5JOBA

Crystal structure of staphylococcal nuclease variant delta+phs l25k/i92a at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKKMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYAYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L25K/I92A at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5jobA00
4PMBA 3MVVA 5IGCA 1A2TA 4HMJA 2OEOA 1SYBA 3MHBA 4KV6A 1NUCA 1EY9A 4K5WA 4EQOA 2F0TA 2EYJA 3HZXA 4K5VA 1JORA 2F3WA 2F0UA 2KQ3A 4DU9A 4RKLA 1STGA 3EVQA 5JAVA 1JOKA 5C5LA 5IGBA 1A3VA 2PZTA 1EZ8A 3NP8A 2O4XA 1KAAA 4NMZA 2EY2A 5KRUA 4YIJA 5C3XA 2F0GA 1SNQA 1KDAA 2EYFA 3C1EA 3HEJA 3P1HA 4HMIA 3SK5A 1STHA 2NUCA 4KJOA 3QOJA 3SK8A 3S9WA 1EYDA 5E3FA 4QF4A 4HTHA 2QDBA 4KD4A 4ODGA 5IIFA 4QB4A 5CGKA 3SK6A 1KDBA 1SNOA 4ZQ3A 4NDXA 3BDCA 4B9WA 3D4WA 5M9OA 3NK9A 3DHQA 1KABA 2LKVA 2EY5A 2EYLA 4IZ8A 5CV7A 4EQNA 1A3UA 3SHLA 4G57A 2PZWA 1II3A 3MEHA 3RUZA 1TR5A 1U9RA 3D4DA 4H7BA 2F0EA 1NSNS 3NHHA 3OMGA 1EYAA 5E1FA 3MZ5A 3T13A 5KYLA 1EY0A 4J1MA 5C3WA 5C5MA 2EYHA 1AEXA 2F0JA 4S3SA 3PMFA 4K8JA 4WORA 5CV6A 1F2YA 1SNDA 2EYPA 2RKSA 5KIXA 1EY8A 2F0PA 4ZUIA 1ENCA 5DEHA 5EKLA 1IHZA 4KTAA 3EROA 1JOOA 2F3VA 2OXPA 4I65A 4DGZA 5I9OA 4B9XA 5CV5A 3D8GA 4IUNA 2OF1A 4RKBA 5IGFA 3E5SA 5KYIA 3OMCA 4DF7A 3QB3A 4MIUA 2EXZA 2F0OA 2KHSA 4LAAA 1STBA 1STNA 2F0FA 1STYA 3OSOA 4N9TA 2EY1A 5DAUA 4F8MA 5J39A 2F0DA 1STAA 4PNYA 1EY5A 1EY6A 2M00A 2EYMA 4ID6A 2F0SA 1TT2A 2PW7A 1RKNA 3LX0A 4KD3A 5EKKA 4EVOA 4KHVA 4TRDA 1TQOA 4ZUJA 2F0MA 4K6DA 1EZ6A 4K5XA 1A3TA 3DMUA 4ME5A 2F0LA 1SNPA 2WACA 3ITPA 2PQEA 2PW5A 1SYFA 1SYCA 1SYDA 1EY7A 3NQTA 3NXWA 4N9PA 5CR3A 4NP5A 5C4ZA 5C6AA 5I9PA 2EYOA 3EJIA 2RDFA 5J22A 4WRDA 1F2MA 5EGTA 3VA5A 2SNSA 5C4HA 5NUCA 3QOLA 3TP7A 1ENAA 2HQEA 4KY7A 4PMCA 2F0KA 5IGGA 2ENBA 3TP5A 1EQVA 4J6HA 3SXHA 4K14A 1SYGA 1SNMA 4R8NA 5IODA 5HGTA 4K2KA 4KY5A 1KDCA 3U9OA 5ISRA 2F0WA 3TP6A 3SR1A 5IOCA 2PZUA 1F2ZA 2PYKA 4OL7A 5CV4A 2EY6A 3ERQA 4DFAA 5KGUA 4EQPA 3R3OA 5CV8A 5I6YA 1EY4A 5IGEA 1JOQA 2RBMA 5CV9A 4F7XA 3SK4A 3V2TA 2F0IA 2SOBA 5HURA 3OWFA 4E6IA 5J1ZA 1EYCA 3C1FA 5CC4A 5F2DA 3T16A 1SYEA 5K5PA 3H6MA 3TMEA 1A2UA 4IALA 5I6WA 3P75A 2F0QA 3MXPA 5KEEA 5JOBA 5IGDA 4KJNA 4NKLA 4QMGA 3NUCA 2SNMA 2F0NA 3D6CA 4K2LA 1SNCA 4KY6A 2F0HA 4K8IA 3BDLA 3TP8A 2F0VA
chains in the Genus database with same CATH superfamily
5IYDG 1Y14B 1HNZL 1P8LA 2F0TA 3S1MH 1U4MA 3M85A 5C4JB 1FL0A 2QW7A 5JVH3 4BS9A 3SK8A 3S15H 3PO3B 4A3BG 3GO5A 3JAMi 1PTOB 3HKZB 1Q1BA 2QDBA 2KOLA 1C48A 2WB1G 3GP7A 3VYTA 1TWFH 4DR1L 1HR0Q 1BOSA 2DJGC 4IZ8A 3HOXB 3T53B 1TWCB 3QO2A 1WTXA 4R4IA 5BN3A 2PMZE 1HUMA 4LUOA 3L7ZC 2CW0D 1E1OA 2MO1A 4HJ7A 5IP9H 4GLXA 1GUTA 5EPKA 4FF2A 4QQBX 4A3IH 4XQQA 3LWEA 4IUNA 3Q8DA 1LV9A 2QKIC 2JSOA 1RTNA 1STBA 1G6PA 1I3QH 1QNKA 3OSOA 5DAUA 3FDTA 2JA5H 1QVCA 3I4LA 2ZM6Q 1BUVT 4X3TA 4KN7C 2NB0A 1JC7A 4A93B 2F4VL 1AE2A 4QIWB 4DR2Q 5C6AA 3OW2A 1VQIA 1R4QB 2Z6BA 5J22A 4HCSA 2Y0SG 1IL8A 4QUFA 1E7ZA 1V1PB 3MFYA 3PV0A 1ZYRD 1JB3A 1EQRA 4GZYC 2OTJA 3G4SA 2KJXA 3UDGA 1CFMA 1NR2A 4HSPA 2D9UA 2QGQA 4JI7Q 1E3PA 2ZJRA 2B2UC 5M5XB 4F7XA 4ZLTF 2AQ1B 3E9IA 3UE1A 5JEAJ 4GNXB 5ELBA 1BBXC 1HQMC 2TSSA 3J81c 1VQ5A 2ZJQA 1J6QA 4LK1C 3MXPA 3KOJA 1LTGD 2SEBD 3A8IE 3KLSA 4B3SL 2BA0A 4C2MB 1HH2P 2HQLA 4BY1H 1GM5A 3W2DA 5EBCA 4DU9A 1BDOA 4LFBL 3NP8A 1VMCA 2CH4A 3F1ZA 4YIJA 3T56B 3RN5A 5CGKA 4A3EG 4NXNQ 2M2LA 2RHQB 4IUQA 1V1QA 4KHZA 1PH7A 2QDLA 4OXPA 1S3OA 4DK6C 5LL6S 4B9WA 4JV5Q 2E2JB 1B2TA 4B3TL 3BJUA 4BY7H 1VQNA 1EQTA 2ALYB 1VQGA 2IY5B 1D1KA 5JJKA 1E2VA 4JOIA 4GNXA 1HNWL 2Y0SE 1RCVD 2A6HC 4X64L 3L3OC 1X3EA 3MZ5A 4DA2A 4IURA 1IBMQ 1EOVA 2Z9HA 5EQ0A 3K59A 1XMOQ 2CWPA 3I70A 2NTTA 3LNNA 4JI8L 4DAPA 1XPUA 2MGSA 2R7ZG 1HTLD 2R3ZA 4LF5L 4A3FB 4FF1A 3I4NH 5TSSA 1KD1C 5M5WB 3OTOQ 4PZ8A 1XMQL 2VQEQ 1FNVA 4LF4Q 1I4QA 3FVQA 3ITPA 4HJ5A 1PRTB 1PFNA 5I9PA 1J8IA 1JICA 3EJIA 4RMFA 3VA7A 3RZDB 1Y8NB 2NWGA 1CKOA 2ATWA 2PNRC 5IYCG 2GN5A 4RCNA 3C46A 3HKSA 3WOFA 2PI2A 3H0GH 5IODA 2AQ2B 4O42A 2WB1B 4DNIA 2EVBA 2C35B 3KF6B 3Q0AA 3B6YA 4JI3L 4ULLA 5GADC 1YEZA 1LABA 2JQOA 1CI3M 5JOBA 2H4OA 1IBKQ 2CCZA 1K8OA 1BBUA 5KNCA 3J80c 4FF4A 3GTGB 4JW0A 2OCEA 1KIXA 1PRTD 2DJFC 2F3WA 1NR4A 1SE2A 2K50A 4X62Q 3PIOA 4O0AA 4H13C 5KRUA 1E24A 2J4XA 5ELDA 3H3VH 3UDIA 4G7HC 4B3ML 1CA5A 1SNQA 1E0BA 3S1NB 2NUCA 1PFSA 4V0BA 1Y1WG 4HTHA 4A76A 3VR5A 3BDCA 2CWAA 3D4WA 3D6WA 3GV3A 3ONAB 1SN8A 1CZGA 1PTOF 2EYLA 3BDOA 3CU7A 5M3MG 5AJ3L 2UUBL 1XPRA 2PPBC 2B2VC 4XIGS 3L0OA 4YY3L 5IYBH 4LF7Q 3N6RA 4PMWA 4J1MA 2J0TD 1Y1VG 1S72A 1HZCA 1RODA 1UAPA 1T9HA 1WTPA 2RKSA 1WTWA 1S5DD 3OIQA 2DNEA 1JCKB 4L5SA 2DUDA 5LL6X 2E74C 3K5LA 3F2DA 2JK8A 4A3LG 3BZKA 4KI0A 4UP8A 2CW0C 1CZWA 1D1IA 5IP7G 1LTRD 4X3UA 3OPOA 2EYMA 1TT2A 1RKNA 2R93G 5EKKA 4TKOB 4YWMA 3GTMH 2R92H 3GTJH 2FMMA 2EQSA 2H5XA 3NXWA 2N49A 5K36G 2O5IC 3T1HL 4RH6A 5IT9L 2DN8A 2KEEA 1BF4A 1X3PA 3DEPA 1MKHA 3KJPA 3CD6A 2B2WC 3TS2A 1DYQA 4GKKL 4DV0Q 1TWAH 2B29A 3TP5A 1WYDA 4A3EB 3J81E 2G9DA 2IT1A 3QG1A 2F0WA 2YYZA 2PYKA 4UDUC 3ERQA 1CKNB 1EWIA 3Q23A 1WD1A 2NVXB 2K28A 4LFCQ 3I90A 2RBMA 1OO9B 3VR6A 1EEID 1K8MA 2I46A 4HIKA 3T16A 1ZYRC 3L9AX 3NWTA 4Y7NB 5KEEA 4K2LA 4MIUA 4LF9Q 4DUZQ 2JA6H 1Q46A 3NE5B 1S40A 2AHOB 1S5FD 3BG3A 1YITA 3CCEA 4DR5L 1U5KA 1J5EL 1VQBA 5D14A 4B08A 4YHHQ 5CBAE 1KAAA 4L5TA 2R7ZB 3PSIA 2CHBD 4L63B 2K5NA 3MAQA 2NBFA 4UP7A 2UUCQ 3GTQB 3E9HA 2VUMG 3M3YB 1X54A 3KLRA 4DR7L 5CV7A 5I2YA 3HOZH 1BCPD 4KN4C 1A3UA 1CKNA 3CQZB 1TR5A 5ELCA 2MHVA 3Q6SA 2EYHA 2GVBA 1AEXA 1XXGA 3HFZB 3D3RA 1B44D 2JEAI 1EY8A 3HG9A 1ESFA 1LTAD 3VYUA 1KHIA 1LO5D 4JPBW 3T1YQ 4IO9A 4DGZA 4I65A 4M8AA 1UE6A 3S16B 4IN3A 4A3GH 4DV6L 2L15A 1A6XA 3AYHB 4K0KQ 1L1OB 4ZKBB 2HHHL 1NMGA 2ZXRA 1RDPD 2L1BA 3IFTA 4X3SA 1KTKA 4ID6A 4CJ2C 4KD3A 2PW7A 3LX0A 4KHVA 2FJ2A 5AFWA 4MTNA 2RDGA 4A3KH 4QY7A 3KBXA 4MN3A 2NN6H 4NP5A 3IKJA 4KMUC 3K7UC 3HOWG 3A5UA 4A3DH 3HOYH 2UXCQ 4BBSH 1GD7A 1PRTF 4JI5Q 4R4QA 2JA8G 4JI0Q 4IOAA 1SYGA 3A54A 3MA2B 3S2DH 1Y1WB 3PIO3 1XNQL 1B50A 4HIDA 4U673 2YU9H 3AB9A 4LMQD 1G91A 5C44G 1OXTA 2O5JC 1DD2A 3J80E 1FR3A 4LWCA 2AWNA 1FNWA 5IWAQ 3J7ZC 3OWEB 5J39A 2A6EC 3OOCA 4RGTA 5M3MB 4YCVA 1LTTD 4IALA 1PV4A 3S2HB 1X32A 1L1OA 3KJOA 3I3CA 1XJVA 2B2UA 5LHY1 4GOPC 5COYA 3DWQA 2EXDA 1B70B 1Z9FA 5IGCA 1QILA 3OW7A 2ID0A 3ICEA 1GHKA 3CC4A 4IPHA 1H9JA 1JWSD 1CT1D 4KHPL 4JI1L 5BR8L 1JJ2A 4IQZA 1PH1A 1C7YA 5C5LA 4L5RC 2LSSA 3M4OB 4JI4Q 4A3CG 5DLQE 3L2PA 1DGSA 4XQNA 1V8QA 4ALPA 5HY6A 4OX9Q 1S4ZA 5GAGC 2R93B 2CH4W 2A74C 3MEHA 1RJTA 1NJIC 1L0YB 2F0EA 5IP9G 4DV4L 3BVZA 3STBD 2Z8LA 4DR6Q 2VNUD 3GTPH 1QB5D 2HIXA 4DR4Q 1SNDA 3CRLC 1M1KC 4A3IG 1E1TA 4LF6Q 2K14A 1T5EA 3K5OA 3F2CA 4NW2A 2Z0SA 1KNAA 1SAPA 3RLNA 2JA5G 5FLXE 2VXWA 3SEBA 1RF2D 1XTCD 3CCVA 5IOCA 3EBEA 2CKZB 3VYSA 2K04A 3J7A5 4JG2A 3F2BA 2AMCB 4P74A 2KBNA 4RCOA 4ZUJA 1WTRA 3JC66 4K6DA 5FO7B 1D6EC 4DR3Q 3M4QA 1Z7TA 1H9RA 4QJFA 4YCUA 1YHQA 4IFDH 3DLLA 2YTYA 1XWEA 4AYBE 4UPAA 4OGQC 4A3JH 1HR0W 4WRDA 4XDXA 1PYSB 4XYQA 1CHPD 2A8VA 1MI2A 1WI5A 2SNSA 3S14H 4IUTA 1XNRQ 4GLAC 3V96A 1K0SA 2FMCA 4EX5A 2L0CA 1H9KA 1K83H 2IPKD 1DOMA 1O78A 3DUZA 4K2KA 3U9OA 3I4OA 3J81i 4ZRZA 4R4CA 2VUMB 5FLXL 2E2HB 2RCNA 5CC4A 4WJ4A 1G51A 2NVTB 2XWBB 1VMPA 3W1GA 1AFPA 2GA4B 4DV7Q 1SBBB 4L5QA 4DNRB 1VQDA 4BY1G 4PV1C 3BDLA 3TP8A 3H3VC 4HMJA 1R4PB 1HNZQ 3AFQA 3D4RA 4BXXH 3DWAA 1JORA 1UNSA 2KQ3A 4C56C 4A4IA 5CORA 1OXVA 1VQ4A 4X6AH 5EAYA 3EIVA 4ODGA 3I73A 1U0LA 4BY7G 4DR1Q 3K0YA 4ABNA 3NK9A 5C4JH 2D2CC 3PF5A 5C0XH 1I6HH 5T1IA 1WTHA 1CQVA 2NVYB 3AFPA 1K8AC 1HTPA 5EBDA 4CJ1B 2Q8TA 3LGJA 1RTOA 5KYLA 3HOWB 5C3WA 4S3SA 1MSHA 2PCFB 5FJ8H 2B2VA 1LT6D 4ZUIA 3HOXH 2JA8B 1TWCH 1Q1EA 1BCPC 1ILQA 1MHWC 5C3EH 5I9OA 4C1NK 5C44B 4HAEA 3E5SA 4Z9CB 1JT8A 1AN8A 3KFUA 1STNA 1EIFA 5LMNL 1L0XB 4C3HH 2N88A 3S1MB 1KRTA 2F4VQ 3H09A 2HDLA 2Z6KC 2KA7A 2MO0A 2NZHA 1SYFA 4OO1I 1NAPA 5EJWA 3S15B 3K5MA 2ICEC 1TXYA 4DUYL 1F2LA 5NUCA 1HZ9A 1PXUA 2K05A 1SMYD 1LT3D 3MXNB 3IFDA 5I4DA 1TWFB 2YTVA 4RA8A 1WOCA 5KNDA 3QWNA 4ZKCB 4OL7A 4LUZA 2EY6A 4HJ9A 1WJJA 1F9PA 1OXUA 1F77A 1ET9A 2F0IA 2K52A 3J80i 3C1FA 3U58A 5IT9c 4P72A 1A2UA 3PCOB 3D31A 1HR0L 4LW1A 1SDFA 5D3DA 3ND9A 3RR5A 4B3SQ 4IJLA 2QA4A 5BN5A 4A3IB 2NTSA 4LFBQ 2MQHA 3S1QB 5JAVA 1K3BC 1N36L 2ZTDA 2JA5B 4HCEA 4P73A 1YBYA 5E3FA 3H91A 3I56A 3MXNA 5M9OA 2MUYA 4ZAIA 5IYBG 3C3LA 4B3TQ 1BNZA 4N8X1 4A75A 2H1EA 3PF4A 1SEBD 5E4XA 3Q24A 2KCMA 1LACA 2ES2A 4DN4M 4H7BA 4HR7B 1PH9A 1QVFA 1HNWQ 4X64Q 1S5CD 1EWHA 2M9VA 3CP0A 4EQ5A 1D5ZC 2IJ0A 1TWGB 3GTLB 1V1PA 4JI8Q 3KF8B 2Q2HA 3HOUG 1F9QA 1JOOA 1CSQA 4ZCKA 3PUWA 4C3IH 2R7DA 3T4AC 1PHJA 4B9XA 1AH9A 1NTGA 3STBC 4IUUA 2V4DA 2IX3A 1IBLL 2O2LD 3I4MH 5M3FG 2KCCA 5CBEE 2L55A 1ML0D 2RVLA 3BYYB 1XMQQ 4PNYA 5JVG3 2B8FA 1Y69U 2PMZB 3R2IA 1TQOA 1KL9A 4WFN3 4K5XA 1CK1A 3F2UA 4BY1B 3CCUA 5E4WC 1Q3LA 5IGFA 1SYCA 1SYDA 2BOSA 1YIJA 3CF5A 2EPBA 4OO1G 4GOPB 2EYOA 2KCNA 3FPPA 4DV2L 4RAUC 1F2MA 4OWTB 5C4HA 1A0IA 1F9RA 1ENAA 1V1OA 2HQEA 4LFAL 5C4XH 2G9HD 4K14A 1N8RC 1O7YA 1HNXQ 4BBRH 3G6JB 1L0WA 5IYDH 3CAMA 1XPOA 4BY7B 1ILPA 3OYYA 3KF8A 2RHSB 4CDDC 1BO0A 3W3AA 1JOQA 3ZYYX 4JI3Q 5J1ZA 1EYCA 1SFOH 1XX8A 4HN7A 3D0FA 1LT4D 1M4VA 3NPPA 2JA6G 2I5HA 2XRSD 3P75A 3PUVA 2XWJB 4KY6A 3JAMc 2A6ED 3TZUA 3PUXA 3MVVA 2UXDQ 2QEXA 1EUJA 1SYBA 4EQOA 3P20A 3S17H 1LTBD 2RF4A 4A3BB 1N32L 5ELNA 2F0UA 2IHEA 2Z4IA 3OHXC 4C3JH 3M7GA 4B3MQ 2BH2A 2NVQH 4GOPA 2EY2A 2K5WA 3ER0A 1IBML 4A3MH 4KKUA 1XMOL 1SSOA 3HOZG 1O7IA 1ZXTA 1ASYA 2KVMA 3SK6A 3CC2A 4NDXA 1D5MC 1K9MC 2AUJD 2LKVA 2EY5A 1B9MA 5AJ3Q 2UUBQ 4ILWA 2K32A 4TSSA 3K0XA 3SHLA 4G57A 1II3A 1HA5A 1KLGD 2QF7A 3S1NH 3EA6A 5A2QE 1EYAA 4JK1C 3OTOL 2YTXA 4P75A 2VQEL 3PO3G 1HFGA 2UUAQ 3CC7A 1MJCA 2EYPA 1VDZA 2KEDA 5JEAH 1ENCA 1LTID 3K7AH 4DV5Q 4A3GG 4GLVB 1AW7A 1N9WA 2KENA 5ELEA 1N33Q 4X65L 1DM0B 2WINB 2NYZD 5CYUA 2JJQA 1I4XA 2K1BA 5KNBA 4N9TA 2EY1A 3KLSX 1IL2A 4R4TA 1ZEQX 3KF6A 1STAA 3DXJC 4LJZC 2NN6G 3DWPA 3VDYA 5FO8B 2N78A 3UI2A 2Y0SB 3P7JA 3FKIG 1WD0A 1K0RA 4A3DG 3HOYG 4H44C 1E22A 3NQTA 3T1HQ 4BBSG 5C4ZA 1FJGL 1ENFA 2A68D 3KUPA 5A2QL 5IY0A 1PFMA 4IPDA 5JJZA 4POGA 5EGTA 4GKKQ 1IBKL 3TP7A 4IJHA 4HEDA 5T1GA 4NXML 2D0PA 1D8LA 5CMDA 1VQEA 1OTCA 1R9TB 5HGTA 1JJCB 1OXXK 1TWHH 2MPMA 2QCPX 2MFIA 4X62L 2ZXOA 2A1AA 3S9WA 3OWFA 5GQOA 3G48A 3TDQA 2K5HA 2QILA 1Z6HA 3H6MA 2ZTCA 2EJFC 4A3EH 1SMYC 5E7NA 2VQFQ 5IGDA 3PO2G 3WDNA 4X66Q 2XNAC 1TS3A 2BDOA 3MHBA 4RHSA 1HXYD 1Q82C 3BU2A 3U4ZA 4AIMA 5ELOA 1J5EQ 4JC0A 2IX0A 3HOUB 1KAWA 1TU2B 2O4XA 4Y7NH 1PVOA 1BCPB 4NB3A 4WJWA 1A63A 4K6LA 4IPGA 1EYDA 1EFWA 1YJWA 4JBMA 5M3FB 2WIIB 3HOVH 3I8ZA 4DR7Q 1LUZA 2DY7A 1DJRD 2A5HA 3ERSX 2IHFA 1X56A 1EQQA 1GUGA 2F3IA 1Y8PB 4UAIA 2JP1A 2RCFA 5GAHC 3GTQH 1BVSA 1B3AA 1EY0A 1MJEA 4C1NI 1F2YA 1SE8A 1X9NA 4P2CB 1LT5D 1MIUA 1KNEA 3CQZH 3J81L 1PZID 1Q81C 4DXGA 2R6GA 1HUNA 4DV6Q 5M5YB 1Q86C 4DV0L 2ZTEA 2HHHQ 4CHTB 4LAAA 4B3RQ 1I4GA 1Q8IA 1VS0A 3K80C 4DV3L 2JA6B 4IFDG 2I5LX 1B9NA 4TRDA 1Q90A 2F0MA 1A3TA 3HP3A 4FO2A 5A35A 4N9PA 3FMCA 4O1NA 1GKHA 1RIPA 3FHWA 3QOLA 2Z6KA 2F52A 4H0LC 1XNQQ 3MWYW 4MZ9A 1B3QA 4DK1A 3IRBA 3HOZB 1K8GA 1PZKD 2UXBL 5I6YA 1EOTA 2XVSA 5JPMC 2XSCA 1QUQB 2B2TC 4OIKA 4JYAL 2HCCA 1BQQT 2A69D 4KK7A 4JOIC 4CDCC 5I6WA 4BXXG 1I4HA 2SNMA 2F0NA 4KY7A 2F0VA 4J6HA 1A15A 2KHJA 1SRUA 1IZ6A 2B63G 2L11A 4KHPQ 4JI1Q 1NCVA 4MTKA 4A3GB 1IKMA 4RHRA 1JOKA 3M7NA 4NMZA 3S2HH 1PH5A 1EYGA 5C0XG 4QF4A 1UWVA 1U4RA 4LF8L 3GTOH 2N8NA 1YJ9A 1WTVA 2PO4A 3RZOH 3KYHC 1SR3A 3U4VA 4JI6L 2LFNA 1YNXA 1Y1VB 2PZWA 3FKIB 4K0KL 3M4OH 4AYBG 4DV4Q 3HOYB 4A3DB 3BZDB 4BBSB 3A74A 5FJ8G 4A3LH 3GDEA 1J9OA 1UE5A 2Q2TA 3TS0A 1DOLA 2AKWB 4TVAB 1WFQA 5IP7H 2F0JA 3S2DB 5C3EG 2YU9B 3A56A 4Q0FA 4O2DA 4GKJL 2WKCA 2JE6I 4AQYQ 3J80L 1B7YB 4JI5L 3ND8A 4RGOS 3QB3A 4C3HG 1VQKA 3O13A 1XYIA 3DM3A 2EE1A 1SMXA 4JI0L 1BKBA 4APVA 4OWXB 1IW7D 3J7AF 2HT1A 4M1UB 4EVOA 4BA2I 1EZ6A 3PO2B 4R1JA 1QG7A 1AZPA 1VF7A 2RDFA 2VL6A 4HJ8A 1UE1A 3DEOA 3W1BA 2XIWA 1WCMH 1Q12A 3A8JE 3TQYA 4DK3C 1KDCA 4DAYB 5ELFA 2B8GA 3CCMA 2LXKA 2LS01 2UU9Q 3BZCA 2A68C 1EU4A 3GTKH 5LMUQ 5IGEA 3S24A 1JWMD 4PQXA 3GTPB 1N34L 1EL0A 1VQ8A 2EZVA 2CQAA 2F0QA 2B39A 2XRQD 4DV7L 4KJNA 4YWKA 3HRZC 1I50B 4PMBA 2E5LQ 2AQ3B 2BE5D 2JA9A 3HZXA 1E2ZA 1GHJA 2LMCB 3EVQA 5GROA 1KXLA 3E0JA 4DV1Q 3HEJA 1PLFA 1X55A 5I2XA 4DR4L 4KJOA 1ET6A 4KD4A 1DZ1A 4POFA 1KDBA 4ZQ3A 2MP1A 4RWSC 2A73B 1BCPF 1P16A 1HCZA 4DAYA 3WWVA 4FXKC 1C4QA 4DKAC 4MHEA 5GAEC 3IAYA 3VR3A 3BS1A 2JA7H 4XYOA 3H3VI 3RUZA 3NQIA 4ZYSA 1Z47A 1AZQA 1U9RA 3GV6A 3TBIB 3S14B 1NSNS 3ULLA 1U4PA 1BR9A 2K5VA 1I5FA 4XXEA 3I91A 4QIWE 4DR3L 4C3IG 4GN5A 1NBWA 1NY4A 3I4MG 2F3VA 4RGNA 3BYTB 1XNRL 3TZDA 1X65A 1BBWA 3FP9A 3OIPA 4IUPA 5G3LD 3PO3H 2SDFA 4R4OA 1EY5A 1PTOH 4OIJA 4DPGA 3AEVA 4V190 1I94L 2YV5A 3PIPA 3UE0A 1LTSD 2WACA 1GO3E 5C44H 4KKSA 5C4XG 3H94A 2B63B 1TY2A 2LXJA 4DUYQ 1FD7D 1K28A 3E3XA 1PH4A 3I4NG 4BBRG 2DY8A 2WKDA 4CKEA 4JI2L 3U9SA 3QIAA 1DXMA 3CMEA 3S1RB 2E2IB 5HGQA 1PYWD 2Q2IA 1CKMA 4IUVA 5FLMH 1I6HB 2E2DC 3R3OA 1TY0A 5EKIA 1EY4A 2KCTA 1YJNA 5HURA 4E6IA 1U4LA 1EIGA 2FFKB 1H95A 2E76C 4Y52H 3Q22A 2Z1CA 1L2FA 4AYBB 2L4NA 4A3CH 3H0GG 3D6CA 3NHHA 2J7ZA 1CSPA 4OONA 1HRJA 1ASZA 2HD3A 3GQBA 4C3JG 3NWSA 4JCVE 4N8FA 5C3EB 4HSVA 1MGSA 1KC8C 2C9OA 4A3MG 4A93H 1C0AA 2FHTA 2IWHA 1CTMA 1STGA 2EJGC 2NZOA 2PI2E 1N36Q 4GN3B 1A3VA 1CHQD 2A69C 2B2WA 1WVLA 1JE4A 1KDAA 1AP0A 3V05A 4HMIA 4EGVA 3CCQA 1XTDA 2EDGA 4C3HB 3SVMA 3MEFA 2Z4HA 3F8TA 1F9SA 1SJED 4FP5D 3S1QH 3HS0C 4R9WA 1DCZA 4RGMA 3A0JA 1PTOD 5M5XH 2HDMA 1QVGA 5DM63 5IE8A 3G6EA 1VQJA 3N52A 5JEAG 4JVZA 3NENA 5JPNC 1EFID 3PMFA 1I3QB 4K8JA 1PZJD 1VQFA 2BCOA 2X69A 1ICWA 4FXGC 2OXPA 4C2MH 3G71A 5FO9B 2X6LA 1IBLQ 5FK9C 3DM1A 3EFXD 4JBKA 1PYBA 3GTLH 1TWGH 3AMUA 2F0DA 2WB1E 3WOEA 4DAVA 1TS4A 1L1OC 1EY6A 2M00A 2RSNA 1FGUA 2ZM6L 4RFBA 5JJLA 1QCBD 2N55A 2L5TA 1PDQA 4ME5A 2F0LA 1SNPA 2AUKA 2E2JH 2PW5A 2R7FA 1PA6A 4DV2Q 1GUNA 1SXTA 4DR2L 2FINB 2K5QA 2ICIA 4LFAQ 3TEHB 4LF5Q 4LNQA 1IW7C 1EQVA 1PH6A 4CJ0B 1QNUA 1I6VC 2JXMB 2L9HA 2R92G 1UE7A 2NN6I 4DFAA 3MFGA 4EQPA 1IKLA 4JI7L 1LM0A 1T5XD 3J7AV 3K81C 2I5MX 1CQFA 4OWWB 5F2DA 5L37A 1WTQA 1PMRA 1SYEA 4A3FH 3NELA 3KDFB 1NE3A 3X3MA 2RQXA 1X6OA 1SNCA 3LWUA 2IX1A 5M5WH 2A19A 2CVRA 2B2TA 4K5WA 1EY9A 4KV6A 3T51B 1IYJB 1N32Q 4K5VA 2E75C 4C3IB 4G7ZC 2VZAA 1AE3A 1TVXA 3RLFA 3NBHB 1GVPA 3NTIA 3MXGA 3I4MB 2VY3A 5IGBA 3HOVG 1B4OA 4IOCA 2F0GA 3P1HA 4NXNL 3RZDH 2OT2A 2OTLA 2B3GA 3QJYA 4QB4A 2BE5C 4J15A 4HJAA 4A3BH 1GJXA 3H15A 4FXDA 4JV5L 3TSSA 5G3LF 4OELB 1QZGA 4RG1A 4KKTA 4JBWA 4TQUS 5FKAC 1YNND 3URYA 5C4XB 2ZJPA 2WV6D 3PIP3 5E1FA 3NTKA 1YHBA 4UY8C 3KDFA 3I4NB 4BBRB 1QE6A 5EPJA 1JMCA 2NZ1D 3NBIA 3GTGH 3NEMA 3PUYA 1GUWA 4KTAA 3EROA 1YNJD 4PZ6A 4FYDA 2LY7A 4X65Q 4YCWA 4OHJA 1SFOB 1K3RA 4XT3B 4CGYB 3NBHA 3ULPA 4DF7A 2I0QA 2F03A 1UEBA 4YY3Q 3TREA 1HNXL 2PNHA 1I4RA 2EJMA 2F0SA 1FGBD 3FRPB 3K57A 5BN4A 1VQMA 1VQ6A 3S17B 1X3GA 1G6ZA 3H0GB 3DMUA 4IPCA 1KQSA 4LF4L 1LLRD 1EIHA 2CFMA 1KRSA 2PQEA 1FJGQ 1TKWB 5CR3A 1EY7A 2K5DA 2KECA 4C3JB 4XQJA 1WTOA 2NVQB 1EIYB 2B2YC 4J8QA 4A3MB 1ICFB 2VW9A 4FDBA 4AH6A 1HQRD 1MBYA 4NXMQ 2UXDL 4CDEC 1PH3A 1O7LA 3CCRA 3UDFA 2DNCA 2DGYA 2K33A 1F2ZA 4IFDI 1VCIA 4A3KG 5CV8A 3E6ZX 1DOKA 1C9OA 1C8CA 1HPCA 3MC0B 2TMPA 2VB2X 1R9TH 1VQCA 3NUCA 3J7YW 3EQLC 4DK0A 3K7AB 1GUOA 4L6TB 4QGUA 2OEOA 3J81j 5IT9E 2K75A 1ONLA 1YHAA 1GXDC 1ESRA 1W2BA 4QCLA 3SGIA 4DNTB 3A7LA 3CW2C 5C3XA 2UUAL 1PFBA 4UHVA 3EN2A 3VR2A 1HJPA 2MJ8A 4F88A 1STHA 3A7AB 3I72A 5IIFA 2RA4A 4DV5L 1SNOA 2D0OA 2F4IA 2ZT9C 1N33L 1KABA 2WP8J 3HOUH 1IYVA 2ZXPA 1GOZA 2NVXH 1NMFA 2OQ0A 3CPWA 4DR5Q 1TS5A 1SJHD 5M3FH 4LF7L 5FLXc 3T13A 3FPUB 5C5MA 5CV6A 1V43A 1TWHB 4WORA 4PZ7A 5DM73 1S5ED 1FYCA 5KIXA 2F0PA 1M8AA 2F1MA 3SE0A 5EKLA 5C0XI 2QEJC 2XTIA 2C5CA 3GTMB 1EU3A 2CQOA 2P5ZX 4U68A 5FOBB 2R92B 1PTOC 1O7ZA 4FNFA 3GTJB 3PQIA 4H02A 5CV5A 4OO1H 5KYIA 3OMCA 1K73C 1HZAA 5EPLA 2F0OA 2R7ZH 2G5DA 3RNUA 4DV3Q 4GN4B 1RHPA 1JJGA 3TRZA 1TWAB 3M3YH 1BXTA 4L8JA 4DXFA 1A8VA 5M5YH 4HIMA 1WCMG 1YVCA 3K5NA 4G7OC 4F87A 2E8GA 4NPSA 1W3SA 2VQFL 3VA5A 1EWCA 3CPFA 4X66L 3HOVB 2ENBA 3RLOA 3SXHA 1QZHA 1SNMA 2VS1A 3AQQA 4KY5A 2MNAA 2XGTA 2PZUA 2IL8A 5IYCH 2UXBQ 1VQPA 4LFCL 5CV9A 3VR4A 4A3JG 3SK4A 4JYAQ 1H9SB 1V9PA 2SOBA 1RD9D 3RN2A 3S16H 3ULJA 1TIID 2FXQA 3AU7A 2WAQG 4BA1I 1JQYD 3R8BA 1W6JA 1I4PA 1VQOA 4LF9L 4DUZL 1JB7A 1DONA 2EYJA 4CKCA 3HGBA 3I2ZA 4RKLA 2PZTA 4YHHL 3JAME 2PQAB 2EYFA 3C1EA 3SK5A 4IFDJ 3C2PA 1SLJA 2OQKA 4QL5A 1VQLA 1JR0D 1SROA 2OWOA 2JA7G 3CCLA 4LF8Q 1VQAA 2R61A 2UUCL 4GNXC 1Y1WH 3I7FA 4JI6Q 3X3NA 1IYUA 2WFWA 2V1CC 4I7AA 2L12A 3A8KE 1LTLA 3D4DA 4B3RL 4PG3A 1H9SA 1NNXA 5BR8Q 3MXUA 5M3MH 4ZK9B 2AWOA 3CRKC 3GD7A 2I07B 4CBVA 4OEMB 4GKJQ 1IHZA 1KLUD 5D65A 1PH8A 4KLKA 1Y1VH 3FKIH 2K01A 1TS2A 4FVMA 4LUVA 1LYLA 2VB3X 3M9BA 3T1YL 1B8AA 1YNNC 4A3KB 3D8GA 3JAML 2OF1A 4RKBA 4WJ3M 1YI2A 1QOHA 3HKZG 4XT1B 1YZ6A 5JJIA 3NTHA 3A5ZB 2F0FA 1STYA 3BVMA 1SE4A 2PQAA 1VQ7A 3I55A 4UP9A 4CDFC 2RDHA 2WAQE 1QUQA 3HOXG 1YNJC 3G7LA 1HZBA 1JE5A 1Y8OB 2R93H 2K4KA 1M90C 3CKIB 3R2TA 5C0XJ 5FLMG 2UXCL 5K36H 4PMCA 2F0KA 4GS3A 1B53A 4R8NA 3GTOB 1GUSA 3PO2H 1UUPA 3TP6A 5H1SE 3RZOB 5CV4A 4Q5VA 3FEWX 2BDNA 1G291 1MD2D 1STEA 1N34Q 5IWAL 1FNUA 1HHVA 1E2WA 3CCJA 5J3BA 1PRTC 2HCIA 4NKLA 4QMGA 2KHIA 3BVGA 4QUCA 3MTSA 4A93G 1A2TA 2N3SA 4JBJA 3KK7A 1NUCA 5LMNW 4XTCS 1D7QA 1D5XC 4CKBA 3ZJYC 1EZ8A 4BWGB 2HIVA 2K6AA 2JEBI 3KLWA 1CUKA 3QOJA 1OXSC 1I50H 3HKZE 4JI4L 2A6HD 2JYOA 2JN4A 1H9MA 2KUMA 3CHBD 1CM9A 1MSGA 2ASBA 1QWYA 3DHQA 4AQYL 4EQNA 4OX9L 2Q8IB 3M4YA 2VUMH 3CMAA 3RMHA 4HIOA 1G2SA 2E2HH 3OMGA 1WCMB 2NVTH 2X6GA 4DR6L 3KBGA 1G2TA 2K03A 3K8AA 3IL8A 1CA6A 1D2BA 1Q7YC 1PH2A 4LF6L 3W5OA 3GTKB 2IW3A 3UDXA 3PGZA 1S5BD 1Q8KA 1X3QA 3RD4A 1W6KA 2EXZA 3A55A 4A3JB 2KHSA 1HA6A 3CCSA 3QR8A 4F8MA 1IXRA 4P71A 1RL2A 2EIFA 4X3KA 1A62A 2HUGA 1I94Q 1VF5C 4ME3A 2WAQB 2UU9L 1K83B 2BH8A 4YWLA 5LMUL 4I7ZC 3E0EA 1SE3A 1HFNA 5ISRA 2Q8RE 2D62A 1EEFD 4G4KA 1FVIA 2NVYH 3SDZA 3M4PA 1B1ZA 3NSWA 5DNFA 4JI2Q 3TN2A 3CXCA 4DAMA 5IGGA 4R8IA 2E5LL 1O80A 3R93A 2Q2UA 3HOWH 3VYRA 1VQHA 1X3FA 3PUZA 3SR1A 2B2YA 5LMNQ 3K58A 5D3IB 5KGUA 2JA8H 2JA7B 2BA1A 2XN9C 4A3FG 2B63H 3K6OA 1UEAB 1ZKOA 4DV1L 1JWUD 2RSOA 1G8ZD 3V2TA 2K7VA 3U50C 1VQ9A 2GVAA 5K5PA 4MNOA 3TMEA 3S1RH 1QJOA 2EOTA 2E2IH 4FF3A 2D5DA 5DEHA 2F0HA 4K8IA
chains in the Genus database with same CATH topology
2F0TA 1U4MA 3M85A 5C4JB 5JVH3 4BS9A 3SK8A 3PO3B 3GO5A 1PTOB 3HKZB 1Q1BA 2QDBA 2KOLA 1C48A 3GP7A 3VYTA 1BOSA 4IZ8A 3HOXB 3T53B 1TWCB 3QO2A 1WTXA 5BN3A 1HUMA 3L7ZC 2CW0D 1GUTA 5EPKA 4FF2A 4XQQA 3LWEA 4IUNA 1LV9A 2QKIC 2JSOA 1RTNA 1STBA 1QNKA 3OSOA 5DAUA 3FDTA 3I4LA 1BUVT 4X3TA 4KN7C 2NB0A 1JC7A 4A93B 4QIWB 5C6AA 1R4QB 5J22A 4HCSA 1IL8A 4QUFA 1V1PB 3MFYA 3PV0A 1ZYRD 1JB3A 4GZYC 2KJXA 1CFMA 1NR2A 4HSPA 2D9UA 2B2UC 5M5XB 4F7XA 4ZLTF 2AQ1B 5JEAJ 5ELBA 1BBXC 1HQMC 2TSSA 4LK1C 3MXPA 1LTGD 2SEBD 3A8IE 3KLSA 2BA0A 4C2MB 3W2DA 5EBCA 4DU9A 1BDOA 3NP8A 1VMCA 3T56B 4YIJA 5CGKA 2M2LA 4IUQA 4KHZA 5LL6S 4B9WA 2E2JB 1B2TA 1EQTA 1D1KA 1E2VA 1RCVD 2A6HC 3L3OC 3MZ5A 4DA2A 4IURA 5EQ0A 3K59A 3I70A 2NTTA 3LNNA 4DAPA 2MGSA 1HTLD 2R3ZA 4A3FB 4FF1A 5TSSA 5M5WB 1FNVA 1I4QA 3FVQA 3ITPA 1PRTB 1PFNA 5I9PA 1J8IA 1JICA 3EJIA 3VA7A 3RZDB 1Y8NB 2NWGA 2PNRC 4RCNA 3C46A 3WOFA 5IODA 2AQ2B 4O42A 2WB1B 2EVBA 3Q0AA 4ULLA 1LABA 1CI3M 5JOBA 2H4OA 1K8OA 5KNCA 4FF4A 3GTGB 1PRTD 2F3WA 1NR4A 1SE2A 4H13C 5KRUA 2J4XA 5ELDA 4G7HC 1CA5A 1SNQA 1E0BA 3S1NB 2NUCA 4V0BA 4HTHA 3VR5A 3BDCA 3D6WA 3D4WA 3GV3A 3ONAB 1CZGA 1PTOF 2EYLA 3BDOA 3CU7A 2PPBC 2B2VC 4XIGS 3N6RA 4PMWA 4J1MA 2J0TD 1RODA 1UAPA 1WTPA 2RKSA 1WTWA 1S5DD 3OIQA 2DNEA 1JCKB 5LL6X 2E74C 3K5LA 4KI0A 2CW0C 1CZWA 1D1IA 1LTRD 4X3UA 3OPOA 2EYMA 1TT2A 1RKNA 5EKKA 4TKOB 2FMMA 3NXWA 5K36G 2O5IC 4RH6A 5IT9L 2DN8A 2KEEA 1BF4A 1X3PA 3DEPA 2B2WC 1DYQA 3TP5A 4A3EB 3J81E 2G9DA 2IT1A 3QG1A 2F0WA 2YYZA 2PYKA 4UDUC 3ERQA 3Q23A 1WD1A 2NVXB 2K28A 3I90A 2RBMA 1OO9B 3VR6A 1EEID 1K8MA 2I46A 3T16A 1ZYRC 3L9AX 3NWTA 4Y7NB 5KEEA 4K2LA 4MIUA 3NE5B 1S5FD 3BG3A 5D14A 4B08A 5CBAE 1KAAA 2R7ZB 2CHBD 4L63B 3MAQA 2NBFA 3GTQB 3M3YB 3KLRA 5CV7A 5I2YA 1BCPD 4KN4C 1A3UA 3CQZB 1TR5A 5ELCA 2MHVA 3Q6SA 2EYHA 1AEXA 1XXGA 3D3RA 1B44D 2JEAI 1EY8A 3HG9A 1ESFA 1LTAD 3VYUA 1LO5D 4DGZA 4I65A 4M8AA 3S16B 4IN3A 1A6XA 4ZKBB 2ZXRA 1RDPD 2L1BA 3IFTA 4X3SA 1KTKA 4ID6A 4CJ2C 4KD3A 2PW7A 3LX0A 4KHVA 2FJ2A 5AFWA 2RDGA 3KBXA 4MN3A 2NN6H 4NP5A 3IKJA 4KMUC 1PRTF 1SYGA 3A54A 3MA2B 1B50A 1Y1WB 3PIO3 4U673 3AB9A 4LMQD 1G91A 1OXTA 2O5JC 1DD2A 3J80E 1FR3A 2AWNA 1FNWA 3OWEB 5J39A 2A6EC 3OOCA 4RGTA 5M3MB 1LTTD 4IALA 3S2HB 1X32A 3I3CA 2B2UA 5LHY1 5COYA 3DWQA 5IGCA 1QILA 3OW7A 2ID0A 1GHKA 1H9JA 1JWSD 1CT1D 4IQZA 5C5LA 3M4OB 4XQNA 1V8QA 1S4ZA 2R93B 2A74C 3MEHA 1RJTA 1L0YB 2F0EA 3BVZA 2VNUD 2Z8LA 1QB5D 1SNDA 3CRLC 1T5EA 3K5OA 4NW2A 1KNAA 1SAPA 5FLXE 2VXWA 3SEBA 1RF2D 1XTCD 5IOCA 3VYSA 2K04A 4RCOA 4ZUJA 1WTRA 4K6DA 5FO7B 1D6EC 1Z7TA 1H9RA 4IFDH 1XWEA 4OGQC 4WRDA 4XDXA 4XYQA 1CHPD 1MI2A 2SNSA 4IUTA 3V96A 2FMCA 2L0CA 1H9KA 2IPKD 1DOMA 1O78A 3DUZA 4K2KA 3U9OA 4ZRZA 2VUMB 5FLXL 2E2HB 5CC4A 2NVTB 2XWBB 1VMPA 1AFPA 2GA4B 1SBBB 4DNRB 4PV1C 3BDLA 3TP8A 3H3VC 4HMJA 1R4PB 3D4RA 3DWAA 1JORA 1UNSA 2KQ3A 4C56C 5CORA 1OXVA 4ODGA 3I73A 3K0YA 4ABNA 3NK9A 2D2CC 5C0XH 5T1IA 1CQVA 2NVYB 1HTPA 5EBDA 4CJ1B 2Q8TA 1RTOA 5KYLA 3HOWB 5C3WA 4S3SA 1MSHA 2PCFB 2B2VA 1LT6D 4ZUIA 2JA8B 1Q1EA 1BCPC 1ILQA 5I9OA 4C1NK 5C44B 4HAEA 3E5SA 4Z9CB 1AN8A 1STNA 1L0XB 2N88A 3S1MB 3H09A 2HDLA 2KA7A 1SYFA 4OO1I 1NAPA 5EJWA 3S15B 3K5MA 2ICEC 1F2LA 5NUCA 1PXUA 2K05A 1SMYD 1LT3D 3IFDA 5I4DA 1TWFB 4RA8A 5KNDA 3QWNA 4ZKCB 4OL7A 2EY6A 1F9PA 1OXUA 1F77A 1ET9A 2F0IA 3C1FA 1A2UA 3D31A 1SDFA 5D3DA 3ND9A 5BN5A 4A3IB 2NTSA 3S1QB 5JAVA 2JA5B 4HCEA 5E3FA 3H91A 3MXNA 5M9OA 2MUYA 4ZAIA 3C3LA 1BNZA 2H1EA 1SEBD 5E4XA 3Q24A 1LACA 4DN4M 4H7BA 4HR7B 1S5CD 1EWHA 2M9VA 1D5ZC 2IJ0A 1TWGB 3GTLB 1V1PA 1F9QA 1JOOA 3PUWA 3T4AC 4B9XA 4IUUA 2V4DA 2IX3A 2O2LD 2KCCA 5CBEE 2L55A 1ML0D 2RVLA 3BYYB 4PNYA 5JVG3 2B8FA 1Y69U 2PMZB 3R2IA 1TQOA 4WFN3 4K5XA 1CK1A 3F2UA 4BY1B 5E4WC 1Q3LA 5IGFA 1SYCA 1SYDA 2BOSA 2EPBA 4OO1G 2EYOA 2KCNA 3FPPA 4RAUC 1F2MA 5C4HA 1F9RA 1ENAA 1V1OA 2HQEA 2G9HD 4K14A 1O7YA 3G6JB 4BY7B 1ILPA 3KF8A 1BO0A 3W3AA 1JOQA 3ZYYX 5J1ZA 1EYCA 1XX8A 4HN7A 1LT4D 1M4VA 3NPPA 2XRSD 3P75A 3PUVA 2XWJB 4KY6A 2A6ED 3TZUA 3PUXA 3MVVA 1SYBA 4EQOA 3P20A 1LTBD 4A3BB 2F0UA 2Z4IA 3OHXC 3M7GA 2EY2A 2K5WA 4KKUA 1SSOA 1ZXTA 2KVMA 3SK6A 4NDXA 1D5MC 2AUJD 2LKVA 2EY5A 1B9MA 4ILWA 2K32A 4TSSA 3SHLA 4G57A 1II3A 1HA5A 1KLGD 2QF7A 3EA6A 5A2QE 1EYAA 4JK1C 1HFGA 2EYPA 2KEDA 1VDZA 5JEAH 1ENCA 1LTID 1AW7A 5ELEA 1DM0B 2WINB 2NYZD 5CYUA 1I4XA 2K1BA 5KNBA 4N9TA 2EY1A 3KLSX 1ZEQX 1STAA 3DXJC 4LJZC 2NN6G 3DWPA 5FO8B 3UI2A 2Y0SB 3P7JA 1WD0A 4H44C 3NQTA 5C4ZA 1ENFA 2A68D 3KUPA 5A2QL 1PFMA 5JJZA 5EGTA 3TP7A 4HEDA 5T1GA 5CMDA 1R9TB 5HGTA 1OXXK 2MPMA 2QCPX 2ZXOA 3S9WA 3OWFA 3TDQA 2QILA 1Z6HA 3H6MA 2EJFC 1SMYC 5IGDA 3WDNA 2XNAC 1TS3A 2BDOA 3MHBA 4RHSA 1HXYD 2IX0A 3HOUB 1TU2B 2O4XA 1BCPB 4WJWA 4K6LA 1EYDA 5M3FB 2WIIB 3I8ZA 2DY7A 1DJRD 2A5HA 1GUGA 1Y8PB 4UAIA 2JP1A 1B3AA 1EY0A 4C1NI 1F2YA 4P2CB 1LT5D 1KNEA 3J81L 1PZID 4DXGA 2R6GA 1HUNA 5M5YB 4CHTB 4LAAA 1I4GA 1Q8IA 2JA6B 4IFDG 1B9NA 4TRDA 1Q90A 2F0MA 1A3TA 3HP3A 4FO2A 5A35A 4N9PA 3FMCA 4O1NA 3QOLA 4H0LC 3MWYW 4DK1A 3HOZB 1PZKD 5I6YA 1EOTA 2XVSA 5JPMC 2XSCA 2B2TC 4OIKA 2HCCA 1BQQT 2A69D 4KK7A 5I6WA 1I4HA 2SNMA 2F0NA 4KY7A 2F0VA 4J6HA 1A15A 2L11A 1NCVA 4A3GB 1IKMA 4RHRA 1JOKA 3M7NA 4NMZA 5C0XG 4QF4A 1U4RA 1WTVA 2PO4A 2LFNA 1Y1VB 3FKIB 2PZWA 4A3DB 3HOYB 3BZDB 4BBSB 1J9OA 1DOLA 2F0JA 3S2DB 2YU9B 3A56A 4Q0FA 2WKCA 2JE6I 3J80L 3ND8A 4RGOS 3QB3A 4C3HG 3O13A 1XYIA 2EE1A 1IW7D 3J7AF 4M1UB 4EVOA 4BA2I 1EZ6A 3PO2B 1QG7A 1AZPA 1VF7A 2RDFA 3DEOA 2XIWA 1Q12A 3A8JE 1KDCA 5ELFA 2B8GA 2LS01 2A68C 1EU4A 5IGEA 1JWMD 4PQXA 3GTPB 1EL0A 2EZVA 2CQAA 2F0QA 2B39A 2XRQD 4KJNA 3HRZC 1I50B 4PMBA 2AQ3B 2BE5D 3HZXA 1E2ZA 1GHJA 2LMCB 3EVQA 3E0JA 3HEJA 1PLFA 5I2XA 4KJOA 1ET6A 4KD4A 1DZ1A 1KDBA 4ZQ3A 2MP1A 4RWSC 2A73B 1BCPF 1HCZA 4DAYA 4FXKC 1C4QA 4MHEA 3IAYA 3VR3A 3BS1A 4XYOA 3RUZA 3NQIA 4ZYSA 1Z47A 1AZQA 1U9RA 3GV6A 3TBIB 3S14B 1NSNS 1U4PA 1BR9A 4XXEA 3I91A 4C3IG 2F3VA 4RGNA 3BYTB 3TZDA 3OIPA 4IUPA 5G3LD 2SDFA 1EY5A 1PTOH 4OIJA 4V190 1LTSD 2WACA 4KKSA 3H94A 2B63B 1TY2A 1FD7D 2DY8A 2WKDA 4CKEA 3U9SA 3QIAA 1DXMA 3S1RB 2E2IB 1PYWD 4IUVA 1I6HB 2E2DC 3R3OA 1TY0A 5EKIA 1EY4A 5HURA 4E6IA 1U4LA 1EIGA 2FFKB 2E76C 3Q22A 2Z1CA 4AYBB 2L4NA 3D6CA 3NHHA 2J7ZA 1HRJA 3GQBA 4C3JG 3NWSA 5C3EB 4HSVA 1MGSA 2C9OA 2FHTA 2IWHA 1CTMA 1STGA 2EJGC 1A3VA 1CHQD 2A69C 2B2WA 1WVLA 1JE4A 1KDAA 1AP0A 3V05A 4HMIA 4EGVA 2EDGA 4C3HB 3SVMA 2Z4HA 1F9SA 1SJED 4FP5D 3HS0C 4R9WA 1DCZA 4RGMA 1PTOD 2HDMA 5DM63 5JEAG 3N52A 5JPNC 1EFID 3PMFA 1I3QB 4K8JA 1PZJD 2BCOA 2X69A 1ICWA 4FXGC 2OXPA 5FO9B 2X6LA 5FK9C 3DM1A 3EFXD 3AMUA 2F0DA 3WOEA 4DAVA 1TS4A 1EY6A 2M00A 2RSNA 4RFBA 1QCBD 2N55A 2L5TA 1PDQA 4ME5A 2F0LA 1SNPA 2AUKA 2PW5A 1GUNA 1SXTA 2FINB 2K5QA 2ICIA 1IW7C 1EQVA 4CJ0B 1QNUA 1I6VC 2JXMB 2L9HA 2NN6I 4DFAA 3MFGA 4EQPA 1IKLA 1T5XD 3J7AV 1CQFA 5F2DA 1WTQA 1PMRA 1SYEA 3X3MA 2RQXA 1SNCA 3LWUA 2IX1A 2CVRA 2B2TA 4K5WA 1EY9A 4KV6A 3T51B 4K5VA 2E75C 4C3IB 4G7ZC 1TVXA 3RLFA 3NTIA 3MXGA 3I4MB 5IGBA 1B4OA 2F0GA 3P1HA 2OT2A 3QJYA 4QB4A 2BE5C 1GJXA 4FXDA 3TSSA 5G3LF 4KKTA 4JBWA 4TQUS 5FKAC 1YNND 3URYA 5C4XB 2WV6D 3PIP3 5E1FA 3NTKA 3I4NB 4BBRB 1QE6A 5EPJA 2NZ1D 3NBIA 3PUYA 1GUWA 4KTAA 3EROA 1YNJD 4FYDA 2LY7A 4OHJA 1SFOB 4XT3B 4CGYB 3NBHA 4DF7A 2F03A 1I4RA 2EJMA 2F0SA 1FGBD 3FRPB 3K57A 5BN4A 3S17B 1G6ZA 3H0GB 3DMUA 1LLRD 1EIHA 2PQEA 1TKWB 5CR3A 1EY7A 2K5DA 2KECA 4C3JB 4XQJA 1WTOA 2NVQB 2B2YC 4J8QA 4A3MB 1HQRD 1MBYA 1O7LA 2DNCA 2K33A 1F2ZA 4IFDI 1VCIA 5CV8A 3E6ZX 1DOKA 1C8CA 1HPCA 3MC0B 2TMPA 2VB2X 3NUCA 3J7YW 3EQLC 4DK0A 3K7AB 1GUOA 4L6TB 2OEOA 5IT9E 1ONLA 1GXDC 1ESRA 4QCLA 4DNTB 3A7LA 5C3XA 1PFBA 3VR2A 4F88A 2MJ8A 1STHA 3A7AB 3I72A 5IIFA 2RA4A 1SNOA 2F4IA 2ZT9C 1KABA 2WP8J 1IYVA 2ZXPA 1GOZA 1TS5A 1SJHD 3T13A 3FPUB 5C5MA 5CV6A 1V43A 1TWHB 4WORA 5DM73 1S5ED 1FYCA 5KIXA 2F0PA 1M8AA 2F1MA 3SE0A 5EKLA 5C0XI 2QEJC 2C5CA 3GTMB 1EU3A 4U68A 5FOBB 2R92B 1PTOC 1O7ZA 4FNFA 3GTJB 5CV5A 4OO1H 5KYIA 3OMCA 5EPLA 2F0OA 1RHPA 1TWAB 1BXTA 4L8JA 4DXFA 3K5NA 4G7OC 4F87A 3VA5A 1EWCA 3HOVB 2ENBA 3SXHA 1SNMA 4KY5A 2PZUA 2IL8A 5CV9A 3VR4A 3SK4A 1H9SB 2SOBA 1RD9D 1TIID 3AU7A 4BA1I 1JQYD 3R8BA 1W6JA 1I4PA 1DONA 2EYJA 4CKCA 3HGBA 4RKLA 2PZTA 3JAME 2EYFA 3C1EA 3SK5A 4IFDJ 3C2PA 1JR0D 2R61A 3X3NA 1IYUA 2L12A 3A8KE 3D4DA 1H9SA 3MXUA 4ZK9B 2AWOA 3CRKC 3GD7A 2I07B 4CBVA 1IHZA 1KLUD 5D65A 2K01A 1TS2A 4FVMA 2VB3X 4A3KB 1YNNC 3D8GA 3JAML 2OF1A 4RKBA 1QOHA 4XT1B 3NTHA 2F0FA 1STYA 3BVMA 1SE4A 2RDHA 1YNJC 3G7LA 1Y8OB 3CKIB 3R2TA 5C0XJ 5K36H 4PMCA 2F0KA 1B53A 4R8NA 3GTOB 1GUSA 1UUPA 3TP6A 3RZOB 5CV4A 4Q5VA 3FEWX 2BDNA 1G291 1MD2D 1STEA 1FNUA 1HHVA 1E2WA 1PRTC 2HCIA 4NKLA 4QMGA 4QUCA 3BVGA 3MTSA 1A2TA 3KK7A 1NUCA 4XTCS 1D5XC 4CKBA 1EZ8A 4BWGB 2K6AA 2JEBI 3QOJA 1OXSC 2A6HD 2JYOA 3CHBD 1H9MA 2KUMA 1CM9A 1MSGA 1QWYA 3DHQA 4EQNA 2Q8IB 3M4YA 3RMHA 1G2SA 3OMGA 1WCMB 2X6GA 3KBGA 1G2TA 2K03A 3IL8A 1CA6A 1D2BA 3GTKB 2IW3A 1S5BD 1X3QA 3RD4A 1W6KA 2EXZA 3A55A 4A3JB 2KHSA 1HA6A 4F8MA 4X3KA 2HUGA 1VF5C 2WAQB 1K83B 4I7ZC 1SE3A 1HFNA 5ISRA 2Q8RE 2D62A 1EEFD 4G4KA 3SDZA 1B1ZA 3NSWA 5DNFA 3TN2A 4R8IA 5IGGA 1O80A 3R93A 3VYRA 3PUZA 3SR1A 2B2YA 3K58A 5D3IB 5KGUA 2JA7B 2BA1A 2XN9C 3K6OA 1UEAB 1ZKOA 1JWUD 2RSOA 1G8ZD 3V2TA 2K7VA 5K5PA 3TMEA 1QJOA 2EOTA 4FF3A 2D5DA 5DEHA 2F0HA 4K8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PMB A;  3MVV A;  5IGC A;  1A2T A;  4HMJ A;  2OEO A;  1SYB A;  3MHB A;  4KV6 A;  1NUC A;  1EY9 A;  4K5W A;  4EQO A;  2F0T A;  2EYJ A;  3HZX A;  4K5V A;  1JOR A;  2F3W A;  2F0U A;  2KQ3 A;  4DU9 A;  4RKL A;  1STG A;  3EVQ A;  5JAV A;  1JOK A;  5C5L A;  5IGB A;  1A3V A;  2PZT A;  1EZ8 A;  3NP8 A;  2O4X A;  1KAA A;  4NMZ A;  2EY2 A;  5KRU A;  4YIJ A;  5C3X A;  2F0G A;  1SNQ A;  1KDA A;  2EYF A;  3C1E A;  3HEJ A;  3P1H A;  4HMI A;  3SK5 A;  1STH A;  2NUC A;  4KJO A;  3QOJ A;  3SK8 A;  3S9W A;  1EYD A;  5E3F A;  4QF4 A;  4HTH A;  2QDB A;  4KD4 A;  4ODG A;  5IIF A;  4QB4 A;  5CGK A;  3SK6 A;  1KDB A;  1SNO A;  4ZQ3 A;  4NDX A;  3BDC A;  4B9W A;  3D4W A;  5M9O A;  3NK9 A;  3DHQ A;  1KAB A;  2LKV A;  2EY5 A;  2EYL A;  4IZ8 A;  5CV7 A;  4EQN A;  1A3U A;  3SHL A;  4G57 A;  2PZW A;  1II3 A;  3MEH A;  3RUZ A;  1TR5 A;  1U9R A;  3D4D A;  4H7B A;  2F0E A;  1NSN S;  3NHH A;  3OMG A;  1EYA A;  5E1F A;  3MZ5 A;  3T13 A;  5KYL A;  1EY0 A;  4J1M A;  5C3W A;  5C5M A;  2EYH A;  1AEX A;  2F0J A;  4S3S A;  3PMF A;  4K8J A;  4WOR A;  5CV6 A;  1F2Y A;  1SND A;  2EYP A;  2RKS A;  5KIX A;  1EY8 A;  2F0P A;  4ZUI A;  1ENC A;  5DEH A;  5EKL A;  1IHZ A;  4KTA A;  3ERO A;  1JOO A;  2F3V A;  2OXP A;  4I65 A;  4DGZ A;  5I9O A;  4B9X A;  5CV5 A;  3D8G A;  4IUN A;  2OF1 A;  4RKB A;  5IGF A;  3E5S A;  5KYI A;  3OMC A;  4DF7 A;  3QB3 A;  4MIU A;  2EXZ A;  2F0O A;  2KHS A;  4LAA A;  1STB A;  1STN A;  2F0F A;  1STY A;  3OSO A;  4N9T A;  2EY1 A;  5DAU A;  4F8M A;  5J39 A;  2F0D A;  1STA A;  4PNY A;  1EY5 A;  1EY6 A;  2M00 A;  2EYM A;  4ID6 A;  2F0S A;  1TT2 A;  2PW7 A;  1RKN A;  3LX0 A;  4KD3 A;  5EKK A;  4EVO A;  4KHV A;  4TRD A;  1TQO A;  4ZUJ A;  2F0M A;  4K6D A;  1EZ6 A;  4K5X A;  1A3T A;  3DMU A;  4ME5 A;  2F0L A;  1SNP A;  2WAC A;  3ITP A;  2PQE A;  2PW5 A;  1SYF A;  1SYC A;  1SYD A;  1EY7 A;  3NQT A;  3NXW A;  4N9P A;  5CR3 A;  4NP5 A;  5C4Z A;  5C6A A;  5I9P A;  2EYO A;  3EJI A;  2RDF A;  5J22 A;  4WRD A;  1F2M A;  5EGT A;  3VA5 A;  2SNS A;  5C4H A;  5NUC A;  3QOL A;  3TP7 A;  1ENA A;  2HQE A;  4KY7 A;  4PMC A;  2F0K A;  5IGG A;  2ENB A;  3TP5 A;  1EQV A;  4J6H A;  3SXH A;  4K14 A;  1SYG A;  1SNM A;  4R8N A;  5IOD A;  5HGT A;  4K2K A;  4KY5 A;  1KDC A;  3U9O A;  5ISR A;  2F0W A;  3TP6 A;  3SR1 A;  5IOC A;  2PZU A;  1F2Z A;  2PYK A;  4OL7 A;  5CV4 A;  2EY6 A;  3ERQ A;  4DFA A;  5KGU A;  4EQP A;  3R3O A;  5CV8 A;  5I6Y A;  1EY4 A;  5IGE A;  1JOQ A;  2RBM A;  5CV9 A;  4F7X A;  3SK4 A;  3V2T A;  2F0I A;  2SOB A;  5HUR A;  3OWF A;  4E6I A;  5J1Z A;  1EYC A;  3C1F A;  5CC4 A;  5F2D A;  3T16 A;  1SYE A;  5K5P A;  3H6M A;  3TME A;  1A2U A;  4IAL A;  5I6W A;  3P75 A;  2F0Q A;  3MXP A;  5KEE A;  5JOB A;  5IGD A;  4KJN A;  4NKL A;  4QMG A;  3NUC A;  2SNM A;  2F0N A;  3D6C A;  4K2L A;  1SNC A;  4KY6 A;  2F0H A;  4K8I A;  3BDL A;  3TP8 A;  2F0V A; 
#chains in the Genus database with same CATH topology
 5IYD G;  1Y14 B;  1HNZ L;  1P8L A;  2F0T A;  3S1M H;  1U4M A;  3M85 A;  5C4J B;  1FL0 A;  2QW7 A;  5JVH 3;  4BS9 A;  3SK8 A;  3S15 H;  3PO3 B;  4A3B G;  3GO5 A;  3JAM i;  1PTO B;  3HKZ B;  1Q1B A;  2QDB A;  2KOL A;  1C48 A;  2WB1 G;  3GP7 A;  3VYT A;  1TWF H;  4DR1 L;  1HR0 Q;  1BOS A;  2DJG C;  4IZ8 A;  3HOX B;  3T53 B;  1TWC B;  3QO2 A;  1WTX A;  4R4I A;  5BN3 A;  2PMZ E;  1HUM A;  4LUO A;  3L7Z C;  2CW0 D;  1E1O A;  2MO1 A;  4HJ7 A;  5IP9 H;  4GLX A;  1GUT A;  5EPK A;  4FF2 A;  4QQB X;  4A3I H;  4XQQ A;  3LWE A;  4IUN A;  3Q8D A;  1LV9 A;  2QKI C;  2JSO A;  1RTN A;  1STB A;  1G6P A;  1I3Q H;  1QNK A;  3OSO A;  5DAU A;  3FDT A;  2JA5 H;  1QVC A;  3I4L A;  2ZM6 Q;  1BUV T;  4X3T A;  4KN7 C;  2NB0 A;  1JC7 A;  4A93 B;  2F4V L;  1AE2 A;  4QIW B;  4DR2 Q;  5C6A A;  3OW2 A;  1VQI A;  1R4Q B;  2Z6B A;  5J22 A;  4HCS A;  2Y0S G;  1IL8 A;  4QUF A;  1E7Z A;  1V1P B;  3MFY A;  3PV0 A;  1ZYR D;  1JB3 A;  1EQR A;  4GZY C;  2OTJ A;  3G4S A;  2KJX A;  3UDG A;  1CFM A;  1NR2 A;  4HSP A;  2D9U A;  2QGQ A;  4JI7 Q;  1E3P A;  2ZJR A;  2B2U C;  5M5X B;  4F7X A;  4ZLT F;  2AQ1 B;  3E9I A;  3UE1 A;  5JEA J;  4GNX B;  5ELB A;  1BBX C;  1HQM C;  2TSS A;  3J81 c;  1VQ5 A;  2ZJQ A;  1J6Q A;  4LK1 C;  3MXP A;  3KOJ A;  1LTG D;  2SEB D;  3A8I E;  3KLS A;  4B3S L;  2BA0 A;  4C2M B;  1HH2 P;  2HQL A;  4BY1 H;  1GM5 A;  3W2D A;  5EBC A;  4DU9 A;  1BDO A;  4LFB L;  3NP8 A;  1VMC A;  2CH4 A;  3F1Z A;  4YIJ A;  3T56 B;  3RN5 A;  5CGK A;  4A3E G;  4NXN Q;  2M2L A;  2RHQ B;  4IUQ A;  1V1Q A;  4KHZ A;  1PH7 A;  2QDL A;  4OXP A;  1S3O A;  4DK6 C;  5LL6 S;  4B9W A;  4JV5 Q;  2E2J B;  1B2T A;  4B3T L;  3BJU A;  4BY7 H;  1VQN A;  1EQT A;  2ALY B;  1VQG A;  2IY5 B;  1D1K A;  5JJK A;  1E2V A;  4JOI A;  4GNX A;  1HNW L;  2Y0S E;  1RCV D;  2A6H C;  4X64 L;  3L3O C;  1X3E A;  3MZ5 A;  4DA2 A;  4IUR A;  1IBM Q;  1EOV A;  2Z9H A;  5EQ0 A;  3K59 A;  1XMO Q;  2CWP A;  3I70 A;  2NTT A;  3LNN A;  4JI8 L;  4DAP A;  1XPU A;  2MGS A;  2R7Z G;  1HTL D;  2R3Z A;  4LF5 L;  4A3F B;  4FF1 A;  3I4N H;  5TSS A;  1KD1 C;  5M5W B;  3OTO Q;  4PZ8 A;  1XMQ L;  2VQE Q;  1FNV A;  4LF4 Q;  1I4Q A;  3FVQ A;  3ITP A;  4HJ5 A;  1PRT B;  1PFN A;  5I9P A;  1J8I A;  1JIC A;  3EJI A;  4RMF A;  3VA7 A;  3RZD B;  1Y8N B;  2NWG A;  1CKO A;  2ATW A;  2PNR C;  5IYC G;  2GN5 A;  4RCN A;  3C46 A;  3HKS A;  3WOF A;  2PI2 A;  3H0G H;  5IOD A;  2AQ2 B;  4O42 A;  2WB1 B;  4DNI A;  2EVB A;  2C35 B;  3KF6 B;  3Q0A A;  3B6Y A;  4JI3 L;  4ULL A;  5GAD C;  1YEZ A;  1LAB A;  2JQO A;  1CI3 M;  5JOB A;  2H4O A;  1IBK Q;  2CCZ A;  1K8O A;  1BBU A;  5KNC A;  3J80 c;  4FF4 A;  3GTG B;  4JW0 A;  2OCE A;  1KIX A;  1PRT D;  2DJF C;  2F3W A;  1NR4 A;  1SE2 A;  2K50 A;  4X62 Q;  3PIO A;  4O0A A;  4H13 C;  5KRU A;  1E24 A;  2J4X A;  5ELD A;  3H3V H;  3UDI A;  4G7H C;  4B3M L;  1CA5 A;  1SNQ A;  1E0B A;  3S1N B;  2NUC A;  1PFS A;  4V0B A;  1Y1W G;  4HTH A;  4A76 A;  3VR5 A;  3BDC A;  2CWA A;  3D4W A;  3D6W A;  3GV3 A;  3ONA B;  1SN8 A;  1CZG A;  1PTO F;  2EYL A;  3BDO A;  3CU7 A;  5M3M G;  5AJ3 L;  2UUB L;  1XPR A;  2PPB C;  2B2V C;  4XIG S;  3L0O A;  4YY3 L;  5IYB H;  4LF7 Q;  3N6R A;  4PMW A;  4J1M A;  2J0T D;  1Y1V G;  1S72 A;  1HZC A;  1ROD A;  1UAP A;  1T9H A;  1WTP A;  2RKS A;  1WTW A;  1S5D D;  3OIQ A;  2DNE A;  1JCK B;  4L5S A;  2DUD A;  5LL6 X;  2E74 C;  3K5L A;  3F2D A;  2JK8 A;  4A3L G;  3BZK A;  4KI0 A;  4UP8 A;  2CW0 C;  1CZW A;  1D1I A;  5IP7 G;  1LTR D;  4X3U A;  3OPO A;  2EYM A;  1TT2 A;  1RKN A;  2R93 G;  5EKK A;  4TKO B;  4YWM A;  3GTM H;  2R92 H;  3GTJ H;  2FMM A;  2EQS A;  2H5X A;  3NXW A;  2N49 A;  5K36 G;  2O5I C;  3T1H L;  4RH6 A;  5IT9 L;  2DN8 A;  2KEE A;  1BF4 A;  1X3P A;  3DEP A;  1MKH A;  3KJP A;  3CD6 A;  2B2W C;  3TS2 A;  1DYQ A;  4GKK L;  4DV0 Q;  1TWA H;  2B29 A;  3TP5 A;  1WYD A;  4A3E B;  3J81 E;  2G9D A;  2IT1 A;  3QG1 A;  2F0W A;  2YYZ A;  2PYK A;  4UDU C;  3ERQ A;  1CKN B;  1EWI A;  3Q23 A;  1WD1 A;  2NVX B;  2K28 A;  4LFC Q;  3I90 A;  2RBM A;  1OO9 B;  3VR6 A;  1EEI D;  1K8M A;  2I46 A;  4HIK A;  3T16 A;  1ZYR C;  3L9A X;  3NWT A;  4Y7N B;  5KEE A;  4K2L A;  4MIU A;  4LF9 Q;  4DUZ Q;  2JA6 H;  1Q46 A;  3NE5 B;  1S40 A;  2AHO B;  1S5F D;  3BG3 A;  1YIT A;  3CCE A;  4DR5 L;  1U5K A;  1J5E L;  1VQB A;  5D14 A;  4B08 A;  4YHH Q;  5CBA E;  1KAA A;  4L5T A;  2R7Z B;  3PSI A;  2CHB D;  4L63 B;  2K5N A;  3MAQ A;  2NBF A;  4UP7 A;  2UUC Q;  3GTQ B;  3E9H A;  2VUM G;  3M3Y B;  1X54 A;  3KLR A;  4DR7 L;  5CV7 A;  5I2Y A;  3HOZ H;  1BCP D;  4KN4 C;  1A3U A;  1CKN A;  3CQZ B;  1TR5 A;  5ELC A;  2MHV A;  3Q6S A;  2EYH A;  2GVB A;  1AEX A;  1XXG A;  3HFZ B;  3D3R A;  1B44 D;  2JEA I;  1EY8 A;  3HG9 A;  1ESF A;  1LTA D;  3VYU A;  1KHI A;  1LO5 D;  4JPB W;  3T1Y Q;  4IO9 A;  4DGZ A;  4I65 A;  4M8A A;  1UE6 A;  3S16 B;  4IN3 A;  4A3G H;  4DV6 L;  2L15 A;  1A6X A;  3AYH B;  4K0K Q;  1L1O B;  4ZKB B;  2HHH L;  1NMG A;  2ZXR A;  1RDP D;  2L1B A;  3IFT A;  4X3S A;  1KTK A;  4ID6 A;  4CJ2 C;  4KD3 A;  2PW7 A;  3LX0 A;  4KHV A;  2FJ2 A;  5AFW A;  4MTN A;  2RDG A;  4A3K H;  4QY7 A;  3KBX A;  4MN3 A;  2NN6 H;  4NP5 A;  3IKJ A;  4KMU C;  3K7U C;  3HOW G;  3A5U A;  4A3D H;  3HOY H;  2UXC Q;  4BBS H;  1GD7 A;  1PRT F;  4JI5 Q;  4R4Q A;  2JA8 G;  4JI0 Q;  4IOA A;  1SYG A;  3A54 A;  3MA2 B;  3S2D H;  1Y1W B;  3PIO 3;  1XNQ L;  1B50 A;  4HID A;  4U67 3;  2YU9 H;  3AB9 A;  4LMQ D;  1G91 A;  5C44 G;  1OXT A;  2O5J C;  1DD2 A;  3J80 E;  1FR3 A;  4LWC A;  2AWN A;  1FNW A;  5IWA Q;  3J7Z C;  3OWE B;  5J39 A;  2A6E C;  3OOC A;  4RGT A;  5M3M B;  4YCV A;  1LTT D;  4IAL A;  1PV4 A;  3S2H B;  1X32 A;  1L1O A;  3KJO A;  3I3C A;  1XJV A;  2B2U A;  5LHY 1;  4GOP C;  5COY A;  3DWQ A;  2EXD A;  1B70 B;  1Z9F A;  5IGC A;  1QIL A;  3OW7 A;  2ID0 A;  3ICE A;  1GHK A;  3CC4 A;  4IPH A;  1H9J A;  1JWS D;  1CT1 D;  4KHP L;  4JI1 L;  5BR8 L;  1JJ2 A;  4IQZ A;  1PH1 A;  1C7Y A;  5C5L A;  4L5R C;  2LSS A;  3M4O B;  4JI4 Q;  4A3C G;  5DLQ E;  3L2P A;  1DGS A;  4XQN A;  1V8Q A;  4ALP A;  5HY6 A;  4OX9 Q;  1S4Z A;  5GAG C;  2R93 B;  2CH4 W;  2A74 C;  3MEH A;  1RJT A;  1NJI C;  1L0Y B;  2F0E A;  5IP9 G;  4DV4 L;  3BVZ A;  3STB D;  2Z8L A;  4DR6 Q;  2VNU D;  3GTP H;  1QB5 D;  2HIX A;  4DR4 Q;  1SND A;  3CRL C;  1M1K C;  4A3I G;  1E1T A;  4LF6 Q;  2K14 A;  1T5E A;  3K5O A;  3F2C A;  4NW2 A;  2Z0S A;  1KNA A;  1SAP A;  3RLN A;  2JA5 G;  5FLX E;  2VXW A;  3SEB A;  1RF2 D;  1XTC D;  3CCV A;  5IOC A;  3EBE A;  2CKZ B;  3VYS A;  2K04 A;  3J7A 5;  4JG2 A;  3F2B A;  2AMC B;  4P74 A;  2KBN A;  4RCO A;  4ZUJ A;  1WTR A;  3JC6 6;  4K6D A;  5FO7 B;  1D6E C;  4DR3 Q;  3M4Q A;  1Z7T A;  1H9R A;  4QJF A;  4YCU A;  1YHQ A;  4IFD H;  3DLL A;  2YTY A;  1XWE A;  4AYB E;  4UPA A;  4OGQ C;  4A3J H;  1HR0 W;  4WRD A;  4XDX A;  1PYS B;  4XYQ A;  1CHP D;  2A8V A;  1MI2 A;  1WI5 A;  2SNS A;  3S14 H;  4IUT A;  1XNR Q;  4GLA C;  3V96 A;  1K0S A;  2FMC A;  4EX5 A;  2L0C A;  1H9K A;  1K83 H;  2IPK D;  1DOM A;  1O78 A;  3DUZ A;  4K2K A;  3U9O A;  3I4O A;  3J81 i;  4ZRZ A;  4R4C A;  2VUM B;  5FLX L;  2E2H B;  2RCN A;  5CC4 A;  4WJ4 A;  1G51 A;  2NVT B;  2XWB B;  1VMP A;  3W1G A;  1AFP A;  2GA4 B;  4DV7 Q;  1SBB B;  4L5Q A;  4DNR B;  1VQD A;  4BY1 G;  4PV1 C;  3BDL A;  3TP8 A;  3H3V C;  4HMJ A;  1R4P B;  1HNZ Q;  3AFQ A;  3D4R A;  4BXX H;  3DWA A;  1JOR A;  1UNS A;  2KQ3 A;  4C56 C;  4A4I A;  5COR A;  1OXV A;  1VQ4 A;  4X6A H;  5EAY A;  3EIV A;  4ODG A;  3I73 A;  1U0L A;  4BY7 G;  4DR1 Q;  3K0Y A;  4ABN A;  3NK9 A;  5C4J H;  2D2C C;  3PF5 A;  5C0X H;  1I6H H;  5T1I A;  1WTH A;  1CQV A;  2NVY B;  3AFP A;  1K8A C;  1HTP A;  5EBD A;  4CJ1 B;  2Q8T A;  3LGJ A;  1RTO A;  5KYL A;  3HOW B;  5C3W A;  4S3S A;  1MSH A;  2PCF B;  5FJ8 H;  2B2V A;  1LT6 D;  4ZUI A;  3HOX H;  2JA8 B;  1TWC H;  1Q1E A;  1BCP C;  1ILQ A;  1MHW C;  5C3E H;  5I9O A;  4C1N K;  5C44 B;  4HAE A;  3E5S A;  4Z9C B;  1JT8 A;  1AN8 A;  3KFU A;  1STN A;  1EIF A;  5LMN L;  1L0X B;  4C3H H;  2N88 A;  3S1M B;  1KRT A;  2F4V Q;  3H09 A;  2HDL A;  2Z6K C;  2KA7 A;  2MO0 A;  2NZH A;  1SYF A;  4OO1 I;  1NAP A;  5EJW A;  3S15 B;  3K5M A;  2ICE C;  1TXY A;  4DUY L;  1F2L A;  5NUC A;  1HZ9 A;  1PXU A;  2K05 A;  1SMY D;  1LT3 D;  3MXN B;  3IFD A;  5I4D A;  1TWF B;  2YTV A;  4RA8 A;  1WOC A;  5KND A;  3QWN A;  4ZKC B;  4OL7 A;  4LUZ A;  2EY6 A;  4HJ9 A;  1WJJ A;  1F9P A;  1OXU A;  1F77 A;  1ET9 A;  2F0I A;  2K52 A;  3J80 i;  3C1F A;  3U58 A;  5IT9 c;  4P72 A;  1A2U A;  3PCO B;  3D31 A;  1HR0 L;  4LW1 A;  1SDF A;  5D3D A;  3ND9 A;  3RR5 A;  4B3S Q;  4IJL A;  2QA4 A;  5BN5 A;  4A3I B;  2NTS A;  4LFB Q;  2MQH A;  3S1Q B;  5JAV A;  1K3B C;  1N36 L;  2ZTD A;  2JA5 B;  4HCE A;  4P73 A;  1YBY A;  5E3F A;  3H91 A;  3I56 A;  3MXN A;  5M9O A;  2MUY A;  4ZAI A;  5IYB G;  3C3L A;  4B3T Q;  1BNZ A;  4N8X 1;  4A75 A;  2H1E A;  3PF4 A;  1SEB D;  5E4X A;  3Q24 A;  2KCM A;  1LAC A;  2ES2 A;  4DN4 M;  4H7B A;  4HR7 B;  1PH9 A;  1QVF A;  1HNW Q;  4X64 Q;  1S5C D;  1EWH A;  2M9V A;  3CP0 A;  4EQ5 A;  1D5Z C;  2IJ0 A;  1TWG B;  3GTL B;  1V1P A;  4JI8 Q;  3KF8 B;  2Q2H A;  3HOU G;  1F9Q A;  1JOO A;  1CSQ A;  4ZCK A;  3PUW A;  4C3I H;  2R7D A;  3T4A C;  1PHJ A;  4B9X A;  1AH9 A;  1NTG A;  3STB C;  4IUU A;  2V4D A;  2IX3 A;  1IBL L;  2O2L D;  3I4M H;  5M3F G;  2KCC A;  5CBE E;  2L55 A;  1ML0 D;  2RVL A;  3BYY B;  1XMQ Q;  4PNY A;  5JVG 3;  2B8F A;  1Y69 U;  2PMZ B;  3R2I A;  1TQO A;  1KL9 A;  4WFN 3;  4K5X A;  1CK1 A;  3F2U A;  4BY1 B;  3CCU A;  5E4W C;  1Q3L A;  5IGF A;  1SYC A;  1SYD A;  2BOS A;  1YIJ A;  3CF5 A;  2EPB A;  4OO1 G;  4GOP B;  2EYO A;  2KCN A;  3FPP A;  4DV2 L;  4RAU C;  1F2M A;  4OWT B;  5C4H A;  1A0I A;  1F9R A;  1ENA A;  1V1O A;  2HQE A;  4LFA L;  5C4X H;  2G9H D;  4K14 A;  1N8R C;  1O7Y A;  1HNX Q;  4BBR H;  3G6J B;  1L0W A;  5IYD H;  3CAM A;  1XPO A;  4BY7 B;  1ILP A;  3OYY A;  3KF8 A;  2RHS B;  4CDD C;  1BO0 A;  3W3A A;  1JOQ A;  3ZYY X;  4JI3 Q;  5J1Z A;  1EYC A;  1SFO H;  1XX8 A;  4HN7 A;  3D0F A;  1LT4 D;  1M4V A;  3NPP A;  2JA6 G;  2I5H A;  2XRS D;  3P75 A;  3PUV A;  2XWJ B;  4KY6 A;  3JAM c;  2A6E D;  3TZU A;  3PUX A;  3MVV A;  2UXD Q;  2QEX A;  1EUJ A;  1SYB A;  4EQO A;  3P20 A;  3S17 H;  1LTB D;  2RF4 A;  4A3B B;  1N32 L;  5ELN A;  2F0U A;  2IHE A;  2Z4I A;  3OHX C;  4C3J H;  3M7G A;  4B3M Q;  2BH2 A;  2NVQ H;  4GOP A;  2EY2 A;  2K5W A;  3ER0 A;  1IBM L;  4A3M H;  4KKU A;  1XMO L;  1SSO A;  3HOZ G;  1O7I A;  1ZXT A;  1ASY A;  2KVM A;  3SK6 A;  3CC2 A;  4NDX A;  1D5M C;  1K9M C;  2AUJ D;  2LKV A;  2EY5 A;  1B9M A;  5AJ3 Q;  2UUB Q;  4ILW A;  2K32 A;  4TSS A;  3K0X A;  3SHL A;  4G57 A;  1II3 A;  1HA5 A;  1KLG D;  2QF7 A;  3S1N H;  3EA6 A;  5A2Q E;  1EYA A;  4JK1 C;  3OTO L;  2YTX A;  4P75 A;  2VQE L;  3PO3 G;  1HFG A;  2UUA Q;  3CC7 A;  1MJC A;  2EYP A;  1VDZ A;  2KED A;  5JEA H;  1ENC A;  1LTI D;  3K7A H;  4DV5 Q;  4A3G G;  4GLV B;  1AW7 A;  1N9W A;  2KEN A;  5ELE A;  1N33 Q;  4X65 L;  1DM0 B;  2WIN B;  2NYZ D;  5CYU A;  2JJQ A;  1I4X A;  2K1B A;  5KNB A;  4N9T A;  2EY1 A;  3KLS X;  1IL2 A;  4R4T A;  1ZEQ X;  3KF6 A;  1STA A;  3DXJ C;  4LJZ C;  2NN6 G;  3DWP A;  3VDY A;  5FO8 B;  2N78 A;  3UI2 A;  2Y0S B;  3P7J A;  3FKI G;  1WD0 A;  1K0R A;  4A3D G;  3HOY G;  4H44 C;  1E22 A;  3NQT A;  3T1H Q;  4BBS G;  5C4Z A;  1FJG L;  1ENF A;  2A68 D;  3KUP A;  5A2Q L;  5IY0 A;  1PFM A;  4IPD A;  5JJZ A;  4POG A;  5EGT A;  4GKK Q;  1IBK L;  3TP7 A;  4IJH A;  4HED A;  5T1G A;  4NXM L;  2D0P A;  1D8L A;  5CMD A;  1VQE A;  1OTC A;  1R9T B;  5HGT A;  1JJC B;  1OXX K;  1TWH H;  2MPM A;  2QCP X;  2MFI A;  4X62 L;  2ZXO A;  2A1A A;  3S9W A;  3OWF A;  5GQO A;  3G48 A;  3TDQ A;  2K5H A;  2QIL A;  1Z6H A;  3H6M A;  2ZTC A;  2EJF C;  4A3E H;  1SMY C;  5E7N A;  2VQF Q;  5IGD A;  3PO2 G;  3WDN A;  4X66 Q;  2XNA C;  1TS3 A;  2BDO A;  3MHB A;  4RHS A;  1HXY D;  1Q82 C;  3BU2 A;  3U4Z A;  4AIM A;  5ELO A;  1J5E Q;  4JC0 A;  2IX0 A;  3HOU B;  1KAW A;  1TU2 B;  2O4X A;  4Y7N H;  1PVO A;  1BCP B;  4NB3 A;  4WJW A;  1A63 A;  4K6L A;  4IPG A;  1EYD A;  1EFW A;  1YJW A;  4JBM A;  5M3F B;  2WII B;  3HOV H;  3I8Z A;  4DR7 Q;  1LUZ A;  2DY7 A;  1DJR D;  2A5H A;  3ERS X;  2IHF A;  1X56 A;  1EQQ A;  1GUG A;  2F3I A;  1Y8P B;  4UAI A;  2JP1 A;  2RCF A;  5GAH C;  3GTQ H;  1BVS A;  1B3A A;  1EY0 A;  1MJE A;  4C1N I;  1F2Y A;  1SE8 A;  1X9N A;  4P2C B;  1LT5 D;  1MIU A;  1KNE A;  3CQZ H;  3J81 L;  1PZI D;  1Q81 C;  4DXG A;  2R6G A;  1HUN A;  4DV6 Q;  5M5Y B;  1Q86 C;  4DV0 L;  2ZTE A;  2HHH Q;  4CHT B;  4LAA A;  4B3R Q;  1I4G A;  1Q8I A;  1VS0 A;  3K80 C;  4DV3 L;  2JA6 B;  4IFD G;  2I5L X;  1B9N A;  4TRD A;  1Q90 A;  2F0M A;  1A3T A;  3HP3 A;  4FO2 A;  5A35 A;  4N9P A;  3FMC A;  4O1N A;  1GKH A;  1RIP A;  3FHW A;  3QOL A;  2Z6K A;  2F52 A;  4H0L C;  1XNQ Q;  3MWY W;  4MZ9 A;  1B3Q A;  4DK1 A;  3IRB A;  3HOZ B;  1K8G A;  1PZK D;  2UXB L;  5I6Y A;  1EOT A;  2XVS A;  5JPM C;  2XSC A;  1QUQ B;  2B2T C;  4OIK A;  4JYA L;  2HCC A;  1BQQ T;  2A69 D;  4KK7 A;  4JOI C;  4CDC C;  5I6W A;  4BXX G;  1I4H A;  2SNM A;  2F0N A;  4KY7 A;  2F0V A;  4J6H A;  1A15 A;  2KHJ A;  1SRU A;  1IZ6 A;  2B63 G;  2L11 A;  4KHP Q;  4JI1 Q;  1NCV A;  4MTK A;  4A3G B;  1IKM A;  4RHR A;  1JOK A;  3M7N A;  4NMZ A;  3S2H H;  1PH5 A;  1EYG A;  5C0X G;  4QF4 A;  1UWV A;  1U4R A;  4LF8 L;  3GTO H;  2N8N A;  1YJ9 A;  1WTV A;  2PO4 A;  3RZO H;  3KYH C;  1SR3 A;  3U4V A;  4JI6 L;  2LFN A;  1YNX A;  1Y1V B;  2PZW A;  3FKI B;  4K0K L;  3M4O H;  4AYB G;  4DV4 Q;  3HOY B;  4A3D B;  3BZD B;  4BBS B;  3A74 A;  5FJ8 G;  4A3L H;  3GDE A;  1J9O A;  1UE5 A;  2Q2T A;  3TS0 A;  1DOL A;  2AKW B;  4TVA B;  1WFQ A;  5IP7 H;  2F0J A;  3S2D B;  5C3E G;  2YU9 B;  3A56 A;  4Q0F A;  4O2D A;  4GKJ L;  2WKC A;  2JE6 I;  4AQY Q;  3J80 L;  1B7Y B;  4JI5 L;  3ND8 A;  4RGO S;  3QB3 A;  4C3H G;  1VQK A;  3O13 A;  1XYI A;  3DM3 A;  2EE1 A;  1SMX A;  4JI0 L;  1BKB A;  4APV A;  4OWX B;  1IW7 D;  3J7A F;  2HT1 A;  4M1U B;  4EVO A;  4BA2 I;  1EZ6 A;  3PO2 B;  4R1J A;  1QG7 A;  1AZP A;  1VF7 A;  2RDF A;  2VL6 A;  4HJ8 A;  1UE1 A;  3DEO A;  3W1B A;  2XIW A;  1WCM H;  1Q12 A;  3A8J E;  3TQY A;  4DK3 C;  1KDC A;  4DAY B;  5ELF A;  2B8G A;  3CCM A;  2LXK A;  2LS0 1;  2UU9 Q;  3BZC A;  2A68 C;  1EU4 A;  3GTK H;  5LMU Q;  5IGE A;  3S24 A;  1JWM D;  4PQX A;  3GTP B;  1N34 L;  1EL0 A;  1VQ8 A;  2EZV A;  2CQA A;  2F0Q A;  2B39 A;  2XRQ D;  4DV7 L;  4KJN A;  4YWK A;  3HRZ C;  1I50 B;  4PMB A;  2E5L Q;  2AQ3 B;  2BE5 D;  2JA9 A;  3HZX A;  1E2Z A;  1GHJ A;  2LMC B;  3EVQ A;  5GRO A;  1KXL A;  3E0J A;  4DV1 Q;  3HEJ A;  1PLF A;  1X55 A;  5I2X A;  4DR4 L;  4KJO A;  1ET6 A;  4KD4 A;  1DZ1 A;  4POF A;  1KDB A;  4ZQ3 A;  2MP1 A;  4RWS C;  2A73 B;  1BCP F;  1P16 A;  1HCZ A;  4DAY A;  3WWV A;  4FXK C;  1C4Q A;  4DKA C;  4MHE A;  5GAE C;  3IAY A;  3VR3 A;  3BS1 A;  2JA7 H;  4XYO A;  3H3V I;  3RUZ A;  3NQI A;  4ZYS A;  1Z47 A;  1AZQ A;  1U9R A;  3GV6 A;  3TBI B;  3S14 B;  1NSN S;  3ULL A;  1U4P A;  1BR9 A;  2K5V A;  1I5F A;  4XXE A;  3I91 A;  4QIW E;  4DR3 L;  4C3I G;  4GN5 A;  1NBW A;  1NY4 A;  3I4M G;  2F3V A;  4RGN A;  3BYT B;  1XNR L;  3TZD A;  1X65 A;  1BBW A;  3FP9 A;  3OIP A;  4IUP A;  5G3L D;  3PO3 H;  2SDF A;  4R4O A;  1EY5 A;  1PTO H;  4OIJ A;  4DPG A;  3AEV A;  4V19 0;  1I94 L;  2YV5 A;  3PIP A;  3UE0 A;  1LTS D;  2WAC A;  1GO3 E;  5C44 H;  4KKS A;  5C4X G;  3H94 A;  2B63 B;  1TY2 A;  2LXJ A;  4DUY Q;  1FD7 D;  1K28 A;  3E3X A;  1PH4 A;  3I4N G;  4BBR G;  2DY8 A;  2WKD A;  4CKE A;  4JI2 L;  3U9S A;  3QIA A;  1DXM A;  3CME A;  3S1R B;  2E2I B;  5HGQ A;  1PYW D;  2Q2I A;  1CKM A;  4IUV A;  5FLM H;  1I6H B;  2E2D C;  3R3O A;  1TY0 A;  5EKI A;  1EY4 A;  2KCT A;  1YJN A;  5HUR A;  4E6I A;  1U4L A;  1EIG A;  2FFK B;  1H95 A;  2E76 C;  4Y52 H;  3Q22 A;  2Z1C A;  1L2F A;  4AYB B;  2L4N A;  4A3C H;  3H0G G;  3D6C A;  3NHH A;  2J7Z A;  1CSP A;  4OON A;  1HRJ A;  1ASZ A;  2HD3 A;  3GQB A;  4C3J G;  3NWS A;  4JCV E;  4N8F A;  5C3E B;  4HSV A;  1MGS A;  1KC8 C;  2C9O A;  4A3M G;  4A93 H;  1C0A A;  2FHT A;  2IWH A;  1CTM A;  1STG A;  2EJG C;  2NZO A;  2PI2 E;  1N36 Q;  4GN3 B;  1A3V A;  1CHQ D;  2A69 C;  2B2W A;  1WVL A;  1JE4 A;  1KDA A;  1AP0 A;  3V05 A;  4HMI A;  4EGV A;  3CCQ A;  1XTD A;  2EDG A;  4C3H B;  3SVM A;  3MEF A;  2Z4H A;  3F8T A;  1F9S A;  1SJE D;  4FP5 D;  3S1Q H;  3HS0 C;  4R9W A;  1DCZ A;  4RGM A;  3A0J A;  1PTO D;  5M5X H;  2HDM A;  1QVG A;  5DM6 3;  5IE8 A;  3G6E A;  1VQJ A;  3N52 A;  5JEA G;  4JVZ A;  3NEN A;  5JPN C;  1EFI D;  3PMF A;  1I3Q B;  4K8J A;  1PZJ D;  1VQF A;  2BCO A;  2X69 A;  1ICW A;  4FXG C;  2OXP A;  4C2M H;  3G71 A;  5FO9 B;  2X6L A;  1IBL Q;  5FK9 C;  3DM1 A;  3EFX D;  4JBK A;  1PYB A;  3GTL H;  1TWG H;  3AMU A;  2F0D A;  2WB1 E;  3WOE A;  4DAV A;  1TS4 A;  1L1O C;  1EY6 A;  2M00 A;  2RSN A;  1FGU A;  2ZM6 L;  4RFB A;  5JJL A;  1QCB D;  2N55 A;  2L5T A;  1PDQ A;  4ME5 A;  2F0L A;  1SNP A;  2AUK A;  2E2J H;  2PW5 A;  2R7F A;  1PA6 A;  4DV2 Q;  1GUN A;  1SXT A;  4DR2 L;  2FIN B;  2K5Q A;  2ICI A;  4LFA Q;  3TEH B;  4LF5 Q;  4LNQ A;  1IW7 C;  1EQV A;  1PH6 A;  4CJ0 B;  1QNU A;  1I6V C;  2JXM B;  2L9H A;  2R92 G;  1UE7 A;  2NN6 I;  4DFA A;  3MFG A;  4EQP A;  1IKL A;  4JI7 L;  1LM0 A;  1T5X D;  3J7A V;  3K81 C;  2I5M X;  1CQF A;  4OWW B;  5F2D A;  5L37 A;  1WTQ A;  1PMR A;  1SYE A;  4A3F H;  3NEL A;  3KDF B;  1NE3 A;  3X3M A;  2RQX A;  1X6O A;  1SNC A;  3LWU A;  2IX1 A;  5M5W H;  2A19 A;  2CVR A;  2B2T A;  4K5W A;  1EY9 A;  4KV6 A;  3T51 B;  1IYJ B;  1N32 Q;  4K5V A;  2E75 C;  4C3I B;  4G7Z C;  2VZA A;  1AE3 A;  1TVX A;  3RLF A;  3NBH B;  1GVP A;  3NTI A;  3MXG A;  3I4M B;  2VY3 A;  5IGB A;  3HOV G;  1B4O A;  4IOC A;  2F0G A;  3P1H A;  4NXN L;  3RZD H;  2OT2 A;  2OTL A;  2B3G A;  3QJY A;  4QB4 A;  2BE5 C;  4J15 A;  4HJA A;  4A3B H;  1GJX A;  3H15 A;  4FXD A;  4JV5 L;  3TSS A;  5G3L F;  4OEL B;  1QZG A;  4RG1 A;  4KKT A;  4JBW A;  4TQU S;  5FKA C;  1YNN D;  3URY A;  5C4X B;  2ZJP A;  2WV6 D;  3PIP 3;  5E1F A;  3NTK A;  1YHB A;  4UY8 C;  3KDF A;  3I4N B;  4BBR B;  1QE6 A;  5EPJ A;  1JMC A;  2NZ1 D;  3NBI A;  3GTG H;  3NEM A;  3PUY A;  1GUW A;  4KTA A;  3ERO A;  1YNJ D;  4PZ6 A;  4FYD A;  2LY7 A;  4X65 Q;  4YCW A;  4OHJ A;  1SFO B;  1K3R A;  4XT3 B;  4CGY B;  3NBH A;  3ULP A;  4DF7 A;  2I0Q A;  2F03 A;  1UEB A;  4YY3 Q;  3TRE A;  1HNX L;  2PNH A;  1I4R A;  2EJM A;  2F0S A;  1FGB D;  3FRP B;  3K57 A;  5BN4 A;  1VQM A;  1VQ6 A;  3S17 B;  1X3G A;  1G6Z A;  3H0G B;  3DMU A;  4IPC A;  1KQS A;  4LF4 L;  1LLR D;  1EIH A;  2CFM A;  1KRS A;  2PQE A;  1FJG Q;  1TKW B;  5CR3 A;  1EY7 A;  2K5D A;  2KEC A;  4C3J B;  4XQJ A;  1WTO A;  2NVQ B;  1EIY B;  2B2Y C;  4J8Q A;  4A3M B;  1ICF B;  2VW9 A;  4FDB A;  4AH6 A;  1HQR D;  1MBY A;  4NXM Q;  2UXD L;  4CDE C;  1PH3 A;  1O7L A;  3CCR A;  3UDF A;  2DNC A;  2DGY A;  2K33 A;  1F2Z A;  4IFD I;  1VCI A;  4A3K G;  5CV8 A;  3E6Z X;  1DOK A;  1C9O A;  1C8C A;  1HPC A;  3MC0 B;  2TMP A;  2VB2 X;  1R9T H;  1VQC A;  3NUC A;  3J7Y W;  3EQL C;  4DK0 A;  3K7A B;  1GUO A;  4L6T B;  4QGU A;  2OEO A;  3J81 j;  5IT9 E;  2K75 A;  1ONL A;  1YHA A;  1GXD C;  1ESR A;  1W2B A;  4QCL A;  3SGI A;  4DNT B;  3A7L A;  3CW2 C;  5C3X A;  2UUA L;  1PFB A;  4UHV A;  3EN2 A;  3VR2 A;  1HJP A;  2MJ8 A;  4F88 A;  1STH A;  3A7A B;  3I72 A;  5IIF A;  2RA4 A;  4DV5 L;  1SNO A;  2D0O A;  2F4I A;  2ZT9 C;  1N33 L;  1KAB A;  2WP8 J;  3HOU H;  1IYV A;  2ZXP A;  1GOZ A;  2NVX H;  1NMF A;  2OQ0 A;  3CPW A;  4DR5 Q;  1TS5 A;  1SJH D;  5M3F H;  4LF7 L;  5FLX c;  3T13 A;  3FPU B;  5C5M A;  5CV6 A;  1V43 A;  1TWH B;  4WOR A;  4PZ7 A;  5DM7 3;  1S5E D;  1FYC A;  5KIX A;  2F0P A;  1M8A A;  2F1M A;  3SE0 A;  5EKL A;  5C0X I;  2QEJ C;  2XTI A;  2C5C A;  3GTM B;  1EU3 A;  2CQO A;  2P5Z X;  4U68 A;  5FOB B;  2R92 B;  1PTO C;  1O7Z A;  4FNF A;  3GTJ B;  3PQI A;  4H02 A;  5CV5 A;  4OO1 H;  5KYI A;  3OMC A;  1K73 C;  1HZA A;  5EPL A;  2F0O A;  2R7Z H;  2G5D A;  3RNU A;  4DV3 Q;  4GN4 B;  1RHP A;  1JJG A;  3TRZ A;  1TWA B;  3M3Y H;  1BXT A;  4L8J A;  4DXF A;  1A8V A;  5M5Y H;  4HIM A;  1WCM G;  1YVC A;  3K5N A;  4G7O C;  4F87 A;  2E8G A;  4NPS A;  1W3S A;  2VQF L;  3VA5 A;  1EWC A;  3CPF A;  4X66 L;  3HOV B;  2ENB A;  3RLO A;  3SXH A;  1QZH A;  1SNM A;  2VS1 A;  3AQQ A;  4KY5 A;  2MNA A;  2XGT A;  2PZU A;  2IL8 A;  5IYC H;  2UXB Q;  1VQP A;  4LFC L;  5CV9 A;  3VR4 A;  4A3J G;  3SK4 A;  4JYA Q;  1H9S B;  1V9P A;  2SOB A;  1RD9 D;  3RN2 A;  3S16 H;  3ULJ A;  1TII D;  2FXQ A;  3AU7 A;  2WAQ G;  4BA1 I;  1JQY D;  3R8B A;  1W6J A;  1I4P A;  1VQO A;  4LF9 L;  4DUZ L;  1JB7 A;  1DON A;  2EYJ A;  4CKC A;  3HGB A;  3I2Z A;  4RKL A;  2PZT A;  4YHH L;  3JAM E;  2PQA B;  2EYF A;  3C1E A;  3SK5 A;  4IFD J;  3C2P A;  1SLJ A;  2OQK A;  4QL5 A;  1VQL A;  1JR0 D;  1SRO A;  2OWO A;  2JA7 G;  3CCL A;  4LF8 Q;  1VQA A;  2R61 A;  2UUC L;  4GNX C;  1Y1W H;  3I7F A;  4JI6 Q;  3X3N A;  1IYU A;  2WFW A;  2V1C C;  4I7A A;  2L12 A;  3A8K E;  1LTL A;  3D4D A;  4B3R L;  4PG3 A;  1H9S A;  1NNX A;  5BR8 Q;  3MXU A;  5M3M H;  4ZK9 B;  2AWO A;  3CRK C;  3GD7 A;  2I07 B;  4CBV A;  4OEM B;  4GKJ Q;  1IHZ A;  1KLU D;  5D65 A;  1PH8 A;  4KLK A;  1Y1V H;  3FKI H;  2K01 A;  1TS2 A;  4FVM A;  4LUV A;  1LYL A;  2VB3 X;  3M9B A;  3T1Y L;  1B8A A;  1YNN C;  4A3K B;  3D8G A;  3JAM L;  2OF1 A;  4RKB A;  4WJ3 M;  1YI2 A;  1QOH A;  3HKZ G;  4XT1 B;  1YZ6 A;  5JJI A;  3NTH A;  3A5Z B;  2F0F A;  1STY A;  3BVM A;  1SE4 A;  2PQA A;  1VQ7 A;  3I55 A;  4UP9 A;  4CDF C;  2RDH A;  2WAQ E;  1QUQ A;  3HOX G;  1YNJ C;  3G7L A;  1HZB A;  1JE5 A;  1Y8O B;  2R93 H;  2K4K A;  1M90 C;  3CKI B;  3R2T A;  5C0X J;  5FLM G;  2UXC L;  5K36 H;  4PMC A;  2F0K A;  4GS3 A;  1B53 A;  4R8N A;  3GTO B;  1GUS A;  3PO2 H;  1UUP A;  3TP6 A;  5H1S E;  3RZO B;  5CV4 A;  4Q5V A;  3FEW X;  2BDN A;  1G29 1;  1MD2 D;  1STE A;  1N34 Q;  5IWA L;  1FNU A;  1HHV A;  1E2W A;  3CCJ A;  5J3B A;  1PRT C;  2HCI A;  4NKL A;  4QMG A;  2KHI A;  3BVG A;  4QUC A;  3MTS A;  4A93 G;  1A2T A;  2N3S A;  4JBJ A;  3KK7 A;  1NUC A;  5LMN W;  4XTC S;  1D7Q A;  1D5X C;  4CKB A;  3ZJY C;  1EZ8 A;  4BWG B;  2HIV A;  2K6A A;  2JEB I;  3KLW A;  1CUK A;  3QOJ A;  1OXS C;  1I50 H;  3HKZ E;  4JI4 L;  2A6H D;  2JYO A;  2JN4 A;  1H9M A;  2KUM A;  3CHB D;  1CM9 A;  1MSG A;  2ASB A;  1QWY A;  3DHQ A;  4AQY L;  4EQN A;  4OX9 L;  2Q8I B;  3M4Y A;  2VUM H;  3CMA A;  3RMH A;  4HIO A;  1G2S A;  2E2H H;  3OMG A;  1WCM B;  2NVT H;  2X6G A;  4DR6 L;  3KBG A;  1G2T A;  2K03 A;  3K8A A;  3IL8 A;  1CA6 A;  1D2B A;  1Q7Y C;  1PH2 A;  4LF6 L;  3W5O A;  3GTK B;  2IW3 A;  3UDX A;  3PGZ A;  1S5B D;  1Q8K A;  1X3Q A;  3RD4 A;  1W6K A;  2EXZ A;  3A55 A;  4A3J B;  2KHS A;  1HA6 A;  3CCS A;  3QR8 A;  4F8M A;  1IXR A;  4P71 A;  1RL2 A;  2EIF A;  4X3K A;  1A62 A;  2HUG A;  1I94 Q;  1VF5 C;  4ME3 A;  2WAQ B;  2UU9 L;  1K83 B;  2BH8 A;  4YWL A;  5LMU L;  4I7Z C;  3E0E A;  1SE3 A;  1HFN A;  5ISR A;  2Q8R E;  2D62 A;  1EEF D;  4G4K A;  1FVI A;  2NVY H;  3SDZ A;  3M4P A;  1B1Z A;  3NSW A;  5DNF A;  4JI2 Q;  3TN2 A;  3CXC A;  4DAM A;  5IGG A;  4R8I A;  2E5L L;  1O80 A;  3R93 A;  2Q2U A;  3HOW H;  3VYR A;  1VQH A;  1X3F A;  3PUZ A;  3SR1 A;  2B2Y A;  5LMN Q;  3K58 A;  5D3I B;  5KGU A;  2JA8 H;  2JA7 B;  2BA1 A;  2XN9 C;  4A3F G;  2B63 H;  3K6O A;  1UEA B;  1ZKO A;  4DV1 L;  1JWU D;  2RSO A;  1G8Z D;  3V2T A;  2K7V A;  3U50 C;  1VQ9 A;  2GVA A;  5K5P A;  4MNO A;  3TME A;  3S1R H;  1QJO A;  2EOT A;  2E2I H;  4FF3 A;  2D5D A;  5DEH A;  2F0H A;  4K8I A; 
#chains in the Genus database with same CATH homology
 2F0T A;  1U4M A;  3M85 A;  5C4J B;  5JVH 3;  4BS9 A;  3SK8 A;  3PO3 B;  3GO5 A;  1PTO B;  3HKZ B;  1Q1B A;  2QDB A;  2KOL A;  1C48 A;  3GP7 A;  3VYT A;  1BOS A;  4IZ8 A;  3HOX B;  3T53 B;  1TWC B;  3QO2 A;  1WTX A;  5BN3 A;  1HUM A;  3L7Z C;  2CW0 D;  1GUT A;  5EPK A;  4FF2 A;  4XQQ A;  3LWE A;  4IUN A;  1LV9 A;  2QKI C;  2JSO A;  1RTN A;  1STB A;  1QNK A;  3OSO A;  5DAU A;  3FDT A;  3I4L A;  1BUV T;  4X3T A;  4KN7 C;  2NB0 A;  1JC7 A;  4A93 B;  4QIW B;  5C6A A;  1R4Q B;  5J22 A;  4HCS A;  1IL8 A;  4QUF A;  1V1P B;  3MFY A;  3PV0 A;  1ZYR D;  1JB3 A;  4GZY C;  2KJX A;  1CFM A;  1NR2 A;  4HSP A;  2D9U A;  2B2U C;  5M5X B;  4F7X A;  4ZLT F;  2AQ1 B;  5JEA J;  5ELB A;  1BBX C;  1HQM C;  2TSS A;  4LK1 C;  3MXP A;  1LTG D;  2SEB D;  3A8I E;  3KLS A;  2BA0 A;  4C2M B;  3W2D A;  5EBC A;  4DU9 A;  1BDO A;  3NP8 A;  1VMC A;  3T56 B;  4YIJ A;  5CGK A;  2M2L A;  4IUQ A;  4KHZ A;  5LL6 S;  4B9W A;  2E2J B;  1B2T A;  1EQT A;  1D1K A;  1E2V A;  1RCV D;  2A6H C;  3L3O C;  3MZ5 A;  4DA2 A;  4IUR A;  5EQ0 A;  3K59 A;  3I70 A;  2NTT A;  3LNN A;  4DAP A;  2MGS A;  1HTL D;  2R3Z A;  4A3F B;  4FF1 A;  5TSS A;  5M5W B;  1FNV A;  1I4Q A;  3FVQ A;  3ITP A;  1PRT B;  1PFN A;  5I9P A;  1J8I A;  1JIC A;  3EJI A;  3VA7 A;  3RZD B;  1Y8N B;  2NWG A;  2PNR C;  4RCN A;  3C46 A;  3WOF A;  5IOD A;  2AQ2 B;  4O42 A;  2WB1 B;  2EVB A;  3Q0A A;  4ULL A;  1LAB A;  1CI3 M;  5JOB A;  2H4O A;  1K8O A;  5KNC A;  4FF4 A;  3GTG B;  1PRT D;  2F3W A;  1NR4 A;  1SE2 A;  4H13 C;  5KRU A;  2J4X A;  5ELD A;  4G7H C;  1CA5 A;  1SNQ A;  1E0B A;  3S1N B;  2NUC A;  4V0B A;  4HTH A;  3VR5 A;  3BDC A;  3D6W A;  3D4W A;  3GV3 A;  3ONA B;  1CZG A;  1PTO F;  2EYL A;  3BDO A;  3CU7 A;  2PPB C;  2B2V C;  4XIG S;  3N6R A;  4PMW A;  4J1M A;  2J0T D;  1ROD A;  1UAP A;  1WTP A;  2RKS A;  1WTW A;  1S5D D;  3OIQ A;  2DNE A;  1JCK B;  5LL6 X;  2E74 C;  3K5L A;  4KI0 A;  2CW0 C;  1CZW A;  1D1I A;  1LTR D;  4X3U A;  3OPO A;  2EYM A;  1TT2 A;  1RKN A;  5EKK A;  4TKO B;  2FMM A;  3NXW A;  5K36 G;  2O5I C;  4RH6 A;  5IT9 L;  2DN8 A;  2KEE A;  1BF4 A;  1X3P A;  3DEP A;  2B2W C;  1DYQ A;  3TP5 A;  4A3E B;  3J81 E;  2G9D A;  2IT1 A;  3QG1 A;  2F0W A;  2YYZ A;  2PYK A;  4UDU C;  3ERQ A;  3Q23 A;  1WD1 A;  2NVX B;  2K28 A;  3I90 A;  2RBM A;  1OO9 B;  3VR6 A;  1EEI D;  1K8M A;  2I46 A;  3T16 A;  1ZYR C;  3L9A X;  3NWT A;  4Y7N B;  5KEE A;  4K2L A;  4MIU A;  3NE5 B;  1S5F D;  3BG3 A;  5D14 A;  4B08 A;  5CBA E;  1KAA A;  2R7Z B;  2CHB D;  4L63 B;  3MAQ A;  2NBF A;  3GTQ B;  3M3Y B;  3KLR A;  5CV7 A;  5I2Y A;  1BCP D;  4KN4 C;  1A3U A;  3CQZ B;  1TR5 A;  5ELC A;  2MHV A;  3Q6S A;  2EYH A;  1AEX A;  1XXG A;  3D3R A;  1B44 D;  2JEA I;  1EY8 A;  3HG9 A;  1ESF A;  1LTA D;  3VYU A;  1LO5 D;  4DGZ A;  4I65 A;  4M8A A;  3S16 B;  4IN3 A;  1A6X A;  4ZKB B;  2ZXR A;  1RDP D;  2L1B A;  3IFT A;  4X3S A;  1KTK A;  4ID6 A;  4CJ2 C;  4KD3 A;  2PW7 A;  3LX0 A;  4KHV A;  2FJ2 A;  5AFW A;  2RDG A;  3KBX A;  4MN3 A;  2NN6 H;  4NP5 A;  3IKJ A;  4KMU C;  1PRT F;  1SYG A;  3A54 A;  3MA2 B;  1B50 A;  1Y1W B;  3PIO 3;  4U67 3;  3AB9 A;  4LMQ D;  1G91 A;  1OXT A;  2O5J C;  1DD2 A;  3J80 E;  1FR3 A;  2AWN A;  1FNW A;  3OWE B;  5J39 A;  2A6E C;  3OOC A;  4RGT A;  5M3M B;  1LTT D;  4IAL A;  3S2H B;  1X32 A;  3I3C A;  2B2U A;  5LHY 1;  5COY A;  3DWQ A;  5IGC A;  1QIL A;  3OW7 A;  2ID0 A;  1GHK A;  1H9J A;  1JWS D;  1CT1 D;  4IQZ A;  5C5L A;  3M4O B;  4XQN A;  1V8Q A;  1S4Z A;  2R93 B;  2A74 C;  3MEH A;  1RJT A;  1L0Y B;  2F0E A;  3BVZ A;  2VNU D;  2Z8L A;  1QB5 D;  1SND A;  3CRL C;  1T5E A;  3K5O A;  4NW2 A;  1KNA A;  1SAP A;  5FLX E;  2VXW A;  3SEB A;  1RF2 D;  1XTC D;  5IOC A;  3VYS A;  2K04 A;  4RCO A;  4ZUJ A;  1WTR A;  4K6D A;  5FO7 B;  1D6E C;  1Z7T A;  1H9R A;  4IFD H;  1XWE A;  4OGQ C;  4WRD A;  4XDX A;  4XYQ A;  1CHP D;  1MI2 A;  2SNS A;  4IUT A;  3V96 A;  2FMC A;  2L0C A;  1H9K A;  2IPK D;  1DOM A;  1O78 A;  3DUZ A;  4K2K A;  3U9O A;  4ZRZ A;  2VUM B;  5FLX L;  2E2H B;  5CC4 A;  2NVT B;  2XWB B;  1VMP A;  1AFP A;  2GA4 B;  1SBB B;  4DNR B;  4PV1 C;  3BDL A;  3TP8 A;  3H3V C;  4HMJ A;  1R4P B;  3D4R A;  3DWA A;  1JOR A;  1UNS A;  2KQ3 A;  4C56 C;  5COR A;  1OXV A;  4ODG A;  3I73 A;  3K0Y A;  4ABN A;  3NK9 A;  2D2C C;  5C0X H;  5T1I A;  1CQV A;  2NVY B;  1HTP A;  5EBD A;  4CJ1 B;  2Q8T A;  1RTO A;  5KYL A;  3HOW B;  5C3W A;  4S3S A;  1MSH A;  2PCF B;  2B2V A;  1LT6 D;  4ZUI A;  2JA8 B;  1Q1E A;  1BCP C;  1ILQ A;  5I9O A;  4C1N K;  5C44 B;  4HAE A;  3E5S A;  4Z9C B;  1AN8 A;  1STN A;  1L0X B;  2N88 A;  3S1M B;  3H09 A;  2HDL A;  2KA7 A;  1SYF A;  4OO1 I;  1NAP A;  5EJW A;  3S15 B;  3K5M A;  2ICE C;  1F2L A;  5NUC A;  1PXU A;  2K05 A;  1SMY D;  1LT3 D;  3IFD A;  5I4D A;  1TWF B;  4RA8 A;  5KND A;  3QWN A;  4ZKC B;  4OL7 A;  2EY6 A;  1F9P A;  1OXU A;  1F77 A;  1ET9 A;  2F0I A;  3C1F A;  1A2U A;  3D31 A;  1SDF A;  5D3D A;  3ND9 A;  5BN5 A;  4A3I B;  2NTS A;  3S1Q B;  5JAV A;  2JA5 B;  4HCE A;  5E3F A;  3H91 A;  3MXN A;  5M9O A;  2MUY A;  4ZAI A;  3C3L A;  1BNZ A;  2H1E A;  1SEB D;  5E4X A;  3Q24 A;  1LAC A;  4DN4 M;  4H7B A;  4HR7 B;  1S5C D;  1EWH A;  2M9V A;  1D5Z C;  2IJ0 A;  1TWG B;  3GTL B;  1V1P A;  1F9Q A;  1JOO A;  3PUW A;  3T4A C;  4B9X A;  4IUU A;  2V4D A;  2IX3 A;  2O2L D;  2KCC A;  5CBE E;  2L55 A;  1ML0 D;  2RVL A;  3BYY B;  4PNY A;  5JVG 3;  2B8F A;  1Y69 U;  2PMZ B;  3R2I A;  1TQO A;  4WFN 3;  4K5X A;  1CK1 A;  3F2U A;  4BY1 B;  5E4W C;  1Q3L A;  5IGF A;  1SYC A;  1SYD A;  2BOS A;  2EPB A;  4OO1 G;  2EYO A;  2KCN A;  3FPP A;  4RAU C;  1F2M A;  5C4H A;  1F9R A;  1ENA A;  1V1O A;  2HQE A;  2G9H D;  4K14 A;  1O7Y A;  3G6J B;  4BY7 B;  1ILP A;  3KF8 A;  1BO0 A;  3W3A A;  1JOQ A;  3ZYY X;  5J1Z A;  1EYC A;  1XX8 A;  4HN7 A;  1LT4 D;  1M4V A;  3NPP A;  2XRS D;  3P75 A;  3PUV A;  2XWJ B;  4KY6 A;  2A6E D;  3TZU A;  3PUX A;  3MVV A;  1SYB A;  4EQO A;  3P20 A;  1LTB D;  4A3B B;  2F0U A;  2Z4I A;  3OHX C;  3M7G A;  2EY2 A;  2K5W A;  4KKU A;  1SSO A;  1ZXT A;  2KVM A;  3SK6 A;  4NDX A;  1D5M C;  2AUJ D;  2LKV A;  2EY5 A;  1B9M A;  4ILW A;  2K32 A;  4TSS A;  3SHL A;  4G57 A;  1II3 A;  1HA5 A;  1KLG D;  2QF7 A;  3EA6 A;  5A2Q E;  1EYA A;  4JK1 C;  1HFG A;  2EYP A;  2KED A;  1VDZ A;  5JEA H;  1ENC A;  1LTI D;  1AW7 A;  5ELE A;  1DM0 B;  2WIN B;  2NYZ D;  5CYU A;  1I4X A;  2K1B A;  5KNB A;  4N9T A;  2EY1 A;  3KLS X;  1ZEQ X;  1STA A;  3DXJ C;  4LJZ C;  2NN6 G;  3DWP A;  5FO8 B;  3UI2 A;  2Y0S B;  3P7J A;  1WD0 A;  4H44 C;  3NQT A;  5C4Z A;  1ENF A;  2A68 D;  3KUP A;  5A2Q L;  1PFM A;  5JJZ A;  5EGT A;  3TP7 A;  4HED A;  5T1G A;  5CMD A;  1R9T B;  5HGT A;  1OXX K;  2MPM A;  2QCP X;  2ZXO A;  3S9W A;  3OWF A;  3TDQ A;  2QIL A;  1Z6H A;  3H6M A;  2EJF C;  1SMY C;  5IGD A;  3WDN A;  2XNA C;  1TS3 A;  2BDO A;  3MHB A;  4RHS A;  1HXY D;  2IX0 A;  3HOU B;  1TU2 B;  2O4X A;  1BCP B;  4WJW A;  4K6L A;  1EYD A;  5M3F B;  2WII B;  3I8Z A;  2DY7 A;  1DJR D;  2A5H A;  1GUG A;  1Y8P B;  4UAI A;  2JP1 A;  1B3A A;  1EY0 A;  4C1N I;  1F2Y A;  4P2C B;  1LT5 D;  1KNE A;  3J81 L;  1PZI D;  4DXG A;  2R6G A;  1HUN A;  5M5Y B;  4CHT B;  4LAA A;  1I4G A;  1Q8I A;  2JA6 B;  4IFD G;  1B9N A;  4TRD A;  1Q90 A;  2F0M A;  1A3T A;  3HP3 A;  4FO2 A;  5A35 A;  4N9P A;  3FMC A;  4O1N A;  3QOL A;  4H0L C;  3MWY W;  4DK1 A;  3HOZ B;  1PZK D;  5I6Y A;  1EOT A;  2XVS A;  5JPM C;  2XSC A;  2B2T C;  4OIK A;  2HCC A;  1BQQ T;  2A69 D;  4KK7 A;  5I6W A;  1I4H A;  2SNM A;  2F0N A;  4KY7 A;  2F0V A;  4J6H A;  1A15 A;  2L11 A;  1NCV A;  4A3G B;  1IKM A;  4RHR A;  1JOK A;  3M7N A;  4NMZ A;  5C0X G;  4QF4 A;  1U4R A;  1WTV A;  2PO4 A;  2LFN A;  1Y1V B;  3FKI B;  2PZW A;  4A3D B;  3HOY B;  3BZD B;  4BBS B;  1J9O A;  1DOL A;  2F0J A;  3S2D B;  2YU9 B;  3A56 A;  4Q0F A;  2WKC A;  2JE6 I;  3J80 L;  3ND8 A;  4RGO S;  3QB3 A;  4C3H G;  3O13 A;  1XYI A;  2EE1 A;  1IW7 D;  3J7A F;  4M1U B;  4EVO A;  4BA2 I;  1EZ6 A;  3PO2 B;  1QG7 A;  1AZP A;  1VF7 A;  2RDF A;  3DEO A;  2XIW A;  1Q12 A;  3A8J E;  1KDC A;  5ELF A;  2B8G A;  2LS0 1;  2A68 C;  1EU4 A;  5IGE A;  1JWM D;  4PQX A;  3GTP B;  1EL0 A;  2EZV A;  2CQA A;  2F0Q A;  2B39 A;  2XRQ D;  4KJN A;  3HRZ C;  1I50 B;  4PMB A;  2AQ3 B;  2BE5 D;  3HZX A;  1E2Z A;  1GHJ A;  2LMC B;  3EVQ A;  3E0J A;  3HEJ A;  1PLF A;  5I2X A;  4KJO A;  1ET6 A;  4KD4 A;  1DZ1 A;  1KDB A;  4ZQ3 A;  2MP1 A;  4RWS C;  2A73 B;  1BCP F;  1HCZ A;  4DAY A;  4FXK C;  1C4Q A;  4MHE A;  3IAY A;  3VR3 A;  3BS1 A;  4XYO A;  3RUZ A;  3NQI A;  4ZYS A;  1Z47 A;  1AZQ A;  1U9R A;  3GV6 A;  3TBI B;  3S14 B;  1NSN S;  1U4P A;  1BR9 A;  4XXE A;  3I91 A;  4C3I G;  2F3V A;  4RGN A;  3BYT B;  3TZD A;  3OIP A;  4IUP A;  5G3L D;  2SDF A;  1EY5 A;  1PTO H;  4OIJ A;  4V19 0;  1LTS D;  2WAC A;  4KKS A;  3H94 A;  2B63 B;  1TY2 A;  1FD7 D;  2DY8 A;  2WKD A;  4CKE A;  3U9S A;  3QIA A;  1DXM A;  3S1R B;  2E2I B;  1PYW D;  4IUV A;  1I6H B;  2E2D C;  3R3O A;  1TY0 A;  5EKI A;  1EY4 A;  5HUR A;  4E6I A;  1U4L A;  1EIG A;  2FFK B;  2E76 C;  3Q22 A;  2Z1C A;  4AYB B;  2L4N A;  3D6C A;  3NHH A;  2J7Z A;  1HRJ A;  3GQB A;  4C3J G;  3NWS A;  5C3E B;  4HSV A;  1MGS A;  2C9O A;  2FHT A;  2IWH A;  1CTM A;  1STG A;  2EJG C;  1A3V A;  1CHQ D;  2A69 C;  2B2W A;  1WVL A;  1JE4 A;  1KDA A;  1AP0 A;  3V05 A;  4HMI A;  4EGV A;  2EDG A;  4C3H B;  3SVM A;  2Z4H A;  1F9S A;  1SJE D;  4FP5 D;  3HS0 C;  4R9W A;  1DCZ A;  4RGM A;  1PTO D;  2HDM A;  5DM6 3;  5JEA G;  3N52 A;  5JPN C;  1EFI D;  3PMF A;  1I3Q B;  4K8J A;  1PZJ D;  2BCO A;  2X69 A;  1ICW A;  4FXG C;  2OXP A;  5FO9 B;  2X6L A;  5FK9 C;  3DM1 A;  3EFX D;  3AMU A;  2F0D A;  3WOE A;  4DAV A;  1TS4 A;  1EY6 A;  2M00 A;  2RSN A;  4RFB A;  1QCB D;  2N55 A;  2L5T A;  1PDQ A;  4ME5 A;  2F0L A;  1SNP A;  2AUK A;  2PW5 A;  1GUN A;  1SXT A;  2FIN B;  2K5Q A;  2ICI A;  1IW7 C;  1EQV A;  4CJ0 B;  1QNU A;  1I6V C;  2JXM B;  2L9H A;  2NN6 I;  4DFA A;  3MFG A;  4EQP A;  1IKL A;  1T5X D;  3J7A V;  1CQF A;  5F2D A;  1WTQ A;  1PMR A;  1SYE A;  3X3M A;  2RQX A;  1SNC A;  3LWU A;  2IX1 A;  2CVR A;  2B2T A;  4K5W A;  1EY9 A;  4KV6 A;  3T51 B;  4K5V A;  2E75 C;  4C3I B;  4G7Z C;  1TVX A;  3RLF A;  3NTI A;  3MXG A;  3I4M B;  5IGB A;  1B4O A;  2F0G A;  3P1H A;  2OT2 A;  3QJY A;  4QB4 A;  2BE5 C;  1GJX A;  4FXD A;  3TSS A;  5G3L F;  4KKT A;  4JBW A;  4TQU S;  5FKA C;  1YNN D;  3URY A;  5C4X B;  2WV6 D;  3PIP 3;  5E1F A;  3NTK A;  3I4N B;  4BBR B;  1QE6 A;  5EPJ A;  2NZ1 D;  3NBI A;  3PUY A;  1GUW A;  4KTA A;  3ERO A;  1YNJ D;  4FYD A;  2LY7 A;  4OHJ A;  1SFO B;  4XT3 B;  4CGY B;  3NBH A;  4DF7 A;  2F03 A;  1I4R A;  2EJM A;  2F0S A;  1FGB D;  3FRP B;  3K57 A;  5BN4 A;  3S17 B;  1G6Z A;  3H0G B;  3DMU A;  1LLR D;  1EIH A;  2PQE A;  1TKW B;  5CR3 A;  1EY7 A;  2K5D A;  2KEC A;  4C3J B;  4XQJ A;  1WTO A;  2NVQ B;  2B2Y C;  4J8Q A;  4A3M B;  1HQR D;  1MBY A;  1O7L A;  2DNC A;  2K33 A;  1F2Z A;  4IFD I;  1VCI A;  5CV8 A;  3E6Z X;  1DOK A;  1C8C A;  1HPC A;  3MC0 B;  2TMP A;  2VB2 X;  3NUC A;  3J7Y W;  3EQL C;  4DK0 A;  3K7A B;  1GUO A;  4L6T B;  2OEO A;  5IT9 E;  1ONL A;  1GXD C;  1ESR A;  4QCL A;  4DNT B;  3A7L A;  5C3X A;  1PFB A;  3VR2 A;  4F88 A;  2MJ8 A;  1STH A;  3A7A B;  3I72 A;  5IIF A;  2RA4 A;  1SNO A;  2F4I A;  2ZT9 C;  1KAB A;  2WP8 J;  1IYV A;  2ZXP A;  1GOZ A;  1TS5 A;  1SJH D;  3T13 A;  3FPU B;  5C5M A;  5CV6 A;  1V43 A;  1TWH B;  4WOR A;  5DM7 3;  1S5E D;  1FYC A;  5KIX A;  2F0P A;  1M8A A;  2F1M A;  3SE0 A;  5EKL A;  5C0X I;  2QEJ C;  2C5C A;  3GTM B;  1EU3 A;  4U68 A;  5FOB B;  2R92 B;  1PTO C;  1O7Z A;  4FNF A;  3GTJ B;  5CV5 A;  4OO1 H;  5KYI A;  3OMC A;  5EPL A;  2F0O A;  1RHP A;  1TWA B;  1BXT A;  4L8J A;  4DXF A;  3K5N A;  4G7O C;  4F87 A;  3VA5 A;  1EWC A;  3HOV B;  2ENB A;  3SXH A;  1SNM A;  4KY5 A;  2PZU A;  2IL8 A;  5CV9 A;  3VR4 A;  3SK4 A;  1H9S B;  2SOB A;  1RD9 D;  1TII D;  3AU7 A;  4BA1 I;  1JQY D;  3R8B A;  1W6J A;  1I4P A;  1DON A;  2EYJ A;  4CKC A;  3HGB A;  4RKL A;  2PZT A;  3JAM E;  2EYF A;  3C1E A;  3SK5 A;  4IFD J;  3C2P A;  1JR0 D;  2R61 A;  3X3N A;  1IYU A;  2L12 A;  3A8K E;  3D4D A;  1H9S A;  3MXU A;  4ZK9 B;  2AWO A;  3CRK C;  3GD7 A;  2I07 B;  4CBV A;  1IHZ A;  1KLU D;  5D65 A;  2K01 A;  1TS2 A;  4FVM A;  2VB3 X;  4A3K B;  1YNN C;  3D8G A;  3JAM L;  2OF1 A;  4RKB A;  1QOH A;  4XT1 B;  3NTH A;  2F0F A;  1STY A;  3BVM A;  1SE4 A;  2RDH A;  1YNJ C;  3G7L A;  1Y8O B;  3CKI B;  3R2T A;  5C0X J;  5K36 H;  4PMC A;  2F0K A;  1B53 A;  4R8N A;  3GTO B;  1GUS A;  1UUP A;  3TP6 A;  3RZO B;  5CV4 A;  4Q5V A;  3FEW X;  2BDN A;  1G29 1;  1MD2 D;  1STE A;  1FNU A;  1HHV A;  1E2W A;  1PRT C;  2HCI A;  4NKL A;  4QMG A;  4QUC A;  3BVG A;  3MTS A;  1A2T A;  3KK7 A;  1NUC A;  4XTC S;  1D5X C;  4CKB A;  1EZ8 A;  4BWG B;  2K6A A;  2JEB I;  3QOJ A;  1OXS C;  2A6H D;  2JYO A;  3CHB D;  1H9M A;  2KUM A;  1CM9 A;  1MSG A;  1QWY A;  3DHQ A;  4EQN A;  2Q8I B;  3M4Y A;  3RMH A;  1G2S A;  3OMG A;  1WCM B;  2X6G A;  3KBG A;  1G2T A;  2K03 A;  3IL8 A;  1CA6 A;  1D2B A;  3GTK B;  2IW3 A;  1S5B D;  1X3Q A;  3RD4 A;  1W6K A;  2EXZ A;  3A55 A;  4A3J B;  2KHS A;  1HA6 A;  4F8M A;  4X3K A;  2HUG A;  1VF5 C;  2WAQ B;  1K83 B;  4I7Z C;  1SE3 A;  1HFN A;  5ISR A;  2Q8R E;  2D62 A;  1EEF D;  4G4K A;  3SDZ A;  1B1Z A;  3NSW A;  5DNF A;  3TN2 A;  4R8I A;  5IGG A;  1O80 A;  3R93 A;  3VYR A;  3PUZ A;  3SR1 A;  2B2Y A;  3K58 A;  5D3I B;  5KGU A;  2JA7 B;  2BA1 A;  2XN9 C;  3K6O A;  1UEA B;  1ZKO A;  1JWU D;  2RSO A;  1G8Z D;  3V2T A;  2K7V A;  5K5P A;  3TME A;  1QJO A;  2EOT A;  4FF3 A;  2D5D A;  5DEH A;  2F0H A;  4K8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...