5CV4A

Crystal structure of staphylococcal nuclease variant delta+phs v23d/v66h at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTDKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMHENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V23D/V66H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5cv4A00
1A2TA 4E6IA 5CC4A 1EZ6A 4ID6A 1ENCA 4KTAA 2WACA 1F2YA 4DFAA 2F3VA 5EGTA 4K6DA 5DEHA 5F2DA 1STAA 1F2MA 2F0UA 2F0QA 3MZ5A 5E3FA 1TT2A 1RKNA 2F0FA 1EZ8A 2SNSA 1IHZA 3OWFA 4DGZA 2EY1A 2F0IA 3OSOA 2OF1A 3DHQA 4PMBA 4NMZA 4DU9A 3TP8A 4RKLA 4QF4A 4ZUIA 3NUCA 2PW5A 3NHHA 5EKKA 2F3WA 5IGEA 2KHSA 4ODGA 3HEJA 1SYCA 4DF7A 1II3A 2EYLA 5J39A 3E5SA 1KDBA 3U9OA 4NKLA 2PZWA 4IALA 4S3SA 2F0WA 4EQNA 2LKVA 1SNPA 1SNMA 3QB3A 1EY7A 4KD3A 5C4ZA 3SK6A 1STHA 1JOOA 1KDCA 1SYDA 5C6AA 5C4HA 3HZXA 3SK8A 1JORA 1EY0A 3P1HA 1JOQA 1EY4A 2F0PA 3OMGA 1EYCA 2EYPA 1STYA 3SK5A 2HQEA 2PYKA 4K5XA 1NSNS 2OXPA 1EY8A 3D4DA 5CV8A 5C3XA 5HURA 4KY5A 3EROA 4HMJA 1SNQA 2EYFA 5DAUA 3MHBA 4RKBA 5C5MA 5IODA 2F0MA 2F0NA 2SOBA 4KV6A 1NUCA 2RDFA 4G57A 5NUCA 3NQTA 2PZTA 4K8IA 2F0VA 1A3TA 1EYAA 2EYHA 3T13A 2F0KA 1KDAA 4YIJA 3TP5A 2EYMA 2F0TA 3OMCA 4WRDA 4B9XA 5IIFA 1TR5A 2F0JA 1SNCA 3VA5A 4HMIA 4ZQ3A 2OEOA 1U9RA 3S9WA 3D4WA 5CGKA 2F0EA 1EYDA 4QMGA 5J1ZA 1A3VA 3QOLA 3TMEA 1SYEA 2RBMA 3NP8A 2RKSA 3TP7A 3T16A 4EVOA 4F7XA 5IOCA 3LX0A 2PW7A 3MVVA 1SNOA 5CV5A 2EY6A 2KQ3A 2EYOA 4KD4A 5JAVA 3ERQA 4J6HA 1SYGA 3MEHA 5CV4A 2NUCA 1EQVA 4H7BA 4HTHA 4IZ8A 3V2TA 5J22A 5HGTA 3NXWA 5I9PA 4KY7A 4I65A 1KABA 4KY6A 4F8MA 5M9OA 4K5VA 5I6YA 2PZUA 3EJIA 3R3OA 4K8JA 3SHLA 1KAAA 5CV7A 1JOKA 1EY5A 2F0SA 1F2ZA 4K5WA 3EVQA 4WORA 5K5PA 2F0HA 3MXPA 4KHVA 4KJOA 4R8NA 3RUZA 2EXZA 5KRUA 3P75A 4ZUJA 5IGBA 5ISRA 1SYBA 5IGDA 1SNDA 2PQEA 5KGUA 4OL7A 5CV9A 2F0GA 5CV6A 3BDLA 5EKLA 5C5LA 1TQOA 4EQOA 4N9TA 3H6MA 4KJNA 2SNMA 1SYFA 4PNYA 5I6WA 4ME5A 3BDCA 4J1MA 3D8GA 4TRDA 2O4XA 2EYJA 3SK4A 5IGGA 1ENAA 4EQPA 5KIXA 3C1FA 3QOJA 4K2LA 5IGCA 2EY5A 1AEXA 1EY9A 4QB4A 3SXHA 5C3WA 3TP6A 1STBA 5KYLA 3DMUA 1STGA 3PMFA 4MIUA 4N9PA 2F0OA 2QDBA 1A2UA 3D6CA 3C1EA 2F0DA 4LAAA 5E1FA 4NP5A 1A3UA 5CR3A 5KYIA 4B9WA 3SR1A 5IGFA 3ITPA 4IUNA 5I9OA 4K2KA 5KEEA 4PMCA 2M00A 2EY2A 1STNA 3NK9A 5JOBA 4K14A 4NDXA 1EY6A 2F0LA 2ENBA
chains in the Genus database with same CATH superfamily
4JOIC 1FD7D 1B2TA 3A56A 3FDTA 3I55A 3UDGA 1LTGD 2BE5D 2KEEA 1PRTD 3HP3A 1XNQQ 4YWMA 3HS0C 4A76A 4DGZA 1ZEQX 3HOYH 3IFDA 3TP8A 4QF4A 1Y1VH 2KHSA 2IWHA 5J39A 2UUCQ 1VQAA 1PH4A 5M3FB 4ZRZA 1VQKA 3PIO3 4R4QA 5LMNW 1V1QA 2ICIA 1D5MC 4POFA 1SYDA 2QDLA 5JPMC 3HZXA 1EY0A 3EA6A 5K36G 2PYKA 2UUBL 1NSNS 2BOSA 1BCPD 4B3SL 4HMJA 1EQTA 5CBAE 1KAWA 4L63B 4ZLTF 5GAEC 2F0NA 4B9WA 3PUZA 3RN5A 2QILA 3HOUH 1XMOL 1VMPA 1BBUA 1QNUA 2AUKA 1PZJD 4DV6L 5CGKA 5C3EH 3KFUA 3SDZA 3K8AA 2RVLA 4IPGA 5C4JH 3NP8A 1FL0A 1PTOC 2OT2A 1W2BA 5M5YB 2L12A 1PYSB 3M3YB 3K7AH 2NZOA 1G8ZD 1SYGA 1PH1A 1NBWA 4H7BA 4C3IH 1SJHD 1IBKQ 3UI2A 2CH4A 2RCNA 4A3GG 4GOPC 1EFWA 4IUQA 1NY4A 1BVSA 1UNSA 4LW1A 1LT3D 2A73B 4WORA 4X6AH 4DV7L 3CC4A 4XQNA 5IGDA 4MNOA 4LF8L 4NXNQ 4OL7A 1K0SA 3G4SA 4JI2L 2VUMH 1VS0A 1YEZA 3H0GG 1W3SA 4YY3L 5I4DA 1VQFA 1LT4D 1VQMA 1SEBD 3KF6B 2F0OA 3RR5A 2Z6KC 1BCPF 3I90A 1MKHA 4BBSH 3EBEA 5JEAG 3I4LA 4FP5D 4ILWA 4ME3A 4JI4Q 1JT8A 1WTXA 1ILPA 4U673 3KUPA 4DV0L 3D31A 2JA6B 2SEBD 2DJGC 3CCLA 3J81L 1J9OA 3A8IE 4DKAC 3UE1A 3HRZC 2CQAA 1IW7D 5I2XA 4DR7L 3IFTA 3GTQB 2FINB 4RWSC 5CYUA 1Y1WG 4P75A 5FLXE 4FXGC 2YV5A 3L7ZC 1I94L 2QW7A 4DAVA 1SFOB 2DY7A 3G6JB 1DM0B 2HT1A 3GP7A 1KRTA 5EPJA 4C3IB 2Y0SG 1HZ9A 1OXSC 4IUPA 3A7LA 4EQ5A 2OTLA 1JJ2A 4R4IA 5HURA 5LMNL 2VB3X 2WV6D 3GO5A 3FRPB 4G57A 2C9OA 3HOUG 3GV3A 3R2IA 1KDAA 4YIJA 4LFCQ 4JI6Q 4DR6Q 1Q7YC 4B3RL 4HJAA 1OXVA 2KBNA 4A3BH 2OEOA 5JJZA 1UE7A 2E2HB 5GADC 2F0EA 1A3VA 1H9SB 3LX0A 4LF9Q 2PW7A 2PO4A 2JYOA 3PF5A 1T5XD 2YTVA 4JBWA 1YHBA 2JA5H 3TZUA 4DXGA 2CW0C 1EIFA 1YJ9A 1X56A 1RIPA 1ZYRD 2QEXA 2JJQA 2ATWA 3TRZA 4DV1L 1WTVA 3RUZA 1W6KA 1YZ6A 4ZUJA 3BU2A 4RCNA 1B44D 2CWAA 1W6JA 2E2HH 2A74C 2A68D 4PNYA 1PHJA 3I4OA 3KJOA 1A8VA 4A3DH 4LF5Q 2ZM6L 3PUVA 4K2LA 4X3KA 1VF7A 3O13A 4CJ2C 1SMYC 4QGUA 4DR4L 3S2HB 4HEDA 4X62Q 3PO3G 1IYJB 1X32A 1CSPA 2HIXA 3M7GA 4A4IA 4DNTB 1BOSA 3SR1A 3K5OA 5KEEA 5C3EG 4JI1Q 5IYBG 1C4QA 2EY2A 5JOBA 4F87A 1LTTD 1D2BA 4GKKL 4GN5A 4ID6A 2O2LD 3K80C 4UHVA 1JE5A 1C48A 3MZ5A 1JWSD 1ESFA 1TWAH 4DR1L 2PNHA 3FVQA 3OWFA 2JEAI 4QIWE 3S17H 2EOTA 3KJPA 3ICEA 1XMQL 1A6XA 1DXMA 3J7AV 1KTKA 1I6HH 1A62A 1R9TH 2K1BA 1EU4A 3FP9A 3HEJA 1H95A 2DY8A 4UP8A 1WI5A 2WB1G 1RCVD 2RCFA 4JI1L 2VB2X 4OO1H 1JICA 5A35A 4GNXB 3N52A 5DLQE 1I4PA 3CF5A 3GTKH 1EYCA 1STYA 5E7NA 5G3LD 4L5TA 4J15A 5IT9c 4A3JH 2IHEA 2J0TD 3CCRA 1BDOA 1FGUA 3H3VC 5D65A 1K8GA 2A68C 3TMEA 5FOBB 1VQCA 2YTYA 4A93H 2F0JA 5M5YH 1Q1BA 4G4KA 1YITA 1U0LA 1ET6A 1ET9A 3S9WA 1B3QA 2A6HD 3K58A 3G48A 4P73A 4QMGA 1YVCA 1UE1A 4FO2A 1HQMC 3J80L 1WVLA 3S1RH 2WAQE 5M5XH 4LUVA 1PZID 1I50H 1TS2A 1JJCB 4IOCA 5M3FG 4HJ5A 1E22A 1TWFB 5CV7A 4DR3L 2UXCQ 2KCCA 1ICWA 4BBRG 1GM5A 1AE2A 1SNDA 3S14B 3S17B 1PFBA 3BVMA 1L0XB 4ZCKA 2F03A 3BDCA 2KHIA 1AZPA 5BR8L 4LF4L 1SAPA 1TY2A 1HRJA 4Y52H 2CKZB 4M8AA 2NBFA 1JC7A 3J80i 2Z6BA 1PFSA 2I0QA 1B8AA 4O0AA 3GTJH 4LAAA 5LMUL 4TSSA 4KKTA 1YHQA 4LUZA 5M3MG 2B2UC 3ULLA 4PV1C 1LYLA 2ENBA 2MO0A 4E6IA 1DYQA 4WJ3M 1ENCA 1E7ZA 5EGTA 2K52A 2HDLA 4JI8L 3GTMB 1I4GA 1PTOH 4JYAL 2F0FA 4RHRA 4QQBX 2NVQB 3ZJYC 1S40A 2K7VA 3GTGB 5IGEA 3GTKB 3GTLH 4I7AA 4XT3B 4DV6Q 2JA6G 5FLMG 3OTOL 4DR4Q 2N49A 3SK8A 2IW3A 1Q8IA 4A3KB 2N78A 1PH2A 5BR8Q 3NQTA 1YJNA 5IYDH 2F0KA 4FDBA 3GTOH 3F2UA 4IPCA 1EQRA 2R6GA 3RZDH 3GDEA 4H44C 5ELCA 4FF2A 4DK0A 2B2VC 2CHBD 1IL2A 3HOVB 3LNNA 4XYOA 1SE4A 1C7YA 3CRKC 4C1NK 3MAQA 4DPGA 1AFPA 2RA4A 2R7DA 4EVOA 3Q22A 1PA6A 4DN4M 5FLXc 1XMQQ 4DK3C 1SNOA 3HOYG 5IP9H 4IPHA 5JJKA 5CV4A 1I6VC 2NUCA 4HTHA 5HGTA 3QWNA 1QNKA 3R3OA 4RGMA 2WB1E 4OWXB 2KECA 2B8FA 3MXPA 1YI2A 2R92G 4A3KG 1HZBA 2KA7A 2N8NA 1SN8A 5JPNC 2B2YA 4J1MA 1Z47A 4DAYB 2N3SA 1X55A 4N8X1 2F4VL 1RODA 2LXJA 4R4CA 4YWLA 4FXDA 2Q8TA 1JJGA 1N33Q 2B2TA 5ELEA 5C4JB 5KYLA 1STGA 1YNNC 1JWUD 4P2CB 1CZWA 4B3ML 2NTSA 4BXXG 1XNQL 1WTHA 1CUKA 3ULPA 4OXPA 2M00A 4C2MH 3AFQA 2IJ0A 1EZ6A 4LFBQ 1QVGA 2F3VA 1WTQA 3IKJA 2RDGA 2Q2UA 4A3GH 3JAME 2B29A 2LFNA 2OF1A 1WTOA 4NMZA 1WTRA 3S2DH 1MSGA 4B3RQ 2EYLA 2JN4A 3BG3A 4S3SA 1PH6A 4A3BB 3KLRA 1STHA 3AFPA 4OIJA 2OCEA 3GTOB 2IX1A 3OMGA 3I3CA 2B63G 4A75A 4V190 4OONA 1X3EA 1Y14B 1ZKOA 3OWEB 3MHBA 1G6PA 3PQIA 1FNUA 2R7FA 4DUZQ 3GTGH 4HJ8A 2I46A 2D2CC 2IX3A 4A3MH 4B3TL 5IIFA 1SBBB 3SEBA 3KK7A 3D4WA 1E2WA 1D1IA 1H9RA 1YNND 1SYEA 2QA4A 2IHFA 2A6ED 2QF7A 3S15B 2L5TA 3MVVA 3RMHA 3X3NA 1NMFA 1SROA 4DV7Q 4OELB 1SFOH 2PQAB 4HIOA 1M8AA 1PH7A 2DJFC 2E2DC 1NR2A 1F2ZA 1HZCA 5FLMH 1FGBD 5D3IB 4BY7H 1IL8A 3DEPA 1FVIA 4DV3L 2SNMA 5I6WA 1YHAA 2K5QA 2JA9A 2ALYB 2V4DA 4A3IG 3I4NB 1EYGA 4BBSG 3J80c 1WCMG 4GLXA 1X9NA 1A2UA 3H3VH 2VQEQ 1PDQA 4P74A 3ITPA 4K2KA 4XXEA 5BN3A 3OW7A 1LV9A 3KF6A 1QCBD 1K8OA 2L15A 5C44H 1I5FA 5F2DA 2Z9HA 2SDFA 5GQOA 1AH9A 4JPBW 3HOWB 1N32L 5HGQA 3EIVA 2F52A 1D7QA 4DUZL 5DNFA 4GS3A 4JBMA 1BKBA 4RKLA 4RH6A 1F9RA 4PZ7A 1N36Q 1OXUA 3L0OA 1MIUA 5ELBA 2QEJC 1LTSD 1SYCA 4DF7A 4RAUC 4BBSB 2L11A 3D4RA 1Q1EA 1B4OA 4HJ9A 2UUAQ 1Q12A 1PYBA 5C6AA 2BH8A 4FYDA 4POGA 3FMCA 2D5DA 2C35B 3KOJA 1XTDA 1X3GA 2BA1A 2I5HA 2J4XA 1EY8A 4XYQA 4AQYL 5A2QE 3EROA 2HDMA 1YNJC 3VR3A 3CP0A 5C5MA 4K8IA 4KHZA 4A3MG 5C4ZA 3FKIH 4RGTA 4WRDA 2VQFL 3A55A 3CCQA 5C4XG 4JI7Q 1HQRD 4JW0A 5TSSA 1VQDA 5FO8B 2K5NA 2WKCA 4UY8C 1F9PA 3OPOA 2EZVA 3WDNA 4MZ9A 2E76C 2XN9C 1PRTC 1S5CD 4DR1Q 4X65Q 4WJ4A 4IFDJ 4F8MA 3BYYB 2GVBA 1E24A 2AKWB 3W1GA 1KAAA 3HOYB 5C44B 4LF5L 2LS01 1RD9D 3JAMc 4BY7G 1VQ5A 5KGUA 5BN4A 1B3AA 1C0AA 5FKAC 4A93G 3I91A 1OXTA 2FXQA 4Z9CB 4C3JB 1VCIA 5KIXA 5IGCA 4A3IH 1EY9A 4NW2A 1HPCA 1STEA 1KNEA 2PI2E 3EFXD 1HFGA 2F0DA 4R4TA 2K5DA 5E1FA 5JJLA 5KNCA 1RF2D 4IQZA 1AW7A 2PPBC 5FJ8G 1VQ4A 1A2TA 3TS2A 1I4QA 3K81C 4JOIA 4QJFA 2L4NA 3OHXC 3I4MB 2JXMB 2L9HA 1VQNA 1CHPD 3T1YQ 2C5CA 3QJYA 1CKOA 3M4PA 2F0IA 4GLAC 1CHQD 5EJWA 3DHQA 3KBXA 1VQJA 4PQXA 1XNRQ 3E5SA 1KDBA 5LMUQ 2HUGA 1M90C 4FF1A 1SNPA 3CHBD 4YWKA 2VW9A 2MJ8A 3SK6A 2XGTA 4X66L 3KF8A 3PO2H 5LMNQ 1EEID 1QOHA 3Q24A 3KLSX 1PFMA 2HD3A 3A5ZB 3EQLC 1GUWA 3G71A 2HQEA 1K0RA 4JI4L 3DUZA 3KLWA 2PCFB 1GXDC 1HFNA 3FKIG 2BDNA 2EYHA 1QG7A 3S16H 2OQ0A 1R9TB 3IAYA 3DWQA 1U9RA 1GUNA 4J8QA 3NEMA 4X3SA 2H5XA 4A3FH 1GVPA 3TP7A 3CC7A 2NZ1D 2EJMA 4C3HH 1N36L 1ASYA 4JI7L 1JQYD 4A3CH 2EYOA 1J8IA 1E0BA 2KCTA 2K28A 2PNRC 1O7IA 2AWNA 2K4KA 2XTIA 2E2IH 3BVGA 3BZCA 1HUMA 4JG2A 4IUTA 4HIDA 5EAYA 1MHWC 1K83H 1O7LA 5IGBA 2ZJPA 1EOTA 4KI0A 1CKMA 3KF8B 1RJTA 4LF8Q 1PH9A 4LFCL 1TS5A 4RCOA 4G7OC 3VYTA 3C1FA 2GA4B 4A3GB 1B1ZA 2BE5C 4QB4A 4YY3Q 5M3MH 1NTGA 2WB1B 2DNCA 2E2IB 2JA5G 2WAQG 3CAMA 5IP9G 2CFMA 4HSVA 1FJGL 3U50C 2X6LA 2E8GA 2E2JH 2ES2A 1RHPA 4R1JA 1KNAA 3NK9A 4K14A 1Z9FA 3HKZB 2PZWA 3D6WA 1LUZA 1T5EA 2WACA 3C3LA 2LMCB 3U9SA 3FEWX 3K6OA 1CQVA 1XJVA 2F4IA 2XIWA 4IJLA 4GZYC 5GAGC 4MTNA 1TT2A 4PZ6A 2MP1A 1AE3A 1IHZA 1IBMQ 4LF6L 4JI8Q 2GVAA 5IE8A 3Q6SA 1H9SA 5J3BA 3BJUA 4AIMA 3HOXH 3M4QA 4HCSA 4DR2L 2K04A 3U4ZA 1WCMB 1E2VA 4CJ1B 3I4NG 3BYTB 4YHHQ 3T1HQ 4JI5L 4OO1I 3CCUA 1ENFA 4UP9A 2MPMA 1VQHA 4UAIA 3W2DA 1VQGA 2ZM6Q 3SK5A 2MQHA 4JI0L 1CA6A 1XPUA 5CV8A 1XPRA 5ELNA 1CQFA 2IL8A 4A3LH 4BBRB 4KV6A 3MFGA 1UUPA 5C4HA 4B3MQ 1HR0W 2EYMA 2F0TA 3OYYA 3CD6A 3I4MG 4GNXC 4LK1C 1JB7A 3I7FA 1HJPA 1SSOA 1EYDA 3NQIA 1Y8NB 5IOCA 4UDUC 1GO3E 1U4PA 3S1MB 1E1OA 4R4OA 3M3YH 3LWEA 5J22A 2K6AA 3V2TA 4KKSA 1CZGA 4R9WA 3T1YL 2B8GA 3HG9A 1XTCD 1KD1C 2ZXRA 3H91A 1EY5A 3BDOA 1GUGA 2F1MA 1QILA 4IOAA 5IWAQ 1SLJA 3E0EA 3F8TA 4BA1I 4TVAB 3NBHA 4BY1H 4NPSA 3K0XA 2Q2HA 4ME5A 1WTWA 3D8GA 2G5DA 4RFBA 2Y0SB 1HHVA 3QOJA 3HOUB 1AZQA 1PFNA 4GNXA 1DOMA 1TWCH 1XXGA 3E6ZX 3GTJB 1EWCA 2BA0A 3L2PA 3HOZB 2XWBB 5KYIA 3GTMH 2R61A 5IGFA 3HFZB 4JBKA 2NVQH 2TSSA 4JBJA 1V8QA 4A3FG 3AU7A 4FF3A 1Y8PB 2NVYH 3JAML 1GUSA 4ZYSA 1F2YA 2KEDA 3ZYYX 4DFAA 5C4XB 3DEOA 2RSOA 4ALPA 4JV5Q 2A69D 4LF7Q 2NVXB 4RHSA 2IX0A 4YHHL 4UPAA 4LFAL 3RLFA 1O78A 4RGOS 3F1ZA 2ZXPA 3CCJA 3S1RB 5AFWA 4BY7B 2NN6I 1N9WA 4JI0Q 2EE1A 3U9OA 3PO3B 3FPUB 2F0WA 3I4NH 1CK1A 2Y0SE 3H15A 3G6EA 4OX9L 2NN6G 2B2VA 1SXTA 3M4OH 1JOQA 1L0YB 1G51A 3HOVH 3W3AA 5IYCG 3TS0A 4I7ZC 3KDFA 4BS9A 4A3LG 1SNQA 1CT1D 1DGSA 2R92B 1Q86C 3H94A 5JVG3 1PH8A 3PCOB 3T13A 3TP5A 3VA5A 4HMIA 3NTKA 3NBIA 4AH6A 4FNFA 2OQKA 3NWTA 1I94Q 3IRBA 3PSIA 1IBML 3CMAA 4OGQC 3T16A 1I50B 3PV0A 4HR7B 1GD7A 1QB5D 1S5BD 2L55A 2EJGC 5LL6S 4A3IB 3F2BA 1K83B 3TREA 1WD1A 5I9PA 5D14A 4N8FA 5KNDA 2PZUA 3UDFA 1MD2D 4K8JA 3V05A 4IFDI 2YTXA 3ER0A 2MFIA 3V96A 3MXNA 3J7AF 5IYDG 4QIWB 4JYAQ 3DXJC 1Y1VB 4ZKCB 4EQOA 3H6MA 2N55A 5DM73 1KXLA 3VYRA 4JVZA 3SK4A 3A74A 2UUBQ 2B2YC 2FMMA 1PZKD 3DLLA 4KMUC 1UE6A 2DUDA 1J5EL 2VL6A 3SXHA 3S1NH 5LHY1 3TBIB 5C4XH 5D3DA 4DV4Q 3A8KE 3PMFA 3LWUA 2BDOA 1VQ7A 1UAPA 3D6CA 3PIOA 1KC8C 3B6YA 1BCPC 2UXDQ 2RHSB 4CDCC 1HNZL 2F0LA 2F3IA 2PI2A 1N8RC 2YU9H 3AQQA 1B9NA 4H02A 4YCWA 3HGBA 3R8BA 1SE2A 4GOPB 1M4VA 5JVH3 1TS4A 2AWOA 2MO1A 4ZAIA 1PVOA 2K01A 1UEAB 4OWTB 4ZK9B 2Z1CA 1VQLA 1S5DD 3L3OC 3SGIA 1DJRD 3WOFA 4A3EG 3HOZG 1HNWQ 1VQPA 4MN3A 4EQNA 4A3BG 3QB3A 4PG3A 1FYCA 1PMRA 1TIID 1UWVA 5KNBA 1D6EC 1PRTB 2BCOA 2A6HC 3S2HH 4A3EB 2NYZD 3CXCA 4HN7A 4K0KL 3KDFB 3A7AB 4KY5A 1L0WA 1L1OA 2K5HA 4JI3Q 1H9MA 3I8ZA 3W5OA 1HNXQ 2PZTA 5FJ8H 4B9XA 3OMCA 2WKDA 2K75A 2Q2TA 1XX8A 1HA5A 3I2ZA 2Z0SA 3M4OB 5JJIA 1GJXA 2JP1A 1U4MA 1U4RA 2RBMA 2RKSA 3RLOA 4XTCS 2JA8G 2HQLA 2L1BA 4LJZC 1D1KA 2KQ3A 4A3DG 2NZHA 4KD4A 3VDYA 3ERQA 2P5ZX 3CPWA 1RTNA 1OTCA 4BWGB 5T1GA 1XNRL 4C3JG 4G7ZC 1L2FA 2D62A 1NAPA 3PO2G 1DONA 1VQ9A 1N34L 2VUMB 2BH2A 2KOLA 2B39A 4B3TQ 3SVMA 2EXDA 3WOEA 4GKKQ 1EWHA 2QGQA 3GV6A 1EFID 2KJXA 5HY6A 3PUYA 4IUUA 4C1NI 4IFDG 1D5XC 3VYSA 2QDBA 4C3HB 3M4YA 3T51B 1G2TA 5H1SE 3P20A 4JV5L 1HNWL 4IUNA 5E4XA 1IYVA 4OIKA 3I70A 1STNA 2R93B 2PMZE 2WFWA 1X3FA 1WD0A 1VMCA 1G2SA 1JWMD 3HOWG 1B7YB 3U58A 1A0IA 2MUYA 4O1NA 4B08A 3S1QB 4DR6L 3T4AC 4KKUA 1NJIC 2R93G 3PO3H 5GAHC 4P71A 4A3EH 1HUNA 2R3ZA 1DCZA 3CMEA 1WJJA 2JA5B 4RMFA 5DM63 1XYIA 3K5LA 1EIHA 3OIPA 1JMCA 3CC2A 2WP8J 4IALA 3NENA 3J7YW 2B2TC 4KD3A 1HTPA 1OO9B 1ONLA 4FXKC 2NWGA 3U4VA 3OOCA 5C3XA 3RN2A 1WYDA 3S1QH 3HKSA 4U68A 2AHOB 2E2JB 1PTOD 4H13C 5IGGA 1ICFB 4LF6Q 4ULLA 3PUWA 1GHJA 1S3OA 4QUFA 4DR2Q 4KHPL 3NTHA 4ZQ3A 1IXRA 2Q8IB 2HHHL 1MJCA 4PMWA 1A63A 2I5MX 1X3PA 1GKHA 1NR4A 2VS1A 5J1ZA 4F88A 2HIVA 4F7XA 3H09A 1X54A 1N32Q 3FHWA 2K5VA 5CV5A 1SRUA 3GTPB 4DR7Q 1BF4A 1QUQB 4QUCA 4X64Q 3NXWA 1B53A 2ZTCA 1XPOA 4C3JH 3E3XA 3K7AB 5ELFA 2F0SA 4K5WA 4KJOA 3MA2B 1XMOQ 1Q82C 1VQIA 1U5KA 1LTAD 5CV6A 3BDLA 1F9SA 4GKJQ 3CU7A 4DK1A 1SYFA 3QR8A 3MFYA 1D5ZC 1EU3A 4TRDA 1X65A 2EYJA 2MGSA 2X6GA 4V0BA 4DV0Q 1IZ6A 1HNXL 2AQ1B 4DV5Q 4C3IG 5EBCA 5FK9C 2KUMA 2M9VA 1AEXA 4IPDA 1LO5D 2XWJB 1ASZA 3GTPH 2XVSA 1CKNB 2ASBA 2DGYA 4CKBA 3I4MH 3C1EA 1NNXA 4NP5A 1BNZA 2JQOA 1VQ8A 1SE8A 3PIP3 2RHQB 2EJFC 3JAMi 4HSPA 4PZ8A 1B50A 3HOWH 5K36H 2Z4HA 4G7HC 1LTRD 1PV4A 5DEHA 5FO7B 3VA7A 2JE6I 4GKJL 1BCPB 1CM9A 2K05A 1LM0A 1RKNA 4BA2I 3T53B 1Y1WB 2SNSA 3STBC 4AYBG 1EL0A 2XNAC 3NELA 4DU9A 1F2LA 4AYBB 3K5NA 1S4ZA 1EIYB 1V43A 3A54A 3NUCA 4X3TA 2G9HD 1IBLL 4L6TB 1CSQA 1QVCA 4ODGA 4HAEA 5CORA 4CDEC 4IO9A 5L37A 1T9HA 1PYWD 1IYUA 2B2WC 1QZHA 1Y69U 3S2DB 4QCLA 3MWYW 4Q0FA 1GUTA 2AQ3B 1SNMA 2DN8A 5IP7G 5ELDA 1B70B 1JOOA 1PTOF 5FO9B 2N88A 4DUYQ 3X3MA 2GN5A 2F0PA 2K5WA 2NTTA 4DV2L 2JK8A 1KRSA 1U4LA 2OXPA 2HHHQ 3QG1A 4WJWA 1JE4A 2O5IC 1Y1WH 4RKBA 5M5WB 3ND8A 5EPLA 2JA7B 5NUCA 3TDQA 1P16A 1A3TA 2LXKA 2A8VA 1TU2B 2A1AA 2WIIB 1TVXA 3E9HA 1TR5A 3D0FA 1K28A 3CPFA 3NSWA 4A3MB 4OX9Q 2NVXH 1TWHB 2FMCA 1ZYRC 3VR5A 4X3UA 2E74C 1BO0A 3IL8A 2D9UA 4LF7L 1IW7C 1V1OA 5CBEE 5JAVA 3QIAA 4J6HA 3MEHA 1QUQA 2ID0A 5I6YA 3SHLA 5JEAJ 3EVQA 2NN6H 4BXXH 3CQZH 4C56C 3DM1A 2IY5B 3S14H 3K57A 2KENA 4CBVA 1Q46A 1F9QA 3JC66 5ISRA 1V1PB 2K14A 5C0XH 4KJNA 1YNXA 1Q8KA 3VR2A 4WFN3 3BS1A 3M7NA 5AJ3Q 3DM3A 5EBDA 1KLUD 5C3WA 4A3CG 5BN5A 2VXWA 1TWGH 3TSSA 4A3DB 3CKIB 4N9PA 1SDFA 1TS3A 2J7ZA 2WAQB 5C0XJ 4OEMB 2DNEA 4R8IA 2F4VQ 4DNRB 4KTAA 2CCZA 4Q5VA 4XT1B 2JA7H 2R7ZH 2UXBL 4DUYL 4OWWB 2F0UA 2F0QA 1QZGA 3K5MA 2B63H 4LF9L 3VYUA 1EZ8A 2JEBI 3UDIA 4LUOA 2M2LA 3OSOA 1PH5A 4PMBA 3J7ZC 3NHHA 2E5LL 1TXYA 1YNJD 2K33A 3PO2B 3G7LA 1II3A 2TMPA 4LFBL 2I5LX 1P8LA 3BZDB 3K0YA 2EQSA 4DXFA 5IY0A 1E1TA 1S5FD 3GTQH 2VY3A 3S1NB 1EY4A 3NWSA 4LF4Q 2RSNA 3LGJA 4C3HG 2A5HA 2LSSA 2A69C 3URYA 1K8MA 3MXUA 3VR6A 1K73C 1G291 2F0MA 4DV3Q 3J81i 1RTOA 1NE3A 1JB3A 2EDGA 2KVMA 3NTIA 1NMGA 1DOLA 1AN8A 1KLGD 3FKIB 4OO1G 1N34Q 3HOXG 1E3PA 3ONAB 3RNUA 1VF5C 4XIGS 2HCIA 4O42A 2A6EC 4X64L 2D0OA 3GQBA 2PMZB 3AB9A 4JCVE 3F2DA 1PLFA 1FNWA 3VR4A 5ELOA 4IZ8A 1I6HB 1IKLA 2QKIC 3P7JA 4KY6A 4JI3L 3NPPA 5IT9L 5M9OA 2HCCA 3EJIA 2K32A 5EQ0A 5EPKA 3OIQA 3AEVA 1XWEA 2F0HA 4QY7A 1Z6HA 2X69A 5IP7H 3P75A 1S5ED 1Y1VG 2UXDL 1V1PA 2PQEA 3DWPA 1SMXA 5C0XG 3OTOQ 2F0GA 3EN2A 1TQOA 2KCMA 3CCSA 3UDXA 2FJ2A 1G6ZA 5C44G 1MJEA 1X6OA 2O4XA 3MXNB 3PGZA 5G3LF 1RL2A 3I72A 5E4WC 4GN3B 3D3RA 5M3FH 4L5QA 2NVYB 4AQYQ 3C46A 4H0LC 2CQOA 3TP6A 4NXNL 2JA8H 2R7ZB 4MIUA 4JI2Q 1JR0D 1CA5A 3AYHB 2OWOA 2B63B 2IT1A 2ZXOA 2AUJD 2Q8RE 3KBGA 3T1HL 4QL5A 1VQEA 3RZOH 4FVMA 4GLVB 5CC4A 4KK7A 3AMUA 3E9IA 1HNZQ 1BUVT 1KL9A 1UEBA 1SJED 3H0GB 2CVRA 2ZJRA 2H1EA 4MTKA 4RA8A 4TKOB 4FF4A 4XQQA 2FFKB 2RDHA 1TWGB 1WCMH 1TWFH 2Z6KA 5C3EB 2PW5A 3W1BA 4ABNA 4KLKA 1I4XA 2NVTB 2XRQD 1X3QA 1GHKA 1S72A 1ILQA 4P72A 2LKVA 1SR3A 4ZKBB 2KHJA 2ZTDA 1C8CA 4TQUS 3NBHB 2JSOA 4LMQD 3QO2A 3K7UC 5LL6X 1JORA 3P1HA 1PH3A 4BY1B 1CI3M 3H3VI 4K5XA 1FNVA 3PUXA 2VUMG 3HKZE 3WWVA 5IODA 1NUCA 2RDFA 1I4RA 2EIFA 3Q8DA 5CMDA 1KQSA 1TWHH 3ULJA 1TY0A 4A3JB 4IURA 4A93B 2OTJA 3S1MH 4DR3Q 3Q23A 2RQXA 4KN7C 2JA8B 1PTOB 4Y7NH 1K8AC 4BY1G 3BVZA 2K03A 2EY6A 3CRLC 1O7ZA 3J81j 3HOXB 3CCMA 3HOVG 1RDPD 2PQAA 1DZ1A 1BBXC 4KY7A 4I65A 1KABA 4DV1Q 3M9BA 4OHJA 1HA6A 4HCEA 5K5PA 3L9AX 4R8NA 1A15A 4IJHA 5C0XI 3KLSA 4LNQA 4KHPQ 1M1KC 3MC0B 3TN2A 3CCVA 5CV9A 1LT5D 1VQBA 5EKLA 1LTID 3SE0A 4DAPA 2EVBA 4MHEA 4IFDH 1MSHA 4EQPA 4APVA 2XSCA 3PIPA 3RZOB 2G9DA 5FLXL 2B3GA 3MEFA 4UP7A 4LWCA 1EOVA 1HH2P 1UE5A 5I9OA 4PMCA 3ERSX 3PF4A 1BBWA 2H4OA 1EY6A 1QVFA 1GUOA 1AP0A 2WINB 4EGVA 1LT6D 3A0JA 4KN4C 5IYBH 3Q0AA 2E5LQ 2ICEC 3TZDA 5E3FA 2AMCB 2VQFQ 1GOZA 4X65L 1O80A 2EY1A 5IYCH 4IN3A 4XQJA 4HIKA 1NCVA 1YJWA 1G91A 4AYBE 3A5UA 2F3WA 3J7A5 1LTBD 5A2QL 3RD4A 4YCUA 2I07B 1HR0Q 4NKLA 1I4HA 4DR5Q 1R4PB 1EY7A 3TQYA 1VQOA 5M3MB 1CFMA 4O2DA 3E0JA 4X62L 4JC0A 1Q90A 2EYFA 3N6RA 4CKEA 2SOBA 2O5JC 2NVTH 1HCZA 4JI6L 2F0VA 1EIGA 2Q2IA 4A3KH 4CKCA 4EX5A 1K3BC 2NB0A 2Z8LA 5EKIA 1EWIA 3CQZB 3HKZG 1HXYD 1LLRD 3FPPA 4IUVA 1E2ZA 2CW0D 1Z7TA 1FJGQ 1I3QB 3OW2A 4JI5Q 2A19A 4DV4L 4DA2A 3NE5B 4HJ7A 1LABA 1MI2A 1Q81C 4L5SA 1MGSA 2D0PA 1IBLQ 4GOPA 4DV5L 4GN4B 4K6LA 4XDXA 3MXGA 4KHVA 3R93A 1KIXA 2EXZA 5KRUA 4L5RC 3TEHB 1K3RA 1TWAB 1WTPA 3C2PA 3CCEA 3J81E 5GROA 4DAMA 2UUAL 2KCNA 2LY7A 1O7YA 4N9TA 4Y7NB 2V1CC 5M5WH 4BBRH 1SMYD 3STBD 1LTLA 1QJOA 1H9JA 2ZJQA 2ZTEA 3CW2C 1VQ6A 1Y8OB 4CDDC 2CH4W 4DV2Q 1Q3LA 1R4QB 2VQEL 1EEFD 1TWCB 2YU9B 4CDFC 4JK1C 3A8JE 1L1OB 3HOZH 3MTSA 1CKNA 2FHTA 4A3JG 3S15H 1IBKL 4C2MB 3I56A 1HTLD 4K6DA 1STAA 1F2MA 1YBYA 1KHIA 4DR5L 4A3FB 4HIMA 2UXCL 3J81c 4ZUIA 1JCKB 5EKKA 4NB3A 4L8JA 1J6QA 3RZDB 5COYA 2VNUD 1K9MC 1KDCA 3J80E 5T1IA 1BQQT 4B3SQ 2EYPA 1F77A 1HR0L 2RF4A 3BZKA 2MHVA 3D4DA 1YIJA 1J5EQ 1B9MA 3KYHC 3F2CA 2R7ZG 1ESRA 1L1OC 3GD7A 5DAUA 3RLNA 3S16B 1V9PA 2B2WA 1ML0D 2QCPX 1EYAA 4DAYA 4RGNA 2YYZA 3S24A 2XRSD 1I3QH 2UUCL 3T56B 1SNCA 1PRTF 2JA7G 1OXXK 1MBYA 5JEAH 1D8LA 3DWAA 2Z4IA 2K50A 3QOLA 1BXTA 4YCVA 1C9OA 1FR3A 1VDZA 1LACA 1DD2A 1EUJA 1QWYA 1H9KA 2UXBQ 1EQVA 2CWPA 2UU9Q 1WOCA 1TKWB 2E75C 5I2YA 2EPBA 4K5VA 4DNIA 1IKMA 1BR9A 1JOKA 4NXML 4RG1A 1QE6A 3K59A 4LFAQ 1SYBA 1EQQA 3UE0A 3GTLB 2B2UA 4X66Q 1SE3A 5C5LA 1WFQA 2L0CA 2JA6H 2R92H 2MNAA 2IPKD 4K0KQ 3H0GH 1ENAA 5M5XB 1N33L 1ZXTA 2EY5A 4CGYB 3R2TA 1CTMA 5AJ3L 2AQ2B 1STBA 3M85A 2UU9L 3DMUA 4CHTB 2R93H 1HZAA 5IWAL 3I73A 3ND9A 4CJ0B 5CR3A 1A3UA 2VZAA 2ZT9C 5IT9E 1DOKA 1PXUA 4DK6C 4NDXA 4NXMQ 4M1UB
chains in the Genus database with same CATH topology
1FD7D 1B2TA 3A56A 3FDTA 1LTGD 2BE5D 2KEEA 1PRTD 3HP3A 3HS0C 4DGZA 1ZEQX 3IFDA 3TP8A 4QF4A 2KHSA 2IWHA 5J39A 5M3FB 4ZRZA 3PIO3 2ICIA 1D5MC 1SYDA 5JPMC 3HZXA 1EY0A 3EA6A 5K36G 2PYKA 1NSNS 2BOSA 1BCPD 4HMJA 1EQTA 5CBAE 4L63B 4ZLTF 2F0NA 4B9WA 3PUZA 2QILA 1VMPA 1QNUA 2AUKA 1PZJD 5CGKA 3SDZA 2RVLA 3NP8A 1PTOC 2OT2A 5M5YB 2L12A 3M3YB 1G8ZD 1SYGA 4H7BA 1SJHD 3UI2A 4IUQA 1UNSA 4WORA 1LT3D 2A73B 4XQNA 5IGDA 4OL7A 5I4DA 1LT4D 1SEBD 2F0OA 1BCPF 3I90A 5JEAG 3I4LA 4FP5D 4ILWA 1WTXA 1ILPA 4U673 3KUPA 3D31A 2JA6B 2SEBD 3J81L 1J9OA 3A8IE 3HRZC 2CQAA 1IW7D 5I2XA 3IFTA 3GTQB 2FINB 4RWSC 5CYUA 5FLXE 4FXGC 3L7ZC 4DAVA 1SFOB 2DY7A 3G6JB 1DM0B 3GP7A 5EPJA 4C3IB 1OXSC 4IUPA 3A7LA 5HURA 2VB3X 2WV6D 3GO5A 3FRPB 4G57A 2C9OA 3GV3A 3R2IA 1KDAA 4YIJA 1OXVA 2OEOA 5JJZA 2E2HB 2F0EA 1A3VA 1H9SB 3LX0A 2PW7A 2PO4A 2JYOA 1T5XD 4JBWA 3TZUA 4DXGA 2CW0C 1ZYRD 1WTVA 3RUZA 1W6KA 4ZUJA 4RCNA 1B44D 1W6JA 2A74C 2A68D 4PNYA 3PUVA 4K2LA 4X3KA 1VF7A 3O13A 4CJ2C 1SMYC 3S2HB 4HEDA 1X32A 3M7GA 4DNTB 1BOSA 3SR1A 3K5OA 5KEEA 1C4QA 2EY2A 5JOBA 4F87A 1LTTD 1D2BA 4ID6A 2O2LD 1C48A 3MZ5A 1JWSD 1ESFA 3OWFA 3FVQA 2JEAI 2EOTA 1A6XA 1DXMA 3J7AV 1KTKA 2K1BA 1EU4A 3HEJA 2DY8A 1RCVD 2VB2X 4OO1H 1JICA 5A35A 3N52A 1I4PA 1EYCA 1STYA 5G3LD 2J0TD 1BDOA 3H3VC 5D65A 2A68C 3TMEA 5FOBB 2F0JA 1Q1BA 4G4KA 1ET6A 1ET9A 3S9WA 2A6HD 3K58A 4QMGA 4FO2A 1HQMC 3J80L 1WVLA 1PZID 1TS2A 1TWFB 5CV7A 2KCCA 1ICWA 1SNDA 3S14B 3S17B 1PFBA 3BVMA 1L0XB 2F03A 3BDCA 1AZPA 1SAPA 1TY2A 1HRJA 4M8AA 2NBFA 1JC7A 4LAAA 4TSSA 4KKTA 2B2UC 4PV1C 2ENBA 4E6IA 1DYQA 1ENCA 5EGTA 2HDLA 3GTMB 1I4GA 1PTOH 2F0FA 4RHRA 2NVQB 2K7VA 3GTGB 5IGEA 3GTKB 4XT3B 3SK8A 2IW3A 1Q8IA 4A3KB 3NQTA 2F0KA 3F2UA 2R6GA 4H44C 5ELCA 4FF2A 4DK0A 2B2VC 2CHBD 3HOVB 3LNNA 4XYOA 1SE4A 3CRKC 4C1NK 3MAQA 1AFPA 2RA4A 3Q22A 4EVOA 4DN4M 1SNOA 5CV4A 1I6VC 2NUCA 4HTHA 5HGTA 3QWNA 1QNKA 3R3OA 4RGMA 2KECA 2B8FA 3MXPA 2KA7A 5JPNC 2B2YA 4J1MA 1Z47A 1RODA 4FXDA 2Q8TA 2B2TA 5C4JB 5ELEA 5KYLA 1STGA 1YNNC 1JWUD 4P2CB 1CZWA 2NTSA 2M00A 2IJ0A 1EZ6A 2F3VA 1WTQA 3IKJA 2RDGA 3JAME 2LFNA 2OF1A 1WTOA 4NMZA 1WTRA 1MSGA 2EYLA 3BG3A 4S3SA 4A3BB 3KLRA 1STHA 4OIJA 3GTOB 2IX1A 3OMGA 3I3CA 4V190 1ZKOA 3OWEB 3MHBA 1FNUA 2I46A 2D2CC 2IX3A 5IIFA 1SBBB 3SEBA 3KK7A 3D4WA 1E2WA 1D1IA 1H9RA 1YNND 1SYEA 2A6ED 2QF7A 3S15B 2L5TA 3MVVA 3RMHA 3X3NA 1M8AA 2E2DC 1NR2A 1F2ZA 1FGBD 5D3IB 1IL8A 3DEPA 2SNMA 5I6WA 2K5QA 2V4DA 3I4NB 1A2UA 1PDQA 3ITPA 4K2KA 4XXEA 5BN3A 3OW7A 1LV9A 1QCBD 1K8OA 5F2DA 2SDFA 3HOWB 5DNFA 4RKLA 4RH6A 1F9RA 1OXUA 5ELBA 2QEJC 1LTSD 1SYCA 4DF7A 4RAUC 4BBSB 2L11A 3D4RA 1Q1EA 1B4OA 1Q12A 5C6AA 4FYDA 3FMCA 2D5DA 2BA1A 2J4XA 1EY8A 4XYQA 5A2QE 3EROA 2HDMA 1YNJC 3VR3A 5C5MA 4K8IA 4KHZA 5C4ZA 4RGTA 4WRDA 3A55A 1HQRD 5TSSA 5FO8B 2WKCA 1F9PA 3OPOA 2EZVA 3WDNA 2E76C 2XN9C 1PRTC 1S5CD 4IFDJ 4F8MA 3BYYB 1KAAA 3HOYB 5C44B 2LS01 1RD9D 5KGUA 5BN4A 1B3AA 5FKAC 3I91A 1OXTA 4Z9CB 4C3JB 1VCIA 5KIXA 5IGCA 1EY9A 4NW2A 1HPCA 1STEA 1KNEA 3EFXD 1HFGA 2F0DA 2K5DA 5E1FA 5KNCA 1RF2D 4IQZA 1AW7A 2PPBC 1A2TA 1I4QA 2L4NA 3OHXC 3I4MB 2JXMB 2L9HA 1CHPD 2C5CA 3QJYA 2F0IA 5EJWA 1CHQD 3DHQA 3KBXA 4PQXA 3E5SA 1KDBA 2HUGA 4FF1A 1SNPA 3CHBD 2MJ8A 3SK6A 3KF8A 1EEID 1QOHA 3Q24A 3KLSX 1PFMA 3EQLC 1GUWA 2HQEA 3DUZA 2PCFB 1GXDC 1HFNA 2BDNA 2EYHA 1QG7A 1R9TB 3IAYA 3DWQA 1U9RA 1GUNA 4J8QA 4X3SA 3TP7A 2NZ1D 2EJMA 1JQYD 2EYOA 1J8IA 1E0BA 2K28A 2PNRC 2AWNA 3BVGA 1HUMA 4IUTA 1O7LA 5IGBA 1EOTA 4KI0A 1RJTA 1TS5A 4RCOA 4G7OC 3VYTA 3C1FA 2GA4B 4A3GB 1B1ZA 2BE5C 4QB4A 2WB1B 2DNCA 2E2IB 4HSVA 2X6LA 1RHPA 1KNAA 3NK9A 4K14A 3HKZB 2PZWA 3D6WA 1T5EA 2WACA 3C3LA 2LMCB 3U9SA 3FEWX 3K6OA 1CQVA 2F4IA 2XIWA 4GZYC 1TT2A 2MP1A 1IHZA 3Q6SA 1H9SA 4HCSA 2K04A 1WCMB 1E2VA 4CJ1B 3BYTB 4OO1I 1ENFA 2MPMA 4UAIA 3W2DA 3SK5A 1CA6A 5CV8A 1CQFA 2IL8A 4BBRB 4KV6A 3MFGA 1UUPA 5C4HA 2EYMA 2F0TA 4LK1C 1SSOA 1EYDA 3NQIA 1Y8NB 5IOCA 4UDUC 1U4PA 3S1MB 3LWEA 5J22A 2K6AA 3V2TA 4KKSA 1CZGA 4R9WA 2B8GA 3HG9A 1XTCD 2ZXRA 3H91A 1EY5A 3BDOA 1GUGA 2F1MA 1QILA 4BA1I 3NBHA 4ME5A 1WTWA 3D8GA 1HHVA 4RFBA 2Y0SB 3QOJA 3HOUB 1AZQA 1PFNA 1DOMA 1XXGA 3E6ZX 3GTJB 1EWCA 2BA0A 3HOZB 2XWBB 5KYIA 2R61A 5IGFA 2TSSA 1V8QA 3AU7A 4FF3A 1Y8PB 3JAML 1GUSA 4ZYSA 1F2YA 2KEDA 3ZYYX 4DFAA 5C4XB 3DEOA 2RSOA 2A69D 2NVXB 4RHSA 2IX0A 3RLFA 1O78A 4RGOS 2ZXPA 3S1RB 5AFWA 4BY7B 2NN6I 2EE1A 3U9OA 3PO3B 3FPUB 2F0WA 1CK1A 2NN6G 2B2VA 1SXTA 1JOQA 1L0YB 3W3AA 4I7ZC 4BS9A 1SNQA 1CT1D 2R92B 3H94A 5JVG3 3T13A 3TP5A 3VA5A 4HMIA 3NTKA 3NBIA 4FNFA 3NWTA 4OGQC 3T16A 1I50B 3PV0A 4HR7B 1QB5D 1S5BD 2L55A 2EJGC 5LL6S 4A3IB 1K83B 1WD1A 5I9PA 5D14A 5KNDA 2PZUA 1MD2D 4K8JA 3V05A 4IFDI 3V96A 3MXNA 3J7AF 4QIWB 3DXJC 1Y1VB 4ZKCB 4EQOA 3H6MA 2N55A 5DM73 3VYRA 3SK4A 2B2YC 2FMMA 1PZKD 4KMUC 3SXHA 5LHY1 3TBIB 5D3DA 3A8KE 3PMFA 3LWUA 2BDOA 1UAPA 3D6CA 1BCPC 2F0LA 1B9NA 3HGBA 3R8BA 1SE2A 1M4VA 5JVH3 1TS4A 2AWOA 4ZAIA 2K01A 1UEAB 4ZK9B 2Z1CA 1S5DD 3L3OC 1DJRD 3WOFA 4MN3A 4EQNA 3QB3A 1FYCA 1PMRA 1TIID 5KNBA 1D6EC 1PRTB 2BCOA 2A6HC 4A3EB 2NYZD 4HN7A 3A7AB 4KY5A 1H9MA 3I8ZA 2PZTA 4B9XA 3OMCA 2WKDA 1XX8A 1HA5A 3M4OB 1GJXA 2JP1A 1U4MA 1U4RA 2RBMA 2RKSA 4XTCS 2L1BA 4LJZC 1D1KA 2KQ3A 4KD4A 3ERQA 1RTNA 4BWGB 5T1GA 4C3JG 4G7ZC 2D62A 1NAPA 1DONA 2VUMB 2KOLA 2B39A 3SVMA 3WOEA 1EWHA 3GV6A 1EFID 2KJXA 3PUYA 4IUUA 4C1NI 4IFDG 1D5XC 3VYSA 2QDBA 4C3HB 3M4YA 3T51B 1G2TA 3P20A 4IUNA 5E4XA 1IYVA 4OIKA 3I70A 1STNA 2R93B 1WD0A 1VMCA 1G2SA 1JWMD 2MUYA 4O1NA 4B08A 3S1QB 3T4AC 4KKUA 1HUNA 2R3ZA 1DCZA 2JA5B 5DM63 1XYIA 1EIHA 3K5LA 3OIPA 2WP8J 4IALA 3J7YW 2B2TC 4KD3A 1HTPA 1OO9B 1ONLA 4FXKC 2NWGA 3OOCA 5C3XA 4U68A 2E2JB 1PTOD 4H13C 5IGGA 4ULLA 3PUWA 1GHJA 4QUFA 3NTHA 4ZQ3A 2Q8IB 4PMWA 1X3PA 1NR4A 5J1ZA 4F88A 4F7XA 3H09A 5CV5A 3GTPB 1BF4A 4QUCA 3NXWA 1B53A 3K7AB 5ELFA 2F0SA 4K5WA 4KJOA 3MA2B 1LTAD 5CV6A 3BDLA 1F9SA 3CU7A 4DK1A 1SYFA 3MFYA 1D5ZC 1EU3A 4TRDA 2MGSA 2EYJA 2X6GA 4V0BA 2AQ1B 4C3IG 5EBCA 5FK9C 2KUMA 2M9VA 1AEXA 1LO5D 2XWJB 2XVSA 4CKBA 3C1EA 1BNZA 4NP5A 3PIP3 2EJFC 4HSPA 1B50A 5K36H 2Z4HA 4G7HC 1LTRD 5FO7B 5DEHA 3VA7A 2JE6I 1BCPB 1CM9A 2K05A 1RKNA 4BA2I 3T53B 1Y1WB 2SNSA 1EL0A 2XNAC 4DU9A 1F2LA 4AYBB 3K5NA 1S4ZA 1V43A 3A54A 3NUCA 4X3TA 2G9HD 4L6TB 5CORA 4ODGA 4HAEA 4QCLA 2B2WC 1PYWD 1IYUA 3S2DB 1Y69U 3MWYW 4Q0FA 1GUTA 2AQ3B 1SNMA 2DN8A 5ELDA 1JOOA 1PTOF 5FO9B 2N88A 3X3MA 2K5WA 2F0PA 2NTTA 1U4LA 2OXPA 3QG1A 4WJWA 1JE4A 2O5IC 4RKBA 5M5WB 3ND8A 5EPLA 2JA7B 5NUCA 3TDQA 1A3TA 1TU2B 2WIIB 1TVXA 1TR5A 3NSWA 4A3MB 1TWHB 2FMCA 1ZYRC 3VR5A 4X3UA 2E74C 1BO0A 3IL8A 2D9UA 1IW7C 1V1OA 5CBEE 5JAVA 3QIAA 4J6HA 3MEHA 2ID0A 5I6YA 3SHLA 5JEAJ 3EVQA 2NN6H 4C56C 3DM1A 3K57A 4CBVA 1F9QA 5ISRA 1V1PB 5C0XH 4KJNA 3VR2A 4WFN3 3BS1A 3M7NA 5EBDA 1KLUD 5C3WA 5BN5A 2VXWA 3TSSA 4A3DB 3CKIB 4N9PA 1SDFA 1TS3A 2J7ZA 2WAQB 5C0XJ 2DNEA 4R8IA 4DNRB 4KTAA 4Q5VA 4XT1B 2F0UA 2F0QA 3K5MA 3VYUA 1EZ8A 2JEBI 2M2LA 3OSOA 4PMBA 3NHHA 1YNJD 2K33A 3PO2B 3G7LA 1II3A 2TMPA 3BZDB 3K0YA 4DXFA 1S5FD 3S1NB 1EY4A 3NWSA 2RSNA 4C3HG 2A5HA 2A69C 3URYA 1K8MA 3MXUA 3VR6A 1G291 2F0MA 1RTOA 1JB3A 2EDGA 2KVMA 3NTIA 1DOLA 1AN8A 1KLGD 3FKIB 4OO1G 3ONAB 1VF5C 4XIGS 2HCIA 4O42A 2A6EC 3GQBA 2PMZB 3AB9A 1PLFA 1FNWA 3VR4A 4IZ8A 1I6HB 1IKLA 2QKIC 3P7JA 4KY6A 5M9OA 3NPPA 5IT9L 2HCCA 3EJIA 2K32A 5EQ0A 5EPKA 3OIQA 1XWEA 2F0HA 1Z6HA 2X69A 3P75A 1S5ED 1V1PA 2PQEA 3DWPA 5C0XG 2F0GA 1TQOA 2FJ2A 1G6ZA 2O4XA 5G3LF 3I72A 5E4WC 3D3RA 3C46A 2NVYB 4H0LC 3TP6A 2R7ZB 4MIUA 1JR0D 1CA5A 2B63B 2IT1A 2ZXOA 2AUJD 2Q8RE 3KBGA 4FVMA 5CC4A 4KK7A 3AMUA 1BUVT 1SJED 3H0GB 2CVRA 2H1EA 4RA8A 4TKOB 4FF4A 4XQQA 2FFKB 2RDHA 1TWGB 5C3EB 2PW5A 4ABNA 1I4XA 2NVTB 2XRQD 1X3QA 1GHKA 1ILQA 2LKVA 4ZKBB 1C8CA 4TQUS 2JSOA 4LMQD 3QO2A 5LL6X 1JORA 3P1HA 4BY1B 1CI3M 4K5XA 1FNVA 3PUXA 5IODA 1NUCA 2RDFA 1I4RA 5CMDA 1TY0A 4A3JB 4IURA 4A93B 3Q23A 2RQXA 4KN7C 2JA8B 1PTOB 3BVZA 2K03A 2EY6A 3CRLC 1O7ZA 3HOXB 1RDPD 1DZ1A 1BBXC 4KY7A 4I65A 1KABA 4OHJA 1HA6A 4HCEA 5K5PA 3L9AX 4R8NA 1A15A 5C0XI 3KLSA 3MC0B 3TN2A 5CV9A 1LT5D 5EKLA 1LTID 3SE0A 4DAPA 2EVBA 4MHEA 4IFDH 1MSHA 4EQPA 3RZOB 2XSCA 2G9DA 5FLXL 5I9OA 4PMCA 2H4OA 1EY6A 1GUOA 1AP0A 2WINB 4EGVA 1LT6D 4KN4C 3Q0AA 2ICEC 3TZDA 5E3FA 1GOZA 1O80A 2EY1A 4IN3A 4XQJA 1NCVA 1G91A 2F3WA 1LTBD 5A2QL 3RD4A 2I07B 4NKLA 1I4HA 1R4PB 1EY7A 5M3MB 1CFMA 3E0JA 1Q90A 2EYFA 3N6RA 4CKEA 2SOBA 2O5JC 1HCZA 2F0VA 1EIGA 4CKCA 2NB0A 2Z8LA 5EKIA 3CQZB 1HXYD 1LLRD 3FPPA 4IUVA 1E2ZA 2CW0D 1Z7TA 1I3QB 4DA2A 3NE5B 1LABA 1MI2A 1MGSA 4K6LA 4XDXA 3MXGA 4KHVA 3R93A 2EXZA 5KRUA 1TWAB 1WTPA 3C2PA 3J81E 2KCNA 2LY7A 1O7YA 4N9TA 4Y7NB 1SMYD 1QJOA 1H9JA 1Y8OB 1Q3LA 1R4QB 1EEFD 1TWCB 2YU9B 4JK1C 3A8JE 3MTSA 2FHTA 4C2MB 1HTLD 4K6DA 1STAA 1F2MA 4A3FB 4ZUIA 1JCKB 5EKKA 4L8JA 3RZDB 5COYA 2VNUD 1KDCA 3J80E 5T1IA 1BQQT 2EYPA 1F77A 2MHVA 3D4DA 1B9MA 1ESRA 3GD7A 5DAUA 3S16B 2B2WA 1ML0D 2QCPX 1EYAA 4DAYA 4RGNA 2YYZA 2XRSD 3T56B 1SNCA 1PRTF 1OXXK 1MBYA 5JEAH 3DWAA 2Z4IA 3QOLA 1BXTA 1FR3A 1VDZA 1LACA 1DD2A 1QWYA 1H9KA 1EQVA 1TKWB 2E75C 5I2YA 2EPBA 4K5VA 1IKMA 1BR9A 1JOKA 1QE6A 3K59A 1SYBA 3GTLB 2B2UA 1SE3A 5C5LA 2L0CA 2IPKD 1ENAA 5M5XB 1ZXTA 2EY5A 4CGYB 3R2TA 1CTMA 2AQ2B 1STBA 3M85A 4CHTB 3DMUA 3I73A 3ND9A 4CJ0B 5CR3A 1A3UA 2ZT9C 5IT9E 1DOKA 1PXUA 4NDXA 4M1UB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A2T A;  4E6I A;  5CC4 A;  1EZ6 A;  4ID6 A;  1ENC A;  4KTA A;  2WAC A;  1F2Y A;  4DFA A;  2F3V A;  5EGT A;  4K6D A;  5DEH A;  5F2D A;  1STA A;  1F2M A;  2F0U A;  2F0Q A;  3MZ5 A;  5E3F A;  1TT2 A;  1RKN A;  2F0F A;  1EZ8 A;  2SNS A;  1IHZ A;  3OWF A;  4DGZ A;  2EY1 A;  2F0I A;  3OSO A;  2OF1 A;  3DHQ A;  4PMB A;  4NMZ A;  4DU9 A;  3TP8 A;  4RKL A;  4QF4 A;  4ZUI A;  3NUC A;  2PW5 A;  3NHH A;  5EKK A;  2F3W A;  5IGE A;  2KHS A;  4ODG A;  3HEJ A;  1SYC A;  4DF7 A;  1II3 A;  2EYL A;  5J39 A;  3E5S A;  1KDB A;  3U9O A;  4NKL A;  2PZW A;  4IAL A;  4S3S A;  2F0W A;  4EQN A;  2LKV A;  1SNP A;  1SNM A;  3QB3 A;  1EY7 A;  4KD3 A;  5C4Z A;  3SK6 A;  1STH A;  1JOO A;  1KDC A;  1SYD A;  5C6A A;  5C4H A;  3HZX A;  3SK8 A;  1JOR A;  1EY0 A;  3P1H A;  1JOQ A;  1EY4 A;  2F0P A;  3OMG A;  1EYC A;  2EYP A;  1STY A;  3SK5 A;  2HQE A;  2PYK A;  4K5X A;  1NSN S;  2OXP A;  1EY8 A;  3D4D A;  5CV8 A;  5C3X A;  5HUR A;  4KY5 A;  3ERO A;  4HMJ A;  1SNQ A;  2EYF A;  5DAU A;  3MHB A;  4RKB A;  5C5M A;  5IOD A;  2F0M A;  2F0N A;  2SOB A;  4KV6 A;  1NUC A;  2RDF A;  4G57 A;  5NUC A;  3NQT A;  2PZT A;  4K8I A;  2F0V A;  1A3T A;  1EYA A;  2EYH A;  3T13 A;  2F0K A;  1KDA A;  4YIJ A;  3TP5 A;  2EYM A;  2F0T A;  3OMC A;  4WRD A;  4B9X A;  5IIF A;  1TR5 A;  2F0J A;  1SNC A;  3VA5 A;  4HMI A;  4ZQ3 A;  2OEO A;  1U9R A;  3S9W A;  3D4W A;  5CGK A;  2F0E A;  1EYD A;  4QMG A;  5J1Z A;  1A3V A;  3QOL A;  3TME A;  1SYE A;  2RBM A;  3NP8 A;  2RKS A;  3TP7 A;  3T16 A;  4EVO A;  4F7X A;  5IOC A;  3LX0 A;  2PW7 A;  3MVV A;  1SNO A;  5CV5 A;  2EY6 A;  2KQ3 A;  2EYO A;  4KD4 A;  5JAV A;  3ERQ A;  4J6H A;  1SYG A;  3MEH A;  5CV4 A;  2NUC A;  1EQV A;  4H7B A;  4HTH A;  4IZ8 A;  3V2T A;  5J22 A;  5HGT A;  3NXW A;  5I9P A;  4KY7 A;  4I65 A;  1KAB A;  4KY6 A;  4F8M A;  5M9O A;  4K5V A;  5I6Y A;  2PZU A;  3EJI A;  3R3O A;  4K8J A;  3SHL A;  1KAA A;  5CV7 A;  1JOK A;  1EY5 A;  2F0S A;  1F2Z A;  4K5W A;  3EVQ A;  4WOR A;  5K5P A;  2F0H A;  3MXP A;  4KHV A;  4KJO A;  4R8N A;  3RUZ A;  2EXZ A;  5KRU A;  3P75 A;  4ZUJ A;  5IGB A;  5ISR A;  1SYB A;  5IGD A;  1SND A;  2PQE A;  5KGU A;  4OL7 A;  5CV9 A;  2F0G A;  5CV6 A;  3BDL A;  5EKL A;  5C5L A;  1TQO A;  4EQO A;  4N9T A;  3H6M A;  4KJN A;  2SNM A;  1SYF A;  4PNY A;  5I6W A;  4ME5 A;  3BDC A;  4J1M A;  3D8G A;  4TRD A;  2O4X A;  2EYJ A;  3SK4 A;  5IGG A;  1ENA A;  4EQP A;  5KIX A;  3C1F A;  3QOJ A;  4K2L A;  5IGC A;  2EY5 A;  1AEX A;  1EY9 A;  4QB4 A;  3SXH A;  5C3W A;  3TP6 A;  1STB A;  5KYL A;  3DMU A;  1STG A;  3PMF A;  4MIU A;  4N9P A;  2F0O A;  2QDB A;  1A2U A;  3D6C A;  3C1E A;  2F0D A;  4LAA A;  5E1F A;  4NP5 A;  1A3U A;  5CR3 A;  5KYI A;  4B9W A;  3SR1 A;  5IGF A;  3ITP A;  4IUN A;  5I9O A;  4K2K A;  5KEE A;  4PMC A;  2M00 A;  2EY2 A;  1STN A;  3NK9 A;  5JOB A;  4K14 A;  4NDX A;  1EY6 A;  2F0L A;  2ENB A; 
#chains in the Genus database with same CATH topology
 4JOI C;  1FD7 D;  1B2T A;  3A56 A;  3FDT A;  3I55 A;  3UDG A;  1LTG D;  2BE5 D;  2KEE A;  1PRT D;  3HP3 A;  1XNQ Q;  4YWM A;  3HS0 C;  4A76 A;  4DGZ A;  1ZEQ X;  3HOY H;  3IFD A;  3TP8 A;  4QF4 A;  1Y1V H;  2KHS A;  2IWH A;  5J39 A;  2UUC Q;  1VQA A;  1PH4 A;  5M3F B;  4ZRZ A;  1VQK A;  3PIO 3;  4R4Q A;  5LMN W;  1V1Q A;  2ICI A;  1D5M C;  4POF A;  1SYD A;  2QDL A;  5JPM C;  3HZX A;  1EY0 A;  3EA6 A;  5K36 G;  2PYK A;  2UUB L;  1NSN S;  2BOS A;  1BCP D;  4B3S L;  4HMJ A;  1EQT A;  5CBA E;  1KAW A;  4L63 B;  4ZLT F;  5GAE C;  2F0N A;  4B9W A;  3PUZ A;  3RN5 A;  2QIL A;  3HOU H;  1XMO L;  1VMP A;  1BBU A;  1QNU A;  2AUK A;  1PZJ D;  4DV6 L;  5CGK A;  5C3E H;  3KFU A;  3SDZ A;  3K8A A;  2RVL A;  4IPG A;  5C4J H;  3NP8 A;  1FL0 A;  1PTO C;  2OT2 A;  1W2B A;  5M5Y B;  2L12 A;  1PYS B;  3M3Y B;  3K7A H;  2NZO A;  1G8Z D;  1SYG A;  1PH1 A;  1NBW A;  4H7B A;  4C3I H;  1SJH D;  1IBK Q;  3UI2 A;  2CH4 A;  2RCN A;  4A3G G;  4GOP C;  1EFW A;  4IUQ A;  1NY4 A;  1BVS A;  1UNS A;  4LW1 A;  1LT3 D;  2A73 B;  4WOR A;  4X6A H;  4DV7 L;  3CC4 A;  4XQN A;  5IGD A;  4MNO A;  4LF8 L;  4NXN Q;  4OL7 A;  1K0S A;  3G4S A;  4JI2 L;  2VUM H;  1VS0 A;  1YEZ A;  3H0G G;  1W3S A;  4YY3 L;  5I4D A;  1VQF A;  1LT4 D;  1VQM A;  1SEB D;  3KF6 B;  2F0O A;  3RR5 A;  2Z6K C;  1BCP F;  3I90 A;  1MKH A;  4BBS H;  3EBE A;  5JEA G;  3I4L A;  4FP5 D;  4ILW A;  4ME3 A;  4JI4 Q;  1JT8 A;  1WTX A;  1ILP A;  4U67 3;  3KUP A;  4DV0 L;  3D31 A;  2JA6 B;  2SEB D;  2DJG C;  3CCL A;  3J81 L;  1J9O A;  3A8I E;  4DKA C;  3UE1 A;  3HRZ C;  2CQA A;  1IW7 D;  5I2X A;  4DR7 L;  3IFT A;  3GTQ B;  2FIN B;  4RWS C;  5CYU A;  1Y1W G;  4P75 A;  5FLX E;  4FXG C;  2YV5 A;  3L7Z C;  1I94 L;  2QW7 A;  4DAV A;  1SFO B;  2DY7 A;  3G6J B;  1DM0 B;  2HT1 A;  3GP7 A;  1KRT A;  5EPJ A;  4C3I B;  2Y0S G;  1HZ9 A;  1OXS C;  4IUP A;  3A7L A;  4EQ5 A;  2OTL A;  1JJ2 A;  4R4I A;  5HUR A;  5LMN L;  2VB3 X;  2WV6 D;  3GO5 A;  3FRP B;  4G57 A;  2C9O A;  3HOU G;  3GV3 A;  3R2I A;  1KDA A;  4YIJ A;  4LFC Q;  4JI6 Q;  4DR6 Q;  1Q7Y C;  4B3R L;  4HJA A;  1OXV A;  2KBN A;  4A3B H;  2OEO A;  5JJZ A;  1UE7 A;  2E2H B;  5GAD C;  2F0E A;  1A3V A;  1H9S B;  3LX0 A;  4LF9 Q;  2PW7 A;  2PO4 A;  2JYO A;  3PF5 A;  1T5X D;  2YTV A;  4JBW A;  1YHB A;  2JA5 H;  3TZU A;  4DXG A;  2CW0 C;  1EIF A;  1YJ9 A;  1X56 A;  1RIP A;  1ZYR D;  2QEX A;  2JJQ A;  2ATW A;  3TRZ A;  4DV1 L;  1WTV A;  3RUZ A;  1W6K A;  1YZ6 A;  4ZUJ A;  3BU2 A;  4RCN A;  1B44 D;  2CWA A;  1W6J A;  2E2H H;  2A74 C;  2A68 D;  4PNY A;  1PHJ A;  3I4O A;  3KJO A;  1A8V A;  4A3D H;  4LF5 Q;  2ZM6 L;  3PUV A;  4K2L A;  4X3K A;  1VF7 A;  3O13 A;  4CJ2 C;  1SMY C;  4QGU A;  4DR4 L;  3S2H B;  4HED A;  4X62 Q;  3PO3 G;  1IYJ B;  1X32 A;  1CSP A;  2HIX A;  3M7G A;  4A4I A;  4DNT B;  1BOS A;  3SR1 A;  3K5O A;  5KEE A;  5C3E G;  4JI1 Q;  5IYB G;  1C4Q A;  2EY2 A;  5JOB A;  4F87 A;  1LTT D;  1D2B A;  4GKK L;  4GN5 A;  4ID6 A;  2O2L D;  3K80 C;  4UHV A;  1JE5 A;  1C48 A;  3MZ5 A;  1JWS D;  1ESF A;  1TWA H;  4DR1 L;  2PNH A;  3FVQ A;  3OWF A;  2JEA I;  4QIW E;  3S17 H;  2EOT A;  3KJP A;  3ICE A;  1XMQ L;  1A6X A;  1DXM A;  3J7A V;  1KTK A;  1I6H H;  1A62 A;  1R9T H;  2K1B A;  1EU4 A;  3FP9 A;  3HEJ A;  1H95 A;  2DY8 A;  4UP8 A;  1WI5 A;  2WB1 G;  1RCV D;  2RCF A;  4JI1 L;  2VB2 X;  4OO1 H;  1JIC A;  5A35 A;  4GNX B;  3N52 A;  5DLQ E;  1I4P A;  3CF5 A;  3GTK H;  1EYC A;  1STY A;  5E7N A;  5G3L D;  4L5T A;  4J15 A;  5IT9 c;  4A3J H;  2IHE A;  2J0T D;  3CCR A;  1BDO A;  1FGU A;  3H3V C;  5D65 A;  1K8G A;  2A68 C;  3TME A;  5FOB B;  1VQC A;  2YTY A;  4A93 H;  2F0J A;  5M5Y H;  1Q1B A;  4G4K A;  1YIT A;  1U0L A;  1ET6 A;  1ET9 A;  3S9W A;  1B3Q A;  2A6H D;  3K58 A;  3G48 A;  4P73 A;  4QMG A;  1YVC A;  1UE1 A;  4FO2 A;  1HQM C;  3J80 L;  1WVL A;  3S1R H;  2WAQ E;  5M5X H;  4LUV A;  1PZI D;  1I50 H;  1TS2 A;  1JJC B;  4IOC A;  5M3F G;  4HJ5 A;  1E22 A;  1TWF B;  5CV7 A;  4DR3 L;  2UXC Q;  2KCC A;  1ICW A;  4BBR G;  1GM5 A;  1AE2 A;  1SND A;  3S14 B;  3S17 B;  1PFB A;  3BVM A;  1L0X B;  4ZCK A;  2F03 A;  3BDC A;  2KHI A;  1AZP A;  5BR8 L;  4LF4 L;  1SAP A;  1TY2 A;  1HRJ A;  4Y52 H;  2CKZ B;  4M8A A;  2NBF A;  1JC7 A;  3J80 i;  2Z6B A;  1PFS A;  2I0Q A;  1B8A A;  4O0A A;  3GTJ H;  4LAA A;  5LMU L;  4TSS A;  4KKT A;  1YHQ A;  4LUZ A;  5M3M G;  2B2U C;  3ULL A;  4PV1 C;  1LYL A;  2ENB A;  2MO0 A;  4E6I A;  1DYQ A;  4WJ3 M;  1ENC A;  1E7Z A;  5EGT A;  2K52 A;  2HDL A;  4JI8 L;  3GTM B;  1I4G A;  1PTO H;  4JYA L;  2F0F A;  4RHR A;  4QQB X;  2NVQ B;  3ZJY C;  1S40 A;  2K7V A;  3GTG B;  5IGE A;  3GTK B;  3GTL H;  4I7A A;  4XT3 B;  4DV6 Q;  2JA6 G;  5FLM G;  3OTO L;  4DR4 Q;  2N49 A;  3SK8 A;  2IW3 A;  1Q8I A;  4A3K B;  2N78 A;  1PH2 A;  5BR8 Q;  3NQT A;  1YJN A;  5IYD H;  2F0K A;  4FDB A;  3GTO H;  3F2U A;  4IPC A;  1EQR A;  2R6G A;  3RZD H;  3GDE A;  4H44 C;  5ELC A;  4FF2 A;  4DK0 A;  2B2V C;  2CHB D;  1IL2 A;  3HOV B;  3LNN A;  4XYO A;  1SE4 A;  1C7Y A;  3CRK C;  4C1N K;  3MAQ A;  4DPG A;  1AFP A;  2RA4 A;  2R7D A;  4EVO A;  3Q22 A;  1PA6 A;  4DN4 M;  5FLX c;  1XMQ Q;  4DK3 C;  1SNO A;  3HOY G;  5IP9 H;  4IPH A;  5JJK A;  5CV4 A;  1I6V C;  2NUC A;  4HTH A;  5HGT A;  3QWN A;  1QNK A;  3R3O A;  4RGM A;  2WB1 E;  4OWX B;  2KEC A;  2B8F A;  3MXP A;  1YI2 A;  2R92 G;  4A3K G;  1HZB A;  2KA7 A;  2N8N A;  1SN8 A;  5JPN C;  2B2Y A;  4J1M A;  1Z47 A;  4DAY B;  2N3S A;  1X55 A;  4N8X 1;  2F4V L;  1ROD A;  2LXJ A;  4R4C A;  4YWL A;  4FXD A;  2Q8T A;  1JJG A;  1N33 Q;  2B2T A;  5ELE A;  5C4J B;  5KYL A;  1STG A;  1YNN C;  1JWU D;  4P2C B;  1CZW A;  4B3M L;  2NTS A;  4BXX G;  1XNQ L;  1WTH A;  1CUK A;  3ULP A;  4OXP A;  2M00 A;  4C2M H;  3AFQ A;  2IJ0 A;  1EZ6 A;  4LFB Q;  1QVG A;  2F3V A;  1WTQ A;  3IKJ A;  2RDG A;  2Q2U A;  4A3G H;  3JAM E;  2B29 A;  2LFN A;  2OF1 A;  1WTO A;  4NMZ A;  1WTR A;  3S2D H;  1MSG A;  4B3R Q;  2EYL A;  2JN4 A;  3BG3 A;  4S3S A;  1PH6 A;  4A3B B;  3KLR A;  1STH A;  3AFP A;  4OIJ A;  2OCE A;  3GTO B;  2IX1 A;  3OMG A;  3I3C A;  2B63 G;  4A75 A;  4V19 0;  4OON A;  1X3E A;  1Y14 B;  1ZKO A;  3OWE B;  3MHB A;  1G6P A;  3PQI A;  1FNU A;  2R7F A;  4DUZ Q;  3GTG H;  4HJ8 A;  2I46 A;  2D2C C;  2IX3 A;  4A3M H;  4B3T L;  5IIF A;  1SBB B;  3SEB A;  3KK7 A;  3D4W A;  1E2W A;  1D1I A;  1H9R A;  1YNN D;  1SYE A;  2QA4 A;  2IHF A;  2A6E D;  2QF7 A;  3S15 B;  2L5T A;  3MVV A;  3RMH A;  3X3N A;  1NMF A;  1SRO A;  4DV7 Q;  4OEL B;  1SFO H;  2PQA B;  4HIO A;  1M8A A;  1PH7 A;  2DJF C;  2E2D C;  1NR2 A;  1F2Z A;  1HZC A;  5FLM H;  1FGB D;  5D3I B;  4BY7 H;  1IL8 A;  3DEP A;  1FVI A;  4DV3 L;  2SNM A;  5I6W A;  1YHA A;  2K5Q A;  2JA9 A;  2ALY B;  2V4D A;  4A3I G;  3I4N B;  1EYG A;  4BBS G;  3J80 c;  1WCM G;  4GLX A;  1X9N A;  1A2U A;  3H3V H;  2VQE Q;  1PDQ A;  4P74 A;  3ITP A;  4K2K A;  4XXE A;  5BN3 A;  3OW7 A;  1LV9 A;  3KF6 A;  1QCB D;  1K8O A;  2L15 A;  5C44 H;  1I5F A;  5F2D A;  2Z9H A;  2SDF A;  5GQO A;  1AH9 A;  4JPB W;  3HOW B;  1N32 L;  5HGQ A;  3EIV A;  2F52 A;  1D7Q A;  4DUZ L;  5DNF A;  4GS3 A;  4JBM A;  1BKB A;  4RKL A;  4RH6 A;  1F9R A;  4PZ7 A;  1N36 Q;  1OXU A;  3L0O A;  1MIU A;  5ELB A;  2QEJ C;  1LTS D;  1SYC A;  4DF7 A;  4RAU C;  4BBS B;  2L11 A;  3D4R A;  1Q1E A;  1B4O A;  4HJ9 A;  2UUA Q;  1Q12 A;  1PYB A;  5C6A A;  2BH8 A;  4FYD A;  4POG A;  3FMC A;  2D5D A;  2C35 B;  3KOJ A;  1XTD A;  1X3G A;  2BA1 A;  2I5H A;  2J4X A;  1EY8 A;  4XYQ A;  4AQY L;  5A2Q E;  3ERO A;  2HDM A;  1YNJ C;  3VR3 A;  3CP0 A;  5C5M A;  4K8I A;  4KHZ A;  4A3M G;  5C4Z A;  3FKI H;  4RGT A;  4WRD A;  2VQF L;  3A55 A;  3CCQ A;  5C4X G;  4JI7 Q;  1HQR D;  4JW0 A;  5TSS A;  1VQD A;  5FO8 B;  2K5N A;  2WKC A;  4UY8 C;  1F9P A;  3OPO A;  2EZV A;  3WDN A;  4MZ9 A;  2E76 C;  2XN9 C;  1PRT C;  1S5C D;  4DR1 Q;  4X65 Q;  4WJ4 A;  4IFD J;  4F8M A;  3BYY B;  2GVB A;  1E24 A;  2AKW B;  3W1G A;  1KAA A;  3HOY B;  5C44 B;  4LF5 L;  2LS0 1;  1RD9 D;  3JAM c;  4BY7 G;  1VQ5 A;  5KGU A;  5BN4 A;  1B3A A;  1C0A A;  5FKA C;  4A93 G;  3I91 A;  1OXT A;  2FXQ A;  4Z9C B;  4C3J B;  1VCI A;  5KIX A;  5IGC A;  4A3I H;  1EY9 A;  4NW2 A;  1HPC A;  1STE A;  1KNE A;  2PI2 E;  3EFX D;  1HFG A;  2F0D A;  4R4T A;  2K5D A;  5E1F A;  5JJL A;  5KNC A;  1RF2 D;  4IQZ A;  1AW7 A;  2PPB C;  5FJ8 G;  1VQ4 A;  1A2T A;  3TS2 A;  1I4Q A;  3K81 C;  4JOI A;  4QJF A;  2L4N A;  3OHX C;  3I4M B;  2JXM B;  2L9H A;  1VQN A;  1CHP D;  3T1Y Q;  2C5C A;  3QJY A;  1CKO A;  3M4P A;  2F0I A;  4GLA C;  1CHQ D;  5EJW A;  3DHQ A;  3KBX A;  1VQJ A;  4PQX A;  1XNR Q;  3E5S A;  1KDB A;  5LMU Q;  2HUG A;  1M90 C;  4FF1 A;  1SNP A;  3CHB D;  4YWK A;  2VW9 A;  2MJ8 A;  3SK6 A;  2XGT A;  4X66 L;  3KF8 A;  3PO2 H;  5LMN Q;  1EEI D;  1QOH A;  3Q24 A;  3KLS X;  1PFM A;  2HD3 A;  3A5Z B;  3EQL C;  1GUW A;  3G71 A;  2HQE A;  1K0R A;  4JI4 L;  3DUZ A;  3KLW A;  2PCF B;  1GXD C;  1HFN A;  3FKI G;  2BDN A;  2EYH A;  1QG7 A;  3S16 H;  2OQ0 A;  1R9T B;  3IAY A;  3DWQ A;  1U9R A;  1GUN A;  4J8Q A;  3NEM A;  4X3S A;  2H5X A;  4A3F H;  1GVP A;  3TP7 A;  3CC7 A;  2NZ1 D;  2EJM A;  4C3H H;  1N36 L;  1ASY A;  4JI7 L;  1JQY D;  4A3C H;  2EYO A;  1J8I A;  1E0B A;  2KCT A;  2K28 A;  2PNR C;  1O7I A;  2AWN A;  2K4K A;  2XTI A;  2E2I H;  3BVG A;  3BZC A;  1HUM A;  4JG2 A;  4IUT A;  4HID A;  5EAY A;  1MHW C;  1K83 H;  1O7L A;  5IGB A;  2ZJP A;  1EOT A;  4KI0 A;  1CKM A;  3KF8 B;  1RJT A;  4LF8 Q;  1PH9 A;  4LFC L;  1TS5 A;  4RCO A;  4G7O C;  3VYT A;  3C1F A;  2GA4 B;  4A3G B;  1B1Z A;  2BE5 C;  4QB4 A;  4YY3 Q;  5M3M H;  1NTG A;  2WB1 B;  2DNC A;  2E2I B;  2JA5 G;  2WAQ G;  3CAM A;  5IP9 G;  2CFM A;  4HSV A;  1FJG L;  3U50 C;  2X6L A;  2E8G A;  2E2J H;  2ES2 A;  1RHP A;  4R1J A;  1KNA A;  3NK9 A;  4K14 A;  1Z9F A;  3HKZ B;  2PZW A;  3D6W A;  1LUZ A;  1T5E A;  2WAC A;  3C3L A;  2LMC B;  3U9S A;  3FEW X;  3K6O A;  1CQV A;  1XJV A;  2F4I A;  2XIW A;  4IJL A;  4GZY C;  5GAG C;  4MTN A;  1TT2 A;  4PZ6 A;  2MP1 A;  1AE3 A;  1IHZ A;  1IBM Q;  4LF6 L;  4JI8 Q;  2GVA A;  5IE8 A;  3Q6S A;  1H9S A;  5J3B A;  3BJU A;  4AIM A;  3HOX H;  3M4Q A;  4HCS A;  4DR2 L;  2K04 A;  3U4Z A;  1WCM B;  1E2V A;  4CJ1 B;  3I4N G;  3BYT B;  4YHH Q;  3T1H Q;  4JI5 L;  4OO1 I;  3CCU A;  1ENF A;  4UP9 A;  2MPM A;  1VQH A;  4UAI A;  3W2D A;  1VQG A;  2ZM6 Q;  3SK5 A;  2MQH A;  4JI0 L;  1CA6 A;  1XPU A;  5CV8 A;  1XPR A;  5ELN A;  1CQF A;  2IL8 A;  4A3L H;  4BBR B;  4KV6 A;  3MFG A;  1UUP A;  5C4H A;  4B3M Q;  1HR0 W;  2EYM A;  2F0T A;  3OYY A;  3CD6 A;  3I4M G;  4GNX C;  4LK1 C;  1JB7 A;  3I7F A;  1HJP A;  1SSO A;  1EYD A;  3NQI A;  1Y8N B;  5IOC A;  4UDU C;  1GO3 E;  1U4P A;  3S1M B;  1E1O A;  4R4O A;  3M3Y H;  3LWE A;  5J22 A;  2K6A A;  3V2T A;  4KKS A;  1CZG A;  4R9W A;  3T1Y L;  2B8G A;  3HG9 A;  1XTC D;  1KD1 C;  2ZXR A;  3H91 A;  1EY5 A;  3BDO A;  1GUG A;  2F1M A;  1QIL A;  4IOA A;  5IWA Q;  1SLJ A;  3E0E A;  3F8T A;  4BA1 I;  4TVA B;  3NBH A;  4BY1 H;  4NPS A;  3K0X A;  2Q2H A;  4ME5 A;  1WTW A;  3D8G A;  2G5D A;  4RFB A;  2Y0S B;  1HHV A;  3QOJ A;  3HOU B;  1AZQ A;  1PFN A;  4GNX A;  1DOM A;  1TWC H;  1XXG A;  3E6Z X;  3GTJ B;  1EWC A;  2BA0 A;  3L2P A;  3HOZ B;  2XWB B;  5KYI A;  3GTM H;  2R61 A;  5IGF A;  3HFZ B;  4JBK A;  2NVQ H;  2TSS A;  4JBJ A;  1V8Q A;  4A3F G;  3AU7 A;  4FF3 A;  1Y8P B;  2NVY H;  3JAM L;  1GUS A;  4ZYS A;  1F2Y A;  2KED A;  3ZYY X;  4DFA A;  5C4X B;  3DEO A;  2RSO A;  4ALP A;  4JV5 Q;  2A69 D;  4LF7 Q;  2NVX B;  4RHS A;  2IX0 A;  4YHH L;  4UPA A;  4LFA L;  3RLF A;  1O78 A;  4RGO S;  3F1Z A;  2ZXP A;  3CCJ A;  3S1R B;  5AFW A;  4BY7 B;  2NN6 I;  1N9W A;  4JI0 Q;  2EE1 A;  3U9O A;  3PO3 B;  3FPU B;  2F0W A;  3I4N H;  1CK1 A;  2Y0S E;  3H15 A;  3G6E A;  4OX9 L;  2NN6 G;  2B2V A;  1SXT A;  3M4O H;  1JOQ A;  1L0Y B;  1G51 A;  3HOV H;  3W3A A;  5IYC G;  3TS0 A;  4I7Z C;  3KDF A;  4BS9 A;  4A3L G;  1SNQ A;  1CT1 D;  1DGS A;  2R92 B;  1Q86 C;  3H94 A;  5JVG 3;  1PH8 A;  3PCO B;  3T13 A;  3TP5 A;  3VA5 A;  4HMI A;  3NTK A;  3NBI A;  4AH6 A;  4FNF A;  2OQK A;  3NWT A;  1I94 Q;  3IRB A;  3PSI A;  1IBM L;  3CMA A;  4OGQ C;  3T16 A;  1I50 B;  3PV0 A;  4HR7 B;  1GD7 A;  1QB5 D;  1S5B D;  2L55 A;  2EJG C;  5LL6 S;  4A3I B;  3F2B A;  1K83 B;  3TRE A;  1WD1 A;  5I9P A;  5D14 A;  4N8F A;  5KND A;  2PZU A;  3UDF A;  1MD2 D;  4K8J A;  3V05 A;  4IFD I;  2YTX A;  3ER0 A;  2MFI A;  3V96 A;  3MXN A;  3J7A F;  5IYD G;  4QIW B;  4JYA Q;  3DXJ C;  1Y1V B;  4ZKC B;  4EQO A;  3H6M A;  2N55 A;  5DM7 3;  1KXL A;  3VYR A;  4JVZ A;  3SK4 A;  3A74 A;  2UUB Q;  2B2Y C;  2FMM A;  1PZK D;  3DLL A;  4KMU C;  1UE6 A;  2DUD A;  1J5E L;  2VL6 A;  3SXH A;  3S1N H;  5LHY 1;  3TBI B;  5C4X H;  5D3D A;  4DV4 Q;  3A8K E;  3PMF A;  3LWU A;  2BDO A;  1VQ7 A;  1UAP A;  3D6C A;  3PIO A;  1KC8 C;  3B6Y A;  1BCP C;  2UXD Q;  2RHS B;  4CDC C;  1HNZ L;  2F0L A;  2F3I A;  2PI2 A;  1N8R C;  2YU9 H;  3AQQ A;  1B9N A;  4H02 A;  4YCW A;  3HGB A;  3R8B A;  1SE2 A;  4GOP B;  1M4V A;  5JVH 3;  1TS4 A;  2AWO A;  2MO1 A;  4ZAI A;  1PVO A;  2K01 A;  1UEA B;  4OWT B;  4ZK9 B;  2Z1C A;  1VQL A;  1S5D D;  3L3O C;  3SGI A;  1DJR D;  3WOF A;  4A3E G;  3HOZ G;  1HNW Q;  1VQP A;  4MN3 A;  4EQN A;  4A3B G;  3QB3 A;  4PG3 A;  1FYC A;  1PMR A;  1TII D;  1UWV A;  5KNB A;  1D6E C;  1PRT B;  2BCO A;  2A6H C;  3S2H H;  4A3E B;  2NYZ D;  3CXC A;  4HN7 A;  4K0K L;  3KDF B;  3A7A B;  4KY5 A;  1L0W A;  1L1O A;  2K5H A;  4JI3 Q;  1H9M A;  3I8Z A;  3W5O A;  1HNX Q;  2PZT A;  5FJ8 H;  4B9X A;  3OMC A;  2WKD A;  2K75 A;  2Q2T A;  1XX8 A;  1HA5 A;  3I2Z A;  2Z0S A;  3M4O B;  5JJI A;  1GJX A;  2JP1 A;  1U4M A;  1U4R A;  2RBM A;  2RKS A;  3RLO A;  4XTC S;  2JA8 G;  2HQL A;  2L1B A;  4LJZ C;  1D1K A;  2KQ3 A;  4A3D G;  2NZH A;  4KD4 A;  3VDY A;  3ERQ A;  2P5Z X;  3CPW A;  1RTN A;  1OTC A;  4BWG B;  5T1G A;  1XNR L;  4C3J G;  4G7Z C;  1L2F A;  2D62 A;  1NAP A;  3PO2 G;  1DON A;  1VQ9 A;  1N34 L;  2VUM B;  2BH2 A;  2KOL A;  2B39 A;  4B3T Q;  3SVM A;  2EXD A;  3WOE A;  4GKK Q;  1EWH A;  2QGQ A;  3GV6 A;  1EFI D;  2KJX A;  5HY6 A;  3PUY A;  4IUU A;  4C1N I;  4IFD G;  1D5X C;  3VYS A;  2QDB A;  4C3H B;  3M4Y A;  3T51 B;  1G2T A;  5H1S E;  3P20 A;  4JV5 L;  1HNW L;  4IUN A;  5E4X A;  1IYV A;  4OIK A;  3I70 A;  1STN A;  2R93 B;  2PMZ E;  2WFW A;  1X3F A;  1WD0 A;  1VMC A;  1G2S A;  1JWM D;  3HOW G;  1B7Y B;  3U58 A;  1A0I A;  2MUY A;  4O1N A;  4B08 A;  3S1Q B;  4DR6 L;  3T4A C;  4KKU A;  1NJI C;  2R93 G;  3PO3 H;  5GAH C;  4P71 A;  4A3E H;  1HUN A;  2R3Z A;  1DCZ A;  3CME A;  1WJJ A;  2JA5 B;  4RMF A;  5DM6 3;  1XYI A;  3K5L A;  1EIH A;  3OIP A;  1JMC A;  3CC2 A;  2WP8 J;  4IAL A;  3NEN A;  3J7Y W;  2B2T C;  4KD3 A;  1HTP A;  1OO9 B;  1ONL A;  4FXK C;  2NWG A;  3U4V A;  3OOC A;  5C3X A;  3RN2 A;  1WYD A;  3S1Q H;  3HKS A;  4U68 A;  2AHO B;  2E2J B;  1PTO D;  4H13 C;  5IGG A;  1ICF B;  4LF6 Q;  4ULL A;  3PUW A;  1GHJ A;  1S3O A;  4QUF A;  4DR2 Q;  4KHP L;  3NTH A;  4ZQ3 A;  1IXR A;  2Q8I B;  2HHH L;  1MJC A;  4PMW A;  1A63 A;  2I5M X;  1X3P A;  1GKH A;  1NR4 A;  2VS1 A;  5J1Z A;  4F88 A;  2HIV A;  4F7X A;  3H09 A;  1X54 A;  1N32 Q;  3FHW A;  2K5V A;  5CV5 A;  1SRU A;  3GTP B;  4DR7 Q;  1BF4 A;  1QUQ B;  4QUC A;  4X64 Q;  3NXW A;  1B53 A;  2ZTC A;  1XPO A;  4C3J H;  3E3X A;  3K7A B;  5ELF A;  2F0S A;  4K5W A;  4KJO A;  3MA2 B;  1XMO Q;  1Q82 C;  1VQI A;  1U5K A;  1LTA D;  5CV6 A;  3BDL A;  1F9S A;  4GKJ Q;  3CU7 A;  4DK1 A;  1SYF A;  3QR8 A;  3MFY A;  1D5Z C;  1EU3 A;  4TRD A;  1X65 A;  2EYJ A;  2MGS A;  2X6G A;  4V0B A;  4DV0 Q;  1IZ6 A;  1HNX L;  2AQ1 B;  4DV5 Q;  4C3I G;  5EBC A;  5FK9 C;  2KUM A;  2M9V A;  1AEX A;  4IPD A;  1LO5 D;  2XWJ B;  1ASZ A;  3GTP H;  2XVS A;  1CKN B;  2ASB A;  2DGY A;  4CKB A;  3I4M H;  3C1E A;  1NNX A;  4NP5 A;  1BNZ A;  2JQO A;  1VQ8 A;  1SE8 A;  3PIP 3;  2RHQ B;  2EJF C;  3JAM i;  4HSP A;  4PZ8 A;  1B50 A;  3HOW H;  5K36 H;  2Z4H A;  4G7H C;  1LTR D;  1PV4 A;  5DEH A;  5FO7 B;  3VA7 A;  2JE6 I;  4GKJ L;  1BCP B;  1CM9 A;  2K05 A;  1LM0 A;  1RKN A;  4BA2 I;  3T53 B;  1Y1W B;  2SNS A;  3STB C;  4AYB G;  1EL0 A;  2XNA C;  3NEL A;  4DU9 A;  1F2L A;  4AYB B;  3K5N A;  1S4Z A;  1EIY B;  1V43 A;  3A54 A;  3NUC A;  4X3T A;  2G9H D;  1IBL L;  4L6T B;  1CSQ A;  1QVC A;  4ODG A;  4HAE A;  5COR A;  4CDE C;  4IO9 A;  5L37 A;  1T9H A;  1PYW D;  1IYU A;  2B2W C;  1QZH A;  1Y69 U;  3S2D B;  4QCL A;  3MWY W;  4Q0F A;  1GUT A;  2AQ3 B;  1SNM A;  2DN8 A;  5IP7 G;  5ELD A;  1B70 B;  1JOO A;  1PTO F;  5FO9 B;  2N88 A;  4DUY Q;  3X3M A;  2GN5 A;  2F0P A;  2K5W A;  2NTT A;  4DV2 L;  2JK8 A;  1KRS A;  1U4L A;  2OXP A;  2HHH Q;  3QG1 A;  4WJW A;  1JE4 A;  2O5I C;  1Y1W H;  4RKB A;  5M5W B;  3ND8 A;  5EPL A;  2JA7 B;  5NUC A;  3TDQ A;  1P16 A;  1A3T A;  2LXK A;  2A8V A;  1TU2 B;  2A1A A;  2WII B;  1TVX A;  3E9H A;  1TR5 A;  3D0F A;  1K28 A;  3CPF A;  3NSW A;  4A3M B;  4OX9 Q;  2NVX H;  1TWH B;  2FMC A;  1ZYR C;  3VR5 A;  4X3U A;  2E74 C;  1BO0 A;  3IL8 A;  2D9U A;  4LF7 L;  1IW7 C;  1V1O A;  5CBE E;  5JAV A;  3QIA A;  4J6H A;  3MEH A;  1QUQ A;  2ID0 A;  5I6Y A;  3SHL A;  5JEA J;  3EVQ A;  2NN6 H;  4BXX H;  3CQZ H;  4C56 C;  3DM1 A;  2IY5 B;  3S14 H;  3K57 A;  2KEN A;  4CBV A;  1Q46 A;  1F9Q A;  3JC6 6;  5ISR A;  1V1P B;  2K14 A;  5C0X H;  4KJN A;  1YNX A;  1Q8K A;  3VR2 A;  4WFN 3;  3BS1 A;  3M7N A;  5AJ3 Q;  3DM3 A;  5EBD A;  1KLU D;  5C3W A;  4A3C G;  5BN5 A;  2VXW A;  1TWG H;  3TSS A;  4A3D B;  3CKI B;  4N9P A;  1SDF A;  1TS3 A;  2J7Z A;  2WAQ B;  5C0X J;  4OEM B;  2DNE A;  4R8I A;  2F4V Q;  4DNR B;  4KTA A;  2CCZ A;  4Q5V A;  4XT1 B;  2JA7 H;  2R7Z H;  2UXB L;  4DUY L;  4OWW B;  2F0U A;  2F0Q A;  1QZG A;  3K5M A;  2B63 H;  4LF9 L;  3VYU A;  1EZ8 A;  2JEB I;  3UDI A;  4LUO A;  2M2L A;  3OSO A;  1PH5 A;  4PMB A;  3J7Z C;  3NHH A;  2E5L L;  1TXY A;  1YNJ D;  2K33 A;  3PO2 B;  3G7L A;  1II3 A;  2TMP A;  4LFB L;  2I5L X;  1P8L A;  3BZD B;  3K0Y A;  2EQS A;  4DXF A;  5IY0 A;  1E1T A;  1S5F D;  3GTQ H;  2VY3 A;  3S1N B;  1EY4 A;  3NWS A;  4LF4 Q;  2RSN A;  3LGJ A;  4C3H G;  2A5H A;  2LSS A;  2A69 C;  3URY A;  1K8M A;  3MXU A;  3VR6 A;  1K73 C;  1G29 1;  2F0M A;  4DV3 Q;  3J81 i;  1RTO A;  1NE3 A;  1JB3 A;  2EDG A;  2KVM A;  3NTI A;  1NMG A;  1DOL A;  1AN8 A;  1KLG D;  3FKI B;  4OO1 G;  1N34 Q;  3HOX G;  1E3P A;  3ONA B;  3RNU A;  1VF5 C;  4XIG S;  2HCI A;  4O42 A;  2A6E C;  4X64 L;  2D0O A;  3GQB A;  2PMZ B;  3AB9 A;  4JCV E;  3F2D A;  1PLF A;  1FNW A;  3VR4 A;  5ELO A;  4IZ8 A;  1I6H B;  1IKL A;  2QKI C;  3P7J A;  4KY6 A;  4JI3 L;  3NPP A;  5IT9 L;  5M9O A;  2HCC A;  3EJI A;  2K32 A;  5EQ0 A;  5EPK A;  3OIQ A;  3AEV A;  1XWE A;  2F0H A;  4QY7 A;  1Z6H A;  2X69 A;  5IP7 H;  3P75 A;  1S5E D;  1Y1V G;  2UXD L;  1V1P A;  2PQE A;  3DWP A;  1SMX A;  5C0X G;  3OTO Q;  2F0G A;  3EN2 A;  1TQO A;  2KCM A;  3CCS A;  3UDX A;  2FJ2 A;  1G6Z A;  5C44 G;  1MJE A;  1X6O A;  2O4X A;  3MXN B;  3PGZ A;  5G3L F;  1RL2 A;  3I72 A;  5E4W C;  4GN3 B;  3D3R A;  5M3F H;  4L5Q A;  2NVY B;  4AQY Q;  3C46 A;  4H0L C;  2CQO A;  3TP6 A;  4NXN L;  2JA8 H;  2R7Z B;  4MIU A;  4JI2 Q;  1JR0 D;  1CA5 A;  3AYH B;  2OWO A;  2B63 B;  2IT1 A;  2ZXO A;  2AUJ D;  2Q8R E;  3KBG A;  3T1H L;  4QL5 A;  1VQE A;  3RZO H;  4FVM A;  4GLV B;  5CC4 A;  4KK7 A;  3AMU A;  3E9I A;  1HNZ Q;  1BUV T;  1KL9 A;  1UEB A;  1SJE D;  3H0G B;  2CVR A;  2ZJR A;  2H1E A;  4MTK A;  4RA8 A;  4TKO B;  4FF4 A;  4XQQ A;  2FFK B;  2RDH A;  1TWG B;  1WCM H;  1TWF H;  2Z6K A;  5C3E B;  2PW5 A;  3W1B A;  4ABN A;  4KLK A;  1I4X A;  2NVT B;  2XRQ D;  1X3Q A;  1GHK A;  1S72 A;  1ILQ A;  4P72 A;  2LKV A;  1SR3 A;  4ZKB B;  2KHJ A;  2ZTD A;  1C8C A;  4TQU S;  3NBH B;  2JSO A;  4LMQ D;  3QO2 A;  3K7U C;  5LL6 X;  1JOR A;  3P1H A;  1PH3 A;  4BY1 B;  1CI3 M;  3H3V I;  4K5X A;  1FNV A;  3PUX A;  2VUM G;  3HKZ E;  3WWV A;  5IOD A;  1NUC A;  2RDF A;  1I4R A;  2EIF A;  3Q8D A;  5CMD A;  1KQS A;  1TWH H;  3ULJ A;  1TY0 A;  4A3J B;  4IUR A;  4A93 B;  2OTJ A;  3S1M H;  4DR3 Q;  3Q23 A;  2RQX A;  4KN7 C;  2JA8 B;  1PTO B;  4Y7N H;  1K8A C;  4BY1 G;  3BVZ A;  2K03 A;  2EY6 A;  3CRL C;  1O7Z A;  3J81 j;  3HOX B;  3CCM A;  3HOV G;  1RDP D;  2PQA A;  1DZ1 A;  1BBX C;  4KY7 A;  4I65 A;  1KAB A;  4DV1 Q;  3M9B A;  4OHJ A;  1HA6 A;  4HCE A;  5K5P A;  3L9A X;  4R8N A;  1A15 A;  4IJH A;  5C0X I;  3KLS A;  4LNQ A;  4KHP Q;  1M1K C;  3MC0 B;  3TN2 A;  3CCV A;  5CV9 A;  1LT5 D;  1VQB A;  5EKL A;  1LTI D;  3SE0 A;  4DAP A;  2EVB A;  4MHE A;  4IFD H;  1MSH A;  4EQP A;  4APV A;  2XSC A;  3PIP A;  3RZO B;  2G9D A;  5FLX L;  2B3G A;  3MEF A;  4UP7 A;  4LWC A;  1EOV A;  1HH2 P;  1UE5 A;  5I9O A;  4PMC A;  3ERS X;  3PF4 A;  1BBW A;  2H4O A;  1EY6 A;  1QVF A;  1GUO A;  1AP0 A;  2WIN B;  4EGV A;  1LT6 D;  3A0J A;  4KN4 C;  5IYB H;  3Q0A A;  2E5L Q;  2ICE C;  3TZD A;  5E3F A;  2AMC B;  2VQF Q;  1GOZ A;  4X65 L;  1O80 A;  2EY1 A;  5IYC H;  4IN3 A;  4XQJ A;  4HIK A;  1NCV A;  1YJW A;  1G91 A;  4AYB E;  3A5U A;  2F3W A;  3J7A 5;  1LTB D;  5A2Q L;  3RD4 A;  4YCU A;  2I07 B;  1HR0 Q;  4NKL A;  1I4H A;  4DR5 Q;  1R4P B;  1EY7 A;  3TQY A;  1VQO A;  5M3M B;  1CFM A;  4O2D A;  3E0J A;  4X62 L;  4JC0 A;  1Q90 A;  2EYF A;  3N6R A;  4CKE A;  2SOB A;  2O5J C;  2NVT H;  1HCZ A;  4JI6 L;  2F0V A;  1EIG A;  2Q2I A;  4A3K H;  4CKC A;  4EX5 A;  1K3B C;  2NB0 A;  2Z8L A;  5EKI A;  1EWI A;  3CQZ B;  3HKZ G;  1HXY D;  1LLR D;  3FPP A;  4IUV A;  1E2Z A;  2CW0 D;  1Z7T A;  1FJG Q;  1I3Q B;  3OW2 A;  4JI5 Q;  2A19 A;  4DV4 L;  4DA2 A;  3NE5 B;  4HJ7 A;  1LAB A;  1MI2 A;  1Q81 C;  4L5S A;  1MGS A;  2D0P A;  1IBL Q;  4GOP A;  4DV5 L;  4GN4 B;  4K6L A;  4XDX A;  3MXG A;  4KHV A;  3R93 A;  1KIX A;  2EXZ A;  5KRU A;  4L5R C;  3TEH B;  1K3R A;  1TWA B;  1WTP A;  3C2P A;  3CCE A;  3J81 E;  5GRO A;  4DAM A;  2UUA L;  2KCN A;  2LY7 A;  1O7Y A;  4N9T A;  4Y7N B;  2V1C C;  5M5W H;  4BBR H;  1SMY D;  3STB D;  1LTL A;  1QJO A;  1H9J A;  2ZJQ A;  2ZTE A;  3CW2 C;  1VQ6 A;  1Y8O B;  4CDD C;  2CH4 W;  4DV2 Q;  1Q3L A;  1R4Q B;  2VQE L;  1EEF D;  1TWC B;  2YU9 B;  4CDF C;  4JK1 C;  3A8J E;  1L1O B;  3HOZ H;  3MTS A;  1CKN A;  2FHT A;  4A3J G;  3S15 H;  1IBK L;  4C2M B;  3I56 A;  1HTL D;  4K6D A;  1STA A;  1F2M A;  1YBY A;  1KHI A;  4DR5 L;  4A3F B;  4HIM A;  2UXC L;  3J81 c;  4ZUI A;  1JCK B;  5EKK A;  4NB3 A;  4L8J A;  1J6Q A;  3RZD B;  5COY A;  2VNU D;  1K9M C;  1KDC A;  3J80 E;  5T1I A;  1BQQ T;  4B3S Q;  2EYP A;  1F77 A;  1HR0 L;  2RF4 A;  3BZK A;  2MHV A;  3D4D A;  1YIJ A;  1J5E Q;  1B9M A;  3KYH C;  3F2C A;  2R7Z G;  1ESR A;  1L1O C;  3GD7 A;  5DAU A;  3RLN A;  3S16 B;  1V9P A;  2B2W A;  1ML0 D;  2QCP X;  1EYA A;  4DAY A;  4RGN A;  2YYZ A;  3S24 A;  2XRS D;  1I3Q H;  2UUC L;  3T56 B;  1SNC A;  1PRT F;  2JA7 G;  1OXX K;  1MBY A;  5JEA H;  1D8L A;  3DWA A;  2Z4I A;  2K50 A;  3QOL A;  1BXT A;  4YCV A;  1C9O A;  1FR3 A;  1VDZ A;  1LAC A;  1DD2 A;  1EUJ A;  1QWY A;  1H9K A;  2UXB Q;  1EQV A;  2CWP A;  2UU9 Q;  1WOC A;  1TKW B;  2E75 C;  5I2Y A;  2EPB A;  4K5V A;  4DNI A;  1IKM A;  1BR9 A;  1JOK A;  4NXM L;  4RG1 A;  1QE6 A;  3K59 A;  4LFA Q;  1SYB A;  1EQQ A;  3UE0 A;  3GTL B;  2B2U A;  4X66 Q;  1SE3 A;  5C5L A;  1WFQ A;  2L0C A;  2JA6 H;  2R92 H;  2MNA A;  2IPK D;  4K0K Q;  3H0G H;  1ENA A;  5M5X B;  1N33 L;  1ZXT A;  2EY5 A;  4CGY B;  3R2T A;  1CTM A;  5AJ3 L;  2AQ2 B;  1STB A;  3M85 A;  2UU9 L;  3DMU A;  4CHT B;  2R93 H;  1HZA A;  5IWA L;  3I73 A;  3ND9 A;  4CJ0 B;  5CR3 A;  1A3U A;  2VZA A;  2ZT9 C;  5IT9 E;  1DOK A;  1PXU A;  4DK6 C;  4NDX A;  4NXM Q;  4M1U B; 
#chains in the Genus database with same CATH homology
 1FD7 D;  1B2T A;  3A56 A;  3FDT A;  1LTG D;  2BE5 D;  2KEE A;  1PRT D;  3HP3 A;  3HS0 C;  4DGZ A;  1ZEQ X;  3IFD A;  3TP8 A;  4QF4 A;  2KHS A;  2IWH A;  5J39 A;  5M3F B;  4ZRZ A;  3PIO 3;  2ICI A;  1D5M C;  1SYD A;  5JPM C;  3HZX A;  1EY0 A;  3EA6 A;  5K36 G;  2PYK A;  1NSN S;  2BOS A;  1BCP D;  4HMJ A;  1EQT A;  5CBA E;  4L63 B;  4ZLT F;  2F0N A;  4B9W A;  3PUZ A;  2QIL A;  1VMP A;  1QNU A;  2AUK A;  1PZJ D;  5CGK A;  3SDZ A;  2RVL A;  3NP8 A;  1PTO C;  2OT2 A;  5M5Y B;  2L12 A;  3M3Y B;  1G8Z D;  1SYG A;  4H7B A;  1SJH D;  3UI2 A;  4IUQ A;  1UNS A;  4WOR A;  1LT3 D;  2A73 B;  4XQN A;  5IGD A;  4OL7 A;  5I4D A;  1LT4 D;  1SEB D;  2F0O A;  1BCP F;  3I90 A;  5JEA G;  3I4L A;  4FP5 D;  4ILW A;  1WTX A;  1ILP A;  4U67 3;  3KUP A;  3D31 A;  2JA6 B;  2SEB D;  3J81 L;  1J9O A;  3A8I E;  3HRZ C;  2CQA A;  1IW7 D;  5I2X A;  3IFT A;  3GTQ B;  2FIN B;  4RWS C;  5CYU A;  5FLX E;  4FXG C;  3L7Z C;  4DAV A;  1SFO B;  2DY7 A;  3G6J B;  1DM0 B;  3GP7 A;  5EPJ A;  4C3I B;  1OXS C;  4IUP A;  3A7L A;  5HUR A;  2VB3 X;  2WV6 D;  3GO5 A;  3FRP B;  4G57 A;  2C9O A;  3GV3 A;  3R2I A;  1KDA A;  4YIJ A;  1OXV A;  2OEO A;  5JJZ A;  2E2H B;  2F0E A;  1A3V A;  1H9S B;  3LX0 A;  2PW7 A;  2PO4 A;  2JYO A;  1T5X D;  4JBW A;  3TZU A;  4DXG A;  2CW0 C;  1ZYR D;  1WTV A;  3RUZ A;  1W6K A;  4ZUJ A;  4RCN A;  1B44 D;  1W6J A;  2A74 C;  2A68 D;  4PNY A;  3PUV A;  4K2L A;  4X3K A;  1VF7 A;  3O13 A;  4CJ2 C;  1SMY C;  3S2H B;  4HED A;  1X32 A;  3M7G A;  4DNT B;  1BOS A;  3SR1 A;  3K5O A;  5KEE A;  1C4Q A;  2EY2 A;  5JOB A;  4F87 A;  1LTT D;  1D2B A;  4ID6 A;  2O2L D;  1C48 A;  3MZ5 A;  1JWS D;  1ESF A;  3OWF A;  3FVQ A;  2JEA I;  2EOT A;  1A6X A;  1DXM A;  3J7A V;  1KTK A;  2K1B A;  1EU4 A;  3HEJ A;  2DY8 A;  1RCV D;  2VB2 X;  4OO1 H;  1JIC A;  5A35 A;  3N52 A;  1I4P A;  1EYC A;  1STY A;  5G3L D;  2J0T D;  1BDO A;  3H3V C;  5D65 A;  2A68 C;  3TME A;  5FOB B;  2F0J A;  1Q1B A;  4G4K A;  1ET6 A;  1ET9 A;  3S9W A;  2A6H D;  3K58 A;  4QMG A;  4FO2 A;  1HQM C;  3J80 L;  1WVL A;  1PZI D;  1TS2 A;  1TWF B;  5CV7 A;  2KCC A;  1ICW A;  1SND A;  3S14 B;  3S17 B;  1PFB A;  3BVM A;  1L0X B;  2F03 A;  3BDC A;  1AZP A;  1SAP A;  1TY2 A;  1HRJ A;  4M8A A;  2NBF A;  1JC7 A;  4LAA A;  4TSS A;  4KKT A;  2B2U C;  4PV1 C;  2ENB A;  4E6I A;  1DYQ A;  1ENC A;  5EGT A;  2HDL A;  3GTM B;  1I4G A;  1PTO H;  2F0F A;  4RHR A;  2NVQ B;  2K7V A;  3GTG B;  5IGE A;  3GTK B;  4XT3 B;  3SK8 A;  2IW3 A;  1Q8I A;  4A3K B;  3NQT A;  2F0K A;  3F2U A;  2R6G A;  4H44 C;  5ELC A;  4FF2 A;  4DK0 A;  2B2V C;  2CHB D;  3HOV B;  3LNN A;  4XYO A;  1SE4 A;  3CRK C;  4C1N K;  3MAQ A;  1AFP A;  2RA4 A;  3Q22 A;  4EVO A;  4DN4 M;  1SNO A;  5CV4 A;  1I6V C;  2NUC A;  4HTH A;  5HGT A;  3QWN A;  1QNK A;  3R3O A;  4RGM A;  2KEC A;  2B8F A;  3MXP A;  2KA7 A;  5JPN C;  2B2Y A;  4J1M A;  1Z47 A;  1ROD A;  4FXD A;  2Q8T A;  2B2T A;  5C4J B;  5ELE A;  5KYL A;  1STG A;  1YNN C;  1JWU D;  4P2C B;  1CZW A;  2NTS A;  2M00 A;  2IJ0 A;  1EZ6 A;  2F3V A;  1WTQ A;  3IKJ A;  2RDG A;  3JAM E;  2LFN A;  2OF1 A;  1WTO A;  4NMZ A;  1WTR A;  1MSG A;  2EYL A;  3BG3 A;  4S3S A;  4A3B B;  3KLR A;  1STH A;  4OIJ A;  3GTO B;  2IX1 A;  3OMG A;  3I3C A;  4V19 0;  1ZKO A;  3OWE B;  3MHB A;  1FNU A;  2I46 A;  2D2C C;  2IX3 A;  5IIF A;  1SBB B;  3SEB A;  3KK7 A;  3D4W A;  1E2W A;  1D1I A;  1H9R A;  1YNN D;  1SYE A;  2A6E D;  2QF7 A;  3S15 B;  2L5T A;  3MVV A;  3RMH A;  3X3N A;  1M8A A;  2E2D C;  1NR2 A;  1F2Z A;  1FGB D;  5D3I B;  1IL8 A;  3DEP A;  2SNM A;  5I6W A;  2K5Q A;  2V4D A;  3I4N B;  1A2U A;  1PDQ A;  3ITP A;  4K2K A;  4XXE A;  5BN3 A;  3OW7 A;  1LV9 A;  1QCB D;  1K8O A;  5F2D A;  2SDF A;  3HOW B;  5DNF A;  4RKL A;  4RH6 A;  1F9R A;  1OXU A;  5ELB A;  2QEJ C;  1LTS D;  1SYC A;  4DF7 A;  4RAU C;  4BBS B;  2L11 A;  3D4R A;  1Q1E A;  1B4O A;  1Q12 A;  5C6A A;  4FYD A;  3FMC A;  2D5D A;  2BA1 A;  2J4X A;  1EY8 A;  4XYQ A;  5A2Q E;  3ERO A;  2HDM A;  1YNJ C;  3VR3 A;  5C5M A;  4K8I A;  4KHZ A;  5C4Z A;  4RGT A;  4WRD A;  3A55 A;  1HQR D;  5TSS A;  5FO8 B;  2WKC A;  1F9P A;  3OPO A;  2EZV A;  3WDN A;  2E76 C;  2XN9 C;  1PRT C;  1S5C D;  4IFD J;  4F8M A;  3BYY B;  1KAA A;  3HOY B;  5C44 B;  2LS0 1;  1RD9 D;  5KGU A;  5BN4 A;  1B3A A;  5FKA C;  3I91 A;  1OXT A;  4Z9C B;  4C3J B;  1VCI A;  5KIX A;  5IGC A;  1EY9 A;  4NW2 A;  1HPC A;  1STE A;  1KNE A;  3EFX D;  1HFG A;  2F0D A;  2K5D A;  5E1F A;  5KNC A;  1RF2 D;  4IQZ A;  1AW7 A;  2PPB C;  1A2T A;  1I4Q A;  2L4N A;  3OHX C;  3I4M B;  2JXM B;  2L9H A;  1CHP D;  2C5C A;  3QJY A;  2F0I A;  5EJW A;  1CHQ D;  3DHQ A;  3KBX A;  4PQX A;  3E5S A;  1KDB A;  2HUG A;  4FF1 A;  1SNP A;  3CHB D;  2MJ8 A;  3SK6 A;  3KF8 A;  1EEI D;  1QOH A;  3Q24 A;  3KLS X;  1PFM A;  3EQL C;  1GUW A;  2HQE A;  3DUZ A;  2PCF B;  1GXD C;  1HFN A;  2BDN A;  2EYH A;  1QG7 A;  1R9T B;  3IAY A;  3DWQ A;  1U9R A;  1GUN A;  4J8Q A;  4X3S A;  3TP7 A;  2NZ1 D;  2EJM A;  1JQY D;  2EYO A;  1J8I A;  1E0B A;  2K28 A;  2PNR C;  2AWN A;  3BVG A;  1HUM A;  4IUT A;  1O7L A;  5IGB A;  1EOT A;  4KI0 A;  1RJT A;  1TS5 A;  4RCO A;  4G7O C;  3VYT A;  3C1F A;  2GA4 B;  4A3G B;  1B1Z A;  2BE5 C;  4QB4 A;  2WB1 B;  2DNC A;  2E2I B;  4HSV A;  2X6L A;  1RHP A;  1KNA A;  3NK9 A;  4K14 A;  3HKZ B;  2PZW A;  3D6W A;  1T5E A;  2WAC A;  3C3L A;  2LMC B;  3U9S A;  3FEW X;  3K6O A;  1CQV A;  2F4I A;  2XIW A;  4GZY C;  1TT2 A;  2MP1 A;  1IHZ A;  3Q6S A;  1H9S A;  4HCS A;  2K04 A;  1WCM B;  1E2V A;  4CJ1 B;  3BYT B;  4OO1 I;  1ENF A;  2MPM A;  4UAI A;  3W2D A;  3SK5 A;  1CA6 A;  5CV8 A;  1CQF A;  2IL8 A;  4BBR B;  4KV6 A;  3MFG A;  1UUP A;  5C4H A;  2EYM A;  2F0T A;  4LK1 C;  1SSO A;  1EYD A;  3NQI A;  1Y8N B;  5IOC A;  4UDU C;  1U4P A;  3S1M B;  3LWE A;  5J22 A;  2K6A A;  3V2T A;  4KKS A;  1CZG A;  4R9W A;  2B8G A;  3HG9 A;  1XTC D;  2ZXR A;  3H91 A;  1EY5 A;  3BDO A;  1GUG A;  2F1M A;  1QIL A;  4BA1 I;  3NBH A;  4ME5 A;  1WTW A;  3D8G A;  1HHV A;  4RFB A;  2Y0S B;  3QOJ A;  3HOU B;  1AZQ A;  1PFN A;  1DOM A;  1XXG A;  3E6Z X;  3GTJ B;  1EWC A;  2BA0 A;  3HOZ B;  2XWB B;  5KYI A;  2R61 A;  5IGF A;  2TSS A;  1V8Q A;  3AU7 A;  4FF3 A;  1Y8P B;  3JAM L;  1GUS A;  4ZYS A;  1F2Y A;  2KED A;  3ZYY X;  4DFA A;  5C4X B;  3DEO A;  2RSO A;  2A69 D;  2NVX B;  4RHS A;  2IX0 A;  3RLF A;  1O78 A;  4RGO S;  2ZXP A;  3S1R B;  5AFW A;  4BY7 B;  2NN6 I;  2EE1 A;  3U9O A;  3PO3 B;  3FPU B;  2F0W A;  1CK1 A;  2NN6 G;  2B2V A;  1SXT A;  1JOQ A;  1L0Y B;  3W3A A;  4I7Z C;  4BS9 A;  1SNQ A;  1CT1 D;  2R92 B;  3H94 A;  5JVG 3;  3T13 A;  3TP5 A;  3VA5 A;  4HMI A;  3NTK A;  3NBI A;  4FNF A;  3NWT A;  4OGQ C;  3T16 A;  1I50 B;  3PV0 A;  4HR7 B;  1QB5 D;  1S5B D;  2L55 A;  2EJG C;  5LL6 S;  4A3I B;  1K83 B;  1WD1 A;  5I9P A;  5D14 A;  5KND A;  2PZU A;  1MD2 D;  4K8J A;  3V05 A;  4IFD I;  3V96 A;  3MXN A;  3J7A F;  4QIW B;  3DXJ C;  1Y1V B;  4ZKC B;  4EQO A;  3H6M A;  2N55 A;  5DM7 3;  3VYR A;  3SK4 A;  2B2Y C;  2FMM A;  1PZK D;  4KMU C;  3SXH A;  5LHY 1;  3TBI B;  5D3D A;  3A8K E;  3PMF A;  3LWU A;  2BDO A;  1UAP A;  3D6C A;  1BCP C;  2F0L A;  1B9N A;  3HGB A;  3R8B A;  1SE2 A;  1M4V A;  5JVH 3;  1TS4 A;  2AWO A;  4ZAI A;  2K01 A;  1UEA B;  4ZK9 B;  2Z1C A;  1S5D D;  3L3O C;  1DJR D;  3WOF A;  4MN3 A;  4EQN A;  3QB3 A;  1FYC A;  1PMR A;  1TII D;  5KNB A;  1D6E C;  1PRT B;  2BCO A;  2A6H C;  4A3E B;  2NYZ D;  4HN7 A;  3A7A B;  4KY5 A;  1H9M A;  3I8Z A;  2PZT A;  4B9X A;  3OMC A;  2WKD A;  1XX8 A;  1HA5 A;  3M4O B;  1GJX A;  2JP1 A;  1U4M A;  1U4R A;  2RBM A;  2RKS A;  4XTC S;  2L1B A;  4LJZ C;  1D1K A;  2KQ3 A;  4KD4 A;  3ERQ A;  1RTN A;  4BWG B;  5T1G A;  4C3J G;  4G7Z C;  2D62 A;  1NAP A;  1DON A;  2VUM B;  2KOL A;  2B39 A;  3SVM A;  3WOE A;  1EWH A;  3GV6 A;  1EFI D;  2KJX A;  3PUY A;  4IUU A;  4C1N I;  4IFD G;  1D5X C;  3VYS A;  2QDB A;  4C3H B;  3M4Y A;  3T51 B;  1G2T A;  3P20 A;  4IUN A;  5E4X A;  1IYV A;  4OIK A;  3I70 A;  1STN A;  2R93 B;  1WD0 A;  1VMC A;  1G2S A;  1JWM D;  2MUY A;  4O1N A;  4B08 A;  3S1Q B;  3T4A C;  4KKU A;  1HUN A;  2R3Z A;  1DCZ A;  2JA5 B;  5DM6 3;  1XYI A;  1EIH A;  3K5L A;  3OIP A;  2WP8 J;  4IAL A;  3J7Y W;  2B2T C;  4KD3 A;  1HTP A;  1OO9 B;  1ONL A;  4FXK C;  2NWG A;  3OOC A;  5C3X A;  4U68 A;  2E2J B;  1PTO D;  4H13 C;  5IGG A;  4ULL A;  3PUW A;  1GHJ A;  4QUF A;  3NTH A;  4ZQ3 A;  2Q8I B;  4PMW A;  1X3P A;  1NR4 A;  5J1Z A;  4F88 A;  4F7X A;  3H09 A;  5CV5 A;  3GTP B;  1BF4 A;  4QUC A;  3NXW A;  1B53 A;  3K7A B;  5ELF A;  2F0S A;  4K5W A;  4KJO A;  3MA2 B;  1LTA D;  5CV6 A;  3BDL A;  1F9S A;  3CU7 A;  4DK1 A;  1SYF A;  3MFY A;  1D5Z C;  1EU3 A;  4TRD A;  2MGS A;  2EYJ A;  2X6G A;  4V0B A;  2AQ1 B;  4C3I G;  5EBC A;  5FK9 C;  2KUM A;  2M9V A;  1AEX A;  1LO5 D;  2XWJ B;  2XVS A;  4CKB A;  3C1E A;  1BNZ A;  4NP5 A;  3PIP 3;  2EJF C;  4HSP A;  1B50 A;  5K36 H;  2Z4H A;  4G7H C;  1LTR D;  5FO7 B;  5DEH A;  3VA7 A;  2JE6 I;  1BCP B;  1CM9 A;  2K05 A;  1RKN A;  4BA2 I;  3T53 B;  1Y1W B;  2SNS A;  1EL0 A;  2XNA C;  4DU9 A;  1F2L A;  4AYB B;  3K5N A;  1S4Z A;  1V43 A;  3A54 A;  3NUC A;  4X3T A;  2G9H D;  4L6T B;  5COR A;  4ODG A;  4HAE A;  4QCL A;  2B2W C;  1PYW D;  1IYU A;  3S2D B;  1Y69 U;  3MWY W;  4Q0F A;  1GUT A;  2AQ3 B;  1SNM A;  2DN8 A;  5ELD A;  1JOO A;  1PTO F;  5FO9 B;  2N88 A;  3X3M A;  2K5W A;  2F0P A;  2NTT A;  1U4L A;  2OXP A;  3QG1 A;  4WJW A;  1JE4 A;  2O5I C;  4RKB A;  5M5W B;  3ND8 A;  5EPL A;  2JA7 B;  5NUC A;  3TDQ A;  1A3T A;  1TU2 B;  2WII B;  1TVX A;  1TR5 A;  3NSW A;  4A3M B;  1TWH B;  2FMC A;  1ZYR C;  3VR5 A;  4X3U A;  2E74 C;  1BO0 A;  3IL8 A;  2D9U A;  1IW7 C;  1V1O A;  5CBE E;  5JAV A;  3QIA A;  4J6H A;  3MEH A;  2ID0 A;  5I6Y A;  3SHL A;  5JEA J;  3EVQ A;  2NN6 H;  4C56 C;  3DM1 A;  3K57 A;  4CBV A;  1F9Q A;  5ISR A;  1V1P B;  5C0X H;  4KJN A;  3VR2 A;  4WFN 3;  3BS1 A;  3M7N A;  5EBD A;  1KLU D;  5C3W A;  5BN5 A;  2VXW A;  3TSS A;  4A3D B;  3CKI B;  4N9P A;  1SDF A;  1TS3 A;  2J7Z A;  2WAQ B;  5C0X J;  2DNE A;  4R8I A;  4DNR B;  4KTA A;  4Q5V A;  4XT1 B;  2F0U A;  2F0Q A;  3K5M A;  3VYU A;  1EZ8 A;  2JEB I;  2M2L A;  3OSO A;  4PMB A;  3NHH A;  1YNJ D;  2K33 A;  3PO2 B;  3G7L A;  1II3 A;  2TMP A;  3BZD B;  3K0Y A;  4DXF A;  1S5F D;  3S1N B;  1EY4 A;  3NWS A;  2RSN A;  4C3H G;  2A5H A;  2A69 C;  3URY A;  1K8M A;  3MXU A;  3VR6 A;  1G29 1;  2F0M A;  1RTO A;  1JB3 A;  2EDG A;  2KVM A;  3NTI A;  1DOL A;  1AN8 A;  1KLG D;  3FKI B;  4OO1 G;  3ONA B;  1VF5 C;  4XIG S;  2HCI A;  4O42 A;  2A6E C;  3GQB A;  2PMZ B;  3AB9 A;  1PLF A;  1FNW A;  3VR4 A;  4IZ8 A;  1I6H B;  1IKL A;  2QKI C;  3P7J A;  4KY6 A;  5M9O A;  3NPP A;  5IT9 L;  2HCC A;  3EJI A;  2K32 A;  5EQ0 A;  5EPK A;  3OIQ A;  1XWE A;  2F0H A;  1Z6H A;  2X69 A;  3P75 A;  1S5E D;  1V1P A;  2PQE A;  3DWP A;  5C0X G;  2F0G A;  1TQO A;  2FJ2 A;  1G6Z A;  2O4X A;  5G3L F;  3I72 A;  5E4W C;  3D3R A;  3C46 A;  2NVY B;  4H0L C;  3TP6 A;  2R7Z B;  4MIU A;  1JR0 D;  1CA5 A;  2B63 B;  2IT1 A;  2ZXO A;  2AUJ D;  2Q8R E;  3KBG A;  4FVM A;  5CC4 A;  4KK7 A;  3AMU A;  1BUV T;  1SJE D;  3H0G B;  2CVR A;  2H1E A;  4RA8 A;  4TKO B;  4FF4 A;  4XQQ A;  2FFK B;  2RDH A;  1TWG B;  5C3E B;  2PW5 A;  4ABN A;  1I4X A;  2NVT B;  2XRQ D;  1X3Q A;  1GHK A;  1ILQ A;  2LKV A;  4ZKB B;  1C8C A;  4TQU S;  2JSO A;  4LMQ D;  3QO2 A;  5LL6 X;  1JOR A;  3P1H A;  4BY1 B;  1CI3 M;  4K5X A;  1FNV A;  3PUX A;  5IOD A;  1NUC A;  2RDF A;  1I4R A;  5CMD A;  1TY0 A;  4A3J B;  4IUR A;  4A93 B;  3Q23 A;  2RQX A;  4KN7 C;  2JA8 B;  1PTO B;  3BVZ A;  2K03 A;  2EY6 A;  3CRL C;  1O7Z A;  3HOX B;  1RDP D;  1DZ1 A;  1BBX C;  4KY7 A;  4I65 A;  1KAB A;  4OHJ A;  1HA6 A;  4HCE A;  5K5P A;  3L9A X;  4R8N A;  1A15 A;  5C0X I;  3KLS A;  3MC0 B;  3TN2 A;  5CV9 A;  1LT5 D;  5EKL A;  1LTI D;  3SE0 A;  4DAP A;  2EVB A;  4MHE A;  4IFD H;  1MSH A;  4EQP A;  3RZO B;  2XSC A;  2G9D A;  5FLX L;  5I9O A;  4PMC A;  2H4O A;  1EY6 A;  1GUO A;  1AP0 A;  2WIN B;  4EGV A;  1LT6 D;  4KN4 C;  3Q0A A;  2ICE C;  3TZD A;  5E3F A;  1GOZ A;  1O80 A;  2EY1 A;  4IN3 A;  4XQJ A;  1NCV A;  1G91 A;  2F3W A;  1LTB D;  5A2Q L;  3RD4 A;  2I07 B;  4NKL A;  1I4H A;  1R4P B;  1EY7 A;  5M3M B;  1CFM A;  3E0J A;  1Q90 A;  2EYF A;  3N6R A;  4CKE A;  2SOB A;  2O5J C;  1HCZ A;  2F0V A;  1EIG A;  4CKC A;  2NB0 A;  2Z8L A;  5EKI A;  3CQZ B;  1HXY D;  1LLR D;  3FPP A;  4IUV A;  1E2Z A;  2CW0 D;  1Z7T A;  1I3Q B;  4DA2 A;  3NE5 B;  1LAB A;  1MI2 A;  1MGS A;  4K6L A;  4XDX A;  3MXG A;  4KHV A;  3R93 A;  2EXZ A;  5KRU A;  1TWA B;  1WTP A;  3C2P A;  3J81 E;  2KCN A;  2LY7 A;  1O7Y A;  4N9T A;  4Y7N B;  1SMY D;  1QJO A;  1H9J A;  1Y8O B;  1Q3L A;  1R4Q B;  1EEF D;  1TWC B;  2YU9 B;  4JK1 C;  3A8J E;  3MTS A;  2FHT A;  4C2M B;  1HTL D;  4K6D A;  1STA A;  1F2M A;  4A3F B;  4ZUI A;  1JCK B;  5EKK A;  4L8J A;  3RZD B;  5COY A;  2VNU D;  1KDC A;  3J80 E;  5T1I A;  1BQQ T;  2EYP A;  1F77 A;  2MHV A;  3D4D A;  1B9M A;  1ESR A;  3GD7 A;  5DAU A;  3S16 B;  2B2W A;  1ML0 D;  2QCP X;  1EYA A;  4DAY A;  4RGN A;  2YYZ A;  2XRS D;  3T56 B;  1SNC A;  1PRT F;  1OXX K;  1MBY A;  5JEA H;  3DWA A;  2Z4I A;  3QOL A;  1BXT A;  1FR3 A;  1VDZ A;  1LAC A;  1DD2 A;  1QWY A;  1H9K A;  1EQV A;  1TKW B;  2E75 C;  5I2Y A;  2EPB A;  4K5V A;  1IKM A;  1BR9 A;  1JOK A;  1QE6 A;  3K59 A;  1SYB A;  3GTL B;  2B2U A;  1SE3 A;  5C5L A;  2L0C A;  2IPK D;  1ENA A;  5M5X B;  1ZXT A;  2EY5 A;  4CGY B;  3R2T A;  1CTM A;  2AQ2 B;  1STB A;  3M85 A;  4CHT B;  3DMU A;  3I73 A;  3ND9 A;  4CJ0 B;  5CR3 A;  1A3U A;  2ZT9 C;  5IT9 E;  1DOK A;  1PXU A;  4NDX A;  4M1U B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...