3H91A

Crystal structure of the complex of human chromobox homolog 2 (cbx2) and h3k27 peptide
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
52
structure length
52
Chain Sequence
EQVFAAECILSKRLRKGKLEYLVKWRGWSSKHNSWEPEENILDPRLLLAFQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromobox protein homolog 2
publication title Recognition and specificity determinants of the human cbx chromodomains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 9
structure length 52
sequence length 52
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3h91A00
1RTOA 1CA6A 5EQ0A 4CJ0B 2DY7A 5DNFA 1B50A 1RHPA 1WTPA 2Q8TA 1WTXA 1LV9A 1EOTA 5CORA 2X6LA 2BDNA 1KNAA 2B2WA 1ESRA 1PFBA 2X6GA 1NR2A 2D9UA 2IL8A 2EOTA 4X3KA 2KECA 1U4LA 1GUWA 1M8AA 1WVLA 1F9PA 1ILQA 1NCVA 1O7ZA 2B2VC 2J7ZA 2JYOA 2FHTA 4X3UA 3IL8A 2KEEA 4ZKCB 3I8ZA 2JP1A 4XDXA 2NZ1D 4ZAIA 3H91A 2DY8A 2L11A 1WTWA 2MJ8A 4HSVA 4IUQA 1AZPA 1ML0D 4X3TA 2KEDA 1DZ1A 4RWSC 4ZKBB 1NR4A 3FPUB 3UI2A 5CBEE 1G2TA 3DEPA 1WTVA 1HHVA 1SAPA 1XX8A 2B2VA 1IKMA 1E0BA 3LWEA 2MPMA 1JE4A 2N55A 1IL8A 2NWGA 4UAIA 1WD0A 1BBXC 3GV6A 2L12A 1PFMA 2N88A 2FINB 1MSHA 2SDFA 2EPBA 3ONAB 4MN3A 2K1BA 5CMDA 2K05A 1O80A 2NYZD 3MTSA 1WD1A 1BO0A 1EQTA 3QO2A 3IFDA 4IURA 2Q8RE 4MHEA 1CA5A 5AFWA 1SSOA 1J9OA 1RTNA 2B2YA 3R93A 2EE1A 1AZQA 5EPJA 4HCSA 5CBAE 5D14A 1BNZA 4RA8A 4OIJA 1F9QA 1VMCA 4IUTA 4R9WA 1J8IA 4IUUA 1HA6A 1HFNA 2K28A 2K04A 1PFNA 1SDFA 1QE6A 1B4OA 3DM1A 3G7LA 2HDMA 1S4ZA 5T1IA 1O7YA 4HEDA 1WTQA 3SVMA 4CJ1B 3F2UA 4NW2A 3FDTA 2X69A 4O42A 1VMPA 2MGSA 1KNEA 2B2TC 2RVLA 3HP3A 3DEOA 5T1GA 1U4RA 2HDLA 1NAPA 1WTOA 1DOMA 1HUNA 1C8CA 3KUPA 4IUVA 1G2SA 1DOLA 2KVMA 1RJTA 1EIGA 1TVXA 3I3CA 5EPLA 1X3PA 2B2WC 2HCCA 3MWYW 1HUMA 3P7JA 1WTRA 2HCIA 2XIWA 4ZLTF 1MSGA 1EIHA 1IKLA 1HFGA 2CVRA 2RA4A 2VXWA 5EPKA 1QG7A 5EKIA 5JJZA 2L4NA 5E4XA 1AP0A 2B2TA 1CM9A 1MGSA 3TZDA 4RAUC 2RSNA 1HRJA 1QNKA 1B3AA 3KBXA 1RODA 4HAEA 1ILPA 4QUCA 1DOKA 3D6WA 5EJWA 4R8IA 2L9HA 2MP1A 2L1BA 5D65A 1DONA 2B2UC 2M2LA 2FMMA 5COYA 1Q3LA 1BF4A 4X3SA 3Q6SA 2KOLA 4XT1B 5E4WC 1PDQA 4DN4M 2HUGA 2FFKB 1A15A 4IUPA 3I90A 2KUMA 1ZXTA 1MI2A 1EL0A 2H1EA 1JICA 2RSOA 4LMQD 4U68A 4OIKA 4QUFA 4ZK9B 1U4PA 1X32A 1G91A 3TN2A 2FJ2A 4CJ2C 1B2TA 3I91A 1XYIA 1PLFA 1F9SA 3GV3A 1ICWA 3N52A 1G6ZA 2B2UA 1F9RA 2K03A 1B53A 1U4MA 1X3QA 2K01A 2R3ZA 1F2LA 4XT3B 2B2YC
chains in the Genus database with same CATH superfamily
4LF4Q 2E2HH 3K8AA 4CJ0B 5M5XH 2VNUD 3T56B 3MZ5A 1Q1BA 1L1OB 2EYOA 4U673 1QB5D 4Q0FA 4GN4B 2EOTA 5C44B 3MXNA 1M8AA 3ND8A 2B2VC 1GM5A 4HMIA 4DAMA 5CC4A 1NTGA 1EFID 3I56A 1B7YB 2UUCL 1EEID 1F2MA 3HOYH 1SNMA 3A8JE 3KDFB 5IGEA 1SEBD 1NR4A 3HS0C 4LUZA 4MTNA 1EZ8A 4DAYA 1Z47A 1S5DD 2PMZE 5CR3A 1FYCA 3SDZA 4HTHA 2EY2A 1N9WA 4A3MB 2K05A 3CPWA 1TS4A 2Z4HA 2IY5B 2QKIC 2BH2A 2XWJB 5C3EG 4JG2A 5CBAE 1A63A 3L2PA 1B4OA 1QE6A 1SMYC 3DM1A 3NXWA 3TSSA 3HOUB 4CJ1B 4BBRH 4A3BH 1UE7A 1Q82C 3FDTA 4A3EG 3KJOA 1I94L 2R6GA 1NUCA 1PH7A 2XVSA 5T1GA 1SNPA 4IUVA 4H44C 3KLWA 4KJOA 1BCPF 2R7DA 4DAYB 3MWYW 4R4CA 4JPBW 1STYA 3C1EA 3W1BA 1STBA 1LLRD 4C3IH 2B2TA 4WORA 3M4PA 3HOXH 1X3FA 4X66L 1X3GA 3HGBA 3M4OH 1F2ZA 4LF4L 1DOKA 4OO1H 3HZXA 4K5VA 2MP1A 1KIXA 3S1MH 4LF8Q 2F0FA 1HJPA 1II3A 3FHWA 4BY1G 1X32A 2ZXPA 3TN2A 2Y0SG 1PLFA 5IT9L 3PUYA 4KD3A 2B2UA 2K03A 2XRSD 1B53A 3M9BA 2K6AA 3OSOA 3TDQA 1UNSA 4R4OA 1KDCA 4KKTA 1VQDA 2Q8TA 5EKKA 1EOTA 3BJUA 4C2MB 2ES2A 1TS3A 1NSNS 1EEFD 5DM73 3T4AC 1PTOH 2L5TA 2C5CA 2E76C 2JYOA 2FHTA 3HG9A 3I4NG 2KEEA 2NTTA 4BBSH 4G7OC 1G6PA 4NPSA 2R92G 3J7AV 3H91A 3CC7A 2L11A 3VR2A 2VZAA 1KRSA 5CV6A 2NVYB 3KF8B 3TMEA 3S17B 3CC4A 1HHVA 3FKIH 1GO3E 3LNNA 3MAQA 3CCEA 1YI2A 2WFWA 3FVQA 3K5MA 2F4VL 2KCMA 2BE5D 2MPMA 1UE6A 5FO7B 2A19A 4K8IA 3VR6A 4JW0A 2EPBA 3ONAB 4OL7A 2RF4A 2K1BA 2O2LD 5FKAC 3URYA 5HGQA 3MTSA 4YCUA 4HN7A 5I4DA 2O5IC 1I4HA 4AH6A 4DUYL 1XMOQ 2E2IB 2KHSA 3SGIA 2M9VA 3KLRA 2H5XA 1HFNA 3NSWA 1Y1VB 3S9WA 4PZ6A 2JJQA 1XNQQ 4O1NA 1QCBD 5GROA 3HOWB 3CQZH 1NMFA 4DFAA 4LF8L 2AWOA 1C8CA 4Y52H 1GOZA 1EIGA 4DR6Q 1TWAB 3E0EA 2NTSA 4GKJQ 1HQRD 3N6RA 4DR1Q 3UDIA 2K5DA 4OONA 2F0KA 2UUAQ 1SMYD 4XQNA 1YHBA 1F2YA 2E8GA 3NQTA 3OIPA 1VQJA 4DV5Q 1Q3LA 3EN2A 3NWTA 5M5WB 1A3TA 3L3OC 2XGTA 2F0DA 3BDCA 2RSOA 3J7AF 4QL5A 3I4LA 2HT1A 5IYDG 2K5HA 5KYIA 4HJ8A 3NPPA 4POFA 3PCOB 2EYJA 1LO5D 2PW7A 3K5NA 2K01A 1H9SB 3PF5A 4X6AH 2B2YC 1Y8OB 1DCZA 1BQQT 2PQAA 1QILA 1RHPA 4BXXG 1LV9A 3CKIB 2R7FA 1Y1WG 3I70A 4POGA 3W5OA 1A3UA 2KECA 5FJ8G 2QILA 1CT1D 3NE5B 2EIFA 4R1JA 1FNVA 2OXPA 1R9TH 2K50A 4RKLA 1C48A 2EVBA 4JI3Q 2NZOA 3NBHA 1EFWA 3ER0A 2KQ3A 1P8LA 3T1YQ 1XMOL 2RHQB 3BVMA 4B9XA 1XPOA 4LFBQ 1FR3A 3CRKC 5GQOA 1STHA 4GS3A 4JI2L 1XNQL 4HJ9A 2E5LQ 2MQHA 3BYTB 4A3EH 2N49A 2PI2A 2AQ2B 2CFMA 4CKEA 3KJPA 2YU9B 1MSHA 4CGYB 1WOCA 4MN3A 3CCMA 3BZCA 3U9OA 2PQAB 2F0GA 3X3NA 2EE1A 4LF7Q 4DR6L 1VQPA 3G71A 3I55A 4DR1L 4JI8Q 1SFOB 1L0XB 3CW2C 1H9KA 3RR5A 4DK1A 5IY0A 2UUAL 3K7AB 3NBHB 5EGTA 3D4DA 3TZUA 5BN4A 3K81C 1N33Q 4DV5L 1Q46A 2OCEA 1N8RC 1YBYA 3A7AB 3RUZA 4BY1H 4KMUC 3VDYA 3I3CA 1TKWB 5IYBG 1H9RA 3S2DB 3GTJB 4FXDA 1OXVA 1IKLA 4KD4A 2RA4A 1F77A 3PUWA 5EKIA 5GAHC 1TXYA 5IODA 4RKBA 3QOLA 2NZHA 4RAUC 3QIAA 1KAAA 2Q2IA 5J39A 4OWXB 4RCNA 2NB0A 3GTLH 1HA5A 3O13A 4X3SA 2AWNA 2PI2E 1STEA 4DR3Q 1A15A 1K73C 5M3MB 3I4MB 3DWQA 1HR0W 3I4NH 2VUMB 4UP7A 4ZK9B 2ZJQA 2NVXB 2WACA 5DLQE 4JI3L 3TP8A 2LFNA 4O2DA 2BDOA 2GVBA 4XIGS 3T1YL 5C4XB 5FLXL 4BWGB 3OWEB 1EYDA 3S1QH 4L5TA 4LFBL 5TSSA 5BN3A 4GLVB 5EBCA 2DY7A 3LX0A 2E5LL 4PMWA 1HQMC 2L0CA 5C4HA 4P74A 1KNAA 1EY7A 2X6GA 1OO9B 1VQGA 4C3JB 1C9OA 1JC7A 3PF4A 1NCVA 1O7ZA 1J5EQ 4V190 1JOKA 3IL8A 1FJGQ 1LABA 5M5YH 3I8ZA 5IGGA 3OTOQ 3Q23A 3S1RB 1EU3A 2F3IA 2OT2A 4HIKA 3JAML 5C0XG 5C0XI 2ZM6Q 1GUSA 1TWFB 2CH4A 5C4ZA 4X65Q 3M3YB 4A93G 1RKNA 1L1OC 4JI8L 3A0JA 5HY6A 2PZWA 1VQBA 4OGQC 4AIMA 2E75C 1V1OA 1S5ED 2MO1A 3SE0A 4OHJA 4AYBB 1XMQL 1QVCA 5IP7G 2QF7A 1D5MC 3HKZB 3J81i 3K0YA 2SOBA 3BZKA 5JPNC 3GQBA 1S40A 4AYBE 3W3AA 3EQLC 3J80i 2JA7B 3HKZE 3SVMA 2R7ZG 3S2DH 3GTJH 3NUCA 4TQUS 4NB3A 2EJMA 1MIUA 2EJFC 4L5RC 4RCOA 1PH5A 3GTMH 1STAA 3SXHA 2HDLA 3HOVB 3QOJA 4KN7C 4C1NK 1LTBD 2F0IA 4DR3L 5GAGC 3NTIA 2JEAI 1WTRA 4DV4Q 4GKKQ 5IYDH 2EJGC 2EXZA 1I50B 3WOFA 4EQNA 3J7ZC 4N9TA 1PH8A 5E4XA 2KCCA 3HOZG 4YWLA 3MHBA 3I4MH 3TZDA 3HFZB 4QUCA 4A3LG 4A3FB 1JOOA 4BXXH 2CKZB 2D5DA 1Y1WH 5LL6S 4CBVA 5C4XH 1GUTA 3GTKB 5FJ8H 3SK4A 3U58A 2XWBB 5ELCA 1J5EL 1FJGL 3OTOL 1OXSC 2B63G 1ENCA 3UE1A 4MTKA 4KY6A 4C3JH 4YHHQ 1IL2A 1F9SA 2Z1CA 2ZM6L 1GHKA 3BDLA 4X65L 4LNQA 2ICEC 1I5FA 4MNOA 2CWAA 3S1RH 5KIXA 4JI1Q 1TWFH 4R4TA 3M3YH 1X6OA 4FF1A 4N8X1 1TQOA 1L0WA 3C3LA 5I2YA 1A2UA 1XTDA 4GN5A 2A1AA 1Q90A 1VQMA 1XJVA 2NZ1D 2I07B 4BA2I 1AZPA 4HSVA 4Y7NH 3W2DA 1VS0A 1EIYB 1G2TA 1K83B 1SYBA 3FP9A 3HOXG 3STBC 1IKMA 2HIXA 1E0BA 5LL6X 2NWGA 1SMXA 4H13C 2L12A 2F0WA 2JK8A 1X9NA 1H9MA 1PZID 3CMAA 2K14A 1IYVA 5IYBH 1SSOA 5IWAQ 4A3DB 3R93A 4DV4L 1GVPA 4GKKL 3M7GA 1I3QH 4LUOA 1JT8A 1VQ6A 2ATWA 5C44G 1PRTD 3V05A 2K28A 2EYHA 5JJLA 4XTCS 1I4GA 5D3DA 3F2UA 1PVOA 4RMFA 1OXUA 5C3XA 1VQ4A 3ND9A 4DF7A 3F1ZA 3OIQA 1X56A 1G2SA 2C9OA 2IPKD 3PIOA 1YJNA 2ZTEA 4IUNA 3L9AX 1HTPA 3SK6A 3TP5A 3P7JA 4APVA 3J81E 1QUQA 5K5PA 1KTKA 3K59A 3CCLA 3GTKH 4JOIA 4YHHL 3P1HA 2UXBQ 3PO3B 1GKHA 4HIDA 1PYBA 2PYKA 4A3MG 2E2JH 3J80E 2O5JC 3E3XA 5CV8A 1YIJA 4OWWB 3OW2A 1BVSA 2SNMA 3Q22A 4KKUA 5C0XJ 1WJJA 4DN4M 4I65A 4IUPA 1SNDA 4KHPL 2H1EA 3HOUG 4DK0A 2AKWB 1KD1C 5C0XH 2N78A 1VQLA 1UWVA 1WI5A 2HQEA 5LMNL 4A93H 2HQLA 3J81c 2IHFA 3S16H 1XWEA 1CFMA 5M9OA 1ASYA 5CV9A 1WTPA 1VQAA 1OXXK 2Z8LA 2X6LA 1QUQB 4H02A 1B44D 3J80c 2YV5A 3F2CA 5F2DA 1JJCB 3RN5A 1DD2A 4NXMQ 4OXPA 3I73A 2RDGA 2LSSA 2LKVA 3BZDB 2A68D 2KENA 2ZJPA 4DV6Q 1WTWA 1ML0D 4GNXA 3BG3A 5E1FA 1SNCA 5IYCG 1KXLA 5FOBB 1YHAA 1LT3D 4FYDA 1XX8A 1PRTB 1P16A 3CU7A 2R7ZH 2BE5C 4R4QA 1JE4A 5JOBA 3I7FA 3OPOA 1T9HA 2L15A 2EYFA 1PTOF 2CH4W 1PA6A 2JA6B 1GUGA 2F03A 2DNCA 1O80A 1SXTA 3FEWX 3SR1A 4GOPA 1LT6D 1LYLA 3S2HB 2PMZB 1AZQA 1R4PB 3U4VA 3HOZH 2PQEA 4RGOS 1E1TA 4JI6Q 2UXBL 1AEXA 2E74C 4S3SA 1BOSA 4B3MQ 4A3LH 1EYAA 3STBD 1KNEA 3PO2B 4QGUA 3PUXA 1DOMA 1CZWA 2PW5A 4H7BA 1G8ZD 1VF5C 1TVXA 5EPLA 5JVG3 1HZCA 1V8QA 4QMGA 4GZYC 2B63H 3RZDB 4EVOA 1STNA 4C56C 1MSGA 2VXWA 5EKLA 3HEJA 4OELB 3K5OA 1HNXQ 1AP0A 3MVVA 1Q86C 4O0AA 1XXGA 4MIUA 4FDBA 3MXNB 1JB3A 3KBXA 2OF1A 4A3GB 1RDPD 3ERSX 2F4VQ 4J6HA 4A4IA 2L9HA 4PZ7A 4V0BA 4XXEA 5COYA 3PSIA 4JBKA 1YJWA 1Y1VG 2KUMA 3M4QA 1XTCD 4NXML 1G91A 2A73B 3EVQA 1UEAB 4DUYQ 3HOWG 1L0YB 5A35A 1DGSA 2O4XA 4DV6L 5FLMG 1JOQA 3CF5A 2JXMB 3NHHA 2RDHA 4CHTB 2IJ0A 3RLNA 2UXCQ 1FVIA 5C6AA 2B2WA 4YY3Q 4M8AA 2JA5B 1C4QA 2IX1A 3RLOA 2A6ED 4IFDI 2I5HA 1FL0A 4FNFA 2P5ZX 4YCWA 4XDXA 3PUZA 3LGJA 2DGYA 3NP8A 2MJ8A 4ODGA 1HH2P 2VQFQ 5C44H 2JA6H 5ELEA 3PIP3 4JI6L 3OMCA 2EY5A 1BCPB 1V1PA 4B3ML 3S2HH 3MXGA 3U9SA 2K7VA 4XQJA 3CCUA 1TS5A 2V4DA 4QB4A 4HMJA 4FXGC 4Z9CB 3MC0B 3TP7A 3Q24A 4L8JA 4IZ8A 3BYYB 1JWSD 4X62L 1A62A 1VMCA 1I6HB 1HNXL 1U0LA 4N9PA 4A3MH 3AB9A 1VQ8A 3H0GB 4A76A 1WCMB 4ZYSA 1SYFA 4DU9A 1CHPD 2A8VA 1VQIA 1EQVA 4XQQA 4A3GH 1RJTA 3HOUH 4KHVA 1Y8NB 2NVQB 1GJXA 2K5NA 5CV5A 2RBMA 4ILWA 2L4NA 3IFTA 1JR0D 2DN8A 3I72A 1HRJA 1KL9A 2QCPX 4JI2Q 4K6DA 2JEBI 1XNRQ 5C3EB 4CDDC 2BH8A 4PNYA 1TIID 3I2ZA 4YCVA 4A3CG 2UXCL 2GN5A 4YY3L 1RL2A 4WRDA 1PYWD 1ZXTA 1Z9FA 1OXTA 1U4PA 4YWKA 3VYRA 5BN5A 3PIO3 3ZYYX 1D6EC 5A2QL 4IPCA 1MD2D 2B8GA 2WB1B 4EGVA 2OQKA 2VQFL 1Y69U 5IYCH 1YNND 3GTQB 2L55A 1WTXA 4NXNQ 1E7ZA 1GUOA 2WB1E 1XPUA 5E7NA 4X64Q 2D0OA 1GUWA 4EQOA 4JK1C 1KQSA 4ZKCB 4KN4C 1VQOA 3L7ZC 1CQVA 2XSCA 4HR7B 4M1UB 1SBBB 2PO4A 4AQYQ 4C2MH 4IUQA 1DZ1A 1CKOA 2RCFA 4DR2L 4B3SQ 5CBEE 5M3MG 3I4MG 3WDNA 2VUMG 2QA4A 2B2VA 1RCVD 4UPAA 4BA1I 2F3WA 2EYLA 3ITPA 2N55A 3GTOB 4ID6A 3OW7A 5DM63 3GV6A 5CV4A 2AUKA 1VQ5A 5C4XG 2NVYH 3S17H 2NUCA 2ASBA 4C3HB 3RMHA 3H0GH 1CA5A 1WCMH 1X55A 5AFWA 1RTNA 1E22A 3AU7A 3DXJC 1O7IA 1K8AC 1UE1A 1NMGA 1PZJD 4C3JG 2XNAC 2R92B 4JV5Q 3E9HA 3CPFA 4OEMB 1VQ7A 2KJXA 3P20A 1XNRL 2E2IH 1VMPA 4RFBA 2M00A 3C1FA 1Y1VH 2HIVA 1KHIA 2KVMA 1CKMA 3KOJA 4EQ5A 2F0MA 1ENAA 1KC8C 2GVAA 1FGBD 3HOWH 1HCZA 2PNRC 4DK3C 3BVZA 5GADC 3MXPA 2KBNA 5FLMH 2ZXOA 1SN8A 4AYBG 1MGSA 3QJYA 2RQXA 2ZTDA 3H6MA 3NWSA 1RODA 3HKZG 4PZ8A 5J22A 5LMUQ 2K5VA 1TWAH 3EFXD 1EWCA 4NXNL 4HJ5A 2EY1A 1BF4A 1EY8A 3Q6SA 1XMQQ 1L2FA 1N34Q 4IFDH 4X64L 3VYUA 3F2DA 3DM3A 1A3VA 2JA7G 1EY6A 4ULLA 1KRTA 5JJIA 1BBWA 1IW7D 3A5UA 1Q81C 3Q0AA 4AQYL 3HOVG 5M5WH 2Z6KC 1SE8A 4P2CB 4DAVA 2XRQD 4B3SL 2WP8J 5DNFA 1YITA 4FF2A 4LAAA 1DJRD 2N3SA 1Z6HA 5C4JB 1ESRA 5KNDA 3DWPA 4DNIA 2EZVA 1M1KC 1NE3A 3NBIA 2WAQB 3K80C 1ILQA 2WINB 1CSPA 1W3SA 1CK1A 3SK5A 2KCTA 3HKSA 4I7AA 4LJZC 5ELNA 2AMCB 4A3FG 1SNQA 2NBFA 5IGDA 2CCZA 4X3TA 3GD7A 1QVFA 2WAQE 5IT9c 4PMCA 4NP5A 1KDAA 1QVGA 3H3VC 1Q7YC 1WTVA 2WV6D 5FK9C 1SAPA 1FD7D 1SRUA 1TY2A 2PCFB 4JV5L 3LWEA 1VQ9A 1BBXC 4A3JB 3BS1A 4B08A 4QF4A 1YNXA 1IBLL 1EY5A 1E24A 3IFDA 3Q8DA 3NQIA 1J9OA 4P75A 1H95A 3IAYA 5EPJA 2G9DA 1RF2D 3J81L 1LTLA 1PRTC 1BDOA 4OIJA 3T13A 1B70B 1PXUA 1TWGB 2YU9H 1HA6A 1PFNA 4JI7Q 1CSQA 1CHQD 4P73A 1KLUD 5I9PA 3K6OA 4BY7B 3AFPA 3J80L 1ICFB 4O42A 5LMUL 4A3CH 3KLSX 1Z7TA 1IZ6A 1SFOH 1N34L 1JWMD 2F0NA 3F8TA 1BR9A 5FO9B 1AH9A 5IE8A 4IQZA 2HCIA 3K7AH 3GTGB 1TR5A 2K5WA 1BBUA 1QG7A 4JCVE 4DAPA 1VQKA 5AJ3Q 1EU4A 4LWCA 5IGBA 1ZYRC 1LTSD 4HAEA 1LUZA 3GTPB 3DHQA 4A3DG 5D65A 2FMMA 4DV7Q 4PMBA 4PV1C 3WWVA 4WJ4A 4DPGA 4KHZA 1EY9A 4F88A 4LFAQ 3S14B 2D62A 1AW7A 2EYMA 4ALPA 2OEOA 1F9RA 1D5ZC 1X3QA 5M3MH 2VUMH 3B6YA 4IPHA 2YTYA 4CDFC 2VQEQ 1JB7A 2F0EA 2JA8B 2NVXH 1B50A 1DYQA 4P71A 3F2BA 2CWPA 4NKLA 2VS1A 1UEBA 1WVLA 3PO3G 2R93B 1F9PA 3ULLA 2CQOA 4IJLA 2UU9Q 2A68C 1XPRA 4ZAIA 4GLXA 2ENBA 4KY5A 1I6VC 3NEMA 3H09A 3QB3A 5M3FB 2WIIB 4JI7L 1C7YA 1IYJB 3JC66 2V1CC 4LF9Q 4UAIA 3H94A 1W2BA 4KV6A 4QJFA 2SDFA 2QEXA 2KHIA 2F0TA 2XTIA 3ICEA 2PNHA 1IBMQ 3QO2A 4PQXA 5ELDA 2JSOA 1K28A 2OTJA 1ZKOA 2IX0A 1WTHA 5GAEC 3H3VI 1MBYA 5D14A 1BNZA 5LMNQ 4UP8A 1D1KA 4R9WA 5HGTA 1EYCA 1SDFA 3FPPA 5AJ3L 4FF4A 2SNSA 3G7LA 1HR0Q 1B8AA 2Z6BA 4WJWA 4A3IB 4RHSA 2MFIA 3GTGH 1SJHD 1QWYA 1NNXA 2AUJD 3VR3A 1ZEQX 2B2TC 1SR3A 1S3OA 1NAPA 4DV7L 3UDFA 1GUNA 1LT5D 3KUPA 1YEZA 2JA7H 5K36G 3ZJYC 3GP7A 4DK6C 1UAPA 2J4XA 3BDOA 4RG1A 3TS2A 2RCNA 2B2WC 1SJED 1I4XA 3GO5A 4LFAL 1FNUA 5JJZA 2IW3A 3CCVA 4LFCQ 5EPKA 3DUZA 3HOVH 3K7UC 3S15B 3IKJA 5CGKA 2JA6G 1NJIC 3SHLA 1HNZQ 2B39A 1MJCA 4L6TB 1PH1A 1SE4A 2VQEL 2VY3A 4CKCA 2VL6A 2B2UC 1I50H 1MJEA 4P72A 1YJ9A 1GD7A 2KOLA 5JVH3 4TRDA 2HUGA 3HRZC 3VR4A 3E6ZX 2E2HB 4U68A 2JA8H 2EYPA 5M5XB 4OIKA 2JQOA 1TU2B 4A3FH 3OHXC 5FLXE 5JPMC 2UU9L 3M85A 3PO2G 3U50C 5C3WA 4HCEA 4TSSA 1PMRA 1F2LA 4N8FA 3P75A 4FF3A 1LM0A 2KCNA 4XYQA 1ZYRD 1GXDC 4FP5D 4ME3A 3T1HQ 3HOYB 3KF6A 1V43A 4LF9L 3CRLC 2A6EC 5M3FH 4UDUC 4IN3A 1E2VA 4A3GG 4R8NA 1B1ZA 2MO0A 3EJIA 1IBML 1RIPA 5J3BA 3UE0A 4QY7A 2F0JA 4JI5L 3PGZA 5JJKA 3FPUB 5FLXc 1ASZA 3DEPA 2UUBQ 2AHOB 4KLKA 3AMUA 1HR0L 4IOCA 2EDGA 2F3VA 3A56A 3UDXA 3U4ZA 1PFMA 4DXGA 3D8GA 1PRTF 1K83H 3FMCA 1BO0A 1EQTA 4A3KB 1L1OA 1M90C 4MHEA 4BBRB 4A3BB 3A8IE 5EBDA 3A55A 1E2WA 3JAMc 4LFCL 4RA8A 1EWHA 1I4QA 1NY4A 4NMZA 2JA5G 1K8MA 4KKSA 5KEEA 2HDMA 1HNZL 4A3DH 3KDFA 4UHVA 1WFQA 1KAWA 4FVMA 4C3IB 4RGMA 5BR8Q 3S15H 2TSSA 2A6HD 1DOLA 2F52A 1ENFA 4DV2Q 2B3GA 3A7LA 3MEFA 1DXMA 2OQ0A 4B3TQ 2K52A 1HFGA 1VQCA 1N36L 3KFUA 2HD3A 3S1MB 5FO8B 2G5DA 5JEAH 3OOCA 3ERQA 3TP6A 3CHBD 1BCPD 2RSNA 4XYOA 4QIWE 5ELFA 1K8GA 1CQFA 1JE5A 3MA2B 5EJWA 1GHJA 1D5XC 3A54A 3T1HL 1TWCB 2Z0SA 1Q1EA 4XT1B 1WYDA 3PO3H 1BUVT 4GNXB 1PYSB 1JICA 3K58A 1UUPA 2F0OA 3H0GG 1WCMG 3PV0A 3I91A 1XYIA 4X62Q 3VYTA 1ICWA 2VB3X 1U9RA 3J7A5 4G7HC 4DGZA 2JN4A 4DNTB 1YNNC 1PTOB 3QWNA 1RTOA 5C5MA 1CA6A 4K0KQ 1QJOA 3D0FA 2UUBL 4BBSB 2DJFC 4L5QA 1D1IA 4OWTB 4GOPB 3I4OA 3TS0A 1PFSA 3V96A 1E1OA 2I46A 1PFBA 1Y8PB 4KTAA 3J7YW 2F0SA 2K5QA 4JI0L 3TQYA 3UDGA 3FKIB 2I5MX 3H3VH 2ALYB 3RZOB 2KEDA 5J1ZA 3NTHA 2Z4IA 4A3KH 1S5FD 1EIFA 2B8FA 2LXJA 3RD4A 3G6JB 1VDZA 3PUVA 1K8OA 4JBMA 3NTKA 3OMGA 3TREA 1T5XD 2WB1G 4IJHA 3WOEA 2LS01 5L37A 4JVZA 5BR8L 3K5LA 2BA1A 3G48A 1G291 4IFDG 5K36H 4K6LA 2A69D 1N32Q 4DV2L 1DM0B 2K75A 4K5XA 1VF7A 1A8VA 4JBJA 3CQZB 4LK1C 4HCSA 4B3TL 2VW9A 2CW0D 2K04A 1K0RA 1O7YA 2BA0A 4QCLA 1QOHA 3R2IA 4NW2A 1STGA 4B3RQ 3KYHC 1Y14B 3KF8A 5I9OA 1WTOA 2NN6G 2NN6I 4ZUIA 3CCJA 4C1NI 1RD9D 1AE3A 2XIWA 1TWCH 1Q8KA 4NDXA 2CVRA 2ZXRA 4MZ9A 3R2TA 3PO2H 4EQPA 4B9WA 3CAMA 3S24A 4EX5A 2D0PA 4DR2Q 1PV4A 1QNKA 3KK7A 1HPCA 1SROA 1C0AA 1X65A 4C3HG 4K0KL 2IX3A 4HSPA 4IPDA 5I2XA 3RZDH 2RHSB 1HZAA 1A2TA 3D4RA 3K0XA 3MEHA 3RLFA 1EYGA 3VA5A 1K3RA 1PH6A 1IW7C 1V1QA 1V1PB 2F0VA 3CP0A 3NELA 1ET9A 3CCSA 1ONLA 2Q2HA 5EAYA 1R9TB 5KNBA 2MNAA 5ELOA 1TT2A 2HHHQ 1BKBA 1EUJA 1PH4A 2RDFA 3RZOH 1NR2A 4CKBA 1U4LA 1SNOA 2QDBA 3T16A 5NUCA 1FNWA 3AEVA 1W6JA 4J1MA 4A3EB 3R3OA 1N32L 3G4SA 2YYZA 2DY8A 2JA5H 1Q8IA 3EIVA 3CCRA 4PG3A 3OYYA 3TRZA 1LTAD 2VB2X 4DV1Q 3E9IA 3CCQA 2WKDA 5DEHA 4CDEC 2UXDQ 1YZ6A 1YHQA 4B3RL 1WD0A 1H9SA 2ZJRA 5CMDA 2JA9A 1D2BA 3DLLA 4UP9A 1CTMA 4RGNA 2LXKA 4F7XA 1TS2A 2WAQG 1JORA 4BY1B 4DNRB 2Y0SB 2MGSA 4DKAC 2PZUA 3HP3A 3DEOA 3AFQA 5CYUA 4DR4Q 1U4RA 1I6HH 1HNWQ 1HUNA 4YIJA 3CXCA 1QZGA 4A75A 4YWMA 2K32A 1JQYD 2RKSA 2Y0SE 4DV3Q 2AQ3B 3GTLB 4A3JG 3VR5A 3R8BA 3D3RA 1OTCA 3OWFA 3I4NB 1KABA 5DAUA 4KK7A 1G51A 4ZQ3A 2NVQH 2M2LA 2HHHL 1PDQA 5IIFA 3S1QB 2BOSA 1D7QA 5KNCA 1IBLQ 1EL0A 2EXDA 4BY7G 1CZGA 5C3EH 4CJ2C 3TEHB 5KRUA 2DJGC 2OTLA 1U4MA 1IYUA 1CI3M 3QR8A 2DUDA 4IO9A 5M5YB 4DV1L 1JWUD 2ZT9C 1IXRA 4IFDJ 1LTTD 3TBIB 2BDNA 3C2PA 2UXDL 4I7ZC 2D9UA 4X3KA 4HIMA 1SYGA 4DV0Q 1HZBA 3A8KE 1B9NA 4UY8C 1YNJC 5IOCA 3RNUA 4F8MA 3GTQH 5IGCA 1M4VA 1Q12A 5IT9E 1JMCA 2JE6I 4LF6Q 1A6XA 2DNEA 4J8QA 4GKJL 5C5LA 4RWSC 1LACA 4BS9A 4ZKBB 2I5LX 3CMEA 1K3BC 3MXUA 3C46A 4OX9Q 2SEBD 1T5EA 4G57A 4DR7Q 2LMCB 4DR5Q 4ME5A 1IBKQ 1J6QA 2NN6H 4DR4L 3EA6A 1HNWL 1HXYD 5ELBA 3FRPB 4IURA 2Q8RE 2JA8G 5JAVA 1D8LA 3GTOH 3V2TA 4DUZQ 4J15A 4DV3L 4HJAA 3NENA 2OWOA 4Q5VA 3GTMB 1EQRA 4DXFA 1F9QA 1W6KA 4IUTA 1J8IA 1BXTA 2R93G 1I4RA 1EWIA 4RGTA 1S4ZA 4C3HH 1B9MA 2NVTB 4GLAC 4HJ7A 4ABNA 2I0QA 1SYEA 3A74A 5LMNW 4JOIC 1EY4A 3M4YA 3RN2A 3K57A 2IHEA 5M3FG 2Q8IB 1EY0A 2BCOA 2R92H 2XN9C 1QNUA 2HCCA 1HUMA 3G6EA 2B29A 5KYLA 1Y1WB 2KA7A 5I6YA 4CDCC 1S5BD 5H1SE 2L1BA 4K14A 1DONA 1VCIA 1A0IA 1R4QB 1H9JA 4DV0L 1VQNA 2FFKB 1SE3A 1MI2A 1AE2A 4QUFA 4LMQD 5A2QE 1PHJA 4A3IG 5IP9G 3S1NB 4LF6L 2FJ2A 4LF7L 1HZ9A 3GV3A 1G6ZA 3QG1A 2D2CC 3A5ZB 2TMPA 2R3ZA 1JJ2A 5I6WA 5ISRA 1V9PA 4XT3B 3H15A 4OX9L 1SE2A 5EQ0A 1KDBA 4GNXC 4DR7L 4WJ3M 5CORA 4DR5L 2K4KA 4L63B 1FGUA 3VA7A 2FXQA 4Y7NB 2IL8A 4HIOA 1S5CD 3D6CA 3BU2A 1N33L 1PZKD 1IBKL 3AYHB 3AQQA 2G9HD 2QEJC 4X3UA 3SEBA 2E2DC 3EROA 3JAMi 2JP1A 2F0QA 1O7LA 1U5KA 1PTOC 4K2KA 3DWAA 5C4JH 4DUZL 2N8NA 1PH9A 3CC2A 4GOPC 5JEAG 1SYDA 4L5SA 3MFGA 3LWUA 3BVGA 1IL8A 1I3QB 2EQSA 1AN8A 3IRBA 3KLSA 3KBGA 4WFN3 3E5SA 2NVTH 1YVCA 1YNJD 2Q2UA 1I4PA 1LTGD 2B2YA 2ID0A 3HOYG 1NBWA 4A3JH 1VQHA 4JC0A 3L0OA 4IUUA 4JI4Q 1AFPA 2CHBD 3NK9A 4GN3B 2RVLA 2H4OA 2EY6A 1TWGH 2A6HC 4KHPQ 5D3IB 2IT1A 2E2JB 4IPGA 1X3PA 4BY7H 4ZLTF 1TY0A 1EIHA 1SLJA 4JI5Q 3PIPA 1PH3A 2MUYA 1CM9A 1BCPC 4RH6A 1MKHA 4A3KG 3D6WA 4BBRG 3PQIA 3S1NH 4A3BG 3VYSA 4K5WA 4FXKC 1EZ6A 1EOVA 4JYAQ 4A93B 2F0LA 2K33A 2WKCA 3I90A 3S16B 3T53B 2F0PA 5E3FA 2PZTA 3GTPH 4LF5Q 5LHY1 1SYCA 5CV7A 4RHRA 3DMUA 4C3IG 1UE5A 3N52A 3D4WA 1QZHA 4R4IA 2KHJA 1EQQA 1E3PA 4OO1G 1CKNA 4OO1I 3S14H 3J81j 1X3EA 1JJGA 1TWHB 3EBEA 2C35B 4JBWA 4K2LA 2AQ1B 3M7NA 2F0UA 2J7ZA 5G3LD 2Z6KA 2R7ZB 2F4IA 4IOAA 2F0HA 3D31A 3W1GA 1N36Q 3T51B 4ZRZA 3UI2A 2ZTCA 2R93H 3PMFA 2QW7A 1KLGD 2R61A 3X3MA 2QGQA 1LTID 2PPBC 4JI4L 1B3QA 1E2ZA 4ZUJA 3HOZB 1PH2A 2ICIA 2GA4B 2N88A 2FINB 4ZCKA 1CUKA 2NYZD 4LUVA 2A74C 2A69C 1O78A 4F87A 3JAME 1WD1A 2UUCQ 1IHZA 4E6IA 2LY7A 4BBSG 1CKNB 3ULJA 2F1MA 1PTOD 2CW0C 4LW1A 1ESFA 5T1IA 2QDLA 1WTQA 1S72A 4HEDA 1LT4D 3FKIG 4KJNA 4G4KA 5HURA 2B63B 4QQBX 2X69A 4JI1L 4FO2A 4H0LC 1MHWC 4JI0Q 2Q2TA 4G7ZC 2YTVA 4JYAL 1VQFA 2FMCA 1JCKB 2Z9HA 1K0SA 4K8JA 4DA2A 1VQEA 1K9MC 4A3IH 3MFYA 5IP9H 4LF5L 3CD6A 2IWHA 3KF6B 3GDEA 5KGUA 2YTXA 1B3AA 3SK8A 5G3LF 4KI0A 1ILPA 4R8IA 1I94Q 1ET6A 1X54A 4IALA 5IGFA 3E0JA 2CQAA 5IP7H 5E4WC 3ULPA 3HOXB 3M4OB 4QIWB 5JEAJ 2J0TD 1HTLD 2A5HA 5IWAL 1TWHH 4TVAB 1B2TA 2MHVA 4KY7A 4X66Q 1LTRD 4TKOB
chains in the Genus database with same CATH topology
4CJ0B 2VNUD 3T56B 3MZ5A 1Q1BA 2EYOA 4U673 1QB5D 4Q0FA 2EOTA 5C44B 3MXNA 1M8AA 3ND8A 2B2VC 4HMIA 5CC4A 1EFID 1EEID 1F2MA 1SNMA 3A8JE 5IGEA 1SEBD 1NR4A 3HS0C 1EZ8A 4DAYA 1Z47A 1S5DD 5CR3A 1FYCA 3SDZA 4HTHA 2EY2A 4A3MB 2K05A 1TS4A 2Z4HA 2QKIC 2XWJB 5CBAE 1B4OA 1QE6A 1SMYC 3DM1A 3NXWA 3TSSA 3HOUB 4CJ1B 3FDTA 2R6GA 1NUCA 2XVSA 5T1GA 1SNPA 4IUVA 4H44C 4KJOA 1BCPF 3MWYW 1STYA 3C1EA 1STBA 1LLRD 2B2TA 4WORA 3HGBA 1F2ZA 1DOKA 4OO1H 3HZXA 4K5VA 2MP1A 2F0FA 1II3A 1X32A 2ZXPA 3TN2A 1PLFA 5IT9L 3PUYA 4KD3A 2B2UA 2K03A 2XRSD 1B53A 2K6AA 3OSOA 3TDQA 1UNSA 1KDCA 4KKTA 2Q8TA 5EKKA 1EOTA 4C2MB 1TS3A 1NSNS 1EEFD 5DM73 3T4AC 1PTOH 2L5TA 2C5CA 2E76C 2JYOA 2FHTA 3HG9A 4G7OC 2KEEA 2NTTA 3J7AV 3H91A 2L11A 3VR2A 5CV6A 2NVYB 3TMEA 3S17B 1HHVA 3MAQA 3LNNA 3FVQA 3K5MA 2MPMA 2BE5D 5FO7B 4K8IA 3VR6A 2EPBA 3ONAB 4OL7A 5FKAC 2K1BA 2O2LD 3URYA 3MTSA 4HN7A 5I4DA 2O5IC 1I4HA 2E2IB 2KHSA 2M9VA 3KLRA 1HFNA 3NSWA 1Y1VB 3S9WA 4O1NA 1QCBD 3HOWB 4DFAA 2AWOA 1C8CA 1GOZA 1EIGA 1TWAB 2NTSA 1HQRD 3N6RA 2K5DA 2F0KA 1SMYD 4XQNA 1F2YA 3NQTA 3OIPA 1Q3LA 3NWTA 5M5WB 1A3TA 3L3OC 2F0DA 3BDCA 2RSOA 3J7AF 3I4LA 5KYIA 3NPPA 2EYJA 1LO5D 2PW7A 3K5NA 2K01A 1H9SB 2B2YC 1Y8OB 1DCZA 1BQQT 1QILA 1RHPA 1LV9A 3CKIB 3I70A 1A3UA 2KECA 2QILA 1CT1D 3NE5B 1FNVA 2OXPA 4RKLA 1C48A 2EVBA 3NBHA 2KQ3A 3BVMA 4B9XA 1FR3A 3CRKC 1STHA 3BYTB 2AQ2B 4CKEA 2YU9B 1MSHA 4CGYB 4MN3A 3U9OA 2F0GA 3X3NA 2EE1A 1SFOB 1L0XB 1H9KA 4DK1A 3K7AB 5EGTA 3D4DA 3TZUA 5BN4A 3A7AB 3RUZA 4KMUC 3I3CA 1TKWB 1H9RA 3S2DB 3GTJB 4FXDA 1OXVA 1IKLA 4KD4A 2RA4A 1F77A 3PUWA 5EKIA 5IODA 4RKBA 3QOLA 4RAUC 3QIAA 1KAAA 5J39A 4RCNA 2NB0A 1HA5A 3O13A 4X3SA 2AWNA 1STEA 1A15A 5M3MB 3I4MB 3DWQA 2VUMB 4ZK9B 2NVXB 2WACA 3TP8A 2LFNA 2BDOA 4XIGS 5C4XB 5FLXL 4BWGB 3OWEB 1EYDA 5TSSA 5BN3A 5EBCA 2DY7A 3LX0A 4PMWA 1HQMC 2L0CA 5C4HA 1KNAA 1EY7A 1OO9B 2X6GA 4C3JB 1JC7A 1NCVA 1O7ZA 4V190 1JOKA 3IL8A 1LABA 3I8ZA 5IGGA 3Q23A 3S1RB 1EU3A 2OT2A 3JAML 5C0XG 5C0XI 1GUSA 1TWFB 5C4ZA 3M3YB 1RKNA 2PZWA 4OGQC 2E75C 1V1OA 1S5ED 3SE0A 4AYBB 4OHJA 2QF7A 1D5MC 3HKZB 3K0YA 2SOBA 5JPNC 3GQBA 3W3AA 3EQLC 2JA7B 3SVMA 3NUCA 4TQUS 2EJMA 2EJFC 4RCOA 1STAA 3SXHA 2HDLA 3HOVB 3QOJA 4KN7C 4C1NK 1LTBD 2F0IA 3NTIA 2JEAI 1WTRA 3WOFA 4EQNA 2EJGC 2EXZA 1I50B 4N9TA 5E4XA 2KCCA 3MHBA 3TZDA 4QUCA 4A3FB 1JOOA 2D5DA 5LL6S 4CBVA 1GUTA 3GTKB 3SK4A 2XWBB 5ELCA 1OXSC 1ENCA 4KY6A 1F9SA 2Z1CA 1GHKA 3BDLA 2ICEC 5KIXA 4FF1A 1TQOA 3C3LA 5I2YA 1A2UA 1Q90A 2NZ1D 2I07B 4BA2I 1AZPA 4HSVA 3W2DA 1G2TA 1K83B 1SYBA 1IKMA 1E0BA 5LL6X 2NWGA 4H13C 2L12A 2F0WA 1H9MA 1PZID 1IYVA 1SSOA 4A3DB 3R93A 3M7GA 1PRTD 3V05A 2K28A 2EYHA 4XTCS 1I4GA 5D3DA 3F2UA 1OXUA 5C3XA 3ND9A 4DF7A 3OIQA 1G2SA 2C9OA 2IPKD 4IUNA 3L9AX 1HTPA 3SK6A 3TP5A 3P7JA 3J81E 5K5PA 1KTKA 3K59A 3P1HA 3PO3B 2PYKA 3J80E 2O5JC 5CV8A 2SNMA 3Q22A 4KKUA 5C0XJ 4DN4M 4I65A 4IUPA 1SNDA 2H1EA 4DK0A 5C0XH 2HQEA 1XWEA 1CFMA 5M9OA 5CV9A 1WTPA 2Z8LA 1OXXK 2X6LA 1B44D 5F2DA 1DD2A 3I73A 2RDGA 2LKVA 3BZDB 2A68D 1WTWA 1ML0D 3BG3A 5E1FA 1SNCA 5FOBB 1LT3D 4FYDA 1XX8A 1PRTB 3CU7A 2BE5C 1JE4A 5JOBA 3OPOA 2EYFA 1PTOF 2JA6B 1GUGA 2F03A 2DNCA 1O80A 1SXTA 3FEWX 3SR1A 1LT6D 3S2HB 2PMZB 1AZQA 1R4PB 2PQEA 4RGOS 1AEXA 2E74C 4S3SA 1BOSA 1EYAA 1KNEA 3PO2B 3PUXA 1DOMA 1CZWA 2PW5A 4H7BA 1G8ZD 1VF5C 1TVXA 5EPLA 5JVG3 1V8QA 4QMGA 4GZYC 3RZDB 4EVOA 1STNA 4C56C 1MSGA 2VXWA 5EKLA 3HEJA 3K5OA 1AP0A 3MVVA 1XXGA 4MIUA 1JB3A 3KBXA 2OF1A 4A3GB 1RDPD 4J6HA 2L9HA 4V0BA 4XXEA 5COYA 2KUMA 1XTCD 1G91A 2A73B 3EVQA 1UEAB 1L0YB 5A35A 2O4XA 1JOQA 2JXMB 3NHHA 2RDHA 4CHTB 2IJ0A 5C6AA 2B2WA 4M8AA 2JA5B 1C4QA 2IX1A 2A6ED 4IFDI 4FNFA 4XDXA 3PUZA 3NP8A 2MJ8A 4ODGA 5ELEA 3PIP3 3OMCA 2EY5A 1BCPB 1V1PA 3MXGA 3U9SA 2K7VA 4XQJA 1TS5A 2V4DA 4QB4A 4HMJA 4FXGC 4Z9CB 3MC0B 3TP7A 3Q24A 4L8JA 4IZ8A 3BYYB 1JWSD 1VMCA 1I6HB 4N9PA 3AB9A 3H0GB 1WCMB 4ZYSA 1SYFA 4DU9A 1CHPD 1EQVA 4XQQA 1RJTA 4KHVA 1Y8NB 2NVQB 1GJXA 5CV5A 2RBMA 4ILWA 2L4NA 3IFTA 1JR0D 2DN8A 3I72A 1HRJA 2QCPX 4K6DA 2JEBI 5C3EB 4PNYA 1TIID 4WRDA 1PYWD 1ZXTA 1OXTA 1U4PA 3VYRA 5BN5A 3PIO3 3ZYYX 1D6EC 5A2QL 1MD2D 2B8GA 2WB1B 4EGVA 1Y69U 1YNND 3GTQB 2L55A 1WTXA 1GUOA 1GUWA 4EQOA 4JK1C 4ZKCB 4KN4C 3L7ZC 1CQVA 2XSCA 4HR7B 4M1UB 1SBBB 2PO4A 4IUQA 1DZ1A 5CBEE 3WDNA 2B2VA 1RCVD 4BA1I 2F3WA 2EYLA 3ITPA 2N55A 3GTOB 4ID6A 3OW7A 5DM63 3GV6A 5CV4A 2AUKA 2NUCA 4C3HB 3RMHA 1CA5A 5AFWA 1RTNA 3AU7A 3DXJC 1PZJD 4C3JG 2XNAC 2R92B 2KJXA 3P20A 1VMPA 4RFBA 2M00A 3C1FA 2KVMA 2F0MA 1ENAA 1FGBD 1HCZA 2PNRC 3BVZA 3MXPA 2ZXOA 1MGSA 3QJYA 2RQXA 3H6MA 3NWSA 1RODA 5J22A 3EFXD 1EWCA 2EY1A 1BF4A 1EY8A 3Q6SA 4IFDH 3VYUA 1A3VA 1EY6A 4ULLA 1IW7D 3Q0AA 4P2CB 4DAVA 2XRQD 2WP8J 5DNFA 4FF2A 4LAAA 1DJRD 1Z6HA 5C4JB 1ESRA 5KNDA 3DWPA 2EZVA 3NBIA 2WAQB 1ILQA 2WINB 3SK5A 1CK1A 4LJZC 1SNQA 2NBFA 5IGDA 4X3TA 3GD7A 4PMCA 4NP5A 1KDAA 3H3VC 1WTVA 2WV6D 5FK9C 1SAPA 1FD7D 2PCFB 1TY2A 3LWEA 1BBXC 4A3JB 3BS1A 4B08A 4QF4A 1EY5A 3IFDA 3NQIA 1J9OA 3IAYA 5EPJA 2G9DA 1RF2D 3J81L 1PRTC 4OIJA 1BDOA 3T13A 1PXUA 1TWGB 1HA6A 1PFNA 1CHQD 5I9PA 1KLUD 3K6OA 4BY7B 3J80L 4O42A 3KLSX 1Z7TA 1JWMD 2F0NA 1BR9A 5FO9B 4IQZA 2HCIA 3GTGB 1TR5A 2K5WA 1QG7A 4DAPA 1EU4A 5IGBA 1ZYRC 1LTSD 4HAEA 3GTPB 3DHQA 5D65A 2FMMA 4PMBA 4PV1C 4KHZA 1EY9A 4F88A 3S14B 2D62A 1AW7A 2EYMA 2OEOA 1F9RA 1D5ZC 1X3QA 2JA8B 2F0EA 1B50A 1DYQA 4NKLA 1WVLA 2R93B 1F9PA 2A68C 4ZAIA 2ENBA 4KY5A 1I6VC 3H09A 3QB3A 5M3FB 2WIIB 4UAIA 3H94A 4KV6A 2SDFA 2F0TA 3QO2A 4PQXA 5ELDA 2JSOA 1ZKOA 2IX0A 1MBYA 5D14A 1BNZA 1D1KA 4R9WA 5HGTA 1EYCA 1SDFA 3FPPA 4FF4A 2SNSA 3G7LA 4WJWA 4A3IB 4RHSA 1SJHD 1QWYA 2AUJD 3VR3A 1ZEQX 2B2TC 1NAPA 1GUNA 1LT5D 3KUPA 5K36G 3GP7A 1UAPA 2J4XA 3BDOA 2B2WC 1SJED 1I4XA 3GO5A 1FNUA 5JJZA 2IW3A 5EPKA 3DUZA 3S15B 3IKJA 5CGKA 3SHLA 2B39A 4L6TB 1SE4A 4CKCA 2B2UC 2KOLA 5JVH3 4TRDA 2HUGA 3HRZC 3VR4A 3E6ZX 2E2HB 4U68A 2EYPA 5M5XB 4OIKA 1TU2B 3OHXC 5FLXE 5JPMC 3M85A 5C3WA 4HCEA 4TSSA 1PMRA 1F2LA 3P75A 4FF3A 2KCNA 4XYQA 1ZYRD 1GXDC 4FP5D 3HOYB 1V43A 3CRLC 2A6EC 4UDUC 4IN3A 1E2VA 4R8NA 1B1ZA 3EJIA 2F0JA 3FPUB 3DEPA 3AMUA 2EDGA 2F3VA 3A56A 1PFMA 4DXGA 3D8GA 1PRTF 3FMCA 1BO0A 1EQTA 4A3KB 4MHEA 4BBRB 4A3BB 3A8IE 5EBDA 3A55A 1E2WA 4RA8A 1EWHA 1I4QA 4NMZA 1K8MA 4KKSA 5KEEA 2HDMA 4FVMA 4C3IB 4RGMA 2TSSA 2A6HD 1DOLA 1ENFA 3A7LA 1DXMA 1HFGA 3S1MB 5FO8B 5JEAH 3OOCA 3ERQA 3TP6A 3CHBD 1BCPD 2RSNA 4XYOA 5ELFA 1CQFA 3MA2B 5EJWA 1GHJA 1D5XC 3A54A 1TWCB 1Q1EA 4XT1B 1BUVT 1JICA 3K58A 1UUPA 2F0OA 3PV0A 3I91A 1XYIA 3VYTA 1ICWA 2VB3X 1U9RA 4G7HC 4DGZA 4DNTB 1YNNC 1PTOB 3QWNA 1RTOA 5C5MA 1CA6A 1QJOA 4BBSB 1D1IA 3V96A 2I46A 1PFBA 1Y8PB 4KTAA 3J7YW 2F0SA 2K5QA 3FKIB 3RZOB 2KEDA 5J1ZA 3NTHA 2Z4IA 1S5FD 2B8FA 3RD4A 3G6JB 1VDZA 3PUVA 1K8OA 3NTKA 3OMGA 1T5XD 3WOEA 3K5LA 2LS01 2BA1A 5K36H 1G291 4IFDG 4K6LA 2A69D 1DM0B 4K5XA 1VF7A 3CQZB 4LK1C 4HCSA 2CW0D 2K04A 1O7YA 2BA0A 4QCLA 1QOHA 3R2IA 4NW2A 1STGA 3KF8A 5I9OA 1WTOA 2NN6G 2NN6I 4ZUIA 4C1NI 1RD9D 2XIWA 4NDXA 2CVRA 2ZXRA 3R2TA 4EQPA 4B9WA 1QNKA 3KK7A 1HPCA 4C3HG 2IX3A 4HSPA 5I2XA 1A2TA 3D4RA 3MEHA 3RLFA 3VA5A 1IW7C 1V1PB 2F0VA 1ET9A 1ONLA 1R9TB 5KNBA 1TT2A 2RDFA 1NR2A 4CKBA 1U4LA 1SNOA 2QDBA 3T16A 5NUCA 1FNWA 1W6JA 4J1MA 4A3EB 3R3OA 2YYZA 2DY8A 1Q8IA 1LTAD 2VB2X 2WKDA 5DEHA 1WD0A 1H9SA 5CMDA 1D2BA 1CTMA 4RGNA 4F7XA 1TS2A 1JORA 4BY1B 4DNRB 2Y0SB 2MGSA 2PZUA 3HP3A 3DEOA 5CYUA 1U4RA 1HUNA 4YIJA 2K32A 1JQYD 2RKSA 2AQ3B 3GTLB 3VR5A 3R8BA 3D3RA 3OWFA 3I4NB 1KABA 5DAUA 4KK7A 4ZQ3A 2M2LA 1PDQA 5IIFA 3S1QB 2BOSA 5KNCA 1EL0A 1CZGA 4CJ2C 5KRUA 1U4MA 1IYUA 1CI3M 5M5YB 1JWUD 2ZT9C 4IFDJ 1LTTD 3TBIB 2BDNA 3C2PA 4I7ZC 2D9UA 4X3KA 1SYGA 3A8KE 1B9NA 1YNJC 5IOCA 4F8MA 5IGCA 1M4VA 1Q12A 5IT9E 1A6XA 2JE6I 2DNEA 4J8QA 5C5LA 4RWSC 1LACA 4ZKBB 4BS9A 3MXUA 3C46A 2SEBD 1T5EA 4G57A 2LMCB 4ME5A 2NN6H 3EA6A 1HXYD 5ELBA 3FRPB 4IURA 2Q8RE 5JAVA 3V2TA 4Q5VA 3GTMB 4DXFA 1F9QA 1W6KA 4IUTA 1J8IA 1BXTA 1I4RA 4RGTA 1S4ZA 1B9MA 2NVTB 4ABNA 1SYEA 1EY4A 3M4YA 3K57A 2Q8IB 1EY0A 2BCOA 2XN9C 1QNUA 2HCCA 1HUMA 5KYLA 1Y1WB 2KA7A 5I6YA 1S5BD 2L1BA 4K14A 1DONA 1VCIA 1R4QB 1H9JA 2FFKB 1SE3A 1MI2A 4QUFA 4LMQD 5A2QE 3S1NB 2FJ2A 3GV3A 1G6ZA 3QG1A 2D2CC 2TMPA 2R3ZA 5I6WA 5ISRA 4XT3B 1SE2A 5EQ0A 1KDBA 5CORA 4L63B 4Y7NB 3VA7A 2IL8A 1S5CD 3D6CA 1PZKD 2G9HD 2QEJC 4X3UA 3SEBA 2E2DC 3EROA 2JP1A 2F0QA 1O7LA 1PTOC 4K2KA 3DWAA 5JEAG 1SYDA 3MFGA 3LWUA 3BVGA 1IL8A 1I3QB 1AN8A 3KLSA 3KBGA 4WFN3 3E5SA 1YNJD 1I4PA 1LTGD 2B2YA 2ID0A 4IUUA 1AFPA 2CHBD 3NK9A 2RVLA 2H4OA 2EY6A 2A6HC 5D3IB 2IT1A 2E2JB 1X3PA 4ZLTF 1TY0A 1EIHA 2MUYA 1CM9A 1BCPC 4RH6A 3D6WA 3VYSA 4K5WA 4FXKC 1EZ6A 4A93B 2F0LA 2K33A 2WKCA 3I90A 3S16B 3T53B 2F0PA 5E3FA 2PZTA 5LHY1 1SYCA 5CV7A 4RHRA 3DMUA 4C3IG 3N52A 3D4WA 4OO1G 4OO1I 1TWHB 4JBWA 4K2LA 2AQ1B 3M7NA 2F0UA 2J7ZA 5G3LD 2R7ZB 2F4IA 2F0HA 3D31A 3T51B 4ZRZA 3UI2A 3PMFA 1KLGD 2R61A 3X3MA 1LTID 2PPBC 1E2ZA 4ZUJA 3HOZB 2ICIA 2GA4B 2N88A 2FINB 4F87A 2NYZD 2A74C 2A69C 1O78A 3JAME 1WD1A 1IHZA 4E6IA 2LY7A 2F1MA 1PTOD 2CW0C 1ESFA 5T1IA 1WTQA 4HEDA 1LT4D 4KJNA 5HURA 4G4KA 2B63B 2X69A 4FO2A 4H0LC 4G7ZC 2FMCA 1JCKB 4K8JA 4DA2A 3MFYA 2IWHA 5KGUA 1B3AA 3SK8A 5G3LF 4KI0A 1ILPA 4R8IA 1ET6A 4IALA 5IGFA 3E0JA 2CQAA 5E4WC 3HOXB 3M4OB 4QIWB 5JEAJ 2J0TD 1HTLD 2A5HA 1B2TA 2MHVA 4KY7A 1LTRD 4TKOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RTO A;  1CA6 A;  5EQ0 A;  4CJ0 B;  2DY7 A;  5DNF A;  1B50 A;  1RHP A;  1WTP A;  2Q8T A;  1WTX A;  1LV9 A;  1EOT A;  5COR A;  2X6L A;  2BDN A;  1KNA A;  2B2W A;  1ESR A;  1PFB A;  2X6G A;  1NR2 A;  2D9U A;  2IL8 A;  2EOT A;  4X3K A;  2KEC A;  1U4L A;  1GUW A;  1M8A A;  1WVL A;  1F9P A;  1ILQ A;  1NCV A;  1O7Z A;  2B2V C;  2J7Z A;  2JYO A;  2FHT A;  4X3U A;  3IL8 A;  2KEE A;  4ZKC B;  3I8Z A;  2JP1 A;  4XDX A;  2NZ1 D;  4ZAI A;  3H91 A;  2DY8 A;  2L11 A;  1WTW A;  2MJ8 A;  4HSV A;  4IUQ A;  1AZP A;  1ML0 D;  4X3T A;  2KED A;  1DZ1 A;  4RWS C;  4ZKB B;  1NR4 A;  3FPU B;  3UI2 A;  5CBE E;  1G2T A;  3DEP A;  1WTV A;  1HHV A;  1SAP A;  1XX8 A;  2B2V A;  1IKM A;  1E0B A;  3LWE A;  2MPM A;  1JE4 A;  2N55 A;  1IL8 A;  2NWG A;  4UAI A;  1WD0 A;  1BBX C;  3GV6 A;  2L12 A;  1PFM A;  2N88 A;  2FIN B;  1MSH A;  2SDF A;  2EPB A;  3ONA B;  4MN3 A;  2K1B A;  5CMD A;  2K05 A;  1O80 A;  2NYZ D;  3MTS A;  1WD1 A;  1BO0 A;  1EQT A;  3QO2 A;  3IFD A;  4IUR A;  2Q8R E;  4MHE A;  1CA5 A;  5AFW A;  1SSO A;  1J9O A;  1RTN A;  2B2Y A;  3R93 A;  2EE1 A;  1AZQ A;  5EPJ A;  4HCS A;  5CBA E;  5D14 A;  1BNZ A;  4RA8 A;  4OIJ A;  1F9Q A;  1VMC A;  4IUT A;  4R9W A;  1J8I A;  4IUU A;  1HA6 A;  1HFN A;  2K28 A;  2K04 A;  1PFN A;  1SDF A;  1QE6 A;  1B4O A;  3DM1 A;  3G7L A;  2HDM A;  1S4Z A;  5T1I A;  1O7Y A;  4HED A;  1WTQ A;  3SVM A;  4CJ1 B;  3F2U A;  4NW2 A;  3FDT A;  2X69 A;  4O42 A;  1VMP A;  2MGS A;  1KNE A;  2B2T C;  2RVL A;  3HP3 A;  3DEO A;  5T1G A;  1U4R A;  2HDL A;  1NAP A;  1WTO A;  1DOM A;  1HUN A;  1C8C A;  3KUP A;  4IUV A;  1G2S A;  1DOL A;  2KVM A;  1RJT A;  1EIG A;  1TVX A;  3I3C A;  5EPL A;  1X3P A;  2B2W C;  2HCC A;  3MWY W;  1HUM A;  3P7J A;  1WTR A;  2HCI A;  2XIW A;  4ZLT F;  1MSG A;  1EIH A;  1IKL A;  1HFG A;  2CVR A;  2RA4 A;  2VXW A;  5EPK A;  1QG7 A;  5EKI A;  5JJZ A;  2L4N A;  5E4X A;  1AP0 A;  2B2T A;  1CM9 A;  1MGS A;  3TZD A;  4RAU C;  2RSN A;  1HRJ A;  1QNK A;  1B3A A;  3KBX A;  1ROD A;  4HAE A;  1ILP A;  4QUC A;  1DOK A;  3D6W A;  5EJW A;  4R8I A;  2L9H A;  2MP1 A;  2L1B A;  5D65 A;  1DON A;  2B2U C;  2M2L A;  2FMM A;  5COY A;  1Q3L A;  1BF4 A;  4X3S A;  3Q6S A;  2KOL A;  4XT1 B;  5E4W C;  1PDQ A;  4DN4 M;  2HUG A;  2FFK B;  1A15 A;  4IUP A;  3I90 A;  2KUM A;  1ZXT A;  1MI2 A;  1EL0 A;  2H1E A;  1JIC A;  2RSO A;  4LMQ D;  4U68 A;  4OIK A;  4QUF A;  4ZK9 B;  1U4P A;  1X32 A;  1G91 A;  3TN2 A;  2FJ2 A;  4CJ2 C;  1B2T A;  3I91 A;  1XYI A;  1PLF A;  1F9S A;  3GV3 A;  1ICW A;  3N52 A;  1G6Z A;  2B2U A;  1F9R A;  2K03 A;  1B53 A;  1U4M A;  1X3Q A;  2K01 A;  2R3Z A;  1F2L A;  4XT3 B;  2B2Y C; 
#chains in the Genus database with same CATH topology
 4LF4 Q;  2E2H H;  3K8A A;  4CJ0 B;  5M5X H;  2VNU D;  3T56 B;  3MZ5 A;  1Q1B A;  1L1O B;  2EYO A;  4U67 3;  1QB5 D;  4Q0F A;  4GN4 B;  2EOT A;  5C44 B;  3MXN A;  1M8A A;  3ND8 A;  2B2V C;  1GM5 A;  4HMI A;  4DAM A;  5CC4 A;  1NTG A;  1EFI D;  3I56 A;  1B7Y B;  2UUC L;  1EEI D;  1F2M A;  3HOY H;  1SNM A;  3A8J E;  3KDF B;  5IGE A;  1SEB D;  1NR4 A;  3HS0 C;  4LUZ A;  4MTN A;  1EZ8 A;  4DAY A;  1Z47 A;  1S5D D;  2PMZ E;  5CR3 A;  1FYC A;  3SDZ A;  4HTH A;  2EY2 A;  1N9W A;  4A3M B;  2K05 A;  3CPW A;  1TS4 A;  2Z4H A;  2IY5 B;  2QKI C;  2BH2 A;  2XWJ B;  5C3E G;  4JG2 A;  5CBA E;  1A63 A;  3L2P A;  1B4O A;  1QE6 A;  1SMY C;  3DM1 A;  3NXW A;  3TSS A;  3HOU B;  4CJ1 B;  4BBR H;  4A3B H;  1UE7 A;  1Q82 C;  3FDT A;  4A3E G;  3KJO A;  1I94 L;  2R6G A;  1NUC A;  1PH7 A;  2XVS A;  5T1G A;  1SNP A;  4IUV A;  4H44 C;  3KLW A;  4KJO A;  1BCP F;  2R7D A;  4DAY B;  3MWY W;  4R4C A;  4JPB W;  1STY A;  3C1E A;  3W1B A;  1STB A;  1LLR D;  4C3I H;  2B2T A;  4WOR A;  3M4P A;  3HOX H;  1X3F A;  4X66 L;  1X3G A;  3HGB A;  3M4O H;  1F2Z A;  4LF4 L;  1DOK A;  4OO1 H;  3HZX A;  4K5V A;  2MP1 A;  1KIX A;  3S1M H;  4LF8 Q;  2F0F A;  1HJP A;  1II3 A;  3FHW A;  4BY1 G;  1X32 A;  2ZXP A;  3TN2 A;  2Y0S G;  1PLF A;  5IT9 L;  3PUY A;  4KD3 A;  2B2U A;  2K03 A;  2XRS D;  1B53 A;  3M9B A;  2K6A A;  3OSO A;  3TDQ A;  1UNS A;  4R4O A;  1KDC A;  4KKT A;  1VQD A;  2Q8T A;  5EKK A;  1EOT A;  3BJU A;  4C2M B;  2ES2 A;  1TS3 A;  1NSN S;  1EEF D;  5DM7 3;  3T4A C;  1PTO H;  2L5T A;  2C5C A;  2E76 C;  2JYO A;  2FHT A;  3HG9 A;  3I4N G;  2KEE A;  2NTT A;  4BBS H;  4G7O C;  1G6P A;  4NPS A;  2R92 G;  3J7A V;  3H91 A;  3CC7 A;  2L11 A;  3VR2 A;  2VZA A;  1KRS A;  5CV6 A;  2NVY B;  3KF8 B;  3TME A;  3S17 B;  3CC4 A;  1HHV A;  3FKI H;  1GO3 E;  3LNN A;  3MAQ A;  3CCE A;  1YI2 A;  2WFW A;  3FVQ A;  3K5M A;  2F4V L;  2KCM A;  2BE5 D;  2MPM A;  1UE6 A;  5FO7 B;  2A19 A;  4K8I A;  3VR6 A;  4JW0 A;  2EPB A;  3ONA B;  4OL7 A;  2RF4 A;  2K1B A;  2O2L D;  5FKA C;  3URY A;  5HGQ A;  3MTS A;  4YCU A;  4HN7 A;  5I4D A;  2O5I C;  1I4H A;  4AH6 A;  4DUY L;  1XMO Q;  2E2I B;  2KHS A;  3SGI A;  2M9V A;  3KLR A;  2H5X A;  1HFN A;  3NSW A;  1Y1V B;  3S9W A;  4PZ6 A;  2JJQ A;  1XNQ Q;  4O1N A;  1QCB D;  5GRO A;  3HOW B;  3CQZ H;  1NMF A;  4DFA A;  4LF8 L;  2AWO A;  1C8C A;  4Y52 H;  1GOZ A;  1EIG A;  4DR6 Q;  1TWA B;  3E0E A;  2NTS A;  4GKJ Q;  1HQR D;  3N6R A;  4DR1 Q;  3UDI A;  2K5D A;  4OON A;  2F0K A;  2UUA Q;  1SMY D;  4XQN A;  1YHB A;  1F2Y A;  2E8G A;  3NQT A;  3OIP A;  1VQJ A;  4DV5 Q;  1Q3L A;  3EN2 A;  3NWT A;  5M5W B;  1A3T A;  3L3O C;  2XGT A;  2F0D A;  3BDC A;  2RSO A;  3J7A F;  4QL5 A;  3I4L A;  2HT1 A;  5IYD G;  2K5H A;  5KYI A;  4HJ8 A;  3NPP A;  4POF A;  3PCO B;  2EYJ A;  1LO5 D;  2PW7 A;  3K5N A;  2K01 A;  1H9S B;  3PF5 A;  4X6A H;  2B2Y C;  1Y8O B;  1DCZ A;  1BQQ T;  2PQA A;  1QIL A;  1RHP A;  4BXX G;  1LV9 A;  3CKI B;  2R7F A;  1Y1W G;  3I70 A;  4POG A;  3W5O A;  1A3U A;  2KEC A;  5FJ8 G;  2QIL A;  1CT1 D;  3NE5 B;  2EIF A;  4R1J A;  1FNV A;  2OXP A;  1R9T H;  2K50 A;  4RKL A;  1C48 A;  2EVB A;  4JI3 Q;  2NZO A;  3NBH A;  1EFW A;  3ER0 A;  2KQ3 A;  1P8L A;  3T1Y Q;  1XMO L;  2RHQ B;  3BVM A;  4B9X A;  1XPO A;  4LFB Q;  1FR3 A;  3CRK C;  5GQO A;  1STH A;  4GS3 A;  4JI2 L;  1XNQ L;  4HJ9 A;  2E5L Q;  2MQH A;  3BYT B;  4A3E H;  2N49 A;  2PI2 A;  2AQ2 B;  2CFM A;  4CKE A;  3KJP A;  2YU9 B;  1MSH A;  4CGY B;  1WOC A;  4MN3 A;  3CCM A;  3BZC A;  3U9O A;  2PQA B;  2F0G A;  3X3N A;  2EE1 A;  4LF7 Q;  4DR6 L;  1VQP A;  3G71 A;  3I55 A;  4DR1 L;  4JI8 Q;  1SFO B;  1L0X B;  3CW2 C;  1H9K A;  3RR5 A;  4DK1 A;  5IY0 A;  2UUA L;  3K7A B;  3NBH B;  5EGT A;  3D4D A;  3TZU A;  5BN4 A;  3K81 C;  1N33 Q;  4DV5 L;  1Q46 A;  2OCE A;  1N8R C;  1YBY A;  3A7A B;  3RUZ A;  4BY1 H;  4KMU C;  3VDY A;  3I3C A;  1TKW B;  5IYB G;  1H9R A;  3S2D B;  3GTJ B;  4FXD A;  1OXV A;  1IKL A;  4KD4 A;  2RA4 A;  1F77 A;  3PUW A;  5EKI A;  5GAH C;  1TXY A;  5IOD A;  4RKB A;  3QOL A;  2NZH A;  4RAU C;  3QIA A;  1KAA A;  2Q2I A;  5J39 A;  4OWX B;  4RCN A;  2NB0 A;  3GTL H;  1HA5 A;  3O13 A;  4X3S A;  2AWN A;  2PI2 E;  1STE A;  4DR3 Q;  1A15 A;  1K73 C;  5M3M B;  3I4M B;  3DWQ A;  1HR0 W;  3I4N H;  2VUM B;  4UP7 A;  4ZK9 B;  2ZJQ A;  2NVX B;  2WAC A;  5DLQ E;  4JI3 L;  3TP8 A;  2LFN A;  4O2D A;  2BDO A;  2GVB A;  4XIG S;  3T1Y L;  5C4X B;  5FLX L;  4BWG B;  3OWE B;  1EYD A;  3S1Q H;  4L5T A;  4LFB L;  5TSS A;  5BN3 A;  4GLV B;  5EBC A;  2DY7 A;  3LX0 A;  2E5L L;  4PMW A;  1HQM C;  2L0C A;  5C4H A;  4P74 A;  1KNA A;  1EY7 A;  2X6G A;  1OO9 B;  1VQG A;  4C3J B;  1C9O A;  1JC7 A;  3PF4 A;  1NCV A;  1O7Z A;  1J5E Q;  4V19 0;  1JOK A;  3IL8 A;  1FJG Q;  1LAB A;  5M5Y H;  3I8Z A;  5IGG A;  3OTO Q;  3Q23 A;  3S1R B;  1EU3 A;  2F3I A;  2OT2 A;  4HIK A;  3JAM L;  5C0X G;  5C0X I;  2ZM6 Q;  1GUS A;  1TWF B;  2CH4 A;  5C4Z A;  4X65 Q;  3M3Y B;  4A93 G;  1RKN A;  1L1O C;  4JI8 L;  3A0J A;  5HY6 A;  2PZW A;  1VQB A;  4OGQ C;  4AIM A;  2E75 C;  1V1O A;  1S5E D;  2MO1 A;  3SE0 A;  4OHJ A;  4AYB B;  1XMQ L;  1QVC A;  5IP7 G;  2QF7 A;  1D5M C;  3HKZ B;  3J81 i;  3K0Y A;  2SOB A;  3BZK A;  5JPN C;  3GQB A;  1S40 A;  4AYB E;  3W3A A;  3EQL C;  3J80 i;  2JA7 B;  3HKZ E;  3SVM A;  2R7Z G;  3S2D H;  3GTJ H;  3NUC A;  4TQU S;  4NB3 A;  2EJM A;  1MIU A;  2EJF C;  4L5R C;  4RCO A;  1PH5 A;  3GTM H;  1STA A;  3SXH A;  2HDL A;  3HOV B;  3QOJ A;  4KN7 C;  4C1N K;  1LTB D;  2F0I A;  4DR3 L;  5GAG C;  3NTI A;  2JEA I;  1WTR A;  4DV4 Q;  4GKK Q;  5IYD H;  2EJG C;  2EXZ A;  1I50 B;  3WOF A;  4EQN A;  3J7Z C;  4N9T A;  1PH8 A;  5E4X A;  2KCC A;  3HOZ G;  4YWL A;  3MHB A;  3I4M H;  3TZD A;  3HFZ B;  4QUC A;  4A3L G;  4A3F B;  1JOO A;  4BXX H;  2CKZ B;  2D5D A;  1Y1W H;  5LL6 S;  4CBV A;  5C4X H;  1GUT A;  3GTK B;  5FJ8 H;  3SK4 A;  3U58 A;  2XWB B;  5ELC A;  1J5E L;  1FJG L;  3OTO L;  1OXS C;  2B63 G;  1ENC A;  3UE1 A;  4MTK A;  4KY6 A;  4C3J H;  4YHH Q;  1IL2 A;  1F9S A;  2Z1C A;  2ZM6 L;  1GHK A;  3BDL A;  4X65 L;  4LNQ A;  2ICE C;  1I5F A;  4MNO A;  2CWA A;  3S1R H;  5KIX A;  4JI1 Q;  1TWF H;  4R4T A;  3M3Y H;  1X6O A;  4FF1 A;  4N8X 1;  1TQO A;  1L0W A;  3C3L A;  5I2Y A;  1A2U A;  1XTD A;  4GN5 A;  2A1A A;  1Q90 A;  1VQM A;  1XJV A;  2NZ1 D;  2I07 B;  4BA2 I;  1AZP A;  4HSV A;  4Y7N H;  3W2D A;  1VS0 A;  1EIY B;  1G2T A;  1K83 B;  1SYB A;  3FP9 A;  3HOX G;  3STB C;  1IKM A;  2HIX A;  1E0B A;  5LL6 X;  2NWG A;  1SMX A;  4H13 C;  2L12 A;  2F0W A;  2JK8 A;  1X9N A;  1H9M A;  1PZI D;  3CMA A;  2K14 A;  1IYV A;  5IYB H;  1SSO A;  5IWA Q;  4A3D B;  3R93 A;  4DV4 L;  1GVP A;  4GKK L;  3M7G A;  1I3Q H;  4LUO A;  1JT8 A;  1VQ6 A;  2ATW A;  5C44 G;  1PRT D;  3V05 A;  2K28 A;  2EYH A;  5JJL A;  4XTC S;  1I4G A;  5D3D A;  3F2U A;  1PVO A;  4RMF A;  1OXU A;  5C3X A;  1VQ4 A;  3ND9 A;  4DF7 A;  3F1Z A;  3OIQ A;  1X56 A;  1G2S A;  2C9O A;  2IPK D;  3PIO A;  1YJN A;  2ZTE A;  4IUN A;  3L9A X;  1HTP A;  3SK6 A;  3TP5 A;  3P7J A;  4APV A;  3J81 E;  1QUQ A;  5K5P A;  1KTK A;  3K59 A;  3CCL A;  3GTK H;  4JOI A;  4YHH L;  3P1H A;  2UXB Q;  3PO3 B;  1GKH A;  4HID A;  1PYB A;  2PYK A;  4A3M G;  2E2J H;  3J80 E;  2O5J C;  3E3X A;  5CV8 A;  1YIJ A;  4OWW B;  3OW2 A;  1BVS A;  2SNM A;  3Q22 A;  4KKU A;  5C0X J;  1WJJ A;  4DN4 M;  4I65 A;  4IUP A;  1SND A;  4KHP L;  2H1E A;  3HOU G;  4DK0 A;  2AKW B;  1KD1 C;  5C0X H;  2N78 A;  1VQL A;  1UWV A;  1WI5 A;  2HQE A;  5LMN L;  4A93 H;  2HQL A;  3J81 c;  2IHF A;  3S16 H;  1XWE A;  1CFM A;  5M9O A;  1ASY A;  5CV9 A;  1WTP A;  1VQA A;  1OXX K;  2Z8L A;  2X6L A;  1QUQ B;  4H02 A;  1B44 D;  3J80 c;  2YV5 A;  3F2C A;  5F2D A;  1JJC B;  3RN5 A;  1DD2 A;  4NXM Q;  4OXP A;  3I73 A;  2RDG A;  2LSS A;  2LKV A;  3BZD B;  2A68 D;  2KEN A;  2ZJP A;  4DV6 Q;  1WTW A;  1ML0 D;  4GNX A;  3BG3 A;  5E1F A;  1SNC A;  5IYC G;  1KXL A;  5FOB B;  1YHA A;  1LT3 D;  4FYD A;  1XX8 A;  1PRT B;  1P16 A;  3CU7 A;  2R7Z H;  2BE5 C;  4R4Q A;  1JE4 A;  5JOB A;  3I7F A;  3OPO A;  1T9H A;  2L15 A;  2EYF A;  1PTO F;  2CH4 W;  1PA6 A;  2JA6 B;  1GUG A;  2F03 A;  2DNC A;  1O80 A;  1SXT A;  3FEW X;  3SR1 A;  4GOP A;  1LT6 D;  1LYL A;  3S2H B;  2PMZ B;  1AZQ A;  1R4P B;  3U4V A;  3HOZ H;  2PQE A;  4RGO S;  1E1T A;  4JI6 Q;  2UXB L;  1AEX A;  2E74 C;  4S3S A;  1BOS A;  4B3M Q;  4A3L H;  1EYA A;  3STB D;  1KNE A;  3PO2 B;  4QGU A;  3PUX A;  1DOM A;  1CZW A;  2PW5 A;  4H7B A;  1G8Z D;  1VF5 C;  1TVX A;  5EPL A;  5JVG 3;  1HZC A;  1V8Q A;  4QMG A;  4GZY C;  2B63 H;  3RZD B;  4EVO A;  1STN A;  4C56 C;  1MSG A;  2VXW A;  5EKL A;  3HEJ A;  4OEL B;  3K5O A;  1HNX Q;  1AP0 A;  3MVV A;  1Q86 C;  4O0A A;  1XXG A;  4MIU A;  4FDB A;  3MXN B;  1JB3 A;  3KBX A;  2OF1 A;  4A3G B;  1RDP D;  3ERS X;  2F4V Q;  4J6H A;  4A4I A;  2L9H A;  4PZ7 A;  4V0B A;  4XXE A;  5COY A;  3PSI A;  4JBK A;  1YJW A;  1Y1V G;  2KUM A;  3M4Q A;  1XTC D;  4NXM L;  1G91 A;  2A73 B;  3EVQ A;  1UEA B;  4DUY Q;  3HOW G;  1L0Y B;  5A35 A;  1DGS A;  2O4X A;  4DV6 L;  5FLM G;  1JOQ A;  3CF5 A;  2JXM B;  3NHH A;  2RDH A;  4CHT B;  2IJ0 A;  3RLN A;  2UXC Q;  1FVI A;  5C6A A;  2B2W A;  4YY3 Q;  4M8A A;  2JA5 B;  1C4Q A;  2IX1 A;  3RLO A;  2A6E D;  4IFD I;  2I5H A;  1FL0 A;  4FNF A;  2P5Z X;  4YCW A;  4XDX A;  3PUZ A;  3LGJ A;  2DGY A;  3NP8 A;  2MJ8 A;  4ODG A;  1HH2 P;  2VQF Q;  5C44 H;  2JA6 H;  5ELE A;  3PIP 3;  4JI6 L;  3OMC A;  2EY5 A;  1BCP B;  1V1P A;  4B3M L;  3S2H H;  3MXG A;  3U9S A;  2K7V A;  4XQJ A;  3CCU A;  1TS5 A;  2V4D A;  4QB4 A;  4HMJ A;  4FXG C;  4Z9C B;  3MC0 B;  3TP7 A;  3Q24 A;  4L8J A;  4IZ8 A;  3BYY B;  1JWS D;  4X62 L;  1A62 A;  1VMC A;  1I6H B;  1HNX L;  1U0L A;  4N9P A;  4A3M H;  3AB9 A;  1VQ8 A;  3H0G B;  4A76 A;  1WCM B;  4ZYS A;  1SYF A;  4DU9 A;  1CHP D;  2A8V A;  1VQI A;  1EQV A;  4XQQ A;  4A3G H;  1RJT A;  3HOU H;  4KHV A;  1Y8N B;  2NVQ B;  1GJX A;  2K5N A;  5CV5 A;  2RBM A;  4ILW A;  2L4N A;  3IFT A;  1JR0 D;  2DN8 A;  3I72 A;  1HRJ A;  1KL9 A;  2QCP X;  4JI2 Q;  4K6D A;  2JEB I;  1XNR Q;  5C3E B;  4CDD C;  2BH8 A;  4PNY A;  1TII D;  3I2Z A;  4YCV A;  4A3C G;  2UXC L;  2GN5 A;  4YY3 L;  1RL2 A;  4WRD A;  1PYW D;  1ZXT A;  1Z9F A;  1OXT A;  1U4P A;  4YWK A;  3VYR A;  5BN5 A;  3PIO 3;  3ZYY X;  1D6E C;  5A2Q L;  4IPC A;  1MD2 D;  2B8G A;  2WB1 B;  4EGV A;  2OQK A;  2VQF L;  1Y69 U;  5IYC H;  1YNN D;  3GTQ B;  2L55 A;  1WTX A;  4NXN Q;  1E7Z A;  1GUO A;  2WB1 E;  1XPU A;  5E7N A;  4X64 Q;  2D0O A;  1GUW A;  4EQO A;  4JK1 C;  1KQS A;  4ZKC B;  4KN4 C;  1VQO A;  3L7Z C;  1CQV A;  2XSC A;  4HR7 B;  4M1U B;  1SBB B;  2PO4 A;  4AQY Q;  4C2M H;  4IUQ A;  1DZ1 A;  1CKO A;  2RCF A;  4DR2 L;  4B3S Q;  5CBE E;  5M3M G;  3I4M G;  3WDN A;  2VUM G;  2QA4 A;  2B2V A;  1RCV D;  4UPA A;  4BA1 I;  2F3W A;  2EYL A;  3ITP A;  2N55 A;  3GTO B;  4ID6 A;  3OW7 A;  5DM6 3;  3GV6 A;  5CV4 A;  2AUK A;  1VQ5 A;  5C4X G;  2NVY H;  3S17 H;  2NUC A;  2ASB A;  4C3H B;  3RMH A;  3H0G H;  1CA5 A;  1WCM H;  1X55 A;  5AFW A;  1RTN A;  1E22 A;  3AU7 A;  3DXJ C;  1O7I A;  1K8A C;  1UE1 A;  1NMG A;  1PZJ D;  4C3J G;  2XNA C;  2R92 B;  4JV5 Q;  3E9H A;  3CPF A;  4OEM B;  1VQ7 A;  2KJX A;  3P20 A;  1XNR L;  2E2I H;  1VMP A;  4RFB A;  2M00 A;  3C1F A;  1Y1V H;  2HIV A;  1KHI A;  2KVM A;  1CKM A;  3KOJ A;  4EQ5 A;  2F0M A;  1ENA A;  1KC8 C;  2GVA A;  1FGB D;  3HOW H;  1HCZ A;  2PNR C;  4DK3 C;  3BVZ A;  5GAD C;  3MXP A;  2KBN A;  5FLM H;  2ZXO A;  1SN8 A;  4AYB G;  1MGS A;  3QJY A;  2RQX A;  2ZTD A;  3H6M A;  3NWS A;  1ROD A;  3HKZ G;  4PZ8 A;  5J22 A;  5LMU Q;  2K5V A;  1TWA H;  3EFX D;  1EWC A;  4NXN L;  4HJ5 A;  2EY1 A;  1BF4 A;  1EY8 A;  3Q6S A;  1XMQ Q;  1L2F A;  1N34 Q;  4IFD H;  4X64 L;  3VYU A;  3F2D A;  3DM3 A;  1A3V A;  2JA7 G;  1EY6 A;  4ULL A;  1KRT A;  5JJI A;  1BBW A;  1IW7 D;  3A5U A;  1Q81 C;  3Q0A A;  4AQY L;  3HOV G;  5M5W H;  2Z6K C;  1SE8 A;  4P2C B;  4DAV A;  2XRQ D;  4B3S L;  2WP8 J;  5DNF A;  1YIT A;  4FF2 A;  4LAA A;  1DJR D;  2N3S A;  1Z6H A;  5C4J B;  1ESR A;  5KND A;  3DWP A;  4DNI A;  2EZV A;  1M1K C;  1NE3 A;  3NBI A;  2WAQ B;  3K80 C;  1ILQ A;  2WIN B;  1CSP A;  1W3S A;  1CK1 A;  3SK5 A;  2KCT A;  3HKS A;  4I7A A;  4LJZ C;  5ELN A;  2AMC B;  4A3F G;  1SNQ A;  2NBF A;  5IGD A;  2CCZ A;  4X3T A;  3GD7 A;  1QVF A;  2WAQ E;  5IT9 c;  4PMC A;  4NP5 A;  1KDA A;  1QVG A;  3H3V C;  1Q7Y C;  1WTV A;  2WV6 D;  5FK9 C;  1SAP A;  1FD7 D;  1SRU A;  1TY2 A;  2PCF B;  4JV5 L;  3LWE A;  1VQ9 A;  1BBX C;  4A3J B;  3BS1 A;  4B08 A;  4QF4 A;  1YNX A;  1IBL L;  1EY5 A;  1E24 A;  3IFD A;  3Q8D A;  3NQI A;  1J9O A;  4P75 A;  1H95 A;  3IAY A;  5EPJ A;  2G9D A;  1RF2 D;  3J81 L;  1LTL A;  1PRT C;  1BDO A;  4OIJ A;  3T13 A;  1B70 B;  1PXU A;  1TWG B;  2YU9 H;  1HA6 A;  1PFN A;  4JI7 Q;  1CSQ A;  1CHQ D;  4P73 A;  1KLU D;  5I9P A;  3K6O A;  4BY7 B;  3AFP A;  3J80 L;  1ICF B;  4O42 A;  5LMU L;  4A3C H;  3KLS X;  1Z7T A;  1IZ6 A;  1SFO H;  1N34 L;  1JWM D;  2F0N A;  3F8T A;  1BR9 A;  5FO9 B;  1AH9 A;  5IE8 A;  4IQZ A;  2HCI A;  3K7A H;  3GTG B;  1TR5 A;  2K5W A;  1BBU A;  1QG7 A;  4JCV E;  4DAP A;  1VQK A;  5AJ3 Q;  1EU4 A;  4LWC A;  5IGB A;  1ZYR C;  1LTS D;  4HAE A;  1LUZ A;  3GTP B;  3DHQ A;  4A3D G;  5D65 A;  2FMM A;  4DV7 Q;  4PMB A;  4PV1 C;  3WWV A;  4WJ4 A;  4DPG A;  4KHZ A;  1EY9 A;  4F88 A;  4LFA Q;  3S14 B;  2D62 A;  1AW7 A;  2EYM A;  4ALP A;  2OEO A;  1F9R A;  1D5Z C;  1X3Q A;  5M3M H;  2VUM H;  3B6Y A;  4IPH A;  2YTY A;  4CDF C;  2VQE Q;  1JB7 A;  2F0E A;  2JA8 B;  2NVX H;  1B50 A;  1DYQ A;  4P71 A;  3F2B A;  2CWP A;  4NKL A;  2VS1 A;  1UEB A;  1WVL A;  3PO3 G;  2R93 B;  1F9P A;  3ULL A;  2CQO A;  4IJL A;  2UU9 Q;  2A68 C;  1XPR A;  4ZAI A;  4GLX A;  2ENB A;  4KY5 A;  1I6V C;  3NEM A;  3H09 A;  3QB3 A;  5M3F B;  2WII B;  4JI7 L;  1C7Y A;  1IYJ B;  3JC6 6;  2V1C C;  4LF9 Q;  4UAI A;  3H94 A;  1W2B A;  4KV6 A;  4QJF A;  2SDF A;  2QEX A;  2KHI A;  2F0T A;  2XTI A;  3ICE A;  2PNH A;  1IBM Q;  3QO2 A;  4PQX A;  5ELD A;  2JSO A;  1K28 A;  2OTJ A;  1ZKO A;  2IX0 A;  1WTH A;  5GAE C;  3H3V I;  1MBY A;  5D14 A;  1BNZ A;  5LMN Q;  4UP8 A;  1D1K A;  4R9W A;  5HGT A;  1EYC A;  1SDF A;  3FPP A;  5AJ3 L;  4FF4 A;  2SNS A;  3G7L A;  1HR0 Q;  1B8A A;  2Z6B A;  4WJW A;  4A3I B;  4RHS A;  2MFI A;  3GTG H;  1SJH D;  1QWY A;  1NNX A;  2AUJ D;  3VR3 A;  1ZEQ X;  2B2T C;  1SR3 A;  1S3O A;  1NAP A;  4DV7 L;  3UDF A;  1GUN A;  1LT5 D;  3KUP A;  1YEZ A;  2JA7 H;  5K36 G;  3ZJY C;  3GP7 A;  4DK6 C;  1UAP A;  2J4X A;  3BDO A;  4RG1 A;  3TS2 A;  2RCN A;  2B2W C;  1SJE D;  1I4X A;  3GO5 A;  4LFA L;  1FNU A;  5JJZ A;  2IW3 A;  3CCV A;  4LFC Q;  5EPK A;  3DUZ A;  3HOV H;  3K7U C;  3S15 B;  3IKJ A;  5CGK A;  2JA6 G;  1NJI C;  3SHL A;  1HNZ Q;  2B39 A;  1MJC A;  4L6T B;  1PH1 A;  1SE4 A;  2VQE L;  2VY3 A;  4CKC A;  2VL6 A;  2B2U C;  1I50 H;  1MJE A;  4P72 A;  1YJ9 A;  1GD7 A;  2KOL A;  5JVH 3;  4TRD A;  2HUG A;  3HRZ C;  3VR4 A;  3E6Z X;  2E2H B;  4U68 A;  2JA8 H;  2EYP A;  5M5X B;  4OIK A;  2JQO A;  1TU2 B;  4A3F H;  3OHX C;  5FLX E;  5JPM C;  2UU9 L;  3M85 A;  3PO2 G;  3U50 C;  5C3W A;  4HCE A;  4TSS A;  1PMR A;  1F2L A;  4N8F A;  3P75 A;  4FF3 A;  1LM0 A;  2KCN A;  4XYQ A;  1ZYR D;  1GXD C;  4FP5 D;  4ME3 A;  3T1H Q;  3HOY B;  3KF6 A;  1V43 A;  4LF9 L;  3CRL C;  2A6E C;  5M3F H;  4UDU C;  4IN3 A;  1E2V A;  4A3G G;  4R8N A;  1B1Z A;  2MO0 A;  3EJI A;  1IBM L;  1RIP A;  5J3B A;  3UE0 A;  4QY7 A;  2F0J A;  4JI5 L;  3PGZ A;  5JJK A;  3FPU B;  5FLX c;  1ASZ A;  3DEP A;  2UUB Q;  2AHO B;  4KLK A;  3AMU A;  1HR0 L;  4IOC A;  2EDG A;  2F3V A;  3A56 A;  3UDX A;  3U4Z A;  1PFM A;  4DXG A;  3D8G A;  1PRT F;  1K83 H;  3FMC A;  1BO0 A;  1EQT A;  4A3K B;  1L1O A;  1M90 C;  4MHE A;  4BBR B;  4A3B B;  3A8I E;  5EBD A;  3A55 A;  1E2W A;  3JAM c;  4LFC L;  4RA8 A;  1EWH A;  1I4Q A;  1NY4 A;  4NMZ A;  2JA5 G;  1K8M A;  4KKS A;  5KEE A;  2HDM A;  1HNZ L;  4A3D H;  3KDF A;  4UHV A;  1WFQ A;  1KAW A;  4FVM A;  4C3I B;  4RGM A;  5BR8 Q;  3S15 H;  2TSS A;  2A6H D;  1DOL A;  2F52 A;  1ENF A;  4DV2 Q;  2B3G A;  3A7L A;  3MEF A;  1DXM A;  2OQ0 A;  4B3T Q;  2K52 A;  1HFG A;  1VQC A;  1N36 L;  3KFU A;  2HD3 A;  3S1M B;  5FO8 B;  2G5D A;  5JEA H;  3OOC A;  3ERQ A;  3TP6 A;  3CHB D;  1BCP D;  2RSN A;  4XYO A;  4QIW E;  5ELF A;  1K8G A;  1CQF A;  1JE5 A;  3MA2 B;  5EJW A;  1GHJ A;  1D5X C;  3A54 A;  3T1H L;  1TWC B;  2Z0S A;  1Q1E A;  4XT1 B;  1WYD A;  3PO3 H;  1BUV T;  4GNX B;  1PYS B;  1JIC A;  3K58 A;  1UUP A;  2F0O A;  3H0G G;  1WCM G;  3PV0 A;  3I91 A;  1XYI A;  4X62 Q;  3VYT A;  1ICW A;  2VB3 X;  1U9R A;  3J7A 5;  4G7H C;  4DGZ A;  2JN4 A;  4DNT B;  1YNN C;  1PTO B;  3QWN A;  1RTO A;  5C5M A;  1CA6 A;  4K0K Q;  1QJO A;  3D0F A;  2UUB L;  4BBS B;  2DJF C;  4L5Q A;  1D1I A;  4OWT B;  4GOP B;  3I4O A;  3TS0 A;  1PFS A;  3V96 A;  1E1O A;  2I46 A;  1PFB A;  1Y8P B;  4KTA A;  3J7Y W;  2F0S A;  2K5Q A;  4JI0 L;  3TQY A;  3UDG A;  3FKI B;  2I5M X;  3H3V H;  2ALY B;  3RZO B;  2KED A;  5J1Z A;  3NTH A;  2Z4I A;  4A3K H;  1S5F D;  1EIF A;  2B8F A;  2LXJ A;  3RD4 A;  3G6J B;  1VDZ A;  3PUV A;  1K8O A;  4JBM A;  3NTK A;  3OMG A;  3TRE A;  1T5X D;  2WB1 G;  4IJH A;  3WOE A;  2LS0 1;  5L37 A;  4JVZ A;  5BR8 L;  3K5L A;  2BA1 A;  3G48 A;  1G29 1;  4IFD G;  5K36 H;  4K6L A;  2A69 D;  1N32 Q;  4DV2 L;  1DM0 B;  2K75 A;  4K5X A;  1VF7 A;  1A8V A;  4JBJ A;  3CQZ B;  4LK1 C;  4HCS A;  4B3T L;  2VW9 A;  2CW0 D;  2K04 A;  1K0R A;  1O7Y A;  2BA0 A;  4QCL A;  1QOH A;  3R2I A;  4NW2 A;  1STG A;  4B3R Q;  3KYH C;  1Y14 B;  3KF8 A;  5I9O A;  1WTO A;  2NN6 G;  2NN6 I;  4ZUI A;  3CCJ A;  4C1N I;  1RD9 D;  1AE3 A;  2XIW A;  1TWC H;  1Q8K A;  4NDX A;  2CVR A;  2ZXR A;  4MZ9 A;  3R2T A;  3PO2 H;  4EQP A;  4B9W A;  3CAM A;  3S24 A;  4EX5 A;  2D0P A;  4DR2 Q;  1PV4 A;  1QNK A;  3KK7 A;  1HPC A;  1SRO A;  1C0A A;  1X65 A;  4C3H G;  4K0K L;  2IX3 A;  4HSP A;  4IPD A;  5I2X A;  3RZD H;  2RHS B;  1HZA A;  1A2T A;  3D4R A;  3K0X A;  3MEH A;  3RLF A;  1EYG A;  3VA5 A;  1K3R A;  1PH6 A;  1IW7 C;  1V1Q A;  1V1P B;  2F0V A;  3CP0 A;  3NEL A;  1ET9 A;  3CCS A;  1ONL A;  2Q2H A;  5EAY A;  1R9T B;  5KNB A;  2MNA A;  5ELO A;  1TT2 A;  2HHH Q;  1BKB A;  1EUJ A;  1PH4 A;  2RDF A;  3RZO H;  1NR2 A;  4CKB A;  1U4L A;  1SNO A;  2QDB A;  3T16 A;  5NUC A;  1FNW A;  3AEV A;  1W6J A;  4J1M A;  4A3E B;  3R3O A;  1N32 L;  3G4S A;  2YYZ A;  2DY8 A;  2JA5 H;  1Q8I A;  3EIV A;  3CCR A;  4PG3 A;  3OYY A;  3TRZ A;  1LTA D;  2VB2 X;  4DV1 Q;  3E9I A;  3CCQ A;  2WKD A;  5DEH A;  4CDE C;  2UXD Q;  1YZ6 A;  1YHQ A;  4B3R L;  1WD0 A;  1H9S A;  2ZJR A;  5CMD A;  2JA9 A;  1D2B A;  3DLL A;  4UP9 A;  1CTM A;  4RGN A;  2LXK A;  4F7X A;  1TS2 A;  2WAQ G;  1JOR A;  4BY1 B;  4DNR B;  2Y0S B;  2MGS A;  4DKA C;  2PZU A;  3HP3 A;  3DEO A;  3AFQ A;  5CYU A;  4DR4 Q;  1U4R A;  1I6H H;  1HNW Q;  1HUN A;  4YIJ A;  3CXC A;  1QZG A;  4A75 A;  4YWM A;  2K32 A;  1JQY D;  2RKS A;  2Y0S E;  4DV3 Q;  2AQ3 B;  3GTL B;  4A3J G;  3VR5 A;  3R8B A;  3D3R A;  1OTC A;  3OWF A;  3I4N B;  1KAB A;  5DAU A;  4KK7 A;  1G51 A;  4ZQ3 A;  2NVQ H;  2M2L A;  2HHH L;  1PDQ A;  5IIF A;  3S1Q B;  2BOS A;  1D7Q A;  5KNC A;  1IBL Q;  1EL0 A;  2EXD A;  4BY7 G;  1CZG A;  5C3E H;  4CJ2 C;  3TEH B;  5KRU A;  2DJG C;  2OTL A;  1U4M A;  1IYU A;  1CI3 M;  3QR8 A;  2DUD A;  4IO9 A;  5M5Y B;  4DV1 L;  1JWU D;  2ZT9 C;  1IXR A;  4IFD J;  1LTT D;  3TBI B;  2BDN A;  3C2P A;  2UXD L;  4I7Z C;  2D9U A;  4X3K A;  4HIM A;  1SYG A;  4DV0 Q;  1HZB A;  3A8K E;  1B9N A;  4UY8 C;  1YNJ C;  5IOC A;  3RNU A;  4F8M A;  3GTQ H;  5IGC A;  1M4V A;  1Q12 A;  5IT9 E;  1JMC A;  2JE6 I;  4LF6 Q;  1A6X A;  2DNE A;  4J8Q A;  4GKJ L;  5C5L A;  4RWS C;  1LAC A;  4BS9 A;  4ZKB B;  2I5L X;  3CME A;  1K3B C;  3MXU A;  3C46 A;  4OX9 Q;  2SEB D;  1T5E A;  4G57 A;  4DR7 Q;  2LMC B;  4DR5 Q;  4ME5 A;  1IBK Q;  1J6Q A;  2NN6 H;  4DR4 L;  3EA6 A;  1HNW L;  1HXY D;  5ELB A;  3FRP B;  4IUR A;  2Q8R E;  2JA8 G;  5JAV A;  1D8L A;  3GTO H;  3V2T A;  4DUZ Q;  4J15 A;  4DV3 L;  4HJA A;  3NEN A;  2OWO A;  4Q5V A;  3GTM B;  1EQR A;  4DXF A;  1F9Q A;  1W6K A;  4IUT A;  1J8I A;  1BXT A;  2R93 G;  1I4R A;  1EWI A;  4RGT A;  1S4Z A;  4C3H H;  1B9M A;  2NVT B;  4GLA C;  4HJ7 A;  4ABN A;  2I0Q A;  1SYE A;  3A74 A;  5LMN W;  4JOI C;  1EY4 A;  3M4Y A;  3RN2 A;  3K57 A;  2IHE A;  5M3F G;  2Q8I B;  1EY0 A;  2BCO A;  2R92 H;  2XN9 C;  1QNU A;  2HCC A;  1HUM A;  3G6E A;  2B29 A;  5KYL A;  1Y1W B;  2KA7 A;  5I6Y A;  4CDC C;  1S5B D;  5H1S E;  2L1B A;  4K14 A;  1DON A;  1VCI A;  1A0I A;  1R4Q B;  1H9J A;  4DV0 L;  1VQN A;  2FFK B;  1SE3 A;  1MI2 A;  1AE2 A;  4QUF A;  4LMQ D;  5A2Q E;  1PHJ A;  4A3I G;  5IP9 G;  3S1N B;  4LF6 L;  2FJ2 A;  4LF7 L;  1HZ9 A;  3GV3 A;  1G6Z A;  3QG1 A;  2D2C C;  3A5Z B;  2TMP A;  2R3Z A;  1JJ2 A;  5I6W A;  5ISR A;  1V9P A;  4XT3 B;  3H15 A;  4OX9 L;  1SE2 A;  5EQ0 A;  1KDB A;  4GNX C;  4DR7 L;  4WJ3 M;  5COR A;  4DR5 L;  2K4K A;  4L63 B;  1FGU A;  3VA7 A;  2FXQ A;  4Y7N B;  2IL8 A;  4HIO A;  1S5C D;  3D6C A;  3BU2 A;  1N33 L;  1PZK D;  1IBK L;  3AYH B;  3AQQ A;  2G9H D;  2QEJ C;  4X3U A;  3SEB A;  2E2D C;  3ERO A;  3JAM i;  2JP1 A;  2F0Q A;  1O7L A;  1U5K A;  1PTO C;  4K2K A;  3DWA A;  5C4J H;  4DUZ L;  2N8N A;  1PH9 A;  3CC2 A;  4GOP C;  5JEA G;  1SYD A;  4L5S A;  3MFG A;  3LWU A;  3BVG A;  1IL8 A;  1I3Q B;  2EQS A;  1AN8 A;  3IRB A;  3KLS A;  3KBG A;  4WFN 3;  3E5S A;  2NVT H;  1YVC A;  1YNJ D;  2Q2U A;  1I4P A;  1LTG D;  2B2Y A;  2ID0 A;  3HOY G;  1NBW A;  4A3J H;  1VQH A;  4JC0 A;  3L0O A;  4IUU A;  4JI4 Q;  1AFP A;  2CHB D;  3NK9 A;  4GN3 B;  2RVL A;  2H4O A;  2EY6 A;  1TWG H;  2A6H C;  4KHP Q;  5D3I B;  2IT1 A;  2E2J B;  4IPG A;  1X3P A;  4BY7 H;  4ZLT F;  1TY0 A;  1EIH A;  1SLJ A;  4JI5 Q;  3PIP A;  1PH3 A;  2MUY A;  1CM9 A;  1BCP C;  4RH6 A;  1MKH A;  4A3K G;  3D6W A;  4BBR G;  3PQI A;  3S1N H;  4A3B G;  3VYS A;  4K5W A;  4FXK C;  1EZ6 A;  1EOV A;  4JYA Q;  4A93 B;  2F0L A;  2K33 A;  2WKC A;  3I90 A;  3S16 B;  3T53 B;  2F0P A;  5E3F A;  2PZT A;  3GTP H;  4LF5 Q;  5LHY 1;  1SYC A;  5CV7 A;  4RHR A;  3DMU A;  4C3I G;  1UE5 A;  3N52 A;  3D4W A;  1QZH A;  4R4I A;  2KHJ A;  1EQQ A;  1E3P A;  4OO1 G;  1CKN A;  4OO1 I;  3S14 H;  3J81 j;  1X3E A;  1JJG A;  1TWH B;  3EBE A;  2C35 B;  4JBW A;  4K2L A;  2AQ1 B;  3M7N A;  2F0U A;  2J7Z A;  5G3L D;  2Z6K A;  2R7Z B;  2F4I A;  4IOA A;  2F0H A;  3D31 A;  3W1G A;  1N36 Q;  3T51 B;  4ZRZ A;  3UI2 A;  2ZTC A;  2R93 H;  3PMF A;  2QW7 A;  1KLG D;  2R61 A;  3X3M A;  2QGQ A;  1LTI D;  2PPB C;  4JI4 L;  1B3Q A;  1E2Z A;  4ZUJ A;  3HOZ B;  1PH2 A;  2ICI A;  2GA4 B;  2N88 A;  2FIN B;  4ZCK A;  1CUK A;  2NYZ D;  4LUV A;  2A74 C;  2A69 C;  1O78 A;  4F87 A;  3JAM E;  1WD1 A;  2UUC Q;  1IHZ A;  4E6I A;  2LY7 A;  4BBS G;  1CKN B;  3ULJ A;  2F1M A;  1PTO D;  2CW0 C;  4LW1 A;  1ESF A;  5T1I A;  2QDL A;  1WTQ A;  1S72 A;  4HED A;  1LT4 D;  3FKI G;  4KJN A;  4G4K A;  5HUR A;  2B63 B;  4QQB X;  2X69 A;  4JI1 L;  4FO2 A;  4H0L C;  1MHW C;  4JI0 Q;  2Q2T A;  4G7Z C;  2YTV A;  4JYA L;  1VQF A;  2FMC A;  1JCK B;  2Z9H A;  1K0S A;  4K8J A;  4DA2 A;  1VQE A;  1K9M C;  4A3I H;  3MFY A;  5IP9 H;  4LF5 L;  3CD6 A;  2IWH A;  3KF6 B;  3GDE A;  5KGU A;  2YTX A;  1B3A A;  3SK8 A;  5G3L F;  4KI0 A;  1ILP A;  4R8I A;  1I94 Q;  1ET6 A;  1X54 A;  4IAL A;  5IGF A;  3E0J A;  2CQA A;  5IP7 H;  5E4W C;  3ULP A;  3HOX B;  3M4O B;  4QIW B;  5JEA J;  2J0T D;  1HTL D;  2A5H A;  5IWA L;  1TWH H;  4TVA B;  1B2T A;  2MHV A;  4KY7 A;  4X66 Q;  1LTR D;  4TKO B; 
#chains in the Genus database with same CATH homology
 4CJ0 B;  2VNU D;  3T56 B;  3MZ5 A;  1Q1B A;  2EYO A;  4U67 3;  1QB5 D;  4Q0F A;  2EOT A;  5C44 B;  3MXN A;  1M8A A;  3ND8 A;  2B2V C;  4HMI A;  5CC4 A;  1EFI D;  1EEI D;  1F2M A;  1SNM A;  3A8J E;  5IGE A;  1SEB D;  1NR4 A;  3HS0 C;  1EZ8 A;  4DAY A;  1Z47 A;  1S5D D;  5CR3 A;  1FYC A;  3SDZ A;  4HTH A;  2EY2 A;  4A3M B;  2K05 A;  1TS4 A;  2Z4H A;  2QKI C;  2XWJ B;  5CBA E;  1B4O A;  1QE6 A;  1SMY C;  3DM1 A;  3NXW A;  3TSS A;  3HOU B;  4CJ1 B;  3FDT A;  2R6G A;  1NUC A;  2XVS A;  5T1G A;  1SNP A;  4IUV A;  4H44 C;  4KJO A;  1BCP F;  3MWY W;  1STY A;  3C1E A;  1STB A;  1LLR D;  2B2T A;  4WOR A;  3HGB A;  1F2Z A;  1DOK A;  4OO1 H;  3HZX A;  4K5V A;  2MP1 A;  2F0F A;  1II3 A;  1X32 A;  2ZXP A;  3TN2 A;  1PLF A;  5IT9 L;  3PUY A;  4KD3 A;  2B2U A;  2K03 A;  2XRS D;  1B53 A;  2K6A A;  3OSO A;  3TDQ A;  1UNS A;  1KDC A;  4KKT A;  2Q8T A;  5EKK A;  1EOT A;  4C2M B;  1TS3 A;  1NSN S;  1EEF D;  5DM7 3;  3T4A C;  1PTO H;  2L5T A;  2C5C A;  2E76 C;  2JYO A;  2FHT A;  3HG9 A;  4G7O C;  2KEE A;  2NTT A;  3J7A V;  3H91 A;  2L11 A;  3VR2 A;  5CV6 A;  2NVY B;  3TME A;  3S17 B;  1HHV A;  3MAQ A;  3LNN A;  3FVQ A;  3K5M A;  2MPM A;  2BE5 D;  5FO7 B;  4K8I A;  3VR6 A;  2EPB A;  3ONA B;  4OL7 A;  5FKA C;  2K1B A;  2O2L D;  3URY A;  3MTS A;  4HN7 A;  5I4D A;  2O5I C;  1I4H A;  2E2I B;  2KHS A;  2M9V A;  3KLR A;  1HFN A;  3NSW A;  1Y1V B;  3S9W A;  4O1N A;  1QCB D;  3HOW B;  4DFA A;  2AWO A;  1C8C A;  1GOZ A;  1EIG A;  1TWA B;  2NTS A;  1HQR D;  3N6R A;  2K5D A;  2F0K A;  1SMY D;  4XQN A;  1F2Y A;  3NQT A;  3OIP A;  1Q3L A;  3NWT A;  5M5W B;  1A3T A;  3L3O C;  2F0D A;  3BDC A;  2RSO A;  3J7A F;  3I4L A;  5KYI A;  3NPP A;  2EYJ A;  1LO5 D;  2PW7 A;  3K5N A;  2K01 A;  1H9S B;  2B2Y C;  1Y8O B;  1DCZ A;  1BQQ T;  1QIL A;  1RHP A;  1LV9 A;  3CKI B;  3I70 A;  1A3U A;  2KEC A;  2QIL A;  1CT1 D;  3NE5 B;  1FNV A;  2OXP A;  4RKL A;  1C48 A;  2EVB A;  3NBH A;  2KQ3 A;  3BVM A;  4B9X A;  1FR3 A;  3CRK C;  1STH A;  3BYT B;  2AQ2 B;  4CKE A;  2YU9 B;  1MSH A;  4CGY B;  4MN3 A;  3U9O A;  2F0G A;  3X3N A;  2EE1 A;  1SFO B;  1L0X B;  1H9K A;  4DK1 A;  3K7A B;  5EGT A;  3D4D A;  3TZU A;  5BN4 A;  3A7A B;  3RUZ A;  4KMU C;  3I3C A;  1TKW B;  1H9R A;  3S2D B;  3GTJ B;  4FXD A;  1OXV A;  1IKL A;  4KD4 A;  2RA4 A;  1F77 A;  3PUW A;  5EKI A;  5IOD A;  4RKB A;  3QOL A;  4RAU C;  3QIA A;  1KAA A;  5J39 A;  4RCN A;  2NB0 A;  1HA5 A;  3O13 A;  4X3S A;  2AWN A;  1STE A;  1A15 A;  5M3M B;  3I4M B;  3DWQ A;  2VUM B;  4ZK9 B;  2NVX B;  2WAC A;  3TP8 A;  2LFN A;  2BDO A;  4XIG S;  5C4X B;  5FLX L;  4BWG B;  3OWE B;  1EYD A;  5TSS A;  5BN3 A;  5EBC A;  2DY7 A;  3LX0 A;  4PMW A;  1HQM C;  2L0C A;  5C4H A;  1KNA A;  1EY7 A;  1OO9 B;  2X6G A;  4C3J B;  1JC7 A;  1NCV A;  1O7Z A;  4V19 0;  1JOK A;  3IL8 A;  1LAB A;  3I8Z A;  5IGG A;  3Q23 A;  3S1R B;  1EU3 A;  2OT2 A;  3JAM L;  5C0X G;  5C0X I;  1GUS A;  1TWF B;  5C4Z A;  3M3Y B;  1RKN A;  2PZW A;  4OGQ C;  2E75 C;  1V1O A;  1S5E D;  3SE0 A;  4AYB B;  4OHJ A;  2QF7 A;  1D5M C;  3HKZ B;  3K0Y A;  2SOB A;  5JPN C;  3GQB A;  3W3A A;  3EQL C;  2JA7 B;  3SVM A;  3NUC A;  4TQU S;  2EJM A;  2EJF C;  4RCO A;  1STA A;  3SXH A;  2HDL A;  3HOV B;  3QOJ A;  4KN7 C;  4C1N K;  1LTB D;  2F0I A;  3NTI A;  2JEA I;  1WTR A;  3WOF A;  4EQN A;  2EJG C;  2EXZ A;  1I50 B;  4N9T A;  5E4X A;  2KCC A;  3MHB A;  3TZD A;  4QUC A;  4A3F B;  1JOO A;  2D5D A;  5LL6 S;  4CBV A;  1GUT A;  3GTK B;  3SK4 A;  2XWB B;  5ELC A;  1OXS C;  1ENC A;  4KY6 A;  1F9S A;  2Z1C A;  1GHK A;  3BDL A;  2ICE C;  5KIX A;  4FF1 A;  1TQO A;  3C3L A;  5I2Y A;  1A2U A;  1Q90 A;  2NZ1 D;  2I07 B;  4BA2 I;  1AZP A;  4HSV A;  3W2D A;  1G2T A;  1K83 B;  1SYB A;  1IKM A;  1E0B A;  5LL6 X;  2NWG A;  4H13 C;  2L12 A;  2F0W A;  1H9M A;  1PZI D;  1IYV A;  1SSO A;  4A3D B;  3R93 A;  3M7G A;  1PRT D;  3V05 A;  2K28 A;  2EYH A;  4XTC S;  1I4G A;  5D3D A;  3F2U A;  1OXU A;  5C3X A;  3ND9 A;  4DF7 A;  3OIQ A;  1G2S A;  2C9O A;  2IPK D;  4IUN A;  3L9A X;  1HTP A;  3SK6 A;  3TP5 A;  3P7J A;  3J81 E;  5K5P A;  1KTK A;  3K59 A;  3P1H A;  3PO3 B;  2PYK A;  3J80 E;  2O5J C;  5CV8 A;  2SNM A;  3Q22 A;  4KKU A;  5C0X J;  4DN4 M;  4I65 A;  4IUP A;  1SND A;  2H1E A;  4DK0 A;  5C0X H;  2HQE A;  1XWE A;  1CFM A;  5M9O A;  5CV9 A;  1WTP A;  2Z8L A;  1OXX K;  2X6L A;  1B44 D;  5F2D A;  1DD2 A;  3I73 A;  2RDG A;  2LKV A;  3BZD B;  2A68 D;  1WTW A;  1ML0 D;  3BG3 A;  5E1F A;  1SNC A;  5FOB B;  1LT3 D;  4FYD A;  1XX8 A;  1PRT B;  3CU7 A;  2BE5 C;  1JE4 A;  5JOB A;  3OPO A;  2EYF A;  1PTO F;  2JA6 B;  1GUG A;  2F03 A;  2DNC A;  1O80 A;  1SXT A;  3FEW X;  3SR1 A;  1LT6 D;  3S2H B;  2PMZ B;  1AZQ A;  1R4P B;  2PQE A;  4RGO S;  1AEX A;  2E74 C;  4S3S A;  1BOS A;  1EYA A;  1KNE A;  3PO2 B;  3PUX A;  1DOM A;  1CZW A;  2PW5 A;  4H7B A;  1G8Z D;  1VF5 C;  1TVX A;  5EPL A;  5JVG 3;  1V8Q A;  4QMG A;  4GZY C;  3RZD B;  4EVO A;  1STN A;  4C56 C;  1MSG A;  2VXW A;  5EKL A;  3HEJ A;  3K5O A;  1AP0 A;  3MVV A;  1XXG A;  4MIU A;  1JB3 A;  3KBX A;  2OF1 A;  4A3G B;  1RDP D;  4J6H A;  2L9H A;  4V0B A;  4XXE A;  5COY A;  2KUM A;  1XTC D;  1G91 A;  2A73 B;  3EVQ A;  1UEA B;  1L0Y B;  5A35 A;  2O4X A;  1JOQ A;  2JXM B;  3NHH A;  2RDH A;  4CHT B;  2IJ0 A;  5C6A A;  2B2W A;  4M8A A;  2JA5 B;  1C4Q A;  2IX1 A;  2A6E D;  4IFD I;  4FNF A;  4XDX A;  3PUZ A;  3NP8 A;  2MJ8 A;  4ODG A;  5ELE A;  3PIP 3;  3OMC A;  2EY5 A;  1BCP B;  1V1P A;  3MXG A;  3U9S A;  2K7V A;  4XQJ A;  1TS5 A;  2V4D A;  4QB4 A;  4HMJ A;  4FXG C;  4Z9C B;  3MC0 B;  3TP7 A;  3Q24 A;  4L8J A;  4IZ8 A;  3BYY B;  1JWS D;  1VMC A;  1I6H B;  4N9P A;  3AB9 A;  3H0G B;  1WCM B;  4ZYS A;  1SYF A;  4DU9 A;  1CHP D;  1EQV A;  4XQQ A;  1RJT A;  4KHV A;  1Y8N B;  2NVQ B;  1GJX A;  5CV5 A;  2RBM A;  4ILW A;  2L4N A;  3IFT A;  1JR0 D;  2DN8 A;  3I72 A;  1HRJ A;  2QCP X;  4K6D A;  2JEB I;  5C3E B;  4PNY A;  1TII D;  4WRD A;  1PYW D;  1ZXT A;  1OXT A;  1U4P A;  3VYR A;  5BN5 A;  3PIO 3;  3ZYY X;  1D6E C;  5A2Q L;  1MD2 D;  2B8G A;  2WB1 B;  4EGV A;  1Y69 U;  1YNN D;  3GTQ B;  2L55 A;  1WTX A;  1GUO A;  1GUW A;  4EQO A;  4JK1 C;  4ZKC B;  4KN4 C;  3L7Z C;  1CQV A;  2XSC A;  4HR7 B;  4M1U B;  1SBB B;  2PO4 A;  4IUQ A;  1DZ1 A;  5CBE E;  3WDN A;  2B2V A;  1RCV D;  4BA1 I;  2F3W A;  2EYL A;  3ITP A;  2N55 A;  3GTO B;  4ID6 A;  3OW7 A;  5DM6 3;  3GV6 A;  5CV4 A;  2AUK A;  2NUC A;  4C3H B;  3RMH A;  1CA5 A;  5AFW A;  1RTN A;  3AU7 A;  3DXJ C;  1PZJ D;  4C3J G;  2XNA C;  2R92 B;  2KJX A;  3P20 A;  1VMP A;  4RFB A;  2M00 A;  3C1F A;  2KVM A;  2F0M A;  1ENA A;  1FGB D;  1HCZ A;  2PNR C;  3BVZ A;  3MXP A;  2ZXO A;  1MGS A;  3QJY A;  2RQX A;  3H6M A;  3NWS A;  1ROD A;  5J22 A;  3EFX D;  1EWC A;  2EY1 A;  1BF4 A;  1EY8 A;  3Q6S A;  4IFD H;  3VYU A;  1A3V A;  1EY6 A;  4ULL A;  1IW7 D;  3Q0A A;  4P2C B;  4DAV A;  2XRQ D;  2WP8 J;  5DNF A;  4FF2 A;  4LAA A;  1DJR D;  1Z6H A;  5C4J B;  1ESR A;  5KND A;  3DWP A;  2EZV A;  3NBI A;  2WAQ B;  1ILQ A;  2WIN B;  3SK5 A;  1CK1 A;  4LJZ C;  1SNQ A;  2NBF A;  5IGD A;  4X3T A;  3GD7 A;  4PMC A;  4NP5 A;  1KDA A;  3H3V C;  1WTV A;  2WV6 D;  5FK9 C;  1SAP A;  1FD7 D;  2PCF B;  1TY2 A;  3LWE A;  1BBX C;  4A3J B;  3BS1 A;  4B08 A;  4QF4 A;  1EY5 A;  3IFD A;  3NQI A;  1J9O A;  3IAY A;  5EPJ A;  2G9D A;  1RF2 D;  3J81 L;  1PRT C;  4OIJ A;  1BDO A;  3T13 A;  1PXU A;  1TWG B;  1HA6 A;  1PFN A;  1CHQ D;  5I9P A;  1KLU D;  3K6O A;  4BY7 B;  3J80 L;  4O42 A;  3KLS X;  1Z7T A;  1JWM D;  2F0N A;  1BR9 A;  5FO9 B;  4IQZ A;  2HCI A;  3GTG B;  1TR5 A;  2K5W A;  1QG7 A;  4DAP A;  1EU4 A;  5IGB A;  1ZYR C;  1LTS D;  4HAE A;  3GTP B;  3DHQ A;  5D65 A;  2FMM A;  4PMB A;  4PV1 C;  4KHZ A;  1EY9 A;  4F88 A;  3S14 B;  2D62 A;  1AW7 A;  2EYM A;  2OEO A;  1F9R A;  1D5Z C;  1X3Q A;  2JA8 B;  2F0E A;  1B50 A;  1DYQ A;  4NKL A;  1WVL A;  2R93 B;  1F9P A;  2A68 C;  4ZAI A;  2ENB A;  4KY5 A;  1I6V C;  3H09 A;  3QB3 A;  5M3F B;  2WII B;  4UAI A;  3H94 A;  4KV6 A;  2SDF A;  2F0T A;  3QO2 A;  4PQX A;  5ELD A;  2JSO A;  1ZKO A;  2IX0 A;  1MBY A;  5D14 A;  1BNZ A;  1D1K A;  4R9W A;  5HGT A;  1EYC A;  1SDF A;  3FPP A;  4FF4 A;  2SNS A;  3G7L A;  4WJW A;  4A3I B;  4RHS A;  1SJH D;  1QWY A;  2AUJ D;  3VR3 A;  1ZEQ X;  2B2T C;  1NAP A;  1GUN A;  1LT5 D;  3KUP A;  5K36 G;  3GP7 A;  1UAP A;  2J4X A;  3BDO A;  2B2W C;  1SJE D;  1I4X A;  3GO5 A;  1FNU A;  5JJZ A;  2IW3 A;  5EPK A;  3DUZ A;  3S15 B;  3IKJ A;  5CGK A;  3SHL A;  2B39 A;  4L6T B;  1SE4 A;  4CKC A;  2B2U C;  2KOL A;  5JVH 3;  4TRD A;  2HUG A;  3HRZ C;  3VR4 A;  3E6Z X;  2E2H B;  4U68 A;  2EYP A;  5M5X B;  4OIK A;  1TU2 B;  3OHX C;  5FLX E;  5JPM C;  3M85 A;  5C3W A;  4HCE A;  4TSS A;  1PMR A;  1F2L A;  3P75 A;  4FF3 A;  2KCN A;  4XYQ A;  1ZYR D;  1GXD C;  4FP5 D;  3HOY B;  1V43 A;  3CRL C;  2A6E C;  4UDU C;  4IN3 A;  1E2V A;  4R8N A;  1B1Z A;  3EJI A;  2F0J A;  3FPU B;  3DEP A;  3AMU A;  2EDG A;  2F3V A;  3A56 A;  1PFM A;  4DXG A;  3D8G A;  1PRT F;  3FMC A;  1BO0 A;  1EQT A;  4A3K B;  4MHE A;  4BBR B;  4A3B B;  3A8I E;  5EBD A;  3A55 A;  1E2W A;  4RA8 A;  1EWH A;  1I4Q A;  4NMZ A;  1K8M A;  4KKS A;  5KEE A;  2HDM A;  4FVM A;  4C3I B;  4RGM A;  2TSS A;  2A6H D;  1DOL A;  1ENF A;  3A7L A;  1DXM A;  1HFG A;  3S1M B;  5FO8 B;  5JEA H;  3OOC A;  3ERQ A;  3TP6 A;  3CHB D;  1BCP D;  2RSN A;  4XYO A;  5ELF A;  1CQF A;  3MA2 B;  5EJW A;  1GHJ A;  1D5X C;  3A54 A;  1TWC B;  1Q1E A;  4XT1 B;  1BUV T;  1JIC A;  3K58 A;  1UUP A;  2F0O A;  3PV0 A;  3I91 A;  1XYI A;  3VYT A;  1ICW A;  2VB3 X;  1U9R A;  4G7H C;  4DGZ A;  4DNT B;  1YNN C;  1PTO B;  3QWN A;  1RTO A;  5C5M A;  1CA6 A;  1QJO A;  4BBS B;  1D1I A;  3V96 A;  2I46 A;  1PFB A;  1Y8P B;  4KTA A;  3J7Y W;  2F0S A;  2K5Q A;  3FKI B;  3RZO B;  2KED A;  5J1Z A;  3NTH A;  2Z4I A;  1S5F D;  2B8F A;  3RD4 A;  3G6J B;  1VDZ A;  3PUV A;  1K8O A;  3NTK A;  3OMG A;  1T5X D;  3WOE A;  3K5L A;  2LS0 1;  2BA1 A;  5K36 H;  1G29 1;  4IFD G;  4K6L A;  2A69 D;  1DM0 B;  4K5X A;  1VF7 A;  3CQZ B;  4LK1 C;  4HCS A;  2CW0 D;  2K04 A;  1O7Y A;  2BA0 A;  4QCL A;  1QOH A;  3R2I A;  4NW2 A;  1STG A;  3KF8 A;  5I9O A;  1WTO A;  2NN6 G;  2NN6 I;  4ZUI A;  4C1N I;  1RD9 D;  2XIW A;  4NDX A;  2CVR A;  2ZXR A;  3R2T A;  4EQP A;  4B9W A;  1QNK A;  3KK7 A;  1HPC A;  4C3H G;  2IX3 A;  4HSP A;  5I2X A;  1A2T A;  3D4R A;  3MEH A;  3RLF A;  3VA5 A;  1IW7 C;  1V1P B;  2F0V A;  1ET9 A;  1ONL A;  1R9T B;  5KNB A;  1TT2 A;  2RDF A;  1NR2 A;  4CKB A;  1U4L A;  1SNO A;  2QDB A;  3T16 A;  5NUC A;  1FNW A;  1W6J A;  4J1M A;  4A3E B;  3R3O A;  2YYZ A;  2DY8 A;  1Q8I A;  1LTA D;  2VB2 X;  2WKD A;  5DEH A;  1WD0 A;  1H9S A;  5CMD A;  1D2B A;  1CTM A;  4RGN A;  4F7X A;  1TS2 A;  1JOR A;  4BY1 B;  4DNR B;  2Y0S B;  2MGS A;  2PZU A;  3HP3 A;  3DEO A;  5CYU A;  1U4R A;  1HUN A;  4YIJ A;  2K32 A;  1JQY D;  2RKS A;  2AQ3 B;  3GTL B;  3VR5 A;  3R8B A;  3D3R A;  3OWF A;  3I4N B;  1KAB A;  5DAU A;  4KK7 A;  4ZQ3 A;  2M2L A;  1PDQ A;  5IIF A;  3S1Q B;  2BOS A;  5KNC A;  1EL0 A;  1CZG A;  4CJ2 C;  5KRU A;  1U4M A;  1IYU A;  1CI3 M;  5M5Y B;  1JWU D;  2ZT9 C;  4IFD J;  1LTT D;  3TBI B;  2BDN A;  3C2P A;  4I7Z C;  2D9U A;  4X3K A;  1SYG A;  3A8K E;  1B9N A;  1YNJ C;  5IOC A;  4F8M A;  5IGC A;  1M4V A;  1Q12 A;  5IT9 E;  1A6X A;  2JE6 I;  2DNE A;  4J8Q A;  5C5L A;  4RWS C;  1LAC A;  4ZKB B;  4BS9 A;  3MXU A;  3C46 A;  2SEB D;  1T5E A;  4G57 A;  2LMC B;  4ME5 A;  2NN6 H;  3EA6 A;  1HXY D;  5ELB A;  3FRP B;  4IUR A;  2Q8R E;  5JAV A;  3V2T A;  4Q5V A;  3GTM B;  4DXF A;  1F9Q A;  1W6K A;  4IUT A;  1J8I A;  1BXT A;  1I4R A;  4RGT A;  1S4Z A;  1B9M A;  2NVT B;  4ABN A;  1SYE A;  1EY4 A;  3M4Y A;  3K57 A;  2Q8I B;  1EY0 A;  2BCO A;  2XN9 C;  1QNU A;  2HCC A;  1HUM A;  5KYL A;  1Y1W B;  2KA7 A;  5I6Y A;  1S5B D;  2L1B A;  4K14 A;  1DON A;  1VCI A;  1R4Q B;  1H9J A;  2FFK B;  1SE3 A;  1MI2 A;  4QUF A;  4LMQ D;  5A2Q E;  3S1N B;  2FJ2 A;  3GV3 A;  1G6Z A;  3QG1 A;  2D2C C;  2TMP A;  2R3Z A;  5I6W A;  5ISR A;  4XT3 B;  1SE2 A;  5EQ0 A;  1KDB A;  5COR A;  4L63 B;  4Y7N B;  3VA7 A;  2IL8 A;  1S5C D;  3D6C A;  1PZK D;  2G9H D;  2QEJ C;  4X3U A;  3SEB A;  2E2D C;  3ERO A;  2JP1 A;  2F0Q A;  1O7L A;  1PTO C;  4K2K A;  3DWA A;  5JEA G;  1SYD A;  3MFG A;  3LWU A;  3BVG A;  1IL8 A;  1I3Q B;  1AN8 A;  3KLS A;  3KBG A;  4WFN 3;  3E5S A;  1YNJ D;  1I4P A;  1LTG D;  2B2Y A;  2ID0 A;  4IUU A;  1AFP A;  2CHB D;  3NK9 A;  2RVL A;  2H4O A;  2EY6 A;  2A6H C;  5D3I B;  2IT1 A;  2E2J B;  1X3P A;  4ZLT F;  1TY0 A;  1EIH A;  2MUY A;  1CM9 A;  1BCP C;  4RH6 A;  3D6W A;  3VYS A;  4K5W A;  4FXK C;  1EZ6 A;  4A93 B;  2F0L A;  2K33 A;  2WKC A;  3I90 A;  3S16 B;  3T53 B;  2F0P A;  5E3F A;  2PZT A;  5LHY 1;  1SYC A;  5CV7 A;  4RHR A;  3DMU A;  4C3I G;  3N52 A;  3D4W A;  4OO1 G;  4OO1 I;  1TWH B;  4JBW A;  4K2L A;  2AQ1 B;  3M7N A;  2F0U A;  2J7Z A;  5G3L D;  2R7Z B;  2F4I A;  2F0H A;  3D31 A;  3T51 B;  4ZRZ A;  3UI2 A;  3PMF A;  1KLG D;  2R61 A;  3X3M A;  1LTI D;  2PPB C;  1E2Z A;  4ZUJ A;  3HOZ B;  2ICI A;  2GA4 B;  2N88 A;  2FIN B;  4F87 A;  2NYZ D;  2A74 C;  2A69 C;  1O78 A;  3JAM E;  1WD1 A;  1IHZ A;  4E6I A;  2LY7 A;  2F1M A;  1PTO D;  2CW0 C;  1ESF A;  5T1I A;  1WTQ A;  4HED A;  1LT4 D;  4KJN A;  5HUR A;  4G4K A;  2B63 B;  2X69 A;  4FO2 A;  4H0L C;  4G7Z C;  2FMC A;  1JCK B;  4K8J A;  4DA2 A;  3MFY A;  2IWH A;  5KGU A;  1B3A A;  3SK8 A;  5G3L F;  4KI0 A;  1ILP A;  4R8I A;  1ET6 A;  4IAL A;  5IGF A;  3E0J A;  2CQA A;  5E4W C;  3HOX B;  3M4O B;  4QIW B;  5JEA J;  2J0T D;  1HTL D;  2A5H A;  1B2T A;  2MHV A;  4KY7 A;  1LTR D;  4TKO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...