5JOBA

Crystal structure of staphylococcal nuclease variant delta+phs l25k/i92a at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKKMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYAYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L25K/I92A at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5jobA00
1EY7A 2NUCA 2OEOA 2PZUA 3BDLA 5I9OA 3NP8A 5KGUA 3NK9A 4YIJA 3MXPA 5KYIA 1JOOA 1EY6A 1KABA 1F2MA 2OF1A 4KJOA 3SK4A 5IODA 5KIXA 2HQEA 2EYJA 1SYFA 1EYDA 5E3FA 4OL7A 2PYKA 4KJNA 1A3UA 1IHZA 1STHA 2EY5A 3MVVA 4IALA 2SNMA 3MEHA 4HTHA 3NQTA 4K8JA 4NDXA 5CV4A 2EY6A 4IZ8A 5CV7A 5CGKA 2KHSA 4S3SA 4J6HA 5C5LA 5EGTA 4ODGA 2F0OA 3V2TA 2F0JA 3H6MA 3T13A 4B9XA 1EZ8A 1EY5A 2F0PA 2RDFA 4K5WA 4NP5A 5CR3A 4LAAA 5E1FA 3TP5A 4F8MA 3HZXA 5C5MA 2F0EA 3DHQA 3MZ5A 3OSOA 5C4HA 2F0UA 4KV6A 5J1ZA 3EVQA 4RKBA 4DFAA 2QDBA 2PZWA 4EVOA 3C1EA 2LKVA 1ENCA 5CV8A 3D4DA 2F3VA 3EJIA 3OWFA 3SK5A 4H7BA 4NKLA 1EY0A 1A3VA 1EYAA 1SNMA 2PZTA 3P1HA 3SXHA 1KDBA 2SNSA 3EROA 4KTAA 5EKKA 2O4XA 1SYBA 3DMUA 3RUZA 5IGCA 1SNDA 4MIUA 1SYDA 5IGDA 1NSNS 5EKLA 1TQOA 3HEJA 1EY9A 5I9PA 3NXWA 5C3XA 1KAAA 1KDCA 1KDAA 3NHHA 3SR1A 2EYHA 3R3OA 4K14A 2KQ3A 2PW7A 3S9WA 4KY6A 4F7XA 3TP7A 1EY4A 2F0VA 3P75A 3TP6A 4ZUIA 5KEEA 2RKSA 2F0LA 4ZQ3A 4B9WA 1ENAA 5HURA 4R8NA 2F0TA 3D6CA 5ISRA 4IUNA 5IGGA 1SYCA 2F0IA 2F0NA 3LX0A 1A3TA 1II3A 2EY1A 3D4WA 3OMCA 5CV5A 2EYPA 4PMBA 5F2DA 5DEHA 3OMGA 5IGFA 4QF4A 3QB3A 1JOKA 1STNA 5HGTA 5NUCA 4KY5A 5DAUA 5IIFA 1SNQA 2F0GA 3VA5A 4EQNA 5K5PA 4K5VA 2F0QA 4KY7A 4N9PA 4N9TA 4TRDA 3PMFA 2EYFA 2ENBA 1F2ZA 1STAA 2EXZA 3BDCA 1F2YA 1SNOA 1SYGA 4K2KA 4QMGA 1EQVA 4WRDA 2F3WA 4EQOA 1TR5A 2F0MA 3SK8A 1STBA 1EYCA 1TT2A 4K2LA 3TMEA 1AEXA 2RBMA 3NUCA 3E5SA 3QOJA 1STYA 4E6IA 5CC4A 5IGBA 3D8GA 4PNYA 1JORA 4K6DA 3SHLA 1SNCA 3TP8A 1EZ6A 2EYLA 2F0SA 5C4ZA 2WACA 4QB4A 1JOQA 2F0DA 4KHVA 1RKNA 4EQPA 5C3WA 4ZUJA 1A2UA 2F0HA 4K5XA 2PW5A 5I6YA 5CV9A 5IGEA 4HMJA 1EY8A 1SYEA 2M00A 4DU9A 5IOCA 1SNPA 4NMZA 5KYLA 5C6AA 5JOBA 4DF7A 3MHBA 3C1FA 4I65A 2PQEA 3U9OA 3T16A 5JAVA 5J39A 2F0FA 2EY2A 4ID6A 4K8IA 2SOBA 4KD4A 4RKLA 3SK6A 4KD3A 4J1MA 5I6WA 1NUCA 2EYMA 5CV6A 1STGA 1U9RA 3QOLA 4ME5A 4WORA 5KRUA 4DGZA 3ERQA 2F0KA 4HMIA 2F0WA 4PMCA 3ITPA 4G57A 5J22A 5M9OA 2EYOA 1A2TA 2OXPA
chains in the Genus database with same CATH superfamily
4MTNA 2NUCA 4DK3C 1JJCB 4A3GG 4KHPL 1KRSA 2NVQB 2IW3A 1STEA 5CYUA 5M5XH 4KJNA 2JA8G 2NVTH 1HZAA 3MVVA 4K8JA 2SNMA 5ELFA 5CGKA 1IBLL 5FJ8G 2P5ZX 5GAGC 2WB1B 4G7ZC 3ZYYX 1FGBD 1DYQA 5LMNL 3T13A 3NWSA 5E1FA 4LAAA 4A3KB 4GLVB 1KC8C 3ULLA 2UUAL 2QDBA 3TS2A 5A2QE 3GD7A 5E7NA 1CK1A 1MIUA 1EY0A 3I4NG 4LF8Q 1SNMA 4I7AA 3MXNA 5IT9L 1XNQQ 3RUZA 3IFTA 1AZQA 5BN4A 3SE0A 4LJZC 4HSPA 2VUMB 2V1CC 1KDCA 3QJYA 2KUMA 2EYHA 3HFZB 3S9WA 4A3LG 3P7JA 1MGSA 3IL8A 2EQSA 1JICA 1IW7C 2RKSA 4XTCS 3ZJYC 4R4QA 5HURA 4OX9Q 1NBWA 1K8OA 4HJ5A 1PRTD 1ZEQX 1FR3A 1YZ6A 2PI2A 1P16A 5CBAE 5TSSA 4RA8A 2EVBA 4K2KA 1STAA 4LWCA 4DR4L 3KOJA 1EQVA 5GQOA 1GO3E 3VDYA 1Q90A 2XNAC 5JJLA 1Q7YC 4C3HH 4UAIA 4QJFA 3S1NB 2CWPA 3HOYB 2EYLA 4C2MH 5ELDA 4XQNA 1N34Q 1PMRA 4XIGS 5GADC 2IJ0A 5D3DA 5C44G 2FXQA 3K0XA 5JOBA 1LM0A 1XPRA 5BN3A 1FGUA 4HCEA 4A3MH 5ELEA 2HHHL 4XDXA 1Q1EA 4HJ7A 5I6WA 3URYA 5C0XH 4A3BH 2E8GA 4YCWA 5KRUA 5M5WB 2UXBL 2AUKA 1TWCB 1I4XA 1R9TB 1CHPD 1HZ9A 3NEMA 4RWSC 4O1NA 4RCOA 4BY7B 3RMHA 3CC4A 2AUJD 1M90C 3I3CA 3VYUA 1EIFA 2KHSA 4J6HA 3A8KE 4BXXG 2G9DA 3R8BA 3H6MA 1WOCA 3GTKH 1W6JA 1EY5A 4A3IH 2ATWA 3EVQA 4JI3L 2IL8A 3OWFA 2L15A 3BVMA 3PUXA 4JI4Q 4FF3A 2XN9C 3P1HA 1I5FA 3UDIA 4DR7Q 3RN5A 2KHJA 4JOIC 3UE0A 3OWEB 4KI0A 4DV3L 3CD6A 4PZ7A 4JC0A 5H1SE 3K58A 3K8AA 3J7AF 3S2DB 3T1HQ 1DXMA 2NVYB 3J81L 4DUYQ 4IFDH 5T1IA 2F0NA 2K7VA 5C0XJ 3CCJA 4ZCKA 2E2IH 3M4PA 1G2SA 5DEHA 1IBKQ 3RLFA 2RSNA 1E2WA 1PH9A 4APVA 3TZDA 2K28A 2F3WA 2FJ2A 2QKIC 3NUCA 3CCRA 1PDQA 4X3TA 3CCUA 2EOTA 3VR3A 3J81i 3FPUB 3HOWB 4K5XA 4UP9A 2Q8RE 3M7GA 4XQQA 1O78A 1CTMA 2ES2A 4H13C 1LTAD 3AQQA 2K5NA 2KCTA 1I4GA 1J9OA 5IYCH 4ID6A 1TWGB 2HCIA 1WTOA 1GKHA 3PSIA 1NUCA 2BE5D 2AHOB 4TQUS 5EPJA 5C3EG 4PMCA 4KKSA 4A3KH 1YITA 1X3FA 5IY0A 2NVXH 1Y8OB 1QUQB 3NE5B 2OXPA 4C3HG 1MSGA 5KGUA 1A0IA 2H4OA 5KYIA 3S17B 5FK9C 1QVFA 2R92B 3I73A 2B2WC 4G7HC 2NVXB 4L5RC 4B9XA 3A5ZB 3CXCA 3C46A 3NBHA 2IX1A 3Q23A 1B2TA 1WJJA 4C1NI 1EZ8A 3SVMA 3FKIB 2JJQA 1YNXA 1YJNA 3NTKA 1EIGA 4HIOA 4Y7NB 1I4RA 1VMCA 4CKEA 4H7BA 4KK7A 4DV6Q 1A3VA 4LF6L 2HHHQ 4K0KQ 4JI7L 5EKKA 2KENA 1SYBA 1YHQA 3SEBA 2L0CA 1PA6A 2BA0A 1C48A 1K83B 1WTPA 4A3CG 3QWNA 4PMWA 4CBVA 1P8LA 4IN3A 4LF9L 4RGNA 3S1NH 2R93H 2A69D 1A15A 4RCNA 2RA4A 3P75A 2QEXA 4LUVA 3HOVB 2RCNA 3EBEA 5D14A 2I0QA 1XJVA 1XNQL 3M85A 2EYPA 1AN8A 3OIPA 4QL5A 4A3DB 1TWFH 1Z6HA 3VA5A 4NXML 1K3BC 1RIPA 4N9TA 1YJ9A 1BF4A 1O7LA 2CFMA 3GTOB 2Z8LA 3S1QH 3X3MA 1GUOA 1A63A 4B08A 3CCEA 1PRTC 1STYA 1JJ2A 1B3QA 2WAQG 5LHY1 1B44D 1H9MA 4DK1A 2VB2X 1SE3A 5ELCA 2F0HA 3RLNA 5I6YA 2MFIA 5J3BA 5FOBB 3KBGA 4YWKA 2NB0A 4JI2L 1ZYRD 1MJEA 4GLAC 1RF2D 2K03A 2DY8A 5JAVA 2B2TA 2R7ZG 1NR4A 3HKZG 1MSHA 1QILA 3D3RA 5JEAG 4HJ8A 3STBC 1PYBA 4OELB 3ITPA 4WJ4A 1Y1VG 4YIJA 4BY1H 1EY6A 1KABA 1Y8PB 5IODA 1M1KC 2E5LQ 1VQJA 1I6HB 1PH5A 1IL8A 2EY5A 4BY1B 1MJCA 5CV4A 4O2DA 2ICIA 2N3SA 4XYOA 3I4MG 2K33A 2JSOA 1LT4D 4FO2A 3CRKC 1LTLA 1XYIA 4F8MA 4IUPA 3WOEA 3S14H 1QE6A 4JPBW 3EIVA 4JI8L 2QCPX 2Y0SE 2VZAA 2PZTA 2MP1A 1HZBA 2Z9HA 1CI3M 4JW0A 5M3MH 4JI6L 1PFMA 1SJHD 5JJIA 5GAHC 2CKZB 1L0WA 1VQ9A 1TQOA 1HNXQ 4V0BA 4B3TL 2L4NA 1WYDA 3S15H 1FVIA 1VS0A 5FKAC 5C3EB 1Y8NB 5JPMC 4ZQ3A 5IYDH 3GO5A 4RHRA 5CV5A 1II3A 2ZTCA 3LWEA 3M9BA 1JOKA 2A69C 4R8IA 1VQLA 2RDGA 4A3DG 3G7LA 4EQNA 5A2QL 4K5VA 3OYYA 1MKHA 4FP5D 5IWAQ 2ENBA 4QMGA 4DAVA 2R7FA 1HH2P 2MUYA 4BA2I 4YHHQ 1UEBA 3A7LA 3D8GA 5IP9H 5K36H 4K6DA 1LO5D 3T51B 1PH1A 2F0DA 5JJZA 2KHIA 5IGEA 2BE5C 3K5OA 3R2IA 4UP8A 1PLFA 1I94L 2Q2HA 1XX8A 4A3FB 3MWYW 4IPCA 1AH9A 1EQQA 3HS0C 3DEOA 4RMFA 1I3QH 2WKDA 4MN3A 1B9MA 3S1MB 1RDPD 3JAME 3A7AB 3HOXH 3ERQA 4QUCA 4DV2Q 1X65A 2CHBD 4F88A 4GZYC 4V190 1HRJA 3F1ZA 1Y1WH 3BDLA 1VQOA 1B50A 2SDFA 3N6RA 3TN2A 1FYCA 5M5YB 3JC66 4BA1I 2RF4A 2NZHA 5M3FH 2EPBA 2R3ZA 3TQYA 1AE2A 2G9HD 4DNRB 1IBMQ 4DR2Q 5AJ3L 4DV0Q 2JE6I 2WP8J 1LABA 1S40A 4ODGA 1QVCA 1SXTA 1NE3A 5LMUL 4OEMB 4BBSB 5ELBA 4DV7L 1BCPB 1GOZA 3JAMc 4L6TB 2JN4A 3JAML 3CQZH 3PUVA 3HOUH 2NTSA 4DA2A 1EYAA 2RQXA 1C7YA 2O4XA 2A19A 3KLWA 4ZKCB 1KHIA 1QWYA 3I4NH 1EOTA 2PI2E 5JVH3 5C3XA 4PQXA 1FJGQ 4WJ3M 3I90A 3J7A5 1HZCA 4BBRB 4LMQD 3QIAA 1C4QA 4JI0L 4X6AH 4IUNA 4JI1Q 4QCLA 2K75A 1I4HA 5M5YH 1Z7TA 2HT1A 1VQFA 3OMGA 2RHSB 2NVQH 2NWGA 4PG3A 3H91A 3NWTA 3PMFA 2EYFA 4DKAC 4LF9Q 1VQBA 3I56A 1TWGH 1AW7A 4HEDA 3S1MH 1WTQA 4FDBA 4PNYA 1JORA 3H94A 1AFPA 2UU9Q 1KRTA 2LXKA 1NAPA 3AU7A 1MI2A 1VQIA 3A56A 4X3UA 5C4XB 1U4MA 1M8AA 3BU2A 4M8AA 3M7NA 2M00A 2ASBA 1F9PA 3J81E 4DF7A 4C2MB 2LSSA 4UPAA 3PO2H 2LMCB 1H9JA 2LXJA 1TWAB 2K32A 3S2HH 3I4LA 4LFBL 1XWEA 4UY8C 1IBLQ 2CQOA 3CCMA 1K0SA 4H0LC 4C3JG 1I6HH 1JWMD 2R7DA 2EYOA 2CW0D 4MHEA 2F4VQ 4B3TQ 3KF8A 1CQVA 2UXDL 4H02A 1EWHA 1G8ZD 4YCVA 4A76A 2D5DA 4X64L 2I46A 1G6ZA 2A74C 4JVZA 1T9HA 4IALA 1ENFA 2VQFL 2B2VC 4OO1H 1OO9B 2AKWB 3MFYA 1VQPA 2WAQB 2C9OA 5M5WH 2C35B 2R61A 3KF8B 1I94Q 3BYYB 3CC7A 4JG2A 1SMXA 3TREA 2F3VA 3CRLC 2E2DC 4DNIA 1CZWA 1EYGA 1UE5A 1PHJA 2WV6D 4U68A 3HG9A 2BH2A 3ND8A 4ULLA 5C4JB 4CJ1B 1KLGD 4MIUA 1RTNA 5IGDA 4HIDA 3KK7A 1LYLA 2OT2A 1Y1VB 3HOVG 1QNKA 1NTGA 3S16B 1QCBD 1C9OA 2Z4IA 1R4PB 2JA5G 2A5HA 2F0IA 4IOAA 4DR2L 1A3TA 4IURA 3S15B 2JA8H 1B4OA 5NUCA 1OXVA 4A3EB 3EN2A 1U0LA 2VQEQ 5FLMG 3UI2A 5LMUQ 3S2DH 1XNRQ 3OW7A 3BZCA 4Q0FA 2NN6G 5KYLA 2OQKA 4WRDA 3U9OA 3PO2B 1HCZA 4A3MB 3BYTB 2BH8A 2UXCQ 3S24A 2PNHA 3TMEA 1CKMA 3GTPH 3DM3A 5IGBA 1NCVA 4LF7Q 1PXUA 1LT3D 1WCMH 4OX9L 4A3BG 4GN4B 1DOMA 2B39A 2Z6KA 4ZUJA 1SAPA 2PO4A 2K14A 3S17H 4C1NK 1SRUA 1PFSA 5C6AA 5HY6A 2I5LX 1H9RA 1GD7A 4I7ZC 1V1QA 1S4ZA 4TKOB 5DM73 3GTQB 2Z1CA 4KD4A 5ELNA 4JI0Q 3HKZE 2X6LA 3A5UA 4DUZQ 3R2TA 1QJOA 4ME5A 4CGYB 5L37A 1EIYB 2EE1A 2M9VA 4JYAL 4GNXC 2R92H 1S5ED 3CAMA 1J5EQ 3RNUA 1IYUA 1FJGL 4O42A 2HIXA 4NB3A 2A68D 4QY7A 1EUJA 1V1PA 4KLKA 5GAEC 4IPHA 1E1TA 3CCQA 1UWVA 3IAYA 4ILWA 4GOPC 4GKJQ 1N36Q 1YNJC 1DZ1A 1VQDA 4BWGB 3BS1A 1GUGA 1LUZA 1RD9D 1YI2A 1D2BA 3RN2A 4DV2L 3BVZA 2F0OA 2E74C 5M3FB 1A62A 5C5MA 3OW2A 1EOVA 1WTRA 1X3GA 1X9NA 3U58A 1DD2A 2E2IB 3CMEA 4BBSH 5IP7H 2DN8A 2JA7B 4KTAA 1G91A 3S16H 2Z0SA 4AYBB 2R6GA 1HR0Q 2D2CC 4PZ6A 2JA6H 5G3LD 1WTVA 4C3HB 1BNZA 4K14A 3OIQA 3ULJA 4Q5VA 1PH7A 4IUUA 3TP7A 1EY4A 2K1BA 4GNXA 2WAQE 1L1OB 1D8LA 4LFBQ 3G4SA 4ABNA 5FJ8H 1IXRA 5ELOA 3CQZB 4PMBA 2IY5B 1CKNA 4GOPA 1EFID 1BVSA 1YEZA 5I2YA 4ZKBB 3AEVA 2ZXRA 1VQKA 2F0MA 4GNXB 1JQYD 4B3SL 3U4ZA 1JWUD 2RBMA 3J81c 1U4PA 1O7ZA 1VQ6A 2AQ3B 2PQAB 2F0SA 2Q2IA 4IFDJ 5JJKA 4EQPA 2TSSA 3AFPA 1Y14B 2PW5A 2VUMG 1TU2B 1NMGA 1SJED 1H9SB 3GP7A 1OXSC 1SYEA 1E22A 3G6JB 1Y69U 1R9TH 2WINB 1TWCH 1ET6A 2F0FA 3FEWX 2B3GA 1SROA 1V1OA 3FKIG 3H3VI 4B3MQ 2E2HH 1RTOA 1UE6A 5IP7G 1B9NA 3J7AV 1JOQA 4HCSA 4J8QA 3SK4A 2LFNA 1ILQA 4B3RQ 2EYJA 3K6OA 1WTWA 1HNWL 3FMCA 1GJXA 4DV6L 4QIWB 1V43A 3FDTA 1KIXA 1STHA 2AWOA 2JA6B 5CV7A 1GHKA 2ZM6Q 4IFDG 3I7FA 1L0XB 3PF5A 1IYJB 2XVSA 5EGTA 1C8CA 4TSSA 2UUBL 3UDFA 1HUNA 4NP5A 4C3JB 3OSOA 4P73A 1XMOL 5J1ZA 3SGIA 3CC2A 2UXCL 1LV9A 1K8GA 3VR6A 2LKVA 2Z4HA 3OTOQ 1JC7A 4GN5A 2ZJQA 5AFWA 4LUZA 3Q0AA 4DR5L 3V05A 3EROA 3DMUA 3B6YA 2Y0SG 1YIJA 1WD0A 2KOLA 4ME3A 1PRTB 1EY9A 3HP3A 2XTIA 1HJPA 2AQ1B 2PW7A 1BDOA 4LF5Q 3PF4A 4M1UB 3AYHB 3OOCA 4OIJA 1BR9A 1TXYA 4ZUIA 1U5KA 1BKBA 4P72A 4MNOA 4R8NA 3C3LA 1AE3A 1SYCA 4RFBA 3CHBD 1CKNB 1MBYA 4JI5L 4K0KL 3D4WA 4DAPA 4WJWA 3T1YQ 1C0AA 4JYAQ 2J4XA 4NXNL 3Q24A 5BN5A 2B2YA 4YWLA 4KHPQ 5LL6X 3BDCA 3I4NB 2A6EC 1X56A 1TR5A 3SK8A 2CQAA 1J6QA 4A3KG 4A3EH 2KBNA 4RG1A 5KNCA 3TP8A 3QO2A 1A2UA 1VQ5A 3PO2G 1QUQA 4KN4C 1B7YB 3NBIA 4AYBG 4NXMQ 3GDEA 2N49A 2E5LL 4A3JH 1BCPC 4JI8Q 4DR1L 1ASZA 3PUYA 1K83H 2JA5B 4DN4M 1TWFB 4DGZA 5M3FG 1HFNA 4IUVA 1CZGA 2D9UA 1KL9A 2AMCB 1YBYA 1Q1BA 4JI2Q 4ALPA 1I50H 4DPGA 3TBIB 2HQEA 3HOZB 1F9SA 1SYFA 2WIIB 3DM1A 2B2YC 2EDGA 1BBXC 1Z47A 4LF8L 1IHZA 1LTGD 1VF7A 3E3XA 2MGSA 4P75A 5EBCA 2BA1A 2KCCA 5FO7B 5G3LF 2FHTA 5CBEE 4ZYSA 1CM9A 4FVMA 1JE5A 4XXEA 2F03A 3EQLC 4RKBA 5IYBH 2N8NA 3MC0B 4LFCQ 4GLXA 4NKLA 3PCOB 3BG3A 1XPUA 3SXHA 2MQHA 5C3EH 1W2BA 1PFNA 4HSVA 5EPLA 1VQ4A 1HFGA 5IGCA 5C0XG 4HIKA 4DR3Q 4DAYA 5IE8A 3F2UA 3VR4A 4JK1C 3S2HB 3LWUA 2Z6BA 3F8TA 4A3BB 3HKSA 1X3EA 1JMCA 1SDFA 4FXKC 3L2PA 3TP6A 4A3FH 2KJXA 3DWAA 1CA5A 4X66L 2CWAA 3U50C 3NTHA 5DLQE 5IGFA 2I5HA 2ZM6L 1G291 2ALYB 3A74A 4P74A 5DAUA 2OWOA 4CDFC 1NJIC 1L1OC 3EFXD 1OXTA 3PIO3 3SR1A 1E2VA 4B3RL 1B70B 1GHJA 4R4OA 1Q86C 2UUAQ 2DJFC 5IT9E 3U4VA 4P71A 3E5SA 3P20A 3DUZA 4RGMA 2UXBQ 1EZ6A 4U673 1Y1WB 5C3WA 2YU9B 1HXYD 1UNSA 3J80E 1UAPA 2CVRA 3HOYH 3ERSX 4LF5L 4I65A 2KA7A 3T16A 3NTIA 3E9HA 3ONAB 4X65Q 1L2FA 4A75A 1X3PA 1G51A 4RKLA 4R4TA 2B63G 2KCMA 4L5QA 1TS5A 2MHVA 4HMIA 2F0WA 4A93B 1PTOH 1J8IA 1EEFD 4NXNQ 2NVYH 2OEOA 1TS2A 2QILA 1K3RA 2WKCA 4QGUA 1F2MA 3VYRA 1PVOA 5BR8Q 3I4OA 3PIP3 4FF2A 4DUYL 2BOSA 4GN3B 1PTOD 2BDNA 4QUFA 3CF5A 4HTHA 1ZKOA 2IT1A 1PV4A 1U4RA 1YVCA 1JT8A 5I2XA 3K5LA 1D5MC 1EU4A 1FD7D 3A54A 1GVPA 5CR3A 1WVLA 2K5WA 5DNFA 5C4HA 4KV6A 3GV3A 4YWMA 3C1EA 4DXGA 5CV8A 3HKZB 2JA6G 3HOWH 4DR1Q 4JBJA 1M4VA 1EWIA 1FNVA 1ASYA 1HPCA 1JCKB 3CPWA 1G2TA 3TZUA 3OHXC 4R4IA 3H0GB 3PIPA 2KEDA 1VF5C 5EPKA 2PQAA 1AZPA 2K52A 1YNNC 1A6XA 1TS3A 1VQGA 3NHHA 4LK1C 3KJPA 1BQQT 2KQ3A 1F9QA 4F7XA 5C4JH 3GQBA 2F52A 4R9WA 2ZTDA 5C44H 4CJ2C 3PGZA 1V1PB 3D6CA 4DXFA 4DK0A 3RZDH 1PTOF 1K8MA 1S5DD 4H44C 2QGQA 3WDNA 2B2UC 2R93G 4OWTB 2EXZA 3NQIA 4A3GH 5FLXL 1ICWA 4K2LA 1ONLA 1ZYRC 3QOJA 3F2CA 2KEEA 3UDXA 4DR7L 3PO3B 1KLUD 3H3VH 2VQFQ 3FP9A 3HOUG 1RL2A 3T1YL 2D0OA 2EZVA 1D5ZC 3STBD 5JPNC 1DGSA 1W3SA 3U9SA 1L0YB 1I6VC 4XT3B 1N8RC 2EY2A 1N9WA 3T1HL 3MAQA 2Z6KC 1RHPA 2EYMA 2FMCA 4KN7C 3GV6A 2JA9A 2GA4B 2HD3A 3KF6A 1PFBA 1O7IA 1HHVA 1EY7A 3IKJA 1SFOB 1YHBA 3MXPA 3PQIA 5C4XH 2NN6H 5KIXA 4X3SA 1Q8IA 4DV5Q 2J7ZA 2PYKA 3ICEA 3CCSA 4JI7Q 1T5EA 3FKIH 5FO9B 3VA7A 2HCCA 3I4MH 3NQTA 2WB1E 3HOZH 1B8AA 3D4RA 1I50B 1TS4A 2ZTEA 5C5LA 3V2TA 4K5WA 2RDFA 2VW9A 3N52A 3I91A 5EBDA 2B2VA 5C0XI 1FNUA 2IPKD 2C5CA 3QR8A 3A8IE 1OXXK 1TY0A 1Y1VH 1DOKA 2SNSA 2YTYA 3A8JE 3TSSA 4BBRH 2XGTA 2YYZA 1E24A 1YJWA 3BJUA 5IT9c 1F9RA 1SNDA 1LTRD 1NSNS 5EKLA 1KQSA 1MD2D 1HNZQ 3LGJA 4DK6C 4DR6L 3R3OA 4IJLA 2M2LA 1PZJD 4POFA 3KLSA 4B9WA 1ENAA 3J80c 1VQEA 2F0TA 2R7ZB 4DUZL 1YNND 3LX0A 4DV4Q 1VQCA 2D0PA 2F1MA 2RCFA 3OMCA 2ZJRA 5FLXE 2UUCQ 1E7ZA 4QF4A 3QB3A 4A3IB 1J5EL 1WTXA 3I70A 4YY3Q 3WWVA 1IYVA 3A0JA 1F2ZA 1F2YA 1ET9A 4RGTA 2N78A 1NMFA 4JCVE 1TT2A 2DNCA 2MPMA 4E6IA 1PTOB 1NY4A 4BBRG 2NTTA 4MZ9A 3H0GH 2YTVA 4KHVA 1HTPA 2A6ED 4KKUA 1MHWC 2XRQD 3K7AB 3RD4A 2VQEL 1S5BD 2F4IA 1PH2A 3HOXB 4A3IG 1SR3A 2EIFA 4BXXH 3J81j 2OCEA 1IL2A 1X3QA 3M3YB 3KF6B 3QOLA 1BCPF 3RR5A 5M5XB 5LMNQ 5M9OA 4P2CB 4XT1B 1K9MC 4FF1A 3NP8A 1VQHA 1KTKA 4J15A 4DAYB 1GM5A 4KJOA 1HQRD 5E3FA 4UHVA 1TWHH 3TRZA 1A3UA 1GUTA 2B8GA 2AQ2B 3GTGH 2JEBI 2IX3A 4JI6Q 4OO1G 1HR0W 2K05A 1HR0L 1Q82C 2F0JA 2KCNA 2GN5A 1TIID 2IX0A 1Z9FA 2XWBB 3DHQA 1O80A 3VR2A 1XPOA 1XTCD 3BVGA 1QVGA 4B3SQ 2ZXOA 2VL6A 2CCZA 1VQAA 3NSWA 2E75C 2XRSD 1WD1A 1H95A 3CP0A 2HUGA 1WFQA 2NZ1D 4OGQC 2IWHA 4PZ8A 2L11A 1SN8A 1K28A 1HTLD 3HEJA 2HDMA 1CSQA 5I9PA 1KDAA 1F2LA 2L55A 2VNUD 3V96A 5I4DA 2F3IA 1XXGA 1B1ZA 3VYSA 3IFDA 4YHHL 4RAUC 1RJTA 2EY1A 3RZOH 4CHTB 3GTPB 1AP0A 3H0GG 1RODA 4A3EG 3T53B 2AWNA 2E2JH 4KKTA 3BDOA 2HQLA 5K5PA 4UDUC 3MXGA 5FO8B 4RGOS 4JBMA 4G7OC 2QDLA 5C4XG 1TKWB 4FNFA 2OTJA 1JWSD 2EJMA 1HA6A 3PV0A 5E4XA 1IKMA 5CC4A 1DJRD 1EU3A 3I2ZA 3I55A 3GTJB 1KXLA 2DY7A 2NBFA 1WTHA 3SDZA 2R93B 1HNXL 4DV7Q 3L7ZC 1KNAA 1SNPA 1XMOQ 2Q2UA 3MHBA 1HNWQ 4BS9A 3C2PA 3A55A 1JB3A 4LFAQ 4R1JA 2YU9H 3PUWA 1UUPA 3OPOA 4EGVA 1EWCA 4AH6A 1K73C 2ZXPA 2ZJPA 5CV6A 4JOIA 5CMDA 2E76C 4FXDA 2K4KA 5E4WC 1YHAA 5J22A 1CQFA 1K0RA 4IJHA 1PTOC 1N34L 2UUBQ 3NK9A 3I4MB 3L3OC 1JOOA 1D6EC 4LUOA 3ND9A 3RZDB 3S1RB 4IUTA 3DLLA 4C3IG 2JA8B 2R92G 4ZRZA 5KNDA 3GTKB 4GS3A 1CKOA 5JEAJ 1PRTF 2CW0C 5C44B 4NDXA 3MEHA 4JI5Q 1LTID 1SFOH 4IZ8A 3S1QB 3GTOH 3F2BA 4DV3Q 5IYDG 2PMZE 2JA5H 4OXPA 4YY3L 2CH4A 3K57A 2F0PA 2O5JC 4HJAA 2XSCA 2K5DA 3CMAA 2Q2TA 3HZXA 3J7YW 3MZ5A 1EQRA 3BZDB 1X6OA 2LS01 3Q8DA 4EVOA 2KECA 3DWQA 4N8X1 1LACA 3SK5A 3CCLA 3RZOB 4CKCA 2WFWA 1KDBA 4R4CA 3M4YA 4C3IB 5EKIA 1IKLA 1I4PA 3AB9A 2A1AA 1IBKL 3E6ZX 2H5XA 3HOUB 3NXWA 2RVLA 1ML0D 4JV5Q 3Q6SA 4HJ9A 4KY6A 4LW1A 3D31A 1JR0D 1LTTD 5FLMH 2E2JB 3GTLB 1V9PA 5HGQA 2XWJB 4RH6A 3M4OH 4CDEC 2UU9L 4G4KA 1HQMC 3CKIB 5COYA 1LLRD 3K5MA 1TVXA 4K6LA 4DV0L 3ULPA 4A3FG 2JP1A 4X62L 4KY5A 1VQMA 2K6AA 3VR5A 1H9SA 1EIHA 4TRDA 2UXDQ 2K5HA 5CORA 4DR6Q 1X54A 2A6HC 4OONA 2ZT9C 4XYQA 4ZK9B 4A3CH 2NN6I 3PIOA 1Y1WG 5KNBA 3AFQA 3H15A 4JI4L 4AYBE 1UE7A 5LMNW 2IHEA 2K50A 4X3KA 1RKNA 1TWAH 1QB5D 1LTBD 2DGYA 3ER0A 3G6EA 3K59A 2F4VL 1EY8A 4DU9A 5IOCA 1CA6A 2JA7H 4ZLTF 4C56C 2Y0SB 3MXUA 4A3LH 3C1FA 4X64Q 1EL0A 1A8VA 3T56B 5J39A 2I07B 3K81C 3E0JA 2VUMH 3LNNA 1KD1C 3MA2B 1BXTA 4KD3A 3K80C 1B3AA 1XTDA 3E0EA 3CCVA 3S1RH 2F0KA 1SE4A 3MXNB 1TWHB 1QG7A 4HAEA 1RCVD 3W1GA 1X55A 1SSOA 5I9OA 2RHQB 3K7AH 1L1OA 4LFCL 3DEPA 4DV1Q 3KBXA 3HOXG 4BY7G 5F2DA 1IZ6A 4GOPB 4DR3L 3I8ZA 4CDDC 1GUNA 1GXDC 1BOSA 1QNUA 4MTKA 2A68C 2VY3A 4BY7H 4A93G 4CKBA 4C3IH 1EFWA 3KLRA 1D5XC 4OWXB 3TP5A 5A35A 3HOVH 3H3VC 3FRPB 5EAYA 1N33L 3GTQH 2X6GA 3UE1A 4EQ5A 3GTJH 2HIVA 1ENCA 3KYHC 2QW7A 3D4DA 3KUPA 4X66Q 1I4QA 1TY2A 1CT1D 3NELA 5K36G 2YTXA 5JEAH 1EEID 1PYWD 1B53A 4NPSA 1U4LA 3BZKA 3DWPA 4OIKA 3IRBA 1SMYD 1EQTA 1S5CD 1KAAA 5IYBG 1DCZA 1CHQD 1O7YA 1LTSD 3TS0A 2SEBD 1BO0A 3PO3G 4LFAL 3TDQA 1PZKD 2F0VA 3GTMB 2TMPA 2K04A 2H1EA 1VQNA 4LF6Q 1KAWA 1SMYC 4LNQA 3FHWA 3WOFA 3X3NA 5HGTA 1S3OA 3GTMH 2B2WA 3T4AC 2J0TD 2A73B 2F0QA 3W5OA 4N9PA 1SBBB 4ZAIA 4OWWB 2YV5A 1FL0A 4AIMA 1STBA 4X65L 1EYCA 2O5IC 3M3YH 4IFDI 2MNAA 1PH4A 2EJFC 5LL6S 1SNCA 2RSOA 2QA4A 4A3JB 1DM0B 2GVAA 1VDZA 2JYOA 2VB3X 4N8FA 3RLOA 1JE4A 4IO9A 1SE2A 5BR8L 2DUDA 2NYZD 2XIWA 1VQ8A 2EXDA 5T1GA 3EA6A 4K8IA 2JEAI 1UEAB 4LF7L 4QQBX 3J80i 4IPDA 1NR2A 2HDLA 4G57A 1NNXA 4X62Q 2Q8IB 2WB1G 4HIMA 1E1OA 4EX5A 3M4OB 1GUWA 4PV1C 4JV5L 1XNRL 4HR7B 4BY1G 1N32Q 4IPGA 3W1BA 4LF4Q 3TEHB 4OL7A 2L5TA 2Q8TA 1D7QA 2QF7A 3CW2C 4AQYQ 4QIWE 1XMQL 2BDOA 3K7UC 1BUVT 3O13A 3QG1A 2PCFB 1ILPA 2FMMA 1KNEA 2B2TC 3K5NA 1X32A 2D62A 1ICFB 2V4DA 4CDCC 4NW2A 1Q81C 4DFAA 4WFN3 2PZWA 4GKKQ 3EJIA 3Q22A 1CFMA 2JK8A 3W3AA 5DM63 5JVG3 1E3PA 1N36L 2MJ8A 5M3MG 2CH4W 3GTLH 1WCMB 2BCOA 4DAMA 2QEJC 4DR4Q 4A3JG 3HRZC 2FFKB 1QZGA 3HOYG 2LY7A 4UP7A 5KEEA 1K8AC 3D6WA 3MTSA 1PH3A 4GKJL 1QZHA 4OO1I 1S72A 1PYSB 1WCMG 2K5QA 2PMZB 3W2DA 5IIFA 2VXWA 1SYGA 4EQOA 3JAMi 3CPFA 3F2DA 3G71A 1V8QA 4DV1L 3J80L 4CJ0B 4L63B 3KFUA 3NBHB 1SLJA 2WACA 4QB4A 1LT5D 1GUSA 2GVBA 3NPPA 5IYCG 3KJOA 1UE1A 2L12A 5CV9A 3L0OA 1R4QB 3D0FA 2L9HA 5IWAL 5FLXc 4JBKA 4A93H 1LT6D 2DNEA 1Q3LA 4J1MA 5AJ3Q 2L1BA 1U9RA 3H09A 1BBUA 1H9KA 1JB7A 2MO0A 2PNRC 1A2TA 1YNJD 2PZUA 5ISRA 1E2ZA 2B63B 2OF1A 3G48A 1VQ7A 4OHJA 1EYDA 1SE8A 4HN7A 4A3DH 1CUKA 3M4QA 2N88A 2DJGC 3CU7A 4FYDA 2JQOA 2EY6A 3HOZG 2UUCL 4S3SA 1JJGA 2X69A 1DONA 1VCIA 3KDFA 1BBWA 1OXUA 3DXJC 4B3ML 1G6PA 2PPBC 1SEBD 2O2LD 2K01A 1PH8A 4L8JA 1ESRA 1D1KA 2F0EA 1FNWA 3MEFA 2F0UA 1I3QB 2EJGC 4KHZA 4DV5L 1OTCA 2A8VA 2IHFA 2RDHA 1PZID 2B2UA 4IUQA 2KVMA 1Q12A 2ICEC 1HA5A 2OQ0A 4Z9CB 4C3JH 4F87A 3VYTA 3NENA 1IW7D 1ESFA 4L5TA 3KDFB 1HUMA 2OTLA 1SYDA 4IQZA 1DOLA 4Y7NH 3GTGB 3HOWG 2B8FA 1E0BA 4L5SA 5EJWA 4LF4L 1N33Q 4YCUA 5EQ0A 2F0LA 4FF4A 3OTOL 4Y52H 3E9IA 3FVQA 5IGGA 2A6HD 1IBML 4AQYL 4TVAB 1XMQQ 1VMPA 4IOCA 3K0YA 3FPPA 1STNA 5GROA 4KMUC 1SNQA 2F0GA 2NZOA 4JBWA 2MO1A 1F77A 1WI5A 3J7ZC 1HNZL 4A4IA 2E2HB 4KY7A 2NVTB 1N32L 1SNOA 1PH6A 3R93A 2G5DA 4JI3Q 3L9AX 3UDGA 4GKKL 1AEXA 4POGA 4O0AA 3HGBA 1D1IA 2ID0A 2JXMB 3SHLA 1W6KA 4DR5Q 2N55A 1BCPD 1S5FD 3KLSX 5C4ZA 4DV4L 4JI1L 4A3MG 1Q8KA 2B63H 2R7ZH 2K5VA 3MFGA 4HMJA 5M3MB 1Q46A 4NMZA 3PO3H 2JA7G 2B29A 2I5MX 3PUZA 5D3IB 2PQEA 5D65A 1ZXTA 1T5XD 1QOHA 4DNTB 4RHSA 2FINB 3S14B 2SOBA 3AMUA 4A3GB 3SK6A 3I72A 1STGA 4WORA 1CSPA 5IP9G 4FXGC 4XQJA 4BBSG 2VS1A
chains in the Genus database with same CATH topology
2NUCA 2NVQB 2IW3A 1STEA 5CYUA 4KJNA 3MVVA 4K8JA 2SNMA 5ELFA 5CGKA 2WB1B 4G7ZC 3ZYYX 1FGBD 1DYQA 3T13A 3NWSA 5E1FA 4LAAA 4A3KB 2QDBA 5A2QE 3GD7A 1CK1A 1EY0A 1SNMA 3MXNA 5IT9L 3RUZA 3IFTA 1AZQA 5BN4A 3SE0A 4LJZC 4HSPA 2VUMB 1KDCA 3QJYA 2KUMA 2EYHA 3S9WA 3P7JA 1MGSA 3IL8A 1JICA 1IW7C 2RKSA 4XTCS 5HURA 1K8OA 1PRTD 1ZEQX 1FR3A 5CBAE 5TSSA 4RA8A 2EVBA 4K2KA 1STAA 1EQVA 1Q90A 2XNAC 4UAIA 3S1NB 3HOYB 2EYLA 5ELDA 4XQNA 1PMRA 4XIGS 2IJ0A 5D3DA 5JOBA 5BN3A 4HCEA 5ELEA 4XDXA 1Q1EA 5I6WA 3URYA 5C0XH 5KRUA 5M5WB 2AUKA 1TWCB 1I4XA 1R9TB 1CHPD 4RWSC 4O1NA 4RCOA 4BY7B 3RMHA 2AUJD 3I3CA 3VYUA 2KHSA 4J6HA 3A8KE 2G9DA 3R8BA 3H6MA 1W6JA 1EY5A 3EVQA 2IL8A 3OWFA 3PUXA 3BVMA 4FF3A 2XN9C 3P1HA 3OWEB 4KI0A 3K58A 3J7AF 3S2DB 1DXMA 2NVYB 3J81L 4IFDH 5T1IA 2F0NA 2K7VA 5C0XJ 1G2SA 5DEHA 3RLFA 2RSNA 1E2WA 3TZDA 2K28A 2F3WA 2FJ2A 2QKIC 3NUCA 1PDQA 4X3TA 2EOTA 3VR3A 3FPUB 3HOWB 4K5XA 2Q8RE 3M7GA 4XQQA 1O78A 1CTMA 4H13C 1LTAD 1I4GA 1J9OA 4ID6A 1TWGB 2HCIA 1WTOA 1NUCA 2BE5D 4TQUS 5EPJA 4PMCA 4KKSA 1Y8OB 4C3HG 3NE5B 2OXPA 1MSGA 5KGUA 2H4OA 5KYIA 3S17B 5FK9C 2R92B 3I73A 2B2WC 4G7HC 2NVXB 4B9XA 3C46A 3NBHA 2IX1A 3Q23A 1B2TA 4C1NI 1EZ8A 3SVMA 3FKIB 3NTKA 1EIGA 4Y7NB 1I4RA 1VMCA 4CKEA 4H7BA 4KK7A 1A3VA 5EKKA 1SYBA 3SEBA 2L0CA 2BA0A 1C48A 1K83B 1WTPA 3QWNA 4PMWA 4CBVA 4IN3A 4RGNA 2A69D 1A15A 4RCNA 2RA4A 3P75A 3HOVB 5D14A 3M85A 2EYPA 1AN8A 3OIPA 4A3DB 1Z6HA 3VA5A 4N9TA 1BF4A 1O7LA 3GTOB 2Z8LA 3X3MA 1GUOA 4B08A 1PRTC 1STYA 5LHY1 1B44D 1H9MA 4DK1A 2VB2X 1SE3A 5ELCA 2F0HA 5I6YA 5FOBB 3KBGA 2NB0A 1ZYRD 1RF2D 2K03A 2DY8A 5JAVA 2B2TA 1NR4A 1MSHA 1QILA 3D3RA 5JEAG 3ITPA 4YIJA 1EY6A 1KABA 1Y8PB 5IODA 1I6HB 1IL8A 2EY5A 4BY1B 5CV4A 2ICIA 4XYOA 2K33A 2JSOA 1LT4D 4FO2A 3CRKC 1XYIA 4F8MA 4IUPA 3WOEA 1QE6A 2QCPX 2PZTA 2MP1A 1CI3M 1PFMA 1SJHD 1TQOA 4V0BA 2L4NA 5FKAC 5C3EB 1Y8NB 5JPMC 4ZQ3A 3GO5A 4RHRA 5CV5A 1II3A 3LWEA 1JOKA 2A69C 4R8IA 2RDGA 3G7LA 4EQNA 5A2QL 4K5VA 4FP5D 4DAVA 2ENBA 4QMGA 4BA2I 2MUYA 3A7LA 3D8GA 5K36H 4K6DA 1LO5D 3T51B 2F0DA 5JJZA 5IGEA 2BE5C 3K5OA 3R2IA 1PLFA 1XX8A 4A3FB 3MWYW 3HS0C 3DEOA 2WKDA 4MN3A 1B9MA 3S1MB 1RDPD 3JAME 3A7AB 3ERQA 4QUCA 2CHBD 4F88A 4GZYC 4V190 1HRJA 3BDLA 1B50A 2SDFA 3N6RA 3TN2A 1FYCA 5M5YB 4BA1I 2EPBA 2R3ZA 2G9HD 4DNRB 2JE6I 2WP8J 1LABA 4ODGA 1SXTA 4BBSB 5ELBA 1BCPB 1GOZA 4L6TB 3JAML 3PUVA 2NTSA 4DA2A 1EYAA 2RQXA 2O4XA 4ZKCB 1QWYA 1EOTA 5JVH3 5C3XA 4PQXA 3I90A 4BBRB 4LMQD 3QIAA 1C4QA 4IUNA 4QCLA 1I4HA 1Z7TA 3OMGA 2NWGA 3H91A 3NWTA 3PMFA 2EYFA 1AW7A 4HEDA 1WTQA 4PNYA 1JORA 3H94A 1AFPA 1NAPA 3AU7A 1MI2A 3A56A 4X3UA 5C4XB 1U4MA 1M8AA 4M8AA 3M7NA 2M00A 1F9PA 3J81E 4DF7A 4C2MB 2LMCB 1H9JA 1TWAB 2K32A 3I4LA 1XWEA 4H0LC 4C3JG 1JWMD 2EYOA 2CW0D 4MHEA 3KF8A 1CQVA 1EWHA 1G8ZD 2D5DA 2I46A 1G6ZA 2A74C 4IALA 1ENFA 2B2VC 4OO1H 1OO9B 3MFYA 2WAQB 2C9OA 2R61A 3BYYB 2F3VA 3CRLC 2E2DC 1CZWA 2WV6D 4U68A 3HG9A 3ND8A 4ULLA 5C4JB 4CJ1B 1KLGD 1RTNA 4MIUA 5IGDA 3KK7A 2OT2A 1Y1VB 1QNKA 3S16B 1QCBD 2Z4IA 1R4PB 2A5HA 2F0IA 1A3TA 4IURA 3S15B 1B4OA 5NUCA 1OXVA 4A3EB 3UI2A 3OW7A 4Q0FA 5KYLA 2NN6G 3PO2B 4WRDA 3U9OA 1HCZA 4A3MB 3BYTB 3TMEA 5IGBA 1NCVA 1PXUA 1LT3D 1DOMA 2B39A 4ZUJA 1SAPA 2PO4A 4C1NK 5C6AA 1H9RA 4I7ZC 1S4ZA 4TKOB 5DM73 3GTQB 2Z1CA 4KD4A 2X6LA 3R2TA 1QJOA 4ME5A 4CGYB 2EE1A 2M9VA 1S5ED 1IYUA 4O42A 2A68D 1V1PA 3IAYA 4ILWA 1YNJC 1DZ1A 4BWGB 3BS1A 1GUGA 1RD9D 1D2BA 3BVZA 2F0OA 2E74C 5M3FB 5C5MA 1WTRA 1DD2A 2E2IB 2DN8A 2JA7B 4KTAA 1G91A 4AYBB 2R6GA 2D2CC 5G3LD 1WTVA 4C3HB 1BNZA 4K14A 3OIQA 4Q5VA 4IUUA 3TP7A 1EY4A 2K1BA 4ABNA 3CQZB 4PMBA 1EFID 5I2YA 4ZKBB 2ZXRA 2F0MA 1JQYD 1JWUD 2RBMA 1U4PA 1O7ZA 2AQ3B 2F0SA 4IFDJ 4EQPA 2TSSA 2PW5A 1TU2B 1SJED 1H9SB 3GP7A 1OXSC 1SYEA 3G6JB 1Y69U 2WINB 1ET6A 2F0FA 3FEWX 1V1OA 1RTOA 1B9NA 3J7AV 1JOQA 4HCSA 4J8QA 3SK4A 2LFNA 1ILQA 2EYJA 3K6OA 1WTWA 3FMCA 1GJXA 4QIWB 1V43A 3FDTA 1STHA 2AWOA 2JA6B 5CV7A 1GHKA 4IFDG 1L0XB 1C8CA 2XVSA 5EGTA 4TSSA 1HUNA 4NP5A 4C3JB 3OSOA 5J1ZA 1LV9A 3VR6A 2LKVA 2Z4HA 1JC7A 5AFWA 3Q0AA 3V05A 3EROA 3DMUA 1WD0A 2KOLA 1PRTB 1EY9A 3HP3A 2AQ1B 2PW7A 1BDOA 4M1UB 3OOCA 4OIJA 1BR9A 4ZUIA 4R8NA 3C3LA 1SYCA 4RFBA 3CHBD 1MBYA 3D4WA 4DAPA 4WJWA 2J4XA 3Q24A 5BN5A 2B2YA 5LL6X 3BDCA 3I4NB 2A6EC 1TR5A 3SK8A 2CQAA 5KNCA 3TP8A 3QO2A 1A2UA 4KN4C 3NBIA 1BCPC 3PUYA 2JA5B 4DN4M 1TWFB 4DGZA 1HFNA 4IUVA 1CZGA 2D9UA 1Q1BA 3TBIB 2HQEA 3HOZB 1F9SA 1SYFA 2WIIB 3DM1A 2B2YC 2EDGA 1BBXC 1Z47A 1IHZA 1LTGD 1VF7A 5EBCA 2MGSA 2BA1A 2KCCA 5FO7B 5G3LF 2FHTA 5CBEE 4ZYSA 1CM9A 4FVMA 4XXEA 2F03A 3EQLC 4RKBA 3MC0B 4NKLA 3BG3A 3SXHA 1PFNA 4HSVA 5EPLA 1HFGA 5IGCA 5C0XG 4DAYA 3F2UA 3VR4A 4JK1C 3S2HB 3LWUA 4A3BB 1SDFA 4FXKC 3TP6A 2KJXA 3DWAA 1CA5A 3NTHA 5IGFA 1G291 5DAUA 3EFXD 1OXTA 3PIO3 3SR1A 1E2VA 1GHJA 5IT9E 3E5SA 3P20A 3DUZA 4RGMA 1EZ6A 4U673 1Y1WB 5C3WA 2YU9B 1HXYD 1UNSA 3J80E 1UAPA 2CVRA 4I65A 2KA7A 3T16A 3NTIA 3ONAB 1X3PA 4RKLA 1TS5A 2MHVA 4HMIA 2F0WA 4A93B 1PTOH 1J8IA 1EEFD 2OEOA 1TS2A 2QILA 2WKCA 1F2MA 3VYRA 3PIP3 4FF2A 2BOSA 1PTOD 2BDNA 4QUFA 4HTHA 1ZKOA 2IT1A 1U4RA 5I2XA 3K5LA 1D5MC 1EU4A 1FD7D 3A54A 5CR3A 1WVLA 2K5WA 5DNFA 5C4HA 4KV6A 3GV3A 3C1EA 4DXGA 5CV8A 3HKZB 1M4VA 1FNVA 1HPCA 1JCKB 1G2TA 3TZUA 3OHXC 3H0GB 2KEDA 1VF5C 5EPKA 1AZPA 1YNNC 1A6XA 1TS3A 3NHHA 4LK1C 1BQQT 2KQ3A 1F9QA 4F7XA 3GQBA 4R9WA 4CJ2C 1V1PB 3D6CA 4DXFA 4DK0A 1PTOF 1K8MA 1S5DD 4H44C 3WDNA 2B2UC 2EXZA 3NQIA 5FLXL 1ICWA 4K2LA 1ONLA 1ZYRC 3QOJA 2KEEA 3PO3B 1KLUD 2EZVA 1D5ZC 5JPNC 3U9SA 1L0YB 1I6VC 4XT3B 2EY2A 3MAQA 1RHPA 2EYMA 2FMCA 4KN7C 3GV6A 2GA4B 1PFBA 1HHVA 1EY7A 3IKJA 1SFOB 3MXPA 2NN6H 5KIXA 4X3SA 1Q8IA 2J7ZA 2PYKA 1T5EA 5FO9B 3VA7A 2HCCA 3NQTA 3D4RA 1I50B 1TS4A 5C5LA 3V2TA 4K5WA 2RDFA 3N52A 3I91A 5EBDA 2B2VA 5C0XI 1FNUA 2IPKD 2C5CA 3A8IE 1OXXK 1TY0A 1DOKA 2SNSA 3A8JE 3TSSA 2YYZA 1F9RA 1SNDA 1LTRD 1NSNS 5EKLA 1MD2D 3R3OA 2M2LA 1PZJD 3KLSA 4B9WA 1ENAA 2F0TA 2R7ZB 1YNND 3LX0A 2F1MA 3OMCA 5FLXE 4QF4A 3QB3A 4A3IB 1WTXA 3I70A 1IYVA 1F2ZA 1F2YA 1ET9A 4RGTA 1TT2A 2DNCA 2MPMA 4E6IA 1PTOB 2NTTA 4KHVA 1HTPA 2A6ED 4KKUA 2XRQD 3K7AB 3RD4A 1S5BD 2F4IA 3HOXB 1X3QA 3M3YB 3QOLA 1BCPF 5M5XB 5M9OA 4P2CB 4XT1B 4FF1A 3NP8A 1KTKA 4KJOA 1HQRD 5E3FA 1A3UA 1GUTA 2B8GA 2AQ2B 4OO1G 2JEBI 2IX3A 2K05A 2F0JA 2KCNA 1TIID 2IX0A 2XWBB 3DHQA 1O80A 3VR2A 1XTCD 3BVGA 2ZXOA 3NSWA 2E75C 2XRSD 1WD1A 2HUGA 2NZ1D 4OGQC 2IWHA 2L11A 1HTLD 3HEJA 2HDMA 5I9PA 1KDAA 1F2LA 2L55A 2VNUD 3V96A 5I4DA 1XXGA 1B1ZA 3VYSA 3IFDA 4RAUC 1RJTA 2EY1A 4CHTB 3GTPB 1AP0A 1RODA 3T53B 2AWNA 3BDOA 4KKTA 5K5PA 4UDUC 3MXGA 5FO8B 4RGOS 4G7OC 1TKWB 4FNFA 1JWSD 2EJMA 1HA6A 3PV0A 5E4XA 1IKMA 5CC4A 1DJRD 1EU3A 3GTJB 2DY7A 2NBFA 3SDZA 2R93B 3L7ZC 1KNAA 1SNPA 3MHBA 3C2PA 4BS9A 3A55A 1JB3A 3PUWA 1UUPA 3OPOA 4EGVA 1EWCA 2ZXPA 5CV6A 5CMDA 2E76C 4FXDA 5E4WC 5J22A 1CQFA 1PTOC 3NK9A 3I4MB 3L3OC 1JOOA 1D6EC 3ND9A 3RZDB 3S1RB 4IUTA 4C3IG 2JA8B 4ZRZA 5KNDA 3GTKB 5JEAJ 1PRTF 2CW0C 5C44B 4NDXA 3MEHA 1LTID 4IZ8A 3S1QB 3K57A 2F0PA 2O5JC 2XSCA 2K5DA 3HZXA 3J7YW 3MZ5A 3BZDB 2LS01 4EVOA 2KECA 3DWQA 3SK5A 1LACA 3RZOB 4CKCA 1KDBA 3M4YA 4C3IB 5EKIA 1IKLA 1I4PA 3AB9A 3E6ZX 3HOUB 3NXWA 2RVLA 1ML0D 3Q6SA 4KY6A 3D31A 1JR0D 1LTTD 2E2JB 3GTLB 2XWJB 4RH6A 4G4KA 1HQMC 3CKIB 5COYA 1LLRD 3K5MA 1TVXA 4K6LA 2JP1A 4KY5A 2K6AA 3VR5A 1H9SA 1EIHA 4TRDA 5CORA 2A6HC 4XYQA 2ZT9C 4ZK9B 2NN6I 5KNBA 4X3KA 1RKNA 1QB5D 1LTBD 3K59A 1EY8A 4DU9A 5IOCA 1CA6A 4ZLTF 4C56C 2Y0SB 3MXUA 3C1FA 1EL0A 3T56B 5J39A 2I07B 3E0JA 3LNNA 3MA2B 1BXTA 4KD3A 1B3AA 2F0KA 1SE4A 1TWHB 1QG7A 4HAEA 1RCVD 1SSOA 5I9OA 3DEPA 3KBXA 5F2DA 3I8ZA 1GUNA 1GXDC 1BOSA 1QNUA 2A68C 4CKBA 3KLRA 1D5XC 3TP5A 5A35A 3H3VC 3FRPB 2X6GA 1ENCA 3D4DA 3KUPA 1I4QA 1TY2A 1CT1D 5K36G 5JEAH 1EEID 1PYWD 1B53A 1U4LA 3DWPA 4OIKA 1SMYD 1EQTA 1S5CD 1KAAA 1DCZA 1CHQD 1O7YA 1LTSD 2SEBD 1BO0A 3TDQA 1PZKD 2F0VA 3GTMB 2TMPA 2K04A 2H1EA 1SMYC 3WOFA 3X3NA 5HGTA 2B2WA 3T4AC 2J0TD 2A73B 2F0QA 4N9PA 1SBBB 4ZAIA 1STBA 2O5IC 1EYCA 4IFDI 2EJFC 5LL6S 1SNCA 2RSOA 4A3JB 1DM0B 1VDZA 2JYOA 2VB3X 1JE4A 1SE2A 2NYZD 2XIWA 5T1GA 3EA6A 4K8IA 2JEAI 1UEAB 1NR2A 2HDLA 4G57A 2Q8IB 3M4OB 1GUWA 4PV1C 4HR7B 4OL7A 2L5TA 2Q8TA 2QF7A 2BDOA 1BUVT 3O13A 3QG1A 2PCFB 1ILPA 2FMMA 1KNEA 2B2TC 3K5NA 1X32A 2D62A 2V4DA 4NW2A 4DFAA 4WFN3 2PZWA 3EJIA 3Q22A 1CFMA 3W3AA 5DM63 5JVG3 2MJ8A 1WCMB 2BCOA 2QEJC 3HRZC 2FFKB 2LY7A 5KEEA 3D6WA 3MTSA 4OO1I 2K5QA 2PMZB 3W2DA 5IIFA 2VXWA 1SYGA 4EQOA 1V8QA 3J80L 4CJ0B 4L63B 2WACA 4QB4A 1LT5D 1GUSA 3NPPA 2L12A 5CV9A 1R4QB 2L9HA 1LT6D 2DNEA 1Q3LA 4J1MA 2L1BA 1U9RA 3H09A 1H9KA 2PNRC 1A2TA 1YNJD 2PZUA 5ISRA 1E2ZA 2B63B 2OF1A 4OHJA 1EYDA 4HN7A 2N88A 3CU7A 4FYDA 2EY6A 4S3SA 2X69A 1DONA 1VCIA 1OXUA 3DXJC 2PPBC 1SEBD 2O2LD 2K01A 4L8JA 1ESRA 1D1KA 2F0EA 1FNWA 2F0UA 1I3QB 2EJGC 4KHZA 1PZID 2B2UA 2RDHA 2KVMA 4IUQA 1Q12A 2ICEC 1HA5A 4Z9CB 4F87A 3VYTA 1IW7D 1ESFA 1HUMA 1SYDA 1DOLA 4IQZA 3GTGB 2B8FA 1E0BA 5EJWA 5EQ0A 2F0LA 4FF4A 3FVQA 5IGGA 2A6HD 1VMPA 3K0YA 3FPPA 1STNA 4KMUC 1SNQA 2F0GA 4JBWA 2E2HB 1F77A 4KY7A 2NVTB 1SNOA 3R93A 3L9AX 1AEXA 3HGBA 1D1IA 2ID0A 2JXMB 3SHLA 1W6KA 2N55A 1BCPD 1S5FD 3KLSX 5C4ZA 3MFGA 4HMJA 5M3MB 4NMZA 3PUZA 5D3IB 2PQEA 5D65A 1ZXTA 1T5XD 1QOHA 4DNTB 4RHSA 2FINB 3S14B 2SOBA 3AMUA 4A3GB 3SK6A 3I72A 1STGA 4WORA 4FXGC 4XQJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EY7 A;  2NUC A;  2OEO A;  2PZU A;  3BDL A;  5I9O A;  3NP8 A;  5KGU A;  3NK9 A;  4YIJ A;  3MXP A;  5KYI A;  1JOO A;  1EY6 A;  1KAB A;  1F2M A;  2OF1 A;  4KJO A;  3SK4 A;  5IOD A;  5KIX A;  2HQE A;  2EYJ A;  1SYF A;  1EYD A;  5E3F A;  4OL7 A;  2PYK A;  4KJN A;  1A3U A;  1IHZ A;  1STH A;  2EY5 A;  3MVV A;  4IAL A;  2SNM A;  3MEH A;  4HTH A;  3NQT A;  4K8J A;  4NDX A;  5CV4 A;  2EY6 A;  4IZ8 A;  5CV7 A;  5CGK A;  2KHS A;  4S3S A;  4J6H A;  5C5L A;  5EGT A;  4ODG A;  2F0O A;  3V2T A;  2F0J A;  3H6M A;  3T13 A;  4B9X A;  1EZ8 A;  1EY5 A;  2F0P A;  2RDF A;  4K5W A;  4NP5 A;  5CR3 A;  4LAA A;  5E1F A;  3TP5 A;  4F8M A;  3HZX A;  5C5M A;  2F0E A;  3DHQ A;  3MZ5 A;  3OSO A;  5C4H A;  2F0U A;  4KV6 A;  5J1Z A;  3EVQ A;  4RKB A;  4DFA A;  2QDB A;  2PZW A;  4EVO A;  3C1E A;  2LKV A;  1ENC A;  5CV8 A;  3D4D A;  2F3V A;  3EJI A;  3OWF A;  3SK5 A;  4H7B A;  4NKL A;  1EY0 A;  1A3V A;  1EYA A;  1SNM A;  2PZT A;  3P1H A;  3SXH A;  1KDB A;  2SNS A;  3ERO A;  4KTA A;  5EKK A;  2O4X A;  1SYB A;  3DMU A;  3RUZ A;  5IGC A;  1SND A;  4MIU A;  1SYD A;  5IGD A;  1NSN S;  5EKL A;  1TQO A;  3HEJ A;  1EY9 A;  5I9P A;  3NXW A;  5C3X A;  1KAA A;  1KDC A;  1KDA A;  3NHH A;  3SR1 A;  2EYH A;  3R3O A;  4K14 A;  2KQ3 A;  2PW7 A;  3S9W A;  4KY6 A;  4F7X A;  3TP7 A;  1EY4 A;  2F0V A;  3P75 A;  3TP6 A;  4ZUI A;  5KEE A;  2RKS A;  2F0L A;  4ZQ3 A;  4B9W A;  1ENA A;  5HUR A;  4R8N A;  2F0T A;  3D6C A;  5ISR A;  4IUN A;  5IGG A;  1SYC A;  2F0I A;  2F0N A;  3LX0 A;  1A3T A;  1II3 A;  2EY1 A;  3D4W A;  3OMC A;  5CV5 A;  2EYP A;  4PMB A;  5F2D A;  5DEH A;  3OMG A;  5IGF A;  4QF4 A;  3QB3 A;  1JOK A;  1STN A;  5HGT A;  5NUC A;  4KY5 A;  5DAU A;  5IIF A;  1SNQ A;  2F0G A;  3VA5 A;  4EQN A;  5K5P A;  4K5V A;  2F0Q A;  4KY7 A;  4N9P A;  4N9T A;  4TRD A;  3PMF A;  2EYF A;  2ENB A;  1F2Z A;  1STA A;  2EXZ A;  3BDC A;  1F2Y A;  1SNO A;  1SYG A;  4K2K A;  4QMG A;  1EQV A;  4WRD A;  2F3W A;  4EQO A;  1TR5 A;  2F0M A;  3SK8 A;  1STB A;  1EYC A;  1TT2 A;  4K2L A;  3TME A;  1AEX A;  2RBM A;  3NUC A;  3E5S A;  3QOJ A;  1STY A;  4E6I A;  5CC4 A;  5IGB A;  3D8G A;  4PNY A;  1JOR A;  4K6D A;  3SHL A;  1SNC A;  3TP8 A;  1EZ6 A;  2EYL A;  2F0S A;  5C4Z A;  2WAC A;  4QB4 A;  1JOQ A;  2F0D A;  4KHV A;  1RKN A;  4EQP A;  5C3W A;  4ZUJ A;  1A2U A;  2F0H A;  4K5X A;  2PW5 A;  5I6Y A;  5CV9 A;  5IGE A;  4HMJ A;  1EY8 A;  1SYE A;  2M00 A;  4DU9 A;  5IOC A;  1SNP A;  4NMZ A;  5KYL A;  5C6A A;  5JOB A;  4DF7 A;  3MHB A;  3C1F A;  4I65 A;  2PQE A;  3U9O A;  3T16 A;  5JAV A;  5J39 A;  2F0F A;  2EY2 A;  4ID6 A;  4K8I A;  2SOB A;  4KD4 A;  4RKL A;  3SK6 A;  4KD3 A;  4J1M A;  5I6W A;  1NUC A;  2EYM A;  5CV6 A;  1STG A;  1U9R A;  3QOL A;  4ME5 A;  4WOR A;  5KRU A;  4DGZ A;  3ERQ A;  2F0K A;  4HMI A;  2F0W A;  4PMC A;  3ITP A;  4G57 A;  5J22 A;  5M9O A;  2EYO A;  1A2T A;  2OXP A; 
#chains in the Genus database with same CATH topology
 4MTN A;  2NUC A;  4DK3 C;  1JJC B;  4A3G G;  4KHP L;  1KRS A;  2NVQ B;  2IW3 A;  1STE A;  5CYU A;  5M5X H;  4KJN A;  2JA8 G;  2NVT H;  1HZA A;  3MVV A;  4K8J A;  2SNM A;  5ELF A;  5CGK A;  1IBL L;  5FJ8 G;  2P5Z X;  5GAG C;  2WB1 B;  4G7Z C;  3ZYY X;  1FGB D;  1DYQ A;  5LMN L;  3T13 A;  3NWS A;  5E1F A;  4LAA A;  4A3K B;  4GLV B;  1KC8 C;  3ULL A;  2UUA L;  2QDB A;  3TS2 A;  5A2Q E;  3GD7 A;  5E7N A;  1CK1 A;  1MIU A;  1EY0 A;  3I4N G;  4LF8 Q;  1SNM A;  4I7A A;  3MXN A;  5IT9 L;  1XNQ Q;  3RUZ A;  3IFT A;  1AZQ A;  5BN4 A;  3SE0 A;  4LJZ C;  4HSP A;  2VUM B;  2V1C C;  1KDC A;  3QJY A;  2KUM A;  2EYH A;  3HFZ B;  3S9W A;  4A3L G;  3P7J A;  1MGS A;  3IL8 A;  2EQS A;  1JIC A;  1IW7 C;  2RKS A;  4XTC S;  3ZJY C;  4R4Q A;  5HUR A;  4OX9 Q;  1NBW A;  1K8O A;  4HJ5 A;  1PRT D;  1ZEQ X;  1FR3 A;  1YZ6 A;  2PI2 A;  1P16 A;  5CBA E;  5TSS A;  4RA8 A;  2EVB A;  4K2K A;  1STA A;  4LWC A;  4DR4 L;  3KOJ A;  1EQV A;  5GQO A;  1GO3 E;  3VDY A;  1Q90 A;  2XNA C;  5JJL A;  1Q7Y C;  4C3H H;  4UAI A;  4QJF A;  3S1N B;  2CWP A;  3HOY B;  2EYL A;  4C2M H;  5ELD A;  4XQN A;  1N34 Q;  1PMR A;  4XIG S;  5GAD C;  2IJ0 A;  5D3D A;  5C44 G;  2FXQ A;  3K0X A;  5JOB A;  1LM0 A;  1XPR A;  5BN3 A;  1FGU A;  4HCE A;  4A3M H;  5ELE A;  2HHH L;  4XDX A;  1Q1E A;  4HJ7 A;  5I6W A;  3URY A;  5C0X H;  4A3B H;  2E8G A;  4YCW A;  5KRU A;  5M5W B;  2UXB L;  2AUK A;  1TWC B;  1I4X A;  1R9T B;  1CHP D;  1HZ9 A;  3NEM A;  4RWS C;  4O1N A;  4RCO A;  4BY7 B;  3RMH A;  3CC4 A;  2AUJ D;  1M90 C;  3I3C A;  3VYU A;  1EIF A;  2KHS A;  4J6H A;  3A8K E;  4BXX G;  2G9D A;  3R8B A;  3H6M A;  1WOC A;  3GTK H;  1W6J A;  1EY5 A;  4A3I H;  2ATW A;  3EVQ A;  4JI3 L;  2IL8 A;  3OWF A;  2L15 A;  3BVM A;  3PUX A;  4JI4 Q;  4FF3 A;  2XN9 C;  3P1H A;  1I5F A;  3UDI A;  4DR7 Q;  3RN5 A;  2KHJ A;  4JOI C;  3UE0 A;  3OWE B;  4KI0 A;  4DV3 L;  3CD6 A;  4PZ7 A;  4JC0 A;  5H1S E;  3K58 A;  3K8A A;  3J7A F;  3S2D B;  3T1H Q;  1DXM A;  2NVY B;  3J81 L;  4DUY Q;  4IFD H;  5T1I A;  2F0N A;  2K7V A;  5C0X J;  3CCJ A;  4ZCK A;  2E2I H;  3M4P A;  1G2S A;  5DEH A;  1IBK Q;  3RLF A;  2RSN A;  1E2W A;  1PH9 A;  4APV A;  3TZD A;  2K28 A;  2F3W A;  2FJ2 A;  2QKI C;  3NUC A;  3CCR A;  1PDQ A;  4X3T A;  3CCU A;  2EOT A;  3VR3 A;  3J81 i;  3FPU B;  3HOW B;  4K5X A;  4UP9 A;  2Q8R E;  3M7G A;  4XQQ A;  1O78 A;  1CTM A;  2ES2 A;  4H13 C;  1LTA D;  3AQQ A;  2K5N A;  2KCT A;  1I4G A;  1J9O A;  5IYC H;  4ID6 A;  1TWG B;  2HCI A;  1WTO A;  1GKH A;  3PSI A;  1NUC A;  2BE5 D;  2AHO B;  4TQU S;  5EPJ A;  5C3E G;  4PMC A;  4KKS A;  4A3K H;  1YIT A;  1X3F A;  5IY0 A;  2NVX H;  1Y8O B;  1QUQ B;  3NE5 B;  2OXP A;  4C3H G;  1MSG A;  5KGU A;  1A0I A;  2H4O A;  5KYI A;  3S17 B;  5FK9 C;  1QVF A;  2R92 B;  3I73 A;  2B2W C;  4G7H C;  2NVX B;  4L5R C;  4B9X A;  3A5Z B;  3CXC A;  3C46 A;  3NBH A;  2IX1 A;  3Q23 A;  1B2T A;  1WJJ A;  4C1N I;  1EZ8 A;  3SVM A;  3FKI B;  2JJQ A;  1YNX A;  1YJN A;  3NTK A;  1EIG A;  4HIO A;  4Y7N B;  1I4R A;  1VMC A;  4CKE A;  4H7B A;  4KK7 A;  4DV6 Q;  1A3V A;  4LF6 L;  2HHH Q;  4K0K Q;  4JI7 L;  5EKK A;  2KEN A;  1SYB A;  1YHQ A;  3SEB A;  2L0C A;  1PA6 A;  2BA0 A;  1C48 A;  1K83 B;  1WTP A;  4A3C G;  3QWN A;  4PMW A;  4CBV A;  1P8L A;  4IN3 A;  4LF9 L;  4RGN A;  3S1N H;  2R93 H;  2A69 D;  1A15 A;  4RCN A;  2RA4 A;  3P75 A;  2QEX A;  4LUV A;  3HOV B;  2RCN A;  3EBE A;  5D14 A;  2I0Q A;  1XJV A;  1XNQ L;  3M85 A;  2EYP A;  1AN8 A;  3OIP A;  4QL5 A;  4A3D B;  1TWF H;  1Z6H A;  3VA5 A;  4NXM L;  1K3B C;  1RIP A;  4N9T A;  1YJ9 A;  1BF4 A;  1O7L A;  2CFM A;  3GTO B;  2Z8L A;  3S1Q H;  3X3M A;  1GUO A;  1A63 A;  4B08 A;  3CCE A;  1PRT C;  1STY A;  1JJ2 A;  1B3Q A;  2WAQ G;  5LHY 1;  1B44 D;  1H9M A;  4DK1 A;  2VB2 X;  1SE3 A;  5ELC A;  2F0H A;  3RLN A;  5I6Y A;  2MFI A;  5J3B A;  5FOB B;  3KBG A;  4YWK A;  2NB0 A;  4JI2 L;  1ZYR D;  1MJE A;  4GLA C;  1RF2 D;  2K03 A;  2DY8 A;  5JAV A;  2B2T A;  2R7Z G;  1NR4 A;  3HKZ G;  1MSH A;  1QIL A;  3D3R A;  5JEA G;  4HJ8 A;  3STB C;  1PYB A;  4OEL B;  3ITP A;  4WJ4 A;  1Y1V G;  4YIJ A;  4BY1 H;  1EY6 A;  1KAB A;  1Y8P B;  5IOD A;  1M1K C;  2E5L Q;  1VQJ A;  1I6H B;  1PH5 A;  1IL8 A;  2EY5 A;  4BY1 B;  1MJC A;  5CV4 A;  4O2D A;  2ICI A;  2N3S A;  4XYO A;  3I4M G;  2K33 A;  2JSO A;  1LT4 D;  4FO2 A;  3CRK C;  1LTL A;  1XYI A;  4F8M A;  4IUP A;  3WOE A;  3S14 H;  1QE6 A;  4JPB W;  3EIV A;  4JI8 L;  2QCP X;  2Y0S E;  2VZA A;  2PZT A;  2MP1 A;  1HZB A;  2Z9H A;  1CI3 M;  4JW0 A;  5M3M H;  4JI6 L;  1PFM A;  1SJH D;  5JJI A;  5GAH C;  2CKZ B;  1L0W A;  1VQ9 A;  1TQO A;  1HNX Q;  4V0B A;  4B3T L;  2L4N A;  1WYD A;  3S15 H;  1FVI A;  1VS0 A;  5FKA C;  5C3E B;  1Y8N B;  5JPM C;  4ZQ3 A;  5IYD H;  3GO5 A;  4RHR A;  5CV5 A;  1II3 A;  2ZTC A;  3LWE A;  3M9B A;  1JOK A;  2A69 C;  4R8I A;  1VQL A;  2RDG A;  4A3D G;  3G7L A;  4EQN A;  5A2Q L;  4K5V A;  3OYY A;  1MKH A;  4FP5 D;  5IWA Q;  2ENB A;  4QMG A;  4DAV A;  2R7F A;  1HH2 P;  2MUY A;  4BA2 I;  4YHH Q;  1UEB A;  3A7L A;  3D8G A;  5IP9 H;  5K36 H;  4K6D A;  1LO5 D;  3T51 B;  1PH1 A;  2F0D A;  5JJZ A;  2KHI A;  5IGE A;  2BE5 C;  3K5O A;  3R2I A;  4UP8 A;  1PLF A;  1I94 L;  2Q2H A;  1XX8 A;  4A3F B;  3MWY W;  4IPC A;  1AH9 A;  1EQQ A;  3HS0 C;  3DEO A;  4RMF A;  1I3Q H;  2WKD A;  4MN3 A;  1B9M A;  3S1M B;  1RDP D;  3JAM E;  3A7A B;  3HOX H;  3ERQ A;  4QUC A;  4DV2 Q;  1X65 A;  2CHB D;  4F88 A;  4GZY C;  4V19 0;  1HRJ A;  3F1Z A;  1Y1W H;  3BDL A;  1VQO A;  1B50 A;  2SDF A;  3N6R A;  3TN2 A;  1FYC A;  5M5Y B;  3JC6 6;  4BA1 I;  2RF4 A;  2NZH A;  5M3F H;  2EPB A;  2R3Z A;  3TQY A;  1AE2 A;  2G9H D;  4DNR B;  1IBM Q;  4DR2 Q;  5AJ3 L;  4DV0 Q;  2JE6 I;  2WP8 J;  1LAB A;  1S40 A;  4ODG A;  1QVC A;  1SXT A;  1NE3 A;  5LMU L;  4OEM B;  4BBS B;  5ELB A;  4DV7 L;  1BCP B;  1GOZ A;  3JAM c;  4L6T B;  2JN4 A;  3JAM L;  3CQZ H;  3PUV A;  3HOU H;  2NTS A;  4DA2 A;  1EYA A;  2RQX A;  1C7Y A;  2O4X A;  2A19 A;  3KLW A;  4ZKC B;  1KHI A;  1QWY A;  3I4N H;  1EOT A;  2PI2 E;  5JVH 3;  5C3X A;  4PQX A;  1FJG Q;  4WJ3 M;  3I90 A;  3J7A 5;  1HZC A;  4BBR B;  4LMQ D;  3QIA A;  1C4Q A;  4JI0 L;  4X6A H;  4IUN A;  4JI1 Q;  4QCL A;  2K75 A;  1I4H A;  5M5Y H;  1Z7T A;  2HT1 A;  1VQF A;  3OMG A;  2RHS B;  2NVQ H;  2NWG A;  4PG3 A;  3H91 A;  3NWT A;  3PMF A;  2EYF A;  4DKA C;  4LF9 Q;  1VQB A;  3I56 A;  1TWG H;  1AW7 A;  4HED A;  3S1M H;  1WTQ A;  4FDB A;  4PNY A;  1JOR A;  3H94 A;  1AFP A;  2UU9 Q;  1KRT A;  2LXK A;  1NAP A;  3AU7 A;  1MI2 A;  1VQI A;  3A56 A;  4X3U A;  5C4X B;  1U4M A;  1M8A A;  3BU2 A;  4M8A A;  3M7N A;  2M00 A;  2ASB A;  1F9P A;  3J81 E;  4DF7 A;  4C2M B;  2LSS A;  4UPA A;  3PO2 H;  2LMC B;  1H9J A;  2LXJ A;  1TWA B;  2K32 A;  3S2H H;  3I4L A;  4LFB L;  1XWE A;  4UY8 C;  1IBL Q;  2CQO A;  3CCM A;  1K0S A;  4H0L C;  4C3J G;  1I6H H;  1JWM D;  2R7D A;  2EYO A;  2CW0 D;  4MHE A;  2F4V Q;  4B3T Q;  3KF8 A;  1CQV A;  2UXD L;  4H02 A;  1EWH A;  1G8Z D;  4YCV A;  4A76 A;  2D5D A;  4X64 L;  2I46 A;  1G6Z A;  2A74 C;  4JVZ A;  1T9H A;  4IAL A;  1ENF A;  2VQF L;  2B2V C;  4OO1 H;  1OO9 B;  2AKW B;  3MFY A;  1VQP A;  2WAQ B;  2C9O A;  5M5W H;  2C35 B;  2R61 A;  3KF8 B;  1I94 Q;  3BYY B;  3CC7 A;  4JG2 A;  1SMX A;  3TRE A;  2F3V A;  3CRL C;  2E2D C;  4DNI A;  1CZW A;  1EYG A;  1UE5 A;  1PHJ A;  2WV6 D;  4U68 A;  3HG9 A;  2BH2 A;  3ND8 A;  4ULL A;  5C4J B;  4CJ1 B;  1KLG D;  4MIU A;  1RTN A;  5IGD A;  4HID A;  3KK7 A;  1LYL A;  2OT2 A;  1Y1V B;  3HOV G;  1QNK A;  1NTG A;  3S16 B;  1QCB D;  1C9O A;  2Z4I A;  1R4P B;  2JA5 G;  2A5H A;  2F0I A;  4IOA A;  4DR2 L;  1A3T A;  4IUR A;  3S15 B;  2JA8 H;  1B4O A;  5NUC A;  1OXV A;  4A3E B;  3EN2 A;  1U0L A;  2VQE Q;  5FLM G;  3UI2 A;  5LMU Q;  3S2D H;  1XNR Q;  3OW7 A;  3BZC A;  4Q0F A;  2NN6 G;  5KYL A;  2OQK A;  4WRD A;  3U9O A;  3PO2 B;  1HCZ A;  4A3M B;  3BYT B;  2BH8 A;  2UXC Q;  3S24 A;  2PNH A;  3TME A;  1CKM A;  3GTP H;  3DM3 A;  5IGB A;  1NCV A;  4LF7 Q;  1PXU A;  1LT3 D;  1WCM H;  4OX9 L;  4A3B G;  4GN4 B;  1DOM A;  2B39 A;  2Z6K A;  4ZUJ A;  1SAP A;  2PO4 A;  2K14 A;  3S17 H;  4C1N K;  1SRU A;  1PFS A;  5C6A A;  5HY6 A;  2I5L X;  1H9R A;  1GD7 A;  4I7Z C;  1V1Q A;  1S4Z A;  4TKO B;  5DM7 3;  3GTQ B;  2Z1C A;  4KD4 A;  5ELN A;  4JI0 Q;  3HKZ E;  2X6L A;  3A5U A;  4DUZ Q;  3R2T A;  1QJO A;  4ME5 A;  4CGY B;  5L37 A;  1EIY B;  2EE1 A;  2M9V A;  4JYA L;  4GNX C;  2R92 H;  1S5E D;  3CAM A;  1J5E Q;  3RNU A;  1IYU A;  1FJG L;  4O42 A;  2HIX A;  4NB3 A;  2A68 D;  4QY7 A;  1EUJ A;  1V1P A;  4KLK A;  5GAE C;  4IPH A;  1E1T A;  3CCQ A;  1UWV A;  3IAY A;  4ILW A;  4GOP C;  4GKJ Q;  1N36 Q;  1YNJ C;  1DZ1 A;  1VQD A;  4BWG B;  3BS1 A;  1GUG A;  1LUZ A;  1RD9 D;  1YI2 A;  1D2B A;  3RN2 A;  4DV2 L;  3BVZ A;  2F0O A;  2E74 C;  5M3F B;  1A62 A;  5C5M A;  3OW2 A;  1EOV A;  1WTR A;  1X3G A;  1X9N A;  3U58 A;  1DD2 A;  2E2I B;  3CME A;  4BBS H;  5IP7 H;  2DN8 A;  2JA7 B;  4KTA A;  1G91 A;  3S16 H;  2Z0S A;  4AYB B;  2R6G A;  1HR0 Q;  2D2C C;  4PZ6 A;  2JA6 H;  5G3L D;  1WTV A;  4C3H B;  1BNZ A;  4K14 A;  3OIQ A;  3ULJ A;  4Q5V A;  1PH7 A;  4IUU A;  3TP7 A;  1EY4 A;  2K1B A;  4GNX A;  2WAQ E;  1L1O B;  1D8L A;  4LFB Q;  3G4S A;  4ABN A;  5FJ8 H;  1IXR A;  5ELO A;  3CQZ B;  4PMB A;  2IY5 B;  1CKN A;  4GOP A;  1EFI D;  1BVS A;  1YEZ A;  5I2Y A;  4ZKB B;  3AEV A;  2ZXR A;  1VQK A;  2F0M A;  4GNX B;  1JQY D;  4B3S L;  3U4Z A;  1JWU D;  2RBM A;  3J81 c;  1U4P A;  1O7Z A;  1VQ6 A;  2AQ3 B;  2PQA B;  2F0S A;  2Q2I A;  4IFD J;  5JJK A;  4EQP A;  2TSS A;  3AFP A;  1Y14 B;  2PW5 A;  2VUM G;  1TU2 B;  1NMG A;  1SJE D;  1H9S B;  3GP7 A;  1OXS C;  1SYE A;  1E22 A;  3G6J B;  1Y69 U;  1R9T H;  2WIN B;  1TWC H;  1ET6 A;  2F0F A;  3FEW X;  2B3G A;  1SRO A;  1V1O A;  3FKI G;  3H3V I;  4B3M Q;  2E2H H;  1RTO A;  1UE6 A;  5IP7 G;  1B9N A;  3J7A V;  1JOQ A;  4HCS A;  4J8Q A;  3SK4 A;  2LFN A;  1ILQ A;  4B3R Q;  2EYJ A;  3K6O A;  1WTW A;  1HNW L;  3FMC A;  1GJX A;  4DV6 L;  4QIW B;  1V43 A;  3FDT A;  1KIX A;  1STH A;  2AWO A;  2JA6 B;  5CV7 A;  1GHK A;  2ZM6 Q;  4IFD G;  3I7F A;  1L0X B;  3PF5 A;  1IYJ B;  2XVS A;  5EGT A;  1C8C A;  4TSS A;  2UUB L;  3UDF A;  1HUN A;  4NP5 A;  4C3J B;  3OSO A;  4P73 A;  1XMO L;  5J1Z A;  3SGI A;  3CC2 A;  2UXC L;  1LV9 A;  1K8G A;  3VR6 A;  2LKV A;  2Z4H A;  3OTO Q;  1JC7 A;  4GN5 A;  2ZJQ A;  5AFW A;  4LUZ A;  3Q0A A;  4DR5 L;  3V05 A;  3ERO A;  3DMU A;  3B6Y A;  2Y0S G;  1YIJ A;  1WD0 A;  2KOL A;  4ME3 A;  1PRT B;  1EY9 A;  3HP3 A;  2XTI A;  1HJP A;  2AQ1 B;  2PW7 A;  1BDO A;  4LF5 Q;  3PF4 A;  4M1U B;  3AYH B;  3OOC A;  4OIJ A;  1BR9 A;  1TXY A;  4ZUI A;  1U5K A;  1BKB A;  4P72 A;  4MNO A;  4R8N A;  3C3L A;  1AE3 A;  1SYC A;  4RFB A;  3CHB D;  1CKN B;  1MBY A;  4JI5 L;  4K0K L;  3D4W A;  4DAP A;  4WJW A;  3T1Y Q;  1C0A A;  4JYA Q;  2J4X A;  4NXN L;  3Q24 A;  5BN5 A;  2B2Y A;  4YWL A;  4KHP Q;  5LL6 X;  3BDC A;  3I4N B;  2A6E C;  1X56 A;  1TR5 A;  3SK8 A;  2CQA A;  1J6Q A;  4A3K G;  4A3E H;  2KBN A;  4RG1 A;  5KNC A;  3TP8 A;  3QO2 A;  1A2U A;  1VQ5 A;  3PO2 G;  1QUQ A;  4KN4 C;  1B7Y B;  3NBI A;  4AYB G;  4NXM Q;  3GDE A;  2N49 A;  2E5L L;  4A3J H;  1BCP C;  4JI8 Q;  4DR1 L;  1ASZ A;  3PUY A;  1K83 H;  2JA5 B;  4DN4 M;  1TWF B;  4DGZ A;  5M3F G;  1HFN A;  4IUV A;  1CZG A;  2D9U A;  1KL9 A;  2AMC B;  1YBY A;  1Q1B A;  4JI2 Q;  4ALP A;  1I50 H;  4DPG A;  3TBI B;  2HQE A;  3HOZ B;  1F9S A;  1SYF A;  2WII B;  3DM1 A;  2B2Y C;  2EDG A;  1BBX C;  1Z47 A;  4LF8 L;  1IHZ A;  1LTG D;  1VF7 A;  3E3X A;  2MGS A;  4P75 A;  5EBC A;  2BA1 A;  2KCC A;  5FO7 B;  5G3L F;  2FHT A;  5CBE E;  4ZYS A;  1CM9 A;  4FVM A;  1JE5 A;  4XXE A;  2F03 A;  3EQL C;  4RKB A;  5IYB H;  2N8N A;  3MC0 B;  4LFC Q;  4GLX A;  4NKL A;  3PCO B;  3BG3 A;  1XPU A;  3SXH A;  2MQH A;  5C3E H;  1W2B A;  1PFN A;  4HSV A;  5EPL A;  1VQ4 A;  1HFG A;  5IGC A;  5C0X G;  4HIK A;  4DR3 Q;  4DAY A;  5IE8 A;  3F2U A;  3VR4 A;  4JK1 C;  3S2H B;  3LWU A;  2Z6B A;  3F8T A;  4A3B B;  3HKS A;  1X3E A;  1JMC A;  1SDF A;  4FXK C;  3L2P A;  3TP6 A;  4A3F H;  2KJX A;  3DWA A;  1CA5 A;  4X66 L;  2CWA A;  3U50 C;  3NTH A;  5DLQ E;  5IGF A;  2I5H A;  2ZM6 L;  1G29 1;  2ALY B;  3A74 A;  4P74 A;  5DAU A;  2OWO A;  4CDF C;  1NJI C;  1L1O C;  3EFX D;  1OXT A;  3PIO 3;  3SR1 A;  1E2V A;  4B3R L;  1B70 B;  1GHJ A;  4R4O A;  1Q86 C;  2UUA Q;  2DJF C;  5IT9 E;  3U4V A;  4P71 A;  3E5S A;  3P20 A;  3DUZ A;  4RGM A;  2UXB Q;  1EZ6 A;  4U67 3;  1Y1W B;  5C3W A;  2YU9 B;  1HXY D;  1UNS A;  3J80 E;  1UAP A;  2CVR A;  3HOY H;  3ERS X;  4LF5 L;  4I65 A;  2KA7 A;  3T16 A;  3NTI A;  3E9H A;  3ONA B;  4X65 Q;  1L2F A;  4A75 A;  1X3P A;  1G51 A;  4RKL A;  4R4T A;  2B63 G;  2KCM A;  4L5Q A;  1TS5 A;  2MHV A;  4HMI A;  2F0W A;  4A93 B;  1PTO H;  1J8I A;  1EEF D;  4NXN Q;  2NVY H;  2OEO A;  1TS2 A;  2QIL A;  1K3R A;  2WKC A;  4QGU A;  1F2M A;  3VYR A;  1PVO A;  5BR8 Q;  3I4O A;  3PIP 3;  4FF2 A;  4DUY L;  2BOS A;  4GN3 B;  1PTO D;  2BDN A;  4QUF A;  3CF5 A;  4HTH A;  1ZKO A;  2IT1 A;  1PV4 A;  1U4R A;  1YVC A;  1JT8 A;  5I2X A;  3K5L A;  1D5M C;  1EU4 A;  1FD7 D;  3A54 A;  1GVP A;  5CR3 A;  1WVL A;  2K5W A;  5DNF A;  5C4H A;  4KV6 A;  3GV3 A;  4YWM A;  3C1E A;  4DXG A;  5CV8 A;  3HKZ B;  2JA6 G;  3HOW H;  4DR1 Q;  4JBJ A;  1M4V A;  1EWI A;  1FNV A;  1ASY A;  1HPC A;  1JCK B;  3CPW A;  1G2T A;  3TZU A;  3OHX C;  4R4I A;  3H0G B;  3PIP A;  2KED A;  1VF5 C;  5EPK A;  2PQA A;  1AZP A;  2K52 A;  1YNN C;  1A6X A;  1TS3 A;  1VQG A;  3NHH A;  4LK1 C;  3KJP A;  1BQQ T;  2KQ3 A;  1F9Q A;  4F7X A;  5C4J H;  3GQB A;  2F52 A;  4R9W A;  2ZTD A;  5C44 H;  4CJ2 C;  3PGZ A;  1V1P B;  3D6C A;  4DXF A;  4DK0 A;  3RZD H;  1PTO F;  1K8M A;  1S5D D;  4H44 C;  2QGQ A;  3WDN A;  2B2U C;  2R93 G;  4OWT B;  2EXZ A;  3NQI A;  4A3G H;  5FLX L;  1ICW A;  4K2L A;  1ONL A;  1ZYR C;  3QOJ A;  3F2C A;  2KEE A;  3UDX A;  4DR7 L;  3PO3 B;  1KLU D;  3H3V H;  2VQF Q;  3FP9 A;  3HOU G;  1RL2 A;  3T1Y L;  2D0O A;  2EZV A;  1D5Z C;  3STB D;  5JPN C;  1DGS A;  1W3S A;  3U9S A;  1L0Y B;  1I6V C;  4XT3 B;  1N8R C;  2EY2 A;  1N9W A;  3T1H L;  3MAQ A;  2Z6K C;  1RHP A;  2EYM A;  2FMC A;  4KN7 C;  3GV6 A;  2JA9 A;  2GA4 B;  2HD3 A;  3KF6 A;  1PFB A;  1O7I A;  1HHV A;  1EY7 A;  3IKJ A;  1SFO B;  1YHB A;  3MXP A;  3PQI A;  5C4X H;  2NN6 H;  5KIX A;  4X3S A;  1Q8I A;  4DV5 Q;  2J7Z A;  2PYK A;  3ICE A;  3CCS A;  4JI7 Q;  1T5E A;  3FKI H;  5FO9 B;  3VA7 A;  2HCC A;  3I4M H;  3NQT A;  2WB1 E;  3HOZ H;  1B8A A;  3D4R A;  1I50 B;  1TS4 A;  2ZTE A;  5C5L A;  3V2T A;  4K5W A;  2RDF A;  2VW9 A;  3N52 A;  3I91 A;  5EBD A;  2B2V A;  5C0X I;  1FNU A;  2IPK D;  2C5C A;  3QR8 A;  3A8I E;  1OXX K;  1TY0 A;  1Y1V H;  1DOK A;  2SNS A;  2YTY A;  3A8J E;  3TSS A;  4BBR H;  2XGT A;  2YYZ A;  1E24 A;  1YJW A;  3BJU A;  5IT9 c;  1F9R A;  1SND A;  1LTR D;  1NSN S;  5EKL A;  1KQS A;  1MD2 D;  1HNZ Q;  3LGJ A;  4DK6 C;  4DR6 L;  3R3O A;  4IJL A;  2M2L A;  1PZJ D;  4POF A;  3KLS A;  4B9W A;  1ENA A;  3J80 c;  1VQE A;  2F0T A;  2R7Z B;  4DUZ L;  1YNN D;  3LX0 A;  4DV4 Q;  1VQC A;  2D0P A;  2F1M A;  2RCF A;  3OMC A;  2ZJR A;  5FLX E;  2UUC Q;  1E7Z A;  4QF4 A;  3QB3 A;  4A3I B;  1J5E L;  1WTX A;  3I70 A;  4YY3 Q;  3WWV A;  1IYV A;  3A0J A;  1F2Z A;  1F2Y A;  1ET9 A;  4RGT A;  2N78 A;  1NMF A;  4JCV E;  1TT2 A;  2DNC A;  2MPM A;  4E6I A;  1PTO B;  1NY4 A;  4BBR G;  2NTT A;  4MZ9 A;  3H0G H;  2YTV A;  4KHV A;  1HTP A;  2A6E D;  4KKU A;  1MHW C;  2XRQ D;  3K7A B;  3RD4 A;  2VQE L;  1S5B D;  2F4I A;  1PH2 A;  3HOX B;  4A3I G;  1SR3 A;  2EIF A;  4BXX H;  3J81 j;  2OCE A;  1IL2 A;  1X3Q A;  3M3Y B;  3KF6 B;  3QOL A;  1BCP F;  3RR5 A;  5M5X B;  5LMN Q;  5M9O A;  4P2C B;  4XT1 B;  1K9M C;  4FF1 A;  3NP8 A;  1VQH A;  1KTK A;  4J15 A;  4DAY B;  1GM5 A;  4KJO A;  1HQR D;  5E3F A;  4UHV A;  1TWH H;  3TRZ A;  1A3U A;  1GUT A;  2B8G A;  2AQ2 B;  3GTG H;  2JEB I;  2IX3 A;  4JI6 Q;  4OO1 G;  1HR0 W;  2K05 A;  1HR0 L;  1Q82 C;  2F0J A;  2KCN A;  2GN5 A;  1TII D;  2IX0 A;  1Z9F A;  2XWB B;  3DHQ A;  1O80 A;  3VR2 A;  1XPO A;  1XTC D;  3BVG A;  1QVG A;  4B3S Q;  2ZXO A;  2VL6 A;  2CCZ A;  1VQA A;  3NSW A;  2E75 C;  2XRS D;  1WD1 A;  1H95 A;  3CP0 A;  2HUG A;  1WFQ A;  2NZ1 D;  4OGQ C;  2IWH A;  4PZ8 A;  2L11 A;  1SN8 A;  1K28 A;  1HTL D;  3HEJ A;  2HDM A;  1CSQ A;  5I9P A;  1KDA A;  1F2L A;  2L55 A;  2VNU D;  3V96 A;  5I4D A;  2F3I A;  1XXG A;  1B1Z A;  3VYS A;  3IFD A;  4YHH L;  4RAU C;  1RJT A;  2EY1 A;  3RZO H;  4CHT B;  3GTP B;  1AP0 A;  3H0G G;  1ROD A;  4A3E G;  3T53 B;  2AWN A;  2E2J H;  4KKT A;  3BDO A;  2HQL A;  5K5P A;  4UDU C;  3MXG A;  5FO8 B;  4RGO S;  4JBM A;  4G7O C;  2QDL A;  5C4X G;  1TKW B;  4FNF A;  2OTJ A;  1JWS D;  2EJM A;  1HA6 A;  3PV0 A;  5E4X A;  1IKM A;  5CC4 A;  1DJR D;  1EU3 A;  3I2Z A;  3I55 A;  3GTJ B;  1KXL A;  2DY7 A;  2NBF A;  1WTH A;  3SDZ A;  2R93 B;  1HNX L;  4DV7 Q;  3L7Z C;  1KNA A;  1SNP A;  1XMO Q;  2Q2U A;  3MHB A;  1HNW Q;  4BS9 A;  3C2P A;  3A55 A;  1JB3 A;  4LFA Q;  4R1J A;  2YU9 H;  3PUW A;  1UUP A;  3OPO A;  4EGV A;  1EWC A;  4AH6 A;  1K73 C;  2ZXP A;  2ZJP A;  5CV6 A;  4JOI A;  5CMD A;  2E76 C;  4FXD A;  2K4K A;  5E4W C;  1YHA A;  5J22 A;  1CQF A;  1K0R A;  4IJH A;  1PTO C;  1N34 L;  2UUB Q;  3NK9 A;  3I4M B;  3L3O C;  1JOO A;  1D6E C;  4LUO A;  3ND9 A;  3RZD B;  3S1R B;  4IUT A;  3DLL A;  4C3I G;  2JA8 B;  2R92 G;  4ZRZ A;  5KND A;  3GTK B;  4GS3 A;  1CKO A;  5JEA J;  1PRT F;  2CW0 C;  5C44 B;  4NDX A;  3MEH A;  4JI5 Q;  1LTI D;  1SFO H;  4IZ8 A;  3S1Q B;  3GTO H;  3F2B A;  4DV3 Q;  5IYD G;  2PMZ E;  2JA5 H;  4OXP A;  4YY3 L;  2CH4 A;  3K57 A;  2F0P A;  2O5J C;  4HJA A;  2XSC A;  2K5D A;  3CMA A;  2Q2T A;  3HZX A;  3J7Y W;  3MZ5 A;  1EQR A;  3BZD B;  1X6O A;  2LS0 1;  3Q8D A;  4EVO A;  2KEC A;  3DWQ A;  4N8X 1;  1LAC A;  3SK5 A;  3CCL A;  3RZO B;  4CKC A;  2WFW A;  1KDB A;  4R4C A;  3M4Y A;  4C3I B;  5EKI A;  1IKL A;  1I4P A;  3AB9 A;  2A1A A;  1IBK L;  3E6Z X;  2H5X A;  3HOU B;  3NXW A;  2RVL A;  1ML0 D;  4JV5 Q;  3Q6S A;  4HJ9 A;  4KY6 A;  4LW1 A;  3D31 A;  1JR0 D;  1LTT D;  5FLM H;  2E2J B;  3GTL B;  1V9P A;  5HGQ A;  2XWJ B;  4RH6 A;  3M4O H;  4CDE C;  2UU9 L;  4G4K A;  1HQM C;  3CKI B;  5COY A;  1LLR D;  3K5M A;  1TVX A;  4K6L A;  4DV0 L;  3ULP A;  4A3F G;  2JP1 A;  4X62 L;  4KY5 A;  1VQM A;  2K6A A;  3VR5 A;  1H9S A;  1EIH A;  4TRD A;  2UXD Q;  2K5H A;  5COR A;  4DR6 Q;  1X54 A;  2A6H C;  4OON A;  2ZT9 C;  4XYQ A;  4ZK9 B;  4A3C H;  2NN6 I;  3PIO A;  1Y1W G;  5KNB A;  3AFQ A;  3H15 A;  4JI4 L;  4AYB E;  1UE7 A;  5LMN W;  2IHE A;  2K50 A;  4X3K A;  1RKN A;  1TWA H;  1QB5 D;  1LTB D;  2DGY A;  3ER0 A;  3G6E A;  3K59 A;  2F4V L;  1EY8 A;  4DU9 A;  5IOC A;  1CA6 A;  2JA7 H;  4ZLT F;  4C56 C;  2Y0S B;  3MXU A;  4A3L H;  3C1F A;  4X64 Q;  1EL0 A;  1A8V A;  3T56 B;  5J39 A;  2I07 B;  3K81 C;  3E0J A;  2VUM H;  3LNN A;  1KD1 C;  3MA2 B;  1BXT A;  4KD3 A;  3K80 C;  1B3A A;  1XTD A;  3E0E A;  3CCV A;  3S1R H;  2F0K A;  1SE4 A;  3MXN B;  1TWH B;  1QG7 A;  4HAE A;  1RCV D;  3W1G A;  1X55 A;  1SSO A;  5I9O A;  2RHQ B;  3K7A H;  1L1O A;  4LFC L;  3DEP A;  4DV1 Q;  3KBX A;  3HOX G;  4BY7 G;  5F2D A;  1IZ6 A;  4GOP B;  4DR3 L;  3I8Z A;  4CDD C;  1GUN A;  1GXD C;  1BOS A;  1QNU A;  4MTK A;  2A68 C;  2VY3 A;  4BY7 H;  4A93 G;  4CKB A;  4C3I H;  1EFW A;  3KLR A;  1D5X C;  4OWX B;  3TP5 A;  5A35 A;  3HOV H;  3H3V C;  3FRP B;  5EAY A;  1N33 L;  3GTQ H;  2X6G A;  3UE1 A;  4EQ5 A;  3GTJ H;  2HIV A;  1ENC A;  3KYH C;  2QW7 A;  3D4D A;  3KUP A;  4X66 Q;  1I4Q A;  1TY2 A;  1CT1 D;  3NEL A;  5K36 G;  2YTX A;  5JEA H;  1EEI D;  1PYW D;  1B53 A;  4NPS A;  1U4L A;  3BZK A;  3DWP A;  4OIK A;  3IRB A;  1SMY D;  1EQT A;  1S5C D;  1KAA A;  5IYB G;  1DCZ A;  1CHQ D;  1O7Y A;  1LTS D;  3TS0 A;  2SEB D;  1BO0 A;  3PO3 G;  4LFA L;  3TDQ A;  1PZK D;  2F0V A;  3GTM B;  2TMP A;  2K04 A;  2H1E A;  1VQN A;  4LF6 Q;  1KAW A;  1SMY C;  4LNQ A;  3FHW A;  3WOF A;  3X3N A;  5HGT A;  1S3O A;  3GTM H;  2B2W A;  3T4A C;  2J0T D;  2A73 B;  2F0Q A;  3W5O A;  4N9P A;  1SBB B;  4ZAI A;  4OWW B;  2YV5 A;  1FL0 A;  4AIM A;  1STB A;  4X65 L;  1EYC A;  2O5I C;  3M3Y H;  4IFD I;  2MNA A;  1PH4 A;  2EJF C;  5LL6 S;  1SNC A;  2RSO A;  2QA4 A;  4A3J B;  1DM0 B;  2GVA A;  1VDZ A;  2JYO A;  2VB3 X;  4N8F A;  3RLO A;  1JE4 A;  4IO9 A;  1SE2 A;  5BR8 L;  2DUD A;  2NYZ D;  2XIW A;  1VQ8 A;  2EXD A;  5T1G A;  3EA6 A;  4K8I A;  2JEA I;  1UEA B;  4LF7 L;  4QQB X;  3J80 i;  4IPD A;  1NR2 A;  2HDL A;  4G57 A;  1NNX A;  4X62 Q;  2Q8I B;  2WB1 G;  4HIM A;  1E1O A;  4EX5 A;  3M4O B;  1GUW A;  4PV1 C;  4JV5 L;  1XNR L;  4HR7 B;  4BY1 G;  1N32 Q;  4IPG A;  3W1B A;  4LF4 Q;  3TEH B;  4OL7 A;  2L5T A;  2Q8T A;  1D7Q A;  2QF7 A;  3CW2 C;  4AQY Q;  4QIW E;  1XMQ L;  2BDO A;  3K7U C;  1BUV T;  3O13 A;  3QG1 A;  2PCF B;  1ILP A;  2FMM A;  1KNE A;  2B2T C;  3K5N A;  1X32 A;  2D62 A;  1ICF B;  2V4D A;  4CDC C;  4NW2 A;  1Q81 C;  4DFA A;  4WFN 3;  2PZW A;  4GKK Q;  3EJI A;  3Q22 A;  1CFM A;  2JK8 A;  3W3A A;  5DM6 3;  5JVG 3;  1E3P A;  1N36 L;  2MJ8 A;  5M3M G;  2CH4 W;  3GTL H;  1WCM B;  2BCO A;  4DAM A;  2QEJ C;  4DR4 Q;  4A3J G;  3HRZ C;  2FFK B;  1QZG A;  3HOY G;  2LY7 A;  4UP7 A;  5KEE A;  1K8A C;  3D6W A;  3MTS A;  1PH3 A;  4GKJ L;  1QZH A;  4OO1 I;  1S72 A;  1PYS B;  1WCM G;  2K5Q A;  2PMZ B;  3W2D A;  5IIF A;  2VXW A;  1SYG A;  4EQO A;  3JAM i;  3CPF A;  3F2D A;  3G71 A;  1V8Q A;  4DV1 L;  3J80 L;  4CJ0 B;  4L63 B;  3KFU A;  3NBH B;  1SLJ A;  2WAC A;  4QB4 A;  1LT5 D;  1GUS A;  2GVB A;  3NPP A;  5IYC G;  3KJO A;  1UE1 A;  2L12 A;  5CV9 A;  3L0O A;  1R4Q B;  3D0F A;  2L9H A;  5IWA L;  5FLX c;  4JBK A;  4A93 H;  1LT6 D;  2DNE A;  1Q3L A;  4J1M A;  5AJ3 Q;  2L1B A;  1U9R A;  3H09 A;  1BBU A;  1H9K A;  1JB7 A;  2MO0 A;  2PNR C;  1A2T A;  1YNJ D;  2PZU A;  5ISR A;  1E2Z A;  2B63 B;  2OF1 A;  3G48 A;  1VQ7 A;  4OHJ A;  1EYD A;  1SE8 A;  4HN7 A;  4A3D H;  1CUK A;  3M4Q A;  2N88 A;  2DJG C;  3CU7 A;  4FYD A;  2JQO A;  2EY6 A;  3HOZ G;  2UUC L;  4S3S A;  1JJG A;  2X69 A;  1DON A;  1VCI A;  3KDF A;  1BBW A;  1OXU A;  3DXJ C;  4B3M L;  1G6P A;  2PPB C;  1SEB D;  2O2L D;  2K01 A;  1PH8 A;  4L8J A;  1ESR A;  1D1K A;  2F0E A;  1FNW A;  3MEF A;  2F0U A;  1I3Q B;  2EJG C;  4KHZ A;  4DV5 L;  1OTC A;  2A8V A;  2IHF A;  2RDH A;  1PZI D;  2B2U A;  4IUQ A;  2KVM A;  1Q12 A;  2ICE C;  1HA5 A;  2OQ0 A;  4Z9C B;  4C3J H;  4F87 A;  3VYT A;  3NEN A;  1IW7 D;  1ESF A;  4L5T A;  3KDF B;  1HUM A;  2OTL A;  1SYD A;  4IQZ A;  1DOL A;  4Y7N H;  3GTG B;  3HOW G;  2B8F A;  1E0B A;  4L5S A;  5EJW A;  4LF4 L;  1N33 Q;  4YCU A;  5EQ0 A;  2F0L A;  4FF4 A;  3OTO L;  4Y52 H;  3E9I A;  3FVQ A;  5IGG A;  2A6H D;  1IBM L;  4AQY L;  4TVA B;  1XMQ Q;  1VMP A;  4IOC A;  3K0Y A;  3FPP A;  1STN A;  5GRO A;  4KMU C;  1SNQ A;  2F0G A;  2NZO A;  4JBW A;  2MO1 A;  1F77 A;  1WI5 A;  3J7Z C;  1HNZ L;  4A4I A;  2E2H B;  4KY7 A;  2NVT B;  1N32 L;  1SNO A;  1PH6 A;  3R93 A;  2G5D A;  4JI3 Q;  3L9A X;  3UDG A;  4GKK L;  1AEX A;  4POG A;  4O0A A;  3HGB A;  1D1I A;  2ID0 A;  2JXM B;  3SHL A;  1W6K A;  4DR5 Q;  2N55 A;  1BCP D;  1S5F D;  3KLS X;  5C4Z A;  4DV4 L;  4JI1 L;  4A3M G;  1Q8K A;  2B63 H;  2R7Z H;  2K5V A;  3MFG A;  4HMJ A;  5M3M B;  1Q46 A;  4NMZ A;  3PO3 H;  2JA7 G;  2B29 A;  2I5M X;  3PUZ A;  5D3I B;  2PQE A;  5D65 A;  1ZXT A;  1T5X D;  1QOH A;  4DNT B;  4RHS A;  2FIN B;  3S14 B;  2SOB A;  3AMU A;  4A3G B;  3SK6 A;  3I72 A;  1STG A;  4WOR A;  1CSP A;  5IP9 G;  4FXG C;  4XQJ A;  4BBS G;  2VS1 A; 
#chains in the Genus database with same CATH homology
 2NUC A;  2NVQ B;  2IW3 A;  1STE A;  5CYU A;  4KJN A;  3MVV A;  4K8J A;  2SNM A;  5ELF A;  5CGK A;  2WB1 B;  4G7Z C;  3ZYY X;  1FGB D;  1DYQ A;  3T13 A;  3NWS A;  5E1F A;  4LAA A;  4A3K B;  2QDB A;  5A2Q E;  3GD7 A;  1CK1 A;  1EY0 A;  1SNM A;  3MXN A;  5IT9 L;  3RUZ A;  3IFT A;  1AZQ A;  5BN4 A;  3SE0 A;  4LJZ C;  4HSP A;  2VUM B;  1KDC A;  3QJY A;  2KUM A;  2EYH A;  3S9W A;  3P7J A;  1MGS A;  3IL8 A;  1JIC A;  1IW7 C;  2RKS A;  4XTC S;  5HUR A;  1K8O A;  1PRT D;  1ZEQ X;  1FR3 A;  5CBA E;  5TSS A;  4RA8 A;  2EVB A;  4K2K A;  1STA A;  1EQV A;  1Q90 A;  2XNA C;  4UAI A;  3S1N B;  3HOY B;  2EYL A;  5ELD A;  4XQN A;  1PMR A;  4XIG S;  2IJ0 A;  5D3D A;  5JOB A;  5BN3 A;  4HCE A;  5ELE A;  4XDX A;  1Q1E A;  5I6W A;  3URY A;  5C0X H;  5KRU A;  5M5W B;  2AUK A;  1TWC B;  1I4X A;  1R9T B;  1CHP D;  4RWS C;  4O1N A;  4RCO A;  4BY7 B;  3RMH A;  2AUJ D;  3I3C A;  3VYU A;  2KHS A;  4J6H A;  3A8K E;  2G9D A;  3R8B A;  3H6M A;  1W6J A;  1EY5 A;  3EVQ A;  2IL8 A;  3OWF A;  3PUX A;  3BVM A;  4FF3 A;  2XN9 C;  3P1H A;  3OWE B;  4KI0 A;  3K58 A;  3J7A F;  3S2D B;  1DXM A;  2NVY B;  3J81 L;  4IFD H;  5T1I A;  2F0N A;  2K7V A;  5C0X J;  1G2S A;  5DEH A;  3RLF A;  2RSN A;  1E2W A;  3TZD A;  2K28 A;  2F3W A;  2FJ2 A;  2QKI C;  3NUC A;  1PDQ A;  4X3T A;  2EOT A;  3VR3 A;  3FPU B;  3HOW B;  4K5X A;  2Q8R E;  3M7G A;  4XQQ A;  1O78 A;  1CTM A;  4H13 C;  1LTA D;  1I4G A;  1J9O A;  4ID6 A;  1TWG B;  2HCI A;  1WTO A;  1NUC A;  2BE5 D;  4TQU S;  5EPJ A;  4PMC A;  4KKS A;  1Y8O B;  4C3H G;  3NE5 B;  2OXP A;  1MSG A;  5KGU A;  2H4O A;  5KYI A;  3S17 B;  5FK9 C;  2R92 B;  3I73 A;  2B2W C;  4G7H C;  2NVX B;  4B9X A;  3C46 A;  3NBH A;  2IX1 A;  3Q23 A;  1B2T A;  4C1N I;  1EZ8 A;  3SVM A;  3FKI B;  3NTK A;  1EIG A;  4Y7N B;  1I4R A;  1VMC A;  4CKE A;  4H7B A;  4KK7 A;  1A3V A;  5EKK A;  1SYB A;  3SEB A;  2L0C A;  2BA0 A;  1C48 A;  1K83 B;  1WTP A;  3QWN A;  4PMW A;  4CBV A;  4IN3 A;  4RGN A;  2A69 D;  1A15 A;  4RCN A;  2RA4 A;  3P75 A;  3HOV B;  5D14 A;  3M85 A;  2EYP A;  1AN8 A;  3OIP A;  4A3D B;  1Z6H A;  3VA5 A;  4N9T A;  1BF4 A;  1O7L A;  3GTO B;  2Z8L A;  3X3M A;  1GUO A;  4B08 A;  1PRT C;  1STY A;  5LHY 1;  1B44 D;  1H9M A;  4DK1 A;  2VB2 X;  1SE3 A;  5ELC A;  2F0H A;  5I6Y A;  5FOB B;  3KBG A;  2NB0 A;  1ZYR D;  1RF2 D;  2K03 A;  2DY8 A;  5JAV A;  2B2T A;  1NR4 A;  1MSH A;  1QIL A;  3D3R A;  5JEA G;  3ITP A;  4YIJ A;  1EY6 A;  1KAB A;  1Y8P B;  5IOD A;  1I6H B;  1IL8 A;  2EY5 A;  4BY1 B;  5CV4 A;  2ICI A;  4XYO A;  2K33 A;  2JSO A;  1LT4 D;  4FO2 A;  3CRK C;  1XYI A;  4F8M A;  4IUP A;  3WOE A;  1QE6 A;  2QCP X;  2PZT A;  2MP1 A;  1CI3 M;  1PFM A;  1SJH D;  1TQO A;  4V0B A;  2L4N A;  5FKA C;  5C3E B;  1Y8N B;  5JPM C;  4ZQ3 A;  3GO5 A;  4RHR A;  5CV5 A;  1II3 A;  3LWE A;  1JOK A;  2A69 C;  4R8I A;  2RDG A;  3G7L A;  4EQN A;  5A2Q L;  4K5V A;  4FP5 D;  4DAV A;  2ENB A;  4QMG A;  4BA2 I;  2MUY A;  3A7L A;  3D8G A;  5K36 H;  4K6D A;  1LO5 D;  3T51 B;  2F0D A;  5JJZ A;  5IGE A;  2BE5 C;  3K5O A;  3R2I A;  1PLF A;  1XX8 A;  4A3F B;  3MWY W;  3HS0 C;  3DEO A;  2WKD A;  4MN3 A;  1B9M A;  3S1M B;  1RDP D;  3JAM E;  3A7A B;  3ERQ A;  4QUC A;  2CHB D;  4F88 A;  4GZY C;  4V19 0;  1HRJ A;  3BDL A;  1B50 A;  2SDF A;  3N6R A;  3TN2 A;  1FYC A;  5M5Y B;  4BA1 I;  2EPB A;  2R3Z A;  2G9H D;  4DNR B;  2JE6 I;  2WP8 J;  1LAB A;  4ODG A;  1SXT A;  4BBS B;  5ELB A;  1BCP B;  1GOZ A;  4L6T B;  3JAM L;  3PUV A;  2NTS A;  4DA2 A;  1EYA A;  2RQX A;  2O4X A;  4ZKC B;  1QWY A;  1EOT A;  5JVH 3;  5C3X A;  4PQX A;  3I90 A;  4BBR B;  4LMQ D;  3QIA A;  1C4Q A;  4IUN A;  4QCL A;  1I4H A;  1Z7T A;  3OMG A;  2NWG A;  3H91 A;  3NWT A;  3PMF A;  2EYF A;  1AW7 A;  4HED A;  1WTQ A;  4PNY A;  1JOR A;  3H94 A;  1AFP A;  1NAP A;  3AU7 A;  1MI2 A;  3A56 A;  4X3U A;  5C4X B;  1U4M A;  1M8A A;  4M8A A;  3M7N A;  2M00 A;  1F9P A;  3J81 E;  4DF7 A;  4C2M B;  2LMC B;  1H9J A;  1TWA B;  2K32 A;  3I4L A;  1XWE A;  4H0L C;  4C3J G;  1JWM D;  2EYO A;  2CW0 D;  4MHE A;  3KF8 A;  1CQV A;  1EWH A;  1G8Z D;  2D5D A;  2I46 A;  1G6Z A;  2A74 C;  4IAL A;  1ENF A;  2B2V C;  4OO1 H;  1OO9 B;  3MFY A;  2WAQ B;  2C9O A;  2R61 A;  3BYY B;  2F3V A;  3CRL C;  2E2D C;  1CZW A;  2WV6 D;  4U68 A;  3HG9 A;  3ND8 A;  4ULL A;  5C4J B;  4CJ1 B;  1KLG D;  1RTN A;  4MIU A;  5IGD A;  3KK7 A;  2OT2 A;  1Y1V B;  1QNK A;  3S16 B;  1QCB D;  2Z4I A;  1R4P B;  2A5H A;  2F0I A;  1A3T A;  4IUR A;  3S15 B;  1B4O A;  5NUC A;  1OXV A;  4A3E B;  3UI2 A;  3OW7 A;  4Q0F A;  5KYL A;  2NN6 G;  3PO2 B;  4WRD A;  3U9O A;  1HCZ A;  4A3M B;  3BYT B;  3TME A;  5IGB A;  1NCV A;  1PXU A;  1LT3 D;  1DOM A;  2B39 A;  4ZUJ A;  1SAP A;  2PO4 A;  4C1N K;  5C6A A;  1H9R A;  4I7Z C;  1S4Z A;  4TKO B;  5DM7 3;  3GTQ B;  2Z1C A;  4KD4 A;  2X6L A;  3R2T A;  1QJO A;  4ME5 A;  4CGY B;  2EE1 A;  2M9V A;  1S5E D;  1IYU A;  4O42 A;  2A68 D;  1V1P A;  3IAY A;  4ILW A;  1YNJ C;  1DZ1 A;  4BWG B;  3BS1 A;  1GUG A;  1RD9 D;  1D2B A;  3BVZ A;  2F0O A;  2E74 C;  5M3F B;  5C5M A;  1WTR A;  1DD2 A;  2E2I B;  2DN8 A;  2JA7 B;  4KTA A;  1G91 A;  4AYB B;  2R6G A;  2D2C C;  5G3L D;  1WTV A;  4C3H B;  1BNZ A;  4K14 A;  3OIQ A;  4Q5V A;  4IUU A;  3TP7 A;  1EY4 A;  2K1B A;  4ABN A;  3CQZ B;  4PMB A;  1EFI D;  5I2Y A;  4ZKB B;  2ZXR A;  2F0M A;  1JQY D;  1JWU D;  2RBM A;  1U4P A;  1O7Z A;  2AQ3 B;  2F0S A;  4IFD J;  4EQP A;  2TSS A;  2PW5 A;  1TU2 B;  1SJE D;  1H9S B;  3GP7 A;  1OXS C;  1SYE A;  3G6J B;  1Y69 U;  2WIN B;  1ET6 A;  2F0F A;  3FEW X;  1V1O A;  1RTO A;  1B9N A;  3J7A V;  1JOQ A;  4HCS A;  4J8Q A;  3SK4 A;  2LFN A;  1ILQ A;  2EYJ A;  3K6O A;  1WTW A;  3FMC A;  1GJX A;  4QIW B;  1V43 A;  3FDT A;  1STH A;  2AWO A;  2JA6 B;  5CV7 A;  1GHK A;  4IFD G;  1L0X B;  1C8C A;  2XVS A;  5EGT A;  4TSS A;  1HUN A;  4NP5 A;  4C3J B;  3OSO A;  5J1Z A;  1LV9 A;  3VR6 A;  2LKV A;  2Z4H A;  1JC7 A;  5AFW A;  3Q0A A;  3V05 A;  3ERO A;  3DMU A;  1WD0 A;  2KOL A;  1PRT B;  1EY9 A;  3HP3 A;  2AQ1 B;  2PW7 A;  1BDO A;  4M1U B;  3OOC A;  4OIJ A;  1BR9 A;  4ZUI A;  4R8N A;  3C3L A;  1SYC A;  4RFB A;  3CHB D;  1MBY A;  3D4W A;  4DAP A;  4WJW A;  2J4X A;  3Q24 A;  5BN5 A;  2B2Y A;  5LL6 X;  3BDC A;  3I4N B;  2A6E C;  1TR5 A;  3SK8 A;  2CQA A;  5KNC A;  3TP8 A;  3QO2 A;  1A2U A;  4KN4 C;  3NBI A;  1BCP C;  3PUY A;  2JA5 B;  4DN4 M;  1TWF B;  4DGZ A;  1HFN A;  4IUV A;  1CZG A;  2D9U A;  1Q1B A;  3TBI B;  2HQE A;  3HOZ B;  1F9S A;  1SYF A;  2WII B;  3DM1 A;  2B2Y C;  2EDG A;  1BBX C;  1Z47 A;  1IHZ A;  1LTG D;  1VF7 A;  5EBC A;  2MGS A;  2BA1 A;  2KCC A;  5FO7 B;  5G3L F;  2FHT A;  5CBE E;  4ZYS A;  1CM9 A;  4FVM A;  4XXE A;  2F03 A;  3EQL C;  4RKB A;  3MC0 B;  4NKL A;  3BG3 A;  3SXH A;  1PFN A;  4HSV A;  5EPL A;  1HFG A;  5IGC A;  5C0X G;  4DAY A;  3F2U A;  3VR4 A;  4JK1 C;  3S2H B;  3LWU A;  4A3B B;  1SDF A;  4FXK C;  3TP6 A;  2KJX A;  3DWA A;  1CA5 A;  3NTH A;  5IGF A;  1G29 1;  5DAU A;  3EFX D;  1OXT A;  3PIO 3;  3SR1 A;  1E2V A;  1GHJ A;  5IT9 E;  3E5S A;  3P20 A;  3DUZ A;  4RGM A;  1EZ6 A;  4U67 3;  1Y1W B;  5C3W A;  2YU9 B;  1HXY D;  1UNS A;  3J80 E;  1UAP A;  2CVR A;  4I65 A;  2KA7 A;  3T16 A;  3NTI A;  3ONA B;  1X3P A;  4RKL A;  1TS5 A;  2MHV A;  4HMI A;  2F0W A;  4A93 B;  1PTO H;  1J8I A;  1EEF D;  2OEO A;  1TS2 A;  2QIL A;  2WKC A;  1F2M A;  3VYR A;  3PIP 3;  4FF2 A;  2BOS A;  1PTO D;  2BDN A;  4QUF A;  4HTH A;  1ZKO A;  2IT1 A;  1U4R A;  5I2X A;  3K5L A;  1D5M C;  1EU4 A;  1FD7 D;  3A54 A;  5CR3 A;  1WVL A;  2K5W A;  5DNF A;  5C4H A;  4KV6 A;  3GV3 A;  3C1E A;  4DXG A;  5CV8 A;  3HKZ B;  1M4V A;  1FNV A;  1HPC A;  1JCK B;  1G2T A;  3TZU A;  3OHX C;  3H0G B;  2KED A;  1VF5 C;  5EPK A;  1AZP A;  1YNN C;  1A6X A;  1TS3 A;  3NHH A;  4LK1 C;  1BQQ T;  2KQ3 A;  1F9Q A;  4F7X A;  3GQB A;  4R9W A;  4CJ2 C;  1V1P B;  3D6C A;  4DXF A;  4DK0 A;  1PTO F;  1K8M A;  1S5D D;  4H44 C;  3WDN A;  2B2U C;  2EXZ A;  3NQI A;  5FLX L;  1ICW A;  4K2L A;  1ONL A;  1ZYR C;  3QOJ A;  2KEE A;  3PO3 B;  1KLU D;  2EZV A;  1D5Z C;  5JPN C;  3U9S A;  1L0Y B;  1I6V C;  4XT3 B;  2EY2 A;  3MAQ A;  1RHP A;  2EYM A;  2FMC A;  4KN7 C;  3GV6 A;  2GA4 B;  1PFB A;  1HHV A;  1EY7 A;  3IKJ A;  1SFO B;  3MXP A;  2NN6 H;  5KIX A;  4X3S A;  1Q8I A;  2J7Z A;  2PYK A;  1T5E A;  5FO9 B;  3VA7 A;  2HCC A;  3NQT A;  3D4R A;  1I50 B;  1TS4 A;  5C5L A;  3V2T A;  4K5W A;  2RDF A;  3N52 A;  3I91 A;  5EBD A;  2B2V A;  5C0X I;  1FNU A;  2IPK D;  2C5C A;  3A8I E;  1OXX K;  1TY0 A;  1DOK A;  2SNS A;  3A8J E;  3TSS A;  2YYZ A;  1F9R A;  1SND A;  1LTR D;  1NSN S;  5EKL A;  1MD2 D;  3R3O A;  2M2L A;  1PZJ D;  3KLS A;  4B9W A;  1ENA A;  2F0T A;  2R7Z B;  1YNN D;  3LX0 A;  2F1M A;  3OMC A;  5FLX E;  4QF4 A;  3QB3 A;  4A3I B;  1WTX A;  3I70 A;  1IYV A;  1F2Z A;  1F2Y A;  1ET9 A;  4RGT A;  1TT2 A;  2DNC A;  2MPM A;  4E6I A;  1PTO B;  2NTT A;  4KHV A;  1HTP A;  2A6E D;  4KKU A;  2XRQ D;  3K7A B;  3RD4 A;  1S5B D;  2F4I A;  3HOX B;  1X3Q A;  3M3Y B;  3QOL A;  1BCP F;  5M5X B;  5M9O A;  4P2C B;  4XT1 B;  4FF1 A;  3NP8 A;  1KTK A;  4KJO A;  1HQR D;  5E3F A;  1A3U A;  1GUT A;  2B8G A;  2AQ2 B;  4OO1 G;  2JEB I;  2IX3 A;  2K05 A;  2F0J A;  2KCN A;  1TII D;  2IX0 A;  2XWB B;  3DHQ A;  1O80 A;  3VR2 A;  1XTC D;  3BVG A;  2ZXO A;  3NSW A;  2E75 C;  2XRS D;  1WD1 A;  2HUG A;  2NZ1 D;  4OGQ C;  2IWH A;  2L11 A;  1HTL D;  3HEJ A;  2HDM A;  5I9P A;  1KDA A;  1F2L A;  2L55 A;  2VNU D;  3V96 A;  5I4D A;  1XXG A;  1B1Z A;  3VYS A;  3IFD A;  4RAU C;  1RJT A;  2EY1 A;  4CHT B;  3GTP B;  1AP0 A;  1ROD A;  3T53 B;  2AWN A;  3BDO A;  4KKT A;  5K5P A;  4UDU C;  3MXG A;  5FO8 B;  4RGO S;  4G7O C;  1TKW B;  4FNF A;  1JWS D;  2EJM A;  1HA6 A;  3PV0 A;  5E4X A;  1IKM A;  5CC4 A;  1DJR D;  1EU3 A;  3GTJ B;  2DY7 A;  2NBF A;  3SDZ A;  2R93 B;  3L7Z C;  1KNA A;  1SNP A;  3MHB A;  3C2P A;  4BS9 A;  3A55 A;  1JB3 A;  3PUW A;  1UUP A;  3OPO A;  4EGV A;  1EWC A;  2ZXP A;  5CV6 A;  5CMD A;  2E76 C;  4FXD A;  5E4W C;  5J22 A;  1CQF A;  1PTO C;  3NK9 A;  3I4M B;  3L3O C;  1JOO A;  1D6E C;  3ND9 A;  3RZD B;  3S1R B;  4IUT A;  4C3I G;  2JA8 B;  4ZRZ A;  5KND A;  3GTK B;  5JEA J;  1PRT F;  2CW0 C;  5C44 B;  4NDX A;  3MEH A;  1LTI D;  4IZ8 A;  3S1Q B;  3K57 A;  2F0P A;  2O5J C;  2XSC A;  2K5D A;  3HZX A;  3J7Y W;  3MZ5 A;  3BZD B;  2LS0 1;  4EVO A;  2KEC A;  3DWQ A;  3SK5 A;  1LAC A;  3RZO B;  4CKC A;  1KDB A;  3M4Y A;  4C3I B;  5EKI A;  1IKL A;  1I4P A;  3AB9 A;  3E6Z X;  3HOU B;  3NXW A;  2RVL A;  1ML0 D;  3Q6S A;  4KY6 A;  3D31 A;  1JR0 D;  1LTT D;  2E2J B;  3GTL B;  2XWJ B;  4RH6 A;  4G4K A;  1HQM C;  3CKI B;  5COY A;  1LLR D;  3K5M A;  1TVX A;  4K6L A;  2JP1 A;  4KY5 A;  2K6A A;  3VR5 A;  1H9S A;  1EIH A;  4TRD A;  5COR A;  2A6H C;  4XYQ A;  2ZT9 C;  4ZK9 B;  2NN6 I;  5KNB A;  4X3K A;  1RKN A;  1QB5 D;  1LTB D;  3K59 A;  1EY8 A;  4DU9 A;  5IOC A;  1CA6 A;  4ZLT F;  4C56 C;  2Y0S B;  3MXU A;  3C1F A;  1EL0 A;  3T56 B;  5J39 A;  2I07 B;  3E0J A;  3LNN A;  3MA2 B;  1BXT A;  4KD3 A;  1B3A A;  2F0K A;  1SE4 A;  1TWH B;  1QG7 A;  4HAE A;  1RCV D;  1SSO A;  5I9O A;  3DEP A;  3KBX A;  5F2D A;  3I8Z A;  1GUN A;  1GXD C;  1BOS A;  1QNU A;  2A68 C;  4CKB A;  3KLR A;  1D5X C;  3TP5 A;  5A35 A;  3H3V C;  3FRP B;  2X6G A;  1ENC A;  3D4D A;  3KUP A;  1I4Q A;  1TY2 A;  1CT1 D;  5K36 G;  5JEA H;  1EEI D;  1PYW D;  1B53 A;  1U4L A;  3DWP A;  4OIK A;  1SMY D;  1EQT A;  1S5C D;  1KAA A;  1DCZ A;  1CHQ D;  1O7Y A;  1LTS D;  2SEB D;  1BO0 A;  3TDQ A;  1PZK D;  2F0V A;  3GTM B;  2TMP A;  2K04 A;  2H1E A;  1SMY C;  3WOF A;  3X3N A;  5HGT A;  2B2W A;  3T4A C;  2J0T D;  2A73 B;  2F0Q A;  4N9P A;  1SBB B;  4ZAI A;  1STB A;  2O5I C;  1EYC A;  4IFD I;  2EJF C;  5LL6 S;  1SNC A;  2RSO A;  4A3J B;  1DM0 B;  1VDZ A;  2JYO A;  2VB3 X;  1JE4 A;  1SE2 A;  2NYZ D;  2XIW A;  5T1G A;  3EA6 A;  4K8I A;  2JEA I;  1UEA B;  1NR2 A;  2HDL A;  4G57 A;  2Q8I B;  3M4O B;  1GUW A;  4PV1 C;  4HR7 B;  4OL7 A;  2L5T A;  2Q8T A;  2QF7 A;  2BDO A;  1BUV T;  3O13 A;  3QG1 A;  2PCF B;  1ILP A;  2FMM A;  1KNE A;  2B2T C;  3K5N A;  1X32 A;  2D62 A;  2V4D A;  4NW2 A;  4DFA A;  4WFN 3;  2PZW A;  3EJI A;  3Q22 A;  1CFM A;  3W3A A;  5DM6 3;  5JVG 3;  2MJ8 A;  1WCM B;  2BCO A;  2QEJ C;  3HRZ C;  2FFK B;  2LY7 A;  5KEE A;  3D6W A;  3MTS A;  4OO1 I;  2K5Q A;  2PMZ B;  3W2D A;  5IIF A;  2VXW A;  1SYG A;  4EQO A;  1V8Q A;  3J80 L;  4CJ0 B;  4L63 B;  2WAC A;  4QB4 A;  1LT5 D;  1GUS A;  3NPP A;  2L12 A;  5CV9 A;  1R4Q B;  2L9H A;  1LT6 D;  2DNE A;  1Q3L A;  4J1M A;  2L1B A;  1U9R A;  3H09 A;  1H9K A;  2PNR C;  1A2T A;  1YNJ D;  2PZU A;  5ISR A;  1E2Z A;  2B63 B;  2OF1 A;  4OHJ A;  1EYD A;  4HN7 A;  2N88 A;  3CU7 A;  4FYD A;  2EY6 A;  4S3S A;  2X69 A;  1DON A;  1VCI A;  1OXU A;  3DXJ C;  2PPB C;  1SEB D;  2O2L D;  2K01 A;  4L8J A;  1ESR A;  1D1K A;  2F0E A;  1FNW A;  2F0U A;  1I3Q B;  2EJG C;  4KHZ A;  1PZI D;  2B2U A;  2RDH A;  2KVM A;  4IUQ A;  1Q12 A;  2ICE C;  1HA5 A;  4Z9C B;  4F87 A;  3VYT A;  1IW7 D;  1ESF A;  1HUM A;  1SYD A;  1DOL A;  4IQZ A;  3GTG B;  2B8F A;  1E0B A;  5EJW A;  5EQ0 A;  2F0L A;  4FF4 A;  3FVQ A;  5IGG A;  2A6H D;  1VMP A;  3K0Y A;  3FPP A;  1STN A;  4KMU C;  1SNQ A;  2F0G A;  4JBW A;  2E2H B;  1F77 A;  4KY7 A;  2NVT B;  1SNO A;  3R93 A;  3L9A X;  1AEX A;  3HGB A;  1D1I A;  2ID0 A;  2JXM B;  3SHL A;  1W6K A;  2N55 A;  1BCP D;  1S5F D;  3KLS X;  5C4Z A;  3MFG A;  4HMJ A;  5M3M B;  4NMZ A;  3PUZ A;  5D3I B;  2PQE A;  5D65 A;  1ZXT A;  1T5X D;  1QOH A;  4DNT B;  4RHS A;  2FIN B;  3S14 B;  2SOB A;  3AMU A;  4A3G B;  3SK6 A;  3I72 A;  1STG A;  4WOR A;  4FXG C;  4XQJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...