2LXKA

Backbone 1h, 13c, and 15n chemical shift assignments for cold shock protein, lmcsp
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
66
structure length
66
Chain Sequence
MEQGTVKWFNAEKGFGFIERENGDDVFVHFSAIQGDGFKSLDEGQAVTFDVEEGQRGPQAANVQKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Dynamic Features of Cold-Shock Proteins of Listeriamonocytogenes, a Psychrophilic Bacterium
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Transcription
molecule keywords Cold shock-like protein CspLA
total genus 10
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2012-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2lxkA00
1QVFA 1Y1VG 4DV3Q 1HR0W 1R9TH 1C9OA 5AJ3Q 3NEMA 1N36Q 2OTLA 2KCMA 4OWWB 3I4MH 4IPHA 3HOWH 4KHPQ 3PIPA 1PH2A 3PO3G 1N9WA 4DUZQ 4A3MG 1N8RC 4NXNQ 1VQ8A 4ME3A 2R92H 3UDIA 3AFPA 4DUZL 3S15H 4DR2L 1UE5A 1X3EA 3E0EA 4AH6A 1PH1A 1FL0A 4JI7Q 3PV0A 2JE6I 2L15A 4PG3A 1L1OA 1VQOA 4JBMA 3W1BA 3CCEA 3AEVA 3NELA 4JG2A 2AKWB 2JA7H 3H3VH 4GS3A 2N78A 4X62Q 3EN2A 3NENA 4Y52H 4OXPA 2PMZE 1U0LA 1HNXQ 4JYAQ 1KRSA 1Y1WG 2UUCQ 3ULLA 2R93H 2NVXH 1YHBA 2N8NA 3UDXA 1MKHA 4YCWA 1YJWA 1HR0Q 2F3IA 2CCZA 2LXJA 1NMFA 1N34Q 4OWXB 2CKZB 3W1GA 4A4IA 4B3RQ 4A3LG 5FLMG 4KHPL 5C0XJ 1PV4A 4JCVE 3TEHB 4EX5A 3GTGH 1YHAA 4NB3A 4A3EH 1IBLQ 3PF4A 1HZCA 5M3FG 4DR4L 2D0PA 1YI2A 3F2DA 1X3FA 1HZBA 1QZGA 4BY7H 3JAMi 2UU9Q 3S24A 4AQYL 3PO2H 4BA2I 3GTJH 3BZCA 3WWVA 2UXDQ 3U4ZA 5M3MG 1S72A 1V1QA 2ATWA 3T1HQ 2NVTH 1UE6A 4GOPC 3ICEA 3G48A 3CW2C 5IP9G 3BZKA 3KJPA 4HIKA 2OTJA 4DV7L 1Q82C 2JA8G 4JI2Q 4GNXA 2BA1A 3KF6B 4DR4Q 2WP8J 2VNUD 3E9HA 1YBYA 3U4VA 1Y1WH 1VQEA 3J7A5 3CC2A 1TXYA 4YWKA 3GDEA 1XMOQ 1GD7A 3K8AA 4IFDJ 1I94L 3CPWA 2MQHA 2Q2IA 4RMFA 2UUCL 4PZ8A 4QQBX 5FJ8G 4LF7L 2EQSA 4A3KG 4AYBE 2RHSB 4C3IH 2ES2A 3I4NG 2Z6KC 4XIGS 4H02A 4P71A 1L1OC 5IP9H 4DV5L 2PI2E 1I50H 5GADC 4IOAA 4IJHA 2D0OA 2R7FA 1W2BA 3I2ZA 4X64L 1JJ2A 1WI5A 1VQBA 2NVYH 3TQYA 4IPGA 4X65L 1HNWL 1VQHA 3CC7A 4DR7Q 2A1AA 1I3QH 5IYCG 2UUAQ 4DV1L 4PZ7A 1EQRA 3CC4A 4LF4Q 4A3EG 1YJ9A 4A3DG 2AMCB 4JOIA 1VCIA 3IRBA 4POFA 3HOXH 1QUQA 1YITA 4O2DA 2JA8H 4J15A 3CCLA 4GKJQ 4JI5L 4A3KH 4HIOA 3M7NA 1M1KC 2JQOA 3L7ZC 4BBRG 1X54A 1IBMQ 4X64Q 2NZOA 2JK8A 1VQAA 4IPCA 4FDBA 3U50C 4DV6L 2YYZA 4GOPB 3S1MH 4UP9A 1SR3A 1E1TA 4A3BH 2K5NA 1O7IA 3KLWA 4L5QA 5HGQA 4A93G 2PQAA 2QA4A 4DR2Q 2I5HA 3ERSX 2E5LL 2Y0SG 1K73C 1I5FA 4OO1I 4AIMA 2KBNA 1Q7YC 1V9PA 2GVBA 2QGQA 1L0WA 4X66Q 1SE8A 1HNZQ 3STBD 5IY0A 1B70B 2VQEQ 1J5EQ 1SFOH 2YTVA 5IT9c 1KAWA 3RN5A 1X6OA 2Z0SA 2GN5A 5HY6A 1SRUA 2LSSA 4IFDI 5JJIA 5M3MH 1A63A 4LFBQ 4Y7NH 1PHJA 2YU9H 1Y14B 3CD6A 3AFQA 2A19A 2F4VL 1N32L 3MXNB 4JI5Q 1SN8A 3KYHC 3HOUH 2JA9A 3EBEA 3D31A 3T1YQ 4MTNA 1TWFH 5M3FH 2E2HH 3A74A 4LF9L 3BU2A 1K8GA 4GN3B 1HJPA 3BJUA 5LMNW 2DGYA 4HJ9A 1KQSA 1EIYB 2UXBQ 2R7ZG 2K50A 2V1CC 4P73A 3CCQA 3A5UA 4YCVA 5IWAL 5FLMH 1EQQA 3LGJA 1XNRQ 5IE8A 4JI6L 4X65Q 1XNQL 3RNUA 3S14H 3D0FA 1P16A 4JI3L 2IX1A 4DR6L 1LYLA 1E22A 1IYJB 1X65A 1CKMA 2HIVA 1NJIC 4JI3Q 5BR8L 2YTYA 2UU9L 3OTOQ 2VQEL 2Q2HA 4OX9L 1NTGA 2B29A 4KHZA 4QL5A 1Q81C 1XMQQ 1H95A 4APVA 5M5YH 1SMXA 4OX9Q 3KFUA 1BBUA 3PCOB 3RN2A 4BBRH 2QEXA 2IY5B 2ZTCA 3M3YH 4C2MH 3CCMA 1LUZA 5M5WH 1Q1BA 1VS0A 5JEAJ 1VQCA 1JT8A 3CCVA 4LFAL 4A3JH 1WJJA 4DR6Q 4A3DH 5H1SE 1Q86C 2WB1E 2R92G 3HOZH 1AH9A 2PNHA 3NBHB 3ZJYC 2ALYB 2YV5A 4DV7Q 1K83H 1KIXA 4POGA 1VQMA 3STBC 2UXCQ 4WJ4A 1CUKA 2Y0SE 1GVPA 2VUMH 3TS2A 1KXLA 1VQFA 3F2BA 2HT1A 2K5HA 2JEAI 4DR1L 4DR5Q 2EIFA 1ASYA 4K0KL 1PA6A 1HNZL 2ZTDA 5GQOA 1X9NA 1PVOA 1DGSA 5C44H 4P74A 4BA1I 1IXRA 1JE5A 1G51A 1OXVA 2KCTA 3HKSA 5IYBH 4R1JA 4GKKQ 3U58A 4IPDA 3K81C 4JI1L 1VQNA 1HNWQ 3KOJA 3GTLH 4B3SL 3B6YA 4GOPA 4HJ8A 1X56A 1PH3A 3J81c 1P8LA 4OWTB 4YY3L 2R7ZH 4X66L 4UP8A 5C0XG 3F1ZA 1A62A 4HJ5A 2JJQA 3RR5A 3M9BA 3HOYH 5IP7G 4LF7Q 4HJAA 1EOVA 2HQLA 2VUMG 1NY4A 1CKNB 3I4OA 3OW2A 1VQ4A 3KDFA 2MFIA 3M4QA 4P75A 4BY1G 3TS0A 1XMOL 1PH7A 2N3SA 3S1RH 1VQPA 5C3EH 3HOXG 4A3JG 4DUYQ 1UE1A 3TREA 2CWAA 3HFZB 5IYBG 1PFSA 5EAYA 3VDYA 5K36G 1Q1EA 4X62L 1XPUA 3PSIA 4MZ9A 1FVIA 4AYBG 3RZOH 4NPSA 1NBWA 3CQZH 1S40A 2VZAA 3FKIG 1ASZA 4A3BG 4DV5Q 2CFMA 2KHJA 4BXXG 1KRTA 2K4KA 2KENA 3S2DH 4JI1Q 1EUJA 1RIPA 3CF5A 1WCMH 1XMQL 1KC8C 1IZ6A 1YVCA 3RLOA 1Q12A 4DR7L 3HOZG 4BXXH 1GKHA 1MJCA 1IBKL 4KLKA 2E5LQ 4JOIC 1E24A 2MO0A 2NVQH 1UEBA 3KF8B 4L5TA 1RL2A 1WCMG 2NN6G 4QJFA 4R4OA 4DV3L 3PUWA 3HKZG 4MNOA 3CCRA 1PH4A 4A3GG 1YHQA 4JYAL 1IBML 2FXQA 3Q8DA 1B7YB 1CSQA 2LXKA 2MO1A 3PUVA 4DK6C 4BY7G 4DV2Q 3CCJA 5JJLA 1BKBA 4YWLA 4IJLA 4X6AH 4IO9A 1K3RA 2PI2A 4DV4Q 2Q2UA 1JJCB 2ID0A 2NZHA 1HR0L 1TWHH 2WAQG 1E7ZA 2OQ0A 1B8AA 1K8AC 4A3CH 3DM3A 4LF8L 3CP0A 4UP7A 4JI8Q 4NXNL 3I56A 1YEZA 1SLJA 4TQUS 5C44G 1N32Q 4QIWE 5JJKA 5JEAG 3OTOL 3L2PA 5IP7H 4JV5L 4A76A 4HJ7A 3JC66 4GN4B 3RLFA 3S1QH 1UWVA 4JI0Q 4R4CA 3T1HL 1EIFA 1K9MC 1N33Q 1J5EL 4B3TQ 4UPAA 3OYYA 1TWCH 2KHIA 1EWIA 1E1OA 1LTLA 1WFQA 4DNIA 5IYCH 1XPOA 4B3ML 2R6GA 3S17H 2OWOA 1LM0A 1A8VA 3AYHB 2ZJRA 4IFDG 2K75A 2WFWA 3G71A 5DLQE 4DR3L 1JMCA 1WYDA 1N36L 1I6HH 1IBLL 4YWMA 2VS1A 2XGTA 1VQ7A 1L2FA 3H0GG 4JBWA 5C3EG 1VQGA 4OONA 2VW9A 2ZM6Q 4LF6Q 4BBSH 2WB1G 4LW1A 4A3FH 3GTPH 4LFCQ 1G6PA 1PYBA 3K80C 2MNAA 3F2CA 4JI8L 1VQLA 1OXSC 2E2JH 1CKNA 2HHHQ 1FJGQ 3CMEA 4JBKA 2E2IH 5GAEC 3DLLA 3FKIH 2AWOA 4DK3C 1IBKQ 4LUZA 2B63G 2VL6A 2VY3A 3FHWA 3HOVG 4GLVB 1CKOA 1U5KA 4GKKL 2JA6H 3JAMc 4A3FG 1GO3E 4JI4L 2B3GA 2IHEA 4HIMA 2AWNA 4LF9Q 3UDFA 4GNXC 3S16H 4UY8C 3ULPA 1YZ6A 2R7DA 1OXXK 2F52A 4C3HH 3G4SA 4JI0L 2IX0A 5LMNQ 1L1OB 1MIUA 3T1YL 2ZTEA 1SROA 4OO1G 4YCUA 3PUYA 1OXTA 1PH9A 2CQOA 1VQ9A 4A3CG 1PYSB 1JB7A 3HOYG 2BH8A 5IWAQ 3J81j 1BVSA 1HZ9A 2WAQE 3M85A 2Q2TA 1C0AA 3ER0A 4A3IG 4LF8Q 4KI0A 3ULJA 5J3BA 1XJVA 4R4IA 2VQFQ 1NMGA 1AE2A 2GVAA 3A5ZB 2Z6KA 3I55A 3CCUA 4DR1Q 4DR5L 1Q46A 1J6QA 4DAMA 4DV1Q 1FJGL 3RLNA 5C4XH 5FJ8H 4PMWA 4RG1A 2ZM6L 4LF6L 3GO5A 5ELOA 4DV0L 1TWAH 2CWPA 3FP9A 4B3SQ 5LMNL 1QVGA 2B63H 2UUBL 1G291 1Z47A 1VQ5A 1HH2P 2JA7G 2UXDL 4LF5Q 1UE7A 2ZJPA 3PO3H 3GTQH 1BBWA 3GTOH 1Z9FA 3W5OA 4A75A 3CAMA 1FGUA 4P72A 1VQKA 1XTDA 4O0AA 3L0OA 5BR8Q 5C0XI 4DV6Q 1JJGA 3J7ZC 4A93H 5C4XG 1KHIA 2K14A 2XTIA 1PH8A 2JEBI 2F4VQ 3EIVA 4JI6Q 3PO2G 4JBJA 4JI2L 1YIJA 4LFBL 4PZ6A 1E3PA 4DUYL 3J80i 4GLAC 4XTCS 4YHHL 4A3IH 2RHQB 3PUXA 1YJNA 4BBSG 4TVAB 1Q8KA 1CSPA 5GROA 2ZJQA 1KL9A 1VQDA 4QGUA 1X55A 1QVCA 3PIOA 3KJOA 4A3GH 4AQYQ 1IL2A 2E8GA 2RCNA 3AQQA 3MEFA 3CMAA 2RF4A 2JA6G 4GLXA 1N33L 1W3SA 2H5XA 5M5XH 1HZAA 1GM5A 4LNQA 5ELNA 1V43A 3PUZA 4IOCA 3CCSA 2R93G 4JV5Q 4JI7L 3GTKH 2EXDA 4C3JH 1VQIA 1EFWA 1D7QA 4R4QA 3KF6A 3J81i 2A8VA 1A0IA 3G6EA 3HOUG 4EQ5A 2N49A 1X3GA 3K0XA 3RZDH 3K7AH 1KD1C 3A0JA 1Y1VH 1I94Q 2UXBL 2I5LX 1QZHA 4A3LH 3M4PA 4LF5L 4K0KQ 4L5SA 2OCEA 4LWCA 5AJ3L 4DKAC 4DV4L 1AE3A 4HIDA 4YHHQ 1C7YA 2UUBQ 4LUOA 3PGZA 3H15A 2ASBA 3H0GH 1NE3A 4LFCL 5GAHC 2UXCL 3UE1A 2IHFA 4DV2L 1XNQQ 3CPFA 4GKJL 4LFAQ 1OXUA 3UE0A 5LMUL 2C35B 3KDFB 5IYDG 3K7UC 4DR3Q 1TWGH 3GTMH 3GD7A 2BH2A 5C4JH 3M4OH 3UDGA 4DAYB 3S2HH 1YNXA 2I5MX 2PQAB 2AHOB 3CXCA 2UUAL 2BA0A 4B3MQ 3HKZE 2JA5G 1T9HA 1PH5A 4B3TL 3I7FA 4R4TA 5E7NA 3I4NH 3F8TA 4NXML 3H3VI 3TRZA 2HHHL 2I0QA 4BY1H 2DUDA 4L5RC 4NXMQ 5GAGC 1QUQB 3HOWG 3I4MG 4QY7A 3SGIA 4GNXB 1OTCA 1VQJA 3HOVH 1VQ6A 1PH6A 4B3RL 1M90C 1XNRL 1XPRA 1MJEA 3J80c 1N34L 1EYGA 4JI4Q 2K5VA 5IYDH 3PF5A 1D8LA 2IT1A 4LF4L 2K52A 3S1NH 2NN6I 1S3OA 2VQFL 4JC0A 4GN5A 4DPGA 4LUVA 5FLXc 5LMUQ 3E9IA 1HNXL 2YTXA 4DV0Q 2HIXA 2D62A 2JA5H 4WJ3M 4YY3Q 4A3MH 1K0RA 2OQKA 1WOCA 4ALPA
chains in the Genus database with same CATH superfamily
3FPPA 1QVFA 1Y1VG 5BN3A 1AN8A 3HS0C 3TP5A 2JA6B 3HOWH 4DFAA 1STEA 3PO3G 1H9JA 1GXDC 1N9WA 2B2UA 3I8ZA 1D1KA 3AFPA 4DR2L 3AB9A 1PH1A 4FF2A 2JE6I 3K5NA 1VQOA 4DGZA 3S2HB 3D3RA 3CCEA 3NELA 2AKWB 4TSSA 3H3VH 4ULLA 1F2MA 4F87A 4Y52H 5M5YB 2PMZE 1HQRD 4B9XA 3GTJB 5C5LA 1YHBA 1CZWA 1SE2A 2F3IA 4FF3A 2CCZA 2ENBA 1Y8NB 2EY6A 3P20A 4A3LG 5FLMG 4PNYA 3TEHB 4BS9A 1BCPF 4EX5A 3GTGH 4A3EH 2L1BA 1GUWA 2KOLA 3J81E 2EJGC 1STYA 4ZQ3A 1QZGA 3NBHA 1EY7A 1EY5A 3EVQA 4RH6A 2RA4A 5M3MG 1S72A 2ICIA 4Y7NB 1UE6A 1WTXA 3CW2C 3C1EA 3CRLC 3KJPA 1F9QA 2JA8G 3A8JE 2RDHA 3U4VA 1TT2A 2Z4IA 2HDLA 1XMOQ 1I94L 3CPWA 4RMFA 4PZ8A 5FJ8G 2AUKA 4AYBE 5T1IA 4IFDH 3I4NG 2Z6KC 3SK4A 2O5JC 4H02A 4P71A 2PI2E 2OT2A 5KEEA 4IOAA 2PYKA 1WI5A 2HDMA 2PW7A 1ONLA 1I4XA 2CH4A 1I3QH 5IYCG 1EY8A 3I4MB 4FO2A 4A3DG 3IRBA 3S9WA 4O2DA 5C4JB 3M7GA 5CV5A 3WDNA 2F03A 4GKJQ 1XYIA 4HIOA 1M1KC 2JQOA 3L7ZC 1X54A 4XT1B 1Z7TA 2NZOA 1K83B 4FDBA 3Q22A 2K5WA 2VB3X 4A93G 2PQAA 2QA4A 2I5HA 2E5LL 2BOSA 1Q7YC 4K2KA 5E3FA 1L0WA 5IODA 1HNZQ 1ICWA 1J5EQ 2Z0SA 2GN5A 2XSCA 2LSSA 4XYQA 5JJIA 1I6HB 4Y7NH 3VR5A 3K59A 4OELB 5K5PA 1ENCA 1PMRA 3KYHC 3HOUH 3NQTA 4MTNA 5BN5A 1TWFH 3K7AB 3A74A 4MHEA 4HJ9A 5D65A 4DU9A 5KNBA 4YCVA 2NUCA 3T51B 5IWAL 3LGJA 3HOZB 4X65Q 4ZK9B 2F0VA 2IX1A 1LYLA 4KY5A 1RCVD 2SNMA 5EKIA 1EZ8A 3VR6A 5ELCA 3C2PA 2K03A 2VQEL 2Q2HA 4O1NA 2B29A 1XMQQ 1H95A 4APVA 2EPBA 5M5YH 5M3FB 4OX9Q 3PCOB 3R2TA 2IWHA 5JAVA 5I6WA 1I4GA 1JT8A 1JWSD 4A3JH 3R93A 1GHJA 1TWAB 2YV5A 1SFOB 2B2VA 1VQMA 4WJ4A 1GUTA 1CUKA 2F0KA 2HT1A 1LT3D 1HUNA 2IPKD 1DGSA 3I91A 3J81L 3DEOA 1IXRA 1JE5A 4DN4M 1IL8A 4GKKQ 4JI1L 2EYFA 3GTLH 1E2VA 4IUUA 4GOPA 4HJ8A 1PH3A 3F1ZA 2QW7A 3F2UA 3HOVB 3QG1A 3HOYH 4HJAA 1EOVA 2VUMG 1JWMD 3KDFA 4IQZA 2MFIA 3R2IA 5A35A 2KJXA 1PH7A 1VQPA 3HOXG 3S17B 5IYBG 3RD4A 2B2YA 2F0OA 4MZ9A 3PMFA 4L63B 4C2MB 3RZOH 3CQZH 1LTBD 3FKIG 2CW0D 4I65A 1KABA 2CFMA 4A3BG 2K4KA 3D6WA 4IUNA 4QCLA 4BY1B 4J8QA 1EY9A 2EJFC 3KLRA 4NP5A 1KC8C 4A3JB 5G3LF 3RLOA 3Q6SA 1GKHA 2E5LQ 1VDZA 1U4MA 1PRTF 4L5TA 4QJFA 4MNOA 3HKZG 4JYAL 1PH4A 4A3GG 1BBXC 1CHQD 2FXQA 2K5QA 1JB3A 5IGFA 3PUVA 4G4KA 3KUPA 2A73B 4KKTA 3CCJA 5JJLA 4IJLA 3T13A 2HCIA 1JC7A 1K3RA 2PI2A 2ID0A 3M4YA 2PCFB 1B8AA 1E2ZA 1EYDA 2KCNA 3D8GA 3GTPB 1SNMA 5IP7H 3JC66 4A3IB 3RLFA 4N9TA 2M2LA 2BCOA 4JI0Q 3T1HL 1K9MC 4H7BA 4B3TQ 4UPAA 2KHIA 1XPOA 5IYCH 3FVQA 5LHY1 5KNCA 1LM0A 1DXMA 2WFWA 5DLQE 1JMCA 3P1HA 1SNPA 1GUNA 4RA8A 1N36L 2NBFA 1WCMB 2B2TC 3SR1A 2MGSA 3H0GG 2ZM6Q 2JA8B 1WTPA 2CVRA 3GTPH 3K80C 3W2DA 3F2CA 1HTPA 2X6GA 5A2QE 1VQLA 2HHHQ 1B9MA 1CKNA 2LMCB 3CMEA 2Q8TA 2E2IH 5CV8A 3DLLA 1IBKQ 3S1MB 2VL6A 4U68A 4GLVB 1U5KA 2B39A 3BYTB 2EY1A 2B3GA 1U4RA 4HIMA 2AWNA 3UDFA 2JXMB 3S16H 4UY8C 1YZ6A 3G4SA 4C3HH 1B2TA 1HA6A 4OO1G 3VYUA 1OXTA 3EQLC 1NSNS 3O13A 4F8MA 5J3BA 1QJOA 4LAAA 5I9PA 1LTSD 4R4IA 1NMGA 2QILA 1KDAA 4BBRB 3CCUA 5EJWA 1J6QA 3IL8A 1K8MA 2WV6D 4TKOB 1MSHA 5FJ8H 1EU3A 4RG1A 1QOHA 3GO5A 5ELOA 4NKLA 2CWPA 4B3SQ 2B63H 2UUBL 5I4DA 1MSGA 1FR3A 1VQ5A 1LTRD 4LF5Q 4H44C 1LLRD 4RAUC 4CDDC 3KLSA 3SK8A 4YIJA 4RGMA 1XTDA 2NN6H 3DWQA 1JWUD 2IW3A 1LTAD 2PZTA 5DNFA 2XTIA 2JEBI 4PZ6A 2K32A 5CV7A 4DUYL 4XQQA 1Y1VB 2RHQB 4TVAB 4I7AA 3TP8A 4DNTB 3KJOA 2RF4A 3D4RA 4GLXA 3SVMA 1HFNA 2EY5A 1GM5A 4FXGC 5ELNA 5LL6S 2E2DC 2R93G 3G6JB 5ELFA 3GTKH 2L0CA 2EXDA 5EQ0A 1EFWA 1D7QA 1A0IA 3HOUG 1SYFA 3K7AH 3A0JA 4HN7A 1I94Q 2PPBC 1RODA 3M4PA 4LF5L 1B3QA 3NP8A 2OCEA 4L5SA 4LF9Q 1AE3A 4HIDA 4LUOA 1NE3A 3BVZA 3J7AF 4LFCL 5GAHC 2ZT9C 3UE1A 1B1ZA 1V1PA 3CPFA 1BF4A 4GKJL 3N52A 4LFAQ 3UE0A 5LMUL 1HQMC 1PLFA 3KDFB 3K7UC 2P5ZX 4DR3Q 2M00A 3GTMH 3GTQB 3M4OH 1YNXA 4KY7A 2QF7A 2D5DA 4UHVA 3CXCA 5TSSA 2JA5G 1PH5A 4ZLTF 2O4XA 1QILA 2PW5A 4HMJA 2FINB 5BN4A 1A3VA 2EOTA 3HOWG 1GUOA 1OTCA 3SEBA 1VQ6A 3J80c 3PF5A 1D8LA 1PZKD 2DY8A 4K2LA 4LF4L 5KNDA 5LMUQ 4DV0Q 3A8IE 3H6MA 2D62A 3I4LA 4M8AA 3WOFA 3VR4A 1XX8A 1WOCA 4FF1A 2G9DA 4ALPA 2XWBB 4E6IA 4DV3Q 1GJXA 2RQXA 3AU7A 3H09A 1C9OA 1SEBD 3NEMA 4OWWB 2KCMA 3I4MH 4IPHA 1N8RC 3UDIA 1NR4A 3S15H 1SSOA 4QUFA 2KEDA 1SE4A 4HAEA 5M5WB 2JA7H 4GS3A 3NENA 1MHWC 4CDEC 4KY6A 1KRSA 1Y1WG 3ULLA 5HGTA 4X3KA 2N8NA 5D3DA 4YCWA 1YJWA 1TY2A 4HSVA 2NB0A 3IKJA 4RKBA 4BBSB 4B3RQ 1NCVA 5C0XJ 2EYPA 1TVXA 1EY4A 2K05A 3PF4A 5D14A 1A6XA 1D6EC 5M3FG 2AUJD 4C3JG 4H0LC 1O7LA 3OSOA 3NTIA 2D0PA 2KA7A 1A3TA 4A3MB 1YI2A 1STGA 3JAMi 3S24A 4BA2I 1JE4A 3GTJH 3BZCA 1EZ6A 2UXDQ 3U4ZA 1X3PA 2ATWA 4A3EB 5IP9G 4HIKA 2MP1A 4DV7L 4CJ1B 2KECA 3NE5B 3KF6B 1EQTA 1H9MA 1Y1WH 4RHSA 4YWKA 3GDEA 1GD7A 3QWNA 4ZCKA 2MPMA 3SK6A 2MQHA 2Q2IA 2UUCL 4LF7L 2EQSA 5CV4A 3NK9A 2RHSB 3DHQA 1TY0A 4EQNA 4IUPA 3HOYB 2DJGC 2MJ8A 4IJHA 2V4DA 3OHXC 3V2TA 1W2BA 1JJ2A 4X64L 5EPJA 2NVYH 3TQYA 3DM1A 5G3LD 2PZUA 4FYDA 2A1AA 3TN2A 2UUAQ 4HTHA 4A3KB 1HPCA 3VA5A 4PZ7A 3CC4A 2G5DA 2CQAA 4LF4Q 4A3EG 1YJ9A 4TRDA 1EIHA 4R9WA 3MVVA 1YITA 3CCLA 4QIWB 1JOOA 4A3KH 3M7NA 2RKSA 1SNDA 4RCOA 2YYZA 1DYQA 4KV6A 4GOPB 2XN9C 4A3BH 1E1TA 5FKAC 3OPOA 5CYUA 4KN7C 2A68C 3PIO3 3ERSX 2R3ZA 1EEID 4OO1I 4F88A 1V9PA 2LY7A 3STBD 3MA2B 3FPUB 4KMUC 5IT9c 2EYOA 4IFDI 4LFBQ 4IZ8A 2C5CA 4HCEA 2YU9H 1Y14B 3H0GB 1D5MC 1N32L 4ME5A 2LKVA 4B08A 3D31A 1F2YA 2RDGA 4LF9L 1RKNA 3A7LA 5LMNW 2DGYA 1KQSA 2K50A 3CCQA 3ND8A 2K28A 3JAME 2XRQD 4FXKC 1STAA 2QCPX 4KD3A 3MAQA 5IE8A 1XNQL 3S14H 3D0FA 1P16A 4JI3L 3SE0A 5CC4A 1IYJB 4JPBW 4IUVA 2VXWA 3ERQA 5BR8L 2YTYA 2UU9L 4RFBA 3S1QB 2FMMA 4QL5A 1BXTA 1Q81C 5C4XB 3D6CA 4PV1C 1BBUA 2QEXA 2IY5B 2ZTCA 1CFMA 4K8JA 3CCMA 2F0JA 1GUGA 5KIXA 3CCVA 1WJJA 4ZKCB 1AH9A 2R92G 1S5CD 4DV7Q 1K83H 1PTOC 4POGA 2UXCQ 4PMCA 1GVPA 3E0JA 4WJWA 4PQXA 2JA7B 4DR5Q 1ASYA 4K8IA 1HNZL 1X9NA 2QDBA 5IYBH 2KCTA 1YNJC 1VQNA 5JOBA 4B3SL 3B6YA 1EL0A 1NNXA 3J81c 1P8LA 1C4QA 2NZ1D 4OWTB 4DK1A 4YY3L 4UP8A 4HSPA 2HD3A 3A56A 4IUQA 3GTOB 2HQLA 1NY4A 3GV6A 1CKNB 2NTSA 1VQ4A 3HRZC 4P75A 4BY1G 1DM0B 5EPKA 1LTID 5C3EH 4DUYQ 1QB5D 2CWAA 1PFSA 2WINB 1I4RA 1V1OA 4X62L 4AYBG 1NBWA 4A3FB 2SEBD 4C1NK 4DV5Q 2FJ2A 5EKKA 4JI1Q 2AQ2B 1RIPA 3CF5A 1K8OA 3FMCA 4CBVA 1XMQL 1Q12A 3Q0AA 1MJCA 4KLKA 4JOIC 3M3YB 4C1NI 3SDZA 3KF8B 4R4OA 4DV3L 1RL2A 2NN6G 2XVSA 4GZYC 3JAML 5DM73 1CSQA 2F0EA 1S5BD 3OWFA 5J1ZA 3T56B 3OOCA 2RCFA 3K6OA 4XYOA 1PFBA 1TS2A 4IO9A 4G7OC 1KTKA 2Q2UA 1SE3A 1HR0L 2L5TA 2Q8IB 1HUMA 1K8AC 1EEFD 4LF8L 4JI8Q 4UP7A 2F4IA 1TU2B 1SLJA 4TQUS 5C44G 3OTOL 4JV5L 1LT5D 4A76A 1DOLA 4R4CA 1S5ED 1N33Q 3OYYA 1TWCH 1EWIA 1LTLA 4KKUA 4B3ML 1G91A 3J7YW 1A8VA 2NVXB 2E76C 3G71A 1B3AA 5C4ZA 2C9OA 3ITPA 1GUSA 3TZUA 2SNSA 4YWMA 4K6DA 1VQ7A 1L2FA 4JBWA 4LF6Q 4OONA 3U9OA 5ELEA 4BBSH 2WB1G 1G6PA 4LFCQ 1PYBA 3CHBD 2MNAA 1B50A 3S1RB 1OXSC 1FJGQ 4ZAIA 4JBKA 1HFGA 5C0XH 2ICEC 1IYVA 1RTNA 4WRDA 2IHEA 4P2CB 2Z8LA 4GNXC 1SDFA 3ULPA 1K3BC 2OEOA 1PRTB 1L1OB 3IAYA 2ZTEA 3C46A 1FD7D 1F2ZA 4YCUA 3K5OA 1VQ9A 1GOZA 3D4WA 2EYJA 1HZ9A 2WAQE 4A3DB 3L9AX 4A3IG 3QO2A 4KI0A 2VQFQ 3A5ZB 3I55A 4DR5L 2F0IA 1FJGL 4RCNA 2WB1B 3V96A 4DV0L 5IOCA 1G291 1Z47A 3PQIA 5C44B 1Z9FA 4G57A 4C3IB 4A75A 1KAAA 3NHHA 3CAMA 2K04A 3MTSA 3NPPA 1VQKA 2O5IC 2BE5C 4O0AA 5BR8Q 2A69C 3TBIB 4CKCA 2K14A 5I2XA 2F4VQ 3W3AA 1AP0A 2B8GA 1VMCA 4GLAC 1D1IA 3J80i 4A3IH 3PUXA 2IX3A 4XDXA 1HA5A 1VQDA 5L37A 4AQYQ 1UEAB 2RCNA 1E2WA 3AQQA 3MEFA 1MBYA 2JA6G 2EVBA 1W3SA 2H5XA 1HZAA 5EGTA 1J9OA 1EWHA 3PUZA 1Z6HA 1EIGA 2K5DA 4JV5Q 4JI7L 1S5FD 4C3JH 5M3MB 3J81i 2A8VA 1S4ZA 1X3GA 1KD1C 1TS3A 2E2HB 1QZHA 4A3LH 1V8QA 1XWEA 2L55A 4LWCA 4YHHQ 3I72A 3PGZA 2ASBA 2NVQB 2R92B 2IHFA 4DV2L 1ENAA 1J8IA 1SBBB 4OIKA 4ILWA 3RUZA 2E74C 1TWGH 3GP7A 1T5EA 1Q3LA 2I5MX 1QWYA 5FK9C 2AHOB 2IJ0A 3AMUA 1T9HA 2NTTA 2X6LA 1A15A 1SYGA 3F8TA 5IT9E 2ZXPA 1O78A 3H3VI 1RD9D 2HHHL 5C3XA 2F0NA 3E3XA 4BY1H 3I3CA 1QE6A 2DUDA 1R4PB 4L5RC 4NXMQ 1JOQA 1H9KA 4QY7A 3HOVH 4CKBA 2DN8A 1VQJA 1Q90A 4B3RL 1M90C 1PFMA 1XPRA 1MJEA 2F0PA 2K7VA 4L8JA 2K5VA 3HZXA 2NN6I 2WKDA 1S3OA 3KF8A 4JC0A 5C5MA 4LUVA 3E9IA 3LX0A 4OHJA 1NAPA 1SYBA 5KRUA 4AYBB 1JICA 4YY3Q 4LJZC 1NUCA 1SNQA 1BUVT 3T1YQ 3DWPA 2M9VA 5AJ3Q 2OTLA 1DZ1A 2TMPA 4KHPQ 4DUZQ 3LWEA 1VQ8A 5K36H 4ME3A 3TDQA 1UE5A 1X3EA 4JI7Q 3PV0A 5CV9A 5LL6X 2L15A 4JBMA 3AEVA 4JG2A 3DUZA 3L3OC 4C3HB 4Z9CB 4NW2A 3EN2A 1LT6D 5DAUA 4OXPA 1U0LA 5A2QL 5CBEE 1HNXQ 4JYAQ 1HRJA 1QNKA 1LABA 2NVXH 3UDXA 1ILQA 1MKHA 1HR0Q 3X3MA 5I9OA 3VR2A 1KLGD 4OWXB 5JJZA 3W1GA 4A4IA 1O7YA 2B2UC 5IGGA 1YHAA 4NB3A 5IGCA 3F2DA 1X3FA 1HZBA 1MI2A 1CT1D 1TKWB 2R61A 3OMCA 4R8NA 4O42A 4X3TA 4AQYL 3PO2H 5JEAH 2R93B 3WWVA 4EGVA 1F2LA 2K01A 1V1QA 3KBGA 3T1HQ 2NVTH 3ICEA 3BZKA 2PQEA 3E6ZX 5JVH3 3J7AV 1AW7A 4JI2Q 3QR8A 2PNRC 4XQNA 2VNUD 1VQEA 1O7ZA 3ONAB 3J7A5 4ZRZA 1PZID 1TXYA 2QEJC 2L11A 4RGOS 2B63B 1VF7A 3GV3A 1Y8PB 4G7ZC 4C56C 3T53B 4A3KG 4JW0A 1D2BA 4C3IH 1ZEQX 2ES2A 5HURA 4XIGS 4DF7A 4WFN3 1L1OC 5IP9H 4DV5L 4HCSA 1EYCA 2R7FA 4X65L 1MD2D 1VQHA 4KJOA 5C3EB 3CC7A 2RVLA 3NWTA 1I6VC 5I2YA 1SYCA 3S1NB 2F0TA 4DV1L 1CA6A 4HR7B 2DJFC 5CBAE 1EQRA 2X69A 2F0QA 4I7ZC 4JOIA 1VCIA 2JA8H 1QUQA 5COYA 2A68D 4OGQC 1F9RA 3S16B 4JI5L 4BBRG 4X64Q 1STBA 1ET9A 2JK8A 4IPCA 2IL8A 4S3SA 2TSSA 3S1MH 1SR3A 1BCPC 1XTCD 3KLWA 4DR2Q 2Y0SG 4CKEA 1I5FA 2KBNA 2GVBA 4X66Q 1SE8A 1ICFB 2EJMA 2YTVA 4FXDA 1KAWA 1B4OA 2F0UA 4C3JB 5M3MH 2G9HD 1A63A 5CMDA 1PTOB 1U4PA 2A19A 3MXNB 4JI5Q 2KHSA 1EYAA 2JA9A 3EBEA 1I4PA 1K8GA 1HJPA 3A54A 1EIYB 2UXBQ 1BCPD 2R7ZG 2V1CC 4QF4A 2NWGA 4KKSA 3A5UA 1EQQA 1TIID 4IURA 1XNRQ 1SXTA 3MWYW 5M5XB 1E22A 3DWAA 1X65A 2HIVA 4JI3Q 3OTOQ 3T16A 1STNA 4OX9L 1NTGA 3RZDB 3UI2A 4CHTB 5C4HA 2DY7A 2AQ1B 3RN2A 4C2MH 1LUZA 1Q1BA 1VS0A 5JEAJ 4Q5VA 1I3QB 4A3DH 5FO7B 3HOZH 3ZJYC 1II3A 1Y69U 4OIJA 4JK1C 2SOBA 3K58A 3MFGA 2JEAI 5IGEA 4DNRB 2ZTDA 1DCZA 1IHZA 2H4OA 1G51A 1OXVA 4K14A 1W6KA 4R1JA 5FO9B 2EYHA 4DAVA 4IPDA 3K81C 4LMQD 1IKLA 3K0YA 1HNWQ 3KOJA 3I4NB 3MZ5A 3HG9A 3HOWB 1GHKA 1DJRD 4QUCA 1DD2A 4X66L 4NMZA 1A62A 4HJ5A 3NSWA 1KDBA 3BVGA 4OEMB 4N8FA 1Y8OB 4LF7Q 1CK1A 3I4OA 1FNWA 4FNFA 2ZXOA 3TS0A 5ELBA 1TQOA 4NDXA 4C3HG 4XXEA 4A3JG 1UE1A 4G7HC 1KNAA 3J80L 5K36G 3ZYYX 3PSIA 2OXPA 5KYIA 2VZAA 2KHJA 5CR3A 1KRTA 2KENA 3S2DH 3H94A 4XT3B 4L6TB 1IZ6A 1YVCA 1YNJD 3MXUA 2J7ZA 3MFYA 1E24A 4IALA 2MO0A 2NVQH 1UEBA 4DR4Q 4K5XA 3PUWA 3CCRA 1B7YB 4ABNA 4LK1C 3A55A 4BY7G 1QNUA 5D3IB 2A5HA 3G7LA 4DV4Q 1PDQA 1TWHH 2OQ0A 4A3CH 1X32A 3MXGA 3SXHA 4F7XA 1LTTD 1L0YB 2OF1A 1N32Q 5E1FA 1AEXA 5JJKA 5JEAG 3L2PA 4KJNA 4Q0FA 3E5SA 3S1QH 2HUGA 2WKCA 5ELDA 2B8FA 1E1OA 4DNIA 3PO3B 3J80E 2OWOA 4UDUC 2SDFA 4CJ0B 1I4QA 1SYDA 1WYDA 3N6RA 4CGYB 1I6HH 5JPNC 5FLXE 2VS1A 2XGTA 3VA7A 2N55A 2PZWA 1G8ZD 4LW1A 4XQJA 4A3FH 4ZUIA 4JI8L 1ZKOA 3S15B 2F3VA 3VR3A 1Q8IA 2A6ED 5M9OA 2HQEA 5DM63 5GAEC 3FKIH 2B63G 4GKKL 3FHWA 1CKOA 1IW7D 2B2WA 1A2TA 3JAMc 4A3FG 4JI4L 2L12A 3MC0B 1JOKA 1NR2A 1BCPB 1OXXK 2F52A 5KYLA 5LMNQ 1O80A 1EFID 3PUYA 1PH9A 1PYSB 2I07B 1PYWD 2BH8A 2EY2A 5IWAQ 1JB7A 1BVSA 3M85A 2K1BA 3TSSA 3ER0A 4LF8Q 4FF4A 3ULJA 3IFTA 3C3LA 1AE2A 4N9PA 2XNAC 2Z6KA 2J4XA 1Q46A 3RLNA 5C4XH 1CZGA 4PMWA 2ZM6L 2K33A 3H91A 3FP9A 5LMNL 1QVGA 2NVYB 3NUCA 1B9NA 2A69D 1HH2P 5ISRA 2JA7G 2UXDL 1UE7A 2ZJPA 3PO3H 3GTQH 3M4OB 3I90A 1WTQA 2KCCA 2N88A 4B9WA 1FGUA 1EQVA 2JN4A 3GTGB 4P72A 2J0TD 4DXGA 1JJGA 3J7ZC 1EY6A 2F0WA 2O2LD 1PH8A 3PO2G 1Y1WB 2LS01 1YIJA 2KEEA 4K6LA 2GA4B 1LV9A 1E3PA 3TP6A 1TS4A 3OIQA 1Q8KA 5GROA 1L0XB 4ZYSA 4QGUA 2A6HD 4A3GH 1PZJD 3OW7A 1IL2A 2E8GA 3R8BA 1ML0D 2F0SA 2RDFA 2QDLA 3ND9A 5M5XH 4A3BB 3NTKA 4LNQA 1V43A 3CCSA 1IW7C 1SJHD 1VQIA 3KF6A 2F3WA 2D9UA 3G6EA 3T4AC 4EQ5A 3RZDH 3K0XA 1Y1VH 3I70A 4K0KQ 2UU9Q 4DV4L 3CRKC 4DKAC 1C7YA 2UUBQ 3H15A 1PTOH 1ESFA 2UXCL 3NTHA 1XNQQ 1BDOA 1OXUA 4UAIA 3OWEB 2C35B 5IYDG 1FGBD 2BH2A 1STHA 1SNOA 5IIFA 2PQAB 2A74C 1EWCA 2BA0A 4B3MQ 3HKZE 2KQ3A 2XRSD 4R4TA 3I4NH 2BDOA 2I0QA 5E4WC 3X3NA 1QUQB 4KD4A 4V190 1ENFA 1PTOF 1K28A 3RMHA 1EYGA 4JI4Q 3MHBA 3S1NH 4RGTA 4GN5A 1AZQA 4DXFA 1HNXL 2DNEA 4CJ2C 2FHTA 2HIXA 4WJ3M 4A3MH 2OQKA 1KL9A 2XIWA 1C8CA 1HR0W 1R9TH 2A6HC 1N36Q 1H9SB 2H1EA 1S5DD 3MXPA 3PIPA 1PH2A 5FOBB 4A3MG 3MXNA 4NXNQ 2R92H 3BG3A 1RHPA 1A2UA 4DUZL 3E0EA 4AH6A 1FL0A 4MN3A 4PG3A 1L1OA 5CV6A 3W1BA 5EKLA 2HCCA 2N78A 4X62Q 1IYUA 3BDCA 2WAQB 4PMBA 4BWGB 2F1MA 2UUCQ 2R93H 3HGBA 2L4NA 3QIAA 5C6AA 2LXJA 1NMFA 1N34Q 1TWHB 2CKZB 4KTAA 2BDNA 3S14B 5C3WA 3LNNA 1WVLA 4KHPL 3OIPA 1PV4A 4JCVE 1F9SA 1IBLQ 3GTKB 2NVTB 1HZCA 4DR4L 3D4DA 1G2SA 4JVZA 1YNND 1RTOA 4HMIA 1H9RA 4BY7H 2JYOA 3HKZB 3SHLA 2KVMA 3SK5A 4C3IG 3K5LA 4GOPC 4A93B 2FFKB 3G48A 3BS1A 1RDPD 5IGBA 2OTJA 4N8X1 3CU7A 1CTMA 2K6AA 1Q82C 4GNXA 3S2DB 2BA1A 3VYSA 1B44D 2WP8J 2R7ZB 3E9HA 1YBYA 3R3OA 1HHVA 3CC2A 3K8AA 1CQFA 4IFDJ 4H13C 2PO4A 5CGKA 1YNNC 4QQBX 3KBXA 1TR5A 3NXWA 1CHPD 2CHBD 2AQ3B 3GTMB 2F0DA 1I50H 5GADC 1B53A 2D0OA 2VUMB 1KNEA 3I2ZA 1VQBA 4IPGA 1HNWL 1DONA 4DR7Q 3NBIA 3A8KE 1LTGD 1I50B 2E2JB 4X3SA 4U673 3TMEA 4M1UB 2AMCB 4POFA 3HOXH 1MGSA 4FVMA 3K5MA 4J15A 4KHVA 3KK7A 5KGUA 3HEJA 1IBMQ 1VQAA 3U50C 4DV6L 4DAPA 2Q8RE 4UP9A 2K5NA 1O7IA 4L5QA 5HGQA 1K73C 4AIMA 4MTKA 1UUPA 1XXGA 2QGQA 4RGNA 5DEHA 4CDCC 5IY0A 1B70B 2VQEQ 1SFOH 2CW0C 3RN5A 1X6OA 5HY6A 1SRUA 2XWJB 2LFNA 3DMUA 3Q24A 1PHJA 5AFWA 3CD6A 3AFQA 2F4VL 1PFNA 5T1GA 3OMGA 1SN8A 5M3FH 1ET6A 2E2HH 1TWGB 3BU2A 3U9SA 4GN3B 2EZVA 1WD0A 3BJUA 1HXYD 1D5XC 4P73A 4K5WA 5FLMH 2JSOA 1AZPA 4RWSC 2F0FA 4JI6L 3RNUA 4OL7A 4DR6L 2RSOA 4X3UA 1CKMA 3CKIB 1T5XD 1NJIC 3VYRA 4ZKBB 2L9HA 2EYMA 4FP5D 4J6HA 2F0GA 4KHZA 1BNZA 2EDGA 2B2WC 1BO0A 1HCZA 1SMXA 1TWFB 1PXUA 3KFUA 4BBRH 1PRTD 3FDTA 3M3YH 3URYA 5M5WH 2A6EC 3TP7A 1VQCA 2WIIB 2EE1A 4LFAL 4DR6Q 1LO5D 5H1SE 1Q86C 2WB1E 2PNHA 2PMZB 3NBHB 2ALYB 1U9RA 1KIXA 3STBC 2E75C 3EJIA 2Y0SE 2VUMH 1KXLA 1UAPA 1FNUA 3TS2A 3EFXD 1VQFA 3F2BA 2K5HA 4EQOA 2BE5D 4DR1L 2EIFA 1QCBD 1PA6A 4K0KL 2DNCA 2EYLA 4DK0A 5GQOA 1PVOA 3V05A 5C44H 3FEWX 4P74A 4BA1I 3HKSA 4WORA 5J39A 3NQIA 1ILPA 1D5ZC 2E2IB 1PRTC 1VMPA 1X56A 2Z9HA 1R9TB 2R7ZH 4MIUA 1CA5A 5C0XG 3FRPB 5EPLA 2JJQA 3RR5A 3M9BA 3RZOB 5IP7G 2VB2X 5JPMC 1ZXTA 3OW2A 5F2DA 3M4QA 3I73A 1XMOL 3NWSA 1ZYRD 2JP1A 2N3SA 3TREA 1UNSA 1M8AA 3HFZB 5EAYA 3VDYA 1Q1EA 1XPUA 3P75A 1FVIA 4NPSA 1S40A 1ASZA 1TS5A 3A7AB 3QOLA 4BXXG 1JR0D 5E4XA 2Z6BA 2WACA 1EUJA 1LT4D 4DA2A 1WCMH 3DEPA 3HP3A 1G2TA 4QMGA 3VYTA 3H3VC 4ZUJA 4DR7L 3HOZG 3QB3A 4BXXH 1JORA 1IBKL 3PO2B 3WOEA 3U58A 1WCMG 1YHQA 1IBML 1C48A 3Q8DA 2LXKA 4DK6C 2MO1A 1RJTA 1V1PB 4DV2Q 1BKBA 4YWLA 4X6AH 3Q23A 1BQQT 1JJCB 2NZHA 2WAQG 1E7ZA 3PIP3 1TWCB 3DM3A 2F0MA 1ESRA 3CP0A 2FMCA 4RHRA 4NXNL 4A3GB 3I56A 1YEZA 1A3UA 4QIWE 1QG7A 1F77A 4HJ7A 1WD1A 4GN4B 3EROA 1UWVA 1EIFA 1SMYD 1J5EL 1SJED 1I4HA 1WFQA 5EBCA 2YU9B 2R6GA 4K5VA 3S17H 2CH4W 3AYHB 4IN3A 2ZJRA 4IFDG 2K75A 4DR3L 1IBLL 3DXJC 1OO9B 5C3EG 1VQGA 2VW9A 1JQYD 2B2YC 3BZDB 1CQVA 3CQZB 3HOUB 2E2JH 1ZYRC 3GTLB 2AWOA 4DK3C 4LUZA 2VY3A 1WTRA 1SMYC 3HOVG 2Y0SB 2KUMA 1WTWA 1F9PA 2JA6H 1GO3E 4KK7A 5IT9L 1WTOA 2R7DA 4JI0L 2IX0A 3HOXB 1MIUA 3T1YL 1EU4A 1SROA 4QB4A 2B2VC 4A3CG 2CQOA 3BDOA 3HOYG 3J81j 2Q2TA 1C0AA 4R8IA 1SYEA 1CM9A 1XJVA 1VF5C 1AFPA 2GVAA 4DR1Q 1H9SA 1U4LA 1DOMA 4DAYA 4DAMA 4DV1Q 4ODGA 5FLXL 1E0BA 2Z4HA 4LF6L 4EQPA 1TWAH 2ZXRA 3P7JA 1X3QA 2MUYA 4OO1H 4BY7B 1EOTA 3MEHA 4RKLA 2F0LA 1BBWA 3GTOH 1PTOD 1M4VA 3W5OA 1LACA 3C1FA 2NYZD 3L0OA 5EBDA 5C0XI 4DV6Q 4ID6A 5J22A 4A93H 5C4XG 1KHIA 2RSNA 1KLUD 3EIVA 5IGDA 4JI6Q 4JBJA 4JI2L 4LFBL 4XTCS 4YHHL 1K0SA 1YJNA 4BBSG 1CSPA 2ZJQA 4EVOA 3TZDA 3QOJA 4KN4C 1X55A 2QKIC 1SNCA 1QVCA 3PIOA 3CMAA 1JCKB 1DOKA 1N33L 1R4QB 4IOCA 2Z1CA 3IFDA 4R4QA 2N49A 5I6YA 3BVMA 4J1MA 2UXBL 2I5LX 1EY0A 5AJ3L 1G6ZA 3KLSX 4CDFC 3H0GH 4HEDA 1FNVA 2MHVA 3LWUA 5NUCA 3BDLA 1KDCA 4IUTA 3BYYB 3GD7A 3K57A 1SAPA 5C4JH 3UDGA 4DAYB 3S2HH 1CI3M 2UUAL 1BOSA 3I7FA 4B3TL 2B2TA 5E7NA 2F0HA 1WTVA 2EXZA 3FKIB 4NXML 3TRZA 1BR9A 3QJYA 1WTHA 5GAGC 3I4MG 3SGIA 3GQBA 5FO8B 4GNXB 1PH6A 1XNRL 1N34L 5JVG3 1RF2D 2D2CC 5IYDH 2JA5B 2IT1A 2K52A 2VQFL 1IKMA 4DPGA 2I46A 5CORA 1W6JA 5FLXc 2YTXA 3EA6A 1FYCA 4V0BA 2JA5H 2RBMA 1HTLD 1K0RA 3S1RH
chains in the Genus database with same CATH topology
1QVFA 1Y1VG 4DV3Q 1HR0W 1R9TH 1C9OA 5AJ3Q 3NEMA 1N36Q 2OTLA 2KCMA 4OWWB 3I4MH 4IPHA 3HOWH 4KHPQ 3PIPA 1PH2A 3PO3G 1N9WA 4DUZQ 4A3MG 1N8RC 4NXNQ 1VQ8A 4ME3A 2R92H 3UDIA 3AFPA 4DUZL 3S15H 4DR2L 1UE5A 1X3EA 3E0EA 4AH6A 1PH1A 1FL0A 4JI7Q 3PV0A 2JE6I 2L15A 4PG3A 1L1OA 1VQOA 4JBMA 3W1BA 3CCEA 3AEVA 3NELA 4JG2A 2AKWB 2JA7H 3H3VH 4GS3A 2N78A 4X62Q 3EN2A 3NENA 4Y52H 4OXPA 2PMZE 1U0LA 1HNXQ 4JYAQ 1KRSA 1Y1WG 2UUCQ 3ULLA 2R93H 2NVXH 1YHBA 2N8NA 3UDXA 1MKHA 4YCWA 1YJWA 1HR0Q 2F3IA 2CCZA 2LXJA 1NMFA 1N34Q 4OWXB 2CKZB 3W1GA 4A4IA 4B3RQ 4A3LG 5FLMG 4KHPL 5C0XJ 1PV4A 4JCVE 3TEHB 4EX5A 3GTGH 1YHAA 4NB3A 4A3EH 1IBLQ 3PF4A 1HZCA 5M3FG 4DR4L 2D0PA 1YI2A 3F2DA 1X3FA 1HZBA 1QZGA 4BY7H 3JAMi 2UU9Q 3S24A 4AQYL 3PO2H 4BA2I 3GTJH 3BZCA 3WWVA 2UXDQ 3U4ZA 5M3MG 1S72A 1V1QA 2ATWA 3T1HQ 2NVTH 1UE6A 4GOPC 3ICEA 3G48A 3CW2C 5IP9G 3BZKA 3KJPA 4HIKA 2OTJA 4DV7L 1Q82C 2JA8G 4JI2Q 4GNXA 2BA1A 3KF6B 4DR4Q 2WP8J 2VNUD 3E9HA 1YBYA 3U4VA 1Y1WH 1VQEA 3J7A5 3CC2A 1TXYA 4YWKA 3GDEA 1XMOQ 1GD7A 3K8AA 4IFDJ 1I94L 3CPWA 2MQHA 2Q2IA 4RMFA 2UUCL 4PZ8A 4QQBX 5FJ8G 4LF7L 2EQSA 4A3KG 4AYBE 2RHSB 4C3IH 2ES2A 3I4NG 2Z6KC 4XIGS 4H02A 4P71A 1L1OC 5IP9H 4DV5L 2PI2E 1I50H 5GADC 4IOAA 4IJHA 2D0OA 2R7FA 1W2BA 3I2ZA 4X64L 1JJ2A 1WI5A 1VQBA 2NVYH 3TQYA 4IPGA 4X65L 1HNWL 1VQHA 3CC7A 4DR7Q 2A1AA 1I3QH 5IYCG 2UUAQ 4DV1L 4PZ7A 1EQRA 3CC4A 4LF4Q 4A3EG 1YJ9A 4A3DG 2AMCB 4JOIA 1VCIA 3IRBA 4POFA 3HOXH 1QUQA 1YITA 4O2DA 2JA8H 4J15A 3CCLA 4GKJQ 4JI5L 4A3KH 4HIOA 3M7NA 1M1KC 2JQOA 3L7ZC 4BBRG 1X54A 1IBMQ 4X64Q 2NZOA 2JK8A 1VQAA 4IPCA 4FDBA 3U50C 4DV6L 2YYZA 4GOPB 3S1MH 4UP9A 1SR3A 1E1TA 4A3BH 2K5NA 1O7IA 3KLWA 4L5QA 5HGQA 4A93G 2PQAA 2QA4A 4DR2Q 2I5HA 3ERSX 2E5LL 2Y0SG 1K73C 1I5FA 4OO1I 4AIMA 2KBNA 1Q7YC 1V9PA 2GVBA 2QGQA 1L0WA 4X66Q 1SE8A 1HNZQ 3STBD 5IY0A 1B70B 2VQEQ 1J5EQ 1SFOH 2YTVA 5IT9c 1KAWA 3RN5A 1X6OA 2Z0SA 2GN5A 5HY6A 1SRUA 2LSSA 4IFDI 5JJIA 5M3MH 1A63A 4LFBQ 4Y7NH 1PHJA 2YU9H 1Y14B 3CD6A 3AFQA 2A19A 2F4VL 1N32L 3MXNB 4JI5Q 1SN8A 3KYHC 3HOUH 2JA9A 3EBEA 3D31A 3T1YQ 4MTNA 1TWFH 5M3FH 2E2HH 3A74A 4LF9L 3BU2A 1K8GA 4GN3B 1HJPA 3BJUA 5LMNW 2DGYA 4HJ9A 1KQSA 1EIYB 2UXBQ 2R7ZG 2K50A 2V1CC 4P73A 3CCQA 3A5UA 4YCVA 5IWAL 5FLMH 1EQQA 3LGJA 1XNRQ 5IE8A 4JI6L 4X65Q 1XNQL 3RNUA 3S14H 3D0FA 1P16A 4JI3L 2IX1A 4DR6L 1LYLA 1E22A 1IYJB 1X65A 1CKMA 2HIVA 1NJIC 4JI3Q 5BR8L 2YTYA 2UU9L 3OTOQ 2VQEL 2Q2HA 4OX9L 1NTGA 2B29A 4KHZA 4QL5A 1Q81C 1XMQQ 1H95A 4APVA 5M5YH 1SMXA 4OX9Q 3KFUA 1BBUA 3PCOB 3RN2A 4BBRH 2QEXA 2IY5B 2ZTCA 3M3YH 4C2MH 3CCMA 1LUZA 5M5WH 1Q1BA 1VS0A 5JEAJ 1VQCA 1JT8A 3CCVA 4LFAL 4A3JH 1WJJA 4DR6Q 4A3DH 5H1SE 1Q86C 2WB1E 2R92G 3HOZH 1AH9A 2PNHA 3NBHB 3ZJYC 2ALYB 2YV5A 4DV7Q 1K83H 1KIXA 4POGA 1VQMA 3STBC 2UXCQ 4WJ4A 1CUKA 2Y0SE 1GVPA 2VUMH 3TS2A 1KXLA 1VQFA 3F2BA 2HT1A 2K5HA 2JEAI 4DR1L 4DR5Q 2EIFA 1ASYA 4K0KL 1PA6A 1HNZL 2ZTDA 5GQOA 1X9NA 1PVOA 1DGSA 5C44H 4P74A 4BA1I 1IXRA 1JE5A 1G51A 1OXVA 2KCTA 3HKSA 5IYBH 4R1JA 4GKKQ 3U58A 4IPDA 3K81C 4JI1L 1VQNA 1HNWQ 3KOJA 3GTLH 4B3SL 3B6YA 4GOPA 4HJ8A 1X56A 1PH3A 3J81c 1P8LA 4OWTB 4YY3L 2R7ZH 4X66L 4UP8A 5C0XG 3F1ZA 1A62A 4HJ5A 2JJQA 3RR5A 3M9BA 3HOYH 5IP7G 4LF7Q 4HJAA 1EOVA 2HQLA 2VUMG 1NY4A 1CKNB 3I4OA 3OW2A 1VQ4A 3KDFA 2MFIA 3M4QA 4P75A 4BY1G 3TS0A 1XMOL 1PH7A 2N3SA 3S1RH 1VQPA 5C3EH 3HOXG 4A3JG 4DUYQ 1UE1A 3TREA 2CWAA 3HFZB 5IYBG 1PFSA 5EAYA 3VDYA 5K36G 1Q1EA 4X62L 1XPUA 3PSIA 4MZ9A 1FVIA 4AYBG 3RZOH 4NPSA 1NBWA 3CQZH 1S40A 2VZAA 3FKIG 1ASZA 4A3BG 4DV5Q 2CFMA 2KHJA 4BXXG 1KRTA 2K4KA 2KENA 3S2DH 4JI1Q 1EUJA 1RIPA 3CF5A 1WCMH 1XMQL 1KC8C 1IZ6A 1YVCA 3RLOA 1Q12A 4DR7L 3HOZG 4BXXH 1GKHA 1MJCA 1IBKL 4KLKA 2E5LQ 4JOIC 1E24A 2MO0A 2NVQH 1UEBA 3KF8B 4L5TA 1RL2A 1WCMG 2NN6G 4QJFA 4R4OA 4DV3L 3PUWA 3HKZG 4MNOA 3CCRA 1PH4A 4A3GG 1YHQA 4JYAL 1IBML 2FXQA 3Q8DA 1B7YB 1CSQA 2LXKA 2MO1A 3PUVA 4DK6C 4BY7G 4DV2Q 3CCJA 5JJLA 1BKBA 4YWLA 4IJLA 4X6AH 4IO9A 1K3RA 2PI2A 4DV4Q 2Q2UA 1JJCB 2ID0A 2NZHA 1HR0L 1TWHH 2WAQG 1E7ZA 2OQ0A 1B8AA 1K8AC 4A3CH 3DM3A 4LF8L 3CP0A 4UP7A 4JI8Q 4NXNL 3I56A 1YEZA 1SLJA 4TQUS 5C44G 1N32Q 4QIWE 5JJKA 5JEAG 3OTOL 3L2PA 5IP7H 4JV5L 4A76A 4HJ7A 3JC66 4GN4B 3RLFA 3S1QH 1UWVA 4JI0Q 4R4CA 3T1HL 1EIFA 1K9MC 1N33Q 1J5EL 4B3TQ 4UPAA 3OYYA 1TWCH 2KHIA 1EWIA 1E1OA 1LTLA 1WFQA 4DNIA 5IYCH 1XPOA 4B3ML 2R6GA 3S17H 2OWOA 1LM0A 1A8VA 3AYHB 2ZJRA 4IFDG 2K75A 2WFWA 3G71A 5DLQE 4DR3L 1JMCA 1WYDA 1N36L 1I6HH 1IBLL 4YWMA 2VS1A 2XGTA 1VQ7A 1L2FA 3H0GG 4JBWA 5C3EG 1VQGA 4OONA 2VW9A 2ZM6Q 4LF6Q 4BBSH 2WB1G 4LW1A 4A3FH 3GTPH 4LFCQ 1G6PA 1PYBA 3K80C 2MNAA 3F2CA 4JI8L 1VQLA 1OXSC 2E2JH 1CKNA 2HHHQ 1FJGQ 3CMEA 4JBKA 2E2IH 5GAEC 3DLLA 3FKIH 2AWOA 4DK3C 1IBKQ 4LUZA 2B63G 2VL6A 2VY3A 3FHWA 3HOVG 4GLVB 1CKOA 1U5KA 4GKKL 2JA6H 3JAMc 4A3FG 1GO3E 4JI4L 2B3GA 2IHEA 4HIMA 2AWNA 4LF9Q 3UDFA 4GNXC 3S16H 4UY8C 3ULPA 1YZ6A 2R7DA 1OXXK 2F52A 4C3HH 3G4SA 4JI0L 2IX0A 5LMNQ 1L1OB 1MIUA 3T1YL 2ZTEA 1SROA 4OO1G 4YCUA 3PUYA 1OXTA 1PH9A 2CQOA 1VQ9A 4A3CG 1PYSB 1JB7A 3HOYG 2BH8A 5IWAQ 3J81j 1BVSA 1HZ9A 2WAQE 3M85A 2Q2TA 1C0AA 3ER0A 4A3IG 4LF8Q 4KI0A 3ULJA 5J3BA 1XJVA 4R4IA 2VQFQ 1NMGA 1AE2A 2GVAA 3A5ZB 2Z6KA 3I55A 3CCUA 4DR1Q 4DR5L 1Q46A 1J6QA 4DAMA 4DV1Q 1FJGL 3RLNA 5C4XH 5FJ8H 4PMWA 4RG1A 2ZM6L 4LF6L 3GO5A 5ELOA 4DV0L 1TWAH 2CWPA 3FP9A 4B3SQ 5LMNL 1QVGA 2B63H 2UUBL 1G291 1Z47A 1VQ5A 1HH2P 2JA7G 2UXDL 4LF5Q 1UE7A 2ZJPA 3PO3H 3GTQH 1BBWA 3GTOH 1Z9FA 3W5OA 4A75A 3CAMA 1FGUA 4P72A 1VQKA 1XTDA 4O0AA 3L0OA 5BR8Q 5C0XI 4DV6Q 1JJGA 3J7ZC 4A93H 5C4XG 1KHIA 2K14A 2XTIA 1PH8A 2JEBI 2F4VQ 3EIVA 4JI6Q 3PO2G 4JBJA 4JI2L 1YIJA 4LFBL 4PZ6A 1E3PA 4DUYL 3J80i 4GLAC 4XTCS 4YHHL 4A3IH 2RHQB 3PUXA 1YJNA 4BBSG 4TVAB 1Q8KA 1CSPA 5GROA 2ZJQA 1KL9A 1VQDA 4QGUA 1X55A 1QVCA 3PIOA 3KJOA 4A3GH 4AQYQ 1IL2A 2E8GA 2RCNA 3AQQA 3MEFA 3CMAA 2RF4A 2JA6G 4GLXA 1N33L 1W3SA 2H5XA 5M5XH 1HZAA 1GM5A 4LNQA 5ELNA 1V43A 3PUZA 4IOCA 3CCSA 2R93G 4JV5Q 4JI7L 3GTKH 2EXDA 4C3JH 1VQIA 1EFWA 1D7QA 4R4QA 3KF6A 3J81i 2A8VA 1A0IA 3G6EA 3HOUG 4EQ5A 2N49A 1X3GA 3K0XA 3RZDH 3K7AH 1KD1C 3A0JA 1Y1VH 1I94Q 2UXBL 2I5LX 1QZHA 4A3LH 3M4PA 4LF5L 4K0KQ 4L5SA 2OCEA 4LWCA 5AJ3L 4DKAC 4DV4L 1AE3A 4HIDA 4YHHQ 1C7YA 2UUBQ 4LUOA 3PGZA 3H15A 2ASBA 3H0GH 1NE3A 4LFCL 5GAHC 2UXCL 3UE1A 2IHFA 4DV2L 1XNQQ 3CPFA 4GKJL 4LFAQ 1OXUA 3UE0A 5LMUL 2C35B 3KDFB 5IYDG 3K7UC 4DR3Q 1TWGH 3GTMH 3GD7A 2BH2A 5C4JH 3M4OH 3UDGA 4DAYB 3S2HH 1YNXA 2I5MX 2PQAB 2AHOB 3CXCA 2UUAL 2BA0A 4B3MQ 3HKZE 2JA5G 1T9HA 1PH5A 4B3TL 3I7FA 4R4TA 5E7NA 3I4NH 3F8TA 4NXML 3H3VI 3TRZA 2HHHL 2I0QA 4BY1H 2DUDA 4L5RC 4NXMQ 5GAGC 1QUQB 3HOWG 3I4MG 4QY7A 3SGIA 4GNXB 1OTCA 1VQJA 3HOVH 1VQ6A 1PH6A 4B3RL 1M90C 1XNRL 1XPRA 1MJEA 3J80c 1N34L 1EYGA 4JI4Q 2K5VA 5IYDH 3PF5A 1D8LA 2IT1A 4LF4L 2K52A 3S1NH 2NN6I 1S3OA 2VQFL 4JC0A 4GN5A 4DPGA 4LUVA 5FLXc 5LMUQ 3E9IA 1HNXL 2YTXA 4DV0Q 2HIXA 2D62A 2JA5H 4WJ3M 4YY3Q 4A3MH 1K0RA 2OQKA 1WOCA 4ALPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVF A;  1Y1V G;  4DV3 Q;  1HR0 W;  1R9T H;  1C9O A;  5AJ3 Q;  3NEM A;  1N36 Q;  2OTL A;  2KCM A;  4OWW B;  3I4M H;  4IPH A;  3HOW H;  4KHP Q;  3PIP A;  1PH2 A;  3PO3 G;  1N9W A;  4DUZ Q;  4A3M G;  1N8R C;  4NXN Q;  1VQ8 A;  4ME3 A;  2R92 H;  3UDI A;  3AFP A;  4DUZ L;  3S15 H;  4DR2 L;  1UE5 A;  1X3E A;  3E0E A;  4AH6 A;  1PH1 A;  1FL0 A;  4JI7 Q;  3PV0 A;  2JE6 I;  2L15 A;  4PG3 A;  1L1O A;  1VQO A;  4JBM A;  3W1B A;  3CCE A;  3AEV A;  3NEL A;  4JG2 A;  2AKW B;  2JA7 H;  3H3V H;  4GS3 A;  2N78 A;  4X62 Q;  3EN2 A;  3NEN A;  4Y52 H;  4OXP A;  2PMZ E;  1U0L A;  1HNX Q;  4JYA Q;  1KRS A;  1Y1W G;  2UUC Q;  3ULL A;  2R93 H;  2NVX H;  1YHB A;  2N8N A;  3UDX A;  1MKH A;  4YCW A;  1YJW A;  1HR0 Q;  2F3I A;  2CCZ A;  2LXJ A;  1NMF A;  1N34 Q;  4OWX B;  2CKZ B;  3W1G A;  4A4I A;  4B3R Q;  4A3L G;  5FLM G;  4KHP L;  5C0X J;  1PV4 A;  4JCV E;  3TEH B;  4EX5 A;  3GTG H;  1YHA A;  4NB3 A;  4A3E H;  1IBL Q;  3PF4 A;  1HZC A;  5M3F G;  4DR4 L;  2D0P A;  1YI2 A;  3F2D A;  1X3F A;  1HZB A;  1QZG A;  4BY7 H;  3JAM i;  2UU9 Q;  3S24 A;  4AQY L;  3PO2 H;  4BA2 I;  3GTJ H;  3BZC A;  3WWV A;  2UXD Q;  3U4Z A;  5M3M G;  1S72 A;  1V1Q A;  2ATW A;  3T1H Q;  2NVT H;  1UE6 A;  4GOP C;  3ICE A;  3G48 A;  3CW2 C;  5IP9 G;  3BZK A;  3KJP A;  4HIK A;  2OTJ A;  4DV7 L;  1Q82 C;  2JA8 G;  4JI2 Q;  4GNX A;  2BA1 A;  3KF6 B;  4DR4 Q;  2WP8 J;  2VNU D;  3E9H A;  1YBY A;  3U4V A;  1Y1W H;  1VQE A;  3J7A 5;  3CC2 A;  1TXY A;  4YWK A;  3GDE A;  1XMO Q;  1GD7 A;  3K8A A;  4IFD J;  1I94 L;  3CPW A;  2MQH A;  2Q2I A;  4RMF A;  2UUC L;  4PZ8 A;  4QQB X;  5FJ8 G;  4LF7 L;  2EQS A;  4A3K G;  4AYB E;  2RHS B;  4C3I H;  2ES2 A;  3I4N G;  2Z6K C;  4XIG S;  4H02 A;  4P71 A;  1L1O C;  5IP9 H;  4DV5 L;  2PI2 E;  1I50 H;  5GAD C;  4IOA A;  4IJH A;  2D0O A;  2R7F A;  1W2B A;  3I2Z A;  4X64 L;  1JJ2 A;  1WI5 A;  1VQB A;  2NVY H;  3TQY A;  4IPG A;  4X65 L;  1HNW L;  1VQH A;  3CC7 A;  4DR7 Q;  2A1A A;  1I3Q H;  5IYC G;  2UUA Q;  4DV1 L;  4PZ7 A;  1EQR A;  3CC4 A;  4LF4 Q;  4A3E G;  1YJ9 A;  4A3D G;  2AMC B;  4JOI A;  1VCI A;  3IRB A;  4POF A;  3HOX H;  1QUQ A;  1YIT A;  4O2D A;  2JA8 H;  4J15 A;  3CCL A;  4GKJ Q;  4JI5 L;  4A3K H;  4HIO A;  3M7N A;  1M1K C;  2JQO A;  3L7Z C;  4BBR G;  1X54 A;  1IBM Q;  4X64 Q;  2NZO A;  2JK8 A;  1VQA A;  4IPC A;  4FDB A;  3U50 C;  4DV6 L;  2YYZ A;  4GOP B;  3S1M H;  4UP9 A;  1SR3 A;  1E1T A;  4A3B H;  2K5N A;  1O7I A;  3KLW A;  4L5Q A;  5HGQ A;  4A93 G;  2PQA A;  2QA4 A;  4DR2 Q;  2I5H A;  3ERS X;  2E5L L;  2Y0S G;  1K73 C;  1I5F A;  4OO1 I;  4AIM A;  2KBN A;  1Q7Y C;  1V9P A;  2GVB A;  2QGQ A;  1L0W A;  4X66 Q;  1SE8 A;  1HNZ Q;  3STB D;  5IY0 A;  1B70 B;  2VQE Q;  1J5E Q;  1SFO H;  2YTV A;  5IT9 c;  1KAW A;  3RN5 A;  1X6O A;  2Z0S A;  2GN5 A;  5HY6 A;  1SRU A;  2LSS A;  4IFD I;  5JJI A;  5M3M H;  1A63 A;  4LFB Q;  4Y7N H;  1PHJ A;  2YU9 H;  1Y14 B;  3CD6 A;  3AFQ A;  2A19 A;  2F4V L;  1N32 L;  3MXN B;  4JI5 Q;  1SN8 A;  3KYH C;  3HOU H;  2JA9 A;  3EBE A;  3D31 A;  3T1Y Q;  4MTN A;  1TWF H;  5M3F H;  2E2H H;  3A74 A;  4LF9 L;  3BU2 A;  1K8G A;  4GN3 B;  1HJP A;  3BJU A;  5LMN W;  2DGY A;  4HJ9 A;  1KQS A;  1EIY B;  2UXB Q;  2R7Z G;  2K50 A;  2V1C C;  4P73 A;  3CCQ A;  3A5U A;  4YCV A;  5IWA L;  5FLM H;  1EQQ A;  3LGJ A;  1XNR Q;  5IE8 A;  4JI6 L;  4X65 Q;  1XNQ L;  3RNU A;  3S14 H;  3D0F A;  1P16 A;  4JI3 L;  2IX1 A;  4DR6 L;  1LYL A;  1E22 A;  1IYJ B;  1X65 A;  1CKM A;  2HIV A;  1NJI C;  4JI3 Q;  5BR8 L;  2YTY A;  2UU9 L;  3OTO Q;  2VQE L;  2Q2H A;  4OX9 L;  1NTG A;  2B29 A;  4KHZ A;  4QL5 A;  1Q81 C;  1XMQ Q;  1H95 A;  4APV A;  5M5Y H;  1SMX A;  4OX9 Q;  3KFU A;  1BBU A;  3PCO B;  3RN2 A;  4BBR H;  2QEX A;  2IY5 B;  2ZTC A;  3M3Y H;  4C2M H;  3CCM A;  1LUZ A;  5M5W H;  1Q1B A;  1VS0 A;  5JEA J;  1VQC A;  1JT8 A;  3CCV A;  4LFA L;  4A3J H;  1WJJ A;  4DR6 Q;  4A3D H;  5H1S E;  1Q86 C;  2WB1 E;  2R92 G;  3HOZ H;  1AH9 A;  2PNH A;  3NBH B;  3ZJY C;  2ALY B;  2YV5 A;  4DV7 Q;  1K83 H;  1KIX A;  4POG A;  1VQM A;  3STB C;  2UXC Q;  4WJ4 A;  1CUK A;  2Y0S E;  1GVP A;  2VUM H;  3TS2 A;  1KXL A;  1VQF A;  3F2B A;  2HT1 A;  2K5H A;  2JEA I;  4DR1 L;  4DR5 Q;  2EIF A;  1ASY A;  4K0K L;  1PA6 A;  1HNZ L;  2ZTD A;  5GQO A;  1X9N A;  1PVO A;  1DGS A;  5C44 H;  4P74 A;  4BA1 I;  1IXR A;  1JE5 A;  1G51 A;  1OXV A;  2KCT A;  3HKS A;  5IYB H;  4R1J A;  4GKK Q;  3U58 A;  4IPD A;  3K81 C;  4JI1 L;  1VQN A;  1HNW Q;  3KOJ A;  3GTL H;  4B3S L;  3B6Y A;  4GOP A;  4HJ8 A;  1X56 A;  1PH3 A;  3J81 c;  1P8L A;  4OWT B;  4YY3 L;  2R7Z H;  4X66 L;  4UP8 A;  5C0X G;  3F1Z A;  1A62 A;  4HJ5 A;  2JJQ A;  3RR5 A;  3M9B A;  3HOY H;  5IP7 G;  4LF7 Q;  4HJA A;  1EOV A;  2HQL A;  2VUM G;  1NY4 A;  1CKN B;  3I4O A;  3OW2 A;  1VQ4 A;  3KDF A;  2MFI A;  3M4Q A;  4P75 A;  4BY1 G;  3TS0 A;  1XMO L;  1PH7 A;  2N3S A;  3S1R H;  1VQP A;  5C3E H;  3HOX G;  4A3J G;  4DUY Q;  1UE1 A;  3TRE A;  2CWA A;  3HFZ B;  5IYB G;  1PFS A;  5EAY A;  3VDY A;  5K36 G;  1Q1E A;  4X62 L;  1XPU A;  3PSI A;  4MZ9 A;  1FVI A;  4AYB G;  3RZO H;  4NPS A;  1NBW A;  3CQZ H;  1S40 A;  2VZA A;  3FKI G;  1ASZ A;  4A3B G;  4DV5 Q;  2CFM A;  2KHJ A;  4BXX G;  1KRT A;  2K4K A;  2KEN A;  3S2D H;  4JI1 Q;  1EUJ A;  1RIP A;  3CF5 A;  1WCM H;  1XMQ L;  1KC8 C;  1IZ6 A;  1YVC A;  3RLO A;  1Q12 A;  4DR7 L;  3HOZ G;  4BXX H;  1GKH A;  1MJC A;  1IBK L;  4KLK A;  2E5L Q;  4JOI C;  1E24 A;  2MO0 A;  2NVQ H;  1UEB A;  3KF8 B;  4L5T A;  1RL2 A;  1WCM G;  2NN6 G;  4QJF A;  4R4O A;  4DV3 L;  3PUW A;  3HKZ G;  4MNO A;  3CCR A;  1PH4 A;  4A3G G;  1YHQ A;  4JYA L;  1IBM L;  2FXQ A;  3Q8D A;  1B7Y B;  1CSQ A;  2LXK A;  2MO1 A;  3PUV A;  4DK6 C;  4BY7 G;  4DV2 Q;  3CCJ A;  5JJL A;  1BKB A;  4YWL A;  4IJL A;  4X6A H;  4IO9 A;  1K3R A;  2PI2 A;  4DV4 Q;  2Q2U A;  1JJC B;  2ID0 A;  2NZH A;  1HR0 L;  1TWH H;  2WAQ G;  1E7Z A;  2OQ0 A;  1B8A A;  1K8A C;  4A3C H;  3DM3 A;  4LF8 L;  3CP0 A;  4UP7 A;  4JI8 Q;  4NXN L;  3I56 A;  1YEZ A;  1SLJ A;  4TQU S;  5C44 G;  1N32 Q;  4QIW E;  5JJK A;  5JEA G;  3OTO L;  3L2P A;  5IP7 H;  4JV5 L;  4A76 A;  4HJ7 A;  3JC6 6;  4GN4 B;  3RLF A;  3S1Q H;  1UWV A;  4JI0 Q;  4R4C A;  3T1H L;  1EIF A;  1K9M C;  1N33 Q;  1J5E L;  4B3T Q;  4UPA A;  3OYY A;  1TWC H;  2KHI A;  1EWI A;  1E1O A;  1LTL A;  1WFQ A;  4DNI A;  5IYC H;  1XPO A;  4B3M L;  2R6G A;  3S17 H;  2OWO A;  1LM0 A;  1A8V A;  3AYH B;  2ZJR A;  4IFD G;  2K75 A;  2WFW A;  3G71 A;  5DLQ E;  4DR3 L;  1JMC A;  1WYD A;  1N36 L;  1I6H H;  1IBL L;  4YWM A;  2VS1 A;  2XGT A;  1VQ7 A;  1L2F A;  3H0G G;  4JBW A;  5C3E G;  1VQG A;  4OON A;  2VW9 A;  2ZM6 Q;  4LF6 Q;  4BBS H;  2WB1 G;  4LW1 A;  4A3F H;  3GTP H;  4LFC Q;  1G6P A;  1PYB A;  3K80 C;  2MNA A;  3F2C A;  4JI8 L;  1VQL A;  1OXS C;  2E2J H;  1CKN A;  2HHH Q;  1FJG Q;  3CME A;  4JBK A;  2E2I H;  5GAE C;  3DLL A;  3FKI H;  2AWO A;  4DK3 C;  1IBK Q;  4LUZ A;  2B63 G;  2VL6 A;  2VY3 A;  3FHW A;  3HOV G;  4GLV B;  1CKO A;  1U5K A;  4GKK L;  2JA6 H;  3JAM c;  4A3F G;  1GO3 E;  4JI4 L;  2B3G A;  2IHE A;  4HIM A;  2AWN A;  4LF9 Q;  3UDF A;  4GNX C;  3S16 H;  4UY8 C;  3ULP A;  1YZ6 A;  2R7D A;  1OXX K;  2F52 A;  4C3H H;  3G4S A;  4JI0 L;  2IX0 A;  5LMN Q;  1L1O B;  1MIU A;  3T1Y L;  2ZTE A;  1SRO A;  4OO1 G;  4YCU A;  3PUY A;  1OXT A;  1PH9 A;  2CQO A;  1VQ9 A;  4A3C G;  1PYS B;  1JB7 A;  3HOY G;  2BH8 A;  5IWA Q;  3J81 j;  1BVS A;  1HZ9 A;  2WAQ E;  3M85 A;  2Q2T A;  1C0A A;  3ER0 A;  4A3I G;  4LF8 Q;  4KI0 A;  3ULJ A;  5J3B A;  1XJV A;  4R4I A;  2VQF Q;  1NMG A;  1AE2 A;  2GVA A;  3A5Z B;  2Z6K A;  3I55 A;  3CCU A;  4DR1 Q;  4DR5 L;  1Q46 A;  1J6Q A;  4DAM A;  4DV1 Q;  1FJG L;  3RLN A;  5C4X H;  5FJ8 H;  4PMW A;  4RG1 A;  2ZM6 L;  4LF6 L;  3GO5 A;  5ELO A;  4DV0 L;  1TWA H;  2CWP A;  3FP9 A;  4B3S Q;  5LMN L;  1QVG A;  2B63 H;  2UUB L;  1G29 1;  1Z47 A;  1VQ5 A;  1HH2 P;  2JA7 G;  2UXD L;  4LF5 Q;  1UE7 A;  2ZJP A;  3PO3 H;  3GTQ H;  1BBW A;  3GTO H;  1Z9F A;  3W5O A;  4A75 A;  3CAM A;  1FGU A;  4P72 A;  1VQK A;  1XTD A;  4O0A A;  3L0O A;  5BR8 Q;  5C0X I;  4DV6 Q;  1JJG A;  3J7Z C;  4A93 H;  5C4X G;  1KHI A;  2K14 A;  2XTI A;  1PH8 A;  2JEB I;  2F4V Q;  3EIV A;  4JI6 Q;  3PO2 G;  4JBJ A;  4JI2 L;  1YIJ A;  4LFB L;  4PZ6 A;  1E3P A;  4DUY L;  3J80 i;  4GLA C;  4XTC S;  4YHH L;  4A3I H;  2RHQ B;  3PUX A;  1YJN A;  4BBS G;  4TVA B;  1Q8K A;  1CSP A;  5GRO A;  2ZJQ A;  1KL9 A;  1VQD A;  4QGU A;  1X55 A;  1QVC A;  3PIO A;  3KJO A;  4A3G H;  4AQY Q;  1IL2 A;  2E8G A;  2RCN A;  3AQQ A;  3MEF A;  3CMA A;  2RF4 A;  2JA6 G;  4GLX A;  1N33 L;  1W3S A;  2H5X A;  5M5X H;  1HZA A;  1GM5 A;  4LNQ A;  5ELN A;  1V43 A;  3PUZ A;  4IOC A;  3CCS A;  2R93 G;  4JV5 Q;  4JI7 L;  3GTK H;  2EXD A;  4C3J H;  1VQI A;  1EFW A;  1D7Q A;  4R4Q A;  3KF6 A;  3J81 i;  2A8V A;  1A0I A;  3G6E A;  3HOU G;  4EQ5 A;  2N49 A;  1X3G A;  3K0X A;  3RZD H;  3K7A H;  1KD1 C;  3A0J A;  1Y1V H;  1I94 Q;  2UXB L;  2I5L X;  1QZH A;  4A3L H;  3M4P A;  4LF5 L;  4K0K Q;  4L5S A;  2OCE A;  4LWC A;  5AJ3 L;  4DKA C;  4DV4 L;  1AE3 A;  4HID A;  4YHH Q;  1C7Y A;  2UUB Q;  4LUO A;  3PGZ A;  3H15 A;  2ASB A;  3H0G H;  1NE3 A;  4LFC L;  5GAH C;  2UXC L;  3UE1 A;  2IHF A;  4DV2 L;  1XNQ Q;  3CPF A;  4GKJ L;  4LFA Q;  1OXU A;  3UE0 A;  5LMU L;  2C35 B;  3KDF B;  5IYD G;  3K7U C;  4DR3 Q;  1TWG H;  3GTM H;  3GD7 A;  2BH2 A;  5C4J H;  3M4O H;  3UDG A;  4DAY B;  3S2H H;  1YNX A;  2I5M X;  2PQA B;  2AHO B;  3CXC A;  2UUA L;  2BA0 A;  4B3M Q;  3HKZ E;  2JA5 G;  1T9H A;  1PH5 A;  4B3T L;  3I7F A;  4R4T A;  5E7N A;  3I4N H;  3F8T A;  4NXM L;  3H3V I;  3TRZ A;  2HHH L;  2I0Q A;  4BY1 H;  2DUD A;  4L5R C;  4NXM Q;  5GAG C;  1QUQ B;  3HOW G;  3I4M G;  4QY7 A;  3SGI A;  4GNX B;  1OTC A;  1VQJ A;  3HOV H;  1VQ6 A;  1PH6 A;  4B3R L;  1M90 C;  1XNR L;  1XPR A;  1MJE A;  3J80 c;  1N34 L;  1EYG A;  4JI4 Q;  2K5V A;  5IYD H;  3PF5 A;  1D8L A;  2IT1 A;  4LF4 L;  2K52 A;  3S1N H;  2NN6 I;  1S3O A;  2VQF L;  4JC0 A;  4GN5 A;  4DPG A;  4LUV A;  5FLX c;  5LMU Q;  3E9I A;  1HNX L;  2YTX A;  4DV0 Q;  2HIX A;  2D62 A;  2JA5 H;  4WJ3 M;  4YY3 Q;  4A3M H;  1K0R A;  2OQK A;  1WOC A;  4ALP A; 
#chains in the Genus database with same CATH topology
 3FPP A;  1QVF A;  1Y1V G;  5BN3 A;  1AN8 A;  3HS0 C;  3TP5 A;  2JA6 B;  3HOW H;  4DFA A;  1STE A;  3PO3 G;  1H9J A;  1GXD C;  1N9W A;  2B2U A;  3I8Z A;  1D1K A;  3AFP A;  4DR2 L;  3AB9 A;  1PH1 A;  4FF2 A;  2JE6 I;  3K5N A;  1VQO A;  4DGZ A;  3S2H B;  3D3R A;  3CCE A;  3NEL A;  2AKW B;  4TSS A;  3H3V H;  4ULL A;  1F2M A;  4F87 A;  4Y52 H;  5M5Y B;  2PMZ E;  1HQR D;  4B9X A;  3GTJ B;  5C5L A;  1YHB A;  1CZW A;  1SE2 A;  2F3I A;  4FF3 A;  2CCZ A;  2ENB A;  1Y8N B;  2EY6 A;  3P20 A;  4A3L G;  5FLM G;  4PNY A;  3TEH B;  4BS9 A;  1BCP F;  4EX5 A;  3GTG H;  4A3E H;  2L1B A;  1GUW A;  2KOL A;  3J81 E;  2EJG C;  1STY A;  4ZQ3 A;  1QZG A;  3NBH A;  1EY7 A;  1EY5 A;  3EVQ A;  4RH6 A;  2RA4 A;  5M3M G;  1S72 A;  2ICI A;  4Y7N B;  1UE6 A;  1WTX A;  3CW2 C;  3C1E A;  3CRL C;  3KJP A;  1F9Q A;  2JA8 G;  3A8J E;  2RDH A;  3U4V A;  1TT2 A;  2Z4I A;  2HDL A;  1XMO Q;  1I94 L;  3CPW A;  4RMF A;  4PZ8 A;  5FJ8 G;  2AUK A;  4AYB E;  5T1I A;  4IFD H;  3I4N G;  2Z6K C;  3SK4 A;  2O5J C;  4H02 A;  4P71 A;  2PI2 E;  2OT2 A;  5KEE A;  4IOA A;  2PYK A;  1WI5 A;  2HDM A;  2PW7 A;  1ONL A;  1I4X A;  2CH4 A;  1I3Q H;  5IYC G;  1EY8 A;  3I4M B;  4FO2 A;  4A3D G;  3IRB A;  3S9W A;  4O2D A;  5C4J B;  3M7G A;  5CV5 A;  3WDN A;  2F03 A;  4GKJ Q;  1XYI A;  4HIO A;  1M1K C;  2JQO A;  3L7Z C;  1X54 A;  4XT1 B;  1Z7T A;  2NZO A;  1K83 B;  4FDB A;  3Q22 A;  2K5W A;  2VB3 X;  4A93 G;  2PQA A;  2QA4 A;  2I5H A;  2E5L L;  2BOS A;  1Q7Y C;  4K2K A;  5E3F A;  1L0W A;  5IOD A;  1HNZ Q;  1ICW A;  1J5E Q;  2Z0S A;  2GN5 A;  2XSC A;  2LSS A;  4XYQ A;  5JJI A;  1I6H B;  4Y7N H;  3VR5 A;  3K59 A;  4OEL B;  5K5P A;  1ENC A;  1PMR A;  3KYH C;  3HOU H;  3NQT A;  4MTN A;  5BN5 A;  1TWF H;  3K7A B;  3A74 A;  4MHE A;  4HJ9 A;  5D65 A;  4DU9 A;  5KNB A;  4YCV A;  2NUC A;  3T51 B;  5IWA L;  3LGJ A;  3HOZ B;  4X65 Q;  4ZK9 B;  2F0V A;  2IX1 A;  1LYL A;  4KY5 A;  1RCV D;  2SNM A;  5EKI A;  1EZ8 A;  3VR6 A;  5ELC A;  3C2P A;  2K03 A;  2VQE L;  2Q2H A;  4O1N A;  2B29 A;  1XMQ Q;  1H95 A;  4APV A;  2EPB A;  5M5Y H;  5M3F B;  4OX9 Q;  3PCO B;  3R2T A;  2IWH A;  5JAV A;  5I6W A;  1I4G A;  1JT8 A;  1JWS D;  4A3J H;  3R93 A;  1GHJ A;  1TWA B;  2YV5 A;  1SFO B;  2B2V A;  1VQM A;  4WJ4 A;  1GUT A;  1CUK A;  2F0K A;  2HT1 A;  1LT3 D;  1HUN A;  2IPK D;  1DGS A;  3I91 A;  3J81 L;  3DEO A;  1IXR A;  1JE5 A;  4DN4 M;  1IL8 A;  4GKK Q;  4JI1 L;  2EYF A;  3GTL H;  1E2V A;  4IUU A;  4GOP A;  4HJ8 A;  1PH3 A;  3F1Z A;  2QW7 A;  3F2U A;  3HOV B;  3QG1 A;  3HOY H;  4HJA A;  1EOV A;  2VUM G;  1JWM D;  3KDF A;  4IQZ A;  2MFI A;  3R2I A;  5A35 A;  2KJX A;  1PH7 A;  1VQP A;  3HOX G;  3S17 B;  5IYB G;  3RD4 A;  2B2Y A;  2F0O A;  4MZ9 A;  3PMF A;  4L63 B;  4C2M B;  3RZO H;  3CQZ H;  1LTB D;  3FKI G;  2CW0 D;  4I65 A;  1KAB A;  2CFM A;  4A3B G;  2K4K A;  3D6W A;  4IUN A;  4QCL A;  4BY1 B;  4J8Q A;  1EY9 A;  2EJF C;  3KLR A;  4NP5 A;  1KC8 C;  4A3J B;  5G3L F;  3RLO A;  3Q6S A;  1GKH A;  2E5L Q;  1VDZ A;  1U4M A;  1PRT F;  4L5T A;  4QJF A;  4MNO A;  3HKZ G;  4JYA L;  1PH4 A;  4A3G G;  1BBX C;  1CHQ D;  2FXQ A;  2K5Q A;  1JB3 A;  5IGF A;  3PUV A;  4G4K A;  3KUP A;  2A73 B;  4KKT A;  3CCJ A;  5JJL A;  4IJL A;  3T13 A;  2HCI A;  1JC7 A;  1K3R A;  2PI2 A;  2ID0 A;  3M4Y A;  2PCF B;  1B8A A;  1E2Z A;  1EYD A;  2KCN A;  3D8G A;  3GTP B;  1SNM A;  5IP7 H;  3JC6 6;  4A3I B;  3RLF A;  4N9T A;  2M2L A;  2BCO A;  4JI0 Q;  3T1H L;  1K9M C;  4H7B A;  4B3T Q;  4UPA A;  2KHI A;  1XPO A;  5IYC H;  3FVQ A;  5LHY 1;  5KNC A;  1LM0 A;  1DXM A;  2WFW A;  5DLQ E;  1JMC A;  3P1H A;  1SNP A;  1GUN A;  4RA8 A;  1N36 L;  2NBF A;  1WCM B;  2B2T C;  3SR1 A;  2MGS A;  3H0G G;  2ZM6 Q;  2JA8 B;  1WTP A;  2CVR A;  3GTP H;  3K80 C;  3W2D A;  3F2C A;  1HTP A;  2X6G A;  5A2Q E;  1VQL A;  2HHH Q;  1B9M A;  1CKN A;  2LMC B;  3CME A;  2Q8T A;  2E2I H;  5CV8 A;  3DLL A;  1IBK Q;  3S1M B;  2VL6 A;  4U68 A;  4GLV B;  1U5K A;  2B39 A;  3BYT B;  2EY1 A;  2B3G A;  1U4R A;  4HIM A;  2AWN A;  3UDF A;  2JXM B;  3S16 H;  4UY8 C;  1YZ6 A;  3G4S A;  4C3H H;  1B2T A;  1HA6 A;  4OO1 G;  3VYU A;  1OXT A;  3EQL C;  1NSN S;  3O13 A;  4F8M A;  5J3B A;  1QJO A;  4LAA A;  5I9P A;  1LTS D;  4R4I A;  1NMG A;  2QIL A;  1KDA A;  4BBR B;  3CCU A;  5EJW A;  1J6Q A;  3IL8 A;  1K8M A;  2WV6 D;  4TKO B;  1MSH A;  5FJ8 H;  1EU3 A;  4RG1 A;  1QOH A;  3GO5 A;  5ELO A;  4NKL A;  2CWP A;  4B3S Q;  2B63 H;  2UUB L;  5I4D A;  1MSG A;  1FR3 A;  1VQ5 A;  1LTR D;  4LF5 Q;  4H44 C;  1LLR D;  4RAU C;  4CDD C;  3KLS A;  3SK8 A;  4YIJ A;  4RGM A;  1XTD A;  2NN6 H;  3DWQ A;  1JWU D;  2IW3 A;  1LTA D;  2PZT A;  5DNF A;  2XTI A;  2JEB I;  4PZ6 A;  2K32 A;  5CV7 A;  4DUY L;  4XQQ A;  1Y1V B;  2RHQ B;  4TVA B;  4I7A A;  3TP8 A;  4DNT B;  3KJO A;  2RF4 A;  3D4R A;  4GLX A;  3SVM A;  1HFN A;  2EY5 A;  1GM5 A;  4FXG C;  5ELN A;  5LL6 S;  2E2D C;  2R93 G;  3G6J B;  5ELF A;  3GTK H;  2L0C A;  2EXD A;  5EQ0 A;  1EFW A;  1D7Q A;  1A0I A;  3HOU G;  1SYF A;  3K7A H;  3A0J A;  4HN7 A;  1I94 Q;  2PPB C;  1ROD A;  3M4P A;  4LF5 L;  1B3Q A;  3NP8 A;  2OCE A;  4L5S A;  4LF9 Q;  1AE3 A;  4HID A;  4LUO A;  1NE3 A;  3BVZ A;  3J7A F;  4LFC L;  5GAH C;  2ZT9 C;  3UE1 A;  1B1Z A;  1V1P A;  3CPF A;  1BF4 A;  4GKJ L;  3N52 A;  4LFA Q;  3UE0 A;  5LMU L;  1HQM C;  1PLF A;  3KDF B;  3K7U C;  2P5Z X;  4DR3 Q;  2M00 A;  3GTM H;  3GTQ B;  3M4O H;  1YNX A;  4KY7 A;  2QF7 A;  2D5D A;  4UHV A;  3CXC A;  5TSS A;  2JA5 G;  1PH5 A;  4ZLT F;  2O4X A;  1QIL A;  2PW5 A;  4HMJ A;  2FIN B;  5BN4 A;  1A3V A;  2EOT A;  3HOW G;  1GUO A;  1OTC A;  3SEB A;  1VQ6 A;  3J80 c;  3PF5 A;  1D8L A;  1PZK D;  2DY8 A;  4K2L A;  4LF4 L;  5KND A;  5LMU Q;  4DV0 Q;  3A8I E;  3H6M A;  2D62 A;  3I4L A;  4M8A A;  3WOF A;  3VR4 A;  1XX8 A;  1WOC A;  4FF1 A;  2G9D A;  4ALP A;  2XWB B;  4E6I A;  4DV3 Q;  1GJX A;  2RQX A;  3AU7 A;  3H09 A;  1C9O A;  1SEB D;  3NEM A;  4OWW B;  2KCM A;  3I4M H;  4IPH A;  1N8R C;  3UDI A;  1NR4 A;  3S15 H;  1SSO A;  4QUF A;  2KED A;  1SE4 A;  4HAE A;  5M5W B;  2JA7 H;  4GS3 A;  3NEN A;  1MHW C;  4CDE C;  4KY6 A;  1KRS A;  1Y1W G;  3ULL A;  5HGT A;  4X3K A;  2N8N A;  5D3D A;  4YCW A;  1YJW A;  1TY2 A;  4HSV A;  2NB0 A;  3IKJ A;  4RKB A;  4BBS B;  4B3R Q;  1NCV A;  5C0X J;  2EYP A;  1TVX A;  1EY4 A;  2K05 A;  3PF4 A;  5D14 A;  1A6X A;  1D6E C;  5M3F G;  2AUJ D;  4C3J G;  4H0L C;  1O7L A;  3OSO A;  3NTI A;  2D0P A;  2KA7 A;  1A3T A;  4A3M B;  1YI2 A;  1STG A;  3JAM i;  3S24 A;  4BA2 I;  1JE4 A;  3GTJ H;  3BZC A;  1EZ6 A;  2UXD Q;  3U4Z A;  1X3P A;  2ATW A;  4A3E B;  5IP9 G;  4HIK A;  2MP1 A;  4DV7 L;  4CJ1 B;  2KEC A;  3NE5 B;  3KF6 B;  1EQT A;  1H9M A;  1Y1W H;  4RHS A;  4YWK A;  3GDE A;  1GD7 A;  3QWN A;  4ZCK A;  2MPM A;  3SK6 A;  2MQH A;  2Q2I A;  2UUC L;  4LF7 L;  2EQS A;  5CV4 A;  3NK9 A;  2RHS B;  3DHQ A;  1TY0 A;  4EQN A;  4IUP A;  3HOY B;  2DJG C;  2MJ8 A;  4IJH A;  2V4D A;  3OHX C;  3V2T A;  1W2B A;  1JJ2 A;  4X64 L;  5EPJ A;  2NVY H;  3TQY A;  3DM1 A;  5G3L D;  2PZU A;  4FYD A;  2A1A A;  3TN2 A;  2UUA Q;  4HTH A;  4A3K B;  1HPC A;  3VA5 A;  4PZ7 A;  3CC4 A;  2G5D A;  2CQA A;  4LF4 Q;  4A3E G;  1YJ9 A;  4TRD A;  1EIH A;  4R9W A;  3MVV A;  1YIT A;  3CCL A;  4QIW B;  1JOO A;  4A3K H;  3M7N A;  2RKS A;  1SND A;  4RCO A;  2YYZ A;  1DYQ A;  4KV6 A;  4GOP B;  2XN9 C;  4A3B H;  1E1T A;  5FKA C;  3OPO A;  5CYU A;  4KN7 C;  2A68 C;  3PIO 3;  3ERS X;  2R3Z A;  1EEI D;  4OO1 I;  4F88 A;  1V9P A;  2LY7 A;  3STB D;  3MA2 B;  3FPU B;  4KMU C;  5IT9 c;  2EYO A;  4IFD I;  4LFB Q;  4IZ8 A;  2C5C A;  4HCE A;  2YU9 H;  1Y14 B;  3H0G B;  1D5M C;  1N32 L;  4ME5 A;  2LKV A;  4B08 A;  3D31 A;  1F2Y A;  2RDG A;  4LF9 L;  1RKN A;  3A7L A;  5LMN W;  2DGY A;  1KQS A;  2K50 A;  3CCQ A;  3ND8 A;  2K28 A;  3JAM E;  2XRQ D;  4FXK C;  1STA A;  2QCP X;  4KD3 A;  3MAQ A;  5IE8 A;  1XNQ L;  3S14 H;  3D0F A;  1P16 A;  4JI3 L;  3SE0 A;  5CC4 A;  1IYJ B;  4JPB W;  4IUV A;  2VXW A;  3ERQ A;  5BR8 L;  2YTY A;  2UU9 L;  4RFB A;  3S1Q B;  2FMM A;  4QL5 A;  1BXT A;  1Q81 C;  5C4X B;  3D6C A;  4PV1 C;  1BBU A;  2QEX A;  2IY5 B;  2ZTC A;  1CFM A;  4K8J A;  3CCM A;  2F0J A;  1GUG A;  5KIX A;  3CCV A;  1WJJ A;  4ZKC B;  1AH9 A;  2R92 G;  1S5C D;  4DV7 Q;  1K83 H;  1PTO C;  4POG A;  2UXC Q;  4PMC A;  1GVP A;  3E0J A;  4WJW A;  4PQX A;  2JA7 B;  4DR5 Q;  1ASY A;  4K8I A;  1HNZ L;  1X9N A;  2QDB A;  5IYB H;  2KCT A;  1YNJ C;  1VQN A;  5JOB A;  4B3S L;  3B6Y A;  1EL0 A;  1NNX A;  3J81 c;  1P8L A;  1C4Q A;  2NZ1 D;  4OWT B;  4DK1 A;  4YY3 L;  4UP8 A;  4HSP A;  2HD3 A;  3A56 A;  4IUQ A;  3GTO B;  2HQL A;  1NY4 A;  3GV6 A;  1CKN B;  2NTS A;  1VQ4 A;  3HRZ C;  4P75 A;  4BY1 G;  1DM0 B;  5EPK A;  1LTI D;  5C3E H;  4DUY Q;  1QB5 D;  2CWA A;  1PFS A;  2WIN B;  1I4R A;  1V1O A;  4X62 L;  4AYB G;  1NBW A;  4A3F B;  2SEB D;  4C1N K;  4DV5 Q;  2FJ2 A;  5EKK A;  4JI1 Q;  2AQ2 B;  1RIP A;  3CF5 A;  1K8O A;  3FMC A;  4CBV A;  1XMQ L;  1Q12 A;  3Q0A A;  1MJC A;  4KLK A;  4JOI C;  3M3Y B;  4C1N I;  3SDZ A;  3KF8 B;  4R4O A;  4DV3 L;  1RL2 A;  2NN6 G;  2XVS A;  4GZY C;  3JAM L;  5DM7 3;  1CSQ A;  2F0E A;  1S5B D;  3OWF A;  5J1Z A;  3T56 B;  3OOC A;  2RCF A;  3K6O A;  4XYO A;  1PFB A;  1TS2 A;  4IO9 A;  4G7O C;  1KTK A;  2Q2U A;  1SE3 A;  1HR0 L;  2L5T A;  2Q8I B;  1HUM A;  1K8A C;  1EEF D;  4LF8 L;  4JI8 Q;  4UP7 A;  2F4I A;  1TU2 B;  1SLJ A;  4TQU S;  5C44 G;  3OTO L;  4JV5 L;  1LT5 D;  4A76 A;  1DOL A;  4R4C A;  1S5E D;  1N33 Q;  3OYY A;  1TWC H;  1EWI A;  1LTL A;  4KKU A;  4B3M L;  1G91 A;  3J7Y W;  1A8V A;  2NVX B;  2E76 C;  3G71 A;  1B3A A;  5C4Z A;  2C9O A;  3ITP A;  1GUS A;  3TZU A;  2SNS A;  4YWM A;  4K6D A;  1VQ7 A;  1L2F A;  4JBW A;  4LF6 Q;  4OON A;  3U9O A;  5ELE A;  4BBS H;  2WB1 G;  1G6P A;  4LFC Q;  1PYB A;  3CHB D;  2MNA A;  1B50 A;  3S1R B;  1OXS C;  1FJG Q;  4ZAI A;  4JBK A;  1HFG A;  5C0X H;  2ICE C;  1IYV A;  1RTN A;  4WRD A;  2IHE A;  4P2C B;  2Z8L A;  4GNX C;  1SDF A;  3ULP A;  1K3B C;  2OEO A;  1PRT B;  1L1O B;  3IAY A;  2ZTE A;  3C46 A;  1FD7 D;  1F2Z A;  4YCU A;  3K5O A;  1VQ9 A;  1GOZ A;  3D4W A;  2EYJ A;  1HZ9 A;  2WAQ E;  4A3D B;  3L9A X;  4A3I G;  3QO2 A;  4KI0 A;  2VQF Q;  3A5Z B;  3I55 A;  4DR5 L;  2F0I A;  1FJG L;  4RCN A;  2WB1 B;  3V96 A;  4DV0 L;  5IOC A;  1G29 1;  1Z47 A;  3PQI A;  5C44 B;  1Z9F A;  4G57 A;  4C3I B;  4A75 A;  1KAA A;  3NHH A;  3CAM A;  2K04 A;  3MTS A;  3NPP A;  1VQK A;  2O5I C;  2BE5 C;  4O0A A;  5BR8 Q;  2A69 C;  3TBI B;  4CKC A;  2K14 A;  5I2X A;  2F4V Q;  3W3A A;  1AP0 A;  2B8G A;  1VMC A;  4GLA C;  1D1I A;  3J80 i;  4A3I H;  3PUX A;  2IX3 A;  4XDX A;  1HA5 A;  1VQD A;  5L37 A;  4AQY Q;  1UEA B;  2RCN A;  1E2W A;  3AQQ A;  3MEF A;  1MBY A;  2JA6 G;  2EVB A;  1W3S A;  2H5X A;  1HZA A;  5EGT A;  1J9O A;  1EWH A;  3PUZ A;  1Z6H A;  1EIG A;  2K5D A;  4JV5 Q;  4JI7 L;  1S5F D;  4C3J H;  5M3M B;  3J81 i;  2A8V A;  1S4Z A;  1X3G A;  1KD1 C;  1TS3 A;  2E2H B;  1QZH A;  4A3L H;  1V8Q A;  1XWE A;  2L55 A;  4LWC A;  4YHH Q;  3I72 A;  3PGZ A;  2ASB A;  2NVQ B;  2R92 B;  2IHF A;  4DV2 L;  1ENA A;  1J8I A;  1SBB B;  4OIK A;  4ILW A;  3RUZ A;  2E74 C;  1TWG H;  3GP7 A;  1T5E A;  1Q3L A;  2I5M X;  1QWY A;  5FK9 C;  2AHO B;  2IJ0 A;  3AMU A;  1T9H A;  2NTT A;  2X6L A;  1A15 A;  1SYG A;  3F8T A;  5IT9 E;  2ZXP A;  1O78 A;  3H3V I;  1RD9 D;  2HHH L;  5C3X A;  2F0N A;  3E3X A;  4BY1 H;  3I3C A;  1QE6 A;  2DUD A;  1R4P B;  4L5R C;  4NXM Q;  1JOQ A;  1H9K A;  4QY7 A;  3HOV H;  4CKB A;  2DN8 A;  1VQJ A;  1Q90 A;  4B3R L;  1M90 C;  1PFM A;  1XPR A;  1MJE A;  2F0P A;  2K7V A;  4L8J A;  2K5V A;  3HZX A;  2NN6 I;  2WKD A;  1S3O A;  3KF8 A;  4JC0 A;  5C5M A;  4LUV A;  3E9I A;  3LX0 A;  4OHJ A;  1NAP A;  1SYB A;  5KRU A;  4AYB B;  1JIC A;  4YY3 Q;  4LJZ C;  1NUC A;  1SNQ A;  1BUV T;  3T1Y Q;  3DWP A;  2M9V A;  5AJ3 Q;  2OTL A;  1DZ1 A;  2TMP A;  4KHP Q;  4DUZ Q;  3LWE A;  1VQ8 A;  5K36 H;  4ME3 A;  3TDQ A;  1UE5 A;  1X3E A;  4JI7 Q;  3PV0 A;  5CV9 A;  5LL6 X;  2L15 A;  4JBM A;  3AEV A;  4JG2 A;  3DUZ A;  3L3O C;  4C3H B;  4Z9C B;  4NW2 A;  3EN2 A;  1LT6 D;  5DAU A;  4OXP A;  1U0L A;  5A2Q L;  5CBE E;  1HNX Q;  4JYA Q;  1HRJ A;  1QNK A;  1LAB A;  2NVX H;  3UDX A;  1ILQ A;  1MKH A;  1HR0 Q;  3X3M A;  5I9O A;  3VR2 A;  1KLG D;  4OWX B;  5JJZ A;  3W1G A;  4A4I A;  1O7Y A;  2B2U C;  5IGG A;  1YHA A;  4NB3 A;  5IGC A;  3F2D A;  1X3F A;  1HZB A;  1MI2 A;  1CT1 D;  1TKW B;  2R61 A;  3OMC A;  4R8N A;  4O42 A;  4X3T A;  4AQY L;  3PO2 H;  5JEA H;  2R93 B;  3WWV A;  4EGV A;  1F2L A;  2K01 A;  1V1Q A;  3KBG A;  3T1H Q;  2NVT H;  3ICE A;  3BZK A;  2PQE A;  3E6Z X;  5JVH 3;  3J7A V;  1AW7 A;  4JI2 Q;  3QR8 A;  2PNR C;  4XQN A;  2VNU D;  1VQE A;  1O7Z A;  3ONA B;  3J7A 5;  4ZRZ A;  1PZI D;  1TXY A;  2QEJ C;  2L11 A;  4RGO S;  2B63 B;  1VF7 A;  3GV3 A;  1Y8P B;  4G7Z C;  4C56 C;  3T53 B;  4A3K G;  4JW0 A;  1D2B A;  4C3I H;  1ZEQ X;  2ES2 A;  5HUR A;  4XIG S;  4DF7 A;  4WFN 3;  1L1O C;  5IP9 H;  4DV5 L;  4HCS A;  1EYC A;  2R7F A;  4X65 L;  1MD2 D;  1VQH A;  4KJO A;  5C3E B;  3CC7 A;  2RVL A;  3NWT A;  1I6V C;  5I2Y A;  1SYC A;  3S1N B;  2F0T A;  4DV1 L;  1CA6 A;  4HR7 B;  2DJF C;  5CBA E;  1EQR A;  2X69 A;  2F0Q A;  4I7Z C;  4JOI A;  1VCI A;  2JA8 H;  1QUQ A;  5COY A;  2A68 D;  4OGQ C;  1F9R A;  3S16 B;  4JI5 L;  4BBR G;  4X64 Q;  1STB A;  1ET9 A;  2JK8 A;  4IPC A;  2IL8 A;  4S3S A;  2TSS A;  3S1M H;  1SR3 A;  1BCP C;  1XTC D;  3KLW A;  4DR2 Q;  2Y0S G;  4CKE A;  1I5F A;  2KBN A;  2GVB A;  4X66 Q;  1SE8 A;  1ICF B;  2EJM A;  2YTV A;  4FXD A;  1KAW A;  1B4O A;  2F0U A;  4C3J B;  5M3M H;  2G9H D;  1A63 A;  5CMD A;  1PTO B;  1U4P A;  2A19 A;  3MXN B;  4JI5 Q;  2KHS A;  1EYA A;  2JA9 A;  3EBE A;  1I4P A;  1K8G A;  1HJP A;  3A54 A;  1EIY B;  2UXB Q;  1BCP D;  2R7Z G;  2V1C C;  4QF4 A;  2NWG A;  4KKS A;  3A5U A;  1EQQ A;  1TII D;  4IUR A;  1XNR Q;  1SXT A;  3MWY W;  5M5X B;  1E22 A;  3DWA A;  1X65 A;  2HIV A;  4JI3 Q;  3OTO Q;  3T16 A;  1STN A;  4OX9 L;  1NTG A;  3RZD B;  3UI2 A;  4CHT B;  5C4H A;  2DY7 A;  2AQ1 B;  3RN2 A;  4C2M H;  1LUZ A;  1Q1B A;  1VS0 A;  5JEA J;  4Q5V A;  1I3Q B;  4A3D H;  5FO7 B;  3HOZ H;  3ZJY C;  1II3 A;  1Y69 U;  4OIJ A;  4JK1 C;  2SOB A;  3K58 A;  3MFG A;  2JEA I;  5IGE A;  4DNR B;  2ZTD A;  1DCZ A;  1IHZ A;  2H4O A;  1G51 A;  1OXV A;  4K14 A;  1W6K A;  4R1J A;  5FO9 B;  2EYH A;  4DAV A;  4IPD A;  3K81 C;  4LMQ D;  1IKL A;  3K0Y A;  1HNW Q;  3KOJ A;  3I4N B;  3MZ5 A;  3HG9 A;  3HOW B;  1GHK A;  1DJR D;  4QUC A;  1DD2 A;  4X66 L;  4NMZ A;  1A62 A;  4HJ5 A;  3NSW A;  1KDB A;  3BVG A;  4OEM B;  4N8F A;  1Y8O B;  4LF7 Q;  1CK1 A;  3I4O A;  1FNW A;  4FNF A;  2ZXO A;  3TS0 A;  5ELB A;  1TQO A;  4NDX A;  4C3H G;  4XXE A;  4A3J G;  1UE1 A;  4G7H C;  1KNA A;  3J80 L;  5K36 G;  3ZYY X;  3PSI A;  2OXP A;  5KYI A;  2VZA A;  2KHJ A;  5CR3 A;  1KRT A;  2KEN A;  3S2D H;  3H94 A;  4XT3 B;  4L6T B;  1IZ6 A;  1YVC A;  1YNJ D;  3MXU A;  2J7Z A;  3MFY A;  1E24 A;  4IAL A;  2MO0 A;  2NVQ H;  1UEB A;  4DR4 Q;  4K5X A;  3PUW A;  3CCR A;  1B7Y B;  4ABN A;  4LK1 C;  3A55 A;  4BY7 G;  1QNU A;  5D3I B;  2A5H A;  3G7L A;  4DV4 Q;  1PDQ A;  1TWH H;  2OQ0 A;  4A3C H;  1X32 A;  3MXG A;  3SXH A;  4F7X A;  1LTT D;  1L0Y B;  2OF1 A;  1N32 Q;  5E1F A;  1AEX A;  5JJK A;  5JEA G;  3L2P A;  4KJN A;  4Q0F A;  3E5S A;  3S1Q H;  2HUG A;  2WKC A;  5ELD A;  2B8F A;  1E1O A;  4DNI A;  3PO3 B;  3J80 E;  2OWO A;  4UDU C;  2SDF A;  4CJ0 B;  1I4Q A;  1SYD A;  1WYD A;  3N6R A;  4CGY B;  1I6H H;  5JPN C;  5FLX E;  2VS1 A;  2XGT A;  3VA7 A;  2N55 A;  2PZW A;  1G8Z D;  4LW1 A;  4XQJ A;  4A3F H;  4ZUI A;  4JI8 L;  1ZKO A;  3S15 B;  2F3V A;  3VR3 A;  1Q8I A;  2A6E D;  5M9O A;  2HQE A;  5DM6 3;  5GAE C;  3FKI H;  2B63 G;  4GKK L;  3FHW A;  1CKO A;  1IW7 D;  2B2W A;  1A2T A;  3JAM c;  4A3F G;  4JI4 L;  2L12 A;  3MC0 B;  1JOK A;  1NR2 A;  1BCP B;  1OXX K;  2F52 A;  5KYL A;  5LMN Q;  1O80 A;  1EFI D;  3PUY A;  1PH9 A;  1PYS B;  2I07 B;  1PYW D;  2BH8 A;  2EY2 A;  5IWA Q;  1JB7 A;  1BVS A;  3M85 A;  2K1B A;  3TSS A;  3ER0 A;  4LF8 Q;  4FF4 A;  3ULJ A;  3IFT A;  3C3L A;  1AE2 A;  4N9P A;  2XNA C;  2Z6K A;  2J4X A;  1Q46 A;  3RLN A;  5C4X H;  1CZG A;  4PMW A;  2ZM6 L;  2K33 A;  3H91 A;  3FP9 A;  5LMN L;  1QVG A;  2NVY B;  3NUC A;  1B9N A;  2A69 D;  1HH2 P;  5ISR A;  2JA7 G;  2UXD L;  1UE7 A;  2ZJP A;  3PO3 H;  3GTQ H;  3M4O B;  3I90 A;  1WTQ A;  2KCC A;  2N88 A;  4B9W A;  1FGU A;  1EQV A;  2JN4 A;  3GTG B;  4P72 A;  2J0T D;  4DXG A;  1JJG A;  3J7Z C;  1EY6 A;  2F0W A;  2O2L D;  1PH8 A;  3PO2 G;  1Y1W B;  2LS0 1;  1YIJ A;  2KEE A;  4K6L A;  2GA4 B;  1LV9 A;  1E3P A;  3TP6 A;  1TS4 A;  3OIQ A;  1Q8K A;  5GRO A;  1L0X B;  4ZYS A;  4QGU A;  2A6H D;  4A3G H;  1PZJ D;  3OW7 A;  1IL2 A;  2E8G A;  3R8B A;  1ML0 D;  2F0S A;  2RDF A;  2QDL A;  3ND9 A;  5M5X H;  4A3B B;  3NTK A;  4LNQ A;  1V43 A;  3CCS A;  1IW7 C;  1SJH D;  1VQI A;  3KF6 A;  2F3W A;  2D9U A;  3G6E A;  3T4A C;  4EQ5 A;  3RZD H;  3K0X A;  1Y1V H;  3I70 A;  4K0K Q;  2UU9 Q;  4DV4 L;  3CRK C;  4DKA C;  1C7Y A;  2UUB Q;  3H15 A;  1PTO H;  1ESF A;  2UXC L;  3NTH A;  1XNQ Q;  1BDO A;  1OXU A;  4UAI A;  3OWE B;  2C35 B;  5IYD G;  1FGB D;  2BH2 A;  1STH A;  1SNO A;  5IIF A;  2PQA B;  2A74 C;  1EWC A;  2BA0 A;  4B3M Q;  3HKZ E;  2KQ3 A;  2XRS D;  4R4T A;  3I4N H;  2BDO A;  2I0Q A;  5E4W C;  3X3N A;  1QUQ B;  4KD4 A;  4V19 0;  1ENF A;  1PTO F;  1K28 A;  3RMH A;  1EYG A;  4JI4 Q;  3MHB A;  3S1N H;  4RGT A;  4GN5 A;  1AZQ A;  4DXF A;  1HNX L;  2DNE A;  4CJ2 C;  2FHT A;  2HIX A;  4WJ3 M;  4A3M H;  2OQK A;  1KL9 A;  2XIW A;  1C8C A;  1HR0 W;  1R9T H;  2A6H C;  1N36 Q;  1H9S B;  2H1E A;  1S5D D;  3MXP A;  3PIP A;  1PH2 A;  5FOB B;  4A3M G;  3MXN A;  4NXN Q;  2R92 H;  3BG3 A;  1RHP A;  1A2U A;  4DUZ L;  3E0E A;  4AH6 A;  1FL0 A;  4MN3 A;  4PG3 A;  1L1O A;  5CV6 A;  3W1B A;  5EKL A;  2HCC A;  2N78 A;  4X62 Q;  1IYU A;  3BDC A;  2WAQ B;  4PMB A;  4BWG B;  2F1M A;  2UUC Q;  2R93 H;  3HGB A;  2L4N A;  3QIA A;  5C6A A;  2LXJ A;  1NMF A;  1N34 Q;  1TWH B;  2CKZ B;  4KTA A;  2BDN A;  3S14 B;  5C3W A;  3LNN A;  1WVL A;  4KHP L;  3OIP A;  1PV4 A;  4JCV E;  1F9S A;  1IBL Q;  3GTK B;  2NVT B;  1HZC A;  4DR4 L;  3D4D A;  1G2S A;  4JVZ A;  1YNN D;  1RTO A;  4HMI A;  1H9R A;  4BY7 H;  2JYO A;  3HKZ B;  3SHL A;  2KVM A;  3SK5 A;  4C3I G;  3K5L A;  4GOP C;  4A93 B;  2FFK B;  3G48 A;  3BS1 A;  1RDP D;  5IGB A;  2OTJ A;  4N8X 1;  3CU7 A;  1CTM A;  2K6A A;  1Q82 C;  4GNX A;  3S2D B;  2BA1 A;  3VYS A;  1B44 D;  2WP8 J;  2R7Z B;  3E9H A;  1YBY A;  3R3O A;  1HHV A;  3CC2 A;  3K8A A;  1CQF A;  4IFD J;  4H13 C;  2PO4 A;  5CGK A;  1YNN C;  4QQB X;  3KBX A;  1TR5 A;  3NXW A;  1CHP D;  2CHB D;  2AQ3 B;  3GTM B;  2F0D A;  1I50 H;  5GAD C;  1B53 A;  2D0O A;  2VUM B;  1KNE A;  3I2Z A;  1VQB A;  4IPG A;  1HNW L;  1DON A;  4DR7 Q;  3NBI A;  3A8K E;  1LTG D;  1I50 B;  2E2J B;  4X3S A;  4U67 3;  3TME A;  4M1U B;  2AMC B;  4POF A;  3HOX H;  1MGS A;  4FVM A;  3K5M A;  4J15 A;  4KHV A;  3KK7 A;  5KGU A;  3HEJ A;  1IBM Q;  1VQA A;  3U50 C;  4DV6 L;  4DAP A;  2Q8R E;  4UP9 A;  2K5N A;  1O7I A;  4L5Q A;  5HGQ A;  1K73 C;  4AIM A;  4MTK A;  1UUP A;  1XXG A;  2QGQ A;  4RGN A;  5DEH A;  4CDC C;  5IY0 A;  1B70 B;  2VQE Q;  1SFO H;  2CW0 C;  3RN5 A;  1X6O A;  5HY6 A;  1SRU A;  2XWJ B;  2LFN A;  3DMU A;  3Q24 A;  1PHJ A;  5AFW A;  3CD6 A;  3AFQ A;  2F4V L;  1PFN A;  5T1G A;  3OMG A;  1SN8 A;  5M3F H;  1ET6 A;  2E2H H;  1TWG B;  3BU2 A;  3U9S A;  4GN3 B;  2EZV A;  1WD0 A;  3BJU A;  1HXY D;  1D5X C;  4P73 A;  4K5W A;  5FLM H;  2JSO A;  1AZP A;  4RWS C;  2F0F A;  4JI6 L;  3RNU A;  4OL7 A;  4DR6 L;  2RSO A;  4X3U A;  1CKM A;  3CKI B;  1T5X D;  1NJI C;  3VYR A;  4ZKB B;  2L9H A;  2EYM A;  4FP5 D;  4J6H A;  2F0G A;  4KHZ A;  1BNZ A;  2EDG A;  2B2W C;  1BO0 A;  1HCZ A;  1SMX A;  1TWF B;  1PXU A;  3KFU A;  4BBR H;  1PRT D;  3FDT A;  3M3Y H;  3URY A;  5M5W H;  2A6E C;  3TP7 A;  1VQC A;  2WII B;  2EE1 A;  4LFA L;  4DR6 Q;  1LO5 D;  5H1S E;  1Q86 C;  2WB1 E;  2PNH A;  2PMZ B;  3NBH B;  2ALY B;  1U9R A;  1KIX A;  3STB C;  2E75 C;  3EJI A;  2Y0S E;  2VUM H;  1KXL A;  1UAP A;  1FNU A;  3TS2 A;  3EFX D;  1VQF A;  3F2B A;  2K5H A;  4EQO A;  2BE5 D;  4DR1 L;  2EIF A;  1QCB D;  1PA6 A;  4K0K L;  2DNC A;  2EYL A;  4DK0 A;  5GQO A;  1PVO A;  3V05 A;  5C44 H;  3FEW X;  4P74 A;  4BA1 I;  3HKS A;  4WOR A;  5J39 A;  3NQI A;  1ILP A;  1D5Z C;  2E2I B;  1PRT C;  1VMP A;  1X56 A;  2Z9H A;  1R9T B;  2R7Z H;  4MIU A;  1CA5 A;  5C0X G;  3FRP B;  5EPL A;  2JJQ A;  3RR5 A;  3M9B A;  3RZO B;  5IP7 G;  2VB2 X;  5JPM C;  1ZXT A;  3OW2 A;  5F2D A;  3M4Q A;  3I73 A;  1XMO L;  3NWS A;  1ZYR D;  2JP1 A;  2N3S A;  3TRE A;  1UNS A;  1M8A A;  3HFZ B;  5EAY A;  3VDY A;  1Q1E A;  1XPU A;  3P75 A;  1FVI A;  4NPS A;  1S40 A;  1ASZ A;  1TS5 A;  3A7A B;  3QOL A;  4BXX G;  1JR0 D;  5E4X A;  2Z6B A;  2WAC A;  1EUJ A;  1LT4 D;  4DA2 A;  1WCM H;  3DEP A;  3HP3 A;  1G2T A;  4QMG A;  3VYT A;  3H3V C;  4ZUJ A;  4DR7 L;  3HOZ G;  3QB3 A;  4BXX H;  1JOR A;  1IBK L;  3PO2 B;  3WOE A;  3U58 A;  1WCM G;  1YHQ A;  1IBM L;  1C48 A;  3Q8D A;  2LXK A;  4DK6 C;  2MO1 A;  1RJT A;  1V1P B;  4DV2 Q;  1BKB A;  4YWL A;  4X6A H;  3Q23 A;  1BQQ T;  1JJC B;  2NZH A;  2WAQ G;  1E7Z A;  3PIP 3;  1TWC B;  3DM3 A;  2F0M A;  1ESR A;  3CP0 A;  2FMC A;  4RHR A;  4NXN L;  4A3G B;  3I56 A;  1YEZ A;  1A3U A;  4QIW E;  1QG7 A;  1F77 A;  4HJ7 A;  1WD1 A;  4GN4 B;  3ERO A;  1UWV A;  1EIF A;  1SMY D;  1J5E L;  1SJE D;  1I4H A;  1WFQ A;  5EBC A;  2YU9 B;  2R6G A;  4K5V A;  3S17 H;  2CH4 W;  3AYH B;  4IN3 A;  2ZJR A;  4IFD G;  2K75 A;  4DR3 L;  1IBL L;  3DXJ C;  1OO9 B;  5C3E G;  1VQG A;  2VW9 A;  1JQY D;  2B2Y C;  3BZD B;  1CQV A;  3CQZ B;  3HOU B;  2E2J H;  1ZYR C;  3GTL B;  2AWO A;  4DK3 C;  4LUZ A;  2VY3 A;  1WTR A;  1SMY C;  3HOV G;  2Y0S B;  2KUM A;  1WTW A;  1F9P A;  2JA6 H;  1GO3 E;  4KK7 A;  5IT9 L;  1WTO A;  2R7D A;  4JI0 L;  2IX0 A;  3HOX B;  1MIU A;  3T1Y L;  1EU4 A;  1SRO A;  4QB4 A;  2B2V C;  4A3C G;  2CQO A;  3BDO A;  3HOY G;  3J81 j;  2Q2T A;  1C0A A;  4R8I A;  1SYE A;  1CM9 A;  1XJV A;  1VF5 C;  1AFP A;  2GVA A;  4DR1 Q;  1H9S A;  1U4L A;  1DOM A;  4DAY A;  4DAM A;  4DV1 Q;  4ODG A;  5FLX L;  1E0B A;  2Z4H A;  4LF6 L;  4EQP A;  1TWA H;  2ZXR A;  3P7J A;  1X3Q A;  2MUY A;  4OO1 H;  4BY7 B;  1EOT A;  3MEH A;  4RKL A;  2F0L A;  1BBW A;  3GTO H;  1PTO D;  1M4V A;  3W5O A;  1LAC A;  3C1F A;  2NYZ D;  3L0O A;  5EBD A;  5C0X I;  4DV6 Q;  4ID6 A;  5J22 A;  4A93 H;  5C4X G;  1KHI A;  2RSN A;  1KLU D;  3EIV A;  5IGD A;  4JI6 Q;  4JBJ A;  4JI2 L;  4LFB L;  4XTC S;  4YHH L;  1K0S A;  1YJN A;  4BBS G;  1CSP A;  2ZJQ A;  4EVO A;  3TZD A;  3QOJ A;  4KN4 C;  1X55 A;  2QKI C;  1SNC A;  1QVC A;  3PIO A;  3CMA A;  1JCK B;  1DOK A;  1N33 L;  1R4Q B;  4IOC A;  2Z1C A;  3IFD A;  4R4Q A;  2N49 A;  5I6Y A;  3BVM A;  4J1M A;  2UXB L;  2I5L X;  1EY0 A;  5AJ3 L;  1G6Z A;  3KLS X;  4CDF C;  3H0G H;  4HED A;  1FNV A;  2MHV A;  3LWU A;  5NUC A;  3BDL A;  1KDC A;  4IUT A;  3BYY B;  3GD7 A;  3K57 A;  1SAP A;  5C4J H;  3UDG A;  4DAY B;  3S2H H;  1CI3 M;  2UUA L;  1BOS A;  3I7F A;  4B3T L;  2B2T A;  5E7N A;  2F0H A;  1WTV A;  2EXZ A;  3FKI B;  4NXM L;  3TRZ A;  1BR9 A;  3QJY A;  1WTH A;  5GAG C;  3I4M G;  3SGI A;  3GQB A;  5FO8 B;  4GNX B;  1PH6 A;  1XNR L;  1N34 L;  5JVG 3;  1RF2 D;  2D2C C;  5IYD H;  2JA5 B;  2IT1 A;  2K52 A;  2VQF L;  1IKM A;  4DPG A;  2I46 A;  5COR A;  1W6J A;  5FLX c;  2YTX A;  3EA6 A;  1FYC A;  4V0B A;  2JA5 H;  2RBM A;  1HTL D;  1K0R A;  3S1R H; 
#chains in the Genus database with same CATH homology
 1QVF A;  1Y1V G;  4DV3 Q;  1HR0 W;  1R9T H;  1C9O A;  5AJ3 Q;  3NEM A;  1N36 Q;  2OTL A;  2KCM A;  4OWW B;  3I4M H;  4IPH A;  3HOW H;  4KHP Q;  3PIP A;  1PH2 A;  3PO3 G;  1N9W A;  4DUZ Q;  4A3M G;  1N8R C;  4NXN Q;  1VQ8 A;  4ME3 A;  2R92 H;  3UDI A;  3AFP A;  4DUZ L;  3S15 H;  4DR2 L;  1UE5 A;  1X3E A;  3E0E A;  4AH6 A;  1PH1 A;  1FL0 A;  4JI7 Q;  3PV0 A;  2JE6 I;  2L15 A;  4PG3 A;  1L1O A;  1VQO A;  4JBM A;  3W1B A;  3CCE A;  3AEV A;  3NEL A;  4JG2 A;  2AKW B;  2JA7 H;  3H3V H;  4GS3 A;  2N78 A;  4X62 Q;  3EN2 A;  3NEN A;  4Y52 H;  4OXP A;  2PMZ E;  1U0L A;  1HNX Q;  4JYA Q;  1KRS A;  1Y1W G;  2UUC Q;  3ULL A;  2R93 H;  2NVX H;  1YHB A;  2N8N A;  3UDX A;  1MKH A;  4YCW A;  1YJW A;  1HR0 Q;  2F3I A;  2CCZ A;  2LXJ A;  1NMF A;  1N34 Q;  4OWX B;  2CKZ B;  3W1G A;  4A4I A;  4B3R Q;  4A3L G;  5FLM G;  4KHP L;  5C0X J;  1PV4 A;  4JCV E;  3TEH B;  4EX5 A;  3GTG H;  1YHA A;  4NB3 A;  4A3E H;  1IBL Q;  3PF4 A;  1HZC A;  5M3F G;  4DR4 L;  2D0P A;  1YI2 A;  3F2D A;  1X3F A;  1HZB A;  1QZG A;  4BY7 H;  3JAM i;  2UU9 Q;  3S24 A;  4AQY L;  3PO2 H;  4BA2 I;  3GTJ H;  3BZC A;  3WWV A;  2UXD Q;  3U4Z A;  5M3M G;  1S72 A;  1V1Q A;  2ATW A;  3T1H Q;  2NVT H;  1UE6 A;  4GOP C;  3ICE A;  3G48 A;  3CW2 C;  5IP9 G;  3BZK A;  3KJP A;  4HIK A;  2OTJ A;  4DV7 L;  1Q82 C;  2JA8 G;  4JI2 Q;  4GNX A;  2BA1 A;  3KF6 B;  4DR4 Q;  2WP8 J;  2VNU D;  3E9H A;  1YBY A;  3U4V A;  1Y1W H;  1VQE A;  3J7A 5;  3CC2 A;  1TXY A;  4YWK A;  3GDE A;  1XMO Q;  1GD7 A;  3K8A A;  4IFD J;  1I94 L;  3CPW A;  2MQH A;  2Q2I A;  4RMF A;  2UUC L;  4PZ8 A;  4QQB X;  5FJ8 G;  4LF7 L;  2EQS A;  4A3K G;  4AYB E;  2RHS B;  4C3I H;  2ES2 A;  3I4N G;  2Z6K C;  4XIG S;  4H02 A;  4P71 A;  1L1O C;  5IP9 H;  4DV5 L;  2PI2 E;  1I50 H;  5GAD C;  4IOA A;  4IJH A;  2D0O A;  2R7F A;  1W2B A;  3I2Z A;  4X64 L;  1JJ2 A;  1WI5 A;  1VQB A;  2NVY H;  3TQY A;  4IPG A;  4X65 L;  1HNW L;  1VQH A;  3CC7 A;  4DR7 Q;  2A1A A;  1I3Q H;  5IYC G;  2UUA Q;  4DV1 L;  4PZ7 A;  1EQR A;  3CC4 A;  4LF4 Q;  4A3E G;  1YJ9 A;  4A3D G;  2AMC B;  4JOI A;  1VCI A;  3IRB A;  4POF A;  3HOX H;  1QUQ A;  1YIT A;  4O2D A;  2JA8 H;  4J15 A;  3CCL A;  4GKJ Q;  4JI5 L;  4A3K H;  4HIO A;  3M7N A;  1M1K C;  2JQO A;  3L7Z C;  4BBR G;  1X54 A;  1IBM Q;  4X64 Q;  2NZO A;  2JK8 A;  1VQA A;  4IPC A;  4FDB A;  3U50 C;  4DV6 L;  2YYZ A;  4GOP B;  3S1M H;  4UP9 A;  1SR3 A;  1E1T A;  4A3B H;  2K5N A;  1O7I A;  3KLW A;  4L5Q A;  5HGQ A;  4A93 G;  2PQA A;  2QA4 A;  4DR2 Q;  2I5H A;  3ERS X;  2E5L L;  2Y0S G;  1K73 C;  1I5F A;  4OO1 I;  4AIM A;  2KBN A;  1Q7Y C;  1V9P A;  2GVB A;  2QGQ A;  1L0W A;  4X66 Q;  1SE8 A;  1HNZ Q;  3STB D;  5IY0 A;  1B70 B;  2VQE Q;  1J5E Q;  1SFO H;  2YTV A;  5IT9 c;  1KAW A;  3RN5 A;  1X6O A;  2Z0S A;  2GN5 A;  5HY6 A;  1SRU A;  2LSS A;  4IFD I;  5JJI A;  5M3M H;  1A63 A;  4LFB Q;  4Y7N H;  1PHJ A;  2YU9 H;  1Y14 B;  3CD6 A;  3AFQ A;  2A19 A;  2F4V L;  1N32 L;  3MXN B;  4JI5 Q;  1SN8 A;  3KYH C;  3HOU H;  2JA9 A;  3EBE A;  3D31 A;  3T1Y Q;  4MTN A;  1TWF H;  5M3F H;  2E2H H;  3A74 A;  4LF9 L;  3BU2 A;  1K8G A;  4GN3 B;  1HJP A;  3BJU A;  5LMN W;  2DGY A;  4HJ9 A;  1KQS A;  1EIY B;  2UXB Q;  2R7Z G;  2K50 A;  2V1C C;  4P73 A;  3CCQ A;  3A5U A;  4YCV A;  5IWA L;  5FLM H;  1EQQ A;  3LGJ A;  1XNR Q;  5IE8 A;  4JI6 L;  4X65 Q;  1XNQ L;  3RNU A;  3S14 H;  3D0F A;  1P16 A;  4JI3 L;  2IX1 A;  4DR6 L;  1LYL A;  1E22 A;  1IYJ B;  1X65 A;  1CKM A;  2HIV A;  1NJI C;  4JI3 Q;  5BR8 L;  2YTY A;  2UU9 L;  3OTO Q;  2VQE L;  2Q2H A;  4OX9 L;  1NTG A;  2B29 A;  4KHZ A;  4QL5 A;  1Q81 C;  1XMQ Q;  1H95 A;  4APV A;  5M5Y H;  1SMX A;  4OX9 Q;  3KFU A;  1BBU A;  3PCO B;  3RN2 A;  4BBR H;  2QEX A;  2IY5 B;  2ZTC A;  3M3Y H;  4C2M H;  3CCM A;  1LUZ A;  5M5W H;  1Q1B A;  1VS0 A;  5JEA J;  1VQC A;  1JT8 A;  3CCV A;  4LFA L;  4A3J H;  1WJJ A;  4DR6 Q;  4A3D H;  5H1S E;  1Q86 C;  2WB1 E;  2R92 G;  3HOZ H;  1AH9 A;  2PNH A;  3NBH B;  3ZJY C;  2ALY B;  2YV5 A;  4DV7 Q;  1K83 H;  1KIX A;  4POG A;  1VQM A;  3STB C;  2UXC Q;  4WJ4 A;  1CUK A;  2Y0S E;  1GVP A;  2VUM H;  3TS2 A;  1KXL A;  1VQF A;  3F2B A;  2HT1 A;  2K5H A;  2JEA I;  4DR1 L;  4DR5 Q;  2EIF A;  1ASY A;  4K0K L;  1PA6 A;  1HNZ L;  2ZTD A;  5GQO A;  1X9N A;  1PVO A;  1DGS A;  5C44 H;  4P74 A;  4BA1 I;  1IXR A;  1JE5 A;  1G51 A;  1OXV A;  2KCT A;  3HKS A;  5IYB H;  4R1J A;  4GKK Q;  3U58 A;  4IPD A;  3K81 C;  4JI1 L;  1VQN A;  1HNW Q;  3KOJ A;  3GTL H;  4B3S L;  3B6Y A;  4GOP A;  4HJ8 A;  1X56 A;  1PH3 A;  3J81 c;  1P8L A;  4OWT B;  4YY3 L;  2R7Z H;  4X66 L;  4UP8 A;  5C0X G;  3F1Z A;  1A62 A;  4HJ5 A;  2JJQ A;  3RR5 A;  3M9B A;  3HOY H;  5IP7 G;  4LF7 Q;  4HJA A;  1EOV A;  2HQL A;  2VUM G;  1NY4 A;  1CKN B;  3I4O A;  3OW2 A;  1VQ4 A;  3KDF A;  2MFI A;  3M4Q A;  4P75 A;  4BY1 G;  3TS0 A;  1XMO L;  1PH7 A;  2N3S A;  3S1R H;  1VQP A;  5C3E H;  3HOX G;  4A3J G;  4DUY Q;  1UE1 A;  3TRE A;  2CWA A;  3HFZ B;  5IYB G;  1PFS A;  5EAY A;  3VDY A;  5K36 G;  1Q1E A;  4X62 L;  1XPU A;  3PSI A;  4MZ9 A;  1FVI A;  4AYB G;  3RZO H;  4NPS A;  1NBW A;  3CQZ H;  1S40 A;  2VZA A;  3FKI G;  1ASZ A;  4A3B G;  4DV5 Q;  2CFM A;  2KHJ A;  4BXX G;  1KRT A;  2K4K A;  2KEN A;  3S2D H;  4JI1 Q;  1EUJ A;  1RIP A;  3CF5 A;  1WCM H;  1XMQ L;  1KC8 C;  1IZ6 A;  1YVC A;  3RLO A;  1Q12 A;  4DR7 L;  3HOZ G;  4BXX H;  1GKH A;  1MJC A;  1IBK L;  4KLK A;  2E5L Q;  4JOI C;  1E24 A;  2MO0 A;  2NVQ H;  1UEB A;  3KF8 B;  4L5T A;  1RL2 A;  1WCM G;  2NN6 G;  4QJF A;  4R4O A;  4DV3 L;  3PUW A;  3HKZ G;  4MNO A;  3CCR A;  1PH4 A;  4A3G G;  1YHQ A;  4JYA L;  1IBM L;  2FXQ A;  3Q8D A;  1B7Y B;  1CSQ A;  2LXK A;  2MO1 A;  3PUV A;  4DK6 C;  4BY7 G;  4DV2 Q;  3CCJ A;  5JJL A;  1BKB A;  4YWL A;  4IJL A;  4X6A H;  4IO9 A;  1K3R A;  2PI2 A;  4DV4 Q;  2Q2U A;  1JJC B;  2ID0 A;  2NZH A;  1HR0 L;  1TWH H;  2WAQ G;  1E7Z A;  2OQ0 A;  1B8A A;  1K8A C;  4A3C H;  3DM3 A;  4LF8 L;  3CP0 A;  4UP7 A;  4JI8 Q;  4NXN L;  3I56 A;  1YEZ A;  1SLJ A;  4TQU S;  5C44 G;  1N32 Q;  4QIW E;  5JJK A;  5JEA G;  3OTO L;  3L2P A;  5IP7 H;  4JV5 L;  4A76 A;  4HJ7 A;  3JC6 6;  4GN4 B;  3RLF A;  3S1Q H;  1UWV A;  4JI0 Q;  4R4C A;  3T1H L;  1EIF A;  1K9M C;  1N33 Q;  1J5E L;  4B3T Q;  4UPA A;  3OYY A;  1TWC H;  2KHI A;  1EWI A;  1E1O A;  1LTL A;  1WFQ A;  4DNI A;  5IYC H;  1XPO A;  4B3M L;  2R6G A;  3S17 H;  2OWO A;  1LM0 A;  1A8V A;  3AYH B;  2ZJR A;  4IFD G;  2K75 A;  2WFW A;  3G71 A;  5DLQ E;  4DR3 L;  1JMC A;  1WYD A;  1N36 L;  1I6H H;  1IBL L;  4YWM A;  2VS1 A;  2XGT A;  1VQ7 A;  1L2F A;  3H0G G;  4JBW A;  5C3E G;  1VQG A;  4OON A;  2VW9 A;  2ZM6 Q;  4LF6 Q;  4BBS H;  2WB1 G;  4LW1 A;  4A3F H;  3GTP H;  4LFC Q;  1G6P A;  1PYB A;  3K80 C;  2MNA A;  3F2C A;  4JI8 L;  1VQL A;  1OXS C;  2E2J H;  1CKN A;  2HHH Q;  1FJG Q;  3CME A;  4JBK A;  2E2I H;  5GAE C;  3DLL A;  3FKI H;  2AWO A;  4DK3 C;  1IBK Q;  4LUZ A;  2B63 G;  2VL6 A;  2VY3 A;  3FHW A;  3HOV G;  4GLV B;  1CKO A;  1U5K A;  4GKK L;  2JA6 H;  3JAM c;  4A3F G;  1GO3 E;  4JI4 L;  2B3G A;  2IHE A;  4HIM A;  2AWN A;  4LF9 Q;  3UDF A;  4GNX C;  3S16 H;  4UY8 C;  3ULP A;  1YZ6 A;  2R7D A;  1OXX K;  2F52 A;  4C3H H;  3G4S A;  4JI0 L;  2IX0 A;  5LMN Q;  1L1O B;  1MIU A;  3T1Y L;  2ZTE A;  1SRO A;  4OO1 G;  4YCU A;  3PUY A;  1OXT A;  1PH9 A;  2CQO A;  1VQ9 A;  4A3C G;  1PYS B;  1JB7 A;  3HOY G;  2BH8 A;  5IWA Q;  3J81 j;  1BVS A;  1HZ9 A;  2WAQ E;  3M85 A;  2Q2T A;  1C0A A;  3ER0 A;  4A3I G;  4LF8 Q;  4KI0 A;  3ULJ A;  5J3B A;  1XJV A;  4R4I A;  2VQF Q;  1NMG A;  1AE2 A;  2GVA A;  3A5Z B;  2Z6K A;  3I55 A;  3CCU A;  4DR1 Q;  4DR5 L;  1Q46 A;  1J6Q A;  4DAM A;  4DV1 Q;  1FJG L;  3RLN A;  5C4X H;  5FJ8 H;  4PMW A;  4RG1 A;  2ZM6 L;  4LF6 L;  3GO5 A;  5ELO A;  4DV0 L;  1TWA H;  2CWP A;  3FP9 A;  4B3S Q;  5LMN L;  1QVG A;  2B63 H;  2UUB L;  1G29 1;  1Z47 A;  1VQ5 A;  1HH2 P;  2JA7 G;  2UXD L;  4LF5 Q;  1UE7 A;  2ZJP A;  3PO3 H;  3GTQ H;  1BBW A;  3GTO H;  1Z9F A;  3W5O A;  4A75 A;  3CAM A;  1FGU A;  4P72 A;  1VQK A;  1XTD A;  4O0A A;  3L0O A;  5BR8 Q;  5C0X I;  4DV6 Q;  1JJG A;  3J7Z C;  4A93 H;  5C4X G;  1KHI A;  2K14 A;  2XTI A;  1PH8 A;  2JEB I;  2F4V Q;  3EIV A;  4JI6 Q;  3PO2 G;  4JBJ A;  4JI2 L;  1YIJ A;  4LFB L;  4PZ6 A;  1E3P A;  4DUY L;  3J80 i;  4GLA C;  4XTC S;  4YHH L;  4A3I H;  2RHQ B;  3PUX A;  1YJN A;  4BBS G;  4TVA B;  1Q8K A;  1CSP A;  5GRO A;  2ZJQ A;  1KL9 A;  1VQD A;  4QGU A;  1X55 A;  1QVC A;  3PIO A;  3KJO A;  4A3G H;  4AQY Q;  1IL2 A;  2E8G A;  2RCN A;  3AQQ A;  3MEF A;  3CMA A;  2RF4 A;  2JA6 G;  4GLX A;  1N33 L;  1W3S A;  2H5X A;  5M5X H;  1HZA A;  1GM5 A;  4LNQ A;  5ELN A;  1V43 A;  3PUZ A;  4IOC A;  3CCS A;  2R93 G;  4JV5 Q;  4JI7 L;  3GTK H;  2EXD A;  4C3J H;  1VQI A;  1EFW A;  1D7Q A;  4R4Q A;  3KF6 A;  3J81 i;  2A8V A;  1A0I A;  3G6E A;  3HOU G;  4EQ5 A;  2N49 A;  1X3G A;  3K0X A;  3RZD H;  3K7A H;  1KD1 C;  3A0J A;  1Y1V H;  1I94 Q;  2UXB L;  2I5L X;  1QZH A;  4A3L H;  3M4P A;  4LF5 L;  4K0K Q;  4L5S A;  2OCE A;  4LWC A;  5AJ3 L;  4DKA C;  4DV4 L;  1AE3 A;  4HID A;  4YHH Q;  1C7Y A;  2UUB Q;  4LUO A;  3PGZ A;  3H15 A;  2ASB A;  3H0G H;  1NE3 A;  4LFC L;  5GAH C;  2UXC L;  3UE1 A;  2IHF A;  4DV2 L;  1XNQ Q;  3CPF A;  4GKJ L;  4LFA Q;  1OXU A;  3UE0 A;  5LMU L;  2C35 B;  3KDF B;  5IYD G;  3K7U C;  4DR3 Q;  1TWG H;  3GTM H;  3GD7 A;  2BH2 A;  5C4J H;  3M4O H;  3UDG A;  4DAY B;  3S2H H;  1YNX A;  2I5M X;  2PQA B;  2AHO B;  3CXC A;  2UUA L;  2BA0 A;  4B3M Q;  3HKZ E;  2JA5 G;  1T9H A;  1PH5 A;  4B3T L;  3I7F A;  4R4T A;  5E7N A;  3I4N H;  3F8T A;  4NXM L;  3H3V I;  3TRZ A;  2HHH L;  2I0Q A;  4BY1 H;  2DUD A;  4L5R C;  4NXM Q;  5GAG C;  1QUQ B;  3HOW G;  3I4M G;  4QY7 A;  3SGI A;  4GNX B;  1OTC A;  1VQJ A;  3HOV H;  1VQ6 A;  1PH6 A;  4B3R L;  1M90 C;  1XNR L;  1XPR A;  1MJE A;  3J80 c;  1N34 L;  1EYG A;  4JI4 Q;  2K5V A;  5IYD H;  3PF5 A;  1D8L A;  2IT1 A;  4LF4 L;  2K52 A;  3S1N H;  2NN6 I;  1S3O A;  2VQF L;  4JC0 A;  4GN5 A;  4DPG A;  4LUV A;  5FLX c;  5LMU Q;  3E9I A;  1HNX L;  2YTX A;  4DV0 Q;  2HIX A;  2D62 A;  2JA5 H;  4WJ3 M;  4YY3 Q;  4A3M H;  1K0R A;  2OQK A;  1WOC A;  4ALP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...