRA 1YNND 4IZ8A 5E3FA 2PPBC 3EA6A 1SEBD 3FPUB 2PCFB 1B1ZA 3OW7A 1TS3A 5EKLA 5C4ZA 2ZXPA 4XT3B 4G4KA 2ID0A 4ZKCB 2F0HA 1KDBA 1G8ZD 4KV6A 4K5VA 3GTKB 3DWQA 3A7LA 4A3EB 3NSWA 1LT6D 1WTPA 2BDOA 3R93A 1T5EA 3BG3A 2K01A 3EQLC 3SXHA 1SBBB 4ZKBB 4CKEA 5KYIA 3J80E 1IYVA 1HXYD 5KGUA 1SNQA 4ZLTF 1H9MA 1SYFA 2JP1A 5C4XB 2OXPA 1WTVA 2MUYA 2F0JA 5CBAE 1JOQA 2EJMA 4KY6A 1BCPC 3M7GA 5EKKA 1DOLA 1F9PA 3OWFA 1W6JA 1UAPA 5EPJA 1MD2D 1GOZA 2B2WA 3P1HA 3SEBA 3TP8A 5EQ0A 3SHLA 4WRDA 3E0JA 3K0YA 3KLRA 2G9HD 1CTMA 1FGBD 3S9WA 1BCPB 1JWMD 4A3GB 1Y8PB 1A6XA 5CV7A 2F0TA 2Z1CA 3NBHA 5CBEE 2HDMA 3CRKC 5DM73 1IW7D 4PQXA 1I4QA 2CW0D 4RKLA 2BOSA 4QMGA 1LO5D 2A6ED 4FVMA 1TWCB 2F0FA 3BVZA 1JB3A 3SK6A 4R8IA 3H0GB 1QB5D 1SE4A 3ND9A 1ONLA 1CA5A 2QDBA 1A3UA 1TQOA 4CJ2C 2C5CA 4KJOA 2B2WC 3K5NA 4CKCA 3SE0A 4KKUA 5M5YB 3BZDB 2B63B 1SJED 5BN3A 1EY9A 1IKMA 3K59A 2EYHA 1S5BD 2IX1A 2M9VA 2BE5C 3KF8A 4DN4M 1U4PA 5KEEA 5KIXA 1M4VA 2K28A 3Q24A 1NR2A 2F0PA 1QCBD 5I9PA 3O13A 1B4OA 1KDAA 5JJZA 3KUPA 4EQNA 4U673 2IX3A 3D6WA 5C4HA 4H13C 3DWPA 1ICWA 2E75C 4S3SA 2OT2A 1RTOA 4FYDA 3MAQA 3TZUA 1AP0A 2KQ3A 3PUYA 1R4PB 5LL6S 4FNFA 5D65A 1WTQA 1RODA 1TY2A 5COYA 5CR3A 3K58A 1HQMC 4HCEA 4X3SA 1EQVA 1NAPA 3T13A 2K5DA 1ILQA 1EOTA 2DNCA 3S17B 5JVG3 3RZDB 1PZID 3LWUA 5FLXL 1PTOC 1I50B 5A2QE 3MZ5A 1LTGD 1XWEA 2K04A 4ZUIA 2IX0A 1Y8OB 4KY7A 3CU7A 1KNEA 2D9UA 3NXWA 3MA2B 3NUCA 1RF2D 1H9KA 3EFXD 4ZAIA 1TWGB 3L7ZC 4ZK9B 4J8QA 5LHY1 2K33A 3HS0C 4RA8A 4KKSA 1PTOB 2EVBA 2J7ZA 1BCPD 2EYFA 2NVTB 1FYCA 3GV3A 1QWYA 1F2ZA 3QG1A 4A93B 2XSCA 2PZTA 4BY1B 1HUMA 1Q90A 3NHHA 3VYTA 2F03A 2AWOA 2EYOA 1BF4A 3KK7A 2R61A 1PFNA 1C48A 5F2DA 1O7LA 1GUSA 1I4GA 4EGVA 3BVGA 1DM0B 4ID6A 1PRTF 4K2LA 3WDNA 3LWEA 3QOLA 4OIJA 3DM1A 2JYOA 5DAUA 1U4RA 2XIWA 1EL0A 2IL8A 1OXXK 1SFOB 2DNEA 4CJ0B 2F0NA 4CGYB 4IFDJ 5C5LA 3VR4A 4X3KA 3BS1A 3V2TA 2RDHA 1KABA 1M8AA 4F7XA 4BBSB 2JA7B 3C1FA 1D5MC 4DXGA 1AZQA 1CM9A 4C3JB 2BE5D 1AEXA 3GQBA 1SMYC 4FF3A 3GV6A 2AUJD 4IUPA 1F9QA 3P20A 3V96A 2PZWA 3I4MB 3D4WA 1PTOH 5BN4A 2L11A 3Q23A 2KUMA 5CV5A 1BDOA 1PZKD 2NYZD 2F4IA 4B08A 1XX8A 2K03A 3HZXA 1RDPD 2EY6A 4H0LC 3I70A 2B2VA 4QIWB 4O42A 2JEBI 1ENFA 4WJWA 4KKTA 5E4XA 2MGSA 2RSNA 1STBA 3K57A 5NUCA 4LMQD 1H9SA 2AQ2B 3VA5A 4FO2A 2WP8J 1NUCA 4ZYSA 1U4LA 5HURA 2NUCA 1SYDA 3NTHA 4R8NA 4QB4A 2MP1A 2V4DA 3T56B 3BYTB 3R2TA 1SJHD 2WKCA 1KAAA 1ET9A 1PTOD 2RA4A 5JPNC 2E76C 3I73A 5IT9L 4K5WA 1JE4A 3NWTA 2O5JC 4XQQA 2F0WA 3HGBA 1EY4A 4RHSA 1ESRA 5M9OA 2K5WA 4XYOA 5I6WA 2HQEA 2RVLA 4NMZA 1ILPA 1ZXTA 5K5PA 1JC7A 3MXUA 3C3LA 3TSSA 1SE3A 1Q3LA 1RHPA 2EOTA 2L9HA 1C8CA 1D2BA 3MWYW 4PV1C 2QF7A 3QB3A 3QIAA 4PNYA 3OIPA 4HCSA 1MGSA 5CYUA 1PLFA 2NTTA 3EJIA 2VNUD 4LAAA 2XN9C 3W2DA 1SYGA 3SVMA 3C46A 1H9SB 2L0CA 2N55A 4UDUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K8J A;  4KHV A;  5E3F A;  3NK9 A;  4K6D A;  3D6C A;  2EYP A;  4I65 A;  3DHQ A;  3NP8 A;  2EXZ A;  3NQT A;  3U9O A;  1STB A;  2PZU A;  5NUC A;  3H6M A;  5IGB A;  1EY6 A;  2F3W A;  4TRD A;  2F3V A;  5EKL A;  5C3W A;  5I6Y A;  3VA5 A;  3MHB A;  5C4Z A;  1RKN A;  4ID6 A;  4QF4 A;  2EYJ A;  4RKL A;  4QMG A;  5CR3 A;  4PMB A;  4K2L A;  4PMC A;  1STY A;  3E5S A;  1NUC A;  3MVV A;  5CC4 A;  2F0F A;  5KRU A;  5CV6 A;  4KD3 A;  3SK6 A;  1EQV A;  2F0M A;  4ZQ3 A;  2F0H A;  3OMC A;  1KDB A;  4KY5 A;  1STG A;  3T13 A;  2SOB A;  5EGT A;  5HUR A;  1SNO A;  1JOK A;  2NUC A;  1SYD A;  3QOL A;  4K5V A;  4KV6 A;  1SNM A;  2PW7 A;  4R8N A;  4QB4 A;  3D4D A;  2QDB A;  1ENA A;  2EYL A;  5DAU A;  3OMG A;  3PMF A;  1JOR A;  4NKL A;  1EYC A;  4IAL A;  2LKV A;  1KAA A;  2ENB A;  2OF1 A;  4N9T A;  1SNC A;  5IOC A;  2F0K A;  4ODG A;  5JOB A;  4EVO A;  5IOD A;  1A3T A;  1A3U A;  1TQO A;  3EVQ A;  3MZ5 A;  3SXH A;  3C1E A;  2F0N A;  4ZUI A;  4K5W A;  5IGD A;  1U9R A;  1STH A;  5KYI A;  5CV4 A;  4KJO A;  4KY7 A;  5C5L A;  1A3V A;  4ZUJ A;  5KYL A;  3BDL A;  3OSO A;  2F0W A;  5KGU A;  2F0V A;  4HTH A;  3V2T A;  4KD4 A;  1STN A;  4K5X A;  4KTA A;  1KAB A;  1EY4 A;  1SNQ A;  3DMU A;  1SYF A;  4K2K A;  4F7X A;  5E1F A;  3TP5 A;  2O4X A;  1A2U A;  1JOO A;  4DFA A;  4KJN A;  3NXW A;  4K14 A;  2F0O A;  2KHS A;  2WAC A;  4NP5 A;  5M9O A;  3SK8 A;  3C1F A;  1EY9 A;  1EY8 A;  2OXP A;  3NUC A;  4HMI A;  3TME A;  2EYH A;  2EY5 A;  1F2Y A;  4MIU A;  2SNS A;  5I6W A;  1EZ6 A;  2F0G A;  2HQE A;  2F0J A;  2RKS A;  2F0U A;  2PW5 A;  4IUN A;  1EYA A;  5CGK A;  4RKB A;  2M00 A;  4NMZ A;  1AEX A;  1F2M A;  1KDC A;  3MEH A;  3SK5 A;  3TP7 A;  1JOQ A;  4HMJ A;  1SYE A;  4ME5 A;  5K5P A;  3SK4 A;  5CV8 A;  2F0E A;  4YIJ A;  1STA A;  5JAV A;  5KEE A;  2EYF A;  3P75 A;  4KY6 A;  5J39 A;  5KIX A;  2F0I A;  1NSN S;  4N9P A;  3D8G A;  3MXP A;  5CV9 A;  2PZW A;  1II3 A;  5EKK A;  2OEO A;  3ERO A;  4B9W A;  1A2T A;  2F0L A;  2EY2 A;  3D4W A;  1F2Z A;  3OWF A;  4DF7 A;  2F0P A;  5C6A A;  4DGZ A;  4NDX A;  4B9X A;  5I9P A;  4E6I A;  3T16 A;  1ENC A;  2F0S A;  5C3X A;  3QB3 A;  2PZT A;  1SYC A;  4K8I A;  4DU9 A;  1EY5 A;  5CV5 A;  1SNP A;  3P1H A;  1KDA A;  2EY1 A;  4PNY A;  3TP8 A;  3LX0 A;  5IIF A;  1EZ8 A;  2PYK A;  3QOJ A;  3RUZ A;  3NHH A;  3SHL A;  2PQE A;  4EQO A;  1EY0 A;  5IGE A;  4WRD A;  4EQN A;  3HEJ A;  5ISR A;  5J22 A;  5I9O A;  5C4H A;  1EYD A;  3TP6 A;  3HZX A;  2EYO A;  3EJI A;  3ITP A;  4G57 A;  5HGT A;  1SND A;  4LAA A;  2EY6 A;  5DEH A;  5IGG A;  3R3O A;  5C5M A;  4EQP A;  3S9W A;  1IHZ A;  4OL7 A;  4S3S A;  5J1Z A;  2RDF A;  3BDC A;  1TR5 A;  4F8M A;  2F0D A;  4J1M A;  2F0Q A;  2SNM A;  1SYG A;  5IGF A;  1TT2 A;  2EYM A;  3ERQ A;  4H7B A;  3SR1 A;  5CV7 A;  5IGC A;  2KQ3 A;  2F0T A;  1SYB A;  4WOR A;  2RBM A;  5F2D A;  4J6H A;  4IZ8 A;  1EY7 A; 
#chains in the Genus database with same CATH topology
 1SE2 A;  4K6D A;  1I94 L;  2UUC Q;  1H9J A;  5C3E B;  3A54 A;  3PO3 G;  1VQK A;  4HR7 B;  5JJI A;  1UEA B;  5EKI A;  3H0G G;  4OHJ A;  2YU9 H;  1BO0 A;  2YTX A;  1RKN A;  4R4I A;  3HOZ G;  1EU3 A;  3KDF B;  1YJW A;  5M5W H;  3S16 B;  1G29 1;  4DKA C;  3HOY B;  4HAE A;  3CD6 A;  4KY5 A;  2SOB A;  4JBW A;  1EIH A;  1OXV A;  1Y1V B;  4DV4 L;  2ZXR A;  1XPO A;  2QKI C;  2EIF A;  2ENB A;  1X32 A;  1PFS A;  2Z8L A;  4DK3 C;  1LTB D;  2I46 A;  3JAM L;  5KNC A;  3CCE A;  3I3C A;  1K28 A;  2I5H A;  1Y1W B;  2EXD A;  5K36 H;  1QOH A;  1TWA H;  1Z7T A;  2EZV A;  3FPP A;  1N34 Q;  2RHQ B;  4YWK A;  1R4Q B;  2R92 B;  4MHE A;  1D1I A;  2B8F A;  4JV5 Q;  4OEL B;  1VQ9 A;  3I90 A;  4K2K A;  2CHB D;  4QUF A;  5IP9 G;  1C9O A;  1PFM A;  1YJ9 A;  1EY8 A;  4R9W A;  3HG9 A;  3M4Y A;  3ER0 A;  1BQQ T;  5T1I A;  1X3E A;  1SMY D;  1ZEQ X;  4F87 A;  4ME3 A;  2X69 A;  3S1Q B;  2BA1 A;  4IN3 A;  3MFY A;  5FKA C;  5J39 A;  1GKH A;  1BR9 A;  4A3D G;  4DAP A;  3E9H A;  4PZ6 A;  1VDZ A;  5JJL A;  4LJZ C;  3ERO A;  4JBJ A;  4JI8 Q;  4HED A;  5JEA H;  5IYC H;  1S3O A;  2UXB Q;  5FO9 B;  4IUQ A;  1IBL L;  3HKZ B;  4TQU S;  3S1N H;  2KCC A;  4OO1 H;  4GLV B;  2EY1 A;  4OEM B;  1TKW B;  1KRT A;  4EQO A;  1EY0 A;  3AYH B;  5J22 A;  3M4O H;  1Y69 U;  2N3S A;  4LUV A;  1UE6 A;  3PIO A;  4K0K Q;  4J15 A;  3IRB A;  4BY7 H;  5ELC A;  1K8A C;  1WTW A;  3S14 H;  4TSS A;  5IGF A;  1TT2 A;  4IUV A;  3WOF A;  4LFA L;  5LMU Q;  5FJ8 G;  5FLM G;  5L37 A;  3TEH B;  1AZP A;  1YNX A;  1YHQ A;  1IBM Q;  1XJV A;  1P16 A;  3H94 A;  4K8J A;  5C0X H;  4A3F B;  4YHH L;  3QJY A;  1MBY A;  3HKS A;  1VF5 C;  2SDF A;  4A3K B;  3NBI A;  1S5E D;  1K73 C;  2PO4 A;  2PMZ E;  4MTN A;  4BWG B;  1RTN A;  4C56 C;  3I91 A;  2WAQ G;  4JI6 Q;  1RCV D;  3GTO B;  3A5Z B;  4H44 C;  4XQJ A;  2JK8 A;  3I4N G;  1ML0 D;  1EEF D;  3PUW A;  3E6Z X;  3ICE A;  1K8M A;  3Q6S A;  2UXC Q;  4YCV A;  5G3L D;  2VXW A;  2XWJ B;  2K1B A;  3OMG A;  2B2U C;  2VS1 A;  1W6K A;  2EJF C;  2YYZ A;  2D2C C;  4CBV A;  3I72 A;  3TRE A;  2LMC B;  1QNK A;  3HP3 A;  2Y0S E;  1SDF A;  2TMP A;  4K5X A;  4JI7 Q;  3PO3 B;  1Q12 A;  1CK1 A;  1HNX Q;  3PQI A;  2KHS A;  1V8Q A;  1HCZ A;  1HZB A;  4HMI A;  4GN4 B;  3HOZ B;  1LLR D;  1B3A A;  4B3R Q;  1MIU A;  2XWB B;  4C1N K;  2E2J B;  2MPM A;  4GKK L;  2IWH A;  2LSS A;  2VL6 A;  5IY0 A;  2UUC L;  4DAY A;  1F9R A;  3TRZ A;  5EPL A;  3BYY B;  3IFD A;  4Y7N H;  4A93 G;  1I5F A;  2F1M A;  3DEO A;  4AYB G;  1HTL D;  1D7Q A;  4DR2 Q;  2Q2U A;  1NSN S;  1PH1 A;  2K5Q A;  3QO2 A;  2E2I B;  3ZJY C;  1NJI C;  1N36 Q;  3RZO H;  2VQE Q;  3S1M H;  2PI2 A;  5IWA L;  4CKB A;  2F0S A;  5C3X A;  1HHV A;  4K8I A;  1PRT C;  2JA6 G;  3Q0A A;  5KNB A;  5M3F B;  4JBM A;  5IYD H;  2VUM G;  5M3M H;  1XNR Q;  1VCI A;  2WB1 B;  1XMQ Q;  5C5M A;  5JAV A;  2RDF A;  3BDC A;  4F8M A;  3J7A V;  1VMC A;  2O2L D;  3MXN A;  4YY3 Q;  4DR3 Q;  2AWN A;  3ERQ A;  5FOB B;  1X6O A;  4N8X 1;  3KBG A;  3ERS X;  2NBF A;  4J6H A;  4A3D B;  3U50 C;  1OXU A;  3L3O C;  3IL8 A;  4BS9 A;  2EYP A;  1Q7Y C;  2EXZ A;  5IP7 G;  2I07 B;  2PZU A;  1EY6 A;  1PRT B;  5C3W A;  1C4Q A;  3E3X A;  2OCE A;  1N32 Q;  4MNO A;  4OO1 I;  3CW2 C;  2RF4 A;  2R93 B;  4RHR A;  1DZ1 A;  4GNX A;  2WFW A;  4A3M H;  2NN6 H;  1EWC A;  3MVV A;  3FVQ A;  1S5F D;  1VMP A;  1FNW A;  3MXG A;  3S2H H;  1JOK A;  2R7F A;  1Q1B A;  2FMC A;  1L0X B;  4DV5 Q;  4JI8 L;  2NTS A;  4DNR B;  2I5L X;  4X3T A;  4K6L A;  3U9S A;  1JB7 A;  4EX5 A;  4DR1 Q;  2ICI A;  1TWH H;  1HQR D;  1SAP A;  3SGI A;  4DV0 L;  1NR4 A;  5C0X I;  3E9I A;  1R9T H;  1HNZ L;  2ALY B;  3HOW B;  4IPG A;  2JA7 G;  4ALP A;  2JSO A;  3PUX A;  2F0V A;  4C3J G;  4G7Z C;  4JOI A;  3TN2 A;  1K8G A;  4DAY B;  1B2T A;  2NVY B;  2NVQ H;  2ZTC A;  1BBX C;  2WAQ B;  1AFP A;  4C3H B;  2K5N A;  2VZA A;  1WI5 A;  2F0G A;  1G91 A;  2DUD A;  2HUG A;  4HJ8 A;  3UI2 A;  3SK5 A;  3I4M G;  3I4N B;  4C2M H;  1CT1 D;  1O78 A;  3K6O A;  3DM3 A;  3P75 A;  5AFW A;  5EBC A;  1PA6 A;  3GTM H;  2UXD L;  1G6P A;  4UP8 A;  4R4T A;  4DV2 Q;  3A8I E;  2F0L A;  3Q8D A;  4NDX A;  1AH9 A;  1JR0 D;  2C9O A;  4OWT B;  1G2S A;  2PNR C;  1Q1E A;  2H1E A;  1HTP A;  2K05 A;  2QCP X;  1EY5 A;  3QOJ A;  2LS0 1;  3MXN B;  3HOX B;  3U4Z A;  3PF5 A;  2ZM6 Q;  4KI0 A;  3JAM c;  4DAM A;  4IQZ A;  2Z4I A;  1JQY D;  4X66 Q;  3J80 L;  5M3F H;  3VR3 A;  2Q8I B;  1AN8 A;  3W3A A;  2B3G A;  1I6H B;  4DV6 Q;  3TZD A;  4DV7 Q;  2IPK D;  3SR1 A;  2WII B;  1FD7 D;  2CWA A;  4AYB B;  4X3U A;  5IGC A;  2MO0 A;  5EBD A;  4GNX B;  1GXD C;  1FNU A;  4IUR A;  4JOI C;  3NK9 A;  4UY8 C;  5E7N A;  4AH6 A;  2JJQ A;  4G7O C;  1BNZ A;  1WOC A;  4TRD A;  3J7Z C;  3KLS A;  2N78 A;  2VQF L;  4DR5 Q;  2WIN B;  3R2I A;  1AE3 A;  1FNV A;  3KBX A;  4L8J A;  2G5D A;  4FF1 A;  2E5L L;  5K36 G;  2NB0 A;  1Q82 C;  1K83 B;  2JA6 B;  4UP9 A;  2CQO A;  2VUM B;  4FDB A;  5C4J B;  1SNM A;  1X3Q A;  3PCO B;  2N88 A;  3OTO L;  1N36 L;  4RMF A;  1J5E Q;  2HIX A;  2EE1 A;  4NKL A;  4DUZ Q;  4FXG C;  2XGT A;  3IFT A;  5IOC A;  1I3Q H;  1JWU D;  1GUN A;  4R4C A;  4A3I B;  2OWO A;  1STH A;  1GHJ A;  2MO1 A;  4M8A A;  1HZ9 A;  2UUA L;  3J81 L;  2A5H A;  3K7U C;  2KCM A;  2FMM A;  4KLK A;  2NN6 I;  3H3V H;  4JG2 A;  2K50 A;  2LFN A;  5JEA G;  5IYC G;  5GQO A;  1WTO A;  1EYA A;  1NCV A;  1VF7 A;  3G6J B;  1SN8 A;  2NVY H;  3MEH A;  4OO1 G;  2NZ1 D;  4I7A A;  5I2X A;  4FXK C;  2MHV A;  5A35 A;  5JPM C;  3GTJ H;  4CJ1 B;  4LW1 A;  2A68 C;  3D8G A;  3K5L A;  1CQF A;  1II3 A;  3CRL C;  1IKL A;  5I4D A;  4BY7 G;  1EWH A;  2RDG A;  4JYA Q;  1XXG A;  2JE6 I;  4XDX A;  4B3T L;  3OIQ A;  1CA6 A;  2RHS B;  3D31 A;  1N8R C;  1ENC A;  2X6L A;  3S1R B;  1SSO A;  4LF7 L;  1I94 Q;  1PRT D;  4ZCK A;  5M5X B;  3RD4 A;  5C0X G;  1AW7 A;  5IGE A;  3HEJ A;  3FP9 A;  1PMR A;  2R3Z A;  4N8F A;  1GD7 A;  1HNW L;  4G57 A;  1Q46 A;  4XQN A;  1SND A;  2VB3 X;  5DEH A;  4BBR B;  4OL7 A;  1XMO L;  4BA1 I;  3HOX H;  5C3E G;  2K5H A;  4QGU A;  3CQZ H;  4DV4 Q;  2HDL A;  2HT1 A;  1ESF A;  4U68 A;  1Z47 A;  1HZC A;  4X64 L;  3HOY G;  4P72 A;  2F3W A;  3H09 A;  1BKB A;  3S15 B;  5I6Y A;  4LUZ A;  3M85 A;  4G7H C;  3ULJ A;  3R8B A;  3GTG B;  4LFB L;  1XNQ Q;  1J9O A;  2CCZ A;  2ZTE A;  5CC4 A;  1JCK B;  3QR8 A;  5D14 A;  1KAW A;  2F0M A;  1UE7 A;  2HIV A;  1Z6H A;  1VQ7 A;  3ONA B;  4HSV A;  4HIK A;  4A75 A;  3KOJ A;  2E2H H;  1J6Q A;  1BUV T;  2EDG A;  2GVA A;  2YU9 B;  2I5M X;  1O80 A;  4KN7 C;  1EQT A;  2B39 A;  1EYC A;  1FR3 A;  3QWN A;  1X56 A;  3RMH A;  1VQI A;  4DK0 A;  3NWS A;  2J4X A;  5M5W B;  2JA5 H;  3CKI B;  2NVX H;  1C7Y A;  3JC6 6;  1NBW A;  3LGJ A;  3L9A X;  1MSH A;  4GS3 A;  1DJR D;  2QIL A;  3FRP B;  1EQQ A;  1CKO A;  1B9M A;  3PF4 A;  3CC2 A;  1DD2 A;  4JC0 A;  4DFA A;  2R7Z H;  2F0O A;  3D3R A;  1IBL Q;  4BXX H;  1H9R A;  1WCM H;  1TWA B;  2PW5 A;  3KDF A;  4FF2 A;  5LL6 X;  2IT1 A;  1BXT A;  1KLU D;  3J7A F;  5IYD G;  3UE1 A;  2HCI A;  1KHI A;  1ASY A;  2IHE A;  2ZJP A;  5M3M G;  3HKZ G;  4HJA A;  4QCL A;  2Z6B A;  3MXP A;  4N9P A;  3IKJ A;  3OHX C;  2KEE A;  1WD0 A;  4LFA Q;  2FIN B;  2K5V A;  4OIK A;  3RLF A;  2ZTD A;  3PO2 H;  4JW0 A;  1PXU A;  4E6I A;  1MI2 A;  4YHH Q;  1GO3 E;  1EEI D;  1NTG A;  5IIF A;  1O7Y A;  2Z4H A;  3H3V I;  2PQE A;  1QJO A;  5ISR A;  2ES2 A;  1S5D D;  2AHO B;  3LNN A;  4RWS C;  2Q8T A;  5A2Q L;  3S1R H;  5ELE A;  1GHK A;  5M5X H;  3U58 A;  2L15 A;  3R3O A;  3S1N B;  5J1Z A;  4A3M G;  2NN6 G;  4UP7 A;  1TR5 A;  2OTJ A;  4J1M A;  1F9S A;  4A3K G;  2EYM A;  1LTI D;  3VA7 A;  2MJ8 A;  1EY7 A;  4RH6 A;  3M4O B;  4BBR H;  4GOP A;  3MC0 B;  1OO9 B;  3U9O A;  2ZXO A;  3AU7 A;  3NQT A;  3S2D B;  3CCM A;  4RAU C;  4BY7 B;  3S14 B;  5ELF A;  1QNU A;  5FLX c;  5FO8 B;  3M7N A;  4PMB A;  1Y8N B;  2BCO A;  2H5X A;  4RGN A;  5CV6 A;  1HRJ A;  2QA4 A;  1CHQ D;  5KND A;  3S15 H;  1LAC A;  3I8Z A;  1TS4 A;  2B8G A;  1D8L A;  1ZYR C;  1VQ5 A;  4IOA A;  3V05 A;  1TY0 A;  4YCU A;  2O5I C;  3CCJ A;  4GKK Q;  2YV5 A;  4IPC A;  1SLJ A;  1MJC A;  1HZA A;  4NXM Q;  2XRQ D;  3URY A;  2D5D A;  1A3V A;  3K7A B;  4ZUJ A;  3I56 A;  1TVX A;  1EU4 A;  2B29 A;  2XRS D;  3NE5 B;  1DYQ A;  3PUZ A;  4MN3 A;  4XIG S;  1NMF A;  1YBY A;  4K14 A;  5IWA Q;  4ILW A;  4GN3 B;  3J80 c;  2CVR A;  3I55 A;  1PH5 A;  3C2P A;  4C3I B;  2SNS A;  1IYU A;  2QGQ A;  2RKS A;  1B70 B;  2F0U A;  3CPW A;  3FKI H;  1QVG A;  4HMJ A;  1EYG A;  2BA0 A;  4GOP C;  4V19 0;  1RD9 D;  2A68 D;  3BU2 A;  4CDE C;  2DJF C;  4L63 B;  4RCN A;  4AQY L;  3M9B A;  1XNQ L;  3VR6 A;  1YIJ A;  4XYQ A;  1TWF H;  2K32 A;  1JWS D;  1XTD A;  4A3B H;  5M3F G;  4QUC A;  1WJJ A;  2AMC B;  5ELO A;  4Y7N B;  1V43 A;  2PQA A;  1TII D;  2WB1 G;  5FLX E;  3F8T A;  4MZ9 A;  4DV3 L;  1WYD A;  3LX0 A;  3TBI B;  3F1Z A;  4JI4 L;  1A0I A;  4QIW E;  1S72 A;  5COR A;  1CHP D;  5I9O A;  3RZO B;  5EPK A;  4LF5 L;  3S1M B;  4GOP B;  4YWL A;  1WTX A;  3GTL H;  1NNX A;  3CC7 A;  5IYB H;  2F0D A;  2LY7 A;  2B2U A;  1E2W A;  3J81 c;  4UAI A;  4IUT A;  3D0F A;  4XTC S;  5M3M B;  3KJP A;  3N52 A;  2R93 G;  4DA2 A;  4HIM A;  1HJP A;  5J3B A;  5IGB A;  3K5O A;  1E1O A;  4DV0 Q;  1TS5 A;  2BDN A;  3A55 A;  1HR0 W;  1D5X C;  2WV6 D;  2XTI A;  4RG1 A;  1HNZ Q;  3WWV A;  4KHP Q;  4IFD H;  3DWA A;  2K7V A;  2XNA C;  4PMC A;  1VQP A;  3S2D H;  4RGO S;  3OMC A;  1CZG A;  3KF6 A;  3FHW A;  1S5C D;  3P7J A;  4JI2 L;  1XYI A;  1DXM A;  1UWV A;  3HOW G;  4A3M B;  2DJG C;  1HUN A;  5JOB A;  5G3L F;  3S2H B;  3C1E A;  2CH4 A;  4IPD A;  4WJ3 M;  5LMN W;  2UXD Q;  2K52 A;  4GLA C;  4C3H G;  5H1S E;  1STE A;  1DCZ A;  4KD4 A;  1OXT A;  1TWH B;  5E1F A;  3TP5 A;  2KEC A;  2FFK B;  1E22 A;  4LF8 L;  2H4O A;  3A8J E;  2CKZ B;  4POG A;  4XT1 B;  3K7A H;  2UUB L;  3TME A;  1LAB A;  2EY5 A;  1R9T B;  5TSS A;  3G71 A;  1EZ6 A;  5D3D A;  2FJ2 A;  4OGQ C;  1S4Z A;  1B53 A;  1Q81 C;  4JPB W;  1F2M A;  3TP7 A;  2A6H C;  1SYE A;  4ME5 A;  1PH3 A;  3J81 E;  1PYB A;  2FHT A;  1HR0 L;  1STA A;  3AFP A;  1X55 A;  2PQA B;  4C3I H;  2NVQ B;  4P75 A;  1PH6 A;  2IW3 A;  1ET6 A;  2A19 A;  2HHH L;  2JA8 H;  1LT3 D;  2J0T D;  3GD7 A;  2N49 A;  1A2T A;  1P8L A;  4DF7 A;  3GTQ H;  2KA7 A;  3HOX G;  3HOV H;  4A3L H;  3A7A B;  2YTY A;  4C2M B;  1SYC A;  1QUQ B;  2EJG C;  3GTM B;  1B7Y B;  2PYK A;  4R4O A;  2VQF Q;  2X6G A;  4OX9 L;  2GA4 B;  3VYS A;  4JBK A;  2D0O A;  1KIX A;  1EYD A;  2E5L Q;  4ABN A;  4NXM L;  4L6T B;  5LMN L;  4ZRZ A;  4EQP A;  1AE2 A;  3KLS X;  2SNM A;  4WFN 3;  4PZ7 A;  1EIG A;  2XVS A;  3OTO Q;  1KL9 A;  1WD1 A;  1YHB A;  3N6R A;  3VYR A;  2AQ1 B;  3D6C A;  4I65 A;  4OWW B;  3KF6 B;  1KQS A;  2L5T A;  4CDD C;  2AQ3 B;  3MHB A;  2JA5 G;  1YI2 A;  2EYJ A;  2B2Y A;  2UUA Q;  1VQN A;  3E5S A;  2OQK A;  3STB C;  5IT9 c;  2DN8 A;  1PH7 A;  4JI5 L;  1F77 A;  1GUT A;  3WOE A;  1SNO A;  1ZYR D;  3G48 A;  2QEJ C;  4F88 A;  1NMG A;  4A3I G;  4RCO A;  5AJ3 L;  4RFB A;  1WCM G;  4IAL A;  1TU2 B;  1W2B A;  3Q22 A;  1SNC A;  4A4I A;  5C4X H;  2F0K A;  4I7Z C;  4EQ5 A;  3T53 B;  1EFW A;  1SRO A;  1A62 A;  3H3V C;  2A69 C;  2E74 C;  5C44 B;  1QZH A;  3OSO A;  2KCN A;  4HTH A;  1VQ6 A;  4IFD I;  3PV0 A;  3PUV A;  4DNT B;  4B3T Q;  2O4X A;  1I3Q B;  1D5Z C;  2KCT A;  3PO2 G;  4LF7 Q;  1F2Y A;  5EAY A;  4RKB A;  1E2V A;  1FL0 A;  4IOC A;  4IJL A;  1KDC A;  1B3Q A;  3VR2 A;  4DAV A;  1CQV A;  3IAY A;  4GN5 A;  3AMU A;  3GTP B;  2YTV A;  3HFZ B;  1HNW Q;  1VQO A;  4PZ8 A;  4KHP L;  1XMO Q;  1T9H A;  1VQJ A;  2OEO A;  4Z9C B;  1QZG A;  3GO5 A;  2B2Y C;  1CZW A;  1I6V C;  2R6G A;  1I4P A;  3OOC A;  3CCS A;  2EQS A;  3BVM A;  3GTJ B;  4DU9 A;  4X64 Q;  1SNP A;  3FEW X;  5IT9 E;  4BBR G;  1G6Z A;  4OWX B;  1HA6 A;  1Y14 B;  3W5O A;  3F2C A;  2JEA I;  2A1A A;  1HFN A;  4LFB Q;  3TP6 A;  3ITP A;  1M90 C;  5HGT A;  3D4R A;  4LF4 L;  4KK7 A;  2HCC A;  3GDE A;  2AUK A;  2F0Q A;  1BCP F;  4Y52 H;  2CQA A;  3K0X A;  1TWC H;  4YWM A;  1PH4 A;  1SYB A;  5CMD A;  1BOS A;  4Q5V A;  3NP8 A;  5FO7 B;  1MJE A;  2Q2H A;  4KHZ A;  3RLN A;  4C1N I;  1E0B A;  2CWP A;  1V1P A;  2TSS A;  3BJU A;  2UU9 L;  1TS2 A;  2NWG A;  3MTS A;  4IJH A;  3CQZ B;  4O2D A;  5KRU A;  3KF8 B;  4KD3 A;  2L4N A;  3BDO A;  3MFG A;  2IY5 B;  5EJW A;  1E1T A;  1N33 L;  2NZO A;  2BH2 A;  4M1U B;  3B6Y A;  1T5X D;  2PW7 A;  3AB9 A;  3L2P A;  1UNS A;  1PZJ D;  3NPP A;  2ZT9 C;  3MEF A;  1J8I A;  5M5Y H;  2B63 H;  5BR8 L;  3PIP 3;  4DV1 L;  2L1B A;  3OWE B;  2E2H B;  4UPA A;  1Q86 C;  5CV4 A;  5KYL A;  3NTI A;  3KJO A;  3BDL A;  1STN A;  1G2T A;  1OXS C;  1N9W A;  1MSG A;  4APV A;  2JA5 B;  2NVX B;  2WAC A;  3CHB D;  5C44 H;  2OTL A;  5DNF A;  3K5M A;  1EUJ A;  1RJT A;  4IUU A;  1V1O A;  1JIC A;  2ASB A;  1YNJ C;  5JJK A;  2A6H D;  1E2Z A;  2A74 C;  5I2Y A;  3KYH C;  3T51 B;  2WKD A;  4YIJ A;  2R7Z B;  2K6A A;  4FXD A;  1LYL A;  4P74 A;  2F0I A;  1WCM B;  1JJG A;  5E4W C;  2AKW B;  2EY2 A;  4DXF A;  3ND8 A;  3KLW A;  1I4R A;  1O7Z A;  5IYB G;  3T1Y L;  3PSI A;  1QIL A;  3GTP H;  4B9X A;  1QG7 A;  2DY8 A;  1B50 A;  3T16 A;  3RR5 A;  3JAM E;  1IBK L;  1EZ8 A;  1K3R A;  2Q8R E;  1U4M A;  3PO2 B;  1WVL A;  2ATW A;  1XPU A;  2ZJQ A;  4IFD G;  2L12 A;  5HGQ A;  4FF4 A;  4TKO B;  4ULL A;  5IGG A;  1W3S A;  3U4V A;  1LTL A;  5BN5 A;  1EWI A;  1V1P B;  1V9P A;  5JEA J;  2RBM A;  2P5Z X;  4KHV A;  1YNN C;  3A8K E;  2JA9 A;  1VQB A;  5ELB A;  5D3I B;  3RZD H;  1VQC A;  2Y0S G;  4QF4 A;  1A15 A;  1VQL A;  5GAH C;  3STB D;  2ICE C;  3F2D A;  1I50 H;  1YZ6 A;  4R1J A;  1STG A;  1BBU A;  1LTS D;  2B2T A;  1DOM A;  1EQR A;  3I2Z A;  4OXP A;  1X3P A;  3DUZ A;  2EYL A;  3HOU B;  3PMF A;  3TDQ A;  3J7Y W;  1JOR A;  5C0X J;  3M4P A;  3FMC A;  4GZY C;  1KD1 C;  4PMW A;  2A8V A;  4N9T A;  4DK1 A;  5IOD A;  3EVQ A;  3CMA A;  2A69 D;  2Z0S A;  3EBE A;  1A63 A;  1U9R A;  4O1N A;  1KNA A;  1SXT A;  4AQY Q;  1VQ8 A;  1TWG H;  4HJ5 A;  1QE6 A;  4C3I G;  1EIF A;  1UEB A;  2WAQ E;  4FP5 D;  2JA8 G;  1LT4 D;  2L55 A;  1X65 A;  1A2U A;  4KJN A;  1LTA D;  3ULL A;  2NVT H;  3SK8 A;  2D62 A;  4MIU A;  1XPR A;  4DV3 Q;  1PDQ A;  3HOV G;  5ELD A;  5CGK A;  2G9D A;  2MFI A;  4IUN A;  1WFQ A;  1LV9 A;  4A93 H;  5IE8 A;  4JI4 Q;  1X3G A;  3G7L A;  5FK9 C;  3SK4 A;  3F2U A;  3PIO 3;  1DOK A;  1KTK A;  3X3M A;  3SDZ A;  3RN2 A;  4Q0F A;  4LF5 Q;  1VQH A;  2Z9H A;  4BY1 H;  1PTO F;  2JN4 A;  2M2L A;  4LFC L;  3X3N A;  5CV9 A;  4X62 L;  3L0O A;  1EIY B;  4QQB X;  1GUG A;  2RCN A;  1B9N A;  1FVI A;  3FKI B;  4JI0 L;  4DGZ A;  1D1K A;  4HID A;  4BA2 I;  1F2L A;  3TS2 A;  2B2T C;  4HN7 A;  2KED A;  4YCW A;  4L5T A;  1UUP A;  2IHF A;  1TWF B;  1PFB A;  5DM6 3;  4A3B B;  3DEP A;  1IL8 A;  1HPC A;  5GAE C;  1IHZ A;  1PH9 A;  2KVM A;  4JI2 Q;  4KN4 C;  1QVF A;  4H7B A;  1HFG A;  1CKN B;  5IP7 H;  2IJ0 A;  1I4H A;  3NQI A;  3NEN A;  3DHQ A;  1IW7 C;  4R4Q A;  3H6M A;  3GTL B;  2F3V A;  1PYW D;  5C4X G;  1CFM A;  4JI3 L;  2CW0 C;  1V1Q A;  2A6E C;  1STY A;  4HJ9 A;  1C0A A;  4HSP A;  2F4V L;  1SFO H;  4ZQ3 A;  1D6E C;  2K75 A;  2PMZ B;  4V0B A;  5EGT A;  5GAD C;  4LF8 Q;  5JVH 3;  4CHT B;  1JE5 A;  1GJX A;  2UUB Q;  2C35 B;  3D4D A;  2B2V C;  3T1H L;  4P71 A;  4X65 Q;  1ENA A;  3VDY A;  4BBS H;  1LT5 D;  2LKV A;  2OF1 A;  4DNI A;  2SEB D;  1XTC D;  4ODG A;  4EVO A;  1A3T A;  2JA7 H;  5HY6 A;  1HR0 Q;  3T4A C;  1KLG D;  3AFQ A;  4RGM A;  1HA5 A;  2FXQ A;  5IGD A;  3HOU H;  1LTT D;  2HHH Q;  1BVS A;  4NW2 A;  2KJX A;  2CH4 W;  1X54 A;  4KTA A;  3DMU A;  3NEL A;  1LTR D;  1JOO A;  1ZKO A;  3DXJ C;  3I4O A;  4NP5 A;  2Y0S B;  3I4L A;  1PYS B;  1EFI D;  2ZJR A;  3FDT A;  1YNJ D;  3OPO A;  3HRZ C;  2KOL A;  2M00 A;  3NTK A;  4RGT A;  1G51 A;  4OX9 Q;  5CV8 A;  2RSO A;  1FJG L;  2F0E A;  1X3F A;  4KMU C;  3A56 A;  2A73 B;  5LMN Q;  1K0R A;  2EPB A;  3TS0 A;  1JJ2 A;  4LK1 C;  2RQX A;  4LF6 L;  3M3Y B;  3E0E A;  1VQG A;  4NXN L;  4B9W A;  1Q8I A;  3VR5 A;  4JK1 C;  1CI3 M;  5C6A A;  1VS0 A;  3ZYY X;  1ICF B;  1K8O A;  2VY3 A;  1GVP A;  1GUO A;  4A3J B;  5T1G A;  3RUZ A;  2JA8 B;  4XXE A;  1DON A;  1L0Y B;  1GUW A;  4QL5 A;  4JI1 L;  3GTQ B;  1B44 D;  4X6A H;  2V1C C;  3GP7 A;  3PGZ A;  3HOV B;  3BZK A;  3H91 A;  4JI5 Q;  4UHV A;  2DY7 A;  2VB2 X;  2E2D C;  4LWC A;  1I4X A;  4QY7 A;  4L5Q A;  2JXM B;  3VYU A;  5AJ3 Q;  4P2C B;  4WOR A;  1CSP A;  1WTR A;  1YNN D;  4IZ8 A;  3RLO A;  5E3F A;  2PPB C;  3EA6 A;  1SEB D;  2K14 A;  2PCF B;  3FPU B;  1B1Z A;  3OW7 A;  4QJF A;  1TS3 A;  4OON A;  5EKL A;  2B63 G;  3A5U A;  2VW9 A;  4AIM A;  5C4Z A;  4DUY Q;  2ZXP A;  4XT3 B;  3CF5 A;  4G4K A;  2ID0 A;  4ZKC B;  2F0H A;  1QUQ A;  1KDB A;  4NB3 A;  1G8Z D;  4KV6 A;  4K5V A;  4LF9 L;  3GTK B;  3J7A 5;  3DWQ A;  3A7L A;  4A3E B;  3NSW A;  5C44 G;  1Z9F A;  1LT6 D;  4LNQ A;  1O7I A;  2BDO A;  1WTP A;  3R93 A;  3K80 C;  3BG3 A;  1T5E A;  2K01 A;  3EQL C;  1IXR A;  3SXH A;  1SBB B;  4ZKB B;  4CKE A;  5KYI A;  3J80 E;  1IYV A;  1HXY D;  5KGU A;  3TQY A;  1SNQ A;  4ZLT F;  1H9M A;  4L5R C;  1SYF A;  3AEV A;  2JP1 A;  5C4X B;  4JCV E;  4WJ4 A;  2Z6K A;  2OXP A;  1WTV A;  2MUY A;  2F0J A;  5CBA E;  2LXJ A;  1JOQ A;  1ASZ A;  2EJM A;  4KY6 A;  1BCP C;  3M7G A;  4LF4 Q;  1L1O A;  1CUK A;  2HQL A;  4DR7 L;  5EKK A;  4HIO A;  2BH8 A;  1DOL A;  1F9P A;  3OWF A;  1W6J A;  1UAP A;  4TVA B;  5EPJ A;  1MD2 D;  4X65 L;  3M3Y H;  1GOZ A;  2B2W A;  3P1H A;  3SEB A;  3TP8 A;  2E8G A;  3EIV A;  5EQ0 A;  3SHL A;  3UDG A;  4WRD A;  2UU9 Q;  4B3M L;  3E0J A;  3A74 A;  3K0Y A;  3KLR A;  2G9H D;  1CTM A;  4A3C H;  1YVC A;  1FGB D;  5C3E H;  4A3J H;  3S9W A;  1BCP B;  4B3S L;  1JWM D;  1VQA A;  1N33 Q;  4A3G B;  1Y8P B;  1A8V A;  1A6X A;  5CV7 A;  2F0T A;  2Z1C A;  3S16 H;  3HOY H;  3NBH A;  5CBE E;  2HDM A;  3CRK C;  5DM7 3;  2KBN A;  1IW7 D;  5BR8 Q;  4PQX A;  4DV1 Q;  3JAM i;  2K4K A;  3CP0 A;  2Z6K C;  3UDX A;  1I4Q A;  4DR4 L;  4DR6 L;  2CW0 D;  3K8A A;  1EOV A;  1Y1V H;  4RKL A;  2BOS A;  4QMG A;  1LO5 D;  2A6E D;  4FVM A;  1TWC B;  2F0F A;  1YHA A;  3BVZ A;  1JB3 A;  3SK6 A;  4R8I A;  3H0G B;  4GLX A;  1Y1W H;  1QB5 D;  1SE4 A;  3ND9 A;  1ONL A;  3J81 j;  2R92 H;  1L1O C;  1CA5 A;  1E7Z A;  2QDB A;  2QW7 A;  1SRU A;  1A3U A;  1TQO A;  4CJ2 C;  1Q8K A;  3GTK H;  4A3E H;  2D0P A;  2C5C A;  2KHI A;  4L5S A;  4KJO A;  2B2W C;  3K5N A;  3DLL A;  2JQO A;  4BY1 G;  4CKC A;  1UE1 A;  3SE0 A;  4KKU A;  3S1Q H;  3T1Y Q;  5M5Y B;  3BZD B;  1JMC A;  2B63 B;  1SJE D;  5BN3 A;  1EY9 A;  1IKM A;  3K59 A;  2EYH A;  2R7Z G;  1PH2 A;  1S5B D;  2IX1 A;  1L1O B;  1IBK Q;  4IPH A;  4BXX G;  2M9V A;  1CSQ A;  2BE5 C;  3KFU A;  3KF8 A;  1L2F A;  4DN4 M;  1U4P A;  5KEE A;  3CCV A;  5KIX A;  1N34 L;  1M4V A;  1U5K A;  2K28 A;  3Q24 A;  4DUY L;  1UE5 A;  4JV5 L;  1NR2 A;  2F0P A;  1M1K C;  1QCB D;  4A76 A;  5I9P A;  3O13 A;  3H15 A;  1B4O A;  1KDA A;  2GN5 A;  2I0Q A;  2KEN A;  5JJZ A;  3A0J A;  3NEM A;  3KUP A;  4PG3 A;  4EQN A;  1PV4 A;  4U67 3;  3W1B A;  2IX3 A;  1S40 A;  3D6W A;  5C4H A;  4A3F H;  1SMX A;  3NBH B;  4H13 C;  4A3K H;  3DWP A;  1ICW A;  2E75 C;  4S3S A;  1PH8 A;  3HKZ E;  1H95 A;  4DPG A;  2OT2 A;  1RTO A;  4FYD A;  3MAQ A;  3TZU A;  1AP0 A;  2KQ3 A;  1U0L A;  3K81 C;  2UXB L;  3PUY A;  1R4P B;  3GTO H;  2Q2I A;  5LL6 S;  4A3G H;  4FNF A;  5D65 A;  1WTQ A;  2NZH A;  4BBS G;  1ROD A;  1TY2 A;  5COY A;  5CR3 A;  3K58 A;  1OTC A;  2Q2T A;  1HQM C;  4HCE A;  4X3S A;  1KC8 C;  1MKH A;  3HOU G;  3CME A;  4K0K L;  1EQV A;  1NAP A;  3T13 A;  2K5D A;  1ILQ A;  2HD3 A;  5DLQ E;  1EOT A;  1JJC B;  2DNC A;  3S17 B;  5JVG 3;  3RZD B;  5LMU L;  1PZI D;  3W1G A;  1IBM L;  3LWU A;  3PO3 H;  1RL2 A;  3H0G H;  3BZC A;  5FLX L;  1PTO C;  1I50 B;  5A2Q E;  3MZ5 A;  1LTG D;  1XWE A;  2K04 A;  3HOZ H;  4ZUI A;  2IX0 A;  1NE3 A;  1RIP A;  1Y8O B;  2DGY A;  4KY7 A;  1VQ4 A;  2E2J H;  4LFC Q;  4X62 Q;  3CU7 A;  4CDF C;  2MQH A;  3F2B A;  1KNE A;  2D9U A;  4JI6 L;  1LUZ A;  2F52 A;  4JI0 Q;  1VQD A;  4GNX C;  3NXW A;  3MA2 B;  3G6E A;  3NUC A;  1RF2 D;  2E2I H;  2UXC L;  1H9K A;  3EFX D;  4ZAI A;  1TWG B;  3L7Z C;  4ZK9 B;  4J8Q A;  5LHY 1;  4LUO A;  3CCL A;  2K33 A;  3HS0 C;  4RA8 A;  4KKS A;  1PTO B;  2EVB A;  2J7Z A;  3FKI G;  1VQF A;  1BCP D;  2EYF A;  1YEZ A;  2NVT B;  1FYC A;  3GV3 A;  1KRS A;  3CXC A;  2RCF A;  1QWY A;  5IP9 H;  4JI7 L;  4GKJ Q;  1F2Z A;  1HNX L;  3QG1 A;  1K9M C;  4A93 B;  1BBW A;  2XSC A;  4A3B G;  2GVB A;  1HH2 P;  3EN2 A;  2PZT A;  4BY1 B;  4B3R L;  1HUM A;  1Q90 A;  1MHW C;  3NHH A;  3VYT A;  1VQM A;  4JI3 Q;  2F03 A;  4A3D H;  5GRO A;  2AWO A;  2EYO A;  1BF4 A;  2F4V Q;  4DR2 L;  3KK7 A;  2N8N A;  1L0W A;  2R61 A;  1PFN A;  3T1H Q;  2R93 H;  1C48 A;  2VQE L;  5F2D A;  2OQ0 A;  1O7L A;  1GUS A;  4H02 A;  2WB1 E;  1I4G A;  4EGV A;  2QDL A;  1DM0 B;  3BVG A;  4ID6 A;  1PRT F;  1XNR L;  4K2L A;  1XMQ L;  3CAM A;  3WDN A;  3LWE A;  5FJ8 H;  5FLM H;  3QOL A;  4OIJ A;  3HOW H;  4YY3 L;  3DM1 A;  4DR3 L;  1IL2 A;  2JYO A;  1VQE A;  2QEX A;  5DAU A;  1U4R A;  2XIW A;  1EL0 A;  2IL8 A;  1OXX K;  1IYJ B;  3UE0 A;  1SFO B;  3S17 H;  2DNE A;  1FJG Q;  4CJ0 B;  2F0N A;  4CGY B;  4C3H H;  4IFD J;  1N32 L;  5C5L A;  3VR4 A;  4X3K A;  3BS1 A;  1QVC A;  1CKN A;  1FGU A;  4LF6 Q;  3V2T A;  2RDH A;  2MNA A;  4NXN Q;  3I4N H;  1PVO A;  1KAB A;  1M8A A;  4F7X A;  1YJN A;  3UDF A;  3S24 A;  4BBS B;  2F3I A;  3RNU A;  1X9N A;  2JA7 B;  3ULP A;  3C1F A;  1D5M C;  4DXG A;  4DV5 L;  1AZQ A;  1CM9 A;  4C3J B;  2BE5 D;  4MTK A;  4DR1 L;  1AEX A;  3GQB A;  1SR3 A;  1SMY C;  4FF3 A;  4JI1 Q;  3GV6 A;  2AUJ D;  4IUP A;  1F9Q A;  3P20 A;  3V96 A;  1IZ6 A;  4DK6 C;  2PZW A;  3J80 i;  4A3C G;  3I4M B;  4A3J G;  3D4W A;  3M4Q A;  1PTO H;  4POF A;  2R7D A;  5BN4 A;  2L11 A;  3Q23 A;  2PI2 E;  2KUM A;  5CV5 A;  1I6H H;  1BDO A;  1PZK D;  4A3L G;  2KHJ A;  2NYZ D;  3AQQ A;  2F4I A;  4B08 A;  1GM5 A;  1XX8 A;  2K03 A;  3HZX A;  1RDP D;  1Y1V G;  2PNH A;  2EY6 A;  3CCR A;  4H0L C;  3I70 A;  2B2V A;  4QIW B;  4O42 A;  1B8A A;  2JEB I;  4LF9 Q;  4DV2 L;  1ENF A;  3CPF A;  1Y1W G;  4WJW A;  4KKT A;  5E4X A;  3OW2 A;  2MGS A;  1K83 H;  1NY4 A;  2JA6 H;  2RSN A;  2R92 G;  2VUM H;  1STB A;  3K57 A;  5NUC A;  5C4J H;  4LMQ D;  1H9S A;  2AQ2 B;  3VA5 A;  4IO9 A;  1E3P A;  4FO2 A;  2ZM6 L;  2WP8 J;  3J81 i;  4A3E G;  1NUC A;  4ZYS A;  4AYB E;  1U4L A;  4X66 L;  4A3I H;  5HUR A;  2NUC A;  1SYD A;  3NTH A;  2CFM A;  4R8N A;  4DV6 L;  4GKJ L;  4DV7 L;  4QB4 A;  2MP1 A;  2V4D A;  3CCQ A;  3T56 B;  3BYT B;  3R2T A;  1E24 A;  1YIT A;  1SJH D;  2WKC A;  1KAA A;  4HJ7 A;  1ET9 A;  1PTO D;  2RA4 A;  3G4S A;  5JPN C;  2E76 C;  3I73 A;  5IT9 L;  1DGS A;  4K5W A;  4DR5 L;  1JE4 A;  1KXL A;  3NWT A;  2O5J C;  4DR7 Q;  4XQQ A;  2F0W A;  3I7F A;  3HGB A;  1EY4 A;  4RHS A;  1ESR A;  5M9O A;  4CDC C;  2K5W A;  4XYO A;  5I6W A;  4JVZ A;  1TXY A;  1J5E L;  2HQE A;  4DUZ L;  2RVL A;  5ELN A;  4NMZ A;  3RN5 A;  4NPS A;  1ILP A;  1ZXT A;  4B3M Q;  5K5P A;  1JC7 A;  1JT8 A;  3MXU A;  3PIP A;  3C3L A;  3TSS A;  1SE3 A;  4C3J H;  4A3F G;  4B3S Q;  1CKM A;  1Q3L A;  1RHP A;  2EOT A;  2L9H A;  1C8C A;  1D2B A;  3MWY W;  4PV1 C;  2QF7 A;  1K0S A;  4O0A A;  3QB3 A;  5GAG C;  3QIA A;  3I4M H;  4PNY A;  4P73 A;  3CCU A;  3OIP A;  4DR4 Q;  4DR6 Q;  4A3G G;  4HCS A;  1SE8 A;  1MGS A;  5CYU A;  1PLF A;  3CC4 A;  1WTH A;  2NTT A;  3EJI A;  2VNU D;  3OYY A;  4LAA A;  2XN9 C;  3W2D A;  1LM0 A;  1K3B C;  3UDI A;  1SYG A;  3SVM A;  1PHJ A;  3C46 A;  1H9S B;  2LXK A;  3GTG H;  2L0C A;  2N55 A;  4JYA L;  4UDU C; 
#chains in the Genus database with same CATH homology
 1SE2 A;  4K6D A;  1H9J A;  5C3E B;  3A54 A;  4HR7 B;  1UEA B;  5EKI A;  4OHJ A;  1BO0 A;  1RKN A;  1EU3 A;  3S16 B;  1G29 1;  3HOY B;  4HAE A;  4KY5 A;  2SOB A;  4JBW A;  1EIH A;  1OXV A;  1Y1V B;  2ZXR A;  2QKI C;  2ENB A;  1X32 A;  2Z8L A;  1LTB D;  2I46 A;  3JAM L;  5KNC A;  3I3C A;  1Y1W B;  5K36 H;  1QOH A;  1Z7T A;  2EZV A;  3FPP A;  1R4Q B;  2R92 B;  4MHE A;  1D1I A;  2B8F A;  3I90 A;  4K2K A;  2CHB D;  4QUF A;  1PFM A;  1EY8 A;  4R9W A;  3HG9 A;  3M4Y A;  1BQQ T;  5T1I A;  1SMY D;  1ZEQ X;  4F87 A;  3S1Q B;  2X69 A;  2BA1 A;  4IN3 A;  3MFY A;  5FKA C;  5J39 A;  1BR9 A;  4DAP A;  1VDZ A;  4LJZ C;  3ERO A;  4HED A;  5JEA H;  5FO9 B;  4IUQ A;  3HKZ B;  4TQU S;  2KCC A;  4OO1 H;  2EY1 A;  1TKW B;  4EQO A;  1EY0 A;  5J22 A;  1Y69 U;  5ELC A;  1WTW A;  4TSS A;  5IGF A;  1TT2 A;  4IUV A;  3WOF A;  1AZP A;  3H94 A;  5C0X H;  4K8J A;  4A3F B;  3QJY A;  1MBY A;  1VF5 C;  2SDF A;  4A3K B;  3NBI A;  1S5E D;  2PO4 A;  4BWG B;  1RTN A;  4C56 C;  3I91 A;  1RCV D;  3GTO B;  4H44 C;  4XQJ A;  1ML0 D;  1EEF D;  3PUW A;  3E6Z X;  1K8M A;  3Q6S A;  5G3L D;  2VXW A;  2XWJ B;  2K1B A;  3OMG A;  2B2U C;  1W6K A;  2EJF C;  2YYZ A;  2D2C C;  4CBV A;  3I72 A;  2LMC B;  1QNK A;  3HP3 A;  1SDF A;  2TMP A;  4K5X A;  3PO3 B;  1Q12 A;  1CK1 A;  2KHS A;  1V8Q A;  1HCZ A;  3HOZ B;  4HMI A;  1LLR D;  1B3A A;  2XWB B;  4C1N K;  2E2J B;  2MPM A;  2IWH A;  4DAY A;  1F9R A;  5EPL A;  3BYY B;  3IFD A;  2F1M A;  3DEO A;  1HTL D;  1NSN S;  2K5Q A;  3QO2 A;  2E2I B;  4CKB A;  2F0S A;  5C3X A;  1HHV A;  4K8I A;  1PRT C;  3Q0A A;  5KNB A;  5M3F B;  1VCI A;  2WB1 B;  5C5M A;  5JAV A;  2RDF A;  3BDC A;  4F8M A;  3J7A V;  1VMC A;  2O2L D;  3MXN A;  2AWN A;  3ERQ A;  5FOB B;  3KBG A;  2NBF A;  4J6H A;  4A3D B;  1OXU A;  3L3O C;  3IL8 A;  4BS9 A;  2EYP A;  2EXZ A;  2I07 B;  2PZU A;  1EY6 A;  1PRT B;  5C3W A;  1C4Q A;  4OO1 I;  2R93 B;  4RHR A;  1DZ1 A;  2NN6 H;  1EWC A;  3MVV A;  3FVQ A;  1S5F D;  1VMP A;  1FNW A;  3MXG A;  1JOK A;  1Q1B A;  2FMC A;  1L0X B;  2NTS A;  4DNR B;  4X3T A;  4K6L A;  3U9S A;  2ICI A;  1HQR D;  1SAP A;  1NR4 A;  5C0X I;  3HOW B;  2JSO A;  3PUX A;  2F0V A;  4C3J G;  4G7Z C;  3TN2 A;  1B2T A;  2NVY B;  1BBX C;  2WAQ B;  1AFP A;  4C3H B;  2F0G A;  1G91 A;  2HUG A;  3UI2 A;  3SK5 A;  3I4N B;  1CT1 D;  1O78 A;  3K6O A;  3P75 A;  5AFW A;  5EBC A;  3A8I E;  2F0L A;  4NDX A;  1JR0 D;  2C9O A;  1G2S A;  2PNR C;  1Q1E A;  2H1E A;  1HTP A;  2K05 A;  2QCP X;  1EY5 A;  3QOJ A;  2LS0 1;  3HOX B;  4KI0 A;  4IQZ A;  2Z4I A;  1JQY D;  3J80 L;  3VR3 A;  2Q8I B;  1AN8 A;  3W3A A;  1I6H B;  3TZD A;  2IPK D;  3SR1 A;  2WII B;  1FD7 D;  4AYB B;  4X3U A;  5IGC A;  5EBD A;  1GXD C;  1FNU A;  4IUR A;  3NK9 A;  4G7O C;  1BNZ A;  4TRD A;  3KLS A;  2WIN B;  3R2I A;  1FNV A;  3KBX A;  4L8J A;  4FF1 A;  5K36 G;  2NB0 A;  1K83 B;  2JA6 B;  2VUM B;  5C4J B;  1SNM A;  1X3Q A;  2N88 A;  2EE1 A;  4NKL A;  4FXG C;  3IFT A;  5IOC A;  1JWU D;  1GUN A;  4A3I B;  1STH A;  1GHJ A;  4M8A A;  3J81 L;  2A5H A;  2FMM A;  2NN6 I;  2LFN A;  5JEA G;  1WTO A;  1EYA A;  1NCV A;  1VF7 A;  3G6J B;  3MEH A;  4OO1 G;  2NZ1 D;  5I2X A;  4FXK C;  2MHV A;  5A35 A;  5JPM C;  4CJ1 B;  2A68 C;  3D8G A;  3K5L A;  1CQF A;  1II3 A;  3CRL C;  1IKL A;  5I4D A;  1EWH A;  2RDG A;  4XDX A;  1XXG A;  2JE6 I;  3OIQ A;  1CA6 A;  3D31 A;  1ENC A;  2X6L A;  3S1R B;  1SSO A;  1PRT D;  5M5X B;  3RD4 A;  5C0X G;  1AW7 A;  5IGE A;  3HEJ A;  1PMR A;  2R3Z A;  4G57 A;  4XQN A;  1SND A;  2VB3 X;  5DEH A;  4BBR B;  4OL7 A;  4BA1 I;  2HDL A;  1ESF A;  4U68 A;  1Z47 A;  2F3W A;  3H09 A;  3S15 B;  5I6Y A;  3M85 A;  4G7H C;  3R8B A;  3GTG B;  1J9O A;  5CC4 A;  1JCK B;  5D14 A;  2F0M A;  1Z6H A;  3ONA B;  4HSV A;  1BUV T;  2EDG A;  2YU9 B;  1O80 A;  4KN7 C;  1EQT A;  2B39 A;  1EYC A;  1FR3 A;  3QWN A;  3RMH A;  4DK0 A;  3NWS A;  2J4X A;  5M5W B;  3CKI B;  3L9A X;  1MSH A;  1DJR D;  2QIL A;  3FRP B;  1B9M A;  1DD2 A;  4DFA A;  2F0O A;  3D3R A;  1H9R A;  1TWA B;  2PW5 A;  4FF2 A;  5LL6 X;  2IT1 A;  1BXT A;  1KLU D;  3J7A F;  2HCI A;  4QCL A;  4N9P A;  3MXP A;  3IKJ A;  3OHX C;  2KEE A;  1WD0 A;  2FIN B;  3RLF A;  4OIK A;  4E6I A;  1PXU A;  1MI2 A;  1EEI D;  5IIF A;  1O7Y A;  2Z4H A;  2PQE A;  1QJO A;  5ISR A;  1S5D D;  5A2Q L;  3LNN A;  4RWS C;  2Q8T A;  5ELE A;  1GHK A;  3R3O A;  3S1N B;  5J1Z A;  2NN6 G;  1TR5 A;  4J1M A;  1F9S A;  2EYM A;  1LTI D;  3VA7 A;  2MJ8 A;  1EY7 A;  4RH6 A;  3M4O B;  3MC0 B;  1OO9 B;  3U9O A;  2ZXO A;  3AU7 A;  3NQT A;  3S2D B;  4RAU C;  4BY7 B;  3S14 B;  5ELF A;  1QNU A;  5FO8 B;  3M7N A;  4PMB A;  1Y8N B;  2BCO A;  4RGN A;  5CV6 A;  1HRJ A;  1CHQ D;  5KND A;  1LAC A;  3I8Z A;  1TS4 A;  2B8G A;  1ZYR C;  3V05 A;  1TY0 A;  2O5I C;  2XRQ D;  3URY A;  2D5D A;  1A3V A;  3K7A B;  4ZUJ A;  1TVX A;  1EU4 A;  2XRS D;  3NE5 B;  1DYQ A;  3PUZ A;  4MN3 A;  4XIG S;  4K14 A;  4ILW A;  3C2P A;  2CVR A;  4C3I B;  2SNS A;  1IYU A;  2RKS A;  2F0U A;  4HMJ A;  2BA0 A;  4V19 0;  1RD9 D;  2A68 D;  4L63 B;  4RCN A;  3VR6 A;  4XYQ A;  2K32 A;  1JWS D;  4QUC A;  4Y7N B;  1V43 A;  1TII D;  5FLX E;  3LX0 A;  3TBI B;  5COR A;  1CHP D;  5I9O A;  3RZO B;  5EPK A;  3S1M B;  1WTX A;  2F0D A;  2LY7 A;  2B2U A;  1E2W A;  4UAI A;  4IUT A;  4XTC S;  5M3M B;  3N52 A;  4DA2 A;  5IGB A;  3K5O A;  1TS5 A;  2BDN A;  3A55 A;  1D5X C;  2WV6 D;  4IFD H;  3DWA A;  2K7V A;  2XNA C;  4PMC A;  4RGO S;  3OMC A;  1CZG A;  1S5C D;  3P7J A;  1XYI A;  1DXM A;  4A3M B;  1HUN A;  5JOB A;  5G3L F;  3S2H B;  3C1E A;  4C3H G;  1STE A;  1DCZ A;  4KD4 A;  1OXT A;  1TWH B;  5E1F A;  3TP5 A;  2KEC A;  2FFK B;  2H4O A;  3A8J E;  4XT1 B;  3TME A;  1LAB A;  2EY5 A;  1R9T B;  5TSS A;  1EZ6 A;  5D3D A;  2FJ2 A;  4OGQ C;  1S4Z A;  1B53 A;  1F2M A;  3TP7 A;  2A6H C;  1SYE A;  4ME5 A;  3J81 E;  2FHT A;  1STA A;  2NVQ B;  2IW3 A;  1ET6 A;  1LT3 D;  2J0T D;  3GD7 A;  1A2T A;  4DF7 A;  2KA7 A;  3A7A B;  4C2M B;  1SYC A;  2EJG C;  3GTM B;  2PYK A;  2X6G A;  2GA4 B;  3VYS A;  1EYD A;  4ABN A;  4L6T B;  4ZRZ A;  4EQP A;  3KLS X;  2SNM A;  4WFN 3;  1EIG A;  2XVS A;  1WD1 A;  3N6R A;  3VYR A;  2AQ1 B;  3D6C A;  4I65 A;  2L5T A;  2AQ3 B;  3MHB A;  2EYJ A;  2B2Y A;  3E5S A;  2DN8 A;  1F77 A;  1GUT A;  3WOE A;  1SNO A;  1ZYR D;  2QEJ C;  4F88 A;  4RCO A;  4RFB A;  4IAL A;  1TU2 B;  3Q22 A;  1SNC A;  2F0K A;  4I7Z C;  3T53 B;  3H3V C;  2A69 C;  2E74 C;  5C44 B;  3OSO A;  2KCN A;  4HTH A;  4IFD I;  3PV0 A;  3PUV A;  4DNT B;  2O4X A;  1I3Q B;  1D5Z C;  1F2Y A;  4RKB A;  1E2V A;  1KDC A;  3VR2 A;  4DAV A;  1CQV A;  3IAY A;  3AMU A;  3GTP B;  2OEO A;  4Z9C B;  3GO5 A;  2B2Y C;  1CZW A;  1I6V C;  2R6G A;  1I4P A;  3OOC A;  3BVM A;  3GTJ B;  4DU9 A;  1SNP A;  3FEW X;  5IT9 E;  1G6Z A;  1HA6 A;  2JEA I;  1HFN A;  3TP6 A;  3ITP A;  5HGT A;  3D4R A;  4KK7 A;  2HCC A;  2AUK A;  2F0Q A;  1BCP F;  2CQA A;  1SYB A;  5CMD A;  1BOS A;  4Q5V A;  3NP8 A;  5FO7 B;  4KHZ A;  4C1N I;  1E0B A;  2TSS A;  1V1P A;  1TS2 A;  2NWG A;  3MTS A;  3CQZ B;  5KRU A;  4KD3 A;  2L4N A;  3BDO A;  3MFG A;  5EJW A;  4M1U B;  1T5X D;  2PW7 A;  3AB9 A;  1UNS A;  1PZJ D;  3NPP A;  2ZT9 C;  1J8I A;  3PIP 3;  2L1B A;  3OWE B;  2E2H B;  5CV4 A;  5KYL A;  3NTI A;  3BDL A;  1STN A;  1G2T A;  1OXS C;  1MSG A;  2JA5 B;  2NVX B;  2WAC A;  3CHB D;  5DNF A;  3K5M A;  1RJT A;  4IUU A;  1V1O A;  1JIC A;  1YNJ C;  2A6H D;  1E2Z A;  2A74 C;  5I2Y A;  3T51 B;  2WKD A;  4YIJ A;  2R7Z B;  2K6A A;  4FXD A;  2F0I A;  1WCM B;  5E4W C;  2EY2 A;  4DXF A;  3ND8 A;  1I4R A;  1O7Z A;  1QIL A;  4B9X A;  1QG7 A;  2DY8 A;  1B50 A;  3T16 A;  3JAM E;  1EZ8 A;  2Q8R E;  1U4M A;  3PO2 B;  1WVL A;  4IFD G;  2L12 A;  4FF4 A;  4TKO B;  4ULL A;  5IGG A;  5BN5 A;  1V1P B;  5JEA J;  2RBM A;  4KHV A;  1YNN C;  3A8K E;  5ELB A;  5D3I B;  4QF4 A;  1A15 A;  2ICE C;  1STG A;  1LTS D;  2B2T A;  1DOM A;  1X3P A;  3DUZ A;  2EYL A;  3HOU B;  3PMF A;  3TDQ A;  3J7Y W;  1JOR A;  5C0X J;  3FMC A;  4GZY C;  4PMW A;  4N9T A;  4DK1 A;  5IOD A;  3EVQ A;  2A69 D;  1U9R A;  4O1N A;  1KNA A;  1SXT A;  1QE6 A;  4C3I G;  4FP5 D;  1LT4 D;  2L55 A;  1A2U A;  4KJN A;  1LTA D;  3SK8 A;  2D62 A;  4MIU A;  1PDQ A;  5ELD A;  5CGK A;  2G9D A;  4IUN A;  1LV9 A;  3G7L A;  5FK9 C;  3SK4 A;  3F2U A;  3PIO 3;  1DOK A;  1KTK A;  3X3M A;  3SDZ A;  4Q0F A;  1PTO F;  2M2L A;  3X3N A;  5CV9 A;  1GUG A;  1B9N A;  3FKI B;  4DGZ A;  1D1K A;  4BA2 I;  1F2L A;  2B2T C;  4HN7 A;  2KED A;  1UUP A;  1TWF B;  1PFB A;  5DM6 3;  4A3B B;  3DEP A;  1IL8 A;  1HPC A;  1IHZ A;  2KVM A;  4KN4 C;  4H7B A;  1HFG A;  2IJ0 A;  1I4H A;  3NQI A;  3DHQ A;  1IW7 C;  3H6M A;  3GTL B;  2F3V A;  1PYW D;  1CFM A;  2CW0 C;  2A6E C;  1STY A;  4HSP A;  4ZQ3 A;  1D6E C;  2PMZ B;  4V0B A;  5EGT A;  5JVH 3;  4CHT B;  1GJX A;  3D4D A;  2B2V C;  1ENA A;  1LT5 D;  2LKV A;  2OF1 A;  2SEB D;  1XTC D;  4ODG A;  4EVO A;  1A3T A;  3T4A C;  1KLG D;  4RGM A;  1HA5 A;  5IGD A;  1LTT D;  4NW2 A;  2KJX A;  4KTA A;  3DMU A;  1LTR D;  1JOO A;  1ZKO A;  3DXJ C;  4NP5 A;  2Y0S B;  3I4L A;  1EFI D;  3FDT A;  1YNJ D;  3OPO A;  3HRZ C;  2KOL A;  2M00 A;  3NTK A;  4RGT A;  5CV8 A;  2RSO A;  2F0E A;  4KMU C;  3A56 A;  2A73 B;  2EPB A;  4LK1 C;  2RQX A;  3M3Y B;  4B9W A;  1Q8I A;  3VR5 A;  4JK1 C;  1CI3 M;  5C6A A;  3ZYY X;  1K8O A;  1GUO A;  4A3J B;  5T1G A;  3RUZ A;  2JA8 B;  4XXE A;  1DON A;  1L0Y B;  1GUW A;  3GTQ B;  1B44 D;  3GP7 A;  3HOV B;  3H91 A;  2DY7 A;  2VB2 X;  2E2D C;  1I4X A;  2JXM B;  3VYU A;  4P2C B;  4WOR A;  1WTR A;  1YNN D;  4IZ8 A;  5E3F A;  2PPB C;  3EA6 A;  1SEB D;  3FPU B;  2PCF B;  1B1Z A;  3OW7 A;  1TS3 A;  5EKL A;  5C4Z A;  2ZXP A;  4XT3 B;  4G4K A;  2ID0 A;  4ZKC B;  2F0H A;  1KDB A;  1G8Z D;  4KV6 A;  4K5V A;  3GTK B;  3DWQ A;  3A7L A;  4A3E B;  3NSW A;  1LT6 D;  1WTP A;  2BDO A;  3R93 A;  1T5E A;  3BG3 A;  2K01 A;  3EQL C;  3SXH A;  1SBB B;  4ZKB B;  4CKE A;  5KYI A;  3J80 E;  1IYV A;  1HXY D;  5KGU A;  1SNQ A;  4ZLT F;  1H9M A;  1SYF A;  2JP1 A;  5C4X B;  2OXP A;  1WTV A;  2MUY A;  2F0J A;  5CBA E;  1JOQ A;  2EJM A;  4KY6 A;  1BCP C;  3M7G A;  5EKK A;  1DOL A;  1F9P A;  3OWF A;  1W6J A;  1UAP A;  5EPJ A;  1MD2 D;  1GOZ A;  2B2W A;  3P1H A;  3SEB A;  3TP8 A;  5EQ0 A;  3SHL A;  4WRD A;  3E0J A;  3K0Y A;  3KLR A;  2G9H D;  1CTM A;  1FGB D;  3S9W A;  1BCP B;  1JWM D;  4A3G B;  1Y8P B;  1A6X A;  5CV7 A;  2F0T A;  2Z1C A;  3NBH A;  5CBE E;  2HDM A;  3CRK C;  5DM7 3;  1IW7 D;  4PQX A;  1I4Q A;  2CW0 D;  4RKL A;  2BOS A;  4QMG A;  1LO5 D;  2A6E D;  4FVM A;  1TWC B;  2F0F A;  3BVZ A;  1JB3 A;  3SK6 A;  4R8I A;  3H0G B;  1QB5 D;  1SE4 A;  3ND9 A;  1ONL A;  1CA5 A;  2QDB A;  1A3U A;  1TQO A;  4CJ2 C;  2C5C A;  4KJO A;  2B2W C;  3K5N A;  4CKC A;  3SE0 A;  4KKU A;  5M5Y B;  3BZD B;  2B63 B;  1SJE D;  5BN3 A;  1EY9 A;  1IKM A;  3K59 A;  2EYH A;  1S5B D;  2IX1 A;  2M9V A;  2BE5 C;  3KF8 A;  4DN4 M;  1U4P A;  5KEE A;  5KIX A;  1M4V A;  2K28 A;  3Q24 A;  1NR2 A;  2F0P A;  1QCB D;  5I9P A;  3O13 A;  1B4O A;  1KDA A;  5JJZ A;  3KUP A;  4EQN A;  4U67 3;  2IX3 A;  3D6W A;  5C4H A;  4H13 C;  3DWP A;  1ICW A;  2E75 C;  4S3S A;  2OT2 A;  1RTO A;  4FYD A;  3MAQ A;  3TZU A;  1AP0 A;  2KQ3 A;  3PUY A;  1R4P B;  5LL6 S;  4FNF A;  5D65 A;  1WTQ A;  1ROD A;  1TY2 A;  5COY A;  5CR3 A;  3K58 A;  1HQM C;  4HCE A;  4X3S A;  1EQV A;  1NAP A;  3T13 A;  2K5D A;  1ILQ A;  1EOT A;  2DNC A;  3S17 B;  5JVG 3;  3RZD B;  1PZI D;  3LWU A;  5FLX L;  1PTO C;  1I50 B;  5A2Q E;  3MZ5 A;  1LTG D;  1XWE A;  2K04 A;  4ZUI A;  2IX0 A;  1Y8O B;  4KY7 A;  3CU7 A;  1KNE A;  2D9U A;  3NXW A;  3MA2 B;  3NUC A;  1RF2 D;  1H9K A;  3EFX D;  4ZAI A;  1TWG B;  3L7Z C;  4ZK9 B;  4J8Q A;  5LHY 1;  2K33 A;  3HS0 C;  4RA8 A;  4KKS A;  1PTO B;  2EVB A;  2J7Z A;  1BCP D;  2EYF A;  2NVT B;  1FYC A;  3GV3 A;  1QWY A;  1F2Z A;  3QG1 A;  4A93 B;  2XSC A;  2PZT A;  4BY1 B;  1HUM A;  1Q90 A;  3NHH A;  3VYT A;  2F03 A;  2AWO A;  2EYO A;  1BF4 A;  3KK7 A;  2R61 A;  1PFN A;  1C48 A;  5F2D A;  1O7L A;  1GUS A;  1I4G A;  4EGV A;  3BVG A;  1DM0 B;  4ID6 A;  1PRT F;  4K2L A;  3WDN A;  3LWE A;  3QOL A;  4OIJ A;  3DM1 A;  2JYO A;  5DAU A;  1U4R A;  2XIW A;  1EL0 A;  2IL8 A;  1OXX K;  1SFO B;  2DNE A;  4CJ0 B;  2F0N A;  4CGY B;  4IFD J;  5C5L A;  3VR4 A;  4X3K A;  3BS1 A;  3V2T A;  2RDH A;  1KAB A;  1M8A A;  4F7X A;  4BBS B;  2JA7 B;  3C1F A;  1D5M C;  4DXG A;  1AZQ A;  1CM9 A;  4C3J B;  2BE5 D;  1AEX A;  3GQB A;  1SMY C;  4FF3 A;  3GV6 A;  2AUJ D;  4IUP A;  1F9Q A;  3P20 A;  3V96 A;  2PZW A;  3I4M B;  3D4W A;  1PTO H;  5BN4 A;  2L11 A;  3Q23 A;  2KUM A;  5CV5 A;  1BDO A;  1PZK D;  2NYZ D;  2F4I A;  4B08 A;  1XX8 A;  2K03 A;  3HZX A;  1RDP D;  2EY6 A;  4H0L C;  3I70 A;  2B2V A;  4QIW B;  4O42 A;  2JEB I;  1ENF A;  4WJW A;  4KKT A;  5E4X A;  2MGS A;  2RSN A;  1STB A;  3K57 A;  5NUC A;  4LMQ D;  1H9S A;  2AQ2 B;  3VA5 A;  4FO2 A;  2WP8 J;  1NUC A;  4ZYS A;  1U4L A;  5HUR A;  2NUC A;  1SYD A;  3NTH A;  4R8N A;  4QB4 A;  2MP1 A;  2V4D A;  3T56 B;  3BYT B;  3R2T A;  1SJH D;  2WKC A;  1KAA A;  1ET9 A;  1PTO D;  2RA4 A;  5JPN C;  2E76 C;  3I73 A;  5IT9 L;  4K5W A;  1JE4 A;  3NWT A;  2O5J C;  4XQQ A;  2F0W A;  3HGB A;  1EY4 A;  4RHS A;  1ESR A;  5M9O A;  2K5W A;  4XYO A;  5I6W A;  2HQE A;  2RVL A;  4NMZ A;  1ILP A;  1ZXT A;  5K5P A;  1JC7 A;  3MXU A;  3C3L A;  3TSS A;  1SE3 A;  1Q3L A;  1RHP A;  2EOT A;  2L9H A;  1C8C A;  1D2B A;  3MWY W;  4PV1 C;  2QF7 A;  3QB3 A;  3QIA A;  4PNY A;  3OIP A;  4HCS A;  1MGS A;  5CYU A;  1PLF A;  2NTT A;  3EJI A;  2VNU D;  4LAA A;  2XN9 C;  3W2D A;  1SYG A;  3SVM A;  3C46 A;  1H9S B;  2L0C A;  2N55 A;  4UDU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...