5JOBA

Crystal structure of staphylococcal nuclease variant delta+phs l25k/i92a at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKKMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYAYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L25K/I92A at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5jobA00
3DMUA 3QOJA 3SXHA 5DEHA 5JAVA 1STNA 1SYFA 1NUCA 1EZ6A 1ENCA 4E6IA 2F0DA 2LKVA 4DF7A 1ENAA 2EYFA 4PNYA 3H6MA 2F0PA 5KIXA 2EYJA 3S9WA 2QDBA 4EQPA 3LX0A 1II3A 5CV8A 5IGGA 4KY7A 3TMEA 1AEXA 1SNOA 5I6YA 2SNMA 3OSOA 1TQOA 1KDAA 5K5PA 2F0LA 2F3WA 1A2TA 2EYOA 4R8NA 3DHQA 4EQOA 2F3VA 2M00A 3EROA 4I65A 4ODGA 2WACA 5IIFA 5M9OA 1JORA 5C5MA 4F8MA 4EQNA 3SHLA 1A3UA 2EYHA 1A3TA 4KD4A 4K8JA 5IGDA 2RDFA 3ERQA 2F0HA 2EYPA 5KEEA 2RKSA 3EJIA 4K5VA 3E5SA 3MZ5A 3P1HA 4NP5A 5C6AA 5C3XA 3D6CA 2O4XA 5J39A 4B9WA 1A2UA 2PQEA 3RUZA 2RBMA 4HMJA 1KDCA 1EY8A 2OF1A 4K5XA 5IODA 5I9PA 3MHBA 4ZUIA 2F0OA 1STYA 2EY5A 1F2MA 2PW7A 4K6DA 3TP5A 5C4HA 3BDCA 1U9RA 1STAA 3OMCA 3PMFA 1SYGA 5EKLA 2OEOA 2F0JA 5HGTA 2F0SA 1STBA 2KQ3A 4F7XA 5CV5A 1JOQA 4DU9A 3U9OA 5CR3A 5IGBA 2EY6A 3T16A 4S3SA 4KD3A 3R3OA 4LAAA 4ZQ3A 2EY1A 2F0FA 2F0TA 1TT2A 3D4WA 1EYDA 1RKNA 4K5WA 1A3VA 4NDXA 4WRDA 3MVVA 5KYIA 5C5LA 2F0UA 5IGEA 5I9OA 4J1MA 1SYBA 2KHSA 3HZXA 2PYKA 3BDLA 4DFAA 1EYCA 1SNMA 5NUCA 5IGCA 2PZTA 2F0QA 1EQVA 2NUCA 1SNDA 2SOBA 2EY2A 4K14A 4KTAA 4ME5A 1TR5A 3SR1A 3SK8A 5IOCA 2F0WA 5J1ZA 4EVOA 3D4DA 1SNCA 4MIUA 4IZ8A 1STHA 1EY5A 1SNQA 5JOBA 3SK4A 3ITPA 1F2ZA 2EYLA 3NP8A 3TP6A 4HTHA 1EY9A 4WORA 4ID6A 3P75A 3T13A 5I6WA 5F2DA 2F0VA 4KJOA 4RKLA 5E3FA 3TP8A 3QOLA 1SNPA 1EY6A 3EVQA 5CV9A 1SYDA 5IGFA 2F0NA 4NMZA 1JOOA 2PW5A 4KY5A 4PMCA 4TRDA 4J6HA 5E1FA 4IUNA 4ZUJA 4B9XA 2ENBA 4K2KA 4H7BA 1SYEA 3NXWA 1EZ8A 2F0KA 3NHHA 1NSNS 4KY6A 4N9TA 4NKLA 3V2TA 5ISRA 2EXZA 3SK6A 5KRUA 3MEHA 4PMBA 1EY4A 5C4ZA 1EY0A 1JOKA 3MXPA 3SK5A 3C1EA 4RKBA 4QB4A 1EYAA 1KAAA 2F0EA 3OMGA 5EGTA 5HURA 4K8IA 4KJNA 1KDBA 3D8GA 5CGKA 3HEJA 2PZWA 3NUCA 5CV6A 1IHZA 5C3WA 5KGUA 4KHVA 1F2YA 4OL7A 4DGZA 5CV4A 5CC4A 3NQTA 4K2LA 2F0GA 3QB3A 2PZUA 2HQEA 4N9PA 4KV6A 5J22A 4QMGA 5EKKA 2F0MA 5CV7A 5DAUA 4HMIA 1EY7A 2OXPA 4YIJA 3OWFA 1KABA 4IALA 3C1FA 3VA5A 1SYCA 4G57A 4QF4A 5KYLA 2SNSA 1STGA 3NK9A 3TP7A 2EYMA 2F0IA
chains in the Genus database with same CATH superfamily
1HZAA 3DMUA 2ZJPA 2IPKD 1LT4D 4L5RC 4OXPA 4G7HC 1RODA 2DJGC 4X6AH 4BXXH 1EQTA 1QVCA 2EYJA 3S9WA 1DOLA 4A3LH 4IOAA 4A3GG 1ICWA 2Q8TA 4R8NA 1PFNA 3ER0A 3FKIG 5EAYA 3J81j 1ESRA 2X6GA 1SMXA 2UUBL 4GOPC 4GN5A 2LXJA 4A3EB 3HOVG 3I4NG 1B9NA 4FP5D 2IT1A 3VR2A 3GTMB 4K5XA 2E2JB 4QGUA 4DPGA 1F2MA 1PH8A 3J80i 1DD2A 1G91A 4AH6A 5M5XB 3RZOB 2KEDA 4A3GH 3RN2A 2NYZD 2GVBA 2D0PA 2NTSA 3GTKB 3FKIH 2E75C 3MVVA 3PO2G 1SJED 3OW2A 1KLGD 2F4VQ 3CQZB 3NEMA 2NVTB 1IYVA 3S1RH 1MI2A 1UNSA 4BY7G 1EQVA 1O7ZA 4DAMA 3NSWA 3HOVH 4MIUA 3I4NH 4GN4B 3H91A 3ITPA 2YTVA 2XRQD 1WTRA 1Y1WH 1D1KA 5K36G 1IBLQ 2BA1A 3RD4A 4DV0Q 4GZYC 1SNPA 3K6OA 3S2HH 1QILA 3NXWA 4NKLA 1WTHA 4LUVA 2P5ZX 4XXEA 3M4QA 2A6ED 3RMHA 3UDIA 5BN4A 4JI8Q 3K81C 3K5LA 3GTOB 3PO2H 2PZWA 4YCWA 1D1IA 4K6LA 4DGZA 2WINB 5M3FH 1PH7A 1J5EQ 3J7AF 3E6ZX 4LUZA 4JI5Q 1LTGD 2L1BA 3M3YH 5FO8B 1HNXQ 2RSOA 2X6LA 2WAQB 1STGA 2JA5B 3FPUB 2UXBQ 1K0SA 2MQHA 1K8GA 5T1GA 1QVFA 4TQUS 1I6VC 3UI2A 2F1MA 3ERSX 2SDFA 4FF4A 4GOPB 5EPJA 1HZ9A 3LX0A 5IP7G 2IY5B 1FNUA 2F3IA 2QF7A 3HOYG 1X3FA 2CWPA 1XPOA 3NTHA 3WDNA 3S17H 3ZYYX 4X3TA 1A8VA 5GAEC 3PIP3 1XMOQ 3F2BA 2RDFA 2PCFB 4OELB 1UEAB 3HP3A 3EJIA 1CI3M 2ZXRA 5GAHC 1KRTA 1PTOD 3HOWG 1HNWQ 1U0LA 3E3XA 3M7NA 1PH9A 4BBRG 1PZJD 2QGQA 4GNXC 2F4VL 4PZ8A 1LTID 3MHBA 2YTYA 4B3TQ 3AYHB 3Q8DA 1HA5A 3VR5A 3BZDB 3G6JB 4WJ3M 2D9UA 2OEOA 2K5QA 3EA6A 4CDFC 4R8IA 3K59A 5IP7H 2EY6A 3OOCA 1OXSC 1IBLL 4LAAA 4DV0L 1RKNA 2K04A 3OHXC 4UPAA 2B39A 3S1QB 1L2FA 1FL0A 2PZTA 2HT1A 3TZUA 3FMCA 4LFCQ 2KCNA 4JI8L 5J1ZA 1SFOH 1PYSB 4BY1G 4DK0A 3HOWH 1S5FD 2HDMA 4BBRH 4MTNA 3UE1A 5BR8Q 4DR2Q 1J5EL 3G71A 3TS0A 3HKZE 4JI5L 2RHSB 2LMCB 1N9WA 2JE6I 4CHTB 1HNXL 4G4KA 1V9PA 4H7BA 1SYEA 4X64Q 1EU4A 1I6HH 1D6EC 1SDFA 1V1PA 2UXBL 2NVXH 5LL6S 1E2ZA 2EZVA 1K9MC 5FOBB 1ASZA 1C4QA 2Z8LA 5M5YB 1RD9D 3TN2A 5C3WA 2WIIB 3URYA 4OL7A 1IL2A 4LF5Q 2AKWB 5IY0A 4KV6A 1ML0D 2B63G 4KHPQ 2H4OA 1PYWD 4C3JH 4BY1H 2ZXOA 3PIOA 3NK9A 2CQAA 1XMOL 4OGQC 1UE6A 2R6GA 1D5MC 3CC2A 2E2HH 3STBD 3J81E 2R7ZH 4KMUC 1HNWL 1PMRA 3TMEA 3D0FA 4IUUA 2G9HD 3M4OB 1NMGA 4B3TL 5FO9B 1VQKA 4ODGA 5IIFA 3S1MB 1Y8OB 4O2DA 2JN4A 4F8MA 1B44D 1SRUA 1WJJA 2RHQB 1ICFB 2K33A 1WVLA 1KNAA 4K8JA 4A3DB 3ND9A 5HGQA 4DV7Q 3QR8A 3K0YA 4K5VA 2B63H 3P1HA 1KRSA 4B9WA 3M7GA 2JA9A 3S14H 4IUQA 1NAPA 3NWSA 5C4HA 4UHVA 4LFCL 3KFUA 3K5OA 4ILWA 4IFDG 1ILQA 3QJYA 3I7FA 3DLLA 5CR3A 5BR8L 4DR2L 4Y52H 5FKAC 3RZDB 2F0TA 1U4PA 3AFPA 1TWCB 3T1YQ 1N8RC 4X64L 2ZJQA 3K5MA 4UAIA 2K5WA 2EY2A 1TS2A 1WTOA 1XNRQ 3CP0A 1OO9B 3W1GA 4LF5L 3HOUG 2K75A 3P75A 4DAYB 1C7YA 4KHPL 1WCMG 3EVQA 1K73C 1SYDA 4RFBA 5A2QE 2PW5A 2KA7A 1WD1A 1E1OA 2ZM6Q 1A63A 3KF8A 3MXPA 2DY8A 1TVXA 4L6TB 1HR0Q 3GTGH 1GUGA 5AFWA 2RSNA 3HS0C 4OHJA 3T53B 1RF2D 2HQEA 1HQRD 1VQ7A 4U68A 4FF3A 2BOSA 3CCJA 4QMGA 1BDOA 2F0MA 2E2DC 3MEFA 1EY7A 1QZHA 2OWOA 5KYLA 4DN4M 1VQAA 4XT1B 3RLOA 3HFZB 1A15A 4TKOB 1HTPA 5EPKA 1YI2A 3UE0A 4B3MQ 2ZXPA 1H9SB 4DV7L 1SYFA 1TWAB 5C0XJ 1WCMH 5C44G 1V1QA 2LKVA 2GVAA 2FXQA 2ICEC 4EQPA 1B2TA 3M9BA 3NTKA 4JI4Q 3BVZA 2MO1A 3A56A 5EQ0A 4LF8Q 3DHQA 4P71A 3S1NH 2AQ2B 1YNJD 3PUVA 1UE5A 3HOVB 4HIOA 1Y1VB 1JWUD 1R4QB 3I4NB 1PH4A 1YJWA 1PDQA 3SEBA 1NY4A 1Y1WB 5E4XA 4X3SA 2K52A 1Q86C 2Q2TA 2A73B 3G4SA 3CCEA 3T1YL 2K32A 5GAGC 2B2UA 4DR5Q 1MSHA 1STAA 5C44H 4L5SA 3HOXB 1EL0A 1BVSA 1Y69U 2EDGA 3I8ZA 5JJZA 4JBJA 3TEHB 1GJXA 1U5KA 4XYOA 5CBEE 5M3FB 2Z6KC 1XNRL 4GKJQ 1T9HA 4R4IA 2EY1A 2JSOA 2YU9H 3GTLH 2OQKA 2E2IH 4BA1I 1HRJA 2JP1A 5L37A 3TQYA 5EPLA 1I3QH 2B2YC 2ZT9C 2ZM6L 2RCFA 1AZQA 3S15B 3KBXA 1X3GA 4KKSA 1Y14B 2KHIA 3JAML 3PQIA 1STEA 4RGNA 1KD1C 1HR0L 1VQPA 3KF6A 1STHA 2Z9HA 2EYLA 1LLRD 5IT9L 3QOLA 4HCEA 2NZOA 2VNUD 4OONA 4KY5A 3D4RA 3PIO3 3WOFA 3JC66 3R8BA 2EE1A 1HQMC 1AN8A 4PMBA 4B3ML 4F87A 1Y8NB 1NCVA 3BU2A 2PPBC 1KAAA 1PVOA 5HURA 1KDBA 4HIMA 1YVCA 5CV6A 1HA6A 3GV3A 3P20A 1HUNA 3A7LA 3BVMA 5CV4A 1S72A 1PXUA 4JI4L 2LXKA 2WV6D 3E9IA 2D0OA 4LF8L 1CQVA 2XSCA 1K83B 1BCPD 3BJUA 1WFQA 4QJFA 1C9OA 3VA5A 4CKEA 2VQFQ 4WJ4A 3NPPA 5JJLA 2O5IC 3NE5B 1Q90A 3CD6A 2XN9C 4YHHQ 2NB0A 2NVQB 2KENA 1BBXC 1IKLA 2L11A 1JICA 2WP8J 5IGGA 4R4OA 1SNOA 4JC0A 2VQEQ 2EQSA 1P8LA 4DR5L 5EBCA 1HZBA 3HOZG 1EFID 1N36Q 1RTNA 5KNCA 2EJFC 4NXMQ 3F2UA 3HOWB 1Q3LA 1A3UA 2VXWA 4KD4A 3VDYA 1B50A 4GKJL 5KEEA 4X66Q 2XTIA 2MPMA 1M8AA 4JPBW 3D31A 5J39A 4DNTB 2A69D 3U4ZA 4HMJA 3KLSA 2XRSD 3L9AX 3S24A 4OIKA 4AYBE 1LV9A 1SXTA 3MC0B 1KIXA 2CW0C 3BDCA 4DV4Q 1B70B 1WTVA 1U4MA 3CC7A 4R1JA 2PMZB 2VB2X 1JR0D 1UE7A 5IGBA 3VR3A 4FO2A 4ZQ3A 1L0WA 2NVYH 4WRDA 4C3JB 2F0UA 2M2LA 3L7ZC 5I9OA 3DXJC 3HZXA 4A3FB 1G51A 3Q23A 1A0IA 3KLWA 3H3VI 4OEMB 2K1BA 1NNXA 2R7ZB 1PTOH 2IWHA 1VMPA 5F2DA 5E3FA 3J81i 1LUZA 4N8X1 4DR1Q 5IGFA 3VYTA 2VY3A 3K7AH 2VQFL 3MXGA 5M3MG 4IN3A 1QOHA 3CCVA 4HEDA 4YHHL 4DK6C 1OXTA 1JOKA 2LSSA 4ABNA 4CDCC 4HR7B 2JA8B 2QEXA 3NUCA 4FXGC 3E0EA 2MUYA 5LMUQ 4RA8A 2VQEL 2PZUA 3S14B 4IFDJ 1N36L 2JA7G 3MXNB 1XPRA 1JB3A 1BOSA 4NXML 1GHKA 3TP7A 3KLRA 2RF4A 3A8KE 2HUGA 4R4TA 3CF5A 1IYJB 3AMUA 3TS2A 4X66L 1STNA 5CYUA 1YNNC 4FYDA 4C3HH 3TRZA 4JI0Q 2EYFA 3M4PA 2EXDA 4H44C 3RLFA 4FXDA 1Q12A 1GOZA 1A2TA 1QNKA 2NWGA 1TWGH 4DV4L 2I5HA 1EFWA 3CCRA 5JPNC 2UUCQ 1SMYC 4IJHA 1S5ED 1Q8IA 2B2VA 4L5TA 3I91A 3ONAB 3MA2B 2PQAB 1HTLD 3KJOA 5FO7B 2UU9Q 1LT5D 2RBMA 4HIKA 2Z0SA 4LF7L 3SVMA 2MGSA 2PW7A 2Z6BA 2CHBD 4XDXA 4A3JH 5EKLA 2MFIA 4HSPA 1JCKB 1VQIA 2JQOA 3T16A 1R9TB 1GO3E 3R3OA 1TT2A 1MJEA 4DR1L 3EQLC 5C5LA 3CRLC 3DUZA 4OWTB 4A3CG 1G6ZA 1EU3A 3IRBA 4KI0A 2R7FA 3FHWA 4A3BG 1CK1A 3U9SA 2F0QA 3L2PA 3NBIA 1S5DD 5IOCA 1EIGA 1PA6A 1BR9A 3UDGA 3D4DA 2WB1G 3GO5A 1Q1EA 1SNQA 1I4PA 5LMUL 4WORA 1RHPA 4ID6A 5C4XG 4DK1A 1CZGA 4LJZC 3V96A 5FLMG 4A3MB 4A3IG 3S16H 2KCCA 4J15A 4PMCA 2JK8A 2DN8A 3PUZA 2N49A 4GS3A 3NHHA 4HJAA 1E24A 4RHSA 3CCSA 3OTOL 3IL8A 5C0XG 3T56B 1F2LA 3H0GG 1H9RA 2B2TC 3SK5A 4Q5VA 4JI0L 4A3CH 3I4MB 3GQBA 4K2LA 3A7AB 3QB3A 1CZWA 1LT3D 1B1ZA 5J22A 1AFPA 3QIAA 4YIJA 3C1FA 3LWEA 3R2TA 2RDGA 2UUCL 3K7UC 2IX1A 3DEOA 5C4XH 1IW7C 3OYYA 3CCMA 3GTLB 1DOKA 3Q22A 2E2IB 4BA2I 2UU9L 2F0PA 1HR0W 5TSSA 4IURA 2QEJC 1YHBA 4M1UB 4B08A 1LTRD 1LYLA 2XGTA 3AU7A 1I94Q 5C0XH 3J7ZC 1KNEA 3H0GH 3NELA 5ELDA 1ET9A 1K8OA 1SLJA 4ALPA 2B2WA 4BY7H 4EQNA 4JBWA 1PH1A 1PFSA 2VUMG 1SROA 3GV6A 1V1OA 3CMEA 2GA4B 3I4LA 4CKBA 4BBSG 4AYBG 3WWVA 5K36H 4DXFA 2Y0SB 1SAPA 2JJQA 1KDCA 1E22A 4IPCA 4DAYA 2F0OA 1OXXK 3J7AV 4JG2A 3K0XA 2JA6G 1O7IA 4MHEA 1CHPD 1AP0A 1G6PA 3CCLA 5ELNA 1PRTC 3BYYB 2K28A 3HKZB 2C9OA 4PV1C 2FJ2A 4A93G 1EYCA 1SNMA 4CJ0B 4ME5A 3SK8A 2D62A 2FFKB 3EN2A 5CMDA 4O1NA 1CKOA 4JI7Q 1N33Q 3A74A 3F1ZA 3MWYW 1MD2D 1GUTA 1CA5A 1ZYRC 4JOIA 3RR5A 2R93B 4UP9A 5JVH3 2K01A 3PO3G 5C3EG 3NTIA 3HOYH 2BDNA 2EOTA 1JOOA 3ULPA 2RCNA 4J6HA 1C0AA 4LFAQ 2XIWA 5IYCG 3V2TA 2L12A 4CBVA 1MJCA 1IL8A 3VYRA 2UXCQ 2O5JC 2VZAA 5JEAJ 5J3BA 4X62Q 1B9MA 1HUMA 1TWFH 2K50A 4PMWA 4A93H 3IFTA 1SE2A 1I94L 2EPBA 5CV7A 1HZCA 5DAUA 1CFMA 4PZ6A 2NZHA 2EYMA 2KUMA 4A3KG 4DV2Q 1VF5C 4HCSA 4QUCA 1JMCA 2J0TD 3PO3H 5C3EH 3VYSA 5IYCH 1BQQT 2HCIA 2JYOA 3S2DH 1TQOA 1KDAA 1L1OC 1LTBD 2NN6G 1FGBD 4I65A 3F2DA 1TU2B 4N8FA 1TWHH 4ZRZA 1ENFA 2L4NA 1PV4A 3JAME 2K05A 3G6EA 2O4XA 1H9JA 1YJNA 4DR3Q 1RCVD 3K7AB 4B3SQ 1BXTA 4UY8C 3U50C 2OTJA 4A3KH 3NBHB 3PCOB 5IT9E 3TP5A 3VYUA 1DXMA 1U9RA 4KHZA 3GTPH 2QILA 4LF6Q 1VQDA 2F0JA 5DLQE 1Y8PB 4JI7L 1N33L 3EBEA 4GNXB 1O78A 2NN6H 3PSIA 1VQOA 4H0LC 4Q0FA 3CCQA 1JJ2A 1I50H 3JAMc 4LFAL 4J1MA 1BBWA 2K5VA 2KEEA 3GTJH 2UXCL 3A5UA 3J81c 3H15A 2BE5C 1VF7A 4C3HB 5ELEA 1SNCA 3F2CA 5IT9c 4X62L 5FJ8G 1EUJA 3TP6A 1F2ZA 2D5DA 4DV5Q 1GUNA 4HTHA 1EY9A 4A75A 4Y7NB 4RH6A 3UDFA 1EWIA 4DV1Q 4APVA 1NR4A 2IL8A 2L5TA 2F0NA 5JJIA 4TRDA 4ZUJA 4DAVA 2XWJB 3KJPA 2R92G 1AE3A 1EY4A 4DV2L 1EY0A 2CVRA 1J9OA 2E8GA 4C56C 3D6WA 3D8GA 3RNUA 1SSOA 2KHJA 4RCNA 2A6HC 5E7NA 1IBKQ 2L0CA 2RQXA 3Q0AA 3PUWA 1FGUA 3MTSA 1M4VA 2HIXA 1KABA 4P72A 4A3JB 2Z6KA 5FJ8H 1L1OB 4IFDH 2MP1A 1HJPA 3E0JA 4MTKA 5JAVA 1EOTA 2K03A 4WFN3 1LT6D 3PUYA 2B2YA 4PNYA 4A4IA 4EX5A 3H6MA 4DR3L 4B3SL 4C3IG 5I6YA 2SNMA 4A3EG 4TVAB 2F0LA 2R92H 3K57A 2G9DA 1TKWB 4NPSA 4LF6L 1D2BA 4QY7A 2L55A 3WOEA 1MBYA 3S16B 3MZ5A 4A3GB 1ESFA 3TBIB 3W1BA 4CGYB 3HOUH 3KLSX 2AUKA 3FKIB 1EOVA 1QE6A 2HCCA 1X3QA 2RDHA 4QQBX 2AQ3B 4QUFA 1YNXA 3KDFB 3OWEB 4ZYSA 4DUYQ 5AJ3Q 1CSQA 4IOCA 4U673 4KLKA 1G2SA 3S1RB 2AWNA 1HFNA 3QG1A 2KVMA 1CSPA 4JBKA 4C3IH 4DV5L 4A3EH 4V190 2F0FA 4DV1L 3CHBD 3GTMH 2E2JH 1YJ9A 4FDBA 1PH3A 1DJRD 1RTOA 2BCOA 5IGEA 2HHHQ 2KHSA 5COYA 3T51B 3S2HB 1FJGQ 5C5MA 1SNDA 1ZXTA 3A8IE 3DWPA 3RZOH 4EVOA 3J7YW 4ZK9B 4XT3B 1G2TA 3SK4A 3GTKH 1EQQA 3K58A 3PO2B 4M8AA 1IBKL 1F9PA 4JI6Q 4KJOA 1O7LA 1M1KC 1EY6A 3D3RA 3A55A 3CQZH 2NVTH 4P2CB 3M3YB 2ENBA 2K14A 1XX8A 3SGIA 2Q2UA 4BY7B 4NXNQ 2MNAA 1G291 1K3BC 4JV5Q 2WAQG 4V0BA 2JA5G 1E0BA 4RGOS 5EGTA 1E2WA 1W6JA 1H9MA 1VQEA 2AMCB 1F2YA 1VQJA 4L5QA 2O2LD 5DNFA 3TSSA 5EKKA 2PQAA 1PZKD 4DAPA 2WB1E 3I72A 1YIJA 1YHQA 4DR6Q 4UP8A 3S17B 2ID0A 2R61A 3QOJA 4JYAQ 4DXGA 4DA2A 1N34Q 1NUCA 4E6IA 4XYQA 3RN5A 4NB3A 1IYUA 1LO5D 1FVIA 5CV8A 1VQ9A 4LUOA 4POFA 1VQMA 3VR4A 4DUYL 5AJ3L 4O0AA 1VQ4A 2JA5H 3FEWX 1UAPA 4IFDI 2KJXA 4OWXB 2M9VA 1A3TA 5IGDA 3MFGA 1Q82C 2LFNA 3DEPA 4LNQA 3HOYB 1IBMQ 3K8AA 2HHHL 2DUDA 4XQNA 2A69C 1CTMA 1FJGL 4ZUIA 1STYA 4CKCA 4K6DA 1R4PB 4FVMA 2HQLA 3DWQA 2YYZA 2TMPA 4L63B 1LTSD 1JOQA 1F9RA 1TWFB 1SFOB 1F9QA 4JI6L 2PO4A 1TS4A 4G7ZC 4H02A 4BBRB 3D4WA 1XXGA 1XPUA 1FNVA 1I4XA 4IUVA 3CU7A 1WYDA 2SEBD 3W3AA 2B2UC 4NXNL 1BF4A 4I7ZC 5JEAG 4JV5L 4QIWE 3SR1A 1I6HB 4J8QA 2NVXB 1GKHA 4IZ8A 1MHWC 2WKDA 1ZKOA 3A8JE 4HSVA 2K5NA 2QA4A 1WD0A 5CORA 4QL5A 1UEBA 1TY2A 3QO2A 3HOZH 4XIGS 1PTOF 2ATWA 3AQQA 4DR6L 2K5DA 1FYCA 4BY1B 1PZID 2Z4IA 1SE8A 1HNZQ 4JYAL 2A5HA 1N34L 4LF7Q 1SEBD 4LMQD 3OMGA 1XTDA 4BS9A 2E2HB 3KF8B 2A68C 5CC4A 3NQTA 3JAMi 2E76C 4IPGA 5JEAH 1IZ6A 2F52A 1X32A 4HMIA 4IALA 1PRTF 4QF4A 2I07B 2R3ZA 3AFQA 4HJ7A 1OXVA 3MXUA 4GOPA 5LMNQ 4GLXA 3VA7A 1JE5A 5DEHA 4DK3C 3I56A 1QCBD 4A3DG 1IBML 1JT8A 2FINB 5KIXA 2IJ0A 3J80L 2B63B 2CW0D 1J8IA 1AEXA 1CM9A 1XTCD 4YCUA 3CPWA 2E74C 3GTJB 3Q6SA 2M00A 1EQRA 4LF4Q 3SHLA 4UP7A 2EYPA 3KK7A 4NP5A 3OTOQ 1VCIA 1SE4A 1VQFA 4XQQA 1A2UA 2ZTCA 1F9SA 4XTCS 1JC7A 1Z47A 1X65A 3S1MH 2D2CC 1N32Q 5M3MH 2E5LQ 3FP9A 2KBNA 1CUKA 4R9WA 1G8ZD 1P16A 1STBA 1VS0A 4F7XA 4YWMA 3O13A 4DU9A 5E4WC 4BXXG 2TSSA 4OX9Q 1KL9A 3TREA 1GD7A 2CFMA 1TXYA 2JA7H 2OTLA 5IYBG 3BDLA 4DFAA 1LTAD 3BDOA 1I4RA 1Q7YC 4A76A 4KTAA 5FK9C 1HNZL 1TR5A 1XYIA 4KN4C 4YY3Q 1JJGA 3RZDH 3IAYA 1K28A 2I5LX 3GTGB 4JI3Q 1SJHD 5KNDA 2F0VA 3PF5A 1TWCH 4IPDA 1I4HA 1E1TA 4B9XA 1YNND 1X9NA 1OTCA 5LMNL 3TZDA 5KRUA 3CRKC 2OCEA 2F0EA 4DKAC 3HOUB 1ILPA 4C2MH 1IHZA 5KGUA 1WCMB 1VQCA 2QKIC 1B7YB 5IYBH 2IX0A 2F0GA 2DJFC 1EEID 1SMYD 3MFYA 1K8AC 3M85A 1X6OA 2QDLA 1TS5A 4LF4L 2SNSA 4LW1A 3S1NB 1X56A 4C3IB 5T1IA 5IODA 1A6XA 3NBHA 1E7ZA 4JBMA 1Y1VG 4CDDC 5FLXL 2F0DA 4GLVB 1YEZA 1Y1WG 1XMQQ 3FVQA 2A6EC 4KY7A 4GNXA 1GUOA 4RGTA 2IHEA 2DGYA 1S5BD 2XVSA 1AH9A 3PF4A 1N32L 1VQNA 2E5LL 1WTWA 3I2ZA 2ES2A 1JE4A 4A3BH 1JORA 2AHOB 3DWAA 3U4VA 1Q81C 4P74A 1ZEQX 1TWAH 5C44B 5LL6X 1XWEA 2WKCA 3HOXG 3DM1A 2HIVA 1W2BA 2H5XA 1U4RA 2MJ8A 4OX9L 1EIFA 5M3FG 2CWAA 3CPFA 2RVLA 3RUZA 5FLMH 1O7YA 2N78A 4A3IH 2YU9B 3I3CA 2Z1CA 5IWAQ 4KKTA 2A74C 1VQHA 4PZ7A 1I3QB 2UUAQ 1Y1VH 1F77A 1TS3A 4R4CA 1D5ZC 4YY3L 3B6YA 2KQ3A 5CV5A 2NZ1D 2OQ0A 1BUVT 2FMMA 2K4KA 2B2VC 2BH8A 4JI3L 4EQ5A 1YZ6A 4JVZA 3UDXA 1V8QA 1DZ1A 4PQXA 1CKNB 3HOXH 1PTOC 1V43A 2SOBA 4C1NK 3J7A5 1KQSA 1B3AA 4KKUA 1EY5A 4ULLA 4EGVA 1M90C 1L1OA 4ZCKA 1S3OA 4RKLA 4HJ5A 3V05A 3HKSA 5JVG3 3S15H 2KCTA 3KUPA 3C2PA 2XNAC 1IW7D 1NE3A 4KY6A 2PNRC 2FMCA 4FF1A 2EXZA 4ZAIA 4PG3A 1MKHA 2IW3A 4YCVA 4X65Q 3C1EA 2VUMH 4KK7A 1XMQL 3LNNA 3HEJA 4RCOA 4HN7A 2B29A 4KHVA 2HDLA 4BBSH 3A0JA 1PH5A 1OXUA 1LABA 3X3MA 4CDEC 3VR6A 1KHIA 1H9SA 2OXPA 2F4IA 1DYQA 2JA6H 1VQBA 4CJ1B 3KDFA 3PV0A 3SXHA 1PFBA 1E2VA 3GD7A 3H94A 1ENAA 2I46A 3KBGA 4FF2A 1EYGA 1K83H 5IWAL 2L15A 1QUQB 5K5PA 3X3NA 1EEFD 3PGZA 3SDZA 3MAQA 3ULJA 2UUAL 2WAQE 1ONLA 4IPHA 2ALYB 2ZTEA 5C4JH 1D5XC 2EJMA 2B8FA 3F8TA 2NVQH 1B8AA 3BYTB 2Y0SE 4MNOA 1DONA 3ERQA 1PRTD 3OPOA 2L9HA 4DUZQ 2RKSA 1S4ZA 3GP7A 5HY6A 1L0YB 3AEVA 3NQIA 1EIHA 3L3OC 3G48A 4RWSC 3Q24A 3HOZB 2JEBI 2NBFA 2NVYB 3STBC 5I9PA 1VQ5A 4C3JG 1WTPA 1S5CD 2I5MX 4RHRA 1B3QA 1SN8A 1YHAA 4A3FG 2B2WC 1GUSA 1ZYRD 1BCPF 4LK1C 3P7JA 1Q1BA 1HH2P 1PTOB 1IKMA 2R7ZG 2X69A 4GKKQ 4KD3A 5EJWA 3BZCA 3CW2C 5EKIA 2C5CA 1CT1D 5GQOA 4IUPA 3GTQH 1RJTA 5C4ZA 4K14A 2NUCA 4X65L 2EIFA 5C0XI 4H13C 1HHVA 2F0WA 1KC8C 1PRTB 2EVBA 2PI2A 3LGJA 3NP8A 4HAEA 1D8LA 3FDTA 1VDZA 2JA8G 2GN5A 5GADC 2V4DA 1I4QA 1UE1A 3AB9A 4NMZA 4A3FH 3M4YA 4DR7Q 1KXLA 3HG9A 2OT2A 5A35A 1NBWA 4K2KA 4AIMA 1BO0A 1EZ8A 1FNWA 4JI1Q 3SK6A 3ICEA 3PUXA 1VQ6A 1H9KA 2G5DA 1RDPD 4I7AA 4KN7C 2Q2HA 2RA4A 1CQFA 4GLAC 2AWOA 4JOIC 4B3RQ 5M3MB 1RL2A 1U4LA 5D65A 3OWFA 4DNIA 1AE2A 2N8NA 4ZLTF 3NWTA 4LWCA 2DY7A 2J4XA 3IKJA 1TWGB 1TY0A 2R7DA 1PLFA 1EWCA 1PYBA 2JA8H 4DUZL 1GVPA 1AZPA 2BA0A 1EZ6A 1LM0A 2JXMB 5M5WH 1II3A 4Z9CB 4JI2Q 2JA7B 2CQOA 3TDQA 5JJKA 4OO1G 1D7QA 1QVGA 1ASYA 2F3WA 1B53A 1NR2A 4FXKC 1SR3A 1Q8KA 3K80C 1QWYA 4RGMA 1MIUA 4HJ9A 2F0HA 3ND8A 1HPCA 4YWLA 5BN5A 4GKKL 5LMNW 4HJ8A 5DM73 3DM3A 3I55A 2QW7A 1KLUD 1GM5A 2BE5D 4WJWA 1MSGA 5BN3A 2ZTDA 1L0XB 4DV6Q 4O42A 1O80A 1XNQQ 3BZKA 2Q8RE 1K3RA 1QB5D 1MGSA 1HCZA 4X3KA 2F0SA 5HGTA 4C2MB 4DNRB 1Z7TA 1YNJC 4OO1H 4K0KQ 2H1EA 4AQYQ 1X54A 5H1SE 4NDXA 1EYDA 3T4AC 2LS01 4DR7L 4LFBQ 1SYBA 2N88A 3K5NA 3OIPA 2PYKA 4A3MG 4QCLA 4JI1L 1WOCA 5D14A 2MO0A 1T5EA 4IUTA 4X3UA 5NUCA 2HD3A 2A6HD 1VQ8A 1HFGA 5G3LF 3R2IA 1R9TH 4RAUC 1C48A 5JOBA 2FHTA 1JB7A 2C35B 2BH2A 3H09A 4B3RL 3I4MG 2AUJD 4A3BB 3J80E 5DM63 2KECA 2F0KA 4GN3B 3CCUA 4JCVE 2WB1B 3MEHA 1DCZA 4IO9A 1EYAA 1YBYA 3QWNA 3E9HA 5C4XB 3MXNA 3IFDA 5M5XH 2KCMA 4A3IB 5KNBA 4A3MH 4JI2L 4OWWB 1NJIC 2CKZB 4OIJA 2K7VA 2NN6I 1SYCA 5I2YA 3H0GB 1LTLA 1S40A 3J80c 1Z9FA 1JWMD 3FPPA 5IE8A 1ENCA 3I4MH 4BWGB 1PH6A 1X55A 2VB3X 1C8CA 2QDBA 4POGA 3CC4A 2N3SA 1V1PB 3H3VH 5I2XA 2Y0SG 4EQOA 2EYOA 4DV6L 5ELFA 5M9OA 2VW9A 1TIID 1WI5A 1XNQL 2CH4A 3CKIB 5GROA 5IYDG 4HIDA 3HRZC 4K0KL 1BCPC 1QJOA 4AQYL 3E5SA 5C6AA 5C3XA 3D6CA 3C46A 3GTOH 3ZJYC 1E3PA 3BVGA 1JWSD 4LFBL 3OIQA 1XJVA 4IQZA 2A1AA 1J6QA 1DOMA 3HKZG 2EY5A 2F03A 3HGBA 1UWVA 3J81L 3PMFA 1SYGA 2VUMB 4QIWB 1KAWA 4BBSB 1H95A 4AYBB 3ULLA 1UUPA 2QCPX 4S3SA 2VL6A 1A3VA 1JJCB 1LTTD 2K5HA 2N55A 3GDEA 4K5WA 4ZKCB 1GUWA 3R93A 5IP9G 2R93G 1JQYD 5IYDH 2JA6B 2B8GA 5JPMC 2WFWA 5IGCA 4R4QA 1EIYB 5ELBA 3CAMA 4P75A 2I0QA 4OO1I 1WTQA 3LWUA 1ET6A 1BKBA 5FLXE 4A93B 4CJ2C 1HXYD 4IUNA 5C4JB 1CHQD 3TP8A 3I90A 3FRPB 4N9TA 5EBDA 1I5FA 4RG1A 5ISRA 1CA6A 4L8JA 1BBUA 4DR4Q 4QB4A 2K6AA 4FNFA 5CGKA 2ASBA 5IP9H 1QNUA 2R93H 3PO3B 5C3EB 3RLNA 3L0OA 1IXRA 2IHFA 4N9PA 1BNZA 2XWBB 4G7OC 1PH2A 2PI2E 4ME3A 4JK1C 4LF9Q 2UXDQ 3S2DB 1VQLA 1DM0B 1YITA 5FLXc 4DV3Q 3S1QH 2F0IA 2ZJRA 2DNEA 5LHY1 4P73A 1TWHB 1CKMA 1QG7A 1X3EA 4DF7A 2B3GA 5A2QL 3SE0A 1GXDC 2CCZA 3I4OA 3A5ZB 1BCPB 3GTQB 3OSOA 2NTTA 4YWKA 2V1CC 3BG3A 4UDUC 2F3VA 3EROA 2WACA 4A3KB 3A54A 3I70A 5ELCA 3T1HQ 1W3SA 2EYHA 3GTPB 1CKNA 2JEAI 2CH4W 2BDOA 3EIVA 4JW0A 3I73A 5M5YH 1PFMA 2PQEA 1EY8A 1K8MA 2OF1A 1I50B 1AW7A 2YTXA 2MHVA 1I4GA 2VS1A 3OMCA 1K0RA 1QZGA 3KYHC 2UUBQ 2A19A 3G7LA 5ELOA 3U9OA 3KOJA 2Q8IB 3NENA 4C3HG 3PIPA 4TSSA 2YV5A 2KOLA 4XQJA 5KYIA 1KTKA 2Q2IA 3N6RA 1SBBB 1FR3A 1WTXA 3CMAA 1W6KA 1DGSA 1EWHA 1A62A 1NTGA 3M4OH 1X3PA 3BS1A 2A68D 1FD7D 1PHJA 2B2TA 2PMZE 4MN3A 4DR4L 2LY7A 3CXCA 5M5WB 3W5OA 4A3DH 1B4OA 5I6WA 3T13A 3C3LA 4C1NI 2IX3A 1Q46A 4F88A 4LF9L 5CV9A 4IJLA 2UXDL 5E1FA 3N52A 5I4DA 3U58A 1VMCA 4A3LG 3EFXD 1LACA 1RIPA 1NSNS 4DV3L 4MZ9A 2AQ1B 1QUQA 2DNCA 2EJGC 4RMFA 3W2DA 4A3JG 2A8VA 3H3VC 5D3IB 4RKBA 2J7ZA 5D3DA 5CBAE 4K8IA 4KJNA 1SE3A 4Y7NH 2ICIA 5G3LD 4ZKBB 1VQGA 1T5XD 2Z4HA 2PNHA 1GHJA 3OW7A 3T1HL 2R92B 4G57A 3KF6B 1Z6HA 4NW2A 1NMFA
chains in the Genus database with same CATH topology
3DMUA 2IPKD 1LT4D 4G7HC 1RODA 1EQTA 2EYJA 3S9WA 1DOLA 1ICWA 2Q8TA 4R8NA 1PFNA 1ESRA 2X6GA 4A3EB 1B9NA 4FP5D 2IT1A 3VR2A 3GTMB 4K5XA 2E2JB 1F2MA 1DD2A 1G91A 5M5XB 3RZOB 2KEDA 2NYZD 2NTSA 3GTKB 2E75C 3MVVA 1SJED 1KLGD 3CQZB 2NVTB 1IYVA 1MI2A 1UNSA 1EQVA 1O7ZA 3NSWA 4MIUA 3H91A 3ITPA 2XRQD 1WTRA 1D1KA 5K36G 2BA1A 3RD4A 4GZYC 1SNPA 3K6OA 1QILA 3NXWA 4NKLA 4XXEA 2A6ED 3RMHA 5BN4A 3K5LA 3GTOB 2PZWA 1D1IA 4K6LA 4DGZA 2WINB 3J7AF 3E6ZX 1LTGD 2L1BA 5FO8B 2RSOA 2X6LA 2WAQB 1STGA 2JA5B 3FPUB 5T1GA 4TQUS 1I6VC 3UI2A 2F1MA 2SDFA 4FF4A 5EPJA 3LX0A 1FNUA 2QF7A 3NTHA 3WDNA 3ZYYX 4X3TA 3PIP3 2RDFA 2PCFB 1UEAB 3HP3A 3EJIA 1CI3M 2ZXRA 1PTOD 3M7NA 1PZJD 1LTID 3MHBA 1HA5A 3VR5A 3BZDB 3G6JB 2D9UA 2OEOA 2K5QA 3EA6A 4R8IA 3K59A 2EY6A 3OOCA 1OXSC 4LAAA 1RKNA 2K04A 3OHXC 2B39A 3S1QB 2PZTA 3TZUA 3FMCA 2KCNA 5J1ZA 4DK0A 1S5FD 2HDMA 2LMCB 2JE6I 4CHTB 4G4KA 4H7BA 1SYEA 1EU4A 1D6EC 1SDFA 1V1PA 5LL6S 1E2ZA 2EZVA 5FOBB 1C4QA 2Z8LA 5M5YB 1RD9D 3TN2A 5C3WA 2WIIB 3URYA 4OL7A 4KV6A 1ML0D 2H4OA 1PYWD 2ZXOA 3NK9A 2CQAA 4OGQC 2R6GA 1D5MC 3J81E 4KMUC 1PMRA 3TMEA 4IUUA 2G9HD 3M4OB 5FO9B 4ODGA 5IIFA 3S1MB 1Y8OB 4F8MA 1B44D 2K33A 1WVLA 1KNAA 4K8JA 4A3DB 3ND9A 3K0YA 4K5VA 3P1HA 4B9WA 3M7GA 4IUQA 1NAPA 3NWSA 5C4HA 3K5OA 4ILWA 4IFDG 1ILQA 3QJYA 5CR3A 5FKAC 3RZDB 2F0TA 1U4PA 1TWCB 3K5MA 4UAIA 2K5WA 2EY2A 1TS2A 1WTOA 1OO9B 3P75A 3EVQA 1SYDA 4RFBA 5A2QE 2PW5A 2KA7A 1WD1A 3KF8A 3MXPA 2DY8A 1TVXA 4L6TB 1GUGA 5AFWA 2RSNA 3HS0C 4OHJA 3T53B 1RF2D 2HQEA 1HQRD 4U68A 4FF3A 2BOSA 4QMGA 1BDOA 2F0MA 2E2DC 1EY7A 5KYLA 4DN4M 4XT1B 1A15A 4TKOB 1HTPA 5EPKA 2ZXPA 1H9SB 1SYFA 1TWAB 5C0XJ 2LKVA 2ICEC 4EQPA 1B2TA 3NTKA 3BVZA 3A56A 5EQ0A 3DHQA 2AQ2B 1YNJD 3PUVA 3HOVB 1Y1VB 1JWUD 1R4QB 3I4NB 1PDQA 3SEBA 1Y1WB 5E4XA 4X3SA 2A73B 2K32A 2B2UA 1MSHA 1STAA 3HOXB 1EL0A 1Y69U 2EDGA 3I8ZA 5JJZA 1GJXA 5M3FB 4XYOA 5CBEE 2EY1A 2JSOA 1HRJA 4BA1I 2JP1A 5EPLA 2B2YC 3S15B 2ZT9C 1AZQA 3KBXA 4KKSA 3JAML 1STEA 4RGNA 1STHA 2EYLA 1LLRD 5IT9L 3QOLA 4HCEA 2VNUD 4KY5A 3D4RA 3PIO3 3WOFA 3R8BA 2EE1A 1HQMC 1AN8A 4PMBA 4F87A 1Y8NB 1NCVA 2PPBC 1KAAA 5HURA 1KDBA 5CV6A 1HA6A 3GV3A 3P20A 1HUNA 3A7LA 3BVMA 5CV4A 1PXUA 2WV6D 1CQVA 2XSCA 1K83B 1BCPD 4CKEA 3VA5A 3NPPA 2O5IC 3NE5B 1Q90A 2XN9C 2NB0A 2NVQB 1BBXC 1IKLA 2L11A 1JICA 2WP8J 5IGGA 1SNOA 5EBCA 1EFID 1RTNA 5KNCA 2EJFC 3F2UA 3HOWB 1Q3LA 1A3UA 2VXWA 4KD4A 1B50A 5KEEA 2MPMA 1M8AA 3D31A 5J39A 4DNTB 2A69D 4HMJA 3KLSA 2XRSD 3L9AX 4OIKA 1LV9A 1SXTA 3MC0B 2CW0C 3BDCA 1WTVA 1U4MA 2PMZB 2VB2X 1JR0D 5IGBA 3VR3A 4FO2A 4ZQ3A 4WRDA 4C3JB 2F0UA 2M2LA 3L7ZC 5I9OA 3DXJC 3HZXA 4A3FB 3Q23A 2K1BA 2R7ZB 1PTOH 2IWHA 1VMPA 5F2DA 5E3FA 5IGFA 3VYTA 3MXGA 4IN3A 1QOHA 4HEDA 1OXTA 1JOKA 4ABNA 4HR7B 2JA8B 3NUCA 4FXGC 2MUYA 4RA8A 2PZUA 3S14B 4IFDJ 1JB3A 1BOSA 1GHKA 3TP7A 3KLRA 3A8KE 2HUGA 3AMUA 4FYDA 1STNA 5CYUA 1YNNC 2EYFA 4FXDA 4H44C 3RLFA 1Q12A 1GOZA 1A2TA 1QNKA 2NWGA 5JPNC 1SMYC 1S5ED 1Q8IA 2B2VA 3I91A 3ONAB 3MA2B 1HTLD 5FO7B 1LT5D 2RBMA 3SVMA 2MGSA 2PW7A 2CHBD 4XDXA 5EKLA 4HSPA 1JCKB 3T16A 1R9TB 3R3OA 1TT2A 3EQLC 5C5LA 3CRLC 3DUZA 1G6ZA 1EU3A 4KI0A 1CK1A 3U9SA 2F0QA 3NBIA 1S5DD 5IOCA 1EIGA 1BR9A 3D4DA 3GO5A 1Q1EA 1SNQA 1I4PA 4WORA 1RHPA 4ID6A 4DK1A 1CZGA 4LJZC 3V96A 4A3MB 2KCCA 4PMCA 2DN8A 3PUZA 3NHHA 4RHSA 3IL8A 5C0XG 3T56B 1F2LA 1H9RA 2B2TC 3SK5A 4Q5VA 3I4MB 3GQBA 4K2LA 3A7AB 3QB3A 1CZWA 1LT3D 1B1ZA 5J22A 1AFPA 3QIAA 4YIJA 3C1FA 3LWEA 3R2TA 2RDGA 2IX1A 3DEOA 1IW7C 3GTLB 1DOKA 3Q22A 2E2IB 4BA2I 2F0PA 5TSSA 4IURA 2QEJC 4M1UB 4B08A 1LTRD 3AU7A 5C0XH 1KNEA 5ELDA 1ET9A 1K8OA 2B2WA 4EQNA 4JBWA 3GV6A 1V1OA 2GA4B 3I4LA 4CKBA 5K36H 4DXFA 2Y0SB 1SAPA 1KDCA 4DAYA 2F0OA 1OXXK 3J7AV 4MHEA 1CHPD 1AP0A 1PRTC 3BYYB 2K28A 3HKZB 2C9OA 4PV1C 2FJ2A 1EYCA 1SNMA 4CJ0B 4ME5A 3SK8A 2D62A 2FFKB 5CMDA 4O1NA 3MWYW 1MD2D 1GUTA 1CA5A 1ZYRC 2R93B 5JVH3 2K01A 3NTIA 2BDNA 2EOTA 1JOOA 4J6HA 2XIWA 3V2TA 2L12A 4CBVA 1IL8A 3VYRA 2O5JC 5JEAJ 1B9MA 1HUMA 4PMWA 3IFTA 1SE2A 2EPBA 5CV7A 5DAUA 1CFMA 2EYMA 2KUMA 1VF5C 4HCSA 4QUCA 2J0TD 3VYSA 1BQQT 2HCIA 2JYOA 1TQOA 1KDAA 1LTBD 2NN6G 1FGBD 4I65A 1TU2B 4ZRZA 1ENFA 2L4NA 3JAME 2K05A 2O4XA 1H9JA 1RCVD 3K7AB 1BXTA 5IT9E 3TP5A 3VYUA 1DXMA 1U9RA 4KHZA 2QILA 2F0JA 1Y8PB 1O78A 2NN6H 4H0LC 4Q0FA 4J1MA 2KEEA 2BE5C 1VF7A 4C3HB 5ELEA 1SNCA 3TP6A 1F2ZA 2D5DA 1GUNA 4HTHA 1EY9A 4Y7NB 4RH6A 1NR4A 2IL8A 2L5TA 2F0NA 4TRDA 4ZUJA 4DAVA 2XWJB 1EY4A 1EY0A 2CVRA 1J9OA 4C56C 3D6WA 3D8GA 1SSOA 4RCNA 2A6HC 2L0CA 2RQXA 3Q0AA 3PUWA 3MTSA 1M4VA 1KABA 4A3JB 4IFDH 2MP1A 3E0JA 5JAVA 1EOTA 2K03A 4WFN3 1LT6D 3PUYA 2B2YA 4PNYA 3H6MA 4C3IG 5I6YA 2SNMA 2F0LA 3K57A 2G9DA 1TKWB 1D2BA 2L55A 3WOEA 1MBYA 3S16B 3MZ5A 4A3GB 1ESFA 3TBIB 4CGYB 3KLSX 2AUKA 3FKIB 1QE6A 2HCCA 1X3QA 2RDHA 2AQ3B 4QUFA 3OWEB 4ZYSA 4U673 1G2SA 3S1RB 2AWNA 1HFNA 3QG1A 2KVMA 4V190 2F0FA 3CHBD 1DJRD 1RTOA 2BCOA 5IGEA 2KHSA 5COYA 3T51B 3S2HB 5C5MA 1SNDA 1ZXTA 3A8IE 3DWPA 4EVOA 3J7YW 4ZK9B 4XT3B 1G2TA 3SK4A 3K58A 3PO2B 4M8AA 1F9PA 4KJOA 1O7LA 1EY6A 3D3RA 3A55A 4P2CB 3M3YB 2ENBA 4BY7B 1XX8A 1G291 4V0BA 1E0BA 4RGOS 5EGTA 1E2WA 1W6JA 1H9MA 1F2YA 3TSSA 2O2LD 5DNFA 5EKKA 1PZKD 4DAPA 3I72A 3S17B 2ID0A 2R61A 3QOJA 4DXGA 4DA2A 1NUCA 4E6IA 4XYQA 1IYUA 1LO5D 5CV8A 3VR4A 3FEWX 1UAPA 4IFDI 2KJXA 2M9VA 1A3TA 5IGDA 3MFGA 2LFNA 3DEPA 3HOYB 4XQNA 2A69C 1CTMA 4ZUIA 1STYA 4CKCA 4K6DA 1R4PB 4FVMA 3DWQA 2YYZA 2TMPA 4L63B 1LTSD 1JOQA 1F9RA 1TWFB 1SFOB 1F9QA 2PO4A 1TS4A 4G7ZC 4BBRB 3D4WA 1XXGA 1FNVA 1I4XA 4IUVA 3CU7A 2SEBD 3W3AA 2B2UC 1BF4A 4I7ZC 5JEAG 3SR1A 1I6HB 4J8QA 2NVXB 4IZ8A 2WKDA 1ZKOA 3A8JE 4HSVA 1WD0A 5CORA 1TY2A 3QO2A 4XIGS 1PTOF 2K5DA 1FYCA 4BY1B 1PZID 2Z4IA 2A5HA 1SEBD 4LMQD 3OMGA 4BS9A 2E2HB 2A68C 5CC4A 3NQTA 2E76C 5JEAH 1X32A 4HMIA 4IALA 1PRTF 4QF4A 2I07B 2R3ZA 1OXVA 3MXUA 3VA7A 5DEHA 1QCBD 2FINB 5KIXA 2IJ0A 3J80L 2B63B 2CW0D 1J8IA 1AEXA 1CM9A 1XTCD 2E74C 3GTJB 3Q6SA 2M00A 3SHLA 2EYPA 3KK7A 4NP5A 1VCIA 1SE4A 4XQQA 1A2UA 1F9SA 4XTCS 1JC7A 1Z47A 2D2CC 4R9WA 1G8ZD 1STBA 4F7XA 3O13A 4DU9A 5E4WC 2TSSA 3BDLA 4DFAA 1LTAD 3BDOA 1I4RA 4KTAA 5FK9C 1TR5A 1XYIA 4KN4C 3IAYA 3GTGB 1SJHD 5KNDA 2F0VA 1I4HA 4B9XA 1YNND 3TZDA 5KRUA 3CRKC 2F0EA 3HOUB 1ILPA 1IHZA 5KGUA 1WCMB 2QKIC 2IX0A 2F0GA 1EEID 1SMYD 3MFYA 3M85A 1TS5A 2SNSA 3S1NB 4C3IB 5T1IA 5IODA 1A6XA 3NBHA 5FLXL 2F0DA 3FVQA 2A6EC 4KY7A 1GUOA 4RGTA 2XVSA 1S5BD 1WTWA 1JE4A 1JORA 3DWAA 1ZEQX 5C44B 5LL6X 1XWEA 2WKCA 3DM1A 1U4RA 2MJ8A 2RVLA 3RUZA 1O7YA 2YU9B 3I3CA 2Z1CA 4KKTA 2A74C 1I3QB 1F77A 1TS3A 1D5ZC 2KQ3A 5CV5A 2NZ1D 1BUVT 2FMMA 2B2VC 1V8QA 1DZ1A 4PQXA 1PTOC 1V43A 2SOBA 4C1NK 1B3AA 4KKUA 1EY5A 4ULLA 4EGVA 4RKLA 3V05A 5JVG3 3KUPA 3C2PA 2XNAC 1IW7D 4KY6A 2PNRC 2FMCA 4FF1A 2EXZA 4ZAIA 2IW3A 3C1EA 4KK7A 3LNNA 3HEJA 4RCOA 4HN7A 4KHVA 2HDLA 1OXUA 1LABA 3X3MA 3VR6A 1H9SA 2OXPA 2F4IA 1DYQA 4CJ1B 3PV0A 3SXHA 1PFBA 1E2VA 3GD7A 3H94A 1ENAA 2I46A 3KBGA 4FF2A 5K5PA 3X3NA 1EEFD 3SDZA 3MAQA 1ONLA 1D5XC 2EJMA 2B8FA 3BYTB 1DONA 3ERQA 1PRTD 3OPOA 2L9HA 2RKSA 1S4ZA 3GP7A 1L0YB 3NQIA 1EIHA 3L3OC 4RWSC 3Q24A 3HOZB 2JEBI 2NBFA 2NVYB 5I9PA 4C3JG 1WTPA 1S5CD 4RHRA 2B2WC 1GUSA 1ZYRD 1BCPF 4LK1C 3P7JA 1Q1BA 1PTOB 1IKMA 2X69A 4KD3A 5EJWA 5EKIA 2C5CA 1CT1D 4IUPA 1RJTA 5C4ZA 4K14A 2NUCA 5C0XI 4H13C 1HHVA 2F0WA 1PRTB 2EVBA 3NP8A 4HAEA 3FDTA 1VDZA 2V4DA 1I4QA 3AB9A 4NMZA 3M4YA 3HG9A 2OT2A 5A35A 4K2KA 1BO0A 1EZ8A 1FNWA 3SK6A 3PUXA 1H9KA 1RDPD 4KN7C 2RA4A 1CQFA 2AWOA 5M3MB 1U4LA 5D65A 3OWFA 4ZLTF 3NWTA 2DY7A 2J4XA 3IKJA 1TWGB 1TY0A 1PLFA 1EWCA 1AZPA 2BA0A 1EZ6A 2JXMB 1II3A 4Z9CB 2JA7B 3TDQA 4OO1G 2F3WA 1B53A 1NR2A 4FXKC 1QWYA 4RGMA 2F0HA 3ND8A 1HPCA 5BN5A 5DM73 1KLUD 2BE5D 4WJWA 1MSGA 5BN3A 1L0XB 4O42A 1O80A 2Q8RE 1QB5D 1MGSA 1HCZA 4X3KA 2F0SA 5HGTA 4C2MB 4DNRB 1Z7TA 1YNJC 4OO1H 2H1EA 4NDXA 1EYDA 3T4AC 2LS01 1SYBA 2N88A 3K5NA 3OIPA 2PYKA 4QCLA 5D14A 1T5EA 4IUTA 4X3UA 5NUCA 2A6HD 1HFGA 5G3LF 3R2IA 4RAUC 1C48A 5JOBA 2FHTA 3H09A 2AUJD 4A3BB 3J80E 5DM63 2KECA 2F0KA 2WB1B 3MEHA 1DCZA 1EYAA 3QWNA 5C4XB 3MXNA 3IFDA 4A3IB 5KNBA 4OIJA 2K7VA 2NN6I 1SYCA 5I2YA 3H0GB 1JWMD 3FPPA 1ENCA 4BWGB 2VB3X 1C8CA 2QDBA 1V1PB 5I2XA 4EQOA 2EYOA 5ELFA 5M9OA 1TIID 3CKIB 3HRZC 1BCPC 1QJOA 3E5SA 5C6AA 5C3XA 3D6CA 3C46A 3BVGA 1JWSD 3OIQA 4IQZA 1DOMA 2EY5A 2F03A 3HGBA 3J81L 3PMFA 1SYGA 2VUMB 4QIWB 4BBSB 4AYBB 1UUPA 2QCPX 4S3SA 4K5WA 1A3VA 1LTTD 2N55A 1GUWA 4ZKCB 3R93A 1JQYD 2JA6B 2B8GA 5JPMC 5IGCA 5ELBA 4OO1I 1WTQA 3LWUA 1ET6A 5FLXE 4A93B 4CJ2C 1HXYD 4IUNA 5C4JB 1CHQD 3TP8A 3I90A 3FRPB 4N9TA 5EBDA 5ISRA 1CA6A 4L8JA 4QB4A 2K6AA 4FNFA 5CGKA 1QNUA 3PO3B 5C3EB 4N9PA 1BNZA 2XWBB 4G7OC 4JK1C 3S2DB 1DM0B 2F0IA 2DNEA 5LHY1 1TWHB 1QG7A 4DF7A 5A2QL 3SE0A 1GXDC 1BCPB 3GTQB 3OSOA 2NTTA 3BG3A 4UDUC 2F3VA 3EROA 2WACA 4A3KB 3A54A 3I70A 5ELCA 2EYHA 3GTPB 2JEAI 2BDOA 3I73A 1PFMA 2PQEA 1EY8A 1K8MA 2OF1A 1I50B 1AW7A 2MHVA 1I4GA 3OMCA 3G7LA 3U9OA 2Q8IB 4C3HG 4TSSA 2KOLA 4XQJA 5KYIA 1KTKA 3N6RA 1SBBB 1FR3A 1WTXA 1W6KA 1EWHA 1X3PA 3BS1A 2A68D 1FD7D 2B2TA 4MN3A 2LY7A 5M5WB 1B4OA 5I6WA 3T13A 3C3LA 4C1NI 2IX3A 4F88A 5CV9A 5E1FA 3N52A 5I4DA 1VMCA 3EFXD 1LACA 1NSNS 2AQ1B 2DNCA 2EJGC 3W2DA 3H3VC 5D3IB 4RKBA 2J7ZA 5D3DA 5CBAE 4K8IA 4KJNA 1SE3A 2ICIA 5G3LD 4ZKBB 1T5XD 2Z4HA 1GHJA 3OW7A 2R92B 4G57A 1Z6HA 4NW2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DMU A;  3QOJ A;  3SXH A;  5DEH A;  5JAV A;  1STN A;  1SYF A;  1NUC A;  1EZ6 A;  1ENC A;  4E6I A;  2F0D A;  2LKV A;  4DF7 A;  1ENA A;  2EYF A;  4PNY A;  3H6M A;  2F0P A;  5KIX A;  2EYJ A;  3S9W A;  2QDB A;  4EQP A;  3LX0 A;  1II3 A;  5CV8 A;  5IGG A;  4KY7 A;  3TME A;  1AEX A;  1SNO A;  5I6Y A;  2SNM A;  3OSO A;  1TQO A;  1KDA A;  5K5P A;  2F0L A;  2F3W A;  1A2T A;  2EYO A;  4R8N A;  3DHQ A;  4EQO A;  2F3V A;  2M00 A;  3ERO A;  4I65 A;  4ODG A;  2WAC A;  5IIF A;  5M9O A;  1JOR A;  5C5M A;  4F8M A;  4EQN A;  3SHL A;  1A3U A;  2EYH A;  1A3T A;  4KD4 A;  4K8J A;  5IGD A;  2RDF A;  3ERQ A;  2F0H A;  2EYP A;  5KEE A;  2RKS A;  3EJI A;  4K5V A;  3E5S A;  3MZ5 A;  3P1H A;  4NP5 A;  5C6A A;  5C3X A;  3D6C A;  2O4X A;  5J39 A;  4B9W A;  1A2U A;  2PQE A;  3RUZ A;  2RBM A;  4HMJ A;  1KDC A;  1EY8 A;  2OF1 A;  4K5X A;  5IOD A;  5I9P A;  3MHB A;  4ZUI A;  2F0O A;  1STY A;  2EY5 A;  1F2M A;  2PW7 A;  4K6D A;  3TP5 A;  5C4H A;  3BDC A;  1U9R A;  1STA A;  3OMC A;  3PMF A;  1SYG A;  5EKL A;  2OEO A;  2F0J A;  5HGT A;  2F0S A;  1STB A;  2KQ3 A;  4F7X A;  5CV5 A;  1JOQ A;  4DU9 A;  3U9O A;  5CR3 A;  5IGB A;  2EY6 A;  3T16 A;  4S3S A;  4KD3 A;  3R3O A;  4LAA A;  4ZQ3 A;  2EY1 A;  2F0F A;  2F0T A;  1TT2 A;  3D4W A;  1EYD A;  1RKN A;  4K5W A;  1A3V A;  4NDX A;  4WRD A;  3MVV A;  5KYI A;  5C5L A;  2F0U A;  5IGE A;  5I9O A;  4J1M A;  1SYB A;  2KHS A;  3HZX A;  2PYK A;  3BDL A;  4DFA A;  1EYC A;  1SNM A;  5NUC A;  5IGC A;  2PZT A;  2F0Q A;  1EQV A;  2NUC A;  1SND A;  2SOB A;  2EY2 A;  4K14 A;  4KTA A;  4ME5 A;  1TR5 A;  3SR1 A;  3SK8 A;  5IOC A;  2F0W A;  5J1Z A;  4EVO A;  3D4D A;  1SNC A;  4MIU A;  4IZ8 A;  1STH A;  1EY5 A;  1SNQ A;  5JOB A;  3SK4 A;  3ITP A;  1F2Z A;  2EYL A;  3NP8 A;  3TP6 A;  4HTH A;  1EY9 A;  4WOR A;  4ID6 A;  3P75 A;  3T13 A;  5I6W A;  5F2D A;  2F0V A;  4KJO A;  4RKL A;  5E3F A;  3TP8 A;  3QOL A;  1SNP A;  1EY6 A;  3EVQ A;  5CV9 A;  1SYD A;  5IGF A;  2F0N A;  4NMZ A;  1JOO A;  2PW5 A;  4KY5 A;  4PMC A;  4TRD A;  4J6H A;  5E1F A;  4IUN A;  4ZUJ A;  4B9X A;  2ENB A;  4K2K A;  4H7B A;  1SYE A;  3NXW A;  1EZ8 A;  2F0K A;  3NHH A;  1NSN S;  4KY6 A;  4N9T A;  4NKL A;  3V2T A;  5ISR A;  2EXZ A;  3SK6 A;  5KRU A;  3MEH A;  4PMB A;  1EY4 A;  5C4Z A;  1EY0 A;  1JOK A;  3MXP A;  3SK5 A;  3C1E A;  4RKB A;  4QB4 A;  1EYA A;  1KAA A;  2F0E A;  3OMG A;  5EGT A;  5HUR A;  4K8I A;  4KJN A;  1KDB A;  3D8G A;  5CGK A;  3HEJ A;  2PZW A;  3NUC A;  5CV6 A;  1IHZ A;  5C3W A;  5KGU A;  4KHV A;  1F2Y A;  4OL7 A;  4DGZ A;  5CV4 A;  5CC4 A;  3NQT A;  4K2L A;  2F0G A;  3QB3 A;  2PZU A;  2HQE A;  4N9P A;  4KV6 A;  5J22 A;  4QMG A;  5EKK A;  2F0M A;  5CV7 A;  5DAU A;  4HMI A;  1EY7 A;  2OXP A;  4YIJ A;  3OWF A;  1KAB A;  4IAL A;  3C1F A;  3VA5 A;  1SYC A;  4G57 A;  4QF4 A;  5KYL A;  2SNS A;  1STG A;  3NK9 A;  3TP7 A;  2EYM A;  2F0I A; 
#chains in the Genus database with same CATH topology
 1HZA A;  3DMU A;  2ZJP A;  2IPK D;  1LT4 D;  4L5R C;  4OXP A;  4G7H C;  1ROD A;  2DJG C;  4X6A H;  4BXX H;  1EQT A;  1QVC A;  2EYJ A;  3S9W A;  1DOL A;  4A3L H;  4IOA A;  4A3G G;  1ICW A;  2Q8T A;  4R8N A;  1PFN A;  3ER0 A;  3FKI G;  5EAY A;  3J81 j;  1ESR A;  2X6G A;  1SMX A;  2UUB L;  4GOP C;  4GN5 A;  2LXJ A;  4A3E B;  3HOV G;  3I4N G;  1B9N A;  4FP5 D;  2IT1 A;  3VR2 A;  3GTM B;  4K5X A;  2E2J B;  4QGU A;  4DPG A;  1F2M A;  1PH8 A;  3J80 i;  1DD2 A;  1G91 A;  4AH6 A;  5M5X B;  3RZO B;  2KED A;  4A3G H;  3RN2 A;  2NYZ D;  2GVB A;  2D0P A;  2NTS A;  3GTK B;  3FKI H;  2E75 C;  3MVV A;  3PO2 G;  1SJE D;  3OW2 A;  1KLG D;  2F4V Q;  3CQZ B;  3NEM A;  2NVT B;  1IYV A;  3S1R H;  1MI2 A;  1UNS A;  4BY7 G;  1EQV A;  1O7Z A;  4DAM A;  3NSW A;  3HOV H;  4MIU A;  3I4N H;  4GN4 B;  3H91 A;  3ITP A;  2YTV A;  2XRQ D;  1WTR A;  1Y1W H;  1D1K A;  5K36 G;  1IBL Q;  2BA1 A;  3RD4 A;  4DV0 Q;  4GZY C;  1SNP A;  3K6O A;  3S2H H;  1QIL A;  3NXW A;  4NKL A;  1WTH A;  4LUV A;  2P5Z X;  4XXE A;  3M4Q A;  2A6E D;  3RMH A;  3UDI A;  5BN4 A;  4JI8 Q;  3K81 C;  3K5L A;  3GTO B;  3PO2 H;  2PZW A;  4YCW A;  1D1I A;  4K6L A;  4DGZ A;  2WIN B;  5M3F H;  1PH7 A;  1J5E Q;  3J7A F;  3E6Z X;  4LUZ A;  4JI5 Q;  1LTG D;  2L1B A;  3M3Y H;  5FO8 B;  1HNX Q;  2RSO A;  2X6L A;  2WAQ B;  1STG A;  2JA5 B;  3FPU B;  2UXB Q;  1K0S A;  2MQH A;  1K8G A;  5T1G A;  1QVF A;  4TQU S;  1I6V C;  3UI2 A;  2F1M A;  3ERS X;  2SDF A;  4FF4 A;  4GOP B;  5EPJ A;  1HZ9 A;  3LX0 A;  5IP7 G;  2IY5 B;  1FNU A;  2F3I A;  2QF7 A;  3HOY G;  1X3F A;  2CWP A;  1XPO A;  3NTH A;  3WDN A;  3S17 H;  3ZYY X;  4X3T A;  1A8V A;  5GAE C;  3PIP 3;  1XMO Q;  3F2B A;  2RDF A;  2PCF B;  4OEL B;  1UEA B;  3HP3 A;  3EJI A;  1CI3 M;  2ZXR A;  5GAH C;  1KRT A;  1PTO D;  3HOW G;  1HNW Q;  1U0L A;  3E3X A;  3M7N A;  1PH9 A;  4BBR G;  1PZJ D;  2QGQ A;  4GNX C;  2F4V L;  4PZ8 A;  1LTI D;  3MHB A;  2YTY A;  4B3T Q;  3AYH B;  3Q8D A;  1HA5 A;  3VR5 A;  3BZD B;  3G6J B;  4WJ3 M;  2D9U A;  2OEO A;  2K5Q A;  3EA6 A;  4CDF C;  4R8I A;  3K59 A;  5IP7 H;  2EY6 A;  3OOC A;  1OXS C;  1IBL L;  4LAA A;  4DV0 L;  1RKN A;  2K04 A;  3OHX C;  4UPA A;  2B39 A;  3S1Q B;  1L2F A;  1FL0 A;  2PZT A;  2HT1 A;  3TZU A;  3FMC A;  4LFC Q;  2KCN A;  4JI8 L;  5J1Z A;  1SFO H;  1PYS B;  4BY1 G;  4DK0 A;  3HOW H;  1S5F D;  2HDM A;  4BBR H;  4MTN A;  3UE1 A;  5BR8 Q;  4DR2 Q;  1J5E L;  3G71 A;  3TS0 A;  3HKZ E;  4JI5 L;  2RHS B;  2LMC B;  1N9W A;  2JE6 I;  4CHT B;  1HNX L;  4G4K A;  1V9P A;  4H7B A;  1SYE A;  4X64 Q;  1EU4 A;  1I6H H;  1D6E C;  1SDF A;  1V1P A;  2UXB L;  2NVX H;  5LL6 S;  1E2Z A;  2EZV A;  1K9M C;  5FOB B;  1ASZ A;  1C4Q A;  2Z8L A;  5M5Y B;  1RD9 D;  3TN2 A;  5C3W A;  2WII B;  3URY A;  4OL7 A;  1IL2 A;  4LF5 Q;  2AKW B;  5IY0 A;  4KV6 A;  1ML0 D;  2B63 G;  4KHP Q;  2H4O A;  1PYW D;  4C3J H;  4BY1 H;  2ZXO A;  3PIO A;  3NK9 A;  2CQA A;  1XMO L;  4OGQ C;  1UE6 A;  2R6G A;  1D5M C;  3CC2 A;  2E2H H;  3STB D;  3J81 E;  2R7Z H;  4KMU C;  1HNW L;  1PMR A;  3TME A;  3D0F A;  4IUU A;  2G9H D;  3M4O B;  1NMG A;  4B3T L;  5FO9 B;  1VQK A;  4ODG A;  5IIF A;  3S1M B;  1Y8O B;  4O2D A;  2JN4 A;  4F8M A;  1B44 D;  1SRU A;  1WJJ A;  2RHQ B;  1ICF B;  2K33 A;  1WVL A;  1KNA A;  4K8J A;  4A3D B;  3ND9 A;  5HGQ A;  4DV7 Q;  3QR8 A;  3K0Y A;  4K5V A;  2B63 H;  3P1H A;  1KRS A;  4B9W A;  3M7G A;  2JA9 A;  3S14 H;  4IUQ A;  1NAP A;  3NWS A;  5C4H A;  4UHV A;  4LFC L;  3KFU A;  3K5O A;  4ILW A;  4IFD G;  1ILQ A;  3QJY A;  3I7F A;  3DLL A;  5CR3 A;  5BR8 L;  4DR2 L;  4Y52 H;  5FKA C;  3RZD B;  2F0T A;  1U4P A;  3AFP A;  1TWC B;  3T1Y Q;  1N8R C;  4X64 L;  2ZJQ A;  3K5M A;  4UAI A;  2K5W A;  2EY2 A;  1TS2 A;  1WTO A;  1XNR Q;  3CP0 A;  1OO9 B;  3W1G A;  4LF5 L;  3HOU G;  2K75 A;  3P75 A;  4DAY B;  1C7Y A;  4KHP L;  1WCM G;  3EVQ A;  1K73 C;  1SYD A;  4RFB A;  5A2Q E;  2PW5 A;  2KA7 A;  1WD1 A;  1E1O A;  2ZM6 Q;  1A63 A;  3KF8 A;  3MXP A;  2DY8 A;  1TVX A;  4L6T B;  1HR0 Q;  3GTG H;  1GUG A;  5AFW A;  2RSN A;  3HS0 C;  4OHJ A;  3T53 B;  1RF2 D;  2HQE A;  1HQR D;  1VQ7 A;  4U68 A;  4FF3 A;  2BOS A;  3CCJ A;  4QMG A;  1BDO A;  2F0M A;  2E2D C;  3MEF A;  1EY7 A;  1QZH A;  2OWO A;  5KYL A;  4DN4 M;  1VQA A;  4XT1 B;  3RLO A;  3HFZ B;  1A15 A;  4TKO B;  1HTP A;  5EPK A;  1YI2 A;  3UE0 A;  4B3M Q;  2ZXP A;  1H9S B;  4DV7 L;  1SYF A;  1TWA B;  5C0X J;  1WCM H;  5C44 G;  1V1Q A;  2LKV A;  2GVA A;  2FXQ A;  2ICE C;  4EQP A;  1B2T A;  3M9B A;  3NTK A;  4JI4 Q;  3BVZ A;  2MO1 A;  3A56 A;  5EQ0 A;  4LF8 Q;  3DHQ A;  4P71 A;  3S1N H;  2AQ2 B;  1YNJ D;  3PUV A;  1UE5 A;  3HOV B;  4HIO A;  1Y1V B;  1JWU D;  1R4Q B;  3I4N B;  1PH4 A;  1YJW A;  1PDQ A;  3SEB A;  1NY4 A;  1Y1W B;  5E4X A;  4X3S A;  2K52 A;  1Q86 C;  2Q2T A;  2A73 B;  3G4S A;  3CCE A;  3T1Y L;  2K32 A;  5GAG C;  2B2U A;  4DR5 Q;  1MSH A;  1STA A;  5C44 H;  4L5S A;  3HOX B;  1EL0 A;  1BVS A;  1Y69 U;  2EDG A;  3I8Z A;  5JJZ A;  4JBJ A;  3TEH B;  1GJX A;  1U5K A;  4XYO A;  5CBE E;  5M3F B;  2Z6K C;  1XNR L;  4GKJ Q;  1T9H A;  4R4I A;  2EY1 A;  2JSO A;  2YU9 H;  3GTL H;  2OQK A;  2E2I H;  4BA1 I;  1HRJ A;  2JP1 A;  5L37 A;  3TQY A;  5EPL A;  1I3Q H;  2B2Y C;  2ZT9 C;  2ZM6 L;  2RCF A;  1AZQ A;  3S15 B;  3KBX A;  1X3G A;  4KKS A;  1Y14 B;  2KHI A;  3JAM L;  3PQI A;  1STE A;  4RGN A;  1KD1 C;  1HR0 L;  1VQP A;  3KF6 A;  1STH A;  2Z9H A;  2EYL A;  1LLR D;  5IT9 L;  3QOL A;  4HCE A;  2NZO A;  2VNU D;  4OON A;  4KY5 A;  3D4R A;  3PIO 3;  3WOF A;  3JC6 6;  3R8B A;  2EE1 A;  1HQM C;  1AN8 A;  4PMB A;  4B3M L;  4F87 A;  1Y8N B;  1NCV A;  3BU2 A;  2PPB C;  1KAA A;  1PVO A;  5HUR A;  1KDB A;  4HIM A;  1YVC A;  5CV6 A;  1HA6 A;  3GV3 A;  3P20 A;  1HUN A;  3A7L A;  3BVM A;  5CV4 A;  1S72 A;  1PXU A;  4JI4 L;  2LXK A;  2WV6 D;  3E9I A;  2D0O A;  4LF8 L;  1CQV A;  2XSC A;  1K83 B;  1BCP D;  3BJU A;  1WFQ A;  4QJF A;  1C9O A;  3VA5 A;  4CKE A;  2VQF Q;  4WJ4 A;  3NPP A;  5JJL A;  2O5I C;  3NE5 B;  1Q90 A;  3CD6 A;  2XN9 C;  4YHH Q;  2NB0 A;  2NVQ B;  2KEN A;  1BBX C;  1IKL A;  2L11 A;  1JIC A;  2WP8 J;  5IGG A;  4R4O A;  1SNO A;  4JC0 A;  2VQE Q;  2EQS A;  1P8L A;  4DR5 L;  5EBC A;  1HZB A;  3HOZ G;  1EFI D;  1N36 Q;  1RTN A;  5KNC A;  2EJF C;  4NXM Q;  3F2U A;  3HOW B;  1Q3L A;  1A3U A;  2VXW A;  4KD4 A;  3VDY A;  1B50 A;  4GKJ L;  5KEE A;  4X66 Q;  2XTI A;  2MPM A;  1M8A A;  4JPB W;  3D31 A;  5J39 A;  4DNT B;  2A69 D;  3U4Z A;  4HMJ A;  3KLS A;  2XRS D;  3L9A X;  3S24 A;  4OIK A;  4AYB E;  1LV9 A;  1SXT A;  3MC0 B;  1KIX A;  2CW0 C;  3BDC A;  4DV4 Q;  1B70 B;  1WTV A;  1U4M A;  3CC7 A;  4R1J A;  2PMZ B;  2VB2 X;  1JR0 D;  1UE7 A;  5IGB A;  3VR3 A;  4FO2 A;  4ZQ3 A;  1L0W A;  2NVY H;  4WRD A;  4C3J B;  2F0U A;  2M2L A;  3L7Z C;  5I9O A;  3DXJ C;  3HZX A;  4A3F B;  1G51 A;  3Q23 A;  1A0I A;  3KLW A;  3H3V I;  4OEM B;  2K1B A;  1NNX A;  2R7Z B;  1PTO H;  2IWH A;  1VMP A;  5F2D A;  5E3F A;  3J81 i;  1LUZ A;  4N8X 1;  4DR1 Q;  5IGF A;  3VYT A;  2VY3 A;  3K7A H;  2VQF L;  3MXG A;  5M3M G;  4IN3 A;  1QOH A;  3CCV A;  4HED A;  4YHH L;  4DK6 C;  1OXT A;  1JOK A;  2LSS A;  4ABN A;  4CDC C;  4HR7 B;  2JA8 B;  2QEX A;  3NUC A;  4FXG C;  3E0E A;  2MUY A;  5LMU Q;  4RA8 A;  2VQE L;  2PZU A;  3S14 B;  4IFD J;  1N36 L;  2JA7 G;  3MXN B;  1XPR A;  1JB3 A;  1BOS A;  4NXM L;  1GHK A;  3TP7 A;  3KLR A;  2RF4 A;  3A8K E;  2HUG A;  4R4T A;  3CF5 A;  1IYJ B;  3AMU A;  3TS2 A;  4X66 L;  1STN A;  5CYU A;  1YNN C;  4FYD A;  4C3H H;  3TRZ A;  4JI0 Q;  2EYF A;  3M4P A;  2EXD A;  4H44 C;  3RLF A;  4FXD A;  1Q12 A;  1GOZ A;  1A2T A;  1QNK A;  2NWG A;  1TWG H;  4DV4 L;  2I5H A;  1EFW A;  3CCR A;  5JPN C;  2UUC Q;  1SMY C;  4IJH A;  1S5E D;  1Q8I A;  2B2V A;  4L5T A;  3I91 A;  3ONA B;  3MA2 B;  2PQA B;  1HTL D;  3KJO A;  5FO7 B;  2UU9 Q;  1LT5 D;  2RBM A;  4HIK A;  2Z0S A;  4LF7 L;  3SVM A;  2MGS A;  2PW7 A;  2Z6B A;  2CHB D;  4XDX A;  4A3J H;  5EKL A;  2MFI A;  4HSP A;  1JCK B;  1VQI A;  2JQO A;  3T16 A;  1R9T B;  1GO3 E;  3R3O A;  1TT2 A;  1MJE A;  4DR1 L;  3EQL C;  5C5L A;  3CRL C;  3DUZ A;  4OWT B;  4A3C G;  1G6Z A;  1EU3 A;  3IRB A;  4KI0 A;  2R7F A;  3FHW A;  4A3B G;  1CK1 A;  3U9S A;  2F0Q A;  3L2P A;  3NBI A;  1S5D D;  5IOC A;  1EIG A;  1PA6 A;  1BR9 A;  3UDG A;  3D4D A;  2WB1 G;  3GO5 A;  1Q1E A;  1SNQ A;  1I4P A;  5LMU L;  4WOR A;  1RHP A;  4ID6 A;  5C4X G;  4DK1 A;  1CZG A;  4LJZ C;  3V96 A;  5FLM G;  4A3M B;  4A3I G;  3S16 H;  2KCC A;  4J15 A;  4PMC A;  2JK8 A;  2DN8 A;  3PUZ A;  2N49 A;  4GS3 A;  3NHH A;  4HJA A;  1E24 A;  4RHS A;  3CCS A;  3OTO L;  3IL8 A;  5C0X G;  3T56 B;  1F2L A;  3H0G G;  1H9R A;  2B2T C;  3SK5 A;  4Q5V A;  4JI0 L;  4A3C H;  3I4M B;  3GQB A;  4K2L A;  3A7A B;  3QB3 A;  1CZW A;  1LT3 D;  1B1Z A;  5J22 A;  1AFP A;  3QIA A;  4YIJ A;  3C1F A;  3LWE A;  3R2T A;  2RDG A;  2UUC L;  3K7U C;  2IX1 A;  3DEO A;  5C4X H;  1IW7 C;  3OYY A;  3CCM A;  3GTL B;  1DOK A;  3Q22 A;  2E2I B;  4BA2 I;  2UU9 L;  2F0P A;  1HR0 W;  5TSS A;  4IUR A;  2QEJ C;  1YHB A;  4M1U B;  4B08 A;  1LTR D;  1LYL A;  2XGT A;  3AU7 A;  1I94 Q;  5C0X H;  3J7Z C;  1KNE A;  3H0G H;  3NEL A;  5ELD A;  1ET9 A;  1K8O A;  1SLJ A;  4ALP A;  2B2W A;  4BY7 H;  4EQN A;  4JBW A;  1PH1 A;  1PFS A;  2VUM G;  1SRO A;  3GV6 A;  1V1O A;  3CME A;  2GA4 B;  3I4L A;  4CKB A;  4BBS G;  4AYB G;  3WWV A;  5K36 H;  4DXF A;  2Y0S B;  1SAP A;  2JJQ A;  1KDC A;  1E22 A;  4IPC A;  4DAY A;  2F0O A;  1OXX K;  3J7A V;  4JG2 A;  3K0X A;  2JA6 G;  1O7I A;  4MHE A;  1CHP D;  1AP0 A;  1G6P A;  3CCL A;  5ELN A;  1PRT C;  3BYY B;  2K28 A;  3HKZ B;  2C9O A;  4PV1 C;  2FJ2 A;  4A93 G;  1EYC A;  1SNM A;  4CJ0 B;  4ME5 A;  3SK8 A;  2D62 A;  2FFK B;  3EN2 A;  5CMD A;  4O1N A;  1CKO A;  4JI7 Q;  1N33 Q;  3A74 A;  3F1Z A;  3MWY W;  1MD2 D;  1GUT A;  1CA5 A;  1ZYR C;  4JOI A;  3RR5 A;  2R93 B;  4UP9 A;  5JVH 3;  2K01 A;  3PO3 G;  5C3E G;  3NTI A;  3HOY H;  2BDN A;  2EOT A;  1JOO A;  3ULP A;  2RCN A;  4J6H A;  1C0A A;  4LFA Q;  2XIW A;  5IYC G;  3V2T A;  2L12 A;  4CBV A;  1MJC A;  1IL8 A;  3VYR A;  2UXC Q;  2O5J C;  2VZA A;  5JEA J;  5J3B A;  4X62 Q;  1B9M A;  1HUM A;  1TWF H;  2K50 A;  4PMW A;  4A93 H;  3IFT A;  1SE2 A;  1I94 L;  2EPB A;  5CV7 A;  1HZC A;  5DAU A;  1CFM A;  4PZ6 A;  2NZH A;  2EYM A;  2KUM A;  4A3K G;  4DV2 Q;  1VF5 C;  4HCS A;  4QUC A;  1JMC A;  2J0T D;  3PO3 H;  5C3E H;  3VYS A;  5IYC H;  1BQQ T;  2HCI A;  2JYO A;  3S2D H;  1TQO A;  1KDA A;  1L1O C;  1LTB D;  2NN6 G;  1FGB D;  4I65 A;  3F2D A;  1TU2 B;  4N8F A;  1TWH H;  4ZRZ A;  1ENF A;  2L4N A;  1PV4 A;  3JAM E;  2K05 A;  3G6E A;  2O4X A;  1H9J A;  1YJN A;  4DR3 Q;  1RCV D;  3K7A B;  4B3S Q;  1BXT A;  4UY8 C;  3U50 C;  2OTJ A;  4A3K H;  3NBH B;  3PCO B;  5IT9 E;  3TP5 A;  3VYU A;  1DXM A;  1U9R A;  4KHZ A;  3GTP H;  2QIL A;  4LF6 Q;  1VQD A;  2F0J A;  5DLQ E;  1Y8P B;  4JI7 L;  1N33 L;  3EBE A;  4GNX B;  1O78 A;  2NN6 H;  3PSI A;  1VQO A;  4H0L C;  4Q0F A;  3CCQ A;  1JJ2 A;  1I50 H;  3JAM c;  4LFA L;  4J1M A;  1BBW A;  2K5V A;  2KEE A;  3GTJ H;  2UXC L;  3A5U A;  3J81 c;  3H15 A;  2BE5 C;  1VF7 A;  4C3H B;  5ELE A;  1SNC A;  3F2C A;  5IT9 c;  4X62 L;  5FJ8 G;  1EUJ A;  3TP6 A;  1F2Z A;  2D5D A;  4DV5 Q;  1GUN A;  4HTH A;  1EY9 A;  4A75 A;  4Y7N B;  4RH6 A;  3UDF A;  1EWI A;  4DV1 Q;  4APV A;  1NR4 A;  2IL8 A;  2L5T A;  2F0N A;  5JJI A;  4TRD A;  4ZUJ A;  4DAV A;  2XWJ B;  3KJP A;  2R92 G;  1AE3 A;  1EY4 A;  4DV2 L;  1EY0 A;  2CVR A;  1J9O A;  2E8G A;  4C56 C;  3D6W A;  3D8G A;  3RNU A;  1SSO A;  2KHJ A;  4RCN A;  2A6H C;  5E7N A;  1IBK Q;  2L0C A;  2RQX A;  3Q0A A;  3PUW A;  1FGU A;  3MTS A;  1M4V A;  2HIX A;  1KAB A;  4P72 A;  4A3J B;  2Z6K A;  5FJ8 H;  1L1O B;  4IFD H;  2MP1 A;  1HJP A;  3E0J A;  4MTK A;  5JAV A;  1EOT A;  2K03 A;  4WFN 3;  1LT6 D;  3PUY A;  2B2Y A;  4PNY A;  4A4I A;  4EX5 A;  3H6M A;  4DR3 L;  4B3S L;  4C3I G;  5I6Y A;  2SNM A;  4A3E G;  4TVA B;  2F0L A;  2R92 H;  3K57 A;  2G9D A;  1TKW B;  4NPS A;  4LF6 L;  1D2B A;  4QY7 A;  2L55 A;  3WOE A;  1MBY A;  3S16 B;  3MZ5 A;  4A3G B;  1ESF A;  3TBI B;  3W1B A;  4CGY B;  3HOU H;  3KLS X;  2AUK A;  3FKI B;  1EOV A;  1QE6 A;  2HCC A;  1X3Q A;  2RDH A;  4QQB X;  2AQ3 B;  4QUF A;  1YNX A;  3KDF B;  3OWE B;  4ZYS A;  4DUY Q;  5AJ3 Q;  1CSQ A;  4IOC A;  4U67 3;  4KLK A;  1G2S A;  3S1R B;  2AWN A;  1HFN A;  3QG1 A;  2KVM A;  1CSP A;  4JBK A;  4C3I H;  4DV5 L;  4A3E H;  4V19 0;  2F0F A;  4DV1 L;  3CHB D;  3GTM H;  2E2J H;  1YJ9 A;  4FDB A;  1PH3 A;  1DJR D;  1RTO A;  2BCO A;  5IGE A;  2HHH Q;  2KHS A;  5COY A;  3T51 B;  3S2H B;  1FJG Q;  5C5M A;  1SND A;  1ZXT A;  3A8I E;  3DWP A;  3RZO H;  4EVO A;  3J7Y W;  4ZK9 B;  4XT3 B;  1G2T A;  3SK4 A;  3GTK H;  1EQQ A;  3K58 A;  3PO2 B;  4M8A A;  1IBK L;  1F9P A;  4JI6 Q;  4KJO A;  1O7L A;  1M1K C;  1EY6 A;  3D3R A;  3A55 A;  3CQZ H;  2NVT H;  4P2C B;  3M3Y B;  2ENB A;  2K14 A;  1XX8 A;  3SGI A;  2Q2U A;  4BY7 B;  4NXN Q;  2MNA A;  1G29 1;  1K3B C;  4JV5 Q;  2WAQ G;  4V0B A;  2JA5 G;  1E0B A;  4RGO S;  5EGT A;  1E2W A;  1W6J A;  1H9M A;  1VQE A;  2AMC B;  1F2Y A;  1VQJ A;  4L5Q A;  2O2L D;  5DNF A;  3TSS A;  5EKK A;  2PQA A;  1PZK D;  4DAP A;  2WB1 E;  3I72 A;  1YIJ A;  1YHQ A;  4DR6 Q;  4UP8 A;  3S17 B;  2ID0 A;  2R61 A;  3QOJ A;  4JYA Q;  4DXG A;  4DA2 A;  1N34 Q;  1NUC A;  4E6I A;  4XYQ A;  3RN5 A;  4NB3 A;  1IYU A;  1LO5 D;  1FVI A;  5CV8 A;  1VQ9 A;  4LUO A;  4POF A;  1VQM A;  3VR4 A;  4DUY L;  5AJ3 L;  4O0A A;  1VQ4 A;  2JA5 H;  3FEW X;  1UAP A;  4IFD I;  2KJX A;  4OWX B;  2M9V A;  1A3T A;  5IGD A;  3MFG A;  1Q82 C;  2LFN A;  3DEP A;  4LNQ A;  3HOY B;  1IBM Q;  3K8A A;  2HHH L;  2DUD A;  4XQN A;  2A69 C;  1CTM A;  1FJG L;  4ZUI A;  1STY A;  4CKC A;  4K6D A;  1R4P B;  4FVM A;  2HQL A;  3DWQ A;  2YYZ A;  2TMP A;  4L63 B;  1LTS D;  1JOQ A;  1F9R A;  1TWF B;  1SFO B;  1F9Q A;  4JI6 L;  2PO4 A;  1TS4 A;  4G7Z C;  4H02 A;  4BBR B;  3D4W A;  1XXG A;  1XPU A;  1FNV A;  1I4X A;  4IUV A;  3CU7 A;  1WYD A;  2SEB D;  3W3A A;  2B2U C;  4NXN L;  1BF4 A;  4I7Z C;  5JEA G;  4JV5 L;  4QIW E;  3SR1 A;  1I6H B;  4J8Q A;  2NVX B;  1GKH A;  4IZ8 A;  1MHW C;  2WKD A;  1ZKO A;  3A8J E;  4HSV A;  2K5N A;  2QA4 A;  1WD0 A;  5COR A;  4QL5 A;  1UEB A;  1TY2 A;  3QO2 A;  3HOZ H;  4XIG S;  1PTO F;  2ATW A;  3AQQ A;  4DR6 L;  2K5D A;  1FYC A;  4BY1 B;  1PZI D;  2Z4I A;  1SE8 A;  1HNZ Q;  4JYA L;  2A5H A;  1N34 L;  4LF7 Q;  1SEB D;  4LMQ D;  3OMG A;  1XTD A;  4BS9 A;  2E2H B;  3KF8 B;  2A68 C;  5CC4 A;  3NQT A;  3JAM i;  2E76 C;  4IPG A;  5JEA H;  1IZ6 A;  2F52 A;  1X32 A;  4HMI A;  4IAL A;  1PRT F;  4QF4 A;  2I07 B;  2R3Z A;  3AFQ A;  4HJ7 A;  1OXV A;  3MXU A;  4GOP A;  5LMN Q;  4GLX A;  3VA7 A;  1JE5 A;  5DEH A;  4DK3 C;  3I56 A;  1QCB D;  4A3D G;  1IBM L;  1JT8 A;  2FIN B;  5KIX A;  2IJ0 A;  3J80 L;  2B63 B;  2CW0 D;  1J8I A;  1AEX A;  1CM9 A;  1XTC D;  4YCU A;  3CPW A;  2E74 C;  3GTJ B;  3Q6S A;  2M00 A;  1EQR A;  4LF4 Q;  3SHL A;  4UP7 A;  2EYP A;  3KK7 A;  4NP5 A;  3OTO Q;  1VCI A;  1SE4 A;  1VQF A;  4XQQ A;  1A2U A;  2ZTC A;  1F9S A;  4XTC S;  1JC7 A;  1Z47 A;  1X65 A;  3S1M H;  2D2C C;  1N32 Q;  5M3M H;  2E5L Q;  3FP9 A;  2KBN A;  1CUK A;  4R9W A;  1G8Z D;  1P16 A;  1STB A;  1VS0 A;  4F7X A;  4YWM A;  3O13 A;  4DU9 A;  5E4W C;  4BXX G;  2TSS A;  4OX9 Q;  1KL9 A;  3TRE A;  1GD7 A;  2CFM A;  1TXY A;  2JA7 H;  2OTL A;  5IYB G;  3BDL A;  4DFA A;  1LTA D;  3BDO A;  1I4R A;  1Q7Y C;  4A76 A;  4KTA A;  5FK9 C;  1HNZ L;  1TR5 A;  1XYI A;  4KN4 C;  4YY3 Q;  1JJG A;  3RZD H;  3IAY A;  1K28 A;  2I5L X;  3GTG B;  4JI3 Q;  1SJH D;  5KND A;  2F0V A;  3PF5 A;  1TWC H;  4IPD A;  1I4H A;  1E1T A;  4B9X A;  1YNN D;  1X9N A;  1OTC A;  5LMN L;  3TZD A;  5KRU A;  3CRK C;  2OCE A;  2F0E A;  4DKA C;  3HOU B;  1ILP A;  4C2M H;  1IHZ A;  5KGU A;  1WCM B;  1VQC A;  2QKI C;  1B7Y B;  5IYB H;  2IX0 A;  2F0G A;  2DJF C;  1EEI D;  1SMY D;  3MFY A;  1K8A C;  3M85 A;  1X6O A;  2QDL A;  1TS5 A;  4LF4 L;  2SNS A;  4LW1 A;  3S1N B;  1X56 A;  4C3I B;  5T1I A;  5IOD A;  1A6X A;  3NBH A;  1E7Z A;  4JBM A;  1Y1V G;  4CDD C;  5FLX L;  2F0D A;  4GLV B;  1YEZ A;  1Y1W G;  1XMQ Q;  3FVQ A;  2A6E C;  4KY7 A;  4GNX A;  1GUO A;  4RGT A;  2IHE A;  2DGY A;  1S5B D;  2XVS A;  1AH9 A;  3PF4 A;  1N32 L;  1VQN A;  2E5L L;  1WTW A;  3I2Z A;  2ES2 A;  1JE4 A;  4A3B H;  1JOR A;  2AHO B;  3DWA A;  3U4V A;  1Q81 C;  4P74 A;  1ZEQ X;  1TWA H;  5C44 B;  5LL6 X;  1XWE A;  2WKC A;  3HOX G;  3DM1 A;  2HIV A;  1W2B A;  2H5X A;  1U4R A;  2MJ8 A;  4OX9 L;  1EIF A;  5M3F G;  2CWA A;  3CPF A;  2RVL A;  3RUZ A;  5FLM H;  1O7Y A;  2N78 A;  4A3I H;  2YU9 B;  3I3C A;  2Z1C A;  5IWA Q;  4KKT A;  2A74 C;  1VQH A;  4PZ7 A;  1I3Q B;  2UUA Q;  1Y1V H;  1F77 A;  1TS3 A;  4R4C A;  1D5Z C;  4YY3 L;  3B6Y A;  2KQ3 A;  5CV5 A;  2NZ1 D;  2OQ0 A;  1BUV T;  2FMM A;  2K4K A;  2B2V C;  2BH8 A;  4JI3 L;  4EQ5 A;  1YZ6 A;  4JVZ A;  3UDX A;  1V8Q A;  1DZ1 A;  4PQX A;  1CKN B;  3HOX H;  1PTO C;  1V43 A;  2SOB A;  4C1N K;  3J7A 5;  1KQS A;  1B3A A;  4KKU A;  1EY5 A;  4ULL A;  4EGV A;  1M90 C;  1L1O A;  4ZCK A;  1S3O A;  4RKL A;  4HJ5 A;  3V05 A;  3HKS A;  5JVG 3;  3S15 H;  2KCT A;  3KUP A;  3C2P A;  2XNA C;  1IW7 D;  1NE3 A;  4KY6 A;  2PNR C;  2FMC A;  4FF1 A;  2EXZ A;  4ZAI A;  4PG3 A;  1MKH A;  2IW3 A;  4YCV A;  4X65 Q;  3C1E A;  2VUM H;  4KK7 A;  1XMQ L;  3LNN A;  3HEJ A;  4RCO A;  4HN7 A;  2B29 A;  4KHV A;  2HDL A;  4BBS H;  3A0J A;  1PH5 A;  1OXU A;  1LAB A;  3X3M A;  4CDE C;  3VR6 A;  1KHI A;  1H9S A;  2OXP A;  2F4I A;  1DYQ A;  2JA6 H;  1VQB A;  4CJ1 B;  3KDF A;  3PV0 A;  3SXH A;  1PFB A;  1E2V A;  3GD7 A;  3H94 A;  1ENA A;  2I46 A;  3KBG A;  4FF2 A;  1EYG A;  1K83 H;  5IWA L;  2L15 A;  1QUQ B;  5K5P A;  3X3N A;  1EEF D;  3PGZ A;  3SDZ A;  3MAQ A;  3ULJ A;  2UUA L;  2WAQ E;  1ONL A;  4IPH A;  2ALY B;  2ZTE A;  5C4J H;  1D5X C;  2EJM A;  2B8F A;  3F8T A;  2NVQ H;  1B8A A;  3BYT B;  2Y0S E;  4MNO A;  1DON A;  3ERQ A;  1PRT D;  3OPO A;  2L9H A;  4DUZ Q;  2RKS A;  1S4Z A;  3GP7 A;  5HY6 A;  1L0Y B;  3AEV A;  3NQI A;  1EIH A;  3L3O C;  3G48 A;  4RWS C;  3Q24 A;  3HOZ B;  2JEB I;  2NBF A;  2NVY B;  3STB C;  5I9P A;  1VQ5 A;  4C3J G;  1WTP A;  1S5C D;  2I5M X;  4RHR A;  1B3Q A;  1SN8 A;  1YHA A;  4A3F G;  2B2W C;  1GUS A;  1ZYR D;  1BCP F;  4LK1 C;  3P7J A;  1Q1B A;  1HH2 P;  1PTO B;  1IKM A;  2R7Z G;  2X69 A;  4GKK Q;  4KD3 A;  5EJW A;  3BZC A;  3CW2 C;  5EKI A;  2C5C A;  1CT1 D;  5GQO A;  4IUP A;  3GTQ H;  1RJT A;  5C4Z A;  4K14 A;  2NUC A;  4X65 L;  2EIF A;  5C0X I;  4H13 C;  1HHV A;  2F0W A;  1KC8 C;  1PRT B;  2EVB A;  2PI2 A;  3LGJ A;  3NP8 A;  4HAE A;  1D8L A;  3FDT A;  1VDZ A;  2JA8 G;  2GN5 A;  5GAD C;  2V4D A;  1I4Q A;  1UE1 A;  3AB9 A;  4NMZ A;  4A3F H;  3M4Y A;  4DR7 Q;  1KXL A;  3HG9 A;  2OT2 A;  5A35 A;  1NBW A;  4K2K A;  4AIM A;  1BO0 A;  1EZ8 A;  1FNW A;  4JI1 Q;  3SK6 A;  3ICE A;  3PUX A;  1VQ6 A;  1H9K A;  2G5D A;  1RDP D;  4I7A A;  4KN7 C;  2Q2H A;  2RA4 A;  1CQF A;  4GLA C;  2AWO A;  4JOI C;  4B3R Q;  5M3M B;  1RL2 A;  1U4L A;  5D65 A;  3OWF A;  4DNI A;  1AE2 A;  2N8N A;  4ZLT F;  3NWT A;  4LWC A;  2DY7 A;  2J4X A;  3IKJ A;  1TWG B;  1TY0 A;  2R7D A;  1PLF A;  1EWC A;  1PYB A;  2JA8 H;  4DUZ L;  1GVP A;  1AZP A;  2BA0 A;  1EZ6 A;  1LM0 A;  2JXM B;  5M5W H;  1II3 A;  4Z9C B;  4JI2 Q;  2JA7 B;  2CQO A;  3TDQ A;  5JJK A;  4OO1 G;  1D7Q A;  1QVG A;  1ASY A;  2F3W A;  1B53 A;  1NR2 A;  4FXK C;  1SR3 A;  1Q8K A;  3K80 C;  1QWY A;  4RGM A;  1MIU A;  4HJ9 A;  2F0H A;  3ND8 A;  1HPC A;  4YWL A;  5BN5 A;  4GKK L;  5LMN W;  4HJ8 A;  5DM7 3;  3DM3 A;  3I55 A;  2QW7 A;  1KLU D;  1GM5 A;  2BE5 D;  4WJW A;  1MSG A;  5BN3 A;  2ZTD A;  1L0X B;  4DV6 Q;  4O42 A;  1O80 A;  1XNQ Q;  3BZK A;  2Q8R E;  1K3R A;  1QB5 D;  1MGS A;  1HCZ A;  4X3K A;  2F0S A;  5HGT A;  4C2M B;  4DNR B;  1Z7T A;  1YNJ C;  4OO1 H;  4K0K Q;  2H1E A;  4AQY Q;  1X54 A;  5H1S E;  4NDX A;  1EYD A;  3T4A C;  2LS0 1;  4DR7 L;  4LFB Q;  1SYB A;  2N88 A;  3K5N A;  3OIP A;  2PYK A;  4A3M G;  4QCL A;  4JI1 L;  1WOC A;  5D14 A;  2MO0 A;  1T5E A;  4IUT A;  4X3U A;  5NUC A;  2HD3 A;  2A6H D;  1VQ8 A;  1HFG A;  5G3L F;  3R2I A;  1R9T H;  4RAU C;  1C48 A;  5JOB A;  2FHT A;  1JB7 A;  2C35 B;  2BH2 A;  3H09 A;  4B3R L;  3I4M G;  2AUJ D;  4A3B B;  3J80 E;  5DM6 3;  2KEC A;  2F0K A;  4GN3 B;  3CCU A;  4JCV E;  2WB1 B;  3MEH A;  1DCZ A;  4IO9 A;  1EYA A;  1YBY A;  3QWN A;  3E9H A;  5C4X B;  3MXN A;  3IFD A;  5M5X H;  2KCM A;  4A3I B;  5KNB A;  4A3M H;  4JI2 L;  4OWW B;  1NJI C;  2CKZ B;  4OIJ A;  2K7V A;  2NN6 I;  1SYC A;  5I2Y A;  3H0G B;  1LTL A;  1S40 A;  3J80 c;  1Z9F A;  1JWM D;  3FPP A;  5IE8 A;  1ENC A;  3I4M H;  4BWG B;  1PH6 A;  1X55 A;  2VB3 X;  1C8C A;  2QDB A;  4POG A;  3CC4 A;  2N3S A;  1V1P B;  3H3V H;  5I2X A;  2Y0S G;  4EQO A;  2EYO A;  4DV6 L;  5ELF A;  5M9O A;  2VW9 A;  1TII D;  1WI5 A;  1XNQ L;  2CH4 A;  3CKI B;  5GRO A;  5IYD G;  4HID A;  3HRZ C;  4K0K L;  1BCP C;  1QJO A;  4AQY L;  3E5S A;  5C6A A;  5C3X A;  3D6C A;  3C46 A;  3GTO H;  3ZJY C;  1E3P A;  3BVG A;  1JWS D;  4LFB L;  3OIQ A;  1XJV A;  4IQZ A;  2A1A A;  1J6Q A;  1DOM A;  3HKZ G;  2EY5 A;  2F03 A;  3HGB A;  1UWV A;  3J81 L;  3PMF A;  1SYG A;  2VUM B;  4QIW B;  1KAW A;  4BBS B;  1H95 A;  4AYB B;  3ULL A;  1UUP A;  2QCP X;  4S3S A;  2VL6 A;  1A3V A;  1JJC B;  1LTT D;  2K5H A;  2N55 A;  3GDE A;  4K5W A;  4ZKC B;  1GUW A;  3R93 A;  5IP9 G;  2R93 G;  1JQY D;  5IYD H;  2JA6 B;  2B8G A;  5JPM C;  2WFW A;  5IGC A;  4R4Q A;  1EIY B;  5ELB A;  3CAM A;  4P75 A;  2I0Q A;  4OO1 I;  1WTQ A;  3LWU A;  1ET6 A;  1BKB A;  5FLX E;  4A93 B;  4CJ2 C;  1HXY D;  4IUN A;  5C4J B;  1CHQ D;  3TP8 A;  3I90 A;  3FRP B;  4N9T A;  5EBD A;  1I5F A;  4RG1 A;  5ISR A;  1CA6 A;  4L8J A;  1BBU A;  4DR4 Q;  4QB4 A;  2K6A A;  4FNF A;  5CGK A;  2ASB A;  5IP9 H;  1QNU A;  2R93 H;  3PO3 B;  5C3E B;  3RLN A;  3L0O A;  1IXR A;  2IHF A;  4N9P A;  1BNZ A;  2XWB B;  4G7O C;  1PH2 A;  2PI2 E;  4ME3 A;  4JK1 C;  4LF9 Q;  2UXD Q;  3S2D B;  1VQL A;  1DM0 B;  1YIT A;  5FLX c;  4DV3 Q;  3S1Q H;  2F0I A;  2ZJR A;  2DNE A;  5LHY 1;  4P73 A;  1TWH B;  1CKM A;  1QG7 A;  1X3E A;  4DF7 A;  2B3G A;  5A2Q L;  3SE0 A;  1GXD C;  2CCZ A;  3I4O A;  3A5Z B;  1BCP B;  3GTQ B;  3OSO A;  2NTT A;  4YWK A;  2V1C C;  3BG3 A;  4UDU C;  2F3V A;  3ERO A;  2WAC A;  4A3K B;  3A54 A;  3I70 A;  5ELC A;  3T1H Q;  1W3S A;  2EYH A;  3GTP B;  1CKN A;  2JEA I;  2CH4 W;  2BDO A;  3EIV A;  4JW0 A;  3I73 A;  5M5Y H;  1PFM A;  2PQE A;  1EY8 A;  1K8M A;  2OF1 A;  1I50 B;  1AW7 A;  2YTX A;  2MHV A;  1I4G A;  2VS1 A;  3OMC A;  1K0R A;  1QZG A;  3KYH C;  2UUB Q;  2A19 A;  3G7L A;  5ELO A;  3U9O A;  3KOJ A;  2Q8I B;  3NEN A;  4C3H G;  3PIP A;  4TSS A;  2YV5 A;  2KOL A;  4XQJ A;  5KYI A;  1KTK A;  2Q2I A;  3N6R A;  1SBB B;  1FR3 A;  1WTX A;  3CMA A;  1W6K A;  1DGS A;  1EWH A;  1A62 A;  1NTG A;  3M4O H;  1X3P A;  3BS1 A;  2A68 D;  1FD7 D;  1PHJ A;  2B2T A;  2PMZ E;  4MN3 A;  4DR4 L;  2LY7 A;  3CXC A;  5M5W B;  3W5O A;  4A3D H;  1B4O A;  5I6W A;  3T13 A;  3C3L A;  4C1N I;  2IX3 A;  1Q46 A;  4F88 A;  4LF9 L;  5CV9 A;  4IJL A;  2UXD L;  5E1F A;  3N52 A;  5I4D A;  3U58 A;  1VMC A;  4A3L G;  3EFX D;  1LAC A;  1RIP A;  1NSN S;  4DV3 L;  4MZ9 A;  2AQ1 B;  1QUQ A;  2DNC A;  2EJG C;  4RMF A;  3W2D A;  4A3J G;  2A8V A;  3H3V C;  5D3I B;  4RKB A;  2J7Z A;  5D3D A;  5CBA E;  4K8I A;  4KJN A;  1SE3 A;  4Y7N H;  2ICI A;  5G3L D;  4ZKB B;  1VQG A;  1T5X D;  2Z4H A;  2PNH A;  1GHJ A;  3OW7 A;  3T1H L;  2R92 B;  4G57 A;  3KF6 B;  1Z6H A;  4NW2 A;  1NMF A; 
#chains in the Genus database with same CATH homology
 3DMU A;  2IPK D;  1LT4 D;  4G7H C;  1ROD A;  1EQT A;  2EYJ A;  3S9W A;  1DOL A;  1ICW A;  2Q8T A;  4R8N A;  1PFN A;  1ESR A;  2X6G A;  4A3E B;  1B9N A;  4FP5 D;  2IT1 A;  3VR2 A;  3GTM B;  4K5X A;  2E2J B;  1F2M A;  1DD2 A;  1G91 A;  5M5X B;  3RZO B;  2KED A;  2NYZ D;  2NTS A;  3GTK B;  2E75 C;  3MVV A;  1SJE D;  1KLG D;  3CQZ B;  2NVT B;  1IYV A;  1MI2 A;  1UNS A;  1EQV A;  1O7Z A;  3NSW A;  4MIU A;  3H91 A;  3ITP A;  2XRQ D;  1WTR A;  1D1K A;  5K36 G;  2BA1 A;  3RD4 A;  4GZY C;  1SNP A;  3K6O A;  1QIL A;  3NXW A;  4NKL A;  4XXE A;  2A6E D;  3RMH A;  5BN4 A;  3K5L A;  3GTO B;  2PZW A;  1D1I A;  4K6L A;  4DGZ A;  2WIN B;  3J7A F;  3E6Z X;  1LTG D;  2L1B A;  5FO8 B;  2RSO A;  2X6L A;  2WAQ B;  1STG A;  2JA5 B;  3FPU B;  5T1G A;  4TQU S;  1I6V C;  3UI2 A;  2F1M A;  2SDF A;  4FF4 A;  5EPJ A;  3LX0 A;  1FNU A;  2QF7 A;  3NTH A;  3WDN A;  3ZYY X;  4X3T A;  3PIP 3;  2RDF A;  2PCF B;  1UEA B;  3HP3 A;  3EJI A;  1CI3 M;  2ZXR A;  1PTO D;  3M7N A;  1PZJ D;  1LTI D;  3MHB A;  1HA5 A;  3VR5 A;  3BZD B;  3G6J B;  2D9U A;  2OEO A;  2K5Q A;  3EA6 A;  4R8I A;  3K59 A;  2EY6 A;  3OOC A;  1OXS C;  4LAA A;  1RKN A;  2K04 A;  3OHX C;  2B39 A;  3S1Q B;  2PZT A;  3TZU A;  3FMC A;  2KCN A;  5J1Z A;  4DK0 A;  1S5F D;  2HDM A;  2LMC B;  2JE6 I;  4CHT B;  4G4K A;  4H7B A;  1SYE A;  1EU4 A;  1D6E C;  1SDF A;  1V1P A;  5LL6 S;  1E2Z A;  2EZV A;  5FOB B;  1C4Q A;  2Z8L A;  5M5Y B;  1RD9 D;  3TN2 A;  5C3W A;  2WII B;  3URY A;  4OL7 A;  4KV6 A;  1ML0 D;  2H4O A;  1PYW D;  2ZXO A;  3NK9 A;  2CQA A;  4OGQ C;  2R6G A;  1D5M C;  3J81 E;  4KMU C;  1PMR A;  3TME A;  4IUU A;  2G9H D;  3M4O B;  5FO9 B;  4ODG A;  5IIF A;  3S1M B;  1Y8O B;  4F8M A;  1B44 D;  2K33 A;  1WVL A;  1KNA A;  4K8J A;  4A3D B;  3ND9 A;  3K0Y A;  4K5V A;  3P1H A;  4B9W A;  3M7G A;  4IUQ A;  1NAP A;  3NWS A;  5C4H A;  3K5O A;  4ILW A;  4IFD G;  1ILQ A;  3QJY A;  5CR3 A;  5FKA C;  3RZD B;  2F0T A;  1U4P A;  1TWC B;  3K5M A;  4UAI A;  2K5W A;  2EY2 A;  1TS2 A;  1WTO A;  1OO9 B;  3P75 A;  3EVQ A;  1SYD A;  4RFB A;  5A2Q E;  2PW5 A;  2KA7 A;  1WD1 A;  3KF8 A;  3MXP A;  2DY8 A;  1TVX A;  4L6T B;  1GUG A;  5AFW A;  2RSN A;  3HS0 C;  4OHJ A;  3T53 B;  1RF2 D;  2HQE A;  1HQR D;  4U68 A;  4FF3 A;  2BOS A;  4QMG A;  1BDO A;  2F0M A;  2E2D C;  1EY7 A;  5KYL A;  4DN4 M;  4XT1 B;  1A15 A;  4TKO B;  1HTP A;  5EPK A;  2ZXP A;  1H9S B;  1SYF A;  1TWA B;  5C0X J;  2LKV A;  2ICE C;  4EQP A;  1B2T A;  3NTK A;  3BVZ A;  3A56 A;  5EQ0 A;  3DHQ A;  2AQ2 B;  1YNJ D;  3PUV A;  3HOV B;  1Y1V B;  1JWU D;  1R4Q B;  3I4N B;  1PDQ A;  3SEB A;  1Y1W B;  5E4X A;  4X3S A;  2A73 B;  2K32 A;  2B2U A;  1MSH A;  1STA A;  3HOX B;  1EL0 A;  1Y69 U;  2EDG A;  3I8Z A;  5JJZ A;  1GJX A;  5M3F B;  4XYO A;  5CBE E;  2EY1 A;  2JSO A;  1HRJ A;  4BA1 I;  2JP1 A;  5EPL A;  2B2Y C;  3S15 B;  2ZT9 C;  1AZQ A;  3KBX A;  4KKS A;  3JAM L;  1STE A;  4RGN A;  1STH A;  2EYL A;  1LLR D;  5IT9 L;  3QOL A;  4HCE A;  2VNU D;  4KY5 A;  3D4R A;  3PIO 3;  3WOF A;  3R8B A;  2EE1 A;  1HQM C;  1AN8 A;  4PMB A;  4F87 A;  1Y8N B;  1NCV A;  2PPB C;  1KAA A;  5HUR A;  1KDB A;  5CV6 A;  1HA6 A;  3GV3 A;  3P20 A;  1HUN A;  3A7L A;  3BVM A;  5CV4 A;  1PXU A;  2WV6 D;  1CQV A;  2XSC A;  1K83 B;  1BCP D;  4CKE A;  3VA5 A;  3NPP A;  2O5I C;  3NE5 B;  1Q90 A;  2XN9 C;  2NB0 A;  2NVQ B;  1BBX C;  1IKL A;  2L11 A;  1JIC A;  2WP8 J;  5IGG A;  1SNO A;  5EBC A;  1EFI D;  1RTN A;  5KNC A;  2EJF C;  3F2U A;  3HOW B;  1Q3L A;  1A3U A;  2VXW A;  4KD4 A;  1B50 A;  5KEE A;  2MPM A;  1M8A A;  3D31 A;  5J39 A;  4DNT B;  2A69 D;  4HMJ A;  3KLS A;  2XRS D;  3L9A X;  4OIK A;  1LV9 A;  1SXT A;  3MC0 B;  2CW0 C;  3BDC A;  1WTV A;  1U4M A;  2PMZ B;  2VB2 X;  1JR0 D;  5IGB A;  3VR3 A;  4FO2 A;  4ZQ3 A;  4WRD A;  4C3J B;  2F0U A;  2M2L A;  3L7Z C;  5I9O A;  3DXJ C;  3HZX A;  4A3F B;  3Q23 A;  2K1B A;  2R7Z B;  1PTO H;  2IWH A;  1VMP A;  5F2D A;  5E3F A;  5IGF A;  3VYT A;  3MXG A;  4IN3 A;  1QOH A;  4HED A;  1OXT A;  1JOK A;  4ABN A;  4HR7 B;  2JA8 B;  3NUC A;  4FXG C;  2MUY A;  4RA8 A;  2PZU A;  3S14 B;  4IFD J;  1JB3 A;  1BOS A;  1GHK A;  3TP7 A;  3KLR A;  3A8K E;  2HUG A;  3AMU A;  4FYD A;  1STN A;  5CYU A;  1YNN C;  2EYF A;  4FXD A;  4H44 C;  3RLF A;  1Q12 A;  1GOZ A;  1A2T A;  1QNK A;  2NWG A;  5JPN C;  1SMY C;  1S5E D;  1Q8I A;  2B2V A;  3I91 A;  3ONA B;  3MA2 B;  1HTL D;  5FO7 B;  1LT5 D;  2RBM A;  3SVM A;  2MGS A;  2PW7 A;  2CHB D;  4XDX A;  5EKL A;  4HSP A;  1JCK B;  3T16 A;  1R9T B;  3R3O A;  1TT2 A;  3EQL C;  5C5L A;  3CRL C;  3DUZ A;  1G6Z A;  1EU3 A;  4KI0 A;  1CK1 A;  3U9S A;  2F0Q A;  3NBI A;  1S5D D;  5IOC A;  1EIG A;  1BR9 A;  3D4D A;  3GO5 A;  1Q1E A;  1SNQ A;  1I4P A;  4WOR A;  1RHP A;  4ID6 A;  4DK1 A;  1CZG A;  4LJZ C;  3V96 A;  4A3M B;  2KCC A;  4PMC A;  2DN8 A;  3PUZ A;  3NHH A;  4RHS A;  3IL8 A;  5C0X G;  3T56 B;  1F2L A;  1H9R A;  2B2T C;  3SK5 A;  4Q5V A;  3I4M B;  3GQB A;  4K2L A;  3A7A B;  3QB3 A;  1CZW A;  1LT3 D;  1B1Z A;  5J22 A;  1AFP A;  3QIA A;  4YIJ A;  3C1F A;  3LWE A;  3R2T A;  2RDG A;  2IX1 A;  3DEO A;  1IW7 C;  3GTL B;  1DOK A;  3Q22 A;  2E2I B;  4BA2 I;  2F0P A;  5TSS A;  4IUR A;  2QEJ C;  4M1U B;  4B08 A;  1LTR D;  3AU7 A;  5C0X H;  1KNE A;  5ELD A;  1ET9 A;  1K8O A;  2B2W A;  4EQN A;  4JBW A;  3GV6 A;  1V1O A;  2GA4 B;  3I4L A;  4CKB A;  5K36 H;  4DXF A;  2Y0S B;  1SAP A;  1KDC A;  4DAY A;  2F0O A;  1OXX K;  3J7A V;  4MHE A;  1CHP D;  1AP0 A;  1PRT C;  3BYY B;  2K28 A;  3HKZ B;  2C9O A;  4PV1 C;  2FJ2 A;  1EYC A;  1SNM A;  4CJ0 B;  4ME5 A;  3SK8 A;  2D62 A;  2FFK B;  5CMD A;  4O1N A;  3MWY W;  1MD2 D;  1GUT A;  1CA5 A;  1ZYR C;  2R93 B;  5JVH 3;  2K01 A;  3NTI A;  2BDN A;  2EOT A;  1JOO A;  4J6H A;  2XIW A;  3V2T A;  2L12 A;  4CBV A;  1IL8 A;  3VYR A;  2O5J C;  5JEA J;  1B9M A;  1HUM A;  4PMW A;  3IFT A;  1SE2 A;  2EPB A;  5CV7 A;  5DAU A;  1CFM A;  2EYM A;  2KUM A;  1VF5 C;  4HCS A;  4QUC A;  2J0T D;  3VYS A;  1BQQ T;  2HCI A;  2JYO A;  1TQO A;  1KDA A;  1LTB D;  2NN6 G;  1FGB D;  4I65 A;  1TU2 B;  4ZRZ A;  1ENF A;  2L4N A;  3JAM E;  2K05 A;  2O4X A;  1H9J A;  1RCV D;  3K7A B;  1BXT A;  5IT9 E;  3TP5 A;  3VYU A;  1DXM A;  1U9R A;  4KHZ A;  2QIL A;  2F0J A;  1Y8P B;  1O78 A;  2NN6 H;  4H0L C;  4Q0F A;  4J1M A;  2KEE A;  2BE5 C;  1VF7 A;  4C3H B;  5ELE A;  1SNC A;  3TP6 A;  1F2Z A;  2D5D A;  1GUN A;  4HTH A;  1EY9 A;  4Y7N B;  4RH6 A;  1NR4 A;  2IL8 A;  2L5T A;  2F0N A;  4TRD A;  4ZUJ A;  4DAV A;  2XWJ B;  1EY4 A;  1EY0 A;  2CVR A;  1J9O A;  4C56 C;  3D6W A;  3D8G A;  1SSO A;  4RCN A;  2A6H C;  2L0C A;  2RQX A;  3Q0A A;  3PUW A;  3MTS A;  1M4V A;  1KAB A;  4A3J B;  4IFD H;  2MP1 A;  3E0J A;  5JAV A;  1EOT A;  2K03 A;  4WFN 3;  1LT6 D;  3PUY A;  2B2Y A;  4PNY A;  3H6M A;  4C3I G;  5I6Y A;  2SNM A;  2F0L A;  3K57 A;  2G9D A;  1TKW B;  1D2B A;  2L55 A;  3WOE A;  1MBY A;  3S16 B;  3MZ5 A;  4A3G B;  1ESF A;  3TBI B;  4CGY B;  3KLS X;  2AUK A;  3FKI B;  1QE6 A;  2HCC A;  1X3Q A;  2RDH A;  2AQ3 B;  4QUF A;  3OWE B;  4ZYS A;  4U67 3;  1G2S A;  3S1R B;  2AWN A;  1HFN A;  3QG1 A;  2KVM A;  4V19 0;  2F0F A;  3CHB D;  1DJR D;  1RTO A;  2BCO A;  5IGE A;  2KHS A;  5COY A;  3T51 B;  3S2H B;  5C5M A;  1SND A;  1ZXT A;  3A8I E;  3DWP A;  4EVO A;  3J7Y W;  4ZK9 B;  4XT3 B;  1G2T A;  3SK4 A;  3K58 A;  3PO2 B;  4M8A A;  1F9P A;  4KJO A;  1O7L A;  1EY6 A;  3D3R A;  3A55 A;  4P2C B;  3M3Y B;  2ENB A;  4BY7 B;  1XX8 A;  1G29 1;  4V0B A;  1E0B A;  4RGO S;  5EGT A;  1E2W A;  1W6J A;  1H9M A;  1F2Y A;  3TSS A;  2O2L D;  5DNF A;  5EKK A;  1PZK D;  4DAP A;  3I72 A;  3S17 B;  2ID0 A;  2R61 A;  3QOJ A;  4DXG A;  4DA2 A;  1NUC A;  4E6I A;  4XYQ A;  1IYU A;  1LO5 D;  5CV8 A;  3VR4 A;  3FEW X;  1UAP A;  4IFD I;  2KJX A;  2M9V A;  1A3T A;  5IGD A;  3MFG A;  2LFN A;  3DEP A;  3HOY B;  4XQN A;  2A69 C;  1CTM A;  4ZUI A;  1STY A;  4CKC A;  4K6D A;  1R4P B;  4FVM A;  3DWQ A;  2YYZ A;  2TMP A;  4L63 B;  1LTS D;  1JOQ A;  1F9R A;  1TWF B;  1SFO B;  1F9Q A;  2PO4 A;  1TS4 A;  4G7Z C;  4BBR B;  3D4W A;  1XXG A;  1FNV A;  1I4X A;  4IUV A;  3CU7 A;  2SEB D;  3W3A A;  2B2U C;  1BF4 A;  4I7Z C;  5JEA G;  3SR1 A;  1I6H B;  4J8Q A;  2NVX B;  4IZ8 A;  2WKD A;  1ZKO A;  3A8J E;  4HSV A;  1WD0 A;  5COR A;  1TY2 A;  3QO2 A;  4XIG S;  1PTO F;  2K5D A;  1FYC A;  4BY1 B;  1PZI D;  2Z4I A;  2A5H A;  1SEB D;  4LMQ D;  3OMG A;  4BS9 A;  2E2H B;  2A68 C;  5CC4 A;  3NQT A;  2E76 C;  5JEA H;  1X32 A;  4HMI A;  4IAL A;  1PRT F;  4QF4 A;  2I07 B;  2R3Z A;  1OXV A;  3MXU A;  3VA7 A;  5DEH A;  1QCB D;  2FIN B;  5KIX A;  2IJ0 A;  3J80 L;  2B63 B;  2CW0 D;  1J8I A;  1AEX A;  1CM9 A;  1XTC D;  2E74 C;  3GTJ B;  3Q6S A;  2M00 A;  3SHL A;  2EYP A;  3KK7 A;  4NP5 A;  1VCI A;  1SE4 A;  4XQQ A;  1A2U A;  1F9S A;  4XTC S;  1JC7 A;  1Z47 A;  2D2C C;  4R9W A;  1G8Z D;  1STB A;  4F7X A;  3O13 A;  4DU9 A;  5E4W C;  2TSS A;  3BDL A;  4DFA A;  1LTA D;  3BDO A;  1I4R A;  4KTA A;  5FK9 C;  1TR5 A;  1XYI A;  4KN4 C;  3IAY A;  3GTG B;  1SJH D;  5KND A;  2F0V A;  1I4H A;  4B9X A;  1YNN D;  3TZD A;  5KRU A;  3CRK C;  2F0E A;  3HOU B;  1ILP A;  1IHZ A;  5KGU A;  1WCM B;  2QKI C;  2IX0 A;  2F0G A;  1EEI D;  1SMY D;  3MFY A;  3M85 A;  1TS5 A;  2SNS A;  3S1N B;  4C3I B;  5T1I A;  5IOD A;  1A6X A;  3NBH A;  5FLX L;  2F0D A;  3FVQ A;  2A6E C;  4KY7 A;  1GUO A;  4RGT A;  2XVS A;  1S5B D;  1WTW A;  1JE4 A;  1JOR A;  3DWA A;  1ZEQ X;  5C44 B;  5LL6 X;  1XWE A;  2WKC A;  3DM1 A;  1U4R A;  2MJ8 A;  2RVL A;  3RUZ A;  1O7Y A;  2YU9 B;  3I3C A;  2Z1C A;  4KKT A;  2A74 C;  1I3Q B;  1F77 A;  1TS3 A;  1D5Z C;  2KQ3 A;  5CV5 A;  2NZ1 D;  1BUV T;  2FMM A;  2B2V C;  1V8Q A;  1DZ1 A;  4PQX A;  1PTO C;  1V43 A;  2SOB A;  4C1N K;  1B3A A;  4KKU A;  1EY5 A;  4ULL A;  4EGV A;  4RKL A;  3V05 A;  5JVG 3;  3KUP A;  3C2P A;  2XNA C;  1IW7 D;  4KY6 A;  2PNR C;  2FMC A;  4FF1 A;  2EXZ A;  4ZAI A;  2IW3 A;  3C1E A;  4KK7 A;  3LNN A;  3HEJ A;  4RCO A;  4HN7 A;  4KHV A;  2HDL A;  1OXU A;  1LAB A;  3X3M A;  3VR6 A;  1H9S A;  2OXP A;  2F4I A;  1DYQ A;  4CJ1 B;  3PV0 A;  3SXH A;  1PFB A;  1E2V A;  3GD7 A;  3H94 A;  1ENA A;  2I46 A;  3KBG A;  4FF2 A;  5K5P A;  3X3N A;  1EEF D;  3SDZ A;  3MAQ A;  1ONL A;  1D5X C;  2EJM A;  2B8F A;  3BYT B;  1DON A;  3ERQ A;  1PRT D;  3OPO A;  2L9H A;  2RKS A;  1S4Z A;  3GP7 A;  1L0Y B;  3NQI A;  1EIH A;  3L3O C;  4RWS C;  3Q24 A;  3HOZ B;  2JEB I;  2NBF A;  2NVY B;  5I9P A;  4C3J G;  1WTP A;  1S5C D;  4RHR A;  2B2W C;  1GUS A;  1ZYR D;  1BCP F;  4LK1 C;  3P7J A;  1Q1B A;  1PTO B;  1IKM A;  2X69 A;  4KD3 A;  5EJW A;  5EKI A;  2C5C A;  1CT1 D;  4IUP A;  1RJT A;  5C4Z A;  4K14 A;  2NUC A;  5C0X I;  4H13 C;  1HHV A;  2F0W A;  1PRT B;  2EVB A;  3NP8 A;  4HAE A;  3FDT A;  1VDZ A;  2V4D A;  1I4Q A;  3AB9 A;  4NMZ A;  3M4Y A;  3HG9 A;  2OT2 A;  5A35 A;  4K2K A;  1BO0 A;  1EZ8 A;  1FNW A;  3SK6 A;  3PUX A;  1H9K A;  1RDP D;  4KN7 C;  2RA4 A;  1CQF A;  2AWO A;  5M3M B;  1U4L A;  5D65 A;  3OWF A;  4ZLT F;  3NWT A;  2DY7 A;  2J4X A;  3IKJ A;  1TWG B;  1TY0 A;  1PLF A;  1EWC A;  1AZP A;  2BA0 A;  1EZ6 A;  2JXM B;  1II3 A;  4Z9C B;  2JA7 B;  3TDQ A;  4OO1 G;  2F3W A;  1B53 A;  1NR2 A;  4FXK C;  1QWY A;  4RGM A;  2F0H A;  3ND8 A;  1HPC A;  5BN5 A;  5DM7 3;  1KLU D;  2BE5 D;  4WJW A;  1MSG A;  5BN3 A;  1L0X B;  4O42 A;  1O80 A;  2Q8R E;  1QB5 D;  1MGS A;  1HCZ A;  4X3K A;  2F0S A;  5HGT A;  4C2M B;  4DNR B;  1Z7T A;  1YNJ C;  4OO1 H;  2H1E A;  4NDX A;  1EYD A;  3T4A C;  2LS0 1;  1SYB A;  2N88 A;  3K5N A;  3OIP A;  2PYK A;  4QCL A;  5D14 A;  1T5E A;  4IUT A;  4X3U A;  5NUC A;  2A6H D;  1HFG A;  5G3L F;  3R2I A;  4RAU C;  1C48 A;  5JOB A;  2FHT A;  3H09 A;  2AUJ D;  4A3B B;  3J80 E;  5DM6 3;  2KEC A;  2F0K A;  2WB1 B;  3MEH A;  1DCZ A;  1EYA A;  3QWN A;  5C4X B;  3MXN A;  3IFD A;  4A3I B;  5KNB A;  4OIJ A;  2K7V A;  2NN6 I;  1SYC A;  5I2Y A;  3H0G B;  1JWM D;  3FPP A;  1ENC A;  4BWG B;  2VB3 X;  1C8C A;  2QDB A;  1V1P B;  5I2X A;  4EQO A;  2EYO A;  5ELF A;  5M9O A;  1TII D;  3CKI B;  3HRZ C;  1BCP C;  1QJO A;  3E5S A;  5C6A A;  5C3X A;  3D6C A;  3C46 A;  3BVG A;  1JWS D;  3OIQ A;  4IQZ A;  1DOM A;  2EY5 A;  2F03 A;  3HGB A;  3J81 L;  3PMF A;  1SYG A;  2VUM B;  4QIW B;  4BBS B;  4AYB B;  1UUP A;  2QCP X;  4S3S A;  4K5W A;  1A3V A;  1LTT D;  2N55 A;  1GUW A;  4ZKC B;  3R93 A;  1JQY D;  2JA6 B;  2B8G A;  5JPM C;  5IGC A;  5ELB A;  4OO1 I;  1WTQ A;  3LWU A;  1ET6 A;  5FLX E;  4A93 B;  4CJ2 C;  1HXY D;  4IUN A;  5C4J B;  1CHQ D;  3TP8 A;  3I90 A;  3FRP B;  4N9T A;  5EBD A;  5ISR A;  1CA6 A;  4L8J A;  4QB4 A;  2K6A A;  4FNF A;  5CGK A;  1QNU A;  3PO3 B;  5C3E B;  4N9P A;  1BNZ A;  2XWB B;  4G7O C;  4JK1 C;  3S2D B;  1DM0 B;  2F0I A;  2DNE A;  5LHY 1;  1TWH B;  1QG7 A;  4DF7 A;  5A2Q L;  3SE0 A;  1GXD C;  1BCP B;  3GTQ B;  3OSO A;  2NTT A;  3BG3 A;  4UDU C;  2F3V A;  3ERO A;  2WAC A;  4A3K B;  3A54 A;  3I70 A;  5ELC A;  2EYH A;  3GTP B;  2JEA I;  2BDO A;  3I73 A;  1PFM A;  2PQE A;  1EY8 A;  1K8M A;  2OF1 A;  1I50 B;  1AW7 A;  2MHV A;  1I4G A;  3OMC A;  3G7L A;  3U9O A;  2Q8I B;  4C3H G;  4TSS A;  2KOL A;  4XQJ A;  5KYI A;  1KTK A;  3N6R A;  1SBB B;  1FR3 A;  1WTX A;  1W6K A;  1EWH A;  1X3P A;  3BS1 A;  2A68 D;  1FD7 D;  2B2T A;  4MN3 A;  2LY7 A;  5M5W B;  1B4O A;  5I6W A;  3T13 A;  3C3L A;  4C1N I;  2IX3 A;  4F88 A;  5CV9 A;  5E1F A;  3N52 A;  5I4D A;  1VMC A;  3EFX D;  1LAC A;  1NSN S;  2AQ1 B;  2DNC A;  2EJG C;  3W2D A;  3H3V C;  5D3I B;  4RKB A;  2J7Z A;  5D3D A;  5CBA E;  4K8I A;  4KJN A;  1SE3 A;  2ICI A;  5G3L D;  4ZKB B;  1T5X D;  2Z4H A;  1GHJ A;  3OW7 A;  2R92 B;  4G57 A;  1Z6H A;  4NW2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...