5IOCA

Crystal structure of staphylococcal nuclease variant delta+phs v66h/v99d at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMHENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMDNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V66H/V99D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5iocA00
4TRDA 2EXZA 2F0WA 5CV9A 4DGZA 1EY9A 4HTHA 4QB4A 4DU9A 3HEJA 3MXPA 3NXWA 1EY4A 5CR3A 5IIFA 1EZ8A 1EY6A 3ITPA 1STHA 2EY5A 3R3OA 4KY7A 4N9PA 4G57A 5NUCA 5CV7A 2RDFA 5I9PA 5KYIA 3ERQA 5F2DA 2EY6A 1A2TA 4KD4A 1EY5A 3P1HA 5KYLA 5I6YA 5CV8A 4EQOA 4K6DA 1TQOA 2PYKA 2SOBA 2F0NA 2HQEA 4S3SA 3C1FA 3EVQA 5HGTA 3D4WA 1SYGA 5IGBA 3NP8A 1SNCA 2F0UA 1STAA 3OSOA 4MIUA 5CV5A 2EYMA 3OWFA 1NSNS 3D6CA 5J39A 3E5SA 1SYCA 5C3XA 2ENBA 5M9OA 4ZUJA 1A3UA 4B9XA 5C5LA 4RKBA 1EY8A 2F0VA 3MVVA 5IGEA 3TP6A 4ME5A 2F3VA 5IGFA 3EJIA 2OF1A 2QDBA 3NK9A 1IHZA 5C6AA 1F2MA 1TT2A 1KDCA 3QB3A 4IALA 1JOKA 2PZTA 3OMGA 1SYEA 1A3VA 1JORA 1EQVA 1A3TA 1F2ZA 5E1FA 5EKLA 2F0IA 1STBA 4H7BA 4K5VA 4ODGA 3NUCA 5JAVA 1JOQA 2LKVA 3MZ5A 4WRDA 4I65A 4KY6A 3TMEA 1SYBA 4KHVA 4RKLA 3SK5A 2F0FA 4HMIA 4ZQ3A 5CC4A 2WACA 4LAAA 2PZUA 4PNYA 2F0MA 4KY5A 5EKKA 5C5MA 2PZWA 4ID6A 4N9TA 3EROA 3OMCA 3TP5A 4K5XA 5DEHA 2M00A 1STGA 3DHQA 4PMBA 3SXHA 2F0DA 5CV4A 4DF7A 3S9WA 2F0LA 1II3A 3SHLA 5IOCA 1AEXA 1ENCA 1JOOA 5KIXA 4PMCA 3MHBA 1EZ6A 4F7XA 1TR5A 1SYDA 2RBMA 2F0PA 5IGGA 5EGTA 4OL7A 2RKSA 3SK4A 5IGCA 4EVOA 3QOLA 5ISRA 3T13A 2F0GA 2F0EA 5IODA 1SNPA 3C1EA 5HURA 4KD3A 5CGKA 3TP7A 5I9OA 5K5PA 1KDAA 2NUCA 4IUNA 3LX0A 4NP5A 5CV6A 2F0OA 4IZ8A 4J1MA 2SNMA 3VA5A 3D4DA 4NMZA 1F2YA 5KGUA 5I6WA 3MEHA 5DAUA 5JOBA 4WORA 1EYAA 3SK6A 3DMUA 3BDCA 3H6MA 1EYCA 1A2UA 1EY7A 2EY1A 3PMFA 4NDXA 2SNSA 1ENAA 4K2KA 5C3WA 1SNQA 2EY2A 4EQPA 5KEEA 4K2LA 4NKLA 1SNDA 4R8NA 1STNA 3RUZA 3QOJA 4B9WA 4EQNA 4KJOA 2PQEA 4DFAA 4KJNA 5IGDA 2PW5A 2PW7A 4YIJA 1EYDA 3NHHA 3V2TA 3SK8A 2KQ3A 4K8JA 1SYFA 2F0SA 1SNOA 2F3WA 2OXPA 4QF4A 5E3FA 3TP8A 3U9OA 1STYA 2EYFA 4E6IA 4J6HA 3NQTA 2O4XA 1EY0A 3BDLA 4HMJA 1KDBA 2EYLA 4K14A 4K8IA 4ZUIA 5C4HA 1KAAA 2EYJA 3T16A 5J22A 1RKNA 5C4ZA 2EYOA 1KABA 2F0JA 4KV6A 2F0KA 2F0HA 2F0QA 5J1ZA 2EYPA 2OEOA 3P75A 1SNMA 1U9RA 3SR1A 4F8MA 1NUCA 4K5WA 4KTAA 3HZXA 5KRUA 2EYHA 4QMGA 2KHSA 2F0TA 3D8GA
chains in the Genus database with same CATH superfamily
3PO3B 1D2BA 1BQQT 4M8AA 4HSPA 1VQDA 4OWTB 3MXPA 3FPUB 3NXWA 4U673 2NN6H 2WFWA 2RDGA 3Q6SA 2XTIA 2RDFA 5M5WB 2YTVA 2P5ZX 4P75A 4DV5L 4K6DA 2Z6KA 4RGTA 4L5SA 1QZHA 4M1UB 3GD7A 4LJZC 1UE5A 3PO2H 3IKJA 4LK1C 3H0GH 3R2IA 2ZT9C 1EOVA 2I5LX 3F2CA 3I4MB 4IFDJ 1BCPF 4CDDC 2KENA 2QDBA 3NQIA 5C6AA 3KF6B 2E74C 4IALA 2UUCQ 2FINB 3GTOB 2R93H 5FLMH 1SAPA 2LY7A 1PHJA 4JK1C 4J8QA 2QF7A 1HA6A 4FXGC 4A3CG 1IKLA 5BN5A 3RMHA 2UUBQ 2PI2E 5KYLA 2WACA 1EIFA 1H95A 1KIXA 2UXBQ 2E2JB 4DR2L 1N32L 3D6WA 4C3JH 5JJKA 1Q8KA 1TWAB 2F0LA 3I2ZA 5LL6X 1HZ9A 3STBD 2XIWA 1JB3A 4X64Q 1VQ9A 5IYCH 1I5FA 2AUJD 2RDHA 1N9WA 1SNPA 3S24A 5FO9B 4HAEA 3TP7A 1SFOB 2FXQA 2JEAI 1F9PA 2NN6I 3MFGA 1NR4A 2R92G 2JEBI 3SK6A 5LMUL 3Q22A 5FLXE 5M5YB 2X6GA 3H09A 4H13C 1WCMH 1B2TA 2MP1A 3NELA 1SE3A 3K7AB 3ZYYX 1IL8A 2VB3X 2PQEA 3I4OA 5FO7B 4A76A 2B8FA 4YIJA 2MGSA 3J80c 4G7ZC 4HJAA 1X32A 1SNOA 1QG7A 4LF9Q 4DK3C 1N36Q 1VQCA 3I4NB 2VUMB 3W5OA 2JJQA 5GQOA 1LUZA 2JA5B 2OEOA 3SR1A 2JP1A 4QUCA 3HOUB 2EXZA 1HA5A 3LNNA 3CC4A 1WD0A 2EJFC 1Z7TA 3J7A5 4DU9A 3PCOB 2RF4A 4P72A 4LNQA 3K57A 4MTNA 3FKIB 5I6YA 1V1PB 4XQJA 5IYBG 2PNRC 1G6ZA 1VQGA 4L6TB 2LS01 4A3FG 1HHVA 4GNXB 3CCJA 5CV5A 1HQMC 4CDCC 1F9RA 3P20A 1HTLD 3UDIA 3U4ZA 2XRSD 3I4LA 3HOXB 2ZM6Q 2QCPX 5C5LA 5IWAQ 2L12A 1JJGA 1IBMQ 1Q1EA 3Q23A 2SDFA 2AMCB 2I5HA 4DV6L 1CZGA 3HP3A 1E2VA 3FDTA 5E1FA 2IX1A 1SBBB 1K83B 3F2DA 3T1HL 5JPNC 1AFPA 1PTOB 1B53A 1E1TA 1F9QA 1RHPA 3CP0A 2CH4W 3KF8A 2O5JC 1JOQA 4JI6Q 1LTAD 5J3BA 2IY5B 2DUDA 4ZQ3A 3WDNA 2R7DA 2OQ0A 4PQXA 3CD6A 5DEHA 4IUVA 4OX9Q 3I8ZA 1LLRD 2VL6A 1SJED 1T5XD 3MC0B 1UE6A 3KDFB 3GTLB 3C1EA 4BY7B 2WINB 3E0JA 2DY7A 4JW0A 2UUCL 1C0AA 3K5OA 3S17H 4NP5A 3LX0A 3EIVA 4A3BG 2Z6BA 4NMZA 5KNBA 1U4PA 1IKMA 1PLFA 1SLJA 4B3RQ 3C3LA 2UUBL 1ESFA 4A93G 3LGJA 3HKZB 2UXBL 2BDNA 4DR1Q 1D5ZC 3SK8A 4PZ7A 4Q0FA 2NZ1D 5EPKA 4X64L 2K14A 3BS1A 1L1OB 4A3IG 5IYBH 2RHSB 4A3FH 3T16A 1DOLA 1KABA 5D3DA 3RLOA 3RNUA 5C44G 4O2DA 2CH4A 4IPGA 3VDYA 5A35A 2ZXRA 2E76C 4JPBW 3Q24A 3HOWB 2GVBA 3R2TA 1CA5A 2A74C 3QJYA 1EQRA 2WAQG 2LXJA 3D0FA 2RCNA 4OO1G 4J15A 2BE5D 2MFIA 4CJ1B 1I6HB 3ERQA 1A2TA 4X3SA 5COYA 3WOFA 2K75A 4ZKBB 3L3OC 2AUKA 3A7LA 5HGTA 3E0EA 3BVMA 4LF9L 2CVRA 3IFDA 1S72A 3GDEA 1N36L 2LMCB 3RZOB 5C3XA 3SVMA 1FYCA 2HCIA 2KUMA 4LF4Q 1KDCA 1JOKA 2VXWA 3NTKA 4BBRG 5M3MG 1SYEA 3GTGH 1A3TA 4UY8C 1STBA 4ODGA 2KOLA 4POGA 4DA2A 1VMPA 2A68D 1SYBA 3K59A 3BZDB 2K5DA 2F0FA 4DPGA 4A3BH 1QOHA 3OYYA 3QR8A 2Q8TA 1S5DD 2IHFA 1G8ZD 3ND9A 3IRBA 1YHQA 5L37A 2HT1A 1I3QH 1T5EA 4A93H 4PMCA 1TS4A 1BVSA 1SYDA 3MXUA 1D7QA 2ZM6L 5IWAL 2UXCQ 4JV5Q 4DK6C 4DR5Q 1IBML 1BF4A 3CCSA 2ZTCA 2EJMA 5ELOA 4A3IH 4DK1A 1S5FD 4YWKA 1UEBA 2SNMA 1L0YB 1EQQA 2NVQB 1WTRA 5M5XH 1EYAA 2KCCA 1WD1A 4JI6L 2RSOA 2B63G 1S4ZA 2Y0SB 4OEMB 1X9NA 4OWWB 5C3WA 1KRTA 2NTSA 3F2UA 1O78A 1ET9A 3QOJA 2CCZA 4OX9L 1LTBD 2C9OA 1HH2P 1A8VA 1IW7D 4OO1H 1JCKB 4RHSA 2D5DA 1STYA 1EWCA 1KRSA 2F03A 3BDLA 1SN8A 3U9SA 4ME3A 2GVAA 5C4ZA 4JI1Q 3JAMc 4X6AH 3HZXA 1T9HA 2KHSA 1X56A 1CQVA 3MXNB 4QY7A 4POFA 3KBGA 1VQKA 5AJ3Q 2BH2A 1SJHD 1PH8A 2PNHA 4B3RL 5CR3A 2X69A 1VQLA 4BBRH 3S1RH 2FMMA 1EFWA 2A73B 5KNDA 5K36G 2K5WA 1PH2A 3E9HA 4C3HB 4DR1L 4MNOA 4ZRZA 1EIYB 2ALYB 1TS5A 4DNRB 3T51B 5D3IB 3E5SA 1CFMA 1B70B 3H3VH 4TSSA 4HIMA 3MVVA 2CWAA 1Y1VB 2OF1A 3ER0A 3FHWA 3QB3A 3TQYA 4KI0A 1JJCB 2ICEC 1JE4A 2QGQA 4ZKCB 4A3JB 1YNND 5JAVA 4RAUC 2MO0A 2R7ZG 5FK9C 1B44D 4OO1I 4RKLA 1YBYA 1WOCA 4HIOA 5EKKA 3CQZB 1Q82C 1CKNB 1TY0A 2VS1A 1K28A 4HIDA 2I0QA 3SXHA 4PMBA 4YHHQ 2CFMA 3QWNA 2B63H 2R7FA 5C4JB 2KA7A 1J5EL 5IOCA 2YV5A 2Q2UA 1PYSB 2WV6D 2ZTEA 4XYOA 4JBMA 1RTOA 1TXYA 2K32A 3OPOA 3M4OB 5EGTA 1WTPA 4TQUS 4GN3B 2XSCA 3MFYA 3H91A 4LF4L 1O7LA 1K0RA 5K5PA 2CW0C 2IPKD 1OXVA 2AHOB 3TSSA 4FYDA 1DCZA 3J80E 1P16A 4RA8A 3TRZA 1Q90A 3GTKB 1F2YA 4TVAB 2FFKB 2KJXA 3W1GA 4IN3A 2B3GA 3J7AF 3AB9A 2JXMB 1WTQA 1QUQB 2YU9B 3M7GA 4DV2Q 5IT9L 1Z6HA 4DFAA 3MXGA 3A5UA 3GV6A 4MTKA 3H3VI 4I7AA 2JN4A 1RODA 3A54A 3CCLA 5K36H 2IL8A 1C8CA 3NTHA 4DAPA 4JV5L 4UP9A 2EYJA 4DR5L 5BN3A 3FMCA 5C0XG 1SNMA 4B3TQ 1QZGA 1X3QA 5CORA 3FP9A 3TZDA 1SRUA 3S1MB 4BBSG 1YJ9A 1EY6A 2L55A 2OTLA 4ILWA 1TQOA 2R7ZH 1HXYD 1GOZA 2NVYB 1VDZA 3G6EA 1TIID 3AFQA 4A4IA 1L2FA 2ENBA 1W6KA 4JI1L 1F9SA 1XXGA 1ASYA 1BXTA 5LHY1 2PI2A 1GXDC 4IO9A 3CCVA 1TWCB 5FJ8G 4V0BA 3KFUA 1CSPA 3J7ZC 5AJ3L 2HCCA 1LO5D 2B2VC 3DEOA 1TWHH 4A3GG 1DONA 2K5HA 4GOPC 2EQSA 1KC8C 1BCPC 4HMIA 2K1BA 1Y1WB 1YNJD 3AQQA 1CKOA 1KLGD 3HRZC 4N9TA 4A3LG 4IFDG 2QW7A 1NE3A 2V1CC 1EQTA 1HR0Q 4QL5A 4DF7A 2AQ1B 5M3FG 4KN4C 4BWGB 1VQ7A 5KIXA 4WJ4A 5IE8A 1HNZQ 1KD1C 1VQ5A 1A15A 4Y7NH 3C2PA 3PO3G 3T13A 2NVXH 2SEBD 2XWJB 1DOKA 1QE6A 5C4XG 2WB1B 2WAQE 4GKKQ 1VQIA 5KGUA 4DAYA 5C0XH 1M8AA 5HY6A 3S1NH 2L0CA 1K8MA 2A6ED 2EY2A 2PMZB 1MKHA 3R93A 2H1EA 4YHHL 4BBSH 2EE1A 1I94Q 4UAIA 1CZWA 3I4MG 1WVLA 2EVBA 4K8JA 4E6IA 4LF5Q 2YTXA 1XX8A 2B2TA 4DXGA 3TN2A 1VQEA 4DV1Q 1E7ZA 2EYPA 1ENFA 3KK7A 2OTJA 3K80C 3TS0A 3M3YB 4IUNA 4R1JA 4FO2A 1YJNA 3S1QH 1PYBA 1OXXK 3R3OA 5IT9c 3I72A 3S16H 3CCUA 4NPSA 5KYIA 1VQFA 5F2DA 4UPAA 4DV2L 2JA7B 1L0XB 3CMAA 3EN2A 4A3GH 2SOBA 4RFBA 3URYA 5EQ0A 1EOTA 2BCOA 2XRQD 4A3LH 3P7JA 2Q2IA 4L5QA 4GS3A 2E2IH 2RVLA 5M3FH 1Q81C 1J8IA 4JI8Q 2KEDA 4B3TL 2KVMA 2Z8LA 5C0XI 1RL2A 1HNWQ 1Q1BA 2PZTA 2KECA 3PIPA 3G4SA 3HOVB 1EQVA 3WOEA 1HJPA 3PO3H 1CHQD 3S2HH 5DNFA 2Z1CA 4YWLA 4IJHA 3K5MA 2RSNA 3ND8A 2I5MX 3Q0AA 1WTWA 4KHVA 5C4XH 1R4QB 3SK5A 1I4RA 3AEVA 1XMQL 5CYUA 2N55A 3CU7A 2PQAA 4XT1B 3I4NG 2VUMG 2ZXOA 3PUXA 3TS2A 4HR7B 2JA5G 3I70A 1Q86C 5CBAE 2UXDL 2QEXA 3DWAA 3OIPA 1ZYRC 2EOTA 3K58A 1TS2A 1KHIA 5BN4A 3I4MH 2N88A 3QG1A 1PFSA 3PO2B 4KKTA 4XYQA 5I9OA 3A7AB 1EIHA 4HEDA 2K28A 3K5NA 3KLSX 1ZXTA 3L7ZC 3BDCA 4IPDA 1EYCA 2L4NA 2R93B 2YYZA 3NBHB 3JAME 2Q8RE 2VQEQ 4B9WA 3RUZA 2ZJRA 1XJVA 1PFBA 1HR0L 1LT5D 3HOXG 1MIUA 4R4TA 2B39A 1SYFA 2F3WA 4I7ZC 4GN4B 1HNZL 1SE4A 5I2YA 1R4PB 1FGUA 2F4IA 4C3JB 4KLKA 1X55A 4YCUA 2VB2X 2F0KA 2HDLA 1H9MA 5GROA 4GKKL 4DGZA 5I2XA 2B2UC 3W3AA 4QB4A 2ZTDA 1YIJA 4NW2A 2I07B 4AYBB 1UNSA 5JVH3 4P73A 4KY7A 1EL0A 3K7AH 1I50H 4DUZQ 4KHPQ 3RZDB 1WCMB 4X65Q 4HN7A 3T4AC 2AQ2B 4MHEA 5EKIA 3OWFA 1H9JA 4O42A 2VUMH 4DV1L 4QGUA 1HNXQ 2JA5H 2LXKA 3TP6A 1G51A 2F3VA 2XWBB 1K3BC 3C46A 3V96A 3KF8B 1H9SA 1TWFB 1TVXA 2L9HA 2O2LD 3I3CA 1MJCA 1AW7A 1UUPA 5T1IA 3CCQA 4TKOB 3KJOA 2R6GA 4A3CH 3MWYW 2HIVA 4KY5A 3KLRA 4ID6A 1NMGA 3CC7A 4R4CA 1PH4A 4JI2L 1VQAA 1BR9A 1A63A 2K52A 1FGBD 4QUFA 1MBYA 3VYTA 1VQ8A 2DJFC 4FNFA 2AKWB 3PIP3 3MHBA 1GHJA 1QNKA 4R4OA 3VA7A 3J81c 3ICEA 2EDGA 1V9PA 4N8X1 3HOWG 4JI8L 4QQBX 1AZQA 3BZCA 1HNWL 2GA4B 4JCVE 4BA1I 4FDBA 1K83H 1B9MA 1PTOH 2R92H 4IUQA 1WYDA 1V43A 2WIIB 3DLLA 2QEJC 4EQPA 5KEEA 3S14B 2DNEA 5TSSA 1MI2A 4LWCA 4C2MH 3CAMA 1QILA 3F1ZA 3SEBA 4QF4A 3NPPA 3DEPA 3ERSX 2VW9A 1LT4D 2MQHA 1KDBA 2HHHQ 4GNXC 3D3RA 4IPCA 4C3IB 1OTCA 2F0QA 3JAML 1E2ZA 4RGMA 2DN8A 4PV1C 4A3MG 3EQLC 1RF2D 5JJIA 1EEID 2F0TA 1SE2A 2XNAC 5E7NA 1PFNA 3MA2B 1CHPD 1FR3A 1PZJD 1SXTA 4HSVA 3VR4A 3S17B 1K0SA 5NUCA 1WJJA 1PTOC 2JSOA 4KD4A 1ICWA 3PUZA 3TZUA 2L5TA 1QVCA 1CK1A 2E2DC 1S5BD 4KN7C 5JJZA 4R9WA 1C9OA 3FRPB 5LMNQ 1SMXA 1PRTB 5IP9G 4ZUJA 4B9XA 2JA8B 1CKMA 4RKBA 3KUPA 4OWXB 4Y52H 2K6AA 3DM3A 1VQBA 2Q2TA 1TT2A 1PH7A 2K04A 2Y0SG 3KYHC 3PUYA 3RLFA 1R9TB 4FF1A 4H7BA 2A68C 2I46A 1G6PA 2JA6B 4LF7Q 3OHXC 2Q8IB 2CKZB 1AH9A 4DUYQ 3BG3A 2F0MA 4BA2I 1JWUD 1TS3A 2D0OA 4DUZL 4KHPL 1LTGD 3A55A 1STGA 3BDOA 4X65L 3CCMA 2F0DA 4DV0Q 4JI7Q 2G5DA 1ENCA 4L63B 4JC0A 5T1GA 3A8JE 5IP7G 3B6YA 3NE5B 2V4DA 1XWEA 4CJ0B 1GM5A 2F0PA 2TSSA 4JBWA 4F88A 1IYUA 1HNXL 3J81j 5IGCA 3CRLC 1M1KC 1L1OC 3GTQH 5IODA 1RDPD 4PG3A 4OONA 1G2SA 2N3SA 1L1OA 3JC66 1LTID 1J6QA 4A3MH 4X3KA 4C3HG 3G6JB 1KNEA 4NDXA 3GTGB 1IW7C 4K2LA 3H15A 4APVA 4ALPA 2A6HD 4EQNA 2MO1A 3PV0A 2PW5A 4QIWB 1FL0A 4DXFA 4U68A 4A3KB 1Y1VG 1KQSA 3HOZG 1W6JA 5IT9E 4DV3Q 1I3QB 1RKNA 2K7VA 1S5CD 5C3EG 1JC7A 3P75A 5J1ZA 4MN3A 1GUTA 3J80i 3GO5A 1PRTD 4QMGA 5IP9H 5C44H 2HD3A 2MHVA 2VQFQ 1ET6A 4A3IB 4AIMA 1PH5A 4B08A 1D6EC 3IFTA 5ELFA 2NZHA 1VS0A 2NYZD 3M4QA 1I4QA 3LWEA 3L2PA 1TWGB 2WP8J 4DNTB 3P1HA 2MUYA 5ELEA 1JICA 3X3NA 1F2LA 3GTMH 3A74A 4DR4Q 1HCZA 1HZBA 4XDXA 1JE5A 1TY2A 5A2QL 3G71A 4OXPA 3BVGA 1QJOA 1CSQA 2F0UA 2HHHL 3AYHB 1VMCA 1B8AA 1SYCA 1K73C 1DM0B 5ELCA 2HIXA 4IJLA 5IP7H 1YNNC 1CTMA 4L5RC 4FP5D 5M3MH 5ELNA 3PGZA 4K5VA 2ZJPA 2H5XA 1GKHA 3TEHB 2D9UA 2FJ2A 1FD7D 4KMUC 3TP5A 5E4XA 2FHTA 3S1RB 3SHLA 2AQ3B 3BZKA 1JOOA 5LMNL 5DM63 5IYDG 1U4LA 2RHQB 4ABNA 3O13A 1V1QA 1X3PA 2F0EA 2F0GA 1ILPA 1Y1VH 2DNCA 1CQFA 1MSHA 2DY8A 4XQQA 1ILQA 5CGKA 3HOZH 1RCVD 1HPCA 1KDAA 2TMPA 3CF5A 5AFWA 4HJ7A 1XPOA 1MJEA 2EXDA 4FVMA 2B2WC 5C3EH 4LF7L 3MEHA 5DAUA 2PO4A 4R8IA 3NBIA 1O7IA 4DUYL 4A3EB 2SNSA 1Y8NB 1SNQA 4NKLA 1PRTF 4BS9A 1EWHA 1QVFA 4DV0L 4RGOS 2VZAA 4JI7L 3V2TA 2L11A 1VQPA 1EY0A 5C4HA 3ULJA 5D14A 4IUPA 1YITA 2B63B 2NWGA 2F0JA 4L5TA 4KV6A 3K5LA 4EQ5A 1B1ZA 4RWSC 2A1AA 1OXUA 1Z47A 4K5WA 2E2HB 4KTAA 1Y8OB 3A8KE 2AWOA 3HKZE 5EBDA 5GAGC 1Y1WG 2QDLA 3GTKH 2ASBA 3S2DB 3MEFA 3RR5A 1ML0D 1PZKD 1DXMA 5EPLA 3ULLA 1E0BA 3ITPA 1HRJA 1UE7A 1DD2A 4IURA 4UDUC 2AWNA 2YU9H 1VQMA 1PDQA 3A5ZB 4RG1A 1VQJA 2ICIA 4ZK9B 2F0NA 2RA4A 2UXCL 3MAQA 3NP8A 2Q2HA 1NSNS 4DV4Q 4RH6A 3D6CA 4DV3L 2WB1G 1EEFD 5M9OA 1A3UA 5DLQE 3TBIB 1CKNA 3NENA 3M4PA 3ONAB 4ME5A 1UAPA 1WFQA 5IYDH 1NNXA 1C7YA 1A3VA 1NBWA 2VQFL 2F0IA 2K5QA 3EBEA 5I4DA 3MZ5A 3J81E 1X54A 1LTSD 5GAHC 2XGTA 4LAAA 5C5MA 2A69C 3NWSA 4BY1G 2PZWA 3GTJB 4X62Q 2RCFA 4DR4L 4K5XA 1LTTD 1W3SA 5JPMC 4V190 1RJTA 3U58A 4DV5Q 4LUVA 1NTGA 1LYLA 1X6OA 1VQOA 2RKSA 1GO3E 1M4VA 2K50A 3U50C 1IXRA 5HURA 1IZ6A 4KD3A 5EJWA 1B4OA 2QILA 1PXUA 1GUWA 4WFN3 4L8JA 1EIGA 1QNUA 4DAYB 1D8LA 2NUCA 1XYIA 3H94A 1JR0D 2KHIA 4JG2A 4CDEC 1TKWB 1SE8A 2JA7G 5I6WA 1HFNA 2B2VA 4WORA 4LFBQ 1K8GA 1A2UA 2QA4A 4GOPA 1DJRD 1JT8A 3A0JA 1E3PA 3DUZA 1AP0A 4JI0Q 3OOCA 1GHKA 3CCEA 1TWHB 1HFGA 4KJOA 1SROA 3R8BA 3NHHA 3CRKC 3S9WA 3F8TA 2F0SA 2OXPA 1XNRQ 4K14A 4ZUIA 3HOVG 5JEAJ 1YVCA 5J22A 2F0HA 2Y0SE 1XTDA 1NUCA 3I56A 1PA6A 1ZEQX 1SR3A 2FMCA 5ELDA 4Y7NB 4LFCQ 1U5KA 2RQXA 2IX3A 2NVXB 4IPHA 5CV9A 3CPFA 4XQNA 4HTHA 4CDFC 1GJXA 3HEJA 1JB7A 2JE6I 5IIFA 2EY5A 3JAMi 4HJ5A 4G57A 1I6VC 2NVTH 3RN5A 2B2YC 1SMYD 3OIQA 4FF3A 1JWSD 5CV8A 2OT2A 2DJGC 2PYKA 3BYYB 4S3SA 2B2YA 1PH3A 3S15H 3OSOA 3PO2G 4BY1H 1EU3A 2KBNA 1E1OA 1H9RA 3WWVA 1B50A 4OHJA 3A8IE 2IT1A 1EY8A 3VYSA 4QCLA 3GV3A 4A3DB 1FNVA 1BKBA 2Z0SA 4FXDA 4JI4Q 3M3YH 1F77A 5FJ8H 4G7HC 1BNZA 3CCRA 1PH9A 2UUAQ 1I4XA 1MHWC 2ID0A 4WRDA 3A56A 2PQAB 3OTOQ 2HDMA 3HOYB 4IOAA 4RCNA 1VQNA 2MJ8A 1HQRD 1EUJA 2KEEA 3S1QB 1PYWD 4DR7Q 3I73A 3S16B 4IFDH 3DHQA 2PCFB 5C0XJ 3GTPB 1DZ1A 1AEXA 4UHVA 5GAEC 4DV4L 3PUWA 1QWYA 2BH8A 1V8QA 2K5NA 4A3GB 3J81L 4ZCKA 1MSGA 1LABA 4EX5A 1Y8PB 4P71A 1YNXA 1PV4A 3HOVH 1D5XC 4DR3Q 3PF5A 4LUOA 5KNCA 4IZ8A 5M5WH 2F4VQ 1EFID 5JOBA 1D5MC 3STBC 3H6MA 2J0TD 3N6RA 2EY1A 4LF8Q 3PMFA 3S2HB 4GLXA 3T1HQ 3UE0A 4X62L 1B9NA 4NXNQ 2Z6KC 4WJ3M 1BOSA 1IYJB 5C4XB 3T1YQ 2PW7A 3KLWA 3L0OA 3HOUG 4C1NK 1RD9D 4J6HA 4C1NI 3FPPA 3H0GB 2ATWA 3GTOH 2M9VA 1B7YB 3CW2C 5CBEE 3FKIG 3G7LA 1BBXC 1YZ6A 2EYHA 2LFNA 3I55A 1GUGA 1X65A 2KCNA 1PH6A 4DAMA 1E22A 4LFBL 2EZVA 3X3MA 3MTSA 4IUTA 2E2JH 2K4KA 4IFDI 2OWOA 1STHA 4GZYC 5G3LD 1TWAH 1MGSA 4JI0L 3CPWA 2X6LA 1VQHA 1X3GA 1EY5A 3BJUA 4EQOA 1KL9A 2H4OA 1KXLA 4OIKA 3HG9A 1VQ6A 3D4WA 4LFAQ 4MIUA 1SDFA 1XNRL 3TREA 1SFOH 5J39A 3HFZB 1K9MC 3M9BA 1H9SB 2HUGA 4NXMQ 2K5VA 2KCMA 1F2MA 4LFCL 4XXEA 2PPBC 2JYOA 5M5YH 1WTOA 4K0KQ 4DNIA 3UE1A 1IBKQ 2B2UA 1ZYRD 3KF6A 4JI5Q 1K8OA 2IWHA 3TMEA 1I94L 1DYQA 3HGBA 1SEBD 3KOJA 2NTTA 3UDXA 2E5LQ 4BY7G 4DV6Q 1WTHA 3QIAA 2J4XA 1Q8IA 3RZDH 1IBLQ 4C3IG 4LF5L 3I4NH 1II3A 2G9DA 3EFXD 2KCTA 1GUOA 4YCVA 3DXJC 3GP7A 2RBMA 1I50B 3NBHA 4KHZA 3HOUH 3NTIA 1AN8A 3HKZG 4H02A 4C56C 4O0AA 4JI4L 1HUMA 3OWEB 3D4RA 1TWFH 4HJ9A 1LACA 2BDOA 2UUAL 2NBFA 3FKIH 3OTOL 4CKEA 2XVSA 1ONLA 2HQLA 1EY7A 2VNUD 4LW1A 4R4QA 1QCBD 1WTVA 1BO0A 4DR7L 5IGDA 2F52A 1G2TA 2JA8G 5FOBB 1HTPA 3HOXH 1LV9A 5FO8B 5E3FA 2WB1E 3N52A 5FKAC 1I4PA 5G3LF 1HZAA 2BA0A 2N8NA 4P74A 2JA6G 1ICFB 1C4QA 1NAPA 1YHAA 4IUUA 1RIPA 2PMZE 5EBCA 3I7FA 5IY0A 1A62A 4DR3L 5EAYA 1G91A 2JA9A 4TRDA 2F4VL 5ELBA 4LF8L 1QVGA 3G48A 3Q8DA 5CV7A 2A8VA 1K8AC 3S14H 2NB0A 2OQKA 2R92B 4DAVA 3T56B 4MZ9A 4EGVA 4RGNA 1KTKA 4RCOA 4NXNL 3BYTB 3T1YL 3VR5A 1J9OA 3C1FA 3GTLH 1V1PA 1SNCA 2EPBA 3KLSA 4X66Q 4BY7H 4C2MB 2DGYA 4B3MQ 4FF2A 2IHEA 2UU9Q 4GNXA 1TU2B 4C3IH 4ULLA 4BXXG 5A2QE 5IGEA 4GLVB 2BE5C 1B3QA 2CQAA 1IHZA 3W2DA 5DM73 4JI3Q 1JORA 5EKLA 4KK7A 4FXKC 3K6OA 3CMEA 4DN4M 2VQEL 3KBXA 1BDOA 3CHBD 3K8AA 4A3KG 5CC4A 2PZUA 2OCEA 4B3SQ 2M00A 1NMFA 5D65A 4YY3Q 4LFAL 1FJGQ 1N33Q 3J7YW 1Q12A 2O5IC 4F7XA 2K33A 2CWPA 1CM9A 1IL2A 4OL7A 3SK4A 2JA8H 1H9KA 2VY3A 4A3FB 3M7NA 4KKSA 3HOWH 4CKCA 4NXML 2XN9C 3KDFA 4CHTB 4DK0A 4N8FA 5FLXL 5E4WC 1Q7YC 3DWQA 4K0KL 3PF4A 3NWTA 1R9TH 1IBKL 1I6HH 4JI5L 1LT6D 2JA6H 3DMUA 1QB5D 1N34Q 2A6HC 1V1OA 2E5LL 1FVIA 1CT1D 1STNA 4XT3B 1IBLL 3RZOH 3FEWX 4JVZA 3UDFA 4DV7Q 4R4IA 1B3AA 3PIOA 4JOIC 1BUVT 1PTOD 1VF7A 3DWPA 4JOIA 1J5EQ 1UE1A 2EYOA 1JWMD 1GUNA 1RTNA 1PRTC 2IW3A 1U9RA 4UP8A 3ULPA 3DM1A 4F87A 4XTCS 4A75A 1O7ZA 3GTQB 4BXXH 1PVOA 2L1BA 1EY9A 1YHBA 3SDZA 4PZ8A 1EY4A 1XMOQ 4A3BB 1CA6A 2EY6A 4HCEA 3RN2A 4A3MB 3BU2A 1VCIA 4JYAQ 2HQEA 1HR0W 4A3KH 5IGBA 1K3RA 4A3JG 4A93B 2EYMA 2B8GA 1Q3LA 4JBJA 1N8RC 4AYBE 4HIKA 2F0VA 1MD2D 5IGFA 2NVQH 3V05A 3IL8A 4Q5VA 3OMGA 4A3EG 5JVG3 4PMWA 1KNAA 3K0XA 1FNUA 5M5XB 3RLNA 4I65A 5C44B 2E75C 3LWUA 3NSWA 5BR8Q 1O7YA 1TWGH 3OMCA 4LUZA 2WAQB 2K03A 3K81C 4P2CB 4NB3A 4OIJA 4X66L 1VQ4A 4AQYQ 5CMDA 4B3ML 3CKIB 3L9AX 3UDGA 3GTMB 2UU9L 2F3IA 4X3UA 2F1MA 4ZYSA 1DOMA 2N78A 2KHJA 1XNQQ 3VR6A 1X3EA 2D0PA 1KLUD 1ZKOA 4JI3L 2E8GA 1P8LA 4QJFA 1L0WA 2B29A 1PTOF 2F0OA 1S5ED 2N49A 3VA5A 4IOCA 3J81i 1NR2A 4KKUA 4RMFA 3AFPA 4YWMA 3VR2A 4C3HH 5M3MB 1LT3D 4BBRB 4K2KA 1S3OA 1PH1A 1NJIC 4R8NA 2C35B 4DKAC 4B3SL 1GD7A 2BOSA 1S40A 4YY3L 3PUVA 1FJGL 1N33L 3U9OA 2WKDA 2ZXPA 3I90A 1AE2A 4IQZA 5FLXc 2WKCA 1KAAA 3T53B 3U4VA 4GLAC 4A3JH 3VR3A 5KRUA 2NZOA 3D8GA 2F0WA 2B2WA 3CQZH 3HOZB 4CJ2C 3PIO3 3MXNA 1N34L 1EZ8A 4N9PA 1D1KA 4A3EH 4OGQC 5C4JH 5JEAG 4G7OC 4CBVA 5C3EB 1HUNA 4DV7L 3M4OH 3W1BA 1SYGA 1STAA 4HJ8A 3E3XA 1Z9FA 1YJWA 1A6XA 3I91A 4PZ6A 2J7ZA 2ZJQA 1E24A 3EJIA 3K0YA 3CC2A 2E2HH 4GKJQ 3HS0C 1XPRA 2LSSA 1YI2A 1BBUA 5H1SE 1A0IA 1XTCD 4HCSA 3RD4A 3S2DH 2LKVA 1JMCA 3H3VC 1XMOL 5JJLA 5IGGA 1GUSA 4PNYA 3EROA 4JYAL 4K6LA 2EJGC 4LF6Q 5CV4A 2MNAA 2IJ0A 1M90C 2K01A 1PFMA 2L15A 1U4MA 1UWVA 3E9IA 1JJ2A 4EVOA 4FF4A 3QOLA 5ISRA 2A5HA 1NY4A 1O80A 3S1MH 4OELB 1I4HA 1ASZA 1CUKA 1YNJC 1LTLA 5CV6A 4GOPB 4DR6Q 3OW2A 2MPMA 4H0LC 2IX0A 2CW0D 5HGQA 1BCPB 3AU7A 2JK8A 5BR8L 1PZID 1PMRA 3CXCA 1ENAA 3HKSA 2NVYH 1G291 1LM0A 4RHRA 3GTJH 1CI3M 3M4YA 4H44C 2R7ZB 1UEAB 3D31A 1C48A 1QUQA 1XMQQ 1SSOA 3TP8A 5JEAH 4AQYL 4A3DG 3PQIA 4JBKA 2EYFA 3NQTA 2D62A 2O4XA 4K8IA 4Z9CB 3J7AV 1TWCH 1XNQL 3ZJYC 2UXDQ 2A6EC 3HOYG 2YTYA 4CGYB 3NEMA 3AMUA 1Q46A 4F8MA 4QIWE 1EU4A 4WJWA 1Y1WH 2R61A 4GN5A 1I4GA 1JQYD 1SMYC 1YEZA 3PSIA 3F2BA 4ZAIA 1BBWA 5I9PA 2M2LA 3SE0A 3VYUA 4UP7A 1D1IA 4AH6A 1KAWA 4DR2Q 1N32Q 1U0LA 1W2BA 3EVQA 5EPJA 2A69D 1STEA 1EWIA 1XPUA 2D2CC 3NK9A 1WTXA 2C5CA 2NN6G 1HZCA 4O1NA 3EA6A 1AZPA 1F2ZA 1X3FA 3TDQA 4LMQD 3NUCA 3QO2A 2Z4HA 2G9HD 3FVQA 5LMUQ 1LTRD 1NCVA 3S1NB 4KY6A 3KJPA 3K7UC 1FNWA 3H0GG 1BCPD 4BBSB 1AE3A 3IAYA 2NVTB 2Z4IA 1OO9B 2A19A 1ESRA 1EZ6A 1VF5C 1U4RA 1TR5A 3J80L 2R93G 5FLMG 3E6ZX 2B2TC 3S15B 1WI5A 2CHBD 4BY1B 4A3DH 1GVPA 2EIFA 4GKJL 5GADC 5LL6S 4YCWA 4CKBA 2Z9HA 4J1MA 3SGIA 3D4DA 2K05A 3HOYH 2JA7H 1IYVA 4C3JG 4XIGS 1DGSA 1E2WA 2CQOA 2GN5A 1EYGA 3OW7A 3M85A 3BVZA 1Y14B 1SNDA 2BA1A 4X3TA 1Y69U 4G4KA 5IYCG 4LF6L 4KJNA 3VYRA 3GTPH 1EYDA 2KQ3A 4ZLTF 4AYBG 2R3ZA 4HMJA 5LMNW 4JI2Q 2EYLA 2E2IB 2QKIC 2ES2A 5M3FB 1OXTA 3UI2A 3GQBA 1OXSC 4DR6L 2JQOA 1WCMG
chains in the Genus database with same CATH topology
3PO3B 1D2BA 1BQQT 4M8AA 4HSPA 3MXPA 3FPUB 3NXWA 4U673 2NN6H 2RDGA 3Q6SA 2RDFA 5M5WB 4K6DA 4RGTA 4M1UB 3GD7A 4LJZC 3IKJA 4LK1C 3R2IA 2ZT9C 3I4MB 4IFDJ 1BCPF 2QDBA 3NQIA 5C6AA 2E74C 4IALA 2FINB 3GTOB 1SAPA 2LY7A 4JK1C 4J8QA 2QF7A 1HA6A 4FXGC 1IKLA 5BN5A 3RMHA 5KYLA 2WACA 2E2JB 3D6WA 1TWAB 2F0LA 5LL6X 2XIWA 1JB3A 2RDHA 2AUJD 1SNPA 5FO9B 4HAEA 3TP7A 1SFOB 2JEAI 1F9PA 2NN6I 3MFGA 1NR4A 2JEBI 3SK6A 3Q22A 5FLXE 5M5YB 2X6GA 3H09A 4H13C 1B2TA 2MP1A 1SE3A 3K7AB 3ZYYX 1IL8A 2VB3X 2PQEA 5FO7B 2B8FA 4YIJA 2MGSA 4G7ZC 1X32A 1SNOA 1QG7A 3I4NB 2VUMB 2JA5B 2OEOA 3SR1A 2JP1A 4QUCA 3HOUB 2EXZA 1HA5A 3LNNA 1WD0A 2EJFC 1Z7TA 4DU9A 3K57A 3FKIB 5I6YA 1V1PB 4XQJA 2PNRC 1G6ZA 4L6TB 2LS01 1HHVA 5CV5A 1HQMC 1F9RA 3P20A 1HTLD 2XRSD 3I4LA 3HOXB 2QCPX 5C5LA 2L12A 1Q1EA 3Q23A 2SDFA 1CZGA 3HP3A 1E2VA 3FDTA 5E1FA 2IX1A 1SBBB 1K83B 5JPNC 1AFPA 1PTOB 1B53A 1JOQA 1F9QA 1RHPA 3KF8A 2O5JC 1LTAD 4ZQ3A 3WDNA 4PQXA 5DEHA 4IUVA 3I8ZA 1LLRD 1SJED 1T5XD 3MC0B 3GTLB 3C1EA 4BY7B 2WINB 3E0JA 2DY7A 3K5OA 4NP5A 3LX0A 4NMZA 5KNBA 1U4PA 1IKMA 1PLFA 3C3LA 1ESFA 3HKZB 2BDNA 1D5ZC 3SK8A 4Q0FA 2NZ1D 5EPKA 3BS1A 3T16A 1DOLA 1KABA 5D3DA 5A35A 2ZXRA 2E76C 3Q24A 3HOWB 3R2TA 1CA5A 2A74C 3QJYA 4OO1G 2BE5D 4CJ1B 1I6HB 3ERQA 1A2TA 4X3SA 5COYA 3WOFA 4ZKBB 3L3OC 2AUKA 3A7LA 5HGTA 3BVMA 2CVRA 3IFDA 2LMCB 3RZOB 5C3XA 3SVMA 1FYCA 2HCIA 2KUMA 1KDCA 1JOKA 2VXWA 3NTKA 1SYEA 1A3TA 1STBA 4ODGA 2KOLA 4DA2A 1VMPA 2A68D 1SYBA 3K59A 3BZDB 2K5DA 2F0FA 1QOHA 2Q8TA 1S5DD 1G8ZD 3ND9A 1T5EA 4PMCA 1TS4A 1SYDA 3MXUA 1BF4A 2EJMA 4DK1A 1S5FD 2SNMA 1L0YB 2NVQB 1WTRA 1EYAA 2KCCA 1WD1A 2RSOA 1S4ZA 2Y0SB 5C3WA 2NTSA 3F2UA 1O78A 1ET9A 3QOJA 1LTBD 2C9OA 1IW7D 4OO1H 1JCKB 4RHSA 2D5DA 1STYA 1EWCA 2F03A 3BDLA 3U9SA 5C4ZA 3HZXA 2KHSA 1CQVA 3KBGA 1SJHD 5CR3A 2X69A 2FMMA 2A73B 5KNDA 5K36G 2K5WA 4C3HB 4ZRZA 1TS5A 4DNRB 3T51B 5D3IB 3E5SA 1CFMA 4TSSA 3MVVA 1Y1VB 2OF1A 3QB3A 4KI0A 2ICEC 1JE4A 4ZKCB 4A3JB 1YNND 5JAVA 4RAUC 5FK9C 1B44D 4OO1I 4RKLA 5EKKA 3CQZB 1TY0A 3SXHA 4PMBA 3QWNA 5C4JB 2KA7A 5IOCA 2WV6D 4XYOA 1RTOA 2K32A 3OPOA 3M4OB 5EGTA 1WTPA 4TQUS 2XSCA 3MFYA 3H91A 1O7LA 5K5PA 2CW0C 2IPKD 1OXVA 3TSSA 4FYDA 1DCZA 3J80E 4RA8A 1Q90A 3GTKB 1F2YA 2FFKB 2KJXA 4IN3A 3J7AF 3AB9A 2JXMB 1WTQA 2YU9B 3M7GA 5IT9L 1Z6HA 4DFAA 3MXGA 3GV6A 1RODA 3A54A 5K36H 2IL8A 1C8CA 3NTHA 4DAPA 2EYJA 5BN3A 3FMCA 5C0XG 1SNMA 1X3QA 5CORA 3TZDA 3S1MB 1EY6A 2L55A 4ILWA 1TQOA 1HXYD 1GOZA 2NVYB 1VDZA 1TIID 2ENBA 1W6KA 1F9SA 1XXGA 1BXTA 5LHY1 1GXDC 1TWCB 4V0BA 2HCCA 1LO5D 2B2VC 3DEOA 1DONA 1BCPC 4HMIA 2K1BA 1Y1WB 1YNJD 3HRZC 1KLGD 4N9TA 4IFDG 1EQTA 4DF7A 2AQ1B 4KN4C 4BWGB 5KIXA 1A15A 3C2PA 3T13A 2SEBD 2XWJB 1DOKA 1QE6A 2WB1B 5KGUA 4DAYA 5C0XH 1M8AA 2L0CA 1K8MA 2A6ED 2EY2A 2PMZB 3R93A 2H1EA 2EE1A 4UAIA 1CZWA 1WVLA 2EVBA 4K8JA 4E6IA 1XX8A 2B2TA 4DXGA 3TN2A 2EYPA 1ENFA 3KK7A 3M3YB 4IUNA 4FO2A 1OXXK 3R3OA 3I72A 5KYIA 5F2DA 2JA7B 1L0XB 2SOBA 4RFBA 3URYA 5EQ0A 1EOTA 2BCOA 2XRQD 3P7JA 2RVLA 1J8IA 2KEDA 2KVMA 2Z8LA 5C0XI 1Q1BA 2PZTA 2KECA 3HOVB 1EQVA 3WOEA 1CHQD 5DNFA 2Z1CA 3K5MA 2RSNA 3ND8A 3Q0AA 1WTWA 4KHVA 1R4QB 3SK5A 1I4RA 5CYUA 2N55A 3CU7A 4XT1B 2ZXOA 3PUXA 4HR7B 3I70A 5CBAE 3DWAA 3OIPA 1ZYRC 2EOTA 3K58A 1TS2A 5BN4A 2N88A 3QG1A 3PO2B 4KKTA 4XYQA 5I9OA 3A7AB 1EIHA 4HEDA 2K28A 3K5NA 3KLSX 1ZXTA 3L7ZC 3BDCA 1EYCA 2L4NA 2R93B 2YYZA 3JAME 2Q8RE 4B9WA 3RUZA 1PFBA 1LT5D 2B39A 1SYFA 2F3WA 4I7ZC 1SE4A 5I2YA 1R4PB 2F4IA 4C3JB 2VB2X 2F0KA 2HDLA 1H9MA 4DGZA 5I2XA 2B2UC 3W3AA 4QB4A 4NW2A 2I07B 4AYBB 1UNSA 5JVH3 4KY7A 1EL0A 3RZDB 1WCMB 4HN7A 3T4AC 2AQ2B 4MHEA 5EKIA 3OWFA 1H9JA 4O42A 3TP6A 2F3VA 2XWBB 3C46A 3V96A 1H9SA 1TWFB 1TVXA 2L9HA 2O2LD 3I3CA 1AW7A 1UUPA 5T1IA 4TKOB 2R6GA 3MWYW 4KY5A 3KLRA 4ID6A 1BR9A 1FGBD 4QUFA 1MBYA 3VYTA 4FNFA 3PIP3 3MHBA 1GHJA 1QNKA 3VA7A 2EDGA 1AZQA 2GA4B 4BA1I 1B9MA 1PTOH 4IUQA 1V43A 2WIIB 2QEJC 4EQPA 5KEEA 3S14B 2DNEA 5TSSA 1MI2A 1QILA 3SEBA 4QF4A 3NPPA 3DEPA 1LT4D 1KDBA 3D3RA 4C3IB 2F0QA 3JAML 1E2ZA 4RGMA 2DN8A 4PV1C 3EQLC 1RF2D 1EEID 2F0TA 1SE2A 2XNAC 1PFNA 3MA2B 1CHPD 1FR3A 1PZJD 1SXTA 4HSVA 3VR4A 3S17B 5NUCA 1PTOC 2JSOA 4KD4A 1ICWA 3PUZA 3TZUA 2L5TA 1CK1A 2E2DC 1S5BD 4KN7C 5JJZA 4R9WA 3FRPB 1PRTB 4ZUJA 4B9XA 2JA8B 4RKBA 3KUPA 2K6AA 1TT2A 2K04A 3PUYA 3RLFA 1R9TB 4FF1A 4H7BA 2A68C 2I46A 2JA6B 3OHXC 2Q8IB 3BG3A 2F0MA 4BA2I 1JWUD 1TS3A 1LTGD 3A55A 1STGA 3BDOA 2F0DA 1ENCA 4L63B 5T1GA 3A8JE 3NE5B 2V4DA 4CJ0B 1XWEA 2F0PA 2TSSA 4JBWA 4F88A 1IYUA 5IGCA 3CRLC 5IODA 1RDPD 1G2SA 1LTID 4X3KA 4C3HG 3G6JB 1KNEA 4NDXA 3GTGB 1IW7C 4K2LA 2A6HD 4EQNA 3PV0A 2PW5A 4QIWB 4DXFA 4U68A 4A3KB 1W6JA 5IT9E 1I3QB 1RKNA 2K7VA 1S5CD 1JC7A 3P75A 5J1ZA 4MN3A 1GUTA 3GO5A 4QMGA 1PRTD 2MHVA 1ET6A 4A3IB 4B08A 1D6EC 3IFTA 5ELFA 2NYZD 1I4QA 3LWEA 1TWGB 2WP8J 4DNTB 3P1HA 2MUYA 5ELEA 1JICA 3X3NA 1F2LA 1HCZA 4XDXA 1TY2A 5A2QL 3BVGA 1QJOA 2F0UA 1VMCA 1SYCA 1DM0B 5ELCA 1YNNC 1CTMA 4FP5D 4K5VA 2D9UA 2FJ2A 1FD7D 4KMUC 3TP5A 5E4XA 2FHTA 3S1RB 3SHLA 2AQ3B 1JOOA 5DM63 1U4LA 4ABNA 3O13A 2F0GA 1X3PA 2F0EA 1ILPA 2DNCA 1CQFA 1MSHA 2DY8A 4XQQA 1ILQA 5CGKA 1RCVD 1HPCA 1KDAA 2TMPA 5AFWA 4FVMA 2B2WC 3MEHA 5DAUA 2PO4A 4R8IA 3NBIA 4A3EB 2SNSA 1Y8NB 1SNQA 4NKLA 1PRTF 4BS9A 1EWHA 4RGOS 3V2TA 2L11A 1EY0A 5C4HA 5D14A 4IUPA 2B63B 2NWGA 2F0JA 3K5LA 4KV6A 1B1ZA 4RWSC 1OXUA 1Z47A 4K5WA 2E2HB 4KTAA 1Y8OB 3A8KE 2AWOA 5EBDA 3S2DB 1ML0D 1PZKD 1DXMA 5EPLA 1E0BA 3ITPA 1HRJA 1DD2A 4IURA 4UDUC 2AWNA 1PDQA 2ICIA 4ZK9B 2F0NA 2RA4A 3MAQA 3NP8A 1NSNS 4RH6A 3D6CA 5M9OA 1EEFD 1A3UA 3TBIB 3ONAB 4ME5A 1UAPA 1A3VA 2F0IA 2K5QA 5I4DA 3MZ5A 3J81E 1LTSD 4LAAA 5C5MA 2A69C 3NWSA 2PZWA 3GTJB 4K5XA 1LTTD 5JPMC 4V190 1RJTA 2RKSA 1M4VA 5HURA 4KD3A 5EJWA 1B4OA 2QILA 1PXUA 1GUWA 4WFN3 4L8JA 1EIGA 1QNUA 2NUCA 1XYIA 3H94A 1JR0D 1TKWB 1HFNA 5I6WA 2B2VA 4WORA 1A2UA 1DJRD 3DUZA 1AP0A 3OOCA 1GHKA 1TWHB 1HFGA 4KJOA 3R8BA 3NHHA 3CRKC 3S9WA 2F0SA 2OXPA 4K14A 4ZUIA 5JEAJ 5J22A 2F0HA 1NUCA 1ZEQX 2FMCA 4Y7NB 5ELDA 2RQXA 2IX3A 2NVXB 5CV9A 4XQNA 4HTHA 1GJXA 3HEJA 2JE6I 5IIFA 2EY5A 4G57A 1I6VC 2B2YC 1SMYD 3OIQA 4FF3A 1JWSD 5CV8A 2OT2A 2PYKA 3BYYB 4S3SA 2B2YA 3OSOA 1EU3A 1H9RA 1B50A 4OHJA 3A8IE 2IT1A 1EY8A 3VYSA 4QCLA 3GV3A 4A3DB 1FNVA 4FXDA 1F77A 4G7HC 1BNZA 1I4XA 3HOYB 2ID0A 4WRDA 3A56A 2HDMA 4RCNA 2MJ8A 1HQRD 2KEEA 3S1QB 1PYWD 3I73A 3S16B 4IFDH 3DHQA 2PCFB 5C0XJ 3GTPB 1DZ1A 1AEXA 3PUWA 1QWYA 1V8QA 4A3GB 3J81L 1MSGA 1LABA 1Y8PB 1D5XC 5KNCA 4IZ8A 1EFID 5JOBA 1D5MC 3H6MA 2J0TD 3N6RA 2EY1A 3PMFA 3S2HB 1B9NA 1BOSA 5C4XB 2PW7A 4C1NK 1RD9D 4J6HA 4C1NI 3FPPA 3H0GB 2M9VA 5CBEE 3G7LA 1BBXC 2EYHA 2LFNA 1GUGA 2KCNA 2EZVA 3X3MA 3MTSA 4IUTA 4IFDI 1STHA 4GZYC 5G3LD 1MGSA 2X6LA 1EY5A 4EQOA 2H4OA 4OIKA 3HG9A 3D4WA 4MIUA 1SDFA 5J39A 1H9SB 2HUGA 1F2MA 4XXEA 2PPBC 2JYOA 1WTOA 2B2UA 1ZYRD 1K8OA 2IWHA 3TMEA 1DYQA 3HGBA 1SEBD 2NTTA 3QIAA 2J4XA 1Q8IA 4C3IG 1II3A 2G9DA 3EFXD 1GUOA 3DXJC 3GP7A 2RBMA 1I50B 3NBHA 4KHZA 3NTIA 1AN8A 4C56C 1HUMA 3OWEB 3D4RA 1LACA 2BDOA 2NBFA 4CKEA 2XVSA 1ONLA 1EY7A 2VNUD 1QCBD 1WTVA 1BO0A 5IGDA 1G2TA 5FOBB 1HTPA 1LV9A 5FO8B 5E3FA 3N52A 5FKAC 1I4PA 5G3LF 2BA0A 1C4QA 1NAPA 4IUUA 5EBCA 1G91A 4TRDA 5ELBA 5CV7A 2NB0A 2R92B 4DAVA 3T56B 4EGVA 4RGNA 1KTKA 4RCOA 3BYTB 3VR5A 1J9OA 3C1FA 1V1PA 1SNCA 2EPBA 3KLSA 4C2MB 4FF2A 1TU2B 4ULLA 5A2QE 5IGEA 2BE5C 2CQAA 1IHZA 3W2DA 5DM73 1JORA 5EKLA 4KK7A 4FXKC 3K6OA 4DN4M 3KBXA 1BDOA 3CHBD 5CC4A 2PZUA 2M00A 5D65A 3J7YW 1Q12A 2O5IC 4F7XA 2K33A 1CM9A 4OL7A 3SK4A 3M7NA 1H9KA 4A3FB 4KKSA 4CKCA 2XN9C 4CHTB 4DK0A 5FLXL 5E4WC 3DWQA 3NWTA 1LT6D 3DMUA 1QB5D 2A6HC 1V1OA 1CT1D 1STNA 4XT3B 3FEWX 1B3AA 1BUVT 1PTOD 1VF7A 3DWPA 2EYOA 1JWMD 1GUNA 1RTNA 1PRTC 2IW3A 1U9RA 3DM1A 4F87A 4XTCS 1O7ZA 3GTQB 2L1BA 1EY9A 3SDZA 1EY4A 4A3BB 1CA6A 2EY6A 4HCEA 4A3MB 1VCIA 2HQEA 5IGBA 4A93B 2EYMA 2B8GA 1Q3LA 2F0VA 1MD2D 5IGFA 3V05A 3IL8A 4Q5VA 3OMGA 5JVG3 4PMWA 1KNAA 1FNUA 5M5XB 4I65A 5C44B 2E75C 3LWUA 3NSWA 1O7YA 3OMCA 2WAQB 2K03A 4P2CB 4OIJA 5CMDA 3CKIB 3L9AX 3GTMB 4X3UA 2F1MA 4ZYSA 1DOMA 3VR6A 1KLUD 1ZKOA 1PTOF 2F0OA 1S5ED 3VA5A 1NR2A 4KKUA 3VR2A 5M3MB 1LT3D 4BBRB 4K2KA 4R8NA 2BOSA 3PUVA 3U9OA 2WKDA 2ZXPA 3I90A 4IQZA 2WKCA 1KAAA 3T53B 3VR3A 5KRUA 3D8GA 2F0WA 2B2WA 3HOZB 4CJ2C 3PIO3 3MXNA 1EZ8A 4N9PA 1D1KA 4OGQC 5JEAG 4G7OC 4CBVA 5C3EB 1HUNA 1SYGA 1STAA 1A6XA 3I91A 2J7ZA 3EJIA 3K0YA 3HS0C 1XTCD 4HCSA 3RD4A 2LKVA 3H3VC 5IGGA 1GUSA 4PNYA 3EROA 4K6LA 2EJGC 5CV4A 2IJ0A 2K01A 1PFMA 1U4MA 4EVOA 4FF4A 3QOLA 5ISRA 2A5HA 1O80A 1I4HA 1YNJC 5CV6A 2MPMA 4H0LC 2IX0A 2CW0D 1BCPB 3AU7A 1PZID 1PMRA 1ENAA 1G291 4RHRA 1CI3M 3M4YA 4H44C 2R7ZB 1UEAB 3D31A 1C48A 1SSOA 3TP8A 5JEAH 2EYFA 3NQTA 2D62A 2O4XA 4K8IA 4Z9CB 3J7AV 2A6EC 4CGYB 3AMUA 4F8MA 1EU4A 4WJWA 2R61A 1I4GA 1JQYD 1SMYC 4ZAIA 5I9PA 2M2LA 3SE0A 3VYUA 1D1IA 3EVQA 5EPJA 2A69D 1STEA 2D2CC 3NK9A 1WTXA 2C5CA 2NN6G 4O1NA 3EA6A 1AZPA 1F2ZA 3TDQA 4LMQD 3NUCA 3QO2A 2Z4HA 2G9HD 3FVQA 1LTRD 1NCVA 3S1NB 4KY6A 1FNWA 1BCPD 4BBSB 3IAYA 2NVTB 2Z4IA 1OO9B 1ESRA 1EZ6A 1VF5C 1U4RA 1TR5A 3J80L 3E6ZX 2B2TC 3S15B 2CHBD 4BY1B 5LL6S 4CKBA 4J1MA 3D4DA 2K05A 1IYVA 4C3JG 4XIGS 1E2WA 3OW7A 3M85A 3BVZA 1Y69U 1SNDA 2BA1A 4X3TA 4G4KA 4KJNA 3VYRA 1EYDA 2KQ3A 4ZLTF 2R3ZA 4HMJA 2EYLA 2E2IB 2QKIC 5M3FB 1OXTA 3UI2A 3GQBA 1OXSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TRD A;  2EXZ A;  2F0W A;  5CV9 A;  4DGZ A;  1EY9 A;  4HTH A;  4QB4 A;  4DU9 A;  3HEJ A;  3MXP A;  3NXW A;  1EY4 A;  5CR3 A;  5IIF A;  1EZ8 A;  1EY6 A;  3ITP A;  1STH A;  2EY5 A;  3R3O A;  4KY7 A;  4N9P A;  4G57 A;  5NUC A;  5CV7 A;  2RDF A;  5I9P A;  5KYI A;  3ERQ A;  5F2D A;  2EY6 A;  1A2T A;  4KD4 A;  1EY5 A;  3P1H A;  5KYL A;  5I6Y A;  5CV8 A;  4EQO A;  4K6D A;  1TQO A;  2PYK A;  2SOB A;  2F0N A;  2HQE A;  4S3S A;  3C1F A;  3EVQ A;  5HGT A;  3D4W A;  1SYG A;  5IGB A;  3NP8 A;  1SNC A;  2F0U A;  1STA A;  3OSO A;  4MIU A;  5CV5 A;  2EYM A;  3OWF A;  1NSN S;  3D6C A;  5J39 A;  3E5S A;  1SYC A;  5C3X A;  2ENB A;  5M9O A;  4ZUJ A;  1A3U A;  4B9X A;  5C5L A;  4RKB A;  1EY8 A;  2F0V A;  3MVV A;  5IGE A;  3TP6 A;  4ME5 A;  2F3V A;  5IGF A;  3EJI A;  2OF1 A;  2QDB A;  3NK9 A;  1IHZ A;  5C6A A;  1F2M A;  1TT2 A;  1KDC A;  3QB3 A;  4IAL A;  1JOK A;  2PZT A;  3OMG A;  1SYE A;  1A3V A;  1JOR A;  1EQV A;  1A3T A;  1F2Z A;  5E1F A;  5EKL A;  2F0I A;  1STB A;  4H7B A;  4K5V A;  4ODG A;  3NUC A;  5JAV A;  1JOQ A;  2LKV A;  3MZ5 A;  4WRD A;  4I65 A;  4KY6 A;  3TME A;  1SYB A;  4KHV A;  4RKL A;  3SK5 A;  2F0F A;  4HMI A;  4ZQ3 A;  5CC4 A;  2WAC A;  4LAA A;  2PZU A;  4PNY A;  2F0M A;  4KY5 A;  5EKK A;  5C5M A;  2PZW A;  4ID6 A;  4N9T A;  3ERO A;  3OMC A;  3TP5 A;  4K5X A;  5DEH A;  2M00 A;  1STG A;  3DHQ A;  4PMB A;  3SXH A;  2F0D A;  5CV4 A;  4DF7 A;  3S9W A;  2F0L A;  1II3 A;  3SHL A;  5IOC A;  1AEX A;  1ENC A;  1JOO A;  5KIX A;  4PMC A;  3MHB A;  1EZ6 A;  4F7X A;  1TR5 A;  1SYD A;  2RBM A;  2F0P A;  5IGG A;  5EGT A;  4OL7 A;  2RKS A;  3SK4 A;  5IGC A;  4EVO A;  3QOL A;  5ISR A;  3T13 A;  2F0G A;  2F0E A;  5IOD A;  1SNP A;  3C1E A;  5HUR A;  4KD3 A;  5CGK A;  3TP7 A;  5I9O A;  5K5P A;  1KDA A;  2NUC A;  4IUN A;  3LX0 A;  4NP5 A;  5CV6 A;  2F0O A;  4IZ8 A;  4J1M A;  2SNM A;  3VA5 A;  3D4D A;  4NMZ A;  1F2Y A;  5KGU A;  5I6W A;  3MEH A;  5DAU A;  5JOB A;  4WOR A;  1EYA A;  3SK6 A;  3DMU A;  3BDC A;  3H6M A;  1EYC A;  1A2U A;  1EY7 A;  2EY1 A;  3PMF A;  4NDX A;  2SNS A;  1ENA A;  4K2K A;  5C3W A;  1SNQ A;  2EY2 A;  4EQP A;  5KEE A;  4K2L A;  4NKL A;  1SND A;  4R8N A;  1STN A;  3RUZ A;  3QOJ A;  4B9W A;  4EQN A;  4KJO A;  2PQE A;  4DFA A;  4KJN A;  5IGD A;  2PW5 A;  2PW7 A;  4YIJ A;  1EYD A;  3NHH A;  3V2T A;  3SK8 A;  2KQ3 A;  4K8J A;  1SYF A;  2F0S A;  1SNO A;  2F3W A;  2OXP A;  4QF4 A;  5E3F A;  3TP8 A;  3U9O A;  1STY A;  2EYF A;  4E6I A;  4J6H A;  3NQT A;  2O4X A;  1EY0 A;  3BDL A;  4HMJ A;  1KDB A;  2EYL A;  4K14 A;  4K8I A;  4ZUI A;  5C4H A;  1KAA A;  2EYJ A;  3T16 A;  5J22 A;  1RKN A;  5C4Z A;  2EYO A;  1KAB A;  2F0J A;  4KV6 A;  2F0K A;  2F0H A;  2F0Q A;  5J1Z A;  2EYP A;  2OEO A;  3P75 A;  1SNM A;  1U9R A;  3SR1 A;  4F8M A;  1NUC A;  4K5W A;  4KTA A;  3HZX A;  5KRU A;  2EYH A;  4QMG A;  2KHS A;  2F0T A;  3D8G A; 
#chains in the Genus database with same CATH topology
 3PO3 B;  1D2B A;  1BQQ T;  4M8A A;  4HSP A;  1VQD A;  4OWT B;  3MXP A;  3FPU B;  3NXW A;  4U67 3;  2NN6 H;  2WFW A;  2RDG A;  3Q6S A;  2XTI A;  2RDF A;  5M5W B;  2YTV A;  2P5Z X;  4P75 A;  4DV5 L;  4K6D A;  2Z6K A;  4RGT A;  4L5S A;  1QZH A;  4M1U B;  3GD7 A;  4LJZ C;  1UE5 A;  3PO2 H;  3IKJ A;  4LK1 C;  3H0G H;  3R2I A;  2ZT9 C;  1EOV A;  2I5L X;  3F2C A;  3I4M B;  4IFD J;  1BCP F;  4CDD C;  2KEN A;  2QDB A;  3NQI A;  5C6A A;  3KF6 B;  2E74 C;  4IAL A;  2UUC Q;  2FIN B;  3GTO B;  2R93 H;  5FLM H;  1SAP A;  2LY7 A;  1PHJ A;  4JK1 C;  4J8Q A;  2QF7 A;  1HA6 A;  4FXG C;  4A3C G;  1IKL A;  5BN5 A;  3RMH A;  2UUB Q;  2PI2 E;  5KYL A;  2WAC A;  1EIF A;  1H95 A;  1KIX A;  2UXB Q;  2E2J B;  4DR2 L;  1N32 L;  3D6W A;  4C3J H;  5JJK A;  1Q8K A;  1TWA B;  2F0L A;  3I2Z A;  5LL6 X;  1HZ9 A;  3STB D;  2XIW A;  1JB3 A;  4X64 Q;  1VQ9 A;  5IYC H;  1I5F A;  2AUJ D;  2RDH A;  1N9W A;  1SNP A;  3S24 A;  5FO9 B;  4HAE A;  3TP7 A;  1SFO B;  2FXQ A;  2JEA I;  1F9P A;  2NN6 I;  3MFG A;  1NR4 A;  2R92 G;  2JEB I;  3SK6 A;  5LMU L;  3Q22 A;  5FLX E;  5M5Y B;  2X6G A;  3H09 A;  4H13 C;  1WCM H;  1B2T A;  2MP1 A;  3NEL A;  1SE3 A;  3K7A B;  3ZYY X;  1IL8 A;  2VB3 X;  2PQE A;  3I4O A;  5FO7 B;  4A76 A;  2B8F A;  4YIJ A;  2MGS A;  3J80 c;  4G7Z C;  4HJA A;  1X32 A;  1SNO A;  1QG7 A;  4LF9 Q;  4DK3 C;  1N36 Q;  1VQC A;  3I4N B;  2VUM B;  3W5O A;  2JJQ A;  5GQO A;  1LUZ A;  2JA5 B;  2OEO A;  3SR1 A;  2JP1 A;  4QUC A;  3HOU B;  2EXZ A;  1HA5 A;  3LNN A;  3CC4 A;  1WD0 A;  2EJF C;  1Z7T A;  3J7A 5;  4DU9 A;  3PCO B;  2RF4 A;  4P72 A;  4LNQ A;  3K57 A;  4MTN A;  3FKI B;  5I6Y A;  1V1P B;  4XQJ A;  5IYB G;  2PNR C;  1G6Z A;  1VQG A;  4L6T B;  2LS0 1;  4A3F G;  1HHV A;  4GNX B;  3CCJ A;  5CV5 A;  1HQM C;  4CDC C;  1F9R A;  3P20 A;  1HTL D;  3UDI A;  3U4Z A;  2XRS D;  3I4L A;  3HOX B;  2ZM6 Q;  2QCP X;  5C5L A;  5IWA Q;  2L12 A;  1JJG A;  1IBM Q;  1Q1E A;  3Q23 A;  2SDF A;  2AMC B;  2I5H A;  4DV6 L;  1CZG A;  3HP3 A;  1E2V A;  3FDT A;  5E1F A;  2IX1 A;  1SBB B;  1K83 B;  3F2D A;  3T1H L;  5JPN C;  1AFP A;  1PTO B;  1B53 A;  1E1T A;  1F9Q A;  1RHP A;  3CP0 A;  2CH4 W;  3KF8 A;  2O5J C;  1JOQ A;  4JI6 Q;  1LTA D;  5J3B A;  2IY5 B;  2DUD A;  4ZQ3 A;  3WDN A;  2R7D A;  2OQ0 A;  4PQX A;  3CD6 A;  5DEH A;  4IUV A;  4OX9 Q;  3I8Z A;  1LLR D;  2VL6 A;  1SJE D;  1T5X D;  3MC0 B;  1UE6 A;  3KDF B;  3GTL B;  3C1E A;  4BY7 B;  2WIN B;  3E0J A;  2DY7 A;  4JW0 A;  2UUC L;  1C0A A;  3K5O A;  3S17 H;  4NP5 A;  3LX0 A;  3EIV A;  4A3B G;  2Z6B A;  4NMZ A;  5KNB A;  1U4P A;  1IKM A;  1PLF A;  1SLJ A;  4B3R Q;  3C3L A;  2UUB L;  1ESF A;  4A93 G;  3LGJ A;  3HKZ B;  2UXB L;  2BDN A;  4DR1 Q;  1D5Z C;  3SK8 A;  4PZ7 A;  4Q0F A;  2NZ1 D;  5EPK A;  4X64 L;  2K14 A;  3BS1 A;  1L1O B;  4A3I G;  5IYB H;  2RHS B;  4A3F H;  3T16 A;  1DOL A;  1KAB A;  5D3D A;  3RLO A;  3RNU A;  5C44 G;  4O2D A;  2CH4 A;  4IPG A;  3VDY A;  5A35 A;  2ZXR A;  2E76 C;  4JPB W;  3Q24 A;  3HOW B;  2GVB A;  3R2T A;  1CA5 A;  2A74 C;  3QJY A;  1EQR A;  2WAQ G;  2LXJ A;  3D0F A;  2RCN A;  4OO1 G;  4J15 A;  2BE5 D;  2MFI A;  4CJ1 B;  1I6H B;  3ERQ A;  1A2T A;  4X3S A;  5COY A;  3WOF A;  2K75 A;  4ZKB B;  3L3O C;  2AUK A;  3A7L A;  5HGT A;  3E0E A;  3BVM A;  4LF9 L;  2CVR A;  3IFD A;  1S72 A;  3GDE A;  1N36 L;  2LMC B;  3RZO B;  5C3X A;  3SVM A;  1FYC A;  2HCI A;  2KUM A;  4LF4 Q;  1KDC A;  1JOK A;  2VXW A;  3NTK A;  4BBR G;  5M3M G;  1SYE A;  3GTG H;  1A3T A;  4UY8 C;  1STB A;  4ODG A;  2KOL A;  4POG A;  4DA2 A;  1VMP A;  2A68 D;  1SYB A;  3K59 A;  3BZD B;  2K5D A;  2F0F A;  4DPG A;  4A3B H;  1QOH A;  3OYY A;  3QR8 A;  2Q8T A;  1S5D D;  2IHF A;  1G8Z D;  3ND9 A;  3IRB A;  1YHQ A;  5L37 A;  2HT1 A;  1I3Q H;  1T5E A;  4A93 H;  4PMC A;  1TS4 A;  1BVS A;  1SYD A;  3MXU A;  1D7Q A;  2ZM6 L;  5IWA L;  2UXC Q;  4JV5 Q;  4DK6 C;  4DR5 Q;  1IBM L;  1BF4 A;  3CCS A;  2ZTC A;  2EJM A;  5ELO A;  4A3I H;  4DK1 A;  1S5F D;  4YWK A;  1UEB A;  2SNM A;  1L0Y B;  1EQQ A;  2NVQ B;  1WTR A;  5M5X H;  1EYA A;  2KCC A;  1WD1 A;  4JI6 L;  2RSO A;  2B63 G;  1S4Z A;  2Y0S B;  4OEM B;  1X9N A;  4OWW B;  5C3W A;  1KRT A;  2NTS A;  3F2U A;  1O78 A;  1ET9 A;  3QOJ A;  2CCZ A;  4OX9 L;  1LTB D;  2C9O A;  1HH2 P;  1A8V A;  1IW7 D;  4OO1 H;  1JCK B;  4RHS A;  2D5D A;  1STY A;  1EWC A;  1KRS A;  2F03 A;  3BDL A;  1SN8 A;  3U9S A;  4ME3 A;  2GVA A;  5C4Z A;  4JI1 Q;  3JAM c;  4X6A H;  3HZX A;  1T9H A;  2KHS A;  1X56 A;  1CQV A;  3MXN B;  4QY7 A;  4POF A;  3KBG A;  1VQK A;  5AJ3 Q;  2BH2 A;  1SJH D;  1PH8 A;  2PNH A;  4B3R L;  5CR3 A;  2X69 A;  1VQL A;  4BBR H;  3S1R H;  2FMM A;  1EFW A;  2A73 B;  5KND A;  5K36 G;  2K5W A;  1PH2 A;  3E9H A;  4C3H B;  4DR1 L;  4MNO A;  4ZRZ A;  1EIY B;  2ALY B;  1TS5 A;  4DNR B;  3T51 B;  5D3I B;  3E5S A;  1CFM A;  1B70 B;  3H3V H;  4TSS A;  4HIM A;  3MVV A;  2CWA A;  1Y1V B;  2OF1 A;  3ER0 A;  3FHW A;  3QB3 A;  3TQY A;  4KI0 A;  1JJC B;  2ICE C;  1JE4 A;  2QGQ A;  4ZKC B;  4A3J B;  1YNN D;  5JAV A;  4RAU C;  2MO0 A;  2R7Z G;  5FK9 C;  1B44 D;  4OO1 I;  4RKL A;  1YBY A;  1WOC A;  4HIO A;  5EKK A;  3CQZ B;  1Q82 C;  1CKN B;  1TY0 A;  2VS1 A;  1K28 A;  4HID A;  2I0Q A;  3SXH A;  4PMB A;  4YHH Q;  2CFM A;  3QWN A;  2B63 H;  2R7F A;  5C4J B;  2KA7 A;  1J5E L;  5IOC A;  2YV5 A;  2Q2U A;  1PYS B;  2WV6 D;  2ZTE A;  4XYO A;  4JBM A;  1RTO A;  1TXY A;  2K32 A;  3OPO A;  3M4O B;  5EGT A;  1WTP A;  4TQU S;  4GN3 B;  2XSC A;  3MFY A;  3H91 A;  4LF4 L;  1O7L A;  1K0R A;  5K5P A;  2CW0 C;  2IPK D;  1OXV A;  2AHO B;  3TSS A;  4FYD A;  1DCZ A;  3J80 E;  1P16 A;  4RA8 A;  3TRZ A;  1Q90 A;  3GTK B;  1F2Y A;  4TVA B;  2FFK B;  2KJX A;  3W1G A;  4IN3 A;  2B3G A;  3J7A F;  3AB9 A;  2JXM B;  1WTQ A;  1QUQ B;  2YU9 B;  3M7G A;  4DV2 Q;  5IT9 L;  1Z6H A;  4DFA A;  3MXG A;  3A5U A;  3GV6 A;  4MTK A;  3H3V I;  4I7A A;  2JN4 A;  1ROD A;  3A54 A;  3CCL A;  5K36 H;  2IL8 A;  1C8C A;  3NTH A;  4DAP A;  4JV5 L;  4UP9 A;  2EYJ A;  4DR5 L;  5BN3 A;  3FMC A;  5C0X G;  1SNM A;  4B3T Q;  1QZG A;  1X3Q A;  5COR A;  3FP9 A;  3TZD A;  1SRU A;  3S1M B;  4BBS G;  1YJ9 A;  1EY6 A;  2L55 A;  2OTL A;  4ILW A;  1TQO A;  2R7Z H;  1HXY D;  1GOZ A;  2NVY B;  1VDZ A;  3G6E A;  1TII D;  3AFQ A;  4A4I A;  1L2F A;  2ENB A;  1W6K A;  4JI1 L;  1F9S A;  1XXG A;  1ASY A;  1BXT A;  5LHY 1;  2PI2 A;  1GXD C;  4IO9 A;  3CCV A;  1TWC B;  5FJ8 G;  4V0B A;  3KFU A;  1CSP A;  3J7Z C;  5AJ3 L;  2HCC A;  1LO5 D;  2B2V C;  3DEO A;  1TWH H;  4A3G G;  1DON A;  2K5H A;  4GOP C;  2EQS A;  1KC8 C;  1BCP C;  4HMI A;  2K1B A;  1Y1W B;  1YNJ D;  3AQQ A;  1CKO A;  1KLG D;  3HRZ C;  4N9T A;  4A3L G;  4IFD G;  2QW7 A;  1NE3 A;  2V1C C;  1EQT A;  1HR0 Q;  4QL5 A;  4DF7 A;  2AQ1 B;  5M3F G;  4KN4 C;  4BWG B;  1VQ7 A;  5KIX A;  4WJ4 A;  5IE8 A;  1HNZ Q;  1KD1 C;  1VQ5 A;  1A15 A;  4Y7N H;  3C2P A;  3PO3 G;  3T13 A;  2NVX H;  2SEB D;  2XWJ B;  1DOK A;  1QE6 A;  5C4X G;  2WB1 B;  2WAQ E;  4GKK Q;  1VQI A;  5KGU A;  4DAY A;  5C0X H;  1M8A A;  5HY6 A;  3S1N H;  2L0C A;  1K8M A;  2A6E D;  2EY2 A;  2PMZ B;  1MKH A;  3R93 A;  2H1E A;  4YHH L;  4BBS H;  2EE1 A;  1I94 Q;  4UAI A;  1CZW A;  3I4M G;  1WVL A;  2EVB A;  4K8J A;  4E6I A;  4LF5 Q;  2YTX A;  1XX8 A;  2B2T A;  4DXG A;  3TN2 A;  1VQE A;  4DV1 Q;  1E7Z A;  2EYP A;  1ENF A;  3KK7 A;  2OTJ A;  3K80 C;  3TS0 A;  3M3Y B;  4IUN A;  4R1J A;  4FO2 A;  1YJN A;  3S1Q H;  1PYB A;  1OXX K;  3R3O A;  5IT9 c;  3I72 A;  3S16 H;  3CCU A;  4NPS A;  5KYI A;  1VQF A;  5F2D A;  4UPA A;  4DV2 L;  2JA7 B;  1L0X B;  3CMA A;  3EN2 A;  4A3G H;  2SOB A;  4RFB A;  3URY A;  5EQ0 A;  1EOT A;  2BCO A;  2XRQ D;  4A3L H;  3P7J A;  2Q2I A;  4L5Q A;  4GS3 A;  2E2I H;  2RVL A;  5M3F H;  1Q81 C;  1J8I A;  4JI8 Q;  2KED A;  4B3T L;  2KVM A;  2Z8L A;  5C0X I;  1RL2 A;  1HNW Q;  1Q1B A;  2PZT A;  2KEC A;  3PIP A;  3G4S A;  3HOV B;  1EQV A;  3WOE A;  1HJP A;  3PO3 H;  1CHQ D;  3S2H H;  5DNF A;  2Z1C A;  4YWL A;  4IJH A;  3K5M A;  2RSN A;  3ND8 A;  2I5M X;  3Q0A A;  1WTW A;  4KHV A;  5C4X H;  1R4Q B;  3SK5 A;  1I4R A;  3AEV A;  1XMQ L;  5CYU A;  2N55 A;  3CU7 A;  2PQA A;  4XT1 B;  3I4N G;  2VUM G;  2ZXO A;  3PUX A;  3TS2 A;  4HR7 B;  2JA5 G;  3I70 A;  1Q86 C;  5CBA E;  2UXD L;  2QEX A;  3DWA A;  3OIP A;  1ZYR C;  2EOT A;  3K58 A;  1TS2 A;  1KHI A;  5BN4 A;  3I4M H;  2N88 A;  3QG1 A;  1PFS A;  3PO2 B;  4KKT A;  4XYQ A;  5I9O A;  3A7A B;  1EIH A;  4HED A;  2K28 A;  3K5N A;  3KLS X;  1ZXT A;  3L7Z C;  3BDC A;  4IPD A;  1EYC A;  2L4N A;  2R93 B;  2YYZ A;  3NBH B;  3JAM E;  2Q8R E;  2VQE Q;  4B9W A;  3RUZ A;  2ZJR A;  1XJV A;  1PFB A;  1HR0 L;  1LT5 D;  3HOX G;  1MIU A;  4R4T A;  2B39 A;  1SYF A;  2F3W A;  4I7Z C;  4GN4 B;  1HNZ L;  1SE4 A;  5I2Y A;  1R4P B;  1FGU A;  2F4I A;  4C3J B;  4KLK A;  1X55 A;  4YCU A;  2VB2 X;  2F0K A;  2HDL A;  1H9M A;  5GRO A;  4GKK L;  4DGZ A;  5I2X A;  2B2U C;  3W3A A;  4QB4 A;  2ZTD A;  1YIJ A;  4NW2 A;  2I07 B;  4AYB B;  1UNS A;  5JVH 3;  4P73 A;  4KY7 A;  1EL0 A;  3K7A H;  1I50 H;  4DUZ Q;  4KHP Q;  3RZD B;  1WCM B;  4X65 Q;  4HN7 A;  3T4A C;  2AQ2 B;  4MHE A;  5EKI A;  3OWF A;  1H9J A;  4O42 A;  2VUM H;  4DV1 L;  4QGU A;  1HNX Q;  2JA5 H;  2LXK A;  3TP6 A;  1G51 A;  2F3V A;  2XWB B;  1K3B C;  3C46 A;  3V96 A;  3KF8 B;  1H9S A;  1TWF B;  1TVX A;  2L9H A;  2O2L D;  3I3C A;  1MJC A;  1AW7 A;  1UUP A;  5T1I A;  3CCQ A;  4TKO B;  3KJO A;  2R6G A;  4A3C H;  3MWY W;  2HIV A;  4KY5 A;  3KLR A;  4ID6 A;  1NMG A;  3CC7 A;  4R4C A;  1PH4 A;  4JI2 L;  1VQA A;  1BR9 A;  1A63 A;  2K52 A;  1FGB D;  4QUF A;  1MBY A;  3VYT A;  1VQ8 A;  2DJF C;  4FNF A;  2AKW B;  3PIP 3;  3MHB A;  1GHJ A;  1QNK A;  4R4O A;  3VA7 A;  3J81 c;  3ICE A;  2EDG A;  1V9P A;  4N8X 1;  3HOW G;  4JI8 L;  4QQB X;  1AZQ A;  3BZC A;  1HNW L;  2GA4 B;  4JCV E;  4BA1 I;  4FDB A;  1K83 H;  1B9M A;  1PTO H;  2R92 H;  4IUQ A;  1WYD A;  1V43 A;  2WII B;  3DLL A;  2QEJ C;  4EQP A;  5KEE A;  3S14 B;  2DNE A;  5TSS A;  1MI2 A;  4LWC A;  4C2M H;  3CAM A;  1QIL A;  3F1Z A;  3SEB A;  4QF4 A;  3NPP A;  3DEP A;  3ERS X;  2VW9 A;  1LT4 D;  2MQH A;  1KDB A;  2HHH Q;  4GNX C;  3D3R A;  4IPC A;  4C3I B;  1OTC A;  2F0Q A;  3JAM L;  1E2Z A;  4RGM A;  2DN8 A;  4PV1 C;  4A3M G;  3EQL C;  1RF2 D;  5JJI A;  1EEI D;  2F0T A;  1SE2 A;  2XNA C;  5E7N A;  1PFN A;  3MA2 B;  1CHP D;  1FR3 A;  1PZJ D;  1SXT A;  4HSV A;  3VR4 A;  3S17 B;  1K0S A;  5NUC A;  1WJJ A;  1PTO C;  2JSO A;  4KD4 A;  1ICW A;  3PUZ A;  3TZU A;  2L5T A;  1QVC A;  1CK1 A;  2E2D C;  1S5B D;  4KN7 C;  5JJZ A;  4R9W A;  1C9O A;  3FRP B;  5LMN Q;  1SMX A;  1PRT B;  5IP9 G;  4ZUJ A;  4B9X A;  2JA8 B;  1CKM A;  4RKB A;  3KUP A;  4OWX B;  4Y52 H;  2K6A A;  3DM3 A;  1VQB A;  2Q2T A;  1TT2 A;  1PH7 A;  2K04 A;  2Y0S G;  3KYH C;  3PUY A;  3RLF A;  1R9T B;  4FF1 A;  4H7B A;  2A68 C;  2I46 A;  1G6P A;  2JA6 B;  4LF7 Q;  3OHX C;  2Q8I B;  2CKZ B;  1AH9 A;  4DUY Q;  3BG3 A;  2F0M A;  4BA2 I;  1JWU D;  1TS3 A;  2D0O A;  4DUZ L;  4KHP L;  1LTG D;  3A55 A;  1STG A;  3BDO A;  4X65 L;  3CCM A;  2F0D A;  4DV0 Q;  4JI7 Q;  2G5D A;  1ENC A;  4L63 B;  4JC0 A;  5T1G A;  3A8J E;  5IP7 G;  3B6Y A;  3NE5 B;  2V4D A;  1XWE A;  4CJ0 B;  1GM5 A;  2F0P A;  2TSS A;  4JBW A;  4F88 A;  1IYU A;  1HNX L;  3J81 j;  5IGC A;  3CRL C;  1M1K C;  1L1O C;  3GTQ H;  5IOD A;  1RDP D;  4PG3 A;  4OON A;  1G2S A;  2N3S A;  1L1O A;  3JC6 6;  1LTI D;  1J6Q A;  4A3M H;  4X3K A;  4C3H G;  3G6J B;  1KNE A;  4NDX A;  3GTG B;  1IW7 C;  4K2L A;  3H15 A;  4APV A;  4ALP A;  2A6H D;  4EQN A;  2MO1 A;  3PV0 A;  2PW5 A;  4QIW B;  1FL0 A;  4DXF A;  4U68 A;  4A3K B;  1Y1V G;  1KQS A;  3HOZ G;  1W6J A;  5IT9 E;  4DV3 Q;  1I3Q B;  1RKN A;  2K7V A;  1S5C D;  5C3E G;  1JC7 A;  3P75 A;  5J1Z A;  4MN3 A;  1GUT A;  3J80 i;  3GO5 A;  1PRT D;  4QMG A;  5IP9 H;  5C44 H;  2HD3 A;  2MHV A;  2VQF Q;  1ET6 A;  4A3I B;  4AIM A;  1PH5 A;  4B08 A;  1D6E C;  3IFT A;  5ELF A;  2NZH A;  1VS0 A;  2NYZ D;  3M4Q A;  1I4Q A;  3LWE A;  3L2P A;  1TWG B;  2WP8 J;  4DNT B;  3P1H A;  2MUY A;  5ELE A;  1JIC A;  3X3N A;  1F2L A;  3GTM H;  3A74 A;  4DR4 Q;  1HCZ A;  1HZB A;  4XDX A;  1JE5 A;  1TY2 A;  5A2Q L;  3G71 A;  4OXP A;  3BVG A;  1QJO A;  1CSQ A;  2F0U A;  2HHH L;  3AYH B;  1VMC A;  1B8A A;  1SYC A;  1K73 C;  1DM0 B;  5ELC A;  2HIX A;  4IJL A;  5IP7 H;  1YNN C;  1CTM A;  4L5R C;  4FP5 D;  5M3M H;  5ELN A;  3PGZ A;  4K5V A;  2ZJP A;  2H5X A;  1GKH A;  3TEH B;  2D9U A;  2FJ2 A;  1FD7 D;  4KMU C;  3TP5 A;  5E4X A;  2FHT A;  3S1R B;  3SHL A;  2AQ3 B;  3BZK A;  1JOO A;  5LMN L;  5DM6 3;  5IYD G;  1U4L A;  2RHQ B;  4ABN A;  3O13 A;  1V1Q A;  1X3P A;  2F0E A;  2F0G A;  1ILP A;  1Y1V H;  2DNC A;  1CQF A;  1MSH A;  2DY8 A;  4XQQ A;  1ILQ A;  5CGK A;  3HOZ H;  1RCV D;  1HPC A;  1KDA A;  2TMP A;  3CF5 A;  5AFW A;  4HJ7 A;  1XPO A;  1MJE A;  2EXD A;  4FVM A;  2B2W C;  5C3E H;  4LF7 L;  3MEH A;  5DAU A;  2PO4 A;  4R8I A;  3NBI A;  1O7I A;  4DUY L;  4A3E B;  2SNS A;  1Y8N B;  1SNQ A;  4NKL A;  1PRT F;  4BS9 A;  1EWH A;  1QVF A;  4DV0 L;  4RGO S;  2VZA A;  4JI7 L;  3V2T A;  2L11 A;  1VQP A;  1EY0 A;  5C4H A;  3ULJ A;  5D14 A;  4IUP A;  1YIT A;  2B63 B;  2NWG A;  2F0J A;  4L5T A;  4KV6 A;  3K5L A;  4EQ5 A;  1B1Z A;  4RWS C;  2A1A A;  1OXU A;  1Z47 A;  4K5W A;  2E2H B;  4KTA A;  1Y8O B;  3A8K E;  2AWO A;  3HKZ E;  5EBD A;  5GAG C;  1Y1W G;  2QDL A;  3GTK H;  2ASB A;  3S2D B;  3MEF A;  3RR5 A;  1ML0 D;  1PZK D;  1DXM A;  5EPL A;  3ULL A;  1E0B A;  3ITP A;  1HRJ A;  1UE7 A;  1DD2 A;  4IUR A;  4UDU C;  2AWN A;  2YU9 H;  1VQM A;  1PDQ A;  3A5Z B;  4RG1 A;  1VQJ A;  2ICI A;  4ZK9 B;  2F0N A;  2RA4 A;  2UXC L;  3MAQ A;  3NP8 A;  2Q2H A;  1NSN S;  4DV4 Q;  4RH6 A;  3D6C A;  4DV3 L;  2WB1 G;  1EEF D;  5M9O A;  1A3U A;  5DLQ E;  3TBI B;  1CKN A;  3NEN A;  3M4P A;  3ONA B;  4ME5 A;  1UAP A;  1WFQ A;  5IYD H;  1NNX A;  1C7Y A;  1A3V A;  1NBW A;  2VQF L;  2F0I A;  2K5Q A;  3EBE A;  5I4D A;  3MZ5 A;  3J81 E;  1X54 A;  1LTS D;  5GAH C;  2XGT A;  4LAA A;  5C5M A;  2A69 C;  3NWS A;  4BY1 G;  2PZW A;  3GTJ B;  4X62 Q;  2RCF A;  4DR4 L;  4K5X A;  1LTT D;  1W3S A;  5JPM C;  4V19 0;  1RJT A;  3U58 A;  4DV5 Q;  4LUV A;  1NTG A;  1LYL A;  1X6O A;  1VQO A;  2RKS A;  1GO3 E;  1M4V A;  2K50 A;  3U50 C;  1IXR A;  5HUR A;  1IZ6 A;  4KD3 A;  5EJW A;  1B4O A;  2QIL A;  1PXU A;  1GUW A;  4WFN 3;  4L8J A;  1EIG A;  1QNU A;  4DAY B;  1D8L A;  2NUC A;  1XYI A;  3H94 A;  1JR0 D;  2KHI A;  4JG2 A;  4CDE C;  1TKW B;  1SE8 A;  2JA7 G;  5I6W A;  1HFN A;  2B2V A;  4WOR A;  4LFB Q;  1K8G A;  1A2U A;  2QA4 A;  4GOP A;  1DJR D;  1JT8 A;  3A0J A;  1E3P A;  3DUZ A;  1AP0 A;  4JI0 Q;  3OOC A;  1GHK A;  3CCE A;  1TWH B;  1HFG A;  4KJO A;  1SRO A;  3R8B A;  3NHH A;  3CRK C;  3S9W A;  3F8T A;  2F0S A;  2OXP A;  1XNR Q;  4K14 A;  4ZUI A;  3HOV G;  5JEA J;  1YVC A;  5J22 A;  2F0H A;  2Y0S E;  1XTD A;  1NUC A;  3I56 A;  1PA6 A;  1ZEQ X;  1SR3 A;  2FMC A;  5ELD A;  4Y7N B;  4LFC Q;  1U5K A;  2RQX A;  2IX3 A;  2NVX B;  4IPH A;  5CV9 A;  3CPF A;  4XQN A;  4HTH A;  4CDF C;  1GJX A;  3HEJ A;  1JB7 A;  2JE6 I;  5IIF A;  2EY5 A;  3JAM i;  4HJ5 A;  4G57 A;  1I6V C;  2NVT H;  3RN5 A;  2B2Y C;  1SMY D;  3OIQ A;  4FF3 A;  1JWS D;  5CV8 A;  2OT2 A;  2DJG C;  2PYK A;  3BYY B;  4S3S A;  2B2Y A;  1PH3 A;  3S15 H;  3OSO A;  3PO2 G;  4BY1 H;  1EU3 A;  2KBN A;  1E1O A;  1H9R A;  3WWV A;  1B50 A;  4OHJ A;  3A8I E;  2IT1 A;  1EY8 A;  3VYS A;  4QCL A;  3GV3 A;  4A3D B;  1FNV A;  1BKB A;  2Z0S A;  4FXD A;  4JI4 Q;  3M3Y H;  1F77 A;  5FJ8 H;  4G7H C;  1BNZ A;  3CCR A;  1PH9 A;  2UUA Q;  1I4X A;  1MHW C;  2ID0 A;  4WRD A;  3A56 A;  2PQA B;  3OTO Q;  2HDM A;  3HOY B;  4IOA A;  4RCN A;  1VQN A;  2MJ8 A;  1HQR D;  1EUJ A;  2KEE A;  3S1Q B;  1PYW D;  4DR7 Q;  3I73 A;  3S16 B;  4IFD H;  3DHQ A;  2PCF B;  5C0X J;  3GTP B;  1DZ1 A;  1AEX A;  4UHV A;  5GAE C;  4DV4 L;  3PUW A;  1QWY A;  2BH8 A;  1V8Q A;  2K5N A;  4A3G B;  3J81 L;  4ZCK A;  1MSG A;  1LAB A;  4EX5 A;  1Y8P B;  4P71 A;  1YNX A;  1PV4 A;  3HOV H;  1D5X C;  4DR3 Q;  3PF5 A;  4LUO A;  5KNC A;  4IZ8 A;  5M5W H;  2F4V Q;  1EFI D;  5JOB A;  1D5M C;  3STB C;  3H6M A;  2J0T D;  3N6R A;  2EY1 A;  4LF8 Q;  3PMF A;  3S2H B;  4GLX A;  3T1H Q;  3UE0 A;  4X62 L;  1B9N A;  4NXN Q;  2Z6K C;  4WJ3 M;  1BOS A;  1IYJ B;  5C4X B;  3T1Y Q;  2PW7 A;  3KLW A;  3L0O A;  3HOU G;  4C1N K;  1RD9 D;  4J6H A;  4C1N I;  3FPP A;  3H0G B;  2ATW A;  3GTO H;  2M9V A;  1B7Y B;  3CW2 C;  5CBE E;  3FKI G;  3G7L A;  1BBX C;  1YZ6 A;  2EYH A;  2LFN A;  3I55 A;  1GUG A;  1X65 A;  2KCN A;  1PH6 A;  4DAM A;  1E22 A;  4LFB L;  2EZV A;  3X3M A;  3MTS A;  4IUT A;  2E2J H;  2K4K A;  4IFD I;  2OWO A;  1STH A;  4GZY C;  5G3L D;  1TWA H;  1MGS A;  4JI0 L;  3CPW A;  2X6L A;  1VQH A;  1X3G A;  1EY5 A;  3BJU A;  4EQO A;  1KL9 A;  2H4O A;  1KXL A;  4OIK A;  3HG9 A;  1VQ6 A;  3D4W A;  4LFA Q;  4MIU A;  1SDF A;  1XNR L;  3TRE A;  1SFO H;  5J39 A;  3HFZ B;  1K9M C;  3M9B A;  1H9S B;  2HUG A;  4NXM Q;  2K5V A;  2KCM A;  1F2M A;  4LFC L;  4XXE A;  2PPB C;  2JYO A;  5M5Y H;  1WTO A;  4K0K Q;  4DNI A;  3UE1 A;  1IBK Q;  2B2U A;  1ZYR D;  3KF6 A;  4JI5 Q;  1K8O A;  2IWH A;  3TME A;  1I94 L;  1DYQ A;  3HGB A;  1SEB D;  3KOJ A;  2NTT A;  3UDX A;  2E5L Q;  4BY7 G;  4DV6 Q;  1WTH A;  3QIA A;  2J4X A;  1Q8I A;  3RZD H;  1IBL Q;  4C3I G;  4LF5 L;  3I4N H;  1II3 A;  2G9D A;  3EFX D;  2KCT A;  1GUO A;  4YCV A;  3DXJ C;  3GP7 A;  2RBM A;  1I50 B;  3NBH A;  4KHZ A;  3HOU H;  3NTI A;  1AN8 A;  3HKZ G;  4H02 A;  4C56 C;  4O0A A;  4JI4 L;  1HUM A;  3OWE B;  3D4R A;  1TWF H;  4HJ9 A;  1LAC A;  2BDO A;  2UUA L;  2NBF A;  3FKI H;  3OTO L;  4CKE A;  2XVS A;  1ONL A;  2HQL A;  1EY7 A;  2VNU D;  4LW1 A;  4R4Q A;  1QCB D;  1WTV A;  1BO0 A;  4DR7 L;  5IGD A;  2F52 A;  1G2T A;  2JA8 G;  5FOB B;  1HTP A;  3HOX H;  1LV9 A;  5FO8 B;  5E3F A;  2WB1 E;  3N52 A;  5FKA C;  1I4P A;  5G3L F;  1HZA A;  2BA0 A;  2N8N A;  4P74 A;  2JA6 G;  1ICF B;  1C4Q A;  1NAP A;  1YHA A;  4IUU A;  1RIP A;  2PMZ E;  5EBC A;  3I7F A;  5IY0 A;  1A62 A;  4DR3 L;  5EAY A;  1G91 A;  2JA9 A;  4TRD A;  2F4V L;  5ELB A;  4LF8 L;  1QVG A;  3G48 A;  3Q8D A;  5CV7 A;  2A8V A;  1K8A C;  3S14 H;  2NB0 A;  2OQK A;  2R92 B;  4DAV A;  3T56 B;  4MZ9 A;  4EGV A;  4RGN A;  1KTK A;  4RCO A;  4NXN L;  3BYT B;  3T1Y L;  3VR5 A;  1J9O A;  3C1F A;  3GTL H;  1V1P A;  1SNC A;  2EPB A;  3KLS A;  4X66 Q;  4BY7 H;  4C2M B;  2DGY A;  4B3M Q;  4FF2 A;  2IHE A;  2UU9 Q;  4GNX A;  1TU2 B;  4C3I H;  4ULL A;  4BXX G;  5A2Q E;  5IGE A;  4GLV B;  2BE5 C;  1B3Q A;  2CQA A;  1IHZ A;  3W2D A;  5DM7 3;  4JI3 Q;  1JOR A;  5EKL A;  4KK7 A;  4FXK C;  3K6O A;  3CME A;  4DN4 M;  2VQE L;  3KBX A;  1BDO A;  3CHB D;  3K8A A;  4A3K G;  5CC4 A;  2PZU A;  2OCE A;  4B3S Q;  2M00 A;  1NMF A;  5D65 A;  4YY3 Q;  4LFA L;  1FJG Q;  1N33 Q;  3J7Y W;  1Q12 A;  2O5I C;  4F7X A;  2K33 A;  2CWP A;  1CM9 A;  1IL2 A;  4OL7 A;  3SK4 A;  2JA8 H;  1H9K A;  2VY3 A;  4A3F B;  3M7N A;  4KKS A;  3HOW H;  4CKC A;  4NXM L;  2XN9 C;  3KDF A;  4CHT B;  4DK0 A;  4N8F A;  5FLX L;  5E4W C;  1Q7Y C;  3DWQ A;  4K0K L;  3PF4 A;  3NWT A;  1R9T H;  1IBK L;  1I6H H;  4JI5 L;  1LT6 D;  2JA6 H;  3DMU A;  1QB5 D;  1N34 Q;  2A6H C;  1V1O A;  2E5L L;  1FVI A;  1CT1 D;  1STN A;  4XT3 B;  1IBL L;  3RZO H;  3FEW X;  4JVZ A;  3UDF A;  4DV7 Q;  4R4I A;  1B3A A;  3PIO A;  4JOI C;  1BUV T;  1PTO D;  1VF7 A;  3DWP A;  4JOI A;  1J5E Q;  1UE1 A;  2EYO A;  1JWM D;  1GUN A;  1RTN A;  1PRT C;  2IW3 A;  1U9R A;  4UP8 A;  3ULP A;  3DM1 A;  4F87 A;  4XTC S;  4A75 A;  1O7Z A;  3GTQ B;  4BXX H;  1PVO A;  2L1B A;  1EY9 A;  1YHB A;  3SDZ A;  4PZ8 A;  1EY4 A;  1XMO Q;  4A3B B;  1CA6 A;  2EY6 A;  4HCE A;  3RN2 A;  4A3M B;  3BU2 A;  1VCI A;  4JYA Q;  2HQE A;  1HR0 W;  4A3K H;  5IGB A;  1K3R A;  4A3J G;  4A93 B;  2EYM A;  2B8G A;  1Q3L A;  4JBJ A;  1N8R C;  4AYB E;  4HIK A;  2F0V A;  1MD2 D;  5IGF A;  2NVQ H;  3V05 A;  3IL8 A;  4Q5V A;  3OMG A;  4A3E G;  5JVG 3;  4PMW A;  1KNA A;  3K0X A;  1FNU A;  5M5X B;  3RLN A;  4I65 A;  5C44 B;  2E75 C;  3LWU A;  3NSW A;  5BR8 Q;  1O7Y A;  1TWG H;  3OMC A;  4LUZ A;  2WAQ B;  2K03 A;  3K81 C;  4P2C B;  4NB3 A;  4OIJ A;  4X66 L;  1VQ4 A;  4AQY Q;  5CMD A;  4B3M L;  3CKI B;  3L9A X;  3UDG A;  3GTM B;  2UU9 L;  2F3I A;  4X3U A;  2F1M A;  4ZYS A;  1DOM A;  2N78 A;  2KHJ A;  1XNQ Q;  3VR6 A;  1X3E A;  2D0P A;  1KLU D;  1ZKO A;  4JI3 L;  2E8G A;  1P8L A;  4QJF A;  1L0W A;  2B29 A;  1PTO F;  2F0O A;  1S5E D;  2N49 A;  3VA5 A;  4IOC A;  3J81 i;  1NR2 A;  4KKU A;  4RMF A;  3AFP A;  4YWM A;  3VR2 A;  4C3H H;  5M3M B;  1LT3 D;  4BBR B;  4K2K A;  1S3O A;  1PH1 A;  1NJI C;  4R8N A;  2C35 B;  4DKA C;  4B3S L;  1GD7 A;  2BOS A;  1S40 A;  4YY3 L;  3PUV A;  1FJG L;  1N33 L;  3U9O A;  2WKD A;  2ZXP A;  3I90 A;  1AE2 A;  4IQZ A;  5FLX c;  2WKC A;  1KAA A;  3T53 B;  3U4V A;  4GLA C;  4A3J H;  3VR3 A;  5KRU A;  2NZO A;  3D8G A;  2F0W A;  2B2W A;  3CQZ H;  3HOZ B;  4CJ2 C;  3PIO 3;  3MXN A;  1N34 L;  1EZ8 A;  4N9P A;  1D1K A;  4A3E H;  4OGQ C;  5C4J H;  5JEA G;  4G7O C;  4CBV A;  5C3E B;  1HUN A;  4DV7 L;  3M4O H;  3W1B A;  1SYG A;  1STA A;  4HJ8 A;  3E3X A;  1Z9F A;  1YJW A;  1A6X A;  3I91 A;  4PZ6 A;  2J7Z A;  2ZJQ A;  1E24 A;  3EJI A;  3K0Y A;  3CC2 A;  2E2H H;  4GKJ Q;  3HS0 C;  1XPR A;  2LSS A;  1YI2 A;  1BBU A;  5H1S E;  1A0I A;  1XTC D;  4HCS A;  3RD4 A;  3S2D H;  2LKV A;  1JMC A;  3H3V C;  1XMO L;  5JJL A;  5IGG A;  1GUS A;  4PNY A;  3ERO A;  4JYA L;  4K6L A;  2EJG C;  4LF6 Q;  5CV4 A;  2MNA A;  2IJ0 A;  1M90 C;  2K01 A;  1PFM A;  2L15 A;  1U4M A;  1UWV A;  3E9I A;  1JJ2 A;  4EVO A;  4FF4 A;  3QOL A;  5ISR A;  2A5H A;  1NY4 A;  1O80 A;  3S1M H;  4OEL B;  1I4H A;  1ASZ A;  1CUK A;  1YNJ C;  1LTL A;  5CV6 A;  4GOP B;  4DR6 Q;  3OW2 A;  2MPM A;  4H0L C;  2IX0 A;  2CW0 D;  5HGQ A;  1BCP B;  3AU7 A;  2JK8 A;  5BR8 L;  1PZI D;  1PMR A;  3CXC A;  1ENA A;  3HKS A;  2NVY H;  1G29 1;  1LM0 A;  4RHR A;  3GTJ H;  1CI3 M;  3M4Y A;  4H44 C;  2R7Z B;  1UEA B;  3D31 A;  1C48 A;  1QUQ A;  1XMQ Q;  1SSO A;  3TP8 A;  5JEA H;  4AQY L;  4A3D G;  3PQI A;  4JBK A;  2EYF A;  3NQT A;  2D62 A;  2O4X A;  4K8I A;  4Z9C B;  3J7A V;  1TWC H;  1XNQ L;  3ZJY C;  2UXD Q;  2A6E C;  3HOY G;  2YTY A;  4CGY B;  3NEM A;  3AMU A;  1Q46 A;  4F8M A;  4QIW E;  1EU4 A;  4WJW A;  1Y1W H;  2R61 A;  4GN5 A;  1I4G A;  1JQY D;  1SMY C;  1YEZ A;  3PSI A;  3F2B A;  4ZAI A;  1BBW A;  5I9P A;  2M2L A;  3SE0 A;  3VYU A;  4UP7 A;  1D1I A;  4AH6 A;  1KAW A;  4DR2 Q;  1N32 Q;  1U0L A;  1W2B A;  3EVQ A;  5EPJ A;  2A69 D;  1STE A;  1EWI A;  1XPU A;  2D2C C;  3NK9 A;  1WTX A;  2C5C A;  2NN6 G;  1HZC A;  4O1N A;  3EA6 A;  1AZP A;  1F2Z A;  1X3F A;  3TDQ A;  4LMQ D;  3NUC A;  3QO2 A;  2Z4H A;  2G9H D;  3FVQ A;  5LMU Q;  1LTR D;  1NCV A;  3S1N B;  4KY6 A;  3KJP A;  3K7U C;  1FNW A;  3H0G G;  1BCP D;  4BBS B;  1AE3 A;  3IAY A;  2NVT B;  2Z4I A;  1OO9 B;  2A19 A;  1ESR A;  1EZ6 A;  1VF5 C;  1U4R A;  1TR5 A;  3J80 L;  2R93 G;  5FLM G;  3E6Z X;  2B2T C;  3S15 B;  1WI5 A;  2CHB D;  4BY1 B;  4A3D H;  1GVP A;  2EIF A;  4GKJ L;  5GAD C;  5LL6 S;  4YCW A;  4CKB A;  2Z9H A;  4J1M A;  3SGI A;  3D4D A;  2K05 A;  3HOY H;  2JA7 H;  1IYV A;  4C3J G;  4XIG S;  1DGS A;  1E2W A;  2CQO A;  2GN5 A;  1EYG A;  3OW7 A;  3M85 A;  3BVZ A;  1Y14 B;  1SND A;  2BA1 A;  4X3T A;  1Y69 U;  4G4K A;  5IYC G;  4LF6 L;  4KJN A;  3VYR A;  3GTP H;  1EYD A;  2KQ3 A;  4ZLT F;  4AYB G;  2R3Z A;  4HMJ A;  5LMN W;  4JI2 Q;  2EYL A;  2E2I B;  2QKI C;  2ES2 A;  5M3F B;  1OXT A;  3UI2 A;  3GQB A;  1OXS C;  4DR6 L;  2JQO A;  1WCM G; 
#chains in the Genus database with same CATH homology
 3PO3 B;  1D2B A;  1BQQ T;  4M8A A;  4HSP A;  3MXP A;  3FPU B;  3NXW A;  4U67 3;  2NN6 H;  2RDG A;  3Q6S A;  2RDF A;  5M5W B;  4K6D A;  4RGT A;  4M1U B;  3GD7 A;  4LJZ C;  3IKJ A;  4LK1 C;  3R2I A;  2ZT9 C;  3I4M B;  4IFD J;  1BCP F;  2QDB A;  3NQI A;  5C6A A;  2E74 C;  4IAL A;  2FIN B;  3GTO B;  1SAP A;  2LY7 A;  4JK1 C;  4J8Q A;  2QF7 A;  1HA6 A;  4FXG C;  1IKL A;  5BN5 A;  3RMH A;  5KYL A;  2WAC A;  2E2J B;  3D6W A;  1TWA B;  2F0L A;  5LL6 X;  2XIW A;  1JB3 A;  2RDH A;  2AUJ D;  1SNP A;  5FO9 B;  4HAE A;  3TP7 A;  1SFO B;  2JEA I;  1F9P A;  2NN6 I;  3MFG A;  1NR4 A;  2JEB I;  3SK6 A;  3Q22 A;  5FLX E;  5M5Y B;  2X6G A;  3H09 A;  4H13 C;  1B2T A;  2MP1 A;  1SE3 A;  3K7A B;  3ZYY X;  1IL8 A;  2VB3 X;  2PQE A;  5FO7 B;  2B8F A;  4YIJ A;  2MGS A;  4G7Z C;  1X32 A;  1SNO A;  1QG7 A;  3I4N B;  2VUM B;  2JA5 B;  2OEO A;  3SR1 A;  2JP1 A;  4QUC A;  3HOU B;  2EXZ A;  1HA5 A;  3LNN A;  1WD0 A;  2EJF C;  1Z7T A;  4DU9 A;  3K57 A;  3FKI B;  5I6Y A;  1V1P B;  4XQJ A;  2PNR C;  1G6Z A;  4L6T B;  2LS0 1;  1HHV A;  5CV5 A;  1HQM C;  1F9R A;  3P20 A;  1HTL D;  2XRS D;  3I4L A;  3HOX B;  2QCP X;  5C5L A;  2L12 A;  1Q1E A;  3Q23 A;  2SDF A;  1CZG A;  3HP3 A;  1E2V A;  3FDT A;  5E1F A;  2IX1 A;  1SBB B;  1K83 B;  5JPN C;  1AFP A;  1PTO B;  1B53 A;  1JOQ A;  1F9Q A;  1RHP A;  3KF8 A;  2O5J C;  1LTA D;  4ZQ3 A;  3WDN A;  4PQX A;  5DEH A;  4IUV A;  3I8Z A;  1LLR D;  1SJE D;  1T5X D;  3MC0 B;  3GTL B;  3C1E A;  4BY7 B;  2WIN B;  3E0J A;  2DY7 A;  3K5O A;  4NP5 A;  3LX0 A;  4NMZ A;  5KNB A;  1U4P A;  1IKM A;  1PLF A;  3C3L A;  1ESF A;  3HKZ B;  2BDN A;  1D5Z C;  3SK8 A;  4Q0F A;  2NZ1 D;  5EPK A;  3BS1 A;  3T16 A;  1DOL A;  1KAB A;  5D3D A;  5A35 A;  2ZXR A;  2E76 C;  3Q24 A;  3HOW B;  3R2T A;  1CA5 A;  2A74 C;  3QJY A;  4OO1 G;  2BE5 D;  4CJ1 B;  1I6H B;  3ERQ A;  1A2T A;  4X3S A;  5COY A;  3WOF A;  4ZKB B;  3L3O C;  2AUK A;  3A7L A;  5HGT A;  3BVM A;  2CVR A;  3IFD A;  2LMC B;  3RZO B;  5C3X A;  3SVM A;  1FYC A;  2HCI A;  2KUM A;  1KDC A;  1JOK A;  2VXW A;  3NTK A;  1SYE A;  1A3T A;  1STB A;  4ODG A;  2KOL A;  4DA2 A;  1VMP A;  2A68 D;  1SYB A;  3K59 A;  3BZD B;  2K5D A;  2F0F A;  1QOH A;  2Q8T A;  1S5D D;  1G8Z D;  3ND9 A;  1T5E A;  4PMC A;  1TS4 A;  1SYD A;  3MXU A;  1BF4 A;  2EJM A;  4DK1 A;  1S5F D;  2SNM A;  1L0Y B;  2NVQ B;  1WTR A;  1EYA A;  2KCC A;  1WD1 A;  2RSO A;  1S4Z A;  2Y0S B;  5C3W A;  2NTS A;  3F2U A;  1O78 A;  1ET9 A;  3QOJ A;  1LTB D;  2C9O A;  1IW7 D;  4OO1 H;  1JCK B;  4RHS A;  2D5D A;  1STY A;  1EWC A;  2F03 A;  3BDL A;  3U9S A;  5C4Z A;  3HZX A;  2KHS A;  1CQV A;  3KBG A;  1SJH D;  5CR3 A;  2X69 A;  2FMM A;  2A73 B;  5KND A;  5K36 G;  2K5W A;  4C3H B;  4ZRZ A;  1TS5 A;  4DNR B;  3T51 B;  5D3I B;  3E5S A;  1CFM A;  4TSS A;  3MVV A;  1Y1V B;  2OF1 A;  3QB3 A;  4KI0 A;  2ICE C;  1JE4 A;  4ZKC B;  4A3J B;  1YNN D;  5JAV A;  4RAU C;  5FK9 C;  1B44 D;  4OO1 I;  4RKL A;  5EKK A;  3CQZ B;  1TY0 A;  3SXH A;  4PMB A;  3QWN A;  5C4J B;  2KA7 A;  5IOC A;  2WV6 D;  4XYO A;  1RTO A;  2K32 A;  3OPO A;  3M4O B;  5EGT A;  1WTP A;  4TQU S;  2XSC A;  3MFY A;  3H91 A;  1O7L A;  5K5P A;  2CW0 C;  2IPK D;  1OXV A;  3TSS A;  4FYD A;  1DCZ A;  3J80 E;  4RA8 A;  1Q90 A;  3GTK B;  1F2Y A;  2FFK B;  2KJX A;  4IN3 A;  3J7A F;  3AB9 A;  2JXM B;  1WTQ A;  2YU9 B;  3M7G A;  5IT9 L;  1Z6H A;  4DFA A;  3MXG A;  3GV6 A;  1ROD A;  3A54 A;  5K36 H;  2IL8 A;  1C8C A;  3NTH A;  4DAP A;  2EYJ A;  5BN3 A;  3FMC A;  5C0X G;  1SNM A;  1X3Q A;  5COR A;  3TZD A;  3S1M B;  1EY6 A;  2L55 A;  4ILW A;  1TQO A;  1HXY D;  1GOZ A;  2NVY B;  1VDZ A;  1TII D;  2ENB A;  1W6K A;  1F9S A;  1XXG A;  1BXT A;  5LHY 1;  1GXD C;  1TWC B;  4V0B A;  2HCC A;  1LO5 D;  2B2V C;  3DEO A;  1DON A;  1BCP C;  4HMI A;  2K1B A;  1Y1W B;  1YNJ D;  3HRZ C;  1KLG D;  4N9T A;  4IFD G;  1EQT A;  4DF7 A;  2AQ1 B;  4KN4 C;  4BWG B;  5KIX A;  1A15 A;  3C2P A;  3T13 A;  2SEB D;  2XWJ B;  1DOK A;  1QE6 A;  2WB1 B;  5KGU A;  4DAY A;  5C0X H;  1M8A A;  2L0C A;  1K8M A;  2A6E D;  2EY2 A;  2PMZ B;  3R93 A;  2H1E A;  2EE1 A;  4UAI A;  1CZW A;  1WVL A;  2EVB A;  4K8J A;  4E6I A;  1XX8 A;  2B2T A;  4DXG A;  3TN2 A;  2EYP A;  1ENF A;  3KK7 A;  3M3Y B;  4IUN A;  4FO2 A;  1OXX K;  3R3O A;  3I72 A;  5KYI A;  5F2D A;  2JA7 B;  1L0X B;  2SOB A;  4RFB A;  3URY A;  5EQ0 A;  1EOT A;  2BCO A;  2XRQ D;  3P7J A;  2RVL A;  1J8I A;  2KED A;  2KVM A;  2Z8L A;  5C0X I;  1Q1B A;  2PZT A;  2KEC A;  3HOV B;  1EQV A;  3WOE A;  1CHQ D;  5DNF A;  2Z1C A;  3K5M A;  2RSN A;  3ND8 A;  3Q0A A;  1WTW A;  4KHV A;  1R4Q B;  3SK5 A;  1I4R A;  5CYU A;  2N55 A;  3CU7 A;  4XT1 B;  2ZXO A;  3PUX A;  4HR7 B;  3I70 A;  5CBA E;  3DWA A;  3OIP A;  1ZYR C;  2EOT A;  3K58 A;  1TS2 A;  5BN4 A;  2N88 A;  3QG1 A;  3PO2 B;  4KKT A;  4XYQ A;  5I9O A;  3A7A B;  1EIH A;  4HED A;  2K28 A;  3K5N A;  3KLS X;  1ZXT A;  3L7Z C;  3BDC A;  1EYC A;  2L4N A;  2R93 B;  2YYZ A;  3JAM E;  2Q8R E;  4B9W A;  3RUZ A;  1PFB A;  1LT5 D;  2B39 A;  1SYF A;  2F3W A;  4I7Z C;  1SE4 A;  5I2Y A;  1R4P B;  2F4I A;  4C3J B;  2VB2 X;  2F0K A;  2HDL A;  1H9M A;  4DGZ A;  5I2X A;  2B2U C;  3W3A A;  4QB4 A;  4NW2 A;  2I07 B;  4AYB B;  1UNS A;  5JVH 3;  4KY7 A;  1EL0 A;  3RZD B;  1WCM B;  4HN7 A;  3T4A C;  2AQ2 B;  4MHE A;  5EKI A;  3OWF A;  1H9J A;  4O42 A;  3TP6 A;  2F3V A;  2XWB B;  3C46 A;  3V96 A;  1H9S A;  1TWF B;  1TVX A;  2L9H A;  2O2L D;  3I3C A;  1AW7 A;  1UUP A;  5T1I A;  4TKO B;  2R6G A;  3MWY W;  4KY5 A;  3KLR A;  4ID6 A;  1BR9 A;  1FGB D;  4QUF A;  1MBY A;  3VYT A;  4FNF A;  3PIP 3;  3MHB A;  1GHJ A;  1QNK A;  3VA7 A;  2EDG A;  1AZQ A;  2GA4 B;  4BA1 I;  1B9M A;  1PTO H;  4IUQ A;  1V43 A;  2WII B;  2QEJ C;  4EQP A;  5KEE A;  3S14 B;  2DNE A;  5TSS A;  1MI2 A;  1QIL A;  3SEB A;  4QF4 A;  3NPP A;  3DEP A;  1LT4 D;  1KDB A;  3D3R A;  4C3I B;  2F0Q A;  3JAM L;  1E2Z A;  4RGM A;  2DN8 A;  4PV1 C;  3EQL C;  1RF2 D;  1EEI D;  2F0T A;  1SE2 A;  2XNA C;  1PFN A;  3MA2 B;  1CHP D;  1FR3 A;  1PZJ D;  1SXT A;  4HSV A;  3VR4 A;  3S17 B;  5NUC A;  1PTO C;  2JSO A;  4KD4 A;  1ICW A;  3PUZ A;  3TZU A;  2L5T A;  1CK1 A;  2E2D C;  1S5B D;  4KN7 C;  5JJZ A;  4R9W A;  3FRP B;  1PRT B;  4ZUJ A;  4B9X A;  2JA8 B;  4RKB A;  3KUP A;  2K6A A;  1TT2 A;  2K04 A;  3PUY A;  3RLF A;  1R9T B;  4FF1 A;  4H7B A;  2A68 C;  2I46 A;  2JA6 B;  3OHX C;  2Q8I B;  3BG3 A;  2F0M A;  4BA2 I;  1JWU D;  1TS3 A;  1LTG D;  3A55 A;  1STG A;  3BDO A;  2F0D A;  1ENC A;  4L63 B;  5T1G A;  3A8J E;  3NE5 B;  2V4D A;  4CJ0 B;  1XWE A;  2F0P A;  2TSS A;  4JBW A;  4F88 A;  1IYU A;  5IGC A;  3CRL C;  5IOD A;  1RDP D;  1G2S A;  1LTI D;  4X3K A;  4C3H G;  3G6J B;  1KNE A;  4NDX A;  3GTG B;  1IW7 C;  4K2L A;  2A6H D;  4EQN A;  3PV0 A;  2PW5 A;  4QIW B;  4DXF A;  4U68 A;  4A3K B;  1W6J A;  5IT9 E;  1I3Q B;  1RKN A;  2K7V A;  1S5C D;  1JC7 A;  3P75 A;  5J1Z A;  4MN3 A;  1GUT A;  3GO5 A;  4QMG A;  1PRT D;  2MHV A;  1ET6 A;  4A3I B;  4B08 A;  1D6E C;  3IFT A;  5ELF A;  2NYZ D;  1I4Q A;  3LWE A;  1TWG B;  2WP8 J;  4DNT B;  3P1H A;  2MUY A;  5ELE A;  1JIC A;  3X3N A;  1F2L A;  1HCZ A;  4XDX A;  1TY2 A;  5A2Q L;  3BVG A;  1QJO A;  2F0U A;  1VMC A;  1SYC A;  1DM0 B;  5ELC A;  1YNN C;  1CTM A;  4FP5 D;  4K5V A;  2D9U A;  2FJ2 A;  1FD7 D;  4KMU C;  3TP5 A;  5E4X A;  2FHT A;  3S1R B;  3SHL A;  2AQ3 B;  1JOO A;  5DM6 3;  1U4L A;  4ABN A;  3O13 A;  2F0G A;  1X3P A;  2F0E A;  1ILP A;  2DNC A;  1CQF A;  1MSH A;  2DY8 A;  4XQQ A;  1ILQ A;  5CGK A;  1RCV D;  1HPC A;  1KDA A;  2TMP A;  5AFW A;  4FVM A;  2B2W C;  3MEH A;  5DAU A;  2PO4 A;  4R8I A;  3NBI A;  4A3E B;  2SNS A;  1Y8N B;  1SNQ A;  4NKL A;  1PRT F;  4BS9 A;  1EWH A;  4RGO S;  3V2T A;  2L11 A;  1EY0 A;  5C4H A;  5D14 A;  4IUP A;  2B63 B;  2NWG A;  2F0J A;  3K5L A;  4KV6 A;  1B1Z A;  4RWS C;  1OXU A;  1Z47 A;  4K5W A;  2E2H B;  4KTA A;  1Y8O B;  3A8K E;  2AWO A;  5EBD A;  3S2D B;  1ML0 D;  1PZK D;  1DXM A;  5EPL A;  1E0B A;  3ITP A;  1HRJ A;  1DD2 A;  4IUR A;  4UDU C;  2AWN A;  1PDQ A;  2ICI A;  4ZK9 B;  2F0N A;  2RA4 A;  3MAQ A;  3NP8 A;  1NSN S;  4RH6 A;  3D6C A;  5M9O A;  1EEF D;  1A3U A;  3TBI B;  3ONA B;  4ME5 A;  1UAP A;  1A3V A;  2F0I A;  2K5Q A;  5I4D A;  3MZ5 A;  3J81 E;  1LTS D;  4LAA A;  5C5M A;  2A69 C;  3NWS A;  2PZW A;  3GTJ B;  4K5X A;  1LTT D;  5JPM C;  4V19 0;  1RJT A;  2RKS A;  1M4V A;  5HUR A;  4KD3 A;  5EJW A;  1B4O A;  2QIL A;  1PXU A;  1GUW A;  4WFN 3;  4L8J A;  1EIG A;  1QNU A;  2NUC A;  1XYI A;  3H94 A;  1JR0 D;  1TKW B;  1HFN A;  5I6W A;  2B2V A;  4WOR A;  1A2U A;  1DJR D;  3DUZ A;  1AP0 A;  3OOC A;  1GHK A;  1TWH B;  1HFG A;  4KJO A;  3R8B A;  3NHH A;  3CRK C;  3S9W A;  2F0S A;  2OXP A;  4K14 A;  4ZUI A;  5JEA J;  5J22 A;  2F0H A;  1NUC A;  1ZEQ X;  2FMC A;  4Y7N B;  5ELD A;  2RQX A;  2IX3 A;  2NVX B;  5CV9 A;  4XQN A;  4HTH A;  1GJX A;  3HEJ A;  2JE6 I;  5IIF A;  2EY5 A;  4G57 A;  1I6V C;  2B2Y C;  1SMY D;  3OIQ A;  4FF3 A;  1JWS D;  5CV8 A;  2OT2 A;  2PYK A;  3BYY B;  4S3S A;  2B2Y A;  3OSO A;  1EU3 A;  1H9R A;  1B50 A;  4OHJ A;  3A8I E;  2IT1 A;  1EY8 A;  3VYS A;  4QCL A;  3GV3 A;  4A3D B;  1FNV A;  4FXD A;  1F77 A;  4G7H C;  1BNZ A;  1I4X A;  3HOY B;  2ID0 A;  4WRD A;  3A56 A;  2HDM A;  4RCN A;  2MJ8 A;  1HQR D;  2KEE A;  3S1Q B;  1PYW D;  3I73 A;  3S16 B;  4IFD H;  3DHQ A;  2PCF B;  5C0X J;  3GTP B;  1DZ1 A;  1AEX A;  3PUW A;  1QWY A;  1V8Q A;  4A3G B;  3J81 L;  1MSG A;  1LAB A;  1Y8P B;  1D5X C;  5KNC A;  4IZ8 A;  1EFI D;  5JOB A;  1D5M C;  3H6M A;  2J0T D;  3N6R A;  2EY1 A;  3PMF A;  3S2H B;  1B9N A;  1BOS A;  5C4X B;  2PW7 A;  4C1N K;  1RD9 D;  4J6H A;  4C1N I;  3FPP A;  3H0G B;  2M9V A;  5CBE E;  3G7L A;  1BBX C;  2EYH A;  2LFN A;  1GUG A;  2KCN A;  2EZV A;  3X3M A;  3MTS A;  4IUT A;  4IFD I;  1STH A;  4GZY C;  5G3L D;  1MGS A;  2X6L A;  1EY5 A;  4EQO A;  2H4O A;  4OIK A;  3HG9 A;  3D4W A;  4MIU A;  1SDF A;  5J39 A;  1H9S B;  2HUG A;  1F2M A;  4XXE A;  2PPB C;  2JYO A;  1WTO A;  2B2U A;  1ZYR D;  1K8O A;  2IWH A;  3TME A;  1DYQ A;  3HGB A;  1SEB D;  2NTT A;  3QIA A;  2J4X A;  1Q8I A;  4C3I G;  1II3 A;  2G9D A;  3EFX D;  1GUO A;  3DXJ C;  3GP7 A;  2RBM A;  1I50 B;  3NBH A;  4KHZ A;  3NTI A;  1AN8 A;  4C56 C;  1HUM A;  3OWE B;  3D4R A;  1LAC A;  2BDO A;  2NBF A;  4CKE A;  2XVS A;  1ONL A;  1EY7 A;  2VNU D;  1QCB D;  1WTV A;  1BO0 A;  5IGD A;  1G2T A;  5FOB B;  1HTP A;  1LV9 A;  5FO8 B;  5E3F A;  3N52 A;  5FKA C;  1I4P A;  5G3L F;  2BA0 A;  1C4Q A;  1NAP A;  4IUU A;  5EBC A;  1G91 A;  4TRD A;  5ELB A;  5CV7 A;  2NB0 A;  2R92 B;  4DAV A;  3T56 B;  4EGV A;  4RGN A;  1KTK A;  4RCO A;  3BYT B;  3VR5 A;  1J9O A;  3C1F A;  1V1P A;  1SNC A;  2EPB A;  3KLS A;  4C2M B;  4FF2 A;  1TU2 B;  4ULL A;  5A2Q E;  5IGE A;  2BE5 C;  2CQA A;  1IHZ A;  3W2D A;  5DM7 3;  1JOR A;  5EKL A;  4KK7 A;  4FXK C;  3K6O A;  4DN4 M;  3KBX A;  1BDO A;  3CHB D;  5CC4 A;  2PZU A;  2M00 A;  5D65 A;  3J7Y W;  1Q12 A;  2O5I C;  4F7X A;  2K33 A;  1CM9 A;  4OL7 A;  3SK4 A;  3M7N A;  1H9K A;  4A3F B;  4KKS A;  4CKC A;  2XN9 C;  4CHT B;  4DK0 A;  5FLX L;  5E4W C;  3DWQ A;  3NWT A;  1LT6 D;  3DMU A;  1QB5 D;  2A6H C;  1V1O A;  1CT1 D;  1STN A;  4XT3 B;  3FEW X;  1B3A A;  1BUV T;  1PTO D;  1VF7 A;  3DWP A;  2EYO A;  1JWM D;  1GUN A;  1RTN A;  1PRT C;  2IW3 A;  1U9R A;  3DM1 A;  4F87 A;  4XTC S;  1O7Z A;  3GTQ B;  2L1B A;  1EY9 A;  3SDZ A;  1EY4 A;  4A3B B;  1CA6 A;  2EY6 A;  4HCE A;  4A3M B;  1VCI A;  2HQE A;  5IGB A;  4A93 B;  2EYM A;  2B8G A;  1Q3L A;  2F0V A;  1MD2 D;  5IGF A;  3V05 A;  3IL8 A;  4Q5V A;  3OMG A;  5JVG 3;  4PMW A;  1KNA A;  1FNU A;  5M5X B;  4I65 A;  5C44 B;  2E75 C;  3LWU A;  3NSW A;  1O7Y A;  3OMC A;  2WAQ B;  2K03 A;  4P2C B;  4OIJ A;  5CMD A;  3CKI B;  3L9A X;  3GTM B;  4X3U A;  2F1M A;  4ZYS A;  1DOM A;  3VR6 A;  1KLU D;  1ZKO A;  1PTO F;  2F0O A;  1S5E D;  3VA5 A;  1NR2 A;  4KKU A;  3VR2 A;  5M3M B;  1LT3 D;  4BBR B;  4K2K A;  4R8N A;  2BOS A;  3PUV A;  3U9O A;  2WKD A;  2ZXP A;  3I90 A;  4IQZ A;  2WKC A;  1KAA A;  3T53 B;  3VR3 A;  5KRU A;  3D8G A;  2F0W A;  2B2W A;  3HOZ B;  4CJ2 C;  3PIO 3;  3MXN A;  1EZ8 A;  4N9P A;  1D1K A;  4OGQ C;  5JEA G;  4G7O C;  4CBV A;  5C3E B;  1HUN A;  1SYG A;  1STA A;  1A6X A;  3I91 A;  2J7Z A;  3EJI A;  3K0Y A;  3HS0 C;  1XTC D;  4HCS A;  3RD4 A;  2LKV A;  3H3V C;  5IGG A;  1GUS A;  4PNY A;  3ERO A;  4K6L A;  2EJG C;  5CV4 A;  2IJ0 A;  2K01 A;  1PFM A;  1U4M A;  4EVO A;  4FF4 A;  3QOL A;  5ISR A;  2A5H A;  1O80 A;  1I4H A;  1YNJ C;  5CV6 A;  2MPM A;  4H0L C;  2IX0 A;  2CW0 D;  1BCP B;  3AU7 A;  1PZI D;  1PMR A;  1ENA A;  1G29 1;  4RHR A;  1CI3 M;  3M4Y A;  4H44 C;  2R7Z B;  1UEA B;  3D31 A;  1C48 A;  1SSO A;  3TP8 A;  5JEA H;  2EYF A;  3NQT A;  2D62 A;  2O4X A;  4K8I A;  4Z9C B;  3J7A V;  2A6E C;  4CGY B;  3AMU A;  4F8M A;  1EU4 A;  4WJW A;  2R61 A;  1I4G A;  1JQY D;  1SMY C;  4ZAI A;  5I9P A;  2M2L A;  3SE0 A;  3VYU A;  1D1I A;  3EVQ A;  5EPJ A;  2A69 D;  1STE A;  2D2C C;  3NK9 A;  1WTX A;  2C5C A;  2NN6 G;  4O1N A;  3EA6 A;  1AZP A;  1F2Z A;  3TDQ A;  4LMQ D;  3NUC A;  3QO2 A;  2Z4H A;  2G9H D;  3FVQ A;  1LTR D;  1NCV A;  3S1N B;  4KY6 A;  1FNW A;  1BCP D;  4BBS B;  3IAY A;  2NVT B;  2Z4I A;  1OO9 B;  1ESR A;  1EZ6 A;  1VF5 C;  1U4R A;  1TR5 A;  3J80 L;  3E6Z X;  2B2T C;  3S15 B;  2CHB D;  4BY1 B;  5LL6 S;  4CKB A;  4J1M A;  3D4D A;  2K05 A;  1IYV A;  4C3J G;  4XIG S;  1E2W A;  3OW7 A;  3M85 A;  3BVZ A;  1Y69 U;  1SND A;  2BA1 A;  4X3T A;  4G4K A;  4KJN A;  3VYR A;  1EYD A;  2KQ3 A;  4ZLT F;  2R3Z A;  4HMJ A;  2EYL A;  2E2I B;  2QKI C;  5M3F B;  1OXT A;  3UI2 A;  3GQB A;  1OXS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...