1FD7D

Heat-labile enterotoxin b-pentamer with bound ligand bmsc001
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
103
Chain Sequence
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT-LABILE ENTEROTOXIN B CHAIN
publication title Exploration of the GM1 receptor-binding site of heat-labile enterotoxin and cholera toxin by phenyl-ring-containing galactose derivatives.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
total genus 24
structure length 103
sequence length 103
chains with identical sequence E, F, G, H, L, M, N, O, P
ec nomenclature
pdb deposition date 2000-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1fd7D00
1S5CD 1CQVA 2NTSA 2O2LD 2QILA 1PTOC 1ET6A 1TY2A 3MFGA 1DJRD 1LT3D 3CHBD 1RF2D 1ESFA 1EWCA 1LO5D 1LTSD 1SJED 2SEBD 1LTRD 3O13A 5ELDA 3BYYB 4RGOS 1I4XA 1PTOD 4O1NA 3R8BA 1LTAD 3BYTB 2IPKD 5ELFA 1ET9A 1XTCD 1PRTF 1CK1A 1JCKB 5TSSA 2G9HD 1FNUA 1STEA 1EFID 1CHQD 5I4DA 3W2DA 1SE3A 1EU3A 1F77A 1KLUD 1M4VA 1TS3A 1S5ED 1PTOH 1AN8A 1B44D 1CHPD 1BCPF 1LT5D 3SEBA 1PTOB 1V1OA 1V1PB 1AW7A 3KLSX 2R61A 1L0YB 1RD9D 1SJHD 1UNSA 1SEBD 4L6TB 3BVZA 1KLGD 1HA5A 1EEID 4RFBA 4RGTA 1D5MC 2AQ1B 2QEJC 1HXYD 1EEFD 1JR0D 1S5DD 1SE2A 1ENFA 1BCPD 5ELBA 1V1PA 1TS2A 1LTBD 1RCVD 1KTKA 1PRTC 1TS5A 1LT4D 1MD2D 2RDHA 2XN9C 3BVMA 3DWAA 3V05A 1TY0A 4RGNA 1SXTA 1L0XB 2ICIA 1JQYD 4DXGA 3BZDB 1G8ZD 2J4XA 1PRTD 3DWPA 1JWSD 1SE4A 1D5ZC 1LTGD 3OWEB 2AQ3B 4Z9CB 1B1ZA 1I4QA 3EFXD 2AQ2B 4BWGB 1EU4A 5ELEA 1BCPC 5FKAC 5D3DA 5ELCA 1LLRD 1CT1D 3DWQA 4RHSA 2NTTA 3R2IA 4RH6A 3TSSA 1I4RA 4RHRA 1PZKD 4TSSA 1HTLD 1JWUD 3URYA 5FK9C 2Z8LA 1LTID 3GP7A 4K6LA 1GOZA 1UUPA 2CHBD 1PTOF 1PRTB 1QILA 3BVGA 4C56C 2TSSA 1BXTA 1XXGA 1SBBB 4ZYSA 1JWMD 2IJ0A 1FNVA 2XRQD 1FNWA 1LT6D 5D3IB 1LTTD 3R2TA 1D6EC 1I4PA 2XNAC 4L63B 4OHJA 2WV6D 1PYWD 1T5XD 3EA6A 4DXFA 1FGBD 1BCPB 2XRSD 1S5BD 1D5XC 1TS4A 4UDUC 3MC0B 1S5FD 1DYQA 2RDGA 1I4HA 1HQRD 4RGMA 4RCOA 1PZID 1I4GA 1PZJD 1FD7D 1RDPD
chains in the Genus database with same CATH superfamily
3NUCA 2KCNA 2N78A 2WKCA 3NELA 1IW7C 1TU2B 3MFGA 4YIJA 3I56A 3M3YB 5AJ3L 4I65A 2F0TA 3M7GA 2WIIB 5E4XA 1E2VA 1YNND 1U4MA 1KNEA 3SHLA 3A5UA 3G71A 3BDLA 1EWIA 5TSSA 2ASBA 4JYAL 2K1BA 4JI1L 2UU9Q 1CHQD 2K32A 2HCIA 3CCLA 2C9OA 5IGEA 3F1ZA 5EQ0A 3CCQA 2EYLA 5JJKA 3EBEA 5CC4A 1S5ED 5C44H 2Y0SG 1A15A 2FMCA 3Q22A 5IY0A 1AW7A 4QF4A 4KKUA 1EY5A 1X3PA 3GQBA 1TXYA 1BKBA 2L12A 4DV5L 4XQQA 1SYGA 4DU9A 5KIXA 1H9KA 1JR0D 2FINB 2NN6G 3STBC 2UXDQ 1Z6HA 3ULLA 1K8AC 3HOUH 1PFMA 1RKNA 1Q7YC 1WOCA 4A3EG 3TZDA 1QOHA 4LFAL 4A3IG 1KRTA 4PMBA 4BY1H 4OX9Q 2JA7G 4A93B 2GA4B 2K50A 4OWTB 3FPUB 5JJLA 4H02A 2K5NA 1BCPC 1JORA 4C2MH 2F1MA 1SMXA 4R4TA 1EIFA 1O7IA 3M85A 3S2HH 1JOKA 4IPDA 1Q82C 5GAEC 3E3XA 1UUPA 2LXKA 1NY4A 1YNJD 2PW7A 3NHHA 2MNAA 4A3BB 5KEEA 4PZ7A 3GTKH 4K2LA 2DNEA 1GO3E 1AP0A 4DV6L 4BY1B 1BUVT 3MWYW 1T5XD 4QY7A 1S3OA 4YWMA 2B2YC 3F8TA 2EZVA 5DM73 4K0KQ 2E5LL 4B9XA 1I6HB 5DAUA 3D0FA 1C7YA 3I4NB 1RDPD 3QB3A 2K03A 1HQMC 3HOZH 1CKMA 2GVAA 1F2YA 5EPJA 3GTOH 2L9HA 2MO1A 3AQQA 4FNFA 2PCFB 3CHBD 4DNTB 1BBUA 5FJ8H 3UDGA 5LL6X 1LTRD 4YWKA 3T4AC 3CCMA 3IL8A 2NN6H 4WJ3M 1XMQL 5ELFA 1PRTF 5FLMG 5JVH3 4A3EH 5EKKA 3OTOQ 5KNDA 1XPOA 4GS3A 1CSQA 4BXXG 2KOLA 1EU3A 4DV2Q 2EOTA 2Z4IA 1XPRA 5EAYA 2UUAL 3HOZB 4A3JG 3GTOB 5C4JH 4HSVA 2PI2E 4JI5Q 1X3QA 5HGQA 3S15B 2I5HA 1L0YB 4JI4Q 2ZXPA 2HQLA 3SR1A 3NWTA 1V43A 2WINB 3D4DA 4DR5Q 4A3GG 4RFBA 1D5MC 2ZJPA 1Q1BA 1MKHA 4I7ZC 5J39A 4DUYL 3FMCA 2E76C 3V05A 3BVMA 4DK3C 2A69D 4WFN3 1RTOA 4RGNA 1EZ8A 3K57A 5FO7B 3K7AH 2C5CA 3I70A 4CJ2C 4FF2A 2K6AA 4JI3Q 3GTMH 1TR5A 1NE3A 3K5OA 3NWSA 3PIO3 1QUQB 1VQ8A 1Y14B 5BR8L 4FXGC 5ELEA 4G7OC 4A3MH 1WYDA 3RR5A 3NBIA 2NVQB 1IL8A 3PIPA 1GD7A 4B9WA 1N36Q 1QUQA 3MXUA 4PZ6A 3CP0A 5I2XA 1JJ2A 2TSSA 1CQFA 1STGA 1X3EA 1J5EL 3TS2A 2ZXOA 4QQBX 4C1NK 2LSSA 2K5WA 4IUVA 2J7ZA 3HKSA 1E1TA 2EYMA 4R4IA 1A3TA 4OWXB 3GTMB 4A3FB 4HJ7A 2JEAI 1HZCA 5FLMH 1Q3LA 2DY7A 1SDFA 4JC0A 2JA5G 4O42A 3OOCA 3L9AX 2JA9A 3UI2A 4ZK9B 4DR1L 3R3OA 2H4OA 3QIAA 4GLVB 4DK6C 4GOPC 4HJ9A 1S5CD 2BA1A 4G4KA 4B3RL 5I6YA 2F0VA 4XDXA 5HURA 4UP7A 4LK1C 3KF8B 4FVMA 4G7ZC 4P72A 3WOEA 3CRLC 4A3GH 5E7NA 3GTQH 1Y1WG 1K9MC 1I4XA 4CBVA 5M3FB 5BN5A 1EWHA 4LWCA 1RODA 1ET9A 1XTCD 2ICEC 4JI0L 2ES2A 3HFZB 3J80i 4MTNA 4CJ0B 5IYBH 3M4OH 2UXDL 2JP1A 4ULLA 1SE3A 3S9WA 1VQBA 3D3RA 5G3LF 3GTLH 2K5DA 3HRZC 2G9DA 4XT1B 3D4RA 4LFCQ 3TDQA 2KEDA 1VF7A 1KLGD 1EEID 5M9OA 2CQOA 4CHTB 4OO1G 1EEFD 3CQZH 2UUCQ 1DM0B 2J0TD 3MXGA 2BH8A 5E4WC 5C4XB 4ZLTF 3FHWA 4F88A 2ATWA 1SXTA 4EQNA 2XWBB 3F2DA 3F2UA 2A68D 1PRTD 1TWGH 1GKHA 3T51B 4KJOA 1TWCH 2UXBL 1LTLA 4HIMA 1U9RA 2JA5H 1G91A 2KVMA 3OMGA 1F2LA 1GUOA 3G4SA 1HHVA 1YZ6A 2NZ1D 1HTLD 1EYCA 1SR3A 3RZOB 1NSNS 1C0AA 3NSWA 1GOZA 3NTHA 1NJIC 4KTAA 1SNQA 4L8JA 4LF4Q 4IZ8A 4R4CA 3G48A 1Y1WH 4LF5L 2UXCQ 1LTTD 4WJWA 4AYBE 3ULPA 3M9BA 3VYRA 1S5BD 2F3IA 3H3VI 1WTXA 3CCUA 1VMPA 2R7FA 1A6XA 1CFMA 2XTIA 2OTLA 2R7DA 2YTVA 1X9NA 5JJIA 2M9VA 4KI0A 5JPNC 1Q8IA 5C5LA 3HKZG 2YU9H 2I46A 4R8NA 2JA6B 2PZTA 2EE1A 3S14H 3TP6A 1IBML 1UWVA 3O13A 4KJNA 1R9TB 4OO1H 3I4OA 1FJGQ 1N32Q 5GADC 4JI4L 1ASZA 3J81L 4XIGS 4DR5L 5M5YB 4YY3L 1VQKA 4GNXC 4CKEA 3F2BA 2KCMA 3LNNA 3M4PA 1KLUD 1M4VA 5LMUQ 4A3DG 5GAGC 2E2HB 3MVVA 4RCNA 2YU9B 2EQSA 3KLSX 4JW0A 5FO9B 2F4VQ 1EY4A 2CW0C 2JK8A 2BDOA 3PUXA 3VYUA 2WB1E 2K33A 4OL7A 4C3HB 3IFDA 2NZHA 1CSPA 1ENCA 2N3SA 1CZWA 2PMZE 4IOCA 2XGTA 3DWAA 2RDHA 1K83B 2CH4W 4CKBA 1WTQA 1N36L 4DXGA 1EQVA 4XQNA 1M90C 1SSOA 1Z47A 2Q8IB 2ZM6L 4GOPB 2Q2UA 3HOWH 4KHZA 5D65A 3HP3A 1G6ZA 1O7YA 3BDCA 1IKMA 3OWEB 3V96A 1I4QA 5LL6S 5GAHC 5BN4A 5CV5A 1LLRD 4GOPA 1SN8A 5G3LD 2LMCB 4HSPA 3RLOA 5IYCG 5FK9C 1JE4A 1GHKA 3GP7A 1VQAA 4IUPA 2K5HA 1PTOF 4X62Q 2HHHQ 2DUDA 3PV0A 4BA2I 2AWOA 2L5TA 3NEMA 1PFSA 4YHHQ 1DOMA 3L7ZC 1H95A 1HNWQ 3ER0A 1XMOL 4DN4M 5JJZA 5IODA 5E1FA 2KHIA 4DAYB 3CMEA 4BBSH 4IFDG 1STBA 1KDBA 3QR8A 4TVAB 3GTPH 3EA6A 2RSNA 2XRSD 3W1BA 2E2JH 1S5FD 5CR3A 5I9OA 1FL0A 1I4HA 4DAYA 2BOSA 4A3KG 3OSOA 1VQNA 1PZJD 1TWHB 1KHIA 1STNA 4A3DH 3A7LA 4H13C 4QB4A 5CV8A 1LT3D 3K7UC 4DNRB 2Q8RE 2R93G 4IUQA 4DV4Q 1L2FA 5M3MB 2AUJD 1DOLA 4LF8L 1Y8NB 2KUMA 5ELDA 3AMUA 3M4YA 3ONAB 2KQ3A 5KGUA 2EY1A 3I2ZA 1QNKA 1EQTA 4BBSB 2F0UA 1GUGA 3GO5A 2CVRA 3TREA 4DAMA 2Y0SE 4ZRZA 4LF6Q 4R4QA 4UPAA 5M5WB 1QVCA 4CDDC 2E2JB 3K58A 1JMCA 1EFID 1VS0A 2L1BA 3CKIB 1VQCA 3T1YL 4H7BA 1WCMH 5CYUA 5IGCA 1XWEA 2NVYH 3IAYA 3L0OA 1B9MA 3E9IA 3OIQA 3I7FA 1SEBD 1VQPA 4MIUA 3GTJH 1JJGA 1VQLA 2WP8J 3QOLA 3UDIA 2EYHA 4ZAIA 2B8GA 2N55A 1RCVD 1T5EA 2XN9C 4LUZA 1D1KA 3RD4A 4B3TQ 1SROA 2J4XA 5EPLA 2K5QA 3EQLC 4EX5A 4IFDH 4LF4L 4Z9CB 1IYUA 3H0GB 1TKWB 3NXWA 1EQRA 1YNXA 2WAQB 1D8LA 3NPPA 2UXCL 3T16A 2OWOA 1X54A 1JT8A 1HR0W 3Q6SA 4A3KH 3CF5A 1XTDA 4LF7L 3GTJB 2H5XA 3Q0AA 4RWSC 1HUMA 3I72A 4DV3Q 1OXVA 2QEXA 5J1ZA 4JV5L 1PRTB 4A75A 5AFWA 5GQOA 1EY6A 3SE0A 2JSOA 1E2WA 1SNCA 1G51A 4A93G 5JOBA 5C44G 4A4IA 4UP9A 3I90A 4BS9A 4JI6Q 1E7ZA 1FJGL 3OW7A 3EVQA 2G5DA 5IT9c 5A2QL 1RJTA 2PQEA 1QWYA 1B3AA 1SNOA 1R4QB 5BN3A 3T53B 4A3BG 4P71A 3M3YH 3CC2A 3FPPA 5C0XJ 5GROA 4JBKA 4BY1G 4JOIA 2WKDA 1EOTA 2RKSA 2F4VL 4HTHA 4O1NA 1PTOD 1B7YB 5CV9A 1PH8A 4NXML 4DAVA 4L5SA 3ERSX 2DN8A 1CKOA 4AH6A 4LW1A 2AHOB 1QCBD 4K5WA 4TKOB 3I4NG 4ZCKA 4ZQ3A 2DY8A 4RA8A 3BJUA 3CC4A 1TS3A 3C1FA 1RHPA 2R3ZA 1HNXQ 2YTXA 3A8JE 1IBLQ 3H6MA 4UAIA 1VQ6A 4H0LC 3QG1A 3FRPB 1RD9D 2K05A 5DLQE 1J9OA 2AQ1B 4UY8C 4LNQA 2DNCA 3E5SA 1BCPD 1MSGA 4M1UB 1K28A 2XSCA 1RL2A 4AYBB 5A35A 1MD2D 2PZUA 1KXLA 1JB7A 1NAPA 1PVOA 1DONA 1G8ZD 4A93H 2HHHL 2BE5D 3HOZG 1VDZA 1LTGD 3PO2B 4JI7L 1LV9A 3LWEA 3A54A 5JEAJ 2CKZB 1AZQA 3NTKA 4XT3B 5FJ8G 1E3PA 3D31A 3MEFA 1VQHA 5LMNW 4DK0A 1LTID 3OW2A 3OIPA 5IT9L 4A3BH 1PYBA 5L37A 3K5MA 3J7AV 1NMGA 3D6CA 4MNOA 4DNIA 3S2DB 1FNVA 1FNWA 1O7LA 5IIFA 2WV6D 2MFIA 3W3AA 2KECA 1B53A 4DV4L 5M5XB 4AQYL 4C1NI 3S16B 2KA7A 1I6HH 5IP9H 1PXUA 1JJCB 1RIPA 3I4NH 2ZJQA 4MZ9A 3TS0A 4GKJL 1A8VA 1XJVA 1UEAB 5FLXc 1OXSC 1CQVA 2R92B 5T1GA 1YNNC 2PMZB 3X3MA 3DXJC 4A3FG 2RVLA 4QCLA 1K8OA 1ZKOA 2OTJA 4A3MG 1NBWA 2F0IA 1H9JA 3W2DA 1N8RC 4HMJA 2IX1A 1N33Q 2HDLA 1VQ5A 1E0BA 4FF4A 1GUNA 3EIVA 1B44D 3PO3B 2EJFC 2K01A 1IYVA 3S15H 2UUBQ 3ND9A 4JVZA 1FYCA 1GM5A 1BF4A 5C4HA 2R61A 2LY7A 1KC8C 1D2BA 3FKIB 3J81E 1HA5A 3E9HA 3D8GA 1YHBA 1SE2A 3JAME 1TS2A 3U9OA 2F0WA 1WD1A 3AFQA 1BDOA 3S24A 3HOYB 2B2WC 4P73A 3CPWA 3K5NA 2SNMA 3N52A 4ZUIA 4QMGA 1UE5A 1WD0A 2MQHA 3NP8A 1OXUA 3RMHA 2QW7A 1MGSA 1CZGA 1NR2A 2L11A 2NVQH 1HR0Q 1DZ1A 5ELCA 2OEOA 2B29A 3DEOA 5T1IA 4BA1I 3HG9A 2WFWA 5COYA 3X3NA 1PZKD 1YNJC 4QL5A 3NTIA 4JI6L 3LWUA 5C4XG 4WRDA 2VQEQ 3NK9A 4DAPA 5IYBG 1BXTA 1Q12A 1SNPA 2MUYA 3Q24A 2CCZA 2SDFA 1SBBB 1A62A 3KOJA 2A5HA 5FLXL 4A3FH 1EQQA 1O78A 3PUZA 5D3IB 4K5VA 5DEHA 4KN7C 1VQ7A 3S1QB 3HKZE 5C5MA 4B08A 3VYTA 1VCIA 2EXZA 4HMIA 2CQAA 3MC0B 4RMFA 4LFBQ 4XXEA 2RDGA 4X64Q 2Q2TA 3JC66 4MN3A 3CCEA 4HIDA 5K36H 1F9QA 4RCOA 1PZID 2VQFL 1B70B 3OYYA 1UE7A 2IX0A 4A3IB 4MHEA 1B9NA 1Q46A 1TWFB 1TY2A 3M4QA 2B63H 1OXXK 3U4ZA 1B8AA 5C3EH 1Y8PB 2FMMA 3H91A 5M3FH 3VR2A 2HQEA 1EYDA 3AB9A 1GUWA 2KHSA 4ALPA 3G7LA 2K14A 1KDCA 4GKKQ 4WJ4A 1ML0D 5I4DA 1PH2A 1YVCA 2N49A 1II3A 2WACA 4KKTA 5KRUA 1I94Q 2UU9L 4APVA 5ELNA 2R7ZB 1LYLA 1X3FA 3BU2A 1CHPD 2D9UA 2X6LA 2JA6G 1PTOB 2EYOA 5FOBB 2D62A 2A8VA 4DR7Q 2DJFC 3RLNA 5EJWA 4U673 2B63B 1Y1VB 3E0EA 4TRDA 5C3EB 1IHZA 2A69C 3NE5B 1H9MA 2IWHA 1ENFA 5C4XH 5I9PA 5IWAQ 3KF8A 5JVG3 1KIXA 2HCCA 3I4LA 4PNYA 1ICFB 4FF1A 1G6PA 2ICIA 3UDXA 4EGVA 2L15A 3R93A 1MBYA 2K75A 1K3RA 5EBDA 4ILWA 4HIOA 3QOJA 2NBFA 2KBNA 4IN3A 1YI2A 2F52A 2EJMA 2D0OA 4IOAA 4OX9L 5D3DA 1IBKQ 3DWQA 3PCOB 3SK6A 4C3HG 3A8KE 4DR3Q 1MHWC 3H3VC 1KAAA 2IL8A 3BZKA 2A6ED 3LGJA 1I4RA 2CH4A 3A5ZB 5J3BA 3RZOH 2M2LA 5KYIA 2NYZD 4NKLA 4N8X1 2F4IA 1QILA 3ERQA 5CBAE 4BY7B 3S1NH 4GN3B 4C3JB 2CWAA 1I50B 1JWMD 1XNRQ 1NMFA 2F0QA 1I4PA 1VMCA 2OQKA 5LHY1 3BDOA 1I6VC 4NW2A 2Z6KC 4LF9Q 2EPBA 5KYLA 4M8AA 1M8AA 4F87A 1HQRD 3PUVA 2NVTB 1GJXA 4DV1Q 3J80c 3KYHC 4K0KL 4L5RC 2QA4A 4HJ5A 4Q5VA 4C3IH 2JA6H 2Q8TA 2QILA 3I73A 4RKBA 3S1NB 3PQIA 1N33L 4NXNQ 2Z4HA 1DXMA 3HOWG 1R9TH 5CV4A 3BYYB 4HAEA 1Y69U 1A0IA 2B2WA 1PH7A 3DM1A 5M5YH 5A2QE 1YHQA 5F2DA 2R6GA 2VB3X 4G7HC 3U50C 3CCRA 1PH5A 4S3SA 4JPBW 1EOVA 4ABNA 3OTOL 2E2HH 1XNQQ 1SMYD 2HD3A 4PG3A 4C3IB 4DV2L 4X6AH 1CUKA 3EJIA 3MHBA 4C3HH 5IYDG 1S4ZA 2P5ZX 5C3WA 3KDFB 4JI5L 3M7NA 4BBSG 1S5DD 1K83H 1YHAA 2VUMB 2A68C 1KAWA 1PRTC 4IALA 3EN2A 1E2ZA 3DHQA 3RNUA 2AMCB 2IW3A 4XQJA 3A74A 4LUVA 3NQTA 1IYJB 4UHVA 4RAUC 5C0XI 5H1SE 1D5ZC 3A0JA 1ENAA 4JI3L 1MSHA 2F0LA 1N9WA 4J6HA 1PMRA 1ZYRD 1CT1D 2OF1A 4JG2A 4OXPA 4RHSA 3KF6B 2OXPA 4QGUA 4FDBA 4DF7A 1BNZA 4A76A 2Z0SA 2F0SA 4YCWA 2O4XA 4JOIC 5HGTA 4K6LA 3C2PA 3PGZA 3KJPA 2CHBD 4X3TA 3BVGA 2RCFA 2VZAA 3H09A 4FP5D 4B3MQ 2QKIC 5JPMC 3J80L 1DD2A 1XXGA 4DUZQ 1ILQA 1WCMG 3SK4A 1BOSA 3CRKC 4BBRB 2ENBA 1D6EC 3H0GG 2OCEA 4NB3A 3S17B 4L63B 2RSOA 2CFMA 1VQDA 4DXFA 2QCPX 2WAQG 3MZ5A 2JJQA 3H3VH 4KKSA 2BH2A 2JYOA 4DV0Q 3I3CA 5IT9E 3GV6A 1B3QA 1TWHH 2E2DC 2YV5A 4L5TA 3L2PA 2E74C 1YJWA 3VR6A 3HOVH 1Q8KA 4K14A 1EIYB 5AJ3Q 3HOXH 4FYDA 3QWNA 2B2VA 2K04A 5M3MH 5IYDH 1I94L 4N8FA 2C35B 5DNFA 1DCZA 4DR2Q 1LO5D 1QG7A 5EBCA 1YBYA 3R8BA 3SDZA 4JYAQ 4DR7L 2IPKD 2F0EA 1X3GA 4HR7B 4ODGA 5CV6A 5C3XA 1SNDA 3VA7A 5M5WH 1JOOA 1JCKB 3TP5A 2A6HD 3HGBA 1F9PA 1STEA 3MXNB 1ONLA 2F0PA 3PUYA 1V1QA 5NUCA 3HOVB 2F03A 1BCPF 4RG1A 3MXNA 3SEBA 2F0GA 3HOXB 4DV5Q 3A56A 1UNSA 1WTHA 4Y7NB 5CORA 1K73C 4LFCL 4OIKA 1FVIA 1IBKL 2K4KA 3K80C 4YWLA 4KHPQ 4DR3L 4O2DA 2F0NA 4LFAQ 1LT4D 1EYAA 1BQQT 2F3VA 2UUCL 3AU7A 1U5KA 5DM63 4PV1C 4JI8Q 2B2TC 3G6EA 4HCSA 1JWSD 3H0GH 3T1HQ 2FJ2A 1VQOA 3N6RA 2AQ2B 2Z6KA 3S1RB 3DM3A 2ZT9C 5IP7G 1TT2A 4DR6Q 4N9PA 4KN4C 3GV3A 4RH6A 3K6OA 1HRJA 2EY5A 4QUCA 4AYBG 2EYJA 2MO0A 4ZUJA 1X56A 3RN5A 4DV1L 4PQXA 5IGBA 4YCUA 3FDTA 1N34Q 2VB2X 3R2TA 1K0RA 4NXNL 2YTYA 3C1EA 3PSIA 1KDAA 4DKAC 4H44C 2HUGA 1DYQA 1FR3A 2OQ0A 4KHVA 3HEJA 1SYFA 4U68A 1CKNB 1G2SA 1Z7TA 2ZTEA 4KV6A 2KHJA 4YCVA 3MFYA 2D0PA 3KK7A 1NCVA 1CM9A 1PH4A 4KY6A 1ESRA 4K5XA 4IQZA 5FLXE 2VL6A 2NTSA 3ULJA 4POFA 2A19A 3S1MB 1CKNA 5IOCA 1DJRD 1P8LA 2JN4A 1XMQQ 1SLJA 3GTGH 3RZDB 1HH2P 2IHEA 1C4QA 1IW7D 5KNCA 1K0SA 1F2MA 4HEDA 1MJEA 2Q2IA 2K52A 5EKIA 1N32L 2PW5A 3P1HA 2L4NA 1WTWA 2UUAQ 2HIXA 1S40A 3Q23A 2KJXA 1L0WA 4FXDA 2R92G 1TWAB 3IKJA 2E8GA 1DGSA 1U4LA 1YIJA 5IP7H 1W2BA 5LMUL 2M00A 1SJHD 2LS01 2B8FA 3GTGB 4RGTA 3I4MB 1HFGA 5C6AA 5C4ZA 1UAPA 2JA8H 4DR4Q 2I0QA 3CD6A 1JB3A 5J22A 3SXHA 1LTBD 4J15A 1PDQA 2JEBI 4J1MA 1WI5A 1L0XB 3FP9A 5IP9G 1ILPA 1K3BC 3STBD 2F0HA 5BR8Q 4CDCC 3PO2H 1X65A 1U4PA 4EQOA 4QUFA 2FFKB 3QO2A 1XX8A 4DUZL 1BVSA 4ME3A 3FKIG 5IE8A 2L0CA 4XYOA 1GVPA 2IY5B 4RHRA 3VA5A 4DFAA 4ZKBB 2JA8B 1A3UA 4DV0L 2PNHA 1XPUA 3HOYG 2D5DA 4F8MA 4DK1A 1Q1EA 3S2DH 3ICEA 2SOBA 5JAVA 1HUNA 4X62L 3ZJYC 2O5IC 2XRQD 1BR9A 4KD3A 1LT6D 1O80A 4YHHL 1SYCA 2MHVA 4IJLA 2BCOA 5M5XH 1HNWL 1SYBA 3S16H 1FGBD 4LJZC 4DR2L 3KLRA 1SFOB 1TS4A 4DR1Q 1YITA 4IUUA 2FXQA 3PMFA 3ITPA 4B3RQ 4CKCA 1VQGA 1FD7D 2RCNA 3CPFA 2R92H 2D2CC 2O2LD 4KD4A 1PTOC 2MGSA 1QNUA 4K8IA 1VQJA 2E75C 1W6KA 1GUTA 2H1EA 4NMZA 4IFDJ 3E0JA 1PA6A 1RF2D 4E6IA 3PF5A 4QIWE 4JI0Q 1NR4A 4RGOS 2NN6I 1PFNA 4NPSA 5CV7A 3QJYA 3RLFA 2JXMB 3T56B 5EKLA 2PQAB 4ME5A 2I07B 2B2TA 2TMPA 1XYIA 5IGFA 1FNUA 1P16A 3A55A 4KHPL 2WB1B 4LF6L 4N9TA 4HJ8A 1A63A 4OIJA 3PO3H 2PQAA 2EYFA 3P20A 3VR5A 4R1JA 4KMUC 3C46A 1SRUA 2LFNA 5C44B 1V1OA 4JI8L 3FKIH 1SAPA 3L3OC 2PYKA 3T1HL 1Z9FA 2EY6A 3PIP3 2QEJC 3K5LA 1G2TA 1HXYD 5ELBA 4DV7Q 4DR6L 2DJGC 2LKVA 3HOYH 3HZXA 2BE5C 3C3LA 4XTCS 3HOUB 4JBMA 2RBMA 1JICA 5K36G 1VF5C 1Y8OB 4KLKA 4JCVE 1VQ9A 4IPCA 2R7ZG 2UXBQ 3DWPA 1A3VA 4B3TL 2AQ3B 2KENA 1HZAA 1EU4A 4GLAC 1SYEA 1N34L 1H9SB 5FKAC 2B63G 1Y1VG 1G291 2X6GA 5C3EG 3R2IA 4C2MB 5M3FG 4G57A 1M1KC 1E24A 2V1CC 3S2HB 1H9SA 4HN7A 2ID0A 1HCZA 1BBWA 1NNXA 4LF5Q 1J8IA 4F7XA 4DV3L 1QZHA 2F0JA 1SNMA 1UE1A 1W3SA 2A73B 1BO0A 2VS1A 3PUWA 3GTKB 3S1QH 3T13A 4OHJA 1AE3A 1MI2A 2X69A 4PMWA 4PMCA 4OONA 3CMAA 1JC7A 4UDUC 2F0FA 3TBIB 1EL0A 1EY8A 3CW2C 3D4WA 2EVBA 3I8ZA 5CMDA 1I4GA 2RA4A 1C48A 1WJJA 3J80E 4A3IH 1WTPA 1HNZQ 2JA7H 3CCVA 3V2TA 1DOKA 3I55A 2KEEA 1A2TA 4BY7G 1TWFH 4Q0FA 1IBMQ 1TVXA 4C3JG 2VXWA 2Y0SB 5HY6A 4CJ1B 4LMQD 3SK8A 1ESFA 3WDNA 1CA5A 4GN5A 2NVXH 3H94A 1EY0A 1L1OC 2QF7A 4YY3Q 4OWWB 1LABA 4IJHA 5I6WA 1PH9A 1YJ9A 2I5MX 5E3FA 3NQIA 3P7JA 4A3EB 1RTNA 4DR4L 3K8AA 2R7ZH 2ZJRA 4IPGA 1F77A 1C9OA 2PO4A 1PTOH 2JA7B 1AN8A 1PHJA 4IUTA 3IFTA 2HIVA 3ND8A 2ZTCA 3K0XA 1V1PB 1Y1VH 5C4JB 3TEHB 3UE1A 1HNXL 1IBLL 4L6TB 1TIID 3BVZA 2VW9A 1X55A 1UE6A 3J7YW 5EGTA 2I5LX 1PH3A 4V0BA 3I91A 2NVXB 1V1PA 2EYPA 4OEMB 5KNBA 2ZM6Q 1NUCA 1OTCA 3J7AF 3F2CA 2NUCA 3OPOA 2AKWB 4J8QA 1AZPA 1HZBA 1PFBA 3K7AB 1PV4A 3KBGA 4IO9A 1SE4A 3J81i 3RN2A 1KNAA 2F0DA 4HCEA 4C3IG 1KQSA 4BWGB 1I3QH 4P74A 3LX0A 2RHSB 3JAMi 1VQEA 4IUNA 4A3MB 1EZ6A 2B2VC 3TP8A 4LUOA 4BXXH 4JBJA 3URYA 2NB0A 2ALYB 2LXJA 1QE6A 2VUMG 1FGUA 1EY7A 2Q2HA 3AEVA 4BY7H 3H15A 1XMOQ 4A3JH 4C3JH 2WAQE 3MXPA 1I50H 4EQPA 4X66Q 2XVSA 1EFWA 2F0OA 1MJCA 2B39A 2K5VA 1IZ6A 2F3WA 3TZUA 1AE2A 1PYWD 1PLFA 1V8QA 1BCPB 1I3QB 5LMNQ 4EQ5A 1LUZA 3KUPA 4EVOA 2NVTH 4RGMA 3SVMA 1SE8A 5CGKA 1D1IA 3U4VA 4DGZA 3E6ZX 2EY2A 4TQUS 2QDBA 2MP1A 2XIWA 4LF8Q 2K7VA 4A3JB 1QJOA 2IHFA 4JI2Q 1T9HA 4WORA 3PIOA 4BBRG 1NTGA 1ASYA 2RDFA 3J81c 4OO1I 1B4OA 4A3GB 1STAA 3GTQB 3EROA 3BYTB 4X65Q 4R9WA 3JAMc 2HT1A 3T1YQ 1SYDA 1WFQA 3NBHB 4L5QA 4DV7L 2ZXRA 1B50A 3M4OB 4CDEC 2XWJB 3MTSA 3UDFA 2PZWA 2B2YA 4P75A 1LT5D 3IRBA 3NBHA 3MA2B 1WTRA 3GTLB 1EIGA 1ZXTA 2BDNA 3HS0C 1IXRA 2UUBL 2FHTA 3KFUA 3VYSA 1OO9B 2OT2A 2CW0D 2VUMH 3MAQA 3CQZB 3TMEA 1TS5A 3J81j 3CC7A 3K81C 2CWPA 3U58A 3W1GA 1YEZA 3VR4A 3BZDB 1VQFA 3HOVG 3UE0A 3CXCA 1ICWA 2A6EC 1TWGB 3HOXG 1F2ZA 4RKLA 4LF7Q 1AEXA 5M3MG 1TWCB 2QDLA 4FF3A 2JA5B 3KLSA 4JV5Q 1HR0L 1L1OB 4QIWB 2VNUD 4P2CB 2Z6BA 1QVFA 4X3KA 3KDFA 3K0YA 4NDXA 4MTKA 4R4OA 3TN2A 3BS1A 1HNZL 1L1OA 4BBRH 3OWFA 3DUZA 4K8JA 2VQEL 3S17H 4KY7A 3BZCA 1AH9A 1KD1C 5C0XG 1Y1WB 1JE5A 5ELOA 4B3SQ 1CI3M 1EYGA 1QB5D 3DLLA 1D5XC 3FEWX 1STYA 2ZTDA 1F9SA 1AFPA 3TQYA 3JAML 4X3UA 2GN5A 1CTMA 4JK1C 4LFBL 4DPGA 2EJGC 1HJPA 1H9RA 4X64L 1K8GA 3KF6A 1V9PA 4AIMA 3K59A 1I5FA 3WOFA 1EWCA 1LTSD 4NXMQ 3S14B 3CCSA 1Q81C 1LTAD 3CCJA 3A7AB 4NP5A 3TP7A 3KJOA 2G9HD 1PYSB 1HA6A 1J6QA 1WVLA 1SMYC 2NZOA 1E1OA 2IT1A 1EY9A 5FO8B 4GKKL 1K8MA 1ZEQX 2RF4A 2B2UC 4LAAA 2AWNA 4Y7NH 1Q86C 3G6JB 1STHA 5JEAG 4JI1Q 4HIKA 3CAMA 5K5PA 4GN4B 1GUSA 4FO2A 1KTKA 4ID6A 1X32A 1JQYD 1MIUA 5IWAL 4JI7Q 1ZYRC 4IFDI 3S1RH 5C0XH 3HOWB 2PI2A 2KCTA 2QGQA 1B1ZA 4X66L 3J7ZC 1BBXC 3OHXC 3W5OA 1WTVA 2NTTA 2RQXA 4XYQA 2MPMA 3I4MG 3TSSA 4TSSA 1PH1A 4X3SA 3Q8DA 1QZGA 4A3LG 1Q90A 5LMNL 1F9RA 1HPCA 1KL9A 3FVQA 1C8CA 3HKZB 4C56C 3BG3A 5IGDA 4QJFA 1EIHA 4POGA 4R8IA 4GZYC 2EXDA 2IJ0A 2Z1CA 4AQYQ 2VY3A 2XNAC 4JI2L 3B6YA 3U9SA 1S72A 1XNRL 1VQMA 4K6DA 3OMCA 3GTPB 3VDYA 1U0LA 1KABA 3CU7A 2PNRC 4X65L 3A8IE 4GKJQ 2O5JC 2JA8G 1A2UA 2YYZA 4LF9L 1CA6A 3S1MH 1HFNA 1PH6A 4A3DB 4DV6Q 1ET6A 3AYHB 3P75A 2Z9HA 1O7ZA 3RUZA 4CGYB 4K2KA 3RZDH 4PZ8A 3PO2G 1SJED 2A6HC 2SEBD 2NWGA 5JEAH 2E2IH 4DA2A 4GLXA 5IYCH 2E5LQ 1CK1A 1EUJA 1YJNA 2DGYA 1VQ4A 1KRSA 4A3CG 3WWVA 4ZKCB 2BA0A 1TWAH 2JE6I 1JOQA 1WCMB 2IX3A 2N8NA 2A1AA 4UP8A 3KBXA 1WTOA 1LACA 1XNQL 5EPKA 4HJAA 2F0MA 2NVYB 2SNSA 4IPHA 1IL2A 3I4MH 1OXTA 3MEHA 1E22A 2E2IB 4A3LH 4OELB 1TQOA 2EDGA 2A74C 5I2YA 2AUKA 4I7AA 5ISRA 1HTPA 1QVGA 1TY0A 2JQOA 5D14A 1B2TA 2WB1G 3NENA 4GNXB 2R93H 3TRZA 2K28A 1IKLA 2B3GA 1VQIA 4Y52H 2EIFA 3EFXD 4V190 1R4PB 3SK5A 4KY5A 2L55A 4GNXA 2KCCA 1W6JA 2PPBC 3J7A5 1HZ9A 4DUYQ 1GHJA 2GVBA 3DMUA 1X6OA 3PF4A 4B3SL 1JWUD 4FXKC 4A3KB 1D7QA 3KLWA 2F0KA 3VR3A 1GXDC 2Z8LA 4IURA 3HOUG 5CBEE 1UEBA 2HDMA 3SGIA 2RHQB 4OGQC 3GDEA 4JBWA 4ZYSA 2R93B 2N88A 3PO3G 1U4RA 4B3ML 3DEPA 1SFOH 3AFPA 4KK7A 3D6WA 2VQFQ 3GD7A 2MJ8A 3ZYYX 4A3CH 4O0AA 1LM0A 2B2UA 1J5EQ 4CDFC 5IGGA 2V4DA
chains in the Genus database with same CATH topology
3NUCA 2KCNA 2WKCA 1IW7C 1TU2B 3MFGA 4YIJA 3M3YB 4I65A 2F0TA 3M7GA 2WIIB 5E4XA 1E2VA 1YNND 1U4MA 1KNEA 3SHLA 3BDLA 5TSSA 2K1BA 1CHQD 2K32A 2HCIA 2C9OA 5IGEA 5EQ0A 2EYLA 5CC4A 1S5ED 1A15A 2FMCA 3Q22A 1AW7A 4QF4A 4KKUA 1EY5A 1X3PA 3GQBA 2L12A 4XQQA 1SYGA 4DU9A 5KIXA 1H9KA 1JR0D 2FINB 2NN6G 1Z6HA 1PFMA 1RKNA 3TZDA 1QOHA 4PMBA 4A93B 2GA4B 3FPUB 1BCPC 1JORA 2F1MA 3M85A 1JOKA 1UUPA 1YNJD 2PW7A 3NHHA 4A3BB 5KEEA 4K2LA 2DNEA 1AP0A 4BY1B 1BUVT 3MWYW 1T5XD 2B2YC 2EZVA 5DM73 4B9XA 1I6HB 5DAUA 3I4NB 1RDPD 3QB3A 2K03A 1HQMC 1F2YA 5EPJA 2L9HA 4FNFA 2PCFB 3CHBD 4DNTB 5LL6X 1LTRD 3T4AC 3IL8A 2NN6H 5ELFA 1PRTF 5JVH3 5EKKA 5KNDA 2KOLA 1EU3A 2EOTA 2Z4IA 3HOZB 3GTOB 4HSVA 1X3QA 3S15B 1L0YB 2ZXPA 3SR1A 3NWTA 1V43A 2WINB 3D4DA 4RFBA 1D5MC 1Q1BA 4I7ZC 5J39A 3FMCA 2E76C 3V05A 3BVMA 4WFN3 2A69D 1RTOA 4RGNA 1EZ8A 3K57A 5FO7B 2C5CA 3I70A 4CJ2C 4FF2A 2K6AA 1TR5A 3K5OA 3NWSA 3PIO3 4FXGC 5ELEA 4G7OC 3NBIA 2NVQB 1IL8A 4B9WA 3MXUA 5I2XA 2TSSA 1CQFA 1STGA 2ZXOA 4C1NK 2K5WA 4IUVA 2J7ZA 2EYMA 3GTMB 1A3TA 4A3FB 2JEAI 1Q3LA 2DY7A 1SDFA 4O42A 3OOCA 3L9AX 3UI2A 4ZK9B 3R3OA 2H4OA 3QIAA 1S5CD 2BA1A 4G4KA 5I6YA 2F0VA 4XDXA 5HURA 4LK1C 4FVMA 4G7ZC 3WOEA 3CRLC 1I4XA 4CBVA 5M3FB 5BN5A 1EWHA 1RODA 1ET9A 1XTCD 2ICEC 4CJ0B 2JP1A 4ULLA 1SE3A 3S9WA 3D3RA 5G3LF 2K5DA 3HRZC 2G9DA 4XT1B 3D4RA 3TDQA 2KEDA 1VF7A 1KLGD 1EEID 5M9OA 4CHTB 4OO1G 1EEFD 1DM0B 2J0TD 3MXGA 5E4WC 5C4XB 4ZLTF 4F88A 1SXTA 4EQNA 2XWBB 3F2UA 2A68D 1PRTD 3T51B 4KJOA 1U9RA 1G91A 2KVMA 3OMGA 1F2LA 1GUOA 1HHVA 2NZ1D 1HTLD 1EYCA 3RZOB 1NSNS 3NSWA 1GOZA 3NTHA 4KTAA 1SNQA 4L8JA 4IZ8A 1LTTD 4WJWA 3VYRA 1S5BD 1WTXA 1VMPA 1A6XA 1CFMA 2M9VA 4KI0A 5JPNC 1Q8IA 5C5LA 2I46A 4R8NA 2JA6B 2PZTA 2EE1A 3TP6A 3O13A 4KJNA 1R9TB 4OO1H 3J81L 4XIGS 5M5YB 4CKEA 3LNNA 1KLUD 1M4VA 2E2HB 3MVVA 4RCNA 2YU9B 3KLSX 5FO9B 1EY4A 2CW0C 2BDOA 3PUXA 3VYUA 2K33A 4OL7A 4C3HB 3IFDA 1ENCA 1CZWA 3DWAA 2RDHA 1K83B 4CKBA 1WTQA 4DXGA 1EQVA 4XQNA 1SSOA 1Z47A 2Q8IB 4KHZA 5D65A 3HP3A 1G6ZA 1O7YA 3BDCA 1IKMA 3OWEB 3V96A 1I4QA 5LL6S 5BN4A 5CV5A 1LLRD 5G3LD 2LMCB 4HSPA 5FK9C 1JE4A 1GHKA 3GP7A 4IUPA 1PTOF 3PV0A 4BA2I 2AWOA 2L5TA 1DOMA 3L7ZC 4DN4M 5JJZA 5IODA 5E1FA 4IFDG 1STBA 1KDBA 3EA6A 2RSNA 2XRSD 1S5FD 5CR3A 5I9OA 1I4HA 4DAYA 2BOSA 3OSOA 1PZJD 1TWHB 1STNA 3A7LA 4H13C 4QB4A 5CV8A 1LT3D 4DNRB 2Q8RE 4IUQA 5M3MB 2AUJD 1DOLA 1Y8NB 2KUMA 5ELDA 3AMUA 3M4YA 3ONAB 2KQ3A 5KGUA 2EY1A 1QNKA 1EQTA 4BBSB 2F0UA 1GUGA 3GO5A 2CVRA 4ZRZA 5M5WB 2E2JB 3K58A 1EFID 2L1BA 3CKIB 4H7BA 5CYUA 5IGCA 1XWEA 3IAYA 1B9MA 3OIQA 1SEBD 4MIUA 2WP8J 3QOLA 2EYHA 4ZAIA 2B8GA 2N55A 1RCVD 1T5EA 2XN9C 1D1KA 3RD4A 2J4XA 5EPLA 2K5QA 3EQLC 4IFDH 4Z9CB 1IYUA 3H0GB 1TKWB 3NXWA 2WAQB 3NPPA 3T16A 3Q6SA 3GTJB 3Q0AA 4RWSC 1HUMA 3I72A 1OXVA 5J1ZA 1PRTB 5AFWA 1EY6A 3SE0A 2JSOA 1E2WA 1SNCA 5JOBA 3I90A 4BS9A 3OW7A 3EVQA 5A2QL 1RJTA 2PQEA 1QWYA 1B3AA 1SNOA 1R4QB 5BN3A 3T53B 3FPPA 5C0XJ 2WKDA 1EOTA 2RKSA 4HTHA 4O1NA 1PTOD 5CV9A 4DAVA 2DN8A 1QCBD 4K5WA 4TKOB 4ZQ3A 2DY8A 4RA8A 1TS3A 3C1FA 1RHPA 2R3ZA 3A8JE 3H6MA 4UAIA 4H0LC 3QG1A 3FRPB 1RD9D 2K05A 1J9OA 2AQ1B 2DNCA 3E5SA 1BCPD 1MSGA 4M1UB 2XSCA 4AYBB 5A35A 1MD2D 2PZUA 1NAPA 1DONA 1G8ZD 2BE5D 1VDZA 1LTGD 3PO2B 1LV9A 3LWEA 3A54A 5JEAJ 1AZQA 3NTKA 4XT3B 3D31A 4DK0A 1LTID 3OIPA 5IT9L 3K5MA 3J7AV 3D6CA 3S2DB 1FNVA 1FNWA 1O7LA 5IIFA 2WV6D 3W3AA 2KECA 1B53A 5M5XB 4C1NI 3S16B 2KA7A 1PXUA 1UEAB 1OXSC 1CQVA 2R92B 5T1GA 1YNNC 2PMZB 3X3MA 3DXJC 2RVLA 4QCLA 1K8OA 1ZKOA 2F0IA 1H9JA 3W2DA 4HMJA 2IX1A 2HDLA 1E0BA 4FF4A 1GUNA 1B44D 3PO3B 2EJFC 2K01A 1IYVA 3ND9A 1FYCA 1BF4A 5C4HA 2R61A 2LY7A 1D2BA 3FKIB 3J81E 1HA5A 3D8GA 1SE2A 3JAME 1TS2A 3U9OA 2F0WA 1WD1A 1BDOA 3HOYB 2B2WC 3K5NA 2SNMA 3N52A 4ZUIA 4QMGA 1WD0A 3NP8A 1OXUA 3RMHA 1MGSA 1CZGA 1NR2A 2L11A 1DZ1A 5ELCA 2OEOA 5T1IA 3DEOA 4BA1I 3HG9A 5COYA 3X3NA 1PZKD 1YNJC 3NTIA 3LWUA 4WRDA 3NK9A 4DAPA 1BXTA 1Q12A 1SNPA 2MUYA 3Q24A 2SDFA 1SBBB 2A5HA 5FLXL 1O78A 3PUZA 5D3IB 4K5VA 5DEHA 4KN7C 3S1QB 5C5MA 4B08A 3VYTA 1VCIA 2EXZA 4HMIA 2CQAA 3MC0B 4XXEA 2RDGA 4MN3A 5K36H 1F9QA 4RCOA 1PZID 2IX0A 4A3IB 4MHEA 1B9NA 1TWFB 1TY2A 1OXXK 1Y8PB 2FMMA 3H91A 3VR2A 2HQEA 1EYDA 3AB9A 1GUWA 2KHSA 3G7LA 1KDCA 1ML0D 5I4DA 2WACA 1II3A 4KKTA 5KRUA 2R7ZB 1CHPD 2D9UA 2X6LA 1PTOB 2EYOA 5FOBB 2D62A 4U673 5EJWA 2B63B 1Y1VB 4TRDA 5C3EB 1IHZA 2A69C 3NE5B 1H9MA 2IWHA 1ENFA 5I9PA 3KF8A 5JVG3 2HCCA 3I4LA 4PNYA 4FF1A 2ICIA 4EGVA 3R93A 1MBYA 5EBDA 4ILWA 3QOJA 2NBFA 4IN3A 2EJMA 5D3DA 3DWQA 3SK6A 4C3HG 3A8KE 3H3VC 1KAAA 2IL8A 2A6ED 1I4RA 2M2LA 5KYIA 2NYZD 4NKLA 2F4IA 1QILA 3ERQA 5CBAE 4BY7B 4C3JB 1I50B 1JWMD 2F0QA 1I4PA 1VMCA 5LHY1 3BDOA 1I6VC 4NW2A 2EPBA 5KYLA 4M8AA 1M8AA 4F87A 1HQRD 3PUVA 2NVTB 1GJXA 4Q5VA 2Q8TA 2QILA 3I73A 4RKBA 3S1NB 2Z4HA 1DXMA 5CV4A 3BYYB 4HAEA 1Y69U 2B2WA 3DM1A 5A2QE 5F2DA 2R6GA 2VB3X 4G7HC 4S3SA 4ABNA 1SMYD 4C3IB 3EJIA 3MHBA 1S4ZA 5C3WA 3M7NA 1S5DD 2VUMB 2A68C 1PRTC 4IALA 1E2ZA 3DHQA 2IW3A 4XQJA 3NQTA 4RAUC 5C0XI 1D5ZC 1ENAA 1MSHA 2F0LA 4J6HA 1PMRA 1ZYRD 1CT1D 2OF1A 4RHSA 2OXPA 4DF7A 1BNZA 2F0SA 2O4XA 5HGTA 4K6LA 3C2PA 2CHBD 4X3TA 3BVGA 3H09A 4FP5D 2QKIC 5JPMC 3J80L 1DD2A 1XXGA 1ILQA 3SK4A 1BOSA 3CRKC 4BBRB 2ENBA 1D6EC 3S17B 4L63B 2RSOA 4DXFA 2QCPX 3MZ5A 4KKSA 2JYOA 3I3CA 5IT9E 3GV6A 2E2DC 2E74C 3VR6A 4K14A 4FYDA 3QWNA 2B2VA 2K04A 5DNFA 1DCZA 1LO5D 1QG7A 5EBCA 3R8BA 3SDZA 2IPKD 2F0EA 4HR7B 4ODGA 5CV6A 5C3XA 1SNDA 3VA7A 1JOOA 1JCKB 3TP5A 2A6HD 3HGBA 1F9PA 1STEA 1ONLA 2F0PA 3PUYA 5NUCA 3HOVB 2F03A 1BCPF 3MXNA 3SEBA 2F0GA 3HOXB 3A56A 1UNSA 4Y7NB 5CORA 4OIKA 2F0NA 1LT4D 1EYAA 1BQQT 2F3VA 3AU7A 5DM63 4PV1C 2B2TC 4HCSA 1JWSD 2FJ2A 3N6RA 2AQ2B 3S1RB 2ZT9C 1TT2A 4N9PA 4KN4C 3GV3A 4RH6A 3K6OA 1HRJA 2EY5A 4QUCA 2EYJA 4ZUJA 4PQXA 5IGBA 3FDTA 2VB2X 3R2TA 3C1EA 1KDAA 4H44C 2HUGA 1DYQA 1FR3A 4KHVA 3HEJA 1SYFA 4U68A 1G2SA 1Z7TA 4KV6A 3MFYA 3KK7A 1NCVA 1CM9A 4KY6A 1ESRA 4K5XA 4IQZA 5FLXE 2NTSA 3S1MB 5IOCA 1DJRD 3RZDB 1C4QA 1IW7D 5KNCA 1F2MA 4HEDA 5EKIA 2PW5A 3P1HA 2L4NA 1WTWA 3Q23A 2KJXA 4FXDA 1TWAB 3IKJA 1U4LA 2M00A 1SJHD 2LS01 2B8FA 3GTGB 4RGTA 3I4MB 1HFGA 5C6AA 5C4ZA 1UAPA 1JB3A 5J22A 3SXHA 1LTBD 1PDQA 2JEBI 4J1MA 1L0XB 1ILPA 2F0HA 1U4PA 4EQOA 4QUFA 2FFKB 3QO2A 1XX8A 2L0CA 4XYOA 4RHRA 3VA5A 4DFAA 4ZKBB 2JA8B 1A3UA 2D5DA 4F8MA 4DK1A 1Q1EA 2SOBA 5JAVA 1HUNA 2O5IC 2XRQD 1BR9A 4KD3A 1LT6D 1O80A 1SYCA 2MHVA 2BCOA 1SYBA 1FGBD 4LJZC 3KLRA 1SFOB 1TS4A 4IUUA 3PMFA 3ITPA 4CKCA 1FD7D 2D2CC 2O2LD 4KD4A 1PTOC 2MGSA 1QNUA 4K8IA 2E75C 1W6KA 1GUTA 2H1EA 4NMZA 4IFDJ 3E0JA 1RF2D 4E6IA 1NR4A 4RGOS 2NN6I 1PFNA 5CV7A 3QJYA 3RLFA 2JXMB 3T56B 5EKLA 4ME5A 2I07B 2B2TA 2TMPA 1XYIA 5IGFA 1FNUA 3A55A 2WB1B 4N9TA 4OIJA 2EYFA 3P20A 3VR5A 4KMUC 3C46A 2LFNA 5C44B 1V1OA 1SAPA 3L3OC 2PYKA 2EY6A 3PIP3 2QEJC 3K5LA 1G2TA 1HXYD 5ELBA 2LKVA 3HZXA 2BE5C 3C3LA 4XTCS 3HOUB 2RBMA 1JICA 5K36G 1VF5C 1Y8OB 3DWPA 1A3VA 2AQ3B 1EU4A 1SYEA 1H9SB 5FKAC 1G291 2X6GA 3R2IA 4C2MB 4G57A 3S2HB 1H9SA 4HN7A 2ID0A 1HCZA 1J8IA 4F7XA 2F0JA 1SNMA 2A73B 1BO0A 3PUWA 3GTKB 3T13A 4OHJA 1MI2A 2X69A 4PMWA 4PMCA 1JC7A 4UDUC 2F0FA 3TBIB 1EL0A 1EY8A 3D4WA 2EVBA 3I8ZA 5CMDA 1I4GA 2RA4A 1C48A 3J80E 1WTPA 3V2TA 1DOKA 2KEEA 1A2TA 4Q0FA 1TVXA 4C3JG 2VXWA 2Y0SB 4CJ1B 4LMQD 3SK8A 1ESFA 3WDNA 1CA5A 3H94A 1EY0A 2QF7A 1LABA 5I6WA 5E3FA 3NQIA 3P7JA 4A3EB 1RTNA 1F77A 2PO4A 1PTOH 2JA7B 1AN8A 4IUTA 3IFTA 3ND8A 1V1PB 5C4JB 4L6TB 1TIID 3BVZA 3J7YW 5EGTA 4V0BA 3I91A 2NVXB 1V1PA 2EYPA 5KNBA 1NUCA 3J7AF 2NUCA 3OPOA 4J8QA 1AZPA 1PFBA 3K7AB 3KBGA 1SE4A 1KNAA 2F0DA 4HCEA 4C3IG 4BWGB 3LX0A 4IUNA 4A3MB 1EZ6A 2B2VC 3TP8A 3URYA 2NB0A 1QE6A 1EY7A 3MXPA 4EQPA 2XVSA 2F0OA 2B39A 2F3WA 3TZUA 1PYWD 1PLFA 1V8QA 1BCPB 1I3QB 3KUPA 4EVOA 4RGMA 3SVMA 5CGKA 1D1IA 4DGZA 3E6ZX 2EY2A 4TQUS 2QDBA 2MP1A 2XIWA 2K7VA 4A3JB 1QJOA 4WORA 2RDFA 4OO1I 1B4OA 4A3GB 1STAA 3GTQB 3EROA 3BYTB 4R9WA 1SYDA 2ZXRA 1B50A 3M4OB 2XWJB 3MTSA 2PZWA 2B2YA 1LT5D 3NBHA 3MA2B 1WTRA 3GTLB 1EIGA 1ZXTA 2BDNA 3HS0C 2FHTA 3VYSA 1OO9B 2OT2A 2CW0D 3MAQA 3CQZB 3TMEA 1TS5A 3VR4A 3BZDB 1ICWA 2A6EC 1TWGB 1F2ZA 4RKLA 1AEXA 1TWCB 4FF3A 2JA5B 3KLSA 2VNUD 4QIWB 4P2CB 4X3KA 3K0YA 4NDXA 3TN2A 3BS1A 3OWFA 3DUZA 4K8JA 4KY7A 5C0XG 1Y1WB 1CI3M 1QB5D 1D5XC 3FEWX 1STYA 1F9SA 1AFPA 3JAML 4X3UA 1CTMA 4JK1C 2EJGC 1H9RA 3K59A 3WOFA 1EWCA 1LTSD 3S14B 1LTAD 3A7AB 4NP5A 3TP7A 2G9HD 1HA6A 1WVLA 1SMYC 2IT1A 1EY9A 5FO8B 1K8MA 1ZEQX 2B2UC 4LAAA 2AWNA 3G6JB 1STHA 5JEAG 5K5PA 1GUSA 4FO2A 1KTKA 4ID6A 1X32A 1JQYD 1ZYRC 4IFDI 5C0XH 3HOWB 1B1ZA 1BBXC 3OHXC 1WTVA 2NTTA 2RQXA 4XYQA 2MPMA 3TSSA 4TSSA 4X3SA 1Q90A 1F9RA 1HPCA 3FVQA 1C8CA 3HKZB 4C56C 3BG3A 5IGDA 1EIHA 4R8IA 4GZYC 2IJ0A 2Z1CA 2XNAC 3U9SA 4K6DA 3OMCA 3GTPB 1KABA 3CU7A 2PNRC 3A8IE 2O5JC 1A2UA 2YYZA 1CA6A 1HFNA 4A3DB 1ET6A 3P75A 3RUZA 1O7ZA 4CGYB 4K2KA 1SJED 2A6HC 2SEBD 2NWGA 5JEAH 4DA2A 1CK1A 4ZKCB 2BA0A 2JE6I 1JOQA 1WCMB 2IX3A 3KBXA 1WTOA 1LACA 5EPKA 2F0MA 2NVYB 2SNSA 1OXTA 3MEHA 2E2IB 1TQOA 5I2YA 2EDGA 2A74C 2AUKA 5ISRA 1HTPA 1TY0A 5D14A 1B2TA 2K28A 1IKLA 3EFXD 4V190 1R4PB 3SK5A 4KY5A 2L55A 2KCCA 1W6JA 2PPBC 1GHJA 3DMUA 1JWUD 4FXKC 4A3KB 2F0KA 3VR3A 1GXDC 2Z8LA 4IURA 5CBEE 2HDMA 4OGQC 4JBWA 4ZYSA 2R93B 2N88A 1U4RA 3DEPA 4KK7A 3D6WA 3GD7A 2MJ8A 3ZYYX 2B2UA 5IGGA 2V4DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S5C D;  1CQV A;  2NTS A;  2O2L D;  2QIL A;  1PTO C;  1ET6 A;  1TY2 A;  3MFG A;  1DJR D;  1LT3 D;  3CHB D;  1RF2 D;  1ESF A;  1EWC A;  1LO5 D;  1LTS D;  1SJE D;  2SEB D;  1LTR D;  3O13 A;  5ELD A;  3BYY B;  4RGO S;  1I4X A;  1PTO D;  4O1N A;  3R8B A;  1LTA D;  3BYT B;  2IPK D;  5ELF A;  1ET9 A;  1XTC D;  1PRT F;  1CK1 A;  1JCK B;  5TSS A;  2G9H D;  1FNU A;  1STE A;  1EFI D;  1CHQ D;  5I4D A;  3W2D A;  1SE3 A;  1EU3 A;  1F77 A;  1KLU D;  1M4V A;  1TS3 A;  1S5E D;  1PTO H;  1AN8 A;  1B44 D;  1CHP D;  1BCP F;  1LT5 D;  3SEB A;  1PTO B;  1V1O A;  1V1P B;  1AW7 A;  3KLS X;  2R61 A;  1L0Y B;  1RD9 D;  1SJH D;  1UNS A;  1SEB D;  4L6T B;  3BVZ A;  1KLG D;  1HA5 A;  1EEI D;  4RFB A;  4RGT A;  1D5M C;  2AQ1 B;  2QEJ C;  1HXY D;  1EEF D;  1JR0 D;  1S5D D;  1SE2 A;  1ENF A;  1BCP D;  5ELB A;  1V1P A;  1TS2 A;  1LTB D;  1RCV D;  1KTK A;  1PRT C;  1TS5 A;  1LT4 D;  1MD2 D;  2RDH A;  2XN9 C;  3BVM A;  3DWA A;  3V05 A;  1TY0 A;  4RGN A;  1SXT A;  1L0X B;  2ICI A;  1JQY D;  4DXG A;  3BZD B;  1G8Z D;  2J4X A;  1PRT D;  3DWP A;  1JWS D;  1SE4 A;  1D5Z C;  1LTG D;  3OWE B;  2AQ3 B;  4Z9C B;  1B1Z A;  1I4Q A;  3EFX D;  2AQ2 B;  4BWG B;  1EU4 A;  5ELE A;  1BCP C;  5FKA C;  5D3D A;  5ELC A;  1LLR D;  1CT1 D;  3DWQ A;  4RHS A;  2NTT A;  3R2I A;  4RH6 A;  3TSS A;  1I4R A;  4RHR A;  1PZK D;  4TSS A;  1HTL D;  1JWU D;  3URY A;  5FK9 C;  2Z8L A;  1LTI D;  3GP7 A;  4K6L A;  1GOZ A;  1UUP A;  2CHB D;  1PTO F;  1PRT B;  1QIL A;  3BVG A;  4C56 C;  2TSS A;  1BXT A;  1XXG A;  1SBB B;  4ZYS A;  1JWM D;  2IJ0 A;  1FNV A;  2XRQ D;  1FNW A;  1LT6 D;  5D3I B;  1LTT D;  3R2T A;  1D6E C;  1I4P A;  2XNA C;  4L63 B;  4OHJ A;  2WV6 D;  1PYW D;  1T5X D;  3EA6 A;  4DXF A;  1FGB D;  1BCP B;  2XRS D;  1S5B D;  1D5X C;  1TS4 A;  4UDU C;  3MC0 B;  1S5F D;  1DYQ A;  2RDG A;  1I4H A;  1HQR D;  4RGM A;  4RCO A;  1PZI D;  1I4G A;  1PZJ D;  1FD7 D;  1RDP D; 
#chains in the Genus database with same CATH topology
 3NUC A;  2KCN A;  2N78 A;  2WKC A;  3NEL A;  1IW7 C;  1TU2 B;  3MFG A;  4YIJ A;  3I56 A;  3M3Y B;  5AJ3 L;  4I65 A;  2F0T A;  3M7G A;  2WII B;  5E4X A;  1E2V A;  1YNN D;  1U4M A;  1KNE A;  3SHL A;  3A5U A;  3G71 A;  3BDL A;  1EWI A;  5TSS A;  2ASB A;  4JYA L;  2K1B A;  4JI1 L;  2UU9 Q;  1CHQ D;  2K32 A;  2HCI A;  3CCL A;  2C9O A;  5IGE A;  3F1Z A;  5EQ0 A;  3CCQ A;  2EYL A;  5JJK A;  3EBE A;  5CC4 A;  1S5E D;  5C44 H;  2Y0S G;  1A15 A;  2FMC A;  3Q22 A;  5IY0 A;  1AW7 A;  4QF4 A;  4KKU A;  1EY5 A;  1X3P A;  3GQB A;  1TXY A;  1BKB A;  2L12 A;  4DV5 L;  4XQQ A;  1SYG A;  4DU9 A;  5KIX A;  1H9K A;  1JR0 D;  2FIN B;  2NN6 G;  3STB C;  2UXD Q;  1Z6H A;  3ULL A;  1K8A C;  3HOU H;  1PFM A;  1RKN A;  1Q7Y C;  1WOC A;  4A3E G;  3TZD A;  1QOH A;  4LFA L;  4A3I G;  1KRT A;  4PMB A;  4BY1 H;  4OX9 Q;  2JA7 G;  4A93 B;  2GA4 B;  2K50 A;  4OWT B;  3FPU B;  5JJL A;  4H02 A;  2K5N A;  1BCP C;  1JOR A;  4C2M H;  2F1M A;  1SMX A;  4R4T A;  1EIF A;  1O7I A;  3M85 A;  3S2H H;  1JOK A;  4IPD A;  1Q82 C;  5GAE C;  3E3X A;  1UUP A;  2LXK A;  1NY4 A;  1YNJ D;  2PW7 A;  3NHH A;  2MNA A;  4A3B B;  5KEE A;  4PZ7 A;  3GTK H;  4K2L A;  2DNE A;  1GO3 E;  1AP0 A;  4DV6 L;  4BY1 B;  1BUV T;  3MWY W;  1T5X D;  4QY7 A;  1S3O A;  4YWM A;  2B2Y C;  3F8T A;  2EZV A;  5DM7 3;  4K0K Q;  2E5L L;  4B9X A;  1I6H B;  5DAU A;  3D0F A;  1C7Y A;  3I4N B;  1RDP D;  3QB3 A;  2K03 A;  1HQM C;  3HOZ H;  1CKM A;  2GVA A;  1F2Y A;  5EPJ A;  3GTO H;  2L9H A;  2MO1 A;  3AQQ A;  4FNF A;  2PCF B;  3CHB D;  4DNT B;  1BBU A;  5FJ8 H;  3UDG A;  5LL6 X;  1LTR D;  4YWK A;  3T4A C;  3CCM A;  3IL8 A;  2NN6 H;  4WJ3 M;  1XMQ L;  5ELF A;  1PRT F;  5FLM G;  5JVH 3;  4A3E H;  5EKK A;  3OTO Q;  5KND A;  1XPO A;  4GS3 A;  1CSQ A;  4BXX G;  2KOL A;  1EU3 A;  4DV2 Q;  2EOT A;  2Z4I A;  1XPR A;  5EAY A;  2UUA L;  3HOZ B;  4A3J G;  3GTO B;  5C4J H;  4HSV A;  2PI2 E;  4JI5 Q;  1X3Q A;  5HGQ A;  3S15 B;  2I5H A;  1L0Y B;  4JI4 Q;  2ZXP A;  2HQL A;  3SR1 A;  3NWT A;  1V43 A;  2WIN B;  3D4D A;  4DR5 Q;  4A3G G;  4RFB A;  1D5M C;  2ZJP A;  1Q1B A;  1MKH A;  4I7Z C;  5J39 A;  4DUY L;  3FMC A;  2E76 C;  3V05 A;  3BVM A;  4DK3 C;  2A69 D;  4WFN 3;  1RTO A;  4RGN A;  1EZ8 A;  3K57 A;  5FO7 B;  3K7A H;  2C5C A;  3I70 A;  4CJ2 C;  4FF2 A;  2K6A A;  4JI3 Q;  3GTM H;  1TR5 A;  1NE3 A;  3K5O A;  3NWS A;  3PIO 3;  1QUQ B;  1VQ8 A;  1Y14 B;  5BR8 L;  4FXG C;  5ELE A;  4G7O C;  4A3M H;  1WYD A;  3RR5 A;  3NBI A;  2NVQ B;  1IL8 A;  3PIP A;  1GD7 A;  4B9W A;  1N36 Q;  1QUQ A;  3MXU A;  4PZ6 A;  3CP0 A;  5I2X A;  1JJ2 A;  2TSS A;  1CQF A;  1STG A;  1X3E A;  1J5E L;  3TS2 A;  2ZXO A;  4QQB X;  4C1N K;  2LSS A;  2K5W A;  4IUV A;  2J7Z A;  3HKS A;  1E1T A;  2EYM A;  4R4I A;  1A3T A;  4OWX B;  3GTM B;  4A3F B;  4HJ7 A;  2JEA I;  1HZC A;  5FLM H;  1Q3L A;  2DY7 A;  1SDF A;  4JC0 A;  2JA5 G;  4O42 A;  3OOC A;  3L9A X;  2JA9 A;  3UI2 A;  4ZK9 B;  4DR1 L;  3R3O A;  2H4O A;  3QIA A;  4GLV B;  4DK6 C;  4GOP C;  4HJ9 A;  1S5C D;  2BA1 A;  4G4K A;  4B3R L;  5I6Y A;  2F0V A;  4XDX A;  5HUR A;  4UP7 A;  4LK1 C;  3KF8 B;  4FVM A;  4G7Z C;  4P72 A;  3WOE A;  3CRL C;  4A3G H;  5E7N A;  3GTQ H;  1Y1W G;  1K9M C;  1I4X A;  4CBV A;  5M3F B;  5BN5 A;  1EWH A;  4LWC A;  1ROD A;  1ET9 A;  1XTC D;  2ICE C;  4JI0 L;  2ES2 A;  3HFZ B;  3J80 i;  4MTN A;  4CJ0 B;  5IYB H;  3M4O H;  2UXD L;  2JP1 A;  4ULL A;  1SE3 A;  3S9W A;  1VQB A;  3D3R A;  5G3L F;  3GTL H;  2K5D A;  3HRZ C;  2G9D A;  4XT1 B;  3D4R A;  4LFC Q;  3TDQ A;  2KED A;  1VF7 A;  1KLG D;  1EEI D;  5M9O A;  2CQO A;  4CHT B;  4OO1 G;  1EEF D;  3CQZ H;  2UUC Q;  1DM0 B;  2J0T D;  3MXG A;  2BH8 A;  5E4W C;  5C4X B;  4ZLT F;  3FHW A;  4F88 A;  2ATW A;  1SXT A;  4EQN A;  2XWB B;  3F2D A;  3F2U A;  2A68 D;  1PRT D;  1TWG H;  1GKH A;  3T51 B;  4KJO A;  1TWC H;  2UXB L;  1LTL A;  4HIM A;  1U9R A;  2JA5 H;  1G91 A;  2KVM A;  3OMG A;  1F2L A;  1GUO A;  3G4S A;  1HHV A;  1YZ6 A;  2NZ1 D;  1HTL D;  1EYC A;  1SR3 A;  3RZO B;  1NSN S;  1C0A A;  3NSW A;  1GOZ A;  3NTH A;  1NJI C;  4KTA A;  1SNQ A;  4L8J A;  4LF4 Q;  4IZ8 A;  4R4C A;  3G48 A;  1Y1W H;  4LF5 L;  2UXC Q;  1LTT D;  4WJW A;  4AYB E;  3ULP A;  3M9B A;  3VYR A;  1S5B D;  2F3I A;  3H3V I;  1WTX A;  3CCU A;  1VMP A;  2R7F A;  1A6X A;  1CFM A;  2XTI A;  2OTL A;  2R7D A;  2YTV A;  1X9N A;  5JJI A;  2M9V A;  4KI0 A;  5JPN C;  1Q8I A;  5C5L A;  3HKZ G;  2YU9 H;  2I46 A;  4R8N A;  2JA6 B;  2PZT A;  2EE1 A;  3S14 H;  3TP6 A;  1IBM L;  1UWV A;  3O13 A;  4KJN A;  1R9T B;  4OO1 H;  3I4O A;  1FJG Q;  1N32 Q;  5GAD C;  4JI4 L;  1ASZ A;  3J81 L;  4XIG S;  4DR5 L;  5M5Y B;  4YY3 L;  1VQK A;  4GNX C;  4CKE A;  3F2B A;  2KCM A;  3LNN A;  3M4P A;  1KLU D;  1M4V A;  5LMU Q;  4A3D G;  5GAG C;  2E2H B;  3MVV A;  4RCN A;  2YU9 B;  2EQS A;  3KLS X;  4JW0 A;  5FO9 B;  2F4V Q;  1EY4 A;  2CW0 C;  2JK8 A;  2BDO A;  3PUX A;  3VYU A;  2WB1 E;  2K33 A;  4OL7 A;  4C3H B;  3IFD A;  2NZH A;  1CSP A;  1ENC A;  2N3S A;  1CZW A;  2PMZ E;  4IOC A;  2XGT A;  3DWA A;  2RDH A;  1K83 B;  2CH4 W;  4CKB A;  1WTQ A;  1N36 L;  4DXG A;  1EQV A;  4XQN A;  1M90 C;  1SSO A;  1Z47 A;  2Q8I B;  2ZM6 L;  4GOP B;  2Q2U A;  3HOW H;  4KHZ A;  5D65 A;  3HP3 A;  1G6Z A;  1O7Y A;  3BDC A;  1IKM A;  3OWE B;  3V96 A;  1I4Q A;  5LL6 S;  5GAH C;  5BN4 A;  5CV5 A;  1LLR D;  4GOP A;  1SN8 A;  5G3L D;  2LMC B;  4HSP A;  3RLO A;  5IYC G;  5FK9 C;  1JE4 A;  1GHK A;  3GP7 A;  1VQA A;  4IUP A;  2K5H A;  1PTO F;  4X62 Q;  2HHH Q;  2DUD A;  3PV0 A;  4BA2 I;  2AWO A;  2L5T A;  3NEM A;  1PFS A;  4YHH Q;  1DOM A;  3L7Z C;  1H95 A;  1HNW Q;  3ER0 A;  1XMO L;  4DN4 M;  5JJZ A;  5IOD A;  5E1F A;  2KHI A;  4DAY B;  3CME A;  4BBS H;  4IFD G;  1STB A;  1KDB A;  3QR8 A;  4TVA B;  3GTP H;  3EA6 A;  2RSN A;  2XRS D;  3W1B A;  2E2J H;  1S5F D;  5CR3 A;  5I9O A;  1FL0 A;  1I4H A;  4DAY A;  2BOS A;  4A3K G;  3OSO A;  1VQN A;  1PZJ D;  1TWH B;  1KHI A;  1STN A;  4A3D H;  3A7L A;  4H13 C;  4QB4 A;  5CV8 A;  1LT3 D;  3K7U C;  4DNR B;  2Q8R E;  2R93 G;  4IUQ A;  4DV4 Q;  1L2F A;  5M3M B;  2AUJ D;  1DOL A;  4LF8 L;  1Y8N B;  2KUM A;  5ELD A;  3AMU A;  3M4Y A;  3ONA B;  2KQ3 A;  5KGU A;  2EY1 A;  3I2Z A;  1QNK A;  1EQT A;  4BBS B;  2F0U A;  1GUG A;  3GO5 A;  2CVR A;  3TRE A;  4DAM A;  2Y0S E;  4ZRZ A;  4LF6 Q;  4R4Q A;  4UPA A;  5M5W B;  1QVC A;  4CDD C;  2E2J B;  3K58 A;  1JMC A;  1EFI D;  1VS0 A;  2L1B A;  3CKI B;  1VQC A;  3T1Y L;  4H7B A;  1WCM H;  5CYU A;  5IGC A;  1XWE A;  2NVY H;  3IAY A;  3L0O A;  1B9M A;  3E9I A;  3OIQ A;  3I7F A;  1SEB D;  1VQP A;  4MIU A;  3GTJ H;  1JJG A;  1VQL A;  2WP8 J;  3QOL A;  3UDI A;  2EYH A;  4ZAI A;  2B8G A;  2N55 A;  1RCV D;  1T5E A;  2XN9 C;  4LUZ A;  1D1K A;  3RD4 A;  4B3T Q;  1SRO A;  2J4X A;  5EPL A;  2K5Q A;  3EQL C;  4EX5 A;  4IFD H;  4LF4 L;  4Z9C B;  1IYU A;  3H0G B;  1TKW B;  3NXW A;  1EQR A;  1YNX A;  2WAQ B;  1D8L A;  3NPP A;  2UXC L;  3T16 A;  2OWO A;  1X54 A;  1JT8 A;  1HR0 W;  3Q6S A;  4A3K H;  3CF5 A;  1XTD A;  4LF7 L;  3GTJ B;  2H5X A;  3Q0A A;  4RWS C;  1HUM A;  3I72 A;  4DV3 Q;  1OXV A;  2QEX A;  5J1Z A;  4JV5 L;  1PRT B;  4A75 A;  5AFW A;  5GQO A;  1EY6 A;  3SE0 A;  2JSO A;  1E2W A;  1SNC A;  1G51 A;  4A93 G;  5JOB A;  5C44 G;  4A4I A;  4UP9 A;  3I90 A;  4BS9 A;  4JI6 Q;  1E7Z A;  1FJG L;  3OW7 A;  3EVQ A;  2G5D A;  5IT9 c;  5A2Q L;  1RJT A;  2PQE A;  1QWY A;  1B3A A;  1SNO A;  1R4Q B;  5BN3 A;  3T53 B;  4A3B G;  4P71 A;  3M3Y H;  3CC2 A;  3FPP A;  5C0X J;  5GRO A;  4JBK A;  4BY1 G;  4JOI A;  2WKD A;  1EOT A;  2RKS A;  2F4V L;  4HTH A;  4O1N A;  1PTO D;  1B7Y B;  5CV9 A;  1PH8 A;  4NXM L;  4DAV A;  4L5S A;  3ERS X;  2DN8 A;  1CKO A;  4AH6 A;  4LW1 A;  2AHO B;  1QCB D;  4K5W A;  4TKO B;  3I4N G;  4ZCK A;  4ZQ3 A;  2DY8 A;  4RA8 A;  3BJU A;  3CC4 A;  1TS3 A;  3C1F A;  1RHP A;  2R3Z A;  1HNX Q;  2YTX A;  3A8J E;  1IBL Q;  3H6M A;  4UAI A;  1VQ6 A;  4H0L C;  3QG1 A;  3FRP B;  1RD9 D;  2K05 A;  5DLQ E;  1J9O A;  2AQ1 B;  4UY8 C;  4LNQ A;  2DNC A;  3E5S A;  1BCP D;  1MSG A;  4M1U B;  1K28 A;  2XSC A;  1RL2 A;  4AYB B;  5A35 A;  1MD2 D;  2PZU A;  1KXL A;  1JB7 A;  1NAP A;  1PVO A;  1DON A;  1G8Z D;  4A93 H;  2HHH L;  2BE5 D;  3HOZ G;  1VDZ A;  1LTG D;  3PO2 B;  4JI7 L;  1LV9 A;  3LWE A;  3A54 A;  5JEA J;  2CKZ B;  1AZQ A;  3NTK A;  4XT3 B;  5FJ8 G;  1E3P A;  3D31 A;  3MEF A;  1VQH A;  5LMN W;  4DK0 A;  1LTI D;  3OW2 A;  3OIP A;  5IT9 L;  4A3B H;  1PYB A;  5L37 A;  3K5M A;  3J7A V;  1NMG A;  3D6C A;  4MNO A;  4DNI A;  3S2D B;  1FNV A;  1FNW A;  1O7L A;  5IIF A;  2WV6 D;  2MFI A;  3W3A A;  2KEC A;  1B53 A;  4DV4 L;  5M5X B;  4AQY L;  4C1N I;  3S16 B;  2KA7 A;  1I6H H;  5IP9 H;  1PXU A;  1JJC B;  1RIP A;  3I4N H;  2ZJQ A;  4MZ9 A;  3TS0 A;  4GKJ L;  1A8V A;  1XJV A;  1UEA B;  5FLX c;  1OXS C;  1CQV A;  2R92 B;  5T1G A;  1YNN C;  2PMZ B;  3X3M A;  3DXJ C;  4A3F G;  2RVL A;  4QCL A;  1K8O A;  1ZKO A;  2OTJ A;  4A3M G;  1NBW A;  2F0I A;  1H9J A;  3W2D A;  1N8R C;  4HMJ A;  2IX1 A;  1N33 Q;  2HDL A;  1VQ5 A;  1E0B A;  4FF4 A;  1GUN A;  3EIV A;  1B44 D;  3PO3 B;  2EJF C;  2K01 A;  1IYV A;  3S15 H;  2UUB Q;  3ND9 A;  4JVZ A;  1FYC A;  1GM5 A;  1BF4 A;  5C4H A;  2R61 A;  2LY7 A;  1KC8 C;  1D2B A;  3FKI B;  3J81 E;  1HA5 A;  3E9H A;  3D8G A;  1YHB A;  1SE2 A;  3JAM E;  1TS2 A;  3U9O A;  2F0W A;  1WD1 A;  3AFQ A;  1BDO A;  3S24 A;  3HOY B;  2B2W C;  4P73 A;  3CPW A;  3K5N A;  2SNM A;  3N52 A;  4ZUI A;  4QMG A;  1UE5 A;  1WD0 A;  2MQH A;  3NP8 A;  1OXU A;  3RMH A;  2QW7 A;  1MGS A;  1CZG A;  1NR2 A;  2L11 A;  2NVQ H;  1HR0 Q;  1DZ1 A;  5ELC A;  2OEO A;  2B29 A;  3DEO A;  5T1I A;  4BA1 I;  3HG9 A;  2WFW A;  5COY A;  3X3N A;  1PZK D;  1YNJ C;  4QL5 A;  3NTI A;  4JI6 L;  3LWU A;  5C4X G;  4WRD A;  2VQE Q;  3NK9 A;  4DAP A;  5IYB G;  1BXT A;  1Q12 A;  1SNP A;  2MUY A;  3Q24 A;  2CCZ A;  2SDF A;  1SBB B;  1A62 A;  3KOJ A;  2A5H A;  5FLX L;  4A3F H;  1EQQ A;  1O78 A;  3PUZ A;  5D3I B;  4K5V A;  5DEH A;  4KN7 C;  1VQ7 A;  3S1Q B;  3HKZ E;  5C5M A;  4B08 A;  3VYT A;  1VCI A;  2EXZ A;  4HMI A;  2CQA A;  3MC0 B;  4RMF A;  4LFB Q;  4XXE A;  2RDG A;  4X64 Q;  2Q2T A;  3JC6 6;  4MN3 A;  3CCE A;  4HID A;  5K36 H;  1F9Q A;  4RCO A;  1PZI D;  2VQF L;  1B70 B;  3OYY A;  1UE7 A;  2IX0 A;  4A3I B;  4MHE A;  1B9N A;  1Q46 A;  1TWF B;  1TY2 A;  3M4Q A;  2B63 H;  1OXX K;  3U4Z A;  1B8A A;  5C3E H;  1Y8P B;  2FMM A;  3H91 A;  5M3F H;  3VR2 A;  2HQE A;  1EYD A;  3AB9 A;  1GUW A;  2KHS A;  4ALP A;  3G7L A;  2K14 A;  1KDC A;  4GKK Q;  4WJ4 A;  1ML0 D;  5I4D A;  1PH2 A;  1YVC A;  2N49 A;  1II3 A;  2WAC A;  4KKT A;  5KRU A;  1I94 Q;  2UU9 L;  4APV A;  5ELN A;  2R7Z B;  1LYL A;  1X3F A;  3BU2 A;  1CHP D;  2D9U A;  2X6L A;  2JA6 G;  1PTO B;  2EYO A;  5FOB B;  2D62 A;  2A8V A;  4DR7 Q;  2DJF C;  3RLN A;  5EJW A;  4U67 3;  2B63 B;  1Y1V B;  3E0E A;  4TRD A;  5C3E B;  1IHZ A;  2A69 C;  3NE5 B;  1H9M A;  2IWH A;  1ENF A;  5C4X H;  5I9P A;  5IWA Q;  3KF8 A;  5JVG 3;  1KIX A;  2HCC A;  3I4L A;  4PNY A;  1ICF B;  4FF1 A;  1G6P A;  2ICI A;  3UDX A;  4EGV A;  2L15 A;  3R93 A;  1MBY A;  2K75 A;  1K3R A;  5EBD A;  4ILW A;  4HIO A;  3QOJ A;  2NBF A;  2KBN A;  4IN3 A;  1YI2 A;  2F52 A;  2EJM A;  2D0O A;  4IOA A;  4OX9 L;  5D3D A;  1IBK Q;  3DWQ A;  3PCO B;  3SK6 A;  4C3H G;  3A8K E;  4DR3 Q;  1MHW C;  3H3V C;  1KAA A;  2IL8 A;  3BZK A;  2A6E D;  3LGJ A;  1I4R A;  2CH4 A;  3A5Z B;  5J3B A;  3RZO H;  2M2L A;  5KYI A;  2NYZ D;  4NKL A;  4N8X 1;  2F4I A;  1QIL A;  3ERQ A;  5CBA E;  4BY7 B;  3S1N H;  4GN3 B;  4C3J B;  2CWA A;  1I50 B;  1JWM D;  1XNR Q;  1NMF A;  2F0Q A;  1I4P A;  1VMC A;  2OQK A;  5LHY 1;  3BDO A;  1I6V C;  4NW2 A;  2Z6K C;  4LF9 Q;  2EPB A;  5KYL A;  4M8A A;  1M8A A;  4F87 A;  1HQR D;  3PUV A;  2NVT B;  1GJX A;  4DV1 Q;  3J80 c;  3KYH C;  4K0K L;  4L5R C;  2QA4 A;  4HJ5 A;  4Q5V A;  4C3I H;  2JA6 H;  2Q8T A;  2QIL A;  3I73 A;  4RKB A;  3S1N B;  3PQI A;  1N33 L;  4NXN Q;  2Z4H A;  1DXM A;  3HOW G;  1R9T H;  5CV4 A;  3BYY B;  4HAE A;  1Y69 U;  1A0I A;  2B2W A;  1PH7 A;  3DM1 A;  5M5Y H;  5A2Q E;  1YHQ A;  5F2D A;  2R6G A;  2VB3 X;  4G7H C;  3U50 C;  3CCR A;  1PH5 A;  4S3S A;  4JPB W;  1EOV A;  4ABN A;  3OTO L;  2E2H H;  1XNQ Q;  1SMY D;  2HD3 A;  4PG3 A;  4C3I B;  4DV2 L;  4X6A H;  1CUK A;  3EJI A;  3MHB A;  4C3H H;  5IYD G;  1S4Z A;  2P5Z X;  5C3W A;  3KDF B;  4JI5 L;  3M7N A;  4BBS G;  1S5D D;  1K83 H;  1YHA A;  2VUM B;  2A68 C;  1KAW A;  1PRT C;  4IAL A;  3EN2 A;  1E2Z A;  3DHQ A;  3RNU A;  2AMC B;  2IW3 A;  4XQJ A;  3A74 A;  4LUV A;  3NQT A;  1IYJ B;  4UHV A;  4RAU C;  5C0X I;  5H1S E;  1D5Z C;  3A0J A;  1ENA A;  4JI3 L;  1MSH A;  2F0L A;  1N9W A;  4J6H A;  1PMR A;  1ZYR D;  1CT1 D;  2OF1 A;  4JG2 A;  4OXP A;  4RHS A;  3KF6 B;  2OXP A;  4QGU A;  4FDB A;  4DF7 A;  1BNZ A;  4A76 A;  2Z0S A;  2F0S A;  4YCW A;  2O4X A;  4JOI C;  5HGT A;  4K6L A;  3C2P A;  3PGZ A;  3KJP A;  2CHB D;  4X3T A;  3BVG A;  2RCF A;  2VZA A;  3H09 A;  4FP5 D;  4B3M Q;  2QKI C;  5JPM C;  3J80 L;  1DD2 A;  1XXG A;  4DUZ Q;  1ILQ A;  1WCM G;  3SK4 A;  1BOS A;  3CRK C;  4BBR B;  2ENB A;  1D6E C;  3H0G G;  2OCE A;  4NB3 A;  3S17 B;  4L63 B;  2RSO A;  2CFM A;  1VQD A;  4DXF A;  2QCP X;  2WAQ G;  3MZ5 A;  2JJQ A;  3H3V H;  4KKS A;  2BH2 A;  2JYO A;  4DV0 Q;  3I3C A;  5IT9 E;  3GV6 A;  1B3Q A;  1TWH H;  2E2D C;  2YV5 A;  4L5T A;  3L2P A;  2E74 C;  1YJW A;  3VR6 A;  3HOV H;  1Q8K A;  4K14 A;  1EIY B;  5AJ3 Q;  3HOX H;  4FYD A;  3QWN A;  2B2V A;  2K04 A;  5M3M H;  5IYD H;  1I94 L;  4N8F A;  2C35 B;  5DNF A;  1DCZ A;  4DR2 Q;  1LO5 D;  1QG7 A;  5EBC A;  1YBY A;  3R8B A;  3SDZ A;  4JYA Q;  4DR7 L;  2IPK D;  2F0E A;  1X3G A;  4HR7 B;  4ODG A;  5CV6 A;  5C3X A;  1SND A;  3VA7 A;  5M5W H;  1JOO A;  1JCK B;  3TP5 A;  2A6H D;  3HGB A;  1F9P A;  1STE A;  3MXN B;  1ONL A;  2F0P A;  3PUY A;  1V1Q A;  5NUC A;  3HOV B;  2F03 A;  1BCP F;  4RG1 A;  3MXN A;  3SEB A;  2F0G A;  3HOX B;  4DV5 Q;  3A56 A;  1UNS A;  1WTH A;  4Y7N B;  5COR A;  1K73 C;  4LFC L;  4OIK A;  1FVI A;  1IBK L;  2K4K A;  3K80 C;  4YWL A;  4KHP Q;  4DR3 L;  4O2D A;  2F0N A;  4LFA Q;  1LT4 D;  1EYA A;  1BQQ T;  2F3V A;  2UUC L;  3AU7 A;  1U5K A;  5DM6 3;  4PV1 C;  4JI8 Q;  2B2T C;  3G6E A;  4HCS A;  1JWS D;  3H0G H;  3T1H Q;  2FJ2 A;  1VQO A;  3N6R A;  2AQ2 B;  2Z6K A;  3S1R B;  3DM3 A;  2ZT9 C;  5IP7 G;  1TT2 A;  4DR6 Q;  4N9P A;  4KN4 C;  3GV3 A;  4RH6 A;  3K6O A;  1HRJ A;  2EY5 A;  4QUC A;  4AYB G;  2EYJ A;  2MO0 A;  4ZUJ A;  1X56 A;  3RN5 A;  4DV1 L;  4PQX A;  5IGB A;  4YCU A;  3FDT A;  1N34 Q;  2VB2 X;  3R2T A;  1K0R A;  4NXN L;  2YTY A;  3C1E A;  3PSI A;  1KDA A;  4DKA C;  4H44 C;  2HUG A;  1DYQ A;  1FR3 A;  2OQ0 A;  4KHV A;  3HEJ A;  1SYF A;  4U68 A;  1CKN B;  1G2S A;  1Z7T A;  2ZTE A;  4KV6 A;  2KHJ A;  4YCV A;  3MFY A;  2D0P A;  3KK7 A;  1NCV A;  1CM9 A;  1PH4 A;  4KY6 A;  1ESR A;  4K5X A;  4IQZ A;  5FLX E;  2VL6 A;  2NTS A;  3ULJ A;  4POF A;  2A19 A;  3S1M B;  1CKN A;  5IOC A;  1DJR D;  1P8L A;  2JN4 A;  1XMQ Q;  1SLJ A;  3GTG H;  3RZD B;  1HH2 P;  2IHE A;  1C4Q A;  1IW7 D;  5KNC A;  1K0S A;  1F2M A;  4HED A;  1MJE A;  2Q2I A;  2K52 A;  5EKI A;  1N32 L;  2PW5 A;  3P1H A;  2L4N A;  1WTW A;  2UUA Q;  2HIX A;  1S40 A;  3Q23 A;  2KJX A;  1L0W A;  4FXD A;  2R92 G;  1TWA B;  3IKJ A;  2E8G A;  1DGS A;  1U4L A;  1YIJ A;  5IP7 H;  1W2B A;  5LMU L;  2M00 A;  1SJH D;  2LS0 1;  2B8F A;  3GTG B;  4RGT A;  3I4M B;  1HFG A;  5C6A A;  5C4Z A;  1UAP A;  2JA8 H;  4DR4 Q;  2I0Q A;  3CD6 A;  1JB3 A;  5J22 A;  3SXH A;  1LTB D;  4J15 A;  1PDQ A;  2JEB I;  4J1M A;  1WI5 A;  1L0X B;  3FP9 A;  5IP9 G;  1ILP A;  1K3B C;  3STB D;  2F0H A;  5BR8 Q;  4CDC C;  3PO2 H;  1X65 A;  1U4P A;  4EQO A;  4QUF A;  2FFK B;  3QO2 A;  1XX8 A;  4DUZ L;  1BVS A;  4ME3 A;  3FKI G;  5IE8 A;  2L0C A;  4XYO A;  1GVP A;  2IY5 B;  4RHR A;  3VA5 A;  4DFA A;  4ZKB B;  2JA8 B;  1A3U A;  4DV0 L;  2PNH A;  1XPU A;  3HOY G;  2D5D A;  4F8M A;  4DK1 A;  1Q1E A;  3S2D H;  3ICE A;  2SOB A;  5JAV A;  1HUN A;  4X62 L;  3ZJY C;  2O5I C;  2XRQ D;  1BR9 A;  4KD3 A;  1LT6 D;  1O80 A;  4YHH L;  1SYC A;  2MHV A;  4IJL A;  2BCO A;  5M5X H;  1HNW L;  1SYB A;  3S16 H;  1FGB D;  4LJZ C;  4DR2 L;  3KLR A;  1SFO B;  1TS4 A;  4DR1 Q;  1YIT A;  4IUU A;  2FXQ A;  3PMF A;  3ITP A;  4B3R Q;  4CKC A;  1VQG A;  1FD7 D;  2RCN A;  3CPF A;  2R92 H;  2D2C C;  2O2L D;  4KD4 A;  1PTO C;  2MGS A;  1QNU A;  4K8I A;  1VQJ A;  2E75 C;  1W6K A;  1GUT A;  2H1E A;  4NMZ A;  4IFD J;  3E0J A;  1PA6 A;  1RF2 D;  4E6I A;  3PF5 A;  4QIW E;  4JI0 Q;  1NR4 A;  4RGO S;  2NN6 I;  1PFN A;  4NPS A;  5CV7 A;  3QJY A;  3RLF A;  2JXM B;  3T56 B;  5EKL A;  2PQA B;  4ME5 A;  2I07 B;  2B2T A;  2TMP A;  1XYI A;  5IGF A;  1FNU A;  1P16 A;  3A55 A;  4KHP L;  2WB1 B;  4LF6 L;  4N9T A;  4HJ8 A;  1A63 A;  4OIJ A;  3PO3 H;  2PQA A;  2EYF A;  3P20 A;  3VR5 A;  4R1J A;  4KMU C;  3C46 A;  1SRU A;  2LFN A;  5C44 B;  1V1O A;  4JI8 L;  3FKI H;  1SAP A;  3L3O C;  2PYK A;  3T1H L;  1Z9F A;  2EY6 A;  3PIP 3;  2QEJ C;  3K5L A;  1G2T A;  1HXY D;  5ELB A;  4DV7 Q;  4DR6 L;  2DJG C;  2LKV A;  3HOY H;  3HZX A;  2BE5 C;  3C3L A;  4XTC S;  3HOU B;  4JBM A;  2RBM A;  1JIC A;  5K36 G;  1VF5 C;  1Y8O B;  4KLK A;  4JCV E;  1VQ9 A;  4IPC A;  2R7Z G;  2UXB Q;  3DWP A;  1A3V A;  4B3T L;  2AQ3 B;  2KEN A;  1HZA A;  1EU4 A;  4GLA C;  1SYE A;  1N34 L;  1H9S B;  5FKA C;  2B63 G;  1Y1V G;  1G29 1;  2X6G A;  5C3E G;  3R2I A;  4C2M B;  5M3F G;  4G57 A;  1M1K C;  1E24 A;  2V1C C;  3S2H B;  1H9S A;  4HN7 A;  2ID0 A;  1HCZ A;  1BBW A;  1NNX A;  4LF5 Q;  1J8I A;  4F7X A;  4DV3 L;  1QZH A;  2F0J A;  1SNM A;  1UE1 A;  1W3S A;  2A73 B;  1BO0 A;  2VS1 A;  3PUW A;  3GTK B;  3S1Q H;  3T13 A;  4OHJ A;  1AE3 A;  1MI2 A;  2X69 A;  4PMW A;  4PMC A;  4OON A;  3CMA A;  1JC7 A;  4UDU C;  2F0F A;  3TBI B;  1EL0 A;  1EY8 A;  3CW2 C;  3D4W A;  2EVB A;  3I8Z A;  5CMD A;  1I4G A;  2RA4 A;  1C48 A;  1WJJ A;  3J80 E;  4A3I H;  1WTP A;  1HNZ Q;  2JA7 H;  3CCV A;  3V2T A;  1DOK A;  3I55 A;  2KEE A;  1A2T A;  4BY7 G;  1TWF H;  4Q0F A;  1IBM Q;  1TVX A;  4C3J G;  2VXW A;  2Y0S B;  5HY6 A;  4CJ1 B;  4LMQ D;  3SK8 A;  1ESF A;  3WDN A;  1CA5 A;  4GN5 A;  2NVX H;  3H94 A;  1EY0 A;  1L1O C;  2QF7 A;  4YY3 Q;  4OWW B;  1LAB A;  4IJH A;  5I6W A;  1PH9 A;  1YJ9 A;  2I5M X;  5E3F A;  3NQI A;  3P7J A;  4A3E B;  1RTN A;  4DR4 L;  3K8A A;  2R7Z H;  2ZJR A;  4IPG A;  1F77 A;  1C9O A;  2PO4 A;  1PTO H;  2JA7 B;  1AN8 A;  1PHJ A;  4IUT A;  3IFT A;  2HIV A;  3ND8 A;  2ZTC A;  3K0X A;  1V1P B;  1Y1V H;  5C4J B;  3TEH B;  3UE1 A;  1HNX L;  1IBL L;  4L6T B;  1TII D;  3BVZ A;  2VW9 A;  1X55 A;  1UE6 A;  3J7Y W;  5EGT A;  2I5L X;  1PH3 A;  4V0B A;  3I91 A;  2NVX B;  1V1P A;  2EYP A;  4OEM B;  5KNB A;  2ZM6 Q;  1NUC A;  1OTC A;  3J7A F;  3F2C A;  2NUC A;  3OPO A;  2AKW B;  4J8Q A;  1AZP A;  1HZB A;  1PFB A;  3K7A B;  1PV4 A;  3KBG A;  4IO9 A;  1SE4 A;  3J81 i;  3RN2 A;  1KNA A;  2F0D A;  4HCE A;  4C3I G;  1KQS A;  4BWG B;  1I3Q H;  4P74 A;  3LX0 A;  2RHS B;  3JAM i;  1VQE A;  4IUN A;  4A3M B;  1EZ6 A;  2B2V C;  3TP8 A;  4LUO A;  4BXX H;  4JBJ A;  3URY A;  2NB0 A;  2ALY B;  2LXJ A;  1QE6 A;  2VUM G;  1FGU A;  1EY7 A;  2Q2H A;  3AEV A;  4BY7 H;  3H15 A;  1XMO Q;  4A3J H;  4C3J H;  2WAQ E;  3MXP A;  1I50 H;  4EQP A;  4X66 Q;  2XVS A;  1EFW A;  2F0O A;  1MJC A;  2B39 A;  2K5V A;  1IZ6 A;  2F3W A;  3TZU A;  1AE2 A;  1PYW D;  1PLF A;  1V8Q A;  1BCP B;  1I3Q B;  5LMN Q;  4EQ5 A;  1LUZ A;  3KUP A;  4EVO A;  2NVT H;  4RGM A;  3SVM A;  1SE8 A;  5CGK A;  1D1I A;  3U4V A;  4DGZ A;  3E6Z X;  2EY2 A;  4TQU S;  2QDB A;  2MP1 A;  2XIW A;  4LF8 Q;  2K7V A;  4A3J B;  1QJO A;  2IHF A;  4JI2 Q;  1T9H A;  4WOR A;  3PIO A;  4BBR G;  1NTG A;  1ASY A;  2RDF A;  3J81 c;  4OO1 I;  1B4O A;  4A3G B;  1STA A;  3GTQ B;  3ERO A;  3BYT B;  4X65 Q;  4R9W A;  3JAM c;  2HT1 A;  3T1Y Q;  1SYD A;  1WFQ A;  3NBH B;  4L5Q A;  4DV7 L;  2ZXR A;  1B50 A;  3M4O B;  4CDE C;  2XWJ B;  3MTS A;  3UDF A;  2PZW A;  2B2Y A;  4P75 A;  1LT5 D;  3IRB A;  3NBH A;  3MA2 B;  1WTR A;  3GTL B;  1EIG A;  1ZXT A;  2BDN A;  3HS0 C;  1IXR A;  2UUB L;  2FHT A;  3KFU A;  3VYS A;  1OO9 B;  2OT2 A;  2CW0 D;  2VUM H;  3MAQ A;  3CQZ B;  3TME A;  1TS5 A;  3J81 j;  3CC7 A;  3K81 C;  2CWP A;  3U58 A;  3W1G A;  1YEZ A;  3VR4 A;  3BZD B;  1VQF A;  3HOV G;  3UE0 A;  3CXC A;  1ICW A;  2A6E C;  1TWG B;  3HOX G;  1F2Z A;  4RKL A;  4LF7 Q;  1AEX A;  5M3M G;  1TWC B;  2QDL A;  4FF3 A;  2JA5 B;  3KLS A;  4JV5 Q;  1HR0 L;  1L1O B;  4QIW B;  2VNU D;  4P2C B;  2Z6B A;  1QVF A;  4X3K A;  3KDF A;  3K0Y A;  4NDX A;  4MTK A;  4R4O A;  3TN2 A;  3BS1 A;  1HNZ L;  1L1O A;  4BBR H;  3OWF A;  3DUZ A;  4K8J A;  2VQE L;  3S17 H;  4KY7 A;  3BZC A;  1AH9 A;  1KD1 C;  5C0X G;  1Y1W B;  1JE5 A;  5ELO A;  4B3S Q;  1CI3 M;  1EYG A;  1QB5 D;  3DLL A;  1D5X C;  3FEW X;  1STY A;  2ZTD A;  1F9S A;  1AFP A;  3TQY A;  3JAM L;  4X3U A;  2GN5 A;  1CTM A;  4JK1 C;  4LFB L;  4DPG A;  2EJG C;  1HJP A;  1H9R A;  4X64 L;  1K8G A;  3KF6 A;  1V9P A;  4AIM A;  3K59 A;  1I5F A;  3WOF A;  1EWC A;  1LTS D;  4NXM Q;  3S14 B;  3CCS A;  1Q81 C;  1LTA D;  3CCJ A;  3A7A B;  4NP5 A;  3TP7 A;  3KJO A;  2G9H D;  1PYS B;  1HA6 A;  1J6Q A;  1WVL A;  1SMY C;  2NZO A;  1E1O A;  2IT1 A;  1EY9 A;  5FO8 B;  4GKK L;  1K8M A;  1ZEQ X;  2RF4 A;  2B2U C;  4LAA A;  2AWN A;  4Y7N H;  1Q86 C;  3G6J B;  1STH A;  5JEA G;  4JI1 Q;  4HIK A;  3CAM A;  5K5P A;  4GN4 B;  1GUS A;  4FO2 A;  1KTK A;  4ID6 A;  1X32 A;  1JQY D;  1MIU A;  5IWA L;  4JI7 Q;  1ZYR C;  4IFD I;  3S1R H;  5C0X H;  3HOW B;  2PI2 A;  2KCT A;  2QGQ A;  1B1Z A;  4X66 L;  3J7Z C;  1BBX C;  3OHX C;  3W5O A;  1WTV A;  2NTT A;  2RQX A;  4XYQ A;  2MPM A;  3I4M G;  3TSS A;  4TSS A;  1PH1 A;  4X3S A;  3Q8D A;  1QZG A;  4A3L G;  1Q90 A;  5LMN L;  1F9R A;  1HPC A;  1KL9 A;  3FVQ A;  1C8C A;  3HKZ B;  4C56 C;  3BG3 A;  5IGD A;  4QJF A;  1EIH A;  4POG A;  4R8I A;  4GZY C;  2EXD A;  2IJ0 A;  2Z1C A;  4AQY Q;  2VY3 A;  2XNA C;  4JI2 L;  3B6Y A;  3U9S A;  1S72 A;  1XNR L;  1VQM A;  4K6D A;  3OMC A;  3GTP B;  3VDY A;  1U0L A;  1KAB A;  3CU7 A;  2PNR C;  4X65 L;  3A8I E;  4GKJ Q;  2O5J C;  2JA8 G;  1A2U A;  2YYZ A;  4LF9 L;  1CA6 A;  3S1M H;  1HFN A;  1PH6 A;  4A3D B;  4DV6 Q;  1ET6 A;  3AYH B;  3P75 A;  2Z9H A;  1O7Z A;  3RUZ A;  4CGY B;  4K2K A;  3RZD H;  4PZ8 A;  3PO2 G;  1SJE D;  2A6H C;  2SEB D;  2NWG A;  5JEA H;  2E2I H;  4DA2 A;  4GLX A;  5IYC H;  2E5L Q;  1CK1 A;  1EUJ A;  1YJN A;  2DGY A;  1VQ4 A;  1KRS A;  4A3C G;  3WWV A;  4ZKC B;  2BA0 A;  1TWA H;  2JE6 I;  1JOQ A;  1WCM B;  2IX3 A;  2N8N A;  2A1A A;  4UP8 A;  3KBX A;  1WTO A;  1LAC A;  1XNQ L;  5EPK A;  4HJA A;  2F0M A;  2NVY B;  2SNS A;  4IPH A;  1IL2 A;  3I4M H;  1OXT A;  3MEH A;  1E22 A;  2E2I B;  4A3L H;  4OEL B;  1TQO A;  2EDG A;  2A74 C;  5I2Y A;  2AUK A;  4I7A A;  5ISR A;  1HTP A;  1QVG A;  1TY0 A;  2JQO A;  5D14 A;  1B2T A;  2WB1 G;  3NEN A;  4GNX B;  2R93 H;  3TRZ A;  2K28 A;  1IKL A;  2B3G A;  1VQI A;  4Y52 H;  2EIF A;  3EFX D;  4V19 0;  1R4P B;  3SK5 A;  4KY5 A;  2L55 A;  4GNX A;  2KCC A;  1W6J A;  2PPB C;  3J7A 5;  1HZ9 A;  4DUY Q;  1GHJ A;  2GVB A;  3DMU A;  1X6O A;  3PF4 A;  4B3S L;  1JWU D;  4FXK C;  4A3K B;  1D7Q A;  3KLW A;  2F0K A;  3VR3 A;  1GXD C;  2Z8L A;  4IUR A;  3HOU G;  5CBE E;  1UEB A;  2HDM A;  3SGI A;  2RHQ B;  4OGQ C;  3GDE A;  4JBW A;  4ZYS A;  2R93 B;  2N88 A;  3PO3 G;  1U4R A;  4B3M L;  3DEP A;  1SFO H;  3AFP A;  4KK7 A;  3D6W A;  2VQF Q;  3GD7 A;  2MJ8 A;  3ZYY X;  4A3C H;  4O0A A;  1LM0 A;  2B2U A;  1J5E Q;  4CDF C;  5IGG A;  2V4D A; 
#chains in the Genus database with same CATH homology
 3NUC A;  2KCN A;  2WKC A;  1IW7 C;  1TU2 B;  3MFG A;  4YIJ A;  3M3Y B;  4I65 A;  2F0T A;  3M7G A;  2WII B;  5E4X A;  1E2V A;  1YNN D;  1U4M A;  1KNE A;  3SHL A;  3BDL A;  5TSS A;  2K1B A;  1CHQ D;  2K32 A;  2HCI A;  2C9O A;  5IGE A;  5EQ0 A;  2EYL A;  5CC4 A;  1S5E D;  1A15 A;  2FMC A;  3Q22 A;  1AW7 A;  4QF4 A;  4KKU A;  1EY5 A;  1X3P A;  3GQB A;  2L12 A;  4XQQ A;  1SYG A;  4DU9 A;  5KIX A;  1H9K A;  1JR0 D;  2FIN B;  2NN6 G;  1Z6H A;  1PFM A;  1RKN A;  3TZD A;  1QOH A;  4PMB A;  4A93 B;  2GA4 B;  3FPU B;  1BCP C;  1JOR A;  2F1M A;  3M85 A;  1JOK A;  1UUP A;  1YNJ D;  2PW7 A;  3NHH A;  4A3B B;  5KEE A;  4K2L A;  2DNE A;  1AP0 A;  4BY1 B;  1BUV T;  3MWY W;  1T5X D;  2B2Y C;  2EZV A;  5DM7 3;  4B9X A;  1I6H B;  5DAU A;  3I4N B;  1RDP D;  3QB3 A;  2K03 A;  1HQM C;  1F2Y A;  5EPJ A;  2L9H A;  4FNF A;  2PCF B;  3CHB D;  4DNT B;  5LL6 X;  1LTR D;  3T4A C;  3IL8 A;  2NN6 H;  5ELF A;  1PRT F;  5JVH 3;  5EKK A;  5KND A;  2KOL A;  1EU3 A;  2EOT A;  2Z4I A;  3HOZ B;  3GTO B;  4HSV A;  1X3Q A;  3S15 B;  1L0Y B;  2ZXP A;  3SR1 A;  3NWT A;  1V43 A;  2WIN B;  3D4D A;  4RFB A;  1D5M C;  1Q1B A;  4I7Z C;  5J39 A;  3FMC A;  2E76 C;  3V05 A;  3BVM A;  4WFN 3;  2A69 D;  1RTO A;  4RGN A;  1EZ8 A;  3K57 A;  5FO7 B;  2C5C A;  3I70 A;  4CJ2 C;  4FF2 A;  2K6A A;  1TR5 A;  3K5O A;  3NWS A;  3PIO 3;  4FXG C;  5ELE A;  4G7O C;  3NBI A;  2NVQ B;  1IL8 A;  4B9W A;  3MXU A;  5I2X A;  2TSS A;  1CQF A;  1STG A;  2ZXO A;  4C1N K;  2K5W A;  4IUV A;  2J7Z A;  2EYM A;  3GTM B;  1A3T A;  4A3F B;  2JEA I;  1Q3L A;  2DY7 A;  1SDF A;  4O42 A;  3OOC A;  3L9A X;  3UI2 A;  4ZK9 B;  3R3O A;  2H4O A;  3QIA A;  1S5C D;  2BA1 A;  4G4K A;  5I6Y A;  2F0V A;  4XDX A;  5HUR A;  4LK1 C;  4FVM A;  4G7Z C;  3WOE A;  3CRL C;  1I4X A;  4CBV A;  5M3F B;  5BN5 A;  1EWH A;  1ROD A;  1ET9 A;  1XTC D;  2ICE C;  4CJ0 B;  2JP1 A;  4ULL A;  1SE3 A;  3S9W A;  3D3R A;  5G3L F;  2K5D A;  3HRZ C;  2G9D A;  4XT1 B;  3D4R A;  3TDQ A;  2KED A;  1VF7 A;  1KLG D;  1EEI D;  5M9O A;  4CHT B;  4OO1 G;  1EEF D;  1DM0 B;  2J0T D;  3MXG A;  5E4W C;  5C4X B;  4ZLT F;  4F88 A;  1SXT A;  4EQN A;  2XWB B;  3F2U A;  2A68 D;  1PRT D;  3T51 B;  4KJO A;  1U9R A;  1G91 A;  2KVM A;  3OMG A;  1F2L A;  1GUO A;  1HHV A;  2NZ1 D;  1HTL D;  1EYC A;  3RZO B;  1NSN S;  3NSW A;  1GOZ A;  3NTH A;  4KTA A;  1SNQ A;  4L8J A;  4IZ8 A;  1LTT D;  4WJW A;  3VYR A;  1S5B D;  1WTX A;  1VMP A;  1A6X A;  1CFM A;  2M9V A;  4KI0 A;  5JPN C;  1Q8I A;  5C5L A;  2I46 A;  4R8N A;  2JA6 B;  2PZT A;  2EE1 A;  3TP6 A;  3O13 A;  4KJN A;  1R9T B;  4OO1 H;  3J81 L;  4XIG S;  5M5Y B;  4CKE A;  3LNN A;  1KLU D;  1M4V A;  2E2H B;  3MVV A;  4RCN A;  2YU9 B;  3KLS X;  5FO9 B;  1EY4 A;  2CW0 C;  2BDO A;  3PUX A;  3VYU A;  2K33 A;  4OL7 A;  4C3H B;  3IFD A;  1ENC A;  1CZW A;  3DWA A;  2RDH A;  1K83 B;  4CKB A;  1WTQ A;  4DXG A;  1EQV A;  4XQN A;  1SSO A;  1Z47 A;  2Q8I B;  4KHZ A;  5D65 A;  3HP3 A;  1G6Z A;  1O7Y A;  3BDC A;  1IKM A;  3OWE B;  3V96 A;  1I4Q A;  5LL6 S;  5BN4 A;  5CV5 A;  1LLR D;  5G3L D;  2LMC B;  4HSP A;  5FK9 C;  1JE4 A;  1GHK A;  3GP7 A;  4IUP A;  1PTO F;  3PV0 A;  4BA2 I;  2AWO A;  2L5T A;  1DOM A;  3L7Z C;  4DN4 M;  5JJZ A;  5IOD A;  5E1F A;  4IFD G;  1STB A;  1KDB A;  3EA6 A;  2RSN A;  2XRS D;  1S5F D;  5CR3 A;  5I9O A;  1I4H A;  4DAY A;  2BOS A;  3OSO A;  1PZJ D;  1TWH B;  1STN A;  3A7L A;  4H13 C;  4QB4 A;  5CV8 A;  1LT3 D;  4DNR B;  2Q8R E;  4IUQ A;  5M3M B;  2AUJ D;  1DOL A;  1Y8N B;  2KUM A;  5ELD A;  3AMU A;  3M4Y A;  3ONA B;  2KQ3 A;  5KGU A;  2EY1 A;  1QNK A;  1EQT A;  4BBS B;  2F0U A;  1GUG A;  3GO5 A;  2CVR A;  4ZRZ A;  5M5W B;  2E2J B;  3K58 A;  1EFI D;  2L1B A;  3CKI B;  4H7B A;  5CYU A;  5IGC A;  1XWE A;  3IAY A;  1B9M A;  3OIQ A;  1SEB D;  4MIU A;  2WP8 J;  3QOL A;  2EYH A;  4ZAI A;  2B8G A;  2N55 A;  1RCV D;  1T5E A;  2XN9 C;  1D1K A;  3RD4 A;  2J4X A;  5EPL A;  2K5Q A;  3EQL C;  4IFD H;  4Z9C B;  1IYU A;  3H0G B;  1TKW B;  3NXW A;  2WAQ B;  3NPP A;  3T16 A;  3Q6S A;  3GTJ B;  3Q0A A;  4RWS C;  1HUM A;  3I72 A;  1OXV A;  5J1Z A;  1PRT B;  5AFW A;  1EY6 A;  3SE0 A;  2JSO A;  1E2W A;  1SNC A;  5JOB A;  3I90 A;  4BS9 A;  3OW7 A;  3EVQ A;  5A2Q L;  1RJT A;  2PQE A;  1QWY A;  1B3A A;  1SNO A;  1R4Q B;  5BN3 A;  3T53 B;  3FPP A;  5C0X J;  2WKD A;  1EOT A;  2RKS A;  4HTH A;  4O1N A;  1PTO D;  5CV9 A;  4DAV A;  2DN8 A;  1QCB D;  4K5W A;  4TKO B;  4ZQ3 A;  2DY8 A;  4RA8 A;  1TS3 A;  3C1F A;  1RHP A;  2R3Z A;  3A8J E;  3H6M A;  4UAI A;  4H0L C;  3QG1 A;  3FRP B;  1RD9 D;  2K05 A;  1J9O A;  2AQ1 B;  2DNC A;  3E5S A;  1BCP D;  1MSG A;  4M1U B;  2XSC A;  4AYB B;  5A35 A;  1MD2 D;  2PZU A;  1NAP A;  1DON A;  1G8Z D;  2BE5 D;  1VDZ A;  1LTG D;  3PO2 B;  1LV9 A;  3LWE A;  3A54 A;  5JEA J;  1AZQ A;  3NTK A;  4XT3 B;  3D31 A;  4DK0 A;  1LTI D;  3OIP A;  5IT9 L;  3K5M A;  3J7A V;  3D6C A;  3S2D B;  1FNV A;  1FNW A;  1O7L A;  5IIF A;  2WV6 D;  3W3A A;  2KEC A;  1B53 A;  5M5X B;  4C1N I;  3S16 B;  2KA7 A;  1PXU A;  1UEA B;  1OXS C;  1CQV A;  2R92 B;  5T1G A;  1YNN C;  2PMZ B;  3X3M A;  3DXJ C;  2RVL A;  4QCL A;  1K8O A;  1ZKO A;  2F0I A;  1H9J A;  3W2D A;  4HMJ A;  2IX1 A;  2HDL A;  1E0B A;  4FF4 A;  1GUN A;  1B44 D;  3PO3 B;  2EJF C;  2K01 A;  1IYV A;  3ND9 A;  1FYC A;  1BF4 A;  5C4H A;  2R61 A;  2LY7 A;  1D2B A;  3FKI B;  3J81 E;  1HA5 A;  3D8G A;  1SE2 A;  3JAM E;  1TS2 A;  3U9O A;  2F0W A;  1WD1 A;  1BDO A;  3HOY B;  2B2W C;  3K5N A;  2SNM A;  3N52 A;  4ZUI A;  4QMG A;  1WD0 A;  3NP8 A;  1OXU A;  3RMH A;  1MGS A;  1CZG A;  1NR2 A;  2L11 A;  1DZ1 A;  5ELC A;  2OEO A;  5T1I A;  3DEO A;  4BA1 I;  3HG9 A;  5COY A;  3X3N A;  1PZK D;  1YNJ C;  3NTI A;  3LWU A;  4WRD A;  3NK9 A;  4DAP A;  1BXT A;  1Q12 A;  1SNP A;  2MUY A;  3Q24 A;  2SDF A;  1SBB B;  2A5H A;  5FLX L;  1O78 A;  3PUZ A;  5D3I B;  4K5V A;  5DEH A;  4KN7 C;  3S1Q B;  5C5M A;  4B08 A;  3VYT A;  1VCI A;  2EXZ A;  4HMI A;  2CQA A;  3MC0 B;  4XXE A;  2RDG A;  4MN3 A;  5K36 H;  1F9Q A;  4RCO A;  1PZI D;  2IX0 A;  4A3I B;  4MHE A;  1B9N A;  1TWF B;  1TY2 A;  1OXX K;  1Y8P B;  2FMM A;  3H91 A;  3VR2 A;  2HQE A;  1EYD A;  3AB9 A;  1GUW A;  2KHS A;  3G7L A;  1KDC A;  1ML0 D;  5I4D A;  2WAC A;  1II3 A;  4KKT A;  5KRU A;  2R7Z B;  1CHP D;  2D9U A;  2X6L A;  1PTO B;  2EYO A;  5FOB B;  2D62 A;  4U67 3;  5EJW A;  2B63 B;  1Y1V B;  4TRD A;  5C3E B;  1IHZ A;  2A69 C;  3NE5 B;  1H9M A;  2IWH A;  1ENF A;  5I9P A;  3KF8 A;  5JVG 3;  2HCC A;  3I4L A;  4PNY A;  4FF1 A;  2ICI A;  4EGV A;  3R93 A;  1MBY A;  5EBD A;  4ILW A;  3QOJ A;  2NBF A;  4IN3 A;  2EJM A;  5D3D A;  3DWQ A;  3SK6 A;  4C3H G;  3A8K E;  3H3V C;  1KAA A;  2IL8 A;  2A6E D;  1I4R A;  2M2L A;  5KYI A;  2NYZ D;  4NKL A;  2F4I A;  1QIL A;  3ERQ A;  5CBA E;  4BY7 B;  4C3J B;  1I50 B;  1JWM D;  2F0Q A;  1I4P A;  1VMC A;  5LHY 1;  3BDO A;  1I6V C;  4NW2 A;  2EPB A;  5KYL A;  4M8A A;  1M8A A;  4F87 A;  1HQR D;  3PUV A;  2NVT B;  1GJX A;  4Q5V A;  2Q8T A;  2QIL A;  3I73 A;  4RKB A;  3S1N B;  2Z4H A;  1DXM A;  5CV4 A;  3BYY B;  4HAE A;  1Y69 U;  2B2W A;  3DM1 A;  5A2Q E;  5F2D A;  2R6G A;  2VB3 X;  4G7H C;  4S3S A;  4ABN A;  1SMY D;  4C3I B;  3EJI A;  3MHB A;  1S4Z A;  5C3W A;  3M7N A;  1S5D D;  2VUM B;  2A68 C;  1PRT C;  4IAL A;  1E2Z A;  3DHQ A;  2IW3 A;  4XQJ A;  3NQT A;  4RAU C;  5C0X I;  1D5Z C;  1ENA A;  1MSH A;  2F0L A;  4J6H A;  1PMR A;  1ZYR D;  1CT1 D;  2OF1 A;  4RHS A;  2OXP A;  4DF7 A;  1BNZ A;  2F0S A;  2O4X A;  5HGT A;  4K6L A;  3C2P A;  2CHB D;  4X3T A;  3BVG A;  3H09 A;  4FP5 D;  2QKI C;  5JPM C;  3J80 L;  1DD2 A;  1XXG A;  1ILQ A;  3SK4 A;  1BOS A;  3CRK C;  4BBR B;  2ENB A;  1D6E C;  3S17 B;  4L63 B;  2RSO A;  4DXF A;  2QCP X;  3MZ5 A;  4KKS A;  2JYO A;  3I3C A;  5IT9 E;  3GV6 A;  2E2D C;  2E74 C;  3VR6 A;  4K14 A;  4FYD A;  3QWN A;  2B2V A;  2K04 A;  5DNF A;  1DCZ A;  1LO5 D;  1QG7 A;  5EBC A;  3R8B A;  3SDZ A;  2IPK D;  2F0E A;  4HR7 B;  4ODG A;  5CV6 A;  5C3X A;  1SND A;  3VA7 A;  1JOO A;  1JCK B;  3TP5 A;  2A6H D;  3HGB A;  1F9P A;  1STE A;  1ONL A;  2F0P A;  3PUY A;  5NUC A;  3HOV B;  2F03 A;  1BCP F;  3MXN A;  3SEB A;  2F0G A;  3HOX B;  3A56 A;  1UNS A;  4Y7N B;  5COR A;  4OIK A;  2F0N A;  1LT4 D;  1EYA A;  1BQQ T;  2F3V A;  3AU7 A;  5DM6 3;  4PV1 C;  2B2T C;  4HCS A;  1JWS D;  2FJ2 A;  3N6R A;  2AQ2 B;  3S1R B;  2ZT9 C;  1TT2 A;  4N9P A;  4KN4 C;  3GV3 A;  4RH6 A;  3K6O A;  1HRJ A;  2EY5 A;  4QUC A;  2EYJ A;  4ZUJ A;  4PQX A;  5IGB A;  3FDT A;  2VB2 X;  3R2T A;  3C1E A;  1KDA A;  4H44 C;  2HUG A;  1DYQ A;  1FR3 A;  4KHV A;  3HEJ A;  1SYF A;  4U68 A;  1G2S A;  1Z7T A;  4KV6 A;  3MFY A;  3KK7 A;  1NCV A;  1CM9 A;  4KY6 A;  1ESR A;  4K5X A;  4IQZ A;  5FLX E;  2NTS A;  3S1M B;  5IOC A;  1DJR D;  3RZD B;  1C4Q A;  1IW7 D;  5KNC A;  1F2M A;  4HED A;  5EKI A;  2PW5 A;  3P1H A;  2L4N A;  1WTW A;  3Q23 A;  2KJX A;  4FXD A;  1TWA B;  3IKJ A;  1U4L A;  2M00 A;  1SJH D;  2LS0 1;  2B8F A;  3GTG B;  4RGT A;  3I4M B;  1HFG A;  5C6A A;  5C4Z A;  1UAP A;  1JB3 A;  5J22 A;  3SXH A;  1LTB D;  1PDQ A;  2JEB I;  4J1M A;  1L0X B;  1ILP A;  2F0H A;  1U4P A;  4EQO A;  4QUF A;  2FFK B;  3QO2 A;  1XX8 A;  2L0C A;  4XYO A;  4RHR A;  3VA5 A;  4DFA A;  4ZKB B;  2JA8 B;  1A3U A;  2D5D A;  4F8M A;  4DK1 A;  1Q1E A;  2SOB A;  5JAV A;  1HUN A;  2O5I C;  2XRQ D;  1BR9 A;  4KD3 A;  1LT6 D;  1O80 A;  1SYC A;  2MHV A;  2BCO A;  1SYB A;  1FGB D;  4LJZ C;  3KLR A;  1SFO B;  1TS4 A;  4IUU A;  3PMF A;  3ITP A;  4CKC A;  1FD7 D;  2D2C C;  2O2L D;  4KD4 A;  1PTO C;  2MGS A;  1QNU A;  4K8I A;  2E75 C;  1W6K A;  1GUT A;  2H1E A;  4NMZ A;  4IFD J;  3E0J A;  1RF2 D;  4E6I A;  1NR4 A;  4RGO S;  2NN6 I;  1PFN A;  5CV7 A;  3QJY A;  3RLF A;  2JXM B;  3T56 B;  5EKL A;  4ME5 A;  2I07 B;  2B2T A;  2TMP A;  1XYI A;  5IGF A;  1FNU A;  3A55 A;  2WB1 B;  4N9T A;  4OIJ A;  2EYF A;  3P20 A;  3VR5 A;  4KMU C;  3C46 A;  2LFN A;  5C44 B;  1V1O A;  1SAP A;  3L3O C;  2PYK A;  2EY6 A;  3PIP 3;  2QEJ C;  3K5L A;  1G2T A;  1HXY D;  5ELB A;  2LKV A;  3HZX A;  2BE5 C;  3C3L A;  4XTC S;  3HOU B;  2RBM A;  1JIC A;  5K36 G;  1VF5 C;  1Y8O B;  3DWP A;  1A3V A;  2AQ3 B;  1EU4 A;  1SYE A;  1H9S B;  5FKA C;  1G29 1;  2X6G A;  3R2I A;  4C2M B;  4G57 A;  3S2H B;  1H9S A;  4HN7 A;  2ID0 A;  1HCZ A;  1J8I A;  4F7X A;  2F0J A;  1SNM A;  2A73 B;  1BO0 A;  3PUW A;  3GTK B;  3T13 A;  4OHJ A;  1MI2 A;  2X69 A;  4PMW A;  4PMC A;  1JC7 A;  4UDU C;  2F0F A;  3TBI B;  1EL0 A;  1EY8 A;  3D4W A;  2EVB A;  3I8Z A;  5CMD A;  1I4G A;  2RA4 A;  1C48 A;  3J80 E;  1WTP A;  3V2T A;  1DOK A;  2KEE A;  1A2T A;  4Q0F A;  1TVX A;  4C3J G;  2VXW A;  2Y0S B;  4CJ1 B;  4LMQ D;  3SK8 A;  1ESF A;  3WDN A;  1CA5 A;  3H94 A;  1EY0 A;  2QF7 A;  1LAB A;  5I6W A;  5E3F A;  3NQI A;  3P7J A;  4A3E B;  1RTN A;  1F77 A;  2PO4 A;  1PTO H;  2JA7 B;  1AN8 A;  4IUT A;  3IFT A;  3ND8 A;  1V1P B;  5C4J B;  4L6T B;  1TII D;  3BVZ A;  3J7Y W;  5EGT A;  4V0B A;  3I91 A;  2NVX B;  1V1P A;  2EYP A;  5KNB A;  1NUC A;  3J7A F;  2NUC A;  3OPO A;  4J8Q A;  1AZP A;  1PFB A;  3K7A B;  3KBG A;  1SE4 A;  1KNA A;  2F0D A;  4HCE A;  4C3I G;  4BWG B;  3LX0 A;  4IUN A;  4A3M B;  1EZ6 A;  2B2V C;  3TP8 A;  3URY A;  2NB0 A;  1QE6 A;  1EY7 A;  3MXP A;  4EQP A;  2XVS A;  2F0O A;  2B39 A;  2F3W A;  3TZU A;  1PYW D;  1PLF A;  1V8Q A;  1BCP B;  1I3Q B;  3KUP A;  4EVO A;  4RGM A;  3SVM A;  5CGK A;  1D1I A;  4DGZ A;  3E6Z X;  2EY2 A;  4TQU S;  2QDB A;  2MP1 A;  2XIW A;  2K7V A;  4A3J B;  1QJO A;  4WOR A;  2RDF A;  4OO1 I;  1B4O A;  4A3G B;  1STA A;  3GTQ B;  3ERO A;  3BYT B;  4R9W A;  1SYD A;  2ZXR A;  1B50 A;  3M4O B;  2XWJ B;  3MTS A;  2PZW A;  2B2Y A;  1LT5 D;  3NBH A;  3MA2 B;  1WTR A;  3GTL B;  1EIG A;  1ZXT A;  2BDN A;  3HS0 C;  2FHT A;  3VYS A;  1OO9 B;  2OT2 A;  2CW0 D;  3MAQ A;  3CQZ B;  3TME A;  1TS5 A;  3VR4 A;  3BZD B;  1ICW A;  2A6E C;  1TWG B;  1F2Z A;  4RKL A;  1AEX A;  1TWC B;  4FF3 A;  2JA5 B;  3KLS A;  2VNU D;  4QIW B;  4P2C B;  4X3K A;  3K0Y A;  4NDX A;  3TN2 A;  3BS1 A;  3OWF A;  3DUZ A;  4K8J A;  4KY7 A;  5C0X G;  1Y1W B;  1CI3 M;  1QB5 D;  1D5X C;  3FEW X;  1STY A;  1F9S A;  1AFP A;  3JAM L;  4X3U A;  1CTM A;  4JK1 C;  2EJG C;  1H9R A;  3K59 A;  3WOF A;  1EWC A;  1LTS D;  3S14 B;  1LTA D;  3A7A B;  4NP5 A;  3TP7 A;  2G9H D;  1HA6 A;  1WVL A;  1SMY C;  2IT1 A;  1EY9 A;  5FO8 B;  1K8M A;  1ZEQ X;  2B2U C;  4LAA A;  2AWN A;  3G6J B;  1STH A;  5JEA G;  5K5P A;  1GUS A;  4FO2 A;  1KTK A;  4ID6 A;  1X32 A;  1JQY D;  1ZYR C;  4IFD I;  5C0X H;  3HOW B;  1B1Z A;  1BBX C;  3OHX C;  1WTV A;  2NTT A;  2RQX A;  4XYQ A;  2MPM A;  3TSS A;  4TSS A;  4X3S A;  1Q90 A;  1F9R A;  1HPC A;  3FVQ A;  1C8C A;  3HKZ B;  4C56 C;  3BG3 A;  5IGD A;  1EIH A;  4R8I A;  4GZY C;  2IJ0 A;  2Z1C A;  2XNA C;  3U9S A;  4K6D A;  3OMC A;  3GTP B;  1KAB A;  3CU7 A;  2PNR C;  3A8I E;  2O5J C;  1A2U A;  2YYZ A;  1CA6 A;  1HFN A;  4A3D B;  1ET6 A;  3P75 A;  3RUZ A;  1O7Z A;  4CGY B;  4K2K A;  1SJE D;  2A6H C;  2SEB D;  2NWG A;  5JEA H;  4DA2 A;  1CK1 A;  4ZKC B;  2BA0 A;  2JE6 I;  1JOQ A;  1WCM B;  2IX3 A;  3KBX A;  1WTO A;  1LAC A;  5EPK A;  2F0M A;  2NVY B;  2SNS A;  1OXT A;  3MEH A;  2E2I B;  1TQO A;  5I2Y A;  2EDG A;  2A74 C;  2AUK A;  5ISR A;  1HTP A;  1TY0 A;  5D14 A;  1B2T A;  2K28 A;  1IKL A;  3EFX D;  4V19 0;  1R4P B;  3SK5 A;  4KY5 A;  2L55 A;  2KCC A;  1W6J A;  2PPB C;  1GHJ A;  3DMU A;  1JWU D;  4FXK C;  4A3K B;  2F0K A;  3VR3 A;  1GXD C;  2Z8L A;  4IUR A;  5CBE E;  2HDM A;  4OGQ C;  4JBW A;  4ZYS A;  2R93 B;  2N88 A;  1U4R A;  3DEP A;  4KK7 A;  3D6W A;  3GD7 A;  2MJ8 A;  3ZYY X;  2B2U A;  5IGG A;  2V4D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...