3H91A

Crystal structure of the complex of human chromobox homolog 2 (cbx2) and h3k27 peptide
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
52
structure length
52
Chain Sequence
b'EQVFAAECILSKRLRKGKLEYLVKWRGWSSKHNSWEPEENILDPRLLLAFQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromobox protein homolog 2
publication title Recognition and specificity determinants of the human cbx chromodomains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 9
structure length 52
sequence length 52
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3h91A00
2R3ZA 2FJ2A 3KBXA 4OIKA 1J9OA 2DY8A 1G2TA 1WTOA 2NZ1D 4IUPA 3R93A 2X6GA 1G6ZA 5AFWA 1O80A 3I3CA 3IFDA 1E0BA 3N52A 1KNAA 2FFKB 2CVRA 1B3AA 4U68A 3I8ZA 2EE1A 1JICA 1M8AA 2B2VC 1AZQA 1O7YA 2FMMA 5COYA 1AZPA 2B2YC 2K28A 1B4OA 1U4PA 1PFNA 3D6WA 4LMQD 2B2UA 2K04A 2VXWA 4RAUC 1RTOA 1WD0A 4CJ0B 1HA6A 4IUVA 2MPMA 1X3PA 1U4LA 2X6LA 3FDTA 4IURA 4X3TA 2MJ8A 3LWEA 4IUQA 3FPUB 1BBXC 4ZK9B 2L9HA 1EQTA 2B2VA 2FHTA 4HEDA 2D9UA 4QUCA 4MN3A 5EPJA 1WD1A 1DONA 1HHVA 2K03A 3MTSA 1PDQA 5EJWA 1HUNA 5CBAE 2KECA 1J8IA 1RODA 1QNKA 1ESRA 1RTNA 2RA4A 1IKLA 1DOLA 1WTPA 1ICWA 3I91A 1WTWA 1EL0A 2K1BA 3KUPA 3I90A 4X3SA 4ZKBB 1WTRA 1JE4A 1X3QA 1A15A 2KEDA 1F9SA 1O7ZA 5D65A 2B2UC 1TVXA 2MGSA 3DEOA 1KNEA 1AP0A 1ZXTA 3P7JA 2KVMA 3HP3A 3ONAB 5CMDA 2HDMA 1MSGA 2L12A 1CA5A 3GV6A 1EIGA 2B2TC 2N55A 2RSOA 3TZDA 2N88A 2DY7A 3GV3A 1ILPA 2SDFA 2EOTA 1BNZA 1C8CA 1NR4A 3F2UA 1MI2A 1EOTA 5E4WC 1NR2A 2RVLA 2J7ZA 5DNFA 1X32A 2L4NA 2K05A 1SDFA 4R8IA 1B2TA 2HDLA 4QUFA 1HUMA 1VMPA 1XX8A 4XT1B 4CJ2C 4CJ1B 4NW2A 3IL8A 1CM9A 2B2TA 1S4ZA 2L11A 5T1GA 2JYOA 2M2LA 1SAPA 2RSNA 1Q3LA 4UAIA 3DM1A 1PFMA 1XYIA 1EIHA 3SVMA 1B50A 1F9QA 5T1IA 3TN2A 4ZLTF 5JJZA 1GUWA 1DOMA 1U4RA 1VMCA 2FINB 2K01A 3MWYW 4RA8A 4X3KA 5EPKA 4XT3B 4IUUA 2H1EA 2KEEA 2JP1A 4OIJA 1PLFA 1WTVA 1IKMA 2Q8TA 4ZAIA 1RHPA 1RJTA 4HSVA 2HCCA 5EQ0A 4O42A 4IUTA 1HFGA 1NAPA 1HFNA 3UI2A 5E4XA 1NCVA 4DN4M 1IL8A 2IL8A 5EKIA 1WTQA 5CBEE 1G91A 2B2WC 1QG7A 2HCIA 4R9WA 3H91A 1BO0A 4RWSC 2NWGA 2XIWA 4HCSA 1LV9A 2MP1A 5D14A 1WTXA 1F9RA 5EPLA 1MSHA 2L1BA 3G7LA 3Q6SA 4X3UA 2KOLA 3DEPA 2EPBA 1HRJA 2Q8RE 1U4MA 2KUMA 1B53A 1ML0D 5CORA 1G2SA 1WVLA 1MGSA 1F2LA 1DZ1A 1SSOA 2B2WA 2X69A 1QE6A 4MHEA 1PFBA 1F9PA 1BF4A 4XDXA 4ZKCB 3QO2A 4HAEA 2BDNA 1DOKA 2NYZD 2HUGA 1CA6A 1ILQA 2B2YA
chains in the Genus database with same CATH superfamily
2D62A 4OIKA 4KV6A 1JWMD 2AUKA 1PZJD 2X6GA 1IBLQ 1O80A 2LKVA 2WAQE 1TT2A 2F0VA 4GN3B 3I8ZA 5J1ZA 3OMGA 4YHHQ 3A7AB 4GLXA 4RGOS 1PA6A 2B2UA 1HA6A 1ET6A 3SK4A 5FLMG 4HJ7A 4IUVA 2ZM6L 1V1PA 1GM5A 3SHLA 4X3TA 4JI8L 2QA4A 4HCEA 3OMCA 4C3HB 3FHWA 1KDBA 1MHWC 4ODGA 2NBFA 4QUCA 4MN3A 2CWAA 2ATWA 4FVMA 4KK7A 1D1KA 4YCVA 4A3BG 1ESRA 1RTNA 3K8AA 1IKLA 4YWKA 4RHRA 2JA5H 3S17H 2F0WA 1STNA 3I90A 1JE4A 3KLRA 2SEBD 3ND9A 2R6GA 3K7UC 4KJNA 2UUBL 4A3FG 1STEA 2PCFB 4O0AA 5J3BA 4A3EG 3PSIA 2F0GA 3ERQA 2BE5C 4FDBA 1JE5A 4OWTB 2B2TC 3CCMA 2RSOA 3TZDA 3GTKH 4NP5A 1S5BD 2EOTA 4HR7B 1H95A 1BR9A 4FP5D 2OXPA 3A0JA 3GQBA 4DNTB 3OOCA 4B3SL 4JI4Q 4KKTA 3VYTA 5C5LA 3J81j 2A6HC 3GTPB 2EY1A 4ZUIA 4UP9A 4UY8C 4XTCS 4JI6Q 1F9QA 1XNQL 1TWAH 2AQ2B 1GUWA 1SRUA 2FINB 2K5QA 1XTCD 1GUTA 2ID0A 1UWVA 4GLAC 1TWHH 3LWUA 2MNAA 3T1YQ 1RJTA 5BN3A 1NAPA 4C3JB 1TY0A 2RQXA 4QY7A 3WOFA 1WTQA 2E5LQ 4HSPA 4LFCL 4LJZC 4AYBE 3I4NB 4Y7NB 4JC0A 3TS2A 1SNCA 3CPFA 3H91A 3H15A 1WCMB 4AQYQ 1SNDA 5JVH3 2J0TD 3BDLA 5EBDA 2Q8RE 2G9HD 1GOZA 1ML0D 2NVXH 2A19A 1Q7YC 1ESFA 1PZID 2JEBI 4JI5L 3NBIA 5KIXA 3PQIA 5GROA 4IFDG 3I3CA 1FNVA 1HZCA 1VQ9A 5JVG3 3RZDB 4YWMA 4A3KB 1WJJA 2BA1A 1JB7A 1V9PA 4KTAA 4MNOA 4JV5L 2ZTCA 1SYEA 4DNIA 3EFXD 4JBJA 2DJFC 1F2ZA 1WD1A 2A5HA 2KHIA 1Z7TA 2F0SA 1TQOA 1BUVT 1SE3A 1XNRQ 5M3FG 2OQ0A 5I4DA 1IYVA 2EY5A 3GO5A 4MTKA 2JA7H 3VDYA 3PF5A 2VQFL 4PMWA 1Q1EA 3QR8A 4FXKC 1XMQL 1CSPA 3GTGB 3KF6A 3ZYYX 4A3JG 1N34L 2KBNA 4JI1Q 4K0KL 4DAVA 2ZJPA 2UUAQ 4E6IA 3JAML 4B3RL 5IYCG 2HT1A 4K2LA 2F4VQ 2EY2A 1AH9A 3Q23A 2B8GA 1C8CA 3D4DA 1CZGA 2K5DA 3E9HA 4C3JH 3VA7A 4JI2L 1JJGA 2JQOA 3J81E 3FPPA 1WTHA 2NVTB 3I4NH 4Y7NH 4CJ2C 2XGTA 3U9OA 1LT5D 5KGUA 4X66L 4WORA 3TZUA 2DN8A 1JR0D 1Q3LA 4DPGA 1B50A 1YIJA 5T1IA 3PUYA 2HIVA 3I4MB 2O5JC 1I4QA 4X3KA 5LMNW 2EYOA 2QCPX 4LWCA 2ASBA 3NHHA 2F0NA 4LF8L 2EJMA 1B8AA 1EOVA 2IL8A 5H1SE 4WJWA 2ZXOA 2A68D 1SJHD 2B2WC 1ZYRD 3R2TA 4EGVA 5JEAH 2ZXPA 1SNOA 2NWGA 5D14A 5GAEC 2MP1A 2RKSA 4GLVB 4DV4Q 3Q6SA 2AQ1B 4CHTB 2O4XA 2KJXA 1HQMC 4F88A 2EDGA 1F2LA 4DR1Q 2KENA 3X3MA 3S24A 1FGUA 3J81c 2UXCL 1XXGA 1BF4A 2OCEA 1EEID 2JE6I 3KLSA 1I6VC 3I4LA 3TMEA 1JMCA 3D8GA 1E2WA 3QG1A 2FFKB 1X9NA 3CRLC 2CH4W 3PO3B 2J4XA 1F77A 2E2HH 4IPGA 1EU4A 4KI0A 2E2DC 3J7A5 1UE7A 4GKKL 2MUYA 3OIQA 2ZTEA 2O2LD 3AFPA 2RDFA 3X3NA 4ZYSA 4LFAQ 3K5MA 3W3AA 3GTQB 1GKHA 3S2DB 5EJWA 1PH2A 4DF7A 3NQIA 5ELEA 1KIXA 3L9AX 2B63G 2ICIA 4A93B 3KF8B 1QVCA 2TMPA 2YV5A 4R4IA 1SR3A 4DR4L 3K6OA 1XJVA 3PCOB 3K81C 3QIAA 3BZDB 5IYDG 1S40A 3LNNA 2R93G 5IT9c 1KNEA 1ZXTA 4JYAQ 4BBRG 4DR7Q 1CA5A 4OO1G 2JA6G 4FO2A 1PFSA 1BXTA 1QWYA 1TWGH 3WWVA 1EYGA 2Z6KA 1TY2A 5DNFA 2WINB 2F3IA 4KJOA 3KFUA 1EY6A 1SDFA 4AYBG 4X62L 3D6CA 1LYLA 1R4PB 4POFA 1VMPA 1XX8A 1CM9A 4KHVA 2YTXA 3AYHB 2M2LA 3LX0A 5IIFA 1XYIA 4DXGA 3Q0AA 2K52A 5LL6S 5JJZA 3J7AF 3BYTB 3PIOA 2JP1A 3K5OA 1RCVD 1II3A 1N32Q 3PO2G 2ALYB 3FKIH 4IUTA 3TRZA 3UI2A 1CKOA 1TXYA 3EBEA 2BE5D 3S1RH 5G3LF 4LFBQ 3WOEA 4WFN3 3RN2A 1CSQA 3CKIB 2K75A 5I6YA 3S1QB 1WTXA 4ZCKA 5IWAL 4C3IG 1VQ6A 3PO3H 2FXQA 1ASZA 2PQAA 4DR5L 2WFWA 5CORA 3K7AB 4DR6Q 1STHA 1DZ1A 1SSOA 3I72A 4MHEA 3HOVG 2QDLA 1Q8IA 4L5RC 1IBML 1VQHA 4A3DB 3KBXA 3CCLA 2K32A 1GXDC 3GTQH 3J7AV 1TIID 2WKCA 2WAQB 3Q22A 3H3VI 1S5CD 2N49A 3N52A 2UUCQ 4M8AA 1W6JA 4K5WA 1IZ6A 2SNSA 4A93H 2B2VC 1CHQD 5ELOA 5C0XG 4A3LG 2VXWA 2LFNA 2CW0D 4NB3A 1JJCB 2NVQB 4IUQA 3H3VH 1JB3A 2XTIA 1K8OA 3VR5A 2D9UA 1HHVA 1E22A 3KJOA 3L0OA 1ICFB 1HNZL 3TBIB 5GADC 1JCKB 1ICWA 1GJXA 1EQVA 2F3VA 3HEJA 5C3XA 2KVMA 5BR8L 2K14A 4JVZA 3GV6A 4QB4A 5CR3A 2EIFA 3W1BA 2LXKA 1S3OA 2DY7A 4YWLA 4DR2Q 3S16H 1MI2A 1VQDA 3T13A 1P8LA 1UE6A 1V43A 2L4NA 5ELDA 2ES2A 1FGBD 2EYFA 2HDLA 4KY7A 3NEMA 4B3TL 4TSSA 4CJ1B 3DUZA 2R93B 5C4XB 2B2TA 1LTSD 4F87A 5T1GA 2Y0SE 5M5WH 4OX9Q 4JOIC 1L1OB 2JA5G 2IX1A 2M9VA 4L63B 1BCPD 3BZKA 3OYYA 1PXUA 1P16A 1DJRD 3K7AH 5IP7H 4PQXA 5LMUL 3H3VC 4O1NA 2WP8J 1QZGA 4AYBB 2Q8IB 3WDNA 2PQAB 4TKOB 1EUJA 4A3DH 1QOHA 3A5ZB 2L5TA 1MSHA 4UP7A 3SXHA 3KOJA 4HIKA 3CMEA 4JW0A 1FYCA 4KMUC 1VQOA 3PO2B 3UDXA 1H9RA 1STYA 4MIUA 1WI5A 1I3QB 2VZAA 4DUZQ 3I2ZA 4LK1C 2D5DA 3A55A 3NENA 5C4JB 2NVQH 1K28A 2FJ2A 5C0XJ 3PUZA 3CPWA 2F0IA 1N9WA 4DV7Q 1HH2P 4FF3A 5ISRA 2K28A 2H5XA 3CQZB 4JBWA 3HOYB 3KBGA 1E2ZA 4B3ML 3Q24A 1NMFA 1D1IA 2NTSA 5FKAC 5C44B 4N8FA 1SJED 2XRQD 2BDOA 4FXDA 1EQRA 4GS3A 2NN6I 3SR1A 1RODA 2ZM6Q 5KNBA 1BBWA 3ITPA 1G51A 3I91A 4A3GB 4ZKBB 4IOAA 2F0OA 5C4XH 4GKJL 2XN9C 4DK1A 4QQBX 4OL7A 3CCRA 3HGBA 3D0FA 1SE4A 1ILPA 2NN6H 3GTJB 2NZHA 1JWSD 3HOZB 1K3RA 2D2CC 1I94Q 3QJYA 2HHHL 1JOKA 3JAMc 5IT9L 2CWPA 5LMNL 1TWCH 4IJLA 5IODA 1YITA 1SBBB 1S4ZA 1D8LA 2EXZA 4DV3Q 5IYBH 5IGFA 1DM0B 4RGNA 3TN2A 1IXRA 4B9WA 4WJ4A 1X56A 1YBYA 4EQ5A 4ZAIA 1I3QH 2A68C 2BOSA 1TR5A 1HFGA 2HD3A 1D5XC 4U673 1ZYRC 5E4XA 4IPCA 2PZTA 1YHAA 4NXMQ 1XNQQ 1TS3A 3EQLC 2Z0SA 4C3JG 2JA5B 1WYDA 3S17B 1G291 4JPBW 3I4NG 1EIFA 2RF4A 4JG2A 4BA2I 1AW7A 1WCMG 5AJ3L 1XWEA 1M4VA 5JPMC 1SFOB 4LFCQ 2KUMA 3CQZH 4ME5A 1N8RC 3HOYH 2UU9Q 2B2WA 4XXEA 1HZBA 1PZKD 2GN5A 1G8ZD 3E9IA 3QO2A 4XDXA 5C44H 1DOKA 4BS9A 2VUMB 4DNRB 5GQOA 1WTOA 3R93A 1G6ZA 3D3RA 4LF5L 1SNMA 3SGIA 4U68A 1BOSA 2EE1A 1AZQA 2FMMA 1AZPA 4HIMA 3KJPA 1KDAA 3MAQA 4BBSB 2E8GA 4A3GH 2JA8B 3CXCA 1ET9A 3GD7A 4JCVE 3FDTA 4JI0L 1A8VA 2KA7A 2DNCA 1VQ8A 1GVPA 1M1KC 4TVAB 1GHJA 3NK9A 4UP8A 4ME3A 1EQTA 1VQIA 3HOZH 2DGYA 1KL9A 1R9TH 2F0FA 1DD2A 3B6YA 5FJ8H 1UNSA 1BCPB 5HY6A 3C1EA 1CK1A 1DYQA 1O7ZA 2K5VA 4GNXA 1YJNA 2Y0SG 2C9OA 2R7DA 1AP0A 2NVXB 1LUZA 4J6HA 1OXUA 1CT1D 3ER0A 2F0HA 1IW7D 2UXBL 2LMCB 2JN4A 1XMQQ 3MXNA 2J7ZA 1FL0A 1PYSB 2XSCA 4DK3C 4R8IA 1N34Q 1B2TA 1E1TA 4CKCA 4EQPA 5I2XA 4K0KQ 1DXMA 4XT1B 1JWUD 1KLGD 4K2KA 1PV4A 3VR3A 4G7OC 5FO7B 5FK9C 3DM1A 2EJGC 1BVSA 4JI2Q 3EVQA 1K0SA 1SFOH 4IUUA 3P75A 3K80C 2EYLA 1ONLA 2A6EC 2HCCA 4X66Q 2IHFA 2IPKD 3I4MG 1YZ6A 3EJIA 1D5ZC 3S2HB 3FMCA 2VUMH 1NJIC 1QG7A 3K59A 1YNND 2JA7B 3MVVA 1B70B 5IGCA 1MIUA 1LTBD 3S9WA 4LF8Q 1JT8A 2L1BA 2EPBA 4IQZA 4B9XA 1EU3A 5KRUA 4BBSH 1B53A 3S1MB 2JA8H 3J81i 2PI2A 2Z4IA 3URYA 5ELFA 2CQAA 2NB0A 2QDBA 3I56A 2HUGA 1ILQA 1SYDA 2F0LA 2PYKA 3DLLA 2D0OA 5JEAJ 3FKIG 3RUZA 1B1ZA 4LF4L 3SK5A 2UXCQ 2UXDL 3H6MA 3I4OA 1E1OA 3TP7A 3CCJA 2CW0C 3M3YB 3CU7A 4RAUC 2KCNA 4RMFA 3PO3G 2RCNA 2MPMA 1K8GA 4K6DA 4IJHA 4RHSA 2QKIC 1BBXC 4OELB 4GNXB 4JBMA 3TREA 2B2VA 3UDIA 4LF7L 3JC66 1DONA 3P20A 2YU9B 1TKWB 2I5LX 3M4QA 4K8IA 4GKKQ 4GOPB 1IL2A 2RA4A 2N78A 3STBC 2KCTA 1EL0A 1LABA 3MXNB 1KDCA 1WTRA 4OONA 2C35B 1D6EC 4A93G 4HMJA 1O7IA 2XWJB 1CZWA 5L37A 3HKZE 5IGDA 3BU2A 3SK8A 1NR4A 1GHKA 1M90C 1X32A 5IGGA 2K05A 3S2HH 2IWHA 3GTOB 2Y0SB 2E2HB 3IL8A 1QJOA 2L11A 1BCPC 3K5LA 3QOLA 1FJGL 4HIOA 3CCEA 1IBLL 4X65L 2R61A 3A56A 4LF6L 2F0UA 1U4RA 1PTOF 5ELCA 4X62Q 1K8MA 3HZXA 3CCUA 1D7QA 3S1MH 2JEAI 4OIJA 3J80c 3KF8A 5IGEA 3MFYA 4OGQC 4JOIA 1QNUA 2OWOA 1Y8PB 3UDFA 4R4TA 2F03A 4R9WA 2Z1CA 1X55A 1JOOA 3KDFB 1E3PA 4IUNA 4KD4A 5E7NA 2AWNA 3U4VA 1U9RA 3M3YH 4HN7A 5HGQA 3CCVA 3HOXB 1GUGA 4HJ8A 4GN4B 1LT6D 4GN5A 4FXGC 1TWGB 1SNPA 3NPPA 5IP7G 4J8QA 5C4HA 2SNMA 4DV5Q 1EWIA 1J9OA 5EAYA 4ZUJA 4P73A 1S5DD 2K33A 3A54A 2YU9H 1OXXK 2MO0A 1D5MC 5EBCA 4A3DG 1KABA 1Q12A 2I07B 4IN3A 3W1GA 2WAQG 2BH2A 5KNDA 3M7NA 2RHQB 1PFNA 1J6QA 1RTOA 4CJ0B 1PMRA 5DM63 1LTLA 2R7FA 1JJ2A 2R7ZH 1HPCA 1R4QB 1VQNA 3FKIB 1Y14B 3S1RB 5IT9E 3F2BA 3DXJC 4KHZA 2F52A 3NBHB 2XVSA 1Y1VH 1WTPA 5EKKA 2F4IA 3GTOH 4UHVA 2QEJC 1NE3A 2PW5A 2E5LL 3NXWA 4DAPA 1Q86C 1NBWA 3MC0B 1XTDA 1HNZQ 1EWCA 2SDFA 3F1ZA 4QIWE 4V0BA 4GNXC 3IAYA 4KHPL 3DWPA 4BY7B 3TP6A 3EA6A 1NR2A 4R1JA 4DAYB 2DNEA 5BR8Q 4GOPC 3TS0A 1I4GA 5FLMH 2K7VA 1HNWQ 2EYJA 2WKDA 3O13A 3A8KE 4ZLTF 2PZWA 5C4XG 2GVBA 5C5MA 4JBKA 2K5WA 4B3TQ 3HOXH 1Q46A 3D31A 4FNFA 3CRKC 1UEAB 2VS1A 5CV9A 2PMZE 2JK8A 3A74A 4F8MA 1SROA 1N36L 2NN6G 5D3IB 4EQOA 5A35A 1VQ4A 1EY4A 5LL6X 1ENAA 1H9SB 1LV9A 1FNWA 1A3UA 3H0GB 3OTOL 4NDXA 5LMUQ 2WV6D 1VS0A 1L0XB 1OO9B 1SMXA 3RD4A 1Q1BA 4A3CH 2ENBA 2K50A 4IZ8A 5IYBG 1MGSA 5E3FA 5CV7A 1OXTA 4DK0A 3S16B 1AEXA 4HAEA 1A6XA 1Q81C 1B7YB 2F0PA 1LTID 4JI1L 1Y8OB 2UUAL 1L1OA 2A6ED 2L55A 2WB1E 1KAWA 2F4VL 4CKBA 3AFQA 3S15B 4Q0FA 5M5WB 2RHSB 3K5NA 4DV6Q 4YY3L 1QB5D 1VDZA 3E0JA 4I65A 2K04A 4X64L 4DUYL 2AMCB 1G6PA 1JORA 2B39A 2X6LA 2EQSA 4LUZA 4ALPA 1K3BC 2CQOA 1PH6A 5I6WA 4ZK9B 1HTPA 4XIGS 3HOYG 2PQEA 4WRDA 4BY7H 3IKJA 1Y69U 5C44G 1U0LA 2KECA 2XWBB 5DLQE 4DR3L 4P71A 4B3MQ 1Y1WB 3VR6A 4BWGB 4LF9L 4OWWB 4JI3Q 1EY7A 1DOLA 4DXFA 3CF5A 2B29A 4APVA 3A8IE 4X3SA 3H94A 1X3QA 3G6EA 5C4ZA 5M3MB 4MTNA 4KY6A 4RCOA 2VQEL 1GUNA 2MGSA 2HDMA 3RMHA 1IW7C 4A3GG 2L12A 4DV0L 5ELBA 5FO8B 1GD7A 4GKJQ 2PO4A 2G5DA 5E4WC 4PG3A 5M9OA 4RGTA 4DR1L 3ULJA 4QUFA 3JAMi 4ULLA 3HOZG 3U4ZA 1IBKL 1LTRD 1N33L 3H0GH 5FJ8G 2RSNA 1PRTF 3STBD 1VQKA 1VQ7A 3MXPA 4A76A 3V05A 3HOUH 3NUCA 1EIHA 3OHXC 4XT3B 2H1EA 5LMNQ 5KEEA 4R8NA 3A7LA 2QF7A 4BA1I 1YNNC 4CDFC 1IL8A 4L8JA 3L2PA 1HR0Q 1SE2A 3RLFA 1F9RA 5EPLA 5LHY1 3GDEA 4KN7C 3J80L 2AKWB 4XYOA 3S15H 4ABNA 2CHBD 1V1QA 5G3LD 1I5FA 1L0WA 1EIYB 1SYBA 1XMOL 3J7YW 1VQBA 2BDNA 1A0IA 2TSSA 5I2YA 2FMCA 3D4WA 2DY8A 5C3EH 3A5UA 4PMBA 3NTHA 4N8X1 5AJ3Q 4DU9A 1E0BA 1ZEQX 5CV6A 4G7HC 2CVRA 4G57A 1TWCB 1Y8NB 2VUMG 1Q8KA 4CKEA 3MA2B 1Y1WH 1M8AA 1SYGA 1KQSA 4TQUS 4H44C 1C7YA 2I5MX 1SNQA 1U4PA 3F8TA 1PYBA 1IYJB 1SN8A 5M3MH 4FYDA 3PUXA 4C56C 4HIDA 3QB3A 4BBSG 3T16A 4L5TA 2JA8G 4JI7L 1HUNA 1EY9A 2K03A 2N3SA 1EWHA 2EYPA 3QOJA 4P75A 1HNXL 5CV5A 4J15A 2XRSD 4BY1B 3T56B 4JI0Q 2Q2IA 1VQPA 4LAAA 4ZRZA 3C46A 2MFIA 3HKZB 3JAME 2PPBC 5ELNA 1MSGA 2F0EA 1PH9A 2V4DA 5HGTA 2N55A 3U50C 1LT3D 1BNZA 1BQQT 5JJKA 1KXLA 4DR6L 3M85A 4A4IA 3HS0C 3V96A 1HUMA 3AU7A 3MEHA 5CV4A 5IOCA 3CAMA 2EXDA 4JI8Q 2E74C 1AE2A 1VCIA 4IALA 2UXBQ 3OWFA 3GTMB 4EVOA 1ZKOA 2E75C 2KEEA 1WTVA 5K36H 3DMUA 2Q8TA 2PNHA 3CC2A 4LW1A 4DAMA 1R9TB 4OEMB 4NXNL 5JPNC 2UUBQ 1LTAD 2JA9A 4P74A 3NE5B 4H0LC 1UAPA 1PH3A 1QUQA 4L6TB 1VQFA 1EY0A 1LTTD 1V8QA 2GVAA 2PNRC 4P72A 1SE8A 4BBRH 4N9TA 2JA7G 1WVLA 4A75A 1VQCA 4B3SQ 5GAHC 2X69A 3MEFA 2ZJRA 3C1FA 3BZCA 2BA0A 1PTOH 2IJ0A 2R3ZA 4A3IB 5FLXc 1G2TA 4IUPA 3T1HL 2VY3A 4RH6A 1C0AA 2QEXA 1EFWA 3MFGA 4AIMA 1XPOA 4BY1H 2LY7A 3NQTA 4PV1C 3T53B 1AE3A 5COYA 1B4OA 2NZOA 4FF2A 2NVYH 3F2CA 1YNJD 1IHZA 1L1OC 1AFPA 1WOCA 3UE1A 4PNYA 2E2JH 3BVZA 3R3OA 4LF4Q 4TRDA 2UXDQ 5EPJA 1CQVA 3CCSA 5CBAE 3L7ZC 1WFQA 1CKNB 2CCZA 4PZ8A 1PH5A 3NWTA 2MO1A 5JEAG 4LF7Q 3GP7A 2PW7A 4UPAA 4B08A 2QW7A 4JI5Q 1MJEA 3DM3A 3GTMH 4QIWB 1JOQA 3L3OC 3VYUA 2KCCA 1KC8C 1B9NA 2QGQA 4CGYB 5J22A 4K5XA 5I9PA 2R7ZG 3FEWX 1B9MA 2RDGA 4DUZL 3NWSA 4NW2A 4JV5Q 4M1UB 1Y1VG 4G4KA 2VNUD 5C6AA 1PFMA 2Q2TA 2OTLA 1VMCA 4RA8A 1QUQB 1RIPA 2YTYA 3PUVA 2Z8LA 2JXMB 1IKMA 2PMZB 3RNUA 4GOPA 4AH6A 3NTIA 1EY8A 1T9HA 1FJGQ 1HFNA 2VQFQ 4Y52H 5DM73 1EYCA 1NCVA 1B44D 4X65Q 2OT2A 3RN5A 5CBEE 3ULPA 4A3IH 4LF6Q 3BG3A 5CYUA 4DKAC 2C5CA 1BO0A 4RWSC 1C48A 1HXYD 4HCSA 4B3RQ 4NKLA 2KOLA 4POGA 1U4MA 3E0EA 1H9JA 3HKSA 4PMCA 4DV2L 2R92B 5FO9B 4QJFA 1F9PA 5CV8A 5M5YB 2DUDA 2NYZD 3HOXG 4GZYC 5EGTA 2E2IB 2NZ1D 4PZ6A 4Q5VA 2WB1B 1EYAA 1T5EA 1JC7A 3CCQA 1B3AA 3VR4A 1Q90A 3K58A 1I94L 1O7YA 2K4KA 4KY5A 4XYQA 2OF1A 5FOBB 2CKZB 2KHJA 4EQNA 3RLNA 4ILWA 4ZQ3A 1YJ9A 1F2YA 3HOWB 4XQNA 2N8NA 4G7ZC 1PRTB 1EY5A 1QZHA 4IURA 1LTGD 3SEBA 4DV3L 4H7BA 1YI2A 4A3CG 1CKMA 2L9HA 4QCLA 1I6HH 1BBUA 1J5EL 2FHTA 4HEDA 1GO3E 3KDFA 3BVGA 5C3WA 3I70A 4FF4A 4NPSA 4O2DA 4HTHA 1SYFA 2GA4B 1YJWA 3D4RA 3T51B 4OXPA 1BDOA 2F0MA 4YCUA 3A8JE 3OW7A 1YHBA 4C2MB 2WACA 4NXML 1E2VA 5DAUA 3HP3A 2PZUA 4C1NK 1QVGA 1EIGA 4DK6C 1VQGA 3Q8DA 3E3XA 3MXUA 3U9SA 4DV1L 1OTCA 4BXXH 1A2UA 2UU9L 1H9KA 1CQFA 3M4OB 3K57A 3AQQA 4BY7G 4CDCC 3J80E 3HG9A 1E7ZA 2IX3A 1RDPD 2AQ3B 1SAPA 1SLJA 4LUVA 3KYHC 4KHPQ 3LGJA 1A63A 1SYCA 2Z9HA 1DGSA 1EZ6A 3NBHA 2R7ZB 4RKBA 4XQJA 4A3MB 2R92H 1CTMA 4S3SA 4C3HH 4DR4Q 1VQAA 1V1PB 5M5YH 2O5IC 3IRBA 5IP9H 2E2IH 4DA2A 1Y1VB 3H09A 3DWAA 3EROA 1FVIA 2XIWA 1PH7A 5EKLA 1VF7A 1MKHA 1N36Q 1K83B 1HRJA 3H0GG 3ND8A 2Q2UA 4DAYA 2OQKA 3HOWH 4R4CA 3HOUG 3OTOQ 4YHHL 4ZKCB 3G4SA 3M4YA 2ZXRA 3PIP3 3MXGA 1YEZA 2P5ZX 5AFWA 3IFDA 3SDZA 3KLWA 1V1OA 1X65A 5A2QL 3QWNA 4LUOA 3GTPH 3C2PA 2EY6A 1XPRA 1LO5D 4C2MH 5FLXL 3ZJYC 5CGKA 1U4LA 2YYZA 3FPUB 4A3BB 1PHJA 2ZJQA 5IWAQ 1H9SA 1PVOA 5IGBA 2EYMA 1TS5A 2Z6BA 4YY3Q 4X64Q 4DUYQ 1S5ED 1CHPD 1HJPA 2MHVA 1SXTA 1VQMA 5C3EG 3FRPB 4DR5Q 4XQQA 3M4OH 1WCMH 5DEHA 4A3FB 1OXSC 3DWQA 4A3EB 2M00A 2K1BA 3AMUA 3CP0A 1A15A 2KEDA 1Y1WG 1IBMQ 1UUPA 3PMFA 3S14B 1TVXA 2I5HA 2B3GA 3ONAB 1HZAA 2KCMA 3P7JA 1T5XD 1YHQA 1VQ5A 4JI4L 2DJGC 4DR3Q 1PRTC 4LF9Q 5M3MG 1JQYD 3GV3A 4X6AH 2E76C 4A3MH 3F2UA 1HR0W 4JI6L 2VQEQ 1FR3A 3E6ZX 3W5OA 3RLOA 1K9MC 2VW9A 3G6JB 2IT1A 3T1YL 1VQLA 4DV0Q 1OXVA 5K5PA 1W2BA 3IFTA 1K0RA 2HQLA 2RCFA 3FVQA 3RZDH 2JJQA 3CMAA 4A3KH 1I4PA 3F2DA 2K5HA 1K83H 2JSOA 1STGA 2KHSA 4IFDJ 4AQYL 1UEBA 1W3SA 1IBKQ 1PH8A 4HSVA 1HQRD 1N33Q 1TWFB 4HMIA 5EKIA 4RFBA 1ASYA 1EYDA 1LM0A 4OHJA 1PTOD 1SMYC 4NMZA 4MZ9A 2LSSA 2IY5B 4R4OA 1QCBD 1RL2A 1C9OA 2I0QA 3GTGH 2MQHA 1KTKA 3KLSX 2BH8A 2A69D 1G2SA 4IPDA 5NUCA 3ICEA 1RKNA 1PFBA 5JAVA 3KF6B 1RD9D 1VF5C 5K36G 2B2YA 2B2UC 4KKSA 3R2IA 3R8BA 2VL6A 3BDOA 5KNCA 2EVBA 4A3BH 5JJLA 4K8JA 3RZOB 3BVMA 5M5XB 1KNAA 4QL5A 2A8VA 2NVTH 4Z9CB 1KAAA 4JK1C 3UDGA 1ENFA 3J7ZC 3BJUA 1XMOQ 4CDDC 5E1FA 1YNJC 2F0KA 2OEOA 3MHBA 4A3FH 4A3EH 4LNQA 4CBVA 4LMQD 4K5VA 5GAGC 1XNRL 3HOUB 1A62A 1X3PA 3S14H 3I4MH 3LWEA 1SEBD 1LLRD 5M3FB 3I55A 3N6RA 3TEHB 3MTSA 1PDQA 2IHEA 2NUCA 5KYLA 1QNKA 5I9OA 4KD3A 1DCZA 1Z47A 3EN2A 4A3JB 1EEFD 3KUPA 2QILA 4JI7Q 4BY1G 3TP5A 1L0YB 5CMDA 1HNXQ 2H4OA 1MJCA 1K73C 1C4QA 2V1CC 1X3GA 2AHOB 3EIVA 3HKZG 1AN8A 2F0TA 3G71A 2VB2X 4EX5A 5C3EB 1EOTA 4I7AA 1TWFH 4L5SA 1BCPF 1YVCA 4RKLA 5J39A 3I73A 1D2BA 2WIIB 1MD2D 4IFDI 4IOCA 1QVFA 2ZT9C 1TU2B 4DV5L 1GUSA 2D0PA 2JYOA 3AEVA 2A6HD 3OWEB 1O7LA 1NY4A 1DOMA 3T4AC 2F3WA 5EPKA 2K01A 4C1NI 1PLFA 2Z4HA 2SOBA 2AWOA 1PYWD 4O42A 2EYHA 4DV4L 4IFDH 1IYUA 1O78A 1L2FA 1RF2D 3S2DH 2F0DA 3BDCA 3RZOH 4RGMA 1HTLD 5M5XH 5IE8A 2KQ3A 1XPUA 1GUOA 4RG1A 4X3UA 1KHIA 3PF4A 4IPHA 4NXNQ 4YIJA 1EZ8A 2HHHQ 3E5SA 2A73B 4KN4C 1CFMA 1I4RA 3BS1A 1Z9FA 1CA6A 1X6OA 5M3FH 1QILA 3BYYB 1HZ9A 3VYSA 2F0QA 4A3IG 4LFAL 1JICA 2RBMA 4HJ9A 4A3JH 1W6KA 3D6WA 3S1NB 2F0JA 5IYCH 1WD0A 3T1HQ 2K6AA 4N9PA 1HCZA 5BN4A 1HNWL 2NTTA 4QMGA 4YCWA 1A3TA 2B63B 4DFAA 2I46A 5TSSA 3P1HA 4JYAL 4DR7L 1PH1A 3S1QH 1VQEA 1HA5A 3W2DA 1WTWA 4BBRB 1NSNS 3DHQA 2JA6B 3NELA 4H02A 5D65A 1A2TA 3DEOA 5CC4A 3NSWA 1S5FD 4CDEC 4RCNA 4LF5Q 1E24A 4H13C 4R4QA 1LT4D 1Z6HA 1PTOB 5BN5A 2RVLA 1EQQA 3RR5A 1UE5A 5HURA 3CC7A 2PI2E 1X3EA 4KLKA 1N32L 2G9DA 4KKUA 5KYIA 4UAIA 4FF1A 2NVYB 5D3DA 3OSOA 5IY0A 3SVMA 1K8AC 3CC4A 2EJFC 4LFBL 2E2JB 3MWYW 1I50B 2EZVA 3C3LA 3HRZC 2L0CA 4QGUA 1CKNA 1RHPA 5EQ0A 1KRSA 4DV6L 1CI3M 1PRTD 4DN4M 5A2QE 4C3IB 1G91A 2A1AA 5JOBA 1TS4A 4BXXG 2A74C 2K5NA 3J81L 3CD6A 3HFZB 5FLXE 3ERSX 1H9MA 3HOVB 3TQYA 3M9BA 3PUWA 3PV0A 3S1NH 4JI3L 4OWXB 2UUCL 1X54A 1ENCA 1MBYA 2HIXA 2ZTDA 1STBA 4OO1I 1FD7D 1A3VA 2RDHA 3TSSA 3KK7A 2B63H 2R92G 4C3HG 3PIO3 4I7ZC 2CH4A 4DV2Q 1F2MA 5IYDH 2HQEA 5IP9G 2R93H 2WB1G 2B2YC 1KD1C 1SMYD 4OO1H 2F1MA 2Q2HA 2JA6H 3PGZA 3GTLB 2ICEC 4J1MA 2MJ8A 1STAA 3M4PA 1S72A 5JJIA 3TDQA 3VR2A 4HJ5A 3HOWG 2IW3A 1NNXA 3K0XA 1I4XA 1UE1A 3SE0A 2CFMA 4K14A 1J8IA 1NUCA 2LS01 3TP8A 3NP8A 3U58A 3K0YA 1NMGA 4DR2L 4P2CB 4QF4A 2L15A 3M7GA 2Z6KC 4L5QA 1J5EQ 1F9SA 1HR0L 1I4HA 4WJ3M 3OPOA 1LACA 3PO2H 2LXJA 1I50H 2N88A 3VA5A 3OW2A 4OX9L 5C4JH 1EFID 1X3FA 4C3IH 4IO9A 1YNXA 2IX0A 3CW2C 2AUJD 3SK6A 1BKBA 2YTVA 4UDUC 4DV1Q 5C0XI 3V2TA 3PIPA 3AB9A 3HOVH 3I7FA 1TS2A 3FP9A 4V190 1KRTA 3GTKB 4F7XA 1B3QA 1I6HB 2OTJA 1VQJA 3MZ5A 1PTOC 5F2DA 1U5KA 4A3MG 1CUKA 2HCIA 3CHBD 2XNAC 5C0XH 4A3LH 4HJAA 1FNUA 4ID6A 1Q82C 2A69C 3G7LA 4K6LA 3DEPA 1TWAB 4DGZA 2VB3X 1KLUD 2B8FA 3ULLA 1NTGA 1TWHB 3NTKA 4PZ7A 4DV7L 4A3KG 3GTLH 1QE6A 3UE0A 1PH4A 2BCOA 3G48A 3J80i 3OIPA 3GTJH 3VYRA
chains in the Genus database with same CATH topology
2D62A 4OIKA 4KV6A 1JWMD 2AUKA 1PZJD 2X6GA 1O80A 2LKVA 1TT2A 2F0VA 3I8ZA 5J1ZA 3OMGA 3A7AB 4RGOS 2B2UA 1HA6A 1ET6A 3SK4A 4IUVA 1V1PA 3SHLA 4X3TA 4HCEA 3OMCA 4C3HB 1KDBA 4ODGA 2NBFA 4QUCA 4MN3A 4FVMA 4KK7A 1D1KA 1ESRA 1RTNA 1IKLA 4RHRA 2F0WA 1STNA 3I90A 1JE4A 3KLRA 2SEBD 3ND9A 2R6GA 4KJNA 1STEA 2PCFB 2F0GA 3ERQA 2BE5C 2B2TC 2RSOA 3TZDA 4NP5A 1S5BD 2EOTA 4HR7B 1BR9A 4FP5D 2OXPA 3GQBA 4DNTB 3OOCA 4KKTA 3VYTA 5C5LA 2A6HC 3GTPB 2EY1A 4ZUIA 4XTCS 1F9QA 1GUWA 2AQ2B 2K5QA 2FINB 1XTCD 1GUTA 2ID0A 3LWUA 1RJTA 5BN3A 1NAPA 4C3JB 1TY0A 2RQXA 3WOFA 1WTQA 4HSPA 4LJZC 3I4NB 4Y7NB 1SNCA 3H91A 1WCMB 1SNDA 5JVH3 2J0TD 3BDLA 5EBDA 2Q8RE 2G9HD 1GOZA 1ML0D 1ESFA 1PZID 2JEBI 3NBIA 5KIXA 4IFDG 3I3CA 1FNVA 5JVG3 3RZDB 4A3KB 2BA1A 4KTAA 1SYEA 3EFXD 1F2ZA 1WD1A 2A5HA 1Z7TA 2F0SA 1TQOA 1BUVT 1SE3A 5I4DA 1IYVA 2EY5A 3GO5A 4PMWA 1Q1EA 4FXKC 3GTGB 3ZYYX 4DAVA 4E6IA 3JAML 4K2LA 2EY2A 3Q23A 2B8GA 1C8CA 3D4DA 1CZGA 2K5DA 3VA7A 3J81E 3FPPA 2NVTB 4CJ2C 3U9OA 1LT5D 5KGUA 4WORA 3TZUA 2DN8A 1JR0D 1Q3LA 1B50A 5T1IA 3PUYA 3I4MB 2O5JC 1I4QA 4X3KA 2EYOA 2QCPX 3NHHA 2F0NA 2EJMA 2IL8A 4WJWA 2ZXOA 2A68D 1SJHD 2B2WC 1ZYRD 3R2TA 4EGVA 5JEAH 2ZXPA 1SNOA 2NWGA 5D14A 2MP1A 2RKSA 3Q6SA 2AQ1B 4CHTB 2O4XA 2KJXA 1HQMC 4F88A 2EDGA 1F2LA 3X3MA 1XXGA 1BF4A 1EEID 2JE6I 3KLSA 1I6VC 3I4LA 3TMEA 3D8GA 1E2WA 3QG1A 2FFKB 3CRLC 3PO3B 2J4XA 1F77A 1EU4A 4KI0A 2E2DC 2MUYA 3OIQA 2O2LD 2RDFA 3X3NA 4ZYSA 3K5MA 3W3AA 3GTQB 3S2DB 5EJWA 4DF7A 3NQIA 5ELEA 3L9AX 2ICIA 4A93B 2TMPA 3K6OA 3QIAA 3BZDB 3LNNA 1KNEA 1ZXTA 1CA5A 4OO1G 4FO2A 1BXTA 1QWYA 1TY2A 5DNFA 2WINB 4KJOA 1EY6A 1SDFA 3D6CA 1R4PB 1VMPA 1XX8A 1CM9A 4KHVA 3LX0A 2M2LA 5IIFA 1XYIA 4DXGA 3Q0AA 5JJZA 5LL6S 3J7AF 3BYTB 2JP1A 3K5OA 1RCVD 1II3A 4IUTA 3UI2A 2BE5D 5G3LF 3WOEA 4WFN3 3S1QB 3CKIB 5I6YA 1WTXA 4C3IG 5CORA 3K7AB 1STHA 1DZ1A 1SSOA 3I72A 4MHEA 1Q8IA 4A3DB 3KBXA 2K32A 1GXDC 3J7AV 1TIID 2WKCA 2WAQB 3Q22A 1S5CD 3N52A 4M8AA 1W6JA 4K5WA 2SNSA 2B2VC 1CHQD 5C0XG 2VXWA 2LFNA 2CW0D 2NVQB 4IUQA 1JB3A 1K8OA 3VR5A 2D9UA 1HHVA 3TBIB 1JCKB 1ICWA 1GJXA 1EQVA 2F3VA 3HEJA 5C3XA 2KVMA 3GV6A 4QB4A 5CR3A 2DY7A 1MI2A 3T13A 1V43A 2L4NA 5ELDA 1FGBD 2EYFA 2HDLA 4KY7A 4TSSA 4CJ1B 3DUZA 2R93B 5C4XB 2B2TA 1LTSD 4F87A 5T1GA 2IX1A 2M9VA 4L63B 1BCPD 1PXUA 1DJRD 4PQXA 3H3VC 4O1NA 2WP8J 4AYBB 2Q8IB 3WDNA 4TKOB 1QOHA 2L5TA 1MSHA 3SXHA 4KMUC 1FYCA 3PO2B 1H9RA 1STYA 4MIUA 1I3QB 4LK1C 2D5DA 3A55A 5C4JB 2FJ2A 5C0XJ 3PUZA 2F0IA 4FF3A 5ISRA 2K28A 3CQZB 4JBWA 3HOYB 3KBGA 1E2ZA 3Q24A 1D1IA 2NTSA 5FKAC 5C44B 1SJED 2XRQD 2BDOA 4FXDA 2NN6I 3SR1A 1RODA 5KNBA 3ITPA 3I91A 4A3GB 4ZKBB 2F0OA 2XN9C 4DK1A 4OL7A 3HGBA 1SE4A 1ILPA 2NN6H 3GTJB 1JWSD 3HOZB 2D2CC 3QJYA 1JOKA 5IT9L 5IODA 1SBBB 1S4ZA 2EXZA 5IGFA 1DM0B 4RGNA 3TN2A 4B9WA 4ZAIA 2A68C 2BOSA 1TR5A 1HFGA 1D5XC 4U673 1ZYRC 5E4XA 2PZTA 1TS3A 3EQLC 4C3JG 2JA5B 3S17B 1G291 4BA2I 1AW7A 1XWEA 1M4VA 5JPMC 1SFOB 2KUMA 4ME5A 2B2WA 4XXEA 1PZKD 4XDXA 1G8ZD 3QO2A 1DOKA 4BS9A 2VUMB 4DNRB 1WTOA 3R93A 1G6ZA 3D3RA 1SNMA 4U68A 1BOSA 2EE1A 1AZQA 2FMMA 1AZPA 3MAQA 1KDAA 4BBSB 2JA8B 1ET9A 3GD7A 3FDTA 2KA7A 2DNCA 1GHJA 3NK9A 1EQTA 2F0FA 1DD2A 1UNSA 1BCPB 3C1EA 1CK1A 1DYQA 1O7ZA 2C9OA 1AP0A 2NVXB 4J6HA 1OXUA 1CT1D 2F0HA 1IW7D 2LMCB 3MXNA 2J7ZA 1B2TA 2XSCA 4R8IA 5I2XA 4CKCA 4EQPA 1DXMA 4XT1B 1JWUD 1KLGD 4K2KA 3VR3A 4G7OC 5FO7B 5FK9C 3DM1A 2EJGC 3EVQA 4IUUA 3P75A 2EYLA 1ONLA 2A6EC 2HCCA 2IPKD 3EJIA 1D5ZC 3S2HB 3FMCA 1QG7A 3K59A 1YNND 2JA7B 3MVVA 5IGCA 1LTBD 3S9WA 2L1BA 2EPBA 4IQZA 4B9XA 1EU3A 5KRUA 1B53A 3S1MB 2Z4IA 3URYA 5ELFA 2CQAA 2NB0A 2QDBA 2HUGA 1SYDA 1ILQA 2F0LA 2PYKA 5JEAJ 3RUZA 1B1ZA 3SK5A 3H6MA 3TP7A 2CW0C 3M3YB 3CU7A 4RAUC 2KCNA 2MPMA 4K6DA 4RHSA 2QKIC 1BBXC 2B2VA 1DONA 3P20A 2YU9B 1TKWB 4K8IA 2RA4A 1EL0A 1LABA 1KDCA 1WTRA 1D6EC 4HMJA 2XWJB 1CZWA 5IGDA 3SK8A 1NR4A 1GHKA 1X32A 5IGGA 2K05A 2IWHA 3GTOB 2Y0SB 2E2HB 3IL8A 1QJOA 2L11A 1BCPC 3K5LA 3QOLA 2R61A 3A56A 2F0UA 1U4RA 1PTOF 5ELCA 1K8MA 3HZXA 2JEAI 4OIJA 3KF8A 5IGEA 3MFYA 4OGQC 1QNUA 1Y8PB 2F03A 4R9WA 2Z1CA 1JOOA 4IUNA 4KD4A 2AWNA 1U9RA 4HN7A 3HOXB 1GUGA 1LT6D 4FXGC 1TWGB 1SNPA 3NPPA 4J8QA 5C4HA 2SNMA 1J9OA 4ZUJA 1S5DD 2K33A 3A54A 1OXXK 1D5MC 5EBCA 1KABA 1Q12A 2I07B 4IN3A 5KNDA 3M7NA 1PFNA 1RTOA 4CJ0B 1PMRA 5DM63 1HPCA 1R4QB 3FKIB 3S1RB 5IT9E 3DXJC 4KHZA 2XVSA 1WTPA 5EKKA 2F4IA 2QEJC 2PW5A 3NXWA 4DAPA 3MC0B 1EWCA 2SDFA 4V0BA 3IAYA 4BY7B 3DWPA 3TP6A 3EA6A 1NR2A 2DNEA 1I4GA 2K7VA 2EYJA 2WKDA 3O13A 3A8KE 4ZLTF 2PZWA 5C5MA 2K5WA 3D31A 4FNFA 3CRKC 1UEAB 5CV9A 4F8MA 2NN6G 5D3IB 4EQOA 5A35A 1EY4A 5LL6X 1ENAA 1H9SB 1LV9A 1FNWA 1A3UA 3H0GB 4NDXA 2WV6D 1L0XB 1OO9B 3RD4A 1Q1BA 2ENBA 4IZ8A 1MGSA 5E3FA 5CV7A 1OXTA 4DK0A 3S16B 1AEXA 4HAEA 1A6XA 2F0PA 1LTID 1Y8OB 2A6ED 2L55A 4CKBA 3S15B 4Q0FA 5M5WB 3K5NA 1QB5D 1VDZA 3E0JA 4I65A 2K04A 1JORA 2B39A 2X6LA 5I6WA 4ZK9B 1HTPA 4XIGS 2PQEA 4WRDA 3IKJA 1Y69U 2KECA 2XWBB 1Y1WB 3VR6A 4BWGB 1EY7A 1DOLA 4DXFA 3A8IE 4X3SA 3H94A 1X3QA 5C4ZA 5M3MB 4KY6A 4RCOA 1GUNA 2MGSA 2HDMA 3RMHA 1IW7C 2L12A 5ELBA 5FO8B 2PO4A 5E4WC 5M9OA 4RGTA 4QUFA 4ULLA 1LTRD 2RSNA 1PRTF 3MXPA 3V05A 1EIHA 3NUCA 3OHXC 4XT3B 2H1EA 5KEEA 4R8NA 3A7LA 2QF7A 4BA1I 1YNNC 1IL8A 4L8JA 1SE2A 3RLFA 1F9RA 5EPLA 5LHY1 4KN7C 3J80L 4XYOA 4ABNA 2CHBD 5G3LD 1SYBA 3J7YW 2BDNA 2TSSA 5I2YA 2FMCA 3D4WA 2DY8A 4PMBA 3NTHA 4DU9A 1E0BA 1ZEQX 5CV6A 4G7HC 2CVRA 4G57A 1TWCB 1Y8NB 4CKEA 3MA2B 1M8AA 1SYGA 4TQUS 4H44C 1SNQA 1U4PA 4FYDA 3PUXA 4C56C 3QB3A 3T16A 1HUNA 1EY9A 2K03A 1EWHA 2EYPA 3QOJA 5CV5A 2XRSD 4BY1B 3T56B 4LAAA 4ZRZA 3C46A 3HKZB 3JAME 2PPBC 1MSGA 2F0EA 2V4DA 5HGTA 2N55A 1LT3D 1BNZA 1BQQT 3M85A 3HS0C 3V96A 1HUMA 3AU7A 3MEHA 5CV4A 5IOCA 2E74C 1VCIA 4IALA 3OWFA 3GTMB 4EVOA 1ZKOA 2E75C 2KEEA 1WTVA 5K36H 3DMUA 2Q8TA 1R9TB 5JPNC 1LTAD 3NE5B 4H0LC 1UAPA 4L6TB 1EY0A 1LTTD 1V8QA 2PNRC 4N9TA 1WVLA 2X69A 3C1FA 2BA0A 1PTOH 2IJ0A 2R3ZA 4A3IB 1G2TA 4IUPA 4RH6A 3MFGA 2LY7A 3NQTA 4PV1C 3T53B 5COYA 1B4OA 4FF2A 1YNJD 1IHZA 1AFPA 4PNYA 3BVZA 3R3OA 4TRDA 5EPJA 1CQVA 5CBAE 3L7ZC 3NWTA 5JEAG 3GP7A 2PW7A 4B08A 4QIWB 1JOQA 3L3OC 3VYUA 2KCCA 1B9NA 4CGYB 5J22A 4K5XA 5I9PA 3FEWX 1B9MA 2RDGA 3NWSA 4NW2A 4M1UB 4G4KA 2VNUD 5C6AA 1PFMA 1VMCA 4RA8A 3PUVA 2Z8LA 2JXMB 1IKMA 2PMZB 3NTIA 1EY8A 1HFNA 5DM73 1EYCA 1NCVA 1B44D 2OT2A 5CBEE 3BG3A 5CYUA 2C5CA 1BO0A 4RWSC 1C48A 1HXYD 4HCSA 4NKLA 2KOLA 1U4MA 1H9JA 4PMCA 2R92B 5FO9B 1F9PA 5CV8A 5M5YB 2NYZD 4GZYC 5EGTA 2E2IB 2NZ1D 4Q5VA 2WB1B 1EYAA 1T5EA 1JC7A 1B3AA 3VR4A 1Q90A 3K58A 1O7YA 4KY5A 4XYQA 2OF1A 5FOBB 4EQNA 4ILWA 4ZQ3A 1F2YA 3HOWB 4XQNA 4G7ZC 1PRTB 1EY5A 4IURA 1LTGD 3SEBA 4H7BA 2L9HA 4QCLA 2FHTA 4HEDA 3BVGA 5C3WA 3I70A 4FF4A 4HTHA 1SYFA 2GA4B 3D4RA 3T51B 1BDOA 2F0MA 3A8JE 3OW7A 4C2MB 2WACA 1E2VA 5DAUA 3HP3A 2PZUA 4C1NK 1EIGA 3MXUA 3U9SA 1A2UA 1H9KA 1CQFA 3M4OB 3K57A 3J80E 3HG9A 2IX3A 1RDPD 2AQ3B 1SAPA 1SYCA 1EZ6A 3NBHA 2R7ZB 4RKBA 4XQJA 4A3MB 1CTMA 4S3SA 1V1PB 2O5IC 4DA2A 1Y1VB 3H09A 3DWAA 3EROA 2XIWA 5EKLA 1VF7A 1K83B 1HRJA 3ND8A 4DAYA 4ZKCB 3M4YA 2ZXRA 3PIP3 3MXGA 5AFWA 3IFDA 3SDZA 1V1OA 5A2QL 3QWNA 3C2PA 2EY6A 1LO5D 5FLXL 5CGKA 1U4LA 2YYZA 3FPUB 4A3BB 1H9SA 5IGBA 2EYMA 1TS5A 1S5ED 1CHPD 2MHVA 1SXTA 3FRPB 4XQQA 5DEHA 4A3FB 1OXSC 3DWQA 4A3EB 2M00A 2K1BA 3AMUA 1A15A 2KEDA 1UUPA 3PMFA 3S14B 1TVXA 3P7JA 3ONAB 1T5XD 1PRTC 1JQYD 3GV3A 2E76C 3F2UA 1FR3A 3E6ZX 3G6JB 2IT1A 1OXVA 5K5PA 3IFTA 3FVQA 1I4PA 2JSOA 1STGA 2KHSA 4IFDJ 4HSVA 1HQRD 1TWFB 4HMIA 5EKIA 4RFBA 1EYDA 4OHJA 1PTOD 1SMYC 4NMZA 1QCBD 1KTKA 3KLSX 2A69D 5NUCA 1G2SA 1RKNA 1PFBA 5JAVA 1RD9D 1VF5C 5K36G 2B2YA 2B2UC 4KKSA 3R2IA 3R8BA 3BDOA 5KNCA 2EVBA 4K8JA 3RZOB 3BVMA 5M5XB 1KNAA 4Z9CB 1KAAA 4JK1C 1ENFA 5E1FA 1YNJC 2F0KA 2OEOA 3MHBA 4CBVA 4LMQD 4K5VA 3HOUB 1X3PA 3LWEA 1SEBD 1LLRD 5M3FB 3N6RA 3MTSA 1PDQA 2NUCA 5KYLA 1QNKA 5I9OA 4KD3A 1DCZA 1Z47A 4A3JB 1EEFD 3KUPA 2QILA 3TP5A 1L0YB 5CMDA 2H4OA 1C4QA 1AN8A 2F0TA 2VB2X 5C3EB 1EOTA 1BCPF 5J39A 4RKLA 3I73A 1D2BA 2WIIB 1MD2D 4IFDI 2ZT9C 1TU2B 1GUSA 2JYOA 2A6HD 3OWEB 1O7LA 1DOMA 3T4AC 2F3WA 5EPKA 2K01A 4C1NI 1PLFA 2Z4HA 2SOBA 2AWOA 1PYWD 4O42A 2EYHA 4IFDH 1IYUA 1O78A 1RF2D 2F0DA 3BDCA 4RGMA 1HTLD 2KQ3A 1GUOA 4X3UA 4YIJA 1EZ8A 3E5SA 2A73B 4KN4C 1CFMA 1I4RA 3BS1A 1CA6A 1QILA 3BYYB 3VYSA 2F0QA 1JICA 2RBMA 1W6KA 3D6WA 3S1NB 2F0JA 1WD0A 2K6AA 4N9PA 1HCZA 5BN4A 2NTTA 4QMGA 1A3TA 2B63B 4DFAA 2I46A 5TSSA 3P1HA 1WTWA 1HA5A 3W2DA 4BBRB 1NSNS 3DHQA 2JA6B 5D65A 1A2TA 3DEOA 5CC4A 3NSWA 1S5FD 4RCNA 4H13C 1LT4D 1Z6HA 1PTOB 5BN5A 2RVLA 5HURA 2G9DA 4KKUA 5KYIA 4UAIA 4FF1A 2NVYB 5D3DA 3OSOA 3SVMA 2EJFC 2E2JB 3MWYW 1I50B 2EZVA 3C3LA 3HRZC 2L0CA 1RHPA 5EQ0A 1CI3M 1PRTD 4DN4M 5A2QE 4C3IB 1G91A 5JOBA 1TS4A 2A74C 3J81L 5FLXE 1H9MA 3HOVB 3PUWA 3PV0A 1ENCA 1MBYA 1STBA 4OO1I 1FD7D 1A3VA 2RDHA 3TSSA 3KK7A 4C3HG 3PIO3 4I7ZC 1F2MA 2HQEA 2B2YC 1SMYD 4OO1H 2F1MA 3GTLB 2ICEC 4J1MA 2MJ8A 1STAA 3TDQA 3VR2A 2IW3A 1I4XA 3SE0A 4K14A 1J8IA 1NUCA 2LS01 3TP8A 3NP8A 3K0YA 4P2CB 4QF4A 3M7GA 1F9SA 1I4HA 3OPOA 1LACA 2N88A 3VA5A 1EFID 2IX0A 2AUJD 3SK6A 4UDUC 5C0XI 3V2TA 3AB9A 1TS2A 4V190 3GTKB 4F7XA 1I6HB 3MZ5A 1PTOC 5F2DA 2HCIA 3CHBD 2XNAC 5C0XH 1FNUA 4ID6A 2A69C 3G7LA 4K6LA 3DEPA 1TWAB 4DGZA 2VB3X 1KLUD 2B8FA 1TWHB 3NTKA 1QE6A 2BCOA 3OIPA 3VYRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R3Z A;  2FJ2 A;  3KBX A;  4OIK A;  1J9O A;  2DY8 A;  1G2T A;  1WTO A;  2NZ1 D;  4IUP A;  3R93 A;  2X6G A;  1G6Z A;  5AFW A;  1O80 A;  3I3C A;  3IFD A;  1E0B A;  3N52 A;  1KNA A;  2FFK B;  2CVR A;  1B3A A;  4U68 A;  3I8Z A;  2EE1 A;  1JIC A;  1M8A A;  2B2V C;  1AZQ A;  1O7Y A;  2FMM A;  5COY A;  1AZP A;  2B2Y C;  2K28 A;  1B4O A;  1U4P A;  1PFN A;  3D6W A;  4LMQ D;  2B2U A;  2K04 A;  2VXW A;  4RAU C;  1RTO A;  1WD0 A;  4CJ0 B;  1HA6 A;  4IUV A;  2MPM A;  1X3P A;  1U4L A;  2X6L A;  3FDT A;  4IUR A;  4X3T A;  2MJ8 A;  3LWE A;  4IUQ A;  3FPU B;  1BBX C;  4ZK9 B;  2L9H A;  1EQT A;  2B2V A;  2FHT A;  4HED A;  2D9U A;  4QUC A;  4MN3 A;  5EPJ A;  1WD1 A;  1DON A;  1HHV A;  2K03 A;  3MTS A;  1PDQ A;  5EJW A;  1HUN A;  5CBA E;  2KEC A;  1J8I A;  1ROD A;  1QNK A;  1ESR A;  1RTN A;  2RA4 A;  1IKL A;  1DOL A;  1WTP A;  1ICW A;  3I91 A;  1WTW A;  1EL0 A;  2K1B A;  3KUP A;  3I90 A;  4X3S A;  4ZKB B;  1WTR A;  1JE4 A;  1X3Q A;  1A15 A;  2KED A;  1F9S A;  1O7Z A;  5D65 A;  2B2U C;  1TVX A;  2MGS A;  3DEO A;  1KNE A;  1AP0 A;  1ZXT A;  3P7J A;  2KVM A;  3HP3 A;  3ONA B;  5CMD A;  2HDM A;  1MSG A;  2L12 A;  1CA5 A;  3GV6 A;  1EIG A;  2B2T C;  2N55 A;  2RSO A;  3TZD A;  2N88 A;  2DY7 A;  3GV3 A;  1ILP A;  2SDF A;  2EOT A;  1BNZ A;  1C8C A;  1NR4 A;  3F2U A;  1MI2 A;  1EOT A;  5E4W C;  1NR2 A;  2RVL A;  2J7Z A;  5DNF A;  1X32 A;  2L4N A;  2K05 A;  1SDF A;  4R8I A;  1B2T A;  2HDL A;  4QUF A;  1HUM A;  1VMP A;  1XX8 A;  4XT1 B;  4CJ2 C;  4CJ1 B;  4NW2 A;  3IL8 A;  1CM9 A;  2B2T A;  1S4Z A;  2L11 A;  5T1G A;  2JYO A;  2M2L A;  1SAP A;  2RSN A;  1Q3L A;  4UAI A;  3DM1 A;  1PFM A;  1XYI A;  1EIH A;  3SVM A;  1B50 A;  1F9Q A;  5T1I A;  3TN2 A;  4ZLT F;  5JJZ A;  1GUW A;  1DOM A;  1U4R A;  1VMC A;  2FIN B;  2K01 A;  3MWY W;  4RA8 A;  4X3K A;  5EPK A;  4XT3 B;  4IUU A;  2H1E A;  2KEE A;  2JP1 A;  4OIJ A;  1PLF A;  1WTV A;  1IKM A;  2Q8T A;  4ZAI A;  1RHP A;  1RJT A;  4HSV A;  2HCC A;  5EQ0 A;  4O42 A;  4IUT A;  1HFG A;  1NAP A;  1HFN A;  3UI2 A;  5E4X A;  1NCV A;  4DN4 M;  1IL8 A;  2IL8 A;  5EKI A;  1WTQ A;  5CBE E;  1G91 A;  2B2W C;  1QG7 A;  2HCI A;  4R9W A;  3H91 A;  1BO0 A;  4RWS C;  2NWG A;  2XIW A;  4HCS A;  1LV9 A;  2MP1 A;  5D14 A;  1WTX A;  1F9R A;  5EPL A;  1MSH A;  2L1B A;  3G7L A;  3Q6S A;  4X3U A;  2KOL A;  3DEP A;  2EPB A;  1HRJ A;  2Q8R E;  1U4M A;  2KUM A;  1B53 A;  1ML0 D;  5COR A;  1G2S A;  1WVL A;  1MGS A;  1F2L A;  1DZ1 A;  1SSO A;  2B2W A;  2X69 A;  1QE6 A;  4MHE A;  1PFB A;  1F9P A;  1BF4 A;  4XDX A;  4ZKC B;  3QO2 A;  4HAE A;  2BDN A;  1DOK A;  2NYZ D;  2HUG A;  1CA6 A;  1ILQ A;  2B2Y A; 
#chains in the Genus database with same CATH topology
 2D62 A;  4OIK A;  4KV6 A;  1JWM D;  2AUK A;  1PZJ D;  2X6G A;  1IBL Q;  1O80 A;  2LKV A;  2WAQ E;  1TT2 A;  2F0V A;  4GN3 B;  3I8Z A;  5J1Z A;  3OMG A;  4YHH Q;  3A7A B;  4GLX A;  4RGO S;  1PA6 A;  2B2U A;  1HA6 A;  1ET6 A;  3SK4 A;  5FLM G;  4HJ7 A;  4IUV A;  2ZM6 L;  1V1P A;  1GM5 A;  3SHL A;  4X3T A;  4JI8 L;  2QA4 A;  4HCE A;  3OMC A;  4C3H B;  3FHW A;  1KDB A;  1MHW C;  4ODG A;  2NBF A;  4QUC A;  4MN3 A;  2CWA A;  2ATW A;  4FVM A;  4KK7 A;  1D1K A;  4YCV A;  4A3B G;  1ESR A;  1RTN A;  3K8A A;  1IKL A;  4YWK A;  4RHR A;  2JA5 H;  3S17 H;  2F0W A;  1STN A;  3I90 A;  1JE4 A;  3KLR A;  2SEB D;  3ND9 A;  2R6G A;  3K7U C;  4KJN A;  2UUB L;  4A3F G;  1STE A;  2PCF B;  4O0A A;  5J3B A;  4A3E G;  3PSI A;  2F0G A;  3ERQ A;  2BE5 C;  4FDB A;  1JE5 A;  4OWT B;  2B2T C;  3CCM A;  2RSO A;  3TZD A;  3GTK H;  4NP5 A;  1S5B D;  2EOT A;  4HR7 B;  1H95 A;  1BR9 A;  4FP5 D;  2OXP A;  3A0J A;  3GQB A;  4DNT B;  3OOC A;  4B3S L;  4JI4 Q;  4KKT A;  3VYT A;  5C5L A;  3J81 j;  2A6H C;  3GTP B;  2EY1 A;  4ZUI A;  4UP9 A;  4UY8 C;  4XTC S;  4JI6 Q;  1F9Q A;  1XNQ L;  1TWA H;  2AQ2 B;  1GUW A;  1SRU A;  2FIN B;  2K5Q A;  1XTC D;  1GUT A;  2ID0 A;  1UWV A;  4GLA C;  1TWH H;  3LWU A;  2MNA A;  3T1Y Q;  1RJT A;  5BN3 A;  1NAP A;  4C3J B;  1TY0 A;  2RQX A;  4QY7 A;  3WOF A;  1WTQ A;  2E5L Q;  4HSP A;  4LFC L;  4LJZ C;  4AYB E;  3I4N B;  4Y7N B;  4JC0 A;  3TS2 A;  1SNC A;  3CPF A;  3H91 A;  3H15 A;  1WCM B;  4AQY Q;  1SND A;  5JVH 3;  2J0T D;  3BDL A;  5EBD A;  2Q8R E;  2G9H D;  1GOZ A;  1ML0 D;  2NVX H;  2A19 A;  1Q7Y C;  1ESF A;  1PZI D;  2JEB I;  4JI5 L;  3NBI A;  5KIX A;  3PQI A;  5GRO A;  4IFD G;  3I3C A;  1FNV A;  1HZC A;  1VQ9 A;  5JVG 3;  3RZD B;  4YWM A;  4A3K B;  1WJJ A;  2BA1 A;  1JB7 A;  1V9P A;  4KTA A;  4MNO A;  4JV5 L;  2ZTC A;  1SYE A;  4DNI A;  3EFX D;  4JBJ A;  2DJF C;  1F2Z A;  1WD1 A;  2A5H A;  2KHI A;  1Z7T A;  2F0S A;  1TQO A;  1BUV T;  1SE3 A;  1XNR Q;  5M3F G;  2OQ0 A;  5I4D A;  1IYV A;  2EY5 A;  3GO5 A;  4MTK A;  2JA7 H;  3VDY A;  3PF5 A;  2VQF L;  4PMW A;  1Q1E A;  3QR8 A;  4FXK C;  1XMQ L;  1CSP A;  3GTG B;  3KF6 A;  3ZYY X;  4A3J G;  1N34 L;  2KBN A;  4JI1 Q;  4K0K L;  4DAV A;  2ZJP A;  2UUA Q;  4E6I A;  3JAM L;  4B3R L;  5IYC G;  2HT1 A;  4K2L A;  2F4V Q;  2EY2 A;  1AH9 A;  3Q23 A;  2B8G A;  1C8C A;  3D4D A;  1CZG A;  2K5D A;  3E9H A;  4C3J H;  3VA7 A;  4JI2 L;  1JJG A;  2JQO A;  3J81 E;  3FPP A;  1WTH A;  2NVT B;  3I4N H;  4Y7N H;  4CJ2 C;  2XGT A;  3U9O A;  1LT5 D;  5KGU A;  4X66 L;  4WOR A;  3TZU A;  2DN8 A;  1JR0 D;  1Q3L A;  4DPG A;  1B50 A;  1YIJ A;  5T1I A;  3PUY A;  2HIV A;  3I4M B;  2O5J C;  1I4Q A;  4X3K A;  5LMN W;  2EYO A;  2QCP X;  4LWC A;  2ASB A;  3NHH A;  2F0N A;  4LF8 L;  2EJM A;  1B8A A;  1EOV A;  2IL8 A;  5H1S E;  4WJW A;  2ZXO A;  2A68 D;  1SJH D;  2B2W C;  1ZYR D;  3R2T A;  4EGV A;  5JEA H;  2ZXP A;  1SNO A;  2NWG A;  5D14 A;  5GAE C;  2MP1 A;  2RKS A;  4GLV B;  4DV4 Q;  3Q6S A;  2AQ1 B;  4CHT B;  2O4X A;  2KJX A;  1HQM C;  4F88 A;  2EDG A;  1F2L A;  4DR1 Q;  2KEN A;  3X3M A;  3S24 A;  1FGU A;  3J81 c;  2UXC L;  1XXG A;  1BF4 A;  2OCE A;  1EEI D;  2JE6 I;  3KLS A;  1I6V C;  3I4L A;  3TME A;  1JMC A;  3D8G A;  1E2W A;  3QG1 A;  2FFK B;  1X9N A;  3CRL C;  2CH4 W;  3PO3 B;  2J4X A;  1F77 A;  2E2H H;  4IPG A;  1EU4 A;  4KI0 A;  2E2D C;  3J7A 5;  1UE7 A;  4GKK L;  2MUY A;  3OIQ A;  2ZTE A;  2O2L D;  3AFP A;  2RDF A;  3X3N A;  4ZYS A;  4LFA Q;  3K5M A;  3W3A A;  3GTQ B;  1GKH A;  3S2D B;  5EJW A;  1PH2 A;  4DF7 A;  3NQI A;  5ELE A;  1KIX A;  3L9A X;  2B63 G;  2ICI A;  4A93 B;  3KF8 B;  1QVC A;  2TMP A;  2YV5 A;  4R4I A;  1SR3 A;  4DR4 L;  3K6O A;  1XJV A;  3PCO B;  3K81 C;  3QIA A;  3BZD B;  5IYD G;  1S40 A;  3LNN A;  2R93 G;  5IT9 c;  1KNE A;  1ZXT A;  4JYA Q;  4BBR G;  4DR7 Q;  1CA5 A;  4OO1 G;  2JA6 G;  4FO2 A;  1PFS A;  1BXT A;  1QWY A;  1TWG H;  3WWV A;  1EYG A;  2Z6K A;  1TY2 A;  5DNF A;  2WIN B;  2F3I A;  4KJO A;  3KFU A;  1EY6 A;  1SDF A;  4AYB G;  4X62 L;  3D6C A;  1LYL A;  1R4P B;  4POF A;  1VMP A;  1XX8 A;  1CM9 A;  4KHV A;  2YTX A;  3AYH B;  2M2L A;  3LX0 A;  5IIF A;  1XYI A;  4DXG A;  3Q0A A;  2K52 A;  5LL6 S;  5JJZ A;  3J7A F;  3BYT B;  3PIO A;  2JP1 A;  3K5O A;  1RCV D;  1II3 A;  1N32 Q;  3PO2 G;  2ALY B;  3FKI H;  4IUT A;  3TRZ A;  3UI2 A;  1CKO A;  1TXY A;  3EBE A;  2BE5 D;  3S1R H;  5G3L F;  4LFB Q;  3WOE A;  4WFN 3;  3RN2 A;  1CSQ A;  3CKI B;  2K75 A;  5I6Y A;  3S1Q B;  1WTX A;  4ZCK A;  5IWA L;  4C3I G;  1VQ6 A;  3PO3 H;  2FXQ A;  1ASZ A;  2PQA A;  4DR5 L;  2WFW A;  5COR A;  3K7A B;  4DR6 Q;  1STH A;  1DZ1 A;  1SSO A;  3I72 A;  4MHE A;  3HOV G;  2QDL A;  1Q8I A;  4L5R C;  1IBM L;  1VQH A;  4A3D B;  3KBX A;  3CCL A;  2K32 A;  1GXD C;  3GTQ H;  3J7A V;  1TII D;  2WKC A;  2WAQ B;  3Q22 A;  3H3V I;  1S5C D;  2N49 A;  3N52 A;  2UUC Q;  4M8A A;  1W6J A;  4K5W A;  1IZ6 A;  2SNS A;  4A93 H;  2B2V C;  1CHQ D;  5ELO A;  5C0X G;  4A3L G;  2VXW A;  2LFN A;  2CW0 D;  4NB3 A;  1JJC B;  2NVQ B;  4IUQ A;  3H3V H;  1JB3 A;  2XTI A;  1K8O A;  3VR5 A;  2D9U A;  1HHV A;  1E22 A;  3KJO A;  3L0O A;  1ICF B;  1HNZ L;  3TBI B;  5GAD C;  1JCK B;  1ICW A;  1GJX A;  1EQV A;  2F3V A;  3HEJ A;  5C3X A;  2KVM A;  5BR8 L;  2K14 A;  4JVZ A;  3GV6 A;  4QB4 A;  5CR3 A;  2EIF A;  3W1B A;  2LXK A;  1S3O A;  2DY7 A;  4YWL A;  4DR2 Q;  3S16 H;  1MI2 A;  1VQD A;  3T13 A;  1P8L A;  1UE6 A;  1V43 A;  2L4N A;  5ELD A;  2ES2 A;  1FGB D;  2EYF A;  2HDL A;  4KY7 A;  3NEM A;  4B3T L;  4TSS A;  4CJ1 B;  3DUZ A;  2R93 B;  5C4X B;  2B2T A;  1LTS D;  4F87 A;  5T1G A;  2Y0S E;  5M5W H;  4OX9 Q;  4JOI C;  1L1O B;  2JA5 G;  2IX1 A;  2M9V A;  4L63 B;  1BCP D;  3BZK A;  3OYY A;  1PXU A;  1P16 A;  1DJR D;  3K7A H;  5IP7 H;  4PQX A;  5LMU L;  3H3V C;  4O1N A;  2WP8 J;  1QZG A;  4AYB B;  2Q8I B;  3WDN A;  2PQA B;  4TKO B;  1EUJ A;  4A3D H;  1QOH A;  3A5Z B;  2L5T A;  1MSH A;  4UP7 A;  3SXH A;  3KOJ A;  4HIK A;  3CME A;  4JW0 A;  1FYC A;  4KMU C;  1VQO A;  3PO2 B;  3UDX A;  1H9R A;  1STY A;  4MIU A;  1WI5 A;  1I3Q B;  2VZA A;  4DUZ Q;  3I2Z A;  4LK1 C;  2D5D A;  3A55 A;  3NEN A;  5C4J B;  2NVQ H;  1K28 A;  2FJ2 A;  5C0X J;  3PUZ A;  3CPW A;  2F0I A;  1N9W A;  4DV7 Q;  1HH2 P;  4FF3 A;  5ISR A;  2K28 A;  2H5X A;  3CQZ B;  4JBW A;  3HOY B;  3KBG A;  1E2Z A;  4B3M L;  3Q24 A;  1NMF A;  1D1I A;  2NTS A;  5FKA C;  5C44 B;  4N8F A;  1SJE D;  2XRQ D;  2BDO A;  4FXD A;  1EQR A;  4GS3 A;  2NN6 I;  3SR1 A;  1ROD A;  2ZM6 Q;  5KNB A;  1BBW A;  3ITP A;  1G51 A;  3I91 A;  4A3G B;  4ZKB B;  4IOA A;  2F0O A;  5C4X H;  4GKJ L;  2XN9 C;  4DK1 A;  4QQB X;  4OL7 A;  3CCR A;  3HGB A;  3D0F A;  1SE4 A;  1ILP A;  2NN6 H;  3GTJ B;  2NZH A;  1JWS D;  3HOZ B;  1K3R A;  2D2C C;  1I94 Q;  3QJY A;  2HHH L;  1JOK A;  3JAM c;  5IT9 L;  2CWP A;  5LMN L;  1TWC H;  4IJL A;  5IOD A;  1YIT A;  1SBB B;  1S4Z A;  1D8L A;  2EXZ A;  4DV3 Q;  5IYB H;  5IGF A;  1DM0 B;  4RGN A;  3TN2 A;  1IXR A;  4B9W A;  4WJ4 A;  1X56 A;  1YBY A;  4EQ5 A;  4ZAI A;  1I3Q H;  2A68 C;  2BOS A;  1TR5 A;  1HFG A;  2HD3 A;  1D5X C;  4U67 3;  1ZYR C;  5E4X A;  4IPC A;  2PZT A;  1YHA A;  4NXM Q;  1XNQ Q;  1TS3 A;  3EQL C;  2Z0S A;  4C3J G;  2JA5 B;  1WYD A;  3S17 B;  1G29 1;  4JPB W;  3I4N G;  1EIF A;  2RF4 A;  4JG2 A;  4BA2 I;  1AW7 A;  1WCM G;  5AJ3 L;  1XWE A;  1M4V A;  5JPM C;  1SFO B;  4LFC Q;  2KUM A;  3CQZ H;  4ME5 A;  1N8R C;  3HOY H;  2UU9 Q;  2B2W A;  4XXE A;  1HZB A;  1PZK D;  2GN5 A;  1G8Z D;  3E9I A;  3QO2 A;  4XDX A;  5C44 H;  1DOK A;  4BS9 A;  2VUM B;  4DNR B;  5GQO A;  1WTO A;  3R93 A;  1G6Z A;  3D3R A;  4LF5 L;  1SNM A;  3SGI A;  4U68 A;  1BOS A;  2EE1 A;  1AZQ A;  2FMM A;  1AZP A;  4HIM A;  3KJP A;  1KDA A;  3MAQ A;  4BBS B;  2E8G A;  4A3G H;  2JA8 B;  3CXC A;  1ET9 A;  3GD7 A;  4JCV E;  3FDT A;  4JI0 L;  1A8V A;  2KA7 A;  2DNC A;  1VQ8 A;  1GVP A;  1M1K C;  4TVA B;  1GHJ A;  3NK9 A;  4UP8 A;  4ME3 A;  1EQT A;  1VQI A;  3HOZ H;  2DGY A;  1KL9 A;  1R9T H;  2F0F A;  1DD2 A;  3B6Y A;  5FJ8 H;  1UNS A;  1BCP B;  5HY6 A;  3C1E A;  1CK1 A;  1DYQ A;  1O7Z A;  2K5V A;  4GNX A;  1YJN A;  2Y0S G;  2C9O A;  2R7D A;  1AP0 A;  2NVX B;  1LUZ A;  4J6H A;  1OXU A;  1CT1 D;  3ER0 A;  2F0H A;  1IW7 D;  2UXB L;  2LMC B;  2JN4 A;  1XMQ Q;  3MXN A;  2J7Z A;  1FL0 A;  1PYS B;  2XSC A;  4DK3 C;  4R8I A;  1N34 Q;  1B2T A;  1E1T A;  4CKC A;  4EQP A;  5I2X A;  4K0K Q;  1DXM A;  4XT1 B;  1JWU D;  1KLG D;  4K2K A;  1PV4 A;  3VR3 A;  4G7O C;  5FO7 B;  5FK9 C;  3DM1 A;  2EJG C;  1BVS A;  4JI2 Q;  3EVQ A;  1K0S A;  1SFO H;  4IUU A;  3P75 A;  3K80 C;  2EYL A;  1ONL A;  2A6E C;  2HCC A;  4X66 Q;  2IHF A;  2IPK D;  3I4M G;  1YZ6 A;  3EJI A;  1D5Z C;  3S2H B;  3FMC A;  2VUM H;  1NJI C;  1QG7 A;  3K59 A;  1YNN D;  2JA7 B;  3MVV A;  1B70 B;  5IGC A;  1MIU A;  1LTB D;  3S9W A;  4LF8 Q;  1JT8 A;  2L1B A;  2EPB A;  4IQZ A;  4B9X A;  1EU3 A;  5KRU A;  4BBS H;  1B53 A;  3S1M B;  2JA8 H;  3J81 i;  2PI2 A;  2Z4I A;  3URY A;  5ELF A;  2CQA A;  2NB0 A;  2QDB A;  3I56 A;  2HUG A;  1ILQ A;  1SYD A;  2F0L A;  2PYK A;  3DLL A;  2D0O A;  5JEA J;  3FKI G;  3RUZ A;  1B1Z A;  4LF4 L;  3SK5 A;  2UXC Q;  2UXD L;  3H6M A;  3I4O A;  1E1O A;  3TP7 A;  3CCJ A;  2CW0 C;  3M3Y B;  3CU7 A;  4RAU C;  2KCN A;  4RMF A;  3PO3 G;  2RCN A;  2MPM A;  1K8G A;  4K6D A;  4IJH A;  4RHS A;  2QKI C;  1BBX C;  4OEL B;  4GNX B;  4JBM A;  3TRE A;  2B2V A;  3UDI A;  4LF7 L;  3JC6 6;  1DON A;  3P20 A;  2YU9 B;  1TKW B;  2I5L X;  3M4Q A;  4K8I A;  4GKK Q;  4GOP B;  1IL2 A;  2RA4 A;  2N78 A;  3STB C;  2KCT A;  1EL0 A;  1LAB A;  3MXN B;  1KDC A;  1WTR A;  4OON A;  2C35 B;  1D6E C;  4A93 G;  4HMJ A;  1O7I A;  2XWJ B;  1CZW A;  5L37 A;  3HKZ E;  5IGD A;  3BU2 A;  3SK8 A;  1NR4 A;  1GHK A;  1M90 C;  1X32 A;  5IGG A;  2K05 A;  3S2H H;  2IWH A;  3GTO B;  2Y0S B;  2E2H B;  3IL8 A;  1QJO A;  2L11 A;  1BCP C;  3K5L A;  3QOL A;  1FJG L;  4HIO A;  3CCE A;  1IBL L;  4X65 L;  2R61 A;  3A56 A;  4LF6 L;  2F0U A;  1U4R A;  1PTO F;  5ELC A;  4X62 Q;  1K8M A;  3HZX A;  3CCU A;  1D7Q A;  3S1M H;  2JEA I;  4OIJ A;  3J80 c;  3KF8 A;  5IGE A;  3MFY A;  4OGQ C;  4JOI A;  1QNU A;  2OWO A;  1Y8P B;  3UDF A;  4R4T A;  2F03 A;  4R9W A;  2Z1C A;  1X55 A;  1JOO A;  3KDF B;  1E3P A;  4IUN A;  4KD4 A;  5E7N A;  2AWN A;  3U4V A;  1U9R A;  3M3Y H;  4HN7 A;  5HGQ A;  3CCV A;  3HOX B;  1GUG A;  4HJ8 A;  4GN4 B;  1LT6 D;  4GN5 A;  4FXG C;  1TWG B;  1SNP A;  3NPP A;  5IP7 G;  4J8Q A;  5C4H A;  2SNM A;  4DV5 Q;  1EWI A;  1J9O A;  5EAY A;  4ZUJ A;  4P73 A;  1S5D D;  2K33 A;  3A54 A;  2YU9 H;  1OXX K;  2MO0 A;  1D5M C;  5EBC A;  4A3D G;  1KAB A;  1Q12 A;  2I07 B;  4IN3 A;  3W1G A;  2WAQ G;  2BH2 A;  5KND A;  3M7N A;  2RHQ B;  1PFN A;  1J6Q A;  1RTO A;  4CJ0 B;  1PMR A;  5DM6 3;  1LTL A;  2R7F A;  1JJ2 A;  2R7Z H;  1HPC A;  1R4Q B;  1VQN A;  3FKI B;  1Y14 B;  3S1R B;  5IT9 E;  3F2B A;  3DXJ C;  4KHZ A;  2F52 A;  3NBH B;  2XVS A;  1Y1V H;  1WTP A;  5EKK A;  2F4I A;  3GTO H;  4UHV A;  2QEJ C;  1NE3 A;  2PW5 A;  2E5L L;  3NXW A;  4DAP A;  1Q86 C;  1NBW A;  3MC0 B;  1XTD A;  1HNZ Q;  1EWC A;  2SDF A;  3F1Z A;  4QIW E;  4V0B A;  4GNX C;  3IAY A;  4KHP L;  3DWP A;  4BY7 B;  3TP6 A;  3EA6 A;  1NR2 A;  4R1J A;  4DAY B;  2DNE A;  5BR8 Q;  4GOP C;  3TS0 A;  1I4G A;  5FLM H;  2K7V A;  1HNW Q;  2EYJ A;  2WKD A;  3O13 A;  3A8K E;  4ZLT F;  2PZW A;  5C4X G;  2GVB A;  5C5M A;  4JBK A;  2K5W A;  4B3T Q;  3HOX H;  1Q46 A;  3D31 A;  4FNF A;  3CRK C;  1UEA B;  2VS1 A;  5CV9 A;  2PMZ E;  2JK8 A;  3A74 A;  4F8M A;  1SRO A;  1N36 L;  2NN6 G;  5D3I B;  4EQO A;  5A35 A;  1VQ4 A;  1EY4 A;  5LL6 X;  1ENA A;  1H9S B;  1LV9 A;  1FNW A;  1A3U A;  3H0G B;  3OTO L;  4NDX A;  5LMU Q;  2WV6 D;  1VS0 A;  1L0X B;  1OO9 B;  1SMX A;  3RD4 A;  1Q1B A;  4A3C H;  2ENB A;  2K50 A;  4IZ8 A;  5IYB G;  1MGS A;  5E3F A;  5CV7 A;  1OXT A;  4DK0 A;  3S16 B;  1AEX A;  4HAE A;  1A6X A;  1Q81 C;  1B7Y B;  2F0P A;  1LTI D;  4JI1 L;  1Y8O B;  2UUA L;  1L1O A;  2A6E D;  2L55 A;  2WB1 E;  1KAW A;  2F4V L;  4CKB A;  3AFQ A;  3S15 B;  4Q0F A;  5M5W B;  2RHS B;  3K5N A;  4DV6 Q;  4YY3 L;  1QB5 D;  1VDZ A;  3E0J A;  4I65 A;  2K04 A;  4X64 L;  4DUY L;  2AMC B;  1G6P A;  1JOR A;  2B39 A;  2X6L A;  2EQS A;  4LUZ A;  4ALP A;  1K3B C;  2CQO A;  1PH6 A;  5I6W A;  4ZK9 B;  1HTP A;  4XIG S;  3HOY G;  2PQE A;  4WRD A;  4BY7 H;  3IKJ A;  1Y69 U;  5C44 G;  1U0L A;  2KEC A;  2XWB B;  5DLQ E;  4DR3 L;  4P71 A;  4B3M Q;  1Y1W B;  3VR6 A;  4BWG B;  4LF9 L;  4OWW B;  4JI3 Q;  1EY7 A;  1DOL A;  4DXF A;  3CF5 A;  2B29 A;  4APV A;  3A8I E;  4X3S A;  3H94 A;  1X3Q A;  3G6E A;  5C4Z A;  5M3M B;  4MTN A;  4KY6 A;  4RCO A;  2VQE L;  1GUN A;  2MGS A;  2HDM A;  3RMH A;  1IW7 C;  4A3G G;  2L12 A;  4DV0 L;  5ELB A;  5FO8 B;  1GD7 A;  4GKJ Q;  2PO4 A;  2G5D A;  5E4W C;  4PG3 A;  5M9O A;  4RGT A;  4DR1 L;  3ULJ A;  4QUF A;  3JAM i;  4ULL A;  3HOZ G;  3U4Z A;  1IBK L;  1LTR D;  1N33 L;  3H0G H;  5FJ8 G;  2RSN A;  1PRT F;  3STB D;  1VQK A;  1VQ7 A;  3MXP A;  4A76 A;  3V05 A;  3HOU H;  3NUC A;  1EIH A;  3OHX C;  4XT3 B;  2H1E A;  5LMN Q;  5KEE A;  4R8N A;  3A7L A;  2QF7 A;  4BA1 I;  1YNN C;  4CDF C;  1IL8 A;  4L8J A;  3L2P A;  1HR0 Q;  1SE2 A;  3RLF A;  1F9R A;  5EPL A;  5LHY 1;  3GDE A;  4KN7 C;  3J80 L;  2AKW B;  4XYO A;  3S15 H;  4ABN A;  2CHB D;  1V1Q A;  5G3L D;  1I5F A;  1L0W A;  1EIY B;  1SYB A;  1XMO L;  3J7Y W;  1VQB A;  2BDN A;  1A0I A;  2TSS A;  5I2Y A;  2FMC A;  3D4W A;  2DY8 A;  5C3E H;  3A5U A;  4PMB A;  3NTH A;  4N8X 1;  5AJ3 Q;  4DU9 A;  1E0B A;  1ZEQ X;  5CV6 A;  4G7H C;  2CVR A;  4G57 A;  1TWC B;  1Y8N B;  2VUM G;  1Q8K A;  4CKE A;  3MA2 B;  1Y1W H;  1M8A A;  1SYG A;  1KQS A;  4TQU S;  4H44 C;  1C7Y A;  2I5M X;  1SNQ A;  1U4P A;  3F8T A;  1PYB A;  1IYJ B;  1SN8 A;  5M3M H;  4FYD A;  3PUX A;  4C56 C;  4HID A;  3QB3 A;  4BBS G;  3T16 A;  4L5T A;  2JA8 G;  4JI7 L;  1HUN A;  1EY9 A;  2K03 A;  2N3S A;  1EWH A;  2EYP A;  3QOJ A;  4P75 A;  1HNX L;  5CV5 A;  4J15 A;  2XRS D;  4BY1 B;  3T56 B;  4JI0 Q;  2Q2I A;  1VQP A;  4LAA A;  4ZRZ A;  3C46 A;  2MFI A;  3HKZ B;  3JAM E;  2PPB C;  5ELN A;  1MSG A;  2F0E A;  1PH9 A;  2V4D A;  5HGT A;  2N55 A;  3U50 C;  1LT3 D;  1BNZ A;  1BQQ T;  5JJK A;  1KXL A;  4DR6 L;  3M85 A;  4A4I A;  3HS0 C;  3V96 A;  1HUM A;  3AU7 A;  3MEH A;  5CV4 A;  5IOC A;  3CAM A;  2EXD A;  4JI8 Q;  2E74 C;  1AE2 A;  1VCI A;  4IAL A;  2UXB Q;  3OWF A;  3GTM B;  4EVO A;  1ZKO A;  2E75 C;  2KEE A;  1WTV A;  5K36 H;  3DMU A;  2Q8T A;  2PNH A;  3CC2 A;  4LW1 A;  4DAM A;  1R9T B;  4OEM B;  4NXN L;  5JPN C;  2UUB Q;  1LTA D;  2JA9 A;  4P74 A;  3NE5 B;  4H0L C;  1UAP A;  1PH3 A;  1QUQ A;  4L6T B;  1VQF A;  1EY0 A;  1LTT D;  1V8Q A;  2GVA A;  2PNR C;  4P72 A;  1SE8 A;  4BBR H;  4N9T A;  2JA7 G;  1WVL A;  4A75 A;  1VQC A;  4B3S Q;  5GAH C;  2X69 A;  3MEF A;  2ZJR A;  3C1F A;  3BZC A;  2BA0 A;  1PTO H;  2IJ0 A;  2R3Z A;  4A3I B;  5FLX c;  1G2T A;  4IUP A;  3T1H L;  2VY3 A;  4RH6 A;  1C0A A;  2QEX A;  1EFW A;  3MFG A;  4AIM A;  1XPO A;  4BY1 H;  2LY7 A;  3NQT A;  4PV1 C;  3T53 B;  1AE3 A;  5COY A;  1B4O A;  2NZO A;  4FF2 A;  2NVY H;  3F2C A;  1YNJ D;  1IHZ A;  1L1O C;  1AFP A;  1WOC A;  3UE1 A;  4PNY A;  2E2J H;  3BVZ A;  3R3O A;  4LF4 Q;  4TRD A;  2UXD Q;  5EPJ A;  1CQV A;  3CCS A;  5CBA E;  3L7Z C;  1WFQ A;  1CKN B;  2CCZ A;  4PZ8 A;  1PH5 A;  3NWT A;  2MO1 A;  5JEA G;  4LF7 Q;  3GP7 A;  2PW7 A;  4UPA A;  4B08 A;  2QW7 A;  4JI5 Q;  1MJE A;  3DM3 A;  3GTM H;  4QIW B;  1JOQ A;  3L3O C;  3VYU A;  2KCC A;  1KC8 C;  1B9N A;  2QGQ A;  4CGY B;  5J22 A;  4K5X A;  5I9P A;  2R7Z G;  3FEW X;  1B9M A;  2RDG A;  4DUZ L;  3NWS A;  4NW2 A;  4JV5 Q;  4M1U B;  1Y1V G;  4G4K A;  2VNU D;  5C6A A;  1PFM A;  2Q2T A;  2OTL A;  1VMC A;  4RA8 A;  1QUQ B;  1RIP A;  2YTY A;  3PUV A;  2Z8L A;  2JXM B;  1IKM A;  2PMZ B;  3RNU A;  4GOP A;  4AH6 A;  3NTI A;  1EY8 A;  1T9H A;  1FJG Q;  1HFN A;  2VQF Q;  4Y52 H;  5DM7 3;  1EYC A;  1NCV A;  1B44 D;  4X65 Q;  2OT2 A;  3RN5 A;  5CBE E;  3ULP A;  4A3I H;  4LF6 Q;  3BG3 A;  5CYU A;  4DKA C;  2C5C A;  1BO0 A;  4RWS C;  1C48 A;  1HXY D;  4HCS A;  4B3R Q;  4NKL A;  2KOL A;  4POG A;  1U4M A;  3E0E A;  1H9J A;  3HKS A;  4PMC A;  4DV2 L;  2R92 B;  5FO9 B;  4QJF A;  1F9P A;  5CV8 A;  5M5Y B;  2DUD A;  2NYZ D;  3HOX G;  4GZY C;  5EGT A;  2E2I B;  2NZ1 D;  4PZ6 A;  4Q5V A;  2WB1 B;  1EYA A;  1T5E A;  1JC7 A;  3CCQ A;  1B3A A;  3VR4 A;  1Q90 A;  3K58 A;  1I94 L;  1O7Y A;  2K4K A;  4KY5 A;  4XYQ A;  2OF1 A;  5FOB B;  2CKZ B;  2KHJ A;  4EQN A;  3RLN A;  4ILW A;  4ZQ3 A;  1YJ9 A;  1F2Y A;  3HOW B;  4XQN A;  2N8N A;  4G7Z C;  1PRT B;  1EY5 A;  1QZH A;  4IUR A;  1LTG D;  3SEB A;  4DV3 L;  4H7B A;  1YI2 A;  4A3C G;  1CKM A;  2L9H A;  4QCL A;  1I6H H;  1BBU A;  1J5E L;  2FHT A;  4HED A;  1GO3 E;  3KDF A;  3BVG A;  5C3W A;  3I70 A;  4FF4 A;  4NPS A;  4O2D A;  4HTH A;  1SYF A;  2GA4 B;  1YJW A;  3D4R A;  3T51 B;  4OXP A;  1BDO A;  2F0M A;  4YCU A;  3A8J E;  3OW7 A;  1YHB A;  4C2M B;  2WAC A;  4NXM L;  1E2V A;  5DAU A;  3HP3 A;  2PZU A;  4C1N K;  1QVG A;  1EIG A;  4DK6 C;  1VQG A;  3Q8D A;  3E3X A;  3MXU A;  3U9S A;  4DV1 L;  1OTC A;  4BXX H;  1A2U A;  2UU9 L;  1H9K A;  1CQF A;  3M4O B;  3K57 A;  3AQQ A;  4BY7 G;  4CDC C;  3J80 E;  3HG9 A;  1E7Z A;  2IX3 A;  1RDP D;  2AQ3 B;  1SAP A;  1SLJ A;  4LUV A;  3KYH C;  4KHP Q;  3LGJ A;  1A63 A;  1SYC A;  2Z9H A;  1DGS A;  1EZ6 A;  3NBH A;  2R7Z B;  4RKB A;  4XQJ A;  4A3M B;  2R92 H;  1CTM A;  4S3S A;  4C3H H;  4DR4 Q;  1VQA A;  1V1P B;  5M5Y H;  2O5I C;  3IRB A;  5IP9 H;  2E2I H;  4DA2 A;  1Y1V B;  3H09 A;  3DWA A;  3ERO A;  1FVI A;  2XIW A;  1PH7 A;  5EKL A;  1VF7 A;  1MKH A;  1N36 Q;  1K83 B;  1HRJ A;  3H0G G;  3ND8 A;  2Q2U A;  4DAY A;  2OQK A;  3HOW H;  4R4C A;  3HOU G;  3OTO Q;  4YHH L;  4ZKC B;  3G4S A;  3M4Y A;  2ZXR A;  3PIP 3;  3MXG A;  1YEZ A;  2P5Z X;  5AFW A;  3IFD A;  3SDZ A;  3KLW A;  1V1O A;  1X65 A;  5A2Q L;  3QWN A;  4LUO A;  3GTP H;  3C2P A;  2EY6 A;  1XPR A;  1LO5 D;  4C2M H;  5FLX L;  3ZJY C;  5CGK A;  1U4L A;  2YYZ A;  3FPU B;  4A3B B;  1PHJ A;  2ZJQ A;  5IWA Q;  1H9S A;  1PVO A;  5IGB A;  2EYM A;  1TS5 A;  2Z6B A;  4YY3 Q;  4X64 Q;  4DUY Q;  1S5E D;  1CHP D;  1HJP A;  2MHV A;  1SXT A;  1VQM A;  5C3E G;  3FRP B;  4DR5 Q;  4XQQ A;  3M4O H;  1WCM H;  5DEH A;  4A3F B;  1OXS C;  3DWQ A;  4A3E B;  2M00 A;  2K1B A;  3AMU A;  3CP0 A;  1A15 A;  2KED A;  1Y1W G;  1IBM Q;  1UUP A;  3PMF A;  3S14 B;  1TVX A;  2I5H A;  2B3G A;  3ONA B;  1HZA A;  2KCM A;  3P7J A;  1T5X D;  1YHQ A;  1VQ5 A;  4JI4 L;  2DJG C;  4DR3 Q;  1PRT C;  4LF9 Q;  5M3M G;  1JQY D;  3GV3 A;  4X6A H;  2E76 C;  4A3M H;  3F2U A;  1HR0 W;  4JI6 L;  2VQE Q;  1FR3 A;  3E6Z X;  3W5O A;  3RLO A;  1K9M C;  2VW9 A;  3G6J B;  2IT1 A;  3T1Y L;  1VQL A;  4DV0 Q;  1OXV A;  5K5P A;  1W2B A;  3IFT A;  1K0R A;  2HQL A;  2RCF A;  3FVQ A;  3RZD H;  2JJQ A;  3CMA A;  4A3K H;  1I4P A;  3F2D A;  2K5H A;  1K83 H;  2JSO A;  1STG A;  2KHS A;  4IFD J;  4AQY L;  1UEB A;  1W3S A;  1IBK Q;  1PH8 A;  4HSV A;  1HQR D;  1N33 Q;  1TWF B;  4HMI A;  5EKI A;  4RFB A;  1ASY A;  1EYD A;  1LM0 A;  4OHJ A;  1PTO D;  1SMY C;  4NMZ A;  4MZ9 A;  2LSS A;  2IY5 B;  4R4O A;  1QCB D;  1RL2 A;  1C9O A;  2I0Q A;  3GTG H;  2MQH A;  1KTK A;  3KLS X;  2BH8 A;  2A69 D;  1G2S A;  4IPD A;  5NUC A;  3ICE A;  1RKN A;  1PFB A;  5JAV A;  3KF6 B;  1RD9 D;  1VF5 C;  5K36 G;  2B2Y A;  2B2U C;  4KKS A;  3R2I A;  3R8B A;  2VL6 A;  3BDO A;  5KNC A;  2EVB A;  4A3B H;  5JJL A;  4K8J A;  3RZO B;  3BVM A;  5M5X B;  1KNA A;  4QL5 A;  2A8V A;  2NVT H;  4Z9C B;  1KAA A;  4JK1 C;  3UDG A;  1ENF A;  3J7Z C;  3BJU A;  1XMO Q;  4CDD C;  5E1F A;  1YNJ C;  2F0K A;  2OEO A;  3MHB A;  4A3F H;  4A3E H;  4LNQ A;  4CBV A;  4LMQ D;  4K5V A;  5GAG C;  1XNR L;  3HOU B;  1A62 A;  1X3P A;  3S14 H;  3I4M H;  3LWE A;  1SEB D;  1LLR D;  5M3F B;  3I55 A;  3N6R A;  3TEH B;  3MTS A;  1PDQ A;  2IHE A;  2NUC A;  5KYL A;  1QNK A;  5I9O A;  4KD3 A;  1DCZ A;  1Z47 A;  3EN2 A;  4A3J B;  1EEF D;  3KUP A;  2QIL A;  4JI7 Q;  4BY1 G;  3TP5 A;  1L0Y B;  5CMD A;  1HNX Q;  2H4O A;  1MJC A;  1K73 C;  1C4Q A;  2V1C C;  1X3G A;  2AHO B;  3EIV A;  3HKZ G;  1AN8 A;  2F0T A;  3G71 A;  2VB2 X;  4EX5 A;  5C3E B;  1EOT A;  4I7A A;  1TWF H;  4L5S A;  1BCP F;  1YVC A;  4RKL A;  5J39 A;  3I73 A;  1D2B A;  2WII B;  1MD2 D;  4IFD I;  4IOC A;  1QVF A;  2ZT9 C;  1TU2 B;  4DV5 L;  1GUS A;  2D0P A;  2JYO A;  3AEV A;  2A6H D;  3OWE B;  1O7L A;  1NY4 A;  1DOM A;  3T4A C;  2F3W A;  5EPK A;  2K01 A;  4C1N I;  1PLF A;  2Z4H A;  2SOB A;  2AWO A;  1PYW D;  4O42 A;  2EYH A;  4DV4 L;  4IFD H;  1IYU A;  1O78 A;  1L2F A;  1RF2 D;  3S2D H;  2F0D A;  3BDC A;  3RZO H;  4RGM A;  1HTL D;  5M5X H;  5IE8 A;  2KQ3 A;  1XPU A;  1GUO A;  4RG1 A;  4X3U A;  1KHI A;  3PF4 A;  4IPH A;  4NXN Q;  4YIJ A;  1EZ8 A;  2HHH Q;  3E5S A;  2A73 B;  4KN4 C;  1CFM A;  1I4R A;  3BS1 A;  1Z9F A;  1CA6 A;  1X6O A;  5M3F H;  1QIL A;  3BYY B;  1HZ9 A;  3VYS A;  2F0Q A;  4A3I G;  4LFA L;  1JIC A;  2RBM A;  4HJ9 A;  4A3J H;  1W6K A;  3D6W A;  3S1N B;  2F0J A;  5IYC H;  1WD0 A;  3T1H Q;  2K6A A;  4N9P A;  1HCZ A;  5BN4 A;  1HNW L;  2NTT A;  4QMG A;  4YCW A;  1A3T A;  2B63 B;  4DFA A;  2I46 A;  5TSS A;  3P1H A;  4JYA L;  4DR7 L;  1PH1 A;  3S1Q H;  1VQE A;  1HA5 A;  3W2D A;  1WTW A;  4BBR B;  1NSN S;  3DHQ A;  2JA6 B;  3NEL A;  4H02 A;  5D65 A;  1A2T A;  3DEO A;  5CC4 A;  3NSW A;  1S5F D;  4CDE C;  4RCN A;  4LF5 Q;  1E24 A;  4H13 C;  4R4Q A;  1LT4 D;  1Z6H A;  1PTO B;  5BN5 A;  2RVL A;  1EQQ A;  3RR5 A;  1UE5 A;  5HUR A;  3CC7 A;  2PI2 E;  1X3E A;  4KLK A;  1N32 L;  2G9D A;  4KKU A;  5KYI A;  4UAI A;  4FF1 A;  2NVY B;  5D3D A;  3OSO A;  5IY0 A;  3SVM A;  1K8A C;  3CC4 A;  2EJF C;  4LFB L;  2E2J B;  3MWY W;  1I50 B;  2EZV A;  3C3L A;  3HRZ C;  2L0C A;  4QGU A;  1CKN A;  1RHP A;  5EQ0 A;  1KRS A;  4DV6 L;  1CI3 M;  1PRT D;  4DN4 M;  5A2Q E;  4C3I B;  1G91 A;  2A1A A;  5JOB A;  1TS4 A;  4BXX G;  2A74 C;  2K5N A;  3J81 L;  3CD6 A;  3HFZ B;  5FLX E;  3ERS X;  1H9M A;  3HOV B;  3TQY A;  3M9B A;  3PUW A;  3PV0 A;  3S1N H;  4JI3 L;  4OWX B;  2UUC L;  1X54 A;  1ENC A;  1MBY A;  2HIX A;  2ZTD A;  1STB A;  4OO1 I;  1FD7 D;  1A3V A;  2RDH A;  3TSS A;  3KK7 A;  2B63 H;  2R92 G;  4C3H G;  3PIO 3;  4I7Z C;  2CH4 A;  4DV2 Q;  1F2M A;  5IYD H;  2HQE A;  5IP9 G;  2R93 H;  2WB1 G;  2B2Y C;  1KD1 C;  1SMY D;  4OO1 H;  2F1M A;  2Q2H A;  2JA6 H;  3PGZ A;  3GTL B;  2ICE C;  4J1M A;  2MJ8 A;  1STA A;  3M4P A;  1S72 A;  5JJI A;  3TDQ A;  3VR2 A;  4HJ5 A;  3HOW G;  2IW3 A;  1NNX A;  3K0X A;  1I4X A;  1UE1 A;  3SE0 A;  2CFM A;  4K14 A;  1J8I A;  1NUC A;  2LS0 1;  3TP8 A;  3NP8 A;  3U58 A;  3K0Y A;  1NMG A;  4DR2 L;  4P2C B;  4QF4 A;  2L15 A;  3M7G A;  2Z6K C;  4L5Q A;  1J5E Q;  1F9S A;  1HR0 L;  1I4H A;  4WJ3 M;  3OPO A;  1LAC A;  3PO2 H;  2LXJ A;  1I50 H;  2N88 A;  3VA5 A;  3OW2 A;  4OX9 L;  5C4J H;  1EFI D;  1X3F A;  4C3I H;  4IO9 A;  1YNX A;  2IX0 A;  3CW2 C;  2AUJ D;  3SK6 A;  1BKB A;  2YTV A;  4UDU C;  4DV1 Q;  5C0X I;  3V2T A;  3PIP A;  3AB9 A;  3HOV H;  3I7F A;  1TS2 A;  3FP9 A;  4V19 0;  1KRT A;  3GTK B;  4F7X A;  1B3Q A;  1I6H B;  2OTJ A;  1VQJ A;  3MZ5 A;  1PTO C;  5F2D A;  1U5K A;  4A3M G;  1CUK A;  2HCI A;  3CHB D;  2XNA C;  5C0X H;  4A3L H;  4HJA A;  1FNU A;  4ID6 A;  1Q82 C;  2A69 C;  3G7L A;  4K6L A;  3DEP A;  1TWA B;  4DGZ A;  2VB3 X;  1KLU D;  2B8F A;  3ULL A;  1NTG A;  1TWH B;  3NTK A;  4PZ7 A;  4DV7 L;  4A3K G;  3GTL H;  1QE6 A;  3UE0 A;  1PH4 A;  2BCO A;  3G48 A;  3J80 i;  3OIP A;  3GTJ H;  3VYR A; 
#chains in the Genus database with same CATH homology
 2D62 A;  4OIK A;  4KV6 A;  1JWM D;  2AUK A;  1PZJ D;  2X6G A;  1O80 A;  2LKV A;  1TT2 A;  2F0V A;  3I8Z A;  5J1Z A;  3OMG A;  3A7A B;  4RGO S;  2B2U A;  1HA6 A;  1ET6 A;  3SK4 A;  4IUV A;  1V1P A;  3SHL A;  4X3T A;  4HCE A;  3OMC A;  4C3H B;  1KDB A;  4ODG A;  2NBF A;  4QUC A;  4MN3 A;  4FVM A;  4KK7 A;  1D1K A;  1ESR A;  1RTN A;  1IKL A;  4RHR A;  2F0W A;  1STN A;  3I90 A;  1JE4 A;  3KLR A;  2SEB D;  3ND9 A;  2R6G A;  4KJN A;  1STE A;  2PCF B;  2F0G A;  3ERQ A;  2BE5 C;  2B2T C;  2RSO A;  3TZD A;  4NP5 A;  1S5B D;  2EOT A;  4HR7 B;  1BR9 A;  4FP5 D;  2OXP A;  3GQB A;  4DNT B;  3OOC A;  4KKT A;  3VYT A;  5C5L A;  2A6H C;  3GTP B;  2EY1 A;  4ZUI A;  4XTC S;  1F9Q A;  1GUW A;  2AQ2 B;  2K5Q A;  2FIN B;  1XTC D;  1GUT A;  2ID0 A;  3LWU A;  1RJT A;  5BN3 A;  1NAP A;  4C3J B;  1TY0 A;  2RQX A;  3WOF A;  1WTQ A;  4HSP A;  4LJZ C;  3I4N B;  4Y7N B;  1SNC A;  3H91 A;  1WCM B;  1SND A;  5JVH 3;  2J0T D;  3BDL A;  5EBD A;  2Q8R E;  2G9H D;  1GOZ A;  1ML0 D;  1ESF A;  1PZI D;  2JEB I;  3NBI A;  5KIX A;  4IFD G;  3I3C A;  1FNV A;  5JVG 3;  3RZD B;  4A3K B;  2BA1 A;  4KTA A;  1SYE A;  3EFX D;  1F2Z A;  1WD1 A;  2A5H A;  1Z7T A;  2F0S A;  1TQO A;  1BUV T;  1SE3 A;  5I4D A;  1IYV A;  2EY5 A;  3GO5 A;  4PMW A;  1Q1E A;  4FXK C;  3GTG B;  3ZYY X;  4DAV A;  4E6I A;  3JAM L;  4K2L A;  2EY2 A;  3Q23 A;  2B8G A;  1C8C A;  3D4D A;  1CZG A;  2K5D A;  3VA7 A;  3J81 E;  3FPP A;  2NVT B;  4CJ2 C;  3U9O A;  1LT5 D;  5KGU A;  4WOR A;  3TZU A;  2DN8 A;  1JR0 D;  1Q3L A;  1B50 A;  5T1I A;  3PUY A;  3I4M B;  2O5J C;  1I4Q A;  4X3K A;  2EYO A;  2QCP X;  3NHH A;  2F0N A;  2EJM A;  2IL8 A;  4WJW A;  2ZXO A;  2A68 D;  1SJH D;  2B2W C;  1ZYR D;  3R2T A;  4EGV A;  5JEA H;  2ZXP A;  1SNO A;  2NWG A;  5D14 A;  2MP1 A;  2RKS A;  3Q6S A;  2AQ1 B;  4CHT B;  2O4X A;  2KJX A;  1HQM C;  4F88 A;  2EDG A;  1F2L A;  3X3M A;  1XXG A;  1BF4 A;  1EEI D;  2JE6 I;  3KLS A;  1I6V C;  3I4L A;  3TME A;  3D8G A;  1E2W A;  3QG1 A;  2FFK B;  3CRL C;  3PO3 B;  2J4X A;  1F77 A;  1EU4 A;  4KI0 A;  2E2D C;  2MUY A;  3OIQ A;  2O2L D;  2RDF A;  3X3N A;  4ZYS A;  3K5M A;  3W3A A;  3GTQ B;  3S2D B;  5EJW A;  4DF7 A;  3NQI A;  5ELE A;  3L9A X;  2ICI A;  4A93 B;  2TMP A;  3K6O A;  3QIA A;  3BZD B;  3LNN A;  1KNE A;  1ZXT A;  1CA5 A;  4OO1 G;  4FO2 A;  1BXT A;  1QWY A;  1TY2 A;  5DNF A;  2WIN B;  4KJO A;  1EY6 A;  1SDF A;  3D6C A;  1R4P B;  1VMP A;  1XX8 A;  1CM9 A;  4KHV A;  3LX0 A;  2M2L A;  5IIF A;  1XYI A;  4DXG A;  3Q0A A;  5JJZ A;  5LL6 S;  3J7A F;  3BYT B;  2JP1 A;  3K5O A;  1RCV D;  1II3 A;  4IUT A;  3UI2 A;  2BE5 D;  5G3L F;  3WOE A;  4WFN 3;  3S1Q B;  3CKI B;  5I6Y A;  1WTX A;  4C3I G;  5COR A;  3K7A B;  1STH A;  1DZ1 A;  1SSO A;  3I72 A;  4MHE A;  1Q8I A;  4A3D B;  3KBX A;  2K32 A;  1GXD C;  3J7A V;  1TII D;  2WKC A;  2WAQ B;  3Q22 A;  1S5C D;  3N52 A;  4M8A A;  1W6J A;  4K5W A;  2SNS A;  2B2V C;  1CHQ D;  5C0X G;  2VXW A;  2LFN A;  2CW0 D;  2NVQ B;  4IUQ A;  1JB3 A;  1K8O A;  3VR5 A;  2D9U A;  1HHV A;  3TBI B;  1JCK B;  1ICW A;  1GJX A;  1EQV A;  2F3V A;  3HEJ A;  5C3X A;  2KVM A;  3GV6 A;  4QB4 A;  5CR3 A;  2DY7 A;  1MI2 A;  3T13 A;  1V43 A;  2L4N A;  5ELD A;  1FGB D;  2EYF A;  2HDL A;  4KY7 A;  4TSS A;  4CJ1 B;  3DUZ A;  2R93 B;  5C4X B;  2B2T A;  1LTS D;  4F87 A;  5T1G A;  2IX1 A;  2M9V A;  4L63 B;  1BCP D;  1PXU A;  1DJR D;  4PQX A;  3H3V C;  4O1N A;  2WP8 J;  4AYB B;  2Q8I B;  3WDN A;  4TKO B;  1QOH A;  2L5T A;  1MSH A;  3SXH A;  4KMU C;  1FYC A;  3PO2 B;  1H9R A;  1STY A;  4MIU A;  1I3Q B;  4LK1 C;  2D5D A;  3A55 A;  5C4J B;  2FJ2 A;  5C0X J;  3PUZ A;  2F0I A;  4FF3 A;  5ISR A;  2K28 A;  3CQZ B;  4JBW A;  3HOY B;  3KBG A;  1E2Z A;  3Q24 A;  1D1I A;  2NTS A;  5FKA C;  5C44 B;  1SJE D;  2XRQ D;  2BDO A;  4FXD A;  2NN6 I;  3SR1 A;  1ROD A;  5KNB A;  3ITP A;  3I91 A;  4A3G B;  4ZKB B;  2F0O A;  2XN9 C;  4DK1 A;  4OL7 A;  3HGB A;  1SE4 A;  1ILP A;  2NN6 H;  3GTJ B;  1JWS D;  3HOZ B;  2D2C C;  3QJY A;  1JOK A;  5IT9 L;  5IOD A;  1SBB B;  1S4Z A;  2EXZ A;  5IGF A;  1DM0 B;  4RGN A;  3TN2 A;  4B9W A;  4ZAI A;  2A68 C;  2BOS A;  1TR5 A;  1HFG A;  1D5X C;  4U67 3;  1ZYR C;  5E4X A;  2PZT A;  1TS3 A;  3EQL C;  4C3J G;  2JA5 B;  3S17 B;  1G29 1;  4BA2 I;  1AW7 A;  1XWE A;  1M4V A;  5JPM C;  1SFO B;  2KUM A;  4ME5 A;  2B2W A;  4XXE A;  1PZK D;  4XDX A;  1G8Z D;  3QO2 A;  1DOK A;  4BS9 A;  2VUM B;  4DNR B;  1WTO A;  3R93 A;  1G6Z A;  3D3R A;  1SNM A;  4U68 A;  1BOS A;  2EE1 A;  1AZQ A;  2FMM A;  1AZP A;  3MAQ A;  1KDA A;  4BBS B;  2JA8 B;  1ET9 A;  3GD7 A;  3FDT A;  2KA7 A;  2DNC A;  1GHJ A;  3NK9 A;  1EQT A;  2F0F A;  1DD2 A;  1UNS A;  1BCP B;  3C1E A;  1CK1 A;  1DYQ A;  1O7Z A;  2C9O A;  1AP0 A;  2NVX B;  4J6H A;  1OXU A;  1CT1 D;  2F0H A;  1IW7 D;  2LMC B;  3MXN A;  2J7Z A;  1B2T A;  2XSC A;  4R8I A;  5I2X A;  4CKC A;  4EQP A;  1DXM A;  4XT1 B;  1JWU D;  1KLG D;  4K2K A;  3VR3 A;  4G7O C;  5FO7 B;  5FK9 C;  3DM1 A;  2EJG C;  3EVQ A;  4IUU A;  3P75 A;  2EYL A;  1ONL A;  2A6E C;  2HCC A;  2IPK D;  3EJI A;  1D5Z C;  3S2H B;  3FMC A;  1QG7 A;  3K59 A;  1YNN D;  2JA7 B;  3MVV A;  5IGC A;  1LTB D;  3S9W A;  2L1B A;  2EPB A;  4IQZ A;  4B9X A;  1EU3 A;  5KRU A;  1B53 A;  3S1M B;  2Z4I A;  3URY A;  5ELF A;  2CQA A;  2NB0 A;  2QDB A;  2HUG A;  1SYD A;  1ILQ A;  2F0L A;  2PYK A;  5JEA J;  3RUZ A;  1B1Z A;  3SK5 A;  3H6M A;  3TP7 A;  2CW0 C;  3M3Y B;  3CU7 A;  4RAU C;  2KCN A;  2MPM A;  4K6D A;  4RHS A;  2QKI C;  1BBX C;  2B2V A;  1DON A;  3P20 A;  2YU9 B;  1TKW B;  4K8I A;  2RA4 A;  1EL0 A;  1LAB A;  1KDC A;  1WTR A;  1D6E C;  4HMJ A;  2XWJ B;  1CZW A;  5IGD A;  3SK8 A;  1NR4 A;  1GHK A;  1X32 A;  5IGG A;  2K05 A;  2IWH A;  3GTO B;  2Y0S B;  2E2H B;  3IL8 A;  1QJO A;  2L11 A;  1BCP C;  3K5L A;  3QOL A;  2R61 A;  3A56 A;  2F0U A;  1U4R A;  1PTO F;  5ELC A;  1K8M A;  3HZX A;  2JEA I;  4OIJ A;  3KF8 A;  5IGE A;  3MFY A;  4OGQ C;  1QNU A;  1Y8P B;  2F03 A;  4R9W A;  2Z1C A;  1JOO A;  4IUN A;  4KD4 A;  2AWN A;  1U9R A;  4HN7 A;  3HOX B;  1GUG A;  1LT6 D;  4FXG C;  1TWG B;  1SNP A;  3NPP A;  4J8Q A;  5C4H A;  2SNM A;  1J9O A;  4ZUJ A;  1S5D D;  2K33 A;  3A54 A;  1OXX K;  1D5M C;  5EBC A;  1KAB A;  1Q12 A;  2I07 B;  4IN3 A;  5KND A;  3M7N A;  1PFN A;  1RTO A;  4CJ0 B;  1PMR A;  5DM6 3;  1HPC A;  1R4Q B;  3FKI B;  3S1R B;  5IT9 E;  3DXJ C;  4KHZ A;  2XVS A;  1WTP A;  5EKK A;  2F4I A;  2QEJ C;  2PW5 A;  3NXW A;  4DAP A;  3MC0 B;  1EWC A;  2SDF A;  4V0B A;  3IAY A;  4BY7 B;  3DWP A;  3TP6 A;  3EA6 A;  1NR2 A;  2DNE A;  1I4G A;  2K7V A;  2EYJ A;  2WKD A;  3O13 A;  3A8K E;  4ZLT F;  2PZW A;  5C5M A;  2K5W A;  3D31 A;  4FNF A;  3CRK C;  1UEA B;  5CV9 A;  4F8M A;  2NN6 G;  5D3I B;  4EQO A;  5A35 A;  1EY4 A;  5LL6 X;  1ENA A;  1H9S B;  1LV9 A;  1FNW A;  1A3U A;  3H0G B;  4NDX A;  2WV6 D;  1L0X B;  1OO9 B;  3RD4 A;  1Q1B A;  2ENB A;  4IZ8 A;  1MGS A;  5E3F A;  5CV7 A;  1OXT A;  4DK0 A;  3S16 B;  1AEX A;  4HAE A;  1A6X A;  2F0P A;  1LTI D;  1Y8O B;  2A6E D;  2L55 A;  4CKB A;  3S15 B;  4Q0F A;  5M5W B;  3K5N A;  1QB5 D;  1VDZ A;  3E0J A;  4I65 A;  2K04 A;  1JOR A;  2B39 A;  2X6L A;  5I6W A;  4ZK9 B;  1HTP A;  4XIG S;  2PQE A;  4WRD A;  3IKJ A;  1Y69 U;  2KEC A;  2XWB B;  1Y1W B;  3VR6 A;  4BWG B;  1EY7 A;  1DOL A;  4DXF A;  3A8I E;  4X3S A;  3H94 A;  1X3Q A;  5C4Z A;  5M3M B;  4KY6 A;  4RCO A;  1GUN A;  2MGS A;  2HDM A;  3RMH A;  1IW7 C;  2L12 A;  5ELB A;  5FO8 B;  2PO4 A;  5E4W C;  5M9O A;  4RGT A;  4QUF A;  4ULL A;  1LTR D;  2RSN A;  1PRT F;  3MXP A;  3V05 A;  1EIH A;  3NUC A;  3OHX C;  4XT3 B;  2H1E A;  5KEE A;  4R8N A;  3A7L A;  2QF7 A;  4BA1 I;  1YNN C;  1IL8 A;  4L8J A;  1SE2 A;  3RLF A;  1F9R A;  5EPL A;  5LHY 1;  4KN7 C;  3J80 L;  4XYO A;  4ABN A;  2CHB D;  5G3L D;  1SYB A;  3J7Y W;  2BDN A;  2TSS A;  5I2Y A;  2FMC A;  3D4W A;  2DY8 A;  4PMB A;  3NTH A;  4DU9 A;  1E0B A;  1ZEQ X;  5CV6 A;  4G7H C;  2CVR A;  4G57 A;  1TWC B;  1Y8N B;  4CKE A;  3MA2 B;  1M8A A;  1SYG A;  4TQU S;  4H44 C;  1SNQ A;  1U4P A;  4FYD A;  3PUX A;  4C56 C;  3QB3 A;  3T16 A;  1HUN A;  1EY9 A;  2K03 A;  1EWH A;  2EYP A;  3QOJ A;  5CV5 A;  2XRS D;  4BY1 B;  3T56 B;  4LAA A;  4ZRZ A;  3C46 A;  3HKZ B;  3JAM E;  2PPB C;  1MSG A;  2F0E A;  2V4D A;  5HGT A;  2N55 A;  1LT3 D;  1BNZ A;  1BQQ T;  3M85 A;  3HS0 C;  3V96 A;  1HUM A;  3AU7 A;  3MEH A;  5CV4 A;  5IOC A;  2E74 C;  1VCI A;  4IAL A;  3OWF A;  3GTM B;  4EVO A;  1ZKO A;  2E75 C;  2KEE A;  1WTV A;  5K36 H;  3DMU A;  2Q8T A;  1R9T B;  5JPN C;  1LTA D;  3NE5 B;  4H0L C;  1UAP A;  4L6T B;  1EY0 A;  1LTT D;  1V8Q A;  2PNR C;  4N9T A;  1WVL A;  2X69 A;  3C1F A;  2BA0 A;  1PTO H;  2IJ0 A;  2R3Z A;  4A3I B;  1G2T A;  4IUP A;  4RH6 A;  3MFG A;  2LY7 A;  3NQT A;  4PV1 C;  3T53 B;  5COY A;  1B4O A;  4FF2 A;  1YNJ D;  1IHZ A;  1AFP A;  4PNY A;  3BVZ A;  3R3O A;  4TRD A;  5EPJ A;  1CQV A;  5CBA E;  3L7Z C;  3NWT A;  5JEA G;  3GP7 A;  2PW7 A;  4B08 A;  4QIW B;  1JOQ A;  3L3O C;  3VYU A;  2KCC A;  1B9N A;  4CGY B;  5J22 A;  4K5X A;  5I9P A;  3FEW X;  1B9M A;  2RDG A;  3NWS A;  4NW2 A;  4M1U B;  4G4K A;  2VNU D;  5C6A A;  1PFM A;  1VMC A;  4RA8 A;  3PUV A;  2Z8L A;  2JXM B;  1IKM A;  2PMZ B;  3NTI A;  1EY8 A;  1HFN A;  5DM7 3;  1EYC A;  1NCV A;  1B44 D;  2OT2 A;  5CBE E;  3BG3 A;  5CYU A;  2C5C A;  1BO0 A;  4RWS C;  1C48 A;  1HXY D;  4HCS A;  4NKL A;  2KOL A;  1U4M A;  1H9J A;  4PMC A;  2R92 B;  5FO9 B;  1F9P A;  5CV8 A;  5M5Y B;  2NYZ D;  4GZY C;  5EGT A;  2E2I B;  2NZ1 D;  4Q5V A;  2WB1 B;  1EYA A;  1T5E A;  1JC7 A;  1B3A A;  3VR4 A;  1Q90 A;  3K58 A;  1O7Y A;  4KY5 A;  4XYQ A;  2OF1 A;  5FOB B;  4EQN A;  4ILW A;  4ZQ3 A;  1F2Y A;  3HOW B;  4XQN A;  4G7Z C;  1PRT B;  1EY5 A;  4IUR A;  1LTG D;  3SEB A;  4H7B A;  2L9H A;  4QCL A;  2FHT A;  4HED A;  3BVG A;  5C3W A;  3I70 A;  4FF4 A;  4HTH A;  1SYF A;  2GA4 B;  3D4R A;  3T51 B;  1BDO A;  2F0M A;  3A8J E;  3OW7 A;  4C2M B;  2WAC A;  1E2V A;  5DAU A;  3HP3 A;  2PZU A;  4C1N K;  1EIG A;  3MXU A;  3U9S A;  1A2U A;  1H9K A;  1CQF A;  3M4O B;  3K57 A;  3J80 E;  3HG9 A;  2IX3 A;  1RDP D;  2AQ3 B;  1SAP A;  1SYC A;  1EZ6 A;  3NBH A;  2R7Z B;  4RKB A;  4XQJ A;  4A3M B;  1CTM A;  4S3S A;  1V1P B;  2O5I C;  4DA2 A;  1Y1V B;  3H09 A;  3DWA A;  3ERO A;  2XIW A;  5EKL A;  1VF7 A;  1K83 B;  1HRJ A;  3ND8 A;  4DAY A;  4ZKC B;  3M4Y A;  2ZXR A;  3PIP 3;  3MXG A;  5AFW A;  3IFD A;  3SDZ A;  1V1O A;  5A2Q L;  3QWN A;  3C2P A;  2EY6 A;  1LO5 D;  5FLX L;  5CGK A;  1U4L A;  2YYZ A;  3FPU B;  4A3B B;  1H9S A;  5IGB A;  2EYM A;  1TS5 A;  1S5E D;  1CHP D;  2MHV A;  1SXT A;  3FRP B;  4XQQ A;  5DEH A;  4A3F B;  1OXS C;  3DWQ A;  4A3E B;  2M00 A;  2K1B A;  3AMU A;  1A15 A;  2KED A;  1UUP A;  3PMF A;  3S14 B;  1TVX A;  3P7J A;  3ONA B;  1T5X D;  1PRT C;  1JQY D;  3GV3 A;  2E76 C;  3F2U A;  1FR3 A;  3E6Z X;  3G6J B;  2IT1 A;  1OXV A;  5K5P A;  3IFT A;  3FVQ A;  1I4P A;  2JSO A;  1STG A;  2KHS A;  4IFD J;  4HSV A;  1HQR D;  1TWF B;  4HMI A;  5EKI A;  4RFB A;  1EYD A;  4OHJ A;  1PTO D;  1SMY C;  4NMZ A;  1QCB D;  1KTK A;  3KLS X;  2A69 D;  5NUC A;  1G2S A;  1RKN A;  1PFB A;  5JAV A;  1RD9 D;  1VF5 C;  5K36 G;  2B2Y A;  2B2U C;  4KKS A;  3R2I A;  3R8B A;  3BDO A;  5KNC A;  2EVB A;  4K8J A;  3RZO B;  3BVM A;  5M5X B;  1KNA A;  4Z9C B;  1KAA A;  4JK1 C;  1ENF A;  5E1F A;  1YNJ C;  2F0K A;  2OEO A;  3MHB A;  4CBV A;  4LMQ D;  4K5V A;  3HOU B;  1X3P A;  3LWE A;  1SEB D;  1LLR D;  5M3F B;  3N6R A;  3MTS A;  1PDQ A;  2NUC A;  5KYL A;  1QNK A;  5I9O A;  4KD3 A;  1DCZ A;  1Z47 A;  4A3J B;  1EEF D;  3KUP A;  2QIL A;  3TP5 A;  1L0Y B;  5CMD A;  2H4O A;  1C4Q A;  1AN8 A;  2F0T A;  2VB2 X;  5C3E B;  1EOT A;  1BCP F;  5J39 A;  4RKL A;  3I73 A;  1D2B A;  2WII B;  1MD2 D;  4IFD I;  2ZT9 C;  1TU2 B;  1GUS A;  2JYO A;  2A6H D;  3OWE B;  1O7L A;  1DOM A;  3T4A C;  2F3W A;  5EPK A;  2K01 A;  4C1N I;  1PLF A;  2Z4H A;  2SOB A;  2AWO A;  1PYW D;  4O42 A;  2EYH A;  4IFD H;  1IYU A;  1O78 A;  1RF2 D;  2F0D A;  3BDC A;  4RGM A;  1HTL D;  2KQ3 A;  1GUO A;  4X3U A;  4YIJ A;  1EZ8 A;  3E5S A;  2A73 B;  4KN4 C;  1CFM A;  1I4R A;  3BS1 A;  1CA6 A;  1QIL A;  3BYY B;  3VYS A;  2F0Q A;  1JIC A;  2RBM A;  1W6K A;  3D6W A;  3S1N B;  2F0J A;  1WD0 A;  2K6A A;  4N9P A;  1HCZ A;  5BN4 A;  2NTT A;  4QMG A;  1A3T A;  2B63 B;  4DFA A;  2I46 A;  5TSS A;  3P1H A;  1WTW A;  1HA5 A;  3W2D A;  4BBR B;  1NSN S;  3DHQ A;  2JA6 B;  5D65 A;  1A2T A;  3DEO A;  5CC4 A;  3NSW A;  1S5F D;  4RCN A;  4H13 C;  1LT4 D;  1Z6H A;  1PTO B;  5BN5 A;  2RVL A;  5HUR A;  2G9D A;  4KKU A;  5KYI A;  4UAI A;  4FF1 A;  2NVY B;  5D3D A;  3OSO A;  3SVM A;  2EJF C;  2E2J B;  3MWY W;  1I50 B;  2EZV A;  3C3L A;  3HRZ C;  2L0C A;  1RHP A;  5EQ0 A;  1CI3 M;  1PRT D;  4DN4 M;  5A2Q E;  4C3I B;  1G91 A;  5JOB A;  1TS4 A;  2A74 C;  3J81 L;  5FLX E;  1H9M A;  3HOV B;  3PUW A;  3PV0 A;  1ENC A;  1MBY A;  1STB A;  4OO1 I;  1FD7 D;  1A3V A;  2RDH A;  3TSS A;  3KK7 A;  4C3H G;  3PIO 3;  4I7Z C;  1F2M A;  2HQE A;  2B2Y C;  1SMY D;  4OO1 H;  2F1M A;  3GTL B;  2ICE C;  4J1M A;  2MJ8 A;  1STA A;  3TDQ A;  3VR2 A;  2IW3 A;  1I4X A;  3SE0 A;  4K14 A;  1J8I A;  1NUC A;  2LS0 1;  3TP8 A;  3NP8 A;  3K0Y A;  4P2C B;  4QF4 A;  3M7G A;  1F9S A;  1I4H A;  3OPO A;  1LAC A;  2N88 A;  3VA5 A;  1EFI D;  2IX0 A;  2AUJ D;  3SK6 A;  4UDU C;  5C0X I;  3V2T A;  3AB9 A;  1TS2 A;  4V19 0;  3GTK B;  4F7X A;  1I6H B;  3MZ5 A;  1PTO C;  5F2D A;  2HCI A;  3CHB D;  2XNA C;  5C0X H;  1FNU A;  4ID6 A;  2A69 C;  3G7L A;  4K6L A;  3DEP A;  1TWA B;  4DGZ A;  2VB3 X;  1KLU D;  2B8F A;  1TWH B;  3NTK A;  1QE6 A;  2BCO A;  3OIP A;  3VYR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...