5IOCA

Crystal structure of staphylococcal nuclease variant delta+phs v66h/v99d at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMHENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMDNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V66H/V99D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5iocA00
4NP5A 3DMUA 5KYLA 1JOQA 4KY6A 4DGZA 1EY6A 2EYFA 5ISRA 4B9WA 2F0QA 1RKNA 1SYCA 3H6MA 4TRDA 5IGGA 1EY8A 4J6HA 4LAAA 2NUCA 3NP8A 4N9PA 3OSOA 3VA5A 3PMFA 3S9WA 3SK4A 4WRDA 2EY6A 4IZ8A 5F2DA 3QOJA 3C1EA 4NKLA 3TP8A 1EZ8A 4F7XA 4DF7A 2PZWA 2M00A 2RKSA 3TP5A 1KDBA 4KJNA 4ZQ3A 1JOOA 3QOLA 3SK6A 2SNMA 2SOBA 3D8GA 3E5SA 1SNMA 2O4XA 3NXWA 3RUZA 2ENBA 5DEHA 5IIFA 1SYEA 5IGFA 3SXHA 2QDBA 3T16A 2F0UA 1II3A 3OWFA 4RKBA 4KJOA 1SNDA 5CV5A 1STAA 4K5XA 2F0OA 2WACA 3D4DA 1NUCA 2F0JA 3DHQA 3U9OA 4N9TA 2PW5A 3OMCA 4WORA 4S3SA 1EY5A 1SNQA 5CGKA 4G57A 5JAVA 2KHSA 2F0PA 4ZUJA 5EKKA 1JOKA 1SYDA 1F2ZA 2F0GA 4KHVA 4OL7A 5C5LA 5KIXA 3SK8A 5I6YA 5I6WA 3ERQA 3MXPA 2EYHA 2EXZA 3P1HA 4YIJA 5IODA 1STNA 2F0LA 4K2LA 5IGDA 1SYBA 5KEEA 3NUCA 5CC4A 1EYAA 3TP7A 4K5VA 4KD3A 4EVOA 1ENAA 1A2TA 4I65A 4KD4A 5IGCA 5IOCA 2F0HA 3T13A 2PQEA 1KDAA 2EYPA 2EYLA 1A2UA 5K5PA 3HEJA 3MEHA 5DAUA 1TR5A 2PZTA 1EQVA 4E6IA 4QF4A 4RKLA 4K8JA 3QB3A 5JOBA 1F2YA 5CV9A 2F0FA 2F0TA 5CR3A 4PMBA 4DFAA 4KY5A 5IGBA 3SR1A 3TP6A 1F2MA 3NQTA 3NHHA 5I9OA 5KYIA 5C4ZA 4KTAA 1NSNS 1SYFA 5EGTA 4H7BA 2RDFA 4J1MA 3LX0A 5I9PA 1A3TA 1SNPA 2EYJA 3D6CA 4NDXA 1TQOA 5CV4A 1EY4A 2F3WA 3D4WA 5C5MA 1ENCA 2F0MA 4MIUA 1SYGA 5EKLA 2HQEA 2EY5A 5KGUA 2EY2A 2EY1A 1A3VA 1KDCA 2F0SA 4K8IA 3SK5A 5C4HA 4IUNA 4KV6A 3BDCA 4PMCA 5CV8A 3R3OA 5CV6A 2EYOA 1A3UA 4ODGA 3TMEA 3HZXA 4QB4A 4R8NA 4K5WA 3MZ5A 5IGEA 5C6AA 2OXPA 4HTHA 4ME5A 4HMJA 5NUCA 1TT2A 4F8MA 5CV7A 4B9XA 5C3WA 3SHLA 5C3XA 2OEOA 3BDLA 4ID6A 1AEXA 2F0NA 4IALA 5E3FA 1STBA 2F0VA 2F0EA 2SNSA 3EROA 3EVQA 4PNYA 4EQOA 3P75A 4KY7A 5HGTA 2PYKA 4K6DA 1EY0A 1EY9A 2F0KA 1SNOA 2F3VA 2KQ3A 2RBMA 1U9RA 1EY7A 1SNCA 1STHA 2F0WA 3EJIA 4ZUIA 5J39A 5KRUA 1KAAA 4NMZA 5E1FA 4EQPA 2PW7A 1JORA 3NK9A 3V2TA 3MHBA 3C1FA 5J22A 5M9OA 2OF1A 1STYA 1STGA 2PZUA 2F0DA 4HMIA 4EQNA 1EYDA 1EYCA 1KABA 2F0IA 2LKVA 3OMGA 5J1ZA 1EZ6A 1IHZA 4QMGA 4K14A 4DU9A 4K2KA 3ITPA 3MVVA 2EYMA 5HURA
chains in the Genus database with same CATH superfamily
4IUVA 1JJCB 1NMFA 1Y1VH 2F4VL 2Z4IA 2WIIB 2F0QA 1ZEQX 4LF6Q 1L1OC 5IGGA 3C46A 4N9PA 1WTOA 3SK4A 1GUNA 1BDOA 5F2DA 4FF3A 4GNXB 3GTJH 1JOOA 1NTGA 3QOLA 1XWEA 4JW0A 3KF6B 5JEAG 3HOYG 1SE2A 1SNMA 2ZM6Q 2ATWA 5K36H 4P71A 2CW0C 4JI0Q 2EJMA 3U9OA 1EIFA 4X64Q 1TWGB 4L5SA 2PW5A 3HOZG 4C1NI 3NTIA 1I3QB 4A3DG 4R4TA 4P74A 4IPGA 4X66L 3S2HB 2KUMA 3LWEA 2NVQH 2EYHA 2R7ZB 5IODA 1CKNA 2F0LA 5J39A 5IGDA 5IYBG 5EPLA 1C0AA 4I65A 1ICFB 2PQEA 4JCVE 1Q90A 1F9RA 3DWPA 2L12A 5E4XA 1FVIA 1GD7A 2JA8G 3SR1A 3KLSX 3NQTA 5G3LF 1N36L 1G6PA 1VQ4A 2VQEL 3W3AA 2XNAC 3HS0C 1VS0A 2DJGC 4LW1A 5LL6S 2CH4W 2QEXA 3KLSA 2NN6I 1SAPA 2UU9Q 4GOPC 4RG1A 2CFMA 5D14A 4ZYSA 1FGUA 3J80i 1ICWA 1B9MA 3BG3A 3PUYA 2K4KA 2RA4A 3GDEA 4KK7A 3T51B 2BH2A 1PH7A 1VQMA 3U4VA 1TY2A 3A5UA 2F0VA 2QDLA 4QJFA 3URYA 3EROA 5C3EB 3HOXH 5ELDA 2OQKA 3KJPA 3CPWA 1D7QA 3S2DH 2IT1A 1B53A 1PH4A 1S5DD 2PW7A 2Z1CA 3C1FA 3MC0B 3I2ZA 1STYA 4ZK9B 5JVG3 3KJOA 4M8AA 3TSSA 1C8CA 5AFWA 1HXYD 3J80c 2A68C 3A8IE 3DM1A 4IJLA 1E2VA 2QA4A 1PTOH 1BCPD 1YNJD 4DR6Q 2VNUD 2K14A 3FKIG 2ZTEA 4GKKQ 5JJIA 4DF7A 1HZ9A 2PZWA 2NVYB 3EFXD 1LTTD 1UWVA 1O7YA 2UUBL 1EOVA 5FO8B 3D8GA 4DK0A 1UAPA 5I4DA 3T1HL 3UI2A 2F0JA 3DHQA 1GHKA 4S3SA 2B2YC 2K32A 3J7A5 1Q1BA 3K7AB 4G57A 3GD7A 1U4LA 3OIPA 5EKKA 3OTOL 2F0GA 4YIJA 4DAMA 3CRKC 5EBDA 3I4NH 1ENAA 3E9HA 1KNAA 2M2LA 2R92G 4DR3L 3K8AA 3MEHA 1Z9FA 2FFKB 2FINB 2GN5A 2I07B 5ELFA 5LMUQ 1A0IA 5BN4A 3RD4A 2ZTDA 1FJGQ 5CORA 4XIGS 1MKHA 5JPMC 4ULLA 2WV6D 3I4MH 4RWSC 3J81i 3HKSA 1QJOA 1OXXK 1VDZA 5I9PA 1IKMA 2X6LA 1S72A 2YTVA 4A3KB 4KMUC 1ZKOA 3FVQA 4HSVA 1CK1A 3CRLC 4AH6A 2CVRA 4L63B 1D1IA 1YJWA 2Q8TA 1EL0A 1BXTA 4K5WA 4B3TQ 1P8LA 4L5RC 5C4XB 4JV5Q 1SDFA 3HKZE 2DN8A 2R93B 3BDLA 1TWFB 1VQOA 1X65A 4IALA 3M4QA 1RD9D 1XJVA 4X65Q 5D3DA 4JOIA 1N9WA 2UXDQ 3K57A 5AJ3Q 3J81c 4A3MH 4UDUC 1NAPA 3GTMB 3TQYA 1I4GA 3J81L 4GN3B 1SXTA 2RHQB 1JJGA 1TWHB 1P16A 1X3EA 4NXNL 3TBIB 4APVA 3CCJA 4C3JB 4ABNA 3E9IA 3GP7A 1VQAA 4YHHL 2RHSB 1VQCA 3B6YA 1W6JA 2N8NA 1L1OB 2UUAQ 1J5EL 5ISRA 3NBHA 4NXMQ 1X56A 2I5MX 1I4RA 3S9WA 2G9DA 4OO1I 1PTOF 2KA7A 4P2CB 5BR8Q 1X55A 2JEBI 2Q2TA 1AZQA 2IJ0A 3J81E 2B39A 1HTLD 1VMCA 1XYIA 1STAA 2WACA 3EIVA 3OW7A 2E5LQ 1R4PB 2UXBL 2JYOA 3F2BA 1MJCA 1F9SA 1C48A 3M4OB 1CM9A 1V1PB 3VYUA 1F2ZA 3LWUA 1B3AA 4AYBG 4DR4Q 4RCOA 4JI8L 1AN8A 1DJRD 4XYQA 1PH5A 3S1RB 2ES2A 3GTGH 2ZJRA 2HIXA 2IX3A 2PZTA 5KNCA 4FNFA 1DOLA 1LT3D 2HIVA 4LK1C 4BBRB 1CHPD 5M3MH 2YTXA 3CC4A 4U673 1VQJA 1GUWA 1IBKQ 4LF6L 5C4ZA 4IJHA 2WAQE 1HNXQ 1ILPA 1YNND 4R8IA 2AWOA 3IFTA 4NDXA 4GOPB 1LTGD 1N34Q 4XXEA 4X3UA 1LYLA 2HQEA 2KHJA 2E2DC 5KGUA 1TY0A 1YI2A 4DUYQ 1KDCA 2ZM6L 2ALYB 5IY0A 4PMCA 1SMYD 4DAYB 4JI0L 3J81j 1K8AC 1MJEA 2L55A 4X64L 1VQ7A 3I55A 1GUGA 3MAQA 2K01A 5CV7A 4B9XA 1E2ZA 3PO3G 5E4WC 3HOWB 3L9AX 3P75A 4CBVA 1PFSA 3L0OA 2F3VA 1MBYA 1ILQA 1U9RA 1MHWC 1T9HA 3NWSA 2B2UA 1KLUD 1YHAA 4DR7Q 2A19A 3NK9A 3SGIA 1CKMA 2B2TA 2C5CA 2OF1A 5EPKA 5KIXA 1H9RA 2KENA 4F88A 2WINB 1YJ9A 4DK3C 3I73A 4HIDA 1DM0B 1LTID 4C3IH 2UU9L 4LFAQ 5GAEC 1IBMQ 4LF4Q 4K0KQ 1HQRD 3CP0A 3CXCA 4R1JA 1SN8A 2ICEC 4NKLA 5FJ8G 1HNWQ 1F77A 4NB3A 1ZYRC 3KDFA 2WB1B 5KNBA 2Q2IA 3BZKA 4O2DA 5DEHA 1RTNA 1Q8KA 3FRPB 2QDBA 1VQ6A 1II3A 3OWFA 1PYBA 1STEA 1G6ZA 4FXDA 2LSSA 1HFGA 4RHRA 3J7YW 3STBC 5G3LD 1HH2P 1LLRD 3OPOA 4R4QA 3R8BA 1BKBA 5JJKA 1WFQA 1R4QB 4Q0FA 3OYYA 3KLWA 2JA7H 2JEAI 4A3IG 3MTSA 1E7ZA 1RCVD 1C9OA 1NMGA 4BY1G 3FPUB 5FLMH 4HIMA 1U5KA 4U68A 4A3LH 1WOCA 2GA4B 3ND9A 4YCWA 4RKLA 3CCVA 3MXUA 4A3BH 4FVMA 3WDNA 3MWYW 4LF5Q 2R7FA 3HG9A 1VCIA 2AMCB 3I4MB 4DR6L 4RFBA 4XDXA 1PZKD 3NPPA 4MN3A 3D6CA 4LJZC 4GKKL 4IFDG 3H0GH 2J0TD 1SEBD 4KV6A 1U4RA 4RAUC 5C44H 5CV6A 2EYOA 2XSCA 1X3QA 3MZ5A 1LTRD 4JBWA 2O5JC 1XPOA 2VUMH 2IPKD 2K75A 4KN7C 4DPGA 4L5QA 1M1KC 2OEOA 2R7ZG 2MHVA 2E2JH 1AE2A 1VQFA 2V1CC 4Z9CB 2K7VA 4LUOA 4KY7A 2CQAA 1TS4A 1KTKA 1SNOA 1XTCD 4HAEA 2QEJC 2D5DA 1E22A 1QUQA 1QVGA 2RDGA 5E1FA 4JOIC 2JA5H 5LMUL 4JI3Q 4BY7H 1PFMA 1IW7C 2CW0D 1B50A 4FF2A 1FJGL 1WCMH 4Y7NH 1KABA 1ESFA 3P7JA 1OTCA 4DU9A 3HOUH 4QMGA 3KUPA 4C3HH 3S17H 5C4JH 1KNEA 2I0QA 1O7LA 2HCIA 2VS1A 5LMNW 4A93G 2DY7A 3H6MA 3H15A 1VF7A 3CF5A 2BA1A 1NY4A 5M3FB 2X69A 1PLFA 1XX8A 3TP5A 3GTOB 3CU7A 1GUTA 3D6WA 2SOBA 4B3TL 4B3MQ 2JJQA 2A5HA 2EJFC 5IIFA 4BBSH 4OEMB 2ZXRA 5C3EG 1CZGA 4C2MH 1Q8IA 3D4DA 1UE7A 2MO0A 1Q3LA 3QO2A 1JE4A 4B08A 4LFCQ 4QIWB 4X65L 1X9NA 1JT8A 4HIOA 4DV1Q 4HJ9A 4ZKCB 4DR5Q 1IYUA 2UXDL 5AJ3L 4ZUJA 3CMAA 3GTLH 2JQOA 5I6WA 1TXYA 2LXJA 4HCEA 1CKNB 5CC4A 1XXGA 3J7ZC 2KEDA 4HJ7A 4RMFA 5IYCG 2E2IB 4DNTB 2KJXA 2MNAA 5CV9A 1QCBD 2BOSA 4POGA 2UUAL 4PZ7A 1B70B 4NXML 1F2MA 1EYGA 1YHBA 4OO1H 2B63H 4IUQA 1EWHA 1PRTC 3K7UC 5BR8L 3CCSA 4JBKA 3G4SA 1BO0A 5EBCA 2EY1A 5GQOA 3RMHA 3HFZB 1VQIA 1OXSC 1RIPA 3AQQA 1V1QA 4G4KA 5M5XB 1N8RC 3KBXA 2E5LL 4HTHA 3PGZA 1R9TB 2I5HA 3I91A 1V1OA 4DR4L 3LGJA 1ML0D 2A6EC 1JMCA 1W3SA 3M7GA 3Q8DA 4ZRZA 4RCNA 1I50H 1J5EQ 1SNCA 1JR0D 5ELEA 3KOJA 3GV3A 1D6EC 1I4QA 4GKJQ 1QG7A 1B3QA 2PZUA 2IX0A 5J1ZA 2MGSA 1IBKL 2NVTH 3IRBA 5GAHC 3ITPA 2EYMA 1HNXL 4DNIA 2OCEA 2MJ8A 4NP5A 3VR4A 1VQ8A 4A3KG 4A3CG 1QVFA 4AYBE 1N34L 2D0OA 2FHTA 1Y1WH 1S5ED 1RKNA 1WTXA 1Q7YC 4DUYL 4HEDA 1EY8A 5FLXc 3S15B 4X3SA 4QIWE 1QNUA 2BDNA 5C4XG 3C1EA 1EZ8A 5JVH3 3Q22A 4A3EH 2R7DA 3CQZH 1O7IA 1DYQA 3V05A 2R93G 3PO2B 4EQ5A 4XTCS 5GROA 2M9VA 5BN3A 5M5WB 1VQ5A 4QGUA 1X3GA 2NTSA 1E2WA 1QZGA 1D5XC 3GTKH 2PCFB 3IL8A 1JOKA 1VQEA 5IT9c 4MTKA 4DR7L 4OHJA 3P1HA 4WJ4A 5IT9L 4DA2A 1E24A 4K5VA 1HZBA 5LL6X 1NJIC 1I4HA 4TSSA 2EYPA 2H1EA 1F9PA 3HEJA 4O42A 4CJ2C 5JEAH 3HOYH 1LM0A 3QB3A 2K5VA 5CR3A 2NVXB 3TDQA 3JAMi 3RZOB 3S1NH 4LFAL 1IBML 4LF4L 3K6OA 4K0KL 1PRTF 3HOZH 1SNPA 5C5MA 1J9OA 1MSHA 1ENCA 1HNWL 4A3DH 4IPCA 2K05A 1A3VA 4UAIA 4GLAC 3H0GB 1PH8A 1Y8NB 2Q2UA 5IT9E 3PUWA 3BYTB 5IYBH 3HZXA 3SEBA 2BH8A 5C44B 2RQXA 4HMJA 1S5FD 2DY8A 4PG3A 3R2IA 2N55A 4X62Q 2JA8H 1BBWA 2TMPA 2IY5B 1ENFA 1CHQD 2F1MA 2AQ1B 2AQ2B 3UDFA 4JYAQ 2K5QA 1EY0A 1K83H 1JQYD 3JAMc 2B29A 2F0KA 1ONLA 1HFNA 3G71A 1STHA 1SLJA 1LTSD 4HIKA 4BBRG 3BYYB 3V2TA 1SBBB 3MHBA 1K8OA 1OXVA 1EIGA 4HMIA 2CKZB 1AFPA 4LF5L 5M5YH 4K14A 2VW9A 2RCFA 1J6QA 3C3LA 3AU7A 1HR0W 1VF5C 3M3YB 4CJ0B 1S5CD 2NYZD 3S17B 2VZAA 4YCVA 1WJJA 3NBHB 4DR2Q 4RGOS 3BVGA 3DWAA 5IP9G 3FEWX 3S1MH 1HQMC 1SR3A 2M00A 3ICEA 4ZQ3A 1E1TA 2JP1A 1GHJA 3FP9A 3RUZA 3PIO3 3HOWG 1QOHA 4KKTA 4JI4Q 4KJOA 3MXGA 3LNNA 4LF7Q 2K33A 4KHZA 3ULJA 2L4NA 1GXDC 1N32Q 4WORA 1Z6HA 1ZXTA 4OONA 1E3PA 2KHSA 2F0PA 4A3FH 3A7AB 1BQQT 3J80L 2Y0SB 1Y8PB 2KCNA 2N49A 1B7YB 4JI3L 3L7ZC 3GTLB 5KEEA 5H1SE 4KD3A 4QY7A 3FKIH 1PTOC 1EQRA 3MA2B 4PV1C 1PV4A 1PHJA 3NTKA 4IFDI 2F0FA 2F0TA 1X6OA 3FHWA 1C7YA 1K8GA 5I9OA 4UY8C 2EE1A 2N3SA 4FXGC 3M4YA 2O2LD 4UHVA 3GTQH 2WB1G 1EY4A 3IKJA 4A3GB 1B4OA 5COYA 2KVMA 5EKLA 3FPPA 2IWHA 3J80E 1SFOH 4X3KA 4B3ML 2K5NA 4A3JB 2R92H 4FDBA 1HJPA 1IXRA 4LFCL 1M8AA 4DV1L 1X54A 5NUCA 4DR5L 2EOTA 4NPSA 4B3RQ 3D0FA 3W5OA 2XRSD 1KC8C 3PIP3 2F0NA 1YBYA 2PMZB 4EQOA 5C0XJ 3PUVA 3ER0A 3T56B 3CHBD 4GS3A 5FKAC 3AB9A 5CBAE 3RN2A 1ZYRD 4QCLA 1I50B 2PQAB 3KF6A 3ZJYC 2F3IA 1SMXA 3S14B 1YIJA 3S16H 2KHIA 4H44C 3I4MG 4LUVA 4H13C 2GVAA 4G7OC 1WTRA 3STBD 2MPMA 3F1ZA 2WP8J 1B8AA 3W1GA 5KYLA 1DD2A 1U0LA 4YWKA 1L0WA 1EY6A 1EOTA 1N33Q 1DXMA 4OGQC 3V96A 4DUZQ 4TRDA 4LAAA 1BBUA 3RN5A 3TRZA 3OSOA 4LWCA 1K8MA 1FNVA 1TWCH 4IZ8A 4ALPA 1UE6A 2HD3A 4KLKA 5JEAJ 3CQZB 3A56A 1GO3E 2K03A 1NUCA 2OTJA 1K0RA 3OMCA 4QUFA 4PMWA 2HT1A 1AP0A 1SE3A 1Y1VB 3ND8A 4KHVA 3ERSX 4OL7A 1TS5A 3NENA 3J7AF 2F4IA 4GKJL 5IP7G 3K5LA 4RA8A 1EYAA 3NBIA 3W1BA 1CA6A 3T13A 2RSNA 3GTPH 1KDAA 1XNQQ 1SE4A 3Q24A 5DAUA 3T1YQ 4LF8Q 3GTJB 2EPBA 1CQFA 3OWEB 4IQZA 1F2YA 3R93A 2Z8LA 3A7LA 1I94Q 1XMQQ 2KCCA 5M3FG 1PA6A 4DKAC 2QF7A 2CCZA 1VQLA 2MUYA 1CT1D 1DGSA 1HUMA 4O0AA 1ASYA 5EJWA 2F52A 3DLLA 1IW7D 1HA6A 2NVQB 1QILA 3R3OA 3VDYA 5KNDA 1AH9A 4HCSA 3A74A 3AEVA 1EU3A 4F8MA 4QQBX 3U9SA 1XPRA 4PZ8A 2O5IC 4DV7Q 1KIXA 3EVQA 5HGTA 3AFQA 4WJ3M 1U4MA 4FXKC 3BZCA 2F0WA 5IYDH 3CC2A 2KOLA 4H0LC 5A2QL 1QUQB 1KAAA 2XWBB 2RF4A 4CJ1B 3Q23A 4ILWA 3UDGA 2F0IA 3WWVA 3MVVA 1UEAB 3NQIA 1J8IA 2UUCQ 2HDLA 4LNQA 3PO3H 1V8QA 4MZ9A 3NSWA 4OWTB 1I6HH 4F87A 3MFGA 3HOXB 4KI0A 2HHHQ 1C4QA 3PUXA 5DNFA 1RL2A 1VQKA 3S1QH 1BUVT 3IAYA 1EWCA 1KDBA 4IURA 5A2QE 2ENBA 3S2DB 4RKBA 4X62L 3F2UA 1JWUD 4P73A 2ID0A 1QVCA 4TKOB 3O13A 1TWAH 1SRUA 4JYAL 3P20A 1PH2A 3UDXA 4DXGA 4CDFC 5JAVA 2NB0A 4A76A 3AMUA 4BXXG 1SYDA 3UE0A 5KRUA 2G9HD 4BWGB 2YU9H 4A3FB 1H9SA 3KK7A 2EXZA 1PTOB 1STNA 3RLNA 3DWQA 1K9MC 5I2XA 4GLVB 4V0BA 5JJLA 2ZXPA 5FJ8H 3L2PA 4AQYQ 2WFWA 2OT2A 1HHVA 1CSPA 2NN6G 1S40A 1UE1A 3TS2A 1FD7D 4TVAB 4DR2L 3L3OC 4DV6Q 3ONAB 1NSNS 1Q12A 2A6ED 4H7BA 1GUSA 1XMOQ 2QW7A 3LX0A 5FO9B 3DUZA 3PO2G 1SYGA 3DEPA 3CCUA 3M85A 1A62A 1D1KA 2WKDA 3UE1A 4JI4L 2DJFC 3ZYYX 4A3IH 2QILA 5CV8A 2K04A 3K5OA 1A3UA 4LF7L 4MHEA 4BY1H 3I4NB 1CFMA 1N32L 3AFPA 3RLOA 2E76C 1PH9A 5IWAQ 1PYWD 3D4RA 5E3FA 5IGFA 1O80A 3VR2A 1OXUA 4LFBQ 2XVSA 2PI2E 4A75A 1IL2A 4KHPQ 2I5LX 4X3TA 2QKIC 4IFDH 1F9QA 2LS01 4PQXA 5M9OA 1STGA 1TWGH 1D8LA 3KFUA 1I3QH 4POFA 4OWXB 3J7AV 2EIFA 3BDOA 2D0PA 1JOQA 3QWNA 4DGZA 1WD1A 1WTHA 3H0GG 2OTLA 3S2HH 1BCPF 2EJGC 4JG2A 4B9WA 1PH3A 2R7ZH 4IOCA 2FMMA 1JCKB 4ZAIA 2XN9C 3I4LA 4H02A 4OX9Q 1D2BA 1EFID 2XGTA 4MNOA 3HOVH 3RR5A 3GQBA 1O78A 2A69C 1G91A 1D5ZC 1BVSA 4A3MB 2DNCA 3BS1A 2NZHA 1PXUA 1SYEA 2JA6H 3DM3A 2Z9HA 4OXPA 3N6RA 4B3RL 1T5EA 1SNDA 1KAWA 1KXLA 1KLGD 1GJXA 4IPHA 2RDHA 4JBJA 2WB1E 3Q6SA 2ZJQA 3I56A 3PF4A 1YEZA 3I7FA 2HDMA 4JI7Q 1X32A 4A93H 1S4ZA 1F2LA 2A6HC 3NUCA 1PYSB 3TP7A 1A2TA 4JBMA 4KN4C 2PNRC 3I70A 2VXWA 4JK1C 5JOBA 3PQIA 4C56C 3ULPA 5C3EH 2MQHA 2IX1A 1U4PA 4DNRB 1N33L 4IUTA 4DUZL 1PH6A 4KTAA 5DLQE 1A3TA 1YNNC 2EXDA 2Q8IB 3MXNA 1LTAD 4HR7B 4GN5A 3TZDA 1HZCA 4C1NK 5C4HA 4BA1I 3C2PA 2KCMA 1PH1A 3TMEA 1DOKA 5C6AA 4EX5A 4B3SQ 4JI2Q 2IL8A 2Y0SG 2OXPA 4ME5A 3K58A 3GTGB 2IW3A 3OHXC 2BA0A 4IPDA 5M3MB 1STBA 2PYKA 4O1NA 3VR5A 4J8QA 2RSOA 1LABA 4L5TA 1EQTA 2IHEA 2UXCQ 1XNQL 3T1YL 5FOBB 4LF8L 1DZ1A 3BVMA 1KRSA 1VQPA 1DONA 1I94L 1XMQL 2D62A 2E2HH 3QIAA 3OMGA 2JN4A 5J3BA 3H3VI 3K7AH 4A3GG 4RGMA 3IFDA 2A68D 2L15A 1WTWA 3K5NA 3OIQA 2Z0SA 4A3JG 2SEBD 2HUGA 2EVBA 2QCPX 3TP8A 1WVLA 2KCTA 2YV5A 4DV5Q 3G6JB 1B2TA 1PTOD 3PF5A 5D65A 3S1QB 2B2UC 1QZHA 3F8TA 4QL5A 1BR9A 1JC7A 4M1UB 5CV5A 3D3RA 4DV7L 1CI3M 2B2TC 1IYVA 1I4PA 3M4PA 1PDQA 1SSOA 4A3KH 3BU2A 3H09A 1BOSA 1CTMA 3SK8A 3MXPA 5CYUA 2ZT9C 4DV3Q 2YU9B 4C3IB 1SYBA 2D9UA 5FLXL 4EVOA 4DXFA 2BCOA 4CKCA 5C4XH 1GM5A 3CCLA 1A2UA 1KHIA 4DV4Q 2CH4A 3CC7A 2AWNA 4QF4A 1X3PA 2UUCL 2R93H 4K8JA 1VQHA 1TWFH 2B3GA 1SE8A 1KD1C 4DFAA 3K0YA 3K5MA 5C0XG 1SJHD 3KF8A 5LMNQ 2VB2X 2HHHL 1FYCA 3H94A 2A8VA 3GTMH 1TQOA 1YVCA 2EY2A 4IFDJ 3Q0AA 3SK5A 1WTPA 1TWHH 4C3JG 3BDCA 2JA7B 1FNUA 1MGSA 1RF2D 5FLXE 3BZDB 1Y8OB 3K80C 1Y1VG 3BJUA 5A35A 2ASBA 4XT1B 5C3WA 1XPUA 1Y69U 1HTPA 1SROA 4UPAA 1AE3A 4P75A 4A3BB 5FO7B 3A55A 1D5MC 1XNRQ 2DUDA 1Y14B 3QJYA 1EY9A 1JB7A 1EIHA 2LXKA 2KEEA 1WYDA 1CSQA 5CMDA 4AQYL 4RGNA 5K36G 2AUKA 1LT6D 3DEOA 3GO5A 2DGYA 3F2DA 4I7AA 1A63A 4DV6L 5HURA 2QGQA 1XMOL 3M4OH 3FDTA 2B8FA 2VUMB 3PIOA 3TN2A 1G2SA 1SYCA 5ELCA 3TEHB 4HSPA 2E2JB 3VA5A 3S1RH 3SE0A 2BE5C 1EQQA 3HOVB 3JAML 1A15A 2SNMA 4BBRH 4HJ8A 3T16A 5IWAL 2JA5B 4BY7B 3WOFA 2E75C 5EAYA 1WCMB 2MO1A 4Y7NB 1GKHA 4LF9Q 2JA6B 4LFBL 3HOUB 1L2FA 2P5ZX 1HNZQ 4C3HB 1ET6A 1RDPD 4KHPL 5C4JB 1EFWA 5I6YA 1B1ZA 4IUUA 1L0YB 2AKWB 4JI1Q 1H9MA 5IP9H 4A93B 2PNHA 3I8ZA 3JAME 1TR5A 3A8KE 2OWOA 3HOWH 4MTNA 4UP9A 1HPCA 4PMBA 1PMRA 4KY5A 4BBSB 3HOXG 4C2MB 4DK1A 1K28A 4OX9L 2ZJPA 2E74C 1JWSD 3PCOB 4J1MA 3KLRA 2R3ZA 3W2DA 2F3WA 4MIUA 1TS2A 2GVBA 2ZXOA 2JK8A 2L1BA 3HKZB 3PIPA 3T4AC 3D31A 3EQLC 4ZCKA 2JSOA 2XIWA 4DV2Q 1GUOA 3SHLA 4A3FG 4ID6A 1PRTB 4HJ5A 4JI7L 1HZAA 5IE8A 4K6DA 2B63B 1H95A 1CZWA 4R4CA 3QR8A 2D2CC 2CHBD 2K5WA 4NMZA 4EQPA 1LV9A 2CQOA 2B2WA 1JWMD 4EQNA 2LKVA 1JE5A 1EZ6A 3E0JA 1EIYB 2E2HB 4OELB 3DMUA 1KQSA 1HCZA 1IKLA 2TSSA 4FO2A 4I7ZC 1TU2B 3NP8A 2AUJD 3A0JA 3I4NG 3QOJA 1H9KA 4F7XA 4GNXA 4QUCA 2RKSA 4B3SL 2Q2HA 4JI2L 3A8JE 1K0SA 1ESRA 3CD6A 1G51A 4L8JA 4K5XA 4CHTB 5BN5A 2Z4HA 3G48A 2NVTB 1EY5A 3E3XA 2PPBC 3I90A 3F2CA 2UXCL 1VQGA 1WTVA 3CCEA 3ERQA 1FR3A 1Y1WB 3CAMA 1H9SB 3U50C 3H3VH 1DOMA 5IOCA 4J15A 4JI5Q 2Y0SE 2RCNA 5K5PA 1W6KA 1X3FA 1V9PA 2WAQB 3KDFB 1GOZA 4RH6A 4A3EB 1JB3A 1ASZA 4YY3Q 3H3VC 4WFN3 5IGBA 1HR0Q 4HJAA 4IO9A 2AQ3B 3NHHA 1WI5A 2JE6I 4CDEC 3SVMA 2E8GA 2EYJA 4N8X1 4DV5L 4A3MG 2F03A 1Q1EA 1MSGA 1KRTA 3DXJC 3GTKB 4CKEA 4XQNA 2C35B 2H5XA 1IBLQ 4K8IA 2LY7A 1S5BD 4FYDA 4R9WA 5IP7H 4DV0Q 5GAGC 4JPBW 1YITA 4QB4A 3G6EA 1HA5A 1G8ZD 1DCZA 1TT2A 5EPJA 5FK9C 4XYOA 1JICA 1LT5D 3U4ZA 3RZDH 2VQFQ 3HOYB 2B2VA 1G291 3QG1A 5M3FH 1OO9B 2OQ0A 4DV3L 3S1NB 1IYJB 3GTOH 2ZTCA 3NELA 4JI6Q 3HOZB 1O7ZA 5GADC 2A69D 3EJIA 4DV4L 2PMZE 2HCCA 2L0CA 4A3DB 4FP5D 4XQQA 3MFYA 3WOEA 2K5DA 1EYDA 3EN2A 1EU4A 5C5LA 4P72A 5LMNL 3NWTA 1RJTA 5E7NA 2C9OA 3FMCA 4KY6A 4OWWB 3KBGA 3GV6A 4DR1Q 2Q8RE 4YCUA 2JA8B 3JC66 2A6HD 2MFIA 1H9JA 1E1OA 1TVXA 4K6LA 1K83B 2E2IH 4DAPA 4IN3A 1NR4A 2O4XA 5M3MG 1UNSA 1RODA 3UDIA 2F0OA 4WJWA 3VR6A 2IHFA 1XNRL 3I72A 5M5YB 1K3RA 3PV0A 5CGKA 4IOAA 2G5DA 4NW2A 4CDDC 5IYDG 1BCPC 1QB5D 1UE5A 1YNJC 5M5XH 5C0XI 1AZPA 1MI2A 3S1MB 2F0HA 5LHY1 1LT4D 1R9TH 4CGYB 1LTBD 5T1GA 3I4OA 1GVPA 1W2BA 2L9HA 1SJED 1G2TA 2NTTA 1K73C 1S3OA 1BF4A 3X3NA 1EEFD 1FNWA 2XRQD 4L6TB 5CBEE 1AW7A 2XTIA 4PZ6A 2LFNA 3NTHA 1PRTD 2XWJB 1QE6A 5CV4A 2F4VQ 1WD0A 1V43A 4BXXH 2WKCA 2EY5A 4KKUA 1EEID 3MXNB 2F0SA 2Z6BA 2PQAA 1FL0A 4YWLA 2YYZA 1JJ2A 1BNZA 4N8FA 4R4IA 5DM63 4R8NA 4LF9L 3FKIB 1UEBA 2MP1A 1HNZL 3RNUA 1CQVA 2NN6H 3EA6A 1YJNA 1PZID 4C3IG 3RLFA 3S15H 1AEXA 4RGTA 2SNSA 1TIID 1MD2D 4OIKA 2NWGA 4JI1L 5JJZA 4LMQD 3E6ZX 2J7ZA 1QNKA 4G7HC 3PO2H 2A1AA 3EBEA 3GTQB 1YHQA 1PFBA 2A74C 2Z6KA 4X66Q 4BA2I 2I46A 3U58A 3ULLA 5EQ0A 4GLXA 1SFOB 1K3BC 2KECA 2NBFA 4LUZA 3TREA 5M5WH 2X6GA 1EYCA 1RTOA 3CKIB 2B2WC 2N88A 4ZLTF 2K52A 2R92B 1CUKA 1L1OA 1T5XD 3HRZC 1VMPA 2EYFA 1VQNA 1N36Q 2JA7G 3HP3A 1NBWA 4J6HA 1A6XA 2NUCA 3PMFA 2K1BA 2VQEQ 3T53B 4A4IA 2ICIA 5FLMG 3G7LA 2K5HA 3E0EA 2EDGA 4A3LG 4RHSA 2J4XA 4KJNA 5HY6A 3E5SA 2NVXH 4GNXC 4DV2L 3N52A 3RZOH 4A3BG 2V4DA 4YWMA 3S16B 3VYTA 2CWPA 1PVOA 1A8VA 3H91A 2K6AA 2LMCB 1SNQA 4KKSA 1LTLA 1PFNA 1KL9A 1V1PA 2KBNA 2NZOA 1XTDA 5T1IA 3A54A 4K2LA 5C44G 4AIMA 1HRJA 3R2TA 5IGCA 3VA7A 1B44D 3CCRA 2EYLA 1NR2A 1TWCB 1M90C 4IUPA 2VUMG 4CDCC 4XQJA 1Q46A 3BVZA 2NZ1D 2A73B 5KYIA 3KF8B 2N78A 2JA9A 3HOVG 3VYRA 3CW2C 1LO5D 4GOPA 3A5ZB 2F0MA 4ME3A 2JA5G 4BY7G 3M9BA 4X6AH 1WCMG 4IUNA 2JA6G 5EKIA 3OW2A 4DK6C 4DAYA 1IZ6A 3HOUG 1TKWB 1Q86C 5IGEA 4C3HG 4BS9A 4Q5VA 2UUBQ 3GTPB 3M3YH 5JPNC 1TS3A 1QWYA 2HQLA 5ELBA 4FF1A 1Q82C 2PI2A 3T1HQ 2EZVA 2BDOA 1Q81C 5ELOA 2DNEA 3RZDB 4PNYA 1NNXA 4FF4A 4ZKBB 2B2VC 2BE5D 3SDZA 2RBMA 3VR3A 3S24A 4JI5L 1M4VA 3OTOQ 3M7NA 2AHOB 4BBSG 1JORA 3CCMA 4JV5L 1UUPA 4AYBB 4YY3L 1SMYC 1HR0L 4DR3Q 3VYSA 1ET9A 4K2KA 3TZUA 2L11A 2VB3X 5IYCH 4JC0A 1VQ9A 3HKZG 1IBLL 2K28A 1BBXC 4TQUS 5I2YA 2NVYH 4DV0L 4WRDA 2EY6A 1VQBA 4HN7A 1YZ6A 2PO4A 5DM73 3K59A 3SK6A 3NXWA 1FGBD 3K81C 3NEMA 3SXHA 2F0UA 3AYHB 2VQFL 1EUJA 2B2YA 2R61A 4OO1G 4N9TA 2B63G 4EGVA 3K0XA 4DN4M 4A3GH 5L37A 1BCPB 4JI6L 2L5TA 1NCVA 3PUZA 1OXTA 4UP8A 3HGBA 3PO3B 3OOCA 4A3JH 2R6GA 1I6HB 4KD4A 1LACA 1L0XB 4GN4B 4CKBA 1EQVA 4E6IA 3CPFA 5D3IB 1CKOA 2EQSA 2VY3A 3TP6A 1MIUA 3TS0A 4DR1L 4NXNQ 1VQDA 5EGTA 1SYFA 2FXQA 1I4XA 2RDFA 4YHHQ 1TWAB 4A3CH 2FMCA 1Z47A 4GZYC 3D4WA 5HGQA 3S14H 2K50A 1I6VC 5TSSA 3I3CA 1I5FA 3CCQA 1Z7TA 2JXMB 4G7ZC 4ODGA 2B8GA 1RHPA 3CMEA 2CWAA 2FJ2A 4R4OA 1Y1WG 5C3XA 1E0BA 1NE3A 2H4OA 4V190 2F0EA 3X3MA 5C0XH 2SDFA 1CA5A 1B9NA 2UXBQ 2WAQG 3KYHC 2KQ3A 5ELNA 1EY7A 4JVZA 4A3EG 4ZUIA 1LUZA 1EWIA 1PZJD 4Y52H 1YNXA 2VL6A 4UP7A 1IL8A 4JI8Q 4DAVA 2YTYA 4XT3B 5J22A 4C3JH 1WTQA 3PSIA 1HUNA 2F0DA 2Z6KC 3MEFA 2RVLA 1IHZA 4A3IB 4OIJA 3NE5B 4BY1B
chains in the Genus database with same CATH topology
4IUVA 2Z4IA 2WIIB 2F0QA 1ZEQX 5IGGA 3C46A 4N9PA 1WTOA 3SK4A 1GUNA 1BDOA 5F2DA 4FF3A 1JOOA 3QOLA 1XWEA 5JEAG 1SE2A 1SNMA 5K36H 2CW0C 2EJMA 3U9OA 1TWGB 2PW5A 4C1NI 3NTIA 1I3QB 3S2HB 2KUMA 3LWEA 2EYHA 2R7ZB 5IODA 2F0LA 5J39A 5IGDA 5EPLA 4I65A 2PQEA 1Q90A 1F9RA 3DWPA 2L12A 5E4XA 3SR1A 3KLSX 3NQTA 5G3LF 3W3AA 2XNAC 3HS0C 5LL6S 3KLSA 2NN6I 1SAPA 5D14A 4ZYSA 1ICWA 1B9MA 3BG3A 3PUYA 2RA4A 4KK7A 3T51B 1TY2A 2F0VA 3URYA 5C3EB 3EROA 5ELDA 2IT1A 1B53A 1S5DD 2PW7A 2Z1CA 3C1FA 3MC0B 1STYA 4ZK9B 5JVG3 4M8AA 3TSSA 1C8CA 5AFWA 1HXYD 2A68C 3A8IE 3DM1A 1E2VA 1PTOH 1BCPD 1YNJD 2VNUD 4DF7A 2PZWA 2NVYB 3EFXD 1LTTD 1O7YA 5FO8B 3D8GA 4DK0A 1UAPA 5I4DA 3UI2A 2F0JA 3DHQA 1GHKA 4S3SA 2B2YC 2K32A 1Q1BA 3K7AB 4G57A 3GD7A 1U4LA 3OIPA 5EKKA 2F0GA 4YIJA 3CRKC 5EBDA 1ENAA 1KNAA 2M2LA 3MEHA 2FFKB 2FINB 2I07B 5ELFA 5BN4A 3RD4A 5CORA 4XIGS 5JPMC 4ULLA 2WV6D 4RWSC 1QJOA 1OXXK 1VDZA 5I9PA 1IKMA 2X6LA 4A3KB 4KMUC 1ZKOA 3FVQA 4HSVA 1CK1A 3CRLC 2CVRA 4L63B 1D1IA 2Q8TA 1EL0A 1BXTA 4K5WA 5C4XB 1SDFA 2DN8A 2R93B 3BDLA 1TWFB 4IALA 1RD9D 5D3DA 3K57A 4UDUC 1NAPA 3GTMB 1I4GA 3J81L 1SXTA 1TWHB 3TBIB 4C3JB 4ABNA 3GP7A 1W6JA 5ISRA 3NBHA 1I4RA 3S9WA 2G9DA 4OO1I 1PTOF 2KA7A 4P2CB 2JEBI 1AZQA 2IJ0A 3J81E 2B39A 1HTLD 1VMCA 1XYIA 1STAA 2WACA 3OW7A 1R4PB 2JYOA 1F9SA 1C48A 3M4OB 1CM9A 1V1PB 3VYUA 1F2ZA 3LWUA 1B3AA 4RCOA 1AN8A 1DJRD 4XYQA 3S1RB 2IX3A 2PZTA 5KNCA 4FNFA 1DOLA 1LT3D 4LK1C 4BBRB 1CHPD 4U673 1GUWA 5C4ZA 1ILPA 1YNND 4R8IA 2AWOA 3IFTA 4NDXA 1LTGD 4XXEA 4X3UA 2HQEA 5KGUA 2E2DC 1TY0A 1KDCA 4PMCA 1SMYD 2L55A 1GUGA 3MAQA 2K01A 5CV7A 4B9XA 1E2ZA 5E4WC 3HOWB 3L9AX 3P75A 4CBVA 2F3VA 1MBYA 1ILQA 1U9RA 3NWSA 2B2UA 1KLUD 3NK9A 2B2TA 2C5CA 2OF1A 5EPKA 5KIXA 1H9RA 4F88A 2WINB 3I73A 1DM0B 1LTID 1HQRD 2ICEC 4NKLA 1F77A 1ZYRC 2WB1B 5KNBA 5DEHA 1RTNA 3FRPB 2QDBA 1II3A 3OWFA 1STEA 1G6ZA 4FXDA 1HFGA 4RHRA 3J7YW 5G3LD 1LLRD 3OPOA 3R8BA 1R4QB 4Q0FA 2JEAI 3MTSA 1RCVD 3FPUB 4U68A 2GA4B 3ND9A 4RKLA 3MXUA 4FVMA 3WDNA 3MWYW 3HG9A 1VCIA 3I4MB 4XDXA 4RFBA 1PZKD 3NPPA 4MN3A 3D6CA 4LJZC 4IFDG 2J0TD 1SEBD 4KV6A 1U4RA 4RAUC 5CV6A 2EYOA 2XSCA 1X3QA 3MZ5A 1LTRD 4JBWA 2O5JC 2IPKD 4KN7C 2OEOA 2MHVA 4Z9CB 2K7VA 4KY7A 2CQAA 1TS4A 1KTKA 1SNOA 1XTCD 4HAEA 2QEJC 2D5DA 2RDGA 5E1FA 1PFMA 1IW7C 2CW0D 1B50A 4FF2A 1KABA 1ESFA 3P7JA 4DU9A 4QMGA 3KUPA 1KNEA 1O7LA 2HCIA 2DY7A 3H6MA 1VF7A 2BA1A 5M3FB 2X69A 1PLFA 1XX8A 3TP5A 3GTOB 3CU7A 1GUTA 3D6WA 2SOBA 2A5HA 2EJFC 5IIFA 2ZXRA 1CZGA 1Q8IA 3D4DA 1Q3LA 3QO2A 1JE4A 4B08A 4QIWB 4ZKCB 1IYUA 4ZUJA 5I6WA 4HCEA 5CC4A 1XXGA 2KEDA 2E2IB 4DNTB 2KJXA 5CV9A 1QCBD 2BOSA 1F2MA 4OO1H 4IUQA 1EWHA 1PRTC 1BO0A 5EBCA 2EY1A 3RMHA 1OXSC 4G4KA 5M5XB 3KBXA 4HTHA 1R9TB 3I91A 1V1OA 1ML0D 2A6EC 3M7GA 4ZRZA 4RCNA 1SNCA 1JR0D 5ELEA 3GV3A 1D6EC 1I4QA 1QG7A 2PZUA 2IX0A 5J1ZA 2MGSA 3ITPA 2EYMA 2MJ8A 4NP5A 3VR4A 2FHTA 1S5ED 1RKNA 1WTXA 4HEDA 1EY8A 3S15B 4X3SA 1QNUA 2BDNA 3C1EA 1EZ8A 5JVH3 3Q22A 1DYQA 3V05A 3PO2B 4XTCS 2M9VA 5BN3A 5M5WB 2NTSA 1E2WA 1D5XC 2PCFB 3IL8A 1JOKA 4OHJA 3P1HA 5IT9L 4DA2A 4K5VA 5LL6X 1I4HA 4TSSA 2EYPA 2H1EA 1F9PA 3HEJA 4O42A 4CJ2C 5JEAH 3QB3A 5CR3A 2NVXB 3TDQA 3RZOB 3K6OA 1PRTF 1SNPA 5C5MA 1J9OA 1MSHA 1ENCA 2K05A 1A3VA 4UAIA 3H0GB 1Y8NB 5IT9E 3PUWA 3BYTB 3HZXA 3SEBA 5C44B 2RQXA 4HMJA 1S5FD 2DY8A 3R2IA 2N55A 2TMPA 1ENFA 1CHQD 2F1MA 2AQ1B 2AQ2B 2K5QA 1EY0A 1JQYD 2F0KA 1ONLA 1HFNA 1STHA 1LTSD 3BYYB 3V2TA 1SBBB 3MHBA 1K8OA 1OXVA 1EIGA 4HMIA 1AFPA 4K14A 3C3LA 3AU7A 1VF5C 3M3YB 4CJ0B 1S5CD 2NYZD 3S17B 4RGOS 3BVGA 3DWAA 3FEWX 1HQMC 2M00A 4ZQ3A 3RUZA 2JP1A 1GHJA 3PIO3 1QOHA 4KKTA 4KJOA 3MXGA 3LNNA 2K33A 4KHZA 2L4NA 1GXDC 4WORA 1Z6HA 1ZXTA 2KHSA 2F0PA 3A7AB 1BQQT 3J80L 2Y0SB 1Y8PB 2KCNA 3L7ZC 3GTLB 5KEEA 4KD3A 1PTOC 3MA2B 4PV1C 3NTKA 4IFDI 2F0FA 2F0TA 5I9OA 2EE1A 4FXGC 3M4YA 2O2LD 1EY4A 3IKJA 4A3GB 1B4OA 5COYA 2KVMA 5EKLA 3FPPA 2IWHA 3J80E 4X3KA 4A3JB 1M8AA 5NUCA 2EOTA 2XRSD 3PIP3 2F0NA 2PMZB 4EQOA 5C0XJ 3PUVA 3T56B 3CHBD 5FKAC 3AB9A 5CBAE 4QCLA 1ZYRD 1I50B 3S14B 4H44C 4H13C 4G7OC 1WTRA 2MPMA 2WP8J 5KYLA 1DD2A 1EY6A 1EOTA 1DXMA 4OGQC 3V96A 4TRDA 4LAAA 3OSOA 1K8MA 1FNVA 4IZ8A 5JEAJ 3CQZB 3A56A 2K03A 1NUCA 3OMCA 4QUFA 4PMWA 1AP0A 1SE3A 1Y1VB 3ND8A 4KHVA 4OL7A 1TS5A 3J7AF 2F4IA 3K5LA 4RA8A 1EYAA 3NBIA 1CA6A 3T13A 2RSNA 1KDAA 1SE4A 3Q24A 5DAUA 3GTJB 2EPBA 1CQFA 3OWEB 4IQZA 1F2YA 3R93A 2Z8LA 3A7LA 2KCCA 2QF7A 2MUYA 1CT1D 1HUMA 5EJWA 1IW7D 1HA6A 2NVQB 1QILA 3R3OA 5KNDA 4HCSA 1EU3A 4F8MA 3U9SA 2O5IC 3EVQA 5HGTA 1U4MA 4FXKC 2F0WA 2KOLA 4H0LC 5A2QL 1KAAA 2XWBB 4CJ1B 3Q23A 4ILWA 2F0IA 3MVVA 1UEAB 3NQIA 1J8IA 2HDLA 1V8QA 3NSWA 4F87A 3MFGA 3HOXB 4KI0A 1C4QA 3PUXA 5DNFA 1BUVT 3IAYA 1EWCA 1KDBA 4IURA 5A2QE 2ENBA 3S2DB 4RKBA 3F2UA 1JWUD 2ID0A 4TKOB 3O13A 3P20A 4DXGA 5JAVA 3AMUA 2NB0A 1SYDA 5KRUA 2G9HD 4BWGB 4A3FB 1H9SA 3KK7A 2EXZA 1PTOB 1STNA 3DWQA 5I2XA 4V0BA 2ZXPA 2OT2A 1HHVA 2NN6G 1FD7D 3L3OC 3ONAB 1NSNS 1Q12A 2A6ED 4H7BA 1GUSA 3LX0A 5FO9B 3DUZA 1SYGA 3DEPA 3M85A 1D1KA 2WKDA 3ZYYX 2QILA 5CV8A 2K04A 3K5OA 1A3UA 4MHEA 3I4NB 1CFMA 2E76C 1PYWD 3D4RA 5E3FA 5IGFA 1O80A 3VR2A 1OXUA 2XVSA 4X3TA 2QKIC 4IFDH 1F9QA 2LS01 4PQXA 5M9OA 1STGA 3J7AV 3BDOA 1JOQA 3QWNA 4DGZA 1WD1A 1BCPF 2EJGC 4B9WA 2FMMA 1JCKB 4ZAIA 2XN9C 3I4LA 1D2BA 1EFID 3GQBA 1O78A 2A69C 1G91A 1D5ZC 4A3MB 2DNCA 3BS1A 1PXUA 1SYEA 3N6RA 1T5EA 1SNDA 1KLGD 1GJXA 2RDHA 3Q6SA 2HDMA 1X32A 1S4ZA 1F2LA 2A6HC 3NUCA 3TP7A 1A2TA 4KN4C 2PNRC 3I70A 2VXWA 4JK1C 5JOBA 4C56C 2IX1A 1U4PA 4DNRB 4IUTA 4KTAA 1A3TA 1YNNC 2Q8IB 3MXNA 1LTAD 4HR7B 3TZDA 4C1NK 5C4HA 4BA1I 3C2PA 3TMEA 1DOKA 5C6AA 2IL8A 3K58A 2OXPA 4ME5A 3GTGB 2IW3A 3OHXC 2BA0A 5M3MB 1STBA 2PYKA 4O1NA 3VR5A 4J8QA 2RSOA 1LABA 1EQTA 5FOBB 1DZ1A 3BVMA 1DONA 2D62A 3QIAA 3OMGA 4RGMA 3IFDA 2A68D 1WTWA 3K5NA 3OIQA 2SEBD 2HUGA 2EVBA 2QCPX 3TP8A 1WVLA 3G6JB 1B2TA 1PTOD 5D65A 3S1QB 2B2UC 1BR9A 1JC7A 4M1UB 5CV5A 3D3RA 1CI3M 2B2TC 1IYVA 1I4PA 1PDQA 1SSOA 1BOSA 3H09A 1CTMA 3SK8A 3MXPA 5CYUA 2ZT9C 2YU9B 4C3IB 1SYBA 2D9UA 5FLXL 4EVOA 4DXFA 2BCOA 4CKCA 1A2UA 2AWNA 4QF4A 1X3PA 4K8JA 4DFAA 3K0YA 3K5MA 5C0XG 1SJHD 3KF8A 2VB2X 1FYCA 3H94A 1TQOA 2EY2A 4IFDJ 3Q0AA 3SK5A 1WTPA 4C3JG 3BDCA 2JA7B 1FNUA 1MGSA 1RF2D 5FLXE 3BZDB 1Y8OB 5A35A 4XT1B 5C3WA 1Y69U 1HTPA 4A3BB 5FO7B 3A55A 1D5MC 1EIHA 3QJYA 1EY9A 2KEEA 5CMDA 4RGNA 5K36G 2AUKA 1LT6D 3DEOA 3GO5A 5HURA 3FDTA 2B8FA 2VUMB 3TN2A 1G2SA 1SYCA 5ELCA 4HSPA 2E2JB 3VA5A 3SE0A 2BE5C 3HOVB 3JAML 1A15A 2SNMA 3T16A 2JA5B 4BY7B 3WOFA 2E75C 1WCMB 4Y7NB 2JA6B 3HOUB 4C3HB 1ET6A 1RDPD 5C4JB 5I6YA 1B1ZA 4IUUA 1L0YB 1H9MA 4A93B 3I8ZA 3JAME 1TR5A 3A8KE 1HPCA 4PMBA 1PMRA 4KY5A 4BBSB 4C2MB 4DK1A 2E74C 1JWSD 4J1MA 3KLRA 2R3ZA 3W2DA 2F3WA 4MIUA 1TS2A 2ZXOA 2L1BA 3HKZB 3T4AC 3D31A 3EQLC 2JSOA 2XIWA 1GUOA 3SHLA 4ID6A 1PRTB 4K6DA 2B63B 1CZWA 2D2CC 2CHBD 2K5WA 4NMZA 4EQPA 1LV9A 2B2WA 1JWMD 4EQNA 2LKVA 1EZ6A 3E0JA 2E2HB 3DMUA 1HCZA 1IKLA 2TSSA 4FO2A 4I7ZC 1TU2B 3NP8A 2AUJD 3QOJA 1H9KA 4F7XA 4QUCA 2RKSA 3A8JE 1ESRA 4L8JA 4K5XA 4CHTB 5BN5A 2Z4HA 2NVTB 1EY5A 2PPBC 3I90A 1WTVA 3ERQA 1FR3A 1Y1WB 1H9SB 1DOMA 5IOCA 5K5PA 1W6KA 2WAQB 1GOZA 4RH6A 4A3EB 1JB3A 3H3VC 4WFN3 5IGBA 2AQ3B 3NHHA 2JE6I 3SVMA 2EYJA 2F03A 1Q1EA 1MSGA 3GTKB 3DXJC 4CKEA 4XQNA 4K8IA 2LY7A 1S5BD 4FYDA 4R9WA 4QB4A 1HA5A 1G8ZD 1DCZA 1TT2A 5EPJA 5FK9C 4XYOA 1JICA 1LT5D 3HOYB 2B2VA 1G291 3QG1A 1OO9B 3S1NB 3HOZB 1O7ZA 2A69D 3EJIA 2HCCA 2L0CA 4A3DB 4FP5D 4XQQA 3MFYA 3WOEA 2K5DA 1EYDA 1EU4A 5C5LA 3NWTA 1RJTA 2C9OA 3FMCA 4KY6A 3KBGA 3GV6A 2Q8RE 2JA8B 2A6HD 1H9JA 1TVXA 4K6LA 1K83B 4DAPA 4IN3A 1NR4A 2O4XA 1UNSA 1RODA 2F0OA 4WJWA 3VR6A 3I72A 5M5YB 3PV0A 5CGKA 4NW2A 1BCPC 1QB5D 1YNJC 5C0XI 1AZPA 1MI2A 3S1MB 2F0HA 5LHY1 1LT4D 4CGYB 1LTBD 5T1GA 2L9HA 1SJED 1G2TA 2NTTA 1BF4A 3X3NA 1EEFD 1FNWA 2XRQD 4L6TB 5CBEE 1AW7A 2LFNA 3NTHA 1PRTD 2XWJB 1QE6A 5CV4A 1WD0A 1V43A 2WKCA 2EY5A 4KKUA 1EEID 2F0SA 2YYZA 1BNZA 5DM63 4R8NA 3FKIB 2MP1A 1CQVA 2NN6H 3EA6A 1PZID 4C3IG 3RLFA 1AEXA 4RGTA 2SNSA 1TIID 1MD2D 4OIKA 2NWGA 5JJZA 4LMQD 3E6ZX 2J7ZA 1QNKA 4G7HC 3GTQB 1PFBA 2A74C 4BA2I 2I46A 5EQ0A 1SFOB 2KECA 2NBFA 2X6GA 1EYCA 1RTOA 3CKIB 2B2WC 2N88A 4ZLTF 2R92B 1T5XD 3HRZC 1VMPA 2EYFA 3HP3A 4J6HA 1A6XA 2NUCA 3PMFA 2K1BA 3T53B 2ICIA 3G7LA 2EDGA 4RHSA 2J4XA 4KJNA 3E5SA 3N52A 2V4DA 3S16B 3VYTA 3H91A 2K6AA 2LMCB 1SNQA 4KKSA 1PFNA 1V1PA 5T1IA 3A54A 4K2LA 1HRJA 3R2TA 5IGCA 3VA7A 1B44D 2EYLA 1NR2A 1TWCB 4IUPA 4XQJA 3BVZA 2NZ1D 2A73B 5KYIA 3VYRA 1LO5D 2F0MA 4IUNA 5EKIA 4DAYA 1TKWB 5IGEA 4C3HG 4BS9A 4Q5VA 3GTPB 5JPNC 1TS3A 1QWYA 4FF1A 5ELBA 2EZVA 2BDOA 2DNEA 3RZDB 4PNYA 4FF4A 4ZKBB 2B2VC 2BE5D 3SDZA 2RBMA 3VR3A 1M4VA 3M7NA 1JORA 1UUPA 4AYBB 1SMYC 3VYSA 1ET9A 4K2KA 3TZUA 2L11A 2VB3X 2K28A 1BBXC 4TQUS 5I2YA 4WRDA 2EY6A 4HN7A 2PO4A 5DM73 3K59A 3SK6A 3NXWA 1FGBD 3SXHA 2F0UA 2B2YA 2R61A 4OO1G 4N9TA 4EGVA 4DN4M 1BCPB 2L5TA 1NCVA 3PUZA 1OXTA 3HGBA 3PO3B 3OOCA 2R6GA 1I6HB 4KD4A 1LACA 1L0XB 4CKBA 1EQVA 4E6IA 5D3IB 3TP6A 5EGTA 1SYFA 1I4XA 2RDFA 1TWAB 2FMCA 1Z47A 4GZYC 3D4WA 1I6VC 5TSSA 3I3CA 1Z7TA 2JXMB 4G7ZC 4ODGA 2B8GA 1RHPA 2FJ2A 5C3XA 1E0BA 2H4OA 4V190 2F0EA 3X3MA 5C0XH 2SDFA 1CA5A 1B9NA 2KQ3A 1EY7A 4ZUIA 1PZJD 1IL8A 4DAVA 1WTQA 4XT3B 5J22A 1HUNA 2F0DA 2RVLA 1IHZA 4A3IB 4OIJA 3NE5B 4BY1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NP5 A;  3DMU A;  5KYL A;  1JOQ A;  4KY6 A;  4DGZ A;  1EY6 A;  2EYF A;  5ISR A;  4B9W A;  2F0Q A;  1RKN A;  1SYC A;  3H6M A;  4TRD A;  5IGG A;  1EY8 A;  4J6H A;  4LAA A;  2NUC A;  3NP8 A;  4N9P A;  3OSO A;  3VA5 A;  3PMF A;  3S9W A;  3SK4 A;  4WRD A;  2EY6 A;  4IZ8 A;  5F2D A;  3QOJ A;  3C1E A;  4NKL A;  3TP8 A;  1EZ8 A;  4F7X A;  4DF7 A;  2PZW A;  2M00 A;  2RKS A;  3TP5 A;  1KDB A;  4KJN A;  4ZQ3 A;  1JOO A;  3QOL A;  3SK6 A;  2SNM A;  2SOB A;  3D8G A;  3E5S A;  1SNM A;  2O4X A;  3NXW A;  3RUZ A;  2ENB A;  5DEH A;  5IIF A;  1SYE A;  5IGF A;  3SXH A;  2QDB A;  3T16 A;  2F0U A;  1II3 A;  3OWF A;  4RKB A;  4KJO A;  1SND A;  5CV5 A;  1STA A;  4K5X A;  2F0O A;  2WAC A;  3D4D A;  1NUC A;  2F0J A;  3DHQ A;  3U9O A;  4N9T A;  2PW5 A;  3OMC A;  4WOR A;  4S3S A;  1EY5 A;  1SNQ A;  5CGK A;  4G57 A;  5JAV A;  2KHS A;  2F0P A;  4ZUJ A;  5EKK A;  1JOK A;  1SYD A;  1F2Z A;  2F0G A;  4KHV A;  4OL7 A;  5C5L A;  5KIX A;  3SK8 A;  5I6Y A;  5I6W A;  3ERQ A;  3MXP A;  2EYH A;  2EXZ A;  3P1H A;  4YIJ A;  5IOD A;  1STN A;  2F0L A;  4K2L A;  5IGD A;  1SYB A;  5KEE A;  3NUC A;  5CC4 A;  1EYA A;  3TP7 A;  4K5V A;  4KD3 A;  4EVO A;  1ENA A;  1A2T A;  4I65 A;  4KD4 A;  5IGC A;  5IOC A;  2F0H A;  3T13 A;  2PQE A;  1KDA A;  2EYP A;  2EYL A;  1A2U A;  5K5P A;  3HEJ A;  3MEH A;  5DAU A;  1TR5 A;  2PZT A;  1EQV A;  4E6I A;  4QF4 A;  4RKL A;  4K8J A;  3QB3 A;  5JOB A;  1F2Y A;  5CV9 A;  2F0F A;  2F0T A;  5CR3 A;  4PMB A;  4DFA A;  4KY5 A;  5IGB A;  3SR1 A;  3TP6 A;  1F2M A;  3NQT A;  3NHH A;  5I9O A;  5KYI A;  5C4Z A;  4KTA A;  1NSN S;  1SYF A;  5EGT A;  4H7B A;  2RDF A;  4J1M A;  3LX0 A;  5I9P A;  1A3T A;  1SNP A;  2EYJ A;  3D6C A;  4NDX A;  1TQO A;  5CV4 A;  1EY4 A;  2F3W A;  3D4W A;  5C5M A;  1ENC A;  2F0M A;  4MIU A;  1SYG A;  5EKL A;  2HQE A;  2EY5 A;  5KGU A;  2EY2 A;  2EY1 A;  1A3V A;  1KDC A;  2F0S A;  4K8I A;  3SK5 A;  5C4H A;  4IUN A;  4KV6 A;  3BDC A;  4PMC A;  5CV8 A;  3R3O A;  5CV6 A;  2EYO A;  1A3U A;  4ODG A;  3TME A;  3HZX A;  4QB4 A;  4R8N A;  4K5W A;  3MZ5 A;  5IGE A;  5C6A A;  2OXP A;  4HTH A;  4ME5 A;  4HMJ A;  5NUC A;  1TT2 A;  4F8M A;  5CV7 A;  4B9X A;  5C3W A;  3SHL A;  5C3X A;  2OEO A;  3BDL A;  4ID6 A;  1AEX A;  2F0N A;  4IAL A;  5E3F A;  1STB A;  2F0V A;  2F0E A;  2SNS A;  3ERO A;  3EVQ A;  4PNY A;  4EQO A;  3P75 A;  4KY7 A;  5HGT A;  2PYK A;  4K6D A;  1EY0 A;  1EY9 A;  2F0K A;  1SNO A;  2F3V A;  2KQ3 A;  2RBM A;  1U9R A;  1EY7 A;  1SNC A;  1STH A;  2F0W A;  3EJI A;  4ZUI A;  5J39 A;  5KRU A;  1KAA A;  4NMZ A;  5E1F A;  4EQP A;  2PW7 A;  1JOR A;  3NK9 A;  3V2T A;  3MHB A;  3C1F A;  5J22 A;  5M9O A;  2OF1 A;  1STY A;  1STG A;  2PZU A;  2F0D A;  4HMI A;  4EQN A;  1EYD A;  1EYC A;  1KAB A;  2F0I A;  2LKV A;  3OMG A;  5J1Z A;  1EZ6 A;  1IHZ A;  4QMG A;  4K14 A;  4DU9 A;  4K2K A;  3ITP A;  3MVV A;  2EYM A;  5HUR A; 
#chains in the Genus database with same CATH topology
 4IUV A;  1JJC B;  1NMF A;  1Y1V H;  2F4V L;  2Z4I A;  2WII B;  2F0Q A;  1ZEQ X;  4LF6 Q;  1L1O C;  5IGG A;  3C46 A;  4N9P A;  1WTO A;  3SK4 A;  1GUN A;  1BDO A;  5F2D A;  4FF3 A;  4GNX B;  3GTJ H;  1JOO A;  1NTG A;  3QOL A;  1XWE A;  4JW0 A;  3KF6 B;  5JEA G;  3HOY G;  1SE2 A;  1SNM A;  2ZM6 Q;  2ATW A;  5K36 H;  4P71 A;  2CW0 C;  4JI0 Q;  2EJM A;  3U9O A;  1EIF A;  4X64 Q;  1TWG B;  4L5S A;  2PW5 A;  3HOZ G;  4C1N I;  3NTI A;  1I3Q B;  4A3D G;  4R4T A;  4P74 A;  4IPG A;  4X66 L;  3S2H B;  2KUM A;  3LWE A;  2NVQ H;  2EYH A;  2R7Z B;  5IOD A;  1CKN A;  2F0L A;  5J39 A;  5IGD A;  5IYB G;  5EPL A;  1C0A A;  4I65 A;  1ICF B;  2PQE A;  4JCV E;  1Q90 A;  1F9R A;  3DWP A;  2L12 A;  5E4X A;  1FVI A;  1GD7 A;  2JA8 G;  3SR1 A;  3KLS X;  3NQT A;  5G3L F;  1N36 L;  1G6P A;  1VQ4 A;  2VQE L;  3W3A A;  2XNA C;  3HS0 C;  1VS0 A;  2DJG C;  4LW1 A;  5LL6 S;  2CH4 W;  2QEX A;  3KLS A;  2NN6 I;  1SAP A;  2UU9 Q;  4GOP C;  4RG1 A;  2CFM A;  5D14 A;  4ZYS A;  1FGU A;  3J80 i;  1ICW A;  1B9M A;  3BG3 A;  3PUY A;  2K4K A;  2RA4 A;  3GDE A;  4KK7 A;  3T51 B;  2BH2 A;  1PH7 A;  1VQM A;  3U4V A;  1TY2 A;  3A5U A;  2F0V A;  2QDL A;  4QJF A;  3URY A;  3ERO A;  5C3E B;  3HOX H;  5ELD A;  2OQK A;  3KJP A;  3CPW A;  1D7Q A;  3S2D H;  2IT1 A;  1B53 A;  1PH4 A;  1S5D D;  2PW7 A;  2Z1C A;  3C1F A;  3MC0 B;  3I2Z A;  1STY A;  4ZK9 B;  5JVG 3;  3KJO A;  4M8A A;  3TSS A;  1C8C A;  5AFW A;  1HXY D;  3J80 c;  2A68 C;  3A8I E;  3DM1 A;  4IJL A;  1E2V A;  2QA4 A;  1PTO H;  1BCP D;  1YNJ D;  4DR6 Q;  2VNU D;  2K14 A;  3FKI G;  2ZTE A;  4GKK Q;  5JJI A;  4DF7 A;  1HZ9 A;  2PZW A;  2NVY B;  3EFX D;  1LTT D;  1UWV A;  1O7Y A;  2UUB L;  1EOV A;  5FO8 B;  3D8G A;  4DK0 A;  1UAP A;  5I4D A;  3T1H L;  3UI2 A;  2F0J A;  3DHQ A;  1GHK A;  4S3S A;  2B2Y C;  2K32 A;  3J7A 5;  1Q1B A;  3K7A B;  4G57 A;  3GD7 A;  1U4L A;  3OIP A;  5EKK A;  3OTO L;  2F0G A;  4YIJ A;  4DAM A;  3CRK C;  5EBD A;  3I4N H;  1ENA A;  3E9H A;  1KNA A;  2M2L A;  2R92 G;  4DR3 L;  3K8A A;  3MEH A;  1Z9F A;  2FFK B;  2FIN B;  2GN5 A;  2I07 B;  5ELF A;  5LMU Q;  1A0I A;  5BN4 A;  3RD4 A;  2ZTD A;  1FJG Q;  5COR A;  4XIG S;  1MKH A;  5JPM C;  4ULL A;  2WV6 D;  3I4M H;  4RWS C;  3J81 i;  3HKS A;  1QJO A;  1OXX K;  1VDZ A;  5I9P A;  1IKM A;  2X6L A;  1S72 A;  2YTV A;  4A3K B;  4KMU C;  1ZKO A;  3FVQ A;  4HSV A;  1CK1 A;  3CRL C;  4AH6 A;  2CVR A;  4L63 B;  1D1I A;  1YJW A;  2Q8T A;  1EL0 A;  1BXT A;  4K5W A;  4B3T Q;  1P8L A;  4L5R C;  5C4X B;  4JV5 Q;  1SDF A;  3HKZ E;  2DN8 A;  2R93 B;  3BDL A;  1TWF B;  1VQO A;  1X65 A;  4IAL A;  3M4Q A;  1RD9 D;  1XJV A;  4X65 Q;  5D3D A;  4JOI A;  1N9W A;  2UXD Q;  3K57 A;  5AJ3 Q;  3J81 c;  4A3M H;  4UDU C;  1NAP A;  3GTM B;  3TQY A;  1I4G A;  3J81 L;  4GN3 B;  1SXT A;  2RHQ B;  1JJG A;  1TWH B;  1P16 A;  1X3E A;  4NXN L;  3TBI B;  4APV A;  3CCJ A;  4C3J B;  4ABN A;  3E9I A;  3GP7 A;  1VQA A;  4YHH L;  2RHS B;  1VQC A;  3B6Y A;  1W6J A;  2N8N A;  1L1O B;  2UUA Q;  1J5E L;  5ISR A;  3NBH A;  4NXM Q;  1X56 A;  2I5M X;  1I4R A;  3S9W A;  2G9D A;  4OO1 I;  1PTO F;  2KA7 A;  4P2C B;  5BR8 Q;  1X55 A;  2JEB I;  2Q2T A;  1AZQ A;  2IJ0 A;  3J81 E;  2B39 A;  1HTL D;  1VMC A;  1XYI A;  1STA A;  2WAC A;  3EIV A;  3OW7 A;  2E5L Q;  1R4P B;  2UXB L;  2JYO A;  3F2B A;  1MJC A;  1F9S A;  1C48 A;  3M4O B;  1CM9 A;  1V1P B;  3VYU A;  1F2Z A;  3LWU A;  1B3A A;  4AYB G;  4DR4 Q;  4RCO A;  4JI8 L;  1AN8 A;  1DJR D;  4XYQ A;  1PH5 A;  3S1R B;  2ES2 A;  3GTG H;  2ZJR A;  2HIX A;  2IX3 A;  2PZT A;  5KNC A;  4FNF A;  1DOL A;  1LT3 D;  2HIV A;  4LK1 C;  4BBR B;  1CHP D;  5M3M H;  2YTX A;  3CC4 A;  4U67 3;  1VQJ A;  1GUW A;  1IBK Q;  4LF6 L;  5C4Z A;  4IJH A;  2WAQ E;  1HNX Q;  1ILP A;  1YNN D;  4R8I A;  2AWO A;  3IFT A;  4NDX A;  4GOP B;  1LTG D;  1N34 Q;  4XXE A;  4X3U A;  1LYL A;  2HQE A;  2KHJ A;  2E2D C;  5KGU A;  1TY0 A;  1YI2 A;  4DUY Q;  1KDC A;  2ZM6 L;  2ALY B;  5IY0 A;  4PMC A;  1SMY D;  4DAY B;  4JI0 L;  3J81 j;  1K8A C;  1MJE A;  2L55 A;  4X64 L;  1VQ7 A;  3I55 A;  1GUG A;  3MAQ A;  2K01 A;  5CV7 A;  4B9X A;  1E2Z A;  3PO3 G;  5E4W C;  3HOW B;  3L9A X;  3P75 A;  4CBV A;  1PFS A;  3L0O A;  2F3V A;  1MBY A;  1ILQ A;  1U9R A;  1MHW C;  1T9H A;  3NWS A;  2B2U A;  1KLU D;  1YHA A;  4DR7 Q;  2A19 A;  3NK9 A;  3SGI A;  1CKM A;  2B2T A;  2C5C A;  2OF1 A;  5EPK A;  5KIX A;  1H9R A;  2KEN A;  4F88 A;  2WIN B;  1YJ9 A;  4DK3 C;  3I73 A;  4HID A;  1DM0 B;  1LTI D;  4C3I H;  2UU9 L;  4LFA Q;  5GAE C;  1IBM Q;  4LF4 Q;  4K0K Q;  1HQR D;  3CP0 A;  3CXC A;  4R1J A;  1SN8 A;  2ICE C;  4NKL A;  5FJ8 G;  1HNW Q;  1F77 A;  4NB3 A;  1ZYR C;  3KDF A;  2WB1 B;  5KNB A;  2Q2I A;  3BZK A;  4O2D A;  5DEH A;  1RTN A;  1Q8K A;  3FRP B;  2QDB A;  1VQ6 A;  1II3 A;  3OWF A;  1PYB A;  1STE A;  1G6Z A;  4FXD A;  2LSS A;  1HFG A;  4RHR A;  3J7Y W;  3STB C;  5G3L D;  1HH2 P;  1LLR D;  3OPO A;  4R4Q A;  3R8B A;  1BKB A;  5JJK A;  1WFQ A;  1R4Q B;  4Q0F A;  3OYY A;  3KLW A;  2JA7 H;  2JEA I;  4A3I G;  3MTS A;  1E7Z A;  1RCV D;  1C9O A;  1NMG A;  4BY1 G;  3FPU B;  5FLM H;  4HIM A;  1U5K A;  4U68 A;  4A3L H;  1WOC A;  2GA4 B;  3ND9 A;  4YCW A;  4RKL A;  3CCV A;  3MXU A;  4A3B H;  4FVM A;  3WDN A;  3MWY W;  4LF5 Q;  2R7F A;  3HG9 A;  1VCI A;  2AMC B;  3I4M B;  4DR6 L;  4RFB A;  4XDX A;  1PZK D;  3NPP A;  4MN3 A;  3D6C A;  4LJZ C;  4GKK L;  4IFD G;  3H0G H;  2J0T D;  1SEB D;  4KV6 A;  1U4R A;  4RAU C;  5C44 H;  5CV6 A;  2EYO A;  2XSC A;  1X3Q A;  3MZ5 A;  1LTR D;  4JBW A;  2O5J C;  1XPO A;  2VUM H;  2IPK D;  2K75 A;  4KN7 C;  4DPG A;  4L5Q A;  1M1K C;  2OEO A;  2R7Z G;  2MHV A;  2E2J H;  1AE2 A;  1VQF A;  2V1C C;  4Z9C B;  2K7V A;  4LUO A;  4KY7 A;  2CQA A;  1TS4 A;  1KTK A;  1SNO A;  1XTC D;  4HAE A;  2QEJ C;  2D5D A;  1E22 A;  1QUQ A;  1QVG A;  2RDG A;  5E1F A;  4JOI C;  2JA5 H;  5LMU L;  4JI3 Q;  4BY7 H;  1PFM A;  1IW7 C;  2CW0 D;  1B50 A;  4FF2 A;  1FJG L;  1WCM H;  4Y7N H;  1KAB A;  1ESF A;  3P7J A;  1OTC A;  4DU9 A;  3HOU H;  4QMG A;  3KUP A;  4C3H H;  3S17 H;  5C4J H;  1KNE A;  2I0Q A;  1O7L A;  2HCI A;  2VS1 A;  5LMN W;  4A93 G;  2DY7 A;  3H6M A;  3H15 A;  1VF7 A;  3CF5 A;  2BA1 A;  1NY4 A;  5M3F B;  2X69 A;  1PLF A;  1XX8 A;  3TP5 A;  3GTO B;  3CU7 A;  1GUT A;  3D6W A;  2SOB A;  4B3T L;  4B3M Q;  2JJQ A;  2A5H A;  2EJF C;  5IIF A;  4BBS H;  4OEM B;  2ZXR A;  5C3E G;  1CZG A;  4C2M H;  1Q8I A;  3D4D A;  1UE7 A;  2MO0 A;  1Q3L A;  3QO2 A;  1JE4 A;  4B08 A;  4LFC Q;  4QIW B;  4X65 L;  1X9N A;  1JT8 A;  4HIO A;  4DV1 Q;  4HJ9 A;  4ZKC B;  4DR5 Q;  1IYU A;  2UXD L;  5AJ3 L;  4ZUJ A;  3CMA A;  3GTL H;  2JQO A;  5I6W A;  1TXY A;  2LXJ A;  4HCE A;  1CKN B;  5CC4 A;  1XXG A;  3J7Z C;  2KED A;  4HJ7 A;  4RMF A;  5IYC G;  2E2I B;  4DNT B;  2KJX A;  2MNA A;  5CV9 A;  1QCB D;  2BOS A;  4POG A;  2UUA L;  4PZ7 A;  1B70 B;  4NXM L;  1F2M A;  1EYG A;  1YHB A;  4OO1 H;  2B63 H;  4IUQ A;  1EWH A;  1PRT C;  3K7U C;  5BR8 L;  3CCS A;  4JBK A;  3G4S A;  1BO0 A;  5EBC A;  2EY1 A;  5GQO A;  3RMH A;  3HFZ B;  1VQI A;  1OXS C;  1RIP A;  3AQQ A;  1V1Q A;  4G4K A;  5M5X B;  1N8R C;  3KBX A;  2E5L L;  4HTH A;  3PGZ A;  1R9T B;  2I5H A;  3I91 A;  1V1O A;  4DR4 L;  3LGJ A;  1ML0 D;  2A6E C;  1JMC A;  1W3S A;  3M7G A;  3Q8D A;  4ZRZ A;  4RCN A;  1I50 H;  1J5E Q;  1SNC A;  1JR0 D;  5ELE A;  3KOJ A;  3GV3 A;  1D6E C;  1I4Q A;  4GKJ Q;  1QG7 A;  1B3Q A;  2PZU A;  2IX0 A;  5J1Z A;  2MGS A;  1IBK L;  2NVT H;  3IRB A;  5GAH C;  3ITP A;  2EYM A;  1HNX L;  4DNI A;  2OCE A;  2MJ8 A;  4NP5 A;  3VR4 A;  1VQ8 A;  4A3K G;  4A3C G;  1QVF A;  4AYB E;  1N34 L;  2D0O A;  2FHT A;  1Y1W H;  1S5E D;  1RKN A;  1WTX A;  1Q7Y C;  4DUY L;  4HED A;  1EY8 A;  5FLX c;  3S15 B;  4X3S A;  4QIW E;  1QNU A;  2BDN A;  5C4X G;  3C1E A;  1EZ8 A;  5JVH 3;  3Q22 A;  4A3E H;  2R7D A;  3CQZ H;  1O7I A;  1DYQ A;  3V05 A;  2R93 G;  3PO2 B;  4EQ5 A;  4XTC S;  5GRO A;  2M9V A;  5BN3 A;  5M5W B;  1VQ5 A;  4QGU A;  1X3G A;  2NTS A;  1E2W A;  1QZG A;  1D5X C;  3GTK H;  2PCF B;  3IL8 A;  1JOK A;  1VQE A;  5IT9 c;  4MTK A;  4DR7 L;  4OHJ A;  3P1H A;  4WJ4 A;  5IT9 L;  4DA2 A;  1E24 A;  4K5V A;  1HZB A;  5LL6 X;  1NJI C;  1I4H A;  4TSS A;  2EYP A;  2H1E A;  1F9P A;  3HEJ A;  4O42 A;  4CJ2 C;  5JEA H;  3HOY H;  1LM0 A;  3QB3 A;  2K5V A;  5CR3 A;  2NVX B;  3TDQ A;  3JAM i;  3RZO B;  3S1N H;  4LFA L;  1IBM L;  4LF4 L;  3K6O A;  4K0K L;  1PRT F;  3HOZ H;  1SNP A;  5C5M A;  1J9O A;  1MSH A;  1ENC A;  1HNW L;  4A3D H;  4IPC A;  2K05 A;  1A3V A;  4UAI A;  4GLA C;  3H0G B;  1PH8 A;  1Y8N B;  2Q2U A;  5IT9 E;  3PUW A;  3BYT B;  5IYB H;  3HZX A;  3SEB A;  2BH8 A;  5C44 B;  2RQX A;  4HMJ A;  1S5F D;  2DY8 A;  4PG3 A;  3R2I A;  2N55 A;  4X62 Q;  2JA8 H;  1BBW A;  2TMP A;  2IY5 B;  1ENF A;  1CHQ D;  2F1M A;  2AQ1 B;  2AQ2 B;  3UDF A;  4JYA Q;  2K5Q A;  1EY0 A;  1K83 H;  1JQY D;  3JAM c;  2B29 A;  2F0K A;  1ONL A;  1HFN A;  3G71 A;  1STH A;  1SLJ A;  1LTS D;  4HIK A;  4BBR G;  3BYY B;  3V2T A;  1SBB B;  3MHB A;  1K8O A;  1OXV A;  1EIG A;  4HMI A;  2CKZ B;  1AFP A;  4LF5 L;  5M5Y H;  4K14 A;  2VW9 A;  2RCF A;  1J6Q A;  3C3L A;  3AU7 A;  1HR0 W;  1VF5 C;  3M3Y B;  4CJ0 B;  1S5C D;  2NYZ D;  3S17 B;  2VZA A;  4YCV A;  1WJJ A;  3NBH B;  4DR2 Q;  4RGO S;  3BVG A;  3DWA A;  5IP9 G;  3FEW X;  3S1M H;  1HQM C;  1SR3 A;  2M00 A;  3ICE A;  4ZQ3 A;  1E1T A;  2JP1 A;  1GHJ A;  3FP9 A;  3RUZ A;  3PIO 3;  3HOW G;  1QOH A;  4KKT A;  4JI4 Q;  4KJO A;  3MXG A;  3LNN A;  4LF7 Q;  2K33 A;  4KHZ A;  3ULJ A;  2L4N A;  1GXD C;  1N32 Q;  4WOR A;  1Z6H A;  1ZXT A;  4OON A;  1E3P A;  2KHS A;  2F0P A;  4A3F H;  3A7A B;  1BQQ T;  3J80 L;  2Y0S B;  1Y8P B;  2KCN A;  2N49 A;  1B7Y B;  4JI3 L;  3L7Z C;  3GTL B;  5KEE A;  5H1S E;  4KD3 A;  4QY7 A;  3FKI H;  1PTO C;  1EQR A;  3MA2 B;  4PV1 C;  1PV4 A;  1PHJ A;  3NTK A;  4IFD I;  2F0F A;  2F0T A;  1X6O A;  3FHW A;  1C7Y A;  1K8G A;  5I9O A;  4UY8 C;  2EE1 A;  2N3S A;  4FXG C;  3M4Y A;  2O2L D;  4UHV A;  3GTQ H;  2WB1 G;  1EY4 A;  3IKJ A;  4A3G B;  1B4O A;  5COY A;  2KVM A;  5EKL A;  3FPP A;  2IWH A;  3J80 E;  1SFO H;  4X3K A;  4B3M L;  2K5N A;  4A3J B;  2R92 H;  4FDB A;  1HJP A;  1IXR A;  4LFC L;  1M8A A;  4DV1 L;  1X54 A;  5NUC A;  4DR5 L;  2EOT A;  4NPS A;  4B3R Q;  3D0F A;  3W5O A;  2XRS D;  1KC8 C;  3PIP 3;  2F0N A;  1YBY A;  2PMZ B;  4EQO A;  5C0X J;  3PUV A;  3ER0 A;  3T56 B;  3CHB D;  4GS3 A;  5FKA C;  3AB9 A;  5CBA E;  3RN2 A;  1ZYR D;  4QCL A;  1I50 B;  2PQA B;  3KF6 A;  3ZJY C;  2F3I A;  1SMX A;  3S14 B;  1YIJ A;  3S16 H;  2KHI A;  4H44 C;  3I4M G;  4LUV A;  4H13 C;  2GVA A;  4G7O C;  1WTR A;  3STB D;  2MPM A;  3F1Z A;  2WP8 J;  1B8A A;  3W1G A;  5KYL A;  1DD2 A;  1U0L A;  4YWK A;  1L0W A;  1EY6 A;  1EOT A;  1N33 Q;  1DXM A;  4OGQ C;  3V96 A;  4DUZ Q;  4TRD A;  4LAA A;  1BBU A;  3RN5 A;  3TRZ A;  3OSO A;  4LWC A;  1K8M A;  1FNV A;  1TWC H;  4IZ8 A;  4ALP A;  1UE6 A;  2HD3 A;  4KLK A;  5JEA J;  3CQZ B;  3A56 A;  1GO3 E;  2K03 A;  1NUC A;  2OTJ A;  1K0R A;  3OMC A;  4QUF A;  4PMW A;  2HT1 A;  1AP0 A;  1SE3 A;  1Y1V B;  3ND8 A;  4KHV A;  3ERS X;  4OL7 A;  1TS5 A;  3NEN A;  3J7A F;  2F4I A;  4GKJ L;  5IP7 G;  3K5L A;  4RA8 A;  1EYA A;  3NBI A;  3W1B A;  1CA6 A;  3T13 A;  2RSN A;  3GTP H;  1KDA A;  1XNQ Q;  1SE4 A;  3Q24 A;  5DAU A;  3T1Y Q;  4LF8 Q;  3GTJ B;  2EPB A;  1CQF A;  3OWE B;  4IQZ A;  1F2Y A;  3R93 A;  2Z8L A;  3A7L A;  1I94 Q;  1XMQ Q;  2KCC A;  5M3F G;  1PA6 A;  4DKA C;  2QF7 A;  2CCZ A;  1VQL A;  2MUY A;  1CT1 D;  1DGS A;  1HUM A;  4O0A A;  1ASY A;  5EJW A;  2F52 A;  3DLL A;  1IW7 D;  1HA6 A;  2NVQ B;  1QIL A;  3R3O A;  3VDY A;  5KND A;  1AH9 A;  4HCS A;  3A74 A;  3AEV A;  1EU3 A;  4F8M A;  4QQB X;  3U9S A;  1XPR A;  4PZ8 A;  2O5I C;  4DV7 Q;  1KIX A;  3EVQ A;  5HGT A;  3AFQ A;  4WJ3 M;  1U4M A;  4FXK C;  3BZC A;  2F0W A;  5IYD H;  3CC2 A;  2KOL A;  4H0L C;  5A2Q L;  1QUQ B;  1KAA A;  2XWB B;  2RF4 A;  4CJ1 B;  3Q23 A;  4ILW A;  3UDG A;  2F0I A;  3WWV A;  3MVV A;  1UEA B;  3NQI A;  1J8I A;  2UUC Q;  2HDL A;  4LNQ A;  3PO3 H;  1V8Q A;  4MZ9 A;  3NSW A;  4OWT B;  1I6H H;  4F87 A;  3MFG A;  3HOX B;  4KI0 A;  2HHH Q;  1C4Q A;  3PUX A;  5DNF A;  1RL2 A;  1VQK A;  3S1Q H;  1BUV T;  3IAY A;  1EWC A;  1KDB A;  4IUR A;  5A2Q E;  2ENB A;  3S2D B;  4RKB A;  4X62 L;  3F2U A;  1JWU D;  4P73 A;  2ID0 A;  1QVC A;  4TKO B;  3O13 A;  1TWA H;  1SRU A;  4JYA L;  3P20 A;  1PH2 A;  3UDX A;  4DXG A;  4CDF C;  5JAV A;  2NB0 A;  4A76 A;  3AMU A;  4BXX G;  1SYD A;  3UE0 A;  5KRU A;  2G9H D;  4BWG B;  2YU9 H;  4A3F B;  1H9S A;  3KK7 A;  2EXZ A;  1PTO B;  1STN A;  3RLN A;  3DWQ A;  1K9M C;  5I2X A;  4GLV B;  4V0B A;  5JJL A;  2ZXP A;  5FJ8 H;  3L2P A;  4AQY Q;  2WFW A;  2OT2 A;  1HHV A;  1CSP A;  2NN6 G;  1S40 A;  1UE1 A;  3TS2 A;  1FD7 D;  4TVA B;  4DR2 L;  3L3O C;  4DV6 Q;  3ONA B;  1NSN S;  1Q12 A;  2A6E D;  4H7B A;  1GUS A;  1XMO Q;  2QW7 A;  3LX0 A;  5FO9 B;  3DUZ A;  3PO2 G;  1SYG A;  3DEP A;  3CCU A;  3M85 A;  1A62 A;  1D1K A;  2WKD A;  3UE1 A;  4JI4 L;  2DJF C;  3ZYY X;  4A3I H;  2QIL A;  5CV8 A;  2K04 A;  3K5O A;  1A3U A;  4LF7 L;  4MHE A;  4BY1 H;  3I4N B;  1CFM A;  1N32 L;  3AFP A;  3RLO A;  2E76 C;  1PH9 A;  5IWA Q;  1PYW D;  3D4R A;  5E3F A;  5IGF A;  1O80 A;  3VR2 A;  1OXU A;  4LFB Q;  2XVS A;  2PI2 E;  4A75 A;  1IL2 A;  4KHP Q;  2I5L X;  4X3T A;  2QKI C;  4IFD H;  1F9Q A;  2LS0 1;  4PQX A;  5M9O A;  1STG A;  1TWG H;  1D8L A;  3KFU A;  1I3Q H;  4POF A;  4OWX B;  3J7A V;  2EIF A;  3BDO A;  2D0P A;  1JOQ A;  3QWN A;  4DGZ A;  1WD1 A;  1WTH A;  3H0G G;  2OTL A;  3S2H H;  1BCP F;  2EJG C;  4JG2 A;  4B9W A;  1PH3 A;  2R7Z H;  4IOC A;  2FMM A;  1JCK B;  4ZAI A;  2XN9 C;  3I4L A;  4H02 A;  4OX9 Q;  1D2B A;  1EFI D;  2XGT A;  4MNO A;  3HOV H;  3RR5 A;  3GQB A;  1O78 A;  2A69 C;  1G91 A;  1D5Z C;  1BVS A;  4A3M B;  2DNC A;  3BS1 A;  2NZH A;  1PXU A;  1SYE A;  2JA6 H;  3DM3 A;  2Z9H A;  4OXP A;  3N6R A;  4B3R L;  1T5E A;  1SND A;  1KAW A;  1KXL A;  1KLG D;  1GJX A;  4IPH A;  2RDH A;  4JBJ A;  2WB1 E;  3Q6S A;  2ZJQ A;  3I56 A;  3PF4 A;  1YEZ A;  3I7F A;  2HDM A;  4JI7 Q;  1X32 A;  4A93 H;  1S4Z A;  1F2L A;  2A6H C;  3NUC A;  1PYS B;  3TP7 A;  1A2T A;  4JBM A;  4KN4 C;  2PNR C;  3I70 A;  2VXW A;  4JK1 C;  5JOB A;  3PQI A;  4C56 C;  3ULP A;  5C3E H;  2MQH A;  2IX1 A;  1U4P A;  4DNR B;  1N33 L;  4IUT A;  4DUZ L;  1PH6 A;  4KTA A;  5DLQ E;  1A3T A;  1YNN C;  2EXD A;  2Q8I B;  3MXN A;  1LTA D;  4HR7 B;  4GN5 A;  3TZD A;  1HZC A;  4C1N K;  5C4H A;  4BA1 I;  3C2P A;  2KCM A;  1PH1 A;  3TME A;  1DOK A;  5C6A A;  4EX5 A;  4B3S Q;  4JI2 Q;  2IL8 A;  2Y0S G;  2OXP A;  4ME5 A;  3K58 A;  3GTG B;  2IW3 A;  3OHX C;  2BA0 A;  4IPD A;  5M3M B;  1STB A;  2PYK A;  4O1N A;  3VR5 A;  4J8Q A;  2RSO A;  1LAB A;  4L5T A;  1EQT A;  2IHE A;  2UXC Q;  1XNQ L;  3T1Y L;  5FOB B;  4LF8 L;  1DZ1 A;  3BVM A;  1KRS A;  1VQP A;  1DON A;  1I94 L;  1XMQ L;  2D62 A;  2E2H H;  3QIA A;  3OMG A;  2JN4 A;  5J3B A;  3H3V I;  3K7A H;  4A3G G;  4RGM A;  3IFD A;  2A68 D;  2L15 A;  1WTW A;  3K5N A;  3OIQ A;  2Z0S A;  4A3J G;  2SEB D;  2HUG A;  2EVB A;  2QCP X;  3TP8 A;  1WVL A;  2KCT A;  2YV5 A;  4DV5 Q;  3G6J B;  1B2T A;  1PTO D;  3PF5 A;  5D65 A;  3S1Q B;  2B2U C;  1QZH A;  3F8T A;  4QL5 A;  1BR9 A;  1JC7 A;  4M1U B;  5CV5 A;  3D3R A;  4DV7 L;  1CI3 M;  2B2T C;  1IYV A;  1I4P A;  3M4P A;  1PDQ A;  1SSO A;  4A3K H;  3BU2 A;  3H09 A;  1BOS A;  1CTM A;  3SK8 A;  3MXP A;  5CYU A;  2ZT9 C;  4DV3 Q;  2YU9 B;  4C3I B;  1SYB A;  2D9U A;  5FLX L;  4EVO A;  4DXF A;  2BCO A;  4CKC A;  5C4X H;  1GM5 A;  3CCL A;  1A2U A;  1KHI A;  4DV4 Q;  2CH4 A;  3CC7 A;  2AWN A;  4QF4 A;  1X3P A;  2UUC L;  2R93 H;  4K8J A;  1VQH A;  1TWF H;  2B3G A;  1SE8 A;  1KD1 C;  4DFA A;  3K0Y A;  3K5M A;  5C0X G;  1SJH D;  3KF8 A;  5LMN Q;  2VB2 X;  2HHH L;  1FYC A;  3H94 A;  2A8V A;  3GTM H;  1TQO A;  1YVC A;  2EY2 A;  4IFD J;  3Q0A A;  3SK5 A;  1WTP A;  1TWH H;  4C3J G;  3BDC A;  2JA7 B;  1FNU A;  1MGS A;  1RF2 D;  5FLX E;  3BZD B;  1Y8O B;  3K80 C;  1Y1V G;  3BJU A;  5A35 A;  2ASB A;  4XT1 B;  5C3W A;  1XPU A;  1Y69 U;  1HTP A;  1SRO A;  4UPA A;  1AE3 A;  4P75 A;  4A3B B;  5FO7 B;  3A55 A;  1D5M C;  1XNR Q;  2DUD A;  1Y14 B;  3QJY A;  1EY9 A;  1JB7 A;  1EIH A;  2LXK A;  2KEE A;  1WYD A;  1CSQ A;  5CMD A;  4AQY L;  4RGN A;  5K36 G;  2AUK A;  1LT6 D;  3DEO A;  3GO5 A;  2DGY A;  3F2D A;  4I7A A;  1A63 A;  4DV6 L;  5HUR A;  2QGQ A;  1XMO L;  3M4O H;  3FDT A;  2B8F A;  2VUM B;  3PIO A;  3TN2 A;  1G2S A;  1SYC A;  5ELC A;  3TEH B;  4HSP A;  2E2J B;  3VA5 A;  3S1R H;  3SE0 A;  2BE5 C;  1EQQ A;  3HOV B;  3JAM L;  1A15 A;  2SNM A;  4BBR H;  4HJ8 A;  3T16 A;  5IWA L;  2JA5 B;  4BY7 B;  3WOF A;  2E75 C;  5EAY A;  1WCM B;  2MO1 A;  4Y7N B;  1GKH A;  4LF9 Q;  2JA6 B;  4LFB L;  3HOU B;  1L2F A;  2P5Z X;  1HNZ Q;  4C3H B;  1ET6 A;  1RDP D;  4KHP L;  5C4J B;  1EFW A;  5I6Y A;  1B1Z A;  4IUU A;  1L0Y B;  2AKW B;  4JI1 Q;  1H9M A;  5IP9 H;  4A93 B;  2PNH A;  3I8Z A;  3JAM E;  1TR5 A;  3A8K E;  2OWO A;  3HOW H;  4MTN A;  4UP9 A;  1HPC A;  4PMB A;  1PMR A;  4KY5 A;  4BBS B;  3HOX G;  4C2M B;  4DK1 A;  1K28 A;  4OX9 L;  2ZJP A;  2E74 C;  1JWS D;  3PCO B;  4J1M A;  3KLR A;  2R3Z A;  3W2D A;  2F3W A;  4MIU A;  1TS2 A;  2GVB A;  2ZXO A;  2JK8 A;  2L1B A;  3HKZ B;  3PIP A;  3T4A C;  3D31 A;  3EQL C;  4ZCK A;  2JSO A;  2XIW A;  4DV2 Q;  1GUO A;  3SHL A;  4A3F G;  4ID6 A;  1PRT B;  4HJ5 A;  4JI7 L;  1HZA A;  5IE8 A;  4K6D A;  2B63 B;  1H95 A;  1CZW A;  4R4C A;  3QR8 A;  2D2C C;  2CHB D;  2K5W A;  4NMZ A;  4EQP A;  1LV9 A;  2CQO A;  2B2W A;  1JWM D;  4EQN A;  2LKV A;  1JE5 A;  1EZ6 A;  3E0J A;  1EIY B;  2E2H B;  4OEL B;  3DMU A;  1KQS A;  1HCZ A;  1IKL A;  2TSS A;  4FO2 A;  4I7Z C;  1TU2 B;  3NP8 A;  2AUJ D;  3A0J A;  3I4N G;  3QOJ A;  1H9K A;  4F7X A;  4GNX A;  4QUC A;  2RKS A;  4B3S L;  2Q2H A;  4JI2 L;  3A8J E;  1K0S A;  1ESR A;  3CD6 A;  1G51 A;  4L8J A;  4K5X A;  4CHT B;  5BN5 A;  2Z4H A;  3G48 A;  2NVT B;  1EY5 A;  3E3X A;  2PPB C;  3I90 A;  3F2C A;  2UXC L;  1VQG A;  1WTV A;  3CCE A;  3ERQ A;  1FR3 A;  1Y1W B;  3CAM A;  1H9S B;  3U50 C;  3H3V H;  1DOM A;  5IOC A;  4J15 A;  4JI5 Q;  2Y0S E;  2RCN A;  5K5P A;  1W6K A;  1X3F A;  1V9P A;  2WAQ B;  3KDF B;  1GOZ A;  4RH6 A;  4A3E B;  1JB3 A;  1ASZ A;  4YY3 Q;  3H3V C;  4WFN 3;  5IGB A;  1HR0 Q;  4HJA A;  4IO9 A;  2AQ3 B;  3NHH A;  1WI5 A;  2JE6 I;  4CDE C;  3SVM A;  2E8G A;  2EYJ A;  4N8X 1;  4DV5 L;  4A3M G;  2F03 A;  1Q1E A;  1MSG A;  1KRT A;  3DXJ C;  3GTK B;  4CKE A;  4XQN A;  2C35 B;  2H5X A;  1IBL Q;  4K8I A;  2LY7 A;  1S5B D;  4FYD A;  4R9W A;  5IP7 H;  4DV0 Q;  5GAG C;  4JPB W;  1YIT A;  4QB4 A;  3G6E A;  1HA5 A;  1G8Z D;  1DCZ A;  1TT2 A;  5EPJ A;  5FK9 C;  4XYO A;  1JIC A;  1LT5 D;  3U4Z A;  3RZD H;  2VQF Q;  3HOY B;  2B2V A;  1G29 1;  3QG1 A;  5M3F H;  1OO9 B;  2OQ0 A;  4DV3 L;  3S1N B;  1IYJ B;  3GTO H;  2ZTC A;  3NEL A;  4JI6 Q;  3HOZ B;  1O7Z A;  5GAD C;  2A69 D;  3EJI A;  4DV4 L;  2PMZ E;  2HCC A;  2L0C A;  4A3D B;  4FP5 D;  4XQQ A;  3MFY A;  3WOE A;  2K5D A;  1EYD A;  3EN2 A;  1EU4 A;  5C5L A;  4P72 A;  5LMN L;  3NWT A;  1RJT A;  5E7N A;  2C9O A;  3FMC A;  4KY6 A;  4OWW B;  3KBG A;  3GV6 A;  4DR1 Q;  2Q8R E;  4YCU A;  2JA8 B;  3JC6 6;  2A6H D;  2MFI A;  1H9J A;  1E1O A;  1TVX A;  4K6L A;  1K83 B;  2E2I H;  4DAP A;  4IN3 A;  1NR4 A;  2O4X A;  5M3M G;  1UNS A;  1ROD A;  3UDI A;  2F0O A;  4WJW A;  3VR6 A;  2IHF A;  1XNR L;  3I72 A;  5M5Y B;  1K3R A;  3PV0 A;  5CGK A;  4IOA A;  2G5D A;  4NW2 A;  4CDD C;  5IYD G;  1BCP C;  1QB5 D;  1UE5 A;  1YNJ C;  5M5X H;  5C0X I;  1AZP A;  1MI2 A;  3S1M B;  2F0H A;  5LHY 1;  1LT4 D;  1R9T H;  4CGY B;  1LTB D;  5T1G A;  3I4O A;  1GVP A;  1W2B A;  2L9H A;  1SJE D;  1G2T A;  2NTT A;  1K73 C;  1S3O A;  1BF4 A;  3X3N A;  1EEF D;  1FNW A;  2XRQ D;  4L6T B;  5CBE E;  1AW7 A;  2XTI A;  4PZ6 A;  2LFN A;  3NTH A;  1PRT D;  2XWJ B;  1QE6 A;  5CV4 A;  2F4V Q;  1WD0 A;  1V43 A;  4BXX H;  2WKC A;  2EY5 A;  4KKU A;  1EEI D;  3MXN B;  2F0S A;  2Z6B A;  2PQA A;  1FL0 A;  4YWL A;  2YYZ A;  1JJ2 A;  1BNZ A;  4N8F A;  4R4I A;  5DM6 3;  4R8N A;  4LF9 L;  3FKI B;  1UEB A;  2MP1 A;  1HNZ L;  3RNU A;  1CQV A;  2NN6 H;  3EA6 A;  1YJN A;  1PZI D;  4C3I G;  3RLF A;  3S15 H;  1AEX A;  4RGT A;  2SNS A;  1TII D;  1MD2 D;  4OIK A;  2NWG A;  4JI1 L;  5JJZ A;  4LMQ D;  3E6Z X;  2J7Z A;  1QNK A;  4G7H C;  3PO2 H;  2A1A A;  3EBE A;  3GTQ B;  1YHQ A;  1PFB A;  2A74 C;  2Z6K A;  4X66 Q;  4BA2 I;  2I46 A;  3U58 A;  3ULL A;  5EQ0 A;  4GLX A;  1SFO B;  1K3B C;  2KEC A;  2NBF A;  4LUZ A;  3TRE A;  5M5W H;  2X6G A;  1EYC A;  1RTO A;  3CKI B;  2B2W C;  2N88 A;  4ZLT F;  2K52 A;  2R92 B;  1CUK A;  1L1O A;  1T5X D;  3HRZ C;  1VMP A;  2EYF A;  1VQN A;  1N36 Q;  2JA7 G;  3HP3 A;  1NBW A;  4J6H A;  1A6X A;  2NUC A;  3PMF A;  2K1B A;  2VQE Q;  3T53 B;  4A4I A;  2ICI A;  5FLM G;  3G7L A;  2K5H A;  3E0E A;  2EDG A;  4A3L G;  4RHS A;  2J4X A;  4KJN A;  5HY6 A;  3E5S A;  2NVX H;  4GNX C;  4DV2 L;  3N52 A;  3RZO H;  4A3B G;  2V4D A;  4YWM A;  3S16 B;  3VYT A;  2CWP A;  1PVO A;  1A8V A;  3H91 A;  2K6A A;  2LMC B;  1SNQ A;  4KKS A;  1LTL A;  1PFN A;  1KL9 A;  1V1P A;  2KBN A;  2NZO A;  1XTD A;  5T1I A;  3A54 A;  4K2L A;  5C44 G;  4AIM A;  1HRJ A;  3R2T A;  5IGC A;  3VA7 A;  1B44 D;  3CCR A;  2EYL A;  1NR2 A;  1TWC B;  1M90 C;  4IUP A;  2VUM G;  4CDC C;  4XQJ A;  1Q46 A;  3BVZ A;  2NZ1 D;  2A73 B;  5KYI A;  3KF8 B;  2N78 A;  2JA9 A;  3HOV G;  3VYR A;  3CW2 C;  1LO5 D;  4GOP A;  3A5Z B;  2F0M A;  4ME3 A;  2JA5 G;  4BY7 G;  3M9B A;  4X6A H;  1WCM G;  4IUN A;  2JA6 G;  5EKI A;  3OW2 A;  4DK6 C;  4DAY A;  1IZ6 A;  3HOU G;  1TKW B;  1Q86 C;  5IGE A;  4C3H G;  4BS9 A;  4Q5V A;  2UUB Q;  3GTP B;  3M3Y H;  5JPN C;  1TS3 A;  1QWY A;  2HQL A;  5ELB A;  4FF1 A;  1Q82 C;  2PI2 A;  3T1H Q;  2EZV A;  2BDO A;  1Q81 C;  5ELO A;  2DNE A;  3RZD B;  4PNY A;  1NNX A;  4FF4 A;  4ZKB B;  2B2V C;  2BE5 D;  3SDZ A;  2RBM A;  3VR3 A;  3S24 A;  4JI5 L;  1M4V A;  3OTO Q;  3M7N A;  2AHO B;  4BBS G;  1JOR A;  3CCM A;  4JV5 L;  1UUP A;  4AYB B;  4YY3 L;  1SMY C;  1HR0 L;  4DR3 Q;  3VYS A;  1ET9 A;  4K2K A;  3TZU A;  2L11 A;  2VB3 X;  5IYC H;  4JC0 A;  1VQ9 A;  3HKZ G;  1IBL L;  2K28 A;  1BBX C;  4TQU S;  5I2Y A;  2NVY H;  4DV0 L;  4WRD A;  2EY6 A;  1VQB A;  4HN7 A;  1YZ6 A;  2PO4 A;  5DM7 3;  3K59 A;  3SK6 A;  3NXW A;  1FGB D;  3K81 C;  3NEM A;  3SXH A;  2F0U A;  3AYH B;  2VQF L;  1EUJ A;  2B2Y A;  2R61 A;  4OO1 G;  4N9T A;  2B63 G;  4EGV A;  3K0X A;  4DN4 M;  4A3G H;  5L37 A;  1BCP B;  4JI6 L;  2L5T A;  1NCV A;  3PUZ A;  1OXT A;  4UP8 A;  3HGB A;  3PO3 B;  3OOC A;  4A3J H;  2R6G A;  1I6H B;  4KD4 A;  1LAC A;  1L0X B;  4GN4 B;  4CKB A;  1EQV A;  4E6I A;  3CPF A;  5D3I B;  1CKO A;  2EQS A;  2VY3 A;  3TP6 A;  1MIU A;  3TS0 A;  4DR1 L;  4NXN Q;  1VQD A;  5EGT A;  1SYF A;  2FXQ A;  1I4X A;  2RDF A;  4YHH Q;  1TWA B;  4A3C H;  2FMC A;  1Z47 A;  4GZY C;  3D4W A;  5HGQ A;  3S14 H;  2K50 A;  1I6V C;  5TSS A;  3I3C A;  1I5F A;  3CCQ A;  1Z7T A;  2JXM B;  4G7Z C;  4ODG A;  2B8G A;  1RHP A;  3CME A;  2CWA A;  2FJ2 A;  4R4O A;  1Y1W G;  5C3X A;  1E0B A;  1NE3 A;  2H4O A;  4V19 0;  2F0E A;  3X3M A;  5C0X H;  2SDF A;  1CA5 A;  1B9N A;  2UXB Q;  2WAQ G;  3KYH C;  2KQ3 A;  5ELN A;  1EY7 A;  4JVZ A;  4A3E G;  4ZUI A;  1LUZ A;  1EWI A;  1PZJ D;  4Y52 H;  1YNX A;  2VL6 A;  4UP7 A;  1IL8 A;  4JI8 Q;  4DAV A;  2YTY A;  4XT3 B;  5J22 A;  4C3J H;  1WTQ A;  3PSI A;  1HUN A;  2F0D A;  2Z6K C;  3MEF A;  2RVL A;  1IHZ A;  4A3I B;  4OIJ A;  3NE5 B;  4BY1 B; 
#chains in the Genus database with same CATH homology
 4IUV A;  2Z4I A;  2WII B;  2F0Q A;  1ZEQ X;  5IGG A;  3C46 A;  4N9P A;  1WTO A;  3SK4 A;  1GUN A;  1BDO A;  5F2D A;  4FF3 A;  1JOO A;  3QOL A;  1XWE A;  5JEA G;  1SE2 A;  1SNM A;  5K36 H;  2CW0 C;  2EJM A;  3U9O A;  1TWG B;  2PW5 A;  4C1N I;  3NTI A;  1I3Q B;  3S2H B;  2KUM A;  3LWE A;  2EYH A;  2R7Z B;  5IOD A;  2F0L A;  5J39 A;  5IGD A;  5EPL A;  4I65 A;  2PQE A;  1Q90 A;  1F9R A;  3DWP A;  2L12 A;  5E4X A;  3SR1 A;  3KLS X;  3NQT A;  5G3L F;  3W3A A;  2XNA C;  3HS0 C;  5LL6 S;  3KLS A;  2NN6 I;  1SAP A;  5D14 A;  4ZYS A;  1ICW A;  1B9M A;  3BG3 A;  3PUY A;  2RA4 A;  4KK7 A;  3T51 B;  1TY2 A;  2F0V A;  3URY A;  5C3E B;  3ERO A;  5ELD A;  2IT1 A;  1B53 A;  1S5D D;  2PW7 A;  2Z1C A;  3C1F A;  3MC0 B;  1STY A;  4ZK9 B;  5JVG 3;  4M8A A;  3TSS A;  1C8C A;  5AFW A;  1HXY D;  2A68 C;  3A8I E;  3DM1 A;  1E2V A;  1PTO H;  1BCP D;  1YNJ D;  2VNU D;  4DF7 A;  2PZW A;  2NVY B;  3EFX D;  1LTT D;  1O7Y A;  5FO8 B;  3D8G A;  4DK0 A;  1UAP A;  5I4D A;  3UI2 A;  2F0J A;  3DHQ A;  1GHK A;  4S3S A;  2B2Y C;  2K32 A;  1Q1B A;  3K7A B;  4G57 A;  3GD7 A;  1U4L A;  3OIP A;  5EKK A;  2F0G A;  4YIJ A;  3CRK C;  5EBD A;  1ENA A;  1KNA A;  2M2L A;  3MEH A;  2FFK B;  2FIN B;  2I07 B;  5ELF A;  5BN4 A;  3RD4 A;  5COR A;  4XIG S;  5JPM C;  4ULL A;  2WV6 D;  4RWS C;  1QJO A;  1OXX K;  1VDZ A;  5I9P A;  1IKM A;  2X6L A;  4A3K B;  4KMU C;  1ZKO A;  3FVQ A;  4HSV A;  1CK1 A;  3CRL C;  2CVR A;  4L63 B;  1D1I A;  2Q8T A;  1EL0 A;  1BXT A;  4K5W A;  5C4X B;  1SDF A;  2DN8 A;  2R93 B;  3BDL A;  1TWF B;  4IAL A;  1RD9 D;  5D3D A;  3K57 A;  4UDU C;  1NAP A;  3GTM B;  1I4G A;  3J81 L;  1SXT A;  1TWH B;  3TBI B;  4C3J B;  4ABN A;  3GP7 A;  1W6J A;  5ISR A;  3NBH A;  1I4R A;  3S9W A;  2G9D A;  4OO1 I;  1PTO F;  2KA7 A;  4P2C B;  2JEB I;  1AZQ A;  2IJ0 A;  3J81 E;  2B39 A;  1HTL D;  1VMC A;  1XYI A;  1STA A;  2WAC A;  3OW7 A;  1R4P B;  2JYO A;  1F9S A;  1C48 A;  3M4O B;  1CM9 A;  1V1P B;  3VYU A;  1F2Z A;  3LWU A;  1B3A A;  4RCO A;  1AN8 A;  1DJR D;  4XYQ A;  3S1R B;  2IX3 A;  2PZT A;  5KNC A;  4FNF A;  1DOL A;  1LT3 D;  4LK1 C;  4BBR B;  1CHP D;  4U67 3;  1GUW A;  5C4Z A;  1ILP A;  1YNN D;  4R8I A;  2AWO A;  3IFT A;  4NDX A;  1LTG D;  4XXE A;  4X3U A;  2HQE A;  5KGU A;  2E2D C;  1TY0 A;  1KDC A;  4PMC A;  1SMY D;  2L55 A;  1GUG A;  3MAQ A;  2K01 A;  5CV7 A;  4B9X A;  1E2Z A;  5E4W C;  3HOW B;  3L9A X;  3P75 A;  4CBV A;  2F3V A;  1MBY A;  1ILQ A;  1U9R A;  3NWS A;  2B2U A;  1KLU D;  3NK9 A;  2B2T A;  2C5C A;  2OF1 A;  5EPK A;  5KIX A;  1H9R A;  4F88 A;  2WIN B;  3I73 A;  1DM0 B;  1LTI D;  1HQR D;  2ICE C;  4NKL A;  1F77 A;  1ZYR C;  2WB1 B;  5KNB A;  5DEH A;  1RTN A;  3FRP B;  2QDB A;  1II3 A;  3OWF A;  1STE A;  1G6Z A;  4FXD A;  1HFG A;  4RHR A;  3J7Y W;  5G3L D;  1LLR D;  3OPO A;  3R8B A;  1R4Q B;  4Q0F A;  2JEA I;  3MTS A;  1RCV D;  3FPU B;  4U68 A;  2GA4 B;  3ND9 A;  4RKL A;  3MXU A;  4FVM A;  3WDN A;  3MWY W;  3HG9 A;  1VCI A;  3I4M B;  4XDX A;  4RFB A;  1PZK D;  3NPP A;  4MN3 A;  3D6C A;  4LJZ C;  4IFD G;  2J0T D;  1SEB D;  4KV6 A;  1U4R A;  4RAU C;  5CV6 A;  2EYO A;  2XSC A;  1X3Q A;  3MZ5 A;  1LTR D;  4JBW A;  2O5J C;  2IPK D;  4KN7 C;  2OEO A;  2MHV A;  4Z9C B;  2K7V A;  4KY7 A;  2CQA A;  1TS4 A;  1KTK A;  1SNO A;  1XTC D;  4HAE A;  2QEJ C;  2D5D A;  2RDG A;  5E1F A;  1PFM A;  1IW7 C;  2CW0 D;  1B50 A;  4FF2 A;  1KAB A;  1ESF A;  3P7J A;  4DU9 A;  4QMG A;  3KUP A;  1KNE A;  1O7L A;  2HCI A;  2DY7 A;  3H6M A;  1VF7 A;  2BA1 A;  5M3F B;  2X69 A;  1PLF A;  1XX8 A;  3TP5 A;  3GTO B;  3CU7 A;  1GUT A;  3D6W A;  2SOB A;  2A5H A;  2EJF C;  5IIF A;  2ZXR A;  1CZG A;  1Q8I A;  3D4D A;  1Q3L A;  3QO2 A;  1JE4 A;  4B08 A;  4QIW B;  4ZKC B;  1IYU A;  4ZUJ A;  5I6W A;  4HCE A;  5CC4 A;  1XXG A;  2KED A;  2E2I B;  4DNT B;  2KJX A;  5CV9 A;  1QCB D;  2BOS A;  1F2M A;  4OO1 H;  4IUQ A;  1EWH A;  1PRT C;  1BO0 A;  5EBC A;  2EY1 A;  3RMH A;  1OXS C;  4G4K A;  5M5X B;  3KBX A;  4HTH A;  1R9T B;  3I91 A;  1V1O A;  1ML0 D;  2A6E C;  3M7G A;  4ZRZ A;  4RCN A;  1SNC A;  1JR0 D;  5ELE A;  3GV3 A;  1D6E C;  1I4Q A;  1QG7 A;  2PZU A;  2IX0 A;  5J1Z A;  2MGS A;  3ITP A;  2EYM A;  2MJ8 A;  4NP5 A;  3VR4 A;  2FHT A;  1S5E D;  1RKN A;  1WTX A;  4HED A;  1EY8 A;  3S15 B;  4X3S A;  1QNU A;  2BDN A;  3C1E A;  1EZ8 A;  5JVH 3;  3Q22 A;  1DYQ A;  3V05 A;  3PO2 B;  4XTC S;  2M9V A;  5BN3 A;  5M5W B;  2NTS A;  1E2W A;  1D5X C;  2PCF B;  3IL8 A;  1JOK A;  4OHJ A;  3P1H A;  5IT9 L;  4DA2 A;  4K5V A;  5LL6 X;  1I4H A;  4TSS A;  2EYP A;  2H1E A;  1F9P A;  3HEJ A;  4O42 A;  4CJ2 C;  5JEA H;  3QB3 A;  5CR3 A;  2NVX B;  3TDQ A;  3RZO B;  3K6O A;  1PRT F;  1SNP A;  5C5M A;  1J9O A;  1MSH A;  1ENC A;  2K05 A;  1A3V A;  4UAI A;  3H0G B;  1Y8N B;  5IT9 E;  3PUW A;  3BYT B;  3HZX A;  3SEB A;  5C44 B;  2RQX A;  4HMJ A;  1S5F D;  2DY8 A;  3R2I A;  2N55 A;  2TMP A;  1ENF A;  1CHQ D;  2F1M A;  2AQ1 B;  2AQ2 B;  2K5Q A;  1EY0 A;  1JQY D;  2F0K A;  1ONL A;  1HFN A;  1STH A;  1LTS D;  3BYY B;  3V2T A;  1SBB B;  3MHB A;  1K8O A;  1OXV A;  1EIG A;  4HMI A;  1AFP A;  4K14 A;  3C3L A;  3AU7 A;  1VF5 C;  3M3Y B;  4CJ0 B;  1S5C D;  2NYZ D;  3S17 B;  4RGO S;  3BVG A;  3DWA A;  3FEW X;  1HQM C;  2M00 A;  4ZQ3 A;  3RUZ A;  2JP1 A;  1GHJ A;  3PIO 3;  1QOH A;  4KKT A;  4KJO A;  3MXG A;  3LNN A;  2K33 A;  4KHZ A;  2L4N A;  1GXD C;  4WOR A;  1Z6H A;  1ZXT A;  2KHS A;  2F0P A;  3A7A B;  1BQQ T;  3J80 L;  2Y0S B;  1Y8P B;  2KCN A;  3L7Z C;  3GTL B;  5KEE A;  4KD3 A;  1PTO C;  3MA2 B;  4PV1 C;  3NTK A;  4IFD I;  2F0F A;  2F0T A;  5I9O A;  2EE1 A;  4FXG C;  3M4Y A;  2O2L D;  1EY4 A;  3IKJ A;  4A3G B;  1B4O A;  5COY A;  2KVM A;  5EKL A;  3FPP A;  2IWH A;  3J80 E;  4X3K A;  4A3J B;  1M8A A;  5NUC A;  2EOT A;  2XRS D;  3PIP 3;  2F0N A;  2PMZ B;  4EQO A;  5C0X J;  3PUV A;  3T56 B;  3CHB D;  5FKA C;  3AB9 A;  5CBA E;  4QCL A;  1ZYR D;  1I50 B;  3S14 B;  4H44 C;  4H13 C;  4G7O C;  1WTR A;  2MPM A;  2WP8 J;  5KYL A;  1DD2 A;  1EY6 A;  1EOT A;  1DXM A;  4OGQ C;  3V96 A;  4TRD A;  4LAA A;  3OSO A;  1K8M A;  1FNV A;  4IZ8 A;  5JEA J;  3CQZ B;  3A56 A;  2K03 A;  1NUC A;  3OMC A;  4QUF A;  4PMW A;  1AP0 A;  1SE3 A;  1Y1V B;  3ND8 A;  4KHV A;  4OL7 A;  1TS5 A;  3J7A F;  2F4I A;  3K5L A;  4RA8 A;  1EYA A;  3NBI A;  1CA6 A;  3T13 A;  2RSN A;  1KDA A;  1SE4 A;  3Q24 A;  5DAU A;  3GTJ B;  2EPB A;  1CQF A;  3OWE B;  4IQZ A;  1F2Y A;  3R93 A;  2Z8L A;  3A7L A;  2KCC A;  2QF7 A;  2MUY A;  1CT1 D;  1HUM A;  5EJW A;  1IW7 D;  1HA6 A;  2NVQ B;  1QIL A;  3R3O A;  5KND A;  4HCS A;  1EU3 A;  4F8M A;  3U9S A;  2O5I C;  3EVQ A;  5HGT A;  1U4M A;  4FXK C;  2F0W A;  2KOL A;  4H0L C;  5A2Q L;  1KAA A;  2XWB B;  4CJ1 B;  3Q23 A;  4ILW A;  2F0I A;  3MVV A;  1UEA B;  3NQI A;  1J8I A;  2HDL A;  1V8Q A;  3NSW A;  4F87 A;  3MFG A;  3HOX B;  4KI0 A;  1C4Q A;  3PUX A;  5DNF A;  1BUV T;  3IAY A;  1EWC A;  1KDB A;  4IUR A;  5A2Q E;  2ENB A;  3S2D B;  4RKB A;  3F2U A;  1JWU D;  2ID0 A;  4TKO B;  3O13 A;  3P20 A;  4DXG A;  5JAV A;  3AMU A;  2NB0 A;  1SYD A;  5KRU A;  2G9H D;  4BWG B;  4A3F B;  1H9S A;  3KK7 A;  2EXZ A;  1PTO B;  1STN A;  3DWQ A;  5I2X A;  4V0B A;  2ZXP A;  2OT2 A;  1HHV A;  2NN6 G;  1FD7 D;  3L3O C;  3ONA B;  1NSN S;  1Q12 A;  2A6E D;  4H7B A;  1GUS A;  3LX0 A;  5FO9 B;  3DUZ A;  1SYG A;  3DEP A;  3M85 A;  1D1K A;  2WKD A;  3ZYY X;  2QIL A;  5CV8 A;  2K04 A;  3K5O A;  1A3U A;  4MHE A;  3I4N B;  1CFM A;  2E76 C;  1PYW D;  3D4R A;  5E3F A;  5IGF A;  1O80 A;  3VR2 A;  1OXU A;  2XVS A;  4X3T A;  2QKI C;  4IFD H;  1F9Q A;  2LS0 1;  4PQX A;  5M9O A;  1STG A;  3J7A V;  3BDO A;  1JOQ A;  3QWN A;  4DGZ A;  1WD1 A;  1BCP F;  2EJG C;  4B9W A;  2FMM A;  1JCK B;  4ZAI A;  2XN9 C;  3I4L A;  1D2B A;  1EFI D;  3GQB A;  1O78 A;  2A69 C;  1G91 A;  1D5Z C;  4A3M B;  2DNC A;  3BS1 A;  1PXU A;  1SYE A;  3N6R A;  1T5E A;  1SND A;  1KLG D;  1GJX A;  2RDH A;  3Q6S A;  2HDM A;  1X32 A;  1S4Z A;  1F2L A;  2A6H C;  3NUC A;  3TP7 A;  1A2T A;  4KN4 C;  2PNR C;  3I70 A;  2VXW A;  4JK1 C;  5JOB A;  4C56 C;  2IX1 A;  1U4P A;  4DNR B;  4IUT A;  4KTA A;  1A3T A;  1YNN C;  2Q8I B;  3MXN A;  1LTA D;  4HR7 B;  3TZD A;  4C1N K;  5C4H A;  4BA1 I;  3C2P A;  3TME A;  1DOK A;  5C6A A;  2IL8 A;  3K58 A;  2OXP A;  4ME5 A;  3GTG B;  2IW3 A;  3OHX C;  2BA0 A;  5M3M B;  1STB A;  2PYK A;  4O1N A;  3VR5 A;  4J8Q A;  2RSO A;  1LAB A;  1EQT A;  5FOB B;  1DZ1 A;  3BVM A;  1DON A;  2D62 A;  3QIA A;  3OMG A;  4RGM A;  3IFD A;  2A68 D;  1WTW A;  3K5N A;  3OIQ A;  2SEB D;  2HUG A;  2EVB A;  2QCP X;  3TP8 A;  1WVL A;  3G6J B;  1B2T A;  1PTO D;  5D65 A;  3S1Q B;  2B2U C;  1BR9 A;  1JC7 A;  4M1U B;  5CV5 A;  3D3R A;  1CI3 M;  2B2T C;  1IYV A;  1I4P A;  1PDQ A;  1SSO A;  1BOS A;  3H09 A;  1CTM A;  3SK8 A;  3MXP A;  5CYU A;  2ZT9 C;  2YU9 B;  4C3I B;  1SYB A;  2D9U A;  5FLX L;  4EVO A;  4DXF A;  2BCO A;  4CKC A;  1A2U A;  2AWN A;  4QF4 A;  1X3P A;  4K8J A;  4DFA A;  3K0Y A;  3K5M A;  5C0X G;  1SJH D;  3KF8 A;  2VB2 X;  1FYC A;  3H94 A;  1TQO A;  2EY2 A;  4IFD J;  3Q0A A;  3SK5 A;  1WTP A;  4C3J G;  3BDC A;  2JA7 B;  1FNU A;  1MGS A;  1RF2 D;  5FLX E;  3BZD B;  1Y8O B;  5A35 A;  4XT1 B;  5C3W A;  1Y69 U;  1HTP A;  4A3B B;  5FO7 B;  3A55 A;  1D5M C;  1EIH A;  3QJY A;  1EY9 A;  2KEE A;  5CMD A;  4RGN A;  5K36 G;  2AUK A;  1LT6 D;  3DEO A;  3GO5 A;  5HUR A;  3FDT A;  2B8F A;  2VUM B;  3TN2 A;  1G2S A;  1SYC A;  5ELC A;  4HSP A;  2E2J B;  3VA5 A;  3SE0 A;  2BE5 C;  3HOV B;  3JAM L;  1A15 A;  2SNM A;  3T16 A;  2JA5 B;  4BY7 B;  3WOF A;  2E75 C;  1WCM B;  4Y7N B;  2JA6 B;  3HOU B;  4C3H B;  1ET6 A;  1RDP D;  5C4J B;  5I6Y A;  1B1Z A;  4IUU A;  1L0Y B;  1H9M A;  4A93 B;  3I8Z A;  3JAM E;  1TR5 A;  3A8K E;  1HPC A;  4PMB A;  1PMR A;  4KY5 A;  4BBS B;  4C2M B;  4DK1 A;  2E74 C;  1JWS D;  4J1M A;  3KLR A;  2R3Z A;  3W2D A;  2F3W A;  4MIU A;  1TS2 A;  2ZXO A;  2L1B A;  3HKZ B;  3T4A C;  3D31 A;  3EQL C;  2JSO A;  2XIW A;  1GUO A;  3SHL A;  4ID6 A;  1PRT B;  4K6D A;  2B63 B;  1CZW A;  2D2C C;  2CHB D;  2K5W A;  4NMZ A;  4EQP A;  1LV9 A;  2B2W A;  1JWM D;  4EQN A;  2LKV A;  1EZ6 A;  3E0J A;  2E2H B;  3DMU A;  1HCZ A;  1IKL A;  2TSS A;  4FO2 A;  4I7Z C;  1TU2 B;  3NP8 A;  2AUJ D;  3QOJ A;  1H9K A;  4F7X A;  4QUC A;  2RKS A;  3A8J E;  1ESR A;  4L8J A;  4K5X A;  4CHT B;  5BN5 A;  2Z4H A;  2NVT B;  1EY5 A;  2PPB C;  3I90 A;  1WTV A;  3ERQ A;  1FR3 A;  1Y1W B;  1H9S B;  1DOM A;  5IOC A;  5K5P A;  1W6K A;  2WAQ B;  1GOZ A;  4RH6 A;  4A3E B;  1JB3 A;  3H3V C;  4WFN 3;  5IGB A;  2AQ3 B;  3NHH A;  2JE6 I;  3SVM A;  2EYJ A;  2F03 A;  1Q1E A;  1MSG A;  3GTK B;  3DXJ C;  4CKE A;  4XQN A;  4K8I A;  2LY7 A;  1S5B D;  4FYD A;  4R9W A;  4QB4 A;  1HA5 A;  1G8Z D;  1DCZ A;  1TT2 A;  5EPJ A;  5FK9 C;  4XYO A;  1JIC A;  1LT5 D;  3HOY B;  2B2V A;  1G29 1;  3QG1 A;  1OO9 B;  3S1N B;  3HOZ B;  1O7Z A;  2A69 D;  3EJI A;  2HCC A;  2L0C A;  4A3D B;  4FP5 D;  4XQQ A;  3MFY A;  3WOE A;  2K5D A;  1EYD A;  1EU4 A;  5C5L A;  3NWT A;  1RJT A;  2C9O A;  3FMC A;  4KY6 A;  3KBG A;  3GV6 A;  2Q8R E;  2JA8 B;  2A6H D;  1H9J A;  1TVX A;  4K6L A;  1K83 B;  4DAP A;  4IN3 A;  1NR4 A;  2O4X A;  1UNS A;  1ROD A;  2F0O A;  4WJW A;  3VR6 A;  3I72 A;  5M5Y B;  3PV0 A;  5CGK A;  4NW2 A;  1BCP C;  1QB5 D;  1YNJ C;  5C0X I;  1AZP A;  1MI2 A;  3S1M B;  2F0H A;  5LHY 1;  1LT4 D;  4CGY B;  1LTB D;  5T1G A;  2L9H A;  1SJE D;  1G2T A;  2NTT A;  1BF4 A;  3X3N A;  1EEF D;  1FNW A;  2XRQ D;  4L6T B;  5CBE E;  1AW7 A;  2LFN A;  3NTH A;  1PRT D;  2XWJ B;  1QE6 A;  5CV4 A;  1WD0 A;  1V43 A;  2WKC A;  2EY5 A;  4KKU A;  1EEI D;  2F0S A;  2YYZ A;  1BNZ A;  5DM6 3;  4R8N A;  3FKI B;  2MP1 A;  1CQV A;  2NN6 H;  3EA6 A;  1PZI D;  4C3I G;  3RLF A;  1AEX A;  4RGT A;  2SNS A;  1TII D;  1MD2 D;  4OIK A;  2NWG A;  5JJZ A;  4LMQ D;  3E6Z X;  2J7Z A;  1QNK A;  4G7H C;  3GTQ B;  1PFB A;  2A74 C;  4BA2 I;  2I46 A;  5EQ0 A;  1SFO B;  2KEC A;  2NBF A;  2X6G A;  1EYC A;  1RTO A;  3CKI B;  2B2W C;  2N88 A;  4ZLT F;  2R92 B;  1T5X D;  3HRZ C;  1VMP A;  2EYF A;  3HP3 A;  4J6H A;  1A6X A;  2NUC A;  3PMF A;  2K1B A;  3T53 B;  2ICI A;  3G7L A;  2EDG A;  4RHS A;  2J4X A;  4KJN A;  3E5S A;  3N52 A;  2V4D A;  3S16 B;  3VYT A;  3H91 A;  2K6A A;  2LMC B;  1SNQ A;  4KKS A;  1PFN A;  1V1P A;  5T1I A;  3A54 A;  4K2L A;  1HRJ A;  3R2T A;  5IGC A;  3VA7 A;  1B44 D;  2EYL A;  1NR2 A;  1TWC B;  4IUP A;  4XQJ A;  3BVZ A;  2NZ1 D;  2A73 B;  5KYI A;  3VYR A;  1LO5 D;  2F0M A;  4IUN A;  5EKI A;  4DAY A;  1TKW B;  5IGE A;  4C3H G;  4BS9 A;  4Q5V A;  3GTP B;  5JPN C;  1TS3 A;  1QWY A;  4FF1 A;  5ELB A;  2EZV A;  2BDO A;  2DNE A;  3RZD B;  4PNY A;  4FF4 A;  4ZKB B;  2B2V C;  2BE5 D;  3SDZ A;  2RBM A;  3VR3 A;  1M4V A;  3M7N A;  1JOR A;  1UUP A;  4AYB B;  1SMY C;  3VYS A;  1ET9 A;  4K2K A;  3TZU A;  2L11 A;  2VB3 X;  2K28 A;  1BBX C;  4TQU S;  5I2Y A;  4WRD A;  2EY6 A;  4HN7 A;  2PO4 A;  5DM7 3;  3K59 A;  3SK6 A;  3NXW A;  1FGB D;  3SXH A;  2F0U A;  2B2Y A;  2R61 A;  4OO1 G;  4N9T A;  4EGV A;  4DN4 M;  1BCP B;  2L5T A;  1NCV A;  3PUZ A;  1OXT A;  3HGB A;  3PO3 B;  3OOC A;  2R6G A;  1I6H B;  4KD4 A;  1LAC A;  1L0X B;  4CKB A;  1EQV A;  4E6I A;  5D3I B;  3TP6 A;  5EGT A;  1SYF A;  1I4X A;  2RDF A;  1TWA B;  2FMC A;  1Z47 A;  4GZY C;  3D4W A;  1I6V C;  5TSS A;  3I3C A;  1Z7T A;  2JXM B;  4G7Z C;  4ODG A;  2B8G A;  1RHP A;  2FJ2 A;  5C3X A;  1E0B A;  2H4O A;  4V19 0;  2F0E A;  3X3M A;  5C0X H;  2SDF A;  1CA5 A;  1B9N A;  2KQ3 A;  1EY7 A;  4ZUI A;  1PZJ D;  1IL8 A;  4DAV A;  1WTQ A;  4XT3 B;  5J22 A;  1HUN A;  2F0D A;  2RVL A;  1IHZ A;  4A3I B;  4OIJ A;  3NE5 B;  4BY1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...