5CV4A

Crystal structure of staphylococcal nuclease variant delta+phs v23d/v66h at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTDKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMHENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V23D/V66H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5cv4A00
1AEXA 4KJNA 1EY0A 2SOBA 4QF4A 5I6WA 5IGDA 5C5LA 5IGFA 3D8GA 3MHBA 4PMBA 4DGZA 4IALA 3TMEA 4DFAA 2RKSA 5CGKA 1A3UA 3R3OA 4KD3A 4ID6A 1IHZA 3SR1A 4E6IA 3OMGA 3NK9A 4IUNA 2PZUA 5C6AA 5KYIA 5JOBA 5CR3A 3SHLA 1F2ZA 4IZ8A 1SYGA 1II3A 2EYMA 2O4XA 3C1FA 4KV6A 5J22A 3HZXA 1KDAA 1A3VA 2HQEA 3EVQA 4H7BA 4RKBA 4WRDA 4ZUIA 3E5SA 2EYOA 1NSNS 4HMJA 5KYLA 3P75A 4F8MA 4EQPA 1SYFA 2F0SA 3OMCA 1EY7A 2PQEA 1ENAA 2LKVA 4DF7A 5ISRA 1SNMA 1SNDA 1F2YA 4HTHA 1SYCA 2EY5A 4MIUA 4K5VA 4J1MA 2QDBA 5J1ZA 1STGA 1EY6A 1SYEA 4K14A 4DU9A 1F2MA 2EY2A 5CV9A 2F0VA 5I9PA 4K5WA 3C1EA 4K2LA 1A3TA 2EYFA 3TP7A 3NP8A 1SNOA 4YIJA 4K6DA 5HGTA 3H6MA 2M00A 5KRUA 4LAAA 2F0OA 2F0LA 4R8NA 5CV5A 1STAA 4B9XA 5JAVA 1NUCA 1TQOA 2OXPA 5NUCA 2KQ3A 3TP5A 5KEEA 5KIXA 4K2KA 1SYDA 4EQOA 2EXZA 2RDFA 3NXWA 3HEJA 3NHHA 3NQTA 2F0TA 4KY7A 5CV6A 3RUZA 2F0HA 3OWFA 3MZ5A 4NKLA 5E1FA 5C5MA 2F3WA 1STNA 3D4DA 5IGBA 4J6HA 4PNYA 3P1HA 1EYCA 2F0GA 4KHVA 5CV7A 2F0MA 2F0PA 5DEHA 2OEOA 4ZQ3A 4QMGA 3T13A 3TP8A 4EQNA 5IGEA 5I6YA 4ZUJA 4ODGA 5EKLA 1U9RA 2NUCA 1KAAA 1STHA 1ENCA 2EY1A 3QOJA 3MEHA 1EZ8A 1RKNA 3TP6A 2PZWA 1EZ6A 2F0WA 4KJOA 5KGUA 2F0QA 5C4HA 4S3SA 1TT2A 4K5XA 3D6CA 2F0KA 4OL7A 3SK8A 1EQVA 2F0IA 4KY6A 4TRDA 5DAUA 3SK4A 1JOKA 4KD4A 5CV4A 1KABA 4WORA 3SK5A 2PW5A 1KDCA 2PYKA 2F0DA 2SNMA 3U9OA 4F7XA 4KTAA 5F2DA 4NDXA 2EY6A 2EYLA 2F3VA 1EY9A 5C4ZA 1JOQA 2KHSA 4ME5A 5CC4A 3DHQA 5C3XA 2EYPA 1TR5A 2F0NA 3LX0A 2PZTA 3QB3A 4I65A 1JOOA 1SNQA 2WACA 1SYBA 5M9OA 1KDBA 5EKKA 5HURA 3SXHA 2RBMA 4K8JA 5C3WA 3ERQA 1EY5A 1EYAA 2OF1A 5EGTA 3QOLA 5IGCA 4K8IA 3MVVA 2ENBA 3DMUA 4NMZA 3ITPA 1SNPA 2F0JA 2EYHA 3VA5A 5K5PA 1JORA 1STBA 3EROA 1EY4A 3OSOA 5IODA 4QB4A 5CV8A 4B9WA 5J39A 4PMCA 4EVOA 2PW7A 4KY5A 5I9OA 2F0EA 3T16A 5IOCA 5E3FA 3D4WA 4N9PA 2F0FA 1EY8A 2EYJA 2SNSA 4N9TA 4G57A 5IGGA 5IIFA 1EYDA 1SNCA 3SK6A 4HMIA 2F0UA 3NUCA 1A2TA 1A2UA 3BDCA 3MXPA 4NP5A 4RKLA 3V2TA 3S9WA 1STYA 3PMFA 3EJIA 3BDLA
chains in the Genus database with same CATH superfamily
5FLXE 1PRTC 4DR5L 3K81C 5KYIA 1YVCA 3G6JB 3KF6B 3I4LA 2KUMA 3I4MG 1SE2A 1MSHA 1F9PA 2K5VA 2K6AA 4JOIA 1A3UA 3R3OA 4KD3A 3M7GA 3R8BA 4A3CH 4GOPC 4WJWA 4A3MG 4L5TA 5CR3A 4BY7G 1SYGA 5KNBA 5D3DA 5J22A 1VQ7A 1JR0D 2HQEA 4IJHA 3AYHB 5LMUL 3IFTA 3ZJYC 1HNWL 1SYFA 2B2YA 2XN9C 2QEXA 3JAMc 4F88A 2FXQA 4RCOA 1B70B 2XWJB 4RH6A 2R7DA 1I50B 2WAQE 1NR2A 1KRSA 3BZKA 5M3FG 4HCSA 3H6MA 3L7ZC 4O1NA 3T1YL 4GKKQ 5JVG3 2NVQH 2QEJC 5JEAH 1NR4A 2JP1A 2B2UA 1N34L 1XPOA 1BKBA 2F0HA 2IW3A 4C56C 4A3JH 2QW7A 1WTQA 2RVLA 3G48A 4A3GH 2F0MA 1ICFB 4JPBW 4X6AH 4IUPA 1G51A 1FNUA 1STHA 3PIO3 4FXDA 2NZOA 2IT1A 1ICWA 1QWYA 2K32A 1XYIA 4H0LC 5FJ8G 2LS01 3UDXA 2R92H 4UDUC 3KF8A 2F03A 2MGSA 2R7FA 3SK4A 3I2ZA 1KDCA 5F2DA 2A6HD 4IFDG 2IPKD 4JI3L 5C3XA 1TR5A 4BY1G 1BVSA 3D0FA 5BN5A 4K8JA 3CCLA 1LT5D 3CKIB 2OF1A 2JA5H 1LYLA 2Q2TA 4L5RC 4GN5A 2ZXOA 4K8IA 1FJGQ 1D7QA 1IW7D 1VF7A 2HQLA 1PXUA 1PH9A 4CJ0B 1PH1A 2L55A 3GP7A 4U68A 2EYJA 4NXML 2JE6I 1PZJD 4M8AA 1TWGH 1PVOA 1DJRD 2E2JB 1LACA 4XXEA 3HOYH 3PO3H 1G6ZA 1QILA 2XRQD 4KJNA 2O5JC 4B3MQ 5C5LA 4V0BA 4UAIA 3PQIA 4IUUA 3ICEA 3K0YA 3J81E 4HIDA 3MEFA 3R2TA 1NJIC 5JOBA 3L9AX 1B4OA 4BY7B 1WD0A 2RSNA 1V9PA 2A68C 4LF7L 2EYOA 2A74C 3KLRA 2VL6A 3E3XA 1JJGA 2EPBA 1K8GA 4RG1A 2EE1A 4DF7A 1SXTA 5ISRA 4HIOA 1X55A 2QILA 4IPHA 4K5VA 3HGBA 1STEA 2RHSB 4MHEA 3CP0A 4X62Q 3GTOB 1QZGA 1JWMD 1RL2A 2JXMB 2X6GA 4JI6L 4JVZA 2VUMB 4IPGA 4LF4L 4DXGA 2UUCL 2BE5D 2CHBD 5ELBA 2B8GA 1GUGA 4R4OA 1H9MA 3PF4A 4YWKA 5CV6A 3UDFA 4HCEA 3BZDB 1Q86C 2YYZA 3RMHA 2QDLA 5IGEA 1RDPD 2BH2A 1KNEA 3MEHA 4IPCA 1H9KA 3KBGA 3V05A 3BYYB 2YU9H 4OL7A 3HRZC 3PO2G 2TSSA 3CHBD 3VA5A 3K5LA 1Q1BA 5M3MG 1CM9A 4NDXA 3F2BA 2GA4B 1X9NA 4A3IG 3A5ZB 3AB9A 5BR8L 5KNCA 1GOZA 1OXVA 2R3ZA 3KDFA 5GAHC 4GNXC 4LUZA 4A3CG 2I46A 1I6HB 1SDFA 3S2HH 3A54A 1EEID 3RZOB 2EJFC 1JJCB 3BG3A 1EY8A 2NN6H 4G57A 4N9TA 5IIFA 3Q23A 3OW7A 3S1QB 1JJ2A 2UXCQ 1WTXA 3OOCA 2NYZD 5C5MA 2JQOA 1EY0A 3X3NA 1VQMA 4ABNA 1V1PB 4A3LG 4L8JA 2RQXA 3SR1A 2L1BA 1Q12A 4KHZA 1NTGA 5C44G 3L0OA 5G3LF 5I4DA 4ZUIA 3EVQA 2PQAB 1WD1A 2D2CC 4GN4B 4A3GG 1BBXC 4DR7Q 4DV2L 2B2WA 4GN3B 4KKUA 4NXNQ 3VYUA 3C3LA 2OWOA 4PZ7A 1UAPA 3UI2A 4CDCC 3I70A 3J7YW 2FINB 2R92G 1XX8A 5J3BA 1SMXA 2Z4HA 1UE7A 1O78A 1TU2B 2Z0SA 1MJEA 5M5WB 4LF6L 2F0LA 4J8QA 5FLMH 4B9XA 3RLNA 4CKEA 1LTRD 3HOZG 5E7NA 1WTVA 2BCOA 1XWEA 1E22A 3VR2A 1GXDC 1RHPA 4HN7A 5JEAJ 1IBMQ 1IL2A 3S2DH 3E0EA 4DR2Q 4KKSA 1G2TA 2Z9HA 4XQJA 4DV7L 5GQOA 4LJZC 1PTOH 3T53B 3OPOA 4EQ5A 3CC2A 2E5LL 1LT4D 4DAYA 2A69D 3CRLC 2DNEA 4DNTB 1OO9B 3PO2B 3MXUA 3HOYG 4DR6L 1FVIA 1I6VC 4F7XA 3S1NH 2EY6A 5T1IA 5CC4A 3KBXA 5KNDA 1L1OB 4FYDA 1LTGD 1PFNA 2NN6I 1S40A 2RBMA 2ZTCA 1YHAA 4LFCQ 1PMRA 3STBC 4GS3A 4NMZA 3DXJC 1XMQL 4TQUS 2K5WA 2GVBA 4JI2Q 4DV0L 1Q82C 2UXBL 2Y0SG 1PTOC 1I50H 2F0FA 3FKIG 5BN4A 1M90C 1M1KC 1B9MA 4ME3A 2E2HB 3S24A 3EQLC 3QR8A 1A2TA 1GO3E 1BQQT 2Q2IA 4DK1A 1YNNC 1Y1WG 3CRKC 4DGZA 4DFAA 1P8LA 1KXLA 4OIJA 1YBYA 4JW0A 1II3A 2EYMA 4OELB 4OX9Q 4Y52H 5ELCA 4WRDA 5IWAQ 1MD2D 4B3TQ 5KYLA 1E2VA 1QJOA 3GV6A 2N3SA 2TMPA 1ESRA 2F0SA 3A8JE 3HG9A 4XT3B 5GAEC 1ENAA 1HNXQ 5IY0A 1E0BA 5DM63 2JA8H 1FR3A 1YNJD 2SEBD 2CCZA 3AMUA 1SYEA 3RLOA 4QY7A 4JBMA 1BDOA 5I9PA 4DV6L 3M85A 1UEAB 3C1EA 3MTSA 4TKOB 2VY3A 4BBSH 4G7ZC 3NBHA 4DK0A 1RJTA 1G2SA 1K8MA 2WIIB 3A74A 4MNOA 3S17B 1QNUA 1VQ6A 1I4XA 1L0WA 3HOZB 3NHHA 3RUZA 2UU9L 1EFID 1VQEA 3TZUA 1K9MC 1B3QA 1HR0L 4HEDA 4J6HA 4RHSA 5D65A 4RMFA 4QMGA 1YNXA 2K05A 2B29A 3PF5A 2E2JH 5EKLA 1AZPA 2CFMA 1EZ8A 4JV5Q 1RKNA 2KENA 1H9SA 2E8GA 2L15A 2Z6KC 1B7YB 3A7AB 1V1QA 5JPMC 4LF9Q 2M2LA 4KD4A 1IBKL 4WORA 4KKTA 2F0DA 1MJCA 3FEWX 4UP9A 1AZQA 1XPRA 3DUZA 1VQIA 4BY7H 1B50A 4X66L 1PH2A 1Z47A 3A56A 1YJWA 4ZAIA 2MFIA 3SXHA 2B2VA 1D5ZC 4PG3A 1EIFA 2IX1A 1I4RA 4IJLA 4R9WA 1K0SA 4GLAC 2E76C 4C3HG 2Q8TA 2UUBQ 4EVOA 3I56A 2PW7A 1WVLA 1Q3LA 2Y0SB 4L6TB 3GTOH 3J7ZC 2VZAA 5CYUA 4DR3Q 1HR0W 3FKIB 2RDHA 2LSSA 2VUMH 1EEFD 2NVTB 1XXGA 3KFUA 3M9BA 1TWHB 4RKLA 1LM0A 4M1UB 1KIXA 5G3LD 1ASZA 3H09A 1ZYRD 4DV5Q 5LMNW 1Y1WB 3D8GA 3TSSA 4IALA 1KNAA 2AKWB 2RCFA 1U0LA 3MXNB 5FLMG 1HFNA 2GN5A 3CCUA 4C2MB 2O2LD 3KOJA 4LFBQ 1X3PA 3I91A 2QKIC 2YTYA 1SE4A 2K1BA 5FJ8H 3JAME 2ZTDA 3J81i 2PQEA 2FJ2A 4YWLA 3AU7A 1G291 1EOTA 1N33L 4IFDH 1LTBD 2Y0SE 1TXYA 3G7LA 3CCVA 4DV3Q 2VS1A 4K2LA 1HNZQ 5ELEA 4AQYQ 4JG2A 3HOXB 3K0XA 1I6HH 2IJ0A 2DN8A 5C0XG 4GOPA 1CZWA 3RZOH 4NKLA 3U4ZA 4A75A 5EPLA 4QL5A 1SJED 1EWIA 3GTLH 3S1QH 3K7AB 3A7LA 4YCVA 3PUVA 3URYA 4HJAA 1A6XA 3VR4A 4DR1L 1FJGL 1GHJA 1I4HA 3CCRA 1AN8A 3D6CA 3NSWA 2NBFA 2R61A 2CW0D 3CXCA 2DGYA 2I5HA 4CGYB 1PLFA 2H1EA 4CDDC 3R2IA 1SE8A 1XMOL 3BVGA 2K7VA 3CMAA 1DZ1A 1JOOA 2D0OA 1HFGA 1Y8OB 4NPSA 3HFZB 4N8X1 1I94Q 1KLGD 3FPUB 2HD3A 4P74A 1JORA 4QGUA 1C48A 1VQ5A 1Y1VB 4B9WA 1EWHA 4DV4L 1XNQL 4LMQD 3EBEA 1VQFA 2EJMA 1J5EL 3B6YA 3X3MA 1UWVA 2BA0A 5M5WH 1E1TA 3OIPA 1FYCA 2VNUD 1PYBA 4DV1Q 4LFAQ 1L0XB 4X62L 3A0JA 1D2BA 1SAPA 4OIKA 1W2BA 3J80L 1X3QA 2UXDQ 2H4OA 5FO8B 1G8ZD 3F2CA 3I4NB 3SHLA 2MPMA 2O4XA 1O7ZA 4CJ1B 2EIFA 2K4KA 1NSNS 1HUMA 4DR4Q 3PO2H 3RN5A 3KDFB 1QCBD 3Q8DA 2KCNA 4A3IH 1Z9FA 1ZKOA 2EYFA 1KD1C 1CSQA 2M00A 3IFDA 1LABA 2LMCB 4R4TA 4X64Q 2VQEQ 2NVYB 2J7ZA 1EWCA 1V43A 2CWPA 2F4VQ 1ET9A 4A3EG 3M4OH 4KY7A 3W3AA 5M5XB 4O42A 1JWSD 2Z1CA 3OWFA 1ESFA 2NVXB 2F3WA 3A5UA 1EIGA 2Z4IA 2PMZB 3UDIA 1K3RA 5I6YA 1FD7D 4JI1Q 3CQZH 4I7ZC 4DNIA 1JWUD 3D6WA 1JE5A 1JB3A 2JN4A 3NTKA 4JI8L 4JI7Q 4QCLA 4JI5Q 2VUMG 2F4IA 5A2QL 1L1OC 2K5HA 4A3LH 3TRZA 4A4IA 2E2IB 2JA7B 4WFN3 2JA6G 5EPJA 4DUYQ 3K6OA 4QIWB 2UXCL 3DHQA 2EYPA 5C44H 1PZID 4DPGA 3RNUA 1DM0B 3MFYA 1BUVT 4ZKBB 3E0JA 4R4CA 1N36Q 1S72A 3K5NA 3HOUG 4X3TA 1STBA 1BCPF 2K50A 1LTLA 2WKDA 3EROA 4ULLA 4PMCA 1UE1A 5IOCA 5BN3A 2RHQB 1S5ED 1U4MA 1SNCA 3MC0B 2K5DA 2KVMA 3SK6A 3GTKB 4DR7L 3PUZA 2IWHA 3S17H 5DM73 5I6WA 3HOZH 1Q1EA 3MHBA 4PMBA 3PIOA 2BA1A 1PV4A 1A0IA 2K52A 1NMGA 2CH4A 2N55A 3TN2A 4DAYB 4YCWA 4IUNA 2IX3A 4GNXA 1HZCA 3BDOA 1Y8NB 1A3VA 5CBAE 4Z9CB 3HOWB 1RODA 3TS2A 1UE5A 3P20A 5JJZA 2BH8A 2KEEA 1JT8A 2N8NA 1A15A 4UY8C 4YY3L 1M4VA 1FGUA 2JJQA 2HIVA 3NTIA 3J80c 1F2MA 2EY2A 1XTDA 2PI2A 3F2UA 4X65Q 2FMCA 4K5WA 2MNAA 1CHPD 1X3EA 3L3OC 1SNOA 2A1AA 4FF2A 4ALPA 2EDGA 3D31A 4IFDJ 4MTKA 1A62A 1JCKB 4K6LA 3TDQA 5FOBB 3R93A 1STAA 3CC7A 4K2KA 1JE4A 1MHWC 3A55A 4A3EB 1W6JA 4BBRB 4KHPQ 4X3UA 3KYHC 1Q7YC 1D6EC 3FKIH 3STBD 1H95A 1CKMA 4RAUC 2NVTH 1TWFH 1TWHH 1VQ4A 2NUCA 2IY5B 5GROA 4LFCL 4ZK9B 4R4QA 1LT6D 1U4PA 1W3SA 3DM3A 3HOVB 1TY0A 4P73A 1Y1WH 1RTNA 1WTHA 1JOKA 3NPPA 1KABA 3CPFA 4C2MH 2XRSD 2JA6B 1K0RA 4RGMA 3QB3A 4HAEA 3EN2A 1VQGA 4PV1C 2AWOA 2V1CC 5C4JH 1H9RA 3BJUA 3C46A 3WOEA 3ITPA 3PCOB 3HOUB 4PQXA 1F77A 2KECA 4QB4A 4JI0Q 5CV8A 1D1IA 4KY5A 3NBHB 2DY7A 1S5BD 3D4WA 4OX9L 3VYTA 5ELFA 1EYDA 1HUNA 3AFPA 3HOXH 4ZLTF 3P7JA 1S3OA 3S15H 3EJIA 1HNXL 2VB2X 2E75C 4KLKA 4A3DB 1GHKA 1H9SB 4JI4L 3OMGA 3K7AH 1WTPA 3VDYA 1EQTA 1PRTF 1F2ZA 3HZXA 2HHHL 1UEBA 1LTTD 2K28A 2ID0A 3HKZB 3VR6A 2QDBA 3DM1A 5LHY1 1ET6A 4TSSA 5CV9A 4POGA 1VQNA 2PNHA 2D62A 3ERSX 3JAMi 4JV5L 1ONLA 2WKCA 1BR9A 3FHWA 3K7UC 2ZJRA 1GUNA 4C3IG 1N34Q 3ND8A 1SYDA 2JA9A 2RDFA 1MBYA 1Y1VH 4C3HH 2F0TA 4DUZQ 5E1FA 2ZJQA 3CU7A 4RGTA 1HZAA 3KLWA 2OEOA 3TP8A 1Q81C 3GO5A 1QVFA 5EPKA 4GZYC 2XIWA 2DJFC 1NCVA 1BOSA 3TP6A 2F0WA 1YZ6A 4FP5D 3I73A 2UUBL 2A8VA 5IYBG 1DOKA 1CKNA 4DR3L 2SNMA 3BU2A 2UUAL 4WJ3M 2KBNA 4KTAA 1BCPD 4L5QA 2EVBA 1I4GA 2ZM6L 1OTCA 2ALYB 1HA5A 4IOAA 5JPNC 5IYDG 1HZ9A 3LX0A 5AFWA 1JICA 2FMMA 1SNQA 5M9OA 2A6HC 4XDXA 1W6KA 4LK1C 5C3WA 1EY5A 1EYAA 4C1NI 1BBUA 3EIVA 1QVGA 2O5IC 2FHTA 4NXMQ 4LFBL 1IW7C 1R9TB 1HRJA 3J7A5 3BZCA 4MN3A 2Z6KA 1CQFA 2KJXA 1VMCA 4NP5A 1SR3A 2N49A 2R93B 2NVYH 2GVAA 3L2PA 1AEXA 1CT1D 1WTRA 5IT9L 3OIQA 1VQBA 5C0XH 5M5XH 3E6ZX 1SFOB 2HCIA 2K75A 4FDBA 2OT2A 2VW9A 4DV3L 4DAPA 5C6AA 3D4RA 3ZYYX 4P72A 2D0PA 4LF7Q 4K0KL 4CKCA 4H02A 2CQAA 2I5MX 4BA2I 4FVMA 4A93G 1HZBA 1S5DD 1KL9A 1GVPA 1JQYD 4FXKC 1HH2P 3DWAA 3I90A 4YHHL 2KA7A 2FFKB 2E2IH 2JA7H 4J1MA 2BOSA 3I4OA 3Q22A 4JI6Q 1QNKA 1YEZA 2F0VA 3S16B 4LF4Q 2AMCB 1T5XD 3TP7A 1T9HA 2K01A 1E1OA 4C3IB 1FNVA 2EXZA 4NW2A 1Q46A 2L4NA 3H0GG 3HEJA 1X3FA 3I72A 1FL0A 2XGTA 1XJVA 4G7OC 3OWEB 1K8AC 1TS3A 3K57A 4G7HC 5CV7A 1N32Q 1HHVA 2MP1A 3WWVA 2NVQB 2BDOA 4L63B 2EY1A 3QOJA 1PYSB 4FNFA 2G9HD 4K5XA 1QUQA 2L11A 3HOXG 2EZVA 3PSIA 3MAQA 4BXXG 2XVSA 4OWXB 1V1OA 2K04A 4DAVA 1SMYC 2KHSA 1NMFA 3GQBA 2VQFL 2I5LX 1BO0A 1JB7A 4DV1L 3HOWH 1PZKD 3PUWA 1WCMG 5EGTA 5IYCH 3QOLA 5IE8A 3NTHA 3MVVA 1GD7A 4RGNA 2F0JA 2HIXA 1VQ9A 1EIHA 5JJLA 4DK3C 2HCCA 1BNZA 5A35A 3PGZA 5C0XI 2UXDL 5I9OA 3KJPA 1S5CD 2X6LA 2Q8IB 1PRTD 2ZJPA 5K36G 4JYAL 2F3IA 4V190 1FNWA 2NTTA 3DWQA 3KJOA 2KCMA 4A3EH 4BS9A 4BBRH 4CDEC 2RKSA 1EQQA 4N8FA 2XNAC 1TWGB 1ML0D 4OO1G 1SRUA 1Y1VG 1LUZA 2X69A 3F2DA 2AWNA 1VQDA 3E5SA 3C2PA 2K14A 1X32A 3H94A 3VR3A 4LF8Q 2F4VL 4A93B 4H13C 5IT9c 4UPAA 1SNMA 1X6OA 1OXTA 3NBIA 1YJNA 2JA6H 2CQOA 3J81j 3BVMA 1V1PA 1VS0A 2E74C 4LF5Q 4LF6Q 3NP8A 4LW1A 1VQCA 4JI5L 3I4NG 3KF8B 1O7IA 5CV5A 4GKKL 2B63G 1YIJA 2OXPA 3K59A 3HOUH 2PQAA 4B3SQ 3NXWA 3H0GB 3QG1A 3IKJA 4DUYL 1HXYD 4QUFA 1K8OA 4PNYA 1EYCA 4X3SA 1I5FA 2PO4A 1WYDA 4LWCA 4TVAB 1C9OA 1EU3A 1VQPA 2E5LQ 1Y8PB 1S5FD 1HTLD 1A8VA 2N88A 1P16A 1EZ6A 2ZTEA 3K80C 4KJOA 4KK7A 3G6EA 4APVA 1TT2A 4GKJQ 1DYQA 2F0IA 4KY6A 4A3DH 4G4KA 2A69C 1SJHD 3BYTB 1EQRA 3GTMB 3IL8A 4XTCS 2EYLA 4ILWA 5C4ZA 2NWGA 3CCQA 4I65A 3CW2C 3H3VH 2D5DA 1WI5A 1PH8A 4Y7NB 5HURA 5COYA 2YU9B 1WCMB 4HJ8A 5IGCA 1KTKA 2KEDA 1B8AA 2UXBQ 3CCMA 1EY4A 3NWSA 4IQZA 2CWAA 4FF4A 4KMUC 2HDMA 5E3FA 3T16A 2DY8A 2PPBC 1QVCA 1XNRQ 2JA7G 3CD6A 4EGVA 4HMIA 4JBKA 4QUCA 3V2TA 4LUVA 2NTSA 4XT1B 1Q90A 1PTOF 3S1MB 2M9VA 2B2TC 2SDFA 1SSOA 4B3ML 3H3VC 1SN8A 2DJGC 4C3JB 4P75A 1QZHA 2A68D 1IXRA 4DKAC 5C0XJ 2DNCA 1VQHA 4IZ8A 4JCVE 2Q2HA 1TS5A 1KDAA 1AE2A 3MA2B 4H7BA 1F9QA 3TQYA 2KCTA 4F8MA 1WTWA 2E2DC 2WV6D 1SEBD 1F2YA 1SNDA 1SYCA 3GDEA 3J80E 3RZDB 5J1ZA 2XTIA 1B2TA 3EFXD 3H91A 1YNJC 3W1BA 4CDFC 3DEPA 4IO9A 2NB0A 3MFGA 2JSOA 1Z7TA 1CFMA 4IFDI 1NAPA 2B63B 5JAVA 3VA7A 2UU9Q 2G9DA 5KIXA 3HKSA 1SBBB 1ZXTA 4UP7A 3HOWG 1HR0Q 1HCZA 4FF3A 5EJWA 4CJ2C 1QOHA 2MO1A 5IYCG 1STNA 1J6QA 5IGBA 2WB1G 2HT1A 1R9TH 5E4WC 2CH4W 3H15A 1U9RA 3FRPB 5LMNQ 3H3VI 1DCZA 2V4DA 1J8IA 2IHEA 4AIMA 1LLRD 2MUYA 1B1ZA 4FXGC 1SFOH 1PDQA 3S2DB 3NEMA 3OW2A 5I2XA 2DUDA 2PW5A 4RFBA 5CORA 4PZ8A 4X66Q 3AEVA 1SROA 1EY9A 2OTLA 4BBRG 1JOQA 1E2WA 2PZTA 2F1MA 3I3CA 1E2ZA 2WACA 4DA2A 4ZKCB 1EUJA 5EKKA 5H1SE 1IL8A 2Q2UA 1CKOA 3T1HQ 5A2QE 2E2HH 3ERQA 1OXSC 3DMUA 4ZYSA 1HJPA 1E3PA 4OGQC 3S1NB 3HOVG 1CZGA 5FLXL 4CKBA 1EU4A 2OQKA 2EQSA 1CK1A 3S16H 1VCIA 3PIP3 4P71A 3UDGA 3AFQA 3NUCA 1A2UA 4B08A 3AQQA 4C3IH 5FO9B 1KRTA 1PHJA 2RCNA 5IGFA 3CPWA 4U673 1B44D 4OWTB 3A8IE 5CGKA 2B8FA 5C4XB 2QCPX 3SGIA 1ZYRC 4A3BG 4E6IA 5JVH3 2PZUA 1PFBA 3GTPB 2ASBA 1CKNB 3PIPA 1O80A 2K33A 3LWUA 5HY6A 3P75A 3Q6SA 1IYVA 1PA6A 2PMZE 1BXTA 4EQPA 3OMCA 2MJ8A 5IYBH 1AP0A 4DUZL 4OHJA 5FO7B 1PH6A 3I55A 4MIUA 1N33Q 1D5MC 4NXNL 1T5EA 1TWAB 3PV0A 5GAGC 3M4YA 3HS0C 4HIKA 4B3RQ 3QWNA 1OXUA 5IYDH 5FKAC 5IP9G 3MXNA 5CMDA 2LFNA 4A3DG 1U5KA 1JMCA 2OTJA 3K58A 1DD2A 2MO0A 2H5XA 2F0OA 2JA8B 3CF5A 4QIWE 3W5OA 1GUTA 5KEEA 3OTOQ 2B3GA 3VYRA 1I4PA 4EQOA 4A3FG 3MZ5A 1F9RA 1NNXA 5AJ3Q 2WB1B 1VQAA 3P1HA 3HKZG 1KQSA 5EBCA 4BBSB 1IBML 4DR2L 1MSGA 4DR1Q 1Y69U 1SLJA 1ENCA 2PCFB 3T56B 4KN4C 3G4SA 1B53A 5KGUA 3WOFA 5C4HA 2D9UA 3T4AC 5C3EG 2F0KA 1EQVA 3ND9A 1XMOQ 1LO5D 1ILQA 4IUTA 2I0QA 2L12A 2CW0C 3CC4A 3LGJA 5EBDA 3J7AV 4JOIC 1TWCB 3G71A 3CMEA 4A93H 3SEBA 5D14A 2AUKA 3I4MB 4H44C 3ULPA 4HJ9A 1SE3A 4Q5VA 3KUPA 1EIYB 2A6EC 2PNRC 1PTOD 5K5PA 3PUYA 1BCPB 4DV4Q 1XNQQ 4A3MB 2R7ZG 3FMCA 4OEMB 2J0TD 4IPDA 2B2YC 3UE0A 2EJGC 1KAWA 3OYYA 3RN2A 1J5EQ 4JI2L 1HA6A 4N9PA 4FF1A 4R4IA 4AH6A 2WB1E 3J81L 2MHVA 1L2FA 1YNND 1PH3A 3NENA 1U4RA 3S9WA 1GM5A 1STYA 3BDLA 1IBLQ 1V8QA 4QF4A 3S14B 3H0GH 3BS1A 4IURA 5FLXc 4MZ9A 5M3FB 5GADC 1CA5A 4A3BB 2B2UC 1QUQB 4KN7C 3GV3A 1E24A 4RKBA 4O2DA 3SVMA 4HSVA 4JK1C 5IWAL 3GTJB 4A3KG 2JYOA 2AUJD 3F8TA 4B3TL 3KK7A 4BXXH 2G5DA 4DR5Q 2R93G 1B9NA 1XTCD 3GTMH 1N32L 4K14A 1XPUA 4DU9A 3K5MA 4Y7NH 1A3TA 4YWMA 1UUPA 1WCMH 3ONAB 1EOVA 1SMYD 5ELNA 4DN4M 4YCUA 5LMUQ 5NUCA 3TP5A 1LV9A 2IHFA 3RR5A 3M3YB 1RTOA 1TS2A 1HNWQ 3I8ZA 4A3FB 4UP8A 4BY1B 1WTOA 1EYGA 1HPCA 1C8CA 3KF6A 5K36H 1K83B 3DEOA 1TVXA 1VF5C 3JC66 4JI8Q 3KLSA 5M5YB 3T1YQ 5C3EB 3S1MH 1D5XC 1NE3A 2XWBB 3SK8A 4TRDA 4KI0A 5CV4A 3U9SA 4C3JH 1MGSA 4FO2A 3GTLB 3U9OA 4LF9L 3QIAA 4OO1H 1IYUA 4QJFA 5IP7H 2I07B 1F9SA 1IZ6A 1SYBA 4Q0FA 2B39A 2OCEA 2P5ZX 3M4PA 1KC8C 2CKZB 2ENBA 5JEAG 2EYHA 3QO2A 3QJYA 3RZDH 5IODA 1VDZA 1R4PB 1O7YA 3T51B 2R7ZB 1O7LA 2VB3X 2F0EA 5E4XA 4A3JG 5JJKA 1AH9A 3GTGB 1ILPA 2VXWA 5IGGA 3HKZE 4BA1I 3Q24A 4LF8L 4JI3Q 1WFQA 3U4VA 3I4NH 5LL6X 2BDNA 2B63H 3F1ZA 2C35B 1I3QB 5HGQA 4DV5L 3NE5B 3CCSA 1G91A 2ICEC 2LXKA 1IHZA 4LF5L 4IUVA 1PRTB 3FVQA 3J81c 4PMWA 4KV6A 3DLLA 4NB3A 4IN3A 3ER0A 1IKLA 5IT9E 3NELA 4DXFA 3GD7A 4B3SL 4GOPB 1KHIA 4A3KB 2JA5G 1QE6A 1C0AA 2LKVA 3SDZA 4YY3Q 4HTHA 2WINB 1FGBD 4XQNA 4DNRB 3U58A 3S1RB 2WP8J 3FPPA 4P2CB 2NVXH 4J15A 4HJ7A 1WJJA 2ICIA 1HNZL 1IYJB 4AQYL 3PO3G 4GKJL 3OHXC 3J80i 4ZRZA 5M3MB 3GTQB 3FP9A 1TQOA 4HJ5A 3TS0A 3NQIA 2HUGA 3NQTA 4A3IB 3VYSA 1PFSA 2ES2A 2MQHA 3K5OA 2R6GA 4HSPA 3D4DA 2L9HA 1CI3M 1X56A 1M8AA 1EFWA 3T13A 4EQNA 1YHBA 2A5HA 4OO1I 3O13A 3WDNA 4LUOA 1IKMA 3M4OB 2Z8LA 4L5SA 2F0QA 4S3SA 2UUCQ 1LTAD 5C4XH 2JK8A 5CBEE 4DK6C 2RF4A 2PYKA 1XNRL 2AHOB 3GTPH 2BE5C 3CQZB 1AW7A 4ME5A 5FK9C 2F0NA 4XYQA 2RSOA 1GUOA 1Q8KA 1YHQA 2YTXA 3GTKH 4UHVA 4F87A 1BBWA 4JC0A 3K8AA 1I94L 1TWAH 5ELOA 3OSOA 2B2WC 2YTVA 5C44B 1DONA 4A3JB 1ENFA 5EAYA 4GLVB 5JJIA 3CAMA 1DOLA 4A3GB 1F2LA 3MXGA 1Y14B 5BR8Q 2NZ1D 1OXXK 1CQVA 3E9HA 3M4QA 3TZDA 2SOBA 2YV5A 3I7FA 1X3GA 1TS4A 4LFAL 2R92B 4MTNA 4JI4Q 1QG7A 1GUWA 2RA4A 3NK9A 4RWSC 1VQ8A 3SE0A 1HTPA 4C1NK 2HHHQ 2KCCA 3TREA 3W1GA 4O0AA 1MKHA 1U4LA 1D1KA 3V96A 1X54A 1ASYA 1D8LA 3ULLA 2C9OA 4LNQA 2JA5B 1EY7A 4RCNA 1E7ZA 4RHRA 4DR4L 1Z6HA 1TIID 2AQ1B 5LL6S 2L5TA 1STGA 3RD4A 1TWCH 1GJXA 1KLUD 2IL8A 2NN6G 5DLQE 4C3JG 5LMNL 1C4QA 1H9JA 4K6DA 4YIJA 3TEHB 3I4MH 1LT3D 1CSPA 2B2TA 4LAAA 3UE1A 4R8NA 5IP7G 1PH4A 3HOYB 3FDTA 3PO3B 1NUCA 1RIPA 4HR7B 4PZ6A 4X64L 2VQEL 3HOVH 4A3MH 4DV2Q 5DNFA 1N9WA 2K03A 2NZHA 4R8IA 1G6PA 4AYBG 2Q8RE 1Q8IA 2RDGA 1K3BC 1DXMA 2F0GA 2KOLA 2F0PA 2L0CA 1RF2D 2N78A 2JEBI 4ZUJA 3T1HL 5EKIA 2WFWA 4JI1L 2PZWA 3S14H 4CBVA 4XIGS 4OXPA 1BF4A 1WOCA 1C7YA 4JI7L 4JBWA 2A73B 2UUAQ 5DAUA 5M3FH 4A3BH 2ZM6Q 5T1GA 2LXJA 1TWFB 2QF7A 2KHJA 2C5CA 5I2YA 3RLFA 1TY2A 1BCPC 3ULJA 4IOCA 3D3RA 3GTJH 4DV7Q 3HP3A 1CA6A 4RGOS 1N36L 3MWYW 5EQ0A 2AQ3B 2QGQA 3IRBA 2KHIA 3VR5A 2F52A 4GNXB 1YITA 2JEAI 1VMPA 1S4ZA 3N52A 1DOMA 2WAQG 4DR6Q 5IP9H 2ZXRA 5D3IB 5C4JB 3Q0AA 1YJ9A 1B3AA 4QQBX 4I7AA 5IGDA 3M3YH 4B3RL 3TMEA 3A8KE 3JAML 4OONA 4A3FH 2EOTA 3CCEA 4BY1H 1XMQQ 5ELDA 3U50C 4ID6A 1PYWD 1GKHA 4DV0Q 1NY4A 4EX5A 4K0KQ 2ATWA 2HDLA 1MIUA 1K83H 3C1FA 3S15B 1X65A 4XYOA 2LY7A 5M5YH 5C3EH 4HMJA 3OTOL 4YHHQ 4XQQA 4IUQA 1CHQD 3J7AF 1L1OA 1R4QB 4HIMA 5AJ3L 3S2HB 2EY5A 1NBWA 1N8RC 4X3KA 1EY6A 1HQRD 5C4XG 2J4XA 1LTSD 3E9IA 5TSSA 4DAMA 2CVRA 1GUSA 5HGTA 1RCVD 4X65L 3LWEA 3IAYA 1RD9D 5KRUA 2EXDA 3NWTA 2KQ3A 1JC7A 2B2VC 4BWGB 2ZXPA 4A76A 2R7ZH 1A63A 1LTID 1VQJA 4AYBB 1UNSA 4KHPL 4WJ4A 3EA6A 3GTGH 2PI2E 2A19A 4KHVA 5DEHA 1HQMC 2A6ED 4POFA 1CUKA 4JBJA 4ZQ3A 4OWWB 4ODGA 1KAAA 4DV6Q 3DWPA 3LNNA 5L37A 1MI2A 1ZEQX 4C3HB 3PUXA 1I3QH 3KLSX 1DGSA 2QA4A 1VQKA 1YI2A 2OQ0A 1CTMA 2Z6BA 1PFMA 3N6RA 3SK5A 1VQOA 2JA8G 1VQLA 1J9OA 2F3VA 2VQFQ 1L0YB 3TBIB 2XSCA 1AFPA 3M7NA 1KDBA 4RA8A 1IBLL 4BBSG 1K28A 2AQ2B 4A3KH 1EL0A 3CCJA 2ZT9C 4ZCKA 4GLXA 1PH7A 1SNPA 2R93H 1K73C 3S1RH 2IX0A 3BVZA 1I4QA 5J39A 4CHTB 1TKWB 1IBKQ 2K5NA 4JI0L 1QB5D 2WAQB 4AYBE 2SNSA 4R1JA 1AE3A 3W2DA 4JYAQ 1UE6A 2F0UA 1PH5A 3MXPA 3BDCA 5M3MH 3GTQH 1PTOB 3PMFA 2K5QA
chains in the Genus database with same CATH topology
5FLXE 1PRTC 5KYIA 3G6JB 3I4LA 2KUMA 1SE2A 1MSHA 1F9PA 2K6AA 1A3UA 3R3OA 4KD3A 3M7GA 3R8BA 4WJWA 5CR3A 1SYGA 5KNBA 5D3DA 5J22A 1JR0D 2HQEA 3IFTA 1SYFA 2B2YA 2XN9C 4F88A 4RCOA 2XWJB 4RH6A 1I50B 1NR2A 4HCSA 3H6MA 3L7ZC 4O1NA 5JVG3 2QEJC 5JEAH 1NR4A 2JP1A 2B2UA 4C56C 2F0HA 2IW3A 1WTQA 2RVLA 2F0MA 4IUPA 1FNUA 1STHA 3PIO3 4FXDA 2IT1A 1ICWA 1QWYA 2K32A 1XYIA 4H0LC 2LS01 4UDUC 3KF8A 2F03A 2MGSA 3SK4A 1KDCA 5F2DA 2A6HD 4IFDG 2IPKD 5C3XA 1TR5A 5BN5A 4K8JA 1LT5D 3CKIB 2OF1A 4K8IA 2ZXOA 1IW7D 1VF7A 1PXUA 4CJ0B 2L55A 3GP7A 4U68A 2EYJA 2JE6I 1PZJD 4M8AA 2E2JB 1DJRD 1LACA 4XXEA 1G6ZA 1QILA 2XRQD 4KJNA 2O5JC 5C5LA 4V0BA 4UAIA 4IUUA 3K0YA 3J81E 3R2TA 5JOBA 3L9AX 1B4OA 4BY7B 1WD0A 2RSNA 2A68C 2EYOA 2A74C 3KLRA 2EPBA 2EE1A 4DF7A 1SXTA 5ISRA 2QILA 4K5VA 3HGBA 1STEA 4MHEA 3GTOB 1JWMD 2JXMB 2X6GA 2VUMB 4DXGA 2BE5D 2CHBD 5ELBA 2B8GA 1GUGA 1H9MA 5CV6A 4HCEA 3BZDB 2YYZA 3RMHA 5IGEA 1RDPD 1KNEA 3MEHA 1H9KA 3KBGA 3V05A 3BYYB 4OL7A 3HRZC 2TSSA 3CHBD 3VA5A 3K5LA 1Q1BA 1CM9A 4NDXA 2GA4B 3AB9A 5KNCA 1GOZA 1OXVA 2R3ZA 2I46A 1I6HB 1SDFA 3A54A 1EEID 3RZOB 2EJFC 3BG3A 1EY8A 2NN6H 4G57A 4N9TA 5IIFA 3Q23A 3OW7A 3S1QB 1WTXA 3OOCA 2NYZD 5C5MA 1EY0A 3X3NA 4ABNA 1V1PB 4L8JA 2RQXA 3SR1A 2L1BA 1Q12A 4KHZA 5G3LF 5I4DA 4ZUIA 3EVQA 1WD1A 2D2CC 1BBXC 2B2WA 4KKUA 3VYUA 3C3LA 1UAPA 3UI2A 3I70A 3J7YW 2FINB 1XX8A 2Z4HA 1O78A 1TU2B 5M5WB 2F0LA 4J8QA 4B9XA 4CKEA 1LTRD 1WTVA 2BCOA 1XWEA 3VR2A 1GXDC 1RHPA 4HN7A 5JEAJ 4KKSA 1G2TA 4XQJA 4LJZC 1PTOH 3T53B 3OPOA 1LT4D 4DAYA 2A69D 3CRLC 2DNEA 4DNTB 1OO9B 3PO2B 3MXUA 1I6VC 4F7XA 2EY6A 5T1IA 5CC4A 3KBXA 5KNDA 4FYDA 1LTGD 1PFNA 2NN6I 2RBMA 1PMRA 4NMZA 3DXJC 4TQUS 2K5WA 1PTOC 2F0FA 5BN4A 1B9MA 2E2HB 3EQLC 1A2TA 1BQQT 4DK1A 1YNNC 3CRKC 4DGZA 4DFAA 4OIJA 1II3A 2EYMA 5ELCA 4WRDA 1MD2D 5KYLA 1E2VA 1QJOA 3GV6A 2TMPA 1ESRA 2F0SA 3A8JE 3HG9A 4XT3B 1ENAA 1E0BA 5DM63 1FR3A 1YNJD 2SEBD 3AMUA 1SYEA 1BDOA 5I9PA 3M85A 1UEAB 3C1EA 3MTSA 4TKOB 4G7ZC 3NBHA 4DK0A 1RJTA 1G2SA 1K8MA 2WIIB 3S17B 1QNUA 1I4XA 3HOZB 3NHHA 3RUZA 1EFID 3TZUA 4HEDA 4J6HA 4RHSA 5D65A 4QMGA 2K05A 5EKLA 1AZPA 1EZ8A 1RKNA 1H9SA 3A7AB 5JPMC 2M2LA 4KD4A 4WORA 4KKTA 2F0DA 3FEWX 1AZQA 3DUZA 1B50A 1Z47A 3A56A 4ZAIA 3SXHA 2B2VA 1D5ZC 2IX1A 1I4RA 4R9WA 2E76C 4C3HG 2Q8TA 4EVOA 2PW7A 1WVLA 1Q3LA 2Y0SB 4L6TB 5CYUA 3FKIB 2RDHA 1EEFD 2NVTB 1XXGA 1TWHB 4RKLA 4M1UB 5G3LD 3H09A 1ZYRD 1Y1WB 3D8GA 3TSSA 4IALA 1KNAA 1HFNA 4C2MB 2O2LD 1X3PA 3I91A 2QKIC 1SE4A 2K1BA 3JAME 2PQEA 2FJ2A 3AU7A 1G291 1EOTA 4IFDH 1LTBD 3G7LA 4K2LA 5ELEA 3HOXB 2IJ0A 2DN8A 5C0XG 1CZWA 4NKLA 5EPLA 1SJED 3K7AB 3A7LA 3PUVA 3URYA 1A6XA 3VR4A 1GHJA 1I4HA 1AN8A 3D6CA 3NSWA 2NBFA 2R61A 2CW0D 4CGYB 1PLFA 2H1EA 3R2IA 3BVGA 2K7VA 1DZ1A 1JOOA 1HFGA 1Y8OB 1KLGD 3FPUB 1JORA 1C48A 1Y1VB 4B9WA 1EWHA 4LMQD 2EJMA 3X3MA 2BA0A 3OIPA 1FYCA 2VNUD 1L0XB 1D2BA 1SAPA 4OIKA 3J80L 1X3QA 2H4OA 5FO8B 1G8ZD 3I4NB 3SHLA 2MPMA 2O4XA 1O7ZA 4CJ1B 1NSNS 1HUMA 1QCBD 2KCNA 1ZKOA 2EYFA 2M00A 3IFDA 1LABA 2LMCB 2NVYB 2J7ZA 1EWCA 1V43A 1ET9A 4KY7A 3W3AA 5M5XB 4O42A 1JWSD 2Z1CA 3OWFA 1ESFA 2NVXB 2F3WA 1EIGA 2Z4IA 2PMZB 5I6YA 1FD7D 4I7ZC 1JWUD 3D6WA 1JB3A 3NTKA 4QCLA 2F4IA 5A2QL 2E2IB 2JA7B 4WFN3 5EPJA 3K6OA 4QIWB 3DHQA 2EYPA 1PZID 1DM0B 3MFYA 1BUVT 4ZKBB 3E0JA 3K5NA 4X3TA 1STBA 1BCPF 3EROA 2WKDA 4ULLA 4PMCA 5IOCA 5BN3A 1S5ED 1U4MA 1SNCA 3MC0B 2K5DA 2KVMA 3SK6A 3GTKB 3PUZA 2IWHA 5DM73 5I6WA 1Q1EA 3MHBA 4PMBA 2BA1A 2N55A 3TN2A 4IUNA 2IX3A 3BDOA 1Y8NB 1A3VA 5CBAE 4Z9CB 3HOWB 1RODA 3P20A 5JJZA 2KEEA 1A15A 1M4VA 3NTIA 1F2MA 2EY2A 3F2UA 2FMCA 4K5WA 1CHPD 3L3OC 1SNOA 4FF2A 2EDGA 3D31A 4IFDJ 1JCKB 3TDQA 5FOBB 4K6LA 3R93A 1STAA 4K2KA 1JE4A 3A55A 4A3EB 1W6JA 4BBRB 4X3UA 1D6EC 4RAUC 2NUCA 4ZK9B 1LT6D 1U4PA 3HOVB 1TY0A 1RTNA 1JOKA 3NPPA 1KABA 2XRSD 2JA6B 4RGMA 3QB3A 4HAEA 4PV1C 2AWOA 1H9RA 3C46A 3WOEA 3ITPA 3HOUB 4PQXA 1F77A 2KECA 4QB4A 5CV8A 1D1IA 4KY5A 2DY7A 1S5BD 3D4WA 3VYTA 5ELFA 1EYDA 1HUNA 4ZLTF 3P7JA 3EJIA 2VB2X 2E75C 4A3DB 1GHKA 1H9SB 3OMGA 1WTPA 1EQTA 1PRTF 1F2ZA 3HZXA 1LTTD 2K28A 2ID0A 3HKZB 3VR6A 2QDBA 3DM1A 5LHY1 1ET6A 4TSSA 5CV9A 2D62A 1ONLA 2WKCA 1BR9A 1GUNA 4C3IG 3ND8A 1SYDA 2RDFA 1MBYA 2F0TA 5E1FA 3CU7A 4RGTA 2OEOA 3TP8A 3GO5A 5EPKA 4GZYC 2XIWA 1NCVA 1BOSA 3TP6A 2F0WA 4FP5D 3I73A 1DOKA 2SNMA 4KTAA 1BCPD 2EVBA 1I4GA 1HA5A 5JPNC 3LX0A 5AFWA 1JICA 2FMMA 1SNQA 5M9OA 2A6HC 4XDXA 1W6KA 4LK1C 5C3WA 1EY5A 1EYAA 4C1NI 2O5IC 2FHTA 1IW7C 1R9TB 1HRJA 4MN3A 1CQFA 2KJXA 1VMCA 4NP5A 2R93B 1AEXA 1CT1D 1WTRA 5IT9L 3OIQA 5C0XH 3E6ZX 1SFOB 2HCIA 2OT2A 4DAPA 5C6AA 3D4RA 3ZYYX 4CKCA 2CQAA 4BA2I 4FVMA 1S5DD 1JQYD 4FXKC 3DWAA 3I90A 2KA7A 2FFKB 4J1MA 2BOSA 3Q22A 1QNKA 2F0VA 3S16B 1T5XD 3TP7A 2K01A 4C3IB 1FNVA 2EXZA 4NW2A 3HEJA 2L4NA 3I72A 4G7OC 3OWEB 1TS3A 3K57A 4G7HC 5CV7A 1HHVA 2MP1A 2NVQB 2BDOA 4L63B 2EY1A 3QOJA 4FNFA 2G9HD 4K5XA 2L11A 2EZVA 3MAQA 2XVSA 1V1OA 2K04A 4DAVA 1SMYC 2KHSA 3GQBA 1BO0A 1PZKD 3PUWA 5EGTA 3QOLA 3NTHA 3MVVA 4RGNA 2F0JA 1EIHA 2HCCA 1BNZA 5A35A 5C0XI 5I9OA 1S5CD 2X6LA 2Q8IB 1PRTD 5K36G 4V190 1FNWA 2NTTA 3DWQA 4BS9A 2RKSA 2XNAC 1TWGB 1ML0D 4OO1G 2X69A 2AWNA 3E5SA 3C2PA 1X32A 3H94A 3VR3A 4A93B 4H13C 1SNMA 1OXTA 3NBIA 3BVMA 1V1PA 2E74C 3NP8A 5CV5A 2OXPA 3K59A 3NXWA 3H0GB 3QG1A 3IKJA 1K8OA 1HXYD 4QUFA 4PNYA 1EYCA 4X3SA 2PO4A 1EU3A 1Y8PB 1S5FD 1HTLD 2N88A 1EZ6A 4KJOA 4KK7A 1TT2A 1DYQA 2F0IA 4KY6A 4G4KA 2A69C 1SJHD 3BYTB 3GTMB 3IL8A 4XTCS 2EYLA 4ILWA 5C4ZA 2NWGA 4I65A 2D5DA 4Y7NB 5HURA 5COYA 2YU9B 1WCMB 5IGCA 1KTKA 2KEDA 1EY4A 3NWSA 4IQZA 4FF4A 4KMUC 2HDMA 5E3FA 3T16A 2DY8A 2PPBC 4EGVA 4HMIA 4QUCA 3V2TA 2NTSA 4XT1B 1Q90A 1PTOF 3S1MB 2M9VA 2B2TC 2SDFA 1SSOA 3H3VC 4C3JB 2A68D 5C0XJ 2DNCA 4IZ8A 1TS5A 1KDAA 3MA2B 4H7BA 1F9QA 4F8MA 1WTWA 2E2DC 2WV6D 1SEBD 1F2YA 1SNDA 1SYCA 3J80E 3RZDB 5J1ZA 1B2TA 3EFXD 3H91A 1YNJC 3DEPA 2NB0A 3MFGA 2JSOA 1Z7TA 1CFMA 4IFDI 1NAPA 2B63B 5JAVA 3VA7A 2G9DA 5KIXA 1SBBB 1ZXTA 1HCZA 4FF3A 5EJWA 4CJ2C 1QOHA 1STNA 5IGBA 5E4WC 1U9RA 3FRPB 1DCZA 2V4DA 1J8IA 1LLRD 2MUYA 1B1ZA 4FXGC 1PDQA 3S2DB 5I2XA 2PW5A 4RFBA 5CORA 1EY9A 1JOQA 1E2WA 2PZTA 2F1MA 3I3CA 1E2ZA 2WACA 4DA2A 4ZKCB 5EKKA 1IL8A 5A2QE 3ERQA 1OXSC 3DMUA 4ZYSA 4OGQC 3S1NB 1CZGA 5FLXL 4CKBA 1EU4A 1CK1A 1VCIA 3PIP3 3NUCA 1A2UA 4B08A 5FO9B 5IGFA 4U673 1B44D 5CGKA 3A8IE 5C4XB 2B8FA 2QCPX 1ZYRC 4E6IA 5JVH3 2PZUA 1PFBA 3GTPB 1O80A 2K33A 3LWUA 3P75A 3Q6SA 1IYVA 4EQPA 1BXTA 3OMCA 2MJ8A 1AP0A 4OHJA 5FO7B 4MIUA 1D5MC 1T5EA 1TWAB 3PV0A 3M4YA 3HS0C 3QWNA 1OXUA 5FKAC 3MXNA 5CMDA 2LFNA 3K58A 1DD2A 2F0OA 2JA8B 1GUTA 5KEEA 4EQOA 1I4PA 3VYRA 3MZ5A 1F9RA 2WB1B 3P1HA 5EBCA 4BBSB 1MSGA 1Y69U 1ENCA 2PCFB 3T56B 4KN4C 1B53A 5KGUA 3WOFA 5C4HA 2D9UA 3T4AC 2F0KA 1EQVA 3ND9A 1LO5D 1ILQA 4IUTA 2L12A 2CW0C 5EBDA 3J7AV 1TWCB 3SEBA 5D14A 2AUKA 3I4MB 4H44C 1SE3A 4Q5VA 3KUPA 2A6EC 2PNRC 1PTOD 5K5PA 3PUYA 1BCPB 4A3MB 3FMCA 2J0TD 2B2YC 2EJGC 1HA6A 4N9PA 4FF1A 3J81L 2MHVA 1YNND 1U4RA 3S9WA 1STYA 3BDLA 1V8QA 4QF4A 3S14B 3BS1A 4IURA 5M3FB 1CA5A 4A3BB 2B2UC 4KN7C 3GV3A 4RKBA 3SVMA 4HSVA 4JK1C 3GTJB 2JYOA 2AUJD 3KK7A 1B9NA 1XTCD 4K14A 4DU9A 3K5MA 1A3TA 1UUPA 3ONAB 1SMYD 4DN4M 5NUCA 3TP5A 1LV9A 3M3YB 1RTOA 1TS2A 3I8ZA 4A3FB 4BY1B 1WTOA 1HPCA 1C8CA 5K36H 1K83B 3DEOA 1TVXA 1VF5C 3KLSA 5M5YB 5C3EB 1D5XC 2XWBB 3SK8A 4TRDA 4KI0A 5CV4A 3U9SA 1MGSA 4FO2A 3GTLB 3U9OA 3QIAA 4OO1H 1IYUA 2I07B 1F9SA 1SYBA 4Q0FA 2B39A 2ENBA 5JEAG 2EYHA 3QO2A 3QJYA 5IODA 1VDZA 1R4PB 1O7YA 3T51B 2R7ZB 1O7LA 2VB3X 2F0EA 5E4XA 3GTGB 1ILPA 2VXWA 5IGGA 4BA1I 3Q24A 5LL6X 2BDNA 1I3QB 3NE5B 1G91A 2ICEC 1IHZA 4IUVA 1PRTB 3FVQA 4PMWA 4KV6A 4IN3A 1IKLA 5IT9E 4DXFA 3GD7A 4A3KB 1QE6A 2LKVA 3SDZA 4HTHA 2WINB 1FGBD 4XQNA 4DNRB 3S1RB 2WP8J 3FPPA 4P2CB 2ICIA 3OHXC 4ZRZA 5M3MB 3GTQB 1TQOA 3NQIA 2HUGA 3NQTA 4A3IB 3VYSA 3K5OA 2R6GA 4HSPA 3D4DA 2L9HA 1CI3M 1M8AA 3T13A 4EQNA 2A5HA 4OO1I 3O13A 3WDNA 1IKMA 3M4OB 2Z8LA 2F0QA 4S3SA 1LTAD 5CBEE 2PYKA 2BE5C 3CQZB 1AW7A 4ME5A 5FK9C 2F0NA 4XYQA 2RSOA 1GUOA 4F87A 3OSOA 2B2WC 5C44B 1DONA 4A3JB 1ENFA 1DOLA 4A3GB 1F2LA 3MXGA 2NZ1D 1OXXK 1CQVA 3TZDA 2SOBA 1TS4A 2R92B 1QG7A 1GUWA 2RA4A 3NK9A 4RWSC 3SE0A 1HTPA 4C1NK 2KCCA 1U4LA 1D1KA 3V96A 2C9OA 2JA5B 1EY7A 4RCNA 4RHRA 1Z6HA 1TIID 2AQ1B 5LL6S 2L5TA 1STGA 3RD4A 1GJXA 1KLUD 2IL8A 2NN6G 4C3JG 1C4QA 4YIJA 1H9JA 4K6DA 1LT3D 2B2TA 4LAAA 3HOYB 3PO3B 4R8NA 3FDTA 1NUCA 4HR7B 5DNFA 2K03A 4R8IA 2Q8RE 1Q8IA 2RDGA 1DXMA 2F0GA 2KOLA 2F0PA 2L0CA 1RF2D 4ZUJA 2JEBI 5EKIA 2PZWA 4CBVA 4XIGS 1BF4A 4JBWA 2A73B 5DAUA 5T1GA 1TWFB 2QF7A 2C5CA 5I2YA 3RLFA 1TY2A 1BCPC 3D3RA 3HP3A 1CA6A 4RGOS 3MWYW 5EQ0A 2AQ3B 3VR5A 2JEAI 1VMPA 1S4ZA 3N52A 1DOMA 2ZXRA 5D3IB 5C4JB 3Q0AA 1B3AA 5IGDA 3TMEA 3A8KE 3JAML 2EOTA 5ELDA 4ID6A 1PYWD 2HDLA 3C1FA 3S15B 4XYOA 2LY7A 4HMJA 4XQQA 4IUQA 1CHQD 3J7AF 1R4QB 3S2HB 2EY5A 4X3KA 1EY6A 1HQRD 2J4XA 1LTSD 5TSSA 2CVRA 1GUSA 5HGTA 1RCVD 3LWEA 3IAYA 1RD9D 5KRUA 3NWTA 2KQ3A 1JC7A 2B2VC 4BWGB 2ZXPA 1LTID 4AYBB 1UNSA 3EA6A 4KHVA 5DEHA 1HQMC 2A6ED 4ZQ3A 4ODGA 1KAAA 3DWPA 3LNNA 1MI2A 1ZEQX 4C3HB 3PUXA 3KLSX 1CTMA 3SK5A 1PFMA 3N6RA 1J9OA 2F3VA 1L0YB 3TBIB 2XSCA 1AFPA 3M7NA 1KDBA 4RA8A 2AQ2B 1EL0A 2ZT9C 1SNPA 2IX0A 3BVZA 1I4QA 5J39A 4CHTB 1TKWB 1QB5D 2WAQB 2SNSA 3W2DA 2F0UA 3MXPA 3BDCA 1PTOB 3PMFA 2K5QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AEX A;  4KJN A;  1EY0 A;  2SOB A;  4QF4 A;  5I6W A;  5IGD A;  5C5L A;  5IGF A;  3D8G A;  3MHB A;  4PMB A;  4DGZ A;  4IAL A;  3TME A;  4DFA A;  2RKS A;  5CGK A;  1A3U A;  3R3O A;  4KD3 A;  4ID6 A;  1IHZ A;  3SR1 A;  4E6I A;  3OMG A;  3NK9 A;  4IUN A;  2PZU A;  5C6A A;  5KYI A;  5JOB A;  5CR3 A;  3SHL A;  1F2Z A;  4IZ8 A;  1SYG A;  1II3 A;  2EYM A;  2O4X A;  3C1F A;  4KV6 A;  5J22 A;  3HZX A;  1KDA A;  1A3V A;  2HQE A;  3EVQ A;  4H7B A;  4RKB A;  4WRD A;  4ZUI A;  3E5S A;  2EYO A;  1NSN S;  4HMJ A;  5KYL A;  3P75 A;  4F8M A;  4EQP A;  1SYF A;  2F0S A;  3OMC A;  1EY7 A;  2PQE A;  1ENA A;  2LKV A;  4DF7 A;  5ISR A;  1SNM A;  1SND A;  1F2Y A;  4HTH A;  1SYC A;  2EY5 A;  4MIU A;  4K5V A;  4J1M A;  2QDB A;  5J1Z A;  1STG A;  1EY6 A;  1SYE A;  4K14 A;  4DU9 A;  1F2M A;  2EY2 A;  5CV9 A;  2F0V A;  5I9P A;  4K5W A;  3C1E A;  4K2L A;  1A3T A;  2EYF A;  3TP7 A;  3NP8 A;  1SNO A;  4YIJ A;  4K6D A;  5HGT A;  3H6M A;  2M00 A;  5KRU A;  4LAA A;  2F0O A;  2F0L A;  4R8N A;  5CV5 A;  1STA A;  4B9X A;  5JAV A;  1NUC A;  1TQO A;  2OXP A;  5NUC A;  2KQ3 A;  3TP5 A;  5KEE A;  5KIX A;  4K2K A;  1SYD A;  4EQO A;  2EXZ A;  2RDF A;  3NXW A;  3HEJ A;  3NHH A;  3NQT A;  2F0T A;  4KY7 A;  5CV6 A;  3RUZ A;  2F0H A;  3OWF A;  3MZ5 A;  4NKL A;  5E1F A;  5C5M A;  2F3W A;  1STN A;  3D4D A;  5IGB A;  4J6H A;  4PNY A;  3P1H A;  1EYC A;  2F0G A;  4KHV A;  5CV7 A;  2F0M A;  2F0P A;  5DEH A;  2OEO A;  4ZQ3 A;  4QMG A;  3T13 A;  3TP8 A;  4EQN A;  5IGE A;  5I6Y A;  4ZUJ A;  4ODG A;  5EKL A;  1U9R A;  2NUC A;  1KAA A;  1STH A;  1ENC A;  2EY1 A;  3QOJ A;  3MEH A;  1EZ8 A;  1RKN A;  3TP6 A;  2PZW A;  1EZ6 A;  2F0W A;  4KJO A;  5KGU A;  2F0Q A;  5C4H A;  4S3S A;  1TT2 A;  4K5X A;  3D6C A;  2F0K A;  4OL7 A;  3SK8 A;  1EQV A;  2F0I A;  4KY6 A;  4TRD A;  5DAU A;  3SK4 A;  1JOK A;  4KD4 A;  5CV4 A;  1KAB A;  4WOR A;  3SK5 A;  2PW5 A;  1KDC A;  2PYK A;  2F0D A;  2SNM A;  3U9O A;  4F7X A;  4KTA A;  5F2D A;  4NDX A;  2EY6 A;  2EYL A;  2F3V A;  1EY9 A;  5C4Z A;  1JOQ A;  2KHS A;  4ME5 A;  5CC4 A;  3DHQ A;  5C3X A;  2EYP A;  1TR5 A;  2F0N A;  3LX0 A;  2PZT A;  3QB3 A;  4I65 A;  1JOO A;  1SNQ A;  2WAC A;  1SYB A;  5M9O A;  1KDB A;  5EKK A;  5HUR A;  3SXH A;  2RBM A;  4K8J A;  5C3W A;  3ERQ A;  1EY5 A;  1EYA A;  2OF1 A;  5EGT A;  3QOL A;  5IGC A;  4K8I A;  3MVV A;  2ENB A;  3DMU A;  4NMZ A;  3ITP A;  1SNP A;  2F0J A;  2EYH A;  3VA5 A;  5K5P A;  1JOR A;  1STB A;  3ERO A;  1EY4 A;  3OSO A;  5IOD A;  4QB4 A;  5CV8 A;  4B9W A;  5J39 A;  4PMC A;  4EVO A;  2PW7 A;  4KY5 A;  5I9O A;  2F0E A;  3T16 A;  5IOC A;  5E3F A;  3D4W A;  4N9P A;  2F0F A;  1EY8 A;  2EYJ A;  2SNS A;  4N9T A;  4G57 A;  5IGG A;  5IIF A;  1EYD A;  1SNC A;  3SK6 A;  4HMI A;  2F0U A;  3NUC A;  1A2T A;  1A2U A;  3BDC A;  3MXP A;  4NP5 A;  4RKL A;  3V2T A;  3S9W A;  1STY A;  3PMF A;  3EJI A;  3BDL A; 
#chains in the Genus database with same CATH topology
 5FLX E;  1PRT C;  4DR5 L;  3K81 C;  5KYI A;  1YVC A;  3G6J B;  3KF6 B;  3I4L A;  2KUM A;  3I4M G;  1SE2 A;  1MSH A;  1F9P A;  2K5V A;  2K6A A;  4JOI A;  1A3U A;  3R3O A;  4KD3 A;  3M7G A;  3R8B A;  4A3C H;  4GOP C;  4WJW A;  4A3M G;  4L5T A;  5CR3 A;  4BY7 G;  1SYG A;  5KNB A;  5D3D A;  5J22 A;  1VQ7 A;  1JR0 D;  2HQE A;  4IJH A;  3AYH B;  5LMU L;  3IFT A;  3ZJY C;  1HNW L;  1SYF A;  2B2Y A;  2XN9 C;  2QEX A;  3JAM c;  4F88 A;  2FXQ A;  4RCO A;  1B70 B;  2XWJ B;  4RH6 A;  2R7D A;  1I50 B;  2WAQ E;  1NR2 A;  1KRS A;  3BZK A;  5M3F G;  4HCS A;  3H6M A;  3L7Z C;  4O1N A;  3T1Y L;  4GKK Q;  5JVG 3;  2NVQ H;  2QEJ C;  5JEA H;  1NR4 A;  2JP1 A;  2B2U A;  1N34 L;  1XPO A;  1BKB A;  2F0H A;  2IW3 A;  4C56 C;  4A3J H;  2QW7 A;  1WTQ A;  2RVL A;  3G48 A;  4A3G H;  2F0M A;  1ICF B;  4JPB W;  4X6A H;  4IUP A;  1G51 A;  1FNU A;  1STH A;  3PIO 3;  4FXD A;  2NZO A;  2IT1 A;  1ICW A;  1QWY A;  2K32 A;  1XYI A;  4H0L C;  5FJ8 G;  2LS0 1;  3UDX A;  2R92 H;  4UDU C;  3KF8 A;  2F03 A;  2MGS A;  2R7F A;  3SK4 A;  3I2Z A;  1KDC A;  5F2D A;  2A6H D;  4IFD G;  2IPK D;  4JI3 L;  5C3X A;  1TR5 A;  4BY1 G;  1BVS A;  3D0F A;  5BN5 A;  4K8J A;  3CCL A;  1LT5 D;  3CKI B;  2OF1 A;  2JA5 H;  1LYL A;  2Q2T A;  4L5R C;  4GN5 A;  2ZXO A;  4K8I A;  1FJG Q;  1D7Q A;  1IW7 D;  1VF7 A;  2HQL A;  1PXU A;  1PH9 A;  4CJ0 B;  1PH1 A;  2L55 A;  3GP7 A;  4U68 A;  2EYJ A;  4NXM L;  2JE6 I;  1PZJ D;  4M8A A;  1TWG H;  1PVO A;  1DJR D;  2E2J B;  1LAC A;  4XXE A;  3HOY H;  3PO3 H;  1G6Z A;  1QIL A;  2XRQ D;  4KJN A;  2O5J C;  4B3M Q;  5C5L A;  4V0B A;  4UAI A;  3PQI A;  4IUU A;  3ICE A;  3K0Y A;  3J81 E;  4HID A;  3MEF A;  3R2T A;  1NJI C;  5JOB A;  3L9A X;  1B4O A;  4BY7 B;  1WD0 A;  2RSN A;  1V9P A;  2A68 C;  4LF7 L;  2EYO A;  2A74 C;  3KLR A;  2VL6 A;  3E3X A;  1JJG A;  2EPB A;  1K8G A;  4RG1 A;  2EE1 A;  4DF7 A;  1SXT A;  5ISR A;  4HIO A;  1X55 A;  2QIL A;  4IPH A;  4K5V A;  3HGB A;  1STE A;  2RHS B;  4MHE A;  3CP0 A;  4X62 Q;  3GTO B;  1QZG A;  1JWM D;  1RL2 A;  2JXM B;  2X6G A;  4JI6 L;  4JVZ A;  2VUM B;  4IPG A;  4LF4 L;  4DXG A;  2UUC L;  2BE5 D;  2CHB D;  5ELB A;  2B8G A;  1GUG A;  4R4O A;  1H9M A;  3PF4 A;  4YWK A;  5CV6 A;  3UDF A;  4HCE A;  3BZD B;  1Q86 C;  2YYZ A;  3RMH A;  2QDL A;  5IGE A;  1RDP D;  2BH2 A;  1KNE A;  3MEH A;  4IPC A;  1H9K A;  3KBG A;  3V05 A;  3BYY B;  2YU9 H;  4OL7 A;  3HRZ C;  3PO2 G;  2TSS A;  3CHB D;  3VA5 A;  3K5L A;  1Q1B A;  5M3M G;  1CM9 A;  4NDX A;  3F2B A;  2GA4 B;  1X9N A;  4A3I G;  3A5Z B;  3AB9 A;  5BR8 L;  5KNC A;  1GOZ A;  1OXV A;  2R3Z A;  3KDF A;  5GAH C;  4GNX C;  4LUZ A;  4A3C G;  2I46 A;  1I6H B;  1SDF A;  3S2H H;  3A54 A;  1EEI D;  3RZO B;  2EJF C;  1JJC B;  3BG3 A;  1EY8 A;  2NN6 H;  4G57 A;  4N9T A;  5IIF A;  3Q23 A;  3OW7 A;  3S1Q B;  1JJ2 A;  2UXC Q;  1WTX A;  3OOC A;  2NYZ D;  5C5M A;  2JQO A;  1EY0 A;  3X3N A;  1VQM A;  4ABN A;  1V1P B;  4A3L G;  4L8J A;  2RQX A;  3SR1 A;  2L1B A;  1Q12 A;  4KHZ A;  1NTG A;  5C44 G;  3L0O A;  5G3L F;  5I4D A;  4ZUI A;  3EVQ A;  2PQA B;  1WD1 A;  2D2C C;  4GN4 B;  4A3G G;  1BBX C;  4DR7 Q;  4DV2 L;  2B2W A;  4GN3 B;  4KKU A;  4NXN Q;  3VYU A;  3C3L A;  2OWO A;  4PZ7 A;  1UAP A;  3UI2 A;  4CDC C;  3I70 A;  3J7Y W;  2FIN B;  2R92 G;  1XX8 A;  5J3B A;  1SMX A;  2Z4H A;  1UE7 A;  1O78 A;  1TU2 B;  2Z0S A;  1MJE A;  5M5W B;  4LF6 L;  2F0L A;  4J8Q A;  5FLM H;  4B9X A;  3RLN A;  4CKE A;  1LTR D;  3HOZ G;  5E7N A;  1WTV A;  2BCO A;  1XWE A;  1E22 A;  3VR2 A;  1GXD C;  1RHP A;  4HN7 A;  5JEA J;  1IBM Q;  1IL2 A;  3S2D H;  3E0E A;  4DR2 Q;  4KKS A;  1G2T A;  2Z9H A;  4XQJ A;  4DV7 L;  5GQO A;  4LJZ C;  1PTO H;  3T53 B;  3OPO A;  4EQ5 A;  3CC2 A;  2E5L L;  1LT4 D;  4DAY A;  2A69 D;  3CRL C;  2DNE A;  4DNT B;  1OO9 B;  3PO2 B;  3MXU A;  3HOY G;  4DR6 L;  1FVI A;  1I6V C;  4F7X A;  3S1N H;  2EY6 A;  5T1I A;  5CC4 A;  3KBX A;  5KND A;  1L1O B;  4FYD A;  1LTG D;  1PFN A;  2NN6 I;  1S40 A;  2RBM A;  2ZTC A;  1YHA A;  4LFC Q;  1PMR A;  3STB C;  4GS3 A;  4NMZ A;  3DXJ C;  1XMQ L;  4TQU S;  2K5W A;  2GVB A;  4JI2 Q;  4DV0 L;  1Q82 C;  2UXB L;  2Y0S G;  1PTO C;  1I50 H;  2F0F A;  3FKI G;  5BN4 A;  1M90 C;  1M1K C;  1B9M A;  4ME3 A;  2E2H B;  3S24 A;  3EQL C;  3QR8 A;  1A2T A;  1GO3 E;  1BQQ T;  2Q2I A;  4DK1 A;  1YNN C;  1Y1W G;  3CRK C;  4DGZ A;  4DFA A;  1P8L A;  1KXL A;  4OIJ A;  1YBY A;  4JW0 A;  1II3 A;  2EYM A;  4OEL B;  4OX9 Q;  4Y52 H;  5ELC A;  4WRD A;  5IWA Q;  1MD2 D;  4B3T Q;  5KYL A;  1E2V A;  1QJO A;  3GV6 A;  2N3S A;  2TMP A;  1ESR A;  2F0S A;  3A8J E;  3HG9 A;  4XT3 B;  5GAE C;  1ENA A;  1HNX Q;  5IY0 A;  1E0B A;  5DM6 3;  2JA8 H;  1FR3 A;  1YNJ D;  2SEB D;  2CCZ A;  3AMU A;  1SYE A;  3RLO A;  4QY7 A;  4JBM A;  1BDO A;  5I9P A;  4DV6 L;  3M85 A;  1UEA B;  3C1E A;  3MTS A;  4TKO B;  2VY3 A;  4BBS H;  4G7Z C;  3NBH A;  4DK0 A;  1RJT A;  1G2S A;  1K8M A;  2WII B;  3A74 A;  4MNO A;  3S17 B;  1QNU A;  1VQ6 A;  1I4X A;  1L0W A;  3HOZ B;  3NHH A;  3RUZ A;  2UU9 L;  1EFI D;  1VQE A;  3TZU A;  1K9M C;  1B3Q A;  1HR0 L;  4HED A;  4J6H A;  4RHS A;  5D65 A;  4RMF A;  4QMG A;  1YNX A;  2K05 A;  2B29 A;  3PF5 A;  2E2J H;  5EKL A;  1AZP A;  2CFM A;  1EZ8 A;  4JV5 Q;  1RKN A;  2KEN A;  1H9S A;  2E8G A;  2L15 A;  2Z6K C;  1B7Y B;  3A7A B;  1V1Q A;  5JPM C;  4LF9 Q;  2M2L A;  4KD4 A;  1IBK L;  4WOR A;  4KKT A;  2F0D A;  1MJC A;  3FEW X;  4UP9 A;  1AZQ A;  1XPR A;  3DUZ A;  1VQI A;  4BY7 H;  1B50 A;  4X66 L;  1PH2 A;  1Z47 A;  3A56 A;  1YJW A;  4ZAI A;  2MFI A;  3SXH A;  2B2V A;  1D5Z C;  4PG3 A;  1EIF A;  2IX1 A;  1I4R A;  4IJL A;  4R9W A;  1K0S A;  4GLA C;  2E76 C;  4C3H G;  2Q8T A;  2UUB Q;  4EVO A;  3I56 A;  2PW7 A;  1WVL A;  1Q3L A;  2Y0S B;  4L6T B;  3GTO H;  3J7Z C;  2VZA A;  5CYU A;  4DR3 Q;  1HR0 W;  3FKI B;  2RDH A;  2LSS A;  2VUM H;  1EEF D;  2NVT B;  1XXG A;  3KFU A;  3M9B A;  1TWH B;  4RKL A;  1LM0 A;  4M1U B;  1KIX A;  5G3L D;  1ASZ A;  3H09 A;  1ZYR D;  4DV5 Q;  5LMN W;  1Y1W B;  3D8G A;  3TSS A;  4IAL A;  1KNA A;  2AKW B;  2RCF A;  1U0L A;  3MXN B;  5FLM G;  1HFN A;  2GN5 A;  3CCU A;  4C2M B;  2O2L D;  3KOJ A;  4LFB Q;  1X3P A;  3I91 A;  2QKI C;  2YTY A;  1SE4 A;  2K1B A;  5FJ8 H;  3JAM E;  2ZTD A;  3J81 i;  2PQE A;  2FJ2 A;  4YWL A;  3AU7 A;  1G29 1;  1EOT A;  1N33 L;  4IFD H;  1LTB D;  2Y0S E;  1TXY A;  3G7L A;  3CCV A;  4DV3 Q;  2VS1 A;  4K2L A;  1HNZ Q;  5ELE A;  4AQY Q;  4JG2 A;  3HOX B;  3K0X A;  1I6H H;  2IJ0 A;  2DN8 A;  5C0X G;  4GOP A;  1CZW A;  3RZO H;  4NKL A;  3U4Z A;  4A75 A;  5EPL A;  4QL5 A;  1SJE D;  1EWI A;  3GTL H;  3S1Q H;  3K7A B;  3A7L A;  4YCV A;  3PUV A;  3URY A;  4HJA A;  1A6X A;  3VR4 A;  4DR1 L;  1FJG L;  1GHJ A;  1I4H A;  3CCR A;  1AN8 A;  3D6C A;  3NSW A;  2NBF A;  2R61 A;  2CW0 D;  3CXC A;  2DGY A;  2I5H A;  4CGY B;  1PLF A;  2H1E A;  4CDD C;  3R2I A;  1SE8 A;  1XMO L;  3BVG A;  2K7V A;  3CMA A;  1DZ1 A;  1JOO A;  2D0O A;  1HFG A;  1Y8O B;  4NPS A;  3HFZ B;  4N8X 1;  1I94 Q;  1KLG D;  3FPU B;  2HD3 A;  4P74 A;  1JOR A;  4QGU A;  1C48 A;  1VQ5 A;  1Y1V B;  4B9W A;  1EWH A;  4DV4 L;  1XNQ L;  4LMQ D;  3EBE A;  1VQF A;  2EJM A;  1J5E L;  3B6Y A;  3X3M A;  1UWV A;  2BA0 A;  5M5W H;  1E1T A;  3OIP A;  1FYC A;  2VNU D;  1PYB A;  4DV1 Q;  4LFA Q;  1L0X B;  4X62 L;  3A0J A;  1D2B A;  1SAP A;  4OIK A;  1W2B A;  3J80 L;  1X3Q A;  2UXD Q;  2H4O A;  5FO8 B;  1G8Z D;  3F2C A;  3I4N B;  3SHL A;  2MPM A;  2O4X A;  1O7Z A;  4CJ1 B;  2EIF A;  2K4K A;  1NSN S;  1HUM A;  4DR4 Q;  3PO2 H;  3RN5 A;  3KDF B;  1QCB D;  3Q8D A;  2KCN A;  4A3I H;  1Z9F A;  1ZKO A;  2EYF A;  1KD1 C;  1CSQ A;  2M00 A;  3IFD A;  1LAB A;  2LMC B;  4R4T A;  4X64 Q;  2VQE Q;  2NVY B;  2J7Z A;  1EWC A;  1V43 A;  2CWP A;  2F4V Q;  1ET9 A;  4A3E G;  3M4O H;  4KY7 A;  3W3A A;  5M5X B;  4O42 A;  1JWS D;  2Z1C A;  3OWF A;  1ESF A;  2NVX B;  2F3W A;  3A5U A;  1EIG A;  2Z4I A;  2PMZ B;  3UDI A;  1K3R A;  5I6Y A;  1FD7 D;  4JI1 Q;  3CQZ H;  4I7Z C;  4DNI A;  1JWU D;  3D6W A;  1JE5 A;  1JB3 A;  2JN4 A;  3NTK A;  4JI8 L;  4JI7 Q;  4QCL A;  4JI5 Q;  2VUM G;  2F4I A;  5A2Q L;  1L1O C;  2K5H A;  4A3L H;  3TRZ A;  4A4I A;  2E2I B;  2JA7 B;  4WFN 3;  2JA6 G;  5EPJ A;  4DUY Q;  3K6O A;  4QIW B;  2UXC L;  3DHQ A;  2EYP A;  5C44 H;  1PZI D;  4DPG A;  3RNU A;  1DM0 B;  3MFY A;  1BUV T;  4ZKB B;  3E0J A;  4R4C A;  1N36 Q;  1S72 A;  3K5N A;  3HOU G;  4X3T A;  1STB A;  1BCP F;  2K50 A;  1LTL A;  2WKD A;  3ERO A;  4ULL A;  4PMC A;  1UE1 A;  5IOC A;  5BN3 A;  2RHQ B;  1S5E D;  1U4M A;  1SNC A;  3MC0 B;  2K5D A;  2KVM A;  3SK6 A;  3GTK B;  4DR7 L;  3PUZ A;  2IWH A;  3S17 H;  5DM7 3;  5I6W A;  3HOZ H;  1Q1E A;  3MHB A;  4PMB A;  3PIO A;  2BA1 A;  1PV4 A;  1A0I A;  2K52 A;  1NMG A;  2CH4 A;  2N55 A;  3TN2 A;  4DAY B;  4YCW A;  4IUN A;  2IX3 A;  4GNX A;  1HZC A;  3BDO A;  1Y8N B;  1A3V A;  5CBA E;  4Z9C B;  3HOW B;  1ROD A;  3TS2 A;  1UE5 A;  3P20 A;  5JJZ A;  2BH8 A;  2KEE A;  1JT8 A;  2N8N A;  1A15 A;  4UY8 C;  4YY3 L;  1M4V A;  1FGU A;  2JJQ A;  2HIV A;  3NTI A;  3J80 c;  1F2M A;  2EY2 A;  1XTD A;  2PI2 A;  3F2U A;  4X65 Q;  2FMC A;  4K5W A;  2MNA A;  1CHP D;  1X3E A;  3L3O C;  1SNO A;  2A1A A;  4FF2 A;  4ALP A;  2EDG A;  3D31 A;  4IFD J;  4MTK A;  1A62 A;  1JCK B;  4K6L A;  3TDQ A;  5FOB B;  3R93 A;  1STA A;  3CC7 A;  4K2K A;  1JE4 A;  1MHW C;  3A55 A;  4A3E B;  1W6J A;  4BBR B;  4KHP Q;  4X3U A;  3KYH C;  1Q7Y C;  1D6E C;  3FKI H;  3STB D;  1H95 A;  1CKM A;  4RAU C;  2NVT H;  1TWF H;  1TWH H;  1VQ4 A;  2NUC A;  2IY5 B;  5GRO A;  4LFC L;  4ZK9 B;  4R4Q A;  1LT6 D;  1U4P A;  1W3S A;  3DM3 A;  3HOV B;  1TY0 A;  4P73 A;  1Y1W H;  1RTN A;  1WTH A;  1JOK A;  3NPP A;  1KAB A;  3CPF A;  4C2M H;  2XRS D;  2JA6 B;  1K0R A;  4RGM A;  3QB3 A;  4HAE A;  3EN2 A;  1VQG A;  4PV1 C;  2AWO A;  2V1C C;  5C4J H;  1H9R A;  3BJU A;  3C46 A;  3WOE A;  3ITP A;  3PCO B;  3HOU B;  4PQX A;  1F77 A;  2KEC A;  4QB4 A;  4JI0 Q;  5CV8 A;  1D1I A;  4KY5 A;  3NBH B;  2DY7 A;  1S5B D;  3D4W A;  4OX9 L;  3VYT A;  5ELF A;  1EYD A;  1HUN A;  3AFP A;  3HOX H;  4ZLT F;  3P7J A;  1S3O A;  3S15 H;  3EJI A;  1HNX L;  2VB2 X;  2E75 C;  4KLK A;  4A3D B;  1GHK A;  1H9S B;  4JI4 L;  3OMG A;  3K7A H;  1WTP A;  3VDY A;  1EQT A;  1PRT F;  1F2Z A;  3HZX A;  2HHH L;  1UEB A;  1LTT D;  2K28 A;  2ID0 A;  3HKZ B;  3VR6 A;  2QDB A;  3DM1 A;  5LHY 1;  1ET6 A;  4TSS A;  5CV9 A;  4POG A;  1VQN A;  2PNH A;  2D62 A;  3ERS X;  3JAM i;  4JV5 L;  1ONL A;  2WKC A;  1BR9 A;  3FHW A;  3K7U C;  2ZJR A;  1GUN A;  4C3I G;  1N34 Q;  3ND8 A;  1SYD A;  2JA9 A;  2RDF A;  1MBY A;  1Y1V H;  4C3H H;  2F0T A;  4DUZ Q;  5E1F A;  2ZJQ A;  3CU7 A;  4RGT A;  1HZA A;  3KLW A;  2OEO A;  3TP8 A;  1Q81 C;  3GO5 A;  1QVF A;  5EPK A;  4GZY C;  2XIW A;  2DJF C;  1NCV A;  1BOS A;  3TP6 A;  2F0W A;  1YZ6 A;  4FP5 D;  3I73 A;  2UUB L;  2A8V A;  5IYB G;  1DOK A;  1CKN A;  4DR3 L;  2SNM A;  3BU2 A;  2UUA L;  4WJ3 M;  2KBN A;  4KTA A;  1BCP D;  4L5Q A;  2EVB A;  1I4G A;  2ZM6 L;  1OTC A;  2ALY B;  1HA5 A;  4IOA A;  5JPN C;  5IYD G;  1HZ9 A;  3LX0 A;  5AFW A;  1JIC A;  2FMM A;  1SNQ A;  5M9O A;  2A6H C;  4XDX A;  1W6K A;  4LK1 C;  5C3W A;  1EY5 A;  1EYA A;  4C1N I;  1BBU A;  3EIV A;  1QVG A;  2O5I C;  2FHT A;  4NXM Q;  4LFB L;  1IW7 C;  1R9T B;  1HRJ A;  3J7A 5;  3BZC A;  4MN3 A;  2Z6K A;  1CQF A;  2KJX A;  1VMC A;  4NP5 A;  1SR3 A;  2N49 A;  2R93 B;  2NVY H;  2GVA A;  3L2P A;  1AEX A;  1CT1 D;  1WTR A;  5IT9 L;  3OIQ A;  1VQB A;  5C0X H;  5M5X H;  3E6Z X;  1SFO B;  2HCI A;  2K75 A;  4FDB A;  2OT2 A;  2VW9 A;  4DV3 L;  4DAP A;  5C6A A;  3D4R A;  3ZYY X;  4P72 A;  2D0P A;  4LF7 Q;  4K0K L;  4CKC A;  4H02 A;  2CQA A;  2I5M X;  4BA2 I;  4FVM A;  4A93 G;  1HZB A;  1S5D D;  1KL9 A;  1GVP A;  1JQY D;  4FXK C;  1HH2 P;  3DWA A;  3I90 A;  4YHH L;  2KA7 A;  2FFK B;  2E2I H;  2JA7 H;  4J1M A;  2BOS A;  3I4O A;  3Q22 A;  4JI6 Q;  1QNK A;  1YEZ A;  2F0V A;  3S16 B;  4LF4 Q;  2AMC B;  1T5X D;  3TP7 A;  1T9H A;  2K01 A;  1E1O A;  4C3I B;  1FNV A;  2EXZ A;  4NW2 A;  1Q46 A;  2L4N A;  3H0G G;  3HEJ A;  1X3F A;  3I72 A;  1FL0 A;  2XGT A;  1XJV A;  4G7O C;  3OWE B;  1K8A C;  1TS3 A;  3K57 A;  4G7H C;  5CV7 A;  1N32 Q;  1HHV A;  2MP1 A;  3WWV A;  2NVQ B;  2BDO A;  4L63 B;  2EY1 A;  3QOJ A;  1PYS B;  4FNF A;  2G9H D;  4K5X A;  1QUQ A;  2L11 A;  3HOX G;  2EZV A;  3PSI A;  3MAQ A;  4BXX G;  2XVS A;  4OWX B;  1V1O A;  2K04 A;  4DAV A;  1SMY C;  2KHS A;  1NMF A;  3GQB A;  2VQF L;  2I5L X;  1BO0 A;  1JB7 A;  4DV1 L;  3HOW H;  1PZK D;  3PUW A;  1WCM G;  5EGT A;  5IYC H;  3QOL A;  5IE8 A;  3NTH A;  3MVV A;  1GD7 A;  4RGN A;  2F0J A;  2HIX A;  1VQ9 A;  1EIH A;  5JJL A;  4DK3 C;  2HCC A;  1BNZ A;  5A35 A;  3PGZ A;  5C0X I;  2UXD L;  5I9O A;  3KJP A;  1S5C D;  2X6L A;  2Q8I B;  1PRT D;  2ZJP A;  5K36 G;  4JYA L;  2F3I A;  4V19 0;  1FNW A;  2NTT A;  3DWQ A;  3KJO A;  2KCM A;  4A3E H;  4BS9 A;  4BBR H;  4CDE C;  2RKS A;  1EQQ A;  4N8F A;  2XNA C;  1TWG B;  1ML0 D;  4OO1 G;  1SRU A;  1Y1V G;  1LUZ A;  2X69 A;  3F2D A;  2AWN A;  1VQD A;  3E5S A;  3C2P A;  2K14 A;  1X32 A;  3H94 A;  3VR3 A;  4LF8 Q;  2F4V L;  4A93 B;  4H13 C;  5IT9 c;  4UPA A;  1SNM A;  1X6O A;  1OXT A;  3NBI A;  1YJN A;  2JA6 H;  2CQO A;  3J81 j;  3BVM A;  1V1P A;  1VS0 A;  2E74 C;  4LF5 Q;  4LF6 Q;  3NP8 A;  4LW1 A;  1VQC A;  4JI5 L;  3I4N G;  3KF8 B;  1O7I A;  5CV5 A;  4GKK L;  2B63 G;  1YIJ A;  2OXP A;  3K59 A;  3HOU H;  2PQA A;  4B3S Q;  3NXW A;  3H0G B;  3QG1 A;  3IKJ A;  4DUY L;  1HXY D;  4QUF A;  1K8O A;  4PNY A;  1EYC A;  4X3S A;  1I5F A;  2PO4 A;  1WYD A;  4LWC A;  4TVA B;  1C9O A;  1EU3 A;  1VQP A;  2E5L Q;  1Y8P B;  1S5F D;  1HTL D;  1A8V A;  2N88 A;  1P16 A;  1EZ6 A;  2ZTE A;  3K80 C;  4KJO A;  4KK7 A;  3G6E A;  4APV A;  1TT2 A;  4GKJ Q;  1DYQ A;  2F0I A;  4KY6 A;  4A3D H;  4G4K A;  2A69 C;  1SJH D;  3BYT B;  1EQR A;  3GTM B;  3IL8 A;  4XTC S;  2EYL A;  4ILW A;  5C4Z A;  2NWG A;  3CCQ A;  4I65 A;  3CW2 C;  3H3V H;  2D5D A;  1WI5 A;  1PH8 A;  4Y7N B;  5HUR A;  5COY A;  2YU9 B;  1WCM B;  4HJ8 A;  5IGC A;  1KTK A;  2KED A;  1B8A A;  2UXB Q;  3CCM A;  1EY4 A;  3NWS A;  4IQZ A;  2CWA A;  4FF4 A;  4KMU C;  2HDM A;  5E3F A;  3T16 A;  2DY8 A;  2PPB C;  1QVC A;  1XNR Q;  2JA7 G;  3CD6 A;  4EGV A;  4HMI A;  4JBK A;  4QUC A;  3V2T A;  4LUV A;  2NTS A;  4XT1 B;  1Q90 A;  1PTO F;  3S1M B;  2M9V A;  2B2T C;  2SDF A;  1SSO A;  4B3M L;  3H3V C;  1SN8 A;  2DJG C;  4C3J B;  4P75 A;  1QZH A;  2A68 D;  1IXR A;  4DKA C;  5C0X J;  2DNC A;  1VQH A;  4IZ8 A;  4JCV E;  2Q2H A;  1TS5 A;  1KDA A;  1AE2 A;  3MA2 B;  4H7B A;  1F9Q A;  3TQY A;  2KCT A;  4F8M A;  1WTW A;  2E2D C;  2WV6 D;  1SEB D;  1F2Y A;  1SND A;  1SYC A;  3GDE A;  3J80 E;  3RZD B;  5J1Z A;  2XTI A;  1B2T A;  3EFX D;  3H91 A;  1YNJ C;  3W1B A;  4CDF C;  3DEP A;  4IO9 A;  2NB0 A;  3MFG A;  2JSO A;  1Z7T A;  1CFM A;  4IFD I;  1NAP A;  2B63 B;  5JAV A;  3VA7 A;  2UU9 Q;  2G9D A;  5KIX A;  3HKS A;  1SBB B;  1ZXT A;  4UP7 A;  3HOW G;  1HR0 Q;  1HCZ A;  4FF3 A;  5EJW A;  4CJ2 C;  1QOH A;  2MO1 A;  5IYC G;  1STN A;  1J6Q A;  5IGB A;  2WB1 G;  2HT1 A;  1R9T H;  5E4W C;  2CH4 W;  3H15 A;  1U9R A;  3FRP B;  5LMN Q;  3H3V I;  1DCZ A;  2V4D A;  1J8I A;  2IHE A;  4AIM A;  1LLR D;  2MUY A;  1B1Z A;  4FXG C;  1SFO H;  1PDQ A;  3S2D B;  3NEM A;  3OW2 A;  5I2X A;  2DUD A;  2PW5 A;  4RFB A;  5COR A;  4PZ8 A;  4X66 Q;  3AEV A;  1SRO A;  1EY9 A;  2OTL A;  4BBR G;  1JOQ A;  1E2W A;  2PZT A;  2F1M A;  3I3C A;  1E2Z A;  2WAC A;  4DA2 A;  4ZKC B;  1EUJ A;  5EKK A;  5H1S E;  1IL8 A;  2Q2U A;  1CKO A;  3T1H Q;  5A2Q E;  2E2H H;  3ERQ A;  1OXS C;  3DMU A;  4ZYS A;  1HJP A;  1E3P A;  4OGQ C;  3S1N B;  3HOV G;  1CZG A;  5FLX L;  4CKB A;  1EU4 A;  2OQK A;  2EQS A;  1CK1 A;  3S16 H;  1VCI A;  3PIP 3;  4P71 A;  3UDG A;  3AFQ A;  3NUC A;  1A2U A;  4B08 A;  3AQQ A;  4C3I H;  5FO9 B;  1KRT A;  1PHJ A;  2RCN A;  5IGF A;  3CPW A;  4U67 3;  1B44 D;  4OWT B;  3A8I E;  5CGK A;  2B8F A;  5C4X B;  2QCP X;  3SGI A;  1ZYR C;  4A3B G;  4E6I A;  5JVH 3;  2PZU A;  1PFB A;  3GTP B;  2ASB A;  1CKN B;  3PIP A;  1O80 A;  2K33 A;  3LWU A;  5HY6 A;  3P75 A;  3Q6S A;  1IYV A;  1PA6 A;  2PMZ E;  1BXT A;  4EQP A;  3OMC A;  2MJ8 A;  5IYB H;  1AP0 A;  4DUZ L;  4OHJ A;  5FO7 B;  1PH6 A;  3I55 A;  4MIU A;  1N33 Q;  1D5M C;  4NXN L;  1T5E A;  1TWA B;  3PV0 A;  5GAG C;  3M4Y A;  3HS0 C;  4HIK A;  4B3R Q;  3QWN A;  1OXU A;  5IYD H;  5FKA C;  5IP9 G;  3MXN A;  5CMD A;  2LFN A;  4A3D G;  1U5K A;  1JMC A;  2OTJ A;  3K58 A;  1DD2 A;  2MO0 A;  2H5X A;  2F0O A;  2JA8 B;  3CF5 A;  4QIW E;  3W5O A;  1GUT A;  5KEE A;  3OTO Q;  2B3G A;  3VYR A;  1I4P A;  4EQO A;  4A3F G;  3MZ5 A;  1F9R A;  1NNX A;  5AJ3 Q;  2WB1 B;  1VQA A;  3P1H A;  3HKZ G;  1KQS A;  5EBC A;  4BBS B;  1IBM L;  4DR2 L;  1MSG A;  4DR1 Q;  1Y69 U;  1SLJ A;  1ENC A;  2PCF B;  3T56 B;  4KN4 C;  3G4S A;  1B53 A;  5KGU A;  3WOF A;  5C4H A;  2D9U A;  3T4A C;  5C3E G;  2F0K A;  1EQV A;  3ND9 A;  1XMO Q;  1LO5 D;  1ILQ A;  4IUT A;  2I0Q A;  2L12 A;  2CW0 C;  3CC4 A;  3LGJ A;  5EBD A;  3J7A V;  4JOI C;  1TWC B;  3G71 A;  3CME A;  4A93 H;  3SEB A;  5D14 A;  2AUK A;  3I4M B;  4H44 C;  3ULP A;  4HJ9 A;  1SE3 A;  4Q5V A;  3KUP A;  1EIY B;  2A6E C;  2PNR C;  1PTO D;  5K5P A;  3PUY A;  1BCP B;  4DV4 Q;  1XNQ Q;  4A3M B;  2R7Z G;  3FMC A;  4OEM B;  2J0T D;  4IPD A;  2B2Y C;  3UE0 A;  2EJG C;  1KAW A;  3OYY A;  3RN2 A;  1J5E Q;  4JI2 L;  1HA6 A;  4N9P A;  4FF1 A;  4R4I A;  4AH6 A;  2WB1 E;  3J81 L;  2MHV A;  1L2F A;  1YNN D;  1PH3 A;  3NEN A;  1U4R A;  3S9W A;  1GM5 A;  1STY A;  3BDL A;  1IBL Q;  1V8Q A;  4QF4 A;  3S14 B;  3H0G H;  3BS1 A;  4IUR A;  5FLX c;  4MZ9 A;  5M3F B;  5GAD C;  1CA5 A;  4A3B B;  2B2U C;  1QUQ B;  4KN7 C;  3GV3 A;  1E24 A;  4RKB A;  4O2D A;  3SVM A;  4HSV A;  4JK1 C;  5IWA L;  3GTJ B;  4A3K G;  2JYO A;  2AUJ D;  3F8T A;  4B3T L;  3KK7 A;  4BXX H;  2G5D A;  4DR5 Q;  2R93 G;  1B9N A;  1XTC D;  3GTM H;  1N32 L;  4K14 A;  1XPU A;  4DU9 A;  3K5M A;  4Y7N H;  1A3T A;  4YWM A;  1UUP A;  1WCM H;  3ONA B;  1EOV A;  1SMY D;  5ELN A;  4DN4 M;  4YCU A;  5LMU Q;  5NUC A;  3TP5 A;  1LV9 A;  2IHF A;  3RR5 A;  3M3Y B;  1RTO A;  1TS2 A;  1HNW Q;  3I8Z A;  4A3F B;  4UP8 A;  4BY1 B;  1WTO A;  1EYG A;  1HPC A;  1C8C A;  3KF6 A;  5K36 H;  1K83 B;  3DEO A;  1TVX A;  1VF5 C;  3JC6 6;  4JI8 Q;  3KLS A;  5M5Y B;  3T1Y Q;  5C3E B;  3S1M H;  1D5X C;  1NE3 A;  2XWB B;  3SK8 A;  4TRD A;  4KI0 A;  5CV4 A;  3U9S A;  4C3J H;  1MGS A;  4FO2 A;  3GTL B;  3U9O A;  4LF9 L;  3QIA A;  4OO1 H;  1IYU A;  4QJF A;  5IP7 H;  2I07 B;  1F9S A;  1IZ6 A;  1SYB A;  4Q0F A;  2B39 A;  2OCE A;  2P5Z X;  3M4P A;  1KC8 C;  2CKZ B;  2ENB A;  5JEA G;  2EYH A;  3QO2 A;  3QJY A;  3RZD H;  5IOD A;  1VDZ A;  1R4P B;  1O7Y A;  3T51 B;  2R7Z B;  1O7L A;  2VB3 X;  2F0E A;  5E4X A;  4A3J G;  5JJK A;  1AH9 A;  3GTG B;  1ILP A;  2VXW A;  5IGG A;  3HKZ E;  4BA1 I;  3Q24 A;  4LF8 L;  4JI3 Q;  1WFQ A;  3U4V A;  3I4N H;  5LL6 X;  2BDN A;  2B63 H;  3F1Z A;  2C35 B;  1I3Q B;  5HGQ A;  4DV5 L;  3NE5 B;  3CCS A;  1G91 A;  2ICE C;  2LXK A;  1IHZ A;  4LF5 L;  4IUV A;  1PRT B;  3FVQ A;  3J81 c;  4PMW A;  4KV6 A;  3DLL A;  4NB3 A;  4IN3 A;  3ER0 A;  1IKL A;  5IT9 E;  3NEL A;  4DXF A;  3GD7 A;  4B3S L;  4GOP B;  1KHI A;  4A3K B;  2JA5 G;  1QE6 A;  1C0A A;  2LKV A;  3SDZ A;  4YY3 Q;  4HTH A;  2WIN B;  1FGB D;  4XQN A;  4DNR B;  3U58 A;  3S1R B;  2WP8 J;  3FPP A;  4P2C B;  2NVX H;  4J15 A;  4HJ7 A;  1WJJ A;  2ICI A;  1HNZ L;  1IYJ B;  4AQY L;  3PO3 G;  4GKJ L;  3OHX C;  3J80 i;  4ZRZ A;  5M3M B;  3GTQ B;  3FP9 A;  1TQO A;  4HJ5 A;  3TS0 A;  3NQI A;  2HUG A;  3NQT A;  4A3I B;  3VYS A;  1PFS A;  2ES2 A;  2MQH A;  3K5O A;  2R6G A;  4HSP A;  3D4D A;  2L9H A;  1CI3 M;  1X56 A;  1M8A A;  1EFW A;  3T13 A;  4EQN A;  1YHB A;  2A5H A;  4OO1 I;  3O13 A;  3WDN A;  4LUO A;  1IKM A;  3M4O B;  2Z8L A;  4L5S A;  2F0Q A;  4S3S A;  2UUC Q;  1LTA D;  5C4X H;  2JK8 A;  5CBE E;  4DK6 C;  2RF4 A;  2PYK A;  1XNR L;  2AHO B;  3GTP H;  2BE5 C;  3CQZ B;  1AW7 A;  4ME5 A;  5FK9 C;  2F0N A;  4XYQ A;  2RSO A;  1GUO A;  1Q8K A;  1YHQ A;  2YTX A;  3GTK H;  4UHV A;  4F87 A;  1BBW A;  4JC0 A;  3K8A A;  1I94 L;  1TWA H;  5ELO A;  3OSO A;  2B2W C;  2YTV A;  5C44 B;  1DON A;  4A3J B;  1ENF A;  5EAY A;  4GLV B;  5JJI A;  3CAM A;  1DOL A;  4A3G B;  1F2L A;  3MXG A;  1Y14 B;  5BR8 Q;  2NZ1 D;  1OXX K;  1CQV A;  3E9H A;  3M4Q A;  3TZD A;  2SOB A;  2YV5 A;  3I7F A;  1X3G A;  1TS4 A;  4LFA L;  2R92 B;  4MTN A;  4JI4 Q;  1QG7 A;  1GUW A;  2RA4 A;  3NK9 A;  4RWS C;  1VQ8 A;  3SE0 A;  1HTP A;  4C1N K;  2HHH Q;  2KCC A;  3TRE A;  3W1G A;  4O0A A;  1MKH A;  1U4L A;  1D1K A;  3V96 A;  1X54 A;  1ASY A;  1D8L A;  3ULL A;  2C9O A;  4LNQ A;  2JA5 B;  1EY7 A;  4RCN A;  1E7Z A;  4RHR A;  4DR4 L;  1Z6H A;  1TII D;  2AQ1 B;  5LL6 S;  2L5T A;  1STG A;  3RD4 A;  1TWC H;  1GJX A;  1KLU D;  2IL8 A;  2NN6 G;  5DLQ E;  4C3J G;  5LMN L;  1C4Q A;  1H9J A;  4K6D A;  4YIJ A;  3TEH B;  3I4M H;  1LT3 D;  1CSP A;  2B2T A;  4LAA A;  3UE1 A;  4R8N A;  5IP7 G;  1PH4 A;  3HOY B;  3FDT A;  3PO3 B;  1NUC A;  1RIP A;  4HR7 B;  4PZ6 A;  4X64 L;  2VQE L;  3HOV H;  4A3M H;  4DV2 Q;  5DNF A;  1N9W A;  2K03 A;  2NZH A;  4R8I A;  1G6P A;  4AYB G;  2Q8R E;  1Q8I A;  2RDG A;  1K3B C;  1DXM A;  2F0G A;  2KOL A;  2F0P A;  2L0C A;  1RF2 D;  2N78 A;  2JEB I;  4ZUJ A;  3T1H L;  5EKI A;  2WFW A;  4JI1 L;  2PZW A;  3S14 H;  4CBV A;  4XIG S;  4OXP A;  1BF4 A;  1WOC A;  1C7Y A;  4JI7 L;  4JBW A;  2A73 B;  2UUA Q;  5DAU A;  5M3F H;  4A3B H;  2ZM6 Q;  5T1G A;  2LXJ A;  1TWF B;  2QF7 A;  2KHJ A;  2C5C A;  5I2Y A;  3RLF A;  1TY2 A;  1BCP C;  3ULJ A;  4IOC A;  3D3R A;  3GTJ H;  4DV7 Q;  3HP3 A;  1CA6 A;  4RGO S;  1N36 L;  3MWY W;  5EQ0 A;  2AQ3 B;  2QGQ A;  3IRB A;  2KHI A;  3VR5 A;  2F52 A;  4GNX B;  1YIT A;  2JEA I;  1VMP A;  1S4Z A;  3N52 A;  1DOM A;  2WAQ G;  4DR6 Q;  5IP9 H;  2ZXR A;  5D3I B;  5C4J B;  3Q0A A;  1YJ9 A;  1B3A A;  4QQB X;  4I7A A;  5IGD A;  3M3Y H;  4B3R L;  3TME A;  3A8K E;  3JAM L;  4OON A;  4A3F H;  2EOT A;  3CCE A;  4BY1 H;  1XMQ Q;  5ELD A;  3U50 C;  4ID6 A;  1PYW D;  1GKH A;  4DV0 Q;  1NY4 A;  4EX5 A;  4K0K Q;  2ATW A;  2HDL A;  1MIU A;  1K83 H;  3C1F A;  3S15 B;  1X65 A;  4XYO A;  2LY7 A;  5M5Y H;  5C3E H;  4HMJ A;  3OTO L;  4YHH Q;  4XQQ A;  4IUQ A;  1CHQ D;  3J7A F;  1L1O A;  1R4Q B;  4HIM A;  5AJ3 L;  3S2H B;  2EY5 A;  1NBW A;  1N8R C;  4X3K A;  1EY6 A;  1HQR D;  5C4X G;  2J4X A;  1LTS D;  3E9I A;  5TSS A;  4DAM A;  2CVR A;  1GUS A;  5HGT A;  1RCV D;  4X65 L;  3LWE A;  3IAY A;  1RD9 D;  5KRU A;  2EXD A;  3NWT A;  2KQ3 A;  1JC7 A;  2B2V C;  4BWG B;  2ZXP A;  4A76 A;  2R7Z H;  1A63 A;  1LTI D;  1VQJ A;  4AYB B;  1UNS A;  4KHP L;  4WJ4 A;  3EA6 A;  3GTG H;  2PI2 E;  2A19 A;  4KHV A;  5DEH A;  1HQM C;  2A6E D;  4POF A;  1CUK A;  4JBJ A;  4ZQ3 A;  4OWW B;  4ODG A;  1KAA A;  4DV6 Q;  3DWP A;  3LNN A;  5L37 A;  1MI2 A;  1ZEQ X;  4C3H B;  3PUX A;  1I3Q H;  3KLS X;  1DGS A;  2QA4 A;  1VQK A;  1YI2 A;  2OQ0 A;  1CTM A;  2Z6B A;  1PFM A;  3N6R A;  3SK5 A;  1VQO A;  2JA8 G;  1VQL A;  1J9O A;  2F3V A;  2VQF Q;  1L0Y B;  3TBI B;  2XSC A;  1AFP A;  3M7N A;  1KDB A;  4RA8 A;  1IBL L;  4BBS G;  1K28 A;  2AQ2 B;  4A3K H;  1EL0 A;  3CCJ A;  2ZT9 C;  4ZCK A;  4GLX A;  1PH7 A;  1SNP A;  2R93 H;  1K73 C;  3S1R H;  2IX0 A;  3BVZ A;  1I4Q A;  5J39 A;  4CHT B;  1TKW B;  1IBK Q;  2K5N A;  4JI0 L;  1QB5 D;  2WAQ B;  4AYB E;  2SNS A;  4R1J A;  1AE3 A;  3W2D A;  4JYA Q;  1UE6 A;  2F0U A;  1PH5 A;  3MXP A;  3BDC A;  5M3M H;  3GTQ H;  1PTO B;  3PMF A;  2K5Q A; 
#chains in the Genus database with same CATH homology
 5FLX E;  1PRT C;  5KYI A;  3G6J B;  3I4L A;  2KUM A;  1SE2 A;  1MSH A;  1F9P A;  2K6A A;  1A3U A;  3R3O A;  4KD3 A;  3M7G A;  3R8B A;  4WJW A;  5CR3 A;  1SYG A;  5KNB A;  5D3D A;  5J22 A;  1JR0 D;  2HQE A;  3IFT A;  1SYF A;  2B2Y A;  2XN9 C;  4F88 A;  4RCO A;  2XWJ B;  4RH6 A;  1I50 B;  1NR2 A;  4HCS A;  3H6M A;  3L7Z C;  4O1N A;  5JVG 3;  2QEJ C;  5JEA H;  1NR4 A;  2JP1 A;  2B2U A;  4C56 C;  2F0H A;  2IW3 A;  1WTQ A;  2RVL A;  2F0M A;  4IUP A;  1FNU A;  1STH A;  3PIO 3;  4FXD A;  2IT1 A;  1ICW A;  1QWY A;  2K32 A;  1XYI A;  4H0L C;  2LS0 1;  4UDU C;  3KF8 A;  2F03 A;  2MGS A;  3SK4 A;  1KDC A;  5F2D A;  2A6H D;  4IFD G;  2IPK D;  5C3X A;  1TR5 A;  5BN5 A;  4K8J A;  1LT5 D;  3CKI B;  2OF1 A;  4K8I A;  2ZXO A;  1IW7 D;  1VF7 A;  1PXU A;  4CJ0 B;  2L55 A;  3GP7 A;  4U68 A;  2EYJ A;  2JE6 I;  1PZJ D;  4M8A A;  2E2J B;  1DJR D;  1LAC A;  4XXE A;  1G6Z A;  1QIL A;  2XRQ D;  4KJN A;  2O5J C;  5C5L A;  4V0B A;  4UAI A;  4IUU A;  3K0Y A;  3J81 E;  3R2T A;  5JOB A;  3L9A X;  1B4O A;  4BY7 B;  1WD0 A;  2RSN A;  2A68 C;  2EYO A;  2A74 C;  3KLR A;  2EPB A;  2EE1 A;  4DF7 A;  1SXT A;  5ISR A;  2QIL A;  4K5V A;  3HGB A;  1STE A;  4MHE A;  3GTO B;  1JWM D;  2JXM B;  2X6G A;  2VUM B;  4DXG A;  2BE5 D;  2CHB D;  5ELB A;  2B8G A;  1GUG A;  1H9M A;  5CV6 A;  4HCE A;  3BZD B;  2YYZ A;  3RMH A;  5IGE A;  1RDP D;  1KNE A;  3MEH A;  1H9K A;  3KBG A;  3V05 A;  3BYY B;  4OL7 A;  3HRZ C;  2TSS A;  3CHB D;  3VA5 A;  3K5L A;  1Q1B A;  1CM9 A;  4NDX A;  2GA4 B;  3AB9 A;  5KNC A;  1GOZ A;  1OXV A;  2R3Z A;  2I46 A;  1I6H B;  1SDF A;  3A54 A;  1EEI D;  3RZO B;  2EJF C;  3BG3 A;  1EY8 A;  2NN6 H;  4G57 A;  4N9T A;  5IIF A;  3Q23 A;  3OW7 A;  3S1Q B;  1WTX A;  3OOC A;  2NYZ D;  5C5M A;  1EY0 A;  3X3N A;  4ABN A;  1V1P B;  4L8J A;  2RQX A;  3SR1 A;  2L1B A;  1Q12 A;  4KHZ A;  5G3L F;  5I4D A;  4ZUI A;  3EVQ A;  1WD1 A;  2D2C C;  1BBX C;  2B2W A;  4KKU A;  3VYU A;  3C3L A;  1UAP A;  3UI2 A;  3I70 A;  3J7Y W;  2FIN B;  1XX8 A;  2Z4H A;  1O78 A;  1TU2 B;  5M5W B;  2F0L A;  4J8Q A;  4B9X A;  4CKE A;  1LTR D;  1WTV A;  2BCO A;  1XWE A;  3VR2 A;  1GXD C;  1RHP A;  4HN7 A;  5JEA J;  4KKS A;  1G2T A;  4XQJ A;  4LJZ C;  1PTO H;  3T53 B;  3OPO A;  1LT4 D;  4DAY A;  2A69 D;  3CRL C;  2DNE A;  4DNT B;  1OO9 B;  3PO2 B;  3MXU A;  1I6V C;  4F7X A;  2EY6 A;  5T1I A;  5CC4 A;  3KBX A;  5KND A;  4FYD A;  1LTG D;  1PFN A;  2NN6 I;  2RBM A;  1PMR A;  4NMZ A;  3DXJ C;  4TQU S;  2K5W A;  1PTO C;  2F0F A;  5BN4 A;  1B9M A;  2E2H B;  3EQL C;  1A2T A;  1BQQ T;  4DK1 A;  1YNN C;  3CRK C;  4DGZ A;  4DFA A;  4OIJ A;  1II3 A;  2EYM A;  5ELC A;  4WRD A;  1MD2 D;  5KYL A;  1E2V A;  1QJO A;  3GV6 A;  2TMP A;  1ESR A;  2F0S A;  3A8J E;  3HG9 A;  4XT3 B;  1ENA A;  1E0B A;  5DM6 3;  1FR3 A;  1YNJ D;  2SEB D;  3AMU A;  1SYE A;  1BDO A;  5I9P A;  3M85 A;  1UEA B;  3C1E A;  3MTS A;  4TKO B;  4G7Z C;  3NBH A;  4DK0 A;  1RJT A;  1G2S A;  1K8M A;  2WII B;  3S17 B;  1QNU A;  1I4X A;  3HOZ B;  3NHH A;  3RUZ A;  1EFI D;  3TZU A;  4HED A;  4J6H A;  4RHS A;  5D65 A;  4QMG A;  2K05 A;  5EKL A;  1AZP A;  1EZ8 A;  1RKN A;  1H9S A;  3A7A B;  5JPM C;  2M2L A;  4KD4 A;  4WOR A;  4KKT A;  2F0D A;  3FEW X;  1AZQ A;  3DUZ A;  1B50 A;  1Z47 A;  3A56 A;  4ZAI A;  3SXH A;  2B2V A;  1D5Z C;  2IX1 A;  1I4R A;  4R9W A;  2E76 C;  4C3H G;  2Q8T A;  4EVO A;  2PW7 A;  1WVL A;  1Q3L A;  2Y0S B;  4L6T B;  5CYU A;  3FKI B;  2RDH A;  1EEF D;  2NVT B;  1XXG A;  1TWH B;  4RKL A;  4M1U B;  5G3L D;  3H09 A;  1ZYR D;  1Y1W B;  3D8G A;  3TSS A;  4IAL A;  1KNA A;  1HFN A;  4C2M B;  2O2L D;  1X3P A;  3I91 A;  2QKI C;  1SE4 A;  2K1B A;  3JAM E;  2PQE A;  2FJ2 A;  3AU7 A;  1G29 1;  1EOT A;  4IFD H;  1LTB D;  3G7L A;  4K2L A;  5ELE A;  3HOX B;  2IJ0 A;  2DN8 A;  5C0X G;  1CZW A;  4NKL A;  5EPL A;  1SJE D;  3K7A B;  3A7L A;  3PUV A;  3URY A;  1A6X A;  3VR4 A;  1GHJ A;  1I4H A;  1AN8 A;  3D6C A;  3NSW A;  2NBF A;  2R61 A;  2CW0 D;  4CGY B;  1PLF A;  2H1E A;  3R2I A;  3BVG A;  2K7V A;  1DZ1 A;  1JOO A;  1HFG A;  1Y8O B;  1KLG D;  3FPU B;  1JOR A;  1C48 A;  1Y1V B;  4B9W A;  1EWH A;  4LMQ D;  2EJM A;  3X3M A;  2BA0 A;  3OIP A;  1FYC A;  2VNU D;  1L0X B;  1D2B A;  1SAP A;  4OIK A;  3J80 L;  1X3Q A;  2H4O A;  5FO8 B;  1G8Z D;  3I4N B;  3SHL A;  2MPM A;  2O4X A;  1O7Z A;  4CJ1 B;  1NSN S;  1HUM A;  1QCB D;  2KCN A;  1ZKO A;  2EYF A;  2M00 A;  3IFD A;  1LAB A;  2LMC B;  2NVY B;  2J7Z A;  1EWC A;  1V43 A;  1ET9 A;  4KY7 A;  3W3A A;  5M5X B;  4O42 A;  1JWS D;  2Z1C A;  3OWF A;  1ESF A;  2NVX B;  2F3W A;  1EIG A;  2Z4I A;  2PMZ B;  5I6Y A;  1FD7 D;  4I7Z C;  1JWU D;  3D6W A;  1JB3 A;  3NTK A;  4QCL A;  2F4I A;  5A2Q L;  2E2I B;  2JA7 B;  4WFN 3;  5EPJ A;  3K6O A;  4QIW B;  3DHQ A;  2EYP A;  1PZI D;  1DM0 B;  3MFY A;  1BUV T;  4ZKB B;  3E0J A;  3K5N A;  4X3T A;  1STB A;  1BCP F;  3ERO A;  2WKD A;  4ULL A;  4PMC A;  5IOC A;  5BN3 A;  1S5E D;  1U4M A;  1SNC A;  3MC0 B;  2K5D A;  2KVM A;  3SK6 A;  3GTK B;  3PUZ A;  2IWH A;  5DM7 3;  5I6W A;  1Q1E A;  3MHB A;  4PMB A;  2BA1 A;  2N55 A;  3TN2 A;  4IUN A;  2IX3 A;  3BDO A;  1Y8N B;  1A3V A;  5CBA E;  4Z9C B;  3HOW B;  1ROD A;  3P20 A;  5JJZ A;  2KEE A;  1A15 A;  1M4V A;  3NTI A;  1F2M A;  2EY2 A;  3F2U A;  2FMC A;  4K5W A;  1CHP D;  3L3O C;  1SNO A;  4FF2 A;  2EDG A;  3D31 A;  4IFD J;  1JCK B;  3TDQ A;  5FOB B;  4K6L A;  3R93 A;  1STA A;  4K2K A;  1JE4 A;  3A55 A;  4A3E B;  1W6J A;  4BBR B;  4X3U A;  1D6E C;  4RAU C;  2NUC A;  4ZK9 B;  1LT6 D;  1U4P A;  3HOV B;  1TY0 A;  1RTN A;  1JOK A;  3NPP A;  1KAB A;  2XRS D;  2JA6 B;  4RGM A;  3QB3 A;  4HAE A;  4PV1 C;  2AWO A;  1H9R A;  3C46 A;  3WOE A;  3ITP A;  3HOU B;  4PQX A;  1F77 A;  2KEC A;  4QB4 A;  5CV8 A;  1D1I A;  4KY5 A;  2DY7 A;  1S5B D;  3D4W A;  3VYT A;  5ELF A;  1EYD A;  1HUN A;  4ZLT F;  3P7J A;  3EJI A;  2VB2 X;  2E75 C;  4A3D B;  1GHK A;  1H9S B;  3OMG A;  1WTP A;  1EQT A;  1PRT F;  1F2Z A;  3HZX A;  1LTT D;  2K28 A;  2ID0 A;  3HKZ B;  3VR6 A;  2QDB A;  3DM1 A;  5LHY 1;  1ET6 A;  4TSS A;  5CV9 A;  2D62 A;  1ONL A;  2WKC A;  1BR9 A;  1GUN A;  4C3I G;  3ND8 A;  1SYD A;  2RDF A;  1MBY A;  2F0T A;  5E1F A;  3CU7 A;  4RGT A;  2OEO A;  3TP8 A;  3GO5 A;  5EPK A;  4GZY C;  2XIW A;  1NCV A;  1BOS A;  3TP6 A;  2F0W A;  4FP5 D;  3I73 A;  1DOK A;  2SNM A;  4KTA A;  1BCP D;  2EVB A;  1I4G A;  1HA5 A;  5JPN C;  3LX0 A;  5AFW A;  1JIC A;  2FMM A;  1SNQ A;  5M9O A;  2A6H C;  4XDX A;  1W6K A;  4LK1 C;  5C3W A;  1EY5 A;  1EYA A;  4C1N I;  2O5I C;  2FHT A;  1IW7 C;  1R9T B;  1HRJ A;  4MN3 A;  1CQF A;  2KJX A;  1VMC A;  4NP5 A;  2R93 B;  1AEX A;  1CT1 D;  1WTR A;  5IT9 L;  3OIQ A;  5C0X H;  3E6Z X;  1SFO B;  2HCI A;  2OT2 A;  4DAP A;  5C6A A;  3D4R A;  3ZYY X;  4CKC A;  2CQA A;  4BA2 I;  4FVM A;  1S5D D;  1JQY D;  4FXK C;  3DWA A;  3I90 A;  2KA7 A;  2FFK B;  4J1M A;  2BOS A;  3Q22 A;  1QNK A;  2F0V A;  3S16 B;  1T5X D;  3TP7 A;  2K01 A;  4C3I B;  1FNV A;  2EXZ A;  4NW2 A;  3HEJ A;  2L4N A;  3I72 A;  4G7O C;  3OWE B;  1TS3 A;  3K57 A;  4G7H C;  5CV7 A;  1HHV A;  2MP1 A;  2NVQ B;  2BDO A;  4L63 B;  2EY1 A;  3QOJ A;  4FNF A;  2G9H D;  4K5X A;  2L11 A;  2EZV A;  3MAQ A;  2XVS A;  1V1O A;  2K04 A;  4DAV A;  1SMY C;  2KHS A;  3GQB A;  1BO0 A;  1PZK D;  3PUW A;  5EGT A;  3QOL A;  3NTH A;  3MVV A;  4RGN A;  2F0J A;  1EIH A;  2HCC A;  1BNZ A;  5A35 A;  5C0X I;  5I9O A;  1S5C D;  2X6L A;  2Q8I B;  1PRT D;  5K36 G;  4V19 0;  1FNW A;  2NTT A;  3DWQ A;  4BS9 A;  2RKS A;  2XNA C;  1TWG B;  1ML0 D;  4OO1 G;  2X69 A;  2AWN A;  3E5S A;  3C2P A;  1X32 A;  3H94 A;  3VR3 A;  4A93 B;  4H13 C;  1SNM A;  1OXT A;  3NBI A;  3BVM A;  1V1P A;  2E74 C;  3NP8 A;  5CV5 A;  2OXP A;  3K59 A;  3NXW A;  3H0G B;  3QG1 A;  3IKJ A;  1K8O A;  1HXY D;  4QUF A;  4PNY A;  1EYC A;  4X3S A;  2PO4 A;  1EU3 A;  1Y8P B;  1S5F D;  1HTL D;  2N88 A;  1EZ6 A;  4KJO A;  4KK7 A;  1TT2 A;  1DYQ A;  2F0I A;  4KY6 A;  4G4K A;  2A69 C;  1SJH D;  3BYT B;  3GTM B;  3IL8 A;  4XTC S;  2EYL A;  4ILW A;  5C4Z A;  2NWG A;  4I65 A;  2D5D A;  4Y7N B;  5HUR A;  5COY A;  2YU9 B;  1WCM B;  5IGC A;  1KTK A;  2KED A;  1EY4 A;  3NWS A;  4IQZ A;  4FF4 A;  4KMU C;  2HDM A;  5E3F A;  3T16 A;  2DY8 A;  2PPB C;  4EGV A;  4HMI A;  4QUC A;  3V2T A;  2NTS A;  4XT1 B;  1Q90 A;  1PTO F;  3S1M B;  2M9V A;  2B2T C;  2SDF A;  1SSO A;  3H3V C;  4C3J B;  2A68 D;  5C0X J;  2DNC A;  4IZ8 A;  1TS5 A;  1KDA A;  3MA2 B;  4H7B A;  1F9Q A;  4F8M A;  1WTW A;  2E2D C;  2WV6 D;  1SEB D;  1F2Y A;  1SND A;  1SYC A;  3J80 E;  3RZD B;  5J1Z A;  1B2T A;  3EFX D;  3H91 A;  1YNJ C;  3DEP A;  2NB0 A;  3MFG A;  2JSO A;  1Z7T A;  1CFM A;  4IFD I;  1NAP A;  2B63 B;  5JAV A;  3VA7 A;  2G9D A;  5KIX A;  1SBB B;  1ZXT A;  1HCZ A;  4FF3 A;  5EJW A;  4CJ2 C;  1QOH A;  1STN A;  5IGB A;  5E4W C;  1U9R A;  3FRP B;  1DCZ A;  2V4D A;  1J8I A;  1LLR D;  2MUY A;  1B1Z A;  4FXG C;  1PDQ A;  3S2D B;  5I2X A;  2PW5 A;  4RFB A;  5COR A;  1EY9 A;  1JOQ A;  1E2W A;  2PZT A;  2F1M A;  3I3C A;  1E2Z A;  2WAC A;  4DA2 A;  4ZKC B;  5EKK A;  1IL8 A;  5A2Q E;  3ERQ A;  1OXS C;  3DMU A;  4ZYS A;  4OGQ C;  3S1N B;  1CZG A;  5FLX L;  4CKB A;  1EU4 A;  1CK1 A;  1VCI A;  3PIP 3;  3NUC A;  1A2U A;  4B08 A;  5FO9 B;  5IGF A;  4U67 3;  1B44 D;  5CGK A;  3A8I E;  5C4X B;  2B8F A;  2QCP X;  1ZYR C;  4E6I A;  5JVH 3;  2PZU A;  1PFB A;  3GTP B;  1O80 A;  2K33 A;  3LWU A;  3P75 A;  3Q6S A;  1IYV A;  4EQP A;  1BXT A;  3OMC A;  2MJ8 A;  1AP0 A;  4OHJ A;  5FO7 B;  4MIU A;  1D5M C;  1T5E A;  1TWA B;  3PV0 A;  3M4Y A;  3HS0 C;  3QWN A;  1OXU A;  5FKA C;  3MXN A;  5CMD A;  2LFN A;  3K58 A;  1DD2 A;  2F0O A;  2JA8 B;  1GUT A;  5KEE A;  4EQO A;  1I4P A;  3VYR A;  3MZ5 A;  1F9R A;  2WB1 B;  3P1H A;  5EBC A;  4BBS B;  1MSG A;  1Y69 U;  1ENC A;  2PCF B;  3T56 B;  4KN4 C;  1B53 A;  5KGU A;  3WOF A;  5C4H A;  2D9U A;  3T4A C;  2F0K A;  1EQV A;  3ND9 A;  1LO5 D;  1ILQ A;  4IUT A;  2L12 A;  2CW0 C;  5EBD A;  3J7A V;  1TWC B;  3SEB A;  5D14 A;  2AUK A;  3I4M B;  4H44 C;  1SE3 A;  4Q5V A;  3KUP A;  2A6E C;  2PNR C;  1PTO D;  5K5P A;  3PUY A;  1BCP B;  4A3M B;  3FMC A;  2J0T D;  2B2Y C;  2EJG C;  1HA6 A;  4N9P A;  4FF1 A;  3J81 L;  2MHV A;  1YNN D;  1U4R A;  3S9W A;  1STY A;  3BDL A;  1V8Q A;  4QF4 A;  3S14 B;  3BS1 A;  4IUR A;  5M3F B;  1CA5 A;  4A3B B;  2B2U C;  4KN7 C;  3GV3 A;  4RKB A;  3SVM A;  4HSV A;  4JK1 C;  3GTJ B;  2JYO A;  2AUJ D;  3KK7 A;  1B9N A;  1XTC D;  4K14 A;  4DU9 A;  3K5M A;  1A3T A;  1UUP A;  3ONA B;  1SMY D;  4DN4 M;  5NUC A;  3TP5 A;  1LV9 A;  3M3Y B;  1RTO A;  1TS2 A;  3I8Z A;  4A3F B;  4BY1 B;  1WTO A;  1HPC A;  1C8C A;  5K36 H;  1K83 B;  3DEO A;  1TVX A;  1VF5 C;  3KLS A;  5M5Y B;  5C3E B;  1D5X C;  2XWB B;  3SK8 A;  4TRD A;  4KI0 A;  5CV4 A;  3U9S A;  1MGS A;  4FO2 A;  3GTL B;  3U9O A;  3QIA A;  4OO1 H;  1IYU A;  2I07 B;  1F9S A;  1SYB A;  4Q0F A;  2B39 A;  2ENB A;  5JEA G;  2EYH A;  3QO2 A;  3QJY A;  5IOD A;  1VDZ A;  1R4P B;  1O7Y A;  3T51 B;  2R7Z B;  1O7L A;  2VB3 X;  2F0E A;  5E4X A;  3GTG B;  1ILP A;  2VXW A;  5IGG A;  4BA1 I;  3Q24 A;  5LL6 X;  2BDN A;  1I3Q B;  3NE5 B;  1G91 A;  2ICE C;  1IHZ A;  4IUV A;  1PRT B;  3FVQ A;  4PMW A;  4KV6 A;  4IN3 A;  1IKL A;  5IT9 E;  4DXF A;  3GD7 A;  4A3K B;  1QE6 A;  2LKV A;  3SDZ A;  4HTH A;  2WIN B;  1FGB D;  4XQN A;  4DNR B;  3S1R B;  2WP8 J;  3FPP A;  4P2C B;  2ICI A;  3OHX C;  4ZRZ A;  5M3M B;  3GTQ B;  1TQO A;  3NQI A;  2HUG A;  3NQT A;  4A3I B;  3VYS A;  3K5O A;  2R6G A;  4HSP A;  3D4D A;  2L9H A;  1CI3 M;  1M8A A;  3T13 A;  4EQN A;  2A5H A;  4OO1 I;  3O13 A;  3WDN A;  1IKM A;  3M4O B;  2Z8L A;  2F0Q A;  4S3S A;  1LTA D;  5CBE E;  2PYK A;  2BE5 C;  3CQZ B;  1AW7 A;  4ME5 A;  5FK9 C;  2F0N A;  4XYQ A;  2RSO A;  1GUO A;  4F87 A;  3OSO A;  2B2W C;  5C44 B;  1DON A;  4A3J B;  1ENF A;  1DOL A;  4A3G B;  1F2L A;  3MXG A;  2NZ1 D;  1OXX K;  1CQV A;  3TZD A;  2SOB A;  1TS4 A;  2R92 B;  1QG7 A;  1GUW A;  2RA4 A;  3NK9 A;  4RWS C;  3SE0 A;  1HTP A;  4C1N K;  2KCC A;  1U4L A;  1D1K A;  3V96 A;  2C9O A;  2JA5 B;  1EY7 A;  4RCN A;  4RHR A;  1Z6H A;  1TII D;  2AQ1 B;  5LL6 S;  2L5T A;  1STG A;  3RD4 A;  1GJX A;  1KLU D;  2IL8 A;  2NN6 G;  4C3J G;  1C4Q A;  4YIJ A;  1H9J A;  4K6D A;  1LT3 D;  2B2T A;  4LAA A;  3HOY B;  3PO3 B;  4R8N A;  3FDT A;  1NUC A;  4HR7 B;  5DNF A;  2K03 A;  4R8I A;  2Q8R E;  1Q8I A;  2RDG A;  1DXM A;  2F0G A;  2KOL A;  2F0P A;  2L0C A;  1RF2 D;  4ZUJ A;  2JEB I;  5EKI A;  2PZW A;  4CBV A;  4XIG S;  1BF4 A;  4JBW A;  2A73 B;  5DAU A;  5T1G A;  1TWF B;  2QF7 A;  2C5C A;  5I2Y A;  3RLF A;  1TY2 A;  1BCP C;  3D3R A;  3HP3 A;  1CA6 A;  4RGO S;  3MWY W;  5EQ0 A;  2AQ3 B;  3VR5 A;  2JEA I;  1VMP A;  1S4Z A;  3N52 A;  1DOM A;  2ZXR A;  5D3I B;  5C4J B;  3Q0A A;  1B3A A;  5IGD A;  3TME A;  3A8K E;  3JAM L;  2EOT A;  5ELD A;  4ID6 A;  1PYW D;  2HDL A;  3C1F A;  3S15 B;  4XYO A;  2LY7 A;  4HMJ A;  4XQQ A;  4IUQ A;  1CHQ D;  3J7A F;  1R4Q B;  3S2H B;  2EY5 A;  4X3K A;  1EY6 A;  1HQR D;  2J4X A;  1LTS D;  5TSS A;  2CVR A;  1GUS A;  5HGT A;  1RCV D;  3LWE A;  3IAY A;  1RD9 D;  5KRU A;  3NWT A;  2KQ3 A;  1JC7 A;  2B2V C;  4BWG B;  2ZXP A;  1LTI D;  4AYB B;  1UNS A;  3EA6 A;  4KHV A;  5DEH A;  1HQM C;  2A6E D;  4ZQ3 A;  4ODG A;  1KAA A;  3DWP A;  3LNN A;  1MI2 A;  1ZEQ X;  4C3H B;  3PUX A;  3KLS X;  1CTM A;  3SK5 A;  1PFM A;  3N6R A;  1J9O A;  2F3V A;  1L0Y B;  3TBI B;  2XSC A;  1AFP A;  3M7N A;  1KDB A;  4RA8 A;  2AQ2 B;  1EL0 A;  2ZT9 C;  1SNP A;  2IX0 A;  3BVZ A;  1I4Q A;  5J39 A;  4CHT B;  1TKW B;  1QB5 D;  2WAQ B;  2SNS A;  3W2D A;  2F0U A;  3MXP A;  3BDC A;  1PTO B;  3PMF A;  2K5Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...