5CV4A

Crystal structure of staphylococcal nuclease variant delta+phs v23d/v66h at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTDKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMHENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V23D/V66H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5cv4A00
2EY6A 4KHVA 4DGZA 4DFAA 2EY2A 5IIFA 2F0HA 4B9XA 1F2YA 1KABA 2F0GA 4DU9A 4RKLA 5C3WA 5KEEA 4NP5A 3SXHA 4H7BA 1EY9A 1F2MA 1KDAA 4N9TA 4NKLA 4J1MA 1STGA 5CV6A 5ISRA 5J22A 4S3SA 4IZ8A 2O4XA 1KAAA 5CV5A 1SYFA 2F0JA 3OMCA 5IOCA 1JOOA 3D4DA 5J1ZA 4KJNA 4KD3A 4B9WA 2EYLA 5NUCA 2F0UA 2EXZA 3TP6A 4K5XA 4ZUIA 3H6MA 5I9PA 1SYBA 3C1EA 5E1FA 3PMFA 1JORA 2M00A 3TP8A 5I9OA 5C4ZA 1STNA 5IGBA 4WRDA 2WACA 1RKNA 3OSOA 4ME5A 4NDXA 1SYEA 4K8JA 4RKBA 5EKKA 4EVOA 4R8NA 1TT2A 2EYOA 4KY7A 4LAAA 3HEJA 3MXPA 5C5MA 4ODGA 3S9WA 3TP7A 4N9PA 2EYFA 1A3UA 2EYJA 3RUZA 1SNDA 3MVVA 3NUCA 3SHLA 2NUCA 1SYGA 1SYDA 5IGGA 2OEOA 4KJOA 5CR3A 3BDCA 2SNMA 3NHHA 3D4WA 2F0IA 3MHBA 2SOBA 3U9OA 5F2DA 3SK5A 1F2ZA 3OWFA 1EY6A 1U9RA 3HZXA 2PZTA 3D8GA 2PZWA 4IUNA 4KTAA 3SR1A 5K5PA 4NMZA 1JOQA 1ENAA 4F7XA 5CC4A 2EYPA 2QDBA 5EGTA 4K5WA 3R3OA 1EYAA 1JOKA 3C1FA 5CV9A 1EY0A 4K14A 4HTHA 3T13A 4J6HA 3QOJA 4KV6A 3DHQA 3LX0A 1KDCA 4IALA 4E6IA 1EZ6A 2F0DA 4HMJA 3ITPA 4QB4A 2F0OA 5DEHA 1SNCA 2F0NA 3NP8A 2F0SA 2OXPA 2RBMA 2F0QA 1TR5A 2F3VA 5IGDA 2PW5A 4YIJA 1EY4A 2KHSA 4EQPA 4K5VA 3VA5A 2F0WA 5E3FA 2F3WA 3EROA 4K2LA 3ERQA 4EQOA 1STAA 5KGUA 1STBA 3D6CA 5I6YA 5DAUA 5JAVA 5KIXA 1EYCA 2HQEA 1EQVA 3P75A 3QB3A 3P1HA 4G57A 4KY5A 4DF7A 1NUCA 4ID6A 5IGFA 2F0EA 3QOLA 2F0TA 5KRUA 3NXWA 2F0KA 4ZQ3A 1SNOA 3V2TA 5C6AA 4WORA 5J39A 3BDLA 3DMUA 1A2TA 3NK9A 3SK8A 3T16A 1SYCA 4K6DA 4PNYA 2F0FA 2RKSA 5CV4A 5IGCA 5I6WA 1SNPA 4HMIA 2EY1A 3MZ5A 2EY5A 2PQEA 3EVQA 1TQOA 2F0MA 1EY7A 4OL7A 4F8MA 5M9OA 1EY5A 3EJIA 4EQNA 2PYKA 1SNMA 3SK4A 2F0LA 1A3TA 1ENCA 2LKVA 1EY8A 1II3A 2ENBA 1NSNS 4QF4A 3MEHA 1A3VA 3E5SA 1STHA 5C4HA 1AEXA 1STYA 4QMGA 5IGEA 5EKLA 4I65A 4MIUA 4PMBA 5JOBA 2F0PA 2F0VA 2PZUA 2RDFA 2OF1A 3NQTA 4K2KA 4PMCA 3SK6A 1EYDA 2KQ3A 4TRDA 5CGKA 5KYLA 1IHZA 2SNSA 2PW7A 5CV8A 4K8IA 5CV7A 1EZ8A 5HGTA 4ZUJA 3OMGA 5C5LA 2EYMA 3TMEA 1SNQA 5KYIA 1KDBA 4KD4A 1A2UA 2EYHA 5IODA 3TP5A 5C3XA 5HURA 4KY6A
chains in the Genus database with same CATH superfamily
3FEWX 1LTLA 4H02A 4X66L 2N88A 4DU9A 3GO5A 4A3GG 3SXHA 3SGIA 2B63G 1VS0A 2IT1A 4MTNA 4GKJQ 2F0JA 3HOVG 4DNIA 4RGMA 1D2BA 4DV0Q 1VQBA 1AFPA 3CC2A 3C1EA 3PMFA 4B3ML 2HT1A 5M5YB 2CVRA 2OCEA 4NDXA 1SYEA 2VUMB 3FPPA 1I50H 3S16B 5IT9L 1T5XD 4C2MB 4ODGA 3TZDA 4J15A 1PYBA 4N9PA 2ATWA 2VQEQ 3R2TA 1BKBA 2K5WA 2Z9HA 4DKAC 5K36G 1SYGA 5LL6S 1S40A 2BDNA 4A3JH 3RZOH 1D7QA 3S17H 3CW2C 1QG7A 4X3UA 2PZWA 4NMZA 3I4OA 2BA1A 3HRZC 2KJXA 2EYPA 5CV9A 4CDEC 3NSWA 2Z6KA 3MTSA 4E6IA 4JI8Q 1UUPA 4B3MQ 1MIUA 4L8JA 3MXNA 3GTJB 3VYRA 3HOYH 1D1KA 2K5DA 3ERQA 2X69A 3O13A 4G57A 1CT1D 1I6VC 2K6AA 5COYA 4DF7A 2NVQB 2F0EA 3N52A 5KRUA 1Z47A 2UXDL 1B4OA 1CKNA 4BS9A 4DA2A 2B2TC 5JJLA 4DR6Q 3S2DB 2ZXPA 1Q81C 2RDHA 1O80A 1SE4A 1LYLA 2NVTB 2A73B 4DR1L 1S5BD 2YU9B 3NTIA 1HJPA 4RA8A 4CJ0B 1PH6A 1P8LA 2AKWB 2ENBA 1XMQL 5JEAG 1TKWB 2E8GA 3A7LA 4BA2I 5LMNW 3S1QH 2J0TD 1PH5A 1S5ED 3VYSA 3R93A 2PZUA 2GN5A 4K2KA 1JJ2A 3J7ZC 2UXDQ 4JC0A 3ONAB 3MEFA 3D0FA 4O1NA 3TMEA 4ZYSA 2HIVA 2EOTA 4QGUA 4DGZA 3P20A 2CQAA 4DR1Q 4A3KH 2D0PA 1K28A 3HOZB 5ELDA 2HHHL 1HQRD 4OEMB 1F2MA 4DAPA 1U4RA 5L37A 1AZQA 1V43A 4S3SA 4HSVA 1JE4A 4BXXG 1SYFA 2NVYB 1XMQQ 4K6LA 1CI3M 3RR5A 5CBAE 4CDDC 4QIWB 3TDQA 2H1EA 5LMNL 4A75A 1IKMA 5E1FA 3MXNB 1PHJA 3J81i 1S72A 4GLXA 4RAUC 1PDQA 5A2QL 2XIWA 4BY7H 2I5MX 3FKIB 3DM1A 4OIJA 3NQIA 3MVVA 3DEPA 4N8X1 1SBBB 3RN2A 1CKNB 2HHHQ 4AYBG 4XQQA 4XQNA 4IUNA 1ZKOA 1BCPC 2L0CA 5EPKA 2MO1A 1X3PA 1I4PA 1EY0A 1MBYA 5LMNQ 4OIKA 2NVXB 4KV6A 4GZYC 2Q2UA 1I6HH 1HNWL 4BWGB 3F2BA 2F0DA 2NZ1D 3ITPA 2HCCA 3TZUA 1K0RA 1A63A 4P73A 4Y52H 2K1BA 4DNTB 4A3JG 5AJ3L 5C0XH 1QZGA 1BBXC 1PRTB 3NWSA 3J7AV 2I5LX 4A3MB 3JAMi 1PFSA 3CCRA 4JBWA 3ER0A 1HNXL 3EA6A 3FP9A 2F0FA 4Z9CB 3PIPA 1TWAH 4HMIA 1M90C 3MZ5A 2D9UA 4A93H 4A3DB 1MHWC 1HNWQ 3HOYG 3I4NB 4X64Q 3I55A 4EQNA 4ULLA 2F0LA 1VDZA 1WJJA 2HCIA 3CAMA 5AJ3Q 1VQIA 2YTVA 4QIWE 2YYZA 1LT4D 1VQ6A 3NTKA 1DOMA 2L55A 2MNAA 2VY3A 1HNXQ 4UPAA 4FF4A 2PW7A 3PIO3 2LS01 4I7ZC 2IW3A 1SE3A 2JA9A 3TP5A 1VQ5A 5KEEA 5C4XH 1BCPF 4J1MA 4DK3C 4DPGA 3SVMA 4GLAC 4IFDI 4JW0A 5FLXL 5I9PA 4NW2A 3M4OH 2NBFA 1L0YB 4M8AA 2FFKB 3HFZB 1E7ZA 4AIMA 1Q46A 4A3KG 1PH1A 4A3EH 2C5CA 2JA8H 1YNJC 1DONA 1XTCD 2QEXA 1RCVD 1MJEA 1A3UA 1XX8A 1C9OA 3VYUA 1AZPA 1TU2B 1PH9A 3ZYYX 2F0IA 3UDXA 5C3EB 1K8MA 4QUFA 2EZVA 3OWFA 4KTAA 3SR1A 2PZTA 1ET9A 3D8GA 1FYCA 3NWTA 3ND9A 3QOJA 4KN4C 2QCPX 4RFBA 2XTIA 1I3QB 4EX5A 2B2WC 2LXKA 3H0GH 1HZ9A 4UAIA 2HD3A 3AFPA 2DNCA 4YCVA 1ONLA 4K0KL 4LFBL 4H13C 3HOUB 3RN5A 4K2LA 5KIXA 3I8ZA 1TWCH 4QCLA 5JVG3 1ENFA 2PPBC 4KY5A 4EQ5A 4RGNA 2KECA 3RZDH 3S1RB 4LWCA 2VXWA 3U4ZA 4B3SL 3BVMA 5M3MH 4POFA 3F1ZA 3T16A 3KLSX 2WKCA 5CV4A 5IGCA 1KXLA 5JJZA 3K5NA 2PQEA 4X3SA 2KCNA 2DY8A 5C0XG 3QG1A 4F8MA 4G7ZC 3S15H 2PYKA 2G9HD 1GHJA 3T51B 3KUPA 2P5ZX 3STBC 2F52A 1S4ZA 4K0KQ 1KD1C 1XWEA 2GVAA 4DR5Q 5IYBG 1A3VA 3E5SA 2ZJQA 3VR5A 2EJMA 2FINB 1DXMA 1K83B 3J7AF 3S2HB 3RLNA 3T1HL 2A6EC 4A93G 1WTHA 4B3SQ 2SNSA 2VQFL 4GNXA 5CV7A 4G7OC 4LUVA 2EYMA 2VW9A 4KD4A 5GROA 2NZHA 3L9AX 2UUAL 4GN4B 2IJ0A 1CZGA 5IIFA 3PCOB 4RKLA 4XXEA 1BCPD 4N9TA 3VA7A 1STGA 5ISRA 3CQZB 3GV3A 1I94L 1A8VA 1PYSB 2R92H 4OO1H 1IBML 4U68A 4HJ5A 5NUCA 2EXZA 4YWLA 3G7LA 3H6MA 5BN3A 5M5WB 5DM63 4MNOA 4K8JA 1TT2A 4B08A 3KJOA 5C4XG 5IWAL 5C5MA 1STEA 1RDPD 1WTRA 1VF7A 3GTKH 1SNDA 3N6RA 2UU9L 3K0YA 3WOFA 2OEOA 3GTOH 1MKHA 1CK1A 1C7YA 1Z6HA 2N55A 1I94Q 3MFYA 3DXJC 3M9BA 1Y1WH 5GAHC 2E2JH 2RCFA 1IBMQ 4DNRB 3EIVA 4RWSC 4A3EG 2JA8G 3QIAA 1EZ6A 2NWGA 2F3VA 3DWPA 3GTMH 3K5OA 1QVGA 2K04A 5EBCA 4K5VA 5IWAQ 4EQOA 1I5FA 2BDOA 1EYCA 1IL8A 3QB3A 1OO9B 1KLUD 2JA7B 3V2TA 3WWVA 1AE3A 2B2TA 4H44C 1DM0B 4P72A 5C4JH 3S14B 1G291 3H0GG 5JVH3 3BS1A 1HNZL 4DV2Q 2XWJB 1RODA 3CXCA 1TQOA 2ZM6L 1HXYD 1EY7A 1X3QA 2L4NA 1TWHB 3U4VA 1C8CA 1DOLA 1U4LA 4BY1B 1PZJD 2OTJA 1IYJB 3H3VI 2I5HA 1XPRA 1L2FA 5M3MG 4BBRB 2WP8J 2AQ3B 1JWUD 5J22A 2SDFA 1Z7TA 1HQMC 4DAYA 1J9OA 1KHIA 1YNJD 4K8IA 1LABA 1LV9A 1VQEA 4R4OA 4R4QA 1EUJA 5J1ZA 1CSPA 3NEMA 1VF5C 2ZM6Q 4B9XA 3PO2B 1JMCA 3KOJA 4DV7L 4A3GH 4R4CA 3C2PA 3S1NB 1R9TH 4UP9A 5J3BA 1RTOA 2F0UA 4K5XA 3PGZA 4NPSA 1HH2P 1TWGB 1YHBA 4CGYB 3TP8A 3OW7A 3A5UA 4JBMA 2ZT9C 1K0SA 2FMMA 2WB1B 3OSOA 4ME5A 1YZ6A 3PUXA 4KY7A 2XRSD 2HIXA 1AH9A 3K7AH 1W2BA 1L1OC 1HR0W 4FF2A 4LF7L 1PH8A 3VR4A 4C3JB 1WD0A 2R92G 1G6PA 2I46A 4IFDJ 3K0XA 3OHXC 4GN5A 3GTPH 2SOBA 3ULJA 5FO7B 2IWHA 4DV7Q 3K80C 3G71A 5CC4A 2K03A 2JSOA 2K33A 2VS1A 4P2CB 5EKIA 1KDCA 3NE5B 1PA6A 2I0QA 3STBD 3M3YH 2EQSA 1WTXA 1RTNA 5DAUA 3OIPA 3ZJYC 3OPOA 2A6ED 4HJ9A 4A3IB 5ELBA 1Y1WG 1HR0L 4ID6A 4LF5L 4DAYB 5D3IB 3NXWA 5C6AA 4JI4L 1K9MC 3H09A 2LSSA 1SR3A 3GTGB 1VQKA 3WDNA 2K52A 1HCZA 2TMPA 2Z4HA 4IOAA 5M9OA 4DR7L 3TEHB 2B63B 3MA2B 2R7ZH 2OQKA 5LMUL 2RHQB 2WAQG 5ELOA 1G2SA 3HP3A 3HOVB 3V96A 3G48A 3CMAA 3F2CA 2RSNA 4WJ4A 1LT5D 4I65A 1HR0Q 4LF5Q 1VQ7A 1W3SA 2WB1E 3AEVA 4JI4Q 4RCNA 4X65L 3A56A 1EZ8A 1V8QA 3PUWA 3I4LA 4C3HB 1SMYC 3PQIA 2EYHA 2QEJC 3H91A 4KHVA 1XNRL 4PZ7A 4DR7Q 3JC66 1BCPB 1KDAA 1TWFH 3TREA 4HAEA 5LMUQ 4C2MH 1N32L 3D3RA 5HY6A 1XMOL 1JOOA 3D4DA 3LGJA 1HUNA 3WOEA 4YWMA 4IUVA 2DUDA 2Y0SE 3VDYA 1SRUA 4P71A 1N36Q 3QWNA 1JWSD 1H95A 2N3SA 2IPKD 2WKDA 4OX9L 4OO1I 2Q8RE 3S9WA 1H9JA 4A3FB 5GADC 1JWMD 2MGSA 3TSSA 1WTOA 1F2ZA 3A0JA 1NMGA 1N32Q 4FXGC 3CMEA 1QZHA 3ULLA 1EQTA 1X3FA 2A1AA 3BYTB 3Q22A 4LMQD 4X6AH 1VQAA 2B8GA 4DV3Q 2B2WA 1B1ZA 2OXPA 5IT9c 4YY3Q 2A69C 3UDGA 4JV5L 4I7AA 1SROA 4OX9Q 1NNXA 2KVMA 1Q90A 5I6YA 4X66Q 3LWEA 2NVTH 2IX3A 1IBKL 3LNNA 4DAMA 1JE5A 2FXQA 1H9MA 4A3CH 2PNHA 3B6YA 1YJWA 1PTOH 3FDTA 4N8FA 3FRPB 2HUGA 4DK1A 1VMCA 1G91A 5IT9E 4PZ8A 1J6QA 1SNMA 1EWIA 3L3OC 3OOCA 1QNUA 2DNEA 1CHPD 1FGUA 1K73C 1O7ZA 3HOXB 2IX1A 1OXXK 3HOZH 1ILQA 3AU7A 4BA1I 1WTPA 2F0VA 1IBKQ 4OGQC 3VR2A 1BF4A 4PMWA 3HKZG 2R7ZG 2KENA 1D5XC 1R4PB 1IW7C 1SFOH 2IL8A 1A0IA 4AYBB 1SAPA 4NP5A 5TSSA 1Y1VH 3CCVA 2MPMA 1C48A 2CWPA 1KAAA 5CV5A 2GA4B 4KJNA 4OHJA 3V05A 3GTLH 1BNZA 5EJWA 1H9RA 1XYIA 1SYBA 3S1MH 5JJKA 2D62A 2EPBA 3K57A 2K32A 1EQRA 4V0BA 4A3JB 3RZOB 4LAAA 1G8ZD 5T1IA 1LO5D 1SN8A 1VCIA 1EFWA 2MP1A 3CRLC 3NHHA 4LF9L 3VR3A 5DM73 1Z9FA 3BZDB 2D2CC 4PV1C 4DUYL 1CTMA 1MSGA 4LF6L 1EYAA 4JBJA 4A3MH 4IURA 1GUGA 2X6LA 5IP9H 1E2VA 2RBMA 4NXNL 3HOWH 2N8NA 3PF5A 1DYQA 3Q24A 4X3KA 2H4OA 1C0AA 2XGTA 4ZAIA 1HPCA 3GD7A 1MJCA 4WORA 1SMYD 3PUVA 2YV5A 2XSCA 2ZTDA 3NK9A 1X54A 4DUYQ 1HZCA 1HA6A 4LF6Q 1YEZA 1QUQA 2V4DA 3QR8A 1TVXA 5A2QE 5AFWA 4AYBE 4QJFA 1LUZA 3S1QB 1Y14B 1EY5A 2JJQA 1DGSA 1SMXA 1SE8A 1VQPA 2LFNA 1II3A 1F9RA 1RIPA 3UDIA 1HUMA 1L0XB 4A3CG 2NTSA 3CP0A 5JOBA 1Y8NB 1J8IA 4RG1A 5IYBH 3A54A 2DN8A 3AFQA 1IXRA 5KNDA 4A3KB 1B3QA 4LFAL 1UAPA 4F88A 4ZUJA 3OMGA 5C5LA 4HJAA 2KA7A 3SE0A 1KDBA 5EBDA 1YITA 3C3LA 4FYDA 1A6XA 4C3IB 5C44B 3K59A 4WJWA 1GKHA 3S24A 3Q0AA 3HOZG 4DK0A 3J80L 4RGOS 1G2TA 2L11A 1SJED 4IUQA 4BY7B 3PUZA 1M1KC 3P7JA 3OWEB 5BN4A 1HTLD 4GOPC 2A69D 2M00A 3T53B 2NZOA 1TS4A 1B2TA 4LFAQ 2BE5C 4ILWA 2UXBL 1Y1VG 1QILA 3LWUA 5LHY1 3T1YL 1D5MC 1L1OA 3RUZA 1DJRD 1I3QH 1SYDA 1VQGA 1B7YB 3J80E 2FJ2A 2I07B 3BZCA 5KNCA 1MGSA 3GP7A 3J81j 3HOUH 1ENAA 5FLXc 1QUQB 4R9WA 5FK9C 4UP8A 1PMRA 4X3TA 1WTQA 3PIOA 5LL6X 1M4VA 3S1RH 1EOTA 4DUZL 3CF5A 3Q8DA 4FO2A 2UXBQ 1TS5A 5GQOA 1JR0D 5KGUA 1LTRD 2K01A 3I2ZA 1TWAB 1GD7A 5DLQE 3QOLA 1EOVA 1M8AA 4A93B 3U9SA 4A3MG 4JI0L 2VNUD 2Q2IA 4IPGA 4X62L 5FLXE 5IP9G 1YI2A 1PH4A 2NN6H 3PO3B 1NJIC 1GO3E 1ASZA 1V1OA 1K83H 3S2HH 3HOWG 2CFMA 3HS0C 2RA4A 2RQXA 2KCCA 1XPUA 1X3EA 4R1JA 1B3AA 4KKSA 1VQDA 3MEHA 1B70B 1STYA 2B2VC 2DGYA 4FP5D 1PTOC 3SK6A 1Q1BA 1ZXTA 2K5VA 2KEEA 4OWWB 1Q3LA 4JI0Q 4TKOB 4X62Q 1TY2A 2Q8TA 3C46A 1HZBA 3FMCA 2EY6A 1J5EL 1SXTA 2QDLA 3QJYA 2JEBI 5ELFA 4H0LC 4JYAL 3M4OB 4LFBQ 1EEID 1X6OA 2KCTA 3E0EA 3D31A 4Y7NH 1ESRA 1VMPA 4JG2A 4FDBA 4OELB 1CQVA 1UWVA 4A3EB 2JA8B 1LLRD 2PNRC 4CBVA 2R7DA 4OWXB 5JPMC 5C4ZA 2R93H 4WRDA 2K5QA 2A6HC 4DXGA 3G6EA 4HJ8A 4LFCL 3D4RA 4A3LH 5G3LD 1H9KA 1Q1EA 3SHLA 1T9HA 1F9SA 4GLVB 2MHVA 3A8JE 1RF2D 4PG3A 3MHBA 4JYAQ 1PZKD 2QA4A 1HTPA 3H0GB 5K5PA 1OXTA 4K14A 4LUOA 5IE8A 1E2WA 3T1HQ 1AE2A 2RSOA 1VQNA 1TWCB 2RVLA 2JA7H 3IFDA 3EQLC 2VQFQ 4BBSH 4OXPA 1B9NA 1TR5A 4YIJA 3RZDB 1X32A 3OIQA 5A35A 3BG3A 3VA5A 4LFCQ 1STAA 5DNFA 5M3MB 3CCEA 3D6CA 3J81L 2UUAQ 4HIMA 3HOUG 1PTOF 2OT2A 1EWCA 1TWHH 2ZXOA 3U50C 4JBKA 2F0TA 4UHVA 2VB2X 1LACA 4LNQA 2A68C 4BY1H 4YWKA 1A2TA 5JPNC 3E9IA 4R4TA 4G7HC 3S15B 1XPOA 5IYCH 1SNPA 1XJVA 2UUCL 1DCZA 1VQMA 2EE1A 2JE6I 2EY5A 4TQUS 3CCJA 2F0MA 2UXCL 4MZ9A 4ZKCB 1EFID 1LTAD 4XIGS 3A7AB 1E22A 1YJ9A 2B2YC 3URYA 1LTTD 1YVCA 4KLKA 1KNEA 3A5ZB 2UU9Q 4CJ2C 1STHA 4GN3B 4QL5A 4L5TA 4CKCA 2PI2A 4LF8L 3PO2H 3PF4A 2BOSA 4GNXB 1S3OA 2NN6G 4IPHA 2Z8LA 3NQTA 4PMCA 4DV6L 4L5RC 3BVGA 3PIP3 2BE5D 2L1BA 4RH6A 2R7FA 1F77A 5C0XI 1EIYB 3JAMc 1V1QA 3E9HA 3JAML 3CD6A 2E2IB 4ZRZA 1PH2A 2UUCQ 5CMDA 3CPFA 1RL2A 2R92B 2KBNA 1U4MA 3I7FA 2CHBD 2KOLA 2UXCQ 1GHKA 1R4QB 5M3FH 3J7A5 3OMCA 4HEDA 5IOCA 3GTQH 3H15A 3TN2A 4YCWA 2M2LA 1E3PA 4C3JH 2M9VA 1I4HA 4DV6Q 3GTKB 3KK7A 2WACA 5IYDH 2FHTA 2WIIB 2NTTA 1PFNA 2B3GA 5JEAJ 3JAME 1ILPA 3KLRA 1BBUA 1HNZQ 4XYQA 2BH8A 3GDEA 4IUUA 1Y1WB 4Q5VA 1ZYRC 2SNMA 2E75C 4JI7L 1A62A 4U673 4A3BH 1DOKA 4HSPA 4F7XA 3TRZA 1EIHA 2R93G 1GXDC 1NR2A 3K5MA 3K5LA 5D3DA 4A3IH 4O2DA 2GVBA 5FLMH 2IY5B 3DHQA 4IALA 5FO8B 2UUBL 2JA6H 4A3LG 1PVOA 2WAQB 1LTGD 1VQ4A 4IQZA 3OTOL 3GTGH 2F0WA 2AUKA 5C4JB 1STBA 1OXSC 1PTOD 3CCUA 1CHQD 2NYZD 2HQEA 2R61A 5D14A 2ZJPA 3RD4A 2J7ZA 5IGFA 3FVQA 1BDOA 1SNOA 1K3RA 2JA7G 3SK8A 4BBSG 1LTBD 3M4PA 3X3MA 3I4MH 4TVAB 2JQOA 2RCNA 1N8RC 2ALYB 2Y0SB 2HQLA 2JA5B 3DUZA 2UUBQ 3T56B 2F03A 1I4QA 3KBGA 3NENA 3W1BA 5M5XH 1Q82C 1Y69U 1FNVA 4PZ6A 4C3HH 2LKVA 3OTOQ 3L2PA 2XVSA 1QWYA 4YHHL 4BY1G 2K50A 2N78A 4LF4L 4LF7Q 2LMCB 2ICEC 5IYCG 1O78A 1O7IA 2A6HD 2RDFA 5E7NA 3I90A 4TRDA 3G4SA 5KYLA 1RHPA 1YNXA 3PSIA 4JOIC 2E2HH 1SNQA 4NXML 5BR8L 5HGQA 3CCLA 1EIFA 1WCMH 4A3GB 2EJFC 2F0HA 1R9TB 2QF7A 4C56C 5CV6A 1FNUA 3PO2G 4JPBW 2HDMA 4DV1L 1EIGA 3MAQA 4YHHQ 4A3FH 2ZTEA 2OTLA 4KD3A 3IL8A 4LF4Q 1YHAA 3W5OA 4ZUIA 4GOPA 3IFTA 1BBWA 1JQYD 3K7AB 4KKTA 1IZ6A 2WAQE 2IHEA 5IGBA 1RKNA 3E0JA 2DJGC 5JJIA 2AWOA 4R8NA 2PI2E 3KBXA 5M3FG 1N34L 5M5YH 5GAEC 1PXUA 2NUCA 2A68D 1Q7YC 2E76C 5IGGA 4KJOA 2VUMH 3DM3A 3S16H 2E74C 1PLFA 4C3JG 1WTVA 4IO9A 4DV1Q 2MFIA 1KRSA 5CBEE 3M3YB 1SJHD 1BUVT 4KHPL 5IYDG 2BCOA 3C1FA 1E24A 3CC4A 1AN8A 4WJ3M 1GOZA 4HMJA 2MO0A 4X65Q 4LK1C 2F0SA 1TXYA 3L0OA 1VQJA 4O42A 5EPLA 1KNAA 1I4RA 3KF8A 1N34Q 3AB9A 4A3BG 1XNRQ 3A8KE 4JK1C 1JJCB 3RLOA 3P1HA 3GTJH 1JB7A 1AW7A 1NUCA 1SSOA 3R2IA 3I72A 4Q0FA 4A3IG 4L5QA 2A5HA 5J39A 5FLMG 3HKZB 1MD2D 1XMOQ 2JA6G 3HOXH 1H9SA 2B2UC 2RKSA 4KKUA 3UE0A 4F87A 2NVQH 1FNWA 3CC7A 3KDFA 2VQEL 3M7GA 4IFDH 1U5KA 1NMFA 3S2DH 4DK6C 1OXVA 2RDGA 2C9OA 2KUMA 4QF4A 3CU7A 4ZLTF 4GOPB 1X9NA 2B2VA 1IBLL 2YU9H 5IGEA 4PMBA 1Y8OB 1SEBD 3I4MG 2KQ3A 2JYOA 4JI8L 1IHZA 1NBWA 1JB3A 4JVZA 1KQSA 1TWFB 2XN9C 1K8AC 2O5IC 1IYVA 3MXUA 3KLWA 1GUWA 1QVCA 4HIKA 4C3HG 1ZYRD 3ERSX 5KNBA 1AP0A 4DFAA 4KN7C 1K8OA 1WD1A 1F9PA 1U4PA 4NKLA 3ULPA 4JV5Q 4C1NK 1KLGD 1HFGA 2Q2HA 4KI0A 1YHQA 1BQQT 2O5JC 2AMCB 4IJLA 3GQBA 4B9WA 4DR6L 1IBLQ 3K7UC 5C0XJ 1KC8C 1LTSD 4LJZC 3BDOA 3NELA 1STNA 1WCMG 2NVYH 4RKBA 1TS3A 4YCUA 3K6OA 3KF8B 2Q2TA 3BU2A 4JI1L 1HZAA 4L63B 1E0BA 3G6JB 3TBIB 2EYFA 4IPDA 4JCVE 4A3FG 2ASBA 3NTHA 3HKZE 3FKIH 3D4WA 5I4DA 3U9OA 5F2DA 2CWAA 1K8GA 1EY6A 1U9RA 1UNSA 1JCKB 1H9SB 3CCQA 1JOQA 1I50B 3HKSA 3F2UA 3KDFB 3AYHB 4UP7A 1F9QA 4IJHA 1JC7A 3M4QA 1SNCA 1QE6A 2EIFA 3S17B 1EY4A 1Q8KA 2VUMG 2MJ8A 4JI1Q 1Q86C 1FJGL 1GVPA 3RNUA 2NVXH 3GV6A 1V9PA 2PO4A 1PTOB 2EXDA 1IYUA 2F4IA 2LXJA 5D65A 1B44D 1D6EC 3PV0A 1CM9A 2F3IA 3UE1A 3K81C 1MSHA 1SYCA 5FKAC 4FF3A 3HOYB 5I6WA 1NR4A 2EY1A 4CJ1B 1WOCA 4XYOA 3BJUA 4PQXA 4IN3A 2Z0SA 2B29A 3SK4A 3AMUA 2B2YA 1GUTA 1FJGQ 1JJGA 4A3DH 1O7LA 3I4NH 3E3XA 4C3IH 4HN7A 5C4HA 5C44H 4POGA 3HOXG 2RF4A 4IUPA 3Q23A 2F0PA 4LF9Q 1YNNC 1WYDA 1SFOB 4IFDG 5CV8A 3K58A 1FL0A 4KHZA 3NBIA 5HGTA 2F4VL 3HG9A 1Y1VB 4L6TB 5KYIA 1N33L 5C3XA 1HA5A 2F0GA 4A4IA 4NXNQ 3GTLB 3W3AA 4DN4M 2K75A 4QQBX 1UE5A 3S1MB 4IZ8A 1ZEQX 1KTKA 1CUKA 3NBHA 1X65A 2EYLA 3I70A 2OQ0A 4MHEA 4TSSA 4DV4L 2CW0C 3CHBD 1RD9D 1NAPA 4X64L 1KIXA 5GAGC 5FOBB 2F4VQ 2EYOA 1N33Q 3HEJA 1B53A 2OWOA 1EU4A 2MQHA 1KAWA 1W6JA 3J80c 2CKZB 4XTCS 1QCBD 4HIOA 2EVBA 3KJPA 1BVSA 4B3TL 2NB0A 3H3VH 3IRBA 3F8TA 3HOWB 3D6WA 1E1TA 4L5SA 3LX0A 5C3EH 4DV4Q 1X56A 4A76A 3X3NA 5ELCA 2F0QA 1EQQA 5IGDA 4ME3A 3PO3H 3FKIG 3A74A 5G3LF 4ZK9B 5IP7H 3F2DA 4ZKBB 1PZID 4XT1B 1I6HB 1RJTA 2ZTCA 2WFWA 4ZQ3A 3VR6A 2PCFB 1G6ZA 1TIID 4K6DA 4XDXA 5CYUA 2O2LD 3M4YA 4OWTB 4B3TQ 4FVMA 2B39A 1EEFD 1PV4A 2K14A 3PUYA 4DV5L 2IX0A 2H5XA 3CRKC 1QB5D 1ENCA 3NBHB 2AQ2B 4GKKL 2X6GA 1NSNS 3T1YQ 2XNAC 3TS2A 3OW2A 1GUNA 4HCSA 4P75A 4P74A 2A74C 4OONA 2R3ZA 1S5CD 1UEBA 3R8BA 2Z1CA 4JOIA 2IHFA 1HHVA 4JI6L 3KLSA 1JT8A 1IW7D 2A8VA 2DJFC 4IPCA 1VQ9A 3SDZA 1NTGA 4MN3A 2EY2A 4DUZQ 4A3DG 2WV6D 3I4NG 1ASYA 4C3IG 4CKBA 1EY9A 5C44G 4DV5Q 2K5HA 1VQLA 1GUOA 2XRQD 4GKKQ 1CA5A 1WI5A 1SDFA 4RHRA 1BOSA 2L12A 1FGBD 4BY7G 1DZ1A 2KHIA 3FHWA 4CKEA 3CQZH 1KL9A 1DD2A 1IKLA 1VQFA 4FF1A 3K8AA 1LTID 5C4XB 3U58A 4UDUC 1XXGA 4JI6Q 1L1OB 4ZCKA 4M1UB 5M5WH 1P16A 1GUSA 2AQ1B 4DR5L 2EYJA 3SEBA 1CA6A 3BDCA 1ICWA 2VB3X 1UE6A 3HZXA 3TS0A 3H94A 1NCVA 1CZWA 4RCOA 1B8AA 4JI5L 1YBYA 4K5WA 1D1IA 2MUYA 1JOKA 3R3OA 4WFN3 2E5LL 1IL2A 2Q8IB 2Z6KC 5DEHA 5FJ8H 1ET6A 4DR4L 2G9DA 3NPPA 2K4KA 4JI2L 2KHSA 1S5FD 4EQPA 1VQHA 5E3FA 1QVFA 1J5EQ 1YNND 2AHOB 3J7YW 1PH7A 4LW1A 2RHSB 4FXKC 1OTCA 4APVA 1X55A 5C3EG 4O0AA 4DAVA 4RGTA 2B2UA 4JI5Q 1FVIA 1U0LA 2C35B 1SE2A 2E5LQ 1FR3A 2F1MA 3PO3G 4KMUC 2E2DC 3S14H 4DR4Q 3DWAA 3EJIA 2AWNA 3UDFA 5IP7G 2BH2A 4JI2Q 5FO9B 3J81c 1XNQL 2E2IH 3M7NA 1LM0A 3CCSA 5I2YA 2CW0D 5BN5A 1XTDA 5I2XA 2JXMB 2ICIA 4UY8C 1UE1A 3KFUA 1EYDA 1PRTC 3ND8A 1Q12A 4BBRH 1F2LA 1A2UA 2G5DA 4NB3A 4KY6A 3MWYW 1O7YA 4Y7NB 1QOHA 5C3WA 5EAYA 1BXTA 1B50A 1Y8PB 4ALPA 1VQ8A 4ABNA 2PMZB 3J81E 1XNQQ 3TQYA 3OYYA 2R93B 3KF6A 5EQ0A 1PFMA 2J4XA 4DV2L 1TY0A 4RMFA 3HGBA 5I9OA 4R8IA 3RLFA 5T1GA 4EVOA 3S1NH 1CFMA 1OXUA 3QO2A 1JICA 4HCEA 4C1NI 1HRJA 2QKIC 3MXPA 2QW7A 1QNKA 2ZXRA 3TP7A 2CH4A 1TWGH 4HR7B 3BZKA 3NUCA 2EDGA 4MTKA 1C4QA 5IY0A 1SLJA 3EBEA 3SK5A 1L0WA 1KRTA 4BBSB 1CKOA 1PFBA 3DLLA 5EGTA 2QDBA 4IOCA 4LF8Q 2JN4A 3T13A 1CSQA 4QB4A 4RHSA 2F0OA 1E1OA 1GM5A 1I4GA 3I56A 3GTOB 3Q6SA 2YTYA 2A19A 2F3WA 1ICFB 5E4XA 5JAVA 1UEAB 2JA5H 2E2JB 1PRTF 2K05A 2VZAA 1LT3D 2CCZA 3H3VC 1NY4A 2JEAI 3DMUA 2PQAA 3L7ZC 2CQOA 3GTMB 5FJ8G 5CORA 1A15A 1BO0A 3DEOA 3CCMA 1E2ZA 3EVQA 4IUTA 1X3GA 3W1GA 4OL7A 4B3RL 1UE7A 1GJXA 2PMZE 1A3TA 2JP1A 1TS2A 1CQFA 3KF6B 1EY8A 4GS3A 3EN2A 4XQJA 4EGVA 3MXGA 4QMGA 2B63H 2YTXA 5ELEA 1EU3A 2Z6BA 3AQQA 4JI7Q 2L9HA 3HOVH 1T5EA 4LUZA 3I73A 3A55A 3RMHA 3DWQA 2ZJRA 3EFXD 2AUJD 1Q8IA 4QUCA 5M3FB 3UI2A 4CHTB 5IODA 5H1SE 1BR9A 3I3CA 5HURA 5ELNA 4JI3L 2R6GA 3GTQB 1F2YA 1KABA 3KYHC 4B3RQ 4CDFC 4H7BA 3VYTA 4OO1G 2FMCA 2NN6I 2O4XA 1V1PA 2CH4W 2Z4IA 4DR2L 2V1CC 5K36H 1D8LA 2N49A 2XWBB 2ES2A 4QY7A 3W2DA 1LT6D 2QILA 3TP6A 4BBRG 3ICEA 1ML0D 1JORA 2LY7A 4HIDA 1G51A 2KEDA 5EKKA 4XT3B 2KCMA 4AH6A 3I91A 4A3BB 4JI3Q 3MFGA 5CR3A 3A8IE 2PQAB 2JA6B 5EPJA 5E4WC 1B9MA 3IKJA 4DR2Q 3IAYA 2KHJA 1WTWA 4G4KA 4HTHA 4J6HA 1MI2A 2L15A 1FD7D 4J8QA 2EJGC 2DY7A 2F0NA 3NP8A 2TSSA 4DR3L 3GTPB 1EWHA 2PW5A 4AQYL 4NXMQ 2WB1G 1VQCA 2K7VA 5BR8Q 3CPWA 2B8FA 3EROA 1WFQA 1EQVA 1S5DD 3P75A 1VQOA 1PRTD 1YIJA 2WINB 2SEBD 3BVZA 1W6KA 3I4MB 4R4IA 1HFNA 1N9WA 2BA0A 2D0OA 2F0KA 1K3BC 5JEAH 1ESFA 1N36L 3BDLA 3MC0B 4FNFA 4PNYA 5M5XB 2K5NA 3J80i 4FXDA 2QGQA 2JK8A 1PYWD 2Y0SG 4CDCC 4HJ7A 2JA5G 4DR3Q 1NE3A 3T4AC 1V1PB 4V190 4AQYQ 4GKJL 1QJOA 1EL0A 4DV0L 2E2HB 1AEXA 2ID0A 5EKLA 4MIUA 2L5TA 4DV3L 5CGKA 2OF1A 3BYYB 1WCMB 3M85A 4BXXH 4DXFA 2HDLA 1YJNA 1PH3A 1WVLA 2VL6A 2K28A 1D5ZC 4GNXC 2R7ZB 4YY3L 3CKIB 2D5DA 4KHPQ 4KK7A 1EYGA 3FPUB 1CKMA 1I4XA 3E6ZX
chains in the Genus database with same CATH topology
3FEWX 2N88A 4DU9A 3GO5A 3SXHA 2IT1A 2F0JA 4RGMA 1D2BA 1AFPA 3C1EA 3PMFA 5M5YB 2CVRA 4NDXA 1SYEA 2VUMB 3FPPA 3S16B 5IT9L 1T5XD 4C2MB 4ODGA 3TZDA 4N9PA 3R2TA 2K5WA 5K36G 1SYGA 5LL6S 2BDNA 1QG7A 4X3UA 2PZWA 4NMZA 2BA1A 3HRZC 2KJXA 2EYPA 5CV9A 3NSWA 3MTSA 4E6IA 1UUPA 4L8JA 3MXNA 3GTJB 3VYRA 1D1KA 2K5DA 3ERQA 2X69A 3O13A 4G57A 1CT1D 1I6VC 2K6AA 5COYA 4DF7A 2NVQB 2F0EA 5KRUA 3N52A 1Z47A 1B4OA 4BS9A 4DA2A 2B2TC 3S2DB 2ZXPA 2RDHA 1O80A 1SE4A 2NVTB 2A73B 1S5BD 2YU9B 3NTIA 4RA8A 4CJ0B 2ENBA 5JEAG 1TKWB 3A7LA 4BA2I 2J0TD 1S5ED 3VYSA 3R93A 2PZUA 4K2KA 3ONAB 4O1NA 3TMEA 4ZYSA 2EOTA 4DGZA 3P20A 2CQAA 3HOZB 5ELDA 1HQRD 4DAPA 1F2MA 1U4RA 1AZQA 1V43A 4S3SA 4HSVA 1JE4A 1SYFA 2NVYB 4K6LA 1CI3M 5CBAE 4QIWB 3TDQA 2H1EA 1IKMA 5E1FA 4RAUC 1PDQA 5A2QL 2XIWA 3FKIB 3DM1A 4OIJA 3NQIA 3MVVA 3DEPA 1SBBB 4XQQA 4XQNA 4IUNA 1ZKOA 1BCPC 2L0CA 5EPKA 1X3PA 1I4PA 1EY0A 1MBYA 4OIKA 2NVXB 4KV6A 4GZYC 4BWGB 2F0DA 2NZ1D 3ITPA 2HCCA 3TZUA 2K1BA 4DNTB 5C0XH 1BBXC 1PRTB 3NWSA 3J7AV 4A3MB 4JBWA 3EA6A 2F0FA 4Z9CB 4HMIA 3MZ5A 2D9UA 4A3DB 3I4NB 4EQNA 4ULLA 2F0LA 1VDZA 2HCIA 2YYZA 1LT4D 3NTKA 1DOMA 2L55A 4FF4A 2PW7A 3PIO3 2LS01 4I7ZC 2IW3A 1SE3A 3TP5A 5KEEA 1BCPF 4J1MA 3SVMA 4IFDI 5FLXL 5I9PA 4NW2A 2NBFA 1L0YB 4M8AA 2FFKB 2C5CA 1YNJC 1DONA 1XTCD 1RCVD 1A3UA 1XX8A 3VYUA 1AZPA 1TU2B 3ZYYX 2F0IA 5C3EB 1K8MA 4QUFA 2EZVA 3OWFA 4KTAA 3SR1A 2PZTA 1ET9A 3D8GA 1FYCA 3NWTA 3ND9A 3QOJA 4KN4C 2QCPX 4RFBA 1I3QB 2B2WC 4UAIA 2DNCA 1ONLA 4H13C 3HOUB 4K2LA 5KIXA 3I8ZA 4QCLA 5JVG3 1ENFA 2PPBC 4KY5A 4RGNA 2KECA 3S1RB 2VXWA 3BVMA 3T16A 3KLSX 2WKCA 5CV4A 5IGCA 5JJZA 3K5NA 2PQEA 4X3SA 2KCNA 2DY8A 5C0XG 3QG1A 4F8MA 4G7ZC 2PYKA 2G9HD 1GHJA 3T51B 3KUPA 1S4ZA 1XWEA 1A3VA 3E5SA 3VR5A 2EJMA 2FINB 1DXMA 1K83B 3J7AF 3S2HB 2A6EC 2SNSA 5CV7A 4G7OC 2EYMA 4KD4A 3L9AX 2IJ0A 1CZGA 5IIFA 4RKLA 4XXEA 1BCPD 4N9TA 3VA7A 1STGA 5ISRA 3CQZB 3GV3A 4OO1H 4U68A 5NUCA 2EXZA 3G7LA 3H6MA 5BN3A 5M5WB 5DM63 4K8JA 1TT2A 4B08A 5C5MA 1STEA 1RDPD 1WTRA 1VF7A 1SNDA 3N6RA 3K0YA 3WOFA 2OEOA 1CK1A 1Z6HA 2N55A 3MFYA 3DXJC 4DNRB 4RWSC 3QIAA 1EZ6A 2NWGA 2F3VA 3DWPA 3K5OA 2K04A 5EBCA 4K5VA 4EQOA 2BDOA 1EYCA 1IL8A 3QB3A 1OO9B 1KLUD 2JA7B 3V2TA 4H44C 2B2TA 1DM0B 3S14B 1G291 5JVH3 3BS1A 2XWJB 1RODA 1TQOA 1HXYD 1EY7A 1X3QA 2L4NA 1TWHB 1C8CA 1DOLA 1U4LA 4BY1B 1PZJD 4BBRB 2WP8J 2AQ3B 1JWUD 5J22A 2SDFA 1Z7TA 1HQMC 4DAYA 1J9OA 1YNJD 4K8IA 1LABA 1LV9A 5J1ZA 1VF5C 4B9XA 3PO2B 3C2PA 3S1NB 1RTOA 2F0UA 4K5XA 1TWGB 4CGYB 3TP8A 3OW7A 2ZT9C 2FMMA 2WB1B 3OSOA 4ME5A 3PUXA 4KY7A 2XRSD 4FF2A 3VR4A 4C3JB 1WD0A 2I46A 4IFDJ 3OHXC 2SOBA 5FO7B 2IWHA 5CC4A 2K03A 2JSOA 2K33A 4P2CB 5EKIA 1KDCA 3NE5B 1WTXA 1RTNA 5DAUA 3OIPA 3OPOA 2A6ED 4A3IB 5ELBA 4ID6A 5D3IB 3NXWA 5C6AA 3H09A 3GTGB 3WDNA 1HCZA 2TMPA 2Z4HA 5M9OA 2B63B 3MA2B 1G2SA 3HP3A 3HOVB 3V96A 2RSNA 1LT5D 4I65A 4RCNA 3A56A 1EZ8A 1V8QA 3PUWA 3I4LA 4C3HB 1SMYC 2EYHA 2QEJC 3H91A 4KHVA 1BCPB 1KDAA 4HAEA 3D3RA 1JOOA 3D4DA 1HUNA 3WOEA 4IUVA 3QWNA 1JWSD 2IPKD 2WKDA 4OO1I 2Q8RE 3S9WA 1H9JA 4A3FB 1JWMD 2MGSA 3TSSA 1WTOA 1F2ZA 4FXGC 1EQTA 3BYTB 3Q22A 4LMQD 2B8GA 2B2WA 1B1ZA 2OXPA 2A69C 2KVMA 1Q90A 5I6YA 3LWEA 2IX3A 3LNNA 1H9MA 1PTOH 3FDTA 3FRPB 2HUGA 4DK1A 1VMCA 1G91A 5IT9E 1SNMA 3L3OC 3OOCA 1QNUA 2DNEA 1CHPD 1O7ZA 3HOXB 2IX1A 1OXXK 1ILQA 3AU7A 4BA1I 1WTPA 2F0VA 4OGQC 3VR2A 1BF4A 4PMWA 1D5XC 1R4PB 1IW7C 2IL8A 4AYBB 1SAPA 4NP5A 5TSSA 2MPMA 1C48A 1KAAA 5CV5A 2GA4B 4KJNA 4OHJA 3V05A 1BNZA 5EJWA 1H9RA 1XYIA 1SYBA 2D62A 2EPBA 3K57A 2K32A 4A3JB 4V0BA 3RZOB 4LAAA 1G8ZD 5T1IA 1LO5D 1VCIA 2MP1A 3CRLC 3NHHA 3VR3A 5DM73 3BZDB 2D2CC 4PV1C 1CTMA 1MSGA 1EYAA 4IURA 1GUGA 2X6LA 1E2VA 2RBMA 1DYQA 3Q24A 4X3KA 2H4OA 4ZAIA 1HPCA 3GD7A 4WORA 1SMYD 3PUVA 2XSCA 3NK9A 1HA6A 2V4DA 1TVXA 5A2QE 5AFWA 3S1QB 1EY5A 2LFNA 1II3A 1F9RA 1HUMA 1L0XB 2NTSA 5JOBA 1Y8NB 1J8IA 3A54A 2DN8A 5KNDA 4A3KB 1UAPA 4F88A 4ZUJA 3OMGA 5C5LA 3SE0A 2KA7A 1KDBA 5EBDA 3C3LA 4FYDA 1A6XA 4C3IB 5C44B 3K59A 4WJWA 3Q0AA 4DK0A 3J80L 4RGOS 1G2TA 2L11A 1SJED 4IUQA 4BY7B 3PUZA 3P7JA 3OWEB 5BN4A 1HTLD 2A69D 2M00A 3T53B 1TS4A 1B2TA 2BE5C 4ILWA 1QILA 3LWUA 5LHY1 1D5MC 3RUZA 1DJRD 1SYDA 3J80E 2FJ2A 2I07B 5KNCA 1MGSA 3GP7A 1ENAA 4R9WA 5FK9C 1PMRA 4X3TA 1WTQA 5LL6X 1M4VA 1EOTA 4FO2A 1TS5A 1JR0D 5KGUA 1LTRD 2K01A 1TWAB 3QOLA 1M8AA 4A93B 3U9SA 2VNUD 5FLXE 2NN6H 3PO3B 1V1OA 3HS0C 2RA4A 2RQXA 2KCCA 1B3AA 4KKSA 3MEHA 1STYA 2B2VC 4FP5D 1PTOC 3SK6A 1Q1BA 1ZXTA 2KEEA 1Q3LA 4TKOB 1TY2A 2Q8TA 3C46A 3FMCA 2EY6A 1SXTA 3QJYA 2JEBI 5ELFA 4H0LC 3M4OB 1EEID 3D31A 1ESRA 1VMPA 1CQVA 4A3EB 2JA8B 1LLRD 2PNRC 4CBVA 5JPMC 5C4ZA 4WRDA 2K5QA 2A6HC 4DXGA 3D4RA 5G3LD 1H9KA 1Q1EA 3SHLA 1F9SA 2MHVA 3A8JE 1RF2D 3MHBA 1PZKD 1HTPA 3H0GB 5K5PA 1OXTA 4K14A 1E2WA 2RSOA 1TWCB 2RVLA 3IFDA 3EQLC 1B9NA 1TR5A 4YIJA 3RZDB 1X32A 3OIQA 5A35A 3BG3A 3VA5A 1STAA 5DNFA 5M3MB 3D6CA 3J81L 1PTOF 2OT2A 1EWCA 2ZXOA 2F0TA 2VB2X 1LACA 2A68C 1A2TA 5JPNC 4G7HC 3S15B 1SNPA 1DCZA 2EE1A 2JE6I 2EY5A 4TQUS 2F0MA 4ZKCB 1EFID 1LTAD 4XIGS 3A7AB 2B2YC 3URYA 1LTTD 1KNEA 4CJ2C 1STHA 4CKCA 2BOSA 2NN6G 2Z8LA 3NQTA 4PMCA 3BVGA 3PIP3 2BE5D 2L1BA 4RH6A 1F77A 5C0XI 3JAML 2E2IB 4ZRZA 5CMDA 2R92B 1U4MA 2CHBD 2KOLA 1GHKA 1R4QB 3OMCA 4HEDA 5IOCA 3TN2A 2M2LA 2M9VA 1I4HA 3GTKB 3KK7A 2WACA 2FHTA 2WIIB 2NTTA 1PFNA 5JEAJ 3JAME 1ILPA 3KLRA 4XYQA 4IUUA 1Y1WB 4Q5VA 1ZYRC 2SNMA 2E75C 4U673 1DOKA 4HSPA 4F7XA 1EIHA 1GXDC 1NR2A 3K5MA 3K5LA 5D3DA 3DHQA 4IALA 5FO8B 2WAQB 1LTGD 4IQZA 2F0WA 2AUKA 5C4JB 1STBA 1OXSC 1PTOD 1CHQD 2NYZD 2HQEA 2R61A 5D14A 3RD4A 2J7ZA 5IGFA 3FVQA 1BDOA 1SNOA 3SK8A 1LTBD 3X3MA 2Y0SB 2JA5B 3DUZA 3T56B 2F03A 1I4QA 3KBGA 1Y69U 1FNVA 2LKVA 2XVSA 1QWYA 2LMCB 2ICEC 1O78A 2A6HD 2RDFA 3I90A 4TRDA 5KYLA 1RHPA 1SNQA 4A3GB 2EJFC 2F0HA 1R9TB 2QF7A 4C56C 5CV6A 1FNUA 2HDMA 1EIGA 3MAQA 4KD3A 3IL8A 4ZUIA 3IFTA 1JQYD 3K7AB 4KKTA 5IGBA 1RKNA 3E0JA 2AWOA 4R8NA 3KBXA 1PXUA 2NUCA 2A68D 2E76C 5IGGA 4KJOA 2E74C 1PLFA 4C3JG 1WTVA 5CBEE 3M3YB 1SJHD 1BUVT 2BCOA 3C1FA 1AN8A 1GOZA 4HMJA 4LK1C 2F0SA 4O42A 5EPLA 1KNAA 1I4RA 3KF8A 3AB9A 3A8KE 4JK1C 3P1HA 1AW7A 1NUCA 1SSOA 3R2IA 3I72A 4Q0FA 2A5HA 5J39A 3HKZB 1MD2D 1H9SA 2B2UC 2RKSA 4KKUA 4F87A 1FNWA 4IFDH 3M7GA 1OXVA 2RDGA 2C9OA 2KUMA 4QF4A 3CU7A 4ZLTF 2B2VA 5IGEA 4PMBA 1Y8OB 1SEBD 2KQ3A 2JYOA 1IHZA 1JB3A 1TWFB 2XN9C 2O5IC 1IYVA 3MXUA 1GUWA 4C3HG 1ZYRD 5KNBA 1AP0A 4DFAA 4KN7C 1K8OA 1WD1A 1F9PA 1U4PA 4NKLA 4C1NK 1KLGD 1HFGA 4KI0A 1BQQT 2O5JC 3GQBA 4B9WA 5C0XJ 1LTSD 4LJZC 3BDOA 1STNA 4RKBA 1TS3A 3K6OA 4L63B 1E0BA 3G6JB 3TBIB 2EYFA 3NTHA 3D4WA 5I4DA 3U9OA 5F2DA 1EY6A 1U9RA 1UNSA 1JCKB 1H9SB 1JOQA 1I50B 3F2UA 1F9QA 1JC7A 1SNCA 1QE6A 3S17B 1EY4A 2MJ8A 3GV6A 2PO4A 1PTOB 1IYUA 2F4IA 5D65A 1B44D 1D6EC 3PV0A 1CM9A 1MSHA 1SYCA 5FKAC 4FF3A 3HOYB 5I6WA 1NR4A 2EY1A 4CJ1B 4XYOA 4PQXA 4IN3A 3SK4A 3AMUA 2B2YA 1GUTA 1O7LA 4HN7A 5C4HA 4IUPA 3Q23A 2F0PA 1YNNC 1SFOB 4IFDG 5CV8A 3K58A 4KHZA 3NBIA 5HGTA 3HG9A 1Y1VB 4L6TB 5KYIA 5C3XA 1HA5A 2F0GA 3GTLB 3W3AA 4DN4M 3S1MB 4IZ8A 1ZEQX 1KTKA 3NBHA 2EYLA 3I70A 4MHEA 4TSSA 2CW0C 3CHBD 1RD9D 1NAPA 5FOBB 2EYOA 3HEJA 1B53A 1EU4A 1W6JA 4XTCS 1QCBD 2EVBA 2NB0A 3HOWB 3D6WA 3LX0A 3X3NA 5ELCA 2F0QA 5IGDA 5G3LF 4ZK9B 4ZKBB 1PZID 4XT1B 1I6HB 1RJTA 4ZQ3A 3VR6A 2PCFB 1G6ZA 1TIID 4K6DA 4XDXA 5CYUA 2O2LD 3M4YA 4FVMA 2B39A 1EEFD 3PUYA 2IX0A 3CRKC 1QB5D 1ENCA 2AQ2B 2X6GA 1NSNS 2XNAC 1GUNA 4HCSA 2A74C 2R3ZA 1S5CD 3R8BA 2Z1CA 1HHVA 3KLSA 1IW7D 3SDZA 4MN3A 2EY2A 2WV6D 4C3IG 4CKBA 1EY9A 1GUOA 2XRQD 1CA5A 1SDFA 4RHRA 1BOSA 2L12A 1FGBD 1DZ1A 4CKEA 1DD2A 1IKLA 4FF1A 1LTID 5C4XB 4UDUC 1XXGA 4M1UB 2AQ1B 1GUSA 2EYJA 3SEBA 1CA6A 3BDCA 1ICWA 2VB3X 3HZXA 3H94A 1NCVA 1CZWA 4RCOA 4K5WA 1D1IA 2MUYA 1JOKA 3R3OA 4WFN3 2Q8IB 5DEHA 1ET6A 2G9DA 3NPPA 2KHSA 1S5FD 4EQPA 5E3FA 1YNND 3J7YW 4FXKC 4DAVA 4RGTA 2B2UA 1SE2A 1FR3A 2F1MA 4KMUC 2E2DC 3DWAA 3EJIA 2AWNA 5FO9B 3M7NA 5I2YA 2CW0D 5BN5A 5I2XA 2JXMB 2ICIA 1EYDA 1PRTC 3ND8A 1Q12A 1F2LA 1A2UA 4KY6A 3MWYW 1O7YA 4Y7NB 1QOHA 5C3WA 1BXTA 1B50A 1Y8PB 4ABNA 2PMZB 3J81E 2R93B 5EQ0A 1PFMA 2J4XA 1TY0A 3HGBA 5I9OA 4R8IA 3RLFA 5T1GA 4EVOA 1CFMA 1OXUA 3QO2A 1JICA 4HCEA 4C1NI 1HRJA 2QKIC 3MXPA 1QNKA 2ZXRA 3TP7A 4HR7B 3NUCA 2EDGA 1C4QA 3SK5A 4BBSB 1PFBA 5EGTA 2QDBA 3T13A 4QB4A 4RHSA 2F0OA 1I4GA 3GTOB 3Q6SA 2F3WA 5E4XA 5JAVA 1UEAB 2E2JB 1PRTF 2K05A 1LT3D 3H3VC 2JEAI 3DMUA 3L7ZC 3GTMB 5CORA 1A15A 1BO0A 3DEOA 1E2ZA 3EVQA 4IUTA 4OL7A 1GJXA 1A3TA 2JP1A 1TS2A 1CQFA 1EY8A 4XQJA 4EGVA 3MXGA 4QMGA 5ELEA 1EU3A 2L9HA 1T5EA 3I73A 3A55A 3RMHA 3DWQA 3EFXD 2AUJD 1Q8IA 4QUCA 5M3FB 3UI2A 4CHTB 5IODA 1BR9A 3I3CA 5HURA 2R6GA 3GTQB 1F2YA 1KABA 4H7BA 3VYTA 4OO1G 2FMCA 2NN6I 2O4XA 1V1PA 2Z4IA 5K36H 2XWBB 3W2DA 1LT6D 2QILA 3TP6A 1ML0D 1JORA 2LY7A 2KEDA 5EKKA 4XT3B 3I91A 4A3BB 3MFGA 5CR3A 3A8IE 2JA6B 5EPJA 5E4WC 1B9MA 3IKJA 3IAYA 1WTWA 4G4KA 4HTHA 4J6HA 1MI2A 1FD7D 4J8QA 2EJGC 2DY7A 2F0NA 3NP8A 2TSSA 3GTPB 1EWHA 2PW5A 2K7VA 2B8FA 3EROA 1EQVA 1S5DD 3P75A 1PRTD 2WINB 2SEBD 3BVZA 1W6KA 3I4MB 1HFNA 2BA0A 2F0KA 5JEAH 1ESFA 3BDLA 3MC0B 4FNFA 4PNYA 5M5XB 4FXDA 1PYWD 3T4AC 4V190 1V1PB 1QJOA 1EL0A 2E2HB 1AEXA 2ID0A 5EKLA 4MIUA 2L5TA 5CGKA 2OF1A 3BYYB 1WCMB 3M85A 4DXFA 2HDLA 1WVLA 2K28A 1D5ZC 2R7ZB 3CKIB 2D5DA 4KK7A 3FPUB 1I4XA 3E6ZX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EY6 A;  4KHV A;  4DGZ A;  4DFA A;  2EY2 A;  5IIF A;  2F0H A;  4B9X A;  1F2Y A;  1KAB A;  2F0G A;  4DU9 A;  4RKL A;  5C3W A;  5KEE A;  4NP5 A;  3SXH A;  4H7B A;  1EY9 A;  1F2M A;  1KDA A;  4N9T A;  4NKL A;  4J1M A;  1STG A;  5CV6 A;  5ISR A;  5J22 A;  4S3S A;  4IZ8 A;  2O4X A;  1KAA A;  5CV5 A;  1SYF A;  2F0J A;  3OMC A;  5IOC A;  1JOO A;  3D4D A;  5J1Z A;  4KJN A;  4KD3 A;  4B9W A;  2EYL A;  5NUC A;  2F0U A;  2EXZ A;  3TP6 A;  4K5X A;  4ZUI A;  3H6M A;  5I9P A;  1SYB A;  3C1E A;  5E1F A;  3PMF A;  1JOR A;  2M00 A;  3TP8 A;  5I9O A;  5C4Z A;  1STN A;  5IGB A;  4WRD A;  2WAC A;  1RKN A;  3OSO A;  4ME5 A;  4NDX A;  1SYE A;  4K8J A;  4RKB A;  5EKK A;  4EVO A;  4R8N A;  1TT2 A;  2EYO A;  4KY7 A;  4LAA A;  3HEJ A;  3MXP A;  5C5M A;  4ODG A;  3S9W A;  3TP7 A;  4N9P A;  2EYF A;  1A3U A;  2EYJ A;  3RUZ A;  1SND A;  3MVV A;  3NUC A;  3SHL A;  2NUC A;  1SYG A;  1SYD A;  5IGG A;  2OEO A;  4KJO A;  5CR3 A;  3BDC A;  2SNM A;  3NHH A;  3D4W A;  2F0I A;  3MHB A;  2SOB A;  3U9O A;  5F2D A;  3SK5 A;  1F2Z A;  3OWF A;  1EY6 A;  1U9R A;  3HZX A;  2PZT A;  3D8G A;  2PZW A;  4IUN A;  4KTA A;  3SR1 A;  5K5P A;  4NMZ A;  1JOQ A;  1ENA A;  4F7X A;  5CC4 A;  2EYP A;  2QDB A;  5EGT A;  4K5W A;  3R3O A;  1EYA A;  1JOK A;  3C1F A;  5CV9 A;  1EY0 A;  4K14 A;  4HTH A;  3T13 A;  4J6H A;  3QOJ A;  4KV6 A;  3DHQ A;  3LX0 A;  1KDC A;  4IAL A;  4E6I A;  1EZ6 A;  2F0D A;  4HMJ A;  3ITP A;  4QB4 A;  2F0O A;  5DEH A;  1SNC A;  2F0N A;  3NP8 A;  2F0S A;  2OXP A;  2RBM A;  2F0Q A;  1TR5 A;  2F3V A;  5IGD A;  2PW5 A;  4YIJ A;  1EY4 A;  2KHS A;  4EQP A;  4K5V A;  3VA5 A;  2F0W A;  5E3F A;  2F3W A;  3ERO A;  4K2L A;  3ERQ A;  4EQO A;  1STA A;  5KGU A;  1STB A;  3D6C A;  5I6Y A;  5DAU A;  5JAV A;  5KIX A;  1EYC A;  2HQE A;  1EQV A;  3P75 A;  3QB3 A;  3P1H A;  4G57 A;  4KY5 A;  4DF7 A;  1NUC A;  4ID6 A;  5IGF A;  2F0E A;  3QOL A;  2F0T A;  5KRU A;  3NXW A;  2F0K A;  4ZQ3 A;  1SNO A;  3V2T A;  5C6A A;  4WOR A;  5J39 A;  3BDL A;  3DMU A;  1A2T A;  3NK9 A;  3SK8 A;  3T16 A;  1SYC A;  4K6D A;  4PNY A;  2F0F A;  2RKS A;  5CV4 A;  5IGC A;  5I6W A;  1SNP A;  4HMI A;  2EY1 A;  3MZ5 A;  2EY5 A;  2PQE A;  3EVQ A;  1TQO A;  2F0M A;  1EY7 A;  4OL7 A;  4F8M A;  5M9O A;  1EY5 A;  3EJI A;  4EQN A;  2PYK A;  1SNM A;  3SK4 A;  2F0L A;  1A3T A;  1ENC A;  2LKV A;  1EY8 A;  1II3 A;  2ENB A;  1NSN S;  4QF4 A;  3MEH A;  1A3V A;  3E5S A;  1STH A;  5C4H A;  1AEX A;  1STY A;  4QMG A;  5IGE A;  5EKL A;  4I65 A;  4MIU A;  4PMB A;  5JOB A;  2F0P A;  2F0V A;  2PZU A;  2RDF A;  2OF1 A;  3NQT A;  4K2K A;  4PMC A;  3SK6 A;  1EYD A;  2KQ3 A;  4TRD A;  5CGK A;  5KYL A;  1IHZ A;  2SNS A;  2PW7 A;  5CV8 A;  4K8I A;  5CV7 A;  1EZ8 A;  5HGT A;  4ZUJ A;  3OMG A;  5C5L A;  2EYM A;  3TME A;  1SNQ A;  5KYI A;  1KDB A;  4KD4 A;  1A2U A;  2EYH A;  5IOD A;  3TP5 A;  5C3X A;  5HUR A;  4KY6 A; 
#chains in the Genus database with same CATH topology
 3FEW X;  1LTL A;  4H02 A;  4X66 L;  2N88 A;  4DU9 A;  3GO5 A;  4A3G G;  3SXH A;  3SGI A;  2B63 G;  1VS0 A;  2IT1 A;  4MTN A;  4GKJ Q;  2F0J A;  3HOV G;  4DNI A;  4RGM A;  1D2B A;  4DV0 Q;  1VQB A;  1AFP A;  3CC2 A;  3C1E A;  3PMF A;  4B3M L;  2HT1 A;  5M5Y B;  2CVR A;  2OCE A;  4NDX A;  1SYE A;  2VUM B;  3FPP A;  1I50 H;  3S16 B;  5IT9 L;  1T5X D;  4C2M B;  4ODG A;  3TZD A;  4J15 A;  1PYB A;  4N9P A;  2ATW A;  2VQE Q;  3R2T A;  1BKB A;  2K5W A;  2Z9H A;  4DKA C;  5K36 G;  1SYG A;  5LL6 S;  1S40 A;  2BDN A;  4A3J H;  3RZO H;  1D7Q A;  3S17 H;  3CW2 C;  1QG7 A;  4X3U A;  2PZW A;  4NMZ A;  3I4O A;  2BA1 A;  3HRZ C;  2KJX A;  2EYP A;  5CV9 A;  4CDE C;  3NSW A;  2Z6K A;  3MTS A;  4E6I A;  4JI8 Q;  1UUP A;  4B3M Q;  1MIU A;  4L8J A;  3MXN A;  3GTJ B;  3VYR A;  3HOY H;  1D1K A;  2K5D A;  3ERQ A;  2X69 A;  3O13 A;  4G57 A;  1CT1 D;  1I6V C;  2K6A A;  5COY A;  4DF7 A;  2NVQ B;  2F0E A;  3N52 A;  5KRU A;  1Z47 A;  2UXD L;  1B4O A;  1CKN A;  4BS9 A;  4DA2 A;  2B2T C;  5JJL A;  4DR6 Q;  3S2D B;  2ZXP A;  1Q81 C;  2RDH A;  1O80 A;  1SE4 A;  1LYL A;  2NVT B;  2A73 B;  4DR1 L;  1S5B D;  2YU9 B;  3NTI A;  1HJP A;  4RA8 A;  4CJ0 B;  1PH6 A;  1P8L A;  2AKW B;  2ENB A;  1XMQ L;  5JEA G;  1TKW B;  2E8G A;  3A7L A;  4BA2 I;  5LMN W;  3S1Q H;  2J0T D;  1PH5 A;  1S5E D;  3VYS A;  3R93 A;  2PZU A;  2GN5 A;  4K2K A;  1JJ2 A;  3J7Z C;  2UXD Q;  4JC0 A;  3ONA B;  3MEF A;  3D0F A;  4O1N A;  3TME A;  4ZYS A;  2HIV A;  2EOT A;  4QGU A;  4DGZ A;  3P20 A;  2CQA A;  4DR1 Q;  4A3K H;  2D0P A;  1K28 A;  3HOZ B;  5ELD A;  2HHH L;  1HQR D;  4OEM B;  1F2M A;  4DAP A;  1U4R A;  5L37 A;  1AZQ A;  1V43 A;  4S3S A;  4HSV A;  1JE4 A;  4BXX G;  1SYF A;  2NVY B;  1XMQ Q;  4K6L A;  1CI3 M;  3RR5 A;  5CBA E;  4CDD C;  4QIW B;  3TDQ A;  2H1E A;  5LMN L;  4A75 A;  1IKM A;  5E1F A;  3MXN B;  1PHJ A;  3J81 i;  1S72 A;  4GLX A;  4RAU C;  1PDQ A;  5A2Q L;  2XIW A;  4BY7 H;  2I5M X;  3FKI B;  3DM1 A;  4OIJ A;  3NQI A;  3MVV A;  3DEP A;  4N8X 1;  1SBB B;  3RN2 A;  1CKN B;  2HHH Q;  4AYB G;  4XQQ A;  4XQN A;  4IUN A;  1ZKO A;  1BCP C;  2L0C A;  5EPK A;  2MO1 A;  1X3P A;  1I4P A;  1EY0 A;  1MBY A;  5LMN Q;  4OIK A;  2NVX B;  4KV6 A;  4GZY C;  2Q2U A;  1I6H H;  1HNW L;  4BWG B;  3F2B A;  2F0D A;  2NZ1 D;  3ITP A;  2HCC A;  3TZU A;  1K0R A;  1A63 A;  4P73 A;  4Y52 H;  2K1B A;  4DNT B;  4A3J G;  5AJ3 L;  5C0X H;  1QZG A;  1BBX C;  1PRT B;  3NWS A;  3J7A V;  2I5L X;  4A3M B;  3JAM i;  1PFS A;  3CCR A;  4JBW A;  3ER0 A;  1HNX L;  3EA6 A;  3FP9 A;  2F0F A;  4Z9C B;  3PIP A;  1TWA H;  4HMI A;  1M90 C;  3MZ5 A;  2D9U A;  4A93 H;  4A3D B;  1MHW C;  1HNW Q;  3HOY G;  3I4N B;  4X64 Q;  3I55 A;  4EQN A;  4ULL A;  2F0L A;  1VDZ A;  1WJJ A;  2HCI A;  3CAM A;  5AJ3 Q;  1VQI A;  2YTV A;  4QIW E;  2YYZ A;  1LT4 D;  1VQ6 A;  3NTK A;  1DOM A;  2L55 A;  2MNA A;  2VY3 A;  1HNX Q;  4UPA A;  4FF4 A;  2PW7 A;  3PIO 3;  2LS0 1;  4I7Z C;  2IW3 A;  1SE3 A;  2JA9 A;  3TP5 A;  1VQ5 A;  5KEE A;  5C4X H;  1BCP F;  4J1M A;  4DK3 C;  4DPG A;  3SVM A;  4GLA C;  4IFD I;  4JW0 A;  5FLX L;  5I9P A;  4NW2 A;  3M4O H;  2NBF A;  1L0Y B;  4M8A A;  2FFK B;  3HFZ B;  1E7Z A;  4AIM A;  1Q46 A;  4A3K G;  1PH1 A;  4A3E H;  2C5C A;  2JA8 H;  1YNJ C;  1DON A;  1XTC D;  2QEX A;  1RCV D;  1MJE A;  1A3U A;  1XX8 A;  1C9O A;  3VYU A;  1AZP A;  1TU2 B;  1PH9 A;  3ZYY X;  2F0I A;  3UDX A;  5C3E B;  1K8M A;  4QUF A;  2EZV A;  3OWF A;  4KTA A;  3SR1 A;  2PZT A;  1ET9 A;  3D8G A;  1FYC A;  3NWT A;  3ND9 A;  3QOJ A;  4KN4 C;  2QCP X;  4RFB A;  2XTI A;  1I3Q B;  4EX5 A;  2B2W C;  2LXK A;  3H0G H;  1HZ9 A;  4UAI A;  2HD3 A;  3AFP A;  2DNC A;  4YCV A;  1ONL A;  4K0K L;  4LFB L;  4H13 C;  3HOU B;  3RN5 A;  4K2L A;  5KIX A;  3I8Z A;  1TWC H;  4QCL A;  5JVG 3;  1ENF A;  2PPB C;  4KY5 A;  4EQ5 A;  4RGN A;  2KEC A;  3RZD H;  3S1R B;  4LWC A;  2VXW A;  3U4Z A;  4B3S L;  3BVM A;  5M3M H;  4POF A;  3F1Z A;  3T16 A;  3KLS X;  2WKC A;  5CV4 A;  5IGC A;  1KXL A;  5JJZ A;  3K5N A;  2PQE A;  4X3S A;  2KCN A;  2DY8 A;  5C0X G;  3QG1 A;  4F8M A;  4G7Z C;  3S15 H;  2PYK A;  2G9H D;  1GHJ A;  3T51 B;  3KUP A;  2P5Z X;  3STB C;  2F52 A;  1S4Z A;  4K0K Q;  1KD1 C;  1XWE A;  2GVA A;  4DR5 Q;  5IYB G;  1A3V A;  3E5S A;  2ZJQ A;  3VR5 A;  2EJM A;  2FIN B;  1DXM A;  1K83 B;  3J7A F;  3S2H B;  3RLN A;  3T1H L;  2A6E C;  4A93 G;  1WTH A;  4B3S Q;  2SNS A;  2VQF L;  4GNX A;  5CV7 A;  4G7O C;  4LUV A;  2EYM A;  2VW9 A;  4KD4 A;  5GRO A;  2NZH A;  3L9A X;  2UUA L;  4GN4 B;  2IJ0 A;  1CZG A;  5IIF A;  3PCO B;  4RKL A;  4XXE A;  1BCP D;  4N9T A;  3VA7 A;  1STG A;  5ISR A;  3CQZ B;  3GV3 A;  1I94 L;  1A8V A;  1PYS B;  2R92 H;  4OO1 H;  1IBM L;  4U68 A;  4HJ5 A;  5NUC A;  2EXZ A;  4YWL A;  3G7L A;  3H6M A;  5BN3 A;  5M5W B;  5DM6 3;  4MNO A;  4K8J A;  1TT2 A;  4B08 A;  3KJO A;  5C4X G;  5IWA L;  5C5M A;  1STE A;  1RDP D;  1WTR A;  1VF7 A;  3GTK H;  1SND A;  3N6R A;  2UU9 L;  3K0Y A;  3WOF A;  2OEO A;  3GTO H;  1MKH A;  1CK1 A;  1C7Y A;  1Z6H A;  2N55 A;  1I94 Q;  3MFY A;  3DXJ C;  3M9B A;  1Y1W H;  5GAH C;  2E2J H;  2RCF A;  1IBM Q;  4DNR B;  3EIV A;  4RWS C;  4A3E G;  2JA8 G;  3QIA A;  1EZ6 A;  2NWG A;  2F3V A;  3DWP A;  3GTM H;  3K5O A;  1QVG A;  2K04 A;  5EBC A;  4K5V A;  5IWA Q;  4EQO A;  1I5F A;  2BDO A;  1EYC A;  1IL8 A;  3QB3 A;  1OO9 B;  1KLU D;  2JA7 B;  3V2T A;  3WWV A;  1AE3 A;  2B2T A;  4H44 C;  1DM0 B;  4P72 A;  5C4J H;  3S14 B;  1G29 1;  3H0G G;  5JVH 3;  3BS1 A;  1HNZ L;  4DV2 Q;  2XWJ B;  1ROD A;  3CXC A;  1TQO A;  2ZM6 L;  1HXY D;  1EY7 A;  1X3Q A;  2L4N A;  1TWH B;  3U4V A;  1C8C A;  1DOL A;  1U4L A;  4BY1 B;  1PZJ D;  2OTJ A;  1IYJ B;  3H3V I;  2I5H A;  1XPR A;  1L2F A;  5M3M G;  4BBR B;  2WP8 J;  2AQ3 B;  1JWU D;  5J22 A;  2SDF A;  1Z7T A;  1HQM C;  4DAY A;  1J9O A;  1KHI A;  1YNJ D;  4K8I A;  1LAB A;  1LV9 A;  1VQE A;  4R4O A;  4R4Q A;  1EUJ A;  5J1Z A;  1CSP A;  3NEM A;  1VF5 C;  2ZM6 Q;  4B9X A;  3PO2 B;  1JMC A;  3KOJ A;  4DV7 L;  4A3G H;  4R4C A;  3C2P A;  3S1N B;  1R9T H;  4UP9 A;  5J3B A;  1RTO A;  2F0U A;  4K5X A;  3PGZ A;  4NPS A;  1HH2 P;  1TWG B;  1YHB A;  4CGY B;  3TP8 A;  3OW7 A;  3A5U A;  4JBM A;  2ZT9 C;  1K0S A;  2FMM A;  2WB1 B;  3OSO A;  4ME5 A;  1YZ6 A;  3PUX A;  4KY7 A;  2XRS D;  2HIX A;  1AH9 A;  3K7A H;  1W2B A;  1L1O C;  1HR0 W;  4FF2 A;  4LF7 L;  1PH8 A;  3VR4 A;  4C3J B;  1WD0 A;  2R92 G;  1G6P A;  2I46 A;  4IFD J;  3K0X A;  3OHX C;  4GN5 A;  3GTP H;  2SOB A;  3ULJ A;  5FO7 B;  2IWH A;  4DV7 Q;  3K80 C;  3G71 A;  5CC4 A;  2K03 A;  2JSO A;  2K33 A;  2VS1 A;  4P2C B;  5EKI A;  1KDC A;  3NE5 B;  1PA6 A;  2I0Q A;  3STB D;  3M3Y H;  2EQS A;  1WTX A;  1RTN A;  5DAU A;  3OIP A;  3ZJY C;  3OPO A;  2A6E D;  4HJ9 A;  4A3I B;  5ELB A;  1Y1W G;  1HR0 L;  4ID6 A;  4LF5 L;  4DAY B;  5D3I B;  3NXW A;  5C6A A;  4JI4 L;  1K9M C;  3H09 A;  2LSS A;  1SR3 A;  3GTG B;  1VQK A;  3WDN A;  2K52 A;  1HCZ A;  2TMP A;  2Z4H A;  4IOA A;  5M9O A;  4DR7 L;  3TEH B;  2B63 B;  3MA2 B;  2R7Z H;  2OQK A;  5LMU L;  2RHQ B;  2WAQ G;  5ELO A;  1G2S A;  3HP3 A;  3HOV B;  3V96 A;  3G48 A;  3CMA A;  3F2C A;  2RSN A;  4WJ4 A;  1LT5 D;  4I65 A;  1HR0 Q;  4LF5 Q;  1VQ7 A;  1W3S A;  2WB1 E;  3AEV A;  4JI4 Q;  4RCN A;  4X65 L;  3A56 A;  1EZ8 A;  1V8Q A;  3PUW A;  3I4L A;  4C3H B;  1SMY C;  3PQI A;  2EYH A;  2QEJ C;  3H91 A;  4KHV A;  1XNR L;  4PZ7 A;  4DR7 Q;  3JC6 6;  1BCP B;  1KDA A;  1TWF H;  3TRE A;  4HAE A;  5LMU Q;  4C2M H;  1N32 L;  3D3R A;  5HY6 A;  1XMO L;  1JOO A;  3D4D A;  3LGJ A;  1HUN A;  3WOE A;  4YWM A;  4IUV A;  2DUD A;  2Y0S E;  3VDY A;  1SRU A;  4P71 A;  1N36 Q;  3QWN A;  1JWS D;  1H95 A;  2N3S A;  2IPK D;  2WKD A;  4OX9 L;  4OO1 I;  2Q8R E;  3S9W A;  1H9J A;  4A3F B;  5GAD C;  1JWM D;  2MGS A;  3TSS A;  1WTO A;  1F2Z A;  3A0J A;  1NMG A;  1N32 Q;  4FXG C;  3CME A;  1QZH A;  3ULL A;  1EQT A;  1X3F A;  2A1A A;  3BYT B;  3Q22 A;  4LMQ D;  4X6A H;  1VQA A;  2B8G A;  4DV3 Q;  2B2W A;  1B1Z A;  2OXP A;  5IT9 c;  4YY3 Q;  2A69 C;  3UDG A;  4JV5 L;  4I7A A;  1SRO A;  4OX9 Q;  1NNX A;  2KVM A;  1Q90 A;  5I6Y A;  4X66 Q;  3LWE A;  2NVT H;  2IX3 A;  1IBK L;  3LNN A;  4DAM A;  1JE5 A;  2FXQ A;  1H9M A;  4A3C H;  2PNH A;  3B6Y A;  1YJW A;  1PTO H;  3FDT A;  4N8F A;  3FRP B;  2HUG A;  4DK1 A;  1VMC A;  1G91 A;  5IT9 E;  4PZ8 A;  1J6Q A;  1SNM A;  1EWI A;  3L3O C;  3OOC A;  1QNU A;  2DNE A;  1CHP D;  1FGU A;  1K73 C;  1O7Z A;  3HOX B;  2IX1 A;  1OXX K;  3HOZ H;  1ILQ A;  3AU7 A;  4BA1 I;  1WTP A;  2F0V A;  1IBK Q;  4OGQ C;  3VR2 A;  1BF4 A;  4PMW A;  3HKZ G;  2R7Z G;  2KEN A;  1D5X C;  1R4P B;  1IW7 C;  1SFO H;  2IL8 A;  1A0I A;  4AYB B;  1SAP A;  4NP5 A;  5TSS A;  1Y1V H;  3CCV A;  2MPM A;  1C48 A;  2CWP A;  1KAA A;  5CV5 A;  2GA4 B;  4KJN A;  4OHJ A;  3V05 A;  3GTL H;  1BNZ A;  5EJW A;  1H9R A;  1XYI A;  1SYB A;  3S1M H;  5JJK A;  2D62 A;  2EPB A;  3K57 A;  2K32 A;  1EQR A;  4V0B A;  4A3J B;  3RZO B;  4LAA A;  1G8Z D;  5T1I A;  1LO5 D;  1SN8 A;  1VCI A;  1EFW A;  2MP1 A;  3CRL C;  3NHH A;  4LF9 L;  3VR3 A;  5DM7 3;  1Z9F A;  3BZD B;  2D2C C;  4PV1 C;  4DUY L;  1CTM A;  1MSG A;  4LF6 L;  1EYA A;  4JBJ A;  4A3M H;  4IUR A;  1GUG A;  2X6L A;  5IP9 H;  1E2V A;  2RBM A;  4NXN L;  3HOW H;  2N8N A;  3PF5 A;  1DYQ A;  3Q24 A;  4X3K A;  2H4O A;  1C0A A;  2XGT A;  4ZAI A;  1HPC A;  3GD7 A;  1MJC A;  4WOR A;  1SMY D;  3PUV A;  2YV5 A;  2XSC A;  2ZTD A;  3NK9 A;  1X54 A;  4DUY Q;  1HZC A;  1HA6 A;  4LF6 Q;  1YEZ A;  1QUQ A;  2V4D A;  3QR8 A;  1TVX A;  5A2Q E;  5AFW A;  4AYB E;  4QJF A;  1LUZ A;  3S1Q B;  1Y14 B;  1EY5 A;  2JJQ A;  1DGS A;  1SMX A;  1SE8 A;  1VQP A;  2LFN A;  1II3 A;  1F9R A;  1RIP A;  3UDI A;  1HUM A;  1L0X B;  4A3C G;  2NTS A;  3CP0 A;  5JOB A;  1Y8N B;  1J8I A;  4RG1 A;  5IYB H;  3A54 A;  2DN8 A;  3AFQ A;  1IXR A;  5KND A;  4A3K B;  1B3Q A;  4LFA L;  1UAP A;  4F88 A;  4ZUJ A;  3OMG A;  5C5L A;  4HJA A;  2KA7 A;  3SE0 A;  1KDB A;  5EBD A;  1YIT A;  3C3L A;  4FYD A;  1A6X A;  4C3I B;  5C44 B;  3K59 A;  4WJW A;  1GKH A;  3S24 A;  3Q0A A;  3HOZ G;  4DK0 A;  3J80 L;  4RGO S;  1G2T A;  2L11 A;  1SJE D;  4IUQ A;  4BY7 B;  3PUZ A;  1M1K C;  3P7J A;  3OWE B;  5BN4 A;  1HTL D;  4GOP C;  2A69 D;  2M00 A;  3T53 B;  2NZO A;  1TS4 A;  1B2T A;  4LFA Q;  2BE5 C;  4ILW A;  2UXB L;  1Y1V G;  1QIL A;  3LWU A;  5LHY 1;  3T1Y L;  1D5M C;  1L1O A;  3RUZ A;  1DJR D;  1I3Q H;  1SYD A;  1VQG A;  1B7Y B;  3J80 E;  2FJ2 A;  2I07 B;  3BZC A;  5KNC A;  1MGS A;  3GP7 A;  3J81 j;  3HOU H;  1ENA A;  5FLX c;  1QUQ B;  4R9W A;  5FK9 C;  4UP8 A;  1PMR A;  4X3T A;  1WTQ A;  3PIO A;  5LL6 X;  1M4V A;  3S1R H;  1EOT A;  4DUZ L;  3CF5 A;  3Q8D A;  4FO2 A;  2UXB Q;  1TS5 A;  5GQO A;  1JR0 D;  5KGU A;  1LTR D;  2K01 A;  3I2Z A;  1TWA B;  1GD7 A;  5DLQ E;  3QOL A;  1EOV A;  1M8A A;  4A93 B;  3U9S A;  4A3M G;  4JI0 L;  2VNU D;  2Q2I A;  4IPG A;  4X62 L;  5FLX E;  5IP9 G;  1YI2 A;  1PH4 A;  2NN6 H;  3PO3 B;  1NJI C;  1GO3 E;  1ASZ A;  1V1O A;  1K83 H;  3S2H H;  3HOW G;  2CFM A;  3HS0 C;  2RA4 A;  2RQX A;  2KCC A;  1XPU A;  1X3E A;  4R1J A;  1B3A A;  4KKS A;  1VQD A;  3MEH A;  1B70 B;  1STY A;  2B2V C;  2DGY A;  4FP5 D;  1PTO C;  3SK6 A;  1Q1B A;  1ZXT A;  2K5V A;  2KEE A;  4OWW B;  1Q3L A;  4JI0 Q;  4TKO B;  4X62 Q;  1TY2 A;  2Q8T A;  3C46 A;  1HZB A;  3FMC A;  2EY6 A;  1J5E L;  1SXT A;  2QDL A;  3QJY A;  2JEB I;  5ELF A;  4H0L C;  4JYA L;  3M4O B;  4LFB Q;  1EEI D;  1X6O A;  2KCT A;  3E0E A;  3D31 A;  4Y7N H;  1ESR A;  1VMP A;  4JG2 A;  4FDB A;  4OEL B;  1CQV A;  1UWV A;  4A3E B;  2JA8 B;  1LLR D;  2PNR C;  4CBV A;  2R7D A;  4OWX B;  5JPM C;  5C4Z A;  2R93 H;  4WRD A;  2K5Q A;  2A6H C;  4DXG A;  3G6E A;  4HJ8 A;  4LFC L;  3D4R A;  4A3L H;  5G3L D;  1H9K A;  1Q1E A;  3SHL A;  1T9H A;  1F9S A;  4GLV B;  2MHV A;  3A8J E;  1RF2 D;  4PG3 A;  3MHB A;  4JYA Q;  1PZK D;  2QA4 A;  1HTP A;  3H0G B;  5K5P A;  1OXT A;  4K14 A;  4LUO A;  5IE8 A;  1E2W A;  3T1H Q;  1AE2 A;  2RSO A;  1VQN A;  1TWC B;  2RVL A;  2JA7 H;  3IFD A;  3EQL C;  2VQF Q;  4BBS H;  4OXP A;  1B9N A;  1TR5 A;  4YIJ A;  3RZD B;  1X32 A;  3OIQ A;  5A35 A;  3BG3 A;  3VA5 A;  4LFC Q;  1STA A;  5DNF A;  5M3M B;  3CCE A;  3D6C A;  3J81 L;  2UUA Q;  4HIM A;  3HOU G;  1PTO F;  2OT2 A;  1EWC A;  1TWH H;  2ZXO A;  3U50 C;  4JBK A;  2F0T A;  4UHV A;  2VB2 X;  1LAC A;  4LNQ A;  2A68 C;  4BY1 H;  4YWK A;  1A2T A;  5JPN C;  3E9I A;  4R4T A;  4G7H C;  3S15 B;  1XPO A;  5IYC H;  1SNP A;  1XJV A;  2UUC L;  1DCZ A;  1VQM A;  2EE1 A;  2JE6 I;  2EY5 A;  4TQU S;  3CCJ A;  2F0M A;  2UXC L;  4MZ9 A;  4ZKC B;  1EFI D;  1LTA D;  4XIG S;  3A7A B;  1E22 A;  1YJ9 A;  2B2Y C;  3URY A;  1LTT D;  1YVC A;  4KLK A;  1KNE A;  3A5Z B;  2UU9 Q;  4CJ2 C;  1STH A;  4GN3 B;  4QL5 A;  4L5T A;  4CKC A;  2PI2 A;  4LF8 L;  3PO2 H;  3PF4 A;  2BOS A;  4GNX B;  1S3O A;  2NN6 G;  4IPH A;  2Z8L A;  3NQT A;  4PMC A;  4DV6 L;  4L5R C;  3BVG A;  3PIP 3;  2BE5 D;  2L1B A;  4RH6 A;  2R7F A;  1F77 A;  5C0X I;  1EIY B;  3JAM c;  1V1Q A;  3E9H A;  3JAM L;  3CD6 A;  2E2I B;  4ZRZ A;  1PH2 A;  2UUC Q;  5CMD A;  3CPF A;  1RL2 A;  2R92 B;  2KBN A;  1U4M A;  3I7F A;  2CHB D;  2KOL A;  2UXC Q;  1GHK A;  1R4Q B;  5M3F H;  3J7A 5;  3OMC A;  4HED A;  5IOC A;  3GTQ H;  3H15 A;  3TN2 A;  4YCW A;  2M2L A;  1E3P A;  4C3J H;  2M9V A;  1I4H A;  4DV6 Q;  3GTK B;  3KK7 A;  2WAC A;  5IYD H;  2FHT A;  2WII B;  2NTT A;  1PFN A;  2B3G A;  5JEA J;  3JAM E;  1ILP A;  3KLR A;  1BBU A;  1HNZ Q;  4XYQ A;  2BH8 A;  3GDE A;  4IUU A;  1Y1W B;  4Q5V A;  1ZYR C;  2SNM A;  2E75 C;  4JI7 L;  1A62 A;  4U67 3;  4A3B H;  1DOK A;  4HSP A;  4F7X A;  3TRZ A;  1EIH A;  2R93 G;  1GXD C;  1NR2 A;  3K5M A;  3K5L A;  5D3D A;  4A3I H;  4O2D A;  2GVB A;  5FLM H;  2IY5 B;  3DHQ A;  4IAL A;  5FO8 B;  2UUB L;  2JA6 H;  4A3L G;  1PVO A;  2WAQ B;  1LTG D;  1VQ4 A;  4IQZ A;  3OTO L;  3GTG H;  2F0W A;  2AUK A;  5C4J B;  1STB A;  1OXS C;  1PTO D;  3CCU A;  1CHQ D;  2NYZ D;  2HQE A;  2R61 A;  5D14 A;  2ZJP A;  3RD4 A;  2J7Z A;  5IGF A;  3FVQ A;  1BDO A;  1SNO A;  1K3R A;  2JA7 G;  3SK8 A;  4BBS G;  1LTB D;  3M4P A;  3X3M A;  3I4M H;  4TVA B;  2JQO A;  2RCN A;  1N8R C;  2ALY B;  2Y0S B;  2HQL A;  2JA5 B;  3DUZ A;  2UUB Q;  3T56 B;  2F03 A;  1I4Q A;  3KBG A;  3NEN A;  3W1B A;  5M5X H;  1Q82 C;  1Y69 U;  1FNV A;  4PZ6 A;  4C3H H;  2LKV A;  3OTO Q;  3L2P A;  2XVS A;  1QWY A;  4YHH L;  4BY1 G;  2K50 A;  2N78 A;  4LF4 L;  4LF7 Q;  2LMC B;  2ICE C;  5IYC G;  1O78 A;  1O7I A;  2A6H D;  2RDF A;  5E7N A;  3I90 A;  4TRD A;  3G4S A;  5KYL A;  1RHP A;  1YNX A;  3PSI A;  4JOI C;  2E2H H;  1SNQ A;  4NXM L;  5BR8 L;  5HGQ A;  3CCL A;  1EIF A;  1WCM H;  4A3G B;  2EJF C;  2F0H A;  1R9T B;  2QF7 A;  4C56 C;  5CV6 A;  1FNU A;  3PO2 G;  4JPB W;  2HDM A;  4DV1 L;  1EIG A;  3MAQ A;  4YHH Q;  4A3F H;  2ZTE A;  2OTL A;  4KD3 A;  3IL8 A;  4LF4 Q;  1YHA A;  3W5O A;  4ZUI A;  4GOP A;  3IFT A;  1BBW A;  1JQY D;  3K7A B;  4KKT A;  1IZ6 A;  2WAQ E;  2IHE A;  5IGB A;  1RKN A;  3E0J A;  2DJG C;  5JJI A;  2AWO A;  4R8N A;  2PI2 E;  3KBX A;  5M3F G;  1N34 L;  5M5Y H;  5GAE C;  1PXU A;  2NUC A;  2A68 D;  1Q7Y C;  2E76 C;  5IGG A;  4KJO A;  2VUM H;  3DM3 A;  3S16 H;  2E74 C;  1PLF A;  4C3J G;  1WTV A;  4IO9 A;  4DV1 Q;  2MFI A;  1KRS A;  5CBE E;  3M3Y B;  1SJH D;  1BUV T;  4KHP L;  5IYD G;  2BCO A;  3C1F A;  1E24 A;  3CC4 A;  1AN8 A;  4WJ3 M;  1GOZ A;  4HMJ A;  2MO0 A;  4X65 Q;  4LK1 C;  2F0S A;  1TXY A;  3L0O A;  1VQJ A;  4O42 A;  5EPL A;  1KNA A;  1I4R A;  3KF8 A;  1N34 Q;  3AB9 A;  4A3B G;  1XNR Q;  3A8K E;  4JK1 C;  1JJC B;  3RLO A;  3P1H A;  3GTJ H;  1JB7 A;  1AW7 A;  1NUC A;  1SSO A;  3R2I A;  3I72 A;  4Q0F A;  4A3I G;  4L5Q A;  2A5H A;  5J39 A;  5FLM G;  3HKZ B;  1MD2 D;  1XMO Q;  2JA6 G;  3HOX H;  1H9S A;  2B2U C;  2RKS A;  4KKU A;  3UE0 A;  4F87 A;  2NVQ H;  1FNW A;  3CC7 A;  3KDF A;  2VQE L;  3M7G A;  4IFD H;  1U5K A;  1NMF A;  3S2D H;  4DK6 C;  1OXV A;  2RDG A;  2C9O A;  2KUM A;  4QF4 A;  3CU7 A;  4ZLT F;  4GOP B;  1X9N A;  2B2V A;  1IBL L;  2YU9 H;  5IGE A;  4PMB A;  1Y8O B;  1SEB D;  3I4M G;  2KQ3 A;  2JYO A;  4JI8 L;  1IHZ A;  1NBW A;  1JB3 A;  4JVZ A;  1KQS A;  1TWF B;  2XN9 C;  1K8A C;  2O5I C;  1IYV A;  3MXU A;  3KLW A;  1GUW A;  1QVC A;  4HIK A;  4C3H G;  1ZYR D;  3ERS X;  5KNB A;  1AP0 A;  4DFA A;  4KN7 C;  1K8O A;  1WD1 A;  1F9P A;  1U4P A;  4NKL A;  3ULP A;  4JV5 Q;  4C1N K;  1KLG D;  1HFG A;  2Q2H A;  4KI0 A;  1YHQ A;  1BQQ T;  2O5J C;  2AMC B;  4IJL A;  3GQB A;  4B9W A;  4DR6 L;  1IBL Q;  3K7U C;  5C0X J;  1KC8 C;  1LTS D;  4LJZ C;  3BDO A;  3NEL A;  1STN A;  1WCM G;  2NVY H;  4RKB A;  1TS3 A;  4YCU A;  3K6O A;  3KF8 B;  2Q2T A;  3BU2 A;  4JI1 L;  1HZA A;  4L63 B;  1E0B A;  3G6J B;  3TBI B;  2EYF A;  4IPD A;  4JCV E;  4A3F G;  2ASB A;  3NTH A;  3HKZ E;  3FKI H;  3D4W A;  5I4D A;  3U9O A;  5F2D A;  2CWA A;  1K8G A;  1EY6 A;  1U9R A;  1UNS A;  1JCK B;  1H9S B;  3CCQ A;  1JOQ A;  1I50 B;  3HKS A;  3F2U A;  3KDF B;  3AYH B;  4UP7 A;  1F9Q A;  4IJH A;  1JC7 A;  3M4Q A;  1SNC A;  1QE6 A;  2EIF A;  3S17 B;  1EY4 A;  1Q8K A;  2VUM G;  2MJ8 A;  4JI1 Q;  1Q86 C;  1FJG L;  1GVP A;  3RNU A;  2NVX H;  3GV6 A;  1V9P A;  2PO4 A;  1PTO B;  2EXD A;  1IYU A;  2F4I A;  2LXJ A;  5D65 A;  1B44 D;  1D6E C;  3PV0 A;  1CM9 A;  2F3I A;  3UE1 A;  3K81 C;  1MSH A;  1SYC A;  5FKA C;  4FF3 A;  3HOY B;  5I6W A;  1NR4 A;  2EY1 A;  4CJ1 B;  1WOC A;  4XYO A;  3BJU A;  4PQX A;  4IN3 A;  2Z0S A;  2B29 A;  3SK4 A;  3AMU A;  2B2Y A;  1GUT A;  1FJG Q;  1JJG A;  4A3D H;  1O7L A;  3I4N H;  3E3X A;  4C3I H;  4HN7 A;  5C4H A;  5C44 H;  4POG A;  3HOX G;  2RF4 A;  4IUP A;  3Q23 A;  2F0P A;  4LF9 Q;  1YNN C;  1WYD A;  1SFO B;  4IFD G;  5CV8 A;  3K58 A;  1FL0 A;  4KHZ A;  3NBI A;  5HGT A;  2F4V L;  3HG9 A;  1Y1V B;  4L6T B;  5KYI A;  1N33 L;  5C3X A;  1HA5 A;  2F0G A;  4A4I A;  4NXN Q;  3GTL B;  3W3A A;  4DN4 M;  2K75 A;  4QQB X;  1UE5 A;  3S1M B;  4IZ8 A;  1ZEQ X;  1KTK A;  1CUK A;  3NBH A;  1X65 A;  2EYL A;  3I70 A;  2OQ0 A;  4MHE A;  4TSS A;  4DV4 L;  2CW0 C;  3CHB D;  1RD9 D;  1NAP A;  4X64 L;  1KIX A;  5GAG C;  5FOB B;  2F4V Q;  2EYO A;  1N33 Q;  3HEJ A;  1B53 A;  2OWO A;  1EU4 A;  2MQH A;  1KAW A;  1W6J A;  3J80 c;  2CKZ B;  4XTC S;  1QCB D;  4HIO A;  2EVB A;  3KJP A;  1BVS A;  4B3T L;  2NB0 A;  3H3V H;  3IRB A;  3F8T A;  3HOW B;  3D6W A;  1E1T A;  4L5S A;  3LX0 A;  5C3E H;  4DV4 Q;  1X56 A;  4A76 A;  3X3N A;  5ELC A;  2F0Q A;  1EQQ A;  5IGD A;  4ME3 A;  3PO3 H;  3FKI G;  3A74 A;  5G3L F;  4ZK9 B;  5IP7 H;  3F2D A;  4ZKB B;  1PZI D;  4XT1 B;  1I6H B;  1RJT A;  2ZTC A;  2WFW A;  4ZQ3 A;  3VR6 A;  2PCF B;  1G6Z A;  1TII D;  4K6D A;  4XDX A;  5CYU A;  2O2L D;  3M4Y A;  4OWT B;  4B3T Q;  4FVM A;  2B39 A;  1EEF D;  1PV4 A;  2K14 A;  3PUY A;  4DV5 L;  2IX0 A;  2H5X A;  3CRK C;  1QB5 D;  1ENC A;  3NBH B;  2AQ2 B;  4GKK L;  2X6G A;  1NSN S;  3T1Y Q;  2XNA C;  3TS2 A;  3OW2 A;  1GUN A;  4HCS A;  4P75 A;  4P74 A;  2A74 C;  4OON A;  2R3Z A;  1S5C D;  1UEB A;  3R8B A;  2Z1C A;  4JOI A;  2IHF A;  1HHV A;  4JI6 L;  3KLS A;  1JT8 A;  1IW7 D;  2A8V A;  2DJF C;  4IPC A;  1VQ9 A;  3SDZ A;  1NTG A;  4MN3 A;  2EY2 A;  4DUZ Q;  4A3D G;  2WV6 D;  3I4N G;  1ASY A;  4C3I G;  4CKB A;  1EY9 A;  5C44 G;  4DV5 Q;  2K5H A;  1VQL A;  1GUO A;  2XRQ D;  4GKK Q;  1CA5 A;  1WI5 A;  1SDF A;  4RHR A;  1BOS A;  2L12 A;  1FGB D;  4BY7 G;  1DZ1 A;  2KHI A;  3FHW A;  4CKE A;  3CQZ H;  1KL9 A;  1DD2 A;  1IKL A;  1VQF A;  4FF1 A;  3K8A A;  1LTI D;  5C4X B;  3U58 A;  4UDU C;  1XXG A;  4JI6 Q;  1L1O B;  4ZCK A;  4M1U B;  5M5W H;  1P16 A;  1GUS A;  2AQ1 B;  4DR5 L;  2EYJ A;  3SEB A;  1CA6 A;  3BDC A;  1ICW A;  2VB3 X;  1UE6 A;  3HZX A;  3TS0 A;  3H94 A;  1NCV A;  1CZW A;  4RCO A;  1B8A A;  4JI5 L;  1YBY A;  4K5W A;  1D1I A;  2MUY A;  1JOK A;  3R3O A;  4WFN 3;  2E5L L;  1IL2 A;  2Q8I B;  2Z6K C;  5DEH A;  5FJ8 H;  1ET6 A;  4DR4 L;  2G9D A;  3NPP A;  2K4K A;  4JI2 L;  2KHS A;  1S5F D;  4EQP A;  1VQH A;  5E3F A;  1QVF A;  1J5E Q;  1YNN D;  2AHO B;  3J7Y W;  1PH7 A;  4LW1 A;  2RHS B;  4FXK C;  1OTC A;  4APV A;  1X55 A;  5C3E G;  4O0A A;  4DAV A;  4RGT A;  2B2U A;  4JI5 Q;  1FVI A;  1U0L A;  2C35 B;  1SE2 A;  2E5L Q;  1FR3 A;  2F1M A;  3PO3 G;  4KMU C;  2E2D C;  3S14 H;  4DR4 Q;  3DWA A;  3EJI A;  2AWN A;  3UDF A;  5IP7 G;  2BH2 A;  4JI2 Q;  5FO9 B;  3J81 c;  1XNQ L;  2E2I H;  3M7N A;  1LM0 A;  3CCS A;  5I2Y A;  2CW0 D;  5BN5 A;  1XTD A;  5I2X A;  2JXM B;  2ICI A;  4UY8 C;  1UE1 A;  3KFU A;  1EYD A;  1PRT C;  3ND8 A;  1Q12 A;  4BBR H;  1F2L A;  1A2U A;  2G5D A;  4NB3 A;  4KY6 A;  3MWY W;  1O7Y A;  4Y7N B;  1QOH A;  5C3W A;  5EAY A;  1BXT A;  1B50 A;  1Y8P B;  4ALP A;  1VQ8 A;  4ABN A;  2PMZ B;  3J81 E;  1XNQ Q;  3TQY A;  3OYY A;  2R93 B;  3KF6 A;  5EQ0 A;  1PFM A;  2J4X A;  4DV2 L;  1TY0 A;  4RMF A;  3HGB A;  5I9O A;  4R8I A;  3RLF A;  5T1G A;  4EVO A;  3S1N H;  1CFM A;  1OXU A;  3QO2 A;  1JIC A;  4HCE A;  4C1N I;  1HRJ A;  2QKI C;  3MXP A;  2QW7 A;  1QNK A;  2ZXR A;  3TP7 A;  2CH4 A;  1TWG H;  4HR7 B;  3BZK A;  3NUC A;  2EDG A;  4MTK A;  1C4Q A;  5IY0 A;  1SLJ A;  3EBE A;  3SK5 A;  1L0W A;  1KRT A;  4BBS B;  1CKO A;  1PFB A;  3DLL A;  5EGT A;  2QDB A;  4IOC A;  4LF8 Q;  2JN4 A;  3T13 A;  1CSQ A;  4QB4 A;  4RHS A;  2F0O A;  1E1O A;  1GM5 A;  1I4G A;  3I56 A;  3GTO B;  3Q6S A;  2YTY A;  2A19 A;  2F3W A;  1ICF B;  5E4X A;  5JAV A;  1UEA B;  2JA5 H;  2E2J B;  1PRT F;  2K05 A;  2VZA A;  1LT3 D;  2CCZ A;  3H3V C;  1NY4 A;  2JEA I;  3DMU A;  2PQA A;  3L7Z C;  2CQO A;  3GTM B;  5FJ8 G;  5COR A;  1A15 A;  1BO0 A;  3DEO A;  3CCM A;  1E2Z A;  3EVQ A;  4IUT A;  1X3G A;  3W1G A;  4OL7 A;  4B3R L;  1UE7 A;  1GJX A;  2PMZ E;  1A3T A;  2JP1 A;  1TS2 A;  1CQF A;  3KF6 B;  1EY8 A;  4GS3 A;  3EN2 A;  4XQJ A;  4EGV A;  3MXG A;  4QMG A;  2B63 H;  2YTX A;  5ELE A;  1EU3 A;  2Z6B A;  3AQQ A;  4JI7 Q;  2L9H A;  3HOV H;  1T5E A;  4LUZ A;  3I73 A;  3A55 A;  3RMH A;  3DWQ A;  2ZJR A;  3EFX D;  2AUJ D;  1Q8I A;  4QUC A;  5M3F B;  3UI2 A;  4CHT B;  5IOD A;  5H1S E;  1BR9 A;  3I3C A;  5HUR A;  5ELN A;  4JI3 L;  2R6G A;  3GTQ B;  1F2Y A;  1KAB A;  3KYH C;  4B3R Q;  4CDF C;  4H7B A;  3VYT A;  4OO1 G;  2FMC A;  2NN6 I;  2O4X A;  1V1P A;  2CH4 W;  2Z4I A;  4DR2 L;  2V1C C;  5K36 H;  1D8L A;  2N49 A;  2XWB B;  2ES2 A;  4QY7 A;  3W2D A;  1LT6 D;  2QIL A;  3TP6 A;  4BBR G;  3ICE A;  1ML0 D;  1JOR A;  2LY7 A;  4HID A;  1G51 A;  2KED A;  5EKK A;  4XT3 B;  2KCM A;  4AH6 A;  3I91 A;  4A3B B;  4JI3 Q;  3MFG A;  5CR3 A;  3A8I E;  2PQA B;  2JA6 B;  5EPJ A;  5E4W C;  1B9M A;  3IKJ A;  4DR2 Q;  3IAY A;  2KHJ A;  1WTW A;  4G4K A;  4HTH A;  4J6H A;  1MI2 A;  2L15 A;  1FD7 D;  4J8Q A;  2EJG C;  2DY7 A;  2F0N A;  3NP8 A;  2TSS A;  4DR3 L;  3GTP B;  1EWH A;  2PW5 A;  4AQY L;  4NXM Q;  2WB1 G;  1VQC A;  2K7V A;  5BR8 Q;  3CPW A;  2B8F A;  3ERO A;  1WFQ A;  1EQV A;  1S5D D;  3P75 A;  1VQO A;  1PRT D;  1YIJ A;  2WIN B;  2SEB D;  3BVZ A;  1W6K A;  3I4M B;  4R4I A;  1HFN A;  1N9W A;  2BA0 A;  2D0O A;  2F0K A;  1K3B C;  5JEA H;  1ESF A;  1N36 L;  3BDL A;  3MC0 B;  4FNF A;  4PNY A;  5M5X B;  2K5N A;  3J80 i;  4FXD A;  2QGQ A;  2JK8 A;  1PYW D;  2Y0S G;  4CDC C;  4HJ7 A;  2JA5 G;  4DR3 Q;  1NE3 A;  3T4A C;  1V1P B;  4V19 0;  4AQY Q;  4GKJ L;  1QJO A;  1EL0 A;  4DV0 L;  2E2H B;  1AEX A;  2ID0 A;  5EKL A;  4MIU A;  2L5T A;  4DV3 L;  5CGK A;  2OF1 A;  3BYY B;  1WCM B;  3M85 A;  4BXX H;  4DXF A;  2HDL A;  1YJN A;  1PH3 A;  1WVL A;  2VL6 A;  2K28 A;  1D5Z C;  4GNX C;  2R7Z B;  4YY3 L;  3CKI B;  2D5D A;  4KHP Q;  4KK7 A;  1EYG A;  3FPU B;  1CKM A;  1I4X A;  3E6Z X; 
#chains in the Genus database with same CATH homology
 3FEW X;  2N88 A;  4DU9 A;  3GO5 A;  3SXH A;  2IT1 A;  2F0J A;  4RGM A;  1D2B A;  1AFP A;  3C1E A;  3PMF A;  5M5Y B;  2CVR A;  4NDX A;  1SYE A;  2VUM B;  3FPP A;  3S16 B;  5IT9 L;  1T5X D;  4C2M B;  4ODG A;  3TZD A;  4N9P A;  3R2T A;  2K5W A;  5K36 G;  1SYG A;  5LL6 S;  2BDN A;  1QG7 A;  4X3U A;  2PZW A;  4NMZ A;  2BA1 A;  3HRZ C;  2KJX A;  2EYP A;  5CV9 A;  3NSW A;  3MTS A;  4E6I A;  1UUP A;  4L8J A;  3MXN A;  3GTJ B;  3VYR A;  1D1K A;  2K5D A;  3ERQ A;  2X69 A;  3O13 A;  4G57 A;  1CT1 D;  1I6V C;  2K6A A;  5COY A;  4DF7 A;  2NVQ B;  2F0E A;  5KRU A;  3N52 A;  1Z47 A;  1B4O A;  4BS9 A;  4DA2 A;  2B2T C;  3S2D B;  2ZXP A;  2RDH A;  1O80 A;  1SE4 A;  2NVT B;  2A73 B;  1S5B D;  2YU9 B;  3NTI A;  4RA8 A;  4CJ0 B;  2ENB A;  5JEA G;  1TKW B;  3A7L A;  4BA2 I;  2J0T D;  1S5E D;  3VYS A;  3R93 A;  2PZU A;  4K2K A;  3ONA B;  4O1N A;  3TME A;  4ZYS A;  2EOT A;  4DGZ A;  3P20 A;  2CQA A;  3HOZ B;  5ELD A;  1HQR D;  4DAP A;  1F2M A;  1U4R A;  1AZQ A;  1V43 A;  4S3S A;  4HSV A;  1JE4 A;  1SYF A;  2NVY B;  4K6L A;  1CI3 M;  5CBA E;  4QIW B;  3TDQ A;  2H1E A;  1IKM A;  5E1F A;  4RAU C;  1PDQ A;  5A2Q L;  2XIW A;  3FKI B;  3DM1 A;  4OIJ A;  3NQI A;  3MVV A;  3DEP A;  1SBB B;  4XQQ A;  4XQN A;  4IUN A;  1ZKO A;  1BCP C;  2L0C A;  5EPK A;  1X3P A;  1I4P A;  1EY0 A;  1MBY A;  4OIK A;  2NVX B;  4KV6 A;  4GZY C;  4BWG B;  2F0D A;  2NZ1 D;  3ITP A;  2HCC A;  3TZU A;  2K1B A;  4DNT B;  5C0X H;  1BBX C;  1PRT B;  3NWS A;  3J7A V;  4A3M B;  4JBW A;  3EA6 A;  2F0F A;  4Z9C B;  4HMI A;  3MZ5 A;  2D9U A;  4A3D B;  3I4N B;  4EQN A;  4ULL A;  2F0L A;  1VDZ A;  2HCI A;  2YYZ A;  1LT4 D;  3NTK A;  1DOM A;  2L55 A;  4FF4 A;  2PW7 A;  3PIO 3;  2LS0 1;  4I7Z C;  2IW3 A;  1SE3 A;  3TP5 A;  5KEE A;  1BCP F;  4J1M A;  3SVM A;  4IFD I;  5FLX L;  5I9P A;  4NW2 A;  2NBF A;  1L0Y B;  4M8A A;  2FFK B;  2C5C A;  1YNJ C;  1DON A;  1XTC D;  1RCV D;  1A3U A;  1XX8 A;  3VYU A;  1AZP A;  1TU2 B;  3ZYY X;  2F0I A;  5C3E B;  1K8M A;  4QUF A;  2EZV A;  3OWF A;  4KTA A;  3SR1 A;  2PZT A;  1ET9 A;  3D8G A;  1FYC A;  3NWT A;  3ND9 A;  3QOJ A;  4KN4 C;  2QCP X;  4RFB A;  1I3Q B;  2B2W C;  4UAI A;  2DNC A;  1ONL A;  4H13 C;  3HOU B;  4K2L A;  5KIX A;  3I8Z A;  4QCL A;  5JVG 3;  1ENF A;  2PPB C;  4KY5 A;  4RGN A;  2KEC A;  3S1R B;  2VXW A;  3BVM A;  3T16 A;  3KLS X;  2WKC A;  5CV4 A;  5IGC A;  5JJZ A;  3K5N A;  2PQE A;  4X3S A;  2KCN A;  2DY8 A;  5C0X G;  3QG1 A;  4F8M A;  4G7Z C;  2PYK A;  2G9H D;  1GHJ A;  3T51 B;  3KUP A;  1S4Z A;  1XWE A;  1A3V A;  3E5S A;  3VR5 A;  2EJM A;  2FIN B;  1DXM A;  1K83 B;  3J7A F;  3S2H B;  2A6E C;  2SNS A;  5CV7 A;  4G7O C;  2EYM A;  4KD4 A;  3L9A X;  2IJ0 A;  1CZG A;  5IIF A;  4RKL A;  4XXE A;  1BCP D;  4N9T A;  3VA7 A;  1STG A;  5ISR A;  3CQZ B;  3GV3 A;  4OO1 H;  4U68 A;  5NUC A;  2EXZ A;  3G7L A;  3H6M A;  5BN3 A;  5M5W B;  5DM6 3;  4K8J A;  1TT2 A;  4B08 A;  5C5M A;  1STE A;  1RDP D;  1WTR A;  1VF7 A;  1SND A;  3N6R A;  3K0Y A;  3WOF A;  2OEO A;  1CK1 A;  1Z6H A;  2N55 A;  3MFY A;  3DXJ C;  4DNR B;  4RWS C;  3QIA A;  1EZ6 A;  2NWG A;  2F3V A;  3DWP A;  3K5O A;  2K04 A;  5EBC A;  4K5V A;  4EQO A;  2BDO A;  1EYC A;  1IL8 A;  3QB3 A;  1OO9 B;  1KLU D;  2JA7 B;  3V2T A;  4H44 C;  2B2T A;  1DM0 B;  3S14 B;  1G29 1;  5JVH 3;  3BS1 A;  2XWJ B;  1ROD A;  1TQO A;  1HXY D;  1EY7 A;  1X3Q A;  2L4N A;  1TWH B;  1C8C A;  1DOL A;  1U4L A;  4BY1 B;  1PZJ D;  4BBR B;  2WP8 J;  2AQ3 B;  1JWU D;  5J22 A;  2SDF A;  1Z7T A;  1HQM C;  4DAY A;  1J9O A;  1YNJ D;  4K8I A;  1LAB A;  1LV9 A;  5J1Z A;  1VF5 C;  4B9X A;  3PO2 B;  3C2P A;  3S1N B;  1RTO A;  2F0U A;  4K5X A;  1TWG B;  4CGY B;  3TP8 A;  3OW7 A;  2ZT9 C;  2FMM A;  2WB1 B;  3OSO A;  4ME5 A;  3PUX A;  4KY7 A;  2XRS D;  4FF2 A;  3VR4 A;  4C3J B;  1WD0 A;  2I46 A;  4IFD J;  3OHX C;  2SOB A;  5FO7 B;  2IWH A;  5CC4 A;  2K03 A;  2JSO A;  2K33 A;  4P2C B;  5EKI A;  1KDC A;  3NE5 B;  1WTX A;  1RTN A;  5DAU A;  3OIP A;  3OPO A;  2A6E D;  4A3I B;  5ELB A;  4ID6 A;  5D3I B;  3NXW A;  5C6A A;  3H09 A;  3GTG B;  3WDN A;  1HCZ A;  2TMP A;  2Z4H A;  5M9O A;  2B63 B;  3MA2 B;  1G2S A;  3HP3 A;  3HOV B;  3V96 A;  2RSN A;  1LT5 D;  4I65 A;  4RCN A;  3A56 A;  1EZ8 A;  1V8Q A;  3PUW A;  3I4L A;  4C3H B;  1SMY C;  2EYH A;  2QEJ C;  3H91 A;  4KHV A;  1BCP B;  1KDA A;  4HAE A;  3D3R A;  1JOO A;  3D4D A;  1HUN A;  3WOE A;  4IUV A;  3QWN A;  1JWS D;  2IPK D;  2WKD A;  4OO1 I;  2Q8R E;  3S9W A;  1H9J A;  4A3F B;  1JWM D;  2MGS A;  3TSS A;  1WTO A;  1F2Z A;  4FXG C;  1EQT A;  3BYT B;  3Q22 A;  4LMQ D;  2B8G A;  2B2W A;  1B1Z A;  2OXP A;  2A69 C;  2KVM A;  1Q90 A;  5I6Y A;  3LWE A;  2IX3 A;  3LNN A;  1H9M A;  1PTO H;  3FDT A;  3FRP B;  2HUG A;  4DK1 A;  1VMC A;  1G91 A;  5IT9 E;  1SNM A;  3L3O C;  3OOC A;  1QNU A;  2DNE A;  1CHP D;  1O7Z A;  3HOX B;  2IX1 A;  1OXX K;  1ILQ A;  3AU7 A;  4BA1 I;  1WTP A;  2F0V A;  4OGQ C;  3VR2 A;  1BF4 A;  4PMW A;  1D5X C;  1R4P B;  1IW7 C;  2IL8 A;  4AYB B;  1SAP A;  4NP5 A;  5TSS A;  2MPM A;  1C48 A;  1KAA A;  5CV5 A;  2GA4 B;  4KJN A;  4OHJ A;  3V05 A;  1BNZ A;  5EJW A;  1H9R A;  1XYI A;  1SYB A;  2D62 A;  2EPB A;  3K57 A;  2K32 A;  4A3J B;  4V0B A;  3RZO B;  4LAA A;  1G8Z D;  5T1I A;  1LO5 D;  1VCI A;  2MP1 A;  3CRL C;  3NHH A;  3VR3 A;  5DM7 3;  3BZD B;  2D2C C;  4PV1 C;  1CTM A;  1MSG A;  1EYA A;  4IUR A;  1GUG A;  2X6L A;  1E2V A;  2RBM A;  1DYQ A;  3Q24 A;  4X3K A;  2H4O A;  4ZAI A;  1HPC A;  3GD7 A;  4WOR A;  1SMY D;  3PUV A;  2XSC A;  3NK9 A;  1HA6 A;  2V4D A;  1TVX A;  5A2Q E;  5AFW A;  3S1Q B;  1EY5 A;  2LFN A;  1II3 A;  1F9R A;  1HUM A;  1L0X B;  2NTS A;  5JOB A;  1Y8N B;  1J8I A;  3A54 A;  2DN8 A;  5KND A;  4A3K B;  1UAP A;  4F88 A;  4ZUJ A;  3OMG A;  5C5L A;  3SE0 A;  2KA7 A;  1KDB A;  5EBD A;  3C3L A;  4FYD A;  1A6X A;  4C3I B;  5C44 B;  3K59 A;  4WJW A;  3Q0A A;  4DK0 A;  3J80 L;  4RGO S;  1G2T A;  2L11 A;  1SJE D;  4IUQ A;  4BY7 B;  3PUZ A;  3P7J A;  3OWE B;  5BN4 A;  1HTL D;  2A69 D;  2M00 A;  3T53 B;  1TS4 A;  1B2T A;  2BE5 C;  4ILW A;  1QIL A;  3LWU A;  5LHY 1;  1D5M C;  3RUZ A;  1DJR D;  1SYD A;  3J80 E;  2FJ2 A;  2I07 B;  5KNC A;  1MGS A;  3GP7 A;  1ENA A;  4R9W A;  5FK9 C;  1PMR A;  4X3T A;  1WTQ A;  5LL6 X;  1M4V A;  1EOT A;  4FO2 A;  1TS5 A;  1JR0 D;  5KGU A;  1LTR D;  2K01 A;  1TWA B;  3QOL A;  1M8A A;  4A93 B;  3U9S A;  2VNU D;  5FLX E;  2NN6 H;  3PO3 B;  1V1O A;  3HS0 C;  2RA4 A;  2RQX A;  2KCC A;  1B3A A;  4KKS A;  3MEH A;  1STY A;  2B2V C;  4FP5 D;  1PTO C;  3SK6 A;  1Q1B A;  1ZXT A;  2KEE A;  1Q3L A;  4TKO B;  1TY2 A;  2Q8T A;  3C46 A;  3FMC A;  2EY6 A;  1SXT A;  3QJY A;  2JEB I;  5ELF A;  4H0L C;  3M4O B;  1EEI D;  3D31 A;  1ESR A;  1VMP A;  1CQV A;  4A3E B;  2JA8 B;  1LLR D;  2PNR C;  4CBV A;  5JPM C;  5C4Z A;  4WRD A;  2K5Q A;  2A6H C;  4DXG A;  3D4R A;  5G3L D;  1H9K A;  1Q1E A;  3SHL A;  1F9S A;  2MHV A;  3A8J E;  1RF2 D;  3MHB A;  1PZK D;  1HTP A;  3H0G B;  5K5P A;  1OXT A;  4K14 A;  1E2W A;  2RSO A;  1TWC B;  2RVL A;  3IFD A;  3EQL C;  1B9N A;  1TR5 A;  4YIJ A;  3RZD B;  1X32 A;  3OIQ A;  5A35 A;  3BG3 A;  3VA5 A;  1STA A;  5DNF A;  5M3M B;  3D6C A;  3J81 L;  1PTO F;  2OT2 A;  1EWC A;  2ZXO A;  2F0T A;  2VB2 X;  1LAC A;  2A68 C;  1A2T A;  5JPN C;  4G7H C;  3S15 B;  1SNP A;  1DCZ A;  2EE1 A;  2JE6 I;  2EY5 A;  4TQU S;  2F0M A;  4ZKC B;  1EFI D;  1LTA D;  4XIG S;  3A7A B;  2B2Y C;  3URY A;  1LTT D;  1KNE A;  4CJ2 C;  1STH A;  4CKC A;  2BOS A;  2NN6 G;  2Z8L A;  3NQT A;  4PMC A;  3BVG A;  3PIP 3;  2BE5 D;  2L1B A;  4RH6 A;  1F77 A;  5C0X I;  3JAM L;  2E2I B;  4ZRZ A;  5CMD A;  2R92 B;  1U4M A;  2CHB D;  2KOL A;  1GHK A;  1R4Q B;  3OMC A;  4HED A;  5IOC A;  3TN2 A;  2M2L A;  2M9V A;  1I4H A;  3GTK B;  3KK7 A;  2WAC A;  2FHT A;  2WII B;  2NTT A;  1PFN A;  5JEA J;  3JAM E;  1ILP A;  3KLR A;  4XYQ A;  4IUU A;  1Y1W B;  4Q5V A;  1ZYR C;  2SNM A;  2E75 C;  4U67 3;  1DOK A;  4HSP A;  4F7X A;  1EIH A;  1GXD C;  1NR2 A;  3K5M A;  3K5L A;  5D3D A;  3DHQ A;  4IAL A;  5FO8 B;  2WAQ B;  1LTG D;  4IQZ A;  2F0W A;  2AUK A;  5C4J B;  1STB A;  1OXS C;  1PTO D;  1CHQ D;  2NYZ D;  2HQE A;  2R61 A;  5D14 A;  3RD4 A;  2J7Z A;  5IGF A;  3FVQ A;  1BDO A;  1SNO A;  3SK8 A;  1LTB D;  3X3M A;  2Y0S B;  2JA5 B;  3DUZ A;  3T56 B;  2F03 A;  1I4Q A;  3KBG A;  1Y69 U;  1FNV A;  2LKV A;  2XVS A;  1QWY A;  2LMC B;  2ICE C;  1O78 A;  2A6H D;  2RDF A;  3I90 A;  4TRD A;  5KYL A;  1RHP A;  1SNQ A;  4A3G B;  2EJF C;  2F0H A;  1R9T B;  2QF7 A;  4C56 C;  5CV6 A;  1FNU A;  2HDM A;  1EIG A;  3MAQ A;  4KD3 A;  3IL8 A;  4ZUI A;  3IFT A;  1JQY D;  3K7A B;  4KKT A;  5IGB A;  1RKN A;  3E0J A;  2AWO A;  4R8N A;  3KBX A;  1PXU A;  2NUC A;  2A68 D;  2E76 C;  5IGG A;  4KJO A;  2E74 C;  1PLF A;  4C3J G;  1WTV A;  5CBE E;  3M3Y B;  1SJH D;  1BUV T;  2BCO A;  3C1F A;  1AN8 A;  1GOZ A;  4HMJ A;  4LK1 C;  2F0S A;  4O42 A;  5EPL A;  1KNA A;  1I4R A;  3KF8 A;  3AB9 A;  3A8K E;  4JK1 C;  3P1H A;  1AW7 A;  1NUC A;  1SSO A;  3R2I A;  3I72 A;  4Q0F A;  2A5H A;  5J39 A;  3HKZ B;  1MD2 D;  1H9S A;  2B2U C;  2RKS A;  4KKU A;  4F87 A;  1FNW A;  4IFD H;  3M7G A;  1OXV A;  2RDG A;  2C9O A;  2KUM A;  4QF4 A;  3CU7 A;  4ZLT F;  2B2V A;  5IGE A;  4PMB A;  1Y8O B;  1SEB D;  2KQ3 A;  2JYO A;  1IHZ A;  1JB3 A;  1TWF B;  2XN9 C;  2O5I C;  1IYV A;  3MXU A;  1GUW A;  4C3H G;  1ZYR D;  5KNB A;  1AP0 A;  4DFA A;  4KN7 C;  1K8O A;  1WD1 A;  1F9P A;  1U4P A;  4NKL A;  4C1N K;  1KLG D;  1HFG A;  4KI0 A;  1BQQ T;  2O5J C;  3GQB A;  4B9W A;  5C0X J;  1LTS D;  4LJZ C;  3BDO A;  1STN A;  4RKB A;  1TS3 A;  3K6O A;  4L63 B;  1E0B A;  3G6J B;  3TBI B;  2EYF A;  3NTH A;  3D4W A;  5I4D A;  3U9O A;  5F2D A;  1EY6 A;  1U9R A;  1UNS A;  1JCK B;  1H9S B;  1JOQ A;  1I50 B;  3F2U A;  1F9Q A;  1JC7 A;  1SNC A;  1QE6 A;  3S17 B;  1EY4 A;  2MJ8 A;  3GV6 A;  2PO4 A;  1PTO B;  1IYU A;  2F4I A;  5D65 A;  1B44 D;  1D6E C;  3PV0 A;  1CM9 A;  1MSH A;  1SYC A;  5FKA C;  4FF3 A;  3HOY B;  5I6W A;  1NR4 A;  2EY1 A;  4CJ1 B;  4XYO A;  4PQX A;  4IN3 A;  3SK4 A;  3AMU A;  2B2Y A;  1GUT A;  1O7L A;  4HN7 A;  5C4H A;  4IUP A;  3Q23 A;  2F0P A;  1YNN C;  1SFO B;  4IFD G;  5CV8 A;  3K58 A;  4KHZ A;  3NBI A;  5HGT A;  3HG9 A;  1Y1V B;  4L6T B;  5KYI A;  5C3X A;  1HA5 A;  2F0G A;  3GTL B;  3W3A A;  4DN4 M;  3S1M B;  4IZ8 A;  1ZEQ X;  1KTK A;  3NBH A;  2EYL A;  3I70 A;  4MHE A;  4TSS A;  2CW0 C;  3CHB D;  1RD9 D;  1NAP A;  5FOB B;  2EYO A;  3HEJ A;  1B53 A;  1EU4 A;  1W6J A;  4XTC S;  1QCB D;  2EVB A;  2NB0 A;  3HOW B;  3D6W A;  3LX0 A;  3X3N A;  5ELC A;  2F0Q A;  5IGD A;  5G3L F;  4ZK9 B;  4ZKB B;  1PZI D;  4XT1 B;  1I6H B;  1RJT A;  4ZQ3 A;  3VR6 A;  2PCF B;  1G6Z A;  1TII D;  4K6D A;  4XDX A;  5CYU A;  2O2L D;  3M4Y A;  4FVM A;  2B39 A;  1EEF D;  3PUY A;  2IX0 A;  3CRK C;  1QB5 D;  1ENC A;  2AQ2 B;  2X6G A;  1NSN S;  2XNA C;  1GUN A;  4HCS A;  2A74 C;  2R3Z A;  1S5C D;  3R8B A;  2Z1C A;  1HHV A;  3KLS A;  1IW7 D;  3SDZ A;  4MN3 A;  2EY2 A;  2WV6 D;  4C3I G;  4CKB A;  1EY9 A;  1GUO A;  2XRQ D;  1CA5 A;  1SDF A;  4RHR A;  1BOS A;  2L12 A;  1FGB D;  1DZ1 A;  4CKE A;  1DD2 A;  1IKL A;  4FF1 A;  1LTI D;  5C4X B;  4UDU C;  1XXG A;  4M1U B;  2AQ1 B;  1GUS A;  2EYJ A;  3SEB A;  1CA6 A;  3BDC A;  1ICW A;  2VB3 X;  3HZX A;  3H94 A;  1NCV A;  1CZW A;  4RCO A;  4K5W A;  1D1I A;  2MUY A;  1JOK A;  3R3O A;  4WFN 3;  2Q8I B;  5DEH A;  1ET6 A;  2G9D A;  3NPP A;  2KHS A;  1S5F D;  4EQP A;  5E3F A;  1YNN D;  3J7Y W;  4FXK C;  4DAV A;  4RGT A;  2B2U A;  1SE2 A;  1FR3 A;  2F1M A;  4KMU C;  2E2D C;  3DWA A;  3EJI A;  2AWN A;  5FO9 B;  3M7N A;  5I2Y A;  2CW0 D;  5BN5 A;  5I2X A;  2JXM B;  2ICI A;  1EYD A;  1PRT C;  3ND8 A;  1Q12 A;  1F2L A;  1A2U A;  4KY6 A;  3MWY W;  1O7Y A;  4Y7N B;  1QOH A;  5C3W A;  1BXT A;  1B50 A;  1Y8P B;  4ABN A;  2PMZ B;  3J81 E;  2R93 B;  5EQ0 A;  1PFM A;  2J4X A;  1TY0 A;  3HGB A;  5I9O A;  4R8I A;  3RLF A;  5T1G A;  4EVO A;  1CFM A;  1OXU A;  3QO2 A;  1JIC A;  4HCE A;  4C1N I;  1HRJ A;  2QKI C;  3MXP A;  1QNK A;  2ZXR A;  3TP7 A;  4HR7 B;  3NUC A;  2EDG A;  1C4Q A;  3SK5 A;  4BBS B;  1PFB A;  5EGT A;  2QDB A;  3T13 A;  4QB4 A;  4RHS A;  2F0O A;  1I4G A;  3GTO B;  3Q6S A;  2F3W A;  5E4X A;  5JAV A;  1UEA B;  2E2J B;  1PRT F;  2K05 A;  1LT3 D;  3H3V C;  2JEA I;  3DMU A;  3L7Z C;  3GTM B;  5COR A;  1A15 A;  1BO0 A;  3DEO A;  1E2Z A;  3EVQ A;  4IUT A;  4OL7 A;  1GJX A;  1A3T A;  2JP1 A;  1TS2 A;  1CQF A;  1EY8 A;  4XQJ A;  4EGV A;  3MXG A;  4QMG A;  5ELE A;  1EU3 A;  2L9H A;  1T5E A;  3I73 A;  3A55 A;  3RMH A;  3DWQ A;  3EFX D;  2AUJ D;  1Q8I A;  4QUC A;  5M3F B;  3UI2 A;  4CHT B;  5IOD A;  1BR9 A;  3I3C A;  5HUR A;  2R6G A;  3GTQ B;  1F2Y A;  1KAB A;  4H7B A;  3VYT A;  4OO1 G;  2FMC A;  2NN6 I;  2O4X A;  1V1P A;  2Z4I A;  5K36 H;  2XWB B;  3W2D A;  1LT6 D;  2QIL A;  3TP6 A;  1ML0 D;  1JOR A;  2LY7 A;  2KED A;  5EKK A;  4XT3 B;  3I91 A;  4A3B B;  3MFG A;  5CR3 A;  3A8I E;  2JA6 B;  5EPJ A;  5E4W C;  1B9M A;  3IKJ A;  3IAY A;  1WTW A;  4G4K A;  4HTH A;  4J6H A;  1MI2 A;  1FD7 D;  4J8Q A;  2EJG C;  2DY7 A;  2F0N A;  3NP8 A;  2TSS A;  3GTP B;  1EWH A;  2PW5 A;  2K7V A;  2B8F A;  3ERO A;  1EQV A;  1S5D D;  3P75 A;  1PRT D;  2WIN B;  2SEB D;  3BVZ A;  1W6K A;  3I4M B;  1HFN A;  2BA0 A;  2F0K A;  5JEA H;  1ESF A;  3BDL A;  3MC0 B;  4FNF A;  4PNY A;  5M5X B;  4FXD A;  1PYW D;  3T4A C;  4V19 0;  1V1P B;  1QJO A;  1EL0 A;  2E2H B;  1AEX A;  2ID0 A;  5EKL A;  4MIU A;  2L5T A;  5CGK A;  2OF1 A;  3BYY B;  1WCM B;  3M85 A;  4DXF A;  2HDL A;  1WVL A;  2K28 A;  1D5Z C;  2R7Z B;  3CKI B;  2D5D A;  4KK7 A;  3FPU B;  1I4X A;  3E6Z X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...