1FD7D

Heat-labile enterotoxin b-pentamer with bound ligand bmsc001
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
103
Chain Sequence
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords HEAT-LABILE ENTEROTOXIN B CHAIN
publication title Exploration of the GM1 receptor-binding site of heat-labile enterotoxin and cholera toxin by phenyl-ring-containing galactose derivatives.
pubmed doi rcsb
source organism Escherichia coli
total genus 24
structure length 103
sequence length 103
chains with identical sequence E, F, G, H, L, M, N, O, P
ec nomenclature
pdb deposition date 2000-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1fd7D00
5I4DA 1SBBB 5ELEA 3BYYB 1SXTA 5ELDA 3MC0B 1D5XC 1I4QA 1JR0D 1CHPD 1FNUA 1SJHD 4TSSA 5D3DA 3R8BA 1JWSD 3DWAA 1EEFD 1F77A 1JQYD 1TS3A 5ELCA 4RGNA 1DYQA 1BCPC 2IPKD 4O1NA 3TSSA 2O2LD 1RCVD 1LO5D 3EA6A 1LTGD 2XRQD 3KLSX 1EFID 2TSSA 1HTLD 3OWEB 1LTTD 4Z9CB 1LT6D 1PYWD 1V1PA 1KLUD 1PRTC 1FNVA 1FGBD 2QEJC 2NTSA 1SE2A 1S5CD 1LTAD 4UDUC 1L0XB 5ELFA 3BVMA 1KTKA 3EFXD 1B44D 1DJRD 4RH6A 1EU4A 1ET6A 3MFGA 2AQ1B 1S5FD 1AW7A 3BYTB 1PTOD 1BCPB 1QILA 1PTOF 4RCOA 1EWCA 1ESFA 1I4HA 1XTCD 1M4VA 1EU3A 1I4XA 1T5XD 4C56C 1PTOH 2G9HD 1LT3D 2J4XA 3DWPA 1PRTB 1PZJD 1S5DD 3BVZA 4L6TB 1SE4A 1UNSA 4RGOS 2AQ2B 4OHJA 1CQVA 4DXGA 1ET9A 3R2IA 3BVGA 1LT4D 5D3IB 4L63B 2QILA 1FNWA 1TS5A 2Z8LA 1SEBD 4RGMA 4RHSA 3V05A 1RD9D 1S5BD 2IJ0A 1PTOC 2AQ3B 1LTRD 2RDHA 1PZKD 1I4PA 1HQRD 5FKAC 1RDPD 4K6LA 1TS4A 1HA5A 4RGTA 2XN9C 1S5ED 3DWQA 3URYA 1JCKB 1CK1A 1JWUD 3BZDB 3O13A 3GP7A 1FD7D 2ICIA 1G8ZD 1D6EC 4DXFA 1I4RA 1I4GA 1LTID 1SE3A 2XRSD 1B1ZA 1BXTA 1KLGD 1L0YB 3W2DA 2R61A 4RHRA 1LTSD 1D5MC 4BWGB 1PTOB 5FK9C 5ELBA 1JWMD 3CHBD 1LLRD 1LTBD 1GOZA 1LT5D 1BCPD 3R2TA 1BCPF 1V1PB 1ENFA 1HXYD 2XNAC 3SEBA 1CHQD 1UUPA 2CHBD 2SEBD 2WV6D 1TY0A 1MD2D 1PZID 1D5ZC 1SJED 1EEID 1XXGA 1STEA 1TY2A 1PRTD 2NTTA 1TS2A 5TSSA 1AN8A 1PRTF 1RF2D 2RDGA 1V1OA 1CT1D 4RFBA 4ZYSA
chains in the Genus database with same CATH superfamily
4AYBB 4A3JB 3T53B 2E5LQ 1IBLQ 1MIUA 3J7YW 4TSSA 1Q7YC 1W2BA 2BDOA 2UXBL 1V9PA 2K50A 4IALA 4K5VA 4QUCA 2ID0A 4DUZQ 1LTGD 2KHSA 3W1BA 2TSSA 4J8QA 2LXKA 2K05A 4KJOA 1X32A 4DR1L 1Y8PB 2JA8B 2JEAI 2L55A 1PH5A 2VQEQ 1ONLA 2JN4A 4DV7Q 3TQYA 3DEPA 1S5FD 3KLRA 3A8IE 4C3JB 4R8IA 3H0GG 3SGIA 2VB2X 4NXNQ 4QCLA 1JOOA 4JCVE 1NJIC 5C0XH 4I7ZC 4P2CB 4FP5D 1Y14B 4A3FB 2NB0A 1LV9A 3I7FA 3FDTA 3SK6A 4TQUS 5CC4A 2LFNA 2MFIA 4A76A 1TXYA 1A8VA 1IW7D 1FNWA 3KF8B 4ZRZA 4HIKA 2YTVA 3A8KE 2EXDA 5C3EG 1BOSA 5LL6S 4B3MQ 1LTRD 3VYTA 2AUJD 2RVLA 5C4ZA 1H9RA 1VQGA 4X6AH 2Z6KC 4GNXA 3CPWA 4G57A 1F2MA 3S2DB 2D0PA 2NN6H 2KEEA 4LWCA 3QR8A 3V2TA 2XIWA 5IE8A 4KTAA 2K6AA 3NPPA 5NUCA 2PQAB 2KCCA 1Z6HA 3MFYA 5LL6X 4RAUC 3DLLA 4YIJA 2ZJQA 1LTBD 4A3MH 1E7ZA 3NWTA 3SXHA 5CV8A 3K5NA 1QB5D 2N8NA 3TZDA 3M7NA 3EIVA 1VS0A 3A55A 2WV6D 1TWHB 5C3XA 1B50A 3T1YQ 4YWKA 5C4HA 4WJ3M 4DV3L 3HOWH 1B9MA 1TWCB 4YCUA 5LMUQ 4RCNA 2B2TA 1CKOA 3KYHC 1C0AA 1JB7A 2Q8IB 2PZWA 4KD4A 3HKZE 5IT9c 4GOPB 5ELCA 2O4XA 4R8NA 3HEJA 5LMNQ 3TSSA 4DV1L 2K5WA 4UAIA 3EA6A 3CC4A 4IJHA 1A63A 1B4OA 1A62A 3S2HH 2GN5A 2DNEA 1FNVA 2UUBL 4JBMA 4K0KQ 4KHZA 1LTAD 3MEFA 3LX0A 1BF4A 1O7LA 1VQBA 1B44D 3D31A 5E3FA 1VDZA 2F0VA 2UXDQ 4JI8Q 1S40A 3S1MB 3TBIB 3MZ5A 2I07B 2RKSA 3KDFB 4DAPA 2O5IC 5ELOA 3CD6A 2EVBA 1HNWQ 2F3WA 5IYCG 5M3FG 2J4XA 3TP8A 1A6XA 3D6CA 4CJ0B 4KJNA 3GTQH 2MPMA 4IOCA 4CKCA 3CRKC 4L63B 2NZ1D 2J0TD 3D4DA 3ONAB 2KA7A 4FXKC 2E2HB 4FF2A 2ZT9C 2JA6H 3RN5A 4A3JH 4G7HC 2KENA 3PO2G 4ILWA 5M5YH 3J7A5 1KDAA 1S5ED 4XQJA 1CK1A 2SOBA 1XNRL 3O13A 5J39A 1FD7D 3W3AA 4WJ4A 4KV6A 4OIJA 5IYBG 3HOXG 1G91A 5ELNA 4EGVA 1CZGA 2JA8H 1VQDA 1JT8A 5G3LD 2AMCB 3I3CA 3R2TA 1PXUA 4QGUA 3NTIA 1I5FA 1TY0A 4C3JH 3EQLC 2EY6A 2EDGA 1STEA 1PH2A 5M3FB 2NTTA 4LF6L 2A5HA 4FXDA 4ZCKA 4YHHL 3Q24A 4O42A 4A3EH 2F0SA 4F88A 4ABNA 2K5VA 2SNSA 3MC0B 4I7AA 5IWAL 1CHPD 4A3FH 4KHPQ 1JWSD 4CGYB 2UUCL 1JQYD 2LS01 3SE0A 3UE0A 1EYGA 3OSOA 1S4ZA 5J1ZA 1C9OA 2PO4A 2A19A 2JK8A 1C4QA 2WAQG 4GKKL 4S3SA 4KK7A 3U4ZA 3PO2B 4NXMQ 2EJFC 4B3TQ 1LT6D 4DV4L 1WCMG 1VQPA 2EXZA 2QEJC 1LYLA 1ICFB 3SK5A 4DV0L 4DUYQ 3M4PA 3P75A 3VA7A 2E2JH 3E9HA 2KOLA 2XSCA 4DR6L 1CM9A 3D8GA 4LF5Q 3PO3H 2M9VA 2AQ1B 3TP7A 1WTQA 3GTKB 2L12A 1N36L 4UHVA 4PZ8A 3MHBA 1TT2A 4FXGC 1U4PA 4EVOA 1N33L 1RL2A 3HOYH 1I94L 5JPMC 4UP7A 5AJ3Q 1X6OA 2RBMA 2YU9H 2IL8A 2B2TC 4A93B 1B3QA 3H0GH 5K5PA 3I55A 2DY8A 2ZM6L 4DR5Q 3CCQA 1TWHH 1X3FA 2G5DA 2X6LA 2XVSA 3KF6B 4JV5Q 4IPDA 1EYAA 4UP8A 4CJ1B 4N9PA 2KUMA 5IOCA 4JVZA 4A3BG 1HCZA 4DAVA 2JSOA 1RDPD 2Z4HA 4G7ZC 4H02A 2TMPA 2IWHA 4RGTA 1MBYA 2NUCA 2H5XA 5IT9L 5LMNW 5C3EH 3J81i 1V43A 2LY7A 4LJZC 4R4IA 4H7BA 1LM0A 1SE3A 1MHWC 4DV5L 1FYCA 1XMOQ 1IW7C 1KC8C 3TP5A 1BR9A 3MXUA 2ES2A 3QWNA 3CC2A 4RHRA 2IX3A 4POGA 5JEAG 4JBWA 1K73C 4DAYA 3K59A 2IX0A 2OQ0A 5I9PA 5BR8L 3WOFA 2QEXA 1HA6A 2HIXA 1SNCA 3C1EA 1YVCA 1RF2D 3L9AX 2EOTA 1V1OA 1L1OA 2B3GA 1VQ5A 2F1MA 2K1BA 2D2CC 2NZOA 3HKZB 4JPBW 4YWMA 5CV6A 1FNUA 1OO9B 4GN3B 4B3RQ 4MIUA 3DWAA 2DY7A 4HJAA 4ZQ3A 2MNAA 1G6PA 4A3GB 2NWGA 1EZ6A 1G291 2R93H 4OX9L 4A3BB 4QF4A 2K7VA 2PCFB 5JEAJ 4X64Q 5A2QL 4Y7NB 2NTSA 3C2PA 4DK0A 3NQIA 1IBKL 3PIP3 2HQLA 2UXBQ 5ELFA 2N78A 1PFMA 3FEWX 4RMFA 5M5WH 4XQQA 4JG2A 1EY0A 4BXXG 3BDLA 4AYBE 2F0DA 1AW7A 1PFNA 4LF4L 3J80L 1YJWA 5J22A 4DR1Q 4Y52H 1GJXA 1XTCD 3VR3A 2F3VA 5FLXL 1VQIA 1RODA 1KIXA 2DGYA 1PVOA 4JI5L 4GN4B 5CR3A 2R92H 3FPUB 3JAMc 1KRTA 5IYCH 5M3FH 1EQRA 1TS5A 1B70B 3I72A 3VDYA 4LF8L 2VY3A 2B2UA 1STNA 1X65A 1P8LA 5C0XG 4IN3A 2A1AA 2JXMB 2A6HD 4GLVB 4JI3L 2MO1A 3S1RB 3ULPA 3DMUA 4YY3L 3X3NA 1LTID 4GLXA 1XMQQ 3PO2H 1EOTA 3OTOL 1VQ7A 1PH6A 3CCVA 2NN6G 3CC7A 4BWGB 2C5CA 2BH2A 1JWMD 5IYBH 3NEMA 3U9SA 2VS1A 3HOXH 3KF8A 1HR0W 1G6ZA 1MJEA 2DUDA 1UUPA 1WTWA 4LFCL 2QCPX 5C0XJ 1SE8A 1OXSC 1K8AC 2PZTA 3I56A 1X3PA 1WTRA 1GUNA 1D5XC 3R8BA 2PQAA 3HS0C 1X54A 1OXXK 2UUAL 1SNOA 1EWIA 1BBWA 3CCSA 3QB3A 2NZHA 3FP9A 2F0EA 3HG9A 1ESRA 3IFDA 4KMUC 1NBWA 3WOEA 1PYWD 2VXWA 3DUZA 1C48A 1Q12A 4HJ8A 2WIIB 4O2DA 1UE1A 4QIWB 1EZ8A 3VR4A 4DV1Q 1PHJA 4V190 1HUNA 2MO0A 4P75A 2BOSA 3VR6A 1WCMH 3G7LA 5JJKA 1IHZA 3VR5A 2NVXB 1GM5A 2QKIC 1JJGA 4IUQA 1NAPA 3K7AB 4GOPA 5GROA 1ASYA 4IZ8A 5CGKA 3CCMA 1HR0L 1L1OC 4JBKA 3PUYA 2B63G 4AH6A 4XYOA 3BVGA 3E0EA 1U0LA 3S15H 4CDFC 1EIGA 1EIYB 4IURA 4OO1G 1SMXA 4YWLA 2F0JA 3D4WA 2PW5A 3HGBA 4DN4M 2WB1G 4FF3A 1AH9A 3KJOA 1PZKD 4B3SL 5I9OA 3G48A 3HOWB 3HZXA 1D1IA 1SYEA 1ZYRD 3I4NG 2Q2IA 1V1QA 1VQAA 3I4MG 1G2TA 3AFQA 4A3BH 1GO3E 2ICIA 2PW7A 3F2UA 3PSIA 1F2LA 1VQJA 3CPFA 2YTXA 3F1ZA 2K01A 4HEDA 4Y7NH 2KECA 2HD3A 2YYZA 4L8JA 1VCIA 3S2HB 5G3LF 1XNRQ 1GOZA 1UEAB 2Y0SE 1I3QH 3CCUA 1K83B 3CCLA 3SEBA 2F0PA 2RF4A 2VNUD 1NR2A 1D5ZC 1EEID 5JEAH 2Z9HA 3KBXA 2B8GA 1AN8A 2RDGA 2F0HA 4IUNA 2B63B 1B9NA 3K58A 1VQLA 1Y8NB 5ELEA 1VQ6A 2B2UC 4LMQD 1I4QA 1SJHD 3K6OA 3PF5A 5IGCA 3RZDH 1Y8OB 4LF6Q 2LSSA 1B7YB 4YHHQ 1Q1EA 4LUVA 2PNRC 5JJZA 1DD2A 2WINB 2UUCQ 1N9WA 3I4MB 3T13A 1E22A 1HZCA 3S1RH 1OTCA 1XX8A 5HY6A 4CDDC 2JA6B 3MFGA 2PZUA 1W6KA 3GDEA 2LMCB 1H9SB 1Y1WH 5M5YB 4HJ5A 4DV4Q 4X3TA 4PNYA 4GKJL 2D5DA 2UXCQ 4LUOA 3S16B 3VA5A 3CMEA 4QY7A 1HNZQ 4BXXH 4DR6Q 2YTYA 1S5DD 1HJPA 4L6TB 1HQMC 3PO3G 3BZCA 5GAGC 1EQTA 1STGA 5C4JB 3OMCA 1VQ9A 1I50B 4LFBL 3D6WA 2Q2UA 1N33Q 3HOYG 1I94Q 3RNUA 2K75A 4OONA 2X6GA 2EJMA 4GZYC 3MXNB 3KFUA 2ZM6Q 4A3CG 1YNND 4XXEA 1QNKA 2H1EA 4A3EB 2MUYA 2E8GA 3Q0AA 4JW0A 1E2ZA 3IFTA 1D6EC 1VQHA 1I4RA 4LK1C 1VQNA 5IYDG 2WP8J 4HIMA 1ILQA 1TR5A 3KUPA 4C1NI 1Q8IA 1XPRA 3SHLA 1BUVT 1LTSD 1D5MC 4GOPC 5FK9C 3CHBD 1A3TA 3KF6A 1VF5C 3WWVA 2V4DA 2A6HC 1N34L 1EIFA 1SR3A 3TS2A 4OGQC 1B3AA 2IHEA 2E2JB 4DV5Q 2QF7A 3J81E 1QWYA 2NVXH 4FNFA 1A15A 2CWAA 2OT2A 3AB9A 1TWFH 3K7AH 2WAQE 5GQOA 1U4LA 3PO3B 4RFBA 4X62L 1R4PB 2HCCA 5JOBA 4CDCC 5E1FA 5JVG3 3X3MA 4BBSG 2F0IA 5BR8Q 5C4XG 3NP8A 2UU9L 4JC0A 3HOYB 3K80C 1EWHA 2IPKD 2YU9B 3H0GB 1ML0D 5DLQE 2I0QA 1P16A 1LTTD 2GVAA 4IUPA 4DV6L 1PH3A 2F52A 2QGQA 5C6AA 1L0XB 1SYFA 2E74C 4A3DG 1SMYC 2R93G 4OX9Q 3EFXD 3HOUG 2Y0SG 2F0QA 4KI0A 1OXUA 3BZKA 4KY7A 5CBEE 4KD3A 1BCPB 3AYHB 3H3VC 1VF7A 4XDXA 4JI4L 5C3EB 4LUZA 1SYBA 4DR4Q 4HCSA 4TVAB 5KNCA 2PMZE 2CWPA 4PMWA 3TN2A 3ND9A 2ZTCA 1DCZA 1PYSB 1E0BA 1F9PA 4X66L 1K83H 3KOJA 4H44C 4LF4Q 3AEVA 1XJVA 2EJGC 1C7YA 4OELB 5EQ0A 5DEHA 1Y1VG 2HIVA 2B63H 3V05A 5K36G 4BBSB 3CF5A 5C4XB 3A5UA 2AQ3B 1DOLA 4XIGS 4JI5Q 4OO1H 2R92G 2ZJPA 1Q8KA 4MNOA 4P74A 4DV2L 4LF8Q 2OTJA 4N8FA 2CQAA 3RN2A 1WVLA 1QUQB 2M2LA 2XRSD 2HCIA 2XTIA 3AFPA 2F0TA 4KKTA 1A2TA 1BXTA 3GTOB 2FXQA 2I5HA 3NXWA 2R93B 4JI3Q 3I4NH 3JAME 3HOUB 3I4MH 2Y0SB 4YY3Q 1LLRD 4JI1Q 4IUTA 1W3SA 2CW0D 4LW1A 1XNQL 1J8IA 1LT5D 2N49A 1U4RA 1NNXA 5BN5A 1EL0A 4CBVA 1ZYRC 4WJWA 5M5WB 3OTOQ 3H3VI 3STBD 4QUFA 1TS2A 3QIAA 4HIOA 3NENA 4ZUIA 3S16H 1NUCA 2K5QA 4IUVA 5I4DA 3J80c 1BVSA 1CZWA 2JJQA 1CTMA 1WTXA 4IJLA 5D3DA 3TS0A 5FLXc 5C4JH 4K14A 1Y1VB 4LFCQ 1EEFD 2DJFC 1TIID 1I50H 1IYVA 4DR2L 3UDFA 2FMMA 5FLMG 5JAVA 1FGUA 1D7QA 4NKLA 3I70A 2R92B 1DM0B 1SAPA 3FPPA 2YV5A 1Q90A 2UUAQ 1N8RC 1LABA 4XTCS 2IHFA 4IOAA 2IX1A 1WJJA 1SNQA 3ULJA 1MSGA 1ESFA 4BA1I 2ICEC 1BO0A 5EJWA 1RIPA 3SK4A 1PRTB 3DM1A 4K6DA 1HHVA 1H9MA 2BE5D 2OCEA 4DK6C 4ZK9B 1II3A 2MP1A 2E76C 3EVQA 3HFZB 1U4MA 3HOXB 1PFBA 2LKVA 1JJ2A 4HJ7A 1HR0Q 1E1OA 2BCOA 4QIWE 3UDIA 5KNDA 1KAAA 5FKAC 1OXVA 1IBLL 1SN8A 4C3IG 2K4KA 5JPNC 5IY0A 3CCEA 3F8TA 2E2DC 3OWFA 3URYA 1KD1C 1ZXTA 3RD4A 4BY7G 3M4YA 4ZLTF 4RG1A 4BY1G 1I4GA 4EQOA 4L5RC 4A3CH 5ISRA 1B1ZA 4HN7A 1YJ9A 4B3SQ 2ALYB 2EYOA 2R61A 4JK1C 1YHQA 1GXDC 3PCOB 1PTOB 2VQEL 5DAUA 5IYDH 4HR7B 2XNAC 1PH4A 5M9OA 3MAQA 1B2TA 2WAQB 4FVMA 3D3RA 5TSSA 5CMDA 4MTNA 4QJFA 4UPAA 1WCMB 2JYOA 1CA5A 5GAEC 3BYYB 2VW9A 2B29A 4FF1A 1R9TB 3ER0A 4DNIA 3A8JE 4GNXB 5IGGA 1LACA 3HOZG 2SDFA 4O0AA 1IKMA 1EY5A 1JOKA 1EY4A 1RCVD 3E9IA 2PQEA 2D9UA 2KCMA 5FOBB 4DNRB 4BBSH 4C3IB 3S15B 3MXPA 1U9RA 2G9DA 1O7YA 5C4XH 2OXPA 1HZ9A 1S5CD 4IFDG 3NTHA 1JJCB 3BS1A 1PA6A 1YI2A 1GKHA 3UDXA 4BY1B 1XPOA 1PYBA 3M9BA 3I90A 3W1GA 1QNUA 1GD7A 3PUWA 1TKWB 3LWEA 3P7JA 5FO7B 1QILA 4A3DH 2R6GA 3GTOH 2PMZB 5T1IA 3N6RA 4EX5A 1OXTA 3HOUH 2IY5B 2HDLA 4KHVA 4LF7L 4EQPA 1I6HB 2WB1E 1STAA 1XYIA 2MHVA 1ENCA 1CQVA 2JA5G 3G71A 1S72A 1F2ZA 2Z4IA 3GTMB 1EUJA 2AHOB 1CQFA 1CSPA 1BBXC 4GKJQ 1EQQA 4UY8C 4IFDJ 1DOMA 1I3QB 1JC7A 4QL5A 3Q22A 1UE6A 5I2XA 4NP5A 1SROA 1SRUA 3VYUA 1YZ6A 3HOZB 1WYDA 2HQEA 1TS4A 4M8AA 1Y1VH 5EAYA 1O80A 5C5LA 5K36H 4LFBQ 4K8JA 3GTLB 1SSOA 3S24A 3MEHA 4A3KG 3CMAA 1AP0A 3OW2A 3MWYW 4X65L 5E4XA 4JBJA 3E3XA 3A56A 4PMBA 3RZDB 2N55A 3EROA 2Q8RE 5EGTA 2EZVA 5FJ8G 2MQHA 3RLFA 4K0KL 1K0SA 4G4KA 4AQYL 4BBRG 2Q8TA 5ELBA 4K2LA 4FO2A 3JAMi 1CKNB 4C2MB 3G6EA 1BCPD 1ENFA 3CU7A 3K5OA 2UXDL 4ID6A 5IGDA 3P1HA 3MXNA 1D2BA 1EY8A 2X69A 3T56B 1BQQT 1SDFA 2JA5B 4ZYSA 3KLSA 2NYZD 1NMFA 1YITA 4L5SA 1EQVA 3LWUA 4PZ7A 4GN5A 1N34Q 5C44G 4NPSA 1JR0D 1HFGA 1CA6A 3U9OA 2NBFA 3HOVG 2CW0C 1FJGL 5KRUA 5F2DA 3CQZB 3A7LA 2JE6I 4X62Q 3NTKA 3Q8DA 1IKLA 3GV6A 1MGSA 5C5MA 1SNDA 5D14A 1FGBD 1NSNS 1TWAB 1SE2A 4DK3C 2UU9Q 3K0YA 1D1KA 2RDFA 2JEBI 4IUUA 4PMCA 4A3KB 3S1QB 5FLMH 3AU7A 3BJUA 5HGTA 5KNBA 4CJ2C 2HT1A 4F8MA 2OEOA 3A5ZB 1Q1BA 4DV6Q 5CYUA 3VR2A 4BBRB 4RCOA 1VQ4A 4DV3Q 3PV0A 3SK8A 3AMUA 1T5XD 3RZOB 1PTOH 1A3UA 3DWPA 5D3IB 1PZJD 1TWGH 1AZQA 2CKZB 3A0JA 5C3WA 3R2IA 5L37A 5C0XI 5AFWA 1GVPA 1QJOA 4JI4Q 3M3YB 3GTPH 1VMPA 3OYYA 2C35B 1QOHA 5M3MH 5IT9E 1R9TH 2UUBQ 4X66Q 1SNMA 1TWFB 4DR3L 3EN2A 4H0LC 3K0XA 1IBML 2NN6I 2BE5C 3FKIG 2FJ2A 2VUMG 1RHPA 1YNXA 4DK1A 5KYLA 4C3IH 1VQOA 2AWOA 3TP6A 1PH9A 4B3TL 3DM3A 1L0YB 5LHY1 4DUYL 4BY7H 3PMFA 3PIO3 1J5EL 2I5LX 5CV9A 2XGTA 3TEHB 4XQNA 4DV2Q 4BY1H 4NB3A 3S9WA 1STBA 1PMRA 3PUXA 4U673 1HXYD 2R7ZG 2M00A 3FVQA 1JE4A 5CV5A 1CHQD 2PNHA 4V0BA 2F03A 1QZHA 4A3IH 4JI2L 3P20A 1PZID 2NVQH 1TY2A 1PRTD 3KK7A 4DFAA 3JC66 1Q46A 3KDFA 2RCNA 4MHEA 3GTJH 1XNQQ 1I6HH 1ENAA 1WI5A 2F4VL 3CXCA 1RTNA 2L15A 3L0OA 1QUQA 1G2SA 5EBCA 3GTMH 1B8AA 3E5SA 5COYA 2EYHA 3I4OA 3SVMA 4OWTB 5BN3A 4JI7L 5DM63 5A2QE 1DXMA 1S3OA 5CV7A 5EKLA 1SYGA 1KDCA 3HP3A 3HOZH 1F9RA 4X3KA 1VQKA 2AKWB 3ULLA 4DR2Q 3K7UC 2K28A 3GTLH 4HMIA 3FRPB 1QVFA 3J80E 4OWWB 1EYDA 4LF9L 1A2UA 5IP7G 1WFQA 2F3IA 4IFDH 1PTOD 2WACA 4NMZA 2K14A 3PIOA 4IPCA 1K8OA 1WTPA 2F0NA 2WB1B 4N8X1 4OO1I 2R7ZB 1DZ1A 4TRDA 4GLAC 1TVXA 1UNSA 4IPHA 2AQ2B 4WRDA 4C2MH 1ET9A 5IWAQ 4QQBX 1J9OA 3I4NB 1LT4D 3HRZC 5IODA 3S17B 4ZKCB 1V8QA 4JOIA 1XPUA 3AQQA 1N32L 3K81C 1GHKA 4POFA 2QILA 4PV1C 3RR5A 5E7NA 4GKKQ 3EBEA 3L7ZC 4R9WA 3F2CA 1GUGA 3HKSA 4LAAA 1X9NA 2JA5H 2ATWA 1S5BD 2IJ0A 3OHXC 2RDHA 5DM73 3H94A 1NMGA 4DV0Q 1EY6A 3VYRA 2PI2E 2RA4A 3TMEA 4B3RL 3OIQA 2GA4B 1X3EA 3BZDB 3CQZH 3GP7A 2BDNA 3BDOA 1N36Q 2CQOA 4X64L 3GD7A 2L4NA 1TWAH 1PLFA 2DNCA 1M1KC 3ICEA 1ILPA 3KBGA 3OPOA 4A3KH 3PUVA 3S1QH 1GUWA 3CKIB 5CBAE 4IPGA 3I4LA 3R3OA 4JI0L 2Q2HA 5EPJA 4OL7A 2DJGC 5FJ8H 1UWVA 4DR7L 4BBRH 4LNQA 2K32A 3SDZA 4MZ9A 1X3GA 5IGEA 3RZOH 1QE6A 5CV4A 5I6WA 1BKBA 3RUZA 1X56A 3PF4A 1HPCA 3WDNA 3G4SA 1JORA 2VL6A 5JJIA 4Q0FA 4QMGA 4KY6A 4O1NA 1BCPC 1JOQA 2XWJB 2FINB 1E24A 4ZAIA 3M3YH 1EFID 5C44H 5GADC 4A75A 3M4OB 3I91A 2K5NA 1R4QB 4P72A 4RA8A 3I73A 2ENBA 1AFPA 5EKIA 1K9MC 3OMGA 3HOVH 1KHIA 2E75C 1YBYA 2KQ3A 5GAHC 4L5TA 4E6IA 1KTKA 1WOCA 1EU4A 3R93A 2F0GA 2CH4A 1JB3A 3PQIA 1XMQL 1T5EA 1NR4A 1U5KA 3Q23A 5IGBA 4C3HG 1EU3A 1CKMA 2A6ED 4DPGA 3OW7A 5EBDA 5KGUA 2V1CC 4IO9A 1SE4A 1O78A 3IL8A 2JA7G 1SYDA 4A3LG 4R4QA 2F0OA 1I6VC 4RWSC 2A69D 2CVRA 2WFWA 2SNMA 1SEBD 3ND8A 4AIMA 1RD9D 4LF7Q 2BA0A 1KRSA 4UP9A 1G51A 4IQZA 3ERQA 4K8IA 1IBKQ 2L1BA 3CW2C 2NVYH 3UE1A 2XN9C 3I8ZA 3T1HL 1Q82C 4FF4A 3E0JA 3TREA 1LUZA 2H4OA 2ZXPA 1VMCA 2EYPA 2EYMA 2P5ZX 2NVTB 4PG3A 4YCWA 1TU2B 1WTVA 4LFAL 1QVCA 1AZPA 3FKIH 2CCZA 2HHHL 5KEEA 2VUMH 5A35A 2HDMA 2WKDA 1QVGA 4B9XA 1BCPF 1V1PB 3RLNA 1B53A 2OTLA 4X65Q 1K8GA 4K5XA 1SFOH 4C3HB 2AWNA 1KDBA 4JOIC 2K5DA 3KLWA 4KN4C 2ZJRA 4AQYQ 2R7ZH 4YCVA 2JA7B 4B08A 1DONA 4R4TA 1SXTA 4DF7A 4A3DB 1Z9FA 5KYIA 1AE3A 2KCNA 3S17H 3Q6SA 2R3ZA 2E2IH 2KEDA 4DU9A 1EOVA 1EIHA 3NBHB 1LO5D 4K5WA 5FO9B 3GTGB 1HNXL 3D4RA 1NTGA 1CKNA 1PRTC 1LTLA 4ZUJA 3OIPA 3TRZA 3CP0A 3IAYA 3T51B 2KCTA 1FJGQ 2WKCA 4OIKA 1M8AA 4RH6A 4R1JA 1ET6A 1Z7TA 2VQFL 1QZGA 4KKSA 2EY2A 5HURA 2L9HA 1MSHA 2F0WA 3J80i 4J6HA 4MN3A 1RKNA 2QDBA 1FL0A 4TKOB 4C56C 5IP7H 3BVZA 4JI6L 4OHJA 3CRLC 3GV3A 2B2YA 2ZXRA 4B9WA 3KJPA 1UAPA 1Y69U 2F4IA 1RTOA 2D62A 2F0UA 1PTOC 1H95A 1E2VA 1Q3LA 1I4PA 4XYQA 3V96A 2F0KA 1EFWA 3H6MA 2B2VA 1H9JA 4A93G 3T4AC 1IXRA 3B6YA 2Q2TA 1YNJD 3L2PA 1F2YA 1G8ZD 1MKHA 5IP9G 3K5LA 5M3MG 4CKEA 2IT1A 3M4OH 4P73A 5IGFA 4PZ6A 3DHQA 2PYKA 1HTPA 3NQTA 4DR3Q 2BA1A 3QG1A 4DNTB 3BG3A 4HMJA 4JYAL 1K8MA 3MTSA 1WTOA 4GNXC 1IBMQ 1X3QA 2LXJA 2EYFA 3NSWA 1L2FA 4NW2A 5DNFA 2Z0SA 1YIJA 1BDOA 2E5LL 4HTHA 1STHA 2SEBD 2JQOA 4DKAC 1SJED 1PRTF 3T16A 2UXCL 1EY7A 1J5EQ 1X55A 4DUZL 2JA9A 2L0CA 3PUZA 4X3SA 1KL9A 1HNZL 2K33A 3S2DH 1WD0A 2Z1CA 1MJCA 1A0IA 4ZKBB 2EE1A 5ELDA 4CDEC 5J3BA 1UEBA 1E3PA 4A3IG 4JI2Q 1VQMA 5HGQA 1VQEA 2QDLA 3IRBA 3ZJYC 1QG7A 1TWGB 4DV7L 2O2LD 2XRQD 1Y1WG 1YNNC 1HTLD 3GQBA 3S14B 4HIDA 2F4VQ 3G6JB 1K3BC 3J7ZC 1KXLA 4HSVA 4UDUC 3HKZG 4NXNL 3GTPB 4BS9A 1E2WA 1EYCA 5IIFA 5M3MB 5M5XB 4DA2A 4JI7Q 1QCBD 2VZAA 4PQXA 4A4IA 1IYJB 1TWCH 1IYUA 1XWEA 2EY5A 2FHTA 3LNNA 5EPLA 4NDXA 4A3GG 2NVTH 1KQSA 1PTOF 3J81c 3TDQA 1EWCA 3U50C 2Z6BA 4HCEA 3IKJA 1M4VA 2N88A 3QOLA 2DN8A 3TZUA 1VQCA 2A68D 5EKKA 3K5MA 3CCRA 2K52A 4B3ML 4X3UA 4H13C 4F7XA 4LF9Q 3VYSA 1A3VA 5JVH3 4RKBA 1ASZA 4BY7B 1D8LA 4C3HH 1H9KA 3H91A 1KNEA 4RGMA 3OOCA 4A3IB 2B39A 4R4CA 2BH8A 2JA7H 3E6ZX 4A3LH 1HQRD 2NVQB 1KNAA 2B2WA 3A7AB 1Q86C 2ASBA 2OF1A 4FDBA 2A6EC 1N32Q 3GTJB 1Y1WB 3BU2A 3S1MH 2A73B 1JCKB 3DEOA 2FMCA 2OQKA 3GTGH 1VQFA 1BNZA 2A69C 2MGSA 1KLGD 2MJ8A 4CHTB 3T1YL 4F87A 3L3OC 4OWXB 1AEXA 3S1NB 5LMUL 1F9QA 4ME5A 4P71A 1Q81C 4J15A 2E2HH 1H9SA 3C46A 3H3VH 2XWBB 3M4QA 2F0LA 1MD2D 2B2YC 4M1UB 3ZYYX 4DR4L 5LMNL 3NELA 3QOJA 1CT1D 3FHWA 2A8VA 1HH2P 1SBBB 5T1GA 3K57A 2QA4A 1MI2A 1TQOA 3M7GA 4JI0Q 2KVMA 2KHIA 3BDCA 4KY5A 3M85A 1ZEQX 1AE2A 4OEMB 4KN7C 1F77A 1TS3A 1W6JA 4DR7Q 4IFDI 2B2VC 3A54A 1VQ8A 4KLKA 4RKLA 2OWOA 3KLSX 1PFSA 3NE5B 3NK9A 3NWSA 4HJ9A 3OWEB 4JI8L 1JE5A 5I6YA 2D0OA 1M90C 3EJIA 1HNWL 3BVMA 5BN4A 5I2YA 3J7AF 1DJRD 5H1SE 3C3LA 2EYJA 2R7DA 2EPBA 1YHBA 1HUMA 4ULLA 4C1NK 2EYLA 1CI3M 1SNPA 3H09A 5EPKA 2G9HD 5JJLA 1LT3D 4JI1L 4RGOS 2PPBC 3N52A 4QB4A 3STBC 3F2DA 3NBIA 2K03A 1FR3A 1KABA 2F0FA 1GUOA 1HZAA 3PIPA 2Z8LA 3I2ZA 1Z47A 2CH4W 1NE3A 4GS3A 4APVA 4XT3B 3LGJA 1UE7A 1O7IA 1BBUA 1YEZA 4K2KA 2K04A 2A74C 3GTKH 3U4VA 1RJTA 1HA5A 3DWQA 1HZBA 2HUGA 1JWUD 1UE5A 2RSOA 1EY9A 4DXFA 4EQNA 4A3MG 4HAEA 1SMYD 3CAMA 3S14H 1NCVA 4ALPA 4ME3A 1C8CA 4A93H 4N9TA 3U58A 3J7AV 4WORA 5C44B 3T1HQ 5IP9H 3MVVA 3HOWG 3MXGA 5M5XH 2RCFA 3H15A 4DAMA 3HOVB 5FO8B 2CFMA 4KHPL 1JICA 4L5QA 1NY4A 4LFAQ 1YNJC 1KAWA 1GHJA 1STYA 3UI2A 3GO5A 3J81L 3F2BA 3SR1A 1O7ZA 1ZKOA 2HHHQ 1T9HA 1WD1A 4CKBA 1PV4A 4NXML 1SYCA 2KHJA 2IW3A 1DGSA 1GUTA 2B2WC 2L5TA 2B8FA 4RGNA 1DYQA 2C9OA 1ICWA 4G7OC 4LF5L 3NHHA 3RMHA 1L0WA 2ZXOA 4Z9CB 1K3RA 2AUKA 1V1PA 1KLUD 1SLJA 2QW7A 2Z6KA 2RHSB 4OXPA 4EQ5A 1PH7A 4FYDA 2EY1A 4DGZA 1J6QA 1WTHA 2EIFA 5AJ3L 2KBNA 2VB3X 2GVBA 4A3MB 1YJNA 5D65A 1GUSA 1HNXQ 4WFN3 3FMCA 3BYTB 2NVYB 1CFMA 4DR5L 4J1MA 1HRJA 1K28A 1I4HA 1FVIA 3QO2A 4JV5L 1YHAA 1I4XA 3S1NH 4A3GH 4U68A 3NBHA 1IL8A 4DXGA 2VQFQ 1PH8A 2EQSA 4AYBG 2N3SA 2J7ZA 2RQXA 2JA6G 3PGZA 4A3JG 3FKIB 2VUMB 2R7FA 1E1TA 4DAYB 4RHSA 1CUKA 1PH1A 3K8AA 4XT1B 4JI6Q 1SFOB 3A74A 1K0RA 2ZTEA 3CCJA 2RSNA 3UDGA 1XMOL 5FLXE 3NUCA 4K6LA 3ERSX 1JMCA 4HSPA 2L11A 1L1OB 1CSQA 3C1FA 3W5OA 2A68C 2O5JC 2FFKB 2I46A 3DXJC 5CORA 2JA8G 1DOKA 3J81j 2E2IB 2KJXA 3ITPA 2F0MA 2JP1A 2RHQB 1HFNA 1XTDA 4C3JG 3MA2B 3W2DA 5KIXA 2I5MX 3RLOA 3D0FA 4MTKA 5E4WC 1F9SA 3JAML 1IL2A 4BA2I 4A3EG 4Q5VA 1PDQA 2K5HA 4KKUA 2CHBD 3GTQB 4R4OA 3QJYA 2PI2A 2ZTDA 1XXGA 4A3FG 1IZ6A 4I65A 4ODGA 4JYAQ
chains in the Genus database with same CATH topology
4AYBB 4A3JB 3T53B 3J7YW 4TSSA 2BDOA 4IALA 4K5VA 4QUCA 2ID0A 1LTGD 2KHSA 2TSSA 4J8QA 2K05A 4KJOA 1X32A 1Y8PB 2JA8B 2JEAI 2L55A 1ONLA 3DEPA 1S5FD 3KLRA 3A8IE 4C3JB 4R8IA 2VB2X 4QCLA 1JOOA 5C0XH 4I7ZC 4P2CB 4FP5D 4A3FB 2NB0A 1LV9A 3FDTA 3SK6A 4TQUS 5CC4A 2LFNA 1IW7D 1FNWA 4ZRZA 3A8KE 1BOSA 5LL6S 1LTRD 3VYTA 2AUJD 2RVLA 5C4ZA 1H9RA 4G57A 1F2MA 3S2DB 2NN6H 2KEEA 3V2TA 2XIWA 4KTAA 2K6AA 3NPPA 5NUCA 2KCCA 1Z6HA 3MFYA 5LL6X 4RAUC 4YIJA 1LTBD 3NWTA 3SXHA 5CV8A 3K5NA 1QB5D 3TZDA 3M7NA 3A55A 2WV6D 1TWHB 5C3XA 1B50A 5C4HA 1B9MA 1TWCB 4RCNA 2B2TA 2Q8IB 2PZWA 4KD4A 5ELCA 2O4XA 4R8NA 3HEJA 3TSSA 2K5WA 4UAIA 3EA6A 1B4OA 2DNEA 1FNVA 4KHZA 1LTAD 3LX0A 1BF4A 1O7LA 1B44D 3D31A 5E3FA 1VDZA 2F0VA 3S1MB 3TBIB 3MZ5A 2I07B 2RKSA 4DAPA 2O5IC 2EVBA 2F3WA 2J4XA 3TP8A 1A6XA 3D6CA 4CJ0B 4KJNA 2MPMA 4CKCA 3CRKC 4L63B 2NZ1D 2J0TD 3D4DA 3ONAB 2KA7A 4FXKC 2E2HB 4FF2A 2ZT9C 4G7HC 4ILWA 1KDAA 1S5ED 4XQJA 1CK1A 2SOBA 3O13A 5J39A 1FD7D 3W3AA 4KV6A 4OIJA 1G91A 4EGVA 1CZGA 5G3LD 3I3CA 3R2TA 1PXUA 3NTIA 1TY0A 3EQLC 2EY6A 2EDGA 1STEA 5M3FB 2NTTA 2A5HA 4FXDA 3Q24A 4O42A 2F0SA 4F88A 4ABNA 2SNSA 3MC0B 1CHPD 1JWSD 4CGYB 1JQYD 2LS01 3SE0A 3OSOA 1S4ZA 5J1ZA 2PO4A 1C4QA 4S3SA 4KK7A 3PO2B 2EJFC 1LT6D 2EXZA 2QEJC 3SK5A 3P75A 3VA7A 2KOLA 2XSCA 1CM9A 3D8GA 2M9VA 2AQ1B 3TP7A 1WTQA 3GTKB 2L12A 3MHBA 1TT2A 4FXGC 1U4PA 4EVOA 5JPMC 2RBMA 2IL8A 2B2TC 4A93B 5K5PA 2DY8A 2X6LA 2XVSA 1EYAA 4CJ1B 4N9PA 2KUMA 5IOCA 1HCZA 4DAVA 2JSOA 1RDPD 2Z4HA 4G7ZC 2IWHA 2TMPA 4RGTA 1MBYA 2NUCA 5IT9L 1V43A 2LY7A 4LJZC 4H7BA 1SE3A 1FYCA 1IW7C 3TP5A 1BR9A 3MXUA 3QWNA 4RHRA 2IX3A 5JEAG 4JBWA 4DAYA 3K59A 2IX0A 5I9PA 3WOFA 1HA6A 1SNCA 3C1EA 1RF2D 2EOTA 3L9AX 1V1OA 2F1MA 2K1BA 2D2CC 3HKZB 5CV6A 1FNUA 1OO9B 4MIUA 3DWAA 2DY7A 4ZQ3A 4A3GB 2NWGA 1EZ6A 1G291 4A3BB 4QF4A 2K7VA 2PCFB 5JEAJ 5A2QL 4Y7NB 2NTSA 3C2PA 4DK0A 3NQIA 3PIP3 5ELFA 1PFMA 3FEWX 4XQQA 1EY0A 3BDLA 2F0DA 1AW7A 1PFNA 3J80L 5J22A 1GJXA 1XTCD 3VR3A 2F3VA 5FLXL 1RODA 5CR3A 3FPUB 1TS5A 3I72A 2B2UA 1STNA 5C0XG 4IN3A 2JXMB 2A6HD 3S1RB 3DMUA 3X3NA 1LTID 1EOTA 2NN6G 4BWGB 2C5CA 1JWMD 3U9SA 3KF8A 1G6ZA 1UUPA 1WTWA 5C0XJ 2QCPX 1OXSC 2PZTA 1X3PA 1WTRA 1GUNA 1D5XC 3R8BA 3HS0C 1OXXK 1SNOA 3QB3A 2F0EA 3HG9A 1ESRA 3IFDA 4KMUC 3WOEA 1PYWD 2VXWA 3DUZA 1C48A 1Q12A 2WIIB 4QIWB 1EZ8A 3VR4A 4V190 1HUNA 2BOSA 3VR6A 3G7LA 1IHZA 3VR5A 2NVXB 2QKIC 4IUQA 1NAPA 3K7AB 4IZ8A 5CGKA 3PUYA 4XYOA 3BVGA 1EIGA 4IURA 4OO1G 2F0JA 3D4WA 2PW5A 3HGBA 4DN4M 4FF3A 1PZKD 5I9OA 3HOWB 3HZXA 1D1IA 1SYEA 1ZYRD 1G2TA 2ICIA 2PW7A 3F2UA 1F2LA 2K01A 4HEDA 2KECA 2YYZA 4L8JA 1VCIA 3S2HB 5G3LF 1GOZA 1UEAB 1K83B 3SEBA 2F0PA 2VNUD 1NR2A 1D5ZC 1EEID 5JEAH 3KBXA 2B8GA 1AN8A 2RDGA 2F0HA 4IUNA 2B63B 1B9NA 3K58A 1Y8NB 5ELEA 2B2UC 4LMQD 1I4QA 1SJHD 3K6OA 5IGCA 1Y8OB 1Q1EA 2PNRC 5JJZA 1DD2A 2WINB 3I4MB 3T13A 1XX8A 2JA6B 3MFGA 2PZUA 1W6KA 2LMCB 1H9SB 5M5YB 4X3TA 4PNYA 2D5DA 3S16B 3VA5A 1S5DD 4L6TB 1HQMC 1EQTA 1STGA 5C4JB 3OMCA 1I50B 3D6WA 2X6GA 2EJMA 4GZYC 1YNND 4XXEA 1QNKA 2H1EA 4A3EB 2MUYA 3Q0AA 1E2ZA 3IFTA 1D6EC 1I4RA 4LK1C 2WP8J 1ILQA 1TR5A 3KUPA 4C1NI 1Q8IA 3SHLA 1BUVT 1LTSD 1D5MC 5FK9C 3CHBD 1A3TA 1VF5C 2V4DA 2A6HC 4OGQC 1B3AA 2E2JB 2QF7A 3J81E 1QWYA 4FNFA 1A15A 2OT2A 3AB9A 3PO3B 1U4LA 4RFBA 1R4PB 2HCCA 5JOBA 5JVG3 5E1FA 3X3MA 2F0IA 3NP8A 3HOYB 1EWHA 2IPKD 2YU9B 3H0GB 1ML0D 1LTTD 4IUPA 5C6AA 1L0XB 1SYFA 2E74C 1SMYC 3EFXD 2F0QA 4KI0A 1OXUA 4KY7A 5CBEE 4KD3A 1BCPB 3H3VC 1VF7A 4XDXA 5C3EB 1SYBA 4HCSA 5KNCA 4PMWA 3TN2A 3ND9A 1DCZA 1E0BA 1F9PA 4H44C 2EJGC 5EQ0A 5DEHA 5K36G 3V05A 4BBSB 5C4XB 2AQ3B 1DOLA 4XIGS 4OO1H 2CQAA 1WVLA 2M2LA 2XRSD 2HCIA 4KKTA 2F0TA 1A2TA 1BXTA 3GTOB 2R93B 3NXWA 3JAME 3HOUB 2Y0SB 1LLRD 4IUTA 2CW0D 1J8IA 1LT5D 1U4RA 5BN5A 1EL0A 4CBVA 1ZYRC 4WJWA 5M5WB 4QUFA 1TS2A 3QIAA 4ZUIA 1NUCA 2K5QA 4IUVA 5I4DA 1CZWA 1CTMA 1WTXA 5D3DA 4K14A 1Y1VB 1EEFD 1TIID 1IYVA 2FMMA 5JAVA 4NKLA 3I70A 2R92B 1DM0B 1SAPA 3FPPA 1Q90A 1LABA 4XTCS 2IX1A 1SNQA 1MSGA 1ESFA 4BA1I 2ICEC 1BO0A 5EJWA 3SK4A 1PRTB 3DM1A 4K6DA 1HHVA 1H9MA 2BE5D 4ZK9B 1II3A 2MP1A 2E76C 3EVQA 1U4MA 3HOXB 1PFBA 2LKVA 2BCOA 5KNDA 1KAAA 5FKAC 1OXVA 4C3IG 5JPNC 2E2DC 3OWFA 3URYA 1ZXTA 3RD4A 3M4YA 4ZLTF 1I4GA 4EQOA 5ISRA 1B1ZA 4HN7A 2EYOA 2R61A 4JK1C 1GXDC 1PTOB 5DAUA 4HR7B 2XNAC 5M9OA 3MAQA 1B2TA 2WAQB 4FVMA 3D3RA 5TSSA 5CMDA 1WCMB 2JYOA 1CA5A 3BYYB 4FF1A 1R9TB 3A8JE 5IGGA 1LACA 2SDFA 1IKMA 1EY5A 1JOKA 1EY4A 1RCVD 2PQEA 2D9UA 5FOBB 4DNRB 4C3IB 3S15B 3MXPA 1U9RA 2G9DA 1O7YA 2OXPA 1S5CD 4IFDG 3NTHA 3BS1A 4BY1B 3I90A 1QNUA 3PUWA 1TKWB 3LWEA 3P7JA 5FO7B 1QILA 2R6GA 2PMZB 5T1IA 3N6RA 1OXTA 2HDLA 4KHVA 4EQPA 1I6HB 1XYIA 1STAA 2MHVA 1ENCA 1CQVA 1F2ZA 2Z4IA 3GTMB 1CQFA 1BBXC 4IFDJ 1DOMA 1I3QB 1JC7A 3Q22A 5I2XA 4NP5A 3VYUA 3HOZB 2HQEA 1TS4A 4M8AA 1O80A 5C5LA 5K36H 4K8JA 3GTLB 1SSOA 3MEHA 1AP0A 3MWYW 5E4XA 3A56A 4PMBA 3RZDB 2N55A 3EROA 2Q8RE 5EGTA 2EZVA 3RLFA 4G4KA 2Q8TA 5ELBA 4K2LA 4FO2A 4C2MB 1BCPD 1ENFA 3CU7A 3K5OA 4ID6A 5IGDA 3P1HA 3MXNA 1D2BA 1EY8A 2X69A 3T56B 1BQQT 1SDFA 2JA5B 4ZYSA 3KLSA 2NYZD 1EQVA 3LWUA 1JR0D 1HFGA 1CA6A 3U9OA 2NBFA 2CW0C 5KRUA 5F2DA 3CQZB 3A7LA 2JE6I 3NTKA 1IKLA 3GV6A 1MGSA 5C5MA 1SNDA 5D14A 1FGBD 1NSNS 1TWAB 1SE2A 3K0YA 1D1KA 2RDFA 2JEBI 4IUUA 4PMCA 4A3KB 3S1QB 3AU7A 5HGTA 5KNBA 4CJ2C 4F8MA 2OEOA 1Q1BA 5CYUA 3VR2A 4BBRB 4RCOA 3PV0A 3SK8A 3AMUA 1T5XD 3RZOB 1PTOH 1A3UA 3DWPA 5D3IB 1PZJD 1AZQA 5C3WA 3R2IA 5C0XI 5AFWA 1QJOA 3M3YB 1VMPA 1QOHA 5IT9E 1SNMA 1TWFB 4H0LC 2NN6I 2BE5C 2FJ2A 1RHPA 4DK1A 5KYLA 2AWOA 3TP6A 1L0YB 5LHY1 3PMFA 3PIO3 5CV9A 4XQNA 3S9WA 1STBA 1PMRA 3PUXA 4U673 1HXYD 2M00A 3FVQA 1JE4A 5CV5A 1CHQD 4V0BA 2F03A 3P20A 1PZID 1TY2A 1PRTD 3KK7A 4DFAA 4MHEA 1ENAA 1RTNA 1G2SA 5EBCA 3E5SA 5COYA 2EYHA 3SVMA 5BN3A 5DM63 5A2QE 1DXMA 5CV7A 5EKLA 1SYGA 1KDCA 3HP3A 1F9RA 4X3KA 2K28A 4HMIA 3FRPB 3J80E 1EYDA 1A2UA 4IFDH 1PTOD 2WACA 4NMZA 1K8OA 1WTPA 2F0NA 2WB1B 4OO1I 2R7ZB 1DZ1A 4TRDA 1TVXA 1UNSA 2AQ2B 4WRDA 1ET9A 1J9OA 3I4NB 1LT4D 3HRZC 5IODA 3S17B 4ZKCB 1V8QA 1GHKA 2QILA 4PV1C 3L7ZC 4R9WA 1GUGA 4LAAA 1S5BD 2IJ0A 3OHXC 2RDHA 5DM73 3H94A 1EY6A 3VYRA 2RA4A 3TMEA 3OIQA 2GA4B 3BZDB 3GP7A 2BDNA 3BDOA 3GD7A 2L4NA 1PLFA 2DNCA 1ILPA 3KBGA 3OPOA 3PUVA 1GUWA 3CKIB 5CBAE 3I4LA 3R3OA 5EPJA 4OL7A 2K32A 3SDZA 5IGEA 1QE6A 5CV4A 5I6WA 3RUZA 1HPCA 3WDNA 1JORA 4Q0FA 4QMGA 4KY6A 4O1NA 1BCPC 1JOQA 2XWJB 2FINB 4ZAIA 1EFID 3M4OB 3I91A 1R4QB 4RA8A 3I73A 2ENBA 1AFPA 5EKIA 3OMGA 2E75C 2KQ3A 4E6IA 1KTKA 1EU4A 3R93A 2F0GA 1JB3A 1T5EA 1NR4A 3Q23A 5IGBA 4C3HG 1EU3A 2A6ED 5KGUA 3OW7A 5EBDA 1SE4A 1O78A 3IL8A 1SYDA 2F0OA 1I6VC 4RWSC 2A69D 2CVRA 2SNMA 1SEBD 3ND8A 1RD9D 2BA0A 4IQZA 3ERQA 4K8IA 2L1BA 2XN9C 3I8ZA 4FF4A 3E0JA 2H4OA 2ZXPA 1VMCA 2EYPA 2EYMA 2NVTB 1WTVA 1TU2B 1AZPA 5KEEA 5A35A 2HDMA 2WKDA 4B9XA 1BCPF 1V1PB 1B53A 4K5XA 4C3HB 2AWNA 1KDBA 2K5DA 4KN4C 2JA7B 4B08A 1DONA 1SXTA 4DF7A 4A3DB 5KYIA 2KCNA 3Q6SA 2R3ZA 2KEDA 4DU9A 1EIHA 1LO5D 4K5WA 5FO9B 3GTGB 3D4RA 1PRTC 4ZUJA 3OIPA 3IAYA 3T51B 2WKCA 4OIKA 1M8AA 4RH6A 1ET6A 1Z7TA 4KKSA 2EY2A 5HURA 2L9HA 1MSHA 2F0WA 4J6HA 4MN3A 1RKNA 2QDBA 4TKOB 4C56C 3BVZA 4OHJA 3CRLC 3GV3A 2B2YA 2ZXRA 4B9WA 1UAPA 1Y69U 2F4IA 1RTOA 2D62A 2F0UA 1PTOC 1E2VA 1Q3LA 1I4PA 4XYQA 3V96A 2F0KA 3H6MA 2B2VA 1H9JA 3T4AC 1YNJD 1F2YA 1G8ZD 3K5LA 4CKEA 2IT1A 5IGFA 3DHQA 2PYKA 1HTPA 3NQTA 2BA1A 3QG1A 4DNTB 3BG3A 4HMJA 1K8MA 3MTSA 1WTOA 1X3QA 2EYFA 3NSWA 4NW2A 5DNFA 1BDOA 4HTHA 1STHA 2SEBD 1SJED 1PRTF 3T16A 1EY7A 3PUZA 2L0CA 4X3SA 2K33A 1WD0A 2Z1CA 4ZKBB 2EE1A 5ELDA 1QG7A 1TWGB 2O2LD 2XRQD 1YNNC 1HTLD 3GQBA 3S14B 3G6JB 4HSVA 4UDUC 3GTPB 4BS9A 1E2WA 1EYCA 5IIFA 5M3MB 5M5XB 4DA2A 1QCBD 4PQXA 2EY5A 1IYUA 1XWEA 2FHTA 3LNNA 5EPLA 4NDXA 1PTOF 3TDQA 1EWCA 4HCEA 3IKJA 1M4VA 2N88A 3QOLA 2DN8A 3TZUA 2A68D 5EKKA 3K5MA 4X3UA 4H13C 4F7XA 3VYSA 1A3VA 5JVH3 4RKBA 4BY7B 1H9KA 3H91A 1KNEA 4RGMA 3OOCA 4A3IB 2B39A 3E6ZX 1HQRD 2NVQB 1KNAA 2B2WA 3A7AB 2OF1A 2A6EC 3GTJB 1Y1WB 2A73B 1JCKB 3DEOA 2FMCA 1BNZA 2A69C 2MGSA 1KLGD 2MJ8A 4CHTB 4F87A 3L3OC 1AEXA 3S1NB 1F9QA 4ME5A 1H9SA 3C46A 2XWBB 2F0LA 1MD2D 2B2YC 4M1UB 3ZYYX 3QOJA 1CT1D 1SBBB 5T1GA 3K57A 1MI2A 1TQOA 3M7GA 2KVMA 3BDCA 4KY5A 3M85A 1ZEQX 4KN7C 1F77A 1TS3A 1W6JA 4IFDI 2B2VC 3A54A 4RKLA 3KLSX 3NE5B 3NK9A 3NWSA 3OWEB 5I6YA 3EJIA 3BVMA 5BN4A 5I2YA 3J7AF 1DJRD 3C3LA 2EYJA 2EPBA 1HUMA 4ULLA 4C1NK 2EYLA 1CI3M 1SNPA 3H09A 5EPKA 2G9HD 1LT3D 4RGOS 2PPBC 3N52A 4QB4A 3NBIA 2K03A 1FR3A 1KABA 2F0FA 1GUOA 2Z8LA 1Z47A 4XT3B 4K2KA 2K04A 2A74C 1RJTA 1HA5A 3DWQA 2HUGA 1JWUD 2RSOA 1EY9A 4DXFA 4EQNA 4HAEA 1SMYD 1NCVA 1C8CA 4N9TA 3J7AV 4WORA 5C44B 3MVVA 3MXGA 3HOVB 5FO8B 1JICA 1YNJC 1GHJA 3UI2A 1STYA 3GO5A 3J81L 3SR1A 1O7ZA 1ZKOA 1WD1A 4CKBA 1SYCA 2IW3A 1GUTA 2B2WC 2L5TA 2B8FA 4RGNA 1DYQA 2C9OA 1ICWA 4G7OC 3NHHA 3RMHA 2ZXOA 4Z9CB 2AUKA 1V1PA 1KLUD 4FYDA 2EY1A 4DGZA 4A3MB 2VB3X 5D65A 1GUSA 4WFN3 3FMCA 3BYTB 2NVYB 1CFMA 4J1MA 1HRJA 3QO2A 1I4HA 1I4XA 4U68A 3NBHA 1IL8A 4DXGA 2J7ZA 2RQXA 3FKIB 2VUMB 4RHSA 4XT1B 1SFOB 2RSNA 5FLXE 3NUCA 4K6LA 4HSPA 2L11A 3C1FA 2A68C 2O5JC 2FFKB 2I46A 3DXJC 5CORA 1DOKA 2E2IB 2KJXA 3ITPA 2F0MA 2JP1A 1HFNA 4C3JG 3MA2B 3W2DA 5KIXA 5E4WC 1F9SA 3JAML 4BA2I 4Q5VA 1PDQA 4KKUA 2CHBD 3GTQB 3QJYA 1XXGA 4I65A 4ODGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I4D A;  1SBB B;  5ELE A;  3BYY B;  1SXT A;  5ELD A;  3MC0 B;  1D5X C;  1I4Q A;  1JR0 D;  1CHP D;  1FNU A;  1SJH D;  4TSS A;  5D3D A;  3R8B A;  1JWS D;  3DWA A;  1EEF D;  1F77 A;  1JQY D;  1TS3 A;  5ELC A;  4RGN A;  1DYQ A;  1BCP C;  2IPK D;  4O1N A;  3TSS A;  2O2L D;  1RCV D;  1LO5 D;  3EA6 A;  1LTG D;  2XRQ D;  3KLS X;  1EFI D;  2TSS A;  1HTL D;  3OWE B;  1LTT D;  4Z9C B;  1LT6 D;  1PYW D;  1V1P A;  1KLU D;  1PRT C;  1FNV A;  1FGB D;  2QEJ C;  2NTS A;  1SE2 A;  1S5C D;  1LTA D;  4UDU C;  1L0X B;  5ELF A;  3BVM A;  1KTK A;  3EFX D;  1B44 D;  1DJR D;  4RH6 A;  1EU4 A;  1ET6 A;  3MFG A;  2AQ1 B;  1S5F D;  1AW7 A;  3BYT B;  1PTO D;  1BCP B;  1QIL A;  1PTO F;  4RCO A;  1EWC A;  1ESF A;  1I4H A;  1XTC D;  1M4V A;  1EU3 A;  1I4X A;  1T5X D;  4C56 C;  1PTO H;  2G9H D;  1LT3 D;  2J4X A;  3DWP A;  1PRT B;  1PZJ D;  1S5D D;  3BVZ A;  4L6T B;  1SE4 A;  1UNS A;  4RGO S;  2AQ2 B;  4OHJ A;  1CQV A;  4DXG A;  1ET9 A;  3R2I A;  3BVG A;  1LT4 D;  5D3I B;  4L63 B;  2QIL A;  1FNW A;  1TS5 A;  2Z8L A;  1SEB D;  4RGM A;  4RHS A;  3V05 A;  1RD9 D;  1S5B D;  2IJ0 A;  1PTO C;  2AQ3 B;  1LTR D;  2RDH A;  1PZK D;  1I4P A;  1HQR D;  5FKA C;  1RDP D;  4K6L A;  1TS4 A;  1HA5 A;  4RGT A;  2XN9 C;  1S5E D;  3DWQ A;  3URY A;  1JCK B;  1CK1 A;  1JWU D;  3BZD B;  3O13 A;  3GP7 A;  1FD7 D;  2ICI A;  1G8Z D;  1D6E C;  4DXF A;  1I4R A;  1I4G A;  1LTI D;  1SE3 A;  2XRS D;  1B1Z A;  1BXT A;  1KLG D;  1L0Y B;  3W2D A;  2R61 A;  4RHR A;  1LTS D;  1D5M C;  4BWG B;  1PTO B;  5FK9 C;  5ELB A;  1JWM D;  3CHB D;  1LLR D;  1LTB D;  1GOZ A;  1LT5 D;  1BCP D;  3R2T A;  1BCP F;  1V1P B;  1ENF A;  1HXY D;  2XNA C;  3SEB A;  1CHQ D;  1UUP A;  2CHB D;  2SEB D;  2WV6 D;  1TY0 A;  1MD2 D;  1PZI D;  1D5Z C;  1SJE D;  1EEI D;  1XXG A;  1STE A;  1TY2 A;  1PRT D;  2NTT A;  1TS2 A;  5TSS A;  1AN8 A;  1PRT F;  1RF2 D;  2RDG A;  1V1O A;  1CT1 D;  4RFB A;  4ZYS A; 
#chains in the Genus database with same CATH topology
 4AYB B;  4A3J B;  3T53 B;  2E5L Q;  1IBL Q;  1MIU A;  3J7Y W;  4TSS A;  1Q7Y C;  1W2B A;  2BDO A;  2UXB L;  1V9P A;  2K50 A;  4IAL A;  4K5V A;  4QUC A;  2ID0 A;  4DUZ Q;  1LTG D;  2KHS A;  3W1B A;  2TSS A;  4J8Q A;  2LXK A;  2K05 A;  4KJO A;  1X32 A;  4DR1 L;  1Y8P B;  2JA8 B;  2JEA I;  2L55 A;  1PH5 A;  2VQE Q;  1ONL A;  2JN4 A;  4DV7 Q;  3TQY A;  3DEP A;  1S5F D;  3KLR A;  3A8I E;  4C3J B;  4R8I A;  3H0G G;  3SGI A;  2VB2 X;  4NXN Q;  4QCL A;  1JOO A;  4JCV E;  1NJI C;  5C0X H;  4I7Z C;  4P2C B;  4FP5 D;  1Y14 B;  4A3F B;  2NB0 A;  1LV9 A;  3I7F A;  3FDT A;  3SK6 A;  4TQU S;  5CC4 A;  2LFN A;  2MFI A;  4A76 A;  1TXY A;  1A8V A;  1IW7 D;  1FNW A;  3KF8 B;  4ZRZ A;  4HIK A;  2YTV A;  3A8K E;  2EXD A;  5C3E G;  1BOS A;  5LL6 S;  4B3M Q;  1LTR D;  3VYT A;  2AUJ D;  2RVL A;  5C4Z A;  1H9R A;  1VQG A;  4X6A H;  2Z6K C;  4GNX A;  3CPW A;  4G57 A;  1F2M A;  3S2D B;  2D0P A;  2NN6 H;  2KEE A;  4LWC A;  3QR8 A;  3V2T A;  2XIW A;  5IE8 A;  4KTA A;  2K6A A;  3NPP A;  5NUC A;  2PQA B;  2KCC A;  1Z6H A;  3MFY A;  5LL6 X;  4RAU C;  3DLL A;  4YIJ A;  2ZJQ A;  1LTB D;  4A3M H;  1E7Z A;  3NWT A;  3SXH A;  5CV8 A;  3K5N A;  1QB5 D;  2N8N A;  3TZD A;  3M7N A;  3EIV A;  1VS0 A;  3A55 A;  2WV6 D;  1TWH B;  5C3X A;  1B50 A;  3T1Y Q;  4YWK A;  5C4H A;  4WJ3 M;  4DV3 L;  3HOW H;  1B9M A;  1TWC B;  4YCU A;  5LMU Q;  4RCN A;  2B2T A;  1CKO A;  3KYH C;  1C0A A;  1JB7 A;  2Q8I B;  2PZW A;  4KD4 A;  3HKZ E;  5IT9 c;  4GOP B;  5ELC A;  2O4X A;  4R8N A;  3HEJ A;  5LMN Q;  3TSS A;  4DV1 L;  2K5W A;  4UAI A;  3EA6 A;  3CC4 A;  4IJH A;  1A63 A;  1B4O A;  1A62 A;  3S2H H;  2GN5 A;  2DNE A;  1FNV A;  2UUB L;  4JBM A;  4K0K Q;  4KHZ A;  1LTA D;  3MEF A;  3LX0 A;  1BF4 A;  1O7L A;  1VQB A;  1B44 D;  3D31 A;  5E3F A;  1VDZ A;  2F0V A;  2UXD Q;  4JI8 Q;  1S40 A;  3S1M B;  3TBI B;  3MZ5 A;  2I07 B;  2RKS A;  3KDF B;  4DAP A;  2O5I C;  5ELO A;  3CD6 A;  2EVB A;  1HNW Q;  2F3W A;  5IYC G;  5M3F G;  2J4X A;  3TP8 A;  1A6X A;  3D6C A;  4CJ0 B;  4KJN A;  3GTQ H;  2MPM A;  4IOC A;  4CKC A;  3CRK C;  4L63 B;  2NZ1 D;  2J0T D;  3D4D A;  3ONA B;  2KA7 A;  4FXK C;  2E2H B;  4FF2 A;  2ZT9 C;  2JA6 H;  3RN5 A;  4A3J H;  4G7H C;  2KEN A;  3PO2 G;  4ILW A;  5M5Y H;  3J7A 5;  1KDA A;  1S5E D;  4XQJ A;  1CK1 A;  2SOB A;  1XNR L;  3O13 A;  5J39 A;  1FD7 D;  3W3A A;  4WJ4 A;  4KV6 A;  4OIJ A;  5IYB G;  3HOX G;  1G91 A;  5ELN A;  4EGV A;  1CZG A;  2JA8 H;  1VQD A;  1JT8 A;  5G3L D;  2AMC B;  3I3C A;  3R2T A;  1PXU A;  4QGU A;  3NTI A;  1I5F A;  1TY0 A;  4C3J H;  3EQL C;  2EY6 A;  2EDG A;  1STE A;  1PH2 A;  5M3F B;  2NTT A;  4LF6 L;  2A5H A;  4FXD A;  4ZCK A;  4YHH L;  3Q24 A;  4O42 A;  4A3E H;  2F0S A;  4F88 A;  4ABN A;  2K5V A;  2SNS A;  3MC0 B;  4I7A A;  5IWA L;  1CHP D;  4A3F H;  4KHP Q;  1JWS D;  4CGY B;  2UUC L;  1JQY D;  2LS0 1;  3SE0 A;  3UE0 A;  1EYG A;  3OSO A;  1S4Z A;  5J1Z A;  1C9O A;  2PO4 A;  2A19 A;  2JK8 A;  1C4Q A;  2WAQ G;  4GKK L;  4S3S A;  4KK7 A;  3U4Z A;  3PO2 B;  4NXM Q;  2EJF C;  4B3T Q;  1LT6 D;  4DV4 L;  1WCM G;  1VQP A;  2EXZ A;  2QEJ C;  1LYL A;  1ICF B;  3SK5 A;  4DV0 L;  4DUY Q;  3M4P A;  3P75 A;  3VA7 A;  2E2J H;  3E9H A;  2KOL A;  2XSC A;  4DR6 L;  1CM9 A;  3D8G A;  4LF5 Q;  3PO3 H;  2M9V A;  2AQ1 B;  3TP7 A;  1WTQ A;  3GTK B;  2L12 A;  1N36 L;  4UHV A;  4PZ8 A;  3MHB A;  1TT2 A;  4FXG C;  1U4P A;  4EVO A;  1N33 L;  1RL2 A;  3HOY H;  1I94 L;  5JPM C;  4UP7 A;  5AJ3 Q;  1X6O A;  2RBM A;  2YU9 H;  2IL8 A;  2B2T C;  4A93 B;  1B3Q A;  3H0G H;  5K5P A;  3I55 A;  2DY8 A;  2ZM6 L;  4DR5 Q;  3CCQ A;  1TWH H;  1X3F A;  2G5D A;  2X6L A;  2XVS A;  3KF6 B;  4JV5 Q;  4IPD A;  1EYA A;  4UP8 A;  4CJ1 B;  4N9P A;  2KUM A;  5IOC A;  4JVZ A;  4A3B G;  1HCZ A;  4DAV A;  2JSO A;  1RDP D;  2Z4H A;  4G7Z C;  4H02 A;  2TMP A;  2IWH A;  4RGT A;  1MBY A;  2NUC A;  2H5X A;  5IT9 L;  5LMN W;  5C3E H;  3J81 i;  1V43 A;  2LY7 A;  4LJZ C;  4R4I A;  4H7B A;  1LM0 A;  1SE3 A;  1MHW C;  4DV5 L;  1FYC A;  1XMO Q;  1IW7 C;  1KC8 C;  3TP5 A;  1BR9 A;  3MXU A;  2ES2 A;  3QWN A;  3CC2 A;  4RHR A;  2IX3 A;  4POG A;  5JEA G;  4JBW A;  1K73 C;  4DAY A;  3K59 A;  2IX0 A;  2OQ0 A;  5I9P A;  5BR8 L;  3WOF A;  2QEX A;  1HA6 A;  2HIX A;  1SNC A;  3C1E A;  1YVC A;  1RF2 D;  3L9A X;  2EOT A;  1V1O A;  1L1O A;  2B3G A;  1VQ5 A;  2F1M A;  2K1B A;  2D2C C;  2NZO A;  3HKZ B;  4JPB W;  4YWM A;  5CV6 A;  1FNU A;  1OO9 B;  4GN3 B;  4B3R Q;  4MIU A;  3DWA A;  2DY7 A;  4HJA A;  4ZQ3 A;  2MNA A;  1G6P A;  4A3G B;  2NWG A;  1EZ6 A;  1G29 1;  2R93 H;  4OX9 L;  4A3B B;  4QF4 A;  2K7V A;  2PCF B;  5JEA J;  4X64 Q;  5A2Q L;  4Y7N B;  2NTS A;  3C2P A;  4DK0 A;  3NQI A;  1IBK L;  3PIP 3;  2HQL A;  2UXB Q;  5ELF A;  2N78 A;  1PFM A;  3FEW X;  4RMF A;  5M5W H;  4XQQ A;  4JG2 A;  1EY0 A;  4BXX G;  3BDL A;  4AYB E;  2F0D A;  1AW7 A;  1PFN A;  4LF4 L;  3J80 L;  1YJW A;  5J22 A;  4DR1 Q;  4Y52 H;  1GJX A;  1XTC D;  3VR3 A;  2F3V A;  5FLX L;  1VQI A;  1ROD A;  1KIX A;  2DGY A;  1PVO A;  4JI5 L;  4GN4 B;  5CR3 A;  2R92 H;  3FPU B;  3JAM c;  1KRT A;  5IYC H;  5M3F H;  1EQR A;  1TS5 A;  1B70 B;  3I72 A;  3VDY A;  4LF8 L;  2VY3 A;  2B2U A;  1STN A;  1X65 A;  1P8L A;  5C0X G;  4IN3 A;  2A1A A;  2JXM B;  2A6H D;  4GLV B;  4JI3 L;  2MO1 A;  3S1R B;  3ULP A;  3DMU A;  4YY3 L;  3X3N A;  1LTI D;  4GLX A;  1XMQ Q;  3PO2 H;  1EOT A;  3OTO L;  1VQ7 A;  1PH6 A;  3CCV A;  2NN6 G;  3CC7 A;  4BWG B;  2C5C A;  2BH2 A;  1JWM D;  5IYB H;  3NEM A;  3U9S A;  2VS1 A;  3HOX H;  3KF8 A;  1HR0 W;  1G6Z A;  1MJE A;  2DUD A;  1UUP A;  1WTW A;  4LFC L;  2QCP X;  5C0X J;  1SE8 A;  1OXS C;  1K8A C;  2PZT A;  3I56 A;  1X3P A;  1WTR A;  1GUN A;  1D5X C;  3R8B A;  2PQA A;  3HS0 C;  1X54 A;  1OXX K;  2UUA L;  1SNO A;  1EWI A;  1BBW A;  3CCS A;  3QB3 A;  2NZH A;  3FP9 A;  2F0E A;  3HG9 A;  1ESR A;  3IFD A;  4KMU C;  1NBW A;  3WOE A;  1PYW D;  2VXW A;  3DUZ A;  1C48 A;  1Q12 A;  4HJ8 A;  2WII B;  4O2D A;  1UE1 A;  4QIW B;  1EZ8 A;  3VR4 A;  4DV1 Q;  1PHJ A;  4V19 0;  1HUN A;  2MO0 A;  4P75 A;  2BOS A;  3VR6 A;  1WCM H;  3G7L A;  5JJK A;  1IHZ A;  3VR5 A;  2NVX B;  1GM5 A;  2QKI C;  1JJG A;  4IUQ A;  1NAP A;  3K7A B;  4GOP A;  5GRO A;  1ASY A;  4IZ8 A;  5CGK A;  3CCM A;  1HR0 L;  1L1O C;  4JBK A;  3PUY A;  2B63 G;  4AH6 A;  4XYO A;  3BVG A;  3E0E A;  1U0L A;  3S15 H;  4CDF C;  1EIG A;  1EIY B;  4IUR A;  4OO1 G;  1SMX A;  4YWL A;  2F0J A;  3D4W A;  2PW5 A;  3HGB A;  4DN4 M;  2WB1 G;  4FF3 A;  1AH9 A;  3KJO A;  1PZK D;  4B3S L;  5I9O A;  3G48 A;  3HOW B;  3HZX A;  1D1I A;  1SYE A;  1ZYR D;  3I4N G;  2Q2I A;  1V1Q A;  1VQA A;  3I4M G;  1G2T A;  3AFQ A;  4A3B H;  1GO3 E;  2ICI A;  2PW7 A;  3F2U A;  3PSI A;  1F2L A;  1VQJ A;  3CPF A;  2YTX A;  3F1Z A;  2K01 A;  4HED A;  4Y7N H;  2KEC A;  2HD3 A;  2YYZ A;  4L8J A;  1VCI A;  3S2H B;  5G3L F;  1XNR Q;  1GOZ A;  1UEA B;  2Y0S E;  1I3Q H;  3CCU A;  1K83 B;  3CCL A;  3SEB A;  2F0P A;  2RF4 A;  2VNU D;  1NR2 A;  1D5Z C;  1EEI D;  5JEA H;  2Z9H A;  3KBX A;  2B8G A;  1AN8 A;  2RDG A;  2F0H A;  4IUN A;  2B63 B;  1B9N A;  3K58 A;  1VQL A;  1Y8N B;  5ELE A;  1VQ6 A;  2B2U C;  4LMQ D;  1I4Q A;  1SJH D;  3K6O A;  3PF5 A;  5IGC A;  3RZD H;  1Y8O B;  4LF6 Q;  2LSS A;  1B7Y B;  4YHH Q;  1Q1E A;  4LUV A;  2PNR C;  5JJZ A;  1DD2 A;  2WIN B;  2UUC Q;  1N9W A;  3I4M B;  3T13 A;  1E22 A;  1HZC A;  3S1R H;  1OTC A;  1XX8 A;  5HY6 A;  4CDD C;  2JA6 B;  3MFG A;  2PZU A;  1W6K A;  3GDE A;  2LMC B;  1H9S B;  1Y1W H;  5M5Y B;  4HJ5 A;  4DV4 Q;  4X3T A;  4PNY A;  4GKJ L;  2D5D A;  2UXC Q;  4LUO A;  3S16 B;  3VA5 A;  3CME A;  4QY7 A;  1HNZ Q;  4BXX H;  4DR6 Q;  2YTY A;  1S5D D;  1HJP A;  4L6T B;  1HQM C;  3PO3 G;  3BZC A;  5GAG C;  1EQT A;  1STG A;  5C4J B;  3OMC A;  1VQ9 A;  1I50 B;  4LFB L;  3D6W A;  2Q2U A;  1N33 Q;  3HOY G;  1I94 Q;  3RNU A;  2K75 A;  4OON A;  2X6G A;  2EJM A;  4GZY C;  3MXN B;  3KFU A;  2ZM6 Q;  4A3C G;  1YNN D;  4XXE A;  1QNK A;  2H1E A;  4A3E B;  2MUY A;  2E8G A;  3Q0A A;  4JW0 A;  1E2Z A;  3IFT A;  1D6E C;  1VQH A;  1I4R A;  4LK1 C;  1VQN A;  5IYD G;  2WP8 J;  4HIM A;  1ILQ A;  1TR5 A;  3KUP A;  4C1N I;  1Q8I A;  1XPR A;  3SHL A;  1BUV T;  1LTS D;  1D5M C;  4GOP C;  5FK9 C;  3CHB D;  1A3T A;  3KF6 A;  1VF5 C;  3WWV A;  2V4D A;  2A6H C;  1N34 L;  1EIF A;  1SR3 A;  3TS2 A;  4OGQ C;  1B3A A;  2IHE A;  2E2J B;  4DV5 Q;  2QF7 A;  3J81 E;  1QWY A;  2NVX H;  4FNF A;  1A15 A;  2CWA A;  2OT2 A;  3AB9 A;  1TWF H;  3K7A H;  2WAQ E;  5GQO A;  1U4L A;  3PO3 B;  4RFB A;  4X62 L;  1R4P B;  2HCC A;  5JOB A;  4CDC C;  5E1F A;  5JVG 3;  3X3M A;  4BBS G;  2F0I A;  5BR8 Q;  5C4X G;  3NP8 A;  2UU9 L;  4JC0 A;  3HOY B;  3K80 C;  1EWH A;  2IPK D;  2YU9 B;  3H0G B;  1ML0 D;  5DLQ E;  2I0Q A;  1P16 A;  1LTT D;  2GVA A;  4IUP A;  4DV6 L;  1PH3 A;  2F52 A;  2QGQ A;  5C6A A;  1L0X B;  1SYF A;  2E74 C;  4A3D G;  1SMY C;  2R93 G;  4OX9 Q;  3EFX D;  3HOU G;  2Y0S G;  2F0Q A;  4KI0 A;  1OXU A;  3BZK A;  4KY7 A;  5CBE E;  4KD3 A;  1BCP B;  3AYH B;  3H3V C;  1VF7 A;  4XDX A;  4JI4 L;  5C3E B;  4LUZ A;  1SYB A;  4DR4 Q;  4HCS A;  4TVA B;  5KNC A;  2PMZ E;  2CWP A;  4PMW A;  3TN2 A;  3ND9 A;  2ZTC A;  1DCZ A;  1PYS B;  1E0B A;  1F9P A;  4X66 L;  1K83 H;  3KOJ A;  4H44 C;  4LF4 Q;  3AEV A;  1XJV A;  2EJG C;  1C7Y A;  4OEL B;  5EQ0 A;  5DEH A;  1Y1V G;  2HIV A;  2B63 H;  3V05 A;  5K36 G;  4BBS B;  3CF5 A;  5C4X B;  3A5U A;  2AQ3 B;  1DOL A;  4XIG S;  4JI5 Q;  4OO1 H;  2R92 G;  2ZJP A;  1Q8K A;  4MNO A;  4P74 A;  4DV2 L;  4LF8 Q;  2OTJ A;  4N8F A;  2CQA A;  3RN2 A;  1WVL A;  1QUQ B;  2M2L A;  2XRS D;  2HCI A;  2XTI A;  3AFP A;  2F0T A;  4KKT A;  1A2T A;  1BXT A;  3GTO B;  2FXQ A;  2I5H A;  3NXW A;  2R93 B;  4JI3 Q;  3I4N H;  3JAM E;  3HOU B;  3I4M H;  2Y0S B;  4YY3 Q;  1LLR D;  4JI1 Q;  4IUT A;  1W3S A;  2CW0 D;  4LW1 A;  1XNQ L;  1J8I A;  1LT5 D;  2N49 A;  1U4R A;  1NNX A;  5BN5 A;  1EL0 A;  4CBV A;  1ZYR C;  4WJW A;  5M5W B;  3OTO Q;  3H3V I;  3STB D;  4QUF A;  1TS2 A;  3QIA A;  4HIO A;  3NEN A;  4ZUI A;  3S16 H;  1NUC A;  2K5Q A;  4IUV A;  5I4D A;  3J80 c;  1BVS A;  1CZW A;  2JJQ A;  1CTM A;  1WTX A;  4IJL A;  5D3D A;  3TS0 A;  5FLX c;  5C4J H;  4K14 A;  1Y1V B;  4LFC Q;  1EEF D;  2DJF C;  1TII D;  1I50 H;  1IYV A;  4DR2 L;  3UDF A;  2FMM A;  5FLM G;  5JAV A;  1FGU A;  1D7Q A;  4NKL A;  3I70 A;  2R92 B;  1DM0 B;  1SAP A;  3FPP A;  2YV5 A;  1Q90 A;  2UUA Q;  1N8R C;  1LAB A;  4XTC S;  2IHF A;  4IOA A;  2IX1 A;  1WJJ A;  1SNQ A;  3ULJ A;  1MSG A;  1ESF A;  4BA1 I;  2ICE C;  1BO0 A;  5EJW A;  1RIP A;  3SK4 A;  1PRT B;  3DM1 A;  4K6D A;  1HHV A;  1H9M A;  2BE5 D;  2OCE A;  4DK6 C;  4ZK9 B;  1II3 A;  2MP1 A;  2E76 C;  3EVQ A;  3HFZ B;  1U4M A;  3HOX B;  1PFB A;  2LKV A;  1JJ2 A;  4HJ7 A;  1HR0 Q;  1E1O A;  2BCO A;  4QIW E;  3UDI A;  5KND A;  1KAA A;  5FKA C;  1OXV A;  1IBL L;  1SN8 A;  4C3I G;  2K4K A;  5JPN C;  5IY0 A;  3CCE A;  3F8T A;  2E2D C;  3OWF A;  3URY A;  1KD1 C;  1ZXT A;  3RD4 A;  4BY7 G;  3M4Y A;  4ZLT F;  4RG1 A;  4BY1 G;  1I4G A;  4EQO A;  4L5R C;  4A3C H;  5ISR A;  1B1Z A;  4HN7 A;  1YJ9 A;  4B3S Q;  2ALY B;  2EYO A;  2R61 A;  4JK1 C;  1YHQ A;  1GXD C;  3PCO B;  1PTO B;  2VQE L;  5DAU A;  5IYD H;  4HR7 B;  2XNA C;  1PH4 A;  5M9O A;  3MAQ A;  1B2T A;  2WAQ B;  4FVM A;  3D3R A;  5TSS A;  5CMD A;  4MTN A;  4QJF A;  4UPA A;  1WCM B;  2JYO A;  1CA5 A;  5GAE C;  3BYY B;  2VW9 A;  2B29 A;  4FF1 A;  1R9T B;  3ER0 A;  4DNI A;  3A8J E;  4GNX B;  5IGG A;  1LAC A;  3HOZ G;  2SDF A;  4O0A A;  1IKM A;  1EY5 A;  1JOK A;  1EY4 A;  1RCV D;  3E9I A;  2PQE A;  2D9U A;  2KCM A;  5FOB B;  4DNR B;  4BBS H;  4C3I B;  3S15 B;  3MXP A;  1U9R A;  2G9D A;  1O7Y A;  5C4X H;  2OXP A;  1HZ9 A;  1S5C D;  4IFD G;  3NTH A;  1JJC B;  3BS1 A;  1PA6 A;  1YI2 A;  1GKH A;  3UDX A;  4BY1 B;  1XPO A;  1PYB A;  3M9B A;  3I90 A;  3W1G A;  1QNU A;  1GD7 A;  3PUW A;  1TKW B;  3LWE A;  3P7J A;  5FO7 B;  1QIL A;  4A3D H;  2R6G A;  3GTO H;  2PMZ B;  5T1I A;  3N6R A;  4EX5 A;  1OXT A;  3HOU H;  2IY5 B;  2HDL A;  4KHV A;  4LF7 L;  4EQP A;  1I6H B;  2WB1 E;  1STA A;  1XYI A;  2MHV A;  1ENC A;  1CQV A;  2JA5 G;  3G71 A;  1S72 A;  1F2Z A;  2Z4I A;  3GTM B;  1EUJ A;  2AHO B;  1CQF A;  1CSP A;  1BBX C;  4GKJ Q;  1EQQ A;  4UY8 C;  4IFD J;  1DOM A;  1I3Q B;  1JC7 A;  4QL5 A;  3Q22 A;  1UE6 A;  5I2X A;  4NP5 A;  1SRO A;  1SRU A;  3VYU A;  1YZ6 A;  3HOZ B;  1WYD A;  2HQE A;  1TS4 A;  4M8A A;  1Y1V H;  5EAY A;  1O80 A;  5C5L A;  5K36 H;  4LFB Q;  4K8J A;  3GTL B;  1SSO A;  3S24 A;  3MEH A;  4A3K G;  3CMA A;  1AP0 A;  3OW2 A;  3MWY W;  4X65 L;  5E4X A;  4JBJ A;  3E3X A;  3A56 A;  4PMB A;  3RZD B;  2N55 A;  3ERO A;  2Q8R E;  5EGT A;  2EZV A;  5FJ8 G;  2MQH A;  3RLF A;  4K0K L;  1K0S A;  4G4K A;  4AQY L;  4BBR G;  2Q8T A;  5ELB A;  4K2L A;  4FO2 A;  3JAM i;  1CKN B;  4C2M B;  3G6E A;  1BCP D;  1ENF A;  3CU7 A;  3K5O A;  2UXD L;  4ID6 A;  5IGD A;  3P1H A;  3MXN A;  1D2B A;  1EY8 A;  2X69 A;  3T56 B;  1BQQ T;  1SDF A;  2JA5 B;  4ZYS A;  3KLS A;  2NYZ D;  1NMF A;  1YIT A;  4L5S A;  1EQV A;  3LWU A;  4PZ7 A;  4GN5 A;  1N34 Q;  5C44 G;  4NPS A;  1JR0 D;  1HFG A;  1CA6 A;  3U9O A;  2NBF A;  3HOV G;  2CW0 C;  1FJG L;  5KRU A;  5F2D A;  3CQZ B;  3A7L A;  2JE6 I;  4X62 Q;  3NTK A;  3Q8D A;  1IKL A;  3GV6 A;  1MGS A;  5C5M A;  1SND A;  5D14 A;  1FGB D;  1NSN S;  1TWA B;  1SE2 A;  4DK3 C;  2UU9 Q;  3K0Y A;  1D1K A;  2RDF A;  2JEB I;  4IUU A;  4PMC A;  4A3K B;  3S1Q B;  5FLM H;  3AU7 A;  3BJU A;  5HGT A;  5KNB A;  4CJ2 C;  2HT1 A;  4F8M A;  2OEO A;  3A5Z B;  1Q1B A;  4DV6 Q;  5CYU A;  3VR2 A;  4BBR B;  4RCO A;  1VQ4 A;  4DV3 Q;  3PV0 A;  3SK8 A;  3AMU A;  1T5X D;  3RZO B;  1PTO H;  1A3U A;  3DWP A;  5D3I B;  1PZJ D;  1TWG H;  1AZQ A;  2CKZ B;  3A0J A;  5C3W A;  3R2I A;  5L37 A;  5C0X I;  5AFW A;  1GVP A;  1QJO A;  4JI4 Q;  3M3Y B;  3GTP H;  1VMP A;  3OYY A;  2C35 B;  1QOH A;  5M3M H;  5IT9 E;  1R9T H;  2UUB Q;  4X66 Q;  1SNM A;  1TWF B;  4DR3 L;  3EN2 A;  4H0L C;  3K0X A;  1IBM L;  2NN6 I;  2BE5 C;  3FKI G;  2FJ2 A;  2VUM G;  1RHP A;  1YNX A;  4DK1 A;  5KYL A;  4C3I H;  1VQO A;  2AWO A;  3TP6 A;  1PH9 A;  4B3T L;  3DM3 A;  1L0Y B;  5LHY 1;  4DUY L;  4BY7 H;  3PMF A;  3PIO 3;  1J5E L;  2I5L X;  5CV9 A;  2XGT A;  3TEH B;  4XQN A;  4DV2 Q;  4BY1 H;  4NB3 A;  3S9W A;  1STB A;  1PMR A;  3PUX A;  4U67 3;  1HXY D;  2R7Z G;  2M00 A;  3FVQ A;  1JE4 A;  5CV5 A;  1CHQ D;  2PNH A;  4V0B A;  2F03 A;  1QZH A;  4A3I H;  4JI2 L;  3P20 A;  1PZI D;  2NVQ H;  1TY2 A;  1PRT D;  3KK7 A;  4DFA A;  3JC6 6;  1Q46 A;  3KDF A;  2RCN A;  4MHE A;  3GTJ H;  1XNQ Q;  1I6H H;  1ENA A;  1WI5 A;  2F4V L;  3CXC A;  1RTN A;  2L15 A;  3L0O A;  1QUQ A;  1G2S A;  5EBC A;  3GTM H;  1B8A A;  3E5S A;  5COY A;  2EYH A;  3I4O A;  3SVM A;  4OWT B;  5BN3 A;  4JI7 L;  5DM6 3;  5A2Q E;  1DXM A;  1S3O A;  5CV7 A;  5EKL A;  1SYG A;  1KDC A;  3HP3 A;  3HOZ H;  1F9R A;  4X3K A;  1VQK A;  2AKW B;  3ULL A;  4DR2 Q;  3K7U C;  2K28 A;  3GTL H;  4HMI A;  3FRP B;  1QVF A;  3J80 E;  4OWW B;  1EYD A;  4LF9 L;  1A2U A;  5IP7 G;  1WFQ A;  2F3I A;  4IFD H;  1PTO D;  2WAC A;  4NMZ A;  2K14 A;  3PIO A;  4IPC A;  1K8O A;  1WTP A;  2F0N A;  2WB1 B;  4N8X 1;  4OO1 I;  2R7Z B;  1DZ1 A;  4TRD A;  4GLA C;  1TVX A;  1UNS A;  4IPH A;  2AQ2 B;  4WRD A;  4C2M H;  1ET9 A;  5IWA Q;  4QQB X;  1J9O A;  3I4N B;  1LT4 D;  3HRZ C;  5IOD A;  3S17 B;  4ZKC B;  1V8Q A;  4JOI A;  1XPU A;  3AQQ A;  1N32 L;  3K81 C;  1GHK A;  4POF A;  2QIL A;  4PV1 C;  3RR5 A;  5E7N A;  4GKK Q;  3EBE A;  3L7Z C;  4R9W A;  3F2C A;  1GUG A;  3HKS A;  4LAA A;  1X9N A;  2JA5 H;  2ATW A;  1S5B D;  2IJ0 A;  3OHX C;  2RDH A;  5DM7 3;  3H94 A;  1NMG A;  4DV0 Q;  1EY6 A;  3VYR A;  2PI2 E;  2RA4 A;  3TME A;  4B3R L;  3OIQ A;  2GA4 B;  1X3E A;  3BZD B;  3CQZ H;  3GP7 A;  2BDN A;  3BDO A;  1N36 Q;  2CQO A;  4X64 L;  3GD7 A;  2L4N A;  1TWA H;  1PLF A;  2DNC A;  1M1K C;  3ICE A;  1ILP A;  3KBG A;  3OPO A;  4A3K H;  3PUV A;  3S1Q H;  1GUW A;  3CKI B;  5CBA E;  4IPG A;  3I4L A;  3R3O A;  4JI0 L;  2Q2H A;  5EPJ A;  4OL7 A;  2DJG C;  5FJ8 H;  1UWV A;  4DR7 L;  4BBR H;  4LNQ A;  2K32 A;  3SDZ A;  4MZ9 A;  1X3G A;  5IGE A;  3RZO H;  1QE6 A;  5CV4 A;  5I6W A;  1BKB A;  3RUZ A;  1X56 A;  3PF4 A;  1HPC A;  3WDN A;  3G4S A;  1JOR A;  2VL6 A;  5JJI A;  4Q0F A;  4QMG A;  4KY6 A;  4O1N A;  1BCP C;  1JOQ A;  2XWJ B;  2FIN B;  1E24 A;  4ZAI A;  3M3Y H;  1EFI D;  5C44 H;  5GAD C;  4A75 A;  3M4O B;  3I91 A;  2K5N A;  1R4Q B;  4P72 A;  4RA8 A;  3I73 A;  2ENB A;  1AFP A;  5EKI A;  1K9M C;  3OMG A;  3HOV H;  1KHI A;  2E75 C;  1YBY A;  2KQ3 A;  5GAH C;  4L5T A;  4E6I A;  1KTK A;  1WOC A;  1EU4 A;  3R93 A;  2F0G A;  2CH4 A;  1JB3 A;  3PQI A;  1XMQ L;  1T5E A;  1NR4 A;  1U5K A;  3Q23 A;  5IGB A;  4C3H G;  1EU3 A;  1CKM A;  2A6E D;  4DPG A;  3OW7 A;  5EBD A;  5KGU A;  2V1C C;  4IO9 A;  1SE4 A;  1O78 A;  3IL8 A;  2JA7 G;  1SYD A;  4A3L G;  4R4Q A;  2F0O A;  1I6V C;  4RWS C;  2A69 D;  2CVR A;  2WFW A;  2SNM A;  1SEB D;  3ND8 A;  4AIM A;  1RD9 D;  4LF7 Q;  2BA0 A;  1KRS A;  4UP9 A;  1G51 A;  4IQZ A;  3ERQ A;  4K8I A;  1IBK Q;  2L1B A;  3CW2 C;  2NVY H;  3UE1 A;  2XN9 C;  3I8Z A;  3T1H L;  1Q82 C;  4FF4 A;  3E0J A;  3TRE A;  1LUZ A;  2H4O A;  2ZXP A;  1VMC A;  2EYP A;  2EYM A;  2P5Z X;  2NVT B;  4PG3 A;  4YCW A;  1TU2 B;  1WTV A;  4LFA L;  1QVC A;  1AZP A;  3FKI H;  2CCZ A;  2HHH L;  5KEE A;  2VUM H;  5A35 A;  2HDM A;  2WKD A;  1QVG A;  4B9X A;  1BCP F;  1V1P B;  3RLN A;  1B53 A;  2OTL A;  4X65 Q;  1K8G A;  4K5X A;  1SFO H;  4C3H B;  2AWN A;  1KDB A;  4JOI C;  2K5D A;  3KLW A;  4KN4 C;  2ZJR A;  4AQY Q;  2R7Z H;  4YCV A;  2JA7 B;  4B08 A;  1DON A;  4R4T A;  1SXT A;  4DF7 A;  4A3D B;  1Z9F A;  5KYI A;  1AE3 A;  2KCN A;  3S17 H;  3Q6S A;  2R3Z A;  2E2I H;  2KED A;  4DU9 A;  1EOV A;  1EIH A;  3NBH B;  1LO5 D;  4K5W A;  5FO9 B;  3GTG B;  1HNX L;  3D4R A;  1NTG A;  1CKN A;  1PRT C;  1LTL A;  4ZUJ A;  3OIP A;  3TRZ A;  3CP0 A;  3IAY A;  3T51 B;  2KCT A;  1FJG Q;  2WKC A;  4OIK A;  1M8A A;  4RH6 A;  4R1J A;  1ET6 A;  1Z7T A;  2VQF L;  1QZG A;  4KKS A;  2EY2 A;  5HUR A;  2L9H A;  1MSH A;  2F0W A;  3J80 i;  4J6H A;  4MN3 A;  1RKN A;  2QDB A;  1FL0 A;  4TKO B;  4C56 C;  5IP7 H;  3BVZ A;  4JI6 L;  4OHJ A;  3CRL C;  3GV3 A;  2B2Y A;  2ZXR A;  4B9W A;  3KJP A;  1UAP A;  1Y69 U;  2F4I A;  1RTO A;  2D62 A;  2F0U A;  1PTO C;  1H95 A;  1E2V A;  1Q3L A;  1I4P A;  4XYQ A;  3V96 A;  2F0K A;  1EFW A;  3H6M A;  2B2V A;  1H9J A;  4A93 G;  3T4A C;  1IXR A;  3B6Y A;  2Q2T A;  1YNJ D;  3L2P A;  1F2Y A;  1G8Z D;  1MKH A;  5IP9 G;  3K5L A;  5M3M G;  4CKE A;  2IT1 A;  3M4O H;  4P73 A;  5IGF A;  4PZ6 A;  3DHQ A;  2PYK A;  1HTP A;  3NQT A;  4DR3 Q;  2BA1 A;  3QG1 A;  4DNT B;  3BG3 A;  4HMJ A;  4JYA L;  1K8M A;  3MTS A;  1WTO A;  4GNX C;  1IBM Q;  1X3Q A;  2LXJ A;  2EYF A;  3NSW A;  1L2F A;  4NW2 A;  5DNF A;  2Z0S A;  1YIJ A;  1BDO A;  2E5L L;  4HTH A;  1STH A;  2SEB D;  2JQO A;  4DKA C;  1SJE D;  1PRT F;  3T16 A;  2UXC L;  1EY7 A;  1J5E Q;  1X55 A;  4DUZ L;  2JA9 A;  2L0C A;  3PUZ A;  4X3S A;  1KL9 A;  1HNZ L;  2K33 A;  3S2D H;  1WD0 A;  2Z1C A;  1MJC A;  1A0I A;  4ZKB B;  2EE1 A;  5ELD A;  4CDE C;  5J3B A;  1UEB A;  1E3P A;  4A3I G;  4JI2 Q;  1VQM A;  5HGQ A;  1VQE A;  2QDL A;  3IRB A;  3ZJY C;  1QG7 A;  1TWG B;  4DV7 L;  2O2L D;  2XRQ D;  1Y1W G;  1YNN C;  1HTL D;  3GQB A;  3S14 B;  4HID A;  2F4V Q;  3G6J B;  1K3B C;  3J7Z C;  1KXL A;  4HSV A;  4UDU C;  3HKZ G;  4NXN L;  3GTP B;  4BS9 A;  1E2W A;  1EYC A;  5IIF A;  5M3M B;  5M5X B;  4DA2 A;  4JI7 Q;  1QCB D;  2VZA A;  4PQX A;  4A4I A;  1IYJ B;  1TWC H;  1IYU A;  1XWE A;  2EY5 A;  2FHT A;  3LNN A;  5EPL A;  4NDX A;  4A3G G;  2NVT H;  1KQS A;  1PTO F;  3J81 c;  3TDQ A;  1EWC A;  3U50 C;  2Z6B A;  4HCE A;  3IKJ A;  1M4V A;  2N88 A;  3QOL A;  2DN8 A;  3TZU A;  1VQC A;  2A68 D;  5EKK A;  3K5M A;  3CCR A;  2K52 A;  4B3M L;  4X3U A;  4H13 C;  4F7X A;  4LF9 Q;  3VYS A;  1A3V A;  5JVH 3;  4RKB A;  1ASZ A;  4BY7 B;  1D8L A;  4C3H H;  1H9K A;  3H91 A;  1KNE A;  4RGM A;  3OOC A;  4A3I B;  2B39 A;  4R4C A;  2BH8 A;  2JA7 H;  3E6Z X;  4A3L H;  1HQR D;  2NVQ B;  1KNA A;  2B2W A;  3A7A B;  1Q86 C;  2ASB A;  2OF1 A;  4FDB A;  2A6E C;  1N32 Q;  3GTJ B;  1Y1W B;  3BU2 A;  3S1M H;  2A73 B;  1JCK B;  3DEO A;  2FMC A;  2OQK A;  3GTG H;  1VQF A;  1BNZ A;  2A69 C;  2MGS A;  1KLG D;  2MJ8 A;  4CHT B;  3T1Y L;  4F87 A;  3L3O C;  4OWX B;  1AEX A;  3S1N B;  5LMU L;  1F9Q A;  4ME5 A;  4P71 A;  1Q81 C;  4J15 A;  2E2H H;  1H9S A;  3C46 A;  3H3V H;  2XWB B;  3M4Q A;  2F0L A;  1MD2 D;  2B2Y C;  4M1U B;  3ZYY X;  4DR4 L;  5LMN L;  3NEL A;  3QOJ A;  1CT1 D;  3FHW A;  2A8V A;  1HH2 P;  1SBB B;  5T1G A;  3K57 A;  2QA4 A;  1MI2 A;  1TQO A;  3M7G A;  4JI0 Q;  2KVM A;  2KHI A;  3BDC A;  4KY5 A;  3M85 A;  1ZEQ X;  1AE2 A;  4OEM B;  4KN7 C;  1F77 A;  1TS3 A;  1W6J A;  4DR7 Q;  4IFD I;  2B2V C;  3A54 A;  1VQ8 A;  4KLK A;  4RKL A;  2OWO A;  3KLS X;  1PFS A;  3NE5 B;  3NK9 A;  3NWS A;  4HJ9 A;  3OWE B;  4JI8 L;  1JE5 A;  5I6Y A;  2D0O A;  1M90 C;  3EJI A;  1HNW L;  3BVM A;  5BN4 A;  5I2Y A;  3J7A F;  1DJR D;  5H1S E;  3C3L A;  2EYJ A;  2R7D A;  2EPB A;  1YHB A;  1HUM A;  4ULL A;  4C1N K;  2EYL A;  1CI3 M;  1SNP A;  3H09 A;  5EPK A;  2G9H D;  5JJL A;  1LT3 D;  4JI1 L;  4RGO S;  2PPB C;  3N52 A;  4QB4 A;  3STB C;  3F2D A;  3NBI A;  2K03 A;  1FR3 A;  1KAB A;  2F0F A;  1GUO A;  1HZA A;  3PIP A;  2Z8L A;  3I2Z A;  1Z47 A;  2CH4 W;  1NE3 A;  4GS3 A;  4APV A;  4XT3 B;  3LGJ A;  1UE7 A;  1O7I A;  1BBU A;  1YEZ A;  4K2K A;  2K04 A;  2A74 C;  3GTK H;  3U4V A;  1RJT A;  1HA5 A;  3DWQ A;  1HZB A;  2HUG A;  1JWU D;  1UE5 A;  2RSO A;  1EY9 A;  4DXF A;  4EQN A;  4A3M G;  4HAE A;  1SMY D;  3CAM A;  3S14 H;  1NCV A;  4ALP A;  4ME3 A;  1C8C A;  4A93 H;  4N9T A;  3U58 A;  3J7A V;  4WOR A;  5C44 B;  3T1H Q;  5IP9 H;  3MVV A;  3HOW G;  3MXG A;  5M5X H;  2RCF A;  3H15 A;  4DAM A;  3HOV B;  5FO8 B;  2CFM A;  4KHP L;  1JIC A;  4L5Q A;  1NY4 A;  4LFA Q;  1YNJ C;  1KAW A;  1GHJ A;  1STY A;  3UI2 A;  3GO5 A;  3J81 L;  3F2B A;  3SR1 A;  1O7Z A;  1ZKO A;  2HHH Q;  1T9H A;  1WD1 A;  4CKB A;  1PV4 A;  4NXM L;  1SYC A;  2KHJ A;  2IW3 A;  1DGS A;  1GUT A;  2B2W C;  2L5T A;  2B8F A;  4RGN A;  1DYQ A;  2C9O A;  1ICW A;  4G7O C;  4LF5 L;  3NHH A;  3RMH A;  1L0W A;  2ZXO A;  4Z9C B;  1K3R A;  2AUK A;  1V1P A;  1KLU D;  1SLJ A;  2QW7 A;  2Z6K A;  2RHS B;  4OXP A;  4EQ5 A;  1PH7 A;  4FYD A;  2EY1 A;  4DGZ A;  1J6Q A;  1WTH A;  2EIF A;  5AJ3 L;  2KBN A;  2VB3 X;  2GVB A;  4A3M B;  1YJN A;  5D65 A;  1GUS A;  1HNX Q;  4WFN 3;  3FMC A;  3BYT B;  2NVY B;  1CFM A;  4DR5 L;  4J1M A;  1HRJ A;  1K28 A;  1I4H A;  1FVI A;  3QO2 A;  4JV5 L;  1YHA A;  1I4X A;  3S1N H;  4A3G H;  4U68 A;  3NBH A;  1IL8 A;  4DXG A;  2VQF Q;  1PH8 A;  2EQS A;  4AYB G;  2N3S A;  2J7Z A;  2RQX A;  2JA6 G;  3PGZ A;  4A3J G;  3FKI B;  2VUM B;  2R7F A;  1E1T A;  4DAY B;  4RHS A;  1CUK A;  1PH1 A;  3K8A A;  4XT1 B;  4JI6 Q;  1SFO B;  3A74 A;  1K0R A;  2ZTE A;  3CCJ A;  2RSN A;  3UDG A;  1XMO L;  5FLX E;  3NUC A;  4K6L A;  3ERS X;  1JMC A;  4HSP A;  2L11 A;  1L1O B;  1CSQ A;  3C1F A;  3W5O A;  2A68 C;  2O5J C;  2FFK B;  2I46 A;  3DXJ C;  5COR A;  2JA8 G;  1DOK A;  3J81 j;  2E2I B;  2KJX A;  3ITP A;  2F0M A;  2JP1 A;  2RHQ B;  1HFN A;  1XTD A;  4C3J G;  3MA2 B;  3W2D A;  5KIX A;  2I5M X;  3RLO A;  3D0F A;  4MTK A;  5E4W C;  1F9S A;  3JAM L;  1IL2 A;  4BA2 I;  4A3E G;  4Q5V A;  1PDQ A;  2K5H A;  4KKU A;  2CHB D;  3GTQ B;  4R4O A;  3QJY A;  2PI2 A;  2ZTD A;  1XXG A;  4A3F G;  1IZ6 A;  4I65 A;  4ODG A;  4JYA Q; 
#chains in the Genus database with same CATH homology
 4AYB B;  4A3J B;  3T53 B;  3J7Y W;  4TSS A;  2BDO A;  4IAL A;  4K5V A;  4QUC A;  2ID0 A;  1LTG D;  2KHS A;  2TSS A;  4J8Q A;  2K05 A;  4KJO A;  1X32 A;  1Y8P B;  2JA8 B;  2JEA I;  2L55 A;  1ONL A;  3DEP A;  1S5F D;  3KLR A;  3A8I E;  4C3J B;  4R8I A;  2VB2 X;  4QCL A;  1JOO A;  5C0X H;  4I7Z C;  4P2C B;  4FP5 D;  4A3F B;  2NB0 A;  1LV9 A;  3FDT A;  3SK6 A;  4TQU S;  5CC4 A;  2LFN A;  1IW7 D;  1FNW A;  4ZRZ A;  3A8K E;  1BOS A;  5LL6 S;  1LTR D;  3VYT A;  2AUJ D;  2RVL A;  5C4Z A;  1H9R A;  4G57 A;  1F2M A;  3S2D B;  2NN6 H;  2KEE A;  3V2T A;  2XIW A;  4KTA A;  2K6A A;  3NPP A;  5NUC A;  2KCC A;  1Z6H A;  3MFY A;  5LL6 X;  4RAU C;  4YIJ A;  1LTB D;  3NWT A;  3SXH A;  5CV8 A;  3K5N A;  1QB5 D;  3TZD A;  3M7N A;  3A55 A;  2WV6 D;  1TWH B;  5C3X A;  1B50 A;  5C4H A;  1B9M A;  1TWC B;  4RCN A;  2B2T A;  2Q8I B;  2PZW A;  4KD4 A;  5ELC A;  2O4X A;  4R8N A;  3HEJ A;  3TSS A;  2K5W A;  4UAI A;  3EA6 A;  1B4O A;  2DNE A;  1FNV A;  4KHZ A;  1LTA D;  3LX0 A;  1BF4 A;  1O7L A;  1B44 D;  3D31 A;  5E3F A;  1VDZ A;  2F0V A;  3S1M B;  3TBI B;  3MZ5 A;  2I07 B;  2RKS A;  4DAP A;  2O5I C;  2EVB A;  2F3W A;  2J4X A;  3TP8 A;  1A6X A;  3D6C A;  4CJ0 B;  4KJN A;  2MPM A;  4CKC A;  3CRK C;  4L63 B;  2NZ1 D;  2J0T D;  3D4D A;  3ONA B;  2KA7 A;  4FXK C;  2E2H B;  4FF2 A;  2ZT9 C;  4G7H C;  4ILW A;  1KDA A;  1S5E D;  4XQJ A;  1CK1 A;  2SOB A;  3O13 A;  5J39 A;  1FD7 D;  3W3A A;  4KV6 A;  4OIJ A;  1G91 A;  4EGV A;  1CZG A;  5G3L D;  3I3C A;  3R2T A;  1PXU A;  3NTI A;  1TY0 A;  3EQL C;  2EY6 A;  2EDG A;  1STE A;  5M3F B;  2NTT A;  2A5H A;  4FXD A;  3Q24 A;  4O42 A;  2F0S A;  4F88 A;  4ABN A;  2SNS A;  3MC0 B;  1CHP D;  1JWS D;  4CGY B;  1JQY D;  2LS0 1;  3SE0 A;  3OSO A;  1S4Z A;  5J1Z A;  2PO4 A;  1C4Q A;  4S3S A;  4KK7 A;  3PO2 B;  2EJF C;  1LT6 D;  2EXZ A;  2QEJ C;  3SK5 A;  3P75 A;  3VA7 A;  2KOL A;  2XSC A;  1CM9 A;  3D8G A;  2M9V A;  2AQ1 B;  3TP7 A;  1WTQ A;  3GTK B;  2L12 A;  3MHB A;  1TT2 A;  4FXG C;  1U4P A;  4EVO A;  5JPM C;  2RBM A;  2IL8 A;  2B2T C;  4A93 B;  5K5P A;  2DY8 A;  2X6L A;  2XVS A;  1EYA A;  4CJ1 B;  4N9P A;  2KUM A;  5IOC A;  1HCZ A;  4DAV A;  2JSO A;  1RDP D;  2Z4H A;  4G7Z C;  2IWH A;  2TMP A;  4RGT A;  1MBY A;  2NUC A;  5IT9 L;  1V43 A;  2LY7 A;  4LJZ C;  4H7B A;  1SE3 A;  1FYC A;  1IW7 C;  3TP5 A;  1BR9 A;  3MXU A;  3QWN A;  4RHR A;  2IX3 A;  5JEA G;  4JBW A;  4DAY A;  3K59 A;  2IX0 A;  5I9P A;  3WOF A;  1HA6 A;  1SNC A;  3C1E A;  1RF2 D;  2EOT A;  3L9A X;  1V1O A;  2F1M A;  2K1B A;  2D2C C;  3HKZ B;  5CV6 A;  1FNU A;  1OO9 B;  4MIU A;  3DWA A;  2DY7 A;  4ZQ3 A;  4A3G B;  2NWG A;  1EZ6 A;  1G29 1;  4A3B B;  4QF4 A;  2K7V A;  2PCF B;  5JEA J;  5A2Q L;  4Y7N B;  2NTS A;  3C2P A;  4DK0 A;  3NQI A;  3PIP 3;  5ELF A;  1PFM A;  3FEW X;  4XQQ A;  1EY0 A;  3BDL A;  2F0D A;  1AW7 A;  1PFN A;  3J80 L;  5J22 A;  1GJX A;  1XTC D;  3VR3 A;  2F3V A;  5FLX L;  1ROD A;  5CR3 A;  3FPU B;  1TS5 A;  3I72 A;  2B2U A;  1STN A;  5C0X G;  4IN3 A;  2JXM B;  2A6H D;  3S1R B;  3DMU A;  3X3N A;  1LTI D;  1EOT A;  2NN6 G;  4BWG B;  2C5C A;  1JWM D;  3U9S A;  3KF8 A;  1G6Z A;  1UUP A;  1WTW A;  5C0X J;  2QCP X;  1OXS C;  2PZT A;  1X3P A;  1WTR A;  1GUN A;  1D5X C;  3R8B A;  3HS0 C;  1OXX K;  1SNO A;  3QB3 A;  2F0E A;  3HG9 A;  1ESR A;  3IFD A;  4KMU C;  3WOE A;  1PYW D;  2VXW A;  3DUZ A;  1C48 A;  1Q12 A;  2WII B;  4QIW B;  1EZ8 A;  3VR4 A;  4V19 0;  1HUN A;  2BOS A;  3VR6 A;  3G7L A;  1IHZ A;  3VR5 A;  2NVX B;  2QKI C;  4IUQ A;  1NAP A;  3K7A B;  4IZ8 A;  5CGK A;  3PUY A;  4XYO A;  3BVG A;  1EIG A;  4IUR A;  4OO1 G;  2F0J A;  3D4W A;  2PW5 A;  3HGB A;  4DN4 M;  4FF3 A;  1PZK D;  5I9O A;  3HOW B;  3HZX A;  1D1I A;  1SYE A;  1ZYR D;  1G2T A;  2ICI A;  2PW7 A;  3F2U A;  1F2L A;  2K01 A;  4HED A;  2KEC A;  2YYZ A;  4L8J A;  1VCI A;  3S2H B;  5G3L F;  1GOZ A;  1UEA B;  1K83 B;  3SEB A;  2F0P A;  2VNU D;  1NR2 A;  1D5Z C;  1EEI D;  5JEA H;  3KBX A;  2B8G A;  1AN8 A;  2RDG A;  2F0H A;  4IUN A;  2B63 B;  1B9N A;  3K58 A;  1Y8N B;  5ELE A;  2B2U C;  4LMQ D;  1I4Q A;  1SJH D;  3K6O A;  5IGC A;  1Y8O B;  1Q1E A;  2PNR C;  5JJZ A;  1DD2 A;  2WIN B;  3I4M B;  3T13 A;  1XX8 A;  2JA6 B;  3MFG A;  2PZU A;  1W6K A;  2LMC B;  1H9S B;  5M5Y B;  4X3T A;  4PNY A;  2D5D A;  3S16 B;  3VA5 A;  1S5D D;  4L6T B;  1HQM C;  1EQT A;  1STG A;  5C4J B;  3OMC A;  1I50 B;  3D6W A;  2X6G A;  2EJM A;  4GZY C;  1YNN D;  4XXE A;  1QNK A;  2H1E A;  4A3E B;  2MUY A;  3Q0A A;  1E2Z A;  3IFT A;  1D6E C;  1I4R A;  4LK1 C;  2WP8 J;  1ILQ A;  1TR5 A;  3KUP A;  4C1N I;  1Q8I A;  3SHL A;  1BUV T;  1LTS D;  1D5M C;  5FK9 C;  3CHB D;  1A3T A;  1VF5 C;  2V4D A;  2A6H C;  4OGQ C;  1B3A A;  2E2J B;  2QF7 A;  3J81 E;  1QWY A;  4FNF A;  1A15 A;  2OT2 A;  3AB9 A;  3PO3 B;  1U4L A;  4RFB A;  1R4P B;  2HCC A;  5JOB A;  5JVG 3;  5E1F A;  3X3M A;  2F0I A;  3NP8 A;  3HOY B;  1EWH A;  2IPK D;  2YU9 B;  3H0G B;  1ML0 D;  1LTT D;  4IUP A;  5C6A A;  1L0X B;  1SYF A;  2E74 C;  1SMY C;  3EFX D;  2F0Q A;  4KI0 A;  1OXU A;  4KY7 A;  5CBE E;  4KD3 A;  1BCP B;  3H3V C;  1VF7 A;  4XDX A;  5C3E B;  1SYB A;  4HCS A;  5KNC A;  4PMW A;  3TN2 A;  3ND9 A;  1DCZ A;  1E0B A;  1F9P A;  4H44 C;  2EJG C;  5EQ0 A;  5DEH A;  5K36 G;  3V05 A;  4BBS B;  5C4X B;  2AQ3 B;  1DOL A;  4XIG S;  4OO1 H;  2CQA A;  1WVL A;  2M2L A;  2XRS D;  2HCI A;  4KKT A;  2F0T A;  1A2T A;  1BXT A;  3GTO B;  2R93 B;  3NXW A;  3JAM E;  3HOU B;  2Y0S B;  1LLR D;  4IUT A;  2CW0 D;  1J8I A;  1LT5 D;  1U4R A;  5BN5 A;  1EL0 A;  4CBV A;  1ZYR C;  4WJW A;  5M5W B;  4QUF A;  1TS2 A;  3QIA A;  4ZUI A;  1NUC A;  2K5Q A;  4IUV A;  5I4D A;  1CZW A;  1CTM A;  1WTX A;  5D3D A;  4K14 A;  1Y1V B;  1EEF D;  1TII D;  1IYV A;  2FMM A;  5JAV A;  4NKL A;  3I70 A;  2R92 B;  1DM0 B;  1SAP A;  3FPP A;  1Q90 A;  1LAB A;  4XTC S;  2IX1 A;  1SNQ A;  1MSG A;  1ESF A;  4BA1 I;  2ICE C;  1BO0 A;  5EJW A;  3SK4 A;  1PRT B;  3DM1 A;  4K6D A;  1HHV A;  1H9M A;  2BE5 D;  4ZK9 B;  1II3 A;  2MP1 A;  2E76 C;  3EVQ A;  1U4M A;  3HOX B;  1PFB A;  2LKV A;  2BCO A;  5KND A;  1KAA A;  5FKA C;  1OXV A;  4C3I G;  5JPN C;  2E2D C;  3OWF A;  3URY A;  1ZXT A;  3RD4 A;  3M4Y A;  4ZLT F;  1I4G A;  4EQO A;  5ISR A;  1B1Z A;  4HN7 A;  2EYO A;  2R61 A;  4JK1 C;  1GXD C;  1PTO B;  5DAU A;  4HR7 B;  2XNA C;  5M9O A;  3MAQ A;  1B2T A;  2WAQ B;  4FVM A;  3D3R A;  5TSS A;  5CMD A;  1WCM B;  2JYO A;  1CA5 A;  3BYY B;  4FF1 A;  1R9T B;  3A8J E;  5IGG A;  1LAC A;  2SDF A;  1IKM A;  1EY5 A;  1JOK A;  1EY4 A;  1RCV D;  2PQE A;  2D9U A;  5FOB B;  4DNR B;  4C3I B;  3S15 B;  3MXP A;  1U9R A;  2G9D A;  1O7Y A;  2OXP A;  1S5C D;  4IFD G;  3NTH A;  3BS1 A;  4BY1 B;  3I90 A;  1QNU A;  3PUW A;  1TKW B;  3LWE A;  3P7J A;  5FO7 B;  1QIL A;  2R6G A;  2PMZ B;  5T1I A;  3N6R A;  1OXT A;  2HDL A;  4KHV A;  4EQP A;  1I6H B;  1XYI A;  1STA A;  2MHV A;  1ENC A;  1CQV A;  1F2Z A;  2Z4I A;  3GTM B;  1CQF A;  1BBX C;  4IFD J;  1DOM A;  1I3Q B;  1JC7 A;  3Q22 A;  5I2X A;  4NP5 A;  3VYU A;  3HOZ B;  2HQE A;  1TS4 A;  4M8A A;  1O80 A;  5C5L A;  5K36 H;  4K8J A;  3GTL B;  1SSO A;  3MEH A;  1AP0 A;  3MWY W;  5E4X A;  3A56 A;  4PMB A;  3RZD B;  2N55 A;  3ERO A;  2Q8R E;  5EGT A;  2EZV A;  3RLF A;  4G4K A;  2Q8T A;  5ELB A;  4K2L A;  4FO2 A;  4C2M B;  1BCP D;  1ENF A;  3CU7 A;  3K5O A;  4ID6 A;  5IGD A;  3P1H A;  3MXN A;  1D2B A;  1EY8 A;  2X69 A;  3T56 B;  1BQQ T;  1SDF A;  2JA5 B;  4ZYS A;  3KLS A;  2NYZ D;  1EQV A;  3LWU A;  1JR0 D;  1HFG A;  1CA6 A;  3U9O A;  2NBF A;  2CW0 C;  5KRU A;  5F2D A;  3CQZ B;  3A7L A;  2JE6 I;  3NTK A;  1IKL A;  3GV6 A;  1MGS A;  5C5M A;  1SND A;  5D14 A;  1FGB D;  1NSN S;  1TWA B;  1SE2 A;  3K0Y A;  1D1K A;  2RDF A;  2JEB I;  4IUU A;  4PMC A;  4A3K B;  3S1Q B;  3AU7 A;  5HGT A;  5KNB A;  4CJ2 C;  4F8M A;  2OEO A;  1Q1B A;  5CYU A;  3VR2 A;  4BBR B;  4RCO A;  3PV0 A;  3SK8 A;  3AMU A;  1T5X D;  3RZO B;  1PTO H;  1A3U A;  3DWP A;  5D3I B;  1PZJ D;  1AZQ A;  5C3W A;  3R2I A;  5C0X I;  5AFW A;  1QJO A;  3M3Y B;  1VMP A;  1QOH A;  5IT9 E;  1SNM A;  1TWF B;  4H0L C;  2NN6 I;  2BE5 C;  2FJ2 A;  1RHP A;  4DK1 A;  5KYL A;  2AWO A;  3TP6 A;  1L0Y B;  5LHY 1;  3PMF A;  3PIO 3;  5CV9 A;  4XQN A;  3S9W A;  1STB A;  1PMR A;  3PUX A;  4U67 3;  1HXY D;  2M00 A;  3FVQ A;  1JE4 A;  5CV5 A;  1CHQ D;  4V0B A;  2F03 A;  3P20 A;  1PZI D;  1TY2 A;  1PRT D;  3KK7 A;  4DFA A;  4MHE A;  1ENA A;  1RTN A;  1G2S A;  5EBC A;  3E5S A;  5COY A;  2EYH A;  3SVM A;  5BN3 A;  5DM6 3;  5A2Q E;  1DXM A;  5CV7 A;  5EKL A;  1SYG A;  1KDC A;  3HP3 A;  1F9R A;  4X3K A;  2K28 A;  4HMI A;  3FRP B;  3J80 E;  1EYD A;  1A2U A;  4IFD H;  1PTO D;  2WAC A;  4NMZ A;  1K8O A;  1WTP A;  2F0N A;  2WB1 B;  4OO1 I;  2R7Z B;  1DZ1 A;  4TRD A;  1TVX A;  1UNS A;  2AQ2 B;  4WRD A;  1ET9 A;  1J9O A;  3I4N B;  1LT4 D;  3HRZ C;  5IOD A;  3S17 B;  4ZKC B;  1V8Q A;  1GHK A;  2QIL A;  4PV1 C;  3L7Z C;  4R9W A;  1GUG A;  4LAA A;  1S5B D;  2IJ0 A;  3OHX C;  2RDH A;  5DM7 3;  3H94 A;  1EY6 A;  3VYR A;  2RA4 A;  3TME A;  3OIQ A;  2GA4 B;  3BZD B;  3GP7 A;  2BDN A;  3BDO A;  3GD7 A;  2L4N A;  1PLF A;  2DNC A;  1ILP A;  3KBG A;  3OPO A;  3PUV A;  1GUW A;  3CKI B;  5CBA E;  3I4L A;  3R3O A;  5EPJ A;  4OL7 A;  2K32 A;  3SDZ A;  5IGE A;  1QE6 A;  5CV4 A;  5I6W A;  3RUZ A;  1HPC A;  3WDN A;  1JOR A;  4Q0F A;  4QMG A;  4KY6 A;  4O1N A;  1BCP C;  1JOQ A;  2XWJ B;  2FIN B;  4ZAI A;  1EFI D;  3M4O B;  3I91 A;  1R4Q B;  4RA8 A;  3I73 A;  2ENB A;  1AFP A;  5EKI A;  3OMG A;  2E75 C;  2KQ3 A;  4E6I A;  1KTK A;  1EU4 A;  3R93 A;  2F0G A;  1JB3 A;  1T5E A;  1NR4 A;  3Q23 A;  5IGB A;  4C3H G;  1EU3 A;  2A6E D;  5KGU A;  3OW7 A;  5EBD A;  1SE4 A;  1O78 A;  3IL8 A;  1SYD A;  2F0O A;  1I6V C;  4RWS C;  2A69 D;  2CVR A;  2SNM A;  1SEB D;  3ND8 A;  1RD9 D;  2BA0 A;  4IQZ A;  3ERQ A;  4K8I A;  2L1B A;  2XN9 C;  3I8Z A;  4FF4 A;  3E0J A;  2H4O A;  2ZXP A;  1VMC A;  2EYP A;  2EYM A;  2NVT B;  1WTV A;  1TU2 B;  1AZP A;  5KEE A;  5A35 A;  2HDM A;  2WKD A;  4B9X A;  1BCP F;  1V1P B;  1B53 A;  4K5X A;  4C3H B;  2AWN A;  1KDB A;  2K5D A;  4KN4 C;  2JA7 B;  4B08 A;  1DON A;  1SXT A;  4DF7 A;  4A3D B;  5KYI A;  2KCN A;  3Q6S A;  2R3Z A;  2KED A;  4DU9 A;  1EIH A;  1LO5 D;  4K5W A;  5FO9 B;  3GTG B;  3D4R A;  1PRT C;  4ZUJ A;  3OIP A;  3IAY A;  3T51 B;  2WKC A;  4OIK A;  1M8A A;  4RH6 A;  1ET6 A;  1Z7T A;  4KKS A;  2EY2 A;  5HUR A;  2L9H A;  1MSH A;  2F0W A;  4J6H A;  4MN3 A;  1RKN A;  2QDB A;  4TKO B;  4C56 C;  3BVZ A;  4OHJ A;  3CRL C;  3GV3 A;  2B2Y A;  2ZXR A;  4B9W A;  1UAP A;  1Y69 U;  2F4I A;  1RTO A;  2D62 A;  2F0U A;  1PTO C;  1E2V A;  1Q3L A;  1I4P A;  4XYQ A;  3V96 A;  2F0K A;  3H6M A;  2B2V A;  1H9J A;  3T4A C;  1YNJ D;  1F2Y A;  1G8Z D;  3K5L A;  4CKE A;  2IT1 A;  5IGF A;  3DHQ A;  2PYK A;  1HTP A;  3NQT A;  2BA1 A;  3QG1 A;  4DNT B;  3BG3 A;  4HMJ A;  1K8M A;  3MTS A;  1WTO A;  1X3Q A;  2EYF A;  3NSW A;  4NW2 A;  5DNF A;  1BDO A;  4HTH A;  1STH A;  2SEB D;  1SJE D;  1PRT F;  3T16 A;  1EY7 A;  3PUZ A;  2L0C A;  4X3S A;  2K33 A;  1WD0 A;  2Z1C A;  4ZKB B;  2EE1 A;  5ELD A;  1QG7 A;  1TWG B;  2O2L D;  2XRQ D;  1YNN C;  1HTL D;  3GQB A;  3S14 B;  3G6J B;  4HSV A;  4UDU C;  3GTP B;  4BS9 A;  1E2W A;  1EYC A;  5IIF A;  5M3M B;  5M5X B;  4DA2 A;  1QCB D;  4PQX A;  2EY5 A;  1IYU A;  1XWE A;  2FHT A;  3LNN A;  5EPL A;  4NDX A;  1PTO F;  3TDQ A;  1EWC A;  4HCE A;  3IKJ A;  1M4V A;  2N88 A;  3QOL A;  2DN8 A;  3TZU A;  2A68 D;  5EKK A;  3K5M A;  4X3U A;  4H13 C;  4F7X A;  3VYS A;  1A3V A;  5JVH 3;  4RKB A;  4BY7 B;  1H9K A;  3H91 A;  1KNE A;  4RGM A;  3OOC A;  4A3I B;  2B39 A;  3E6Z X;  1HQR D;  2NVQ B;  1KNA A;  2B2W A;  3A7A B;  2OF1 A;  2A6E C;  3GTJ B;  1Y1W B;  2A73 B;  1JCK B;  3DEO A;  2FMC A;  1BNZ A;  2A69 C;  2MGS A;  1KLG D;  2MJ8 A;  4CHT B;  4F87 A;  3L3O C;  1AEX A;  3S1N B;  1F9Q A;  4ME5 A;  1H9S A;  3C46 A;  2XWB B;  2F0L A;  1MD2 D;  2B2Y C;  4M1U B;  3ZYY X;  3QOJ A;  1CT1 D;  1SBB B;  5T1G A;  3K57 A;  1MI2 A;  1TQO A;  3M7G A;  2KVM A;  3BDC A;  4KY5 A;  3M85 A;  1ZEQ X;  4KN7 C;  1F77 A;  1TS3 A;  1W6J A;  4IFD I;  2B2V C;  3A54 A;  4RKL A;  3KLS X;  3NE5 B;  3NK9 A;  3NWS A;  3OWE B;  5I6Y A;  3EJI A;  3BVM A;  5BN4 A;  5I2Y A;  3J7A F;  1DJR D;  3C3L A;  2EYJ A;  2EPB A;  1HUM A;  4ULL A;  4C1N K;  2EYL A;  1CI3 M;  1SNP A;  3H09 A;  5EPK A;  2G9H D;  1LT3 D;  4RGO S;  2PPB C;  3N52 A;  4QB4 A;  3NBI A;  2K03 A;  1FR3 A;  1KAB A;  2F0F A;  1GUO A;  2Z8L A;  1Z47 A;  4XT3 B;  4K2K A;  2K04 A;  2A74 C;  1RJT A;  1HA5 A;  3DWQ A;  2HUG A;  1JWU D;  2RSO A;  1EY9 A;  4DXF A;  4EQN A;  4HAE A;  1SMY D;  1NCV A;  1C8C A;  4N9T A;  3J7A V;  4WOR A;  5C44 B;  3MVV A;  3MXG A;  3HOV B;  5FO8 B;  1JIC A;  1YNJ C;  1GHJ A;  3UI2 A;  1STY A;  3GO5 A;  3J81 L;  3SR1 A;  1O7Z A;  1ZKO A;  1WD1 A;  4CKB A;  1SYC A;  2IW3 A;  1GUT A;  2B2W C;  2L5T A;  2B8F A;  4RGN A;  1DYQ A;  2C9O A;  1ICW A;  4G7O C;  3NHH A;  3RMH A;  2ZXO A;  4Z9C B;  2AUK A;  1V1P A;  1KLU D;  4FYD A;  2EY1 A;  4DGZ A;  4A3M B;  2VB3 X;  5D65 A;  1GUS A;  4WFN 3;  3FMC A;  3BYT B;  2NVY B;  1CFM A;  4J1M A;  1HRJ A;  3QO2 A;  1I4H A;  1I4X A;  4U68 A;  3NBH A;  1IL8 A;  4DXG A;  2J7Z A;  2RQX A;  3FKI B;  2VUM B;  4RHS A;  4XT1 B;  1SFO B;  2RSN A;  5FLX E;  3NUC A;  4K6L A;  4HSP A;  2L11 A;  3C1F A;  2A68 C;  2O5J C;  2FFK B;  2I46 A;  3DXJ C;  5COR A;  1DOK A;  2E2I B;  2KJX A;  3ITP A;  2F0M A;  2JP1 A;  1HFN A;  4C3J G;  3MA2 B;  3W2D A;  5KIX A;  5E4W C;  1F9S A;  3JAM L;  4BA2 I;  4Q5V A;  1PDQ A;  4KKU A;  2CHB D;  3GTQ B;  3QJY A;  1XXG A;  4I65 A;  4ODG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...