3H91A

Crystal structure of the complex of human chromobox homolog 2 (cbx2) and h3k27 peptide
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
52
structure length
52
Chain Sequence
EQVFAAECILSKRLRKGKLEYLVKWRGWSSKHNSWEPEENILDPRLLLAFQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Chromobox protein homolog 2
publication title Recognition and specificity determinants of the human cbx chromodomains.
pubmed doi rcsb
source organism Homo sapiens
total genus 9
structure length 52
sequence length 52
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3h91A00
1LV9A 1MGSA 1PFNA 2IL8A 2B2YA 1EIGA 1F9QA 2HDMA 3P7JA 1BBXC 4MHEA 2MJ8A 2B2TC 3I3CA 5EPJA 1G2SA 1BNZA 1B2TA 1HUNA 1ILPA 2MP1A 2RSNA 2L9HA 5E4WC 5EJWA 2K03A 4HEDA 2B2WA 1EIHA 3HP3A 1WTOA 1WTPA 1U4MA 1WTVA 3ONAB 4XT3B 1CA5A 2KECA 2L4NA 1WTQA 1DONA 4IUVA 2DY8A 2BDNA 2X6LA 4O42A 4CJ1B 4IUQA 5COYA 4ZK9B 2HDLA 1WTXA 1WTRA 2L11A 1ESRA 2HCIA 2X69A 3I90A 5T1GA 3KUPA 3I91A 1PDQA 1EL0A 1SAPA 4HSVA 1XX8A 5E4XA 4LMQD 4XT1B 1AP0A 3TZDA 1DOMA 2EPBA 1HUMA 2FINB 1F2LA 1RTOA 1MSHA 3SVMA 2RA4A 1G6ZA 2K05A 2B2WC 1EQTA 1EOTA 1SSOA 1F9RA 1NR2A 1X3QA 1GUWA 2H1EA 2SDFA 1F9PA 2K01A 1PFMA 3MWYW 1DOLA 4MN3A 3D6WA 4RA8A 4ZAIA 1C8CA 2L12A 2Q8RE 2J7ZA 4RAUC 1MSGA 5EPLA 2B2UA 1B50A 1RHPA 4IUTA 2HCCA 1RTNA 1VMPA 2KEEA 2VXWA 1G91A 2N88A 1QE6A 2EE1A 1A15A 5EKIA 2B2VA 1Q3LA 1NCVA 1O7ZA 2B2YC 3QO2A 4HAEA 1ZXTA 3H91A 5CORA 1WD1A 4ZKBB 4X3KA 2RVLA 1M8AA 1KNAA 5CBAE 1BO0A 2N55A 1IKMA 4RWSC 5EPKA 1X32A 5D14A 5AFWA 4CJ0B 1VMCA 2L1BA 3DEPA 1IL8A 4IUPA 3R93A 4CJ2C 1HFNA 3TN2A 2X6GA 2NWGA 2B2UC 1ML0D 1WD0A 1HFGA 2NZ1D 2CVRA 3IL8A 4ZLTF 1U4LA 2MGSA 3IFDA 1DZ1A 2KOLA 4UAIA 1PLFA 1KNEA 1O80A 4XDXA 1F9SA 2FJ2A 1B4OA 3KBXA 2FHTA 4QUCA 4R9WA 5CBEE 2R3ZA 1ICWA 2B2VC 1U4RA 1X3PA 1AZQA 1QNKA 2K04A 1AZPA 4IUUA 1HRJA 2D9UA 2MPMA 1TVXA 4OIKA 1ILQA 5D65A 4OIJA 1E0BA 1J8IA 1HHVA 4HCSA 1PFBA 1J9OA 2RSOA 2Q8TA 1XYIA 3DM1A 2FFKB 2FMMA 2K28A 2EOTA 2KVMA 4ZKCB 1U4PA 1G2TA 5DNFA 3UI2A 1CM9A 3MTSA 5T1IA 2JP1A 1NR4A 3F2UA 4DN4M 3G7LA 1B53A 1RJTA 2B2TA 1NAPA 1B3AA 1JE4A 1SDFA 4X3TA 4X3SA 1O7YA 1WTWA 3GV3A 2K1BA 1QG7A 1DOKA 2HUGA 1RODA 2NYZD 2JYOA 2KEDA 3DEOA 3FDTA 4NW2A 3Q6SA 5CMDA 3I8ZA 1HA6A 2M2LA 4IURA 4QUFA 1MI2A 1JICA 3GV6A 3LWEA 2KUMA 1IKLA 3N52A 1CA6A 4R8IA 1WVLA 1BF4A 5JJZA 2XIWA 4X3UA 1S4ZA 4U68A 5EQ0A 2DY7A 3FPUB
chains in the Genus database with same CATH superfamily
1CSPA 2AQ1B 5C5LA 1EIGA 2HDMA 1ET9A 4OO1H 1SYFA 4H02A 1VQDA 2A6EC 5EPJA 5GQOA 1STGA 5E4WC 5A2QL 4C3HG 2EYFA 4I7ZC 1Q8KA 1CZWA 1WCMG 1Y8PB 2FXQA 3SK8A 1GKHA 2L4NA 4NPSA 1EY8A 3PUWA 1STYA 2ASBA 3S16H 1G6PA 3FMCA 2YTVA 1JOOA 5IWAQ 4A3MB 1C0AA 2EYOA 4A3EG 2EDGA 1C9OA 3CKIB 1X54A 3FKIH 4LF4L 3UE0A 2GA4B 3G6EA 4IFDJ 2EPBA 4PMWA 4LF8L 2FINB 4DV2Q 2OF1A 1N36Q 1VQ7A 2CWAA 2E8GA 2JA8B 2LKVA 5AJ3Q 3CAMA 1YITA 4ID6A 3OYYA 4MN3A 2XNAC 2Q8RE 3HZXA 1XXGA 5GAGC 4B9WA 4DV5L 5K5PA 5EKKA 2VXWA 2NUCA 2PI2A 3Q8DA 3CQZH 3HRZC 2O2LD 5LMUQ 2RKSA 2UXBL 5DLQE 2RVLA 2B39A 2UXDL 1TKWB 3R3OA 1VDZA 1AN8A 3GQBA 2L1BA 4RHRA 1IL8A 4B3RQ 3M9BA 2NZ1D 1X55A 4Q0FA 1P16A 3X3NA 4X64L 3PO2H 4BBRH 1K28A 4BA1I 1N32L 2K5QA 4DAYB 1EFWA 4KHPL 3A7LA 1GHKA 2UU9Q 1D7QA 1D5ZC 1Q81C 2Y0SE 1STHA 4DN4M 3ER0A 5IOCA 4GZYC 4JW0A 2M9VA 2ZM6Q 2HUGA 1BDOA 4JI8L 4OX9Q 1TWFB 4J1MA 3VA5A 5L37A 3S1MH 2OQKA 3A74A 4QGUA 4R8IA 3HOYH 5C3WA 2PW7A 3OWFA 4GNXA 3PUXA 4A3LH 5CR3A 3LWUA 2JA5G 3MXGA 4AH6A 3S2DH 4UY8C 3UE1A 3AFPA 3VDYA 2UUBL 4DKAC 4F88A 1SE4A 1LUZA 4XT3B 3BG3A 2ZT9C 4A3BB 3E0JA 3AEVA 2LY7A 1K3BC 2NVXB 1WYDA 2BH8A 1WTXA 1XMQQ 4TVAB 5DM63 2CH4W 1EY9A 3VR2A 3K59A 1PDQA 4JI5Q 4MTKA 3MFGA 4YWMA 1F2YA 3VR3A 3D8GA 2NVTB 3OPOA 1YHAA 2K05A 2Z0SA 2CFMA 4BBRG 4C3HB 1M4VA 4MNOA 1IZ6A 1LT3D 1WCMB 2PMZE 2K52A 2D0OA 3VYSA 1HNWL 3QWNA 4X65L 2GVAA 1O78A 2WINB 1CZGA 2RHSB 1R9TB 2PI2E 1PRTD 4A3EB 3J7AV 4L6TB 1VQ5A 3NSWA 1EIFA 5IGBA 4LWCA 4P2CB 1BQQT 2VQEL 1KNAA 3FP9A 1BO0A 1LTRD 2CH4A 3P20A 5KYLA 3HOYG 5AFWA 1VMCA 3DEPA 1ENCA 5JPMC 1OXVA 4KKSA 4B3TL 2A6ED 1A3UA 4ZLTF 2E2HH 3S1QH 2JEAI 5HGTA 5FKAC 1PLFA 4DF7A 2J4XA 3PO3G 1DGSA 2WP8J 3J80L 1JB7A 1JJGA 3M7NA 1PXUA 1J9OA 2N8NA 5C5MA 2K28A 3JC66 4LUVA 1QILA 1U4PA 1LM0A 3SHLA 3RD4A 1STAA 4B3ML 1B53A 1E24A 1IXRA 1O7YA 3RR5A 3CMAA 4RHSA 5KNBA 3NE5B 1FL0A 2AQ2B 1YIJA 1SBBB 1HPCA 4DXFA 1VQ4A 1EY4A 5M3FG 1GJXA 3W3AA 5CV8A 4X6AH 5EQ0A 4JOIA 4Q5VA 1EZ6A 2VB2X 4LK1C 3S16B 4PG3A 1V9PA 5IIFA 1UE6A 4KMUC 2L55A 5ELDA 1MBYA 2K4KA 3VYTA 2OT2A 2RSNA 3HG9A 5EJWA 5TSSA 4GKKQ 1QVCA 2WACA 4ZCKA 5C3XA 4C56C 3FKIB 4O1NA 4K0KQ 2AWOA 4B08A 1S5DD 1WTQA 1E2ZA 1RKNA 2XTIA 4ZK9B 4UP7A 5LMNL 4DUYL 3PF5A 2I07B 1Y8NB 2YYZA 1LLRD 1UWVA 2X69A 3EQLC 1I4GA 2XN9C 4K8JA 4LMQD 3TZDA 3NK9A 1XPUA 1WTHA 2VUMH 1K0RA 2AUKA 3SVMA 5M3MH 1G8ZD 1D5MC 3CQZB 1BCPB 3IRBA 1SYCA 1D1KA 1F9PA 4NXNL 5DEHA 1X3EA 5G3LD 3HOVG 2UUAQ 2DNCA 5IWAL 1KDAA 1U0LA 1OTCA 1RHPA 1VQIA 4FP5D 3A54A 2NBFA 1IBMQ 5IGGA 3EFXD 4A3GG 4DV2L 3GTQH 2H5XA 1PTOH 1N36L 3H91A 1JOKA 3CCEA 5AJ3L 2WAQE 4RWSC 1JE5A 4HJ7A 3PO2B 3EJIA 4BBRB 1KRTA 4QCLA 1J6QA 1NTGA 1GVPA 4B3SQ 3RMHA 3T1HQ 5IP9G 1H9JA 2NTTA 1Z9FA 2QF7A 4A3JH 1L1OB 5LMUL 1WI5A 1QNKA 2YTXA 3G71A 3K57A 4DK1A 3HOXG 3S17H 3I4MG 3S24A 3A55A 3S1MB 1Q86C 5DNFA 4B3RL 3HOYB 2D0PA 2J0TD 1VQAA 4DNIA 3S2DB 1WJJA 5C0XH 3JAMi 5GADC 3NP8A 1SN8A 5IYBH 1JB3A 4ZYSA 3H3VC 3I56A 5M5XH 3TP6A 4DR1Q 3PO3B 4K6LA 3GV6A 3MHBA 3CCSA 2K5WA 2UU9L 4KY6A 1KRSA 4IALA 4N8X1 1EYAA 2B2YA 3BYYB 2MJ8A 2E2IH 4NDXA 1PZJD 2ZM6L 2A5HA 4IJLA 4FF2A 4OX9L 3GTMH 3KF6A 1HNXQ 1VCIA 5D3IB 1CKMA 1MHWC 1BBWA 5C6AA 1GUSA 5M3FB 4R4QA 2NVQB 4P71A 3Q23A 1BXTA 1DOMA 2PZTA 3NBHA 2ZTCA 2A8VA 1EQTA 1TWAH 1NMGA 5ELBA 1K83B 3A8JE 1QNUA 5EPLA 1Y1WH 1XMQL 2HCCA 4LFBQ 4A93H 1JJ2A 4JI5L 3TEHB 4WORA 2F0IA 2A69C 4CBVA 1N8RC 2E2HB 5J39A 4IO9A 3QO2A 1ZXTA 1QB5D 1SNDA 5CBAE 3T56B 1Y1VG 2K14A 2JK8A 1IBKL 4KN7C 5C4XH 1N9WA 4KLKA 3E3XA 1HR0Q 3H0GG 3I4OA 1GUTA 1ML0D 5C4JB 3HOVB 5LMNW 3IFDA 1TS3A 3CC4A 1NMFA 4UAIA 4HIKA 3URYA 1F2ZA 1KDBA 3WWVA 3NENA 2B2VC 1XMOQ 1QVFA 2QDLA 1SROA 1MJCA 4HJAA 4G7HC 2JA8H 1E0BA 1VQEA 3I73A 3NQIA 1HHVA 3S14H 4N9PA 2KVMA 4KHPQ 3A0JA 2QGQA 4FVMA 4RGMA 2DN8A 4IQZA 1EUJA 5KNDA 4C3IG 2RDFA 3U9OA 2HIVA 1TU2B 5I2YA 4RKBA 4JBMA 4GKJQ 3T16A 3CCMA 4NW2A 3K5OA 3MXNA 4NP5A 1JICA 1PTOF 5FLXc 4RMFA 3RUZA 4JCVE 1SE8A 3F8TA 1S4ZA 3NTKA 1B3QA 2DY7A 4LUOA 1UAPA 3K6OA 2JA6G 1MGSA 5BN3A 2IL8A 1SNQA 3PF4A 3S1NH 4CDCC 3ULPA 1JJCB 3M4PA 1UE5A 3KF8A 3KBGA 2NN6H 2RBMA 1C7YA 2UUBQ 2P5ZX 5M3MB 5C4XG 3SGIA 3HS0C 1XWEA 4K8IA 4YY3Q 1TWCB 3RLFA 4OWWB 3PQIA 2D5DA 2L11A 4CKEA 2DJGC 4K14A 4XT1B 3PMFA 2TSSA 2QDBA 4YWLA 3TQYA 4GKKL 1MSHA 2ALYB 3KLSA 3SXHA 3J7ZC 4K0KL 1TWFH 1X3GA 5CYUA 4LAAA 4OWTB 3GTQB 4RGOS 3MEFA 3MWYW 3DUZA 3HKZE 1Z47A 5KNCA 3NXWA 1NNXA 1PZID 1QUQB 2DJFC 3J80E 3CPWA 4M1UB 5ELNA 1LACA 1L0WA 2B2YC 3M3YH 1FGBD 4A3JB 5LL6S 3HOZG 1X32A 4LFCQ 2F0HA 4CDFC 4TKOB 4OEMB 2UUAL 1HFNA 3HKSA 1PV4A 1BOSA 3UDIA 3S17B 1SEBD 2PZWA 3MEHA 2A73B 3ULJA 5C4HA 4PZ8A 1F9SA 1GUGA 2R7DA 3T51B 4B3TQ 3STBC 1U4RA 3PIPA 3GTGH 4EGVA 4UP9A 1UE7A 2XGTA 1WCMH 5D65A 1HTLD 3M4OH 1Y1VB 2WAQG 4A4IA 4JVZA 1NBWA 5M5XB 3QB3A 3KDFB 2OWOA 2KCMA 4J6HA 1CM9A 3BVMA 2JSOA 1Q1EA 3BDCA 4B3SL 1R9TH 4NXMQ 3T1HL 5M9OA 4A3KG 4A3EH 1SDFA 3NEMA 1FD7D 1A63A 1WTWA 3D6CA 4DR3Q 2HHHQ 2JYOA 2E2IB 1UE1A 1EFID 5IP7H 3RN5A 2A68D 3B6YA 3L2PA 3LGJA 4X3UA 4FYDA 3GTMB 3JAML 1LABA 1V1QA 2PYKA 4XQQA 2SOBA 2Z9HA 1LV9A 1EYCA 1YEZA 4U673 3GTKH 1CK1A 3U9SA 4GN5A 1PH5A 4C3IB 1I3QB 1Z6HA 2L9HA 4F8MA 4P72A 5C0XJ 1D6EC 2XRSD 1WTPA 1WTVA 1RIPA 3TZUA 1ZYRC 2K7VA 4DR1L 3FPPA 1BKBA 3I70A 1TWAB 4DK3C 1V43A 1S3OA 1WTRA 3W2DA 4KD4A 4ODGA 1PYWD 1SAPA 4O0AA 1B1ZA 1VQNA 4A93B 3KLRA 2RA4A 4IPHA 1YZ6A 4HR7B 3E9HA 1KAWA 1HNZQ 5FJ8H 1HNXL 1TWGH 1LTLA 3D6WA 4I7AA 5C4XB 2KHIA 4KHVA 5LHY1 4K5XA 4NXNQ 4GNXB 1RTNA 2KEEA 3IFTA 4HTHA 1QZGA 1XNQQ 1Y14B 4AQYQ 4KTAA 3WOFA 1ET6A 3G6JB 1EOVA 1E7ZA 2F0LA 3GTPH 4ZKBB 1HZ9A 4C2MH 5KGUA 5IP7G 3D4WA 1A8VA 1I5FA 1MD2D 5BN4A 3KDFA 4MZ9A 2B2UC 1PH8A 2L5TA 3K81C 3KOJA 4LFBL 3S14B 5ISRA 4GLXA 2JA5H 1VQMA 2AWNA 1O80A 4FF1A 4R9WA 1A2UA 1TXYA 1X3PA 4ZUJA 4EVOA 1AZQA 2K04A 1EY5A 1QWYA 5LL6X 3C46A 2OTLA 4JI0Q 5J3BA 5JEAJ 4AYBE 1HR0L 2FMMA 3OWEB 4GN3B 5CC4A 2CHBD 4XQNA 2IT1A 5NUCA 1YNND 1X9NA 3J7A5 2EXDA 4IJHA 1YNXA 1XMOL 3S1NB 1KHIA 2BOSA 4P74A 2N3SA 1JWSD 2ENBA 3L3OC 5JJZA 3QOJA 4R8NA 5FJ8G 4GLAC 4RGNA 4R4OA 1PFNA 1TWHH 1LO5D 1ICFB 3CF5A 3CCVA 5GAEC 4A3KB 1A0IA 1FJGQ 4GKJL 1B7YB 3FVQA 4R4CA 1TY0A 3ONAB 1CA5A 4IPCA 2BDNA 3ICEA 1U5KA 3MC0B 3FHWA 1IYJB 1OXXK 2Z4IA 1KD1C 2CQAA 2D2CC 2KA7A 1YNJC 4KJOA 1TIID 1K8AC 1SNOA 4HSVA 2SNMA 3STBD 1HUMA 3OW7A 2ES2A 2HT1A 4HJ8A 2WKCA 3PO3H 3EBEA 3M3YB 1JCKB 3OIQA 5H1SE 1C8CA 3QIAA 4YY3L 1M1KC 2LXKA 3GD7A 3VA7A 3DLLA 3BDOA 3TREA 1B9NA 3K5LA 4M8AA 3M85A 3EROA 1NCVA 1O7ZA 2AUJD 4TQUS 3PIOA 4DR2Q 1ENAA 3H15A 4G4KA 1IKMA 5JAVA 1UUPA 1K8GA 3OW2A 2DNEA 3GTGB 1S5ED 1N34Q 3R93A 1A2TA 1R4PB 2F3VA 5M3FH 1IBKQ 2NVQH 3W1GA 4CDDC 3M4OB 1HFGA 2XWJB 1CKOA 2KOLA 1X3FA 2VNUD 4RKLA 1KABA 1ZYRD 1XTCD 2UUCQ 1B70B 1K83H 1JR0D 3NQTA 4LFCL 1EQQA 1ZKOA 3DM1A 1AE3A 1XPRA 2JA7H 4QIWB 1RJTA 1NAPA 4Y7NH 1O7IA 3GTJH 1QG7A 3PUVA 3FDTA 3GTKB 1RODA 2NB0A 2R7FA 1HA6A 3OOCA 4GOPC 3Q22A 4HN7A 2JA9A 2IX3A 1BF4A 2A19A 3PSIA 3UDXA 2F0PA 3PUYA 2F0NA 5C4JH 1AE2A 5DM73 2Z1CA 2VY3A 3SDZA 1T5XD 4JI2Q 4NXML 3HOVH 2B2TC 1EWIA 1B2TA 2VS1A 5JOBA 3BZDB 3MVVA 2HQEA 4DR3L 1LYLA 2HHHL 2E2DC 4A3GH 3DWPA 3F2DA 3R2IA 3GO5A 4IUVA 2X6LA 1VQ8A 1SYBA 2F0JA 1BCPF 1YHBA 3CPFA 3KFUA 4EQ5A 1HR0W 4A3DH 2F0GA 1TWGB 3VR5A 2MUYA 2BH2A 5IP9H 1IL2A 3WDNA 5E7NA 4Z9CB 1HA5A 1II3A 4LF6Q 4HJ5A 3S15H 2Z8LA 4LJZC 4FXGC 4CGYB 3GTPB 1PFMA 1QVGA 3HOXH 4C2MB 3I4MH 2JA7G 2IY5B 1VMPA 4L5RC 1HZBA 1SJED 3M7GA 2B2VA 1X6OA 3ERSX 2G5DA 3V96A 3NELA 2JA5B 1GUNA 3S1RB 4DXGA 4BY1G 1BUVT 1HNZL 1LT4D 2F3WA 3I7FA 5CV6A 1TWCH 4C1NK 3KF6B 3TN2A 1Q46A 2CCZA 1U4LA 3HEJA 1XNQL 4CKCA 2FJ2A 4AQYL 2YU9H 3W1BA 4JC0A 3JAME 3NBHB 3AFQA 1IYUA 2F0UA 1W2BA 2EJMA 2RHQB 2RSOA 1YNJD 1CFMA 4H0LC 3ZYYX 5IE8A 1STBA 3PIO3 1YHQA 1H9SA 2K5NA 1EY7A 1DCZA 4A3DG 4EQOA 4K2KA 3RZOH 1IHZA 5IGFA 4K6DA 3L0OA 3T53B 1TWHB 4N8FA 2NYZD 5CMDA 1M90C 2M2LA 3NWTA 1VQBA 4PMCA 3QG1A 4NKLA 4JI0L 2QCPX 3DM3A 3NPPA 1EU4A 1EQRA 4AYBG 3KK7A 4RFBA 2A6HC 4HIMA 1VQJA 1G291 5FLMH 4DA2A 2D62A 3J81i 1PRTB 2K6AA 3D4RA 4IUNA 4J15A 2IW3A 5IYDG 1NE3A 3BDLA 1JWUD 1SYDA 1Y1VH 4RH6A 2HQLA 2F4VQ 4A3FG 1L0XB 3A5UA 4C3JH 4FDBA 2HCIA 1VF5C 3H0GH 1UNSA 1PH1A 4DV1Q 1B8AA 1SE3A 3FEWX 4JI6Q 2Y0SG 1FJGL 4V0BA 2ID0A 3ND9A 3TS2A 1EOTA 3K7AH 2EVBA 3I4NG 2K33A 2MFIA 1LTTD 5ELFA 4IZ8A 3MXNB 2KHSA 1EEFD 2I0QA 1MSGA 1VQLA 1B50A 1PTOD 2XRQD 1RF2D 3N6RA 4C3IH 1I3QH 1FNUA 4ZRZA 1Q3LA 1ONLA 1GO3E 4WJWA 5BR8Q 1GD7A 1Q82C 1PH2A 3CD6A 1HJPA 4X3KA 3PGZA 2F1MA 3F1ZA 3KF8B 2N49A 1E1TA 1ASZA 2LXJA 4CDEC 3KJPA 1AW7A 4LF5Q 3IL8A 4A3IH 4WJ3M 2XVSA 2A68C 3BVZA 1JQYD 4IPDA 1HQRD 2JA6H 2JA7B 1ILPA 2FHTA 1EIYB 2R3ZA 3CU7A 4JBKA 1DJRD 1K3RA 3BZKA 2SEBD 5FLMG 4Y7NB 4I65A 4DR2L 2E76C 3EN2A 3GTJB 2JJQA 2QKIC 2EY1A 5CGKA 2VQFQ 1PFBA 3R2TA 1L0YB 4KJNA 2RDHA 1N34L 1W3SA 4BY1B 2Q2IA 2QEXA 2B29A 4ZQ3A 3MTSA 4IFDI 3J81j 1NR4A 3FRPB 2AMCB 4C3JG 1FR3A 2XSCA 3MXPA 2BA0A 5EAYA 3C3LA 5EKLA 3OHXC 2OTJA 1TY2A 2K1BA 2PQAA 2EXZA 1HXYD 2UUCL 3CC7A 5CV9A 4QUFA 1MI2A 2DGYA 1CA6A 4FO2A 1WVLA 4A3GB 3M4QA 4PZ7A 2LFNA 2WIIB 5JJKA 4KN4C 4ABNA 2GVBA 2VW9A 2B3GA 4A3DB 5FLXL 2E74C 3A8KE 4C1NI 2EYHA 3LX0A 2I46A 3NHHA 4KV6A 3I2ZA 1CHPD 4O42A 1K9MC 2ZTDA 1KIXA 2F0TA 2HDLA 3S15B 3HOZH 4A3CG 4JI1Q 3MFYA 1I6HH 3HOWH 5E4XA 2Z6BA 4A3IG 4JI2L 3HOXB 2EJFC 2R93H 3I4MB 5C3EH 1SMYC 1KLUD 3H3VH 1RD9D 1O7LA 4KD3A 2B2WC 2MNAA 1PH6A 4R4IA 2PPBC 3H3VI 1DYQA 4B9XA 1KAAA 4YCWA 2ZJQA 1X3QA 1AH9A 1CKNA 2F0KA 2BE5C 4BY7G 2JQOA 2L12A 4IFDG 4RAUC 3K5NA 2B2UA 2NZHA 4DAMA 4IUTA 2IPKD 5JVH3 2PCFB 4A3FB 1G51A 1PH7A 2VL6A 2YV5A 5IT9c 5IYCH 4DFAA 1PFSA 4XYQA 4A3KH 2I5LX 2YU9B 2Y0SB 1CHQD 4LF6L 2O5IC 3RLNA 2KHJA 1YNNC 1CTMA 5HGQA 2E2JH 1EEID 2IWHA 5CV5A 2A6HD 1WD0A 1R4QB 2EYJA 4DR5Q 1HZCA 5KRUA 3HOUG 3IAYA 1GXDC 4DU9A 4DPGA 2RCNA 4BWGB 1WFQA 2M00A 3SK5A 3J7YW 4G7OC 3RZOB 4F87A 2D9UA 4UPAA 1STNA 1V1OA 1EU3A 2AQ3B 1YVCA 2IHFA 1XYIA 3SE0A 2E5LQ 1UEAB 3UI2A 2PW5A 2OCEA 2Q2HA 2F4IA 2ICIA 4JBWA 5ELOA 3HOWG 2R61A 1PVOA 1JT8A 3DWQA 3CMEA 4DV6Q 2R93G 5C3EG 2KEDA 2K5DA 4BBSG 1SRUA 1PZKD 4KY7A 2KUMA 4RGTA 3SK4A 4UP8A 3BU2A 1VQOA 4U68A 3SK6A 4OWXB 2ZJPA 4IOCA 3P7JA 4JYAQ 2KBNA 1I4HA 3D3RA 4C3JB 5KIXA 3H0GB 2K03A 2PMZB 3A8IE 5IYCG 2F52A 1BCPC 1WTOA 4DR4Q 2KCNA 4G57A 4BXXG 2Q2TA 5HURA 4HSPA 3CW2C 2LMCB 2EYLA 3CRKC 3K7AB 1PHJA 2NVYB 3U4VA 1PYBA 1HH2P 1W6KA 5T1GA 5FOBB 3KUPA 3I91A 3SR1A 2EY5A 3RZDH 2L0CA 3CHBD 2I5MX 3J81c 3L9AX 1LTGD 1IW7C 2SDFA 3J80i 4RA8A 1KQSA 3I4LA 2F4VL 1EYGA 3S2HH 3TDQA 4PQXA 2ZXRA 4CHTB 1EY6A 2WV6D 2MQHA 2KJXA 1G91A 4OELB 2N88A 1YJNA 1L1OC 5DAUA 4QMGA 3CCUA 3D4DA 4DV1L 4A3IB 4JI6L 4HAEA 4DUZQ 2JA6B 4L63B 1OXTA 2JE6I 5M5WH 4BA2I 1I4RA 5D14A 1VQHA 3G48A 3CC2A 2N78A 2F0WA 2NWGA 5I6YA 3S9WA 4A3BG 1LTAD 1J5EQ 1DZ1A 1TS2A 2K5VA 4DAPA 1E2WA 1XTDA 4OL7A 1OO9B 5BR8L 3A7AB 1I4PA 4XYOA 2MPMA 4GOPA 3T13A 3QOLA 4QJFA 3ITPA 4POGA 3NUCA 1MKHA 5EBCA 4FXDA 2EOTA 3P75A 1BVSA 3U4ZA 4ULLA 4OO1I 4LF5L 3H09A 1FNWA 1V1PA 1NUCA 1QCBD 1SMYD 2B2TA 2WB1E 1NJIC 3KJOA 1VF7A 3GV3A 3HOUB 2WKDA 1DOKA 3HFZB 1OXSC 4ILWA 1VQPA 2BE5D 3S1RH 4J8QA 3OTOL 4Y52H 2VQFL 3H6MA 4JI4Q 5A35A 1DXMA 2Z4HA 5K36H 4K2LA 4P75A 1S5FD 2BDOA 2K5HA 4DK6C 3HOZB 1QJOA 3I3CA 2I5HA 2PQEA 4HEDA 1I6HB 3HOWB 3ERQA 3HP3A 4CKBA 1U4MA 1PYSB 3BZCA 2R93B 3BVGA 2KECA 3K0XA 3PCOB 5C3EB 3GP7A 4BBSB 4IUQA 2C9OA 3EA6A 4S3SA 3CCQA 4MIUA 2G9HD 2V1CC 1N33Q 1EL0A 3MXUA 1KL9A 4KI0A 4LFAQ 2WAQB 3PIP3 1F2LA 1NY4A 1MJEA 5I2XA 3T1YQ 2R92H 3TBIB 3LNNA 4TRDA 1DOLA 1E22A 4OO1G 1EYDA 2J7ZA 3D31A 4JI1L 4K5VA 2E2JB 2IX0A 3TP8A 1I4QA 2F03A 3W5OA 3GTLH 3NWSA 1M8AA 4YIJA 3PUZA 4QQBX 2H4OA 4OHJA 3H94A 4L5QA 1KC8C 5JJLA 3U58A 2IJ0A 3AYHB 4CJ0B 3K58A 3FKIG 4DV0Q 1P8LA 5K36G 2F0QA 1RCVD 2G9DA 1BCPD 1Q8IA 1SR3A 2LSSA 3KBXA 2ZJRA 2Z6KC 3E0EA 2QILA 4PZ6A 1I94Q 4DV7Q 4KKTA 4ZUIA 1ILQA 2MHVA 4OIJA 3T4AC 5IGCA 2EQSA 5FO7B 2Q8TA 5JJIA 2O5JC 2FFKB 1JOQA 5I6WA 3G7LA 4X62Q 2VZAA 4DR5L 2K32A 1T9HA 5FLXE 1B3AA 1JE4A 1WOCA 4FF4A 3F2CA 4X3SA 3HKZG 1CT1D 4A76A 2EY2A 1IW7D 4N9TA 5EGTA 2R92G 4YHHQ 3BYTB 1FYCA 2XIWA 1CUKA 2A74C 2DUDA 2E5LL 2L15A 1VQGA 1C48A 4V190 1BBXC 3PO2G 4MHEA 2PO4A 4ALPA 5IY0A 1HUNA 1TT2A 3PV0A 4DV6L 2SNSA 3DMUA 5IT9E 3MA2B 4EQNA 1GOZA 4POFA 3RZDB 1S5CD 1PTOC 2HIXA 4EX5A 4WFN3 2AHOB 5IODA 1VS0A 3EVQA 2Q2UA 1GUOA 2TMPA 4BY1H 4F7XA 5J1ZA 1H95A 3VR4A 4JYAL 1AP0A 4L5TA 1H9SB 4IPGA 4O2DA 3UDGA 3S2HB 1B9MA 3L7ZC 4DAYA 1AEXA 3MZ5A 1HTPA 1LTID 4L8JA 4DR4L 2B8GA 1KTKA 1IBLQ 3U50C 4A3LG 1SSOA 1F9RA 1CI3M 1PA6A 4EQPA 3R8BA 1SFOH 1TQOA 3AB9A 5M5WB 3KYHC 2VB3X 4H7BA 2PNRC 1STEA 3DHQA 5FO9B 1YJWA 2JEBI 4ME3A 1RL2A 2EE1A 3P1HA 3UDFA 1FNVA 1TR5A 1CQFA 4NB3A 1WD1A 5IGDA 4RCNA 2N55A 1A3TA 2CW0C 5E3FA 2MO0A 4X66Q 3J80c 4JI3Q 4YCVA 4IUPA 2EIFA 4CJ2C 4XTCS 3NBIA 5JPNC 1LTSD 2X6GA 2EYPA 4OGQC 1CQVA 2MGSA 3I55A 3BJUA 2KENA 2R7ZH 4UDUC 1VQ9A 1MIUA 1KNEA 2LS01 1ICWA 4AIMA 3Q24A 2F0SA 2F0DA 4RCOA 4DUZL 1AZPA 2OXPA 4DV4Q 4JK1C 3E5SA 1I4XA 2BCOA 1Y69U 5IYDH 1KLGD 5T1IA 4JV5Q 4LF9Q 2UXCQ 4A3FH 1J5EL 3RNUA 1Q90A 1S40A 5I9PA 1SYGA 3BS1A 4QF4A 3DEOA 3Q6SA 1D5XC 1I6VC 4FF3A 1L2FA 3J81E 4JG2A 1C4QA 1DM0B 1PRTF 5D3DA 2B63H 2MO1A 1JWMD 3NTHA 3QJYA 4KKUA 3I4NH 1NSNS 5ELEA 1HZAA 2EZVA 3CRLC 2C35B 1TS5A 1D8LA 1G2SA 2F0OA 3X3MA 2MP1A 2WB1G 5C44H 5JVG3 4E6IA 3M4YA 1VQ6A 4L5SA 2B2WA 1Q7YC 2B8FA 3HKZB 4RG1A 4FNFA 3TSSA 5GAHC 4A75A 1YJ9A 1XNRQ 2DY8A 3E6ZX 4OXPA 4GNXC 4JI4L 2R92B 4DGZA 3J7AF 5E1FA 2K50A 2F0VA 1W6JA 2AKWB 3V2TA 1S5BD 4LF7Q 2R7ZG 1G6ZA 1K8OA 1Q12A 2QEJC 2QW7A 1NR2A 2PQAB 1RDPD 3GTLB 2EY6A 2PZUA 2K01A 2RF4A 1ASYA 3RN2A 4DR7Q 4IOAA 1K8MA 4YWKA 4DR6Q 2E75C 1N33L 2JXMB 2KCCA 3CCLA 4APVA 3VYRA 1A15A 4LFAL 5CV4A 1EQVA 1I50H 5BN5A 3F2BA 4P73A 2EYMA 3T1YL 4DK0A 2BA1A 4MTNA 5A2QE 2O4XA 4KY5A 4JI7Q 5M5YH 2JN4A 1JMCA 3K5MA 1B44D 2B63G 2NVYH 4HMIA 4KHZA 2KCTA 3I72A 5ELCA 1VQKA 2IHEA 2VUMG 5C0XI 1F2MA 4OONA 5M3MG 4DV3Q 5KYIA 4XDXA 1B4OA 1EZ8A 1VQCA 2C5CA 1H9KA 4XXEA 5C44G 5CV7A 1HRJA 1YI2A 4HCSA 4DAVA 2ZTEA 1A3VA 2F3IA 1CKNB 4DV0L 2JP1A 2FMCA 4A3CH 2CQOA 1FGUA 1S72A 5I9OA 1EWHA 1SXTA 5G3LF 1BBUA 3OSOA 3TRZA 1I94L 2A1AA 4DV7L 4R1JA 1Y1WB 3KLWA 4TSSA 3SEBA 1EY0A 3OTOQ 2NTSA 4BY7H 1ESFA 4PNYA 1SNPA 4A3JG 3GTOH 4X62L 4IFDH 4LF4Q 4HMJA 1BNZA 4LF8Q 3MAQA 1BR9A 4GS3A 5KEEA 3WOEA 4QIWE 3AMUA 1EIHA 2CW0D 3CXCA 3ULLA 3RLOA 3D0FA 1DONA 1SJHD 4LNQA 4CJ1B 4JBJA 4YHHL 2CKZB 4JOIC 5FK9C 4DV5Q 1ESRA 4PV1C 3S1QB 3I90A 5C0XG 5IGEA 1SFOB 1XX8A 5IYBG 1L1OA 3OMGA 3KLSX 5F2DA 1U9RA 3DWAA 3HOUH 3VYUA 1RTOA 5JEAH 3K7UC 2UXBQ 4QB4A 2Q8IB 4NMZA 2WB1B 4WRDA 1A62A 1CSQA 2UXDQ 4A3MH 2H1EA 3QR8A 1DD2A 4ZAIA 4HJ9A 3OMCA 4GLVB 3C1EA 2CWPA 5GROA 1QE6A 4X64Q 2ICEC 4H44C 1N32Q 2R7ZB 4HCEA 4AYBB 1IBLL 2XWBB 4XQJA 4BBSH 3CP0A 2RCFA 1YBYA 2GN5A 1Z7TA 4IN3A 1Q1BA 2F0FA 2OEOA 4HIDA 2CVRA 2V4DA 5IT9L 4WJ4A 4G7ZC 1F77A 3CCJA 4QUCA 1J8IA 1LT5D 1K73C 4JI8Q 1UEBA 3ND8A 3K0YA 1X56A 1SNMA 4QL5A 2R6GA 4DNRB 1Y1WG 4X66L 1PH9A 4JI3L 5I4DA 4BXXH 4KK7A 4A93G 1G2TA 1LT6D 4K5WA 5HY6A 2B63B 3I4NB 1ENFA 1XPOA 2EJGC 1XJVA 1E2VA 3A5ZB 2VUMB 2NN6I 3IKJA 5JEAG 3I8ZA 4LW1A 4IURA 1V8QA 4PMBA 3LWEA 5C44B 4A3MG 4DV4L 3ZJYC 4HIOA 1GHJA 1TS4A 3TP7A 3FPUB 3EIVA 4JV5L 4LF9L 1F9QA 1H9RA 2UXCL 2RQXA 3A56A 2KQ3A 2HD3A 2WFWA 4BS9A 2JA8G 1PTOB 2IX1A 4LUZA 2ZXPA 1D2BA 1D1IA 5COYA 1HNWQ 4GOPB 2K75A 3K8AA 3NTIA 4X65Q 4GN4B 1T5EA 1X65A 4R4TA 1IYVA 1V1PB 4A3BH 1SMXA 5EBDA 2VQEQ 1SLJA 3HGBA 2NVXH 1PMRA 1XNRL 1GUWA 1SE2A 1I50B 2NZOA 1IBML 4UHVA 4YCUA 1JC7A 2PNHA 5M5YB 2NVTH 1K0SA 1A6XA 3GDEA 4C3HH 3E9IA 3J81L 4LF7L 2NN6G 3AU7A 5EKIA 3C2PA 3O13A 2Z6KA 4ME5A 1LTBD 5FO8B 5CORA 5EPKA 1KDCA 1OXUA 3TMEA 1PH4A 3TS0A 1HCZA 1QZHA 3CCRA 4DR7L 1Y8OB 4B3MQ 4H13C 1PH3A 4DR6L 1SYEA 4JPBW 1AFPA 3Q0AA 2YTYA 3C1FA 5CBEE 3DXJC 4QY7A 3OIPA 5J22A 5C4ZA 1E3PA 1HQMC 4IUUA 3TP5A 1TVXA 4OIKA 4FXKC 1H9MA 2A69D 4JI7L 2QA4A 4ZKCB 1GM5A 4XIGS 1ZEQX 3F2UA 3JAMc 1SNCA 1FVIA 1VQFA 4X3TA 3VR6A 4DV3L 1PRTC 4BY7B 3GTOB 2F0MA 1EWCA 2RDGA 3AQQA 3V05A 4DNTB 1JORA 2F0EA 3K80C 3N52A 1IKLA 2ATWA 1QOHA 1KXLA 1E1OA 5LMNQ 4DUYQ 2OQ0A 2ZXOA 1QUQA 3G4SA
chains in the Genus database with same CATH topology
2AQ1B 5C5LA 1EIGA 2HDMA 1ET9A 4OO1H 1SYFA 2A6EC 5EPJA 1STGA 5E4WC 5A2QL 4C3HG 2EYFA 4I7ZC 1CZWA 1Y8PB 3SK8A 2L4NA 1EY8A 3PUWA 1STYA 3FMCA 1JOOA 4A3MB 2EYOA 2EDGA 3CKIB 4IFDJ 2GA4B 2EPBA 4PMWA 2FINB 2OF1A 2JA8B 2LKVA 4ID6A 4MN3A 2XNAC 2Q8RE 3HZXA 1XXGA 4B9WA 5K5PA 5EKKA 2VXWA 2NUCA 3HRZC 2O2LD 2RKSA 2RVLA 2B39A 1TKWB 3R3OA 1VDZA 1AN8A 3GQBA 2L1BA 4RHRA 1IL8A 2NZ1D 4Q0FA 3X3NA 4BA1I 2K5QA 3A7LA 1GHKA 1D5ZC 1STHA 4DN4M 5IOCA 4GZYC 2M9VA 2HUGA 1BDOA 1TWFB 4J1MA 3VA5A 4R8IA 5C3WA 2PW7A 3OWFA 3PUXA 5CR3A 3LWUA 3MXGA 4F88A 1SE4A 4XT3B 3BG3A 2ZT9C 4A3BB 3E0JA 2LY7A 2NVXB 1WTXA 5DM63 3VR2A 1EY9A 3K59A 1PDQA 3MFGA 1F2YA 3VR3A 3D8GA 2NVTB 3OPOA 2K05A 4C3HB 1M4VA 1LT3D 1WCMB 3VYSA 3QWNA 1O78A 2WINB 1CZGA 1R9TB 1PRTD 4A3EB 3J7AV 4L6TB 3NSWA 5IGBA 4P2CB 1BQQT 1KNAA 1BO0A 1LTRD 3P20A 5KYLA 5AFWA 1VMCA 3DEPA 1ENCA 5JPMC 1OXVA 4KKSA 2A6ED 1A3UA 4ZLTF 2JEAI 5HGTA 5FKAC 1PLFA 4DF7A 2J4XA 2WP8J 3J80L 3M7NA 1PXUA 1J9OA 5C5MA 2K28A 1QILA 1U4PA 3SHLA 3RD4A 1STAA 1B53A 1O7YA 4RHSA 5KNBA 3NE5B 2AQ2B 1SBBB 1HPCA 4DXFA 1EY4A 1GJXA 3W3AA 5CV8A 5EQ0A 4Q5VA 1EZ6A 2VB2X 4LK1C 3S16B 5IIFA 4KMUC 2L55A 5ELDA 1MBYA 3VYTA 2OT2A 2RSNA 3HG9A 5EJWA 5TSSA 2WACA 5C3XA 4C56C 3FKIB 4O1NA 2AWOA 4B08A 1S5DD 1WTQA 1E2ZA 1RKNA 4ZK9B 2I07B 1Y8NB 2YYZA 1LLRD 2X69A 3EQLC 1I4GA 2XN9C 4K8JA 4LMQD 3TZDA 3NK9A 2AUKA 3SVMA 1G8ZD 1D5MC 3CQZB 1BCPB 1SYCA 1D1KA 1F9PA 5DEHA 5G3LD 2DNCA 1KDAA 1RHPA 4FP5D 3A54A 2NBFA 5IGGA 3EFXD 1PTOH 3H91A 1JOKA 4RWSC 3PO2B 3EJIA 4BBRB 4QCLA 3RMHA 1H9JA 2NTTA 2QF7A 1QNKA 3K57A 4DK1A 3A55A 3S1MB 5DNFA 3HOYB 2J0TD 3S2DB 5C0XH 3NP8A 1JB3A 4ZYSA 3H3VC 3TP6A 3PO3B 4K6LA 3GV6A 3MHBA 2K5WA 4KY6A 4IALA 1EYAA 2B2YA 3BYYB 2MJ8A 4NDXA 1PZJD 2A5HA 4FF2A 1VCIA 5D3IB 5C6AA 1GUSA 5M3FB 2NVQB 3Q23A 1BXTA 1DOMA 2PZTA 3NBHA 1EQTA 5ELBA 1K83B 3A8JE 1QNUA 5EPLA 2HCCA 4WORA 2F0IA 2A69C 4CBVA 2E2HB 5J39A 3QO2A 1ZXTA 1QB5D 1SNDA 5CBAE 3T56B 4KN7C 1GUTA 1ML0D 5C4JB 3HOVB 3IFDA 1TS3A 4UAIA 3URYA 1F2ZA 1KDBA 2B2VC 4G7HC 1E0BA 3I73A 3NQIA 1HHVA 4N9PA 2KVMA 4FVMA 4RGMA 2DN8A 4IQZA 5KNDA 4C3IG 2RDFA 3U9OA 1TU2B 5I2YA 4RKBA 3T16A 4NW2A 3K5OA 3MXNA 4NP5A 1JICA 1PTOF 3RUZA 1S4ZA 3NTKA 2DY7A 1UAPA 3K6OA 1MGSA 5BN3A 2IL8A 1SNQA 3KF8A 3KBGA 2NN6H 2RBMA 5M3MB 3HS0C 1XWEA 4K8IA 1TWCB 3RLFA 2D5DA 2L11A 4CKEA 4K14A 4XT1B 3PMFA 2TSSA 2QDBA 1MSHA 3KLSA 3SXHA 5CYUA 4LAAA 3GTQB 4RGOS 3MWYW 3DUZA 1Z47A 5KNCA 3NXWA 1PZID 3J80E 4M1UB 1LACA 2B2YC 1FGBD 4A3JB 5LL6S 1X32A 2F0HA 4TKOB 1HFNA 1BOSA 3S17B 1SEBD 2PZWA 3MEHA 2A73B 5C4HA 1F9SA 1GUGA 3T51B 1U4RA 4EGVA 5D65A 1HTLD 1Y1VB 5M5XB 3QB3A 4J6HA 1CM9A 3BVMA 2JSOA 1Q1EA 3BDCA 5M9OA 1SDFA 1FD7D 1WTWA 3D6CA 2JYOA 2E2IB 1EFID 2A68D 4X3UA 4FYDA 3GTMB 3JAML 1LABA 2PYKA 4XQQA 2SOBA 1LV9A 1EYCA 4U673 1CK1A 3U9SA 4C3IB 1I3QB 1Z6HA 2L9HA 4F8MA 5C0XJ 1D6EC 2XRSD 1WTPA 1WTVA 3TZUA 1ZYRC 2K7VA 3FPPA 3I70A 1TWAB 1V43A 1WTRA 3W2DA 4KD4A 4ODGA 1PYWD 1SAPA 1B1ZA 4A93B 3KLRA 2RA4A 4HR7B 3D6WA 5C4XB 4KHVA 5LHY1 4K5XA 1RTNA 2KEEA 3IFTA 4HTHA 4KTAA 3WOFA 1ET6A 3G6JB 2F0LA 4ZKBB 5KGUA 3D4WA 1MD2D 5BN4A 2B2UC 2L5TA 3S14B 5ISRA 2AWNA 1O80A 4FF1A 4R9WA 1A2UA 4EVOA 1X3PA 4ZUJA 1AZQA 2K04A 1EY5A 1QWYA 5LL6X 3C46A 5JEAJ 2FMMA 3OWEB 5CC4A 2CHBD 4XQNA 2IT1A 5NUCA 1YNND 3S1NB 2BOSA 1JWSD 2ENBA 3L3OC 5JJZA 3QOJA 4R8NA 4RGNA 1PFNA 1LO5D 4A3KB 3FVQA 1TY0A 3ONAB 1CA5A 2BDNA 3MC0B 1OXXK 2Z4IA 2CQAA 2D2CC 2KA7A 1YNJC 4KJOA 1TIID 1SNOA 4HSVA 2SNMA 1HUMA 3OW7A 2WKCA 3M3YB 1JCKB 3OIQA 1C8CA 3QIAA 3GD7A 3VA7A 3BDOA 1B9NA 3K5LA 4M8AA 3M85A 3EROA 1NCVA 1O7ZA 2AUJD 4TQUS 1ENAA 4G4KA 1IKMA 5JAVA 1UUPA 3GTGB 2DNEA 1S5ED 3R93A 1A2TA 1R4PB 2F3VA 3M4OB 1HFGA 2XWJB 2KOLA 2VNUD 4RKLA 1KABA 1ZYRD 1XTCD 1JR0D 3NQTA 1ZKOA 3DM1A 4QIWB 1RJTA 1NAPA 1QG7A 3PUVA 3FDTA 3GTKB 1RODA 2NB0A 1HA6A 3OOCA 3Q22A 4HN7A 2IX3A 1BF4A 2F0PA 3PUYA 2F0NA 5DM73 3SDZA 2Z1CA 1T5XD 2B2TC 1B2TA 5JOBA 3BZDB 3MVVA 2HQEA 2E2DC 3DWPA 3R2IA 3GO5A 4IUVA 2X6LA 1SYBA 2F0JA 1BCPF 2F0GA 1TWGB 3VR5A 2MUYA 3WDNA 4Z9CB 1HA5A 1II3A 2Z8LA 4LJZC 4FXGC 4CGYB 3GTPB 1PFMA 4C2MB 1VMPA 1SJED 3M7GA 2B2VA 3V96A 2JA5B 1GUNA 3S1RB 4DXGA 1BUVT 1LT4D 2F3WA 5CV6A 4C1NK 3TN2A 1U4LA 3HEJA 4CKCA 2FJ2A 3JAME 1IYUA 2F0UA 2EJMA 2RSOA 1YNJD 1CFMA 4H0LC 3ZYYX 1STBA 3PIO3 1H9SA 1EY7A 1DCZA 4EQOA 4K2KA 1IHZA 5IGFA 4K6DA 3T53B 1TWHB 2NYZD 5CMDA 2M2LA 3NWTA 4PMCA 3QG1A 4NKLA 2QCPX 3NPPA 1EU4A 3KK7A 4RFBA 2A6HC 1G291 4DA2A 2D62A 1PRTB 2K6AA 3D4RA 4IUNA 2IW3A 3BDLA 1JWUD 1SYDA 4RH6A 1L0XB 2HCIA 1VF5C 1UNSA 1SE3A 3FEWX 4V0BA 2ID0A 3ND9A 1EOTA 2EVBA 2K33A 1LTTD 5ELFA 4IZ8A 2KHSA 1EEFD 1MSGA 1B50A 1PTOD 2XRQD 1RF2D 3N6RA 1FNUA 4ZRZA 1Q3LA 1ONLA 4WJWA 4X3KA 2F1MA 1AW7A 3IL8A 2XVSA 2A68C 3BVZA 1JQYD 1HQRD 2JA7B 1ILPA 2FHTA 2R3ZA 3CU7A 1DJRD 2SEBD 4Y7NB 4I65A 2E76C 3GTJB 2QKIC 2EY1A 5CGKA 1PFBA 3R2TA 1L0YB 4KJNA 2RDHA 4BY1B 4ZQ3A 3MTSA 4IFDI 1NR4A 3FRPB 4C3JG 1FR3A 2XSCA 3MXPA 2BA0A 3C3LA 5EKLA 3OHXC 1TY2A 2K1BA 2EXZA 1HXYD 5CV9A 4QUFA 1MI2A 1CA6A 4FO2A 1WVLA 4A3GB 2LFNA 2WIIB 4KN4C 4ABNA 4A3DB 5FLXL 2E74C 3A8KE 4C1NI 2EYHA 3LX0A 2I46A 3NHHA 4KV6A 4O42A 1CHPD 2F0TA 2HDLA 3S15B 3MFYA 5E4XA 3HOXB 2EJFC 3I4MB 1SMYC 1KLUD 1RD9D 1O7LA 4KD3A 2B2WC 2PPBC 1DYQA 4B9XA 1KAAA 1X3QA 2F0KA 2BE5C 2L12A 4IFDG 4RAUC 3K5NA 2B2UA 4IUTA 2IPKD 5JVH3 2PCFB 4A3FB 4DFAA 4XYQA 2YU9B 2Y0SB 1CHQD 2O5IC 1YNNC 1CTMA 1EEID 2IWHA 5CV5A 2A6HD 1WD0A 1R4QB 2EYJA 5KRUA 3IAYA 1GXDC 4DU9A 4BWGB 2M00A 3SK5A 3J7YW 4G7OC 3RZOB 4F87A 2D9UA 1STNA 1V1OA 1EU3A 2AQ3B 1XYIA 3SE0A 1UEAB 3UI2A 2PW5A 2F4IA 2ICIA 4JBWA 2R61A 3DWQA 2KEDA 2K5DA 1PZKD 4KY7A 2KUMA 4RGTA 3SK4A 4U68A 3SK6A 3P7JA 1I4HA 3D3RA 4C3JB 5KIXA 3H0GB 2K03A 2PMZB 3A8IE 1BCPC 1WTOA 2KCNA 4G57A 5HURA 4HSPA 2LMCB 2EYLA 3CRKC 3K7AB 2NVYB 1W6KA 5T1GA 5FOBB 3KUPA 3I91A 3SR1A 2EY5A 2L0CA 3CHBD 3L9AX 1LTGD 1IW7C 2SDFA 4RA8A 3I4LA 3TDQA 4PQXA 2ZXRA 4CHTB 1EY6A 2WV6D 2KJXA 1G91A 2N88A 5DAUA 4QMGA 3D4DA 4A3IB 4HAEA 2JA6B 4L63B 1OXTA 2JE6I 4BA2I 1I4RA 5D14A 2F0WA 2NWGA 5I6YA 3S9WA 1LTAD 1DZ1A 1TS2A 4DAPA 1E2WA 4OL7A 1OO9B 3A7AB 1I4PA 4XYOA 2MPMA 3T13A 3QOLA 3ITPA 3NUCA 5EBCA 4FXDA 2EOTA 3P75A 4ULLA 4OO1I 3H09A 1FNWA 1V1PA 1NUCA 1QCBD 1SMYD 2B2TA 1VF7A 3GV3A 3HOUB 2WKDA 1DOKA 1OXSC 4ILWA 2BE5D 4J8QA 3H6MA 5A35A 1DXMA 2Z4HA 5K36H 4K2LA 1S5FD 2BDOA 3HOZB 1QJOA 3I3CA 2PQEA 4HEDA 1I6HB 3HOWB 3ERQA 3HP3A 4CKBA 1U4MA 2R93B 3BVGA 2KECA 5C3EB 3GP7A 4BBSB 4IUQA 2C9OA 3EA6A 4S3SA 4MIUA 2G9HD 1EL0A 3MXUA 4KI0A 2WAQB 3PIP3 1F2LA 5I2XA 3TBIB 3LNNA 4TRDA 1DOLA 4OO1G 1EYDA 2J7ZA 3D31A 4K5VA 2E2JB 2IX0A 3TP8A 1I4QA 2F03A 3NWSA 1M8AA 4YIJA 3PUZA 2H4OA 4OHJA 3H94A 2IJ0A 4CJ0B 3K58A 5K36G 2F0QA 1RCVD 2G9DA 1BCPD 1Q8IA 3KBXA 2QILA 4KKTA 4ZUIA 1ILQA 5IGCA 3T4AC 2MHVA 4OIJA 5FO7B 2Q8TA 2O5JC 2FFKB 1JOQA 5I6WA 3G7LA 2K32A 5FLXE 1B3AA 1JE4A 4FF4A 4X3SA 1CT1D 2EY2A 1IW7D 4N9TA 5EGTA 3BYTB 1FYCA 2XIWA 2A74C 1C48A 4V190 1BBXC 4MHEA 2PO4A 1HUNA 1TT2A 3PV0A 2SNSA 3DMUA 5IT9E 3MA2B 4EQNA 1GOZA 3RZDB 1S5CD 1PTOC 4WFN3 5IODA 3EVQA 1GUOA 2TMPA 4F7XA 5J1ZA 3VR4A 1AP0A 1H9SB 3S2HB 1B9MA 3L7ZC 4DAYA 1AEXA 3MZ5A 1HTPA 1LTID 4L8JA 2B8GA 1KTKA 1SSOA 1F9RA 1CI3M 4EQPA 3R8BA 1TQOA 3AB9A 5M5WB 4H7BA 2VB3X 2PNRC 1STEA 3DHQA 5FO9B 2JEBI 2EE1A 3P1HA 1FNVA 1TR5A 1CQFA 1WD1A 5IGDA 4RCNA 2N55A 1A3TA 2CW0C 5E3FA 4IUPA 4CJ2C 4XTCS 3NBIA 5JPNC 1LTSD 2X6GA 2EYPA 4OGQC 1CQVA 2MGSA 4UDUC 1KNEA 2LS01 1ICWA 3Q24A 2F0SA 2F0DA 4RCOA 1AZPA 2OXPA 4JK1C 3E5SA 1I4XA 2BCOA 1Y69U 1KLGD 5T1IA 1Q90A 5I9PA 1SYGA 3BS1A 4QF4A 3DEOA 3Q6SA 1D5XC 1I6VC 4FF3A 3J81E 1C4QA 1DM0B 1PRTF 5D3DA 3QJYA 1JWMD 3NTHA 4KKUA 1NSNS 5ELEA 2EZVA 3CRLC 1TS5A 1G2SA 2F0OA 3X3MA 2MP1A 5JVG3 4E6IA 3M4YA 2B2WA 2B8FA 3HKZB 3TSSA 4FNFA 2DY8A 3E6ZX 2R92B 4DGZA 3J7AF 5E1FA 2F0VA 1W6JA 3V2TA 1S5BD 1G6ZA 1K8OA 1Q12A 2QEJC 1NR2A 3GTLB 1RDPD 2EY6A 2PZUA 2K01A 1K8MA 2E75C 2JXMB 2KCCA 3VYRA 1A15A 5CV4A 1EQVA 5BN5A 2EYMA 4DK0A 2BA1A 5A2QE 2O4XA 4KY5A 3K5MA 1B44D 4HMIA 4KHZA 3I72A 5ELCA 5C0XI 1F2MA 5KYIA 4XDXA 1B4OA 1EZ8A 2C5CA 1H9KA 4XXEA 5CV7A 1HRJA 4HCSA 4DAVA 1A3VA 2JP1A 2FMCA 5I9OA 1EWHA 1SXTA 5G3LF 3OSOA 4TSSA 3SEBA 1EY0A 2NTSA 1ESFA 4PNYA 1SNPA 4IFDH 4HMJA 1BNZA 3MAQA 1BR9A 5KEEA 3WOEA 3AMUA 1EIHA 2CW0D 1DONA 1SJHD 4CJ1B 5FK9C 4PV1C 1ESRA 3S1QB 3I90A 5C0XG 5IGEA 1SFOB 1XX8A 3OMGA 5F2DA 3KLSX 1U9RA 3DWAA 3VYUA 1RTOA 5JEAH 4QB4A 2Q8IB 4NMZA 2WB1B 4WRDA 2H1EA 1DD2A 4ZAIA 3OMCA 3C1EA 1QE6A 2ICEC 4H44C 2R7ZB 4HCEA 4AYBB 2XWBB 4XQJA 1Z7TA 4IN3A 1Q1BA 2F0FA 2OEOA 2CVRA 2V4DA 5IT9L 4G7ZC 1F77A 1J8IA 4QUCA 1LT5D 3ND8A 3K0YA 1SNMA 2R6GA 4DNRB 5I4DA 4KK7A 1G2TA 1LT6D 4K5WA 2B63B 3I4NB 1ENFA 2EJGC 1E2VA 2VUMB 2NN6I 3IKJA 5JEAG 3I8ZA 4IURA 1V8QA 4PMBA 3LWEA 5C44B 1GHJA 1TS4A 3TP7A 3FPUB 1F9QA 1H9RA 2RQXA 3A56A 2KQ3A 4BS9A 1PTOB 2IX1A 2ZXPA 1D2BA 1D1IA 5COYA 3NTIA 1T5EA 1IYVA 1V1PB 5EBDA 3HGBA 1PMRA 1GUWA 1SE2A 1I50B 1JC7A 5M5YB 3J81L 2NN6G 3AU7A 5EKIA 3C2PA 3O13A 4ME5A 5FO8B 1LTBD 5CORA 5EPKA 1KDCA 1OXUA 3TMEA 1HCZA 1Y8OB 4H13C 1SYEA 1AFPA 3Q0AA 3C1FA 5CBEE 3DXJC 3OIPA 5J22A 5C4ZA 4IUUA 1HQMC 3TP5A 1TVXA 4OIKA 4FXKC 1H9MA 2A69D 4ZKCB 4XIGS 1ZEQX 3F2UA 1SNCA 4X3TA 3VR6A 1PRTC 4BY7B 3GTOB 2F0MA 1EWCA 2RDGA 3V05A 4DNTB 1JORA 2F0EA 3N52A 1IKLA 1QOHA 2ZXOA 1Y1WB 1A6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LV9 A;  1MGS A;  1PFN A;  2IL8 A;  2B2Y A;  1EIG A;  1F9Q A;  2HDM A;  3P7J A;  1BBX C;  4MHE A;  2MJ8 A;  2B2T C;  3I3C A;  5EPJ A;  1G2S A;  1BNZ A;  1B2T A;  1HUN A;  1ILP A;  2MP1 A;  2RSN A;  2L9H A;  5E4W C;  5EJW A;  2K03 A;  4HED A;  2B2W A;  1EIH A;  3HP3 A;  1WTO A;  1WTP A;  1U4M A;  1WTV A;  3ONA B;  4XT3 B;  1CA5 A;  2KEC A;  2L4N A;  1WTQ A;  1DON A;  4IUV A;  2DY8 A;  2BDN A;  2X6L A;  4O42 A;  4CJ1 B;  4IUQ A;  5COY A;  4ZK9 B;  2HDL A;  1WTX A;  1WTR A;  2L11 A;  1ESR A;  2HCI A;  2X69 A;  3I90 A;  5T1G A;  3KUP A;  3I91 A;  1PDQ A;  1EL0 A;  1SAP A;  4HSV A;  1XX8 A;  5E4X A;  4LMQ D;  4XT1 B;  1AP0 A;  3TZD A;  1DOM A;  2EPB A;  1HUM A;  2FIN B;  1F2L A;  1RTO A;  1MSH A;  3SVM A;  2RA4 A;  1G6Z A;  2K05 A;  2B2W C;  1EQT A;  1EOT A;  1SSO A;  1F9R A;  1NR2 A;  1X3Q A;  1GUW A;  2H1E A;  2SDF A;  1F9P A;  2K01 A;  1PFM A;  3MWY W;  1DOL A;  4MN3 A;  3D6W A;  4RA8 A;  4ZAI A;  1C8C A;  2L12 A;  2Q8R E;  2J7Z A;  4RAU C;  1MSG A;  5EPL A;  2B2U A;  1B50 A;  1RHP A;  4IUT A;  2HCC A;  1RTN A;  1VMP A;  2KEE A;  2VXW A;  1G91 A;  2N88 A;  1QE6 A;  2EE1 A;  1A15 A;  5EKI A;  2B2V A;  1Q3L A;  1NCV A;  1O7Z A;  2B2Y C;  3QO2 A;  4HAE A;  1ZXT A;  3H91 A;  5COR A;  1WD1 A;  4ZKB B;  4X3K A;  2RVL A;  1M8A A;  1KNA A;  5CBA E;  1BO0 A;  2N55 A;  1IKM A;  4RWS C;  5EPK A;  1X32 A;  5D14 A;  5AFW A;  4CJ0 B;  1VMC A;  2L1B A;  3DEP A;  1IL8 A;  4IUP A;  3R93 A;  4CJ2 C;  1HFN A;  3TN2 A;  2X6G A;  2NWG A;  2B2U C;  1ML0 D;  1WD0 A;  1HFG A;  2NZ1 D;  2CVR A;  3IL8 A;  4ZLT F;  1U4L A;  2MGS A;  3IFD A;  1DZ1 A;  2KOL A;  4UAI A;  1PLF A;  1KNE A;  1O80 A;  4XDX A;  1F9S A;  2FJ2 A;  1B4O A;  3KBX A;  2FHT A;  4QUC A;  4R9W A;  5CBE E;  2R3Z A;  1ICW A;  2B2V C;  1U4R A;  1X3P A;  1AZQ A;  1QNK A;  2K04 A;  1AZP A;  4IUU A;  1HRJ A;  2D9U A;  2MPM A;  1TVX A;  4OIK A;  1ILQ A;  5D65 A;  4OIJ A;  1E0B A;  1J8I A;  1HHV A;  4HCS A;  1PFB A;  1J9O A;  2RSO A;  2Q8T A;  1XYI A;  3DM1 A;  2FFK B;  2FMM A;  2K28 A;  2EOT A;  2KVM A;  4ZKC B;  1U4P A;  1G2T A;  5DNF A;  3UI2 A;  1CM9 A;  3MTS A;  5T1I A;  2JP1 A;  1NR4 A;  3F2U A;  4DN4 M;  3G7L A;  1B53 A;  1RJT A;  2B2T A;  1NAP A;  1B3A A;  1JE4 A;  1SDF A;  4X3T A;  4X3S A;  1O7Y A;  1WTW A;  3GV3 A;  2K1B A;  1QG7 A;  1DOK A;  2HUG A;  1ROD A;  2NYZ D;  2JYO A;  2KED A;  3DEO A;  3FDT A;  4NW2 A;  3Q6S A;  5CMD A;  3I8Z A;  1HA6 A;  2M2L A;  4IUR A;  4QUF A;  1MI2 A;  1JIC A;  3GV6 A;  3LWE A;  2KUM A;  1IKL A;  3N52 A;  1CA6 A;  4R8I A;  1WVL A;  1BF4 A;  5JJZ A;  2XIW A;  4X3U A;  1S4Z A;  4U68 A;  5EQ0 A;  2DY7 A;  3FPU B; 
#chains in the Genus database with same CATH topology
 1CSP A;  2AQ1 B;  5C5L A;  1EIG A;  2HDM A;  1ET9 A;  4OO1 H;  1SYF A;  4H02 A;  1VQD A;  2A6E C;  5EPJ A;  5GQO A;  1STG A;  5E4W C;  5A2Q L;  4C3H G;  2EYF A;  4I7Z C;  1Q8K A;  1CZW A;  1WCM G;  1Y8P B;  2FXQ A;  3SK8 A;  1GKH A;  2L4N A;  4NPS A;  1EY8 A;  3PUW A;  1STY A;  2ASB A;  3S16 H;  1G6P A;  3FMC A;  2YTV A;  1JOO A;  5IWA Q;  4A3M B;  1C0A A;  2EYO A;  4A3E G;  2EDG A;  1C9O A;  3CKI B;  1X54 A;  3FKI H;  4LF4 L;  3UE0 A;  2GA4 B;  3G6E A;  4IFD J;  2EPB A;  4PMW A;  4LF8 L;  2FIN B;  4DV2 Q;  2OF1 A;  1N36 Q;  1VQ7 A;  2CWA A;  2E8G A;  2JA8 B;  2LKV A;  5AJ3 Q;  3CAM A;  1YIT A;  4ID6 A;  3OYY A;  4MN3 A;  2XNA C;  2Q8R E;  3HZX A;  1XXG A;  5GAG C;  4B9W A;  4DV5 L;  5K5P A;  5EKK A;  2VXW A;  2NUC A;  2PI2 A;  3Q8D A;  3CQZ H;  3HRZ C;  2O2L D;  5LMU Q;  2RKS A;  2UXB L;  5DLQ E;  2RVL A;  2B39 A;  2UXD L;  1TKW B;  3R3O A;  1VDZ A;  1AN8 A;  3GQB A;  2L1B A;  4RHR A;  1IL8 A;  4B3R Q;  3M9B A;  2NZ1 D;  1X55 A;  4Q0F A;  1P16 A;  3X3N A;  4X64 L;  3PO2 H;  4BBR H;  1K28 A;  4BA1 I;  1N32 L;  2K5Q A;  4DAY B;  1EFW A;  4KHP L;  3A7L A;  1GHK A;  2UU9 Q;  1D7Q A;  1D5Z C;  1Q81 C;  2Y0S E;  1STH A;  4DN4 M;  3ER0 A;  5IOC A;  4GZY C;  4JW0 A;  2M9V A;  2ZM6 Q;  2HUG A;  1BDO A;  4JI8 L;  4OX9 Q;  1TWF B;  4J1M A;  3VA5 A;  5L37 A;  3S1M H;  2OQK A;  3A74 A;  4QGU A;  4R8I A;  3HOY H;  5C3W A;  2PW7 A;  3OWF A;  4GNX A;  3PUX A;  4A3L H;  5CR3 A;  3LWU A;  2JA5 G;  3MXG A;  4AH6 A;  3S2D H;  4UY8 C;  3UE1 A;  3AFP A;  3VDY A;  2UUB L;  4DKA C;  4F88 A;  1SE4 A;  1LUZ A;  4XT3 B;  3BG3 A;  2ZT9 C;  4A3B B;  3E0J A;  3AEV A;  2LY7 A;  1K3B C;  2NVX B;  1WYD A;  2BH8 A;  1WTX A;  1XMQ Q;  4TVA B;  5DM6 3;  2CH4 W;  1EY9 A;  3VR2 A;  3K59 A;  1PDQ A;  4JI5 Q;  4MTK A;  3MFG A;  4YWM A;  1F2Y A;  3VR3 A;  3D8G A;  2NVT B;  3OPO A;  1YHA A;  2K05 A;  2Z0S A;  2CFM A;  4BBR G;  4C3H B;  1M4V A;  4MNO A;  1IZ6 A;  1LT3 D;  1WCM B;  2PMZ E;  2K52 A;  2D0O A;  3VYS A;  1HNW L;  3QWN A;  4X65 L;  2GVA A;  1O78 A;  2WIN B;  1CZG A;  2RHS B;  1R9T B;  2PI2 E;  1PRT D;  4A3E B;  3J7A V;  4L6T B;  1VQ5 A;  3NSW A;  1EIF A;  5IGB A;  4LWC A;  4P2C B;  1BQQ T;  2VQE L;  1KNA A;  3FP9 A;  1BO0 A;  1LTR D;  2CH4 A;  3P20 A;  5KYL A;  3HOY G;  5AFW A;  1VMC A;  3DEP A;  1ENC A;  5JPM C;  1OXV A;  4KKS A;  4B3T L;  2A6E D;  1A3U A;  4ZLT F;  2E2H H;  3S1Q H;  2JEA I;  5HGT A;  5FKA C;  1PLF A;  4DF7 A;  2J4X A;  3PO3 G;  1DGS A;  2WP8 J;  3J80 L;  1JB7 A;  1JJG A;  3M7N A;  1PXU A;  1J9O A;  2N8N A;  5C5M A;  2K28 A;  3JC6 6;  4LUV A;  1QIL A;  1U4P A;  1LM0 A;  3SHL A;  3RD4 A;  1STA A;  4B3M L;  1B53 A;  1E24 A;  1IXR A;  1O7Y A;  3RR5 A;  3CMA A;  4RHS A;  5KNB A;  3NE5 B;  1FL0 A;  2AQ2 B;  1YIJ A;  1SBB B;  1HPC A;  4DXF A;  1VQ4 A;  1EY4 A;  5M3F G;  1GJX A;  3W3A A;  5CV8 A;  4X6A H;  5EQ0 A;  4JOI A;  4Q5V A;  1EZ6 A;  2VB2 X;  4LK1 C;  3S16 B;  4PG3 A;  1V9P A;  5IIF A;  1UE6 A;  4KMU C;  2L55 A;  5ELD A;  1MBY A;  2K4K A;  3VYT A;  2OT2 A;  2RSN A;  3HG9 A;  5EJW A;  5TSS A;  4GKK Q;  1QVC A;  2WAC A;  4ZCK A;  5C3X A;  4C56 C;  3FKI B;  4O1N A;  4K0K Q;  2AWO A;  4B08 A;  1S5D D;  1WTQ A;  1E2Z A;  1RKN A;  2XTI A;  4ZK9 B;  4UP7 A;  5LMN L;  4DUY L;  3PF5 A;  2I07 B;  1Y8N B;  2YYZ A;  1LLR D;  1UWV A;  2X69 A;  3EQL C;  1I4G A;  2XN9 C;  4K8J A;  4LMQ D;  3TZD A;  3NK9 A;  1XPU A;  1WTH A;  2VUM H;  1K0R A;  2AUK A;  3SVM A;  5M3M H;  1G8Z D;  1D5M C;  3CQZ B;  1BCP B;  3IRB A;  1SYC A;  1D1K A;  1F9P A;  4NXN L;  5DEH A;  1X3E A;  5G3L D;  3HOV G;  2UUA Q;  2DNC A;  5IWA L;  1KDA A;  1U0L A;  1OTC A;  1RHP A;  1VQI A;  4FP5 D;  3A54 A;  2NBF A;  1IBM Q;  5IGG A;  3EFX D;  4A3G G;  4DV2 L;  3GTQ H;  2H5X A;  1PTO H;  1N36 L;  3H91 A;  1JOK A;  3CCE A;  5AJ3 L;  2WAQ E;  4RWS C;  1JE5 A;  4HJ7 A;  3PO2 B;  3EJI A;  4BBR B;  1KRT A;  4QCL A;  1J6Q A;  1NTG A;  1GVP A;  4B3S Q;  3RMH A;  3T1H Q;  5IP9 G;  1H9J A;  2NTT A;  1Z9F A;  2QF7 A;  4A3J H;  1L1O B;  5LMU L;  1WI5 A;  1QNK A;  2YTX A;  3G71 A;  3K57 A;  4DK1 A;  3HOX G;  3S17 H;  3I4M G;  3S24 A;  3A55 A;  3S1M B;  1Q86 C;  5DNF A;  4B3R L;  3HOY B;  2D0P A;  2J0T D;  1VQA A;  4DNI A;  3S2D B;  1WJJ A;  5C0X H;  3JAM i;  5GAD C;  3NP8 A;  1SN8 A;  5IYB H;  1JB3 A;  4ZYS A;  3H3V C;  3I56 A;  5M5X H;  3TP6 A;  4DR1 Q;  3PO3 B;  4K6L A;  3GV6 A;  3MHB A;  3CCS A;  2K5W A;  2UU9 L;  4KY6 A;  1KRS A;  4IAL A;  4N8X 1;  1EYA A;  2B2Y A;  3BYY B;  2MJ8 A;  2E2I H;  4NDX A;  1PZJ D;  2ZM6 L;  2A5H A;  4IJL A;  4FF2 A;  4OX9 L;  3GTM H;  3KF6 A;  1HNX Q;  1VCI A;  5D3I B;  1CKM A;  1MHW C;  1BBW A;  5C6A A;  1GUS A;  5M3F B;  4R4Q A;  2NVQ B;  4P71 A;  3Q23 A;  1BXT A;  1DOM A;  2PZT A;  3NBH A;  2ZTC A;  2A8V A;  1EQT A;  1TWA H;  1NMG A;  5ELB A;  1K83 B;  3A8J E;  1QNU A;  5EPL A;  1Y1W H;  1XMQ L;  2HCC A;  4LFB Q;  4A93 H;  1JJ2 A;  4JI5 L;  3TEH B;  4WOR A;  2F0I A;  2A69 C;  4CBV A;  1N8R C;  2E2H B;  5J39 A;  4IO9 A;  3QO2 A;  1ZXT A;  1QB5 D;  1SND A;  5CBA E;  3T56 B;  1Y1V G;  2K14 A;  2JK8 A;  1IBK L;  4KN7 C;  5C4X H;  1N9W A;  4KLK A;  3E3X A;  1HR0 Q;  3H0G G;  3I4O A;  1GUT A;  1ML0 D;  5C4J B;  3HOV B;  5LMN W;  3IFD A;  1TS3 A;  3CC4 A;  1NMF A;  4UAI A;  4HIK A;  3URY A;  1F2Z A;  1KDB A;  3WWV A;  3NEN A;  2B2V C;  1XMO Q;  1QVF A;  2QDL A;  1SRO A;  1MJC A;  4HJA A;  4G7H C;  2JA8 H;  1E0B A;  1VQE A;  3I73 A;  3NQI A;  1HHV A;  3S14 H;  4N9P A;  2KVM A;  4KHP Q;  3A0J A;  2QGQ A;  4FVM A;  4RGM A;  2DN8 A;  4IQZ A;  1EUJ A;  5KND A;  4C3I G;  2RDF A;  3U9O A;  2HIV A;  1TU2 B;  5I2Y A;  4RKB A;  4JBM A;  4GKJ Q;  3T16 A;  3CCM A;  4NW2 A;  3K5O A;  3MXN A;  4NP5 A;  1JIC A;  1PTO F;  5FLX c;  4RMF A;  3RUZ A;  4JCV E;  1SE8 A;  3F8T A;  1S4Z A;  3NTK A;  1B3Q A;  2DY7 A;  4LUO A;  1UAP A;  3K6O A;  2JA6 G;  1MGS A;  5BN3 A;  2IL8 A;  1SNQ A;  3PF4 A;  3S1N H;  4CDC C;  3ULP A;  1JJC B;  3M4P A;  1UE5 A;  3KF8 A;  3KBG A;  2NN6 H;  2RBM A;  1C7Y A;  2UUB Q;  2P5Z X;  5M3M B;  5C4X G;  3SGI A;  3HS0 C;  1XWE A;  4K8I A;  4YY3 Q;  1TWC B;  3RLF A;  4OWW B;  3PQI A;  2D5D A;  2L11 A;  4CKE A;  2DJG C;  4K14 A;  4XT1 B;  3PMF A;  2TSS A;  2QDB A;  4YWL A;  3TQY A;  4GKK L;  1MSH A;  2ALY B;  3KLS A;  3SXH A;  3J7Z C;  4K0K L;  1TWF H;  1X3G A;  5CYU A;  4LAA A;  4OWT B;  3GTQ B;  4RGO S;  3MEF A;  3MWY W;  3DUZ A;  3HKZ E;  1Z47 A;  5KNC A;  3NXW A;  1NNX A;  1PZI D;  1QUQ B;  2DJF C;  3J80 E;  3CPW A;  4M1U B;  5ELN A;  1LAC A;  1L0W A;  2B2Y C;  3M3Y H;  1FGB D;  4A3J B;  5LL6 S;  3HOZ G;  1X32 A;  4LFC Q;  2F0H A;  4CDF C;  4TKO B;  4OEM B;  2UUA L;  1HFN A;  3HKS A;  1PV4 A;  1BOS A;  3UDI A;  3S17 B;  1SEB D;  2PZW A;  3MEH A;  2A73 B;  3ULJ A;  5C4H A;  4PZ8 A;  1F9S A;  1GUG A;  2R7D A;  3T51 B;  4B3T Q;  3STB C;  1U4R A;  3PIP A;  3GTG H;  4EGV A;  4UP9 A;  1UE7 A;  2XGT A;  1WCM H;  5D65 A;  1HTL D;  3M4O H;  1Y1V B;  2WAQ G;  4A4I A;  4JVZ A;  1NBW A;  5M5X B;  3QB3 A;  3KDF B;  2OWO A;  2KCM A;  4J6H A;  1CM9 A;  3BVM A;  2JSO A;  1Q1E A;  3BDC A;  4B3S L;  1R9T H;  4NXM Q;  3T1H L;  5M9O A;  4A3K G;  4A3E H;  1SDF A;  3NEM A;  1FD7 D;  1A63 A;  1WTW A;  3D6C A;  4DR3 Q;  2HHH Q;  2JYO A;  2E2I B;  1UE1 A;  1EFI D;  5IP7 H;  3RN5 A;  2A68 D;  3B6Y A;  3L2P A;  3LGJ A;  4X3U A;  4FYD A;  3GTM B;  3JAM L;  1LAB A;  1V1Q A;  2PYK A;  4XQQ A;  2SOB A;  2Z9H A;  1LV9 A;  1EYC A;  1YEZ A;  4U67 3;  3GTK H;  1CK1 A;  3U9S A;  4GN5 A;  1PH5 A;  4C3I B;  1I3Q B;  1Z6H A;  2L9H A;  4F8M A;  4P72 A;  5C0X J;  1D6E C;  2XRS D;  1WTP A;  1WTV A;  1RIP A;  3TZU A;  1ZYR C;  2K7V A;  4DR1 L;  3FPP A;  1BKB A;  3I70 A;  1TWA B;  4DK3 C;  1V43 A;  1S3O A;  1WTR A;  3W2D A;  4KD4 A;  4ODG A;  1PYW D;  1SAP A;  4O0A A;  1B1Z A;  1VQN A;  4A93 B;  3KLR A;  2RA4 A;  4IPH A;  1YZ6 A;  4HR7 B;  3E9H A;  1KAW A;  1HNZ Q;  5FJ8 H;  1HNX L;  1TWG H;  1LTL A;  3D6W A;  4I7A A;  5C4X B;  2KHI A;  4KHV A;  5LHY 1;  4K5X A;  4NXN Q;  4GNX B;  1RTN A;  2KEE A;  3IFT A;  4HTH A;  1QZG A;  1XNQ Q;  1Y14 B;  4AQY Q;  4KTA A;  3WOF A;  1ET6 A;  3G6J B;  1EOV A;  1E7Z A;  2F0L A;  3GTP H;  4ZKB B;  1HZ9 A;  4C2M H;  5KGU A;  5IP7 G;  3D4W A;  1A8V A;  1I5F A;  1MD2 D;  5BN4 A;  3KDF A;  4MZ9 A;  2B2U C;  1PH8 A;  2L5T A;  3K81 C;  3KOJ A;  4LFB L;  3S14 B;  5ISR A;  4GLX A;  2JA5 H;  1VQM A;  2AWN A;  1O80 A;  4FF1 A;  4R9W A;  1A2U A;  1TXY A;  1X3P A;  4ZUJ A;  4EVO A;  1AZQ A;  2K04 A;  1EY5 A;  1QWY A;  5LL6 X;  3C46 A;  2OTL A;  4JI0 Q;  5J3B A;  5JEA J;  4AYB E;  1HR0 L;  2FMM A;  3OWE B;  4GN3 B;  5CC4 A;  2CHB D;  4XQN A;  2IT1 A;  5NUC A;  1YNN D;  1X9N A;  3J7A 5;  2EXD A;  4IJH A;  1YNX A;  1XMO L;  3S1N B;  1KHI A;  2BOS A;  4P74 A;  2N3S A;  1JWS D;  2ENB A;  3L3O C;  5JJZ A;  3QOJ A;  4R8N A;  5FJ8 G;  4GLA C;  4RGN A;  4R4O A;  1PFN A;  1TWH H;  1LO5 D;  1ICF B;  3CF5 A;  3CCV A;  5GAE C;  4A3K B;  1A0I A;  1FJG Q;  4GKJ L;  1B7Y B;  3FVQ A;  4R4C A;  1TY0 A;  3ONA B;  1CA5 A;  4IPC A;  2BDN A;  3ICE A;  1U5K A;  3MC0 B;  3FHW A;  1IYJ B;  1OXX K;  2Z4I A;  1KD1 C;  2CQA A;  2D2C C;  2KA7 A;  1YNJ C;  4KJO A;  1TII D;  1K8A C;  1SNO A;  4HSV A;  2SNM A;  3STB D;  1HUM A;  3OW7 A;  2ES2 A;  2HT1 A;  4HJ8 A;  2WKC A;  3PO3 H;  3EBE A;  3M3Y B;  1JCK B;  3OIQ A;  5H1S E;  1C8C A;  3QIA A;  4YY3 L;  1M1K C;  2LXK A;  3GD7 A;  3VA7 A;  3DLL A;  3BDO A;  3TRE A;  1B9N A;  3K5L A;  4M8A A;  3M85 A;  3ERO A;  1NCV A;  1O7Z A;  2AUJ D;  4TQU S;  3PIO A;  4DR2 Q;  1ENA A;  3H15 A;  4G4K A;  1IKM A;  5JAV A;  1UUP A;  1K8G A;  3OW2 A;  2DNE A;  3GTG B;  1S5E D;  1N34 Q;  3R93 A;  1A2T A;  1R4P B;  2F3V A;  5M3F H;  1IBK Q;  2NVQ H;  3W1G A;  4CDD C;  3M4O B;  1HFG A;  2XWJ B;  1CKO A;  2KOL A;  1X3F A;  2VNU D;  4RKL A;  1KAB A;  1ZYR D;  1XTC D;  2UUC Q;  1B70 B;  1K83 H;  1JR0 D;  3NQT A;  4LFC L;  1EQQ A;  1ZKO A;  3DM1 A;  1AE3 A;  1XPR A;  2JA7 H;  4QIW B;  1RJT A;  1NAP A;  4Y7N H;  1O7I A;  3GTJ H;  1QG7 A;  3PUV A;  3FDT A;  3GTK B;  1ROD A;  2NB0 A;  2R7F A;  1HA6 A;  3OOC A;  4GOP C;  3Q22 A;  4HN7 A;  2JA9 A;  2IX3 A;  1BF4 A;  2A19 A;  3PSI A;  3UDX A;  2F0P A;  3PUY A;  2F0N A;  5C4J H;  1AE2 A;  5DM7 3;  2Z1C A;  2VY3 A;  3SDZ A;  1T5X D;  4JI2 Q;  4NXM L;  3HOV H;  2B2T C;  1EWI A;  1B2T A;  2VS1 A;  5JOB A;  3BZD B;  3MVV A;  2HQE A;  4DR3 L;  1LYL A;  2HHH L;  2E2D C;  4A3G H;  3DWP A;  3F2D A;  3R2I A;  3GO5 A;  4IUV A;  2X6L A;  1VQ8 A;  1SYB A;  2F0J A;  1BCP F;  1YHB A;  3CPF A;  3KFU A;  4EQ5 A;  1HR0 W;  4A3D H;  2F0G A;  1TWG B;  3VR5 A;  2MUY A;  2BH2 A;  5IP9 H;  1IL2 A;  3WDN A;  5E7N A;  4Z9C B;  1HA5 A;  1II3 A;  4LF6 Q;  4HJ5 A;  3S15 H;  2Z8L A;  4LJZ C;  4FXG C;  4CGY B;  3GTP B;  1PFM A;  1QVG A;  3HOX H;  4C2M B;  3I4M H;  2JA7 G;  2IY5 B;  1VMP A;  4L5R C;  1HZB A;  1SJE D;  3M7G A;  2B2V A;  1X6O A;  3ERS X;  2G5D A;  3V96 A;  3NEL A;  2JA5 B;  1GUN A;  3S1R B;  4DXG A;  4BY1 G;  1BUV T;  1HNZ L;  1LT4 D;  2F3W A;  3I7F A;  5CV6 A;  1TWC H;  4C1N K;  3KF6 B;  3TN2 A;  1Q46 A;  2CCZ A;  1U4L A;  3HEJ A;  1XNQ L;  4CKC A;  2FJ2 A;  4AQY L;  2YU9 H;  3W1B A;  4JC0 A;  3JAM E;  3NBH B;  3AFQ A;  1IYU A;  2F0U A;  1W2B A;  2EJM A;  2RHQ B;  2RSO A;  1YNJ D;  1CFM A;  4H0L C;  3ZYY X;  5IE8 A;  1STB A;  3PIO 3;  1YHQ A;  1H9S A;  2K5N A;  1EY7 A;  1DCZ A;  4A3D G;  4EQO A;  4K2K A;  3RZO H;  1IHZ A;  5IGF A;  4K6D A;  3L0O A;  3T53 B;  1TWH B;  4N8F A;  2NYZ D;  5CMD A;  1M90 C;  2M2L A;  3NWT A;  1VQB A;  4PMC A;  3QG1 A;  4NKL A;  4JI0 L;  2QCP X;  3DM3 A;  3NPP A;  1EU4 A;  1EQR A;  4AYB G;  3KK7 A;  4RFB A;  2A6H C;  4HIM A;  1VQJ A;  1G29 1;  5FLM H;  4DA2 A;  2D62 A;  3J81 i;  1PRT B;  2K6A A;  3D4R A;  4IUN A;  4J15 A;  2IW3 A;  5IYD G;  1NE3 A;  3BDL A;  1JWU D;  1SYD A;  1Y1V H;  4RH6 A;  2HQL A;  2F4V Q;  4A3F G;  1L0X B;  3A5U A;  4C3J H;  4FDB A;  2HCI A;  1VF5 C;  3H0G H;  1UNS A;  1PH1 A;  4DV1 Q;  1B8A A;  1SE3 A;  3FEW X;  4JI6 Q;  2Y0S G;  1FJG L;  4V0B A;  2ID0 A;  3ND9 A;  3TS2 A;  1EOT A;  3K7A H;  2EVB A;  3I4N G;  2K33 A;  2MFI A;  1LTT D;  5ELF A;  4IZ8 A;  3MXN B;  2KHS A;  1EEF D;  2I0Q A;  1MSG A;  1VQL A;  1B50 A;  1PTO D;  2XRQ D;  1RF2 D;  3N6R A;  4C3I H;  1I3Q H;  1FNU A;  4ZRZ A;  1Q3L A;  1ONL A;  1GO3 E;  4WJW A;  5BR8 Q;  1GD7 A;  1Q82 C;  1PH2 A;  3CD6 A;  1HJP A;  4X3K A;  3PGZ A;  2F1M A;  3F1Z A;  3KF8 B;  2N49 A;  1E1T A;  1ASZ A;  2LXJ A;  4CDE C;  3KJP A;  1AW7 A;  4LF5 Q;  3IL8 A;  4A3I H;  4WJ3 M;  2XVS A;  2A68 C;  3BVZ A;  1JQY D;  4IPD A;  1HQR D;  2JA6 H;  2JA7 B;  1ILP A;  2FHT A;  1EIY B;  2R3Z A;  3CU7 A;  4JBK A;  1DJR D;  1K3R A;  3BZK A;  2SEB D;  5FLM G;  4Y7N B;  4I65 A;  4DR2 L;  2E76 C;  3EN2 A;  3GTJ B;  2JJQ A;  2QKI C;  2EY1 A;  5CGK A;  2VQF Q;  1PFB A;  3R2T A;  1L0Y B;  4KJN A;  2RDH A;  1N34 L;  1W3S A;  4BY1 B;  2Q2I A;  2QEX A;  2B29 A;  4ZQ3 A;  3MTS A;  4IFD I;  3J81 j;  1NR4 A;  3FRP B;  2AMC B;  4C3J G;  1FR3 A;  2XSC A;  3MXP A;  2BA0 A;  5EAY A;  3C3L A;  5EKL A;  3OHX C;  2OTJ A;  1TY2 A;  2K1B A;  2PQA A;  2EXZ A;  1HXY D;  2UUC L;  3CC7 A;  5CV9 A;  4QUF A;  1MI2 A;  2DGY A;  1CA6 A;  4FO2 A;  1WVL A;  4A3G B;  3M4Q A;  4PZ7 A;  2LFN A;  2WII B;  5JJK A;  4KN4 C;  4ABN A;  2GVB A;  2VW9 A;  2B3G A;  4A3D B;  5FLX L;  2E74 C;  3A8K E;  4C1N I;  2EYH A;  3LX0 A;  2I46 A;  3NHH A;  4KV6 A;  3I2Z A;  1CHP D;  4O42 A;  1K9M C;  2ZTD A;  1KIX A;  2F0T A;  2HDL A;  3S15 B;  3HOZ H;  4A3C G;  4JI1 Q;  3MFY A;  1I6H H;  3HOW H;  5E4X A;  2Z6B A;  4A3I G;  4JI2 L;  3HOX B;  2EJF C;  2R93 H;  3I4M B;  5C3E H;  1SMY C;  1KLU D;  3H3V H;  1RD9 D;  1O7L A;  4KD3 A;  2B2W C;  2MNA A;  1PH6 A;  4R4I A;  2PPB C;  3H3V I;  1DYQ A;  4B9X A;  1KAA A;  4YCW A;  2ZJQ A;  1X3Q A;  1AH9 A;  1CKN A;  2F0K A;  2BE5 C;  4BY7 G;  2JQO A;  2L12 A;  4IFD G;  4RAU C;  3K5N A;  2B2U A;  2NZH A;  4DAM A;  4IUT A;  2IPK D;  5JVH 3;  2PCF B;  4A3F B;  1G51 A;  1PH7 A;  2VL6 A;  2YV5 A;  5IT9 c;  5IYC H;  4DFA A;  1PFS A;  4XYQ A;  4A3K H;  2I5L X;  2YU9 B;  2Y0S B;  1CHQ D;  4LF6 L;  2O5I C;  3RLN A;  2KHJ A;  1YNN C;  1CTM A;  5HGQ A;  2E2J H;  1EEI D;  2IWH A;  5CV5 A;  2A6H D;  1WD0 A;  1R4Q B;  2EYJ A;  4DR5 Q;  1HZC A;  5KRU A;  3HOU G;  3IAY A;  1GXD C;  4DU9 A;  4DPG A;  2RCN A;  4BWG B;  1WFQ A;  2M00 A;  3SK5 A;  3J7Y W;  4G7O C;  3RZO B;  4F87 A;  2D9U A;  4UPA A;  1STN A;  1V1O A;  1EU3 A;  2AQ3 B;  1YVC A;  2IHF A;  1XYI A;  3SE0 A;  2E5L Q;  1UEA B;  3UI2 A;  2PW5 A;  2OCE A;  2Q2H A;  2F4I A;  2ICI A;  4JBW A;  5ELO A;  3HOW G;  2R61 A;  1PVO A;  1JT8 A;  3DWQ A;  3CME A;  4DV6 Q;  2R93 G;  5C3E G;  2KED A;  2K5D A;  4BBS G;  1SRU A;  1PZK D;  4KY7 A;  2KUM A;  4RGT A;  3SK4 A;  4UP8 A;  3BU2 A;  1VQO A;  4U68 A;  3SK6 A;  4OWX B;  2ZJP A;  4IOC A;  3P7J A;  4JYA Q;  2KBN A;  1I4H A;  3D3R A;  4C3J B;  5KIX A;  3H0G B;  2K03 A;  2PMZ B;  3A8I E;  5IYC G;  2F52 A;  1BCP C;  1WTO A;  4DR4 Q;  2KCN A;  4G57 A;  4BXX G;  2Q2T A;  5HUR A;  4HSP A;  3CW2 C;  2LMC B;  2EYL A;  3CRK C;  3K7A B;  1PHJ A;  2NVY B;  3U4V A;  1PYB A;  1HH2 P;  1W6K A;  5T1G A;  5FOB B;  3KUP A;  3I91 A;  3SR1 A;  2EY5 A;  3RZD H;  2L0C A;  3CHB D;  2I5M X;  3J81 c;  3L9A X;  1LTG D;  1IW7 C;  2SDF A;  3J80 i;  4RA8 A;  1KQS A;  3I4L A;  2F4V L;  1EYG A;  3S2H H;  3TDQ A;  4PQX A;  2ZXR A;  4CHT B;  1EY6 A;  2WV6 D;  2MQH A;  2KJX A;  1G91 A;  4OEL B;  2N88 A;  1YJN A;  1L1O C;  5DAU A;  4QMG A;  3CCU A;  3D4D A;  4DV1 L;  4A3I B;  4JI6 L;  4HAE A;  4DUZ Q;  2JA6 B;  4L63 B;  1OXT A;  2JE6 I;  5M5W H;  4BA2 I;  1I4R A;  5D14 A;  1VQH A;  3G48 A;  3CC2 A;  2N78 A;  2F0W A;  2NWG A;  5I6Y A;  3S9W A;  4A3B G;  1LTA D;  1J5E Q;  1DZ1 A;  1TS2 A;  2K5V A;  4DAP A;  1E2W A;  1XTD A;  4OL7 A;  1OO9 B;  5BR8 L;  3A7A B;  1I4P A;  4XYO A;  2MPM A;  4GOP A;  3T13 A;  3QOL A;  4QJF A;  3ITP A;  4POG A;  3NUC A;  1MKH A;  5EBC A;  4FXD A;  2EOT A;  3P75 A;  1BVS A;  3U4Z A;  4ULL A;  4OO1 I;  4LF5 L;  3H09 A;  1FNW A;  1V1P A;  1NUC A;  1QCB D;  1SMY D;  2B2T A;  2WB1 E;  1NJI C;  3KJO A;  1VF7 A;  3GV3 A;  3HOU B;  2WKD A;  1DOK A;  3HFZ B;  1OXS C;  4ILW A;  1VQP A;  2BE5 D;  3S1R H;  4J8Q A;  3OTO L;  4Y52 H;  2VQF L;  3H6M A;  4JI4 Q;  5A35 A;  1DXM A;  2Z4H A;  5K36 H;  4K2L A;  4P75 A;  1S5F D;  2BDO A;  2K5H A;  4DK6 C;  3HOZ B;  1QJO A;  3I3C A;  2I5H A;  2PQE A;  4HED A;  1I6H B;  3HOW B;  3ERQ A;  3HP3 A;  4CKB A;  1U4M A;  1PYS B;  3BZC A;  2R93 B;  3BVG A;  2KEC A;  3K0X A;  3PCO B;  5C3E B;  3GP7 A;  4BBS B;  4IUQ A;  2C9O A;  3EA6 A;  4S3S A;  3CCQ A;  4MIU A;  2G9H D;  2V1C C;  1N33 Q;  1EL0 A;  3MXU A;  1KL9 A;  4KI0 A;  4LFA Q;  2WAQ B;  3PIP 3;  1F2L A;  1NY4 A;  1MJE A;  5I2X A;  3T1Y Q;  2R92 H;  3TBI B;  3LNN A;  4TRD A;  1DOL A;  1E22 A;  4OO1 G;  1EYD A;  2J7Z A;  3D31 A;  4JI1 L;  4K5V A;  2E2J B;  2IX0 A;  3TP8 A;  1I4Q A;  2F03 A;  3W5O A;  3GTL H;  3NWS A;  1M8A A;  4YIJ A;  3PUZ A;  4QQB X;  2H4O A;  4OHJ A;  3H94 A;  4L5Q A;  1KC8 C;  5JJL A;  3U58 A;  2IJ0 A;  3AYH B;  4CJ0 B;  3K58 A;  3FKI G;  4DV0 Q;  1P8L A;  5K36 G;  2F0Q A;  1RCV D;  2G9D A;  1BCP D;  1Q8I A;  1SR3 A;  2LSS A;  3KBX A;  2ZJR A;  2Z6K C;  3E0E A;  2QIL A;  4PZ6 A;  1I94 Q;  4DV7 Q;  4KKT A;  4ZUI A;  1ILQ A;  2MHV A;  4OIJ A;  3T4A C;  5IGC A;  2EQS A;  5FO7 B;  2Q8T A;  5JJI A;  2O5J C;  2FFK B;  1JOQ A;  5I6W A;  3G7L A;  4X62 Q;  2VZA A;  4DR5 L;  2K32 A;  1T9H A;  5FLX E;  1B3A A;  1JE4 A;  1WOC A;  4FF4 A;  3F2C A;  4X3S A;  3HKZ G;  1CT1 D;  4A76 A;  2EY2 A;  1IW7 D;  4N9T A;  5EGT A;  2R92 G;  4YHH Q;  3BYT B;  1FYC A;  2XIW A;  1CUK A;  2A74 C;  2DUD A;  2E5L L;  2L15 A;  1VQG A;  1C48 A;  4V19 0;  1BBX C;  3PO2 G;  4MHE A;  2PO4 A;  4ALP A;  5IY0 A;  1HUN A;  1TT2 A;  3PV0 A;  4DV6 L;  2SNS A;  3DMU A;  5IT9 E;  3MA2 B;  4EQN A;  1GOZ A;  4POF A;  3RZD B;  1S5C D;  1PTO C;  2HIX A;  4EX5 A;  4WFN 3;  2AHO B;  5IOD A;  1VS0 A;  3EVQ A;  2Q2U A;  1GUO A;  2TMP A;  4BY1 H;  4F7X A;  5J1Z A;  1H95 A;  3VR4 A;  4JYA L;  1AP0 A;  4L5T A;  1H9S B;  4IPG A;  4O2D A;  3UDG A;  3S2H B;  1B9M A;  3L7Z C;  4DAY A;  1AEX A;  3MZ5 A;  1HTP A;  1LTI D;  4L8J A;  4DR4 L;  2B8G A;  1KTK A;  1IBL Q;  3U50 C;  4A3L G;  1SSO A;  1F9R A;  1CI3 M;  1PA6 A;  4EQP A;  3R8B A;  1SFO H;  1TQO A;  3AB9 A;  5M5W B;  3KYH C;  2VB3 X;  4H7B A;  2PNR C;  1STE A;  3DHQ A;  5FO9 B;  1YJW A;  2JEB I;  4ME3 A;  1RL2 A;  2EE1 A;  3P1H A;  3UDF A;  1FNV A;  1TR5 A;  1CQF A;  4NB3 A;  1WD1 A;  5IGD A;  4RCN A;  2N55 A;  1A3T A;  2CW0 C;  5E3F A;  2MO0 A;  4X66 Q;  3J80 c;  4JI3 Q;  4YCV A;  4IUP A;  2EIF A;  4CJ2 C;  4XTC S;  3NBI A;  5JPN C;  1LTS D;  2X6G A;  2EYP A;  4OGQ C;  1CQV A;  2MGS A;  3I55 A;  3BJU A;  2KEN A;  2R7Z H;  4UDU C;  1VQ9 A;  1MIU A;  1KNE A;  2LS0 1;  1ICW A;  4AIM A;  3Q24 A;  2F0S A;  2F0D A;  4RCO A;  4DUZ L;  1AZP A;  2OXP A;  4DV4 Q;  4JK1 C;  3E5S A;  1I4X A;  2BCO A;  1Y69 U;  5IYD H;  1KLG D;  5T1I A;  4JV5 Q;  4LF9 Q;  2UXC Q;  4A3F H;  1J5E L;  3RNU A;  1Q90 A;  1S40 A;  5I9P A;  1SYG A;  3BS1 A;  4QF4 A;  3DEO A;  3Q6S A;  1D5X C;  1I6V C;  4FF3 A;  1L2F A;  3J81 E;  4JG2 A;  1C4Q A;  1DM0 B;  1PRT F;  5D3D A;  2B63 H;  2MO1 A;  1JWM D;  3NTH A;  3QJY A;  4KKU A;  3I4N H;  1NSN S;  5ELE A;  1HZA A;  2EZV A;  3CRL C;  2C35 B;  1TS5 A;  1D8L A;  1G2S A;  2F0O A;  3X3M A;  2MP1 A;  2WB1 G;  5C44 H;  5JVG 3;  4E6I A;  3M4Y A;  1VQ6 A;  4L5S A;  2B2W A;  1Q7Y C;  2B8F A;  3HKZ B;  4RG1 A;  4FNF A;  3TSS A;  5GAH C;  4A75 A;  1YJ9 A;  1XNR Q;  2DY8 A;  3E6Z X;  4OXP A;  4GNX C;  4JI4 L;  2R92 B;  4DGZ A;  3J7A F;  5E1F A;  2K50 A;  2F0V A;  1W6J A;  2AKW B;  3V2T A;  1S5B D;  4LF7 Q;  2R7Z G;  1G6Z A;  1K8O A;  1Q12 A;  2QEJ C;  2QW7 A;  1NR2 A;  2PQA B;  1RDP D;  3GTL B;  2EY6 A;  2PZU A;  2K01 A;  2RF4 A;  1ASY A;  3RN2 A;  4DR7 Q;  4IOA A;  1K8M A;  4YWK A;  4DR6 Q;  2E75 C;  1N33 L;  2JXM B;  2KCC A;  3CCL A;  4APV A;  3VYR A;  1A15 A;  4LFA L;  5CV4 A;  1EQV A;  1I50 H;  5BN5 A;  3F2B A;  4P73 A;  2EYM A;  3T1Y L;  4DK0 A;  2BA1 A;  4MTN A;  5A2Q E;  2O4X A;  4KY5 A;  4JI7 Q;  5M5Y H;  2JN4 A;  1JMC A;  3K5M A;  1B44 D;  2B63 G;  2NVY H;  4HMI A;  4KHZ A;  2KCT A;  3I72 A;  5ELC A;  1VQK A;  2IHE A;  2VUM G;  5C0X I;  1F2M A;  4OON A;  5M3M G;  4DV3 Q;  5KYI A;  4XDX A;  1B4O A;  1EZ8 A;  1VQC A;  2C5C A;  1H9K A;  4XXE A;  5C44 G;  5CV7 A;  1HRJ A;  1YI2 A;  4HCS A;  4DAV A;  2ZTE A;  1A3V A;  2F3I A;  1CKN B;  4DV0 L;  2JP1 A;  2FMC A;  4A3C H;  2CQO A;  1FGU A;  1S72 A;  5I9O A;  1EWH A;  1SXT A;  5G3L F;  1BBU A;  3OSO A;  3TRZ A;  1I94 L;  2A1A A;  4DV7 L;  4R1J A;  1Y1W B;  3KLW A;  4TSS A;  3SEB A;  1EY0 A;  3OTO Q;  2NTS A;  4BY7 H;  1ESF A;  4PNY A;  1SNP A;  4A3J G;  3GTO H;  4X62 L;  4IFD H;  4LF4 Q;  4HMJ A;  1BNZ A;  4LF8 Q;  3MAQ A;  1BR9 A;  4GS3 A;  5KEE A;  3WOE A;  4QIW E;  3AMU A;  1EIH A;  2CW0 D;  3CXC A;  3ULL A;  3RLO A;  3D0F A;  1DON A;  1SJH D;  4LNQ A;  4CJ1 B;  4JBJ A;  4YHH L;  2CKZ B;  4JOI C;  5FK9 C;  4DV5 Q;  1ESR A;  4PV1 C;  3S1Q B;  3I90 A;  5C0X G;  5IGE A;  1SFO B;  1XX8 A;  5IYB G;  1L1O A;  3OMG A;  3KLS X;  5F2D A;  1U9R A;  3DWA A;  3HOU H;  3VYU A;  1RTO A;  5JEA H;  3K7U C;  2UXB Q;  4QB4 A;  2Q8I B;  4NMZ A;  2WB1 B;  4WRD A;  1A62 A;  1CSQ A;  2UXD Q;  4A3M H;  2H1E A;  3QR8 A;  1DD2 A;  4ZAI A;  4HJ9 A;  3OMC A;  4GLV B;  3C1E A;  2CWP A;  5GRO A;  1QE6 A;  4X64 Q;  2ICE C;  4H44 C;  1N32 Q;  2R7Z B;  4HCE A;  4AYB B;  1IBL L;  2XWB B;  4XQJ A;  4BBS H;  3CP0 A;  2RCF A;  1YBY A;  2GN5 A;  1Z7T A;  4IN3 A;  1Q1B A;  2F0F A;  2OEO A;  4HID A;  2CVR A;  2V4D A;  5IT9 L;  4WJ4 A;  4G7Z C;  1F77 A;  3CCJ A;  4QUC A;  1J8I A;  1LT5 D;  1K73 C;  4JI8 Q;  1UEB A;  3ND8 A;  3K0Y A;  1X56 A;  1SNM A;  4QL5 A;  2R6G A;  4DNR B;  1Y1W G;  4X66 L;  1PH9 A;  4JI3 L;  5I4D A;  4BXX H;  4KK7 A;  4A93 G;  1G2T A;  1LT6 D;  4K5W A;  5HY6 A;  2B63 B;  3I4N B;  1ENF A;  1XPO A;  2EJG C;  1XJV A;  1E2V A;  3A5Z B;  2VUM B;  2NN6 I;  3IKJ A;  5JEA G;  3I8Z A;  4LW1 A;  4IUR A;  1V8Q A;  4PMB A;  3LWE A;  5C44 B;  4A3M G;  4DV4 L;  3ZJY C;  4HIO A;  1GHJ A;  1TS4 A;  3TP7 A;  3FPU B;  3EIV A;  4JV5 L;  4LF9 L;  1F9Q A;  1H9R A;  2UXC L;  2RQX A;  3A56 A;  2KQ3 A;  2HD3 A;  2WFW A;  4BS9 A;  2JA8 G;  1PTO B;  2IX1 A;  4LUZ A;  2ZXP A;  1D2B A;  1D1I A;  5COY A;  1HNW Q;  4GOP B;  2K75 A;  3K8A A;  3NTI A;  4X65 Q;  4GN4 B;  1T5E A;  1X65 A;  4R4T A;  1IYV A;  1V1P B;  4A3B H;  1SMX A;  5EBD A;  2VQE Q;  1SLJ A;  3HGB A;  2NVX H;  1PMR A;  1XNR L;  1GUW A;  1SE2 A;  1I50 B;  2NZO A;  1IBM L;  4UHV A;  4YCU A;  1JC7 A;  2PNH A;  5M5Y B;  2NVT H;  1K0S A;  1A6X A;  3GDE A;  4C3H H;  3E9I A;  3J81 L;  4LF7 L;  2NN6 G;  3AU7 A;  5EKI A;  3C2P A;  3O13 A;  2Z6K A;  4ME5 A;  1LTB D;  5FO8 B;  5COR A;  5EPK A;  1KDC A;  1OXU A;  3TME A;  1PH4 A;  3TS0 A;  1HCZ A;  1QZH A;  3CCR A;  4DR7 L;  1Y8O B;  4B3M Q;  4H13 C;  1PH3 A;  4DR6 L;  1SYE A;  4JPB W;  1AFP A;  3Q0A A;  2YTY A;  3C1F A;  5CBE E;  3DXJ C;  4QY7 A;  3OIP A;  5J22 A;  5C4Z A;  1E3P A;  1HQM C;  4IUU A;  3TP5 A;  1TVX A;  4OIK A;  4FXK C;  1H9M A;  2A69 D;  4JI7 L;  2QA4 A;  4ZKC B;  1GM5 A;  4XIG S;  1ZEQ X;  3F2U A;  3JAM c;  1SNC A;  1FVI A;  1VQF A;  4X3T A;  3VR6 A;  4DV3 L;  1PRT C;  4BY7 B;  3GTO B;  2F0M A;  1EWC A;  2RDG A;  3AQQ A;  3V05 A;  4DNT B;  1JOR A;  2F0E A;  3K80 C;  3N52 A;  1IKL A;  2ATW A;  1QOH A;  1KXL A;  1E1O A;  5LMN Q;  4DUY Q;  2OQ0 A;  2ZXO A;  1QUQ A;  3G4S A; 
#chains in the Genus database with same CATH homology
 2AQ1 B;  5C5L A;  1EIG A;  2HDM A;  1ET9 A;  4OO1 H;  1SYF A;  2A6E C;  5EPJ A;  1STG A;  5E4W C;  5A2Q L;  4C3H G;  2EYF A;  4I7Z C;  1CZW A;  1Y8P B;  3SK8 A;  2L4N A;  1EY8 A;  3PUW A;  1STY A;  3FMC A;  1JOO A;  4A3M B;  2EYO A;  2EDG A;  3CKI B;  4IFD J;  2GA4 B;  2EPB A;  4PMW A;  2FIN B;  2OF1 A;  2JA8 B;  2LKV A;  4ID6 A;  4MN3 A;  2XNA C;  2Q8R E;  3HZX A;  1XXG A;  4B9W A;  5K5P A;  5EKK A;  2VXW A;  2NUC A;  3HRZ C;  2O2L D;  2RKS A;  2RVL A;  2B39 A;  1TKW B;  3R3O A;  1VDZ A;  1AN8 A;  3GQB A;  2L1B A;  4RHR A;  1IL8 A;  2NZ1 D;  4Q0F A;  3X3N A;  4BA1 I;  2K5Q A;  3A7L A;  1GHK A;  1D5Z C;  1STH A;  4DN4 M;  5IOC A;  4GZY C;  2M9V A;  2HUG A;  1BDO A;  1TWF B;  4J1M A;  3VA5 A;  4R8I A;  5C3W A;  2PW7 A;  3OWF A;  3PUX A;  5CR3 A;  3LWU A;  3MXG A;  4F88 A;  1SE4 A;  4XT3 B;  3BG3 A;  2ZT9 C;  4A3B B;  3E0J A;  2LY7 A;  2NVX B;  1WTX A;  5DM6 3;  3VR2 A;  1EY9 A;  3K59 A;  1PDQ A;  3MFG A;  1F2Y A;  3VR3 A;  3D8G A;  2NVT B;  3OPO A;  2K05 A;  4C3H B;  1M4V A;  1LT3 D;  1WCM B;  3VYS A;  3QWN A;  1O78 A;  2WIN B;  1CZG A;  1R9T B;  1PRT D;  4A3E B;  3J7A V;  4L6T B;  3NSW A;  5IGB A;  4P2C B;  1BQQ T;  1KNA A;  1BO0 A;  1LTR D;  3P20 A;  5KYL A;  5AFW A;  1VMC A;  3DEP A;  1ENC A;  5JPM C;  1OXV A;  4KKS A;  2A6E D;  1A3U A;  4ZLT F;  2JEA I;  5HGT A;  5FKA C;  1PLF A;  4DF7 A;  2J4X A;  2WP8 J;  3J80 L;  3M7N A;  1PXU A;  1J9O A;  5C5M A;  2K28 A;  1QIL A;  1U4P A;  3SHL A;  3RD4 A;  1STA A;  1B53 A;  1O7Y A;  4RHS A;  5KNB A;  3NE5 B;  2AQ2 B;  1SBB B;  1HPC A;  4DXF A;  1EY4 A;  1GJX A;  3W3A A;  5CV8 A;  5EQ0 A;  4Q5V A;  1EZ6 A;  2VB2 X;  4LK1 C;  3S16 B;  5IIF A;  4KMU C;  2L55 A;  5ELD A;  1MBY A;  3VYT A;  2OT2 A;  2RSN A;  3HG9 A;  5EJW A;  5TSS A;  2WAC A;  5C3X A;  4C56 C;  3FKI B;  4O1N A;  2AWO A;  4B08 A;  1S5D D;  1WTQ A;  1E2Z A;  1RKN A;  4ZK9 B;  2I07 B;  1Y8N B;  2YYZ A;  1LLR D;  2X69 A;  3EQL C;  1I4G A;  2XN9 C;  4K8J A;  4LMQ D;  3TZD A;  3NK9 A;  2AUK A;  3SVM A;  1G8Z D;  1D5M C;  3CQZ B;  1BCP B;  1SYC A;  1D1K A;  1F9P A;  5DEH A;  5G3L D;  2DNC A;  1KDA A;  1RHP A;  4FP5 D;  3A54 A;  2NBF A;  5IGG A;  3EFX D;  1PTO H;  3H91 A;  1JOK A;  4RWS C;  3PO2 B;  3EJI A;  4BBR B;  4QCL A;  3RMH A;  1H9J A;  2NTT A;  2QF7 A;  1QNK A;  3K57 A;  4DK1 A;  3A55 A;  3S1M B;  5DNF A;  3HOY B;  2J0T D;  3S2D B;  5C0X H;  3NP8 A;  1JB3 A;  4ZYS A;  3H3V C;  3TP6 A;  3PO3 B;  4K6L A;  3GV6 A;  3MHB A;  2K5W A;  4KY6 A;  4IAL A;  1EYA A;  2B2Y A;  3BYY B;  2MJ8 A;  4NDX A;  1PZJ D;  2A5H A;  4FF2 A;  1VCI A;  5D3I B;  5C6A A;  1GUS A;  5M3F B;  2NVQ B;  3Q23 A;  1BXT A;  1DOM A;  2PZT A;  3NBH A;  1EQT A;  5ELB A;  1K83 B;  3A8J E;  1QNU A;  5EPL A;  2HCC A;  4WOR A;  2F0I A;  2A69 C;  4CBV A;  2E2H B;  5J39 A;  3QO2 A;  1ZXT A;  1QB5 D;  1SND A;  5CBA E;  3T56 B;  4KN7 C;  1GUT A;  1ML0 D;  5C4J B;  3HOV B;  3IFD A;  1TS3 A;  4UAI A;  3URY A;  1F2Z A;  1KDB A;  2B2V C;  4G7H C;  1E0B A;  3I73 A;  3NQI A;  1HHV A;  4N9P A;  2KVM A;  4FVM A;  4RGM A;  2DN8 A;  4IQZ A;  5KND A;  4C3I G;  2RDF A;  3U9O A;  1TU2 B;  5I2Y A;  4RKB A;  3T16 A;  4NW2 A;  3K5O A;  3MXN A;  4NP5 A;  1JIC A;  1PTO F;  3RUZ A;  1S4Z A;  3NTK A;  2DY7 A;  1UAP A;  3K6O A;  1MGS A;  5BN3 A;  2IL8 A;  1SNQ A;  3KF8 A;  3KBG A;  2NN6 H;  2RBM A;  5M3M B;  3HS0 C;  1XWE A;  4K8I A;  1TWC B;  3RLF A;  2D5D A;  2L11 A;  4CKE A;  4K14 A;  4XT1 B;  3PMF A;  2TSS A;  2QDB A;  1MSH A;  3KLS A;  3SXH A;  5CYU A;  4LAA A;  3GTQ B;  4RGO S;  3MWY W;  3DUZ A;  1Z47 A;  5KNC A;  3NXW A;  1PZI D;  3J80 E;  4M1U B;  1LAC A;  2B2Y C;  1FGB D;  4A3J B;  5LL6 S;  1X32 A;  2F0H A;  4TKO B;  1HFN A;  1BOS A;  3S17 B;  1SEB D;  2PZW A;  3MEH A;  2A73 B;  5C4H A;  1F9S A;  1GUG A;  3T51 B;  1U4R A;  4EGV A;  5D65 A;  1HTL D;  1Y1V B;  5M5X B;  3QB3 A;  4J6H A;  1CM9 A;  3BVM A;  2JSO A;  1Q1E A;  3BDC A;  5M9O A;  1SDF A;  1FD7 D;  1WTW A;  3D6C A;  2JYO A;  2E2I B;  1EFI D;  2A68 D;  4X3U A;  4FYD A;  3GTM B;  3JAM L;  1LAB A;  2PYK A;  4XQQ A;  2SOB A;  1LV9 A;  1EYC A;  4U67 3;  1CK1 A;  3U9S A;  4C3I B;  1I3Q B;  1Z6H A;  2L9H A;  4F8M A;  5C0X J;  1D6E C;  2XRS D;  1WTP A;  1WTV A;  3TZU A;  1ZYR C;  2K7V A;  3FPP A;  3I70 A;  1TWA B;  1V43 A;  1WTR A;  3W2D A;  4KD4 A;  4ODG A;  1PYW D;  1SAP A;  1B1Z A;  4A93 B;  3KLR A;  2RA4 A;  4HR7 B;  3D6W A;  5C4X B;  4KHV A;  5LHY 1;  4K5X A;  1RTN A;  2KEE A;  3IFT A;  4HTH A;  4KTA A;  3WOF A;  1ET6 A;  3G6J B;  2F0L A;  4ZKB B;  5KGU A;  3D4W A;  1MD2 D;  5BN4 A;  2B2U C;  2L5T A;  3S14 B;  5ISR A;  2AWN A;  1O80 A;  4FF1 A;  4R9W A;  1A2U A;  4EVO A;  1X3P A;  4ZUJ A;  1AZQ A;  2K04 A;  1EY5 A;  1QWY A;  5LL6 X;  3C46 A;  5JEA J;  2FMM A;  3OWE B;  5CC4 A;  2CHB D;  4XQN A;  2IT1 A;  5NUC A;  1YNN D;  3S1N B;  2BOS A;  1JWS D;  2ENB A;  3L3O C;  5JJZ A;  3QOJ A;  4R8N A;  4RGN A;  1PFN A;  1LO5 D;  4A3K B;  3FVQ A;  1TY0 A;  3ONA B;  1CA5 A;  2BDN A;  3MC0 B;  1OXX K;  2Z4I A;  2CQA A;  2D2C C;  2KA7 A;  1YNJ C;  4KJO A;  1TII D;  1SNO A;  4HSV A;  2SNM A;  1HUM A;  3OW7 A;  2WKC A;  3M3Y B;  1JCK B;  3OIQ A;  1C8C A;  3QIA A;  3GD7 A;  3VA7 A;  3BDO A;  1B9N A;  3K5L A;  4M8A A;  3M85 A;  3ERO A;  1NCV A;  1O7Z A;  2AUJ D;  4TQU S;  1ENA A;  4G4K A;  1IKM A;  5JAV A;  1UUP A;  3GTG B;  2DNE A;  1S5E D;  3R93 A;  1A2T A;  1R4P B;  2F3V A;  3M4O B;  1HFG A;  2XWJ B;  2KOL A;  2VNU D;  4RKL A;  1KAB A;  1ZYR D;  1XTC D;  1JR0 D;  3NQT A;  1ZKO A;  3DM1 A;  4QIW B;  1RJT A;  1NAP A;  1QG7 A;  3PUV A;  3FDT A;  3GTK B;  1ROD A;  2NB0 A;  1HA6 A;  3OOC A;  3Q22 A;  4HN7 A;  2IX3 A;  1BF4 A;  2F0P A;  3PUY A;  2F0N A;  5DM7 3;  3SDZ A;  2Z1C A;  1T5X D;  2B2T C;  1B2T A;  5JOB A;  3BZD B;  3MVV A;  2HQE A;  2E2D C;  3DWP A;  3R2I A;  3GO5 A;  4IUV A;  2X6L A;  1SYB A;  2F0J A;  1BCP F;  2F0G A;  1TWG B;  3VR5 A;  2MUY A;  3WDN A;  4Z9C B;  1HA5 A;  1II3 A;  2Z8L A;  4LJZ C;  4FXG C;  4CGY B;  3GTP B;  1PFM A;  4C2M B;  1VMP A;  1SJE D;  3M7G A;  2B2V A;  3V96 A;  2JA5 B;  1GUN A;  3S1R B;  4DXG A;  1BUV T;  1LT4 D;  2F3W A;  5CV6 A;  4C1N K;  3TN2 A;  1U4L A;  3HEJ A;  4CKC A;  2FJ2 A;  3JAM E;  1IYU A;  2F0U A;  2EJM A;  2RSO A;  1YNJ D;  1CFM A;  4H0L C;  3ZYY X;  1STB A;  3PIO 3;  1H9S A;  1EY7 A;  1DCZ A;  4EQO A;  4K2K A;  1IHZ A;  5IGF A;  4K6D A;  3T53 B;  1TWH B;  2NYZ D;  5CMD A;  2M2L A;  3NWT A;  4PMC A;  3QG1 A;  4NKL A;  2QCP X;  3NPP A;  1EU4 A;  3KK7 A;  4RFB A;  2A6H C;  1G29 1;  4DA2 A;  2D62 A;  1PRT B;  2K6A A;  3D4R A;  4IUN A;  2IW3 A;  3BDL A;  1JWU D;  1SYD A;  4RH6 A;  1L0X B;  2HCI A;  1VF5 C;  1UNS A;  1SE3 A;  3FEW X;  4V0B A;  2ID0 A;  3ND9 A;  1EOT A;  2EVB A;  2K33 A;  1LTT D;  5ELF A;  4IZ8 A;  2KHS A;  1EEF D;  1MSG A;  1B50 A;  1PTO D;  2XRQ D;  1RF2 D;  3N6R A;  1FNU A;  4ZRZ A;  1Q3L A;  1ONL A;  4WJW A;  4X3K A;  2F1M A;  1AW7 A;  3IL8 A;  2XVS A;  2A68 C;  3BVZ A;  1JQY D;  1HQR D;  2JA7 B;  1ILP A;  2FHT A;  2R3Z A;  3CU7 A;  1DJR D;  2SEB D;  4Y7N B;  4I65 A;  2E76 C;  3GTJ B;  2QKI C;  2EY1 A;  5CGK A;  1PFB A;  3R2T A;  1L0Y B;  4KJN A;  2RDH A;  4BY1 B;  4ZQ3 A;  3MTS A;  4IFD I;  1NR4 A;  3FRP B;  4C3J G;  1FR3 A;  2XSC A;  3MXP A;  2BA0 A;  3C3L A;  5EKL A;  3OHX C;  1TY2 A;  2K1B A;  2EXZ A;  1HXY D;  5CV9 A;  4QUF A;  1MI2 A;  1CA6 A;  4FO2 A;  1WVL A;  4A3G B;  2LFN A;  2WII B;  4KN4 C;  4ABN A;  4A3D B;  5FLX L;  2E74 C;  3A8K E;  4C1N I;  2EYH A;  3LX0 A;  2I46 A;  3NHH A;  4KV6 A;  4O42 A;  1CHP D;  2F0T A;  2HDL A;  3S15 B;  3MFY A;  5E4X A;  3HOX B;  2EJF C;  3I4M B;  1SMY C;  1KLU D;  1RD9 D;  1O7L A;  4KD3 A;  2B2W C;  2PPB C;  1DYQ A;  4B9X A;  1KAA A;  1X3Q A;  2F0K A;  2BE5 C;  2L12 A;  4IFD G;  4RAU C;  3K5N A;  2B2U A;  4IUT A;  2IPK D;  5JVH 3;  2PCF B;  4A3F B;  4DFA A;  4XYQ A;  2YU9 B;  2Y0S B;  1CHQ D;  2O5I C;  1YNN C;  1CTM A;  1EEI D;  2IWH A;  5CV5 A;  2A6H D;  1WD0 A;  1R4Q B;  2EYJ A;  5KRU A;  3IAY A;  1GXD C;  4DU9 A;  4BWG B;  2M00 A;  3SK5 A;  3J7Y W;  4G7O C;  3RZO B;  4F87 A;  2D9U A;  1STN A;  1V1O A;  1EU3 A;  2AQ3 B;  1XYI A;  3SE0 A;  1UEA B;  3UI2 A;  2PW5 A;  2F4I A;  2ICI A;  4JBW A;  2R61 A;  3DWQ A;  2KED A;  2K5D A;  1PZK D;  4KY7 A;  2KUM A;  4RGT A;  3SK4 A;  4U68 A;  3SK6 A;  3P7J A;  1I4H A;  3D3R A;  4C3J B;  5KIX A;  3H0G B;  2K03 A;  2PMZ B;  3A8I E;  1BCP C;  1WTO A;  2KCN A;  4G57 A;  5HUR A;  4HSP A;  2LMC B;  2EYL A;  3CRK C;  3K7A B;  2NVY B;  1W6K A;  5T1G A;  5FOB B;  3KUP A;  3I91 A;  3SR1 A;  2EY5 A;  2L0C A;  3CHB D;  3L9A X;  1LTG D;  1IW7 C;  2SDF A;  4RA8 A;  3I4L A;  3TDQ A;  4PQX A;  2ZXR A;  4CHT B;  1EY6 A;  2WV6 D;  2KJX A;  1G91 A;  2N88 A;  5DAU A;  4QMG A;  3D4D A;  4A3I B;  4HAE A;  2JA6 B;  4L63 B;  1OXT A;  2JE6 I;  4BA2 I;  1I4R A;  5D14 A;  2F0W A;  2NWG A;  5I6Y A;  3S9W A;  1LTA D;  1DZ1 A;  1TS2 A;  4DAP A;  1E2W A;  4OL7 A;  1OO9 B;  3A7A B;  1I4P A;  4XYO A;  2MPM A;  3T13 A;  3QOL A;  3ITP A;  3NUC A;  5EBC A;  4FXD A;  2EOT A;  3P75 A;  4ULL A;  4OO1 I;  3H09 A;  1FNW A;  1V1P A;  1NUC A;  1QCB D;  1SMY D;  2B2T A;  1VF7 A;  3GV3 A;  3HOU B;  2WKD A;  1DOK A;  1OXS C;  4ILW A;  2BE5 D;  4J8Q A;  3H6M A;  5A35 A;  1DXM A;  2Z4H A;  5K36 H;  4K2L A;  1S5F D;  2BDO A;  3HOZ B;  1QJO A;  3I3C A;  2PQE A;  4HED A;  1I6H B;  3HOW B;  3ERQ A;  3HP3 A;  4CKB A;  1U4M A;  2R93 B;  3BVG A;  2KEC A;  5C3E B;  3GP7 A;  4BBS B;  4IUQ A;  2C9O A;  3EA6 A;  4S3S A;  4MIU A;  2G9H D;  1EL0 A;  3MXU A;  4KI0 A;  2WAQ B;  3PIP 3;  1F2L A;  5I2X A;  3TBI B;  3LNN A;  4TRD A;  1DOL A;  4OO1 G;  1EYD A;  2J7Z A;  3D31 A;  4K5V A;  2E2J B;  2IX0 A;  3TP8 A;  1I4Q A;  2F03 A;  3NWS A;  1M8A A;  4YIJ A;  3PUZ A;  2H4O A;  4OHJ A;  3H94 A;  2IJ0 A;  4CJ0 B;  3K58 A;  5K36 G;  2F0Q A;  1RCV D;  2G9D A;  1BCP D;  1Q8I A;  3KBX A;  2QIL A;  4KKT A;  4ZUI A;  1ILQ A;  5IGC A;  3T4A C;  2MHV A;  4OIJ A;  5FO7 B;  2Q8T A;  2O5J C;  2FFK B;  1JOQ A;  5I6W A;  3G7L A;  2K32 A;  5FLX E;  1B3A A;  1JE4 A;  4FF4 A;  4X3S A;  1CT1 D;  2EY2 A;  1IW7 D;  4N9T A;  5EGT A;  3BYT B;  1FYC A;  2XIW A;  2A74 C;  1C48 A;  4V19 0;  1BBX C;  4MHE A;  2PO4 A;  1HUN A;  1TT2 A;  3PV0 A;  2SNS A;  3DMU A;  5IT9 E;  3MA2 B;  4EQN A;  1GOZ A;  3RZD B;  1S5C D;  1PTO C;  4WFN 3;  5IOD A;  3EVQ A;  1GUO A;  2TMP A;  4F7X A;  5J1Z A;  3VR4 A;  1AP0 A;  1H9S B;  3S2H B;  1B9M A;  3L7Z C;  4DAY A;  1AEX A;  3MZ5 A;  1HTP A;  1LTI D;  4L8J A;  2B8G A;  1KTK A;  1SSO A;  1F9R A;  1CI3 M;  4EQP A;  3R8B A;  1TQO A;  3AB9 A;  5M5W B;  4H7B A;  2VB3 X;  2PNR C;  1STE A;  3DHQ A;  5FO9 B;  2JEB I;  2EE1 A;  3P1H A;  1FNV A;  1TR5 A;  1CQF A;  1WD1 A;  5IGD A;  4RCN A;  2N55 A;  1A3T A;  2CW0 C;  5E3F A;  4IUP A;  4CJ2 C;  4XTC S;  3NBI A;  5JPN C;  1LTS D;  2X6G A;  2EYP A;  4OGQ C;  1CQV A;  2MGS A;  4UDU C;  1KNE A;  2LS0 1;  1ICW A;  3Q24 A;  2F0S A;  2F0D A;  4RCO A;  1AZP A;  2OXP A;  4JK1 C;  3E5S A;  1I4X A;  2BCO A;  1Y69 U;  1KLG D;  5T1I A;  1Q90 A;  5I9P A;  1SYG A;  3BS1 A;  4QF4 A;  3DEO A;  3Q6S A;  1D5X C;  1I6V C;  4FF3 A;  3J81 E;  1C4Q A;  1DM0 B;  1PRT F;  5D3D A;  3QJY A;  1JWM D;  3NTH A;  4KKU A;  1NSN S;  5ELE A;  2EZV A;  3CRL C;  1TS5 A;  1G2S A;  2F0O A;  3X3M A;  2MP1 A;  5JVG 3;  4E6I A;  3M4Y A;  2B2W A;  2B8F A;  3HKZ B;  3TSS A;  4FNF A;  2DY8 A;  3E6Z X;  2R92 B;  4DGZ A;  3J7A F;  5E1F A;  2F0V A;  1W6J A;  3V2T A;  1S5B D;  1G6Z A;  1K8O A;  1Q12 A;  2QEJ C;  1NR2 A;  3GTL B;  1RDP D;  2EY6 A;  2PZU A;  2K01 A;  1K8M A;  2E75 C;  2JXM B;  2KCC A;  3VYR A;  1A15 A;  5CV4 A;  1EQV A;  5BN5 A;  2EYM A;  4DK0 A;  2BA1 A;  5A2Q E;  2O4X A;  4KY5 A;  3K5M A;  1B44 D;  4HMI A;  4KHZ A;  3I72 A;  5ELC A;  5C0X I;  1F2M A;  5KYI A;  4XDX A;  1B4O A;  1EZ8 A;  2C5C A;  1H9K A;  4XXE A;  5CV7 A;  1HRJ A;  4HCS A;  4DAV A;  1A3V A;  2JP1 A;  2FMC A;  5I9O A;  1EWH A;  1SXT A;  5G3L F;  3OSO A;  4TSS A;  3SEB A;  1EY0 A;  2NTS A;  1ESF A;  4PNY A;  1SNP A;  4IFD H;  4HMJ A;  1BNZ A;  3MAQ A;  1BR9 A;  5KEE A;  3WOE A;  3AMU A;  1EIH A;  2CW0 D;  1DON A;  1SJH D;  4CJ1 B;  5FK9 C;  4PV1 C;  1ESR A;  3S1Q B;  3I90 A;  5C0X G;  5IGE A;  1SFO B;  1XX8 A;  3OMG A;  5F2D A;  3KLS X;  1U9R A;  3DWA A;  3VYU A;  1RTO A;  5JEA H;  4QB4 A;  2Q8I B;  4NMZ A;  2WB1 B;  4WRD A;  2H1E A;  1DD2 A;  4ZAI A;  3OMC A;  3C1E A;  1QE6 A;  2ICE C;  4H44 C;  2R7Z B;  4HCE A;  4AYB B;  2XWB B;  4XQJ A;  1Z7T A;  4IN3 A;  1Q1B A;  2F0F A;  2OEO A;  2CVR A;  2V4D A;  5IT9 L;  4G7Z C;  1F77 A;  1J8I A;  4QUC A;  1LT5 D;  3ND8 A;  3K0Y A;  1SNM A;  2R6G A;  4DNR B;  5I4D A;  4KK7 A;  1G2T A;  1LT6 D;  4K5W A;  2B63 B;  3I4N B;  1ENF A;  2EJG C;  1E2V A;  2VUM B;  2NN6 I;  3IKJ A;  5JEA G;  3I8Z A;  4IUR A;  1V8Q A;  4PMB A;  3LWE A;  5C44 B;  1GHJ A;  1TS4 A;  3TP7 A;  3FPU B;  1F9Q A;  1H9R A;  2RQX A;  3A56 A;  2KQ3 A;  4BS9 A;  1PTO B;  2IX1 A;  2ZXP A;  1D2B A;  1D1I A;  5COY A;  3NTI A;  1T5E A;  1IYV A;  1V1P B;  5EBD A;  3HGB A;  1PMR A;  1GUW A;  1SE2 A;  1I50 B;  1JC7 A;  5M5Y B;  3J81 L;  2NN6 G;  3AU7 A;  5EKI A;  3C2P A;  3O13 A;  4ME5 A;  5FO8 B;  1LTB D;  5COR A;  5EPK A;  1KDC A;  1OXU A;  3TME A;  1HCZ A;  1Y8O B;  4H13 C;  1SYE A;  1AFP A;  3Q0A A;  3C1F A;  5CBE E;  3DXJ C;  3OIP A;  5J22 A;  5C4Z A;  4IUU A;  1HQM C;  3TP5 A;  1TVX A;  4OIK A;  4FXK C;  1H9M A;  2A69 D;  4ZKC B;  4XIG S;  1ZEQ X;  3F2U A;  1SNC A;  4X3T A;  3VR6 A;  1PRT C;  4BY7 B;  3GTO B;  2F0M A;  1EWC A;  2RDG A;  3V05 A;  4DNT B;  1JOR A;  2F0E A;  3N52 A;  1IKL A;  1QOH A;  2ZXO A;  1Y1W B;  1A6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...