5JOBA

Crystal structure of staphylococcal nuclease variant delta+phs l25k/i92a at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKKMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYAYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L25K/I92A at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5jobA00
1STYA 2EXZA 2NUCA 4NKLA 2HQEA 4ME5A 1JOKA 4DF7A 2KHSA 4KV6A 5CV7A 4K5XA 2PQEA 3HEJA 3TP5A 1A3VA 5CGKA 3MVVA 5IGBA 2PZUA 2F0GA 3BDCA 4QF4A 4QMGA 3P1HA 3SK8A 2O4XA 4N9TA 1KAAA 4F8MA 1EZ8A 4PMCA 1EZ6A 2F0EA 3MHBA 3OMCA 4HMJA 3C1FA 3RUZA 5C3WA 2F0VA 5C3XA 5C6AA 5IIFA 5ISRA 1IHZA 3TP7A 1SNMA 4F7XA 5IODA 5C4HA 4S3SA 1EY7A 1EY0A 1TQOA 2EYJA 2EYPA 3OWFA 5CV4A 3SK4A 4YIJA 5HURA 2F0PA 2F0MA 4EVOA 1AEXA 2EY2A 4DFAA 1KDCA 3QOLA 3V2TA 5J1ZA 5KYIA 3NQTA 3D8GA 3MXPA 1F2YA 3NHHA 3TMEA 5I9PA 3NP8A 2PZWA 1EY6A 4J1MA 5KYLA 1JORA 2F3WA 1SNOA 1SYEA 2EYHA 3D4DA 4KTAA 4ODGA 1ENCA 1RKNA 3ERQA 4RKBA 5M9OA 1STAA 4H7BA 3BDLA 5C5LA 1SNCA 5EKLA 4IUNA 1A2TA 2PZTA 3C1EA 4KY6A 1SNDA 4WRDA 2F0SA 2PW7A 5IGDA 1EYCA 1EY9A 4OL7A 3VA5A 3SK5A 5KIXA 3P75A 3MEHA 3U9OA 1KABA 5I6YA 5NUCA 3PMFA 3SXHA 4KY7A 4ZQ3A 1KDAA 2F0IA 5CV5A 4ZUIA 4LAAA 3SK6A 1STHA 2EY5A 2RKSA 3NXWA 1NSNS 2OF1A 4TRDA 1U9RA 1JOQA 2SOBA 5IGEA 4KD4A 2F0JA 3EJIA 5EGTA 3E5SA 5F2DA 5K5PA 3SHLA 2EYFA 5DEHA 2OXPA 5IGCA 5KEEA 4K6DA 5I9OA 5JAVA 1SNQA 1STGA 4MIUA 2RDFA 5I6WA 5KRUA 3DMUA 3ITPA 4R8NA 2F0WA 4ZUJA 2F0DA 1JOOA 2F0QA 2SNMA 5HGTA 1EY8A 1II3A 1TR5A 2LKVA 4KD3A 4NMZA 4I65A 4IALA 4IZ8A 2ENBA 2EY1A 2M00A 5E1FA 1SYDA 4PNYA 1EYAA 1F2ZA 2SNSA 5C4ZA 3D6CA 4B9WA 4ID6A 1EY4A 2F3VA 5CV6A 3T16A 4E6IA 4EQOA 4NDXA 4KJOA 2F0FA 5DAUA 4N9PA 3LX0A 4DGZA 2F0HA 5C5MA 5IGFA 4RKLA 5CC4A 2F0OA 1EQVA 5JOBA 1F2MA 2EY6A 2KQ3A 3TP6A 3QB3A 3QOJA 1A3TA 4K2KA 1A3UA 4HMIA 3OSOA 5KGUA 4K5VA 1A2UA 3T13A 4KY5A 3R3OA 2QDBA 1SNPA 3MZ5A 4WORA 2F0LA 1NUCA 1SYBA 2WACA 3TP8A 1STNA 2F0UA 2PW5A 3HZXA 3SR1A 3D4WA 5CV8A 1ENAA 4HTHA 1EYDA 5CV9A 1SYGA 3S9WA 1KDBA 2RBMA 2F0NA 4J6HA 2EYOA 5E3FA 4K5WA 4B9XA 4DU9A 3H6MA 1STBA 4KJNA 4K8JA 1SYFA 5CR3A 4QB4A 2F0TA 2EYMA 5EKKA 2PYKA 4NP5A 5IOCA 1SYCA 3NK9A 3OMGA 4K14A 4EQNA 5IGGA 3DHQA 4G57A 4KHVA 4PMBA 4K8IA 4EQPA 2OEOA 3NUCA 2F0KA 3EROA 2EYLA 5J22A 5J39A 4K2LA 3EVQA 1EY5A 1TT2A
chains in the Genus database with same CATH superfamily
2WAQE 2HQEA 4KMUC 1JOKA 1QOHA 5C4JH 4KN4C 5I2YA 3Q6SA 3CRLC 3PF5A 1M1KC 2I07B 5IYCH 2NTTA 2PZUA 3HOXB 4TQUS 1C4QA 4DR2Q 1FJGL 4DV1L 1HRJA 4B3RL 4A3JG 4DUZQ 1ET6A 4A3IG 5M3FB 2F4IA 2KBNA 3PUZA 4KN7C 1BF4A 5FLXL 3FKIG 4RH6A 1HCZA 2J7ZA 4C3JH 4A75A 3O13A 1D1KA 2K03A 1Q8IA 1VQ5A 4LF9L 3F2BA 1STAA 2DY8A 4IJLA 1RIPA 1SNCA 1I50H 2HHHL 1ASZA 1JJ2A 2E2JH 2JA7B 1W6KA 1SRUA 5IYDG 2UU9L 2A6ED 4DK0A 3VR2A 2EJFC 3GTMB 2NTSA 1FNVA 4LWCA 4A3GH 3J80i 2NWGA 2X69A 4BA1I 3GTKB 2O2LD 2VQFL 2KOLA 4BBSB 1S5BD 1SAPA 2G9DA 1U4LA 1SNQA 5BR8L 4MIUA 1VF5C 5I6WA 4ZYSA 2LS01 1KXLA 4DR7Q 2F0WA 1S5DD 4UAIA 1IBKQ 3S15B 3IRBA 3HFZB 2GVBA 4I65A 4IZ8A 1XYIA 2VB2X 4A93G 2A68D 1BCPD 1I6HH 2NVTH 4E6IA 5C44B 2VW9A 1PZJD 1WJJA 1Y8OB 5E4XA 2UUAL 1JWSD 1PTOH 4GS3A 5JOBA 1HNXL 2JA5G 3QOJA 3T51B 4IQZA 1GHJA 5C4XG 3I4MH 4B08A 2K32A 3OTOL 3MZ5A 5FLXE 1K0RA 1BBUA 1BXTA 2UXCL 1VQCA 5CBAE 1UNSA 1KDBA 1VMPA 2B2UC 4JI4L 4QB4A 4JI5Q 2KEEA 3BZKA 3JC66 3A7AB 1XTDA 3S14B 4KHPL 5J22A 4H02A 3EROA 1IYUA 4KLKA 4DN4M 3S24A 4A3MH 1UE6A 2DJGC 4POGA 4BY1B 3HKZG 4C3JB 4IFDG 5K36H 1SE2A 4QMGA 1T9HA 1YZ6A 4JBKA 4C2MH 2O4XA 2K5VA 1EYGA 2MNAA 2JA6G 4HMJA 1NTGA 3S1NH 4YHHQ 2WKDA 1I50B 3J7A5 2QDLA 4H13C 1S5CD 4QUFA 1E3PA 3K81C 1G2SA 1CM9A 4YIJA 1ZKOA 3RR5A 2Z6KA 2J4XA 2A69D 4FVMA 2G5DA 1FNUA 5KYLA 1ASYA 4DPGA 4G7ZC 3C46A 1FYCA 1S5FD 1WD0A 1JT8A 5ELBA 1F9QA 3KLSA 1AZQA 1U4MA 3FP9A 1ILPA 2R7ZG 2F0IA 5CV5A 1CKNB 1UEAB 1VS0A 2EY5A 1Q8KA 3GTPH 3EJIA 1K83B 1L1OC 1PTOB 3C2PA 4BY7B 1HZAA 1TWGH 1E24A 1KLUD 2Z4HA 2NVYH 5IYBG 3RMHA 1VQHA 4C1NI 1FVIA 4IOAA 4OWWB 1PFMA 2EPBA 2H5XA 4L5TA 2K1BA 2EE1A 4UPAA 1VMCA 3R93A 4OXPA 1N32L 3OSOA 4JW0A 3V96A 4RGTA 4LUZA 1SNPA 1V43A 2EJMA 3K80C 1G51A 4IN3A 3CC4A 2VY3A 1STNA 5TSSA 4A3MB 1YI2A 2PW5A 4RCOA 2ZM6Q 5JJIA 5CV8A 4RA8A 1N36L 1MJCA 4C3HB 1RCVD 1GOZA 2IPKD 4DU9A 3TS2A 4UY8C 3A54A 1XPOA 1J6QA 1PH2A 3M4OH 3MAQA 1IXRA 3S1NB 3JAME 2LY7A 5IGGA 1PVOA 4LFCQ 2B63G 1WCMG 3DEOA 2YU9B 3EVQA 4LFBQ 1K0SA 5ELNA 4V0BA 1QVFA 1I4GA 1PMRA 3K6OA 3H94A 3FDTA 2Q2IA 1GD7A 5EJWA 2HIVA 2F0GA 1QVCA 3EN2A 4HIKA 3T1HQ 1XMOQ 1EZ6A 3TP7A 1WTQA 2QCPX 1YITA 2LSSA 2I0QA 1QNUA 3AB9A 3ZYYX 3G48A 1CZWA 3BVGA 4A3KH 1LUZA 2EY2A 5D14A 2Q2TA 3MC0B 3F1ZA 2JA8B 3LWUA 3K0XA 3FHWA 4K0KL 1Q81C 2XRQD 1ENCA 1Q1EA 4H7BA 1TWGB 1ESRA 4KY6A 4HIMA 2EQSA 1TS4A 2B2VA 1AE2A 3NBHA 3TEHB 4OL7A 1B44D 2JQOA 2FMMA 2RCNA 1IKLA 4DR1L 1BNZA 4A3JB 1HJPA 4LAAA 4A3IB 1Y1VH 3TRZA 2F0JA 1C7YA 4LFAL 5DEHA 1E1OA 3UDIA 1EIFA 1I94L 3BU2A 3FKIB 4OHJA 3DMUA 1KQSA 1MSHA 3ITPA 1PH6A 4WJ4A 1AW7A 2E2HB 3A56A 1PH4A 4JOIA 1W6JA 1EOVA 1PTOF 3E3XA 2EIFA 4DK1A 4WJ3M 2PNHA 4A3FG 1PH5A 1L0YB 2KEDA 1E0BA 1STEA 1DONA 1LTLA 3I91A 4ID6A 3GTJH 1VQ4A 1SXTA 3H3VH 4JI7Q 2NVXH 4DR6Q 2NB0A 1BBXC 3HG9A 2DNCA 1ENFA 4BA2I 2C5CA 1GUGA 5CC4A 1V8QA 3GTLB 1GXDC 4DAMA 3W1BA 1RHPA 4ABNA 1SYBA 4HCSA 1PDQA 4L5RC 1Q86C 4DAVA 2IY5B 4FXDA 1LV9A 1EYDA 4IO9A 4ZLTF 4X62L 1TWCH 2XVSA 3G6EA 4G7OC 4K8JA 1NR2A 1TWFB 4JPBW 4IFDI 3D31A 2BH8A 2PYKA 1AZPA 3NK9A 1B70B 1DOLA 3OMGA 2EYLA 1VQIA 1WFQA 2JA5B 3U58A 4KHPQ 1EQRA 4DAPA 5C4XB 4GN5A 2R93G 2I5MX 4GLVB 2AKWB 1Y69U 5G3LD 4YWLA 4TVAB 4BS9A 5JJZA 1I4HA 3PIP3 5IT9c 5C6AA 5C3WA 2Z9HA 1K8MA 2C35B 2PI2A 1EU3A 5J3BA 2PO4A 3CRKC 3UDGA 2YTYA 1QILA 1SMYC 1HNZQ 4ZRZA 1WOCA 4OIKA 3JAMi 2O5JC 2XNAC 4DR2L 2LXJA 1HA5A 4KTAA 1DZ1A 1RKNA 2ZTDA 3A74A 2E75C 4MNOA 2CWAA 2JP1A 3KLSX 4IUNA 1WTOA 2ASBA 2PZTA 4DUZL 3I2ZA 4OONA 2NZOA 1LT5D 2JA6B 1LTAD 5EAYA 2D5DA 1BO0A 4ZQ3A 3CC2A 3PIO3 1HH2P 1WCMH 3GTJB 2NVXB 3A7LA 3UDFA 3M4QA 1L0WA 2N78A 4YWMA 4A3EG 5JAVA 3J7AV 3S2DB 4FF2A 4DNTB 5AJ3Q 2CH4A 1BBWA 1MSGA 5EBDA 4JI8Q 1I4PA 2N8NA 2QA4A 2M2LA 4OX9Q 2AQ1B 2M00A 1T5EA 1IBMQ 2KHIA 2ZXOA 3ERSX 4DV2Q 3DWPA 2R7ZB 2A8VA 2EVBA 4KKUA 1FGUA 1HTLD 2K75A 3B6YA 2X6GA 3L7ZC 1R9TH 1C0AA 2CWPA 3T13A 3G71A 4DR7L 1PH7A 1KC8C 1IBKL 3A8IE 2WKCA 1QUQB 2WINB 2J0TD 3HZXA 3IKJA 3AEVA 1AH9A 1CHPD 2B2TA 2K5QA 1BKBA 2N88A 3FMCA 4DV7Q 2QKIC 5BN3A 2KCTA 2RHQB 4K5WA 3S1QH 3EQLC 1IBLQ 3AMUA 3G4SA 4RCNA 4A3LH 1Z9FA 4AQYL 2PI2E 3J81L 4LMQD 3I8ZA 4N8X1 3PO3G 1RODA 4IPHA 3AU7A 2VQEQ 4Z9CB 5D65A 2ZTEA 3W5OA 4XQQA 4HJAA 2JEBI 5LHY1 3P1HA 1DGSA 2G9HD 5JEAG 4JI5L 1V1QA 1X3QA 5C4HA 1PH3A 5I9OA 1TQOA 1Y14B 1VQGA 4MTNA 1Q7YC 2Y0SE 1O7ZA 5M5WH 2K52A 1SLJA 1HFGA 3QOLA 1I4QA 1JWMD 2L1BA 1WCMB 2B63B 3MXPA 1F2YA 3GTOH 1K8GA 2HIXA 1SFOH 2L12A 2VNUD 3KDFA 3A55A 5M9OA 2OQKA 4UDUC 4CGYB 5C5LA 4YHHL 1XPRA 3RZDH 4IOCA 1SNDA 3VR6A 3EBEA 3K7UC 3MFYA 3VDYA 1D5MC 5ELDA 2IX0A 4A3BH 5T1GA 1EL0A 3NXWA 2I46A 1O7IA 4C56C 2LMCB 4HR7B 2B8GA 3J81E 2K28A 3MFGA 2R93H 4YCVA 2RDFA 1M8AA 1L2FA 3DWQA 1WD1A 2ATWA 1CUKA 3RZOB 3M3YB 3IFTA 5HGTA 3KDFB 1QG7A 2K5DA 2HDMA 1A8VA 5E1FA 4GN4B 1SYDA 2RDGA 2O5IC 2SNSA 5M3FH 3S1QB 4YY3Q 4IURA 2FJ2A 5EQ0A 1TKWB 1SBBB 3TP6A 1ET9A 2NN6I 2R6GA 4K2KA 3MXGA 3TREA 4XIGS 2TMPA 2ZJQA 3D4WA 1ENAA 4UP8A 3FVQA 2ZTCA 4XYQA 2JA7H 4RG1A 5E4WC 1G6ZA 2EYOA 4JI2Q 4A3FB 3GTMH 2K14A 5IP9G 3SDZA 3GTKH 1UEBA 2N55A 5EPKA 1HPCA 2CVRA 3ULPA 4BBSH 2NUCA 1TXYA 2B3GA 2ZM6L 1QE6A 4PG3A 1RDPD 1CKMA 4IJHA 2EXDA 3IAYA 5I4DA 1SFOB 3H91A 2L15A 5L37A 5C44H 5ISRA 4P71A 3RZDB 3D6WA 4LFCL 4A3CH 1IZ6A 3UE0A 2OQ0A 2F0MA 4NB3A 2L0CA 1PH8A 1FL0A 3LWEA 1PRTB 1G8ZD 3D8GA 1E2ZA 3V05A 1CZGA 4LW1A 3K5LA 4QUCA 1C9OA 2PZWA 4X66Q 3FEWX 2PMZE 1D6EC 3CKIB 2F3WA 1RL2A 3I90A 4RHRA 3T1HL 1XMOL 3J80c 2VL6A 5IY0A 4JI6Q 2R93B 2UXBQ 5JPMC 2F0SA 1FNWA 3PUYA 1S40A 1TY0A 3S14H 2A74C 5JVH3 5LMNW 1B2TA 1PYBA 3GDEA 3Q0AA 1C48A 4BY1H 5FOBB 1B7YB 4MN3A 4MTKA 3S17B 3KK7A 2F0QA 3GD7A 1LACA 1II3A 4A3DG 3KLRA 1QNKA 1F2ZA 1PTOC 1XX8A 2B29A 2Z6KC 3ND9A 3AFQA 2DNEA 4HAEA 1OXVA 2KJXA 1T5XD 1X32A 2F0HA 2GN5A 3SE0A 3ULLA 5JPNC 4P2CB 3FRPB 4L6TB 3J81i 4JCVE 3D3RA 4ZKCB 2OT2A 1TU2B 3SR1A 1BCPB 2MFIA 2FMCA 1KLGD 2JN4A 1HZBA 1JICA 2D0OA 1NMGA 2RBMA 4QIWB 4UP9A 1CA6A 4JI7L 4DR6L 2VXWA 3KYHC 4XXEA 2LXKA 4CBVA 4DA2A 1E2VA 2FINB 2IHEA 2IW3A 2N49A 3FPPA 3K8AA 1K83H 1KRTA 1TWHB 1JE4A 3HOVG 3P7JA 4BY7H 3Q23A 3NE5B 4O42A 4AQYQ 1QZHA 1LT4D 2NVQH 2OTJA 1VQFA 4KV6A 2K4KA 3TP5A 1I4RA 1OXTA 5GROA 5CGKA 2F03A 2HDLA 1EOTA 2CQOA 4GLAC 4PZ6A 4ALPA 4PMCA 1GUNA 3GP7A 1Q46A 3ER0A 3MHBA 3OMCA 1M4VA 4OO1G 3HOYG 5ELEA 3J7ZC 5CV4A 1OTCA 5HURA 3A5UA 4O1NA 1HR0W 5EPLA 2RF4A 3PO3B 1EIYB 2OWOA 1Z7TA 4EGVA 1I3QB 3IL8A 3SGIA 1O7LA 2EYHA 4C3HH 3HOWG 2IJ0A 4FXKC 1O80A 3BDLA 3K5OA 1PRTF 2KVMA 2B2YA 1TS5A 1WVLA 1J5EQ 2XRSD 4XQNA 2KECA 1CKNA 4P75A 1G6PA 3OWEB 3IFDA 3I70A 4NXMQ 1F77A 3STBC 1HNZL 2YU9H 3S1MB 4HSVA 1SMXA 2ZXRA 1JOQA 4KD4A 4F88A 1NR4A 1VQMA 2C9OA 1K3RA 3T1YQ 2CHBD 1VCIA 2WP8J 1WYDA 5T1IA 2FHTA 2V1CC 2QF7A 4QGUA 4DR5Q 4PQXA 3DUZA 2F3VA 3KFUA 1DJRD 3JAML 2JA8H 1UWVA 3NWSA 5AJ3L 4DV5Q 4J15A 3BYTB 5FO9B 1K3BC 1X3PA 4JI8L 5M3MG 4NPSA 4OX9L 2B2VC 2NVQB 2K7VA 2KA7A 1JCKB 1DM0B 1MHWC 2DY7A 3D4RA 1IBML 4DV2L 4A3JH 4KJNA 1FR3A 1HA6A 4A3IH 4JBWA 4PZ8A 1PXUA 4CDEC 5FLMG 1BCPF 1V1OA 4EQNA 5FLXc 2OEOA 3K58A 1HFNA 4FF4A 1TT2A 3FKIH 2EXZA 3PUWA 2MPMA 3BVMA 4RGMA 5LL6X 3DM1A 1QJOA 4JOIC 1PTOD 1XMQQ 4XQJA 2E2HH 4DV7L 3A5ZB 1WTHA 4QF4A 3K7AB 1U0LA 3CMAA 1IBLL 4JBMA 2EZVA 1EZ8A 3N6RA 4HIOA 3C1FA 1SE4A 4BWGB 1GUTA 5HGQA 5IYDH 3BDOA 4RWSC 5ELCA 4DUYL 3PO2G 1L0XB 4L63B 1EWCA 3GTLH 3M7NA 4JI3Q 4Y7NH 1Q82C 2VQEL 4FYDA 3NEMA 1N33Q 2AUKA 4JC0A 4U68A 3GV3A 1HUNA 1SN8A 4EX5A 3NTHA 1A0IA 3MA2B 4JI1L 4A93H 1GUSA 3URYA 5GAGC 4GOPA 1TWFH 4U673 2RSOA 3PUXA 4FDBA 3PGZA 4DV4Q 5KNCA 3PIPA 1VQLA 1HNWL 5C0XG 3ZJYC 1OXUA 2RCFA 3OW7A 1QZGA 5EPJA 2JA5H 1LTID 5F2DA 3NQIA 5C4XH 4DR3L 3TBIB 2EYFA 4XTCS 4HJ8A 1PLFA 1A62A 4OEMB 4PZ7A 1UUPA 1D7QA 4POFA 3MEFA 2D2CC 3H3VC 4RAUC 1WTWA 3CCUA 4PNYA 1EYAA 4QL5A 4G4KA 4P73A 1JB7A 4L8JA 5JJKA 4X65Q 1ZYRC 1DOMA 3T16A 4NDXA 1DCZA 4GOPB 1TWAB 2R7DA 1MGSA 5C5MA 4RKLA 3I4NG 3J7YW 2RSNA 2XWBB 2WV6D 4LF6Q 1EIHA 1YNXA 1BQQT 4NXNQ 2Z8LA 3BYYB 3PIOA 1K8OA 1HTPA 1N34Q 2PQAA 4IFDH 3I72A 2UXDQ 3PQIA 4OGQC 2KHJA 3M85A 1VQ6A 2NZ1D 4TSSA 1EWIA 4HTHA 3STBD 2F4VQ 3Q8DA 2JA6H 2RVLA 5E3FA 1CKOA 1VQEA 4A3DB 4C1NK 4YY3L 3HS0C 3NSWA 3ULJA 4AYBG 4Y52H 1D2BA 3GV6A 1X65A 2JYOA 3UE1A 4KHVA 1BUVT 1WTXA 2WAQG 2E2IB 4AH6A 1MBYA 4OO1I 3S2DH 4Y7NB 4ME5A 2KHSA 4CHTB 4IUUA 1B53A 3MVVA 1NJIC 5IGBA 2CKZB 4JI2L 2PQAB 3E9HA 3CCRA 3H0GG 3T53B 5JVG3 1LABA 3C3LA 2NN6G 5IIFA 3JAMc 2IL8A 3TSSA 3PCOB 3DWAA 4A93B 2R7ZH 1CI3M 1HQMC 3W1GA 3SEBA 2Z1CA 2L11A 1YVCA 1CK1A 2VUMG 3GTQH 5KYIA 2Z4IA 4LNQA 2B2TC 2EJGC 2ZJPA 1E1TA 1BDOA 3I56A 1SNOA 4IUQA 5IYBH 4C3IG 2R92G 2YTVA 3UI2A 1A2TA 1RF2D 2SEBD 2IX3A 1DD2A 2I5HA 2A5HA 2CCZA 1TVXA 2L9HA 1Q3LA 1X6OA 3PMFA 3HOYB 4JI0Q 1KDAA 1VQAA 4LJZC 1ESFA 3DLLA 4GKKQ 2DGYA 1G2TA 4X66L 4K6DA 1STGA 4JI6L 5KRUA 2UXBL 3HOXG 3A0JA 2K01A 1HXYD 2JEAI 3HKZB 2SNMA 3HOWB 1JB3A 3M9BA 4CDDC 5CBEE 3D6CA 2HD3A 5COYA 4KJOA 3W3AA 1KTKA 3QR8A 4O0AA 3PUVA 2B63H 4B9XA 2R7FA 1O7YA 5KNDA 3OW2A 1QUQA 2H1EA 3CCQA 1Y1WG 1DOKA 5FKAC 1HQRD 2JXMB 1D8LA 1JE5A 3MXNB 4GKJQ 5DNFA 2Q8IB 4BXXG 1OXXK 4B3TQ 3HOUG 3HRZC 1UAPA 3NTKA 4DV6Q 2DJFC 3S1RB 5EKKA 5AFWA 4BBRG 3K5NA 4K14A 3QJYA 1NMFA 5J39A 3A8KE 4IFDJ 1AFPA 2M9VA 2SDFA 1GJXA 1LM0A 3GTQB 4JG2A 3RZOH 2PQEA 3M3YH 1JWUD 1ZYRD 3RN2A 5M3MB 1RTOA 3HKZE 4EQ5A 4F8MA 1H9JA 3RUZA 5IP7G 4JV5Q 4CJ1B 2XSCA 3SK4A 1I6VC 1XWEA 2YV5A 3BZCA 5CORA 5FJ8G 5C3EG 4DUYQ 1H9SB 3HP3A 1CT1D 4CDFC 1EWHA 1O78A 2RHSB 5GAEC 1CFMA 5C0XI 1SYEA 2MO1A 3CD6A 3CU7A 5IYCG 2BA0A 3C1EA 3K57A 1B50A 4A3FH 1J8IA 3M4YA 5G3LF 1PRTC 3RLNA 3EIVA 1QCBD 3OOCA 5I6YA 4JI1Q 1IL2A 1P8LA 3QWNA 2UUCQ 1CQFA 2F3IA 1STHA 1NSNS 1YNNC 3E0EA 2N3SA 1HNWQ 3BG3A 1ICWA 4LUVA 2WFWA 3K0YA 2OXPA 1LTGD 3BZDB 3S16B 3NBIA 5HY6A 4DR3Q 1KNAA 1NAPA 3H0GH 1IYJB 2F0DA 3KF6B 2K04A 1J5EL 1EY8A 1GHKA 4NXML 1ZXTA 4B9WA 5CV6A 2E5LQ 4GZYC 2K50A 2MJ8A 2QILA 4EQOA 2F0FA 3UDXA 1U4RA 3GQBA 2DN8A 5DLQE 4GNXA 2K05A 2PPBC 4FP5D 4A3GG 1JC7A 1A3TA 3T1YL 1X9NA 4R4OA 4HJ9A 2D62A 4WORA 4DK6C 2F0UA 2B2WA 2IWHA 1XNRQ 2FFKB 4DR5L 4DV0Q 4B3SQ 1HZCA 3VYSA 3W2DA 3H15A 1SMYD 1PZID 4R1JA 2F0TA 1W3SA 4CKEA 4NP5A 1X3FA 1SYCA 1VQOA 1GVPA 4DV5L 4JK1C 3I4NB 3CXCA 2X6LA 4K2LA 3U4VA 5I9PA 3K5MA 4GNXB 1YJWA 4DF7A 3I4MG 3S17H 3OYYA 4RMFA 1D1IA 1XNQQ 1S4ZA 1S3OA 3CCVA 1SROA 2AQ2B 5FO7B 3PV0A 2BDNA 1A6XA 4RGOS 1KAAA 3KBGA 1H95A 2AWNA 3NPPA 2F1MA 1D5ZC 5ELOA 2HQLA 3NENA 2Q2HA 4S3SA 2XTIA 5A35A 4AYBB 5A2QL 4HN7A 4QJFA 4DFAA 1XMQL 4A3EH 2WAQB 1QB5D 4A3MG 4O2DA 1EY6A 4RKBA 2A1AA 5K36G 1SJHD 3HOUH 2VZAA 1SE3A 3H0GB 4P72A 5LL6S 1EYCA 1TS2A 3VYTA 5I2XA 5KIXA 1KABA 4JI3L 4V190 1SJED 1TWHH 1N33L 1S72A 1V1PA 2E76C 1B9NA 3OIQA 1GO3E 1PZKD 4H44C 1R4QB 1LTTD 1ICFB 2AMCB 3WOFA 1NE3A 1DXMA 4C3IB 2NYZD 2R92B 3VA5A 1PH9A 4DV4L 2PNRC 4FXGC 5C4ZA 2K5HA 5H1SE 3NELA 3HGBA 1A63A 3J81c 4QCLA 3QIAA 4N9PA 1LO5D 3R8BA 5EBCA 5LMNQ 2F0OA 1EQVA 3PO3H 2EY6A 5A2QE 2H4OA 1VDZA 1I3QH 5M5XH 4KY5A 1V1PB 3L3OC 1PRTD 3CPWA 2QW7A 1KD1C 2B2YC 1YHAA 3DM3A 1XTCD 5JEAH 1SEBD 1YNND 4X65L 3S9WA 4Q0FA 4R4TA 1VQPA 1IYVA 2K5WA 4DKAC 2JA9A 1ILQA 1CSPA 1HZ9A 3S1MH 5IOCA 4LF6L 1XJVA 4NXNL 4G57A 5BN5A 3NUCA 1YHBA 2F0KA 3VA7A 4IPCA 1N34L 4NKLA 3KBXA 4A4IA 2UXDL 3CW2C 1K8AC 3Q24A 1PYWD 2YYZA 5CV7A 2F4VL 4A3EB 1Y1WB 3AFPA 1R4PB 4ZK9B 3L2PA 1KIXA 2ALYB 2KCCA 3HOUB 3TZDA 1EY0A 2DUDA 4DV3Q 3VYRA 2HCCA 1QVGA 4BBRB 2HT1A 4HJ7A 1YNJC 1GKHA 1EUJA 3NP8A 3DXJC 4ODGA 4WFN3 3ERQA 2E74C 4KHZA 2CH4W 4YWKA 1KNEA 2K5NA 3KOJA 2PW7A 4UP7A 3NWTA 4R4IA 1WI5A 1D5XC 3SXHA 1TIID 1HUMA 4X3SA 2UUBQ 1U9RA 2D0PA 5LMUQ 5C3EB 3NTIA 2NBFA 3I55A 4A3KG 1HR0Q 4KKSA 4ULLA 4X3KA 4LK1C 1OO9B 3M4PA 5M5XB 5C4JB 1OXSC 3ICEA 3K7AH 3L9AX 2RQXA 1CSQA 1PFNA 1WTVA 3RN5A 2BH2A 4R4CA 4CKCA 1YIJA 2JSOA 2MP1A 4JI0L 4DAYA 4QIWE 1LLRD 3HKSA 4Q5VA 1U5KA 5CYUA 2ICIA 1VQ8A 2XGTA 5IP9H 5DAUA 4GKKL 1F9PA 1Y1VG 2CQAA 1F2MA 3CCEA 2K33A 4X64Q 5KGUA 2ID0A 2IX1A 3OHXC 1KAWA 1NUCA 1SE8A 1YBYA 2F52A 1G91A 4GOPC 3E6ZX 1NNXA 4DK3C 4DNRB 2CFMA 1YJ9A 4YCWA 1VQDA 4LF8Q 4RFBA 5CR3A 1EEFD 2L4NA 2E2JB 1I4XA 4DAYB 2AWOA 1VQJA 1B3AA 3DHQA 4K8IA 4L5SA 4A3GB 3I73A 5DM73 4LF5Q 3PF4A 2WB1G 4L5QA 5JEAJ 4GKJL 2R3ZA 1X3GA 3U50C 4B3TL 3M7GA 4B3MQ 4N9TA 4DV6L 2F0EA 5C3XA 1GUOA 1IHZA 1TWAH 2Y0SG 3CPFA 1I6HB 2EYPA 1ONLA 2NVTB 5IWAQ 4DR4Q 1TY2A 2EDGA 3SVMA 1KDCA 3V2TA 4IUPA 1Q90A 1E2WA 5E7NA 1CQVA 3I4MB 1ZEQX 4J1MA 4J8QA 1K9MC 4JV5L 3BJUA 4A3DH 1SR3A 4I7AA 4MHEA 2HUGA 1VQNA 1EY9A 3I4OA 2WIIB 3SK5A 5IT9L 3BVZA 1B4OA 5NUCA 4KY7A 4IPDA 4ZUIA 3D0FA 2E2IH 4GLXA 4ZAIA 2B2UA 2OF1A 2SOBA 1Y8NB 2TSSA 2AHOB 3E5SA 3TN2A 3SHLA 4JBJA 5IGCA 5KEEA 2BE5C 3TDQA 3AQQA 3N52A 1PA6A 1IL8A 2LKVA 4IALA 2A73B 3Q22A 2EY1A 2UUCL 4C2MB 1V9PA 1YJNA 1YNJD 4LF4Q 1VQBA 1UE5A 4FF3A 3HOVH 1CTMA 1LTBD 1A3UA 1G291 1EQQA 4JYAQ 3I3CA 3R3OA 4LF7Q 2GA4B 1P16A 3TP8A 5FK9C 2L5TA 2RDHA 1PHJA 3ONAB 3VR4A 5CV9A 4N8FA 2E5LL 2F0NA 4OO1H 3HOYH 2YTXA 4X3TA 1E7ZA 1FJGQ 2CW0C 1N9WA 4CJ2C 4DV1Q 2KENA 2P5ZX 5IT9E 4B3RQ 3PSIA 3J7AF 2VS1A 4PMWA 1K73C 4J6HA 1NY4A 1EY5A 1STYA 1H9RA 3GTPB 2XIWA 1XNRL 2FXQA 4K5XA 4DV0L 4B3SL 3CHBD 1IW7C 2JJQA 1BR9A 1L1OA 3HOWH 4HIDA 2B39A 4GN3B 2E2DC 1YHQA 4AIMA 2NVYB 2V4DA 4LF9Q 1WTPA 2HHHQ 2F0VA 1E22A 2R61A 4IUVA 1SNMA 2I5LX 4F7XA 5IODA 3KLWA 1EY7A 1JJCB 2EYJA 1EFID 4A3LG 3S2HH 1X56A 2UU9Q 2Q8TA 4DNIA 2ZXPA 5J1ZA 3CQZH 1H9KA 1XNQL 1XPUA 1Q1BA 1NBWA 1BOSA 2VQFQ 3D4DA 5IGEA 5BR8Q 5EKLA 3GTGH 2MQHA 3QG1A 1L1OB 3KJPA 2JK8A 3S1RH 2AQ3B 4HJ5A 1S5ED 4X3UA 3NBHB 1QWYA 3ND8A 3M4OB 3OIPA 1DYQA 3G7LA 3CCJA 2KCMA 4UHVA 3TZUA 2UUAQ 1X54A 4ZKBB 3HOVB 4QY7A 2BDOA 1HNXQ 1SSOA 5M3MH 3FPUB 4XDXA 3OTOQ 3CCLA 4IPGA 1JOOA 1HHVA 2UXCQ 4NMZA 4FF1A 2ENBA 5FLMH 2B8FA 5M5YH 4A3BG 1PV4A 3LX0A 1MJEA 3HOZG 1RTNA 2ICEC 4JI4Q 5IGFA 1LT6D 3I7FA 3E9IA 3QB3A 4HMIA 3CF5A 1C8CA 4A3KB 1LYLA 5KNBA 3H3VI 3MXNA 3H09A 3KUPA 1SYGA 4H0LC 3F8TA 3PO2H 3H6MA 4LUOA 4R9WA 1RD9D 2BE5D 5M3FG 3VYUA 5LMNL 2QEXA 2Q2UA 2D9UA 1B1ZA 3TQYA 1UE1A 1AN8A 2A6HC 4A76A 1Y1VB 3S2HB 3I4LA 3S16H 4R4QA 1MD2D 4DXGA 1PH1A 4XYOA 5D3IB 1A15A 1EEID 4ZCKA 3HEJA 1W2BA 1A3VA 1F9RA 3CQZB 1UE7A 3U4ZA 5IE8A 2RA4A 4ME3A 1X55A 3SK8A 2JA7G 4GNXC 3GTGB 5C0XH 4KI0A 3K59A 2VB3X 3OWFA 1JR0D 1H9SA 2F0PA 3R2TA 1EQTA 1AEXA 1FGBD 1B3QA 4MZ9A 4BBSG 2B2WC 3NQTA 2WB1B 2IHFA 2K6AA 2CW0D 3F2CA 4OELB 4PV1C 4APVA 4IUTA 5BN4A 4HEDA 3RLFA 2ES2A 1B8AA 4WRDA 4DV3L 4HCEA 5C44G 1TWCB 3U9OA 4NW2A 2QEJC 2Y0SB 4K6LA 4TKOB 4A3CG 2RKSA 2BA1A 4FNFA 1IW7D 3BS1A 5EKIA 1VQKA 1H9MA 3I4NH 3LNNA 4TRDA 5M5YB 2AUJD 5EGTA 5K5PA 1U4PA 2BCOA 2MHVA 2EOTA 1VQ9A 1LT3D 2XWJB 1N32Q 1Y8PB 4HSPA 5FO8B 3KF6A 3EFXD 4OWTB 4R8NA 4DXFA 4I7ZC 3CC7A 1B9MA 4RGNA 3L0OA 3J80L 1MI2A 4JVZA 1N36Q 3CCSA 2UUBL 1F2LA 3CP0A 3VR5A 4X6AH 5LMUL 3PO2B 1EIGA 4OIJA 1HR0L 4OWXB 2XN9C 2KQ3A 1VF7A 1A2UA 2HCIA 3WWVA 3CCMA 4BY1G 2QDBA 2WB1E 3P20A 4C3JG 2F0LA 2WACA 1KL9A 3TS0A 2ZT9C 1LTSD 4RHSA 3WOEA 4QQBX 1F9SA 2NN6H 2GVAA 3RLOA 5GAHC 3X3MA 2JE6I 1RJTA 1SYFA 4KKTA 3T4AC 2EYMA 3E0JA 4X64L 5ELFA 4M8AA 1Q12A 2A19A 4EQPA 1CA5A 1BVSA 4PMBA 3MXUA 5D3DA 2VUMH 1LTRD 3SK6A 2A6EC 2E8GA 1Z47A 3F2UA 3J81j 2BOSA 5JJLA 3OPOA 5DM63 4C3IH 1PFSA 1KHIA 4FO2A 2R92H 3BDCA 3AYHB 2Z0SA 4LF8L 4K0KQ 1PFBA 4CKBA 1JQYD 1AP0A 3J80E 1X3EA 4ILWA 1NCVA 3G6JB 3RNUA 3HOZH 1SDFA 3X3NA 4LF5L 4DR1Q 4EVOA 1VQ7A 3U9SA 4M1UB 2A68C 1BCPC 4BY7G 1EU4A 3NHHA 1N8RC 2KCNA 3TMEA 1R9TB 4LFAQ 4YCUA 2QGQA 4CDCC 3HOXH 2Z6BA 4P74A 4B3ML 1JORA 3QO2A 3KF8A 1I94Q 1GUWA 1MIUA 3VR3A 5C0XJ 2A6HD 5GQOA 3CAMA 5IGDA 5IWAL 4DR4L 3R2IA 3P75A 3MEHA 2MGSA 2MO0A 1WTRA 1I5FA 4F87A 1J9OA 2Q8RE 1EFWA 1JJGA 5GADC 4R8IA 2MUYA 3F2DA 4KK7A 3GO5A 1K28A 3DEPA 1Y1WH 1IKMA 1JMCA 2PMZB 2OCEA 4ZUJA 3KJOA 4C3HG 4BXXH 1M90C 1ML0D 1TR5A 1TS3A 3A8JE 2LFNA 1YEZA 3KF8B 4KD3A 1Z6HA 1EY4A 1PYSB 4X62Q 4BBRH 3LGJA 4DGZA 5M5WB 2PCFB 1GM5A 3T56B 2ZJRA 4G7HC 1FD7D 4K5VA 2IT1A 2VUMB 1KRSA 2L55A 3S15H 3GTOB 4XT1B 2NZHA 3RD4A 3MTSA 2A69C 1AE3A 3EA6A 4WJWA 4CJ0B 2OTLA 5IP7H 4LF4L 1STBA 1XXGA 1CHQD 3MWYW 3CMEA 4XT3B 4LFBL 1MKHA 5FJ8H 5CMDA 4AYBE 4A3BB 5C3EH 3WDNA 4JYAL 3HOZB 2KUMA 4LF7L 2JA8G
chains in the Genus database with same CATH topology
2HQEA 4KMUC 1JOKA 1QOHA 4KN4C 5I2YA 3Q6SA 3CRLC 2I07B 2NTTA 2PZUA 3HOXB 4TQUS 1C4QA 1HRJA 1ET6A 5M3FB 2F4IA 3PUZA 4KN7C 1BF4A 5FLXL 4RH6A 1HCZA 2J7ZA 3O13A 1D1KA 2K03A 1Q8IA 1STAA 2DY8A 1SNCA 2JA7B 1W6KA 2A6ED 4DK0A 3VR2A 2EJFC 3GTMB 2NTSA 1FNVA 2NWGA 2X69A 4BA1I 3GTKB 2O2LD 2KOLA 4BBSB 1S5BD 1SAPA 2G9DA 1U4LA 1SNQA 4MIUA 1VF5C 5I6WA 4ZYSA 2LS01 2F0WA 1S5DD 4UAIA 3S15B 4I65A 4IZ8A 1XYIA 2VB2X 2A68D 1BCPD 4E6IA 5C44B 1PZJD 1Y8OB 5E4XA 1JWSD 1PTOH 5JOBA 3QOJA 3T51B 4IQZA 1GHJA 4B08A 2K32A 3MZ5A 5FLXE 1BXTA 5CBAE 1UNSA 1KDBA 1VMPA 2B2UC 4QB4A 2KEEA 3A7AB 3S14B 5J22A 3EROA 1IYUA 4DN4M 4BY1B 4C3JB 4IFDG 5K36H 1SE2A 4QMGA 2O4XA 4HMJA 2WKDA 1I50B 4H13C 1S5CD 4QUFA 1G2SA 1CM9A 4YIJA 1ZKOA 2J4XA 2A69D 4FVMA 1FNUA 5KYLA 4G7ZC 3C46A 1FYCA 1S5FD 1WD0A 5ELBA 1F9QA 3KLSA 1AZQA 1U4MA 1ILPA 2F0IA 5CV5A 1UEAB 2EY5A 3EJIA 1K83B 1PTOB 3C2PA 4BY7B 1KLUD 2Z4HA 3RMHA 4C1NI 1PFMA 2EPBA 2K1BA 2EE1A 1VMCA 3R93A 3OSOA 3V96A 4RGTA 1SNPA 1V43A 2EJMA 4IN3A 1STNA 5TSSA 4A3MB 2PW5A 4RCOA 5CV8A 4RA8A 4C3HB 1RCVD 1GOZA 2IPKD 4DU9A 3A54A 3MAQA 3S1NB 3JAME 2LY7A 5IGGA 3DEOA 2YU9B 3EVQA 4V0BA 1I4GA 1PMRA 3K6OA 3H94A 3FDTA 5EJWA 2F0GA 1EZ6A 3TP7A 1WTQA 2QCPX 1QNUA 3AB9A 3ZYYX 1CZWA 3BVGA 2EY2A 5D14A 3MC0B 2JA8B 3LWUA 2XRQD 1ENCA 1Q1EA 4H7BA 1TWGB 1ESRA 4KY6A 1TS4A 2B2VA 3NBHA 4OL7A 1B44D 2FMMA 1IKLA 1BNZA 4A3JB 4LAAA 4A3IB 2F0JA 5DEHA 3FKIB 4OHJA 3DMUA 1MSHA 3ITPA 1AW7A 2E2HB 3A56A 1W6JA 1PTOF 4DK1A 1L0YB 2KEDA 1E0BA 1STEA 1DONA 3I91A 4ID6A 1SXTA 2NB0A 1BBXC 3HG9A 2DNCA 1ENFA 4BA2I 2C5CA 1GUGA 5CC4A 1V8QA 3GTLB 1GXDC 1RHPA 4ABNA 1SYBA 4HCSA 1PDQA 4DAVA 4FXDA 1LV9A 1EYDA 4ZLTF 2XVSA 4G7OC 4K8JA 1NR2A 1TWFB 4IFDI 3D31A 2PYKA 1AZPA 3NK9A 3OMGA 1DOLA 2EYLA 2JA5B 4DAPA 5C4XB 1Y69U 5G3LD 4BS9A 5JJZA 1I4HA 3PIP3 5C6AA 5C3WA 1K8MA 1EU3A 2PO4A 3CRKC 1QILA 1SMYC 4ZRZA 4OIKA 2O5JC 2XNAC 1HA5A 4KTAA 1DZ1A 1RKNA 2E75C 2JP1A 3KLSX 4IUNA 1WTOA 2PZTA 1LT5D 2JA6B 1LTAD 2D5DA 1BO0A 4ZQ3A 3PIO3 3GTJB 2NVXB 3A7LA 5JAVA 3J7AV 3S2DB 4FF2A 4DNTB 1MSGA 5EBDA 1I4PA 2M2LA 2AQ1B 2M00A 1T5EA 2ZXOA 3DWPA 2R7ZB 2EVBA 4KKUA 1HTLD 3L7ZC 2X6GA 3T13A 3A8IE 2WKCA 2WINB 2J0TD 3HZXA 3IKJA 1CHPD 2B2TA 2K5QA 2N88A 3FMCA 2QKIC 5BN3A 4K5WA 3EQLC 3AMUA 4RCNA 3J81L 4LMQD 3I8ZA 1RODA 3AU7A 4Z9CB 5D65A 4XQQA 2JEBI 5LHY1 3P1HA 2G9HD 5JEAG 1X3QA 5C4HA 5I9OA 1TQOA 1O7ZA 1HFGA 3QOLA 1I4QA 1JWMD 2L1BA 1WCMB 2B63B 3MXPA 1F2YA 2L12A 2VNUD 3A55A 5M9OA 4UDUC 4CGYB 5C5LA 1SNDA 3VR6A 3MFYA 1D5MC 5ELDA 2IX0A 5T1GA 1EL0A 3NXWA 2I46A 4C56C 2LMCB 4HR7B 2B8GA 3J81E 2K28A 3MFGA 2RDFA 1M8AA 3DWQA 1WD1A 3RZOB 3M3YB 3IFTA 5HGTA 1QG7A 2K5DA 2HDMA 5E1FA 1SYDA 2RDGA 2O5IC 2SNSA 3S1QB 4IURA 2FJ2A 5EQ0A 1TKWB 1SBBB 3TP6A 1ET9A 2NN6I 2R6GA 4K2KA 3MXGA 4XIGS 2TMPA 3D4WA 1ENAA 3FVQA 4XYQA 5E4WC 1G6ZA 2EYOA 4A3FB 3SDZA 2N55A 5EPKA 1HPCA 2CVRA 2NUCA 1QE6A 1RDPD 3IAYA 5I4DA 1SFOB 3H91A 5ISRA 3RZDB 3D6WA 2F0MA 2L0CA 3LWEA 1PRTB 1G8ZD 3D8GA 1E2ZA 3V05A 1CZGA 3K5LA 4QUCA 2PZWA 3FEWX 1D6EC 3CKIB 2F3WA 3I90A 4RHRA 2R93B 5JPMC 2F0SA 1FNWA 3PUYA 1TY0A 2A74C 5JVH3 1B2TA 3Q0AA 1C48A 5FOBB 4MN3A 3S17B 3KK7A 2F0QA 3GD7A 1LACA 1II3A 3KLRA 1QNKA 1F2ZA 1PTOC 1XX8A 3ND9A 2DNEA 4HAEA 1OXVA 2KJXA 1T5XD 1X32A 2F0HA 3SE0A 5JPNC 4P2CB 3FRPB 4L6TB 4ZKCB 3D3RA 2OT2A 1TU2B 3SR1A 1BCPB 2FMCA 1KLGD 2RBMA 1JICA 4QIWB 1CA6A 2VXWA 4XXEA 4CBVA 4DA2A 1E2VA 2FINB 2IW3A 3FPPA 1TWHB 1JE4A 3P7JA 3Q23A 3NE5B 4O42A 1LT4D 4KV6A 3TP5A 1I4RA 1OXTA 5CGKA 2F03A 2HDLA 1EOTA 4PMCA 1GUNA 3GP7A 3MHBA 3OMCA 1M4VA 4OO1G 5ELEA 5CV4A 5HURA 4O1NA 5EPLA 3PO3B 1Z7TA 4EGVA 1I3QB 3IL8A 1O7LA 2EYHA 2IJ0A 4FXKC 1O80A 3BDLA 3K5OA 1PRTF 2KVMA 2B2YA 1TS5A 1WVLA 2XRSD 4XQNA 2KECA 3OWEB 3IFDA 3I70A 1F77A 3S1MB 4HSVA 2ZXRA 1JOQA 4KD4A 4F88A 1NR4A 2C9OA 2CHBD 1VCIA 2WP8J 5T1IA 2FHTA 2QF7A 4PQXA 3DUZA 2F3VA 1DJRD 3JAML 3NWSA 3BYTB 5FO9B 1X3PA 2B2VC 2NVQB 2K7VA 2KA7A 1JCKB 1DM0B 2DY7A 3D4RA 4KJNA 1FR3A 1HA6A 4JBWA 1PXUA 1BCPF 1V1OA 4EQNA 2OEOA 3K58A 1HFNA 4FF4A 1TT2A 2EXZA 2MPMA 3PUWA 3BVMA 4RGMA 5LL6X 3DM1A 1QJOA 1PTOD 4XQJA 4QF4A 3K7AB 2EZVA 1EZ8A 3N6RA 3C1FA 1SE4A 4BWGB 1GUTA 3BDOA 4RWSC 5ELCA 1L0XB 4L63B 1EWCA 3M7NA 4FYDA 2AUKA 4U68A 3GV3A 1HUNA 3NTHA 3MA2B 1GUSA 3URYA 4U673 2RSOA 3PUXA 5KNCA 5C0XG 1OXUA 3OW7A 5EPJA 1LTID 5F2DA 3NQIA 3TBIB 2EYFA 4XTCS 1PLFA 1UUPA 2D2CC 3H3VC 4RAUC 1WTWA 4PNYA 1EYAA 4G4KA 4L8JA 1ZYRC 1DOMA 3T16A 4NDXA 1DCZA 1TWAB 1MGSA 5C5MA 4RKLA 3J7YW 2RSNA 2XWBB 2WV6D 1EIHA 1BQQT 2Z8LA 3BYYB 1K8OA 1HTPA 4IFDH 3I72A 4OGQC 3M85A 2NZ1D 4TSSA 4HTHA 2RVLA 5E3FA 4A3DB 4C1NK 3HS0C 3NSWA 1D2BA 3GV6A 2JYOA 4KHVA 1BUVT 1WTXA 2E2IB 1MBYA 4OO1I 4Y7NB 4ME5A 2KHSA 4CHTB 4IUUA 1B53A 3MVVA 5IGBA 3T53B 3C3LA 5JVG3 1LABA 2NN6G 5IIFA 2IL8A 3TSSA 3DWAA 4A93B 1CI3M 1HQMC 3SEBA 2Z1CA 2L11A 1CK1A 5KYIA 2Z4IA 2B2TC 2EJGC 1BDOA 1SNOA 4IUQA 4C3IG 3UI2A 1A2TA 1RF2D 2SEBD 2IX3A 1DD2A 2A5HA 1TVXA 2L9HA 1Q3LA 3PMFA 3HOYB 1KDAA 4LJZC 1ESFA 1G2TA 4K6DA 1STGA 5KRUA 2K01A 1HXYD 2JEAI 3HKZB 2SNMA 3HOWB 1JB3A 5CBEE 3D6CA 5COYA 4KJOA 3W3AA 1KTKA 3PUVA 4B9XA 1O7YA 5KNDA 2H1EA 1DOKA 5FKAC 1HQRD 2JXMB 5DNFA 2Q8IB 1OXXK 3HRZC 1UAPA 3NTKA 3S1RB 5EKKA 5AFWA 3K5NA 4K14A 3QJYA 5J39A 3A8KE 4IFDJ 1AFPA 2M9VA 2SDFA 1GJXA 3GTQB 2PQEA 1JWUD 1ZYRD 5M3MB 1RTOA 4F8MA 1H9JA 3RUZA 4CJ1B 2XSCA 3SK4A 1I6VC 1XWEA 5CORA 1H9SB 3HP3A 1CT1D 1EWHA 1O78A 1CFMA 5C0XI 1SYEA 3CU7A 2BA0A 3C1EA 3K57A 1B50A 1J8IA 3M4YA 5G3LF 1PRTC 1QCBD 3OOCA 5I6YA 3QWNA 1CQFA 1STHA 1NSNS 1YNNC 3BG3A 1ICWA 3K0YA 2OXPA 1LTGD 3BZDB 3S16B 3NBIA 1KNAA 1NAPA 2F0DA 2K04A 1EY8A 1GHKA 1ZXTA 4B9WA 5CV6A 4GZYC 2MJ8A 2QILA 4EQOA 2F0FA 1U4RA 3GQBA 2DN8A 2K05A 2PPBC 4FP5D 1JC7A 1A3TA 2D62A 4WORA 2F0UA 2B2WA 2IWHA 2FFKB 3VYSA 3W2DA 1SMYD 1PZID 2F0TA 4CKEA 4NP5A 1SYCA 4JK1C 3I4NB 2X6LA 4K2LA 5I9PA 3K5MA 4DF7A 1D1IA 1S4ZA 2AQ2B 5FO7B 3PV0A 2BDNA 1A6XA 4RGOS 1KAAA 3KBGA 2AWNA 3NPPA 2F1MA 1D5ZC 4S3SA 5A35A 4AYBB 5A2QL 4HN7A 4DFAA 2WAQB 1QB5D 1EY6A 4RKBA 5K36G 1SJHD 1SE3A 3H0GB 5LL6S 1EYCA 1TS2A 3VYTA 5I2XA 5KIXA 1KABA 4V190 1SJED 1V1PA 2E76C 1B9NA 3OIQA 1PZKD 4H44C 1R4QB 1LTTD 3WOFA 1DXMA 4C3IB 2NYZD 2R92B 3VA5A 2PNRC 4FXGC 5C4ZA 3HGBA 4QCLA 3QIAA 4N9PA 1LO5D 3R8BA 5EBCA 2F0OA 1EQVA 2EY6A 5A2QE 2H4OA 1VDZA 4KY5A 1V1PB 3L3OC 1PRTD 2B2YC 1XTCD 5JEAH 1SEBD 1YNND 3S9WA 4Q0FA 1IYVA 2K5WA 1ILQA 5IOCA 4G57A 5BN5A 3NUCA 2F0KA 3VA7A 4NKLA 3KBXA 3Q24A 1PYWD 2YYZA 5CV7A 4A3EB 1Y1WB 1R4PB 4ZK9B 2KCCA 3HOUB 3TZDA 1EY0A 3VYRA 2HCCA 4BBRB 1YNJC 3NP8A 3DXJC 4ODGA 4WFN3 3ERQA 2E74C 4KHZA 1KNEA 2PW7A 3NWTA 1D5XC 3SXHA 1TIID 1HUMA 4X3SA 1U9RA 5C3EB 3NTIA 2NBFA 4KKSA 4ULLA 4X3KA 4LK1C 1OO9B 5M5XB 5C4JB 1OXSC 3L9AX 2RQXA 1PFNA 1WTVA 4CKCA 2JSOA 2MP1A 4DAYA 1LLRD 4Q5VA 5CYUA 2ICIA 5DAUA 1F9PA 2CQAA 1F2MA 2K33A 5KGUA 2ID0A 2IX1A 3OHXC 1NUCA 1G91A 3E6ZX 4DNRB 4RFBA 5CR3A 1EEFD 2L4NA 2E2JB 1I4XA 2AWOA 1B3AA 3DHQA 4K8IA 4A3GB 3I73A 5DM73 5JEAJ 2R3ZA 3M7GA 4N9TA 2F0EA 5C3XA 1GUOA 1IHZA 1I6HB 2EYPA 1ONLA 2NVTB 1TY2A 2EDGA 3SVMA 1KDCA 3V2TA 4IUPA 1Q90A 1E2WA 1CQVA 3I4MB 1ZEQX 4J1MA 4J8QA 4MHEA 2HUGA 1EY9A 2WIIB 3SK5A 5IT9L 3BVZA 1B4OA 5NUCA 4KY7A 4ZUIA 4ZAIA 2B2UA 2OF1A 2SOBA 1Y8NB 2TSSA 3E5SA 3TN2A 3SHLA 5IGCA 5KEEA 2BE5C 3TDQA 3N52A 1IL8A 2LKVA 4IALA 2A73B 3Q22A 2EY1A 4C2MB 1YNJD 4FF3A 1CTMA 1LTBD 1A3UA 1G291 3I3CA 3R3OA 2GA4B 3TP8A 5FK9C 2L5TA 2RDHA 3ONAB 3VR4A 5CV9A 2F0NA 4OO1H 4X3TA 2CW0C 4CJ2C 5IT9E 3J7AF 4PMWA 4J6HA 1EY5A 1STYA 1H9RA 3GTPB 2XIWA 4K5XA 3CHBD 1IW7C 1BR9A 2B39A 2E2DC 2NVYB 2V4DA 1WTPA 2F0VA 2R61A 4IUVA 1SNMA 4F7XA 5IODA 1EY7A 2EYJA 1EFID 2Q8TA 2ZXPA 5J1ZA 1H9KA 1Q1BA 1BOSA 3D4DA 5IGEA 5EKLA 3QG1A 2AQ3B 1S5ED 4X3UA 1QWYA 3ND8A 3M4OB 3OIPA 1DYQA 3G7LA 3TZUA 4ZKBB 3HOVB 2BDOA 1SSOA 3FPUB 4XDXA 1JOOA 1HHVA 4NMZA 4FF1A 2ENBA 2B8FA 3LX0A 1RTNA 2ICEC 5IGFA 1LT6D 3QB3A 4HMIA 1C8CA 4A3KB 5KNBA 3MXNA 3H09A 3KUPA 1SYGA 4H0LC 3H6MA 4R9WA 1RD9D 2BE5D 3VYUA 2D9UA 1B1ZA 1AN8A 2A6HC 1Y1VB 3S2HB 3I4LA 1MD2D 4DXGA 4XYOA 5D3IB 1A15A 1EEID 3HEJA 1A3VA 1F9RA 3CQZB 2RA4A 3SK8A 3GTGB 5C0XH 4KI0A 3K59A 2VB3X 3OWFA 1JR0D 1H9SA 2F0PA 3R2TA 1EQTA 1AEXA 1FGBD 2B2WC 3NQTA 2WB1B 2K6AA 2CW0D 4PV1C 4IUTA 5BN4A 4HEDA 3RLFA 4WRDA 4HCEA 1TWCB 3U9OA 4NW2A 2QEJC 2Y0SB 4K6LA 4TKOB 2RKSA 2BA1A 4FNFA 1IW7D 3BS1A 5EKIA 1H9MA 5M5YB 3LNNA 4TRDA 2AUJD 5EGTA 5K5PA 1U4PA 2BCOA 2MHVA 2EOTA 1LT3D 2XWJB 1Y8PB 4HSPA 5FO8B 4R8NA 3EFXD 4DXFA 4I7ZC 1B9MA 4RGNA 3J80L 1MI2A 1F2LA 3VR5A 3PO2B 1EIGA 4OIJA 2XN9C 2KQ3A 1VF7A 1A2UA 2HCIA 2QDBA 3P20A 4C3JG 2F0LA 2WACA 2ZT9C 1LTSD 4RHSA 3WOEA 1F9SA 2NN6H 3X3MA 2JE6I 1RJTA 1SYFA 4KKTA 3T4AC 2EYMA 3E0JA 5ELFA 4M8AA 1Q12A 4EQPA 1CA5A 4PMBA 3MXUA 5D3DA 1LTRD 3SK6A 2A6EC 1Z47A 3F2UA 2BOSA 3OPOA 5DM63 4FO2A 3BDCA 1PFBA 4CKBA 1JQYD 1AP0A 3J80E 4ILWA 1NCVA 3G6JB 1SDFA 3X3NA 4EVOA 3U9SA 4M1UB 2A68C 1BCPC 1EU4A 3NHHA 2KCNA 3TMEA 1R9TB 1JORA 3QO2A 3KF8A 1GUWA 3VR3A 5C0XJ 2A6HD 5IGDA 3R2IA 3P75A 3MEHA 2MGSA 1WTRA 4F87A 1J9OA 2Q8RE 4R8IA 2MUYA 4KK7A 3GO5A 3DEPA 1IKMA 2PMZB 4ZUJA 4C3HG 1ML0D 1TR5A 1TS3A 3A8JE 2LFNA 4KD3A 1Z6HA 1EY4A 4DGZA 5M5WB 2PCFB 3T56B 4G7HC 1FD7D 4K5VA 2IT1A 2VUMB 2L55A 3GTOB 4XT1B 3RD4A 3MTSA 2A69C 3EA6A 4WJWA 4CJ0B 1STBA 1XXGA 1CHQD 3MWYW 4XT3B 5CMDA 4A3BB 3WDNA 3HOZB 2KUMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1STY A;  2EXZ A;  2NUC A;  4NKL A;  2HQE A;  4ME5 A;  1JOK A;  4DF7 A;  2KHS A;  4KV6 A;  5CV7 A;  4K5X A;  2PQE A;  3HEJ A;  3TP5 A;  1A3V A;  5CGK A;  3MVV A;  5IGB A;  2PZU A;  2F0G A;  3BDC A;  4QF4 A;  4QMG A;  3P1H A;  3SK8 A;  2O4X A;  4N9T A;  1KAA A;  4F8M A;  1EZ8 A;  4PMC A;  1EZ6 A;  2F0E A;  3MHB A;  3OMC A;  4HMJ A;  3C1F A;  3RUZ A;  5C3W A;  2F0V A;  5C3X A;  5C6A A;  5IIF A;  5ISR A;  1IHZ A;  3TP7 A;  1SNM A;  4F7X A;  5IOD A;  5C4H A;  4S3S A;  1EY7 A;  1EY0 A;  1TQO A;  2EYJ A;  2EYP A;  3OWF A;  5CV4 A;  3SK4 A;  4YIJ A;  5HUR A;  2F0P A;  2F0M A;  4EVO A;  1AEX A;  2EY2 A;  4DFA A;  1KDC A;  3QOL A;  3V2T A;  5J1Z A;  5KYI A;  3NQT A;  3D8G A;  3MXP A;  1F2Y A;  3NHH A;  3TME A;  5I9P A;  3NP8 A;  2PZW A;  1EY6 A;  4J1M A;  5KYL A;  1JOR A;  2F3W A;  1SNO A;  1SYE A;  2EYH A;  3D4D A;  4KTA A;  4ODG A;  1ENC A;  1RKN A;  3ERQ A;  4RKB A;  5M9O A;  1STA A;  4H7B A;  3BDL A;  5C5L A;  1SNC A;  5EKL A;  4IUN A;  1A2T A;  2PZT A;  3C1E A;  4KY6 A;  1SND A;  4WRD A;  2F0S A;  2PW7 A;  5IGD A;  1EYC A;  1EY9 A;  4OL7 A;  3VA5 A;  3SK5 A;  5KIX A;  3P75 A;  3MEH A;  3U9O A;  1KAB A;  5I6Y A;  5NUC A;  3PMF A;  3SXH A;  4KY7 A;  4ZQ3 A;  1KDA A;  2F0I A;  5CV5 A;  4ZUI A;  4LAA A;  3SK6 A;  1STH A;  2EY5 A;  2RKS A;  3NXW A;  1NSN S;  2OF1 A;  4TRD A;  1U9R A;  1JOQ A;  2SOB A;  5IGE A;  4KD4 A;  2F0J A;  3EJI A;  5EGT A;  3E5S A;  5F2D A;  5K5P A;  3SHL A;  2EYF A;  5DEH A;  2OXP A;  5IGC A;  5KEE A;  4K6D A;  5I9O A;  5JAV A;  1SNQ A;  1STG A;  4MIU A;  2RDF A;  5I6W A;  5KRU A;  3DMU A;  3ITP A;  4R8N A;  2F0W A;  4ZUJ A;  2F0D A;  1JOO A;  2F0Q A;  2SNM A;  5HGT A;  1EY8 A;  1II3 A;  1TR5 A;  2LKV A;  4KD3 A;  4NMZ A;  4I65 A;  4IAL A;  4IZ8 A;  2ENB A;  2EY1 A;  2M00 A;  5E1F A;  1SYD A;  4PNY A;  1EYA A;  1F2Z A;  2SNS A;  5C4Z A;  3D6C A;  4B9W A;  4ID6 A;  1EY4 A;  2F3V A;  5CV6 A;  3T16 A;  4E6I A;  4EQO A;  4NDX A;  4KJO A;  2F0F A;  5DAU A;  4N9P A;  3LX0 A;  4DGZ A;  2F0H A;  5C5M A;  5IGF A;  4RKL A;  5CC4 A;  2F0O A;  1EQV A;  5JOB A;  1F2M A;  2EY6 A;  2KQ3 A;  3TP6 A;  3QB3 A;  3QOJ A;  1A3T A;  4K2K A;  1A3U A;  4HMI A;  3OSO A;  5KGU A;  4K5V A;  1A2U A;  3T13 A;  4KY5 A;  3R3O A;  2QDB A;  1SNP A;  3MZ5 A;  4WOR A;  2F0L A;  1NUC A;  1SYB A;  2WAC A;  3TP8 A;  1STN A;  2F0U A;  2PW5 A;  3HZX A;  3SR1 A;  3D4W A;  5CV8 A;  1ENA A;  4HTH A;  1EYD A;  5CV9 A;  1SYG A;  3S9W A;  1KDB A;  2RBM A;  2F0N A;  4J6H A;  2EYO A;  5E3F A;  4K5W A;  4B9X A;  4DU9 A;  3H6M A;  1STB A;  4KJN A;  4K8J A;  1SYF A;  5CR3 A;  4QB4 A;  2F0T A;  2EYM A;  5EKK A;  2PYK A;  4NP5 A;  5IOC A;  1SYC A;  3NK9 A;  3OMG A;  4K14 A;  4EQN A;  5IGG A;  3DHQ A;  4G57 A;  4KHV A;  4PMB A;  4K8I A;  4EQP A;  2OEO A;  3NUC A;  2F0K A;  3ERO A;  2EYL A;  5J22 A;  5J39 A;  4K2L A;  3EVQ A;  1EY5 A;  1TT2 A; 
#chains in the Genus database with same CATH topology
 2WAQ E;  2HQE A;  4KMU C;  1JOK A;  1QOH A;  5C4J H;  4KN4 C;  5I2Y A;  3Q6S A;  3CRL C;  3PF5 A;  1M1K C;  2I07 B;  5IYC H;  2NTT A;  2PZU A;  3HOX B;  4TQU S;  1C4Q A;  4DR2 Q;  1FJG L;  4DV1 L;  1HRJ A;  4B3R L;  4A3J G;  4DUZ Q;  1ET6 A;  4A3I G;  5M3F B;  2F4I A;  2KBN A;  3PUZ A;  4KN7 C;  1BF4 A;  5FLX L;  3FKI G;  4RH6 A;  1HCZ A;  2J7Z A;  4C3J H;  4A75 A;  3O13 A;  1D1K A;  2K03 A;  1Q8I A;  1VQ5 A;  4LF9 L;  3F2B A;  1STA A;  2DY8 A;  4IJL A;  1RIP A;  1SNC A;  1I50 H;  2HHH L;  1ASZ A;  1JJ2 A;  2E2J H;  2JA7 B;  1W6K A;  1SRU A;  5IYD G;  2UU9 L;  2A6E D;  4DK0 A;  3VR2 A;  2EJF C;  3GTM B;  2NTS A;  1FNV A;  4LWC A;  4A3G H;  3J80 i;  2NWG A;  2X69 A;  4BA1 I;  3GTK B;  2O2L D;  2VQF L;  2KOL A;  4BBS B;  1S5B D;  1SAP A;  2G9D A;  1U4L A;  1SNQ A;  5BR8 L;  4MIU A;  1VF5 C;  5I6W A;  4ZYS A;  2LS0 1;  1KXL A;  4DR7 Q;  2F0W A;  1S5D D;  4UAI A;  1IBK Q;  3S15 B;  3IRB A;  3HFZ B;  2GVB A;  4I65 A;  4IZ8 A;  1XYI A;  2VB2 X;  4A93 G;  2A68 D;  1BCP D;  1I6H H;  2NVT H;  4E6I A;  5C44 B;  2VW9 A;  1PZJ D;  1WJJ A;  1Y8O B;  5E4X A;  2UUA L;  1JWS D;  1PTO H;  4GS3 A;  5JOB A;  1HNX L;  2JA5 G;  3QOJ A;  3T51 B;  4IQZ A;  1GHJ A;  5C4X G;  3I4M H;  4B08 A;  2K32 A;  3OTO L;  3MZ5 A;  5FLX E;  1K0R A;  1BBU A;  1BXT A;  2UXC L;  1VQC A;  5CBA E;  1UNS A;  1KDB A;  1VMP A;  2B2U C;  4JI4 L;  4QB4 A;  4JI5 Q;  2KEE A;  3BZK A;  3JC6 6;  3A7A B;  1XTD A;  3S14 B;  4KHP L;  5J22 A;  4H02 A;  3ERO A;  1IYU A;  4KLK A;  4DN4 M;  3S24 A;  4A3M H;  1UE6 A;  2DJG C;  4POG A;  4BY1 B;  3HKZ G;  4C3J B;  4IFD G;  5K36 H;  1SE2 A;  4QMG A;  1T9H A;  1YZ6 A;  4JBK A;  4C2M H;  2O4X A;  2K5V A;  1EYG A;  2MNA A;  2JA6 G;  4HMJ A;  1NTG A;  3S1N H;  4YHH Q;  2WKD A;  1I50 B;  3J7A 5;  2QDL A;  4H13 C;  1S5C D;  4QUF A;  1E3P A;  3K81 C;  1G2S A;  1CM9 A;  4YIJ A;  1ZKO A;  3RR5 A;  2Z6K A;  2J4X A;  2A69 D;  4FVM A;  2G5D A;  1FNU A;  5KYL A;  1ASY A;  4DPG A;  4G7Z C;  3C46 A;  1FYC A;  1S5F D;  1WD0 A;  1JT8 A;  5ELB A;  1F9Q A;  3KLS A;  1AZQ A;  1U4M A;  3FP9 A;  1ILP A;  2R7Z G;  2F0I A;  5CV5 A;  1CKN B;  1UEA B;  1VS0 A;  2EY5 A;  1Q8K A;  3GTP H;  3EJI A;  1K83 B;  1L1O C;  1PTO B;  3C2P A;  4BY7 B;  1HZA A;  1TWG H;  1E24 A;  1KLU D;  2Z4H A;  2NVY H;  5IYB G;  3RMH A;  1VQH A;  4C1N I;  1FVI A;  4IOA A;  4OWW B;  1PFM A;  2EPB A;  2H5X A;  4L5T A;  2K1B A;  2EE1 A;  4UPA A;  1VMC A;  3R93 A;  4OXP A;  1N32 L;  3OSO A;  4JW0 A;  3V96 A;  4RGT A;  4LUZ A;  1SNP A;  1V43 A;  2EJM A;  3K80 C;  1G51 A;  4IN3 A;  3CC4 A;  2VY3 A;  1STN A;  5TSS A;  4A3M B;  1YI2 A;  2PW5 A;  4RCO A;  2ZM6 Q;  5JJI A;  5CV8 A;  4RA8 A;  1N36 L;  1MJC A;  4C3H B;  1RCV D;  1GOZ A;  2IPK D;  4DU9 A;  3TS2 A;  4UY8 C;  3A54 A;  1XPO A;  1J6Q A;  1PH2 A;  3M4O H;  3MAQ A;  1IXR A;  3S1N B;  3JAM E;  2LY7 A;  5IGG A;  1PVO A;  4LFC Q;  2B63 G;  1WCM G;  3DEO A;  2YU9 B;  3EVQ A;  4LFB Q;  1K0S A;  5ELN A;  4V0B A;  1QVF A;  1I4G A;  1PMR A;  3K6O A;  3H94 A;  3FDT A;  2Q2I A;  1GD7 A;  5EJW A;  2HIV A;  2F0G A;  1QVC A;  3EN2 A;  4HIK A;  3T1H Q;  1XMO Q;  1EZ6 A;  3TP7 A;  1WTQ A;  2QCP X;  1YIT A;  2LSS A;  2I0Q A;  1QNU A;  3AB9 A;  3ZYY X;  3G48 A;  1CZW A;  3BVG A;  4A3K H;  1LUZ A;  2EY2 A;  5D14 A;  2Q2T A;  3MC0 B;  3F1Z A;  2JA8 B;  3LWU A;  3K0X A;  3FHW A;  4K0K L;  1Q81 C;  2XRQ D;  1ENC A;  1Q1E A;  4H7B A;  1TWG B;  1ESR A;  4KY6 A;  4HIM A;  2EQS A;  1TS4 A;  2B2V A;  1AE2 A;  3NBH A;  3TEH B;  4OL7 A;  1B44 D;  2JQO A;  2FMM A;  2RCN A;  1IKL A;  4DR1 L;  1BNZ A;  4A3J B;  1HJP A;  4LAA A;  4A3I B;  1Y1V H;  3TRZ A;  2F0J A;  1C7Y A;  4LFA L;  5DEH A;  1E1O A;  3UDI A;  1EIF A;  1I94 L;  3BU2 A;  3FKI B;  4OHJ A;  3DMU A;  1KQS A;  1MSH A;  3ITP A;  1PH6 A;  4WJ4 A;  1AW7 A;  2E2H B;  3A56 A;  1PH4 A;  4JOI A;  1W6J A;  1EOV A;  1PTO F;  3E3X A;  2EIF A;  4DK1 A;  4WJ3 M;  2PNH A;  4A3F G;  1PH5 A;  1L0Y B;  2KED A;  1E0B A;  1STE A;  1DON A;  1LTL A;  3I91 A;  4ID6 A;  3GTJ H;  1VQ4 A;  1SXT A;  3H3V H;  4JI7 Q;  2NVX H;  4DR6 Q;  2NB0 A;  1BBX C;  3HG9 A;  2DNC A;  1ENF A;  4BA2 I;  2C5C A;  1GUG A;  5CC4 A;  1V8Q A;  3GTL B;  1GXD C;  4DAM A;  3W1B A;  1RHP A;  4ABN A;  1SYB A;  4HCS A;  1PDQ A;  4L5R C;  1Q86 C;  4DAV A;  2IY5 B;  4FXD A;  1LV9 A;  1EYD A;  4IO9 A;  4ZLT F;  4X62 L;  1TWC H;  2XVS A;  3G6E A;  4G7O C;  4K8J A;  1NR2 A;  1TWF B;  4JPB W;  4IFD I;  3D31 A;  2BH8 A;  2PYK A;  1AZP A;  3NK9 A;  1B70 B;  1DOL A;  3OMG A;  2EYL A;  1VQI A;  1WFQ A;  2JA5 B;  3U58 A;  4KHP Q;  1EQR A;  4DAP A;  5C4X B;  4GN5 A;  2R93 G;  2I5M X;  4GLV B;  2AKW B;  1Y69 U;  5G3L D;  4YWL A;  4TVA B;  4BS9 A;  5JJZ A;  1I4H A;  3PIP 3;  5IT9 c;  5C6A A;  5C3W A;  2Z9H A;  1K8M A;  2C35 B;  2PI2 A;  1EU3 A;  5J3B A;  2PO4 A;  3CRK C;  3UDG A;  2YTY A;  1QIL A;  1SMY C;  1HNZ Q;  4ZRZ A;  1WOC A;  4OIK A;  3JAM i;  2O5J C;  2XNA C;  4DR2 L;  2LXJ A;  1HA5 A;  4KTA A;  1DZ1 A;  1RKN A;  2ZTD A;  3A74 A;  2E75 C;  4MNO A;  2CWA A;  2JP1 A;  3KLS X;  4IUN A;  1WTO A;  2ASB A;  2PZT A;  4DUZ L;  3I2Z A;  4OON A;  2NZO A;  1LT5 D;  2JA6 B;  1LTA D;  5EAY A;  2D5D A;  1BO0 A;  4ZQ3 A;  3CC2 A;  3PIO 3;  1HH2 P;  1WCM H;  3GTJ B;  2NVX B;  3A7L A;  3UDF A;  3M4Q A;  1L0W A;  2N78 A;  4YWM A;  4A3E G;  5JAV A;  3J7A V;  3S2D B;  4FF2 A;  4DNT B;  5AJ3 Q;  2CH4 A;  1BBW A;  1MSG A;  5EBD A;  4JI8 Q;  1I4P A;  2N8N A;  2QA4 A;  2M2L A;  4OX9 Q;  2AQ1 B;  2M00 A;  1T5E A;  1IBM Q;  2KHI A;  2ZXO A;  3ERS X;  4DV2 Q;  3DWP A;  2R7Z B;  2A8V A;  2EVB A;  4KKU A;  1FGU A;  1HTL D;  2K75 A;  3B6Y A;  2X6G A;  3L7Z C;  1R9T H;  1C0A A;  2CWP A;  3T13 A;  3G71 A;  4DR7 L;  1PH7 A;  1KC8 C;  1IBK L;  3A8I E;  2WKC A;  1QUQ B;  2WIN B;  2J0T D;  3HZX A;  3IKJ A;  3AEV A;  1AH9 A;  1CHP D;  2B2T A;  2K5Q A;  1BKB A;  2N88 A;  3FMC A;  4DV7 Q;  2QKI C;  5BN3 A;  2KCT A;  2RHQ B;  4K5W A;  3S1Q H;  3EQL C;  1IBL Q;  3AMU A;  3G4S A;  4RCN A;  4A3L H;  1Z9F A;  4AQY L;  2PI2 E;  3J81 L;  4LMQ D;  3I8Z A;  4N8X 1;  3PO3 G;  1ROD A;  4IPH A;  3AU7 A;  2VQE Q;  4Z9C B;  5D65 A;  2ZTE A;  3W5O A;  4XQQ A;  4HJA A;  2JEB I;  5LHY 1;  3P1H A;  1DGS A;  2G9H D;  5JEA G;  4JI5 L;  1V1Q A;  1X3Q A;  5C4H A;  1PH3 A;  5I9O A;  1TQO A;  1Y14 B;  1VQG A;  4MTN A;  1Q7Y C;  2Y0S E;  1O7Z A;  5M5W H;  2K52 A;  1SLJ A;  1HFG A;  3QOL A;  1I4Q A;  1JWM D;  2L1B A;  1WCM B;  2B63 B;  3MXP A;  1F2Y A;  3GTO H;  1K8G A;  2HIX A;  1SFO H;  2L12 A;  2VNU D;  3KDF A;  3A55 A;  5M9O A;  2OQK A;  4UDU C;  4CGY B;  5C5L A;  4YHH L;  1XPR A;  3RZD H;  4IOC A;  1SND A;  3VR6 A;  3EBE A;  3K7U C;  3MFY A;  3VDY A;  1D5M C;  5ELD A;  2IX0 A;  4A3B H;  5T1G A;  1EL0 A;  3NXW A;  2I46 A;  1O7I A;  4C56 C;  2LMC B;  4HR7 B;  2B8G A;  3J81 E;  2K28 A;  3MFG A;  2R93 H;  4YCV A;  2RDF A;  1M8A A;  1L2F A;  3DWQ A;  1WD1 A;  2ATW A;  1CUK A;  3RZO B;  3M3Y B;  3IFT A;  5HGT A;  3KDF B;  1QG7 A;  2K5D A;  2HDM A;  1A8V A;  5E1F A;  4GN4 B;  1SYD A;  2RDG A;  2O5I C;  2SNS A;  5M3F H;  3S1Q B;  4YY3 Q;  4IUR A;  2FJ2 A;  5EQ0 A;  1TKW B;  1SBB B;  3TP6 A;  1ET9 A;  2NN6 I;  2R6G A;  4K2K A;  3MXG A;  3TRE A;  4XIG S;  2TMP A;  2ZJQ A;  3D4W A;  1ENA A;  4UP8 A;  3FVQ A;  2ZTC A;  4XYQ A;  2JA7 H;  4RG1 A;  5E4W C;  1G6Z A;  2EYO A;  4JI2 Q;  4A3F B;  3GTM H;  2K14 A;  5IP9 G;  3SDZ A;  3GTK H;  1UEB A;  2N55 A;  5EPK A;  1HPC A;  2CVR A;  3ULP A;  4BBS H;  2NUC A;  1TXY A;  2B3G A;  2ZM6 L;  1QE6 A;  4PG3 A;  1RDP D;  1CKM A;  4IJH A;  2EXD A;  3IAY A;  5I4D A;  1SFO B;  3H91 A;  2L15 A;  5L37 A;  5C44 H;  5ISR A;  4P71 A;  3RZD B;  3D6W A;  4LFC L;  4A3C H;  1IZ6 A;  3UE0 A;  2OQ0 A;  2F0M A;  4NB3 A;  2L0C A;  1PH8 A;  1FL0 A;  3LWE A;  1PRT B;  1G8Z D;  3D8G A;  1E2Z A;  3V05 A;  1CZG A;  4LW1 A;  3K5L A;  4QUC A;  1C9O A;  2PZW A;  4X66 Q;  3FEW X;  2PMZ E;  1D6E C;  3CKI B;  2F3W A;  1RL2 A;  3I90 A;  4RHR A;  3T1H L;  1XMO L;  3J80 c;  2VL6 A;  5IY0 A;  4JI6 Q;  2R93 B;  2UXB Q;  5JPM C;  2F0S A;  1FNW A;  3PUY A;  1S40 A;  1TY0 A;  3S14 H;  2A74 C;  5JVH 3;  5LMN W;  1B2T A;  1PYB A;  3GDE A;  3Q0A A;  1C48 A;  4BY1 H;  5FOB B;  1B7Y B;  4MN3 A;  4MTK A;  3S17 B;  3KK7 A;  2F0Q A;  3GD7 A;  1LAC A;  1II3 A;  4A3D G;  3KLR A;  1QNK A;  1F2Z A;  1PTO C;  1XX8 A;  2B29 A;  2Z6K C;  3ND9 A;  3AFQ A;  2DNE A;  4HAE A;  1OXV A;  2KJX A;  1T5X D;  1X32 A;  2F0H A;  2GN5 A;  3SE0 A;  3ULL A;  5JPN C;  4P2C B;  3FRP B;  4L6T B;  3J81 i;  4JCV E;  3D3R A;  4ZKC B;  2OT2 A;  1TU2 B;  3SR1 A;  1BCP B;  2MFI A;  2FMC A;  1KLG D;  2JN4 A;  1HZB A;  1JIC A;  2D0O A;  1NMG A;  2RBM A;  4QIW B;  4UP9 A;  1CA6 A;  4JI7 L;  4DR6 L;  2VXW A;  3KYH C;  4XXE A;  2LXK A;  4CBV A;  4DA2 A;  1E2V A;  2FIN B;  2IHE A;  2IW3 A;  2N49 A;  3FPP A;  3K8A A;  1K83 H;  1KRT A;  1TWH B;  1JE4 A;  3HOV G;  3P7J A;  4BY7 H;  3Q23 A;  3NE5 B;  4O42 A;  4AQY Q;  1QZH A;  1LT4 D;  2NVQ H;  2OTJ A;  1VQF A;  4KV6 A;  2K4K A;  3TP5 A;  1I4R A;  1OXT A;  5GRO A;  5CGK A;  2F03 A;  2HDL A;  1EOT A;  2CQO A;  4GLA C;  4PZ6 A;  4ALP A;  4PMC A;  1GUN A;  3GP7 A;  1Q46 A;  3ER0 A;  3MHB A;  3OMC A;  1M4V A;  4OO1 G;  3HOY G;  5ELE A;  3J7Z C;  5CV4 A;  1OTC A;  5HUR A;  3A5U A;  4O1N A;  1HR0 W;  5EPL A;  2RF4 A;  3PO3 B;  1EIY B;  2OWO A;  1Z7T A;  4EGV A;  1I3Q B;  3IL8 A;  3SGI A;  1O7L A;  2EYH A;  4C3H H;  3HOW G;  2IJ0 A;  4FXK C;  1O80 A;  3BDL A;  3K5O A;  1PRT F;  2KVM A;  2B2Y A;  1TS5 A;  1WVL A;  1J5E Q;  2XRS D;  4XQN A;  2KEC A;  1CKN A;  4P75 A;  1G6P A;  3OWE B;  3IFD A;  3I70 A;  4NXM Q;  1F77 A;  3STB C;  1HNZ L;  2YU9 H;  3S1M B;  4HSV A;  1SMX A;  2ZXR A;  1JOQ A;  4KD4 A;  4F88 A;  1NR4 A;  1VQM A;  2C9O A;  1K3R A;  3T1Y Q;  2CHB D;  1VCI A;  2WP8 J;  1WYD A;  5T1I A;  2FHT A;  2V1C C;  2QF7 A;  4QGU A;  4DR5 Q;  4PQX A;  3DUZ A;  2F3V A;  3KFU A;  1DJR D;  3JAM L;  2JA8 H;  1UWV A;  3NWS A;  5AJ3 L;  4DV5 Q;  4J15 A;  3BYT B;  5FO9 B;  1K3B C;  1X3P A;  4JI8 L;  5M3M G;  4NPS A;  4OX9 L;  2B2V C;  2NVQ B;  2K7V A;  2KA7 A;  1JCK B;  1DM0 B;  1MHW C;  2DY7 A;  3D4R A;  1IBM L;  4DV2 L;  4A3J H;  4KJN A;  1FR3 A;  1HA6 A;  4A3I H;  4JBW A;  4PZ8 A;  1PXU A;  4CDE C;  5FLM G;  1BCP F;  1V1O A;  4EQN A;  5FLX c;  2OEO A;  3K58 A;  1HFN A;  4FF4 A;  1TT2 A;  3FKI H;  2EXZ A;  3PUW A;  2MPM A;  3BVM A;  4RGM A;  5LL6 X;  3DM1 A;  1QJO A;  4JOI C;  1PTO D;  1XMQ Q;  4XQJ A;  2E2H H;  4DV7 L;  3A5Z B;  1WTH A;  4QF4 A;  3K7A B;  1U0L A;  3CMA A;  1IBL L;  4JBM A;  2EZV A;  1EZ8 A;  3N6R A;  4HIO A;  3C1F A;  1SE4 A;  4BWG B;  1GUT A;  5HGQ A;  5IYD H;  3BDO A;  4RWS C;  5ELC A;  4DUY L;  3PO2 G;  1L0X B;  4L63 B;  1EWC A;  3GTL H;  3M7N A;  4JI3 Q;  4Y7N H;  1Q82 C;  2VQE L;  4FYD A;  3NEM A;  1N33 Q;  2AUK A;  4JC0 A;  4U68 A;  3GV3 A;  1HUN A;  1SN8 A;  4EX5 A;  3NTH A;  1A0I A;  3MA2 B;  4JI1 L;  4A93 H;  1GUS A;  3URY A;  5GAG C;  4GOP A;  1TWF H;  4U67 3;  2RSO A;  3PUX A;  4FDB A;  3PGZ A;  4DV4 Q;  5KNC A;  3PIP A;  1VQL A;  1HNW L;  5C0X G;  3ZJY C;  1OXU A;  2RCF A;  3OW7 A;  1QZG A;  5EPJ A;  2JA5 H;  1LTI D;  5F2D A;  3NQI A;  5C4X H;  4DR3 L;  3TBI B;  2EYF A;  4XTC S;  4HJ8 A;  1PLF A;  1A62 A;  4OEM B;  4PZ7 A;  1UUP A;  1D7Q A;  4POF A;  3MEF A;  2D2C C;  3H3V C;  4RAU C;  1WTW A;  3CCU A;  4PNY A;  1EYA A;  4QL5 A;  4G4K A;  4P73 A;  1JB7 A;  4L8J A;  5JJK A;  4X65 Q;  1ZYR C;  1DOM A;  3T16 A;  4NDX A;  1DCZ A;  4GOP B;  1TWA B;  2R7D A;  1MGS A;  5C5M A;  4RKL A;  3I4N G;  3J7Y W;  2RSN A;  2XWB B;  2WV6 D;  4LF6 Q;  1EIH A;  1YNX A;  1BQQ T;  4NXN Q;  2Z8L A;  3BYY B;  3PIO A;  1K8O A;  1HTP A;  1N34 Q;  2PQA A;  4IFD H;  3I72 A;  2UXD Q;  3PQI A;  4OGQ C;  2KHJ A;  3M85 A;  1VQ6 A;  2NZ1 D;  4TSS A;  1EWI A;  4HTH A;  3STB D;  2F4V Q;  3Q8D A;  2JA6 H;  2RVL A;  5E3F A;  1CKO A;  1VQE A;  4A3D B;  4C1N K;  4YY3 L;  3HS0 C;  3NSW A;  3ULJ A;  4AYB G;  4Y52 H;  1D2B A;  3GV6 A;  1X65 A;  2JYO A;  3UE1 A;  4KHV A;  1BUV T;  1WTX A;  2WAQ G;  2E2I B;  4AH6 A;  1MBY A;  4OO1 I;  3S2D H;  4Y7N B;  4ME5 A;  2KHS A;  4CHT B;  4IUU A;  1B53 A;  3MVV A;  1NJI C;  5IGB A;  2CKZ B;  4JI2 L;  2PQA B;  3E9H A;  3CCR A;  3H0G G;  3T53 B;  5JVG 3;  1LAB A;  3C3L A;  2NN6 G;  5IIF A;  3JAM c;  2IL8 A;  3TSS A;  3PCO B;  3DWA A;  4A93 B;  2R7Z H;  1CI3 M;  1HQM C;  3W1G A;  3SEB A;  2Z1C A;  2L11 A;  1YVC A;  1CK1 A;  2VUM G;  3GTQ H;  5KYI A;  2Z4I A;  4LNQ A;  2B2T C;  2EJG C;  2ZJP A;  1E1T A;  1BDO A;  3I56 A;  1SNO A;  4IUQ A;  5IYB H;  4C3I G;  2R92 G;  2YTV A;  3UI2 A;  1A2T A;  1RF2 D;  2SEB D;  2IX3 A;  1DD2 A;  2I5H A;  2A5H A;  2CCZ A;  1TVX A;  2L9H A;  1Q3L A;  1X6O A;  3PMF A;  3HOY B;  4JI0 Q;  1KDA A;  1VQA A;  4LJZ C;  1ESF A;  3DLL A;  4GKK Q;  2DGY A;  1G2T A;  4X66 L;  4K6D A;  1STG A;  4JI6 L;  5KRU A;  2UXB L;  3HOX G;  3A0J A;  2K01 A;  1HXY D;  2JEA I;  3HKZ B;  2SNM A;  3HOW B;  1JB3 A;  3M9B A;  4CDD C;  5CBE E;  3D6C A;  2HD3 A;  5COY A;  4KJO A;  3W3A A;  1KTK A;  3QR8 A;  4O0A A;  3PUV A;  2B63 H;  4B9X A;  2R7F A;  1O7Y A;  5KND A;  3OW2 A;  1QUQ A;  2H1E A;  3CCQ A;  1Y1W G;  1DOK A;  5FKA C;  1HQR D;  2JXM B;  1D8L A;  1JE5 A;  3MXN B;  4GKJ Q;  5DNF A;  2Q8I B;  4BXX G;  1OXX K;  4B3T Q;  3HOU G;  3HRZ C;  1UAP A;  3NTK A;  4DV6 Q;  2DJF C;  3S1R B;  5EKK A;  5AFW A;  4BBR G;  3K5N A;  4K14 A;  3QJY A;  1NMF A;  5J39 A;  3A8K E;  4IFD J;  1AFP A;  2M9V A;  2SDF A;  1GJX A;  1LM0 A;  3GTQ B;  4JG2 A;  3RZO H;  2PQE A;  3M3Y H;  1JWU D;  1ZYR D;  3RN2 A;  5M3M B;  1RTO A;  3HKZ E;  4EQ5 A;  4F8M A;  1H9J A;  3RUZ A;  5IP7 G;  4JV5 Q;  4CJ1 B;  2XSC A;  3SK4 A;  1I6V C;  1XWE A;  2YV5 A;  3BZC A;  5COR A;  5FJ8 G;  5C3E G;  4DUY Q;  1H9S B;  3HP3 A;  1CT1 D;  4CDF C;  1EWH A;  1O78 A;  2RHS B;  5GAE C;  1CFM A;  5C0X I;  1SYE A;  2MO1 A;  3CD6 A;  3CU7 A;  5IYC G;  2BA0 A;  3C1E A;  3K57 A;  1B50 A;  4A3F H;  1J8I A;  3M4Y A;  5G3L F;  1PRT C;  3RLN A;  3EIV A;  1QCB D;  3OOC A;  5I6Y A;  4JI1 Q;  1IL2 A;  1P8L A;  3QWN A;  2UUC Q;  1CQF A;  2F3I A;  1STH A;  1NSN S;  1YNN C;  3E0E A;  2N3S A;  1HNW Q;  3BG3 A;  1ICW A;  4LUV A;  2WFW A;  3K0Y A;  2OXP A;  1LTG D;  3BZD B;  3S16 B;  3NBI A;  5HY6 A;  4DR3 Q;  1KNA A;  1NAP A;  3H0G H;  1IYJ B;  2F0D A;  3KF6 B;  2K04 A;  1J5E L;  1EY8 A;  1GHK A;  4NXM L;  1ZXT A;  4B9W A;  5CV6 A;  2E5L Q;  4GZY C;  2K50 A;  2MJ8 A;  2QIL A;  4EQO A;  2F0F A;  3UDX A;  1U4R A;  3GQB A;  2DN8 A;  5DLQ E;  4GNX A;  2K05 A;  2PPB C;  4FP5 D;  4A3G G;  1JC7 A;  1A3T A;  3T1Y L;  1X9N A;  4R4O A;  4HJ9 A;  2D62 A;  4WOR A;  4DK6 C;  2F0U A;  2B2W A;  2IWH A;  1XNR Q;  2FFK B;  4DR5 L;  4DV0 Q;  4B3S Q;  1HZC A;  3VYS A;  3W2D A;  3H15 A;  1SMY D;  1PZI D;  4R1J A;  2F0T A;  1W3S A;  4CKE A;  4NP5 A;  1X3F A;  1SYC A;  1VQO A;  1GVP A;  4DV5 L;  4JK1 C;  3I4N B;  3CXC A;  2X6L A;  4K2L A;  3U4V A;  5I9P A;  3K5M A;  4GNX B;  1YJW A;  4DF7 A;  3I4M G;  3S17 H;  3OYY A;  4RMF A;  1D1I A;  1XNQ Q;  1S4Z A;  1S3O A;  3CCV A;  1SRO A;  2AQ2 B;  5FO7 B;  3PV0 A;  2BDN A;  1A6X A;  4RGO S;  1KAA A;  3KBG A;  1H95 A;  2AWN A;  3NPP A;  2F1M A;  1D5Z C;  5ELO A;  2HQL A;  3NEN A;  2Q2H A;  4S3S A;  2XTI A;  5A35 A;  4AYB B;  5A2Q L;  4HN7 A;  4QJF A;  4DFA A;  1XMQ L;  4A3E H;  2WAQ B;  1QB5 D;  4A3M G;  4O2D A;  1EY6 A;  4RKB A;  2A1A A;  5K36 G;  1SJH D;  3HOU H;  2VZA A;  1SE3 A;  3H0G B;  4P72 A;  5LL6 S;  1EYC A;  1TS2 A;  3VYT A;  5I2X A;  5KIX A;  1KAB A;  4JI3 L;  4V19 0;  1SJE D;  1TWH H;  1N33 L;  1S72 A;  1V1P A;  2E76 C;  1B9N A;  3OIQ A;  1GO3 E;  1PZK D;  4H44 C;  1R4Q B;  1LTT D;  1ICF B;  2AMC B;  3WOF A;  1NE3 A;  1DXM A;  4C3I B;  2NYZ D;  2R92 B;  3VA5 A;  1PH9 A;  4DV4 L;  2PNR C;  4FXG C;  5C4Z A;  2K5H A;  5H1S E;  3NEL A;  3HGB A;  1A63 A;  3J81 c;  4QCL A;  3QIA A;  4N9P A;  1LO5 D;  3R8B A;  5EBC A;  5LMN Q;  2F0O A;  1EQV A;  3PO3 H;  2EY6 A;  5A2Q E;  2H4O A;  1VDZ A;  1I3Q H;  5M5X H;  4KY5 A;  1V1P B;  3L3O C;  1PRT D;  3CPW A;  2QW7 A;  1KD1 C;  2B2Y C;  1YHA A;  3DM3 A;  1XTC D;  5JEA H;  1SEB D;  1YNN D;  4X65 L;  3S9W A;  4Q0F A;  4R4T A;  1VQP A;  1IYV A;  2K5W A;  4DKA C;  2JA9 A;  1ILQ A;  1CSP A;  1HZ9 A;  3S1M H;  5IOC A;  4LF6 L;  1XJV A;  4NXN L;  4G57 A;  5BN5 A;  3NUC A;  1YHB A;  2F0K A;  3VA7 A;  4IPC A;  1N34 L;  4NKL A;  3KBX A;  4A4I A;  2UXD L;  3CW2 C;  1K8A C;  3Q24 A;  1PYW D;  2YYZ A;  5CV7 A;  2F4V L;  4A3E B;  1Y1W B;  3AFP A;  1R4P B;  4ZK9 B;  3L2P A;  1KIX A;  2ALY B;  2KCC A;  3HOU B;  3TZD A;  1EY0 A;  2DUD A;  4DV3 Q;  3VYR A;  2HCC A;  1QVG A;  4BBR B;  2HT1 A;  4HJ7 A;  1YNJ C;  1GKH A;  1EUJ A;  3NP8 A;  3DXJ C;  4ODG A;  4WFN 3;  3ERQ A;  2E74 C;  4KHZ A;  2CH4 W;  4YWK A;  1KNE A;  2K5N A;  3KOJ A;  2PW7 A;  4UP7 A;  3NWT A;  4R4I A;  1WI5 A;  1D5X C;  3SXH A;  1TII D;  1HUM A;  4X3S A;  2UUB Q;  1U9R A;  2D0P A;  5LMU Q;  5C3E B;  3NTI A;  2NBF A;  3I55 A;  4A3K G;  1HR0 Q;  4KKS A;  4ULL A;  4X3K A;  4LK1 C;  1OO9 B;  3M4P A;  5M5X B;  5C4J B;  1OXS C;  3ICE A;  3K7A H;  3L9A X;  2RQX A;  1CSQ A;  1PFN A;  1WTV A;  3RN5 A;  2BH2 A;  4R4C A;  4CKC A;  1YIJ A;  2JSO A;  2MP1 A;  4JI0 L;  4DAY A;  4QIW E;  1LLR D;  3HKS A;  4Q5V A;  1U5K A;  5CYU A;  2ICI A;  1VQ8 A;  2XGT A;  5IP9 H;  5DAU A;  4GKK L;  1F9P A;  1Y1V G;  2CQA A;  1F2M A;  3CCE A;  2K33 A;  4X64 Q;  5KGU A;  2ID0 A;  2IX1 A;  3OHX C;  1KAW A;  1NUC A;  1SE8 A;  1YBY A;  2F52 A;  1G91 A;  4GOP C;  3E6Z X;  1NNX A;  4DK3 C;  4DNR B;  2CFM A;  1YJ9 A;  4YCW A;  1VQD A;  4LF8 Q;  4RFB A;  5CR3 A;  1EEF D;  2L4N A;  2E2J B;  1I4X A;  4DAY B;  2AWO A;  1VQJ A;  1B3A A;  3DHQ A;  4K8I A;  4L5S A;  4A3G B;  3I73 A;  5DM7 3;  4LF5 Q;  3PF4 A;  2WB1 G;  4L5Q A;  5JEA J;  4GKJ L;  2R3Z A;  1X3G A;  3U50 C;  4B3T L;  3M7G A;  4B3M Q;  4N9T A;  4DV6 L;  2F0E A;  5C3X A;  1GUO A;  1IHZ A;  1TWA H;  2Y0S G;  3CPF A;  1I6H B;  2EYP A;  1ONL A;  2NVT B;  5IWA Q;  4DR4 Q;  1TY2 A;  2EDG A;  3SVM A;  1KDC A;  3V2T A;  4IUP A;  1Q90 A;  1E2W A;  5E7N A;  1CQV A;  3I4M B;  1ZEQ X;  4J1M A;  4J8Q A;  1K9M C;  4JV5 L;  3BJU A;  4A3D H;  1SR3 A;  4I7A A;  4MHE A;  2HUG A;  1VQN A;  1EY9 A;  3I4O A;  2WII B;  3SK5 A;  5IT9 L;  3BVZ A;  1B4O A;  5NUC A;  4KY7 A;  4IPD A;  4ZUI A;  3D0F A;  2E2I H;  4GLX A;  4ZAI A;  2B2U A;  2OF1 A;  2SOB A;  1Y8N B;  2TSS A;  2AHO B;  3E5S A;  3TN2 A;  3SHL A;  4JBJ A;  5IGC A;  5KEE A;  2BE5 C;  3TDQ A;  3AQQ A;  3N52 A;  1PA6 A;  1IL8 A;  2LKV A;  4IAL A;  2A73 B;  3Q22 A;  2EY1 A;  2UUC L;  4C2M B;  1V9P A;  1YJN A;  1YNJ D;  4LF4 Q;  1VQB A;  1UE5 A;  4FF3 A;  3HOV H;  1CTM A;  1LTB D;  1A3U A;  1G29 1;  1EQQ A;  4JYA Q;  3I3C A;  3R3O A;  4LF7 Q;  2GA4 B;  1P16 A;  3TP8 A;  5FK9 C;  2L5T A;  2RDH A;  1PHJ A;  3ONA B;  3VR4 A;  5CV9 A;  4N8F A;  2E5L L;  2F0N A;  4OO1 H;  3HOY H;  2YTX A;  4X3T A;  1E7Z A;  1FJG Q;  2CW0 C;  1N9W A;  4CJ2 C;  4DV1 Q;  2KEN A;  2P5Z X;  5IT9 E;  4B3R Q;  3PSI A;  3J7A F;  2VS1 A;  4PMW A;  1K73 C;  4J6H A;  1NY4 A;  1EY5 A;  1STY A;  1H9R A;  3GTP B;  2XIW A;  1XNR L;  2FXQ A;  4K5X A;  4DV0 L;  4B3S L;  3CHB D;  1IW7 C;  2JJQ A;  1BR9 A;  1L1O A;  3HOW H;  4HID A;  2B39 A;  4GN3 B;  2E2D C;  1YHQ A;  4AIM A;  2NVY B;  2V4D A;  4LF9 Q;  1WTP A;  2HHH Q;  2F0V A;  1E22 A;  2R61 A;  4IUV A;  1SNM A;  2I5L X;  4F7X A;  5IOD A;  3KLW A;  1EY7 A;  1JJC B;  2EYJ A;  1EFI D;  4A3L G;  3S2H H;  1X56 A;  2UU9 Q;  2Q8T A;  4DNI A;  2ZXP A;  5J1Z A;  3CQZ H;  1H9K A;  1XNQ L;  1XPU A;  1Q1B A;  1NBW A;  1BOS A;  2VQF Q;  3D4D A;  5IGE A;  5BR8 Q;  5EKL A;  3GTG H;  2MQH A;  3QG1 A;  1L1O B;  3KJP A;  2JK8 A;  3S1R H;  2AQ3 B;  4HJ5 A;  1S5E D;  4X3U A;  3NBH B;  1QWY A;  3ND8 A;  3M4O B;  3OIP A;  1DYQ A;  3G7L A;  3CCJ A;  2KCM A;  4UHV A;  3TZU A;  2UUA Q;  1X54 A;  4ZKB B;  3HOV B;  4QY7 A;  2BDO A;  1HNX Q;  1SSO A;  5M3M H;  3FPU B;  4XDX A;  3OTO Q;  3CCL A;  4IPG A;  1JOO A;  1HHV A;  2UXC Q;  4NMZ A;  4FF1 A;  2ENB A;  5FLM H;  2B8F A;  5M5Y H;  4A3B G;  1PV4 A;  3LX0 A;  1MJE A;  3HOZ G;  1RTN A;  2ICE C;  4JI4 Q;  5IGF A;  1LT6 D;  3I7F A;  3E9I A;  3QB3 A;  4HMI A;  3CF5 A;  1C8C A;  4A3K B;  1LYL A;  5KNB A;  3H3V I;  3MXN A;  3H09 A;  3KUP A;  1SYG A;  4H0L C;  3F8T A;  3PO2 H;  3H6M A;  4LUO A;  4R9W A;  1RD9 D;  2BE5 D;  5M3F G;  3VYU A;  5LMN L;  2QEX A;  2Q2U A;  2D9U A;  1B1Z A;  3TQY A;  1UE1 A;  1AN8 A;  2A6H C;  4A76 A;  1Y1V B;  3S2H B;  3I4L A;  3S16 H;  4R4Q A;  1MD2 D;  4DXG A;  1PH1 A;  4XYO A;  5D3I B;  1A15 A;  1EEI D;  4ZCK A;  3HEJ A;  1W2B A;  1A3V A;  1F9R A;  3CQZ B;  1UE7 A;  3U4Z A;  5IE8 A;  2RA4 A;  4ME3 A;  1X55 A;  3SK8 A;  2JA7 G;  4GNX C;  3GTG B;  5C0X H;  4KI0 A;  3K59 A;  2VB3 X;  3OWF A;  1JR0 D;  1H9S A;  2F0P A;  3R2T A;  1EQT A;  1AEX A;  1FGB D;  1B3Q A;  4MZ9 A;  4BBS G;  2B2W C;  3NQT A;  2WB1 B;  2IHF A;  2K6A A;  2CW0 D;  3F2C A;  4OEL B;  4PV1 C;  4APV A;  4IUT A;  5BN4 A;  4HED A;  3RLF A;  2ES2 A;  1B8A A;  4WRD A;  4DV3 L;  4HCE A;  5C44 G;  1TWC B;  3U9O A;  4NW2 A;  2QEJ C;  2Y0S B;  4K6L A;  4TKO B;  4A3C G;  2RKS A;  2BA1 A;  4FNF A;  1IW7 D;  3BS1 A;  5EKI A;  1VQK A;  1H9M A;  3I4N H;  3LNN A;  4TRD A;  5M5Y B;  2AUJ D;  5EGT A;  5K5P A;  1U4P A;  2BCO A;  2MHV A;  2EOT A;  1VQ9 A;  1LT3 D;  2XWJ B;  1N32 Q;  1Y8P B;  4HSP A;  5FO8 B;  3KF6 A;  3EFX D;  4OWT B;  4R8N A;  4DXF A;  4I7Z C;  3CC7 A;  1B9M A;  4RGN A;  3L0O A;  3J80 L;  1MI2 A;  4JVZ A;  1N36 Q;  3CCS A;  2UUB L;  1F2L A;  3CP0 A;  3VR5 A;  4X6A H;  5LMU L;  3PO2 B;  1EIG A;  4OIJ A;  1HR0 L;  4OWX B;  2XN9 C;  2KQ3 A;  1VF7 A;  1A2U A;  2HCI A;  3WWV A;  3CCM A;  4BY1 G;  2QDB A;  2WB1 E;  3P20 A;  4C3J G;  2F0L A;  2WAC A;  1KL9 A;  3TS0 A;  2ZT9 C;  1LTS D;  4RHS A;  3WOE A;  4QQB X;  1F9S A;  2NN6 H;  2GVA A;  3RLO A;  5GAH C;  3X3M A;  2JE6 I;  1RJT A;  1SYF A;  4KKT A;  3T4A C;  2EYM A;  3E0J A;  4X64 L;  5ELF A;  4M8A A;  1Q12 A;  2A19 A;  4EQP A;  1CA5 A;  1BVS A;  4PMB A;  3MXU A;  5D3D A;  2VUM H;  1LTR D;  3SK6 A;  2A6E C;  2E8G A;  1Z47 A;  3F2U A;  3J81 j;  2BOS A;  5JJL A;  3OPO A;  5DM6 3;  4C3I H;  1PFS A;  1KHI A;  4FO2 A;  2R92 H;  3BDC A;  3AYH B;  2Z0S A;  4LF8 L;  4K0K Q;  1PFB A;  4CKB A;  1JQY D;  1AP0 A;  3J80 E;  1X3E A;  4ILW A;  1NCV A;  3G6J B;  3RNU A;  3HOZ H;  1SDF A;  3X3N A;  4LF5 L;  4DR1 Q;  4EVO A;  1VQ7 A;  3U9S A;  4M1U B;  2A68 C;  1BCP C;  4BY7 G;  1EU4 A;  3NHH A;  1N8R C;  2KCN A;  3TME A;  1R9T B;  4LFA Q;  4YCU A;  2QGQ A;  4CDC C;  3HOX H;  2Z6B A;  4P74 A;  4B3M L;  1JOR A;  3QO2 A;  3KF8 A;  1I94 Q;  1GUW A;  1MIU A;  3VR3 A;  5C0X J;  2A6H D;  5GQO A;  3CAM A;  5IGD A;  5IWA L;  4DR4 L;  3R2I A;  3P75 A;  3MEH A;  2MGS A;  2MO0 A;  1WTR A;  1I5F A;  4F87 A;  1J9O A;  2Q8R E;  1EFW A;  1JJG A;  5GAD C;  4R8I A;  2MUY A;  3F2D A;  4KK7 A;  3GO5 A;  1K28 A;  3DEP A;  1Y1W H;  1IKM A;  1JMC A;  2PMZ B;  2OCE A;  4ZUJ A;  3KJO A;  4C3H G;  4BXX H;  1M90 C;  1ML0 D;  1TR5 A;  1TS3 A;  3A8J E;  2LFN A;  1YEZ A;  3KF8 B;  4KD3 A;  1Z6H A;  1EY4 A;  1PYS B;  4X62 Q;  4BBR H;  3LGJ A;  4DGZ A;  5M5W B;  2PCF B;  1GM5 A;  3T56 B;  2ZJR A;  4G7H C;  1FD7 D;  4K5V A;  2IT1 A;  2VUM B;  1KRS A;  2L55 A;  3S15 H;  3GTO B;  4XT1 B;  2NZH A;  3RD4 A;  3MTS A;  2A69 C;  1AE3 A;  3EA6 A;  4WJW A;  4CJ0 B;  2OTL A;  5IP7 H;  4LF4 L;  1STB A;  1XXG A;  1CHQ D;  3MWY W;  3CME A;  4XT3 B;  4LFB L;  1MKH A;  5FJ8 H;  5CMD A;  4AYB E;  4A3B B;  5C3E H;  3WDN A;  4JYA L;  3HOZ B;  2KUM A;  4LF7 L;  2JA8 G; 
#chains in the Genus database with same CATH homology
 2HQE A;  4KMU C;  1JOK A;  1QOH A;  4KN4 C;  5I2Y A;  3Q6S A;  3CRL C;  2I07 B;  2NTT A;  2PZU A;  3HOX B;  4TQU S;  1C4Q A;  1HRJ A;  1ET6 A;  5M3F B;  2F4I A;  3PUZ A;  4KN7 C;  1BF4 A;  5FLX L;  4RH6 A;  1HCZ A;  2J7Z A;  3O13 A;  1D1K A;  2K03 A;  1Q8I A;  1STA A;  2DY8 A;  1SNC A;  2JA7 B;  1W6K A;  2A6E D;  4DK0 A;  3VR2 A;  2EJF C;  3GTM B;  2NTS A;  1FNV A;  2NWG A;  2X69 A;  4BA1 I;  3GTK B;  2O2L D;  2KOL A;  4BBS B;  1S5B D;  1SAP A;  2G9D A;  1U4L A;  1SNQ A;  4MIU A;  1VF5 C;  5I6W A;  4ZYS A;  2LS0 1;  2F0W A;  1S5D D;  4UAI A;  3S15 B;  4I65 A;  4IZ8 A;  1XYI A;  2VB2 X;  2A68 D;  1BCP D;  4E6I A;  5C44 B;  1PZJ D;  1Y8O B;  5E4X A;  1JWS D;  1PTO H;  5JOB A;  3QOJ A;  3T51 B;  4IQZ A;  1GHJ A;  4B08 A;  2K32 A;  3MZ5 A;  5FLX E;  1BXT A;  5CBA E;  1UNS A;  1KDB A;  1VMP A;  2B2U C;  4QB4 A;  2KEE A;  3A7A B;  3S14 B;  5J22 A;  3ERO A;  1IYU A;  4DN4 M;  4BY1 B;  4C3J B;  4IFD G;  5K36 H;  1SE2 A;  4QMG A;  2O4X A;  4HMJ A;  2WKD A;  1I50 B;  4H13 C;  1S5C D;  4QUF A;  1G2S A;  1CM9 A;  4YIJ A;  1ZKO A;  2J4X A;  2A69 D;  4FVM A;  1FNU A;  5KYL A;  4G7Z C;  3C46 A;  1FYC A;  1S5F D;  1WD0 A;  5ELB A;  1F9Q A;  3KLS A;  1AZQ A;  1U4M A;  1ILP A;  2F0I A;  5CV5 A;  1UEA B;  2EY5 A;  3EJI A;  1K83 B;  1PTO B;  3C2P A;  4BY7 B;  1KLU D;  2Z4H A;  3RMH A;  4C1N I;  1PFM A;  2EPB A;  2K1B A;  2EE1 A;  1VMC A;  3R93 A;  3OSO A;  3V96 A;  4RGT A;  1SNP A;  1V43 A;  2EJM A;  4IN3 A;  1STN A;  5TSS A;  4A3M B;  2PW5 A;  4RCO A;  5CV8 A;  4RA8 A;  4C3H B;  1RCV D;  1GOZ A;  2IPK D;  4DU9 A;  3A54 A;  3MAQ A;  3S1N B;  3JAM E;  2LY7 A;  5IGG A;  3DEO A;  2YU9 B;  3EVQ A;  4V0B A;  1I4G A;  1PMR A;  3K6O A;  3H94 A;  3FDT A;  5EJW A;  2F0G A;  1EZ6 A;  3TP7 A;  1WTQ A;  2QCP X;  1QNU A;  3AB9 A;  3ZYY X;  1CZW A;  3BVG A;  2EY2 A;  5D14 A;  3MC0 B;  2JA8 B;  3LWU A;  2XRQ D;  1ENC A;  1Q1E A;  4H7B A;  1TWG B;  1ESR A;  4KY6 A;  1TS4 A;  2B2V A;  3NBH A;  4OL7 A;  1B44 D;  2FMM A;  1IKL A;  1BNZ A;  4A3J B;  4LAA A;  4A3I B;  2F0J A;  5DEH A;  3FKI B;  4OHJ A;  3DMU A;  1MSH A;  3ITP A;  1AW7 A;  2E2H B;  3A56 A;  1W6J A;  1PTO F;  4DK1 A;  1L0Y B;  2KED A;  1E0B A;  1STE A;  1DON A;  3I91 A;  4ID6 A;  1SXT A;  2NB0 A;  1BBX C;  3HG9 A;  2DNC A;  1ENF A;  4BA2 I;  2C5C A;  1GUG A;  5CC4 A;  1V8Q A;  3GTL B;  1GXD C;  1RHP A;  4ABN A;  1SYB A;  4HCS A;  1PDQ A;  4DAV A;  4FXD A;  1LV9 A;  1EYD A;  4ZLT F;  2XVS A;  4G7O C;  4K8J A;  1NR2 A;  1TWF B;  4IFD I;  3D31 A;  2PYK A;  1AZP A;  3NK9 A;  3OMG A;  1DOL A;  2EYL A;  2JA5 B;  4DAP A;  5C4X B;  1Y69 U;  5G3L D;  4BS9 A;  5JJZ A;  1I4H A;  3PIP 3;  5C6A A;  5C3W A;  1K8M A;  1EU3 A;  2PO4 A;  3CRK C;  1QIL A;  1SMY C;  4ZRZ A;  4OIK A;  2O5J C;  2XNA C;  1HA5 A;  4KTA A;  1DZ1 A;  1RKN A;  2E75 C;  2JP1 A;  3KLS X;  4IUN A;  1WTO A;  2PZT A;  1LT5 D;  2JA6 B;  1LTA D;  2D5D A;  1BO0 A;  4ZQ3 A;  3PIO 3;  3GTJ B;  2NVX B;  3A7L A;  5JAV A;  3J7A V;  3S2D B;  4FF2 A;  4DNT B;  1MSG A;  5EBD A;  1I4P A;  2M2L A;  2AQ1 B;  2M00 A;  1T5E A;  2ZXO A;  3DWP A;  2R7Z B;  2EVB A;  4KKU A;  1HTL D;  3L7Z C;  2X6G A;  3T13 A;  3A8I E;  2WKC A;  2WIN B;  2J0T D;  3HZX A;  3IKJ A;  1CHP D;  2B2T A;  2K5Q A;  2N88 A;  3FMC A;  2QKI C;  5BN3 A;  4K5W A;  3EQL C;  3AMU A;  4RCN A;  3J81 L;  4LMQ D;  3I8Z A;  1ROD A;  3AU7 A;  4Z9C B;  5D65 A;  4XQQ A;  2JEB I;  5LHY 1;  3P1H A;  2G9H D;  5JEA G;  1X3Q A;  5C4H A;  5I9O A;  1TQO A;  1O7Z A;  1HFG A;  3QOL A;  1I4Q A;  1JWM D;  2L1B A;  1WCM B;  2B63 B;  3MXP A;  1F2Y A;  2L12 A;  2VNU D;  3A55 A;  5M9O A;  4UDU C;  4CGY B;  5C5L A;  1SND A;  3VR6 A;  3MFY A;  1D5M C;  5ELD A;  2IX0 A;  5T1G A;  1EL0 A;  3NXW A;  2I46 A;  4C56 C;  2LMC B;  4HR7 B;  2B8G A;  3J81 E;  2K28 A;  3MFG A;  2RDF A;  1M8A A;  3DWQ A;  1WD1 A;  3RZO B;  3M3Y B;  3IFT A;  5HGT A;  1QG7 A;  2K5D A;  2HDM A;  5E1F A;  1SYD A;  2RDG A;  2O5I C;  2SNS A;  3S1Q B;  4IUR A;  2FJ2 A;  5EQ0 A;  1TKW B;  1SBB B;  3TP6 A;  1ET9 A;  2NN6 I;  2R6G A;  4K2K A;  3MXG A;  4XIG S;  2TMP A;  3D4W A;  1ENA A;  3FVQ A;  4XYQ A;  5E4W C;  1G6Z A;  2EYO A;  4A3F B;  3SDZ A;  2N55 A;  5EPK A;  1HPC A;  2CVR A;  2NUC A;  1QE6 A;  1RDP D;  3IAY A;  5I4D A;  1SFO B;  3H91 A;  5ISR A;  3RZD B;  3D6W A;  2F0M A;  2L0C A;  3LWE A;  1PRT B;  1G8Z D;  3D8G A;  1E2Z A;  3V05 A;  1CZG A;  3K5L A;  4QUC A;  2PZW A;  3FEW X;  1D6E C;  3CKI B;  2F3W A;  3I90 A;  4RHR A;  2R93 B;  5JPM C;  2F0S A;  1FNW A;  3PUY A;  1TY0 A;  2A74 C;  5JVH 3;  1B2T A;  3Q0A A;  1C48 A;  5FOB B;  4MN3 A;  3S17 B;  3KK7 A;  2F0Q A;  3GD7 A;  1LAC A;  1II3 A;  3KLR A;  1QNK A;  1F2Z A;  1PTO C;  1XX8 A;  3ND9 A;  2DNE A;  4HAE A;  1OXV A;  2KJX A;  1T5X D;  1X32 A;  2F0H A;  3SE0 A;  5JPN C;  4P2C B;  3FRP B;  4L6T B;  4ZKC B;  3D3R A;  2OT2 A;  1TU2 B;  3SR1 A;  1BCP B;  2FMC A;  1KLG D;  2RBM A;  1JIC A;  4QIW B;  1CA6 A;  2VXW A;  4XXE A;  4CBV A;  4DA2 A;  1E2V A;  2FIN B;  2IW3 A;  3FPP A;  1TWH B;  1JE4 A;  3P7J A;  3Q23 A;  3NE5 B;  4O42 A;  1LT4 D;  4KV6 A;  3TP5 A;  1I4R A;  1OXT A;  5CGK A;  2F03 A;  2HDL A;  1EOT A;  4PMC A;  1GUN A;  3GP7 A;  3MHB A;  3OMC A;  1M4V A;  4OO1 G;  5ELE A;  5CV4 A;  5HUR A;  4O1N A;  5EPL A;  3PO3 B;  1Z7T A;  4EGV A;  1I3Q B;  3IL8 A;  1O7L A;  2EYH A;  2IJ0 A;  4FXK C;  1O80 A;  3BDL A;  3K5O A;  1PRT F;  2KVM A;  2B2Y A;  1TS5 A;  1WVL A;  2XRS D;  4XQN A;  2KEC A;  3OWE B;  3IFD A;  3I70 A;  1F77 A;  3S1M B;  4HSV A;  2ZXR A;  1JOQ A;  4KD4 A;  4F88 A;  1NR4 A;  2C9O A;  2CHB D;  1VCI A;  2WP8 J;  5T1I A;  2FHT A;  2QF7 A;  4PQX A;  3DUZ A;  2F3V A;  1DJR D;  3JAM L;  3NWS A;  3BYT B;  5FO9 B;  1X3P A;  2B2V C;  2NVQ B;  2K7V A;  2KA7 A;  1JCK B;  1DM0 B;  2DY7 A;  3D4R A;  4KJN A;  1FR3 A;  1HA6 A;  4JBW A;  1PXU A;  1BCP F;  1V1O A;  4EQN A;  2OEO A;  3K58 A;  1HFN A;  4FF4 A;  1TT2 A;  2EXZ A;  2MPM A;  3PUW A;  3BVM A;  4RGM A;  5LL6 X;  3DM1 A;  1QJO A;  1PTO D;  4XQJ A;  4QF4 A;  3K7A B;  2EZV A;  1EZ8 A;  3N6R A;  3C1F A;  1SE4 A;  4BWG B;  1GUT A;  3BDO A;  4RWS C;  5ELC A;  1L0X B;  4L63 B;  1EWC A;  3M7N A;  4FYD A;  2AUK A;  4U68 A;  3GV3 A;  1HUN A;  3NTH A;  3MA2 B;  1GUS A;  3URY A;  4U67 3;  2RSO A;  3PUX A;  5KNC A;  5C0X G;  1OXU A;  3OW7 A;  5EPJ A;  1LTI D;  5F2D A;  3NQI A;  3TBI B;  2EYF A;  4XTC S;  1PLF A;  1UUP A;  2D2C C;  3H3V C;  4RAU C;  1WTW A;  4PNY A;  1EYA A;  4G4K A;  4L8J A;  1ZYR C;  1DOM A;  3T16 A;  4NDX A;  1DCZ A;  1TWA B;  1MGS A;  5C5M A;  4RKL A;  3J7Y W;  2RSN A;  2XWB B;  2WV6 D;  1EIH A;  1BQQ T;  2Z8L A;  3BYY B;  1K8O A;  1HTP A;  4IFD H;  3I72 A;  4OGQ C;  3M85 A;  2NZ1 D;  4TSS A;  4HTH A;  2RVL A;  5E3F A;  4A3D B;  4C1N K;  3HS0 C;  3NSW A;  1D2B A;  3GV6 A;  2JYO A;  4KHV A;  1BUV T;  1WTX A;  2E2I B;  1MBY A;  4OO1 I;  4Y7N B;  4ME5 A;  2KHS A;  4CHT B;  4IUU A;  1B53 A;  3MVV A;  5IGB A;  3T53 B;  3C3L A;  5JVG 3;  1LAB A;  2NN6 G;  5IIF A;  2IL8 A;  3TSS A;  3DWA A;  4A93 B;  1CI3 M;  1HQM C;  3SEB A;  2Z1C A;  2L11 A;  1CK1 A;  5KYI A;  2Z4I A;  2B2T C;  2EJG C;  1BDO A;  1SNO A;  4IUQ A;  4C3I G;  3UI2 A;  1A2T A;  1RF2 D;  2SEB D;  2IX3 A;  1DD2 A;  2A5H A;  1TVX A;  2L9H A;  1Q3L A;  3PMF A;  3HOY B;  1KDA A;  4LJZ C;  1ESF A;  1G2T A;  4K6D A;  1STG A;  5KRU A;  2K01 A;  1HXY D;  2JEA I;  3HKZ B;  2SNM A;  3HOW B;  1JB3 A;  5CBE E;  3D6C A;  5COY A;  4KJO A;  3W3A A;  1KTK A;  3PUV A;  4B9X A;  1O7Y A;  5KND A;  2H1E A;  1DOK A;  5FKA C;  1HQR D;  2JXM B;  5DNF A;  2Q8I B;  1OXX K;  3HRZ C;  1UAP A;  3NTK A;  3S1R B;  5EKK A;  5AFW A;  3K5N A;  4K14 A;  3QJY A;  5J39 A;  3A8K E;  4IFD J;  1AFP A;  2M9V A;  2SDF A;  1GJX A;  3GTQ B;  2PQE A;  1JWU D;  1ZYR D;  5M3M B;  1RTO A;  4F8M A;  1H9J A;  3RUZ A;  4CJ1 B;  2XSC A;  3SK4 A;  1I6V C;  1XWE A;  5COR A;  1H9S B;  3HP3 A;  1CT1 D;  1EWH A;  1O78 A;  1CFM A;  5C0X I;  1SYE A;  3CU7 A;  2BA0 A;  3C1E A;  3K57 A;  1B50 A;  1J8I A;  3M4Y A;  5G3L F;  1PRT C;  1QCB D;  3OOC A;  5I6Y A;  3QWN A;  1CQF A;  1STH A;  1NSN S;  1YNN C;  3BG3 A;  1ICW A;  3K0Y A;  2OXP A;  1LTG D;  3BZD B;  3S16 B;  3NBI A;  1KNA A;  1NAP A;  2F0D A;  2K04 A;  1EY8 A;  1GHK A;  1ZXT A;  4B9W A;  5CV6 A;  4GZY C;  2MJ8 A;  2QIL A;  4EQO A;  2F0F A;  1U4R A;  3GQB A;  2DN8 A;  2K05 A;  2PPB C;  4FP5 D;  1JC7 A;  1A3T A;  2D62 A;  4WOR A;  2F0U A;  2B2W A;  2IWH A;  2FFK B;  3VYS A;  3W2D A;  1SMY D;  1PZI D;  2F0T A;  4CKE A;  4NP5 A;  1SYC A;  4JK1 C;  3I4N B;  2X6L A;  4K2L A;  5I9P A;  3K5M A;  4DF7 A;  1D1I A;  1S4Z A;  2AQ2 B;  5FO7 B;  3PV0 A;  2BDN A;  1A6X A;  4RGO S;  1KAA A;  3KBG A;  2AWN A;  3NPP A;  2F1M A;  1D5Z C;  4S3S A;  5A35 A;  4AYB B;  5A2Q L;  4HN7 A;  4DFA A;  2WAQ B;  1QB5 D;  1EY6 A;  4RKB A;  5K36 G;  1SJH D;  1SE3 A;  3H0G B;  5LL6 S;  1EYC A;  1TS2 A;  3VYT A;  5I2X A;  5KIX A;  1KAB A;  4V19 0;  1SJE D;  1V1P A;  2E76 C;  1B9N A;  3OIQ A;  1PZK D;  4H44 C;  1R4Q B;  1LTT D;  3WOF A;  1DXM A;  4C3I B;  2NYZ D;  2R92 B;  3VA5 A;  2PNR C;  4FXG C;  5C4Z A;  3HGB A;  4QCL A;  3QIA A;  4N9P A;  1LO5 D;  3R8B A;  5EBC A;  2F0O A;  1EQV A;  2EY6 A;  5A2Q E;  2H4O A;  1VDZ A;  4KY5 A;  1V1P B;  3L3O C;  1PRT D;  2B2Y C;  1XTC D;  5JEA H;  1SEB D;  1YNN D;  3S9W A;  4Q0F A;  1IYV A;  2K5W A;  1ILQ A;  5IOC A;  4G57 A;  5BN5 A;  3NUC A;  2F0K A;  3VA7 A;  4NKL A;  3KBX A;  3Q24 A;  1PYW D;  2YYZ A;  5CV7 A;  4A3E B;  1Y1W B;  1R4P B;  4ZK9 B;  2KCC A;  3HOU B;  3TZD A;  1EY0 A;  3VYR A;  2HCC A;  4BBR B;  1YNJ C;  3NP8 A;  3DXJ C;  4ODG A;  4WFN 3;  3ERQ A;  2E74 C;  4KHZ A;  1KNE A;  2PW7 A;  3NWT A;  1D5X C;  3SXH A;  1TII D;  1HUM A;  4X3S A;  1U9R A;  5C3E B;  3NTI A;  2NBF A;  4KKS A;  4ULL A;  4X3K A;  4LK1 C;  1OO9 B;  5M5X B;  5C4J B;  1OXS C;  3L9A X;  2RQX A;  1PFN A;  1WTV A;  4CKC A;  2JSO A;  2MP1 A;  4DAY A;  1LLR D;  4Q5V A;  5CYU A;  2ICI A;  5DAU A;  1F9P A;  2CQA A;  1F2M A;  2K33 A;  5KGU A;  2ID0 A;  2IX1 A;  3OHX C;  1NUC A;  1G91 A;  3E6Z X;  4DNR B;  4RFB A;  5CR3 A;  1EEF D;  2L4N A;  2E2J B;  1I4X A;  2AWO A;  1B3A A;  3DHQ A;  4K8I A;  4A3G B;  3I73 A;  5DM7 3;  5JEA J;  2R3Z A;  3M7G A;  4N9T A;  2F0E A;  5C3X A;  1GUO A;  1IHZ A;  1I6H B;  2EYP A;  1ONL A;  2NVT B;  1TY2 A;  2EDG A;  3SVM A;  1KDC A;  3V2T A;  4IUP A;  1Q90 A;  1E2W A;  1CQV A;  3I4M B;  1ZEQ X;  4J1M A;  4J8Q A;  4MHE A;  2HUG A;  1EY9 A;  2WII B;  3SK5 A;  5IT9 L;  3BVZ A;  1B4O A;  5NUC A;  4KY7 A;  4ZUI A;  4ZAI A;  2B2U A;  2OF1 A;  2SOB A;  1Y8N B;  2TSS A;  3E5S A;  3TN2 A;  3SHL A;  5IGC A;  5KEE A;  2BE5 C;  3TDQ A;  3N52 A;  1IL8 A;  2LKV A;  4IAL A;  2A73 B;  3Q22 A;  2EY1 A;  4C2M B;  1YNJ D;  4FF3 A;  1CTM A;  1LTB D;  1A3U A;  1G29 1;  3I3C A;  3R3O A;  2GA4 B;  3TP8 A;  5FK9 C;  2L5T A;  2RDH A;  3ONA B;  3VR4 A;  5CV9 A;  2F0N A;  4OO1 H;  4X3T A;  2CW0 C;  4CJ2 C;  5IT9 E;  3J7A F;  4PMW A;  4J6H A;  1EY5 A;  1STY A;  1H9R A;  3GTP B;  2XIW A;  4K5X A;  3CHB D;  1IW7 C;  1BR9 A;  2B39 A;  2E2D C;  2NVY B;  2V4D A;  1WTP A;  2F0V A;  2R61 A;  4IUV A;  1SNM A;  4F7X A;  5IOD A;  1EY7 A;  2EYJ A;  1EFI D;  2Q8T A;  2ZXP A;  5J1Z A;  1H9K A;  1Q1B A;  1BOS A;  3D4D A;  5IGE A;  5EKL A;  3QG1 A;  2AQ3 B;  1S5E D;  4X3U A;  1QWY A;  3ND8 A;  3M4O B;  3OIP A;  1DYQ A;  3G7L A;  3TZU A;  4ZKB B;  3HOV B;  2BDO A;  1SSO A;  3FPU B;  4XDX A;  1JOO A;  1HHV A;  4NMZ A;  4FF1 A;  2ENB A;  2B8F A;  3LX0 A;  1RTN A;  2ICE C;  5IGF A;  1LT6 D;  3QB3 A;  4HMI A;  1C8C A;  4A3K B;  5KNB A;  3MXN A;  3H09 A;  3KUP A;  1SYG A;  4H0L C;  3H6M A;  4R9W A;  1RD9 D;  2BE5 D;  3VYU A;  2D9U A;  1B1Z A;  1AN8 A;  2A6H C;  1Y1V B;  3S2H B;  3I4L A;  1MD2 D;  4DXG A;  4XYO A;  5D3I B;  1A15 A;  1EEI D;  3HEJ A;  1A3V A;  1F9R A;  3CQZ B;  2RA4 A;  3SK8 A;  3GTG B;  5C0X H;  4KI0 A;  3K59 A;  2VB3 X;  3OWF A;  1JR0 D;  1H9S A;  2F0P A;  3R2T A;  1EQT A;  1AEX A;  1FGB D;  2B2W C;  3NQT A;  2WB1 B;  2K6A A;  2CW0 D;  4PV1 C;  4IUT A;  5BN4 A;  4HED A;  3RLF A;  4WRD A;  4HCE A;  1TWC B;  3U9O A;  4NW2 A;  2QEJ C;  2Y0S B;  4K6L A;  4TKO B;  2RKS A;  2BA1 A;  4FNF A;  1IW7 D;  3BS1 A;  5EKI A;  1H9M A;  5M5Y B;  3LNN A;  4TRD A;  2AUJ D;  5EGT A;  5K5P A;  1U4P A;  2BCO A;  2MHV A;  2EOT A;  1LT3 D;  2XWJ B;  1Y8P B;  4HSP A;  5FO8 B;  4R8N A;  3EFX D;  4DXF A;  4I7Z C;  1B9M A;  4RGN A;  3J80 L;  1MI2 A;  1F2L A;  3VR5 A;  3PO2 B;  1EIG A;  4OIJ A;  2XN9 C;  2KQ3 A;  1VF7 A;  1A2U A;  2HCI A;  2QDB A;  3P20 A;  4C3J G;  2F0L A;  2WAC A;  2ZT9 C;  1LTS D;  4RHS A;  3WOE A;  1F9S A;  2NN6 H;  3X3M A;  2JE6 I;  1RJT A;  1SYF A;  4KKT A;  3T4A C;  2EYM A;  3E0J A;  5ELF A;  4M8A A;  1Q12 A;  4EQP A;  1CA5 A;  4PMB A;  3MXU A;  5D3D A;  1LTR D;  3SK6 A;  2A6E C;  1Z47 A;  3F2U A;  2BOS A;  3OPO A;  5DM6 3;  4FO2 A;  3BDC A;  1PFB A;  4CKB A;  1JQY D;  1AP0 A;  3J80 E;  4ILW A;  1NCV A;  3G6J B;  1SDF A;  3X3N A;  4EVO A;  3U9S A;  4M1U B;  2A68 C;  1BCP C;  1EU4 A;  3NHH A;  2KCN A;  3TME A;  1R9T B;  1JOR A;  3QO2 A;  3KF8 A;  1GUW A;  3VR3 A;  5C0X J;  2A6H D;  5IGD A;  3R2I A;  3P75 A;  3MEH A;  2MGS A;  1WTR A;  4F87 A;  1J9O A;  2Q8R E;  4R8I A;  2MUY A;  4KK7 A;  3GO5 A;  3DEP A;  1IKM A;  2PMZ B;  4ZUJ A;  4C3H G;  1ML0 D;  1TR5 A;  1TS3 A;  3A8J E;  2LFN A;  4KD3 A;  1Z6H A;  1EY4 A;  4DGZ A;  5M5W B;  2PCF B;  3T56 B;  4G7H C;  1FD7 D;  4K5V A;  2IT1 A;  2VUM B;  2L55 A;  3GTO B;  4XT1 B;  3RD4 A;  3MTS A;  2A69 C;  3EA6 A;  4WJW A;  4CJ0 B;  1STB A;  1XXG A;  1CHQ D;  3MWY W;  4XT3 B;  5CMD A;  4A3B B;  3WDN A;  3HOZ B;  2KUM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...