1FD7D

Heat-labile enterotoxin b-pentamer with bound ligand bmsc001
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
103
Chain Sequence
b'APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT-LABILE ENTEROTOXIN B CHAIN
publication title Exploration of the GM1 receptor-binding site of heat-labile enterotoxin and cholera toxin by phenyl-ring-containing galactose derivatives.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
total genus 24
structure length 103
sequence length 103
chains with identical sequence E, F, G, H, L, M, N, O, P
ec nomenclature
pdb deposition date 2000-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1fd7D00
1DYQA 4DXGA 1PRTF 1CQVA 4O1NA 1FNVA 1M4VA 2XN9C 1BXTA 1JR0D 1JWUD 2AQ1B 3DWPA 4RGTA 1KLGD 1TS4A 1LT4D 1BCPC 3KLSX 1G8ZD 1CT1D 1V1PA 1UUPA 1EEFD 2XRQD 1S5BD 2RDGA 2WV6D 3BVMA 3EA6A 1PTOC 1LO5D 1SXTA 1LTTD 1BCPD 1RF2D 3O13A 2J4XA 1HTLD 2R61A 2AQ3B 2AQ2B 1FGBD 1I4HA 1PTOD 1XXGA 1SJHD 1TS5A 4C56C 4UDUC 1HQRD 1XTCD 5ELCA 1PZID 5FKAC 5D3DA 4DXFA 1RCVD 1JQYD 3W2DA 1MD2D 1PRTB 4ZYSA 3DWAA 2XRSD 3EFXD 1S5FD 1AW7A 3DWQA 1ET9A 1FNWA 3TSSA 1LTBD 1S5DD 3OWEB 1LT3D 2RDHA 4RGOS 1KTKA 2O2LD 2QEJC 3GP7A 3R2IA 1RDPD 1EU3A 2ICIA 3BYTB 1EEID 1S5ED 3BVZA 5ELDA 1LLRD 4Z9CB 1I4QA 1V1PB 1PZKD 1SJED 1ESFA 1PZJD 1EWCA 1GOZA 5FK9C 1B1ZA 1L0XB 1D5MC 3BZDB 1F77A 1LTID 1AN8A 1SE4A 3R8BA 2IJ0A 1T5XD 4RFBA 2IPKD 1HA5A 1CK1A 3SEBA 4BWGB 1V1OA 3MC0B 2G9HD 1SE3A 1BCPF 1EFID 1TS3A 1LTAD 1I4RA 1PRTC 1B44D 1TS2A 2XNAC 1TY0A 5TSSA 1I4XA 1PTOF 1RD9D 1SBBB 2Z8LA 4RCOA 1PRTD 4RHRA 2QILA 1UNSA 1S5CD 1PTOH 1LTSD 1L0YB 4OHJA 1I4GA 1CHQD 3CHBD 3MFGA 2CHBD 1JWMD 1JWSD 5ELFA 1FD7D 4TSSA 1LT5D 1TY2A 1KLUD 4RHSA 1QILA 3V05A 4L63B 3BVGA 1STEA 3R2TA 1FNUA 1PYWD 4K6LA 4L6TB 1BCPB 5D3IB 1LT6D 1ET6A 1PTOB 4RGMA 1EU4A 1JCKB 1DJRD 5ELEA 1CHPD 2TSSA 1D6EC 2SEBD 5I4DA 1ENFA 1LTGD 1D5ZC 2NTTA 1LTRD 1D5XC 4RGNA 4RH6A 2NTSA 3URYA 1SE2A 1HXYD 1SEBD 1I4PA 5ELBA 3BYYB
chains in the Genus database with same CATH superfamily
4U68A 3DM3A 3S17B 2F0LA 1BXTA 1O7ZA 1CSPA 1EYGA 2JXMB 1Q12A 2K5HA 3F2BA 3STBD 1BF4A 1MI2A 1WTWA 1E2ZA 1Y14B 3A7AB 1XX8A 3WOFA 2JE6I 3OWFA 2B2WC 5ELNA 3C1FA 5J22A 4CKEA 4A3DH 1IL8A 5KYLA 3CCLA 4DR7L 2WB1B 1OXXK 3A55A 1C48A 1EQTA 2B2WA 4IPGA 2F1MA 4CBVA 1XMQL 2NVQB 5FO9B 1KTKA 1STYA 3TP8A 1N33L 1SFOH 1BNZA 2WB1G 2A6ED 1CI3M 4RA8A 3OW7A 3U4ZA 5CC4A 3LWEA 4FXGC 3TQYA 3R3OA 1PZJD 5C0XH 1B1ZA 1C4QA 1EYDA 3CW2C 4H44C 3BZDB 2RQXA 1EZ6A 4GN3B 1JOOA 3AB9A 3CCQA 1RJTA 4CDCC 1YNJD 4ID6A 2I5MX 3CMEA 3TBIB 1H9RA 4QIWB 1RODA 5DEHA 3K0YA 2YU9H 1V9PA 1TS3A 1CUKA 5BN5A 5HGTA 3QJYA 4RG1A 3W1BA 4DV3Q 1AE2A 1Q46A 4DV2Q 5I6YA 3SE0A 4K6DA 4A3CG 2VQEQ 4IOAA 2QGQA 4HMJA 5EPJA 1L1OA 2AWOA 2IX1A 1SNCA 4A3FB 1YHBA 3AU7A 1IYUA 1CQFA 4IZ8A 4PZ7A 5BN3A 3OSOA 3CU7A 3I8ZA 1I50H 4KKSA 4JW0A 5JEAH 3J7YW 3C2PA 3S1QH 1NBWA 1XMOQ 5C3XA 2A74C 4A3FG 4GS3A 1EQRA 1N32Q 1CFMA 1IXRA 3K6OA 1XNRL 3H3VH 2EJFC 2F0JA 3KFUA 4DR6L 3IFDA 4DPGA 3L3OC 2KENA 1OXUA 5IP7G 2Z1CA 1YNNC 2B2YC 1Z9FA 4IUTA 4O1NA 1IKMA 1MSHA 2K5NA 1LT4D 1OXVA 5D65A 2F0GA 1EOVA 3PO2H 4YWMA 2WV6D 3SGIA 1IBLL 4V190 4DR7Q 2LFNA 4FF4A 2F03A 4LFCQ 1GHKA 4CHTB 5EGTA 3HGBA 1A3UA 3FVQA 1GJXA 1NAPA 2MP1A 1RTNA 1AEXA 1N33Q 1Q1EA 4IPHA 2R93H 4WRDA 4JI7L 1WTQA 3MTSA 1S72A 1TWHB 1LT3D 2NZOA 5EQ0A 3UI2A 1LACA 4Q0FA 5IYCH 3ULPA 1MHWC 4LFAL 4C3JB 1PZKD 1GOZA 2A1AA 3M4OH 1D5MC 1LTID 2HCCA 3I73A 2IJ0A 1HRJA 1YEZA 2HDLA 1IBKL 4Y52H 4CDEC 4DK1A 3BG3A 2F0FA 2K1BA 3R93A 4XT1B 4ODGA 5LMUL 3HOZH 4C3JG 1BCPF 1QUQB 1WCMB 2PI2E 1B3AA 2D9UA 2VB2X 1O7LA 4B3SQ 1X32A 2BDNA 4DV5L 1SBBB 1HNXQ 2WIIB 4KHZA 2OCEA 1LYLA 4ZLTF 4GLAC 1WCMG 3ITPA 3F2CA 1R9TH 1TWFB 2ICEC 1TWGB 2GVAA 4N8X1 1ONLA 1PH4A 1TT2A 1B7YB 4MIUA 1K8OA 3IKJA 3MXNB 1SNMA 4CDFC 2UU9L 1YNND 5IYDH 4GLXA 5HY6A 4OWXB 1HHVA 2VUMH 4F7XA 3CRLC 4UP7A 2M9VA 1D6EC 4A3IB 1PYSB 1LTGD 4NW2A 3SDZA 3U9SA 4LF9Q 4B3TQ 2E2HB 4PMWA 3CCEA 4IJHA 3KF6A 1SE2A 3KJOA 2HIXA 5COYA 4A3IG 3TRZA 1E22A 4X62Q 4HJ5A 1X9NA 3J81j 2X6LA 4ALPA 4IFDJ 4GNXC 2CH4W 1BCPC 2PO4A 5JOBA 5A35A 2NVXB 4JBWA 2CWAA 5LL6S 1A3VA 1SYEA 4A3EH 4CJ1B 1MSGA 1VQKA 2HQLA 3S2DB 1G6ZA 1N36L 4IURA 4GNXA 4R8NA 3I3CA 4PMCA 4L5SA 3DLLA 1EIFA 4DR4Q 4XQJA 1FNWA 1B2TA 1LTBD 1S5DD 1BBXC 2O2LD 3GP7A 3R2IA 3J80c 1HZ9A 2ICIA 1VQIA 4A3JH 1KRSA 3MVVA 3S2HB 3PUVA 1K73C 1SNOA 2K6AA 4G4KA 2K75A 4IO9A 1SE4A 5I2XA 4S3SA 2PYKA 2F0SA 5C3EH 4DV5Q 4FP5D 2EXZA 5KEEA 1NJIC 1X3FA 3T16A 1DOLA 3CD6A 1YZ6A 1BR9A 2A73B 2DNEA 1B44D 3ZJYC 3GTJH 3GTLH 5CV9A 1EY6A 2FFKB 1U4LA 1YHQA 2K4KA 2ENBA 2UU9Q 3J7A5 2UXBL 1RHPA 1MIUA 4DUZL 2QDLA 1FD7D 3LNNA 4EQNA 1VQAA 3NWSA 4QQBX 1NR2A 4IQZA 3CF5A 4RKBA 4JI0L 1BCPB 1HR0Q 2PPBC 3OW2A 1DD2A 2A69C 2OTLA 2RF4A 1ET6A 1QB5D 2EYLA 2KJXA 3Q24A 3CQZH 1YIJA 1M8AA 4LJZC 3KK7A 4YY3Q 2QKIC 4LF8L 3K7AB 1N34Q 4A3LG 3I91A 4N8FA 3S1RH 4JBJA 1YVCA 2YTVA 1FJGL 1P16A 3URYA 1XJVA 4I7AA 4AQYL 3HOVH 1NUCA 4WJWA 1PRTF 5CBAE 3DHQA 4DR5L 1X56A 4DNRB 4QJFA 1N36Q 3AEVA 2B8FA 3GTKB 3CMAA 3GD7A 3SXHA 2EXDA 5M5YH 1PH5A 1WTOA 3S16H 3A74A 1D2BA 1RF2D 1F9PA 1IBML 5J1ZA 4XQQA 2PZUA 1R4QB 1UE5A 4BBSB 1M1KC 4FF2A 1JQYD 3KLSA 1ASZA 1Q81C 1Y8NB 4ZYSA 3EFXD 3I4MH 3GTGB 3JAMc 4PZ8A 4BBSG 2B63B 3I4OA 4UP9A 3AFQA 4NKLA 3C1EA 4G57A 3FPPA 3D0FA 4IPCA 2NZHA 3NBHB 2K5QA 2FINB 4HEDA 1Y1VH 3T13A 1E0BA 1D8LA 5GROA 5EBDA 4LF4L 2B63G 4QL5A 1X3GA 2YYZA 1GHJA 3SEBA 1CK1A 2F0QA 4Q5VA 2K01A 1PRTC 2UXDQ 4OL7A 4DUZQ 3GTQH 4QB4A 4YWLA 2GVBA 2A69D 2WINB 2L11A 2UUCQ 1VQ7A 3TREA 4C3HB 4JI0Q 3CCVA 2ZM6L 2NZ1D 3T4AC 3QB3A 1Q1BA 1X55A 3F1ZA 1PYWD 4R4QA 4C3HG 1WJJA 5NUCA 3GV6A 3W3AA 4A4IA 1HUMA 2EY1A 4JV5L 4HJAA 4KY6A 1WOCA 4B3ML 4OONA 4APVA 2EE1A 1GUGA 4C3IB 5JJZA 1KL9A 1D5ZC 3I2ZA 4DR5Q 1J5EQ 1CZGA 3CXCA 1U5KA 2K32A 3N52A 2DJFC 2F0MA 5M3FB 2MO1A 4C3IG 1LM0A 2R7ZB 4FXDA 3A8IE 1TKWB 2K05A 2AQ1B 4O2DA 3S9WA 4G7OC 2F4IA 2PW5A 1U4PA 3OHXC 4UPAA 5M3FG 1AP0A 2R7ZG 1SXTA 4MZ9A 1L2FA 2A6HC 2LKVA 2AQ2B 5KGUA 2ZJPA 1XPUA 5FKAC 2CW0C 3HKSA 2L55A 1PRTB 3BS1A 2IL8A 4N9PA 4JBKA 4YCVA 2L9HA 5FOBB 5AJ3L 4R1JA 1E2WA 3S14H 5C5MA 4LF4Q 4H02A 2WKCA 1D7QA 1BBWA 5M3MH 2XGTA 2I0QA 3M3YB 3J81c 4M8AA 2F0TA 2OQKA 3IRBA 5IGGA 5JJLA 1Z47A 5FJ8G 3SK5A 3TMEA 2NVTH 2B2VC 1STBA 1B50A 4G7HC 1PH6A 2C35B 4BY1H 3RLNA 2L15A 3KBGA 2Y0SB 3QR8A 4KHPL 2XNAC 4YHHL 2ZM6Q 4JI2Q 2B29A 4LUVA 2Z6KC 1Y1WB 1F9SA 1RKNA 2JYOA 2Y0SG 2B2UA 1IZ6A 1JOQA 4ZRZA 1EY7A 5EBCA 2E2IH 4ZUIA 5C44H 3AFPA 4IN3A 4EX5A 2Q2TA 4JV5Q 3S24A 3PUYA 1STGA 1Y1WG 3HOUB 2I5HA 2NN6G 2Z6KA 3MA2B 4DU9A 4B3RL 4P71A 4L6TB 4DV6L 4Y7NH 3P20A 5E4WC 1BKBA 2NN6I 1C0AA 2J7ZA 1PFSA 3HOUG 1SYDA 4HN7A 2TSSA 1KIXA 1CA5A 4X64Q 3F2UA 2WACA 1Q7YC 5HGQA 2NTSA 2FHTA 2A6HD 2RHSB 2QF7A 3T1HL 1PLFA 1I6HH 4C2MH 4DV2L 4ZUJA 1HZCA 1X3EA 1T5EA 3NTHA 4HAEA 4TKOB 3SK8A 1IHZA 2EYMA 1JR0D 2F0OA 4ZQ3A 2PMZB 2CW0D 2HIVA 3PO3B 1F2LA 3QOLA 4A3KB 1CT1D 3HOYH 1SYCA 2KQ3A 2K7VA 1PFBA 1U4MA 4ZK9B 3JC66 1S40A 4IUNA 1PH1A 1K83B 1ENAA 1LTTD 1SNPA 2BA1A 2LMCB 4LW1A 2KHSA 3PO3G 1VQ5A 3NSWA 3GTMH 5AJ3Q 4A3KG 3QG1A 1XMOL 3TDQA 5DM63 4PQXA 2NVYH 2I07B 2BA0A 1RCVD 2N78A 3PUXA 1PHJA 1A3TA 1KD1C 3MXUA 4NXNQ 3DWAA 2BCOA 3OWEB 1MJEA 4FO2A 2JA8B 5M5XH 4RAUC 4OO1H 3K7UC 2E2JH 1EU3A 4E6IA 1I6VC 1A8VA 2KCTA 1GUOA 1HZBA 3BZKA 1S5ED 4GOPB 4DV0Q 1CKMA 4BY7H 1S3OA 1G291 1WYDA 3DUZA 2ASBA 1PXUA 4KHPQ 2E5LL 2JA8G 3KDFA 4YHHQ 1UEAB 4K2LA 5BN4A 3F8TA 3RZOH 2VY3A 4DK3C 3KLWA 1FL0A 4LFCL 3SHLA 1QWYA 5I9PA 1Y8OB 4KK7A 5C0XI 2K14A 1HNZQ 1TS2A 2K5WA 2XWBB 1H9SA 5KNBA 2CVRA 5IWAQ 5CV7A 2R92H 5D14A 2IX0A 4P72A 4UP8A 4P75A 2EY2A 4B3RQ 3K80C 3RLFA 4DV6Q 5IE8A 4KY5A 3K5LA 1TY2A 3OMCA 4HCEA 1TVXA 3RD4A 5DM73 1QZHA 1B8AA 5JVG3 4GKJQ 3LX0A 1HJPA 4MNOA 4PZ6A 4B9WA 2L0CA 3S17H 2KOLA 1BDOA 1KRTA 1JB7A 5E1FA 3T1HQ 1JT8A 5LMNQ 5GQOA 1OTCA 1TU2B 1MJCA 4XYOA 2KCCA 5DNFA 3HOWB 4DR1Q 4H7BA 4HIOA 5CORA 3Q22A 3P1HA 1EIYB 4B3SL 2WAQB 4PMBA 4IPDA 1HNXL 4KI0A 4EVOA 2Q8TA 4A75A 1CKNB 2I5LX 2D0OA 3H3VI 3HOWG 1U9RA 4CJ2C 5JPMC 4KJNA 3KDFB 1VQGA 1SE8A 3AMUA 1VQJA 2WAQG 1EEFD 2OF1A 2LSSA 2RBMA 2A8VA 1DOMA 5CV4A 2NVQH 3GV3A 2L4NA 1H9SB 3K5MA 4OIJA 1QUQA 3LWUA 3A8KE 5ELCA 5IYBG 1PZID 1VQ4A 2SNMA 3PIOA 2XIWA 2LS01 3DWQA 4LF9L 1TWCB 4B3TL 1CSQA 1CM9A 4N9TA 2E74C 2MGSA 3ERQA 4K5XA 4A3CH 3A5ZB 3MWYW 4K8IA 2E5LQ 1HH2P 2Z4HA 4O0AA 3I4NB 2PQAB 2B2YA 3H94A 1EEID 4IFDG 2MQHA 5C0XJ 4X62L 1X65A 1ICWA 3G6JB 5DAUA 1EQVA 2RCFA 3D31A 3MXNA 1F77A 3CCRA 2Y0SE 4IFDI 4HSVA 4RFBA 3I4NG 5JJKA 1AZPA 4A3FH 1VQDA 2CFMA 1LTAD 4DGZA 5M5WB 2F0VA 2FXQA 4KD4A 5TSSA 5CGKA 1GUNA 1PTOF 2MJ8A 4CKCA 4JG2A 1YITA 1O7YA 4A93B 1QG7A 5IP7H 4JCVE 4DR4L 2N55A 4ZCKA 2EYHA 2ID0A 4DAVA 3K5OA 2A19A 2MUYA 5JEAJ 4A93G 1FNUA 4XT3B 5CMDA 4BS9A 2D0PA 5IGEA 3ULLA 3G4SA 1P8LA 1VQ8A 3ICEA 4RGNA 2RCNA 1ICFB 1HXYD 1NY4A 2VB3X 2NBFA 5ELBA 3BYYB 1DYQA 1DZ1A 4MTNA 3I56A 4R4OA 1HUNA 1SYFA 1Q3LA 3CP0A 3I72A 3M9BA 3C46A 2XVSA 1JE5A 3ULJA 1TWAB 1MGSA 4L8JA 4AYBB 2BH2A 4DV7L 2HDMA 1PTOC 1TWHH 4LUOA 1WTPA 1PA6A 2VNUD 2J4XA 4L5QA 2R61A 3NPPA 3TEHB 1HR0L 3WDNA 5FLMG 4C3JH 3RN5A 2UUAL 2RSOA 4AYBG 3PUWA 1FGUA 4YY3L 3Q8DA 3H91A 1WTXA 2R7FA 2J0TD 1N34L 5IP9G 3CKIB 3MXGA 2R7DA 1E1OA 2KEDA 2KUMA 2KCNA 2RHQB 2KEEA 1B70B 3HKZB 1J8IA 1SRUA 1WCMH 2DNCA 3QO2A 2WKDA 1V1PB 3VYRA 1NSNS 1ESFA 1JE4A 2QA4A 1DM0B 1Q90A 1V8QA 2WB1E 1A15A 3MEHA 4JI8Q 3GDEA 3HKZG 3BDOA 4HMIA 1K8MA 3DM1A 4NMZA 1VQNA 1F2MA 1TWFH 2ZTDA 1V43A 3MC0B 5GAHC 1TWGH 4ZKCB 1SNDA 2HD3A 4UHVA 2KBNA 1I4RA 1IYJB 1MBYA 1EYCA 3PMFA 2Q2HA 2M00A 1KDAA 1Y8PB 2JEAI 3RZDB 3CPWA 2EQSA 4RHRA 3BZCA 3EJIA 1HNWQ 3EIVA 5GAGC 3S1NH 1CHQD 3CHBD 2DN8A 3IAYA 4A3IH 1AFPA 3Q6SA 3K59A 4ME5A 4QIWE 5EPKA 3VDYA 2E2HH 1KNAA 1X3PA 5A2QE 3U58A 1EY8A 2GN5A 3R2TA 5F2DA 4V0BA 1NCVA 1TXYA 3EN2A 3QIAA 4HJ7A 1M90C 1PTOB 1GUTA 4JPBW 5ELEA 2NVXH 2NTTA 5E4XA 3GTOB 2UXDL 4L5RC 3VR6A 1PV4A 1QOHA 3S2DH 4LWCA 1WD0A 4JI1L 1X54A 1HQMC 4ME3A 2FMCA 4DV7Q 4LF6L 1EY0A 3NBIA 2UUCL 5K36G 3NBHA 3NE5B 1F9QA 2SNSA 3C3LA 2RDFA 3P75A 1S5BD 3NENA 2VW9A 2UUAQ 1BCPD 1HTLD 2F0WA 5K5PA 2AQ3B 1E7ZA 3PGZA 4DAPA 3OOCA 3S2HH 1TIID 3Q0AA 2K28A 5IODA 4DXFA 3U50C 5C3WA 4H13C 1UE1A 1E2VA 4JYAQ 1S5FD 3GTPB 2BDOA 3S1MB 3TSSA 5GAEC 1J5EL 2ES2A 4HJ9A 2RDHA 2N49A 2MHVA 1I94L 5H1SE 1EWHA 1OXSC 3A7LA 2UXCQ 2JA5B 2PZTA 2EY6A 1AN8A 4KD3A 1A2UA 1D1IA 2IPKD 1A62A 1HA5A 3VA7A 1Q82C 1CA6A 1SSOA 3CC7A 2VS1A 2OXPA 2ATWA 2JA5G 2RA4A 1JB3A 4G7ZC 2ZXRA 4DR3Q 4A3LH 4WJ4A 5J39A 1KC8C 4RCOA 3PF5A 1G51A 3M4PA 3IL8A 4X3TA 3H0GB 2E2DC 3S15B 4DAYB 1L0YB 4FDBA 4XIGS 2CHBD 4BA1I 1JWSD 3I7FA 1II3A 3K7AH 3I90A 4NXMQ 5KYIA 3BVGA 3H0GG 3ERSX 2AWNA 1SYGA 4A3BB 1AZQA 4B08A 4X66Q 1HZAA 1G2SA 5L37A 2LY7A 4J1MA 2H5XA 3J80i 5CV5A 1E24A 3NWTA 3GTKH 2WP8J 1CHPD 4JI1Q 4CKBA 4A3BG 4LF6Q 2N8NA 2H4OA 4OGQC 2NB0A 1D5XC 3RR5A 3I4LA 1K8GA 1EIHA 3IFTA 2A68C 1IKLA 4JI2L 2B39A 1SMYC 4HTHA 2JA7B 4BBSH 4AYBE 4R4IA 1IYVA 1TS4A 2JP1A 2YTXA 4BBRB 3E9IA 4OWTB 2EDGA 2F0NA 2XRQD 2F4VQ 3FKIB 3GTGH 1EFWA 4KY7A 1NMGA 3K58A 2JA7G 2EVBA 3H09A 2B63H 3CRKC 1SAPA 1DGSA 1F9RA 4BBRG 5CV6A 2CKZB 2JA6B 3DXJC 3EBEA 4TQUS 3VYUA 3FKIG 2IT1A 1I94Q 1ZKOA 1ESRA 1EY9A 4X64L 1FVIA 4X65L 1FR3A 2R6GA 2JA6G 4BXXG 4TRDA 1W6JA 1VQEA 2EIFA 5C4JB 1QJOA 1WTRA 1Q86C 1R4PB 4LMQD 1DONA 1I4QA 4UY8C 3PCOB 5JPNC 4A3MB 1L0XB 1GUSA 3OIQA 4K2KA 1CKOA 4IUQA 3X3NA 4C3HH 3HZXA 2IX3A 5EPLA 5C4XB 2HHHQ 4A3MG 1QVCA 3TP5A 1I3QB 2TMPA 1EUJA 4I7ZC 1I5FA 2KVMA 3BJUA 3D4RA 1PRTD 1HPCA 5C4XG 1VQHA 3L0OA 4IUVA 1GD7A 2DJGC 4NXNL 1LTSD 1JJGA 4OHJA 1VF5C 3MFGA 4C3IH 4CGYB 2Z9HA 4WFN3 4O42A 2L1BA 3D4WA 1KAAA 2JK8A 5M3FH 4DV0L 3JAMi 1SMYD 2HUGA 2HQEA 2L12A 5IT9L 2R7ZH 1LT6D 2UUBQ 4HJ8A 1QNUA 1JOKA 2B2VA 4ZAIA 1BO0A 4RKLA 4A3GB 1Z7TA 4KJOA 3EVQA 4JI3Q 1D1KA 2Z6BA 3FP9A 1GXDC 1HNZL 5IGBA 4H0LC 5IIFA 4GOPC 4DKAC 4K0KQ 2G9DA 2Q8RE 1SEBD 4YCWA 1RTOA 5IWAL 1VQFA 2ZXPA 4A3GG 4JI4Q 3DEPA 1FNVA 2N88A 4KTAA 3E0JA 2CH4A 4GOPA 2B2TC 1HR0W 2MO0A 2CCZA 2K03A 3TZDA 4GKJL 3RN2A 5FJ8H 3HOXB 3V2TA 1WD1A 4XXEA 4X65Q 1I4HA 3M3YH 3BU2A 2B2TA 4DR2L 4C56C 5LMNL 3L9AX 5CBEE 3VA5A 3HOXG 3PIO3 5C5LA 2PW7A 4DR1L 1KQSA 1RL2A 5A2QL 3T56B 1STHA 2VXWA 2MFIA 3GO5A 3H3VC 4YCUA 2QW7A 5DLQE 1PH3A 1LLRD 4JC0A 3CC2A 4A3DB 1AH9A 1H95A 1EWCA 2VL6A 3FRPB 4OXPA 1Y1WH 4X3SA 2VZAA 2NN6H 3FDTA 3F2DA 3WWVA 1VQ6A 3RNUA 3CCMA 1B53A 4BWGB 4A3DG 1PH9A 2AUKA 1VF7A 3CC4A 1EFID 2V4DA 1SFOB 4DUYQ 4HIKA 3HOUH 3VR5A 5KNCA 3NUCA 4FYDA 1E1TA 4ILWA 2E8GA 1XTDA 2EYOA 2A5HA 1CKNA 4AIMA 5E7NA 3OTOQ 4KN7C 2YU9B 5C0XG 2JN4A 1BUVT 1JMCA 1KAWA 2EJGC 1STEA 3D6WA 1IW7C 1ASYA 3SVMA 2PNHA 4NB3A 3PF4A 1EY4A 4FXKC 4DK6C 3M7GA 3RMHA 1SYBA 2NWGA 1STAA 2EYFA 3PO3H 3J81i 4A3KH 3E6ZX 1NE3A 5I2YA 1XPRA 3HS0C 1QNKA 2KHIA 2GA4B 3KF8A 1EL0A 1EIGA 1XNQL 1K83H 1I50B 2NYZD 3J7AF 4J6HA 2L5TA 4LFBQ 2EY5A 2IHFA 3V96A 3S1QB 3E5SA 4OWWB 1B3QA 2AKWB 2F52A 2PQAA 3LGJA 2MPMA 2OQ0A 5JEAG 5CR3A 1A63A 3ER0A 4DNTB 3BVMA 4DR2Q 3N6RA 3OPOA 2JA8H 3NTIA 2CQOA 1Z6HA 2VQFQ 1HQRD 4P74A 1N8RC 4LUZA 2BH8A 1EQQA 3DMUA 3T53B 1ILPA 1GM5A 3PO2B 1L1OC 3E0EA 4EQ5A 3L2PA 1SN8A 3JAME 1VQ9A 2OWOA 3BVZA 4YWKA 4TVAB 5ELDA 1YJ9A 4Z9CB 3QWNA 4OELB 2K33A 3PO2G 1SJED 1B9NA 2HCIA 1VQMA 2R93B 3PIP3 2ZT9C 3CCSA 4DV1Q 2Z0SA 2LXJA 3KF8B 1B9MA 5JAVA 4C1NK 5BR8L 1SE3A 2DY8A 3BDCA 3T1YL 1IW7D 2R93G 2IWHA 5C6AA 2AUJD 3M4OB 2RKSA 1UNSA 3QOJA 4R4CA 5FO7B 5IYCG 5FO8B 2DGYA 4QMGA 5FLXE 3HOZB 3EQLC 3HOWH 3NQTA 4TSSA 3ZYYX 1LT5D 1KLUD 4WJ3M 4L63B 4J15A 2K52A 4JI6L 1KABA 4DAMA 5D3IB 3UDGA 1GVPA 5CV8A 4CDDC 1PFMA 5IGCA 3P7JA 4JI8L 3HOZG 1XNQQ 2H1EA 1TQOA 2X6GA 4LNQA 1DJRD 1QE6A 1R9TB 5KNDA 2Q2UA 3MAQA 3I70A 5HURA 4HCSA 5IYBH 1HA6A 4R9WA 1XMQQ 2WFWA 4ABNA 3OYYA 1YJNA 3H15A 2YTYA 4F88A 1K0SA 4HIDA 4IALA 2VUMB 1HNWL 1L1OB 3FPUB 1ZEQX 1ZYRC 4GLVB 1SROA 4ZKBB 4JK1C 4RGTA 2KHJA 3D6CA 4AH6A 1G8ZD 1UEBA 1V1PA 4IFDH 2IY5B 5IYDG 5ELOA 3UDFA 4I65A 2XWJB 1TWCH 5JJIA 2EYPA 2VUMG 1GKHA 3O13A 3Q23A 1BQQT 4IUUA 1QVGA 3UE1A 4EQOA 3I4NH 3H6MA 2PCFB 1SJHD 1V1QA 2JEBI 2SDFA 2OT2A 3CAMA 4UDUC 1LV9A 5D3DA 2PMZE 4XYQA 4NP5A 2RVLA 3W2DA 4FF1A 1GO3E 2B8GA 4QUFA 1LABA 5G3LF 1G2TA 4A3EB 4RGOS 3FHWA 1DOKA 2QEJC 1G6PA 2EPBA 3D8GA 5M5WH 3NP8A 1Q8KA 1DCZA 4XTCS 5BR8Q 3J81E 3VYSA 2FMMA 3FEWX 4A3EG 1B4OA 4A93H 3TP6A 1T5XD 2CWPA 3T1YQ 4KN4C 4DK0A 2KCMA 2Q2IA 1TR5A 3J7ZC 1XNRQ 5IT9E 3MHBA 4DR6Q 2O4XA 2E75C 4K8JA 4A3JB 1TY0A 2R3ZA 3CCJA 1RD9D 3S1NB 1J9OA 5IGDA 1PDQA 2F0EA 1HCZA 4ULLA 4JYAL 3PUZA 1KHIA 1S5CD 1YBYA 4WORA 1I4GA 4U673 5C3EB 4JI6Q 4A3JG 4LF5L 1JWMD 1C8CA 3PIPA 1K8AC 1IBLQ 2PNRC 4K6LA 3GTJB 3GTLB 2DY7A 5C3EG 3VYTA 2Q8IB 3TP7A 1U4RA 2UXCL 5IOCA 1N9WA 2BOSA 1ZYRD 4RGMA 5KRUA 4KLKA 1JCKB 3NXWA 5FLMH 2PQEA 2SEBD 1PH7A 3ONAB 4JI7Q 1TWAH 4KHVA 3W1GA 1K28A 1A6XA 1EOTA 4DR3L 1WTHA 4JI5L 4RH6A 5EJWA 1SLJA 1HFGA 4RWSC 4F87A 3J80L 3A5UA 5IP9H 3TS2A 2EYJA 1PYBA 3G6EA 4LFAQ 2XN9C 4EQPA 3CQZB 2ZJQA 3DWPA 1ILQA 4DF7A 3MEFA 1IBKQ 2JA9A 3S1RB 2RDGA 4NXML 4KV6A 1SR3A 2F0UA 5LMUQ 3HOVB 3D3RA 2WAQE 5LMNW 3K8AA 4X66L 1PTOD 4LK1C 3FMCA 3PSIA 3A56A 2F3VA 4XDXA 5LHY1 3HP3A 4L5TA 3KF6B 3HOVG 4B9XA 2XRSD 4PNYA 4X6AH 1NNXA 1ET9A 5M5YB 3S16B 1NMFA 3PQIA 4DAYA 1RDPD 1W2BA 1E3PA 3KOJA 4JBMA 5IGFA 4RCNA 1IL2A 1W3SA 4KKUA 4OIKA 4K14A 3RZDH 5FK9C 4OX9L 5M9OA 4XQNA 4K5WA 3M7NA 2F0DA 1H9JA 2K50A 2F4VL 3I4MB 3G71A 3DEOA 5C4HA 1O7IA 1V1OA 2G9HD 1K0RA 1O80A 1VCIA 1UWVA 4GNXB 1C7YA 5I9OA 4MHEA 1H9MA 4LF5Q 2SOBA 5EKLA 1QZGA 1Y1VB 1EYAA 3BDLA 4MN3A 1S4ZA 4QGUA 3I4MG 3VR4A 3VR3A 1BOSA 3G7LA 5G3LD 2EZVA 1PTOH 3TS0A 1Q8IA 2G5DA 1EWIA 4QCLA 3K57A 1Y1VG 3SK4A 3TZUA 1CTMA 3GTOH 1QCBD 5K36H 1QILA 3V05A 1LUZA 3GTQB 1PMRA 1MKHA 3MFYA 1VQOA 1STNA 2QCPX 4JI5Q 3SR1A 3HG9A 4P2CB 1VMCA 5I4DA 1F2ZA 3KLRA 2HHHL 2EOTA 3UDXA 1UE6A 3JAML 1WTVA 1YNXA 2XTIA 2AHOB 3E3XA 4P73A 4BA2I 3ND9A 4PV1C 1OO9B 3ND8A 3KJPA 4LAAA 1KNEA 1CQVA 1J6QA 3NK9A 2C5CA 1JWUD 4NPSA 2JQOA 1KLGD 1A2TA 4LF7L 1UUPA 5E3FA 2JSOA 1ENCA 4QUCA 3GTPH 3U9OA 2BE5C 3S1MH 1JORA 2D2CC 1PFNA 4A76A 3D4DA 4YIJA 4M1UB 3M85A 2M2LA 3GQBA 4R4TA 1XXGA 4GKKL 1LTLA 4RMFA 2DUDA 2JJQA 2UUBL 1TS5A 2F3IA 2Z4IA 3T51B 2JA5H 2XSCA 5FLXL 1FYCA 3M4YA 4JI3L 1AW7A 5T1IA 2UXBQ 1KDCA 1VQCA 1K3RA 4DA2A 4OX9Q 1A0IA 1YHAA 4K0KL 2F3WA 4JI4L 3BYTB 4DFAA 1KXLA 2PZWA 3CPFA 2IW3A 4HR7B 5T1GA 1SNQA 4K5VA 5FLXc 1VQLA 4IUPA 1VMPA 3R8BA 3H0GH 2ZTCA 3S15H 1PH2A 4DV4L 3M4QA 3KUPA 3KBXA 5ISRA 2OTJA 4LF8Q 3S14B 1K9MC 3UE0A 3HKZE 5KIXA 3A0JA 4GN5A 1FJGQ 5M3MB 3K0XA 5I6WA 4AQYQ 1VS0A 4A3BH 1H9KA 2C9OA 4IJLA 4POFA 5EAYA 2MNAA 4KKTA 4FF3A 3A54A 1EY5A 1X3QA 2NVTB 1VQBA 5M3MG 4BY1B 3AYHB 1HFNA 2F0HA 5AFWA 4QY7A 2P5ZX 2K5DA 4UAIA 1IBMQ 3MXPA 1XPOA 4MTKA 1CZWA 1K3BC 2K04A 4PG3A 4BY1G 4CJ0B 1WVLA 2JA7H 5IY0A 3AQQA 1NTGA 3NHHA 5C4ZA 4R8IA 2QEXA 4BBRH 2E2IB 4GZYC 1AE3A 3HRZC 2HT1A 2BE5D 5C44B 2ALYB 3FKIH 1LTRD 4DUYL 4FVMA 5EKIA 3NQIA 1ML0D 2D62A 2RSNA 1UE7A 3E9HA 1YI2A 4LF7Q 1I4PA 4Y7NB 4DXGA 3J81L 4KMUC 2JA6H 4BXXH 2A68D 1M4VA 2PI2A 5EKKA 3NEMA 2D5DA 2N3SA 5C44G 2E76C 1EZ8A 3NELA 3K81C 1JC7A 1BBUA 4HSPA 3KLSX 1JJ2A 4GKKQ 2ZXOA 1XWEA 3OTOL 1OXTA 3VR2A 5CYUA 4GN4B 4J8QA 3MZ5A 3EA6A 1LO5D 1DXMA 3OMGA 4C1NI 3TN2A 4F8MA 2OEOA 1I6HB 4X3UA 3W5OA 4C2MB 2B3GA 2ZJRA 1FGBD 3RUZA 5C4JH 1SMXA 2F0IA 2I46A 5IT9c 1Y69U 3A8JE 4A3MH 1XTCD 3SK6A 1GUWA 2B2UC 3J7AV 1MD2D 2FJ2A 3UDIA 2O5IC 3HOYB 3STBC 5C4XH 1PH8A 1YJWA 1HTPA 4DV4Q 4LFBL 3GTMB 1ZXTA 1I3QH 4DN4M 3HOYG 2NVYB 2V1CC 3I55A 4X3KA 3OIPA 5J3BA 1WFQA 3K5NA 4HIMA 1O78A 1KDBA 2K5VA 2KECA 1BVSA 4B3MQ 1QVFA 1G91A 1JICA 3B6YA 1W6KA 5LL6X 5M5XB 1C9OA 3NTKA 2E2JB 4DNIA 2A6EC 1I4XA 2F0KA 3HFZB 3RLOA 2EJMA 2VQFL 2QDBA 2Z8LA 4BY7B 1XYIA 1JJCB 4JVZA 2QILA 2IHEA 1U0LA 1VDZA 3G48A 3J80E 4OO1G 1YNJC 4A3GH 3RZOB 2KA7A 5ELFA 4DV3L 1RIPA 4EGVA 4JOIC 1F2YA 2CQAA 2O5JC 4BY7G 4RHSA 1SDFA 4OO1I 2VQEL 3X3MA 4OEMB 2AMCB 3CCUA 2R92B 1T9HA 1VQPA 2LXKA 3U4VA 3HEJA 3L7ZC 3PV0A 2X69A 3KYHC 4IOCA 1PVOA 4JOIA 2NUCA 1WI5A 1NR4A 1EU4A 4NDXA 4POGA 2YV5A 4QF4A 5GADC 4DV1L 1ENFA 1L0WA 2ZTEA 2R92G 4FNFA 1UAPA 2F0PA 1X6OA 3WOEA 3HOXH 5JVH3 1N32L 3EROA
chains in the Genus database with same CATH topology
4U68A 3S17B 2F0LA 1BXTA 1O7ZA 2JXMB 1Q12A 1BF4A 1MI2A 1WTWA 1E2ZA 3A7AB 1XX8A 3WOFA 2JE6I 3OWFA 2B2WC 3C1FA 5J22A 4CKEA 1IL8A 5KYLA 2WB1B 1OXXK 3A55A 1C48A 1EQTA 2B2WA 2F1MA 4CBVA 2NVQB 5FO9B 1KTKA 1STYA 3TP8A 1BNZA 2A6ED 1CI3M 4RA8A 3OW7A 5CC4A 3LWEA 4FXGC 3R3OA 1PZJD 5C0XH 1B1ZA 1C4QA 1EYDA 4H44C 3BZDB 2RQXA 1EZ6A 1JOOA 3AB9A 1RJTA 1YNJD 4ID6A 3TBIB 1H9RA 4QIWB 1RODA 5DEHA 3K0YA 1TS3A 5BN5A 5HGTA 3QJYA 5I6YA 3SE0A 4K6DA 4HMJA 5EPJA 2AWOA 2IX1A 1SNCA 4A3FB 3AU7A 1IYUA 1CQFA 4IZ8A 5BN3A 3OSOA 3CU7A 3I8ZA 4KKSA 5JEAH 3J7YW 3C2PA 5C3XA 2A74C 1CFMA 3K6OA 2EJFC 2F0JA 3IFDA 3L3OC 1OXUA 2Z1CA 1YNNC 2B2YC 4IUTA 4O1NA 1IKMA 1MSHA 1LT4D 1OXVA 5D65A 2F0GA 2WV6D 4V190 2LFNA 4FF4A 2F03A 1GHKA 4CHTB 5EGTA 3HGBA 1A3UA 3FVQA 1GJXA 1NAPA 2MP1A 1RTNA 1AEXA 1Q1EA 4WRDA 1WTQA 3MTSA 1TWHB 1LT3D 5EQ0A 3UI2A 1LACA 4Q0FA 4C3JB 1PZKD 1GOZA 1D5MC 1LTID 2HCCA 3I73A 2IJ0A 1HRJA 2HDLA 4DK1A 3BG3A 2F0FA 2K1BA 3R93A 4XT1B 4ODGA 4C3JG 1BCPF 1WCMB 1B3AA 2D9UA 2VB2X 1O7LA 1X32A 2BDNA 1SBBB 2WIIB 4KHZA 4ZLTF 3ITPA 1TWFB 2ICEC 1TWGB 1ONLA 1TT2A 4MIUA 1K8OA 3IKJA 1SNMA 1YNND 1HHVA 4F7XA 3CRLC 2M9VA 1D6EC 4A3IB 1LTGD 4NW2A 3SDZA 3U9SA 2E2HB 4PMWA 1SE2A 5COYA 2X6LA 4IFDJ 1BCPC 2PO4A 5JOBA 5A35A 2NVXB 4JBWA 5LL6S 1A3VA 1SYEA 4CJ1B 1MSGA 3S2DB 1G6ZA 4IURA 4R8NA 3I3CA 4PMCA 4XQJA 1FNWA 1B2TA 1LTBD 1S5DD 1BBXC 2O2LD 3GP7A 3R2IA 2ICIA 3MVVA 3S2HB 3PUVA 1SNOA 2K6AA 4G4KA 1SE4A 5I2XA 4S3SA 2PYKA 2F0SA 4FP5D 2EXZA 5KEEA 3T16A 1DOLA 2A73B 1BR9A 2DNEA 1B44D 5CV9A 1EY6A 2FFKB 1U4LA 2ENBA 1RHPA 1FD7D 3LNNA 4EQNA 3NWSA 1NR2A 4IQZA 4RKBA 1BCPB 2PPBC 1DD2A 2A69C 1ET6A 1QB5D 2EYLA 2KJXA 3Q24A 1M8AA 4LJZC 3KK7A 2QKIC 3K7AB 3I91A 3URYA 1NUCA 4WJWA 1PRTF 5CBAE 3DHQA 4DNRB 3GTKB 2B8FA 3GD7A 3SXHA 1WTOA 1D2BA 1RF2D 1F9PA 5J1ZA 4XQQA 2PZUA 1R4QB 4BBSB 4FF2A 1JQYD 3KLSA 1Y8NB 4ZYSA 3EFXD 3GTGB 2B63B 4NKLA 3C1EA 4G57A 3FPPA 2K5QA 2FINB 4HEDA 3T13A 1E0BA 5EBDA 2YYZA 1GHJA 3SEBA 1CK1A 2F0QA 4Q5VA 2K01A 1PRTC 4OL7A 4QB4A 2A69D 2WINB 2L11A 4C3HB 2NZ1D 3T4AC 3QB3A 1Q1BA 1PYWD 4C3HG 5NUCA 3GV6A 3W3AA 1HUMA 2EY1A 4KY6A 4C3IB 2EE1A 1GUGA 5JJZA 1D5ZC 1CZGA 2K32A 3N52A 2F0MA 5M3FB 4C3IG 2R7ZB 4FXDA 3A8IE 1TKWB 2K05A 2AQ1B 3S9WA 4G7OC 2F4IA 2PW5A 1U4PA 3OHXC 1AP0A 1SXTA 2A6HC 2LKVA 2AQ2B 5KGUA 5FKAC 2CW0C 2L55A 1PRTB 3BS1A 2IL8A 4N9PA 2L9HA 5FOBB 1E2WA 5C5MA 2WKCA 3M3YB 4M8AA 2F0TA 5IGGA 1Z47A 3SK5A 3TMEA 2B2VC 1STBA 1B50A 4G7HC 3KBGA 2Y0SB 2XNAC 1Y1WB 1F9SA 1RKNA 2JYOA 2B2UA 1JOQA 4ZRZA 1EY7A 5EBCA 4ZUIA 4IN3A 3HOUB 3PUYA 1STGA 2NN6G 3MA2B 4DU9A 4L6TB 3P20A 5E4WC 2NN6I 2J7ZA 1SYDA 4HN7A 2TSSA 1CA5A 3F2UA 2WACA 2NTSA 2FHTA 2A6HD 2QF7A 1PLFA 4ZUJA 1T5EA 3NTHA 4HAEA 4TKOB 3SK8A 1IHZA 2EYMA 1JR0D 2F0OA 4ZQ3A 2PMZB 2CW0D 3PO3B 1F2LA 3QOLA 4A3KB 1CT1D 1SYCA 2KQ3A 2K7VA 1PFBA 1U4MA 4ZK9B 4IUNA 1K83B 1ENAA 1LTTD 1SNPA 2BA1A 2LMCB 2KHSA 3NSWA 3QG1A 3TDQA 5DM63 4PQXA 2I07B 2BA0A 1RCVD 3PUXA 1A3TA 3MXUA 3DWAA 2BCOA 3OWEB 4FO2A 2JA8B 4RAUC 4OO1H 1EU3A 4E6IA 1I6VC 1GUOA 1S5ED 1G291 3DUZA 1PXUA 1UEAB 4K2LA 5BN4A 3SHLA 1QWYA 5I9PA 1Y8OB 4KK7A 5C0XI 1TS2A 2K5WA 2XWBB 1H9SA 5KNBA 2CVRA 5CV7A 5D14A 2IX0A 2EY2A 3RLFA 4KY5A 3K5LA 1TY2A 3OMCA 4HCEA 1TVXA 3RD4A 5DM73 5JVG3 3LX0A 4B9WA 2L0CA 2KOLA 1BDOA 5E1FA 1TU2B 4XYOA 2KCCA 5DNFA 3HOWB 4H7BA 5CORA 3Q22A 3P1HA 2WAQB 4PMBA 4KI0A 4EVOA 2Q8TA 1U9RA 4CJ2C 5JPMC 4KJNA 3AMUA 1EEFD 2OF1A 2RBMA 1DOMA 5CV4A 3GV3A 2L4NA 1H9SB 3K5MA 4OIJA 3LWUA 3A8KE 5ELCA 1PZID 2SNMA 2XIWA 2LS01 3DWQA 1TWCB 4N9TA 1CM9A 2E74C 2MGSA 3ERQA 4K5XA 3MWYW 4K8IA 2Z4HA 3I4NB 2B2YA 3H94A 1EEID 4IFDG 5C0XJ 1ICWA 3G6JB 5DAUA 1EQVA 3D31A 3MXNA 1F77A 4IFDI 4HSVA 4RFBA 1AZPA 1LTAD 4DGZA 5M5WB 2F0VA 4KD4A 5TSSA 5CGKA 1GUNA 1PTOF 2MJ8A 4CKCA 1O7YA 4A93B 1QG7A 2N55A 2EYHA 2ID0A 4DAVA 3K5OA 2MUYA 5JEAJ 1FNUA 4XT3B 5CMDA 4BS9A 5IGEA 4RGNA 1HXYD 2VB3X 2NBFA 5ELBA 3BYYB 1DYQA 1DZ1A 1HUNA 1SYFA 1Q3LA 3I72A 3C46A 2XVSA 1TWAB 1MGSA 4L8JA 4AYBB 2HDMA 1PTOC 1WTPA 2VNUD 2J4XA 2R61A 3NPPA 3WDNA 2RSOA 3PUWA 3H91A 1WTXA 2J0TD 3CKIB 3MXGA 2KEDA 2KUMA 2KCNA 2KEEA 3HKZB 1J8IA 2DNCA 3QO2A 2WKDA 1V1PB 3VYRA 1NSNS 1ESFA 1JE4A 1Q90A 1DM0B 1V8QA 1A15A 3MEHA 3BDOA 4HMIA 1K8MA 3DM1A 4NMZA 1F2MA 1V43A 3MC0B 4ZKCB 1SNDA 1I4RA 1MBYA 1EYCA 3PMFA 2M00A 1KDAA 1Y8PB 2JEAI 3RZDB 4RHRA 3EJIA 1CHQD 3CHBD 2DN8A 3IAYA 1AFPA 3Q6SA 3K59A 4ME5A 5EPKA 1KNAA 1X3PA 5A2QE 1EY8A 3R2TA 5F2DA 4V0BA 1NCVA 3QIAA 1PTOB 1GUTA 5ELEA 2NTTA 5E4XA 3GTOB 3VR6A 1QOHA 1WD0A 1HQMC 2FMCA 1EY0A 3NBIA 5K36G 3NBHA 3NE5B 1F9QA 2SNSA 3C3LA 2RDFA 3P75A 1S5BD 1BCPD 1HTLD 2F0WA 5K5PA 2AQ3B 4DAPA 3OOCA 1TIID 3Q0AA 2K28A 5IODA 4DXFA 5C3WA 4H13C 1E2VA 1S5FD 3GTPB 2BDOA 3S1MB 3TSSA 2RDHA 2MHVA 1EWHA 1OXSC 3A7LA 2JA5B 2PZTA 2EY6A 1AN8A 4KD3A 1A2UA 1D1IA 2IPKD 1HA5A 3VA7A 1CA6A 1SSOA 2OXPA 2RA4A 1JB3A 4G7ZC 2ZXRA 5J39A 4RCOA 3IL8A 4X3TA 3H0GB 2E2DC 3S15B 1L0YB 4XIGS 2CHBD 4BA1I 1JWSD 1II3A 3I90A 5KYIA 3BVGA 2AWNA 1SYGA 4A3BB 1AZQA 4B08A 1G2SA 2LY7A 4J1MA 5CV5A 3NWTA 2WP8J 1CHPD 4CKBA 2H4OA 4OGQC 2NB0A 1D5XC 3I4LA 1EIHA 3IFTA 2A68C 1IKLA 2B39A 1SMYC 4HTHA 2JA7B 1IYVA 1TS4A 2JP1A 4BBRB 2EDGA 2F0NA 2XRQD 3FKIB 4KY7A 3K58A 2EVBA 3H09A 3CRKC 1SAPA 1F9RA 5CV6A 2JA6B 3DXJC 4TQUS 3VYUA 2IT1A 1ZKOA 1ESRA 1EY9A 1FR3A 2R6GA 4TRDA 1W6JA 5C4JB 1QJOA 1WTRA 1R4PB 4LMQD 1DONA 1I4QA 5JPNC 4A3MB 1L0XB 1GUSA 3OIQA 4K2KA 4IUQA 3X3NA 3HZXA 2IX3A 5EPLA 5C4XB 3TP5A 1I3QB 2TMPA 4I7ZC 2KVMA 3D4RA 1PRTD 1HPCA 4IUVA 1LTSD 4OHJA 1VF5C 3MFGA 4CGYB 4WFN3 4O42A 2L1BA 3D4WA 1KAAA 1SMYD 2HUGA 2HQEA 2L12A 5IT9L 1LT6D 1QNUA 1JOKA 2B2VA 4ZAIA 1BO0A 4RKLA 4A3GB 1Z7TA 4KJOA 3EVQA 1D1KA 1GXDC 5IGBA 4H0LC 5IIFA 2G9DA 2Q8RE 1SEBD 1RTOA 2ZXPA 3DEPA 1FNVA 2N88A 4KTAA 3E0JA 2B2TC 2K03A 3TZDA 3HOXB 3V2TA 1WD1A 4XXEA 1I4HA 2B2TA 4C56C 3L9AX 5CBEE 3VA5A 3PIO3 5C5LA 2PW7A 5A2QL 3T56B 1STHA 2VXWA 3GO5A 3H3VC 1LLRD 4A3DB 1EWCA 3FRPB 4X3SA 2NN6H 3FDTA 1B53A 4BWGB 2AUKA 1VF7A 1EFID 2V4DA 1SFOB 3VR5A 5KNCA 3NUCA 4FYDA 4ILWA 2EYOA 2A5HA 2YU9B 4KN7C 5C0XG 1BUVT 2EJGC 1STEA 3D6WA 1IW7C 3SVMA 1EY4A 4FXKC 3M7GA 3RMHA 1SYBA 2NWGA 1STAA 2EYFA 3E6ZX 5I2YA 3HS0C 1QNKA 1EL0A 2GA4B 3KF8A 1EIGA 1I50B 2NYZD 3J7AF 4J6HA 2L5TA 2EY5A 3V96A 3S1QB 3E5SA 2MPMA 5JEAG 5CR3A 4DNTB 3BVMA 3N6RA 3OPOA 3NTIA 1Z6HA 1HQRD 3DMUA 3T53B 1ILPA 3PO2B 3JAME 3BVZA 5ELDA 4Z9CB 3QWNA 2K33A 1SJED 1B9NA 2HCIA 2R93B 3PIP3 2ZT9C 1B9MA 5JAVA 4C1NK 1SE3A 2DY8A 3BDCA 1IW7D 2IWHA 5C6AA 2AUJD 3M4OB 2RKSA 1UNSA 3QOJA 5FO7B 5FO8B 4QMGA 5FLXE 3HOZB 3EQLC 3NQTA 4TSSA 3ZYYX 1LT5D 1KLUD 4L63B 1KABA 5D3IB 5CV8A 1PFMA 5IGCA 3P7JA 2H1EA 1TQOA 2X6GA 1DJRD 1QE6A 1R9TB 5KNDA 3MAQA 3I70A 5HURA 4HCSA 1HA6A 4R9WA 4ABNA 4F88A 4IALA 2VUMB 3FPUB 1ZEQX 1ZYRC 4ZKBB 4JK1C 4RGTA 3D6CA 4IFDH 1G8ZD 1V1PA 4I65A 2XWJB 2EYPA 3O13A 3Q23A 1BQQT 4IUUA 4EQOA 3H6MA 2PCFB 1SJHD 2JEBI 2SDFA 2OT2A 4UDUC 1LV9A 5D3DA 4XYQA 4NP5A 2RVLA 3W2DA 4FF1A 2B8GA 4QUFA 1LABA 5G3LF 1G2TA 4A3EB 4RGOS 1DOKA 2QEJC 2EPBA 3D8GA 3NP8A 1DCZA 4XTCS 3J81E 3VYSA 2FMMA 3FEWX 1B4OA 3TP6A 1T5XD 4KN4C 4DK0A 1TR5A 5IT9E 3MHBA 2O4XA 2E75C 4K8JA 4A3JB 1TY0A 2R3ZA 1RD9D 3S1NB 1J9OA 5IGDA 1PDQA 2F0EA 1HCZA 4ULLA 3PUZA 1S5CD 4WORA 1I4GA 4U673 5C3EB 1JWMD 1C8CA 2PNRC 4K6LA 3GTJB 3GTLB 2DY7A 3VYTA 2Q8IB 3TP7A 1U4RA 5IOCA 2BOSA 1ZYRD 4RGMA 5KRUA 1JCKB 3NXWA 2PQEA 2SEBD 3ONAB 4KHVA 1A6XA 1EOTA 4RH6A 5EJWA 1HFGA 4RWSC 4F87A 3J80L 2EYJA 4EQPA 2XN9C 3CQZB 3DWPA 1ILQA 4DF7A 3S1RB 2RDGA 4KV6A 2F0UA 3HOVB 3D3RA 1PTOD 4LK1C 3FMCA 3A56A 2F3VA 4XDXA 5LHY1 3HP3A 4B9XA 2XRSD 4PNYA 1ET9A 5M5YB 3S16B 4DAYA 1RDPD 5IGFA 4RCNA 4OIKA 4KKUA 4K14A 5FK9C 5M9OA 4XQNA 4K5WA 3M7NA 2F0DA 1H9JA 3I4MB 3DEOA 5C4HA 1V1OA 2G9HD 1O80A 1VCIA 5I9OA 4MHEA 1H9MA 2SOBA 5EKLA 1Y1VB 1EYAA 3BDLA 4MN3A 1S4ZA 3VR4A 3VR3A 1BOSA 3G7LA 5G3LD 2EZVA 1PTOH 1Q8IA 4QCLA 3K57A 3SK4A 3TZUA 1CTMA 5K36H 1QCBD 1QILA 3V05A 3GTQB 1PMRA 3MFYA 1STNA 2QCPX 3SR1A 3HG9A 4P2CB 1VMCA 5I4DA 1F2ZA 3KLRA 2EOTA 1WTVA 3JAML 4BA2I 3ND9A 4PV1C 1OO9B 3ND8A 4LAAA 1KNEA 1CQVA 3NK9A 2C5CA 1JWUD 1KLGD 1A2TA 1UUPA 5E3FA 2JSOA 1ENCA 4QUCA 3U9OA 2BE5C 1JORA 2D2CC 1PFNA 3D4DA 4YIJA 4M1UB 3M85A 2M2LA 3GQBA 1XXGA 1TS5A 2Z4IA 3T51B 2XSCA 5FLXL 1FYCA 3M4YA 1AW7A 5T1IA 1KDCA 4DA2A 2F3WA 3BYTB 4DFAA 2PZWA 2IW3A 4HR7B 5T1GA 1SNQA 4K5VA 4IUPA 1VMPA 3R8BA 3KUPA 3KBXA 5ISRA 3S14B 5KIXA 5M3MB 5I6WA 1H9KA 2C9OA 4KKTA 4FF3A 3A54A 1EY5A 1X3QA 2NVTB 4BY1B 1HFNA 2F0HA 5AFWA 2K5DA 4UAIA 3MXPA 1CZWA 2K04A 4CJ0B 1WVLA 3NHHA 5C4ZA 4R8IA 2E2IB 4GZYC 3HRZC 2BE5D 5C44B 1LTRD 4FVMA 5EKIA 3NQIA 1ML0D 2D62A 2RSNA 1I4PA 4Y7NB 4DXGA 3J81L 4KMUC 2A68D 1M4VA 5EKKA 2D5DA 2E76C 1EZ8A 1JC7A 4HSPA 3KLSX 2ZXOA 1XWEA 1OXTA 3VR2A 5CYUA 4J8QA 3MZ5A 3EA6A 1LO5D 1DXMA 3OMGA 4C1NI 3TN2A 4F8MA 2OEOA 1I6HB 4X3UA 4C2MB 1FGBD 3RUZA 2F0IA 2I46A 1Y69U 3A8JE 1XTCD 3SK6A 1GUWA 2B2UC 3J7AV 1MD2D 2FJ2A 2O5IC 3HOYB 1HTPA 3GTMB 1ZXTA 4DN4M 2NVYB 4X3KA 3OIPA 3K5NA 1O78A 1KDBA 2KECA 1G91A 1JICA 1W6KA 5LL6X 5M5XB 3NTKA 2E2JB 2A6EC 1I4XA 2F0KA 2EJMA 2QDBA 2Z8LA 4BY7B 1XYIA 2QILA 1VDZA 3J80E 4OO1G 1YNJC 3RZOB 2KA7A 5ELFA 4EGVA 1F2YA 2CQAA 2O5JC 4RHSA 1SDFA 4OO1I 3X3MA 2R92B 3HEJA 3L7ZC 3PV0A 2X69A 2NUCA 1NR4A 1EU4A 4NDXA 4QF4A 1ENFA 4FNFA 1UAPA 2F0PA 3WOEA 5JVH3 3EROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DYQ A;  4DXG A;  1PRT F;  1CQV A;  4O1N A;  1FNV A;  1M4V A;  2XN9 C;  1BXT A;  1JR0 D;  1JWU D;  2AQ1 B;  3DWP A;  4RGT A;  1KLG D;  1TS4 A;  1LT4 D;  1BCP C;  3KLS X;  1G8Z D;  1CT1 D;  1V1P A;  1UUP A;  1EEF D;  2XRQ D;  1S5B D;  2RDG A;  2WV6 D;  3BVM A;  3EA6 A;  1PTO C;  1LO5 D;  1SXT A;  1LTT D;  1BCP D;  1RF2 D;  3O13 A;  2J4X A;  1HTL D;  2R61 A;  2AQ3 B;  2AQ2 B;  1FGB D;  1I4H A;  1PTO D;  1XXG A;  1SJH D;  1TS5 A;  4C56 C;  4UDU C;  1HQR D;  1XTC D;  5ELC A;  1PZI D;  5FKA C;  5D3D A;  4DXF A;  1RCV D;  1JQY D;  3W2D A;  1MD2 D;  1PRT B;  4ZYS A;  3DWA A;  2XRS D;  3EFX D;  1S5F D;  1AW7 A;  3DWQ A;  1ET9 A;  1FNW A;  3TSS A;  1LTB D;  1S5D D;  3OWE B;  1LT3 D;  2RDH A;  4RGO S;  1KTK A;  2O2L D;  2QEJ C;  3GP7 A;  3R2I A;  1RDP D;  1EU3 A;  2ICI A;  3BYT B;  1EEI D;  1S5E D;  3BVZ A;  5ELD A;  1LLR D;  4Z9C B;  1I4Q A;  1V1P B;  1PZK D;  1SJE D;  1ESF A;  1PZJ D;  1EWC A;  1GOZ A;  5FK9 C;  1B1Z A;  1L0X B;  1D5M C;  3BZD B;  1F77 A;  1LTI D;  1AN8 A;  1SE4 A;  3R8B A;  2IJ0 A;  1T5X D;  4RFB A;  2IPK D;  1HA5 A;  1CK1 A;  3SEB A;  4BWG B;  1V1O A;  3MC0 B;  2G9H D;  1SE3 A;  1BCP F;  1EFI D;  1TS3 A;  1LTA D;  1I4R A;  1PRT C;  1B44 D;  1TS2 A;  2XNA C;  1TY0 A;  5TSS A;  1I4X A;  1PTO F;  1RD9 D;  1SBB B;  2Z8L A;  4RCO A;  1PRT D;  4RHR A;  2QIL A;  1UNS A;  1S5C D;  1PTO H;  1LTS D;  1L0Y B;  4OHJ A;  1I4G A;  1CHQ D;  3CHB D;  3MFG A;  2CHB D;  1JWM D;  1JWS D;  5ELF A;  1FD7 D;  4TSS A;  1LT5 D;  1TY2 A;  1KLU D;  4RHS A;  1QIL A;  3V05 A;  4L63 B;  3BVG A;  1STE A;  3R2T A;  1FNU A;  1PYW D;  4K6L A;  4L6T B;  1BCP B;  5D3I B;  1LT6 D;  1ET6 A;  1PTO B;  4RGM A;  1EU4 A;  1JCK B;  1DJR D;  5ELE A;  1CHP D;  2TSS A;  1D6E C;  2SEB D;  5I4D A;  1ENF A;  1LTG D;  1D5Z C;  2NTT A;  1LTR D;  1D5X C;  4RGN A;  4RH6 A;  2NTS A;  3URY A;  1SE2 A;  1HXY D;  1SEB D;  1I4P A;  5ELB A;  3BYY B; 
#chains in the Genus database with same CATH topology
 4U68 A;  3DM3 A;  3S17 B;  2F0L A;  1BXT A;  1O7Z A;  1CSP A;  1EYG A;  2JXM B;  1Q12 A;  2K5H A;  3F2B A;  3STB D;  1BF4 A;  1MI2 A;  1WTW A;  1E2Z A;  1Y14 B;  3A7A B;  1XX8 A;  3WOF A;  2JE6 I;  3OWF A;  2B2W C;  5ELN A;  3C1F A;  5J22 A;  4CKE A;  4A3D H;  1IL8 A;  5KYL A;  3CCL A;  4DR7 L;  2WB1 B;  1OXX K;  3A55 A;  1C48 A;  1EQT A;  2B2W A;  4IPG A;  2F1M A;  4CBV A;  1XMQ L;  2NVQ B;  5FO9 B;  1KTK A;  1STY A;  3TP8 A;  1N33 L;  1SFO H;  1BNZ A;  2WB1 G;  2A6E D;  1CI3 M;  4RA8 A;  3OW7 A;  3U4Z A;  5CC4 A;  3LWE A;  4FXG C;  3TQY A;  3R3O A;  1PZJ D;  5C0X H;  1B1Z A;  1C4Q A;  1EYD A;  3CW2 C;  4H44 C;  3BZD B;  2RQX A;  1EZ6 A;  4GN3 B;  1JOO A;  3AB9 A;  3CCQ A;  1RJT A;  4CDC C;  1YNJ D;  4ID6 A;  2I5M X;  3CME A;  3TBI B;  1H9R A;  4QIW B;  1ROD A;  5DEH A;  3K0Y A;  2YU9 H;  1V9P A;  1TS3 A;  1CUK A;  5BN5 A;  5HGT A;  3QJY A;  4RG1 A;  3W1B A;  4DV3 Q;  1AE2 A;  1Q46 A;  4DV2 Q;  5I6Y A;  3SE0 A;  4K6D A;  4A3C G;  2VQE Q;  4IOA A;  2QGQ A;  4HMJ A;  5EPJ A;  1L1O A;  2AWO A;  2IX1 A;  1SNC A;  4A3F B;  1YHB A;  3AU7 A;  1IYU A;  1CQF A;  4IZ8 A;  4PZ7 A;  5BN3 A;  3OSO A;  3CU7 A;  3I8Z A;  1I50 H;  4KKS A;  4JW0 A;  5JEA H;  3J7Y W;  3C2P A;  3S1Q H;  1NBW A;  1XMO Q;  5C3X A;  2A74 C;  4A3F G;  4GS3 A;  1EQR A;  1N32 Q;  1CFM A;  1IXR A;  3K6O A;  1XNR L;  3H3V H;  2EJF C;  2F0J A;  3KFU A;  4DR6 L;  3IFD A;  4DPG A;  3L3O C;  2KEN A;  1OXU A;  5IP7 G;  2Z1C A;  1YNN C;  2B2Y C;  1Z9F A;  4IUT A;  4O1N A;  1IKM A;  1MSH A;  2K5N A;  1LT4 D;  1OXV A;  5D65 A;  2F0G A;  1EOV A;  3PO2 H;  4YWM A;  2WV6 D;  3SGI A;  1IBL L;  4V19 0;  4DR7 Q;  2LFN A;  4FF4 A;  2F03 A;  4LFC Q;  1GHK A;  4CHT B;  5EGT A;  3HGB A;  1A3U A;  3FVQ A;  1GJX A;  1NAP A;  2MP1 A;  1RTN A;  1AEX A;  1N33 Q;  1Q1E A;  4IPH A;  2R93 H;  4WRD A;  4JI7 L;  1WTQ A;  3MTS A;  1S72 A;  1TWH B;  1LT3 D;  2NZO A;  5EQ0 A;  3UI2 A;  1LAC A;  4Q0F A;  5IYC H;  3ULP A;  1MHW C;  4LFA L;  4C3J B;  1PZK D;  1GOZ A;  2A1A A;  3M4O H;  1D5M C;  1LTI D;  2HCC A;  3I73 A;  2IJ0 A;  1HRJ A;  1YEZ A;  2HDL A;  1IBK L;  4Y52 H;  4CDE C;  4DK1 A;  3BG3 A;  2F0F A;  2K1B A;  3R93 A;  4XT1 B;  4ODG A;  5LMU L;  3HOZ H;  4C3J G;  1BCP F;  1QUQ B;  1WCM B;  2PI2 E;  1B3A A;  2D9U A;  2VB2 X;  1O7L A;  4B3S Q;  1X32 A;  2BDN A;  4DV5 L;  1SBB B;  1HNX Q;  2WII B;  4KHZ A;  2OCE A;  1LYL A;  4ZLT F;  4GLA C;  1WCM G;  3ITP A;  3F2C A;  1R9T H;  1TWF B;  2ICE C;  1TWG B;  2GVA A;  4N8X 1;  1ONL A;  1PH4 A;  1TT2 A;  1B7Y B;  4MIU A;  1K8O A;  3IKJ A;  3MXN B;  1SNM A;  4CDF C;  2UU9 L;  1YNN D;  5IYD H;  4GLX A;  5HY6 A;  4OWX B;  1HHV A;  2VUM H;  4F7X A;  3CRL C;  4UP7 A;  2M9V A;  1D6E C;  4A3I B;  1PYS B;  1LTG D;  4NW2 A;  3SDZ A;  3U9S A;  4LF9 Q;  4B3T Q;  2E2H B;  4PMW A;  3CCE A;  4IJH A;  3KF6 A;  1SE2 A;  3KJO A;  2HIX A;  5COY A;  4A3I G;  3TRZ A;  1E22 A;  4X62 Q;  4HJ5 A;  1X9N A;  3J81 j;  2X6L A;  4ALP A;  4IFD J;  4GNX C;  2CH4 W;  1BCP C;  2PO4 A;  5JOB A;  5A35 A;  2NVX B;  4JBW A;  2CWA A;  5LL6 S;  1A3V A;  1SYE A;  4A3E H;  4CJ1 B;  1MSG A;  1VQK A;  2HQL A;  3S2D B;  1G6Z A;  1N36 L;  4IUR A;  4GNX A;  4R8N A;  3I3C A;  4PMC A;  4L5S A;  3DLL A;  1EIF A;  4DR4 Q;  4XQJ A;  1FNW A;  1B2T A;  1LTB D;  1S5D D;  1BBX C;  2O2L D;  3GP7 A;  3R2I A;  3J80 c;  1HZ9 A;  2ICI A;  1VQI A;  4A3J H;  1KRS A;  3MVV A;  3S2H B;  3PUV A;  1K73 C;  1SNO A;  2K6A A;  4G4K A;  2K75 A;  4IO9 A;  1SE4 A;  5I2X A;  4S3S A;  2PYK A;  2F0S A;  5C3E H;  4DV5 Q;  4FP5 D;  2EXZ A;  5KEE A;  1NJI C;  1X3F A;  3T16 A;  1DOL A;  3CD6 A;  1YZ6 A;  1BR9 A;  2A73 B;  2DNE A;  1B44 D;  3ZJY C;  3GTJ H;  3GTL H;  5CV9 A;  1EY6 A;  2FFK B;  1U4L A;  1YHQ A;  2K4K A;  2ENB A;  2UU9 Q;  3J7A 5;  2UXB L;  1RHP A;  1MIU A;  4DUZ L;  2QDL A;  1FD7 D;  3LNN A;  4EQN A;  1VQA A;  3NWS A;  4QQB X;  1NR2 A;  4IQZ A;  3CF5 A;  4RKB A;  4JI0 L;  1BCP B;  1HR0 Q;  2PPB C;  3OW2 A;  1DD2 A;  2A69 C;  2OTL A;  2RF4 A;  1ET6 A;  1QB5 D;  2EYL A;  2KJX A;  3Q24 A;  3CQZ H;  1YIJ A;  1M8A A;  4LJZ C;  3KK7 A;  4YY3 Q;  2QKI C;  4LF8 L;  3K7A B;  1N34 Q;  4A3L G;  3I91 A;  4N8F A;  3S1R H;  4JBJ A;  1YVC A;  2YTV A;  1FJG L;  1P16 A;  3URY A;  1XJV A;  4I7A A;  4AQY L;  3HOV H;  1NUC A;  4WJW A;  1PRT F;  5CBA E;  3DHQ A;  4DR5 L;  1X56 A;  4DNR B;  4QJF A;  1N36 Q;  3AEV A;  2B8F A;  3GTK B;  3CMA A;  3GD7 A;  3SXH A;  2EXD A;  5M5Y H;  1PH5 A;  1WTO A;  3S16 H;  3A74 A;  1D2B A;  1RF2 D;  1F9P A;  1IBM L;  5J1Z A;  4XQQ A;  2PZU A;  1R4Q B;  1UE5 A;  4BBS B;  1M1K C;  4FF2 A;  1JQY D;  3KLS A;  1ASZ A;  1Q81 C;  1Y8N B;  4ZYS A;  3EFX D;  3I4M H;  3GTG B;  3JAM c;  4PZ8 A;  4BBS G;  2B63 B;  3I4O A;  4UP9 A;  3AFQ A;  4NKL A;  3C1E A;  4G57 A;  3FPP A;  3D0F A;  4IPC A;  2NZH A;  3NBH B;  2K5Q A;  2FIN B;  4HED A;  1Y1V H;  3T13 A;  1E0B A;  1D8L A;  5GRO A;  5EBD A;  4LF4 L;  2B63 G;  4QL5 A;  1X3G A;  2YYZ A;  1GHJ A;  3SEB A;  1CK1 A;  2F0Q A;  4Q5V A;  2K01 A;  1PRT C;  2UXD Q;  4OL7 A;  4DUZ Q;  3GTQ H;  4QB4 A;  4YWL A;  2GVB A;  2A69 D;  2WIN B;  2L11 A;  2UUC Q;  1VQ7 A;  3TRE A;  4C3H B;  4JI0 Q;  3CCV A;  2ZM6 L;  2NZ1 D;  3T4A C;  3QB3 A;  1Q1B A;  1X55 A;  3F1Z A;  1PYW D;  4R4Q A;  4C3H G;  1WJJ A;  5NUC A;  3GV6 A;  3W3A A;  4A4I A;  1HUM A;  2EY1 A;  4JV5 L;  4HJA A;  4KY6 A;  1WOC A;  4B3M L;  4OON A;  4APV A;  2EE1 A;  1GUG A;  4C3I B;  5JJZ A;  1KL9 A;  1D5Z C;  3I2Z A;  4DR5 Q;  1J5E Q;  1CZG A;  3CXC A;  1U5K A;  2K32 A;  3N52 A;  2DJF C;  2F0M A;  5M3F B;  2MO1 A;  4C3I G;  1LM0 A;  2R7Z B;  4FXD A;  3A8I E;  1TKW B;  2K05 A;  2AQ1 B;  4O2D A;  3S9W A;  4G7O C;  2F4I A;  2PW5 A;  1U4P A;  3OHX C;  4UPA A;  5M3F G;  1AP0 A;  2R7Z G;  1SXT A;  4MZ9 A;  1L2F A;  2A6H C;  2LKV A;  2AQ2 B;  5KGU A;  2ZJP A;  1XPU A;  5FKA C;  2CW0 C;  3HKS A;  2L55 A;  1PRT B;  3BS1 A;  2IL8 A;  4N9P A;  4JBK A;  4YCV A;  2L9H A;  5FOB B;  5AJ3 L;  4R1J A;  1E2W A;  3S14 H;  5C5M A;  4LF4 Q;  4H02 A;  2WKC A;  1D7Q A;  1BBW A;  5M3M H;  2XGT A;  2I0Q A;  3M3Y B;  3J81 c;  4M8A A;  2F0T A;  2OQK A;  3IRB A;  5IGG A;  5JJL A;  1Z47 A;  5FJ8 G;  3SK5 A;  3TME A;  2NVT H;  2B2V C;  1STB A;  1B50 A;  4G7H C;  1PH6 A;  2C35 B;  4BY1 H;  3RLN A;  2L15 A;  3KBG A;  2Y0S B;  3QR8 A;  4KHP L;  2XNA C;  4YHH L;  2ZM6 Q;  4JI2 Q;  2B29 A;  4LUV A;  2Z6K C;  1Y1W B;  1F9S A;  1RKN A;  2JYO A;  2Y0S G;  2B2U A;  1IZ6 A;  1JOQ A;  4ZRZ A;  1EY7 A;  5EBC A;  2E2I H;  4ZUI A;  5C44 H;  3AFP A;  4IN3 A;  4EX5 A;  2Q2T A;  4JV5 Q;  3S24 A;  3PUY A;  1STG A;  1Y1W G;  3HOU B;  2I5H A;  2NN6 G;  2Z6K A;  3MA2 B;  4DU9 A;  4B3R L;  4P71 A;  4L6T B;  4DV6 L;  4Y7N H;  3P20 A;  5E4W C;  1BKB A;  2NN6 I;  1C0A A;  2J7Z A;  1PFS A;  3HOU G;  1SYD A;  4HN7 A;  2TSS A;  1KIX A;  1CA5 A;  4X64 Q;  3F2U A;  2WAC A;  1Q7Y C;  5HGQ A;  2NTS A;  2FHT A;  2A6H D;  2RHS B;  2QF7 A;  3T1H L;  1PLF A;  1I6H H;  4C2M H;  4DV2 L;  4ZUJ A;  1HZC A;  1X3E A;  1T5E A;  3NTH A;  4HAE A;  4TKO B;  3SK8 A;  1IHZ A;  2EYM A;  1JR0 D;  2F0O A;  4ZQ3 A;  2PMZ B;  2CW0 D;  2HIV A;  3PO3 B;  1F2L A;  3QOL A;  4A3K B;  1CT1 D;  3HOY H;  1SYC A;  2KQ3 A;  2K7V A;  1PFB A;  1U4M A;  4ZK9 B;  3JC6 6;  1S40 A;  4IUN A;  1PH1 A;  1K83 B;  1ENA A;  1LTT D;  1SNP A;  2BA1 A;  2LMC B;  4LW1 A;  2KHS A;  3PO3 G;  1VQ5 A;  3NSW A;  3GTM H;  5AJ3 Q;  4A3K G;  3QG1 A;  1XMO L;  3TDQ A;  5DM6 3;  4PQX A;  2NVY H;  2I07 B;  2BA0 A;  1RCV D;  2N78 A;  3PUX A;  1PHJ A;  1A3T A;  1KD1 C;  3MXU A;  4NXN Q;  3DWA A;  2BCO A;  3OWE B;  1MJE A;  4FO2 A;  2JA8 B;  5M5X H;  4RAU C;  4OO1 H;  3K7U C;  2E2J H;  1EU3 A;  4E6I A;  1I6V C;  1A8V A;  2KCT A;  1GUO A;  1HZB A;  3BZK A;  1S5E D;  4GOP B;  4DV0 Q;  1CKM A;  4BY7 H;  1S3O A;  1G29 1;  1WYD A;  3DUZ A;  2ASB A;  1PXU A;  4KHP Q;  2E5L L;  2JA8 G;  3KDF A;  4YHH Q;  1UEA B;  4K2L A;  5BN4 A;  3F8T A;  3RZO H;  2VY3 A;  4DK3 C;  3KLW A;  1FL0 A;  4LFC L;  3SHL A;  1QWY A;  5I9P A;  1Y8O B;  4KK7 A;  5C0X I;  2K14 A;  1HNZ Q;  1TS2 A;  2K5W A;  2XWB B;  1H9S A;  5KNB A;  2CVR A;  5IWA Q;  5CV7 A;  2R92 H;  5D14 A;  2IX0 A;  4P72 A;  4UP8 A;  4P75 A;  2EY2 A;  4B3R Q;  3K80 C;  3RLF A;  4DV6 Q;  5IE8 A;  4KY5 A;  3K5L A;  1TY2 A;  3OMC A;  4HCE A;  1TVX A;  3RD4 A;  5DM7 3;  1QZH A;  1B8A A;  5JVG 3;  4GKJ Q;  3LX0 A;  1HJP A;  4MNO A;  4PZ6 A;  4B9W A;  2L0C A;  3S17 H;  2KOL A;  1BDO A;  1KRT A;  1JB7 A;  5E1F A;  3T1H Q;  1JT8 A;  5LMN Q;  5GQO A;  1OTC A;  1TU2 B;  1MJC A;  4XYO A;  2KCC A;  5DNF A;  3HOW B;  4DR1 Q;  4H7B A;  4HIO A;  5COR A;  3Q22 A;  3P1H A;  1EIY B;  4B3S L;  2WAQ B;  4PMB A;  4IPD A;  1HNX L;  4KI0 A;  4EVO A;  2Q8T A;  4A75 A;  1CKN B;  2I5L X;  2D0O A;  3H3V I;  3HOW G;  1U9R A;  4CJ2 C;  5JPM C;  4KJN A;  3KDF B;  1VQG A;  1SE8 A;  3AMU A;  1VQJ A;  2WAQ G;  1EEF D;  2OF1 A;  2LSS A;  2RBM A;  2A8V A;  1DOM A;  5CV4 A;  2NVQ H;  3GV3 A;  2L4N A;  1H9S B;  3K5M A;  4OIJ A;  1QUQ A;  3LWU A;  3A8K E;  5ELC A;  5IYB G;  1PZI D;  1VQ4 A;  2SNM A;  3PIO A;  2XIW A;  2LS0 1;  3DWQ A;  4LF9 L;  1TWC B;  4B3T L;  1CSQ A;  1CM9 A;  4N9T A;  2E74 C;  2MGS A;  3ERQ A;  4K5X A;  4A3C H;  3A5Z B;  3MWY W;  4K8I A;  2E5L Q;  1HH2 P;  2Z4H A;  4O0A A;  3I4N B;  2PQA B;  2B2Y A;  3H94 A;  1EEI D;  4IFD G;  2MQH A;  5C0X J;  4X62 L;  1X65 A;  1ICW A;  3G6J B;  5DAU A;  1EQV A;  2RCF A;  3D31 A;  3MXN A;  1F77 A;  3CCR A;  2Y0S E;  4IFD I;  4HSV A;  4RFB A;  3I4N G;  5JJK A;  1AZP A;  4A3F H;  1VQD A;  2CFM A;  1LTA D;  4DGZ A;  5M5W B;  2F0V A;  2FXQ A;  4KD4 A;  5TSS A;  5CGK A;  1GUN A;  1PTO F;  2MJ8 A;  4CKC A;  4JG2 A;  1YIT A;  1O7Y A;  4A93 B;  1QG7 A;  5IP7 H;  4JCV E;  4DR4 L;  2N55 A;  4ZCK A;  2EYH A;  2ID0 A;  4DAV A;  3K5O A;  2A19 A;  2MUY A;  5JEA J;  4A93 G;  1FNU A;  4XT3 B;  5CMD A;  4BS9 A;  2D0P A;  5IGE A;  3ULL A;  3G4S A;  1P8L A;  1VQ8 A;  3ICE A;  4RGN A;  2RCN A;  1ICF B;  1HXY D;  1NY4 A;  2VB3 X;  2NBF A;  5ELB A;  3BYY B;  1DYQ A;  1DZ1 A;  4MTN A;  3I56 A;  4R4O A;  1HUN A;  1SYF A;  1Q3L A;  3CP0 A;  3I72 A;  3M9B A;  3C46 A;  2XVS A;  1JE5 A;  3ULJ A;  1TWA B;  1MGS A;  4L8J A;  4AYB B;  2BH2 A;  4DV7 L;  2HDM A;  1PTO C;  1TWH H;  4LUO A;  1WTP A;  1PA6 A;  2VNU D;  2J4X A;  4L5Q A;  2R61 A;  3NPP A;  3TEH B;  1HR0 L;  3WDN A;  5FLM G;  4C3J H;  3RN5 A;  2UUA L;  2RSO A;  4AYB G;  3PUW A;  1FGU A;  4YY3 L;  3Q8D A;  3H91 A;  1WTX A;  2R7F A;  2J0T D;  1N34 L;  5IP9 G;  3CKI B;  3MXG A;  2R7D A;  1E1O A;  2KED A;  2KUM A;  2KCN A;  2RHQ B;  2KEE A;  1B70 B;  3HKZ B;  1J8I A;  1SRU A;  1WCM H;  2DNC A;  3QO2 A;  2WKD A;  1V1P B;  3VYR A;  1NSN S;  1ESF A;  1JE4 A;  2QA4 A;  1DM0 B;  1Q90 A;  1V8Q A;  2WB1 E;  1A15 A;  3MEH A;  4JI8 Q;  3GDE A;  3HKZ G;  3BDO A;  4HMI A;  1K8M A;  3DM1 A;  4NMZ A;  1VQN A;  1F2M A;  1TWF H;  2ZTD A;  1V43 A;  3MC0 B;  5GAH C;  1TWG H;  4ZKC B;  1SND A;  2HD3 A;  4UHV A;  2KBN A;  1I4R A;  1IYJ B;  1MBY A;  1EYC A;  3PMF A;  2Q2H A;  2M00 A;  1KDA A;  1Y8P B;  2JEA I;  3RZD B;  3CPW A;  2EQS A;  4RHR A;  3BZC A;  3EJI A;  1HNW Q;  3EIV A;  5GAG C;  3S1N H;  1CHQ D;  3CHB D;  2DN8 A;  3IAY A;  4A3I H;  1AFP A;  3Q6S A;  3K59 A;  4ME5 A;  4QIW E;  5EPK A;  3VDY A;  2E2H H;  1KNA A;  1X3P A;  5A2Q E;  3U58 A;  1EY8 A;  2GN5 A;  3R2T A;  5F2D A;  4V0B A;  1NCV A;  1TXY A;  3EN2 A;  3QIA A;  4HJ7 A;  1M90 C;  1PTO B;  1GUT A;  4JPB W;  5ELE A;  2NVX H;  2NTT A;  5E4X A;  3GTO B;  2UXD L;  4L5R C;  3VR6 A;  1PV4 A;  1QOH A;  3S2D H;  4LWC A;  1WD0 A;  4JI1 L;  1X54 A;  1HQM C;  4ME3 A;  2FMC A;  4DV7 Q;  4LF6 L;  1EY0 A;  3NBI A;  2UUC L;  5K36 G;  3NBH A;  3NE5 B;  1F9Q A;  2SNS A;  3C3L A;  2RDF A;  3P75 A;  1S5B D;  3NEN A;  2VW9 A;  2UUA Q;  1BCP D;  1HTL D;  2F0W A;  5K5P A;  2AQ3 B;  1E7Z A;  3PGZ A;  4DAP A;  3OOC A;  3S2H H;  1TII D;  3Q0A A;  2K28 A;  5IOD A;  4DXF A;  3U50 C;  5C3W A;  4H13 C;  1UE1 A;  1E2V A;  4JYA Q;  1S5F D;  3GTP B;  2BDO A;  3S1M B;  3TSS A;  5GAE C;  1J5E L;  2ES2 A;  4HJ9 A;  2RDH A;  2N49 A;  2MHV A;  1I94 L;  5H1S E;  1EWH A;  1OXS C;  3A7L A;  2UXC Q;  2JA5 B;  2PZT A;  2EY6 A;  1AN8 A;  4KD3 A;  1A2U A;  1D1I A;  2IPK D;  1A62 A;  1HA5 A;  3VA7 A;  1Q82 C;  1CA6 A;  1SSO A;  3CC7 A;  2VS1 A;  2OXP A;  2ATW A;  2JA5 G;  2RA4 A;  1JB3 A;  4G7Z C;  2ZXR A;  4DR3 Q;  4A3L H;  4WJ4 A;  5J39 A;  1KC8 C;  4RCO A;  3PF5 A;  1G51 A;  3M4P A;  3IL8 A;  4X3T A;  3H0G B;  2E2D C;  3S15 B;  4DAY B;  1L0Y B;  4FDB A;  4XIG S;  2CHB D;  4BA1 I;  1JWS D;  3I7F A;  1II3 A;  3K7A H;  3I90 A;  4NXM Q;  5KYI A;  3BVG A;  3H0G G;  3ERS X;  2AWN A;  1SYG A;  4A3B B;  1AZQ A;  4B08 A;  4X66 Q;  1HZA A;  1G2S A;  5L37 A;  2LY7 A;  4J1M A;  2H5X A;  3J80 i;  5CV5 A;  1E24 A;  3NWT A;  3GTK H;  2WP8 J;  1CHP D;  4JI1 Q;  4CKB A;  4A3B G;  4LF6 Q;  2N8N A;  2H4O A;  4OGQ C;  2NB0 A;  1D5X C;  3RR5 A;  3I4L A;  1K8G A;  1EIH A;  3IFT A;  2A68 C;  1IKL A;  4JI2 L;  2B39 A;  1SMY C;  4HTH A;  2JA7 B;  4BBS H;  4AYB E;  4R4I A;  1IYV A;  1TS4 A;  2JP1 A;  2YTX A;  4BBR B;  3E9I A;  4OWT B;  2EDG A;  2F0N A;  2XRQ D;  2F4V Q;  3FKI B;  3GTG H;  1EFW A;  4KY7 A;  1NMG A;  3K58 A;  2JA7 G;  2EVB A;  3H09 A;  2B63 H;  3CRK C;  1SAP A;  1DGS A;  1F9R A;  4BBR G;  5CV6 A;  2CKZ B;  2JA6 B;  3DXJ C;  3EBE A;  4TQU S;  3VYU A;  3FKI G;  2IT1 A;  1I94 Q;  1ZKO A;  1ESR A;  1EY9 A;  4X64 L;  1FVI A;  4X65 L;  1FR3 A;  2R6G A;  2JA6 G;  4BXX G;  4TRD A;  1W6J A;  1VQE A;  2EIF A;  5C4J B;  1QJO A;  1WTR A;  1Q86 C;  1R4P B;  4LMQ D;  1DON A;  1I4Q A;  4UY8 C;  3PCO B;  5JPN C;  4A3M B;  1L0X B;  1GUS A;  3OIQ A;  4K2K A;  1CKO A;  4IUQ A;  3X3N A;  4C3H H;  3HZX A;  2IX3 A;  5EPL A;  5C4X B;  2HHH Q;  4A3M G;  1QVC A;  3TP5 A;  1I3Q B;  2TMP A;  1EUJ A;  4I7Z C;  1I5F A;  2KVM A;  3BJU A;  3D4R A;  1PRT D;  1HPC A;  5C4X G;  1VQH A;  3L0O A;  4IUV A;  1GD7 A;  2DJG C;  4NXN L;  1LTS D;  1JJG A;  4OHJ A;  1VF5 C;  3MFG A;  4C3I H;  4CGY B;  2Z9H A;  4WFN 3;  4O42 A;  2L1B A;  3D4W A;  1KAA A;  2JK8 A;  5M3F H;  4DV0 L;  3JAM i;  1SMY D;  2HUG A;  2HQE A;  2L12 A;  5IT9 L;  2R7Z H;  1LT6 D;  2UUB Q;  4HJ8 A;  1QNU A;  1JOK A;  2B2V A;  4ZAI A;  1BO0 A;  4RKL A;  4A3G B;  1Z7T A;  4KJO A;  3EVQ A;  4JI3 Q;  1D1K A;  2Z6B A;  3FP9 A;  1GXD C;  1HNZ L;  5IGB A;  4H0L C;  5IIF A;  4GOP C;  4DKA C;  4K0K Q;  2G9D A;  2Q8R E;  1SEB D;  4YCW A;  1RTO A;  5IWA L;  1VQF A;  2ZXP A;  4A3G G;  4JI4 Q;  3DEP A;  1FNV A;  2N88 A;  4KTA A;  3E0J A;  2CH4 A;  4GOP A;  2B2T C;  1HR0 W;  2MO0 A;  2CCZ A;  2K03 A;  3TZD A;  4GKJ L;  3RN2 A;  5FJ8 H;  3HOX B;  3V2T A;  1WD1 A;  4XXE A;  4X65 Q;  1I4H A;  3M3Y H;  3BU2 A;  2B2T A;  4DR2 L;  4C56 C;  5LMN L;  3L9A X;  5CBE E;  3VA5 A;  3HOX G;  3PIO 3;  5C5L A;  2PW7 A;  4DR1 L;  1KQS A;  1RL2 A;  5A2Q L;  3T56 B;  1STH A;  2VXW A;  2MFI A;  3GO5 A;  3H3V C;  4YCU A;  2QW7 A;  5DLQ E;  1PH3 A;  1LLR D;  4JC0 A;  3CC2 A;  4A3D B;  1AH9 A;  1H95 A;  1EWC A;  2VL6 A;  3FRP B;  4OXP A;  1Y1W H;  4X3S A;  2VZA A;  2NN6 H;  3FDT A;  3F2D A;  3WWV A;  1VQ6 A;  3RNU A;  3CCM A;  1B53 A;  4BWG B;  4A3D G;  1PH9 A;  2AUK A;  1VF7 A;  3CC4 A;  1EFI D;  2V4D A;  1SFO B;  4DUY Q;  4HIK A;  3HOU H;  3VR5 A;  5KNC A;  3NUC A;  4FYD A;  1E1T A;  4ILW A;  2E8G A;  1XTD A;  2EYO A;  2A5H A;  1CKN A;  4AIM A;  5E7N A;  3OTO Q;  4KN7 C;  2YU9 B;  5C0X G;  2JN4 A;  1BUV T;  1JMC A;  1KAW A;  2EJG C;  1STE A;  3D6W A;  1IW7 C;  1ASY A;  3SVM A;  2PNH A;  4NB3 A;  3PF4 A;  1EY4 A;  4FXK C;  4DK6 C;  3M7G A;  3RMH A;  1SYB A;  2NWG A;  1STA A;  2EYF A;  3PO3 H;  3J81 i;  4A3K H;  3E6Z X;  1NE3 A;  5I2Y A;  1XPR A;  3HS0 C;  1QNK A;  2KHI A;  2GA4 B;  3KF8 A;  1EL0 A;  1EIG A;  1XNQ L;  1K83 H;  1I50 B;  2NYZ D;  3J7A F;  4J6H A;  2L5T A;  4LFB Q;  2EY5 A;  2IHF A;  3V96 A;  3S1Q B;  3E5S A;  4OWW B;  1B3Q A;  2AKW B;  2F52 A;  2PQA A;  3LGJ A;  2MPM A;  2OQ0 A;  5JEA G;  5CR3 A;  1A63 A;  3ER0 A;  4DNT B;  3BVM A;  4DR2 Q;  3N6R A;  3OPO A;  2JA8 H;  3NTI A;  2CQO A;  1Z6H A;  2VQF Q;  1HQR D;  4P74 A;  1N8R C;  4LUZ A;  2BH8 A;  1EQQ A;  3DMU A;  3T53 B;  1ILP A;  1GM5 A;  3PO2 B;  1L1O C;  3E0E A;  4EQ5 A;  3L2P A;  1SN8 A;  3JAM E;  1VQ9 A;  2OWO A;  3BVZ A;  4YWK A;  4TVA B;  5ELD A;  1YJ9 A;  4Z9C B;  3QWN A;  4OEL B;  2K33 A;  3PO2 G;  1SJE D;  1B9N A;  2HCI A;  1VQM A;  2R93 B;  3PIP 3;  2ZT9 C;  3CCS A;  4DV1 Q;  2Z0S A;  2LXJ A;  3KF8 B;  1B9M A;  5JAV A;  4C1N K;  5BR8 L;  1SE3 A;  2DY8 A;  3BDC A;  3T1Y L;  1IW7 D;  2R93 G;  2IWH A;  5C6A A;  2AUJ D;  3M4O B;  2RKS A;  1UNS A;  3QOJ A;  4R4C A;  5FO7 B;  5IYC G;  5FO8 B;  2DGY A;  4QMG A;  5FLX E;  3HOZ B;  3EQL C;  3HOW H;  3NQT A;  4TSS A;  3ZYY X;  1LT5 D;  1KLU D;  4WJ3 M;  4L63 B;  4J15 A;  2K52 A;  4JI6 L;  1KAB A;  4DAM A;  5D3I B;  3UDG A;  1GVP A;  5CV8 A;  4CDD C;  1PFM A;  5IGC A;  3P7J A;  4JI8 L;  3HOZ G;  1XNQ Q;  2H1E A;  1TQO A;  2X6G A;  4LNQ A;  1DJR D;  1QE6 A;  1R9T B;  5KND A;  2Q2U A;  3MAQ A;  3I70 A;  5HUR A;  4HCS A;  5IYB H;  1HA6 A;  4R9W A;  1XMQ Q;  2WFW A;  4ABN A;  3OYY A;  1YJN A;  3H15 A;  2YTY A;  4F88 A;  1K0S A;  4HID A;  4IAL A;  2VUM B;  1HNW L;  1L1O B;  3FPU B;  1ZEQ X;  1ZYR C;  4GLV B;  1SRO A;  4ZKB B;  4JK1 C;  4RGT A;  2KHJ A;  3D6C A;  4AH6 A;  1G8Z D;  1UEB A;  1V1P A;  4IFD H;  2IY5 B;  5IYD G;  5ELO A;  3UDF A;  4I65 A;  2XWJ B;  1TWC H;  5JJI A;  2EYP A;  2VUM G;  1GKH A;  3O13 A;  3Q23 A;  1BQQ T;  4IUU A;  1QVG A;  3UE1 A;  4EQO A;  3I4N H;  3H6M A;  2PCF B;  1SJH D;  1V1Q A;  2JEB I;  2SDF A;  2OT2 A;  3CAM A;  4UDU C;  1LV9 A;  5D3D A;  2PMZ E;  4XYQ A;  4NP5 A;  2RVL A;  3W2D A;  4FF1 A;  1GO3 E;  2B8G A;  4QUF A;  1LAB A;  5G3L F;  1G2T A;  4A3E B;  4RGO S;  3FHW A;  1DOK A;  2QEJ C;  1G6P A;  2EPB A;  3D8G A;  5M5W H;  3NP8 A;  1Q8K A;  1DCZ A;  4XTC S;  5BR8 Q;  3J81 E;  3VYS A;  2FMM A;  3FEW X;  4A3E G;  1B4O A;  4A93 H;  3TP6 A;  1T5X D;  2CWP A;  3T1Y Q;  4KN4 C;  4DK0 A;  2KCM A;  2Q2I A;  1TR5 A;  3J7Z C;  1XNR Q;  5IT9 E;  3MHB A;  4DR6 Q;  2O4X A;  2E75 C;  4K8J A;  4A3J B;  1TY0 A;  2R3Z A;  3CCJ A;  1RD9 D;  3S1N B;  1J9O A;  5IGD A;  1PDQ A;  2F0E A;  1HCZ A;  4ULL A;  4JYA L;  3PUZ A;  1KHI A;  1S5C D;  1YBY A;  4WOR A;  1I4G A;  4U67 3;  5C3E B;  4JI6 Q;  4A3J G;  4LF5 L;  1JWM D;  1C8C A;  3PIP A;  1K8A C;  1IBL Q;  2PNR C;  4K6L A;  3GTJ B;  3GTL B;  2DY7 A;  5C3E G;  3VYT A;  2Q8I B;  3TP7 A;  1U4R A;  2UXC L;  5IOC A;  1N9W A;  2BOS A;  1ZYR D;  4RGM A;  5KRU A;  4KLK A;  1JCK B;  3NXW A;  5FLM H;  2PQE A;  2SEB D;  1PH7 A;  3ONA B;  4JI7 Q;  1TWA H;  4KHV A;  3W1G A;  1K28 A;  1A6X A;  1EOT A;  4DR3 L;  1WTH A;  4JI5 L;  4RH6 A;  5EJW A;  1SLJ A;  1HFG A;  4RWS C;  4F87 A;  3J80 L;  3A5U A;  5IP9 H;  3TS2 A;  2EYJ A;  1PYB A;  3G6E A;  4LFA Q;  2XN9 C;  4EQP A;  3CQZ B;  2ZJQ A;  3DWP A;  1ILQ A;  4DF7 A;  3MEF A;  1IBK Q;  2JA9 A;  3S1R B;  2RDG A;  4NXM L;  4KV6 A;  1SR3 A;  2F0U A;  5LMU Q;  3HOV B;  3D3R A;  2WAQ E;  5LMN W;  3K8A A;  4X66 L;  1PTO D;  4LK1 C;  3FMC A;  3PSI A;  3A56 A;  2F3V A;  4XDX A;  5LHY 1;  3HP3 A;  4L5T A;  3KF6 B;  3HOV G;  4B9X A;  2XRS D;  4PNY A;  4X6A H;  1NNX A;  1ET9 A;  5M5Y B;  3S16 B;  1NMF A;  3PQI A;  4DAY A;  1RDP D;  1W2B A;  1E3P A;  3KOJ A;  4JBM A;  5IGF A;  4RCN A;  1IL2 A;  1W3S A;  4KKU A;  4OIK A;  4K14 A;  3RZD H;  5FK9 C;  4OX9 L;  5M9O A;  4XQN A;  4K5W A;  3M7N A;  2F0D A;  1H9J A;  2K50 A;  2F4V L;  3I4M B;  3G71 A;  3DEO A;  5C4H A;  1O7I A;  1V1O A;  2G9H D;  1K0R A;  1O80 A;  1VCI A;  1UWV A;  4GNX B;  1C7Y A;  5I9O A;  4MHE A;  1H9M A;  4LF5 Q;  2SOB A;  5EKL A;  1QZG A;  1Y1V B;  1EYA A;  3BDL A;  4MN3 A;  1S4Z A;  4QGU A;  3I4M G;  3VR4 A;  3VR3 A;  1BOS A;  3G7L A;  5G3L D;  2EZV A;  1PTO H;  3TS0 A;  1Q8I A;  2G5D A;  1EWI A;  4QCL A;  3K57 A;  1Y1V G;  3SK4 A;  3TZU A;  1CTM A;  3GTO H;  1QCB D;  5K36 H;  1QIL A;  3V05 A;  1LUZ A;  3GTQ B;  1PMR A;  1MKH A;  3MFY A;  1VQO A;  1STN A;  2QCP X;  4JI5 Q;  3SR1 A;  3HG9 A;  4P2C B;  1VMC A;  5I4D A;  1F2Z A;  3KLR A;  2HHH L;  2EOT A;  3UDX A;  1UE6 A;  3JAM L;  1WTV A;  1YNX A;  2XTI A;  2AHO B;  3E3X A;  4P73 A;  4BA2 I;  3ND9 A;  4PV1 C;  1OO9 B;  3ND8 A;  3KJP A;  4LAA A;  1KNE A;  1CQV A;  1J6Q A;  3NK9 A;  2C5C A;  1JWU D;  4NPS A;  2JQO A;  1KLG D;  1A2T A;  4LF7 L;  1UUP A;  5E3F A;  2JSO A;  1ENC A;  4QUC A;  3GTP H;  3U9O A;  2BE5 C;  3S1M H;  1JOR A;  2D2C C;  1PFN A;  4A76 A;  3D4D A;  4YIJ A;  4M1U B;  3M85 A;  2M2L A;  3GQB A;  4R4T A;  1XXG A;  4GKK L;  1LTL A;  4RMF A;  2DUD A;  2JJQ A;  2UUB L;  1TS5 A;  2F3I A;  2Z4I A;  3T51 B;  2JA5 H;  2XSC A;  5FLX L;  1FYC A;  3M4Y A;  4JI3 L;  1AW7 A;  5T1I A;  2UXB Q;  1KDC A;  1VQC A;  1K3R A;  4DA2 A;  4OX9 Q;  1A0I A;  1YHA A;  4K0K L;  2F3W A;  4JI4 L;  3BYT B;  4DFA A;  1KXL A;  2PZW A;  3CPF A;  2IW3 A;  4HR7 B;  5T1G A;  1SNQ A;  4K5V A;  5FLX c;  1VQL A;  4IUP A;  1VMP A;  3R8B A;  3H0G H;  2ZTC A;  3S15 H;  1PH2 A;  4DV4 L;  3M4Q A;  3KUP A;  3KBX A;  5ISR A;  2OTJ A;  4LF8 Q;  3S14 B;  1K9M C;  3UE0 A;  3HKZ E;  5KIX A;  3A0J A;  4GN5 A;  1FJG Q;  5M3M B;  3K0X A;  5I6W A;  4AQY Q;  1VS0 A;  4A3B H;  1H9K A;  2C9O A;  4IJL A;  4POF A;  5EAY A;  2MNA A;  4KKT A;  4FF3 A;  3A54 A;  1EY5 A;  1X3Q A;  2NVT B;  1VQB A;  5M3M G;  4BY1 B;  3AYH B;  1HFN A;  2F0H A;  5AFW A;  4QY7 A;  2P5Z X;  2K5D A;  4UAI A;  1IBM Q;  3MXP A;  1XPO A;  4MTK A;  1CZW A;  1K3B C;  2K04 A;  4PG3 A;  4BY1 G;  4CJ0 B;  1WVL A;  2JA7 H;  5IY0 A;  3AQQ A;  1NTG A;  3NHH A;  5C4Z A;  4R8I A;  2QEX A;  4BBR H;  2E2I B;  4GZY C;  1AE3 A;  3HRZ C;  2HT1 A;  2BE5 D;  5C44 B;  2ALY B;  3FKI H;  1LTR D;  4DUY L;  4FVM A;  5EKI A;  3NQI A;  1ML0 D;  2D62 A;  2RSN A;  1UE7 A;  3E9H A;  1YI2 A;  4LF7 Q;  1I4P A;  4Y7N B;  4DXG A;  3J81 L;  4KMU C;  2JA6 H;  4BXX H;  2A68 D;  1M4V A;  2PI2 A;  5EKK A;  3NEM A;  2D5D A;  2N3S A;  5C44 G;  2E76 C;  1EZ8 A;  3NEL A;  3K81 C;  1JC7 A;  1BBU A;  4HSP A;  3KLS X;  1JJ2 A;  4GKK Q;  2ZXO A;  1XWE A;  3OTO L;  1OXT A;  3VR2 A;  5CYU A;  4GN4 B;  4J8Q A;  3MZ5 A;  3EA6 A;  1LO5 D;  1DXM A;  3OMG A;  4C1N I;  3TN2 A;  4F8M A;  2OEO A;  1I6H B;  4X3U A;  3W5O A;  4C2M B;  2B3G A;  2ZJR A;  1FGB D;  3RUZ A;  5C4J H;  1SMX A;  2F0I A;  2I46 A;  5IT9 c;  1Y69 U;  3A8J E;  4A3M H;  1XTC D;  3SK6 A;  1GUW A;  2B2U C;  3J7A V;  1MD2 D;  2FJ2 A;  3UDI A;  2O5I C;  3HOY B;  3STB C;  5C4X H;  1PH8 A;  1YJW A;  1HTP A;  4DV4 Q;  4LFB L;  3GTM B;  1ZXT A;  1I3Q H;  4DN4 M;  3HOY G;  2NVY B;  2V1C C;  3I55 A;  4X3K A;  3OIP A;  5J3B A;  1WFQ A;  3K5N A;  4HIM A;  1O78 A;  1KDB A;  2K5V A;  2KEC A;  1BVS A;  4B3M Q;  1QVF A;  1G91 A;  1JIC A;  3B6Y A;  1W6K A;  5LL6 X;  5M5X B;  1C9O A;  3NTK A;  2E2J B;  4DNI A;  2A6E C;  1I4X A;  2F0K A;  3HFZ B;  3RLO A;  2EJM A;  2VQF L;  2QDB A;  2Z8L A;  4BY7 B;  1XYI A;  1JJC B;  4JVZ A;  2QIL A;  2IHE A;  1U0L A;  1VDZ A;  3G48 A;  3J80 E;  4OO1 G;  1YNJ C;  4A3G H;  3RZO B;  2KA7 A;  5ELF A;  4DV3 L;  1RIP A;  4EGV A;  4JOI C;  1F2Y A;  2CQA A;  2O5J C;  4BY7 G;  4RHS A;  1SDF A;  4OO1 I;  2VQE L;  3X3M A;  4OEM B;  2AMC B;  3CCU A;  2R92 B;  1T9H A;  1VQP A;  2LXK A;  3U4V A;  3HEJ A;  3L7Z C;  3PV0 A;  2X69 A;  3KYH C;  4IOC A;  1PVO A;  4JOI A;  2NUC A;  1WI5 A;  1NR4 A;  1EU4 A;  4NDX A;  4POG A;  2YV5 A;  4QF4 A;  5GAD C;  4DV1 L;  1ENF A;  1L0W A;  2ZTE A;  2R92 G;  4FNF A;  1UAP A;  2F0P A;  1X6O A;  3WOE A;  3HOX H;  5JVH 3;  1N32 L;  3ERO A; 
#chains in the Genus database with same CATH homology
 4U68 A;  3S17 B;  2F0L A;  1BXT A;  1O7Z A;  2JXM B;  1Q12 A;  1BF4 A;  1MI2 A;  1WTW A;  1E2Z A;  3A7A B;  1XX8 A;  3WOF A;  2JE6 I;  3OWF A;  2B2W C;  3C1F A;  5J22 A;  4CKE A;  1IL8 A;  5KYL A;  2WB1 B;  1OXX K;  3A55 A;  1C48 A;  1EQT A;  2B2W A;  2F1M A;  4CBV A;  2NVQ B;  5FO9 B;  1KTK A;  1STY A;  3TP8 A;  1BNZ A;  2A6E D;  1CI3 M;  4RA8 A;  3OW7 A;  5CC4 A;  3LWE A;  4FXG C;  3R3O A;  1PZJ D;  5C0X H;  1B1Z A;  1C4Q A;  1EYD A;  4H44 C;  3BZD B;  2RQX A;  1EZ6 A;  1JOO A;  3AB9 A;  1RJT A;  1YNJ D;  4ID6 A;  3TBI B;  1H9R A;  4QIW B;  1ROD A;  5DEH A;  3K0Y A;  1TS3 A;  5BN5 A;  5HGT A;  3QJY A;  5I6Y A;  3SE0 A;  4K6D A;  4HMJ A;  5EPJ A;  2AWO A;  2IX1 A;  1SNC A;  4A3F B;  3AU7 A;  1IYU A;  1CQF A;  4IZ8 A;  5BN3 A;  3OSO A;  3CU7 A;  3I8Z A;  4KKS A;  5JEA H;  3J7Y W;  3C2P A;  5C3X A;  2A74 C;  1CFM A;  3K6O A;  2EJF C;  2F0J A;  3IFD A;  3L3O C;  1OXU A;  2Z1C A;  1YNN C;  2B2Y C;  4IUT A;  4O1N A;  1IKM A;  1MSH A;  1LT4 D;  1OXV A;  5D65 A;  2F0G A;  2WV6 D;  4V19 0;  2LFN A;  4FF4 A;  2F03 A;  1GHK A;  4CHT B;  5EGT A;  3HGB A;  1A3U A;  3FVQ A;  1GJX A;  1NAP A;  2MP1 A;  1RTN A;  1AEX A;  1Q1E A;  4WRD A;  1WTQ A;  3MTS A;  1TWH B;  1LT3 D;  5EQ0 A;  3UI2 A;  1LAC A;  4Q0F A;  4C3J B;  1PZK D;  1GOZ A;  1D5M C;  1LTI D;  2HCC A;  3I73 A;  2IJ0 A;  1HRJ A;  2HDL A;  4DK1 A;  3BG3 A;  2F0F A;  2K1B A;  3R93 A;  4XT1 B;  4ODG A;  4C3J G;  1BCP F;  1WCM B;  1B3A A;  2D9U A;  2VB2 X;  1O7L A;  1X32 A;  2BDN A;  1SBB B;  2WII B;  4KHZ A;  4ZLT F;  3ITP A;  1TWF B;  2ICE C;  1TWG B;  1ONL A;  1TT2 A;  4MIU A;  1K8O A;  3IKJ A;  1SNM A;  1YNN D;  1HHV A;  4F7X A;  3CRL C;  2M9V A;  1D6E C;  4A3I B;  1LTG D;  4NW2 A;  3SDZ A;  3U9S A;  2E2H B;  4PMW A;  1SE2 A;  5COY A;  2X6L A;  4IFD J;  1BCP C;  2PO4 A;  5JOB A;  5A35 A;  2NVX B;  4JBW A;  5LL6 S;  1A3V A;  1SYE A;  4CJ1 B;  1MSG A;  3S2D B;  1G6Z A;  4IUR A;  4R8N A;  3I3C A;  4PMC A;  4XQJ A;  1FNW A;  1B2T A;  1LTB D;  1S5D D;  1BBX C;  2O2L D;  3GP7 A;  3R2I A;  2ICI A;  3MVV A;  3S2H B;  3PUV A;  1SNO A;  2K6A A;  4G4K A;  1SE4 A;  5I2X A;  4S3S A;  2PYK A;  2F0S A;  4FP5 D;  2EXZ A;  5KEE A;  3T16 A;  1DOL A;  2A73 B;  1BR9 A;  2DNE A;  1B44 D;  5CV9 A;  1EY6 A;  2FFK B;  1U4L A;  2ENB A;  1RHP A;  1FD7 D;  3LNN A;  4EQN A;  3NWS A;  1NR2 A;  4IQZ A;  4RKB A;  1BCP B;  2PPB C;  1DD2 A;  2A69 C;  1ET6 A;  1QB5 D;  2EYL A;  2KJX A;  3Q24 A;  1M8A A;  4LJZ C;  3KK7 A;  2QKI C;  3K7A B;  3I91 A;  3URY A;  1NUC A;  4WJW A;  1PRT F;  5CBA E;  3DHQ A;  4DNR B;  3GTK B;  2B8F A;  3GD7 A;  3SXH A;  1WTO A;  1D2B A;  1RF2 D;  1F9P A;  5J1Z A;  4XQQ A;  2PZU A;  1R4Q B;  4BBS B;  4FF2 A;  1JQY D;  3KLS A;  1Y8N B;  4ZYS A;  3EFX D;  3GTG B;  2B63 B;  4NKL A;  3C1E A;  4G57 A;  3FPP A;  2K5Q A;  2FIN B;  4HED A;  3T13 A;  1E0B A;  5EBD A;  2YYZ A;  1GHJ A;  3SEB A;  1CK1 A;  2F0Q A;  4Q5V A;  2K01 A;  1PRT C;  4OL7 A;  4QB4 A;  2A69 D;  2WIN B;  2L11 A;  4C3H B;  2NZ1 D;  3T4A C;  3QB3 A;  1Q1B A;  1PYW D;  4C3H G;  5NUC A;  3GV6 A;  3W3A A;  1HUM A;  2EY1 A;  4KY6 A;  4C3I B;  2EE1 A;  1GUG A;  5JJZ A;  1D5Z C;  1CZG A;  2K32 A;  3N52 A;  2F0M A;  5M3F B;  4C3I G;  2R7Z B;  4FXD A;  3A8I E;  1TKW B;  2K05 A;  2AQ1 B;  3S9W A;  4G7O C;  2F4I A;  2PW5 A;  1U4P A;  3OHX C;  1AP0 A;  1SXT A;  2A6H C;  2LKV A;  2AQ2 B;  5KGU A;  5FKA C;  2CW0 C;  2L55 A;  1PRT B;  3BS1 A;  2IL8 A;  4N9P A;  2L9H A;  5FOB B;  1E2W A;  5C5M A;  2WKC A;  3M3Y B;  4M8A A;  2F0T A;  5IGG A;  1Z47 A;  3SK5 A;  3TME A;  2B2V C;  1STB A;  1B50 A;  4G7H C;  3KBG A;  2Y0S B;  2XNA C;  1Y1W B;  1F9S A;  1RKN A;  2JYO A;  2B2U A;  1JOQ A;  4ZRZ A;  1EY7 A;  5EBC A;  4ZUI A;  4IN3 A;  3HOU B;  3PUY A;  1STG A;  2NN6 G;  3MA2 B;  4DU9 A;  4L6T B;  3P20 A;  5E4W C;  2NN6 I;  2J7Z A;  1SYD A;  4HN7 A;  2TSS A;  1CA5 A;  3F2U A;  2WAC A;  2NTS A;  2FHT A;  2A6H D;  2QF7 A;  1PLF A;  4ZUJ A;  1T5E A;  3NTH A;  4HAE A;  4TKO B;  3SK8 A;  1IHZ A;  2EYM A;  1JR0 D;  2F0O A;  4ZQ3 A;  2PMZ B;  2CW0 D;  3PO3 B;  1F2L A;  3QOL A;  4A3K B;  1CT1 D;  1SYC A;  2KQ3 A;  2K7V A;  1PFB A;  1U4M A;  4ZK9 B;  4IUN A;  1K83 B;  1ENA A;  1LTT D;  1SNP A;  2BA1 A;  2LMC B;  2KHS A;  3NSW A;  3QG1 A;  3TDQ A;  5DM6 3;  4PQX A;  2I07 B;  2BA0 A;  1RCV D;  3PUX A;  1A3T A;  3MXU A;  3DWA A;  2BCO A;  3OWE B;  4FO2 A;  2JA8 B;  4RAU C;  4OO1 H;  1EU3 A;  4E6I A;  1I6V C;  1GUO A;  1S5E D;  1G29 1;  3DUZ A;  1PXU A;  1UEA B;  4K2L A;  5BN4 A;  3SHL A;  1QWY A;  5I9P A;  1Y8O B;  4KK7 A;  5C0X I;  1TS2 A;  2K5W A;  2XWB B;  1H9S A;  5KNB A;  2CVR A;  5CV7 A;  5D14 A;  2IX0 A;  2EY2 A;  3RLF A;  4KY5 A;  3K5L A;  1TY2 A;  3OMC A;  4HCE A;  1TVX A;  3RD4 A;  5DM7 3;  5JVG 3;  3LX0 A;  4B9W A;  2L0C A;  2KOL A;  1BDO A;  5E1F A;  1TU2 B;  4XYO A;  2KCC A;  5DNF A;  3HOW B;  4H7B A;  5COR A;  3Q22 A;  3P1H A;  2WAQ B;  4PMB A;  4KI0 A;  4EVO A;  2Q8T A;  1U9R A;  4CJ2 C;  5JPM C;  4KJN A;  3AMU A;  1EEF D;  2OF1 A;  2RBM A;  1DOM A;  5CV4 A;  3GV3 A;  2L4N A;  1H9S B;  3K5M A;  4OIJ A;  3LWU A;  3A8K E;  5ELC A;  1PZI D;  2SNM A;  2XIW A;  2LS0 1;  3DWQ A;  1TWC B;  4N9T A;  1CM9 A;  2E74 C;  2MGS A;  3ERQ A;  4K5X A;  3MWY W;  4K8I A;  2Z4H A;  3I4N B;  2B2Y A;  3H94 A;  1EEI D;  4IFD G;  5C0X J;  1ICW A;  3G6J B;  5DAU A;  1EQV A;  3D31 A;  3MXN A;  1F77 A;  4IFD I;  4HSV A;  4RFB A;  1AZP A;  1LTA D;  4DGZ A;  5M5W B;  2F0V A;  4KD4 A;  5TSS A;  5CGK A;  1GUN A;  1PTO F;  2MJ8 A;  4CKC A;  1O7Y A;  4A93 B;  1QG7 A;  2N55 A;  2EYH A;  2ID0 A;  4DAV A;  3K5O A;  2MUY A;  5JEA J;  1FNU A;  4XT3 B;  5CMD A;  4BS9 A;  5IGE A;  4RGN A;  1HXY D;  2VB3 X;  2NBF A;  5ELB A;  3BYY B;  1DYQ A;  1DZ1 A;  1HUN A;  1SYF A;  1Q3L A;  3I72 A;  3C46 A;  2XVS A;  1TWA B;  1MGS A;  4L8J A;  4AYB B;  2HDM A;  1PTO C;  1WTP A;  2VNU D;  2J4X A;  2R61 A;  3NPP A;  3WDN A;  2RSO A;  3PUW A;  3H91 A;  1WTX A;  2J0T D;  3CKI B;  3MXG A;  2KED A;  2KUM A;  2KCN A;  2KEE A;  3HKZ B;  1J8I A;  2DNC A;  3QO2 A;  2WKD A;  1V1P B;  3VYR A;  1NSN S;  1ESF A;  1JE4 A;  1Q90 A;  1DM0 B;  1V8Q A;  1A15 A;  3MEH A;  3BDO A;  4HMI A;  1K8M A;  3DM1 A;  4NMZ A;  1F2M A;  1V43 A;  3MC0 B;  4ZKC B;  1SND A;  1I4R A;  1MBY A;  1EYC A;  3PMF A;  2M00 A;  1KDA A;  1Y8P B;  2JEA I;  3RZD B;  4RHR A;  3EJI A;  1CHQ D;  3CHB D;  2DN8 A;  3IAY A;  1AFP A;  3Q6S A;  3K59 A;  4ME5 A;  5EPK A;  1KNA A;  1X3P A;  5A2Q E;  1EY8 A;  3R2T A;  5F2D A;  4V0B A;  1NCV A;  3QIA A;  1PTO B;  1GUT A;  5ELE A;  2NTT A;  5E4X A;  3GTO B;  3VR6 A;  1QOH A;  1WD0 A;  1HQM C;  2FMC A;  1EY0 A;  3NBI A;  5K36 G;  3NBH A;  3NE5 B;  1F9Q A;  2SNS A;  3C3L A;  2RDF A;  3P75 A;  1S5B D;  1BCP D;  1HTL D;  2F0W A;  5K5P A;  2AQ3 B;  4DAP A;  3OOC A;  1TII D;  3Q0A A;  2K28 A;  5IOD A;  4DXF A;  5C3W A;  4H13 C;  1E2V A;  1S5F D;  3GTP B;  2BDO A;  3S1M B;  3TSS A;  2RDH A;  2MHV A;  1EWH A;  1OXS C;  3A7L A;  2JA5 B;  2PZT A;  2EY6 A;  1AN8 A;  4KD3 A;  1A2U A;  1D1I A;  2IPK D;  1HA5 A;  3VA7 A;  1CA6 A;  1SSO A;  2OXP A;  2RA4 A;  1JB3 A;  4G7Z C;  2ZXR A;  5J39 A;  4RCO A;  3IL8 A;  4X3T A;  3H0G B;  2E2D C;  3S15 B;  1L0Y B;  4XIG S;  2CHB D;  4BA1 I;  1JWS D;  1II3 A;  3I90 A;  5KYI A;  3BVG A;  2AWN A;  1SYG A;  4A3B B;  1AZQ A;  4B08 A;  1G2S A;  2LY7 A;  4J1M A;  5CV5 A;  3NWT A;  2WP8 J;  1CHP D;  4CKB A;  2H4O A;  4OGQ C;  2NB0 A;  1D5X C;  3I4L A;  1EIH A;  3IFT A;  2A68 C;  1IKL A;  2B39 A;  1SMY C;  4HTH A;  2JA7 B;  1IYV A;  1TS4 A;  2JP1 A;  4BBR B;  2EDG A;  2F0N A;  2XRQ D;  3FKI B;  4KY7 A;  3K58 A;  2EVB A;  3H09 A;  3CRK C;  1SAP A;  1F9R A;  5CV6 A;  2JA6 B;  3DXJ C;  4TQU S;  3VYU A;  2IT1 A;  1ZKO A;  1ESR A;  1EY9 A;  1FR3 A;  2R6G A;  4TRD A;  1W6J A;  5C4J B;  1QJO A;  1WTR A;  1R4P B;  4LMQ D;  1DON A;  1I4Q A;  5JPN C;  4A3M B;  1L0X B;  1GUS A;  3OIQ A;  4K2K A;  4IUQ A;  3X3N A;  3HZX A;  2IX3 A;  5EPL A;  5C4X B;  3TP5 A;  1I3Q B;  2TMP A;  4I7Z C;  2KVM A;  3D4R A;  1PRT D;  1HPC A;  4IUV A;  1LTS D;  4OHJ A;  1VF5 C;  3MFG A;  4CGY B;  4WFN 3;  4O42 A;  2L1B A;  3D4W A;  1KAA A;  1SMY D;  2HUG A;  2HQE A;  2L12 A;  5IT9 L;  1LT6 D;  1QNU A;  1JOK A;  2B2V A;  4ZAI A;  1BO0 A;  4RKL A;  4A3G B;  1Z7T A;  4KJO A;  3EVQ A;  1D1K A;  1GXD C;  5IGB A;  4H0L C;  5IIF A;  2G9D A;  2Q8R E;  1SEB D;  1RTO A;  2ZXP A;  3DEP A;  1FNV A;  2N88 A;  4KTA A;  3E0J A;  2B2T C;  2K03 A;  3TZD A;  3HOX B;  3V2T A;  1WD1 A;  4XXE A;  1I4H A;  2B2T A;  4C56 C;  3L9A X;  5CBE E;  3VA5 A;  3PIO 3;  5C5L A;  2PW7 A;  5A2Q L;  3T56 B;  1STH A;  2VXW A;  3GO5 A;  3H3V C;  1LLR D;  4A3D B;  1EWC A;  3FRP B;  4X3S A;  2NN6 H;  3FDT A;  1B53 A;  4BWG B;  2AUK A;  1VF7 A;  1EFI D;  2V4D A;  1SFO B;  3VR5 A;  5KNC A;  3NUC A;  4FYD A;  4ILW A;  2EYO A;  2A5H A;  2YU9 B;  4KN7 C;  5C0X G;  1BUV T;  2EJG C;  1STE A;  3D6W A;  1IW7 C;  3SVM A;  1EY4 A;  4FXK C;  3M7G A;  3RMH A;  1SYB A;  2NWG A;  1STA A;  2EYF A;  3E6Z X;  5I2Y A;  3HS0 C;  1QNK A;  1EL0 A;  2GA4 B;  3KF8 A;  1EIG A;  1I50 B;  2NYZ D;  3J7A F;  4J6H A;  2L5T A;  2EY5 A;  3V96 A;  3S1Q B;  3E5S A;  2MPM A;  5JEA G;  5CR3 A;  4DNT B;  3BVM A;  3N6R A;  3OPO A;  3NTI A;  1Z6H A;  1HQR D;  3DMU A;  3T53 B;  1ILP A;  3PO2 B;  3JAM E;  3BVZ A;  5ELD A;  4Z9C B;  3QWN A;  2K33 A;  1SJE D;  1B9N A;  2HCI A;  2R93 B;  3PIP 3;  2ZT9 C;  1B9M A;  5JAV A;  4C1N K;  1SE3 A;  2DY8 A;  3BDC A;  1IW7 D;  2IWH A;  5C6A A;  2AUJ D;  3M4O B;  2RKS A;  1UNS A;  3QOJ A;  5FO7 B;  5FO8 B;  4QMG A;  5FLX E;  3HOZ B;  3EQL C;  3NQT A;  4TSS A;  3ZYY X;  1LT5 D;  1KLU D;  4L63 B;  1KAB A;  5D3I B;  5CV8 A;  1PFM A;  5IGC A;  3P7J A;  2H1E A;  1TQO A;  2X6G A;  1DJR D;  1QE6 A;  1R9T B;  5KND A;  3MAQ A;  3I70 A;  5HUR A;  4HCS A;  1HA6 A;  4R9W A;  4ABN A;  4F88 A;  4IAL A;  2VUM B;  3FPU B;  1ZEQ X;  1ZYR C;  4ZKB B;  4JK1 C;  4RGT A;  3D6C A;  4IFD H;  1G8Z D;  1V1P A;  4I65 A;  2XWJ B;  2EYP A;  3O13 A;  3Q23 A;  1BQQ T;  4IUU A;  4EQO A;  3H6M A;  2PCF B;  1SJH D;  2JEB I;  2SDF A;  2OT2 A;  4UDU C;  1LV9 A;  5D3D A;  4XYQ A;  4NP5 A;  2RVL A;  3W2D A;  4FF1 A;  2B8G A;  4QUF A;  1LAB A;  5G3L F;  1G2T A;  4A3E B;  4RGO S;  1DOK A;  2QEJ C;  2EPB A;  3D8G A;  3NP8 A;  1DCZ A;  4XTC S;  3J81 E;  3VYS A;  2FMM A;  3FEW X;  1B4O A;  3TP6 A;  1T5X D;  4KN4 C;  4DK0 A;  1TR5 A;  5IT9 E;  3MHB A;  2O4X A;  2E75 C;  4K8J A;  4A3J B;  1TY0 A;  2R3Z A;  1RD9 D;  3S1N B;  1J9O A;  5IGD A;  1PDQ A;  2F0E A;  1HCZ A;  4ULL A;  3PUZ A;  1S5C D;  4WOR A;  1I4G A;  4U67 3;  5C3E B;  1JWM D;  1C8C A;  2PNR C;  4K6L A;  3GTJ B;  3GTL B;  2DY7 A;  3VYT A;  2Q8I B;  3TP7 A;  1U4R A;  5IOC A;  2BOS A;  1ZYR D;  4RGM A;  5KRU A;  1JCK B;  3NXW A;  2PQE A;  2SEB D;  3ONA B;  4KHV A;  1A6X A;  1EOT A;  4RH6 A;  5EJW A;  1HFG A;  4RWS C;  4F87 A;  3J80 L;  2EYJ A;  4EQP A;  2XN9 C;  3CQZ B;  3DWP A;  1ILQ A;  4DF7 A;  3S1R B;  2RDG A;  4KV6 A;  2F0U A;  3HOV B;  3D3R A;  1PTO D;  4LK1 C;  3FMC A;  3A56 A;  2F3V A;  4XDX A;  5LHY 1;  3HP3 A;  4B9X A;  2XRS D;  4PNY A;  1ET9 A;  5M5Y B;  3S16 B;  4DAY A;  1RDP D;  5IGF A;  4RCN A;  4OIK A;  4KKU A;  4K14 A;  5FK9 C;  5M9O A;  4XQN A;  4K5W A;  3M7N A;  2F0D A;  1H9J A;  3I4M B;  3DEO A;  5C4H A;  1V1O A;  2G9H D;  1O80 A;  1VCI A;  5I9O A;  4MHE A;  1H9M A;  2SOB A;  5EKL A;  1Y1V B;  1EYA A;  3BDL A;  4MN3 A;  1S4Z A;  3VR4 A;  3VR3 A;  1BOS A;  3G7L A;  5G3L D;  2EZV A;  1PTO H;  1Q8I A;  4QCL A;  3K57 A;  3SK4 A;  3TZU A;  1CTM A;  5K36 H;  1QCB D;  1QIL A;  3V05 A;  3GTQ B;  1PMR A;  3MFY A;  1STN A;  2QCP X;  3SR1 A;  3HG9 A;  4P2C B;  1VMC A;  5I4D A;  1F2Z A;  3KLR A;  2EOT A;  1WTV A;  3JAM L;  4BA2 I;  3ND9 A;  4PV1 C;  1OO9 B;  3ND8 A;  4LAA A;  1KNE A;  1CQV A;  3NK9 A;  2C5C A;  1JWU D;  1KLG D;  1A2T A;  1UUP A;  5E3F A;  2JSO A;  1ENC A;  4QUC A;  3U9O A;  2BE5 C;  1JOR A;  2D2C C;  1PFN A;  3D4D A;  4YIJ A;  4M1U B;  3M85 A;  2M2L A;  3GQB A;  1XXG A;  1TS5 A;  2Z4I A;  3T51 B;  2XSC A;  5FLX L;  1FYC A;  3M4Y A;  1AW7 A;  5T1I A;  1KDC A;  4DA2 A;  2F3W A;  3BYT B;  4DFA A;  2PZW A;  2IW3 A;  4HR7 B;  5T1G A;  1SNQ A;  4K5V A;  4IUP A;  1VMP A;  3R8B A;  3KUP A;  3KBX A;  5ISR A;  3S14 B;  5KIX A;  5M3M B;  5I6W A;  1H9K A;  2C9O A;  4KKT A;  4FF3 A;  3A54 A;  1EY5 A;  1X3Q A;  2NVT B;  4BY1 B;  1HFN A;  2F0H A;  5AFW A;  2K5D A;  4UAI A;  3MXP A;  1CZW A;  2K04 A;  4CJ0 B;  1WVL A;  3NHH A;  5C4Z A;  4R8I A;  2E2I B;  4GZY C;  3HRZ C;  2BE5 D;  5C44 B;  1LTR D;  4FVM A;  5EKI A;  3NQI A;  1ML0 D;  2D62 A;  2RSN A;  1I4P A;  4Y7N B;  4DXG A;  3J81 L;  4KMU C;  2A68 D;  1M4V A;  5EKK A;  2D5D A;  2E76 C;  1EZ8 A;  1JC7 A;  4HSP A;  3KLS X;  2ZXO A;  1XWE A;  1OXT A;  3VR2 A;  5CYU A;  4J8Q A;  3MZ5 A;  3EA6 A;  1LO5 D;  1DXM A;  3OMG A;  4C1N I;  3TN2 A;  4F8M A;  2OEO A;  1I6H B;  4X3U A;  4C2M B;  1FGB D;  3RUZ A;  2F0I A;  2I46 A;  1Y69 U;  3A8J E;  1XTC D;  3SK6 A;  1GUW A;  2B2U C;  3J7A V;  1MD2 D;  2FJ2 A;  2O5I C;  3HOY B;  1HTP A;  3GTM B;  1ZXT A;  4DN4 M;  2NVY B;  4X3K A;  3OIP A;  3K5N A;  1O78 A;  1KDB A;  2KEC A;  1G91 A;  1JIC A;  1W6K A;  5LL6 X;  5M5X B;  3NTK A;  2E2J B;  2A6E C;  1I4X A;  2F0K A;  2EJM A;  2QDB A;  2Z8L A;  4BY7 B;  1XYI A;  2QIL A;  1VDZ A;  3J80 E;  4OO1 G;  1YNJ C;  3RZO B;  2KA7 A;  5ELF A;  4EGV A;  1F2Y A;  2CQA A;  2O5J C;  4RHS A;  1SDF A;  4OO1 I;  3X3M A;  2R92 B;  3HEJ A;  3L7Z C;  3PV0 A;  2X69 A;  2NUC A;  1NR4 A;  1EU4 A;  4NDX A;  4QF4 A;  1ENF A;  4FNF A;  1UAP A;  2F0P A;  3WOE A;  5JVH 3;  3ERO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...