2LXKA

Backbone 1h, 13c, and 15n chemical shift assignments for cold shock protein, lmcsp
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
66
structure length
66
Chain Sequence
MEQGTVKWFNAEKGFGFIERENGDDVFVHFSAIQGDGFKSLDEGQAVTFDVEEGQRGPQAANVQKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Cold shock-like protein CspLA
publication title Structural and Dynamic Features of Cold-Shock Proteins of Listeriamonocytogenes, a Psychrophilic Bacterium
pubmed doi rcsb
source organism Listeria monocytogenes
total genus 10
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2012-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2lxkA00
1LUZA 1N34Q 3A5UA 2ZTDA 4QL5A 1IL2A 4BY7G 1PYSB 2K4KA 3K7AH 3EN2A 5C44G 1AH9A 2R93G 2IT1A 3JC66 2MNAA 3I4NH 3K7UC 3GDEA 1WFQA 3KOJA 3TEHB 3L2PA 5LMNW 4HIKA 2MQHA 1KIXA 2NVXH 2JA7H 4DV2Q 1G51A 3TS2A 4X65L 4A3GH 2BA0A 4OO1G 1C0AA 2R7ZH 1HH2P 2NZOA 1AE2A 2LSSA 3PV0A 4YCWA 4HJ5A 2XGTA 4LFAL 4A3MG 2AKWB 4UPAA 5C4XH 2UUBQ 4L5SA 5C0XJ 4OWXB 3J80i 2CQOA 3PUZA 1E1OA 2ZJQA 2IHEA 1KHIA 1V1QA 3CCRA 1P8LA 4YHHL 4DR5Q 1BKBA 2UXBQ 1TWHH 1UE7A 4OXPA 4BBRH 2HIVA 3FHWA 2Z6KA 3F2DA 1IBLL 3F1ZA 1I94L 3I4NG 4BA1I 3PF5A 4A3DH 3W5OA 4NXNL 1VQIA 1J5EQ 2JA6H 2PNHA 1E24A 2JA7G 1N36Q 3Q8DA 2N8NA 3RZOH 3D31A 3FKIH 3BJUA 3U4VA 1XPRA 1K8AC 1M90C 1VQDA 4LF8Q 2R7ZG 3S14H 2E8GA 4JI0L 4L5TA 3IRBA 2ZTCA 4IJHA 5IT9c 2VW9A 4A3IH 4DV0Q 2OWOA 4LF4Q 2FXQA 3S1NH 3TRZA 2R7FA 1BBWA 1UE1A 1ASYA 4JYAL 2ATWA 3B6YA 5C4XG 1X65A 1VQOA 1VS0A 2QEXA 1EIYB 1WJJA 1GKHA 4C3JH 4DV3L 4LFCQ 4DR2L 2VNUD 4WJ4A 4BBRG 4DV7L 1Q81C 3TS0A 3HKZE 3BU2A 5M3FH 1CKNA 3ULLA 1V9PA 1PHJA 4A3DG 4LFBL 1JJGA 4KLKA 4FDBA 3KDFA 3G71A 4J15A 1K8GA 4JI2Q 2MFIA 3AYHB 3OW2A 4UP9A 2JA6G 3ICEA 3FKIG 2JA9A 4A3GG 2E2JH 3KYHC 3A0JA 4A3IG 3EIVA 1QZHA 3I56A 3S2HH 1C7YA 5JJKA 3L0OA 3HKZG 3W1GA 2MO1A 4GNXA 1KC8C 1Y1VH 2WAQE 5GADC 4B3TL 1Q12A 1KRTA 1I5FA 2K5NA 4DK3C 3UDXA 2E2IH 3T1YL 1HZ9A 2VUMH 2VQEQ 2K75A 3NEMA 1N33Q 4P71A 1SE8A 3S15H 1NMGA 5M3FG 4HIOA 1PV4A 2Q2TA 4JI5L 1TWFH 4BBSH 1YI2A 4BBSG 1QVCA 2WAQG 4LF6L 4DK6C 1BVSA 5C4JH 1YBYA 1VQFA 2NN6G 1X55A 1Y1WH 4JOIC 5BR8L 4YCVA 4LUZA 1K73C 1GM5A 1OXVA 2ZJRA 1HR0W 1E7ZA 1B8AA 1Y1VG 1N9WA 2KCMA 5J3BA 2AMCB 2QGQA 1KAWA 1YNXA 2K50A 5LMUQ 4AQYQ 1PH5A 1JJ2A 5E7NA 4LF9L 1XNQL 3AEVA 4GOPC 2VUMG 2N49A 2UXCL 1G291 4NB3A 4P72A 4JBMA 4XIGS 4GKJQ 4A93H 3GTKH 2VL6A 3KF6B 4IO9A 1EFWA 4DKAC 3AFQA 5GAHC 1HR0Q 1W2BA 4Y52H 1PH2A 3ULJA 4X64Q 3S2DH 1XNRL 2RF4A 4XTCS 3M4QA 2E5LL 1Y1WG 1N32Q 2Q2UA 3CCUA 4DV5L 3RLOA 1U0LA 2EIFA 1L0WA 3DLLA 2IHFA 4NPSA 4DV6Q 1UWVA 4AIMA 1IXRA 2UXDQ 2Y0SE 1CSQA 2OCEA 2R7DA 3TQYA 4JBWA 4YWMA 1H95A 4JI4Q 2V1CC 3RR5A 2CFMA 1Q82C 3CCMA 2GN5A 4JI8Q 3F8TA 5IWAL 4K0KL 1OXXK 1QUQB 4A93G 4JI1L 1VQNA 5IYBH 1XPUA 4B3RQ 2DUDA 2PQAB 4GN5A 2YTXA 3GTJH 2Q2IA 2Y0SG 2YU9H 1X3FA 4KHPL 4OONA 4DR7L 3PO2H 1HNXL 2HHHL 4OX9Q 1X54A 2L15A 3A74A 2ZM6L 2GVBA 3PUYA 3H3VH 4DR4L 4QQBX 1T9HA 2UXCQ 1VQ7A 1IBML 2NVTH 4DR1Q 5AJ3Q 1NBWA 2WP8J 4R4IA 4JBJA 4A3JH 1K3RA 5C0XI 3PUVA 1VQGA 1V43A 4QJFA 4GOPB 2AWOA 3K80C 1YHQA 4B3SL 5IYBG 4AYBE 1EIFA 1G6PA 4QGUA 4A3FH 1A62A 1QZGA 1C9OA 1RIPA 2CCZA 3PO2G 4OWWB 2AWNA 1Y14B 2JJQA 3I55A 1WOCA 5JEAG 4LF5Q 2ES2A 2UU9L 1LTLA 4IPCA 5C3EH 3J7ZC 2R6GA 1ASZA 4AYBG 4X66Q 3A5ZB 1X56A 4PG3A 4JCVE 4A4IA 3CPWA 1HNWQ 4A3JG 2NN6I 3ERSX 1CKOA 1OXSC 2LXJA 4JI3L 4B3ML 3HKSA 3G4SA 2UUCQ 1X9NA 3KFUA 4YY3L 2EQSA 1HNZL 4A3FG 3CPFA 1Q46A 3I4OA 1PH4A 2JQOA 4JI7L 1XMOQ 1VQ9A 4DR6Q 2GVAA 2F52A 2BH2A 3CCVA 5JJLA 1PYBA 4HIDA 3UDFA 4KI0A 4HJ7A 1M1KC 3HOVH 5C3EG 4A3LH 3CD6A 4TQUS 1JB7A 3CMEA 2PI2E 1SFOH 4POFA 1GVPA 2N3SA 4X62L 1PH6A 1YHBA 1TWGH 3TREA 2D0OA 4B3SQ 1GD7A 3M7NA 4WJ3M 2MO0A 3KJPA 4A3KH 3CCJA 1YITA 4X65Q 5M5YH 1OXTA 3AFPA 5M5WH 1CUKA 1XMQL 2NZHA 2I0QA 4BY1H 4HJ9A 1AE3A 4IPHA 4LFAQ 3HOVG 4A3LG 4QY7A 1JE5A 5C0XG 2EXDA 2IX1A 4GLAC 3E9IA 4MZ9A 3JAMc 2QA4A 3F2BA 3GTPH 4YHHQ 4DNIA 1X3GA 3S1RH 4GKKL 1IBLQ 4UY8C 2ID0A 3CP0A 1I94Q 3PGZA 2YYZA 3I2ZA 4DV4L 4A76A 1HNZQ 4LUVA 5DLQE 1Z9FA 4NXNQ 4A3KG 4ME3A 4BY1G 3VDYA 1PFSA 1L1OA 1FGUA 4DUYL 4JI0Q 1K0RA 3S24A 3PF4A 4JI6L 3HOUH 2KHIA 2K52A 1LM0A 4JG2A 2IY5B 4JYAQ 1QVGA 3S17H 2HIXA 4RG1A 2YTVA 3H15A 1FVIA 3L7ZC 4DV3Q 1IBKL 1MIUA 1VQ5A 1O7IA 4DR2Q 3CC2A 1CKNB 1TWAH 4DR3L 3LGJA 3PUWA 3KDFB 4MNOA 4EX5A 5M5XH 4DV7Q 2NVQH 3H3VI 4LFBQ 3CQZH 1YHAA 2BH8A 2F4VL 2VQFL 1MJCA 1KQSA 1S72A 3MEFA 3HOZH 1VQ8A 1K83H 1MKHA 1PH9A 3KF8B 3S1MH 1S3OA 5K36G 3KLWA 4HJ8A 5GQOA 2VS1A 2JEBI 2NVYH 1WI5A 3HOUG 2Z0SA 1YIJA 4NXML 1PH8A 1I6HH 1FJGQ 4O0AA 2PQAA 4UP7A 3GO5A 3HOXH 4B3TQ 4LF7L 3T1YQ 1VQAA 1EWIA 4IFDJ 4KHZA 4PZ7A 4DUZL 2D62A 1B7YB 4JI5Q 3UDGA 3NELA 2CWAA 4DV1L 4LF6Q 3HOZG 1DGSA 3CCSA 4IOAA 4JI6Q 1N34L 1Q1EA 3JAMi 1D7QA 4C3IH 3AQQA 4PZ8A 5BR8Q 1SLJA 4ALPA 1VCIA 1B70B 1KD1C 1IYJB 3EBEA 2WB1E 4GN4B 1EUJA 1E1TA 3HOXG 4DV2L 1NY4A 4LF9Q 4A3BH 1TXYA 1XNQQ 1KRSA 3CMAA 3M9BA 2OQKA 4RMFA 3RN2A 3D0FA 3CF5A 3GTOH 1VQEA 3J81c 2UUBL 5LMNL 2WB1G 3H0GH 4C3HH 3CC7A 1WCMH 1A0IA 1VQJA 4TVAB 1BBUA 3CXCA 4L5RC 2E2HH 4GLXA 4LUOA 1XNRQ 1CSPA 4HJAA 2I5HA 1SN8A 2HQLA 4YWLA 4DR5L 2E5LQ 4BA2I 2UXBL 5EAYA 3G6EA 4DV5Q 1VQMA 4EQ5A 2K5VA 3PUXA 1J5EL 3KJOA 2OQ0A 4DPGA 1UE6A 3UE1A 2JA5H 4A3BG 4LF8L 2Z6KC 1FL0A 2B3GA 2BA1A 3CCLA 3OTOL 2F3IA 3DM3A 1Z47A 3UE0A 1VQBA 5IWAQ 4LF4L 4QIWE 4DV0L 4K0KQ 1XJVA 4DV1Q 3OYYA 1VQ6A 4JI1Q 2A8VA 1EYGA 3H0GG 2RCNA 5IY0A 1WCMG 2VZAA 1HZBA 1U5KA 4LFCL 2JE6I 1Q7YC 4KHPQ 5HY6A 4DR7Q 1HNXQ 2HHHQ 2ZM6Q 1HZCA 1J6QA 2JA8H 1RL2A 3BZCA 3E9HA 4O2DA 1R9TH 2JEAI 4DR4Q 1SMXA 3T1HL 3GTGH 1SROA 3W1BA 3PCOB 2YTYA 2JA5G 4JI2L 1IBMQ 3ZJYC 3FP9A 1NTGA 5LMNQ 1VQ4A 1PH1A 3WWVA 1VQCA 1SR3A 2ALYB 1HZAA 1Q8KA 5FJ8H 2D0PA 4C2MH 4A3CH 2VQEL 4GNXC 1PVOA 2AHOB 1YVCA 1N33L 4A3EH 5ELNA 2K14A 1NJIC 2UU9Q 2JA8G 2A1AA 3GTQH 1D8LA 3U58A 3ER0A 3STBD 3J81i 3OTOQ 4LWCA 3J7A5 2ASBA 1PA6A 1UE5A 4R4TA 2PMZE 3G48A 4JI3Q 5IP9H 3HOWH 1L1OC 1S40A 4BXXH 4B3MQ 3S16H 2B63H 3STBC 4R4QA 1FJGL 3HFZB 3PIPA 5LMUL 1X6OA 1UEBA 4AH6A 4YY3Q 3F2CA 4HIMA 5FJ8G 4AQYL 2KBNA 1YJWA 1N8RC 4A3CG 4JI7Q 4JV5L 4A3EG 4GKJL 3T1HQ 4YWKA 4GLVB 2KHJA 1VQKA 1HJPA 2VY3A 2ZJPA 1L2FA 3ULPA 4Y7NH 1I3QH 1HR0L 3K0XA 3CCQA 3GTLH 1A8VA 3KF6A 4X64L 4PMWA 5H1SE 2YV5A 4X62Q 2ZTEA 1JT8A 1X3EA 3E0EA 5GROA 1IZ6A 4P74A 3J81j 3I4MH 2R92H 1N32L 1I50H 5IP9G 2WFWA 3HOWG 1CKMA 2LXKA 1OXUA 4L5QA 4BXXG 4LW1A 2B63G 3PIOA 4P73A 2DGYA 4JC0A 4DV6L 4R4OA 3M3YH 4IFDI 3K8AA 4YCUA 2UXDL 3CW2C 4JI4L 3PO3H 3I7FA 1XMQQ 2XTIA 1P16A 3MXNB 2I5MX 4JI8L 5FLMH 1EQRA 2OTLA 3RN5A 1TWCH 4GS3A 3U4ZA 5M3MH 4GNXB 1EOVA 4B3RL 1E3PA 3RZDH 5FLXc 1QUQA 5GAEC 1XPOA 3RNUA 2K5HA 3HOYH 4H02A 3S1QH 3RLNA 2CKZB 1KXLA 1KL9A 1XTDA 2I5LX 1K9MC 4P75A 1NE3A 1W3SA 1MJEA 3I4MG 1VQLA 4OX9L 2R92G 4GKKQ 2JK8A 1JJCB 1EQQA 2H5XA 2Q2HA 5ELOA 4DV4Q 1Q86C 4IPGA 2UUAL 3CC4A 3NBHB 4POGA 4OO1I 1L1OB 3PSIA 4IOCA 5AJ3L 4DR1L 4JV5Q 4DAYB 3M4PA 4JOIA 1LYLA 3PO3G 5IYDH 5GAGC 4DUYQ 1OTCA 4X6AH 3CAMA 4MTNA 5FLMG 1QVFA 1VQPA 3NENA 5HGQA 1JMCA 5M3MG 3J80c 2IX0A 5IYCH 1WYDA 4GOPA 1PH3A 3SGIA 3HOYG 1IBKQ 4A75A 1E22A 4R1JA 3M85A 4LF5L 2OTJA 4DR3Q 4DAMA 1PH7A 5JEAJ 2C35B 5IP7H 1SRUA 3UDIA 4APVA 4X66L 2F4VQ 2VQFQ 4JBKA 4UP8A 3CCEA 1Q1BA 2KCTA 5IYDG 1HNWL 4BY7H 5C44H 2N78A 3K81C 4LNQA 3RLFA 2R93H 4OWTB 1YJNA 4NXMQ 5IYCG 3M4OH 1A63A 2A19A 2PI2A 2UUCL 3BZKA 1YJ9A 1VQHA 4R4CA 1YEZA 4LF7Q 5JJIA 2KENA 1XMOL 1N36L 3GD7A 4IFDG 4DR6L 2UUAQ 2RHQB 3U50C 1YZ6A 4PZ6A 4DUZQ 4A3MH 3GTMH 2RHSB 4GN3B 5IP7G 2HT1A 2B29A 2CWPA 4IPDA 1GO3E 1NMFA 4IJLA 5IE8A
chains in the Genus database with same CATH superfamily
4BY7G 4QL5A 1PYSB 3IL8A 2IT1A 3JC66 3K7UC 3GDEA 1WFQA 2NVXH 1GJXA 3TS2A 2TSSA 2R7ZH 1HH2P 5C4XB 1AE2A 1NCVA 4LFAL 2XGTA 4KKTA 4L5SA 4FXKC 5C0XJ 1WD0A 2ZJQA 1WTPA 1KHIA 4HSVA 4YHHL 4DR5Q 4A3EB 1TWHH 4OXPA 2F0KA 4BBRH 2Z6KA 2F3WA 1I94L 3I4NG 3CRLC 3LNNA 4A3DH 1II3A 2JA7G 2PNHA 1E24A 5BN5A 4DAPA 2IJ0A 5IGFA 1I4RA 2E2DC 4LF8Q 1TS2A 3S14H 2E8GA 3HOWB 3IRBA 4A3IH 4IJHA 2VW9A 1SNCA 4DV0Q 4FF3A 3S1NH 2FXQA 2Z6BA 3TRZA 2VB2X 5C4XG 1UE1A 4WJWA 2KECA 2ATWA 4JYAL 1CHQD 2QEXA 2CHBD 4K6LA 2E74C 1GKHA 1EZ6A 5CC4A 4DR2L 1H9KA 4BBSB 1SNPA 2WAQB 2XWBB 1CKNA 1O7ZA 3L9AX 4ZKCB 1SYCA 3GTLB 4FDBA 3KDFA 4J15A 1LT6D 2MFIA 3TN2A 2JA9A 2E2JH 1WTHA 3KYHC 1QZHA 2EYFA 3L0OA 3HKZG 4GNXA 1Q12A 4DK3C 2K5NA 1HZ9A 1EOTA 3NEMA 1STAA 5C4HA 2M9VA 1NMGA 2A6EC 2ENBA 2EYMA 3RZDB 4JI5L 1YI2A 4BBSG 1QVCA 2WAQG 2F0SA 1E2VA 1VQFA 4RCOA 4F7XA 1C48A 1X55A 5DEHA 4JOIC 1K73C 1OXVA 1RKNA 1HR0W 1CZWA 2KCMA 5CV4A 3AMUA 3AEVA 1AN8A 2VUMG 2N49A 1G291 4P72A 1GUSA 1VMCA 4GKJQ 1BCPC 1PTOB 2BE5C 3DHQA 5GAHC 1ILQA 2SOBA 3MAQA 3ULJA 4X64Q 4HAEA 3SK4A 3M4QA 5IIFA 1Y1WG 1N32Q 1F2YA 1M8AA 5KNCA 1IYVA 4OHJA 1CHPD 3NTIA 2Y0SE 2R7DA 1I4XA 5C5MA 4K2KA 5C44B 3RR5A 2CFMA 3D8GA 2GN5A 4G57A 2R93B 3F8TA 4K0KL 1QUQB 1GUNA 4K5WA 2PZWA 1VQNA 2DUDA 2OEOA 4GN5A 2Q2IA 1MSHA 1X3FA 4OONA 1HRJA 3PO2H 1HNXL 1O7YA 1X54A 2B2UA 2A68D 5JEAH 2ZM6L 4IUNA 2F0OA 4DR4L 5I2XA 1T9HA 1SJHD 1HA5A 4DR1Q 1O78A 4A3JH 1K3RA 3E5SA 1V43A 5KIXA 1AZPA 5CMDA 1S4ZA 4IALA 3SEBA 4A3FH 2RVLA 1QZGA 2Q8RE 1C9OA 1ZEQX 4OWWB 4OIKA 3I55A 2UU9L 2B2TC 1S5BD 1J8IA 1XWEA 4A4IA 1HNWQ 5K5PA 2NN6I 1FYCA 2EY2A 2LXJA 4EQPA 1PLFA 4B3ML 4S3SA 3G4SA 2UUCQ 1X9NA 4PV1C 4YY3L 3I4OA 1Q46A 1XMOQ 4DK0A 4DR6Q 1EY0A 2F0NA 3CCVA 2BH2A 1PYBA 5E3FA 1EEFD 4HJ7A 4A3LH 3H6MA 4C3JB 4KY6A 1GVPA 5D3DA 1YHBA 3H09A 4BS9A 3I73A 1CQVA 4B3SQ 2L12A 3QR8A 1D5ZC 4K5VA 3R2TA 3PIP3 1XMQL 4BY1H 2F0IA 1E0BA 1AE3A 2DY8A 4LFAQ 1SDFA 3MXNA 4QY7A 5C0XG 2IX1A 5DM63 2RDFA 3JAMc 4YHHQ 3HZXA 4C3JG 3S1RH 4GKKL 3S15B 2ID0A 1BBXC 1I94Q 3L3OC 3I2ZA 3PGZA 1Z9FA 1EYCA 2IL8A 3NBHA 1PFSA 1L1OA 1J9OA 1BQQT 4JI6L 4XYOA 1G91A 4JYAQ 2F0VA 1IBKL 1BNZA 4ZUJA 1O7IA 4DR2Q 1JWUD 1TWAH 3GTKB 1D5XC 1QNUA 4MNOA 4CJ2C 2ZT9C 2MHVA 3BYYB 1YHAA 2F4VL 3S2DB 3NTKA 2WACA 3MEFA 1PZKD 2F0TA 4ZCKA 1MKHA 2PPBC 3KF8B 5K36G 2QDBA 4KN4C 1O80A 1MHWC 5JOBA 2VS1A 3ERQA 4HJ8A 2VB3X 1DJRD 1HA6A 2EJFC 2PQAA 4UP7A 5EKLA 5G3LF 3G7LA 3E6ZX 3M7GA 4LF7L 4G4KA 1CA5A 2QILA 1L0XB 2P5ZX 4PZ7A 1K8MA 2KCNA 4JI5Q 2B2UC 3UDGA 3GTJB 4DV1L 1DGSA 3BVMA 3R2IA 1E2ZA 3CCSA 4IOAA 5ISRA 4EGVA 2WIIB 4B08A 2LKVA 2NTTA 1KNEA 2MPMA 4C3IH 4PZ8A 4AYBB 3EBEA 4DV2L 2IW3A 1TXYA 3NTHA 4RKLA 1KRSA 1WTOA 3CMAA 1S5DD 4RMFA 1TVXA 3H0GB 1YNJC 4V190 3S16B 2HUGA 4NDXA 1TS3A 1T5XD 5LMNL 2UUBL 1F2MA 4GLXA 1K3BC 4KKUA 2UXBL 3P7JA 5D14A 4G7ZC 4RHSA 2G9DA 1J5EL 2NTSA 3UE1A 3NBIA 5KYLA 1HCZA 4ZK9B 3OHXC 2N55A 4LF4L 1VQBA 4OELB 4K0KQ 1ZYRD 3V05A 3H0GG 4FF1A 2JE6I 3D6WA 1HNXQ 2ZM6Q 2BCOA 1SYGA 1V1PA 4DR4Q 4JI2L 2YTYA 4F88A 3MXGA 1TWGB 2ICIA 1L0YB 2ZXRA 3SDZA 1NTGA 1PH1A 3WWVA 4WORA 3MEHA 1VQCA 4RH6A 2M00A 5M5WB 3WOFA 5COYA 1BOSA 4A3CH 2VQEL 2A69D 2AHOB 1YVCA 1N33L 4KY7A 4A3EH 1B2TA 1PRTC 2K14A 4CJ0B 2UU9Q 1GUGA 3GTQH 1D8LA 4L8JA 3STBD 3GTPB 1PTOD 3J7A5 2FFKB 1JQYD 1V1OA 3IFDA 3C3LA 3HOWH 1L1OC 2DY7A 4B3MQ 3N6RA 4RWSC 3PIPA 3AU7A 1SNOA 4AH6A 4YY3Q 4HIMA 1V8QA 1N8RC 2KBNA 1BF4A 3OSOA 1C4QA 1TKWB 1IW7C 1HJPA 2VY3A 1L2FA 1U4MA 3GTLH 1JT8A 1X3EA 5GROA 1IZ6A 3M3YB 1CKMA 2LXKA 4L5QA 2B2WA 3HOZB 1WTRA 4P73A 4J8QA 1XMQQ 2XTIA 5EPJA 2I5MX 2OTLA 4FP5D 4GS3A 4O1NA 1E3PA 3RZDH 5FLXc 1JC7A 3HOYH 4H44C 1EIGA 1KL9A 1K9MC 3HG9A 4LMQD 4GKKQ 3I90A 5CR3A 2CQAA 4RAUC 2EZVA 2A6HC 2Q2HA 2WB1B 2ZXPA 4KD3A 3QB3A 4H7BA 4IOCA 5AJ3L 1EY5A 5IYDH 3M4PA 4ILWA 4IUVA 3PO3G 4QCLA 4FXDA 1OTCA 5I9OA 3J7AF 1VQPA 2IX0A 3MC0B 5IYCH 1PTOH 1SE3A 4A3BB 4ME5A 2QDLA 2RKSA 2X6LA 4RKBA 4GOPA 1PH3A 2E75C 3NWTA 4HEDA 1IBKQ 2EJMA 5IOCA 1E22A 4LF5L 2OTJA 1PH7A 2C35B 1SRUA 4C3HB 1KABA 2F4VQ 4UDUC 2E2HB 4CJ1B 3VA5A 3CCEA 2FHTA 1TS5A 1JOQA 5C44H 2R93H 4XQNA 4CDCC 3BZKA 3NHHA 4LF7Q 4A3MB 1LTTD 1B1ZA 1SNMA 2RHSB 1RD9D 4FXGC 3EFXD 1GUTA 2RSOA 1NMFA 2XSCA 4IJLA 5IE8A 3A5UA 3QO2A 1Q8IA 2K4KA 2JA8B 2K28A 3T13A 5CV7A 5JVH3 3KOJA 3L2PA 4OL7A 4HIKA 4DV2Q 1G51A 3NWSA 4OO1G 2B2YA 5J39A 4HMIA 4TSSA 4YCWA 1I4QA 4RA8A 4A3MG 2AKWB 2UUBQ 3TZDA 3J80i 3PUZA 1E1OA 4C2MB 2IHEA 1V1QA 1P8LA 2UXBQ 1IBLL 2MGSA 4FYDA 3F2DA 2PCFB 2EJGC 2RA4A 1PZJD 4HCEA 3SK8A 1NUCA 4NXNL 1J5EQ 4A3GG 1SYBA 3RZOH 3D31A 3FKIH 1XPRA 1K8AC 2MP1A 4L5TA 5KGUA 5IT9c 4LF4Q 1HTLD 2B63B 1ASYA 1VS0A 4X3UA 4C3JH 3TDQA 3BVZA 3I72A 4WJ4A 4DV7L 1CZGA 3VYRA 3BU2A 1EFID 2KUMA 4LFBL 3D6CA 1JJGA 3G71A 2JA6G 3EQLC 4JI2Q 1EY7A 2F0WA 4DN4M 1ZKOA 2B2WC 4PNYA 3I4MB 2K5DA 5F2DA 1RHPA 3W1GA 2MO1A 1KC8C 2PO4A 1Y1VH 1AFPA 1KRTA 4QUCA 3UDXA 3TP8A 2VQEQ 1NNXA 1N33Q 1TWCB 1RTOA 3FEWX 3S15H 1NSNS 5M3FG 4HIOA 1TWFH 3MVVA 1M4VA 4LF6L 2J0TD 1BVSA 1NR4A 1QCBD 2AQ1B 1RODA 4DF7A 2EDGA 2NN6G 1G6ZA 4YCVA 4LUZA 5C3WA 5JJZA 2K05A 5CV9A 2SNSA 5C6AA 1PTOF 5FOBB 1N9WA 1C0AA 2AMCB 4LF9L 1KAWA 1I4GA 2K50A 1PH5A 1XNQL 4GOPC 2RDGA 3O13A 2L4NA 4JBMA 3GTKH 3KF6B 1EFWA 1CFMA 2CW0C 4KJOA 1H9SB 3S2DH 3CCUA 3N52A 3C46A 1K28A 5FK9C 3NE5B 2EIFA 1L0WA 1UWVA 4AIMA 4CDEC 3BDLA 5CV8A 1Q82C 4A93G 3HEJA 1KAAA 4J1MA 2EOTA 1CM9A 4WFN3 3GTJH 3K5MA 4KHPL 4DR7L 2PQEA 2HHHL 1STBA 4I65A 4RGTA 3NP8A 1C8CA 2GVBA 3PUYA 3SK5A 3H3VH 1KLGD 4QQBX 1XXGA 3P1HA 2UXCQ 1VQ7A 1U4RA 4QUFA 1GOZA 5AJ3Q 1JORA 1NBWA 1PFNA 4K5XA 4R4IA 2CH4A 4L63B 1VF7A 3RMHA 2A68C 2EYOA 1VQGA 2B2YC 3MXUA 4CKBA 4B3SL 2JA7B 5I4DA 5IYBG 4AYBE 1EIFA 3TMEA 1BCPB 1ENAA 5L37A 1A62A 1RIPA 2AWNA 4LF5Q 1UAPA 5C3EH 3J7ZC 2X6GA 1ASZA 1IL8A 3A5ZB 4PG3A 3ERSX 1CKOA 4JI3L 4DU9A 3J80E 4IQZA 2JN4A 5EGTA 3HKSA 3KFUA 2HCIA 2F0PA 3H91A 2JQOA 4JI7L 4N8FA 2F52A 1SFOB 3HKZB 4HIDA 3HOVH 4KI0A 3Q0AA 4ZRZA 3CD6A 2XIWA 1JB7A 2PI2E 5JPMC 3BYTB 1TWGH 3DEPA 2D0OA 1QILA 1TR5A 2RCFA 2N88A 4UHVA 3DXJC 2MO0A 3KJPA 3OWEB 1B9NA 3CCJA 4A3KH 5M5YH 2XNAC 3V2TA 3AFPA 5M5WH 5C5LA 2O5IC 1LTAD 5G3LD 4IPHA 1S5FD 3DWAA 4GLAC 2KHSA 2F0UA 2E2IB 3E9IA 1JICA 2VUMB 3GTPH 2EY6A 3A56A 4MHEA 4DNTB 1IBLQ 4HTHA 3T56B 1HNZQ 1PZID 2C9OA 5DLQE 4NXNQ 1HFGA 5ELBA 1GHJA 3J80L 3VDYA 1Y1WB 1G8ZD 1K0RA 4FVMA 3K58A 3HOUH 2K52A 2HIXA 2YTVA 2SEBD 2NVQB 5KNDA 1MIUA 5DM73 1VQ5A 1CKNB 3PUWA 1EQTA 3KDFB 3LGJA 1GXDC 4DV7Q 3PQIA 4LFBQ 3CQZH 3VR3A 5CV5A 1KQSA 3EJIA 1DYQA 3HOZH 1PH9A 3S1MH 3A8JE 4ZUIA 4CKEA 3KLWA 4C1NK 2JEBI 3D4RA 1YIJA 4NXML 3QJYA 3K5LA 3VR2A 2K6AA 1EY9A 1BR9A 3ND9A 2D62A 1B7YB 3K57A 3NELA 2YU9B 4LF6Q 3OIQA 5IGBA 1N34L 2F0EA 4DXFA 3AQQA 1X3QA 3JAME 4ALPA 1VCIA 1B70B 3CKIB 2O5JC 2WB1E 5LL6S 1EUJA 1E1TA 2C5CA 3HOXG 2R3ZA 4LF9Q 4A3BH 1XNQQ 4EQOA 1S5ED 2OQKA 3RN2A 1WCMB 1FNUA 1VQEA 4G7HC 1JB3A 4ZYSA 4C3HH 1VQJA 1LLRD 2KA7A 3MTSA 4TVAB 3CXCA 4ID6A 2E2HH 2EE1A 4LUOA 4HJAA 2I5HA 2XRSD 5EAYA 1MBYA 1LT4D 4CDDC 1EY4A 1D2BA 4EQ5A 3PUXA 3OPOA 2G9HD 3TZUA 3KJOA 1UE6A 2Z6KC 3MFGA 3BZDB 3CCLA 3DM3A 3UE0A 3OW7A 1XJVA 1VQ6A 3OYYA 1GUOA 3SHLA 2RCNA 1WCMG 4MTKA 1U5KA 1Q7YC 3FDTA 5HY6A 1STGA 4DR7Q 1ZYRC 4KHPQ 3GTGB 2HHHQ 1BDOA 2KJXA 2JA8H 3UI2A 4B9WA 2JEAI 3E9HA 1JE4A 3CU7A 1SMXA 2JA5G 3W1BA 3PCOB 2NUCA 2F1MA 2K04A 1IKLA 3CHBD 5FJ8H 2TMPA 5E1FA 4C2MH 4GNXC 1PVOA 1YNNC 4X3SA 1XYIA 4YIJA 1CA6A 2L11A 3X3MA 3U58A 2PZUA 3IFTA 3J81i 3DEOA 3NK9A 1PA6A 1UE5A 4R4TA 2FMCA 4JI3Q 5IP9H 5FO8B 4MN3A 2B63H 3STBC 1FJGL 5LMUL 1X6OA 4XT1B 3T16A 2QCPX 4JI7Q 3D3RA 2NB0A 4GLVB 3S17B 1KDBA 2IPKD 3CCQA 1I50B 1A8VA 3KF8A 4JK1C 3J81j 2EVBA 3I4MH 2R92H 2D2CC 2A6ED 2DJGC 2WFWA 4BXXG 4LW1A 3I91A 4DV6L 2UXDL 1AEXA 4IFDI 3K8AA 3ZYYX 4IUQA 3I7FA 3MXNB 1W6JA 1LTBD 1HFNA 5FLMH 2XRQD 3S1QB 1I6HB 1TWCH 2NBFA 3A55A 1PRTB 4K14A 3RNUA 2I5LX 1NE3A 3KUPA 1MJEA 2KCCA 1JJCB 4JVZA 5ELOA 1Q86C 2XWJB 2AUKA 3NBHB 1L1OB 4JV5Q 4DAYB 1LYLA 2XN9C 5GAGC 1SMYD 5HGQA 1F2ZA 2KOLA 5M3MG 1JMCA 3VR6A 3SGIA 5ELFA 4DA2A 4IFDH 3K59A 3GTOB 4K2LA 5JEAJ 1IKMA 5IP7H 1WTQA 2DJFC 4H13C 1MI2A 4BY7H 2JSOA 4LNQA 2G5DA 1SSOA 2WKCA 1YJNA 4NXMQ 2J4XA 4LJZC 2PI2A 3D4DA 1DOMA 2UUAQ 1K0SA 1SE4A 1A2UA 2HT1A 2L1BA 1DONA 1GO3E 1VDZA 1WTWA 1LUZA 1N34Q 3FPUB 5FLXE 1IYUA 3EN2A 1HTPA 4FF2A 2MNAA 1ICWA 3I4NH 2R7ZB 3OMCA 5LMNW 1KIXA 2JA7H 2NYZD 3QOJA 4X65L 1FNVA 2BA0A 4U68A 4C1NI 1R4QB 4KK7A 4KV6A 2NZ1D 5I6WA 2BDOA 3PV0A 1H9RA 5C4XH 2EY5A 2CQOA 4PMBA 3CCRA 1RTNA 2K01A 1UE7A 2HIVA 3FHWA 4J6HA 3F1ZA 5AFWA 4BA1I 3PF5A 3W5OA 1ESRA 4A3IB 1B3QA 2PW5A 2N8NA 2Z4HA 3Q8DA 3BS1A 3BJUA 3U4VA 1M90C 2R7ZG 3TP7A 3C2PA 1STEA 2ZTCA 4ZAIA 2R7FA 3J81E 3B6YA 3QG1A 1VQOA 1WJJA 5ELCA 4IN3A 2VNUD 4OIJA 1V1PB 1F9PA 4BBRG 1R4PB 4Y7NB 3HKZE 3TS0A 2E2JB 1RJTA 4A3DG 1A3TA 4KLKA 4BBSH 1EU4A 3AYHB 3OW2A 4UP9A 4BWGB 1KTKA 4N9PA 4RFBA 2XVSA 4A3IG 3EIVA 3I56A 1AZQA 1C7YA 5JJKA 2FINB 2WAQE 5GADC 4B3TL 3PO3B 2E2IH 4X3TA 4WRDA 2VUMH 2K75A 1SE8A 3CRKC 3F2UA 1PV4A 3GQBA 4OGQC 5JAVA 3T4AC 4DK6C 1TS4A 4KY5A 3I3CA 4Q0FA 1ET6A 4ODGA 1Y1WH 3K0YA 3IAYA 1GM5A 4DFAA 1SYDA 1UEAB 1FJGQ 1JJ2A 5LMUQ 1YNXA 4DGZA 5KNBA 2UXCL 2HDMA 2VL6A 4IO9A 2M2LA 4DKAC 3AFQA 1S5CD 4M8AA 5A2QE 1W2BA 1PH2A 2FJ2A 2RF4A 2A5HA 3T53B 4XTCS 5A35A 4ZKBB 4Z9CB 1STNA 2Q2UA 1ICFB 1SNDA 2EY1A 5EKIA 1U0LA 2IHFA 2CH4W 4NPSA 4DV6Q 2UXDQ 1CSQA 2OCEA 3TQYA 4JBWA 4IUUA 4YWMA 2V1CC 1AP0A 1ENCA 4JPBW 4JI1L 2YTXA 2Y0SG 2YU9H 4RHRA 4K8IA 4R8IA 1YNJD 2L15A 3A74A 1B44D 4A3JB 4N9TA 1IBML 1KLUD 2L5TA 1BCPF 4JBJA 3K7AB 2KEEA 5C0XI 3PUVA 4GOPB 2AWOA 3K80C 1YHQA 4A3GB 4KTAA 4HR7B 1CK1A 2CCZA 3PO2G 2L55A 1WOCA 5JEAG 2ES2A 4IPCA 1Z6HA 4A3JG 5J1ZA 1OXSC 2JA6B 1U9RA 4QF4A 1WTVA 2A73B 2EQSA 1HNZL 4A3FG 3FPPA 1VQ9A 2GVAA 5JJLA 3UDFA 5C0XH 4TQUS 1HXYD 4POFA 3IKJA 2N3SA 5C4ZA 1NAPA 3TREA 1GD7A 5M3FB 3M7NA 2O4XA 4WJ3M 4BY1B 4X65Q 1EY8A 1OXTA 2PNRC 3S2HB 4K6DA 4A3LG 1JE5A 2EXDA 3S1RB 3LWUA 2QA4A 4RGOS 1X3GA 3KBXA 2OT2A 4UY8C 1LABA 4DV4L 4A76A 4R9WA 4RGNA 4FNFA 5C4JB 1HUNA 3PIO3 4BY1G 5K36H 3P20A 3K5OA 3W3AA 1I6VC 4LAAA 3OMGA 3S24A 2KHIA 4JG2A 2B8GA 5I2YA 1QVGA 3S17H 1H9SA 3H15A 1FVIA 4FF4A 1Y69U 1ESFA 3CC2A 4A93B 3HGBA 4DR3L 4O42A 4EX5A 3H3VI 2BH8A 2VQFL 3W2DA 1S72A 1UNSA 2L9HA 3GV3A 3DMUA 1F9QA 2Q8IB 2A6HD 1WI5A 1EWHA 1I6HH 4O0AA 4B3TQ 3GO5A 3J7AV 3A7AB 2BDNA 1ENFA 1VQAA 1F9SA 1EWIA 1ONLA 4HSPA 4KHZA 1XX8A 4DUZL 3NQTA 3MZ5A 2CWAA 4C3IB 1JWMD 1Y8PB 4OEMB 5I6YA 3JAMi 2K32A 1SLJA 3OWFA 2K1BA 4F87A 1QWYA 4ABNA 1IYJB 5EJWA 4GN4B 5HURA 2NVTB 1NY4A 3M9BA 3V96A 5FKAC 1LTID 3GTOH 3H0GH 4IUTA 1A0IA 2QKIC 3S16H 1CSPA 2HQLA 4C3IG 4F8MA 5LL6X 1VQMA 2K5VA 2OQ0A 4DPGA 2Z8LA 5HGTA 5KYIA 4XQJA 1X3PA 1LTRD 1Z47A 1EY6A 4JI1Q 2RQXA 1MGSA 1EYGA 1MSGA 1SXTA 2VZAA 1HZBA 4LFCL 4DK1A 2KVMA 1J6QA 2KEDA 3QWNA 2SNMA 2JXMB 1QOHA 1IBMQ 2Q8TA 4M1UB 4GZYC 3DUZA 2F3VA 4U673 4I7ZC 1A6XA 1AW7A 3DWPA 5ELEA 1D1KA 1SR3A 2ALYB 2B2TA 3MWYW 3GTQB 4HMJA 1FR3A 3K6OA 5ELNA 1FNWA 3GP7A 1SBBB 1H9MA 3OTOQ 3VYSA 5E4XA 5IGEA 4DAVA 3G48A 1DZ1A 1S40A 4X3KA 3BG3A 3H94A 3BVGA 1BUVT 1DCZA 1UEBA 5M9OA 2L0CA 4AQYL 1BO0A 3TP5A 5EKKA 2EYJA 4A3CG 5CBEE 4JV5L 4A3EG 1I4PA 3T1HQ 4QMGA 1VQKA 3VYTA 2OXPA 2ZJPA 1MD2D 4Y7NH 1OO9B 1HR0L 2QW7A 3K0XA 2DNCA 1HQMC 2B2VA 1VF5C 3NQIA 2YV5A 5IODA 3FRPB 2ZTEA 5M5XB 3EROA 3HOWG 1OXUA 3KLSX 3NPPA 1Q90A 3PIOA 4JC0A 1K83B 4R4OA 3M3YH 3MA2B 4YCUA 1PRTF 1ET9A 3CW2C 4JI4L 3PO3H 2F0JA 2NVYB 1P16A 4JI8L 2D9UA 1EQRA 3HOYB 3RN5A 4GNXB 4B3RL 3HOXB 1QUQA 3C1EA 5CBAE 5GAEC 1KXLA 1PFMA 2LMCB 1XTDA 4P75A 1W3SA 1EYDA 3C1FA 4OX9L 1EQQA 2H5XA 5FO7B 2CW0D 4DV4Q 2UUAL 3CC4A 4OO1I 4POGA 3PSIA 1TIID 2I46A 2ICEC 3MHBA 2IX3A 1A3UA 2AQ2B 5ELDA 4X6AH 2I07B 4MTNA 5EBDA 1QVFA 3SVMA 3J80c 5J22A 1D6EC 3Q24A 1WYDA 5KEEA 3HOYG 4RCNA 1D1IA 1SEBD 2F0QA 2K5QA 1SMYC 4DR3Q 3G6JB 4C56C 4DAMA 1LTSD 1SYFA 4APVA 4X66L 1TQOA 2VQFQ 4UP8A 2KCTA 1Y8NB 5IYDG 1I4HA 4QIWB 3K81C 3E3XA 4HCSA 4OWTB 3RLFA 1RCVD 5IYCG 2JA5B 1DOLA 1YJ9A 1FD7D 1VQHA 4R4CA 4OO1H 2IWHA 2KENA 5CORA 2PW7A 2RHQB 1YZ6A 4PZ6A 4DUZQ 2K7VA 4A3MH 4IURA 4GN3B 2K33A 2B29A 2CWPA 2J7ZA 4IPDA 4NKLA 5CYUA 1Z7TA 1IL2A 4P2CB 2ZTDA 5C44G 3K7AH 1AH9A 2R93G 2WV6D 3EVQA 1R9TB 4ULLA 1STYA 4CKCA 3TEHB 4A3GH 2MQHA 3RUZA 4IZ8A 2NZOA 2LSSA 3P75A 4HJ5A 3KBGA 1G2TA 3JAML 2DN8A 4UPAA 1WD1A 4OWXB 3Q23A 1LACA 2HDLA 2MJ8A 1QB5D 1BKBA 2PMZB 3RZOB 3FKIB 3MFYA 1VQIA 2F0GA 2JA6H 4QB4A 1N36Q 1VQDA 2H1EA 4JI0L 2MUYA 2OWOA 2A69C 5TSSA 1BBWA 1H9JA 1B53A 1X65A 5BN3A 3I70A 1EIYB 1DD2A 2FMMA 4DV3L 5CV6A 4LFCQ 1PTOC 2LFNA 2B2VC 1B3AA 1QG7A 1Q81C 5M3FH 1PHJA 2OF1A 3ULLA 1I3QB 1V9PA 1EQVA 3T51B 1K8GA 1ZXTA 2BOSA 3ICEA 3FKIG 3D4WA 3TBIB 1GUWA 2NN6H 1D5MC 1Y1VB 3A0JA 4IUPA 3S2HH 1CTMA 1U4LA 4MIUA 1I5FA 4KMUC 2K03A 3T1YL 1TWFB 1KDAA 4P71A 5M3MB 2Q2TA 4V0BA 4EVOA 5C4JH 1YBYA 4DAYA 3KLRA 3SXHA 1SYEA 4FO2A 1LO5D 5BR8L 1HQRD 3BDOA 3U9SA 2ZJRA 1BCPD 1E7ZA 1B8AA 1Y1VG 5J3BA 4ZLTF 2BE5D 2QGQA 4AQYQ 1HUMA 4UAIA 5E7NA 1F2LA 4NB3A 4KD4A 4XIGS 1WVLA 4A93H 1A2TA 1HR0Q 4Y52H 3A8IE 1XNRL 2E5LL 4KN7C 4DV5L 1SAPA 2EYHA 3RLOA 3DLLA 1IXRA 1H95A 2AQ3B 5JPNC 4JI4Q 3CCMA 4JI8Q 5IWAL 1DXMA 1OXXK 3M4OB 3A54A 5IYBH 1XPUA 4B3RQ 2PQAB 2A74C 3SR1A 1LT3D 4OX9Q 3GTMB 3VA7A 1HPCA 1VMPA 3QOLA 3A7LA 2NVTH 3SK6A 4CBVA 2WP8J 1RF2D 4N8X1 4QJFA 4R8NA 5IGDA 3J7YW 1A15A 2NVXB 1G6PA 4QGUA 2KQ3A 5NUCA 4TRDA 5C3EB 1NR2A 1QE6A 1Y14B 2JJQA 1EIHA 1LTLA 2F0MA 2HQEA 2R6GA 4CDFC 3NXWA 1SE2A 5EQ0A 4AYBG 4X66Q 3BDCA 5EBCA 1QNKA 1X56A 2K5WA 4JCVE 3CPWA 1TWHB 1Y8OB 2PYKA 4BBRB 5JVG3 4A3DB 1JOKA 3EA6A 3S14B 3HOVB 3CPFA 1PH4A 3S1NB 1JCKB 1EWCA 1M1KC 4NMZA 5C3EG 1HHVA 3AB9A 3VR5A 3WOEA 3CMEA 1SFOH 2E76C 1IHZA 4X62L 4DXGA 1PH6A 1YNND 4A3KB 3QIAA 5M5YB 4KHVA 1YITA 2QEJC 3TP6A 1CUKA 1BXTA 2NZHA 2I0QA 2AUJD 5FLXL 2H4OA 4HJ9A 3HOVG 2GA4B 4MZ9A 1KNAA 2F0LA 4RGMA 4H0LC 3URYA 3F2BA 4DNIA 3CP0A 4TKOB 1ML0D 1GHKA 2YYZA 5D65A 4LUVA 4Q5VA 4A3KG 2Z1CA 5DNFA 3HOUB 1TY0A 4ME3A 5CGKA 3H3VC 4DUYL 1FGUA 4CGYB 4JI0Q 3PF4A 1A3VA 1LM0A 2IY5B 1UUPA 4NP5A 3DWQA 4RG1A 1WTXA 1DOKA 2D5DA 2JP1A 3L7ZC 4DV3Q 3CQZB 5LHY1 1O7LA 5M5XH 2NVQH 3J81L 3I4LA 3S1MB 5C3XA 3PMFA 2Y0SB 1MJCA 4XQQA 1VQ8A 1K83H 4PMCA 2VXWA 3R93A 2LY7A 1S3OA 1PXUA 3ND8A 5GQOA 5IT9E 4G7OC 3M4YA 2NVYH 3Q6SA 3HOUG 2Z0SA 2JYOA 3LWEA 2EPBA 1PH8A 1CI3M 2QF7A 3HOXH 4E6IA 1CQFA 3KLSA 2HCCA 1B9MA 3T1YQ 1DM0B 1PYWD 3HS0C 2PZTA 2SDFA 5IGGA 4IFDJ 3R3OA 2R61A 1E2WA 1W6KA 1FGBD 2F03A 3HOZG 4CHTB 3PO2B 4JI6Q 1Q1EA 1QJOA 1D7QA 4I7AA 5BR8Q 1TY2A 1KD1C 2RSNA 2F0DA 3FMCA 4XT3B 3HRZC 2LS01 4K8JA 3D0FA 1TT2A 3CF5A 3J81c 3I8ZA 2WB1G 3CC7A 4A3FB 1WCMH 1BBUA 4L5RC 1XNRQ 3GV6A 1B50A 4DR5L 5FO9B 4YWLA 1SN8A 4BA2I 2E5LQ 2B39A 3G6EA 4DV5Q 3DM1A 5T1GA 2EXZA 3K5NA 5A2QL 2JA5H 5IT9L 1X32A 4L6TB 4A3BG 1JOOA 4LF8L 4KKSA 1FL0A 2B3GA 2BA1A 3OTOL 2EYPA 2F3IA 2RDHA 5IWAQ 4QIWE 4DV0L 4DV1Q 2F0HA 4PQXA 2A8VA 5KRUA 1CT1D 5DAUA 1EYAA 4C3HG 5IY0A 3MXPA 1SJED 1F9RA 3R8BA 4XDXA 1HZCA 1RL2A 3BZCA 4O2DA 1R9TH 3TSSA 1PDQA 2WINB 1T5EA 3T1HL 3GTGH 1SROA 3RD4A 1JR0D 1KDCA 1EZ8A 3LX0A 3ITPA 3ZJYC 3FP9A 5LMNQ 1VQ4A 1PRTD 5I9PA 4KJNA 1HZAA 1Q8KA 2D0PA 1PFBA 3U9OA 3VYUA 1LT5D 1NJIC 2JA8G 2A1AA 1JWSD 2EYLA 3ER0A 4ZQ3A 4LWCA 1PMRA 2ASBA 1LV9A 2PMZE 3NSWA 1EEID 4BXXH 1IW7D 4R4QA 3HFZB 3F2CA 3VR4A 5FJ8G 1YJWA 3NUCA 4GKJL 4YWKA 2KHJA 3X3NA 3ULPA 2WKDA 1I3QH 1TU2B 2R92B 2V4DA 3KF6A 4X64L 4PMWA 5H1SE 2RBMA 4X62Q 3E0EA 1TWAB 4P74A 1N32L 1I50H 3ONAB 5IP9G 2CVRA 2B63G 2DGYA 3FVQA 3WDNA 5BN4A 1B4OA 1F77A 1LTGD 3U4ZA 5M3MH 1EL0A 1EOVA 2ZXOA 1U4PA 1XPOA 2K5HA 4H02A 3S1QH 3RLNA 2CKZB 4HN7A 5EPLA 3Q22A 2F4IA 4B9XA 2HD3A 3I4MG 1VQLA 2R92G 4DNRB 3OIPA 2JK8A 2NWGA 4IPGA 4LK1C 1STHA 4DR1L 4JOIA 1K8OA 3E0JA 4DUYQ 3A8KE 3CAMA 5FLMG 4NW2A 3NENA 2DNEA 5D3IB 3KK7A 1G2SA 1RDPD 2B8FA 2F0FA 4A75A 4R1JA 3OOCA 3M85A 5EPKA 1SNQA 4XXEA 3UDIA 4BY7B 4JW0A 4JBKA 2O2LD 5E4WC 1HNWL 1Q1BA 2X69A 2N78A 1XTCD 4XYQA 2Z4IA 2Z9HA 3M4OH 1A63A 2A19A 2UUCL 3SE0A 1YEZA 5JJIA 1EU3A 1XMOL 1N36L 3GD7A 4IFDG 4DR6L 3U50C 3S9WA 3GTMH 5IP7G 5T1IA 4EQNA 5IGCA 1Q3LA 1ILPA 3HP3A 3I4NB
chains in the Genus database with same CATH topology
1LUZA 1N34Q 3A5UA 2ZTDA 4QL5A 1IL2A 4BY7G 1PYSB 2K4KA 3K7AH 3EN2A 5C44G 1AH9A 2R93G 2IT1A 3JC66 2MNAA 3I4NH 3K7UC 3GDEA 1WFQA 3KOJA 3TEHB 3L2PA 5LMNW 4HIKA 2MQHA 1KIXA 2NVXH 2JA7H 4DV2Q 1G51A 3TS2A 4X65L 4A3GH 2BA0A 4OO1G 1C0AA 2R7ZH 1HH2P 2NZOA 1AE2A 2LSSA 3PV0A 4YCWA 4HJ5A 2XGTA 4LFAL 4A3MG 2AKWB 4UPAA 5C4XH 2UUBQ 4L5SA 5C0XJ 4OWXB 3J80i 2CQOA 3PUZA 1E1OA 2ZJQA 2IHEA 1KHIA 1V1QA 3CCRA 1P8LA 4YHHL 4DR5Q 1BKBA 2UXBQ 1TWHH 1UE7A 4OXPA 4BBRH 2HIVA 3FHWA 2Z6KA 3F2DA 1IBLL 3F1ZA 1I94L 3I4NG 4BA1I 3PF5A 4A3DH 3W5OA 4NXNL 1VQIA 1J5EQ 2JA6H 2PNHA 1E24A 2JA7G 1N36Q 3Q8DA 2N8NA 3RZOH 3D31A 3FKIH 3BJUA 3U4VA 1XPRA 1K8AC 1M90C 1VQDA 4LF8Q 2R7ZG 3S14H 2E8GA 4JI0L 4L5TA 3IRBA 2ZTCA 4IJHA 5IT9c 2VW9A 4A3IH 4DV0Q 2OWOA 4LF4Q 2FXQA 3S1NH 3TRZA 2R7FA 1BBWA 1UE1A 1ASYA 4JYAL 2ATWA 3B6YA 5C4XG 1X65A 1VQOA 1VS0A 2QEXA 1EIYB 1WJJA 1GKHA 4C3JH 4DV3L 4LFCQ 4DR2L 2VNUD 4WJ4A 4BBRG 4DV7L 1Q81C 3TS0A 3HKZE 3BU2A 5M3FH 1CKNA 3ULLA 1V9PA 1PHJA 4A3DG 4LFBL 1JJGA 4KLKA 4FDBA 3KDFA 3G71A 4J15A 1K8GA 4JI2Q 2MFIA 3AYHB 3OW2A 4UP9A 2JA6G 3ICEA 3FKIG 2JA9A 4A3GG 2E2JH 3KYHC 3A0JA 4A3IG 3EIVA 1QZHA 3I56A 3S2HH 1C7YA 5JJKA 3L0OA 3HKZG 3W1GA 2MO1A 4GNXA 1KC8C 1Y1VH 2WAQE 5GADC 4B3TL 1Q12A 1KRTA 1I5FA 2K5NA 4DK3C 3UDXA 2E2IH 3T1YL 1HZ9A 2VUMH 2VQEQ 2K75A 3NEMA 1N33Q 4P71A 1SE8A 3S15H 1NMGA 5M3FG 4HIOA 1PV4A 2Q2TA 4JI5L 1TWFH 4BBSH 1YI2A 4BBSG 1QVCA 2WAQG 4LF6L 4DK6C 1BVSA 5C4JH 1YBYA 1VQFA 2NN6G 1X55A 1Y1WH 4JOIC 5BR8L 4YCVA 4LUZA 1K73C 1GM5A 1OXVA 2ZJRA 1HR0W 1E7ZA 1B8AA 1Y1VG 1N9WA 2KCMA 5J3BA 2AMCB 2QGQA 1KAWA 1YNXA 2K50A 5LMUQ 4AQYQ 1PH5A 1JJ2A 5E7NA 4LF9L 1XNQL 3AEVA 4GOPC 2VUMG 2N49A 2UXCL 1G291 4NB3A 4P72A 4JBMA 4XIGS 4GKJQ 4A93H 3GTKH 2VL6A 3KF6B 4IO9A 1EFWA 4DKAC 3AFQA 5GAHC 1HR0Q 1W2BA 4Y52H 1PH2A 3ULJA 4X64Q 3S2DH 1XNRL 2RF4A 4XTCS 3M4QA 2E5LL 1Y1WG 1N32Q 2Q2UA 3CCUA 4DV5L 3RLOA 1U0LA 2EIFA 1L0WA 3DLLA 2IHFA 4NPSA 4DV6Q 1UWVA 4AIMA 1IXRA 2UXDQ 2Y0SE 1CSQA 2OCEA 2R7DA 3TQYA 4JBWA 4YWMA 1H95A 4JI4Q 2V1CC 3RR5A 2CFMA 1Q82C 3CCMA 2GN5A 4JI8Q 3F8TA 5IWAL 4K0KL 1OXXK 1QUQB 4A93G 4JI1L 1VQNA 5IYBH 1XPUA 4B3RQ 2DUDA 2PQAB 4GN5A 2YTXA 3GTJH 2Q2IA 2Y0SG 2YU9H 1X3FA 4KHPL 4OONA 4DR7L 3PO2H 1HNXL 2HHHL 4OX9Q 1X54A 2L15A 3A74A 2ZM6L 2GVBA 3PUYA 3H3VH 4DR4L 4QQBX 1T9HA 2UXCQ 1VQ7A 1IBML 2NVTH 4DR1Q 5AJ3Q 1NBWA 2WP8J 4R4IA 4JBJA 4A3JH 1K3RA 5C0XI 3PUVA 1VQGA 1V43A 4QJFA 4GOPB 2AWOA 3K80C 1YHQA 4B3SL 5IYBG 4AYBE 1EIFA 1G6PA 4QGUA 4A3FH 1A62A 1QZGA 1C9OA 1RIPA 2CCZA 3PO2G 4OWWB 2AWNA 1Y14B 2JJQA 3I55A 1WOCA 5JEAG 4LF5Q 2ES2A 2UU9L 1LTLA 4IPCA 5C3EH 3J7ZC 2R6GA 1ASZA 4AYBG 4X66Q 3A5ZB 1X56A 4PG3A 4JCVE 4A4IA 3CPWA 1HNWQ 4A3JG 2NN6I 3ERSX 1CKOA 1OXSC 2LXJA 4JI3L 4B3ML 3HKSA 3G4SA 2UUCQ 1X9NA 3KFUA 4YY3L 2EQSA 1HNZL 4A3FG 3CPFA 1Q46A 3I4OA 1PH4A 2JQOA 4JI7L 1XMOQ 1VQ9A 4DR6Q 2GVAA 2F52A 2BH2A 3CCVA 5JJLA 1PYBA 4HIDA 3UDFA 4KI0A 4HJ7A 1M1KC 3HOVH 5C3EG 4A3LH 3CD6A 4TQUS 1JB7A 3CMEA 2PI2E 1SFOH 4POFA 1GVPA 2N3SA 4X62L 1PH6A 1YHBA 1TWGH 3TREA 2D0OA 4B3SQ 1GD7A 3M7NA 4WJ3M 2MO0A 3KJPA 4A3KH 3CCJA 1YITA 4X65Q 5M5YH 1OXTA 3AFPA 5M5WH 1CUKA 1XMQL 2NZHA 2I0QA 4BY1H 4HJ9A 1AE3A 4IPHA 4LFAQ 3HOVG 4A3LG 4QY7A 1JE5A 5C0XG 2EXDA 2IX1A 4GLAC 3E9IA 4MZ9A 3JAMc 2QA4A 3F2BA 3GTPH 4YHHQ 4DNIA 1X3GA 3S1RH 4GKKL 1IBLQ 4UY8C 2ID0A 3CP0A 1I94Q 3PGZA 2YYZA 3I2ZA 4DV4L 4A76A 1HNZQ 4LUVA 5DLQE 1Z9FA 4NXNQ 4A3KG 4ME3A 4BY1G 3VDYA 1PFSA 1L1OA 1FGUA 4DUYL 4JI0Q 1K0RA 3S24A 3PF4A 4JI6L 3HOUH 2KHIA 2K52A 1LM0A 4JG2A 2IY5B 4JYAQ 1QVGA 3S17H 2HIXA 4RG1A 2YTVA 3H15A 1FVIA 3L7ZC 4DV3Q 1IBKL 1MIUA 1VQ5A 1O7IA 4DR2Q 3CC2A 1CKNB 1TWAH 4DR3L 3LGJA 3PUWA 3KDFB 4MNOA 4EX5A 5M5XH 4DV7Q 2NVQH 3H3VI 4LFBQ 3CQZH 1YHAA 2BH8A 2F4VL 2VQFL 1MJCA 1KQSA 1S72A 3MEFA 3HOZH 1VQ8A 1K83H 1MKHA 1PH9A 3KF8B 3S1MH 1S3OA 5K36G 3KLWA 4HJ8A 5GQOA 2VS1A 2JEBI 2NVYH 1WI5A 3HOUG 2Z0SA 1YIJA 4NXML 1PH8A 1I6HH 1FJGQ 4O0AA 2PQAA 4UP7A 3GO5A 3HOXH 4B3TQ 4LF7L 3T1YQ 1VQAA 1EWIA 4IFDJ 4KHZA 4PZ7A 4DUZL 2D62A 1B7YB 4JI5Q 3UDGA 3NELA 2CWAA 4DV1L 4LF6Q 3HOZG 1DGSA 3CCSA 4IOAA 4JI6Q 1N34L 1Q1EA 3JAMi 1D7QA 4C3IH 3AQQA 4PZ8A 5BR8Q 1SLJA 4ALPA 1VCIA 1B70B 1KD1C 1IYJB 3EBEA 2WB1E 4GN4B 1EUJA 1E1TA 3HOXG 4DV2L 1NY4A 4LF9Q 4A3BH 1TXYA 1XNQQ 1KRSA 3CMAA 3M9BA 2OQKA 4RMFA 3RN2A 3D0FA 3CF5A 3GTOH 1VQEA 3J81c 2UUBL 5LMNL 2WB1G 3H0GH 4C3HH 3CC7A 1WCMH 1A0IA 1VQJA 4TVAB 1BBUA 3CXCA 4L5RC 2E2HH 4GLXA 4LUOA 1XNRQ 1CSPA 4HJAA 2I5HA 1SN8A 2HQLA 4YWLA 4DR5L 2E5LQ 4BA2I 2UXBL 5EAYA 3G6EA 4DV5Q 1VQMA 4EQ5A 2K5VA 3PUXA 1J5EL 3KJOA 2OQ0A 4DPGA 1UE6A 3UE1A 2JA5H 4A3BG 4LF8L 2Z6KC 1FL0A 2B3GA 2BA1A 3CCLA 3OTOL 2F3IA 3DM3A 1Z47A 3UE0A 1VQBA 5IWAQ 4LF4L 4QIWE 4DV0L 4K0KQ 1XJVA 4DV1Q 3OYYA 1VQ6A 4JI1Q 2A8VA 1EYGA 3H0GG 2RCNA 5IY0A 1WCMG 2VZAA 1HZBA 1U5KA 4LFCL 2JE6I 1Q7YC 4KHPQ 5HY6A 4DR7Q 1HNXQ 2HHHQ 2ZM6Q 1HZCA 1J6QA 2JA8H 1RL2A 3BZCA 3E9HA 4O2DA 1R9TH 2JEAI 4DR4Q 1SMXA 3T1HL 3GTGH 1SROA 3W1BA 3PCOB 2YTYA 2JA5G 4JI2L 1IBMQ 3ZJYC 3FP9A 1NTGA 5LMNQ 1VQ4A 1PH1A 3WWVA 1VQCA 1SR3A 2ALYB 1HZAA 1Q8KA 5FJ8H 2D0PA 4C2MH 4A3CH 2VQEL 4GNXC 1PVOA 2AHOB 1YVCA 1N33L 4A3EH 5ELNA 2K14A 1NJIC 2UU9Q 2JA8G 2A1AA 3GTQH 1D8LA 3U58A 3ER0A 3STBD 3J81i 3OTOQ 4LWCA 3J7A5 2ASBA 1PA6A 1UE5A 4R4TA 2PMZE 3G48A 4JI3Q 5IP9H 3HOWH 1L1OC 1S40A 4BXXH 4B3MQ 3S16H 2B63H 3STBC 4R4QA 1FJGL 3HFZB 3PIPA 5LMUL 1X6OA 1UEBA 4AH6A 4YY3Q 3F2CA 4HIMA 5FJ8G 4AQYL 2KBNA 1YJWA 1N8RC 4A3CG 4JI7Q 4JV5L 4A3EG 4GKJL 3T1HQ 4YWKA 4GLVB 2KHJA 1VQKA 1HJPA 2VY3A 2ZJPA 1L2FA 3ULPA 4Y7NH 1I3QH 1HR0L 3K0XA 3CCQA 3GTLH 1A8VA 3KF6A 4X64L 4PMWA 5H1SE 2YV5A 4X62Q 2ZTEA 1JT8A 1X3EA 3E0EA 5GROA 1IZ6A 4P74A 3J81j 3I4MH 2R92H 1N32L 1I50H 5IP9G 2WFWA 3HOWG 1CKMA 2LXKA 1OXUA 4L5QA 4BXXG 4LW1A 2B63G 3PIOA 4P73A 2DGYA 4JC0A 4DV6L 4R4OA 3M3YH 4IFDI 3K8AA 4YCUA 2UXDL 3CW2C 4JI4L 3PO3H 3I7FA 1XMQQ 2XTIA 1P16A 3MXNB 2I5MX 4JI8L 5FLMH 1EQRA 2OTLA 3RN5A 1TWCH 4GS3A 3U4ZA 5M3MH 4GNXB 1EOVA 4B3RL 1E3PA 3RZDH 5FLXc 1QUQA 5GAEC 1XPOA 3RNUA 2K5HA 3HOYH 4H02A 3S1QH 3RLNA 2CKZB 1KXLA 1KL9A 1XTDA 2I5LX 1K9MC 4P75A 1NE3A 1W3SA 1MJEA 3I4MG 1VQLA 4OX9L 2R92G 4GKKQ 2JK8A 1JJCB 1EQQA 2H5XA 2Q2HA 5ELOA 4DV4Q 1Q86C 4IPGA 2UUAL 3CC4A 3NBHB 4POGA 4OO1I 1L1OB 3PSIA 4IOCA 5AJ3L 4DR1L 4JV5Q 4DAYB 3M4PA 4JOIA 1LYLA 3PO3G 5IYDH 5GAGC 4DUYQ 1OTCA 4X6AH 3CAMA 4MTNA 5FLMG 1QVFA 1VQPA 3NENA 5HGQA 1JMCA 5M3MG 3J80c 2IX0A 5IYCH 1WYDA 4GOPA 1PH3A 3SGIA 3HOYG 1IBKQ 4A75A 1E22A 4R1JA 3M85A 4LF5L 2OTJA 4DR3Q 4DAMA 1PH7A 5JEAJ 2C35B 5IP7H 1SRUA 3UDIA 4APVA 4X66L 2F4VQ 2VQFQ 4JBKA 4UP8A 3CCEA 1Q1BA 2KCTA 5IYDG 1HNWL 4BY7H 5C44H 2N78A 3K81C 4LNQA 3RLFA 2R93H 4OWTB 1YJNA 4NXMQ 5IYCG 3M4OH 1A63A 2A19A 2PI2A 2UUCL 3BZKA 1YJ9A 1VQHA 4R4CA 1YEZA 4LF7Q 5JJIA 2KENA 1XMOL 1N36L 3GD7A 4IFDG 4DR6L 2UUAQ 2RHQB 3U50C 1YZ6A 4PZ6A 4DUZQ 4A3MH 3GTMH 2RHSB 4GN3B 5IP7G 2HT1A 2B29A 2CWPA 4IPDA 1GO3E 1NMFA 4IJLA 5IE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LUZ A;  1N34 Q;  3A5U A;  2ZTD A;  4QL5 A;  1IL2 A;  4BY7 G;  1PYS B;  2K4K A;  3K7A H;  3EN2 A;  5C44 G;  1AH9 A;  2R93 G;  2IT1 A;  3JC6 6;  2MNA A;  3I4N H;  3K7U C;  3GDE A;  1WFQ A;  3KOJ A;  3TEH B;  3L2P A;  5LMN W;  4HIK A;  2MQH A;  1KIX A;  2NVX H;  2JA7 H;  4DV2 Q;  1G51 A;  3TS2 A;  4X65 L;  4A3G H;  2BA0 A;  4OO1 G;  1C0A A;  2R7Z H;  1HH2 P;  2NZO A;  1AE2 A;  2LSS A;  3PV0 A;  4YCW A;  4HJ5 A;  2XGT A;  4LFA L;  4A3M G;  2AKW B;  4UPA A;  5C4X H;  2UUB Q;  4L5S A;  5C0X J;  4OWX B;  3J80 i;  2CQO A;  3PUZ A;  1E1O A;  2ZJQ A;  2IHE A;  1KHI A;  1V1Q A;  3CCR A;  1P8L A;  4YHH L;  4DR5 Q;  1BKB A;  2UXB Q;  1TWH H;  1UE7 A;  4OXP A;  4BBR H;  2HIV A;  3FHW A;  2Z6K A;  3F2D A;  1IBL L;  3F1Z A;  1I94 L;  3I4N G;  4BA1 I;  3PF5 A;  4A3D H;  3W5O A;  4NXN L;  1VQI A;  1J5E Q;  2JA6 H;  2PNH A;  1E24 A;  2JA7 G;  1N36 Q;  3Q8D A;  2N8N A;  3RZO H;  3D31 A;  3FKI H;  3BJU A;  3U4V A;  1XPR A;  1K8A C;  1M90 C;  1VQD A;  4LF8 Q;  2R7Z G;  3S14 H;  2E8G A;  4JI0 L;  4L5T A;  3IRB A;  2ZTC A;  4IJH A;  5IT9 c;  2VW9 A;  4A3I H;  4DV0 Q;  2OWO A;  4LF4 Q;  2FXQ A;  3S1N H;  3TRZ A;  2R7F A;  1BBW A;  1UE1 A;  1ASY A;  4JYA L;  2ATW A;  3B6Y A;  5C4X G;  1X65 A;  1VQO A;  1VS0 A;  2QEX A;  1EIY B;  1WJJ A;  1GKH A;  4C3J H;  4DV3 L;  4LFC Q;  4DR2 L;  2VNU D;  4WJ4 A;  4BBR G;  4DV7 L;  1Q81 C;  3TS0 A;  3HKZ E;  3BU2 A;  5M3F H;  1CKN A;  3ULL A;  1V9P A;  1PHJ A;  4A3D G;  4LFB L;  1JJG A;  4KLK A;  4FDB A;  3KDF A;  3G71 A;  4J15 A;  1K8G A;  4JI2 Q;  2MFI A;  3AYH B;  3OW2 A;  4UP9 A;  2JA6 G;  3ICE A;  3FKI G;  2JA9 A;  4A3G G;  2E2J H;  3KYH C;  3A0J A;  4A3I G;  3EIV A;  1QZH A;  3I56 A;  3S2H H;  1C7Y A;  5JJK A;  3L0O A;  3HKZ G;  3W1G A;  2MO1 A;  4GNX A;  1KC8 C;  1Y1V H;  2WAQ E;  5GAD C;  4B3T L;  1Q12 A;  1KRT A;  1I5F A;  2K5N A;  4DK3 C;  3UDX A;  2E2I H;  3T1Y L;  1HZ9 A;  2VUM H;  2VQE Q;  2K75 A;  3NEM A;  1N33 Q;  4P71 A;  1SE8 A;  3S15 H;  1NMG A;  5M3F G;  4HIO A;  1PV4 A;  2Q2T A;  4JI5 L;  1TWF H;  4BBS H;  1YI2 A;  4BBS G;  1QVC A;  2WAQ G;  4LF6 L;  4DK6 C;  1BVS A;  5C4J H;  1YBY A;  1VQF A;  2NN6 G;  1X55 A;  1Y1W H;  4JOI C;  5BR8 L;  4YCV A;  4LUZ A;  1K73 C;  1GM5 A;  1OXV A;  2ZJR A;  1HR0 W;  1E7Z A;  1B8A A;  1Y1V G;  1N9W A;  2KCM A;  5J3B A;  2AMC B;  2QGQ A;  1KAW A;  1YNX A;  2K50 A;  5LMU Q;  4AQY Q;  1PH5 A;  1JJ2 A;  5E7N A;  4LF9 L;  1XNQ L;  3AEV A;  4GOP C;  2VUM G;  2N49 A;  2UXC L;  1G29 1;  4NB3 A;  4P72 A;  4JBM A;  4XIG S;  4GKJ Q;  4A93 H;  3GTK H;  2VL6 A;  3KF6 B;  4IO9 A;  1EFW A;  4DKA C;  3AFQ A;  5GAH C;  1HR0 Q;  1W2B A;  4Y52 H;  1PH2 A;  3ULJ A;  4X64 Q;  3S2D H;  1XNR L;  2RF4 A;  4XTC S;  3M4Q A;  2E5L L;  1Y1W G;  1N32 Q;  2Q2U A;  3CCU A;  4DV5 L;  3RLO A;  1U0L A;  2EIF A;  1L0W A;  3DLL A;  2IHF A;  4NPS A;  4DV6 Q;  1UWV A;  4AIM A;  1IXR A;  2UXD Q;  2Y0S E;  1CSQ A;  2OCE A;  2R7D A;  3TQY A;  4JBW A;  4YWM A;  1H95 A;  4JI4 Q;  2V1C C;  3RR5 A;  2CFM A;  1Q82 C;  3CCM A;  2GN5 A;  4JI8 Q;  3F8T A;  5IWA L;  4K0K L;  1OXX K;  1QUQ B;  4A93 G;  4JI1 L;  1VQN A;  5IYB H;  1XPU A;  4B3R Q;  2DUD A;  2PQA B;  4GN5 A;  2YTX A;  3GTJ H;  2Q2I A;  2Y0S G;  2YU9 H;  1X3F A;  4KHP L;  4OON A;  4DR7 L;  3PO2 H;  1HNX L;  2HHH L;  4OX9 Q;  1X54 A;  2L15 A;  3A74 A;  2ZM6 L;  2GVB A;  3PUY A;  3H3V H;  4DR4 L;  4QQB X;  1T9H A;  2UXC Q;  1VQ7 A;  1IBM L;  2NVT H;  4DR1 Q;  5AJ3 Q;  1NBW A;  2WP8 J;  4R4I A;  4JBJ A;  4A3J H;  1K3R A;  5C0X I;  3PUV A;  1VQG A;  1V43 A;  4QJF A;  4GOP B;  2AWO A;  3K80 C;  1YHQ A;  4B3S L;  5IYB G;  4AYB E;  1EIF A;  1G6P A;  4QGU A;  4A3F H;  1A62 A;  1QZG A;  1C9O A;  1RIP A;  2CCZ A;  3PO2 G;  4OWW B;  2AWN A;  1Y14 B;  2JJQ A;  3I55 A;  1WOC A;  5JEA G;  4LF5 Q;  2ES2 A;  2UU9 L;  1LTL A;  4IPC A;  5C3E H;  3J7Z C;  2R6G A;  1ASZ A;  4AYB G;  4X66 Q;  3A5Z B;  1X56 A;  4PG3 A;  4JCV E;  4A4I A;  3CPW A;  1HNW Q;  4A3J G;  2NN6 I;  3ERS X;  1CKO A;  1OXS C;  2LXJ A;  4JI3 L;  4B3M L;  3HKS A;  3G4S A;  2UUC Q;  1X9N A;  3KFU A;  4YY3 L;  2EQS A;  1HNZ L;  4A3F G;  3CPF A;  1Q46 A;  3I4O A;  1PH4 A;  2JQO A;  4JI7 L;  1XMO Q;  1VQ9 A;  4DR6 Q;  2GVA A;  2F52 A;  2BH2 A;  3CCV A;  5JJL A;  1PYB A;  4HID A;  3UDF A;  4KI0 A;  4HJ7 A;  1M1K C;  3HOV H;  5C3E G;  4A3L H;  3CD6 A;  4TQU S;  1JB7 A;  3CME A;  2PI2 E;  1SFO H;  4POF A;  1GVP A;  2N3S A;  4X62 L;  1PH6 A;  1YHB A;  1TWG H;  3TRE A;  2D0O A;  4B3S Q;  1GD7 A;  3M7N A;  4WJ3 M;  2MO0 A;  3KJP A;  4A3K H;  3CCJ A;  1YIT A;  4X65 Q;  5M5Y H;  1OXT A;  3AFP A;  5M5W H;  1CUK A;  1XMQ L;  2NZH A;  2I0Q A;  4BY1 H;  4HJ9 A;  1AE3 A;  4IPH A;  4LFA Q;  3HOV G;  4A3L G;  4QY7 A;  1JE5 A;  5C0X G;  2EXD A;  2IX1 A;  4GLA C;  3E9I A;  4MZ9 A;  3JAM c;  2QA4 A;  3F2B A;  3GTP H;  4YHH Q;  4DNI A;  1X3G A;  3S1R H;  4GKK L;  1IBL Q;  4UY8 C;  2ID0 A;  3CP0 A;  1I94 Q;  3PGZ A;  2YYZ A;  3I2Z A;  4DV4 L;  4A76 A;  1HNZ Q;  4LUV A;  5DLQ E;  1Z9F A;  4NXN Q;  4A3K G;  4ME3 A;  4BY1 G;  3VDY A;  1PFS A;  1L1O A;  1FGU A;  4DUY L;  4JI0 Q;  1K0R A;  3S24 A;  3PF4 A;  4JI6 L;  3HOU H;  2KHI A;  2K52 A;  1LM0 A;  4JG2 A;  2IY5 B;  4JYA Q;  1QVG A;  3S17 H;  2HIX A;  4RG1 A;  2YTV A;  3H15 A;  1FVI A;  3L7Z C;  4DV3 Q;  1IBK L;  1MIU A;  1VQ5 A;  1O7I A;  4DR2 Q;  3CC2 A;  1CKN B;  1TWA H;  4DR3 L;  3LGJ A;  3PUW A;  3KDF B;  4MNO A;  4EX5 A;  5M5X H;  4DV7 Q;  2NVQ H;  3H3V I;  4LFB Q;  3CQZ H;  1YHA A;  2BH8 A;  2F4V L;  2VQF L;  1MJC A;  1KQS A;  1S72 A;  3MEF A;  3HOZ H;  1VQ8 A;  1K83 H;  1MKH A;  1PH9 A;  3KF8 B;  3S1M H;  1S3O A;  5K36 G;  3KLW A;  4HJ8 A;  5GQO A;  2VS1 A;  2JEB I;  2NVY H;  1WI5 A;  3HOU G;  2Z0S A;  1YIJ A;  4NXM L;  1PH8 A;  1I6H H;  1FJG Q;  4O0A A;  2PQA A;  4UP7 A;  3GO5 A;  3HOX H;  4B3T Q;  4LF7 L;  3T1Y Q;  1VQA A;  1EWI A;  4IFD J;  4KHZ A;  4PZ7 A;  4DUZ L;  2D62 A;  1B7Y B;  4JI5 Q;  3UDG A;  3NEL A;  2CWA A;  4DV1 L;  4LF6 Q;  3HOZ G;  1DGS A;  3CCS A;  4IOA A;  4JI6 Q;  1N34 L;  1Q1E A;  3JAM i;  1D7Q A;  4C3I H;  3AQQ A;  4PZ8 A;  5BR8 Q;  1SLJ A;  4ALP A;  1VCI A;  1B70 B;  1KD1 C;  1IYJ B;  3EBE A;  2WB1 E;  4GN4 B;  1EUJ A;  1E1T A;  3HOX G;  4DV2 L;  1NY4 A;  4LF9 Q;  4A3B H;  1TXY A;  1XNQ Q;  1KRS A;  3CMA A;  3M9B A;  2OQK A;  4RMF A;  3RN2 A;  3D0F A;  3CF5 A;  3GTO H;  1VQE A;  3J81 c;  2UUB L;  5LMN L;  2WB1 G;  3H0G H;  4C3H H;  3CC7 A;  1WCM H;  1A0I A;  1VQJ A;  4TVA B;  1BBU A;  3CXC A;  4L5R C;  2E2H H;  4GLX A;  4LUO A;  1XNR Q;  1CSP A;  4HJA A;  2I5H A;  1SN8 A;  2HQL A;  4YWL A;  4DR5 L;  2E5L Q;  4BA2 I;  2UXB L;  5EAY A;  3G6E A;  4DV5 Q;  1VQM A;  4EQ5 A;  2K5V A;  3PUX A;  1J5E L;  3KJO A;  2OQ0 A;  4DPG A;  1UE6 A;  3UE1 A;  2JA5 H;  4A3B G;  4LF8 L;  2Z6K C;  1FL0 A;  2B3G A;  2BA1 A;  3CCL A;  3OTO L;  2F3I A;  3DM3 A;  1Z47 A;  3UE0 A;  1VQB A;  5IWA Q;  4LF4 L;  4QIW E;  4DV0 L;  4K0K Q;  1XJV A;  4DV1 Q;  3OYY A;  1VQ6 A;  4JI1 Q;  2A8V A;  1EYG A;  3H0G G;  2RCN A;  5IY0 A;  1WCM G;  2VZA A;  1HZB A;  1U5K A;  4LFC L;  2JE6 I;  1Q7Y C;  4KHP Q;  5HY6 A;  4DR7 Q;  1HNX Q;  2HHH Q;  2ZM6 Q;  1HZC A;  1J6Q A;  2JA8 H;  1RL2 A;  3BZC A;  3E9H A;  4O2D A;  1R9T H;  2JEA I;  4DR4 Q;  1SMX A;  3T1H L;  3GTG H;  1SRO A;  3W1B A;  3PCO B;  2YTY A;  2JA5 G;  4JI2 L;  1IBM Q;  3ZJY C;  3FP9 A;  1NTG A;  5LMN Q;  1VQ4 A;  1PH1 A;  3WWV A;  1VQC A;  1SR3 A;  2ALY B;  1HZA A;  1Q8K A;  5FJ8 H;  2D0P A;  4C2M H;  4A3C H;  2VQE L;  4GNX C;  1PVO A;  2AHO B;  1YVC A;  1N33 L;  4A3E H;  5ELN A;  2K14 A;  1NJI C;  2UU9 Q;  2JA8 G;  2A1A A;  3GTQ H;  1D8L A;  3U58 A;  3ER0 A;  3STB D;  3J81 i;  3OTO Q;  4LWC A;  3J7A 5;  2ASB A;  1PA6 A;  1UE5 A;  4R4T A;  2PMZ E;  3G48 A;  4JI3 Q;  5IP9 H;  3HOW H;  1L1O C;  1S40 A;  4BXX H;  4B3M Q;  3S16 H;  2B63 H;  3STB C;  4R4Q A;  1FJG L;  3HFZ B;  3PIP A;  5LMU L;  1X6O A;  1UEB A;  4AH6 A;  4YY3 Q;  3F2C A;  4HIM A;  5FJ8 G;  4AQY L;  2KBN A;  1YJW A;  1N8R C;  4A3C G;  4JI7 Q;  4JV5 L;  4A3E G;  4GKJ L;  3T1H Q;  4YWK A;  4GLV B;  2KHJ A;  1VQK A;  1HJP A;  2VY3 A;  2ZJP A;  1L2F A;  3ULP A;  4Y7N H;  1I3Q H;  1HR0 L;  3K0X A;  3CCQ A;  3GTL H;  1A8V A;  3KF6 A;  4X64 L;  4PMW A;  5H1S E;  2YV5 A;  4X62 Q;  2ZTE A;  1JT8 A;  1X3E A;  3E0E A;  5GRO A;  1IZ6 A;  4P74 A;  3J81 j;  3I4M H;  2R92 H;  1N32 L;  1I50 H;  5IP9 G;  2WFW A;  3HOW G;  1CKM A;  2LXK A;  1OXU A;  4L5Q A;  4BXX G;  4LW1 A;  2B63 G;  3PIO A;  4P73 A;  2DGY A;  4JC0 A;  4DV6 L;  4R4O A;  3M3Y H;  4IFD I;  3K8A A;  4YCU A;  2UXD L;  3CW2 C;  4JI4 L;  3PO3 H;  3I7F A;  1XMQ Q;  2XTI A;  1P16 A;  3MXN B;  2I5M X;  4JI8 L;  5FLM H;  1EQR A;  2OTL A;  3RN5 A;  1TWC H;  4GS3 A;  3U4Z A;  5M3M H;  4GNX B;  1EOV A;  4B3R L;  1E3P A;  3RZD H;  5FLX c;  1QUQ A;  5GAE C;  1XPO A;  3RNU A;  2K5H A;  3HOY H;  4H02 A;  3S1Q H;  3RLN A;  2CKZ B;  1KXL A;  1KL9 A;  1XTD A;  2I5L X;  1K9M C;  4P75 A;  1NE3 A;  1W3S A;  1MJE A;  3I4M G;  1VQL A;  4OX9 L;  2R92 G;  4GKK Q;  2JK8 A;  1JJC B;  1EQQ A;  2H5X A;  2Q2H A;  5ELO A;  4DV4 Q;  1Q86 C;  4IPG A;  2UUA L;  3CC4 A;  3NBH B;  4POG A;  4OO1 I;  1L1O B;  3PSI A;  4IOC A;  5AJ3 L;  4DR1 L;  4JV5 Q;  4DAY B;  3M4P A;  4JOI A;  1LYL A;  3PO3 G;  5IYD H;  5GAG C;  4DUY Q;  1OTC A;  4X6A H;  3CAM A;  4MTN A;  5FLM G;  1QVF A;  1VQP A;  3NEN A;  5HGQ A;  1JMC A;  5M3M G;  3J80 c;  2IX0 A;  5IYC H;  1WYD A;  4GOP A;  1PH3 A;  3SGI A;  3HOY G;  1IBK Q;  4A75 A;  1E22 A;  4R1J A;  3M85 A;  4LF5 L;  2OTJ A;  4DR3 Q;  4DAM A;  1PH7 A;  5JEA J;  2C35 B;  5IP7 H;  1SRU A;  3UDI A;  4APV A;  4X66 L;  2F4V Q;  2VQF Q;  4JBK A;  4UP8 A;  3CCE A;  1Q1B A;  2KCT A;  5IYD G;  1HNW L;  4BY7 H;  5C44 H;  2N78 A;  3K81 C;  4LNQ A;  3RLF A;  2R93 H;  4OWT B;  1YJN A;  4NXM Q;  5IYC G;  3M4O H;  1A63 A;  2A19 A;  2PI2 A;  2UUC L;  3BZK A;  1YJ9 A;  1VQH A;  4R4C A;  1YEZ A;  4LF7 Q;  5JJI A;  2KEN A;  1XMO L;  1N36 L;  3GD7 A;  4IFD G;  4DR6 L;  2UUA Q;  2RHQ B;  3U50 C;  1YZ6 A;  4PZ6 A;  4DUZ Q;  4A3M H;  3GTM H;  2RHS B;  4GN3 B;  5IP7 G;  2HT1 A;  2B29 A;  2CWP A;  4IPD A;  1GO3 E;  1NMF A;  4IJL A;  5IE8 A; 
#chains in the Genus database with same CATH topology
 4BY7 G;  4QL5 A;  1PYS B;  3IL8 A;  2IT1 A;  3JC6 6;  3K7U C;  3GDE A;  1WFQ A;  2NVX H;  1GJX A;  3TS2 A;  2TSS A;  2R7Z H;  1HH2 P;  5C4X B;  1AE2 A;  1NCV A;  4LFA L;  2XGT A;  4KKT A;  4L5S A;  4FXK C;  5C0X J;  1WD0 A;  2ZJQ A;  1WTP A;  1KHI A;  4HSV A;  4YHH L;  4DR5 Q;  4A3E B;  1TWH H;  4OXP A;  2F0K A;  4BBR H;  2Z6K A;  2F3W A;  1I94 L;  3I4N G;  3CRL C;  3LNN A;  4A3D H;  1II3 A;  2JA7 G;  2PNH A;  1E24 A;  5BN5 A;  4DAP A;  2IJ0 A;  5IGF A;  1I4R A;  2E2D C;  4LF8 Q;  1TS2 A;  3S14 H;  2E8G A;  3HOW B;  3IRB A;  4A3I H;  4IJH A;  2VW9 A;  1SNC A;  4DV0 Q;  4FF3 A;  3S1N H;  2FXQ A;  2Z6B A;  3TRZ A;  2VB2 X;  5C4X G;  1UE1 A;  4WJW A;  2KEC A;  2ATW A;  4JYA L;  1CHQ D;  2QEX A;  2CHB D;  4K6L A;  2E74 C;  1GKH A;  1EZ6 A;  5CC4 A;  4DR2 L;  1H9K A;  4BBS B;  1SNP A;  2WAQ B;  2XWB B;  1CKN A;  1O7Z A;  3L9A X;  4ZKC B;  1SYC A;  3GTL B;  4FDB A;  3KDF A;  4J15 A;  1LT6 D;  2MFI A;  3TN2 A;  2JA9 A;  2E2J H;  1WTH A;  3KYH C;  1QZH A;  2EYF A;  3L0O A;  3HKZ G;  4GNX A;  1Q12 A;  4DK3 C;  2K5N A;  1HZ9 A;  1EOT A;  3NEM A;  1STA A;  5C4H A;  2M9V A;  1NMG A;  2A6E C;  2ENB A;  2EYM A;  3RZD B;  4JI5 L;  1YI2 A;  4BBS G;  1QVC A;  2WAQ G;  2F0S A;  1E2V A;  1VQF A;  4RCO A;  4F7X A;  1C48 A;  1X55 A;  5DEH A;  4JOI C;  1K73 C;  1OXV A;  1RKN A;  1HR0 W;  1CZW A;  2KCM A;  5CV4 A;  3AMU A;  3AEV A;  1AN8 A;  2VUM G;  2N49 A;  1G29 1;  4P72 A;  1GUS A;  1VMC A;  4GKJ Q;  1BCP C;  1PTO B;  2BE5 C;  3DHQ A;  5GAH C;  1ILQ A;  2SOB A;  3MAQ A;  3ULJ A;  4X64 Q;  4HAE A;  3SK4 A;  3M4Q A;  5IIF A;  1Y1W G;  1N32 Q;  1F2Y A;  1M8A A;  5KNC A;  1IYV A;  4OHJ A;  1CHP D;  3NTI A;  2Y0S E;  2R7D A;  1I4X A;  5C5M A;  4K2K A;  5C44 B;  3RR5 A;  2CFM A;  3D8G A;  2GN5 A;  4G57 A;  2R93 B;  3F8T A;  4K0K L;  1QUQ B;  1GUN A;  4K5W A;  2PZW A;  1VQN A;  2DUD A;  2OEO A;  4GN5 A;  2Q2I A;  1MSH A;  1X3F A;  4OON A;  1HRJ A;  3PO2 H;  1HNX L;  1O7Y A;  1X54 A;  2B2U A;  2A68 D;  5JEA H;  2ZM6 L;  4IUN A;  2F0O A;  4DR4 L;  5I2X A;  1T9H A;  1SJH D;  1HA5 A;  4DR1 Q;  1O78 A;  4A3J H;  1K3R A;  3E5S A;  1V43 A;  5KIX A;  1AZP A;  5CMD A;  1S4Z A;  4IAL A;  3SEB A;  4A3F H;  2RVL A;  1QZG A;  2Q8R E;  1C9O A;  1ZEQ X;  4OWW B;  4OIK A;  3I55 A;  2UU9 L;  2B2T C;  1S5B D;  1J8I A;  1XWE A;  4A4I A;  1HNW Q;  5K5P A;  2NN6 I;  1FYC A;  2EY2 A;  2LXJ A;  4EQP A;  1PLF A;  4B3M L;  4S3S A;  3G4S A;  2UUC Q;  1X9N A;  4PV1 C;  4YY3 L;  3I4O A;  1Q46 A;  1XMO Q;  4DK0 A;  4DR6 Q;  1EY0 A;  2F0N A;  3CCV A;  2BH2 A;  1PYB A;  5E3F A;  1EEF D;  4HJ7 A;  4A3L H;  3H6M A;  4C3J B;  4KY6 A;  1GVP A;  5D3D A;  1YHB A;  3H09 A;  4BS9 A;  3I73 A;  1CQV A;  4B3S Q;  2L12 A;  3QR8 A;  1D5Z C;  4K5V A;  3R2T A;  3PIP 3;  1XMQ L;  4BY1 H;  2F0I A;  1E0B A;  1AE3 A;  2DY8 A;  4LFA Q;  1SDF A;  3MXN A;  4QY7 A;  5C0X G;  2IX1 A;  5DM6 3;  2RDF A;  3JAM c;  4YHH Q;  3HZX A;  4C3J G;  3S1R H;  4GKK L;  3S15 B;  2ID0 A;  1BBX C;  1I94 Q;  3L3O C;  3I2Z A;  3PGZ A;  1Z9F A;  1EYC A;  2IL8 A;  3NBH A;  1PFS A;  1L1O A;  1J9O A;  1BQQ T;  4JI6 L;  4XYO A;  1G91 A;  4JYA Q;  2F0V A;  1IBK L;  1BNZ A;  4ZUJ A;  1O7I A;  4DR2 Q;  1JWU D;  1TWA H;  3GTK B;  1D5X C;  1QNU A;  4MNO A;  4CJ2 C;  2ZT9 C;  2MHV A;  3BYY B;  1YHA A;  2F4V L;  3S2D B;  3NTK A;  2WAC A;  3MEF A;  1PZK D;  2F0T A;  4ZCK A;  1MKH A;  2PPB C;  3KF8 B;  5K36 G;  2QDB A;  4KN4 C;  1O80 A;  1MHW C;  5JOB A;  2VS1 A;  3ERQ A;  4HJ8 A;  2VB3 X;  1DJR D;  1HA6 A;  2EJF C;  2PQA A;  4UP7 A;  5EKL A;  5G3L F;  3G7L A;  3E6Z X;  3M7G A;  4LF7 L;  4G4K A;  1CA5 A;  2QIL A;  1L0X B;  2P5Z X;  4PZ7 A;  1K8M A;  2KCN A;  4JI5 Q;  2B2U C;  3UDG A;  3GTJ B;  4DV1 L;  1DGS A;  3BVM A;  3R2I A;  1E2Z A;  3CCS A;  4IOA A;  5ISR A;  4EGV A;  2WII B;  4B08 A;  2LKV A;  2NTT A;  1KNE A;  2MPM A;  4C3I H;  4PZ8 A;  4AYB B;  3EBE A;  4DV2 L;  2IW3 A;  1TXY A;  3NTH A;  4RKL A;  1KRS A;  1WTO A;  3CMA A;  1S5D D;  4RMF A;  1TVX A;  3H0G B;  1YNJ C;  4V19 0;  3S16 B;  2HUG A;  4NDX A;  1TS3 A;  1T5X D;  5LMN L;  2UUB L;  1F2M A;  4GLX A;  1K3B C;  4KKU A;  2UXB L;  3P7J A;  5D14 A;  4G7Z C;  4RHS A;  2G9D A;  1J5E L;  2NTS A;  3UE1 A;  3NBI A;  5KYL A;  1HCZ A;  4ZK9 B;  3OHX C;  2N55 A;  4LF4 L;  1VQB A;  4OEL B;  4K0K Q;  1ZYR D;  3V05 A;  3H0G G;  4FF1 A;  2JE6 I;  3D6W A;  1HNX Q;  2ZM6 Q;  2BCO A;  1SYG A;  1V1P A;  4DR4 Q;  4JI2 L;  2YTY A;  4F88 A;  3MXG A;  1TWG B;  2ICI A;  1L0Y B;  2ZXR A;  3SDZ A;  1NTG A;  1PH1 A;  3WWV A;  4WOR A;  3MEH A;  1VQC A;  4RH6 A;  2M00 A;  5M5W B;  3WOF A;  5COY A;  1BOS A;  4A3C H;  2VQE L;  2A69 D;  2AHO B;  1YVC A;  1N33 L;  4KY7 A;  4A3E H;  1B2T A;  1PRT C;  2K14 A;  4CJ0 B;  2UU9 Q;  1GUG A;  3GTQ H;  1D8L A;  4L8J A;  3STB D;  3GTP B;  1PTO D;  3J7A 5;  2FFK B;  1JQY D;  1V1O A;  3IFD A;  3C3L A;  3HOW H;  1L1O C;  2DY7 A;  4B3M Q;  3N6R A;  4RWS C;  3PIP A;  3AU7 A;  1SNO A;  4AH6 A;  4YY3 Q;  4HIM A;  1V8Q A;  1N8R C;  2KBN A;  1BF4 A;  3OSO A;  1C4Q A;  1TKW B;  1IW7 C;  1HJP A;  2VY3 A;  1L2F A;  1U4M A;  3GTL H;  1JT8 A;  1X3E A;  5GRO A;  1IZ6 A;  3M3Y B;  1CKM A;  2LXK A;  4L5Q A;  2B2W A;  3HOZ B;  1WTR A;  4P73 A;  4J8Q A;  1XMQ Q;  2XTI A;  5EPJ A;  2I5M X;  2OTL A;  4FP5 D;  4GS3 A;  4O1N A;  1E3P A;  3RZD H;  5FLX c;  1JC7 A;  3HOY H;  4H44 C;  1EIG A;  1KL9 A;  1K9M C;  3HG9 A;  4LMQ D;  4GKK Q;  3I90 A;  5CR3 A;  2CQA A;  4RAU C;  2EZV A;  2A6H C;  2Q2H A;  2WB1 B;  2ZXP A;  4KD3 A;  3QB3 A;  4H7B A;  4IOC A;  5AJ3 L;  1EY5 A;  5IYD H;  3M4P A;  4ILW A;  4IUV A;  3PO3 G;  4QCL A;  4FXD A;  1OTC A;  5I9O A;  3J7A F;  1VQP A;  2IX0 A;  3MC0 B;  5IYC H;  1PTO H;  1SE3 A;  4A3B B;  4ME5 A;  2QDL A;  2RKS A;  2X6L A;  4RKB A;  4GOP A;  1PH3 A;  2E75 C;  3NWT A;  4HED A;  1IBK Q;  2EJM A;  5IOC A;  1E22 A;  4LF5 L;  2OTJ A;  1PH7 A;  2C35 B;  1SRU A;  4C3H B;  1KAB A;  2F4V Q;  4UDU C;  2E2H B;  4CJ1 B;  3VA5 A;  3CCE A;  2FHT A;  1TS5 A;  1JOQ A;  5C44 H;  2R93 H;  4XQN A;  4CDC C;  3BZK A;  3NHH A;  4LF7 Q;  4A3M B;  1LTT D;  1B1Z A;  1SNM A;  2RHS B;  1RD9 D;  4FXG C;  3EFX D;  1GUT A;  2RSO A;  1NMF A;  2XSC A;  4IJL A;  5IE8 A;  3A5U A;  3QO2 A;  1Q8I A;  2K4K A;  2JA8 B;  2K28 A;  3T13 A;  5CV7 A;  5JVH 3;  3KOJ A;  3L2P A;  4OL7 A;  4HIK A;  4DV2 Q;  1G51 A;  3NWS A;  4OO1 G;  2B2Y A;  5J39 A;  4HMI A;  4TSS A;  4YCW A;  1I4Q A;  4RA8 A;  4A3M G;  2AKW B;  2UUB Q;  3TZD A;  3J80 i;  3PUZ A;  1E1O A;  4C2M B;  2IHE A;  1V1Q A;  1P8L A;  2UXB Q;  1IBL L;  2MGS A;  4FYD A;  3F2D A;  2PCF B;  2EJG C;  2RA4 A;  1PZJ D;  4HCE A;  3SK8 A;  1NUC A;  4NXN L;  1J5E Q;  4A3G G;  1SYB A;  3RZO H;  3D31 A;  3FKI H;  1XPR A;  1K8A C;  2MP1 A;  4L5T A;  5KGU A;  5IT9 c;  4LF4 Q;  1HTL D;  2B63 B;  1ASY A;  1VS0 A;  4X3U A;  4C3J H;  3TDQ A;  3BVZ A;  3I72 A;  4WJ4 A;  4DV7 L;  1CZG A;  3VYR A;  3BU2 A;  1EFI D;  2KUM A;  4LFB L;  3D6C A;  1JJG A;  3G71 A;  2JA6 G;  3EQL C;  4JI2 Q;  1EY7 A;  2F0W A;  4DN4 M;  1ZKO A;  2B2W C;  4PNY A;  3I4M B;  2K5D A;  5F2D A;  1RHP A;  3W1G A;  2MO1 A;  1KC8 C;  2PO4 A;  1Y1V H;  1AFP A;  1KRT A;  4QUC A;  3UDX A;  3TP8 A;  2VQE Q;  1NNX A;  1N33 Q;  1TWC B;  1RTO A;  3FEW X;  3S15 H;  1NSN S;  5M3F G;  4HIO A;  1TWF H;  3MVV A;  1M4V A;  4LF6 L;  2J0T D;  1BVS A;  1NR4 A;  1QCB D;  2AQ1 B;  1ROD A;  4DF7 A;  2EDG A;  2NN6 G;  1G6Z A;  4YCV A;  4LUZ A;  5C3W A;  5JJZ A;  2K05 A;  5CV9 A;  2SNS A;  5C6A A;  1PTO F;  5FOB B;  1N9W A;  1C0A A;  2AMC B;  4LF9 L;  1KAW A;  1I4G A;  2K50 A;  1PH5 A;  1XNQ L;  4GOP C;  2RDG A;  3O13 A;  2L4N A;  4JBM A;  3GTK H;  3KF6 B;  1EFW A;  1CFM A;  2CW0 C;  4KJO A;  1H9S B;  3S2D H;  3CCU A;  3N52 A;  3C46 A;  1K28 A;  5FK9 C;  3NE5 B;  2EIF A;  1L0W A;  1UWV A;  4AIM A;  4CDE C;  3BDL A;  5CV8 A;  1Q82 C;  4A93 G;  3HEJ A;  1KAA A;  4J1M A;  2EOT A;  1CM9 A;  4WFN 3;  3GTJ H;  3K5M A;  4KHP L;  4DR7 L;  2PQE A;  2HHH L;  1STB A;  4I65 A;  4RGT A;  3NP8 A;  1C8C A;  2GVB A;  3PUY A;  3SK5 A;  3H3V H;  1KLG D;  4QQB X;  1XXG A;  3P1H A;  2UXC Q;  1VQ7 A;  1U4R A;  4QUF A;  1GOZ A;  5AJ3 Q;  1JOR A;  1NBW A;  1PFN A;  4K5X A;  4R4I A;  2CH4 A;  4L63 B;  1VF7 A;  3RMH A;  2A68 C;  2EYO A;  1VQG A;  2B2Y C;  3MXU A;  4CKB A;  4B3S L;  2JA7 B;  5I4D A;  5IYB G;  4AYB E;  1EIF A;  3TME A;  1BCP B;  1ENA A;  5L37 A;  1A62 A;  1RIP A;  2AWN A;  4LF5 Q;  1UAP A;  5C3E H;  3J7Z C;  2X6G A;  1ASZ A;  1IL8 A;  3A5Z B;  4PG3 A;  3ERS X;  1CKO A;  4JI3 L;  4DU9 A;  3J80 E;  4IQZ A;  2JN4 A;  5EGT A;  3HKS A;  3KFU A;  2HCI A;  2F0P A;  3H91 A;  2JQO A;  4JI7 L;  4N8F A;  2F52 A;  1SFO B;  3HKZ B;  4HID A;  3HOV H;  4KI0 A;  3Q0A A;  4ZRZ A;  3CD6 A;  2XIW A;  1JB7 A;  2PI2 E;  5JPM C;  3BYT B;  1TWG H;  3DEP A;  2D0O A;  1QIL A;  1TR5 A;  2RCF A;  2N88 A;  4UHV A;  3DXJ C;  2MO0 A;  3KJP A;  3OWE B;  1B9N A;  3CCJ A;  4A3K H;  5M5Y H;  2XNA C;  3V2T A;  3AFP A;  5M5W H;  5C5L A;  2O5I C;  1LTA D;  5G3L D;  4IPH A;  1S5F D;  3DWA A;  4GLA C;  2KHS A;  2F0U A;  2E2I B;  3E9I A;  1JIC A;  2VUM B;  3GTP H;  2EY6 A;  3A56 A;  4MHE A;  4DNT B;  1IBL Q;  4HTH A;  3T56 B;  1HNZ Q;  1PZI D;  2C9O A;  5DLQ E;  4NXN Q;  1HFG A;  5ELB A;  1GHJ A;  3J80 L;  3VDY A;  1Y1W B;  1G8Z D;  1K0R A;  4FVM A;  3K58 A;  3HOU H;  2K52 A;  2HIX A;  2YTV A;  2SEB D;  2NVQ B;  5KND A;  1MIU A;  5DM7 3;  1VQ5 A;  1CKN B;  3PUW A;  1EQT A;  3KDF B;  3LGJ A;  1GXD C;  4DV7 Q;  3PQI A;  4LFB Q;  3CQZ H;  3VR3 A;  5CV5 A;  1KQS A;  3EJI A;  1DYQ A;  3HOZ H;  1PH9 A;  3S1M H;  3A8J E;  4ZUI A;  4CKE A;  3KLW A;  4C1N K;  2JEB I;  3D4R A;  1YIJ A;  4NXM L;  3QJY A;  3K5L A;  3VR2 A;  2K6A A;  1EY9 A;  1BR9 A;  3ND9 A;  2D62 A;  1B7Y B;  3K57 A;  3NEL A;  2YU9 B;  4LF6 Q;  3OIQ A;  5IGB A;  1N34 L;  2F0E A;  4DXF A;  3AQQ A;  1X3Q A;  3JAM E;  4ALP A;  1VCI A;  1B70 B;  3CKI B;  2O5J C;  2WB1 E;  5LL6 S;  1EUJ A;  1E1T A;  2C5C A;  3HOX G;  2R3Z A;  4LF9 Q;  4A3B H;  1XNQ Q;  4EQO A;  1S5E D;  2OQK A;  3RN2 A;  1WCM B;  1FNU A;  1VQE A;  4G7H C;  1JB3 A;  4ZYS A;  4C3H H;  1VQJ A;  1LLR D;  2KA7 A;  3MTS A;  4TVA B;  3CXC A;  4ID6 A;  2E2H H;  2EE1 A;  4LUO A;  4HJA A;  2I5H A;  2XRS D;  5EAY A;  1MBY A;  1LT4 D;  4CDD C;  1EY4 A;  1D2B A;  4EQ5 A;  3PUX A;  3OPO A;  2G9H D;  3TZU A;  3KJO A;  1UE6 A;  2Z6K C;  3MFG A;  3BZD B;  3CCL A;  3DM3 A;  3UE0 A;  3OW7 A;  1XJV A;  1VQ6 A;  3OYY A;  1GUO A;  3SHL A;  2RCN A;  1WCM G;  4MTK A;  1U5K A;  1Q7Y C;  3FDT A;  5HY6 A;  1STG A;  4DR7 Q;  1ZYR C;  4KHP Q;  3GTG B;  2HHH Q;  1BDO A;  2KJX A;  2JA8 H;  3UI2 A;  4B9W A;  2JEA I;  3E9H A;  1JE4 A;  3CU7 A;  1SMX A;  2JA5 G;  3W1B A;  3PCO B;  2NUC A;  2F1M A;  2K04 A;  1IKL A;  3CHB D;  5FJ8 H;  2TMP A;  5E1F A;  4C2M H;  4GNX C;  1PVO A;  1YNN C;  4X3S A;  1XYI A;  4YIJ A;  1CA6 A;  2L11 A;  3X3M A;  3U58 A;  2PZU A;  3IFT A;  3J81 i;  3DEO A;  3NK9 A;  1PA6 A;  1UE5 A;  4R4T A;  2FMC A;  4JI3 Q;  5IP9 H;  5FO8 B;  4MN3 A;  2B63 H;  3STB C;  1FJG L;  5LMU L;  1X6O A;  4XT1 B;  3T16 A;  2QCP X;  4JI7 Q;  3D3R A;  2NB0 A;  4GLV B;  3S17 B;  1KDB A;  2IPK D;  3CCQ A;  1I50 B;  1A8V A;  3KF8 A;  4JK1 C;  3J81 j;  2EVB A;  3I4M H;  2R92 H;  2D2C C;  2A6E D;  2DJG C;  2WFW A;  4BXX G;  4LW1 A;  3I91 A;  4DV6 L;  2UXD L;  1AEX A;  4IFD I;  3K8A A;  3ZYY X;  4IUQ A;  3I7F A;  3MXN B;  1W6J A;  1LTB D;  1HFN A;  5FLM H;  2XRQ D;  3S1Q B;  1I6H B;  1TWC H;  2NBF A;  3A55 A;  1PRT B;  4K14 A;  3RNU A;  2I5L X;  1NE3 A;  3KUP A;  1MJE A;  2KCC A;  1JJC B;  4JVZ A;  5ELO A;  1Q86 C;  2XWJ B;  2AUK A;  3NBH B;  1L1O B;  4JV5 Q;  4DAY B;  1LYL A;  2XN9 C;  5GAG C;  1SMY D;  5HGQ A;  1F2Z A;  2KOL A;  5M3M G;  1JMC A;  3VR6 A;  3SGI A;  5ELF A;  4DA2 A;  4IFD H;  3K59 A;  3GTO B;  4K2L A;  5JEA J;  1IKM A;  5IP7 H;  1WTQ A;  2DJF C;  4H13 C;  1MI2 A;  4BY7 H;  2JSO A;  4LNQ A;  2G5D A;  1SSO A;  2WKC A;  1YJN A;  4NXM Q;  2J4X A;  4LJZ C;  2PI2 A;  3D4D A;  1DOM A;  2UUA Q;  1K0S A;  1SE4 A;  1A2U A;  2HT1 A;  2L1B A;  1DON A;  1GO3 E;  1VDZ A;  1WTW A;  1LUZ A;  1N34 Q;  3FPU B;  5FLX E;  1IYU A;  3EN2 A;  1HTP A;  4FF2 A;  2MNA A;  1ICW A;  3I4N H;  2R7Z B;  3OMC A;  5LMN W;  1KIX A;  2JA7 H;  2NYZ D;  3QOJ A;  4X65 L;  1FNV A;  2BA0 A;  4U68 A;  4C1N I;  1R4Q B;  4KK7 A;  4KV6 A;  2NZ1 D;  5I6W A;  2BDO A;  3PV0 A;  1H9R A;  5C4X H;  2EY5 A;  2CQO A;  4PMB A;  3CCR A;  1RTN A;  2K01 A;  1UE7 A;  2HIV A;  3FHW A;  4J6H A;  3F1Z A;  5AFW A;  4BA1 I;  3PF5 A;  3W5O A;  1ESR A;  4A3I B;  1B3Q A;  2PW5 A;  2N8N A;  2Z4H A;  3Q8D A;  3BS1 A;  3BJU A;  3U4V A;  1M90 C;  2R7Z G;  3TP7 A;  3C2P A;  1STE A;  2ZTC A;  4ZAI A;  2R7F A;  3J81 E;  3B6Y A;  3QG1 A;  1VQO A;  1WJJ A;  5ELC A;  4IN3 A;  2VNU D;  4OIJ A;  1V1P B;  1F9P A;  4BBR G;  1R4P B;  4Y7N B;  3HKZ E;  3TS0 A;  2E2J B;  1RJT A;  4A3D G;  1A3T A;  4KLK A;  4BBS H;  1EU4 A;  3AYH B;  3OW2 A;  4UP9 A;  4BWG B;  1KTK A;  4N9P A;  4RFB A;  2XVS A;  4A3I G;  3EIV A;  3I56 A;  1AZQ A;  1C7Y A;  5JJK A;  2FIN B;  2WAQ E;  5GAD C;  4B3T L;  3PO3 B;  2E2I H;  4X3T A;  4WRD A;  2VUM H;  2K75 A;  1SE8 A;  3CRK C;  3F2U A;  1PV4 A;  3GQB A;  4OGQ C;  5JAV A;  3T4A C;  4DK6 C;  1TS4 A;  4KY5 A;  3I3C A;  4Q0F A;  1ET6 A;  4ODG A;  1Y1W H;  3K0Y A;  3IAY A;  1GM5 A;  4DFA A;  1SYD A;  1UEA B;  1FJG Q;  1JJ2 A;  5LMU Q;  1YNX A;  4DGZ A;  5KNB A;  2UXC L;  2HDM A;  2VL6 A;  4IO9 A;  2M2L A;  4DKA C;  3AFQ A;  1S5C D;  4M8A A;  5A2Q E;  1W2B A;  1PH2 A;  2FJ2 A;  2RF4 A;  2A5H A;  3T53 B;  4XTC S;  5A35 A;  4ZKB B;  4Z9C B;  1STN A;  2Q2U A;  1ICF B;  1SND A;  2EY1 A;  5EKI A;  1U0L A;  2IHF A;  2CH4 W;  4NPS A;  4DV6 Q;  2UXD Q;  1CSQ A;  2OCE A;  3TQY A;  4JBW A;  4IUU A;  4YWM A;  2V1C C;  1AP0 A;  1ENC A;  4JPB W;  4JI1 L;  2YTX A;  2Y0S G;  2YU9 H;  4RHR A;  4K8I A;  4R8I A;  1YNJ D;  2L15 A;  3A74 A;  1B44 D;  4A3J B;  4N9T A;  1IBM L;  1KLU D;  2L5T A;  1BCP F;  4JBJ A;  3K7A B;  2KEE A;  5C0X I;  3PUV A;  4GOP B;  2AWO A;  3K80 C;  1YHQ A;  4A3G B;  4KTA A;  4HR7 B;  1CK1 A;  2CCZ A;  3PO2 G;  2L55 A;  1WOC A;  5JEA G;  2ES2 A;  4IPC A;  1Z6H A;  4A3J G;  5J1Z A;  1OXS C;  2JA6 B;  1U9R A;  4QF4 A;  1WTV A;  2A73 B;  2EQS A;  1HNZ L;  4A3F G;  3FPP A;  1VQ9 A;  2GVA A;  5JJL A;  3UDF A;  5C0X H;  4TQU S;  1HXY D;  4POF A;  3IKJ A;  2N3S A;  5C4Z A;  1NAP A;  3TRE A;  1GD7 A;  5M3F B;  3M7N A;  2O4X A;  4WJ3 M;  4BY1 B;  4X65 Q;  1EY8 A;  1OXT A;  2PNR C;  3S2H B;  4K6D A;  4A3L G;  1JE5 A;  2EXD A;  3S1R B;  3LWU A;  2QA4 A;  4RGO S;  1X3G A;  3KBX A;  2OT2 A;  4UY8 C;  1LAB A;  4DV4 L;  4A76 A;  4R9W A;  4RGN A;  4FNF A;  5C4J B;  1HUN A;  3PIO 3;  4BY1 G;  5K36 H;  3P20 A;  3K5O A;  3W3A A;  1I6V C;  4LAA A;  3OMG A;  3S24 A;  2KHI A;  4JG2 A;  2B8G A;  5I2Y A;  1QVG A;  3S17 H;  1H9S A;  3H15 A;  1FVI A;  4FF4 A;  1Y69 U;  1ESF A;  3CC2 A;  4A93 B;  3HGB A;  4DR3 L;  4O42 A;  4EX5 A;  3H3V I;  2BH8 A;  2VQF L;  3W2D A;  1S72 A;  1UNS A;  2L9H A;  3GV3 A;  3DMU A;  1F9Q A;  2Q8I B;  2A6H D;  1WI5 A;  1EWH A;  1I6H H;  4O0A A;  4B3T Q;  3GO5 A;  3J7A V;  3A7A B;  2BDN A;  1ENF A;  1VQA A;  1F9S A;  1EWI A;  1ONL A;  4HSP A;  4KHZ A;  1XX8 A;  4DUZ L;  3NQT A;  3MZ5 A;  2CWA A;  4C3I B;  1JWM D;  1Y8P B;  4OEM B;  5I6Y A;  3JAM i;  2K32 A;  1SLJ A;  3OWF A;  2K1B A;  4F87 A;  1QWY A;  4ABN A;  1IYJ B;  5EJW A;  4GN4 B;  5HUR A;  2NVT B;  1NY4 A;  3M9B A;  3V96 A;  5FKA C;  1LTI D;  3GTO H;  3H0G H;  4IUT A;  1A0I A;  2QKI C;  3S16 H;  1CSP A;  2HQL A;  4C3I G;  4F8M A;  5LL6 X;  1VQM A;  2K5V A;  2OQ0 A;  4DPG A;  2Z8L A;  5HGT A;  5KYI A;  4XQJ A;  1X3P A;  1LTR D;  1Z47 A;  1EY6 A;  4JI1 Q;  2RQX A;  1MGS A;  1EYG A;  1MSG A;  1SXT A;  2VZA A;  1HZB A;  4LFC L;  4DK1 A;  2KVM A;  1J6Q A;  2KED A;  3QWN A;  2SNM A;  2JXM B;  1QOH A;  1IBM Q;  2Q8T A;  4M1U B;  4GZY C;  3DUZ A;  2F3V A;  4U67 3;  4I7Z C;  1A6X A;  1AW7 A;  3DWP A;  5ELE A;  1D1K A;  1SR3 A;  2ALY B;  2B2T A;  3MWY W;  3GTQ B;  4HMJ A;  1FR3 A;  3K6O A;  5ELN A;  1FNW A;  3GP7 A;  1SBB B;  1H9M A;  3OTO Q;  3VYS A;  5E4X A;  5IGE A;  4DAV A;  3G48 A;  1DZ1 A;  1S40 A;  4X3K A;  3BG3 A;  3H94 A;  3BVG A;  1BUV T;  1DCZ A;  1UEB A;  5M9O A;  2L0C A;  4AQY L;  1BO0 A;  3TP5 A;  5EKK A;  2EYJ A;  4A3C G;  5CBE E;  4JV5 L;  4A3E G;  1I4P A;  3T1H Q;  4QMG A;  1VQK A;  3VYT A;  2OXP A;  2ZJP A;  1MD2 D;  4Y7N H;  1OO9 B;  1HR0 L;  2QW7 A;  3K0X A;  2DNC A;  1HQM C;  2B2V A;  1VF5 C;  3NQI A;  2YV5 A;  5IOD A;  3FRP B;  2ZTE A;  5M5X B;  3ERO A;  3HOW G;  1OXU A;  3KLS X;  3NPP A;  1Q90 A;  3PIO A;  4JC0 A;  1K83 B;  4R4O A;  3M3Y H;  3MA2 B;  4YCU A;  1PRT F;  1ET9 A;  3CW2 C;  4JI4 L;  3PO3 H;  2F0J A;  2NVY B;  1P16 A;  4JI8 L;  2D9U A;  1EQR A;  3HOY B;  3RN5 A;  4GNX B;  4B3R L;  3HOX B;  1QUQ A;  3C1E A;  5CBA E;  5GAE C;  1KXL A;  1PFM A;  2LMC B;  1XTD A;  4P75 A;  1W3S A;  1EYD A;  3C1F A;  4OX9 L;  1EQQ A;  2H5X A;  5FO7 B;  2CW0 D;  4DV4 Q;  2UUA L;  3CC4 A;  4OO1 I;  4POG A;  3PSI A;  1TII D;  2I46 A;  2ICE C;  3MHB A;  2IX3 A;  1A3U A;  2AQ2 B;  5ELD A;  4X6A H;  2I07 B;  4MTN A;  5EBD A;  1QVF A;  3SVM A;  3J80 c;  5J22 A;  1D6E C;  3Q24 A;  1WYD A;  5KEE A;  3HOY G;  4RCN A;  1D1I A;  1SEB D;  2F0Q A;  2K5Q A;  1SMY C;  4DR3 Q;  3G6J B;  4C56 C;  4DAM A;  1LTS D;  1SYF A;  4APV A;  4X66 L;  1TQO A;  2VQF Q;  4UP8 A;  2KCT A;  1Y8N B;  5IYD G;  1I4H A;  4QIW B;  3K81 C;  3E3X A;  4HCS A;  4OWT B;  3RLF A;  1RCV D;  5IYC G;  2JA5 B;  1DOL A;  1YJ9 A;  1FD7 D;  1VQH A;  4R4C A;  4OO1 H;  2IWH A;  2KEN A;  5COR A;  2PW7 A;  2RHQ B;  1YZ6 A;  4PZ6 A;  4DUZ Q;  2K7V A;  4A3M H;  4IUR A;  4GN3 B;  2K33 A;  2B29 A;  2CWP A;  2J7Z A;  4IPD A;  4NKL A;  5CYU A;  1Z7T A;  1IL2 A;  4P2C B;  2ZTD A;  5C44 G;  3K7A H;  1AH9 A;  2R93 G;  2WV6 D;  3EVQ A;  1R9T B;  4ULL A;  1STY A;  4CKC A;  3TEH B;  4A3G H;  2MQH A;  3RUZ A;  4IZ8 A;  2NZO A;  2LSS A;  3P75 A;  4HJ5 A;  3KBG A;  1G2T A;  3JAM L;  2DN8 A;  4UPA A;  1WD1 A;  4OWX B;  3Q23 A;  1LAC A;  2HDL A;  2MJ8 A;  1QB5 D;  1BKB A;  2PMZ B;  3RZO B;  3FKI B;  3MFY A;  1VQI A;  2F0G A;  2JA6 H;  4QB4 A;  1N36 Q;  1VQD A;  2H1E A;  4JI0 L;  2MUY A;  2OWO A;  2A69 C;  5TSS A;  1BBW A;  1H9J A;  1B53 A;  1X65 A;  5BN3 A;  3I70 A;  1EIY B;  1DD2 A;  2FMM A;  4DV3 L;  5CV6 A;  4LFC Q;  1PTO C;  2LFN A;  2B2V C;  1B3A A;  1QG7 A;  1Q81 C;  5M3F H;  1PHJ A;  2OF1 A;  3ULL A;  1I3Q B;  1V9P A;  1EQV A;  3T51 B;  1K8G A;  1ZXT A;  2BOS A;  3ICE A;  3FKI G;  3D4W A;  3TBI B;  1GUW A;  2NN6 H;  1D5M C;  1Y1V B;  3A0J A;  4IUP A;  3S2H H;  1CTM A;  1U4L A;  4MIU A;  1I5F A;  4KMU C;  2K03 A;  3T1Y L;  1TWF B;  1KDA A;  4P71 A;  5M3M B;  2Q2T A;  4V0B A;  4EVO A;  5C4J H;  1YBY A;  4DAY A;  3KLR A;  3SXH A;  1SYE A;  4FO2 A;  1LO5 D;  5BR8 L;  1HQR D;  3BDO A;  3U9S A;  2ZJR A;  1BCP D;  1E7Z A;  1B8A A;  1Y1V G;  5J3B A;  4ZLT F;  2BE5 D;  2QGQ A;  4AQY Q;  1HUM A;  4UAI A;  5E7N A;  1F2L A;  4NB3 A;  4KD4 A;  4XIG S;  1WVL A;  4A93 H;  1A2T A;  1HR0 Q;  4Y52 H;  3A8I E;  1XNR L;  2E5L L;  4KN7 C;  4DV5 L;  1SAP A;  2EYH A;  3RLO A;  3DLL A;  1IXR A;  1H95 A;  2AQ3 B;  5JPN C;  4JI4 Q;  3CCM A;  4JI8 Q;  5IWA L;  1DXM A;  1OXX K;  3M4O B;  3A54 A;  5IYB H;  1XPU A;  4B3R Q;  2PQA B;  2A74 C;  3SR1 A;  1LT3 D;  4OX9 Q;  3GTM B;  3VA7 A;  1HPC A;  1VMP A;  3QOL A;  3A7L A;  2NVT H;  3SK6 A;  4CBV A;  2WP8 J;  1RF2 D;  4N8X 1;  4QJF A;  4R8N A;  5IGD A;  3J7Y W;  1A15 A;  2NVX B;  1G6P A;  4QGU A;  2KQ3 A;  5NUC A;  4TRD A;  5C3E B;  1NR2 A;  1QE6 A;  1Y14 B;  2JJQ A;  1EIH A;  1LTL A;  2F0M A;  2HQE A;  2R6G A;  4CDF C;  3NXW A;  1SE2 A;  5EQ0 A;  4AYB G;  4X66 Q;  3BDC A;  5EBC A;  1QNK A;  1X56 A;  2K5W A;  4JCV E;  3CPW A;  1TWH B;  1Y8O B;  2PYK A;  4BBR B;  5JVG 3;  4A3D B;  1JOK A;  3EA6 A;  3S14 B;  3HOV B;  3CPF A;  1PH4 A;  3S1N B;  1JCK B;  1EWC A;  1M1K C;  4NMZ A;  5C3E G;  1HHV A;  3AB9 A;  3VR5 A;  3WOE A;  3CME A;  1SFO H;  2E76 C;  1IHZ A;  4X62 L;  4DXG A;  1PH6 A;  1YNN D;  4A3K B;  3QIA A;  5M5Y B;  4KHV A;  1YIT A;  2QEJ C;  3TP6 A;  1CUK A;  1BXT A;  2NZH A;  2I0Q A;  2AUJ D;  5FLX L;  2H4O A;  4HJ9 A;  3HOV G;  2GA4 B;  4MZ9 A;  1KNA A;  2F0L A;  4RGM A;  4H0L C;  3URY A;  3F2B A;  4DNI A;  3CP0 A;  4TKO B;  1ML0 D;  1GHK A;  2YYZ A;  5D65 A;  4LUV A;  4Q5V A;  4A3K G;  2Z1C A;  5DNF A;  3HOU B;  1TY0 A;  4ME3 A;  5CGK A;  3H3V C;  4DUY L;  1FGU A;  4CGY B;  4JI0 Q;  3PF4 A;  1A3V A;  1LM0 A;  2IY5 B;  1UUP A;  4NP5 A;  3DWQ A;  4RG1 A;  1WTX A;  1DOK A;  2D5D A;  2JP1 A;  3L7Z C;  4DV3 Q;  3CQZ B;  5LHY 1;  1O7L A;  5M5X H;  2NVQ H;  3J81 L;  3I4L A;  3S1M B;  5C3X A;  3PMF A;  2Y0S B;  1MJC A;  4XQQ A;  1VQ8 A;  1K83 H;  4PMC A;  2VXW A;  3R93 A;  2LY7 A;  1S3O A;  1PXU A;  3ND8 A;  5GQO A;  5IT9 E;  4G7O C;  3M4Y A;  2NVY H;  3Q6S A;  3HOU G;  2Z0S A;  2JYO A;  3LWE A;  2EPB A;  1PH8 A;  1CI3 M;  2QF7 A;  3HOX H;  4E6I A;  1CQF A;  3KLS A;  2HCC A;  1B9M A;  3T1Y Q;  1DM0 B;  1PYW D;  3HS0 C;  2PZT A;  2SDF A;  5IGG A;  4IFD J;  3R3O A;  2R61 A;  1E2W A;  1W6K A;  1FGB D;  2F03 A;  3HOZ G;  4CHT B;  3PO2 B;  4JI6 Q;  1Q1E A;  1QJO A;  1D7Q A;  4I7A A;  5BR8 Q;  1TY2 A;  1KD1 C;  2RSN A;  2F0D A;  3FMC A;  4XT3 B;  3HRZ C;  2LS0 1;  4K8J A;  3D0F A;  1TT2 A;  3CF5 A;  3J81 c;  3I8Z A;  2WB1 G;  3CC7 A;  4A3F B;  1WCM H;  1BBU A;  4L5R C;  1XNR Q;  3GV6 A;  1B50 A;  4DR5 L;  5FO9 B;  4YWL A;  1SN8 A;  4BA2 I;  2E5L Q;  2B39 A;  3G6E A;  4DV5 Q;  3DM1 A;  5T1G A;  2EXZ A;  3K5N A;  5A2Q L;  2JA5 H;  5IT9 L;  1X32 A;  4L6T B;  4A3B G;  1JOO A;  4LF8 L;  4KKS A;  1FL0 A;  2B3G A;  2BA1 A;  3OTO L;  2EYP A;  2F3I A;  2RDH A;  5IWA Q;  4QIW E;  4DV0 L;  4DV1 Q;  2F0H A;  4PQX A;  2A8V A;  5KRU A;  1CT1 D;  5DAU A;  1EYA A;  4C3H G;  5IY0 A;  3MXP A;  1SJE D;  1F9R A;  3R8B A;  4XDX A;  1HZC A;  1RL2 A;  3BZC A;  4O2D A;  1R9T H;  3TSS A;  1PDQ A;  2WIN B;  1T5E A;  3T1H L;  3GTG H;  1SRO A;  3RD4 A;  1JR0 D;  1KDC A;  1EZ8 A;  3LX0 A;  3ITP A;  3ZJY C;  3FP9 A;  5LMN Q;  1VQ4 A;  1PRT D;  5I9P A;  4KJN A;  1HZA A;  1Q8K A;  2D0P A;  1PFB A;  3U9O A;  3VYU A;  1LT5 D;  1NJI C;  2JA8 G;  2A1A A;  1JWS D;  2EYL A;  3ER0 A;  4ZQ3 A;  4LWC A;  1PMR A;  2ASB A;  1LV9 A;  2PMZ E;  3NSW A;  1EEI D;  4BXX H;  1IW7 D;  4R4Q A;  3HFZ B;  3F2C A;  3VR4 A;  5FJ8 G;  1YJW A;  3NUC A;  4GKJ L;  4YWK A;  2KHJ A;  3X3N A;  3ULP A;  2WKD A;  1I3Q H;  1TU2 B;  2R92 B;  2V4D A;  3KF6 A;  4X64 L;  4PMW A;  5H1S E;  2RBM A;  4X62 Q;  3E0E A;  1TWA B;  4P74 A;  1N32 L;  1I50 H;  3ONA B;  5IP9 G;  2CVR A;  2B63 G;  2DGY A;  3FVQ A;  3WDN A;  5BN4 A;  1B4O A;  1F77 A;  1LTG D;  3U4Z A;  5M3M H;  1EL0 A;  1EOV A;  2ZXO A;  1U4P A;  1XPO A;  2K5H A;  4H02 A;  3S1Q H;  3RLN A;  2CKZ B;  4HN7 A;  5EPL A;  3Q22 A;  2F4I A;  4B9X A;  2HD3 A;  3I4M G;  1VQL A;  2R92 G;  4DNR B;  3OIP A;  2JK8 A;  2NWG A;  4IPG A;  4LK1 C;  1STH A;  4DR1 L;  4JOI A;  1K8O A;  3E0J A;  4DUY Q;  3A8K E;  3CAM A;  5FLM G;  4NW2 A;  3NEN A;  2DNE A;  5D3I B;  3KK7 A;  1G2S A;  1RDP D;  2B8F A;  2F0F A;  4A75 A;  4R1J A;  3OOC A;  3M85 A;  5EPK A;  1SNQ A;  4XXE A;  3UDI A;  4BY7 B;  4JW0 A;  4JBK A;  2O2L D;  5E4W C;  1HNW L;  1Q1B A;  2X69 A;  2N78 A;  1XTC D;  4XYQ A;  2Z4I A;  2Z9H A;  3M4O H;  1A63 A;  2A19 A;  2UUC L;  3SE0 A;  1YEZ A;  5JJI A;  1EU3 A;  1XMO L;  1N36 L;  3GD7 A;  4IFD G;  4DR6 L;  3U50 C;  3S9W A;  3GTM H;  5IP7 G;  5T1I A;  4EQN A;  5IGC A;  1Q3L A;  1ILP A;  3HP3 A;  3I4N B; 
#chains in the Genus database with same CATH homology
 1LUZ A;  1N34 Q;  3A5U A;  2ZTD A;  4QL5 A;  1IL2 A;  4BY7 G;  1PYS B;  2K4K A;  3K7A H;  3EN2 A;  5C44 G;  1AH9 A;  2R93 G;  2IT1 A;  3JC6 6;  2MNA A;  3I4N H;  3K7U C;  3GDE A;  1WFQ A;  3KOJ A;  3TEH B;  3L2P A;  5LMN W;  4HIK A;  2MQH A;  1KIX A;  2NVX H;  2JA7 H;  4DV2 Q;  1G51 A;  3TS2 A;  4X65 L;  4A3G H;  2BA0 A;  4OO1 G;  1C0A A;  2R7Z H;  1HH2 P;  2NZO A;  1AE2 A;  2LSS A;  3PV0 A;  4YCW A;  4HJ5 A;  2XGT A;  4LFA L;  4A3M G;  2AKW B;  4UPA A;  5C4X H;  2UUB Q;  4L5S A;  5C0X J;  4OWX B;  3J80 i;  2CQO A;  3PUZ A;  1E1O A;  2ZJQ A;  2IHE A;  1KHI A;  1V1Q A;  3CCR A;  1P8L A;  4YHH L;  4DR5 Q;  1BKB A;  2UXB Q;  1TWH H;  1UE7 A;  4OXP A;  4BBR H;  2HIV A;  3FHW A;  2Z6K A;  3F2D A;  1IBL L;  3F1Z A;  1I94 L;  3I4N G;  4BA1 I;  3PF5 A;  4A3D H;  3W5O A;  4NXN L;  1VQI A;  1J5E Q;  2JA6 H;  2PNH A;  1E24 A;  2JA7 G;  1N36 Q;  3Q8D A;  2N8N A;  3RZO H;  3D31 A;  3FKI H;  3BJU A;  3U4V A;  1XPR A;  1K8A C;  1M90 C;  1VQD A;  4LF8 Q;  2R7Z G;  3S14 H;  2E8G A;  4JI0 L;  4L5T A;  3IRB A;  2ZTC A;  4IJH A;  5IT9 c;  2VW9 A;  4A3I H;  4DV0 Q;  2OWO A;  4LF4 Q;  2FXQ A;  3S1N H;  3TRZ A;  2R7F A;  1BBW A;  1UE1 A;  1ASY A;  4JYA L;  2ATW A;  3B6Y A;  5C4X G;  1X65 A;  1VQO A;  1VS0 A;  2QEX A;  1EIY B;  1WJJ A;  1GKH A;  4C3J H;  4DV3 L;  4LFC Q;  4DR2 L;  2VNU D;  4WJ4 A;  4BBR G;  4DV7 L;  1Q81 C;  3TS0 A;  3HKZ E;  3BU2 A;  5M3F H;  1CKN A;  3ULL A;  1V9P A;  1PHJ A;  4A3D G;  4LFB L;  1JJG A;  4KLK A;  4FDB A;  3KDF A;  3G71 A;  4J15 A;  1K8G A;  4JI2 Q;  2MFI A;  3AYH B;  3OW2 A;  4UP9 A;  2JA6 G;  3ICE A;  3FKI G;  2JA9 A;  4A3G G;  2E2J H;  3KYH C;  3A0J A;  4A3I G;  3EIV A;  1QZH A;  3I56 A;  3S2H H;  1C7Y A;  5JJK A;  3L0O A;  3HKZ G;  3W1G A;  2MO1 A;  4GNX A;  1KC8 C;  1Y1V H;  2WAQ E;  5GAD C;  4B3T L;  1Q12 A;  1KRT A;  1I5F A;  2K5N A;  4DK3 C;  3UDX A;  2E2I H;  3T1Y L;  1HZ9 A;  2VUM H;  2VQE Q;  2K75 A;  3NEM A;  1N33 Q;  4P71 A;  1SE8 A;  3S15 H;  1NMG A;  5M3F G;  4HIO A;  1PV4 A;  2Q2T A;  4JI5 L;  1TWF H;  4BBS H;  1YI2 A;  4BBS G;  1QVC A;  2WAQ G;  4LF6 L;  4DK6 C;  1BVS A;  5C4J H;  1YBY A;  1VQF A;  2NN6 G;  1X55 A;  1Y1W H;  4JOI C;  5BR8 L;  4YCV A;  4LUZ A;  1K73 C;  1GM5 A;  1OXV A;  2ZJR A;  1HR0 W;  1E7Z A;  1B8A A;  1Y1V G;  1N9W A;  2KCM A;  5J3B A;  2AMC B;  2QGQ A;  1KAW A;  1YNX A;  2K50 A;  5LMU Q;  4AQY Q;  1PH5 A;  1JJ2 A;  5E7N A;  4LF9 L;  1XNQ L;  3AEV A;  4GOP C;  2VUM G;  2N49 A;  2UXC L;  1G29 1;  4NB3 A;  4P72 A;  4JBM A;  4XIG S;  4GKJ Q;  4A93 H;  3GTK H;  2VL6 A;  3KF6 B;  4IO9 A;  1EFW A;  4DKA C;  3AFQ A;  5GAH C;  1HR0 Q;  1W2B A;  4Y52 H;  1PH2 A;  3ULJ A;  4X64 Q;  3S2D H;  1XNR L;  2RF4 A;  4XTC S;  3M4Q A;  2E5L L;  1Y1W G;  1N32 Q;  2Q2U A;  3CCU A;  4DV5 L;  3RLO A;  1U0L A;  2EIF A;  1L0W A;  3DLL A;  2IHF A;  4NPS A;  4DV6 Q;  1UWV A;  4AIM A;  1IXR A;  2UXD Q;  2Y0S E;  1CSQ A;  2OCE A;  2R7D A;  3TQY A;  4JBW A;  4YWM A;  1H95 A;  4JI4 Q;  2V1C C;  3RR5 A;  2CFM A;  1Q82 C;  3CCM A;  2GN5 A;  4JI8 Q;  3F8T A;  5IWA L;  4K0K L;  1OXX K;  1QUQ B;  4A93 G;  4JI1 L;  1VQN A;  5IYB H;  1XPU A;  4B3R Q;  2DUD A;  2PQA B;  4GN5 A;  2YTX A;  3GTJ H;  2Q2I A;  2Y0S G;  2YU9 H;  1X3F A;  4KHP L;  4OON A;  4DR7 L;  3PO2 H;  1HNX L;  2HHH L;  4OX9 Q;  1X54 A;  2L15 A;  3A74 A;  2ZM6 L;  2GVB A;  3PUY A;  3H3V H;  4DR4 L;  4QQB X;  1T9H A;  2UXC Q;  1VQ7 A;  1IBM L;  2NVT H;  4DR1 Q;  5AJ3 Q;  1NBW A;  2WP8 J;  4R4I A;  4JBJ A;  4A3J H;  1K3R A;  5C0X I;  3PUV A;  1VQG A;  1V43 A;  4QJF A;  4GOP B;  2AWO A;  3K80 C;  1YHQ A;  4B3S L;  5IYB G;  4AYB E;  1EIF A;  1G6P A;  4QGU A;  4A3F H;  1A62 A;  1QZG A;  1C9O A;  1RIP A;  2CCZ A;  3PO2 G;  4OWW B;  2AWN A;  1Y14 B;  2JJQ A;  3I55 A;  1WOC A;  5JEA G;  4LF5 Q;  2ES2 A;  2UU9 L;  1LTL A;  4IPC A;  5C3E H;  3J7Z C;  2R6G A;  1ASZ A;  4AYB G;  4X66 Q;  3A5Z B;  1X56 A;  4PG3 A;  4JCV E;  4A4I A;  3CPW A;  1HNW Q;  4A3J G;  2NN6 I;  3ERS X;  1CKO A;  1OXS C;  2LXJ A;  4JI3 L;  4B3M L;  3HKS A;  3G4S A;  2UUC Q;  1X9N A;  3KFU A;  4YY3 L;  2EQS A;  1HNZ L;  4A3F G;  3CPF A;  1Q46 A;  3I4O A;  1PH4 A;  2JQO A;  4JI7 L;  1XMO Q;  1VQ9 A;  4DR6 Q;  2GVA A;  2F52 A;  2BH2 A;  3CCV A;  5JJL A;  1PYB A;  4HID A;  3UDF A;  4KI0 A;  4HJ7 A;  1M1K C;  3HOV H;  5C3E G;  4A3L H;  3CD6 A;  4TQU S;  1JB7 A;  3CME A;  2PI2 E;  1SFO H;  4POF A;  1GVP A;  2N3S A;  4X62 L;  1PH6 A;  1YHB A;  1TWG H;  3TRE A;  2D0O A;  4B3S Q;  1GD7 A;  3M7N A;  4WJ3 M;  2MO0 A;  3KJP A;  4A3K H;  3CCJ A;  1YIT A;  4X65 Q;  5M5Y H;  1OXT A;  3AFP A;  5M5W H;  1CUK A;  1XMQ L;  2NZH A;  2I0Q A;  4BY1 H;  4HJ9 A;  1AE3 A;  4IPH A;  4LFA Q;  3HOV G;  4A3L G;  4QY7 A;  1JE5 A;  5C0X G;  2EXD A;  2IX1 A;  4GLA C;  3E9I A;  4MZ9 A;  3JAM c;  2QA4 A;  3F2B A;  3GTP H;  4YHH Q;  4DNI A;  1X3G A;  3S1R H;  4GKK L;  1IBL Q;  4UY8 C;  2ID0 A;  3CP0 A;  1I94 Q;  3PGZ A;  2YYZ A;  3I2Z A;  4DV4 L;  4A76 A;  1HNZ Q;  4LUV A;  5DLQ E;  1Z9F A;  4NXN Q;  4A3K G;  4ME3 A;  4BY1 G;  3VDY A;  1PFS A;  1L1O A;  1FGU A;  4DUY L;  4JI0 Q;  1K0R A;  3S24 A;  3PF4 A;  4JI6 L;  3HOU H;  2KHI A;  2K52 A;  1LM0 A;  4JG2 A;  2IY5 B;  4JYA Q;  1QVG A;  3S17 H;  2HIX A;  4RG1 A;  2YTV A;  3H15 A;  1FVI A;  3L7Z C;  4DV3 Q;  1IBK L;  1MIU A;  1VQ5 A;  1O7I A;  4DR2 Q;  3CC2 A;  1CKN B;  1TWA H;  4DR3 L;  3LGJ A;  3PUW A;  3KDF B;  4MNO A;  4EX5 A;  5M5X H;  4DV7 Q;  2NVQ H;  3H3V I;  4LFB Q;  3CQZ H;  1YHA A;  2BH8 A;  2F4V L;  2VQF L;  1MJC A;  1KQS A;  1S72 A;  3MEF A;  3HOZ H;  1VQ8 A;  1K83 H;  1MKH A;  1PH9 A;  3KF8 B;  3S1M H;  1S3O A;  5K36 G;  3KLW A;  4HJ8 A;  5GQO A;  2VS1 A;  2JEB I;  2NVY H;  1WI5 A;  3HOU G;  2Z0S A;  1YIJ A;  4NXM L;  1PH8 A;  1I6H H;  1FJG Q;  4O0A A;  2PQA A;  4UP7 A;  3GO5 A;  3HOX H;  4B3T Q;  4LF7 L;  3T1Y Q;  1VQA A;  1EWI A;  4IFD J;  4KHZ A;  4PZ7 A;  4DUZ L;  2D62 A;  1B7Y B;  4JI5 Q;  3UDG A;  3NEL A;  2CWA A;  4DV1 L;  4LF6 Q;  3HOZ G;  1DGS A;  3CCS A;  4IOA A;  4JI6 Q;  1N34 L;  1Q1E A;  3JAM i;  1D7Q A;  4C3I H;  3AQQ A;  4PZ8 A;  5BR8 Q;  1SLJ A;  4ALP A;  1VCI A;  1B70 B;  1KD1 C;  1IYJ B;  3EBE A;  2WB1 E;  4GN4 B;  1EUJ A;  1E1T A;  3HOX G;  4DV2 L;  1NY4 A;  4LF9 Q;  4A3B H;  1TXY A;  1XNQ Q;  1KRS A;  3CMA A;  3M9B A;  2OQK A;  4RMF A;  3RN2 A;  3D0F A;  3CF5 A;  3GTO H;  1VQE A;  3J81 c;  2UUB L;  5LMN L;  2WB1 G;  3H0G H;  4C3H H;  3CC7 A;  1WCM H;  1A0I A;  1VQJ A;  4TVA B;  1BBU A;  3CXC A;  4L5R C;  2E2H H;  4GLX A;  4LUO A;  1XNR Q;  1CSP A;  4HJA A;  2I5H A;  1SN8 A;  2HQL A;  4YWL A;  4DR5 L;  2E5L Q;  4BA2 I;  2UXB L;  5EAY A;  3G6E A;  4DV5 Q;  1VQM A;  4EQ5 A;  2K5V A;  3PUX A;  1J5E L;  3KJO A;  2OQ0 A;  4DPG A;  1UE6 A;  3UE1 A;  2JA5 H;  4A3B G;  4LF8 L;  2Z6K C;  1FL0 A;  2B3G A;  2BA1 A;  3CCL A;  3OTO L;  2F3I A;  3DM3 A;  1Z47 A;  3UE0 A;  1VQB A;  5IWA Q;  4LF4 L;  4QIW E;  4DV0 L;  4K0K Q;  1XJV A;  4DV1 Q;  3OYY A;  1VQ6 A;  4JI1 Q;  2A8V A;  1EYG A;  3H0G G;  2RCN A;  5IY0 A;  1WCM G;  2VZA A;  1HZB A;  1U5K A;  4LFC L;  2JE6 I;  1Q7Y C;  4KHP Q;  5HY6 A;  4DR7 Q;  1HNX Q;  2HHH Q;  2ZM6 Q;  1HZC A;  1J6Q A;  2JA8 H;  1RL2 A;  3BZC A;  3E9H A;  4O2D A;  1R9T H;  2JEA I;  4DR4 Q;  1SMX A;  3T1H L;  3GTG H;  1SRO A;  3W1B A;  3PCO B;  2YTY A;  2JA5 G;  4JI2 L;  1IBM Q;  3ZJY C;  3FP9 A;  1NTG A;  5LMN Q;  1VQ4 A;  1PH1 A;  3WWV A;  1VQC A;  1SR3 A;  2ALY B;  1HZA A;  1Q8K A;  5FJ8 H;  2D0P A;  4C2M H;  4A3C H;  2VQE L;  4GNX C;  1PVO A;  2AHO B;  1YVC A;  1N33 L;  4A3E H;  5ELN A;  2K14 A;  1NJI C;  2UU9 Q;  2JA8 G;  2A1A A;  3GTQ H;  1D8L A;  3U58 A;  3ER0 A;  3STB D;  3J81 i;  3OTO Q;  4LWC A;  3J7A 5;  2ASB A;  1PA6 A;  1UE5 A;  4R4T A;  2PMZ E;  3G48 A;  4JI3 Q;  5IP9 H;  3HOW H;  1L1O C;  1S40 A;  4BXX H;  4B3M Q;  3S16 H;  2B63 H;  3STB C;  4R4Q A;  1FJG L;  3HFZ B;  3PIP A;  5LMU L;  1X6O A;  1UEB A;  4AH6 A;  4YY3 Q;  3F2C A;  4HIM A;  5FJ8 G;  4AQY L;  2KBN A;  1YJW A;  1N8R C;  4A3C G;  4JI7 Q;  4JV5 L;  4A3E G;  4GKJ L;  3T1H Q;  4YWK A;  4GLV B;  2KHJ A;  1VQK A;  1HJP A;  2VY3 A;  2ZJP A;  1L2F A;  3ULP A;  4Y7N H;  1I3Q H;  1HR0 L;  3K0X A;  3CCQ A;  3GTL H;  1A8V A;  3KF6 A;  4X64 L;  4PMW A;  5H1S E;  2YV5 A;  4X62 Q;  2ZTE A;  1JT8 A;  1X3E A;  3E0E A;  5GRO A;  1IZ6 A;  4P74 A;  3J81 j;  3I4M H;  2R92 H;  1N32 L;  1I50 H;  5IP9 G;  2WFW A;  3HOW G;  1CKM A;  2LXK A;  1OXU A;  4L5Q A;  4BXX G;  4LW1 A;  2B63 G;  3PIO A;  4P73 A;  2DGY A;  4JC0 A;  4DV6 L;  4R4O A;  3M3Y H;  4IFD I;  3K8A A;  4YCU A;  2UXD L;  3CW2 C;  4JI4 L;  3PO3 H;  3I7F A;  1XMQ Q;  2XTI A;  1P16 A;  3MXN B;  2I5M X;  4JI8 L;  5FLM H;  1EQR A;  2OTL A;  3RN5 A;  1TWC H;  4GS3 A;  3U4Z A;  5M3M H;  4GNX B;  1EOV A;  4B3R L;  1E3P A;  3RZD H;  5FLX c;  1QUQ A;  5GAE C;  1XPO A;  3RNU A;  2K5H A;  3HOY H;  4H02 A;  3S1Q H;  3RLN A;  2CKZ B;  1KXL A;  1KL9 A;  1XTD A;  2I5L X;  1K9M C;  4P75 A;  1NE3 A;  1W3S A;  1MJE A;  3I4M G;  1VQL A;  4OX9 L;  2R92 G;  4GKK Q;  2JK8 A;  1JJC B;  1EQQ A;  2H5X A;  2Q2H A;  5ELO A;  4DV4 Q;  1Q86 C;  4IPG A;  2UUA L;  3CC4 A;  3NBH B;  4POG A;  4OO1 I;  1L1O B;  3PSI A;  4IOC A;  5AJ3 L;  4DR1 L;  4JV5 Q;  4DAY B;  3M4P A;  4JOI A;  1LYL A;  3PO3 G;  5IYD H;  5GAG C;  4DUY Q;  1OTC A;  4X6A H;  3CAM A;  4MTN A;  5FLM G;  1QVF A;  1VQP A;  3NEN A;  5HGQ A;  1JMC A;  5M3M G;  3J80 c;  2IX0 A;  5IYC H;  1WYD A;  4GOP A;  1PH3 A;  3SGI A;  3HOY G;  1IBK Q;  4A75 A;  1E22 A;  4R1J A;  3M85 A;  4LF5 L;  2OTJ A;  4DR3 Q;  4DAM A;  1PH7 A;  5JEA J;  2C35 B;  5IP7 H;  1SRU A;  3UDI A;  4APV A;  4X66 L;  2F4V Q;  2VQF Q;  4JBK A;  4UP8 A;  3CCE A;  1Q1B A;  2KCT A;  5IYD G;  1HNW L;  4BY7 H;  5C44 H;  2N78 A;  3K81 C;  4LNQ A;  3RLF A;  2R93 H;  4OWT B;  1YJN A;  4NXM Q;  5IYC G;  3M4O H;  1A63 A;  2A19 A;  2PI2 A;  2UUC L;  3BZK A;  1YJ9 A;  1VQH A;  4R4C A;  1YEZ A;  4LF7 Q;  5JJI A;  2KEN A;  1XMO L;  1N36 L;  3GD7 A;  4IFD G;  4DR6 L;  2UUA Q;  2RHQ B;  3U50 C;  1YZ6 A;  4PZ6 A;  4DUZ Q;  4A3M H;  3GTM H;  2RHS B;  4GN3 B;  5IP7 G;  2HT1 A;  2B29 A;  2CWP A;  4IPD A;  1GO3 E;  1NMF A;  4IJL A;  5IE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...