5CV4A

Crystal structure of staphylococcal nuclease variant delta+phs v23d/v66h at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTDKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMHENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V23D/V66H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5cv4A00
1SNPA 2SOBA 3P75A 5EGTA 3T16A 4RKBA 3TP8A 4E6IA 3C1FA 5KYIA 2F0SA 2PYKA 3D6CA 3SK8A 2PZUA 3BDCA 1A2UA 5EKKA 5IGDA 4YIJA 3S9WA 1F2MA 2EYPA 1EY4A 2KHSA 5HURA 1F2ZA 3QOLA 4KV6A 4KJOA 1STHA 2NUCA 2O4XA 4IUNA 4N9PA 4PNYA 5IGCA 5C3XA 3EJIA 2RDFA 5CV5A 1KAAA 4ODGA 2F0GA 1EYCA 3P1HA 4F8MA 5JOBA 2OXPA 4HMIA 3NK9A 3SXHA 4PMCA 4TRDA 4IALA 4DU9A 5IIFA 1SNQA 4K5VA 2OF1A 2PZWA 3QB3A 4K8JA 3U9OA 3D4WA 5E3FA 1ENCA 5NUCA 1SNOA 2PQEA 3MHBA 5C3WA 1STGA 1NSNS 3MXPA 3TP5A 4NKLA 4J1MA 2F0VA 3NXWA 5ISRA 5CGKA 2F0UA 3EVQA 1A3VA 3H6MA 5E1FA 5CV4A 2F0NA 3T13A 1SYFA 2EYFA 2PZTA 1EY0A 2RBMA 2WACA 3NQTA 3MEHA 4ID6A 3NHHA 2F0OA 2F0DA 3ERQA 4NMZA 4R8NA 5I9PA 4NP5A 3SK5A 4F7XA 3D4DA 2F0JA 2F3VA 4DGZA 3DMUA 4K8IA 2EXZA 1II3A 4S3SA 4K5XA 2F0PA 5F2DA 1EY9A 4K14A 1SYBA 5CR3A 5J1ZA 1SNCA 4KY7A 4B9XA 4EQPA 5KGUA 5J22A 1SYDA 4NDXA 5IGGA 2EY1A 2EYLA 2F0WA 2F0TA 2OEOA 1IHZA 2RKSA 5C5LA 4K6DA 1A2TA 4QF4A 2F0LA 2HQEA 4H7BA 1STYA 1ENAA 4K2LA 1TQOA 4KD4A 5CV6A 2F0EA 2F0IA 5IGBA 1JOQA 1STAA 3C1EA 5CV9A 4K2KA 4QB4A 5EKLA 1TT2A 4EVOA 1TR5A 4IZ8A 1U9RA 4ZQ3A 5JAVA 3OWFA 2F0HA 5DEHA 4B9WA 4KTAA 5KYLA 1SYGA 3OSOA 5M9OA 3VA5A 2F0KA 4LAAA 5I9OA 3D8GA 4KY6A 1EY5A 4PMBA 3R3OA 4QMGA 4EQNA 5HGTA 2QDBA 2EYHA 3V2TA 5KRUA 1JORA 5IGEA 1A3TA 1KDBA 1KDCA 2F0FA 1SNDA 3TP6A 2F3WA 5KIXA 3E5SA 4DF7A 3SK6A 1SNMA 4G57A 4KY5A 1F2YA 4HTHA 1AEXA 2ENBA 3OMCA 3TMEA 5C5MA 2EYJA 5IGFA 3SR1A 1EY7A 1RKNA 3PMFA 2M00A 5KEEA 4WORA 3NP8A 1KABA 5I6WA 2LKVA 3BDLA 5C4ZA 5IODA 1NUCA 3TP7A 4I65A 3HZXA 1EY8A 2EY6A 3MVVA 4EQOA 3NUCA 1A3UA 2EYMA 2F0QA 1STNA 4KHVA 4J6HA 3EROA 1KDAA 3ITPA 3QOJA 2PW7A 3MZ5A 4OL7A 5DAUA 3SK4A 2KQ3A 5C4HA 1SYCA 4HMJA 1STBA 5CV7A 4WRDA 4MIUA 1EZ6A 2EYOA 2SNSA 3OMGA 4K5WA 4RKLA 5CC4A 5I6YA 5J39A 2EY2A 3DHQA 4ZUIA 5C6AA 5IOCA 1SYEA 1JOKA 2EY5A 1EYDA 3SHLA 1EZ8A 4KJNA 2PW5A 5CV8A 1EY6A 4ZUJA 3LX0A 1JOOA 2SNMA 5K5PA 1EQVA 4ME5A 4KD3A 4N9TA 3RUZA 1EYAA 2F0MA 3HEJA 4DFAA
chains in the Genus database with same CATH superfamily
1D7QA 4IURA 2G9HD 2NTSA 4DKAC 4BBSG 2F0SA 3D6CA 2JEBI 3X3MA 3H3VC 3S2HB 4RWSC 2WINB 2MNAA 4R4CA 3TQYA 2XTIA 1K0SA 3KLWA 1QVCA 2O4XA 2DNEA 1N34L 1CKOA 4X3TA 2E5LQ 2PMZE 2H4OA 5JEAG 1Y14B 1KRTA 3ERSX 3P1HA 1HZCA 2RDHA 3FDTA 5I4DA 5IE8A 1W6JA 1NR4A 3I4MB 1HNWL 1IBML 3DWQA 4J15A 1E2WA 1PZJD 4PZ6A 1STGA 4FDBA 3TP5A 1D2BA 1X3QA 1C8CA 1GUWA 5M3FG 2K03A 5IYDH 2PI2A 2HCCA 1Y8NB 2Q8TA 2ALYB 2QKIC 3A7AB 4HCSA 2YYZA 1Q81C 1S72A 2LSSA 3R93A 2X6LA 4JI7Q 4BY1H 3SE0A 4JC0A 1VQMA 1UNSA 2AUJD 3DWAA 2L9HA 5COYA 5C0XI 5A35A 2F0TA 4DK6C 1I3QH 3H94A 4F87A 3EN2A 4JBKA 3I70A 3HOWH 4A3FB 5J3BA 1CZWA 2F1MA 2J0TD 4JV5L 4KD4A 1EIYB 1CKMA 1U4PA 3EQLC 2E2HB 1JJ2A 4QB4A 3OW2A 2JA5H 1ICFB 3FMCA 5FOBB 5KYLA 1SYGA 1SN8A 5E7NA 4BBSB 3ZYYX 3BVGA 3K59A 1XMOQ 1XXGA 2A6ED 1HFGA 1RJTA 3A5ZB 4B08A 4X62L 1V9PA 1B3QA 2ZM6L 1N32L 2IJ0A 2RSNA 2E2JB 2R61A 1B4OA 1RTNA 1WFQA 2DY8A 2E2IH 2E5LL 1YZ6A 3TP7A 3VR4A 1I94L 1WD1A 2NVXB 3PIOA 4LF5Q 5M3FB 3FPUB 3N52A 1A0IA 4IUVA 4RGOS 1SMXA 1VQNA 1W6KA 4K5WA 3OYYA 4FF3A 4GNXA 4NXNL 1IZ6A 2CHBD 3VYRA 2Q2IA 4RHSA 3JAME 1EZ8A 3UI2A 5K5PA 1PYSB 3CU7A 1PRTD 5K36H 4DR4L 2RF4A 5M3MG 2R7FA 1FNWA 5M5WB 4DV7L 2KCTA 1QE6A 2BCOA 2R93H 3I7FA 4YIJA 1XWEA 2EYPA 4B3RQ 1KLUD 1VQCA 3STBD 1PZID 2KHSA 1D1KA 3N6RA 3QOLA 4KV6A 4MHEA 2NUCA 1G91A 4CKBA 3QO2A 3CCEA 2ZXPA 1A15A 1TWHB 2F0GA 2A6HD 4O0AA 1TWFB 1FL0A 3NK9A 2PO4A 4B3SQ 2JXMB 4PV1C 5IP9H 2VQFL 4KHPL 1LABA 4IOCA 1B9NA 1KQSA 2TMPA 3I56A 1L2FA 4UP7A 1G2TA 3HOUH 2C5CA 4B3TQ 2UU9Q 3MEHA 2K4KA 4NP5A 2ASBA 3BS1A 1TXYA 2HIVA 2MJ8A 1SYBA 4EQPA 4IJHA 3HG9A 3KDFB 4NDXA 3PUVA 3HRZC 1YITA 1CI3M 3CCMA 1ET9A 1TKWB 3CC7A 4LF6Q 1I6HH 2KCNA 1ZYRD 3P20A 1YNJC 3RD4A 1NNXA 1IKMA 4OWTB 5EKLA 1JB7A 1H9SA 1QZGA 5M3MB 3EFXD 1J6QA 2QEXA 2KENA 1M1KC 4QMGA 1VQ4A 2CWAA 3I55A 1JMCA 4HJ8A 4LFCL 1DZ1A 2UUCQ 1SNMA 4O42A 2EQSA 2F52A 2O5JC 3S14B 1MSHA 4C2MB 5IODA 1WTHA 2LKVA 3BDLA 3K7AB 1IKLA 1UAPA 4C3IG 4DR5Q 3MZ5A 4LJZC 1BBXC 2VS1A 2F4VL 2JK8A 1WTPA 1EZ6A 1SBBB 4H0LC 4LF7L 3H0GG 1I4GA 4NW2A 4DUYQ 2WV6D 3ER0A 1VQOA 1CHQD 2K6AA 4ZUIA 5C6AA 3RZOH 1CZGA 3MA2B 1XMQQ 4B3TL 3PUXA 3M4OB 2B3GA 4ZUJA 1EY6A 3LX0A 2SNMA 4JG2A 1CSPA 1F9SA 4N9TA 1E7ZA 1EYAA 5EQ0A 2ZXRA 2F0MA 3I4NH 4IPHA 4PQXA 4YY3Q 2KHIA 4LUOA 1PDQA 1D6EC 4BY7G 3DEOA 3OOCA 4JI5Q 2N49A 5ELEA 1XTCD 3J80L 2G9DA 3X3NA 1VS0A 4A93H 1L0WA 1G51A 3EJIA 3HOZG 1NY4A 5EPKA 1KAAA 2WAQE 2K5QA 1EYCA 2L15A 2JA8G 1QNKA 3KLRA 4NXML 1PYWD 3NELA 3UDFA 3QB3A 4YWLA 3Q22A 1MKHA 3S17B 2F0VA 3GO5A 1PTOB 2K33A 1T5EA 2N55A 3VYTA 4A3BH 2EE1A 2PZTA 1K28A 1EY0A 3D3RA 4B3MQ 2F0DA 3NE5B 4C3IB 2OQKA 1JWMD 3M4PA 4UDUC 5C5LA 1RTOA 3H0GB 2IHFA 1V1OA 3FEWX 3GDEA 4ILWA 3HS0C 1ILPA 1YHQA 5JEAJ 2L5TA 2B2YC 1NMGA 3GTQB 2K5HA 1XJVA 4KK7A 3E3XA 1UE7A 1BR9A 4KY6A 4PMBA 1R9TH 4BY7B 1X54A 2EYHA 1TU2B 4K6LA 5EPJA 1HFNA 1A3TA 4O2DA 1CA6A 1SNDA 1X3EA 5DNFA 2BA0A 4WFN3 4HTHA 1AEXA 3SVMA 1UE6A 3G4SA 1C7YA 3HOZB 2JA8B 2B39A 2F03A 1PV4A 4QJFA 1O80A 2JYOA 4GKKQ 3S1RH 2XSCA 2IHEA 1TY0A 4H44C 2LS01 2EYMA 1J8IA 2I46A 1ICWA 3BZDB 5DAUA 4OWWB 2KQ3A 1HNXQ 2CCZA 4IJLA 2EYOA 4QCLA 3JC66 3FKIG 4C1NI 5C4XH 4GZYC 1SYEA 2ZT9C 4B3ML 2HD3A 2I5MX 2CFMA 3U4VA 4OWXB 2PYKA 2H5XA 5C3EH 5IGDA 2R92G 2L4NA 2NBFA 2HQLA 5T1GA 4LF8L 4UAIA 1YNXA 5IT9L 4FF4A 1L1OC 1I4XA 2ZXOA 2X69A 4JI8Q 1V1PB 4F8MA 4X3UA 4P71A 4IALA 1SNQA 3MEFA 4LFBQ 4JOIC 2PQEA 1EU3A 2Y0SG 3S1QH 3TSSA 1IYJB 1WTQA 4I7ZC 3G6EA 2WIIB 1GXDC 3H6MA 3DUZA 4JBMA 1JJCB 3GTOB 3NHHA 3OW7A 4DA2A 4DR6Q 3DMUA 1KC8C 1Q82C 4DAVA 2N88A 2KHJA 2UUBQ 3FKIB 1A2TA 2XGTA 5FLXL 3SDZA 4Q5VA 2ATWA 1DOKA 1HNXL 4GOPB 3OIQA 1MGSA 2EPBA 1DM0B 3OIPA 5GQOA 1N36Q 2C9OA 2L0CA 2F0HA 1ZXTA 5M9OA 4V0BA 3TREA 2CQAA 5GADC 2R92B 3HP3A 5KIXA 3J7ZC 4FO2A 4DV4Q 3GTGH 1F2YA 3OMCA 4C3JG 5C5MA 3A7LA 5IGFA 4IFDH 4IPGA 4KKUA 3Q23A 2B63H 1NE3A 5FO9B 5LHY1 1BCPC 2MO0A 4EQOA 2Y0SB 1VQFA 1HPCA 1X6OA 3M4QA 3EROA 5EBCA 3OTOQ 4OL7A 4OO1G 4FP5D 4XIGS 3D6WA 5M5XB 1JWUD 1BXTA 3HKZG 4KKSA 4GOPC 5IP7G 1LTRD 2ZTDA 4ALPA 1G6ZA 2DGYA 1QVGA 2B2WC 4HIOA 4UP8A 2J4XA 2RQXA 3C1FA 4LF9Q 3A0JA 4JI0Q 3AMUA 2UUBL 2VW9A 1BBUA 1AE2A 1VQHA 5C4JB 3CCRA 1LUZA 1X56A 3NSWA 4HJ9A 1UE5A 4DR3L 3KBXA 1CQVA 3VR3A 3BJUA 2HHHL 3E6ZX 2MHVA 1NJIC 1YBYA 4K0KL 3K81C 4DAYA 4C3JB 3I4OA 1N33L 2IW3A 1PA6A 1I5FA 1WI5A 4L5QA 3MHBA 3MXPA 4DR1Q 3S15H 5CGKA 5E1FA 3HOXH 3MXNB 4QL5A 1LO5D 1Y1WH 4HAEA 3K5NA 3ERQA 5I9PA 4XQJA 3KJOA 4A3DH 1O7YA 1VF7A 4R4QA 4QGUA 1DONA 1STEA 1MJCA 2E76C 1LYLA 4F88A 1H9KA 1LT3D 1LACA 3HKZB 4J8QA 2F0LA 2CVRA 4LF4Q 2EZVA 1SMYD 1EUJA 2D5DA 3URYA 4JBJA 3KBGA 4IO9A 3IFTA 1Z7TA 1TT2A 2UUAL 1RHPA 1TR5A 3FP9A 5G3LF 3J81c 2YU9H 4YCUA 5FO7B 1HCZA 2BOSA 2QDLA 4A3EG 1UE1A 5GROA 1KDCA 2HDMA 2NVTH 3MTSA 4FVMA 4LF9L 4X65L 1WYDA 2BA1A 3M4YA 1U4LA 2XWBB 2M00A 3A8IE 1MIUA 1EQTA 1Q86C 3LGJA 3NP8A 1KABA 3RZDH 3JAML 3HZXA 1N34Q 1GVPA 1D1IA 3I8ZA 1A3UA 1CQFA 2CH4A 2RA4A 2F0QA 1XPRA 3DM1A 2PCFB 1EIFA 3PF5A 2K52A 2A6EC 2I5HA 1IBMQ 2O2LD 1STBA 4P75A 2NVQH 2XRQD 1SSOA 2NZHA 1QWYA 3U9SA 5ELOA 1PTOF 4CJ1B 3I4MG 1JOKA 3E9HA 3CCVA 4KJNA 2NTTA 4POGA 5DLQE 2KOLA 4KI0A 2UXBL 1SJHD 1VQ9A 3P75A 3A5UA 2NWGA 1BUVT 4RGMA 3DM3A 1VMCA 3BDCA 2NN6H 2DY7A 1TWAB 1CUKA 5JJZA 1QZHA 1VQ8A 4JV5Q 3ULPA 4IUPA 4Q0FA 2YTYA 4IUNA 1DYQA 1P16A 5C3XA 4A3EB 4HN7A 1Q8KA 4GNXC 5JOBA 1PRTC 5LMUL 1TWCB 5C0XG 1XNQQ 3J7AF 2JN4A 1QOHA 5E4WC 4ZKCB 2KA7A 3W2DA 3CQZB 3KF6A 2EOTA 4X62Q 2ZM6Q 2N78A 5CV4A 1N32Q 1SYFA 3STBC 3PO3G 4R8NA 4X66Q 3NTIA 3SK5A 2PQAA 3K80C 2AQ3B 2F0JA 2WKDA 4X64L 3KF8B 2EXZA 1K73C 5J1ZA 1EY9A 1O78A 3ONAB 5IP9G 4KY7A 2A6HC 4JI6Q 5IGGA 2JA7G 2VB2X 1FNUA 4DR7L 4ZRZA 3MFYA 1I94Q 2CH4W 3VA7A 3BZKA 2JA6G 2F0IA 3M3YB 3O13A 4K2KA 4A3IH 2JEAI 3NTKA 1KNEA 2TSSA 4NXNQ 5D3IB 1PZKD 2ZTCA 4LFAL 3S1NH 3I3CA 1K0RA 2QEJC 2QDBA 4TSSA 1LLRD 1O7IA 4WJ3M 1JORA 3R2IA 1PFMA 2F0FA 3TDQA 4DR4Q 1QUQB 4A3JG 4A3CH 2MUYA 1QNUA 3I4LA 3HOYH 4FF1A 4DV7Q 1ZYRC 1EOVA 2K28A 5KEEA 4R9WA 2B2VA 3T4AC 3S1MH 3PO2H 2IPKD 3Q0AA 4XYOA 1LTSD 4I65A 3IL8A 1EQQA 4YCWA 3GTJB 3IFDA 3GTLH 2A73B 1XNQL 2Z0SA 4JBWA 2QGQA 2Q8IB 2JP1A 2VQFQ 3PO3B 4KHPQ 3OMGA 4DR2L 2EY2A 5IYBH 2Z1CA 4BBRG 4X66L 2JA7B 2HUGA 3Q8DA 4KN7C 1K83B 2ID0A 4JI2Q 4X3KA 2Q8RE 4DAPA 5CBEE 4JI6L 2K5WA 1LTTD 2JA6B 3BYTB 2EDGA 4RGTA 4C56C 1CKNB 5IY0A 4UHVA 1F2MA 3S2HH 1MHWC 1K8GA 1HTPA 1I4QA 2K5VA 5IGCA 3L2PA 1VQ7A 5CV5A 4Y52H 4A3JB 3SXHA 2AQ1B 4DN4M 2OF1A 3RLFA 2MP1A 4ZK9B 1J5EL 5NUCA 1RODA 1VQPA 1AH9A 1I4HA 3W1GA 2BE5D 3PIP3 4LFCQ 4DV3Q 2RHSB 1WTOA 4XTCS 4X6AH 1Y8OB 4ZCKA 4S3SA 2O5IC 1D5ZC 1NBWA 2K04A 2F0WA 2OEOA 1VQKA 1K3RA 4K6DA 1Q8IA 3CC2A 2NZOA 4H7BA 4GLXA 1VMPA 1SE3A 1AFPA 3HGBA 2A1AA 4BBRB 5IYCG 4A3FH 2F4VQ 4LF7Q 1NTGA 1A8VA 1HTLD 1UEAB 1M8AA 1YNND 3PUZA 5HGTA 2UXDL 1G8ZD 4GN3B 4BBSH 4JI2L 3TP6A 4DK3C 2N8NA 4APVA 2QW7A 4G57A 2A68D 4UP9A 4GKJL 1WCMG 3AFPA 1SE4A 3U58A 5JEAH 2E2JH 1SAPA 3CD6A 1IYVA 3NUCA 1J9OA 2P5ZX 3D0FA 3LNNA 3QOJA 2NVXH 4NXMQ 1OXXK 5LMNL 5M3FH 2N3SA 4C3HG 3W5OA 3IKJA 2FJ2A 4RKLA 3CCQA 2ZJRA 1G6PA 3DHQA 2Z4HA 4DV3L 2EY5A 3SGIA 1EYDA 1R4PB 3RR5A 3GTMB 3S16B 2B29A 1JOOA 3VR5A 4Y7NB 1PFSA 5CYUA 1SNPA 1X55A 3T16A 4HJ5A 4U673 1HHVA 1YI2A 1TWGB 5M5WH 1B44D 1VQGA 5EJWA 4RAUC 3A55A 4A3GG 1ONLA 3A8JE 3F1ZA 4HMIA 1TWHH 1TWFH 3KYHC 4K8JA 1BNZA 2A19A 1BQQT 3K5MA 4OHJA 1E3PA 1QUQA 1WCMB 2IL8A 2KBNA 3NXWA 4CKCA 3RN2A 2F0UA 2WKCA 2ZTEA 2B2TA 3K0YA 4QIWB 3T13A 1CSQA 4BA1I 1HXYD 1XPUA 1CTMA 4K8IA 4K14A 3R8BA 4B9XA 5ELFA 2BH2A 4IUQA 4C3HB 2JSOA 2R7ZG 2MO1A 4L8JA 4GLVB 2XN9C 2F3IA 2I0QA 1ENAA 2LXKA 2F0EA 4IUTA 3J80c 1Y69U 1N9WA 4IQZA 1FD7D 2NZ1D 4ZQ3A 3VYSA 3F2DA 4HIMA 5M3MH 2JE6I 5C0XJ 1LTGD 2IY5B 2NVYB 1VDZA 3G6JB 4A3KG 4GS3A 2FFKB 2L1BA 2EYJA 3TMEA 2VUMG 2XNAC 4OIJA 4A3GB 4WORA 1L0YB 2VNUD 1UUPA 3G71A 2F4IA 3S14H 4LF8Q 5C4ZA 2CW0D 1SROA 4C2MH 2WP8J 1SFOB 3T1HL 2IT1A 3K7AH 3S2DB 1HR0L 2H1EA 4YCVA 1WD0A 1G291 4IFDG 2FMMA 1Q46A 2Y0SE 4X3SA 1XX8A 2BDNA 2K32A 2Z6KC 1B1ZA 2M9VA 3MWYW 3UE1A 1L1OB 5CV8A 1EYGA 3M4OH 2Q2UA 2R7ZB 1VQIA 2Z6BA 4XT3B 2JQOA 1VQ5A 3PQIA 4RKBA 1KHIA 5AFWA 2LMCB 5M5YB 4YWMA 3MXUA 2ES2A 3S9WA 3DWPA 3AB9A 1D5XC 2L12A 3A54A 4GN4B 1S40A 3L3OC 4PNYA 1KRSA 3M85A 1EWCA 1VQEA 2B8GA 4JPBW 1X65A 4DUZL 4A3KB 1MSGA 2R6GA 4DU9A 4K5VA 3RLOA 3D4WA 4DK1A 2VUMB 5C3WA 3ND9A 5FJ8G 2LXJA 4RCNA 3S17H 4QQBX 1ASYA 2B2UA 3KDFA 1PTOH 4IFDI 1EIGA 2XIWA 3BVMA 1HNZL 2OTLA 2DJGC 1II3A 5F2DA 3HFZB 1MJEA 2UXCL 3GV3A 3LWUA 4C3IH 1PH7A 2DUDA 5E4XA 1HQMC 4XT1B 1HJPA 1IHZA 4XQQA 2AKWB 3H0GH 2PNRC 3W1BA 1K9MC 1X3FA 4BXXG 1STAA 3HKZE 4JW0A 4ZLTF 4A4IA 3F2CA 4RCOA 1Y1VG 4EVOA 4DV6L 3J81i 2R7DA 5IT9c 1U9RA 1WJJA 4JI1L 3GTQH 5FLMG 1BCPB 3UDXA 3RLNA 2QCPX 4BY7H 1KDBA 4R4OA 1IW7D 4LWCA 1MI2A 1C0AA 4PG3A 4A76A 4AH6A 3G7LA 4ZAIA 4G7HC 1C4QA 3PMFA 4LMQD 3HOZH 4HJAA 2WB1G 3K57A 4YWKA 2JA8H 4HJ7A 2B8FA 2GA4B 4DR3Q 2EY6A 1JE5A 3HOVG 3CCLA 2K7VA 4J6HA 2HHHQ 5BN5A 3E9IA 4ZYSA 4NPSA 4K0KQ 1X3GA 1N33Q 5G3LD 1ESRA 2SNSA 3RMHA 5I6YA 1EU4A 5IOCA 1AN8A 4A75A 1FJGL 3NEMA 2XRSD 1SLJA 5C44G 1EQRA 1K3BC 2FHTA 4Z9CB 4E6IA 3DEPA 5A2QE 4A3LG 4FYDA 1IXRA 3TS0A 2AWOA 3P7JA 1Y1VB 1KD1C 2A5HA 1EY4A 1EWHA 4HCEA 5ELNA 3GTKB 4DK0A 1LTBD 1HA6A 3M7NA 1O7LA 2Q2TA 3MFGA 4OXPA 5BN4A 3K6OA 2UUAQ 1QCBD 5GAEC 1SJED 5DM73 1PTOD 1PH4A 5EAYA 4L5SA 5JPNC 3G48A 4J1MA 4ABNA 5KNBA 5EBDA 4IPDA 1XTDA 4A3MG 2WB1B 1KNAA 4X65Q 1FR3A 2F0OA 3HOVB 3V05A 3GTOH 2F3VA 4C1NK 1UWVA 2LY7A 4RFBA 1FGBD 1AZQA 4DV2L 1JT8A 1G2SA 1STYA 2X6GA 1WOCA 4JYAL 1Y8PB 4BWGB 4CDEC 1XNRQ 4HSPA 4OX9Q 4YHHQ 2K01A 5C44B 1KLGD 4IZ8A 2HT1A 1H9JA 1LTID 5JAVA 2D9UA 3CCSA 3SEBA 1SDFA 3J7A5 1ZKOA 3GTPB 5HGQA 1GUOA 2F3WA 2K5DA 2R92H 2UXBQ 3ZJYC 3A56A 1QG7A 3ULLA 4JOIA 3SR1A 2NN6I 2D62A 3J7YW 1AW7A 5IYDG 1VQDA 3PF4A 4IPCA 3Q24A 4BY1G 1YEZA 1GOZA 4AQYL 3BG3A 4A3MB 1F9QA 1JR0D 5LMUQ 2Z4IA 3A8KE 4MIUA 3C3LA 1HZ9A 4CGYB 3HOWG 3T1YL 3CPFA 4FNFA 1RDPD 3K7UC 2JA5G 3NBIA 1MD2D 4JVZA 3EIVA 3RUZA 1JC7A 1A62A 4MZ9A 2IX0A 2B2VC 4X64Q 1YJWA 2SOBA 4GNXB 2OT2A 1X32A 2LFNA 1PRTB 4IN3A 1NR2A 3GD7A 5JJKA 5KYIA 1E24A 2PZUA 5EKKA 1V1PA 2XWJB 3V96A 3Q6SA 3KJPA 4DR7Q 1E1OA 2OCEA 5C4JH 4M1UB 3KK7A 2I07B 5ELBA 1TY2A 1XNRL 3K0XA 3L0OA 4N8FA 4OX9L 4YHHL 5EPLA 1GHKA 1S5FD 4JI3Q 1EWIA 1OO9B 2D2CC 3JAMc 4PMCA 4TRDA 4LFAQ 3BDOA 1YJ9A 4IFDJ 1EFID 2PZWA 1IL2A 3VR6A 4XYQA 4POFA 3IRBA 5D65A 4C3JH 3J81j 3D31A 1FGUA 4NKLA 1VQJA 5CORA 4CBVA 3NWTA 5FKAC 3CMEA 4BY1B 1OXSC 4GOPA 1AZPA 1PVOA 3FVQA 5CR3A 1SNCA 3T56B 5DM63 1I3QB 4RH6A 5K36G 4DV1L 4OO1H 1N8RC 1W3SA 4DPGA 1WTRA 3HOWB 2A74C 2K50A 4TQUS 3LWEA 3MAQA 3PIPA 1EIHA 1U4RA 3D4RA 2R93G 2JA5B 2BE5C 3QJYA 5IP7H 1I50H 1Q7YC 1DOMA 4DR2Q 2K75A 3DXJC 4LUVA 5DEHA 1KXLA 3BZCA 1JB3A 4KKTA 5KRUA 1Q1BA 1XYIA 4EQ5A 2E74C 1BOSA 4XXEA 4UPAA 1OXUA 4DXFA 1JWSD 4OONA 5L37A 3HOUG 1U0LA 2E2IB 5JPMC 1EOTA 1HZAA 3QR8A 2JA9A 3HKSA 3CF5A 1EY8A 4JI3L 1YNNC 1CA5A 1DCZA 3QG1A 2VZAA 3CKIB 2A69D 1ESFA 4CDFC 1SYCA 4HMJA 4JI4L 4PMWA 1J5EQ 1SRUA 2C35B 5CC4A 2E75C 4ULLA 3H3VH 2A68C 3MXGA 1NAPA 3WDNA 3B6YA 3WOFA 2PW5A 4HIKA 2NYZD 4KD3A 2K05A 5EKIA 1VQLA 3HEJA 4DFAA 5EGTA 2PPBC 4XDXA 3UDIA 4G4KA 3VR2A 1KIXA 4PZ8A 2R93B 1A2UA 2M2LA 1GD7A 2XVSA 4CKEA 1KL9A 4UY8C 1TWAH 2RHQB 1PFNA 3FHWA 4ZKBB 4MTKA 3CC4A 4A3EH 3MXNA 1PH3A 1BCPF 3I2ZA 4DV5L 3U9OA 1TWCH 2UXDQ 3TS2A 3HOUB 1I4PA 1NSNS 3EVQA 2FINB 3QWNA 3CQZH 3J81E 3DLLA 1F9RA 1GUSA 1HQRD 4KN4C 2K5NA 3CP0A 3QIAA 4GKJQ 1LV9A 5BN3A 4K5XA 4QIWE 1E2ZA 1GUNA 1UEBA 5KGUA 3ND8A 2PNHA 1BVSA 4LNQA 1PFBA 2K14A 3I4NG 1I6HB 1LTLA 2VL6A 2IWHA 2BDOA 3J80i 2QA4A 5LMNQ 5H1SE 3I4MH 1HZBA 2KEDA 3NENA 5CV9A 3PSIA 3CXCA 4A93G 4OGQC 3M3YH 4QUFA 1LT5D 3TEHB 2HCIA 2MPMA 3OSOA 2B2TC 3I91A 3WWVA 3E0JA 2VY3A 4H02A 3S24A 1RL2A 3E5SA 3CRLC 3PUWA 4KY5A 1VF5C 3NPPA 1R4QB 3GP7A 3UE0A 1EY7A 4JI7L 3H15A 4A3BG 2KVMA 2KCMA 1K8OA 2MQHA 2G5DA 4L63B 2RCNA 5LMNW 3FPPA 1TIID 1JQYD 5C0XH 2E2HH 3KUPA 3NTHA 4RG1A 3K58A 3GTJH 3F8TA 1A63A 4G7OC 4HR7B 3RZOB 3PO3H 2OQ0A 3I90A 4JK1C 3CHBD 3KLSA 2AQ2B 2KECA 1QJOA 3I4NB 5AJ3Q 2KEEA 1XMOL 2CW0C 4QY7A 2JA7H 3T53B 1K83H 5JVG3 4DV0Q 5LL6X 1M4VA 4AIMA 1HUMA 1F9PA 4LK1C 1KTKA 2JA6H 4A93B 2PMZB 4MNOA 3TZUA 5HURA 1HRJA 3KOJA 1B2TA 4N9PA 5D3DA 4DNRB 1CHPD 1JE4A 5ELCA 1Z47A 2RDFA 1XPOA 1GKHA 4ODGA 1IBKQ 4LF5L 1DXMA 5IIFA 3PCOB 4A3JH 3K5LA 1B3AA 4MN3A 1RIPA 1RCVD 1CT1D 3KF8A 1BDOA 1WTVA 4A3BB 3AYHB 3C2PA 1Q12A 2F0NA 2A8VA 2AUKA 2K1BA 4ID6A 4P2CB 5C4XG 1KAWA 1QILA 4CJ0B 4F7XA 4RHRA 1SR3A 3IAYA 4WJ4A 5J22A 1AP0A 1EL0A 3PV0A 3C46A 1ZEQX 2EY1A 3T1HQ 4P74A 4B3RL 2NB0A 1WTXA 1YVCA 5C3EG 1HR0Q 5FK9C 5JJIA 4BS9A 3C1EA 3F2BA 4BBRH 3BU2A 4HSVA 4B3SL 1R9TB 2F0KA 2B2UC 3NBHB 3WOEA 1M90C 4LAAA 2OTJA 3D8GA 1EY5A 5AJ3L 3R3OA 4H13C 5IGEA 2SEBD 3PIO3 1H9RA 1PHJA 1B8AA 1W2BA 3J7AV 1PRTF 1DJRD 4DV0L 5HY6A 4HIDA 1U4MA 2UU9L 3CCUA 2Z9HA 1EFWA 3CRKC 4MTNA 1PH5A 2IX1A 3AQQA 1YIJA 3S1RB 3PGZA 1HR0W 2RDGA 3W3AA 1T9HA 1IBKL 4LF6L 4FXDA 1DD2A 4DUZQ 4FXKC 4GLAC 1LT6D 5A2QL 1IW7C 1S5DD 5C4XB 1F2LA 2L55A 5J39A 2E8GA 3SHLA 4RGNA 1CKNA 1HNZQ 2V1CC 4HEDA 3GTMH 3S16H 2IX3A 5BR8Q 2UUCL 4Y7NH 1GM5A 4NB3A 5C3EB 1JJGA 2UXCQ 2ICEC 3SK8A 1B50A 4P72A 5IYCH 1EEFD 1AE3A 1TWGH 1F2ZA 1VQBA 1STHA 4DXGA 1OTCA 4WJWA 2B63G 1SE2A 4DV6Q 2GVAA 1H95A 4DR5L 2AMCB 2BH8A 5ELDA 1P8LA 3TBIB 4JI1Q 4XQNA 3I73A 2RSOA 1NMFA 3S1QB 1ENCA 1SNOA 1I4RA 2FMCA 4DUYL 3M9BA 1YNJD 4DNTB 1S5CD 1V43A 2EIFA 2MGSA 1XMQL 1WCMH 4ME3A 1YHAA 1S5BD 2RBMA 2EJMA 1RF2D 4DAYB 1C48A 5D14A 2WB1E 4DNIA 5IWAQ 2OWOA 1LM0A 2F0PA 4YY3L 5JJLA 4GN5A 4LW1A 4JI5L 3BVZA 2EYLA 2I5LX 1PH9A 3F2UA 3NQIA 4C3HH 1K8MA 1PTOC 4OIKA 2PI2E 4K2LA 1TQOA 5JVH3 1JOQA 5IGBA 1Q3LA 1O7ZA 3CCJA 2DNCA 1E2VA 2WAQG 3NWSA 1D5MC 4KTAA 3VA5A 3EA6A 4OELB 5I9OA 4R4IA 3R2TA 1FJGQ 5I2XA 4KMUC 4R1JA 3GTGB 5BR8L 2D0OA 3CW2C 3OWEB 3TRZA 4P73A 3SK6A 1B9MA 2NVYH 1F77A 1TS5A 1CK1A 1YHBA 2B63B 3HOXG 1TS3A 3GV6A 1Y1WG 4A3GH 5I6WA 3UDGA 1Q90A 1WTWA 4A3DG 1DGSA 3MVVA 2GN5A 4KLKA 5LL6S 1GUTA 1STNA 1SFOH 1GO3E 4R4TA 1IYUA 2GVBA 3S2DH 5CV7A 2Z8LA 2J7ZA 2QF7A 2ZJPA 1PYBA 3K8AA 1B7YB 1U5KA 1OXVA 1SMYC 5CBAE 4RA8A 2V4DA 2Q2HA 5IWAL 4U68A 1FYCA 2R7ZH 3TP8A 3PUYA 3L9AX 2EJGC 2R3ZA 4DV2Q 3EBEA 3ICEA 1GUGA 1NCVA 2CWPA 2VB3X 1VQAA 5M5YH 1WVLA 1BKBA 1TS2A 2WAQB 1TS4A 4KJOA 4GKKL 4JYAQ 5FLXc 1ENFA 3E0EA 1PH2A 3JAMi 4R8IA 2OXPA 1CM9A 2EXDA 3NBHA 1QB5D 1DOLA 1BBWA 4A3KH 1Q1EA 1BO0A 3S15B 2B2YA 3J80E 2VQEQ 1BF4A 5ISRA 1IL8A 3HOXB 2VUMH 1SEBD 1Y1WB 1A3VA 1IBLQ 2EYFA 2WACA 1L0XB 3NQTA 3GQBA 4A3DB 2Z6KA 1Z9FA 4O1NA 1FVIA 3KF6B 2JJQA 1SYDA 4EX5A 4CJ2C 2HDLA 2PQAB 4IUUA 4AQYQ 1SXTA 2RVLA 5CV6A 2NN6G 3M7GA 3L7ZC 4JI8L 1D8LA 2YU9B 1SE8A 3T1YQ 2EVBA 4LFBL 1PMRA 3CMAA 3CPWA 3V2TA 2NVTB 1FNVA 2ICIA 5T1IA 4AYBE 4I7AA 2AWNA 2WFWA 1GHJA 1YJNA 4DR6L 3FKIH 3RZDB 1PXUA 1E1TA 2DJFC 3U4ZA 2RCFA 1C9OA 1E22A 2YTXA 4OEMB 1KDAA 5FJ8H 2KJXA 2PW7A 1L1OA 2NVQB 1T5XD 3VDYA 2VXWA 2VQEL 4BA2I 2L11A 1N36L 1K8AC 5KNDA 2FXQA 1IBLL 4TKOB 4A3IG 1HH2P 3A74A 1V1QA 4DAMA 3VYUA 1EQVA 3RNUA 4G7ZC 1EEID 1X3PA 4DV4L 2SDFA 3MC0B 1VCIA 3CAMA 4OO1I 2A69C 4DV1Q 2KCCA 1JCKB 1LTAD 3AFQA 1ML0D 3OPOA 4A3CG 4BXXH 2YTVA 3RN5A 3HOYG 1OXTA 1Y1VH 2KUMA 4RMFA 3J81L 3GTKH 4V190 1I6VC 4N8X1 5FLMH 5M5XH 1H9MA 2D0PA 3K5OA 3PO2G 1A6XA 3OTOL 4M8AA 1V8QA 3KLSX 1QVFA 1MBYA 1S3OA 2YV5A 1JICA 1I50B 5E3FA 4KHZA 3OHXC 1Z6HA 2AHOB 2CKZB 5IT9E 4CDDC 3AU7A 4NMZA 4AYBG 3KFUA 5IYBG 5CMDA 5TSSA 3D4DA 1LT4D 4DGZA 3HOVH 2QILA 4L5RC 3H09A 2ZJQA 3AEVA 4JI0L 2RKSA 4LUZA 2DN8A 1E0BA 4QF4A 2HQEA 4JCVE 4A3IB 4JI4Q 4FF2A 3BYYB 4L6TB 5GAHC 1HUNA 1B53A 3H3VI 1BCPD 3OWFA 4B9WA 3I72A 4TVAB 5C44H 3H91A 3S1NB 2MFIA 1HNWQ 2E2DC 4EQNA 1X9NA 4QUCA 4DR1L 1HA5A 4A3LH 1PH1A 2EJFC 3GTPH 5FLXE 5I2YA 3HOYB 4DF7A 1RD9D 1ET6A 2ENBA 5GAGC 3ULJA 2B2WA 4FXGC 1RKNA 3S1MB 1S5ED 3PO2B 3FRPB 1ASZA 3TN2A 4CHTB 3U50C 1PLFA 1NUCA 3TZDA 1TVXA 4CDCC 1PH6A 1GJXA 3GTLB 5FO8B 4KHVA 4LF4L 1ILQA 3ITPA 4EGVA 4IOAA 2CQOA 5C4HA 3SK4A 4PZ7A 4A3MH 4DV5Q 2HIXA 4WRDA 4AYBB 4L5TA 1B70B 1H9SB 4A3FG 1S4ZA 3T51B 1CFMA 1PH8A 5KNCA 4ME5A 1VQ6A
chains in the Genus database with same CATH topology
4IURA 2G9HD 2NTSA 2F0SA 3D6CA 2JEBI 3X3MA 3H3VC 3S2HB 4RWSC 2WINB 2O4XA 2DNEA 4X3TA 2H4OA 5JEAG 3P1HA 2RDHA 3FDTA 5I4DA 1W6JA 1NR4A 3I4MB 3DWQA 1E2WA 1PZJD 1STGA 3TP5A 1D2BA 1X3QA 1C8CA 1GUWA 2K03A 2HCCA 1Y8NB 2Q8TA 2QKIC 3A7AB 4HCSA 2YYZA 3R93A 2X6LA 3SE0A 1UNSA 2AUJD 3DWAA 2L9HA 5COYA 5C0XI 5A35A 2F0TA 3H94A 4F87A 3I70A 4A3FB 1CZWA 2F1MA 2J0TD 4KD4A 1U4PA 3EQLC 2E2HB 4QB4A 3FMCA 5FOBB 5KYLA 1SYGA 4BBSB 3ZYYX 3BVGA 3K59A 1XXGA 2A6ED 1HFGA 1RJTA 4B08A 2IJ0A 2RSNA 2E2JB 2R61A 1B4OA 1RTNA 2DY8A 3TP7A 3VR4A 1WD1A 2NVXB 5M3FB 3FPUB 3N52A 4IUVA 4RGOS 1W6KA 4K5WA 4FF3A 2CHBD 3VYRA 4RHSA 3JAME 1EZ8A 3UI2A 5K5PA 3CU7A 1PRTD 5K36H 1FNWA 5M5WB 1QE6A 2BCOA 4YIJA 1XWEA 2EYPA 1KLUD 1PZID 2KHSA 1D1KA 3N6RA 3QOLA 4KV6A 4MHEA 2NUCA 1G91A 4CKBA 3QO2A 2ZXPA 1A15A 1TWHB 2F0GA 2A6HD 1TWFB 3NK9A 2PO4A 2JXMB 4PV1C 1LABA 1B9NA 2TMPA 1G2TA 2C5CA 3MEHA 4NP5A 3BS1A 2MJ8A 1SYBA 4EQPA 3HG9A 4NDXA 3PUVA 3HRZC 1CI3M 1ET9A 1TKWB 2KCNA 1ZYRD 3P20A 1YNJC 3RD4A 1IKMA 5EKLA 1H9SA 5M3MB 3EFXD 4QMGA 1DZ1A 1SNMA 4O42A 2O5JC 3S14B 1MSHA 4C2MB 5IODA 2LKVA 3BDLA 3K7AB 1IKLA 1UAPA 4C3IG 3MZ5A 4LJZC 1BBXC 1WTPA 1EZ6A 1SBBB 4H0LC 1I4GA 4NW2A 2WV6D 1CHQD 2K6AA 4ZUIA 5C6AA 1CZGA 3MA2B 3PUXA 3M4OB 4ZUJA 1EY6A 3LX0A 2SNMA 1F9SA 4N9TA 5EQ0A 1EYAA 2ZXRA 2F0MA 4PQXA 1PDQA 1D6EC 3DEOA 3OOCA 5ELEA 1XTCD 3J80L 2G9DA 3X3NA 3EJIA 5EPKA 1KAAA 2K5QA 1EYCA 1QNKA 3KLRA 1PYWD 3QB3A 3Q22A 3S17B 2F0VA 3GO5A 1PTOB 2K33A 1T5EA 2N55A 3VYTA 2EE1A 2PZTA 3D3RA 1EY0A 2F0DA 3NE5B 4C3IB 1JWMD 4UDUC 5C5LA 1RTOA 3H0GB 1V1OA 3FEWX 4ILWA 3HS0C 1ILPA 5JEAJ 2L5TA 2B2YC 3GTQB 4KK7A 1BR9A 4KY6A 4PMBA 4BY7B 2EYHA 1TU2B 4K6LA 5EPJA 1HFNA 1A3TA 1CA6A 1SNDA 5DNFA 2BA0A 4WFN3 4HTHA 1AEXA 3SVMA 3HOZB 2JA8B 2B39A 2F03A 1O80A 2JYOA 2XSCA 1TY0A 4H44C 2LS01 2EYMA 1J8IA 2I46A 5DAUA 1ICWA 3BZDB 2KQ3A 2EYOA 4QCLA 4C1NI 4GZYC 1SYEA 2ZT9C 2PYKA 5IGDA 2L4NA 2NBFA 5T1GA 4UAIA 5IT9L 4FF4A 1I4XA 2ZXOA 2X69A 1V1PB 4F8MA 4X3UA 4IALA 1SNQA 2PQEA 1EU3A 3TSSA 1WTQA 4I7ZC 2WIIB 1GXDC 3H6MA 3DUZA 3GTOB 3NHHA 3OW7A 4DA2A 3DMUA 4DAVA 2N88A 3FKIB 1A2TA 5FLXL 3SDZA 4Q5VA 1DOKA 3OIQA 1MGSA 2EPBA 1DM0B 3OIPA 2C9OA 2L0CA 2F0HA 1ZXTA 5M9OA 4V0BA 2CQAA 2R92B 3HP3A 5KIXA 4FO2A 1F2YA 3OMCA 4C3JG 5C5MA 5IGFA 3A7LA 4IFDH 4KKUA 3Q23A 5FO9B 5LHY1 1BCPC 4EQOA 2Y0SB 1HPCA 3EROA 5EBCA 4OL7A 4OO1G 4FP5D 4XIGS 3D6WA 5M5XB 1JWUD 1BXTA 4KKSA 1LTRD 1G6ZA 2B2WC 2J4XA 2RQXA 3C1FA 3AMUA 5C4JB 3NSWA 3KBXA 1CQVA 3VR3A 3E6ZX 2MHVA 4DAYA 4C3JB 2IW3A 3MHBA 3MXPA 5CGKA 5E1FA 1LO5D 4HAEA 3K5NA 3ERQA 5I9PA 4XQJA 1O7YA 1VF7A 1DONA 1STEA 2E76C 4F88A 1H9KA 1LT3D 1LACA 3HKZB 4J8QA 2F0LA 2CVRA 2EZVA 1SMYD 2D5DA 3URYA 3KBGA 3IFTA 1Z7TA 1TT2A 1RHPA 1TR5A 5G3LF 5FO7B 1HCZA 2BOSA 1KDCA 2HDMA 3MTSA 4FVMA 2BA1A 3M4YA 1U4LA 2XWBB 2M00A 3A8IE 1EQTA 3NP8A 1KABA 3JAML 3HZXA 1D1IA 3I8ZA 1A3UA 1CQFA 2RA4A 2F0QA 3DM1A 2PCFB 2A6EC 2O2LD 1STBA 2XRQD 1SSOA 1QWYA 3U9SA 1PTOF 4CJ1B 1JOKA 4KJNA 2NTTA 2KOLA 4KI0A 1SJHD 3P75A 2NWGA 1BUVT 4RGMA 1VMCA 3BDCA 2NN6H 2DY7A 1TWAB 5JJZA 4IUPA 4Q0FA 4IUNA 1DYQA 5C3XA 4A3EB 4HN7A 5JOBA 1PRTC 1TWCB 5C0XG 3J7AF 5E4WC 1QOHA 4ZKCB 2KA7A 3W2DA 3CQZB 2EOTA 5CV4A 1SYFA 4R8NA 3NTIA 3SK5A 2AQ3B 2F0JA 2WKDA 2EXZA 5J1ZA 1EY9A 1O78A 3ONAB 4KY7A 2A6HC 5IGGA 2VB2X 1FNUA 4ZRZA 3MFYA 3VA7A 2F0IA 3M3YB 3O13A 4K2KA 2JEAI 3NTKA 1KNEA 2TSSA 5D3IB 1PZKD 3I3CA 2QEJC 2QDBA 4TSSA 1LLRD 1JORA 3R2IA 1PFMA 2F0FA 3TDQA 2MUYA 1QNUA 3I4LA 4FF1A 1ZYRC 2K28A 5KEEA 4R9WA 2B2VA 3T4AC 2IPKD 3Q0AA 4XYOA 1LTSD 4I65A 3IL8A 3GTJB 3IFDA 2A73B 4JBWA 2Q8IB 2JP1A 3PO3B 3OMGA 2EY2A 2Z1CA 2JA7B 2HUGA 4KN7C 1K83B 2ID0A 4X3KA 2Q8RE 4DAPA 5CBEE 2K5WA 1LTTD 2JA6B 3BYTB 2EDGA 4RGTA 4C56C 1F2MA 1HTPA 1I4QA 5IGCA 5CV5A 4A3JB 3SXHA 2AQ1B 4DN4M 2OF1A 3RLFA 4ZK9B 2MP1A 5NUCA 1RODA 1I4HA 2BE5D 3PIP3 1WTOA 4XTCS 1Y8OB 4S3SA 2O5IC 1D5ZC 2K04A 2F0WA 2OEOA 4K6DA 1Q8IA 4H7BA 1VMPA 1SE3A 1AFPA 3HGBA 4BBRB 1HTLD 1UEAB 1M8AA 1YNND 3PUZA 5HGTA 1G8ZD 3TP6A 4G57A 2A68D 1SE4A 5JEAH 1SAPA 1IYVA 3NUCA 1J9OA 3QOJA 3LNNA 1OXXK 4C3HG 3IKJA 2FJ2A 4RKLA 3DHQA 2Z4HA 2EY5A 1EYDA 1R4PB 3GTMB 3S16B 1JOOA 3VR5A 4Y7NB 5CYUA 1SNPA 3T16A 4U673 1HHVA 1TWGB 1B44D 5EJWA 4RAUC 3A55A 1ONLA 3A8JE 4HMIA 4K8JA 1BNZA 1BQQT 3K5MA 4OHJA 1WCMB 2IL8A 3NXWA 4CKCA 2F0UA 2WKCA 2B2TA 3K0YA 4QIWB 3T13A 4BA1I 1HXYD 1CTMA 4K8IA 4K14A 3R8BA 4B9XA 5ELFA 4IUQA 4C3HB 2JSOA 4L8JA 2XN9C 1ENAA 2F0EA 4IUTA 1Y69U 4IQZA 1FD7D 2NZ1D 4ZQ3A 3VYSA 2JE6I 5C0XJ 1LTGD 2NVYB 1VDZA 3G6JB 2FFKB 2L1BA 2EYJA 3TMEA 2XNAC 4OIJA 4A3GB 4WORA 1L0YB 2VNUD 1UUPA 2F4IA 5C4ZA 2CW0D 2WP8J 1SFOB 2IT1A 3S2DB 2H1EA 1WD0A 1G291 4IFDG 2FMMA 4X3SA 1XX8A 2BDNA 2K32A 1B1ZA 2M9VA 3MWYW 5CV8A 2R7ZB 4XT3B 4RKBA 5AFWA 2LMCB 5M5YB 3MXUA 3S9WA 3DWPA 3AB9A 1D5XC 2L12A 3A54A 3L3OC 4PNYA 3M85A 1EWCA 2B8GA 4A3KB 1MSGA 2R6GA 4DU9A 4K5VA 3D4WA 4DK1A 2VUMB 5C3WA 3ND9A 4RCNA 2B2UA 1PTOH 4IFDI 1EIGA 2XIWA 3BVMA 1II3A 5F2DA 3GV3A 3LWUA 5E4XA 1HQMC 4XT1B 1IHZA 4XQQA 2PNRC 1STAA 4ZLTF 4RCOA 4EVOA 1U9RA 1BCPB 2QCPX 1KDBA 1IW7D 1MI2A 3G7LA 4ZAIA 4G7HC 1C4QA 3PMFA 4LMQD 3K57A 2B8FA 2GA4B 2EY6A 2K7VA 4J6HA 5BN5A 4ZYSA 5G3LD 1ESRA 2SNSA 3RMHA 5I6YA 1EU4A 5IOCA 1AN8A 2XRSD 2FHTA 4Z9CB 4E6IA 3DEPA 5A2QE 4FYDA 2AWOA 3P7JA 1Y1VB 2A5HA 1EY4A 1EWHA 4HCEA 3GTKB 4DK0A 1LTBD 1HA6A 3M7NA 1O7LA 3MFGA 5BN4A 3K6OA 1QCBD 1SJED 5DM73 1PTOD 5JPNC 4J1MA 4ABNA 5KNBA 5EBDA 2WB1B 1KNAA 1FR3A 2F0OA 3HOVB 3V05A 2F3VA 4C1NK 2LY7A 4RFBA 1FGBD 1AZQA 1G2SA 1STYA 2X6GA 1Y8PB 4BWGB 4HSPA 2K01A 5C44B 1KLGD 4IZ8A 1H9JA 1LTID 5JAVA 2D9UA 3SEBA 1SDFA 1ZKOA 3GTPB 1GUOA 2F3WA 2K5DA 3A56A 1QG7A 3SR1A 2NN6I 2D62A 3J7YW 1AW7A 3Q24A 1GOZA 3BG3A 4A3MB 1F9QA 1JR0D 2Z4IA 3A8KE 4MIUA 3C3LA 4CGYB 4FNFA 1RDPD 3NBIA 1MD2D 3RUZA 1JC7A 2IX0A 2B2VC 2SOBA 2OT2A 1X32A 2LFNA 1PRTB 4IN3A 1NR2A 3GD7A 5KYIA 2PZUA 5EKKA 3V96A 1V1PA 2XWJB 3Q6SA 4M1UB 3KK7A 2I07B 5ELBA 1TY2A 1GHKA 5EPLA 1S5FD 1OO9B 2D2CC 4PMCA 4TRDA 3BDOA 4IFDJ 1EFID 2PZWA 3VR6A 4XYQA 5D65A 3D31A 4NKLA 5CORA 4CBVA 3NWTA 5FKAC 4BY1B 1OXSC 1AZPA 3FVQA 5CR3A 1SNCA 3T56B 5DM63 1I3QB 4RH6A 5K36G 4OO1H 1WTRA 3HOWB 2A74C 4TQUS 3LWEA 3MAQA 1EIHA 1U4RA 3D4RA 2JA5B 2BE5C 3QJYA 1DOMA 3DXJC 5DEHA 1JB3A 4KKTA 5KRUA 1Q1BA 1XYIA 2E74C 1BOSA 4XXEA 1OXUA 4DXFA 1JWSD 2E2IB 5JPMC 1EOTA 1EY8A 1YNNC 1CA5A 1DCZA 3QG1A 3CKIB 2A69D 1ESFA 1SYCA 4HMJA 4PMWA 5CC4A 2E75C 4ULLA 2A68C 3MXGA 1NAPA 3WDNA 3WOFA 2PW5A 2NYZD 4KD3A 2K05A 5EKIA 3HEJA 4DFAA 5EGTA 2PPBC 4XDXA 4G4KA 3VR2A 2R93B 1A2UA 2M2LA 2XVSA 4CKEA 1PFNA 4ZKBB 3MXNA 1BCPF 3U9OA 3HOUB 1I4PA 1NSNS 3EVQA 2FINB 3QWNA 3J81E 1F9RA 1GUSA 1HQRD 4KN4C 3QIAA 1LV9A 5BN3A 4K5XA 1E2ZA 1GUNA 5KGUA 3ND8A 1PFBA 1I6HB 2IWHA 2BDOA 2KEDA 5CV9A 4OGQC 4QUFA 1LT5D 2HCIA 2MPMA 3OSOA 2B2TC 3I91A 3E0JA 3E5SA 3CRLC 3PUWA 4KY5A 1VF5C 3NPPA 1R4QB 3GP7A 1EY7A 2KVMA 1K8OA 4L63B 3FPPA 1TIID 1JQYD 5C0XH 3KUPA 3NTHA 3K58A 4G7OC 4HR7B 3RZOB 3I90A 4JK1C 3CHBD 3KLSA 2AQ2B 2KECA 1QJOA 3I4NB 2KEEA 2CW0C 3T53B 5JVG3 5LL6X 1M4VA 1HUMA 1F9PA 4LK1C 1KTKA 4A93B 2PMZB 3TZUA 5HURA 1HRJA 1B2TA 4N9PA 5D3DA 4DNRB 1CHPD 1JE4A 5ELCA 1Z47A 2RDFA 4ODGA 1DXMA 5IIFA 3K5LA 1B3AA 4MN3A 1RCVD 1CT1D 3KF8A 1BDOA 1WTVA 4A3BB 3C2PA 1Q12A 2F0NA 2AUKA 2K1BA 4ID6A 4P2CB 1QILA 4CJ0B 4F7XA 4RHRA 3IAYA 1AP0A 5J22A 1EL0A 3PV0A 3C46A 1ZEQX 2EY1A 2NB0A 1WTXA 5FK9C 4BS9A 3C1EA 4HSVA 1R9TB 2F0KA 2B2UC 3WOEA 4LAAA 3D8GA 1EY5A 3R3OA 4H13C 5IGEA 2SEBD 3PIO3 1H9RA 3J7AV 1PRTF 1DJRD 1U4MA 3CRKC 2IX1A 3S1RB 2RDGA 3W3AA 4FXDA 1DD2A 4FXKC 1LT6D 5A2QL 1IW7C 1S5DD 5C4XB 1F2LA 2L55A 5J39A 3SHLA 4RGNA 4HEDA 2IX3A 5C3EB 2ICEC 3SK8A 1B50A 1EEFD 1F2ZA 1STHA 4DXGA 4WJWA 1SE2A 5ELDA 3TBIB 4XQNA 3I73A 2RSOA 3S1QB 1ENCA 1SNOA 1I4RA 2FMCA 1YNJD 4DNTB 1S5CD 1V43A 2MGSA 1S5BD 2RBMA 2EJMA 1RF2D 1C48A 5D14A 2F0PA 3BVZA 2EYLA 3F2UA 3NQIA 1K8MA 1PTOC 4OIKA 4K2LA 1TQOA 5JVH3 1JOQA 5IGBA 1Q3LA 1O7ZA 2DNCA 1E2VA 3NWSA 1D5MC 4KTAA 3VA5A 3EA6A 5I9OA 3R2TA 5I2XA 4KMUC 3GTGB 3OWEB 3SK6A 1B9MA 1F77A 1TS5A 1CK1A 2B63B 1TS3A 3GV6A 5I6WA 1Q90A 1WTWA 3MVVA 5LL6S 1GUTA 1STNA 1IYUA 5CV7A 2Z8LA 2J7ZA 2QF7A 1OXVA 1SMYC 5CBAE 4RA8A 2V4DA 4U68A 1FYCA 3TP8A 3PUYA 2R3ZA 2EJGC 3L9AX 1GUGA 1NCVA 2VB3X 1WVLA 1TS2A 2WAQB 1TS4A 4KJOA 1ENFA 4R8IA 2OXPA 1CM9A 3NBHA 1QB5D 1DOLA 1Q1EA 1BO0A 3S15B 2B2YA 3J80E 1BF4A 5ISRA 1IL8A 3HOXB 1SEBD 1Y1WB 1A3VA 2EYFA 2WACA 1L0XB 3NQTA 3GQBA 4A3DB 4O1NA 1SYDA 4CJ2C 2HDLA 4IUUA 1SXTA 2RVLA 5CV6A 2NN6G 3M7GA 3L7ZC 2YU9B 2EVBA 1PMRA 3V2TA 2NVTB 1FNVA 2ICIA 5T1IA 2AWNA 1GHJA 3RZDB 1PXUA 1KDAA 2KJXA 2PW7A 2NVQB 1T5XD 2VXWA 4BA2I 2L11A 5KNDA 4TKOB 3VYUA 1EQVA 4G7ZC 1EEID 1X3PA 2SDFA 3MC0B 1VCIA 4OO1I 2A69C 2KCCA 1JCKB 1LTAD 3OPOA 1ML0D 1OXTA 2KUMA 3J81L 4V190 1I6VC 1H9MA 3K5OA 1A6XA 4M8AA 1V8QA 3KLSX 1MBYA 1JICA 1I50B 5E3FA 4KHZA 3OHXC 1Z6HA 5IT9E 3AU7A 4NMZA 5CMDA 5TSSA 3D4DA 1LT4D 4DGZA 2QILA 3H09A 2RKSA 2DN8A 1E0BA 4QF4A 2HQEA 4A3IB 4FF2A 3BYYB 4L6TB 1HUNA 1B53A 1BCPD 4B9WA 3OWFA 3I72A 3H91A 3S1NB 2E2DC 4EQNA 4QUCA 1HA5A 2EJFC 5FLXE 5I2YA 3HOYB 4DF7A 1RD9D 1ET6A 2ENBA 2B2WA 4FXGC 1RKNA 3S1MB 1S5ED 3PO2B 3FRPB 3TN2A 4CHTB 1PLFA 1NUCA 3TZDA 1TVXA 1GJXA 3GTLB 5FO8B 4KHVA 1ILQA 3ITPA 4EGVA 5C4HA 3SK4A 4WRDA 4AYBB 1H9SB 1S4ZA 3T51B 1CFMA 5KNCA 4ME5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SNP A;  2SOB A;  3P75 A;  5EGT A;  3T16 A;  4RKB A;  3TP8 A;  4E6I A;  3C1F A;  5KYI A;  2F0S A;  2PYK A;  3D6C A;  3SK8 A;  2PZU A;  3BDC A;  1A2U A;  5EKK A;  5IGD A;  4YIJ A;  3S9W A;  1F2M A;  2EYP A;  1EY4 A;  2KHS A;  5HUR A;  1F2Z A;  3QOL A;  4KV6 A;  4KJO A;  1STH A;  2NUC A;  2O4X A;  4IUN A;  4N9P A;  4PNY A;  5IGC A;  5C3X A;  3EJI A;  2RDF A;  5CV5 A;  1KAA A;  4ODG A;  2F0G A;  1EYC A;  3P1H A;  4F8M A;  5JOB A;  2OXP A;  4HMI A;  3NK9 A;  3SXH A;  4PMC A;  4TRD A;  4IAL A;  4DU9 A;  5IIF A;  1SNQ A;  4K5V A;  2OF1 A;  2PZW A;  3QB3 A;  4K8J A;  3U9O A;  3D4W A;  5E3F A;  1ENC A;  5NUC A;  1SNO A;  2PQE A;  3MHB A;  5C3W A;  1STG A;  1NSN S;  3MXP A;  3TP5 A;  4NKL A;  4J1M A;  2F0V A;  3NXW A;  5ISR A;  5CGK A;  2F0U A;  3EVQ A;  1A3V A;  3H6M A;  5E1F A;  5CV4 A;  2F0N A;  3T13 A;  1SYF A;  2EYF A;  2PZT A;  1EY0 A;  2RBM A;  2WAC A;  3NQT A;  3MEH A;  4ID6 A;  3NHH A;  2F0O A;  2F0D A;  3ERQ A;  4NMZ A;  4R8N A;  5I9P A;  4NP5 A;  3SK5 A;  4F7X A;  3D4D A;  2F0J A;  2F3V A;  4DGZ A;  3DMU A;  4K8I A;  2EXZ A;  1II3 A;  4S3S A;  4K5X A;  2F0P A;  5F2D A;  1EY9 A;  4K14 A;  1SYB A;  5CR3 A;  5J1Z A;  1SNC A;  4KY7 A;  4B9X A;  4EQP A;  5KGU A;  5J22 A;  1SYD A;  4NDX A;  5IGG A;  2EY1 A;  2EYL A;  2F0W A;  2F0T A;  2OEO A;  1IHZ A;  2RKS A;  5C5L A;  4K6D A;  1A2T A;  4QF4 A;  2F0L A;  2HQE A;  4H7B A;  1STY A;  1ENA A;  4K2L A;  1TQO A;  4KD4 A;  5CV6 A;  2F0E A;  2F0I A;  5IGB A;  1JOQ A;  1STA A;  3C1E A;  5CV9 A;  4K2K A;  4QB4 A;  5EKL A;  1TT2 A;  4EVO A;  1TR5 A;  4IZ8 A;  1U9R A;  4ZQ3 A;  5JAV A;  3OWF A;  2F0H A;  5DEH A;  4B9W A;  4KTA A;  5KYL A;  1SYG A;  3OSO A;  5M9O A;  3VA5 A;  2F0K A;  4LAA A;  5I9O A;  3D8G A;  4KY6 A;  1EY5 A;  4PMB A;  3R3O A;  4QMG A;  4EQN A;  5HGT A;  2QDB A;  2EYH A;  3V2T A;  5KRU A;  1JOR A;  5IGE A;  1A3T A;  1KDB A;  1KDC A;  2F0F A;  1SND A;  3TP6 A;  2F3W A;  5KIX A;  3E5S A;  4DF7 A;  3SK6 A;  1SNM A;  4G57 A;  4KY5 A;  1F2Y A;  4HTH A;  1AEX A;  2ENB A;  3OMC A;  3TME A;  5C5M A;  2EYJ A;  5IGF A;  3SR1 A;  1EY7 A;  1RKN A;  3PMF A;  2M00 A;  5KEE A;  4WOR A;  3NP8 A;  1KAB A;  5I6W A;  2LKV A;  3BDL A;  5C4Z A;  5IOD A;  1NUC A;  3TP7 A;  4I65 A;  3HZX A;  1EY8 A;  2EY6 A;  3MVV A;  4EQO A;  3NUC A;  1A3U A;  2EYM A;  2F0Q A;  1STN A;  4KHV A;  4J6H A;  3ERO A;  1KDA A;  3ITP A;  3QOJ A;  2PW7 A;  3MZ5 A;  4OL7 A;  5DAU A;  3SK4 A;  2KQ3 A;  5C4H A;  1SYC A;  4HMJ A;  1STB A;  5CV7 A;  4WRD A;  4MIU A;  1EZ6 A;  2EYO A;  2SNS A;  3OMG A;  4K5W A;  4RKL A;  5CC4 A;  5I6Y A;  5J39 A;  2EY2 A;  3DHQ A;  4ZUI A;  5C6A A;  5IOC A;  1SYE A;  1JOK A;  2EY5 A;  1EYD A;  3SHL A;  1EZ8 A;  4KJN A;  2PW5 A;  5CV8 A;  1EY6 A;  4ZUJ A;  3LX0 A;  1JOO A;  2SNM A;  5K5P A;  1EQV A;  4ME5 A;  4KD3 A;  4N9T A;  3RUZ A;  1EYA A;  2F0M A;  3HEJ A;  4DFA A; 
#chains in the Genus database with same CATH topology
 1D7Q A;  4IUR A;  2G9H D;  2NTS A;  4DKA C;  4BBS G;  2F0S A;  3D6C A;  2JEB I;  3X3M A;  3H3V C;  3S2H B;  4RWS C;  2WIN B;  2MNA A;  4R4C A;  3TQY A;  2XTI A;  1K0S A;  3KLW A;  1QVC A;  2O4X A;  2DNE A;  1N34 L;  1CKO A;  4X3T A;  2E5L Q;  2PMZ E;  2H4O A;  5JEA G;  1Y14 B;  1KRT A;  3ERS X;  3P1H A;  1HZC A;  2RDH A;  3FDT A;  5I4D A;  5IE8 A;  1W6J A;  1NR4 A;  3I4M B;  1HNW L;  1IBM L;  3DWQ A;  4J15 A;  1E2W A;  1PZJ D;  4PZ6 A;  1STG A;  4FDB A;  3TP5 A;  1D2B A;  1X3Q A;  1C8C A;  1GUW A;  5M3F G;  2K03 A;  5IYD H;  2PI2 A;  2HCC A;  1Y8N B;  2Q8T A;  2ALY B;  2QKI C;  3A7A B;  4HCS A;  2YYZ A;  1Q81 C;  1S72 A;  2LSS A;  3R93 A;  2X6L A;  4JI7 Q;  4BY1 H;  3SE0 A;  4JC0 A;  1VQM A;  1UNS A;  2AUJ D;  3DWA A;  2L9H A;  5COY A;  5C0X I;  5A35 A;  2F0T A;  4DK6 C;  1I3Q H;  3H94 A;  4F87 A;  3EN2 A;  4JBK A;  3I70 A;  3HOW H;  4A3F B;  5J3B A;  1CZW A;  2F1M A;  2J0T D;  4JV5 L;  4KD4 A;  1EIY B;  1CKM A;  1U4P A;  3EQL C;  2E2H B;  1JJ2 A;  4QB4 A;  3OW2 A;  2JA5 H;  1ICF B;  3FMC A;  5FOB B;  5KYL A;  1SYG A;  1SN8 A;  5E7N A;  4BBS B;  3ZYY X;  3BVG A;  3K59 A;  1XMO Q;  1XXG A;  2A6E D;  1HFG A;  1RJT A;  3A5Z B;  4B08 A;  4X62 L;  1V9P A;  1B3Q A;  2ZM6 L;  1N32 L;  2IJ0 A;  2RSN A;  2E2J B;  2R61 A;  1B4O A;  1RTN A;  1WFQ A;  2DY8 A;  2E2I H;  2E5L L;  1YZ6 A;  3TP7 A;  3VR4 A;  1I94 L;  1WD1 A;  2NVX B;  3PIO A;  4LF5 Q;  5M3F B;  3FPU B;  3N52 A;  1A0I A;  4IUV A;  4RGO S;  1SMX A;  1VQN A;  1W6K A;  4K5W A;  3OYY A;  4FF3 A;  4GNX A;  4NXN L;  1IZ6 A;  2CHB D;  3VYR A;  2Q2I A;  4RHS A;  3JAM E;  1EZ8 A;  3UI2 A;  5K5P A;  1PYS B;  3CU7 A;  1PRT D;  5K36 H;  4DR4 L;  2RF4 A;  5M3M G;  2R7F A;  1FNW A;  5M5W B;  4DV7 L;  2KCT A;  1QE6 A;  2BCO A;  2R93 H;  3I7F A;  4YIJ A;  1XWE A;  2EYP A;  4B3R Q;  1KLU D;  1VQC A;  3STB D;  1PZI D;  2KHS A;  1D1K A;  3N6R A;  3QOL A;  4KV6 A;  4MHE A;  2NUC A;  1G91 A;  4CKB A;  3QO2 A;  3CCE A;  2ZXP A;  1A15 A;  1TWH B;  2F0G A;  2A6H D;  4O0A A;  1TWF B;  1FL0 A;  3NK9 A;  2PO4 A;  4B3S Q;  2JXM B;  4PV1 C;  5IP9 H;  2VQF L;  4KHP L;  1LAB A;  4IOC A;  1B9N A;  1KQS A;  2TMP A;  3I56 A;  1L2F A;  4UP7 A;  1G2T A;  3HOU H;  2C5C A;  4B3T Q;  2UU9 Q;  3MEH A;  2K4K A;  4NP5 A;  2ASB A;  3BS1 A;  1TXY A;  2HIV A;  2MJ8 A;  1SYB A;  4EQP A;  4IJH A;  3HG9 A;  3KDF B;  4NDX A;  3PUV A;  3HRZ C;  1YIT A;  1CI3 M;  3CCM A;  1ET9 A;  1TKW B;  3CC7 A;  4LF6 Q;  1I6H H;  2KCN A;  1ZYR D;  3P20 A;  1YNJ C;  3RD4 A;  1NNX A;  1IKM A;  4OWT B;  5EKL A;  1JB7 A;  1H9S A;  1QZG A;  5M3M B;  3EFX D;  1J6Q A;  2QEX A;  2KEN A;  1M1K C;  4QMG A;  1VQ4 A;  2CWA A;  3I55 A;  1JMC A;  4HJ8 A;  4LFC L;  1DZ1 A;  2UUC Q;  1SNM A;  4O42 A;  2EQS A;  2F52 A;  2O5J C;  3S14 B;  1MSH A;  4C2M B;  5IOD A;  1WTH A;  2LKV A;  3BDL A;  3K7A B;  1IKL A;  1UAP A;  4C3I G;  4DR5 Q;  3MZ5 A;  4LJZ C;  1BBX C;  2VS1 A;  2F4V L;  2JK8 A;  1WTP A;  1EZ6 A;  1SBB B;  4H0L C;  4LF7 L;  3H0G G;  1I4G A;  4NW2 A;  4DUY Q;  2WV6 D;  3ER0 A;  1VQO A;  1CHQ D;  2K6A A;  4ZUI A;  5C6A A;  3RZO H;  1CZG A;  3MA2 B;  1XMQ Q;  4B3T L;  3PUX A;  3M4O B;  2B3G A;  4ZUJ A;  1EY6 A;  3LX0 A;  2SNM A;  4JG2 A;  1CSP A;  1F9S A;  4N9T A;  1E7Z A;  1EYA A;  5EQ0 A;  2ZXR A;  2F0M A;  3I4N H;  4IPH A;  4PQX A;  4YY3 Q;  2KHI A;  4LUO A;  1PDQ A;  1D6E C;  4BY7 G;  3DEO A;  3OOC A;  4JI5 Q;  2N49 A;  5ELE A;  1XTC D;  3J80 L;  2G9D A;  3X3N A;  1VS0 A;  4A93 H;  1L0W A;  1G51 A;  3EJI A;  3HOZ G;  1NY4 A;  5EPK A;  1KAA A;  2WAQ E;  2K5Q A;  1EYC A;  2L15 A;  2JA8 G;  1QNK A;  3KLR A;  4NXM L;  1PYW D;  3NEL A;  3UDF A;  3QB3 A;  4YWL A;  3Q22 A;  1MKH A;  3S17 B;  2F0V A;  3GO5 A;  1PTO B;  2K33 A;  1T5E A;  2N55 A;  3VYT A;  4A3B H;  2EE1 A;  2PZT A;  1K28 A;  1EY0 A;  3D3R A;  4B3M Q;  2F0D A;  3NE5 B;  4C3I B;  2OQK A;  1JWM D;  3M4P A;  4UDU C;  5C5L A;  1RTO A;  3H0G B;  2IHF A;  1V1O A;  3FEW X;  3GDE A;  4ILW A;  3HS0 C;  1ILP A;  1YHQ A;  5JEA J;  2L5T A;  2B2Y C;  1NMG A;  3GTQ B;  2K5H A;  1XJV A;  4KK7 A;  3E3X A;  1UE7 A;  1BR9 A;  4KY6 A;  4PMB A;  1R9T H;  4BY7 B;  1X54 A;  2EYH A;  1TU2 B;  4K6L A;  5EPJ A;  1HFN A;  1A3T A;  4O2D A;  1CA6 A;  1SND A;  1X3E A;  5DNF A;  2BA0 A;  4WFN 3;  4HTH A;  1AEX A;  3SVM A;  1UE6 A;  3G4S A;  1C7Y A;  3HOZ B;  2JA8 B;  2B39 A;  2F03 A;  1PV4 A;  4QJF A;  1O80 A;  2JYO A;  4GKK Q;  3S1R H;  2XSC A;  2IHE A;  1TY0 A;  4H44 C;  2LS0 1;  2EYM A;  1J8I A;  2I46 A;  1ICW A;  3BZD B;  5DAU A;  4OWW B;  2KQ3 A;  1HNX Q;  2CCZ A;  4IJL A;  2EYO A;  4QCL A;  3JC6 6;  3FKI G;  4C1N I;  5C4X H;  4GZY C;  1SYE A;  2ZT9 C;  4B3M L;  2HD3 A;  2I5M X;  2CFM A;  3U4V A;  4OWX B;  2PYK A;  2H5X A;  5C3E H;  5IGD A;  2R92 G;  2L4N A;  2NBF A;  2HQL A;  5T1G A;  4LF8 L;  4UAI A;  1YNX A;  5IT9 L;  4FF4 A;  1L1O C;  1I4X A;  2ZXO A;  2X69 A;  4JI8 Q;  1V1P B;  4F8M A;  4X3U A;  4P71 A;  4IAL A;  1SNQ A;  3MEF A;  4LFB Q;  4JOI C;  2PQE A;  1EU3 A;  2Y0S G;  3S1Q H;  3TSS A;  1IYJ B;  1WTQ A;  4I7Z C;  3G6E A;  2WII B;  1GXD C;  3H6M A;  3DUZ A;  4JBM A;  1JJC B;  3GTO B;  3NHH A;  3OW7 A;  4DA2 A;  4DR6 Q;  3DMU A;  1KC8 C;  1Q82 C;  4DAV A;  2N88 A;  2KHJ A;  2UUB Q;  3FKI B;  1A2T A;  2XGT A;  5FLX L;  3SDZ A;  4Q5V A;  2ATW A;  1DOK A;  1HNX L;  4GOP B;  3OIQ A;  1MGS A;  2EPB A;  1DM0 B;  3OIP A;  5GQO A;  1N36 Q;  2C9O A;  2L0C A;  2F0H A;  1ZXT A;  5M9O A;  4V0B A;  3TRE A;  2CQA A;  5GAD C;  2R92 B;  3HP3 A;  5KIX A;  3J7Z C;  4FO2 A;  4DV4 Q;  3GTG H;  1F2Y A;  3OMC A;  4C3J G;  5C5M A;  3A7L A;  5IGF A;  4IFD H;  4IPG A;  4KKU A;  3Q23 A;  2B63 H;  1NE3 A;  5FO9 B;  5LHY 1;  1BCP C;  2MO0 A;  4EQO A;  2Y0S B;  1VQF A;  1HPC A;  1X6O A;  3M4Q A;  3ERO A;  5EBC A;  3OTO Q;  4OL7 A;  4OO1 G;  4FP5 D;  4XIG S;  3D6W A;  5M5X B;  1JWU D;  1BXT A;  3HKZ G;  4KKS A;  4GOP C;  5IP7 G;  1LTR D;  2ZTD A;  4ALP A;  1G6Z A;  2DGY A;  1QVG A;  2B2W C;  4HIO A;  4UP8 A;  2J4X A;  2RQX A;  3C1F A;  4LF9 Q;  3A0J A;  4JI0 Q;  3AMU A;  2UUB L;  2VW9 A;  1BBU A;  1AE2 A;  1VQH A;  5C4J B;  3CCR A;  1LUZ A;  1X56 A;  3NSW A;  4HJ9 A;  1UE5 A;  4DR3 L;  3KBX A;  1CQV A;  3VR3 A;  3BJU A;  2HHH L;  3E6Z X;  2MHV A;  1NJI C;  1YBY A;  4K0K L;  3K81 C;  4DAY A;  4C3J B;  3I4O A;  1N33 L;  2IW3 A;  1PA6 A;  1I5F A;  1WI5 A;  4L5Q A;  3MHB A;  3MXP A;  4DR1 Q;  3S15 H;  5CGK A;  5E1F A;  3HOX H;  3MXN B;  4QL5 A;  1LO5 D;  1Y1W H;  4HAE A;  3K5N A;  3ERQ A;  5I9P A;  4XQJ A;  3KJO A;  4A3D H;  1O7Y A;  1VF7 A;  4R4Q A;  4QGU A;  1DON A;  1STE A;  1MJC A;  2E76 C;  1LYL A;  4F88 A;  1H9K A;  1LT3 D;  1LAC A;  3HKZ B;  4J8Q A;  2F0L A;  2CVR A;  4LF4 Q;  2EZV A;  1SMY D;  1EUJ A;  2D5D A;  3URY A;  4JBJ A;  3KBG A;  4IO9 A;  3IFT A;  1Z7T A;  1TT2 A;  2UUA L;  1RHP A;  1TR5 A;  3FP9 A;  5G3L F;  3J81 c;  2YU9 H;  4YCU A;  5FO7 B;  1HCZ A;  2BOS A;  2QDL A;  4A3E G;  1UE1 A;  5GRO A;  1KDC A;  2HDM A;  2NVT H;  3MTS A;  4FVM A;  4LF9 L;  4X65 L;  1WYD A;  2BA1 A;  3M4Y A;  1U4L A;  2XWB B;  2M00 A;  3A8I E;  1MIU A;  1EQT A;  1Q86 C;  3LGJ A;  3NP8 A;  1KAB A;  3RZD H;  3JAM L;  3HZX A;  1N34 Q;  1GVP A;  1D1I A;  3I8Z A;  1A3U A;  1CQF A;  2CH4 A;  2RA4 A;  2F0Q A;  1XPR A;  3DM1 A;  2PCF B;  1EIF A;  3PF5 A;  2K52 A;  2A6E C;  2I5H A;  1IBM Q;  2O2L D;  1STB A;  4P75 A;  2NVQ H;  2XRQ D;  1SSO A;  2NZH A;  1QWY A;  3U9S A;  5ELO A;  1PTO F;  4CJ1 B;  3I4M G;  1JOK A;  3E9H A;  3CCV A;  4KJN A;  2NTT A;  4POG A;  5DLQ E;  2KOL A;  4KI0 A;  2UXB L;  1SJH D;  1VQ9 A;  3P75 A;  3A5U A;  2NWG A;  1BUV T;  4RGM A;  3DM3 A;  1VMC A;  3BDC A;  2NN6 H;  2DY7 A;  1TWA B;  1CUK A;  5JJZ A;  1QZH A;  1VQ8 A;  4JV5 Q;  3ULP A;  4IUP A;  4Q0F A;  2YTY A;  4IUN A;  1DYQ A;  1P16 A;  5C3X A;  4A3E B;  4HN7 A;  1Q8K A;  4GNX C;  5JOB A;  1PRT C;  5LMU L;  1TWC B;  5C0X G;  1XNQ Q;  3J7A F;  2JN4 A;  1QOH A;  5E4W C;  4ZKC B;  2KA7 A;  3W2D A;  3CQZ B;  3KF6 A;  2EOT A;  4X62 Q;  2ZM6 Q;  2N78 A;  5CV4 A;  1N32 Q;  1SYF A;  3STB C;  3PO3 G;  4R8N A;  4X66 Q;  3NTI A;  3SK5 A;  2PQA A;  3K80 C;  2AQ3 B;  2F0J A;  2WKD A;  4X64 L;  3KF8 B;  2EXZ A;  1K73 C;  5J1Z A;  1EY9 A;  1O78 A;  3ONA B;  5IP9 G;  4KY7 A;  2A6H C;  4JI6 Q;  5IGG A;  2JA7 G;  2VB2 X;  1FNU A;  4DR7 L;  4ZRZ A;  3MFY A;  1I94 Q;  2CH4 W;  3VA7 A;  3BZK A;  2JA6 G;  2F0I A;  3M3Y B;  3O13 A;  4K2K A;  4A3I H;  2JEA I;  3NTK A;  1KNE A;  2TSS A;  4NXN Q;  5D3I B;  1PZK D;  2ZTC A;  4LFA L;  3S1N H;  3I3C A;  1K0R A;  2QEJ C;  2QDB A;  4TSS A;  1LLR D;  1O7I A;  4WJ3 M;  1JOR A;  3R2I A;  1PFM A;  2F0F A;  3TDQ A;  4DR4 Q;  1QUQ B;  4A3J G;  4A3C H;  2MUY A;  1QNU A;  3I4L A;  3HOY H;  4FF1 A;  4DV7 Q;  1ZYR C;  1EOV A;  2K28 A;  5KEE A;  4R9W A;  2B2V A;  3T4A C;  3S1M H;  3PO2 H;  2IPK D;  3Q0A A;  4XYO A;  1LTS D;  4I65 A;  3IL8 A;  1EQQ A;  4YCW A;  3GTJ B;  3IFD A;  3GTL H;  2A73 B;  1XNQ L;  2Z0S A;  4JBW A;  2QGQ A;  2Q8I B;  2JP1 A;  2VQF Q;  3PO3 B;  4KHP Q;  3OMG A;  4DR2 L;  2EY2 A;  5IYB H;  2Z1C A;  4BBR G;  4X66 L;  2JA7 B;  2HUG A;  3Q8D A;  4KN7 C;  1K83 B;  2ID0 A;  4JI2 Q;  4X3K A;  2Q8R E;  4DAP A;  5CBE E;  4JI6 L;  2K5W A;  1LTT D;  2JA6 B;  3BYT B;  2EDG A;  4RGT A;  4C56 C;  1CKN B;  5IY0 A;  4UHV A;  1F2M A;  3S2H H;  1MHW C;  1K8G A;  1HTP A;  1I4Q A;  2K5V A;  5IGC A;  3L2P A;  1VQ7 A;  5CV5 A;  4Y52 H;  4A3J B;  3SXH A;  2AQ1 B;  4DN4 M;  2OF1 A;  3RLF A;  2MP1 A;  4ZK9 B;  1J5E L;  5NUC A;  1ROD A;  1VQP A;  1AH9 A;  1I4H A;  3W1G A;  2BE5 D;  3PIP 3;  4LFC Q;  4DV3 Q;  2RHS B;  1WTO A;  4XTC S;  4X6A H;  1Y8O B;  4ZCK A;  4S3S A;  2O5I C;  1D5Z C;  1NBW A;  2K04 A;  2F0W A;  2OEO A;  1VQK A;  1K3R A;  4K6D A;  1Q8I A;  3CC2 A;  2NZO A;  4H7B A;  4GLX A;  1VMP A;  1SE3 A;  1AFP A;  3HGB A;  2A1A A;  4BBR B;  5IYC G;  4A3F H;  2F4V Q;  4LF7 Q;  1NTG A;  1A8V A;  1HTL D;  1UEA B;  1M8A A;  1YNN D;  3PUZ A;  5HGT A;  2UXD L;  1G8Z D;  4GN3 B;  4BBS H;  4JI2 L;  3TP6 A;  4DK3 C;  2N8N A;  4APV A;  2QW7 A;  4G57 A;  2A68 D;  4UP9 A;  4GKJ L;  1WCM G;  3AFP A;  1SE4 A;  3U58 A;  5JEA H;  2E2J H;  1SAP A;  3CD6 A;  1IYV A;  3NUC A;  1J9O A;  2P5Z X;  3D0F A;  3LNN A;  3QOJ A;  2NVX H;  4NXM Q;  1OXX K;  5LMN L;  5M3F H;  2N3S A;  4C3H G;  3W5O A;  3IKJ A;  2FJ2 A;  4RKL A;  3CCQ A;  2ZJR A;  1G6P A;  3DHQ A;  2Z4H A;  4DV3 L;  2EY5 A;  3SGI A;  1EYD A;  1R4P B;  3RR5 A;  3GTM B;  3S16 B;  2B29 A;  1JOO A;  3VR5 A;  4Y7N B;  1PFS A;  5CYU A;  1SNP A;  1X55 A;  3T16 A;  4HJ5 A;  4U67 3;  1HHV A;  1YI2 A;  1TWG B;  5M5W H;  1B44 D;  1VQG A;  5EJW A;  4RAU C;  3A55 A;  4A3G G;  1ONL A;  3A8J E;  3F1Z A;  4HMI A;  1TWH H;  1TWF H;  3KYH C;  4K8J A;  1BNZ A;  2A19 A;  1BQQ T;  3K5M A;  4OHJ A;  1E3P A;  1QUQ A;  1WCM B;  2IL8 A;  2KBN A;  3NXW A;  4CKC A;  3RN2 A;  2F0U A;  2WKC A;  2ZTE A;  2B2T A;  3K0Y A;  4QIW B;  3T13 A;  1CSQ A;  4BA1 I;  1HXY D;  1XPU A;  1CTM A;  4K8I A;  4K14 A;  3R8B A;  4B9X A;  5ELF A;  2BH2 A;  4IUQ A;  4C3H B;  2JSO A;  2R7Z G;  2MO1 A;  4L8J A;  4GLV B;  2XN9 C;  2F3I A;  2I0Q A;  1ENA A;  2LXK A;  2F0E A;  4IUT A;  3J80 c;  1Y69 U;  1N9W A;  4IQZ A;  1FD7 D;  2NZ1 D;  4ZQ3 A;  3VYS A;  3F2D A;  4HIM A;  5M3M H;  2JE6 I;  5C0X J;  1LTG D;  2IY5 B;  2NVY B;  1VDZ A;  3G6J B;  4A3K G;  4GS3 A;  2FFK B;  2L1B A;  2EYJ A;  3TME A;  2VUM G;  2XNA C;  4OIJ A;  4A3G B;  4WOR A;  1L0Y B;  2VNU D;  1UUP A;  3G71 A;  2F4I A;  3S14 H;  4LF8 Q;  5C4Z A;  2CW0 D;  1SRO A;  4C2M H;  2WP8 J;  1SFO B;  3T1H L;  2IT1 A;  3K7A H;  3S2D B;  1HR0 L;  2H1E A;  4YCV A;  1WD0 A;  1G29 1;  4IFD G;  2FMM A;  1Q46 A;  2Y0S E;  4X3S A;  1XX8 A;  2BDN A;  2K32 A;  2Z6K C;  1B1Z A;  2M9V A;  3MWY W;  3UE1 A;  1L1O B;  5CV8 A;  1EYG A;  3M4O H;  2Q2U A;  2R7Z B;  1VQI A;  2Z6B A;  4XT3 B;  2JQO A;  1VQ5 A;  3PQI A;  4RKB A;  1KHI A;  5AFW A;  2LMC B;  5M5Y B;  4YWM A;  3MXU A;  2ES2 A;  3S9W A;  3DWP A;  3AB9 A;  1D5X C;  2L12 A;  3A54 A;  4GN4 B;  1S40 A;  3L3O C;  4PNY A;  1KRS A;  3M85 A;  1EWC A;  1VQE A;  2B8G A;  4JPB W;  1X65 A;  4DUZ L;  4A3K B;  1MSG A;  2R6G A;  4DU9 A;  4K5V A;  3RLO A;  3D4W A;  4DK1 A;  2VUM B;  5C3W A;  3ND9 A;  5FJ8 G;  2LXJ A;  4RCN A;  3S17 H;  4QQB X;  1ASY A;  2B2U A;  3KDF A;  1PTO H;  4IFD I;  1EIG A;  2XIW A;  3BVM A;  1HNZ L;  2OTL A;  2DJG C;  1II3 A;  5F2D A;  3HFZ B;  1MJE A;  2UXC L;  3GV3 A;  3LWU A;  4C3I H;  1PH7 A;  2DUD A;  5E4X A;  1HQM C;  4XT1 B;  1HJP A;  1IHZ A;  4XQQ A;  2AKW B;  3H0G H;  2PNR C;  3W1B A;  1K9M C;  1X3F A;  4BXX G;  1STA A;  3HKZ E;  4JW0 A;  4ZLT F;  4A4I A;  3F2C A;  4RCO A;  1Y1V G;  4EVO A;  4DV6 L;  3J81 i;  2R7D A;  5IT9 c;  1U9R A;  1WJJ A;  4JI1 L;  3GTQ H;  5FLM G;  1BCP B;  3UDX A;  3RLN A;  2QCP X;  4BY7 H;  1KDB A;  4R4O A;  1IW7 D;  4LWC A;  1MI2 A;  1C0A A;  4PG3 A;  4A76 A;  4AH6 A;  3G7L A;  4ZAI A;  4G7H C;  1C4Q A;  3PMF A;  4LMQ D;  3HOZ H;  4HJA A;  2WB1 G;  3K57 A;  4YWK A;  2JA8 H;  4HJ7 A;  2B8F A;  2GA4 B;  4DR3 Q;  2EY6 A;  1JE5 A;  3HOV G;  3CCL A;  2K7V A;  4J6H A;  2HHH Q;  5BN5 A;  3E9I A;  4ZYS A;  4NPS A;  4K0K Q;  1X3G A;  1N33 Q;  5G3L D;  1ESR A;  2SNS A;  3RMH A;  5I6Y A;  1EU4 A;  5IOC A;  1AN8 A;  4A75 A;  1FJG L;  3NEM A;  2XRS D;  1SLJ A;  5C44 G;  1EQR A;  1K3B C;  2FHT A;  4Z9C B;  4E6I A;  3DEP A;  5A2Q E;  4A3L G;  4FYD A;  1IXR A;  3TS0 A;  2AWO A;  3P7J A;  1Y1V B;  1KD1 C;  2A5H A;  1EY4 A;  1EWH A;  4HCE A;  5ELN A;  3GTK B;  4DK0 A;  1LTB D;  1HA6 A;  3M7N A;  1O7L A;  2Q2T A;  3MFG A;  4OXP A;  5BN4 A;  3K6O A;  2UUA Q;  1QCB D;  5GAE C;  1SJE D;  5DM7 3;  1PTO D;  1PH4 A;  5EAY A;  4L5S A;  5JPN C;  3G48 A;  4J1M A;  4ABN A;  5KNB A;  5EBD A;  4IPD A;  1XTD A;  4A3M G;  2WB1 B;  1KNA A;  4X65 Q;  1FR3 A;  2F0O A;  3HOV B;  3V05 A;  3GTO H;  2F3V A;  4C1N K;  1UWV A;  2LY7 A;  4RFB A;  1FGB D;  1AZQ A;  4DV2 L;  1JT8 A;  1G2S A;  1STY A;  2X6G A;  1WOC A;  4JYA L;  1Y8P B;  4BWG B;  4CDE C;  1XNR Q;  4HSP A;  4OX9 Q;  4YHH Q;  2K01 A;  5C44 B;  1KLG D;  4IZ8 A;  2HT1 A;  1H9J A;  1LTI D;  5JAV A;  2D9U A;  3CCS A;  3SEB A;  1SDF A;  3J7A 5;  1ZKO A;  3GTP B;  5HGQ A;  1GUO A;  2F3W A;  2K5D A;  2R92 H;  2UXB Q;  3ZJY C;  3A56 A;  1QG7 A;  3ULL A;  4JOI A;  3SR1 A;  2NN6 I;  2D62 A;  3J7Y W;  1AW7 A;  5IYD G;  1VQD A;  3PF4 A;  4IPC A;  3Q24 A;  4BY1 G;  1YEZ A;  1GOZ A;  4AQY L;  3BG3 A;  4A3M B;  1F9Q A;  1JR0 D;  5LMU Q;  2Z4I A;  3A8K E;  4MIU A;  3C3L A;  1HZ9 A;  4CGY B;  3HOW G;  3T1Y L;  3CPF A;  4FNF A;  1RDP D;  3K7U C;  2JA5 G;  3NBI A;  1MD2 D;  4JVZ A;  3EIV A;  3RUZ A;  1JC7 A;  1A62 A;  4MZ9 A;  2IX0 A;  2B2V C;  4X64 Q;  1YJW A;  2SOB A;  4GNX B;  2OT2 A;  1X32 A;  2LFN A;  1PRT B;  4IN3 A;  1NR2 A;  3GD7 A;  5JJK A;  5KYI A;  1E24 A;  2PZU A;  5EKK A;  1V1P A;  2XWJ B;  3V96 A;  3Q6S A;  3KJP A;  4DR7 Q;  1E1O A;  2OCE A;  5C4J H;  4M1U B;  3KK7 A;  2I07 B;  5ELB A;  1TY2 A;  1XNR L;  3K0X A;  3L0O A;  4N8F A;  4OX9 L;  4YHH L;  5EPL A;  1GHK A;  1S5F D;  4JI3 Q;  1EWI A;  1OO9 B;  2D2C C;  3JAM c;  4PMC A;  4TRD A;  4LFA Q;  3BDO A;  1YJ9 A;  4IFD J;  1EFI D;  2PZW A;  1IL2 A;  3VR6 A;  4XYQ A;  4POF A;  3IRB A;  5D65 A;  4C3J H;  3J81 j;  3D31 A;  1FGU A;  4NKL A;  1VQJ A;  5COR A;  4CBV A;  3NWT A;  5FKA C;  3CME A;  4BY1 B;  1OXS C;  4GOP A;  1AZP A;  1PVO A;  3FVQ A;  5CR3 A;  1SNC A;  3T56 B;  5DM6 3;  1I3Q B;  4RH6 A;  5K36 G;  4DV1 L;  4OO1 H;  1N8R C;  1W3S A;  4DPG A;  1WTR A;  3HOW B;  2A74 C;  2K50 A;  4TQU S;  3LWE A;  3MAQ A;  3PIP A;  1EIH A;  1U4R A;  3D4R A;  2R93 G;  2JA5 B;  2BE5 C;  3QJY A;  5IP7 H;  1I50 H;  1Q7Y C;  1DOM A;  4DR2 Q;  2K75 A;  3DXJ C;  4LUV A;  5DEH A;  1KXL A;  3BZC A;  1JB3 A;  4KKT A;  5KRU A;  1Q1B A;  1XYI A;  4EQ5 A;  2E74 C;  1BOS A;  4XXE A;  4UPA A;  1OXU A;  4DXF A;  1JWS D;  4OON A;  5L37 A;  3HOU G;  1U0L A;  2E2I B;  5JPM C;  1EOT A;  1HZA A;  3QR8 A;  2JA9 A;  3HKS A;  3CF5 A;  1EY8 A;  4JI3 L;  1YNN C;  1CA5 A;  1DCZ A;  3QG1 A;  2VZA A;  3CKI B;  2A69 D;  1ESF A;  4CDF C;  1SYC A;  4HMJ A;  4JI4 L;  4PMW A;  1J5E Q;  1SRU A;  2C35 B;  5CC4 A;  2E75 C;  4ULL A;  3H3V H;  2A68 C;  3MXG A;  1NAP A;  3WDN A;  3B6Y A;  3WOF A;  2PW5 A;  4HIK A;  2NYZ D;  4KD3 A;  2K05 A;  5EKI A;  1VQL A;  3HEJ A;  4DFA A;  5EGT A;  2PPB C;  4XDX A;  3UDI A;  4G4K A;  3VR2 A;  1KIX A;  4PZ8 A;  2R93 B;  1A2U A;  2M2L A;  1GD7 A;  2XVS A;  4CKE A;  1KL9 A;  4UY8 C;  1TWA H;  2RHQ B;  1PFN A;  3FHW A;  4ZKB B;  4MTK A;  3CC4 A;  4A3E H;  3MXN A;  1PH3 A;  1BCP F;  3I2Z A;  4DV5 L;  3U9O A;  1TWC H;  2UXD Q;  3TS2 A;  3HOU B;  1I4P A;  1NSN S;  3EVQ A;  2FIN B;  3QWN A;  3CQZ H;  3J81 E;  3DLL A;  1F9R A;  1GUS A;  1HQR D;  4KN4 C;  2K5N A;  3CP0 A;  3QIA A;  4GKJ Q;  1LV9 A;  5BN3 A;  4K5X A;  4QIW E;  1E2Z A;  1GUN A;  1UEB A;  5KGU A;  3ND8 A;  2PNH A;  1BVS A;  4LNQ A;  1PFB A;  2K14 A;  3I4N G;  1I6H B;  1LTL A;  2VL6 A;  2IWH A;  2BDO A;  3J80 i;  2QA4 A;  5LMN Q;  5H1S E;  3I4M H;  1HZB A;  2KED A;  3NEN A;  5CV9 A;  3PSI A;  3CXC A;  4A93 G;  4OGQ C;  3M3Y H;  4QUF A;  1LT5 D;  3TEH B;  2HCI A;  2MPM A;  3OSO A;  2B2T C;  3I91 A;  3WWV A;  3E0J A;  2VY3 A;  4H02 A;  3S24 A;  1RL2 A;  3E5S A;  3CRL C;  3PUW A;  4KY5 A;  1VF5 C;  3NPP A;  1R4Q B;  3GP7 A;  3UE0 A;  1EY7 A;  4JI7 L;  3H15 A;  4A3B G;  2KVM A;  2KCM A;  1K8O A;  2MQH A;  2G5D A;  4L63 B;  2RCN A;  5LMN W;  3FPP A;  1TII D;  1JQY D;  5C0X H;  2E2H H;  3KUP A;  3NTH A;  4RG1 A;  3K58 A;  3GTJ H;  3F8T A;  1A63 A;  4G7O C;  4HR7 B;  3RZO B;  3PO3 H;  2OQ0 A;  3I90 A;  4JK1 C;  3CHB D;  3KLS A;  2AQ2 B;  2KEC A;  1QJO A;  3I4N B;  5AJ3 Q;  2KEE A;  1XMO L;  2CW0 C;  4QY7 A;  2JA7 H;  3T53 B;  1K83 H;  5JVG 3;  4DV0 Q;  5LL6 X;  1M4V A;  4AIM A;  1HUM A;  1F9P A;  4LK1 C;  1KTK A;  2JA6 H;  4A93 B;  2PMZ B;  4MNO A;  3TZU A;  5HUR A;  1HRJ A;  3KOJ A;  1B2T A;  4N9P A;  5D3D A;  4DNR B;  1CHP D;  1JE4 A;  5ELC A;  1Z47 A;  2RDF A;  1XPO A;  1GKH A;  4ODG A;  1IBK Q;  4LF5 L;  1DXM A;  5IIF A;  3PCO B;  4A3J H;  3K5L A;  1B3A A;  4MN3 A;  1RIP A;  1RCV D;  1CT1 D;  3KF8 A;  1BDO A;  1WTV A;  4A3B B;  3AYH B;  3C2P A;  1Q12 A;  2F0N A;  2A8V A;  2AUK A;  2K1B A;  4ID6 A;  4P2C B;  5C4X G;  1KAW A;  1QIL A;  4CJ0 B;  4F7X A;  4RHR A;  1SR3 A;  3IAY A;  4WJ4 A;  5J22 A;  1AP0 A;  1EL0 A;  3PV0 A;  3C46 A;  1ZEQ X;  2EY1 A;  3T1H Q;  4P74 A;  4B3R L;  2NB0 A;  1WTX A;  1YVC A;  5C3E G;  1HR0 Q;  5FK9 C;  5JJI A;  4BS9 A;  3C1E A;  3F2B A;  4BBR H;  3BU2 A;  4HSV A;  4B3S L;  1R9T B;  2F0K A;  2B2U C;  3NBH B;  3WOE A;  1M90 C;  4LAA A;  2OTJ A;  3D8G A;  1EY5 A;  5AJ3 L;  3R3O A;  4H13 C;  5IGE A;  2SEB D;  3PIO 3;  1H9R A;  1PHJ A;  1B8A A;  1W2B A;  3J7A V;  1PRT F;  1DJR D;  4DV0 L;  5HY6 A;  4HID A;  1U4M A;  2UU9 L;  3CCU A;  2Z9H A;  1EFW A;  3CRK C;  4MTN A;  1PH5 A;  2IX1 A;  3AQQ A;  1YIJ A;  3S1R B;  3PGZ A;  1HR0 W;  2RDG A;  3W3A A;  1T9H A;  1IBK L;  4LF6 L;  4FXD A;  1DD2 A;  4DUZ Q;  4FXK C;  4GLA C;  1LT6 D;  5A2Q L;  1IW7 C;  1S5D D;  5C4X B;  1F2L A;  2L55 A;  5J39 A;  2E8G A;  3SHL A;  4RGN A;  1CKN A;  1HNZ Q;  2V1C C;  4HED A;  3GTM H;  3S16 H;  2IX3 A;  5BR8 Q;  2UUC L;  4Y7N H;  1GM5 A;  4NB3 A;  5C3E B;  1JJG A;  2UXC Q;  2ICE C;  3SK8 A;  1B50 A;  4P72 A;  5IYC H;  1EEF D;  1AE3 A;  1TWG H;  1F2Z A;  1VQB A;  1STH A;  4DXG A;  1OTC A;  4WJW A;  2B63 G;  1SE2 A;  4DV6 Q;  2GVA A;  1H95 A;  4DR5 L;  2AMC B;  2BH8 A;  5ELD A;  1P8L A;  3TBI B;  4JI1 Q;  4XQN A;  3I73 A;  2RSO A;  1NMF A;  3S1Q B;  1ENC A;  1SNO A;  1I4R A;  2FMC A;  4DUY L;  3M9B A;  1YNJ D;  4DNT B;  1S5C D;  1V43 A;  2EIF A;  2MGS A;  1XMQ L;  1WCM H;  4ME3 A;  1YHA A;  1S5B D;  2RBM A;  2EJM A;  1RF2 D;  4DAY B;  1C48 A;  5D14 A;  2WB1 E;  4DNI A;  5IWA Q;  2OWO A;  1LM0 A;  2F0P A;  4YY3 L;  5JJL A;  4GN5 A;  4LW1 A;  4JI5 L;  3BVZ A;  2EYL A;  2I5L X;  1PH9 A;  3F2U A;  3NQI A;  4C3H H;  1K8M A;  1PTO C;  4OIK A;  2PI2 E;  4K2L A;  1TQO A;  5JVH 3;  1JOQ A;  5IGB A;  1Q3L A;  1O7Z A;  3CCJ A;  2DNC A;  1E2V A;  2WAQ G;  3NWS A;  1D5M C;  4KTA A;  3VA5 A;  3EA6 A;  4OEL B;  5I9O A;  4R4I A;  3R2T A;  1FJG Q;  5I2X A;  4KMU C;  4R1J A;  3GTG B;  5BR8 L;  2D0O A;  3CW2 C;  3OWE B;  3TRZ A;  4P73 A;  3SK6 A;  1B9M A;  2NVY H;  1F77 A;  1TS5 A;  1CK1 A;  1YHB A;  2B63 B;  3HOX G;  1TS3 A;  3GV6 A;  1Y1W G;  4A3G H;  5I6W A;  3UDG A;  1Q90 A;  1WTW A;  4A3D G;  1DGS A;  3MVV A;  2GN5 A;  4KLK A;  5LL6 S;  1GUT A;  1STN A;  1SFO H;  1GO3 E;  4R4T A;  1IYU A;  2GVB A;  3S2D H;  5CV7 A;  2Z8L A;  2J7Z A;  2QF7 A;  2ZJP A;  1PYB A;  3K8A A;  1B7Y B;  1U5K A;  1OXV A;  1SMY C;  5CBA E;  4RA8 A;  2V4D A;  2Q2H A;  5IWA L;  4U68 A;  1FYC A;  2R7Z H;  3TP8 A;  3PUY A;  3L9A X;  2EJG C;  2R3Z A;  4DV2 Q;  3EBE A;  3ICE A;  1GUG A;  1NCV A;  2CWP A;  2VB3 X;  1VQA A;  5M5Y H;  1WVL A;  1BKB A;  1TS2 A;  2WAQ B;  1TS4 A;  4KJO A;  4GKK L;  4JYA Q;  5FLX c;  1ENF A;  3E0E A;  1PH2 A;  3JAM i;  4R8I A;  2OXP A;  1CM9 A;  2EXD A;  3NBH A;  1QB5 D;  1DOL A;  1BBW A;  4A3K H;  1Q1E A;  1BO0 A;  3S15 B;  2B2Y A;  3J80 E;  2VQE Q;  1BF4 A;  5ISR A;  1IL8 A;  3HOX B;  2VUM H;  1SEB D;  1Y1W B;  1A3V A;  1IBL Q;  2EYF A;  2WAC A;  1L0X B;  3NQT A;  3GQB A;  4A3D B;  2Z6K A;  1Z9F A;  4O1N A;  1FVI A;  3KF6 B;  2JJQ A;  1SYD A;  4EX5 A;  4CJ2 C;  2HDL A;  2PQA B;  4IUU A;  4AQY Q;  1SXT A;  2RVL A;  5CV6 A;  2NN6 G;  3M7G A;  3L7Z C;  4JI8 L;  1D8L A;  2YU9 B;  1SE8 A;  3T1Y Q;  2EVB A;  4LFB L;  1PMR A;  3CMA A;  3CPW A;  3V2T A;  2NVT B;  1FNV A;  2ICI A;  5T1I A;  4AYB E;  4I7A A;  2AWN A;  2WFW A;  1GHJ A;  1YJN A;  4DR6 L;  3FKI H;  3RZD B;  1PXU A;  1E1T A;  2DJF C;  3U4Z A;  2RCF A;  1C9O A;  1E22 A;  2YTX A;  4OEM B;  1KDA A;  5FJ8 H;  2KJX A;  2PW7 A;  1L1O A;  2NVQ B;  1T5X D;  3VDY A;  2VXW A;  2VQE L;  4BA2 I;  2L11 A;  1N36 L;  1K8A C;  5KND A;  2FXQ A;  1IBL L;  4TKO B;  4A3I G;  1HH2 P;  3A74 A;  1V1Q A;  4DAM A;  3VYU A;  1EQV A;  3RNU A;  4G7Z C;  1EEI D;  1X3P A;  4DV4 L;  2SDF A;  3MC0 B;  1VCI A;  3CAM A;  4OO1 I;  2A69 C;  4DV1 Q;  2KCC A;  1JCK B;  1LTA D;  3AFQ A;  1ML0 D;  3OPO A;  4A3C G;  4BXX H;  2YTV A;  3RN5 A;  3HOY G;  1OXT A;  1Y1V H;  2KUM A;  4RMF A;  3J81 L;  3GTK H;  4V19 0;  1I6V C;  4N8X 1;  5FLM H;  5M5X H;  1H9M A;  2D0P A;  3K5O A;  3PO2 G;  1A6X A;  3OTO L;  4M8A A;  1V8Q A;  3KLS X;  1QVF A;  1MBY A;  1S3O A;  2YV5 A;  1JIC A;  1I50 B;  5E3F A;  4KHZ A;  3OHX C;  1Z6H A;  2AHO B;  2CKZ B;  5IT9 E;  4CDD C;  3AU7 A;  4NMZ A;  4AYB G;  3KFU A;  5IYB G;  5CMD A;  5TSS A;  3D4D A;  1LT4 D;  4DGZ A;  3HOV H;  2QIL A;  4L5R C;  3H09 A;  2ZJQ A;  3AEV A;  4JI0 L;  2RKS A;  4LUZ A;  2DN8 A;  1E0B A;  4QF4 A;  2HQE A;  4JCV E;  4A3I B;  4JI4 Q;  4FF2 A;  3BYY B;  4L6T B;  5GAH C;  1HUN A;  1B53 A;  3H3V I;  1BCP D;  3OWF A;  4B9W A;  3I72 A;  4TVA B;  5C44 H;  3H91 A;  3S1N B;  2MFI A;  1HNW Q;  2E2D C;  4EQN A;  1X9N A;  4QUC A;  4DR1 L;  1HA5 A;  4A3L H;  1PH1 A;  2EJF C;  3GTP H;  5FLX E;  5I2Y A;  3HOY B;  4DF7 A;  1RD9 D;  1ET6 A;  2ENB A;  5GAG C;  3ULJ A;  2B2W A;  4FXG C;  1RKN A;  3S1M B;  1S5E D;  3PO2 B;  3FRP B;  1ASZ A;  3TN2 A;  4CHT B;  3U50 C;  1PLF A;  1NUC A;  3TZD A;  1TVX A;  4CDC C;  1PH6 A;  1GJX A;  3GTL B;  5FO8 B;  4KHV A;  4LF4 L;  1ILQ A;  3ITP A;  4EGV A;  4IOA A;  2CQO A;  5C4H A;  3SK4 A;  4PZ7 A;  4A3M H;  4DV5 Q;  2HIX A;  4WRD A;  4AYB B;  4L5T A;  1B70 B;  1H9S B;  4A3F G;  1S4Z A;  3T51 B;  1CFM A;  1PH8 A;  5KNC A;  4ME5 A;  1VQ6 A; 
#chains in the Genus database with same CATH homology
 4IUR A;  2G9H D;  2NTS A;  2F0S A;  3D6C A;  2JEB I;  3X3M A;  3H3V C;  3S2H B;  4RWS C;  2WIN B;  2O4X A;  2DNE A;  4X3T A;  2H4O A;  5JEA G;  3P1H A;  2RDH A;  3FDT A;  5I4D A;  1W6J A;  1NR4 A;  3I4M B;  3DWQ A;  1E2W A;  1PZJ D;  1STG A;  3TP5 A;  1D2B A;  1X3Q A;  1C8C A;  1GUW A;  2K03 A;  2HCC A;  1Y8N B;  2Q8T A;  2QKI C;  3A7A B;  4HCS A;  2YYZ A;  3R93 A;  2X6L A;  3SE0 A;  1UNS A;  2AUJ D;  3DWA A;  2L9H A;  5COY A;  5C0X I;  5A35 A;  2F0T A;  3H94 A;  4F87 A;  3I70 A;  4A3F B;  1CZW A;  2F1M A;  2J0T D;  4KD4 A;  1U4P A;  3EQL C;  2E2H B;  4QB4 A;  3FMC A;  5FOB B;  5KYL A;  1SYG A;  4BBS B;  3ZYY X;  3BVG A;  3K59 A;  1XXG A;  2A6E D;  1HFG A;  1RJT A;  4B08 A;  2IJ0 A;  2RSN A;  2E2J B;  2R61 A;  1B4O A;  1RTN A;  2DY8 A;  3TP7 A;  3VR4 A;  1WD1 A;  2NVX B;  5M3F B;  3FPU B;  3N52 A;  4IUV A;  4RGO S;  1W6K A;  4K5W A;  4FF3 A;  2CHB D;  3VYR A;  4RHS A;  3JAM E;  1EZ8 A;  3UI2 A;  5K5P A;  3CU7 A;  1PRT D;  5K36 H;  1FNW A;  5M5W B;  1QE6 A;  2BCO A;  4YIJ A;  1XWE A;  2EYP A;  1KLU D;  1PZI D;  2KHS A;  1D1K A;  3N6R A;  3QOL A;  4KV6 A;  4MHE A;  2NUC A;  1G91 A;  4CKB A;  3QO2 A;  2ZXP A;  1A15 A;  1TWH B;  2F0G A;  2A6H D;  1TWF B;  3NK9 A;  2PO4 A;  2JXM B;  4PV1 C;  1LAB A;  1B9N A;  2TMP A;  1G2T A;  2C5C A;  3MEH A;  4NP5 A;  3BS1 A;  2MJ8 A;  1SYB A;  4EQP A;  3HG9 A;  4NDX A;  3PUV A;  3HRZ C;  1CI3 M;  1ET9 A;  1TKW B;  2KCN A;  1ZYR D;  3P20 A;  1YNJ C;  3RD4 A;  1IKM A;  5EKL A;  1H9S A;  5M3M B;  3EFX D;  4QMG A;  1DZ1 A;  1SNM A;  4O42 A;  2O5J C;  3S14 B;  1MSH A;  4C2M B;  5IOD A;  2LKV A;  3BDL A;  3K7A B;  1IKL A;  1UAP A;  4C3I G;  3MZ5 A;  4LJZ C;  1BBX C;  1WTP A;  1EZ6 A;  1SBB B;  4H0L C;  1I4G A;  4NW2 A;  2WV6 D;  1CHQ D;  2K6A A;  4ZUI A;  5C6A A;  1CZG A;  3MA2 B;  3PUX A;  3M4O B;  4ZUJ A;  1EY6 A;  3LX0 A;  2SNM A;  1F9S A;  4N9T A;  5EQ0 A;  1EYA A;  2ZXR A;  2F0M A;  4PQX A;  1PDQ A;  1D6E C;  3DEO A;  3OOC A;  5ELE A;  1XTC D;  3J80 L;  2G9D A;  3X3N A;  3EJI A;  5EPK A;  1KAA A;  2K5Q A;  1EYC A;  1QNK A;  3KLR A;  1PYW D;  3QB3 A;  3Q22 A;  3S17 B;  2F0V A;  3GO5 A;  1PTO B;  2K33 A;  1T5E A;  2N55 A;  3VYT A;  2EE1 A;  2PZT A;  3D3R A;  1EY0 A;  2F0D A;  3NE5 B;  4C3I B;  1JWM D;  4UDU C;  5C5L A;  1RTO A;  3H0G B;  1V1O A;  3FEW X;  4ILW A;  3HS0 C;  1ILP A;  5JEA J;  2L5T A;  2B2Y C;  3GTQ B;  4KK7 A;  1BR9 A;  4KY6 A;  4PMB A;  4BY7 B;  2EYH A;  1TU2 B;  4K6L A;  5EPJ A;  1HFN A;  1A3T A;  1CA6 A;  1SND A;  5DNF A;  2BA0 A;  4WFN 3;  4HTH A;  1AEX A;  3SVM A;  3HOZ B;  2JA8 B;  2B39 A;  2F03 A;  1O80 A;  2JYO A;  2XSC A;  1TY0 A;  4H44 C;  2LS0 1;  2EYM A;  1J8I A;  2I46 A;  5DAU A;  1ICW A;  3BZD B;  2KQ3 A;  2EYO A;  4QCL A;  4C1N I;  4GZY C;  1SYE A;  2ZT9 C;  2PYK A;  5IGD A;  2L4N A;  2NBF A;  5T1G A;  4UAI A;  5IT9 L;  4FF4 A;  1I4X A;  2ZXO A;  2X69 A;  1V1P B;  4F8M A;  4X3U A;  4IAL A;  1SNQ A;  2PQE A;  1EU3 A;  3TSS A;  1WTQ A;  4I7Z C;  2WII B;  1GXD C;  3H6M A;  3DUZ A;  3GTO B;  3NHH A;  3OW7 A;  4DA2 A;  3DMU A;  4DAV A;  2N88 A;  3FKI B;  1A2T A;  5FLX L;  3SDZ A;  4Q5V A;  1DOK A;  3OIQ A;  1MGS A;  2EPB A;  1DM0 B;  3OIP A;  2C9O A;  2L0C A;  2F0H A;  1ZXT A;  5M9O A;  4V0B A;  2CQA A;  2R92 B;  3HP3 A;  5KIX A;  4FO2 A;  1F2Y A;  3OMC A;  4C3J G;  5C5M A;  5IGF A;  3A7L A;  4IFD H;  4KKU A;  3Q23 A;  5FO9 B;  5LHY 1;  1BCP C;  4EQO A;  2Y0S B;  1HPC A;  3ERO A;  5EBC A;  4OL7 A;  4OO1 G;  4FP5 D;  4XIG S;  3D6W A;  5M5X B;  1JWU D;  1BXT A;  4KKS A;  1LTR D;  1G6Z A;  2B2W C;  2J4X A;  2RQX A;  3C1F A;  3AMU A;  5C4J B;  3NSW A;  3KBX A;  1CQV A;  3VR3 A;  3E6Z X;  2MHV A;  4DAY A;  4C3J B;  2IW3 A;  3MHB A;  3MXP A;  5CGK A;  5E1F A;  1LO5 D;  4HAE A;  3K5N A;  3ERQ A;  5I9P A;  4XQJ A;  1O7Y A;  1VF7 A;  1DON A;  1STE A;  2E76 C;  4F88 A;  1H9K A;  1LT3 D;  1LAC A;  3HKZ B;  4J8Q A;  2F0L A;  2CVR A;  2EZV A;  1SMY D;  2D5D A;  3URY A;  3KBG A;  3IFT A;  1Z7T A;  1TT2 A;  1RHP A;  1TR5 A;  5G3L F;  5FO7 B;  1HCZ A;  2BOS A;  1KDC A;  2HDM A;  3MTS A;  4FVM A;  2BA1 A;  3M4Y A;  1U4L A;  2XWB B;  2M00 A;  3A8I E;  1EQT A;  3NP8 A;  1KAB A;  3JAM L;  3HZX A;  1D1I A;  3I8Z A;  1A3U A;  1CQF A;  2RA4 A;  2F0Q A;  3DM1 A;  2PCF B;  2A6E C;  2O2L D;  1STB A;  2XRQ D;  1SSO A;  1QWY A;  3U9S A;  1PTO F;  4CJ1 B;  1JOK A;  4KJN A;  2NTT A;  2KOL A;  4KI0 A;  1SJH D;  3P75 A;  2NWG A;  1BUV T;  4RGM A;  1VMC A;  3BDC A;  2NN6 H;  2DY7 A;  1TWA B;  5JJZ A;  4IUP A;  4Q0F A;  4IUN A;  1DYQ A;  5C3X A;  4A3E B;  4HN7 A;  5JOB A;  1PRT C;  1TWC B;  5C0X G;  3J7A F;  5E4W C;  1QOH A;  4ZKC B;  2KA7 A;  3W2D A;  3CQZ B;  2EOT A;  5CV4 A;  1SYF A;  4R8N A;  3NTI A;  3SK5 A;  2AQ3 B;  2F0J A;  2WKD A;  2EXZ A;  5J1Z A;  1EY9 A;  1O78 A;  3ONA B;  4KY7 A;  2A6H C;  5IGG A;  2VB2 X;  1FNU A;  4ZRZ A;  3MFY A;  3VA7 A;  2F0I A;  3M3Y B;  3O13 A;  4K2K A;  2JEA I;  3NTK A;  1KNE A;  2TSS A;  5D3I B;  1PZK D;  3I3C A;  2QEJ C;  2QDB A;  4TSS A;  1LLR D;  1JOR A;  3R2I A;  1PFM A;  2F0F A;  3TDQ A;  2MUY A;  1QNU A;  3I4L A;  4FF1 A;  1ZYR C;  2K28 A;  5KEE A;  4R9W A;  2B2V A;  3T4A C;  2IPK D;  3Q0A A;  4XYO A;  1LTS D;  4I65 A;  3IL8 A;  3GTJ B;  3IFD A;  2A73 B;  4JBW A;  2Q8I B;  2JP1 A;  3PO3 B;  3OMG A;  2EY2 A;  2Z1C A;  2JA7 B;  2HUG A;  4KN7 C;  1K83 B;  2ID0 A;  4X3K A;  2Q8R E;  4DAP A;  5CBE E;  2K5W A;  1LTT D;  2JA6 B;  3BYT B;  2EDG A;  4RGT A;  4C56 C;  1F2M A;  1HTP A;  1I4Q A;  5IGC A;  5CV5 A;  4A3J B;  3SXH A;  2AQ1 B;  4DN4 M;  2OF1 A;  3RLF A;  4ZK9 B;  2MP1 A;  5NUC A;  1ROD A;  1I4H A;  2BE5 D;  3PIP 3;  1WTO A;  4XTC S;  1Y8O B;  4S3S A;  2O5I C;  1D5Z C;  2K04 A;  2F0W A;  2OEO A;  4K6D A;  1Q8I A;  4H7B A;  1VMP A;  1SE3 A;  1AFP A;  3HGB A;  4BBR B;  1HTL D;  1UEA B;  1M8A A;  1YNN D;  3PUZ A;  5HGT A;  1G8Z D;  3TP6 A;  4G57 A;  2A68 D;  1SE4 A;  5JEA H;  1SAP A;  1IYV A;  3NUC A;  1J9O A;  3QOJ A;  3LNN A;  1OXX K;  4C3H G;  3IKJ A;  2FJ2 A;  4RKL A;  3DHQ A;  2Z4H A;  2EY5 A;  1EYD A;  1R4P B;  3GTM B;  3S16 B;  1JOO A;  3VR5 A;  4Y7N B;  5CYU A;  1SNP A;  3T16 A;  4U67 3;  1HHV A;  1TWG B;  1B44 D;  5EJW A;  4RAU C;  3A55 A;  1ONL A;  3A8J E;  4HMI A;  4K8J A;  1BNZ A;  1BQQ T;  3K5M A;  4OHJ A;  1WCM B;  2IL8 A;  3NXW A;  4CKC A;  2F0U A;  2WKC A;  2B2T A;  3K0Y A;  4QIW B;  3T13 A;  4BA1 I;  1HXY D;  1CTM A;  4K8I A;  4K14 A;  3R8B A;  4B9X A;  5ELF A;  4IUQ A;  4C3H B;  2JSO A;  4L8J A;  2XN9 C;  1ENA A;  2F0E A;  4IUT A;  1Y69 U;  4IQZ A;  1FD7 D;  2NZ1 D;  4ZQ3 A;  3VYS A;  2JE6 I;  5C0X J;  1LTG D;  2NVY B;  1VDZ A;  3G6J B;  2FFK B;  2L1B A;  2EYJ A;  3TME A;  2XNA C;  4OIJ A;  4A3G B;  4WOR A;  1L0Y B;  2VNU D;  1UUP A;  2F4I A;  5C4Z A;  2CW0 D;  2WP8 J;  1SFO B;  2IT1 A;  3S2D B;  2H1E A;  1WD0 A;  1G29 1;  4IFD G;  2FMM A;  4X3S A;  1XX8 A;  2BDN A;  2K32 A;  1B1Z A;  2M9V A;  3MWY W;  5CV8 A;  2R7Z B;  4XT3 B;  4RKB A;  5AFW A;  2LMC B;  5M5Y B;  3MXU A;  3S9W A;  3DWP A;  3AB9 A;  1D5X C;  2L12 A;  3A54 A;  3L3O C;  4PNY A;  3M85 A;  1EWC A;  2B8G A;  4A3K B;  1MSG A;  2R6G A;  4DU9 A;  4K5V A;  3D4W A;  4DK1 A;  2VUM B;  5C3W A;  3ND9 A;  4RCN A;  2B2U A;  1PTO H;  4IFD I;  1EIG A;  2XIW A;  3BVM A;  1II3 A;  5F2D A;  3GV3 A;  3LWU A;  5E4X A;  1HQM C;  4XT1 B;  1IHZ A;  4XQQ A;  2PNR C;  1STA A;  4ZLT F;  4RCO A;  4EVO A;  1U9R A;  1BCP B;  2QCP X;  1KDB A;  1IW7 D;  1MI2 A;  3G7L A;  4ZAI A;  4G7H C;  1C4Q A;  3PMF A;  4LMQ D;  3K57 A;  2B8F A;  2GA4 B;  2EY6 A;  2K7V A;  4J6H A;  5BN5 A;  4ZYS A;  5G3L D;  1ESR A;  2SNS A;  3RMH A;  5I6Y A;  1EU4 A;  5IOC A;  1AN8 A;  2XRS D;  2FHT A;  4Z9C B;  4E6I A;  3DEP A;  5A2Q E;  4FYD A;  2AWO A;  3P7J A;  1Y1V B;  2A5H A;  1EY4 A;  1EWH A;  4HCE A;  3GTK B;  4DK0 A;  1LTB D;  1HA6 A;  3M7N A;  1O7L A;  3MFG A;  5BN4 A;  3K6O A;  1QCB D;  1SJE D;  5DM7 3;  1PTO D;  5JPN C;  4J1M A;  4ABN A;  5KNB A;  5EBD A;  2WB1 B;  1KNA A;  1FR3 A;  2F0O A;  3HOV B;  3V05 A;  2F3V A;  4C1N K;  2LY7 A;  4RFB A;  1FGB D;  1AZQ A;  1G2S A;  1STY A;  2X6G A;  1Y8P B;  4BWG B;  4HSP A;  2K01 A;  5C44 B;  1KLG D;  4IZ8 A;  1H9J A;  1LTI D;  5JAV A;  2D9U A;  3SEB A;  1SDF A;  1ZKO A;  3GTP B;  1GUO A;  2F3W A;  2K5D A;  3A56 A;  1QG7 A;  3SR1 A;  2NN6 I;  2D62 A;  3J7Y W;  1AW7 A;  3Q24 A;  1GOZ A;  3BG3 A;  4A3M B;  1F9Q A;  1JR0 D;  2Z4I A;  3A8K E;  4MIU A;  3C3L A;  4CGY B;  4FNF A;  1RDP D;  3NBI A;  1MD2 D;  3RUZ A;  1JC7 A;  2IX0 A;  2B2V C;  2SOB A;  2OT2 A;  1X32 A;  2LFN A;  1PRT B;  4IN3 A;  1NR2 A;  3GD7 A;  5KYI A;  2PZU A;  5EKK A;  3V96 A;  1V1P A;  2XWJ B;  3Q6S A;  4M1U B;  3KK7 A;  2I07 B;  5ELB A;  1TY2 A;  1GHK A;  5EPL A;  1S5F D;  1OO9 B;  2D2C C;  4PMC A;  4TRD A;  3BDO A;  4IFD J;  1EFI D;  2PZW A;  3VR6 A;  4XYQ A;  5D65 A;  3D31 A;  4NKL A;  5COR A;  4CBV A;  3NWT A;  5FKA C;  4BY1 B;  1OXS C;  1AZP A;  3FVQ A;  5CR3 A;  1SNC A;  3T56 B;  5DM6 3;  1I3Q B;  4RH6 A;  5K36 G;  4OO1 H;  1WTR A;  3HOW B;  2A74 C;  4TQU S;  3LWE A;  3MAQ A;  1EIH A;  1U4R A;  3D4R A;  2JA5 B;  2BE5 C;  3QJY A;  1DOM A;  3DXJ C;  5DEH A;  1JB3 A;  4KKT A;  5KRU A;  1Q1B A;  1XYI A;  2E74 C;  1BOS A;  4XXE A;  1OXU A;  4DXF A;  1JWS D;  2E2I B;  5JPM C;  1EOT A;  1EY8 A;  1YNN C;  1CA5 A;  1DCZ A;  3QG1 A;  3CKI B;  2A69 D;  1ESF A;  1SYC A;  4HMJ A;  4PMW A;  5CC4 A;  2E75 C;  4ULL A;  2A68 C;  3MXG A;  1NAP A;  3WDN A;  3WOF A;  2PW5 A;  2NYZ D;  4KD3 A;  2K05 A;  5EKI A;  3HEJ A;  4DFA A;  5EGT A;  2PPB C;  4XDX A;  4G4K A;  3VR2 A;  2R93 B;  1A2U A;  2M2L A;  2XVS A;  4CKE A;  1PFN A;  4ZKB B;  3MXN A;  1BCP F;  3U9O A;  3HOU B;  1I4P A;  1NSN S;  3EVQ A;  2FIN B;  3QWN A;  3J81 E;  1F9R A;  1GUS A;  1HQR D;  4KN4 C;  3QIA A;  1LV9 A;  5BN3 A;  4K5X A;  1E2Z A;  1GUN A;  5KGU A;  3ND8 A;  1PFB A;  1I6H B;  2IWH A;  2BDO A;  2KED A;  5CV9 A;  4OGQ C;  4QUF A;  1LT5 D;  2HCI A;  2MPM A;  3OSO A;  2B2T C;  3I91 A;  3E0J A;  3E5S A;  3CRL C;  3PUW A;  4KY5 A;  1VF5 C;  3NPP A;  1R4Q B;  3GP7 A;  1EY7 A;  2KVM A;  1K8O A;  4L63 B;  3FPP A;  1TII D;  1JQY D;  5C0X H;  3KUP A;  3NTH A;  3K58 A;  4G7O C;  4HR7 B;  3RZO B;  3I90 A;  4JK1 C;  3CHB D;  3KLS A;  2AQ2 B;  2KEC A;  1QJO A;  3I4N B;  2KEE A;  2CW0 C;  3T53 B;  5JVG 3;  5LL6 X;  1M4V A;  1HUM A;  1F9P A;  4LK1 C;  1KTK A;  4A93 B;  2PMZ B;  3TZU A;  5HUR A;  1HRJ A;  1B2T A;  4N9P A;  5D3D A;  4DNR B;  1CHP D;  1JE4 A;  5ELC A;  1Z47 A;  2RDF A;  4ODG A;  1DXM A;  5IIF A;  3K5L A;  1B3A A;  4MN3 A;  1RCV D;  1CT1 D;  3KF8 A;  1BDO A;  1WTV A;  4A3B B;  3C2P A;  1Q12 A;  2F0N A;  2AUK A;  2K1B A;  4ID6 A;  4P2C B;  1QIL A;  4CJ0 B;  4F7X A;  4RHR A;  3IAY A;  1AP0 A;  5J22 A;  1EL0 A;  3PV0 A;  3C46 A;  1ZEQ X;  2EY1 A;  2NB0 A;  1WTX A;  5FK9 C;  4BS9 A;  3C1E A;  4HSV A;  1R9T B;  2F0K A;  2B2U C;  3WOE A;  4LAA A;  3D8G A;  1EY5 A;  3R3O A;  4H13 C;  5IGE A;  2SEB D;  3PIO 3;  1H9R A;  3J7A V;  1PRT F;  1DJR D;  1U4M A;  3CRK C;  2IX1 A;  3S1R B;  2RDG A;  3W3A A;  4FXD A;  1DD2 A;  4FXK C;  1LT6 D;  5A2Q L;  1IW7 C;  1S5D D;  5C4X B;  1F2L A;  2L55 A;  5J39 A;  3SHL A;  4RGN A;  4HED A;  2IX3 A;  5C3E B;  2ICE C;  3SK8 A;  1B50 A;  1EEF D;  1F2Z A;  1STH A;  4DXG A;  4WJW A;  1SE2 A;  5ELD A;  3TBI B;  4XQN A;  3I73 A;  2RSO A;  3S1Q B;  1ENC A;  1SNO A;  1I4R A;  2FMC A;  1YNJ D;  4DNT B;  1S5C D;  1V43 A;  2MGS A;  1S5B D;  2RBM A;  2EJM A;  1RF2 D;  1C48 A;  5D14 A;  2F0P A;  3BVZ A;  2EYL A;  3F2U A;  3NQI A;  1K8M A;  1PTO C;  4OIK A;  4K2L A;  1TQO A;  5JVH 3;  1JOQ A;  5IGB A;  1Q3L A;  1O7Z A;  2DNC A;  1E2V A;  3NWS A;  1D5M C;  4KTA A;  3VA5 A;  3EA6 A;  5I9O A;  3R2T A;  5I2X A;  4KMU C;  3GTG B;  3OWE B;  3SK6 A;  1B9M A;  1F77 A;  1TS5 A;  1CK1 A;  2B63 B;  1TS3 A;  3GV6 A;  5I6W A;  1Q90 A;  1WTW A;  3MVV A;  5LL6 S;  1GUT A;  1STN A;  1IYU A;  5CV7 A;  2Z8L A;  2J7Z A;  2QF7 A;  1OXV A;  1SMY C;  5CBA E;  4RA8 A;  2V4D A;  4U68 A;  1FYC A;  3TP8 A;  3PUY A;  2R3Z A;  2EJG C;  3L9A X;  1GUG A;  1NCV A;  2VB3 X;  1WVL A;  1TS2 A;  2WAQ B;  1TS4 A;  4KJO A;  1ENF A;  4R8I A;  2OXP A;  1CM9 A;  3NBH A;  1QB5 D;  1DOL A;  1Q1E A;  1BO0 A;  3S15 B;  2B2Y A;  3J80 E;  1BF4 A;  5ISR A;  1IL8 A;  3HOX B;  1SEB D;  1Y1W B;  1A3V A;  2EYF A;  2WAC A;  1L0X B;  3NQT A;  3GQB A;  4A3D B;  4O1N A;  1SYD A;  4CJ2 C;  2HDL A;  4IUU A;  1SXT A;  2RVL A;  5CV6 A;  2NN6 G;  3M7G A;  3L7Z C;  2YU9 B;  2EVB A;  1PMR A;  3V2T A;  2NVT B;  1FNV A;  2ICI A;  5T1I A;  2AWN A;  1GHJ A;  3RZD B;  1PXU A;  1KDA A;  2KJX A;  2PW7 A;  2NVQ B;  1T5X D;  2VXW A;  4BA2 I;  2L11 A;  5KND A;  4TKO B;  3VYU A;  1EQV A;  4G7Z C;  1EEI D;  1X3P A;  2SDF A;  3MC0 B;  1VCI A;  4OO1 I;  2A69 C;  2KCC A;  1JCK B;  1LTA D;  3OPO A;  1ML0 D;  1OXT A;  2KUM A;  3J81 L;  4V19 0;  1I6V C;  1H9M A;  3K5O A;  1A6X A;  4M8A A;  1V8Q A;  3KLS X;  1MBY A;  1JIC A;  1I50 B;  5E3F A;  4KHZ A;  3OHX C;  1Z6H A;  5IT9 E;  3AU7 A;  4NMZ A;  5CMD A;  5TSS A;  3D4D A;  1LT4 D;  4DGZ A;  2QIL A;  3H09 A;  2RKS A;  2DN8 A;  1E0B A;  4QF4 A;  2HQE A;  4A3I B;  4FF2 A;  3BYY B;  4L6T B;  1HUN A;  1B53 A;  1BCP D;  4B9W A;  3OWF A;  3I72 A;  3H91 A;  3S1N B;  2E2D C;  4EQN A;  4QUC A;  1HA5 A;  2EJF C;  5FLX E;  5I2Y A;  3HOY B;  4DF7 A;  1RD9 D;  1ET6 A;  2ENB A;  2B2W A;  4FXG C;  1RKN A;  3S1M B;  1S5E D;  3PO2 B;  3FRP B;  3TN2 A;  4CHT B;  1PLF A;  1NUC A;  3TZD A;  1TVX A;  1GJX A;  3GTL B;  5FO8 B;  4KHV A;  1ILQ A;  3ITP A;  4EGV A;  5C4H A;  3SK4 A;  4WRD A;  4AYB B;  1H9S B;  1S4Z A;  3T51 B;  1CFM A;  5KNC A;  4ME5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...