5KYLA

Crystal structure of staphylococcal nuclease variant delta+phs t62k/v66e ph 7 at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFKKKMEENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62K/V66E pH 7 at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5kylA00
2PZWA 1KABA 5I6WA 3D4WA 1KDCA 4K2KA 3R3OA 3H6MA 5IODA 5KGUA 2F0HA 1NSNS 4NP5A 2EYOA 2EYMA 4IZ8A 5CV9A 4QMGA 5EKLA 3TP8A 1NUCA 5HGTA 5I9OA 3NUCA 4HMJA 4K8IA 1TQOA 2F0MA 1EZ6A 1EY6A 1JORA 2PYKA 4K6DA 5CV7A 5CV6A 2O4XA 4RKBA 5NUCA 2PQEA 4G57A 5HURA 5F2DA 3NQTA 1EZ8A 4K5WA 2F0QA 2F0LA 4ID6A 3OSOA 5EKKA 4ZUJA 1EYCA 3TP6A 1SNQA 5KIXA 1TT2A 5C4HA 1EQVA 4K5VA 1AEXA 4OL7A 4PMBA 1SNDA 4PNYA 5JOBA 2KHSA 1EYDA 2KQ3A 3SXHA 4S3SA 3RUZA 4DFAA 1F2ZA 5CR3A 1SYFA 1EY8A 4I65A 2EY6A 5CV4A 2F0EA 3LX0A 3PMFA 4KD4A 2PZTA 3D6CA 3MHBA 4TRDA 3MEHA 3TP7A 2F3VA 5C3XA 5KEEA 2OXPA 2F0SA 3OMCA 2F0NA 1KDAA 2LKVA 1II3A 2EYPA 1STBA 3SHLA 1RKNA 2F0IA 3MZ5A 3ERQA 2F3WA 3HEJA 3NXWA 3QB3A 4DU9A 5E1FA 4EQPA 4KJNA 1EY7A 3V2TA 2F0WA 5J1ZA 3EJIA 4IALA 5C5LA 3C1EA 1F2YA 1A3TA 4B9WA 3MXPA 4KJOA 3BDLA 3SK8A 5I9PA 5J22A 4KY5A 1SNMA 2EXZA 2SNSA 5IGEA 4YIJA 2F0OA 3SR1A 5IIFA 4WORA 5DEHA 5CV5A 1F2MA 5C6AA 4B9XA 4LAAA 1JOOA 5EGTA 1JOQA 1TR5A 2RDFA 3OWFA 3TP5A 1SYDA 4ZUIA 4N9PA 3SK5A 3VA5A 3NHHA 1EYAA 5KRUA 4QF4A 2ENBA 4KY6A 3U9OA 4KY7A 3D8GA 2F0TA 1A3UA 4WRDA 2EYLA 2SNMA 2EY2A 1SYBA 4ODGA 4QB4A 2PZUA 1SYGA 2F0JA 2NUCA 5CC4A 3EROA 1STGA 5K5PA 3HZXA 5IGCA 1EY5A 2EY5A 2RKSA 4KTAA 1STAA 4NDXA 4DGZA 3C1FA 4R8NA 2F0PA 2F0FA 1EY0A 4K8JA 1SNCA 4F8MA 1SNPA 5C4ZA 5IGGA 4RKLA 4DF7A 1A2UA 1STHA 5IOCA 5E3FA 1JOKA 3ITPA 5C5MA 2EYHA 1IHZA 2F0UA 1KAAA 2RBMA 3T16A 1A3VA 5JAVA 1STYA 4ZQ3A 4N9TA 4NKLA 4IUNA 5KYLA 4K2LA 2F0GA 5J39A 2F0KA 4J1MA 3S9WA 3D4DA 5KYIA 4J6HA 2OF1A 1EY4A 1SYCA 4EQOA 4HMIA 4PMCA 3SK6A 5IGBA 2EYJA 5CGKA 2M00A 4HTHA 4K5XA 5C3WA 3SK4A 3P75A 2F0DA 3BDCA 4NMZA 3QOJA 3TMEA 3NP8A 3EVQA 1ENAA 4ME5A 3E5SA 5IGDA 2PW5A 1A2TA 1KDBA 1STNA 5DAUA 4H7BA 2HQEA 4KD3A 4E6IA 4EQNA 5CV8A 4KV6A 1SYEA 5I6YA 1EY9A 1U9RA 3P1HA 2EYFA 3OMGA 4K14A 2PW7A 2QDBA 3DMUA 5ISRA 2WACA 4EVOA 2EY1A 2F0VA 3DHQA 4F7XA 5M9OA 2OEOA 2SOBA 3MVVA 5IGFA 4MIUA 1ENCA 3QOLA 3T13A 4KHVA 3NK9A 1SNOA
chains in the Genus database with same CATH superfamily
3P20A 3D4WA 4DR3L 4BY7G 4DXGA 1BBUA 2HT1A 4NP5A 5CBEE 2KEDA 1ILQA 2GA4B 1JCKB 1TQOA 2NWGA 3RD4A 3Q6SA 1PH9A 1PH3A 1Y1WH 1C7YA 1LT5D 5IYBH 4HJ7A 1NR2A 1EIGA 4GOPA 2ZT9C 1TT2A 2MPMA 4L5TA 5KGUA 2Y0SB 1QWYA 4BBRG 1ZXTA 2PMZE 3I4OA 3UI2A 1QUQB 1EEFD 3ER0A 4YWKA 2F0EA 4DR7L 3AU7A 3S1MB 4KI0A 1Z47A 1S72A 2CKZB 5FJ8G 3S14B 1L0YB 5KNBA 1KAWA 2PPBC 1VS0A 1KDAA 4JI7L 2MO1A 3NXWA 4EQPA 4OWTB 2E76C 2R7ZB 4N8X1 4KKSA 3EJIA 4QIWB 3BYTB 1BCPB 4POGA 2N8NA 2AUJD 2ASBA 3KF6B 3OWFA 3VDYA 2QF7A 4GLAC 4LF8L 4HJAA 3S15B 2VUMH 1YI2A 4KKUA 4CDCC 1KHIA 2HCIA 1GJXA 4A3KB 1YJ9A 1K8AC 5IGCA 1EY5A 5C4XH 1IYVA 4ZLTF 5CBAE 1L0WA 1SNPA 5COYA 1PH6A 1HZBA 1VMPA 3W1BA 1VQPA 2KCTA 2KVMA 1KC8C 4KN4C 5C5MA 4XQQA 1PZID 3STBC 2EYHA 2WKCA 2AHOB 4JI8L 1RIPA 3TN2A 2L5TA 4BBSG 3D31A 1X3FA 3A7AB 1PA6A 1FNUA 3OYYA 4NMZA 3I73A 1DOKA 1N9WA 1LM0A 3H3VH 3CPWA 1WCMB 1AH9A 4XDXA 4DR6Q 2B39A 3L9AX 1IL8A 5IP9G 1HUNA 4RWSC 1XPOA 4H44C 1WTRA 1ENCA 4CJ2C 4DR2Q 2QEXA 4DAMA 1JQYD 1YNNC 3R3OA 4LFAL 2EYMA 4A3IG 3G6JB 3HKZE 1QOHA 2C35B 3KJOA 2I07B 4DV0Q 5A2QE 2D62A 4LF6Q 3NEMA 2EPBA 1Q81C 1S5DD 4UAIA 1Q1EA 3DM3A 4C3IB 1B4OA 4IPHA 3RNUA 3SXHA 5K36H 2QW7A 2MUYA 4LNQA 2KHJA 2IHFA 1LO5D 2VY3A 3M9BA 2XSCA 2BH2A 4A3EH 2A73B 5I4DA 2R93H 2PZTA 4R4CA 5IT9c 1FGUA 1XMQL 3MXGA 3OMCA 1K28A 2E2DC 4L6TB 3RZDB 4KJNA 4H0LC 4QL5A 1BKBA 3GTQH 2JQOA 3NBIA 3HOYH 4YHHL 4DR4Q 4HR7B 4WORA 3BJUA 1TU2B 2ZXRA 5ELFA 1TWAH 3GTOH 1LTTD 1JE5A 2XTIA 4R8IA 1S5ED 4QQBX 4X3KA 3EROA 4DV3Q 1SEBD 3DWAA 1SNCA 1S5FD 2A74C 2CWPA 4P71A 4B3SQ 4TQUS 5FLMG 5GAHC 4UDUC 3J7AF 4DNTB 1B7YB 1NR4A 1KNAA 4N9TA 3K7AB 3FVQA 2RDGA 4GKJL 2MQHA 3GD7A 3J7A5 1NMGA 4LK1C 4WJ4A 5IP7G 3PIOA 2CHBD 1DM0B 1HNXQ 1A2TA 1STNA 3I70A 5M5XH 2H4OA 4EQNA 5CYUA 1IKLA 3QJYA 2EYFA 2IX3A 4HEDA 1BUVT 2QDBA 4RGOS 1QCBD 1PVOA 3N6RA 2F4VQ 1X9NA 2N3SA 2L15A 2B2TC 3LWEA 5CORA 5JEAJ 3I4NH 3SK5A 1RTNA 4B3RL 3EN2A 2JYOA 4A3FB 4CJ0B 2F0HA 3HP3A 3T1YL 1PTOB 3V96A 1HFGA 2EJGC 1N34L 1CFMA 3HOVG 5CV6A 1UNSA 2JA8H 2Y0SG 1JICA 3OSOA 4BY1H 4JV5Q 3I4LA 4IJHA 1EQRA 4ULLA 1U4PA 1AEXA 4DFAA 5IWAQ 4PZ7A 1HNWL 4S3SA 4X62Q 3ND8A 1GUTA 4A75A 1SYFA 2Q2TA 5G3LD 4GKKQ 5HY6A 2PI2A 1F77A 2UXCL 5AJ3Q 4FO2A 2QDLA 2EDGA 5L37A 2E5LL 2F0SA 3M4OH 4TVAB 5IGDA 2F4IA 2HIVA 4JV5L 1RKNA 3X3NA 3UDIA 2JP1A 4X64L 2WB1E 3RZOH 4FF2A 5IWAL 4LF4Q 1G6PA 1EQQA 3HOUH 4A3DG 4IUPA 4Q0FA 1WTOA 3FKIH 2C5CA 3TP5A 4A3KG 3PIPA 1GVPA 1LTGD 1CA6A 1BCPD 2ENBA 2N55A 2R3ZA 1EYGA 3Q22A 4EGVA 2SNMA 5DM73 1HR0Q 4JW0A 3S1NB 2JA7B 1JE4A 1SBBB 1OTCA 1PFMA 3U4ZA 4JBKA 2XIWA 2K05A 1XMOQ 3GTMB 2LSSA 4BA1I 1AE3A 1JJCB 2JA6H 1LUZA 1M8AA 3KBGA 3S2HH 1TY2A 4CHTB 1A3VA 3E3XA 1WD1A 1QVFA 2EJFC 3AFQA 4DKAC 1AE2A 2E74C 3OTOQ 4J6HA 2YTYA 4CGYB 4HMIA 1CSPA 2NB0A 1I4RA 5CGKA 3IAYA 1WCMG 4POFA 2QA4A 4N8FA 3HOXB 4QGUA 4HSVA 2K5WA 1UWVA 1TKWB 5C0XJ 3PF5A 3S2DB 1FJGQ 3BVZA 2Q2UA 3DMUA 4AQYQ 2FJ2A 4EVOA 3HOZH 3QIAA 3DHQA 5IT9L 3OTOL 2OEOA 3H0GH 3ULLA 1GUSA 3GV6A 4OX9Q 3IRBA 1Q82C 2A68C 4X66L 3T13A 4JYAQ 4H13C 2WIIB 3PIO3 3M7GA 3ERSX 5IODA 4LW1A 2K52A 5IYCH 3HGBA 5JEAH 1H9KA 4RAUC 3EIVA 1I4XA 1XJVA 1IBKQ 3MXNB 5CV7A 2LXJA 3CAMA 4C3IG 3SEBA 2B2TA 4OELB 1PDQA 3VR3A 4AQYL 2MO0A 2QCPX 3TRZA 5EPJA 2NVXB 4HIMA 4PMBA 2VQEQ 1UE6A 2KHSA 2VXWA 3K0XA 3IL8A 2HQLA 3E9IA 2R6GA 4X3UA 4B3TL 4DV5L 2RF4A 3KLSX 2A68D 5KEEA 3DM1A 4BY7B 1CUKA 1STBA 4DN4M 1WYDA 1LT3D 1BDOA 2HDLA 3C1EA 1HUMA 4B9WA 1UEBA 1UEAB 2DY8A 3BS1A 2K5VA 3BZKA 4RGTA 3GO5A 3K5LA 3PO3B 4WJWA 2UUBL 4FXDA 5IYDH 1I4PA 4KN7C 3VA5A 1CZGA 1GUNA 4DK3C 2KHIA 1MGSA 1RDPD 2YU9H 3I90A 3KLWA 1YHQA 4CKEA 3CCLA 4R9WA 1VCIA 3H94A 1TWHH 5M5YB 1STAA 1GO3E 4LJZC 4DGZA 2J7ZA 3VR6A 5M3FB 5IGGA 1CKOA 1K8OA 1HTLD 2CWAA 4OHJA 4DUYQ 1SFOB 3GTJB 2E2IH 4IUNA 3C2PA 2B2UC 3PGZA 1Q86C 5JJZA 3OOCA 2EYJA 3GQBA 1QZHA 2M00A 5C3EH 1XYIA 1QVCA 2QILA 3GTKH 3GTLH 4AYBB 1EUJA 5E7NA 3NTIA 3RR5A 5DAUA 1VQNA 2V1CC 1TVXA 3P1HA 1TWGB 4DV2L 2DN8A 2ZM6L 1I6VC 3OW7A 4A3FG 3TBIB 1SE8A 5C0XH 3T1HL 3A54A 4MIUA 1SNOA 1DGSA 3NBHB 1C0AA 3JAMi 4C2MH 3FEWX 1PRTF 2H1EA 1CA5A 2L11A 4JI5L 1VF5C 2WKDA 1OXUA 4P74A 3SGIA 3I4MH 2LY7A 1PTOD 1CI3M 1VQJA 3K59A 2WAQB 3PO2B 1EYCA 3G7LA 4HIOA 1E24A 2YTVA 1W2BA 1GOZA 3GTPB 3BU2A 1AP0A 4KHPL 4QCLA 1EY8A 1LTAD 2IT1A 2R7FA 1OXVA 3CMAA 1MJEA 2IY5B 3CQZB 4KK7A 3URYA 3AFPA 1CQVA 3PF4A 2K14A 3D6CA 3DEOA 1V1PA 2A19A 4LUVA 2F52A 1U4LA 1PH4A 1L1OC 4C3HB 4RA8A 5J1ZA 2IWHA 1CKNA 1YBYA 3E6ZX 5IYBG 3PUZA 1DCZA 3J81L 5JVH3 5D65A 1NJIC 1O80A 1YHBA 3MA2B 1CQFA 2LMCB 1EYAA 4KY6A 5GADC 2VB3X 4KY7A 5DM63 3IFTA 1F9QA 4IN3A 4RCNA 2EY2A 1ICWA 5CC4A 1E3PA 3HOWG 1VQ6A 2GN5A 3ND9A 4RGNA 2WINB 2IX0A 5ELCA 4OIJA 1GUWA 2SDFA 1GHJA 1UE5A 1O7LA 4LFBQ 5DNFA 3VR4A 1VQAA 1VQ5A 4ZQ3A 4DV1Q 2PMZB 3HOXG 1QJOA 2UUAL 2P5ZX 3CU7A 1SRUA 1Z9FA 5BN5A 3K80C 1PZKD 1ILPA 3W3AA 5ELBA 1JWSD 1QNUA 2B8FA 4NXNQ 2HQEA 3Q8DA 2MHVA 2B2UA 4DR5L 1ONLA 2NVTH 3AEVA 2RA4A 4FVMA 4GS3A 5LHY1 3A0JA 1QG7A 2WACA 3A55A 2BA1A 3J81E 1T5EA 2HCCA 3D4RA 3RN2A 3K58A 2A6HC 2UXDL 1FVIA 5I9OA 3SE0A 1X56A 2MP1A 4NXNL 1VQIA 2XGTA 4DR3Q 3AMUA 1IW7C 1EY6A 4XT3B 2EXDA 4RKBA 2PQEA 1XWEA 2JK8A 2NN6H 1HNZL 2RCNA 3WWVA 1PMRA 4C1NK 4L5QA 4ZUJA 1M90C 2EJMA 2I0QA 2MGSA 2NTSA 1XPRA 1B1ZA 4A3MB 1K83H 1RHPA 2B63B 2AWOA 1QB5D 1I5FA 2BCOA 4HIKA 4DAYB 2O5JC 4XXEA 1EFWA 4RCOA 2L4NA 1JWMD 1UE7A 4LF7L 5DLQE 1B9NA 2AKWB 4F87A 3MEHA 3D0FA 3NWSA 3TP7A 1C4QA 4GLVB 4DR7Q 4FF1A 2XRQD 5EQ0A 2LKVA 1JB3A 2A6HD 4JBJA 3R2IA 4LF9L 5E1FA 5C4JB 5LMNQ 4JI2L 3PO3G 2OT2A 2Z4IA 4C1NI 1IW7D 4JI7Q 3DUZA 1PH5A 3HOVB 1EFID 1NAPA 2JEAI 1E1TA 1ML0D 1EIYB 1JOQA 3TSSA 2RDFA 2FINB 1HR0W 2RDHA 1L1OA 1XX8A 1QE6A 3TDQA 5M3FG 1F9PA 3GTGB 3HKZB 4C3JB 4LF8Q 5LMNL 2FMCA 3KFUA 2RKSA 4BXXG 4IFDI 2Z6KC 4F8MA 1VQ7A 1HJPA 2PI2E 3T53B 5E4WC 2K1BA 1IBLL 5IOCA 4OO1I 5E3FA 2Q8TA 3F2BA 2RBMA 4JI3L 3F2CA 1LTID 2DJFC 2OQ0A 3T56B 3U4VA 5EBDA 5J39A 4AYBG 3J7YW 1D7QA 2OF1A 2J4XA 4JI8Q 4IFDH 4A3DB 3SDZA 4PMCA 3SK6A 4HIDA 4LMQD 4ZYSA 4A3GB 4OO1H 1ESFA 4ZK9B 1ENAA 3ONAB 5A2QL 3JC66 1KDBA 4KV6A 1XNQL 1HZAA 1WTVA 3OMGA 1PV4A 4CJ1B 3FMCA 1N36L 3L0OA 1PXUA 3H3VI 1KABA 1N32L 2R92H 2K4KA 1TXYA 2EYOA 1I3QH 4X3TA 4ZRZA 2DGYA 1C8CA 2WAQG 3PO2G 4A3JB 4LFAQ 1J9OA 2NVYH 1A6XA 4MTNA 1EZ8A 4IUUA 1EWHA 1KIXA 2WP8J 3TP6A 1TWFB 2F3IA 1R9TH 2F1MA 5JOBA 1RD9D 1SNDA 4PNYA 2ZJRA 1JB7A 3MWYW 1JR0D 1PH1A 2I5HA 3J80c 5CV4A 4A3LH 1H9SB 3QG1A 4DNRB 2RHSB 4C3HG 1M4VA 1SE3A 4GN5A 4ALPA 4JPBW 2X6LA 2KCNA 1EIHA 2IW3A 3I55A 1I50B 4DV6L 3SVMA 2F3WA 1XMQQ 1PRTB 5C5LA 1A3TA 3AYHB 5J22A 2PQAA 1VMCA 1FD7D 3RLNA 4BY1G 2AQ1B 4B9XA 3EA6A 2OWOA 4YHHQ 4RH6A 1ESRA 4HJ9A 5FLXE 1F2LA 3FP9A 2NUCA 2HHHL 3TQYA 4L5RC 4CKCA 3F8TA 3KDFB 3BZCA 2GVBA 2F0FA 4FXKC 3MFYA 4BBRH 4QIWE 1S3OA 4DF7A 1SAPA 1Y1VB 3PCOB 1BVSA 1STHA 5LMUQ 4B08A 4YCWA 2F0UA 3A7LA 2VQFQ 2FMMA 3L7ZC 3VYSA 5FJ8H 2Z6KA 4O1NA 4OONA 3S1QB 1NTGA 1F9RA 1PZJD 3BZDB 1IKMA 3KUPA 4GKJQ 3QOJA 5T1GA 1VQLA 2DNEA 1XTDA 1A8VA 2PW5A 3W2DA 2ZTEA 4KD3A 5M3MB 2PNHA 2IX1A 2VNUD 5LMUL 2XRSD 1PH2A 1WJJA 2E75C 2VQFL 2KOLA 1HZCA 1TWCH 2N49A 2NVQH 1WTQA 4CDDC 5M5WH 5EKIA 2PZWA 3K5MA 3S17H 1SJHD 4HSPA 4P2CB 2JA5H 4Z9CB 2ICIA 4M8AA 3M3YB 3L2PA 1B3AA 4B3RQ 2MFIA 2F0MA 4MNOA 2CFMA 3T1YQ 3KF8B 1KRSA 2G5DA 4A3BB 2M9VA 4A3MG 3S1RH 1N34Q 4ZCKA 2B63G 4BBSH 1BXTA 4APVA 2K5NA 5C4HA 1JC7A 2CW0D 4K5VA 3DWQA 4OEMB 1BQQT 3ULJA 4U68A 5CMDA 5C44B 1HNWQ 1CT1D 3IFDA 1WTHA 1Z6HA 3A8IE 4IPGA 1HFNA 4JI1Q 5IP9H 1HQMC 5IYCG 4G7HC 2UXCQ 3J81j 2K7VA 2E5LQ 4GNXB 2K32A 3HFZB 3U50C 4R4IA 1BCPC 2A69C 4KY5A 4X64Q 1SNMA 4A3IH 4DAPA 1MHWC 1SLJA 1JJGA 2B2VC 4LAAA 3HKZG 3LGJA 2KEEA 1B50A 4N9PA 4C3JG 4FDBA 4JI1L 1XTCD 4UY8C 3H15A 2WFWA 4DK6C 4ODGA 2E2HB 4IOAA 1SYGA 1STGA 3K0YA 3KLRA 4XT1B 3VR2A 3S16H 1Q7YC 1I6HH 3UE0A 4X3SA 3LNNA 2E2JH 3ITPA 5AFWA 4FF4A 1D5ZC 1IYUA 4A3GG 4Y7NH 1WTWA 2RSOA 4UP9A 3RLFA 3S9WA 1Y1WB 1WI5A 4JI0L 2ID0A 1ET9A 2A69D 1NCVA 1YVCA 3SK4A 4A93G 1J5EL 3NP8A 3TS2A 1LTRD 1LT4D 2UUCL 3CCVA 1KNEA 2DUDA 5CV8A 3Q0AA 3CC2A 2AMCB 3J80L 4RG1A 2PW7A 1EL0A 3A74A 1JT8A 3HOWB 2J0TD 2SOBA 2K5HA 2XVSA 1IL2A 1AZPA 4KHVA 1KQSA 2K04A 2YV5A 4A3JG 3H6MA 3M85A 5EPKA 4GOPB 3TP8A 4G4KA 4X66Q 2UU9L 4MZ9A 1HHVA 2RHQB 1GD7A 2VB2X 1Q8IA 4HMJA 2VW9A 2ZJQA 1LV9A 4UP7A 3J81c 3M4YA 1D5MC 3CCEA 1STEA 1VQGA 3JAME 3NQIA 1SMYD 4P72A 4DA2A 3CF5A 2VUMB 2RSNA 5IP7H 1EYDA 3RUZA 4L63B 4JK1C 4I65A 2EY6A 4A3CG 5C4XB 3ICEA 4NPSA 1RTOA 1MBYA 4NXML 2LFNA 1C48A 3DLLA 2KECA 1HTPA 1K3RA 3OPOA 5LMNW 3CRLC 1O7IA 2CQOA 4B3TQ 5FKAC 4OWXB 4DV5Q 1EIFA 2D5DA 1X54A 2EZVA 4V0BA 1V43A 4ABNA 1QUQA 2K5DA 4IO9A 3J80E 3CD6A 2QGQA 4IUQA 1IXRA 3BDLA 3SK8A 5FO9B 1AZQA 1AW7A 3GV3A 3SR1A 2F0OA 1CHPD 4K0KL 4IUTA 1PRTD 1HCZA 1SE2A 2ALYB 1BNZA 4XQNA 2B2YC 3N52A 2UUBQ 4PV1C 3G48A 5G3LF 3K6OA 1Y1VG 1OXSC 1W6KA 3KK7A 2B2VA 1HH2P 3KF6A 5BN3A 3S1MH 2JXMB 2NTTA 3R2TA 3S14H 2CH4W 1BOSA 1K8MA 1EWIA 1HZ9A 3NELA 4O0AA 1STYA 1SE4A 4NKLA 5BN4A 1AN8A 2R7ZH 1MIUA 4R4OA 3CHBD 1SYCA 2L55A 1D5XC 1Y8NB 1SMXA 5M3MG 1DXMA 1SSOA 4Q5VA 1GUGA 4H02A 1LTSD 1IYJB 4H7BA 3I2ZA 1EY9A 4YY3L 1DOMA 3S15H 4A3EB 1Q90A 4A3KH 2EY1A 2R93B 1K73C 3BG3A 4DV2Q 2HD3A 5IGFA 3QOLA 2ZM6Q 2A8VA 4M1UB 2Z6BA 1EOTA 1KDCA 2L12A 4DV7L 3T1HQ 1CK1A 1KL9A 1BF4A 4IZ8A 5HGTA 1PTOC 2XNAC 2O5IC 4A3BG 3NUCA 4F88A 4FXGC 1D2BA 5C0XI 3GTQB 3HOYB 1NE3A 4AIMA 1YZ6A 4QY7A 2F0QA 4GNXC 2F0LA 4JI5Q 2VZAA 2V4DA 2TMPA 1TWAB 3GTOB 5C44G 2KCMA 2L1BA 1YHAA 1WCMH 5GROA 3C3LA 1Y8OB 1J6QA 2Z1CA 5KNCA 4GN3B 3PUXA 3QWNA 1R4PB 4HJ5A 4KHPQ 3UDXA 4TRDA 1X3PA 5C3XA 1SDFA 3VYUA 1CKMA 1X65A 3CCMA 2UXBL 4I7AA 1KRTA 2OQKA 1VQHA 5A35A 2NBFA 4JC0A 3U58A 1Q46A 3TS0A 5M5XB 4IOCA 4C3IH 3EFXD 4JI4L 1B44D 1W6JA 1N33L 2ZTCA 4PMWA 4CKBA 2DNCA 4B3ML 3I4NB 3FPPA 3PV0A 1TS5A 3I56A 5FLXc 2B2YA 1Y1WG 1CZWA 4BA2I 2RCFA 3RZDH 4OWWB 1E22A 5KYLA 2F0KA 2AQ2B 2JA8B 1A0IA 4GN4B 1TY0A 1X6OA 5BR8L 4TKOB 4HTHA 1UUPA 4BY1B 4XYQA 3R8BA 2UUAQ 3TMEA 4P75A 3S24A 1DONA 2KBNA 4DK0A 3GP7A 1QZGA 1PFBA 2CVRA 4HCEA 1FL0A 4DR5Q 4ZKBB 1ET6A 1GUOA 1DZ1A 3UE1A 1MKHA 3M4OB 5CV9A 1NUCA 3NSWA 3RZOB 1V1OA 1A63A 3K7AH 3HOUB 1EZ6A 2UXDQ 1TIID 3RLOA 3UDFA 3OIQA 3E9HA 2XN9C 3FKIB 2NZHA 2VUMG 3ULPA 4R4QA 4MTKA 1D8LA 4KKTA 1K0SA 4MN3A 5C4XG 1HNZQ 3C46A 2K03A 1E7ZA 1U0LA 2NN6I 4X6AH 4GNXA 4HN7A 2G9HD 2IHEA 1OXTA 1BBXC 2JA6B 4DR1L 1YNJC 1JMCA 3KJPA 3I8ZA 3BYYB 3J7ZC 4LF5L 4LF7Q 2ICEC 4A3FH 1RL2A 5GAGC 2EE1A 2ZTDA 3K5NA 3QB3A 1VQOA 3FPUB 1PTOH 1O7ZA 1G8ZD 2ZJPA 2AQ3B 2KA7A 4LF9Q 4XYOA 1FNVA 4JI2Q 2EXZA 5IGEA 4YIJA 1F2MA 5EGTA 4IURA 1EU4A 1SYDA 3NWTA 1DD2A 1I4QA 1A3UA 1U5KA 4IQZA 1P8LA 2IPKD 3KBXA 5K5PA 2Z9HA 3HOZB 3H0GB 4LFCL 5C4ZA 4K8JA 2E2HH 1YNJD 1IBMQ 1CHQD 1IHZA 5ELEA 3TZUA 2OTJA 1KAAA 1D1IA 1IBLQ 3TEHB 4EX5A 3KYHC 5LL6S 4JI3Q 2I5MX 3CC7A 4C56C 1X3QA 5K36G 2A6EC 4ME3A 1SJED 2LS01 2Q2IA 4A3EG 1YJWA 3EVQA 2KCCA 2VS1A 4XTCS 3ZJYC 2D0PA 2QKIC 2R93G 5TSSA 1IBML 3LWUA 4X65L 4K14A 4R4TA 1HRJA 1LACA 4GLXA 3CCUA 3S1NH 2JA7H 3PQIA 1XNQQ 1DYQA 1HA5A 5M9OA 4JBWA 3GTMH 3VYTA 4ZKCB 2B29A 4IJLA 3NK9A 2OXPA 1N36Q 1VQMA 3HOYG 3HOWH 3M4PA 4IPDA 5JPMC 3NENA 1A15A 4WJ3M 2PNRC 1N32Q 2WV6D 5NUCA 5HURA 2O4XA 1B2TA 1LABA 5F2DA 4K5WA 2A6ED 2BE5C 5D3DA 4ID6A 4A93B 1MD2D 4XIGS 2IJ0A 1PH8A 5JPNC 3HOXH 2BDNA 4DAVA 2YU9B 1O78A 1FGBD 1ICFB 4LUOA 2TSSA 3MXNA 1KLGD 2E8GA 3G4SA 2I46A 2R61A 3JAMc 3PUVA 3S2DH 1TWHB 1Y14B 1RF2D 1ASYA 3LX0A 4YWMA 1VQEA 5FLXL 1QNKA 1ASZA 4DUZQ 1XXGA 2JA5G 4PZ6A 3HS0C 4GZYC 2EYPA 5IY0A 2C9OA 1N8RC 1RJTA 2E2IB 3CMEA 5KNDA 4IALA 4I7ZC 3I3CA 4DV6Q 4KJOA 3NTKA 5C3EB 5IIFA 1BO0A 3GTLB 3GTKB 2Q8IB 2BE5D 2QEJC 3CPFA 4DPGA 1BR9A 2HDMA 4QF4A 3U9OA 2NVXH 4DUZL 1VQ8A 1VQKA 2EYLA 3I4NG 3BVGA 2F0JA 3PUYA 3HZXA 4KTAA 3J81i 3CCJA 3C1FA 4R8NA 3PUWA 2XWJB 4NW2A 2HHHQ 2BH8A 3P7JA 1A2UA 2IL8A 4J8QA 1OO9B 3HKSA 2F03A 4C2MB 2JA8G 2Y0SE 1TS4A 4BY7H 3T16A 2EIFA 5JAVA 3OHXC 1U4MA 1K0RA 1X32A 3MFGA 4MHEA 4O42A 3STBD 3I4MB 2OTLA 4YWLA 3I72A 5EBCA 4LUZA 3I91A 1A62A 3PO3H 3L3OC 5JJKA 4DR6L 3V05A 4PQXA 5FO7B 3FRPB 3A5ZB 1VF7A 3K8AA 3T4AC 4DR2L 5M5YH 4AH6A 3MVVA 3VYRA 2DJGC 5M3FH 1JJ2A 1SR3A 1Q1BA 3HOUG 1H95A 4DV0L 1FNWA 5D14A 4LF6L 3CC4A 4BXXH 1HQRD 1Q8KA 1E0BA 3FKIG 2YTXA 5GQOA 1SFOH 3GTJH 3DEPA 3GDEA 1JORA 1YNND 5JVG3 4G57A 4J15A 1YJNA 2XWBB 2K28A 2CW0C 1EOVA 3NQTA 2NYZD 2ZXOA 1R4QB 3NBHA 2Z8LA 1V1PB 1B53A 3QO2A 2WB1B 3M4QA 1L2FA 1B70B 4A76A 5JJLA 2JA6G 3AB9A 3I7FA 2RVLA 3RMHA 5H1SE 1TWGH 4IPCA 1C9OA 2M2LA 1YIJA 4JI6Q 1CKNB 4KD4A 3MHBA 1BBWA 1F9SA 2F3VA 3KLSA 1U4RA 1VQ4A 2AWNA 1VQ9A 1P16A 4DR4L 3OWEB 2F0WA 3A8KE 2B3GA 1VQDA 3RN5A 1PYBA 4QJFA 3OIPA 1WTXA 2Z4HA 2PCFB 3A8JE 1JOOA 4JI6L 1WTPA 3PO2H 1Z7TA 3M7NA 4QUFA 3HOZG 2K01A 4DV3L 3H0GG 4U673 3GTPH 2NVTB 3BVMA 1HXYD 4QB4A 5T1IA 2FHTA 4PG3A 1I4HA 4B3SL 3CQZH 5JEAG 1YITA 1X3GA 1TS3A 1JOKA 1EEID 3D3RA 4C3HH 2F0GA 5I2XA 5KYIA 4KLKA 1EY4A 2EOTA 1HNXL 3NE5B 2JJQA 2JSOA 5EJWA 4FNFA 1B3QA 1CM9A 4JI0Q 3TREA 4OXPA 1LT6D 2F4VL 1K83B 3JAML 1J5EQ 1EU3A 4TSSA 2UUCQ 1KXLA 1I94Q 5ISRA 1YNXA 5FOBB 1T9HA 2SEBD 3AQQA 4K6LA 2JEBI 3CKIB 4JCVE 3DWPA 4ZAIA 4K2KA 1X3EA 2ATWA 1RCVD 3ZYYX 2R7ZG 3Q24A 5IYDG 1SMYC 1VQBA 1E2WA 2NZ1D 1G51A 5I6YA 2Z0SA 4K6DA 4L8JA 2UU9Q 3DXJC 1TS2A 2H5XA 1I94L 3MAQA 4X62L 1SNQA 4RHRA 4BS9A 1WOCA 4IUVA 4OL7A 3G6EA 4G7OC 2K33A 4EQ5A 4GKKL 1F2ZA 2G9DA 3MTSA 4PZ8A 5AJ3L 1MJCA 1Q3LA 3K81C 3F2DA 1S5BD 3D6WA 4NXMQ 3Q23A 4LF4L 3SHLA 5FLMH 1LTLA 1SXTA 3HEJA 4G7ZC 5C3EG 1L1OB 1PRTC 1ENFA 1F2YA 4DAYA 3R93A 4UPAA 2NZOA 5I9PA 2A5HA 2SNSA 1Y69U 4HCSA 5CV5A 5C6AA 3CCSA 1CSQA 1TR5A 3T51B 3WOEA 1HR0L 3NHHA 1B8AA 4ILWA 4DK1A 1T5XD 1FYCA 4K0KQ 5C0XG 3K5OA 1XMOL 1NMFA 4A3MH 4XQJA 3VR5A 5ELOA 3WDNA 2B63H 2K6AA 1K3BC 1X55A 2EY5A 1S5CD 4NDXA 2F0PA 3CP0A 1D6EC 1NY4A 4UP8A 3K7UC 4HJ8A 1G2TA 1SROA 2R92B 2CQAA 3CXCA 2I5LX 1VDZA 1I3QB 3I4MG 1DOLA 1XPUA 5FK9C 4RHSA 1IZ6A 5E4XA 5C4JH 3NPPA 3X3MA 3MC0B 2K75A 2NVYB 5IGBA 3HOVH 2EQSA 1WD0A 2F0DA 3U9SA 1V9PA 2FXQA 4ME5A 2B2WC 1R9TB 2CH4A 2HUGA 3QR8A 1FJGL 3HRZC 4E6IA 1SYEA 3H09A 2Q2HA 4CDEC 4OX9L 3GTGH 1HPCA 4C3JH 4JYAL 1O7YA 2F0VA 2L0CA 4YY3Q 3EBEA 4Y52H 1D1KA 1G2SA 1MSGA 2ES2A 1OXXK 3E0JA 1IBKL 1NSNS 1H9RA 5EKLA 1FR3A 4DV7Q 4CBVA 1BCPF 2PYKA 2WB1G 1Y8PB 1MI2A 4A3DH 3BDOA 4A3GH 3KOJA 2VQEL 2AUKA 1QILA 5KIXA 1V8QA 4RMFA 5IT9E 1E2ZA 1H9MA 1G91A 4A93H 1EQTA 2B8GA 4UHVA 1PFNA 1AFPA 3W1GA 4FYDA 3PMFA 4O2DA 2FFKB 4BBRB 2PQAB 1M1KC 1LTBD 3F1ZA 1II3A 2F0IA 3MZ5A 3ERQA 3VA7A 1EY7A 2EVBA 2X6GA 1H9SA 2K50A 5ELDA 1KLUD 5D3IB 3MXPA 3PIP3 4A3JH 4LWCA 1V1QA 4OGQC 3W5OA 2CCZA 3F2UA 4JOIC 2X69A 2D0OA 3CW2C 2UXBQ 5KRUA 1TWFH 1UAPA 2MJ8A 4HAEA 1VQFA 4WRDA 4DXFA 1SYBA 2OCEA 3HG9A 2K5QA 1NNXA 1TWCB 1J8IA 4JI4Q 4DUYL 1MSHA 2NVQB 1EY0A 1N33Q 2Q8RE 3E0EA 5M5WB 4RKLA 1K8GA 3S17B 4V190 4A3CH 1WVLA 1K9MC 4B3MQ 2JA5B 3TZDA 4JVZA 2BA0A 2NN6G 1I50H 1PFSA 4K2LA 3KDFA 2HIXA 5IE8A 1ZEQX 2LXKA 5I2YA 1LLRD 4YCUA 3S1RB 5C3WA 2KUMA 2D9UA 1KTKA 3P75A 3BDCA 4BBSB 1E1OA 1ZKOA 1GM5A 4KHZA 3E5SA 4RGMA 5BR8Q 1ZYRC 5EAYA 4YCVA 1CTMA 4L5SA 1G291 2VL6A 4QUCA 3J7AV 5JJIA 1UE1A 4FP5D 2B2WA 3EQLC 1NBWA 1Y1VH 1WFQA 4R1JA 5I6WA 4GOPC 2D2CC 3A56A 3J80i 4QMGA 2BOSA 3B6YA 4RFBA 5EPLA 2JA9A 2O2LD 4K8IA 1PH7A 4KMUC 3O13A 2KJXA 3UDGA 3S1QH 4A3IB 5LL6X 1XNRQ 2ZXPA 4CDFC 5EKKA 1EWCA 2BDOA 3CCRA 4FF3A 1PYWD 3PSIA 2KENA 3WOFA 1ZYRD 1EQVA 2KQ3A 5M3MH 5CR3A 2JA7G 1HA6A 3H91A 2R7DA 3KF8A 3S16B 2RQXA 2GVAA 1I6HB 3FHWA 1PHJA 1GHKA 4AYBE 2JN4A 2PO4A 2N88A 5ELNA 1YEZA 2E2JB 1XNRL 1W3SA 3K57A 4IFDG 2F0NA 3CCQA 1H9JA 4Y7NB 4DR1Q 4DU9A 3M3YH 3NTHA 1S4ZA 3V2TA 4OO1G 3CRKC 4LF5Q 1PLFA 1E2VA 1G6ZA 1SN8A 4OIKA 3A5UA 4IFDJ 4JBMA 3FDTA 5DEHA 5FO8B 4A3BH 4JG2A 4NB3A 1Q12A 4ZUIA 2DY7A 3H3VC 4DV4Q 3D8GA 2F0TA 1GKHA 2PZUA 1GXDC 1JWUD 4WFN3 2R92G 3S2HB 5C44H 4JOIA 2JE6I 4LFBL 5HGQA 2WAQE 3IKJA 4DNIA 4LFCQ 4DV1L 1PTOF 3MXUA 1I4GA 4P73A 4DV4L 1RODA 4J1MA 3D4DA 2MNAA 4EQOA 5GAEC 3OW2A 2N78A 1B9MA 4K5XA 1LYLA 1L0XB 4A3LG 1PYSB 5J3BA 3G71A 1KD1C 1VQCA 4BWGB 1U9RA 3MEFA 2A1AA 1S40A 2YYZA 4F7XA 4A4IA 4X65Q 1DJRD 1QVGA 2L9HA
chains in the Genus database with same CATH topology
3P20A 3D4WA 4DXGA 4NP5A 5CBEE 2KEDA 1ILQA 2GA4B 1JCKB 1TQOA 2NWGA 3RD4A 3Q6SA 1LT5D 1NR2A 1EIGA 2ZT9C 1TT2A 2MPMA 5KGUA 2Y0SB 1QWYA 1ZXTA 3UI2A 1EEFD 2F0EA 3AU7A 3S1MB 4KI0A 1Z47A 3S14B 1L0YB 5KNBA 2PPBC 1KDAA 3NXWA 4EQPA 2E76C 2R7ZB 4KKSA 3EJIA 4QIWB 3BYTB 1BCPB 2AUJD 3OWFA 2QF7A 3S15B 4KKUA 2HCIA 1GJXA 4A3KB 5IGCA 1EY5A 1IYVA 4ZLTF 5CBAE 1SNPA 5COYA 1VMPA 2KVMA 4KN4C 5C5MA 4XQQA 1PZID 2EYHA 2WKCA 3TN2A 2L5TA 3D31A 3A7AB 1FNUA 4NMZA 3I73A 1DOKA 1WCMB 4XDXA 2B39A 3L9AX 1IL8A 1HUNA 4RWSC 4H44C 1WTRA 1ENCA 4CJ2C 1JQYD 1YNNC 3R3OA 2EYMA 3G6JB 1QOHA 2I07B 5A2QE 2D62A 2EPBA 1S5DD 4UAIA 1Q1EA 4C3IB 1B4OA 5K36H 3SXHA 2MUYA 1LO5D 2XSCA 2A73B 5I4DA 2PZTA 3MXGA 3OMCA 2E2DC 4L6TB 3RZDB 4KJNA 4H0LC 3NBIA 4HR7B 4WORA 1TU2B 2ZXRA 5ELFA 1LTTD 4R8IA 1S5ED 4X3KA 3EROA 1SEBD 3DWAA 1SNCA 1S5FD 2A74C 4TQUS 4UDUC 3J7AF 4DNTB 1NR4A 1KNAA 4N9TA 3K7AB 3FVQA 2RDGA 3GD7A 4LK1C 2CHBD 1DM0B 1A2TA 1STNA 3I70A 2H4OA 4EQNA 5CYUA 1IKLA 3QJYA 2EYFA 2IX3A 4HEDA 1BUVT 2QDBA 4RGOS 1QCBD 3N6RA 2B2TC 3LWEA 5CORA 5JEAJ 3SK5A 1RTNA 2JYOA 4A3FB 4CJ0B 2F0HA 3HP3A 1PTOB 3V96A 1HFGA 2EJGC 1CFMA 5CV6A 1UNSA 1JICA 3OSOA 3I4LA 4ULLA 1U4PA 1AEXA 4DFAA 4S3SA 3ND8A 1GUTA 1SYFA 5G3LD 1F77A 4FO2A 2EDGA 2F0SA 5IGDA 2F4IA 1RKNA 3X3NA 2JP1A 4FF2A 4IUPA 4Q0FA 1WTOA 2C5CA 3TP5A 1LTGD 1CA6A 1BCPD 2ENBA 2N55A 2R3ZA 3Q22A 4EGVA 2SNMA 5DM73 3S1NB 2JA7B 1JE4A 1SBBB 1PFMA 2XIWA 2K05A 3GTMB 4BA1I 1M8AA 3KBGA 1TY2A 4CHTB 1A3VA 1WD1A 2EJFC 2E74C 4J6HA 4CGYB 4HMIA 2NB0A 1I4RA 5CGKA 3IAYA 3HOXB 4HSVA 2K5WA 1TKWB 5C0XJ 3S2DB 3BVZA 3DMUA 2FJ2A 4EVOA 3QIAA 3DHQA 5IT9L 2OEOA 1GUSA 3GV6A 2A68C 3T13A 4H13C 2WIIB 3PIO3 3M7GA 5IODA 3HGBA 5JEAH 1H9KA 4RAUC 1I4XA 5CV7A 4C3IG 3SEBA 2B2TA 1PDQA 3VR3A 2QCPX 5EPJA 2NVXB 4PMBA 2KHSA 2VXWA 3IL8A 2R6GA 4X3UA 3KLSX 2A68D 5KEEA 3DM1A 4BY7B 1STBA 4DN4M 1LT3D 1BDOA 2HDLA 3C1EA 1HUMA 4B9WA 1UEAB 2DY8A 3BS1A 3K5LA 4RGTA 3GO5A 3PO3B 4WJWA 4FXDA 1I4PA 4KN7C 3VA5A 1CZGA 1GUNA 1MGSA 1RDPD 3I90A 4CKEA 4R9WA 1VCIA 3H94A 5M5YB 1STAA 4LJZC 4DGZA 2J7ZA 3VR6A 5M3FB 5IGGA 1K8OA 1HTLD 4OHJA 1SFOB 3GTJB 4IUNA 3C2PA 2B2UC 5JJZA 3OOCA 2EYJA 3GQBA 2M00A 1XYIA 2QILA 4AYBB 3NTIA 5DAUA 1TVXA 3P1HA 1TWGB 2DN8A 1I6VC 3OW7A 3TBIB 5C0XH 3A54A 4MIUA 1SNOA 3FEWX 1PRTF 2H1EA 1CA5A 2L11A 1VF5C 2WKDA 1OXUA 2LY7A 1PTOD 1CI3M 3K59A 2WAQB 3PO2B 1EYCA 3G7LA 1GOZA 3GTPB 1AP0A 4QCLA 1EY8A 1LTAD 2IT1A 1OXVA 3CQZB 4KK7A 3URYA 1CQVA 3D6CA 3DEOA 1V1PA 1U4LA 4C3HB 4RA8A 5J1ZA 2IWHA 3E6ZX 3PUZA 1DCZA 3J81L 5JVH3 5D65A 1O80A 3MA2B 1CQFA 2LMCB 1EYAA 4KY6A 2VB3X 4KY7A 5DM63 3IFTA 1F9QA 4IN3A 4RCNA 2EY2A 1ICWA 5CC4A 3ND9A 4RGNA 2WINB 2IX0A 5ELCA 4OIJA 1GUWA 2SDFA 1GHJA 1O7LA 5DNFA 3VR4A 4ZQ3A 2PMZB 1QJOA 3CU7A 5BN5A 1PZKD 1ILPA 3W3AA 5ELBA 1JWSD 1QNUA 2B8FA 2HQEA 2MHVA 2B2UA 1ONLA 2RA4A 4FVMA 5LHY1 1QG7A 2WACA 3A55A 2BA1A 3J81E 1T5EA 2HCCA 3D4RA 3K58A 2A6HC 5I9OA 3SE0A 2MP1A 3AMUA 1IW7C 1EY6A 4XT3B 4RKBA 2PQEA 1XWEA 2NN6H 1PMRA 4C1NK 4ZUJA 2EJMA 2MGSA 2NTSA 1B1ZA 4A3MB 1RHPA 2B63B 2AWOA 1QB5D 2BCOA 2O5JC 4XXEA 4RCOA 2L4NA 1JWMD 1B9NA 4F87A 3MEHA 3NWSA 3TP7A 1C4QA 4FF1A 2XRQD 5EQ0A 2LKVA 1JB3A 2A6HD 3R2IA 5E1FA 5C4JB 2OT2A 2Z4IA 4C1NI 1IW7D 3DUZA 3HOVB 1EFID 1NAPA 2JEAI 1ML0D 1JOQA 3TSSA 2RDFA 2FINB 2RDHA 1XX8A 1QE6A 3TDQA 1F9PA 3GTGB 3HKZB 4C3JB 2FMCA 2RKSA 4IFDI 4F8MA 3T53B 5E4WC 2K1BA 5IOCA 4OO1I 5E3FA 2Q8TA 2RBMA 1LTID 3T56B 5EBDA 5J39A 3J7YW 2OF1A 2J4XA 4A3DB 4IFDH 3SDZA 4PMCA 3SK6A 4LMQD 4ZYSA 4A3GB 4OO1H 1ESFA 4ZK9B 1ENAA 3ONAB 5A2QL 1KDBA 4KV6A 1WTVA 3OMGA 4CJ1B 3FMCA 1PXUA 1KABA 2EYOA 4X3TA 4ZRZA 1C8CA 4A3JB 1J9OA 1A6XA 1EZ8A 4IUUA 1EWHA 2WP8J 3TP6A 1TWFB 2F1MA 5JOBA 1RD9D 1SNDA 4PNYA 3MWYW 1JR0D 5CV4A 1H9SB 3QG1A 4DNRB 4C3HG 1M4VA 1SE3A 2X6LA 2KCNA 1EIHA 2IW3A 1I50B 3SVMA 2F3WA 1PRTB 5C5LA 1A3TA 5J22A 1VMCA 1FD7D 2AQ1B 4B9XA 3EA6A 4RH6A 1ESRA 5FLXE 1F2LA 2NUCA 4CKCA 2F0FA 4FXKC 3MFYA 4DF7A 1SAPA 1Y1VB 1STHA 4B08A 2F0UA 3A7LA 2FMMA 3L7ZC 3VYSA 4O1NA 3S1QB 1F9RA 1PZJD 3BZDB 1IKMA 3KUPA 3QOJA 5T1GA 2DNEA 2PW5A 3W2DA 4KD3A 5M3MB 2IX1A 2VNUD 2XRSD 2E75C 2KOLA 1WTQA 5EKIA 2PZWA 3K5MA 1SJHD 4HSPA 4P2CB 4Z9CB 2ICIA 4M8AA 3M3YB 1B3AA 2F0MA 4A3BB 2M9VA 1BXTA 5C4HA 1JC7A 2CW0D 4K5VA 3DWQA 1BQQT 4U68A 5CMDA 5C44B 1CT1D 3IFDA 1Z6HA 3A8IE 1HFNA 1HQMC 4G7HC 2K7VA 2K32A 1BCPC 2A69C 4KY5A 1SNMA 4DAPA 2B2VC 4LAAA 2KEEA 1B50A 4N9PA 4C3JG 1XTCD 4ODGA 2E2HB 1SYGA 1STGA 3K0YA 3KLRA 4XT1B 3VR2A 4X3SA 3LNNA 3ITPA 5AFWA 4FF4A 1D5ZC 1IYUA 1WTWA 2RSOA 3RLFA 3S9WA 1Y1WB 2ID0A 1ET9A 2A69D 1NCVA 3SK4A 3NP8A 1LTRD 1LT4D 1KNEA 5CV8A 3Q0AA 3J80L 2PW7A 1EL0A 3HOWB 2J0TD 2SOBA 2XVSA 1AZPA 4KHVA 2K04A 3H6MA 3M85A 5EPKA 3TP8A 4G4KA 1HHVA 2VB2X 1Q8IA 4HMJA 1LV9A 3M4YA 1D5MC 1STEA 3JAME 3NQIA 1SMYD 4DA2A 2VUMB 2RSNA 1EYDA 3RUZA 4L63B 4JK1C 4I65A 2EY6A 5C4XB 1RTOA 1MBYA 2LFNA 1C48A 2KECA 1HTPA 3OPOA 3CRLC 5FKAC 2D5DA 2EZVA 4V0BA 1V43A 4ABNA 2K5DA 3J80E 4IUQA 3BDLA 3SK8A 5FO9B 1AZQA 1AW7A 3GV3A 3SR1A 2F0OA 1CHPD 4IUTA 1PRTD 1HCZA 1SE2A 1BNZA 4XQNA 2B2YC 3N52A 4PV1C 5G3LF 3K6OA 1OXSC 1W6KA 3KK7A 2B2VA 5BN3A 2JXMB 2NTTA 3R2TA 1BOSA 1K8MA 1STYA 1SE4A 4NKLA 5BN4A 1AN8A 3CHBD 1SYCA 2L55A 1D5XC 1Y8NB 1DXMA 1SSOA 4Q5VA 1GUGA 1LTSD 4H7BA 1EY9A 1DOMA 4A3EB 1Q90A 2EY1A 2R93B 3BG3A 5IGFA 3QOLA 4M1UB 1EOTA 1KDCA 2L12A 1CK1A 1BF4A 4IZ8A 5HGTA 1PTOC 2XNAC 2O5IC 3NUCA 4F88A 4FXGC 1D2BA 5C0XI 3GTQB 3HOYB 2F0QA 2F0LA 2V4DA 2TMPA 1TWAB 3GTOB 2L1BA 3C3LA 1Y8OB 2Z1CA 5KNCA 3PUXA 3QWNA 1R4PB 4TRDA 1X3PA 5C3XA 1SDFA 3VYUA 5A35A 2NBFA 5M5XB 3EFXD 1B44D 1W6JA 4PMWA 4CKBA 2DNCA 3I4NB 3FPPA 3PV0A 1TS5A 2B2YA 1CZWA 4BA2I 5KYLA 2F0KA 2AQ2B 2JA8B 1TY0A 4TKOB 4HTHA 1UUPA 4BY1B 4XYQA 3R8BA 3TMEA 1DONA 4DK0A 3GP7A 1PFBA 2CVRA 4HCEA 4ZKBB 1ET6A 1GUOA 1DZ1A 3M4OB 5CV9A 1NUCA 3NSWA 3RZOB 1V1OA 3HOUB 1EZ6A 1TIID 3OIQA 2XN9C 3FKIB 4KKTA 4MN3A 3C46A 2K03A 2NN6I 4HN7A 2G9HD 1OXTA 1BBXC 2JA6B 1YNJC 3I8ZA 3BYYB 2ICEC 2EE1A 3K5NA 3QB3A 3FPUB 1PTOH 1O7ZA 1G8ZD 2AQ3B 2KA7A 4XYOA 1FNVA 2EXZA 5IGEA 4YIJA 1F2MA 5EGTA 4IURA 1EU4A 1SYDA 3NWTA 1DD2A 1I4QA 1A3UA 4IQZA 2IPKD 3KBXA 5K5PA 3HOZB 3H0GB 5C4ZA 4K8JA 1YNJD 1CHQD 1IHZA 5ELEA 3TZUA 1KAAA 1D1IA 5LL6S 4C56C 1X3QA 5K36G 2A6EC 1SJED 2LS01 3EVQA 2KCCA 4XTCS 2QKIC 5TSSA 3LWUA 4K14A 1HRJA 1LACA 1DYQA 1HA5A 5M9OA 4JBWA 3VYTA 4ZKCB 3NK9A 2OXPA 5JPMC 1A15A 2PNRC 2WV6D 5NUCA 5HURA 2O4XA 1B2TA 1LABA 5F2DA 4K5WA 2A6ED 2BE5C 5D3DA 4ID6A 4A93B 1MD2D 4XIGS 2IJ0A 5JPNC 2BDNA 4DAVA 2YU9B 1O78A 1FGBD 2TSSA 3MXNA 1KLGD 2I46A 2R61A 3PUVA 1TWHB 1RF2D 3LX0A 5FLXL 1QNKA 1XXGA 3HS0C 4GZYC 2EYPA 2C9OA 1RJTA 2E2IB 5KNDA 4IALA 4I7ZC 3I3CA 4KJOA 3NTKA 5C3EB 5IIFA 1BO0A 3GTLB 3GTKB 2Q8IB 2BE5D 2QEJC 1BR9A 2HDMA 4QF4A 3U9OA 2EYLA 3BVGA 2F0JA 3PUYA 3HZXA 4KTAA 3C1FA 4R8NA 3PUWA 2XWJB 4NW2A 3P7JA 1A2UA 2IL8A 4J8QA 1OO9B 2F03A 4C2MB 1TS4A 3T16A 5JAVA 3OHXC 1U4MA 1X32A 3MFGA 4MHEA 4O42A 3I4MB 3I72A 5EBCA 3I91A 3L3OC 3V05A 4PQXA 5FO7B 3FRPB 1VF7A 3T4AC 3MVVA 3VYRA 1Q1BA 1FNWA 5D14A 1HQRD 1E0BA 3DEPA 1JORA 1YNND 5JVG3 4G57A 2XWBB 2K28A 2CW0C 3NQTA 2NYZD 2ZXOA 1R4QB 3NBHA 2Z8LA 1V1PB 1B53A 3QO2A 2WB1B 3AB9A 2RVLA 3RMHA 2M2LA 4KD4A 3MHBA 1F9SA 2F3VA 3KLSA 1U4RA 2AWNA 3OWEB 2F0WA 3A8KE 3OIPA 1WTXA 2Z4HA 2PCFB 3A8JE 1JOOA 1WTPA 1Z7TA 3M7NA 4QUFA 2K01A 4U673 2NVTB 3BVMA 1HXYD 4QB4A 5T1IA 2FHTA 1I4HA 5JEAG 1TS3A 1JOKA 1EEID 3D3RA 2F0GA 5I2XA 5KYIA 1EY4A 2EOTA 3NE5B 2JSOA 5EJWA 4FNFA 1CM9A 1LT6D 1K83B 3JAML 1EU3A 4TSSA 5ISRA 5FOBB 2SEBD 4K6LA 2JEBI 3CKIB 3DWPA 4ZAIA 4K2KA 1RCVD 3ZYYX 3Q24A 1SMYC 1E2WA 2NZ1D 5I6YA 4K6DA 4L8JA 3DXJC 1TS2A 3MAQA 1SNQA 4RHRA 4BS9A 4IUVA 4OL7A 4G7OC 2K33A 1F2ZA 2G9DA 3MTSA 1Q3LA 1S5BD 3D6WA 3Q23A 3SHLA 1SXTA 3HEJA 4G7ZC 1PRTC 1ENFA 1F2YA 4DAYA 3R93A 5I9PA 2A5HA 2SNSA 1Y69U 4HCSA 5CV5A 5C6AA 1TR5A 3T51B 3WOEA 3NHHA 4ILWA 4DK1A 1T5XD 1FYCA 5C0XG 3K5OA 4XQJA 3VR5A 3WDNA 2K6AA 2EY5A 4NDXA 1S5CD 2F0PA 1D6EC 1G2TA 2R92B 2CQAA 1VDZA 1I3QB 1DOLA 5FK9C 4RHSA 5E4XA 3NPPA 3X3MA 3MC0B 2NVYB 5IGBA 1WD0A 2F0DA 3U9SA 4ME5A 2B2WC 1R9TB 2HUGA 3HRZC 4E6IA 1SYEA 3H09A 1HPCA 1O7YA 2F0VA 2L0CA 1D1KA 1G2SA 1MSGA 1OXXK 3E0JA 1NSNS 1H9RA 5EKLA 1FR3A 4CBVA 1BCPF 2PYKA 1Y8PB 1MI2A 3BDOA 2AUKA 1QILA 5KIXA 1V8QA 5IT9E 1E2ZA 1H9MA 1G91A 1EQTA 2B8GA 1PFNA 1AFPA 4FYDA 3PMFA 2FFKB 4BBRB 1LTBD 1II3A 2F0IA 3MZ5A 3ERQA 3VA7A 1EY7A 2EVBA 2X6GA 1H9SA 5ELDA 1KLUD 5D3IB 3MXPA 3PIP3 4OGQC 3F2UA 2X69A 5KRUA 1UAPA 2MJ8A 4HAEA 4WRDA 4DXFA 1SYBA 3HG9A 2K5QA 1TWCB 1J8IA 1MSHA 2NVQB 1EY0A 2Q8RE 5M5WB 4RKLA 3S17B 4V190 1WVLA 2JA5B 3TZDA 2BA0A 2NN6G 4K2LA 1ZEQX 5I2YA 1LLRD 3S1RB 5C3WA 2KUMA 2D9UA 1KTKA 3P75A 3BDCA 4BBSB 1ZKOA 4KHZA 3E5SA 4RGMA 1ZYRC 1CTMA 1G291 4QUCA 3J7AV 4FP5D 2B2WA 3EQLC 5I6WA 2D2CC 3A56A 4QMGA 2BOSA 4RFBA 5EPLA 2O2LD 4K8IA 4KMUC 3O13A 2KJXA 4A3IB 5LL6X 2ZXPA 5EKKA 1EWCA 2BDOA 4FF3A 1PYWD 3WOFA 1ZYRD 1EQVA 2KQ3A 5CR3A 1HA6A 3H91A 3KF8A 3S16B 2RQXA 1I6HB 1GHKA 2PO4A 2N88A 2E2JB 3K57A 4IFDG 2F0NA 1H9JA 4Y7NB 4DU9A 3NTHA 1S4ZA 3V2TA 4OO1G 3CRKC 1PLFA 1E2VA 1G6ZA 4OIKA 4IFDJ 3FDTA 5DEHA 5FO8B 1Q12A 4ZUIA 2DY7A 3H3VC 3D8GA 2F0TA 2PZUA 1GXDC 1JWUD 4WFN3 3S2HB 2JE6I 3IKJA 1PTOF 3MXUA 1I4GA 1RODA 4J1MA 3D4DA 4EQOA 1B9MA 4K5XA 1L0XB 4BWGB 1U9RA 2YYZA 4F7XA 1DJRD 2L9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PZW A;  1KAB A;  5I6W A;  3D4W A;  1KDC A;  4K2K A;  3R3O A;  3H6M A;  5IOD A;  5KGU A;  2F0H A;  1NSN S;  4NP5 A;  2EYO A;  2EYM A;  4IZ8 A;  5CV9 A;  4QMG A;  5EKL A;  3TP8 A;  1NUC A;  5HGT A;  5I9O A;  3NUC A;  4HMJ A;  4K8I A;  1TQO A;  2F0M A;  1EZ6 A;  1EY6 A;  1JOR A;  2PYK A;  4K6D A;  5CV7 A;  5CV6 A;  2O4X A;  4RKB A;  5NUC A;  2PQE A;  4G57 A;  5HUR A;  5F2D A;  3NQT A;  1EZ8 A;  4K5W A;  2F0Q A;  2F0L A;  4ID6 A;  3OSO A;  5EKK A;  4ZUJ A;  1EYC A;  3TP6 A;  1SNQ A;  5KIX A;  1TT2 A;  5C4H A;  1EQV A;  4K5V A;  1AEX A;  4OL7 A;  4PMB A;  1SND A;  4PNY A;  5JOB A;  2KHS A;  1EYD A;  2KQ3 A;  3SXH A;  4S3S A;  3RUZ A;  4DFA A;  1F2Z A;  5CR3 A;  1SYF A;  1EY8 A;  4I65 A;  2EY6 A;  5CV4 A;  2F0E A;  3LX0 A;  3PMF A;  4KD4 A;  2PZT A;  3D6C A;  3MHB A;  4TRD A;  3MEH A;  3TP7 A;  2F3V A;  5C3X A;  5KEE A;  2OXP A;  2F0S A;  3OMC A;  2F0N A;  1KDA A;  2LKV A;  1II3 A;  2EYP A;  1STB A;  3SHL A;  1RKN A;  2F0I A;  3MZ5 A;  3ERQ A;  2F3W A;  3HEJ A;  3NXW A;  3QB3 A;  4DU9 A;  5E1F A;  4EQP A;  4KJN A;  1EY7 A;  3V2T A;  2F0W A;  5J1Z A;  3EJI A;  4IAL A;  5C5L A;  3C1E A;  1F2Y A;  1A3T A;  4B9W A;  3MXP A;  4KJO A;  3BDL A;  3SK8 A;  5I9P A;  5J22 A;  4KY5 A;  1SNM A;  2EXZ A;  2SNS A;  5IGE A;  4YIJ A;  2F0O A;  3SR1 A;  5IIF A;  4WOR A;  5DEH A;  5CV5 A;  1F2M A;  5C6A A;  4B9X A;  4LAA A;  1JOO A;  5EGT A;  1JOQ A;  1TR5 A;  2RDF A;  3OWF A;  3TP5 A;  1SYD A;  4ZUI A;  4N9P A;  3SK5 A;  3VA5 A;  3NHH A;  1EYA A;  5KRU A;  4QF4 A;  2ENB A;  4KY6 A;  3U9O A;  4KY7 A;  3D8G A;  2F0T A;  1A3U A;  4WRD A;  2EYL A;  2SNM A;  2EY2 A;  1SYB A;  4ODG A;  4QB4 A;  2PZU A;  1SYG A;  2F0J A;  2NUC A;  5CC4 A;  3ERO A;  1STG A;  5K5P A;  3HZX A;  5IGC A;  1EY5 A;  2EY5 A;  2RKS A;  4KTA A;  1STA A;  4NDX A;  4DGZ A;  3C1F A;  4R8N A;  2F0P A;  2F0F A;  1EY0 A;  4K8J A;  1SNC A;  4F8M A;  1SNP A;  5C4Z A;  5IGG A;  4RKL A;  4DF7 A;  1A2U A;  1STH A;  5IOC A;  5E3F A;  1JOK A;  3ITP A;  5C5M A;  2EYH A;  1IHZ A;  2F0U A;  1KAA A;  2RBM A;  3T16 A;  1A3V A;  5JAV A;  1STY A;  4ZQ3 A;  4N9T A;  4NKL A;  4IUN A;  5KYL A;  4K2L A;  2F0G A;  5J39 A;  2F0K A;  4J1M A;  3S9W A;  3D4D A;  5KYI A;  4J6H A;  2OF1 A;  1EY4 A;  1SYC A;  4EQO A;  4HMI A;  4PMC A;  3SK6 A;  5IGB A;  2EYJ A;  5CGK A;  2M00 A;  4HTH A;  4K5X A;  5C3W A;  3SK4 A;  3P75 A;  2F0D A;  3BDC A;  4NMZ A;  3QOJ A;  3TME A;  3NP8 A;  3EVQ A;  1ENA A;  4ME5 A;  3E5S A;  5IGD A;  2PW5 A;  1A2T A;  1KDB A;  1STN A;  5DAU A;  4H7B A;  2HQE A;  4KD3 A;  4E6I A;  4EQN A;  5CV8 A;  4KV6 A;  1SYE A;  5I6Y A;  1EY9 A;  1U9R A;  3P1H A;  2EYF A;  3OMG A;  4K14 A;  2PW7 A;  2QDB A;  3DMU A;  5ISR A;  2WAC A;  4EVO A;  2EY1 A;  2F0V A;  3DHQ A;  4F7X A;  5M9O A;  2OEO A;  2SOB A;  3MVV A;  5IGF A;  4MIU A;  1ENC A;  3QOL A;  3T13 A;  4KHV A;  3NK9 A;  1SNO A; 
#chains in the Genus database with same CATH topology
 3P20 A;  3D4W A;  4DR3 L;  4BY7 G;  4DXG A;  1BBU A;  2HT1 A;  4NP5 A;  5CBE E;  2KED A;  1ILQ A;  2GA4 B;  1JCK B;  1TQO A;  2NWG A;  3RD4 A;  3Q6S A;  1PH9 A;  1PH3 A;  1Y1W H;  1C7Y A;  1LT5 D;  5IYB H;  4HJ7 A;  1NR2 A;  1EIG A;  4GOP A;  2ZT9 C;  1TT2 A;  2MPM A;  4L5T A;  5KGU A;  2Y0S B;  1QWY A;  4BBR G;  1ZXT A;  2PMZ E;  3I4O A;  3UI2 A;  1QUQ B;  1EEF D;  3ER0 A;  4YWK A;  2F0E A;  4DR7 L;  3AU7 A;  3S1M B;  4KI0 A;  1Z47 A;  1S72 A;  2CKZ B;  5FJ8 G;  3S14 B;  1L0Y B;  5KNB A;  1KAW A;  2PPB C;  1VS0 A;  1KDA A;  4JI7 L;  2MO1 A;  3NXW A;  4EQP A;  4OWT B;  2E76 C;  2R7Z B;  4N8X 1;  4KKS A;  3EJI A;  4QIW B;  3BYT B;  1BCP B;  4POG A;  2N8N A;  2AUJ D;  2ASB A;  3KF6 B;  3OWF A;  3VDY A;  2QF7 A;  4GLA C;  4LF8 L;  4HJA A;  3S15 B;  2VUM H;  1YI2 A;  4KKU A;  4CDC C;  1KHI A;  2HCI A;  1GJX A;  4A3K B;  1YJ9 A;  1K8A C;  5IGC A;  1EY5 A;  5C4X H;  1IYV A;  4ZLT F;  5CBA E;  1L0W A;  1SNP A;  5COY A;  1PH6 A;  1HZB A;  1VMP A;  3W1B A;  1VQP A;  2KCT A;  2KVM A;  1KC8 C;  4KN4 C;  5C5M A;  4XQQ A;  1PZI D;  3STB C;  2EYH A;  2WKC A;  2AHO B;  4JI8 L;  1RIP A;  3TN2 A;  2L5T A;  4BBS G;  3D31 A;  1X3F A;  3A7A B;  1PA6 A;  1FNU A;  3OYY A;  4NMZ A;  3I73 A;  1DOK A;  1N9W A;  1LM0 A;  3H3V H;  3CPW A;  1WCM B;  1AH9 A;  4XDX A;  4DR6 Q;  2B39 A;  3L9A X;  1IL8 A;  5IP9 G;  1HUN A;  4RWS C;  1XPO A;  4H44 C;  1WTR A;  1ENC A;  4CJ2 C;  4DR2 Q;  2QEX A;  4DAM A;  1JQY D;  1YNN C;  3R3O A;  4LFA L;  2EYM A;  4A3I G;  3G6J B;  3HKZ E;  1QOH A;  2C35 B;  3KJO A;  2I07 B;  4DV0 Q;  5A2Q E;  2D62 A;  4LF6 Q;  3NEM A;  2EPB A;  1Q81 C;  1S5D D;  4UAI A;  1Q1E A;  3DM3 A;  4C3I B;  1B4O A;  4IPH A;  3RNU A;  3SXH A;  5K36 H;  2QW7 A;  2MUY A;  4LNQ A;  2KHJ A;  2IHF A;  1LO5 D;  2VY3 A;  3M9B A;  2XSC A;  2BH2 A;  4A3E H;  2A73 B;  5I4D A;  2R93 H;  2PZT A;  4R4C A;  5IT9 c;  1FGU A;  1XMQ L;  3MXG A;  3OMC A;  1K28 A;  2E2D C;  4L6T B;  3RZD B;  4KJN A;  4H0L C;  4QL5 A;  1BKB A;  3GTQ H;  2JQO A;  3NBI A;  3HOY H;  4YHH L;  4DR4 Q;  4HR7 B;  4WOR A;  3BJU A;  1TU2 B;  2ZXR A;  5ELF A;  1TWA H;  3GTO H;  1LTT D;  1JE5 A;  2XTI A;  4R8I A;  1S5E D;  4QQB X;  4X3K A;  3ERO A;  4DV3 Q;  1SEB D;  3DWA A;  1SNC A;  1S5F D;  2A74 C;  2CWP A;  4P71 A;  4B3S Q;  4TQU S;  5FLM G;  5GAH C;  4UDU C;  3J7A F;  4DNT B;  1B7Y B;  1NR4 A;  1KNA A;  4N9T A;  3K7A B;  3FVQ A;  2RDG A;  4GKJ L;  2MQH A;  3GD7 A;  3J7A 5;  1NMG A;  4LK1 C;  4WJ4 A;  5IP7 G;  3PIO A;  2CHB D;  1DM0 B;  1HNX Q;  1A2T A;  1STN A;  3I70 A;  5M5X H;  2H4O A;  4EQN A;  5CYU A;  1IKL A;  3QJY A;  2EYF A;  2IX3 A;  4HED A;  1BUV T;  2QDB A;  4RGO S;  1QCB D;  1PVO A;  3N6R A;  2F4V Q;  1X9N A;  2N3S A;  2L15 A;  2B2T C;  3LWE A;  5COR A;  5JEA J;  3I4N H;  3SK5 A;  1RTN A;  4B3R L;  3EN2 A;  2JYO A;  4A3F B;  4CJ0 B;  2F0H A;  3HP3 A;  3T1Y L;  1PTO B;  3V96 A;  1HFG A;  2EJG C;  1N34 L;  1CFM A;  3HOV G;  5CV6 A;  1UNS A;  2JA8 H;  2Y0S G;  1JIC A;  3OSO A;  4BY1 H;  4JV5 Q;  3I4L A;  4IJH A;  1EQR A;  4ULL A;  1U4P A;  1AEX A;  4DFA A;  5IWA Q;  4PZ7 A;  1HNW L;  4S3S A;  4X62 Q;  3ND8 A;  1GUT A;  4A75 A;  1SYF A;  2Q2T A;  5G3L D;  4GKK Q;  5HY6 A;  2PI2 A;  1F77 A;  2UXC L;  5AJ3 Q;  4FO2 A;  2QDL A;  2EDG A;  5L37 A;  2E5L L;  2F0S A;  3M4O H;  4TVA B;  5IGD A;  2F4I A;  2HIV A;  4JV5 L;  1RKN A;  3X3N A;  3UDI A;  2JP1 A;  4X64 L;  2WB1 E;  3RZO H;  4FF2 A;  5IWA L;  4LF4 Q;  1G6P A;  1EQQ A;  3HOU H;  4A3D G;  4IUP A;  4Q0F A;  1WTO A;  3FKI H;  2C5C A;  3TP5 A;  4A3K G;  3PIP A;  1GVP A;  1LTG D;  1CA6 A;  1BCP D;  2ENB A;  2N55 A;  2R3Z A;  1EYG A;  3Q22 A;  4EGV A;  2SNM A;  5DM7 3;  1HR0 Q;  4JW0 A;  3S1N B;  2JA7 B;  1JE4 A;  1SBB B;  1OTC A;  1PFM A;  3U4Z A;  4JBK A;  2XIW A;  2K05 A;  1XMO Q;  3GTM B;  2LSS A;  4BA1 I;  1AE3 A;  1JJC B;  2JA6 H;  1LUZ A;  1M8A A;  3KBG A;  3S2H H;  1TY2 A;  4CHT B;  1A3V A;  3E3X A;  1WD1 A;  1QVF A;  2EJF C;  3AFQ A;  4DKA C;  1AE2 A;  2E74 C;  3OTO Q;  4J6H A;  2YTY A;  4CGY B;  4HMI A;  1CSP A;  2NB0 A;  1I4R A;  5CGK A;  3IAY A;  1WCM G;  4POF A;  2QA4 A;  4N8F A;  3HOX B;  4QGU A;  4HSV A;  2K5W A;  1UWV A;  1TKW B;  5C0X J;  3PF5 A;  3S2D B;  1FJG Q;  3BVZ A;  2Q2U A;  3DMU A;  4AQY Q;  2FJ2 A;  4EVO A;  3HOZ H;  3QIA A;  3DHQ A;  5IT9 L;  3OTO L;  2OEO A;  3H0G H;  3ULL A;  1GUS A;  3GV6 A;  4OX9 Q;  3IRB A;  1Q82 C;  2A68 C;  4X66 L;  3T13 A;  4JYA Q;  4H13 C;  2WII B;  3PIO 3;  3M7G A;  3ERS X;  5IOD A;  4LW1 A;  2K52 A;  5IYC H;  3HGB A;  5JEA H;  1H9K A;  4RAU C;  3EIV A;  1I4X A;  1XJV A;  1IBK Q;  3MXN B;  5CV7 A;  2LXJ A;  3CAM A;  4C3I G;  3SEB A;  2B2T A;  4OEL B;  1PDQ A;  3VR3 A;  4AQY L;  2MO0 A;  2QCP X;  3TRZ A;  5EPJ A;  2NVX B;  4HIM A;  4PMB A;  2VQE Q;  1UE6 A;  2KHS A;  2VXW A;  3K0X A;  3IL8 A;  2HQL A;  3E9I A;  2R6G A;  4X3U A;  4B3T L;  4DV5 L;  2RF4 A;  3KLS X;  2A68 D;  5KEE A;  3DM1 A;  4BY7 B;  1CUK A;  1STB A;  4DN4 M;  1WYD A;  1LT3 D;  1BDO A;  2HDL A;  3C1E A;  1HUM A;  4B9W A;  1UEB A;  1UEA B;  2DY8 A;  3BS1 A;  2K5V A;  3BZK A;  4RGT A;  3GO5 A;  3K5L A;  3PO3 B;  4WJW A;  2UUB L;  4FXD A;  5IYD H;  1I4P A;  4KN7 C;  3VA5 A;  1CZG A;  1GUN A;  4DK3 C;  2KHI A;  1MGS A;  1RDP D;  2YU9 H;  3I90 A;  3KLW A;  1YHQ A;  4CKE A;  3CCL A;  4R9W A;  1VCI A;  3H94 A;  1TWH H;  5M5Y B;  1STA A;  1GO3 E;  4LJZ C;  4DGZ A;  2J7Z A;  3VR6 A;  5M3F B;  5IGG A;  1CKO A;  1K8O A;  1HTL D;  2CWA A;  4OHJ A;  4DUY Q;  1SFO B;  3GTJ B;  2E2I H;  4IUN A;  3C2P A;  2B2U C;  3PGZ A;  1Q86 C;  5JJZ A;  3OOC A;  2EYJ A;  3GQB A;  1QZH A;  2M00 A;  5C3E H;  1XYI A;  1QVC A;  2QIL A;  3GTK H;  3GTL H;  4AYB B;  1EUJ A;  5E7N A;  3NTI A;  3RR5 A;  5DAU A;  1VQN A;  2V1C C;  1TVX A;  3P1H A;  1TWG B;  4DV2 L;  2DN8 A;  2ZM6 L;  1I6V C;  3OW7 A;  4A3F G;  3TBI B;  1SE8 A;  5C0X H;  3T1H L;  3A54 A;  4MIU A;  1SNO A;  1DGS A;  3NBH B;  1C0A A;  3JAM i;  4C2M H;  3FEW X;  1PRT F;  2H1E A;  1CA5 A;  2L11 A;  4JI5 L;  1VF5 C;  2WKD A;  1OXU A;  4P74 A;  3SGI A;  3I4M H;  2LY7 A;  1PTO D;  1CI3 M;  1VQJ A;  3K59 A;  2WAQ B;  3PO2 B;  1EYC A;  3G7L A;  4HIO A;  1E24 A;  2YTV A;  1W2B A;  1GOZ A;  3GTP B;  3BU2 A;  1AP0 A;  4KHP L;  4QCL A;  1EY8 A;  1LTA D;  2IT1 A;  2R7F A;  1OXV A;  3CMA A;  1MJE A;  2IY5 B;  3CQZ B;  4KK7 A;  3URY A;  3AFP A;  1CQV A;  3PF4 A;  2K14 A;  3D6C A;  3DEO A;  1V1P A;  2A19 A;  4LUV A;  2F52 A;  1U4L A;  1PH4 A;  1L1O C;  4C3H B;  4RA8 A;  5J1Z A;  2IWH A;  1CKN A;  1YBY A;  3E6Z X;  5IYB G;  3PUZ A;  1DCZ A;  3J81 L;  5JVH 3;  5D65 A;  1NJI C;  1O80 A;  1YHB A;  3MA2 B;  1CQF A;  2LMC B;  1EYA A;  4KY6 A;  5GAD C;  2VB3 X;  4KY7 A;  5DM6 3;  3IFT A;  1F9Q A;  4IN3 A;  4RCN A;  2EY2 A;  1ICW A;  5CC4 A;  1E3P A;  3HOW G;  1VQ6 A;  2GN5 A;  3ND9 A;  4RGN A;  2WIN B;  2IX0 A;  5ELC A;  4OIJ A;  1GUW A;  2SDF A;  1GHJ A;  1UE5 A;  1O7L A;  4LFB Q;  5DNF A;  3VR4 A;  1VQA A;  1VQ5 A;  4ZQ3 A;  4DV1 Q;  2PMZ B;  3HOX G;  1QJO A;  2UUA L;  2P5Z X;  3CU7 A;  1SRU A;  1Z9F A;  5BN5 A;  3K80 C;  1PZK D;  1ILP A;  3W3A A;  5ELB A;  1JWS D;  1QNU A;  2B8F A;  4NXN Q;  2HQE A;  3Q8D A;  2MHV A;  2B2U A;  4DR5 L;  1ONL A;  2NVT H;  3AEV A;  2RA4 A;  4FVM A;  4GS3 A;  5LHY 1;  3A0J A;  1QG7 A;  2WAC A;  3A55 A;  2BA1 A;  3J81 E;  1T5E A;  2HCC A;  3D4R A;  3RN2 A;  3K58 A;  2A6H C;  2UXD L;  1FVI A;  5I9O A;  3SE0 A;  1X56 A;  2MP1 A;  4NXN L;  1VQI A;  2XGT A;  4DR3 Q;  3AMU A;  1IW7 C;  1EY6 A;  4XT3 B;  2EXD A;  4RKB A;  2PQE A;  1XWE A;  2JK8 A;  2NN6 H;  1HNZ L;  2RCN A;  3WWV A;  1PMR A;  4C1N K;  4L5Q A;  4ZUJ A;  1M90 C;  2EJM A;  2I0Q A;  2MGS A;  2NTS A;  1XPR A;  1B1Z A;  4A3M B;  1K83 H;  1RHP A;  2B63 B;  2AWO A;  1QB5 D;  1I5F A;  2BCO A;  4HIK A;  4DAY B;  2O5J C;  4XXE A;  1EFW A;  4RCO A;  2L4N A;  1JWM D;  1UE7 A;  4LF7 L;  5DLQ E;  1B9N A;  2AKW B;  4F87 A;  3MEH A;  3D0F A;  3NWS A;  3TP7 A;  1C4Q A;  4GLV B;  4DR7 Q;  4FF1 A;  2XRQ D;  5EQ0 A;  2LKV A;  1JB3 A;  2A6H D;  4JBJ A;  3R2I A;  4LF9 L;  5E1F A;  5C4J B;  5LMN Q;  4JI2 L;  3PO3 G;  2OT2 A;  2Z4I A;  4C1N I;  1IW7 D;  4JI7 Q;  3DUZ A;  1PH5 A;  3HOV B;  1EFI D;  1NAP A;  2JEA I;  1E1T A;  1ML0 D;  1EIY B;  1JOQ A;  3TSS A;  2RDF A;  2FIN B;  1HR0 W;  2RDH A;  1L1O A;  1XX8 A;  1QE6 A;  3TDQ A;  5M3F G;  1F9P A;  3GTG B;  3HKZ B;  4C3J B;  4LF8 Q;  5LMN L;  2FMC A;  3KFU A;  2RKS A;  4BXX G;  4IFD I;  2Z6K C;  4F8M A;  1VQ7 A;  1HJP A;  2PI2 E;  3T53 B;  5E4W C;  2K1B A;  1IBL L;  5IOC A;  4OO1 I;  5E3F A;  2Q8T A;  3F2B A;  2RBM A;  4JI3 L;  3F2C A;  1LTI D;  2DJF C;  2OQ0 A;  3T56 B;  3U4V A;  5EBD A;  5J39 A;  4AYB G;  3J7Y W;  1D7Q A;  2OF1 A;  2J4X A;  4JI8 Q;  4IFD H;  4A3D B;  3SDZ A;  4PMC A;  3SK6 A;  4HID A;  4LMQ D;  4ZYS A;  4A3G B;  4OO1 H;  1ESF A;  4ZK9 B;  1ENA A;  3ONA B;  5A2Q L;  3JC6 6;  1KDB A;  4KV6 A;  1XNQ L;  1HZA A;  1WTV A;  3OMG A;  1PV4 A;  4CJ1 B;  3FMC A;  1N36 L;  3L0O A;  1PXU A;  3H3V I;  1KAB A;  1N32 L;  2R92 H;  2K4K A;  1TXY A;  2EYO A;  1I3Q H;  4X3T A;  4ZRZ A;  2DGY A;  1C8C A;  2WAQ G;  3PO2 G;  4A3J B;  4LFA Q;  1J9O A;  2NVY H;  1A6X A;  4MTN A;  1EZ8 A;  4IUU A;  1EWH A;  1KIX A;  2WP8 J;  3TP6 A;  1TWF B;  2F3I A;  1R9T H;  2F1M A;  5JOB A;  1RD9 D;  1SND A;  4PNY A;  2ZJR A;  1JB7 A;  3MWY W;  1JR0 D;  1PH1 A;  2I5H A;  3J80 c;  5CV4 A;  4A3L H;  1H9S B;  3QG1 A;  4DNR B;  2RHS B;  4C3H G;  1M4V A;  1SE3 A;  4GN5 A;  4ALP A;  4JPB W;  2X6L A;  2KCN A;  1EIH A;  2IW3 A;  3I55 A;  1I50 B;  4DV6 L;  3SVM A;  2F3W A;  1XMQ Q;  1PRT B;  5C5L A;  1A3T A;  3AYH B;  5J22 A;  2PQA A;  1VMC A;  1FD7 D;  3RLN A;  4BY1 G;  2AQ1 B;  4B9X A;  3EA6 A;  2OWO A;  4YHH Q;  4RH6 A;  1ESR A;  4HJ9 A;  5FLX E;  1F2L A;  3FP9 A;  2NUC A;  2HHH L;  3TQY A;  4L5R C;  4CKC A;  3F8T A;  3KDF B;  3BZC A;  2GVB A;  2F0F A;  4FXK C;  3MFY A;  4BBR H;  4QIW E;  1S3O A;  4DF7 A;  1SAP A;  1Y1V B;  3PCO B;  1BVS A;  1STH A;  5LMU Q;  4B08 A;  4YCW A;  2F0U A;  3A7L A;  2VQF Q;  2FMM A;  3L7Z C;  3VYS A;  5FJ8 H;  2Z6K A;  4O1N A;  4OON A;  3S1Q B;  1NTG A;  1F9R A;  1PZJ D;  3BZD B;  1IKM A;  3KUP A;  4GKJ Q;  3QOJ A;  5T1G A;  1VQL A;  2DNE A;  1XTD A;  1A8V A;  2PW5 A;  3W2D A;  2ZTE A;  4KD3 A;  5M3M B;  2PNH A;  2IX1 A;  2VNU D;  5LMU L;  2XRS D;  1PH2 A;  1WJJ A;  2E75 C;  2VQF L;  2KOL A;  1HZC A;  1TWC H;  2N49 A;  2NVQ H;  1WTQ A;  4CDD C;  5M5W H;  5EKI A;  2PZW A;  3K5M A;  3S17 H;  1SJH D;  4HSP A;  4P2C B;  2JA5 H;  4Z9C B;  2ICI A;  4M8A A;  3M3Y B;  3L2P A;  1B3A A;  4B3R Q;  2MFI A;  2F0M A;  4MNO A;  2CFM A;  3T1Y Q;  3KF8 B;  1KRS A;  2G5D A;  4A3B B;  2M9V A;  4A3M G;  3S1R H;  1N34 Q;  4ZCK A;  2B63 G;  4BBS H;  1BXT A;  4APV A;  2K5N A;  5C4H A;  1JC7 A;  2CW0 D;  4K5V A;  3DWQ A;  4OEM B;  1BQQ T;  3ULJ A;  4U68 A;  5CMD A;  5C44 B;  1HNW Q;  1CT1 D;  3IFD A;  1WTH A;  1Z6H A;  3A8I E;  4IPG A;  1HFN A;  4JI1 Q;  5IP9 H;  1HQM C;  5IYC G;  4G7H C;  2UXC Q;  3J81 j;  2K7V A;  2E5L Q;  4GNX B;  2K32 A;  3HFZ B;  3U50 C;  4R4I A;  1BCP C;  2A69 C;  4KY5 A;  4X64 Q;  1SNM A;  4A3I H;  4DAP A;  1MHW C;  1SLJ A;  1JJG A;  2B2V C;  4LAA A;  3HKZ G;  3LGJ A;  2KEE A;  1B50 A;  4N9P A;  4C3J G;  4FDB A;  4JI1 L;  1XTC D;  4UY8 C;  3H15 A;  2WFW A;  4DK6 C;  4ODG A;  2E2H B;  4IOA A;  1SYG A;  1STG A;  3K0Y A;  3KLR A;  4XT1 B;  3VR2 A;  3S16 H;  1Q7Y C;  1I6H H;  3UE0 A;  4X3S A;  3LNN A;  2E2J H;  3ITP A;  5AFW A;  4FF4 A;  1D5Z C;  1IYU A;  4A3G G;  4Y7N H;  1WTW A;  2RSO A;  4UP9 A;  3RLF A;  3S9W A;  1Y1W B;  1WI5 A;  4JI0 L;  2ID0 A;  1ET9 A;  2A69 D;  1NCV A;  1YVC A;  3SK4 A;  4A93 G;  1J5E L;  3NP8 A;  3TS2 A;  1LTR D;  1LT4 D;  2UUC L;  3CCV A;  1KNE A;  2DUD A;  5CV8 A;  3Q0A A;  3CC2 A;  2AMC B;  3J80 L;  4RG1 A;  2PW7 A;  1EL0 A;  3A74 A;  1JT8 A;  3HOW B;  2J0T D;  2SOB A;  2K5H A;  2XVS A;  1IL2 A;  1AZP A;  4KHV A;  1KQS A;  2K04 A;  2YV5 A;  4A3J G;  3H6M A;  3M85 A;  5EPK A;  4GOP B;  3TP8 A;  4G4K A;  4X66 Q;  2UU9 L;  4MZ9 A;  1HHV A;  2RHQ B;  1GD7 A;  2VB2 X;  1Q8I A;  4HMJ A;  2VW9 A;  2ZJQ A;  1LV9 A;  4UP7 A;  3J81 c;  3M4Y A;  1D5M C;  3CCE A;  1STE A;  1VQG A;  3JAM E;  3NQI A;  1SMY D;  4P72 A;  4DA2 A;  3CF5 A;  2VUM B;  2RSN A;  5IP7 H;  1EYD A;  3RUZ A;  4L63 B;  4JK1 C;  4I65 A;  2EY6 A;  4A3C G;  5C4X B;  3ICE A;  4NPS A;  1RTO A;  1MBY A;  4NXM L;  2LFN A;  1C48 A;  3DLL A;  2KEC A;  1HTP A;  1K3R A;  3OPO A;  5LMN W;  3CRL C;  1O7I A;  2CQO A;  4B3T Q;  5FKA C;  4OWX B;  4DV5 Q;  1EIF A;  2D5D A;  1X54 A;  2EZV A;  4V0B A;  1V43 A;  4ABN A;  1QUQ A;  2K5D A;  4IO9 A;  3J80 E;  3CD6 A;  2QGQ A;  4IUQ A;  1IXR A;  3BDL A;  3SK8 A;  5FO9 B;  1AZQ A;  1AW7 A;  3GV3 A;  3SR1 A;  2F0O A;  1CHP D;  4K0K L;  4IUT A;  1PRT D;  1HCZ A;  1SE2 A;  2ALY B;  1BNZ A;  4XQN A;  2B2Y C;  3N52 A;  2UUB Q;  4PV1 C;  3G48 A;  5G3L F;  3K6O A;  1Y1V G;  1OXS C;  1W6K A;  3KK7 A;  2B2V A;  1HH2 P;  3KF6 A;  5BN3 A;  3S1M H;  2JXM B;  2NTT A;  3R2T A;  3S14 H;  2CH4 W;  1BOS A;  1K8M A;  1EWI A;  1HZ9 A;  3NEL A;  4O0A A;  1STY A;  1SE4 A;  4NKL A;  5BN4 A;  1AN8 A;  2R7Z H;  1MIU A;  4R4O A;  3CHB D;  1SYC A;  2L55 A;  1D5X C;  1Y8N B;  1SMX A;  5M3M G;  1DXM A;  1SSO A;  4Q5V A;  1GUG A;  4H02 A;  1LTS D;  1IYJ B;  4H7B A;  3I2Z A;  1EY9 A;  4YY3 L;  1DOM A;  3S15 H;  4A3E B;  1Q90 A;  4A3K H;  2EY1 A;  2R93 B;  1K73 C;  3BG3 A;  4DV2 Q;  2HD3 A;  5IGF A;  3QOL A;  2ZM6 Q;  2A8V A;  4M1U B;  2Z6B A;  1EOT A;  1KDC A;  2L12 A;  4DV7 L;  3T1H Q;  1CK1 A;  1KL9 A;  1BF4 A;  4IZ8 A;  5HGT A;  1PTO C;  2XNA C;  2O5I C;  4A3B G;  3NUC A;  4F88 A;  4FXG C;  1D2B A;  5C0X I;  3GTQ B;  3HOY B;  1NE3 A;  4AIM A;  1YZ6 A;  4QY7 A;  2F0Q A;  4GNX C;  2F0L A;  4JI5 Q;  2VZA A;  2V4D A;  2TMP A;  1TWA B;  3GTO B;  5C44 G;  2KCM A;  2L1B A;  1YHA A;  1WCM H;  5GRO A;  3C3L A;  1Y8O B;  1J6Q A;  2Z1C A;  5KNC A;  4GN3 B;  3PUX A;  3QWN A;  1R4P B;  4HJ5 A;  4KHP Q;  3UDX A;  4TRD A;  1X3P A;  5C3X A;  1SDF A;  3VYU A;  1CKM A;  1X65 A;  3CCM A;  2UXB L;  4I7A A;  1KRT A;  2OQK A;  1VQH A;  5A35 A;  2NBF A;  4JC0 A;  3U58 A;  1Q46 A;  3TS0 A;  5M5X B;  4IOC A;  4C3I H;  3EFX D;  4JI4 L;  1B44 D;  1W6J A;  1N33 L;  2ZTC A;  4PMW A;  4CKB A;  2DNC A;  4B3M L;  3I4N B;  3FPP A;  3PV0 A;  1TS5 A;  3I56 A;  5FLX c;  2B2Y A;  1Y1W G;  1CZW A;  4BA2 I;  2RCF A;  3RZD H;  4OWW B;  1E22 A;  5KYL A;  2F0K A;  2AQ2 B;  2JA8 B;  1A0I A;  4GN4 B;  1TY0 A;  1X6O A;  5BR8 L;  4TKO B;  4HTH A;  1UUP A;  4BY1 B;  4XYQ A;  3R8B A;  2UUA Q;  3TME A;  4P75 A;  3S24 A;  1DON A;  2KBN A;  4DK0 A;  3GP7 A;  1QZG A;  1PFB A;  2CVR A;  4HCE A;  1FL0 A;  4DR5 Q;  4ZKB B;  1ET6 A;  1GUO A;  1DZ1 A;  3UE1 A;  1MKH A;  3M4O B;  5CV9 A;  1NUC A;  3NSW A;  3RZO B;  1V1O A;  1A63 A;  3K7A H;  3HOU B;  1EZ6 A;  2UXD Q;  1TII D;  3RLO A;  3UDF A;  3OIQ A;  3E9H A;  2XN9 C;  3FKI B;  2NZH A;  2VUM G;  3ULP A;  4R4Q A;  4MTK A;  1D8L A;  4KKT A;  1K0S A;  4MN3 A;  5C4X G;  1HNZ Q;  3C46 A;  2K03 A;  1E7Z A;  1U0L A;  2NN6 I;  4X6A H;  4GNX A;  4HN7 A;  2G9H D;  2IHE A;  1OXT A;  1BBX C;  2JA6 B;  4DR1 L;  1YNJ C;  1JMC A;  3KJP A;  3I8Z A;  3BYY B;  3J7Z C;  4LF5 L;  4LF7 Q;  2ICE C;  4A3F H;  1RL2 A;  5GAG C;  2EE1 A;  2ZTD A;  3K5N A;  3QB3 A;  1VQO A;  3FPU B;  1PTO H;  1O7Z A;  1G8Z D;  2ZJP A;  2AQ3 B;  2KA7 A;  4LF9 Q;  4XYO A;  1FNV A;  4JI2 Q;  2EXZ A;  5IGE A;  4YIJ A;  1F2M A;  5EGT A;  4IUR A;  1EU4 A;  1SYD A;  3NWT A;  1DD2 A;  1I4Q A;  1A3U A;  1U5K A;  4IQZ A;  1P8L A;  2IPK D;  3KBX A;  5K5P A;  2Z9H A;  3HOZ B;  3H0G B;  4LFC L;  5C4Z A;  4K8J A;  2E2H H;  1YNJ D;  1IBM Q;  1CHQ D;  1IHZ A;  5ELE A;  3TZU A;  2OTJ A;  1KAA A;  1D1I A;  1IBL Q;  3TEH B;  4EX5 A;  3KYH C;  5LL6 S;  4JI3 Q;  2I5M X;  3CC7 A;  4C56 C;  1X3Q A;  5K36 G;  2A6E C;  4ME3 A;  1SJE D;  2LS0 1;  2Q2I A;  4A3E G;  1YJW A;  3EVQ A;  2KCC A;  2VS1 A;  4XTC S;  3ZJY C;  2D0P A;  2QKI C;  2R93 G;  5TSS A;  1IBM L;  3LWU A;  4X65 L;  4K14 A;  4R4T A;  1HRJ A;  1LAC A;  4GLX A;  3CCU A;  3S1N H;  2JA7 H;  3PQI A;  1XNQ Q;  1DYQ A;  1HA5 A;  5M9O A;  4JBW A;  3GTM H;  3VYT A;  4ZKC B;  2B29 A;  4IJL A;  3NK9 A;  2OXP A;  1N36 Q;  1VQM A;  3HOY G;  3HOW H;  3M4P A;  4IPD A;  5JPM C;  3NEN A;  1A15 A;  4WJ3 M;  2PNR C;  1N32 Q;  2WV6 D;  5NUC A;  5HUR A;  2O4X A;  1B2T A;  1LAB A;  5F2D A;  4K5W A;  2A6E D;  2BE5 C;  5D3D A;  4ID6 A;  4A93 B;  1MD2 D;  4XIG S;  2IJ0 A;  1PH8 A;  5JPN C;  3HOX H;  2BDN A;  4DAV A;  2YU9 B;  1O78 A;  1FGB D;  1ICF B;  4LUO A;  2TSS A;  3MXN A;  1KLG D;  2E8G A;  3G4S A;  2I46 A;  2R61 A;  3JAM c;  3PUV A;  3S2D H;  1TWH B;  1Y14 B;  1RF2 D;  1ASY A;  3LX0 A;  4YWM A;  1VQE A;  5FLX L;  1QNK A;  1ASZ A;  4DUZ Q;  1XXG A;  2JA5 G;  4PZ6 A;  3HS0 C;  4GZY C;  2EYP A;  5IY0 A;  2C9O A;  1N8R C;  1RJT A;  2E2I B;  3CME A;  5KND A;  4IAL A;  4I7Z C;  3I3C A;  4DV6 Q;  4KJO A;  3NTK A;  5C3E B;  5IIF A;  1BO0 A;  3GTL B;  3GTK B;  2Q8I B;  2BE5 D;  2QEJ C;  3CPF A;  4DPG A;  1BR9 A;  2HDM A;  4QF4 A;  3U9O A;  2NVX H;  4DUZ L;  1VQ8 A;  1VQK A;  2EYL A;  3I4N G;  3BVG A;  2F0J A;  3PUY A;  3HZX A;  4KTA A;  3J81 i;  3CCJ A;  3C1F A;  4R8N A;  3PUW A;  2XWJ B;  4NW2 A;  2HHH Q;  2BH8 A;  3P7J A;  1A2U A;  2IL8 A;  4J8Q A;  1OO9 B;  3HKS A;  2F03 A;  4C2M B;  2JA8 G;  2Y0S E;  1TS4 A;  4BY7 H;  3T16 A;  2EIF A;  5JAV A;  3OHX C;  1U4M A;  1K0R A;  1X32 A;  3MFG A;  4MHE A;  4O42 A;  3STB D;  3I4M B;  2OTL A;  4YWL A;  3I72 A;  5EBC A;  4LUZ A;  3I91 A;  1A62 A;  3PO3 H;  3L3O C;  5JJK A;  4DR6 L;  3V05 A;  4PQX A;  5FO7 B;  3FRP B;  3A5Z B;  1VF7 A;  3K8A A;  3T4A C;  4DR2 L;  5M5Y H;  4AH6 A;  3MVV A;  3VYR A;  2DJG C;  5M3F H;  1JJ2 A;  1SR3 A;  1Q1B A;  3HOU G;  1H95 A;  4DV0 L;  1FNW A;  5D14 A;  4LF6 L;  3CC4 A;  4BXX H;  1HQR D;  1Q8K A;  1E0B A;  3FKI G;  2YTX A;  5GQO A;  1SFO H;  3GTJ H;  3DEP A;  3GDE A;  1JOR A;  1YNN D;  5JVG 3;  4G57 A;  4J15 A;  1YJN A;  2XWB B;  2K28 A;  2CW0 C;  1EOV A;  3NQT A;  2NYZ D;  2ZXO A;  1R4Q B;  3NBH A;  2Z8L A;  1V1P B;  1B53 A;  3QO2 A;  2WB1 B;  3M4Q A;  1L2F A;  1B70 B;  4A76 A;  5JJL A;  2JA6 G;  3AB9 A;  3I7F A;  2RVL A;  3RMH A;  5H1S E;  1TWG H;  4IPC A;  1C9O A;  2M2L A;  1YIJ A;  4JI6 Q;  1CKN B;  4KD4 A;  3MHB A;  1BBW A;  1F9S A;  2F3V A;  3KLS A;  1U4R A;  1VQ4 A;  2AWN A;  1VQ9 A;  1P16 A;  4DR4 L;  3OWE B;  2F0W A;  3A8K E;  2B3G A;  1VQD A;  3RN5 A;  1PYB A;  4QJF A;  3OIP A;  1WTX A;  2Z4H A;  2PCF B;  3A8J E;  1JOO A;  4JI6 L;  1WTP A;  3PO2 H;  1Z7T A;  3M7N A;  4QUF A;  3HOZ G;  2K01 A;  4DV3 L;  3H0G G;  4U67 3;  3GTP H;  2NVT B;  3BVM A;  1HXY D;  4QB4 A;  5T1I A;  2FHT A;  4PG3 A;  1I4H A;  4B3S L;  3CQZ H;  5JEA G;  1YIT A;  1X3G A;  1TS3 A;  1JOK A;  1EEI D;  3D3R A;  4C3H H;  2F0G A;  5I2X A;  5KYI A;  4KLK A;  1EY4 A;  2EOT A;  1HNX L;  3NE5 B;  2JJQ A;  2JSO A;  5EJW A;  4FNF A;  1B3Q A;  1CM9 A;  4JI0 Q;  3TRE A;  4OXP A;  1LT6 D;  2F4V L;  1K83 B;  3JAM L;  1J5E Q;  1EU3 A;  4TSS A;  2UUC Q;  1KXL A;  1I94 Q;  5ISR A;  1YNX A;  5FOB B;  1T9H A;  2SEB D;  3AQQ A;  4K6L A;  2JEB I;  3CKI B;  4JCV E;  3DWP A;  4ZAI A;  4K2K A;  1X3E A;  2ATW A;  1RCV D;  3ZYY X;  2R7Z G;  3Q24 A;  5IYD G;  1SMY C;  1VQB A;  1E2W A;  2NZ1 D;  1G51 A;  5I6Y A;  2Z0S A;  4K6D A;  4L8J A;  2UU9 Q;  3DXJ C;  1TS2 A;  2H5X A;  1I94 L;  3MAQ A;  4X62 L;  1SNQ A;  4RHR A;  4BS9 A;  1WOC A;  4IUV A;  4OL7 A;  3G6E A;  4G7O C;  2K33 A;  4EQ5 A;  4GKK L;  1F2Z A;  2G9D A;  3MTS A;  4PZ8 A;  5AJ3 L;  1MJC A;  1Q3L A;  3K81 C;  3F2D A;  1S5B D;  3D6W A;  4NXM Q;  3Q23 A;  4LF4 L;  3SHL A;  5FLM H;  1LTL A;  1SXT A;  3HEJ A;  4G7Z C;  5C3E G;  1L1O B;  1PRT C;  1ENF A;  1F2Y A;  4DAY A;  3R93 A;  4UPA A;  2NZO A;  5I9P A;  2A5H A;  2SNS A;  1Y69 U;  4HCS A;  5CV5 A;  5C6A A;  3CCS A;  1CSQ A;  1TR5 A;  3T51 B;  3WOE A;  1HR0 L;  3NHH A;  1B8A A;  4ILW A;  4DK1 A;  1T5X D;  1FYC A;  4K0K Q;  5C0X G;  3K5O A;  1XMO L;  1NMF A;  4A3M H;  4XQJ A;  3VR5 A;  5ELO A;  3WDN A;  2B63 H;  2K6A A;  1K3B C;  1X55 A;  2EY5 A;  1S5C D;  4NDX A;  2F0P A;  3CP0 A;  1D6E C;  1NY4 A;  4UP8 A;  3K7U C;  4HJ8 A;  1G2T A;  1SRO A;  2R92 B;  2CQA A;  3CXC A;  2I5L X;  1VDZ A;  1I3Q B;  3I4M G;  1DOL A;  1XPU A;  5FK9 C;  4RHS A;  1IZ6 A;  5E4X A;  5C4J H;  3NPP A;  3X3M A;  3MC0 B;  2K75 A;  2NVY B;  5IGB A;  3HOV H;  2EQS A;  1WD0 A;  2F0D A;  3U9S A;  1V9P A;  2FXQ A;  4ME5 A;  2B2W C;  1R9T B;  2CH4 A;  2HUG A;  3QR8 A;  1FJG L;  3HRZ C;  4E6I A;  1SYE A;  3H09 A;  2Q2H A;  4CDE C;  4OX9 L;  3GTG H;  1HPC A;  4C3J H;  4JYA L;  1O7Y A;  2F0V A;  2L0C A;  4YY3 Q;  3EBE A;  4Y52 H;  1D1K A;  1G2S A;  1MSG A;  2ES2 A;  1OXX K;  3E0J A;  1IBK L;  1NSN S;  1H9R A;  5EKL A;  1FR3 A;  4DV7 Q;  4CBV A;  1BCP F;  2PYK A;  2WB1 G;  1Y8P B;  1MI2 A;  4A3D H;  3BDO A;  4A3G H;  3KOJ A;  2VQE L;  2AUK A;  1QIL A;  5KIX A;  1V8Q A;  4RMF A;  5IT9 E;  1E2Z A;  1H9M A;  1G91 A;  4A93 H;  1EQT A;  2B8G A;  4UHV A;  1PFN A;  1AFP A;  3W1G A;  4FYD A;  3PMF A;  4O2D A;  2FFK B;  4BBR B;  2PQA B;  1M1K C;  1LTB D;  3F1Z A;  1II3 A;  2F0I A;  3MZ5 A;  3ERQ A;  3VA7 A;  1EY7 A;  2EVB A;  2X6G A;  1H9S A;  2K50 A;  5ELD A;  1KLU D;  5D3I B;  3MXP A;  3PIP 3;  4A3J H;  4LWC A;  1V1Q A;  4OGQ C;  3W5O A;  2CCZ A;  3F2U A;  4JOI C;  2X69 A;  2D0O A;  3CW2 C;  2UXB Q;  5KRU A;  1TWF H;  1UAP A;  2MJ8 A;  4HAE A;  1VQF A;  4WRD A;  4DXF A;  1SYB A;  2OCE A;  3HG9 A;  2K5Q A;  1NNX A;  1TWC B;  1J8I A;  4JI4 Q;  4DUY L;  1MSH A;  2NVQ B;  1EY0 A;  1N33 Q;  2Q8R E;  3E0E A;  5M5W B;  4RKL A;  1K8G A;  3S17 B;  4V19 0;  4A3C H;  1WVL A;  1K9M C;  4B3M Q;  2JA5 B;  3TZD A;  4JVZ A;  2BA0 A;  2NN6 G;  1I50 H;  1PFS A;  4K2L A;  3KDF A;  2HIX A;  5IE8 A;  1ZEQ X;  2LXK A;  5I2Y A;  1LLR D;  4YCU A;  3S1R B;  5C3W A;  2KUM A;  2D9U A;  1KTK A;  3P75 A;  3BDC A;  4BBS B;  1E1O A;  1ZKO A;  1GM5 A;  4KHZ A;  3E5S A;  4RGM A;  5BR8 Q;  1ZYR C;  5EAY A;  4YCV A;  1CTM A;  4L5S A;  1G29 1;  2VL6 A;  4QUC A;  3J7A V;  5JJI A;  1UE1 A;  4FP5 D;  2B2W A;  3EQL C;  1NBW A;  1Y1V H;  1WFQ A;  4R1J A;  5I6W A;  4GOP C;  2D2C C;  3A56 A;  3J80 i;  4QMG A;  2BOS A;  3B6Y A;  4RFB A;  5EPL A;  2JA9 A;  2O2L D;  4K8I A;  1PH7 A;  4KMU C;  3O13 A;  2KJX A;  3UDG A;  3S1Q H;  4A3I B;  5LL6 X;  1XNR Q;  2ZXP A;  4CDF C;  5EKK A;  1EWC A;  2BDO A;  3CCR A;  4FF3 A;  1PYW D;  3PSI A;  2KEN A;  3WOF A;  1ZYR D;  1EQV A;  2KQ3 A;  5M3M H;  5CR3 A;  2JA7 G;  1HA6 A;  3H91 A;  2R7D A;  3KF8 A;  3S16 B;  2RQX A;  2GVA A;  1I6H B;  3FHW A;  1PHJ A;  1GHK A;  4AYB E;  2JN4 A;  2PO4 A;  2N88 A;  5ELN A;  1YEZ A;  2E2J B;  1XNR L;  1W3S A;  3K57 A;  4IFD G;  2F0N A;  3CCQ A;  1H9J A;  4Y7N B;  4DR1 Q;  4DU9 A;  3M3Y H;  3NTH A;  1S4Z A;  3V2T A;  4OO1 G;  3CRK C;  4LF5 Q;  1PLF A;  1E2V A;  1G6Z A;  1SN8 A;  4OIK A;  3A5U A;  4IFD J;  4JBM A;  3FDT A;  5DEH A;  5FO8 B;  4A3B H;  4JG2 A;  4NB3 A;  1Q12 A;  4ZUI A;  2DY7 A;  3H3V C;  4DV4 Q;  3D8G A;  2F0T A;  1GKH A;  2PZU A;  1GXD C;  1JWU D;  4WFN 3;  2R92 G;  3S2H B;  5C44 H;  4JOI A;  2JE6 I;  4LFB L;  5HGQ A;  2WAQ E;  3IKJ A;  4DNI A;  4LFC Q;  4DV1 L;  1PTO F;  3MXU A;  1I4G A;  4P73 A;  4DV4 L;  1ROD A;  4J1M A;  3D4D A;  2MNA A;  4EQO A;  5GAE C;  3OW2 A;  2N78 A;  1B9M A;  4K5X A;  1LYL A;  1L0X B;  4A3L G;  1PYS B;  5J3B A;  3G71 A;  1KD1 C;  1VQC A;  4BWG B;  1U9R A;  3MEF A;  2A1A A;  1S40 A;  2YYZ A;  4F7X A;  4A4I A;  4X65 Q;  1DJR D;  1QVG A;  2L9H A; 
#chains in the Genus database with same CATH homology
 3P20 A;  3D4W A;  4DXG A;  4NP5 A;  5CBE E;  2KED A;  1ILQ A;  2GA4 B;  1JCK B;  1TQO A;  2NWG A;  3RD4 A;  3Q6S A;  1LT5 D;  1NR2 A;  1EIG A;  2ZT9 C;  1TT2 A;  2MPM A;  5KGU A;  2Y0S B;  1QWY A;  1ZXT A;  3UI2 A;  1EEF D;  2F0E A;  3AU7 A;  3S1M B;  4KI0 A;  1Z47 A;  3S14 B;  1L0Y B;  5KNB A;  2PPB C;  1KDA A;  3NXW A;  4EQP A;  2E76 C;  2R7Z B;  4KKS A;  3EJI A;  4QIW B;  3BYT B;  1BCP B;  2AUJ D;  3OWF A;  2QF7 A;  3S15 B;  4KKU A;  2HCI A;  1GJX A;  4A3K B;  5IGC A;  1EY5 A;  1IYV A;  4ZLT F;  5CBA E;  1SNP A;  5COY A;  1VMP A;  2KVM A;  4KN4 C;  5C5M A;  4XQQ A;  1PZI D;  2EYH A;  2WKC A;  3TN2 A;  2L5T A;  3D31 A;  3A7A B;  1FNU A;  4NMZ A;  3I73 A;  1DOK A;  1WCM B;  4XDX A;  2B39 A;  3L9A X;  1IL8 A;  1HUN A;  4RWS C;  4H44 C;  1WTR A;  1ENC A;  4CJ2 C;  1JQY D;  1YNN C;  3R3O A;  2EYM A;  3G6J B;  1QOH A;  2I07 B;  5A2Q E;  2D62 A;  2EPB A;  1S5D D;  4UAI A;  1Q1E A;  4C3I B;  1B4O A;  5K36 H;  3SXH A;  2MUY A;  1LO5 D;  2XSC A;  2A73 B;  5I4D A;  2PZT A;  3MXG A;  3OMC A;  2E2D C;  4L6T B;  3RZD B;  4KJN A;  4H0L C;  3NBI A;  4HR7 B;  4WOR A;  1TU2 B;  2ZXR A;  5ELF A;  1LTT D;  4R8I A;  1S5E D;  4X3K A;  3ERO A;  1SEB D;  3DWA A;  1SNC A;  1S5F D;  2A74 C;  4TQU S;  4UDU C;  3J7A F;  4DNT B;  1NR4 A;  1KNA A;  4N9T A;  3K7A B;  3FVQ A;  2RDG A;  3GD7 A;  4LK1 C;  2CHB D;  1DM0 B;  1A2T A;  1STN A;  3I70 A;  2H4O A;  4EQN A;  5CYU A;  1IKL A;  3QJY A;  2EYF A;  2IX3 A;  4HED A;  1BUV T;  2QDB A;  4RGO S;  1QCB D;  3N6R A;  2B2T C;  3LWE A;  5COR A;  5JEA J;  3SK5 A;  1RTN A;  2JYO A;  4A3F B;  4CJ0 B;  2F0H A;  3HP3 A;  1PTO B;  3V96 A;  1HFG A;  2EJG C;  1CFM A;  5CV6 A;  1UNS A;  1JIC A;  3OSO A;  3I4L A;  4ULL A;  1U4P A;  1AEX A;  4DFA A;  4S3S A;  3ND8 A;  1GUT A;  1SYF A;  5G3L D;  1F77 A;  4FO2 A;  2EDG A;  2F0S A;  5IGD A;  2F4I A;  1RKN A;  3X3N A;  2JP1 A;  4FF2 A;  4IUP A;  4Q0F A;  1WTO A;  2C5C A;  3TP5 A;  1LTG D;  1CA6 A;  1BCP D;  2ENB A;  2N55 A;  2R3Z A;  3Q22 A;  4EGV A;  2SNM A;  5DM7 3;  3S1N B;  2JA7 B;  1JE4 A;  1SBB B;  1PFM A;  2XIW A;  2K05 A;  3GTM B;  4BA1 I;  1M8A A;  3KBG A;  1TY2 A;  4CHT B;  1A3V A;  1WD1 A;  2EJF C;  2E74 C;  4J6H A;  4CGY B;  4HMI A;  2NB0 A;  1I4R A;  5CGK A;  3IAY A;  3HOX B;  4HSV A;  2K5W A;  1TKW B;  5C0X J;  3S2D B;  3BVZ A;  3DMU A;  2FJ2 A;  4EVO A;  3QIA A;  3DHQ A;  5IT9 L;  2OEO A;  1GUS A;  3GV6 A;  2A68 C;  3T13 A;  4H13 C;  2WII B;  3PIO 3;  3M7G A;  5IOD A;  3HGB A;  5JEA H;  1H9K A;  4RAU C;  1I4X A;  5CV7 A;  4C3I G;  3SEB A;  2B2T A;  1PDQ A;  3VR3 A;  2QCP X;  5EPJ A;  2NVX B;  4PMB A;  2KHS A;  2VXW A;  3IL8 A;  2R6G A;  4X3U A;  3KLS X;  2A68 D;  5KEE A;  3DM1 A;  4BY7 B;  1STB A;  4DN4 M;  1LT3 D;  1BDO A;  2HDL A;  3C1E A;  1HUM A;  4B9W A;  1UEA B;  2DY8 A;  3BS1 A;  3K5L A;  4RGT A;  3GO5 A;  3PO3 B;  4WJW A;  4FXD A;  1I4P A;  4KN7 C;  3VA5 A;  1CZG A;  1GUN A;  1MGS A;  1RDP D;  3I90 A;  4CKE A;  4R9W A;  1VCI A;  3H94 A;  5M5Y B;  1STA A;  4LJZ C;  4DGZ A;  2J7Z A;  3VR6 A;  5M3F B;  5IGG A;  1K8O A;  1HTL D;  4OHJ A;  1SFO B;  3GTJ B;  4IUN A;  3C2P A;  2B2U C;  5JJZ A;  3OOC A;  2EYJ A;  3GQB A;  2M00 A;  1XYI A;  2QIL A;  4AYB B;  3NTI A;  5DAU A;  1TVX A;  3P1H A;  1TWG B;  2DN8 A;  1I6V C;  3OW7 A;  3TBI B;  5C0X H;  3A54 A;  4MIU A;  1SNO A;  3FEW X;  1PRT F;  2H1E A;  1CA5 A;  2L11 A;  1VF5 C;  2WKD A;  1OXU A;  2LY7 A;  1PTO D;  1CI3 M;  3K59 A;  2WAQ B;  3PO2 B;  1EYC A;  3G7L A;  1GOZ A;  3GTP B;  1AP0 A;  4QCL A;  1EY8 A;  1LTA D;  2IT1 A;  1OXV A;  3CQZ B;  4KK7 A;  3URY A;  1CQV A;  3D6C A;  3DEO A;  1V1P A;  1U4L A;  4C3H B;  4RA8 A;  5J1Z A;  2IWH A;  3E6Z X;  3PUZ A;  1DCZ A;  3J81 L;  5JVH 3;  5D65 A;  1O80 A;  3MA2 B;  1CQF A;  2LMC B;  1EYA A;  4KY6 A;  2VB3 X;  4KY7 A;  5DM6 3;  3IFT A;  1F9Q A;  4IN3 A;  4RCN A;  2EY2 A;  1ICW A;  5CC4 A;  3ND9 A;  4RGN A;  2WIN B;  2IX0 A;  5ELC A;  4OIJ A;  1GUW A;  2SDF A;  1GHJ A;  1O7L A;  5DNF A;  3VR4 A;  4ZQ3 A;  2PMZ B;  1QJO A;  3CU7 A;  5BN5 A;  1PZK D;  1ILP A;  3W3A A;  5ELB A;  1JWS D;  1QNU A;  2B8F A;  2HQE A;  2MHV A;  2B2U A;  1ONL A;  2RA4 A;  4FVM A;  5LHY 1;  1QG7 A;  2WAC A;  3A55 A;  2BA1 A;  3J81 E;  1T5E A;  2HCC A;  3D4R A;  3K58 A;  2A6H C;  5I9O A;  3SE0 A;  2MP1 A;  3AMU A;  1IW7 C;  1EY6 A;  4XT3 B;  4RKB A;  2PQE A;  1XWE A;  2NN6 H;  1PMR A;  4C1N K;  4ZUJ A;  2EJM A;  2MGS A;  2NTS A;  1B1Z A;  4A3M B;  1RHP A;  2B63 B;  2AWO A;  1QB5 D;  2BCO A;  2O5J C;  4XXE A;  4RCO A;  2L4N A;  1JWM D;  1B9N A;  4F87 A;  3MEH A;  3NWS A;  3TP7 A;  1C4Q A;  4FF1 A;  2XRQ D;  5EQ0 A;  2LKV A;  1JB3 A;  2A6H D;  3R2I A;  5E1F A;  5C4J B;  2OT2 A;  2Z4I A;  4C1N I;  1IW7 D;  3DUZ A;  3HOV B;  1EFI D;  1NAP A;  2JEA I;  1ML0 D;  1JOQ A;  3TSS A;  2RDF A;  2FIN B;  2RDH A;  1XX8 A;  1QE6 A;  3TDQ A;  1F9P A;  3GTG B;  3HKZ B;  4C3J B;  2FMC A;  2RKS A;  4IFD I;  4F8M A;  3T53 B;  5E4W C;  2K1B A;  5IOC A;  4OO1 I;  5E3F A;  2Q8T A;  2RBM A;  1LTI D;  3T56 B;  5EBD A;  5J39 A;  3J7Y W;  2OF1 A;  2J4X A;  4A3D B;  4IFD H;  3SDZ A;  4PMC A;  3SK6 A;  4LMQ D;  4ZYS A;  4A3G B;  4OO1 H;  1ESF A;  4ZK9 B;  1ENA A;  3ONA B;  5A2Q L;  1KDB A;  4KV6 A;  1WTV A;  3OMG A;  4CJ1 B;  3FMC A;  1PXU A;  1KAB A;  2EYO A;  4X3T A;  4ZRZ A;  1C8C A;  4A3J B;  1J9O A;  1A6X A;  1EZ8 A;  4IUU A;  1EWH A;  2WP8 J;  3TP6 A;  1TWF B;  2F1M A;  5JOB A;  1RD9 D;  1SND A;  4PNY A;  3MWY W;  1JR0 D;  5CV4 A;  1H9S B;  3QG1 A;  4DNR B;  4C3H G;  1M4V A;  1SE3 A;  2X6L A;  2KCN A;  1EIH A;  2IW3 A;  1I50 B;  3SVM A;  2F3W A;  1PRT B;  5C5L A;  1A3T A;  5J22 A;  1VMC A;  1FD7 D;  2AQ1 B;  4B9X A;  3EA6 A;  4RH6 A;  1ESR A;  5FLX E;  1F2L A;  2NUC A;  4CKC A;  2F0F A;  4FXK C;  3MFY A;  4DF7 A;  1SAP A;  1Y1V B;  1STH A;  4B08 A;  2F0U A;  3A7L A;  2FMM A;  3L7Z C;  3VYS A;  4O1N A;  3S1Q B;  1F9R A;  1PZJ D;  3BZD B;  1IKM A;  3KUP A;  3QOJ A;  5T1G A;  2DNE A;  2PW5 A;  3W2D A;  4KD3 A;  5M3M B;  2IX1 A;  2VNU D;  2XRS D;  2E75 C;  2KOL A;  1WTQ A;  5EKI A;  2PZW A;  3K5M A;  1SJH D;  4HSP A;  4P2C B;  4Z9C B;  2ICI A;  4M8A A;  3M3Y B;  1B3A A;  2F0M A;  4A3B B;  2M9V A;  1BXT A;  5C4H A;  1JC7 A;  2CW0 D;  4K5V A;  3DWQ A;  1BQQ T;  4U68 A;  5CMD A;  5C44 B;  1CT1 D;  3IFD A;  1Z6H A;  3A8I E;  1HFN A;  1HQM C;  4G7H C;  2K7V A;  2K32 A;  1BCP C;  2A69 C;  4KY5 A;  1SNM A;  4DAP A;  2B2V C;  4LAA A;  2KEE A;  1B50 A;  4N9P A;  4C3J G;  1XTC D;  4ODG A;  2E2H B;  1SYG A;  1STG A;  3K0Y A;  3KLR A;  4XT1 B;  3VR2 A;  4X3S A;  3LNN A;  3ITP A;  5AFW A;  4FF4 A;  1D5Z C;  1IYU A;  1WTW A;  2RSO A;  3RLF A;  3S9W A;  1Y1W B;  2ID0 A;  1ET9 A;  2A69 D;  1NCV A;  3SK4 A;  3NP8 A;  1LTR D;  1LT4 D;  1KNE A;  5CV8 A;  3Q0A A;  3J80 L;  2PW7 A;  1EL0 A;  3HOW B;  2J0T D;  2SOB A;  2XVS A;  1AZP A;  4KHV A;  2K04 A;  3H6M A;  3M85 A;  5EPK A;  3TP8 A;  4G4K A;  1HHV A;  2VB2 X;  1Q8I A;  4HMJ A;  1LV9 A;  3M4Y A;  1D5M C;  1STE A;  3JAM E;  3NQI A;  1SMY D;  4DA2 A;  2VUM B;  2RSN A;  1EYD A;  3RUZ A;  4L63 B;  4JK1 C;  4I65 A;  2EY6 A;  5C4X B;  1RTO A;  1MBY A;  2LFN A;  1C48 A;  2KEC A;  1HTP A;  3OPO A;  3CRL C;  5FKA C;  2D5D A;  2EZV A;  4V0B A;  1V43 A;  4ABN A;  2K5D A;  3J80 E;  4IUQ A;  3BDL A;  3SK8 A;  5FO9 B;  1AZQ A;  1AW7 A;  3GV3 A;  3SR1 A;  2F0O A;  1CHP D;  4IUT A;  1PRT D;  1HCZ A;  1SE2 A;  1BNZ A;  4XQN A;  2B2Y C;  3N52 A;  4PV1 C;  5G3L F;  3K6O A;  1OXS C;  1W6K A;  3KK7 A;  2B2V A;  5BN3 A;  2JXM B;  2NTT A;  3R2T A;  1BOS A;  1K8M A;  1STY A;  1SE4 A;  4NKL A;  5BN4 A;  1AN8 A;  3CHB D;  1SYC A;  2L55 A;  1D5X C;  1Y8N B;  1DXM A;  1SSO A;  4Q5V A;  1GUG A;  1LTS D;  4H7B A;  1EY9 A;  1DOM A;  4A3E B;  1Q90 A;  2EY1 A;  2R93 B;  3BG3 A;  5IGF A;  3QOL A;  4M1U B;  1EOT A;  1KDC A;  2L12 A;  1CK1 A;  1BF4 A;  4IZ8 A;  5HGT A;  1PTO C;  2XNA C;  2O5I C;  3NUC A;  4F88 A;  4FXG C;  1D2B A;  5C0X I;  3GTQ B;  3HOY B;  2F0Q A;  2F0L A;  2V4D A;  2TMP A;  1TWA B;  3GTO B;  2L1B A;  3C3L A;  1Y8O B;  2Z1C A;  5KNC A;  3PUX A;  3QWN A;  1R4P B;  4TRD A;  1X3P A;  5C3X A;  1SDF A;  3VYU A;  5A35 A;  2NBF A;  5M5X B;  3EFX D;  1B44 D;  1W6J A;  4PMW A;  4CKB A;  2DNC A;  3I4N B;  3FPP A;  3PV0 A;  1TS5 A;  2B2Y A;  1CZW A;  4BA2 I;  5KYL A;  2F0K A;  2AQ2 B;  2JA8 B;  1TY0 A;  4TKO B;  4HTH A;  1UUP A;  4BY1 B;  4XYQ A;  3R8B A;  3TME A;  1DON A;  4DK0 A;  3GP7 A;  1PFB A;  2CVR A;  4HCE A;  4ZKB B;  1ET6 A;  1GUO A;  1DZ1 A;  3M4O B;  5CV9 A;  1NUC A;  3NSW A;  3RZO B;  1V1O A;  3HOU B;  1EZ6 A;  1TII D;  3OIQ A;  2XN9 C;  3FKI B;  4KKT A;  4MN3 A;  3C46 A;  2K03 A;  2NN6 I;  4HN7 A;  2G9H D;  1OXT A;  1BBX C;  2JA6 B;  1YNJ C;  3I8Z A;  3BYY B;  2ICE C;  2EE1 A;  3K5N A;  3QB3 A;  3FPU B;  1PTO H;  1O7Z A;  1G8Z D;  2AQ3 B;  2KA7 A;  4XYO A;  1FNV A;  2EXZ A;  5IGE A;  4YIJ A;  1F2M A;  5EGT A;  4IUR A;  1EU4 A;  1SYD A;  3NWT A;  1DD2 A;  1I4Q A;  1A3U A;  4IQZ A;  2IPK D;  3KBX A;  5K5P A;  3HOZ B;  3H0G B;  5C4Z A;  4K8J A;  1YNJ D;  1CHQ D;  1IHZ A;  5ELE A;  3TZU A;  1KAA A;  1D1I A;  5LL6 S;  4C56 C;  1X3Q A;  5K36 G;  2A6E C;  1SJE D;  2LS0 1;  3EVQ A;  2KCC A;  4XTC S;  2QKI C;  5TSS A;  3LWU A;  4K14 A;  1HRJ A;  1LAC A;  1DYQ A;  1HA5 A;  5M9O A;  4JBW A;  3VYT A;  4ZKC B;  3NK9 A;  2OXP A;  5JPM C;  1A15 A;  2PNR C;  2WV6 D;  5NUC A;  5HUR A;  2O4X A;  1B2T A;  1LAB A;  5F2D A;  4K5W A;  2A6E D;  2BE5 C;  5D3D A;  4ID6 A;  4A93 B;  1MD2 D;  4XIG S;  2IJ0 A;  5JPN C;  2BDN A;  4DAV A;  2YU9 B;  1O78 A;  1FGB D;  2TSS A;  3MXN A;  1KLG D;  2I46 A;  2R61 A;  3PUV A;  1TWH B;  1RF2 D;  3LX0 A;  5FLX L;  1QNK A;  1XXG A;  3HS0 C;  4GZY C;  2EYP A;  2C9O A;  1RJT A;  2E2I B;  5KND A;  4IAL A;  4I7Z C;  3I3C A;  4KJO A;  3NTK A;  5C3E B;  5IIF A;  1BO0 A;  3GTL B;  3GTK B;  2Q8I B;  2BE5 D;  2QEJ C;  1BR9 A;  2HDM A;  4QF4 A;  3U9O A;  2EYL A;  3BVG A;  2F0J A;  3PUY A;  3HZX A;  4KTA A;  3C1F A;  4R8N A;  3PUW A;  2XWJ B;  4NW2 A;  3P7J A;  1A2U A;  2IL8 A;  4J8Q A;  1OO9 B;  2F03 A;  4C2M B;  1TS4 A;  3T16 A;  5JAV A;  3OHX C;  1U4M A;  1X32 A;  3MFG A;  4MHE A;  4O42 A;  3I4M B;  3I72 A;  5EBC A;  3I91 A;  3L3O C;  3V05 A;  4PQX A;  5FO7 B;  3FRP B;  1VF7 A;  3T4A C;  3MVV A;  3VYR A;  1Q1B A;  1FNW A;  5D14 A;  1HQR D;  1E0B A;  3DEP A;  1JOR A;  1YNN D;  5JVG 3;  4G57 A;  2XWB B;  2K28 A;  2CW0 C;  3NQT A;  2NYZ D;  2ZXO A;  1R4Q B;  3NBH A;  2Z8L A;  1V1P B;  1B53 A;  3QO2 A;  2WB1 B;  3AB9 A;  2RVL A;  3RMH A;  2M2L A;  4KD4 A;  3MHB A;  1F9S A;  2F3V A;  3KLS A;  1U4R A;  2AWN A;  3OWE B;  2F0W A;  3A8K E;  3OIP A;  1WTX A;  2Z4H A;  2PCF B;  3A8J E;  1JOO A;  1WTP A;  1Z7T A;  3M7N A;  4QUF A;  2K01 A;  4U67 3;  2NVT B;  3BVM A;  1HXY D;  4QB4 A;  5T1I A;  2FHT A;  1I4H A;  5JEA G;  1TS3 A;  1JOK A;  1EEI D;  3D3R A;  2F0G A;  5I2X A;  5KYI A;  1EY4 A;  2EOT A;  3NE5 B;  2JSO A;  5EJW A;  4FNF A;  1CM9 A;  1LT6 D;  1K83 B;  3JAM L;  1EU3 A;  4TSS A;  5ISR A;  5FOB B;  2SEB D;  4K6L A;  2JEB I;  3CKI B;  3DWP A;  4ZAI A;  4K2K A;  1RCV D;  3ZYY X;  3Q24 A;  1SMY C;  1E2W A;  2NZ1 D;  5I6Y A;  4K6D A;  4L8J A;  3DXJ C;  1TS2 A;  3MAQ A;  1SNQ A;  4RHR A;  4BS9 A;  4IUV A;  4OL7 A;  4G7O C;  2K33 A;  1F2Z A;  2G9D A;  3MTS A;  1Q3L A;  1S5B D;  3D6W A;  3Q23 A;  3SHL A;  1SXT A;  3HEJ A;  4G7Z C;  1PRT C;  1ENF A;  1F2Y A;  4DAY A;  3R93 A;  5I9P A;  2A5H A;  2SNS A;  1Y69 U;  4HCS A;  5CV5 A;  5C6A A;  1TR5 A;  3T51 B;  3WOE A;  3NHH A;  4ILW A;  4DK1 A;  1T5X D;  1FYC A;  5C0X G;  3K5O A;  4XQJ A;  3VR5 A;  3WDN A;  2K6A A;  2EY5 A;  4NDX A;  1S5C D;  2F0P A;  1D6E C;  1G2T A;  2R92 B;  2CQA A;  1VDZ A;  1I3Q B;  1DOL A;  5FK9 C;  4RHS A;  5E4X A;  3NPP A;  3X3M A;  3MC0 B;  2NVY B;  5IGB A;  1WD0 A;  2F0D A;  3U9S A;  4ME5 A;  2B2W C;  1R9T B;  2HUG A;  3HRZ C;  4E6I A;  1SYE A;  3H09 A;  1HPC A;  1O7Y A;  2F0V A;  2L0C A;  1D1K A;  1G2S A;  1MSG A;  1OXX K;  3E0J A;  1NSN S;  1H9R A;  5EKL A;  1FR3 A;  4CBV A;  1BCP F;  2PYK A;  1Y8P B;  1MI2 A;  3BDO A;  2AUK A;  1QIL A;  5KIX A;  1V8Q A;  5IT9 E;  1E2Z A;  1H9M A;  1G91 A;  1EQT A;  2B8G A;  1PFN A;  1AFP A;  4FYD A;  3PMF A;  2FFK B;  4BBR B;  1LTB D;  1II3 A;  2F0I A;  3MZ5 A;  3ERQ A;  3VA7 A;  1EY7 A;  2EVB A;  2X6G A;  1H9S A;  5ELD A;  1KLU D;  5D3I B;  3MXP A;  3PIP 3;  4OGQ C;  3F2U A;  2X69 A;  5KRU A;  1UAP A;  2MJ8 A;  4HAE A;  4WRD A;  4DXF A;  1SYB A;  3HG9 A;  2K5Q A;  1TWC B;  1J8I A;  1MSH A;  2NVQ B;  1EY0 A;  2Q8R E;  5M5W B;  4RKL A;  3S17 B;  4V19 0;  1WVL A;  2JA5 B;  3TZD A;  2BA0 A;  2NN6 G;  4K2L A;  1ZEQ X;  5I2Y A;  1LLR D;  3S1R B;  5C3W A;  2KUM A;  2D9U A;  1KTK A;  3P75 A;  3BDC A;  4BBS B;  1ZKO A;  4KHZ A;  3E5S A;  4RGM A;  1ZYR C;  1CTM A;  1G29 1;  4QUC A;  3J7A V;  4FP5 D;  2B2W A;  3EQL C;  5I6W A;  2D2C C;  3A56 A;  4QMG A;  2BOS A;  4RFB A;  5EPL A;  2O2L D;  4K8I A;  4KMU C;  3O13 A;  2KJX A;  4A3I B;  5LL6 X;  2ZXP A;  5EKK A;  1EWC A;  2BDO A;  4FF3 A;  1PYW D;  3WOF A;  1ZYR D;  1EQV A;  2KQ3 A;  5CR3 A;  1HA6 A;  3H91 A;  3KF8 A;  3S16 B;  2RQX A;  1I6H B;  1GHK A;  2PO4 A;  2N88 A;  2E2J B;  3K57 A;  4IFD G;  2F0N A;  1H9J A;  4Y7N B;  4DU9 A;  3NTH A;  1S4Z A;  3V2T A;  4OO1 G;  3CRK C;  1PLF A;  1E2V A;  1G6Z A;  4OIK A;  4IFD J;  3FDT A;  5DEH A;  5FO8 B;  1Q12 A;  4ZUI A;  2DY7 A;  3H3V C;  3D8G A;  2F0T A;  2PZU A;  1GXD C;  1JWU D;  4WFN 3;  3S2H B;  2JE6 I;  3IKJ A;  1PTO F;  3MXU A;  1I4G A;  1ROD A;  4J1M A;  3D4D A;  4EQO A;  1B9M A;  4K5X A;  1L0X B;  4BWG B;  1U9R A;  2YYZ A;  4F7X A;  1DJR D;  2L9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...