5CV4A

Crystal structure of staphylococcal nuclease variant delta+phs v23d/v66h at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTDKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMHENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V23D/V66H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5cv4A00
4B9XA 3SK5A 4K2LA 5ISRA 4H7BA 3TP7A 2EXZA 3DHQA 2EY1A 3TP8A 2KQ3A 2F0NA 3T16A 3V2TA 4DF7A 2QDBA 5C4ZA 5IIFA 1EY9A 4IZ8A 4DGZA 1JOQA 1STNA 2F0GA 4K2KA 3TMEA 4B9WA 4PMCA 4HMIA 2PW5A 1EYDA 5EKLA 1EZ8A 3E5SA 4EQOA 5I9PA 2F0SA 5CGKA 1SNPA 1SYCA 5KRUA 4KV6A 3MZ5A 5C3XA 2KHSA 4ZQ3A 4F8MA 5IOCA 5E3FA 1EY4A 1EY0A 4N9TA 5C3WA 4DU9A 4K8IA 5HURA 3DMUA 5J22A 2F0PA 3NXWA 4KD3A 2EYLA 4I65A 2F3VA 1ENCA 5J1ZA 5KGUA 5EGTA 3NUCA 2EYFA 3BDCA 3C1FA 4KY7A 4PNYA 1JOKA 2F0MA 2PZUA 4WORA 5DAUA 1EYCA 3EVQA 5CV7A 3EROA 5CV5A 2RKSA 4S3SA 2ENBA 1JORA 1SNMA 3P75A 5C5LA 3P1HA 2F0JA 3SR1A 4TRDA 3D8GA 5I6YA 1KABA 1SYEA 4E6IA 2EY6A 2EYPA 5IGGA 4NP5A 1SYDA 3ITPA 3MXPA 2F0HA 5I6WA 4KTAA 3MHBA 1TQOA 3QB3A 5CV6A 2F0FA 1EY8A 2F0WA 4EQPA 2SNSA 2F0OA 4IALA 3C1EA 4KJNA 5CV4A 3NHHA 3S9WA 4RKBA 2SOBA 5KIXA 5KYLA 5EKKA 1EYAA 5HGTA 3NK9A 4NKLA 4LAAA 1F2MA 1EY5A 3T13A 1II3A 3BDLA 1A2UA 2PZTA 5CC4A 1STHA 1RKNA 2EYHA 1KAAA 3U9OA 1STGA 2F0TA 4K6DA 3TP5A 4K8JA 4PMBA 5JAVA 4KY5A 1SNDA 1TT2A 3VA5A 3TP6A 4ODGA 1F2YA 2EYMA 5C6AA 5C5MA 5I9OA 3RUZA 1JOOA 2F0LA 2F0DA 1STAA 1STYA 2LKVA 2OF1A 2SNMA 1TR5A 3HZXA 1NSNS 4KD4A 4QMGA 4QB4A 4YIJA 5DEHA 5IGEA 2EY5A 3SHLA 4WRDA 4K14A 5NUCA 4K5WA 1SYFA 4QF4A 4ID6A 4K5VA 5CR3A 1SNCA 3D4WA 2EY2A 5F2DA 3SXHA 5IGBA 3MEHA 4F7XA 1EQVA 5M9OA 3MVVA 4J1MA 1A2TA 1EY7A 5E1FA 4N9PA 5IODA 1ENAA 4K5XA 4EVOA 1A3UA 5CV8A 3D6CA 2EYOA 1NUCA 1U9RA 1EZ6A 5JOBA 2OEOA 2RBMA 3HEJA 3QOLA 4J6HA 3D4DA 3SK4A 2F0IA 5C4HA 4ME5A 5IGCA 3EJIA 5KEEA 1SNQA 1AEXA 4NDXA 2F0EA 2EYJA 5KYIA 1KDBA 1SYBA 2PW7A 4MIUA 4ZUJA 4HMJA 5CV9A 2OXPA 1IHZA 2O4XA 4ZUIA 1A3TA 4EQNA 2HQEA 2PQEA 5J39A 3OWFA 1SYGA 1A3VA 2F0VA 3SK8A 3NQTA 4RKLA 3QOJA 3OSOA 4G57A 3OMCA 4HTHA 4KY6A 4IUNA 4OL7A 2PZWA 5IGDA 5K5PA 2NUCA 4NMZA 2PYKA 2M00A 1F2ZA 2F3WA 3H6MA 1SNOA 3LX0A 4KJOA 1KDAA 2F0KA 2RDFA 3PMFA 5IGFA 1KDCA 3R3OA 1EY6A 2F0QA 2WACA 2F0UA 4R8NA 3ERQA 3OMGA 1STBA 3NP8A 4DFAA 4KHVA 3SK6A
chains in the Genus database with same CATH superfamily
4JYAQ 1SE4A 2K5DA 3ZYYX 4H7BA 4IO9A 1U4MA 3A8IE 2BH8A 2NN6G 3CRLC 1PRTC 4IZ8A 2RA4A 3NQIA 2F0GA 2RCNA 3PUXA 2KHSA 4F8MA 3G48A 4JI2Q 2OT2A 4BA2I 4BBRB 5CBEE 2KJXA 3JAME 1UEAB 3RMHA 5CV7A 5C44G 4FF4A 4DUYQ 1PTOF 3WOEA 4A3DG 2PPBC 4BBRH 3CAMA 4JI4Q 1IBML 3T51B 1GUOA 1PZID 4TRDA 1TWAH 4JI7L 1SYDA 1LM0A 2MO0A 2MO1A 1XTDA 5EPKA 3HOWB 3KF6A 1UWVA 1DOMA 3UDFA 3RN2A 2UUAQ 1K73C 5KIXA 2I46A 4G7HC 2EQSA 2DN8A 2B8FA 4NW2A 2YU9B 2FXQA 1CKMA 2CW0D 3W2DA 1PHJA 2JSOA 3HOXH 1SNDA 5I9OA 1JICA 1WTVA 3G4SA 4A3IH 3ONAB 4OELB 4L8JA 1X9NA 3I73A 1WTWA 4R1JA 4NPSA 1VQDA 2B2UC 1PZKD 4ZAIA 1HNZL 2MP1A 4RCNA 4LF7L 1JORA 4O2DA 4BY1G 1GD7A 1E2WA 4AQYL 3PIOA 2RSOA 4DV1L 1SJHD 1M90C 1MJCA 1JJCB 4DA2A 2B2UA 3FMCA 4U673 1YNXA 2JEBI 4HTHA 2MUYA 4GZYC 1YHAA 4KJOA 5ELNA 1MIUA 2C9OA 4KK7A 2R92G 2L1BA 2F0QA 2L9HA 1IBMQ 4R8NA 4JI5Q 4DR4Q 1N34L 1EUJA 1PV4A 2AQ1B 3I55A 3J7AV 4CJ1B 2QEXA 1BCPB 4JI2L 2WINB 1LTRD 1EFID 1STNA 1H95A 3KLSA 2J4XA 1SMYC 5EKLA 5KNBA 1NNXA 1AW7A 1BCPD 4LF5L 1C7YA 3NBIA 2H5XA 4N9TA 3GTKB 2VY3A 4K8IA 3DMUA 5EJWA 3E6ZX 2JXMB 1PH7A 3CC2A 2YTVA 1NMFA 3MXNB 4OEMB 1B3AA 1ZXTA 5FLXL 3EVQA 1JE4A 1C4QA 2MQHA 4HAEA 4A3EH 2Y0SE 1YNNC 5IYBG 2ALYB 2ZXOA 3SR1A 1F9QA 4E6IA 1B9MA 2FJ2A 3GP7A 4XQQA 3BDOA 3WDNA 3RN5A 2F0HA 5ELBA 1ILPA 1XPOA 1RIPA 2CFMA 1FGUA 5BR8Q 3F2DA 4A3GG 4EQ5A 2WFWA 3QWNA 1CQVA 3H0GG 2WB1B 1FJGQ 1LACA 4DV3L 5AJ3Q 4LF9Q 1BXTA 1OO9B 4NKLA 5EQ0A 3TQYA 3BDLA 3ULJA 1X3QA 1TIID 3GV6A 1E2ZA 3U9OA 1STGA 2L0CA 4A3BG 4A3DB 3CPWA 1HA5A 4P75A 4LF6L 2E75C 2KOLA 1B8AA 4HJ8A 4DV5L 3FPUB 1K3RA 2ICEC 5LL6X 1HUMA 1CKOA 5T1IA 4B9XA 5BN3A 1EIYB 3Q22A 3M9BA 2AHOB 3S17H 3W1BA 3SHLA 4DV5Q 1GVPA 1KLUD 2DGYA 5C3EB 1BO0A 4GLVB 4LK1C 1VQBA 3MVVA 1IYVA 4LFCQ 3LWUA 1CA6A 5LMUQ 1SDFA 4K5XA 4EVOA 5JVH3 1PFSA 2KUMA 1YHQA 1RJTA 1D5ZC 2JA5G 1DJRD 2Y0SB 1VQIA 2B39A 2RCFA 1JC7A 4RCOA 4R4IA 2MGSA 3A5UA 4V0BA 2QKIC 2KCCA 2BA0A 4LWCA 2R93H 2TMPA 2KCNA 4OL7A 1C48A 1YBYA 4WRDA 2LS01 2QA4A 1LABA 3HOYB 3FKIG 1NY4A 5D3IB 1PH4A 4CDDC 1AP0A 3J7YW 1L0WA 1WTRA 4QUFA 4GKJL 3KK7A 3RD4A 5A2QL 1XPRA 2NVQB 1B4OA 4B9WA 1LV9A 2RHSB 3PQIA 4ZQ3A 3TN2A 1Z47A 2QCPX 3K58A 4G7OC 1KIXA 4BWGB 2ZT9C 5EGTA 4A3LG 2HQLA 4C1NI 4BXXG 2OQKA 3J80i 3A8JE 2VUMH 1M4VA 2BE5C 1IKLA 3I4NH 4RH6A 4X6AH 2Z6KC 2LY7A 3KYHC 2F3IA 4A3MB 1NJIC 3HOUG 4F88A 3CCRA 4RMFA 3FKIH 1S5DD 1ZEQX 4RHSA 1QILA 1CHQD 5JEAG 5FLMH 1JWSD 1UE5A 2E5LL 2JJQA 1B1ZA 2F0WA 4GOPA 2DNEA 3NENA 1YNJC 3K0YA 4Q0FA 1IKMA 3BZKA 2AKWB 4DR1L 1EIFA 1AZPA 2HHHQ 1NE3A 3T56B 3URYA 1R9TB 3AEVA 1WVLA 1EY5A 1F2MA 1VQFA 3T13A 3KLRA 5CC4A 2EYHA 1HFGA 1FL0A 3TP5A 2F03A 4A3MH 3HOVG 4N8X1 2I5LX 1F2YA 3I56A 3BZDB 4OWWB 1I4HA 2F0DA 1STAA 1STYA 3CRKC 3NELA 4I7ZC 4K14A 4TQUS 3SE0A 2ASBA 4ABNA 5IGBA 3J81L 1NAPA 1BCPF 1ESRA 4IPCA 4DR2Q 2E74C 1ENAA 1A3UA 1A62A 1U9RA 3F2BA 2CWPA 1RTNA 3H3VH 4ZYSA 1V8QA 2ZJQA 1RD9D 3ULLA 3U50C 1LTBD 3OWEB 4JI1L 1EOTA 4P72A 3AB9A 3M4YA 5JPNC 3I4MH 5IYCG 1QVCA 4X65L 4KHVA 3UI2A 1BBUA 1CKNB 3VDYA 3RZOB 4GNXC 3OTOQ 2QDBA 3Q8DA 4DAYB 5IIFA 1EQRA 4DV6Q 5I9PA 3OIPA 1MI2A 1DOLA 5CGKA 1SNPA 5IP7G 1QG7A 1CT1D 4FXDA 3ERSX 4AYBB 5M3FB 3KDFA 4JI5L 4IUPA 4GKKQ 4LF8L 1VMPA 1QZHA 3S17B 4RGOS 1A8VA 4IUVA 4IFDG 2JA6B 4S3SA 5IYDG 3CMEA 1SNMA 2V1CC 2CCZA 2KHJA 2E2IB 3O13A 5A35A 4DV1Q 3WOFA 2WV6D 1YNND 3S2DH 5I6WA 5ELFA 3K7AB 1YVCA 1TQOA 3QB3A 5M3MG 1O80A 1QNKA 3IKJA 3A74A 1GUTA 2SNSA 5FOBB 3W1GA 3VA7A 1F9SA 2NVYH 1HNZQ 1O7YA 2QDLA 3AYHB 2BDOA 3S1QH 2Z4HA 3FDTA 3PUYA 2NVTH 2D9UA 3NK9A 2K6AA 4XT1B 1II3A 3Q24A 4R4QA 1STHA 3U58A 2JA8G 5JEAJ 3LNNA 4A3EG 2FHTA 4HIKA 1E1OA 1ASYA 1IBKQ 2KENA 3T16A 4DGZA 3Q23A 1VS0A 1W3SA 3GTMB 3QIAA 1UEBA 1L1OC 4FXGC 5IY0A 3J7A5 4QF4A 4UP7A 1GXDC 3CCQA 4BBSB 1HNWQ 1EQVA 3DXJC 2HHHL 3CD6A 1YI2A 1HZBA 1SSOA 1OTCA 1F2LA 3CCJA 5M5YB 3D6CA 1NUCA 4XQJA 4KKUA 2VB2X 1KLGD 2B2VA 5CORA 4GNXA 4LFAQ 1VF5C 1XNRL 2XVSA 2F0VA 3OWFA 4JBJA 3NQTA 2Q2UA 2WKDA 3T4AC 4IUNA 3PO2H 2K05A 2IY5B 2ZXPA 1EU3A 1X55A 4DAPA 4MZ9A 1HZ9A 1PYWD 1PH1A 1Y1VH 3J81c 1GHJA 4L5TA 4H13C 4Q5VA 1W6KA 5JEAH 5FLMG 4M1UB 2EY1A 3TP8A 2H1EA 4YY3Q 1TXYA 4A93B 1JOQA 2E2DC 2JE6I 2QF7A 3G6EA 4HMIA 3TS2A 1GHKA 1EZ8A 2NBFA 1HQMC 2IWHA 3AFQA 4JYAL 3HOVH 4POGA 3P7JA 4IPDA 1EY0A 2K5HA 3TREA 1PTOC 2OQ0A 3E9HA 2QW7A 4H02A 1S5CD 4I65A 3BS1A 2A1AA 3GTKH 4C3IH 2N49A 3BVMA 1EYGA 1KRSA 1IBLL 4C3IB 1PH5A 1FD7D 2K5WA 1BCPC 4JW0A 2L4NA 2X6GA 3GTQB 1VCIA 1SMYD 3HFZB 1HZAA 4MTNA 3I4MG 5I6YA 2K4KA 1KABA 3NTKA 2NVTB 1J5EL 4DR7L 1CTMA 1T5EA 4ZLTF 4PZ7A 1OXSC 3NSWA 2A8VA 3L3OC 1I6VC 3VYTA 3C1EA 1ICFB 4KJNA 1MJEA 4F87A 3J7AF 4C3JH 4P2CB 4JI6L 4DR3Q 4KKTA 1HNWL 2R93G 4YWKA 5IP9G 4YHHQ 4A3JH 2N3SA 2K52A 4B3TQ 2IHFA 5AJ3L 1FJGL 4BXXH 1Y1VG 4K8JA 2YYZA 1N33Q 4WJ3M 2DJFC 2NTTA 3EN2A 1B9NA 3TP6A 4GOPC 1VQ8A 1V1OA 1JOOA 3KBGA 3M7NA 3PUZA 1PRTB 5IGEA 4BY7G 1IL8A 2EY5A 1TVXA 2A6EC 2A69D 4GLXA 2R7ZG 1GUWA 3MEHA 3D0FA 1EWIA 1PRTF 4N9PA 1G291 2OEOA 3HOWG 3GTGH 1MHWC 3CW2C 3EJIA 3BJUA 3M3YH 3S1NB 1I3QB 2HCIA 3VYRA 1HR0Q 1B2TA 1GUSA 1AE3A 2A68C 4KY6A 3J80c 3N52A 2MFIA 2VQFL 1PH8A 2C35B 5CV5A 1KD1C 3GTQH 1SNOA 2F0KA 3R93A 1EY6A 1HUNA 1UAPA 1BVSA 4AYBE 1STBA 4A3GH 2EDGA 4GOPB 3CXCA 1NR4A 3KDFB 2JQOA 3OTOL 3W5OA 3DEOA 4K6LA 1WTQA 3CHBD 5CYUA 3U4ZA 5C4XB 3MZ5A 2JK8A 3OOCA 1M8AA 3NWSA 4CBVA 3M4OB 3HKZG 1V43A 4L63B 4MN3A 1DONA 2XGTA 3S16B 2OWOA 3D8GA 1RF2D 1BOSA 1PRTD 1R9TH 4TVAB 4JG2A 4C56C 2A69C 2A6ED 4PZ8A 4R9WA 5JVG3 3STBD 1PFBA 2B63H 5LMNL 5M3MB 2AWOA 1DD2A 3R2TA 4QJFA 1I4XA 5M5WB 5GADC 2SOBA 2R3ZA 4IPHA 5ELOA 1D1IA 3A56A 5D14A 4RGNA 5ELEA 4YHHL 2AMCB 5H1SE 3F2UA 1SXTA 4JI6Q 3KJOA 1TT2A 1LTTD 4IFDH 2EJGC 5IYDH 1PH9A 1WD1A 3HOYG 3HP3A 5D3DA 5GROA 3N6RA 4DR7Q 5K36G 2UU9Q 5CR3A 4K5VA 5F2DA 4HIDA 2EY2A 3AMUA 1LTSD 1EY7A 5IWAQ 3GTGB 2UUAL 1O7ZA 1ESFA 2NN6H 3S1QB 2E76C 2DY8A 3VR2A 5T1GA 3EIVA 3A0JA 3QOLA 4MHEA 4OO1G 3D4DA 5C4XH 2F0IA 4JBKA 1B44D 3HGBA 2JA7H 4FDBA 4X3UA 5FJ8H 4JI7Q 3S1MH 4Y52H 1PTOD 1IHZA 1PMRA 3DUZA 3E9IA 3R8BA 4L5RC 1Y8OB 3C3LA 4A3JG 3DLLA 2DNCA 1XNQL 1B53A 1KDAA 5EBDA 1MSHA 4YY3L 1KDCA 5LMNW 2K5QA 2R61A 1D5MC 1ZKOA 2F0UA 1GJXA 2PI2E 3CC4A 1ZYRC 4YCWA 1LT3D 4JOIC 4PZ6A 3L0OA 1M1KC 4J15A 4LUVA 2NYZD 4K2LA 1VQLA 3V05A 5ISRA 4QIWE 4KN7C 1GOZA 4A3FH 4HCEA 3UE1A 4O42A 4K2KA 4LJZC 4EQOA 4PMCA 5C4XG 1QJOA 2SEBD 4ULLA 2HIVA 5JJZA 5KRUA 2ICIA 4GN4B 5C3XA 2OTJA 1H9RA 2VZAA 1EY4A 1EIHA 4WFN3 5HY6A 4OGQC 1U0LA 5KGUA 3NUCA 3BDCA 4JI4L 3CQZB 2F0MA 1EYCA 1GUGA 2ZTDA 1ILQA 2ENBA 2UUBL 4GLAC 1EIGA 5G3LD 3A7AB 5IGGA 2K14A 1I4RA 3DEPA 5KNDA 3RZDB 2R7ZH 4KTAA 4JV5L 1K83B 3T1HL 2F0FA 1EY8A 4ZRZA 2ID0A 3HOZB 1LT6D 4LFCL 2E2IH 1K83H 4Z9CB 1O7IA 5HGTA 4A3FG 1VQ9A 2R7ZB 2IL8A 3SGIA 2PZTA 2F4IA 1P8LA 2F0TA 5M5XH 4BBSG 4YWLA 3RLOA 2CH4W 3OIQA 1L1OB 1IXRA 1X3EA 4Y7NH 1G91A 4A3LH 5DEHA 2IHEA 5EPLA 1C0AA 4L6TB 2PI2A 3J81i 2Q2TA 1Q12A 1Q82C 1XPUA 1K0SA 4RGTA 1IBLQ 2YV5A 4DK0A 4F7XA 4ME3A 2NZOA 4JPBW 1PFMA 4LUZA 4HCSA 5CV8A 4JBMA 2EPBA 3FRPB 2ES2A 3L9AX 4X62L 2JYOA 2F0EA 2M9VA 1QNUA 3G71A 1VQKA 2QEJC 4HMJA 4KHZA 4O1NA 5FLXE 1EL0A 1CZGA 1A15A 2PQEA 1EWCA 1UE1A 1CA5A 4X3TA 4DPGA 2EXDA 5A2QE 3X3NA 4B3SQ 3S2HB 1LO5D 4RGMA 4DR3L 1X3PA 2IX1A 2VNUD 1SAPA 1VF7A 3RR5A 3PUWA 2WACA 2CVRA 1RHPA 2Y0SG 4A3CH 1TWHH 3MXNA 1HNXQ 3JAMc 2F0NA 1XMQQ 1X6OA 4LFAL 3LWEA 2Z6BA 2PQAA 1C8CA 4OO1H 1MSGA 3OW7A 5FKAC 5GQOA 1HTPA 2Z4IA 2I07B 3TEHB 5IOCA 4DK1A 5FO7B 3GTPB 2F0PA 1HFNA 1TS5A 3KF6B 3C1FA 4A3EB 2MHVA 1PA6A 1VQ6A 3T53B 4IURA 4DXFA 2ATWA 1EFWA 3EA6A 1FNWA 4A3FB 3U9SA 2R93B 2AQ2B 4NP5A 1I94Q 4HSPA 3CMAA 4GN3B 1PH6A 1LTID 4B3MQ 4OIJA 3PCOB 4LFBL 1N32L 1GKHA 2DJGC 3ND8A 2VW9A 1VQHA 3CC7A 1NBWA 4ZKCB 4QUCA 4RKBA 2E2JB 1K28A 1H9KA 3MC0B 1X56A 1A2UA 1TU2B 1SROA 3I4LA 1KTKA 4K6DA 5IT9c 2F4VL 5AFWA 5C44B 2NWGA 4CJ2C 5JAVA 3VR6A 3HS0C 3RNUA 2UXCL 4BBRG 1YNJD 2OF1A 2LXKA 4O0AA 1NSNS 4QMGA 1XJVA 1KRTA 5DNFA 3QJYA 1FNUA 3G6JB 3D4WA 3PF5A 4A3DH 5M9OA 1WOCA 1SJED 5E1FA 4APVA 2BOSA 4LF8Q 1D6EC 1BNZA 1Q8IA 2HD3A 1PZJD 1F9PA 2RDGA 1LT5D 1RODA 1SNQA 4QL5A 2K5NA 3NPPA 5CV9A 2C5CA 3WWVA 4B3ML 3SK8A 4A3MG 3QOJA 4N8FA 1MGSA 2CH4A 1TWGB 3DWQA 3W3AA 1B3QA 5IGFA 5I2YA 4IUUA 2L15A 3R3OA 4CDFC 2GVBA 2EE1A 2FMCA 1N32Q 3UDXA 3V96A 1BUVT 1UE6A 1Q46A 1QUQB 3AU7A 2EOTA 3HOVB 4H44C 2B63G 3H09A 1KNEA 3K81C 5ELDA 5EPJA 2Z0SA 2G5DA 3FP9A 4WJ4A 4DK6C 1T9HA 1I6HH 4OIKA 2DUDA 3FKIB 3NXWA 2KCMA 2F3VA 1DCZA 3JAML 4C3HG 1U4LA 3I4NB 4POFA 2JA7G 1JT8A 1H9SA 3GQBA 3BVZA 3TSSA 5LMUL 1Y14B 1Q1BA 4UP8A 1I6HB 1R4PB 1XMQL 2AUJD 3ITPA 2H4OA 3MXPA 1K9MC 5IT9E 5COYA 2Q2HA 4NXNL 3BVGA 3IL8A 2N55A 4X65Q 1G6ZA 1X3FA 2F0OA 5BN5A 3KUPA 3VYSA 2B2TA 1SN8A 3S9WA 3BU2A 2RF4A 3GTLB 1UNSA 4OHJA 1RKNA 4JOIA 4FP5D 4IUQA 2CWAA 1LTLA 3ER0A 3SVMA 2K04A 1WFQA 4ODGA 2EYMA 2RVLA 5C5MA 1D2BA 2SNMA 2G9DA 2HCCA 3IRBA 3BZCA 3D31A 1U4PA 1MD2D 4A3CG 1TWGH 2KEEA 1F77A 2EVBA 4MNOA 2D0OA 1TS4A 4J1MA 1O7LA 1QVGA 2HT1A 1PYSB 4PQXA 3TS0A 2WB1G 3M4PA 4ME5A 4LF4Q 3VYUA 4CKBA 1TS2A 1A3TA 4A3BH 2BCOA 1HH2P 1MKHA 1TS3A 3SDZA 4A3KH 2RQXA 4IUTA 1VQAA 3S1RH 2PMZE 3TDQA 3M85A 1EWHA 1XNQQ 1FR3A 1BBWA 3NP8A 4BY7B 3KBXA 2BH2A 1TY0A 4DR4L 4CGYB 2KQ3A 5IP9H 3H3VI 1HPCA 1CK1A 1CSPA 3OPOA 4AH6A 5C3EG 1SYCA 4JBWA 4DNTB 2Z1CA 4R8IA 1EQQA 5C3WA 4KMUC 4CKCA 4FYDA 3A54A 4XQNA 1AE2A 2I5MX 5IWAL 1JOKA 2PZUA 3TZUA 5FO8B 2VS1A 4OXPA 1G8ZD 4GS3A 1KXLA 3IFDA 5C5LA 4B3RQ 4RG1A 4K0KQ 2WB1E 2K33A 4HN7A 5G3LF 1VQPA 1I4PA 1S40A 1BKBA 1CQFA 3MXGA 3HOWH 2B2WC 1H9JA 4UY8C 2B2YA 2JP1A 5CV6A 2A73B 2NVYB 1K8AC 4LF9L 4OX9Q 4Y7NB 1JR0D 4BA1I 5IP7H 4BY1B 1E22A 3UE0A 1K3BC 4NB3A 2D62A 2Q8TA 4AIMA 1VQJA 1PH3A 1PH2A 5C0XJ 2G9HD 2L11A 4PMBA 2NVXB 5IYCH 1LYLA 1RCVD 1Y8NB 2ZJRA 2XTIA 1ENFA 1TR5A 1S3OA 4U68A 3C2PA 3NTHA 1BR9A 3QO2A 3QR8A 1NR2A 3LGJA 1L0XB 1VQGA 2UXCQ 4RWSC 1HA6A 1SMXA 4LNQA 1OXXK 2A68D 4LF7Q 2KA7A 4UDUC 3ND9A 5JOBA 2RHQB 3SK4A 3H3VC 2VQEL 5C4HA 4NDXA 2EYJA 5LMNQ 2A6HD 1IW7C 3J80L 3K5MA 3PGZA 4YCUA 2O4XA 1J6QA 3MTSA 3MA2B 4IPGA 5L37A 5BN4A 1WCMH 1YJNA 1Z6HA 3TBIB 3R2IA 1QUQA 2R7DA 1JMCA 4IN3A 4XYQA 1LLRD 3OMGA 1QB5D 1S72A 3MWYW 1ML0D 1SBBB 4X64L 4QCLA 4CKEA 4DR6L 3NBHA 2EJFC 2EXZA 1PLFA 1HR0L 4IFDJ 1A0IA 5C4ZA 1B50A 3P20A 1HTLD 2KECA 4P73A 1VQOA 1EYDA 1YJ9A 5I4DA 5HGQA 4KHPQ 4HR7B 1E0BA 2IW3A 5J22A 3GV3A 2EYLA 5J1ZA 2ZJPA 4BY1H 2N78A 3S24A 1K8GA 5I2XA 3DWPA 3K59A 1SFOH 3I8ZA 4JCVE 4XT3B 4LF5Q 3K6OA 4CHTB 4LW1A 4YWMA 1G2SA 1EOVA 4HEDA 4DV4L 1EU4A 3AFPA 2EY6A 3I70A 2CKZB 2EYPA 3PO3B 1BBXC 1Q8KA 2Z8LA 4CDEC 3JAMi 4XXEA 3NE5B 4QQBX 1PVOA 1I4QA 1GO3E 5E7NA 3GTOB 3BG3A 3NHHA 3KFUA 5E4XA 1AFPA 5KYLA 3MFGA 3GTMH 4ALPA 5LL6S 1XX8A 2B2YC 2QGQA 4C3HH 2B29A 3ZJYC 1LT4D 4RAUC 3J7ZC 2I5HA 4V190 3M4OH 4QB4A 4G4KA 4AYBG 5M3FG 2Z6KA 2E8GA 1JB7A 1U4RA 4X66L 1XTCD 2GN5A 3SXHA 3S14B 4DUYL 2K32A 1N33L 1OXUA 2XIWA 3S14H 1A2TA 2VUMB 3NEMA 1OXVA 2B2VC 4PG3A 3OHXC 1TWHB 2ZM6L 4DF7A 1EZ6A 1HQRD 1ZYRD 5GAGC 5IGCA 4QGUA 5JJIA 1AEXA 1F9RA 1WYDA 4H0LC 2PW7A 4ZUJA 2NN6I 2XSCA 1I94L 3RLFA 1J9OA 2OXPA 5TSSA 4EQNA 4NXNQ 1BDOA 3RZDH 2R7FA 3GTJH 3T1HQ 1VQCA 1J5EQ 5GAEC 2BDNA 1WI5A 5FLXc 3H6MA 1J8IA 2A19A 4OO1I 3PMFA 3HOYH 3K8AA 2A74C 4BS9A 5JJKA 4OWTB 2UUBQ 3H91A 3D4RA 3SK6A 2E2HH 4HJ5A 3KF8A 1LUZA 2QILA 2HDLA 2Q8RE 1XNRQ 3V2TA 1EY9A 3TMEA 2PW5A 3MXUA 4UP9A 1HNXL 1D1KA 2R6GA 3FPPA 4DU9A 2F1MA 3VR4A 5EKIA 1G51A 2HIXA 4GKJQ 1JQYD 1FVIA 4PNYA 2B3GA 1V1PA 2WIIB 1FYCA 2UXDL 1DZ1A 3EROA 2EJMA 1GM5A 3PO3H 5FJ8G 2O5JC 4HJ9A 1TWCH 3TRZA 3BYYB 1I4GA 3J81E 3KLSX 1ET9A 1XYIA 4JI0L 1JE5A 3S16H 1SYEA 4A3JB 2NZ1D 2ZTCA 4X66Q 2GA4B 2D5DA 1VDZA 4X62Q 3S1MB 3PO2B 1X3GA 3HKZB 3MAQA 4EQPA 2Q8IB 1C9OA 2AWNA 4FF2A 2KHIA 4XTCS 4IOAA 1VQMA 4KKSA 3CCUA 4RFBA 5C0XH 1IW7D 5CBAE 3S2HH 4DV0Q 4R4OA 3CF5A 2F0LA 3L7ZC 2YTYA 4JC0A 1CKNA 4QY7A 2NZHA 4ID6A 1SNCA 3DM1A 1V1QA 4R4TA 3H94A 4NXML 5C3EH 2K50A 5IODA 2OCEA 3GTPH 3S1NH 1E7ZA 4GKKL 4MTKA 4ILWA 2RBMA 4DV7L 1SR3A 5KEEA 3Q6SA 3D3RA 1VQ7A 1KNAA 5C4JB 1TWFH 1NMGA 2YTXA 1SYGA 1A3VA 3S15H 1S5BD 2HDMA 1SFOB 3OSOA 2CHBD 3OMCA 2LFNA 4P74A 4HIOA 4UHVA 5IGDA 3VR5A 1HZCA 2F3WA 2Z9HA 3K7AH 3HKZE 4BY7H 3KOJA 1S5ED 4QIWB 3M4QA 4DR6Q 3ERQA 2AQ3B 1XXGA 5C4JH 2ZXRA 4DNIA 3HOXG 4X64Q 1TWCB 4JI1Q 3SK5A 2NVQH 4DUZL 3VR3A 3QG1A 4UPAA 1G6PA 5K36H 4DAVA 1HCZA 2JA8H 4OONA 1DGSA 2F0SA 1PTOH 4XYOA 1PXUA 4DV6L 4A93G 4JI3L 3CCSA 4KD3A 1QOHA 2V4DA 1P16A 5EAYA 3FEWX 1SE8A 2EYFA 4KY7A 1I50B 1DXMA 1NTGA 4IQZA 4DN4M 2MPMA 1VQ5A 2BA1A 3JC66 4CJ0B 3K5LA 2RKSA 2X69A 5LHY1 4LMQD 3CQZH 1B70B 2HUGA 2LMCB 3K0XA 5E4WC 3J81j 1CUKA 2L5TA 4KHPL 2VQFQ 1I50H 4DV7Q 4RHRA 1PYBA 2XRSD 5M5XB 1L1OA 2VQEQ 1L2FA 1QCBD 3GTJB 5J3BA 4UAIA 3GTLH 3CPFA 1WCMG 1X32A 1VQEA 2JA9A 1TY2A 2WAQB 1CSQA 3SEBA 3NTIA 4YCVA 2PQAB 3HOZH 2WKCA 1I5FA 3PUVA 2VB3X 1KC8C 2ZTEA 1N9WA 4DV0L 2JN4A 4KI0A 2O2LD 3HKSA 2XN9C 3Q0AA 4KN4C 4PMWA 2K7VA 4DR2L 4A3KB 3PIP3 3F8TA 4XDXA 2K75A 5M5YH 5ELCA 4A75A 3HOUH 3T1YQ 2E2JH 4B3RL 3KLWA 4A3GB 4CDCC 5FK9C 4A3IB 3H0GB 3HOXB 5KYIA 1KDBA 2UUCL 4MIUA 4B08A 4HIMA 1AZQA 2VXWA 1AN8A 3GTOH 4K0KL 4FF3A 2VL6A 2MJ8A 4P71A 4JI8Q 1KQSA 2UXDQ 2KVMA 1WTPA 2A5HA 1DYQA 1IYJB 3A5ZB 2A6HC 2K1BA 4C2MB 3F2CA 3CP0A 2JA6G 4DFAA 5DLQE 4RKLA 2E5LQ 4GNXB 1QZGA 2L55A 1ET6A 1UUPA 1N36Q 1K0RA 4OX9L 1B7YB 1QE6A 4FVMA 1YIJA 1RDPD 1LTGD 1VQNA 5HURA 4DV2Q 1SRUA 2D0PA 2K5VA 4IJLA 5DAUA 4J8QA 2JA5H 4LF4L 4WORA 1OXTA 2AUKA 1LTAD 1EQTA 4B3SL 1Y1VB 3PV0A 3CKIB 4HJAA 3P1HA 4X3SA 1STEA 3H15A 5M3FH 3DWAA 2JA6H 3S15B 4LF6Q 1S4ZA 3MHBA 4DAYA 3CU7A 4JK1C 1G2TA 2RDHA 2IJ0A 2XRQD 3CCLA 2PNRC 2E2HB 1BF4A 1R4QB 3A8KE 5CMDA 2WP8J 1Q81C 1EYAA 1HRJA 4A3KG 3UDIA 1D5XC 4M8AA 1FGBD 2B2WA 4DK3C 5BR8L 3RZOH 1KAAA 4RA8A 4TKOB 4C3IG 3I72A 2N8NA 2O5IC 1Q86C 4KY5A 2XNAC 3VA5A 4JI8L 3B6YA 3J80E 2LKVA 4IJHA 3HZXA 4PV1C 2JA8B 2I0QA 3PIPA 2EZVA 4B3TL 4K5WA 1PFNA 1IBKL 5DM63 1D8LA 1SE2A 2PCFB 1EEFD 3AQQA 5IYBH 3ULPA 3DM3A 1Q7YC 2MNAA 4DNRB 2BE5D 4L5QA 1X65A 1WJJA 3HEJA 1DOKA 4IFDI 4JV5Q 1JB3A 1ASZA 1YHBA 3ICEA 2FFKB 1SYBA 5C44H 5KNCA 5FO9B 3HOZG 1Y8PB 2M2LA 1PDQA 1V1PB 2CQAA 4XIGS 5J39A 1SLJA 1CZWA 1W2BA 4DV3Q 3K7UC 2NUCA 5K5PA 1WD0A 2M00A 1K8MA 3A55A 3LX0A 2RDFA 1T5XD 3E0EA 1XMOL 2UXBQ 1MBYA 3K57A 1Q3LA 2OTLA 4L5SA 5C0XI 4A3IG 1Y69U 3TP7A 2JEAI 2CQOA 1XWEA 1UE7A 1L0YB 1A63A 1JWMD 3C46A 2Q2IA 3H0GH 4KV6A 2SDFA 4TSSA 1BQQT 3FVQA 4A4IA 1HHVA 5E3FA 3GO5A 1S5FD 5GAHC 4ZKBB 1NCVA 3K5NA 1V9PA 1VMCA 3K5OA 4DV2L 2LSSA 4G7ZC 3PO2G 4FXKC 2DY7A 1QVFA 1Q90A 3P75A 1Q1EA 4DXGA 2F0JA 4FO2A 2B8GA 5D65A 3X3MA 3I4OA 3I2ZA 1N36L 1H9SB 1PTOB 1CI3M 5IE8A 1N34Q 1D7QA 2B2TC 2FMMA 2J0TD 3E3XA 5CV4A 4DUZQ 1GUNA 1HJPA 1QWYA 2JA5B 3IFTA 4LUOA 4OWXB 4KLKA 4C3JB 2UU9L 5EKKA 2FINB 1IZ6A 1YITA 1DM0B 2P5ZX 4C1NK 2K28A 2KEDA 2XWBB 1IYUA 3OYYA 4FF1A 1U5KA 1YEZA 4DR5Q 2UUCQ 5C6AA 3RUZA 4AQYQ 1ONLA 4IOCA 4LFBQ 4YIJA 4X3KA 3PF4A 1WTHA 2IPKD 5NUCA 3G7LA 3T1YL 4WJWA 4DR5L 2X6LA 4I7AA 4JI0Q 2NTSA 3I3CA 4EX5A 3FHWA 3NWTA 2EYOA 2YU9H 2KCTA 4DAMA 4HJ7A 1WTOA 4DR1Q 4A93H 1AH9A 3EBEA 5JJLA 3PIO3 4A76A 2N88A 4ZUIA 1X54A 3EFXD 5C0XG 1FNVA 2PMZB 3I7FA 4G57A 3RLNA 2NVXH 2PZWA 3MEFA 1KL9A 2IX0A 2J7ZA 1HR0W 3HRZC 3I4NG 3HOUB 3CCEA 2F4VQ 1A6XA 1SEBD 1TWAB 1O78A 2PO4A 3I91A 3M7GA 3K80C 1Y1WH 4EGVA 4JVZA 1YJWA 5DM73 3DHQA 3CCMA 2LXJA 4DKAC 4R4CA 3S1RB 1Y1WB 4ZK9B 3E5SA 1CFMA 5IT9L 1JCKB 3A7LA 3KF8B 3KJPA 1CHPD 2TSSA 1ENCA 3GD7A 1E24A 4JI3Q 4BBSH 4HSVA 2IT1A 1RL2A 2D2CC 3STBC 2ZM6Q 4ZCKA 1XMOQ 2UXBL 1CM9A 1WCMB 2WAQG 1YZ6A 4GN5A 2RSNA 1E2VA 3GDEA 1H9MA 1I3QH 1E3PA 5JPMC 3M3YB 2WAQE 3E0JA 5M5WH 3PSIA 4IALA 1HXYD 2CW0C 4LAAA 3U4VA 2K01A 1EEID 1VQ4A 2B63B 2JA7B 1KHIA 1IL2A 1RTOA 3S2DB 1TKWB 2KBNA 4KD4A 3UDGA 2PNHA 1KAWA 3MFYA 2R92H 3IAYA 2L12A 3NBHB 1SE3A 3EQLC 3HG9A 3I90A 1Z9FA 2R92B 1SYFA 1WTXA 1Y1WG 4NXMQ 3TZDA 4A3BB 3OW2A 4DV4Q 3F1ZA 1W6JA 2NB0A 1JJGA 1JWUD 3D6WA 4C3JG 4J6HA 2EIFA 1TWFB 4FNFA 3PO3G 5EBCA 2F52A 2HQEA 1E1TA 3L2PA 2VUMG 1Z7TA 4NMZA 2PYKA 3BYTB 1F2ZA 2K03A 3I4MB 1K8OA 5M3MH 4C3HB 3CCVA 2GVAA 1JJ2A 2IX3A 4C2MH 1N8RC 1ICWA 2XWJB
chains in the Genus database with same CATH topology
1SE4A 2K5DA 3ZYYX 4H7BA 1U4MA 3A8IE 2NN6G 3CRLC 1PRTC 4IZ8A 2RA4A 3NQIA 2F0GA 3PUXA 2KHSA 4F8MA 4BA2I 2OT2A 4BBRB 5CBEE 2KJXA 3JAME 1UEAB 3RMHA 5CV7A 4FF4A 1PTOF 3WOEA 2PPBC 3T51B 1GUOA 1PZID 4TRDA 1SYDA 5EPKA 3HOWB 1DOMA 5KIXA 2I46A 4G7HC 2DN8A 2B8FA 4NW2A 2YU9B 2CW0D 3W2DA 2JSOA 1SNDA 5I9OA 1JICA 1WTVA 3ONAB 4L8JA 3I73A 1WTWA 2B2UC 1PZKD 4ZAIA 2MP1A 4RCNA 1JORA 1E2WA 2RSOA 1SJHD 4DA2A 2B2UA 3FMCA 4U673 2JEBI 4HTHA 2MUYA 4GZYC 4KJOA 2C9OA 4KK7A 2L1BA 2F0QA 2L9HA 4R8NA 2AQ1B 3J7AV 4CJ1B 1BCPB 2WINB 1LTRD 1EFID 1STNA 3KLSA 2J4XA 1SMYC 5EKLA 5KNBA 1AW7A 1BCPD 3NBIA 4N9TA 3GTKB 4K8IA 5EJWA 3DMUA 3E6ZX 2JXMB 1B3AA 1ZXTA 5FLXL 3EVQA 1JE4A 1C4QA 4HAEA 1YNNC 2ZXOA 3SR1A 1F9QA 4E6IA 1B9MA 2FJ2A 3GP7A 4XQQA 3BDOA 3WDNA 2F0HA 5ELBA 1ILPA 3QWNA 1CQVA 2WB1B 1LACA 1BXTA 1OO9B 4NKLA 5EQ0A 3BDLA 1X3QA 1TIID 3GV6A 1E2ZA 3U9OA 1STGA 2L0CA 4A3DB 1HA5A 2E75C 2KOLA 3FPUB 2ICEC 5LL6X 1HUMA 5T1IA 4B9XA 5BN3A 3Q22A 3SHLA 1KLUD 5C3EB 1BO0A 4LK1C 3MVVA 1IYVA 3LWUA 1CA6A 1SDFA 4K5XA 4EVOA 5JVH3 2KUMA 1RJTA 1D5ZC 1DJRD 2Y0SB 2B39A 4RCOA 1JC7A 2MGSA 4V0BA 2QKIC 2KCCA 2BA0A 2TMPA 2KCNA 4OL7A 1C48A 4WRDA 2LS01 1LABA 3HOYB 5D3IB 1AP0A 3J7YW 1WTRA 4QUFA 3KK7A 3RD4A 5A2QL 2NVQB 1B4OA 4B9WA 1LV9A 4ZQ3A 3TN2A 1Z47A 2QCPX 3K58A 4G7OC 4BWGB 2ZT9C 5EGTA 4C1NI 3A8JE 1M4VA 2BE5C 1IKLA 4RH6A 2LY7A 4A3MB 4F88A 1S5DD 1ZEQX 4RHSA 1QILA 1CHQD 5JEAG 1JWSD 1B1ZA 2F0WA 2DNEA 4Q0FA 1YNJC 3K0YA 1IKMA 1AZPA 3T56B 3URYA 1R9TB 1WVLA 1EY5A 1F2MA 3T13A 3KLRA 5CC4A 2EYHA 1HFGA 3TP5A 2F03A 1F2YA 3BZDB 1I4HA 2F0DA 1STAA 1STYA 3CRKC 4I7ZC 4K14A 4TQUS 3SE0A 4ABNA 5IGBA 3J81L 1NAPA 1BCPF 1ESRA 2E74C 1ENAA 1A3UA 1U9RA 1RTNA 4ZYSA 1V8QA 1RD9D 1LTBD 3OWEB 1EOTA 3AB9A 3M4YA 5JPNC 4KHVA 3UI2A 3RZOB 2QDBA 5IIFA 5I9PA 3OIPA 1MI2A 1DOLA 5CGKA 1SNPA 1QG7A 1CT1D 4FXDA 4AYBB 5M3FB 4IUPA 1VMPA 3S17B 4RGOS 4IUVA 4IFDG 2JA6B 4S3SA 1SNMA 2E2IB 3O13A 5A35A 3WOFA 2WV6D 1YNND 5I6WA 5ELFA 3K7AB 1TQOA 3QB3A 1O80A 1QNKA 3IKJA 1GUTA 2SNSA 5FOBB 3VA7A 1F9SA 1O7YA 2BDOA 2Z4HA 3FDTA 3PUYA 2D9UA 3NK9A 2K6AA 4XT1B 1II3A 3Q24A 1STHA 5JEAJ 3LNNA 2FHTA 3T16A 4DGZA 3Q23A 3GTMB 3QIAA 4FXGC 4QF4A 1GXDC 4BBSB 1EQVA 3DXJC 1SSOA 1F2LA 5M5YB 3D6CA 1NUCA 4XQJA 4KKUA 2VB2X 1KLGD 2B2VA 5CORA 1VF5C 2XVSA 2F0VA 3OWFA 3NQTA 2WKDA 3T4AC 4IUNA 2K05A 2ZXPA 1EU3A 4DAPA 1PYWD 1GHJA 4H13C 4Q5VA 1W6KA 5JEAH 4M1UB 2EY1A 3TP8A 2H1EA 4A93B 1JOQA 2E2DC 2JE6I 2QF7A 4HMIA 1GHKA 1EZ8A 2NBFA 1HQMC 2IWHA 3P7JA 1EY0A 1PTOC 1S5CD 4I65A 3BS1A 3BVMA 4C3IB 1FD7D 2K5WA 1BCPC 2L4NA 2X6GA 3GTQB 1VCIA 1SMYD 5I6YA 1KABA 3NTKA 2NVTB 1CTMA 1T5EA 4ZLTF 1OXSC 3NSWA 3L3OC 1I6VC 3VYTA 3C1EA 4KJNA 4F87A 3J7AF 4P2CB 4KKTA 4K8JA 2YYZA 2NTTA 1B9NA 3TP6A 1V1OA 1JOOA 3KBGA 3M7NA 3PUZA 1PRTB 5IGEA 1IL8A 2EY5A 1TVXA 2A6EC 2A69D 1GUWA 3MEHA 1PRTF 4N9PA 1G291 2OEOA 3EJIA 3S1NB 1I3QB 2HCIA 3VYRA 1B2TA 1GUSA 2A68C 4KY6A 3N52A 5CV5A 1SNOA 2F0KA 3R93A 1EY6A 1HUNA 1UAPA 1STBA 2EDGA 1NR4A 3DEOA 4K6LA 1WTQA 3CHBD 5CYUA 5C4XB 3MZ5A 3OOCA 1M8AA 3NWSA 4CBVA 3M4OB 1V43A 4L63B 4MN3A 1DONA 3S16B 3D8GA 1RF2D 1BOSA 1PRTD 4C56C 2A69C 2A6ED 4R9WA 5JVG3 1PFBA 5M3MB 2AWOA 1DD2A 3R2TA 1I4XA 5M5WB 2SOBA 2R3ZA 1D1IA 3A56A 5D14A 4RGNA 5ELEA 3F2UA 1SXTA 1TT2A 1LTTD 4IFDH 2EJGC 1WD1A 3HP3A 5D3DA 3N6RA 5K36G 5CR3A 4K5VA 5F2DA 2EY2A 3AMUA 1LTSD 1EY7A 3GTGB 1O7ZA 1ESFA 2NN6H 3S1QB 2E76C 2DY8A 3VR2A 5T1GA 3QOLA 4MHEA 4OO1G 3D4DA 2F0IA 1B44D 3HGBA 4X3UA 1PTOD 1IHZA 1PMRA 3DUZA 3R8BA 1Y8OB 3C3LA 2DNCA 1B53A 1KDAA 5EBDA 1MSHA 1KDCA 2K5QA 2R61A 1D5MC 1ZKOA 2F0UA 1GJXA 1ZYRC 1LT3D 2NYZD 4K2LA 3V05A 5ISRA 4KN7C 1GOZA 4HCEA 4O42A 4K2KA 4LJZC 4EQOA 4PMCA 1QJOA 2SEBD 4ULLA 5JJZA 5KRUA 2ICIA 5C3XA 1H9RA 1EY4A 1EIHA 4WFN3 4OGQC 5KGUA 3NUCA 3BDCA 3CQZB 2F0MA 1EYCA 1GUGA 1ILQA 2ENBA 1EIGA 5G3LD 3A7AB 5IGGA 1I4RA 3DEPA 5KNDA 3RZDB 4KTAA 1K83B 2F0FA 1EY8A 4ZRZA 2ID0A 3HOZB 1LT6D 4Z9CB 5HGTA 2R7ZB 2IL8A 2PZTA 2F4IA 2F0TA 3OIQA 1G91A 5DEHA 5EPLA 4L6TB 1Q12A 4RGTA 4DK0A 4F7XA 1PFMA 4HCSA 5CV8A 2EPBA 3FRPB 3L9AX 2JYOA 2F0EA 2M9VA 1QNUA 2QEJC 4HMJA 4KHZA 5FLXE 4O1NA 1EL0A 1CZGA 1A15A 2PQEA 1EWCA 1CA5A 4X3TA 5A2QE 3X3NA 3S2HB 1LO5D 4RGMA 1X3PA 2IX1A 2VNUD 1SAPA 1VF7A 3PUWA 2WACA 2CVRA 1RHPA 3MXNA 2F0NA 3LWEA 1C8CA 4OO1H 1MSGA 3OW7A 5FKAC 1HTPA 2Z4IA 2I07B 5IOCA 4DK1A 5FO7B 3GTPB 2F0PA 1HFNA 1TS5A 3C1FA 4A3EB 2MHVA 3T53B 4IURA 4DXFA 3EA6A 1FNWA 4A3FB 3U9SA 2R93B 2AQ2B 4NP5A 4HSPA 1LTID 4OIJA 3ND8A 4ZKCB 4QUCA 4RKBA 2E2JB 1H9KA 3MC0B 1A2UA 1TU2B 3I4LA 1KTKA 4K6DA 5AFWA 5C44B 2NWGA 4CJ2C 5JAVA 3VR6A 3HS0C 1YNJD 2OF1A 1NSNS 4QMGA 5DNFA 3QJYA 1FNUA 3G6JB 3D4WA 5M9OA 1SJED 5E1FA 2BOSA 1D6EC 1BNZA 1Q8IA 1PZJD 1F9PA 2RDGA 1LT5D 1RODA 1SNQA 3NPPA 5CV9A 2C5CA 3SK8A 3QOJA 1MGSA 1TWGB 3DWQA 3W3AA 5IGFA 5I2YA 4IUUA 3R3OA 2EE1A 2FMCA 3V96A 1BUVT 3AU7A 2EOTA 3HOVB 4H44C 3H09A 1KNEA 5ELDA 5EPJA 4OIKA 3FKIB 3NXWA 2F3VA 1DCZA 3JAML 4C3HG 1U4LA 3I4NB 1H9SA 3GQBA 3BVZA 3TSSA 1Q1BA 1I6HB 1R4PB 2AUJD 3ITPA 2H4OA 3MXPA 5IT9E 5COYA 3BVGA 3IL8A 2N55A 1G6ZA 2F0OA 5BN5A 3KUPA 3VYSA 2B2TA 3S9WA 3GTLB 1UNSA 4OHJA 1RKNA 4FP5D 4IUQA 3SVMA 2K04A 4ODGA 2EYMA 2RVLA 5C5MA 1D2BA 2SNMA 2G9DA 2HCCA 3D31A 1U4PA 1MD2D 2KEEA 1F77A 2EVBA 1TS4A 4J1MA 1O7LA 4PQXA 4ME5A 3VYUA 4CKBA 1TS2A 1A3TA 2BCOA 1TS3A 3SDZA 2RQXA 4IUTA 3TDQA 3M85A 1EWHA 1FR3A 4BY7B 3NP8A 3KBXA 1TY0A 4CGYB 2KQ3A 1HPCA 1CK1A 3OPOA 1SYCA 4JBWA 4DNTB 2Z1CA 4R8IA 5C3WA 4KMUC 4CKCA 4FYDA 3A54A 4XQNA 1JOKA 2PZUA 3TZUA 5FO8B 1G8ZD 3IFDA 5C5LA 2K33A 4HN7A 5G3LF 1I4PA 1CQFA 3MXGA 2B2WC 1H9JA 2B2YA 2JP1A 5CV6A 2A73B 2NVYB 4Y7NB 1JR0D 4BA1I 4BY1B 2D62A 2Q8TA 5C0XJ 2G9HD 2L11A 4PMBA 2NVXB 1RCVD 1Y8NB 1ENFA 1TR5A 4U68A 3C2PA 3NTHA 1BR9A 3QO2A 1NR2A 1L0XB 1HA6A 4RWSC 1OXXK 2A68D 2KA7A 4UDUC 3ND9A 5JOBA 3SK4A 3H3VC 5C4HA 4NDXA 2EYJA 2A6HD 1IW7C 3J80L 3K5MA 2O4XA 3MTSA 3MA2B 5BN4A 1Z6HA 3TBIB 3R2IA 4IN3A 4XYQA 1LLRD 3OMGA 1QB5D 3MWYW 1ML0D 1SBBB 4QCLA 4CKEA 3NBHA 2EJFC 2EXZA 1PLFA 4IFDJ 5C4ZA 1B50A 3P20A 1HTLD 2KECA 1EYDA 5I4DA 4HR7B 1E0BA 2IW3A 5J22A 3GV3A 2EYLA 5J1ZA 5I2XA 3DWPA 3K59A 3I8ZA 4XT3B 3K6OA 4CHTB 1G2SA 4HEDA 1EU4A 2EY6A 2EYPA 3I70A 3PO3B 1BBXC 2Z8LA 4XXEA 3NE5B 1I4QA 3GTOB 3BG3A 3NHHA 5E4XA 1AFPA 5KYLA 3MFGA 5LL6S 1XX8A 2B2YC 1LT4D 4RAUC 4V190 4QB4A 4G4KA 1U4RA 1XTCD 3S14B 3SXHA 2K32A 1OXUA 2XIWA 1A2TA 2VUMB 1OXVA 2B2VC 3OHXC 1TWHB 4DF7A 1EZ6A 1HQRD 1ZYRD 5IGCA 1AEXA 1F9RA 4H0LC 2PW7A 4ZUJA 2NN6I 2XSCA 3RLFA 1J9OA 2OXPA 5TSSA 4EQNA 1BDOA 2BDNA 3H6MA 1J8IA 4OO1I 3PMFA 2A74C 4BS9A 3H91A 3D4RA 3SK6A 3KF8A 2QILA 2HDLA 2Q8RE 3V2TA 1EY9A 3TMEA 2PW5A 3MXUA 1D1KA 2R6GA 3FPPA 4DU9A 2F1MA 3VR4A 5EKIA 1JQYD 4PNYA 1V1PA 2WIIB 1FYCA 1DZ1A 3EROA 2EJMA 2O5JC 3BYYB 1I4GA 3J81E 3KLSX 1ET9A 1XYIA 1SYEA 4A3JB 2NZ1D 2GA4B 2D5DA 1VDZA 3S1MB 3PO2B 3HKZB 3MAQA 4EQPA 2Q8IB 2AWNA 4FF2A 4XTCS 4KKSA 4RFBA 5C0XH 1IW7D 5CBAE 2F0LA 3L7ZC 4ID6A 1SNCA 3DM1A 3H94A 5IODA 4ILWA 2RBMA 5KEEA 3Q6SA 3D3RA 1KNAA 5C4JB 1SYGA 1A3VA 1S5BD 2HDMA 1SFOB 3OSOA 2CHBD 3OMCA 2LFNA 5IGDA 3VR5A 2F3WA 1S5ED 4QIWB 3ERQA 2AQ3B 1XXGA 2ZXRA 1TWCB 3SK5A 3VR3A 3QG1A 5K36H 4DAVA 1HCZA 2F0SA 1PTOH 4XYOA 1PXUA 4KD3A 1QOHA 2V4DA 3FEWX 4KY7A 2EYFA 1I50B 1DXMA 4IQZA 4DN4M 2MPMA 2BA1A 4CJ0B 3K5LA 2RKSA 2X69A 5LHY1 4LMQD 2HUGA 2LMCB 5E4WC 2L5TA 4RHRA 5M5XB 2XRSD 1QCBD 3GTJB 4UAIA 1X32A 2WAQB 3SEBA 1TY2A 3NTIA 2WKCA 3PUVA 2VB3X 4KI0A 2O2LD 2XN9C 3Q0AA 4KN4C 4PMWA 2K7VA 4A3KB 3PIP3 4XDXA 5ELCA 4A3GB 5FK9C 4A3IB 3H0GB 3HOXB 5KYIA 1KDBA 4MIUA 4B08A 1AZQA 2VXWA 1AN8A 4FF3A 2MJ8A 2KVMA 1WTPA 2A5HA 1DYQA 2A6HC 2K1BA 4C2MB 4DFAA 4RKLA 2L55A 1ET6A 1UUPA 1QE6A 4FVMA 1RDPD 1LTGD 5HURA 5DAUA 4J8QA 4WORA 1OXTA 2AUKA 1LTAD 1EQTA 1Y1VB 3PV0A 3CKIB 3P1HA 4X3SA 1STEA 3DWAA 3S15B 1S4ZA 3MHBA 4DAYA 3CU7A 4JK1C 1G2TA 2RDHA 2IJ0A 2XRQD 2PNRC 2E2HB 1BF4A 1R4QB 3A8KE 5CMDA 2WP8J 1EYAA 1HRJA 1D5XC 4M8AA 1FGBD 2B2WA 1KAAA 4RA8A 4TKOB 4C3IG 3I72A 2O5IC 4KY5A 2XNAC 3VA5A 3J80E 2LKVA 3HZXA 4PV1C 2JA8B 2EZVA 4K5WA 1PFNA 5DM63 1SE2A 2PCFB 1EEFD 4DNRB 2BE5D 3HEJA 1DOKA 4IFDI 1JB3A 2FFKB 1SYBA 5KNCA 5FO9B 1Y8PB 2M2LA 1PDQA 1V1PB 2CQAA 4XIGS 5J39A 1CZWA 5K5PA 2NUCA 1WD0A 2M00A 1K8MA 3A55A 3LX0A 2RDFA 1T5XD 1MBYA 3K57A 1Q3LA 5C0XI 1Y69U 3TP7A 2JEAI 1XWEA 1L0YB 1JWMD 3C46A 4KV6A 2SDFA 4TSSA 1BQQT 3FVQA 1HHVA 5E3FA 3GO5A 1S5FD 4ZKBB 1NCVA 3K5NA 1VMCA 3K5OA 4G7ZC 4FXKC 2DY7A 1Q90A 3P75A 1Q1EA 4DXGA 2F0JA 4FO2A 2B8GA 5D65A 3X3MA 1H9SB 1PTOB 1CI3M 2B2TC 2FMMA 2J0TD 5CV4A 1GUNA 1QWYA 2JA5B 3IFTA 4C3JB 5EKKA 2FINB 1DM0B 4C1NK 2K28A 2KEDA 2XWBB 1IYUA 4FF1A 5C6AA 3RUZA 1ONLA 4YIJA 4X3KA 2IPKD 5NUCA 3G7LA 4WJWA 2X6LA 2NTSA 3I3CA 3NWTA 2EYOA 1WTOA 3PIO3 2N88A 4ZUIA 3EFXD 5C0XG 1FNVA 2PMZB 4G57A 2PZWA 2IX0A 2J7ZA 3HRZC 3HOUB 1A6XA 1SEBD 1TWAB 1O78A 2PO4A 3I91A 3M7GA 4EGVA 5DM73 3DHQA 3S1RB 1Y1WB 4ZK9B 3E5SA 1CFMA 5IT9L 1JCKB 3A7LA 1CHPD 2TSSA 1ENCA 3GD7A 4HSVA 2IT1A 2D2CC 1CM9A 1WCMB 2RSNA 1E2VA 1H9MA 5JPMC 3M3YB 3E0JA 4IALA 1HXYD 2CW0C 4LAAA 2K01A 2B63B 1EEID 2JA7B 1RTOA 3S2DB 1TKWB 4KD4A 3MFYA 3IAYA 2L12A 3I90A 1SE3A 3EQLC 3HG9A 2R92B 1SYFA 1WTXA 3TZDA 4A3BB 1W6JA 2NB0A 1JWUD 3D6WA 4C3JG 4J6HA 1TWFB 4FNFA 5EBCA 2HQEA 1Z7TA 4NMZA 2PYKA 3BYTB 1F2ZA 2K03A 3I4MB 1K8OA 4C3HB 2IX3A 1ICWA 2XWJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B9X A;  3SK5 A;  4K2L A;  5ISR A;  4H7B A;  3TP7 A;  2EXZ A;  3DHQ A;  2EY1 A;  3TP8 A;  2KQ3 A;  2F0N A;  3T16 A;  3V2T A;  4DF7 A;  2QDB A;  5C4Z A;  5IIF A;  1EY9 A;  4IZ8 A;  4DGZ A;  1JOQ A;  1STN A;  2F0G A;  4K2K A;  3TME A;  4B9W A;  4PMC A;  4HMI A;  2PW5 A;  1EYD A;  5EKL A;  1EZ8 A;  3E5S A;  4EQO A;  5I9P A;  2F0S A;  5CGK A;  1SNP A;  1SYC A;  5KRU A;  4KV6 A;  3MZ5 A;  5C3X A;  2KHS A;  4ZQ3 A;  4F8M A;  5IOC A;  5E3F A;  1EY4 A;  1EY0 A;  4N9T A;  5C3W A;  4DU9 A;  4K8I A;  5HUR A;  3DMU A;  5J22 A;  2F0P A;  3NXW A;  4KD3 A;  2EYL A;  4I65 A;  2F3V A;  1ENC A;  5J1Z A;  5KGU A;  5EGT A;  3NUC A;  2EYF A;  3BDC A;  3C1F A;  4KY7 A;  4PNY A;  1JOK A;  2F0M A;  2PZU A;  4WOR A;  5DAU A;  1EYC A;  3EVQ A;  5CV7 A;  3ERO A;  5CV5 A;  2RKS A;  4S3S A;  2ENB A;  1JOR A;  1SNM A;  3P75 A;  5C5L A;  3P1H A;  2F0J A;  3SR1 A;  4TRD A;  3D8G A;  5I6Y A;  1KAB A;  1SYE A;  4E6I A;  2EY6 A;  2EYP A;  5IGG A;  4NP5 A;  1SYD A;  3ITP A;  3MXP A;  2F0H A;  5I6W A;  4KTA A;  3MHB A;  1TQO A;  3QB3 A;  5CV6 A;  2F0F A;  1EY8 A;  2F0W A;  4EQP A;  2SNS A;  2F0O A;  4IAL A;  3C1E A;  4KJN A;  5CV4 A;  3NHH A;  3S9W A;  4RKB A;  2SOB A;  5KIX A;  5KYL A;  5EKK A;  1EYA A;  5HGT A;  3NK9 A;  4NKL A;  4LAA A;  1F2M A;  1EY5 A;  3T13 A;  1II3 A;  3BDL A;  1A2U A;  2PZT A;  5CC4 A;  1STH A;  1RKN A;  2EYH A;  1KAA A;  3U9O A;  1STG A;  2F0T A;  4K6D A;  3TP5 A;  4K8J A;  4PMB A;  5JAV A;  4KY5 A;  1SND A;  1TT2 A;  3VA5 A;  3TP6 A;  4ODG A;  1F2Y A;  2EYM A;  5C6A A;  5C5M A;  5I9O A;  3RUZ A;  1JOO A;  2F0L A;  2F0D A;  1STA A;  1STY A;  2LKV A;  2OF1 A;  2SNM A;  1TR5 A;  3HZX A;  1NSN S;  4KD4 A;  4QMG A;  4QB4 A;  4YIJ A;  5DEH A;  5IGE A;  2EY5 A;  3SHL A;  4WRD A;  4K14 A;  5NUC A;  4K5W A;  1SYF A;  4QF4 A;  4ID6 A;  4K5V A;  5CR3 A;  1SNC A;  3D4W A;  2EY2 A;  5F2D A;  3SXH A;  5IGB A;  3MEH A;  4F7X A;  1EQV A;  5M9O A;  3MVV A;  4J1M A;  1A2T A;  1EY7 A;  5E1F A;  4N9P A;  5IOD A;  1ENA A;  4K5X A;  4EVO A;  1A3U A;  5CV8 A;  3D6C A;  2EYO A;  1NUC A;  1U9R A;  1EZ6 A;  5JOB A;  2OEO A;  2RBM A;  3HEJ A;  3QOL A;  4J6H A;  3D4D A;  3SK4 A;  2F0I A;  5C4H A;  4ME5 A;  5IGC A;  3EJI A;  5KEE A;  1SNQ A;  1AEX A;  4NDX A;  2F0E A;  2EYJ A;  5KYI A;  1KDB A;  1SYB A;  2PW7 A;  4MIU A;  4ZUJ A;  4HMJ A;  5CV9 A;  2OXP A;  1IHZ A;  2O4X A;  4ZUI A;  1A3T A;  4EQN A;  2HQE A;  2PQE A;  5J39 A;  3OWF A;  1SYG A;  1A3V A;  2F0V A;  3SK8 A;  3NQT A;  4RKL A;  3QOJ A;  3OSO A;  4G57 A;  3OMC A;  4HTH A;  4KY6 A;  4IUN A;  4OL7 A;  2PZW A;  5IGD A;  5K5P A;  2NUC A;  4NMZ A;  2PYK A;  2M00 A;  1F2Z A;  2F3W A;  3H6M A;  1SNO A;  3LX0 A;  4KJO A;  1KDA A;  2F0K A;  2RDF A;  3PMF A;  5IGF A;  1KDC A;  3R3O A;  1EY6 A;  2F0Q A;  2WAC A;  2F0U A;  4R8N A;  3ERQ A;  3OMG A;  1STB A;  3NP8 A;  4DFA A;  4KHV A;  3SK6 A; 
#chains in the Genus database with same CATH topology
 4JYA Q;  1SE4 A;  2K5D A;  3ZYY X;  4H7B A;  4IO9 A;  1U4M A;  3A8I E;  2BH8 A;  2NN6 G;  3CRL C;  1PRT C;  4IZ8 A;  2RA4 A;  3NQI A;  2F0G A;  2RCN A;  3PUX A;  2KHS A;  4F8M A;  3G48 A;  4JI2 Q;  2OT2 A;  4BA2 I;  4BBR B;  5CBE E;  2KJX A;  3JAM E;  1UEA B;  3RMH A;  5CV7 A;  5C44 G;  4FF4 A;  4DUY Q;  1PTO F;  3WOE A;  4A3D G;  2PPB C;  4BBR H;  3CAM A;  4JI4 Q;  1IBM L;  3T51 B;  1GUO A;  1PZI D;  4TRD A;  1TWA H;  4JI7 L;  1SYD A;  1LM0 A;  2MO0 A;  2MO1 A;  1XTD A;  5EPK A;  3HOW B;  3KF6 A;  1UWV A;  1DOM A;  3UDF A;  3RN2 A;  2UUA Q;  1K73 C;  5KIX A;  2I46 A;  4G7H C;  2EQS A;  2DN8 A;  2B8F A;  4NW2 A;  2YU9 B;  2FXQ A;  1CKM A;  2CW0 D;  3W2D A;  1PHJ A;  2JSO A;  3HOX H;  1SND A;  5I9O A;  1JIC A;  1WTV A;  3G4S A;  4A3I H;  3ONA B;  4OEL B;  4L8J A;  1X9N A;  3I73 A;  1WTW A;  4R1J A;  4NPS A;  1VQD A;  2B2U C;  1PZK D;  4ZAI A;  1HNZ L;  2MP1 A;  4RCN A;  4LF7 L;  1JOR A;  4O2D A;  4BY1 G;  1GD7 A;  1E2W A;  4AQY L;  3PIO A;  2RSO A;  4DV1 L;  1SJH D;  1M90 C;  1MJC A;  1JJC B;  4DA2 A;  2B2U A;  3FMC A;  4U67 3;  1YNX A;  2JEB I;  4HTH A;  2MUY A;  4GZY C;  1YHA A;  4KJO A;  5ELN A;  1MIU A;  2C9O A;  4KK7 A;  2R92 G;  2L1B A;  2F0Q A;  2L9H A;  1IBM Q;  4R8N A;  4JI5 Q;  4DR4 Q;  1N34 L;  1EUJ A;  1PV4 A;  2AQ1 B;  3I55 A;  3J7A V;  4CJ1 B;  2QEX A;  1BCP B;  4JI2 L;  2WIN B;  1LTR D;  1EFI D;  1STN A;  1H95 A;  3KLS A;  2J4X A;  1SMY C;  5EKL A;  5KNB A;  1NNX A;  1AW7 A;  1BCP D;  4LF5 L;  1C7Y A;  3NBI A;  2H5X A;  4N9T A;  3GTK B;  2VY3 A;  4K8I A;  3DMU A;  5EJW A;  3E6Z X;  2JXM B;  1PH7 A;  3CC2 A;  2YTV A;  1NMF A;  3MXN B;  4OEM B;  1B3A A;  1ZXT A;  5FLX L;  3EVQ A;  1JE4 A;  1C4Q A;  2MQH A;  4HAE A;  4A3E H;  2Y0S E;  1YNN C;  5IYB G;  2ALY B;  2ZXO A;  3SR1 A;  1F9Q A;  4E6I A;  1B9M A;  2FJ2 A;  3GP7 A;  4XQQ A;  3BDO A;  3WDN A;  3RN5 A;  2F0H A;  5ELB A;  1ILP A;  1XPO A;  1RIP A;  2CFM A;  1FGU A;  5BR8 Q;  3F2D A;  4A3G G;  4EQ5 A;  2WFW A;  3QWN A;  1CQV A;  3H0G G;  2WB1 B;  1FJG Q;  1LAC A;  4DV3 L;  5AJ3 Q;  4LF9 Q;  1BXT A;  1OO9 B;  4NKL A;  5EQ0 A;  3TQY A;  3BDL A;  3ULJ A;  1X3Q A;  1TII D;  3GV6 A;  1E2Z A;  3U9O A;  1STG A;  2L0C A;  4A3B G;  4A3D B;  3CPW A;  1HA5 A;  4P75 A;  4LF6 L;  2E75 C;  2KOL A;  1B8A A;  4HJ8 A;  4DV5 L;  3FPU B;  1K3R A;  2ICE C;  5LL6 X;  1HUM A;  1CKO A;  5T1I A;  4B9X A;  5BN3 A;  1EIY B;  3Q22 A;  3M9B A;  2AHO B;  3S17 H;  3W1B A;  3SHL A;  4DV5 Q;  1GVP A;  1KLU D;  2DGY A;  5C3E B;  1BO0 A;  4GLV B;  4LK1 C;  1VQB A;  3MVV A;  1IYV A;  4LFC Q;  3LWU A;  1CA6 A;  5LMU Q;  1SDF A;  4K5X A;  4EVO A;  5JVH 3;  1PFS A;  2KUM A;  1YHQ A;  1RJT A;  1D5Z C;  2JA5 G;  1DJR D;  2Y0S B;  1VQI A;  2B39 A;  2RCF A;  1JC7 A;  4RCO A;  4R4I A;  2MGS A;  3A5U A;  4V0B A;  2QKI C;  2KCC A;  2BA0 A;  4LWC A;  2R93 H;  2TMP A;  2KCN A;  4OL7 A;  1C48 A;  1YBY A;  4WRD A;  2LS0 1;  2QA4 A;  1LAB A;  3HOY B;  3FKI G;  1NY4 A;  5D3I B;  1PH4 A;  4CDD C;  1AP0 A;  3J7Y W;  1L0W A;  1WTR A;  4QUF A;  4GKJ L;  3KK7 A;  3RD4 A;  5A2Q L;  1XPR A;  2NVQ B;  1B4O A;  4B9W A;  1LV9 A;  2RHS B;  3PQI A;  4ZQ3 A;  3TN2 A;  1Z47 A;  2QCP X;  3K58 A;  4G7O C;  1KIX A;  4BWG B;  2ZT9 C;  5EGT A;  4A3L G;  2HQL A;  4C1N I;  4BXX G;  2OQK A;  3J80 i;  3A8J E;  2VUM H;  1M4V A;  2BE5 C;  1IKL A;  3I4N H;  4RH6 A;  4X6A H;  2Z6K C;  2LY7 A;  3KYH C;  2F3I A;  4A3M B;  1NJI C;  3HOU G;  4F88 A;  3CCR A;  4RMF A;  3FKI H;  1S5D D;  1ZEQ X;  4RHS A;  1QIL A;  1CHQ D;  5JEA G;  5FLM H;  1JWS D;  1UE5 A;  2E5L L;  2JJQ A;  1B1Z A;  2F0W A;  4GOP A;  2DNE A;  3NEN A;  1YNJ C;  3K0Y A;  4Q0F A;  1IKM A;  3BZK A;  2AKW B;  4DR1 L;  1EIF A;  1AZP A;  2HHH Q;  1NE3 A;  3T56 B;  3URY A;  1R9T B;  3AEV A;  1WVL A;  1EY5 A;  1F2M A;  1VQF A;  3T13 A;  3KLR A;  5CC4 A;  2EYH A;  1HFG A;  1FL0 A;  3TP5 A;  2F03 A;  4A3M H;  3HOV G;  4N8X 1;  2I5L X;  1F2Y A;  3I56 A;  3BZD B;  4OWW B;  1I4H A;  2F0D A;  1STA A;  1STY A;  3CRK C;  3NEL A;  4I7Z C;  4K14 A;  4TQU S;  3SE0 A;  2ASB A;  4ABN A;  5IGB A;  3J81 L;  1NAP A;  1BCP F;  1ESR A;  4IPC A;  4DR2 Q;  2E74 C;  1ENA A;  1A3U A;  1A62 A;  1U9R A;  3F2B A;  2CWP A;  1RTN A;  3H3V H;  4ZYS A;  1V8Q A;  2ZJQ A;  1RD9 D;  3ULL A;  3U50 C;  1LTB D;  3OWE B;  4JI1 L;  1EOT A;  4P72 A;  3AB9 A;  3M4Y A;  5JPN C;  3I4M H;  5IYC G;  1QVC A;  4X65 L;  4KHV A;  3UI2 A;  1BBU A;  1CKN B;  3VDY A;  3RZO B;  4GNX C;  3OTO Q;  2QDB A;  3Q8D A;  4DAY B;  5IIF A;  1EQR A;  4DV6 Q;  5I9P A;  3OIP A;  1MI2 A;  1DOL A;  5CGK A;  1SNP A;  5IP7 G;  1QG7 A;  1CT1 D;  4FXD A;  3ERS X;  4AYB B;  5M3F B;  3KDF A;  4JI5 L;  4IUP A;  4GKK Q;  4LF8 L;  1VMP A;  1QZH A;  3S17 B;  4RGO S;  1A8V A;  4IUV A;  4IFD G;  2JA6 B;  4S3S A;  5IYD G;  3CME A;  1SNM A;  2V1C C;  2CCZ A;  2KHJ A;  2E2I B;  3O13 A;  5A35 A;  4DV1 Q;  3WOF A;  2WV6 D;  1YNN D;  3S2D H;  5I6W A;  5ELF A;  3K7A B;  1YVC A;  1TQO A;  3QB3 A;  5M3M G;  1O80 A;  1QNK A;  3IKJ A;  3A74 A;  1GUT A;  2SNS A;  5FOB B;  3W1G A;  3VA7 A;  1F9S A;  2NVY H;  1HNZ Q;  1O7Y A;  2QDL A;  3AYH B;  2BDO A;  3S1Q H;  2Z4H A;  3FDT A;  3PUY A;  2NVT H;  2D9U A;  3NK9 A;  2K6A A;  4XT1 B;  1II3 A;  3Q24 A;  4R4Q A;  1STH A;  3U58 A;  2JA8 G;  5JEA J;  3LNN A;  4A3E G;  2FHT A;  4HIK A;  1E1O A;  1ASY A;  1IBK Q;  2KEN A;  3T16 A;  4DGZ A;  3Q23 A;  1VS0 A;  1W3S A;  3GTM B;  3QIA A;  1UEB A;  1L1O C;  4FXG C;  5IY0 A;  3J7A 5;  4QF4 A;  4UP7 A;  1GXD C;  3CCQ A;  4BBS B;  1HNW Q;  1EQV A;  3DXJ C;  2HHH L;  3CD6 A;  1YI2 A;  1HZB A;  1SSO A;  1OTC A;  1F2L A;  3CCJ A;  5M5Y B;  3D6C A;  1NUC A;  4XQJ A;  4KKU A;  2VB2 X;  1KLG D;  2B2V A;  5COR A;  4GNX A;  4LFA Q;  1VF5 C;  1XNR L;  2XVS A;  2F0V A;  3OWF A;  4JBJ A;  3NQT A;  2Q2U A;  2WKD A;  3T4A C;  4IUN A;  3PO2 H;  2K05 A;  2IY5 B;  2ZXP A;  1EU3 A;  1X55 A;  4DAP A;  4MZ9 A;  1HZ9 A;  1PYW D;  1PH1 A;  1Y1V H;  3J81 c;  1GHJ A;  4L5T A;  4H13 C;  4Q5V A;  1W6K A;  5JEA H;  5FLM G;  4M1U B;  2EY1 A;  3TP8 A;  2H1E A;  4YY3 Q;  1TXY A;  4A93 B;  1JOQ A;  2E2D C;  2JE6 I;  2QF7 A;  3G6E A;  4HMI A;  3TS2 A;  1GHK A;  1EZ8 A;  2NBF A;  1HQM C;  2IWH A;  3AFQ A;  4JYA L;  3HOV H;  4POG A;  3P7J A;  4IPD A;  1EY0 A;  2K5H A;  3TRE A;  1PTO C;  2OQ0 A;  3E9H A;  2QW7 A;  4H02 A;  1S5C D;  4I65 A;  3BS1 A;  2A1A A;  3GTK H;  4C3I H;  2N49 A;  3BVM A;  1EYG A;  1KRS A;  1IBL L;  4C3I B;  1PH5 A;  1FD7 D;  2K5W A;  1BCP C;  4JW0 A;  2L4N A;  2X6G A;  3GTQ B;  1VCI A;  1SMY D;  3HFZ B;  1HZA A;  4MTN A;  3I4M G;  5I6Y A;  2K4K A;  1KAB A;  3NTK A;  2NVT B;  1J5E L;  4DR7 L;  1CTM A;  1T5E A;  4ZLT F;  4PZ7 A;  1OXS C;  3NSW A;  2A8V A;  3L3O C;  1I6V C;  3VYT A;  3C1E A;  1ICF B;  4KJN A;  1MJE A;  4F87 A;  3J7A F;  4C3J H;  4P2C B;  4JI6 L;  4DR3 Q;  4KKT A;  1HNW L;  2R93 G;  4YWK A;  5IP9 G;  4YHH Q;  4A3J H;  2N3S A;  2K52 A;  4B3T Q;  2IHF A;  5AJ3 L;  1FJG L;  4BXX H;  1Y1V G;  4K8J A;  2YYZ A;  1N33 Q;  4WJ3 M;  2DJF C;  2NTT A;  3EN2 A;  1B9N A;  3TP6 A;  4GOP C;  1VQ8 A;  1V1O A;  1JOO A;  3KBG A;  3M7N A;  3PUZ A;  1PRT B;  5IGE A;  4BY7 G;  1IL8 A;  2EY5 A;  1TVX A;  2A6E C;  2A69 D;  4GLX A;  2R7Z G;  1GUW A;  3MEH A;  3D0F A;  1EWI A;  1PRT F;  4N9P A;  1G29 1;  2OEO A;  3HOW G;  3GTG H;  1MHW C;  3CW2 C;  3EJI A;  3BJU A;  3M3Y H;  3S1N B;  1I3Q B;  2HCI A;  3VYR A;  1HR0 Q;  1B2T A;  1GUS A;  1AE3 A;  2A68 C;  4KY6 A;  3J80 c;  3N52 A;  2MFI A;  2VQF L;  1PH8 A;  2C35 B;  5CV5 A;  1KD1 C;  3GTQ H;  1SNO A;  2F0K A;  3R93 A;  1EY6 A;  1HUN A;  1UAP A;  1BVS A;  4AYB E;  1STB A;  4A3G H;  2EDG A;  4GOP B;  3CXC A;  1NR4 A;  3KDF B;  2JQO A;  3OTO L;  3W5O A;  3DEO A;  4K6L A;  1WTQ A;  3CHB D;  5CYU A;  3U4Z A;  5C4X B;  3MZ5 A;  2JK8 A;  3OOC A;  1M8A A;  3NWS A;  4CBV A;  3M4O B;  3HKZ G;  1V43 A;  4L63 B;  4MN3 A;  1DON A;  2XGT A;  3S16 B;  2OWO A;  3D8G A;  1RF2 D;  1BOS A;  1PRT D;  1R9T H;  4TVA B;  4JG2 A;  4C56 C;  2A69 C;  2A6E D;  4PZ8 A;  4R9W A;  5JVG 3;  3STB D;  1PFB A;  2B63 H;  5LMN L;  5M3M B;  2AWO A;  1DD2 A;  3R2T A;  4QJF A;  1I4X A;  5M5W B;  5GAD C;  2SOB A;  2R3Z A;  4IPH A;  5ELO A;  1D1I A;  3A56 A;  5D14 A;  4RGN A;  5ELE A;  4YHH L;  2AMC B;  5H1S E;  3F2U A;  1SXT A;  4JI6 Q;  3KJO A;  1TT2 A;  1LTT D;  4IFD H;  2EJG C;  5IYD H;  1PH9 A;  1WD1 A;  3HOY G;  3HP3 A;  5D3D A;  5GRO A;  3N6R A;  4DR7 Q;  5K36 G;  2UU9 Q;  5CR3 A;  4K5V A;  5F2D A;  4HID A;  2EY2 A;  3AMU A;  1LTS D;  1EY7 A;  5IWA Q;  3GTG B;  2UUA L;  1O7Z A;  1ESF A;  2NN6 H;  3S1Q B;  2E76 C;  2DY8 A;  3VR2 A;  5T1G A;  3EIV A;  3A0J A;  3QOL A;  4MHE A;  4OO1 G;  3D4D A;  5C4X H;  2F0I A;  4JBK A;  1B44 D;  3HGB A;  2JA7 H;  4FDB A;  4X3U A;  5FJ8 H;  4JI7 Q;  3S1M H;  4Y52 H;  1PTO D;  1IHZ A;  1PMR A;  3DUZ A;  3E9I A;  3R8B A;  4L5R C;  1Y8O B;  3C3L A;  4A3J G;  3DLL A;  2DNC A;  1XNQ L;  1B53 A;  1KDA A;  5EBD A;  1MSH A;  4YY3 L;  1KDC A;  5LMN W;  2K5Q A;  2R61 A;  1D5M C;  1ZKO A;  2F0U A;  1GJX A;  2PI2 E;  3CC4 A;  1ZYR C;  4YCW A;  1LT3 D;  4JOI C;  4PZ6 A;  3L0O A;  1M1K C;  4J15 A;  4LUV A;  2NYZ D;  4K2L A;  1VQL A;  3V05 A;  5ISR A;  4QIW E;  4KN7 C;  1GOZ A;  4A3F H;  4HCE A;  3UE1 A;  4O42 A;  4K2K A;  4LJZ C;  4EQO A;  4PMC A;  5C4X G;  1QJO A;  2SEB D;  4ULL A;  2HIV A;  5JJZ A;  5KRU A;  2ICI A;  4GN4 B;  5C3X A;  2OTJ A;  1H9R A;  2VZA A;  1EY4 A;  1EIH A;  4WFN 3;  5HY6 A;  4OGQ C;  1U0L A;  5KGU A;  3NUC A;  3BDC A;  4JI4 L;  3CQZ B;  2F0M A;  1EYC A;  1GUG A;  2ZTD A;  1ILQ A;  2ENB A;  2UUB L;  4GLA C;  1EIG A;  5G3L D;  3A7A B;  5IGG A;  2K14 A;  1I4R A;  3DEP A;  5KND A;  3RZD B;  2R7Z H;  4KTA A;  4JV5 L;  1K83 B;  3T1H L;  2F0F A;  1EY8 A;  4ZRZ A;  2ID0 A;  3HOZ B;  1LT6 D;  4LFC L;  2E2I H;  1K83 H;  4Z9C B;  1O7I A;  5HGT A;  4A3F G;  1VQ9 A;  2R7Z B;  2IL8 A;  3SGI A;  2PZT A;  2F4I A;  1P8L A;  2F0T A;  5M5X H;  4BBS G;  4YWL A;  3RLO A;  2CH4 W;  3OIQ A;  1L1O B;  1IXR A;  1X3E A;  4Y7N H;  1G91 A;  4A3L H;  5DEH A;  2IHE A;  5EPL A;  1C0A A;  4L6T B;  2PI2 A;  3J81 i;  2Q2T A;  1Q12 A;  1Q82 C;  1XPU A;  1K0S A;  4RGT A;  1IBL Q;  2YV5 A;  4DK0 A;  4F7X A;  4ME3 A;  2NZO A;  4JPB W;  1PFM A;  4LUZ A;  4HCS A;  5CV8 A;  4JBM A;  2EPB A;  3FRP B;  2ES2 A;  3L9A X;  4X62 L;  2JYO A;  2F0E A;  2M9V A;  1QNU A;  3G71 A;  1VQK A;  2QEJ C;  4HMJ A;  4KHZ A;  4O1N A;  5FLX E;  1EL0 A;  1CZG A;  1A15 A;  2PQE A;  1EWC A;  1UE1 A;  1CA5 A;  4X3T A;  4DPG A;  2EXD A;  5A2Q E;  3X3N A;  4B3S Q;  3S2H B;  1LO5 D;  4RGM A;  4DR3 L;  1X3P A;  2IX1 A;  2VNU D;  1SAP A;  1VF7 A;  3RR5 A;  3PUW A;  2WAC A;  2CVR A;  1RHP A;  2Y0S G;  4A3C H;  1TWH H;  3MXN A;  1HNX Q;  3JAM c;  2F0N A;  1XMQ Q;  1X6O A;  4LFA L;  3LWE A;  2Z6B A;  2PQA A;  1C8C A;  4OO1 H;  1MSG A;  3OW7 A;  5FKA C;  5GQO A;  1HTP A;  2Z4I A;  2I07 B;  3TEH B;  5IOC A;  4DK1 A;  5FO7 B;  3GTP B;  2F0P A;  1HFN A;  1TS5 A;  3KF6 B;  3C1F A;  4A3E B;  2MHV A;  1PA6 A;  1VQ6 A;  3T53 B;  4IUR A;  4DXF A;  2ATW A;  1EFW A;  3EA6 A;  1FNW A;  4A3F B;  3U9S A;  2R93 B;  2AQ2 B;  4NP5 A;  1I94 Q;  4HSP A;  3CMA A;  4GN3 B;  1PH6 A;  1LTI D;  4B3M Q;  4OIJ A;  3PCO B;  4LFB L;  1N32 L;  1GKH A;  2DJG C;  3ND8 A;  2VW9 A;  1VQH A;  3CC7 A;  1NBW A;  4ZKC B;  4QUC A;  4RKB A;  2E2J B;  1K28 A;  1H9K A;  3MC0 B;  1X56 A;  1A2U A;  1TU2 B;  1SRO A;  3I4L A;  1KTK A;  4K6D A;  5IT9 c;  2F4V L;  5AFW A;  5C44 B;  2NWG A;  4CJ2 C;  5JAV A;  3VR6 A;  3HS0 C;  3RNU A;  2UXC L;  4BBR G;  1YNJ D;  2OF1 A;  2LXK A;  4O0A A;  1NSN S;  4QMG A;  1XJV A;  1KRT A;  5DNF A;  3QJY A;  1FNU A;  3G6J B;  3D4W A;  3PF5 A;  4A3D H;  5M9O A;  1WOC A;  1SJE D;  5E1F A;  4APV A;  2BOS A;  4LF8 Q;  1D6E C;  1BNZ A;  1Q8I A;  2HD3 A;  1PZJ D;  1F9P A;  2RDG A;  1LT5 D;  1ROD A;  1SNQ A;  4QL5 A;  2K5N A;  3NPP A;  5CV9 A;  2C5C A;  3WWV A;  4B3M L;  3SK8 A;  4A3M G;  3QOJ A;  4N8F A;  1MGS A;  2CH4 A;  1TWG B;  3DWQ A;  3W3A A;  1B3Q A;  5IGF A;  5I2Y A;  4IUU A;  2L15 A;  3R3O A;  4CDF C;  2GVB A;  2EE1 A;  2FMC A;  1N32 Q;  3UDX A;  3V96 A;  1BUV T;  1UE6 A;  1Q46 A;  1QUQ B;  3AU7 A;  2EOT A;  3HOV B;  4H44 C;  2B63 G;  3H09 A;  1KNE A;  3K81 C;  5ELD A;  5EPJ A;  2Z0S A;  2G5D A;  3FP9 A;  4WJ4 A;  4DK6 C;  1T9H A;  1I6H H;  4OIK A;  2DUD A;  3FKI B;  3NXW A;  2KCM A;  2F3V A;  1DCZ A;  3JAM L;  4C3H G;  1U4L A;  3I4N B;  4POF A;  2JA7 G;  1JT8 A;  1H9S A;  3GQB A;  3BVZ A;  3TSS A;  5LMU L;  1Y14 B;  1Q1B A;  4UP8 A;  1I6H B;  1R4P B;  1XMQ L;  2AUJ D;  3ITP A;  2H4O A;  3MXP A;  1K9M C;  5IT9 E;  5COY A;  2Q2H A;  4NXN L;  3BVG A;  3IL8 A;  2N55 A;  4X65 Q;  1G6Z A;  1X3F A;  2F0O A;  5BN5 A;  3KUP A;  3VYS A;  2B2T A;  1SN8 A;  3S9W A;  3BU2 A;  2RF4 A;  3GTL B;  1UNS A;  4OHJ A;  1RKN A;  4JOI A;  4FP5 D;  4IUQ A;  2CWA A;  1LTL A;  3ER0 A;  3SVM A;  2K04 A;  1WFQ A;  4ODG A;  2EYM A;  2RVL A;  5C5M A;  1D2B A;  2SNM A;  2G9D A;  2HCC A;  3IRB A;  3BZC A;  3D31 A;  1U4P A;  1MD2 D;  4A3C G;  1TWG H;  2KEE A;  1F77 A;  2EVB A;  4MNO A;  2D0O A;  1TS4 A;  4J1M A;  1O7L A;  1QVG A;  2HT1 A;  1PYS B;  4PQX A;  3TS0 A;  2WB1 G;  3M4P A;  4ME5 A;  4LF4 Q;  3VYU A;  4CKB A;  1TS2 A;  1A3T A;  4A3B H;  2BCO A;  1HH2 P;  1MKH A;  1TS3 A;  3SDZ A;  4A3K H;  2RQX A;  4IUT A;  1VQA A;  3S1R H;  2PMZ E;  3TDQ A;  3M85 A;  1EWH A;  1XNQ Q;  1FR3 A;  1BBW A;  3NP8 A;  4BY7 B;  3KBX A;  2BH2 A;  1TY0 A;  4DR4 L;  4CGY B;  2KQ3 A;  5IP9 H;  3H3V I;  1HPC A;  1CK1 A;  1CSP A;  3OPO A;  4AH6 A;  5C3E G;  1SYC A;  4JBW A;  4DNT B;  2Z1C A;  4R8I A;  1EQQ A;  5C3W A;  4KMU C;  4CKC A;  4FYD A;  3A54 A;  4XQN A;  1AE2 A;  2I5M X;  5IWA L;  1JOK A;  2PZU A;  3TZU A;  5FO8 B;  2VS1 A;  4OXP A;  1G8Z D;  4GS3 A;  1KXL A;  3IFD A;  5C5L A;  4B3R Q;  4RG1 A;  4K0K Q;  2WB1 E;  2K33 A;  4HN7 A;  5G3L F;  1VQP A;  1I4P A;  1S40 A;  1BKB A;  1CQF A;  3MXG A;  3HOW H;  2B2W C;  1H9J A;  4UY8 C;  2B2Y A;  2JP1 A;  5CV6 A;  2A73 B;  2NVY B;  1K8A C;  4LF9 L;  4OX9 Q;  4Y7N B;  1JR0 D;  4BA1 I;  5IP7 H;  4BY1 B;  1E22 A;  3UE0 A;  1K3B C;  4NB3 A;  2D62 A;  2Q8T A;  4AIM A;  1VQJ A;  1PH3 A;  1PH2 A;  5C0X J;  2G9H D;  2L11 A;  4PMB A;  2NVX B;  5IYC H;  1LYL A;  1RCV D;  1Y8N B;  2ZJR A;  2XTI A;  1ENF A;  1TR5 A;  1S3O A;  4U68 A;  3C2P A;  3NTH A;  1BR9 A;  3QO2 A;  3QR8 A;  1NR2 A;  3LGJ A;  1L0X B;  1VQG A;  2UXC Q;  4RWS C;  1HA6 A;  1SMX A;  4LNQ A;  1OXX K;  2A68 D;  4LF7 Q;  2KA7 A;  4UDU C;  3ND9 A;  5JOB A;  2RHQ B;  3SK4 A;  3H3V C;  2VQE L;  5C4H A;  4NDX A;  2EYJ A;  5LMN Q;  2A6H D;  1IW7 C;  3J80 L;  3K5M A;  3PGZ A;  4YCU A;  2O4X A;  1J6Q A;  3MTS A;  3MA2 B;  4IPG A;  5L37 A;  5BN4 A;  1WCM H;  1YJN A;  1Z6H A;  3TBI B;  3R2I A;  1QUQ A;  2R7D A;  1JMC A;  4IN3 A;  4XYQ A;  1LLR D;  3OMG A;  1QB5 D;  1S72 A;  3MWY W;  1ML0 D;  1SBB B;  4X64 L;  4QCL A;  4CKE A;  4DR6 L;  3NBH A;  2EJF C;  2EXZ A;  1PLF A;  1HR0 L;  4IFD J;  1A0I A;  5C4Z A;  1B50 A;  3P20 A;  1HTL D;  2KEC A;  4P73 A;  1VQO A;  1EYD A;  1YJ9 A;  5I4D A;  5HGQ A;  4KHP Q;  4HR7 B;  1E0B A;  2IW3 A;  5J22 A;  3GV3 A;  2EYL A;  5J1Z A;  2ZJP A;  4BY1 H;  2N78 A;  3S24 A;  1K8G A;  5I2X A;  3DWP A;  3K59 A;  1SFO H;  3I8Z A;  4JCV E;  4XT3 B;  4LF5 Q;  3K6O A;  4CHT B;  4LW1 A;  4YWM A;  1G2S A;  1EOV A;  4HED A;  4DV4 L;  1EU4 A;  3AFP A;  2EY6 A;  3I70 A;  2CKZ B;  2EYP A;  3PO3 B;  1BBX C;  1Q8K A;  2Z8L A;  4CDE C;  3JAM i;  4XXE A;  3NE5 B;  4QQB X;  1PVO A;  1I4Q A;  1GO3 E;  5E7N A;  3GTO B;  3BG3 A;  3NHH A;  3KFU A;  5E4X A;  1AFP A;  5KYL A;  3MFG A;  3GTM H;  4ALP A;  5LL6 S;  1XX8 A;  2B2Y C;  2QGQ A;  4C3H H;  2B29 A;  3ZJY C;  1LT4 D;  4RAU C;  3J7Z C;  2I5H A;  4V19 0;  3M4O H;  4QB4 A;  4G4K A;  4AYB G;  5M3F G;  2Z6K A;  2E8G A;  1JB7 A;  1U4R A;  4X66 L;  1XTC D;  2GN5 A;  3SXH A;  3S14 B;  4DUY L;  2K32 A;  1N33 L;  1OXU A;  2XIW A;  3S14 H;  1A2T A;  2VUM B;  3NEM A;  1OXV A;  2B2V C;  4PG3 A;  3OHX C;  1TWH B;  2ZM6 L;  4DF7 A;  1EZ6 A;  1HQR D;  1ZYR D;  5GAG C;  5IGC A;  4QGU A;  5JJI A;  1AEX A;  1F9R A;  1WYD A;  4H0L C;  2PW7 A;  4ZUJ A;  2NN6 I;  2XSC A;  1I94 L;  3RLF A;  1J9O A;  2OXP A;  5TSS A;  4EQN A;  4NXN Q;  1BDO A;  3RZD H;  2R7F A;  3GTJ H;  3T1H Q;  1VQC A;  1J5E Q;  5GAE C;  2BDN A;  1WI5 A;  5FLX c;  3H6M A;  1J8I A;  2A19 A;  4OO1 I;  3PMF A;  3HOY H;  3K8A A;  2A74 C;  4BS9 A;  5JJK A;  4OWT B;  2UUB Q;  3H91 A;  3D4R A;  3SK6 A;  2E2H H;  4HJ5 A;  3KF8 A;  1LUZ A;  2QIL A;  2HDL A;  2Q8R E;  1XNR Q;  3V2T A;  1EY9 A;  3TME A;  2PW5 A;  3MXU A;  4UP9 A;  1HNX L;  1D1K A;  2R6G A;  3FPP A;  4DU9 A;  2F1M A;  3VR4 A;  5EKI A;  1G51 A;  2HIX A;  4GKJ Q;  1JQY D;  1FVI A;  4PNY A;  2B3G A;  1V1P A;  2WII B;  1FYC A;  2UXD L;  1DZ1 A;  3ERO A;  2EJM A;  1GM5 A;  3PO3 H;  5FJ8 G;  2O5J C;  4HJ9 A;  1TWC H;  3TRZ A;  3BYY B;  1I4G A;  3J81 E;  3KLS X;  1ET9 A;  1XYI A;  4JI0 L;  1JE5 A;  3S16 H;  1SYE A;  4A3J B;  2NZ1 D;  2ZTC A;  4X66 Q;  2GA4 B;  2D5D A;  1VDZ A;  4X62 Q;  3S1M B;  3PO2 B;  1X3G A;  3HKZ B;  3MAQ A;  4EQP A;  2Q8I B;  1C9O A;  2AWN A;  4FF2 A;  2KHI A;  4XTC S;  4IOA A;  1VQM A;  4KKS A;  3CCU A;  4RFB A;  5C0X H;  1IW7 D;  5CBA E;  3S2H H;  4DV0 Q;  4R4O A;  3CF5 A;  2F0L A;  3L7Z C;  2YTY A;  4JC0 A;  1CKN A;  4QY7 A;  2NZH A;  4ID6 A;  1SNC A;  3DM1 A;  1V1Q A;  4R4T A;  3H94 A;  4NXM L;  5C3E H;  2K50 A;  5IOD A;  2OCE A;  3GTP H;  3S1N H;  1E7Z A;  4GKK L;  4MTK A;  4ILW A;  2RBM A;  4DV7 L;  1SR3 A;  5KEE A;  3Q6S A;  3D3R A;  1VQ7 A;  1KNA A;  5C4J B;  1TWF H;  1NMG A;  2YTX A;  1SYG A;  1A3V A;  3S15 H;  1S5B D;  2HDM A;  1SFO B;  3OSO A;  2CHB D;  3OMC A;  2LFN A;  4P74 A;  4HIO A;  4UHV A;  5IGD A;  3VR5 A;  1HZC A;  2F3W A;  2Z9H A;  3K7A H;  3HKZ E;  4BY7 H;  3KOJ A;  1S5E D;  4QIW B;  3M4Q A;  4DR6 Q;  3ERQ A;  2AQ3 B;  1XXG A;  5C4J H;  2ZXR A;  4DNI A;  3HOX G;  4X64 Q;  1TWC B;  4JI1 Q;  3SK5 A;  2NVQ H;  4DUZ L;  3VR3 A;  3QG1 A;  4UPA A;  1G6P A;  5K36 H;  4DAV A;  1HCZ A;  2JA8 H;  4OON A;  1DGS A;  2F0S A;  1PTO H;  4XYO A;  1PXU A;  4DV6 L;  4A93 G;  4JI3 L;  3CCS A;  4KD3 A;  1QOH A;  2V4D A;  1P16 A;  5EAY A;  3FEW X;  1SE8 A;  2EYF A;  4KY7 A;  1I50 B;  1DXM A;  1NTG A;  4IQZ A;  4DN4 M;  2MPM A;  1VQ5 A;  2BA1 A;  3JC6 6;  4CJ0 B;  3K5L A;  2RKS A;  2X69 A;  5LHY 1;  4LMQ D;  3CQZ H;  1B70 B;  2HUG A;  2LMC B;  3K0X A;  5E4W C;  3J81 j;  1CUK A;  2L5T A;  4KHP L;  2VQF Q;  1I50 H;  4DV7 Q;  4RHR A;  1PYB A;  2XRS D;  5M5X B;  1L1O A;  2VQE Q;  1L2F A;  1QCB D;  3GTJ B;  5J3B A;  4UAI A;  3GTL H;  3CPF A;  1WCM G;  1X32 A;  1VQE A;  2JA9 A;  1TY2 A;  2WAQ B;  1CSQ A;  3SEB A;  3NTI A;  4YCV A;  2PQA B;  3HOZ H;  2WKC A;  1I5F A;  3PUV A;  2VB3 X;  1KC8 C;  2ZTE A;  1N9W A;  4DV0 L;  2JN4 A;  4KI0 A;  2O2L D;  3HKS A;  2XN9 C;  3Q0A A;  4KN4 C;  4PMW A;  2K7V A;  4DR2 L;  4A3K B;  3PIP 3;  3F8T A;  4XDX A;  2K75 A;  5M5Y H;  5ELC A;  4A75 A;  3HOU H;  3T1Y Q;  2E2J H;  4B3R L;  3KLW A;  4A3G B;  4CDC C;  5FK9 C;  4A3I B;  3H0G B;  3HOX B;  5KYI A;  1KDB A;  2UUC L;  4MIU A;  4B08 A;  4HIM A;  1AZQ A;  2VXW A;  1AN8 A;  3GTO H;  4K0K L;  4FF3 A;  2VL6 A;  2MJ8 A;  4P71 A;  4JI8 Q;  1KQS A;  2UXD Q;  2KVM A;  1WTP A;  2A5H A;  1DYQ A;  1IYJ B;  3A5Z B;  2A6H C;  2K1B A;  4C2M B;  3F2C A;  3CP0 A;  2JA6 G;  4DFA A;  5DLQ E;  4RKL A;  2E5L Q;  4GNX B;  1QZG A;  2L55 A;  1ET6 A;  1UUP A;  1N36 Q;  1K0R A;  4OX9 L;  1B7Y B;  1QE6 A;  4FVM A;  1YIJ A;  1RDP D;  1LTG D;  1VQN A;  5HUR A;  4DV2 Q;  1SRU A;  2D0P A;  2K5V A;  4IJL A;  5DAU A;  4J8Q A;  2JA5 H;  4LF4 L;  4WOR A;  1OXT A;  2AUK A;  1LTA D;  1EQT A;  4B3S L;  1Y1V B;  3PV0 A;  3CKI B;  4HJA A;  3P1H A;  4X3S A;  1STE A;  3H15 A;  5M3F H;  3DWA A;  2JA6 H;  3S15 B;  4LF6 Q;  1S4Z A;  3MHB A;  4DAY A;  3CU7 A;  4JK1 C;  1G2T A;  2RDH A;  2IJ0 A;  2XRQ D;  3CCL A;  2PNR C;  2E2H B;  1BF4 A;  1R4Q B;  3A8K E;  5CMD A;  2WP8 J;  1Q81 C;  1EYA A;  1HRJ A;  4A3K G;  3UDI A;  1D5X C;  4M8A A;  1FGB D;  2B2W A;  4DK3 C;  5BR8 L;  3RZO H;  1KAA A;  4RA8 A;  4TKO B;  4C3I G;  3I72 A;  2N8N A;  2O5I C;  1Q86 C;  4KY5 A;  2XNA C;  3VA5 A;  4JI8 L;  3B6Y A;  3J80 E;  2LKV A;  4IJH A;  3HZX A;  4PV1 C;  2JA8 B;  2I0Q A;  3PIP A;  2EZV A;  4B3T L;  4K5W A;  1PFN A;  1IBK L;  5DM6 3;  1D8L A;  1SE2 A;  2PCF B;  1EEF D;  3AQQ A;  5IYB H;  3ULP A;  3DM3 A;  1Q7Y C;  2MNA A;  4DNR B;  2BE5 D;  4L5Q A;  1X65 A;  1WJJ A;  3HEJ A;  1DOK A;  4IFD I;  4JV5 Q;  1JB3 A;  1ASZ A;  1YHB A;  3ICE A;  2FFK B;  1SYB A;  5C44 H;  5KNC A;  5FO9 B;  3HOZ G;  1Y8P B;  2M2L A;  1PDQ A;  1V1P B;  2CQA A;  4XIG S;  5J39 A;  1SLJ A;  1CZW A;  1W2B A;  4DV3 Q;  3K7U C;  2NUC A;  5K5P A;  1WD0 A;  2M00 A;  1K8M A;  3A55 A;  3LX0 A;  2RDF A;  1T5X D;  3E0E A;  1XMO L;  2UXB Q;  1MBY A;  3K57 A;  1Q3L A;  2OTL A;  4L5S A;  5C0X I;  4A3I G;  1Y69 U;  3TP7 A;  2JEA I;  2CQO A;  1XWE A;  1UE7 A;  1L0Y B;  1A63 A;  1JWM D;  3C46 A;  2Q2I A;  3H0G H;  4KV6 A;  2SDF A;  4TSS A;  1BQQ T;  3FVQ A;  4A4I A;  1HHV A;  5E3F A;  3GO5 A;  1S5F D;  5GAH C;  4ZKB B;  1NCV A;  3K5N A;  1V9P A;  1VMC A;  3K5O A;  4DV2 L;  2LSS A;  4G7Z C;  3PO2 G;  4FXK C;  2DY7 A;  1QVF A;  1Q90 A;  3P75 A;  1Q1E A;  4DXG A;  2F0J A;  4FO2 A;  2B8G A;  5D65 A;  3X3M A;  3I4O A;  3I2Z A;  1N36 L;  1H9S B;  1PTO B;  1CI3 M;  5IE8 A;  1N34 Q;  1D7Q A;  2B2T C;  2FMM A;  2J0T D;  3E3X A;  5CV4 A;  4DUZ Q;  1GUN A;  1HJP A;  1QWY A;  2JA5 B;  3IFT A;  4LUO A;  4OWX B;  4KLK A;  4C3J B;  2UU9 L;  5EKK A;  2FIN B;  1IZ6 A;  1YIT A;  1DM0 B;  2P5Z X;  4C1N K;  2K28 A;  2KED A;  2XWB B;  1IYU A;  3OYY A;  4FF1 A;  1U5K A;  1YEZ A;  4DR5 Q;  2UUC Q;  5C6A A;  3RUZ A;  4AQY Q;  1ONL A;  4IOC A;  4LFB Q;  4YIJ A;  4X3K A;  3PF4 A;  1WTH A;  2IPK D;  5NUC A;  3G7L A;  3T1Y L;  4WJW A;  4DR5 L;  2X6L A;  4I7A A;  4JI0 Q;  2NTS A;  3I3C A;  4EX5 A;  3FHW A;  3NWT A;  2EYO A;  2YU9 H;  2KCT A;  4DAM A;  4HJ7 A;  1WTO A;  4DR1 Q;  4A93 H;  1AH9 A;  3EBE A;  5JJL A;  3PIO 3;  4A76 A;  2N88 A;  4ZUI A;  1X54 A;  3EFX D;  5C0X G;  1FNV A;  2PMZ B;  3I7F A;  4G57 A;  3RLN A;  2NVX H;  2PZW A;  3MEF A;  1KL9 A;  2IX0 A;  2J7Z A;  1HR0 W;  3HRZ C;  3I4N G;  3HOU B;  3CCE A;  2F4V Q;  1A6X A;  1SEB D;  1TWA B;  1O78 A;  2PO4 A;  3I91 A;  3M7G A;  3K80 C;  1Y1W H;  4EGV A;  4JVZ A;  1YJW A;  5DM7 3;  3DHQ A;  3CCM A;  2LXJ A;  4DKA C;  4R4C A;  3S1R B;  1Y1W B;  4ZK9 B;  3E5S A;  1CFM A;  5IT9 L;  1JCK B;  3A7L A;  3KF8 B;  3KJP A;  1CHP D;  2TSS A;  1ENC A;  3GD7 A;  1E24 A;  4JI3 Q;  4BBS H;  4HSV A;  2IT1 A;  1RL2 A;  2D2C C;  3STB C;  2ZM6 Q;  4ZCK A;  1XMO Q;  2UXB L;  1CM9 A;  1WCM B;  2WAQ G;  1YZ6 A;  4GN5 A;  2RSN A;  1E2V A;  3GDE A;  1H9M A;  1I3Q H;  1E3P A;  5JPM C;  3M3Y B;  2WAQ E;  3E0J A;  5M5W H;  3PSI A;  4IAL A;  1HXY D;  2CW0 C;  4LAA A;  3U4V A;  2K01 A;  1EEI D;  1VQ4 A;  2B63 B;  2JA7 B;  1KHI A;  1IL2 A;  1RTO A;  3S2D B;  1TKW B;  2KBN A;  4KD4 A;  3UDG A;  2PNH A;  1KAW A;  3MFY A;  2R92 H;  3IAY A;  2L12 A;  3NBH B;  1SE3 A;  3EQL C;  3HG9 A;  3I90 A;  1Z9F A;  2R92 B;  1SYF A;  1WTX A;  1Y1W G;  4NXM Q;  3TZD A;  4A3B B;  3OW2 A;  4DV4 Q;  3F1Z A;  1W6J A;  2NB0 A;  1JJG A;  1JWU D;  3D6W A;  4C3J G;  4J6H A;  2EIF A;  1TWF B;  4FNF A;  3PO3 G;  5EBC A;  2F52 A;  2HQE A;  1E1T A;  3L2P A;  2VUM G;  1Z7T A;  4NMZ A;  2PYK A;  3BYT B;  1F2Z A;  2K03 A;  3I4M B;  1K8O A;  5M3M H;  4C3H B;  3CCV A;  2GVA A;  1JJ2 A;  2IX3 A;  4C2M H;  1N8R C;  1ICW A;  2XWJ B; 
#chains in the Genus database with same CATH homology
 1SE4 A;  2K5D A;  3ZYY X;  4H7B A;  1U4M A;  3A8I E;  2NN6 G;  3CRL C;  1PRT C;  4IZ8 A;  2RA4 A;  3NQI A;  2F0G A;  3PUX A;  2KHS A;  4F8M A;  4BA2 I;  2OT2 A;  4BBR B;  5CBE E;  2KJX A;  3JAM E;  1UEA B;  3RMH A;  5CV7 A;  4FF4 A;  1PTO F;  3WOE A;  2PPB C;  3T51 B;  1GUO A;  1PZI D;  4TRD A;  1SYD A;  5EPK A;  3HOW B;  1DOM A;  5KIX A;  2I46 A;  4G7H C;  2DN8 A;  2B8F A;  4NW2 A;  2YU9 B;  2CW0 D;  3W2D A;  2JSO A;  1SND A;  5I9O A;  1JIC A;  1WTV A;  3ONA B;  4L8J A;  3I73 A;  1WTW A;  2B2U C;  1PZK D;  4ZAI A;  2MP1 A;  4RCN A;  1JOR A;  1E2W A;  2RSO A;  1SJH D;  4DA2 A;  2B2U A;  3FMC A;  4U67 3;  2JEB I;  4HTH A;  2MUY A;  4GZY C;  4KJO A;  2C9O A;  4KK7 A;  2L1B A;  2F0Q A;  2L9H A;  4R8N A;  2AQ1 B;  3J7A V;  4CJ1 B;  1BCP B;  2WIN B;  1LTR D;  1EFI D;  1STN A;  3KLS A;  2J4X A;  1SMY C;  5EKL A;  5KNB A;  1AW7 A;  1BCP D;  3NBI A;  4N9T A;  3GTK B;  4K8I A;  5EJW A;  3DMU A;  3E6Z X;  2JXM B;  1B3A A;  1ZXT A;  5FLX L;  3EVQ A;  1JE4 A;  1C4Q A;  4HAE A;  1YNN C;  2ZXO A;  3SR1 A;  1F9Q A;  4E6I A;  1B9M A;  2FJ2 A;  3GP7 A;  4XQQ A;  3BDO A;  3WDN A;  2F0H A;  5ELB A;  1ILP A;  3QWN A;  1CQV A;  2WB1 B;  1LAC A;  1BXT A;  1OO9 B;  4NKL A;  5EQ0 A;  3BDL A;  1X3Q A;  1TII D;  3GV6 A;  1E2Z A;  3U9O A;  1STG A;  2L0C A;  4A3D B;  1HA5 A;  2E75 C;  2KOL A;  3FPU B;  2ICE C;  5LL6 X;  1HUM A;  5T1I A;  4B9X A;  5BN3 A;  3Q22 A;  3SHL A;  1KLU D;  5C3E B;  1BO0 A;  4LK1 C;  3MVV A;  1IYV A;  3LWU A;  1CA6 A;  1SDF A;  4K5X A;  4EVO A;  5JVH 3;  2KUM A;  1RJT A;  1D5Z C;  1DJR D;  2Y0S B;  2B39 A;  4RCO A;  1JC7 A;  2MGS A;  4V0B A;  2QKI C;  2KCC A;  2BA0 A;  2TMP A;  2KCN A;  4OL7 A;  1C48 A;  4WRD A;  2LS0 1;  1LAB A;  3HOY B;  5D3I B;  1AP0 A;  3J7Y W;  1WTR A;  4QUF A;  3KK7 A;  3RD4 A;  5A2Q L;  2NVQ B;  1B4O A;  4B9W A;  1LV9 A;  4ZQ3 A;  3TN2 A;  1Z47 A;  2QCP X;  3K58 A;  4G7O C;  4BWG B;  2ZT9 C;  5EGT A;  4C1N I;  3A8J E;  1M4V A;  2BE5 C;  1IKL A;  4RH6 A;  2LY7 A;  4A3M B;  4F88 A;  1S5D D;  1ZEQ X;  4RHS A;  1QIL A;  1CHQ D;  5JEA G;  1JWS D;  1B1Z A;  2F0W A;  2DNE A;  4Q0F A;  1YNJ C;  3K0Y A;  1IKM A;  1AZP A;  3T56 B;  3URY A;  1R9T B;  1WVL A;  1EY5 A;  1F2M A;  3T13 A;  3KLR A;  5CC4 A;  2EYH A;  1HFG A;  3TP5 A;  2F03 A;  1F2Y A;  3BZD B;  1I4H A;  2F0D A;  1STA A;  1STY A;  3CRK C;  4I7Z C;  4K14 A;  4TQU S;  3SE0 A;  4ABN A;  5IGB A;  3J81 L;  1NAP A;  1BCP F;  1ESR A;  2E74 C;  1ENA A;  1A3U A;  1U9R A;  1RTN A;  4ZYS A;  1V8Q A;  1RD9 D;  1LTB D;  3OWE B;  1EOT A;  3AB9 A;  3M4Y A;  5JPN C;  4KHV A;  3UI2 A;  3RZO B;  2QDB A;  5IIF A;  5I9P A;  3OIP A;  1MI2 A;  1DOL A;  5CGK A;  1SNP A;  1QG7 A;  1CT1 D;  4FXD A;  4AYB B;  5M3F B;  4IUP A;  1VMP A;  3S17 B;  4RGO S;  4IUV A;  4IFD G;  2JA6 B;  4S3S A;  1SNM A;  2E2I B;  3O13 A;  5A35 A;  3WOF A;  2WV6 D;  1YNN D;  5I6W A;  5ELF A;  3K7A B;  1TQO A;  3QB3 A;  1O80 A;  1QNK A;  3IKJ A;  1GUT A;  2SNS A;  5FOB B;  3VA7 A;  1F9S A;  1O7Y A;  2BDO A;  2Z4H A;  3FDT A;  3PUY A;  2D9U A;  3NK9 A;  2K6A A;  4XT1 B;  1II3 A;  3Q24 A;  1STH A;  5JEA J;  3LNN A;  2FHT A;  3T16 A;  4DGZ A;  3Q23 A;  3GTM B;  3QIA A;  4FXG C;  4QF4 A;  1GXD C;  4BBS B;  1EQV A;  3DXJ C;  1SSO A;  1F2L A;  5M5Y B;  3D6C A;  1NUC A;  4XQJ A;  4KKU A;  2VB2 X;  1KLG D;  2B2V A;  5COR A;  1VF5 C;  2XVS A;  2F0V A;  3OWF A;  3NQT A;  2WKD A;  3T4A C;  4IUN A;  2K05 A;  2ZXP A;  1EU3 A;  4DAP A;  1PYW D;  1GHJ A;  4H13 C;  4Q5V A;  1W6K A;  5JEA H;  4M1U B;  2EY1 A;  3TP8 A;  2H1E A;  4A93 B;  1JOQ A;  2E2D C;  2JE6 I;  2QF7 A;  4HMI A;  1GHK A;  1EZ8 A;  2NBF A;  1HQM C;  2IWH A;  3P7J A;  1EY0 A;  1PTO C;  1S5C D;  4I65 A;  3BS1 A;  3BVM A;  4C3I B;  1FD7 D;  2K5W A;  1BCP C;  2L4N A;  2X6G A;  3GTQ B;  1VCI A;  1SMY D;  5I6Y A;  1KAB A;  3NTK A;  2NVT B;  1CTM A;  1T5E A;  4ZLT F;  1OXS C;  3NSW A;  3L3O C;  1I6V C;  3VYT A;  3C1E A;  4KJN A;  4F87 A;  3J7A F;  4P2C B;  4KKT A;  4K8J A;  2YYZ A;  2NTT A;  1B9N A;  3TP6 A;  1V1O A;  1JOO A;  3KBG A;  3M7N A;  3PUZ A;  1PRT B;  5IGE A;  1IL8 A;  2EY5 A;  1TVX A;  2A6E C;  2A69 D;  1GUW A;  3MEH A;  1PRT F;  4N9P A;  1G29 1;  2OEO A;  3EJI A;  3S1N B;  1I3Q B;  2HCI A;  3VYR A;  1B2T A;  1GUS A;  2A68 C;  4KY6 A;  3N52 A;  5CV5 A;  1SNO A;  2F0K A;  3R93 A;  1EY6 A;  1HUN A;  1UAP A;  1STB A;  2EDG A;  1NR4 A;  3DEO A;  4K6L A;  1WTQ A;  3CHB D;  5CYU A;  5C4X B;  3MZ5 A;  3OOC A;  1M8A A;  3NWS A;  4CBV A;  3M4O B;  1V43 A;  4L63 B;  4MN3 A;  1DON A;  3S16 B;  3D8G A;  1RF2 D;  1BOS A;  1PRT D;  4C56 C;  2A69 C;  2A6E D;  4R9W A;  5JVG 3;  1PFB A;  5M3M B;  2AWO A;  1DD2 A;  3R2T A;  1I4X A;  5M5W B;  2SOB A;  2R3Z A;  1D1I A;  3A56 A;  5D14 A;  4RGN A;  5ELE A;  3F2U A;  1SXT A;  1TT2 A;  1LTT D;  4IFD H;  2EJG C;  1WD1 A;  3HP3 A;  5D3D A;  3N6R A;  5K36 G;  5CR3 A;  4K5V A;  5F2D A;  2EY2 A;  3AMU A;  1LTS D;  1EY7 A;  3GTG B;  1O7Z A;  1ESF A;  2NN6 H;  3S1Q B;  2E76 C;  2DY8 A;  3VR2 A;  5T1G A;  3QOL A;  4MHE A;  4OO1 G;  3D4D A;  2F0I A;  1B44 D;  3HGB A;  4X3U A;  1PTO D;  1IHZ A;  1PMR A;  3DUZ A;  3R8B A;  1Y8O B;  3C3L A;  2DNC A;  1B53 A;  1KDA A;  5EBD A;  1MSH A;  1KDC A;  2K5Q A;  2R61 A;  1D5M C;  1ZKO A;  2F0U A;  1GJX A;  1ZYR C;  1LT3 D;  2NYZ D;  4K2L A;  3V05 A;  5ISR A;  4KN7 C;  1GOZ A;  4HCE A;  4O42 A;  4K2K A;  4LJZ C;  4EQO A;  4PMC A;  1QJO A;  2SEB D;  4ULL A;  5JJZ A;  5KRU A;  2ICI A;  5C3X A;  1H9R A;  1EY4 A;  1EIH A;  4WFN 3;  4OGQ C;  5KGU A;  3NUC A;  3BDC A;  3CQZ B;  2F0M A;  1EYC A;  1GUG A;  1ILQ A;  2ENB A;  1EIG A;  5G3L D;  3A7A B;  5IGG A;  1I4R A;  3DEP A;  5KND A;  3RZD B;  4KTA A;  1K83 B;  2F0F A;  1EY8 A;  4ZRZ A;  2ID0 A;  3HOZ B;  1LT6 D;  4Z9C B;  5HGT A;  2R7Z B;  2IL8 A;  2PZT A;  2F4I A;  2F0T A;  3OIQ A;  1G91 A;  5DEH A;  5EPL A;  4L6T B;  1Q12 A;  4RGT A;  4DK0 A;  4F7X A;  1PFM A;  4HCS A;  5CV8 A;  2EPB A;  3FRP B;  3L9A X;  2JYO A;  2F0E A;  2M9V A;  1QNU A;  2QEJ C;  4HMJ A;  4KHZ A;  5FLX E;  4O1N A;  1EL0 A;  1CZG A;  1A15 A;  2PQE A;  1EWC A;  1CA5 A;  4X3T A;  5A2Q E;  3X3N A;  3S2H B;  1LO5 D;  4RGM A;  1X3P A;  2IX1 A;  2VNU D;  1SAP A;  1VF7 A;  3PUW A;  2WAC A;  2CVR A;  1RHP A;  3MXN A;  2F0N A;  3LWE A;  1C8C A;  4OO1 H;  1MSG A;  3OW7 A;  5FKA C;  1HTP A;  2Z4I A;  2I07 B;  5IOC A;  4DK1 A;  5FO7 B;  3GTP B;  2F0P A;  1HFN A;  1TS5 A;  3C1F A;  4A3E B;  2MHV A;  3T53 B;  4IUR A;  4DXF A;  3EA6 A;  1FNW A;  4A3F B;  3U9S A;  2R93 B;  2AQ2 B;  4NP5 A;  4HSP A;  1LTI D;  4OIJ A;  3ND8 A;  4ZKC B;  4QUC A;  4RKB A;  2E2J B;  1H9K A;  3MC0 B;  1A2U A;  1TU2 B;  3I4L A;  1KTK A;  4K6D A;  5AFW A;  5C44 B;  2NWG A;  4CJ2 C;  5JAV A;  3VR6 A;  3HS0 C;  1YNJ D;  2OF1 A;  1NSN S;  4QMG A;  5DNF A;  3QJY A;  1FNU A;  3G6J B;  3D4W A;  5M9O A;  1SJE D;  5E1F A;  2BOS A;  1D6E C;  1BNZ A;  1Q8I A;  1PZJ D;  1F9P A;  2RDG A;  1LT5 D;  1ROD A;  1SNQ A;  3NPP A;  5CV9 A;  2C5C A;  3SK8 A;  3QOJ A;  1MGS A;  1TWG B;  3DWQ A;  3W3A A;  5IGF A;  5I2Y A;  4IUU A;  3R3O A;  2EE1 A;  2FMC A;  3V96 A;  1BUV T;  3AU7 A;  2EOT A;  3HOV B;  4H44 C;  3H09 A;  1KNE A;  5ELD A;  5EPJ A;  4OIK A;  3FKI B;  3NXW A;  2F3V A;  1DCZ A;  3JAM L;  4C3H G;  1U4L A;  3I4N B;  1H9S A;  3GQB A;  3BVZ A;  3TSS A;  1Q1B A;  1I6H B;  1R4P B;  2AUJ D;  3ITP A;  2H4O A;  3MXP A;  5IT9 E;  5COY A;  3BVG A;  3IL8 A;  2N55 A;  1G6Z A;  2F0O A;  5BN5 A;  3KUP A;  3VYS A;  2B2T A;  3S9W A;  3GTL B;  1UNS A;  4OHJ A;  1RKN A;  4FP5 D;  4IUQ A;  3SVM A;  2K04 A;  4ODG A;  2EYM A;  2RVL A;  5C5M A;  1D2B A;  2SNM A;  2G9D A;  2HCC A;  3D31 A;  1U4P A;  1MD2 D;  2KEE A;  1F77 A;  2EVB A;  1TS4 A;  4J1M A;  1O7L A;  4PQX A;  4ME5 A;  3VYU A;  4CKB A;  1TS2 A;  1A3T A;  2BCO A;  1TS3 A;  3SDZ A;  2RQX A;  4IUT A;  3TDQ A;  3M85 A;  1EWH A;  1FR3 A;  4BY7 B;  3NP8 A;  3KBX A;  1TY0 A;  4CGY B;  2KQ3 A;  1HPC A;  1CK1 A;  3OPO A;  1SYC A;  4JBW A;  4DNT B;  2Z1C A;  4R8I A;  5C3W A;  4KMU C;  4CKC A;  4FYD A;  3A54 A;  4XQN A;  1JOK A;  2PZU A;  3TZU A;  5FO8 B;  1G8Z D;  3IFD A;  5C5L A;  2K33 A;  4HN7 A;  5G3L F;  1I4P A;  1CQF A;  3MXG A;  2B2W C;  1H9J A;  2B2Y A;  2JP1 A;  5CV6 A;  2A73 B;  2NVY B;  4Y7N B;  1JR0 D;  4BA1 I;  4BY1 B;  2D62 A;  2Q8T A;  5C0X J;  2G9H D;  2L11 A;  4PMB A;  2NVX B;  1RCV D;  1Y8N B;  1ENF A;  1TR5 A;  4U68 A;  3C2P A;  3NTH A;  1BR9 A;  3QO2 A;  1NR2 A;  1L0X B;  1HA6 A;  4RWS C;  1OXX K;  2A68 D;  2KA7 A;  4UDU C;  3ND9 A;  5JOB A;  3SK4 A;  3H3V C;  5C4H A;  4NDX A;  2EYJ A;  2A6H D;  1IW7 C;  3J80 L;  3K5M A;  2O4X A;  3MTS A;  3MA2 B;  5BN4 A;  1Z6H A;  3TBI B;  3R2I A;  4IN3 A;  4XYQ A;  1LLR D;  3OMG A;  1QB5 D;  3MWY W;  1ML0 D;  1SBB B;  4QCL A;  4CKE A;  3NBH A;  2EJF C;  2EXZ A;  1PLF A;  4IFD J;  5C4Z A;  1B50 A;  3P20 A;  1HTL D;  2KEC A;  1EYD A;  5I4D A;  4HR7 B;  1E0B A;  2IW3 A;  5J22 A;  3GV3 A;  2EYL A;  5J1Z A;  5I2X A;  3DWP A;  3K59 A;  3I8Z A;  4XT3 B;  3K6O A;  4CHT B;  1G2S A;  4HED A;  1EU4 A;  2EY6 A;  2EYP A;  3I70 A;  3PO3 B;  1BBX C;  2Z8L A;  4XXE A;  3NE5 B;  1I4Q A;  3GTO B;  3BG3 A;  3NHH A;  5E4X A;  1AFP A;  5KYL A;  3MFG A;  5LL6 S;  1XX8 A;  2B2Y C;  1LT4 D;  4RAU C;  4V19 0;  4QB4 A;  4G4K A;  1U4R A;  1XTC D;  3S14 B;  3SXH A;  2K32 A;  1OXU A;  2XIW A;  1A2T A;  2VUM B;  1OXV A;  2B2V C;  3OHX C;  1TWH B;  4DF7 A;  1EZ6 A;  1HQR D;  1ZYR D;  5IGC A;  1AEX A;  1F9R A;  4H0L C;  2PW7 A;  4ZUJ A;  2NN6 I;  2XSC A;  3RLF A;  1J9O A;  2OXP A;  5TSS A;  4EQN A;  1BDO A;  2BDN A;  3H6M A;  1J8I A;  4OO1 I;  3PMF A;  2A74 C;  4BS9 A;  3H91 A;  3D4R A;  3SK6 A;  3KF8 A;  2QIL A;  2HDL A;  2Q8R E;  3V2T A;  1EY9 A;  3TME A;  2PW5 A;  3MXU A;  1D1K A;  2R6G A;  3FPP A;  4DU9 A;  2F1M A;  3VR4 A;  5EKI A;  1JQY D;  4PNY A;  1V1P A;  2WII B;  1FYC A;  1DZ1 A;  3ERO A;  2EJM A;  2O5J C;  3BYY B;  1I4G A;  3J81 E;  3KLS X;  1ET9 A;  1XYI A;  1SYE A;  4A3J B;  2NZ1 D;  2GA4 B;  2D5D A;  1VDZ A;  3S1M B;  3PO2 B;  3HKZ B;  3MAQ A;  4EQP A;  2Q8I B;  2AWN A;  4FF2 A;  4XTC S;  4KKS A;  4RFB A;  5C0X H;  1IW7 D;  5CBA E;  2F0L A;  3L7Z C;  4ID6 A;  1SNC A;  3DM1 A;  3H94 A;  5IOD A;  4ILW A;  2RBM A;  5KEE A;  3Q6S A;  3D3R A;  1KNA A;  5C4J B;  1SYG A;  1A3V A;  1S5B D;  2HDM A;  1SFO B;  3OSO A;  2CHB D;  3OMC A;  2LFN A;  5IGD A;  3VR5 A;  2F3W A;  1S5E D;  4QIW B;  3ERQ A;  2AQ3 B;  1XXG A;  2ZXR A;  1TWC B;  3SK5 A;  3VR3 A;  3QG1 A;  5K36 H;  4DAV A;  1HCZ A;  2F0S A;  1PTO H;  4XYO A;  1PXU A;  4KD3 A;  1QOH A;  2V4D A;  3FEW X;  4KY7 A;  2EYF A;  1I50 B;  1DXM A;  4IQZ A;  4DN4 M;  2MPM A;  2BA1 A;  4CJ0 B;  3K5L A;  2RKS A;  2X69 A;  5LHY 1;  4LMQ D;  2HUG A;  2LMC B;  5E4W C;  2L5T A;  4RHR A;  5M5X B;  2XRS D;  1QCB D;  3GTJ B;  4UAI A;  1X32 A;  2WAQ B;  3SEB A;  1TY2 A;  3NTI A;  2WKC A;  3PUV A;  2VB3 X;  4KI0 A;  2O2L D;  2XN9 C;  3Q0A A;  4KN4 C;  4PMW A;  2K7V A;  4A3K B;  3PIP 3;  4XDX A;  5ELC A;  4A3G B;  5FK9 C;  4A3I B;  3H0G B;  3HOX B;  5KYI A;  1KDB A;  4MIU A;  4B08 A;  1AZQ A;  2VXW A;  1AN8 A;  4FF3 A;  2MJ8 A;  2KVM A;  1WTP A;  2A5H A;  1DYQ A;  2A6H C;  2K1B A;  4C2M B;  4DFA A;  4RKL A;  2L55 A;  1ET6 A;  1UUP A;  1QE6 A;  4FVM A;  1RDP D;  1LTG D;  5HUR A;  5DAU A;  4J8Q A;  4WOR A;  1OXT A;  2AUK A;  1LTA D;  1EQT A;  1Y1V B;  3PV0 A;  3CKI B;  3P1H A;  4X3S A;  1STE A;  3DWA A;  3S15 B;  1S4Z A;  3MHB A;  4DAY A;  3CU7 A;  4JK1 C;  1G2T A;  2RDH A;  2IJ0 A;  2XRQ D;  2PNR C;  2E2H B;  1BF4 A;  1R4Q B;  3A8K E;  5CMD A;  2WP8 J;  1EYA A;  1HRJ A;  1D5X C;  4M8A A;  1FGB D;  2B2W A;  1KAA A;  4RA8 A;  4TKO B;  4C3I G;  3I72 A;  2O5I C;  4KY5 A;  2XNA C;  3VA5 A;  3J80 E;  2LKV A;  3HZX A;  4PV1 C;  2JA8 B;  2EZV A;  4K5W A;  1PFN A;  5DM6 3;  1SE2 A;  2PCF B;  1EEF D;  4DNR B;  2BE5 D;  3HEJ A;  1DOK A;  4IFD I;  1JB3 A;  2FFK B;  1SYB A;  5KNC A;  5FO9 B;  1Y8P B;  2M2L A;  1PDQ A;  1V1P B;  2CQA A;  4XIG S;  5J39 A;  1CZW A;  5K5P A;  2NUC A;  1WD0 A;  2M00 A;  1K8M A;  3A55 A;  3LX0 A;  2RDF A;  1T5X D;  1MBY A;  3K57 A;  1Q3L A;  5C0X I;  1Y69 U;  3TP7 A;  2JEA I;  1XWE A;  1L0Y B;  1JWM D;  3C46 A;  4KV6 A;  2SDF A;  4TSS A;  1BQQ T;  3FVQ A;  1HHV A;  5E3F A;  3GO5 A;  1S5F D;  4ZKB B;  1NCV A;  3K5N A;  1VMC A;  3K5O A;  4G7Z C;  4FXK C;  2DY7 A;  1Q90 A;  3P75 A;  1Q1E A;  4DXG A;  2F0J A;  4FO2 A;  2B8G A;  5D65 A;  3X3M A;  1H9S B;  1PTO B;  1CI3 M;  2B2T C;  2FMM A;  2J0T D;  5CV4 A;  1GUN A;  1QWY A;  2JA5 B;  3IFT A;  4C3J B;  5EKK A;  2FIN B;  1DM0 B;  4C1N K;  2K28 A;  2KED A;  2XWB B;  1IYU A;  4FF1 A;  5C6A A;  3RUZ A;  1ONL A;  4YIJ A;  4X3K A;  2IPK D;  5NUC A;  3G7L A;  4WJW A;  2X6L A;  2NTS A;  3I3C A;  3NWT A;  2EYO A;  1WTO A;  3PIO 3;  2N88 A;  4ZUI A;  3EFX D;  5C0X G;  1FNV A;  2PMZ B;  4G57 A;  2PZW A;  2IX0 A;  2J7Z A;  3HRZ C;  3HOU B;  1A6X A;  1SEB D;  1TWA B;  1O78 A;  2PO4 A;  3I91 A;  3M7G A;  4EGV A;  5DM7 3;  3DHQ A;  3S1R B;  1Y1W B;  4ZK9 B;  3E5S A;  1CFM A;  5IT9 L;  1JCK B;  3A7L A;  1CHP D;  2TSS A;  1ENC A;  3GD7 A;  4HSV A;  2IT1 A;  2D2C C;  1CM9 A;  1WCM B;  2RSN A;  1E2V A;  1H9M A;  5JPM C;  3M3Y B;  3E0J A;  4IAL A;  1HXY D;  2CW0 C;  4LAA A;  2K01 A;  2B63 B;  1EEI D;  2JA7 B;  1RTO A;  3S2D B;  1TKW B;  4KD4 A;  3MFY A;  3IAY A;  2L12 A;  3I90 A;  1SE3 A;  3EQL C;  3HG9 A;  2R92 B;  1SYF A;  1WTX A;  3TZD A;  4A3B B;  1W6J A;  2NB0 A;  1JWU D;  3D6W A;  4C3J G;  4J6H A;  1TWF B;  4FNF A;  5EBC A;  2HQE A;  1Z7T A;  4NMZ A;  2PYK A;  3BYT B;  1F2Z A;  2K03 A;  3I4M B;  1K8O A;  4C3H B;  2IX3 A;  1ICW A;  2XWJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...