2EJGC

Crystal structure of the biotin protein ligase (mutation r48a) and biotin carboxyl carrier protein complex from pyrococcus horikoshii ot3
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
69
structure length
69
Chain Sequence
NVVSAPMPGKVLRVLVRVGDRVRVGQGLLVLEAMKMENEIPSPRDGVVKRILVKEGEAVDTGQPLIELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 235aa long hypothetical biotin--[acetyl-CoA-carboxylase] lig
publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 13
structure length 69
sequence length 69
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ejgC00
2K32A 3IKJA 3BDOA 3T51B 1GUTA 3MFYA 3U9SA 5BN4A 5K36H 1H9KA 1HCZA 5K36G 4KN4C 3QG1A 1O78A 1YNJC 4BA1I 4KKTA 3ND9A 2A6EC 4DK1A 4KHZA 3A7AB 2D5DA 3AB9A 2JEBI 3FPPA 1Y69U 3A8IE 1Q1EA 4TKOB 3PUVA 2A6ED 4I7ZC 1ZKOA 1TU2B 3VR5A 2EJGC 4RCNA 3VR2A 1YNNC 2NN6H 3N6RA 1CTMA 3T53B 1E2ZA 2K33A 2A6HD 2NN6G 3HGBA 4DK0A 3M7NA 2E75C 1V43A 4BA2I 2JEAI 1VCIA 2KA7A 2EJFC 3ND8A 4HR7B 2KCCA 3OW7A 1K8OA 2QF7A 2R6GA 2V4DA 2NN6I 2YYZA 1GHKA 2D62A 5KNBA 3PUYA 1K8MA 1PMRA 4G7HC 4JBWA 2B8GA 3RLFA 3CRKC 3QJYA 3VR4A 3I72A 1H9SB 1ZYRC 2EDGA 3GD7A 2CW0C 3DXJC 4PV1C 2BE5D 1Q12A 3PV0A 1CI3M 1O7LA 1ONLA 1VDZA 1Q1BA 4KN7C 1Y8PB 5JEAH 3WDNA 2E76C 3NE5B 5JEAG 1H9RA 4GZYC 2A6HC 2D2CC 2JXMB 2F1MA 4KKSA 1OXXK 1GUOA 1B9NA 1BDOA 1HTPA 2DNEA 1QJOA 2E74C 1FYCA 2EJMA 3P20A 3VR3A 4IFDH 3FMCA 1OXUA 1IW7D 3T56B 2O5JC 4IFDG 3A7LA 4IQZA 3M85A 1IYVA 3A8KE 1VF5C 2K7VA 4JK1C 2JE6I 1IYUA 1Y8NB 3CRLC 1A6XA 4G7ZC 4DNRB 2BE5C 4XTCS 2PNRC 3GQBA 1E2WA 2ZT9C 1GJXA 4LJZC 3H94A 1H9JA 1OXTA 2Q8IB 4KMUC 1GUSA 3LNNA 3M4YA 4L8JA 1T5EA 3SE0A 3QIAA 1FR3A 1G291 5A35A 1IW7C 2A68D 3IFTA 4XIGS 3VR6A 5KNCA 4KKUA 1DD2A 2LMCB 4G7OC 2EVBA 2PCFB 4LK1C 1DXMA 2DNCA 1I6VC 3KLRA 3PUZA 4H0LC 2AWOA 3SDZA 2AUJD 3A8JE 1H9SA 1LACA 1Y8OB 1VF7A 3MXUA 5KNDA 1OXSC 4H44C 1OXVA 3VA7A 2DN8A 4H13C 3L7ZC 1GHJA 1HPCA 2IT1A 1GUGA 4OGQC 1V8QA 2BA1A 2O5IC 1Z7TA 3BG3A 2PPBC 3OPOA 3I73A 1DCZA 3LWUA 5BN3A 1GUNA 3EQLC 4DNTB 3OOCA 1B9MA 1H9MA 4OO1H 2AUKA 3TZUA 4KI0A 2A68C 3D31A 4OO1G 1LABA 2L5TA 3PUWA 3W3AA 5BN5A 1Z6HA 1SMYC 2BDOA 2A69C 3D4RA 3PUXA 1E2VA 2B8FA 1EWHA 3I4LA 1TKWB 1Q90A 5C0XH 1HQMC 1CFMA 2A69D 2BA0A 4TQUS 5C0XG
chains in the Genus database with same CATH superfamily
2QGQA 3PIO3 1SR3A 1BVSA 5BN4A 1XNRQ 3GTGB 3KUPA 5EBCA 1UE5A 2C9OA 2I5MX 1QUQB 3QG1A 5C0XI 4JI1L 3RZOB 2IJ0A 4IUTA 3A54A 3S2DH 4X64L 4NXNQ 1V1PB 3P1HA 3C46A 3ER0A 3HOVB 3NELA 1XNQL 1WCMH 3U4VA 2R7ZB 1F2ZA 2EIFA 4JYAQ 1CSQA 3S9WA 1IBMQ 4RKBA 3M7NA 2E75C 3SVMA 3OWEB 2JYOA 4FNFA 2JA8H 2NN6I 4KD3A 2EYJA 1EY0A 3PMFA 2I07B 3TS0A 1MSGA 4YCWA 3K0XA 3OIQA 1JCKB 3GD7A 4HTHA 5ELFA 1IBKQ 5T1IA 1KXLA 3CC7A 4GN5A 5JEAH 4GZYC 4BBSG 2BCOA 1QJOA 5M3FG 1EU3A 5DM63 3CCLA 3A7LA 1UAPA 4R4CA 4A76A 4DR1Q 1WTOA 1VF5C 2OXPA 1KL9A 1YI2A 4DNRB 4B3SL 2BE5C 4GOPB 3GQBA 3OW2A 1HR0L 1I6HB 2B2YA 4BY1B 4A3BG 3LGJA 2QEXA 3S16H 3H91A 1KIXA 3E6ZX 4LF4L 4A93B 1XPRA 4JCVE 4V0BA 3S15B 1K0RA 3Q23A 4A3FH 4H0LC 4IN3A 1HA6A 2AWOA 1MBYA 4O2DA 3HOUH 1SSOA 3CKIB 1ASYA 4L5TA 1IZ6A 5D3IB 1HQRD 2VXWA 3H3VC 2BA1A 3GTOH 1RHPA 4WJWA 3HOXG 5LMNW 2WB1E 1AZQA 5IGCA 2DUDA 1CK1A 5D3DA 1B7YB 3MXGA 5I9PA 1VQ8A 1B9MA 2FHTA 1U9RA 1UE1A 1K83B 2I0QA 4BY7G 1V9PA 3D4RA 3J7ZC 4OHJA 2XN9C 2QILA 1PDQA 4X62Q 4B9WA 1WTHA 1Y1VG 5C0XG 2BH2A 3K80C 2PZTA 1SNPA 2ICEC 4OWXB 4YY3L 3T51B 4EGVA 1CA6A 2JA5H 1EZ6A 1HNXQ 4LF8L 3HOWH 3HKZB 2R7DA 4IURA 1EY7A 2R92H 1G6PA 2DJFC 3FRPB 4CJ1B 4RAUC 2M2LA 3BU2A 1I4QA 2R93G 1STHA 2VUMH 3H09A 5IP9H 2NN6G 2XVSA 2A5HA 2EY2A 3W1GA 2EJFC 5ELCA 4CHTB 1JICA 1QB5D 3HOVG 4QIWE 1VS0A 3Q0AA 1HZBA 1VQGA 1X3FA 3KBGA 4BBRH 4LUZA 2R7ZG 2AQ1B 1YVCA 5EPJA 1MD2D 2XTIA 2B8GA 1KAWA 3RLFA 4RHRA 4V190 4CDCC 4PV1C 3M3YB 2BE5D 3OHXC 1FGUA 1ONLA 3OWFA 1Q1BA 4WJ3M 4OWWB 5ELBA 3SK6A 4CDEC 4C2MH 2NZOA 3JC66 1BNZA 1VMCA 4EQ5A 5IYCG 1A0IA 1B3QA 4IFDH 3X3NA 1OXUA 2E5LL 2BH8A 5I9OA 4IQZA 1U0LA 3CU7A 4A3EG 3HKSA 2K5WA 2OWOA 1TS3A 4QGUA 1JB7A 1WYDA 3R2IA 1VQ7A 3S1QH 2UXBQ 1S5ED 4JBJA 1LM0A 2XWBB 2YTYA 4HAEA 4KMUC 1GUSA 1PZJD 1QILA 1Y14B 3CF5A 4JW0A 1IL2A 1VQFA 3IFTA 2JA6B 3RN5A 1W6KA 3F2BA 4FF2A 4BY1G 4C3HG 4ZK9B 3PCOB 2DNCA 1Z9FA 2VB3X 5FLMG 3FHWA 3I4MB 1VF7A 5EKLA 2XNAC 4LNQA 1NR2A 4DV1Q 1DZ1A 1DGSA 1DCZA 1TWGH 1A3UA 2HIVA 3PIP3 3TEHB 2E2HH 1LABA 1AEXA 4DV4L 2RCFA 3STBC 2BDOA 3ERSX 4GKJL 1WTWA 3J7AF 4GOPC 1SYCA 1ILQA 1HQMC 3EN2A 3GTPH 3VYUA 2B39A 1L0YB 1W3SA 2VW9A 4HN7A 5AJ3Q 1EIYB 4IPHA 3RR5A 2C35B 2SOBA 2IL8A 2PNHA 1YNJC 3TSSA 2WKDA 4TSSA 2R61A 3D0FA 3J80i 1EIHA 5C3XA 2CH4A 2ZM6Q 2WP8J 4DUYQ 4B3TQ 3A5ZB 1PFNA 3HKZG 3VA5A 3T53B 1BCPB 1I3QB 2GA4B 3VYRA 2NVXB 2L12A 2AMCB 1B1ZA 4HR7B 3KF6B 4QL5A 2KCCA 4Q0FA 1FGBD 2LKVA 1GM5A 3J7AV 5ELDA 1XPOA 3FVQA 4UPAA 2RCNA 1I94Q 2WAQG 2VNUD 4AYBE 4TRDA 5JEAJ 2F0QA 1R9TB 2ATWA 2JP1A 3OTOQ 4KJOA 4ZYSA 2IX3A 4J1MA 1Y8PB 1CQVA 4KHPL 1PRTB 1S5DD 5EBDA 4QF4A 1GUOA 4PZ7A 1TWHB 4BWGB 2F52A 4GKKQ 4QY7A 1EEFD 3CRLC 3RLNA 4FVMA 2D9UA 1E2WA 5M5YH 2AHOB 1EYDA 1U4RA 5FLXc 3U9OA 5GAHC 5LMUQ 2YTXA 1EYGA 3GTMH 3E0EA 2K4KA 1VQDA 4A3KH 2QKIC 2SDFA 2IHEA 3STBD 5IIFA 1HHVA 2K6AA 3BJUA 5E4XA 4DV5Q 3H0GB 1B8AA 4DAVA 3PO3H 3VA7A 3FEWX 2F0TA 1X9NA 2JA6G 3OPOA 2UUCQ 1G2SA 1JWSD 4JVZA 1P16A 2EE1A 3L3OC 1PH2A 2HDMA 2OCEA 1ET6A 2IY5B 4R4TA 3I4MG 5JJKA 2EYFA 2RBMA 2UUAL 2CFMA 1RIPA 1UUPA 3NTHA 2K28A 4A3CG 4ALPA 2NUCA 4JI2L 3S2DB 3SEBA 4PZ8A 1XMQL 1EY9A 3FDTA 1NMGA 4A3IH 4EQNA 1HA5A 4DU9A 5DEHA 4DXFA 1WCMB 4KN4C 4JI5L 2CHBD 3S24A 1LTID 1YHAA 5G3LF 3KJOA 1PH4A 2UUBL 1FNVA 3A7AB 2D5DA 5IWAL 1E7ZA 5IYDH 1A63A 2EZVA 2EQSA 1N33L 1SAPA 2EY6A 4R4QA 3PIOA 2JA8B 1A15A 3A74A 3KLSA 4LFAL 4GLXA 1IBLQ 2XRSD 3C2PA 1QOHA 1WD1A 1K8OA 2K50A 1WJJA 2QF7A 3I90A 3L2PA 1FL0A 3V96A 3JAMc 1BF4A 3RLOA 3ULJA 5IGBA 1EEID 4G7HC 2L11A 2IX0A 1EL0A 1G2TA 3VR4A 4GLVB 4LF9Q 2OEOA 2ZTDA 1Q12A 2RVLA 4L5QA 3PV0A 1O7LA 1HZ9A 1NUCA 1VDZA 4DAPA 3K7UC 3NE5B 4IFDJ 2KJXA 1DM0B 1JC7A 1P8LA 4XT1B 5IGDA 3QO2A 4EQOA 4HIMA 1SE4A 2F0JA 4HCSA 2HQEA 4UAIA 5FO9B 5J1ZA 3UDXA 3K59A 2EXZA 1X3GA 1BCPC 5C44H 2EY1A 1TS4A 4DUZL 1K3BC 4A3FB 1KHIA 1SYFA 3AFPA 2VQFL 1EQVA 3HOUB 2RHQB 4A3DH 4NXML 4LF5Q 1PH8A 4CDFC 4KKUA 3GTOB 1QUQA 5JPNC 1LACA 1VQJA 1V1PA 3NWSA 2JA9A 1HPCA 1PRTC 1PVOA 1PYBA 1LO5D 1BOSA 5E4WC 1PTOF 1F2MA 5CR3A 1GUNA 4ZUJA 2EYHA 3MAQA 4ZAIA 3BS1A 1AFPA 2RKSA 4A3MH 5IYBG 3GTJH 2JA5B 4IUNA 1PH7A 3RUZA 3HOWB 3M4QA 2R92B 1FNWA 1FD7D 3BDOA 5IT9L 5C4XH 2EYPA 1CKNB 1F2YA 1XTDA 4A3GH 2VUMB 2VL6A 2GVAA 5IP7G 4KHZA 3SK8A 4PG3A 3E9HA 2N88A 1N9WA 3PUVA 4K0KL 4S3SA 4RCNA 4WORA 3RD4A 1LUZA 4BBRB 3KFUA 4KTAA 3QWNA 4A3JH 2B3GA 3B6YA 4GOPA 4BA2I 4FO2A 2JA7H 1EZ8A 1YIJA 4DV7L 3PQIA 1BUVT 1QVCA 1W2BA 1GHKA 2JK8A 2A1AA 4C2MB 4DV3L 2JJQA 3CMAA 3DXJC 5E1FA 4XYQA 1NTGA 1LLRD 4KN7C 1BR9A 3WDNA 1BCPD 5JEAG 4MZ9A 1GKHA 2FFKB 4JI3L 4DV0L 4KKSA 4LFBL 1YHQA 2DNEA 5JJIA 1Q3LA 3CHBD 2B2UC 1E0BA 2JSOA 4ZLTF 5I6YA 3S1QB 5IE8A 1SJED 3BDLA 2JN4A 1G6ZA 1TWFH 2CQAA 4IFDI 4LF7L 1T9HA 1WFQA 1B3AA 2OTJA 4LUVA 4Z9CB 1F9PA 3LNNA 4G4KA 4KY7A 3TZDA 2F0KA 1X65A 4A4IA 3HG9A 1XXGA 3KF8B 1TWGB 2CVRA 4DAYA 5EKKA 1QZHA 1OXSC 1PZKD 2IWHA 1KD1C 3JAMi 3HOUG 2E2HB 1OXVA 2NB0A 3TBIB 3EJIA 2Y0SB 2X69A 3CC2A 2HUGA 3HEJA 3I73A 3HFZB 2EYLA 4IUVA 3I55A 5M5WH 4XDXA 5HGQA 1SYEA 4NXNL 4POFA 4DXGA 3GTPB 2LY7A 1SYBA 3SK5A 4YWLA 2QCPX 4OX9Q 1V1QA 2R7FA 4DR2Q 1IBML 3K57A 5T1GA 2BA0A 3AU7A 3SK4A 3PIPA 4DR6L 1M4VA 1X54A 4JI0Q 3MFYA 3SHLA 1N34L 3EFXD 3PF5A 4RA8A 4BA1I 2JA5G 2A6EC 3HOWG 1Q82C 2R92G 5CC4A 2JEBI 4TKOB 3TP7A 1RD9D 2K03A 1N8RC 4AQYQ 1ZKOA 1QWYA 2RQXA 5EPKA 3RZDH 5IP9G 1V43A 1LTSD 5J3BA 1XWEA 2YYZA 1UE7A 4BBRG 2F0EA 1I4RA 2IW3A 5FLXL 1AP0A 3I72A 3ICEA 1NNXA 1E1OA 3ULPA 5EQ0A 1VQBA 2E76C 3C1FA 2CH4W 1EIGA 2CW0D 2XIWA 3U4ZA 4B3ML 2VS1A 2AQ2B 3LX0A 2Q2TA 4HJ8A 4RWSC 4QUCA 1YITA 1FYCA 2F0DA 3T56B 2O5JC 4IFDG 2ZXPA 1FJGQ 5M5YB 1F9RA 3GTMB 1B4OA 1LTBD 3MXNB 4A3KB 4UDUC 3HP3A 3R2TA 4PMBA 1S72A 3HKZE 1MHWC 1A62A 2F4VQ 4F88A 1VQPA 1UEAB 4B08A 1KDCA 3QIAA 4RFBA 1X3QA 3PO3B 1JMCA 4TVAB 2WAQE 2EVBA 2PZUA 5FJ8G 2QEJC 3D8GA 5C6AA 1KQSA 3DEPA 2IHFA 3SDZA 3PF4A 2PI2A 4K2KA 1Y8OB 5DAUA 3MXUA 3I2ZA 4LF6L 1A2UA 2J7ZA 1D6EC 3BG3A 1HNXL 3CCRA 2ES2A 4L5SA 3JAME 2VQEL 3J80c 5J39A 1KNEA 4A3IB 1J5EL 4MHEA 3KF6A 4R4OA 3NUCA 5M3MG 1VQIA 1S5FD 3K6OA 3S1MH 4B3RQ 5CBAE 2RA4A 3NQTA 2K5HA 2NTSA 2K32A 3IKJA 1CSPA 3MXPA 2KEEA 2CCZA 2X6GA 5K5PA 1PFBA 2LS01 3OSOA 1PHJA 1JJCB 1H9KA 1HCZA 4JI1Q 5FO8B 3KJPA 3I4NB 4X64Q 4JI7L 1W6JA 3QOLA 4P75A 4XXEA 4IUQA 3R8BA 5C3EB 2EYMA 3A8IE 1N32L 4GS3A 1VQEA 1H95A 4A75A 4JBKA 2Q2UA 1E2ZA 2K33A 1PH9A 4QUFA 2MNAA 3IL8A 3ND8A 3OW7A 2K14A 4NPSA 1I50H 1RTOA 3CP0A 3UE1A 3PUYA 4BS9A 2WINB 1G8ZD 2HHHQ 2PW7A 1I4PA 4JV5L 2C5CA 2EPBA 2Z6BA 4DAYB 2SNSA 2UXBL 3KLSX 4C3JG 4Y52H 1SBBB 3MZ5A 4R4IA 1H9RA 1B2TA 1EY4A 1L2FA 2F1MA 3TN2A 3S14H 1HTPA 3NENA 2WFWA 2NVTH 3VR3A 2TSSA 4OWTB 5C44B 1TS2A 3A8KE 5FK9C 4YHHQ 1S40A 4DGZA 1VQAA 3TP5A 2MO1A 1HR0Q 4A3DB 1ENAA 2I46A 4DV1L 4ME3A 3S1NB 1KNAA 5DLQE 3PO2H 4FXKC 5KIXA 3M4PA 4LF4Q 1LTLA 3L0OA 3EVQA 5C4ZA 1T5EA 4X3SA 2F0UA 4DR7L 2A19A 1JWMD 4A3KG 5A35A 2G9DA 2KCNA 4N8FA 5DNFA 4DR3Q 4PMCA 3VDYA 4JI8L 3I70A 1ET9A 1S5BD 2B2UA 1H9SA 2OTLA 1SROA 2K01A 2KCTA 2DN8A 2IT1A 4NMZA 3PO3G 4A3MB 2JQOA 4JI6Q 2HIXA 3SR1A 3GTJB 4RGMA 4PMWA 1EWIA 4CKBA 4DNTB 5CORA 2LSSA 2A68C 5C4XB 3PUXA 1J9OA 2WV6D 1NSNS 4B3TL 1F77A 1EWHA 1SNCA 3G48A 2N55A 4A3GB 1CHPD 4DR4Q 1RODA 1BQQT 2L0CA 2O2LD 3EA6A 4CGYB 4A3IG 4LF8Q 1GVPA 2WB1B 2KCMA 4A93G 1KLGD 2UXCL 1AE2A 3ZYYX 4KY6A 4A3JB 3OTOL 4LWCA 5IYDG 4XQQA 2JA7B 5I2YA 1ENFA 1IL8A 1N36L 1PYSB 3EROA 4MN3A 2L9HA 5EAYA 2QW7A 2ICIA 4CKEA 1SNQA 1CZWA 3BVMA 1BO0A 2NWGA 4C56C 2QDBA 4X3KA 2E2JH 4CJ2C 1B44D 1Y1WH 4OELB 2V4DA 2HCCA 4PQXA 3DWQA 5DM73 5KNBA 1ESRA 2G5DA 4DV2L 4FYDA 2K04A 1Q81C 2Q2HA 2Z9HA 1PLFA 2BOSA 4JBMA 1PYWD 4ZRZA 5IODA 2GN5A 4Y7NH 4J6HA 3K0YA 2J0TD 5CV6A 5F2DA 1KAAA 3CD6A 1KDAA 1TWFB 2DJGC 2E5LQ 3CC4A 3S2HH 4MTNA 3A55A 4O42A 1MGSA 4RHSA 3T1HL 4QIWB 5KYIA 4UY8C 2F3IA 3K5OA 2F3VA 4AIMA 3HOZH 1CKMA 1TWCH 2EYOA 2MQHA 3NK9A 4DV5L 3C1EA 3NBIA 4K8JA 4NB3A 4JI4L 2UUCL 2ZT9C 1X3EA 3AYHB 5CGKA 4IOAA 3G6EA 2QDLA 4ODGA 2UU9L 3T1YL 1WOCA 1WTVA 1JQYD 4A3DG 1YJNA 2A68D 2LMCB 1CKNA 4K8IA 4UHVA 2PCFB 5CBEE 4ID6A 4I7AA 4LAAA 1U4PA 5M5WB 1AH9A 1HNWQ 4UP7A 1M1KC 3E5SA 1T5XD 1GHJA 2D0OA 1VQNA 1CQFA 1PFSA 3T16A 1O7YA 1Q46A 3G7LA 1X56A 4AH6A 4OO1H 4DV4Q 2AUKA 4DR5L 2F0IA 3NBHA 2R93H 1HXYD 3W3AA 2GVBA 5CV4A 1UEBA 3G4SA 3E3XA 1DOLA 4A3MG 1NR4A 1EFID 5J22A 1ML0D 4RGOS 1RJTA 2VY3A 5JOBA 1J6QA 2OQKA 1ILPA 4OIJA 1YJWA 3PSIA 5I6WA 3RZDB 3OIPA 4BXXH 2F03A 2N8NA 1RDPD 2PQEA 5COYA 1YNJD 5EJWA 5A2QE 1X3PA 4I7ZC 1SE8A 2ZJPA 1TU2B 1UE6A 2ZXRA 3A56A 1STGA 2JEAI 4XT3B 2KA7A 2Z4IA 1NAPA 5JAVA 2JA7G 2RDHA 3W2DA 1VQOA 1A3TA 3TQYA 2B2TA 2SNMA 1HR0W 2KHSA 1WTPA 1PTOB 1H9SB 5M5XH 4A3LH 4IO9A 1TXYA 4KHPQ 3Q22A 4K5XA 2F0OA 3KF8A 2RDGA 2MPMA 3J80E 1D8LA 3I4NH 3DM3A 1BDOA 1BCPF 3K7AH 5EPLA 4K6DA 1SE2A 5C3EH 1SNDA 3SXHA 1HUNA 1YNXA 3OMGA 3NSWA 4NKLA 2CKZB 4OL7A 1IYUA 1XPUA 4AYBB 4HMIA 2F3WA 2CQOA 3UDIA 1TQOA 3I91A 4J8QA 4X66L 2HCIA 3T4AC 4IJLA 1C9OA 1B70B 4M8AA 2PYKA 1V1OA 4WJ4A 1FR3A 4P73A 1SLJA 1IXRA 2KHIA 1BBXC 3NP8A 5JPMC 3M9BA 3FKIH 3RNUA 3J81i 1D5MC 2F4IA 3LWUA 1STNA 3S1MB 1SNMA 2K5VA 2UUAQ 4C3IH 1VQCA 1HNZL 4QB4A 4X65Q 2QA4A 2HQLA 3F1ZA 2A69C 1DONA 4NDXA 5IY0A 4JI2Q 3S1NH 1Q90A 2K75A 1XMQQ 2PZWA 1C48A 3GP7A 4C1NI 3BYYB 3CXCA 1QE6A 5K36H 4JI5Q 4N8X1 2UUBQ 4DKAC 1TY0A 1O78A 5D65A 2K5QA 2M9VA 5IWAQ 4OEMB 3UDFA 4LFCL 3QR8A 5LMNL 3TDQA 1N33Q 5M9OA 1E22A 2KOLA 3H0GG 3K8AA 1I50B 3GO5A 2F0GA 1CHQD 2AKWB 4LMQD 3AQQA 2L4NA 1DJRD 3MXNA 4I65A 2UXDL 4DK0A 3AMUA 1BKBA 1STBA 4C1NK 4DV6L 2ALYB 2D62A 4FF1A 1A8VA 1LV9A 2PMZE 3OMCA 4DFAA 3S14B 3CQZH 2WKCA 3VYTA 2NVTB 4ILWA 4HJ5A 3F2DA 2A6HC 4H02A 3X3MA 1WCMG 3NTIA 1A3VA 4R1JA 3S17H 3PO2B 3NBHB 3CW2C 3KLWA 3CPWA 4GLAC 4FDBA 4GN3B 2CWPA 4G7ZC 3EIVA 2JA8G 5JJLA 4RGNA 4XTCS 4DUZQ 4LJZC 3H94A 2VQFQ 1OXTA 4FP5D 2AWNA 5CV5A 1EY5A 4HIKA 3MWYW 4FXDA 1C7YA 1SYDA 1S3OA 4OX9L 1II3A 1YZ6A 4XIGS 4PNYA 3C3LA 1PTOC 1QNUA 2LFNA 1I6VC 4YWMA 3BVGA 3V2TA 4IUUA 5KNDA 1JB3A 4H13C 4R8IA 4HIOA 1MI2A 1V8QA 4ABNA 1Q86C 3HZXA 3KDFB 3NTKA 5C5LA 1STYA 4KLKA 1Q7YC 4O0AA 1PRTD 3J81E 2OT2A 4KI0A 4IJHA 1STAA 2B63H 4HSPA 3DWAA 1Z6HA 1SMYC 1LT5D 4ZKBB 1JE5A 1QVGA 1PH3A 1SRUA 1VQ9A 5ELOA 2F0FA 2EOTA 4A3FG 1D2BA 4GN4B 2KUMA 3CMEA 1FNUA 3O13A 1SMXA 2KQ3A 1TVXA 2Z6KC 4MIUA 1MIUA 2E8GA 1YEZA 5EKIA 5C4HA 1XNRL 4KKTA 4GNXA 3D6CA 3V05A 4UP9A 3MHBA 1SXTA 4K0KQ 4LW1A 3BYTB 2E2JB 5C4JH 1Y1WB 3IFDA 1L1OA 2A6HD 4A3BB 4JYAL 4DV7Q 4XQNA 1DOMA 1VQ5A 3D3RA 1SJHD 5CYUA 4Y7NB 1JE4A 3T13A 4DV3Q 1MJEA 4P74A 4CKCA 3WOEA 1EQQA 3S2HB 4Q5VA 1XMOQ 2Z8LA 1IBKL 4DV0Q 3FPUB 4JI3Q 4LFBQ 3HOZB 1TWCB 3ERQA 4QCLA 4N9PA 4DN4M 1GUWA 4MTKA 2VUMG 2B2VA 3DM1A 2A8VA 3FMCA 4HEDA 1PH5A 4IZ8A 2TMPA 4RH6A 3W5OA 3P7JA 4BY7B 2RSOA 4DR1L 1O7IA 1GOZA 2B29A 3NPPA 3MVVA 2PNRC 2EXDA 1O80A 1EUJA 1TIID 5AFWA 3PO2G 1ICFB 1YBYA 1HH2P 3SE0A 2RHSB 5GAEC 1LYLA 2Z4HA 1DD2A 1PTOH 3PGZA 5KEEA 5LL6X 4B3RL 1BBUA 4G7OC 5TSSA 5JJZA 4DK6C 4RCOA 5BR8Q 1G91A 2NYZD 4JG2A 1MSHA 2R93B 5IP7H 1GUGA 3S1RB 3CCSA 1BXTA 4CBVA 4L63B 2K5NA 2E2DC 2KEDA 3DHQA 1CT1D 4HJAA 2L5TA 1U5KA 1K28A 4H7BA 3RMHA 1E2VA 2B8FA 4K5VA 1JJGA 3K5MA 1CKOA 1IKMA 2FXQA 4OO1I 3NWTA 3M7GA 4QQBX 4DR6Q 4X62L 1N34Q 3UI2A 1EOVA 1K8GA 1CUKA 3P75A 1GUTA 4YWKA 1JT8A 2MJ8A 2K5DA 4OIKA 4MNOA 2HHHL 1JR0D 1SEBD 3GTLH 3AB9A 4KY5A 4A3EB 4HMJA 1Q1EA 2A6ED 3VR5A 5CMDA 2EJGC 2OF1A 2F0SA 2YTVA 4QMGA 1RTNA 2OQ0A 2NZ1D 2Y0SG 1XTCD 2KHJA 1Z47A 4X3TA 5M5XB 4XQJA 5E3FA 2B2TC 4OONA 4YHHL 1Y1WG 5ISRA 3JAML 1PMRA 1S4ZA 4JBWA 4IUPA 4C3HB 3QJYA 3K7AB 2EY5A 2I5LX 4DPGA 3HS0C 1XNQQ 3F8TA 4B3MQ 1SYGA 3HOYH 2KENA 4RG1A 4APVA 1X6OA 1U4LA 2FJ2A 2MGSA 1EY6A 2E74C 2EJMA 4DR3L 1MJCA 4ME5A 1LTRD 2K7VA 1KDBA 1PV4A 2ZTEA 3HOZG 4KD4A 4HJ9A 1HRJA 1D5XC 1K73C 3QOJA 5L37A 1WTRA 4JI6L 1B53A 1RKNA 2X6LA 4LUOA 1X55A 3N52A 4EQPA 3FKIB 1EQRA 5IGFA 4X3UA 1E3PA 4GNXB 1IW7C 2MUYA 1K0SA 1SNOA 2PQAA 4QJFA 4DR4L 2AUJD 3A8JE 5GQOA 5CV7A 1TWAH 4K6LA 4C3IB 4LF6Q 3WWVA 4B3SQ 5KRUA 4JOIC 4YCUA 1L1OB 2VQEQ 1HTLD 2PPBC 3TMEA 1RF2D 2XWJB 5HURA 5C5MA 1GD7A 2PI2E 3OOCA 2D0PA 2KECA 1Q8KA 1J5EQ 2YU9H 2KVMA 4OO1G 1JOKA 2WAQB 1VMPA 2NVYH 1QCBD 3I4LA 2ASBA 1I4XA 3DLLA 4JPBW 1PH6A 5H1SE 2NVQH 5GAGC 5IT9c 1JJ2A 4E6IA 5AJ3L 2ZJQA 4JI7Q 2XSCA 3I56A 3D4DA 5E7NA 1N32Q 4BXXG 2AQ3B 1Y69U 1VQHA 2N78A 1WTXA 1TT2A 1M90C 2ZM6L 3VR2A 2L1BA 3TREA 1RCVD 4DUYL 1IHZA 1CTMA 3R93A 3M4OH 3GTKH 4N9TA 3URYA 1VCIA 4YY3Q 3CQZB 4U68A 2MP1A 1G51A 3VYSA 5CV9A 1NMFA 1LTGD 1K8MA 3GTQH 1GO3E 1KABA 2Z6KA 4JV5Q 1I94L 1E24A 2WACA 1Q8IA 1WVLA 2E2IB 1FVIA 5GADC 1VQ6A 4A3LG 3S17B 4B9XA 1CI3M 2F0HA 1ZXTA 4BBSH 3G71A 2H5XA 4K14A 5FJ8H 1OXXK 5KYLA 3I4NG 5M3FH 2P5ZX 1EIFA 1IW7D 1NE3A 3CCJA 5EGTA 5C3EG 4P2CB 1HNWL 3SGIA 2JE6I 3H3VH 4GKKL 1Y8NB 4IPDA 1CM9A 5CV8A 3J81c 4A3BH 2K52A 2XRQD 4F87A 3KYHC 4EX5A 3CCUA 1H9JA 2Q8IB 4DR7Q 5M3MH 3G6JB 3E0JA 5LMUL 1MKHA 4JC0A 2KBNA 5KNCA 3VR6A 4JI8Q 1U4MA 4KJNA 3EBEA 5IGGA 5JVH3 5NUCA 2MO0A 4H44C 3FKIG 2B63B 3K5LA 3HOXH 4OGQC 1JWUD 1VQLA 3EQLC 2ZJRA 1SFOH 3F2UA 3MEHA 3UE0A 2FMMA 2NTTA 5C44G 4C3IG 3HRZC 4BY7H 4DF7A 1VQ4A 5BN5A 2PO4A 1XJVA 3IAYA 1ZEQX 2YV5A 1Y1VH 5C0XH 1CFMA 2NBFA 4WFN3 4TQUS 3QB3A 1IYJB 1F9QA 2Z0SA 4K5WA 2DGYA 5K36G 5C4JB 2A74C 2UXCQ 4GNXC 4PZ6A 4C3JH 3L9AX 5ELEA 1N36Q 2H1EA 1QVFA 3GTGH 1HFGA 4GKJQ 3BZCA 3S1RH 3RZOH 4FF4A 1L1OC 2NN6H 4ULLA 1J8IA 5GROA 1OO9B 1HUMA 1L0WA 2F0PA 5ELNA 3HOVH 1HJPA 3R3OA 2Z1CA 3J81j 1D1IA 1IBLL 2R7ZH 3K58A 4DV2Q 2R6GA 2HDLA 5C4XG 4F8MA 2PQAB 1M8AA 1ENCA 1ZYRC 4A3GG 5I4DA 1PH1A 2ZTCA 2B2WC 4LF9L 3IRBA 1I4HA 5FKAC 3CAMA 4FF3A 2WB1G 5IYCH 1O7ZA 4FXGC 3I8ZA 1LTAD 1PZID 2B2VC 2F0WA 3T1HQ 1WD0A 1EOTA 3ITPA 4A3EH 4A3JG 3KDFA 4O1NA 4IOCA 3M85A 1HZAA 3MTSA 4JK1C 1S5CD 4HSVA 1A6XA 3KK7A 4JI4Q 2F0MA 2J4XA 5A2QL 2Q8TA 3I3CA 1ESFA 2UU9Q 5D14A 3T1YQ 5HGTA 1EFWA 2ZXOA 4X65L 1SE3A 3Q8DA 1I6HH 1BBWA 3MFGA 2LXKA 2V1CC 4C3HH 3A5UA 4BY1H 4LF5L 1HZCA 3F2CA 4LK1C 4R8NA 1K8AC 5FLMH 2FINB 1ASZA 5IGEA 2L15A 4HIDA 3BZDB 5IOCA 4A93H 2N49A 4IALA 3FP9A 1I4GA 3I7FA 1PA6A 3L7ZC 1XYIA 2O5IC 4G57A 3S15H 1LT4D 3K81C 2XGTA 3J7A5 1GXDC 4DR5Q 3J80L 4X6AH 3CCQA 3GDEA 2R3ZA 3TP8A 3D31A 1TS5A 1L0XB 1C4QA 2B63G 1PRTF 3DWPA 1QG7A 1DOKA 5I2XA 1NJIC 3TZUA 3GTLB 2RSNA 4M1UB 1K83H 1AW7A 4DAMA 1C0AA 3U9SA 4WRDA 2A73B 4IPGA 2L55A 4NW2A 5C3WA 2F0LA 4JOIA 4DK1A 1KTKA 1AE3A 4L6TB 3FPPA 4NP5A 3MC0B 5FO7B 3K5NA 1ZYRD 3Q6SA 1D7QA 3UDGA 4UP8A 3H15A 2DY7A 1VQMA 2VZAA 4YCVA 1TY2A 3S16B 3ONAB 1EYAA 3NHHA 4POGA 3HOYB 2Q2IA 2B2YC 2ID0A 5FOBB 1PFMA 4DNIA 3CRKC 4RKLA 2DY8A 1SN8A 4ZKCB 1NBWA 4ZUIA 3TRZA 4HCEA 2I5HA 1HFNA 2MFIA 2D2CC 2JXMB 1B9NA 2ENBA 3NQIA 4LFAQ 2MHVA 3P20A 2LXJA 3M3YH 1IYVA 2FMCA 1TR5A 1YHBA 2G9HD 2H4OA 1C8CA 1F2LA 2SEBD 1F9SA 4X66Q 1KRTA 3BZKA 5IT9E 1KC8C 3KBXA 2Y0SE 4DK3C 2N3SA 1GJXA 1QNKA 1EU4A 3D6WA 3MEFA 1JOOA 4R9WA 3M4YA 5LL6S 3E9IA 3I4OA 4L8JA 1VQKA 2F0VA 1TWAB 2IX1A 1UWVA 3ZJYC 4RMFA 4DA2A 4EVOA 3RN2A 4HJ7A 2E2IH 1NY4A 2YU9B 4P71A 2JA6H 3DMUA 3A0JA 3BDCA 1Z7TA 2NVYB 4CJ0B 3TP6A 1HNZQ 3I4MH 4P72A 3CCVA 4RGTA 3PUWA 4CDDC 4YIJA 5C0XJ 4NXMQ 2NVQB 1PXUA 1WTQA 1B50A 1ICWA 4AYBG 4A3CH 4KK7A 4KHVA 3CPFA 1UNSA 1D1KA 1TKWB 4DR2L 4KV6A 2A69D 1CZGA 2HT1A 5G3LD 1A2TA 4JI0L 2CWAA 2Q8RE 3U50C 1EY8A 4LFCQ 3ND9A 5LMNQ 1E1TA 3OYYA 4J15A 3M4OB 4XYOA 3GTKB 1NCVA 2WIIB 3NEMA 3GV3A 1STEA 1XMOL 3U58A 1DYQA 4AQYL 1YNNC 2UXDQ 3GTQB 3N6RA 1QZGA 1LT3D 1XX8A 3HGBA 1KLUD 4DV6Q 2M00A 1K9MC 3CCEA 4BBSB 5HY6A 4IPCA 3J81L 1I3QH 1JORA 4L5RC 2NVXH 1OTCA 1LT6D 2EDGA 2HD3A 2CW0C 5M3FB 3TS2A 2NZHA 1AZPA 2F0NA 3HOYG 2K1BA 1R9TH 3W1BA 1I5FA 2BDNA 3WOFA 5BR8L 1EWCA 1SDFA 1WI5A 1FJGL 5M3MB 1EQTA 1R4QB 1LTTD 2PMZB 3KOJA 1JOQA 1KRSA 3DEOA 1TWHH 3H3VI 2RF4A 2F4VL 3AFQA 3AEVA 2B2WA 2RDFA 4U673 1R4PB 1G291 4ZCKA 3HOXB 3H6MA 3MA2B 5LHY1 3NXWA 1DXMA 3KLRA 3PUZA 2PW5A 1SFOB 3CCMA 5JVG3 4F7XA 1PTOD 2O4XA 2K05A 1AN8A 1RL2A 4LF7Q 1K3RA 3GV6A 3Q24A 4K2LA 5BN3A 3LWEA 1D5ZC 4OXPA 2IPKD 1Y1VB 3BVZA 1H9MA 3H0GH 5KGUA 1IKLA 4ZQ3A 5FLXE 1YJ9A 5IYBH 3DUZA 3D4WA 1EYCA 3ULLA 1X32A 2VB2X 1CA5A 3J7YW 1SMYD 4C3JB 1YNND
chains in the Genus database with same CATH topology
3PIO3 5BN4A 3GTGB 3KUPA 5EBCA 2C9OA 3QG1A 5C0XI 3RZOB 2IJ0A 4IUTA 3A54A 1V1PB 3P1HA 3C46A 3HOVB 2R7ZB 1F2ZA 3S9WA 4RKBA 3M7NA 2E75C 3SVMA 3OWEB 2JYOA 4FNFA 2NN6I 4KD3A 2EYJA 1EY0A 3PMFA 2I07B 1MSGA 3OIQA 5ELFA 1JCKB 3GD7A 4HTHA 5T1IA 5JEAH 4GZYC 2BCOA 1QJOA 1EU3A 5DM63 3A7LA 1UAPA 1WTOA 1VF5C 2OXPA 4DNRB 2BE5C 3GQBA 1I6HB 2B2YA 4BY1B 3H91A 3E6ZX 4A93B 4V0BA 3S15B 3Q23A 4H0LC 4IN3A 1HA6A 2AWOA 1MBYA 1SSOA 3CKIB 5D3IB 1HQRD 2VXWA 3H3VC 2BA1A 1RHPA 4WJWA 1AZQA 5IGCA 5D3DA 1CK1A 3MXGA 5I9PA 1B9MA 2FHTA 1U9RA 1K83B 3D4RA 4OHJA 2XN9C 2QILA 1PDQA 4B9WA 5C0XG 2PZTA 1SNPA 2ICEC 3T51B 4EGVA 1CA6A 1EZ6A 3HKZB 4IURA 1EY7A 3FRPB 4CJ1B 4RAUC 2M2LA 1I4QA 1STHA 3H09A 2NN6G 2XVSA 2A5HA 2EY2A 2EJFC 5ELCA 4CHTB 1JICA 1QB5D 3Q0AA 3KBGA 2AQ1B 5EPJA 1MD2D 2B8GA 3RLFA 4RHRA 4V190 4PV1C 3M3YB 2BE5D 3OHXC 1ONLA 3OWFA 1Q1BA 5ELBA 3SK6A 1BNZA 1VMCA 4IFDH 3X3NA 1OXUA 5I9OA 4IQZA 3CU7A 2K5WA 1TS3A 3R2IA 1S5ED 2XWBB 4HAEA 4KMUC 1GUSA 1PZJD 1QILA 3IFTA 2JA6B 1W6KA 4FF2A 4C3HG 4ZK9B 2DNCA 2VB3X 3I4MB 1VF7A 5EKLA 2XNAC 1NR2A 1DZ1A 1DCZA 1A3UA 3PIP3 1LABA 1AEXA 2BDOA 1WTWA 3J7AF 1SYCA 1ILQA 1HQMC 3VYUA 2B39A 1L0YB 4HN7A 2SOBA 2IL8A 1YNJC 3TSSA 2WKDA 4TSSA 2R61A 1EIHA 5C3XA 2WP8J 1PFNA 3VA5A 3T53B 1BCPB 1I3QB 2GA4B 3VYRA 2NVXB 2L12A 1B1ZA 4HR7B 2KCCA 4Q0FA 1FGBD 2LKVA 3J7AV 5ELDA 3FVQA 2VNUD 4TRDA 5JEAJ 2F0QA 1R9TB 2JP1A 4KJOA 4ZYSA 2IX3A 4J1MA 1Y8PB 1CQVA 1PRTB 1S5DD 5EBDA 4QF4A 1GUOA 1TWHB 4BWGB 1EEFD 3CRLC 4FVMA 2D9UA 1E2WA 1EYDA 1U4RA 3U9OA 2QKIC 2SDFA 5IIFA 1HHVA 2K6AA 5E4XA 3H0GB 4DAVA 3VA7A 3FEWX 2F0TA 3OPOA 1G2SA 1JWSD 2EE1A 3L3OC 2HDMA 1ET6A 2EYFA 2RBMA 1UUPA 3NTHA 2K28A 2NUCA 3S2DB 3SEBA 1EY9A 3FDTA 4EQNA 1HA5A 4DU9A 5DEHA 4DXFA 1WCMB 4KN4C 2CHBD 1LTID 5G3LF 1FNVA 3A7AB 2D5DA 2EZVA 1SAPA 2EY6A 2JA8B 1A15A 3KLSA 2XRSD 3C2PA 1QOHA 1WD1A 1K8OA 2QF7A 3I90A 1BF4A 3V96A 4G7HC 5IGBA 1EEID 2L11A 2IX0A 1EL0A 1G2TA 3VR4A 2OEOA 1Q12A 2RVLA 3PV0A 1O7LA 4DAPA 1NUCA 1VDZA 4IFDJ 3NE5B 2KJXA 1DM0B 1JC7A 4XT1B 5IGDA 3QO2A 4EQOA 1SE4A 2F0JA 4HCSA 2HQEA 4UAIA 5FO9B 5J1ZA 3K59A 2EXZA 1BCPC 2EY1A 1TS4A 4A3FB 1SYFA 1EQVA 3HOUB 4KKUA 3GTOB 5JPNC 1LACA 1V1PA 3NWSA 1HPCA 1PRTC 1BOSA 1LO5D 5E4WC 1PTOF 1F2MA 5CR3A 1GUNA 4ZUJA 2EYHA 3MAQA 4ZAIA 3BS1A 1AFPA 2RKSA 2JA5B 4IUNA 3RUZA 3HOWB 2R92B 1FNWA 1FD7D 3BDOA 5IT9L 2EYPA 1F2YA 2VUMB 4KHZA 3SK8A 2N88A 3PUVA 4S3SA 4RCNA 4WORA 3RD4A 4BBRB 4KTAA 3QWNA 4BA2I 4FO2A 1EZ8A 1BUVT 1GHKA 4C2MB 3DXJC 5E1FA 4XYQA 1LLRD 4KN7C 1BR9A 3WDNA 1BCPD 5JEAG 2FFKB 4KKSA 2DNEA 1Q3LA 3CHBD 2B2UC 1E0BA 2JSOA 4ZLTF 5I6YA 3S1QB 1SJED 3BDLA 1G6ZA 2CQAA 4IFDI 1B3AA 4Z9CB 1F9PA 3LNNA 4G4KA 4KY7A 3TZDA 2F0KA 3HG9A 1XXGA 1TWGB 2CVRA 4DAYA 5EKKA 1OXSC 1PZKD 2IWHA 2E2HB 1OXVA 2NB0A 3TBIB 3EJIA 2Y0SB 2X69A 2HUGA 3HEJA 3I73A 2EYLA 4IUVA 4XDXA 1SYEA 4DXGA 3GTPB 2LY7A 1SYBA 3SK5A 2QCPX 3K57A 5T1GA 2BA0A 3AU7A 3SK4A 1M4VA 3MFYA 3SHLA 3EFXD 4RA8A 4BA1I 2A6EC 5CC4A 2JEBI 4TKOB 3TP7A 1RD9D 2K03A 1ZKOA 1QWYA 2RQXA 5EPKA 1V43A 1LTSD 1XWEA 2YYZA 2F0EA 1I4RA 2IW3A 5FLXL 1AP0A 3I72A 5EQ0A 2E76C 3C1FA 1EIGA 2CW0D 2XIWA 2AQ2B 3LX0A 4RWSC 4QUCA 1FYCA 2F0DA 3T56B 2O5JC 4IFDG 2ZXPA 5M5YB 1F9RA 3GTMB 1B4OA 1LTBD 4A3KB 4UDUC 3HP3A 3R2TA 4PMBA 4F88A 1UEAB 4B08A 1KDCA 3QIAA 4RFBA 1X3QA 3PO3B 2EVBA 2PZUA 2QEJC 3D8GA 5C6AA 3DEPA 3SDZA 4K2KA 1Y8OB 5DAUA 3MXUA 1A2UA 2J7ZA 1D6EC 3BG3A 3JAME 5J39A 1KNEA 4A3IB 4MHEA 3NUCA 1S5FD 3K6OA 5CBAE 2RA4A 3NQTA 2NTSA 2K32A 3IKJA 3MXPA 2KEEA 2X6GA 5K5PA 1PFBA 2LS01 3OSOA 1H9KA 1HCZA 5FO8B 3I4NB 1W6JA 3QOLA 4XXEA 4IUQA 3R8BA 5C3EB 2EYMA 3A8IE 1E2ZA 2K33A 4QUFA 3IL8A 3ND8A 3OW7A 1RTOA 3PUYA 4BS9A 2WINB 1G8ZD 2PW7A 1I4PA 2C5CA 2EPBA 2SNSA 3KLSX 4C3JG 1SBBB 3MZ5A 1H9RA 1B2TA 1EY4A 2F1MA 3TN2A 1HTPA 3VR3A 2TSSA 5C44B 1TS2A 3A8KE 5FK9C 4DGZA 3TP5A 4A3DB 1ENAA 2I46A 3S1NB 1KNAA 4FXKC 5KIXA 3EVQA 5C4ZA 1T5EA 4X3SA 2F0UA 1JWMD 5A35A 2G9DA 2KCNA 5DNFA 4PMCA 3I70A 1ET9A 1S5BD 2B2UA 1H9SA 2K01A 2DN8A 2IT1A 4NMZA 4A3MB 3SR1A 3GTJB 4RGMA 4PMWA 4CKBA 4DNTB 5CORA 2A68C 5C4XB 3PUXA 1J9OA 2WV6D 1NSNS 1F77A 1EWHA 1SNCA 2N55A 4A3GB 1CHPD 1RODA 1BQQT 2L0CA 2O2LD 3EA6A 4CGYB 2WB1B 1KLGD 3ZYYX 4KY6A 4A3JB 4XQQA 2JA7B 5I2YA 1ENFA 1IL8A 3EROA 4MN3A 2L9HA 2ICIA 4CKEA 1SNQA 1CZWA 3BVMA 1BO0A 2NWGA 4C56C 2QDBA 4X3KA 4CJ2C 1B44D 2V4DA 2HCCA 4PQXA 3DWQA 5DM73 5KNBA 1ESRA 4FYDA 2K04A 1PLFA 2BOSA 1PYWD 4ZRZA 5IODA 4J6HA 3K0YA 2J0TD 5CV6A 5F2DA 1KAAA 1KDAA 1TWFB 3A55A 4O42A 1MGSA 4RHSA 4QIWB 5KYIA 3K5OA 2F3VA 2EYOA 3NK9A 3C1EA 3NBIA 4K8JA 2ZT9C 5CGKA 4ODGA 1WTVA 1JQYD 2A68D 2LMCB 4K8IA 2PCFB 5CBEE 4ID6A 4LAAA 1U4PA 5M5WB 3E5SA 1T5XD 1GHJA 1CQFA 3T16A 1O7YA 3G7LA 4OO1H 2AUKA 2F0IA 3NBHA 1HXYD 3W3AA 5CV4A 1DOLA 1NR4A 1EFID 5J22A 1ML0D 4RGOS 1RJTA 5JOBA 1ILPA 4OIJA 5I6WA 3RZDB 3OIPA 2F03A 1RDPD 2PQEA 5COYA 1YNJD 5EJWA 5A2QE 1X3PA 4I7ZC 1TU2B 2ZXRA 3A56A 1STGA 2JEAI 4XT3B 2KA7A 2Z4IA 1NAPA 5JAVA 2RDHA 3W2DA 1A3TA 2B2TA 2SNMA 2KHSA 1WTPA 1PTOB 1H9SB 3Q22A 4K5XA 2F0OA 3KF8A 2RDGA 2MPMA 3J80E 1BDOA 1BCPF 5EPLA 4K6DA 1SE2A 1SNDA 3SXHA 1HUNA 3OMGA 3NSWA 4NKLA 4OL7A 1IYUA 4AYBB 4HMIA 2F3WA 1TQOA 3I91A 4J8QA 2HCIA 3T4AC 4M8AA 2PYKA 1V1OA 1FR3A 1BBXC 3NP8A 5JPMC 1D5MC 2F4IA 3LWUA 1STNA 3S1MB 1SNMA 4QB4A 2A69C 1DONA 4NDXA 1Q90A 2PZWA 1C48A 3GP7A 4C1NI 3BYYB 1QE6A 5K36H 1TY0A 1O78A 5D65A 2K5QA 2M9VA 3TDQA 5M9OA 2KOLA 1I50B 3GO5A 2F0GA 1CHQD 4LMQD 2L4NA 1DJRD 3MXNA 4I65A 4DK0A 3AMUA 1STBA 4C1NK 2D62A 4FF1A 1LV9A 3OMCA 4DFAA 3S14B 2WKCA 3VYTA 2NVTB 4ILWA 2A6HC 3X3MA 3NTIA 1A3VA 3PO2B 4G7ZC 4RGNA 4XTCS 4LJZC 3H94A 1OXTA 4FP5D 2AWNA 5CV5A 1EY5A 3MWYW 4FXDA 1SYDA 1II3A 4XIGS 4PNYA 3C3LA 1PTOC 1QNUA 2LFNA 1I6VC 3BVGA 3V2TA 4IUUA 5KNDA 1JB3A 4H13C 4R8IA 1MI2A 1V8QA 4ABNA 3HZXA 3NTKA 5C5LA 1STYA 1PRTD 3J81E 2OT2A 4KI0A 1STAA 4HSPA 3DWAA 1Z6HA 1SMYC 1LT5D 4ZKBB 2F0FA 2EOTA 1D2BA 2KUMA 1FNUA 3O13A 2KQ3A 1TVXA 4MIUA 5EKIA 5C4HA 4KKTA 3D6CA 3V05A 3MHBA 1SXTA 3BYTB 2E2JB 1Y1WB 3IFDA 2A6HD 4A3BB 4XQNA 1DOMA 3D3RA 1SJHD 5CYUA 4Y7NB 1JE4A 3T13A 4CKCA 3WOEA 3S2HB 4Q5VA 2Z8LA 3FPUB 3HOZB 1TWCB 3ERQA 4QCLA 4N9PA 4DN4M 1GUWA 2B2VA 3DM1A 3FMCA 4HEDA 4IZ8A 2TMPA 4RH6A 3P7JA 4BY7B 2RSOA 1GOZA 3NPPA 3MVVA 2PNRC 1O80A 1TIID 5AFWA 3SE0A 2Z4HA 1DD2A 1PTOH 5KEEA 5LL6X 4G7OC 5TSSA 5JJZA 4RCOA 1G91A 2NYZD 1MSHA 2R93B 3S1RB 1GUGA 1BXTA 4CBVA 4L63B 2E2DC 2KEDA 3DHQA 1CT1D 2L5TA 3RMHA 4H7BA 1E2VA 2B8FA 4K5VA 3K5MA 1IKMA 4OO1I 3NWTA 3M7GA 3UI2A 3P75A 1GUTA 2MJ8A 2K5DA 4OIKA 1JR0D 1SEBD 3AB9A 4KY5A 4A3EB 4HMJA 1Q1EA 2A6ED 3VR5A 5CMDA 2EJGC 2OF1A 2F0SA 4QMGA 1RTNA 2NZ1D 1XTCD 1Z47A 4X3TA 5M5XB 4XQJA 5E3FA 2B2TC 5ISRA 3JAML 1PMRA 1S4ZA 4JBWA 4IUPA 4C3HB 3QJYA 3K7AB 2EY5A 3HS0C 1SYGA 1U4LA 2FJ2A 2MGSA 1EY6A 2E74C 2EJMA 4ME5A 1LTRD 2K7VA 1KDBA 4KD4A 1HRJA 1D5XC 3QOJA 1WTRA 1B53A 1RKNA 2X6LA 3N52A 4EQPA 3FKIB 5IGFA 4X3UA 1IW7C 2MUYA 1SNOA 2AUJD 3A8JE 5CV7A 4K6LA 4C3IB 5KRUA 1HTLD 2PPBC 3TMEA 1RF2D 2XWJB 5HURA 5C5MA 3OOCA 2KECA 2KVMA 4OO1G 1JOKA 2WAQB 1VMPA 1QCBD 3I4LA 1I4XA 4E6IA 2XSCA 3D4DA 2AQ3B 1Y69U 1WTXA 1TT2A 3VR2A 2L1BA 1RCVD 1IHZA 1CTMA 3R93A 4N9TA 3URYA 1VCIA 3CQZB 4U68A 2MP1A 3VYSA 5CV9A 1LTGD 1K8MA 1KABA 2WACA 1Q8IA 1WVLA 2E2IB 3S17B 4B9XA 1CI3M 2F0HA 1ZXTA 4K14A 1OXXK 5KYLA 1IW7D 5EGTA 4P2CB 2JE6I 1Y8NB 1CM9A 5CV8A 2XRQD 4F87A 1H9JA 2Q8IB 3G6JB 3E0JA 5KNCA 3VR6A 1U4MA 4KJNA 5IGGA 5JVH3 5NUCA 4H44C 2B63B 3K5LA 4OGQC 1JWUD 3EQLC 3F2UA 3MEHA 2FMMA 2NTTA 4C3IG 3HRZC 4DF7A 5BN5A 2PO4A 3IAYA 1ZEQX 5C0XH 1CFMA 2NBFA 4WFN3 4TQUS 3QB3A 1F9QA 4K5WA 5K36G 5C4JB 2A74C 3L9AX 5ELEA 2H1EA 1HFGA 4FF4A 2NN6H 4ULLA 1J8IA 1OO9B 1HUMA 2F0PA 3R3OA 2Z1CA 1D1IA 3K58A 2R6GA 2HDLA 4F8MA 1M8AA 1ENCA 1ZYRC 5I4DA 2B2WC 1I4HA 5FKAC 4FF3A 1O7ZA 4FXGC 3I8ZA 1LTAD 1PZID 2B2VC 2F0WA 1WD0A 1EOTA 3ITPA 4O1NA 3M85A 3MTSA 4JK1C 1S5CD 4HSVA 1A6XA 3KK7A 2F0MA 2J4XA 5A2QL 2Q8TA 3I3CA 1ESFA 5D14A 5HGTA 2ZXOA 1SE3A 3MFGA 4LK1C 4R8NA 2FINB 5IGEA 3BZDB 5IOCA 4IALA 1I4GA 3L7ZC 1XYIA 2O5IC 4G57A 1LT4D 1GXDC 3J80L 2R3ZA 3TP8A 3D31A 1TS5A 1L0XB 1C4QA 1PRTF 3DWPA 1QG7A 1DOKA 5I2XA 3TZUA 3GTLB 2RSNA 4M1UB 1AW7A 3U9SA 4WRDA 2A73B 2L55A 4NW2A 5C3WA 2F0LA 4DK1A 1KTKA 4L6TB 3FPPA 4NP5A 3MC0B 5FO7B 3K5NA 1ZYRD 3Q6SA 2DY7A 1TY2A 3S16B 3ONAB 1EYAA 3NHHA 3HOYB 2B2YC 2ID0A 5FOBB 1PFMA 3CRKC 4RKLA 2DY8A 4ZKCB 4ZUIA 4HCEA 1HFNA 2D2CC 2JXMB 1B9NA 2ENBA 3NQIA 2MHVA 3P20A 1IYVA 2FMCA 1TR5A 2G9HD 2H4OA 1C8CA 1F2LA 2SEBD 1F9SA 5IT9E 3KBXA 1GJXA 1QNKA 1EU4A 3D6WA 4R9WA 1JOOA 3M4YA 5LL6S 4L8JA 2F0VA 1TWAB 2IX1A 4DA2A 4EVOA 2YU9B 3DMUA 3BDCA 1Z7TA 2NVYB 4CJ0B 3TP6A 4RGTA 3PUWA 5C0XJ 4YIJA 2NVQB 1B50A 1PXUA 1WTQA 1ICWA 4KK7A 4KHVA 1UNSA 1D1KA 1TKWB 4KV6A 2A69D 1CZGA 5G3LD 1A2TA 2Q8RE 1EY8A 3ND9A 3M4OB 4XYOA 3GTKB 1NCVA 2WIIB 3GV3A 1STEA 1DYQA 1YNNC 3GTQB 3N6RA 1LT3D 1XX8A 3HGBA 1KLUD 2M00A 4BBSB 3J81L 1JORA 1LT6D 2EDGA 5M3FB 2CW0C 1AZPA 2F0NA 2K1BA 2BDNA 3WOFA 1EWCA 1SDFA 5M3MB 1EQTA 1R4QB 1LTTD 2PMZB 1JOQA 3DEOA 2B2WA 2RDFA 4U673 1R4PB 1G291 3HOXB 3H6MA 3MA2B 5LHY1 3NXWA 1DXMA 3KLRA 3PUZA 2PW5A 1SFOB 5JVG3 4F7XA 1PTOD 2O4XA 2K05A 1AN8A 3GV6A 3Q24A 4K2LA 5BN3A 3LWEA 1D5ZC 2IPKD 1Y1VB 3BVZA 1H9MA 5KGUA 1IKLA 4ZQ3A 5FLXE 3DUZA 3D4WA 1EYCA 1X32A 2VB2X 1CA5A 3J7YW 1SMYD 4C3JB 1YNND
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K32 A;  3IKJ A;  3BDO A;  3T51 B;  1GUT A;  3MFY A;  3U9S A;  5BN4 A;  5K36 H;  1H9K A;  1HCZ A;  5K36 G;  4KN4 C;  3QG1 A;  1O78 A;  1YNJ C;  4BA1 I;  4KKT A;  3ND9 A;  2A6E C;  4DK1 A;  4KHZ A;  3A7A B;  2D5D A;  3AB9 A;  2JEB I;  3FPP A;  1Y69 U;  3A8I E;  1Q1E A;  4TKO B;  3PUV A;  2A6E D;  4I7Z C;  1ZKO A;  1TU2 B;  3VR5 A;  2EJG C;  4RCN A;  3VR2 A;  1YNN C;  2NN6 H;  3N6R A;  1CTM A;  3T53 B;  1E2Z A;  2K33 A;  2A6H D;  2NN6 G;  3HGB A;  4DK0 A;  3M7N A;  2E75 C;  1V43 A;  4BA2 I;  2JEA I;  1VCI A;  2KA7 A;  2EJF C;  3ND8 A;  4HR7 B;  2KCC A;  3OW7 A;  1K8O A;  2QF7 A;  2R6G A;  2V4D A;  2NN6 I;  2YYZ A;  1GHK A;  2D62 A;  5KNB A;  3PUY A;  1K8M A;  1PMR A;  4G7H C;  4JBW A;  2B8G A;  3RLF A;  3CRK C;  3QJY A;  3VR4 A;  3I72 A;  1H9S B;  1ZYR C;  2EDG A;  3GD7 A;  2CW0 C;  3DXJ C;  4PV1 C;  2BE5 D;  1Q12 A;  3PV0 A;  1CI3 M;  1O7L A;  1ONL A;  1VDZ A;  1Q1B A;  4KN7 C;  1Y8P B;  5JEA H;  3WDN A;  2E76 C;  3NE5 B;  5JEA G;  1H9R A;  4GZY C;  2A6H C;  2D2C C;  2JXM B;  2F1M A;  4KKS A;  1OXX K;  1GUO A;  1B9N A;  1BDO A;  1HTP A;  2DNE A;  1QJO A;  2E74 C;  1FYC A;  2EJM A;  3P20 A;  3VR3 A;  4IFD H;  3FMC A;  1OXU A;  1IW7 D;  3T56 B;  2O5J C;  4IFD G;  3A7L A;  4IQZ A;  3M85 A;  1IYV A;  3A8K E;  1VF5 C;  2K7V A;  4JK1 C;  2JE6 I;  1IYU A;  1Y8N B;  3CRL C;  1A6X A;  4G7Z C;  4DNR B;  2BE5 C;  4XTC S;  2PNR C;  3GQB A;  1E2W A;  2ZT9 C;  1GJX A;  4LJZ C;  3H94 A;  1H9J A;  1OXT A;  2Q8I B;  4KMU C;  1GUS A;  3LNN A;  3M4Y A;  4L8J A;  1T5E A;  3SE0 A;  3QIA A;  1FR3 A;  1G29 1;  5A35 A;  1IW7 C;  2A68 D;  3IFT A;  4XIG S;  3VR6 A;  5KNC A;  4KKU A;  1DD2 A;  2LMC B;  4G7O C;  2EVB A;  2PCF B;  4LK1 C;  1DXM A;  2DNC A;  1I6V C;  3KLR A;  3PUZ A;  4H0L C;  2AWO A;  3SDZ A;  2AUJ D;  3A8J E;  1H9S A;  1LAC A;  1Y8O B;  1VF7 A;  3MXU A;  5KND A;  1OXS C;  4H44 C;  1OXV A;  3VA7 A;  2DN8 A;  4H13 C;  3L7Z C;  1GHJ A;  1HPC A;  2IT1 A;  1GUG A;  4OGQ C;  1V8Q A;  2BA1 A;  2O5I C;  1Z7T A;  3BG3 A;  2PPB C;  3OPO A;  3I73 A;  1DCZ A;  3LWU A;  5BN3 A;  1GUN A;  3EQL C;  4DNT B;  3OOC A;  1B9M A;  1H9M A;  4OO1 H;  2AUK A;  3TZU A;  4KI0 A;  2A68 C;  3D31 A;  4OO1 G;  1LAB A;  2L5T A;  3PUW A;  3W3A A;  5BN5 A;  1Z6H A;  1SMY C;  2BDO A;  2A69 C;  3D4R A;  3PUX A;  1E2V A;  2B8F A;  1EWH A;  3I4L A;  1TKW B;  1Q90 A;  5C0X H;  1HQM C;  1CFM A;  2A69 D;  2BA0 A;  4TQU S;  5C0X G; 
#chains in the Genus database with same CATH topology
 2QGQ A;  3PIO 3;  1SR3 A;  1BVS A;  5BN4 A;  1XNR Q;  3GTG B;  3KUP A;  5EBC A;  1UE5 A;  2C9O A;  2I5M X;  1QUQ B;  3QG1 A;  5C0X I;  4JI1 L;  3RZO B;  2IJ0 A;  4IUT A;  3A54 A;  3S2D H;  4X64 L;  4NXN Q;  1V1P B;  3P1H A;  3C46 A;  3ER0 A;  3HOV B;  3NEL A;  1XNQ L;  1WCM H;  3U4V A;  2R7Z B;  1F2Z A;  2EIF A;  4JYA Q;  1CSQ A;  3S9W A;  1IBM Q;  4RKB A;  3M7N A;  2E75 C;  3SVM A;  3OWE B;  2JYO A;  4FNF A;  2JA8 H;  2NN6 I;  4KD3 A;  2EYJ A;  1EY0 A;  3PMF A;  2I07 B;  3TS0 A;  1MSG A;  4YCW A;  3K0X A;  3OIQ A;  1JCK B;  3GD7 A;  4HTH A;  5ELF A;  1IBK Q;  5T1I A;  1KXL A;  3CC7 A;  4GN5 A;  5JEA H;  4GZY C;  4BBS G;  2BCO A;  1QJO A;  5M3F G;  1EU3 A;  5DM6 3;  3CCL A;  3A7L A;  1UAP A;  4R4C A;  4A76 A;  4DR1 Q;  1WTO A;  1VF5 C;  2OXP A;  1KL9 A;  1YI2 A;  4DNR B;  4B3S L;  2BE5 C;  4GOP B;  3GQB A;  3OW2 A;  1HR0 L;  1I6H B;  2B2Y A;  4BY1 B;  4A3B G;  3LGJ A;  2QEX A;  3S16 H;  3H91 A;  1KIX A;  3E6Z X;  4LF4 L;  4A93 B;  1XPR A;  4JCV E;  4V0B A;  3S15 B;  1K0R A;  3Q23 A;  4A3F H;  4H0L C;  4IN3 A;  1HA6 A;  2AWO A;  1MBY A;  4O2D A;  3HOU H;  1SSO A;  3CKI B;  1ASY A;  4L5T A;  1IZ6 A;  5D3I B;  1HQR D;  2VXW A;  3H3V C;  2BA1 A;  3GTO H;  1RHP A;  4WJW A;  3HOX G;  5LMN W;  2WB1 E;  1AZQ A;  5IGC A;  2DUD A;  1CK1 A;  5D3D A;  1B7Y B;  3MXG A;  5I9P A;  1VQ8 A;  1B9M A;  2FHT A;  1U9R A;  1UE1 A;  1K83 B;  2I0Q A;  4BY7 G;  1V9P A;  3D4R A;  3J7Z C;  4OHJ A;  2XN9 C;  2QIL A;  1PDQ A;  4X62 Q;  4B9W A;  1WTH A;  1Y1V G;  5C0X G;  2BH2 A;  3K80 C;  2PZT A;  1SNP A;  2ICE C;  4OWX B;  4YY3 L;  3T51 B;  4EGV A;  1CA6 A;  2JA5 H;  1EZ6 A;  1HNX Q;  4LF8 L;  3HOW H;  3HKZ B;  2R7D A;  4IUR A;  1EY7 A;  2R92 H;  1G6P A;  2DJF C;  3FRP B;  4CJ1 B;  4RAU C;  2M2L A;  3BU2 A;  1I4Q A;  2R93 G;  1STH A;  2VUM H;  3H09 A;  5IP9 H;  2NN6 G;  2XVS A;  2A5H A;  2EY2 A;  3W1G A;  2EJF C;  5ELC A;  4CHT B;  1JIC A;  1QB5 D;  3HOV G;  4QIW E;  1VS0 A;  3Q0A A;  1HZB A;  1VQG A;  1X3F A;  3KBG A;  4BBR H;  4LUZ A;  2R7Z G;  2AQ1 B;  1YVC A;  5EPJ A;  1MD2 D;  2XTI A;  2B8G A;  1KAW A;  3RLF A;  4RHR A;  4V19 0;  4CDC C;  4PV1 C;  3M3Y B;  2BE5 D;  3OHX C;  1FGU A;  1ONL A;  3OWF A;  1Q1B A;  4WJ3 M;  4OWW B;  5ELB A;  3SK6 A;  4CDE C;  4C2M H;  2NZO A;  3JC6 6;  1BNZ A;  1VMC A;  4EQ5 A;  5IYC G;  1A0I A;  1B3Q A;  4IFD H;  3X3N A;  1OXU A;  2E5L L;  2BH8 A;  5I9O A;  4IQZ A;  1U0L A;  3CU7 A;  4A3E G;  3HKS A;  2K5W A;  2OWO A;  1TS3 A;  4QGU A;  1JB7 A;  1WYD A;  3R2I A;  1VQ7 A;  3S1Q H;  2UXB Q;  1S5E D;  4JBJ A;  1LM0 A;  2XWB B;  2YTY A;  4HAE A;  4KMU C;  1GUS A;  1PZJ D;  1QIL A;  1Y14 B;  3CF5 A;  4JW0 A;  1IL2 A;  1VQF A;  3IFT A;  2JA6 B;  3RN5 A;  1W6K A;  3F2B A;  4FF2 A;  4BY1 G;  4C3H G;  4ZK9 B;  3PCO B;  2DNC A;  1Z9F A;  2VB3 X;  5FLM G;  3FHW A;  3I4M B;  1VF7 A;  5EKL A;  2XNA C;  4LNQ A;  1NR2 A;  4DV1 Q;  1DZ1 A;  1DGS A;  1DCZ A;  1TWG H;  1A3U A;  2HIV A;  3PIP 3;  3TEH B;  2E2H H;  1LAB A;  1AEX A;  4DV4 L;  2RCF A;  3STB C;  2BDO A;  3ERS X;  4GKJ L;  1WTW A;  3J7A F;  4GOP C;  1SYC A;  1ILQ A;  1HQM C;  3EN2 A;  3GTP H;  3VYU A;  2B39 A;  1L0Y B;  1W3S A;  2VW9 A;  4HN7 A;  5AJ3 Q;  1EIY B;  4IPH A;  3RR5 A;  2C35 B;  2SOB A;  2IL8 A;  2PNH A;  1YNJ C;  3TSS A;  2WKD A;  4TSS A;  2R61 A;  3D0F A;  3J80 i;  1EIH A;  5C3X A;  2CH4 A;  2ZM6 Q;  2WP8 J;  4DUY Q;  4B3T Q;  3A5Z B;  1PFN A;  3HKZ G;  3VA5 A;  3T53 B;  1BCP B;  1I3Q B;  2GA4 B;  3VYR A;  2NVX B;  2L12 A;  2AMC B;  1B1Z A;  4HR7 B;  3KF6 B;  4QL5 A;  2KCC A;  4Q0F A;  1FGB D;  2LKV A;  1GM5 A;  3J7A V;  5ELD A;  1XPO A;  3FVQ A;  4UPA A;  2RCN A;  1I94 Q;  2WAQ G;  2VNU D;  4AYB E;  4TRD A;  5JEA J;  2F0Q A;  1R9T B;  2ATW A;  2JP1 A;  3OTO Q;  4KJO A;  4ZYS A;  2IX3 A;  4J1M A;  1Y8P B;  1CQV A;  4KHP L;  1PRT B;  1S5D D;  5EBD A;  4QF4 A;  1GUO A;  4PZ7 A;  1TWH B;  4BWG B;  2F52 A;  4GKK Q;  4QY7 A;  1EEF D;  3CRL C;  3RLN A;  4FVM A;  2D9U A;  1E2W A;  5M5Y H;  2AHO B;  1EYD A;  1U4R A;  5FLX c;  3U9O A;  5GAH C;  5LMU Q;  2YTX A;  1EYG A;  3GTM H;  3E0E A;  2K4K A;  1VQD A;  4A3K H;  2QKI C;  2SDF A;  2IHE A;  3STB D;  5IIF A;  1HHV A;  2K6A A;  3BJU A;  5E4X A;  4DV5 Q;  3H0G B;  1B8A A;  4DAV A;  3PO3 H;  3VA7 A;  3FEW X;  2F0T A;  1X9N A;  2JA6 G;  3OPO A;  2UUC Q;  1G2S A;  1JWS D;  4JVZ A;  1P16 A;  2EE1 A;  3L3O C;  1PH2 A;  2HDM A;  2OCE A;  1ET6 A;  2IY5 B;  4R4T A;  3I4M G;  5JJK A;  2EYF A;  2RBM A;  2UUA L;  2CFM A;  1RIP A;  1UUP A;  3NTH A;  2K28 A;  4A3C G;  4ALP A;  2NUC A;  4JI2 L;  3S2D B;  3SEB A;  4PZ8 A;  1XMQ L;  1EY9 A;  3FDT A;  1NMG A;  4A3I H;  4EQN A;  1HA5 A;  4DU9 A;  5DEH A;  4DXF A;  1WCM B;  4KN4 C;  4JI5 L;  2CHB D;  3S24 A;  1LTI D;  1YHA A;  5G3L F;  3KJO A;  1PH4 A;  2UUB L;  1FNV A;  3A7A B;  2D5D A;  5IWA L;  1E7Z A;  5IYD H;  1A63 A;  2EZV A;  2EQS A;  1N33 L;  1SAP A;  2EY6 A;  4R4Q A;  3PIO A;  2JA8 B;  1A15 A;  3A74 A;  3KLS A;  4LFA L;  4GLX A;  1IBL Q;  2XRS D;  3C2P A;  1QOH A;  1WD1 A;  1K8O A;  2K50 A;  1WJJ A;  2QF7 A;  3I90 A;  3L2P A;  1FL0 A;  3V96 A;  3JAM c;  1BF4 A;  3RLO A;  3ULJ A;  5IGB A;  1EEI D;  4G7H C;  2L11 A;  2IX0 A;  1EL0 A;  1G2T A;  3VR4 A;  4GLV B;  4LF9 Q;  2OEO A;  2ZTD A;  1Q12 A;  2RVL A;  4L5Q A;  3PV0 A;  1O7L A;  1HZ9 A;  1NUC A;  1VDZ A;  4DAP A;  3K7U C;  3NE5 B;  4IFD J;  2KJX A;  1DM0 B;  1JC7 A;  1P8L A;  4XT1 B;  5IGD A;  3QO2 A;  4EQO A;  4HIM A;  1SE4 A;  2F0J A;  4HCS A;  2HQE A;  4UAI A;  5FO9 B;  5J1Z A;  3UDX A;  3K59 A;  2EXZ A;  1X3G A;  1BCP C;  5C44 H;  2EY1 A;  1TS4 A;  4DUZ L;  1K3B C;  4A3F B;  1KHI A;  1SYF A;  3AFP A;  2VQF L;  1EQV A;  3HOU B;  2RHQ B;  4A3D H;  4NXM L;  4LF5 Q;  1PH8 A;  4CDF C;  4KKU A;  3GTO B;  1QUQ A;  5JPN C;  1LAC A;  1VQJ A;  1V1P A;  3NWS A;  2JA9 A;  1HPC A;  1PRT C;  1PVO A;  1PYB A;  1LO5 D;  1BOS A;  5E4W C;  1PTO F;  1F2M A;  5CR3 A;  1GUN A;  4ZUJ A;  2EYH A;  3MAQ A;  4ZAI A;  3BS1 A;  1AFP A;  2RKS A;  4A3M H;  5IYB G;  3GTJ H;  2JA5 B;  4IUN A;  1PH7 A;  3RUZ A;  3HOW B;  3M4Q A;  2R92 B;  1FNW A;  1FD7 D;  3BDO A;  5IT9 L;  5C4X H;  2EYP A;  1CKN B;  1F2Y A;  1XTD A;  4A3G H;  2VUM B;  2VL6 A;  2GVA A;  5IP7 G;  4KHZ A;  3SK8 A;  4PG3 A;  3E9H A;  2N88 A;  1N9W A;  3PUV A;  4K0K L;  4S3S A;  4RCN A;  4WOR A;  3RD4 A;  1LUZ A;  4BBR B;  3KFU A;  4KTA A;  3QWN A;  4A3J H;  2B3G A;  3B6Y A;  4GOP A;  4BA2 I;  4FO2 A;  2JA7 H;  1EZ8 A;  1YIJ A;  4DV7 L;  3PQI A;  1BUV T;  1QVC A;  1W2B A;  1GHK A;  2JK8 A;  2A1A A;  4C2M B;  4DV3 L;  2JJQ A;  3CMA A;  3DXJ C;  5E1F A;  4XYQ A;  1NTG A;  1LLR D;  4KN7 C;  1BR9 A;  3WDN A;  1BCP D;  5JEA G;  4MZ9 A;  1GKH A;  2FFK B;  4JI3 L;  4DV0 L;  4KKS A;  4LFB L;  1YHQ A;  2DNE A;  5JJI A;  1Q3L A;  3CHB D;  2B2U C;  1E0B A;  2JSO A;  4ZLT F;  5I6Y A;  3S1Q B;  5IE8 A;  1SJE D;  3BDL A;  2JN4 A;  1G6Z A;  1TWF H;  2CQA A;  4IFD I;  4LF7 L;  1T9H A;  1WFQ A;  1B3A A;  2OTJ A;  4LUV A;  4Z9C B;  1F9P A;  3LNN A;  4G4K A;  4KY7 A;  3TZD A;  2F0K A;  1X65 A;  4A4I A;  3HG9 A;  1XXG A;  3KF8 B;  1TWG B;  2CVR A;  4DAY A;  5EKK A;  1QZH A;  1OXS C;  1PZK D;  2IWH A;  1KD1 C;  3JAM i;  3HOU G;  2E2H B;  1OXV A;  2NB0 A;  3TBI B;  3EJI A;  2Y0S B;  2X69 A;  3CC2 A;  2HUG A;  3HEJ A;  3I73 A;  3HFZ B;  2EYL A;  4IUV A;  3I55 A;  5M5W H;  4XDX A;  5HGQ A;  1SYE A;  4NXN L;  4POF A;  4DXG A;  3GTP B;  2LY7 A;  1SYB A;  3SK5 A;  4YWL A;  2QCP X;  4OX9 Q;  1V1Q A;  2R7F A;  4DR2 Q;  1IBM L;  3K57 A;  5T1G A;  2BA0 A;  3AU7 A;  3SK4 A;  3PIP A;  4DR6 L;  1M4V A;  1X54 A;  4JI0 Q;  3MFY A;  3SHL A;  1N34 L;  3EFX D;  3PF5 A;  4RA8 A;  4BA1 I;  2JA5 G;  2A6E C;  3HOW G;  1Q82 C;  2R92 G;  5CC4 A;  2JEB I;  4TKO B;  3TP7 A;  1RD9 D;  2K03 A;  1N8R C;  4AQY Q;  1ZKO A;  1QWY A;  2RQX A;  5EPK A;  3RZD H;  5IP9 G;  1V43 A;  1LTS D;  5J3B A;  1XWE A;  2YYZ A;  1UE7 A;  4BBR G;  2F0E A;  1I4R A;  2IW3 A;  5FLX L;  1AP0 A;  3I72 A;  3ICE A;  1NNX A;  1E1O A;  3ULP A;  5EQ0 A;  1VQB A;  2E76 C;  3C1F A;  2CH4 W;  1EIG A;  2CW0 D;  2XIW A;  3U4Z A;  4B3M L;  2VS1 A;  2AQ2 B;  3LX0 A;  2Q2T A;  4HJ8 A;  4RWS C;  4QUC A;  1YIT A;  1FYC A;  2F0D A;  3T56 B;  2O5J C;  4IFD G;  2ZXP A;  1FJG Q;  5M5Y B;  1F9R A;  3GTM B;  1B4O A;  1LTB D;  3MXN B;  4A3K B;  4UDU C;  3HP3 A;  3R2T A;  4PMB A;  1S72 A;  3HKZ E;  1MHW C;  1A62 A;  2F4V Q;  4F88 A;  1VQP A;  1UEA B;  4B08 A;  1KDC A;  3QIA A;  4RFB A;  1X3Q A;  3PO3 B;  1JMC A;  4TVA B;  2WAQ E;  2EVB A;  2PZU A;  5FJ8 G;  2QEJ C;  3D8G A;  5C6A A;  1KQS A;  3DEP A;  2IHF A;  3SDZ A;  3PF4 A;  2PI2 A;  4K2K A;  1Y8O B;  5DAU A;  3MXU A;  3I2Z A;  4LF6 L;  1A2U A;  2J7Z A;  1D6E C;  3BG3 A;  1HNX L;  3CCR A;  2ES2 A;  4L5S A;  3JAM E;  2VQE L;  3J80 c;  5J39 A;  1KNE A;  4A3I B;  1J5E L;  4MHE A;  3KF6 A;  4R4O A;  3NUC A;  5M3M G;  1VQI A;  1S5F D;  3K6O A;  3S1M H;  4B3R Q;  5CBA E;  2RA4 A;  3NQT A;  2K5H A;  2NTS A;  2K32 A;  3IKJ A;  1CSP A;  3MXP A;  2KEE A;  2CCZ A;  2X6G A;  5K5P A;  1PFB A;  2LS0 1;  3OSO A;  1PHJ A;  1JJC B;  1H9K A;  1HCZ A;  4JI1 Q;  5FO8 B;  3KJP A;  3I4N B;  4X64 Q;  4JI7 L;  1W6J A;  3QOL A;  4P75 A;  4XXE A;  4IUQ A;  3R8B A;  5C3E B;  2EYM A;  3A8I E;  1N32 L;  4GS3 A;  1VQE A;  1H95 A;  4A75 A;  4JBK A;  2Q2U A;  1E2Z A;  2K33 A;  1PH9 A;  4QUF A;  2MNA A;  3IL8 A;  3ND8 A;  3OW7 A;  2K14 A;  4NPS A;  1I50 H;  1RTO A;  3CP0 A;  3UE1 A;  3PUY A;  4BS9 A;  2WIN B;  1G8Z D;  2HHH Q;  2PW7 A;  1I4P A;  4JV5 L;  2C5C A;  2EPB A;  2Z6B A;  4DAY B;  2SNS A;  2UXB L;  3KLS X;  4C3J G;  4Y52 H;  1SBB B;  3MZ5 A;  4R4I A;  1H9R A;  1B2T A;  1EY4 A;  1L2F A;  2F1M A;  3TN2 A;  3S14 H;  1HTP A;  3NEN A;  2WFW A;  2NVT H;  3VR3 A;  2TSS A;  4OWT B;  5C44 B;  1TS2 A;  3A8K E;  5FK9 C;  4YHH Q;  1S40 A;  4DGZ A;  1VQA A;  3TP5 A;  2MO1 A;  1HR0 Q;  4A3D B;  1ENA A;  2I46 A;  4DV1 L;  4ME3 A;  3S1N B;  1KNA A;  5DLQ E;  3PO2 H;  4FXK C;  5KIX A;  3M4P A;  4LF4 Q;  1LTL A;  3L0O A;  3EVQ A;  5C4Z A;  1T5E A;  4X3S A;  2F0U A;  4DR7 L;  2A19 A;  1JWM D;  4A3K G;  5A35 A;  2G9D A;  2KCN A;  4N8F A;  5DNF A;  4DR3 Q;  4PMC A;  3VDY A;  4JI8 L;  3I70 A;  1ET9 A;  1S5B D;  2B2U A;  1H9S A;  2OTL A;  1SRO A;  2K01 A;  2KCT A;  2DN8 A;  2IT1 A;  4NMZ A;  3PO3 G;  4A3M B;  2JQO A;  4JI6 Q;  2HIX A;  3SR1 A;  3GTJ B;  4RGM A;  4PMW A;  1EWI A;  4CKB A;  4DNT B;  5COR A;  2LSS A;  2A68 C;  5C4X B;  3PUX A;  1J9O A;  2WV6 D;  1NSN S;  4B3T L;  1F77 A;  1EWH A;  1SNC A;  3G48 A;  2N55 A;  4A3G B;  1CHP D;  4DR4 Q;  1ROD A;  1BQQ T;  2L0C A;  2O2L D;  3EA6 A;  4CGY B;  4A3I G;  4LF8 Q;  1GVP A;  2WB1 B;  2KCM A;  4A93 G;  1KLG D;  2UXC L;  1AE2 A;  3ZYY X;  4KY6 A;  4A3J B;  3OTO L;  4LWC A;  5IYD G;  4XQQ A;  2JA7 B;  5I2Y A;  1ENF A;  1IL8 A;  1N36 L;  1PYS B;  3ERO A;  4MN3 A;  2L9H A;  5EAY A;  2QW7 A;  2ICI A;  4CKE A;  1SNQ A;  1CZW A;  3BVM A;  1BO0 A;  2NWG A;  4C56 C;  2QDB A;  4X3K A;  2E2J H;  4CJ2 C;  1B44 D;  1Y1W H;  4OEL B;  2V4D A;  2HCC A;  4PQX A;  3DWQ A;  5DM7 3;  5KNB A;  1ESR A;  2G5D A;  4DV2 L;  4FYD A;  2K04 A;  1Q81 C;  2Q2H A;  2Z9H A;  1PLF A;  2BOS A;  4JBM A;  1PYW D;  4ZRZ A;  5IOD A;  2GN5 A;  4Y7N H;  4J6H A;  3K0Y A;  2J0T D;  5CV6 A;  5F2D A;  1KAA A;  3CD6 A;  1KDA A;  1TWF B;  2DJG C;  2E5L Q;  3CC4 A;  3S2H H;  4MTN A;  3A55 A;  4O42 A;  1MGS A;  4RHS A;  3T1H L;  4QIW B;  5KYI A;  4UY8 C;  2F3I A;  3K5O A;  2F3V A;  4AIM A;  3HOZ H;  1CKM A;  1TWC H;  2EYO A;  2MQH A;  3NK9 A;  4DV5 L;  3C1E A;  3NBI A;  4K8J A;  4NB3 A;  4JI4 L;  2UUC L;  2ZT9 C;  1X3E A;  3AYH B;  5CGK A;  4IOA A;  3G6E A;  2QDL A;  4ODG A;  2UU9 L;  3T1Y L;  1WOC A;  1WTV A;  1JQY D;  4A3D G;  1YJN A;  2A68 D;  2LMC B;  1CKN A;  4K8I A;  4UHV A;  2PCF B;  5CBE E;  4ID6 A;  4I7A A;  4LAA A;  1U4P A;  5M5W B;  1AH9 A;  1HNW Q;  4UP7 A;  1M1K C;  3E5S A;  1T5X D;  1GHJ A;  2D0O A;  1VQN A;  1CQF A;  1PFS A;  3T16 A;  1O7Y A;  1Q46 A;  3G7L A;  1X56 A;  4AH6 A;  4OO1 H;  4DV4 Q;  2AUK A;  4DR5 L;  2F0I A;  3NBH A;  2R93 H;  1HXY D;  3W3A A;  2GVB A;  5CV4 A;  1UEB A;  3G4S A;  3E3X A;  1DOL A;  4A3M G;  1NR4 A;  1EFI D;  5J22 A;  1ML0 D;  4RGO S;  1RJT A;  2VY3 A;  5JOB A;  1J6Q A;  2OQK A;  1ILP A;  4OIJ A;  1YJW A;  3PSI A;  5I6W A;  3RZD B;  3OIP A;  4BXX H;  2F03 A;  2N8N A;  1RDP D;  2PQE A;  5COY A;  1YNJ D;  5EJW A;  5A2Q E;  1X3P A;  4I7Z C;  1SE8 A;  2ZJP A;  1TU2 B;  1UE6 A;  2ZXR A;  3A56 A;  1STG A;  2JEA I;  4XT3 B;  2KA7 A;  2Z4I A;  1NAP A;  5JAV A;  2JA7 G;  2RDH A;  3W2D A;  1VQO A;  1A3T A;  3TQY A;  2B2T A;  2SNM A;  1HR0 W;  2KHS A;  1WTP A;  1PTO B;  1H9S B;  5M5X H;  4A3L H;  4IO9 A;  1TXY A;  4KHP Q;  3Q22 A;  4K5X A;  2F0O A;  3KF8 A;  2RDG A;  2MPM A;  3J80 E;  1D8L A;  3I4N H;  3DM3 A;  1BDO A;  1BCP F;  3K7A H;  5EPL A;  4K6D A;  1SE2 A;  5C3E H;  1SND A;  3SXH A;  1HUN A;  1YNX A;  3OMG A;  3NSW A;  4NKL A;  2CKZ B;  4OL7 A;  1IYU A;  1XPU A;  4AYB B;  4HMI A;  2F3W A;  2CQO A;  3UDI A;  1TQO A;  3I91 A;  4J8Q A;  4X66 L;  2HCI A;  3T4A C;  4IJL A;  1C9O A;  1B70 B;  4M8A A;  2PYK A;  1V1O A;  4WJ4 A;  1FR3 A;  4P73 A;  1SLJ A;  1IXR A;  2KHI A;  1BBX C;  3NP8 A;  5JPM C;  3M9B A;  3FKI H;  3RNU A;  3J81 i;  1D5M C;  2F4I A;  3LWU A;  1STN A;  3S1M B;  1SNM A;  2K5V A;  2UUA Q;  4C3I H;  1VQC A;  1HNZ L;  4QB4 A;  4X65 Q;  2QA4 A;  2HQL A;  3F1Z A;  2A69 C;  1DON A;  4NDX A;  5IY0 A;  4JI2 Q;  3S1N H;  1Q90 A;  2K75 A;  1XMQ Q;  2PZW A;  1C48 A;  3GP7 A;  4C1N I;  3BYY B;  3CXC A;  1QE6 A;  5K36 H;  4JI5 Q;  4N8X 1;  2UUB Q;  4DKA C;  1TY0 A;  1O78 A;  5D65 A;  2K5Q A;  2M9V A;  5IWA Q;  4OEM B;  3UDF A;  4LFC L;  3QR8 A;  5LMN L;  3TDQ A;  1N33 Q;  5M9O A;  1E22 A;  2KOL A;  3H0G G;  3K8A A;  1I50 B;  3GO5 A;  2F0G A;  1CHQ D;  2AKW B;  4LMQ D;  3AQQ A;  2L4N A;  1DJR D;  3MXN A;  4I65 A;  2UXD L;  4DK0 A;  3AMU A;  1BKB A;  1STB A;  4C1N K;  4DV6 L;  2ALY B;  2D62 A;  4FF1 A;  1A8V A;  1LV9 A;  2PMZ E;  3OMC A;  4DFA A;  3S14 B;  3CQZ H;  2WKC A;  3VYT A;  2NVT B;  4ILW A;  4HJ5 A;  3F2D A;  2A6H C;  4H02 A;  3X3M A;  1WCM G;  3NTI A;  1A3V A;  4R1J A;  3S17 H;  3PO2 B;  3NBH B;  3CW2 C;  3KLW A;  3CPW A;  4GLA C;  4FDB A;  4GN3 B;  2CWP A;  4G7Z C;  3EIV A;  2JA8 G;  5JJL A;  4RGN A;  4XTC S;  4DUZ Q;  4LJZ C;  3H94 A;  2VQF Q;  1OXT A;  4FP5 D;  2AWN A;  5CV5 A;  1EY5 A;  4HIK A;  3MWY W;  4FXD A;  1C7Y A;  1SYD A;  1S3O A;  4OX9 L;  1II3 A;  1YZ6 A;  4XIG S;  4PNY A;  3C3L A;  1PTO C;  1QNU A;  2LFN A;  1I6V C;  4YWM A;  3BVG A;  3V2T A;  4IUU A;  5KND A;  1JB3 A;  4H13 C;  4R8I A;  4HIO A;  1MI2 A;  1V8Q A;  4ABN A;  1Q86 C;  3HZX A;  3KDF B;  3NTK A;  5C5L A;  1STY A;  4KLK A;  1Q7Y C;  4O0A A;  1PRT D;  3J81 E;  2OT2 A;  4KI0 A;  4IJH A;  1STA A;  2B63 H;  4HSP A;  3DWA A;  1Z6H A;  1SMY C;  1LT5 D;  4ZKB B;  1JE5 A;  1QVG A;  1PH3 A;  1SRU A;  1VQ9 A;  5ELO A;  2F0F A;  2EOT A;  4A3F G;  1D2B A;  4GN4 B;  2KUM A;  3CME A;  1FNU A;  3O13 A;  1SMX A;  2KQ3 A;  1TVX A;  2Z6K C;  4MIU A;  1MIU A;  2E8G A;  1YEZ A;  5EKI A;  5C4H A;  1XNR L;  4KKT A;  4GNX A;  3D6C A;  3V05 A;  4UP9 A;  3MHB A;  1SXT A;  4K0K Q;  4LW1 A;  3BYT B;  2E2J B;  5C4J H;  1Y1W B;  3IFD A;  1L1O A;  2A6H D;  4A3B B;  4JYA L;  4DV7 Q;  4XQN A;  1DOM A;  1VQ5 A;  3D3R A;  1SJH D;  5CYU A;  4Y7N B;  1JE4 A;  3T13 A;  4DV3 Q;  1MJE A;  4P74 A;  4CKC A;  3WOE A;  1EQQ A;  3S2H B;  4Q5V A;  1XMO Q;  2Z8L A;  1IBK L;  4DV0 Q;  3FPU B;  4JI3 Q;  4LFB Q;  3HOZ B;  1TWC B;  3ERQ A;  4QCL A;  4N9P A;  4DN4 M;  1GUW A;  4MTK A;  2VUM G;  2B2V A;  3DM1 A;  2A8V A;  3FMC A;  4HED A;  1PH5 A;  4IZ8 A;  2TMP A;  4RH6 A;  3W5O A;  3P7J A;  4BY7 B;  2RSO A;  4DR1 L;  1O7I A;  1GOZ A;  2B29 A;  3NPP A;  3MVV A;  2PNR C;  2EXD A;  1O80 A;  1EUJ A;  1TII D;  5AFW A;  3PO2 G;  1ICF B;  1YBY A;  1HH2 P;  3SE0 A;  2RHS B;  5GAE C;  1LYL A;  2Z4H A;  1DD2 A;  1PTO H;  3PGZ A;  5KEE A;  5LL6 X;  4B3R L;  1BBU A;  4G7O C;  5TSS A;  5JJZ A;  4DK6 C;  4RCO A;  5BR8 Q;  1G91 A;  2NYZ D;  4JG2 A;  1MSH A;  2R93 B;  5IP7 H;  1GUG A;  3S1R B;  3CCS A;  1BXT A;  4CBV A;  4L63 B;  2K5N A;  2E2D C;  2KED A;  3DHQ A;  1CT1 D;  4HJA A;  2L5T A;  1U5K A;  1K28 A;  4H7B A;  3RMH A;  1E2V A;  2B8F A;  4K5V A;  1JJG A;  3K5M A;  1CKO A;  1IKM A;  2FXQ A;  4OO1 I;  3NWT A;  3M7G A;  4QQB X;  4DR6 Q;  4X62 L;  1N34 Q;  3UI2 A;  1EOV A;  1K8G A;  1CUK A;  3P75 A;  1GUT A;  4YWK A;  1JT8 A;  2MJ8 A;  2K5D A;  4OIK A;  4MNO A;  2HHH L;  1JR0 D;  1SEB D;  3GTL H;  3AB9 A;  4KY5 A;  4A3E B;  4HMJ A;  1Q1E A;  2A6E D;  3VR5 A;  5CMD A;  2EJG C;  2OF1 A;  2F0S A;  2YTV A;  4QMG A;  1RTN A;  2OQ0 A;  2NZ1 D;  2Y0S G;  1XTC D;  2KHJ A;  1Z47 A;  4X3T A;  5M5X B;  4XQJ A;  5E3F A;  2B2T C;  4OON A;  4YHH L;  1Y1W G;  5ISR A;  3JAM L;  1PMR A;  1S4Z A;  4JBW A;  4IUP A;  4C3H B;  3QJY A;  3K7A B;  2EY5 A;  2I5L X;  4DPG A;  3HS0 C;  1XNQ Q;  3F8T A;  4B3M Q;  1SYG A;  3HOY H;  2KEN A;  4RG1 A;  4APV A;  1X6O A;  1U4L A;  2FJ2 A;  2MGS A;  1EY6 A;  2E74 C;  2EJM A;  4DR3 L;  1MJC A;  4ME5 A;  1LTR D;  2K7V A;  1KDB A;  1PV4 A;  2ZTE A;  3HOZ G;  4KD4 A;  4HJ9 A;  1HRJ A;  1D5X C;  1K73 C;  3QOJ A;  5L37 A;  1WTR A;  4JI6 L;  1B53 A;  1RKN A;  2X6L A;  4LUO A;  1X55 A;  3N52 A;  4EQP A;  3FKI B;  1EQR A;  5IGF A;  4X3U A;  1E3P A;  4GNX B;  1IW7 C;  2MUY A;  1K0S A;  1SNO A;  2PQA A;  4QJF A;  4DR4 L;  2AUJ D;  3A8J E;  5GQO A;  5CV7 A;  1TWA H;  4K6L A;  4C3I B;  4LF6 Q;  3WWV A;  4B3S Q;  5KRU A;  4JOI C;  4YCU A;  1L1O B;  2VQE Q;  1HTL D;  2PPB C;  3TME A;  1RF2 D;  2XWJ B;  5HUR A;  5C5M A;  1GD7 A;  2PI2 E;  3OOC A;  2D0P A;  2KEC A;  1Q8K A;  1J5E Q;  2YU9 H;  2KVM A;  4OO1 G;  1JOK A;  2WAQ B;  1VMP A;  2NVY H;  1QCB D;  3I4L A;  2ASB A;  1I4X A;  3DLL A;  4JPB W;  1PH6 A;  5H1S E;  2NVQ H;  5GAG C;  5IT9 c;  1JJ2 A;  4E6I A;  5AJ3 L;  2ZJQ A;  4JI7 Q;  2XSC A;  3I56 A;  3D4D A;  5E7N A;  1N32 Q;  4BXX G;  2AQ3 B;  1Y69 U;  1VQH A;  2N78 A;  1WTX A;  1TT2 A;  1M90 C;  2ZM6 L;  3VR2 A;  2L1B A;  3TRE A;  1RCV D;  4DUY L;  1IHZ A;  1CTM A;  3R93 A;  3M4O H;  3GTK H;  4N9T A;  3URY A;  1VCI A;  4YY3 Q;  3CQZ B;  4U68 A;  2MP1 A;  1G51 A;  3VYS A;  5CV9 A;  1NMF A;  1LTG D;  1K8M A;  3GTQ H;  1GO3 E;  1KAB A;  2Z6K A;  4JV5 Q;  1I94 L;  1E24 A;  2WAC A;  1Q8I A;  1WVL A;  2E2I B;  1FVI A;  5GAD C;  1VQ6 A;  4A3L G;  3S17 B;  4B9X A;  1CI3 M;  2F0H A;  1ZXT A;  4BBS H;  3G71 A;  2H5X A;  4K14 A;  5FJ8 H;  1OXX K;  5KYL A;  3I4N G;  5M3F H;  2P5Z X;  1EIF A;  1IW7 D;  1NE3 A;  3CCJ A;  5EGT A;  5C3E G;  4P2C B;  1HNW L;  3SGI A;  2JE6 I;  3H3V H;  4GKK L;  1Y8N B;  4IPD A;  1CM9 A;  5CV8 A;  3J81 c;  4A3B H;  2K52 A;  2XRQ D;  4F87 A;  3KYH C;  4EX5 A;  3CCU A;  1H9J A;  2Q8I B;  4DR7 Q;  5M3M H;  3G6J B;  3E0J A;  5LMU L;  1MKH A;  4JC0 A;  2KBN A;  5KNC A;  3VR6 A;  4JI8 Q;  1U4M A;  4KJN A;  3EBE A;  5IGG A;  5JVH 3;  5NUC A;  2MO0 A;  4H44 C;  3FKI G;  2B63 B;  3K5L A;  3HOX H;  4OGQ C;  1JWU D;  1VQL A;  3EQL C;  2ZJR A;  1SFO H;  3F2U A;  3MEH A;  3UE0 A;  2FMM A;  2NTT A;  5C44 G;  4C3I G;  3HRZ C;  4BY7 H;  4DF7 A;  1VQ4 A;  5BN5 A;  2PO4 A;  1XJV A;  3IAY A;  1ZEQ X;  2YV5 A;  1Y1V H;  5C0X H;  1CFM A;  2NBF A;  4WFN 3;  4TQU S;  3QB3 A;  1IYJ B;  1F9Q A;  2Z0S A;  4K5W A;  2DGY A;  5K36 G;  5C4J B;  2A74 C;  2UXC Q;  4GNX C;  4PZ6 A;  4C3J H;  3L9A X;  5ELE A;  1N36 Q;  2H1E A;  1QVF A;  3GTG H;  1HFG A;  4GKJ Q;  3BZC A;  3S1R H;  3RZO H;  4FF4 A;  1L1O C;  2NN6 H;  4ULL A;  1J8I A;  5GRO A;  1OO9 B;  1HUM A;  1L0W A;  2F0P A;  5ELN A;  3HOV H;  1HJP A;  3R3O A;  2Z1C A;  3J81 j;  1D1I A;  1IBL L;  2R7Z H;  3K58 A;  4DV2 Q;  2R6G A;  2HDL A;  5C4X G;  4F8M A;  2PQA B;  1M8A A;  1ENC A;  1ZYR C;  4A3G G;  5I4D A;  1PH1 A;  2ZTC A;  2B2W C;  4LF9 L;  3IRB A;  1I4H A;  5FKA C;  3CAM A;  4FF3 A;  2WB1 G;  5IYC H;  1O7Z A;  4FXG C;  3I8Z A;  1LTA D;  1PZI D;  2B2V C;  2F0W A;  3T1H Q;  1WD0 A;  1EOT A;  3ITP A;  4A3E H;  4A3J G;  3KDF A;  4O1N A;  4IOC A;  3M85 A;  1HZA A;  3MTS A;  4JK1 C;  1S5C D;  4HSV A;  1A6X A;  3KK7 A;  4JI4 Q;  2F0M A;  2J4X A;  5A2Q L;  2Q8T A;  3I3C A;  1ESF A;  2UU9 Q;  5D14 A;  3T1Y Q;  5HGT A;  1EFW A;  2ZXO A;  4X65 L;  1SE3 A;  3Q8D A;  1I6H H;  1BBW A;  3MFG A;  2LXK A;  2V1C C;  4C3H H;  3A5U A;  4BY1 H;  4LF5 L;  1HZC A;  3F2C A;  4LK1 C;  4R8N A;  1K8A C;  5FLM H;  2FIN B;  1ASZ A;  5IGE A;  2L15 A;  4HID A;  3BZD B;  5IOC A;  4A93 H;  2N49 A;  4IAL A;  3FP9 A;  1I4G A;  3I7F A;  1PA6 A;  3L7Z C;  1XYI A;  2O5I C;  4G57 A;  3S15 H;  1LT4 D;  3K81 C;  2XGT A;  3J7A 5;  1GXD C;  4DR5 Q;  3J80 L;  4X6A H;  3CCQ A;  3GDE A;  2R3Z A;  3TP8 A;  3D31 A;  1TS5 A;  1L0X B;  1C4Q A;  2B63 G;  1PRT F;  3DWP A;  1QG7 A;  1DOK A;  5I2X A;  1NJI C;  3TZU A;  3GTL B;  2RSN A;  4M1U B;  1K83 H;  1AW7 A;  4DAM A;  1C0A A;  3U9S A;  4WRD A;  2A73 B;  4IPG A;  2L55 A;  4NW2 A;  5C3W A;  2F0L A;  4JOI A;  4DK1 A;  1KTK A;  1AE3 A;  4L6T B;  3FPP A;  4NP5 A;  3MC0 B;  5FO7 B;  3K5N A;  1ZYR D;  3Q6S A;  1D7Q A;  3UDG A;  4UP8 A;  3H15 A;  2DY7 A;  1VQM A;  2VZA A;  4YCV A;  1TY2 A;  3S16 B;  3ONA B;  1EYA A;  3NHH A;  4POG A;  3HOY B;  2Q2I A;  2B2Y C;  2ID0 A;  5FOB B;  1PFM A;  4DNI A;  3CRK C;  4RKL A;  2DY8 A;  1SN8 A;  4ZKC B;  1NBW A;  4ZUI A;  3TRZ A;  4HCE A;  2I5H A;  1HFN A;  2MFI A;  2D2C C;  2JXM B;  1B9N A;  2ENB A;  3NQI A;  4LFA Q;  2MHV A;  3P20 A;  2LXJ A;  3M3Y H;  1IYV A;  2FMC A;  1TR5 A;  1YHB A;  2G9H D;  2H4O A;  1C8C A;  1F2L A;  2SEB D;  1F9S A;  4X66 Q;  1KRT A;  3BZK A;  5IT9 E;  1KC8 C;  3KBX A;  2Y0S E;  4DK3 C;  2N3S A;  1GJX A;  1QNK A;  1EU4 A;  3D6W A;  3MEF A;  1JOO A;  4R9W A;  3M4Y A;  5LL6 S;  3E9I A;  3I4O A;  4L8J A;  1VQK A;  2F0V A;  1TWA B;  2IX1 A;  1UWV A;  3ZJY C;  4RMF A;  4DA2 A;  4EVO A;  3RN2 A;  4HJ7 A;  2E2I H;  1NY4 A;  2YU9 B;  4P71 A;  2JA6 H;  3DMU A;  3A0J A;  3BDC A;  1Z7T A;  2NVY B;  4CJ0 B;  3TP6 A;  1HNZ Q;  3I4M H;  4P72 A;  3CCV A;  4RGT A;  3PUW A;  4CDD C;  4YIJ A;  5C0X J;  4NXM Q;  2NVQ B;  1PXU A;  1WTQ A;  1B50 A;  1ICW A;  4AYB G;  4A3C H;  4KK7 A;  4KHV A;  3CPF A;  1UNS A;  1D1K A;  1TKW B;  4DR2 L;  4KV6 A;  2A69 D;  1CZG A;  2HT1 A;  5G3L D;  1A2T A;  4JI0 L;  2CWA A;  2Q8R E;  3U50 C;  1EY8 A;  4LFC Q;  3ND9 A;  5LMN Q;  1E1T A;  3OYY A;  4J15 A;  3M4O B;  4XYO A;  3GTK B;  1NCV A;  2WII B;  3NEM A;  3GV3 A;  1STE A;  1XMO L;  3U58 A;  1DYQ A;  4AQY L;  1YNN C;  2UXD Q;  3GTQ B;  3N6R A;  1QZG A;  1LT3 D;  1XX8 A;  3HGB A;  1KLU D;  4DV6 Q;  2M00 A;  1K9M C;  3CCE A;  4BBS B;  5HY6 A;  4IPC A;  3J81 L;  1I3Q H;  1JOR A;  4L5R C;  2NVX H;  1OTC A;  1LT6 D;  2EDG A;  2HD3 A;  2CW0 C;  5M3F B;  3TS2 A;  2NZH A;  1AZP A;  2F0N A;  3HOY G;  2K1B A;  1R9T H;  3W1B A;  1I5F A;  2BDN A;  3WOF A;  5BR8 L;  1EWC A;  1SDF A;  1WI5 A;  1FJG L;  5M3M B;  1EQT A;  1R4Q B;  1LTT D;  2PMZ B;  3KOJ A;  1JOQ A;  1KRS A;  3DEO A;  1TWH H;  3H3V I;  2RF4 A;  2F4V L;  3AFQ A;  3AEV A;  2B2W A;  2RDF A;  4U67 3;  1R4P B;  1G29 1;  4ZCK A;  3HOX B;  3H6M A;  3MA2 B;  5LHY 1;  3NXW A;  1DXM A;  3KLR A;  3PUZ A;  2PW5 A;  1SFO B;  3CCM A;  5JVG 3;  4F7X A;  1PTO D;  2O4X A;  2K05 A;  1AN8 A;  1RL2 A;  4LF7 Q;  1K3R A;  3GV6 A;  3Q24 A;  4K2L A;  5BN3 A;  3LWE A;  1D5Z C;  4OXP A;  2IPK D;  1Y1V B;  3BVZ A;  1H9M A;  3H0G H;  5KGU A;  1IKL A;  4ZQ3 A;  5FLX E;  1YJ9 A;  5IYB H;  3DUZ A;  3D4W A;  1EYC A;  3ULL A;  1X32 A;  2VB2 X;  1CA5 A;  3J7Y W;  1SMY D;  4C3J B;  1YNN D; 
#chains in the Genus database with same CATH homology
 3PIO 3;  5BN4 A;  3GTG B;  3KUP A;  5EBC A;  2C9O A;  3QG1 A;  5C0X I;  3RZO B;  2IJ0 A;  4IUT A;  3A54 A;  1V1P B;  3P1H A;  3C46 A;  3HOV B;  2R7Z B;  1F2Z A;  3S9W A;  4RKB A;  3M7N A;  2E75 C;  3SVM A;  3OWE B;  2JYO A;  4FNF A;  2NN6 I;  4KD3 A;  2EYJ A;  1EY0 A;  3PMF A;  2I07 B;  1MSG A;  3OIQ A;  5ELF A;  1JCK B;  3GD7 A;  4HTH A;  5T1I A;  5JEA H;  4GZY C;  2BCO A;  1QJO A;  1EU3 A;  5DM6 3;  3A7L A;  1UAP A;  1WTO A;  1VF5 C;  2OXP A;  4DNR B;  2BE5 C;  3GQB A;  1I6H B;  2B2Y A;  4BY1 B;  3H91 A;  3E6Z X;  4A93 B;  4V0B A;  3S15 B;  3Q23 A;  4H0L C;  4IN3 A;  1HA6 A;  2AWO A;  1MBY A;  1SSO A;  3CKI B;  5D3I B;  1HQR D;  2VXW A;  3H3V C;  2BA1 A;  1RHP A;  4WJW A;  1AZQ A;  5IGC A;  5D3D A;  1CK1 A;  3MXG A;  5I9P A;  1B9M A;  2FHT A;  1U9R A;  1K83 B;  3D4R A;  4OHJ A;  2XN9 C;  2QIL A;  1PDQ A;  4B9W A;  5C0X G;  2PZT A;  1SNP A;  2ICE C;  3T51 B;  4EGV A;  1CA6 A;  1EZ6 A;  3HKZ B;  4IUR A;  1EY7 A;  3FRP B;  4CJ1 B;  4RAU C;  2M2L A;  1I4Q A;  1STH A;  3H09 A;  2NN6 G;  2XVS A;  2A5H A;  2EY2 A;  2EJF C;  5ELC A;  4CHT B;  1JIC A;  1QB5 D;  3Q0A A;  3KBG A;  2AQ1 B;  5EPJ A;  1MD2 D;  2B8G A;  3RLF A;  4RHR A;  4V19 0;  4PV1 C;  3M3Y B;  2BE5 D;  3OHX C;  1ONL A;  3OWF A;  1Q1B A;  5ELB A;  3SK6 A;  1BNZ A;  1VMC A;  4IFD H;  3X3N A;  1OXU A;  5I9O A;  4IQZ A;  3CU7 A;  2K5W A;  1TS3 A;  3R2I A;  1S5E D;  2XWB B;  4HAE A;  4KMU C;  1GUS A;  1PZJ D;  1QIL A;  3IFT A;  2JA6 B;  1W6K A;  4FF2 A;  4C3H G;  4ZK9 B;  2DNC A;  2VB3 X;  3I4M B;  1VF7 A;  5EKL A;  2XNA C;  1NR2 A;  1DZ1 A;  1DCZ A;  1A3U A;  3PIP 3;  1LAB A;  1AEX A;  2BDO A;  1WTW A;  3J7A F;  1SYC A;  1ILQ A;  1HQM C;  3VYU A;  2B39 A;  1L0Y B;  4HN7 A;  2SOB A;  2IL8 A;  1YNJ C;  3TSS A;  2WKD A;  4TSS A;  2R61 A;  1EIH A;  5C3X A;  2WP8 J;  1PFN A;  3VA5 A;  3T53 B;  1BCP B;  1I3Q B;  2GA4 B;  3VYR A;  2NVX B;  2L12 A;  1B1Z A;  4HR7 B;  2KCC A;  4Q0F A;  1FGB D;  2LKV A;  3J7A V;  5ELD A;  3FVQ A;  2VNU D;  4TRD A;  5JEA J;  2F0Q A;  1R9T B;  2JP1 A;  4KJO A;  4ZYS A;  2IX3 A;  4J1M A;  1Y8P B;  1CQV A;  1PRT B;  1S5D D;  5EBD A;  4QF4 A;  1GUO A;  1TWH B;  4BWG B;  1EEF D;  3CRL C;  4FVM A;  2D9U A;  1E2W A;  1EYD A;  1U4R A;  3U9O A;  2QKI C;  2SDF A;  5IIF A;  1HHV A;  2K6A A;  5E4X A;  3H0G B;  4DAV A;  3VA7 A;  3FEW X;  2F0T A;  3OPO A;  1G2S A;  1JWS D;  2EE1 A;  3L3O C;  2HDM A;  1ET6 A;  2EYF A;  2RBM A;  1UUP A;  3NTH A;  2K28 A;  2NUC A;  3S2D B;  3SEB A;  1EY9 A;  3FDT A;  4EQN A;  1HA5 A;  4DU9 A;  5DEH A;  4DXF A;  1WCM B;  4KN4 C;  2CHB D;  1LTI D;  5G3L F;  1FNV A;  3A7A B;  2D5D A;  2EZV A;  1SAP A;  2EY6 A;  2JA8 B;  1A15 A;  3KLS A;  2XRS D;  3C2P A;  1QOH A;  1WD1 A;  1K8O A;  2QF7 A;  3I90 A;  1BF4 A;  3V96 A;  4G7H C;  5IGB A;  1EEI D;  2L11 A;  2IX0 A;  1EL0 A;  1G2T A;  3VR4 A;  2OEO A;  1Q12 A;  2RVL A;  3PV0 A;  1O7L A;  4DAP A;  1NUC A;  1VDZ A;  4IFD J;  3NE5 B;  2KJX A;  1DM0 B;  1JC7 A;  4XT1 B;  5IGD A;  3QO2 A;  4EQO A;  1SE4 A;  2F0J A;  4HCS A;  2HQE A;  4UAI A;  5FO9 B;  5J1Z A;  3K59 A;  2EXZ A;  1BCP C;  2EY1 A;  1TS4 A;  4A3F B;  1SYF A;  1EQV A;  3HOU B;  4KKU A;  3GTO B;  5JPN C;  1LAC A;  1V1P A;  3NWS A;  1HPC A;  1PRT C;  1BOS A;  1LO5 D;  5E4W C;  1PTO F;  1F2M A;  5CR3 A;  1GUN A;  4ZUJ A;  2EYH A;  3MAQ A;  4ZAI A;  3BS1 A;  1AFP A;  2RKS A;  2JA5 B;  4IUN A;  3RUZ A;  3HOW B;  2R92 B;  1FNW A;  1FD7 D;  3BDO A;  5IT9 L;  2EYP A;  1F2Y A;  2VUM B;  4KHZ A;  3SK8 A;  2N88 A;  3PUV A;  4S3S A;  4RCN A;  4WOR A;  3RD4 A;  4BBR B;  4KTA A;  3QWN A;  4BA2 I;  4FO2 A;  1EZ8 A;  1BUV T;  1GHK A;  4C2M B;  3DXJ C;  5E1F A;  4XYQ A;  1LLR D;  4KN7 C;  1BR9 A;  3WDN A;  1BCP D;  5JEA G;  2FFK B;  4KKS A;  2DNE A;  1Q3L A;  3CHB D;  2B2U C;  1E0B A;  2JSO A;  4ZLT F;  5I6Y A;  3S1Q B;  1SJE D;  3BDL A;  1G6Z A;  2CQA A;  4IFD I;  1B3A A;  4Z9C B;  1F9P A;  3LNN A;  4G4K A;  4KY7 A;  3TZD A;  2F0K A;  3HG9 A;  1XXG A;  1TWG B;  2CVR A;  4DAY A;  5EKK A;  1OXS C;  1PZK D;  2IWH A;  2E2H B;  1OXV A;  2NB0 A;  3TBI B;  3EJI A;  2Y0S B;  2X69 A;  2HUG A;  3HEJ A;  3I73 A;  2EYL A;  4IUV A;  4XDX A;  1SYE A;  4DXG A;  3GTP B;  2LY7 A;  1SYB A;  3SK5 A;  2QCP X;  3K57 A;  5T1G A;  2BA0 A;  3AU7 A;  3SK4 A;  1M4V A;  3MFY A;  3SHL A;  3EFX D;  4RA8 A;  4BA1 I;  2A6E C;  5CC4 A;  2JEB I;  4TKO B;  3TP7 A;  1RD9 D;  2K03 A;  1ZKO A;  1QWY A;  2RQX A;  5EPK A;  1V43 A;  1LTS D;  1XWE A;  2YYZ A;  2F0E A;  1I4R A;  2IW3 A;  5FLX L;  1AP0 A;  3I72 A;  5EQ0 A;  2E76 C;  3C1F A;  1EIG A;  2CW0 D;  2XIW A;  2AQ2 B;  3LX0 A;  4RWS C;  4QUC A;  1FYC A;  2F0D A;  3T56 B;  2O5J C;  4IFD G;  2ZXP A;  5M5Y B;  1F9R A;  3GTM B;  1B4O A;  1LTB D;  4A3K B;  4UDU C;  3HP3 A;  3R2T A;  4PMB A;  4F88 A;  1UEA B;  4B08 A;  1KDC A;  3QIA A;  4RFB A;  1X3Q A;  3PO3 B;  2EVB A;  2PZU A;  2QEJ C;  3D8G A;  5C6A A;  3DEP A;  3SDZ A;  4K2K A;  1Y8O B;  5DAU A;  3MXU A;  1A2U A;  2J7Z A;  1D6E C;  3BG3 A;  3JAM E;  5J39 A;  1KNE A;  4A3I B;  4MHE A;  3NUC A;  1S5F D;  3K6O A;  5CBA E;  2RA4 A;  3NQT A;  2NTS A;  2K32 A;  3IKJ A;  3MXP A;  2KEE A;  2X6G A;  5K5P A;  1PFB A;  2LS0 1;  3OSO A;  1H9K A;  1HCZ A;  5FO8 B;  3I4N B;  1W6J A;  3QOL A;  4XXE A;  4IUQ A;  3R8B A;  5C3E B;  2EYM A;  3A8I E;  1E2Z A;  2K33 A;  4QUF A;  3IL8 A;  3ND8 A;  3OW7 A;  1RTO A;  3PUY A;  4BS9 A;  2WIN B;  1G8Z D;  2PW7 A;  1I4P A;  2C5C A;  2EPB A;  2SNS A;  3KLS X;  4C3J G;  1SBB B;  3MZ5 A;  1H9R A;  1B2T A;  1EY4 A;  2F1M A;  3TN2 A;  1HTP A;  3VR3 A;  2TSS A;  5C44 B;  1TS2 A;  3A8K E;  5FK9 C;  4DGZ A;  3TP5 A;  4A3D B;  1ENA A;  2I46 A;  3S1N B;  1KNA A;  4FXK C;  5KIX A;  3EVQ A;  5C4Z A;  1T5E A;  4X3S A;  2F0U A;  1JWM D;  5A35 A;  2G9D A;  2KCN A;  5DNF A;  4PMC A;  3I70 A;  1ET9 A;  1S5B D;  2B2U A;  1H9S A;  2K01 A;  2DN8 A;  2IT1 A;  4NMZ A;  4A3M B;  3SR1 A;  3GTJ B;  4RGM A;  4PMW A;  4CKB A;  4DNT B;  5COR A;  2A68 C;  5C4X B;  3PUX A;  1J9O A;  2WV6 D;  1NSN S;  1F77 A;  1EWH A;  1SNC A;  2N55 A;  4A3G B;  1CHP D;  1ROD A;  1BQQ T;  2L0C A;  2O2L D;  3EA6 A;  4CGY B;  2WB1 B;  1KLG D;  3ZYY X;  4KY6 A;  4A3J B;  4XQQ A;  2JA7 B;  5I2Y A;  1ENF A;  1IL8 A;  3ERO A;  4MN3 A;  2L9H A;  2ICI A;  4CKE A;  1SNQ A;  1CZW A;  3BVM A;  1BO0 A;  2NWG A;  4C56 C;  2QDB A;  4X3K A;  4CJ2 C;  1B44 D;  2V4D A;  2HCC A;  4PQX A;  3DWQ A;  5DM7 3;  5KNB A;  1ESR A;  4FYD A;  2K04 A;  1PLF A;  2BOS A;  1PYW D;  4ZRZ A;  5IOD A;  4J6H A;  3K0Y A;  2J0T D;  5CV6 A;  5F2D A;  1KAA A;  1KDA A;  1TWF B;  3A55 A;  4O42 A;  1MGS A;  4RHS A;  4QIW B;  5KYI A;  3K5O A;  2F3V A;  2EYO A;  3NK9 A;  3C1E A;  3NBI A;  4K8J A;  2ZT9 C;  5CGK A;  4ODG A;  1WTV A;  1JQY D;  2A68 D;  2LMC B;  4K8I A;  2PCF B;  5CBE E;  4ID6 A;  4LAA A;  1U4P A;  5M5W B;  3E5S A;  1T5X D;  1GHJ A;  1CQF A;  3T16 A;  1O7Y A;  3G7L A;  4OO1 H;  2AUK A;  2F0I A;  3NBH A;  1HXY D;  3W3A A;  5CV4 A;  1DOL A;  1NR4 A;  1EFI D;  5J22 A;  1ML0 D;  4RGO S;  1RJT A;  5JOB A;  1ILP A;  4OIJ A;  5I6W A;  3RZD B;  3OIP A;  2F03 A;  1RDP D;  2PQE A;  5COY A;  1YNJ D;  5EJW A;  5A2Q E;  1X3P A;  4I7Z C;  1TU2 B;  2ZXR A;  3A56 A;  1STG A;  2JEA I;  4XT3 B;  2KA7 A;  2Z4I A;  1NAP A;  5JAV A;  2RDH A;  3W2D A;  1A3T A;  2B2T A;  2SNM A;  2KHS A;  1WTP A;  1PTO B;  1H9S B;  3Q22 A;  4K5X A;  2F0O A;  3KF8 A;  2RDG A;  2MPM A;  3J80 E;  1BDO A;  1BCP F;  5EPL A;  4K6D A;  1SE2 A;  1SND A;  3SXH A;  1HUN A;  3OMG A;  3NSW A;  4NKL A;  4OL7 A;  1IYU A;  4AYB B;  4HMI A;  2F3W A;  1TQO A;  3I91 A;  4J8Q A;  2HCI A;  3T4A C;  4M8A A;  2PYK A;  1V1O A;  1FR3 A;  1BBX C;  3NP8 A;  5JPM C;  1D5M C;  2F4I A;  3LWU A;  1STN A;  3S1M B;  1SNM A;  4QB4 A;  2A69 C;  1DON A;  4NDX A;  1Q90 A;  2PZW A;  1C48 A;  3GP7 A;  4C1N I;  3BYY B;  1QE6 A;  5K36 H;  1TY0 A;  1O78 A;  5D65 A;  2K5Q A;  2M9V A;  3TDQ A;  5M9O A;  2KOL A;  1I50 B;  3GO5 A;  2F0G A;  1CHQ D;  4LMQ D;  2L4N A;  1DJR D;  3MXN A;  4I65 A;  4DK0 A;  3AMU A;  1STB A;  4C1N K;  2D62 A;  4FF1 A;  1LV9 A;  3OMC A;  4DFA A;  3S14 B;  2WKC A;  3VYT A;  2NVT B;  4ILW A;  2A6H C;  3X3M A;  3NTI A;  1A3V A;  3PO2 B;  4G7Z C;  4RGN A;  4XTC S;  4LJZ C;  3H94 A;  1OXT A;  4FP5 D;  2AWN A;  5CV5 A;  1EY5 A;  3MWY W;  4FXD A;  1SYD A;  1II3 A;  4XIG S;  4PNY A;  3C3L A;  1PTO C;  1QNU A;  2LFN A;  1I6V C;  3BVG A;  3V2T A;  4IUU A;  5KND A;  1JB3 A;  4H13 C;  4R8I A;  1MI2 A;  1V8Q A;  4ABN A;  3HZX A;  3NTK A;  5C5L A;  1STY A;  1PRT D;  3J81 E;  2OT2 A;  4KI0 A;  1STA A;  4HSP A;  3DWA A;  1Z6H A;  1SMY C;  1LT5 D;  4ZKB B;  2F0F A;  2EOT A;  1D2B A;  2KUM A;  1FNU A;  3O13 A;  2KQ3 A;  1TVX A;  4MIU A;  5EKI A;  5C4H A;  4KKT A;  3D6C A;  3V05 A;  3MHB A;  1SXT A;  3BYT B;  2E2J B;  1Y1W B;  3IFD A;  2A6H D;  4A3B B;  4XQN A;  1DOM A;  3D3R A;  1SJH D;  5CYU A;  4Y7N B;  1JE4 A;  3T13 A;  4CKC A;  3WOE A;  3S2H B;  4Q5V A;  2Z8L A;  3FPU B;  3HOZ B;  1TWC B;  3ERQ A;  4QCL A;  4N9P A;  4DN4 M;  1GUW A;  2B2V A;  3DM1 A;  3FMC A;  4HED A;  4IZ8 A;  2TMP A;  4RH6 A;  3P7J A;  4BY7 B;  2RSO A;  1GOZ A;  3NPP A;  3MVV A;  2PNR C;  1O80 A;  1TII D;  5AFW A;  3SE0 A;  2Z4H A;  1DD2 A;  1PTO H;  5KEE A;  5LL6 X;  4G7O C;  5TSS A;  5JJZ A;  4RCO A;  1G91 A;  2NYZ D;  1MSH A;  2R93 B;  3S1R B;  1GUG A;  1BXT A;  4CBV A;  4L63 B;  2E2D C;  2KED A;  3DHQ A;  1CT1 D;  2L5T A;  3RMH A;  4H7B A;  1E2V A;  2B8F A;  4K5V A;  3K5M A;  1IKM A;  4OO1 I;  3NWT A;  3M7G A;  3UI2 A;  3P75 A;  1GUT A;  2MJ8 A;  2K5D A;  4OIK A;  1JR0 D;  1SEB D;  3AB9 A;  4KY5 A;  4A3E B;  4HMJ A;  1Q1E A;  2A6E D;  3VR5 A;  5CMD A;  2EJG C;  2OF1 A;  2F0S A;  4QMG A;  1RTN A;  2NZ1 D;  1XTC D;  1Z47 A;  4X3T A;  5M5X B;  4XQJ A;  5E3F A;  2B2T C;  5ISR A;  3JAM L;  1PMR A;  1S4Z A;  4JBW A;  4IUP A;  4C3H B;  3QJY A;  3K7A B;  2EY5 A;  3HS0 C;  1SYG A;  1U4L A;  2FJ2 A;  2MGS A;  1EY6 A;  2E74 C;  2EJM A;  4ME5 A;  1LTR D;  2K7V A;  1KDB A;  4KD4 A;  1HRJ A;  1D5X C;  3QOJ A;  1WTR A;  1B53 A;  1RKN A;  2X6L A;  3N52 A;  4EQP A;  3FKI B;  5IGF A;  4X3U A;  1IW7 C;  2MUY A;  1SNO A;  2AUJ D;  3A8J E;  5CV7 A;  4K6L A;  4C3I B;  5KRU A;  1HTL D;  2PPB C;  3TME A;  1RF2 D;  2XWJ B;  5HUR A;  5C5M A;  3OOC A;  2KEC A;  2KVM A;  4OO1 G;  1JOK A;  2WAQ B;  1VMP A;  1QCB D;  3I4L A;  1I4X A;  4E6I A;  2XSC A;  3D4D A;  2AQ3 B;  1Y69 U;  1WTX A;  1TT2 A;  3VR2 A;  2L1B A;  1RCV D;  1IHZ A;  1CTM A;  3R93 A;  4N9T A;  3URY A;  1VCI A;  3CQZ B;  4U68 A;  2MP1 A;  3VYS A;  5CV9 A;  1LTG D;  1K8M A;  1KAB A;  2WAC A;  1Q8I A;  1WVL A;  2E2I B;  3S17 B;  4B9X A;  1CI3 M;  2F0H A;  1ZXT A;  4K14 A;  1OXX K;  5KYL A;  1IW7 D;  5EGT A;  4P2C B;  2JE6 I;  1Y8N B;  1CM9 A;  5CV8 A;  2XRQ D;  4F87 A;  1H9J A;  2Q8I B;  3G6J B;  3E0J A;  5KNC A;  3VR6 A;  1U4M A;  4KJN A;  5IGG A;  5JVH 3;  5NUC A;  4H44 C;  2B63 B;  3K5L A;  4OGQ C;  1JWU D;  3EQL C;  3F2U A;  3MEH A;  2FMM A;  2NTT A;  4C3I G;  3HRZ C;  4DF7 A;  5BN5 A;  2PO4 A;  3IAY A;  1ZEQ X;  5C0X H;  1CFM A;  2NBF A;  4WFN 3;  4TQU S;  3QB3 A;  1F9Q A;  4K5W A;  5K36 G;  5C4J B;  2A74 C;  3L9A X;  5ELE A;  2H1E A;  1HFG A;  4FF4 A;  2NN6 H;  4ULL A;  1J8I A;  1OO9 B;  1HUM A;  2F0P A;  3R3O A;  2Z1C A;  1D1I A;  3K58 A;  2R6G A;  2HDL A;  4F8M A;  1M8A A;  1ENC A;  1ZYR C;  5I4D A;  2B2W C;  1I4H A;  5FKA C;  4FF3 A;  1O7Z A;  4FXG C;  3I8Z A;  1LTA D;  1PZI D;  2B2V C;  2F0W A;  1WD0 A;  1EOT A;  3ITP A;  4O1N A;  3M85 A;  3MTS A;  4JK1 C;  1S5C D;  4HSV A;  1A6X A;  3KK7 A;  2F0M A;  2J4X A;  5A2Q L;  2Q8T A;  3I3C A;  1ESF A;  5D14 A;  5HGT A;  2ZXO A;  1SE3 A;  3MFG A;  4LK1 C;  4R8N A;  2FIN B;  5IGE A;  3BZD B;  5IOC A;  4IAL A;  1I4G A;  3L7Z C;  1XYI A;  2O5I C;  4G57 A;  1LT4 D;  1GXD C;  3J80 L;  2R3Z A;  3TP8 A;  3D31 A;  1TS5 A;  1L0X B;  1C4Q A;  1PRT F;  3DWP A;  1QG7 A;  1DOK A;  5I2X A;  3TZU A;  3GTL B;  2RSN A;  4M1U B;  1AW7 A;  3U9S A;  4WRD A;  2A73 B;  2L55 A;  4NW2 A;  5C3W A;  2F0L A;  4DK1 A;  1KTK A;  4L6T B;  3FPP A;  4NP5 A;  3MC0 B;  5FO7 B;  3K5N A;  1ZYR D;  3Q6S A;  2DY7 A;  1TY2 A;  3S16 B;  3ONA B;  1EYA A;  3NHH A;  3HOY B;  2B2Y C;  2ID0 A;  5FOB B;  1PFM A;  3CRK C;  4RKL A;  2DY8 A;  4ZKC B;  4ZUI A;  4HCE A;  1HFN A;  2D2C C;  2JXM B;  1B9N A;  2ENB A;  3NQI A;  2MHV A;  3P20 A;  1IYV A;  2FMC A;  1TR5 A;  2G9H D;  2H4O A;  1C8C A;  1F2L A;  2SEB D;  1F9S A;  5IT9 E;  3KBX A;  1GJX A;  1QNK A;  1EU4 A;  3D6W A;  4R9W A;  1JOO A;  3M4Y A;  5LL6 S;  4L8J A;  2F0V A;  1TWA B;  2IX1 A;  4DA2 A;  4EVO A;  2YU9 B;  3DMU A;  3BDC A;  1Z7T A;  2NVY B;  4CJ0 B;  3TP6 A;  4RGT A;  3PUW A;  5C0X J;  4YIJ A;  2NVQ B;  1B50 A;  1PXU A;  1WTQ A;  1ICW A;  4KK7 A;  4KHV A;  1UNS A;  1D1K A;  1TKW B;  4KV6 A;  2A69 D;  1CZG A;  5G3L D;  1A2T A;  2Q8R E;  1EY8 A;  3ND9 A;  3M4O B;  4XYO A;  3GTK B;  1NCV A;  2WII B;  3GV3 A;  1STE A;  1DYQ A;  1YNN C;  3GTQ B;  3N6R A;  1LT3 D;  1XX8 A;  3HGB A;  1KLU D;  2M00 A;  4BBS B;  3J81 L;  1JOR A;  1LT6 D;  2EDG A;  5M3F B;  2CW0 C;  1AZP A;  2F0N A;  2K1B A;  2BDN A;  3WOF A;  1EWC A;  1SDF A;  5M3M B;  1EQT A;  1R4Q B;  1LTT D;  2PMZ B;  1JOQ A;  3DEO A;  2B2W A;  2RDF A;  4U67 3;  1R4P B;  1G29 1;  3HOX B;  3H6M A;  3MA2 B;  5LHY 1;  3NXW A;  1DXM A;  3KLR A;  3PUZ A;  2PW5 A;  1SFO B;  5JVG 3;  4F7X A;  1PTO D;  2O4X A;  2K05 A;  1AN8 A;  3GV6 A;  3Q24 A;  4K2L A;  5BN3 A;  3LWE A;  1D5Z C;  2IPK D;  1Y1V B;  3BVZ A;  1H9M A;  5KGU A;  1IKL A;  4ZQ3 A;  5FLX E;  3DUZ A;  3D4W A;  1EYC A;  1X32 A;  2VB2 X;  1CA5 A;  3J7Y W;  1SMY D;  4C3J B;  1YNN D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...