2LXKA

Backbone 1h, 13c, and 15n chemical shift assignments for cold shock protein, lmcsp
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
66
structure length
66
Chain Sequence
MEQGTVKWFNAEKGFGFIERENGDDVFVHFSAIQGDGFKSLDEGQAVTFDVEEGQRGPQAANVQKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Dynamic Features of Cold-Shock Proteins of Listeriamonocytogenes, a Psychrophilic Bacterium
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Transcription
molecule keywords Cold shock-like protein CspLA
total genus 10
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2012-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2lxkA00
1VQ9A 2R7ZH 3J80c 1IBKL 1I5FA 1IBLQ 4HJ7A 4IO9A 2ZJQA 3UDFA 4LF5L 4QY7A 3U4ZA 4X64L 3S15H 4WJ3M 3OTOQ 1MIUA 2H5XA 4A3LG 1A63A 4DR2L 4A3DG 1CSPA 3DM3A 2ID0A 2UXBL 1AH9A 5LMNQ 3HOVH 2LXKA 1N34L 4KLKA 3HOYH 3HFZB 1YVCA 2QGQA 3H0GG 3PIPA 3CCVA 4OONA 4YHHQ 4AQYL 1J5EL 2OWOA 1H95A 1GO3E 3ULLA 1TXYA 3BJUA 3F8TA 1WOCA 5JEAJ 4C3IH 1HNXQ 3ICEA 3RN5A 1VQ4A 4DK6C 3K80C 4OXPA 3UE0A 3HOZG 1XMOQ 4DV2L 3CQZH 4EQ5A 4YY3L 5AJ3Q 2HIVA 4QGUA 1OXXK 4L5TA 3L2PA 4JI7L 4JV5Q 2UUBQ 4P73A 1AE2A 1VQGA 1XMQQ 4LF4Q 1L1OA 4BA1I 4HJ9A 3CC4A 2D62A 4LW1A 5FLMH 1V43A 2IX0A 3PUZA 1NY4A 2JA8H 1X54A 5K36G 1GD7A 4NXNL 5M3FH 1HR0Q 2DGYA 3EN2A 2E5LQ 4WJ4A 2LXJA 1D7QA 1JB7A 4DV7L 3I56A 1X3GA 3HOUG 3TRZA 3TS2A 3GTPH 3GD7A 1KHIA 1TWGH 4DR7Q 1XNRQ 5IP9H 4A75A 3NELA 3PUXA 4DV3L 1K0RA 3JAMc 4K0KL 4JI0L 3M7NA 2WB1G 5IYBH 1WFQA 4LFBQ 4GNXA 4LWCA 1S72A 4DAMA 1QUQB 4A3LH 1SMXA 3FHWA 3GTLH 1Q1BA 1Q46A 3PV0A 1IXRA 4H02A 4J15A 3I55A 1UWVA 1LUZA 5C3EH 4JYAQ 1S40A 3HOYG 5JEAG 5C0XI 3T1YL 1X6OA 4GNXB 2NVTH 4OO1I 4GOPA 3GTOH 2PQAB 1YBYA 4XTCS 1X3FA 4KI0A 2UXDQ 2L15A 3F1ZA 2R92G 4JBWA 4HIOA 3JC66 3K0XA 3LGJA 2XGTA 1L2FA 1WCMH 4L5SA 4JOIC 3CD6A 4HJ5A 1V9PA 4JBJA 5M5XH 2BA0A 1NMFA 1PH9A 1OXSC 4C2MH 3J7A5 1BBUA 1D8LA 2MQHA 2BH8A 1SR3A 4IPDA 4YWMA 3CXCA 2HHHQ 2UUAL 4JI4L 5M3FG 4A76A 4A3EG 4BBRH 2Y0SE 4LF8Q 4DKAC 1CKOA 1CUKA 1OXVA 2ZM6Q 4LNQA 1VQIA 1UE6A 1PH4A 2ASBA 2R7FA 2Z6KC 1HNZL 3Q8DA 2NZOA 1Y1WH 2JEBI 3GTMH 2IY5B 2Q2HA 3K7AH 3RNUA 1PH3A 1X55A 2VZAA 3NEMA 4YCUA 4JI5Q 2WP8J 4UP7A 1Z9FA 4DR5Q 4JI3L 1EWIA 1Y1VG 2C35B 1TWAH 3G6EA 2JQOA 4BXXG 4JYAL 4GLXA 4OX9L 2JEAI 1XTDA 1YJ9A 3G48A 4QQBX 1RL2A 4GLVB 4GS3A 5AJ3L 3UDIA 3W1BA 4JI4Q 4HIDA 1GKHA 3SGIA 2NZHA 4APVA 2UUCL 1HZAA 4DK3C 1E3PA 2NN6G 1N8RC 1L1OC 1UE1A 2ZJRA 1JMCA 2UXBQ 3NBHB 3CCMA 1I94Q 1K9MC 2R93H 2FXQA 4GKJQ 4C3HH 4A3KG 1XJVA 4B3SL 2VUMH 4X65Q 1LTLA 1WI5A 1PH8A 4BY7G 2YV5A 4YWLA 2CWPA 2K4KA 4ME3A 4EX5A 1VQKA 3HOXG 1NBWA 2Q2TA 3TEHB 4DR7L 1CKNB 2UUAQ 3S24A 4A3EH 1IBMQ 2A19A 1UE7A 3E9HA 2PI2A 1VQFA 4A3JG 1PH5A 4A3BH 1TWCH 1Q82C 4NXML 2E8GA 5FJ8H 4B3MQ 2I5LX 2RHSB 5IYDH 2AKWB 2PQAA 1QVCA 2IX1A 4DV5L 3VDYA 4AYBE 1W2BA 1K73C 3S1QH 3W5OA 1JJGA 1N32Q 3AFQA 1VQDA 2VS1A 4IFDI 4JBKA 4JI6L 2ATWA 3AEVA 2WAQG 3CAMA 2EIFA 2I0QA 2HHHL 4PZ8A 4PMWA 3K8AA 2XTIA 1K83H 1EQRA 1KRTA 3TREA 1N36L 4LF8L 4LFAL 1N33L 4YCVA 3S17H 3S1NH 5C4XG 1XPOA 5IP7G 4A3IG 1Z47A 5HY6A 2JK8A 2IHFA 3F2CA 4DR4L 1JE5A 3B6YA 3S2DH 4LFBL 2PI2E 3I2ZA 1I94L 2VL6A 1NMGA 3KDFA 1KXLA 2NVYH 3S1RH 4LFAQ 3ZJYC 1PV4A 3M9BA 3GTGH 4A3GH 1VQBA 1WJJA 5GAHC 3GO5A 3OTOL 1NJIC 5IYCH 2E2IH 4GKKL 4JI3Q 3GTQH 2WAQE 3A0JA 2VQFL 4A93G 1V1QA 2RHQB 1IZ6A 2NVXH 3CPWA 4OX9Q 4NXNQ 1VQ6A 4KHPL 2B29A 1EYGA 4A4IA 1B8AA 5IT9c 3IRBA 3S16H 4DR6Q 4BY7H 2OQKA 4AQYQ 1J5EQ 4MZ9A 2OQ0A 3RZDH 1YZ6A 3EIVA 3W1GA 3RN2A 3HKZE 1HR0L 1CKNA 1N33Q 2KENA 1YIJA 4LF7L 3U4VA 4DAYB 1EIYB 2MO0A 3CC2A 1CSQA 2JA5H 3CCLA 2R7DA 3PF5A 5IWAQ 5LMUL 1XPRA 2AMCB 2AHOB 2E2JH 2HQLA 3CCQA 2IHEA 2OTJA 3K81C 3EBEA 1E24A 5M3MH 4QL5A 3PUVA 3CMEA 5C44H 4LF6Q 2CFMA 3TS0A 2N78A 1PHJA 1PVOA 1E1OA 4XIGS 2KCTA 2N3SA 3M85A 2F4VQ 4A3CG 4IFDJ 2D0PA 1IBML 1EOVA 1OXTA 3J81c 2UU9Q 2Z6KA 3D31A 4FDBA 3HOWH 4B3RQ 3CC7A 4DR3L 1VQNA 4X62L 4BA2I 2R7ZG 4JI7Q 4GOPB 5IP7H 4A3IH 4R4QA 3S14H 2YU9H 2MO1A 4RG1A 3L7ZC 2I5MX 4PZ6A 4LUVA 4IJHA 5BR8Q 4LF9L 3BU2A 4JV5L 1X3EA 2UXDL 2K14A 1L0WA 2VW9A 5GADC 1ASZA 2CCZA 4DV6L 4A3DH 1KL9A 1MJEA 3CPFA 3ERSX 5FLXc 2BH2A 2WB1E 3AYHB 3CCUA 1HNXL 3AFPA 2CWAA 4IOAA 4IPHA 2GVAA 3I4NH 1ASYA 1YJNA 2A1AA 4UPAA 3G4SA 3PO3G 2Z0SA 4JI2Q 1YI2A 1FL0A 3UE1A 1SN8A 1VQ5A 2ALYB 3HOZH 4A3FH 1HR0W 3MXNB 1IYJB 3KOJA 2Y0SG 4C3JH 2E2HH 2K75A 2JA5G 4JI8Q 1YNXA 1B70B 4JI6Q 2ES2A 1BBWA 5IWAL 5LMUQ 1YITA 3KYHC 4DR5L 4DR6L 4HIKA 1VQAA 5M3MG 1VQ8A 2WFWA 3KJPA 2UUBL 4IFDG 2V1CC 4NB3A 2UU9L 4B3RL 4ALPA 1L1OB 1KC8C 1E7ZA 2GVBA 2KHIA 1Q86C 2PNHA 4DV1L 4DR1L 1K8GA 4IOCA 4BBSH 1HNWQ 3G71A 1MKHA 3E0EA 3HOUH 2VY3A 3HKZG 1G6PA 1QVGA 3F2DA 4JI2L 1T9HA 1KIXA 4DV7Q 1GVPA 1QUQA 2Q2UA 1A8VA 2YTXA 1KRSA 4YWKA 3TQYA 1HZ9A 4OO1G 4B3TL 5IYBG 3KFUA 4IPCA 2QEXA 3PF4A 2ZTEA 4DR4Q 2ZTDA 1EIFA 1X65A 3T1HQ 5C3EG 3GTKH 4GN4B 4NPSA 1BVSA 1FGUA 3I4NG 1VQHA 3STBD 1R9TH 5LMNW 3U50C 3PO3H 4MTNA 5M5WH 4JI5L 3D0FA 3KDFB 3KF6B 2YTYA 5JJLA 1WCMG 1IBKQ 4OWTB 2R92H 3T1YQ 4A3FG 1VQCA 4L5QA 4DV5Q 1VQLA 2VNUD 1EQQA 1XNQL 2A8VA 1E22A 4PG3A 5LMNL 4NXMQ 1YEZA 4RMFA 4JI8L 5JJIA 4DUYQ 2YYZA 1MJCA 3KF6A 3KF8B 3ULJA 4DV3Q 2F3IA 1O7IA 4DR2Q 1VQ7A 2UUCQ 3BZKA 2F4VL 2LSSA 1OXUA 3UDGA 2RF4A 2OCEA 3PIOA 4K0KQ 1HNZQ 1E1TA 3RLOA 1QZGA 3A5ZB 4DV1Q 4DR1Q 4UP9A 1IL2A 3DLLA 4UY8C 3M4QA 4BBRG 4GNXC 2YTVA 5C0XJ 2AWOA 2BA1A 1Y1WG 1WYDA 4POGA 2JA7H 4B3SQ 4BBSG 1I6HH 1A62A 3CP0A 4OWXB 2B63H 4HJ8A 4LF7Q 3PO2G 3S2HH 1HH2P 3GDEA 4LUZA 1PH1A 1GM5A 1G291 2Q2IA 1XMQL 2E5LL 4LF4L 1BKBA 1VS0A 1FVIA 1LYLA 1UEBA 1Y1VH 5EAYA 5ELNA 1PH2A 4BY1H 4DNIA 1CKMA 4GN3B 4KHZA 3STBC 5HGQA 2B3GA 2ZJPA 1PH7A 1Q1EA 2HIXA 4R4CA 4GKKQ 2K5HA 1NE3A 4JCVE 5DLQE 5GROA 5M5YH 4IJLA 3OW2A 4LF5Q 1XNRL 3CCSA 5BR8L 4LF9Q 1I50H 4BXXH 1VQOA 3CF5A 3PGZA 1XMOL 1SLJA 2AWNA 2K50A 3E9IA 3FKIH 4GKJL 3FP9A 5GAEC 1YHQA 2UXCQ 1VQPA 1N34Q 1B7YB 2N8NA 1KAWA 3NENA 3UDXA 3RLNA 4P75A 4DUZQ 2DUDA 2VQEQ 4UP8A 1SRUA 4O2DA 1JT8A 3L0OA 2R93G 1KD1C 1EUJA 5GAGC 3GTJH 1RIPA 2MNAA 2QA4A 4JI0Q 4QIWE 1SFOH 2VQFQ 1Q12A 1SROA 3A74A 3RLFA 3CMAA 4A3KH 2CQOA 2IT1A 4R4OA 4DV0Q 1IBLL 4DV2Q 2VUMG 3MEFA 4POFA 3HOXH 1HJPA 4DV6Q 4AYBG 2NVQH 3KLWA 5IE8A 3JAMi 2I5HA 4X66Q 1LM0A 4X65L 1XPUA 1HZCA 5J3BA 2EXDA 1K3RA 1I3QH 4QJFA 4A3JH 4YHHL 1Q7YC 1N9WA 4JBMA 5FJ8G 4B3TQ 5IYDG 4YCWA 2JE6I 4A3BG 2OTLA 4GLAC 1YHBA 1XNQQ 2JA7G 4DPGA 4LUOA 1M1KC 3J80i 3K7UC 1TWFH 4MNOA 1EFWA 3S1MH 1N36Q 1VQMA 2B63G 2KBNA 1PFSA 4LFCL 3J7ZC 2JJQA 1AE3A 3OYYA 3A5UA 1FJGQ 2JA6G 3PO2H 1M90C 3T1HL 1QZHA 3I4MH 5C4JH 4LFCQ 4BY1G 2ZM6L 2F52A 3PCOB 1J6QA 4JC0A 3I7FA 5C4XH 4GOPC 4A3MH 3H15A 3ULPA 1Q81C 4DR3Q 1K8AC 4PZ7A 3WWVA 3PSIA 4TVAB 1PYSB 1JJCB 2R6GA 3AQQA 1QVFA 4DUYL 3FKIG 4DUZL 2KCMA 1VCIA 3PUYA 4R4TA 3M4OH 4A3GG 2UXCL 1HNWL 2RCNA 3M3YH 5IYCG 1P8LA 1U0LA 2JA9A 2K52A 4R1JA 2HT1A 1C7YA 4TQUS 4A93H 2EQSA 4X64Q 1YHAA 4AH6A 3HOVG 1P16A 1PH6A 1G51A 5C0XG 2D0OA 3H0GH 5GQOA 2N49A 4JI1Q 4HIMA 4P72A 1N32L 1UE5A 2GN5A 3RZOH 1SE8A 3I4OA 2PMZE 1PYBA 3H3VI 4AIMA 4P71A 2KHJA 4X66L 1X9NA 4P74A 4JOIA 1NTGA 3BZCA 4OWWB 4X6AH 4Y52H 1DGSA 1OTCA 1A0IA 4JI1L 4DV4L 2CKZB 1KQSA 5JJKA 1JJ2A 3M4PA 1C9OA 4LF6L 4GN5A 3RR5A 3CCRA 1YJWA 5FLMG 3H3VH 5H1SE 1VQJA 1X56A 4DV4Q 1Y14B 4O0AA 3CW2C 4JG2A 2JA8G 2NN6I 2K5VA 3CCJA 5C44G 4IPGA 3F2BA 3CCEA 4DV0L 1C0AA 1Q8KA 5E7NA 3KJOA 1U5KA 4X62Q 2JA6H 3ER0A 1FJGL 3J81j 2MFIA 4Y7NH 5IY0A 3HKSA 1HZBA 3I4MG 5ELOA 3HOWG 4HJAA 2K5NA 2VQEL 2ZTCA 4R4IA 3PUWA 3J81i 1TWHH 4L5RC 4A3CH 4B3ML 4A3MG 5IP9G 4KHPQ 1W3SA 1S3OA 1PA6A 3U58A 4YY3Q 1VQEA
chains in the Genus database with same CATH superfamily
1VQ9A 2R7ZH 3NSWA 1IBKL 1IBLQ 3MEHA 4KD4A 2X69A 3UDFA 4LF5L 3S15H 1YNJC 4A3LG 1H9JA 1CSPA 1FNVA 3DM3A 3W2DA 3NQIA 3J7AF 2KA7A 3X3MA 2EVBA 1N34L 3HOYH 3NPPA 1J5EL 1GO3E 3A8KE 3BJUA 1A3VA 5KNBA 1F9QA 1SMYC 1SNOA 3CQZH 1PDQA 4X3KA 4OELB 2UUBQ 4HJ9A 4KTAA 1DCZA 3M4OB 4QF4A 1V43A 5D14A 2IJ0A 1GD7A 3EN2A 1D7QA 1PRTD 3T16A 2M9VA 3I56A 3TRZA 1XX8A 1ET6A 3TS2A 5FO7B 1KHIA 1Z7TA 3MFGA 3OOCA 1GHJA 2MP1A 1XNRQ 2E75C 5IP9H 1HPCA 4A75A 3PUXA 4DV3L 1K0RA 4K2KA 4ZAIA 5IYBH 2IX3A 4LWCA 5EPJA 4N8FA 2C9OA 1TU2B 3GTLH 1Q46A 2VB3X 4HCEA 3ITPA 3JAML 2NVTH 3F1ZA 2I07B 2A69C 2Q8RE 3CRLC 3JC66 4TRDA 1GUNA 1AP0A 2BA0A 1BBXC 5LL6X 3AB9A 4C2MH 2MQHA 1SR3A 1JOKA 4A3EG 4JVZA 2Y0SE 4XDXA 1IW7D 4DKAC 1CKOA 1NR2A 4PMBA 1VQIA 5CR3A 1E2ZA 1RD9D 2PYKA 3C1FA 2ASBA 1EYAA 1HNZL 1Y1WH 1EU3A 1YNND 3TDQA 1X55A 2VZAA 3HKZB 3NE5B 4UP7A 1G2SA 2C35B 1XWEA 1TWAH 2JQOA 4BXXG 4JYAL 3GV3A 4OX9L 3R2TA 1YJ9A 4GS3A 1DM0B 4N9TA 5AJ3L 3W1BA 4JI4Q 3J80L 4HIDA 2NZHA 5A2QE 4IZ8A 1HZAA 3I8ZA 1ILPA 4DK3C 2NN6G 3EJIA 5IGDA 2KECA 4X3SA 2FXQA 1STHA 2JN4A 4B3SL 2VUMH 4X65Q 4KD3A 3NHHA 1KNEA 2F0HA 1PTOF 2CWPA 4BBRB 2Q2TA 2K5DA 3SK6A 3CU7A 2D9UA 1WVLA 4A3IB 2UUAQ 1EWHA 2L55A 4PMCA 3TP7A 5M5XB 4XQQA 3URYA 1VQFA 4A3JG 4QUFA 1TWCH 2E8GA 2I5LX 3IL8A 5IYDH 2F0OA 3M7GA 1HTLD 3D3RA 1JJGA 3W5OA 3A8IE 5D3DA 1K8MA 3TP6A 3L9AX 3AEVA 3K57A 2XTIA 3TREA 1MSGA 1FYCA 1CQFA 4LFAL 2EYFA 4A3IG 2AQ1B 2JYOA 4IUQA 2JK8A 4DR4L 2O5IC 4Y7NB 3RZDB 1JE5A 3S2DH 4LFBL 5JPMC 1PTOB 2F0FA 2XWJB 1PV4A 4X3UA 3VYRA 4A3GH 5GAHC 1QCBD 5J1ZA 1NJIC 1B44D 4JI3Q 4QMGA 2XN9C 2KCCA 3CPWA 4K2LA 4DR6Q 3S16H 1SYBA 2OQ0A 3RZDH 3W1GA 3HKZE 1U4LA 1CKNA 1B3QA 2KENA 1N33Q 1YIJA 2PPBC 1EIYB 3H0GB 2MO0A 3CC2A 1EY4A 5LMUL 5L37A 2ICIA 1DOKA 2IHEA 4F88A 4OHJA 3EBEA 1WTRA 4OIKA 3PUVA 3PIO3 5C44H 1PHJA 3HRZC 1YNJD 4RA8A 1SJHD 3NTIA 4XIGS 2KCTA 2N3SA 4DNTB 1PFNA 4ZYSA 1OXTA 3J81c 2UU9Q 2Z6KA 3D31A 3DM1A 2F0SA 3HOWH 4DR3L 1VQNA 2FMMA 3S14H 2I5MX 1IW7C 2DN8A 5BR8Q 4LF9L 2WKDA 1UEAB 2F03A 4DV6L 2DJFC 2R7ZB 1MJEA 3ERSX 4U68A 5CV4A 3CCUA 1NR4A 4K14A 1CI3M 4DA2A 1XTCD 3PO3G 1EY5A 1U9RA 1LT3D 3X3NA 1MGSA 4C3JH 1TQOA 2SDFA 1TWAB 2K75A 2B2WA 1BBWA 1LTSD 5HGTA 4RHSA 4H0LC 4KY5A 2RVLA 4M1UB 1WD1A 4HN7A 1PFMA 4S3SA 2A74C 4DV1L 5M5YB 3BVGA 4P2CB 4BBSH 3G71A 1MKHA 3E0EA 2L5TA 2VY3A 5FLXE 4O1NA 3IFTA 3WDNA 2B2TC 4KN7C 5E3FA 4YWKA 1EY6A 3EVQA 1SJED 4IPCA 4RGMA 2ZTEA 1WCMB 4KK7A 5EGTA 4A3EB 3T1HQ 1CA6A 2KJXA 3EROA 2DY8A 1EY9A 1LTGD 3A55A 4R8IA 1VQHA 3TBIB 3RMHA 2K5QA 1I4GA 3U50C 3V96A 4JI5L 4FXGC 3S1MB 4EQOA 4I7AA 4A3FG 1EL0A 4L5QA 4DV5Q 2F3WA 1TS3A 2RA4A 2A8VA 1LTBD 4PG3A 4NXMQ 3DMUA 4DR2Q 1VQ7A 1S5ED 1MI2A 2RF4A 1E1TA 5M9OA 3C3LA 4DR1Q 1IL2A 1RCVD 3QWNA 3DLLA 4UY8C 4GNXC 1UNSA 3BVZA 2EJMA 4POGA 1WYDA 2JA7H 3U9SA 1Y8NB 5KNDA 1G91A 1GUWA 2F0GA 3S2HH 3GDEA 3MXNA 1HUMA 1G291 2HCCA 4LF4L 1BKBA 2F0LA 1Y1VH 4FP5D 4BY1H 4DNIA 4GN3B 4KHZA 2VB2X 5IGCA 1B50A 2B3GA 2ZJPA 2HIXA 3Q6SA 4Q5VA 1ET9A 1NE3A 1ML0D 1JCKB 1I50H 1C4QA 3CF5A 3BYTB 2AWNA 4C3IB 3SK4A 5GAEC 1HFNA 1YHQA 4Z9CB 4DFAA 2UXCQ 4WRDA 4P75A 4L6TB 3BS1A 3L0OA 2R93G 1EUJA 3Q24A 4JI0Q 1ZEQX 1SFOH 2VQFQ 3RLFA 2UXDQ 2VUMG 2EYJA 3SVMA 1RTNA 2DNCA 2SNSA 3MEFA 4POFA 1BO0A 2JSOA 5EPKA 4NMZA 1SYGA 4X65L 5JPNC 1V1OA 1X3PA 2EXDA 4DAYA 5KYIA 3HP3A 4B3TQ 3H6MA 1F2YA 2OTLA 4GLAC 1YHBA 4G7HC 1SE3A 1M1KC 3K7UC 1ESRA 4MNOA 2B63G 2KBNA 2WINB 2B2UC 3PO2H 3PO3B 1CTMA 3ONAB 2K05A 3KLSA 3PCOB 5C4XH 1Q81C 4DR3Q 4PZ7A 3PSIA 1V1PA 1VMCA 1JJCB 3AQQA 4I65A 1TY2A 2B8FA 4V190 3A56A 5TSSA 3M3YH 5IYCG 2JA9A 2K52A 3D4WA 1RKNA 2HT1A 4TQUS 4A93H 1PRTF 1EEID 4HIMA 1N32L 1UE5A 3D6CA 2PMZE 2A68D 3VR5A 3HOVB 1CM9A 4X6AH 2NVXB 2TSSA 5JJKA 4DV4L 5ELBA 1JJ2A 4LF6L 4GN5A 3RR5A 1D6EC 1KABA 3H3VH 1TVXA 1VQJA 4DV4Q 2JA8G 3GTGB 3F2BA 3CCEA 1EOTA 1Q8KA 3R2IA 5E7NA 1U5KA 2JA6H 3ER0A 1BQQT 3KLRA 2MFIA 4FF1A 3HKSA 4HJAA 5CV7A 2ZXOA 3J81i 4A3CH 1TWHH 5IP9G 1PA6A 3U58A 1HUNA 4YY3Q 1O7YA 5FK9C 5KIXA 4MIUA 5JVG3 1I5FA 4HJ7A 1WTQA 1Q90A 4QY7A 4X64L 2LMCB 1SFOB 3VA5A 1DOLA 4EVOA 4DR2L 2ZXPA 1AH9A 3HOVH 2LXKA 4KLKA 1YVCA 3H0GG 1L0XB 3PIPA 4YHHQ 4ZKBB 4MHEA 1H95A 2J0TD 2F0PA 2NZ1D 1JE4A 3F8TA 4C3IH 1JWUD 5EKLA 3K80C 4OXPA 1JOQA 2E2JB 1XMOQ 2WACA 4YY3L 1IKLA 4XT3B 3R8BA 1XMQQ 1L1OA 4BA1I 3CC4A 4LW1A 2BDOA 3PUZA 3SR1A 3CHBD 3HGBA 1GXDC 4NXNL 2E5LQ 1LT4D 3HOUG 3P20A 3GD7A 4DR7Q 1TWGH 2E2DC 3H3VC 5KGUA 3PO2B 2NVYB 3GP7A 3KBGA 1Y8PB 3SK5A 4JI0L 4J6HA 1WFQA 1PXUA 4OO1H 2F0JA 1S72A 4DAMA 1QUQB 5IT9L 4A3LH 1SMXA 3FHWA 1Q1BA 1IXRA 2RSNA 4OEMB 1LUZA 4IUUA 3T1YL 1X6OA 3I70A 4GNXB 4HMIA 1BXTA 2RDFA 4ZK9B 2R92G 3K0XA 3RD4A 1WCMH 4L5SA 4H44C 1V9PA 5EBDA 3Q22A 2ZXRA 5F2DA 1PH9A 3J7A5 1PMRA 1BBUA 2PCFB 4KKSA 2BH8A 4IPDA 2HHHQ 5I6WA 4NDXA 2WKCA 1I50B 1OXVA 1LV9A 2ZM6Q 1CA5A 1EFID 1PH4A 5K5PA 2R7FA 1A3UA 1ILQA 3Q8DA 2JEBI 3WOFA 2R93B 2PW5A 1PH3A 1ENFA 3QJYA 4JI5Q 2EPBA 1Z9FA 4QIWB 2JA7B 4JI3L 1QOHA 2QDBA 3UI2A 4G7OC 4C3JB 1CZWA 4GLXA 5EJWA 2JEAI 2VXWA 4QQBX 1RL2A 3UDIA 4U673 4APVA 1E3PA 4CJ0B 1F9RA 3CCMA 3AU7A 4M8AA 4YWLA 4ME3A 3PIP3 1NBWA 2YU9B 2BOSA 3M4YA 3TEHB 2IW3A 4A3EH 1IBMQ 2A19A 3HOWB 3J7YW 3D4DA 3VR4A 3E6ZX 4KY7A 4RAUC 4R9WA 1PH5A 1GOZA 1VMPA 1I4RA 2XSCA 3VDYA 1K73C 4AYBE 4RHRA 1CFMA 1STEA 2ATWA 2WAQG 3CAMA 4XXEA 5C3EB 1EQRA 3G6JB 4FXKC 1N36L 1HA6A 1GHKA 3KF8A 1XPOA 1U4PA 2ENBA 3DWAA 2K28A 2QEJC 5CV9A 3F2CA 2PI2E 1I94L 3S16B 1ICFB 1KXLA 1B4OA 4KKUA 4UHVA 4LFAQ 1JOOA 2Z1CA 4GKKL 1DZ1A 2NYZD 5IYCH 3KUPA 3GTQH 4ZKCB 1V1QA 1II3A 2K6AA 2NVXH 1DONA 4HMJA 2EY5A 4LAAA 3VYTA 3I4NB 5DNFA 2JA8B 1CSQA 2JA5H 2R7DA 1PTOC 3NBHA 2HD3A 3FPPA 3K5OA 2H4OA 3C1EA 3K81C 3K0YA 1EY8A 4QL5A 2N78A 2AQ3B 1PVOA 2F4VQ 3M85A 4IFDJ 2D0PA 1EOVA 3CC7A 4JI7Q 4A3IH 4R4QA 5C44B 4AYBB 4B9XA 2N55A 4RG1A 3L7ZC 3NTKA 3OPOA 2L9HA 2UXDL 3BU2A 4NP5A 2WAQB 2K14A 1ASZA 2VW9A 5GADC 1SNDA 5I2XA 1KL9A 3CPFA 1ZYRC 4C3HB 2WB1E 1HFGA 1STGA 4IPHA 3I4NH 4NW2A 5T1IA 2A1AA 3G4SA 4F87A 2LS01 4JI2Q 1W6KA 1FL0A 1T5EA 2ALYB 4A3FH 1HR0W 4RGTA 2LY7A 1AZPA 1RJTA 5ISRA 2MPMA 2SOBA 1B70B 5KYLA 4JK1C 5ELEA 3N52A 1PTOH 1F2LA 4DR5L 3K7AB 4B08A 1PZKD 3KJPA 4IFDG 4K8IA 1QILA 2QKIC 4B3RL 4ALPA 2GVBA 4YIJA 1SMYD 4DR1L 4IOCA 1HNWQ 1SEBD 5JAVA 1QVGA 3F2DA 1GUOA 1T9HA 4HSPA 1BDOA 1DD2A 1IL8A 1GVPA 2YTXA 1RHPA 4FF2A 2N88A 1WTXA 2QEXA 1QJOA 2B2WC 1V8QA 1AEXA 3BYYB 3GTKH 3EFXD 4DN4M 2C5CA 5KNCA 1EEFD 1BVSA 3QR8A 5JVH3 2NVTB 4KN4C 5IGBA 1RDPD 2F0MA 4MTNA 1TY0A 2YTYA 5JJLA 1TWFB 4OWTB 3GTLB 3T13A 2X6LA 3MTSA 1EQQA 4IUPA 1E22A 1YEZA 4JI8L 4DUYQ 1MJCA 2M2LA 1I3QB 3KF8B 2UUCQ 1CHQD 3UDGA 1NNXA 4K0KQ 1HNZQ 5FO9B 4DV1Q 4CJ2C 1Y1WG 3QB3A 2X6GA 3CP0A 4RGOS 4OWXB 5M3FB 4LF7Q 1HH2P 2Q2IA 5C5MA 1FVIA 1LYLA 1EZ6A 2L12A 1PH2A 1PRTB 5C3XA 1QB5D 1TS4A 4BBSB 1DOMA 4JCVE 4LF5Q 5M5YH 1HA5A 4I7ZC 4ODGA 2H1EA 2Z8LA 1SLJA 2NN6H 4LMQD 2K50A 3FKIH 3FP9A 4CHTB 2NB0A 3T51B 3OIPA 1SRUA 4O2DA 4CDDC 1KD1C 1K0SA 5GAGC 1B9NA 1RIPA 3QOLA 4X3TA 4C3HG 3S15B 1Q12A 1B53A 2CQOA 4DV0Q 1CZGA 2B2VA 1HJPA 4DV6Q 4AYBG 5IE8A 3JAMi 4F7XA 1DYQA 5J3BA 1Q7YC 4YHHL 2G9DA 5FJ8G 3HG9A 5IYDG 1G2TA 1HHVA 2J7ZA 2JA7G 1ENAA 5BN5A 1EFWA 1H9MA 1VQMA 4LFCL 3J7ZC 3OYYA 3A5UA 1FJGQ 2PW7A 3NBIA 1QZHA 1D1IA 1LTTD 5A35A 4BY1G 2ZM6L 4H13C 4JC0A 1ZXTA 4GOPC 1KDBA 3H15A 3ULPA 2NBFA 2EYMA 3FVQA 3OIQA 1D5MC 2KEEA 5EPLA 4A3GG 1SNQA 2PNRC 4ZUIA 2K33A 5CBAE 3IFDA 4X64Q 2PMZB 4HSVA 1Y69U 3OWFA 1G51A 5GQOA 3H0GH 5I6YA 4CKBA 1GUGA 2Q8IB 3BZDB 3H3VI 4AIMA 3HOYB 4P71A 2F0NA 1F77A 2KHJA 4XYOA 1X9NA 1J8IA 3BZCA 1QNKA 1KTKA 1A0IA 1OTCA 2CKZB 5C4HA 3M4PA 1BR9A 1C9OA 3EA6A 1YJWA 3BDOA 1GJXA 5H1SE 5CV8A 1Y14B 2F0UA 2NN6I 4JPBW 5C44G 1C0AA 5CV6A 2CH4A 1PYWD 5BN4A 3J81L 4ZRZA 1FJGL 3BDLA 5IY0A 2VQEL 4L5RC 4B3ML 4A3MG 4F8MA 1MD2D 5C6AA 1VF5C 1VQEA 1S5CD 4O42A 2O4XA 4IO9A 2PZUA 4A3KB 5I9PA 3OTOQ 3GTJB 5IT9E 4A3DG 1EIHA 1K3BC 5G3LF 5LMNQ 4ZUJA 3SE0A 5C0XH 1O7LA 2QGQA 4OONA 4J1MA 1CHPD 1TXYA 3ICEA 1OO9B 1VQ4A 1AFPA 5CC4A 4DK6C 1AZQA 2HDMA 4QB4A 3UE0A 1E2VA 3SDZA 4EQ5A 1F9PA 1D5XC 5AJ3Q 5CORA 1OXXK 4L5TA 4QGUA 3L2PA 4JI7L 4JV5Q 1AE2A 4K8JA 3FMCA 1S5FD 1E2WA 1YNNC 3ERQA 1O7ZA 2IX0A 2JA8H 1X54A 1SNCA 4RGNA 1X3QA 1HR0Q 2DGYA 4WJ4A 2LXJA 3D6WA 4IFDH 1JB7A 4DV7L 1WTVA 1X3GA 1SNMA 2DNEA 1SDFA 2AUKA 2HUGA 1I4HA 3H94A 2K03A 2FINB 4NKLA 3M7NA 1QWYA 4LFBQ 3I3CA 4GNXA 4FXDA 1TIID 4ABNA 3ND8A 4A3JB 3PV0A 4H02A 3DXJC 1BCPC 1UWVA 5C0XI 3TP8A 1A2TA 3MFYA 5J39A 4OO1I 4GOPA 3HOXB 1HTPA 1X3FA 5FKAC 4KI0A 4EQPA 2L15A 4C2MB 2CW0D 4JBWA 3LGJA 1H9RA 2RQXA 1L2FA 3I90A 1UAPA 4DU9A 2A5HA 2B39A 4UAIA 4JBJA 3A8JE 3MA2B 1EIGA 1NMFA 1OXSC 2IWHA 4JI4L 2UUAL 4YWMA 3CXCA 5JJZA 1S5BD 5M3FG 1LT6D 2L11A 1CUKA 1QNUA 4C1NK 2L1BA 3J7AV 1UE6A 1W6JA 1PZJD 1VF7A 1I6VC 1Y1VB 3TP5A 2BDNA 1Q3LA 4CJ1B 4V0BA 4YCUA 2WP8J 5E4WC 3F2UA 3G6EA 4CKCA 4HEDA 1WTPA 2I46A 4N9PA 5CGKA 3G48A 1TKWB 5IGEA 3MC0B 3NK9A 1GKHA 3R93A 3W3AA 2UUCL 5CV5A 4DK1A 1N8RC 2ZJRA 3NBHB 1I94Q 1K9MC 2R93H 1XJVA 4A3DB 2K04A 4QCLA 1ZKOA 3E3XA 2K4KA 4EX5A 4DAVA 1R9TB 1VQKA 1SAPA 3HOXG 5IGGA 4DR7L 4FNFA 3S24A 1AN8A 1UE7A 1G8ZD 2O2LD 3E9HA 2CW0C 3K58A 1Q82C 5FJ8H 3DWQA 2RHSB 2MHVA 1KDAA 2AKWB 4DV5L 3S1QH 2QDLA 1N32Q 2QF7A 3MZ5A 4IFDI 3NXWA 3SXHA 4JI6L 1PTOD 2HHHL 4PZ8A 4PMWA 3K8AA 1GUSA 3Q23A 1K83H 4LF8L 1N33L 4YCVA 3S17H 4WORA 2F0EA 3HZXA 2IHFA 3KBXA 2OT2A 3B6YA 3QO2A 2VL6A 1NMGA 2NVYH 3M9BA 3GTGH 3HEJA 1EY7A 3OTOL 1V1PB 2E2HB 2E2IB 1TWGB 2WAQE 3A0JA 2VQFL 2RHQB 3S1RB 3I72A 2B29A 4JW0A 4FF4A 1SYCA 4BY7H 4G7ZC 1J5EQ 4MZ9A 2NTSA 1YZ6A 1TT2A 3RN2A 2F0KA 4LF7L 3U4VA 2MJ8A 4DAYB 3CCLA 4RFBA 2RDGA 1SNPA 2JXMB 3WOEA 4N8X1 3CCQA 3M3YB 5M3MH 3P7JA 3P75A 2CFMA 3TS0A 3S14B 1NCVA 4LK1C 1JICA 4A3CG 1H9KA 1IBML 4B3RQ 4PV1C 1QE6A 1SSOA 5IP7H 4E6IA 2JP1A 4KV6A 4PZ6A 4OIJA 2RSOA 4LUVA 2AQ2B 4JV5L 3K6OA 2E74C 1L0WA 2CCZA 3K5NA 3D4RA 5FLXc 2F4IA 1IHZA 2OF1A 1HNXL 2CWAA 2GVAA 1ASYA 2EYHA 1TS5A 2PZWA 4R8NA 3DWPA 2B2VC 4BWGB 2EY2A 1SYEA 2Z0SA 3UE1A 1SN8A 1VQ5A 3HOZH 3C46A 1D5ZC 3MXNB 4K5XA 1PZID 1IYJB 5C5LA 2JA5G 2PQEA 2KCNA 2ES2A 5LMUQ 2PZTA 4EGVA 1JQYD 1YITA 3KYHC 4PNYA 1XXGA 1SYFA 2F0IA 4HIKA 4FVMA 3K5LA 3S9WA 2WFWA 2UUBL 2V1CC 4NB3A 1BCPB 5DM73 1L1OB 1KC8C 3S1NB 2KHIA 1Q86C 2PNHA 5LL6S 1EQTA 2A73B 3NWSA 5IODA 4A93B 4G57A 1TS2A 5HURA 1KIXA 4DV7Q 2F0VA 2BCOA 3TQYA 2ICEC 1HZ9A 4IUTA 3S2HB 4OO1G 4B3TL 3GV6A 3OWEB 5IYBG 4DR4Q 3QOJA 2ZTDA 3O13A 5AFWA 5C3EG 3MAQA 3R3OA 1FGUA 3J81E 4L63B 3I4NG 1JR0D 2QCPX 3GTOB 4C1NI 4G4KA 4XQNA 2NUCA 5M5WH 5EQ0A 3PMFA 1LT5D 1LTRD 1WCMG 2VUMB 5C4ZA 1VQLA 1IYUA 1XNQL 5EKKA 5LMNL 4RMFA 2EY6A 2YYZA 4FO2A 3KF6A 3ULJA 4DV3Q 2F3IA 1O7IA 1BF4A 2F4VL 2LSSA 3DEOA 3PIOA 4PQXA 3RLOA 1Y8OB 1LTID 3M4QA 4QUCA 4ILWA 2YTVA 3DUZA 3MXGA 5CBEE 1I6HH 1A62A 1SE4A 2EY1A 4HJ8A 3OMCA 4LUZA 1PH1A 1GM5A 1XMQL 4HTHA 1VS0A 3KLSX 1Y1WB 1ONLA 1CKMA 3STBC 5HGQA 2FHTA 4GKKQ 1Q1EA 5I9OA 3TN2A 3OW2A 5DLQE 4IJLA 1XNRL 2A6HC 4BXXH 1PFBA 2HCIA 5BR8L 3CCSA 4LF9Q 3PGZA 4BY1B 4GKJL 2CHBD 3FRPB 1VQPA 1B7YB 2N8NA 2XIWA 3NENA 2K01A 3RLNA 1NUCA 4DUZQ 3IAYA 4B9WA 2DUDA 1JORA 4UP8A 5C3WA 1HQMC 2MNAA 3HS0C 4J8QA 4QIWE 1EYCA 4K5VA 2RKSA 1SROA 3VR2A 1F2MA 4ID6A 2IT1A 3K59A 4DV2Q 3LWEA 2NVQH 4RKLA 5ELDA 1LM0A 4ULLA 1I3QH 4ZLTF 1D1KA 4JBMA 4YCWA 2JE6I 2K1BA 1LO5D 2TMPA 1TWFH 1N36Q 1PFSA 3QG1A 3C2PA 4K5WA 1AE3A 5I2YA 5IOCA 3PQIA 1M90C 3ND9A 3I4MH 4CBVA 5C4JH 1GUTA 2F52A 1J6QA 1EU4A 1WD0A 2CQAA 3GTKB 3N6RA 3TMEA 4A3MH 1FNUA 1A6XA 1K8AC 3LX0A 1PYSB 2R6GA 5COYA 1QVFA 3FKIG 4R4TA 1VCIA 3M4OH 5A2QL 4DAPA 2UXCL 1HNWL 2RCNA 1P8LA 2B8GA 3CQZB 4AH6A 2EYPA 2BE5C 2KUMA 1P16A 1PH6A 2F0WA 5C0XG 4OGQC 4HR7B 3T4AC 2CH4W 4C56C 2OEOA 3VR3A 1PYBA 2XRSD 5IIFA 4DF7A 1HXYD 4OWWB 1S4ZA 1SXTA 4UDUC 4JI1L 1I4PA 1KQSA 3CCRA 3I4MB 1X56A 3CW2C 2R61A 4JG2A 4A3FB 2K5VA 3CCJA 5ELCA 4DV0L 1T5XD 3KJOA 4X62Q 1M8AA 3SHLA 1EWCA 2F1MA 4Y7NH 3BDCA 1HZBA 2K5NA 2ZTCA 3PUWA 2FMCA 2XRQD 3NWTA 1F2ZA 3J80c 5KRUA 1PLFA 1KLUD 2ZJQA 1U4RA 3DHQA 3U4ZA 4WJ3M 2WIIB 2K5WA 1J9OA 1MIUA 2H5XA 1A63A 2XVSA 2ID0A 2OXPA 2UXBL 3V05A 2PO4A 4A3BB 1IKMA 4OL7A 3HFZB 3CCVA 4AQYL 1ESFA 2OWOA 5FOBB 3RZOB 3ULLA 3FKIB 1WOCA 5JEAJ 1HNXQ 3RN5A 2EDGA 2F3VA 3J80E 1BCPD 3HOZG 4DV2L 2HIVA 1BNZA 4P73A 1VQGA 4LF4Q 2BE5D 1S5DD 2EYLA 4RH6A 2D62A 5FLMH 1NY4A 3U9OA 5K36G 5M3FH 3OHXC 2A68C 5IGFA 2SEBD 1C8CA 1A3TA 2B2YA 3E5SA 1A2UA 3TZDA 2DJGC 3GTPH 1BOSA 3QIAA 3K5MA 2KQ3A 5KEEA 2KOLA 4A3GB 3NELA 3DEPA 3A7LA 1B2TA 3JAMc 2KEDA 4K0KL 2WB1G 3S2DB 2B2TA 4DXFA 3MHBA 1X32A 1A15A 2M00A 4DGZA 1H9SA 3I55A 4J15A 3AMUA 1STBA 5C3EH 4JYAQ 3NUCA 1S40A 5JEAG 3HOYG 1L0YB 2NVQB 3GTOH 2IPKD 1YBYA 2PQAB 3GQBA 4XTCS 1M4VA 1D2BA 4HIOA 2XGTA 1JC7A 2KVMA 1TWCB 4JOIC 4KJNA 5I4DA 3CD6A 4HJ5A 1FD7D 5EKIA 3ZYYX 5M5XH 4TSSA 2HQEA 1D8LA 1Z6HA 2HDLA 4A76A 1R4PB 4BBRH 4LF8Q 4LNQA 4K6DA 3FEWX 2L4NA 2Z6KC 1JB3A 2NZOA 1CT1D 1NSNS 3GTMH 2IY5B 1EQVA 2Q2HA 3K7AH 3RNUA 3NEMA 1K28A 1I6HB 3H09A 4DR5Q 1EWIA 1Y1VG 1XTDA 3GTPB 2A69D 4GLVB 3SEBA 2D2CC 3SGIA 4GZYC 5E1FA 1L1OC 1UE1A 5DM63 1STNA 1JMCA 2UXBQ 1G6ZA 4CKEA 1LABA 2EJFC 4Q0FA 2Z4HA 4GKJQ 4C3HH 5EBCA 1I4QA 4A3KG 1MBYA 1STYA 2R92B 1LTLA 1WI5A 3FPUB 1PH8A 1FGBD 5D65A 4BY7G 2YV5A 1B9MA 4IN3A 1SE2A 1KLGD 5T1GA 4DNRB 2EYOA 2P5ZX 1CKNB 3CRKC 3T53B 2PI2A 4A3BH 5NUCA 1HQRD 3TZUA 3MXUA 4NXML 4B3MQ 3D8GA 1BUVT 1EYDA 1HCZA 4L8JA 2PQAA 1QVCA 4ME5A 2IX1A 1W2BA 1UUPA 4DK0A 3AFQA 2NTTA 3P1HA 1VQDA 2VS1A 4JBKA 2EIFA 3KK7A 2I0QA 3LNNA 4LJZC 1KRTA 4BS9A 3VR6A 2JA5B 1STAA 3S1NH 5C4XG 2IL8A 1SYDA 5IP7G 1Z47A 5DAUA 4DXGA 5HY6A 1ICWA 1LLRD 5E4XA 3I2ZA 2LFNA 1K8OA 3VYSA 3KDFA 3S1RH 1IYVA 2AUJD 2K7VA 2Z9HA 4KJOA 3ZJYC 3JAME 1VQBA 1WJJA 3GTQB 3GO5A 2E2IH 2CVRA 4A93G 1IZ6A 4KHPL 4OX9Q 1VQ6A 4NXNQ 4TKOB 1EYGA 4A4IA 1B8AA 5IT9c 3IRBA 2OQKA 4AQYQ 2RBMA 3Q0AA 2FJ2A 3EIVA 1HR0L 3A54A 2RDHA 5FO8B 4C3JG 3S17B 3PF5A 5IWAQ 1XPRA 2AMCB 1DJRD 2AHOB 2E2JH 3L3OC 2HQLA 2QW7A 2OTJA 1TR5A 2XNAC 1E24A 3CMEA 4LF6Q 2Z6BA 1E1OA 2LKVA 4FDBA 2A6ED 4BA2I 4A3MB 4X62L 2R7ZG 4GOPB 2O5JC 2B2UA 2YU9H 2MO1A 5C4JB 2Z4IA 4IJHA 1X3EA 4IUVA 1Q8IA 4CDCC 4A3DH 3I4LA 2WV6D 1RTOA 2BH2A 2R3ZA 4HAEA 3AYHB 3AFPA 4IOAA 2F0QA 4IQZA 4UPAA 1YJNA 4KY6A 3G7LA 2JA6B 4RKBA 1JWSD 1HRJA 1YI2A 5BN3A 4C3IG 5J22A 2G9HD 5FLXL 3KOJA 2Y0SG 2E2HH 4JI8Q 1YNXA 4JI6Q 1NAPA 5IWAL 2GA4B 4DR6L 2FFKB 1WTWA 1VQAA 1JWMD 5M3MG 1VQ8A 3T56B 5CYUA 5K36H 2UU9L 1C48A 1E7ZA 3NQTA 4EQNA 1K8GA 4KHVA 3HOUH 3HKZG 1G6PA 4JI2L 1ENCA 1QUQA 2Q2UA 1A8VA 3S1QB 1U4MA 3KFUA 1WTHA 3PF4A 1O78A 2D5DA 3RUZA 1EIFA 1X65A 1MSHA 3VA7A 5C4XB 2G5DA 4NPSA 1QG7A 4GN4B 5CMDA 4FYDA 3BVMA 3STBD 1R9TH 5LMNW 2F0DA 5JEAH 1XYIA 3NP8A 3PO3H 3MVVA 3D0FA 3KDFB 3KF6B 2Q8TA 1IBKQ 2R92H 1LTAD 3T1YQ 1VQCA 2VNUD 4CDEC 1ZYRD 3VYUA 1RF2D 2F0TA 5JJIA 4IALA 1CQVA 3BZKA 5M5WB 1OXUA 2OCEA 1KAAA 3CKIB 3BG3A 1QZGA 2B2YC 3OSOA 5G3LD 5ELFA 3A5ZB 4KKTA 4UP9A 4BBRG 5LHY1 5C0XJ 2AWOA 2BA1A 4CDFC 4B3SQ 4BBSG 2B63H 1BCPF 3PO2G 2EXZA 2E5LL 2V4DA 1UEBA 4KMUC 3E0JA 5EAYA 5ELNA 3GTMB 3IKJA 2EZVA 4XT1B 2NWGA 1PH7A 2ZT9C 4R4CA 2K5HA 3HOUB 1FR3A 4MN3A 5GROA 1VQOA 2QILA 1E0BA 1XMOL 3E9IA 4K6LA 3I91A 1N34Q 1KAWA 3UDXA 4FF3A 2A6EC 4CGYB 2VQEQ 2B63B 1B3AA 1JT8A 2K32A 4HCSA 3GTJH 2QA4A 2L0CA 2RCFA 3A74A 3CMAA 4A3KH 4R4OA 1IBLL 5JOBA 3HOXH 3HOZB 1O80A 3KLWA 2I5HA 2DY7A 4X66Q 2EJGC 1XPUA 1HZCA 4ZQ3A 1K3RA 2XWBB 4QJFA 4A3JH 4MTKA 1TWHB 1N9WA 3H91A 2Y0SB 4A3BG 1XNQQ 4H7BA 4DPGA 1FNWA 4LUOA 3J80i 3S1MH 4RCNA 1KNAA 2JJQA 2A6HD 2J4XA 3TSSA 2JA6G 3T1HL 1LACA 2SNMA 4LFCQ 1SBBB 3MWYW 3I7FA 4RCOA 1WTOA 1I4XA 3WWVA 2WB1B 1AW7A 4TVAB 1MHWC 1DXMA 4DUYL 4DUZL 2KCMA 1R4QB 2KHSA 3PUYA 2EE1A 5DEHA 5M3MB 1U0LA 3EQLC 4R1JA 1B1ZA 3SK8A 4IURA 1C7YA 1VDZA 2EQSA 1YHAA 1KDCA 3NTHA 3HOVG 1H9SB 2D0OA 2N49A 4JI1Q 1CK1A 4P72A 2E76C 2GN5A 3RZOH 1SE8A 3I4OA 1PRTC 4X66L 4BY7B 3A7AB 4P74A 4JOIA 1NTGA 3MXPA 4WJWA 4Y52H 1DGSA 3OMGA 1RODA 3I73A 1F9SA 4XYQA 5FLMG 3LWUA 4O0AA 4ZCKA 1EZ8A 4IPGA 3FDTA 1EY0A 5D3IB 3J81j 3V2TA 3I4MG 5ELOA 3HOWG 4WFN3 4R4IA 4IUNA 2MGSA 2EOTA 4XQJA 4KHPQ 1W3SA 1S3OA 3OW7A 2MUYA 4RWSC 1K83B 1KRSA
chains in the Genus database with same CATH topology
1VQ9A 2R7ZH 3J80c 1IBKL 1I5FA 1IBLQ 4HJ7A 4IO9A 2ZJQA 3UDFA 4LF5L 4QY7A 3U4ZA 4X64L 3S15H 4WJ3M 3OTOQ 1MIUA 2H5XA 4A3LG 1A63A 4DR2L 4A3DG 1CSPA 3DM3A 2ID0A 2UXBL 1AH9A 5LMNQ 3HOVH 2LXKA 1N34L 4KLKA 3HOYH 3HFZB 1YVCA 2QGQA 3H0GG 3PIPA 3CCVA 4OONA 4YHHQ 4AQYL 1J5EL 2OWOA 1H95A 1GO3E 3ULLA 1TXYA 3BJUA 3F8TA 1WOCA 5JEAJ 4C3IH 1HNXQ 3ICEA 3RN5A 1VQ4A 4DK6C 3K80C 4OXPA 3UE0A 3HOZG 1XMOQ 4DV2L 3CQZH 4EQ5A 4YY3L 5AJ3Q 2HIVA 4QGUA 1OXXK 4L5TA 3L2PA 4JI7L 4JV5Q 2UUBQ 4P73A 1AE2A 1VQGA 1XMQQ 4LF4Q 1L1OA 4BA1I 4HJ9A 3CC4A 2D62A 4LW1A 5FLMH 1V43A 2IX0A 3PUZA 1NY4A 2JA8H 1X54A 5K36G 1GD7A 4NXNL 5M3FH 1HR0Q 2DGYA 3EN2A 2E5LQ 4WJ4A 2LXJA 1D7QA 1JB7A 4DV7L 3I56A 1X3GA 3HOUG 3TRZA 3TS2A 3GTPH 3GD7A 1KHIA 1TWGH 4DR7Q 1XNRQ 5IP9H 4A75A 3NELA 3PUXA 4DV3L 1K0RA 3JAMc 4K0KL 4JI0L 3M7NA 2WB1G 5IYBH 1WFQA 4LFBQ 4GNXA 4LWCA 1S72A 4DAMA 1QUQB 4A3LH 1SMXA 3FHWA 3GTLH 1Q1BA 1Q46A 3PV0A 1IXRA 4H02A 4J15A 3I55A 1UWVA 1LUZA 5C3EH 4JYAQ 1S40A 3HOYG 5JEAG 5C0XI 3T1YL 1X6OA 4GNXB 2NVTH 4OO1I 4GOPA 3GTOH 2PQAB 1YBYA 4XTCS 1X3FA 4KI0A 2UXDQ 2L15A 3F1ZA 2R92G 4JBWA 4HIOA 3JC66 3K0XA 3LGJA 2XGTA 1L2FA 1WCMH 4L5SA 4JOIC 3CD6A 4HJ5A 1V9PA 4JBJA 5M5XH 2BA0A 1NMFA 1PH9A 1OXSC 4C2MH 3J7A5 1BBUA 1D8LA 2MQHA 2BH8A 1SR3A 4IPDA 4YWMA 3CXCA 2HHHQ 2UUAL 4JI4L 5M3FG 4A76A 4A3EG 4BBRH 2Y0SE 4LF8Q 4DKAC 1CKOA 1CUKA 1OXVA 2ZM6Q 4LNQA 1VQIA 1UE6A 1PH4A 2ASBA 2R7FA 2Z6KC 1HNZL 3Q8DA 2NZOA 1Y1WH 2JEBI 3GTMH 2IY5B 2Q2HA 3K7AH 3RNUA 1PH3A 1X55A 2VZAA 3NEMA 4YCUA 4JI5Q 2WP8J 4UP7A 1Z9FA 4DR5Q 4JI3L 1EWIA 1Y1VG 2C35B 1TWAH 3G6EA 2JQOA 4BXXG 4JYAL 4GLXA 4OX9L 2JEAI 1XTDA 1YJ9A 3G48A 4QQBX 1RL2A 4GLVB 4GS3A 5AJ3L 3UDIA 3W1BA 4JI4Q 4HIDA 1GKHA 3SGIA 2NZHA 4APVA 2UUCL 1HZAA 4DK3C 1E3PA 2NN6G 1N8RC 1L1OC 1UE1A 2ZJRA 1JMCA 2UXBQ 3NBHB 3CCMA 1I94Q 1K9MC 2R93H 2FXQA 4GKJQ 4C3HH 4A3KG 1XJVA 4B3SL 2VUMH 4X65Q 1LTLA 1WI5A 1PH8A 4BY7G 2YV5A 4YWLA 2CWPA 2K4KA 4ME3A 4EX5A 1VQKA 3HOXG 1NBWA 2Q2TA 3TEHB 4DR7L 1CKNB 2UUAQ 3S24A 4A3EH 1IBMQ 2A19A 1UE7A 3E9HA 2PI2A 1VQFA 4A3JG 1PH5A 4A3BH 1TWCH 1Q82C 4NXML 2E8GA 5FJ8H 4B3MQ 2I5LX 2RHSB 5IYDH 2AKWB 2PQAA 1QVCA 2IX1A 4DV5L 3VDYA 4AYBE 1W2BA 1K73C 3S1QH 3W5OA 1JJGA 1N32Q 3AFQA 1VQDA 2VS1A 4IFDI 4JBKA 4JI6L 2ATWA 3AEVA 2WAQG 3CAMA 2EIFA 2I0QA 2HHHL 4PZ8A 4PMWA 3K8AA 2XTIA 1K83H 1EQRA 1KRTA 3TREA 1N36L 4LF8L 4LFAL 1N33L 4YCVA 3S17H 3S1NH 5C4XG 1XPOA 5IP7G 4A3IG 1Z47A 5HY6A 2JK8A 2IHFA 3F2CA 4DR4L 1JE5A 3B6YA 3S2DH 4LFBL 2PI2E 3I2ZA 1I94L 2VL6A 1NMGA 3KDFA 1KXLA 2NVYH 3S1RH 4LFAQ 3ZJYC 1PV4A 3M9BA 3GTGH 4A3GH 1VQBA 1WJJA 5GAHC 3GO5A 3OTOL 1NJIC 5IYCH 2E2IH 4GKKL 4JI3Q 3GTQH 2WAQE 3A0JA 2VQFL 4A93G 1V1QA 2RHQB 1IZ6A 2NVXH 3CPWA 4OX9Q 4NXNQ 1VQ6A 4KHPL 2B29A 1EYGA 4A4IA 1B8AA 5IT9c 3IRBA 3S16H 4DR6Q 4BY7H 2OQKA 4AQYQ 1J5EQ 4MZ9A 2OQ0A 3RZDH 1YZ6A 3EIVA 3W1GA 3RN2A 3HKZE 1HR0L 1CKNA 1N33Q 2KENA 1YIJA 4LF7L 3U4VA 4DAYB 1EIYB 2MO0A 3CC2A 1CSQA 2JA5H 3CCLA 2R7DA 3PF5A 5IWAQ 5LMUL 1XPRA 2AMCB 2AHOB 2E2JH 2HQLA 3CCQA 2IHEA 2OTJA 3K81C 3EBEA 1E24A 5M3MH 4QL5A 3PUVA 3CMEA 5C44H 4LF6Q 2CFMA 3TS0A 2N78A 1PHJA 1PVOA 1E1OA 4XIGS 2KCTA 2N3SA 3M85A 2F4VQ 4A3CG 4IFDJ 2D0PA 1IBML 1EOVA 1OXTA 3J81c 2UU9Q 2Z6KA 3D31A 4FDBA 3HOWH 4B3RQ 3CC7A 4DR3L 1VQNA 4X62L 4BA2I 2R7ZG 4JI7Q 4GOPB 5IP7H 4A3IH 4R4QA 3S14H 2YU9H 2MO1A 4RG1A 3L7ZC 2I5MX 4PZ6A 4LUVA 4IJHA 5BR8Q 4LF9L 3BU2A 4JV5L 1X3EA 2UXDL 2K14A 1L0WA 2VW9A 5GADC 1ASZA 2CCZA 4DV6L 4A3DH 1KL9A 1MJEA 3CPFA 3ERSX 5FLXc 2BH2A 2WB1E 3AYHB 3CCUA 1HNXL 3AFPA 2CWAA 4IOAA 4IPHA 2GVAA 3I4NH 1ASYA 1YJNA 2A1AA 4UPAA 3G4SA 3PO3G 2Z0SA 4JI2Q 1YI2A 1FL0A 3UE1A 1SN8A 1VQ5A 2ALYB 3HOZH 4A3FH 1HR0W 3MXNB 1IYJB 3KOJA 2Y0SG 4C3JH 2E2HH 2K75A 2JA5G 4JI8Q 1YNXA 1B70B 4JI6Q 2ES2A 1BBWA 5IWAL 5LMUQ 1YITA 3KYHC 4DR5L 4DR6L 4HIKA 1VQAA 5M3MG 1VQ8A 2WFWA 3KJPA 2UUBL 4IFDG 2V1CC 4NB3A 2UU9L 4B3RL 4ALPA 1L1OB 1KC8C 1E7ZA 2GVBA 2KHIA 1Q86C 2PNHA 4DV1L 4DR1L 1K8GA 4IOCA 4BBSH 1HNWQ 3G71A 1MKHA 3E0EA 3HOUH 2VY3A 3HKZG 1G6PA 1QVGA 3F2DA 4JI2L 1T9HA 1KIXA 4DV7Q 1GVPA 1QUQA 2Q2UA 1A8VA 2YTXA 1KRSA 4YWKA 3TQYA 1HZ9A 4OO1G 4B3TL 5IYBG 3KFUA 4IPCA 2QEXA 3PF4A 2ZTEA 4DR4Q 2ZTDA 1EIFA 1X65A 3T1HQ 5C3EG 3GTKH 4GN4B 4NPSA 1BVSA 1FGUA 3I4NG 1VQHA 3STBD 1R9TH 5LMNW 3U50C 3PO3H 4MTNA 5M5WH 4JI5L 3D0FA 3KDFB 3KF6B 2YTYA 5JJLA 1WCMG 1IBKQ 4OWTB 2R92H 3T1YQ 4A3FG 1VQCA 4L5QA 4DV5Q 1VQLA 2VNUD 1EQQA 1XNQL 2A8VA 1E22A 4PG3A 5LMNL 4NXMQ 1YEZA 4RMFA 4JI8L 5JJIA 4DUYQ 2YYZA 1MJCA 3KF6A 3KF8B 3ULJA 4DV3Q 2F3IA 1O7IA 4DR2Q 1VQ7A 2UUCQ 3BZKA 2F4VL 2LSSA 1OXUA 3UDGA 2RF4A 2OCEA 3PIOA 4K0KQ 1HNZQ 1E1TA 3RLOA 1QZGA 3A5ZB 4DV1Q 4DR1Q 4UP9A 1IL2A 3DLLA 4UY8C 3M4QA 4BBRG 4GNXC 2YTVA 5C0XJ 2AWOA 2BA1A 1Y1WG 1WYDA 4POGA 2JA7H 4B3SQ 4BBSG 1I6HH 1A62A 3CP0A 4OWXB 2B63H 4HJ8A 4LF7Q 3PO2G 3S2HH 1HH2P 3GDEA 4LUZA 1PH1A 1GM5A 1G291 2Q2IA 1XMQL 2E5LL 4LF4L 1BKBA 1VS0A 1FVIA 1LYLA 1UEBA 1Y1VH 5EAYA 5ELNA 1PH2A 4BY1H 4DNIA 1CKMA 4GN3B 4KHZA 3STBC 5HGQA 2B3GA 2ZJPA 1PH7A 1Q1EA 2HIXA 4R4CA 4GKKQ 2K5HA 1NE3A 4JCVE 5DLQE 5GROA 5M5YH 4IJLA 3OW2A 4LF5Q 1XNRL 3CCSA 5BR8L 4LF9Q 1I50H 4BXXH 1VQOA 3CF5A 3PGZA 1XMOL 1SLJA 2AWNA 2K50A 3E9IA 3FKIH 4GKJL 3FP9A 5GAEC 1YHQA 2UXCQ 1VQPA 1N34Q 1B7YB 2N8NA 1KAWA 3NENA 3UDXA 3RLNA 4P75A 4DUZQ 2DUDA 2VQEQ 4UP8A 1SRUA 4O2DA 1JT8A 3L0OA 2R93G 1KD1C 1EUJA 5GAGC 3GTJH 1RIPA 2MNAA 2QA4A 4JI0Q 4QIWE 1SFOH 2VQFQ 1Q12A 1SROA 3A74A 3RLFA 3CMAA 4A3KH 2CQOA 2IT1A 4R4OA 4DV0Q 1IBLL 4DV2Q 2VUMG 3MEFA 4POFA 3HOXH 1HJPA 4DV6Q 4AYBG 2NVQH 3KLWA 5IE8A 3JAMi 2I5HA 4X66Q 1LM0A 4X65L 1XPUA 1HZCA 5J3BA 2EXDA 1K3RA 1I3QH 4QJFA 4A3JH 4YHHL 1Q7YC 1N9WA 4JBMA 5FJ8G 4B3TQ 5IYDG 4YCWA 2JE6I 4A3BG 2OTLA 4GLAC 1YHBA 1XNQQ 2JA7G 4DPGA 4LUOA 1M1KC 3J80i 3K7UC 1TWFH 4MNOA 1EFWA 3S1MH 1N36Q 1VQMA 2B63G 2KBNA 1PFSA 4LFCL 3J7ZC 2JJQA 1AE3A 3OYYA 3A5UA 1FJGQ 2JA6G 3PO2H 1M90C 3T1HL 1QZHA 3I4MH 5C4JH 4LFCQ 4BY1G 2ZM6L 2F52A 3PCOB 1J6QA 4JC0A 3I7FA 5C4XH 4GOPC 4A3MH 3H15A 3ULPA 1Q81C 4DR3Q 1K8AC 4PZ7A 3WWVA 3PSIA 4TVAB 1PYSB 1JJCB 2R6GA 3AQQA 1QVFA 4DUYL 3FKIG 4DUZL 2KCMA 1VCIA 3PUYA 4R4TA 3M4OH 4A3GG 2UXCL 1HNWL 2RCNA 3M3YH 5IYCG 1P8LA 1U0LA 2JA9A 2K52A 4R1JA 2HT1A 1C7YA 4TQUS 4A93H 2EQSA 4X64Q 1YHAA 4AH6A 3HOVG 1P16A 1PH6A 1G51A 5C0XG 2D0OA 3H0GH 5GQOA 2N49A 4JI1Q 4HIMA 4P72A 1N32L 1UE5A 2GN5A 3RZOH 1SE8A 3I4OA 2PMZE 1PYBA 3H3VI 4AIMA 4P71A 2KHJA 4X66L 1X9NA 4P74A 4JOIA 1NTGA 3BZCA 4OWWB 4X6AH 4Y52H 1DGSA 1OTCA 1A0IA 4JI1L 4DV4L 2CKZB 1KQSA 5JJKA 1JJ2A 3M4PA 1C9OA 4LF6L 4GN5A 3RR5A 3CCRA 1YJWA 5FLMG 3H3VH 5H1SE 1VQJA 1X56A 4DV4Q 1Y14B 4O0AA 3CW2C 4JG2A 2JA8G 2NN6I 2K5VA 3CCJA 5C44G 4IPGA 3F2BA 3CCEA 4DV0L 1C0AA 1Q8KA 5E7NA 3KJOA 1U5KA 4X62Q 2JA6H 3ER0A 1FJGL 3J81j 2MFIA 4Y7NH 5IY0A 3HKSA 1HZBA 3I4MG 5ELOA 3HOWG 4HJAA 2K5NA 2VQEL 2ZTCA 4R4IA 3PUWA 3J81i 1TWHH 4L5RC 4A3CH 4B3ML 4A3MG 5IP9G 4KHPQ 1W3SA 1S3OA 1PA6A 3U58A 4YY3Q 1VQEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ9 A;  2R7Z H;  3J80 c;  1IBK L;  1I5F A;  1IBL Q;  4HJ7 A;  4IO9 A;  2ZJQ A;  3UDF A;  4LF5 L;  4QY7 A;  3U4Z A;  4X64 L;  3S15 H;  4WJ3 M;  3OTO Q;  1MIU A;  2H5X A;  4A3L G;  1A63 A;  4DR2 L;  4A3D G;  1CSP A;  3DM3 A;  2ID0 A;  2UXB L;  1AH9 A;  5LMN Q;  3HOV H;  2LXK A;  1N34 L;  4KLK A;  3HOY H;  3HFZ B;  1YVC A;  2QGQ A;  3H0G G;  3PIP A;  3CCV A;  4OON A;  4YHH Q;  4AQY L;  1J5E L;  2OWO A;  1H95 A;  1GO3 E;  3ULL A;  1TXY A;  3BJU A;  3F8T A;  1WOC A;  5JEA J;  4C3I H;  1HNX Q;  3ICE A;  3RN5 A;  1VQ4 A;  4DK6 C;  3K80 C;  4OXP A;  3UE0 A;  3HOZ G;  1XMO Q;  4DV2 L;  3CQZ H;  4EQ5 A;  4YY3 L;  5AJ3 Q;  2HIV A;  4QGU A;  1OXX K;  4L5T A;  3L2P A;  4JI7 L;  4JV5 Q;  2UUB Q;  4P73 A;  1AE2 A;  1VQG A;  1XMQ Q;  4LF4 Q;  1L1O A;  4BA1 I;  4HJ9 A;  3CC4 A;  2D62 A;  4LW1 A;  5FLM H;  1V43 A;  2IX0 A;  3PUZ A;  1NY4 A;  2JA8 H;  1X54 A;  5K36 G;  1GD7 A;  4NXN L;  5M3F H;  1HR0 Q;  2DGY A;  3EN2 A;  2E5L Q;  4WJ4 A;  2LXJ A;  1D7Q A;  1JB7 A;  4DV7 L;  3I56 A;  1X3G A;  3HOU G;  3TRZ A;  3TS2 A;  3GTP H;  3GD7 A;  1KHI A;  1TWG H;  4DR7 Q;  1XNR Q;  5IP9 H;  4A75 A;  3NEL A;  3PUX A;  4DV3 L;  1K0R A;  3JAM c;  4K0K L;  4JI0 L;  3M7N A;  2WB1 G;  5IYB H;  1WFQ A;  4LFB Q;  4GNX A;  4LWC A;  1S72 A;  4DAM A;  1QUQ B;  4A3L H;  1SMX A;  3FHW A;  3GTL H;  1Q1B A;  1Q46 A;  3PV0 A;  1IXR A;  4H02 A;  4J15 A;  3I55 A;  1UWV A;  1LUZ A;  5C3E H;  4JYA Q;  1S40 A;  3HOY G;  5JEA G;  5C0X I;  3T1Y L;  1X6O A;  4GNX B;  2NVT H;  4OO1 I;  4GOP A;  3GTO H;  2PQA B;  1YBY A;  4XTC S;  1X3F A;  4KI0 A;  2UXD Q;  2L15 A;  3F1Z A;  2R92 G;  4JBW A;  4HIO A;  3JC6 6;  3K0X A;  3LGJ A;  2XGT A;  1L2F A;  1WCM H;  4L5S A;  4JOI C;  3CD6 A;  4HJ5 A;  1V9P A;  4JBJ A;  5M5X H;  2BA0 A;  1NMF A;  1PH9 A;  1OXS C;  4C2M H;  3J7A 5;  1BBU A;  1D8L A;  2MQH A;  2BH8 A;  1SR3 A;  4IPD A;  4YWM A;  3CXC A;  2HHH Q;  2UUA L;  4JI4 L;  5M3F G;  4A76 A;  4A3E G;  4BBR H;  2Y0S E;  4LF8 Q;  4DKA C;  1CKO A;  1CUK A;  1OXV A;  2ZM6 Q;  4LNQ A;  1VQI A;  1UE6 A;  1PH4 A;  2ASB A;  2R7F A;  2Z6K C;  1HNZ L;  3Q8D A;  2NZO A;  1Y1W H;  2JEB I;  3GTM H;  2IY5 B;  2Q2H A;  3K7A H;  3RNU A;  1PH3 A;  1X55 A;  2VZA A;  3NEM A;  4YCU A;  4JI5 Q;  2WP8 J;  4UP7 A;  1Z9F A;  4DR5 Q;  4JI3 L;  1EWI A;  1Y1V G;  2C35 B;  1TWA H;  3G6E A;  2JQO A;  4BXX G;  4JYA L;  4GLX A;  4OX9 L;  2JEA I;  1XTD A;  1YJ9 A;  3G48 A;  4QQB X;  1RL2 A;  4GLV B;  4GS3 A;  5AJ3 L;  3UDI A;  3W1B A;  4JI4 Q;  4HID A;  1GKH A;  3SGI A;  2NZH A;  4APV A;  2UUC L;  1HZA A;  4DK3 C;  1E3P A;  2NN6 G;  1N8R C;  1L1O C;  1UE1 A;  2ZJR A;  1JMC A;  2UXB Q;  3NBH B;  3CCM A;  1I94 Q;  1K9M C;  2R93 H;  2FXQ A;  4GKJ Q;  4C3H H;  4A3K G;  1XJV A;  4B3S L;  2VUM H;  4X65 Q;  1LTL A;  1WI5 A;  1PH8 A;  4BY7 G;  2YV5 A;  4YWL A;  2CWP A;  2K4K A;  4ME3 A;  4EX5 A;  1VQK A;  3HOX G;  1NBW A;  2Q2T A;  3TEH B;  4DR7 L;  1CKN B;  2UUA Q;  3S24 A;  4A3E H;  1IBM Q;  2A19 A;  1UE7 A;  3E9H A;  2PI2 A;  1VQF A;  4A3J G;  1PH5 A;  4A3B H;  1TWC H;  1Q82 C;  4NXM L;  2E8G A;  5FJ8 H;  4B3M Q;  2I5L X;  2RHS B;  5IYD H;  2AKW B;  2PQA A;  1QVC A;  2IX1 A;  4DV5 L;  3VDY A;  4AYB E;  1W2B A;  1K73 C;  3S1Q H;  3W5O A;  1JJG A;  1N32 Q;  3AFQ A;  1VQD A;  2VS1 A;  4IFD I;  4JBK A;  4JI6 L;  2ATW A;  3AEV A;  2WAQ G;  3CAM A;  2EIF A;  2I0Q A;  2HHH L;  4PZ8 A;  4PMW A;  3K8A A;  2XTI A;  1K83 H;  1EQR A;  1KRT A;  3TRE A;  1N36 L;  4LF8 L;  4LFA L;  1N33 L;  4YCV A;  3S17 H;  3S1N H;  5C4X G;  1XPO A;  5IP7 G;  4A3I G;  1Z47 A;  5HY6 A;  2JK8 A;  2IHF A;  3F2C A;  4DR4 L;  1JE5 A;  3B6Y A;  3S2D H;  4LFB L;  2PI2 E;  3I2Z A;  1I94 L;  2VL6 A;  1NMG A;  3KDF A;  1KXL A;  2NVY H;  3S1R H;  4LFA Q;  3ZJY C;  1PV4 A;  3M9B A;  3GTG H;  4A3G H;  1VQB A;  1WJJ A;  5GAH C;  3GO5 A;  3OTO L;  1NJI C;  5IYC H;  2E2I H;  4GKK L;  4JI3 Q;  3GTQ H;  2WAQ E;  3A0J A;  2VQF L;  4A93 G;  1V1Q A;  2RHQ B;  1IZ6 A;  2NVX H;  3CPW A;  4OX9 Q;  4NXN Q;  1VQ6 A;  4KHP L;  2B29 A;  1EYG A;  4A4I A;  1B8A A;  5IT9 c;  3IRB A;  3S16 H;  4DR6 Q;  4BY7 H;  2OQK A;  4AQY Q;  1J5E Q;  4MZ9 A;  2OQ0 A;  3RZD H;  1YZ6 A;  3EIV A;  3W1G A;  3RN2 A;  3HKZ E;  1HR0 L;  1CKN A;  1N33 Q;  2KEN A;  1YIJ A;  4LF7 L;  3U4V A;  4DAY B;  1EIY B;  2MO0 A;  3CC2 A;  1CSQ A;  2JA5 H;  3CCL A;  2R7D A;  3PF5 A;  5IWA Q;  5LMU L;  1XPR A;  2AMC B;  2AHO B;  2E2J H;  2HQL A;  3CCQ A;  2IHE A;  2OTJ A;  3K81 C;  3EBE A;  1E24 A;  5M3M H;  4QL5 A;  3PUV A;  3CME A;  5C44 H;  4LF6 Q;  2CFM A;  3TS0 A;  2N78 A;  1PHJ A;  1PVO A;  1E1O A;  4XIG S;  2KCT A;  2N3S A;  3M85 A;  2F4V Q;  4A3C G;  4IFD J;  2D0P A;  1IBM L;  1EOV A;  1OXT A;  3J81 c;  2UU9 Q;  2Z6K A;  3D31 A;  4FDB A;  3HOW H;  4B3R Q;  3CC7 A;  4DR3 L;  1VQN A;  4X62 L;  4BA2 I;  2R7Z G;  4JI7 Q;  4GOP B;  5IP7 H;  4A3I H;  4R4Q A;  3S14 H;  2YU9 H;  2MO1 A;  4RG1 A;  3L7Z C;  2I5M X;  4PZ6 A;  4LUV A;  4IJH A;  5BR8 Q;  4LF9 L;  3BU2 A;  4JV5 L;  1X3E A;  2UXD L;  2K14 A;  1L0W A;  2VW9 A;  5GAD C;  1ASZ A;  2CCZ A;  4DV6 L;  4A3D H;  1KL9 A;  1MJE A;  3CPF A;  3ERS X;  5FLX c;  2BH2 A;  2WB1 E;  3AYH B;  3CCU A;  1HNX L;  3AFP A;  2CWA A;  4IOA A;  4IPH A;  2GVA A;  3I4N H;  1ASY A;  1YJN A;  2A1A A;  4UPA A;  3G4S A;  3PO3 G;  2Z0S A;  4JI2 Q;  1YI2 A;  1FL0 A;  3UE1 A;  1SN8 A;  1VQ5 A;  2ALY B;  3HOZ H;  4A3F H;  1HR0 W;  3MXN B;  1IYJ B;  3KOJ A;  2Y0S G;  4C3J H;  2E2H H;  2K75 A;  2JA5 G;  4JI8 Q;  1YNX A;  1B70 B;  4JI6 Q;  2ES2 A;  1BBW A;  5IWA L;  5LMU Q;  1YIT A;  3KYH C;  4DR5 L;  4DR6 L;  4HIK A;  1VQA A;  5M3M G;  1VQ8 A;  2WFW A;  3KJP A;  2UUB L;  4IFD G;  2V1C C;  4NB3 A;  2UU9 L;  4B3R L;  4ALP A;  1L1O B;  1KC8 C;  1E7Z A;  2GVB A;  2KHI A;  1Q86 C;  2PNH A;  4DV1 L;  4DR1 L;  1K8G A;  4IOC A;  4BBS H;  1HNW Q;  3G71 A;  1MKH A;  3E0E A;  3HOU H;  2VY3 A;  3HKZ G;  1G6P A;  1QVG A;  3F2D A;  4JI2 L;  1T9H A;  1KIX A;  4DV7 Q;  1GVP A;  1QUQ A;  2Q2U A;  1A8V A;  2YTX A;  1KRS A;  4YWK A;  3TQY A;  1HZ9 A;  4OO1 G;  4B3T L;  5IYB G;  3KFU A;  4IPC A;  2QEX A;  3PF4 A;  2ZTE A;  4DR4 Q;  2ZTD A;  1EIF A;  1X65 A;  3T1H Q;  5C3E G;  3GTK H;  4GN4 B;  4NPS A;  1BVS A;  1FGU A;  3I4N G;  1VQH A;  3STB D;  1R9T H;  5LMN W;  3U50 C;  3PO3 H;  4MTN A;  5M5W H;  4JI5 L;  3D0F A;  3KDF B;  3KF6 B;  2YTY A;  5JJL A;  1WCM G;  1IBK Q;  4OWT B;  2R92 H;  3T1Y Q;  4A3F G;  1VQC A;  4L5Q A;  4DV5 Q;  1VQL A;  2VNU D;  1EQQ A;  1XNQ L;  2A8V A;  1E22 A;  4PG3 A;  5LMN L;  4NXM Q;  1YEZ A;  4RMF A;  4JI8 L;  5JJI A;  4DUY Q;  2YYZ A;  1MJC A;  3KF6 A;  3KF8 B;  3ULJ A;  4DV3 Q;  2F3I A;  1O7I A;  4DR2 Q;  1VQ7 A;  2UUC Q;  3BZK A;  2F4V L;  2LSS A;  1OXU A;  3UDG A;  2RF4 A;  2OCE A;  3PIO A;  4K0K Q;  1HNZ Q;  1E1T A;  3RLO A;  1QZG A;  3A5Z B;  4DV1 Q;  4DR1 Q;  4UP9 A;  1IL2 A;  3DLL A;  4UY8 C;  3M4Q A;  4BBR G;  4GNX C;  2YTV A;  5C0X J;  2AWO A;  2BA1 A;  1Y1W G;  1WYD A;  4POG A;  2JA7 H;  4B3S Q;  4BBS G;  1I6H H;  1A62 A;  3CP0 A;  4OWX B;  2B63 H;  4HJ8 A;  4LF7 Q;  3PO2 G;  3S2H H;  1HH2 P;  3GDE A;  4LUZ A;  1PH1 A;  1GM5 A;  1G29 1;  2Q2I A;  1XMQ L;  2E5L L;  4LF4 L;  1BKB A;  1VS0 A;  1FVI A;  1LYL A;  1UEB A;  1Y1V H;  5EAY A;  5ELN A;  1PH2 A;  4BY1 H;  4DNI A;  1CKM A;  4GN3 B;  4KHZ A;  3STB C;  5HGQ A;  2B3G A;  2ZJP A;  1PH7 A;  1Q1E A;  2HIX A;  4R4C A;  4GKK Q;  2K5H A;  1NE3 A;  4JCV E;  5DLQ E;  5GRO A;  5M5Y H;  4IJL A;  3OW2 A;  4LF5 Q;  1XNR L;  3CCS A;  5BR8 L;  4LF9 Q;  1I50 H;  4BXX H;  1VQO A;  3CF5 A;  3PGZ A;  1XMO L;  1SLJ A;  2AWN A;  2K50 A;  3E9I A;  3FKI H;  4GKJ L;  3FP9 A;  5GAE C;  1YHQ A;  2UXC Q;  1VQP A;  1N34 Q;  1B7Y B;  2N8N A;  1KAW A;  3NEN A;  3UDX A;  3RLN A;  4P75 A;  4DUZ Q;  2DUD A;  2VQE Q;  4UP8 A;  1SRU A;  4O2D A;  1JT8 A;  3L0O A;  2R93 G;  1KD1 C;  1EUJ A;  5GAG C;  3GTJ H;  1RIP A;  2MNA A;  2QA4 A;  4JI0 Q;  4QIW E;  1SFO H;  2VQF Q;  1Q12 A;  1SRO A;  3A74 A;  3RLF A;  3CMA A;  4A3K H;  2CQO A;  2IT1 A;  4R4O A;  4DV0 Q;  1IBL L;  4DV2 Q;  2VUM G;  3MEF A;  4POF A;  3HOX H;  1HJP A;  4DV6 Q;  4AYB G;  2NVQ H;  3KLW A;  5IE8 A;  3JAM i;  2I5H A;  4X66 Q;  1LM0 A;  4X65 L;  1XPU A;  1HZC A;  5J3B A;  2EXD A;  1K3R A;  1I3Q H;  4QJF A;  4A3J H;  4YHH L;  1Q7Y C;  1N9W A;  4JBM A;  5FJ8 G;  4B3T Q;  5IYD G;  4YCW A;  2JE6 I;  4A3B G;  2OTL A;  4GLA C;  1YHB A;  1XNQ Q;  2JA7 G;  4DPG A;  4LUO A;  1M1K C;  3J80 i;  3K7U C;  1TWF H;  4MNO A;  1EFW A;  3S1M H;  1N36 Q;  1VQM A;  2B63 G;  2KBN A;  1PFS A;  4LFC L;  3J7Z C;  2JJQ A;  1AE3 A;  3OYY A;  3A5U A;  1FJG Q;  2JA6 G;  3PO2 H;  1M90 C;  3T1H L;  1QZH A;  3I4M H;  5C4J H;  4LFC Q;  4BY1 G;  2ZM6 L;  2F52 A;  3PCO B;  1J6Q A;  4JC0 A;  3I7F A;  5C4X H;  4GOP C;  4A3M H;  3H15 A;  3ULP A;  1Q81 C;  4DR3 Q;  1K8A C;  4PZ7 A;  3WWV A;  3PSI A;  4TVA B;  1PYS B;  1JJC B;  2R6G A;  3AQQ A;  1QVF A;  4DUY L;  3FKI G;  4DUZ L;  2KCM A;  1VCI A;  3PUY A;  4R4T A;  3M4O H;  4A3G G;  2UXC L;  1HNW L;  2RCN A;  3M3Y H;  5IYC G;  1P8L A;  1U0L A;  2JA9 A;  2K52 A;  4R1J A;  2HT1 A;  1C7Y A;  4TQU S;  4A93 H;  2EQS A;  4X64 Q;  1YHA A;  4AH6 A;  3HOV G;  1P16 A;  1PH6 A;  1G51 A;  5C0X G;  2D0O A;  3H0G H;  5GQO A;  2N49 A;  4JI1 Q;  4HIM A;  4P72 A;  1N32 L;  1UE5 A;  2GN5 A;  3RZO H;  1SE8 A;  3I4O A;  2PMZ E;  1PYB A;  3H3V I;  4AIM A;  4P71 A;  2KHJ A;  4X66 L;  1X9N A;  4P74 A;  4JOI A;  1NTG A;  3BZC A;  4OWW B;  4X6A H;  4Y52 H;  1DGS A;  1OTC A;  1A0I A;  4JI1 L;  4DV4 L;  2CKZ B;  1KQS A;  5JJK A;  1JJ2 A;  3M4P A;  1C9O A;  4LF6 L;  4GN5 A;  3RR5 A;  3CCR A;  1YJW A;  5FLM G;  3H3V H;  5H1S E;  1VQJ A;  1X56 A;  4DV4 Q;  1Y14 B;  4O0A A;  3CW2 C;  4JG2 A;  2JA8 G;  2NN6 I;  2K5V A;  3CCJ A;  5C44 G;  4IPG A;  3F2B A;  3CCE A;  4DV0 L;  1C0A A;  1Q8K A;  5E7N A;  3KJO A;  1U5K A;  4X62 Q;  2JA6 H;  3ER0 A;  1FJG L;  3J81 j;  2MFI A;  4Y7N H;  5IY0 A;  3HKS A;  1HZB A;  3I4M G;  5ELO A;  3HOW G;  4HJA A;  2K5N A;  2VQE L;  2ZTC A;  4R4I A;  3PUW A;  3J81 i;  1TWH H;  4L5R C;  4A3C H;  4B3M L;  4A3M G;  5IP9 G;  4KHP Q;  1W3S A;  1S3O A;  1PA6 A;  3U58 A;  4YY3 Q;  1VQE A; 
#chains in the Genus database with same CATH topology
 1VQ9 A;  2R7Z H;  3NSW A;  1IBK L;  1IBL Q;  3MEH A;  4KD4 A;  2X69 A;  3UDF A;  4LF5 L;  3S15 H;  1YNJ C;  4A3L G;  1H9J A;  1CSP A;  1FNV A;  3DM3 A;  3W2D A;  3NQI A;  3J7A F;  2KA7 A;  3X3M A;  2EVB A;  1N34 L;  3HOY H;  3NPP A;  1J5E L;  1GO3 E;  3A8K E;  3BJU A;  1A3V A;  5KNB A;  1F9Q A;  1SMY C;  1SNO A;  3CQZ H;  1PDQ A;  4X3K A;  4OEL B;  2UUB Q;  4HJ9 A;  4KTA A;  1DCZ A;  3M4O B;  4QF4 A;  1V43 A;  5D14 A;  2IJ0 A;  1GD7 A;  3EN2 A;  1D7Q A;  1PRT D;  3T16 A;  2M9V A;  3I56 A;  3TRZ A;  1XX8 A;  1ET6 A;  3TS2 A;  5FO7 B;  1KHI A;  1Z7T A;  3MFG A;  3OOC A;  1GHJ A;  2MP1 A;  1XNR Q;  2E75 C;  5IP9 H;  1HPC A;  4A75 A;  3PUX A;  4DV3 L;  1K0R A;  4K2K A;  4ZAI A;  5IYB H;  2IX3 A;  4LWC A;  5EPJ A;  4N8F A;  2C9O A;  1TU2 B;  3GTL H;  1Q46 A;  2VB3 X;  4HCE A;  3ITP A;  3JAM L;  2NVT H;  3F1Z A;  2I07 B;  2A69 C;  2Q8R E;  3CRL C;  3JC6 6;  4TRD A;  1GUN A;  1AP0 A;  2BA0 A;  1BBX C;  5LL6 X;  3AB9 A;  4C2M H;  2MQH A;  1SR3 A;  1JOK A;  4A3E G;  4JVZ A;  2Y0S E;  4XDX A;  1IW7 D;  4DKA C;  1CKO A;  1NR2 A;  4PMB A;  1VQI A;  5CR3 A;  1E2Z A;  1RD9 D;  2PYK A;  3C1F A;  2ASB A;  1EYA A;  1HNZ L;  1Y1W H;  1EU3 A;  1YNN D;  3TDQ A;  1X55 A;  2VZA A;  3HKZ B;  3NE5 B;  4UP7 A;  1G2S A;  2C35 B;  1XWE A;  1TWA H;  2JQO A;  4BXX G;  4JYA L;  3GV3 A;  4OX9 L;  3R2T A;  1YJ9 A;  4GS3 A;  1DM0 B;  4N9T A;  5AJ3 L;  3W1B A;  4JI4 Q;  3J80 L;  4HID A;  2NZH A;  5A2Q E;  4IZ8 A;  1HZA A;  3I8Z A;  1ILP A;  4DK3 C;  2NN6 G;  3EJI A;  5IGD A;  2KEC A;  4X3S A;  2FXQ A;  1STH A;  2JN4 A;  4B3S L;  2VUM H;  4X65 Q;  4KD3 A;  3NHH A;  1KNE A;  2F0H A;  1PTO F;  2CWP A;  4BBR B;  2Q2T A;  2K5D A;  3SK6 A;  3CU7 A;  2D9U A;  1WVL A;  4A3I B;  2UUA Q;  1EWH A;  2L55 A;  4PMC A;  3TP7 A;  5M5X B;  4XQQ A;  3URY A;  1VQF A;  4A3J G;  4QUF A;  1TWC H;  2E8G A;  2I5L X;  3IL8 A;  5IYD H;  2F0O A;  3M7G A;  1HTL D;  3D3R A;  1JJG A;  3W5O A;  3A8I E;  5D3D A;  1K8M A;  3TP6 A;  3L9A X;  3AEV A;  3K57 A;  2XTI A;  3TRE A;  1MSG A;  1FYC A;  1CQF A;  4LFA L;  2EYF A;  4A3I G;  2AQ1 B;  2JYO A;  4IUQ A;  2JK8 A;  4DR4 L;  2O5I C;  4Y7N B;  3RZD B;  1JE5 A;  3S2D H;  4LFB L;  5JPM C;  1PTO B;  2F0F A;  2XWJ B;  1PV4 A;  4X3U A;  3VYR A;  4A3G H;  5GAH C;  1QCB D;  5J1Z A;  1NJI C;  1B44 D;  4JI3 Q;  4QMG A;  2XN9 C;  2KCC A;  3CPW A;  4K2L A;  4DR6 Q;  3S16 H;  1SYB A;  2OQ0 A;  3RZD H;  3W1G A;  3HKZ E;  1U4L A;  1CKN A;  1B3Q A;  2KEN A;  1N33 Q;  1YIJ A;  2PPB C;  1EIY B;  3H0G B;  2MO0 A;  3CC2 A;  1EY4 A;  5LMU L;  5L37 A;  2ICI A;  1DOK A;  2IHE A;  4F88 A;  4OHJ A;  3EBE A;  1WTR A;  4OIK A;  3PUV A;  3PIO 3;  5C44 H;  1PHJ A;  3HRZ C;  1YNJ D;  4RA8 A;  1SJH D;  3NTI A;  4XIG S;  2KCT A;  2N3S A;  4DNT B;  1PFN A;  4ZYS A;  1OXT A;  3J81 c;  2UU9 Q;  2Z6K A;  3D31 A;  3DM1 A;  2F0S A;  3HOW H;  4DR3 L;  1VQN A;  2FMM A;  3S14 H;  2I5M X;  1IW7 C;  2DN8 A;  5BR8 Q;  4LF9 L;  2WKD A;  1UEA B;  2F03 A;  4DV6 L;  2DJF C;  2R7Z B;  1MJE A;  3ERS X;  4U68 A;  5CV4 A;  3CCU A;  1NR4 A;  4K14 A;  1CI3 M;  4DA2 A;  1XTC D;  3PO3 G;  1EY5 A;  1U9R A;  1LT3 D;  3X3N A;  1MGS A;  4C3J H;  1TQO A;  2SDF A;  1TWA B;  2K75 A;  2B2W A;  1BBW A;  1LTS D;  5HGT A;  4RHS A;  4H0L C;  4KY5 A;  2RVL A;  4M1U B;  1WD1 A;  4HN7 A;  1PFM A;  4S3S A;  2A74 C;  4DV1 L;  5M5Y B;  3BVG A;  4P2C B;  4BBS H;  3G71 A;  1MKH A;  3E0E A;  2L5T A;  2VY3 A;  5FLX E;  4O1N A;  3IFT A;  3WDN A;  2B2T C;  4KN7 C;  5E3F A;  4YWK A;  1EY6 A;  3EVQ A;  1SJE D;  4IPC A;  4RGM A;  2ZTE A;  1WCM B;  4KK7 A;  5EGT A;  4A3E B;  3T1H Q;  1CA6 A;  2KJX A;  3ERO A;  2DY8 A;  1EY9 A;  1LTG D;  3A55 A;  4R8I A;  1VQH A;  3TBI B;  3RMH A;  2K5Q A;  1I4G A;  3U50 C;  3V96 A;  4JI5 L;  4FXG C;  3S1M B;  4EQO A;  4I7A A;  4A3F G;  1EL0 A;  4L5Q A;  4DV5 Q;  2F3W A;  1TS3 A;  2RA4 A;  2A8V A;  1LTB D;  4PG3 A;  4NXM Q;  3DMU A;  4DR2 Q;  1VQ7 A;  1S5E D;  1MI2 A;  2RF4 A;  1E1T A;  5M9O A;  3C3L A;  4DR1 Q;  1IL2 A;  1RCV D;  3QWN A;  3DLL A;  4UY8 C;  4GNX C;  1UNS A;  3BVZ A;  2EJM A;  4POG A;  1WYD A;  2JA7 H;  3U9S A;  1Y8N B;  5KND A;  1G91 A;  1GUW A;  2F0G A;  3S2H H;  3GDE A;  3MXN A;  1HUM A;  1G29 1;  2HCC A;  4LF4 L;  1BKB A;  2F0L A;  1Y1V H;  4FP5 D;  4BY1 H;  4DNI A;  4GN3 B;  4KHZ A;  2VB2 X;  5IGC A;  1B50 A;  2B3G A;  2ZJP A;  2HIX A;  3Q6S A;  4Q5V A;  1ET9 A;  1NE3 A;  1ML0 D;  1JCK B;  1I50 H;  1C4Q A;  3CF5 A;  3BYT B;  2AWN A;  4C3I B;  3SK4 A;  5GAE C;  1HFN A;  1YHQ A;  4Z9C B;  4DFA A;  2UXC Q;  4WRD A;  4P75 A;  4L6T B;  3BS1 A;  3L0O A;  2R93 G;  1EUJ A;  3Q24 A;  4JI0 Q;  1ZEQ X;  1SFO H;  2VQF Q;  3RLF A;  2UXD Q;  2VUM G;  2EYJ A;  3SVM A;  1RTN A;  2DNC A;  2SNS A;  3MEF A;  4POF A;  1BO0 A;  2JSO A;  5EPK A;  4NMZ A;  1SYG A;  4X65 L;  5JPN C;  1V1O A;  1X3P A;  2EXD A;  4DAY A;  5KYI A;  3HP3 A;  4B3T Q;  3H6M A;  1F2Y A;  2OTL A;  4GLA C;  1YHB A;  4G7H C;  1SE3 A;  1M1K C;  3K7U C;  1ESR A;  4MNO A;  2B63 G;  2KBN A;  2WIN B;  2B2U C;  3PO2 H;  3PO3 B;  1CTM A;  3ONA B;  2K05 A;  3KLS A;  3PCO B;  5C4X H;  1Q81 C;  4DR3 Q;  4PZ7 A;  3PSI A;  1V1P A;  1VMC A;  1JJC B;  3AQQ A;  4I65 A;  1TY2 A;  2B8F A;  4V19 0;  3A56 A;  5TSS A;  3M3Y H;  5IYC G;  2JA9 A;  2K52 A;  3D4W A;  1RKN A;  2HT1 A;  4TQU S;  4A93 H;  1PRT F;  1EEI D;  4HIM A;  1N32 L;  1UE5 A;  3D6C A;  2PMZ E;  2A68 D;  3VR5 A;  3HOV B;  1CM9 A;  4X6A H;  2NVX B;  2TSS A;  5JJK A;  4DV4 L;  5ELB A;  1JJ2 A;  4LF6 L;  4GN5 A;  3RR5 A;  1D6E C;  1KAB A;  3H3V H;  1TVX A;  1VQJ A;  4DV4 Q;  2JA8 G;  3GTG B;  3F2B A;  3CCE A;  1EOT A;  1Q8K A;  3R2I A;  5E7N A;  1U5K A;  2JA6 H;  3ER0 A;  1BQQ T;  3KLR A;  2MFI A;  4FF1 A;  3HKS A;  4HJA A;  5CV7 A;  2ZXO A;  3J81 i;  4A3C H;  1TWH H;  5IP9 G;  1PA6 A;  3U58 A;  1HUN A;  4YY3 Q;  1O7Y A;  5FK9 C;  5KIX A;  4MIU A;  5JVG 3;  1I5F A;  4HJ7 A;  1WTQ A;  1Q90 A;  4QY7 A;  4X64 L;  2LMC B;  1SFO B;  3VA5 A;  1DOL A;  4EVO A;  4DR2 L;  2ZXP A;  1AH9 A;  3HOV H;  2LXK A;  4KLK A;  1YVC A;  3H0G G;  1L0X B;  3PIP A;  4YHH Q;  4ZKB B;  4MHE A;  1H95 A;  2J0T D;  2F0P A;  2NZ1 D;  1JE4 A;  3F8T A;  4C3I H;  1JWU D;  5EKL A;  3K80 C;  4OXP A;  1JOQ A;  2E2J B;  1XMO Q;  2WAC A;  4YY3 L;  1IKL A;  4XT3 B;  3R8B A;  1XMQ Q;  1L1O A;  4BA1 I;  3CC4 A;  4LW1 A;  2BDO A;  3PUZ A;  3SR1 A;  3CHB D;  3HGB A;  1GXD C;  4NXN L;  2E5L Q;  1LT4 D;  3HOU G;  3P20 A;  3GD7 A;  4DR7 Q;  1TWG H;  2E2D C;  3H3V C;  5KGU A;  3PO2 B;  2NVY B;  3GP7 A;  3KBG A;  1Y8P B;  3SK5 A;  4JI0 L;  4J6H A;  1WFQ A;  1PXU A;  4OO1 H;  2F0J A;  1S72 A;  4DAM A;  1QUQ B;  5IT9 L;  4A3L H;  1SMX A;  3FHW A;  1Q1B A;  1IXR A;  2RSN A;  4OEM B;  1LUZ A;  4IUU A;  3T1Y L;  1X6O A;  3I70 A;  4GNX B;  4HMI A;  1BXT A;  2RDF A;  4ZK9 B;  2R92 G;  3K0X A;  3RD4 A;  1WCM H;  4L5S A;  4H44 C;  1V9P A;  5EBD A;  3Q22 A;  2ZXR A;  5F2D A;  1PH9 A;  3J7A 5;  1PMR A;  1BBU A;  2PCF B;  4KKS A;  2BH8 A;  4IPD A;  2HHH Q;  5I6W A;  4NDX A;  2WKC A;  1I50 B;  1OXV A;  1LV9 A;  2ZM6 Q;  1CA5 A;  1EFI D;  1PH4 A;  5K5P A;  2R7F A;  1A3U A;  1ILQ A;  3Q8D A;  2JEB I;  3WOF A;  2R93 B;  2PW5 A;  1PH3 A;  1ENF A;  3QJY A;  4JI5 Q;  2EPB A;  1Z9F A;  4QIW B;  2JA7 B;  4JI3 L;  1QOH A;  2QDB A;  3UI2 A;  4G7O C;  4C3J B;  1CZW A;  4GLX A;  5EJW A;  2JEA I;  2VXW A;  4QQB X;  1RL2 A;  3UDI A;  4U67 3;  4APV A;  1E3P A;  4CJ0 B;  1F9R A;  3CCM A;  3AU7 A;  4M8A A;  4YWL A;  4ME3 A;  3PIP 3;  1NBW A;  2YU9 B;  2BOS A;  3M4Y A;  3TEH B;  2IW3 A;  4A3E H;  1IBM Q;  2A19 A;  3HOW B;  3J7Y W;  3D4D A;  3VR4 A;  3E6Z X;  4KY7 A;  4RAU C;  4R9W A;  1PH5 A;  1GOZ A;  1VMP A;  1I4R A;  2XSC A;  3VDY A;  1K73 C;  4AYB E;  4RHR A;  1CFM A;  1STE A;  2ATW A;  2WAQ G;  3CAM A;  4XXE A;  5C3E B;  1EQR A;  3G6J B;  4FXK C;  1N36 L;  1HA6 A;  1GHK A;  3KF8 A;  1XPO A;  1U4P A;  2ENB A;  3DWA A;  2K28 A;  2QEJ C;  5CV9 A;  3F2C A;  2PI2 E;  1I94 L;  3S16 B;  1ICF B;  1KXL A;  1B4O A;  4KKU A;  4UHV A;  4LFA Q;  1JOO A;  2Z1C A;  4GKK L;  1DZ1 A;  2NYZ D;  5IYC H;  3KUP A;  3GTQ H;  4ZKC B;  1V1Q A;  1II3 A;  2K6A A;  2NVX H;  1DON A;  4HMJ A;  2EY5 A;  4LAA A;  3VYT A;  3I4N B;  5DNF A;  2JA8 B;  1CSQ A;  2JA5 H;  2R7D A;  1PTO C;  3NBH A;  2HD3 A;  3FPP A;  3K5O A;  2H4O A;  3C1E A;  3K81 C;  3K0Y A;  1EY8 A;  4QL5 A;  2N78 A;  2AQ3 B;  1PVO A;  2F4V Q;  3M85 A;  4IFD J;  2D0P A;  1EOV A;  3CC7 A;  4JI7 Q;  4A3I H;  4R4Q A;  5C44 B;  4AYB B;  4B9X A;  2N55 A;  4RG1 A;  3L7Z C;  3NTK A;  3OPO A;  2L9H A;  2UXD L;  3BU2 A;  4NP5 A;  2WAQ B;  2K14 A;  1ASZ A;  2VW9 A;  5GAD C;  1SND A;  5I2X A;  1KL9 A;  3CPF A;  1ZYR C;  4C3H B;  2WB1 E;  1HFG A;  1STG A;  4IPH A;  3I4N H;  4NW2 A;  5T1I A;  2A1A A;  3G4S A;  4F87 A;  2LS0 1;  4JI2 Q;  1W6K A;  1FL0 A;  1T5E A;  2ALY B;  4A3F H;  1HR0 W;  4RGT A;  2LY7 A;  1AZP A;  1RJT A;  5ISR A;  2MPM A;  2SOB A;  1B70 B;  5KYL A;  4JK1 C;  5ELE A;  3N52 A;  1PTO H;  1F2L A;  4DR5 L;  3K7A B;  4B08 A;  1PZK D;  3KJP A;  4IFD G;  4K8I A;  1QIL A;  2QKI C;  4B3R L;  4ALP A;  2GVB A;  4YIJ A;  1SMY D;  4DR1 L;  4IOC A;  1HNW Q;  1SEB D;  5JAV A;  1QVG A;  3F2D A;  1GUO A;  1T9H A;  4HSP A;  1BDO A;  1DD2 A;  1IL8 A;  1GVP A;  2YTX A;  1RHP A;  4FF2 A;  2N88 A;  1WTX A;  2QEX A;  1QJO A;  2B2W C;  1V8Q A;  1AEX A;  3BYY B;  3GTK H;  3EFX D;  4DN4 M;  2C5C A;  5KNC A;  1EEF D;  1BVS A;  3QR8 A;  5JVH 3;  2NVT B;  4KN4 C;  5IGB A;  1RDP D;  2F0M A;  4MTN A;  1TY0 A;  2YTY A;  5JJL A;  1TWF B;  4OWT B;  3GTL B;  3T13 A;  2X6L A;  3MTS A;  1EQQ A;  4IUP A;  1E22 A;  1YEZ A;  4JI8 L;  4DUY Q;  1MJC A;  2M2L A;  1I3Q B;  3KF8 B;  2UUC Q;  1CHQ D;  3UDG A;  1NNX A;  4K0K Q;  1HNZ Q;  5FO9 B;  4DV1 Q;  4CJ2 C;  1Y1W G;  3QB3 A;  2X6G A;  3CP0 A;  4RGO S;  4OWX B;  5M3F B;  4LF7 Q;  1HH2 P;  2Q2I A;  5C5M A;  1FVI A;  1LYL A;  1EZ6 A;  2L12 A;  1PH2 A;  1PRT B;  5C3X A;  1QB5 D;  1TS4 A;  4BBS B;  1DOM A;  4JCV E;  4LF5 Q;  5M5Y H;  1HA5 A;  4I7Z C;  4ODG A;  2H1E A;  2Z8L A;  1SLJ A;  2NN6 H;  4LMQ D;  2K50 A;  3FKI H;  3FP9 A;  4CHT B;  2NB0 A;  3T51 B;  3OIP A;  1SRU A;  4O2D A;  4CDD C;  1KD1 C;  1K0S A;  5GAG C;  1B9N A;  1RIP A;  3QOL A;  4X3T A;  4C3H G;  3S15 B;  1Q12 A;  1B53 A;  2CQO A;  4DV0 Q;  1CZG A;  2B2V A;  1HJP A;  4DV6 Q;  4AYB G;  5IE8 A;  3JAM i;  4F7X A;  1DYQ A;  5J3B A;  1Q7Y C;  4YHH L;  2G9D A;  5FJ8 G;  3HG9 A;  5IYD G;  1G2T A;  1HHV A;  2J7Z A;  2JA7 G;  1ENA A;  5BN5 A;  1EFW A;  1H9M A;  1VQM A;  4LFC L;  3J7Z C;  3OYY A;  3A5U A;  1FJG Q;  2PW7 A;  3NBI A;  1QZH A;  1D1I A;  1LTT D;  5A35 A;  4BY1 G;  2ZM6 L;  4H13 C;  4JC0 A;  1ZXT A;  4GOP C;  1KDB A;  3H15 A;  3ULP A;  2NBF A;  2EYM A;  3FVQ A;  3OIQ A;  1D5M C;  2KEE A;  5EPL A;  4A3G G;  1SNQ A;  2PNR C;  4ZUI A;  2K33 A;  5CBA E;  3IFD A;  4X64 Q;  2PMZ B;  4HSV A;  1Y69 U;  3OWF A;  1G51 A;  5GQO A;  3H0G H;  5I6Y A;  4CKB A;  1GUG A;  2Q8I B;  3BZD B;  3H3V I;  4AIM A;  3HOY B;  4P71 A;  2F0N A;  1F77 A;  2KHJ A;  4XYO A;  1X9N A;  1J8I A;  3BZC A;  1QNK A;  1KTK A;  1A0I A;  1OTC A;  2CKZ B;  5C4H A;  3M4P A;  1BR9 A;  1C9O A;  3EA6 A;  1YJW A;  3BDO A;  1GJX A;  5H1S E;  5CV8 A;  1Y14 B;  2F0U A;  2NN6 I;  4JPB W;  5C44 G;  1C0A A;  5CV6 A;  2CH4 A;  1PYW D;  5BN4 A;  3J81 L;  4ZRZ A;  1FJG L;  3BDL A;  5IY0 A;  2VQE L;  4L5R C;  4B3M L;  4A3M G;  4F8M A;  1MD2 D;  5C6A A;  1VF5 C;  1VQE A;  1S5C D;  4O42 A;  2O4X A;  4IO9 A;  2PZU A;  4A3K B;  5I9P A;  3OTO Q;  3GTJ B;  5IT9 E;  4A3D G;  1EIH A;  1K3B C;  5G3L F;  5LMN Q;  4ZUJ A;  3SE0 A;  5C0X H;  1O7L A;  2QGQ A;  4OON A;  4J1M A;  1CHP D;  1TXY A;  3ICE A;  1OO9 B;  1VQ4 A;  1AFP A;  5CC4 A;  4DK6 C;  1AZQ A;  2HDM A;  4QB4 A;  3UE0 A;  1E2V A;  3SDZ A;  4EQ5 A;  1F9P A;  1D5X C;  5AJ3 Q;  5COR A;  1OXX K;  4L5T A;  4QGU A;  3L2P A;  4JI7 L;  4JV5 Q;  1AE2 A;  4K8J A;  3FMC A;  1S5F D;  1E2W A;  1YNN C;  3ERQ A;  1O7Z A;  2IX0 A;  2JA8 H;  1X54 A;  1SNC A;  4RGN A;  1X3Q A;  1HR0 Q;  2DGY A;  4WJ4 A;  2LXJ A;  3D6W A;  4IFD H;  1JB7 A;  4DV7 L;  1WTV A;  1X3G A;  1SNM A;  2DNE A;  1SDF A;  2AUK A;  2HUG A;  1I4H A;  3H94 A;  2K03 A;  2FIN B;  4NKL A;  3M7N A;  1QWY A;  4LFB Q;  3I3C A;  4GNX A;  4FXD A;  1TII D;  4ABN A;  3ND8 A;  4A3J B;  3PV0 A;  4H02 A;  3DXJ C;  1BCP C;  1UWV A;  5C0X I;  3TP8 A;  1A2T A;  3MFY A;  5J39 A;  4OO1 I;  4GOP A;  3HOX B;  1HTP A;  1X3F A;  5FKA C;  4KI0 A;  4EQP A;  2L15 A;  4C2M B;  2CW0 D;  4JBW A;  3LGJ A;  1H9R A;  2RQX A;  1L2F A;  3I90 A;  1UAP A;  4DU9 A;  2A5H A;  2B39 A;  4UAI A;  4JBJ A;  3A8J E;  3MA2 B;  1EIG A;  1NMF A;  1OXS C;  2IWH A;  4JI4 L;  2UUA L;  4YWM A;  3CXC A;  5JJZ A;  1S5B D;  5M3F G;  1LT6 D;  2L11 A;  1CUK A;  1QNU A;  4C1N K;  2L1B A;  3J7A V;  1UE6 A;  1W6J A;  1PZJ D;  1VF7 A;  1I6V C;  1Y1V B;  3TP5 A;  2BDN A;  1Q3L A;  4CJ1 B;  4V0B A;  4YCU A;  2WP8 J;  5E4W C;  3F2U A;  3G6E A;  4CKC A;  4HED A;  1WTP A;  2I46 A;  4N9P A;  5CGK A;  3G48 A;  1TKW B;  5IGE A;  3MC0 B;  3NK9 A;  1GKH A;  3R93 A;  3W3A A;  2UUC L;  5CV5 A;  4DK1 A;  1N8R C;  2ZJR A;  3NBH B;  1I94 Q;  1K9M C;  2R93 H;  1XJV A;  4A3D B;  2K04 A;  4QCL A;  1ZKO A;  3E3X A;  2K4K A;  4EX5 A;  4DAV A;  1R9T B;  1VQK A;  1SAP A;  3HOX G;  5IGG A;  4DR7 L;  4FNF A;  3S24 A;  1AN8 A;  1UE7 A;  1G8Z D;  2O2L D;  3E9H A;  2CW0 C;  3K58 A;  1Q82 C;  5FJ8 H;  3DWQ A;  2RHS B;  2MHV A;  1KDA A;  2AKW B;  4DV5 L;  3S1Q H;  2QDL A;  1N32 Q;  2QF7 A;  3MZ5 A;  4IFD I;  3NXW A;  3SXH A;  4JI6 L;  1PTO D;  2HHH L;  4PZ8 A;  4PMW A;  3K8A A;  1GUS A;  3Q23 A;  1K83 H;  4LF8 L;  1N33 L;  4YCV A;  3S17 H;  4WOR A;  2F0E A;  3HZX A;  2IHF A;  3KBX A;  2OT2 A;  3B6Y A;  3QO2 A;  2VL6 A;  1NMG A;  2NVY H;  3M9B A;  3GTG H;  3HEJ A;  1EY7 A;  3OTO L;  1V1P B;  2E2H B;  2E2I B;  1TWG B;  2WAQ E;  3A0J A;  2VQF L;  2RHQ B;  3S1R B;  3I72 A;  2B29 A;  4JW0 A;  4FF4 A;  1SYC A;  4BY7 H;  4G7Z C;  1J5E Q;  4MZ9 A;  2NTS A;  1YZ6 A;  1TT2 A;  3RN2 A;  2F0K A;  4LF7 L;  3U4V A;  2MJ8 A;  4DAY B;  3CCL A;  4RFB A;  2RDG A;  1SNP A;  2JXM B;  3WOE A;  4N8X 1;  3CCQ A;  3M3Y B;  5M3M H;  3P7J A;  3P75 A;  2CFM A;  3TS0 A;  3S14 B;  1NCV A;  4LK1 C;  1JIC A;  4A3C G;  1H9K A;  1IBM L;  4B3R Q;  4PV1 C;  1QE6 A;  1SSO A;  5IP7 H;  4E6I A;  2JP1 A;  4KV6 A;  4PZ6 A;  4OIJ A;  2RSO A;  4LUV A;  2AQ2 B;  4JV5 L;  3K6O A;  2E74 C;  1L0W A;  2CCZ A;  3K5N A;  3D4R A;  5FLX c;  2F4I A;  1IHZ A;  2OF1 A;  1HNX L;  2CWA A;  2GVA A;  1ASY A;  2EYH A;  1TS5 A;  2PZW A;  4R8N A;  3DWP A;  2B2V C;  4BWG B;  2EY2 A;  1SYE A;  2Z0S A;  3UE1 A;  1SN8 A;  1VQ5 A;  3HOZ H;  3C46 A;  1D5Z C;  3MXN B;  4K5X A;  1PZI D;  1IYJ B;  5C5L A;  2JA5 G;  2PQE A;  2KCN A;  2ES2 A;  5LMU Q;  2PZT A;  4EGV A;  1JQY D;  1YIT A;  3KYH C;  4PNY A;  1XXG A;  1SYF A;  2F0I A;  4HIK A;  4FVM A;  3K5L A;  3S9W A;  2WFW A;  2UUB L;  2V1C C;  4NB3 A;  1BCP B;  5DM7 3;  1L1O B;  1KC8 C;  3S1N B;  2KHI A;  1Q86 C;  2PNH A;  5LL6 S;  1EQT A;  2A73 B;  3NWS A;  5IOD A;  4A93 B;  4G57 A;  1TS2 A;  5HUR A;  1KIX A;  4DV7 Q;  2F0V A;  2BCO A;  3TQY A;  2ICE C;  1HZ9 A;  4IUT A;  3S2H B;  4OO1 G;  4B3T L;  3GV6 A;  3OWE B;  5IYB G;  4DR4 Q;  3QOJ A;  2ZTD A;  3O13 A;  5AFW A;  5C3E G;  3MAQ A;  3R3O A;  1FGU A;  3J81 E;  4L63 B;  3I4N G;  1JR0 D;  2QCP X;  3GTO B;  4C1N I;  4G4K A;  4XQN A;  2NUC A;  5M5W H;  5EQ0 A;  3PMF A;  1LT5 D;  1LTR D;  1WCM G;  2VUM B;  5C4Z A;  1VQL A;  1IYU A;  1XNQ L;  5EKK A;  5LMN L;  4RMF A;  2EY6 A;  2YYZ A;  4FO2 A;  3KF6 A;  3ULJ A;  4DV3 Q;  2F3I A;  1O7I A;  1BF4 A;  2F4V L;  2LSS A;  3DEO A;  3PIO A;  4PQX A;  3RLO A;  1Y8O B;  1LTI D;  3M4Q A;  4QUC A;  4ILW A;  2YTV A;  3DUZ A;  3MXG A;  5CBE E;  1I6H H;  1A62 A;  1SE4 A;  2EY1 A;  4HJ8 A;  3OMC A;  4LUZ A;  1PH1 A;  1GM5 A;  1XMQ L;  4HTH A;  1VS0 A;  3KLS X;  1Y1W B;  1ONL A;  1CKM A;  3STB C;  5HGQ A;  2FHT A;  4GKK Q;  1Q1E A;  5I9O A;  3TN2 A;  3OW2 A;  5DLQ E;  4IJL A;  1XNR L;  2A6H C;  4BXX H;  1PFB A;  2HCI A;  5BR8 L;  3CCS A;  4LF9 Q;  3PGZ A;  4BY1 B;  4GKJ L;  2CHB D;  3FRP B;  1VQP A;  1B7Y B;  2N8N A;  2XIW A;  3NEN A;  2K01 A;  3RLN A;  1NUC A;  4DUZ Q;  3IAY A;  4B9W A;  2DUD A;  1JOR A;  4UP8 A;  5C3W A;  1HQM C;  2MNA A;  3HS0 C;  4J8Q A;  4QIW E;  1EYC A;  4K5V A;  2RKS A;  1SRO A;  3VR2 A;  1F2M A;  4ID6 A;  2IT1 A;  3K59 A;  4DV2 Q;  3LWE A;  2NVQ H;  4RKL A;  5ELD A;  1LM0 A;  4ULL A;  1I3Q H;  4ZLT F;  1D1K A;  4JBM A;  4YCW A;  2JE6 I;  2K1B A;  1LO5 D;  2TMP A;  1TWF H;  1N36 Q;  1PFS A;  3QG1 A;  3C2P A;  4K5W A;  1AE3 A;  5I2Y A;  5IOC A;  3PQI A;  1M90 C;  3ND9 A;  3I4M H;  4CBV A;  5C4J H;  1GUT A;  2F52 A;  1J6Q A;  1EU4 A;  1WD0 A;  2CQA A;  3GTK B;  3N6R A;  3TME A;  4A3M H;  1FNU A;  1A6X A;  1K8A C;  3LX0 A;  1PYS B;  2R6G A;  5COY A;  1QVF A;  3FKI G;  4R4T A;  1VCI A;  3M4O H;  5A2Q L;  4DAP A;  2UXC L;  1HNW L;  2RCN A;  1P8L A;  2B8G A;  3CQZ B;  4AH6 A;  2EYP A;  2BE5 C;  2KUM A;  1P16 A;  1PH6 A;  2F0W A;  5C0X G;  4OGQ C;  4HR7 B;  3T4A C;  2CH4 W;  4C56 C;  2OEO A;  3VR3 A;  1PYB A;  2XRS D;  5IIF A;  4DF7 A;  1HXY D;  4OWW B;  1S4Z A;  1SXT A;  4UDU C;  4JI1 L;  1I4P A;  1KQS A;  3CCR A;  3I4M B;  1X56 A;  3CW2 C;  2R61 A;  4JG2 A;  4A3F B;  2K5V A;  3CCJ A;  5ELC A;  4DV0 L;  1T5X D;  3KJO A;  4X62 Q;  1M8A A;  3SHL A;  1EWC A;  2F1M A;  4Y7N H;  3BDC A;  1HZB A;  2K5N A;  2ZTC A;  3PUW A;  2FMC A;  2XRQ D;  3NWT A;  1F2Z A;  3J80 c;  5KRU A;  1PLF A;  1KLU D;  2ZJQ A;  1U4R A;  3DHQ A;  3U4Z A;  4WJ3 M;  2WII B;  2K5W A;  1J9O A;  1MIU A;  2H5X A;  1A63 A;  2XVS A;  2ID0 A;  2OXP A;  2UXB L;  3V05 A;  2PO4 A;  4A3B B;  1IKM A;  4OL7 A;  3HFZ B;  3CCV A;  4AQY L;  1ESF A;  2OWO A;  5FOB B;  3RZO B;  3ULL A;  3FKI B;  1WOC A;  5JEA J;  1HNX Q;  3RN5 A;  2EDG A;  2F3V A;  3J80 E;  1BCP D;  3HOZ G;  4DV2 L;  2HIV A;  1BNZ A;  4P73 A;  1VQG A;  4LF4 Q;  2BE5 D;  1S5D D;  2EYL A;  4RH6 A;  2D62 A;  5FLM H;  1NY4 A;  3U9O A;  5K36 G;  5M3F H;  3OHX C;  2A68 C;  5IGF A;  2SEB D;  1C8C A;  1A3T A;  2B2Y A;  3E5S A;  1A2U A;  3TZD A;  2DJG C;  3GTP H;  1BOS A;  3QIA A;  3K5M A;  2KQ3 A;  5KEE A;  2KOL A;  4A3G B;  3NEL A;  3DEP A;  3A7L A;  1B2T A;  3JAM c;  2KED A;  4K0K L;  2WB1 G;  3S2D B;  2B2T A;  4DXF A;  3MHB A;  1X32 A;  1A15 A;  2M00 A;  4DGZ A;  1H9S A;  3I55 A;  4J15 A;  3AMU A;  1STB A;  5C3E H;  4JYA Q;  3NUC A;  1S40 A;  5JEA G;  3HOY G;  1L0Y B;  2NVQ B;  3GTO H;  2IPK D;  1YBY A;  2PQA B;  3GQB A;  4XTC S;  1M4V A;  1D2B A;  4HIO A;  2XGT A;  1JC7 A;  2KVM A;  1TWC B;  4JOI C;  4KJN A;  5I4D A;  3CD6 A;  4HJ5 A;  1FD7 D;  5EKI A;  3ZYY X;  5M5X H;  4TSS A;  2HQE A;  1D8L A;  1Z6H A;  2HDL A;  4A76 A;  1R4P B;  4BBR H;  4LF8 Q;  4LNQ A;  4K6D A;  3FEW X;  2L4N A;  2Z6K C;  1JB3 A;  2NZO A;  1CT1 D;  1NSN S;  3GTM H;  2IY5 B;  1EQV A;  2Q2H A;  3K7A H;  3RNU A;  3NEM A;  1K28 A;  1I6H B;  3H09 A;  4DR5 Q;  1EWI A;  1Y1V G;  1XTD A;  3GTP B;  2A69 D;  4GLV B;  3SEB A;  2D2C C;  3SGI A;  4GZY C;  5E1F A;  1L1O C;  1UE1 A;  5DM6 3;  1STN A;  1JMC A;  2UXB Q;  1G6Z A;  4CKE A;  1LAB A;  2EJF C;  4Q0F A;  2Z4H A;  4GKJ Q;  4C3H H;  5EBC A;  1I4Q A;  4A3K G;  1MBY A;  1STY A;  2R92 B;  1LTL A;  1WI5 A;  3FPU B;  1PH8 A;  1FGB D;  5D65 A;  4BY7 G;  2YV5 A;  1B9M A;  4IN3 A;  1SE2 A;  1KLG D;  5T1G A;  4DNR B;  2EYO A;  2P5Z X;  1CKN B;  3CRK C;  3T53 B;  2PI2 A;  4A3B H;  5NUC A;  1HQR D;  3TZU A;  3MXU A;  4NXM L;  4B3M Q;  3D8G A;  1BUV T;  1EYD A;  1HCZ A;  4L8J A;  2PQA A;  1QVC A;  4ME5 A;  2IX1 A;  1W2B A;  1UUP A;  4DK0 A;  3AFQ A;  2NTT A;  3P1H A;  1VQD A;  2VS1 A;  4JBK A;  2EIF A;  3KK7 A;  2I0Q A;  3LNN A;  4LJZ C;  1KRT A;  4BS9 A;  3VR6 A;  2JA5 B;  1STA A;  3S1N H;  5C4X G;  2IL8 A;  1SYD A;  5IP7 G;  1Z47 A;  5DAU A;  4DXG A;  5HY6 A;  1ICW A;  1LLR D;  5E4X A;  3I2Z A;  2LFN A;  1K8O A;  3VYS A;  3KDF A;  3S1R H;  1IYV A;  2AUJ D;  2K7V A;  2Z9H A;  4KJO A;  3ZJY C;  3JAM E;  1VQB A;  1WJJ A;  3GTQ B;  3GO5 A;  2E2I H;  2CVR A;  4A93 G;  1IZ6 A;  4KHP L;  4OX9 Q;  1VQ6 A;  4NXN Q;  4TKO B;  1EYG A;  4A4I A;  1B8A A;  5IT9 c;  3IRB A;  2OQK A;  4AQY Q;  2RBM A;  3Q0A A;  2FJ2 A;  3EIV A;  1HR0 L;  3A54 A;  2RDH A;  5FO8 B;  4C3J G;  3S17 B;  3PF5 A;  5IWA Q;  1XPR A;  2AMC B;  1DJR D;  2AHO B;  2E2J H;  3L3O C;  2HQL A;  2QW7 A;  2OTJ A;  1TR5 A;  2XNA C;  1E24 A;  3CME A;  4LF6 Q;  2Z6B A;  1E1O A;  2LKV A;  4FDB A;  2A6E D;  4BA2 I;  4A3M B;  4X62 L;  2R7Z G;  4GOP B;  2O5J C;  2B2U A;  2YU9 H;  2MO1 A;  5C4J B;  2Z4I A;  4IJH A;  1X3E A;  4IUV A;  1Q8I A;  4CDC C;  4A3D H;  3I4L A;  2WV6 D;  1RTO A;  2BH2 A;  2R3Z A;  4HAE A;  3AYH B;  3AFP A;  4IOA A;  2F0Q A;  4IQZ A;  4UPA A;  1YJN A;  4KY6 A;  3G7L A;  2JA6 B;  4RKB A;  1JWS D;  1HRJ A;  1YI2 A;  5BN3 A;  4C3I G;  5J22 A;  2G9H D;  5FLX L;  3KOJ A;  2Y0S G;  2E2H H;  4JI8 Q;  1YNX A;  4JI6 Q;  1NAP A;  5IWA L;  2GA4 B;  4DR6 L;  2FFK B;  1WTW A;  1VQA A;  1JWM D;  5M3M G;  1VQ8 A;  3T56 B;  5CYU A;  5K36 H;  2UU9 L;  1C48 A;  1E7Z A;  3NQT A;  4EQN A;  1K8G A;  4KHV A;  3HOU H;  3HKZ G;  1G6P A;  4JI2 L;  1ENC A;  1QUQ A;  2Q2U A;  1A8V A;  3S1Q B;  1U4M A;  3KFU A;  1WTH A;  3PF4 A;  1O78 A;  2D5D A;  3RUZ A;  1EIF A;  1X65 A;  1MSH A;  3VA7 A;  5C4X B;  2G5D A;  4NPS A;  1QG7 A;  4GN4 B;  5CMD A;  4FYD A;  3BVM A;  3STB D;  1R9T H;  5LMN W;  2F0D A;  5JEA H;  1XYI A;  3NP8 A;  3PO3 H;  3MVV A;  3D0F A;  3KDF B;  3KF6 B;  2Q8T A;  1IBK Q;  2R92 H;  1LTA D;  3T1Y Q;  1VQC A;  2VNU D;  4CDE C;  1ZYR D;  3VYU A;  1RF2 D;  2F0T A;  5JJI A;  4IAL A;  1CQV A;  3BZK A;  5M5W B;  1OXU A;  2OCE A;  1KAA A;  3CKI B;  3BG3 A;  1QZG A;  2B2Y C;  3OSO A;  5G3L D;  5ELF A;  3A5Z B;  4KKT A;  4UP9 A;  4BBR G;  5LHY 1;  5C0X J;  2AWO A;  2BA1 A;  4CDF C;  4B3S Q;  4BBS G;  2B63 H;  1BCP F;  3PO2 G;  2EXZ A;  2E5L L;  2V4D A;  1UEB A;  4KMU C;  3E0J A;  5EAY A;  5ELN A;  3GTM B;  3IKJ A;  2EZV A;  4XT1 B;  2NWG A;  1PH7 A;  2ZT9 C;  4R4C A;  2K5H A;  3HOU B;  1FR3 A;  4MN3 A;  5GRO A;  1VQO A;  2QIL A;  1E0B A;  1XMO L;  3E9I A;  4K6L A;  3I91 A;  1N34 Q;  1KAW A;  3UDX A;  4FF3 A;  2A6E C;  4CGY B;  2VQE Q;  2B63 B;  1B3A A;  1JT8 A;  2K32 A;  4HCS A;  3GTJ H;  2QA4 A;  2L0C A;  2RCF A;  3A74 A;  3CMA A;  4A3K H;  4R4O A;  1IBL L;  5JOB A;  3HOX H;  3HOZ B;  1O80 A;  3KLW A;  2I5H A;  2DY7 A;  4X66 Q;  2EJG C;  1XPU A;  1HZC A;  4ZQ3 A;  1K3R A;  2XWB B;  4QJF A;  4A3J H;  4MTK A;  1TWH B;  1N9W A;  3H91 A;  2Y0S B;  4A3B G;  1XNQ Q;  4H7B A;  4DPG A;  1FNW A;  4LUO A;  3J80 i;  3S1M H;  4RCN A;  1KNA A;  2JJQ A;  2A6H D;  2J4X A;  3TSS A;  2JA6 G;  3T1H L;  1LAC A;  2SNM A;  4LFC Q;  1SBB B;  3MWY W;  3I7F A;  4RCO A;  1WTO A;  1I4X A;  3WWV A;  2WB1 B;  1AW7 A;  4TVA B;  1MHW C;  1DXM A;  4DUY L;  4DUZ L;  2KCM A;  1R4Q B;  2KHS A;  3PUY A;  2EE1 A;  5DEH A;  5M3M B;  1U0L A;  3EQL C;  4R1J A;  1B1Z A;  3SK8 A;  4IUR A;  1C7Y A;  1VDZ A;  2EQS A;  1YHA A;  1KDC A;  3NTH A;  3HOV G;  1H9S B;  2D0O A;  2N49 A;  4JI1 Q;  1CK1 A;  4P72 A;  2E76 C;  2GN5 A;  3RZO H;  1SE8 A;  3I4O A;  1PRT C;  4X66 L;  4BY7 B;  3A7A B;  4P74 A;  4JOI A;  1NTG A;  3MXP A;  4WJW A;  4Y52 H;  1DGS A;  3OMG A;  1ROD A;  3I73 A;  1F9S A;  4XYQ A;  5FLM G;  3LWU A;  4O0A A;  4ZCK A;  1EZ8 A;  4IPG A;  3FDT A;  1EY0 A;  5D3I B;  3J81 j;  3V2T A;  3I4M G;  5ELO A;  3HOW G;  4WFN 3;  4R4I A;  4IUN A;  2MGS A;  2EOT A;  4XQJ A;  4KHP Q;  1W3S A;  1S3O A;  3OW7 A;  2MUY A;  4RWS C;  1K83 B;  1KRS A; 
#chains in the Genus database with same CATH homology
 1VQ9 A;  2R7Z H;  3J80 c;  1IBK L;  1I5F A;  1IBL Q;  4HJ7 A;  4IO9 A;  2ZJQ A;  3UDF A;  4LF5 L;  4QY7 A;  3U4Z A;  4X64 L;  3S15 H;  4WJ3 M;  3OTO Q;  1MIU A;  2H5X A;  4A3L G;  1A63 A;  4DR2 L;  4A3D G;  1CSP A;  3DM3 A;  2ID0 A;  2UXB L;  1AH9 A;  5LMN Q;  3HOV H;  2LXK A;  1N34 L;  4KLK A;  3HOY H;  3HFZ B;  1YVC A;  2QGQ A;  3H0G G;  3PIP A;  3CCV A;  4OON A;  4YHH Q;  4AQY L;  1J5E L;  2OWO A;  1H95 A;  1GO3 E;  3ULL A;  1TXY A;  3BJU A;  3F8T A;  1WOC A;  5JEA J;  4C3I H;  1HNX Q;  3ICE A;  3RN5 A;  1VQ4 A;  4DK6 C;  3K80 C;  4OXP A;  3UE0 A;  3HOZ G;  1XMO Q;  4DV2 L;  3CQZ H;  4EQ5 A;  4YY3 L;  5AJ3 Q;  2HIV A;  4QGU A;  1OXX K;  4L5T A;  3L2P A;  4JI7 L;  4JV5 Q;  2UUB Q;  4P73 A;  1AE2 A;  1VQG A;  1XMQ Q;  4LF4 Q;  1L1O A;  4BA1 I;  4HJ9 A;  3CC4 A;  2D62 A;  4LW1 A;  5FLM H;  1V43 A;  2IX0 A;  3PUZ A;  1NY4 A;  2JA8 H;  1X54 A;  5K36 G;  1GD7 A;  4NXN L;  5M3F H;  1HR0 Q;  2DGY A;  3EN2 A;  2E5L Q;  4WJ4 A;  2LXJ A;  1D7Q A;  1JB7 A;  4DV7 L;  3I56 A;  1X3G A;  3HOU G;  3TRZ A;  3TS2 A;  3GTP H;  3GD7 A;  1KHI A;  1TWG H;  4DR7 Q;  1XNR Q;  5IP9 H;  4A75 A;  3NEL A;  3PUX A;  4DV3 L;  1K0R A;  3JAM c;  4K0K L;  4JI0 L;  3M7N A;  2WB1 G;  5IYB H;  1WFQ A;  4LFB Q;  4GNX A;  4LWC A;  1S72 A;  4DAM A;  1QUQ B;  4A3L H;  1SMX A;  3FHW A;  3GTL H;  1Q1B A;  1Q46 A;  3PV0 A;  1IXR A;  4H02 A;  4J15 A;  3I55 A;  1UWV A;  1LUZ A;  5C3E H;  4JYA Q;  1S40 A;  3HOY G;  5JEA G;  5C0X I;  3T1Y L;  1X6O A;  4GNX B;  2NVT H;  4OO1 I;  4GOP A;  3GTO H;  2PQA B;  1YBY A;  4XTC S;  1X3F A;  4KI0 A;  2UXD Q;  2L15 A;  3F1Z A;  2R92 G;  4JBW A;  4HIO A;  3JC6 6;  3K0X A;  3LGJ A;  2XGT A;  1L2F A;  1WCM H;  4L5S A;  4JOI C;  3CD6 A;  4HJ5 A;  1V9P A;  4JBJ A;  5M5X H;  2BA0 A;  1NMF A;  1PH9 A;  1OXS C;  4C2M H;  3J7A 5;  1BBU A;  1D8L A;  2MQH A;  2BH8 A;  1SR3 A;  4IPD A;  4YWM A;  3CXC A;  2HHH Q;  2UUA L;  4JI4 L;  5M3F G;  4A76 A;  4A3E G;  4BBR H;  2Y0S E;  4LF8 Q;  4DKA C;  1CKO A;  1CUK A;  1OXV A;  2ZM6 Q;  4LNQ A;  1VQI A;  1UE6 A;  1PH4 A;  2ASB A;  2R7F A;  2Z6K C;  1HNZ L;  3Q8D A;  2NZO A;  1Y1W H;  2JEB I;  3GTM H;  2IY5 B;  2Q2H A;  3K7A H;  3RNU A;  1PH3 A;  1X55 A;  2VZA A;  3NEM A;  4YCU A;  4JI5 Q;  2WP8 J;  4UP7 A;  1Z9F A;  4DR5 Q;  4JI3 L;  1EWI A;  1Y1V G;  2C35 B;  1TWA H;  3G6E A;  2JQO A;  4BXX G;  4JYA L;  4GLX A;  4OX9 L;  2JEA I;  1XTD A;  1YJ9 A;  3G48 A;  4QQB X;  1RL2 A;  4GLV B;  4GS3 A;  5AJ3 L;  3UDI A;  3W1B A;  4JI4 Q;  4HID A;  1GKH A;  3SGI A;  2NZH A;  4APV A;  2UUC L;  1HZA A;  4DK3 C;  1E3P A;  2NN6 G;  1N8R C;  1L1O C;  1UE1 A;  2ZJR A;  1JMC A;  2UXB Q;  3NBH B;  3CCM A;  1I94 Q;  1K9M C;  2R93 H;  2FXQ A;  4GKJ Q;  4C3H H;  4A3K G;  1XJV A;  4B3S L;  2VUM H;  4X65 Q;  1LTL A;  1WI5 A;  1PH8 A;  4BY7 G;  2YV5 A;  4YWL A;  2CWP A;  2K4K A;  4ME3 A;  4EX5 A;  1VQK A;  3HOX G;  1NBW A;  2Q2T A;  3TEH B;  4DR7 L;  1CKN B;  2UUA Q;  3S24 A;  4A3E H;  1IBM Q;  2A19 A;  1UE7 A;  3E9H A;  2PI2 A;  1VQF A;  4A3J G;  1PH5 A;  4A3B H;  1TWC H;  1Q82 C;  4NXM L;  2E8G A;  5FJ8 H;  4B3M Q;  2I5L X;  2RHS B;  5IYD H;  2AKW B;  2PQA A;  1QVC A;  2IX1 A;  4DV5 L;  3VDY A;  4AYB E;  1W2B A;  1K73 C;  3S1Q H;  3W5O A;  1JJG A;  1N32 Q;  3AFQ A;  1VQD A;  2VS1 A;  4IFD I;  4JBK A;  4JI6 L;  2ATW A;  3AEV A;  2WAQ G;  3CAM A;  2EIF A;  2I0Q A;  2HHH L;  4PZ8 A;  4PMW A;  3K8A A;  2XTI A;  1K83 H;  1EQR A;  1KRT A;  3TRE A;  1N36 L;  4LF8 L;  4LFA L;  1N33 L;  4YCV A;  3S17 H;  3S1N H;  5C4X G;  1XPO A;  5IP7 G;  4A3I G;  1Z47 A;  5HY6 A;  2JK8 A;  2IHF A;  3F2C A;  4DR4 L;  1JE5 A;  3B6Y A;  3S2D H;  4LFB L;  2PI2 E;  3I2Z A;  1I94 L;  2VL6 A;  1NMG A;  3KDF A;  1KXL A;  2NVY H;  3S1R H;  4LFA Q;  3ZJY C;  1PV4 A;  3M9B A;  3GTG H;  4A3G H;  1VQB A;  1WJJ A;  5GAH C;  3GO5 A;  3OTO L;  1NJI C;  5IYC H;  2E2I H;  4GKK L;  4JI3 Q;  3GTQ H;  2WAQ E;  3A0J A;  2VQF L;  4A93 G;  1V1Q A;  2RHQ B;  1IZ6 A;  2NVX H;  3CPW A;  4OX9 Q;  4NXN Q;  1VQ6 A;  4KHP L;  2B29 A;  1EYG A;  4A4I A;  1B8A A;  5IT9 c;  3IRB A;  3S16 H;  4DR6 Q;  4BY7 H;  2OQK A;  4AQY Q;  1J5E Q;  4MZ9 A;  2OQ0 A;  3RZD H;  1YZ6 A;  3EIV A;  3W1G A;  3RN2 A;  3HKZ E;  1HR0 L;  1CKN A;  1N33 Q;  2KEN A;  1YIJ A;  4LF7 L;  3U4V A;  4DAY B;  1EIY B;  2MO0 A;  3CC2 A;  1CSQ A;  2JA5 H;  3CCL A;  2R7D A;  3PF5 A;  5IWA Q;  5LMU L;  1XPR A;  2AMC B;  2AHO B;  2E2J H;  2HQL A;  3CCQ A;  2IHE A;  2OTJ A;  3K81 C;  3EBE A;  1E24 A;  5M3M H;  4QL5 A;  3PUV A;  3CME A;  5C44 H;  4LF6 Q;  2CFM A;  3TS0 A;  2N78 A;  1PHJ A;  1PVO A;  1E1O A;  4XIG S;  2KCT A;  2N3S A;  3M85 A;  2F4V Q;  4A3C G;  4IFD J;  2D0P A;  1IBM L;  1EOV A;  1OXT A;  3J81 c;  2UU9 Q;  2Z6K A;  3D31 A;  4FDB A;  3HOW H;  4B3R Q;  3CC7 A;  4DR3 L;  1VQN A;  4X62 L;  4BA2 I;  2R7Z G;  4JI7 Q;  4GOP B;  5IP7 H;  4A3I H;  4R4Q A;  3S14 H;  2YU9 H;  2MO1 A;  4RG1 A;  3L7Z C;  2I5M X;  4PZ6 A;  4LUV A;  4IJH A;  5BR8 Q;  4LF9 L;  3BU2 A;  4JV5 L;  1X3E A;  2UXD L;  2K14 A;  1L0W A;  2VW9 A;  5GAD C;  1ASZ A;  2CCZ A;  4DV6 L;  4A3D H;  1KL9 A;  1MJE A;  3CPF A;  3ERS X;  5FLX c;  2BH2 A;  2WB1 E;  3AYH B;  3CCU A;  1HNX L;  3AFP A;  2CWA A;  4IOA A;  4IPH A;  2GVA A;  3I4N H;  1ASY A;  1YJN A;  2A1A A;  4UPA A;  3G4S A;  3PO3 G;  2Z0S A;  4JI2 Q;  1YI2 A;  1FL0 A;  3UE1 A;  1SN8 A;  1VQ5 A;  2ALY B;  3HOZ H;  4A3F H;  1HR0 W;  3MXN B;  1IYJ B;  3KOJ A;  2Y0S G;  4C3J H;  2E2H H;  2K75 A;  2JA5 G;  4JI8 Q;  1YNX A;  1B70 B;  4JI6 Q;  2ES2 A;  1BBW A;  5IWA L;  5LMU Q;  1YIT A;  3KYH C;  4DR5 L;  4DR6 L;  4HIK A;  1VQA A;  5M3M G;  1VQ8 A;  2WFW A;  3KJP A;  2UUB L;  4IFD G;  2V1C C;  4NB3 A;  2UU9 L;  4B3R L;  4ALP A;  1L1O B;  1KC8 C;  1E7Z A;  2GVB A;  2KHI A;  1Q86 C;  2PNH A;  4DV1 L;  4DR1 L;  1K8G A;  4IOC A;  4BBS H;  1HNW Q;  3G71 A;  1MKH A;  3E0E A;  3HOU H;  2VY3 A;  3HKZ G;  1G6P A;  1QVG A;  3F2D A;  4JI2 L;  1T9H A;  1KIX A;  4DV7 Q;  1GVP A;  1QUQ A;  2Q2U A;  1A8V A;  2YTX A;  1KRS A;  4YWK A;  3TQY A;  1HZ9 A;  4OO1 G;  4B3T L;  5IYB G;  3KFU A;  4IPC A;  2QEX A;  3PF4 A;  2ZTE A;  4DR4 Q;  2ZTD A;  1EIF A;  1X65 A;  3T1H Q;  5C3E G;  3GTK H;  4GN4 B;  4NPS A;  1BVS A;  1FGU A;  3I4N G;  1VQH A;  3STB D;  1R9T H;  5LMN W;  3U50 C;  3PO3 H;  4MTN A;  5M5W H;  4JI5 L;  3D0F A;  3KDF B;  3KF6 B;  2YTY A;  5JJL A;  1WCM G;  1IBK Q;  4OWT B;  2R92 H;  3T1Y Q;  4A3F G;  1VQC A;  4L5Q A;  4DV5 Q;  1VQL A;  2VNU D;  1EQQ A;  1XNQ L;  2A8V A;  1E22 A;  4PG3 A;  5LMN L;  4NXM Q;  1YEZ A;  4RMF A;  4JI8 L;  5JJI A;  4DUY Q;  2YYZ A;  1MJC A;  3KF6 A;  3KF8 B;  3ULJ A;  4DV3 Q;  2F3I A;  1O7I A;  4DR2 Q;  1VQ7 A;  2UUC Q;  3BZK A;  2F4V L;  2LSS A;  1OXU A;  3UDG A;  2RF4 A;  2OCE A;  3PIO A;  4K0K Q;  1HNZ Q;  1E1T A;  3RLO A;  1QZG A;  3A5Z B;  4DV1 Q;  4DR1 Q;  4UP9 A;  1IL2 A;  3DLL A;  4UY8 C;  3M4Q A;  4BBR G;  4GNX C;  2YTV A;  5C0X J;  2AWO A;  2BA1 A;  1Y1W G;  1WYD A;  4POG A;  2JA7 H;  4B3S Q;  4BBS G;  1I6H H;  1A62 A;  3CP0 A;  4OWX B;  2B63 H;  4HJ8 A;  4LF7 Q;  3PO2 G;  3S2H H;  1HH2 P;  3GDE A;  4LUZ A;  1PH1 A;  1GM5 A;  1G29 1;  2Q2I A;  1XMQ L;  2E5L L;  4LF4 L;  1BKB A;  1VS0 A;  1FVI A;  1LYL A;  1UEB A;  1Y1V H;  5EAY A;  5ELN A;  1PH2 A;  4BY1 H;  4DNI A;  1CKM A;  4GN3 B;  4KHZ A;  3STB C;  5HGQ A;  2B3G A;  2ZJP A;  1PH7 A;  1Q1E A;  2HIX A;  4R4C A;  4GKK Q;  2K5H A;  1NE3 A;  4JCV E;  5DLQ E;  5GRO A;  5M5Y H;  4IJL A;  3OW2 A;  4LF5 Q;  1XNR L;  3CCS A;  5BR8 L;  4LF9 Q;  1I50 H;  4BXX H;  1VQO A;  3CF5 A;  3PGZ A;  1XMO L;  1SLJ A;  2AWN A;  2K50 A;  3E9I A;  3FKI H;  4GKJ L;  3FP9 A;  5GAE C;  1YHQ A;  2UXC Q;  1VQP A;  1N34 Q;  1B7Y B;  2N8N A;  1KAW A;  3NEN A;  3UDX A;  3RLN A;  4P75 A;  4DUZ Q;  2DUD A;  2VQE Q;  4UP8 A;  1SRU A;  4O2D A;  1JT8 A;  3L0O A;  2R93 G;  1KD1 C;  1EUJ A;  5GAG C;  3GTJ H;  1RIP A;  2MNA A;  2QA4 A;  4JI0 Q;  4QIW E;  1SFO H;  2VQF Q;  1Q12 A;  1SRO A;  3A74 A;  3RLF A;  3CMA A;  4A3K H;  2CQO A;  2IT1 A;  4R4O A;  4DV0 Q;  1IBL L;  4DV2 Q;  2VUM G;  3MEF A;  4POF A;  3HOX H;  1HJP A;  4DV6 Q;  4AYB G;  2NVQ H;  3KLW A;  5IE8 A;  3JAM i;  2I5H A;  4X66 Q;  1LM0 A;  4X65 L;  1XPU A;  1HZC A;  5J3B A;  2EXD A;  1K3R A;  1I3Q H;  4QJF A;  4A3J H;  4YHH L;  1Q7Y C;  1N9W A;  4JBM A;  5FJ8 G;  4B3T Q;  5IYD G;  4YCW A;  2JE6 I;  4A3B G;  2OTL A;  4GLA C;  1YHB A;  1XNQ Q;  2JA7 G;  4DPG A;  4LUO A;  1M1K C;  3J80 i;  3K7U C;  1TWF H;  4MNO A;  1EFW A;  3S1M H;  1N36 Q;  1VQM A;  2B63 G;  2KBN A;  1PFS A;  4LFC L;  3J7Z C;  2JJQ A;  1AE3 A;  3OYY A;  3A5U A;  1FJG Q;  2JA6 G;  3PO2 H;  1M90 C;  3T1H L;  1QZH A;  3I4M H;  5C4J H;  4LFC Q;  4BY1 G;  2ZM6 L;  2F52 A;  3PCO B;  1J6Q A;  4JC0 A;  3I7F A;  5C4X H;  4GOP C;  4A3M H;  3H15 A;  3ULP A;  1Q81 C;  4DR3 Q;  1K8A C;  4PZ7 A;  3WWV A;  3PSI A;  4TVA B;  1PYS B;  1JJC B;  2R6G A;  3AQQ A;  1QVF A;  4DUY L;  3FKI G;  4DUZ L;  2KCM A;  1VCI A;  3PUY A;  4R4T A;  3M4O H;  4A3G G;  2UXC L;  1HNW L;  2RCN A;  3M3Y H;  5IYC G;  1P8L A;  1U0L A;  2JA9 A;  2K52 A;  4R1J A;  2HT1 A;  1C7Y A;  4TQU S;  4A93 H;  2EQS A;  4X64 Q;  1YHA A;  4AH6 A;  3HOV G;  1P16 A;  1PH6 A;  1G51 A;  5C0X G;  2D0O A;  3H0G H;  5GQO A;  2N49 A;  4JI1 Q;  4HIM A;  4P72 A;  1N32 L;  1UE5 A;  2GN5 A;  3RZO H;  1SE8 A;  3I4O A;  2PMZ E;  1PYB A;  3H3V I;  4AIM A;  4P71 A;  2KHJ A;  4X66 L;  1X9N A;  4P74 A;  4JOI A;  1NTG A;  3BZC A;  4OWW B;  4X6A H;  4Y52 H;  1DGS A;  1OTC A;  1A0I A;  4JI1 L;  4DV4 L;  2CKZ B;  1KQS A;  5JJK A;  1JJ2 A;  3M4P A;  1C9O A;  4LF6 L;  4GN5 A;  3RR5 A;  3CCR A;  1YJW A;  5FLM G;  3H3V H;  5H1S E;  1VQJ A;  1X56 A;  4DV4 Q;  1Y14 B;  4O0A A;  3CW2 C;  4JG2 A;  2JA8 G;  2NN6 I;  2K5V A;  3CCJ A;  5C44 G;  4IPG A;  3F2B A;  3CCE A;  4DV0 L;  1C0A A;  1Q8K A;  5E7N A;  3KJO A;  1U5K A;  4X62 Q;  2JA6 H;  3ER0 A;  1FJG L;  3J81 j;  2MFI A;  4Y7N H;  5IY0 A;  3HKS A;  1HZB A;  3I4M G;  5ELO A;  3HOW G;  4HJA A;  2K5N A;  2VQE L;  2ZTC A;  4R4I A;  3PUW A;  3J81 i;  1TWH H;  4L5R C;  4A3C H;  4B3M L;  4A3M G;  5IP9 G;  4KHP Q;  1W3S A;  1S3O A;  1PA6 A;  3U58 A;  4YY3 Q;  1VQE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...