5KYLA

Crystal structure of staphylococcal nuclease variant delta+phs t62k/v66e ph 7 at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFKKKMEENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62K/V66E pH 7 at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5kylA00
4NKLA 1EYAA 5KYIA 1EY5A 1NSNS 3SK6A 2EY2A 3D4DA 5CV7A 5I9PA 1JORA 4ZUJA 3EVQA 3MXPA 2F0IA 4PMBA 4J1MA 4KHVA 2F0VA 5HURA 2PW7A 2F0FA 3TP8A 4K5VA 5JAVA 1SYBA 3MVVA 4DU9A 4QF4A 4DF7A 5J22A 4LAAA 3TP5A 1F2YA 3SR1A 5CC4A 2EXZA 5CV4A 4ME5A 5IGCA 1EY7A 1AEXA 1SNDA 2RBMA 2OF1A 3P75A 4K2KA 4NDXA 3SXHA 4B9WA 3HEJA 4IZ8A 1EY8A 5I9OA 4B9XA 3MEHA 4NMZA 2EY5A 4EQPA 2PZUA 1SNOA 3S9WA 1KABA 2F0DA 4R8NA 1A3TA 5IGBA 5KIXA 2EY1A 3D6CA 1SYGA 2PYKA 1EQVA 4E6IA 5C3XA 1STHA 1EYCA 2EYHA 2OXPA 1SYDA 4KV6A 5CV5A 5M9OA 2PZTA 3EJIA 2EYFA 5CR3A 2F0QA 2F0TA 3PMFA 4N9TA 3NP8A 4WRDA 2OEOA 1EZ6A 2F0SA 1SNQA 2RKSA 4K14A 4K8JA 2F0OA 1EY4A 1SYCA 5IGDA 2RDFA 5C4HA 5K5PA 5KGUA 3NQTA 4QMGA 3NK9A 4K5WA 2SNSA 3U9OA 5IGEA 3QOLA 1ENAA 3OMCA 1SNCA 2F0EA 5IOCA 5ISRA 1NUCA 3H6MA 3D4WA 5F2DA 1STNA 4EQNA 2EYMA 3DHQA 2F3WA 5KYLA 3SK8A 1JOKA 3RUZA 2KHSA 1TT2A 2WACA 4ZQ3A 4EQOA 3OMGA 3T16A 1EY0A 2F0GA 4ZUIA 4QB4A 1STYA 3MHBA 3NUCA 3TP7A 2EYOA 5EKLA 1JOQA 3OWFA 5IGGA 5CV6A 4HMJA 5J39A 3ITPA 4KJOA 2F0UA 4F7XA 5C3WA 3VA5A 1A2UA 4DFAA 1SNMA 2ENBA 2EYPA 1STGA 2F0LA 2LKVA 1STAA 2F0KA 3EROA 3MZ5A 2EYJA 3NHHA 4G57A 4HTHA 4RKLA 4EVOA 1TQOA 5JOBA 2SOBA 5C6AA 3ERQA 3LX0A 1II3A 3T13A 5EKKA 4ODGA 5C5LA 2O4XA 5CV9A 5EGTA 4YIJA 2NUCA 2HQEA 4H7BA 3SK4A 1KAAA 4KTAA 4ID6A 1F2MA 3NXWA 4KJNA 4KY5A 5CV8A 5J1ZA 3SK5A 5E1FA 4DGZA 1RKNA 3C1EA 1JOOA 2M00A 4OL7A 1ENCA 3E5SA 4N9PA 3P1HA 3QOJA 5C5MA 4IUNA 5IGFA 2QDBA 3BDCA 4K8IA 1U9RA 4K6DA 2EYLA 3V2TA 2PW5A 3BDLA 4IALA 5DEHA 1KDAA 4KD4A 5I6WA 2F3VA 4S3SA 2PQEA 4K2LA 5KEEA 3TMEA 5HGTA 4KY7A 1EZ8A 5E3FA 4F8MA 1A3UA 4HMIA 1IHZA 2SNMA 3HZXA 3SHLA 4J6HA 1SYEA 1EY9A 3D8GA 1F2ZA 4NP5A 1STBA 5C4ZA 1SYFA 5IODA 3R3OA 1SNPA 4PMCA 3C1FA 2F0WA 5CGKA 4RKBA 3DMUA 2F0PA 4PNYA 5KRUA 4K5XA 4TRDA 2F0HA 3QB3A 5DAUA 4KD3A 2F0JA 3OSOA 4WORA 2F0NA 5IIFA 3TP6A 5NUCA 5I6YA 1EY6A 1KDCA 4I65A 1KDBA 1A3VA 4KY6A 1A2TA 2EY6A 2PZWA 2KQ3A 1TR5A 1EYDA 4MIUA 2F0MA
chains in the Genus database with same CATH superfamily
4CJ1B 1E0BA 5IYBH 4PZ7A 4IPDA 3SK6A 3HOZG 1GD7A 4PMBA 5EPLA 1D5MC 3CPWA 1C8CA 3BVMA 4X65Q 1PTOD 3Q24A 4OO1I 2WV6D 2LSSA 4LWCA 1CK1A 2VY3A 2ATWA 4OX9Q 3HOXH 2RBMA 4JOIC 2K5HA 3OYYA 2O2LD 4KMUC 3FKIB 1LT3D 1TS4A 2IT1A 2QKIC 2YU9B 1X3GA 4R4TA 1VCIA 3QIAA 4IFDJ 3Q6SA 2K5DA 4KV6A 4FF4A 1A15A 2B2VA 5M3FH 4DV7Q 1RL2A 1TY2A 1I6HB 3NENA 2A19A 1Q1BA 2AUKA 2GA4B 5KGUA 1SYCA 1LTAD 1GM5A 4FF2A 4HJ5A 3HOWH 2K50A 3KLRA 2UXCL 1D5XC 3T1HL 2VQFQ 3OMGA 4GLXA 1EY0A 1EIFA 1PV4A 1S72A 1VS0A 3BZDB 2DY7A 3J7YW 1U4PA 4DAYA 2LKVA 4LF4Q 3G71A 2NN6I 3A8JE 2NVYB 1TQOA 3G7LA 3K0XA 4UP8A 4YCWA 5JOBA 1K73C 1L0WA 2Z9HA 2EZVA 5E4WC 2I5LX 3DM3A 1WCMG 5FKAC 2HQEA 1PZID 3E9HA 2UU9Q 1RHPA 5I2XA 3L0OA 1P8LA 1RKNA 1SE2A 3PUZA 4BY1G 2BH8A 1HZCA 4ABNA 4XXEA 1KIXA 2QDBA 1CUKA 3R93A 3VR6A 3Q22A 2KCNA 3VA7A 2AKWB 1MI2A 4KD4A 2K52A 3GTGB 1A0IA 2PQEA 4IQZA 1DCZA 1JJ2A 3I72A 1J9OA 4J6HA 3G4SA 1B2TA 4KLKA 4A3EG 3CU7A 3A7LA 1V9PA 4KKUA 5KRUA 3A8IE 4POGA 4WORA 1N36Q 1PRTC 4AQYQ 1DXMA 1I50B 2K28A 3LWEA 3GTPB 2JXMB 4FNFA 1A2TA 1WTQA 2B2YC 4HIDA 4LF6Q 1NSNS 4JI1Q 3T51B 1WI5A 1S5CD 5A2QL 4P71A 4PG3A 2ZM6Q 4Q0FA 3TSSA 5CV4A 2E76C 1LACA 4XTCS 4Y7NB 2NTSA 1PTOH 2R7FA 2N3SA 2BCOA 3TZDA 4LFAL 1I3QB 4HSVA 3QWNA 3ICEA 2BE5C 4OO1H 4HSPA 1LUZA 1SYDA 1PA6A 1EWHA 1Q7YC 2NVXB 2XVSA 1K83B 4N9TA 1H9JA 1L0XB 1ZYRD 2ES2A 3PO3G 2A68D 5G3LF 4NW2A 5IYDG 2RKSA 4JI8L 5FJ8H 4TSSA 4X64Q 2FMMA 1Q86C 3O13A 5FOBB 5IGEA 4BXXH 1ESFA 3PUXA 1NUCA 1CKOA 4B3SQ 1VQNA 2JA7B 3T4AC 1PXUA 1Q8IA 1TWAH 4CHTB 4BBRG 4ZK9B 3UE1A 3NUCA 4LF5L 2VUMG 1CM9A 1HH2P 4APVA 4IPHA 4K6LA 5C3WA 1VQKA 3GTJH 2BDNA 4RFBA 5IYBG 4RCNA 4K0KL 4GOPB 3A5ZB 1I4RA 1LTSD 1SSOA 3SVMA 2HHHQ 4DV1Q 5DLQE 2ZXOA 5ELEA 1V8QA 1PHJA 1X32A 3S15B 5EBCA 2EE1A 3CQZB 4ZYSA 5IYCH 4EGVA 2PQAA 4R1JA 1TWGB 1S5ED 2MGSA 2NYZD 3K7AB 3ONAB 5FK9C 3I55A 3GDEA 2RF4A 5DEHA 3HOYH 5HGTA 1VQ4A 2AWNA 1I4GA 2JQOA 1NAPA 3D8GA 1IKLA 4NP5A 5M3FG 2EDGA 5FLMH 3H91A 1SMXA 2MPMA 5ELBA 1SMYC 3M4QA 3K80C 4BBSH 1Y1VH 1G6ZA 3RN2A 2DY8A 1VQ6A 2Z6KA 3PO2B 1GO3E 2HIXA 3MA2B 1J5EQ 3M4OH 5ELCA 4OXPA 5KYIA 2X69A 2FHTA 1IBLQ 4ZUJA 1SE8A 4PZ8A 2JA8H 2F0IA 2ASBA 3KLSX 1YNNC 3K58A 5GQOA 5LL6X 4A3BH 2G9HD 4G4KA 1X65A 5A2QE 1IXRA 3NBHA 1Q3LA 2G5DA 1ESRA 3KK7A 1Y69U 1EY7A 4CKEA 3CW2C 3P75A 1KTKA 1GHKA 3DUZA 1LO5D 1EQRA 4DNRB 2A73B 4BA1I 2A6ED 2VNUD 2B2TA 3EN2A 4IJLA 3NBIA 4XIGS 1X54A 2GVAA 3RLOA 3J7AF 2CCZA 3CC4A 2OQ0A 5FO7B 3G6JB 1NR4A 2HDLA 5K5PA 1D1KA 2JK8A 1HNZQ 1FNVA 4CDCC 1JR0D 1KLUD 3H6MA 2L5TA 4JBMA 1EWIA 3I4LA 3K57A 5CMDA 1XXGA 2WACA 5BN4A 1AZQA 5G3LD 2E5LQ 3OOCA 1MSHA 3CMAA 1CSPA 3VA5A 1K28A 3CRKC 3NWTA 4ZLTF 1WTWA 2Q8TA 4RKLA 5HY6A 1FJGL 4YCUA 3LX0A 1XMQL 3ERSX 2R7ZH 2CQAA 2XN9C 4QIWE 3SK4A 1D8LA 3BDOA 4KK7A 2KUMA 4KY5A 1TWHH 1FNWA 2J7ZA 3CCMA 1W2BA 5AJ3Q 1XNQL 1MGSA 4KN4C 1PH2A 4N9PA 3P1HA 2H4OA 3V05A 3V2TA 1AW7A 1PFSA 4NXNQ 1IYUA 3F2BA 1BBWA 1VQCA 4A3GH 4JBWA 4OO1G 4DAPA 3SHLA 1TU2B 4GZYC 4LFCL 2NVQB 1F2ZA 3FRPB 1G291 2YV5A 4I7AA 4DR5Q 1LTLA 1A62A 3J7ZC 2F0HA 4KD3A 5FJ8G 5E4XA 2I5HA 2HD3A 2A69D 2IY5B 4BXXG 3H3VC 4X62Q 3MAQA 4IO9A 2D5DA 1EYDA 4Q5VA 2QW7A 2Z4IA 1JC7A 1EYAA 3KBGA 3IRBA 3PF5A 1N33L 5HURA 4HCEA 3KJOA 2DNCA 2KHJA 3U4VA 2JA6B 3GTQH 4A93H 1E2ZA 3P7JA 4CDEC 1GKHA 5ELDA 4GNXB 2D0PA 4R4OA 3SEBA 1PRTF 1R4QB 3D6WA 4DR2L 1SNDA 1XMOQ 4IZ8A 5C0XJ 4U673 1YITA 1CZGA 4B3RL 4A3FB 1Q46A 5IGBA 2F3IA 5CV5A 5IYCG 1AH9A 3HKZB 1AE2A 4JI7Q 2AQ3B 3I56A 2RQXA 3CCRA 3PGZA 2ICEC 2GVBA 2EVBA 2C35B 3HOYG 1F9SA 1SROA 2NB0A 3MFGA 4H13C 1LV9A 2PCFB 1X3QA 3GD7A 3U9OA 3OTOL 1ENAA 1H9RA 2K5WA 3GTKH 1HUMA 1IBKQ 4ME3A 3CKIB 5FLMG 3C46A 4JI2L 2JA5B 2PNHA 4BBSG 1Y1VG 4JI6Q 4QB4A 1EU3A 3OWEB 1XTDA 1SE3A 4LMQD 4KJOA 1XNRQ 4KHPQ 3M85A 2R3ZA 1A2UA 1NNXA 3N6RA 1I5FA 1STAA 3NHHA 3S17H 2JA8G 2AUJD 3T13A 1B8AA 1UEAB 3K5OA 4A3BG 4JG2A 4PMWA 3HOVB 5EKIA 3I4MB 4TKOB 1LYLA 2SEBD 3QR8A 1WYDA 2Q2HA 4F88A 4DV6Q 1MD2D 2B63H 4IOAA 3J80E 1STEA 2M00A 4A3LH 2JP1A 4IUNA 4K8IA 1W3SA 1B4OA 3DM1A 3V96A 1RTOA 2IJ0A 2UUBL 5KEEA 4OWXB 1FL0A 1QG7A 3HZXA 4YY3Q 5EAYA 2LFNA 1Y1WH 4OIKA 1WOCA 2F0PA 4DV3Q 3M4YA 5IP9H 3JAMc 1BR9A 4A3IB 4A3JH 4DV4Q 1MSGA 1XJVA 2L11A 1H9MA 3FP9A 4DR7L 3K5NA 4O0AA 3EIVA 5FLXL 1VQHA 5IT9L 3BU2A 4N8X1 3HGBA 4K5VA 2RHQB 2CW0C 1UE7A 2HUGA 1MJEA 1KLGD 2WAQE 2KCCA 1E3PA 2JN4A 4K2KA 1IYVA 2R7ZG 5EJWA 1GHJA 1EWCA 1MJCA 4EQPA 1YJNA 2OTJA 1T9HA 2KENA 2ZJRA 5KIXA 3Q23A 5C3XA 2AMCB 1HCZA 2R93B 4JVZA 3U9SA 3R2TA 3J7AV 3EJIA 2B2WA 3GTLB 3S16H 4GKKQ 4X66Q 1PRTD 2HIVA 4K8JA 4UPAA 4K14A 4FXDA 1LLRD 1WCMH 3QJYA 1EU4A 5C4HA 3W2DA 1KRSA 1R9TH 3F2UA 1IBML 4JI3L 3BJUA 2EYMA 3QO2A 2IW3A 4ZCKA 2WAQG 1D2BA 1K0SA 4DR1Q 5K36G 2DGYA 2EYOA 5EKLA 4V190 4FVMA 2CWAA 2PQAB 3OPOA 3HOUH 4A3EH 3NTKA 5C4XH 2YTXA 4C3IH 1X56A 4NB3A 1Z47A 5EKKA 5CV9A 2IHEA 3TRZA 4A93G 3MWYW 4DR3Q 3E6ZX 4X65L 2QEJC 3I70A 3NE5B 3AU7A 2BDOA 3J81i 1B53A 3VYTA 1WTHA 2PW5A 2E2IH 3ULPA 1O7YA 4A3KH 1S5FD 1Y14B 1YZ6A 2E2JH 1N32Q 3RZOB 1B9NA 2B2UC 1JQYD 1PFBA 2ZT9C 1IL2A 3GTMH 1H9KA 4LUZA 1E24A 1SYFA 5IWAQ 3CMEA 1LABA 3C1FA 1U4RA 2MFIA 1HNXQ 4BY7H 3OW7A 2EJGC 1EY6A 1QUQA 4QJFA 5IE8A 3I4NB 4KY6A 3ND8A 1L0YB 4MIUA 2F4IA 3I7FA 1YBYA 1KNAA 1QILA 1EL0A 4IJHA 1E1OA 2JJQA 2CHBD 5FLXE 4DV0Q 1F77A 5IT9E 2K01A 2NZHA 1N34L 1ZKOA 4JYAQ 4L5RC 3MXGA 2CKZB 5TSSA 3ZJYC 4IOCA 2XNAC 1BKBA 4C3HB 3L3OC 4IUUA 3KOJA 2N88A 2Q2IA 4NMZA 1I6VC 1TXYA 3SGIA 3PIO3 2PYKA 2WB1B 1I4PA 4E6IA 1STHA 4JI5Q 2B63G 1B70B 1KNEA 2PZTA 4ZRZA 1ILQA 2F0QA 4A3LG 1SMYD 1H9SA 3NP8A 1G8ZD 4WRDA 2OEOA 2KEEA 1I4XA 1VQ8A 3HP3A 3A54A 1I94L 4K5WA 4LF9Q 5IOCA 5GAEC 1CT1D 1EYGA 3GTOB 1HFNA 4TQUS 5C44B 5FO9B 1Y1WG 1YNND 4IUQA 5IP9G 5H1SE 5GROA 3LNNA 3RZDH 2FJ2A 3ND9A 4A3JG 1PZKD 5HGQA 4HIKA 2E2HH 2XSCA 1JB3A 1IZ6A 2VB3X 4ZKCB 4LFBQ 4DR6Q 2ZTDA 2EIFA 4WJ4A 1XX8A 3I90A 4L6TB 4UDUC 2LXJA 4KKSA 5EGTA 1HA5A 4HJ9A 1EFWA 3D3RA 4JW0A 3GP7A 4A3DB 5BN5A 2EXDA 3S1MH 2ZM6L 2QF7A 1GUWA 1XPUA 1IW7D 3S24A 2IWHA 3CCUA 1GUNA 3S1NH 1A3UA 3K5MA 4FF1A 2DJGC 3KDFB 1JICA 2OCEA 1JE5A 5M5YB 1A63A 2Y0SE 3BYTB 3LGJA 2L15A 4JI4Q 3I4OA 1S5DD 2UUCL 1XPOA 2E2DC 2VL6A 4A3CH 5JPNC 3UDFA 4A3MB 3F8TA 4JV5Q 2A74C 3DEPA 4JI0L 1TWFH 2K5NA 1EIHA 4IPGA 3HOUG 2UUAL 4RGOS 1T5EA 5C4XG 3SXHA 4C3IG 3KBXA 4IUVA 2P5ZX 3K59A 4DK3C 2CH4A 4JBKA 1GOZA 1M1KC 1C9OA 2Y0SG 4UP9A 1WJJA 2CWPA 5J3BA 1V1PA 4C2MH 4RG1A 1EZ6A 5C4JB 3WDNA 1SNQA 2B2VC 5M3MB 4GNXC 4A3KG 2BA1A 1YJWA 2WINB 1HHVA 1PH7A 3OMCA 2EPBA 1BO0A 3TZUA 3P20A 1JOKA 1B3AA 4M1UB 1BCPB 4QUFA 4BY7G 3S14B 1Q8KA 5IGGA 3M7GA 2F4VQ 1RJTA 4DFAA 3CCEA 2ENBA 2EYPA 1PYBA 4EVOA 3MZ5A 1U0LA 1TWCH 4HN7A 4XQQA 5C3EB 3OIQA 2XRQD 2UXCQ 3QG1A 1SAPA 2R92H 3T1HQ 1UUPA 1BCPF 1ASYA 3BZCA 1EQQA 1LT6D 3HOZB 2K75A 1X3EA 1IYJB 1OO9B 1RD9D 2L1BA 4R4CA 1E2WA 1AZPA 3RR5A 5GAGC 3BDLA 1KDAA 4RGTA 4C1NK 1K0RA 4LW1A 1D1IA 1PH4A 1YHAA 3J81c 2C5CA 1SFOH 4GLAC 3H15A 2M2LA 3L9AX 3U50C 3T1YL 3OSOA 1ENFA 4DV2L 5T1IA 1AFPA 1UAPA 3WOFA 5LMUL 4WJ3M 1HZ9A 1EIGA 4HIMA 2Q2TA 2XTIA 5BR8L 2EY2A 4B3MQ 1P16A 5DNFA 1NR2A 5LMNQ 4CBVA 2OQKA 5AFWA 1CA5A 2B29A 2J0TD 3MXNA 1Y8PB 3JAMi 4C3JH 3HG9A 2EXZA 4DR4Q 2KOLA 1HXYD 2OF1A 3FEWX 2HDMA 3HEJA 4CJ0B 3OIPA 5E7NA 2KJXA 3UDXA 3S2DH 1SNOA 4JPBW 3UDIA 2F0DA 3RMHA 1TS3A 3S1QB 3S1RB 1KRTA 4G7HC 2UXBL 1XPRA 4A3FG 3CHBD 2EQSA 1IKMA 2K5VA 3FHWA 2B3GA 1G91A 1WCMB 1UE6A 2NBFA 2RDFA 5EBDA 4DN4M 3K7UC 1QNKA 1CA6A 3E3XA 4HJ8A 1SNCA 1VQJA 5ELOA 2F0EA 4BY1B 2K6AA 3D4WA 1PTOC 1F2LA 5F2DA 1QE6A 1Y8OB 1HR0W 3KFUA 3H3VH 1B1ZA 1EFID 2CW0D 1L1OA 4QUCA 3T16A 4BS9A 4JI8Q 2TMPA 2JA5G 5CV6A 2L12A 2I0QA 3BVGA 4XQJA 4X62L 1LT4D 4A3CG 2XRSD 4G7OC 3IL8A 3DLLA 1WVLA 1WTPA 1QOHA 2BH2A 4YHHL 3JC66 3C3LA 1BQQT 1FD7D 2XWJB 3H0GH 3KF8A 3SK5A 3VR2A 1MBYA 1PH8A 3E5SA 4K0KQ 2HCCA 1XMOL 4IURA 2E2IB 4RGNA 1WTRA 2N78A 1FR3A 1QNUA 1JJGA 1IHZA 4IN3A 4JI7L 4LNQA 5JEAJ 2R6GA 4P75A 4ALPA 2SDFA 5M5XB 5CGKA 2YTVA 4GLVB 4MTKA 2NVTB 1S5BD 5IIFA 3FKIH 2YU9H 2I5MX 4XQNA 3S2HB 2PZWA 3VR4A 2PI2E 5M5WB 2B39A 3PO3B 2C9OA 3L2PA 1V1QA 2Z6KC 3M3YB 1I6HH 3CCSA 5COYA 4QQBX 5KNDA 5JAVA 4JBJA 4QF4A 4DF7A 3TBIB 3MXUA 1E1TA 3PV0A 2D2CC 1BDOA 3JAML 3I3CA 5FO8B 4BBRB 1Q81C 4LUVA 2R92G 2VUMB 1CI3M 5K36H 2MO1A 2PPBC 4RGMA 1SYGA 1HNWL 3G48A 2MUYA 1WTVA 4MNOA 4YWMA 3AYHB 2O5IC 4L5QA 2B2TC 3F1ZA 2NVYH 4X3SA 1PH1A 3KF6A 2PMZE 1M8AA 3FVQA 1ICFB 2FXQA 2L9HA 3HOXB 1HZBA 5KYLA 2RSOA 3ZYYX 4ZQ3A 4DAMA 3A7AB 4DV3L 2F0GA 3KUPA 2HQLA 1N8RC 3G6EA 2ZTCA 4HMJA 3GTGH 4GN5A 3A0JA 1LTTD 3NQIA 1RCVD 4OEMB 3MC0B 5M3FB 1TVXA 1CKNA 4ULLA 2Z8LA 4GKJL 2L55A 4I7ZC 4PZ6A 1ZYRC 4R9WA 3HOWB 1U4MA 2NUCA 4DAYB 4AYBE 3DWQA 1KAAA 1KD1C 1K8OA 4C3JG 1I50H 3GTPH 1FYCA 5CV8A 2QGQA 3VR5A 2KA7A 4X3KA 4EQ5A 1FJGQ 2EOTA 1XMQQ 1SR3A 2LXKA 4YWLA 1AP0A 1WD0A 4DNTB 1EZ8A 1BVSA 1X9NA 4QCLA 4TVAB 1PFMA 3N52A 1STBA 5C4ZA 3R3OA 1RF2D 1BOSA 4X66L 4DV5L 1MHWC 4PNYA 5T1GA 3A5UA 4TRDA 4DUYQ 1B3QA 1HR0L 4RMFA 1FVIA 1X3FA 3F2DA 4I65A 3IFDA 1I3QH 3PUVA 1TR5A 1GUGA 3PIP3 2XGTA 5I9PA 2NVXH 4LFCQ 1JORA 2JA9A 4AYBG 1K83H 4KHVA 1OXTA 4DUZQ 1NMFA 1TS2A 1Q1EA 2IX0A 2F1MA 4KI0A 1B9MA 2JYOA 2DUDA 2CFMA 3C2PA 1F2YA 2QEXA 1HPCA 3GV6A 1V1PB 4RHSA 5IGCA 1G2TA 4F87A 2PO4A 4NDXA 4B9XA 1VMPA 3A55A 3OW2A 2JA7H 1N33Q 1GUTA 4EX5A 3J80c 2CVRA 3A8KE 5EPJA 1VQ7A 1NJIC 2MHVA 2VQEL 2EYHA 1PH3A 3H0GG 5C0XH 1PZJD 3PMFA 2F0TA 2A6HC 1GVPA 4DR2Q 1G2SA 1JWMD 1MIUA 1NTGA 1VQOA 2D62A 4B3RQ 3EQLC 4QMGA 3Q8DA 1VF7A 3QOLA 4CGYB 1NE3A 2QCPX 3CCQA 1QWYA 3S15H 4OONA 4O2DA 3I73A 3CQZH 1PVOA 4XT3B 4YWKA 3TQYA 1TWGH 1PTOB 4MTNA 3K7AH 3SDZA 4GOPA 1Q82C 5D3IB 4DK1A 1STYA 3FKIG 3TP7A 2RDHA 4RH6A 4NXMQ 2K14A 3ER0A 4F7XA 4HCSA 3OTOQ 2X6GA 3H94A 3M7NA 2A6EC 1O7ZA 2EYJA 4RAUC 1WFQA 2AHOB 2RHSB 1HA6A 1PTOF 2BA0A 4JYAL 4N8FA 4LF8L 3PO2H 1CHPD 1PMRA 1YEZA 1BCPC 1S3OA 2L0CA 3NPPA 1BF4A 4UP7A 4QIWB 3NTHA 1TWAB 4OL7A 4MHEA 4B3TL 2OT2A 3BDCA 2VZAA 1CKMA 3U58A 1HZAA 1BUVT 1B44D 1GJXA 2Z6BA 5L37A 1E2VA 3TMEA 3GTJB 1EQTA 1Z7TA 2EJMA 4JI5L 2KEDA 1R4PB 1EY9A 2RDGA 1KXLA 2V4DA 1LTBD 4RKBA 2BE5D 2AQ1B 1BXTA 4FDBA 1DOLA 3STBC 1X6OA 2Z1CA 2UUBQ 3CF5A 1SE4A 4L5SA 4OX9L 3BYYB 1A8VA 3TS0A 4J1MA 3K81C 2YYZA 3HOYB 4FF3A 1SRUA 4O42A 4R4QA 3CCJA 1K3RA 4JOIA 1QCBD 3AFQA 3CP0A 3TP5A 4CDDC 4DV7L 4LFBL 1X3PA 2WFWA 3GV3A 4BBSB 1Y1VB 4YCVA 1SBBB 1BNZA 3NBHB 2KECA 2EJFC 3NWSA 3M4OB 4OELB 1EQVA 4DK0A 4DA2A 2VW9A 2JA8B 2RCFA 3D4RA 2VQFL 1ET9A 1L1OB 1VQEA 3R8BA 4A3BB 3CC2A 1YNXA 3A74A 1WTXA 1J6QA 4U68A 1O80A 2IL8A 2B2WC 2ALYB 1B50A 4LF4L 1SJHD 2AQ2B 1STNA 2CQOA 4IFDI 1YJ9A 3KLWA 2HCIA 3X3MA 4ZUIA 1GUSA 5I4DA 1LTGD 3VYSA 2LY7A 2UU9L 2F0UA 1G51A 3KF8B 1FNUA 2F0LA 1HTLD 1VQGA 2F0KA 1IBMQ 1SXTA 2NVQH 3ERQA 4JI3Q 3T56B 4ODGA 5C5LA 5A35A 4LF7Q 1RODA 1ASZA 2VXWA 2E74C 1PH9A 3NTIA 3UI2A 1C7YA 4ID6A 1F2MA 4XT1B 3GQBA 3NSWA 2JA7G 1U9RA 1N36L 4K6DA 4AQYL 5I6WA 3D0FA 1M90C 2FFKB 4F8MA 2JA6H 1KC8C 4LF6L 2WP8J 1KAWA 1VQPA 4JI1L 5C0XG 1VF5C 4HR7B 4L8JA 2UXDQ 2R7ZB 1QZGA 1E7ZA 1EEID 3HS0C 1PFNA 2B2YA 1XYIA 4DAVA 1VQFA 4DXFA 2MO0A 3R2IA 1TWHB 4A3FH 2EY6A 5D14A 3KJPA 4GNXA 3D4DA 1UWVA 1U4LA 2V1CC 3MXPA 4C1NI 4QY7A 4A75A 1HFGA 3J81L 4A3GB 1C4QA 3TP8A 3EBEA 4FP5D 2F4VL 2Q8IB 5KNCA 4O1NA 3MFYA 1F9RA 5JVH3 2WAQB 3GO5A 3KLSA 2PZUA 3KF6B 4UAIA 1KABA 2JA5H 4DPGA 4X64L 1A3TA 1O7LA 2DN8A 1N34Q 4CJ2C 3PO2G 1EYCA 3EA6A 3W1GA 4LK1C 1HQMC 4B3SL 2EYFA 2K05A 2B8FA 4BWGB 4R8IA 3GTQB 4A93B 4FXKC 2F0OA 5IGDA 2FINB 3NK9A 4B08A 2DNEA 3HOVH 1CFMA 3I4MH 1CKNB 2RSNA 3WWVA 1DONA 2HHHL 4DV1L 1VQLA 4QGUA 3VR3A 5JVG3 1O7IA 5JJZA 3TS2A 4BA2I 5J39A 1VQDA 4DXGA 1I94Q 2KHIA 5DM73 1KQSA 1K9MC 3H3VI 4B3ML 4IFDH 3OHXC 5LMNL 2O4XA 1FGBD 3CD6A 3I91A 1CTMA 1Q90A 1TKWB 2A8VA 4H7BA 3D31A 3GTKB 1HRJA 4WFN3 1DD2A 4KTAA 4ILWA 4A3IH 5J1ZA 2KBNA 4C56C 4DR4L 2NZOA 1JOOA 5IGFA 3M4PA 1OXVA 4IALA 1DOMA 4S3SA 1J5EL 4J15A 3RN5A 1HTPA 3IAYA 2SNMA 3S17B 3DEOA 1IBLL 2J4XA 3J81j 4G7ZC 1K8GA 1JJCB 1XWEA 1YNJC 5IY0A 3I8ZA 4K5XA 5DAUA 2N55A 1JT8A 3DXJC 1A6XA 4M8AA 2F0NA 2ID0A 2R61A 3UE0A 4GN4B 3CC7A 1KDBA 2B63B 4WJWA 5IP7H 3AB9A 2KCMA 1EY5A 1HQRD 3F2CA 2R93H 2GN5A 4X3UA 2B8GA 3GTLH 1F9PA 3URYA 1NBWA 1UNSA 1ZEQX 2AWOA 3J81E 1SYBA 2FMCA 3MVVA 4DU9A 4GS3A 3E0JA 5J22A 2UUCQ 3ULJA 2TSSA 3T53B 5CC4A 3FPUB 5KNBA 1Y1WB 2NTTA 3PIOA 4B9WA 1EUJA 3TREA 2PI2A 1HNZL 3HKZE 4A3JB 2WKDA 4HJ7A 1HUNA 4JI0Q 2Z0SA 5M9OA 1QJOA 1W6JA 1JWUD 1D5ZC 3K0YA 2N8NA 3NELA 2UUAQ 5JJIA 5GAHC 1DM0B 3FDTA 2E5LL 1B7YB 1G6PA 3TN2A 3NQTA 2JA6G 4UY8C 4PQXA 2M9VA 4OIJA 3J80i 1PYSB 2L4NA 1ML0D 2YTYA 3LWUA 3X3NA 3L7ZC 2KHSA 3HOXG 2F52A 2NN6H 2O5JC 4H0LC 1JOQA 3OWFA 4DK6C 1D6EC 3RNUA 2K32A 4DKAC 4ZAIA 5CBEE 4V0BA 5AJ3L 1YHQA 3RZOH 3S16B 1Z9FA 3EROA 3HKZG 1DGSA 4NXNL 1AN8A 5D3DA 1JWSD 4YIJA 4LFAQ 1R9TB 3IFTA 4UHVA 3HOWG 3NXWA 4KJNA 1DZ1A 3I4NH 2A6HD 2OWOA 4MN3A 1U5KA 4DR5L 4AIMA 2EYLA 3RLNA 4K2LA 4RWSC 2I46A 4KY7A 5E3FA 4HIOA 3HOUB 4A3EB 1GXDC 1F9QA 1AE3A 4KHZA 4C3IB 1OTCA 5C4XB 5IODA 4PMCA 3BS1A 4C3HH 1SDFA 5GADC 2F0JA 4LF5Q 1L2FA 2N49A 5NUCA 2Y0SB 3VDYA 2LMCB 2RVLA 1EEFD 1H95A 3HOVG 3PUWA 3I4MG 5D65A 2F0MA 1N9WA 4NKLA 3RLFA 1CHQD 4MZ9A 3EVQA 3TEHB 4A3KB 2F0VA 2E2JB 1QUQB 2E75C 3K5LA 3T1YQ 1VQAA 1EIYB 1IW7C 3GTMB 4DV2Q 1BCPD 1PDQA 1SEBD 2ICIA 5LMUQ 2NZ1D 4LUOA 1NCVA 3BG3A 4IFDG 4BY7B 3PCOB 5I9OA 5BR8Q 3GTOH 3I2ZA 5C44H 4R8NA 1OXSC 2DJFC 3D6CA 4A4IA 5LHY1 1IBKL 2OXPA 4A3IG 5LL6S 5CR3A 1M4VA 1Z6HA 3DWAA 1UE5A 4JI6L 3STBD 2F0SA 4NPSA 3A56A 2OTLA 5ELFA 1XNRL 4KHPL 1C48A 5C0XI 1E22A 2D9UA 2SNSA 4LJZC 4HJAA 2UXBQ 4P73A 1JE4A 1H9SB 5ISRA 4A3DH 3AEVA 3AQQA 3J80L 3FMCA 4FO2A 2F3WA 2K1BA 1TT2A 4IUPA 1QB5D 4EQOA 1QZHA 1VQMA 4DUYL 4DV6L 5IP7G 2XIWA 1SNMA 2K04A 1L1OC 2R7DA 1QVFA 4KKTA 1V43A 2R93G 5C6AA 2MJ8A 4JCVE 4H02A 2RCNA 5M5YH 2JEBI 5EPKA 1K8MA 4DUZL 1V1OA 4XYQA 3MTSA 1OXXK 2QILA 4YY3L 1PRTB 4P72A 5JJKA 3KDFA 1YIJA 3EFXD 1YVCA 5C5MA 4X3TA 2D0OA 3RZDB 1SN8A 1DYQA 1VQBA 4A3MH 4A76A 4DV4L 5I2YA 2E2HB 1LM0A 2K7VA 1RDPD 4YHHQ 4HMIA 2Q2UA 1TIID 1QVCA 4CKCA 4OWTB 3DMUA 3E0EA 4XDXA 4J8QA 3QB3A 3J7A5 4JK1C 2A68C 5CYUA 3TP6A 2LS01 3ULLA 3S1MB 5I6YA 2WKCA 5JEAH 4IPCA 1ZXTA 3UDGA 5BN3A 1EOVA 1I4HA 5CV7A 3K6OA 2A1AA 2MP1A 1ILPA 2NN6G 3W3AA 4RHRA 2K4KA 5EQ0A 1VQIA 3BVZA 2PW7A 5C4JH 3H09A 3S1NB 4RA8A 3AMUA 1IL8A 5M3MH 4NXML 1JB7A 1ICWA 1PH6A 4CKBA 1I4QA 3SR1A 5JJLA 4R4IA 4ME5A 1XNQQ 4GKKL 1CQVA 4XYOA 1EY8A 2WB1E 4Y7NH 3MEHA 1YHBA 2EY5A 4L5TA 1Q12A 1SJED 2KVMA 3S9WA 3CAMA 3S14H 1ET6A 1NMGA 1JMCA 3I4NG 1S4ZA 4CDFC 4DR1L 5C3EH 1TWFB 1EY4A 4FXGC 2A5HA 2Z4HA 1TY0A 3B6YA 1BBUA 1UE1A 1NY4A 3DWPA 3U4ZA 1HNWQ 3W5OA 2PNRC 2JEAI 3JAME 5JPMC 4EQNA 2I07B 3HOZH 3SK8A 3MEFA 1OXUA 4C3HG 3CPFA 4DR3L 1KL9A 1LTID 2K5QA 1S40A 2WB1G 1STGA 4C2MB 2MQHA 4G57A 5CORA 1DOKA 2VS1A 4P74A 1N32L 4DNIA 1WD1A 5IWAL 1CZWA 2HT1A 4IUTA 4HAEA 4OWWB 4KN7C 1HNXL 1PLFA 2JE6I 2B2UA 3CXCA 5C44G 4GKJQ 1KHIA 2F3VA 2H1EA 1C0AA 4OHJA 3FPPA 3BZKA 2ZXPA 1SYEA 1TWCB 3VYRA 2ZTEA 2QA4A 4HEDA 4DV0L 4FYDA 2R92B 2F0WA 4JI2Q 1JCKB 4AH6A 2X6LA 3SE0A 1KDCA 1Y8NB 2KQ3A 3S1RH 3S1QH 4POFA 4A3DG 1XTCD 4L63B 3K8AA 2ZJPA 1TS5A 4QL5A 1YI2A 2E8GA 3HRZC 1QVGA 4Z9CB 4DV5Q 2F0FA 5DM63 3W1BA 1HR0Q 4LAAA 1SFOB 2JSOA 4A3GG 1T5XD 3HKSA 2G9DA 2IX1A 2K33A 1CQFA 1AEXA 4BY1H 3WOEA 1WTOA 3PSIA 3AFPA 4X6AH 4LF7L 3MXNB 1D7QA 1EOTA 3IKJA 2EY1A 4LF9L 4GN3B 1MKHA 1X55A 3PUYA 1J8IA 4Y52H 2NWGA 4RCOA 1YNJD 1PYWD 3TDQA 2F03A 2H5XA 1K3BC 1PH5A 4A3MG 3CRLC 3E9IA 1BBXC 1SLJA 4C3JB 1CSQA 5LMNW 4DR6L 2ZXRA 4JC0A 2VQEQ 4DR7Q 1LTRD 2UXDL 3DHQA 2PMZB 3S2DB 1K8AC 2VB2X 3RUZA 4OGQC 3NEMA 2CH4W 3MHBA 2K03A 1GUOA 3PQIA 5JEAG 1VQ5A 3ITPA 3Q0AA 4GOPC 2A69C 3M9BA 3PF4A 1HJPA 2IHFA 4HTHA 1VDZA 3VYUA 2WIIB 1UEBA 2SOBA 2ZJQA 1II3A 3CCVA 3HFZB 2Q8RE 1W6KA 2KCTA 5M5XH 2NVTH 5M3MG 2XWBB 5CBAE 1O78A 2IX3A 5E1FA 4DGZA 3S2HH 3C1EA 4AYBB 1ENCA 5M5WH 3PO3H 3QOJA 1VMCA 4JI4L 1ONLA 1LT5D 1RIPA 5IYDH 3M3YH 2RA4A 5FLXc 5IT9c 1VQ9A 3RD4A 2BOSA 3KYHC 4LF8Q 4PV1C 2MNAA 3CCLA 4H44C 2IPKD 1SNPA 1FGUA 4JV5L 5C3EG 4BBRH 4B3TQ 4P2CB 2VUMH 1DJRD 4ZKBB 5ELNA 3PIPA 3H0GB 1A3VA 2QDLA 1RTNA
chains in the Genus database with same CATH topology
4CJ1B 1E0BA 3SK6A 4PMBA 5EPLA 1D5MC 1C8CA 3BVMA 3Q24A 1PTOD 4OO1I 2WV6D 1CK1A 2RBMA 2O2LD 4KMUC 3FKIB 1LT3D 1TS4A 2IT1A 2QKIC 2YU9B 1VCIA 3QIAA 4IFDJ 3Q6SA 2K5DA 4KV6A 4FF4A 1A15A 2B2VA 1I6HB 1TY2A 1Q1BA 2AUKA 2GA4B 5KGUA 1SYCA 1LTAD 4FF2A 3KLRA 1D5XC 3OMGA 1EY0A 3BZDB 2DY7A 3J7YW 1U4PA 4DAYA 2LKVA 2NN6I 3A8JE 2NVYB 1TQOA 3G7LA 5JOBA 2EZVA 5E4WC 5FKAC 2HQEA 1PZID 1RHPA 5I2XA 1RKNA 1SE2A 3PUZA 4ABNA 4XXEA 2QDBA 3R93A 3VR6A 3Q22A 2KCNA 3VA7A 3GTGB 1MI2A 4KD4A 2PQEA 4IQZA 1DCZA 3I72A 1J9OA 4J6HA 1B2TA 3CU7A 3A7LA 4KKUA 5KRUA 3A8IE 4WORA 1PRTC 1DXMA 1I50B 2K28A 3LWEA 3GTPB 2JXMB 4FNFA 1A2TA 1WTQA 2B2YC 1NSNS 3T51B 1S5CD 5A2QL 4Q0FA 3TSSA 5CV4A 2E76C 1LACA 4XTCS 4Y7NB 2NTSA 1PTOH 2BCOA 3TZDA 1I3QB 4HSVA 3QWNA 2BE5C 4OO1H 4HSPA 1SYDA 1EWHA 2NVXB 2XVSA 1K83B 4N9TA 1H9JA 1L0XB 1ZYRD 2A68D 5G3LF 4NW2A 2RKSA 4TSSA 2FMMA 3O13A 5FOBB 5IGEA 1ESFA 3PUXA 1NUCA 2JA7B 3T4AC 1PXUA 1Q8IA 4CHTB 4ZK9B 3NUCA 1CM9A 4K6LA 5C3WA 2BDNA 4RFBA 4RCNA 1I4RA 1LTSD 1SSOA 3SVMA 5ELEA 2ZXOA 1V8QA 1X32A 3S15B 5EBCA 2EE1A 3CQZB 4ZYSA 4EGVA 1TWGB 1S5ED 2MGSA 2NYZD 3K7AB 3ONAB 5FK9C 5DEHA 5HGTA 2AWNA 1I4GA 1NAPA 3D8GA 1IKLA 4NP5A 2EDGA 3H91A 2MPMA 5ELBA 1SMYC 1G6ZA 2DY8A 3PO2B 3MA2B 5ELCA 5KYIA 2X69A 2FHTA 4ZUJA 2F0IA 3KLSX 1YNNC 3K58A 5LL6X 2G9HD 4G4KA 5A2QE 3NBHA 1Q3LA 1ESRA 3KK7A 1Y69U 1EY7A 4CKEA 3P75A 1KTKA 1GHKA 3DUZA 1LO5D 4DNRB 2A73B 4BA1I 2A6ED 2VNUD 2B2TA 3NBIA 4XIGS 3J7AF 5FO7B 3G6JB 1NR4A 2HDLA 5K5PA 1D1KA 1FNVA 1JR0D 1KLUD 3H6MA 2L5TA 3I4LA 3K57A 5CMDA 1XXGA 2WACA 5BN4A 1AZQA 5G3LD 3OOCA 1MSHA 3VA5A 3CRKC 3NWTA 4ZLTF 1WTWA 2Q8TA 4RKLA 3LX0A 2CQAA 2XN9C 3SK4A 3BDOA 4KK7A 2KUMA 4KY5A 1FNWA 2J7ZA 1MGSA 4KN4C 4N9PA 3P1HA 2H4OA 3V05A 3V2TA 1AW7A 1IYUA 4JBWA 4OO1G 4DAPA 3SHLA 1TU2B 4GZYC 2NVQB 1F2ZA 3FRPB 1G291 2F0HA 4KD3A 5E4XA 2A69D 3H3VC 3MAQA 2D5DA 1EYDA 4Q5VA 2Z4IA 1JC7A 1EYAA 3KBGA 5HURA 4HCEA 2DNCA 2JA6B 1E2ZA 3P7JA 5ELDA 3SEBA 1PRTF 1R4QB 3D6WA 1SNDA 4IZ8A 5C0XJ 4U673 1CZGA 4A3FB 5IGBA 5CV5A 3HKZB 2AQ3B 2RQXA 2ICEC 2EVBA 1F9SA 2NB0A 3MFGA 4H13C 1LV9A 2PCFB 1X3QA 3GD7A 3U9OA 1ENAA 1H9RA 2K5WA 1HUMA 3CKIB 3C46A 2JA5B 4QB4A 1EU3A 3OWEB 1SE3A 4LMQD 4KJOA 3M85A 2R3ZA 1A2UA 3N6RA 1STAA 3NHHA 2AUJD 3T13A 1UEAB 3K5OA 4PMWA 3HOVB 5EKIA 3I4MB 4TKOB 2SEBD 4F88A 1MD2D 3J80E 1STEA 2M00A 2JP1A 4IUNA 4K8IA 1B4OA 3DM1A 3V96A 1RTOA 2IJ0A 5KEEA 1QG7A 3HZXA 2LFNA 4OIKA 2F0PA 3M4YA 1BR9A 4A3IB 1MSGA 2L11A 1H9MA 3K5NA 5FLXL 5IT9L 3HGBA 4K5VA 2CW0C 2HUGA 1KLGD 2KCCA 4K2KA 1IYVA 5EJWA 1GHJA 1EWCA 4EQPA 5KIXA 3Q23A 5C3XA 1HCZA 2R93B 3U9SA 3R2TA 3J7AV 3EJIA 2B2WA 3GTLB 1PRTD 4K8JA 4K14A 4FXDA 1LLRD 3QJYA 1EU4A 5C4HA 3W2DA 3F2UA 2EYMA 3QO2A 2IW3A 1D2BA 5K36G 2EYOA 5EKLA 4V190 4FVMA 3OPOA 3NTKA 1Z47A 5EKKA 5CV9A 3MWYW 3E6ZX 2QEJC 3I70A 3NE5B 3AU7A 2BDOA 1B53A 3VYTA 2PW5A 1O7YA 1S5FD 3RZOB 1B9NA 2B2UC 1JQYD 1PFBA 2ZT9C 1H9KA 1SYFA 1LABA 3C1FA 1U4RA 3OW7A 2EJGC 1EY6A 3I4NB 4KY6A 3ND8A 1L0YB 4MIUA 2F4IA 1KNAA 1QILA 1EL0A 2CHBD 5FLXE 1F77A 5IT9E 2K01A 1ZKOA 3MXGA 5TSSA 4C3HB 2XNAC 3L3OC 4IUUA 2N88A 4NMZA 1I6VC 3PIO3 2PYKA 2WB1B 1I4PA 4E6IA 1STHA 1KNEA 2PZTA 4ZRZA 1ILQA 2F0QA 1SMYD 1H9SA 3NP8A 1G8ZD 4WRDA 2OEOA 2KEEA 1I4XA 3HP3A 3A54A 4K5WA 5IOCA 1CT1D 3GTOB 1HFNA 4TQUS 5C44B 5FO9B 1YNND 4IUQA 3LNNA 2FJ2A 3ND9A 1PZKD 2XSCA 1JB3A 2VB3X 4ZKCB 1XX8A 3I90A 4L6TB 4UDUC 4KKSA 5EGTA 1HA5A 3D3RA 3GP7A 4A3DB 5BN5A 2QF7A 1GUWA 1IW7D 2IWHA 1GUNA 1A3UA 3K5MA 4FF1A 1JICA 5M5YB 3BYTB 1S5DD 2E2DC 5JPNC 4A3MB 2A74C 3DEPA 1EIHA 4RGOS 1T5EA 3SXHA 4C3IG 3KBXA 4IUVA 3K59A 1GOZA 1V1PA 1EZ6A 5C4JB 3WDNA 1SNQA 2B2VC 5M3MB 2BA1A 2WINB 1HHVA 3OMCA 2EPBA 1BO0A 3TZUA 3P20A 1JOKA 1B3AA 4M1UB 1BCPB 4QUFA 3S14B 5IGGA 3M7GA 1RJTA 4DFAA 2ENBA 2EYPA 4EVOA 3MZ5A 4HN7A 4XQQA 5C3EB 3OIQA 2XRQD 3QG1A 1SAPA 1UUPA 1BCPF 1LT6D 3HOZB 1OO9B 1RD9D 2L1BA 1E2WA 1AZPA 3BDLA 1KDAA 4RGTA 4C1NK 1D1IA 2C5CA 2M2LA 3L9AX 3OSOA 1ENFA 5T1IA 1AFPA 1UAPA 3WOFA 1EIGA 2EY2A 5DNFA 1NR2A 4CBVA 5AFWA 1CA5A 2J0TD 3MXNA 1Y8PB 3HG9A 2EXZA 2KOLA 1HXYD 2OF1A 3FEWX 2HDMA 3HEJA 4CJ0B 3OIPA 2KJXA 1SNOA 2F0DA 3RMHA 1TS3A 3S1QB 3S1RB 4G7HC 3CHBD 1IKMA 1G91A 1WCMB 2NBFA 2RDFA 5EBDA 4DN4M 1QNKA 1CA6A 1SNCA 2F0EA 4BY1B 2K6AA 3D4WA 1PTOC 1F2LA 5F2DA 1QE6A 1Y8OB 1B1ZA 1EFID 2CW0D 3T16A 4QUCA 4BS9A 2TMPA 5CV6A 2L12A 3BVGA 4XQJA 1LT4D 2XRSD 4G7OC 3IL8A 1WVLA 1WTPA 1QOHA 3C3LA 1BQQT 1FD7D 2XWJB 3SK5A 3KF8A 3VR2A 1MBYA 3E5SA 2HCCA 4IURA 2E2IB 4RGNA 1WTRA 1FR3A 1QNUA 1IHZA 4IN3A 5JEAJ 2R6GA 2SDFA 5M5XB 5CGKA 2NVTB 1S5BD 5IIFA 4XQNA 3S2HB 2PZWA 3VR4A 5M5WB 2B39A 3PO3B 2C9OA 3M3YB 5COYA 5KNDA 5JAVA 4QF4A 4DF7A 3TBIB 3MXUA 3PV0A 2D2CC 1BDOA 3JAML 3I3CA 5FO8B 4BBRB 2VUMB 1CI3M 5K36H 2PPBC 4RGMA 1SYGA 2MUYA 1WTVA 2O5IC 2B2TC 4X3SA 1M8AA 3FVQA 2L9HA 3HOXB 5KYLA 2RSOA 3ZYYX 4ZQ3A 3A7AB 2F0GA 3KUPA 4HMJA 3NQIA 1LTTD 1RCVD 3MC0B 5M3FB 1TVXA 4ULLA 2Z8LA 2L55A 4I7ZC 1ZYRC 4R9WA 3HOWB 1U4MA 2NUCA 3DWQA 1KAAA 1K8OA 4C3JG 1FYCA 5CV8A 3VR5A 2KA7A 4X3KA 2EOTA 1AP0A 1WD0A 4DNTB 1EZ8A 4QCLA 1PFMA 3N52A 1STBA 5C4ZA 3R3OA 1RF2D 1BOSA 4PNYA 5T1GA 4TRDA 4I65A 3IFDA 3PUVA 1TR5A 1GUGA 3PIP3 5I9PA 1JORA 4KHVA 1OXTA 1TS2A 1Q1EA 2IX0A 2F1MA 4KI0A 1B9MA 2JYOA 3C2PA 1F2YA 1HPCA 3GV6A 1V1PB 4RHSA 5IGCA 1G2TA 4F87A 2PO4A 4NDXA 4B9XA 1VMPA 3A55A 1GUTA 2CVRA 3A8KE 5EPJA 2MHVA 2EYHA 5C0XH 1PZJD 3PMFA 2F0TA 2A6HC 1G2SA 1JWMD 2D62A 3EQLC 4QMGA 1VF7A 3QOLA 4CGYB 2QCPX 1QWYA 3I73A 4XT3B 1PTOB 3SDZA 5D3IB 4DK1A 1STYA 3TP7A 2RDHA 4RH6A 4F7XA 4HCSA 2X6GA 3H94A 3M7NA 2A6EC 1O7ZA 2EYJA 4RAUC 1HA6A 1PTOF 2BA0A 1CHPD 1PMRA 1BCPC 2L0CA 3NPPA 1BF4A 4QIWB 3NTHA 1TWAB 4OL7A 4MHEA 2OT2A 3BDCA 1BUVT 1B44D 1GJXA 1E2VA 3TMEA 3GTJB 1EQTA 1Z7TA 2EJMA 2KEDA 1R4PB 1EY9A 2RDGA 2V4DA 1LTBD 4RKBA 2BE5D 2AQ1B 1BXTA 1DOLA 2Z1CA 1SE4A 3BYYB 4J1MA 2YYZA 3HOYB 4FF3A 4O42A 1QCBD 3TP5A 1X3PA 3GV3A 4BBSB 1Y1VB 1SBBB 1BNZA 2KECA 2EJFC 3NWSA 3M4OB 1EQVA 4DK0A 4DA2A 2JA8B 3D4RA 1ET9A 3R8BA 4A3BB 1WTXA 4U68A 1O80A 2IL8A 2B2WC 1B50A 1SJHD 2AQ2B 1STNA 4IFDI 2HCIA 3X3MA 4ZUIA 1GUSA 5I4DA 1LTGD 3VYSA 2LY7A 2F0UA 1FNUA 2F0LA 1HTLD 2F0KA 1SXTA 3ERQA 3T56B 4ODGA 5C5LA 5A35A 1RODA 2VXWA 2E74C 3NTIA 3UI2A 4ID6A 1F2MA 4XT1B 3GQBA 3NSWA 1U9RA 4K6DA 5I6WA 2FFKB 4F8MA 2WP8J 5C0XG 1VF5C 4HR7B 4L8JA 2R7ZB 1EEID 3HS0C 1PFNA 2B2YA 1XYIA 4DAVA 4DXFA 3R2IA 1TWHB 2EY6A 5D14A 3D4DA 1U4LA 3MXPA 4C1NI 1HFGA 3J81L 4A3GB 1C4QA 3TP8A 4FP5D 2Q8IB 5KNCA 4O1NA 3MFYA 1F9RA 5JVH3 2WAQB 3GO5A 3KLSA 2PZUA 4UAIA 1KABA 1A3TA 1O7LA 2DN8A 4CJ2C 1EYCA 3EA6A 4LK1C 1HQMC 2EYFA 2K05A 2B8FA 4BWGB 4R8IA 3GTQB 4A93B 4FXKC 2F0OA 5IGDA 2FINB 3NK9A 4B08A 2DNEA 1CFMA 2RSNA 1DONA 3VR3A 5JVG3 5JJZA 4BA2I 5J39A 4DXGA 5DM73 4IFDH 3OHXC 2O4XA 1FGBD 3I91A 1CTMA 1Q90A 1TKWB 4H7BA 3D31A 3GTKB 1HRJA 4WFN3 1DD2A 4KTAA 4ILWA 5J1ZA 4C56C 1JOOA 5IGFA 1OXVA 4IALA 1DOMA 4S3SA 1HTPA 3IAYA 2SNMA 3S17B 3DEOA 2J4XA 4G7ZC 1XWEA 1YNJC 3I8ZA 4K5XA 5DAUA 2N55A 3DXJC 1A6XA 4M8AA 2F0NA 2ID0A 2R61A 1KDBA 2B63B 4WJWA 3AB9A 1EY5A 1HQRD 4X3UA 2B8GA 1F9PA 3URYA 1UNSA 1ZEQX 2AWOA 3J81E 1SYBA 2FMCA 3MVVA 4DU9A 3E0JA 5J22A 2TSSA 3T53B 5CC4A 3FPUB 5KNBA 1Y1WB 2NTTA 4B9WA 4A3JB 2WKDA 1HUNA 5M9OA 1QJOA 1W6JA 1JWUD 1D5ZC 3K0YA 1DM0B 3FDTA 3TN2A 3NQTA 4PQXA 2M9VA 4OIJA 2L4NA 1ML0D 3LWUA 3X3NA 3L7ZC 2KHSA 2NN6H 2O5JC 4H0LC 1JOQA 3OWFA 1D6EC 2K32A 4ZAIA 5CBEE 4V0BA 3S16B 3EROA 1AN8A 5D3DA 1JWSD 4YIJA 1R9TB 3IFTA 3NXWA 4KJNA 1DZ1A 2A6HD 4MN3A 2EYLA 4K2LA 4RWSC 2I46A 4KY7A 5E3FA 3HOUB 4A3EB 1GXDC 1F9QA 4KHZA 5C4XB 4C3IB 5IODA 4PMCA 3BS1A 1SDFA 2F0JA 5NUCA 2Y0SB 2LMCB 2RVLA 1EEFD 3PUWA 5D65A 2F0MA 4NKLA 3RLFA 1CHQD 3EVQA 4A3KB 2F0VA 2E2JB 2E75C 3K5LA 1IW7C 3GTMB 1BCPD 1PDQA 1SEBD 2ICIA 2NZ1D 1NCVA 3BG3A 4IFDG 4BY7B 5I9OA 4R8NA 1OXSC 3D6CA 5LHY1 2OXPA 5LL6S 5CR3A 1M4VA 1Z6HA 3DWAA 2F0SA 3A56A 5ELFA 1C48A 5C0XI 2D9UA 2SNSA 4LJZC 1JE4A 1H9SB 5ISRA 3J80L 3FMCA 4FO2A 2F3WA 2K1BA 1TT2A 4IUPA 1QB5D 4EQOA 2XIWA 1SNMA 2K04A 4KKTA 1V43A 5C6AA 2MJ8A 2JEBI 5EPKA 1K8MA 1V1OA 4XYQA 3MTSA 1OXXK 2QILA 1PRTB 3EFXD 5C5MA 4X3TA 3RZDB 1DYQA 5I2YA 2E2HB 2K7VA 1RDPD 4HMIA 1TIID 4CKCA 3DMUA 4XDXA 4J8QA 3QB3A 4JK1C 2A68C 5CYUA 3TP6A 2LS01 3S1MB 5I6YA 2WKCA 5JEAH 1ZXTA 5BN3A 1I4HA 5CV7A 3K6OA 2MP1A 1ILPA 2NN6G 3W3AA 4RHRA 5EQ0A 3BVZA 2PW7A 3S1NB 3H09A 4RA8A 3AMUA 1IL8A 1ICWA 4CKBA 1I4QA 3SR1A 4ME5A 1CQVA 4XYOA 1EY8A 3MEHA 2EY5A 3S9WA 1Q12A 1SJED 2KVMA 1ET6A 1S4ZA 1TWFB 1EY4A 4FXGC 2A5HA 2Z4HA 1TY0A 3DWPA 2PNRC 2JEAI 3JAME 5JPMC 4EQNA 2I07B 3SK8A 1OXUA 4C3HG 1LTID 2K5QA 1STGA 4C2MB 4G57A 5CORA 1DOKA 1WD1A 1CZWA 4IUTA 4HAEA 4KN7C 1PLFA 2JE6I 2B2UA 2F3VA 2H1EA 4OHJA 3FPPA 2ZXPA 1SYEA 1TWCB 3VYRA 4HEDA 4FYDA 2R92B 2F0WA 1JCKB 2X6LA 3SE0A 1KDCA 1Y8NB 2KQ3A 1XTCD 4L63B 1TS5A 3HRZC 4Z9CB 2F0FA 5DM63 4LAAA 1SFOB 2JSOA 1T5XD 2G9DA 2IX1A 2K33A 1CQFA 1AEXA 3WOEA 1WTOA 1EOTA 3IKJA 2EY1A 3PUYA 1J8IA 2NWGA 4RCOA 1YNJD 1PYWD 3TDQA 2F03A 3CRLC 1BBXC 4C3JB 2ZXRA 1LTRD 3DHQA 2PMZB 3S2DB 2VB2X 3RUZA 4OGQC 3MHBA 2K03A 1GUOA 5JEAG 3ITPA 3Q0AA 2A69C 4HTHA 1VDZA 3VYUA 2WIIB 2SOBA 1II3A 2Q8RE 1W6KA 2XWBB 5CBAE 1O78A 2IX3A 5E1FA 4DGZA 3C1EA 4AYBB 1ENCA 3QOJA 1VMCA 1ONLA 1LT5D 2RA4A 3RD4A 2BOSA 4PV1C 4H44C 2IPKD 1SNPA 4P2CB 1DJRD 4ZKBB 3H0GB 1A3VA 1RTNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NKL A;  1EYA A;  5KYI A;  1EY5 A;  1NSN S;  3SK6 A;  2EY2 A;  3D4D A;  5CV7 A;  5I9P A;  1JOR A;  4ZUJ A;  3EVQ A;  3MXP A;  2F0I A;  4PMB A;  4J1M A;  4KHV A;  2F0V A;  5HUR A;  2PW7 A;  2F0F A;  3TP8 A;  4K5V A;  5JAV A;  1SYB A;  3MVV A;  4DU9 A;  4QF4 A;  4DF7 A;  5J22 A;  4LAA A;  3TP5 A;  1F2Y A;  3SR1 A;  5CC4 A;  2EXZ A;  5CV4 A;  4ME5 A;  5IGC A;  1EY7 A;  1AEX A;  1SND A;  2RBM A;  2OF1 A;  3P75 A;  4K2K A;  4NDX A;  3SXH A;  4B9W A;  3HEJ A;  4IZ8 A;  1EY8 A;  5I9O A;  4B9X A;  3MEH A;  4NMZ A;  2EY5 A;  4EQP A;  2PZU A;  1SNO A;  3S9W A;  1KAB A;  2F0D A;  4R8N A;  1A3T A;  5IGB A;  5KIX A;  2EY1 A;  3D6C A;  1SYG A;  2PYK A;  1EQV A;  4E6I A;  5C3X A;  1STH A;  1EYC A;  2EYH A;  2OXP A;  1SYD A;  4KV6 A;  5CV5 A;  5M9O A;  2PZT A;  3EJI A;  2EYF A;  5CR3 A;  2F0Q A;  2F0T A;  3PMF A;  4N9T A;  3NP8 A;  4WRD A;  2OEO A;  1EZ6 A;  2F0S A;  1SNQ A;  2RKS A;  4K14 A;  4K8J A;  2F0O A;  1EY4 A;  1SYC A;  5IGD A;  2RDF A;  5C4H A;  5K5P A;  5KGU A;  3NQT A;  4QMG A;  3NK9 A;  4K5W A;  2SNS A;  3U9O A;  5IGE A;  3QOL A;  1ENA A;  3OMC A;  1SNC A;  2F0E A;  5IOC A;  5ISR A;  1NUC A;  3H6M A;  3D4W A;  5F2D A;  1STN A;  4EQN A;  2EYM A;  3DHQ A;  2F3W A;  5KYL A;  3SK8 A;  1JOK A;  3RUZ A;  2KHS A;  1TT2 A;  2WAC A;  4ZQ3 A;  4EQO A;  3OMG A;  3T16 A;  1EY0 A;  2F0G A;  4ZUI A;  4QB4 A;  1STY A;  3MHB A;  3NUC A;  3TP7 A;  2EYO A;  5EKL A;  1JOQ A;  3OWF A;  5IGG A;  5CV6 A;  4HMJ A;  5J39 A;  3ITP A;  4KJO A;  2F0U A;  4F7X A;  5C3W A;  3VA5 A;  1A2U A;  4DFA A;  1SNM A;  2ENB A;  2EYP A;  1STG A;  2F0L A;  2LKV A;  1STA A;  2F0K A;  3ERO A;  3MZ5 A;  2EYJ A;  3NHH A;  4G57 A;  4HTH A;  4RKL A;  4EVO A;  1TQO A;  5JOB A;  2SOB A;  5C6A A;  3ERQ A;  3LX0 A;  1II3 A;  3T13 A;  5EKK A;  4ODG A;  5C5L A;  2O4X A;  5CV9 A;  5EGT A;  4YIJ A;  2NUC A;  2HQE A;  4H7B A;  3SK4 A;  1KAA A;  4KTA A;  4ID6 A;  1F2M A;  3NXW A;  4KJN A;  4KY5 A;  5CV8 A;  5J1Z A;  3SK5 A;  5E1F A;  4DGZ A;  1RKN A;  3C1E A;  1JOO A;  2M00 A;  4OL7 A;  1ENC A;  3E5S A;  4N9P A;  3P1H A;  3QOJ A;  5C5M A;  4IUN A;  5IGF A;  2QDB A;  3BDC A;  4K8I A;  1U9R A;  4K6D A;  2EYL A;  3V2T A;  2PW5 A;  3BDL A;  4IAL A;  5DEH A;  1KDA A;  4KD4 A;  5I6W A;  2F3V A;  4S3S A;  2PQE A;  4K2L A;  5KEE A;  3TME A;  5HGT A;  4KY7 A;  1EZ8 A;  5E3F A;  4F8M A;  1A3U A;  4HMI A;  1IHZ A;  2SNM A;  3HZX A;  3SHL A;  4J6H A;  1SYE A;  1EY9 A;  3D8G A;  1F2Z A;  4NP5 A;  1STB A;  5C4Z A;  1SYF A;  5IOD A;  3R3O A;  1SNP A;  4PMC A;  3C1F A;  2F0W A;  5CGK A;  4RKB A;  3DMU A;  2F0P A;  4PNY A;  5KRU A;  4K5X A;  4TRD A;  2F0H A;  3QB3 A;  5DAU A;  4KD3 A;  2F0J A;  3OSO A;  4WOR A;  2F0N A;  5IIF A;  3TP6 A;  5NUC A;  5I6Y A;  1EY6 A;  1KDC A;  4I65 A;  1KDB A;  1A3V A;  4KY6 A;  1A2T A;  2EY6 A;  2PZW A;  2KQ3 A;  1TR5 A;  1EYD A;  4MIU A;  2F0M A; 
#chains in the Genus database with same CATH topology
 4CJ1 B;  1E0B A;  5IYB H;  4PZ7 A;  4IPD A;  3SK6 A;  3HOZ G;  1GD7 A;  4PMB A;  5EPL A;  1D5M C;  3CPW A;  1C8C A;  3BVM A;  4X65 Q;  1PTO D;  3Q24 A;  4OO1 I;  2WV6 D;  2LSS A;  4LWC A;  1CK1 A;  2VY3 A;  2ATW A;  4OX9 Q;  3HOX H;  2RBM A;  4JOI C;  2K5H A;  3OYY A;  2O2L D;  4KMU C;  3FKI B;  1LT3 D;  1TS4 A;  2IT1 A;  2QKI C;  2YU9 B;  1X3G A;  4R4T A;  1VCI A;  3QIA A;  4IFD J;  3Q6S A;  2K5D A;  4KV6 A;  4FF4 A;  1A15 A;  2B2V A;  5M3F H;  4DV7 Q;  1RL2 A;  1TY2 A;  1I6H B;  3NEN A;  2A19 A;  1Q1B A;  2AUK A;  2GA4 B;  5KGU A;  1SYC A;  1LTA D;  1GM5 A;  4FF2 A;  4HJ5 A;  3HOW H;  2K50 A;  3KLR A;  2UXC L;  1D5X C;  3T1H L;  2VQF Q;  3OMG A;  4GLX A;  1EY0 A;  1EIF A;  1PV4 A;  1S72 A;  1VS0 A;  3BZD B;  2DY7 A;  3J7Y W;  1U4P A;  4DAY A;  2LKV A;  4LF4 Q;  3G71 A;  2NN6 I;  3A8J E;  2NVY B;  1TQO A;  3G7L A;  3K0X A;  4UP8 A;  4YCW A;  5JOB A;  1K73 C;  1L0W A;  2Z9H A;  2EZV A;  5E4W C;  2I5L X;  3DM3 A;  1WCM G;  5FKA C;  2HQE A;  1PZI D;  3E9H A;  2UU9 Q;  1RHP A;  5I2X A;  3L0O A;  1P8L A;  1RKN A;  1SE2 A;  3PUZ A;  4BY1 G;  2BH8 A;  1HZC A;  4ABN A;  4XXE A;  1KIX A;  2QDB A;  1CUK A;  3R93 A;  3VR6 A;  3Q22 A;  2KCN A;  3VA7 A;  2AKW B;  1MI2 A;  4KD4 A;  2K52 A;  3GTG B;  1A0I A;  2PQE A;  4IQZ A;  1DCZ A;  1JJ2 A;  3I72 A;  1J9O A;  4J6H A;  3G4S A;  1B2T A;  4KLK A;  4A3E G;  3CU7 A;  3A7L A;  1V9P A;  4KKU A;  5KRU A;  3A8I E;  4POG A;  4WOR A;  1N36 Q;  1PRT C;  4AQY Q;  1DXM A;  1I50 B;  2K28 A;  3LWE A;  3GTP B;  2JXM B;  4FNF A;  1A2T A;  1WTQ A;  2B2Y C;  4HID A;  4LF6 Q;  1NSN S;  4JI1 Q;  3T51 B;  1WI5 A;  1S5C D;  5A2Q L;  4P71 A;  4PG3 A;  2ZM6 Q;  4Q0F A;  3TSS A;  5CV4 A;  2E76 C;  1LAC A;  4XTC S;  4Y7N B;  2NTS A;  1PTO H;  2R7F A;  2N3S A;  2BCO A;  3TZD A;  4LFA L;  1I3Q B;  4HSV A;  3QWN A;  3ICE A;  2BE5 C;  4OO1 H;  4HSP A;  1LUZ A;  1SYD A;  1PA6 A;  1EWH A;  1Q7Y C;  2NVX B;  2XVS A;  1K83 B;  4N9T A;  1H9J A;  1L0X B;  1ZYR D;  2ES2 A;  3PO3 G;  2A68 D;  5G3L F;  4NW2 A;  5IYD G;  2RKS A;  4JI8 L;  5FJ8 H;  4TSS A;  4X64 Q;  2FMM A;  1Q86 C;  3O13 A;  5FOB B;  5IGE A;  4BXX H;  1ESF A;  3PUX A;  1NUC A;  1CKO A;  4B3S Q;  1VQN A;  2JA7 B;  3T4A C;  1PXU A;  1Q8I A;  1TWA H;  4CHT B;  4BBR G;  4ZK9 B;  3UE1 A;  3NUC A;  4LF5 L;  2VUM G;  1CM9 A;  1HH2 P;  4APV A;  4IPH A;  4K6L A;  5C3W A;  1VQK A;  3GTJ H;  2BDN A;  4RFB A;  5IYB G;  4RCN A;  4K0K L;  4GOP B;  3A5Z B;  1I4R A;  1LTS D;  1SSO A;  3SVM A;  2HHH Q;  4DV1 Q;  5DLQ E;  2ZXO A;  5ELE A;  1V8Q A;  1PHJ A;  1X32 A;  3S15 B;  5EBC A;  2EE1 A;  3CQZ B;  4ZYS A;  5IYC H;  4EGV A;  2PQA A;  4R1J A;  1TWG B;  1S5E D;  2MGS A;  2NYZ D;  3K7A B;  3ONA B;  5FK9 C;  3I55 A;  3GDE A;  2RF4 A;  5DEH A;  3HOY H;  5HGT A;  1VQ4 A;  2AWN A;  1I4G A;  2JQO A;  1NAP A;  3D8G A;  1IKL A;  4NP5 A;  5M3F G;  2EDG A;  5FLM H;  3H91 A;  1SMX A;  2MPM A;  5ELB A;  1SMY C;  3M4Q A;  3K80 C;  4BBS H;  1Y1V H;  1G6Z A;  3RN2 A;  2DY8 A;  1VQ6 A;  2Z6K A;  3PO2 B;  1GO3 E;  2HIX A;  3MA2 B;  1J5E Q;  3M4O H;  5ELC A;  4OXP A;  5KYI A;  2X69 A;  2FHT A;  1IBL Q;  4ZUJ A;  1SE8 A;  4PZ8 A;  2JA8 H;  2F0I A;  2ASB A;  3KLS X;  1YNN C;  3K58 A;  5GQO A;  5LL6 X;  4A3B H;  2G9H D;  4G4K A;  1X65 A;  5A2Q E;  1IXR A;  3NBH A;  1Q3L A;  2G5D A;  1ESR A;  3KK7 A;  1Y69 U;  1EY7 A;  4CKE A;  3CW2 C;  3P75 A;  1KTK A;  1GHK A;  3DUZ A;  1LO5 D;  1EQR A;  4DNR B;  2A73 B;  4BA1 I;  2A6E D;  2VNU D;  2B2T A;  3EN2 A;  4IJL A;  3NBI A;  4XIG S;  1X54 A;  2GVA A;  3RLO A;  3J7A F;  2CCZ A;  3CC4 A;  2OQ0 A;  5FO7 B;  3G6J B;  1NR4 A;  2HDL A;  5K5P A;  1D1K A;  2JK8 A;  1HNZ Q;  1FNV A;  4CDC C;  1JR0 D;  1KLU D;  3H6M A;  2L5T A;  4JBM A;  1EWI A;  3I4L A;  3K57 A;  5CMD A;  1XXG A;  2WAC A;  5BN4 A;  1AZQ A;  5G3L D;  2E5L Q;  3OOC A;  1MSH A;  3CMA A;  1CSP A;  3VA5 A;  1K28 A;  3CRK C;  3NWT A;  4ZLT F;  1WTW A;  2Q8T A;  4RKL A;  5HY6 A;  1FJG L;  4YCU A;  3LX0 A;  1XMQ L;  3ERS X;  2R7Z H;  2CQA A;  2XN9 C;  4QIW E;  3SK4 A;  1D8L A;  3BDO A;  4KK7 A;  2KUM A;  4KY5 A;  1TWH H;  1FNW A;  2J7Z A;  3CCM A;  1W2B A;  5AJ3 Q;  1XNQ L;  1MGS A;  4KN4 C;  1PH2 A;  4N9P A;  3P1H A;  2H4O A;  3V05 A;  3V2T A;  1AW7 A;  1PFS A;  4NXN Q;  1IYU A;  3F2B A;  1BBW A;  1VQC A;  4A3G H;  4JBW A;  4OO1 G;  4DAP A;  3SHL A;  1TU2 B;  4GZY C;  4LFC L;  2NVQ B;  1F2Z A;  3FRP B;  1G29 1;  2YV5 A;  4I7A A;  4DR5 Q;  1LTL A;  1A62 A;  3J7Z C;  2F0H A;  4KD3 A;  5FJ8 G;  5E4X A;  2I5H A;  2HD3 A;  2A69 D;  2IY5 B;  4BXX G;  3H3V C;  4X62 Q;  3MAQ A;  4IO9 A;  2D5D A;  1EYD A;  4Q5V A;  2QW7 A;  2Z4I A;  1JC7 A;  1EYA A;  3KBG A;  3IRB A;  3PF5 A;  1N33 L;  5HUR A;  4HCE A;  3KJO A;  2DNC A;  2KHJ A;  3U4V A;  2JA6 B;  3GTQ H;  4A93 H;  1E2Z A;  3P7J A;  4CDE C;  1GKH A;  5ELD A;  4GNX B;  2D0P A;  4R4O A;  3SEB A;  1PRT F;  1R4Q B;  3D6W A;  4DR2 L;  1SND A;  1XMO Q;  4IZ8 A;  5C0X J;  4U67 3;  1YIT A;  1CZG A;  4B3R L;  4A3F B;  1Q46 A;  5IGB A;  2F3I A;  5CV5 A;  5IYC G;  1AH9 A;  3HKZ B;  1AE2 A;  4JI7 Q;  2AQ3 B;  3I56 A;  2RQX A;  3CCR A;  3PGZ A;  2ICE C;  2GVB A;  2EVB A;  2C35 B;  3HOY G;  1F9S A;  1SRO A;  2NB0 A;  3MFG A;  4H13 C;  1LV9 A;  2PCF B;  1X3Q A;  3GD7 A;  3U9O A;  3OTO L;  1ENA A;  1H9R A;  2K5W A;  3GTK H;  1HUM A;  1IBK Q;  4ME3 A;  3CKI B;  5FLM G;  3C46 A;  4JI2 L;  2JA5 B;  2PNH A;  4BBS G;  1Y1V G;  4JI6 Q;  4QB4 A;  1EU3 A;  3OWE B;  1XTD A;  1SE3 A;  4LMQ D;  4KJO A;  1XNR Q;  4KHP Q;  3M85 A;  2R3Z A;  1A2U A;  1NNX A;  3N6R A;  1I5F A;  1STA A;  3NHH A;  3S17 H;  2JA8 G;  2AUJ D;  3T13 A;  1B8A A;  1UEA B;  3K5O A;  4A3B G;  4JG2 A;  4PMW A;  3HOV B;  5EKI A;  3I4M B;  4TKO B;  1LYL A;  2SEB D;  3QR8 A;  1WYD A;  2Q2H A;  4F88 A;  4DV6 Q;  1MD2 D;  2B63 H;  4IOA A;  3J80 E;  1STE A;  2M00 A;  4A3L H;  2JP1 A;  4IUN A;  4K8I A;  1W3S A;  1B4O A;  3DM1 A;  3V96 A;  1RTO A;  2IJ0 A;  2UUB L;  5KEE A;  4OWX B;  1FL0 A;  1QG7 A;  3HZX A;  4YY3 Q;  5EAY A;  2LFN A;  1Y1W H;  4OIK A;  1WOC A;  2F0P A;  4DV3 Q;  3M4Y A;  5IP9 H;  3JAM c;  1BR9 A;  4A3I B;  4A3J H;  4DV4 Q;  1MSG A;  1XJV A;  2L11 A;  1H9M A;  3FP9 A;  4DR7 L;  3K5N A;  4O0A A;  3EIV A;  5FLX L;  1VQH A;  5IT9 L;  3BU2 A;  4N8X 1;  3HGB A;  4K5V A;  2RHQ B;  2CW0 C;  1UE7 A;  2HUG A;  1MJE A;  1KLG D;  2WAQ E;  2KCC A;  1E3P A;  2JN4 A;  4K2K A;  1IYV A;  2R7Z G;  5EJW A;  1GHJ A;  1EWC A;  1MJC A;  4EQP A;  1YJN A;  2OTJ A;  1T9H A;  2KEN A;  2ZJR A;  5KIX A;  3Q23 A;  5C3X A;  2AMC B;  1HCZ A;  2R93 B;  4JVZ A;  3U9S A;  3R2T A;  3J7A V;  3EJI A;  2B2W A;  3GTL B;  3S16 H;  4GKK Q;  4X66 Q;  1PRT D;  2HIV A;  4K8J A;  4UPA A;  4K14 A;  4FXD A;  1LLR D;  1WCM H;  3QJY A;  1EU4 A;  5C4H A;  3W2D A;  1KRS A;  1R9T H;  3F2U A;  1IBM L;  4JI3 L;  3BJU A;  2EYM A;  3QO2 A;  2IW3 A;  4ZCK A;  2WAQ G;  1D2B A;  1K0S A;  4DR1 Q;  5K36 G;  2DGY A;  2EYO A;  5EKL A;  4V19 0;  4FVM A;  2CWA A;  2PQA B;  3OPO A;  3HOU H;  4A3E H;  3NTK A;  5C4X H;  2YTX A;  4C3I H;  1X56 A;  4NB3 A;  1Z47 A;  5EKK A;  5CV9 A;  2IHE A;  3TRZ A;  4A93 G;  3MWY W;  4DR3 Q;  3E6Z X;  4X65 L;  2QEJ C;  3I70 A;  3NE5 B;  3AU7 A;  2BDO A;  3J81 i;  1B53 A;  3VYT A;  1WTH A;  2PW5 A;  2E2I H;  3ULP A;  1O7Y A;  4A3K H;  1S5F D;  1Y14 B;  1YZ6 A;  2E2J H;  1N32 Q;  3RZO B;  1B9N A;  2B2U C;  1JQY D;  1PFB A;  2ZT9 C;  1IL2 A;  3GTM H;  1H9K A;  4LUZ A;  1E24 A;  1SYF A;  5IWA Q;  3CME A;  1LAB A;  3C1F A;  1U4R A;  2MFI A;  1HNX Q;  4BY7 H;  3OW7 A;  2EJG C;  1EY6 A;  1QUQ A;  4QJF A;  5IE8 A;  3I4N B;  4KY6 A;  3ND8 A;  1L0Y B;  4MIU A;  2F4I A;  3I7F A;  1YBY A;  1KNA A;  1QIL A;  1EL0 A;  4IJH A;  1E1O A;  2JJQ A;  2CHB D;  5FLX E;  4DV0 Q;  1F77 A;  5IT9 E;  2K01 A;  2NZH A;  1N34 L;  1ZKO A;  4JYA Q;  4L5R C;  3MXG A;  2CKZ B;  5TSS A;  3ZJY C;  4IOC A;  2XNA C;  1BKB A;  4C3H B;  3L3O C;  4IUU A;  3KOJ A;  2N88 A;  2Q2I A;  4NMZ A;  1I6V C;  1TXY A;  3SGI A;  3PIO 3;  2PYK A;  2WB1 B;  1I4P A;  4E6I A;  1STH A;  4JI5 Q;  2B63 G;  1B70 B;  1KNE A;  2PZT A;  4ZRZ A;  1ILQ A;  2F0Q A;  4A3L G;  1SMY D;  1H9S A;  3NP8 A;  1G8Z D;  4WRD A;  2OEO A;  2KEE A;  1I4X A;  1VQ8 A;  3HP3 A;  3A54 A;  1I94 L;  4K5W A;  4LF9 Q;  5IOC A;  5GAE C;  1CT1 D;  1EYG A;  3GTO B;  1HFN A;  4TQU S;  5C44 B;  5FO9 B;  1Y1W G;  1YNN D;  4IUQ A;  5IP9 G;  5H1S E;  5GRO A;  3LNN A;  3RZD H;  2FJ2 A;  3ND9 A;  4A3J G;  1PZK D;  5HGQ A;  4HIK A;  2E2H H;  2XSC A;  1JB3 A;  1IZ6 A;  2VB3 X;  4ZKC B;  4LFB Q;  4DR6 Q;  2ZTD A;  2EIF A;  4WJ4 A;  1XX8 A;  3I90 A;  4L6T B;  4UDU C;  2LXJ A;  4KKS A;  5EGT A;  1HA5 A;  4HJ9 A;  1EFW A;  3D3R A;  4JW0 A;  3GP7 A;  4A3D B;  5BN5 A;  2EXD A;  3S1M H;  2ZM6 L;  2QF7 A;  1GUW A;  1XPU A;  1IW7 D;  3S24 A;  2IWH A;  3CCU A;  1GUN A;  3S1N H;  1A3U A;  3K5M A;  4FF1 A;  2DJG C;  3KDF B;  1JIC A;  2OCE A;  1JE5 A;  5M5Y B;  1A63 A;  2Y0S E;  3BYT B;  3LGJ A;  2L15 A;  4JI4 Q;  3I4O A;  1S5D D;  2UUC L;  1XPO A;  2E2D C;  2VL6 A;  4A3C H;  5JPN C;  3UDF A;  4A3M B;  3F8T A;  4JV5 Q;  2A74 C;  3DEP A;  4JI0 L;  1TWF H;  2K5N A;  1EIH A;  4IPG A;  3HOU G;  2UUA L;  4RGO S;  1T5E A;  5C4X G;  3SXH A;  4C3I G;  3KBX A;  4IUV A;  2P5Z X;  3K59 A;  4DK3 C;  2CH4 A;  4JBK A;  1GOZ A;  1M1K C;  1C9O A;  2Y0S G;  4UP9 A;  1WJJ A;  2CWP A;  5J3B A;  1V1P A;  4C2M H;  4RG1 A;  1EZ6 A;  5C4J B;  3WDN A;  1SNQ A;  2B2V C;  5M3M B;  4GNX C;  4A3K G;  2BA1 A;  1YJW A;  2WIN B;  1HHV A;  1PH7 A;  3OMC A;  2EPB A;  1BO0 A;  3TZU A;  3P20 A;  1JOK A;  1B3A A;  4M1U B;  1BCP B;  4QUF A;  4BY7 G;  3S14 B;  1Q8K A;  5IGG A;  3M7G A;  2F4V Q;  1RJT A;  4DFA A;  3CCE A;  2ENB A;  2EYP A;  1PYB A;  4EVO A;  3MZ5 A;  1U0L A;  1TWC H;  4HN7 A;  4XQQ A;  5C3E B;  3OIQ A;  2XRQ D;  2UXC Q;  3QG1 A;  1SAP A;  2R92 H;  3T1H Q;  1UUP A;  1BCP F;  1ASY A;  3BZC A;  1EQQ A;  1LT6 D;  3HOZ B;  2K75 A;  1X3E A;  1IYJ B;  1OO9 B;  1RD9 D;  2L1B A;  4R4C A;  1E2W A;  1AZP A;  3RR5 A;  5GAG C;  3BDL A;  1KDA A;  4RGT A;  4C1N K;  1K0R A;  4LW1 A;  1D1I A;  1PH4 A;  1YHA A;  3J81 c;  2C5C A;  1SFO H;  4GLA C;  3H15 A;  2M2L A;  3L9A X;  3U50 C;  3T1Y L;  3OSO A;  1ENF A;  4DV2 L;  5T1I A;  1AFP A;  1UAP A;  3WOF A;  5LMU L;  4WJ3 M;  1HZ9 A;  1EIG A;  4HIM A;  2Q2T A;  2XTI A;  5BR8 L;  2EY2 A;  4B3M Q;  1P16 A;  5DNF A;  1NR2 A;  5LMN Q;  4CBV A;  2OQK A;  5AFW A;  1CA5 A;  2B29 A;  2J0T D;  3MXN A;  1Y8P B;  3JAM i;  4C3J H;  3HG9 A;  2EXZ A;  4DR4 Q;  2KOL A;  1HXY D;  2OF1 A;  3FEW X;  2HDM A;  3HEJ A;  4CJ0 B;  3OIP A;  5E7N A;  2KJX A;  3UDX A;  3S2D H;  1SNO A;  4JPB W;  3UDI A;  2F0D A;  3RMH A;  1TS3 A;  3S1Q B;  3S1R B;  1KRT A;  4G7H C;  2UXB L;  1XPR A;  4A3F G;  3CHB D;  2EQS A;  1IKM A;  2K5V A;  3FHW A;  2B3G A;  1G91 A;  1WCM B;  1UE6 A;  2NBF A;  2RDF A;  5EBD A;  4DN4 M;  3K7U C;  1QNK A;  1CA6 A;  3E3X A;  4HJ8 A;  1SNC A;  1VQJ A;  5ELO A;  2F0E A;  4BY1 B;  2K6A A;  3D4W A;  1PTO C;  1F2L A;  5F2D A;  1QE6 A;  1Y8O B;  1HR0 W;  3KFU A;  3H3V H;  1B1Z A;  1EFI D;  2CW0 D;  1L1O A;  4QUC A;  3T16 A;  4BS9 A;  4JI8 Q;  2TMP A;  2JA5 G;  5CV6 A;  2L12 A;  2I0Q A;  3BVG A;  4XQJ A;  4X62 L;  1LT4 D;  4A3C G;  2XRS D;  4G7O C;  3IL8 A;  3DLL A;  1WVL A;  1WTP A;  1QOH A;  2BH2 A;  4YHH L;  3JC6 6;  3C3L A;  1BQQ T;  1FD7 D;  2XWJ B;  3H0G H;  3KF8 A;  3SK5 A;  3VR2 A;  1MBY A;  1PH8 A;  3E5S A;  4K0K Q;  2HCC A;  1XMO L;  4IUR A;  2E2I B;  4RGN A;  1WTR A;  2N78 A;  1FR3 A;  1QNU A;  1JJG A;  1IHZ A;  4IN3 A;  4JI7 L;  4LNQ A;  5JEA J;  2R6G A;  4P75 A;  4ALP A;  2SDF A;  5M5X B;  5CGK A;  2YTV A;  4GLV B;  4MTK A;  2NVT B;  1S5B D;  5IIF A;  3FKI H;  2YU9 H;  2I5M X;  4XQN A;  3S2H B;  2PZW A;  3VR4 A;  2PI2 E;  5M5W B;  2B39 A;  3PO3 B;  2C9O A;  3L2P A;  1V1Q A;  2Z6K C;  3M3Y B;  1I6H H;  3CCS A;  5COY A;  4QQB X;  5KND A;  5JAV A;  4JBJ A;  4QF4 A;  4DF7 A;  3TBI B;  3MXU A;  1E1T A;  3PV0 A;  2D2C C;  1BDO A;  3JAM L;  3I3C A;  5FO8 B;  4BBR B;  1Q81 C;  4LUV A;  2R92 G;  2VUM B;  1CI3 M;  5K36 H;  2MO1 A;  2PPB C;  4RGM A;  1SYG A;  1HNW L;  3G48 A;  2MUY A;  1WTV A;  4MNO A;  4YWM A;  3AYH B;  2O5I C;  4L5Q A;  2B2T C;  3F1Z A;  2NVY H;  4X3S A;  1PH1 A;  3KF6 A;  2PMZ E;  1M8A A;  3FVQ A;  1ICF B;  2FXQ A;  2L9H A;  3HOX B;  1HZB A;  5KYL A;  2RSO A;  3ZYY X;  4ZQ3 A;  4DAM A;  3A7A B;  4DV3 L;  2F0G A;  3KUP A;  2HQL A;  1N8R C;  3G6E A;  2ZTC A;  4HMJ A;  3GTG H;  4GN5 A;  3A0J A;  1LTT D;  3NQI A;  1RCV D;  4OEM B;  3MC0 B;  5M3F B;  1TVX A;  1CKN A;  4ULL A;  2Z8L A;  4GKJ L;  2L55 A;  4I7Z C;  4PZ6 A;  1ZYR C;  4R9W A;  3HOW B;  1U4M A;  2NUC A;  4DAY B;  4AYB E;  3DWQ A;  1KAA A;  1KD1 C;  1K8O A;  4C3J G;  1I50 H;  3GTP H;  1FYC A;  5CV8 A;  2QGQ A;  3VR5 A;  2KA7 A;  4X3K A;  4EQ5 A;  1FJG Q;  2EOT A;  1XMQ Q;  1SR3 A;  2LXK A;  4YWL A;  1AP0 A;  1WD0 A;  4DNT B;  1EZ8 A;  1BVS A;  1X9N A;  4QCL A;  4TVA B;  1PFM A;  3N52 A;  1STB A;  5C4Z A;  3R3O A;  1RF2 D;  1BOS A;  4X66 L;  4DV5 L;  1MHW C;  4PNY A;  5T1G A;  3A5U A;  4TRD A;  4DUY Q;  1B3Q A;  1HR0 L;  4RMF A;  1FVI A;  1X3F A;  3F2D A;  4I65 A;  3IFD A;  1I3Q H;  3PUV A;  1TR5 A;  1GUG A;  3PIP 3;  2XGT A;  5I9P A;  2NVX H;  4LFC Q;  1JOR A;  2JA9 A;  4AYB G;  1K83 H;  4KHV A;  1OXT A;  4DUZ Q;  1NMF A;  1TS2 A;  1Q1E A;  2IX0 A;  2F1M A;  4KI0 A;  1B9M A;  2JYO A;  2DUD A;  2CFM A;  3C2P A;  1F2Y A;  2QEX A;  1HPC A;  3GV6 A;  1V1P B;  4RHS A;  5IGC A;  1G2T A;  4F87 A;  2PO4 A;  4NDX A;  4B9X A;  1VMP A;  3A55 A;  3OW2 A;  2JA7 H;  1N33 Q;  1GUT A;  4EX5 A;  3J80 c;  2CVR A;  3A8K E;  5EPJ A;  1VQ7 A;  1NJI C;  2MHV A;  2VQE L;  2EYH A;  1PH3 A;  3H0G G;  5C0X H;  1PZJ D;  3PMF A;  2F0T A;  2A6H C;  1GVP A;  4DR2 Q;  1G2S A;  1JWM D;  1MIU A;  1NTG A;  1VQO A;  2D62 A;  4B3R Q;  3EQL C;  4QMG A;  3Q8D A;  1VF7 A;  3QOL A;  4CGY B;  1NE3 A;  2QCP X;  3CCQ A;  1QWY A;  3S15 H;  4OON A;  4O2D A;  3I73 A;  3CQZ H;  1PVO A;  4XT3 B;  4YWK A;  3TQY A;  1TWG H;  1PTO B;  4MTN A;  3K7A H;  3SDZ A;  4GOP A;  1Q82 C;  5D3I B;  4DK1 A;  1STY A;  3FKI G;  3TP7 A;  2RDH A;  4RH6 A;  4NXM Q;  2K14 A;  3ER0 A;  4F7X A;  4HCS A;  3OTO Q;  2X6G A;  3H94 A;  3M7N A;  2A6E C;  1O7Z A;  2EYJ A;  4RAU C;  1WFQ A;  2AHO B;  2RHS B;  1HA6 A;  1PTO F;  2BA0 A;  4JYA L;  4N8F A;  4LF8 L;  3PO2 H;  1CHP D;  1PMR A;  1YEZ A;  1BCP C;  1S3O A;  2L0C A;  3NPP A;  1BF4 A;  4UP7 A;  4QIW B;  3NTH A;  1TWA B;  4OL7 A;  4MHE A;  4B3T L;  2OT2 A;  3BDC A;  2VZA A;  1CKM A;  3U58 A;  1HZA A;  1BUV T;  1B44 D;  1GJX A;  2Z6B A;  5L37 A;  1E2V A;  3TME A;  3GTJ B;  1EQT A;  1Z7T A;  2EJM A;  4JI5 L;  2KED A;  1R4P B;  1EY9 A;  2RDG A;  1KXL A;  2V4D A;  1LTB D;  4RKB A;  2BE5 D;  2AQ1 B;  1BXT A;  4FDB A;  1DOL A;  3STB C;  1X6O A;  2Z1C A;  2UUB Q;  3CF5 A;  1SE4 A;  4L5S A;  4OX9 L;  3BYY B;  1A8V A;  3TS0 A;  4J1M A;  3K81 C;  2YYZ A;  3HOY B;  4FF3 A;  1SRU A;  4O42 A;  4R4Q A;  3CCJ A;  1K3R A;  4JOI A;  1QCB D;  3AFQ A;  3CP0 A;  3TP5 A;  4CDD C;  4DV7 L;  4LFB L;  1X3P A;  2WFW A;  3GV3 A;  4BBS B;  1Y1V B;  4YCV A;  1SBB B;  1BNZ A;  3NBH B;  2KEC A;  2EJF C;  3NWS A;  3M4O B;  4OEL B;  1EQV A;  4DK0 A;  4DA2 A;  2VW9 A;  2JA8 B;  2RCF A;  3D4R A;  2VQF L;  1ET9 A;  1L1O B;  1VQE A;  3R8B A;  4A3B B;  3CC2 A;  1YNX A;  3A74 A;  1WTX A;  1J6Q A;  4U68 A;  1O80 A;  2IL8 A;  2B2W C;  2ALY B;  1B50 A;  4LF4 L;  1SJH D;  2AQ2 B;  1STN A;  2CQO A;  4IFD I;  1YJ9 A;  3KLW A;  2HCI A;  3X3M A;  4ZUI A;  1GUS A;  5I4D A;  1LTG D;  3VYS A;  2LY7 A;  2UU9 L;  2F0U A;  1G51 A;  3KF8 B;  1FNU A;  2F0L A;  1HTL D;  1VQG A;  2F0K A;  1IBM Q;  1SXT A;  2NVQ H;  3ERQ A;  4JI3 Q;  3T56 B;  4ODG A;  5C5L A;  5A35 A;  4LF7 Q;  1ROD A;  1ASZ A;  2VXW A;  2E74 C;  1PH9 A;  3NTI A;  3UI2 A;  1C7Y A;  4ID6 A;  1F2M A;  4XT1 B;  3GQB A;  3NSW A;  2JA7 G;  1U9R A;  1N36 L;  4K6D A;  4AQY L;  5I6W A;  3D0F A;  1M90 C;  2FFK B;  4F8M A;  2JA6 H;  1KC8 C;  4LF6 L;  2WP8 J;  1KAW A;  1VQP A;  4JI1 L;  5C0X G;  1VF5 C;  4HR7 B;  4L8J A;  2UXD Q;  2R7Z B;  1QZG A;  1E7Z A;  1EEI D;  3HS0 C;  1PFN A;  2B2Y A;  1XYI A;  4DAV A;  1VQF A;  4DXF A;  2MO0 A;  3R2I A;  1TWH B;  4A3F H;  2EY6 A;  5D14 A;  3KJP A;  4GNX A;  3D4D A;  1UWV A;  1U4L A;  2V1C C;  3MXP A;  4C1N I;  4QY7 A;  4A75 A;  1HFG A;  3J81 L;  4A3G B;  1C4Q A;  3TP8 A;  3EBE A;  4FP5 D;  2F4V L;  2Q8I B;  5KNC A;  4O1N A;  3MFY A;  1F9R A;  5JVH 3;  2WAQ B;  3GO5 A;  3KLS A;  2PZU A;  3KF6 B;  4UAI A;  1KAB A;  2JA5 H;  4DPG A;  4X64 L;  1A3T A;  1O7L A;  2DN8 A;  1N34 Q;  4CJ2 C;  3PO2 G;  1EYC A;  3EA6 A;  3W1G A;  4LK1 C;  1HQM C;  4B3S L;  2EYF A;  2K05 A;  2B8F A;  4BWG B;  4R8I A;  3GTQ B;  4A93 B;  4FXK C;  2F0O A;  5IGD A;  2FIN B;  3NK9 A;  4B08 A;  2DNE A;  3HOV H;  1CFM A;  3I4M H;  1CKN B;  2RSN A;  3WWV A;  1DON A;  2HHH L;  4DV1 L;  1VQL A;  4QGU A;  3VR3 A;  5JVG 3;  1O7I A;  5JJZ A;  3TS2 A;  4BA2 I;  5J39 A;  1VQD A;  4DXG A;  1I94 Q;  2KHI A;  5DM7 3;  1KQS A;  1K9M C;  3H3V I;  4B3M L;  4IFD H;  3OHX C;  5LMN L;  2O4X A;  1FGB D;  3CD6 A;  3I91 A;  1CTM A;  1Q90 A;  1TKW B;  2A8V A;  4H7B A;  3D31 A;  3GTK B;  1HRJ A;  4WFN 3;  1DD2 A;  4KTA A;  4ILW A;  4A3I H;  5J1Z A;  2KBN A;  4C56 C;  4DR4 L;  2NZO A;  1JOO A;  5IGF A;  3M4P A;  1OXV A;  4IAL A;  1DOM A;  4S3S A;  1J5E L;  4J15 A;  3RN5 A;  1HTP A;  3IAY A;  2SNM A;  3S17 B;  3DEO A;  1IBL L;  2J4X A;  3J81 j;  4G7Z C;  1K8G A;  1JJC B;  1XWE A;  1YNJ C;  5IY0 A;  3I8Z A;  4K5X A;  5DAU A;  2N55 A;  1JT8 A;  3DXJ C;  1A6X A;  4M8A A;  2F0N A;  2ID0 A;  2R61 A;  3UE0 A;  4GN4 B;  3CC7 A;  1KDB A;  2B63 B;  4WJW A;  5IP7 H;  3AB9 A;  2KCM A;  1EY5 A;  1HQR D;  3F2C A;  2R93 H;  2GN5 A;  4X3U A;  2B8G A;  3GTL H;  1F9P A;  3URY A;  1NBW A;  1UNS A;  1ZEQ X;  2AWO A;  3J81 E;  1SYB A;  2FMC A;  3MVV A;  4DU9 A;  4GS3 A;  3E0J A;  5J22 A;  2UUC Q;  3ULJ A;  2TSS A;  3T53 B;  5CC4 A;  3FPU B;  5KNB A;  1Y1W B;  2NTT A;  3PIO A;  4B9W A;  1EUJ A;  3TRE A;  2PI2 A;  1HNZ L;  3HKZ E;  4A3J B;  2WKD A;  4HJ7 A;  1HUN A;  4JI0 Q;  2Z0S A;  5M9O A;  1QJO A;  1W6J A;  1JWU D;  1D5Z C;  3K0Y A;  2N8N A;  3NEL A;  2UUA Q;  5JJI A;  5GAH C;  1DM0 B;  3FDT A;  2E5L L;  1B7Y B;  1G6P A;  3TN2 A;  3NQT A;  2JA6 G;  4UY8 C;  4PQX A;  2M9V A;  4OIJ A;  3J80 i;  1PYS B;  2L4N A;  1ML0 D;  2YTY A;  3LWU A;  3X3N A;  3L7Z C;  2KHS A;  3HOX G;  2F52 A;  2NN6 H;  2O5J C;  4H0L C;  1JOQ A;  3OWF A;  4DK6 C;  1D6E C;  3RNU A;  2K32 A;  4DKA C;  4ZAI A;  5CBE E;  4V0B A;  5AJ3 L;  1YHQ A;  3RZO H;  3S16 B;  1Z9F A;  3ERO A;  3HKZ G;  1DGS A;  4NXN L;  1AN8 A;  5D3D A;  1JWS D;  4YIJ A;  4LFA Q;  1R9T B;  3IFT A;  4UHV A;  3HOW G;  3NXW A;  4KJN A;  1DZ1 A;  3I4N H;  2A6H D;  2OWO A;  4MN3 A;  1U5K A;  4DR5 L;  4AIM A;  2EYL A;  3RLN A;  4K2L A;  4RWS C;  2I46 A;  4KY7 A;  5E3F A;  4HIO A;  3HOU B;  4A3E B;  1GXD C;  1F9Q A;  1AE3 A;  4KHZ A;  4C3I B;  1OTC A;  5C4X B;  5IOD A;  4PMC A;  3BS1 A;  4C3H H;  1SDF A;  5GAD C;  2F0J A;  4LF5 Q;  1L2F A;  2N49 A;  5NUC A;  2Y0S B;  3VDY A;  2LMC B;  2RVL A;  1EEF D;  1H95 A;  3HOV G;  3PUW A;  3I4M G;  5D65 A;  2F0M A;  1N9W A;  4NKL A;  3RLF A;  1CHQ D;  4MZ9 A;  3EVQ A;  3TEH B;  4A3K B;  2F0V A;  2E2J B;  1QUQ B;  2E75 C;  3K5L A;  3T1Y Q;  1VQA A;  1EIY B;  1IW7 C;  3GTM B;  4DV2 Q;  1BCP D;  1PDQ A;  1SEB D;  2ICI A;  5LMU Q;  2NZ1 D;  4LUO A;  1NCV A;  3BG3 A;  4IFD G;  4BY7 B;  3PCO B;  5I9O A;  5BR8 Q;  3GTO H;  3I2Z A;  5C44 H;  4R8N A;  1OXS C;  2DJF C;  3D6C A;  4A4I A;  5LHY 1;  1IBK L;  2OXP A;  4A3I G;  5LL6 S;  5CR3 A;  1M4V A;  1Z6H A;  3DWA A;  1UE5 A;  4JI6 L;  3STB D;  2F0S A;  4NPS A;  3A56 A;  2OTL A;  5ELF A;  1XNR L;  4KHP L;  1C48 A;  5C0X I;  1E22 A;  2D9U A;  2SNS A;  4LJZ C;  4HJA A;  2UXB Q;  4P73 A;  1JE4 A;  1H9S B;  5ISR A;  4A3D H;  3AEV A;  3AQQ A;  3J80 L;  3FMC A;  4FO2 A;  2F3W A;  2K1B A;  1TT2 A;  4IUP A;  1QB5 D;  4EQO A;  1QZH A;  1VQM A;  4DUY L;  4DV6 L;  5IP7 G;  2XIW A;  1SNM A;  2K04 A;  1L1O C;  2R7D A;  1QVF A;  4KKT A;  1V43 A;  2R93 G;  5C6A A;  2MJ8 A;  4JCV E;  4H02 A;  2RCN A;  5M5Y H;  2JEB I;  5EPK A;  1K8M A;  4DUZ L;  1V1O A;  4XYQ A;  3MTS A;  1OXX K;  2QIL A;  4YY3 L;  1PRT B;  4P72 A;  5JJK A;  3KDF A;  1YIJ A;  3EFX D;  1YVC A;  5C5M A;  4X3T A;  2D0O A;  3RZD B;  1SN8 A;  1DYQ A;  1VQB A;  4A3M H;  4A76 A;  4DV4 L;  5I2Y A;  2E2H B;  1LM0 A;  2K7V A;  1RDP D;  4YHH Q;  4HMI A;  2Q2U A;  1TII D;  1QVC A;  4CKC A;  4OWT B;  3DMU A;  3E0E A;  4XDX A;  4J8Q A;  3QB3 A;  3J7A 5;  4JK1 C;  2A68 C;  5CYU A;  3TP6 A;  2LS0 1;  3ULL A;  3S1M B;  5I6Y A;  2WKC A;  5JEA H;  4IPC A;  1ZXT A;  3UDG A;  5BN3 A;  1EOV A;  1I4H A;  5CV7 A;  3K6O A;  2A1A A;  2MP1 A;  1ILP A;  2NN6 G;  3W3A A;  4RHR A;  2K4K A;  5EQ0 A;  1VQI A;  3BVZ A;  2PW7 A;  5C4J H;  3H09 A;  3S1N B;  4RA8 A;  3AMU A;  1IL8 A;  5M3M H;  4NXM L;  1JB7 A;  1ICW A;  1PH6 A;  4CKB A;  1I4Q A;  3SR1 A;  5JJL A;  4R4I A;  4ME5 A;  1XNQ Q;  4GKK L;  1CQV A;  4XYO A;  1EY8 A;  2WB1 E;  4Y7N H;  3MEH A;  1YHB A;  2EY5 A;  4L5T A;  1Q12 A;  1SJE D;  2KVM A;  3S9W A;  3CAM A;  3S14 H;  1ET6 A;  1NMG A;  1JMC A;  3I4N G;  1S4Z A;  4CDF C;  4DR1 L;  5C3E H;  1TWF B;  1EY4 A;  4FXG C;  2A5H A;  2Z4H A;  1TY0 A;  3B6Y A;  1BBU A;  1UE1 A;  1NY4 A;  3DWP A;  3U4Z A;  1HNW Q;  3W5O A;  2PNR C;  2JEA I;  3JAM E;  5JPM C;  4EQN A;  2I07 B;  3HOZ H;  3SK8 A;  3MEF A;  1OXU A;  4C3H G;  3CPF A;  4DR3 L;  1KL9 A;  1LTI D;  2K5Q A;  1S40 A;  2WB1 G;  1STG A;  4C2M B;  2MQH A;  4G57 A;  5COR A;  1DOK A;  2VS1 A;  4P74 A;  1N32 L;  4DNI A;  1WD1 A;  5IWA L;  1CZW A;  2HT1 A;  4IUT A;  4HAE A;  4OWW B;  4KN7 C;  1HNX L;  1PLF A;  2JE6 I;  2B2U A;  3CXC A;  5C44 G;  4GKJ Q;  1KHI A;  2F3V A;  2H1E A;  1C0A A;  4OHJ A;  3FPP A;  3BZK A;  2ZXP A;  1SYE A;  1TWC B;  3VYR A;  2ZTE A;  2QA4 A;  4HED A;  4DV0 L;  4FYD A;  2R92 B;  2F0W A;  4JI2 Q;  1JCK B;  4AH6 A;  2X6L A;  3SE0 A;  1KDC A;  1Y8N B;  2KQ3 A;  3S1R H;  3S1Q H;  4POF A;  4A3D G;  1XTC D;  4L63 B;  3K8A A;  2ZJP A;  1TS5 A;  4QL5 A;  1YI2 A;  2E8G A;  3HRZ C;  1QVG A;  4Z9C B;  4DV5 Q;  2F0F A;  5DM6 3;  3W1B A;  1HR0 Q;  4LAA A;  1SFO B;  2JSO A;  4A3G G;  1T5X D;  3HKS A;  2G9D A;  2IX1 A;  2K33 A;  1CQF A;  1AEX A;  4BY1 H;  3WOE A;  1WTO A;  3PSI A;  3AFP A;  4X6A H;  4LF7 L;  3MXN B;  1D7Q A;  1EOT A;  3IKJ A;  2EY1 A;  4LF9 L;  4GN3 B;  1MKH A;  1X55 A;  3PUY A;  1J8I A;  4Y52 H;  2NWG A;  4RCO A;  1YNJ D;  1PYW D;  3TDQ A;  2F03 A;  2H5X A;  1K3B C;  1PH5 A;  4A3M G;  3CRL C;  3E9I A;  1BBX C;  1SLJ A;  4C3J B;  1CSQ A;  5LMN W;  4DR6 L;  2ZXR A;  4JC0 A;  2VQE Q;  4DR7 Q;  1LTR D;  2UXD L;  3DHQ A;  2PMZ B;  3S2D B;  1K8A C;  2VB2 X;  3RUZ A;  4OGQ C;  3NEM A;  2CH4 W;  3MHB A;  2K03 A;  1GUO A;  3PQI A;  5JEA G;  1VQ5 A;  3ITP A;  3Q0A A;  4GOP C;  2A69 C;  3M9B A;  3PF4 A;  1HJP A;  2IHF A;  4HTH A;  1VDZ A;  3VYU A;  2WII B;  1UEB A;  2SOB A;  2ZJQ A;  1II3 A;  3CCV A;  3HFZ B;  2Q8R E;  1W6K A;  2KCT A;  5M5X H;  2NVT H;  5M3M G;  2XWB B;  5CBA E;  1O78 A;  2IX3 A;  5E1F A;  4DGZ A;  3S2H H;  3C1E A;  4AYB B;  1ENC A;  5M5W H;  3PO3 H;  3QOJ A;  1VMC A;  4JI4 L;  1ONL A;  1LT5 D;  1RIP A;  5IYD H;  3M3Y H;  2RA4 A;  5FLX c;  5IT9 c;  1VQ9 A;  3RD4 A;  2BOS A;  3KYH C;  4LF8 Q;  4PV1 C;  2MNA A;  3CCL A;  4H44 C;  2IPK D;  1SNP A;  1FGU A;  4JV5 L;  5C3E G;  4BBR H;  4B3T Q;  4P2C B;  2VUM H;  1DJR D;  4ZKB B;  5ELN A;  3PIP A;  3H0G B;  1A3V A;  2QDL A;  1RTN A; 
#chains in the Genus database with same CATH homology
 4CJ1 B;  1E0B A;  3SK6 A;  4PMB A;  5EPL A;  1D5M C;  1C8C A;  3BVM A;  3Q24 A;  1PTO D;  4OO1 I;  2WV6 D;  1CK1 A;  2RBM A;  2O2L D;  4KMU C;  3FKI B;  1LT3 D;  1TS4 A;  2IT1 A;  2QKI C;  2YU9 B;  1VCI A;  3QIA A;  4IFD J;  3Q6S A;  2K5D A;  4KV6 A;  4FF4 A;  1A15 A;  2B2V A;  1I6H B;  1TY2 A;  1Q1B A;  2AUK A;  2GA4 B;  5KGU A;  1SYC A;  1LTA D;  4FF2 A;  3KLR A;  1D5X C;  3OMG A;  1EY0 A;  3BZD B;  2DY7 A;  3J7Y W;  1U4P A;  4DAY A;  2LKV A;  2NN6 I;  3A8J E;  2NVY B;  1TQO A;  3G7L A;  5JOB A;  2EZV A;  5E4W C;  5FKA C;  2HQE A;  1PZI D;  1RHP A;  5I2X A;  1RKN A;  1SE2 A;  3PUZ A;  4ABN A;  4XXE A;  2QDB A;  3R93 A;  3VR6 A;  3Q22 A;  2KCN A;  3VA7 A;  3GTG B;  1MI2 A;  4KD4 A;  2PQE A;  4IQZ A;  1DCZ A;  3I72 A;  1J9O A;  4J6H A;  1B2T A;  3CU7 A;  3A7L A;  4KKU A;  5KRU A;  3A8I E;  4WOR A;  1PRT C;  1DXM A;  1I50 B;  2K28 A;  3LWE A;  3GTP B;  2JXM B;  4FNF A;  1A2T A;  1WTQ A;  2B2Y C;  1NSN S;  3T51 B;  1S5C D;  5A2Q L;  4Q0F A;  3TSS A;  5CV4 A;  2E76 C;  1LAC A;  4XTC S;  4Y7N B;  2NTS A;  1PTO H;  2BCO A;  3TZD A;  1I3Q B;  4HSV A;  3QWN A;  2BE5 C;  4OO1 H;  4HSP A;  1SYD A;  1EWH A;  2NVX B;  2XVS A;  1K83 B;  4N9T A;  1H9J A;  1L0X B;  1ZYR D;  2A68 D;  5G3L F;  4NW2 A;  2RKS A;  4TSS A;  2FMM A;  3O13 A;  5FOB B;  5IGE A;  1ESF A;  3PUX A;  1NUC A;  2JA7 B;  3T4A C;  1PXU A;  1Q8I A;  4CHT B;  4ZK9 B;  3NUC A;  1CM9 A;  4K6L A;  5C3W A;  2BDN A;  4RFB A;  4RCN A;  1I4R A;  1LTS D;  1SSO A;  3SVM A;  5ELE A;  2ZXO A;  1V8Q A;  1X32 A;  3S15 B;  5EBC A;  2EE1 A;  3CQZ B;  4ZYS A;  4EGV A;  1TWG B;  1S5E D;  2MGS A;  2NYZ D;  3K7A B;  3ONA B;  5FK9 C;  5DEH A;  5HGT A;  2AWN A;  1I4G A;  1NAP A;  3D8G A;  1IKL A;  4NP5 A;  2EDG A;  3H91 A;  2MPM A;  5ELB A;  1SMY C;  1G6Z A;  2DY8 A;  3PO2 B;  3MA2 B;  5ELC A;  5KYI A;  2X69 A;  2FHT A;  4ZUJ A;  2F0I A;  3KLS X;  1YNN C;  3K58 A;  5LL6 X;  2G9H D;  4G4K A;  5A2Q E;  3NBH A;  1Q3L A;  1ESR A;  3KK7 A;  1Y69 U;  1EY7 A;  4CKE A;  3P75 A;  1KTK A;  1GHK A;  3DUZ A;  1LO5 D;  4DNR B;  2A73 B;  4BA1 I;  2A6E D;  2VNU D;  2B2T A;  3NBI A;  4XIG S;  3J7A F;  5FO7 B;  3G6J B;  1NR4 A;  2HDL A;  5K5P A;  1D1K A;  1FNV A;  1JR0 D;  1KLU D;  3H6M A;  2L5T A;  3I4L A;  3K57 A;  5CMD A;  1XXG A;  2WAC A;  5BN4 A;  1AZQ A;  5G3L D;  3OOC A;  1MSH A;  3VA5 A;  3CRK C;  3NWT A;  4ZLT F;  1WTW A;  2Q8T A;  4RKL A;  3LX0 A;  2CQA A;  2XN9 C;  3SK4 A;  3BDO A;  4KK7 A;  2KUM A;  4KY5 A;  1FNW A;  2J7Z A;  1MGS A;  4KN4 C;  4N9P A;  3P1H A;  2H4O A;  3V05 A;  3V2T A;  1AW7 A;  1IYU A;  4JBW A;  4OO1 G;  4DAP A;  3SHL A;  1TU2 B;  4GZY C;  2NVQ B;  1F2Z A;  3FRP B;  1G29 1;  2F0H A;  4KD3 A;  5E4X A;  2A69 D;  3H3V C;  3MAQ A;  2D5D A;  1EYD A;  4Q5V A;  2Z4I A;  1JC7 A;  1EYA A;  3KBG A;  5HUR A;  4HCE A;  2DNC A;  2JA6 B;  1E2Z A;  3P7J A;  5ELD A;  3SEB A;  1PRT F;  1R4Q B;  3D6W A;  1SND A;  4IZ8 A;  5C0X J;  4U67 3;  1CZG A;  4A3F B;  5IGB A;  5CV5 A;  3HKZ B;  2AQ3 B;  2RQX A;  2ICE C;  2EVB A;  1F9S A;  2NB0 A;  3MFG A;  4H13 C;  1LV9 A;  2PCF B;  1X3Q A;  3GD7 A;  3U9O A;  1ENA A;  1H9R A;  2K5W A;  1HUM A;  3CKI B;  3C46 A;  2JA5 B;  4QB4 A;  1EU3 A;  3OWE B;  1SE3 A;  4LMQ D;  4KJO A;  3M85 A;  2R3Z A;  1A2U A;  3N6R A;  1STA A;  3NHH A;  2AUJ D;  3T13 A;  1UEA B;  3K5O A;  4PMW A;  3HOV B;  5EKI A;  3I4M B;  4TKO B;  2SEB D;  4F88 A;  1MD2 D;  3J80 E;  1STE A;  2M00 A;  2JP1 A;  4IUN A;  4K8I A;  1B4O A;  3DM1 A;  3V96 A;  1RTO A;  2IJ0 A;  5KEE A;  1QG7 A;  3HZX A;  2LFN A;  4OIK A;  2F0P A;  3M4Y A;  1BR9 A;  4A3I B;  1MSG A;  2L11 A;  1H9M A;  3K5N A;  5FLX L;  5IT9 L;  3HGB A;  4K5V A;  2CW0 C;  2HUG A;  1KLG D;  2KCC A;  4K2K A;  1IYV A;  5EJW A;  1GHJ A;  1EWC A;  4EQP A;  5KIX A;  3Q23 A;  5C3X A;  1HCZ A;  2R93 B;  3U9S A;  3R2T A;  3J7A V;  3EJI A;  2B2W A;  3GTL B;  1PRT D;  4K8J A;  4K14 A;  4FXD A;  1LLR D;  3QJY A;  1EU4 A;  5C4H A;  3W2D A;  3F2U A;  2EYM A;  3QO2 A;  2IW3 A;  1D2B A;  5K36 G;  2EYO A;  5EKL A;  4V19 0;  4FVM A;  3OPO A;  3NTK A;  1Z47 A;  5EKK A;  5CV9 A;  3MWY W;  3E6Z X;  2QEJ C;  3I70 A;  3NE5 B;  3AU7 A;  2BDO A;  1B53 A;  3VYT A;  2PW5 A;  1O7Y A;  1S5F D;  3RZO B;  1B9N A;  2B2U C;  1JQY D;  1PFB A;  2ZT9 C;  1H9K A;  1SYF A;  1LAB A;  3C1F A;  1U4R A;  3OW7 A;  2EJG C;  1EY6 A;  3I4N B;  4KY6 A;  3ND8 A;  1L0Y B;  4MIU A;  2F4I A;  1KNA A;  1QIL A;  1EL0 A;  2CHB D;  5FLX E;  1F77 A;  5IT9 E;  2K01 A;  1ZKO A;  3MXG A;  5TSS A;  4C3H B;  2XNA C;  3L3O C;  4IUU A;  2N88 A;  4NMZ A;  1I6V C;  3PIO 3;  2PYK A;  2WB1 B;  1I4P A;  4E6I A;  1STH A;  1KNE A;  2PZT A;  4ZRZ A;  1ILQ A;  2F0Q A;  1SMY D;  1H9S A;  3NP8 A;  1G8Z D;  4WRD A;  2OEO A;  2KEE A;  1I4X A;  3HP3 A;  3A54 A;  4K5W A;  5IOC A;  1CT1 D;  3GTO B;  1HFN A;  4TQU S;  5C44 B;  5FO9 B;  1YNN D;  4IUQ A;  3LNN A;  2FJ2 A;  3ND9 A;  1PZK D;  2XSC A;  1JB3 A;  2VB3 X;  4ZKC B;  1XX8 A;  3I90 A;  4L6T B;  4UDU C;  4KKS A;  5EGT A;  1HA5 A;  3D3R A;  3GP7 A;  4A3D B;  5BN5 A;  2QF7 A;  1GUW A;  1IW7 D;  2IWH A;  1GUN A;  1A3U A;  3K5M A;  4FF1 A;  1JIC A;  5M5Y B;  3BYT B;  1S5D D;  2E2D C;  5JPN C;  4A3M B;  2A74 C;  3DEP A;  1EIH A;  4RGO S;  1T5E A;  3SXH A;  4C3I G;  3KBX A;  4IUV A;  3K59 A;  1GOZ A;  1V1P A;  1EZ6 A;  5C4J B;  3WDN A;  1SNQ A;  2B2V C;  5M3M B;  2BA1 A;  2WIN B;  1HHV A;  3OMC A;  2EPB A;  1BO0 A;  3TZU A;  3P20 A;  1JOK A;  1B3A A;  4M1U B;  1BCP B;  4QUF A;  3S14 B;  5IGG A;  3M7G A;  1RJT A;  4DFA A;  2ENB A;  2EYP A;  4EVO A;  3MZ5 A;  4HN7 A;  4XQQ A;  5C3E B;  3OIQ A;  2XRQ D;  3QG1 A;  1SAP A;  1UUP A;  1BCP F;  1LT6 D;  3HOZ B;  1OO9 B;  1RD9 D;  2L1B A;  1E2W A;  1AZP A;  3BDL A;  1KDA A;  4RGT A;  4C1N K;  1D1I A;  2C5C A;  2M2L A;  3L9A X;  3OSO A;  1ENF A;  5T1I A;  1AFP A;  1UAP A;  3WOF A;  1EIG A;  2EY2 A;  5DNF A;  1NR2 A;  4CBV A;  5AFW A;  1CA5 A;  2J0T D;  3MXN A;  1Y8P B;  3HG9 A;  2EXZ A;  2KOL A;  1HXY D;  2OF1 A;  3FEW X;  2HDM A;  3HEJ A;  4CJ0 B;  3OIP A;  2KJX A;  1SNO A;  2F0D A;  3RMH A;  1TS3 A;  3S1Q B;  3S1R B;  4G7H C;  3CHB D;  1IKM A;  1G91 A;  1WCM B;  2NBF A;  2RDF A;  5EBD A;  4DN4 M;  1QNK A;  1CA6 A;  1SNC A;  2F0E A;  4BY1 B;  2K6A A;  3D4W A;  1PTO C;  1F2L A;  5F2D A;  1QE6 A;  1Y8O B;  1B1Z A;  1EFI D;  2CW0 D;  3T16 A;  4QUC A;  4BS9 A;  2TMP A;  5CV6 A;  2L12 A;  3BVG A;  4XQJ A;  1LT4 D;  2XRS D;  4G7O C;  3IL8 A;  1WVL A;  1WTP A;  1QOH A;  3C3L A;  1BQQ T;  1FD7 D;  2XWJ B;  3SK5 A;  3KF8 A;  3VR2 A;  1MBY A;  3E5S A;  2HCC A;  4IUR A;  2E2I B;  4RGN A;  1WTR A;  1FR3 A;  1QNU A;  1IHZ A;  4IN3 A;  5JEA J;  2R6G A;  2SDF A;  5M5X B;  5CGK A;  2NVT B;  1S5B D;  5IIF A;  4XQN A;  3S2H B;  2PZW A;  3VR4 A;  5M5W B;  2B39 A;  3PO3 B;  2C9O A;  3M3Y B;  5COY A;  5KND A;  5JAV A;  4QF4 A;  4DF7 A;  3TBI B;  3MXU A;  3PV0 A;  2D2C C;  1BDO A;  3JAM L;  3I3C A;  5FO8 B;  4BBR B;  2VUM B;  1CI3 M;  5K36 H;  2PPB C;  4RGM A;  1SYG A;  2MUY A;  1WTV A;  2O5I C;  2B2T C;  4X3S A;  1M8A A;  3FVQ A;  2L9H A;  3HOX B;  5KYL A;  2RSO A;  3ZYY X;  4ZQ3 A;  3A7A B;  2F0G A;  3KUP A;  4HMJ A;  3NQI A;  1LTT D;  1RCV D;  3MC0 B;  5M3F B;  1TVX A;  4ULL A;  2Z8L A;  2L55 A;  4I7Z C;  1ZYR C;  4R9W A;  3HOW B;  1U4M A;  2NUC A;  3DWQ A;  1KAA A;  1K8O A;  4C3J G;  1FYC A;  5CV8 A;  3VR5 A;  2KA7 A;  4X3K A;  2EOT A;  1AP0 A;  1WD0 A;  4DNT B;  1EZ8 A;  4QCL A;  1PFM A;  3N52 A;  1STB A;  5C4Z A;  3R3O A;  1RF2 D;  1BOS A;  4PNY A;  5T1G A;  4TRD A;  4I65 A;  3IFD A;  3PUV A;  1TR5 A;  1GUG A;  3PIP 3;  5I9P A;  1JOR A;  4KHV A;  1OXT A;  1TS2 A;  1Q1E A;  2IX0 A;  2F1M A;  4KI0 A;  1B9M A;  2JYO A;  3C2P A;  1F2Y A;  1HPC A;  3GV6 A;  1V1P B;  4RHS A;  5IGC A;  1G2T A;  4F87 A;  2PO4 A;  4NDX A;  4B9X A;  1VMP A;  3A55 A;  1GUT A;  2CVR A;  3A8K E;  5EPJ A;  2MHV A;  2EYH A;  5C0X H;  1PZJ D;  3PMF A;  2F0T A;  2A6H C;  1G2S A;  1JWM D;  2D62 A;  3EQL C;  4QMG A;  1VF7 A;  3QOL A;  4CGY B;  2QCP X;  1QWY A;  3I73 A;  4XT3 B;  1PTO B;  3SDZ A;  5D3I B;  4DK1 A;  1STY A;  3TP7 A;  2RDH A;  4RH6 A;  4F7X A;  4HCS A;  2X6G A;  3H94 A;  3M7N A;  2A6E C;  1O7Z A;  2EYJ A;  4RAU C;  1HA6 A;  1PTO F;  2BA0 A;  1CHP D;  1PMR A;  1BCP C;  2L0C A;  3NPP A;  1BF4 A;  4QIW B;  3NTH A;  1TWA B;  4OL7 A;  4MHE A;  2OT2 A;  3BDC A;  1BUV T;  1B44 D;  1GJX A;  1E2V A;  3TME A;  3GTJ B;  1EQT A;  1Z7T A;  2EJM A;  2KED A;  1R4P B;  1EY9 A;  2RDG A;  2V4D A;  1LTB D;  4RKB A;  2BE5 D;  2AQ1 B;  1BXT A;  1DOL A;  2Z1C A;  1SE4 A;  3BYY B;  4J1M A;  2YYZ A;  3HOY B;  4FF3 A;  4O42 A;  1QCB D;  3TP5 A;  1X3P A;  3GV3 A;  4BBS B;  1Y1V B;  1SBB B;  1BNZ A;  2KEC A;  2EJF C;  3NWS A;  3M4O B;  1EQV A;  4DK0 A;  4DA2 A;  2JA8 B;  3D4R A;  1ET9 A;  3R8B A;  4A3B B;  1WTX A;  4U68 A;  1O80 A;  2IL8 A;  2B2W C;  1B50 A;  1SJH D;  2AQ2 B;  1STN A;  4IFD I;  2HCI A;  3X3M A;  4ZUI A;  1GUS A;  5I4D A;  1LTG D;  3VYS A;  2LY7 A;  2F0U A;  1FNU A;  2F0L A;  1HTL D;  2F0K A;  1SXT A;  3ERQ A;  3T56 B;  4ODG A;  5C5L A;  5A35 A;  1ROD A;  2VXW A;  2E74 C;  3NTI A;  3UI2 A;  4ID6 A;  1F2M A;  4XT1 B;  3GQB A;  3NSW A;  1U9R A;  4K6D A;  5I6W A;  2FFK B;  4F8M A;  2WP8 J;  5C0X G;  1VF5 C;  4HR7 B;  4L8J A;  2R7Z B;  1EEI D;  3HS0 C;  1PFN A;  2B2Y A;  1XYI A;  4DAV A;  4DXF A;  3R2I A;  1TWH B;  2EY6 A;  5D14 A;  3D4D A;  1U4L A;  3MXP A;  4C1N I;  1HFG A;  3J81 L;  4A3G B;  1C4Q A;  3TP8 A;  4FP5 D;  2Q8I B;  5KNC A;  4O1N A;  3MFY A;  1F9R A;  5JVH 3;  2WAQ B;  3GO5 A;  3KLS A;  2PZU A;  4UAI A;  1KAB A;  1A3T A;  1O7L A;  2DN8 A;  4CJ2 C;  1EYC A;  3EA6 A;  4LK1 C;  1HQM C;  2EYF A;  2K05 A;  2B8F A;  4BWG B;  4R8I A;  3GTQ B;  4A93 B;  4FXK C;  2F0O A;  5IGD A;  2FIN B;  3NK9 A;  4B08 A;  2DNE A;  1CFM A;  2RSN A;  1DON A;  3VR3 A;  5JVG 3;  5JJZ A;  4BA2 I;  5J39 A;  4DXG A;  5DM7 3;  4IFD H;  3OHX C;  2O4X A;  1FGB D;  3I91 A;  1CTM A;  1Q90 A;  1TKW B;  4H7B A;  3D31 A;  3GTK B;  1HRJ A;  4WFN 3;  1DD2 A;  4KTA A;  4ILW A;  5J1Z A;  4C56 C;  1JOO A;  5IGF A;  1OXV A;  4IAL A;  1DOM A;  4S3S A;  1HTP A;  3IAY A;  2SNM A;  3S17 B;  3DEO A;  2J4X A;  4G7Z C;  1XWE A;  1YNJ C;  3I8Z A;  4K5X A;  5DAU A;  2N55 A;  3DXJ C;  1A6X A;  4M8A A;  2F0N A;  2ID0 A;  2R61 A;  1KDB A;  2B63 B;  4WJW A;  3AB9 A;  1EY5 A;  1HQR D;  4X3U A;  2B8G A;  1F9P A;  3URY A;  1UNS A;  1ZEQ X;  2AWO A;  3J81 E;  1SYB A;  2FMC A;  3MVV A;  4DU9 A;  3E0J A;  5J22 A;  2TSS A;  3T53 B;  5CC4 A;  3FPU B;  5KNB A;  1Y1W B;  2NTT A;  4B9W A;  4A3J B;  2WKD A;  1HUN A;  5M9O A;  1QJO A;  1W6J A;  1JWU D;  1D5Z C;  3K0Y A;  1DM0 B;  3FDT A;  3TN2 A;  3NQT A;  4PQX A;  2M9V A;  4OIJ A;  2L4N A;  1ML0 D;  3LWU A;  3X3N A;  3L7Z C;  2KHS A;  2NN6 H;  2O5J C;  4H0L C;  1JOQ A;  3OWF A;  1D6E C;  2K32 A;  4ZAI A;  5CBE E;  4V0B A;  3S16 B;  3ERO A;  1AN8 A;  5D3D A;  1JWS D;  4YIJ A;  1R9T B;  3IFT A;  3NXW A;  4KJN A;  1DZ1 A;  2A6H D;  4MN3 A;  2EYL A;  4K2L A;  4RWS C;  2I46 A;  4KY7 A;  5E3F A;  3HOU B;  4A3E B;  1GXD C;  1F9Q A;  4KHZ A;  5C4X B;  4C3I B;  5IOD A;  4PMC A;  3BS1 A;  1SDF A;  2F0J A;  5NUC A;  2Y0S B;  2LMC B;  2RVL A;  1EEF D;  3PUW A;  5D65 A;  2F0M A;  4NKL A;  3RLF A;  1CHQ D;  3EVQ A;  4A3K B;  2F0V A;  2E2J B;  2E75 C;  3K5L A;  1IW7 C;  3GTM B;  1BCP D;  1PDQ A;  1SEB D;  2ICI A;  2NZ1 D;  1NCV A;  3BG3 A;  4IFD G;  4BY7 B;  5I9O A;  4R8N A;  1OXS C;  3D6C A;  5LHY 1;  2OXP A;  5LL6 S;  5CR3 A;  1M4V A;  1Z6H A;  3DWA A;  2F0S A;  3A56 A;  5ELF A;  1C48 A;  5C0X I;  2D9U A;  2SNS A;  4LJZ C;  1JE4 A;  1H9S B;  5ISR A;  3J80 L;  3FMC A;  4FO2 A;  2F3W A;  2K1B A;  1TT2 A;  4IUP A;  1QB5 D;  4EQO A;  2XIW A;  1SNM A;  2K04 A;  4KKT A;  1V43 A;  5C6A A;  2MJ8 A;  2JEB I;  5EPK A;  1K8M A;  1V1O A;  4XYQ A;  3MTS A;  1OXX K;  2QIL A;  1PRT B;  3EFX D;  5C5M A;  4X3T A;  3RZD B;  1DYQ A;  5I2Y A;  2E2H B;  2K7V A;  1RDP D;  4HMI A;  1TII D;  4CKC A;  3DMU A;  4XDX A;  4J8Q A;  3QB3 A;  4JK1 C;  2A68 C;  5CYU A;  3TP6 A;  2LS0 1;  3S1M B;  5I6Y A;  2WKC A;  5JEA H;  1ZXT A;  5BN3 A;  1I4H A;  5CV7 A;  3K6O A;  2MP1 A;  1ILP A;  2NN6 G;  3W3A A;  4RHR A;  5EQ0 A;  3BVZ A;  2PW7 A;  3S1N B;  3H09 A;  4RA8 A;  3AMU A;  1IL8 A;  1ICW A;  4CKB A;  1I4Q A;  3SR1 A;  4ME5 A;  1CQV A;  4XYO A;  1EY8 A;  3MEH A;  2EY5 A;  3S9W A;  1Q12 A;  1SJE D;  2KVM A;  1ET6 A;  1S4Z A;  1TWF B;  1EY4 A;  4FXG C;  2A5H A;  2Z4H A;  1TY0 A;  3DWP A;  2PNR C;  2JEA I;  3JAM E;  5JPM C;  4EQN A;  2I07 B;  3SK8 A;  1OXU A;  4C3H G;  1LTI D;  2K5Q A;  1STG A;  4C2M B;  4G57 A;  5COR A;  1DOK A;  1WD1 A;  1CZW A;  4IUT A;  4HAE A;  4KN7 C;  1PLF A;  2JE6 I;  2B2U A;  2F3V A;  2H1E A;  4OHJ A;  3FPP A;  2ZXP A;  1SYE A;  1TWC B;  3VYR A;  4HED A;  4FYD A;  2R92 B;  2F0W A;  1JCK B;  2X6L A;  3SE0 A;  1KDC A;  1Y8N B;  2KQ3 A;  1XTC D;  4L63 B;  1TS5 A;  3HRZ C;  4Z9C B;  2F0F A;  5DM6 3;  4LAA A;  1SFO B;  2JSO A;  1T5X D;  2G9D A;  2IX1 A;  2K33 A;  1CQF A;  1AEX A;  3WOE A;  1WTO A;  1EOT A;  3IKJ A;  2EY1 A;  3PUY A;  1J8I A;  2NWG A;  4RCO A;  1YNJ D;  1PYW D;  3TDQ A;  2F03 A;  3CRL C;  1BBX C;  4C3J B;  2ZXR A;  1LTR D;  3DHQ A;  2PMZ B;  3S2D B;  2VB2 X;  3RUZ A;  4OGQ C;  3MHB A;  2K03 A;  1GUO A;  5JEA G;  3ITP A;  3Q0A A;  2A69 C;  4HTH A;  1VDZ A;  3VYU A;  2WII B;  2SOB A;  1II3 A;  2Q8R E;  1W6K A;  2XWB B;  5CBA E;  1O78 A;  2IX3 A;  5E1F A;  4DGZ A;  3C1E A;  4AYB B;  1ENC A;  3QOJ A;  1VMC A;  1ONL A;  1LT5 D;  2RA4 A;  3RD4 A;  2BOS A;  4PV1 C;  4H44 C;  2IPK D;  1SNP A;  4P2C B;  1DJR D;  4ZKB B;  3H0G B;  1A3V A;  1RTN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...