5JOBA

Crystal structure of staphylococcal nuclease variant delta+phs l25k/i92a at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKKMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYAYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L25K/I92A at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5jobA00
2PQEA 3MVVA 1STAA 3EVQA 4HMJA 5EKKA 3P1HA 2OF1A 1TT2A 3P75A 3NXWA 1ENAA 1EY0A 3OSOA 2KHSA 4K6DA 5CV7A 2EY2A 2EY6A 4K5XA 4KHVA 3OMGA 5DAUA 4J6HA 2RKSA 2O4XA 4ME5A 4NP5A 2F0FA 5E3FA 1F2MA 2PZTA 2HQEA 5J1ZA 4YIJA 1A3TA 3SR1A 4ODGA 3D4WA 1A2TA 5CV5A 5KRUA 3MZ5A 1JOQA 4WRDA 4F7XA 5F2DA 3R3OA 4EQPA 1KABA 1STHA 5J39A 3DHQA 1SYBA 4K2KA 5C5LA 4IALA 2F0SA 2PW5A 5KYIA 2F3VA 1EY7A 2F0WA 2F0QA 1IHZA 2PW7A 1JOKA 1SNQA 3D6CA 4MIUA 1STBA 4S3SA 3C1EA 3MEHA 5E1FA 2SNSA 4ID6A 2F0UA 3T16A 4J1MA 4IUNA 5I9OA 1STNA 3SK6A 1A2UA 3TP8A 5KGUA 1SYEA 2RDFA 2F0EA 1EY5A 5HURA 4K8JA 3DMUA 2OEOA 5CV4A 5M9OA 5J22A 2EYMA 2F0DA 3E5SA 3TP7A 5EGTA 4E6IA 5DEHA 3HZXA 4ZQ3A 3SK4A 4QF4A 5CR3A 4ZUJA 2WACA 5KEEA 2EYJA 2F0LA 4KJNA 5CC4A 3V2TA 3QOLA 5NUCA 1EY8A 3NK9A 4K5VA 2F0NA 4EQNA 4KY6A 4WORA 4ZUIA 1II3A 5JOBA 5IGCA 3SK8A 2F3WA 1TR5A 2RBMA 3OWFA 4RKBA 5IGGA 2F0IA 4NMZA 2F0KA 2F0GA 2ENBA 2EYLA 4QB4A 4KY7A 5IIFA 4K8IA 3ERQA 3OMCA 3SK5A 4HMIA 4F8MA 1NUCA 4DF7A 5I6YA 1EY4A 3QB3A 1RKNA 1KDCA 2PYKA 3NP8A 5C5MA 3NUCA 1STGA 4R8NA 1TQOA 3EJIA 2NUCA 2OXPA 2PZUA 3SHLA 1A3UA 4N9PA 1F2YA 1JOOA 2EYOA 5EKLA 4EVOA 2KQ3A 4KJOA 3LX0A 4IZ8A 1SYCA 5C3XA 4N9TA 5JAVA 4OL7A 4B9XA 3BDLA 1KAAA 2QDBA 5IGDA 3D8GA 5ISRA 3NHHA 4PMBA 2EY1A 4DU9A 5KIXA 1EQVA 5C4HA 4KY5A 3T13A 5CV8A 4LAAA 4KTAA 1NSNS 2F0JA 2F0HA 1KDBA 2SOBA 4DGZA 2EYPA 1SNPA 3MHBA 3SXHA 5C3WA 5C6AA 5I6WA 1AEXA 4KV6A 4NDXA 3TP5A 2LKVA 4DFAA 5I9PA 1EZ6A 1SNCA 1EY9A 1EYAA 3BDCA 4K14A 1SYDA 2EXZA 4PNYA 3TP6A 4I65A 5HGTA 3HEJA 1KDAA 4G57A 4K5WA 4QMGA 4B9WA 3PMFA 1SNDA 1EZ8A 4K2LA 5IGFA 3S9WA 2F0TA 1SYGA 5CV9A 1U9RA 2SNMA 5KYLA 5IGBA 5IOCA 2F0VA 3NQTA 2F0OA 1SNMA 3ITPA 5C4ZA 3H6MA 4KD3A 1A3VA 4NKLA 1STYA 4EQOA 4TRDA 3TMEA 5IODA 1EYCA 3QOJA 1ENCA 2EYFA 3C1FA 5CV6A 1EYDA 1SNOA 4H7BA 4KD4A 2F0PA 4PMCA 3MXPA 1JORA 5K5PA 4HTHA 3U9OA 5CGKA 1EY6A 3RUZA 5IGEA 3EROA 1SYFA 3VA5A 4RKLA 2F0MA 2EY5A 1F2ZA 2EYHA 2M00A 2PZWA 3D4DA
chains in the Genus database with same CATH superfamily
4QJFA 2PQEA 1TT2A 3P75A 3S14H 2EVBA 2OT2A 2L5TA 1UEBA 4X3KA 4C3JB 1PA6A 3ER0A 4KHVA 5DAUA 5E3FA 5M5WH 2KCNA 1VQNA 3EN2A 3JC66 1VDZA 2QCPX 3KYHC 1O80A 3PF4A 5M5YH 4GNXC 4POGA 5LMNW 4GLAC 4JK1C 4DR3Q 2N55A 1S5DD 3T16A 2F4VL 2XRSD 2FFKB 2L0CA 2CWPA 2MHVA 2K50A 1I3QB 1XMQL 4AIMA 3S1MH 3TP7A 1TWCB 1SFOB 1HQRD 1Q46A 4HJ7A 5KEEA 1SMYC 4KJNA 5DNFA 4OO1G 1QCBD 5EPJA 1ICFB 2B2YC 5GADC 5C0XI 3X3NA 1FNVA 1PLFA 3F8TA 1EY4A 3GTGH 1UE1A 3LWUA 4KN4C 4DUYL 3EIVA 4ZCKA 2NVYH 1VQ5A 1J6QA 1SXTA 2WAQE 4DAVA 3CCSA 1F9SA 1TIID 3GD7A 1RTNA 3HOXG 3T13A 2D62A 1G8ZD 1N32Q 2EXDA 2F0HA 1VQGA 4WFN3 1G291 3HG9A 4R4OA 3PO2H 1HZCA 4GOPB 3K80C 2Q2IA 3TP6A 3RN2A 3BYYB 4NB3A 1PH5A 2N3SA 1MIUA 1JB3A 1QNUA 1PMRA 4JW0A 1VQAA 2F0TA 2NWGA 3EBEA 2FMMA 3S14B 4JI1L 3A7AB 3I4NG 4KN7C 1HR0Q 3QOJA 1EWIA 1DGSA 1SNOA 2FJ2A 5M5WB 3RN5A 3PV0A 2QA4A 5IGEA 4GKKQ 3MTSA 1PH2A 1RF2D 2M00A 3VYUA 3DWQA 4IJLA 4IPHA 5M5YB 2BH8A 4R8IA 4DV3Q 3CW2C 1EY0A 1KNEA 4GKJL 4P73A 5FK9C 2ZXRA 4FF3A 1NTGA 1OXTA 1RHPA 5FO8B 3A5UA 4I7ZC 1FGUA 1HR0W 2JK8A 2ZXOA 3S1MB 1N8RC 3QG1A 2MFIA 2NVXH 2RDHA 1HFGA 1RIPA 1Q81C 2NZHA 2VQFQ 3OW7A 4YCUA 5C5LA 2F0WA 1ESRA 4JC0A 1KAWA 1STBA 4FDBA 5IWAQ 1Y69U 4HAEA 1DONA 4ILWA 1A63A 4OO1H 1IYVA 1XXGA 4G7ZC 3CRKC 4DR7Q 4Y52H 5CV4A 1R4PB 5DM73 2TSSA 1D1IA 1QUQB 4QCLA 4JI8Q 4OWWB 3GTGB 4NXNL 5I2XA 2WACA 2KVMA 2ZM6L 3H15A 4XQJA 4LJZC 4K5VA 1PH1A 3FKIG 4KY6A 3VR2A 3T1YL 3G6EA 3V96A 5JVG3 2NVYB 4PMWA 2NB0A 3HOWG 1HNWL 5GAGC 1GD7A 4C1NK 5IIFA 4KKUA 2K32A 4DXGA 2WAQG 3VA7A 4XYQA 2OCEA 1EEFD 2X69A 1K9MC 3NUCA 3GTJH 4ULLA 2ASBA 4DV4L 1KRSA 3PO2B 4RCNA 3HOXH 2KQ3A 1SYCA 4EQ5A 2UXBL 1HUNA 1R9TH 4B3RQ 2PQAB 4PMBA 3T4AC 3VDYA 2EE1A 2EPBA 1HHVA 3M9BA 4MHEA 2QEJC 4LAAA 4DGZA 1IBKL 2JA8G 3GTPH 1GO3E 4BA1I 1PV4A 4A3MG 1AEXA 4OIJA 4KV6A 4BY1G 4DV1Q 1ZEQX 4DXFA 2G5DA 1PTOD 1PH6A 3HOYG 2Z9HA 3I4NH 1SYDA 2VY3A 5H1SE 1G51A 2K5VA 2XWJB 3HEJA 2MPMA 2B2UA 4IURA 5GROA 1DXMA 4PZ7A 2R92G 1PRTB 2WIIB 1CSQA 5IODA 3TMEA 2RDGA 1EUJA 2R7DA 4ALPA 2CW0D 1SEBD 2WINB 1CKMA 1JQYD 2EZVA 4DUZL 4YWLA 1ASYA 2D9UA 2PZWA 3OMCA 1NMFA 3HS0C 1RODA 4GLVB 4Z9CB 5GQOA 2NVXB 4DK3C 3GV3A 3D31A 2F3IA 3K5OA 1QWYA 3A74A 4K5XA 1CFMA 2RCFA 4FNFA 1S72A 2KHJA 3G4SA 3VYTA 3N52A 1CQVA 4ODGA 1JT8A 2PI2E 2K75A 1VQHA 3MZ5A 2MNAA 3KBGA 4R4QA 5FLXE 3TRZA 2UUBQ 2K5WA 2HD3A 2TMPA 2LSSA 2C9OA 3H3VC 4B3SL 1EWHA 4P2CB 1HA6A 3NBHB 4JI5Q 4U673 2K01A 3JAME 3FKIH 1QNKA 3TBIB 2A6HD 3DMUA 1EFWA 2F0DA 2RA4A 4JI7Q 5HY6A 1FJGQ 3HOWH 3GTJB 1GUSA 2QKIC 3HOXB 5FLXc 1B2TA 5NUCA 4F87A 3AFPA 2JA5G 1Y1VG 4LF8Q 1LO5D 3RMHA 4WORA 1AN8A 4HJ5A 3NE5B 4NMZA 1R9TB 2ATWA 2EYLA 2NVQH 1HNXL 5I6YA 3IAYA 1HQMC 3JAMc 3GTPB 3P7JA 2OXPA 2B2VC 1RTOA 3SHLA 2JSOA 1I4XA 4RGOS 4X66L 3I4NB 2JA8H 2E2JH 2NN6I 1HTLD 4A3MH 1YI2A 1X56A 2A1AA 4BY1H 5IGDA 2A6EC 4O2DA 4DK6C 4HJAA 4UAIA 3HOYH 1EQVA 3PUZA 4FXDA 4QQBX 2E5LQ 1XMOQ 2DUDA 1KRTA 4LUOA 1L2FA 2H5XA 2L1BA 4DV0Q 3MFGA 4UP7A 4X3SA 5A2QE 1I94Q 5CYUA 2R92H 1CHPD 1LT5D 4LNQA 1NCVA 1S5CD 1PZID 2VQEL 1VQJA 3GDEA 5EBDA 1C48A 1X9NA 3QR8A 3AFQA 5CV9A 4WJ3M 1U9RA 2HIVA 1SN8A 2Q2UA 2WP8J 1IKLA 3L2PA 4EQOA 4NKLA 3M4QA 2IWHA 1VQDA 4PMCA 3I4LA 4JI3Q 1PH4A 4HTHA 2NYZD 1QB5D 1VQCA 3I7FA 2HCIA 3UE1A 3CCUA 1K83H 1STAA 2YTYA 1QVCA 2EQSA 3NTKA 1ET9A 2E2HH 4HCSA 2LMCB 3W1GA 1QILA 2NTSA 1HRJA 3FKIB 3PQIA 3J7ZC 2K4KA 3HOWB 3M4YA 2VNUD 3L7ZC 2BA1A 3GV6A 4MTNA 2WAQB 2VZAA 2NVTH 2HUGA 5EAYA 5KYIA 1BCPC 1CI3M 4MIUA 2BA0A 2B2TA 1B53A 1UE6A 2KHIA 1Y1VH 2NVQB 1WVLA 1DZ1A 3MXNA 4A3JG 5K36G 4OXPA 2BCOA 3M7GA 3VR4A 4BA2I 1O7IA 3E5SA 2IHFA 2JA9A 3MXGA 2SDFA 5CBEE 3V2TA 1V9PA 4Y7NH 2JA8B 2E2JB 4OWTB 2VL6A 2AUJD 4LK1C 4A3MB 4BY1B 3L3OC 2F0IA 3HOYB 4K8IA 3H0GG 1FYCA 3Q0AA 4XT3B 1LLRD 2ZXPA 4LF6L 3CAMA 3SGIA 1EIGA 3MC0B 4CDCC 2RF4A 3KF6A 2R92B 4DR1L 1SE8A 4GN4B 4DV6L 1BBXC 2C35B 3AMUA 1TWHH 1KAAA 1W6JA 2PMZE 3D8GA 4RGMA 5ISRA 2K7VA 3A0JA 2B8GA 2DY7A 5LL6X 4A3BG 4KTAA 4YY3Q 1YITA 1PH7A 3IKJA 2DY8A 4CJ0B 5I6WA 1TY2A 4AH6A 1NE3A 1SNCA 1I6VC 5C4JH 4K6LA 1KL9A 3I4OA 1UAPA 5EJWA 1Q12A 2F52A 1BXTA 3JAMi 4IFDJ 1K83B 3PCOB 3RLOA 3S9WA 1YJWA 3C3LA 2HT1A 2E2HB 1STYA 2IX3A 4LF7L 2UUAL 4JBMA 1ENCA 1EYDA 1HZBA 1GOZA 3U9OA 4JYAQ 1EY6A 1A15A 4WJ4A 1EOTA 2EY5A 3PIO3 2IY5B 3N6RA 1BDOA 1DOMA 4HMJA 5AFWA 1BOSA 1NAPA 1EIHA 2NVTB 1TS3A 2EY2A 2KECA 1CHQD 1LUZA 4UP8A 1W3SA 4MNOA 1PH9A 2B2VA 3NBIA 5IP7G 2JA5B 1Y1VB 1PDQA 2AQ3B 2F03A 2JN4A 2WB1E 2VUMG 1K8OA 3IFDA 2IX0A 1HXYD 1QJOA 3UI2A 3R3OA 4B08A 1Q86C 1YZ6A 1A8VA 4K2KA 3S24A 4A3JH 5K36H 1MD2D 2PW5A 4Y7NB 2K5QA 2K5HA 4L5QA 2SNSA 1E7ZA 4X65L 1T5XD 5I9OA 2A68D 1N33L 3TP8A 4JVZA 1FR3A 2DJFC 2KBNA 2R6GA 5I2YA 1VQ6A 4ZUJA 3H0GH 1D5MC 3HRZC 2ALYB 1PYBA 4RHRA 1BVSA 1TWHB 4AYBE 1EFID 3CCQA 1FNUA 1VQ4A 3KLSA 4HMIA 1NUCA 1L0YB 2E74C 5JJLA 1LM0A 2D0OA 3R93A 4Q0FA 3G48A 3BJUA 5ELOA 1AFPA 2ICEC 2NBFA 2YTVA 1ZYRD 4ZK9B 4A3BH 5C4JB 2A73B 2IHEA 3W1BA 1XPUA 3FVQA 3J81L 1GKHA 1UWVA 4DAYB 1UUPA 5G3LF 1YNXA 4IQZA 3WOFA 5C4HA 3KF8A 3DLLA 2X6GA 2I5MX 4OO1I 4DV2Q 1LT6D 2KENA 2BH2A 1CZWA 3W5OA 4C3HG 3D0FA 1QVGA 1AE2A 4RHSA 4NW2A 4IJHA 1EZ6A 2UXCL 4P72A 5C3EG 2F4VQ 1ILPA 1YHAA 4HJ8A 1YJNA 4HSVA 1L0XB 2BE5D 2JXMB 1XMQQ 3GTMH 3K7AH 1VQ7A 1VQPA 3HOUG 1WTPA 2B63G 4K0KL 5CV6A 1TS4A 1I4GA 4N8FA 1ICWA 2GVBA 5IE8A 5CGKA 1IYJB 1C8CA 3BG3A 3QO2A 4EX5A 1JMCA 2WB1G 5IP7H 1O7ZA 3EFXD 4DR4L 3EVQA 4A3JB 3GTLH 1PZKD 4OONA 2VUMH 2K52A 4JCVE 2A5HA 1SROA 3ICEA 3DWPA 3K81C 4X62L 1FGBD 2F0FA 4YHHL 1PTOC 3K7UC 3NTIA 1A3TA 4A4IA 2UU9L 4YWMA 1VF5C 3F2DA 1Z9FA 1S5ED 3DHQA 3H0GB 4JBJA 1JC7A 3W3AA 4X64L 3W2DA 1DD2A 1JOKA 3ND8A 1S5BD 5ELEA 1C7YA 2F0UA 2D0PA 5BR8L 1LT3D 2MJ8A 2CW0C 4AYBG 4UHVA 1U4RA 1E2ZA 1BUVT 4KHPL 4A3BB 3NK9A 2F0NA 5IYCG 1BR9A 2RBMA 2BOSA 3OWFA 4RKBA 3T53B 5E4WC 4QB4A 1GXDC 2F0GA 4L5RC 3UDFA 2XSCA 3ERQA 2M2LA 3FPPA 3HOVG 2O5IC 3TN2A 1I4RA 4IN3A 2B3GA 2B2UC 4N9PA 4V0BA 3Q24A 4C3HH 1CT1D 3SVMA 2QDBA 4CKEA 2EY1A 2KOLA 4IUPA 2A6HC 1UEAB 4JV5Q 5C3EH 3GTMB 5CV8A 3K7AB 4BWGB 1KDBA 3OTOL 1XNQQ 5AJ3L 2IJ0A 4GNXB 2KCCA 3I2ZA 5C6AA 1OXSC 2H4OA 4DFAA 4LMQD 3HFZB 1VQMA 3HOUH 2EXZA 1ET6A 1WFQA 4I65A 2B63H 2MUYA 1JR0D 1SNDA 3GTLB 3K0YA 5FOBB 1Q7YC 1JWMD 4GLXA 2Y0SE 2VUMB 2IPKD 3DWAA 1HNZQ 1A3VA 2PNRC 4ZAIA 1M90C 5C0XJ 4LF9L 3E6ZX 4A3LG 4JI0Q 3EROA 1L1OA 2F0MA 1D5XC 1F2ZA 2EYHA 5BN4A 1D7QA 4KHZA 2RQXA 2MQHA 3I73A 1ENAA 3I8ZA 2JE6I 2LY7A 4XQNA 3KBXA 4LFBQ 2UXDQ 1F9QA 1DOKA 3J81j 3VR3A 2F1MA 2K5DA 4XYOA 1M8AA 5JJIA 1IL2A 2UXBQ 1KC8C 1F77A 1KHIA 2PMZB 3RZOH 4OX9L 2AKWB 1SR3A 1IL8A 2LS01 2I5LX 5EQ0A 4OWXB 3BZDB 1I6HH 5D3IB 3BYTB 1OXUA 1X3FA 3URYA 5IYCH 1B44D 1K0RA 1MHWC 3R2IA 4CDFC 1X3GA 3PUYA 4TQUS 1FNWA 3U58A 1X3PA 4EQNA 1IXRA 3HOVH 4C3HB 5E7NA 1IW7D 1H9SB 1RJTA 4IO9A 4DR3L 4ZKCB 3S17H 1PRTF 1V1PA 2K04A 5EKIA 4F8MA 5C3EB 1H95A 2R3ZA 4R8NA 2C5CA 3SDZA 1DYQA 3OYYA 4DN4M 1B3AA 1WOCA 2AQ1B 3HOUB 4L5TA 2B63B 3KLRA 1EU3A 5IP9G 2ZJQA 3B6YA 1RD9D 5KNDA 2EIFA 2WB1B 2Y0SG 2LKVA 4LF5Q 1QOHA 2I46A 4HIOA 3AB9A 3GQBA 4B3SQ 1IBMQ 1SJHD 1XNRQ 3RZDH 1N9WA 3PMFA 4A3LH 3T1HQ 4ABNA 4LFAQ 1CKNB 4N8X1 3UE0A 5IT9L 4TVAB 5C0XG 4DR6Q 4A76A 3I70A 1PFMA 2KA7A 3ULJA 1YNJD 2G9HD 1BKBA 2B2TC 2BDNA 1WD0A 3F2UA 2PO4A 4AYBB 3RZOB 3P1HA 1IBLQ 4G7HC 1HNXQ 3E0JA 2CQAA 1EL0A 5LMUQ 2B8FA 4BS9A 3D3RA 1I6HB 4MTKA 1PHJA 1HR0L 2OQ0A 4IPGA 2MO1A 2V1CC 5FO9B 4X66Q 3K5MA 1I4HA 2IW3A 2B2WA 4YIJA 1QZGA 5D14A 4B3TL 1MSGA 1KXLA 4EGVA 4GKKL 1E3PA 1ESFA 1PZJD 1G6ZA 1N36Q 2K1BA 4EQPA 1HPCA 4YCVA 5G3LD 2ICIA 1O78A 1T9HA 4DR5Q 4BBSG 2PW7A 4DV3L 3HOVB 3CF5A 3S17B 4JI6L 1B9MA 2RDFA 4O42A 1X6OA 5J22A 4RFBA 4BXXG 4ZRZA 3FPUB 4A3DG 1ML0D 1VF7A 2OWOA 1EYGA 1NNXA 3V05A 2VQFL 1I4PA 5EBCA 3S2HH 5DLQE 5IWAL 4B3MQ 1I5FA 3TS2A 3BVGA 2K03A 2P5ZX 1W2BA 2WKDA 3OW2A 4DR7L 5IP9H 3K59A 2PYKA 3S1RH 2NZ1D 3CHBD 3BVZA 4GOPA 4J8QA 3CC7A 4JI8L 1TU2B 1AE3A 1P16A 2CQOA 3BVMA 5IYDG 3I4MG 3RZDB 3NWTA 1VMPA 3OHXC 2A68C 4FO2A 4BY7G 2EOTA 2CH4A 3J7AV 3TZUA 3KJOA 1HH2P 2F0JA 3H09A 1Q8KA 1G2SA 1HUMA 4G4KA 5D65A 4DK0A 1EY9A 4H13C 3CMEA 2XNAC 1H9MA 5C0XH 3SEBA 2A19A 1HFNA 3J7AF 1EZ8A 5IY0A 1X65A 1SJED 2SNMA 4HSPA 4QL5A 1SDFA 4NXML 1XYIA 1J5EQ 4DNRB 4CBVA 4GN3B 3PIOA 2E76C 1ZYRC 1E24A 4DV1L 1VCIA 4R4CA 1GUOA 1SLJA 3NSWA 1EQQA 5JJKA 1VQ9A 3J80E 2H1EA 3NXWA 2XN9C 4K6DA 2EY6A 2QW7A 2RVLA 4H0LC 3CD6A 1E1TA 3TDQA 2EDGA 4JBKA 4BBSH 3D4WA 1BQQT 4DV6Q 3ND9A 1STEA 2BE5C 3ERSX 4H44C 3CCRA 1LTAD 3CCLA 3OIQA 1W6KA 3J80c 4BXXH 3D6CA 2EJMA 4FF4A 3S2HB 4A3DH 1Q1EA 4IUNA 2A69D 2K33A 1EY5A 3S1RB 2ZJPA 2I0QA 3I90A 1J8IA 4QF4A 1HZ9A 3KUPA 5LL6S 4LF4L 3OOCA 3MAQA 2Y0SB 5JOBA 2PQAA 3NWSA 5IGGA 2J4XA 3O13A 4JI5L 1LT4D 2AUKA 5ELNA 2KCTA 5J3BA 3I4MH 5IYDH 3S1NH 2UUCL 3DM1A 4JI7L 1FJGL 4BY7H 1CSPA 2CCZA 4JOIA 1VQKA 1Y8OB 2JA6G 4HN7A 4LF8L 4B9XA 4NPSA 3BZCA 1CTMA 3NHHA 1BNZA 1WTVA 4FF2A 3GTQH 2MP1A 1UE7A 2HDLA 3M7NA 2MGSA 1NSNS 4QIWE 1BCPB 2RHSB 3TP5A 1VQ8A 2K28A 3R8BA 4LUZA 1KLGD 1NR2A 5CMDA 4A3IG 3A7LA 4B9WA 1Q90A 4O0AA 1U4MA 3PF5A 1WTWA 3WOEA 2Z1CA 3GTOH 2E5LL 2XWBB 5JEAJ 1B4OA 1OXXK 2VB3X 3NPPA 4KD4A 4DV0L 1U4PA 2CVRA 3QWNA 4BBSB 1I94L 1F2LA 3CCEA 3S16H 5EPKA 3DEPA 1PRTD 2OF1A 3KDFB 1GHKA 2A74C 2CKZB 4RAUC 1VQIA 3OSOA 3FHWA 2KJXA 1CUKA 4A3DB 2B29A 1ZXTA 4FVMA 2PZTA 4KLKA 4JI4Q 2PNHA 1X3QA 1EWCA 4JI3L 1KQSA 2DJGC 4JPBW 1STHA 1QG7A 2QDLA 2ZT9C 4IALA 3I91A 3VR5A 3RLFA 4MN3A 3MEHA 1TVXA 4ZKBB 3I4MB 3S1NB 1K8AC 1HJPA 3CU7A 2PPBC 1P8LA 4K8JA 2OEOA 1SAPA 5FLXL 4CJ1B 5DEHA 3HZXA 4ZQ3A 4BY7B 1FVIA 3K8AA 1GM5A 1XPRA 1JJCB 4ZUIA 4PZ6A 2D2CC 3AU7A 3CPFA 1CKOA 4X3TA 3JAML 2JYOA 2JA6H 3HKZE 2G9DA 2Z8LA 3GTQB 2X6LA 1EIFA 3FMCA 3NP8A 3K5NA 3J80i 3A5ZB 3EJIA 1G91A 4IZ8A 1JB7A 4OL7A 1MJCA 3S15H 4X62Q 5KNCA 1KD1C 3VYRA 1AZQA 4DU9A 1V1OA 1L1OC 4A3IH 4P71A 2CWAA 3GTOB 4DV5Q 2VW9A 1X54A 1PH3A 2HCCA 5C3WA 2E2IH 2YTXA 1TWAH 1WYDA 1YEZA 1SSOA 1D5ZC 1IW7C 1PYSB 2FINB 1PTOH 4HIKA 3S16B 2L9HA 3RLNA 5JVH3 1MSHA 3HP3A 3NELA 3CMAA 1PVOA 2KEEA 4FXKC 3HKSA 1LACA 5JEAG 3KLSX 4KD3A 3U4VA 4YY3L 2AWNA 2VS1A 1EYCA 2N49A 1S5FD 1TS2A 1PTOF 2GVAA 4RGNA 1SYFA 1V43A 4RKLA 4NDXA 2ZTDA 3A8IE 2DN8A 5EPLA 4XTCS 2JEAI 2ZTCA 1GUTA 2OTLA 4V190 3MEFA 1OTCA 4IFDG 3STBD 3UDIA 1XX8A 2L55A 4NP5A 4JI2L 2WFWA 5J1ZA 4TSSA 1SE4A 3OPOA 4X6AH 4JYAL 4L6TB 2Q2TA 1WTXA 4WRDA 4RMFA 5FJ8G 1FD7D 5JPMC 3ONAB 4AQYL 2O2LD 1PFBA 4PZ8A 2R7ZG 4PQXA 2CH4W 2JJQA 2JA6B 1STNA 1YNJC 3I72A 2F0EA 1RCVD 1KNAA 3HKZG 1B7YB 1LTSD 4O1NA 4A93G 2EJFC 4E6IA 1UE5A 1N34L 3F1ZA 4DUYQ 1EY8A 2K14A 2F3WA 1K8MA 3S15B 1Y1WG 4RCOA 3I55A 2J7ZA 4A3IB 1X55A 1CK1A 2N78A 1KDCA 1PFSA 1FL0A 2E2IB 4FP5D 2R61A 1F2YA 2EYOA 1TWAB 5EKLA 4R4IA 3FP9A 1HA5A 1PTOB 1HCZA 2RCNA 3TS0A 4R1JA 4RH6A 1H9KA 5KIXA 1X32A 4KKSA 4JI1Q 2JP1A 1A6XA 1CQFA 5M5XH 3AEVA 3MHBA 3TREA 4UDUC 4OX9Q 1EEID 1LTID 4LFCL 3E3XA 5JEAH 3ULLA 4QUCA 4OEMB 2QGQA 1AH9A 1XPOA 4DR2L 1K8GA 1D1KA 2B2WC 4K2LA 4GKJQ 3F2BA 3NQTA 3ZJYC 4DV2L 2XTIA 2RSOA 4UPAA 3OIPA 1EOVA 3K0XA 1GHJA 1B1ZA 3OWEB 4MZ9A 4DA2A 1MGSA 1Y8NB 1GJXA 4IFDH 1ONLA 2J0TD 3D4DA 2GA4B 3QIAA 5L37A 4PG3A 2HHHL 4FYDA 2K5NA 5EKKA 3F2CA 1JCKB 2KHSA 5CV7A 3KLWA 5FJ8H 2V4DA 1D2BA 3K58A 1JWUD 4KKTA 2R7ZH 4NXNQ 2ZM6Q 2XIWA 4XQQA 4A3EG 4WJWA 4KI0A 1YVCA 1DM0B 3FDTA 1LABA 3T1YQ 2F3VA 4DV7L 4A93H 4GOPC 3MWYW 5FKAC 3C1EA 3PSIA 4TKOB 4U68A 1HNWQ 4QIWB 1G2TA 1B8AA 2WV6D 1CA5A 1WD1A 1IZ6A 4HCEA 5M9OA 3PO3G 4DV4Q 1VQFA 2NTTA 1Y1WH 3GTKH 4RWSC 4IUQA 1KTKA 3D6WA 4DAYA 3L0OA 1LTTD 5LMNL 4XDXA 2F0KA 2PI2A 3MXUA 1Y14B 1PH8A 5A35A 2I5HA 4C2MH 4QUFA 1QE6A 3PIP3 1YNND 3CP0A 1IBKQ 3K5LA 1D8LA 5M5XB 1TQOA 1B9NA 3QJYA 2GN5A 1WTHA 4L5SA 2LXKA 5KNBA 4KJOA 1TKWB 4R4TA 1XTCD 5C3XA 5JAVA 1JE4A 3J7A5 1OO9B 1VQEA 1Y8PB 3A8JE 4XT1B 1K0SA 2Q8IB 2A69C 3L9AX 4B3TQ 5C4XG 1PYWD 3G6JB 2AWOA 2SOBA 2EYPA 3KK7A 1SNPA 1I50H 1B70B 1S3OA 1TWFH 3M4OH 3S1QH 3LWEA 4DUZQ 3G7LA 4RA8A 3CCMA 4JI6Q 1G6PA 2JQOA 2F0OA 4JV5L 4GS3A 1MI2A 5M3MG 2CHBD 2MO0A 1LTGD 1XNQL 4H7BA 2F0PA 3HGBA 4DKAC 4IPCA 3FEWX 3C2PA 2R7ZB 2NZOA 1LTRD 3PUXA 2HDMA 4JBWA 3HKZB 4A3GG 2BDOA 1AZPA 4A93B 5BN5A 3D4RA 4DNIA 1HNZL 4HEDA 3OMGA 4A3EH 4J6HA 3IRBA 4FXGC 1F2MA 4RG1A 4CDEC 4JI0L 4M1UB 2CFMA 1N32L 1JOQA 1Y1WB 1X3EA 1K28A 3H3VH 3GTKB 3I3CA 5T1IA 1V8QA 3PO3H 2F0QA 1Q1BA 1DOLA 1SNQA 4LFBL 2UXDL 1E0BA 3CC2A 4J1MA 4JOIC 4C3IG 2QF7A 3SK6A 4C2MB 4HIDA 1DCZA 1YIJA 4KK7A 1A0IA 4HR7B 2EYMA 1EIYB 2AMCB 1PRTC 2B39A 3EQLC 3QOLA 4NXMQ 1II3A 4IUVA 2KCMA 1YHQA 1VQLA 1LTBD 4OHJA 3X3MA 4GNXA 3M3YH 5ELBA 4I7AA 5C5MA 3MXNB 1V1QA 1I50B 3BZKA 1CM9A 1WCMG 4OIKA 3CCVA 4A3CG 1TWFB 5C4XH 3M4OB 3S1QB 1CZGA 1Q3LA 2VQEQ 3LX0A 2N8NA 1WTRA 4N9TA 1KIXA 3Q6SA 2QILA 1EQRA 3NEMA 4KY5A 1NR4A 2B2YA 5C44G 4UY8C 3CKIB 1JJGA 5M3FG 1QZHA 1EU4A 3H91A 4PNYA 1LYLA 5M3MH 3KF6B 1KDAA 4G57A 1K3RA 1SE3A 4L8JA 2ZJRA 2YYZA 1BBWA 5IGFA 1SYGA 5IGBA 4PV1C 3CQZH 4IUUA 2DNEA 3K6OA 5DM63 4A3EB 1XWEA 4A3FG 4LF4Q 2JA7G 4A3GH 4LF5L 1JE5A 2RSNA 1IBML 3BDOA 1XNRL 4P74A 1SMYD 3MVVA 3T51B 3T1HL 3PO3B 2UUCQ 4LFAL 2FXQA 1ZKOA 1WTQA 3LGJA 1E22A 4DR6L 4B3RL 3U50C 3SR1A 1T5EA 2D5DA 2M9VA 5CV5A 2FHTA 1BBUA 3ULPA 5F2DA 4C3IH 1KABA 2E75C 1SYBA 5IYBG 2VXWA 3HOZG 1H9SA 1IBLL 1EY7A 4ZLTF 1IHZA 2KEDA 5E1FA 4ME3A 5LMUL 3E0EA 4BBRG 1VQBA 1IYUA 4CDDC 2XRQD 4APVA 1SYEA 4DNTB 3M3YB 1B3QA 1F9PA 4R9WA 3UDXA 4LF6Q 3MFYA 1BCPF 2YU9H 1YJ9A 5LHY1 4DPGA 1N36L 4DR1Q 1QUQA 5C4XB 1EQTA 5D3DA 5T1GA 4DR5L 3STBC 3SK8A 2FMCA 1WCMH 2R93G 1GVPA 3NQIA 4A3CH 1ILQA 3J81E 2ENBA 2Q2HA 3MA2B 4OELB 3QB3A 1RKNA 1YHBA 1TXYA 1NY4A 4HIMA 1WJJA 3C46A 1Q8IA 1JOOA 4EVOA 5C44H 1ASZA 5M3MB 3VR6A 1Q82C 5M3FH 1S40A 1CKNA 1TY0A 3UDGA 3E9HA 4B3ML 2UUBL 3A56A 2Z0SA 3J81c 1LTLA 3CQZB 5FLMG 4LF7Q 2UUAQ 3M4PA 1NBWA 1QVFA 5HGQA 4A3GB 1YBYA 3LNNA 2Z4IA 2IX1A 1EYAA 4K14A 2Z6BA 1NMGA 4A3FH 3BS1A 4DAPA 4QMGA 2JA7H 2I07B 5KYLA 1R4QB 1PXUA 2ID0A 4P75A 1I4QA 2F0VA 1SNMA 2AQ2B 3ITPA 5E4XA 3CCJA 3KF8B 1BO0A 3DM3A 1BF4A 2KUMA 2K05A 3KOJA 2JEBI 5K5PA 1E2VA 3Q23A 3RUZA 4GZYC 4G7OC 4CHTB 2R7FA 3J7YW 4C3IB 3RNUA 2F4IA 3WWVA 2JA5H 2Z6KC 4A3KG 3Q8DA 1MBYA 1RDPD 2Q8RE 2DNCA 5ELFA 1B50A 4HJ9A 1J5EL 4X65Q 1H9JA 5IYBH 1N33Q 3HOZH 3I56A 4IOAA 1A2TA 4L63B 4BBRH 2YU9B 1XMOL 1IKMA 4JG2A 5TSSA 3TSSA 4YCWA 2L12A 1J9OA 3H94A 1JJ2A 2F0SA 4M8AA 2OTJA 5GAEC 1S4ZA 4S3SA 1WCMB 4ID6A 3NBHA 2NN6G 3U9SA 3T56B 1DJRD 1LV9A 2R93H 5EGTA 2RHQB 3SK4A 4C3JG 5CR3A 3SE0A 4CKCA 4IFDI 4F88A 4C56C 5C44B 4LW1A 2L11A 1TR5A 4DK1A 5M3FB 3G71A 4DAMA 3KFUA 3S2DH 1RL2A 3GP7A 4KY7A 2VB2X 3SK5A 1H9RA 1E1OA 4DF7A 3AQQA 3FRPB 1STGA 1Z47A 2O5JC 2IT1A 2NUCA 2Q8TA 5GAHC 1GUWA 2PZUA 1A3UA 3A54A 3GO5A 5JJZA 5FLMH 1HZAA 2UXCQ 2E2DC 2A8VA 4A3FB 3ZYYX 2JA7B 1TWGH 4IUTA 4JI2Q 1VQOA 4RGTA 1E2WA 3A8KE 4OGQC 4K0KQ 1C4QA 4POFA 2XVSA 3SXHA 2HQLA 4AQYQ 1UNSA 5I9PA 1SRUA 2ES2A 3DUZA 2HIXA 2XGTA 5CORA 1NJIC 2L4NA 3U4ZA 5HGTA 1C0AA 1M4VA 1C9OA 1JICA 4K5WA 4DR4Q 4C1NI 1SBBB 1U4LA 4KMUC 1YNNC 2DGYA 3H6MA 4A75A 4TRDA 3M85A 4YHHQ 2ZTEA 4Q5VA 1N34Q 4A3KH 3HOZB 1XJVA 1GUGA 3EA6A 2UU9Q 2IL8A 4BBRB 3VA5A 4LUVA 3J81i 1WTOA 3WDNA 1OXVA 3PUWA 1K73C 2AHOB 4X64Q 2LXJA 2L15A 1O7YA 3DEOA 3E9IA 5BR8Q 4QY7A 4QGUA 1WI5A 2O4XA 2RKSA 4ME5A 3PGZA 5CBAE 1M1KC 2HQEA 1L0WA 2OQKA 4XXEA 1O7LA 3Q22A 5KRUA 2R93B 1D6EC 4F7XA 5A2QL 3J80L 1K3BC 5J39A 1L1OB 4KHPQ 4J15A 2NN6H 3RD4A 4ZYSA 1HTPA 5I4DA 5COYA 4YWKA 3BU2A 3NTHA 4C3JH 5ELDA 3CC4A 4XIGS 3S2DB 4FF1A 1ENFA 1KLUD 1VMCA 2A6ED 3VYSA 1A2UA 5KGUA 4LFCQ 5FO7B 4JI4L 1U5KA 5HURA 4IOCA 2SEBD 4DR2Q 4UP9A 2EYJA 2F0LA 5CC4A 3RR5A 3PUVA 3TZDA 5IGCA 1AP0A 2K6AA 3PIPA 1TWGB 1VS0A 4CJ2C 1XTDA 1I3QH 3TEHB 3OTOQ 5AJ3Q 1TWCH 1SFOH 1CA6A 2HHHQ 3DXJC 2PCFB 2Z6KA 4H02A 2N88A 1Z6HA 2Z4HA 3H3VI 1GUNA 3BDLA 2YV5A 1MKHA 3K57A 4LWCA 3IFTA 3TQYA 3CPWA 1U0LA 5ELCA 1PFNA 1V1PB 4LF9Q 2EJGC 4IPDA 5IT9E 2WKCA 4A3KB 1F9RA 1AW7A 1TS5A 3BDCA 4DV7Q 1MJEA 5JPNC 4X3UA 1SMXA 3NENA 3IL8A 3KDFA 4CKBA 1A62A 3PO2G 1JWSD 3A55A 5IOCA 3CXCA 5C4ZA 2E8GA 3AYHB 1BCPD 3P20A 4GN5A 1Z7TA 2EYFA 3C1FA 2QEXA 4DV5L 3KJPA 1SE2A 3MXPA 1JORA 5IT9c 2LFNA 3R2TA 5BN3A 3CRLC 4CGYB 5LMNQ
chains in the Genus database with same CATH topology
2PQEA 1TT2A 3P75A 2EVBA 2OT2A 2L5TA 4X3KA 4C3JB 4KHVA 5DAUA 5E3FA 2KCNA 1VDZA 2QCPX 1O80A 4JK1C 2N55A 1S5DD 3T16A 2XRSD 2FFKB 2L0CA 2MHVA 1I3QB 3TP7A 1TWCB 1SFOB 1HQRD 5KEEA 1SMYC 4KJNA 5DNFA 4OO1G 1QCBD 5EPJA 2B2YC 5C0XI 3X3NA 1FNVA 1PLFA 1EY4A 3LWUA 4KN4C 1SXTA 4DAVA 1F9SA 1TIID 3GD7A 1RTNA 3T13A 2D62A 1G8ZD 2F0HA 4WFN3 1G291 3HG9A 3TP6A 3BYYB 1JB3A 1QNUA 1PMRA 2F0TA 2NWGA 2FMMA 3S14B 3A7AB 4KN7C 3QOJA 1SNOA 2FJ2A 5M5WB 3PV0A 5IGEA 3MTSA 1RF2D 2M00A 3VYUA 3DWQA 5M5YB 4R8IA 1EY0A 1KNEA 5FK9C 2ZXRA 4FF3A 1OXTA 1RHPA 5FO8B 4I7ZC 2ZXOA 3S1MB 3QG1A 2RDHA 1HFGA 3OW7A 5C5LA 2F0WA 1ESRA 1STBA 1Y69U 4HAEA 1DONA 4ILWA 1IYVA 4OO1H 1XXGA 4G7ZC 3CRKC 5CV4A 1R4PB 5DM73 2TSSA 1D1IA 4QCLA 3GTGB 5I2XA 2WACA 2KVMA 4XQJA 4LJZC 4K5VA 4KY6A 3VR2A 3V96A 5JVG3 2NVYB 4PMWA 2NB0A 4C1NK 5IIFA 4KKUA 2K32A 4DXGA 3VA7A 4XYQA 1EEFD 2X69A 3NUCA 4ULLA 3PO2B 4RCNA 2KQ3A 1SYCA 1HUNA 4PMBA 3T4AC 2EE1A 2EPBA 1HHVA 4MHEA 2QEJC 4LAAA 4DGZA 4BA1I 1AEXA 4OIJA 4KV6A 1ZEQX 4DXFA 1PTOD 1SYDA 2XWJB 3HEJA 2MPMA 2B2UA 4IURA 1DXMA 1PRTB 2WIIB 5IODA 3TMEA 2RDGA 2CW0D 1SEBD 2WINB 1JQYD 2EZVA 2D9UA 2PZWA 3OMCA 3HS0C 4Z9CB 1RODA 2NVXB 3GV3A 3D31A 3K5OA 1QWYA 4K5XA 1CFMA 4FNFA 3VYTA 3N52A 1CQVA 4ODGA 3MZ5A 3KBGA 5FLXE 2K5WA 2TMPA 2C9OA 3H3VC 1EWHA 4P2CB 1HA6A 4U673 2K01A 3JAME 1QNKA 3TBIB 2A6HD 3DMUA 2F0DA 2RA4A 3GTJB 1GUSA 2QKIC 3HOXB 1B2TA 5NUCA 4F87A 1LO5D 3RMHA 4WORA 1AN8A 3NE5B 4NMZA 1R9TB 2EYLA 5I6YA 3IAYA 1HQMC 3GTPB 3P7JA 2OXPA 2B2VC 1RTOA 3SHLA 2JSOA 1I4XA 4RGOS 3I4NB 2NN6I 1HTLD 5IGDA 2A6EC 4UAIA 1EQVA 3PUZA 4FXDA 2L1BA 3MFGA 4X3SA 5A2QE 5CYUA 1CHPD 1LT5D 1NCVA 1S5CD 1PZID 5EBDA 1C48A 5CV9A 1U9RA 2WP8J 1IKLA 4EQOA 4NKLA 2IWHA 4PMCA 3I4LA 4HTHA 2NYZD 1QB5D 2HCIA 1STAA 3NTKA 1ET9A 4HCSA 2LMCB 1QILA 2NTSA 1HRJA 3FKIB 3HOWB 3M4YA 2VNUD 3L7ZC 2BA1A 3GV6A 2WAQB 2HUGA 5KYIA 1BCPC 1CI3M 4MIUA 2BA0A 2B2TA 1B53A 2NVQB 1WVLA 1DZ1A 3MXNA 5K36G 2BCOA 3M7GA 3VR4A 4BA2I 3E5SA 3MXGA 2SDFA 5CBEE 3V2TA 2JA8B 2E2JB 4LK1C 2AUJD 4A3MB 4BY1B 3L3OC 2F0IA 3HOYB 4K8IA 1FYCA 3Q0AA 4XT3B 1LLRD 2ZXPA 1EIGA 3MC0B 2R92B 1BBXC 3AMUA 1KAAA 1W6JA 3D8GA 4RGMA 5ISRA 2K7VA 2B8GA 2DY7A 5LL6X 4KTAA 3IKJA 2DY8A 4CJ0B 5I6WA 1TY2A 1SNCA 1I6VC 4K6LA 1UAPA 5EJWA 1Q12A 1BXTA 4IFDJ 1K83B 3S9WA 3C3LA 2E2HB 1STYA 2IX3A 1ENCA 1EYDA 1GOZA 3U9OA 1EY6A 1A15A 1EOTA 2EY5A 3PIO3 3N6RA 1BDOA 1DOMA 4HMJA 5AFWA 1BOSA 1NAPA 1EIHA 2NVTB 1TS3A 2EY2A 2KECA 1CHQD 2B2VA 3NBIA 2JA5B 1Y1VB 1PDQA 2AQ3B 2F03A 1K8OA 3IFDA 2IX0A 1HXYD 1QJOA 3UI2A 3R3OA 4B08A 4K2KA 5K36H 1MD2D 2PW5A 4Y7NB 2K5QA 2SNSA 1T5XD 5I9OA 2A68D 3TP8A 1FR3A 2R6GA 5I2YA 4ZUJA 1D5MC 3HRZC 4RHRA 1TWHB 1EFID 1FNUA 3KLSA 4HMIA 1NUCA 1L0YB 2E74C 3R93A 4Q0FA 1AFPA 2ICEC 2NBFA 1ZYRD 4ZK9B 5C4JB 2A73B 3FVQA 3J81L 1UUPA 5G3LF 4IQZA 3WOFA 5C4HA 3KF8A 2X6GA 4OO1I 1LT6D 1CZWA 4C3HG 4RHSA 4NW2A 1EZ6A 1ILPA 4HSVA 1L0XB 2BE5D 2JXMB 1WTPA 5CV6A 1TS4A 1I4GA 1ICWA 5CGKA 1C8CA 3BG3A 3QO2A 1O7ZA 3EFXD 3EVQA 4A3JB 1PZKD 2A5HA 3DWPA 1FGBD 2F0FA 1PTOC 3NTIA 1A3TA 1VF5C 1S5ED 3DHQA 3H0GB 1JC7A 3W3AA 3W2DA 1DD2A 1JOKA 3ND8A 1S5BD 5ELEA 2F0UA 1LT3D 2MJ8A 2CW0C 1U4RA 1E2ZA 1BUVT 4A3BB 3NK9A 2F0NA 1BR9A 2RBMA 2BOSA 3OWFA 4RKBA 3T53B 5E4WC 4QB4A 1GXDC 2F0GA 2XSCA 3ERQA 2M2LA 3FPPA 2O5IC 3TN2A 1I4RA 4IN3A 2B2UC 4N9PA 4V0BA 3Q24A 1CT1D 3SVMA 2QDBA 4CKEA 2EY1A 2KOLA 4IUPA 2A6HC 1UEAB 3GTMB 5CV8A 3K7AB 4BWGB 1KDBA 2IJ0A 2KCCA 5C6AA 1OXSC 2H4OA 4DFAA 4LMQD 2EXZA 1ET6A 4I65A 2MUYA 1JR0D 1SNDA 3GTLB 3K0YA 5FOBB 1JWMD 2VUMB 2IPKD 3DWAA 1A3VA 2PNRC 4ZAIA 5C0XJ 3E6ZX 3EROA 2F0MA 1D5XC 1F2ZA 2EYHA 5BN4A 4KHZA 2RQXA 3I73A 1ENAA 3I8ZA 2JE6I 2LY7A 4XQNA 3KBXA 1F9QA 1DOKA 3VR3A 2F1MA 2K5DA 4XYOA 1M8AA 1F77A 2PMZB 1IL8A 2LS01 5EQ0A 3BZDB 5D3IB 3BYTB 1OXUA 3URYA 1B44D 3R2IA 3PUYA 4TQUS 1FNWA 1X3PA 4EQNA 4C3HB 1IW7D 1H9SB 1RJTA 4ZKCB 1PRTF 1V1PA 2K04A 5EKIA 4F8MA 5C3EB 2R3ZA 4R8NA 2C5CA 3SDZA 1DYQA 4DN4M 1B3AA 2AQ1B 3HOUB 2B63B 3KLRA 1EU3A 1RD9D 5KNDA 2WB1B 2LKVA 1QOHA 2I46A 3AB9A 3GQBA 1SJHD 3PMFA 4ABNA 5IT9L 5C0XG 3I70A 1PFMA 2KA7A 1YNJD 2G9HD 2B2TC 2BDNA 1WD0A 3F2UA 2PO4A 4AYBB 3RZOB 3P1HA 4G7HC 3E0JA 2CQAA 1EL0A 2B8FA 4BS9A 3D3RA 1I6HB 5FO9B 3K5MA 1I4HA 2IW3A 2B2WA 4YIJA 5D14A 1MSGA 4EGVA 1ESFA 1PZJD 1G6ZA 2K1BA 4EQPA 1HPCA 5G3LD 2ICIA 1O78A 2PW7A 3HOVB 3S17B 1B9MA 2RDFA 4O42A 5J22A 4RFBA 4ZRZA 3FPUB 1ML0D 1VF7A 3V05A 1I4PA 5EBCA 3BVGA 2K03A 2WKDA 3K59A 2PYKA 2NZ1D 3CHBD 3BVZA 4J8QA 1TU2B 3BVMA 3RZDB 3NWTA 1VMPA 3OHXC 2A68C 4FO2A 2EOTA 3J7AV 3TZUA 2F0JA 3H09A 1G2SA 1HUMA 4G4KA 5D65A 4DK0A 1EY9A 4H13C 2XNAC 1H9MA 5C0XH 3SEBA 1HFNA 3J7AF 1EZ8A 1SJED 2SNMA 4HSPA 1SDFA 1XYIA 4DNRB 4CBVA 2E76C 1ZYRC 1VCIA 1GUOA 3NSWA 3J80E 2H1EA 3NXWA 2XN9C 4K6DA 2EY6A 2RVLA 4H0LC 3TDQA 2EDGA 3D4WA 1BQQT 3ND9A 1STEA 2BE5C 4H44C 1LTAD 3OIQA 1W6KA 3D6CA 2EJMA 4FF4A 3S2HB 1Q1EA 4IUNA 2A69D 2K33A 1EY5A 3S1RB 3I90A 1J8IA 4QF4A 3KUPA 5LL6S 3OOCA 3MAQA 2Y0SB 5JOBA 3NWSA 5IGGA 2J4XA 3O13A 1LT4D 2AUKA 3DM1A 1Y8OB 4HN7A 4B9XA 1CTMA 3NHHA 1BNZA 1WTVA 4FF2A 2MP1A 2HDLA 3M7NA 2MGSA 1NSNS 1BCPB 3TP5A 2K28A 3R8BA 1KLGD 1NR2A 5CMDA 3A7LA 4B9WA 1Q90A 1U4MA 1WTWA 3WOEA 2Z1CA 5JEAJ 2XWBB 1B4OA 1OXXK 2VB3X 3NPPA 4KD4A 1U4PA 2CVRA 3QWNA 4BBSB 1F2LA 5EPKA 3DEPA 1PRTD 2OF1A 1GHKA 2A74C 4RAUC 3OSOA 2KJXA 4A3DB 1ZXTA 4FVMA 2PZTA 1X3QA 1EWCA 1STHA 1QG7A 2ZT9C 4IALA 3I91A 3VR5A 3RLFA 4MN3A 3MEHA 1TVXA 4ZKBB 3I4MB 3S1NB 3CU7A 2PPBC 4K8JA 2OEOA 1SAPA 5FLXL 4CJ1B 5DEHA 3HZXA 4ZQ3A 4BY7B 4ZUIA 2D2CC 3AU7A 4X3TA 3JAML 2JYOA 2G9DA 2Z8LA 3GTQB 2X6LA 3FMCA 3NP8A 3K5NA 3EJIA 1G91A 4IZ8A 4OL7A 5KNCA 3VYRA 1AZQA 4DU9A 1V1OA 3GTOB 2HCCA 5C3WA 1SSOA 1D5ZC 1IW7C 2FINB 1PTOH 3S16B 2L9HA 5JVH3 1MSHA 3HP3A 2KEEA 4FXKC 1LACA 5JEAG 3KLSX 4KD3A 2AWNA 1EYCA 1S5FD 1TS2A 1PTOF 4RGNA 1SYFA 1V43A 4RKLA 4NDXA 3A8IE 2DN8A 5EPLA 4XTCS 2JEAI 1GUTA 4V190 4IFDG 1XX8A 2L55A 4NP5A 5J1ZA 4TSSA 1SE4A 3OPOA 4L6TB 1WTXA 4WRDA 1FD7D 5JPMC 3ONAB 2O2LD 1PFBA 4PQXA 2JA6B 1STNA 1YNJC 3I72A 2F0EA 1RCVD 1KNAA 1LTSD 4O1NA 2EJFC 4E6IA 1EY8A 2F3WA 1K8MA 3S15B 4RCOA 2J7ZA 4A3IB 1CK1A 1KDCA 2E2IB 4FP5D 2R61A 1F2YA 2EYOA 1TWAB 5EKLA 1HA5A 1PTOB 1HCZA 4RH6A 1H9KA 5KIXA 1X32A 4KKSA 2JP1A 1A6XA 1CQFA 3MHBA 4UDUC 1EEID 1LTID 5JEAH 4QUCA 1D1KA 2B2WC 4K2LA 3NQTA 2RSOA 3OIPA 1GHJA 1B1ZA 3OWEB 4DA2A 1MGSA 1Y8NB 1GJXA 4IFDH 1ONLA 2J0TD 3D4DA 2GA4B 3QIAA 4FYDA 5EKKA 1JCKB 2KHSA 5CV7A 2V4DA 1D2BA 3K58A 1JWUD 4KKTA 2XIWA 4XQQA 4WJWA 4KI0A 1DM0B 3FDTA 1LABA 2F3VA 3MWYW 5FKAC 3C1EA 4TKOB 4U68A 4QIWB 1G2TA 2WV6D 1CA5A 1WD1A 4HCEA 5M9OA 2NTTA 4RWSC 4IUQA 1KTKA 3D6WA 4DAYA 1LTTD 4XDXA 2F0KA 3MXUA 5A35A 4QUFA 1QE6A 3PIP3 1YNND 3K5LA 5M5XB 1TQOA 1B9NA 3QJYA 5KNBA 4KJOA 1TKWB 1XTCD 5C3XA 5JAVA 1JE4A 1OO9B 1Y8PB 3A8JE 4XT1B 2Q8IB 2A69C 3L9AX 1PYWD 3G6JB 2AWOA 2SOBA 2EYPA 3KK7A 1SNPA 3LWEA 3G7LA 4RA8A 2F0OA 1MI2A 2CHBD 1LTGD 4H7BA 2F0PA 3HGBA 3FEWX 3C2PA 2R7ZB 1LTRD 3PUXA 2HDMA 4JBWA 3HKZB 2BDOA 1AZPA 4A93B 5BN5A 3D4RA 4HEDA 3OMGA 4J6HA 4FXGC 1F2MA 4M1UB 1JOQA 1Y1WB 3GTKB 3I3CA 5T1IA 1V8QA 2F0QA 1Q1BA 1DOLA 1SNQA 1E0BA 4J1MA 4C3IG 2QF7A 3SK6A 4C2MB 1DCZA 4KK7A 4HR7B 2EYMA 1PRTC 2B39A 3EQLC 3QOLA 1II3A 4IUVA 1LTBD 4OHJA 3X3MA 5ELBA 5C5MA 1I50B 1CM9A 4OIKA 1TWFB 3M4OB 3S1QB 1CZGA 1Q3LA 3LX0A 1WTRA 4N9TA 3Q6SA 2QILA 4KY5A 1NR4A 2B2YA 3CKIB 1EU4A 3H91A 4PNYA 1KDAA 4G57A 1SE3A 4L8JA 2YYZA 5IGFA 1SYGA 5IGBA 4PV1C 4IUUA 2DNEA 3K6OA 5DM63 4A3EB 1XWEA 2RSNA 3BDOA 1SMYD 3MVVA 3T51B 3PO3B 1ZKOA 1WTQA 3SR1A 1T5EA 2D5DA 2M9VA 5CV5A 2FHTA 5F2DA 1KABA 2E75C 1SYBA 2VXWA 1H9SA 1EY7A 4ZLTF 1IHZA 2KEDA 5E1FA 1IYUA 2XRQD 1SYEA 4DNTB 3M3YB 1F9PA 4R9WA 3MFYA 1BCPF 5LHY1 5C4XB 1EQTA 5D3DA 5T1GA 3SK8A 2FMCA 3NQIA 1ILQA 3J81E 2ENBA 3MA2B 3QB3A 1RKNA 3C46A 1Q8IA 1JOOA 4EVOA 5M3MB 3VR6A 1TY0A 3A56A 3CQZB 4A3GB 3LNNA 2Z4IA 2IX1A 1EYAA 4K14A 3BS1A 4DAPA 4QMGA 2I07B 5KYLA 1R4QB 1PXUA 2ID0A 1I4QA 2F0VA 1SNMA 2AQ2B 3ITPA 5E4XA 1BO0A 1BF4A 2KUMA 2K05A 2JEBI 5K5PA 1E2VA 3Q23A 3RUZA 4GZYC 4G7OC 4CHTB 3J7YW 4C3IB 2F4IA 1MBYA 1RDPD 2Q8RE 2DNCA 5ELFA 1B50A 1H9JA 1A2TA 4L63B 2YU9B 1IKMA 5TSSA 3TSSA 2L12A 1J9OA 3H94A 2F0SA 4M8AA 1S4ZA 4S3SA 1WCMB 4ID6A 3NBHA 2NN6G 3U9SA 3T56B 1DJRD 1LV9A 5EGTA 3SK4A 4C3JG 5CR3A 3SE0A 4CKCA 4IFDI 4F88A 4C56C 5C44B 2L11A 1TR5A 4DK1A 5M3FB 3GP7A 4KY7A 2VB2X 3SK5A 1H9RA 4DF7A 3FRPB 1STGA 1Z47A 2O5JC 2IT1A 2NUCA 2Q8TA 1GUWA 2PZUA 1A3UA 3A54A 3GO5A 5JJZA 2E2DC 4A3FB 3ZYYX 2JA7B 4IUTA 4RGTA 1E2WA 3A8KE 4OGQC 1C4QA 2XVSA 3SXHA 1UNSA 5I9PA 3DUZA 5CORA 2L4NA 5HGTA 1M4VA 1JICA 4K5WA 4C1NI 1SBBB 1U4LA 4KMUC 1YNNC 3H6MA 4TRDA 3M85A 4Q5VA 3HOZB 1GUGA 3EA6A 2IL8A 4BBRB 3VA5A 1WTOA 3WDNA 1OXVA 3PUWA 1O7YA 3DEOA 2RKSA 2O4XA 4ME5A 5CBAE 2HQEA 4XXEA 1O7LA 3Q22A 5KRUA 2R93B 1D6EC 4F7XA 5A2QL 3J80L 5J39A 2NN6H 3RD4A 4ZYSA 1HTPA 5I4DA 5COYA 3NTHA 5ELDA 4XIGS 3S2DB 4FF1A 1ENFA 1KLUD 1VMCA 2A6ED 3VYSA 1A2UA 5KGUA 5FO7B 5HURA 2SEBD 2EYJA 2F0LA 5CC4A 3PUVA 3TZDA 5IGCA 1AP0A 2K6AA 1TWGB 4CJ2C 1CA6A 3DXJC 2PCFB 2N88A 1Z6HA 2Z4HA 1GUNA 3BDLA 3K57A 3IFTA 5ELCA 1PFNA 1V1PB 2EJGC 5IT9E 2WKCA 4A3KB 1F9RA 1AW7A 1TS5A 3BDCA 5JPNC 4X3UA 3IL8A 4CKBA 1JWSD 3A55A 5IOCA 5C4ZA 1BCPD 3P20A 1Z7TA 2EYFA 3C1FA 1SE2A 3MXPA 1JORA 2LFNA 3R2TA 5BN3A 3CRLC 4CGYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PQE A;  3MVV A;  1STA A;  3EVQ A;  4HMJ A;  5EKK A;  3P1H A;  2OF1 A;  1TT2 A;  3P75 A;  3NXW A;  1ENA A;  1EY0 A;  3OSO A;  2KHS A;  4K6D A;  5CV7 A;  2EY2 A;  2EY6 A;  4K5X A;  4KHV A;  3OMG A;  5DAU A;  4J6H A;  2RKS A;  2O4X A;  4ME5 A;  4NP5 A;  2F0F A;  5E3F A;  1F2M A;  2PZT A;  2HQE A;  5J1Z A;  4YIJ A;  1A3T A;  3SR1 A;  4ODG A;  3D4W A;  1A2T A;  5CV5 A;  5KRU A;  3MZ5 A;  1JOQ A;  4WRD A;  4F7X A;  5F2D A;  3R3O A;  4EQP A;  1KAB A;  1STH A;  5J39 A;  3DHQ A;  1SYB A;  4K2K A;  5C5L A;  4IAL A;  2F0S A;  2PW5 A;  5KYI A;  2F3V A;  1EY7 A;  2F0W A;  2F0Q A;  1IHZ A;  2PW7 A;  1JOK A;  1SNQ A;  3D6C A;  4MIU A;  1STB A;  4S3S A;  3C1E A;  3MEH A;  5E1F A;  2SNS A;  4ID6 A;  2F0U A;  3T16 A;  4J1M A;  4IUN A;  5I9O A;  1STN A;  3SK6 A;  1A2U A;  3TP8 A;  5KGU A;  1SYE A;  2RDF A;  2F0E A;  1EY5 A;  5HUR A;  4K8J A;  3DMU A;  2OEO A;  5CV4 A;  5M9O A;  5J22 A;  2EYM A;  2F0D A;  3E5S A;  3TP7 A;  5EGT A;  4E6I A;  5DEH A;  3HZX A;  4ZQ3 A;  3SK4 A;  4QF4 A;  5CR3 A;  4ZUJ A;  2WAC A;  5KEE A;  2EYJ A;  2F0L A;  4KJN A;  5CC4 A;  3V2T A;  3QOL A;  5NUC A;  1EY8 A;  3NK9 A;  4K5V A;  2F0N A;  4EQN A;  4KY6 A;  4WOR A;  4ZUI A;  1II3 A;  5JOB A;  5IGC A;  3SK8 A;  2F3W A;  1TR5 A;  2RBM A;  3OWF A;  4RKB A;  5IGG A;  2F0I A;  4NMZ A;  2F0K A;  2F0G A;  2ENB A;  2EYL A;  4QB4 A;  4KY7 A;  5IIF A;  4K8I A;  3ERQ A;  3OMC A;  3SK5 A;  4HMI A;  4F8M A;  1NUC A;  4DF7 A;  5I6Y A;  1EY4 A;  3QB3 A;  1RKN A;  1KDC A;  2PYK A;  3NP8 A;  5C5M A;  3NUC A;  1STG A;  4R8N A;  1TQO A;  3EJI A;  2NUC A;  2OXP A;  2PZU A;  3SHL A;  1A3U A;  4N9P A;  1F2Y A;  1JOO A;  2EYO A;  5EKL A;  4EVO A;  2KQ3 A;  4KJO A;  3LX0 A;  4IZ8 A;  1SYC A;  5C3X A;  4N9T A;  5JAV A;  4OL7 A;  4B9X A;  3BDL A;  1KAA A;  2QDB A;  5IGD A;  3D8G A;  5ISR A;  3NHH A;  4PMB A;  2EY1 A;  4DU9 A;  5KIX A;  1EQV A;  5C4H A;  4KY5 A;  3T13 A;  5CV8 A;  4LAA A;  4KTA A;  1NSN S;  2F0J A;  2F0H A;  1KDB A;  2SOB A;  4DGZ A;  2EYP A;  1SNP A;  3MHB A;  3SXH A;  5C3W A;  5C6A A;  5I6W A;  1AEX A;  4KV6 A;  4NDX A;  3TP5 A;  2LKV A;  4DFA A;  5I9P A;  1EZ6 A;  1SNC A;  1EY9 A;  1EYA A;  3BDC A;  4K14 A;  1SYD A;  2EXZ A;  4PNY A;  3TP6 A;  4I65 A;  5HGT A;  3HEJ A;  1KDA A;  4G57 A;  4K5W A;  4QMG A;  4B9W A;  3PMF A;  1SND A;  1EZ8 A;  4K2L A;  5IGF A;  3S9W A;  2F0T A;  1SYG A;  5CV9 A;  1U9R A;  2SNM A;  5KYL A;  5IGB A;  5IOC A;  2F0V A;  3NQT A;  2F0O A;  1SNM A;  3ITP A;  5C4Z A;  3H6M A;  4KD3 A;  1A3V A;  4NKL A;  1STY A;  4EQO A;  4TRD A;  3TME A;  5IOD A;  1EYC A;  3QOJ A;  1ENC A;  2EYF A;  3C1F A;  5CV6 A;  1EYD A;  1SNO A;  4H7B A;  4KD4 A;  2F0P A;  4PMC A;  3MXP A;  1JOR A;  5K5P A;  4HTH A;  3U9O A;  5CGK A;  1EY6 A;  3RUZ A;  5IGE A;  3ERO A;  1SYF A;  3VA5 A;  4RKL A;  2F0M A;  2EY5 A;  1F2Z A;  2EYH A;  2M00 A;  2PZW A;  3D4D A; 
#chains in the Genus database with same CATH topology
 4QJF A;  2PQE A;  1TT2 A;  3P75 A;  3S14 H;  2EVB A;  2OT2 A;  2L5T A;  1UEB A;  4X3K A;  4C3J B;  1PA6 A;  3ER0 A;  4KHV A;  5DAU A;  5E3F A;  5M5W H;  2KCN A;  1VQN A;  3EN2 A;  3JC6 6;  1VDZ A;  2QCP X;  3KYH C;  1O80 A;  3PF4 A;  5M5Y H;  4GNX C;  4POG A;  5LMN W;  4GLA C;  4JK1 C;  4DR3 Q;  2N55 A;  1S5D D;  3T16 A;  2F4V L;  2XRS D;  2FFK B;  2L0C A;  2CWP A;  2MHV A;  2K50 A;  1I3Q B;  1XMQ L;  4AIM A;  3S1M H;  3TP7 A;  1TWC B;  1SFO B;  1HQR D;  1Q46 A;  4HJ7 A;  5KEE A;  1SMY C;  4KJN A;  5DNF A;  4OO1 G;  1QCB D;  5EPJ A;  1ICF B;  2B2Y C;  5GAD C;  5C0X I;  3X3N A;  1FNV A;  1PLF A;  3F8T A;  1EY4 A;  3GTG H;  1UE1 A;  3LWU A;  4KN4 C;  4DUY L;  3EIV A;  4ZCK A;  2NVY H;  1VQ5 A;  1J6Q A;  1SXT A;  2WAQ E;  4DAV A;  3CCS A;  1F9S A;  1TII D;  3GD7 A;  1RTN A;  3HOX G;  3T13 A;  2D62 A;  1G8Z D;  1N32 Q;  2EXD A;  2F0H A;  1VQG A;  4WFN 3;  1G29 1;  3HG9 A;  4R4O A;  3PO2 H;  1HZC A;  4GOP B;  3K80 C;  2Q2I A;  3TP6 A;  3RN2 A;  3BYY B;  4NB3 A;  1PH5 A;  2N3S A;  1MIU A;  1JB3 A;  1QNU A;  1PMR A;  4JW0 A;  1VQA A;  2F0T A;  2NWG A;  3EBE A;  2FMM A;  3S14 B;  4JI1 L;  3A7A B;  3I4N G;  4KN7 C;  1HR0 Q;  3QOJ A;  1EWI A;  1DGS A;  1SNO A;  2FJ2 A;  5M5W B;  3RN5 A;  3PV0 A;  2QA4 A;  5IGE A;  4GKK Q;  3MTS A;  1PH2 A;  1RF2 D;  2M00 A;  3VYU A;  3DWQ A;  4IJL A;  4IPH A;  5M5Y B;  2BH8 A;  4R8I A;  4DV3 Q;  3CW2 C;  1EY0 A;  1KNE A;  4GKJ L;  4P73 A;  5FK9 C;  2ZXR A;  4FF3 A;  1NTG A;  1OXT A;  1RHP A;  5FO8 B;  3A5U A;  4I7Z C;  1FGU A;  1HR0 W;  2JK8 A;  2ZXO A;  3S1M B;  1N8R C;  3QG1 A;  2MFI A;  2NVX H;  2RDH A;  1HFG A;  1RIP A;  1Q81 C;  2NZH A;  2VQF Q;  3OW7 A;  4YCU A;  5C5L A;  2F0W A;  1ESR A;  4JC0 A;  1KAW A;  1STB A;  4FDB A;  5IWA Q;  1Y69 U;  4HAE A;  1DON A;  4ILW A;  1A63 A;  4OO1 H;  1IYV A;  1XXG A;  4G7Z C;  3CRK C;  4DR7 Q;  4Y52 H;  5CV4 A;  1R4P B;  5DM7 3;  2TSS A;  1D1I A;  1QUQ B;  4QCL A;  4JI8 Q;  4OWW B;  3GTG B;  4NXN L;  5I2X A;  2WAC A;  2KVM A;  2ZM6 L;  3H15 A;  4XQJ A;  4LJZ C;  4K5V A;  1PH1 A;  3FKI G;  4KY6 A;  3VR2 A;  3T1Y L;  3G6E A;  3V96 A;  5JVG 3;  2NVY B;  4PMW A;  2NB0 A;  3HOW G;  1HNW L;  5GAG C;  1GD7 A;  4C1N K;  5IIF A;  4KKU A;  2K32 A;  4DXG A;  2WAQ G;  3VA7 A;  4XYQ A;  2OCE A;  1EEF D;  2X69 A;  1K9M C;  3NUC A;  3GTJ H;  4ULL A;  2ASB A;  4DV4 L;  1KRS A;  3PO2 B;  4RCN A;  3HOX H;  2KQ3 A;  1SYC A;  4EQ5 A;  2UXB L;  1HUN A;  1R9T H;  4B3R Q;  2PQA B;  4PMB A;  3T4A C;  3VDY A;  2EE1 A;  2EPB A;  1HHV A;  3M9B A;  4MHE A;  2QEJ C;  4LAA A;  4DGZ A;  1IBK L;  2JA8 G;  3GTP H;  1GO3 E;  4BA1 I;  1PV4 A;  4A3M G;  1AEX A;  4OIJ A;  4KV6 A;  4BY1 G;  4DV1 Q;  1ZEQ X;  4DXF A;  2G5D A;  1PTO D;  1PH6 A;  3HOY G;  2Z9H A;  3I4N H;  1SYD A;  2VY3 A;  5H1S E;  1G51 A;  2K5V A;  2XWJ B;  3HEJ A;  2MPM A;  2B2U A;  4IUR A;  5GRO A;  1DXM A;  4PZ7 A;  2R92 G;  1PRT B;  2WII B;  1CSQ A;  5IOD A;  3TME A;  2RDG A;  1EUJ A;  2R7D A;  4ALP A;  2CW0 D;  1SEB D;  2WIN B;  1CKM A;  1JQY D;  2EZV A;  4DUZ L;  4YWL A;  1ASY A;  2D9U A;  2PZW A;  3OMC A;  1NMF A;  3HS0 C;  1ROD A;  4GLV B;  4Z9C B;  5GQO A;  2NVX B;  4DK3 C;  3GV3 A;  3D31 A;  2F3I A;  3K5O A;  1QWY A;  3A74 A;  4K5X A;  1CFM A;  2RCF A;  4FNF A;  1S72 A;  2KHJ A;  3G4S A;  3VYT A;  3N52 A;  1CQV A;  4ODG A;  1JT8 A;  2PI2 E;  2K75 A;  1VQH A;  3MZ5 A;  2MNA A;  3KBG A;  4R4Q A;  5FLX E;  3TRZ A;  2UUB Q;  2K5W A;  2HD3 A;  2TMP A;  2LSS A;  2C9O A;  3H3V C;  4B3S L;  1EWH A;  4P2C B;  1HA6 A;  3NBH B;  4JI5 Q;  4U67 3;  2K01 A;  3JAM E;  3FKI H;  1QNK A;  3TBI B;  2A6H D;  3DMU A;  1EFW A;  2F0D A;  2RA4 A;  4JI7 Q;  5HY6 A;  1FJG Q;  3HOW H;  3GTJ B;  1GUS A;  2QKI C;  3HOX B;  5FLX c;  1B2T A;  5NUC A;  4F87 A;  3AFP A;  2JA5 G;  1Y1V G;  4LF8 Q;  1LO5 D;  3RMH A;  4WOR A;  1AN8 A;  4HJ5 A;  3NE5 B;  4NMZ A;  1R9T B;  2ATW A;  2EYL A;  2NVQ H;  1HNX L;  5I6Y A;  3IAY A;  1HQM C;  3JAM c;  3GTP B;  3P7J A;  2OXP A;  2B2V C;  1RTO A;  3SHL A;  2JSO A;  1I4X A;  4RGO S;  4X66 L;  3I4N B;  2JA8 H;  2E2J H;  2NN6 I;  1HTL D;  4A3M H;  1YI2 A;  1X56 A;  2A1A A;  4BY1 H;  5IGD A;  2A6E C;  4O2D A;  4DK6 C;  4HJA A;  4UAI A;  3HOY H;  1EQV A;  3PUZ A;  4FXD A;  4QQB X;  2E5L Q;  1XMO Q;  2DUD A;  1KRT A;  4LUO A;  1L2F A;  2H5X A;  2L1B A;  4DV0 Q;  3MFG A;  4UP7 A;  4X3S A;  5A2Q E;  1I94 Q;  5CYU A;  2R92 H;  1CHP D;  1LT5 D;  4LNQ A;  1NCV A;  1S5C D;  1PZI D;  2VQE L;  1VQJ A;  3GDE A;  5EBD A;  1C48 A;  1X9N A;  3QR8 A;  3AFQ A;  5CV9 A;  4WJ3 M;  1U9R A;  2HIV A;  1SN8 A;  2Q2U A;  2WP8 J;  1IKL A;  3L2P A;  4EQO A;  4NKL A;  3M4Q A;  2IWH A;  1VQD A;  4PMC A;  3I4L A;  4JI3 Q;  1PH4 A;  4HTH A;  2NYZ D;  1QB5 D;  1VQC A;  3I7F A;  2HCI A;  3UE1 A;  3CCU A;  1K83 H;  1STA A;  2YTY A;  1QVC A;  2EQS A;  3NTK A;  1ET9 A;  2E2H H;  4HCS A;  2LMC B;  3W1G A;  1QIL A;  2NTS A;  1HRJ A;  3FKI B;  3PQI A;  3J7Z C;  2K4K A;  3HOW B;  3M4Y A;  2VNU D;  3L7Z C;  2BA1 A;  3GV6 A;  4MTN A;  2WAQ B;  2VZA A;  2NVT H;  2HUG A;  5EAY A;  5KYI A;  1BCP C;  1CI3 M;  4MIU A;  2BA0 A;  2B2T A;  1B53 A;  1UE6 A;  2KHI A;  1Y1V H;  2NVQ B;  1WVL A;  1DZ1 A;  3MXN A;  4A3J G;  5K36 G;  4OXP A;  2BCO A;  3M7G A;  3VR4 A;  4BA2 I;  1O7I A;  3E5S A;  2IHF A;  2JA9 A;  3MXG A;  2SDF A;  5CBE E;  3V2T A;  1V9P A;  4Y7N H;  2JA8 B;  2E2J B;  4OWT B;  2VL6 A;  2AUJ D;  4LK1 C;  4A3M B;  4BY1 B;  3L3O C;  2F0I A;  3HOY B;  4K8I A;  3H0G G;  1FYC A;  3Q0A A;  4XT3 B;  1LLR D;  2ZXP A;  4LF6 L;  3CAM A;  3SGI A;  1EIG A;  3MC0 B;  4CDC C;  2RF4 A;  3KF6 A;  2R92 B;  4DR1 L;  1SE8 A;  4GN4 B;  4DV6 L;  1BBX C;  2C35 B;  3AMU A;  1TWH H;  1KAA A;  1W6J A;  2PMZ E;  3D8G A;  4RGM A;  5ISR A;  2K7V A;  3A0J A;  2B8G A;  2DY7 A;  5LL6 X;  4A3B G;  4KTA A;  4YY3 Q;  1YIT A;  1PH7 A;  3IKJ A;  2DY8 A;  4CJ0 B;  5I6W A;  1TY2 A;  4AH6 A;  1NE3 A;  1SNC A;  1I6V C;  5C4J H;  4K6L A;  1KL9 A;  3I4O A;  1UAP A;  5EJW A;  1Q12 A;  2F52 A;  1BXT A;  3JAM i;  4IFD J;  1K83 B;  3PCO B;  3RLO A;  3S9W A;  1YJW A;  3C3L A;  2HT1 A;  2E2H B;  1STY A;  2IX3 A;  4LF7 L;  2UUA L;  4JBM A;  1ENC A;  1EYD A;  1HZB A;  1GOZ A;  3U9O A;  4JYA Q;  1EY6 A;  1A15 A;  4WJ4 A;  1EOT A;  2EY5 A;  3PIO 3;  2IY5 B;  3N6R A;  1BDO A;  1DOM A;  4HMJ A;  5AFW A;  1BOS A;  1NAP A;  1EIH A;  2NVT B;  1TS3 A;  2EY2 A;  2KEC A;  1CHQ D;  1LUZ A;  4UP8 A;  1W3S A;  4MNO A;  1PH9 A;  2B2V A;  3NBI A;  5IP7 G;  2JA5 B;  1Y1V B;  1PDQ A;  2AQ3 B;  2F03 A;  2JN4 A;  2WB1 E;  2VUM G;  1K8O A;  3IFD A;  2IX0 A;  1HXY D;  1QJO A;  3UI2 A;  3R3O A;  4B08 A;  1Q86 C;  1YZ6 A;  1A8V A;  4K2K A;  3S24 A;  4A3J H;  5K36 H;  1MD2 D;  2PW5 A;  4Y7N B;  2K5Q A;  2K5H A;  4L5Q A;  2SNS A;  1E7Z A;  4X65 L;  1T5X D;  5I9O A;  2A68 D;  1N33 L;  3TP8 A;  4JVZ A;  1FR3 A;  2DJF C;  2KBN A;  2R6G A;  5I2Y A;  1VQ6 A;  4ZUJ A;  3H0G H;  1D5M C;  3HRZ C;  2ALY B;  1PYB A;  4RHR A;  1BVS A;  1TWH B;  4AYB E;  1EFI D;  3CCQ A;  1FNU A;  1VQ4 A;  3KLS A;  4HMI A;  1NUC A;  1L0Y B;  2E74 C;  5JJL A;  1LM0 A;  2D0O A;  3R93 A;  4Q0F A;  3G48 A;  3BJU A;  5ELO A;  1AFP A;  2ICE C;  2NBF A;  2YTV A;  1ZYR D;  4ZK9 B;  4A3B H;  5C4J B;  2A73 B;  2IHE A;  3W1B A;  1XPU A;  3FVQ A;  3J81 L;  1GKH A;  1UWV A;  4DAY B;  1UUP A;  5G3L F;  1YNX A;  4IQZ A;  3WOF A;  5C4H A;  3KF8 A;  3DLL A;  2X6G A;  2I5M X;  4OO1 I;  4DV2 Q;  1LT6 D;  2KEN A;  2BH2 A;  1CZW A;  3W5O A;  4C3H G;  3D0F A;  1QVG A;  1AE2 A;  4RHS A;  4NW2 A;  4IJH A;  1EZ6 A;  2UXC L;  4P72 A;  5C3E G;  2F4V Q;  1ILP A;  1YHA A;  4HJ8 A;  1YJN A;  4HSV A;  1L0X B;  2BE5 D;  2JXM B;  1XMQ Q;  3GTM H;  3K7A H;  1VQ7 A;  1VQP A;  3HOU G;  1WTP A;  2B63 G;  4K0K L;  5CV6 A;  1TS4 A;  1I4G A;  4N8F A;  1ICW A;  2GVB A;  5IE8 A;  5CGK A;  1IYJ B;  1C8C A;  3BG3 A;  3QO2 A;  4EX5 A;  1JMC A;  2WB1 G;  5IP7 H;  1O7Z A;  3EFX D;  4DR4 L;  3EVQ A;  4A3J B;  3GTL H;  1PZK D;  4OON A;  2VUM H;  2K52 A;  4JCV E;  2A5H A;  1SRO A;  3ICE A;  3DWP A;  3K81 C;  4X62 L;  1FGB D;  2F0F A;  4YHH L;  1PTO C;  3K7U C;  3NTI A;  1A3T A;  4A4I A;  2UU9 L;  4YWM A;  1VF5 C;  3F2D A;  1Z9F A;  1S5E D;  3DHQ A;  3H0G B;  4JBJ A;  1JC7 A;  3W3A A;  4X64 L;  3W2D A;  1DD2 A;  1JOK A;  3ND8 A;  1S5B D;  5ELE A;  1C7Y A;  2F0U A;  2D0P A;  5BR8 L;  1LT3 D;  2MJ8 A;  2CW0 C;  4AYB G;  4UHV A;  1U4R A;  1E2Z A;  1BUV T;  4KHP L;  4A3B B;  3NK9 A;  2F0N A;  5IYC G;  1BR9 A;  2RBM A;  2BOS A;  3OWF A;  4RKB A;  3T53 B;  5E4W C;  4QB4 A;  1GXD C;  2F0G A;  4L5R C;  3UDF A;  2XSC A;  3ERQ A;  2M2L A;  3FPP A;  3HOV G;  2O5I C;  3TN2 A;  1I4R A;  4IN3 A;  2B3G A;  2B2U C;  4N9P A;  4V0B A;  3Q24 A;  4C3H H;  1CT1 D;  3SVM A;  2QDB A;  4CKE A;  2EY1 A;  2KOL A;  4IUP A;  2A6H C;  1UEA B;  4JV5 Q;  5C3E H;  3GTM B;  5CV8 A;  3K7A B;  4BWG B;  1KDB A;  3OTO L;  1XNQ Q;  5AJ3 L;  2IJ0 A;  4GNX B;  2KCC A;  3I2Z A;  5C6A A;  1OXS C;  2H4O A;  4DFA A;  4LMQ D;  3HFZ B;  1VQM A;  3HOU H;  2EXZ A;  1ET6 A;  1WFQ A;  4I65 A;  2B63 H;  2MUY A;  1JR0 D;  1SND A;  3GTL B;  3K0Y A;  5FOB B;  1Q7Y C;  1JWM D;  4GLX A;  2Y0S E;  2VUM B;  2IPK D;  3DWA A;  1HNZ Q;  1A3V A;  2PNR C;  4ZAI A;  1M90 C;  5C0X J;  4LF9 L;  3E6Z X;  4A3L G;  4JI0 Q;  3ERO A;  1L1O A;  2F0M A;  1D5X C;  1F2Z A;  2EYH A;  5BN4 A;  1D7Q A;  4KHZ A;  2RQX A;  2MQH A;  3I73 A;  1ENA A;  3I8Z A;  2JE6 I;  2LY7 A;  4XQN A;  3KBX A;  4LFB Q;  2UXD Q;  1F9Q A;  1DOK A;  3J81 j;  3VR3 A;  2F1M A;  2K5D A;  4XYO A;  1M8A A;  5JJI A;  1IL2 A;  2UXB Q;  1KC8 C;  1F77 A;  1KHI A;  2PMZ B;  3RZO H;  4OX9 L;  2AKW B;  1SR3 A;  1IL8 A;  2LS0 1;  2I5L X;  5EQ0 A;  4OWX B;  3BZD B;  1I6H H;  5D3I B;  3BYT B;  1OXU A;  1X3F A;  3URY A;  5IYC H;  1B44 D;  1K0R A;  1MHW C;  3R2I A;  4CDF C;  1X3G A;  3PUY A;  4TQU S;  1FNW A;  3U58 A;  1X3P A;  4EQN A;  1IXR A;  3HOV H;  4C3H B;  5E7N A;  1IW7 D;  1H9S B;  1RJT A;  4IO9 A;  4DR3 L;  4ZKC B;  3S17 H;  1PRT F;  1V1P A;  2K04 A;  5EKI A;  4F8M A;  5C3E B;  1H95 A;  2R3Z A;  4R8N A;  2C5C A;  3SDZ A;  1DYQ A;  3OYY A;  4DN4 M;  1B3A A;  1WOC A;  2AQ1 B;  3HOU B;  4L5T A;  2B63 B;  3KLR A;  1EU3 A;  5IP9 G;  2ZJQ A;  3B6Y A;  1RD9 D;  5KND A;  2EIF A;  2WB1 B;  2Y0S G;  2LKV A;  4LF5 Q;  1QOH A;  2I46 A;  4HIO A;  3AB9 A;  3GQB A;  4B3S Q;  1IBM Q;  1SJH D;  1XNR Q;  3RZD H;  1N9W A;  3PMF A;  4A3L H;  3T1H Q;  4ABN A;  4LFA Q;  1CKN B;  4N8X 1;  3UE0 A;  5IT9 L;  4TVA B;  5C0X G;  4DR6 Q;  4A76 A;  3I70 A;  1PFM A;  2KA7 A;  3ULJ A;  1YNJ D;  2G9H D;  1BKB A;  2B2T C;  2BDN A;  1WD0 A;  3F2U A;  2PO4 A;  4AYB B;  3RZO B;  3P1H A;  1IBL Q;  4G7H C;  1HNX Q;  3E0J A;  2CQA A;  1EL0 A;  5LMU Q;  2B8F A;  4BS9 A;  3D3R A;  1I6H B;  4MTK A;  1PHJ A;  1HR0 L;  2OQ0 A;  4IPG A;  2MO1 A;  2V1C C;  5FO9 B;  4X66 Q;  3K5M A;  1I4H A;  2IW3 A;  2B2W A;  4YIJ A;  1QZG A;  5D14 A;  4B3T L;  1MSG A;  1KXL A;  4EGV A;  4GKK L;  1E3P A;  1ESF A;  1PZJ D;  1G6Z A;  1N36 Q;  2K1B A;  4EQP A;  1HPC A;  4YCV A;  5G3L D;  2ICI A;  1O78 A;  1T9H A;  4DR5 Q;  4BBS G;  2PW7 A;  4DV3 L;  3HOV B;  3CF5 A;  3S17 B;  4JI6 L;  1B9M A;  2RDF A;  4O42 A;  1X6O A;  5J22 A;  4RFB A;  4BXX G;  4ZRZ A;  3FPU B;  4A3D G;  1ML0 D;  1VF7 A;  2OWO A;  1EYG A;  1NNX A;  3V05 A;  2VQF L;  1I4P A;  5EBC A;  3S2H H;  5DLQ E;  5IWA L;  4B3M Q;  1I5F A;  3TS2 A;  3BVG A;  2K03 A;  2P5Z X;  1W2B A;  2WKD A;  3OW2 A;  4DR7 L;  5IP9 H;  3K59 A;  2PYK A;  3S1R H;  2NZ1 D;  3CHB D;  3BVZ A;  4GOP A;  4J8Q A;  3CC7 A;  4JI8 L;  1TU2 B;  1AE3 A;  1P16 A;  2CQO A;  3BVM A;  5IYD G;  3I4M G;  3RZD B;  3NWT A;  1VMP A;  3OHX C;  2A68 C;  4FO2 A;  4BY7 G;  2EOT A;  2CH4 A;  3J7A V;  3TZU A;  3KJO A;  1HH2 P;  2F0J A;  3H09 A;  1Q8K A;  1G2S A;  1HUM A;  4G4K A;  5D65 A;  4DK0 A;  1EY9 A;  4H13 C;  3CME A;  2XNA C;  1H9M A;  5C0X H;  3SEB A;  2A19 A;  1HFN A;  3J7A F;  1EZ8 A;  5IY0 A;  1X65 A;  1SJE D;  2SNM A;  4HSP A;  4QL5 A;  1SDF A;  4NXM L;  1XYI A;  1J5E Q;  4DNR B;  4CBV A;  4GN3 B;  3PIO A;  2E76 C;  1ZYR C;  1E24 A;  4DV1 L;  1VCI A;  4R4C A;  1GUO A;  1SLJ A;  3NSW A;  1EQQ A;  5JJK A;  1VQ9 A;  3J80 E;  2H1E A;  3NXW A;  2XN9 C;  4K6D A;  2EY6 A;  2QW7 A;  2RVL A;  4H0L C;  3CD6 A;  1E1T A;  3TDQ A;  2EDG A;  4JBK A;  4BBS H;  3D4W A;  1BQQ T;  4DV6 Q;  3ND9 A;  1STE A;  2BE5 C;  3ERS X;  4H44 C;  3CCR A;  1LTA D;  3CCL A;  3OIQ A;  1W6K A;  3J80 c;  4BXX H;  3D6C A;  2EJM A;  4FF4 A;  3S2H B;  4A3D H;  1Q1E A;  4IUN A;  2A69 D;  2K33 A;  1EY5 A;  3S1R B;  2ZJP A;  2I0Q A;  3I90 A;  1J8I A;  4QF4 A;  1HZ9 A;  3KUP A;  5LL6 S;  4LF4 L;  3OOC A;  3MAQ A;  2Y0S B;  5JOB A;  2PQA A;  3NWS A;  5IGG A;  2J4X A;  3O13 A;  4JI5 L;  1LT4 D;  2AUK A;  5ELN A;  2KCT A;  5J3B A;  3I4M H;  5IYD H;  3S1N H;  2UUC L;  3DM1 A;  4JI7 L;  1FJG L;  4BY7 H;  1CSP A;  2CCZ A;  4JOI A;  1VQK A;  1Y8O B;  2JA6 G;  4HN7 A;  4LF8 L;  4B9X A;  4NPS A;  3BZC A;  1CTM A;  3NHH A;  1BNZ A;  1WTV A;  4FF2 A;  3GTQ H;  2MP1 A;  1UE7 A;  2HDL A;  3M7N A;  2MGS A;  1NSN S;  4QIW E;  1BCP B;  2RHS B;  3TP5 A;  1VQ8 A;  2K28 A;  3R8B A;  4LUZ A;  1KLG D;  1NR2 A;  5CMD A;  4A3I G;  3A7L A;  4B9W A;  1Q90 A;  4O0A A;  1U4M A;  3PF5 A;  1WTW A;  3WOE A;  2Z1C A;  3GTO H;  2E5L L;  2XWB B;  5JEA J;  1B4O A;  1OXX K;  2VB3 X;  3NPP A;  4KD4 A;  4DV0 L;  1U4P A;  2CVR A;  3QWN A;  4BBS B;  1I94 L;  1F2L A;  3CCE A;  3S16 H;  5EPK A;  3DEP A;  1PRT D;  2OF1 A;  3KDF B;  1GHK A;  2A74 C;  2CKZ B;  4RAU C;  1VQI A;  3OSO A;  3FHW A;  2KJX A;  1CUK A;  4A3D B;  2B29 A;  1ZXT A;  4FVM A;  2PZT A;  4KLK A;  4JI4 Q;  2PNH A;  1X3Q A;  1EWC A;  4JI3 L;  1KQS A;  2DJG C;  4JPB W;  1STH A;  1QG7 A;  2QDL A;  2ZT9 C;  4IAL A;  3I91 A;  3VR5 A;  3RLF A;  4MN3 A;  3MEH A;  1TVX A;  4ZKB B;  3I4M B;  3S1N B;  1K8A C;  1HJP A;  3CU7 A;  2PPB C;  1P8L A;  4K8J A;  2OEO A;  1SAP A;  5FLX L;  4CJ1 B;  5DEH A;  3HZX A;  4ZQ3 A;  4BY7 B;  1FVI A;  3K8A A;  1GM5 A;  1XPR A;  1JJC B;  4ZUI A;  4PZ6 A;  2D2C C;  3AU7 A;  3CPF A;  1CKO A;  4X3T A;  3JAM L;  2JYO A;  2JA6 H;  3HKZ E;  2G9D A;  2Z8L A;  3GTQ B;  2X6L A;  1EIF A;  3FMC A;  3NP8 A;  3K5N A;  3J80 i;  3A5Z B;  3EJI A;  1G91 A;  4IZ8 A;  1JB7 A;  4OL7 A;  1MJC A;  3S15 H;  4X62 Q;  5KNC A;  1KD1 C;  3VYR A;  1AZQ A;  4DU9 A;  1V1O A;  1L1O C;  4A3I H;  4P71 A;  2CWA A;  3GTO B;  4DV5 Q;  2VW9 A;  1X54 A;  1PH3 A;  2HCC A;  5C3W A;  2E2I H;  2YTX A;  1TWA H;  1WYD A;  1YEZ A;  1SSO A;  1D5Z C;  1IW7 C;  1PYS B;  2FIN B;  1PTO H;  4HIK A;  3S16 B;  2L9H A;  3RLN A;  5JVH 3;  1MSH A;  3HP3 A;  3NEL A;  3CMA A;  1PVO A;  2KEE A;  4FXK C;  3HKS A;  1LAC A;  5JEA G;  3KLS X;  4KD3 A;  3U4V A;  4YY3 L;  2AWN A;  2VS1 A;  1EYC A;  2N49 A;  1S5F D;  1TS2 A;  1PTO F;  2GVA A;  4RGN A;  1SYF A;  1V43 A;  4RKL A;  4NDX A;  2ZTD A;  3A8I E;  2DN8 A;  5EPL A;  4XTC S;  2JEA I;  2ZTC A;  1GUT A;  2OTL A;  4V19 0;  3MEF A;  1OTC A;  4IFD G;  3STB D;  3UDI A;  1XX8 A;  2L55 A;  4NP5 A;  4JI2 L;  2WFW A;  5J1Z A;  4TSS A;  1SE4 A;  3OPO A;  4X6A H;  4JYA L;  4L6T B;  2Q2T A;  1WTX A;  4WRD A;  4RMF A;  5FJ8 G;  1FD7 D;  5JPM C;  3ONA B;  4AQY L;  2O2L D;  1PFB A;  4PZ8 A;  2R7Z G;  4PQX A;  2CH4 W;  2JJQ A;  2JA6 B;  1STN A;  1YNJ C;  3I72 A;  2F0E A;  1RCV D;  1KNA A;  3HKZ G;  1B7Y B;  1LTS D;  4O1N A;  4A93 G;  2EJF C;  4E6I A;  1UE5 A;  1N34 L;  3F1Z A;  4DUY Q;  1EY8 A;  2K14 A;  2F3W A;  1K8M A;  3S15 B;  1Y1W G;  4RCO A;  3I55 A;  2J7Z A;  4A3I B;  1X55 A;  1CK1 A;  2N78 A;  1KDC A;  1PFS A;  1FL0 A;  2E2I B;  4FP5 D;  2R61 A;  1F2Y A;  2EYO A;  1TWA B;  5EKL A;  4R4I A;  3FP9 A;  1HA5 A;  1PTO B;  1HCZ A;  2RCN A;  3TS0 A;  4R1J A;  4RH6 A;  1H9K A;  5KIX A;  1X32 A;  4KKS A;  4JI1 Q;  2JP1 A;  1A6X A;  1CQF A;  5M5X H;  3AEV A;  3MHB A;  3TRE A;  4UDU C;  4OX9 Q;  1EEI D;  1LTI D;  4LFC L;  3E3X A;  5JEA H;  3ULL A;  4QUC A;  4OEM B;  2QGQ A;  1AH9 A;  1XPO A;  4DR2 L;  1K8G A;  1D1K A;  2B2W C;  4K2L A;  4GKJ Q;  3F2B A;  3NQT A;  3ZJY C;  4DV2 L;  2XTI A;  2RSO A;  4UPA A;  3OIP A;  1EOV A;  3K0X A;  1GHJ A;  1B1Z A;  3OWE B;  4MZ9 A;  4DA2 A;  1MGS A;  1Y8N B;  1GJX A;  4IFD H;  1ONL A;  2J0T D;  3D4D A;  2GA4 B;  3QIA A;  5L37 A;  4PG3 A;  2HHH L;  4FYD A;  2K5N A;  5EKK A;  3F2C A;  1JCK B;  2KHS A;  5CV7 A;  3KLW A;  5FJ8 H;  2V4D A;  1D2B A;  3K58 A;  1JWU D;  4KKT A;  2R7Z H;  4NXN Q;  2ZM6 Q;  2XIW A;  4XQQ A;  4A3E G;  4WJW A;  4KI0 A;  1YVC A;  1DM0 B;  3FDT A;  1LAB A;  3T1Y Q;  2F3V A;  4DV7 L;  4A93 H;  4GOP C;  3MWY W;  5FKA C;  3C1E A;  3PSI A;  4TKO B;  4U68 A;  1HNW Q;  4QIW B;  1G2T A;  1B8A A;  2WV6 D;  1CA5 A;  1WD1 A;  1IZ6 A;  4HCE A;  5M9O A;  3PO3 G;  4DV4 Q;  1VQF A;  2NTT A;  1Y1W H;  3GTK H;  4RWS C;  4IUQ A;  1KTK A;  3D6W A;  4DAY A;  3L0O A;  1LTT D;  5LMN L;  4XDX A;  2F0K A;  2PI2 A;  3MXU A;  1Y14 B;  1PH8 A;  5A35 A;  2I5H A;  4C2M H;  4QUF A;  1QE6 A;  3PIP 3;  1YNN D;  3CP0 A;  1IBK Q;  3K5L A;  1D8L A;  5M5X B;  1TQO A;  1B9N A;  3QJY A;  2GN5 A;  1WTH A;  4L5S A;  2LXK A;  5KNB A;  4KJO A;  1TKW B;  4R4T A;  1XTC D;  5C3X A;  5JAV A;  1JE4 A;  3J7A 5;  1OO9 B;  1VQE A;  1Y8P B;  3A8J E;  4XT1 B;  1K0S A;  2Q8I B;  2A69 C;  3L9A X;  4B3T Q;  5C4X G;  1PYW D;  3G6J B;  2AWO A;  2SOB A;  2EYP A;  3KK7 A;  1SNP A;  1I50 H;  1B70 B;  1S3O A;  1TWF H;  3M4O H;  3S1Q H;  3LWE A;  4DUZ Q;  3G7L A;  4RA8 A;  3CCM A;  4JI6 Q;  1G6P A;  2JQO A;  2F0O A;  4JV5 L;  4GS3 A;  1MI2 A;  5M3M G;  2CHB D;  2MO0 A;  1LTG D;  1XNQ L;  4H7B A;  2F0P A;  3HGB A;  4DKA C;  4IPC A;  3FEW X;  3C2P A;  2R7Z B;  2NZO A;  1LTR D;  3PUX A;  2HDM A;  4JBW A;  3HKZ B;  4A3G G;  2BDO A;  1AZP A;  4A93 B;  5BN5 A;  3D4R A;  4DNI A;  1HNZ L;  4HED A;  3OMG A;  4A3E H;  4J6H A;  3IRB A;  4FXG C;  1F2M A;  4RG1 A;  4CDE C;  4JI0 L;  4M1U B;  2CFM A;  1N32 L;  1JOQ A;  1Y1W B;  1X3E A;  1K28 A;  3H3V H;  3GTK B;  3I3C A;  5T1I A;  1V8Q A;  3PO3 H;  2F0Q A;  1Q1B A;  1DOL A;  1SNQ A;  4LFB L;  2UXD L;  1E0B A;  3CC2 A;  4J1M A;  4JOI C;  4C3I G;  2QF7 A;  3SK6 A;  4C2M B;  4HID A;  1DCZ A;  1YIJ A;  4KK7 A;  1A0I A;  4HR7 B;  2EYM A;  1EIY B;  2AMC B;  1PRT C;  2B39 A;  3EQL C;  3QOL A;  4NXM Q;  1II3 A;  4IUV A;  2KCM A;  1YHQ A;  1VQL A;  1LTB D;  4OHJ A;  3X3M A;  4GNX A;  3M3Y H;  5ELB A;  4I7A A;  5C5M A;  3MXN B;  1V1Q A;  1I50 B;  3BZK A;  1CM9 A;  1WCM G;  4OIK A;  3CCV A;  4A3C G;  1TWF B;  5C4X H;  3M4O B;  3S1Q B;  1CZG A;  1Q3L A;  2VQE Q;  3LX0 A;  2N8N A;  1WTR A;  4N9T A;  1KIX A;  3Q6S A;  2QIL A;  1EQR A;  3NEM A;  4KY5 A;  1NR4 A;  2B2Y A;  5C44 G;  4UY8 C;  3CKI B;  1JJG A;  5M3F G;  1QZH A;  1EU4 A;  3H91 A;  4PNY A;  1LYL A;  5M3M H;  3KF6 B;  1KDA A;  4G57 A;  1K3R A;  1SE3 A;  4L8J A;  2ZJR A;  2YYZ A;  1BBW A;  5IGF A;  1SYG A;  5IGB A;  4PV1 C;  3CQZ H;  4IUU A;  2DNE A;  3K6O A;  5DM6 3;  4A3E B;  1XWE A;  4A3F G;  4LF4 Q;  2JA7 G;  4A3G H;  4LF5 L;  1JE5 A;  2RSN A;  1IBM L;  3BDO A;  1XNR L;  4P74 A;  1SMY D;  3MVV A;  3T51 B;  3T1H L;  3PO3 B;  2UUC Q;  4LFA L;  2FXQ A;  1ZKO A;  1WTQ A;  3LGJ A;  1E22 A;  4DR6 L;  4B3R L;  3U50 C;  3SR1 A;  1T5E A;  2D5D A;  2M9V A;  5CV5 A;  2FHT A;  1BBU A;  3ULP A;  5F2D A;  4C3I H;  1KAB A;  2E75 C;  1SYB A;  5IYB G;  2VXW A;  3HOZ G;  1H9S A;  1IBL L;  1EY7 A;  4ZLT F;  1IHZ A;  2KED A;  5E1F A;  4ME3 A;  5LMU L;  3E0E A;  4BBR G;  1VQB A;  1IYU A;  4CDD C;  2XRQ D;  4APV A;  1SYE A;  4DNT B;  3M3Y B;  1B3Q A;  1F9P A;  4R9W A;  3UDX A;  4LF6 Q;  3MFY A;  1BCP F;  2YU9 H;  1YJ9 A;  5LHY 1;  4DPG A;  1N36 L;  4DR1 Q;  1QUQ A;  5C4X B;  1EQT A;  5D3D A;  5T1G A;  4DR5 L;  3STB C;  3SK8 A;  2FMC A;  1WCM H;  2R93 G;  1GVP A;  3NQI A;  4A3C H;  1ILQ A;  3J81 E;  2ENB A;  2Q2H A;  3MA2 B;  4OEL B;  3QB3 A;  1RKN A;  1YHB A;  1TXY A;  1NY4 A;  4HIM A;  1WJJ A;  3C46 A;  1Q8I A;  1JOO A;  4EVO A;  5C44 H;  1ASZ A;  5M3M B;  3VR6 A;  1Q82 C;  5M3F H;  1S40 A;  1CKN A;  1TY0 A;  3UDG A;  3E9H A;  4B3M L;  2UUB L;  3A56 A;  2Z0S A;  3J81 c;  1LTL A;  3CQZ B;  5FLM G;  4LF7 Q;  2UUA Q;  3M4P A;  1NBW A;  1QVF A;  5HGQ A;  4A3G B;  1YBY A;  3LNN A;  2Z4I A;  2IX1 A;  1EYA A;  4K14 A;  2Z6B A;  1NMG A;  4A3F H;  3BS1 A;  4DAP A;  4QMG A;  2JA7 H;  2I07 B;  5KYL A;  1R4Q B;  1PXU A;  2ID0 A;  4P75 A;  1I4Q A;  2F0V A;  1SNM A;  2AQ2 B;  3ITP A;  5E4X A;  3CCJ A;  3KF8 B;  1BO0 A;  3DM3 A;  1BF4 A;  2KUM A;  2K05 A;  3KOJ A;  2JEB I;  5K5P A;  1E2V A;  3Q23 A;  3RUZ A;  4GZY C;  4G7O C;  4CHT B;  2R7F A;  3J7Y W;  4C3I B;  3RNU A;  2F4I A;  3WWV A;  2JA5 H;  2Z6K C;  4A3K G;  3Q8D A;  1MBY A;  1RDP D;  2Q8R E;  2DNC A;  5ELF A;  1B50 A;  4HJ9 A;  1J5E L;  4X65 Q;  1H9J A;  5IYB H;  1N33 Q;  3HOZ H;  3I56 A;  4IOA A;  1A2T A;  4L63 B;  4BBR H;  2YU9 B;  1XMO L;  1IKM A;  4JG2 A;  5TSS A;  3TSS A;  4YCW A;  2L12 A;  1J9O A;  3H94 A;  1JJ2 A;  2F0S A;  4M8A A;  2OTJ A;  5GAE C;  1S4Z A;  4S3S A;  1WCM B;  4ID6 A;  3NBH A;  2NN6 G;  3U9S A;  3T56 B;  1DJR D;  1LV9 A;  2R93 H;  5EGT A;  2RHQ B;  3SK4 A;  4C3J G;  5CR3 A;  3SE0 A;  4CKC A;  4IFD I;  4F88 A;  4C56 C;  5C44 B;  4LW1 A;  2L11 A;  1TR5 A;  4DK1 A;  5M3F B;  3G71 A;  4DAM A;  3KFU A;  3S2D H;  1RL2 A;  3GP7 A;  4KY7 A;  2VB2 X;  3SK5 A;  1H9R A;  1E1O A;  4DF7 A;  3AQQ A;  3FRP B;  1STG A;  1Z47 A;  2O5J C;  2IT1 A;  2NUC A;  2Q8T A;  5GAH C;  1GUW A;  2PZU A;  1A3U A;  3A54 A;  3GO5 A;  5JJZ A;  5FLM H;  1HZA A;  2UXC Q;  2E2D C;  2A8V A;  4A3F B;  3ZYY X;  2JA7 B;  1TWG H;  4IUT A;  4JI2 Q;  1VQO A;  4RGT A;  1E2W A;  3A8K E;  4OGQ C;  4K0K Q;  1C4Q A;  4POF A;  2XVS A;  3SXH A;  2HQL A;  4AQY Q;  1UNS A;  5I9P A;  1SRU A;  2ES2 A;  3DUZ A;  2HIX A;  2XGT A;  5COR A;  1NJI C;  2L4N A;  3U4Z A;  5HGT A;  1C0A A;  1M4V A;  1C9O A;  1JIC A;  4K5W A;  4DR4 Q;  4C1N I;  1SBB B;  1U4L A;  4KMU C;  1YNN C;  2DGY A;  3H6M A;  4A75 A;  4TRD A;  3M85 A;  4YHH Q;  2ZTE A;  4Q5V A;  1N34 Q;  4A3K H;  3HOZ B;  1XJV A;  1GUG A;  3EA6 A;  2UU9 Q;  2IL8 A;  4BBR B;  3VA5 A;  4LUV A;  3J81 i;  1WTO A;  3WDN A;  1OXV A;  3PUW A;  1K73 C;  2AHO B;  4X64 Q;  2LXJ A;  2L15 A;  1O7Y A;  3DEO A;  3E9I A;  5BR8 Q;  4QY7 A;  4QGU A;  1WI5 A;  2O4X A;  2RKS A;  4ME5 A;  3PGZ A;  5CBA E;  1M1K C;  2HQE A;  1L0W A;  2OQK A;  4XXE A;  1O7L A;  3Q22 A;  5KRU A;  2R93 B;  1D6E C;  4F7X A;  5A2Q L;  3J80 L;  1K3B C;  5J39 A;  1L1O B;  4KHP Q;  4J15 A;  2NN6 H;  3RD4 A;  4ZYS A;  1HTP A;  5I4D A;  5COY A;  4YWK A;  3BU2 A;  3NTH A;  4C3J H;  5ELD A;  3CC4 A;  4XIG S;  3S2D B;  4FF1 A;  1ENF A;  1KLU D;  1VMC A;  2A6E D;  3VYS A;  1A2U A;  5KGU A;  4LFC Q;  5FO7 B;  4JI4 L;  1U5K A;  5HUR A;  4IOC A;  2SEB D;  4DR2 Q;  4UP9 A;  2EYJ A;  2F0L A;  5CC4 A;  3RR5 A;  3PUV A;  3TZD A;  5IGC A;  1AP0 A;  2K6A A;  3PIP A;  1TWG B;  1VS0 A;  4CJ2 C;  1XTD A;  1I3Q H;  3TEH B;  3OTO Q;  5AJ3 Q;  1TWC H;  1SFO H;  1CA6 A;  2HHH Q;  3DXJ C;  2PCF B;  2Z6K A;  4H02 A;  2N88 A;  1Z6H A;  2Z4H A;  3H3V I;  1GUN A;  3BDL A;  2YV5 A;  1MKH A;  3K57 A;  4LWC A;  3IFT A;  3TQY A;  3CPW A;  1U0L A;  5ELC A;  1PFN A;  1V1P B;  4LF9 Q;  2EJG C;  4IPD A;  5IT9 E;  2WKC A;  4A3K B;  1F9R A;  1AW7 A;  1TS5 A;  3BDC A;  4DV7 Q;  1MJE A;  5JPN C;  4X3U A;  1SMX A;  3NEN A;  3IL8 A;  3KDF A;  4CKB A;  1A62 A;  3PO2 G;  1JWS D;  3A55 A;  5IOC A;  3CXC A;  5C4Z A;  2E8G A;  3AYH B;  1BCP D;  3P20 A;  4GN5 A;  1Z7T A;  2EYF A;  3C1F A;  2QEX A;  4DV5 L;  3KJP A;  1SE2 A;  3MXP A;  1JOR A;  5IT9 c;  2LFN A;  3R2T A;  5BN3 A;  3CRL C;  4CGY B;  5LMN Q; 
#chains in the Genus database with same CATH homology
 2PQE A;  1TT2 A;  3P75 A;  2EVB A;  2OT2 A;  2L5T A;  4X3K A;  4C3J B;  4KHV A;  5DAU A;  5E3F A;  2KCN A;  1VDZ A;  2QCP X;  1O80 A;  4JK1 C;  2N55 A;  1S5D D;  3T16 A;  2XRS D;  2FFK B;  2L0C A;  2MHV A;  1I3Q B;  3TP7 A;  1TWC B;  1SFO B;  1HQR D;  5KEE A;  1SMY C;  4KJN A;  5DNF A;  4OO1 G;  1QCB D;  5EPJ A;  2B2Y C;  5C0X I;  3X3N A;  1FNV A;  1PLF A;  1EY4 A;  3LWU A;  4KN4 C;  1SXT A;  4DAV A;  1F9S A;  1TII D;  3GD7 A;  1RTN A;  3T13 A;  2D62 A;  1G8Z D;  2F0H A;  4WFN 3;  1G29 1;  3HG9 A;  3TP6 A;  3BYY B;  1JB3 A;  1QNU A;  1PMR A;  2F0T A;  2NWG A;  2FMM A;  3S14 B;  3A7A B;  4KN7 C;  3QOJ A;  1SNO A;  2FJ2 A;  5M5W B;  3PV0 A;  5IGE A;  3MTS A;  1RF2 D;  2M00 A;  3VYU A;  3DWQ A;  5M5Y B;  4R8I A;  1EY0 A;  1KNE A;  5FK9 C;  2ZXR A;  4FF3 A;  1OXT A;  1RHP A;  5FO8 B;  4I7Z C;  2ZXO A;  3S1M B;  3QG1 A;  2RDH A;  1HFG A;  3OW7 A;  5C5L A;  2F0W A;  1ESR A;  1STB A;  1Y69 U;  4HAE A;  1DON A;  4ILW A;  1IYV A;  4OO1 H;  1XXG A;  4G7Z C;  3CRK C;  5CV4 A;  1R4P B;  5DM7 3;  2TSS A;  1D1I A;  4QCL A;  3GTG B;  5I2X A;  2WAC A;  2KVM A;  4XQJ A;  4LJZ C;  4K5V A;  4KY6 A;  3VR2 A;  3V96 A;  5JVG 3;  2NVY B;  4PMW A;  2NB0 A;  4C1N K;  5IIF A;  4KKU A;  2K32 A;  4DXG A;  3VA7 A;  4XYQ A;  1EEF D;  2X69 A;  3NUC A;  4ULL A;  3PO2 B;  4RCN A;  2KQ3 A;  1SYC A;  1HUN A;  4PMB A;  3T4A C;  2EE1 A;  2EPB A;  1HHV A;  4MHE A;  2QEJ C;  4LAA A;  4DGZ A;  4BA1 I;  1AEX A;  4OIJ A;  4KV6 A;  1ZEQ X;  4DXF A;  1PTO D;  1SYD A;  2XWJ B;  3HEJ A;  2MPM A;  2B2U A;  4IUR A;  1DXM A;  1PRT B;  2WII B;  5IOD A;  3TME A;  2RDG A;  2CW0 D;  1SEB D;  2WIN B;  1JQY D;  2EZV A;  2D9U A;  2PZW A;  3OMC A;  3HS0 C;  4Z9C B;  1ROD A;  2NVX B;  3GV3 A;  3D31 A;  3K5O A;  1QWY A;  4K5X A;  1CFM A;  4FNF A;  3VYT A;  3N52 A;  1CQV A;  4ODG A;  3MZ5 A;  3KBG A;  5FLX E;  2K5W A;  2TMP A;  2C9O A;  3H3V C;  1EWH A;  4P2C B;  1HA6 A;  4U67 3;  2K01 A;  3JAM E;  1QNK A;  3TBI B;  2A6H D;  3DMU A;  2F0D A;  2RA4 A;  3GTJ B;  1GUS A;  2QKI C;  3HOX B;  1B2T A;  5NUC A;  4F87 A;  1LO5 D;  3RMH A;  4WOR A;  1AN8 A;  3NE5 B;  4NMZ A;  1R9T B;  2EYL A;  5I6Y A;  3IAY A;  1HQM C;  3GTP B;  3P7J A;  2OXP A;  2B2V C;  1RTO A;  3SHL A;  2JSO A;  1I4X A;  4RGO S;  3I4N B;  2NN6 I;  1HTL D;  5IGD A;  2A6E C;  4UAI A;  1EQV A;  3PUZ A;  4FXD A;  2L1B A;  3MFG A;  4X3S A;  5A2Q E;  5CYU A;  1CHP D;  1LT5 D;  1NCV A;  1S5C D;  1PZI D;  5EBD A;  1C48 A;  5CV9 A;  1U9R A;  2WP8 J;  1IKL A;  4EQO A;  4NKL A;  2IWH A;  4PMC A;  3I4L A;  4HTH A;  2NYZ D;  1QB5 D;  2HCI A;  1STA A;  3NTK A;  1ET9 A;  4HCS A;  2LMC B;  1QIL A;  2NTS A;  1HRJ A;  3FKI B;  3HOW B;  3M4Y A;  2VNU D;  3L7Z C;  2BA1 A;  3GV6 A;  2WAQ B;  2HUG A;  5KYI A;  1BCP C;  1CI3 M;  4MIU A;  2BA0 A;  2B2T A;  1B53 A;  2NVQ B;  1WVL A;  1DZ1 A;  3MXN A;  5K36 G;  2BCO A;  3M7G A;  3VR4 A;  4BA2 I;  3E5S A;  3MXG A;  2SDF A;  5CBE E;  3V2T A;  2JA8 B;  2E2J B;  4LK1 C;  2AUJ D;  4A3M B;  4BY1 B;  3L3O C;  2F0I A;  3HOY B;  4K8I A;  1FYC A;  3Q0A A;  4XT3 B;  1LLR D;  2ZXP A;  1EIG A;  3MC0 B;  2R92 B;  1BBX C;  3AMU A;  1KAA A;  1W6J A;  3D8G A;  4RGM A;  5ISR A;  2K7V A;  2B8G A;  2DY7 A;  5LL6 X;  4KTA A;  3IKJ A;  2DY8 A;  4CJ0 B;  5I6W A;  1TY2 A;  1SNC A;  1I6V C;  4K6L A;  1UAP A;  5EJW A;  1Q12 A;  1BXT A;  4IFD J;  1K83 B;  3S9W A;  3C3L A;  2E2H B;  1STY A;  2IX3 A;  1ENC A;  1EYD A;  1GOZ A;  3U9O A;  1EY6 A;  1A15 A;  1EOT A;  2EY5 A;  3PIO 3;  3N6R A;  1BDO A;  1DOM A;  4HMJ A;  5AFW A;  1BOS A;  1NAP A;  1EIH A;  2NVT B;  1TS3 A;  2EY2 A;  2KEC A;  1CHQ D;  2B2V A;  3NBI A;  2JA5 B;  1Y1V B;  1PDQ A;  2AQ3 B;  2F03 A;  1K8O A;  3IFD A;  2IX0 A;  1HXY D;  1QJO A;  3UI2 A;  3R3O A;  4B08 A;  4K2K A;  5K36 H;  1MD2 D;  2PW5 A;  4Y7N B;  2K5Q A;  2SNS A;  1T5X D;  5I9O A;  2A68 D;  3TP8 A;  1FR3 A;  2R6G A;  5I2Y A;  4ZUJ A;  1D5M C;  3HRZ C;  4RHR A;  1TWH B;  1EFI D;  1FNU A;  3KLS A;  4HMI A;  1NUC A;  1L0Y B;  2E74 C;  3R93 A;  4Q0F A;  1AFP A;  2ICE C;  2NBF A;  1ZYR D;  4ZK9 B;  5C4J B;  2A73 B;  3FVQ A;  3J81 L;  1UUP A;  5G3L F;  4IQZ A;  3WOF A;  5C4H A;  3KF8 A;  2X6G A;  4OO1 I;  1LT6 D;  1CZW A;  4C3H G;  4RHS A;  4NW2 A;  1EZ6 A;  1ILP A;  4HSV A;  1L0X B;  2BE5 D;  2JXM B;  1WTP A;  5CV6 A;  1TS4 A;  1I4G A;  1ICW A;  5CGK A;  1C8C A;  3BG3 A;  3QO2 A;  1O7Z A;  3EFX D;  3EVQ A;  4A3J B;  1PZK D;  2A5H A;  3DWP A;  1FGB D;  2F0F A;  1PTO C;  3NTI A;  1A3T A;  1VF5 C;  1S5E D;  3DHQ A;  3H0G B;  1JC7 A;  3W3A A;  3W2D A;  1DD2 A;  1JOK A;  3ND8 A;  1S5B D;  5ELE A;  2F0U A;  1LT3 D;  2MJ8 A;  2CW0 C;  1U4R A;  1E2Z A;  1BUV T;  4A3B B;  3NK9 A;  2F0N A;  1BR9 A;  2RBM A;  2BOS A;  3OWF A;  4RKB A;  3T53 B;  5E4W C;  4QB4 A;  1GXD C;  2F0G A;  2XSC A;  3ERQ A;  2M2L A;  3FPP A;  2O5I C;  3TN2 A;  1I4R A;  4IN3 A;  2B2U C;  4N9P A;  4V0B A;  3Q24 A;  1CT1 D;  3SVM A;  2QDB A;  4CKE A;  2EY1 A;  2KOL A;  4IUP A;  2A6H C;  1UEA B;  3GTM B;  5CV8 A;  3K7A B;  4BWG B;  1KDB A;  2IJ0 A;  2KCC A;  5C6A A;  1OXS C;  2H4O A;  4DFA A;  4LMQ D;  2EXZ A;  1ET6 A;  4I65 A;  2MUY A;  1JR0 D;  1SND A;  3GTL B;  3K0Y A;  5FOB B;  1JWM D;  2VUM B;  2IPK D;  3DWA A;  1A3V A;  2PNR C;  4ZAI A;  5C0X J;  3E6Z X;  3ERO A;  2F0M A;  1D5X C;  1F2Z A;  2EYH A;  5BN4 A;  4KHZ A;  2RQX A;  3I73 A;  1ENA A;  3I8Z A;  2JE6 I;  2LY7 A;  4XQN A;  3KBX A;  1F9Q A;  1DOK A;  3VR3 A;  2F1M A;  2K5D A;  4XYO A;  1M8A A;  1F77 A;  2PMZ B;  1IL8 A;  2LS0 1;  5EQ0 A;  3BZD B;  5D3I B;  3BYT B;  1OXU A;  3URY A;  1B44 D;  3R2I A;  3PUY A;  4TQU S;  1FNW A;  1X3P A;  4EQN A;  4C3H B;  1IW7 D;  1H9S B;  1RJT A;  4ZKC B;  1PRT F;  1V1P A;  2K04 A;  5EKI A;  4F8M A;  5C3E B;  2R3Z A;  4R8N A;  2C5C A;  3SDZ A;  1DYQ A;  4DN4 M;  1B3A A;  2AQ1 B;  3HOU B;  2B63 B;  3KLR A;  1EU3 A;  1RD9 D;  5KND A;  2WB1 B;  2LKV A;  1QOH A;  2I46 A;  3AB9 A;  3GQB A;  1SJH D;  3PMF A;  4ABN A;  5IT9 L;  5C0X G;  3I70 A;  1PFM A;  2KA7 A;  1YNJ D;  2G9H D;  2B2T C;  2BDN A;  1WD0 A;  3F2U A;  2PO4 A;  4AYB B;  3RZO B;  3P1H A;  4G7H C;  3E0J A;  2CQA A;  1EL0 A;  2B8F A;  4BS9 A;  3D3R A;  1I6H B;  5FO9 B;  3K5M A;  1I4H A;  2IW3 A;  2B2W A;  4YIJ A;  5D14 A;  1MSG A;  4EGV A;  1ESF A;  1PZJ D;  1G6Z A;  2K1B A;  4EQP A;  1HPC A;  5G3L D;  2ICI A;  1O78 A;  2PW7 A;  3HOV B;  3S17 B;  1B9M A;  2RDF A;  4O42 A;  5J22 A;  4RFB A;  4ZRZ A;  3FPU B;  1ML0 D;  1VF7 A;  3V05 A;  1I4P A;  5EBC A;  3BVG A;  2K03 A;  2WKD A;  3K59 A;  2PYK A;  2NZ1 D;  3CHB D;  3BVZ A;  4J8Q A;  1TU2 B;  3BVM A;  3RZD B;  3NWT A;  1VMP A;  3OHX C;  2A68 C;  4FO2 A;  2EOT A;  3J7A V;  3TZU A;  2F0J A;  3H09 A;  1G2S A;  1HUM A;  4G4K A;  5D65 A;  4DK0 A;  1EY9 A;  4H13 C;  2XNA C;  1H9M A;  5C0X H;  3SEB A;  1HFN A;  3J7A F;  1EZ8 A;  1SJE D;  2SNM A;  4HSP A;  1SDF A;  1XYI A;  4DNR B;  4CBV A;  2E76 C;  1ZYR C;  1VCI A;  1GUO A;  3NSW A;  3J80 E;  2H1E A;  3NXW A;  2XN9 C;  4K6D A;  2EY6 A;  2RVL A;  4H0L C;  3TDQ A;  2EDG A;  3D4W A;  1BQQ T;  3ND9 A;  1STE A;  2BE5 C;  4H44 C;  1LTA D;  3OIQ A;  1W6K A;  3D6C A;  2EJM A;  4FF4 A;  3S2H B;  1Q1E A;  4IUN A;  2A69 D;  2K33 A;  1EY5 A;  3S1R B;  3I90 A;  1J8I A;  4QF4 A;  3KUP A;  5LL6 S;  3OOC A;  3MAQ A;  2Y0S B;  5JOB A;  3NWS A;  5IGG A;  2J4X A;  3O13 A;  1LT4 D;  2AUK A;  3DM1 A;  1Y8O B;  4HN7 A;  4B9X A;  1CTM A;  3NHH A;  1BNZ A;  1WTV A;  4FF2 A;  2MP1 A;  2HDL A;  3M7N A;  2MGS A;  1NSN S;  1BCP B;  3TP5 A;  2K28 A;  3R8B A;  1KLG D;  1NR2 A;  5CMD A;  3A7L A;  4B9W A;  1Q90 A;  1U4M A;  1WTW A;  3WOE A;  2Z1C A;  5JEA J;  2XWB B;  1B4O A;  1OXX K;  2VB3 X;  3NPP A;  4KD4 A;  1U4P A;  2CVR A;  3QWN A;  4BBS B;  1F2L A;  5EPK A;  3DEP A;  1PRT D;  2OF1 A;  1GHK A;  2A74 C;  4RAU C;  3OSO A;  2KJX A;  4A3D B;  1ZXT A;  4FVM A;  2PZT A;  1X3Q A;  1EWC A;  1STH A;  1QG7 A;  2ZT9 C;  4IAL A;  3I91 A;  3VR5 A;  3RLF A;  4MN3 A;  3MEH A;  1TVX A;  4ZKB B;  3I4M B;  3S1N B;  3CU7 A;  2PPB C;  4K8J A;  2OEO A;  1SAP A;  5FLX L;  4CJ1 B;  5DEH A;  3HZX A;  4ZQ3 A;  4BY7 B;  4ZUI A;  2D2C C;  3AU7 A;  4X3T A;  3JAM L;  2JYO A;  2G9D A;  2Z8L A;  3GTQ B;  2X6L A;  3FMC A;  3NP8 A;  3K5N A;  3EJI A;  1G91 A;  4IZ8 A;  4OL7 A;  5KNC A;  3VYR A;  1AZQ A;  4DU9 A;  1V1O A;  3GTO B;  2HCC A;  5C3W A;  1SSO A;  1D5Z C;  1IW7 C;  2FIN B;  1PTO H;  3S16 B;  2L9H A;  5JVH 3;  1MSH A;  3HP3 A;  2KEE A;  4FXK C;  1LAC A;  5JEA G;  3KLS X;  4KD3 A;  2AWN A;  1EYC A;  1S5F D;  1TS2 A;  1PTO F;  4RGN A;  1SYF A;  1V43 A;  4RKL A;  4NDX A;  3A8I E;  2DN8 A;  5EPL A;  4XTC S;  2JEA I;  1GUT A;  4V19 0;  4IFD G;  1XX8 A;  2L55 A;  4NP5 A;  5J1Z A;  4TSS A;  1SE4 A;  3OPO A;  4L6T B;  1WTX A;  4WRD A;  1FD7 D;  5JPM C;  3ONA B;  2O2L D;  1PFB A;  4PQX A;  2JA6 B;  1STN A;  1YNJ C;  3I72 A;  2F0E A;  1RCV D;  1KNA A;  1LTS D;  4O1N A;  2EJF C;  4E6I A;  1EY8 A;  2F3W A;  1K8M A;  3S15 B;  4RCO A;  2J7Z A;  4A3I B;  1CK1 A;  1KDC A;  2E2I B;  4FP5 D;  2R61 A;  1F2Y A;  2EYO A;  1TWA B;  5EKL A;  1HA5 A;  1PTO B;  1HCZ A;  4RH6 A;  1H9K A;  5KIX A;  1X32 A;  4KKS A;  2JP1 A;  1A6X A;  1CQF A;  3MHB A;  4UDU C;  1EEI D;  1LTI D;  5JEA H;  4QUC A;  1D1K A;  2B2W C;  4K2L A;  3NQT A;  2RSO A;  3OIP A;  1GHJ A;  1B1Z A;  3OWE B;  4DA2 A;  1MGS A;  1Y8N B;  1GJX A;  4IFD H;  1ONL A;  2J0T D;  3D4D A;  2GA4 B;  3QIA A;  4FYD A;  5EKK A;  1JCK B;  2KHS A;  5CV7 A;  2V4D A;  1D2B A;  3K58 A;  1JWU D;  4KKT A;  2XIW A;  4XQQ A;  4WJW A;  4KI0 A;  1DM0 B;  3FDT A;  1LAB A;  2F3V A;  3MWY W;  5FKA C;  3C1E A;  4TKO B;  4U68 A;  4QIW B;  1G2T A;  2WV6 D;  1CA5 A;  1WD1 A;  4HCE A;  5M9O A;  2NTT A;  4RWS C;  4IUQ A;  1KTK A;  3D6W A;  4DAY A;  1LTT D;  4XDX A;  2F0K A;  3MXU A;  5A35 A;  4QUF A;  1QE6 A;  3PIP 3;  1YNN D;  3K5L A;  5M5X B;  1TQO A;  1B9N A;  3QJY A;  5KNB A;  4KJO A;  1TKW B;  1XTC D;  5C3X A;  5JAV A;  1JE4 A;  1OO9 B;  1Y8P B;  3A8J E;  4XT1 B;  2Q8I B;  2A69 C;  3L9A X;  1PYW D;  3G6J B;  2AWO A;  2SOB A;  2EYP A;  3KK7 A;  1SNP A;  3LWE A;  3G7L A;  4RA8 A;  2F0O A;  1MI2 A;  2CHB D;  1LTG D;  4H7B A;  2F0P A;  3HGB A;  3FEW X;  3C2P A;  2R7Z B;  1LTR D;  3PUX A;  2HDM A;  4JBW A;  3HKZ B;  2BDO A;  1AZP A;  4A93 B;  5BN5 A;  3D4R A;  4HED A;  3OMG A;  4J6H A;  4FXG C;  1F2M A;  4M1U B;  1JOQ A;  1Y1W B;  3GTK B;  3I3C A;  5T1I A;  1V8Q A;  2F0Q A;  1Q1B A;  1DOL A;  1SNQ A;  1E0B A;  4J1M A;  4C3I G;  2QF7 A;  3SK6 A;  4C2M B;  1DCZ A;  4KK7 A;  4HR7 B;  2EYM A;  1PRT C;  2B39 A;  3EQL C;  3QOL A;  1II3 A;  4IUV A;  1LTB D;  4OHJ A;  3X3M A;  5ELB A;  5C5M A;  1I50 B;  1CM9 A;  4OIK A;  1TWF B;  3M4O B;  3S1Q B;  1CZG A;  1Q3L A;  3LX0 A;  1WTR A;  4N9T A;  3Q6S A;  2QIL A;  4KY5 A;  1NR4 A;  2B2Y A;  3CKI B;  1EU4 A;  3H91 A;  4PNY A;  1KDA A;  4G57 A;  1SE3 A;  4L8J A;  2YYZ A;  5IGF A;  1SYG A;  5IGB A;  4PV1 C;  4IUU A;  2DNE A;  3K6O A;  5DM6 3;  4A3E B;  1XWE A;  2RSN A;  3BDO A;  1SMY D;  3MVV A;  3T51 B;  3PO3 B;  1ZKO A;  1WTQ A;  3SR1 A;  1T5E A;  2D5D A;  2M9V A;  5CV5 A;  2FHT A;  5F2D A;  1KAB A;  2E75 C;  1SYB A;  2VXW A;  1H9S A;  1EY7 A;  4ZLT F;  1IHZ A;  2KED A;  5E1F A;  1IYU A;  2XRQ D;  1SYE A;  4DNT B;  3M3Y B;  1F9P A;  4R9W A;  3MFY A;  1BCP F;  5LHY 1;  5C4X B;  1EQT A;  5D3D A;  5T1G A;  3SK8 A;  2FMC A;  3NQI A;  1ILQ A;  3J81 E;  2ENB A;  3MA2 B;  3QB3 A;  1RKN A;  3C46 A;  1Q8I A;  1JOO A;  4EVO A;  5M3M B;  3VR6 A;  1TY0 A;  3A56 A;  3CQZ B;  4A3G B;  3LNN A;  2Z4I A;  2IX1 A;  1EYA A;  4K14 A;  3BS1 A;  4DAP A;  4QMG A;  2I07 B;  5KYL A;  1R4Q B;  1PXU A;  2ID0 A;  1I4Q A;  2F0V A;  1SNM A;  2AQ2 B;  3ITP A;  5E4X A;  1BO0 A;  1BF4 A;  2KUM A;  2K05 A;  2JEB I;  5K5P A;  1E2V A;  3Q23 A;  3RUZ A;  4GZY C;  4G7O C;  4CHT B;  3J7Y W;  4C3I B;  2F4I A;  1MBY A;  1RDP D;  2Q8R E;  2DNC A;  5ELF A;  1B50 A;  1H9J A;  1A2T A;  4L63 B;  2YU9 B;  1IKM A;  5TSS A;  3TSS A;  2L12 A;  1J9O A;  3H94 A;  2F0S A;  4M8A A;  1S4Z A;  4S3S A;  1WCM B;  4ID6 A;  3NBH A;  2NN6 G;  3U9S A;  3T56 B;  1DJR D;  1LV9 A;  5EGT A;  3SK4 A;  4C3J G;  5CR3 A;  3SE0 A;  4CKC A;  4IFD I;  4F88 A;  4C56 C;  5C44 B;  2L11 A;  1TR5 A;  4DK1 A;  5M3F B;  3GP7 A;  4KY7 A;  2VB2 X;  3SK5 A;  1H9R A;  4DF7 A;  3FRP B;  1STG A;  1Z47 A;  2O5J C;  2IT1 A;  2NUC A;  2Q8T A;  1GUW A;  2PZU A;  1A3U A;  3A54 A;  3GO5 A;  5JJZ A;  2E2D C;  4A3F B;  3ZYY X;  2JA7 B;  4IUT A;  4RGT A;  1E2W A;  3A8K E;  4OGQ C;  1C4Q A;  2XVS A;  3SXH A;  1UNS A;  5I9P A;  3DUZ A;  5COR A;  2L4N A;  5HGT A;  1M4V A;  1JIC A;  4K5W A;  4C1N I;  1SBB B;  1U4L A;  4KMU C;  1YNN C;  3H6M A;  4TRD A;  3M85 A;  4Q5V A;  3HOZ B;  1GUG A;  3EA6 A;  2IL8 A;  4BBR B;  3VA5 A;  1WTO A;  3WDN A;  1OXV A;  3PUW A;  1O7Y A;  3DEO A;  2RKS A;  2O4X A;  4ME5 A;  5CBA E;  2HQE A;  4XXE A;  1O7L A;  3Q22 A;  5KRU A;  2R93 B;  1D6E C;  4F7X A;  5A2Q L;  3J80 L;  5J39 A;  2NN6 H;  3RD4 A;  4ZYS A;  1HTP A;  5I4D A;  5COY A;  3NTH A;  5ELD A;  4XIG S;  3S2D B;  4FF1 A;  1ENF A;  1KLU D;  1VMC A;  2A6E D;  3VYS A;  1A2U A;  5KGU A;  5FO7 B;  5HUR A;  2SEB D;  2EYJ A;  2F0L A;  5CC4 A;  3PUV A;  3TZD A;  5IGC A;  1AP0 A;  2K6A A;  1TWG B;  4CJ2 C;  1CA6 A;  3DXJ C;  2PCF B;  2N88 A;  1Z6H A;  2Z4H A;  1GUN A;  3BDL A;  3K57 A;  3IFT A;  5ELC A;  1PFN A;  1V1P B;  2EJG C;  5IT9 E;  2WKC A;  4A3K B;  1F9R A;  1AW7 A;  1TS5 A;  3BDC A;  5JPN C;  4X3U A;  3IL8 A;  4CKB A;  1JWS D;  3A55 A;  5IOC A;  5C4Z A;  1BCP D;  3P20 A;  1Z7T A;  2EYF A;  3C1F A;  1SE2 A;  3MXP A;  1JOR A;  2LFN A;  3R2T A;  5BN3 A;  3CRL C;  4CGY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...