2EJGC

Crystal structure of the biotin protein ligase (mutation r48a) and biotin carboxyl carrier protein complex from pyrococcus horikoshii ot3
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
69
structure length
69
Chain Sequence
NVVSAPMPGKVLRVLVRVGDRVRVGQGLLVLEAMKMENEIPSPRDGVVKRILVKEGEAVDTGQPLIELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords 235aa long hypothetical biotin--[acetyl-CoA-carboxylase] lig
publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
total genus 13
structure length 69
sequence length 69
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ejgC00
3A8KE 3IKJA 1Y8NB 2KA7A 2Q8IB 5A35A 2B8GA 4IQZA 4IFDG 3PUZA 1CTMA 3BDOA 2JEAI 4OO1G 1OXXK 2E75C 1ZKOA 3CRLC 1Z6HA 2BA1A 5C0XG 3EQLC 1ZYRC 1IW7C 3HGBA 2K33A 2JEBI 3H94A 5JEAG 1H9MA 1GHKA 1VCIA 3LNNA 2ZT9C 3M4YA 1G291 1BDOA 4OGQC 1Y8OB 1GUGA 4L8JA 2K32A 1E2VA 1DD2A 3CRKC 2PPBC 3W3AA 3QIAA 1Q12A 3PUWA 1Y8PB 3GD7A 3I4LA 2EDGA 2A6HC 4H44C 4RCNA 4DNRB 3D31A 3QG1A 3VA7A 2D2CC 3KLRA 2D62A 4DK1A 3M85A 2YYZA 2BE5D 1FR3A 3T56B 3PUXA 1Y69U 1Q90A 2EJFC 1E2WA 1GUOA 4PV1C 4BA2I 2JXMB 1A6XA 3N6RA 3ND9A 2A6EC 2CW0C 1OXUA 3L7ZC 1Q1BA 3VR5A 3VR6A 1H9RA 1O7LA 2A69C 4TKOB 3D4RA 4I7ZC 1VF7A 3U9SA 5BN4A 4KKUA 1OXSC 2E74C 2EJMA 4JK1C 1ONLA 2AUKA 2AUJD 4H13C 1HCZA 2A68C 3MXUA 5KNDA 3LWUA 1Z7TA 1K8MA 2EJGC 4H0LC 1GJXA 1HQMC 1OXTA 2L5TA 1GUSA 2BE5C 2KCCA 3GQBA 1CFMA 2B8FA 2F1MA 2NN6H 4KKSA 3T53B 3DXJC 2R6GA 2E76C 1HTPA 5BN3A 1VF5C 5K36H 3RLFA 1HPCA 2D5DA 1LACA 3OW7A 1Q1EA 1V43A 2AWOA 5BN5A 4G7HC 1IYUA 4G7OC 4XTCS 2NN6G 3FPPA 3A7AB 3P20A 1VDZA 3A8JE 3QJYA 1PMRA 3VR4A 1FYCA 3PUVA 4LK1C 4G7ZC 1V8QA 2BDOA 1B9MA 1CI3M 1GUTA 5K36G 1IW7D 4LJZC 4DK0A 1LABA 1B9NA 1SMYC 3M7NA 1K8OA 3PV0A 3MFYA 3OOCA 1OXVA 3A7LA 5KNCA 2BA0A 3VR3A 2NN6I 2DNCA 3SE0A 3AB9A 3PUYA 2DN8A 2PCFB 4KI0A 4KN7C 1H9KA 1TU2B 3SDZA 4BA1I 1IYVA 1T5EA 3NE5B 2A6HD 2EVBA 3A8IE 4XIGS 1YNNC 1GUNA 2QF7A 4JBWA 2O5IC 3IFTA 3BG3A 2IT1A 4KMUC 1EWHA 2K7VA 1E2ZA 4KHZA 2DNEA 3FMCA 3I73A 4GZYC 4HR7B 1DXMA 2A6ED 5KNBA 4IFDH 2O5JC 1H9SA 3WDNA 1QJOA 2A69D 2V4DA 3I72A 3OPOA 4KN4C 4OO1H 1GHJA 3VR2A 1H9SB 4KKTA 1YNJC 3T51B 5C0XH 1TKWB 3ND8A 1O78A 2A68D 4TQUS 5JEAH 1DCZA 2PNRC 2LMCB 3TZUA 1I6VC 4DNTB 2JE6I 1H9JA
chains in the Genus database with same CATH superfamily
3IAYA 4A3EH 2PO4A 5FLXL 1Y1WH 1XPOA 1VQ5A 2JA6B 1CHPD 3TEHB 3HOXH 1JJ2A 2UUCQ 2ZXPA 3BJUA 3J81E 3S2HB 5FO7B 3V2TA 1V1PA 3S1NH 3DM1A 3KOJA 4KD4A 1YIJA 1L0WA 2UXDL 3S15H 2DY7A 3DMUA 5TSSA 3HOWG 1VQ9A 4ZLTF 3GTMB 4P74A 1FL0A 1D8LA 2Q8RE 4R4CA 3J80c 1Y8PB 5CBAE 1GUWA 4DKAC 1STBA 2RBMA 2WACA 2D62A 1ASZA 1F9RA 3S2DB 1W6JA 1E22A 2K50A 2F3WA 4DV4Q 3K81C 2R7FA 2OCEA 1C8CA 1N8RC 5HGQA 5AJ3Q 4BBRH 2OQ0A 1FNUA 1VQ7A 3I4MH 2L5TA 4QJFA 3RZDB 1XPRA 3J7A5 5CMDA 1TWGH 1HNZL 1EY0A 1KNAA 1X54A 4CDDC 1HNXQ 3RN2A 1BOSA 2EYMA 5ELFA 3SK6A 1HR0L 1JR0D 4DV7Q 3KBGA 4G7HC 4IUTA 2N3SA 1IYUA 4FP5D 1LTLA 4MIUA 1IYJB 3VYUA 5CV9A 1XMQL 3P7JA 5C3EB 4EGVA 5KRUA 1YNXA 2NVYB 3H15A 1CQFA 2PI2A 2MHVA 1HUMA 3JAML 1NNXA 1AN8A 1XTDA 1PXUA 1KNEA 2CKZB 4KI0A 1IYVA 1WTQA 4B9XA 1YNNC 4PZ7A 3U4VA 3BDCA 2EZVA 4K8JA 2RVLA 4X3SA 1STEA 4AYBB 1HRJA 2IHEA 4DV5L 2NZ1D 3HZXA 1TY2A 1K28A 1SYFA 2Q2IA 2R92H 3OTOL 3OSOA 2A74C 4DNIA 4RAUC 2L4NA 4IPGA 2IHFA 5C4XB 1B4OA 1ENCA 1HFGA 4OXPA 3HOZB 2HDLA 3TS2A 1Y1WB 2UXCQ 1IBML 1SNCA 5I9OA 3RLNA 4OO1G 1OXXK 1S5FD 1T5XD 2KCMA 1PZID 2B63B 2HCIA 2EYPA 1JICA 5D3IB 1Q81C 4DA2A 5JEAG 3KJOA 4AH6A 4K0KQ 1JE5A 2VQFQ 5ELOA 4IFDI 3M4YA 1KDCA 1KAWA 4Y52H 5JVH3 2PPBC 3FKIH 4QMGA 1GVPA 2XN9C 4WORA 4WFN3 3J81i 4JI7L 2A6HC 1B7YB 5M9OA 1B1ZA 4DR4L 3DLLA 2K5WA 1D5MC 1Q1BA 2M2LA 3CQZH 3DUZA 4J6HA 1K3RA 3E5SA 1YNND 2SNMA 2ZJRA 1HNWL 1NCVA 4ZKCB 2B2VC 2KCTA 5ELEA 4JI0L 1HH2P 1EFWA 4I65A 2JQOA 4B08A 1UEBA 4P75A 2JA5G 1TWGB 5LMNW 1C9OA 4POFA 4YCWA 1PYBA 3FVQA 1HPCA 4HSPA 3PIOA 4A3FG 1HJPA 1MBYA 3A7AB 4R4IA 2K5QA 3PUVA 2A19A 3CCSA 4LFAQ 3GV3A 1A15A 5GAGC 2Y0SG 2XRQD 3S16B 4FF1A 5FLMG 2G9DA 4X3TA 1XNRQ 1CM9A 1LV9A 2WV6D 2B2WA 3SE0A 4FXGC 4APVA 4PMCA 5JVG3 2A6HD 2SDFA 2EXZA 5M3MH 2WINB 1NUCA 2L11A 4QIWE 4HJ5A 1CKNB 5FO8B 2KHSA 4JI5Q 3TP6A 3S9WA 1NBWA 4A3MG 3M3YH 1HHVA 4XT3B 3HOVB 4HN7A 1HTLD 4Y7NB 2E2DC 1XMOQ 5I6YA 2F0UA 4RKBA 5C4JB 4GNXB 1EIHA 3TZUA 2LMCB 1EU4A 2V1CC 2OWOA 2VQFL 1JQYD 4DR2L 4RA8A 1CKOA 3I8ZA 1SYEA 1EY5A 4A3IB 1PRTB 1IW7C 1I3QB 1O80A 4ALPA 3H94A 2OTJA 1VCIA 3K58A 3LNNA 5IY0A 1KIXA 3GP7A 3S1QH 2HQLA 2K32A 3TRZA 4P71A 3PF4A 3PIP3 2UU9Q 3FKIB 5CV5A 1AZQA 4RHSA 2I5HA 1CKMA 4NXNL 4DUYQ 3TP5A 3OMCA 5IT9E 1C0AA 4LFCL 4LF4Q 3BYTB 1O7LA 4N8FA 2QEJC 4A3GB 4B9WA 4DF7A 2IX0A 2F0KA 2VUMG 5KNDA 3S17H 3EJIA 3I70A 1VQFA 1GXDC 3A56A 1M90C 4LF8Q 2XWBB 2KEEA 1CZGA 4RGNA 1BCPC 4RFBA 1D1IA 4ZAIA 3J7YW 2B8FA 1KTKA 3CCMA 3PO2G 1SMYD 1TXYA 3K0XA 4NP5A 2AWOA 1PA6A 3D6WA 2PMZB 1U5KA 4B3SL 4ODGA 3T1HQ 1IW7D 4A3JB 3T13A 3GTKB 2ID0A 2Q8TA 2ZM6L 1Q8KA 4UP9A 3K7UC 1TU2B 2F0LA 1QVGA 5JOBA 4R8NA 1XMOL 1GUNA 4L5RC 1I4PA 1A8VA 2IT1A 2WB1G 3FMCA 4K5XA 1NE3A 4CDCC 4GZYC 1EY9A 4CJ0B 5KYLA 4DV2Q 1F2ZA 2O5JC 4CBVA 2V4DA 4JCVE 3NPPA 5EPKA 1H9SB 2X6LA 2ZTDA 4IUQA 5LMNL 1VQPA 2JE6I 1BXTA 2OXPA 3DWQA 5AFWA 2MGSA 5FO9B 4IALA 1BCPD 3EA6A 3PO3B 4IFDG 2EIFA 1D7QA 4C56C 5FLXE 2BA1A 2F0WA 3I56A 1AH9A 4N8X1 3FDTA 4YY3L 3DEPA 4A3EG 3MA2B 1U0LA 1J5EQ 2UUAQ 1KXLA 3HOXG 1E2VA 3OWFA 3TREA 3T1YL 1XXGA 5DEHA 4DK3C 1SE3A 3I3CA 1HA6A 3TP8A 5ELDA 2EY5A 4JG2A 1A6XA 3GTQH 1PFBA 4GKKQ 3HOWB 3I4NH 2RDFA 2A69C 4O1NA 3U9SA 4KD3A 4FNFA 1RJTA 1SYCA 3CXCA 3K5LA 5C6AA 4GN4B 2K6AA 1EEID 2VY3A 4EX5A 2PQAA 4A76A 3AFPA 3RN5A 4DR6L 3MXNB 3GTJH 4HJAA 1RTOA 1IXRA 1N34Q 5KYIA 2N49A 4PZ8A 4BBRG 5IWAL 5K36H 2B2TC 3CC2A 2C35B 3I4MG 1Z47A 1PV4A 1JWUD 3WOFA 1KQSA 4M1UB 5EAYA 2NUCA 3C1FA 1VDZA 4QL5A 4EVOA 3QOLA 2O4XA 1VQKA 2RSOA 1BR9A 2EYHA 3OW2A 4C3IB 1SLJA 4A3FH 3MFYA 1EY6A 1IZ6A 2NWGA 3FHWA 1G8ZD 2B2WC 1S3OA 3O13A 3TBIB 3SVMA 4IJHA 1EQTA 4HAEA 4FDBA 3JAME 3HFZB 1SE8A 2PNHA 3IFTA 1EWHA 4IPCA 2JN4A 5E4XA 3I73A 4JYAL 1VQHA 1VS0A 2F4IA 2A69D 3GTGH 1EZ8A 3BYYB 2JK8A 3PIPA 2NBFA 4FF3A 1CT1D 3CD6A 1G91A 3GTLH 3WWVA 3D4WA 1NTGA 1OO9B 4WRDA 1WTOA 2YU9B 1RTNA 4A3DH 5E4WC 2R92G 2N55A 2K33A 4PNYA 1PFSA 2Q2HA 1GD7A 5T1IA 5HY6A 3HKSA 4MTKA 5A2QE 1CHQD 4HTHA 2CH4W 3CHBD 3D31A 4B3RL 2X6GA 1SMXA 2R7DA 5M5YH 1E2WA 5LMUL 1ILQA 4HMIA 3QR8A 4P72A 1CZWA 1B44D 4I7ZC 1SFOH 4DPGA 4KKUA 1LTAD 3BZDB 5D3DA 4H02A 2HQEA 3J80E 1K0SA 3CW2C 1A62A 1TWAH 1D6EC 1YBYA 4YWKA 3C46A 3KDFB 3NBIA 3L3OC 4AYBE 1VMPA 1RHPA 2F0DA 4DR5Q 2GVBA 2F3VA 1WFQA 1DM0B 4JI4Q 4KHPQ 2VUMH 4X3UA 1WCMH 1HXYD 5IGCA 3KBXA 4XDXA 4J1MA 1V43A 4HCSA 4X65L 2JA5B 1ET9A 1WTXA 2K14A 2KUMA 1RDPD 3G6JB 2RDGA 2SEBD 1LABA 4OWTB 2HIVA 4OWWB 1EWCA 3RUZA 1Y14B 3VR3A 3A5UA 3PUYA 2KBNA 4LMQD 3UI2A 4X66Q 3Q23A 4FXKC 5JJIA 1QVFA 1Q46A 2PZUA 2Y0SB 4M8AA 3J81j 1JORA 4KMUC 3OHXC 1B50A 1S5DD 3P1HA 1G2TA 2X69A 4X64Q 5M3FH 1FNWA 1FVIA 3JAMi 5IYDH 1SR3A 2NTTA 4F88A 2LXJA 2EXDA 3STBD 1ASYA 1SJHD 2PW5A 5CV7A 4JBMA 1L1OB 5IP7H 2E2JB 2NVXB 1ESRA 4A3MB 5A35A 1VQIA 1ML0D 4GKJQ 4RHRA 3TZDA 2VQEL 2A8VA 1LTBD 1TT2A 3ZJYC 5ELCA 1EFID 1Z6HA 4RGOS 1XJVA 5LHY1 2G5DA 3HGBA 3M9BA 1GHKA 2BCOA 2RA4A 4K6DA 2CW0D 4DUZL 2F0HA 1XTCD 3NP8A 2F4VQ 1GUGA 4H7BA 4JI2Q 4HSVA 3CCRA 3CRKC 3FP9A 4A4IA 3MTSA 4IPDA 3RZOH 2MUYA 4WJ4A 2IW3A 1M4VA 4LF5L 2A5HA 3I4OA 3FRPB 5KIXA 4PV1C 4A3KH 2HCCA 3R8BA 3S1RH 4LAAA 1H9RA 4RG1A 4TKOB 4DR5L 2R7ZG 1JWMD 2M9VA 5CV4A 4LF6L 4Z9CB 1JOKA 1IBLQ 5HURA 1SN8A 3HOYB 5IGBA 1HCZA 1SEBD 1CUKA 4KY7A 2QDBA 1RIPA 4R4OA 3JC66 5EKKA 1VQ8A 4IN3A 1G2SA 5IE8A 4RCOA 1HTPA 2VUMB 1NSNS 1SNMA 3GDEA 1GOZA 2B2UC 5CV6A 1X3QA 5GAEC 1A0IA 2AWNA 2K5VA 3LWEA 5DAUA 3VR4A 3BDLA 3QO2A 3PO2B 1PTOC 2FFKB 1X6OA 1E0BA 4ZCKA 1QE6A 4DXFA 3AQQA 4B3ML 1BF4A 1N33Q 3NWSA 5IODA 2N88A 4CDEC 1NMGA 1BQQT 5IYCG 2EVBA 4XIGS 5DLQE 4PG3A 2OT2A 2HDMA 4CDFC 2H5XA 1H95A 1I6HH 4JI8L 4ZQ3A 3OYYA 3R3OA 1NJIC 4AQYQ 1UUPA 4DAYA 3MVVA 1DZ1A 4KN4C 1I4XA 1UEAB 2F52A 5D14A 5EBCA 4J15A 1O78A 3L2PA 4JBKA 2RF4A 2WB1B 5C3XA 2UUBQ 4KV6A 1G6PA 4DNTB 2E5LL 1SNQA 2E2HB 1JJCB 2LY7A 2Q8IB 3DWAA 4C3JH 3L9AX 2F4VL 3BDOA 4K14A 5KEEA 1QZGA 3VYTA 4GOPB 4TSSA 2I0QA 4BBSG 1E1OA 2ENBA 2RDHA 1HZAA 3HRZC 2HD3A 1VQAA 4DK6C 3F2BA 2PMZE 2OEOA 2UUCL 1KAAA 2K52A 4C1NI 1D5ZC 3HP3A 3CPFA 3HEJA 3PQIA 1NR4A 2YYZA 4R9WA 3R2IA 2NB0A 4RMFA 1X3GA 4A3EB 2CCZA 4K5VA 3X3NA 4OL7A 3Q8DA 4BS9A 4A3CG 1EU3A 1KHIA 4I7AA 3HOXB 4L5QA 1VF7A 3K5NA 2K05A 3G7LA 1IL8A 5A2QL 1DJRD 4UP8A 1EOVA 4ZK9B 4BY7H 3S1NB 4FF2A 2Z9HA 1X3EA 3LWUA 2J4XA 4DV4L 3HS0C 1U9RA 1GUSA 3S15B 4MN3A 4C1NK 5IOCA 4IOCA 1PRTF 3I4NG 4JI1Q 4KKSA 1K8GA 4NMZA 3T53B 2KHJA 3DXJC 5AJ3L 5I4DA 3NBHB 4Q0FA 1M1KC 1EWIA 1FJGQ 3EVQA 2PZTA 2FHTA 1V9PA 4BY1G 2ZXRA 3J80L 1UE6A 1N33L 4R4QA 4LNQA 3G71A 1HNXL 2KVMA 1TS4A 4G7ZC 4BBRB 3QB3A 3DEOA 5CC4A 5K36G 4JI6Q 3PSIA 4DV7L 3KF6B 1STYA 3I4MB 4R4TA 1JE4A 3CKIB 3U4ZA 3MFGA 2F0IA 1WVLA 2PW7A 2K28A 4A93H 4L6TB 1CSPA 1O7ZA 1ET6A 4KJOA 2B2TA 4KHZA 1DOKA 2DNEA 4FO2A 1EQQA 2VB2X 3F2DA 2EYOA 1QCBD 1P16A 3I90A 1RODA 1R4QB 2VW9A 4PMWA 3DHQA 4KKTA 1YNJC 3A0JA 3Q22A 4RGTA 1MI2A 3T4AC 1FD7D 1KC8C 3A8KE 1E7ZA 2KA7A 3KLSX 2NTSA 2B8GA 4B3TQ 2DJGC 1MIUA 2JEAI 4DN4M 1P8LA 5M5XH 1JB3A 2WFWA 3CMAA 2MFIA 4NW2A 1A3UA 2FXQA 4HJ7A 4IOAA 2UXCL 1I94Q 1BDOA 2MO0A 1Y8OB 3CP0A 4KK7A 1DD2A 3QIAA 3GD7A 4A3DG 2K04A 2R92B 2XRSD 2D2CC 3Q0AA 4DK1A 1CA5A 4DAPA 3CCQA 2QKIC 4K0KL 1WYDA 2BOSA 1GUOA 4U68A 1PTOF 3ND9A 1ESFA 5C4HA 3VR5A 1K9MC 3VR6A 3E0JA 1QZHA 5I6WA 3HOUG 2IY5B 3HKZG 1EYGA 1PTOH 2NVTH 4YHHQ 2R93H 4OEMB 4KHVA 2R7ZH 1CFMA 3D8GA 3J7ZC 4C2MH 2B39A 1YNJD 3ULJA 2MO1A 4KY6A 1I50H 5C44G 5BN3A 2EYFA 2G9HD 2PZWA 3UDGA 4HIMA 1TWFH 1TY0A 1Q1EA 4K6LA 4DV3Q 4MZ9A 3W1BA 1QNKA 2JA6G 3CQZB 4LF7Q 2F0JA 2BDNA 2DJFC 3RMHA 1SAPA 3M4OH 3DM3A 4X3KA 1WCMG 1K8OA 1STAA 2EOTA 1PH8A 2PQEA 3BU2A 2HUGA 3H91A 2DNCA 2I46A 1LTGD 3F8TA 1K83H 4GLXA 1IBKQ 4LFAL 2RHSB 3UE1A 1F9QA 1CKNA 2D0PA 1QUQB 1PZJD 2CHBD 2JA7H 1XNRL 5IIFA 1WTHA 5C0XJ 1GM5A 3PF5A 2R3ZA 4HIDA 3SK4A 1V1OA 4X62Q 5IYCH 4F87A 3ULLA 3VR2A 4GLAC 1XPUA 5C0XH 5EBDA 1X32A 4JI5L 2FMMA 2PNRC 3DWPA 2F03A 3TSSA 1MGSA 4HMJA 2JP1A 4NXMQ 5M3FG 2K1BA 2ZJPA 1U4RA 3NWTA 5IYDG 1DONA 1JJGA 2C9OA 5M3MB 3KF8B 2ZXOA 2JEBI 3CCVA 1TIID 5IP7G 5E1FA 3V96A 2MQHA 4KTAA 1A3VA 1BBXC 4U673 3M3YB 1F2LA 4IPHA 4OWXB 4L8JA 5IGGA 4L5TA 4EQPA 2MP1A 3IFDA 4BBSH 1DOLA 2IWHA 2B3GA 1MJCA 1IKLA 3QG1A 3KLRA 5I2XA 2RSNA 3NTHA 1CK1A 3GV6A 2ZJQA 1S5CD 2H1EA 5BN4A 2UU9L 2OF1A 2Y0SE 3K0YA 1UNSA 4TRDA 1Z7TA 1GJXA 4DUYL 1WTPA 4A3KG 2NVTB 3S1QB 2BE5C 4A3CH 4LF4L 2KCCA 1B3AA 4K8IA 3GTOH 1E3PA 2NN6H 4YWMA 2R7ZB 2Z4HA 2YTVA 3NQIA 3ZYYX 1XYIA 1QNUA 5C5MA 4QUFA 2CVRA 3AU7A 2K5DA 4LF8L 1LACA 1EIFA 4YCUA 3PMFA 3GO5A 2LKVA 3HG9A 2JSOA 1OTCA 2JJQA 5JJZA 3HOZG 2FJ2A 1VQ4A 3A8JE 4ME5A 5JEAJ 3S14H 1Y1VG 4LW1A 1UE5A 2ZTCA 5IGEA 4JI3Q 4S3SA 2HT1A 4XYQA 3S17B 4F8MA 2JA8H 4A3BH 4BY1H 2Q2TA 4N9TA 5J1ZA 2QA4A 1LLRD 4POGA 3AB9A 4JV5Q 4EQNA 3T1HL 1STHA 4JBWA 2B2UA 3E3XA 2UXBQ 1LTID 2LSSA 1VQNA 2CFMA 5M5WH 4NXML 4ZUIA 1T9HA 2EYLA 1LUZA 1H9SA 4OX9Q 1QJOA 4CKBA 1VQCA 1ILPA 1J9OA 5E3FA 2VZAA 3ND8A 4UHVA 3TMEA 1MHWC 1EEFD 5JJLA 3IKJA 4LF9Q 3G4SA 2PI2E 4DV2L 4NKLA 3CCJA 1B70B 4DXGA 4IQZA 2NVQH 2WAQG 2E75C 2B2YA 1YJWA 4HJ8A 1R9TH 1XNQQ 4IZ8A 1SROA 4IURA 1HA5A 4DR7Q 5CBEE 4JOIA 3URYA 1LTRD 4C3HH 5ISRA 4C3JG 4A3LH 3SK5A 1EUJA 1VQDA 1F2YA 2F0VA 3W3AA 5C0XI 4DV0Q 4BBSB 1ENAA 4DV1Q 3E0EA 2VL6A 4QUCA 4QGUA 1J5EL 3NSWA 3EIVA 5G3LF 5L37A 2UUAL 1OXUA 1N32Q 3EBEA 4LFBQ 1OXSC 1PH7A 1TVXA 4OIKA 1I4GA 2L1BA 1PH1A 5C4ZA 1V1QA 3MXNA 1HQMC 4KJNA 1RCVD 4GKKL 3D4DA 2F1MA 4HIOA 5EKLA 1PVOA 4EQOA 3HOUH 1N36Q 1SE2A 1PHJA 2L0CA 1D2BA 4BY7G 2WB1E 2IL8A 5J3BA 4JI3L 2SOBA 2ES2A 3CU7A 4CHTB 1SXTA 1NMFA 4O42A 4DV6Q 4DR3Q 3GTQB 4G7OC 1F77A 5BR8Q 4DGZA 3I4NB 3FPPA 3LX0A 2YTYA 1N34L 5C44H 1PMRA 3TQYA 1QVCA 4HIKA 1BVSA 2ALYB 1JOQA 2F0NA 1CI3M 1GUTA 4LJZC 4DK0A 5C3WA 1B2TA 3NTIA 3A7LA 1TS5A 4BY1B 1JWSD 1JOOA 1VQMA 4JPBW 2JA6H 3GTJB 2NN6I 3A54A 5GAHC 2Z0SA 4OX9L 5CGKA 2K5NA 2SNSA 3S2HH 2K4KA 4XT1B 2O5IC 5CYUA 1RKNA 4PQXA 4DFAA 3H3VC 2XTIA 2QEXA 1BO0A 1CQVA 1E2ZA 4HEDA 3CPWA 4OIJA 1EIGA 3OIQA 2ZTEA 1PH6A 4A93G 1F9SA 1PH5A 1I4RA 3GTMH 1C4QA 3U50C 4RWSC 2A73B 4L5SA 2EPBA 3FEWX 4DR7L 4A3FB 3S2DH 4BA2I 3MXPA 4EQ5A 2UXDQ 4IUUA 3CC7A 3G48A 4R1JA 1PRTC 4X6AH 2C5CA 2Q2UA 4IJLA 3MHBA 1K73C 4DV1L 3CAMA 5FJ8H 4YCVA 1V1PB 3RZDH 4IUVA 1SNOA 4J8QA 1YZ6A 2KCNA 1VQOA 3GTGB 5IGDA 3C2PA 1AFPA 3FPUB 5T1GA 3VA7A 5JJKA 1AE2A 2K5HA 3M85A 1Q82C 1ZEQX 1S4ZA 2F0MA 5IYBG 3GTLB 2A6EC 4UP7A 1HNZQ 3JAMc 1K3BC 4ABNA 1ONLA 2AUKA 4GN3B 3RLOA 5C3EH 4A3DB 2QW7A 2NVYH 4YIJA 1HR0Q 2EY6A 3N52A 2R61A 1Z9FA 3ERQA 1JCKB 4ZRZA 3D6CA 1LTSD 1Q7YC 4JC0A 1BCPB 3Q24A 1XMQQ 2E76C 2P5ZX 3HKZB 3UE0A 1IL2A 1LYLA 1O7YA 5IGFA 1S5ED 1KL9A 1SBBB 2R93G 5M5YB 1VQGA 3ULPA 1WD1A 3IL8A 3BVZA 2IX3A 3PO3G 1W2BA 1PRTD 4A75A 2KHIA 3W5OA 1SFOB 4JI4L 4KHPL 1UWVA 4DU9A 4LK1C 2KJXA 2BDOA 3E9IA 1LO5D 4CGYB 2K03A 5E7NA 5C4XH 3F2CA 1TWAB 2E8GA 3HOZH 3H0GG 1VQLA 1FGUA 1Y1VH 4BWGB 1STNA 3CMEA 2B63H 4DV5Q 5EGTA 3J80i 3NK9A 3OTOQ 1JC7A 1WCMB 2CWAA 2JYOA 4UAIA 4HR7B 1DXMA 2A6ED 3PCOB 1R4PB 4X66L 5J22A 1IBMQ 1J6QA 3I72A 4JVZA 1GHJA 1EIYB 2L15A 2DGYA 1IHZA 1L1OA 1K0RA 3EROA 3QWNA 1WI5A 3F1ZA 2JA7G 1F9PA 4X64L 2CQOA 1HZ9A 2LS01 2KOLA 2B2YC 1PYSB 2XSCA 3S24A 2EY1A 1LTTD 5C0XG 4JI7Q 4JOIC 1KDAA 3VYRA 4DR4Q 1N9WA 5D65A 4GKJL 1WTVA 4RH6A 5M3FB 2CH4A 3ERSX 1VQEA 3A55A 4FF4A 5DNFA 4DNRB 1ZXTA 4QY7A 4CKCA 3U9OA 3CCEA 2HHHQ 1YJ9A 1LM0A 1X3FA 5FKAC 1HNWQ 2Z6BA 1Q8IA 4LWCA 4C3IG 1FR3A 1YHQA 5ELNA 1HQRD 4JI0Q 3PUXA 2EYJA 3N6RA 3I7FA 2WKDA 4JI2L 2RCFA 2WP8J 4UPAA 4XQNA 1GKHA 4CKEA 2A68C 4ME3A 4UDUC 3S16H 4MTNA 1D1KA 1B8AA 1A2TA 4HCEA 4P2CB 3TP7A 1PTOD 3K59A 3T16A 1IBLL 2R6GA 1KRTA 3RZOB 4ZUJA 3OW7A 5J39A 4A3KB 3H3VH 3B6YA 5JPNC 2I5LX 1A3TA 3S1RB 4ILWA 2NN6G 3E9HA 3HOVH 4Y7NH 2K75A 1XX8A 1X65A 2M00A 2BH8A 4TVAB 2B29A 4QB4A 5C4JH 2AKWB 1B9NA 3M7NA 5I9PA 3PV0A 1QG7A 2BA0A 2DN8A 1H9KA 1K8AC 1SSOA 2N8NA 1Y1VB 3NE5B 3KUPA 3A8IE 2KEDA 2RKSA 4A3IH 5CV8A 1I3QH 2JA8G 4A3BG 3Q6SA 3RNUA 4XQQA 1TWCH 1LT4D 4GS3A 1AZPA 3OPOA 1EY8A 3J81c 4DR2Q 4UY8C 5GADC 1STGA 5EJWA 3L0OA 1NY4A 2NZHA 1VQJA 5CORA 4F7XA 3ER0A 2A68D 1C7YA 1EY7A 4AQYL 4PMBA 1I5FA 2I07B 2YTXA 2N78A 3NHHA 4GOPA 1VQ6A 4WJ3M 1WD0A 4A3GH 1HFNA 4FYDA 1ZYRC 2UUBL 2HHHL 1I6HB 4NXNQ 1KDBA 1O7IA 1YHAA 1MJEA 4OGQC 4LFCQ 2WAQB 2XIWA 4DAVA 2VS1A 2EDGA 4H44C 2OQKA 1L0YB 1AE3A 4FXDA 1HZBA 3OIPA 1Q90A 4HJ9A 4V190 2AHOB 3PGZA 2EQSA 4C3HG 4C3JB 4A3LG 3NTKA 3K57A 2F0FA 1DOMA 3K7AH 3KJPA 4A3JH 1SRUA 3MXUA 1DGSA 3M7GA 1K8MA 3GTKH 5IYBH 1OXTA 4P73A 4O2DA 2J0TD 3NBHA 1UE1A 1VQBA 2Z6KA 3I91A 1X56A 4OHJA 3SXHA 1Q86C 4B3SQ 1G6ZA 2RQXA 1SYDA 5LL6X 1E24A 1YVCA 3NXWA 1BKBA 1XWEA 2ZM6Q 3CC4A 4XTCS 1W6KA 1X55A 2D0OA 2JA9A 4JI1L 5DM73 3P20A 3QJYA 5COYA 1FYCA 1FJGL 5JAVA 1ZYRD 4V0BA 1PH2A 4BY7B 3KF6A 5GROA 1YI2A 4L63B 1SMYC 1L0XB 3BVMA 3P75A 3ITPA 5KNCA 1M8AA 4LUOA 1YJNA 1F2MA 3AYHB 3PO3H 4DR1Q 2PCFB 2AMCB 1FGBD 2FINB 4E6IA 1T5EA 4KY5A 1UE7A 2DY8A 1PDQA 2OTLA 2CQAA 4JI6L 3BG3A 5LMNQ 1EQVA 3U58A 1LT3D 1A2UA 3H3VI 3H0GH 1TWCB 2QCPX 3WDNA 4NPSA 1UAPA 2CWPA 1L1OC 3BVGA 3T51B 2F0PA 1GO3E 2YV5A 3ICEA 1DCZA 1U4MA 2GA4B 1EZ6A 4PZ6A 3HOYG 1G51A 3WOEA 4YY3Q 3CF5A 3D3RA 4OELB 3J81L 4A93B 2J7ZA 3HOWH 1CTMA 1ZKOA 2NYZD 1LT6D 3CRLC 1EYCA 2H4OA 1W3SA 4CJ2C 3T1YQ 3VDYA 3EQLC 4AIMA 1SNPA 3SHLA 4B3TL 4BXXG 5I2YA 3MEFA 3TS0A 2LFNA 4GNXA 1U4PA 1Q12A 4N9PA 2F0SA 4IO9A 1EOTA 1BBUA 3X3MA 5DM63 1PFMA 5FJ8G 2A1AA 1I94L 3R93A 5FOBB 5IP9G 4DR6Q 3C3LA 1TS3A 5EKIA 1MD2D 3K80C 3D4RA 5M5XB 4MNOA 3OWEB 1PFNA 1A63A 1YITA 2AUJD 1NR2A 4C3IH 5IWAQ 3K7AB 2L9HA 4LUVA 1HUNA 4XQJA 2F0OA 1EL0A 1EYAA 1X9NA 2PQAB 5G3LD 1S5BD 1QILA 3OMGA 3RD4A 4ZKBB 3VYSA 3K6OA 5C3EG 3K5MA 2KQ3A 3RLFA 4YHHL 1RL2A 2D5DA 1WOCA 1QB5D 3CCLA 2XVSA 4QQBX 2MNAA 1KLGD 3EFXD 3J7AF 1BUVT 4DR1L 2NZOA 1KABA 3TN2A 1SYBA 1PTOB 4DV3L 1OXVA 2R93B 1L2FA 4QF4A 1PH3A 1QWYA 2KECA 4JYAQ 4LF7L 4AYBG 1KLUD 3SDZA 2TSSA 4C2MB 2F0GA 1QUQA 2YU9H 1I50B 3TDQA 1BBWA 2DUDA 1TWFB 5C4XG 3RR5A 4RGMA 3GTPH 2L55A 5KNBA 1Y1WG 3H0GB 3UDFA 3KLSA 4OO1H 1IBKL 4G4KA 2B63G 4ID6A 3MWYW 3QOJA 3M4OB 1TKWB 3BZKA 4TQUS 3NQTA 5JEAH 1JT8A 2IJ0A 2WKCA 3W1GA 1Y8NB 2IPKD 4GOPC 1LT5D 3PUZA 2L12A 3SK8A 4X62L 3K8AA 1K83B 3KF8A 3I55A 3HKZE 4DAMA 1E1TA 4IUPA 1D5XC 1SDFA 2RHQB 3KFUA 5IT9c 4B3RQ 2JA7B 1TS2A 1G291 1RD9D 3H09A 5LMUQ 2BH2A 2F3IA 2EY2A 3R2TA 1AEXA 2VXWA 3UDIA 2BE5D 4QIWB 2F0TA 1Y69U 1YEZA 1PYWD 2JA5H 3L7ZC 1II3A 3F2UA 3D0FA 1PH4A 2EJMA 4RKLA 5ELBA 4O0AA 4H13C 2MPMA 3KK7A 2EJGC 2AQ1B 1AW7A 2RCNA 5NUCA 1SE4A 4X65Q 2MJ8A 2F0QA 4QCLA 2XGTA 2Z6KC 3BS1A 4ZYSA 5C5LA 1TQOA 2E2IH 1I4HA 1FNVA 1ICWA 1C48A 2EE1A 5FLMH 1TWHH 1KRSA 1CSQA 2K01A 5EPLA 1J8IA 3CCUA 1JB7A 2D9UA 2VNUD 2ASBA 1B9MA 3W2DA 4YWLA 2TMPA 2E2JH 4LUZA 3OOCA 2NVXH 1MKHA 4A3MH 4MHEA 3MC0B 4XXEA 3HOVG 3MEHA 3GTOB 3E6ZX 1PH9A 3S1MH 1IKMA 2QGQA 3H6MA 1EY4A 2QF7A 1DYQA 1Q3LA 3AEVA 1BCPF 1B3QA 5FLXc 4IUNA 5LL6S 3GTPB 3NEMA 2VQEQ 5F2DA 4JV5L 2KENA 5H1SE 3S14B 4NDXA 3IRBA 2PYKA 4A3IG 2JA8B 1KD1C 2UXBL 2F0EA 4A3BB 1H9JA 5EPJA 4DUZQ 1MSGA 1EQRA 1MSHA 3KYHC 2ICIA 1HR0W 1SJED 2QILA 3FKIG 4CJ1B 3HOYH 1H9MA 3A74A 3STBC 4LF9L 1HZCA 4LF5Q 3SEBA 5M5WB 1SYGA 2ZT9C 4OO1I 2XNAC 1SNDA 4GNXC 2QDLA 1QOHA 2I5MX 2ICEC 1ENFA 4K2KA 4A3GG 1XNQL 3PUWA 4JW0A 2GVAA 3I4LA 4RCNA 3AFQA 1YHBA 4LF6Q 3K5OA 1ICFB 5IT9L 3NUCA 1JMCA 1RF2D 3UDXA 4BXXH 1AP0A 3T56B 2EJFC 2JXMB 2NVQB 1WJJA 2CW0C 2ATWA 2Z4IA 4ULLA 3LGJA 2E74C 4DV0L 1R9TB 3PO2H 3NELA 2GN5A 4JK1C 1CA6A 4OONA 2AQ3B 4FVMA 3V05A 2B2VA 1NAPA 4XYOA 5IP9H 3M4PA 2FMCA 4C3HB 1S72A 3SGIA 3J7AV 1N32L 3GQBA 4NB3A 4LFBL 2VB3X 3EN2A 3MZ5A 1VF5C 4K5WA 1WTWA 4A3JG 3MXGA 4JBJA 2E2IB 4K2LA 4Q5VA 5BN5A 5CR3A 4KLKA 3SR1A 1TWHB 4B3MQ 2HIXA 1I4QA 5JPMC 1N36L 5HGTA 1V8QA 3KLWA 3KDFA 2O2LD 5M3MG 2E2HH 4DV6L 4DR3L 4JI8Q 2LXKA 5BR8L 2WAQE 4BA1I 4KN7C 3C1EA 4WJWA 3I2ZA 3HOUB 3S1MB 3NENA 3VA5A 2AQ2B 4G57A 4IFDJ 2WIIB 4GLVB 2Z1CA 5K5PA 3PIO3 3MAQA 3G6EA 2K7VA 1TR5A 2XWJB 2E5LQ 1S40A 2IX1A 1EYDA 4IFDH 1B53A 5KGUA 2Z8LA 3A5ZB 5GQOA 5C44B 4DAYB 1PZKD 1U4LA 3AMUA 3ONAB 1WTRA 1X3PA 4GN5A 1PLFA 3BZCA 5EQ0A 4R8IA 1BNZA 1VMCA 4H0LC 5FK9C 1I6VC 3M4QA
chains in the Genus database with same CATH topology
3IAYA 2PO4A 5FLXL 2JA6B 1CHPD 2ZXPA 3J81E 3S2HB 5FO7B 3V2TA 1V1PA 3DM1A 4KD4A 2DY7A 3DMUA 5TSSA 4ZLTF 3GTMB 2Q8RE 1Y8PB 5CBAE 1GUWA 1STBA 2RBMA 2WACA 2D62A 1F9RA 3S2DB 1W6JA 2F3WA 1C8CA 1FNUA 2L5TA 3RZDB 5CMDA 1EY0A 1KNAA 1BOSA 2EYMA 5ELFA 3SK6A 1JR0D 3KBGA 4G7HC 4IUTA 1IYUA 4FP5D 4MIUA 3VYUA 5CV9A 3P7JA 5C3EB 4EGVA 5KRUA 2NVYB 1CQFA 2MHVA 1HUMA 3JAML 1AN8A 1PXUA 1KNEA 4KI0A 1IYVA 1WTQA 4B9XA 1YNNC 3BDCA 2EZVA 4K8JA 2RVLA 4X3SA 1STEA 4AYBB 1HRJA 2NZ1D 3HZXA 1TY2A 1SYFA 3OSOA 2A74C 4RAUC 2L4NA 5C4XB 1B4OA 1ENCA 1HFGA 3HOZB 2HDLA 1Y1WB 1SNCA 5I9OA 4OO1G 1OXXK 1S5FD 1T5XD 1PZID 2B63B 2HCIA 2EYPA 1JICA 5D3IB 4DA2A 5JEAG 4IFDI 3M4YA 1KDCA 5JVH3 2PPBC 4QMGA 2XN9C 4WFN3 4WORA 2A6HC 5M9OA 1B1ZA 2K5WA 1D5MC 1Q1BA 2M2LA 3DUZA 4J6HA 3E5SA 1YNND 2SNMA 1NCVA 4ZKCB 2B2VC 5ELEA 4I65A 4B08A 1TWGB 3FVQA 1HPCA 4HSPA 1MBYA 3A7AB 2K5QA 3PUVA 3GV3A 1A15A 2XRQD 3S16B 4FF1A 2G9DA 4X3TA 1CM9A 1LV9A 2WV6D 2B2WA 3SE0A 4FXGC 4PMCA 5JVG3 2A6HD 2SDFA 2EXZA 2WINB 1NUCA 2L11A 5FO8B 2KHSA 3TP6A 3S9WA 1HHVA 4XT3B 3HOVB 4HN7A 1HTLD 4Y7NB 2E2DC 5I6YA 2F0UA 4RKBA 5C4JB 1EIHA 3TZUA 2LMCB 1EU4A 1JQYD 4RA8A 3I8ZA 1SYEA 1EY5A 4A3IB 1PRTB 1IW7C 1I3QB 1O80A 3H94A 1VCIA 3K58A 3LNNA 3GP7A 2K32A 3PIP3 3FKIB 5CV5A 1AZQA 4RHSA 3TP5A 3OMCA 5IT9E 3BYTB 1O7LA 2QEJC 4A3GB 4B9WA 4DF7A 2IX0A 2F0KA 5KNDA 3EJIA 3I70A 1GXDC 3A56A 2XWBB 2KEEA 1CZGA 4RGNA 1BCPC 4RFBA 1D1IA 4ZAIA 3J7YW 2B8FA 1KTKA 1SMYD 4NP5A 2AWOA 3D6WA 2PMZB 4ODGA 1IW7D 4A3JB 3T13A 3GTKB 2ID0A 2Q8TA 1TU2B 2F0LA 5JOBA 4R8NA 1GUNA 1I4PA 2IT1A 3FMCA 4K5XA 4GZYC 1EY9A 4CJ0B 5KYLA 1F2ZA 2O5JC 4CBVA 2V4DA 3NPPA 5EPKA 1H9SB 2X6LA 4IUQA 2JE6I 1BXTA 2OXPA 3DWQA 5AFWA 2MGSA 5FO9B 4IALA 1BCPD 3EA6A 3PO3B 4IFDG 4C56C 5FLXE 2BA1A 2F0WA 3FDTA 3DEPA 3MA2B 1E2VA 3OWFA 1XXGA 5DEHA 1SE3A 3I3CA 1HA6A 3TP8A 5ELDA 2EY5A 1A6XA 1PFBA 3HOWB 2RDFA 2A69C 4O1NA 3U9SA 4KD3A 4FNFA 1RJTA 1SYCA 3K5LA 5C6AA 2K6AA 1EEID 1RTOA 5KYIA 5K36H 2B2TC 1Z47A 1JWUD 3WOFA 4M1UB 2NUCA 3C1FA 1VDZA 4EVOA 3QOLA 2O4XA 2RSOA 1BR9A 2EYHA 4C3IB 3MFYA 1EY6A 2NWGA 1G8ZD 2B2WC 3O13A 3TBIB 3SVMA 1EQTA 4HAEA 3JAME 3IFTA 1EWHA 5E4XA 3I73A 2F4IA 2A69D 1EZ8A 3BYYB 2NBFA 4FF3A 1CT1D 1G91A 3D4WA 1OO9B 4WRDA 1WTOA 2YU9B 1RTNA 5E4WC 2N55A 2K33A 4PNYA 5T1IA 5A2QE 1CHQD 4HTHA 3CHBD 3D31A 2X6GA 1E2WA 1ILQA 4HMIA 1CZWA 1B44D 4I7ZC 4KKUA 1LTAD 3BZDB 5D3DA 2HQEA 3J80E 1D6EC 3C46A 3NBIA 3L3OC 1VMPA 1RHPA 2F0DA 2F3VA 1DM0B 4X3UA 1HXYD 5IGCA 3KBXA 4XDXA 4J1MA 1V43A 4HCSA 2JA5B 1ET9A 1WTXA 2KUMA 1RDPD 3G6JB 2RDGA 2SEBD 1LABA 1EWCA 3RUZA 3VR3A 3PUYA 4LMQD 3UI2A 3Q23A 4FXKC 2PZUA 2Y0SB 4M8AA 1JORA 4KMUC 3OHXC 1B50A 1S5DD 3P1HA 1G2TA 2X69A 1FNWA 2NTTA 4F88A 1SJHD 2PW5A 5CV7A 2E2JB 2NVXB 1ESRA 4A3MB 5A35A 1ML0D 4RHRA 3TZDA 1LTBD 1TT2A 5ELCA 1EFID 1Z6HA 4RGOS 5LHY1 3HGBA 1GHKA 2BCOA 2RA4A 4K6DA 2CW0D 2F0HA 1XTCD 3NP8A 1GUGA 4H7BA 4HSVA 3CRKC 3MTSA 2MUYA 2IW3A 1M4VA 2A5HA 3FRPB 5KIXA 4PV1C 2HCCA 3R8BA 4LAAA 1H9RA 4TKOB 1JWMD 2M9VA 5CV4A 4Z9CB 1JOKA 5HURA 3HOYB 5IGBA 1HCZA 1SEBD 4KY7A 2QDBA 5EKKA 4IN3A 1G2SA 4RCOA 1HTPA 2VUMB 1NSNS 1SNMA 1GOZA 2B2UC 5CV6A 1X3QA 2AWNA 3LWEA 5DAUA 3VR4A 3BDLA 3QO2A 3PO2B 1PTOC 2FFKB 1E0BA 1QE6A 4DXFA 1BF4A 3NWSA 5IODA 2N88A 1BQQT 2EVBA 4XIGS 2OT2A 2HDMA 4ZQ3A 3R3OA 1UUPA 4DAYA 3MVVA 1DZ1A 4KN4C 1I4XA 1UEAB 5D14A 5EBCA 1O78A 2WB1B 5C3XA 4KV6A 4DNTB 1SNQA 2E2HB 2LY7A 2Q8IB 3DWAA 3L9AX 3BDOA 4K14A 5KEEA 3VYTA 4TSSA 2ENBA 2RDHA 3HRZC 2OEOA 1KAAA 4C1NI 1D5ZC 3HP3A 3HEJA 1NR4A 2YYZA 4R9WA 3R2IA 2NB0A 4A3EB 4K5VA 3X3NA 4OL7A 4BS9A 1EU3A 3HOXB 1VF7A 3K5NA 2K05A 3G7LA 1IL8A 5A2QL 1DJRD 4ZK9B 3S1NB 4FF2A 2J4XA 3LWUA 3HS0C 1U9RA 1GUSA 3S15B 4MN3A 4C1NK 5IOCA 1PRTF 4KKSA 4NMZA 3T53B 3DXJC 5I4DA 4Q0FA 3EVQA 2PZTA 2FHTA 2ZXRA 3J80L 2KVMA 1TS4A 4G7ZC 4BBRB 3QB3A 3DEOA 5CC4A 5K36G 1STYA 3I4MB 1JE4A 3CKIB 3MFGA 2F0IA 1WVLA 2PW7A 2K28A 4L6TB 1O7ZA 1ET6A 4KJOA 2B2TA 4KHZA 1DOKA 2DNEA 4FO2A 2VB2X 2EYOA 1QCBD 3I90A 1RODA 1R4QB 4PMWA 3DHQA 4KKTA 1YNJC 3Q22A 4RGTA 1MI2A 3T4AC 1FD7D 3A8KE 3KLSX 2KA7A 2NTSA 2B8GA 2JEAI 4DN4M 1JB3A 4NW2A 1A3UA 1BDOA 1Y8OB 4KK7A 1DD2A 3QIAA 3GD7A 2K04A 2R92B 2XRSD 2D2CC 3Q0AA 4DK1A 1CA5A 4DAPA 2QKIC 2BOSA 1GUOA 4U68A 1PTOF 3ND9A 1ESFA 5C4HA 3VR5A 3VR6A 3E0JA 5I6WA 1PTOH 4KHVA 1CFMA 3D8GA 2B39A 1YNJD 4KY6A 5BN3A 2EYFA 2G9HD 2PZWA 1TY0A 1Q1EA 4K6LA 1QNKA 3CQZB 2F0JA 2BDNA 3RMHA 1SAPA 4X3KA 1K8OA 1STAA 2EOTA 2PQEA 2HUGA 3H91A 2DNCA 2I46A 1LTGD 1F9QA 1PZJD 2CHBD 5IIFA 5C0XJ 2R3ZA 3SK4A 1V1OA 4F87A 3VR2A 5C0XH 5EBDA 1X32A 2FMMA 2PNRC 3DWPA 2F03A 3TSSA 1MGSA 4HMJA 2JP1A 2K1BA 1U4RA 3NWTA 1DONA 2C9OA 5M3MB 2ZXOA 2JEBI 1TIID 5E1FA 3V96A 1BBXC 4KTAA 1A3VA 4U673 3M3YB 1F2LA 4L8JA 5IGGA 4EQPA 2MP1A 3IFDA 1DOLA 2IWHA 1IKLA 3QG1A 3KLRA 5I2XA 2RSNA 3NTHA 1CK1A 3GV6A 1S5CD 2H1EA 5BN4A 2OF1A 3K0YA 1UNSA 4TRDA 1Z7TA 1GJXA 1WTPA 2NVTB 3S1QB 2BE5C 2KCCA 1B3AA 4K8IA 2NN6H 2R7ZB 2Z4HA 3NQIA 3ZYYX 1XYIA 1QNUA 5C5MA 4QUFA 2CVRA 3AU7A 2K5DA 1LACA 3PMFA 3GO5A 2LKVA 3HG9A 2JSOA 5JJZA 2FJ2A 3A8JE 4ME5A 5JEAJ 5IGEA 4S3SA 4XYQA 3S17B 4F8MA 4N9TA 5J1ZA 1LLRD 3AB9A 4EQNA 1STHA 4JBWA 2B2UA 1LTID 4ZUIA 2EYLA 1H9SA 1QJOA 4CKBA 1ILPA 1J9OA 5E3FA 3ND8A 3TMEA 1EEFD 3IKJA 4NKLA 4DXGA 4IQZA 2E75C 2B2YA 4IZ8A 4IURA 1HA5A 5CBEE 3URYA 1LTRD 5ISRA 4C3JG 3SK5A 1F2YA 2F0VA 3W3AA 5C0XI 4BBSB 1ENAA 4QUCA 3NSWA 5G3LF 1OXUA 1OXSC 1TVXA 4OIKA 1I4GA 2L1BA 5C4ZA 3MXNA 1HQMC 4KJNA 1RCVD 3D4DA 2F1MA 5EKLA 4EQOA 1SE2A 2L0CA 1D2BA 2IL8A 2SOBA 3CU7A 4CHTB 1SXTA 4O42A 3GTQB 4G7OC 1F77A 4DGZA 3I4NB 3FPPA 3LX0A 1PMRA 1JOQA 2F0NA 1CI3M 1GUTA 4LJZC 4DK0A 5C3WA 1B2TA 3NTIA 3A7LA 1TS5A 4BY1B 1JWSD 1JOOA 3GTJB 2NN6I 3A54A 5CGKA 2SNSA 4XT1B 2O5IC 5CYUA 1RKNA 4PQXA 4DFAA 3H3VC 1BO0A 1CQVA 1E2ZA 4HEDA 4OIJA 1EIGA 3OIQA 1F9SA 1I4RA 1C4QA 4RWSC 2A73B 2EPBA 3FEWX 4A3FB 4BA2I 3MXPA 4IUUA 1PRTC 2C5CA 3MHBA 1V1PB 4IUVA 1SNOA 4J8QA 2KCNA 3GTGB 5IGDA 3C2PA 1AFPA 3FPUB 5T1GA 3VA7A 3M85A 1ZEQX 1S4ZA 2F0MA 3GTLB 2A6EC 4ABNA 1ONLA 2AUKA 4A3DB 4YIJA 2EY6A 3N52A 2R61A 3ERQA 1JCKB 4ZRZA 3D6CA 1LTSD 1BCPB 3Q24A 2E76C 3HKZB 1O7YA 5IGFA 1S5ED 1SBBB 5M5YB 1WD1A 3IL8A 3BVZA 2IX3A 1PRTD 1SFOB 4DU9A 4LK1C 2KJXA 2BDOA 1LO5D 4CGYB 2K03A 1TWAB 4BWGB 1STNA 5EGTA 3NK9A 1JC7A 1WCMB 2JYOA 4UAIA 4HR7B 1DXMA 2A6ED 1R4PB 5J22A 3I72A 1GHJA 1IHZA 3EROA 3QWNA 1F9PA 2LS01 2KOLA 2B2YC 2XSCA 2EY1A 1LTTD 5C0XG 3VYRA 1KDAA 5D65A 1WTVA 4RH6A 5M3FB 3A55A 4FF4A 5DNFA 4DNRB 1ZXTA 4CKCA 3U9OA 5FKAC 1Q8IA 4C3IG 1FR3A 1HQRD 3PUXA 2EYJA 3N6RA 2WKDA 2WP8J 4XQNA 4CKEA 2A68C 4UDUC 1D1KA 1A2TA 4HCEA 4P2CB 3TP7A 1PTOD 3K59A 3T16A 2R6GA 3RZOB 4ZUJA 3OW7A 5J39A 4A3KB 5JPNC 1A3TA 3S1RB 4ILWA 2NN6G 1XX8A 2M00A 4QB4A 1B9NA 3M7NA 5I9PA 3PV0A 1QG7A 2BA0A 2DN8A 1H9KA 1SSOA 1Y1VB 3NE5B 3KUPA 3A8IE 2KEDA 2RKSA 5CV8A 3Q6SA 4XQQA 1LT4D 1AZPA 3OPOA 1EY8A 1STGA 5EJWA 5CORA 4F7XA 2A68D 1EY7A 4PMBA 2I07B 3NHHA 1WD0A 1HFNA 4FYDA 1ZYRC 1I6HB 1KDBA 4OGQC 2WAQB 2XIWA 4DAVA 2EDGA 4H44C 1L0YB 4FXDA 3OIPA 1Q90A 4V190 4C3HG 4C3JB 3NTKA 3K57A 2F0FA 1DOMA 3MXUA 3M7GA 1K8MA 1OXTA 2J0TD 3NBHA 3I91A 1G6ZA 4OHJA 3SXHA 2RQXA 1SYDA 5LL6X 3NXWA 1XWEA 4XTCS 1W6KA 5DM73 3P20A 3QJYA 5COYA 1FYCA 5JAVA 1ZYRD 4V0BA 4BY7B 4L63B 1SMYC 1L0XB 3BVMA 3P75A 3ITPA 5KNCA 1M8AA 1F2MA 2PCFB 1FGBD 2FINB 4E6IA 1T5EA 4KY5A 2DY8A 1PDQA 2CQAA 3BG3A 1EQVA 1LT3D 1A2UA 1TWCB 2QCPX 3WDNA 1UAPA 3BVGA 3T51B 2F0PA 1DCZA 1U4MA 2GA4B 1EZ6A 3WOEA 3D3RA 3J81L 4A93B 2J7ZA 1CTMA 1ZKOA 2NYZD 1LT6D 3CRLC 1EYCA 2H4OA 4CJ2C 3EQLC 1SNPA 3SHLA 5I2YA 2LFNA 1U4PA 1Q12A 4N9PA 2F0SA 1EOTA 3X3MA 5DM63 1PFMA 3R93A 5FOBB 3C3LA 1TS3A 5EKIA 1MD2D 5M5XB 3D4RA 3OWEB 1PFNA 2AUJD 1NR2A 3K7AB 2L9HA 1HUNA 4XQJA 2F0OA 1EL0A 1EYAA 5G3LD 1S5BD 1QILA 3OMGA 3RD4A 4ZKBB 3VYSA 3K6OA 3K5MA 2KQ3A 3RLFA 2D5DA 1QB5D 2XVSA 1KLGD 3EFXD 3J7AF 1BUVT 1KABA 3TN2A 1SYBA 1PTOB 1OXVA 2R93B 4QF4A 1QWYA 2KECA 1KLUD 3SDZA 2TSSA 4C2MB 2F0GA 1I50B 3TDQA 1TWFB 4RGMA 2L55A 5KNBA 3H0GB 3KLSA 4OO1H 4G4KA 4ID6A 3MWYW 3QOJA 3M4OB 1TKWB 4TQUS 3NQTA 5JEAH 2IJ0A 2WKCA 1Y8NB 2IPKD 1LT5D 3PUZA 2L12A 3SK8A 1K83B 3KF8A 4IUPA 1D5XC 1SDFA 2JA7B 1TS2A 1G291 1RD9D 3H09A 2EY2A 3R2TA 1AEXA 2VXWA 2BE5D 4QIWB 2F0TA 1Y69U 1PYWD 3L7ZC 1II3A 3F2UA 2EJMA 4RKLA 5ELBA 4H13C 2MPMA 3KK7A 5NUCA 2EJGC 2AQ1B 1AW7A 1SE4A 2MJ8A 2F0QA 4QCLA 3BS1A 4ZYSA 5C5LA 1TQOA 1I4HA 1FNVA 1ICWA 1C48A 2EE1A 5EPLA 2K01A 1J8IA 2D9UA 2VNUD 1B9MA 3W2DA 2TMPA 3OOCA 4MHEA 3MC0B 4XXEA 3MEHA 3GTOB 3E6ZX 1IKMA 3H6MA 1EY4A 2QF7A 1DYQA 1Q3LA 1BCPF 3GTPB 4IUNA 5LL6S 5F2DA 3S14B 4NDXA 2PYKA 2JA8B 2F0EA 4A3BB 1H9JA 5EPJA 1MSGA 1MSHA 2ICIA 1SJED 2QILA 4CJ1B 1H9MA 3SEBA 5M5WB 1SYGA 2ZT9C 4OO1I 2XNAC 1SNDA 1QOHA 2ICEC 1ENFA 4K2KA 3PUWA 3I4LA 4RCNA 3K5OA 5IT9L 3NUCA 1RF2D 1AP0A 3T56B 2EJFC 2JXMB 2NVQB 2CW0C 2Z4IA 4ULLA 2E74C 1R9TB 4JK1C 1CA6A 2AQ3B 4FVMA 3V05A 2B2VA 1NAPA 4XYOA 2FMCA 4C3HB 3J7AV 3GQBA 2VB3X 3MZ5A 1VF5C 4K5WA 1WTWA 3MXGA 2E2IB 4K2LA 4Q5VA 5BN5A 5CR3A 3SR1A 1TWHB 1I4QA 5JPMC 5HGTA 1V8QA 2O2LD 4BA1I 4KN7C 3C1EA 4WJWA 3HOUB 3S1MB 3VA5A 2AQ2B 4G57A 4IFDJ 2WIIB 2Z1CA 5K5PA 3PIO3 3MAQA 2K7VA 1TR5A 2XWJB 2IX1A 1EYDA 4IFDH 1B53A 5KGUA 2Z8LA 5C44B 1PZKD 1U4LA 3AMUA 3ONAB 1WTRA 1X3PA 1PLFA 5EQ0A 4R8IA 1BNZA 1VMCA 4H0LC 5FK9C 1I6VC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A8K E;  3IKJ A;  1Y8N B;  2KA7 A;  2Q8I B;  5A35 A;  2B8G A;  4IQZ A;  4IFD G;  3PUZ A;  1CTM A;  3BDO A;  2JEA I;  4OO1 G;  1OXX K;  2E75 C;  1ZKO A;  3CRL C;  1Z6H A;  2BA1 A;  5C0X G;  3EQL C;  1ZYR C;  1IW7 C;  3HGB A;  2K33 A;  2JEB I;  3H94 A;  5JEA G;  1H9M A;  1GHK A;  1VCI A;  3LNN A;  2ZT9 C;  3M4Y A;  1G29 1;  1BDO A;  4OGQ C;  1Y8O B;  1GUG A;  4L8J A;  2K32 A;  1E2V A;  1DD2 A;  3CRK C;  2PPB C;  3W3A A;  3QIA A;  1Q12 A;  3PUW A;  1Y8P B;  3GD7 A;  3I4L A;  2EDG A;  2A6H C;  4H44 C;  4RCN A;  4DNR B;  3D31 A;  3QG1 A;  3VA7 A;  2D2C C;  3KLR A;  2D62 A;  4DK1 A;  3M85 A;  2YYZ A;  2BE5 D;  1FR3 A;  3T56 B;  3PUX A;  1Y69 U;  1Q90 A;  2EJF C;  1E2W A;  1GUO A;  4PV1 C;  4BA2 I;  2JXM B;  1A6X A;  3N6R A;  3ND9 A;  2A6E C;  2CW0 C;  1OXU A;  3L7Z C;  1Q1B A;  3VR5 A;  3VR6 A;  1H9R A;  1O7L A;  2A69 C;  4TKO B;  3D4R A;  4I7Z C;  1VF7 A;  3U9S A;  5BN4 A;  4KKU A;  1OXS C;  2E74 C;  2EJM A;  4JK1 C;  1ONL A;  2AUK A;  2AUJ D;  4H13 C;  1HCZ A;  2A68 C;  3MXU A;  5KND A;  3LWU A;  1Z7T A;  1K8M A;  2EJG C;  4H0L C;  1GJX A;  1HQM C;  1OXT A;  2L5T A;  1GUS A;  2BE5 C;  2KCC A;  3GQB A;  1CFM A;  2B8F A;  2F1M A;  2NN6 H;  4KKS A;  3T53 B;  3DXJ C;  2R6G A;  2E76 C;  1HTP A;  5BN3 A;  1VF5 C;  5K36 H;  3RLF A;  1HPC A;  2D5D A;  1LAC A;  3OW7 A;  1Q1E A;  1V43 A;  2AWO A;  5BN5 A;  4G7H C;  1IYU A;  4G7O C;  4XTC S;  2NN6 G;  3FPP A;  3A7A B;  3P20 A;  1VDZ A;  3A8J E;  3QJY A;  1PMR A;  3VR4 A;  1FYC A;  3PUV A;  4LK1 C;  4G7Z C;  1V8Q A;  2BDO A;  1B9M A;  1CI3 M;  1GUT A;  5K36 G;  1IW7 D;  4LJZ C;  4DK0 A;  1LAB A;  1B9N A;  1SMY C;  3M7N A;  1K8O A;  3PV0 A;  3MFY A;  3OOC A;  1OXV A;  3A7L A;  5KNC A;  2BA0 A;  3VR3 A;  2NN6 I;  2DNC A;  3SE0 A;  3AB9 A;  3PUY A;  2DN8 A;  2PCF B;  4KI0 A;  4KN7 C;  1H9K A;  1TU2 B;  3SDZ A;  4BA1 I;  1IYV A;  1T5E A;  3NE5 B;  2A6H D;  2EVB A;  3A8I E;  4XIG S;  1YNN C;  1GUN A;  2QF7 A;  4JBW A;  2O5I C;  3IFT A;  3BG3 A;  2IT1 A;  4KMU C;  1EWH A;  2K7V A;  1E2Z A;  4KHZ A;  2DNE A;  3FMC A;  3I73 A;  4GZY C;  4HR7 B;  1DXM A;  2A6E D;  5KNB A;  4IFD H;  2O5J C;  1H9S A;  3WDN A;  1QJO A;  2A69 D;  2V4D A;  3I72 A;  3OPO A;  4KN4 C;  4OO1 H;  1GHJ A;  3VR2 A;  1H9S B;  4KKT A;  1YNJ C;  3T51 B;  5C0X H;  1TKW B;  3ND8 A;  1O78 A;  2A68 D;  4TQU S;  5JEA H;  1DCZ A;  2PNR C;  2LMC B;  3TZU A;  1I6V C;  4DNT B;  2JE6 I;  1H9J A; 
#chains in the Genus database with same CATH topology
 3IAY A;  4A3E H;  2PO4 A;  5FLX L;  1Y1W H;  1XPO A;  1VQ5 A;  2JA6 B;  1CHP D;  3TEH B;  3HOX H;  1JJ2 A;  2UUC Q;  2ZXP A;  3BJU A;  3J81 E;  3S2H B;  5FO7 B;  3V2T A;  1V1P A;  3S1N H;  3DM1 A;  3KOJ A;  4KD4 A;  1YIJ A;  1L0W A;  2UXD L;  3S15 H;  2DY7 A;  3DMU A;  5TSS A;  3HOW G;  1VQ9 A;  4ZLT F;  3GTM B;  4P74 A;  1FL0 A;  1D8L A;  2Q8R E;  4R4C A;  3J80 c;  1Y8P B;  5CBA E;  1GUW A;  4DKA C;  1STB A;  2RBM A;  2WAC A;  2D62 A;  1ASZ A;  1F9R A;  3S2D B;  1W6J A;  1E22 A;  2K50 A;  2F3W A;  4DV4 Q;  3K81 C;  2R7F A;  2OCE A;  1C8C A;  1N8R C;  5HGQ A;  5AJ3 Q;  4BBR H;  2OQ0 A;  1FNU A;  1VQ7 A;  3I4M H;  2L5T A;  4QJF A;  3RZD B;  1XPR A;  3J7A 5;  5CMD A;  1TWG H;  1HNZ L;  1EY0 A;  1KNA A;  1X54 A;  4CDD C;  1HNX Q;  3RN2 A;  1BOS A;  2EYM A;  5ELF A;  3SK6 A;  1HR0 L;  1JR0 D;  4DV7 Q;  3KBG A;  4G7H C;  4IUT A;  2N3S A;  1IYU A;  4FP5 D;  1LTL A;  4MIU A;  1IYJ B;  3VYU A;  5CV9 A;  1XMQ L;  3P7J A;  5C3E B;  4EGV A;  5KRU A;  1YNX A;  2NVY B;  3H15 A;  1CQF A;  2PI2 A;  2MHV A;  1HUM A;  3JAM L;  1NNX A;  1AN8 A;  1XTD A;  1PXU A;  1KNE A;  2CKZ B;  4KI0 A;  1IYV A;  1WTQ A;  4B9X A;  1YNN C;  4PZ7 A;  3U4V A;  3BDC A;  2EZV A;  4K8J A;  2RVL A;  4X3S A;  1STE A;  4AYB B;  1HRJ A;  2IHE A;  4DV5 L;  2NZ1 D;  3HZX A;  1TY2 A;  1K28 A;  1SYF A;  2Q2I A;  2R92 H;  3OTO L;  3OSO A;  2A74 C;  4DNI A;  4RAU C;  2L4N A;  4IPG A;  2IHF A;  5C4X B;  1B4O A;  1ENC A;  1HFG A;  4OXP A;  3HOZ B;  2HDL A;  3TS2 A;  1Y1W B;  2UXC Q;  1IBM L;  1SNC A;  5I9O A;  3RLN A;  4OO1 G;  1OXX K;  1S5F D;  1T5X D;  2KCM A;  1PZI D;  2B63 B;  2HCI A;  2EYP A;  1JIC A;  5D3I B;  1Q81 C;  4DA2 A;  5JEA G;  3KJO A;  4AH6 A;  4K0K Q;  1JE5 A;  2VQF Q;  5ELO A;  4IFD I;  3M4Y A;  1KDC A;  1KAW A;  4Y52 H;  5JVH 3;  2PPB C;  3FKI H;  4QMG A;  1GVP A;  2XN9 C;  4WOR A;  4WFN 3;  3J81 i;  4JI7 L;  2A6H C;  1B7Y B;  5M9O A;  1B1Z A;  4DR4 L;  3DLL A;  2K5W A;  1D5M C;  1Q1B A;  2M2L A;  3CQZ H;  3DUZ A;  4J6H A;  1K3R A;  3E5S A;  1YNN D;  2SNM A;  2ZJR A;  1HNW L;  1NCV A;  4ZKC B;  2B2V C;  2KCT A;  5ELE A;  4JI0 L;  1HH2 P;  1EFW A;  4I65 A;  2JQO A;  4B08 A;  1UEB A;  4P75 A;  2JA5 G;  1TWG B;  5LMN W;  1C9O A;  4POF A;  4YCW A;  1PYB A;  3FVQ A;  1HPC A;  4HSP A;  3PIO A;  4A3F G;  1HJP A;  1MBY A;  3A7A B;  4R4I A;  2K5Q A;  3PUV A;  2A19 A;  3CCS A;  4LFA Q;  3GV3 A;  1A15 A;  5GAG C;  2Y0S G;  2XRQ D;  3S16 B;  4FF1 A;  5FLM G;  2G9D A;  4X3T A;  1XNR Q;  1CM9 A;  1LV9 A;  2WV6 D;  2B2W A;  3SE0 A;  4FXG C;  4APV A;  4PMC A;  5JVG 3;  2A6H D;  2SDF A;  2EXZ A;  5M3M H;  2WIN B;  1NUC A;  2L11 A;  4QIW E;  4HJ5 A;  1CKN B;  5FO8 B;  2KHS A;  4JI5 Q;  3TP6 A;  3S9W A;  1NBW A;  4A3M G;  3M3Y H;  1HHV A;  4XT3 B;  3HOV B;  4HN7 A;  1HTL D;  4Y7N B;  2E2D C;  1XMO Q;  5I6Y A;  2F0U A;  4RKB A;  5C4J B;  4GNX B;  1EIH A;  3TZU A;  2LMC B;  1EU4 A;  2V1C C;  2OWO A;  2VQF L;  1JQY D;  4DR2 L;  4RA8 A;  1CKO A;  3I8Z A;  1SYE A;  1EY5 A;  4A3I B;  1PRT B;  1IW7 C;  1I3Q B;  1O80 A;  4ALP A;  3H94 A;  2OTJ A;  1VCI A;  3K58 A;  3LNN A;  5IY0 A;  1KIX A;  3GP7 A;  3S1Q H;  2HQL A;  2K32 A;  3TRZ A;  4P71 A;  3PF4 A;  3PIP 3;  2UU9 Q;  3FKI B;  5CV5 A;  1AZQ A;  4RHS A;  2I5H A;  1CKM A;  4NXN L;  4DUY Q;  3TP5 A;  3OMC A;  5IT9 E;  1C0A A;  4LFC L;  4LF4 Q;  3BYT B;  1O7L A;  4N8F A;  2QEJ C;  4A3G B;  4B9W A;  4DF7 A;  2IX0 A;  2F0K A;  2VUM G;  5KND A;  3S17 H;  3EJI A;  3I70 A;  1VQF A;  1GXD C;  3A56 A;  1M90 C;  4LF8 Q;  2XWB B;  2KEE A;  1CZG A;  4RGN A;  1BCP C;  4RFB A;  1D1I A;  4ZAI A;  3J7Y W;  2B8F A;  1KTK A;  3CCM A;  3PO2 G;  1SMY D;  1TXY A;  3K0X A;  4NP5 A;  2AWO A;  1PA6 A;  3D6W A;  2PMZ B;  1U5K A;  4B3S L;  4ODG A;  3T1H Q;  1IW7 D;  4A3J B;  3T13 A;  3GTK B;  2ID0 A;  2Q8T A;  2ZM6 L;  1Q8K A;  4UP9 A;  3K7U C;  1TU2 B;  2F0L A;  1QVG A;  5JOB A;  4R8N A;  1XMO L;  1GUN A;  4L5R C;  1I4P A;  1A8V A;  2IT1 A;  2WB1 G;  3FMC A;  4K5X A;  1NE3 A;  4CDC C;  4GZY C;  1EY9 A;  4CJ0 B;  5KYL A;  4DV2 Q;  1F2Z A;  2O5J C;  4CBV A;  2V4D A;  4JCV E;  3NPP A;  5EPK A;  1H9S B;  2X6L A;  2ZTD A;  4IUQ A;  5LMN L;  1VQP A;  2JE6 I;  1BXT A;  2OXP A;  3DWQ A;  5AFW A;  2MGS A;  5FO9 B;  4IAL A;  1BCP D;  3EA6 A;  3PO3 B;  4IFD G;  2EIF A;  1D7Q A;  4C56 C;  5FLX E;  2BA1 A;  2F0W A;  3I56 A;  1AH9 A;  4N8X 1;  3FDT A;  4YY3 L;  3DEP A;  4A3E G;  3MA2 B;  1U0L A;  1J5E Q;  2UUA Q;  1KXL A;  3HOX G;  1E2V A;  3OWF A;  3TRE A;  3T1Y L;  1XXG A;  5DEH A;  4DK3 C;  1SE3 A;  3I3C A;  1HA6 A;  3TP8 A;  5ELD A;  2EY5 A;  4JG2 A;  1A6X A;  3GTQ H;  1PFB A;  4GKK Q;  3HOW B;  3I4N H;  2RDF A;  2A69 C;  4O1N A;  3U9S A;  4KD3 A;  4FNF A;  1RJT A;  1SYC A;  3CXC A;  3K5L A;  5C6A A;  4GN4 B;  2K6A A;  1EEI D;  2VY3 A;  4EX5 A;  2PQA A;  4A76 A;  3AFP A;  3RN5 A;  4DR6 L;  3MXN B;  3GTJ H;  4HJA A;  1RTO A;  1IXR A;  1N34 Q;  5KYI A;  2N49 A;  4PZ8 A;  4BBR G;  5IWA L;  5K36 H;  2B2T C;  3CC2 A;  2C35 B;  3I4M G;  1Z47 A;  1PV4 A;  1JWU D;  3WOF A;  1KQS A;  4M1U B;  5EAY A;  2NUC A;  3C1F A;  1VDZ A;  4QL5 A;  4EVO A;  3QOL A;  2O4X A;  1VQK A;  2RSO A;  1BR9 A;  2EYH A;  3OW2 A;  4C3I B;  1SLJ A;  4A3F H;  3MFY A;  1EY6 A;  1IZ6 A;  2NWG A;  3FHW A;  1G8Z D;  2B2W C;  1S3O A;  3O13 A;  3TBI B;  3SVM A;  4IJH A;  1EQT A;  4HAE A;  4FDB A;  3JAM E;  3HFZ B;  1SE8 A;  2PNH A;  3IFT A;  1EWH A;  4IPC A;  2JN4 A;  5E4X A;  3I73 A;  4JYA L;  1VQH A;  1VS0 A;  2F4I A;  2A69 D;  3GTG H;  1EZ8 A;  3BYY B;  2JK8 A;  3PIP A;  2NBF A;  4FF3 A;  1CT1 D;  3CD6 A;  1G91 A;  3GTL H;  3WWV A;  3D4W A;  1NTG A;  1OO9 B;  4WRD A;  1WTO A;  2YU9 B;  1RTN A;  4A3D H;  5E4W C;  2R92 G;  2N55 A;  2K33 A;  4PNY A;  1PFS A;  2Q2H A;  1GD7 A;  5T1I A;  5HY6 A;  3HKS A;  4MTK A;  5A2Q E;  1CHQ D;  4HTH A;  2CH4 W;  3CHB D;  3D31 A;  4B3R L;  2X6G A;  1SMX A;  2R7D A;  5M5Y H;  1E2W A;  5LMU L;  1ILQ A;  4HMI A;  3QR8 A;  4P72 A;  1CZW A;  1B44 D;  4I7Z C;  1SFO H;  4DPG A;  4KKU A;  1LTA D;  3BZD B;  5D3D A;  4H02 A;  2HQE A;  3J80 E;  1K0S A;  3CW2 C;  1A62 A;  1TWA H;  1D6E C;  1YBY A;  4YWK A;  3C46 A;  3KDF B;  3NBI A;  3L3O C;  4AYB E;  1VMP A;  1RHP A;  2F0D A;  4DR5 Q;  2GVB A;  2F3V A;  1WFQ A;  1DM0 B;  4JI4 Q;  4KHP Q;  2VUM H;  4X3U A;  1WCM H;  1HXY D;  5IGC A;  3KBX A;  4XDX A;  4J1M A;  1V43 A;  4HCS A;  4X65 L;  2JA5 B;  1ET9 A;  1WTX A;  2K14 A;  2KUM A;  1RDP D;  3G6J B;  2RDG A;  2SEB D;  1LAB A;  4OWT B;  2HIV A;  4OWW B;  1EWC A;  3RUZ A;  1Y14 B;  3VR3 A;  3A5U A;  3PUY A;  2KBN A;  4LMQ D;  3UI2 A;  4X66 Q;  3Q23 A;  4FXK C;  5JJI A;  1QVF A;  1Q46 A;  2PZU A;  2Y0S B;  4M8A A;  3J81 j;  1JOR A;  4KMU C;  3OHX C;  1B50 A;  1S5D D;  3P1H A;  1G2T A;  2X69 A;  4X64 Q;  5M3F H;  1FNW A;  1FVI A;  3JAM i;  5IYD H;  1SR3 A;  2NTT A;  4F88 A;  2LXJ A;  2EXD A;  3STB D;  1ASY A;  1SJH D;  2PW5 A;  5CV7 A;  4JBM A;  1L1O B;  5IP7 H;  2E2J B;  2NVX B;  1ESR A;  4A3M B;  5A35 A;  1VQI A;  1ML0 D;  4GKJ Q;  4RHR A;  3TZD A;  2VQE L;  2A8V A;  1LTB D;  1TT2 A;  3ZJY C;  5ELC A;  1EFI D;  1Z6H A;  4RGO S;  1XJV A;  5LHY 1;  2G5D A;  3HGB A;  3M9B A;  1GHK A;  2BCO A;  2RA4 A;  4K6D A;  2CW0 D;  4DUZ L;  2F0H A;  1XTC D;  3NP8 A;  2F4V Q;  1GUG A;  4H7B A;  4JI2 Q;  4HSV A;  3CCR A;  3CRK C;  3FP9 A;  4A4I A;  3MTS A;  4IPD A;  3RZO H;  2MUY A;  4WJ4 A;  2IW3 A;  1M4V A;  4LF5 L;  2A5H A;  3I4O A;  3FRP B;  5KIX A;  4PV1 C;  4A3K H;  2HCC A;  3R8B A;  3S1R H;  4LAA A;  1H9R A;  4RG1 A;  4TKO B;  4DR5 L;  2R7Z G;  1JWM D;  2M9V A;  5CV4 A;  4LF6 L;  4Z9C B;  1JOK A;  1IBL Q;  5HUR A;  1SN8 A;  3HOY B;  5IGB A;  1HCZ A;  1SEB D;  1CUK A;  4KY7 A;  2QDB A;  1RIP A;  4R4O A;  3JC6 6;  5EKK A;  1VQ8 A;  4IN3 A;  1G2S A;  5IE8 A;  4RCO A;  1HTP A;  2VUM B;  1NSN S;  1SNM A;  3GDE A;  1GOZ A;  2B2U C;  5CV6 A;  1X3Q A;  5GAE C;  1A0I A;  2AWN A;  2K5V A;  3LWE A;  5DAU A;  3VR4 A;  3BDL A;  3QO2 A;  3PO2 B;  1PTO C;  2FFK B;  1X6O A;  1E0B A;  4ZCK A;  1QE6 A;  4DXF A;  3AQQ A;  4B3M L;  1BF4 A;  1N33 Q;  3NWS A;  5IOD A;  2N88 A;  4CDE C;  1NMG A;  1BQQ T;  5IYC G;  2EVB A;  4XIG S;  5DLQ E;  4PG3 A;  2OT2 A;  2HDM A;  4CDF C;  2H5X A;  1H95 A;  1I6H H;  4JI8 L;  4ZQ3 A;  3OYY A;  3R3O A;  1NJI C;  4AQY Q;  1UUP A;  4DAY A;  3MVV A;  1DZ1 A;  4KN4 C;  1I4X A;  1UEA B;  2F52 A;  5D14 A;  5EBC A;  4J15 A;  1O78 A;  3L2P A;  4JBK A;  2RF4 A;  2WB1 B;  5C3X A;  2UUB Q;  4KV6 A;  1G6P A;  4DNT B;  2E5L L;  1SNQ A;  2E2H B;  1JJC B;  2LY7 A;  2Q8I B;  3DWA A;  4C3J H;  3L9A X;  2F4V L;  3BDO A;  4K14 A;  5KEE A;  1QZG A;  3VYT A;  4GOP B;  4TSS A;  2I0Q A;  4BBS G;  1E1O A;  2ENB A;  2RDH A;  1HZA A;  3HRZ C;  2HD3 A;  1VQA A;  4DK6 C;  3F2B A;  2PMZ E;  2OEO A;  2UUC L;  1KAA A;  2K52 A;  4C1N I;  1D5Z C;  3HP3 A;  3CPF A;  3HEJ A;  3PQI A;  1NR4 A;  2YYZ A;  4R9W A;  3R2I A;  2NB0 A;  4RMF A;  1X3G A;  4A3E B;  2CCZ A;  4K5V A;  3X3N A;  4OL7 A;  3Q8D A;  4BS9 A;  4A3C G;  1EU3 A;  1KHI A;  4I7A A;  3HOX B;  4L5Q A;  1VF7 A;  3K5N A;  2K05 A;  3G7L A;  1IL8 A;  5A2Q L;  1DJR D;  4UP8 A;  1EOV A;  4ZK9 B;  4BY7 H;  3S1N B;  4FF2 A;  2Z9H A;  1X3E A;  3LWU A;  2J4X A;  4DV4 L;  3HS0 C;  1U9R A;  1GUS A;  3S15 B;  4MN3 A;  4C1N K;  5IOC A;  4IOC A;  1PRT F;  3I4N G;  4JI1 Q;  4KKS A;  1K8G A;  4NMZ A;  3T53 B;  2KHJ A;  3DXJ C;  5AJ3 L;  5I4D A;  3NBH B;  4Q0F A;  1M1K C;  1EWI A;  1FJG Q;  3EVQ A;  2PZT A;  2FHT A;  1V9P A;  4BY1 G;  2ZXR A;  3J80 L;  1UE6 A;  1N33 L;  4R4Q A;  4LNQ A;  3G71 A;  1HNX L;  2KVM A;  1TS4 A;  4G7Z C;  4BBR B;  3QB3 A;  3DEO A;  5CC4 A;  5K36 G;  4JI6 Q;  3PSI A;  4DV7 L;  3KF6 B;  1STY A;  3I4M B;  4R4T A;  1JE4 A;  3CKI B;  3U4Z A;  3MFG A;  2F0I A;  1WVL A;  2PW7 A;  2K28 A;  4A93 H;  4L6T B;  1CSP A;  1O7Z A;  1ET6 A;  4KJO A;  2B2T A;  4KHZ A;  1DOK A;  2DNE A;  4FO2 A;  1EQQ A;  2VB2 X;  3F2D A;  2EYO A;  1QCB D;  1P16 A;  3I90 A;  1ROD A;  1R4Q B;  2VW9 A;  4PMW A;  3DHQ A;  4KKT A;  1YNJ C;  3A0J A;  3Q22 A;  4RGT A;  1MI2 A;  3T4A C;  1FD7 D;  1KC8 C;  3A8K E;  1E7Z A;  2KA7 A;  3KLS X;  2NTS A;  2B8G A;  4B3T Q;  2DJG C;  1MIU A;  2JEA I;  4DN4 M;  1P8L A;  5M5X H;  1JB3 A;  2WFW A;  3CMA A;  2MFI A;  4NW2 A;  1A3U A;  2FXQ A;  4HJ7 A;  4IOA A;  2UXC L;  1I94 Q;  1BDO A;  2MO0 A;  1Y8O B;  3CP0 A;  4KK7 A;  1DD2 A;  3QIA A;  3GD7 A;  4A3D G;  2K04 A;  2R92 B;  2XRS D;  2D2C C;  3Q0A A;  4DK1 A;  1CA5 A;  4DAP A;  3CCQ A;  2QKI C;  4K0K L;  1WYD A;  2BOS A;  1GUO A;  4U68 A;  1PTO F;  3ND9 A;  1ESF A;  5C4H A;  3VR5 A;  1K9M C;  3VR6 A;  3E0J A;  1QZH A;  5I6W A;  3HOU G;  2IY5 B;  3HKZ G;  1EYG A;  1PTO H;  2NVT H;  4YHH Q;  2R93 H;  4OEM B;  4KHV A;  2R7Z H;  1CFM A;  3D8G A;  3J7Z C;  4C2M H;  2B39 A;  1YNJ D;  3ULJ A;  2MO1 A;  4KY6 A;  1I50 H;  5C44 G;  5BN3 A;  2EYF A;  2G9H D;  2PZW A;  3UDG A;  4HIM A;  1TWF H;  1TY0 A;  1Q1E A;  4K6L A;  4DV3 Q;  4MZ9 A;  3W1B A;  1QNK A;  2JA6 G;  3CQZ B;  4LF7 Q;  2F0J A;  2BDN A;  2DJF C;  3RMH A;  1SAP A;  3M4O H;  3DM3 A;  4X3K A;  1WCM G;  1K8O A;  1STA A;  2EOT A;  1PH8 A;  2PQE A;  3BU2 A;  2HUG A;  3H91 A;  2DNC A;  2I46 A;  1LTG D;  3F8T A;  1K83 H;  4GLX A;  1IBK Q;  4LFA L;  2RHS B;  3UE1 A;  1F9Q A;  1CKN A;  2D0P A;  1QUQ B;  1PZJ D;  2CHB D;  2JA7 H;  1XNR L;  5IIF A;  1WTH A;  5C0X J;  1GM5 A;  3PF5 A;  2R3Z A;  4HID A;  3SK4 A;  1V1O A;  4X62 Q;  5IYC H;  4F87 A;  3ULL A;  3VR2 A;  4GLA C;  1XPU A;  5C0X H;  5EBD A;  1X32 A;  4JI5 L;  2FMM A;  2PNR C;  3DWP A;  2F03 A;  3TSS A;  1MGS A;  4HMJ A;  2JP1 A;  4NXM Q;  5M3F G;  2K1B A;  2ZJP A;  1U4R A;  3NWT A;  5IYD G;  1DON A;  1JJG A;  2C9O A;  5M3M B;  3KF8 B;  2ZXO A;  2JEB I;  3CCV A;  1TII D;  5IP7 G;  5E1F A;  3V96 A;  2MQH A;  4KTA A;  1A3V A;  1BBX C;  4U67 3;  3M3Y B;  1F2L A;  4IPH A;  4OWX B;  4L8J A;  5IGG A;  4L5T A;  4EQP A;  2MP1 A;  3IFD A;  4BBS H;  1DOL A;  2IWH A;  2B3G A;  1MJC A;  1IKL A;  3QG1 A;  3KLR A;  5I2X A;  2RSN A;  3NTH A;  1CK1 A;  3GV6 A;  2ZJQ A;  1S5C D;  2H1E A;  5BN4 A;  2UU9 L;  2OF1 A;  2Y0S E;  3K0Y A;  1UNS A;  4TRD A;  1Z7T A;  1GJX A;  4DUY L;  1WTP A;  4A3K G;  2NVT B;  3S1Q B;  2BE5 C;  4A3C H;  4LF4 L;  2KCC A;  1B3A A;  4K8I A;  3GTO H;  1E3P A;  2NN6 H;  4YWM A;  2R7Z B;  2Z4H A;  2YTV A;  3NQI A;  3ZYY X;  1XYI A;  1QNU A;  5C5M A;  4QUF A;  2CVR A;  3AU7 A;  2K5D A;  4LF8 L;  1LAC A;  1EIF A;  4YCU A;  3PMF A;  3GO5 A;  2LKV A;  3HG9 A;  2JSO A;  1OTC A;  2JJQ A;  5JJZ A;  3HOZ G;  2FJ2 A;  1VQ4 A;  3A8J E;  4ME5 A;  5JEA J;  3S14 H;  1Y1V G;  4LW1 A;  1UE5 A;  2ZTC A;  5IGE A;  4JI3 Q;  4S3S A;  2HT1 A;  4XYQ A;  3S17 B;  4F8M A;  2JA8 H;  4A3B H;  4BY1 H;  2Q2T A;  4N9T A;  5J1Z A;  2QA4 A;  1LLR D;  4POG A;  3AB9 A;  4JV5 Q;  4EQN A;  3T1H L;  1STH A;  4JBW A;  2B2U A;  3E3X A;  2UXB Q;  1LTI D;  2LSS A;  1VQN A;  2CFM A;  5M5W H;  4NXM L;  4ZUI A;  1T9H A;  2EYL A;  1LUZ A;  1H9S A;  4OX9 Q;  1QJO A;  4CKB A;  1VQC A;  1ILP A;  1J9O A;  5E3F A;  2VZA A;  3ND8 A;  4UHV A;  3TME A;  1MHW C;  1EEF D;  5JJL A;  3IKJ A;  4LF9 Q;  3G4S A;  2PI2 E;  4DV2 L;  4NKL A;  3CCJ A;  1B70 B;  4DXG A;  4IQZ A;  2NVQ H;  2WAQ G;  2E75 C;  2B2Y A;  1YJW A;  4HJ8 A;  1R9T H;  1XNQ Q;  4IZ8 A;  1SRO A;  4IUR A;  1HA5 A;  4DR7 Q;  5CBE E;  4JOI A;  3URY A;  1LTR D;  4C3H H;  5ISR A;  4C3J G;  4A3L H;  3SK5 A;  1EUJ A;  1VQD A;  1F2Y A;  2F0V A;  3W3A A;  5C0X I;  4DV0 Q;  4BBS B;  1ENA A;  4DV1 Q;  3E0E A;  2VL6 A;  4QUC A;  4QGU A;  1J5E L;  3NSW A;  3EIV A;  5G3L F;  5L37 A;  2UUA L;  1OXU A;  1N32 Q;  3EBE A;  4LFB Q;  1OXS C;  1PH7 A;  1TVX A;  4OIK A;  1I4G A;  2L1B A;  1PH1 A;  5C4Z A;  1V1Q A;  3MXN A;  1HQM C;  4KJN A;  1RCV D;  4GKK L;  3D4D A;  2F1M A;  4HIO A;  5EKL A;  1PVO A;  4EQO A;  3HOU H;  1N36 Q;  1SE2 A;  1PHJ A;  2L0C A;  1D2B A;  4BY7 G;  2WB1 E;  2IL8 A;  5J3B A;  4JI3 L;  2SOB A;  2ES2 A;  3CU7 A;  4CHT B;  1SXT A;  1NMF A;  4O42 A;  4DV6 Q;  4DR3 Q;  3GTQ B;  4G7O C;  1F77 A;  5BR8 Q;  4DGZ A;  3I4N B;  3FPP A;  3LX0 A;  2YTY A;  1N34 L;  5C44 H;  1PMR A;  3TQY A;  1QVC A;  4HIK A;  1BVS A;  2ALY B;  1JOQ A;  2F0N A;  1CI3 M;  1GUT A;  4LJZ C;  4DK0 A;  5C3W A;  1B2T A;  3NTI A;  3A7L A;  1TS5 A;  4BY1 B;  1JWS D;  1JOO A;  1VQM A;  4JPB W;  2JA6 H;  3GTJ B;  2NN6 I;  3A54 A;  5GAH C;  2Z0S A;  4OX9 L;  5CGK A;  2K5N A;  2SNS A;  3S2H H;  2K4K A;  4XT1 B;  2O5I C;  5CYU A;  1RKN A;  4PQX A;  4DFA A;  3H3V C;  2XTI A;  2QEX A;  1BO0 A;  1CQV A;  1E2Z A;  4HED A;  3CPW A;  4OIJ A;  1EIG A;  3OIQ A;  2ZTE A;  1PH6 A;  4A93 G;  1F9S A;  1PH5 A;  1I4R A;  3GTM H;  1C4Q A;  3U50 C;  4RWS C;  2A73 B;  4L5S A;  2EPB A;  3FEW X;  4DR7 L;  4A3F B;  3S2D H;  4BA2 I;  3MXP A;  4EQ5 A;  2UXD Q;  4IUU A;  3CC7 A;  3G48 A;  4R1J A;  1PRT C;  4X6A H;  2C5C A;  2Q2U A;  4IJL A;  3MHB A;  1K73 C;  4DV1 L;  3CAM A;  5FJ8 H;  4YCV A;  1V1P B;  3RZD H;  4IUV A;  1SNO A;  4J8Q A;  1YZ6 A;  2KCN A;  1VQO A;  3GTG B;  5IGD A;  3C2P A;  1AFP A;  3FPU B;  5T1G A;  3VA7 A;  5JJK A;  1AE2 A;  2K5H A;  3M85 A;  1Q82 C;  1ZEQ X;  1S4Z A;  2F0M A;  5IYB G;  3GTL B;  2A6E C;  4UP7 A;  1HNZ Q;  3JAM c;  1K3B C;  4ABN A;  1ONL A;  2AUK A;  4GN3 B;  3RLO A;  5C3E H;  4A3D B;  2QW7 A;  2NVY H;  4YIJ A;  1HR0 Q;  2EY6 A;  3N52 A;  2R61 A;  1Z9F A;  3ERQ A;  1JCK B;  4ZRZ A;  3D6C A;  1LTS D;  1Q7Y C;  4JC0 A;  1BCP B;  3Q24 A;  1XMQ Q;  2E76 C;  2P5Z X;  3HKZ B;  3UE0 A;  1IL2 A;  1LYL A;  1O7Y A;  5IGF A;  1S5E D;  1KL9 A;  1SBB B;  2R93 G;  5M5Y B;  1VQG A;  3ULP A;  1WD1 A;  3IL8 A;  3BVZ A;  2IX3 A;  3PO3 G;  1W2B A;  1PRT D;  4A75 A;  2KHI A;  3W5O A;  1SFO B;  4JI4 L;  4KHP L;  1UWV A;  4DU9 A;  4LK1 C;  2KJX A;  2BDO A;  3E9I A;  1LO5 D;  4CGY B;  2K03 A;  5E7N A;  5C4X H;  3F2C A;  1TWA B;  2E8G A;  3HOZ H;  3H0G G;  1VQL A;  1FGU A;  1Y1V H;  4BWG B;  1STN A;  3CME A;  2B63 H;  4DV5 Q;  5EGT A;  3J80 i;  3NK9 A;  3OTO Q;  1JC7 A;  1WCM B;  2CWA A;  2JYO A;  4UAI A;  4HR7 B;  1DXM A;  2A6E D;  3PCO B;  1R4P B;  4X66 L;  5J22 A;  1IBM Q;  1J6Q A;  3I72 A;  4JVZ A;  1GHJ A;  1EIY B;  2L15 A;  2DGY A;  1IHZ A;  1L1O A;  1K0R A;  3ERO A;  3QWN A;  1WI5 A;  3F1Z A;  2JA7 G;  1F9P A;  4X64 L;  2CQO A;  1HZ9 A;  2LS0 1;  2KOL A;  2B2Y C;  1PYS B;  2XSC A;  3S24 A;  2EY1 A;  1LTT D;  5C0X G;  4JI7 Q;  4JOI C;  1KDA A;  3VYR A;  4DR4 Q;  1N9W A;  5D65 A;  4GKJ L;  1WTV A;  4RH6 A;  5M3F B;  2CH4 A;  3ERS X;  1VQE A;  3A55 A;  4FF4 A;  5DNF A;  4DNR B;  1ZXT A;  4QY7 A;  4CKC A;  3U9O A;  3CCE A;  2HHH Q;  1YJ9 A;  1LM0 A;  1X3F A;  5FKA C;  1HNW Q;  2Z6B A;  1Q8I A;  4LWC A;  4C3I G;  1FR3 A;  1YHQ A;  5ELN A;  1HQR D;  4JI0 Q;  3PUX A;  2EYJ A;  3N6R A;  3I7F A;  2WKD A;  4JI2 L;  2RCF A;  2WP8 J;  4UPA A;  4XQN A;  1GKH A;  4CKE A;  2A68 C;  4ME3 A;  4UDU C;  3S16 H;  4MTN A;  1D1K A;  1B8A A;  1A2T A;  4HCE A;  4P2C B;  3TP7 A;  1PTO D;  3K59 A;  3T16 A;  1IBL L;  2R6G A;  1KRT A;  3RZO B;  4ZUJ A;  3OW7 A;  5J39 A;  4A3K B;  3H3V H;  3B6Y A;  5JPN C;  2I5L X;  1A3T A;  3S1R B;  4ILW A;  2NN6 G;  3E9H A;  3HOV H;  4Y7N H;  2K75 A;  1XX8 A;  1X65 A;  2M00 A;  2BH8 A;  4TVA B;  2B29 A;  4QB4 A;  5C4J H;  2AKW B;  1B9N A;  3M7N A;  5I9P A;  3PV0 A;  1QG7 A;  2BA0 A;  2DN8 A;  1H9K A;  1K8A C;  1SSO A;  2N8N A;  1Y1V B;  3NE5 B;  3KUP A;  3A8I E;  2KED A;  2RKS A;  4A3I H;  5CV8 A;  1I3Q H;  2JA8 G;  4A3B G;  3Q6S A;  3RNU A;  4XQQ A;  1TWC H;  1LT4 D;  4GS3 A;  1AZP A;  3OPO A;  1EY8 A;  3J81 c;  4DR2 Q;  4UY8 C;  5GAD C;  1STG A;  5EJW A;  3L0O A;  1NY4 A;  2NZH A;  1VQJ A;  5COR A;  4F7X A;  3ER0 A;  2A68 D;  1C7Y A;  1EY7 A;  4AQY L;  4PMB A;  1I5F A;  2I07 B;  2YTX A;  2N78 A;  3NHH A;  4GOP A;  1VQ6 A;  4WJ3 M;  1WD0 A;  4A3G H;  1HFN A;  4FYD A;  1ZYR C;  2UUB L;  2HHH L;  1I6H B;  4NXN Q;  1KDB A;  1O7I A;  1YHA A;  1MJE A;  4OGQ C;  4LFC Q;  2WAQ B;  2XIW A;  4DAV A;  2VS1 A;  2EDG A;  4H44 C;  2OQK A;  1L0Y B;  1AE3 A;  4FXD A;  1HZB A;  3OIP A;  1Q90 A;  4HJ9 A;  4V19 0;  2AHO B;  3PGZ A;  2EQS A;  4C3H G;  4C3J B;  4A3L G;  3NTK A;  3K57 A;  2F0F A;  1DOM A;  3K7A H;  3KJP A;  4A3J H;  1SRU A;  3MXU A;  1DGS A;  3M7G A;  1K8M A;  3GTK H;  5IYB H;  1OXT A;  4P73 A;  4O2D A;  2J0T D;  3NBH A;  1UE1 A;  1VQB A;  2Z6K A;  3I91 A;  1X56 A;  4OHJ A;  3SXH A;  1Q86 C;  4B3S Q;  1G6Z A;  2RQX A;  1SYD A;  5LL6 X;  1E24 A;  1YVC A;  3NXW A;  1BKB A;  1XWE A;  2ZM6 Q;  3CC4 A;  4XTC S;  1W6K A;  1X55 A;  2D0O A;  2JA9 A;  4JI1 L;  5DM7 3;  3P20 A;  3QJY A;  5COY A;  1FYC A;  1FJG L;  5JAV A;  1ZYR D;  4V0B A;  1PH2 A;  4BY7 B;  3KF6 A;  5GRO A;  1YI2 A;  4L63 B;  1SMY C;  1L0X B;  3BVM A;  3P75 A;  3ITP A;  5KNC A;  1M8A A;  4LUO A;  1YJN A;  1F2M A;  3AYH B;  3PO3 H;  4DR1 Q;  2PCF B;  2AMC B;  1FGB D;  2FIN B;  4E6I A;  1T5E A;  4KY5 A;  1UE7 A;  2DY8 A;  1PDQ A;  2OTL A;  2CQA A;  4JI6 L;  3BG3 A;  5LMN Q;  1EQV A;  3U58 A;  1LT3 D;  1A2U A;  3H3V I;  3H0G H;  1TWC B;  2QCP X;  3WDN A;  4NPS A;  1UAP A;  2CWP A;  1L1O C;  3BVG A;  3T51 B;  2F0P A;  1GO3 E;  2YV5 A;  3ICE A;  1DCZ A;  1U4M A;  2GA4 B;  1EZ6 A;  4PZ6 A;  3HOY G;  1G51 A;  3WOE A;  4YY3 Q;  3CF5 A;  3D3R A;  4OEL B;  3J81 L;  4A93 B;  2J7Z A;  3HOW H;  1CTM A;  1ZKO A;  2NYZ D;  1LT6 D;  3CRL C;  1EYC A;  2H4O A;  1W3S A;  4CJ2 C;  3T1Y Q;  3VDY A;  3EQL C;  4AIM A;  1SNP A;  3SHL A;  4B3T L;  4BXX G;  5I2Y A;  3MEF A;  3TS0 A;  2LFN A;  4GNX A;  1U4P A;  1Q12 A;  4N9P A;  2F0S A;  4IO9 A;  1EOT A;  1BBU A;  3X3M A;  5DM6 3;  1PFM A;  5FJ8 G;  2A1A A;  1I94 L;  3R93 A;  5FOB B;  5IP9 G;  4DR6 Q;  3C3L A;  1TS3 A;  5EKI A;  1MD2 D;  3K80 C;  3D4R A;  5M5X B;  4MNO A;  3OWE B;  1PFN A;  1A63 A;  1YIT A;  2AUJ D;  1NR2 A;  4C3I H;  5IWA Q;  3K7A B;  2L9H A;  4LUV A;  1HUN A;  4XQJ A;  2F0O A;  1EL0 A;  1EYA A;  1X9N A;  2PQA B;  5G3L D;  1S5B D;  1QIL A;  3OMG A;  3RD4 A;  4ZKB B;  3VYS A;  3K6O A;  5C3E G;  3K5M A;  2KQ3 A;  3RLF A;  4YHH L;  1RL2 A;  2D5D A;  1WOC A;  1QB5 D;  3CCL A;  2XVS A;  4QQB X;  2MNA A;  1KLG D;  3EFX D;  3J7A F;  1BUV T;  4DR1 L;  2NZO A;  1KAB A;  3TN2 A;  1SYB A;  1PTO B;  4DV3 L;  1OXV A;  2R93 B;  1L2F A;  4QF4 A;  1PH3 A;  1QWY A;  2KEC A;  4JYA Q;  4LF7 L;  4AYB G;  1KLU D;  3SDZ A;  2TSS A;  4C2M B;  2F0G A;  1QUQ A;  2YU9 H;  1I50 B;  3TDQ A;  1BBW A;  2DUD A;  1TWF B;  5C4X G;  3RR5 A;  4RGM A;  3GTP H;  2L55 A;  5KNB A;  1Y1W G;  3H0G B;  3UDF A;  3KLS A;  4OO1 H;  1IBK L;  4G4K A;  2B63 G;  4ID6 A;  3MWY W;  3QOJ A;  3M4O B;  1TKW B;  3BZK A;  4TQU S;  3NQT A;  5JEA H;  1JT8 A;  2IJ0 A;  2WKC A;  3W1G A;  1Y8N B;  2IPK D;  4GOP C;  1LT5 D;  3PUZ A;  2L12 A;  3SK8 A;  4X62 L;  3K8A A;  1K83 B;  3KF8 A;  3I55 A;  3HKZ E;  4DAM A;  1E1T A;  4IUP A;  1D5X C;  1SDF A;  2RHQ B;  3KFU A;  5IT9 c;  4B3R Q;  2JA7 B;  1TS2 A;  1G29 1;  1RD9 D;  3H09 A;  5LMU Q;  2BH2 A;  2F3I A;  2EY2 A;  3R2T A;  1AEX A;  2VXW A;  3UDI A;  2BE5 D;  4QIW B;  2F0T A;  1Y69 U;  1YEZ A;  1PYW D;  2JA5 H;  3L7Z C;  1II3 A;  3F2U A;  3D0F A;  1PH4 A;  2EJM A;  4RKL A;  5ELB A;  4O0A A;  4H13 C;  2MPM A;  3KK7 A;  2EJG C;  2AQ1 B;  1AW7 A;  2RCN A;  5NUC A;  1SE4 A;  4X65 Q;  2MJ8 A;  2F0Q A;  4QCL A;  2XGT A;  2Z6K C;  3BS1 A;  4ZYS A;  5C5L A;  1TQO A;  2E2I H;  1I4H A;  1FNV A;  1ICW A;  1C48 A;  2EE1 A;  5FLM H;  1TWH H;  1KRS A;  1CSQ A;  2K01 A;  5EPL A;  1J8I A;  3CCU A;  1JB7 A;  2D9U A;  2VNU D;  2ASB A;  1B9M A;  3W2D A;  4YWL A;  2TMP A;  2E2J H;  4LUZ A;  3OOC A;  2NVX H;  1MKH A;  4A3M H;  4MHE A;  3MC0 B;  4XXE A;  3HOV G;  3MEH A;  3GTO B;  3E6Z X;  1PH9 A;  3S1M H;  1IKM A;  2QGQ A;  3H6M A;  1EY4 A;  2QF7 A;  1DYQ A;  1Q3L A;  3AEV A;  1BCP F;  1B3Q A;  5FLX c;  4IUN A;  5LL6 S;  3GTP B;  3NEM A;  2VQE Q;  5F2D A;  4JV5 L;  2KEN A;  5H1S E;  3S14 B;  4NDX A;  3IRB A;  2PYK A;  4A3I G;  2JA8 B;  1KD1 C;  2UXB L;  2F0E A;  4A3B B;  1H9J A;  5EPJ A;  4DUZ Q;  1MSG A;  1EQR A;  1MSH A;  3KYH C;  2ICI A;  1HR0 W;  1SJE D;  2QIL A;  3FKI G;  4CJ1 B;  3HOY H;  1H9M A;  3A74 A;  3STB C;  4LF9 L;  1HZC A;  4LF5 Q;  3SEB A;  5M5W B;  1SYG A;  2ZT9 C;  4OO1 I;  2XNA C;  1SND A;  4GNX C;  2QDL A;  1QOH A;  2I5M X;  2ICE C;  1ENF A;  4K2K A;  4A3G G;  1XNQ L;  3PUW A;  4JW0 A;  2GVA A;  3I4L A;  4RCN A;  3AFQ A;  1YHB A;  4LF6 Q;  3K5O A;  1ICF B;  5IT9 L;  3NUC A;  1JMC A;  1RF2 D;  3UDX A;  4BXX H;  1AP0 A;  3T56 B;  2EJF C;  2JXM B;  2NVQ B;  1WJJ A;  2CW0 C;  2ATW A;  2Z4I A;  4ULL A;  3LGJ A;  2E74 C;  4DV0 L;  1R9T B;  3PO2 H;  3NEL A;  2GN5 A;  4JK1 C;  1CA6 A;  4OON A;  2AQ3 B;  4FVM A;  3V05 A;  2B2V A;  1NAP A;  4XYO A;  5IP9 H;  3M4P A;  2FMC A;  4C3H B;  1S72 A;  3SGI A;  3J7A V;  1N32 L;  3GQB A;  4NB3 A;  4LFB L;  2VB3 X;  3EN2 A;  3MZ5 A;  1VF5 C;  4K5W A;  1WTW A;  4A3J G;  3MXG A;  4JBJ A;  2E2I B;  4K2L A;  4Q5V A;  5BN5 A;  5CR3 A;  4KLK A;  3SR1 A;  1TWH B;  4B3M Q;  2HIX A;  1I4Q A;  5JPM C;  1N36 L;  5HGT A;  1V8Q A;  3KLW A;  3KDF A;  2O2L D;  5M3M G;  2E2H H;  4DV6 L;  4DR3 L;  4JI8 Q;  2LXK A;  5BR8 L;  2WAQ E;  4BA1 I;  4KN7 C;  3C1E A;  4WJW A;  3I2Z A;  3HOU B;  3S1M B;  3NEN A;  3VA5 A;  2AQ2 B;  4G57 A;  4IFD J;  2WII B;  4GLV B;  2Z1C A;  5K5P A;  3PIO 3;  3MAQ A;  3G6E A;  2K7V A;  1TR5 A;  2XWJ B;  2E5L Q;  1S40 A;  2IX1 A;  1EYD A;  4IFD H;  1B53 A;  5KGU A;  2Z8L A;  3A5Z B;  5GQO A;  5C44 B;  4DAY B;  1PZK D;  1U4L A;  3AMU A;  3ONA B;  1WTR A;  1X3P A;  4GN5 A;  1PLF A;  3BZC A;  5EQ0 A;  4R8I A;  1BNZ A;  1VMC A;  4H0L C;  5FK9 C;  1I6V C;  3M4Q A; 
#chains in the Genus database with same CATH homology
 3IAY A;  2PO4 A;  5FLX L;  2JA6 B;  1CHP D;  2ZXP A;  3J81 E;  3S2H B;  5FO7 B;  3V2T A;  1V1P A;  3DM1 A;  4KD4 A;  2DY7 A;  3DMU A;  5TSS A;  4ZLT F;  3GTM B;  2Q8R E;  1Y8P B;  5CBA E;  1GUW A;  1STB A;  2RBM A;  2WAC A;  2D62 A;  1F9R A;  3S2D B;  1W6J A;  2F3W A;  1C8C A;  1FNU A;  2L5T A;  3RZD B;  5CMD A;  1EY0 A;  1KNA A;  1BOS A;  2EYM A;  5ELF A;  3SK6 A;  1JR0 D;  3KBG A;  4G7H C;  4IUT A;  1IYU A;  4FP5 D;  4MIU A;  3VYU A;  5CV9 A;  3P7J A;  5C3E B;  4EGV A;  5KRU A;  2NVY B;  1CQF A;  2MHV A;  1HUM A;  3JAM L;  1AN8 A;  1PXU A;  1KNE A;  4KI0 A;  1IYV A;  1WTQ A;  4B9X A;  1YNN C;  3BDC A;  2EZV A;  4K8J A;  2RVL A;  4X3S A;  1STE A;  4AYB B;  1HRJ A;  2NZ1 D;  3HZX A;  1TY2 A;  1SYF A;  3OSO A;  2A74 C;  4RAU C;  2L4N A;  5C4X B;  1B4O A;  1ENC A;  1HFG A;  3HOZ B;  2HDL A;  1Y1W B;  1SNC A;  5I9O A;  4OO1 G;  1OXX K;  1S5F D;  1T5X D;  1PZI D;  2B63 B;  2HCI A;  2EYP A;  1JIC A;  5D3I B;  4DA2 A;  5JEA G;  4IFD I;  3M4Y A;  1KDC A;  5JVH 3;  2PPB C;  4QMG A;  2XN9 C;  4WFN 3;  4WOR A;  2A6H C;  5M9O A;  1B1Z A;  2K5W A;  1D5M C;  1Q1B A;  2M2L A;  3DUZ A;  4J6H A;  3E5S A;  1YNN D;  2SNM A;  1NCV A;  4ZKC B;  2B2V C;  5ELE A;  4I65 A;  4B08 A;  1TWG B;  3FVQ A;  1HPC A;  4HSP A;  1MBY A;  3A7A B;  2K5Q A;  3PUV A;  3GV3 A;  1A15 A;  2XRQ D;  3S16 B;  4FF1 A;  2G9D A;  4X3T A;  1CM9 A;  1LV9 A;  2WV6 D;  2B2W A;  3SE0 A;  4FXG C;  4PMC A;  5JVG 3;  2A6H D;  2SDF A;  2EXZ A;  2WIN B;  1NUC A;  2L11 A;  5FO8 B;  2KHS A;  3TP6 A;  3S9W A;  1HHV A;  4XT3 B;  3HOV B;  4HN7 A;  1HTL D;  4Y7N B;  2E2D C;  5I6Y A;  2F0U A;  4RKB A;  5C4J B;  1EIH A;  3TZU A;  2LMC B;  1EU4 A;  1JQY D;  4RA8 A;  3I8Z A;  1SYE A;  1EY5 A;  4A3I B;  1PRT B;  1IW7 C;  1I3Q B;  1O80 A;  3H94 A;  1VCI A;  3K58 A;  3LNN A;  3GP7 A;  2K32 A;  3PIP 3;  3FKI B;  5CV5 A;  1AZQ A;  4RHS A;  3TP5 A;  3OMC A;  5IT9 E;  3BYT B;  1O7L A;  2QEJ C;  4A3G B;  4B9W A;  4DF7 A;  2IX0 A;  2F0K A;  5KND A;  3EJI A;  3I70 A;  1GXD C;  3A56 A;  2XWB B;  2KEE A;  1CZG A;  4RGN A;  1BCP C;  4RFB A;  1D1I A;  4ZAI A;  3J7Y W;  2B8F A;  1KTK A;  1SMY D;  4NP5 A;  2AWO A;  3D6W A;  2PMZ B;  4ODG A;  1IW7 D;  4A3J B;  3T13 A;  3GTK B;  2ID0 A;  2Q8T A;  1TU2 B;  2F0L A;  5JOB A;  4R8N A;  1GUN A;  1I4P A;  2IT1 A;  3FMC A;  4K5X A;  4GZY C;  1EY9 A;  4CJ0 B;  5KYL A;  1F2Z A;  2O5J C;  4CBV A;  2V4D A;  3NPP A;  5EPK A;  1H9S B;  2X6L A;  4IUQ A;  2JE6 I;  1BXT A;  2OXP A;  3DWQ A;  5AFW A;  2MGS A;  5FO9 B;  4IAL A;  1BCP D;  3EA6 A;  3PO3 B;  4IFD G;  4C56 C;  5FLX E;  2BA1 A;  2F0W A;  3FDT A;  3DEP A;  3MA2 B;  1E2V A;  3OWF A;  1XXG A;  5DEH A;  1SE3 A;  3I3C A;  1HA6 A;  3TP8 A;  5ELD A;  2EY5 A;  1A6X A;  1PFB A;  3HOW B;  2RDF A;  2A69 C;  4O1N A;  3U9S A;  4KD3 A;  4FNF A;  1RJT A;  1SYC A;  3K5L A;  5C6A A;  2K6A A;  1EEI D;  1RTO A;  5KYI A;  5K36 H;  2B2T C;  1Z47 A;  1JWU D;  3WOF A;  4M1U B;  2NUC A;  3C1F A;  1VDZ A;  4EVO A;  3QOL A;  2O4X A;  2RSO A;  1BR9 A;  2EYH A;  4C3I B;  3MFY A;  1EY6 A;  2NWG A;  1G8Z D;  2B2W C;  3O13 A;  3TBI B;  3SVM A;  1EQT A;  4HAE A;  3JAM E;  3IFT A;  1EWH A;  5E4X A;  3I73 A;  2F4I A;  2A69 D;  1EZ8 A;  3BYY B;  2NBF A;  4FF3 A;  1CT1 D;  1G91 A;  3D4W A;  1OO9 B;  4WRD A;  1WTO A;  2YU9 B;  1RTN A;  5E4W C;  2N55 A;  2K33 A;  4PNY A;  5T1I A;  5A2Q E;  1CHQ D;  4HTH A;  3CHB D;  3D31 A;  2X6G A;  1E2W A;  1ILQ A;  4HMI A;  1CZW A;  1B44 D;  4I7Z C;  4KKU A;  1LTA D;  3BZD B;  5D3D A;  2HQE A;  3J80 E;  1D6E C;  3C46 A;  3NBI A;  3L3O C;  1VMP A;  1RHP A;  2F0D A;  2F3V A;  1DM0 B;  4X3U A;  1HXY D;  5IGC A;  3KBX A;  4XDX A;  4J1M A;  1V43 A;  4HCS A;  2JA5 B;  1ET9 A;  1WTX A;  2KUM A;  1RDP D;  3G6J B;  2RDG A;  2SEB D;  1LAB A;  1EWC A;  3RUZ A;  3VR3 A;  3PUY A;  4LMQ D;  3UI2 A;  3Q23 A;  4FXK C;  2PZU A;  2Y0S B;  4M8A A;  1JOR A;  4KMU C;  3OHX C;  1B50 A;  1S5D D;  3P1H A;  1G2T A;  2X69 A;  1FNW A;  2NTT A;  4F88 A;  1SJH D;  2PW5 A;  5CV7 A;  2E2J B;  2NVX B;  1ESR A;  4A3M B;  5A35 A;  1ML0 D;  4RHR A;  3TZD A;  1LTB D;  1TT2 A;  5ELC A;  1EFI D;  1Z6H A;  4RGO S;  5LHY 1;  3HGB A;  1GHK A;  2BCO A;  2RA4 A;  4K6D A;  2CW0 D;  2F0H A;  1XTC D;  3NP8 A;  1GUG A;  4H7B A;  4HSV A;  3CRK C;  3MTS A;  2MUY A;  2IW3 A;  1M4V A;  2A5H A;  3FRP B;  5KIX A;  4PV1 C;  2HCC A;  3R8B A;  4LAA A;  1H9R A;  4TKO B;  1JWM D;  2M9V A;  5CV4 A;  4Z9C B;  1JOK A;  5HUR A;  3HOY B;  5IGB A;  1HCZ A;  1SEB D;  4KY7 A;  2QDB A;  5EKK A;  4IN3 A;  1G2S A;  4RCO A;  1HTP A;  2VUM B;  1NSN S;  1SNM A;  1GOZ A;  2B2U C;  5CV6 A;  1X3Q A;  2AWN A;  3LWE A;  5DAU A;  3VR4 A;  3BDL A;  3QO2 A;  3PO2 B;  1PTO C;  2FFK B;  1E0B A;  1QE6 A;  4DXF A;  1BF4 A;  3NWS A;  5IOD A;  2N88 A;  1BQQ T;  2EVB A;  4XIG S;  2OT2 A;  2HDM A;  4ZQ3 A;  3R3O A;  1UUP A;  4DAY A;  3MVV A;  1DZ1 A;  4KN4 C;  1I4X A;  1UEA B;  5D14 A;  5EBC A;  1O78 A;  2WB1 B;  5C3X A;  4KV6 A;  4DNT B;  1SNQ A;  2E2H B;  2LY7 A;  2Q8I B;  3DWA A;  3L9A X;  3BDO A;  4K14 A;  5KEE A;  3VYT A;  4TSS A;  2ENB A;  2RDH A;  3HRZ C;  2OEO A;  1KAA A;  4C1N I;  1D5Z C;  3HP3 A;  3HEJ A;  1NR4 A;  2YYZ A;  4R9W A;  3R2I A;  2NB0 A;  4A3E B;  4K5V A;  3X3N A;  4OL7 A;  4BS9 A;  1EU3 A;  3HOX B;  1VF7 A;  3K5N A;  2K05 A;  3G7L A;  1IL8 A;  5A2Q L;  1DJR D;  4ZK9 B;  3S1N B;  4FF2 A;  2J4X A;  3LWU A;  3HS0 C;  1U9R A;  1GUS A;  3S15 B;  4MN3 A;  4C1N K;  5IOC A;  1PRT F;  4KKS A;  4NMZ A;  3T53 B;  3DXJ C;  5I4D A;  4Q0F A;  3EVQ A;  2PZT A;  2FHT A;  2ZXR A;  3J80 L;  2KVM A;  1TS4 A;  4G7Z C;  4BBR B;  3QB3 A;  3DEO A;  5CC4 A;  5K36 G;  1STY A;  3I4M B;  1JE4 A;  3CKI B;  3MFG A;  2F0I A;  1WVL A;  2PW7 A;  2K28 A;  4L6T B;  1O7Z A;  1ET6 A;  4KJO A;  2B2T A;  4KHZ A;  1DOK A;  2DNE A;  4FO2 A;  2VB2 X;  2EYO A;  1QCB D;  3I90 A;  1ROD A;  1R4Q B;  4PMW A;  3DHQ A;  4KKT A;  1YNJ C;  3Q22 A;  4RGT A;  1MI2 A;  3T4A C;  1FD7 D;  3A8K E;  3KLS X;  2KA7 A;  2NTS A;  2B8G A;  2JEA I;  4DN4 M;  1JB3 A;  4NW2 A;  1A3U A;  1BDO A;  1Y8O B;  4KK7 A;  1DD2 A;  3QIA A;  3GD7 A;  2K04 A;  2R92 B;  2XRS D;  2D2C C;  3Q0A A;  4DK1 A;  1CA5 A;  4DAP A;  2QKI C;  2BOS A;  1GUO A;  4U68 A;  1PTO F;  3ND9 A;  1ESF A;  5C4H A;  3VR5 A;  3VR6 A;  3E0J A;  5I6W A;  1PTO H;  4KHV A;  1CFM A;  3D8G A;  2B39 A;  1YNJ D;  4KY6 A;  5BN3 A;  2EYF A;  2G9H D;  2PZW A;  1TY0 A;  1Q1E A;  4K6L A;  1QNK A;  3CQZ B;  2F0J A;  2BDN A;  3RMH A;  1SAP A;  4X3K A;  1K8O A;  1STA A;  2EOT A;  2PQE A;  2HUG A;  3H91 A;  2DNC A;  2I46 A;  1LTG D;  1F9Q A;  1PZJ D;  2CHB D;  5IIF A;  5C0X J;  2R3Z A;  3SK4 A;  1V1O A;  4F87 A;  3VR2 A;  5C0X H;  5EBD A;  1X32 A;  2FMM A;  2PNR C;  3DWP A;  2F03 A;  3TSS A;  1MGS A;  4HMJ A;  2JP1 A;  2K1B A;  1U4R A;  3NWT A;  1DON A;  2C9O A;  5M3M B;  2ZXO A;  2JEB I;  1TII D;  5E1F A;  3V96 A;  1BBX C;  4KTA A;  1A3V A;  4U67 3;  3M3Y B;  1F2L A;  4L8J A;  5IGG A;  4EQP A;  2MP1 A;  3IFD A;  1DOL A;  2IWH A;  1IKL A;  3QG1 A;  3KLR A;  5I2X A;  2RSN A;  3NTH A;  1CK1 A;  3GV6 A;  1S5C D;  2H1E A;  5BN4 A;  2OF1 A;  3K0Y A;  1UNS A;  4TRD A;  1Z7T A;  1GJX A;  1WTP A;  2NVT B;  3S1Q B;  2BE5 C;  2KCC A;  1B3A A;  4K8I A;  2NN6 H;  2R7Z B;  2Z4H A;  3NQI A;  3ZYY X;  1XYI A;  1QNU A;  5C5M A;  4QUF A;  2CVR A;  3AU7 A;  2K5D A;  1LAC A;  3PMF A;  3GO5 A;  2LKV A;  3HG9 A;  2JSO A;  5JJZ A;  2FJ2 A;  3A8J E;  4ME5 A;  5JEA J;  5IGE A;  4S3S A;  4XYQ A;  3S17 B;  4F8M A;  4N9T A;  5J1Z A;  1LLR D;  3AB9 A;  4EQN A;  1STH A;  4JBW A;  2B2U A;  1LTI D;  4ZUI A;  2EYL A;  1H9S A;  1QJO A;  4CKB A;  1ILP A;  1J9O A;  5E3F A;  3ND8 A;  3TME A;  1EEF D;  3IKJ A;  4NKL A;  4DXG A;  4IQZ A;  2E75 C;  2B2Y A;  4IZ8 A;  4IUR A;  1HA5 A;  5CBE E;  3URY A;  1LTR D;  5ISR A;  4C3J G;  3SK5 A;  1F2Y A;  2F0V A;  3W3A A;  5C0X I;  4BBS B;  1ENA A;  4QUC A;  3NSW A;  5G3L F;  1OXU A;  1OXS C;  1TVX A;  4OIK A;  1I4G A;  2L1B A;  5C4Z A;  3MXN A;  1HQM C;  4KJN A;  1RCV D;  3D4D A;  2F1M A;  5EKL A;  4EQO A;  1SE2 A;  2L0C A;  1D2B A;  2IL8 A;  2SOB A;  3CU7 A;  4CHT B;  1SXT A;  4O42 A;  3GTQ B;  4G7O C;  1F77 A;  4DGZ A;  3I4N B;  3FPP A;  3LX0 A;  1PMR A;  1JOQ A;  2F0N A;  1CI3 M;  1GUT A;  4LJZ C;  4DK0 A;  5C3W A;  1B2T A;  3NTI A;  3A7L A;  1TS5 A;  4BY1 B;  1JWS D;  1JOO A;  3GTJ B;  2NN6 I;  3A54 A;  5CGK A;  2SNS A;  4XT1 B;  2O5I C;  5CYU A;  1RKN A;  4PQX A;  4DFA A;  3H3V C;  1BO0 A;  1CQV A;  1E2Z A;  4HED A;  4OIJ A;  1EIG A;  3OIQ A;  1F9S A;  1I4R A;  1C4Q A;  4RWS C;  2A73 B;  2EPB A;  3FEW X;  4A3F B;  4BA2 I;  3MXP A;  4IUU A;  1PRT C;  2C5C A;  3MHB A;  1V1P B;  4IUV A;  1SNO A;  4J8Q A;  2KCN A;  3GTG B;  5IGD A;  3C2P A;  1AFP A;  3FPU B;  5T1G A;  3VA7 A;  3M85 A;  1ZEQ X;  1S4Z A;  2F0M A;  3GTL B;  2A6E C;  4ABN A;  1ONL A;  2AUK A;  4A3D B;  4YIJ A;  2EY6 A;  3N52 A;  2R61 A;  3ERQ A;  1JCK B;  4ZRZ A;  3D6C A;  1LTS D;  1BCP B;  3Q24 A;  2E76 C;  3HKZ B;  1O7Y A;  5IGF A;  1S5E D;  1SBB B;  5M5Y B;  1WD1 A;  3IL8 A;  3BVZ A;  2IX3 A;  1PRT D;  1SFO B;  4DU9 A;  4LK1 C;  2KJX A;  2BDO A;  1LO5 D;  4CGY B;  2K03 A;  1TWA B;  4BWG B;  1STN A;  5EGT A;  3NK9 A;  1JC7 A;  1WCM B;  2JYO A;  4UAI A;  4HR7 B;  1DXM A;  2A6E D;  1R4P B;  5J22 A;  3I72 A;  1GHJ A;  1IHZ A;  3ERO A;  3QWN A;  1F9P A;  2LS0 1;  2KOL A;  2B2Y C;  2XSC A;  2EY1 A;  1LTT D;  5C0X G;  3VYR A;  1KDA A;  5D65 A;  1WTV A;  4RH6 A;  5M3F B;  3A55 A;  4FF4 A;  5DNF A;  4DNR B;  1ZXT A;  4CKC A;  3U9O A;  5FKA C;  1Q8I A;  4C3I G;  1FR3 A;  1HQR D;  3PUX A;  2EYJ A;  3N6R A;  2WKD A;  2WP8 J;  4XQN A;  4CKE A;  2A68 C;  4UDU C;  1D1K A;  1A2T A;  4HCE A;  4P2C B;  3TP7 A;  1PTO D;  3K59 A;  3T16 A;  2R6G A;  3RZO B;  4ZUJ A;  3OW7 A;  5J39 A;  4A3K B;  5JPN C;  1A3T A;  3S1R B;  4ILW A;  2NN6 G;  1XX8 A;  2M00 A;  4QB4 A;  1B9N A;  3M7N A;  5I9P A;  3PV0 A;  1QG7 A;  2BA0 A;  2DN8 A;  1H9K A;  1SSO A;  1Y1V B;  3NE5 B;  3KUP A;  3A8I E;  2KED A;  2RKS A;  5CV8 A;  3Q6S A;  4XQQ A;  1LT4 D;  1AZP A;  3OPO A;  1EY8 A;  1STG A;  5EJW A;  5COR A;  4F7X A;  2A68 D;  1EY7 A;  4PMB A;  2I07 B;  3NHH A;  1WD0 A;  1HFN A;  4FYD A;  1ZYR C;  1I6H B;  1KDB A;  4OGQ C;  2WAQ B;  2XIW A;  4DAV A;  2EDG A;  4H44 C;  1L0Y B;  4FXD A;  3OIP A;  1Q90 A;  4V19 0;  4C3H G;  4C3J B;  3NTK A;  3K57 A;  2F0F A;  1DOM A;  3MXU A;  3M7G A;  1K8M A;  1OXT A;  2J0T D;  3NBH A;  3I91 A;  1G6Z A;  4OHJ A;  3SXH A;  2RQX A;  1SYD A;  5LL6 X;  3NXW A;  1XWE A;  4XTC S;  1W6K A;  5DM7 3;  3P20 A;  3QJY A;  5COY A;  1FYC A;  5JAV A;  1ZYR D;  4V0B A;  4BY7 B;  4L63 B;  1SMY C;  1L0X B;  3BVM A;  3P75 A;  3ITP A;  5KNC A;  1M8A A;  1F2M A;  2PCF B;  1FGB D;  2FIN B;  4E6I A;  1T5E A;  4KY5 A;  2DY8 A;  1PDQ A;  2CQA A;  3BG3 A;  1EQV A;  1LT3 D;  1A2U A;  1TWC B;  2QCP X;  3WDN A;  1UAP A;  3BVG A;  3T51 B;  2F0P A;  1DCZ A;  1U4M A;  2GA4 B;  1EZ6 A;  3WOE A;  3D3R A;  3J81 L;  4A93 B;  2J7Z A;  1CTM A;  1ZKO A;  2NYZ D;  1LT6 D;  3CRL C;  1EYC A;  2H4O A;  4CJ2 C;  3EQL C;  1SNP A;  3SHL A;  5I2Y A;  2LFN A;  1U4P A;  1Q12 A;  4N9P A;  2F0S A;  1EOT A;  3X3M A;  5DM6 3;  1PFM A;  3R93 A;  5FOB B;  3C3L A;  1TS3 A;  5EKI A;  1MD2 D;  5M5X B;  3D4R A;  3OWE B;  1PFN A;  2AUJ D;  1NR2 A;  3K7A B;  2L9H A;  1HUN A;  4XQJ A;  2F0O A;  1EL0 A;  1EYA A;  5G3L D;  1S5B D;  1QIL A;  3OMG A;  3RD4 A;  4ZKB B;  3VYS A;  3K6O A;  3K5M A;  2KQ3 A;  3RLF A;  2D5D A;  1QB5 D;  2XVS A;  1KLG D;  3EFX D;  3J7A F;  1BUV T;  1KAB A;  3TN2 A;  1SYB A;  1PTO B;  1OXV A;  2R93 B;  4QF4 A;  1QWY A;  2KEC A;  1KLU D;  3SDZ A;  2TSS A;  4C2M B;  2F0G A;  1I50 B;  3TDQ A;  1TWF B;  4RGM A;  2L55 A;  5KNB A;  3H0G B;  3KLS A;  4OO1 H;  4G4K A;  4ID6 A;  3MWY W;  3QOJ A;  3M4O B;  1TKW B;  4TQU S;  3NQT A;  5JEA H;  2IJ0 A;  2WKC A;  1Y8N B;  2IPK D;  1LT5 D;  3PUZ A;  2L12 A;  3SK8 A;  1K83 B;  3KF8 A;  4IUP A;  1D5X C;  1SDF A;  2JA7 B;  1TS2 A;  1G29 1;  1RD9 D;  3H09 A;  2EY2 A;  3R2T A;  1AEX A;  2VXW A;  2BE5 D;  4QIW B;  2F0T A;  1Y69 U;  1PYW D;  3L7Z C;  1II3 A;  3F2U A;  2EJM A;  4RKL A;  5ELB A;  4H13 C;  2MPM A;  3KK7 A;  5NUC A;  2EJG C;  2AQ1 B;  1AW7 A;  1SE4 A;  2MJ8 A;  2F0Q A;  4QCL A;  3BS1 A;  4ZYS A;  5C5L A;  1TQO A;  1I4H A;  1FNV A;  1ICW A;  1C48 A;  2EE1 A;  5EPL A;  2K01 A;  1J8I A;  2D9U A;  2VNU D;  1B9M A;  3W2D A;  2TMP A;  3OOC A;  4MHE A;  3MC0 B;  4XXE A;  3MEH A;  3GTO B;  3E6Z X;  1IKM A;  3H6M A;  1EY4 A;  2QF7 A;  1DYQ A;  1Q3L A;  1BCP F;  3GTP B;  4IUN A;  5LL6 S;  5F2D A;  3S14 B;  4NDX A;  2PYK A;  2JA8 B;  2F0E A;  4A3B B;  1H9J A;  5EPJ A;  1MSG A;  1MSH A;  2ICI A;  1SJE D;  2QIL A;  4CJ1 B;  1H9M A;  3SEB A;  5M5W B;  1SYG A;  2ZT9 C;  4OO1 I;  2XNA C;  1SND A;  1QOH A;  2ICE C;  1ENF A;  4K2K A;  3PUW A;  3I4L A;  4RCN A;  3K5O A;  5IT9 L;  3NUC A;  1RF2 D;  1AP0 A;  3T56 B;  2EJF C;  2JXM B;  2NVQ B;  2CW0 C;  2Z4I A;  4ULL A;  2E74 C;  1R9T B;  4JK1 C;  1CA6 A;  2AQ3 B;  4FVM A;  3V05 A;  2B2V A;  1NAP A;  4XYO A;  2FMC A;  4C3H B;  3J7A V;  3GQB A;  2VB3 X;  3MZ5 A;  1VF5 C;  4K5W A;  1WTW A;  3MXG A;  2E2I B;  4K2L A;  4Q5V A;  5BN5 A;  5CR3 A;  3SR1 A;  1TWH B;  1I4Q A;  5JPM C;  5HGT A;  1V8Q A;  2O2L D;  4BA1 I;  4KN7 C;  3C1E A;  4WJW A;  3HOU B;  3S1M B;  3VA5 A;  2AQ2 B;  4G57 A;  4IFD J;  2WII B;  2Z1C A;  5K5P A;  3PIO 3;  3MAQ A;  2K7V A;  1TR5 A;  2XWJ B;  2IX1 A;  1EYD A;  4IFD H;  1B53 A;  5KGU A;  2Z8L A;  5C44 B;  1PZK D;  1U4L A;  3AMU A;  3ONA B;  1WTR A;  1X3P A;  1PLF A;  5EQ0 A;  4R8I A;  1BNZ A;  1VMC A;  4H0L C;  5FK9 C;  1I6V C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...