5JOBA

Crystal structure of staphylococcal nuclease variant delta+phs l25k/i92a at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKKMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYAYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L25K/I92A at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5jobA00
4DGZA 1KAAA 1SYBA 1F2YA 2EY2A 4G57A 4ZQ3A 5IODA 1SYGA 3OSOA 4NKLA 5C4HA 5HGTA 2O4XA 4I65A 2EXZA 5K5PA 5CV4A 4F7XA 1JOQA 1TQOA 1EY4A 4KY6A 5DAUA 2OF1A 5E1FA 2F0KA 4MIUA 1TR5A 5J39A 1NSNS 2F0JA 3SK8A 3NP8A 1U9RA 4ID6A 4TRDA 3EJIA 1STBA 4KTAA 4LAAA 4NDXA 5CV7A 3EROA 1SYEA 5M9OA 5I9PA 2F0OA 2F0VA 3QB3A 4K8IA 1SYFA 4PMBA 1STAA 3SR1A 1A3UA 3H6MA 4K2KA 5EKKA 1EY0A 2M00A 1SNOA 2PW7A 5CC4A 1F2ZA 2SNMA 5CV8A 5KYIA 3SHLA 1EYDA 4K2LA 3SXHA 4J6HA 3T13A 3BDLA 5C6AA 5CV9A 4ZUIA 4KJOA 5KIXA 2F0GA 3R3OA 2EYPA 1JOOA 3C1EA 5IGBA 5KEEA 4E6IA 2EY6A 4ME5A 2F0TA 4J1MA 4B9WA 1STYA 2RDFA 1SNCA 1SNQA 4PMCA 1SYCA 2F3WA 2F0FA 2F0UA 1A3TA 4KD3A 3NQTA 4NP5A 4EVOA 1JOKA 3P75A 1II3A 4K6DA 1EY9A 2F0WA 4R8NA 2PZWA 1EZ8A 4YIJA 2F0QA 1EYAA 1SNMA 4ZUJA 2F0LA 1STNA 5KYLA 1NUCA 5KRUA 2SOBA 3NXWA 1SNDA 5C5LA 3NHHA 3D4DA 2EYMA 3MXPA 5IGEA 3S9WA 2PYKA 2F0HA 1IHZA 3E5SA 3D8GA 3RUZA 1STHA 1KABA 2EYHA 2KQ3A 1F2MA 5C5MA 4K5VA 3VA5A 3OWFA 3D6CA 3TP5A 1EY6A 3T16A 4B9XA 5IIFA 4HMJA 3TMEA 4IZ8A 4WRDA 4KD4A 5I9OA 3OMGA 4IALA 2F0DA 4RKLA 5I6WA 4H7BA 1A2UA 4EQOA 3C1FA 3HZXA 3PMFA 1ENCA 1A3VA 3SK4A 4DFAA 5JAVA 1EZ6A 5E3FA 4DF7A 3DHQA 2F0MA 2PW5A 2EYOA 4ODGA 5C3WA 2EY1A 4F8MA 4RKBA 4QF4A 1SYDA 1STGA 2OEOA 4HMIA 3TP8A 4KY5A 3HEJA 1EYCA 1EY5A 5C3XA 3OMCA 2F0NA 3NUCA 5KGUA 2OXPA 4DU9A 3ERQA 5DEHA 5IOCA 1TT2A 2PZTA 3QOLA 4K14A 4S3SA 5CR3A 4K5WA 4PNYA 3NK9A 4KHVA 2HQEA 3V2TA 2RKSA 1RKNA 4K8JA 5IGDA 2RBMA 2EY5A 3TP7A 1SNPA 5CV6A 4KJNA 2QDBA 5JOBA 5I6YA 3MZ5A 2EYFA 1ENAA 3D4WA 4QMGA 5NUCA 2EYJA 2WACA 4N9PA 5EGTA 5IGGA 2SNSA 4N9TA 4NMZA 4EQPA 4EQNA 1KDCA 2PQEA 5HURA 2F0SA 2F0PA 3U9OA 2KHSA 5IGCA 4HTHA 2NUCA 3SK6A 3DMUA 3TP6A 2LKVA 3EVQA 3SK5A 3BDCA 1AEXA 3MHBA 5ISRA 2F0IA 1EY7A 4KV6A 2PZUA 5CV5A 3MVVA 4KY7A 3LX0A 5EKLA 5J1ZA 1A2TA 1KDBA 5IGFA 5J22A 4K5XA 3P1HA 4OL7A 1KDAA 5CGKA 5C4ZA 2ENBA 2EYLA 2F3VA 5F2DA 1EQVA 4QB4A 1JORA 3MEHA 1EY8A 2F0EA 3QOJA 4WORA 4IUNA 3ITPA
chains in the Genus database with same CATH superfamily
5JJKA 2AKWB 1VDZA 2CQOA 1WTHA 4O2DA 2A8VA 1WTRA 4RMFA 5EPJA 1W2BA 4NW2A 2MGSA 3M4OH 2VQFQ 3RMHA 3RNUA 2ZTEA 1VQKA 4B3TL 4A3IG 1FGBD 5IYDG 2QF7A 2ZTCA 1VF5C 2Z8LA 1EWIA 3GTKB 2A6ED 2R6GA 4APVA 1SMYD 4X62Q 3CRLC 3D31A 3GTMH 1TIID 2KEEA 1M90C 3GV6A 1Q1EA 4R9WA 1JOOA 1SROA 1VQ4A 1XYIA 4NPSA 5M3FH 4B3MQ 1ILQA 4C3IB 3CMEA 3IFDA 4UP7A 2VUMG 4CKCA 1HRJA 4DR4L 4IUPA 5ELNA 3IKJA 1UWVA 5C4JH 2DGYA 4A3DG 3V96A 5LL6X 2EPBA 4LF5Q 1FJGL 4DR3Q 2ZXPA 4GKJQ 3TP5A 3QWNA 2X6LA 1AW7A 4A3JB 2Z9HA 4H13C 1L2FA 4IZ8A 4WRDA 2E5LL 3HOWG 5FJ8G 4A3LG 2A68D 1VQMA 4PQXA 5E3FA 4DAMA 4B3ML 3AEVA 3DHQA 1QE6A 1RODA 2HCIA 1G291 1K3BC 1IL2A 3MXNA 3OW2A 1KHIA 4LF4L 1E2VA 4X6AH 5FJ8H 4LNQA 2A19A 2XVSA 1TT2A 2JJQA 3F2CA 1VQOA 2JK8A 3H0GG 2F03A 5C3EB 2EYJA 4X3KA 4JI7Q 4LFBQ 4CHTB 1UNSA 3RR5A 4EQNA 2FXQA 4LJZC 1E2ZA 2E5LQ 1WTPA 4L5RC 4A3MB 1PH4A 3ZYYX 5FLXE 5EPLA 3K0YA 1AFPA 3SK5A 3PIPA 3BDCA 1IBLL 1I4HA 5D3IB 1R4QB 1U4LA 1K0SA 5C4ZA 2F4VQ 4LFAL 2BA0A 3U4VA 5TSSA 3FP9A 1VQBA 4IPGA 3UE1A 1VQLA 2F0EA 4DV6Q 2KA7A 2EDGA 2JA5G 2QKIC 4G57A 3R2TA 2CWAA 1I50H 1SDFA 1B7YB 5LL6S 3K8AA 2PMZB 1WVLA 4CJ2C 1DCZA 1HXYD 1GUGA 4TRDA 1STBA 2PNHA 1SRUA 2B2VA 4DV1L 3HFZB 1Q86C 4PMBA 1BBUA 2K03A 4B08A 3T4AC 2HD3A 3VYUA 1PTOD 1SNOA 5CC4A 2F4VL 3S15H 1N36Q 2R7ZG 5C6AA 5M5XB 1S3OA 5ELCA 4DXFA 2EZVA 4GNXA 1I5FA 1XTDA 4JG2A 2HUGA 1Y14B 2N78A 1BR9A 1PLFA 2ASBA 1G2SA 3HOXG 1KRTA 3OIQA 3K7AB 3OHXC 4KI0A 1TXYA 4R4QA 1EY9A 4ALPA 3OYYA 1EWCA 4ZCKA 1SNDA 4P71A 2CW0C 4HIKA 3E5SA 1K83B 1WTQA 2UU9L 1HNXL 4K5VA 2OCEA 1IKMA 3OMGA 5I6WA 2L4NA 1BF4A 5IT9L 2WKCA 2R93G 3M4PA 5JVG3 1MKHA 2IX1A 3NENA 3I56A 2XWJB 1EYGA 3DXJC 1Q81C 2Y0SE 1HZBA 5KNBA 4HMIA 4I7ZC 1EEFD 1TVXA 2X69A 4A3GH 2IY5B 1B2TA 1WD0A 4QUCA 1KRSA 4HIMA 3HOUB 2MJ8A 2UUCL 5K36G 2RKSA 4JI8L 1RKNA 3M9BA 4FYDA 3UDGA 1HNZL 4AIMA 1ICFB 1SE8A 3DWQA 4N9TA 2OTLA 1HH2P 5HURA 4CDEC 1Q8KA 4FF4A 1LT4D 4LF8L 2KHJA 4DA2A 3A5ZB 1EQRA 2Z1CA 3EVQA 4A3CH 1EY7A 2VNUD 2K7VA 1QUQB 3LX0A 1TU2B 4YY3Q 2K5HA 3S1NH 3MEFA 3L3OC 2N3SA 3J80E 1FYCA 5JEAG 5F2DA 2R3ZA 1ZYRD 3S1NB 1EU4A 4C3JH 1Q82C 4KD4A 1A63A 1ESRA 3TDQA 1SYGA 1FNVA 1HNZQ 1GXDC 4H0LC 2XTIA 3I4MG 1HUMA 1SE4A 1HJPA 2YTYA 1SE3A 1V43A 3NP8A 1AN8A 1U9RA 4DNRB 2JA7G 1MD2D 1N33L 1YNNC 1LTID 3SDZA 4YWKA 1WTWA 1STAA 2K5DA 3H6MA 1MGSA 3M7GA 1U5KA 5EQ0A 5IYBG 2EYPA 4CKEA 1RTOA 1PHJA 3FHWA 2L11A 2XWBB 2B2WA 3J7A5 1C4QA 1S5DD 2F3WA 5LMUL 4DV0L 4NP5A 3M4QA 1BQQT 2L12A 3FPUB 2KHIA 4B3RQ 1CI3M 4LUOA 1HZCA 3W2DA 2M9VA 1VMPA 2RA4A 2EQSA 4DAPA 1PFSA 2KUMA 1K28A 4UPAA 4DPGA 1GUNA 1NNXA 5C3EG 3NEMA 4RKLA 1CHPD 1GUWA 2TSSA 5JJIA 1A3VA 1WCMH 1CSPA 1WTXA 4A3LH 3QIAA 2B2TC 3F2UA 5LHY1 1XWEA 1B70B 4MTNA 1N8RC 5M5XH 5C3XA 1EY5A 1VQIA 4DUYQ 1KQSA 4A75A 1G2TA 4S3SA 4A3DB 5GAHC 3CCRA 2E2HB 3VR4A 1EFID 4P73A 3Q8DA 2I5LX 3PUZA 4OIKA 4DV2L 4RCOA 2J0TD 1I6HB 3IAYA 2BH2A 3MA2B 2UXDQ 4HCEA 3OW7A 2KVMA 5M3MG 1IKLA 5IT9c 5IGCA 1TS3A 2ALYB 4CBVA 3CRKC 5FO8B 1JWUD 1NMGA 2EOTA 2GA4B 4UY8C 4A3BB 3ULLA 3A8KE 1DOLA 1JORA 2AQ2B 4ZLTF 4RWSC 5AJ3Q 2NBFA 3OSOA 3AB9A 4DV2Q 5CV4A 4F7XA 3FKIG 1XTCD 1BBXC 4R4IA 1I6VC 4G4KA 4ME3A 4FXKC 1L0WA 1DOKA 4JBJA 1SN8A 3MAQA 3HOXB 3BVZA 4A3KH 3HOVH 1HR0W 4LF6L 2V4DA 2F0VA 4IUUA 3C46A 1HA5A 4PZ8A 4BBSG 3A7LA 3PF5A 2IHEA 4BBRH 3CC4A 1EYDA 3T13A 2KCNA 4RG1A 2NVYH 2PCFB 2ICIA 1JCKB 1F2LA 1I4QA 1NMFA 2QA4A 2L5TA 4DAYB 3PF4A 1NY4A 1XXGA 2A6HC 3CCUA 3P75A 1FL0A 1B1ZA 2AMCB 4LFCL 2I0QA 3T1YQ 1UAPA 2QGQA 3CCEA 4ABNA 1CKMA 2C35B 1PH5A 3T56B 3OPOA 3VA5A 1PH3A 1EY6A 2FMCA 4NXML 1LTTD 1NTGA 4GOPB 4IALA 4BY1B 5GAGC 3DUZA 1QZHA 4DF7A 3VR6A 1MSHA 4YWLA 2I07B 1AP0A 4OHJA 1IW7C 2C9OA 1CKNA 4ZK9B 2JN4A 3D4RA 4XT1B 4DR2L 2TMPA 3EFXD 4K6LA 1IBML 1QVCA 1Q7YC 3GTKH 4A3EH 1YITA 2B2TA 1JICA 1LM0A 3NE5B 2HQLA 4L5QA 3Q0AA 1XPRA 4MTKA 2UUBQ 1U0LA 3K7UC 4OO1H 4BY1G 3ND8A 1F9QA 3AFQA 1V9PA 4XQJA 2F0SA 3VR5A 3TEHB 4H44C 4X64L 3RZOB 4A93H 4LFAQ 3KUPA 2B29A 3R2IA 4IOCA 4JI0Q 1HFNA 5M3MH 4DUYL 3S16B 2K32A 2NN6I 5J22A 1PRTD 4OL7A 1O78A 1KNEA 3PO3H 4DR2Q 4POFA 4MN3A 2JP1A 3J80L 3STBD 4P75A 5LMNW 5AFWA 1X56A 1AE3A 1OTCA 3LGJA 5M3FG 3D3RA 1SEBD 1ZEQX 1KD1C 4IFDG 1VQ8A 4A3FB 2F0OA 4JI0L 2B63H 4JV5Q 4CKBA 2BDOA 1EY0A 2L0CA 4L8JA 1VQ7A 1K3RA 3J80i 1TWHH 4J15A 5E7NA 3Q22A 2NVXH 2PQAB 5AJ3L 4OX9Q 4XXEA 3KF6A 5A35A 5IGBA 1AZPA 4DV7Q 1PYBA 4J8QA 4HJ5A 5BN5A 1SBBB 1U4MA 2ZT9C 2WP8J 4HIOA 3NQTA 1XMQL 1XX8A 5M3FB 3KLSA 2ZJQA 1KIXA 1Y1VB 2SOBA 4DV5L 4JYAQ 2V1CC 5ELOA 3IFTA 1STHA 1DGSA 2XSCA 4POGA 2EYHA 3GTQH 1Q12A 3BU2A 3H15A 5COYA 3WDNA 3HGBA 2G9DA 1Q3LA 1NCVA 3HOXH 4OO1G 3T53B 3CCJA 3S1RB 2HT1A 3WOEA 3W1GA 4K0KL 1FD7D 5FO9B 3A74A 5D3DA 4DNIA 2JEAI 2F0NA 2N8NA 3RD4A 3VYRA 5FLMG 1Z47A 2PZTA 1YJ9A 1GVPA 1UE5A 3S1QH 3SE0A 4CJ1B 2RBMA 5CV6A 4X3SA 1K8AC 1ONLA 4QCLA 4A3BH 1V1OA 2JE6I 5M5WB 2UXBL 1RJTA 2QCPX 5FLMH 1QOHA 4DK1A 1RTNA 5IP9H 1K73C 5A2QE 3U9OA 4ZYSA 1WCMG 1SAPA 2HHHL 2Q2UA 3BDOA 1Y8NB 1GUSA 2YTVA 4OWTB 4OGQC 4LF6Q 1OXVA 4K5XA 1BOSA 1DJRD 3J7AV 1RL2A 2ENBA 1PTOB 4BBSB 4PZ6A 1HR0L 3RLFA 1STEA 2BDNA 2WIIB 1Q46A 2WV6D 1EOTA 1VS0A 4X65L 2OF1A 1PH9A 4MIUA 1KNAA 1LABA 2VY3A 2JEBI 3PUYA 3EROA 1S40A 1IBKQ 4OELB 3RN5A 3ND9A 1SJED 1OO9B 4K8IA 1MSGA 1X3GA 2B3GA 1E1TA 1LTRD 2XIWA 1N36L 2DNEA 1NE3A 3KYHC 4UHVA 1QZGA 1YIJA 1UEAB 2NVTB 4J6HA 3PCOB 4YCVA 4TKOB 1X55A 4L5SA 3PQIA 3HOYB 4JBMA 1A3TA 3LNNA 2NB0A 2WB1E 4FDBA 4RFBA 4AQYL 1II3A 2ZTDA 1DONA 4WJ3M 2EE1A 3A5UA 2JYOA 4JV5L 5KRUA 5ELFA 1I94L 1ET9A 3MXPA 3PUVA 1BXTA 2PYKA 4OEMB 2OTJA 5HGQA 1FR3A 1JQYD 1QVFA 5C5MA 4EX5A 1EQTA 3PIO3 1H9MA 4DV7L 4LWCA 5CBAE 1ENFA 1S5ED 4X66L 5JJZA 2HIXA 2B2YA 3S24A 3HG9A 4JI4Q 1EIHA 2MO0A 4A3IB 1GHJA 4IFDJ 3KBGA 1TY0A 4KY5A 5T1IA 1I4XA 2GN5A 3NUCA 4U68A 4GKKL 5IOCA 1XMQQ 4PG3A 3V2TA 4C3JB 1X65A 4JI5L 1H9JA 4OIJA 1IXRA 1QB5D 2FFKB 2DY8A 3J81c 4I7AA 4BXXG 1SMYC 3HOUH 1LYLA 5ELEA 3FVQA 1KDCA 1P8LA 2RCFA 4KKUA 2VZAA 2NYZD 2VUMB 4A3MG 1TWFB 2J7ZA 1A62A 4RHRA 3EN2A 4FP5D 3SK6A 3TP6A 5KNDA 3K58A 2I5HA 2Q8TA 3FDTA 2Q8IB 2EJMA 2SDFA 3K6OA 1VF7A 1X3QA 5D65A 2F3VA 1JMCA 1EQVA 2F1MA 3RLOA 3S1QB 1TS2A 4UP8A 4LUVA 3PO3G 5IYBH 4JPBW 3VDYA 3HKZG 5IP7G 1XPOA 1FNUA 3S1RH 2BE5D 2VXWA 3KJOA 4P72A 3W1BA 4F88A 3BJUA 4JI2L 3E3XA 4WJ4A 1B4OA 4LAAA 3S2DB 4O1NA 3I2ZA 1C9OA 3L0OA 3MTSA 1Y1VG 3HP3A 5C4XH 1SYFA 3I4NB 3CHBD 3KLRA 2HCCA 4DR4Q 3QR8A 3AU7A 2JA6H 3S15B 2RCNA 3CCSA 5KEEA 2IPKD 4E6IA 3K57A 2F0TA 4KHPQ 1Y69U 3T1YL 2JXMB 3S2HB 4DR3L 2NZ1D 4PMCA 4HJAA 3R8BA 2IWHA 5CMDA 4A3CG 2DY7A 4C2MH 3WWVA 4A3FG 2CQAA 3S9WA 3D4DA 2NVXB 2A73B 4HR7B 3K80C 1CFMA 3RUZA 1ASZA 1VQ6A 5C44B 3H3VH 1XPUA 3D6CA 4DAYA 4B9XA 4DV4Q 4IJLA 5IIFA 4A3FH 1D6EC 1O7IA 3PUXA 3MFGA 3CW2C 1PDQA 2F0DA 1BNZA 4EQOA 2CVRA 1CZGA 2JSOA 2QEXA 1VQCA 4OWWB 2K5VA 4F8MA 4JI3L 4QF4A 4XT3B 4TQUS 1EUJA 4XYQA 1G51A 1XMOQ 2PQAA 1XNRL 3JAMc 3H0GH 1JJCB 4TVAB 3KDFB 2ATWA 1CKOA 2KCTA 4PNYA 3F8TA 1CZWA 1ZXTA 4K8JA 1L1OB 1CSQA 3MZ5A 3RN2A 4M8AA 3PUWA 3KF8B 3H94A 2CWPA 3DWPA 5IGGA 5IWAL 2Z4IA 5IYDH 2R7FA 4JI1Q 2E75C 2PQEA 3RZOH 1LTBD 2K5QA 2NUCA 4DKAC 3MHBA 1AEXA 5A2QL 4JC0A 3H3VC 3A55A 4A3MH 1IBKL 3S17B 1K8OA 3PO2G 4A3EB 1IW7D 2CH4A 2EIFA 4HN7A 1L1OA 1YHQA 3L7ZC 4FF2A 3CC2A 1ZYRC 3I73A 4DGZA 4A3JG 1C7YA 2G9HD 2EXZA 4IUVA 1TQOA 2ZXOA 1PRTC 2WKDA 2L55A 1TR5A 4OX9L 1LTLA 1E3PA 1F9PA 3J7ZC 1KXLA 4ID6A 4KTAA 4A93G 1DXMA 2H5XA 2RHSB 3OWEB 4K2KA 2B2VC 4A3JH 1U4PA 2PW7A 2E74C 3CQZB 1F2ZA 3BYTB 3DLLA 2KCMA 1YNND 1PFMA 2R7DA 3C1EA 1O80A 1WTOA 4J1MA 1STYA 2RDFA 1HNXQ 1SNQA 1XJVA 3S2HH 4Q0FA 4EVOA 3HOZH 5E4XA 1P16A 1BKBA 1OXSC 4CDFC 3H91A 2B8GA 4HSPA 2D0PA 3J81i 3CCMA 4LF7L 1VQNA 4DR6Q 1LTAD 4BBRB 1BCPF 2KQ3A 4CDCC 3NPPA 5IT9E 1Z6HA 2JA5B 3A7AB 1H9SB 3PMFA 3ERSX 2QILA 1HHVA 3NQIA 2N88A 4HEDA 2P5ZX 3HOVB 2VQFL 2R61A 2EY1A 4Q5VA 2OEOA 4RAUC 1PRTF 3CCQA 4XQQA 3GTLB 2WB1G 1VQJA 1ML0D 4K5WA 4G7ZC 3CXCA 3GTGH 4YCWA 1ICWA 4BBRG 3RZDH 2EY5A 4DR6L 3L2PA 1Y8PB 2EYFA 3KF8A 2WACA 3CKIB 4EQPA 5FKAC 2A69C 5BN3A 2K14A 1YJNA 3GTPH 5LMUQ 4DV0Q 2F0PA 4BA1I 3HOVG 2AQ3B 2Z4HA 5BN4A 1B53A 1E2WA 4LK1C 2OQKA 3D6WA 4B3SQ 4K0KQ 1EQQA 2WAQB 5I2YA 4JW0A 1SE2A 2WB1B 1SFOB 4A3BG 2KENA 1GKHA 2MNAA 3KOJA 2N49A 2E2HH 4JOIA 3ITPA 3GDEA 4LF5L 1FJGQ 4DAVA 1E22A 4C1NK 4DN4M 3KF6B 1TWFH 2G5DA 1B9MA 1BCPC 4XDXA 4GN3B 2AUJD 2E2JH 1L1OC 1G6ZA 5IWAQ 4JVZA 1IL8A 1H9RA 2D2CC 4RH6A 3KFUA 1RIPA 2I46A 2JA8H 2YV5A 5EKKA 2YU9H 3P7JA 1LT3D 3JC66 2R7ZB 5CV8A 1QILA 3AYHB 3VR2A 2AWNA 4IOAA 1PZID 1YEZA 3R3OA 3NWSA 3J80c 4A3IH 1TWCH 4V0BA 1I4RA 1SNCA 1EEID 1SYCA 5JJLA 4KD3A 2F3IA 3S2DH 1VCIA 4K6DA 3CPWA 5IP7H 1X3FA 1PFNA 2H1EA 3OOCA 1KAWA 1V8QA 4YIJA 4ZUJA 5KYLA 1YVCA 2B39A 4DV5Q 2K5WA 1OXUA 2WFWA 3ULPA 1T5EA 2NVTH 3BVGA 3GTOB 3BZKA 5G3LD 1MJCA 1HPCA 5DNFA 3NTHA 2LSSA 1YI2A 5FOBB 5I9OA 2Q8RE 4H7BA 2R93B 3C1FA 4P74A 4DFAA 2RVLA 4OXPA 5JAVA 3CCVA 1AH9A 1G91A 2ZM6L 4GNXB 2PW5A 3FPPA 2JA7B 2D62A 2EVBA 3S14H 2OXPA 4JK1C 4B3TQ 4KHVA 1WD1A 1N34L 1SNPA 4KJNA 1X6OA 2PI2E 3GP7A 1TWAB 3DWAA 5EPKA 1DM0B 2PO4A 2E2JB 1HNWL 1X3PA 3I3CA 4HSVA 4NXNL 3G6EA 3HKZE 5FK9C 4YWMA 4KV6A 1WTVA 1W6JA 1A2TA 1N32L 1YJWA 3J81E 1KDAA 2JA9A 3S1MH 5LMNL 1R9TH 2Y0SG 1PH8A 5EKIA 2MFIA 1LO5D 1PTOF 2UU9Q 2EJGC 1A6XA 4GZYC 4QQBX 5ELBA 5HGTA 2O4XA 4I65A 3I4MB 1A8VA 2F0KA 1IZ6A 4FO2A 4GKJL 2NN6H 4G7HC 4IURA 3B6YA 2UUCQ 3KK7A 4LF4Q 1VQEA 4QIWE 3ICEA 4QUFA 2NZHA 3EA6A 4KK7A 4A3EG 2B2WC 1RCVD 1VQAA 2E2IH 3GTQB 1N32Q 1MBYA 1X9NA 1JWSD 1T5XD 1Y1WG 2E76C 2Y0SB 1JC7A 1S4ZA 2DNCA 2FJ2A 1WJJA 4JI7L 4LFBL 1KLUD 2FINB 1K9MC 1TY2A 2QEJC 3V05A 4ME5A 2NZOA 1Z7TA 3G6JB 2ZJRA 2F0UA 2BE5C 5C0XI 1EOVA 1GUTA 4R8NA 1PH7A 4Y7NB 2K50A 2XN9C 3NXWA 2CCZA 3HS0C 2EYMA 4YY3L 3BVMA 4ZKCB 1PH2A 4UP9A 4X3UA 3TMEA 3NTKA 3HOZB 1N33Q 4NB3A 2ZXRA 3HOWB 1ENCA 2C5CA 3I55A 4AYBB 4DV6L 1PTOC 2IX3A 2EYOA 4ODGA 3OTOQ 1EFWA 1IBMQ 5JPNC 1S72A 3FMCA 5DEHA 3MWYW 1D2BA 3QOLA 2EXDA 1H9KA 2RHQB 2X6GA 2B63B 4DV1Q 2VQEQ 3PO3B 3RZDB 1KC8C 3UI2A 4C3HB 4A3GG 1PYWD 3N52A 3STBC 1S5CD 4A76A 2AWOA 1PH1A 5M3MB 1E7ZA 4JOIC 1U4RA 3JAME 4GN4B 1MI2A 1Y8OB 1TWGH 2PZUA 3GV3A 4JCVE 2L1BA 2NWGA 1QNUA 1ET6A 2IHFA 1PRTB 4KHZA 2A1AA 1FVIA 2IJ0A 4OWXB 1O7ZA 2FMMA 1LT6D 4FXGC 1EY8A 3U50C 2IW3A 2EY2A 1QVGA 4L63B 4WJWA 2Z0SA 3A0JA 2CKZB 4LF9L 4LMQD 1V1PB 1PA6A 1HQMC 3IRBA 1JWMD 1SLJA 4GLVB 1TS5A 1I4GA 1E24A 1HNWQ 2N55A 1CT1D 1NBWA 2MP1A 1LTGD 5GROA 3D0FA 3H0GB 5KYIA 1VQPA 3W5OA 3BZDB 1GO3E 3KLWA 2F4IA 1KLGD 2K52A 4JI8Q 4ZKBB 1G8ZD 1S5FD 2F0FA 1EU3A 2D0OA 3MXUA 4IN3A 2F52A 2A74C 2PZWA 2K1BA 4KKTA 4GLXA 1NUCA 5FO7B 3TQYA 1B9NA 2A6EC 3QJYA 5C5LA 3D8GA 2JA6B 1B3AA 5JVH3 2ICEC 1HA6A 3SEBA 2JA8G 2ES2A 1HFGA 4X65Q 3GQBA 4YHHL 2NTTA 1O7YA 3S16H 3NTIA 2A69D 1TWGB 4A3KB 1SR3A 3M4OB 2NVYB 1W6KA 3K81C 3HEJA 4GOPC 1J5EQ 3W3AA 3NSWA 4CDDC 1PVOA 3I4NH 2BA1A 4BWGB 4AH6A 1FGUA 3CU7A 1N9WA 2RSNA 2JA6G 3TP7A 1D8LA 1BDOA 2PI2A 4H02A 4QMGA 3UDIA 3Q24A 4DR1Q 4YHHQ 5CYUA 2MHVA 5J3BA 1X32A 5ISRA 5FLXL 4B3RL 1Q8IA 2MQHA 1F9SA 5EKLA 5J1ZA 2Z6KC 1KDBA 5EAYA 3BS1A 4DR7Q 5D14A 1I6HH 3GTJB 1EIYB 5BR8L 1GJXA 4QL5A 2LXJA 3GO5A 2OQ0A 4N9PA 1JJ2A 1J8IA 1XMOL 1YBYA 1D1IA 1CUKA 1VQ9A 4NXMQ 3TREA 1C48A 2RF4A 2UUAQ 3SVMA 1Z9FA 3HOWH 1PH6A 2LXKA 2NN6G 3NBIA 1OXXK 3H09A 2I5MX 2MPMA 4DR7L 5M5YB 2M00A 4GNXC 3A54A 1CK1A 1T9HA 2D5DA 3TS0A 1EWHA 4IUQA 1I3QB 2EY6A 4DXGA 2R92H 4C3IG 4IFDH 2CFMA 2XRQD 1VQFA 2CW0D 1I4PA 4C1NI 1EZ8A 1STNA 4WFN3 4HJ8A 5H1SE 1CKNB 1IHZA 2BOSA 3WOFA 3A8IE 2WAQE 2DJFC 2XRSD 2E2IB 2NVQB 4HMJA 2VQEL 3HKZB 3I90A 1PZJD 3SK4A 2LFNA 2ZJPA 4GKKQ 2L9HA 2MO1A 1LV9A 5C3WA 1VMCA 2AHOB 4ZAIA 1HUNA 4RKBA 5G3LF 4TSSA 3TP8A 1EYCA 3UE0A 3MXNB 4EQ5A 3H3VI 2HDLA 4KN4C 3ERQA 1QG7A 4L6TB 1LTSD 1R9TB 3TS2A 1B50A 2YYZA 3NK9A 2HQEA 3CMAA 4YCUA 3K59A 2LMCB 3VYTA 3D4WA 3RLNA 2DJGC 4CGYB 1OXTA 4RCNA 3A8JE 1XNQL 4JI6Q 4R4CA 4AYBG 3L9AX 1CQFA 3E9IA 2KHSA 4XYOA 1EL0A 2ZM6Q 5LMNQ 4LF7Q 2K01A 3F1ZA 3F2BA 2PMZE 1TWAH 4R8IA 3K5LA 2K5NA 3PO2B 5M5WH 5CGKA 2B8FA 2SEBD 1SJHD 1BVSA 5C44G 4R1JA 1AE2A 3MEHA 4R4TA 3MC0B 2LY7A 1BO0A 4FXDA 1YNXA 3I72A 1JOQA 5DAUA 3TBIB 2K75A 1UUPA 3EIVA 3I91A 2PPBC 3EBEA 5HY6A 4GS3A 1SYEA 1XNRQ 3HOYH 4N8X1 5FLXc 2NVQH 4RGNA 2UXCL 2XNAC 5T1GA 3MXGA 1CA5A 2E2DC 1G6PA 3CAMA 5CV9A 4ZUIA 1HZ9A 5KIXA 3C2PA 4ZRZA 4A4IA 3N6RA 3O13A 1J6QA 2DUDA 5KNCA 3TN2A 4R4OA 4X64Q 3HOYG 4FF1A 2K04A 2HHHQ 2UUBL 1VQDA 1CTMA 1EYAA 1SNMA 2F0LA 1NR2A 2K6AA 2M2LA 5IP9G 2VB3X 1V1QA 1Y1WH 4CJ0B 3OTOL 2F0HA 4DR5L 3ULJA 3NWTA 4OONA 4IPDA 1HTLD 5GQOA 5IY0A 1HZAA 5I2XA 1PTOH 2IL8A 1HCZA 1WOCA 5L37A 4JI4L 1EZ6A 4BA2I 2E8GA 3DEOA 1JR0D 4X3TA 3J7AF 1PZKD 1SYDA 4PZ7A 4MNOA 2VW9A 3GTPB 1TWHB 4DU9A 1C8CA 3HOUG 2DN8A 5CR3A 4JI5Q 1L0XB 4RGTA 5ELDA 1BCPD 5BR8Q 4DK3C 3M7NA 3GTJH 1ZKOA 2QDBA 3GTGB 4AQYQ 2SNSA 4NMZA 2J4XA 1WFQA 5C0XG 5C0XJ 3M3YH 3ONAB 4NXNQ 3X3NA 1S5BD 4P2CB 2Z6KA 3HRZC 5CORA 4DV3Q 3LWEA 1H95A 5DM63 5C0XH 2B2UA 4HJ7A 1MIUA 2EJFC 1DYQA 3K5OA 2WAQG 3G48A 4ULLA 3JAMi 2B2UC 4IPHA 1JT8A 4JBWA 3GTLH 5GADC 1GHKA 4XTCS 4ZQ3A 5IODA 4RGMA 1A0IA 2MUYA 3I7FA 3ER0A 3GD7A 5IE8A 4KY6A 3E0JA 3NELA 1N34Q 3AQQA 3SK8A 1GOZA 3K5MA 3K7AH 5CV7A 1X54A 3URYA 5I9PA 2HDMA 4BY1H 1CQVA 2XGTA 4IUTA 3SR1A 1A3UA 1NR4A 1YHAA 1CHQD 3M85A 1FNWA 2SNMA 1QCBD 3SXHA 2LS01 2O5IC 2UXBQ 2F0GA 3I8ZA 1VQGA 4B9WA 1LLRD 1QWYA 4C3IH 1LUZA 5GAEC 2F0WA 3CCLA 4KMUC 2UXCQ 4FF3A 4QY7A 2A68C 1JB7A 3MFYA 4KLKA 3CQZH 1CM9A 1HR0Q 5C4JB 1MHWC 1F2MA 4HJ9A 3GTMB 4Y7NH 4LF8Q 2Q2HA 4QGUA 1E0BA 4M1UB 2VS1A 3LWUA 1A2UA 3FRPB 1WYDA 3HZXA 4U673 4BY7G 2VB2X 3QO2A 2IT1A 2KCCA 4A93B 1QJOA 1D5MC 3OMCA 5KGUA 3J81L 1NJIC 3A56A 4F87A 5EBDA 1EIGA 1SMXA 1B3QA 5C4XB 5IGDA 1JB3A 4LUZA 1IYJB 5JOBA 5JEAH 1TKWB 1K8MA 5NUCA 3TSSA 3G4SA 5CBEE 3G71A 5DM73 4KHPL 2KOLA 4BY7B 3R93A 3ZJYC 3I4MH 2LKVA 1MJEA 3M3YB 4XIGS 3UDXA 3C3LA 3MVVA 4KY7A 3QG1A 4C3HH 4DV4L 4MZ9A 1Q90A 1CA6A 1GM5A 1VQHA 3J81j 1PV4A 3QOJA 5C4XG 4EGVA 4WORA 3Q6SA 4IUNA 3U9SA 5C44H 3BYYB 1SYBA 1R4PB 1F2YA 2A5HA 3KLSX 4X66Q 5C4HA 4LF9Q 3FKIB 2JQOA 5I4DA 2VUMH 4IQZA 4UDUC 4DR1L 5EJWA 5J39A 1NSNS 4C2MB 3CC7A 1QNKA 3TRZA 4N8FA 1NAPA 3FEWX 1PMRA 5M9OA 4V190 3F2DA 3QB3A 4KN7C 4A3DH 4BXXH 2GVAA 4FVMA 3T1HL 3T51B 1Y1WB 3S14B 5DLQE 2BCOA 2O2LD 4K2LA 4DUZQ 3BDLA 4MHEA 1YZ6A 1UE6A 3I4OA 2OWOA 1M4VA 2YTXA 1GUOA 4G7OC 1WCMB 3NBHA 4HIDA 2R93H 1BUVT 1K8GA 1JOKA 3I4LA 2K4KA 2RSOA 4FNFA 2F0QA 3NHHA 5IGEA 1IYUA 3PIOA 2UXDL 4BS9A 3AMUA 1KABA 3OWFA 3E6ZX 3KBXA 4GLAC 4JYAL 1JJGA 2GVBA 2Q2TA 1KL9A 1D5ZC 1HTPA 3HOZG 1YNJC 3NBHB 1TS4A 4Z9CB 3TZUA 1TWCB 3KDFA 3SGIA 4HCSA 3CF5A 4OO1I 4RA8A 1XNQQ 1RF2D 1F77A 1O7LA 4RHSA 3E9HA 2R7ZH 1M1KC 1AZQA 1K0RA 1SXTA 2NTSA 2B2YC 3S1MB 4C3JG 2K28A 2B63G 3PO2H 1D7QA 4UAIA 1ENAA 3PV0A 1JE5A 2IX0A 5EGTA 3K0XA 4AYBE 2K33A 1F9RA 2KJXA 1JE4A 3J7YW 4ILWA 4IJHA 3U4ZA 1ESFA 3KJPA 4HTHA 2HIVA 2JA7H 2K05A 4DK0A 2F0IA 1PYSB 1DZ1A 2CH4W 4L5TA 4B3SL 5CV5A 4IFDI 2RDGA 4C56C 2OT2A 3P1HA 4QIWB 3M4YA 1PFBA 1VQ5A 4QB4A 1L0YB 3PGZA 2H4OA 1J5EL 1Q1BA 3BZCA 3OIPA 3GTOH 1KAAA 3VA7A 5IYCG 4NKLA 5K5PA 1D5XC 1M8AA 1SSOA 2Z6BA 2UUAL 4LFCQ 1EY4A 5E1FA 4JI3Q 2F0JA 2R92G 3EJIA 3EQLC 4NDXA 4JI2Q 2CHBD 1IBLQ 2KEDA 1YHBA 4QJFA 1C0AA 3X3MA 1UE1A 5JEAJ 1WI5A 3BG3A 3I4NG 3JAML 3E0EA 1BBWA 3IL8A 3CD6A 1RDPD 2QDLA 3SHLA 3U58A 1A15A 4C3HG 4A3GB 1LT5D 4KJOA 2VL6A 4XQNA 4PMWA 2KBNA 4Y52H 2BH8A 1H9SA 4RGOS 1D1KA 3Q23A 2L15A 2R92B 4JI1L 4JBKA 1UEBA 2RQXA 4DNTB 4O42A 1YNJD 1I3QH 1B44D 3CP0A 1K83H 5IYCH 5K36H 4GN5A 4DUZL 5M5YH 4O0AA 1LACA 1X3EA 3P20A 4IPCA 1EIFA 1Y1VH 2AQ1B 3T16A 2JA8B 3VR3A 5E4WC 1I94Q 1SFOH 4DK6C 2YU9B 2RDHA 1W3SA 3K5NA 2PNRC 3T1HQ 2ID0A 5EBCA 3CPFA 3VYSA 2F0MA 4A3KG 4GOPA 1HQRD 2A6HD 1QUQA 1STGA 5JPMC 2KECA 2O5JC 1RD9D 2Q2IA 1B8AA 4K14A 1BCPB 1IYVA 4BBSH 4DV3L 1ASYA 3HKSA 4DR5Q 3DM3A 1UE7A 4LW1A 5I6YA 1GD7A 2AUKA 4JI6L 1DOMA 1J9OA 2D9UA 4HAEA 4PV1C 3I70A 1PXUA 3AFPA 4KKSA 1V1PA 4IO9A 4BY7H 3G7LA 3FKIH 3DMUA 1I50B 3DEPA 3PIP3 2FHTA 1DD2A 5IGFA 4X62L 1KTKA 3TZDA 5C3EH 2EYLA 2WINB 2JA5H 3PSIA 1RHPA 1E1OA 2QW7A 1ILPA 3UDFA 3S17H 3DM1A
chains in the Genus database with same CATH topology
1VDZA 1WTRA 5EPJA 4NW2A 2MGSA 3RMHA 1FGBD 2QF7A 1VF5C 2Z8LA 3GTKB 2A6ED 2R6GA 1SMYD 3CRLC 3D31A 1TIID 2KEEA 3GV6A 1Q1EA 4R9WA 1JOOA 1XYIA 1ILQA 4C3IB 3IFDA 4CKCA 1HRJA 4IUPA 3IKJA 3V96A 5LL6X 2EPBA 2ZXPA 3TP5A 3QWNA 2X6LA 1AW7A 4A3JB 4H13C 4IZ8A 4WRDA 2A68D 4PQXA 5E3FA 3DHQA 1QE6A 1RODA 2HCIA 1G291 3MXNA 1E2VA 2XVSA 1TT2A 2F03A 5C3EB 2EYJA 4X3KA 4CHTB 1UNSA 4EQNA 4LJZC 1E2ZA 1WTPA 4A3MB 3ZYYX 5FLXE 5EPLA 3K0YA 1AFPA 3SK5A 3BDCA 1I4HA 5D3IB 1R4QB 1U4LA 5C4ZA 2BA0A 5TSSA 2F0EA 2KA7A 2EDGA 2QKIC 4G57A 3R2TA 1SDFA 5LL6S 2PMZB 1WVLA 4CJ2C 1DCZA 1HXYD 1GUGA 4TRDA 1STBA 2B2VA 4PMBA 2K03A 4B08A 3T4AC 3VYUA 1PTOD 1SNOA 5CC4A 5C6AA 5M5XB 4DXFA 5ELCA 2EZVA 2HUGA 1BR9A 1PLFA 1G2SA 3OIQA 3K7AB 3OHXC 4KI0A 1EY9A 1EWCA 1SNDA 2CW0C 3E5SA 1K83B 1WTQA 4K5VA 1IKMA 3OMGA 1BF4A 5I6WA 2L4NA 5IT9L 2WKCA 5JVG3 2IX1A 2XWJB 3DXJC 5KNBA 4HMIA 4I7ZC 1EEFD 1TVXA 2X69A 1B2TA 1WD0A 4QUCA 3HOUB 2MJ8A 5K36G 2RKSA 4FYDA 1RKNA 3DWQA 4N9TA 5HURA 4FF4A 1LT4D 4DA2A 3EVQA 2Z1CA 1EY7A 2VNUD 2K7VA 3LX0A 1TU2B 3L3OC 3J80E 1FYCA 5JEAG 5F2DA 2R3ZA 1ZYRD 3S1NB 1EU4A 4KD4A 1ESRA 3TDQA 1SYGA 1FNVA 1GXDC 4H0LC 1HUMA 1SE4A 1SE3A 1V43A 3NP8A 1AN8A 1U9RA 4DNRB 1MD2D 1YNNC 1LTID 3SDZA 1WTWA 1STAA 2K5DA 3H6MA 1MGSA 3M7GA 5EQ0A 2EYPA 4CKEA 1RTOA 2L11A 2XWBB 2B2WA 1C4QA 1S5DD 2F3WA 4NP5A 1BQQT 2L12A 3FPUB 1CI3M 3W2DA 2M9VA 1VMPA 2RA4A 4DAPA 2KUMA 1GUNA 4RKLA 1CHPD 1GUWA 2TSSA 1A3VA 1WTXA 3QIAA 2B2TC 3F2UA 5LHY1 1XWEA 5C3XA 1EY5A 1G2TA 4S3SA 4A3DB 2E2HB 3VR4A 1EFID 3PUZA 4OIKA 4RCOA 2J0TD 1I6HB 3IAYA 3MA2B 4HCEA 3OW7A 2KVMA 1IKLA 5IGCA 1TS3A 4CBVA 3CRKC 5FO8B 1JWUD 2EOTA 2GA4B 4A3BB 3A8KE 1DOLA 1JORA 2AQ2B 4ZLTF 4RWSC 2NBFA 3OSOA 3AB9A 5CV4A 4F7XA 1XTCD 1BBXC 1I6VC 4G4KA 4FXKC 1DOKA 3MAQA 3HOXB 3BVZA 2V4DA 2F0VA 4IUUA 3C46A 1HA5A 3A7LA 1EYDA 3T13A 2KCNA 2PCFB 2ICIA 1JCKB 1F2LA 1I4QA 2L5TA 1XXGA 2A6HC 3P75A 1B1ZA 1UAPA 4ABNA 3T56B 3OPOA 3VA5A 1EY6A 2FMCA 1LTTD 4IALA 4BY1B 3DUZA 4DF7A 3VR6A 1MSHA 2I07B 1AP0A 4OHJA 1IW7C 2C9OA 4ZK9B 3D4RA 4XT1B 2TMPA 3EFXD 4K6LA 2B2TA 1JICA 3NE5B 3Q0AA 4OO1H 1F9QA 3ND8A 4XQJA 2F0SA 3VR5A 4H44C 3RZOB 3KUPA 3R2IA 1HFNA 3S16B 2K32A 2NN6I 5J22A 1PRTD 4OL7A 1O78A 1KNEA 4MN3A 2JP1A 3J80L 5AFWA 3D3RA 1SEBD 1ZEQX 4IFDG 4A3FB 2F0OA 4CKBA 2BDOA 1EY0A 2L0CA 4L8JA 3Q22A 4XXEA 5A35A 5IGBA 1AZPA 4J8QA 5BN5A 1SBBB 1U4MA 2ZT9C 2WP8J 3NQTA 1XX8A 5M3FB 3KLSA 1Y1VB 2SOBA 3IFTA 1STHA 2XSCA 2EYHA 1Q12A 5COYA 3WDNA 3HGBA 2G9DA 1Q3LA 1NCVA 4OO1G 3T53B 3S1RB 3WOEA 1FD7D 5FO9B 5D3DA 2JEAI 2F0NA 3RD4A 3VYRA 1Z47A 2PZTA 3SE0A 4CJ1B 2RBMA 5CV6A 4X3SA 4QCLA 1ONLA 1V1OA 2JE6I 5M5WB 1RJTA 2QCPX 1QOHA 4DK1A 1RTNA 5A2QE 3U9OA 4ZYSA 1SAPA 3BDOA 1Y8NB 1GUSA 4OGQC 1OXVA 4K5XA 1BOSA 1DJRD 3J7AV 2ENBA 1PTOB 4BBSB 3RLFA 1STEA 2BDNA 2WIIB 2WV6D 1EOTA 2OF1A 4MIUA 1KNAA 1LABA 2JEBI 3PUYA 3EROA 3ND9A 1SJED 1OO9B 4K8IA 1MSGA 1LTRD 2XIWA 2DNEA 1UEAB 2NVTB 4J6HA 4TKOB 3HOYB 1A3TA 3LNNA 2NB0A 4RFBA 1II3A 1DONA 2EE1A 2JYOA 5KRUA 5ELFA 1ET9A 3MXPA 3PUVA 1BXTA 2PYKA 1FR3A 1JQYD 5C5MA 1EQTA 3PIO3 1H9MA 5CBAE 1ENFA 1S5ED 5JJZA 2B2YA 3HG9A 1EIHA 4A3IB 1GHJA 4IFDJ 3KBGA 1TY0A 4KY5A 5T1IA 1I4XA 3NUCA 4U68A 5IOCA 3V2TA 4C3JB 1H9JA 4OIJA 1QB5D 2FFKB 2DY8A 1SMYC 5ELEA 3FVQA 1KDCA 4KKUA 2NYZD 2VUMB 1TWFB 2J7ZA 4RHRA 3SK6A 4FP5D 3TP6A 5KNDA 3K58A 2Q8TA 3FDTA 2Q8IB 2EJMA 2SDFA 3K6OA 1VF7A 1X3QA 5D65A 2F3VA 1EQVA 2F1MA 3S1QB 1TS2A 1FNUA 2BE5D 2VXWA 4F88A 1B4OA 4LAAA 3S2DB 4O1NA 3MTSA 3HP3A 1SYFA 3I4NB 3CHBD 3KLRA 2HCCA 3AU7A 3S15B 5KEEA 2IPKD 4E6IA 3K57A 2F0TA 1Y69U 2JXMB 3S2HB 2NZ1D 4PMCA 3R8BA 2IWHA 5CMDA 2DY7A 2CQAA 3S9WA 3D4DA 2NVXB 2A73B 4HR7B 1CFMA 3RUZA 5C44B 3D6CA 4DAYA 4B9XA 5IIFA 1D6EC 3PUXA 3MFGA 1PDQA 2F0DA 1BNZA 4EQOA 2CVRA 1CZGA 2JSOA 4F8MA 4QF4A 4XT3B 4TQUS 4XYQA 4PNYA 1CZWA 1ZXTA 4K8JA 3MZ5A 3PUWA 4M8AA 3H94A 3DWPA 5IGGA 2Z4IA 2E75C 2PQEA 1LTBD 2K5QA 2NUCA 3MHBA 1AEXA 5A2QL 3H3VC 3A55A 3S17B 1K8OA 4A3EB 1IW7D 4HN7A 3L7ZC 4FF2A 1ZYRC 3I73A 4DGZA 2G9HD 2EXZA 4IUVA 1TQOA 2ZXOA 1PRTC 2WKDA 2L55A 1TR5A 1F9PA 4ID6A 4KTAA 1DXMA 3OWEB 4K2KA 2B2VC 1U4PA 2PW7A 2E74C 3CQZB 1F2ZA 3BYTB 1YNND 1PFMA 3C1EA 1O80A 1WTOA 4J1MA 1STYA 2RDFA 1SNQA 4Q0FA 4EVOA 5E4XA 1OXSC 3H91A 2B8GA 4HSPA 1LTAD 4BBRB 1BCPF 2KQ3A 3NPPA 5IT9E 1Z6HA 2JA5B 3A7AB 1H9SB 3PMFA 1HHVA 2QILA 3NQIA 2N88A 4HEDA 3HOVB 2R61A 2EY1A 4Q5VA 2OEOA 4RAUC 1PRTF 4XQQA 3GTLB 1ML0D 4K5WA 4G7ZC 1ICWA 2EY5A 1Y8PB 2EYFA 3KF8A 2WACA 3CKIB 4EQPA 5FKAC 2A69C 5BN3A 2F0PA 4BA1I 2AQ3B 2Z4HA 5BN4A 1B53A 1E2WA 4LK1C 3D6WA 2WAQB 5I2YA 1SE2A 2WB1B 1SFOB 3ITPA 4DAVA 4C1NK 4DN4M 1B9MA 1BCPC 4XDXA 2AUJD 1G6ZA 1IL8A 1H9RA 2D2CC 4RH6A 2I46A 5EKKA 3P7JA 1LT3D 2R7ZB 5CV8A 1QILA 3VR2A 2AWNA 1PZID 3R3OA 3NWSA 4V0BA 1I4RA 1SNCA 1EEID 1SYCA 4KD3A 1VCIA 4K6DA 1PFNA 2H1EA 3OOCA 4ZUJA 1V8QA 4YIJA 5KYLA 2B39A 2K5WA 1OXUA 1T5EA 3BVGA 3GTOB 5G3LD 1HPCA 5DNFA 3NTHA 5FOBB 5I9OA 2Q8RE 4H7BA 2R93B 3C1FA 4DFAA 5JAVA 2RVLA 1G91A 2PW5A 3FPPA 2JA7B 2D62A 2EVBA 2OXPA 4JK1C 4KHVA 1WD1A 1SNPA 4KJNA 3GP7A 1TWAB 3DWAA 5EPKA 1DM0B 2PO4A 2E2JB 1X3PA 3I3CA 4HSVA 5FK9C 4KV6A 1WTVA 1W6JA 1A2TA 3J81E 1KDAA 5EKIA 1LO5D 1PTOF 2EJGC 1A6XA 4GZYC 5ELBA 5HGTA 2O4XA 4I65A 3I4MB 2F0KA 4FO2A 2NN6H 4G7HC 4IURA 3KK7A 4QUFA 3EA6A 4KK7A 2B2WC 1RCVD 3GTQB 1MBYA 1JWSD 1T5XD 2E76C 2Y0SB 1JC7A 1S4ZA 2DNCA 2FJ2A 1KLUD 2FINB 1TY2A 2QEJC 3V05A 4ME5A 1Z7TA 3G6JB 2F0UA 2BE5C 5C0XI 1GUTA 4R8NA 4Y7NB 2XN9C 3NXWA 3HS0C 2EYMA 3BVMA 4ZKCB 4X3UA 3TMEA 3NTKA 3HOZB 2ZXRA 3HOWB 1ENCA 2C5CA 4AYBB 1PTOC 2IX3A 2EYOA 4ODGA 5JPNC 3FMCA 5DEHA 3MWYW 1D2BA 3QOLA 1H9KA 2X6GA 2B63B 3PO3B 3RZDB 3UI2A 4C3HB 1PYWD 3N52A 1S5CD 2AWOA 5M3MB 1U4RA 3JAME 1MI2A 1Y8OB 2PZUA 3GV3A 2L1BA 2NWGA 1QNUA 1ET6A 1PRTB 4KHZA 2IJ0A 1O7ZA 2FMMA 1LT6D 4FXGC 1EY8A 2IW3A 2EY2A 4L63B 4WJWA 4LMQD 1V1PB 1HQMC 1JWMD 1TS5A 1I4GA 2N55A 1CT1D 2MP1A 1LTGD 3H0GB 5KYIA 3BZDB 2F4IA 1KLGD 4ZKBB 1G8ZD 1S5FD 2F0FA 1EU3A 3MXUA 4IN3A 2A74C 2PZWA 2K1BA 4KKTA 1NUCA 5FO7B 1B9NA 2A6EC 3QJYA 5C5LA 3D8GA 2JA6B 1B3AA 5JVH3 2ICEC 1HA6A 3SEBA 1HFGA 3GQBA 2NTTA 1O7YA 3NTIA 2A69D 1TWGB 4A3KB 3M4OB 2NVYB 1W6KA 3HEJA 3W3AA 3NSWA 2BA1A 4BWGB 3CU7A 2RSNA 3TP7A 1BDOA 4QMGA 3Q24A 5CYUA 2MHVA 1X32A 5ISRA 5FLXL 1Q8IA 1F9SA 5EKLA 5J1ZA 3BS1A 1KDBA 5D14A 3GTJB 1GJXA 3GO5A 4N9PA 1J8IA 1D1IA 1C48A 3SVMA 2NN6G 3NBIA 1OXXK 3H09A 2MPMA 5M5YB 2M00A 3A54A 1CK1A 2D5DA 1EWHA 4IUQA 1I3QB 2EY6A 4DXGA 4C3IG 4IFDH 2XRQD 2CW0D 1I4PA 4C1NI 1EZ8A 1STNA 4WFN3 1IHZA 2BOSA 3WOFA 3A8IE 2XRSD 2E2IB 2NVQB 4HMJA 3HKZB 3I90A 1PZJD 3SK4A 2LFNA 2L9HA 1LV9A 5C3WA 1VMCA 4ZAIA 1HUNA 4RKBA 5G3LF 4TSSA 3TP8A 1EYCA 2HDLA 4KN4C 3ERQA 1QG7A 4L6TB 1LTSD 1R9TB 1B50A 2YYZA 3NK9A 2HQEA 3K59A 2LMCB 3VYTA 3D4WA 4CGYB 1OXTA 4RCNA 3A8JE 3L9AX 1CQFA 4XYOA 2KHSA 1EL0A 2K01A 4R8IA 3K5LA 3PO2B 5CGKA 2B8FA 2SEBD 1SJHD 3MEHA 3MC0B 2LY7A 1BO0A 4FXDA 3I72A 1JOQA 5DAUA 3TBIB 1UUPA 3I91A 2PPBC 1SYEA 4RGNA 2XNAC 5T1GA 3MXGA 1CA5A 2E2DC 5CV9A 4ZUIA 3C2PA 5KIXA 4ZRZA 3N6RA 3O13A 5KNCA 3TN2A 4FF1A 2K04A 1CTMA 1EYAA 1SNMA 2F0LA 1NR2A 2K6AA 2M2LA 2VB3X 4CJ0B 2F0HA 3NWTA 1HTLD 5I2XA 1PTOH 2IL8A 1HCZA 1EZ6A 4BA2I 3DEOA 1JR0D 4X3TA 3J7AF 1PZKD 1SYDA 3GTPB 1TWHB 4DU9A 1C8CA 2DN8A 5CR3A 1L0XB 4RGTA 5ELDA 1BCPD 3M7NA 1ZKOA 2QDBA 3GTGB 2SNSA 4NMZA 2J4XA 5C0XG 5C0XJ 3ONAB 3X3NA 1S5BD 4P2CB 3HRZC 5CORA 3LWEA 5DM63 5C0XH 2B2UA 2EJFC 1DYQA 3K5OA 4ULLA 2B2UC 4JBWA 1GHKA 4XTCS 4ZQ3A 5IODA 4RGMA 2MUYA 3GD7A 4KY6A 3E0JA 3SK8A 1GOZA 3K5MA 5CV7A 3URYA 5I9PA 2HDMA 1CQVA 4IUTA 3SR1A 1A3UA 1NR4A 1CHQD 3M85A 1FNWA 2SNMA 1QCBD 3SXHA 2LS01 2O5IC 2F0GA 3I8ZA 4B9WA 1LLRD 1QWYA 2F0WA 4KMUC 4FF3A 2A68C 3MFYA 1CM9A 5C4JB 1F2MA 3GTMB 1E0BA 4M1UB 3LWUA 1A2UA 3FRPB 3HZXA 4U673 2VB2X 3QO2A 2IT1A 2KCCA 4A93B 1QJOA 1D5MC 3OMCA 5KGUA 3J81L 3A56A 4F87A 5EBDA 1EIGA 5C4XB 5IGDA 1JB3A 5JOBA 5JEAH 1TKWB 1K8MA 5NUCA 3TSSA 5CBEE 5DM73 2KOLA 4BY7B 3R93A 2LKVA 3M3YB 4XIGS 3C3LA 3MVVA 4KY7A 3QG1A 1Q90A 1CA6A 3QOJA 4EGVA 4WORA 3Q6SA 4IUNA 3U9SA 3BYYB 1SYBA 1R4PB 1F2YA 2A5HA 3KLSX 5C4HA 3FKIB 5I4DA 4IQZA 4UDUC 5EJWA 5J39A 1NSNS 4C2MB 1QNKA 1NAPA 3FEWX 1PMRA 5M9OA 4V190 3QB3A 4KN7C 4FVMA 3S14B 3T51B 1Y1WB 2BCOA 2O2LD 4K2LA 3BDLA 4MHEA 1M4VA 1GUOA 4G7OC 1WCMB 3NBHA 1BUVT 1JOKA 3I4LA 2RSOA 4FNFA 2F0QA 3NHHA 5IGEA 1IYUA 4BS9A 3AMUA 1KABA 3OWFA 3E6ZX 3KBXA 1D5ZC 1HTPA 1YNJC 1TS4A 4Z9CB 3TZUA 1TWCB 4OO1I 4HCSA 4RA8A 1RF2D 1F77A 1O7LA 4RHSA 1AZQA 2NTSA 1SXTA 2B2YC 3S1MB 4C3JG 2K28A 4UAIA 1ENAA 3PV0A 2IX0A 5EGTA 2K33A 1F9RA 2KJXA 1JE4A 3J7YW 4ILWA 1ESFA 4HTHA 2K05A 4DK0A 2F0IA 1DZ1A 5CV5A 4IFDI 2RDGA 4C56C 2OT2A 3P1HA 4QIWB 3M4YA 1PFBA 4QB4A 1L0YB 2H4OA 1Q1BA 3OIPA 1KAAA 3VA7A 4NKLA 5K5PA 1D5XC 1M8AA 1SSOA 1EY4A 5E1FA 2F0JA 3EJIA 3EQLC 4NDXA 2CHBD 2KEDA 3X3MA 5JEAJ 3BG3A 3JAML 3IL8A 1RDPD 3SHLA 1A15A 4C3HG 4A3GB 1LT5D 4KJOA 4XQNA 4PMWA 1H9SA 4RGOS 1D1KA 3Q23A 2R92B 2RQXA 4DNTB 4O42A 1YNJD 1B44D 5K36H 1LACA 3P20A 2AQ1B 3T16A 2JA8B 3VR3A 5E4WC 2YU9B 2RDHA 3K5NA 2PNRC 2ID0A 5EBCA 3VYSA 2F0MA 1HQRD 2A6HD 5JPMC 1STGA 2KECA 2O5JC 1RD9D 4K14A 1BCPB 1IYVA 5I6YA 2AUKA 1DOMA 1J9OA 2D9UA 4HAEA 4PV1C 3I70A 1PXUA 4KKSA 1V1PA 3G7LA 3DMUA 1I50B 3DEPA 3PIP3 2FHTA 1DD2A 5IGFA 1KTKA 3TZDA 2EYLA 2WINB 1RHPA 1ILPA 3DM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DGZ A;  1KAA A;  1SYB A;  1F2Y A;  2EY2 A;  4G57 A;  4ZQ3 A;  5IOD A;  1SYG A;  3OSO A;  4NKL A;  5C4H A;  5HGT A;  2O4X A;  4I65 A;  2EXZ A;  5K5P A;  5CV4 A;  4F7X A;  1JOQ A;  1TQO A;  1EY4 A;  4KY6 A;  5DAU A;  2OF1 A;  5E1F A;  2F0K A;  4MIU A;  1TR5 A;  5J39 A;  1NSN S;  2F0J A;  3SK8 A;  3NP8 A;  1U9R A;  4ID6 A;  4TRD A;  3EJI A;  1STB A;  4KTA A;  4LAA A;  4NDX A;  5CV7 A;  3ERO A;  1SYE A;  5M9O A;  5I9P A;  2F0O A;  2F0V A;  3QB3 A;  4K8I A;  1SYF A;  4PMB A;  1STA A;  3SR1 A;  1A3U A;  3H6M A;  4K2K A;  5EKK A;  1EY0 A;  2M00 A;  1SNO A;  2PW7 A;  5CC4 A;  1F2Z A;  2SNM A;  5CV8 A;  5KYI A;  3SHL A;  1EYD A;  4K2L A;  3SXH A;  4J6H A;  3T13 A;  3BDL A;  5C6A A;  5CV9 A;  4ZUI A;  4KJO A;  5KIX A;  2F0G A;  3R3O A;  2EYP A;  1JOO A;  3C1E A;  5IGB A;  5KEE A;  4E6I A;  2EY6 A;  4ME5 A;  2F0T A;  4J1M A;  4B9W A;  1STY A;  2RDF A;  1SNC A;  1SNQ A;  4PMC A;  1SYC A;  2F3W A;  2F0F A;  2F0U A;  1A3T A;  4KD3 A;  3NQT A;  4NP5 A;  4EVO A;  1JOK A;  3P75 A;  1II3 A;  4K6D A;  1EY9 A;  2F0W A;  4R8N A;  2PZW A;  1EZ8 A;  4YIJ A;  2F0Q A;  1EYA A;  1SNM A;  4ZUJ A;  2F0L A;  1STN A;  5KYL A;  1NUC A;  5KRU A;  2SOB A;  3NXW A;  1SND A;  5C5L A;  3NHH A;  3D4D A;  2EYM A;  3MXP A;  5IGE A;  3S9W A;  2PYK A;  2F0H A;  1IHZ A;  3E5S A;  3D8G A;  3RUZ A;  1STH A;  1KAB A;  2EYH A;  2KQ3 A;  1F2M A;  5C5M A;  4K5V A;  3VA5 A;  3OWF A;  3D6C A;  3TP5 A;  1EY6 A;  3T16 A;  4B9X A;  5IIF A;  4HMJ A;  3TME A;  4IZ8 A;  4WRD A;  4KD4 A;  5I9O A;  3OMG A;  4IAL A;  2F0D A;  4RKL A;  5I6W A;  4H7B A;  1A2U A;  4EQO A;  3C1F A;  3HZX A;  3PMF A;  1ENC A;  1A3V A;  3SK4 A;  4DFA A;  5JAV A;  1EZ6 A;  5E3F A;  4DF7 A;  3DHQ A;  2F0M A;  2PW5 A;  2EYO A;  4ODG A;  5C3W A;  2EY1 A;  4F8M A;  4RKB A;  4QF4 A;  1SYD A;  1STG A;  2OEO A;  4HMI A;  3TP8 A;  4KY5 A;  3HEJ A;  1EYC A;  1EY5 A;  5C3X A;  3OMC A;  2F0N A;  3NUC A;  5KGU A;  2OXP A;  4DU9 A;  3ERQ A;  5DEH A;  5IOC A;  1TT2 A;  2PZT A;  3QOL A;  4K14 A;  4S3S A;  5CR3 A;  4K5W A;  4PNY A;  3NK9 A;  4KHV A;  2HQE A;  3V2T A;  2RKS A;  1RKN A;  4K8J A;  5IGD A;  2RBM A;  2EY5 A;  3TP7 A;  1SNP A;  5CV6 A;  4KJN A;  2QDB A;  5JOB A;  5I6Y A;  3MZ5 A;  2EYF A;  1ENA A;  3D4W A;  4QMG A;  5NUC A;  2EYJ A;  2WAC A;  4N9P A;  5EGT A;  5IGG A;  2SNS A;  4N9T A;  4NMZ A;  4EQP A;  4EQN A;  1KDC A;  2PQE A;  5HUR A;  2F0S A;  2F0P A;  3U9O A;  2KHS A;  5IGC A;  4HTH A;  2NUC A;  3SK6 A;  3DMU A;  3TP6 A;  2LKV A;  3EVQ A;  3SK5 A;  3BDC A;  1AEX A;  3MHB A;  5ISR A;  2F0I A;  1EY7 A;  4KV6 A;  2PZU A;  5CV5 A;  3MVV A;  4KY7 A;  3LX0 A;  5EKL A;  5J1Z A;  1A2T A;  1KDB A;  5IGF A;  5J22 A;  4K5X A;  3P1H A;  4OL7 A;  1KDA A;  5CGK A;  5C4Z A;  2ENB A;  2EYL A;  2F3V A;  5F2D A;  1EQV A;  4QB4 A;  1JOR A;  3MEH A;  1EY8 A;  2F0E A;  3QOJ A;  4WOR A;  4IUN A;  3ITP A; 
#chains in the Genus database with same CATH topology
 5JJK A;  2AKW B;  1VDZ A;  2CQO A;  1WTH A;  4O2D A;  2A8V A;  1WTR A;  4RMF A;  5EPJ A;  1W2B A;  4NW2 A;  2MGS A;  3M4O H;  2VQF Q;  3RMH A;  3RNU A;  2ZTE A;  1VQK A;  4B3T L;  4A3I G;  1FGB D;  5IYD G;  2QF7 A;  2ZTC A;  1VF5 C;  2Z8L A;  1EWI A;  3GTK B;  2A6E D;  2R6G A;  4APV A;  1SMY D;  4X62 Q;  3CRL C;  3D31 A;  3GTM H;  1TII D;  2KEE A;  1M90 C;  3GV6 A;  1Q1E A;  4R9W A;  1JOO A;  1SRO A;  1VQ4 A;  1XYI A;  4NPS A;  5M3F H;  4B3M Q;  1ILQ A;  4C3I B;  3CME A;  3IFD A;  4UP7 A;  2VUM G;  4CKC A;  1HRJ A;  4DR4 L;  4IUP A;  5ELN A;  3IKJ A;  1UWV A;  5C4J H;  2DGY A;  4A3D G;  3V96 A;  5LL6 X;  2EPB A;  4LF5 Q;  1FJG L;  4DR3 Q;  2ZXP A;  4GKJ Q;  3TP5 A;  3QWN A;  2X6L A;  1AW7 A;  4A3J B;  2Z9H A;  4H13 C;  1L2F A;  4IZ8 A;  4WRD A;  2E5L L;  3HOW G;  5FJ8 G;  4A3L G;  2A68 D;  1VQM A;  4PQX A;  5E3F A;  4DAM A;  4B3M L;  3AEV A;  3DHQ A;  1QE6 A;  1ROD A;  2HCI A;  1G29 1;  1K3B C;  1IL2 A;  3MXN A;  3OW2 A;  1KHI A;  4LF4 L;  1E2V A;  4X6A H;  5FJ8 H;  4LNQ A;  2A19 A;  2XVS A;  1TT2 A;  2JJQ A;  3F2C A;  1VQO A;  2JK8 A;  3H0G G;  2F03 A;  5C3E B;  2EYJ A;  4X3K A;  4JI7 Q;  4LFB Q;  4CHT B;  1UNS A;  3RR5 A;  4EQN A;  2FXQ A;  4LJZ C;  1E2Z A;  2E5L Q;  1WTP A;  4L5R C;  4A3M B;  1PH4 A;  3ZYY X;  5FLX E;  5EPL A;  3K0Y A;  1AFP A;  3SK5 A;  3PIP A;  3BDC A;  1IBL L;  1I4H A;  5D3I B;  1R4Q B;  1U4L A;  1K0S A;  5C4Z A;  2F4V Q;  4LFA L;  2BA0 A;  3U4V A;  5TSS A;  3FP9 A;  1VQB A;  4IPG A;  3UE1 A;  1VQL A;  2F0E A;  4DV6 Q;  2KA7 A;  2EDG A;  2JA5 G;  2QKI C;  4G57 A;  3R2T A;  2CWA A;  1I50 H;  1SDF A;  1B7Y B;  5LL6 S;  3K8A A;  2PMZ B;  1WVL A;  4CJ2 C;  1DCZ A;  1HXY D;  1GUG A;  4TRD A;  1STB A;  2PNH A;  1SRU A;  2B2V A;  4DV1 L;  3HFZ B;  1Q86 C;  4PMB A;  1BBU A;  2K03 A;  4B08 A;  3T4A C;  2HD3 A;  3VYU A;  1PTO D;  1SNO A;  5CC4 A;  2F4V L;  3S15 H;  1N36 Q;  2R7Z G;  5C6A A;  5M5X B;  1S3O A;  5ELC A;  4DXF A;  2EZV A;  4GNX A;  1I5F A;  1XTD A;  4JG2 A;  2HUG A;  1Y14 B;  2N78 A;  1BR9 A;  1PLF A;  2ASB A;  1G2S A;  3HOX G;  1KRT A;  3OIQ A;  3K7A B;  3OHX C;  4KI0 A;  1TXY A;  4R4Q A;  1EY9 A;  4ALP A;  3OYY A;  1EWC A;  4ZCK A;  1SND A;  4P71 A;  2CW0 C;  4HIK A;  3E5S A;  1K83 B;  1WTQ A;  2UU9 L;  1HNX L;  4K5V A;  2OCE A;  1IKM A;  3OMG A;  5I6W A;  2L4N A;  1BF4 A;  5IT9 L;  2WKC A;  2R93 G;  3M4P A;  5JVG 3;  1MKH A;  2IX1 A;  3NEN A;  3I56 A;  2XWJ B;  1EYG A;  3DXJ C;  1Q81 C;  2Y0S E;  1HZB A;  5KNB A;  4HMI A;  4I7Z C;  1EEF D;  1TVX A;  2X69 A;  4A3G H;  2IY5 B;  1B2T A;  1WD0 A;  4QUC A;  1KRS A;  4HIM A;  3HOU B;  2MJ8 A;  2UUC L;  5K36 G;  2RKS A;  4JI8 L;  1RKN A;  3M9B A;  4FYD A;  3UDG A;  1HNZ L;  4AIM A;  1ICF B;  1SE8 A;  3DWQ A;  4N9T A;  2OTL A;  1HH2 P;  5HUR A;  4CDE C;  1Q8K A;  4FF4 A;  1LT4 D;  4LF8 L;  2KHJ A;  4DA2 A;  3A5Z B;  1EQR A;  2Z1C A;  3EVQ A;  4A3C H;  1EY7 A;  2VNU D;  2K7V A;  1QUQ B;  3LX0 A;  1TU2 B;  4YY3 Q;  2K5H A;  3S1N H;  3MEF A;  3L3O C;  2N3S A;  3J80 E;  1FYC A;  5JEA G;  5F2D A;  2R3Z A;  1ZYR D;  3S1N B;  1EU4 A;  4C3J H;  1Q82 C;  4KD4 A;  1A63 A;  1ESR A;  3TDQ A;  1SYG A;  1FNV A;  1HNZ Q;  1GXD C;  4H0L C;  2XTI A;  3I4M G;  1HUM A;  1SE4 A;  1HJP A;  2YTY A;  1SE3 A;  1V43 A;  3NP8 A;  1AN8 A;  1U9R A;  4DNR B;  2JA7 G;  1MD2 D;  1N33 L;  1YNN C;  1LTI D;  3SDZ A;  4YWK A;  1WTW A;  1STA A;  2K5D A;  3H6M A;  1MGS A;  3M7G A;  1U5K A;  5EQ0 A;  5IYB G;  2EYP A;  4CKE A;  1RTO A;  1PHJ A;  3FHW A;  2L11 A;  2XWB B;  2B2W A;  3J7A 5;  1C4Q A;  1S5D D;  2F3W A;  5LMU L;  4DV0 L;  4NP5 A;  3M4Q A;  1BQQ T;  2L12 A;  3FPU B;  2KHI A;  4B3R Q;  1CI3 M;  4LUO A;  1HZC A;  3W2D A;  2M9V A;  1VMP A;  2RA4 A;  2EQS A;  4DAP A;  1PFS A;  2KUM A;  1K28 A;  4UPA A;  4DPG A;  1GUN A;  1NNX A;  5C3E G;  3NEM A;  4RKL A;  1CHP D;  1GUW A;  2TSS A;  5JJI A;  1A3V A;  1WCM H;  1CSP A;  1WTX A;  4A3L H;  3QIA A;  2B2T C;  3F2U A;  5LHY 1;  1XWE A;  1B70 B;  4MTN A;  1N8R C;  5M5X H;  5C3X A;  1EY5 A;  1VQI A;  4DUY Q;  1KQS A;  4A75 A;  1G2T A;  4S3S A;  4A3D B;  5GAH C;  3CCR A;  2E2H B;  3VR4 A;  1EFI D;  4P73 A;  3Q8D A;  2I5L X;  3PUZ A;  4OIK A;  4DV2 L;  4RCO A;  2J0T D;  1I6H B;  3IAY A;  2BH2 A;  3MA2 B;  2UXD Q;  4HCE A;  3OW7 A;  2KVM A;  5M3M G;  1IKL A;  5IT9 c;  5IGC A;  1TS3 A;  2ALY B;  4CBV A;  3CRK C;  5FO8 B;  1JWU D;  1NMG A;  2EOT A;  2GA4 B;  4UY8 C;  4A3B B;  3ULL A;  3A8K E;  1DOL A;  1JOR A;  2AQ2 B;  4ZLT F;  4RWS C;  5AJ3 Q;  2NBF A;  3OSO A;  3AB9 A;  4DV2 Q;  5CV4 A;  4F7X A;  3FKI G;  1XTC D;  1BBX C;  4R4I A;  1I6V C;  4G4K A;  4ME3 A;  4FXK C;  1L0W A;  1DOK A;  4JBJ A;  1SN8 A;  3MAQ A;  3HOX B;  3BVZ A;  4A3K H;  3HOV H;  1HR0 W;  4LF6 L;  2V4D A;  2F0V A;  4IUU A;  3C46 A;  1HA5 A;  4PZ8 A;  4BBS G;  3A7L A;  3PF5 A;  2IHE A;  4BBR H;  3CC4 A;  1EYD A;  3T13 A;  2KCN A;  4RG1 A;  2NVY H;  2PCF B;  2ICI A;  1JCK B;  1F2L A;  1I4Q A;  1NMF A;  2QA4 A;  2L5T A;  4DAY B;  3PF4 A;  1NY4 A;  1XXG A;  2A6H C;  3CCU A;  3P75 A;  1FL0 A;  1B1Z A;  2AMC B;  4LFC L;  2I0Q A;  3T1Y Q;  1UAP A;  2QGQ A;  3CCE A;  4ABN A;  1CKM A;  2C35 B;  1PH5 A;  3T56 B;  3OPO A;  3VA5 A;  1PH3 A;  1EY6 A;  2FMC A;  4NXM L;  1LTT D;  1NTG A;  4GOP B;  4IAL A;  4BY1 B;  5GAG C;  3DUZ A;  1QZH A;  4DF7 A;  3VR6 A;  1MSH A;  4YWL A;  2I07 B;  1AP0 A;  4OHJ A;  1IW7 C;  2C9O A;  1CKN A;  4ZK9 B;  2JN4 A;  3D4R A;  4XT1 B;  4DR2 L;  2TMP A;  3EFX D;  4K6L A;  1IBM L;  1QVC A;  1Q7Y C;  3GTK H;  4A3E H;  1YIT A;  2B2T A;  1JIC A;  1LM0 A;  3NE5 B;  2HQL A;  4L5Q A;  3Q0A A;  1XPR A;  4MTK A;  2UUB Q;  1U0L A;  3K7U C;  4OO1 H;  4BY1 G;  3ND8 A;  1F9Q A;  3AFQ A;  1V9P A;  4XQJ A;  2F0S A;  3VR5 A;  3TEH B;  4H44 C;  4X64 L;  3RZO B;  4A93 H;  4LFA Q;  3KUP A;  2B29 A;  3R2I A;  4IOC A;  4JI0 Q;  1HFN A;  5M3M H;  4DUY L;  3S16 B;  2K32 A;  2NN6 I;  5J22 A;  1PRT D;  4OL7 A;  1O78 A;  1KNE A;  3PO3 H;  4DR2 Q;  4POF A;  4MN3 A;  2JP1 A;  3J80 L;  3STB D;  4P75 A;  5LMN W;  5AFW A;  1X56 A;  1AE3 A;  1OTC A;  3LGJ A;  5M3F G;  3D3R A;  1SEB D;  1ZEQ X;  1KD1 C;  4IFD G;  1VQ8 A;  4A3F B;  2F0O A;  4JI0 L;  2B63 H;  4JV5 Q;  4CKB A;  2BDO A;  1EY0 A;  2L0C A;  4L8J A;  1VQ7 A;  1K3R A;  3J80 i;  1TWH H;  4J15 A;  5E7N A;  3Q22 A;  2NVX H;  2PQA B;  5AJ3 L;  4OX9 Q;  4XXE A;  3KF6 A;  5A35 A;  5IGB A;  1AZP A;  4DV7 Q;  1PYB A;  4J8Q A;  4HJ5 A;  5BN5 A;  1SBB B;  1U4M A;  2ZT9 C;  2WP8 J;  4HIO A;  3NQT A;  1XMQ L;  1XX8 A;  5M3F B;  3KLS A;  2ZJQ A;  1KIX A;  1Y1V B;  2SOB A;  4DV5 L;  4JYA Q;  2V1C C;  5ELO A;  3IFT A;  1STH A;  1DGS A;  2XSC A;  4POG A;  2EYH A;  3GTQ H;  1Q12 A;  3BU2 A;  3H15 A;  5COY A;  3WDN A;  3HGB A;  2G9D A;  1Q3L A;  1NCV A;  3HOX H;  4OO1 G;  3T53 B;  3CCJ A;  3S1R B;  2HT1 A;  3WOE A;  3W1G A;  4K0K L;  1FD7 D;  5FO9 B;  3A74 A;  5D3D A;  4DNI A;  2JEA I;  2F0N A;  2N8N A;  3RD4 A;  3VYR A;  5FLM G;  1Z47 A;  2PZT A;  1YJ9 A;  1GVP A;  1UE5 A;  3S1Q H;  3SE0 A;  4CJ1 B;  2RBM A;  5CV6 A;  4X3S A;  1K8A C;  1ONL A;  4QCL A;  4A3B H;  1V1O A;  2JE6 I;  5M5W B;  2UXB L;  1RJT A;  2QCP X;  5FLM H;  1QOH A;  4DK1 A;  1RTN A;  5IP9 H;  1K73 C;  5A2Q E;  3U9O A;  4ZYS A;  1WCM G;  1SAP A;  2HHH L;  2Q2U A;  3BDO A;  1Y8N B;  1GUS A;  2YTV A;  4OWT B;  4OGQ C;  4LF6 Q;  1OXV A;  4K5X A;  1BOS A;  1DJR D;  3J7A V;  1RL2 A;  2ENB A;  1PTO B;  4BBS B;  4PZ6 A;  1HR0 L;  3RLF A;  1STE A;  2BDN A;  2WII B;  1Q46 A;  2WV6 D;  1EOT A;  1VS0 A;  4X65 L;  2OF1 A;  1PH9 A;  4MIU A;  1KNA A;  1LAB A;  2VY3 A;  2JEB I;  3PUY A;  3ERO A;  1S40 A;  1IBK Q;  4OEL B;  3RN5 A;  3ND9 A;  1SJE D;  1OO9 B;  4K8I A;  1MSG A;  1X3G A;  2B3G A;  1E1T A;  1LTR D;  2XIW A;  1N36 L;  2DNE A;  1NE3 A;  3KYH C;  4UHV A;  1QZG A;  1YIJ A;  1UEA B;  2NVT B;  4J6H A;  3PCO B;  4YCV A;  4TKO B;  1X55 A;  4L5S A;  3PQI A;  3HOY B;  4JBM A;  1A3T A;  3LNN A;  2NB0 A;  2WB1 E;  4FDB A;  4RFB A;  4AQY L;  1II3 A;  2ZTD A;  1DON A;  4WJ3 M;  2EE1 A;  3A5U A;  2JYO A;  4JV5 L;  5KRU A;  5ELF A;  1I94 L;  1ET9 A;  3MXP A;  3PUV A;  1BXT A;  2PYK A;  4OEM B;  2OTJ A;  5HGQ A;  1FR3 A;  1JQY D;  1QVF A;  5C5M A;  4EX5 A;  1EQT A;  3PIO 3;  1H9M A;  4DV7 L;  4LWC A;  5CBA E;  1ENF A;  1S5E D;  4X66 L;  5JJZ A;  2HIX A;  2B2Y A;  3S24 A;  3HG9 A;  4JI4 Q;  1EIH A;  2MO0 A;  4A3I B;  1GHJ A;  4IFD J;  3KBG A;  1TY0 A;  4KY5 A;  5T1I A;  1I4X A;  2GN5 A;  3NUC A;  4U68 A;  4GKK L;  5IOC A;  1XMQ Q;  4PG3 A;  3V2T A;  4C3J B;  1X65 A;  4JI5 L;  1H9J A;  4OIJ A;  1IXR A;  1QB5 D;  2FFK B;  2DY8 A;  3J81 c;  4I7A A;  4BXX G;  1SMY C;  3HOU H;  1LYL A;  5ELE A;  3FVQ A;  1KDC A;  1P8L A;  2RCF A;  4KKU A;  2VZA A;  2NYZ D;  2VUM B;  4A3M G;  1TWF B;  2J7Z A;  1A62 A;  4RHR A;  3EN2 A;  4FP5 D;  3SK6 A;  3TP6 A;  5KND A;  3K58 A;  2I5H A;  2Q8T A;  3FDT A;  2Q8I B;  2EJM A;  2SDF A;  3K6O A;  1VF7 A;  1X3Q A;  5D65 A;  2F3V A;  1JMC A;  1EQV A;  2F1M A;  3RLO A;  3S1Q B;  1TS2 A;  4UP8 A;  4LUV A;  3PO3 G;  5IYB H;  4JPB W;  3VDY A;  3HKZ G;  5IP7 G;  1XPO A;  1FNU A;  3S1R H;  2BE5 D;  2VXW A;  3KJO A;  4P72 A;  3W1B A;  4F88 A;  3BJU A;  4JI2 L;  3E3X A;  4WJ4 A;  1B4O A;  4LAA A;  3S2D B;  4O1N A;  3I2Z A;  1C9O A;  3L0O A;  3MTS A;  1Y1V G;  3HP3 A;  5C4X H;  1SYF A;  3I4N B;  3CHB D;  3KLR A;  2HCC A;  4DR4 Q;  3QR8 A;  3AU7 A;  2JA6 H;  3S15 B;  2RCN A;  3CCS A;  5KEE A;  2IPK D;  4E6I A;  3K57 A;  2F0T A;  4KHP Q;  1Y69 U;  3T1Y L;  2JXM B;  3S2H B;  4DR3 L;  2NZ1 D;  4PMC A;  4HJA A;  3R8B A;  2IWH A;  5CMD A;  4A3C G;  2DY7 A;  4C2M H;  3WWV A;  4A3F G;  2CQA A;  3S9W A;  3D4D A;  2NVX B;  2A73 B;  4HR7 B;  3K80 C;  1CFM A;  3RUZ A;  1ASZ A;  1VQ6 A;  5C44 B;  3H3V H;  1XPU A;  3D6C A;  4DAY A;  4B9X A;  4DV4 Q;  4IJL A;  5IIF A;  4A3F H;  1D6E C;  1O7I A;  3PUX A;  3MFG A;  3CW2 C;  1PDQ A;  2F0D A;  1BNZ A;  4EQO A;  2CVR A;  1CZG A;  2JSO A;  2QEX A;  1VQC A;  4OWW B;  2K5V A;  4F8M A;  4JI3 L;  4QF4 A;  4XT3 B;  4TQU S;  1EUJ A;  4XYQ A;  1G51 A;  1XMO Q;  2PQA A;  1XNR L;  3JAM c;  3H0G H;  1JJC B;  4TVA B;  3KDF B;  2ATW A;  1CKO A;  2KCT A;  4PNY A;  3F8T A;  1CZW A;  1ZXT A;  4K8J A;  1L1O B;  1CSQ A;  3MZ5 A;  3RN2 A;  4M8A A;  3PUW A;  3KF8 B;  3H94 A;  2CWP A;  3DWP A;  5IGG A;  5IWA L;  2Z4I A;  5IYD H;  2R7F A;  4JI1 Q;  2E75 C;  2PQE A;  3RZO H;  1LTB D;  2K5Q A;  2NUC A;  4DKA C;  3MHB A;  1AEX A;  5A2Q L;  4JC0 A;  3H3V C;  3A55 A;  4A3M H;  1IBK L;  3S17 B;  1K8O A;  3PO2 G;  4A3E B;  1IW7 D;  2CH4 A;  2EIF A;  4HN7 A;  1L1O A;  1YHQ A;  3L7Z C;  4FF2 A;  3CC2 A;  1ZYR C;  3I73 A;  4DGZ A;  4A3J G;  1C7Y A;  2G9H D;  2EXZ A;  4IUV A;  1TQO A;  2ZXO A;  1PRT C;  2WKD A;  2L55 A;  1TR5 A;  4OX9 L;  1LTL A;  1E3P A;  1F9P A;  3J7Z C;  1KXL A;  4ID6 A;  4KTA A;  4A93 G;  1DXM A;  2H5X A;  2RHS B;  3OWE B;  4K2K A;  2B2V C;  4A3J H;  1U4P A;  2PW7 A;  2E74 C;  3CQZ B;  1F2Z A;  3BYT B;  3DLL A;  2KCM A;  1YNN D;  1PFM A;  2R7D A;  3C1E A;  1O80 A;  1WTO A;  4J1M A;  1STY A;  2RDF A;  1HNX Q;  1SNQ A;  1XJV A;  3S2H H;  4Q0F A;  4EVO A;  3HOZ H;  5E4X A;  1P16 A;  1BKB A;  1OXS C;  4CDF C;  3H91 A;  2B8G A;  4HSP A;  2D0P A;  3J81 i;  3CCM A;  4LF7 L;  1VQN A;  4DR6 Q;  1LTA D;  4BBR B;  1BCP F;  2KQ3 A;  4CDC C;  3NPP A;  5IT9 E;  1Z6H A;  2JA5 B;  3A7A B;  1H9S B;  3PMF A;  3ERS X;  2QIL A;  1HHV A;  3NQI A;  2N88 A;  4HED A;  2P5Z X;  3HOV B;  2VQF L;  2R61 A;  2EY1 A;  4Q5V A;  2OEO A;  4RAU C;  1PRT F;  3CCQ A;  4XQQ A;  3GTL B;  2WB1 G;  1VQJ A;  1ML0 D;  4K5W A;  4G7Z C;  3CXC A;  3GTG H;  4YCW A;  1ICW A;  4BBR G;  3RZD H;  2EY5 A;  4DR6 L;  3L2P A;  1Y8P B;  2EYF A;  3KF8 A;  2WAC A;  3CKI B;  4EQP A;  5FKA C;  2A69 C;  5BN3 A;  2K14 A;  1YJN A;  3GTP H;  5LMU Q;  4DV0 Q;  2F0P A;  4BA1 I;  3HOV G;  2AQ3 B;  2Z4H A;  5BN4 A;  1B53 A;  1E2W A;  4LK1 C;  2OQK A;  3D6W A;  4B3S Q;  4K0K Q;  1EQQ A;  2WAQ B;  5I2Y A;  4JW0 A;  1SE2 A;  2WB1 B;  1SFO B;  4A3B G;  2KEN A;  1GKH A;  2MNA A;  3KOJ A;  2N49 A;  2E2H H;  4JOI A;  3ITP A;  3GDE A;  4LF5 L;  1FJG Q;  4DAV A;  1E22 A;  4C1N K;  4DN4 M;  3KF6 B;  1TWF H;  2G5D A;  1B9M A;  1BCP C;  4XDX A;  4GN3 B;  2AUJ D;  2E2J H;  1L1O C;  1G6Z A;  5IWA Q;  4JVZ A;  1IL8 A;  1H9R A;  2D2C C;  4RH6 A;  3KFU A;  1RIP A;  2I46 A;  2JA8 H;  2YV5 A;  5EKK A;  2YU9 H;  3P7J A;  1LT3 D;  3JC6 6;  2R7Z B;  5CV8 A;  1QIL A;  3AYH B;  3VR2 A;  2AWN A;  4IOA A;  1PZI D;  1YEZ A;  3R3O A;  3NWS A;  3J80 c;  4A3I H;  1TWC H;  4V0B A;  1I4R A;  1SNC A;  1EEI D;  1SYC A;  5JJL A;  4KD3 A;  2F3I A;  3S2D H;  1VCI A;  4K6D A;  3CPW A;  5IP7 H;  1X3F A;  1PFN A;  2H1E A;  3OOC A;  1KAW A;  1V8Q A;  4YIJ A;  4ZUJ A;  5KYL A;  1YVC A;  2B39 A;  4DV5 Q;  2K5W A;  1OXU A;  2WFW A;  3ULP A;  1T5E A;  2NVT H;  3BVG A;  3GTO B;  3BZK A;  5G3L D;  1MJC A;  1HPC A;  5DNF A;  3NTH A;  2LSS A;  1YI2 A;  5FOB B;  5I9O A;  2Q8R E;  4H7B A;  2R93 B;  3C1F A;  4P74 A;  4DFA A;  2RVL A;  4OXP A;  5JAV A;  3CCV A;  1AH9 A;  1G91 A;  2ZM6 L;  4GNX B;  2PW5 A;  3FPP A;  2JA7 B;  2D62 A;  2EVB A;  3S14 H;  2OXP A;  4JK1 C;  4B3T Q;  4KHV A;  1WD1 A;  1N34 L;  1SNP A;  4KJN A;  1X6O A;  2PI2 E;  3GP7 A;  1TWA B;  3DWA A;  5EPK A;  1DM0 B;  2PO4 A;  2E2J B;  1HNW L;  1X3P A;  3I3C A;  4HSV A;  4NXN L;  3G6E A;  3HKZ E;  5FK9 C;  4YWM A;  4KV6 A;  1WTV A;  1W6J A;  1A2T A;  1N32 L;  1YJW A;  3J81 E;  1KDA A;  2JA9 A;  3S1M H;  5LMN L;  1R9T H;  2Y0S G;  1PH8 A;  5EKI A;  2MFI A;  1LO5 D;  1PTO F;  2UU9 Q;  2EJG C;  1A6X A;  4GZY C;  4QQB X;  5ELB A;  5HGT A;  2O4X A;  4I65 A;  3I4M B;  1A8V A;  2F0K A;  1IZ6 A;  4FO2 A;  4GKJ L;  2NN6 H;  4G7H C;  4IUR A;  3B6Y A;  2UUC Q;  3KK7 A;  4LF4 Q;  1VQE A;  4QIW E;  3ICE A;  4QUF A;  2NZH A;  3EA6 A;  4KK7 A;  4A3E G;  2B2W C;  1RCV D;  1VQA A;  2E2I H;  3GTQ B;  1N32 Q;  1MBY A;  1X9N A;  1JWS D;  1T5X D;  1Y1W G;  2E76 C;  2Y0S B;  1JC7 A;  1S4Z A;  2DNC A;  2FJ2 A;  1WJJ A;  4JI7 L;  4LFB L;  1KLU D;  2FIN B;  1K9M C;  1TY2 A;  2QEJ C;  3V05 A;  4ME5 A;  2NZO A;  1Z7T A;  3G6J B;  2ZJR A;  2F0U A;  2BE5 C;  5C0X I;  1EOV A;  1GUT A;  4R8N A;  1PH7 A;  4Y7N B;  2K50 A;  2XN9 C;  3NXW A;  2CCZ A;  3HS0 C;  2EYM A;  4YY3 L;  3BVM A;  4ZKC B;  1PH2 A;  4UP9 A;  4X3U A;  3TME A;  3NTK A;  3HOZ B;  1N33 Q;  4NB3 A;  2ZXR A;  3HOW B;  1ENC A;  2C5C A;  3I55 A;  4AYB B;  4DV6 L;  1PTO C;  2IX3 A;  2EYO A;  4ODG A;  3OTO Q;  1EFW A;  1IBM Q;  5JPN C;  1S72 A;  3FMC A;  5DEH A;  3MWY W;  1D2B A;  3QOL A;  2EXD A;  1H9K A;  2RHQ B;  2X6G A;  2B63 B;  4DV1 Q;  2VQE Q;  3PO3 B;  3RZD B;  1KC8 C;  3UI2 A;  4C3H B;  4A3G G;  1PYW D;  3N52 A;  3STB C;  1S5C D;  4A76 A;  2AWO A;  1PH1 A;  5M3M B;  1E7Z A;  4JOI C;  1U4R A;  3JAM E;  4GN4 B;  1MI2 A;  1Y8O B;  1TWG H;  2PZU A;  3GV3 A;  4JCV E;  2L1B A;  2NWG A;  1QNU A;  1ET6 A;  2IHF A;  1PRT B;  4KHZ A;  2A1A A;  1FVI A;  2IJ0 A;  4OWX B;  1O7Z A;  2FMM A;  1LT6 D;  4FXG C;  1EY8 A;  3U50 C;  2IW3 A;  2EY2 A;  1QVG A;  4L63 B;  4WJW A;  2Z0S A;  3A0J A;  2CKZ B;  4LF9 L;  4LMQ D;  1V1P B;  1PA6 A;  1HQM C;  3IRB A;  1JWM D;  1SLJ A;  4GLV B;  1TS5 A;  1I4G A;  1E24 A;  1HNW Q;  2N55 A;  1CT1 D;  1NBW A;  2MP1 A;  1LTG D;  5GRO A;  3D0F A;  3H0G B;  5KYI A;  1VQP A;  3W5O A;  3BZD B;  1GO3 E;  3KLW A;  2F4I A;  1KLG D;  2K52 A;  4JI8 Q;  4ZKB B;  1G8Z D;  1S5F D;  2F0F A;  1EU3 A;  2D0O A;  3MXU A;  4IN3 A;  2F52 A;  2A74 C;  2PZW A;  2K1B A;  4KKT A;  4GLX A;  1NUC A;  5FO7 B;  3TQY A;  1B9N A;  2A6E C;  3QJY A;  5C5L A;  3D8G A;  2JA6 B;  1B3A A;  5JVH 3;  2ICE C;  1HA6 A;  3SEB A;  2JA8 G;  2ES2 A;  1HFG A;  4X65 Q;  3GQB A;  4YHH L;  2NTT A;  1O7Y A;  3S16 H;  3NTI A;  2A69 D;  1TWG B;  4A3K B;  1SR3 A;  3M4O B;  2NVY B;  1W6K A;  3K81 C;  3HEJ A;  4GOP C;  1J5E Q;  3W3A A;  3NSW A;  4CDD C;  1PVO A;  3I4N H;  2BA1 A;  4BWG B;  4AH6 A;  1FGU A;  3CU7 A;  1N9W A;  2RSN A;  2JA6 G;  3TP7 A;  1D8L A;  1BDO A;  2PI2 A;  4H02 A;  4QMG A;  3UDI A;  3Q24 A;  4DR1 Q;  4YHH Q;  5CYU A;  2MHV A;  5J3B A;  1X32 A;  5ISR A;  5FLX L;  4B3R L;  1Q8I A;  2MQH A;  1F9S A;  5EKL A;  5J1Z A;  2Z6K C;  1KDB A;  5EAY A;  3BS1 A;  4DR7 Q;  5D14 A;  1I6H H;  3GTJ B;  1EIY B;  5BR8 L;  1GJX A;  4QL5 A;  2LXJ A;  3GO5 A;  2OQ0 A;  4N9P A;  1JJ2 A;  1J8I A;  1XMO L;  1YBY A;  1D1I A;  1CUK A;  1VQ9 A;  4NXM Q;  3TRE A;  1C48 A;  2RF4 A;  2UUA Q;  3SVM A;  1Z9F A;  3HOW H;  1PH6 A;  2LXK A;  2NN6 G;  3NBI A;  1OXX K;  3H09 A;  2I5M X;  2MPM A;  4DR7 L;  5M5Y B;  2M00 A;  4GNX C;  3A54 A;  1CK1 A;  1T9H A;  2D5D A;  3TS0 A;  1EWH A;  4IUQ A;  1I3Q B;  2EY6 A;  4DXG A;  2R92 H;  4C3I G;  4IFD H;  2CFM A;  2XRQ D;  1VQF A;  2CW0 D;  1I4P A;  4C1N I;  1EZ8 A;  1STN A;  4WFN 3;  4HJ8 A;  5H1S E;  1CKN B;  1IHZ A;  2BOS A;  3WOF A;  3A8I E;  2WAQ E;  2DJF C;  2XRS D;  2E2I B;  2NVQ B;  4HMJ A;  2VQE L;  3HKZ B;  3I90 A;  1PZJ D;  3SK4 A;  2LFN A;  2ZJP A;  4GKK Q;  2L9H A;  2MO1 A;  1LV9 A;  5C3W A;  1VMC A;  2AHO B;  4ZAI A;  1HUN A;  4RKB A;  5G3L F;  4TSS A;  3TP8 A;  1EYC A;  3UE0 A;  3MXN B;  4EQ5 A;  3H3V I;  2HDL A;  4KN4 C;  3ERQ A;  1QG7 A;  4L6T B;  1LTS D;  1R9T B;  3TS2 A;  1B50 A;  2YYZ A;  3NK9 A;  2HQE A;  3CMA A;  4YCU A;  3K59 A;  2LMC B;  3VYT A;  3D4W A;  3RLN A;  2DJG C;  4CGY B;  1OXT A;  4RCN A;  3A8J E;  1XNQ L;  4JI6 Q;  4R4C A;  4AYB G;  3L9A X;  1CQF A;  3E9I A;  2KHS A;  4XYO A;  1EL0 A;  2ZM6 Q;  5LMN Q;  4LF7 Q;  2K01 A;  3F1Z A;  3F2B A;  2PMZ E;  1TWA H;  4R8I A;  3K5L A;  2K5N A;  3PO2 B;  5M5W H;  5CGK A;  2B8F A;  2SEB D;  1SJH D;  1BVS A;  5C44 G;  4R1J A;  1AE2 A;  3MEH A;  4R4T A;  3MC0 B;  2LY7 A;  1BO0 A;  4FXD A;  1YNX A;  3I72 A;  1JOQ A;  5DAU A;  3TBI B;  2K75 A;  1UUP A;  3EIV A;  3I91 A;  2PPB C;  3EBE A;  5HY6 A;  4GS3 A;  1SYE A;  1XNR Q;  3HOY H;  4N8X 1;  5FLX c;  2NVQ H;  4RGN A;  2UXC L;  2XNA C;  5T1G A;  3MXG A;  1CA5 A;  2E2D C;  1G6P A;  3CAM A;  5CV9 A;  4ZUI A;  1HZ9 A;  5KIX A;  3C2P A;  4ZRZ A;  4A4I A;  3N6R A;  3O13 A;  1J6Q A;  2DUD A;  5KNC A;  3TN2 A;  4R4O A;  4X64 Q;  3HOY G;  4FF1 A;  2K04 A;  2HHH Q;  2UUB L;  1VQD A;  1CTM A;  1EYA A;  1SNM A;  2F0L A;  1NR2 A;  2K6A A;  2M2L A;  5IP9 G;  2VB3 X;  1V1Q A;  1Y1W H;  4CJ0 B;  3OTO L;  2F0H A;  4DR5 L;  3ULJ A;  3NWT A;  4OON A;  4IPD A;  1HTL D;  5GQO A;  5IY0 A;  1HZA A;  5I2X A;  1PTO H;  2IL8 A;  1HCZ A;  1WOC A;  5L37 A;  4JI4 L;  1EZ6 A;  4BA2 I;  2E8G A;  3DEO A;  1JR0 D;  4X3T A;  3J7A F;  1PZK D;  1SYD A;  4PZ7 A;  4MNO A;  2VW9 A;  3GTP B;  1TWH B;  4DU9 A;  1C8C A;  3HOU G;  2DN8 A;  5CR3 A;  4JI5 Q;  1L0X B;  4RGT A;  5ELD A;  1BCP D;  5BR8 Q;  4DK3 C;  3M7N A;  3GTJ H;  1ZKO A;  2QDB A;  3GTG B;  4AQY Q;  2SNS A;  4NMZ A;  2J4X A;  1WFQ A;  5C0X G;  5C0X J;  3M3Y H;  3ONA B;  4NXN Q;  3X3N A;  1S5B D;  4P2C B;  2Z6K A;  3HRZ C;  5COR A;  4DV3 Q;  3LWE A;  1H95 A;  5DM6 3;  5C0X H;  2B2U A;  4HJ7 A;  1MIU A;  2EJF C;  1DYQ A;  3K5O A;  2WAQ G;  3G48 A;  4ULL A;  3JAM i;  2B2U C;  4IPH A;  1JT8 A;  4JBW A;  3GTL H;  5GAD C;  1GHK A;  4XTC S;  4ZQ3 A;  5IOD A;  4RGM A;  1A0I A;  2MUY A;  3I7F A;  3ER0 A;  3GD7 A;  5IE8 A;  4KY6 A;  3E0J A;  3NEL A;  1N34 Q;  3AQQ A;  3SK8 A;  1GOZ A;  3K5M A;  3K7A H;  5CV7 A;  1X54 A;  3URY A;  5I9P A;  2HDM A;  4BY1 H;  1CQV A;  2XGT A;  4IUT A;  3SR1 A;  1A3U A;  1NR4 A;  1YHA A;  1CHQ D;  3M85 A;  1FNW A;  2SNM A;  1QCB D;  3SXH A;  2LS0 1;  2O5I C;  2UXB Q;  2F0G A;  3I8Z A;  1VQG A;  4B9W A;  1LLR D;  1QWY A;  4C3I H;  1LUZ A;  5GAE C;  2F0W A;  3CCL A;  4KMU C;  2UXC Q;  4FF3 A;  4QY7 A;  2A68 C;  1JB7 A;  3MFY A;  4KLK A;  3CQZ H;  1CM9 A;  1HR0 Q;  5C4J B;  1MHW C;  1F2M A;  4HJ9 A;  3GTM B;  4Y7N H;  4LF8 Q;  2Q2H A;  4QGU A;  1E0B A;  4M1U B;  2VS1 A;  3LWU A;  1A2U A;  3FRP B;  1WYD A;  3HZX A;  4U67 3;  4BY7 G;  2VB2 X;  3QO2 A;  2IT1 A;  2KCC A;  4A93 B;  1QJO A;  1D5M C;  3OMC A;  5KGU A;  3J81 L;  1NJI C;  3A56 A;  4F87 A;  5EBD A;  1EIG A;  1SMX A;  1B3Q A;  5C4X B;  5IGD A;  1JB3 A;  4LUZ A;  1IYJ B;  5JOB A;  5JEA H;  1TKW B;  1K8M A;  5NUC A;  3TSS A;  3G4S A;  5CBE E;  3G71 A;  5DM7 3;  4KHP L;  2KOL A;  4BY7 B;  3R93 A;  3ZJY C;  3I4M H;  2LKV A;  1MJE A;  3M3Y B;  4XIG S;  3UDX A;  3C3L A;  3MVV A;  4KY7 A;  3QG1 A;  4C3H H;  4DV4 L;  4MZ9 A;  1Q90 A;  1CA6 A;  1GM5 A;  1VQH A;  3J81 j;  1PV4 A;  3QOJ A;  5C4X G;  4EGV A;  4WOR A;  3Q6S A;  4IUN A;  3U9S A;  5C44 H;  3BYY B;  1SYB A;  1R4P B;  1F2Y A;  2A5H A;  3KLS X;  4X66 Q;  5C4H A;  4LF9 Q;  3FKI B;  2JQO A;  5I4D A;  2VUM H;  4IQZ A;  4UDU C;  4DR1 L;  5EJW A;  5J39 A;  1NSN S;  4C2M B;  3CC7 A;  1QNK A;  3TRZ A;  4N8F A;  1NAP A;  3FEW X;  1PMR A;  5M9O A;  4V19 0;  3F2D A;  3QB3 A;  4KN7 C;  4A3D H;  4BXX H;  2GVA A;  4FVM A;  3T1H L;  3T51 B;  1Y1W B;  3S14 B;  5DLQ E;  2BCO A;  2O2L D;  4K2L A;  4DUZ Q;  3BDL A;  4MHE A;  1YZ6 A;  1UE6 A;  3I4O A;  2OWO A;  1M4V A;  2YTX A;  1GUO A;  4G7O C;  1WCM B;  3NBH A;  4HID A;  2R93 H;  1BUV T;  1K8G A;  1JOK A;  3I4L A;  2K4K A;  2RSO A;  4FNF A;  2F0Q A;  3NHH A;  5IGE A;  1IYU A;  3PIO A;  2UXD L;  4BS9 A;  3AMU A;  1KAB A;  3OWF A;  3E6Z X;  3KBX A;  4GLA C;  4JYA L;  1JJG A;  2GVB A;  2Q2T A;  1KL9 A;  1D5Z C;  1HTP A;  3HOZ G;  1YNJ C;  3NBH B;  1TS4 A;  4Z9C B;  3TZU A;  1TWC B;  3KDF A;  3SGI A;  4HCS A;  3CF5 A;  4OO1 I;  4RA8 A;  1XNQ Q;  1RF2 D;  1F77 A;  1O7L A;  4RHS A;  3E9H A;  2R7Z H;  1M1K C;  1AZQ A;  1K0R A;  1SXT A;  2NTS A;  2B2Y C;  3S1M B;  4C3J G;  2K28 A;  2B63 G;  3PO2 H;  1D7Q A;  4UAI A;  1ENA A;  3PV0 A;  1JE5 A;  2IX0 A;  5EGT A;  3K0X A;  4AYB E;  2K33 A;  1F9R A;  2KJX A;  1JE4 A;  3J7Y W;  4ILW A;  4IJH A;  3U4Z A;  1ESF A;  3KJP A;  4HTH A;  2HIV A;  2JA7 H;  2K05 A;  4DK0 A;  2F0I A;  1PYS B;  1DZ1 A;  2CH4 W;  4L5T A;  4B3S L;  5CV5 A;  4IFD I;  2RDG A;  4C56 C;  2OT2 A;  3P1H A;  4QIW B;  3M4Y A;  1PFB A;  1VQ5 A;  4QB4 A;  1L0Y B;  3PGZ A;  2H4O A;  1J5E L;  1Q1B A;  3BZC A;  3OIP A;  3GTO H;  1KAA A;  3VA7 A;  5IYC G;  4NKL A;  5K5P A;  1D5X C;  1M8A A;  1SSO A;  2Z6B A;  2UUA L;  4LFC Q;  1EY4 A;  5E1F A;  4JI3 Q;  2F0J A;  2R92 G;  3EJI A;  3EQL C;  4NDX A;  4JI2 Q;  2CHB D;  1IBL Q;  2KED A;  1YHB A;  4QJF A;  1C0A A;  3X3M A;  1UE1 A;  5JEA J;  1WI5 A;  3BG3 A;  3I4N G;  3JAM L;  3E0E A;  1BBW A;  3IL8 A;  3CD6 A;  1RDP D;  2QDL A;  3SHL A;  3U58 A;  1A15 A;  4C3H G;  4A3G B;  1LT5 D;  4KJO A;  2VL6 A;  4XQN A;  4PMW A;  2KBN A;  4Y52 H;  2BH8 A;  1H9S A;  4RGO S;  1D1K A;  3Q23 A;  2L15 A;  2R92 B;  4JI1 L;  4JBK A;  1UEB A;  2RQX A;  4DNT B;  4O42 A;  1YNJ D;  1I3Q H;  1B44 D;  3CP0 A;  1K83 H;  5IYC H;  5K36 H;  4GN5 A;  4DUZ L;  5M5Y H;  4O0A A;  1LAC A;  1X3E A;  3P20 A;  4IPC A;  1EIF A;  1Y1V H;  2AQ1 B;  3T16 A;  2JA8 B;  3VR3 A;  5E4W C;  1I94 Q;  1SFO H;  4DK6 C;  2YU9 B;  2RDH A;  1W3S A;  3K5N A;  2PNR C;  3T1H Q;  2ID0 A;  5EBC A;  3CPF A;  3VYS A;  2F0M A;  4A3K G;  4GOP A;  1HQR D;  2A6H D;  1QUQ A;  1STG A;  5JPM C;  2KEC A;  2O5J C;  1RD9 D;  2Q2I A;  1B8A A;  4K14 A;  1BCP B;  1IYV A;  4BBS H;  4DV3 L;  1ASY A;  3HKS A;  4DR5 Q;  3DM3 A;  1UE7 A;  4LW1 A;  5I6Y A;  1GD7 A;  2AUK A;  4JI6 L;  1DOM A;  1J9O A;  2D9U A;  4HAE A;  4PV1 C;  3I70 A;  1PXU A;  3AFP A;  4KKS A;  1V1P A;  4IO9 A;  4BY7 H;  3G7L A;  3FKI H;  3DMU A;  1I50 B;  3DEP A;  3PIP 3;  2FHT A;  1DD2 A;  5IGF A;  4X62 L;  1KTK A;  3TZD A;  5C3E H;  2EYL A;  2WIN B;  2JA5 H;  3PSI A;  1RHP A;  1E1O A;  2QW7 A;  1ILP A;  3UDF A;  3S17 H;  3DM1 A; 
#chains in the Genus database with same CATH homology
 1VDZ A;  1WTR A;  5EPJ A;  4NW2 A;  2MGS A;  3RMH A;  1FGB D;  2QF7 A;  1VF5 C;  2Z8L A;  3GTK B;  2A6E D;  2R6G A;  1SMY D;  3CRL C;  3D31 A;  1TII D;  2KEE A;  3GV6 A;  1Q1E A;  4R9W A;  1JOO A;  1XYI A;  1ILQ A;  4C3I B;  3IFD A;  4CKC A;  1HRJ A;  4IUP A;  3IKJ A;  3V96 A;  5LL6 X;  2EPB A;  2ZXP A;  3TP5 A;  3QWN A;  2X6L A;  1AW7 A;  4A3J B;  4H13 C;  4IZ8 A;  4WRD A;  2A68 D;  4PQX A;  5E3F A;  3DHQ A;  1QE6 A;  1ROD A;  2HCI A;  1G29 1;  3MXN A;  1E2V A;  2XVS A;  1TT2 A;  2F03 A;  5C3E B;  2EYJ A;  4X3K A;  4CHT B;  1UNS A;  4EQN A;  4LJZ C;  1E2Z A;  1WTP A;  4A3M B;  3ZYY X;  5FLX E;  5EPL A;  3K0Y A;  1AFP A;  3SK5 A;  3BDC A;  1I4H A;  5D3I B;  1R4Q B;  1U4L A;  5C4Z A;  2BA0 A;  5TSS A;  2F0E A;  2KA7 A;  2EDG A;  2QKI C;  4G57 A;  3R2T A;  1SDF A;  5LL6 S;  2PMZ B;  1WVL A;  4CJ2 C;  1DCZ A;  1HXY D;  1GUG A;  4TRD A;  1STB A;  2B2V A;  4PMB A;  2K03 A;  4B08 A;  3T4A C;  3VYU A;  1PTO D;  1SNO A;  5CC4 A;  5C6A A;  5M5X B;  4DXF A;  5ELC A;  2EZV A;  2HUG A;  1BR9 A;  1PLF A;  1G2S A;  3OIQ A;  3K7A B;  3OHX C;  4KI0 A;  1EY9 A;  1EWC A;  1SND A;  2CW0 C;  3E5S A;  1K83 B;  1WTQ A;  4K5V A;  1IKM A;  3OMG A;  1BF4 A;  5I6W A;  2L4N A;  5IT9 L;  2WKC A;  5JVG 3;  2IX1 A;  2XWJ B;  3DXJ C;  5KNB A;  4HMI A;  4I7Z C;  1EEF D;  1TVX A;  2X69 A;  1B2T A;  1WD0 A;  4QUC A;  3HOU B;  2MJ8 A;  5K36 G;  2RKS A;  4FYD A;  1RKN A;  3DWQ A;  4N9T A;  5HUR A;  4FF4 A;  1LT4 D;  4DA2 A;  3EVQ A;  2Z1C A;  1EY7 A;  2VNU D;  2K7V A;  3LX0 A;  1TU2 B;  3L3O C;  3J80 E;  1FYC A;  5JEA G;  5F2D A;  2R3Z A;  1ZYR D;  3S1N B;  1EU4 A;  4KD4 A;  1ESR A;  3TDQ A;  1SYG A;  1FNV A;  1GXD C;  4H0L C;  1HUM A;  1SE4 A;  1SE3 A;  1V43 A;  3NP8 A;  1AN8 A;  1U9R A;  4DNR B;  1MD2 D;  1YNN C;  1LTI D;  3SDZ A;  1WTW A;  1STA A;  2K5D A;  3H6M A;  1MGS A;  3M7G A;  5EQ0 A;  2EYP A;  4CKE A;  1RTO A;  2L11 A;  2XWB B;  2B2W A;  1C4Q A;  1S5D D;  2F3W A;  4NP5 A;  1BQQ T;  2L12 A;  3FPU B;  1CI3 M;  3W2D A;  2M9V A;  1VMP A;  2RA4 A;  4DAP A;  2KUM A;  1GUN A;  4RKL A;  1CHP D;  1GUW A;  2TSS A;  1A3V A;  1WTX A;  3QIA A;  2B2T C;  3F2U A;  5LHY 1;  1XWE A;  5C3X A;  1EY5 A;  1G2T A;  4S3S A;  4A3D B;  2E2H B;  3VR4 A;  1EFI D;  3PUZ A;  4OIK A;  4RCO A;  2J0T D;  1I6H B;  3IAY A;  3MA2 B;  4HCE A;  3OW7 A;  2KVM A;  1IKL A;  5IGC A;  1TS3 A;  4CBV A;  3CRK C;  5FO8 B;  1JWU D;  2EOT A;  2GA4 B;  4A3B B;  3A8K E;  1DOL A;  1JOR A;  2AQ2 B;  4ZLT F;  4RWS C;  2NBF A;  3OSO A;  3AB9 A;  5CV4 A;  4F7X A;  1XTC D;  1BBX C;  1I6V C;  4G4K A;  4FXK C;  1DOK A;  3MAQ A;  3HOX B;  3BVZ A;  2V4D A;  2F0V A;  4IUU A;  3C46 A;  1HA5 A;  3A7L A;  1EYD A;  3T13 A;  2KCN A;  2PCF B;  2ICI A;  1JCK B;  1F2L A;  1I4Q A;  2L5T A;  1XXG A;  2A6H C;  3P75 A;  1B1Z A;  1UAP A;  4ABN A;  3T56 B;  3OPO A;  3VA5 A;  1EY6 A;  2FMC A;  1LTT D;  4IAL A;  4BY1 B;  3DUZ A;  4DF7 A;  3VR6 A;  1MSH A;  2I07 B;  1AP0 A;  4OHJ A;  1IW7 C;  2C9O A;  4ZK9 B;  3D4R A;  4XT1 B;  2TMP A;  3EFX D;  4K6L A;  2B2T A;  1JIC A;  3NE5 B;  3Q0A A;  4OO1 H;  1F9Q A;  3ND8 A;  4XQJ A;  2F0S A;  3VR5 A;  4H44 C;  3RZO B;  3KUP A;  3R2I A;  1HFN A;  3S16 B;  2K32 A;  2NN6 I;  5J22 A;  1PRT D;  4OL7 A;  1O78 A;  1KNE A;  4MN3 A;  2JP1 A;  3J80 L;  5AFW A;  3D3R A;  1SEB D;  1ZEQ X;  4IFD G;  4A3F B;  2F0O A;  4CKB A;  2BDO A;  1EY0 A;  2L0C A;  4L8J A;  3Q22 A;  4XXE A;  5A35 A;  5IGB A;  1AZP A;  4J8Q A;  5BN5 A;  1SBB B;  1U4M A;  2ZT9 C;  2WP8 J;  3NQT A;  1XX8 A;  5M3F B;  3KLS A;  1Y1V B;  2SOB A;  3IFT A;  1STH A;  2XSC A;  2EYH A;  1Q12 A;  5COY A;  3WDN A;  3HGB A;  2G9D A;  1Q3L A;  1NCV A;  4OO1 G;  3T53 B;  3S1R B;  3WOE A;  1FD7 D;  5FO9 B;  5D3D A;  2JEA I;  2F0N A;  3RD4 A;  3VYR A;  1Z47 A;  2PZT A;  3SE0 A;  4CJ1 B;  2RBM A;  5CV6 A;  4X3S A;  4QCL A;  1ONL A;  1V1O A;  2JE6 I;  5M5W B;  1RJT A;  2QCP X;  1QOH A;  4DK1 A;  1RTN A;  5A2Q E;  3U9O A;  4ZYS A;  1SAP A;  3BDO A;  1Y8N B;  1GUS A;  4OGQ C;  1OXV A;  4K5X A;  1BOS A;  1DJR D;  3J7A V;  2ENB A;  1PTO B;  4BBS B;  3RLF A;  1STE A;  2BDN A;  2WII B;  2WV6 D;  1EOT A;  2OF1 A;  4MIU A;  1KNA A;  1LAB A;  2JEB I;  3PUY A;  3ERO A;  3ND9 A;  1SJE D;  1OO9 B;  4K8I A;  1MSG A;  1LTR D;  2XIW A;  2DNE A;  1UEA B;  2NVT B;  4J6H A;  4TKO B;  3HOY B;  1A3T A;  3LNN A;  2NB0 A;  4RFB A;  1II3 A;  1DON A;  2EE1 A;  2JYO A;  5KRU A;  5ELF A;  1ET9 A;  3MXP A;  3PUV A;  1BXT A;  2PYK A;  1FR3 A;  1JQY D;  5C5M A;  1EQT A;  3PIO 3;  1H9M A;  5CBA E;  1ENF A;  1S5E D;  5JJZ A;  2B2Y A;  3HG9 A;  1EIH A;  4A3I B;  1GHJ A;  4IFD J;  3KBG A;  1TY0 A;  4KY5 A;  5T1I A;  1I4X A;  3NUC A;  4U68 A;  5IOC A;  3V2T A;  4C3J B;  1H9J A;  4OIJ A;  1QB5 D;  2FFK B;  2DY8 A;  1SMY C;  5ELE A;  3FVQ A;  1KDC A;  4KKU A;  2NYZ D;  2VUM B;  1TWF B;  2J7Z A;  4RHR A;  3SK6 A;  4FP5 D;  3TP6 A;  5KND A;  3K58 A;  2Q8T A;  3FDT A;  2Q8I B;  2EJM A;  2SDF A;  3K6O A;  1VF7 A;  1X3Q A;  5D65 A;  2F3V A;  1EQV A;  2F1M A;  3S1Q B;  1TS2 A;  1FNU A;  2BE5 D;  2VXW A;  4F88 A;  1B4O A;  4LAA A;  3S2D B;  4O1N A;  3MTS A;  3HP3 A;  1SYF A;  3I4N B;  3CHB D;  3KLR A;  2HCC A;  3AU7 A;  3S15 B;  5KEE A;  2IPK D;  4E6I A;  3K57 A;  2F0T A;  1Y69 U;  2JXM B;  3S2H B;  2NZ1 D;  4PMC A;  3R8B A;  2IWH A;  5CMD A;  2DY7 A;  2CQA A;  3S9W A;  3D4D A;  2NVX B;  2A73 B;  4HR7 B;  1CFM A;  3RUZ A;  5C44 B;  3D6C A;  4DAY A;  4B9X A;  5IIF A;  1D6E C;  3PUX A;  3MFG A;  1PDQ A;  2F0D A;  1BNZ A;  4EQO A;  2CVR A;  1CZG A;  2JSO A;  4F8M A;  4QF4 A;  4XT3 B;  4TQU S;  4XYQ A;  4PNY A;  1CZW A;  1ZXT A;  4K8J A;  3MZ5 A;  3PUW A;  4M8A A;  3H94 A;  3DWP A;  5IGG A;  2Z4I A;  2E75 C;  2PQE A;  1LTB D;  2K5Q A;  2NUC A;  3MHB A;  1AEX A;  5A2Q L;  3H3V C;  3A55 A;  3S17 B;  1K8O A;  4A3E B;  1IW7 D;  4HN7 A;  3L7Z C;  4FF2 A;  1ZYR C;  3I73 A;  4DGZ A;  2G9H D;  2EXZ A;  4IUV A;  1TQO A;  2ZXO A;  1PRT C;  2WKD A;  2L55 A;  1TR5 A;  1F9P A;  4ID6 A;  4KTA A;  1DXM A;  3OWE B;  4K2K A;  2B2V C;  1U4P A;  2PW7 A;  2E74 C;  3CQZ B;  1F2Z A;  3BYT B;  1YNN D;  1PFM A;  3C1E A;  1O80 A;  1WTO A;  4J1M A;  1STY A;  2RDF A;  1SNQ A;  4Q0F A;  4EVO A;  5E4X A;  1OXS C;  3H91 A;  2B8G A;  4HSP A;  1LTA D;  4BBR B;  1BCP F;  2KQ3 A;  3NPP A;  5IT9 E;  1Z6H A;  2JA5 B;  3A7A B;  1H9S B;  3PMF A;  1HHV A;  2QIL A;  3NQI A;  2N88 A;  4HED A;  3HOV B;  2R61 A;  2EY1 A;  4Q5V A;  2OEO A;  4RAU C;  1PRT F;  4XQQ A;  3GTL B;  1ML0 D;  4K5W A;  4G7Z C;  1ICW A;  2EY5 A;  1Y8P B;  2EYF A;  3KF8 A;  2WAC A;  3CKI B;  4EQP A;  5FKA C;  2A69 C;  5BN3 A;  2F0P A;  4BA1 I;  2AQ3 B;  2Z4H A;  5BN4 A;  1B53 A;  1E2W A;  4LK1 C;  3D6W A;  2WAQ B;  5I2Y A;  1SE2 A;  2WB1 B;  1SFO B;  3ITP A;  4DAV A;  4C1N K;  4DN4 M;  1B9M A;  1BCP C;  4XDX A;  2AUJ D;  1G6Z A;  1IL8 A;  1H9R A;  2D2C C;  4RH6 A;  2I46 A;  5EKK A;  3P7J A;  1LT3 D;  2R7Z B;  5CV8 A;  1QIL A;  3VR2 A;  2AWN A;  1PZI D;  3R3O A;  3NWS A;  4V0B A;  1I4R A;  1SNC A;  1EEI D;  1SYC A;  4KD3 A;  1VCI A;  4K6D A;  1PFN A;  2H1E A;  3OOC A;  4ZUJ A;  1V8Q A;  4YIJ A;  5KYL A;  2B39 A;  2K5W A;  1OXU A;  1T5E A;  3BVG A;  3GTO B;  5G3L D;  1HPC A;  5DNF A;  3NTH A;  5FOB B;  5I9O A;  2Q8R E;  4H7B A;  2R93 B;  3C1F A;  4DFA A;  5JAV A;  2RVL A;  1G91 A;  2PW5 A;  3FPP A;  2JA7 B;  2D62 A;  2EVB A;  2OXP A;  4JK1 C;  4KHV A;  1WD1 A;  1SNP A;  4KJN A;  3GP7 A;  1TWA B;  3DWA A;  5EPK A;  1DM0 B;  2PO4 A;  2E2J B;  1X3P A;  3I3C A;  4HSV A;  5FK9 C;  4KV6 A;  1WTV A;  1W6J A;  1A2T A;  3J81 E;  1KDA A;  5EKI A;  1LO5 D;  1PTO F;  2EJG C;  1A6X A;  4GZY C;  5ELB A;  5HGT A;  2O4X A;  4I65 A;  3I4M B;  2F0K A;  4FO2 A;  2NN6 H;  4G7H C;  4IUR A;  3KK7 A;  4QUF A;  3EA6 A;  4KK7 A;  2B2W C;  1RCV D;  3GTQ B;  1MBY A;  1JWS D;  1T5X D;  2E76 C;  2Y0S B;  1JC7 A;  1S4Z A;  2DNC A;  2FJ2 A;  1KLU D;  2FIN B;  1TY2 A;  2QEJ C;  3V05 A;  4ME5 A;  1Z7T A;  3G6J B;  2F0U A;  2BE5 C;  5C0X I;  1GUT A;  4R8N A;  4Y7N B;  2XN9 C;  3NXW A;  3HS0 C;  2EYM A;  3BVM A;  4ZKC B;  4X3U A;  3TME A;  3NTK A;  3HOZ B;  2ZXR A;  3HOW B;  1ENC A;  2C5C A;  4AYB B;  1PTO C;  2IX3 A;  2EYO A;  4ODG A;  5JPN C;  3FMC A;  5DEH A;  3MWY W;  1D2B A;  3QOL A;  1H9K A;  2X6G A;  2B63 B;  3PO3 B;  3RZD B;  3UI2 A;  4C3H B;  1PYW D;  3N52 A;  1S5C D;  2AWO A;  5M3M B;  1U4R A;  3JAM E;  1MI2 A;  1Y8O B;  2PZU A;  3GV3 A;  2L1B A;  2NWG A;  1QNU A;  1ET6 A;  1PRT B;  4KHZ A;  2IJ0 A;  1O7Z A;  2FMM A;  1LT6 D;  4FXG C;  1EY8 A;  2IW3 A;  2EY2 A;  4L63 B;  4WJW A;  4LMQ D;  1V1P B;  1HQM C;  1JWM D;  1TS5 A;  1I4G A;  2N55 A;  1CT1 D;  2MP1 A;  1LTG D;  3H0G B;  5KYI A;  3BZD B;  2F4I A;  1KLG D;  4ZKB B;  1G8Z D;  1S5F D;  2F0F A;  1EU3 A;  3MXU A;  4IN3 A;  2A74 C;  2PZW A;  2K1B A;  4KKT A;  1NUC A;  5FO7 B;  1B9N A;  2A6E C;  3QJY A;  5C5L A;  3D8G A;  2JA6 B;  1B3A A;  5JVH 3;  2ICE C;  1HA6 A;  3SEB A;  1HFG A;  3GQB A;  2NTT A;  1O7Y A;  3NTI A;  2A69 D;  1TWG B;  4A3K B;  3M4O B;  2NVY B;  1W6K A;  3HEJ A;  3W3A A;  3NSW A;  2BA1 A;  4BWG B;  3CU7 A;  2RSN A;  3TP7 A;  1BDO A;  4QMG A;  3Q24 A;  5CYU A;  2MHV A;  1X32 A;  5ISR A;  5FLX L;  1Q8I A;  1F9S A;  5EKL A;  5J1Z A;  3BS1 A;  1KDB A;  5D14 A;  3GTJ B;  1GJX A;  3GO5 A;  4N9P A;  1J8I A;  1D1I A;  1C48 A;  3SVM A;  2NN6 G;  3NBI A;  1OXX K;  3H09 A;  2MPM A;  5M5Y B;  2M00 A;  3A54 A;  1CK1 A;  2D5D A;  1EWH A;  4IUQ A;  1I3Q B;  2EY6 A;  4DXG A;  4C3I G;  4IFD H;  2XRQ D;  2CW0 D;  1I4P A;  4C1N I;  1EZ8 A;  1STN A;  4WFN 3;  1IHZ A;  2BOS A;  3WOF A;  3A8I E;  2XRS D;  2E2I B;  2NVQ B;  4HMJ A;  3HKZ B;  3I90 A;  1PZJ D;  3SK4 A;  2LFN A;  2L9H A;  1LV9 A;  5C3W A;  1VMC A;  4ZAI A;  1HUN A;  4RKB A;  5G3L F;  4TSS A;  3TP8 A;  1EYC A;  2HDL A;  4KN4 C;  3ERQ A;  1QG7 A;  4L6T B;  1LTS D;  1R9T B;  1B50 A;  2YYZ A;  3NK9 A;  2HQE A;  3K59 A;  2LMC B;  3VYT A;  3D4W A;  4CGY B;  1OXT A;  4RCN A;  3A8J E;  3L9A X;  1CQF A;  4XYO A;  2KHS A;  1EL0 A;  2K01 A;  4R8I A;  3K5L A;  3PO2 B;  5CGK A;  2B8F A;  2SEB D;  1SJH D;  3MEH A;  3MC0 B;  2LY7 A;  1BO0 A;  4FXD A;  3I72 A;  1JOQ A;  5DAU A;  3TBI B;  1UUP A;  3I91 A;  2PPB C;  1SYE A;  4RGN A;  2XNA C;  5T1G A;  3MXG A;  1CA5 A;  2E2D C;  5CV9 A;  4ZUI A;  3C2P A;  5KIX A;  4ZRZ A;  3N6R A;  3O13 A;  5KNC A;  3TN2 A;  4FF1 A;  2K04 A;  1CTM A;  1EYA A;  1SNM A;  2F0L A;  1NR2 A;  2K6A A;  2M2L A;  2VB3 X;  4CJ0 B;  2F0H A;  3NWT A;  1HTL D;  5I2X A;  1PTO H;  2IL8 A;  1HCZ A;  1EZ6 A;  4BA2 I;  3DEO A;  1JR0 D;  4X3T A;  3J7A F;  1PZK D;  1SYD A;  3GTP B;  1TWH B;  4DU9 A;  1C8C A;  2DN8 A;  5CR3 A;  1L0X B;  4RGT A;  5ELD A;  1BCP D;  3M7N A;  1ZKO A;  2QDB A;  3GTG B;  2SNS A;  4NMZ A;  2J4X A;  5C0X G;  5C0X J;  3ONA B;  3X3N A;  1S5B D;  4P2C B;  3HRZ C;  5COR A;  3LWE A;  5DM6 3;  5C0X H;  2B2U A;  2EJF C;  1DYQ A;  3K5O A;  4ULL A;  2B2U C;  4JBW A;  1GHK A;  4XTC S;  4ZQ3 A;  5IOD A;  4RGM A;  2MUY A;  3GD7 A;  4KY6 A;  3E0J A;  3SK8 A;  1GOZ A;  3K5M A;  5CV7 A;  3URY A;  5I9P A;  2HDM A;  1CQV A;  4IUT A;  3SR1 A;  1A3U A;  1NR4 A;  1CHQ D;  3M85 A;  1FNW A;  2SNM A;  1QCB D;  3SXH A;  2LS0 1;  2O5I C;  2F0G A;  3I8Z A;  4B9W A;  1LLR D;  1QWY A;  2F0W A;  4KMU C;  4FF3 A;  2A68 C;  3MFY A;  1CM9 A;  5C4J B;  1F2M A;  3GTM B;  1E0B A;  4M1U B;  3LWU A;  1A2U A;  3FRP B;  3HZX A;  4U67 3;  2VB2 X;  3QO2 A;  2IT1 A;  2KCC A;  4A93 B;  1QJO A;  1D5M C;  3OMC A;  5KGU A;  3J81 L;  3A56 A;  4F87 A;  5EBD A;  1EIG A;  5C4X B;  5IGD A;  1JB3 A;  5JOB A;  5JEA H;  1TKW B;  1K8M A;  5NUC A;  3TSS A;  5CBE E;  5DM7 3;  2KOL A;  4BY7 B;  3R93 A;  2LKV A;  3M3Y B;  4XIG S;  3C3L A;  3MVV A;  4KY7 A;  3QG1 A;  1Q90 A;  1CA6 A;  3QOJ A;  4EGV A;  4WOR A;  3Q6S A;  4IUN A;  3U9S A;  3BYY B;  1SYB A;  1R4P B;  1F2Y A;  2A5H A;  3KLS X;  5C4H A;  3FKI B;  5I4D A;  4IQZ A;  4UDU C;  5EJW A;  5J39 A;  1NSN S;  4C2M B;  1QNK A;  1NAP A;  3FEW X;  1PMR A;  5M9O A;  4V19 0;  3QB3 A;  4KN7 C;  4FVM A;  3S14 B;  3T51 B;  1Y1W B;  2BCO A;  2O2L D;  4K2L A;  3BDL A;  4MHE A;  1M4V A;  1GUO A;  4G7O C;  1WCM B;  3NBH A;  1BUV T;  1JOK A;  3I4L A;  2RSO A;  4FNF A;  2F0Q A;  3NHH A;  5IGE A;  1IYU A;  4BS9 A;  3AMU A;  1KAB A;  3OWF A;  3E6Z X;  3KBX A;  1D5Z C;  1HTP A;  1YNJ C;  1TS4 A;  4Z9C B;  3TZU A;  1TWC B;  4OO1 I;  4HCS A;  4RA8 A;  1RF2 D;  1F77 A;  1O7L A;  4RHS A;  1AZQ A;  2NTS A;  1SXT A;  2B2Y C;  3S1M B;  4C3J G;  2K28 A;  4UAI A;  1ENA A;  3PV0 A;  2IX0 A;  5EGT A;  2K33 A;  1F9R A;  2KJX A;  1JE4 A;  3J7Y W;  4ILW A;  1ESF A;  4HTH A;  2K05 A;  4DK0 A;  2F0I A;  1DZ1 A;  5CV5 A;  4IFD I;  2RDG A;  4C56 C;  2OT2 A;  3P1H A;  4QIW B;  3M4Y A;  1PFB A;  4QB4 A;  1L0Y B;  2H4O A;  1Q1B A;  3OIP A;  1KAA A;  3VA7 A;  4NKL A;  5K5P A;  1D5X C;  1M8A A;  1SSO A;  1EY4 A;  5E1F A;  2F0J A;  3EJI A;  3EQL C;  4NDX A;  2CHB D;  2KED A;  3X3M A;  5JEA J;  3BG3 A;  3JAM L;  3IL8 A;  1RDP D;  3SHL A;  1A15 A;  4C3H G;  4A3G B;  1LT5 D;  4KJO A;  4XQN A;  4PMW A;  1H9S A;  4RGO S;  1D1K A;  3Q23 A;  2R92 B;  2RQX A;  4DNT B;  4O42 A;  1YNJ D;  1B44 D;  5K36 H;  1LAC A;  3P20 A;  2AQ1 B;  3T16 A;  2JA8 B;  3VR3 A;  5E4W C;  2YU9 B;  2RDH A;  3K5N A;  2PNR C;  2ID0 A;  5EBC A;  3VYS A;  2F0M A;  1HQR D;  2A6H D;  5JPM C;  1STG A;  2KEC A;  2O5J C;  1RD9 D;  4K14 A;  1BCP B;  1IYV A;  5I6Y A;  2AUK A;  1DOM A;  1J9O A;  2D9U A;  4HAE A;  4PV1 C;  3I70 A;  1PXU A;  4KKS A;  1V1P A;  3G7L A;  3DMU A;  1I50 B;  3DEP A;  3PIP 3;  2FHT A;  1DD2 A;  5IGF A;  1KTK A;  3TZD A;  2EYL A;  2WIN B;  1RHP A;  1ILP A;  3DM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...