2LXKA

Backbone 1h, 13c, and 15n chemical shift assignments for cold shock protein, lmcsp
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
66
structure length
66
Chain Sequence
MEQGTVKWFNAEKGFGFIERENGDDVFVHFSAIQGDGFKSLDEGQAVTFDVEEGQRGPQAANVQKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cold shock-like protein CspLA
publication title Structural and Dynamic Features of Cold-Shock Proteins of Listeriamonocytogenes, a Psychrophilic Bacterium
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Transcription
total genus 10
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2012-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2lxkA00
2YV5A 2JEBI 4BA1I 4YCUA 3RZOH 1I94L 1VQKA 2IHFA 3TEHB 1XPOA 3CC2A 3CCMA 3I55A 1PV4A 2VQEL 3FHWA 4A3EG 1LTLA 1QUQB 3GD7A 1VQFA 3K8AA 3S2DH 2B63H 4OONA 4NPSA 3K80C 4LF8Q 3EBEA 2UUAQ 1ASYA 1NTGA 3GDEA 2UXDL 3W1GA 4QGUA 2E2IH 1GD7A 2YTXA 5IP7G 1YEZA 1AH9A 4DR2L 2VZAA 1YJ9A 1G291 2UU9Q 2VNUD 2IX1A 1HZCA 5M5YH 4IFDI 3S14H 2AMCB 3BZKA 4A3DG 3J7ZC 2JA6G 1D7QA 3HOWH 4O2DA 1WCMG 3Q8DA 4YHHQ 4GKJQ 4BY1H 3KLWA 1E1OA 1SE8A 3JC66 4DV7L 2ZTDA 1XMOQ 2N78A 4LF4Q 4O0AA 5DLQE 1VQOA 1BBUA 2MFIA 2GN5A 4BBRG 4BXXG 3RZDH 4JV5L 5K36G 1U5KA 4A76A 5JJKA 4JI8Q 3I56A 4X66Q 4DR4Q 3CC7A 2EIFA 2R7FA 3KJPA 4JYAL 1L0WA 2NVYH 1U0LA 5J3BA 4IOAA 3AFPA 2IY5B 3LGJA 3NENA 2A19A 1NJIC 1HNXQ 4JI3Q 2D62A 2N8NA 1N34L 3AEVA 1HH2P 1PH1A 2RCNA 5C44G 4B3MQ 3CP0A 1J5EL 4LF5Q 3CCLA 5IP7H 2F4VL 1SR3A 3ER0A 5M3FG 1XMQL 1CSPA 4DV6L 3S24A 1YHAA 4R4QA 3CAMA 4A3DH 5IYBG 4YY3Q 3CMAA 2E2JH 2JA6H 1WCMH 3IRBA 2JEAI 4LF7L 2IX0A 3AFQA 3BZCA 3K7AH 2BH8A 2Q2UA 4LFAL 3DLLA 3MXNB 4DR3L 1S3OA 3PUWA 1Q86C 4UY8C 4AQYL 4HJAA 4BBRH 4BXXH 4L5QA 4DR6L 3D31A 1Q82C 2WAQG 1PA6A 2BA0A 1VQPA 2OWOA 1CKNA 1UE7A 2Y0SE 1N32L 4GKKQ 2IT1A 1B8AA 1YVCA 2E5LL 4R1JA 3F2BA 2VQEQ 4JI4L 3GTKH 5C0XJ 4DV0L 2UXCL 1X3EA 1FVIA 1CSQA 5C44H 3PV0A 1FL0A 4YWKA 3T1HQ 3T1YQ 4OXPA 1IXRA 2WB1G 4LF9L 5M3FH 4DV5L 3CPFA 1TXYA 4A93G 4DAMA 4OWXB 5IYBH 4GLVB 1VQEA 4MTNA 1PH6A 4DR2Q 4P71A 4APVA 1K9MC 5IWAL 1PH5A 4JBKA 3KF6B 1WYDA 3G6EA 3S15H 1T9HA 1G51A 3S1RH 3G48A 3RNUA 3L0OA 4LFCQ 2R92G 1JJ2A 1N36Q 2OQKA 2D0OA 4JOIC 3D0FA 3U58A 1VQHA 2ID0A 2KHJA 2ZJPA 1LM0A 1D8LA 1YNXA 4GN4B 4LW1A 4PG3A 4JI3L 5C3EG 1Q81C 2UUCL 4JYAQ 3RN2A 1QVFA 1YITA 4B3TL 2DGYA 4GNXB 1VQMA 4YCVA 2AHOB 1PH7A 4UPAA 5FLXc 4DUYQ 1HNWQ 3HKZG 4GS3A 4NB3A 2VY3A 4X62L 4IOCA 1PHJA 1S40A 1N33L 4K0KL 4P75A 1TWFH 4YWLA 3HOXG 4WJ3M 2CQOA 1X55A 4X65L 4A93H 1AE2A 2BA1A 1VQ5A 4MZ9A 5JEAG 3TREA 2F4VQ 1PVOA 2HQLA 5IT9c 4A75A 4A3MG 4XIGS 1HZBA 2Q2IA 3F2CA 4DV3L 3KJOA 1AE3A 4R4IA 2HT1A 3J81j 4QL5A 4JI1L 1L1OC 4LFAQ 3E9IA 2I5LX 3A0JA 3W1BA 2R92H 2AKWB 1VQ8A 1H95A 3H15A 1X54A 4DR6Q 1BVSA 4DPGA 1SFOH 4IPHA 1UE6A 1Q7YC 4JI6L 2R93G 3KF8B 5E7NA 3A74A 3I7FA 1K73C 1KD1C 5FJ8G 3I4NG 5C3EH 2NVXH 2CFMA 4JI7L 1HNZL 4KI0A 2NZHA 4HIDA 4BBSH 1C7YA 4B3RL 1K83H 2ATWA 1GM5A 4DV1Q 1X9NA 1S72A 4DV0Q 2ZM6Q 4JI0L 3HOXH 3J80i 4AIMA 2UXBQ 2KCMA 4OO1I 4DR1L 3E0EA 2YTVA 4ME3A 1TWCH 4UP9A 1IYJB 3UDIA 1SRUA 4DV2Q 1KRSA 4A3BG 2DUDA 4QJFA 1GVPA 4A3KG 4L5RC 3H3VH 4A4IA 3ULJA 4C3HH 1NBWA 1XPUA 4A3MH 5AJ3Q 4EQ5A 4MNOA 1FGUA 1X56A 3PSIA 3OTOL 4LFBL 1V9PA 1IBKQ 5IWAQ 1JT8A 1KQSA 3KDFA 1QZGA 1WOCA 4A3IG 2PQAB 4A3JG 1PH4A 1KIXA 3CPWA 1TWAH 1NMGA 4JCVE 3TS0A 4DR7L 1JJGA 3GO5A 4C2MH 3PO3H 2R93H 1OXVA 1QVGA 4JG2A 3AQQA 4NXMQ 3J7A5 1PH2A 3RLFA 3J81c 1X3FA 5FJ8H 1VQ4A 2Z6KA 3I4NH 2QA4A 4DUZL 1VQBA 5LMNL 1KAWA 3RN5A 1UE5A 4A3FG 4LF6L 1UWVA 1QUQA 1HZAA 2WFWA 3M4OH 2JA9A 4X64Q 3UDXA 3CCUA 1Q1EA 1VQAA 3CF5A 1JE5A 4JI2Q 1GKHA 2VQFL 2UUCQ 4A3LG 4B3TQ 1E7ZA 1C0AA 4NXNL 4IJLA 2MNAA 1CKMA 1EIYB 3RR5A 1MJEA 4A3BH 2R7DA 3UDFA 4B3SQ 1VQNA 4XTCS 4PZ6A 3I2ZA 4JC0A 5BR8L 4A3KH 3PUVA 3JAMi 4L5SA 1XNQQ 3RLOA 1XTDA 4X65Q 1TWGH 2JK8A 2VL6A 3M4QA 1FJGL 4OX9Q 2UUBQ 4J15A 4DV4L 4TQUS 2JA8G 1E3PA 1Z47A 4IFDJ 1SMXA 4R4CA 2LXKA 1V43A 1Y1VH 5ELNA 2FXQA 4A3IH 4A3JH 1UE1A 1Q1BA 3J80c 4DKAC 3KOJA 5GAHC 2QGQA 3H3VI 4KHZA 1I94Q 2CWPA 4DK3C 2JA7G 3BJUA 2ZTCA 4OO1G 1LUZA 1I5FA 1IBLL 2HHHL 1IZ6A 4GOPB 3TQYA 1BBWA 1EOVA 2V1CC 1G6PA 4RG1A 2PNHA 1Z9FA 1J6QA 3PUXA 4A3FH 4YWMA 3E9HA 5IP9H 3STBC 1VS0A 1R9TH 4A3LH 2UXDQ 1VCIA 4JI5L 4UP8A 2R7ZG 2K4KA 2R6GA 2I0QA 3GTQH 2PI2A 1PYSB 1QZHA 5JJLA 4GOPC 1KHIA 4DR1Q 1YHBA 1VQJA 4GN3B 5M3MG 2JE6I 3I4OA 1WFQA 2UUAL 5EAYA 1JB7A 3K0XA 2JA8H 3U4VA 2JA5H 4JBMA 4WJ4A 2LXJA 3PF4A 3S1QH 4QY7A 1Y14B 4DV7Q 4R4OA 1K8AC 3S16H 2OTLA 4LFBQ 1A8VA 3PCOB 1X65A 2ALYB 3GTJH 1IBML 3CC4A 2YTYA 2NVTH 2CWAA 3ICEA 4BBSG 4JV5Q 2JA7H 2N3SA 3JAMc 1EQQA 4LNQA 4DR5L 1B70B 2HIXA 2I5HA 4YHHL 1Y1WG 3M3YH 4GKJL 3NEMA 1XMOL 4LF4L 2MQHA 3U50C 5C0XG 3A5ZB 4YCWA 4IJHA 4IPCA 4P73A 4LWCA 3M4PA 1EYGA 5M5WH 1L1OB 3SGIA 4Y52H 4GN5A 3K7UC 1N34Q 2R7ZH 3KFUA 2WAQE 4DR4L 1VQGA 1KC8C 5C4JH 4POGA 3CD6A 2VQFQ 1J5EQ 2XGTA 2CCZA 3TRZA 4A3GG 3J81i 2B3GA 5GROA 4P74A 1XMQQ 4DV6Q 5M3MH 1E24A 3I4MH 1A0IA 3HOVG 1V1QA 3EN2A 1O7IA 2OQ0A 2E8GA 4JOIA 2NN6G 1HNXL 1KXLA 2OCEA 1FJGQ 4DNIA 4LF7Q 1JJCB 1JMCA 3PF5A 4B3ML 1OTCA 4LF5L 1B7YB 3KF6A 4DR3Q 3HOUG 3M7NA 4AQYQ 1YJWA 1Q8KA 2WB1E 2AWOA 3PUZA 3PO3G 1EIFA 1EWIA 1C9OA 3GTOH 1HZ9A 1Y1WH 3NELA 3GTMH 3S1NH 1N32Q 1EQRA 2Q2HA 3F1ZA 5IYDG 1IBLQ 1IL2A 2F3IA 2E5LQ 1XPRA 1MKHA 2VW9A 2ES2A 4C3IH 4HIMA 1VQ6A 3GTGH 4JI4Q 5GAGC 2UXCQ 3S2HH 2IHEA 4GNXA 4HIOA 4PMWA 4ALPA 3BU2A 3CW2C 2KENA 3DM3A 4JBJA 4Y7NH 1W3SA 2PI2E 4GKKL 1L1OA 2K5NA 4LF9Q 5M5XH 1SLJA 1UEBA 1WI5A 1L2FA 4JI5Q 4DV5Q 4A3GH 4DAYB 4GLXA 3HOVH 5JJIA 5IE8A 2GVAA 2LSSA 3RLNA 2KHIA 2E2HH 4HJ8A 1GO3E 2CKZB 1RIPA 3T1HL 3T1YL 5IYCG 1Y1VG 3HKZE 2NZOA 3CCSA 2ZJRA 1YHQA 3HOUH 4KLKA 4RMFA 2WP8J 4PZ8A 4P72A 3CCJA 4AYBE 3FP9A 1IBMQ 2Z6KC 2Y0SG 4LUVA 1ASZA 3TS2A 1CUKA 5FLMG 3PGZA 5LMUL 2L15A 5HY6A 5H1SE 5IYDH 3PUYA 3VDYA 4DR5Q 5IP9G 4K0KQ 3U4ZA 1NY4A 1PFSA 2JQOA 3FKIG 1LYLA 3CCRA 1SN8A 5C4XG 4LFCL 1N8RC 1E22A 3OYYA 1N36L 4QQBX 1CKNB 1PYBA 4X62Q 1N33Q 4R4TA 3CCQA 4A3CG 5HGQA 4BY7G 1XNRL 1YIJA 2K5HA 1X6OA 5C0XI 2D0PA 3CCEA 2BH2A 2MO1A 2ZTEA 1M90C 4A3EH 1NE3A 1HNWL 4EX5A 2PMZE 3KYHC 2JA5G 4DUYL 2KCTA 3CMEA 3HOYG 3WWVA 4KHPL 4DV3Q 5IYCH 2A8VA 3GTPH 1K8GA 1VQ7A 4IPDA 4POFA 1A62A 3H0GG 4JI1Q 4IPGA 3STBD 2VS1A 2PQAA 1OXTA 3S1MH 1VQLA 1SROA 1RL2A 2NN6I 4LUZA 5FLMH 2JJQA 3HOZG 4JI6Q 1HR0L 1HJPA 1VQCA 2I5MX 2QEXA 4HJ5A 1PH3A 3UE1A 5LMNW 4C3JH 4JI7Q 1N9WA 1HNZQ 3FKIH 5C4XH 5GADC 2YU9H 4B3RQ 3CCVA 1CKOA 2ZJQA 5IY0A 1WJJA 2K5VA 1PH9A 1QVCA 3CQZH 4JI0Q 4A3CH 3ULLA 2A1AA 4BY7H 2GVBA 2NVQH 2XTIA 3I4MG 3UE0A 4LF8L 3EIVA 1MIUA 4IO9A 2K14A 2K50A 4H02A 4DK6C 2OTJA 1YZ6A 3B6YA 2RHSB 3L7ZC 1YI2A 3HOYH 2RF4A 4IFDG 2H5XA 3ULPA 4DV1L 4TVAB 3PO2G 1K0RA 4BA2I 2ZM6L 3OTOQ 2VUMG 2UXBL 2UU9L 3H0GH 1XJVA 4DV2L 3GTLH 3HKSA 4HJ9A 2Z0SA 1P16A 1OXSC 4JBWA 4UP7A 1KRTA 2HIVA 1DGSA 4DR7Q 3S17H 5AJ3L 3HOZH 3F8TA 1K3RA 4FDBA 5JEAJ 3G4SA 1YJNA 1IBKL 1PH8A 4GOPA 2EXDA 4DUZQ 5LMUQ 5LMNQ 1VQDA 1HR0W 2K52A 4LF6Q 4HJ7A 4JI8L 1YBYA 4X66L 4L5TA 1M1KC 1EUJA 3OW2A 1VQ9A 5GAEC 2MO0A 4NXNQ 1VQIA 4NXML 1BKBA 4LUOA 2C35B 3PIPA 1E1TA 4HIKA 5BR8Q 1P8LA 1TWHH 1XNRQ 3M85A 4AH6A 3UDGA 3PIOA 4QIWE 2B63G 2KBNA 4X64L 4OWWB 4DV4Q 3PO2H 3AYHB 4PZ7A 4JI2L 3MEFA 4X6AH 2VUMH 4GLAC 5ELOA 1MJCA 1Q12A 2F52A 1NMFA 1X3GA 2AWNA 1I50H 2B29A 3NBHB 4OWTB 4B3SL 4KHPQ 1I6HH 2YYZA 1KL9A 3L2PA 1EFWA 1XNQL 4YY3L 5GQOA 2N49A 3K81C 1W2BA 1OXXK 2Q2TA 1A63A 3W5OA 4AYBG 2UUBL 4OX9L 3CXCA 1I3QH 2K75A 3F2DA 3M9BA 3HOWG 2HHHQ 3A5UA 1Q46A 3HFZB 3KDFB 4BY1G 2EQSA 2RHQB 3ERSX 4GNXC 3G71A 3ZJYC 2ASBA 1OXUA 1HR0Q
chains in the Genus database with same CATH superfamily
4FP5D 1HQMC 1GOZA 4ULLA 1NSNS 1VQKA 1XWEA 1GHKA 1BQQT 3FDTA 4GZYC 3FHWA 1VQFA 5DM73 2B63H 4OONA 3M7GA 3EBEA 2UXDL 3C2PA 4OIKA 2K5DA 2B2TC 4QCLA 1GD7A 2D2CC 2V4DA 2YTXA 1YEZA 2B2WC 2FJ2A 2G9HD 4A3DG 4O2DA 1YNJC 4X3KA 2QDLA 1E1OA 1SE8A 1I50B 4LF4Q 1CHQD 5IGGA 3K5MA 2WB1B 1QNUA 4BXXG 4A93B 2LMCB 4JI8Q 2WV6D 1B9MA 4X66Q 3I56A 4JYAL 1L0WA 1NCVA 2NVYH 1HCZA 1LTAD 3JAME 3J81L 4K5XA 4HR7B 1MI2A 2O5JC 3RZOB 2D62A 3AEVA 1CA5A 1GUNA 2NYZD 3KLSA 2F4VL 3E0JA 5M3FG 1RTOA 3S24A 4DV6L 4R4QA 2SDFA 4HEDA 5IYBG 3AMUA 2KOLA 2E2JH 4KN7C 1WCMH 3CHBD 3IRBA 5LHY1 2IX0A 3AFQA 3HKZB 3DLLA 1BDOA 1D1KA 5EBCA 1Q86C 2F0JA 4IUVA 4AQYL 3MFGA 1G2SA 3S15B 2NTTA 2VB2X 1XTCD 2E2DC 2HDLA 2WAQG 1VQPA 5EGTA 2Y0SE 4A3MB 4GKKQ 1N32L 1STEA 5EKLA 1YVCA 4DNRB 5I2YA 3F2BA 5FOBB 3GP7A 4K14A 2XVSA 3GTKH 1IHZA 5C0XJ 4DV0L 4JW0A 3NHHA 1ZKOA 2R93B 4DV5L 1TXYA 1BBXC 2A6ED 3I4NB 1K9MC 1PH5A 1MD2D 5KNCA 1WYDA 2PQEA 4V190 5HGTA 1G51A 2NUCA 3RNUA 3L0OA 2CW0D 4A3DB 1JJ2A 1E2WA 1N36Q 2D0OA 5BN5A 2SNSA 3JAML 3K57A 1D8LA 1YNXA 2UUCL 5C3EG 4HAEA 3MXUA 1SE2A 2DGYA 1PH7A 1F2YA 5FLXc 1EYAA 2VY3A 1LT6D 2CQOA 3VYUA 4A93H 2BA1A 1F9PA 4C3HG 4WFN3 4A75A 4XIGS 1STBA 4R4IA 2HT1A 2LS01 3MXPA 1B50A 1W6KA 4JPBW 4XQJA 3E9IA 3A0JA 1VQ8A 1H95A 3H15A 2RDHA 5CV7A 1BVSA 4RWSC 1UE6A 2EDGA 4HMJA 3KF8B 2JA8B 5FJ8G 3S1RB 4KI0A 2B2UA 1C7YA 1K83H 5FO9B 4MTKA 1PLFA 1GM5A 2ZM6Q 4JI0L 1GUTA 5T1IA 5HURA 4UP9A 2YTVA 4ME3A 4ZRZA 4DR1L 4P2CB 3S15H 4UHVA 1KRSA 2F3VA 1GVPA 1I4XA 3NTKA 2EY2A 4A3MH 1FGUA 1V9PA 1SNDA 1KQSA 2F0OA 1QZGA 2F0UA 2E75C 1PH4A 4TRDA 5CGKA 1NMGA 4JCVE 3SHLA 1BCPD 1H9JA 3PO3H 2R93H 4JG2A 1RTNA 3J81c 1JCKB 3I4NH 2AUKA 2QA4A 3TP7A 5C5LA 1A3VA 1V8QA 1E2VA 4PMBA 4LF6L 1UWVA 1QUQA 2WFWA 5DM63 2F0KA 1VQAA 4I65A 1JE5A 2MGSA 1GKHA 4B3TQ 1E7ZA 1C0AA 2MNAA 1CKMA 1EIYB 1O80A 1VQNA 1Y1WB 4QUCA 1XNQQ 1ICWA 1XTDA 4X65Q 3M4QA 4J15A 4DV4L 3Q6SA 1RKNA 4TQUS 2RSOA 4R4CA 2LXKA 4A3IH 1GUSA 3DWQA 3QOJA 4DK3C 2ZTCA 2F0GA 1I5FA 1BBWA 3NTIA 1EOVA 3A7AB 2PNHA 3PUXA 1U4LA 4YWMA 3E9HA 1EEID 2F0SA 1VS0A 4A3LH 2L11A 3D4WA 4JI5L 3C46A 1STHA 2PI2A 1QZHA 5JJLA 5CMDA 5M3MG 4NMZA 3PQIA 5C6AA 2DY8A 3A54A 2JA8H 1EIHA 3U4VA 5DEHA 2O5IC 2LXJA 3PF4A 4QY7A 2XWJB 2XSCA 4FNFA 3GTJH 3CC4A 4U673 3ICEA 5BN3A 1SYDA 2EVBA 2F0VA 3JAMc 3TDQA 4LNQA 1EL0A 2I5HA 1SXTA 5FO7B 4LF4L 1KTKA 5C0XG 3U50C 2B2VC 4IJHA 5EPJA 4P73A 1GUOA 3M4PA 2F0PA 1SMYC 5ELCA 3SVMA 4C1NI 2DJGC 4KN4C 3KFUA 2WAQE 2DNCA 2AUJD 2A6EC 1VQGA 3CRLC 2VQFQ 4FO2A 1LO5D 2CCZA 1SYCA 2NBFA 1A0IA 3EN2A 2A73B 2CQAA 4C3JB 1WD0A 2CH4A 3FKIB 5CV8A 2M00A 3VYRA 1LTSD 4LF7Q 1LACA 5D14A 4X3UA 5CBEE 4DR3Q 4RCOA 4B9WA 1YJWA 4BY7B 1MBYA 5D3IB 3A8IE 5KYLA 2Z4HA 1C9OA 2ZXRA 2E74C 1VF7A 5E4XA 1Y1WH 3NELA 2Q2HA 3F1ZA 1IL2A 1B4OA 2NVTB 3H0GB 4JI4Q 5IGCA 3S2HH 2IHEA 3D6WA 4GNXA 2KENA 4GKKL 1L1OA 4LF9Q 4GLXA 5JJIA 1PRTF 3IKJA 1LLRD 1YNND 1Y1VG 3CCSA 4KLKA 4DFAA 2WP8J 2XRQD 2DN8A 5M3MB 3RMHA 2I07B 3I4MB 3VYTA 3TS2A 3HP3A 3PGZA 5CORA 2L15A 2WINB 5IYDH 3VDYA 4DR5Q 4IALA 2VUMB 5IP9G 5J22A 2OF1A 2K05A 1N36L 1PYBA 4H13C 1N33Q 1Y69U 3S1NB 4H0LC 2K5HA 3CCEA 2B8FA 1D1IA 3OPOA 4A3EH 4C3IB 3GQBA 2JA5G 3KYHC 3A55A 1EY8A 3WWVA 5IYCH 1K8GA 1VQ7A 2F0WA 2B2YA 3BYTB 4JI1Q 2RQXA 1B3AA 2K6AA 1OXTA 2KJXA 2NN6I 1RL2A 2X69A 3S2DB 1S5BD 3MA2B 1HJPA 4HJ5A 2PZWA 3NQIA 3ERQA 1PH3A 5LMNW 4C3JH 1N9WA 2SOBA 3FKIH 4LJZC 1ESRA 2YU9H 2K01A 1WJJA 3A7LA 4A3CH 4BY7H 1FD7D 1PRTD 3S14B 4CJ0B 5J1ZA 4IO9A 2K50A 1YZ6A 2RHSB 3HOYH 2RF4A 3FRPB 2RDFA 5IGEA 3PO2G 3EROA 1CHPD 4TVAB 4CJ1B 1A15A 4HMIA 3OTOQ 2ZM6L 4BA2I 5NUCA 2BDNA 2UU9L 3H0GH 3GTLH 3OHXC 2Z0SA 1P16A 1OXSC 3C1FA 4UP7A 2RBMA 3WOEA 1BNZA 3DUZA 3TP5A 3HOZH 1K3RA 4FDBA 1PFNA 1PH8A 1EYCA 1I4HA 1ZXTA 3A8KE 2EXDA 4N9TA 4F87A 2K52A 3MAQA 2F0FA 3OW2A 2K32A 3K5NA 1LT3D 5GAEC 3PIO3 1BKBA 2JA6B 5KEEA 3PIPA 1IYUA 1ESFA 5BR8Q 1P8LA 1PTOF 2B63G 2KBNA 2PNRC 4BBRB 3TZUA 3MEFA 2VUMH 4GLAC 3CQZB 4K8JA 1I6HH 1EFWA 1ML0D 1XNQL 1XX8A 1U4PA 1O7ZA 1OXXK 3H09A 2B2UC 4AYBG 1A63A 1SJHD 3CXCA 3ONAB 2N55A 4G7OC 5CV9A 1SBBB 2EQSA 2RHQB 3ERSX 5CBAE 5C44B 1OXUA 1HR0Q 2JEBI 1DOMA 1EU3A 1SSOA 1K0SA 2SNMA 5C4HA 3TEHB 2EYHA 3J80E 3CC2A 3I55A 1PV4A 3NBIA 3S2DH 3MHBA 4LF8Q 2FFKB 2UUAQ 1NTGA 3GDEA 4X3TA 1NR4A 4IUQA 5IODA 2PPBC 1UAPA 4RGNA 4RKLA 2JSOA 2VZAA 1NR2A 1G291 3V96A 2IX1A 3NXWA 1HZCA 2GA4B 2AMCB 3S14H 3PO2B 1D7QA 1WCMG 3Q8DA 4QF4A 4YHHQ 4GKJQ 4BY1H 1CZWA 2N78A 4O0AA 5DLQE 1BBUA 1TWFB 2GN5A 2MFIA 2HUGA 3RZDH 4A76A 5JJKA 1X32A 4ZKCB 2R7FA 4ME5A 3KJPA 2QEJC 1TS5A 3TP6A 3LGJA 1LTID 4XT1B 2R92B 4CGYB 1SNQA 4J1MA 1TKWB 2EE1A 5IP7H 2A68D 1SR3A 1AW7A 3CAMA 4YY3Q 2JA6H 5I9PA 4LF7L 3QWNA 2Q2UA 2BH8A 4LFAL 4DR3L 4XYOA 1F2LA 3HOXB 5E1FA 4HJAA 4BBRH 4G7HC 5IIFA 3OOCA 4ODGA 2BA0A 2F1MA 2OWOA 1B8AA 1R4PB 2VQEQ 4FYDA 4JI4L 1FNVA 3N6RA 5COYA 1FVIA 5C44H 4OL7A 3O13A 1IXRA 1CM9A 2WB1G 4LF9L 2NVYB 1BUVT 1EU4A 3CPFA 4A93G 4KY6A 5I6WA 3N52A 1FYCA 2PMZB 4DR2Q 3LX0A 1AZQA 1D5ZC 3AU7A 4EQOA 5EQ0A 3KF6B 2PW7A 2O4XA 4LK1C 3SR1A 1T9HA 3NE5B 1PRTC 4LFCQ 1EIGA 1L0XB 2E2JB 2OQKA 2JP1A 3UI2A 1CK1A 3HGBA 1TWGB 1CFMA 5KGUA 4ABNA 2RVLA 5CV6A 4GN4B 4R9WA 1Q81C 3RN2A 3D6CA 1ILQA 1VQMA 2AHOB 3EQLC 4DUYQ 3HKZG 2B2VA 4ID6A 4L8JA 1N33L 4CKCA 4P75A 1TWFH 1AP0A 2O2LD 4WJ3M 1X55A 1DXMA 1VQ5A 3BVMA 3GTKB 2HQLA 4A3MG 3F2CA 2L5TA 2ICIA 1AE3A 3ZYYX 1KABA 3J81j 2F0EA 4JI1L 1L1OC 3K5LA 3W1BA 2R92H 3GTQB 3OWFA 4DR6Q 3V05A 4DPGA 2R93G 1TIID 1UEAB 3A74A 4MIUA 4Q0FA 4WJWA 1F2ZA 1EFID 1K73C 3I4NG 2NVXH 2CFMA 4BBSH 3S16B 2OT2A 1ICFB 3I70A 5CV5A 1FR3A 1X9NA 4EGVA 3Q23A 3HOXH 2UXBQ 2JA7B 2KCMA 3E0EA 1JT8A 3UDIA 1SRUA 1ENAA 5JEAH 1SE4A 3KLRA 1NBWA 4DXGA 2FINB 4MNOA 1X56A 4RKBA 3OTOL 1BXTA 1CQVA 5IWAQ 2R7ZB 1SYBA 4A3IG 2N88A 1LT5D 2AQ2B 2NZ1D 3CPWA 3TN2A 3AQQA 1PH2A 1JICA 3MZ5A 3SK5A 1VQ4A 4RHSA 1VQBA 3Q22A 1KAWA 2B2YC 3FPUB 1HZAA 3M4OH 4X64Q 4JI3Q 4JI2Q 4A3LG 3C1EA 4IJLA 1NUCA 3RR5A 5LL6S 1JQYD 2RSNA 1D6EC 3UDFA 4L63B 4DN4M 2EYLA 3I2ZA 5BR8L 2VB3X 3JAMi 1LTBD 4HN7A 1D5MC 3RLOA 1TWGH 4RAUC 1K83B 2VL6A 1FJGL 1TS4A 5CR3A 3OW7A 2JA8G 3MEHA 1E3PA 1Z47A 2ENBA 1SMXA 3GV6A 4DAPA 3QG1A 1PTOC 1V43A 5ELNA 2FXQA 1UE1A 3J80c 4DKAC 4Y7NB 3KOJA 5GAHC 2QGQA 4A3GB 1I94Q 3T56B 3HOVB 2I46A 4OEMB 1IZ6A 3Q24A 1G6PA 2V1CC 5CV4A 1U4MA 3BDOA 3J7AF 1Z9FA 4F7XA 4A3FH 1II3A 1KLUD 1I4PA 5EBDA 3STBC 1R9TH 2A68C 3PO3B 2I0QA 3GTQH 1PYSB 1KHIA 1YHBA 1VQJA 2UUAL 1U9RA 2J0TD 3J7AV 3SEBA 3S1QH 4DV7Q 1K8AC 3S16H 2EJFC 4LFBQ 3MXNA 3PCOB 1ET9A 3TSSA 1WTHA 1HRJA 2EYFA 4JV5Q 2JA7H 4OO1H 3VR3A 3NK9A 1EQQA 4YHHL 1QOHA 1BCPF 1IL8A 2QILA 1Y1WG 4GKJL 2MQHA 4WORA 4RGTA 4YCWA 4A3IB 3GTPB 1QB5D 3I3CA 1EYGA 5M5WH 1HFNA 1K8OA 3K7UC 2R7ZH 3W2DA 3CD6A 1J5EQ 1SNMA 2SEBD 4OHJA 3TP8A 4DK0A 3TRZA 3FVQA 5DNFA 3TMEA 1XMQQ 2DY7A 3EA6A 5A2QE 2E8GA 4JOIA 4HTHA 4KV6A 2KEDA 2OCEA 1T5XD 3PF5A 1DJRD 4ZCKA 2EOTA 1Q8KA 2WB1E 2NVQB 1WTPA 1EY9A 2WACA 1ZYRD 1HZ9A 1EQRA 1Z7TA 5IYDG 1IBLQ 4O1NA 1XPRA 3GTJB 5IT9L 2MPMA 4HIMA 3W3AA 3GTGH 2UXCQ 2P5ZX 3P7JA 1AEXA 5IGBA 4WRDA 2Z8LA 4JBJA 4Y7NH 4A3GH 1F9RA 1L2FA 3HOVH 2GVAA 4UAIA 2LSSA 2NN6H 4R8NA 1RIPA 2M2LA 5IYCG 1YHQA 3HKZE 2NZOA 4K8IA 2A74C 4NW2A 3A8JE 1IBMQ 2Z6KC 4LUVA 1TWHB 5C3XA 5M9OA 5HY6A 4YIJA 3PUYA 5F2DA 1ENFA 4K0KQ 1EWHA 1HTPA 1NY4A 4C3JG 1KNEA 3FKIG 1LYLA 2J4XA 1SN8A 4XYQA 4LFCL 3CCRA 1I4RA 1HUMA 1E22A 4IURA 3CU7A 1S5ED 4R4TA 4A3CG 5HGQA 4BY7G 1XNRL 1I3QB 5A2QL 2MO1A 2ZTEA 1WTOA 1NE3A 3NWTA 4EX5A 3S2HB 2Q8RE 2RA4A 1KDCA 3KLSX 4DUYL 2KCTA 3HOYG 4O42A 4DV3Q 1G6ZA 3GTPH 4IPDA 3H0GG 2JN4A 1KDBA 3K0YA 2PQAA 2Z9HA 4MHEA 3S1MH 2LKVA 3HOZG 4K2LA 4JI6Q 4IQZA 2F0IA 1HNZQ 3HEJA 5C4XH 4B3RQ 4LMQD 1NAPA 1JE4A 3P1HA 5D3DA 5M5YB 2KUMA 2NVQH 4K5VA 3J7YW 2M9VA 3T13A 3I4MG 3WDNA 1QJOA 2Z6BA 4H02A 4DK6C 5JVG3 1W6JA 4OGQC 2F0TA 1K0RA 5FKAC 1SEBD 2VUMG 2UXBL 2MHVA 1RJTA 1S5CD 3R2TA 3MC0B 4JBWA 1KRTA 3DXJC 4DF7A 4A3EB 1D2BA 1G2TA 2IX3A 4IZ8A 1Z6HA 2F0NA 5JEAJ 3G4SA 4XXEA 4GOPA 4C3IG 5LMUQ 5LMNQ 1WD1A 5CC4A 4JI8L 4X66L 4PNYA 2BOSA 5BN4A 2H4OA 1SNPA 2A6HD 2B8GA 3V2TA 4HIKA 3HRZC 2LY7A 3K7AB 1TWHH 2YU9B 1VMPA 3PIOA 4X64L 4OWWB 3AYHB 3QJYA 4PZ7A 2CW0C 4JI2L 4X6AH 1Q12A 3C3LA 2F52A 1BR9A 4KHPQ 1KNAA 2XWBB 3L2PA 1LABA 1SJED 1M4VA 1EYDA 1GUGA 3HOYB 1IW7D 1I3QH 3F2DA 3M9BA 2EYMA 2HHHQ 1C48A 1Q46A 4BY1G 3DEPA 1AZPA 3ZJYC 2F0HA 2ASBA 3GTLB 5T1GA 4CJ2C 4YCUA 1I94L 2E76C 2EXZA 3HOZB 1V1PA 2K7VA 3CCMA 1JC7A 2L0CA 1LTLA 1QUQB 3GD7A 3K8AA 4RFBA 3H6MA 4NPSA 1ASYA 1PXUA 3W1GA 4NKLA 4DGZA 5IP7G 1AH9A 2VNUD 2MJ8A 2X6LA 5M5YH 4IFDI 3BZKA 2JA6G 4B9XA 3F2UA 4KD4A 3KLWA 1XMOQ 3JC66 4DV7L 1I6HB 4QB4A 1A3TA 4BBRG 1EY5A 4JV5L 1U5KA 4DR4Q 3CC7A 2EIFA 1HHVA 2IW3A 3DMUA 3TBIB 1EQTA 1U0LA 3H91A 1JWSD 4IOAA 1I4GA 4DAYA 3AFPA 3X3NA 3NENA 1NJIC 2IY5B 1GJXA 1BCPC 1HH2P 1PH1A 2RCNA 5LL6X 5C44G 1XXGA 4B3MQ 1J5EL 4LF5Q 4IUUA 4DAVA 1XMQL 2OXPA 2RKSA 1Q3LA 2KCCA 1O7LA 1TR5A 3BZCA 3K7AH 4NDXA 4XDXA 1S3OA 3PUWA 3RUZA 4UY8C 3E6ZX 1Q82C 5K36H 2EYPA 4E6IA 5I2XA 1U4RA 1Y8NB 4CKEA 2PZTA 1CKNA 3D4DA 1MSHA 2CVRA 4BY1B 3P75A 4F88A 4R1JA 3KK7A 3BDCA 3RZDB 2UXCL 1X3EA 4ILWA 5G3LD 1FL0A 3T1HQ 3T1YQ 5ELDA 4RCNA 3H3VC 5EKKA 1GUWA 4I7AA 4OWXB 4DAMA 4GLVB 1PH6A 4P71A 4EQNA 1STGA 1PZID 2A5HA 1LT4D 2QW7A 3I90A 2J7ZA 3NSWA 1SNCA 3G48A 3I8ZA 2R92G 1H9SA 4A3KB 4JOIC 1KDAA 1DM0B 3D0FA 4XT3B 3U58A 2PW5A 2KHJA 2ZJPA 3BVGA 1V1OA 2FMMA 4LW1A 4JYAQ 4K0KL 2PO4A 2KQ3A 1YITA 4B3TL 1SYGA 4GNXB 4YCVA 4A3JB 4BBSG 1ET6A 4IOCA 1PHJA 3HOXG 5IOCA 1RODA 3OWEB 4X65L 3CKIB 2F4VQ 4MZ9A 5JEAG 5KRUA 1PVOA 1HZBA 2Q2IA 4DV3L 4CDCC 2MUYA 4DU9A 3I72A 4EVOA 2I5LX 2AKWB 5ELEA 1SFOH 1Y8PB 4IPHA 5AFWA 1Q7YC 4JI6L 5E7NA 3I7FA 1HNZL 2NZHA 4HIDA 2CH4W 4B3RL 2ATWA 2CHBD 5K5PA 4DV1Q 1HTLD 4DV0Q 3J80i 4AIMA 1TWCH 1IYJB 3NBHA 1IW7C 4QMGA 5JOBA 3I91A 3M3YB 4QJFA 2KHSA 4A4IA 4QIWB 4EQ5A 2QCPX 5A35A 3KDFA 1WOCA 5C4JB 1KIXA 5KYIA 1EQVA 1TWAH 3TS0A 3GO5A 1LTTD 3HS0C 1QVGA 4FXDA 5JPNC 4NXMQ 4JVZA 3RLFA 1BO0A 1YNNC 1X3FA 2Z6KA 5LMNL 4A3FG 1UE5A 3VR4A 5D65A 3CCUA 3UDXA 2UUCQ 3CF5A 2VQFL 3BVZA 1PTOB 1MJEA 4A3BH 4B3SQ 4XTCS 1F9SA 4JC0A 4A3KH 3PUVA 4L5SA 2NVXB 4CDDC 4BBSB 4OX9Q 2UUBQ 1AN8A 1Y1VH 2HQEA 4Z9CB 4A3JH 1Q1BA 2C5CA 2PCFB 3H3VI 5M5XB 1QG7A 4KHZA 3MXGA 3LWUA 1NNXA 2CWPA 3FPPA 2JA7G 4OO1G 1LUZA 5ISRA 1XYIA 2HHHL 3TQYA 4RG1A 1J6QA 1HFGA 3FMCA 3URYA 5IP9H 3GV3A 1DZ1A 1VCIA 4UP8A 2R7ZG 2K4KA 2R6GA 4GOPC 4DR1Q 4GN3B 3I4OA 3K6OA 3M4OB 3R2IA 1JB7A 3D8GA 2JA5H 4WJ4A 3MVVA 3G6JB 4HSVA 1A3UA 1Y14B 4R4OA 2OTLA 4X3SA 1X3PA 1X65A 3DEOA 3E5SA 2YTYA 4K6DA 2K5QA 1Q8IA 4CKBA 2N3SA 3ND9A 3P20A 2B39A 4DR5L 2Z4IA 3L3OC 4KHVA 3M3YH 3NEMA 1XMOL 3A5ZB 2F0MA 1E0BA 4F8MA 5DAUA 2TSSA 2EJMA 4GN5A 3NPPA 1N34Q 4DR4L 4ZKBB 2Y0SB 1KC8C 5C4JH 5I4DA 3NWSA 3J81i 1M8AA 2B3GA 4A3GG 4P74A 4A3FB 1E24A 1I4QA 1WTXA 3HOVG 1V1QA 1KAAA 2NN6G 1R9TB 1J8IA 1WVLA 1KXLA 1BOSA 3SE0A 3DM1A 1JJCB 3T53B 1JMCA 4B3ML 1OTCA 4LF5L 1B7YB 5FLXL 1MGSA 2AWOA 3PUZA 3PO3G 1JR0D 1PTOH 1EWIA 1PZKD 1BF4A 4IUTA 3IFDA 3G7LA 3GTOH 4DA2A 3S1QB 2F3IA 5C3WA 2E5LQ 1JOKA 3SK6A 2ES2A 2FHTA 2VW9A 1VQ6A 1DCZA 3DHQA 1HA5A 4PMWA 4ALPA 3BU2A 3CW2C 3S17B 5M5XH 1UEBA 4JI5Q 1C4QA 2IL8A 3BYYB 2WKCA 2HCIA 5M5WB 2KHIA 4HJ8A 4PMCA 3E3XA 3T1HL 3T1YL 2ZJRA 3HOUH 4MN3A 4ZQ3A 2EJGC 4EQPA 4GNXC 4P72A 1DD2A 3CCJA 4AYBE 1ASZA 1QILA 2PZUA 2WKDA 5H1SE 5FO8B 2F3WA 3KF8A 3U4ZA 1CI3M 2JQOA 5C4XG 3OIQA 3OYYA 3NTHA 4X62Q 3OSOA 3CCQA 3NQTA 4K5WA 4ZLTF 3QO2A 5C0XI 1YIJA 2D0PA 2BH2A 5L37A 3KBXA 3GTGB 1B2TA 2VXWA 4RHRA 2PMZE 4LAAA 3HZXA 3CMEA 4HCSA 1DOLA 2HD3A 1A6XA 1A62A 5KNBA 1VQLA 1SROA 5FLMH 2JJQA 1HR0L 1VQCA 2I5MX 2QEXA 2E2IB 5IT9E 2XN9C 5E3FA 4JI7Q 3H94A 1Y8OB 2PYKA 1JWUD 4KJOA 5IY0A 2K5VA 1PH9A 1QVCA 3ULLA 2EPBA 1STAA 2GVBA 3HOWB 1STNA 4LF8L 1MIUA 5J39A 2DNEA 1LTGD 1SNOA 3L7ZC 1IKLA 2NB0A 3ULPA 4DV1L 4ZK9B 2BDOA 3HKSA 3ITPA 1SMYD 2HIVA 4IUNA 4DR7Q 3S17H 3NUCA 3K58A 1YJNA 4PQXA 4V0BA 4DUZQ 1HQRD 4FF1A 4L5TA 1M1KC 3S1MB 1EUJA 3L9AX 1LV9A 3MFYA 1WTVA 1K3BC 4CBVA 2MO0A 4NXNQ 4NXML 4LUOA 3SK4A 2R61A 1E1TA 1SDFA 3M85A 4AH6A 5JJZA 4IFDH 4FF3A 5C4XB 3LNNA 5EPKA 4RA8A 3DWPA 3TZDA 1NMFA 1X3GA 4KKUA 1I50H 4KY7A 4OWTB 1G8ZD 4B3SL 1HUNA 2YYZA 1QCBD 4YY3L 1K28A 1W2BA 2Q2TA 3W5OA 3EVQA 2UUBL 4OX9L 4C56C 2K75A 4QUFA 3FEWX 2KCNA 3G71A 2EYOA 1J9OA 2FMCA 2YV5A 4BA1I 5M3FB 3RZOH 2IHFA 2ICEC 1XPOA 2L12A 3VA5A 4H7BA 2VQEL 3OMGA 4A3EG 5IGDA 4L6TB 3EFXD 1GXDC 3I73A 3K80C 4RH6A 1UNSA 4QGUA 2E2IH 2WAQB 2ZT9C 1KLGD 2NTSA 5FK9C 2L1BA 1RD9D 4DR2L 2WIIB 1YJ9A 2UU9Q 1TU2B 4J8QA 3J7ZC 1D5XC 3HOWH 2F0QA 2KA7A 2ZTDA 3DWAA 1VQOA 1BCPB 3SXHA 1X3QA 5K36G 1PFBA 1S5DD 1FNWA 4B08A 5J3BA 1QNKA 2X6GA 2A19A 1HNXQ 1CT1D 1RHPA 2N8NA 2QKIC 1N34L 2EY5A 5EJWA 1CZGA 3CP0A 2L9HA 1QWYA 1TY2A 3QIAA 3CCLA 3ER0A 1CSPA 3AB9A 3OIPA 1YHAA 4G4KA 4A3DH 3CMAA 5C3EB 1ONLA 4ZUIA 4HSPA 5TSSA 2JEAI 2IPKD 3MXNB 3K5OA 1FGBD 1H9MA 4BXXH 4IN3A 4L5QA 4DR6L 3D31A 1PA6A 4C3HB 4G7ZC 1UE7A 1F2MA 2IT1A 1EY4A 4KJNA 2E5LL 4OELB 1MSGA 1RDPD 1CSQA 3PV0A 4YWKA 4OXPA 2K33A 1EY0A 2JYOA 4C2MB 1DOKA 5M3FH 4C1NK 1O7YA 5IYBH 2HDMA 4MTNA 1VQEA 4BS9A 3BDLA 4APVA 5IWAL 1O78A 1LTRD 4JBKA 3G6EA 2RDGA 3S1RH 2Q8TA 4IUPA 1EY6A 2OEOA 2H1EA 3WOFA 3KUPA 4BWGB 1VQHA 2ID0A 1LM0A 1EOTA 1HPCA 3OMCA 4PG3A 4JI3L 1JB3A 1QVFA 1TQOA 1HNWQ 4UPAA 4KY5A 4GS3A 4NB3A 4X62L 4FF2A 4XQQA 1S40A 3ND8A 4K6LA 4YWLA 2K1BA 1IKMA 2HCCA 2F4IA 1AE2A 3A56A 1Q90A 1VDZA 3TREA 5IT9c 3KJOA 1G91A 2KECA 2QF7A 4I7ZC 4QL5A 1UUPA 5EPLA 4LFAQ 3IAYA 4R8IA 1SYFA 4DK1A 2K28A 1EWCA 1X54A 3BG3A 3VR6A 1KD1C 5C3EH 4JI7L 2BE5D 3BZDB 1B53A 2NWGA 4KMUC 1AFPA 3SK8A 2K04A 1S72A 1ENCA 1ZYRC 1E2ZA 4OO1I 3MWYW 4A3BG 5G3LF 2EY1A 4DV2Q 3PMFA 2DUDA 4A3KG 4L5RC 2Z1CA 3H3VH 1JOQA 3ULJA 3VR2A 4C3HH 1XPUA 4TKOB 5AJ3Q 2ZXPA 5KIXA 2A69D 3PSIA 4LFBL 1IBKQ 2JXMB 1JWMD 4A3JG 2PQAB 1VMCA 3CRKC 4DR7L 1JJGA 2B2TA 2K03A 4C2MH 1OXVA 4U68A 3J7A5 4RGMA 5FJ8H 5JVH3 2B2WA 4DUZL 3VYSA 2EZVA 3EJIA 3MTSA 3RN5A 1JOOA 2JA9A 4H44C 1Q1EA 1SFOB 3IL8A 4NXNL 5I9OA 1PFMA 2R7DA 4ZUJA 4PZ6A 1A2TA 3GTMB 1ILPA 4KK7A 1MHWC 2JK8A 3Q0AA 1QE6A 2XIWA 4ZYSA 4FXGC 2IWHA 4IFDJ 1TWCB 4CHTB 1SE3A 1B1ZA 1CQFA 2LFNA 1HXYD 4FF4A 3BJUA 1IBLL 4TSSA 4GOPB 1F9QA 2E2HB 1H9KA 3QOLA 1TS3A 1TWAB 2UXDQ 1STYA 1PRTB 4OIJA 1RF2D 5C4ZA 1C8CA 1H9RA 2D9UA 2JE6I 1WFQA 4UDUC 3IFTA 5ELFA 5EAYA 3K0XA 4JBMA 2QDBA 2F03A 1WTWA 4HCEA 3QR8A 4A3BB 1A8VA 2ALYB 1IBML 2NVTH 2CWAA 1PDQA 1TS2A 4FXKC 4NP5A 3R3OA 4FVMA 1B70B 2HIXA 1S5FD 5KNDA 2IJ0A 1Y1VB 4N9PA 3M4YA 4IPCA 2KEEA 3D4RA 4LWCA 3U9SA 1GHJA 1L1OB 1CTMA 3SGIA 4Y52H 1V1PB 1SAPA 4POGA 1EEFD 2XGTA 3NP8A 3HG9A 5GROA 3T16A 1FNUA 5M3MH 4DV6Q 3I4MH 1JORA 1O7IA 2OQ0A 4CDEC 1HNXL 2KVMA 2A6HC 2L4NA 1FJGQ 4DNIA 2Q8IB 3KF6A 3HOUG 3M7NA 4M8AA 4AQYQ 1EY7A 4KKTA 1EIFA 4KD3A 4N8FA 2JA5B 3GTMH 3S1NH 2R3ZA 1N32Q 3T51B 5C0XH 4RGOS 5ELBA 1MKHA 1YNJD 4C3IH 1HA6A 2G9DA 5GAGC 4HIOA 3R93A 2MP1A 3DM3A 1W3SA 2PI2E 2BCOA 2K5NA 1SLJA 1WI5A 4XQNA 4DV5Q 4DAYB 5IE8A 1S4ZA 3RLNA 4KKSA 2E2HH 3LWEA 1GO3E 2CKZB 5I6YA 3R8BA 2XNAC 1T5EA 3T4AC 4RMFA 4PZ8A 2EYJA 2RCFA 3KBGA 3SDZA 3FP9A 2Y0SG 1CUKA 5FLMG 2BE5C 1B9NA 5LMUL 2F0LA 2C9OA 5CYUA 1R4QB 3U9OA 1PFSA 3VA7A 3X3MA 1N8RC 4QQBX 1CKNB 3GTOB 4N8X1 1PTOD 4JK1C 1X6OA 4M1UB 2A69C 1M90C 1PYWD 1HNWL 2EY6A 3QB3A 1WTRA 4KHPL 2A8VA 4POFA 5FLXE 4IPGA 3STBD 2VS1A 3RD4A 4LUZA 2B63B 4ZAIA 1PZJD 3HOUB 1TVXA 1A2UA 3UE1A 4Q5VA 2AQ3B 4DNTB 5GADC 1H9SB 3CCVA 1CKOA 1TT2A 2ZJQA 3D3RA 1EZ6A 4JI0Q 3CQZH 4AYBB 3S9WA 2A1AA 3J80L 1B3QA 4KTAA 1B44D 2XTIA 3UE0A 3EIVA 4CDFC 5E4WC 2K14A 1WTQA 5IGFA 3K59A 2OTJA 5JAVA 4IFDG 3B6YA 1YI2A 2ZXOA 1DYQA 2H5XA 3VR5A 1F77A 3BS1A 2L55A 1XJVA 4DV2L 3I4LA 4HJ9A 4J6HA 2DJFC 1EZ8A 1DGSA 5JPMC 1DONA 5AJ3L 2TMPA 3F8TA 4G57A 1IBKL 1OO9B 1VQDA 2K5WA 1HR0W 4LF6Q 4HJ7A 3PIP3 1YBYA 1IYVA 1VQ9A 2XRSD 1VQIA 2C35B 1WCMB 5C5MA 2G5DA 1K8MA 4DXFA 5EKIA 1XNRQ 4PV1C 2AQ1B 3J81E 3UDGA 4QIWE 1L0YB 1RCVD 4DV4Q 3PO2H 1I6VC 5ELOA 1MJCA 1CA6A 1VF5C 2AWNA 2B29A 3NBHB 1KL9A 5GQOA 2N49A 3K81C 4K2KA 4S3SA 1ZEQX 2D5DA 1SYEA 3HOWG 3A5UA 3HFZB 3KDFB 1TY0A 2F0DA 1PMRA
chains in the Genus database with same CATH topology
2YV5A 2JEBI 4BA1I 4YCUA 3RZOH 1I94L 1VQKA 2IHFA 3TEHB 1XPOA 3CC2A 3CCMA 3I55A 1PV4A 2VQEL 3FHWA 4A3EG 1LTLA 1QUQB 3GD7A 1VQFA 3K8AA 3S2DH 2B63H 4OONA 4NPSA 3K80C 4LF8Q 3EBEA 2UUAQ 1ASYA 1NTGA 3GDEA 2UXDL 3W1GA 4QGUA 2E2IH 1GD7A 2YTXA 5IP7G 1YEZA 1AH9A 4DR2L 2VZAA 1YJ9A 1G291 2UU9Q 2VNUD 2IX1A 1HZCA 5M5YH 4IFDI 3S14H 2AMCB 3BZKA 4A3DG 3J7ZC 2JA6G 1D7QA 3HOWH 4O2DA 1WCMG 3Q8DA 4YHHQ 4GKJQ 4BY1H 3KLWA 1E1OA 1SE8A 3JC66 4DV7L 2ZTDA 1XMOQ 2N78A 4LF4Q 4O0AA 5DLQE 1VQOA 1BBUA 2MFIA 2GN5A 4BBRG 4BXXG 3RZDH 4JV5L 5K36G 1U5KA 4A76A 5JJKA 4JI8Q 3I56A 4X66Q 4DR4Q 3CC7A 2EIFA 2R7FA 3KJPA 4JYAL 1L0WA 2NVYH 1U0LA 5J3BA 4IOAA 3AFPA 2IY5B 3LGJA 3NENA 2A19A 1NJIC 1HNXQ 4JI3Q 2D62A 2N8NA 1N34L 3AEVA 1HH2P 1PH1A 2RCNA 5C44G 4B3MQ 3CP0A 1J5EL 4LF5Q 3CCLA 5IP7H 2F4VL 1SR3A 3ER0A 5M3FG 1XMQL 1CSPA 4DV6L 3S24A 1YHAA 4R4QA 3CAMA 4A3DH 5IYBG 4YY3Q 3CMAA 2E2JH 2JA6H 1WCMH 3IRBA 2JEAI 4LF7L 2IX0A 3AFQA 3BZCA 3K7AH 2BH8A 2Q2UA 4LFAL 3DLLA 3MXNB 4DR3L 1S3OA 3PUWA 1Q86C 4UY8C 4AQYL 4HJAA 4BBRH 4BXXH 4L5QA 4DR6L 3D31A 1Q82C 2WAQG 1PA6A 2BA0A 1VQPA 2OWOA 1CKNA 1UE7A 2Y0SE 1N32L 4GKKQ 2IT1A 1B8AA 1YVCA 2E5LL 4R1JA 3F2BA 2VQEQ 4JI4L 3GTKH 5C0XJ 4DV0L 2UXCL 1X3EA 1FVIA 1CSQA 5C44H 3PV0A 1FL0A 4YWKA 3T1HQ 3T1YQ 4OXPA 1IXRA 2WB1G 4LF9L 5M3FH 4DV5L 3CPFA 1TXYA 4A93G 4DAMA 4OWXB 5IYBH 4GLVB 1VQEA 4MTNA 1PH6A 4DR2Q 4P71A 4APVA 1K9MC 5IWAL 1PH5A 4JBKA 3KF6B 1WYDA 3G6EA 3S15H 1T9HA 1G51A 3S1RH 3G48A 3RNUA 3L0OA 4LFCQ 2R92G 1JJ2A 1N36Q 2OQKA 2D0OA 4JOIC 3D0FA 3U58A 1VQHA 2ID0A 2KHJA 2ZJPA 1LM0A 1D8LA 1YNXA 4GN4B 4LW1A 4PG3A 4JI3L 5C3EG 1Q81C 2UUCL 4JYAQ 3RN2A 1QVFA 1YITA 4B3TL 2DGYA 4GNXB 1VQMA 4YCVA 2AHOB 1PH7A 4UPAA 5FLXc 4DUYQ 1HNWQ 3HKZG 4GS3A 4NB3A 2VY3A 4X62L 4IOCA 1PHJA 1S40A 1N33L 4K0KL 4P75A 1TWFH 4YWLA 3HOXG 4WJ3M 2CQOA 1X55A 4X65L 4A93H 1AE2A 2BA1A 1VQ5A 4MZ9A 5JEAG 3TREA 2F4VQ 1PVOA 2HQLA 5IT9c 4A75A 4A3MG 4XIGS 1HZBA 2Q2IA 3F2CA 4DV3L 3KJOA 1AE3A 4R4IA 2HT1A 3J81j 4QL5A 4JI1L 1L1OC 4LFAQ 3E9IA 2I5LX 3A0JA 3W1BA 2R92H 2AKWB 1VQ8A 1H95A 3H15A 1X54A 4DR6Q 1BVSA 4DPGA 1SFOH 4IPHA 1UE6A 1Q7YC 4JI6L 2R93G 3KF8B 5E7NA 3A74A 3I7FA 1K73C 1KD1C 5FJ8G 3I4NG 5C3EH 2NVXH 2CFMA 4JI7L 1HNZL 4KI0A 2NZHA 4HIDA 4BBSH 1C7YA 4B3RL 1K83H 2ATWA 1GM5A 4DV1Q 1X9NA 1S72A 4DV0Q 2ZM6Q 4JI0L 3HOXH 3J80i 4AIMA 2UXBQ 2KCMA 4OO1I 4DR1L 3E0EA 2YTVA 4ME3A 1TWCH 4UP9A 1IYJB 3UDIA 1SRUA 4DV2Q 1KRSA 4A3BG 2DUDA 4QJFA 1GVPA 4A3KG 4L5RC 3H3VH 4A4IA 3ULJA 4C3HH 1NBWA 1XPUA 4A3MH 5AJ3Q 4EQ5A 4MNOA 1FGUA 1X56A 3PSIA 3OTOL 4LFBL 1V9PA 1IBKQ 5IWAQ 1JT8A 1KQSA 3KDFA 1QZGA 1WOCA 4A3IG 2PQAB 4A3JG 1PH4A 1KIXA 3CPWA 1TWAH 1NMGA 4JCVE 3TS0A 4DR7L 1JJGA 3GO5A 4C2MH 3PO3H 2R93H 1OXVA 1QVGA 4JG2A 3AQQA 4NXMQ 3J7A5 1PH2A 3RLFA 3J81c 1X3FA 5FJ8H 1VQ4A 2Z6KA 3I4NH 2QA4A 4DUZL 1VQBA 5LMNL 1KAWA 3RN5A 1UE5A 4A3FG 4LF6L 1UWVA 1QUQA 1HZAA 2WFWA 3M4OH 2JA9A 4X64Q 3UDXA 3CCUA 1Q1EA 1VQAA 3CF5A 1JE5A 4JI2Q 1GKHA 2VQFL 2UUCQ 4A3LG 4B3TQ 1E7ZA 1C0AA 4NXNL 4IJLA 2MNAA 1CKMA 1EIYB 3RR5A 1MJEA 4A3BH 2R7DA 3UDFA 4B3SQ 1VQNA 4XTCS 4PZ6A 3I2ZA 4JC0A 5BR8L 4A3KH 3PUVA 3JAMi 4L5SA 1XNQQ 3RLOA 1XTDA 4X65Q 1TWGH 2JK8A 2VL6A 3M4QA 1FJGL 4OX9Q 2UUBQ 4J15A 4DV4L 4TQUS 2JA8G 1E3PA 1Z47A 4IFDJ 1SMXA 4R4CA 2LXKA 1V43A 1Y1VH 5ELNA 2FXQA 4A3IH 4A3JH 1UE1A 1Q1BA 3J80c 4DKAC 3KOJA 5GAHC 2QGQA 3H3VI 4KHZA 1I94Q 2CWPA 4DK3C 2JA7G 3BJUA 2ZTCA 4OO1G 1LUZA 1I5FA 1IBLL 2HHHL 1IZ6A 4GOPB 3TQYA 1BBWA 1EOVA 2V1CC 1G6PA 4RG1A 2PNHA 1Z9FA 1J6QA 3PUXA 4A3FH 4YWMA 3E9HA 5IP9H 3STBC 1VS0A 1R9TH 4A3LH 2UXDQ 1VCIA 4JI5L 4UP8A 2R7ZG 2K4KA 2R6GA 2I0QA 3GTQH 2PI2A 1PYSB 1QZHA 5JJLA 4GOPC 1KHIA 4DR1Q 1YHBA 1VQJA 4GN3B 5M3MG 2JE6I 3I4OA 1WFQA 2UUAL 5EAYA 1JB7A 3K0XA 2JA8H 3U4VA 2JA5H 4JBMA 4WJ4A 2LXJA 3PF4A 3S1QH 4QY7A 1Y14B 4DV7Q 4R4OA 1K8AC 3S16H 2OTLA 4LFBQ 1A8VA 3PCOB 1X65A 2ALYB 3GTJH 1IBML 3CC4A 2YTYA 2NVTH 2CWAA 3ICEA 4BBSG 4JV5Q 2JA7H 2N3SA 3JAMc 1EQQA 4LNQA 4DR5L 1B70B 2HIXA 2I5HA 4YHHL 1Y1WG 3M3YH 4GKJL 3NEMA 1XMOL 4LF4L 2MQHA 3U50C 5C0XG 3A5ZB 4YCWA 4IJHA 4IPCA 4P73A 4LWCA 3M4PA 1EYGA 5M5WH 1L1OB 3SGIA 4Y52H 4GN5A 3K7UC 1N34Q 2R7ZH 3KFUA 2WAQE 4DR4L 1VQGA 1KC8C 5C4JH 4POGA 3CD6A 2VQFQ 1J5EQ 2XGTA 2CCZA 3TRZA 4A3GG 3J81i 2B3GA 5GROA 4P74A 1XMQQ 4DV6Q 5M3MH 1E24A 3I4MH 1A0IA 3HOVG 1V1QA 3EN2A 1O7IA 2OQ0A 2E8GA 4JOIA 2NN6G 1HNXL 1KXLA 2OCEA 1FJGQ 4DNIA 4LF7Q 1JJCB 1JMCA 3PF5A 4B3ML 1OTCA 4LF5L 1B7YB 3KF6A 4DR3Q 3HOUG 3M7NA 4AQYQ 1YJWA 1Q8KA 2WB1E 2AWOA 3PUZA 3PO3G 1EIFA 1EWIA 1C9OA 3GTOH 1HZ9A 1Y1WH 3NELA 3GTMH 3S1NH 1N32Q 1EQRA 2Q2HA 3F1ZA 5IYDG 1IBLQ 1IL2A 2F3IA 2E5LQ 1XPRA 1MKHA 2VW9A 2ES2A 4C3IH 4HIMA 1VQ6A 3GTGH 4JI4Q 5GAGC 2UXCQ 3S2HH 2IHEA 4GNXA 4HIOA 4PMWA 4ALPA 3BU2A 3CW2C 2KENA 3DM3A 4JBJA 4Y7NH 1W3SA 2PI2E 4GKKL 1L1OA 2K5NA 4LF9Q 5M5XH 1SLJA 1UEBA 1WI5A 1L2FA 4JI5Q 4DV5Q 4A3GH 4DAYB 4GLXA 3HOVH 5JJIA 5IE8A 2GVAA 2LSSA 3RLNA 2KHIA 2E2HH 4HJ8A 1GO3E 2CKZB 1RIPA 3T1HL 3T1YL 5IYCG 1Y1VG 3HKZE 2NZOA 3CCSA 2ZJRA 1YHQA 3HOUH 4KLKA 4RMFA 2WP8J 4PZ8A 4P72A 3CCJA 4AYBE 3FP9A 1IBMQ 2Z6KC 2Y0SG 4LUVA 1ASZA 3TS2A 1CUKA 5FLMG 3PGZA 5LMUL 2L15A 5HY6A 5H1SE 5IYDH 3PUYA 3VDYA 4DR5Q 5IP9G 4K0KQ 3U4ZA 1NY4A 1PFSA 2JQOA 3FKIG 1LYLA 3CCRA 1SN8A 5C4XG 4LFCL 1N8RC 1E22A 3OYYA 1N36L 4QQBX 1CKNB 1PYBA 4X62Q 1N33Q 4R4TA 3CCQA 4A3CG 5HGQA 4BY7G 1XNRL 1YIJA 2K5HA 1X6OA 5C0XI 2D0PA 3CCEA 2BH2A 2MO1A 2ZTEA 1M90C 4A3EH 1NE3A 1HNWL 4EX5A 2PMZE 3KYHC 2JA5G 4DUYL 2KCTA 3CMEA 3HOYG 3WWVA 4KHPL 4DV3Q 5IYCH 2A8VA 3GTPH 1K8GA 1VQ7A 4IPDA 4POFA 1A62A 3H0GG 4JI1Q 4IPGA 3STBD 2VS1A 2PQAA 1OXTA 3S1MH 1VQLA 1SROA 1RL2A 2NN6I 4LUZA 5FLMH 2JJQA 3HOZG 4JI6Q 1HR0L 1HJPA 1VQCA 2I5MX 2QEXA 4HJ5A 1PH3A 3UE1A 5LMNW 4C3JH 4JI7Q 1N9WA 1HNZQ 3FKIH 5C4XH 5GADC 2YU9H 4B3RQ 3CCVA 1CKOA 2ZJQA 5IY0A 1WJJA 2K5VA 1PH9A 1QVCA 3CQZH 4JI0Q 4A3CH 3ULLA 2A1AA 4BY7H 2GVBA 2NVQH 2XTIA 3I4MG 3UE0A 4LF8L 3EIVA 1MIUA 4IO9A 2K14A 2K50A 4H02A 4DK6C 2OTJA 1YZ6A 3B6YA 2RHSB 3L7ZC 1YI2A 3HOYH 2RF4A 4IFDG 2H5XA 3ULPA 4DV1L 4TVAB 3PO2G 1K0RA 4BA2I 2ZM6L 3OTOQ 2VUMG 2UXBL 2UU9L 3H0GH 1XJVA 4DV2L 3GTLH 3HKSA 4HJ9A 2Z0SA 1P16A 1OXSC 4JBWA 4UP7A 1KRTA 2HIVA 1DGSA 4DR7Q 3S17H 5AJ3L 3HOZH 3F8TA 1K3RA 4FDBA 5JEAJ 3G4SA 1YJNA 1IBKL 1PH8A 4GOPA 2EXDA 4DUZQ 5LMUQ 5LMNQ 1VQDA 1HR0W 2K52A 4LF6Q 4HJ7A 4JI8L 1YBYA 4X66L 4L5TA 1M1KC 1EUJA 3OW2A 1VQ9A 5GAEC 2MO0A 4NXNQ 1VQIA 4NXML 1BKBA 4LUOA 2C35B 3PIPA 1E1TA 4HIKA 5BR8Q 1P8LA 1TWHH 1XNRQ 3M85A 4AH6A 3UDGA 3PIOA 4QIWE 2B63G 2KBNA 4X64L 4OWWB 4DV4Q 3PO2H 3AYHB 4PZ7A 4JI2L 3MEFA 4X6AH 2VUMH 4GLAC 5ELOA 1MJCA 1Q12A 2F52A 1NMFA 1X3GA 2AWNA 1I50H 2B29A 3NBHB 4OWTB 4B3SL 4KHPQ 1I6HH 2YYZA 1KL9A 3L2PA 1EFWA 1XNQL 4YY3L 5GQOA 2N49A 3K81C 1W2BA 1OXXK 2Q2TA 1A63A 3W5OA 4AYBG 2UUBL 4OX9L 3CXCA 1I3QH 2K75A 3F2DA 3M9BA 3HOWG 2HHHQ 3A5UA 1Q46A 3HFZB 3KDFB 4BY1G 2EQSA 2RHQB 3ERSX 4GNXC 3G71A 3ZJYC 2ASBA 1OXUA 1HR0Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YV5 A;  2JEB I;  4BA1 I;  4YCU A;  3RZO H;  1I94 L;  1VQK A;  2IHF A;  3TEH B;  1XPO A;  3CC2 A;  3CCM A;  3I55 A;  1PV4 A;  2VQE L;  3FHW A;  4A3E G;  1LTL A;  1QUQ B;  3GD7 A;  1VQF A;  3K8A A;  3S2D H;  2B63 H;  4OON A;  4NPS A;  3K80 C;  4LF8 Q;  3EBE A;  2UUA Q;  1ASY A;  1NTG A;  3GDE A;  2UXD L;  3W1G A;  4QGU A;  2E2I H;  1GD7 A;  2YTX A;  5IP7 G;  1YEZ A;  1AH9 A;  4DR2 L;  2VZA A;  1YJ9 A;  1G29 1;  2UU9 Q;  2VNU D;  2IX1 A;  1HZC A;  5M5Y H;  4IFD I;  3S14 H;  2AMC B;  3BZK A;  4A3D G;  3J7Z C;  2JA6 G;  1D7Q A;  3HOW H;  4O2D A;  1WCM G;  3Q8D A;  4YHH Q;  4GKJ Q;  4BY1 H;  3KLW A;  1E1O A;  1SE8 A;  3JC6 6;  4DV7 L;  2ZTD A;  1XMO Q;  2N78 A;  4LF4 Q;  4O0A A;  5DLQ E;  1VQO A;  1BBU A;  2MFI A;  2GN5 A;  4BBR G;  4BXX G;  3RZD H;  4JV5 L;  5K36 G;  1U5K A;  4A76 A;  5JJK A;  4JI8 Q;  3I56 A;  4X66 Q;  4DR4 Q;  3CC7 A;  2EIF A;  2R7F A;  3KJP A;  4JYA L;  1L0W A;  2NVY H;  1U0L A;  5J3B A;  4IOA A;  3AFP A;  2IY5 B;  3LGJ A;  3NEN A;  2A19 A;  1NJI C;  1HNX Q;  4JI3 Q;  2D62 A;  2N8N A;  1N34 L;  3AEV A;  1HH2 P;  1PH1 A;  2RCN A;  5C44 G;  4B3M Q;  3CP0 A;  1J5E L;  4LF5 Q;  3CCL A;  5IP7 H;  2F4V L;  1SR3 A;  3ER0 A;  5M3F G;  1XMQ L;  1CSP A;  4DV6 L;  3S24 A;  1YHA A;  4R4Q A;  3CAM A;  4A3D H;  5IYB G;  4YY3 Q;  3CMA A;  2E2J H;  2JA6 H;  1WCM H;  3IRB A;  2JEA I;  4LF7 L;  2IX0 A;  3AFQ A;  3BZC A;  3K7A H;  2BH8 A;  2Q2U A;  4LFA L;  3DLL A;  3MXN B;  4DR3 L;  1S3O A;  3PUW A;  1Q86 C;  4UY8 C;  4AQY L;  4HJA A;  4BBR H;  4BXX H;  4L5Q A;  4DR6 L;  3D31 A;  1Q82 C;  2WAQ G;  1PA6 A;  2BA0 A;  1VQP A;  2OWO A;  1CKN A;  1UE7 A;  2Y0S E;  1N32 L;  4GKK Q;  2IT1 A;  1B8A A;  1YVC A;  2E5L L;  4R1J A;  3F2B A;  2VQE Q;  4JI4 L;  3GTK H;  5C0X J;  4DV0 L;  2UXC L;  1X3E A;  1FVI A;  1CSQ A;  5C44 H;  3PV0 A;  1FL0 A;  4YWK A;  3T1H Q;  3T1Y Q;  4OXP A;  1IXR A;  2WB1 G;  4LF9 L;  5M3F H;  4DV5 L;  3CPF A;  1TXY A;  4A93 G;  4DAM A;  4OWX B;  5IYB H;  4GLV B;  1VQE A;  4MTN A;  1PH6 A;  4DR2 Q;  4P71 A;  4APV A;  1K9M C;  5IWA L;  1PH5 A;  4JBK A;  3KF6 B;  1WYD A;  3G6E A;  3S15 H;  1T9H A;  1G51 A;  3S1R H;  3G48 A;  3RNU A;  3L0O A;  4LFC Q;  2R92 G;  1JJ2 A;  1N36 Q;  2OQK A;  2D0O A;  4JOI C;  3D0F A;  3U58 A;  1VQH A;  2ID0 A;  2KHJ A;  2ZJP A;  1LM0 A;  1D8L A;  1YNX A;  4GN4 B;  4LW1 A;  4PG3 A;  4JI3 L;  5C3E G;  1Q81 C;  2UUC L;  4JYA Q;  3RN2 A;  1QVF A;  1YIT A;  4B3T L;  2DGY A;  4GNX B;  1VQM A;  4YCV A;  2AHO B;  1PH7 A;  4UPA A;  5FLX c;  4DUY Q;  1HNW Q;  3HKZ G;  4GS3 A;  4NB3 A;  2VY3 A;  4X62 L;  4IOC A;  1PHJ A;  1S40 A;  1N33 L;  4K0K L;  4P75 A;  1TWF H;  4YWL A;  3HOX G;  4WJ3 M;  2CQO A;  1X55 A;  4X65 L;  4A93 H;  1AE2 A;  2BA1 A;  1VQ5 A;  4MZ9 A;  5JEA G;  3TRE A;  2F4V Q;  1PVO A;  2HQL A;  5IT9 c;  4A75 A;  4A3M G;  4XIG S;  1HZB A;  2Q2I A;  3F2C A;  4DV3 L;  3KJO A;  1AE3 A;  4R4I A;  2HT1 A;  3J81 j;  4QL5 A;  4JI1 L;  1L1O C;  4LFA Q;  3E9I A;  2I5L X;  3A0J A;  3W1B A;  2R92 H;  2AKW B;  1VQ8 A;  1H95 A;  3H15 A;  1X54 A;  4DR6 Q;  1BVS A;  4DPG A;  1SFO H;  4IPH A;  1UE6 A;  1Q7Y C;  4JI6 L;  2R93 G;  3KF8 B;  5E7N A;  3A74 A;  3I7F A;  1K73 C;  1KD1 C;  5FJ8 G;  3I4N G;  5C3E H;  2NVX H;  2CFM A;  4JI7 L;  1HNZ L;  4KI0 A;  2NZH A;  4HID A;  4BBS H;  1C7Y A;  4B3R L;  1K83 H;  2ATW A;  1GM5 A;  4DV1 Q;  1X9N A;  1S72 A;  4DV0 Q;  2ZM6 Q;  4JI0 L;  3HOX H;  3J80 i;  4AIM A;  2UXB Q;  2KCM A;  4OO1 I;  4DR1 L;  3E0E A;  2YTV A;  4ME3 A;  1TWC H;  4UP9 A;  1IYJ B;  3UDI A;  1SRU A;  4DV2 Q;  1KRS A;  4A3B G;  2DUD A;  4QJF A;  1GVP A;  4A3K G;  4L5R C;  3H3V H;  4A4I A;  3ULJ A;  4C3H H;  1NBW A;  1XPU A;  4A3M H;  5AJ3 Q;  4EQ5 A;  4MNO A;  1FGU A;  1X56 A;  3PSI A;  3OTO L;  4LFB L;  1V9P A;  1IBK Q;  5IWA Q;  1JT8 A;  1KQS A;  3KDF A;  1QZG A;  1WOC A;  4A3I G;  2PQA B;  4A3J G;  1PH4 A;  1KIX A;  3CPW A;  1TWA H;  1NMG A;  4JCV E;  3TS0 A;  4DR7 L;  1JJG A;  3GO5 A;  4C2M H;  3PO3 H;  2R93 H;  1OXV A;  1QVG A;  4JG2 A;  3AQQ A;  4NXM Q;  3J7A 5;  1PH2 A;  3RLF A;  3J81 c;  1X3F A;  5FJ8 H;  1VQ4 A;  2Z6K A;  3I4N H;  2QA4 A;  4DUZ L;  1VQB A;  5LMN L;  1KAW A;  3RN5 A;  1UE5 A;  4A3F G;  4LF6 L;  1UWV A;  1QUQ A;  1HZA A;  2WFW A;  3M4O H;  2JA9 A;  4X64 Q;  3UDX A;  3CCU A;  1Q1E A;  1VQA A;  3CF5 A;  1JE5 A;  4JI2 Q;  1GKH A;  2VQF L;  2UUC Q;  4A3L G;  4B3T Q;  1E7Z A;  1C0A A;  4NXN L;  4IJL A;  2MNA A;  1CKM A;  1EIY B;  3RR5 A;  1MJE A;  4A3B H;  2R7D A;  3UDF A;  4B3S Q;  1VQN A;  4XTC S;  4PZ6 A;  3I2Z A;  4JC0 A;  5BR8 L;  4A3K H;  3PUV A;  3JAM i;  4L5S A;  1XNQ Q;  3RLO A;  1XTD A;  4X65 Q;  1TWG H;  2JK8 A;  2VL6 A;  3M4Q A;  1FJG L;  4OX9 Q;  2UUB Q;  4J15 A;  4DV4 L;  4TQU S;  2JA8 G;  1E3P A;  1Z47 A;  4IFD J;  1SMX A;  4R4C A;  2LXK A;  1V43 A;  1Y1V H;  5ELN A;  2FXQ A;  4A3I H;  4A3J H;  1UE1 A;  1Q1B A;  3J80 c;  4DKA C;  3KOJ A;  5GAH C;  2QGQ A;  3H3V I;  4KHZ A;  1I94 Q;  2CWP A;  4DK3 C;  2JA7 G;  3BJU A;  2ZTC A;  4OO1 G;  1LUZ A;  1I5F A;  1IBL L;  2HHH L;  1IZ6 A;  4GOP B;  3TQY A;  1BBW A;  1EOV A;  2V1C C;  1G6P A;  4RG1 A;  2PNH A;  1Z9F A;  1J6Q A;  3PUX A;  4A3F H;  4YWM A;  3E9H A;  5IP9 H;  3STB C;  1VS0 A;  1R9T H;  4A3L H;  2UXD Q;  1VCI A;  4JI5 L;  4UP8 A;  2R7Z G;  2K4K A;  2R6G A;  2I0Q A;  3GTQ H;  2PI2 A;  1PYS B;  1QZH A;  5JJL A;  4GOP C;  1KHI A;  4DR1 Q;  1YHB A;  1VQJ A;  4GN3 B;  5M3M G;  2JE6 I;  3I4O A;  1WFQ A;  2UUA L;  5EAY A;  1JB7 A;  3K0X A;  2JA8 H;  3U4V A;  2JA5 H;  4JBM A;  4WJ4 A;  2LXJ A;  3PF4 A;  3S1Q H;  4QY7 A;  1Y14 B;  4DV7 Q;  4R4O A;  1K8A C;  3S16 H;  2OTL A;  4LFB Q;  1A8V A;  3PCO B;  1X65 A;  2ALY B;  3GTJ H;  1IBM L;  3CC4 A;  2YTY A;  2NVT H;  2CWA A;  3ICE A;  4BBS G;  4JV5 Q;  2JA7 H;  2N3S A;  3JAM c;  1EQQ A;  4LNQ A;  4DR5 L;  1B70 B;  2HIX A;  2I5H A;  4YHH L;  1Y1W G;  3M3Y H;  4GKJ L;  3NEM A;  1XMO L;  4LF4 L;  2MQH A;  3U50 C;  5C0X G;  3A5Z B;  4YCW A;  4IJH A;  4IPC A;  4P73 A;  4LWC A;  3M4P A;  1EYG A;  5M5W H;  1L1O B;  3SGI A;  4Y52 H;  4GN5 A;  3K7U C;  1N34 Q;  2R7Z H;  3KFU A;  2WAQ E;  4DR4 L;  1VQG A;  1KC8 C;  5C4J H;  4POG A;  3CD6 A;  2VQF Q;  1J5E Q;  2XGT A;  2CCZ A;  3TRZ A;  4A3G G;  3J81 i;  2B3G A;  5GRO A;  4P74 A;  1XMQ Q;  4DV6 Q;  5M3M H;  1E24 A;  3I4M H;  1A0I A;  3HOV G;  1V1Q A;  3EN2 A;  1O7I A;  2OQ0 A;  2E8G A;  4JOI A;  2NN6 G;  1HNX L;  1KXL A;  2OCE A;  1FJG Q;  4DNI A;  4LF7 Q;  1JJC B;  1JMC A;  3PF5 A;  4B3M L;  1OTC A;  4LF5 L;  1B7Y B;  3KF6 A;  4DR3 Q;  3HOU G;  3M7N A;  4AQY Q;  1YJW A;  1Q8K A;  2WB1 E;  2AWO A;  3PUZ A;  3PO3 G;  1EIF A;  1EWI A;  1C9O A;  3GTO H;  1HZ9 A;  1Y1W H;  3NEL A;  3GTM H;  3S1N H;  1N32 Q;  1EQR A;  2Q2H A;  3F1Z A;  5IYD G;  1IBL Q;  1IL2 A;  2F3I A;  2E5L Q;  1XPR A;  1MKH A;  2VW9 A;  2ES2 A;  4C3I H;  4HIM A;  1VQ6 A;  3GTG H;  4JI4 Q;  5GAG C;  2UXC Q;  3S2H H;  2IHE A;  4GNX A;  4HIO A;  4PMW A;  4ALP A;  3BU2 A;  3CW2 C;  2KEN A;  3DM3 A;  4JBJ A;  4Y7N H;  1W3S A;  2PI2 E;  4GKK L;  1L1O A;  2K5N A;  4LF9 Q;  5M5X H;  1SLJ A;  1UEB A;  1WI5 A;  1L2F A;  4JI5 Q;  4DV5 Q;  4A3G H;  4DAY B;  4GLX A;  3HOV H;  5JJI A;  5IE8 A;  2GVA A;  2LSS A;  3RLN A;  2KHI A;  2E2H H;  4HJ8 A;  1GO3 E;  2CKZ B;  1RIP A;  3T1H L;  3T1Y L;  5IYC G;  1Y1V G;  3HKZ E;  2NZO A;  3CCS A;  2ZJR A;  1YHQ A;  3HOU H;  4KLK A;  4RMF A;  2WP8 J;  4PZ8 A;  4P72 A;  3CCJ A;  4AYB E;  3FP9 A;  1IBM Q;  2Z6K C;  2Y0S G;  4LUV A;  1ASZ A;  3TS2 A;  1CUK A;  5FLM G;  3PGZ A;  5LMU L;  2L15 A;  5HY6 A;  5H1S E;  5IYD H;  3PUY A;  3VDY A;  4DR5 Q;  5IP9 G;  4K0K Q;  3U4Z A;  1NY4 A;  1PFS A;  2JQO A;  3FKI G;  1LYL A;  3CCR A;  1SN8 A;  5C4X G;  4LFC L;  1N8R C;  1E22 A;  3OYY A;  1N36 L;  4QQB X;  1CKN B;  1PYB A;  4X62 Q;  1N33 Q;  4R4T A;  3CCQ A;  4A3C G;  5HGQ A;  4BY7 G;  1XNR L;  1YIJ A;  2K5H A;  1X6O A;  5C0X I;  2D0P A;  3CCE A;  2BH2 A;  2MO1 A;  2ZTE A;  1M90 C;  4A3E H;  1NE3 A;  1HNW L;  4EX5 A;  2PMZ E;  3KYH C;  2JA5 G;  4DUY L;  2KCT A;  3CME A;  3HOY G;  3WWV A;  4KHP L;  4DV3 Q;  5IYC H;  2A8V A;  3GTP H;  1K8G A;  1VQ7 A;  4IPD A;  4POF A;  1A62 A;  3H0G G;  4JI1 Q;  4IPG A;  3STB D;  2VS1 A;  2PQA A;  1OXT A;  3S1M H;  1VQL A;  1SRO A;  1RL2 A;  2NN6 I;  4LUZ A;  5FLM H;  2JJQ A;  3HOZ G;  4JI6 Q;  1HR0 L;  1HJP A;  1VQC A;  2I5M X;  2QEX A;  4HJ5 A;  1PH3 A;  3UE1 A;  5LMN W;  4C3J H;  4JI7 Q;  1N9W A;  1HNZ Q;  3FKI H;  5C4X H;  5GAD C;  2YU9 H;  4B3R Q;  3CCV A;  1CKO A;  2ZJQ A;  5IY0 A;  1WJJ A;  2K5V A;  1PH9 A;  1QVC A;  3CQZ H;  4JI0 Q;  4A3C H;  3ULL A;  2A1A A;  4BY7 H;  2GVB A;  2NVQ H;  2XTI A;  3I4M G;  3UE0 A;  4LF8 L;  3EIV A;  1MIU A;  4IO9 A;  2K14 A;  2K50 A;  4H02 A;  4DK6 C;  2OTJ A;  1YZ6 A;  3B6Y A;  2RHS B;  3L7Z C;  1YI2 A;  3HOY H;  2RF4 A;  4IFD G;  2H5X A;  3ULP A;  4DV1 L;  4TVA B;  3PO2 G;  1K0R A;  4BA2 I;  2ZM6 L;  3OTO Q;  2VUM G;  2UXB L;  2UU9 L;  3H0G H;  1XJV A;  4DV2 L;  3GTL H;  3HKS A;  4HJ9 A;  2Z0S A;  1P16 A;  1OXS C;  4JBW A;  4UP7 A;  1KRT A;  2HIV A;  1DGS A;  4DR7 Q;  3S17 H;  5AJ3 L;  3HOZ H;  3F8T A;  1K3R A;  4FDB A;  5JEA J;  3G4S A;  1YJN A;  1IBK L;  1PH8 A;  4GOP A;  2EXD A;  4DUZ Q;  5LMU Q;  5LMN Q;  1VQD A;  1HR0 W;  2K52 A;  4LF6 Q;  4HJ7 A;  4JI8 L;  1YBY A;  4X66 L;  4L5T A;  1M1K C;  1EUJ A;  3OW2 A;  1VQ9 A;  5GAE C;  2MO0 A;  4NXN Q;  1VQI A;  4NXM L;  1BKB A;  4LUO A;  2C35 B;  3PIP A;  1E1T A;  4HIK A;  5BR8 Q;  1P8L A;  1TWH H;  1XNR Q;  3M85 A;  4AH6 A;  3UDG A;  3PIO A;  4QIW E;  2B63 G;  2KBN A;  4X64 L;  4OWW B;  4DV4 Q;  3PO2 H;  3AYH B;  4PZ7 A;  4JI2 L;  3MEF A;  4X6A H;  2VUM H;  4GLA C;  5ELO A;  1MJC A;  1Q12 A;  2F52 A;  1NMF A;  1X3G A;  2AWN A;  1I50 H;  2B29 A;  3NBH B;  4OWT B;  4B3S L;  4KHP Q;  1I6H H;  2YYZ A;  1KL9 A;  3L2P A;  1EFW A;  1XNQ L;  4YY3 L;  5GQO A;  2N49 A;  3K81 C;  1W2B A;  1OXX K;  2Q2T A;  1A63 A;  3W5O A;  4AYB G;  2UUB L;  4OX9 L;  3CXC A;  1I3Q H;  2K75 A;  3F2D A;  3M9B A;  3HOW G;  2HHH Q;  3A5U A;  1Q46 A;  3HFZ B;  3KDF B;  4BY1 G;  2EQS A;  2RHQ B;  3ERS X;  4GNX C;  3G71 A;  3ZJY C;  2ASB A;  1OXU A;  1HR0 Q; 
#chains in the Genus database with same CATH topology
 4FP5 D;  1HQM C;  1GOZ A;  4ULL A;  1NSN S;  1VQK A;  1XWE A;  1GHK A;  1BQQ T;  3FDT A;  4GZY C;  3FHW A;  1VQF A;  5DM7 3;  2B63 H;  4OON A;  3M7G A;  3EBE A;  2UXD L;  3C2P A;  4OIK A;  2K5D A;  2B2T C;  4QCL A;  1GD7 A;  2D2C C;  2V4D A;  2YTX A;  1YEZ A;  2B2W C;  2FJ2 A;  2G9H D;  4A3D G;  4O2D A;  1YNJ C;  4X3K A;  2QDL A;  1E1O A;  1SE8 A;  1I50 B;  4LF4 Q;  1CHQ D;  5IGG A;  3K5M A;  2WB1 B;  1QNU A;  4BXX G;  4A93 B;  2LMC B;  4JI8 Q;  2WV6 D;  1B9M A;  4X66 Q;  3I56 A;  4JYA L;  1L0W A;  1NCV A;  2NVY H;  1HCZ A;  1LTA D;  3JAM E;  3J81 L;  4K5X A;  4HR7 B;  1MI2 A;  2O5J C;  3RZO B;  2D62 A;  3AEV A;  1CA5 A;  1GUN A;  2NYZ D;  3KLS A;  2F4V L;  3E0J A;  5M3F G;  1RTO A;  3S24 A;  4DV6 L;  4R4Q A;  2SDF A;  4HED A;  5IYB G;  3AMU A;  2KOL A;  2E2J H;  4KN7 C;  1WCM H;  3CHB D;  3IRB A;  5LHY 1;  2IX0 A;  3AFQ A;  3HKZ B;  3DLL A;  1BDO A;  1D1K A;  5EBC A;  1Q86 C;  2F0J A;  4IUV A;  4AQY L;  3MFG A;  1G2S A;  3S15 B;  2NTT A;  2VB2 X;  1XTC D;  2E2D C;  2HDL A;  2WAQ G;  1VQP A;  5EGT A;  2Y0S E;  4A3M B;  4GKK Q;  1N32 L;  1STE A;  5EKL A;  1YVC A;  4DNR B;  5I2Y A;  3F2B A;  5FOB B;  3GP7 A;  4K14 A;  2XVS A;  3GTK H;  1IHZ A;  5C0X J;  4DV0 L;  4JW0 A;  3NHH A;  1ZKO A;  2R93 B;  4DV5 L;  1TXY A;  1BBX C;  2A6E D;  3I4N B;  1K9M C;  1PH5 A;  1MD2 D;  5KNC A;  1WYD A;  2PQE A;  4V19 0;  5HGT A;  1G51 A;  2NUC A;  3RNU A;  3L0O A;  2CW0 D;  4A3D B;  1JJ2 A;  1E2W A;  1N36 Q;  2D0O A;  5BN5 A;  2SNS A;  3JAM L;  3K57 A;  1D8L A;  1YNX A;  2UUC L;  5C3E G;  4HAE A;  3MXU A;  1SE2 A;  2DGY A;  1PH7 A;  1F2Y A;  5FLX c;  1EYA A;  2VY3 A;  1LT6 D;  2CQO A;  3VYU A;  4A93 H;  2BA1 A;  1F9P A;  4C3H G;  4WFN 3;  4A75 A;  4XIG S;  1STB A;  4R4I A;  2HT1 A;  2LS0 1;  3MXP A;  1B50 A;  1W6K A;  4JPB W;  4XQJ A;  3E9I A;  3A0J A;  1VQ8 A;  1H95 A;  3H15 A;  2RDH A;  5CV7 A;  1BVS A;  4RWS C;  1UE6 A;  2EDG A;  4HMJ A;  3KF8 B;  2JA8 B;  5FJ8 G;  3S1R B;  4KI0 A;  2B2U A;  1C7Y A;  1K83 H;  5FO9 B;  4MTK A;  1PLF A;  1GM5 A;  2ZM6 Q;  4JI0 L;  1GUT A;  5T1I A;  5HUR A;  4UP9 A;  2YTV A;  4ME3 A;  4ZRZ A;  4DR1 L;  4P2C B;  3S15 H;  4UHV A;  1KRS A;  2F3V A;  1GVP A;  1I4X A;  3NTK A;  2EY2 A;  4A3M H;  1FGU A;  1V9P A;  1SND A;  1KQS A;  2F0O A;  1QZG A;  2F0U A;  2E75 C;  1PH4 A;  4TRD A;  5CGK A;  1NMG A;  4JCV E;  3SHL A;  1BCP D;  1H9J A;  3PO3 H;  2R93 H;  4JG2 A;  1RTN A;  3J81 c;  1JCK B;  3I4N H;  2AUK A;  2QA4 A;  3TP7 A;  5C5L A;  1A3V A;  1V8Q A;  1E2V A;  4PMB A;  4LF6 L;  1UWV A;  1QUQ A;  2WFW A;  5DM6 3;  2F0K A;  1VQA A;  4I65 A;  1JE5 A;  2MGS A;  1GKH A;  4B3T Q;  1E7Z A;  1C0A A;  2MNA A;  1CKM A;  1EIY B;  1O80 A;  1VQN A;  1Y1W B;  4QUC A;  1XNQ Q;  1ICW A;  1XTD A;  4X65 Q;  3M4Q A;  4J15 A;  4DV4 L;  3Q6S A;  1RKN A;  4TQU S;  2RSO A;  4R4C A;  2LXK A;  4A3I H;  1GUS A;  3DWQ A;  3QOJ A;  4DK3 C;  2ZTC A;  2F0G A;  1I5F A;  1BBW A;  3NTI A;  1EOV A;  3A7A B;  2PNH A;  3PUX A;  1U4L A;  4YWM A;  3E9H A;  1EEI D;  2F0S A;  1VS0 A;  4A3L H;  2L11 A;  3D4W A;  4JI5 L;  3C46 A;  1STH A;  2PI2 A;  1QZH A;  5JJL A;  5CMD A;  5M3M G;  4NMZ A;  3PQI A;  5C6A A;  2DY8 A;  3A54 A;  2JA8 H;  1EIH A;  3U4V A;  5DEH A;  2O5I C;  2LXJ A;  3PF4 A;  4QY7 A;  2XWJ B;  2XSC A;  4FNF A;  3GTJ H;  3CC4 A;  4U67 3;  3ICE A;  5BN3 A;  1SYD A;  2EVB A;  2F0V A;  3JAM c;  3TDQ A;  4LNQ A;  1EL0 A;  2I5H A;  1SXT A;  5FO7 B;  4LF4 L;  1KTK A;  5C0X G;  3U50 C;  2B2V C;  4IJH A;  5EPJ A;  4P73 A;  1GUO A;  3M4P A;  2F0P A;  1SMY C;  5ELC A;  3SVM A;  4C1N I;  2DJG C;  4KN4 C;  3KFU A;  2WAQ E;  2DNC A;  2AUJ D;  2A6E C;  1VQG A;  3CRL C;  2VQF Q;  4FO2 A;  1LO5 D;  2CCZ A;  1SYC A;  2NBF A;  1A0I A;  3EN2 A;  2A73 B;  2CQA A;  4C3J B;  1WD0 A;  2CH4 A;  3FKI B;  5CV8 A;  2M00 A;  3VYR A;  1LTS D;  4LF7 Q;  1LAC A;  5D14 A;  4X3U A;  5CBE E;  4DR3 Q;  4RCO A;  4B9W A;  1YJW A;  4BY7 B;  1MBY A;  5D3I B;  3A8I E;  5KYL A;  2Z4H A;  1C9O A;  2ZXR A;  2E74 C;  1VF7 A;  5E4X A;  1Y1W H;  3NEL A;  2Q2H A;  3F1Z A;  1IL2 A;  1B4O A;  2NVT B;  3H0G B;  4JI4 Q;  5IGC A;  3S2H H;  2IHE A;  3D6W A;  4GNX A;  2KEN A;  4GKK L;  1L1O A;  4LF9 Q;  4GLX A;  5JJI A;  1PRT F;  3IKJ A;  1LLR D;  1YNN D;  1Y1V G;  3CCS A;  4KLK A;  4DFA A;  2WP8 J;  2XRQ D;  2DN8 A;  5M3M B;  3RMH A;  2I07 B;  3I4M B;  3VYT A;  3TS2 A;  3HP3 A;  3PGZ A;  5COR A;  2L15 A;  2WIN B;  5IYD H;  3VDY A;  4DR5 Q;  4IAL A;  2VUM B;  5IP9 G;  5J22 A;  2OF1 A;  2K05 A;  1N36 L;  1PYB A;  4H13 C;  1N33 Q;  1Y69 U;  3S1N B;  4H0L C;  2K5H A;  3CCE A;  2B8F A;  1D1I A;  3OPO A;  4A3E H;  4C3I B;  3GQB A;  2JA5 G;  3KYH C;  3A55 A;  1EY8 A;  3WWV A;  5IYC H;  1K8G A;  1VQ7 A;  2F0W A;  2B2Y A;  3BYT B;  4JI1 Q;  2RQX A;  1B3A A;  2K6A A;  1OXT A;  2KJX A;  2NN6 I;  1RL2 A;  2X69 A;  3S2D B;  1S5B D;  3MA2 B;  1HJP A;  4HJ5 A;  2PZW A;  3NQI A;  3ERQ A;  1PH3 A;  5LMN W;  4C3J H;  1N9W A;  2SOB A;  3FKI H;  4LJZ C;  1ESR A;  2YU9 H;  2K01 A;  1WJJ A;  3A7L A;  4A3C H;  4BY7 H;  1FD7 D;  1PRT D;  3S14 B;  4CJ0 B;  5J1Z A;  4IO9 A;  2K50 A;  1YZ6 A;  2RHS B;  3HOY H;  2RF4 A;  3FRP B;  2RDF A;  5IGE A;  3PO2 G;  3ERO A;  1CHP D;  4TVA B;  4CJ1 B;  1A15 A;  4HMI A;  3OTO Q;  2ZM6 L;  4BA2 I;  5NUC A;  2BDN A;  2UU9 L;  3H0G H;  3GTL H;  3OHX C;  2Z0S A;  1P16 A;  1OXS C;  3C1F A;  4UP7 A;  2RBM A;  3WOE A;  1BNZ A;  3DUZ A;  3TP5 A;  3HOZ H;  1K3R A;  4FDB A;  1PFN A;  1PH8 A;  1EYC A;  1I4H A;  1ZXT A;  3A8K E;  2EXD A;  4N9T A;  4F87 A;  2K52 A;  3MAQ A;  2F0F A;  3OW2 A;  2K32 A;  3K5N A;  1LT3 D;  5GAE C;  3PIO 3;  1BKB A;  2JA6 B;  5KEE A;  3PIP A;  1IYU A;  1ESF A;  5BR8 Q;  1P8L A;  1PTO F;  2B63 G;  2KBN A;  2PNR C;  4BBR B;  3TZU A;  3MEF A;  2VUM H;  4GLA C;  3CQZ B;  4K8J A;  1I6H H;  1EFW A;  1ML0 D;  1XNQ L;  1XX8 A;  1U4P A;  1O7Z A;  1OXX K;  3H09 A;  2B2U C;  4AYB G;  1A63 A;  1SJH D;  3CXC A;  3ONA B;  2N55 A;  4G7O C;  5CV9 A;  1SBB B;  2EQS A;  2RHQ B;  3ERS X;  5CBA E;  5C44 B;  1OXU A;  1HR0 Q;  2JEB I;  1DOM A;  1EU3 A;  1SSO A;  1K0S A;  2SNM A;  5C4H A;  3TEH B;  2EYH A;  3J80 E;  3CC2 A;  3I55 A;  1PV4 A;  3NBI A;  3S2D H;  3MHB A;  4LF8 Q;  2FFK B;  2UUA Q;  1NTG A;  3GDE A;  4X3T A;  1NR4 A;  4IUQ A;  5IOD A;  2PPB C;  1UAP A;  4RGN A;  4RKL A;  2JSO A;  2VZA A;  1NR2 A;  1G29 1;  3V96 A;  2IX1 A;  3NXW A;  1HZC A;  2GA4 B;  2AMC B;  3S14 H;  3PO2 B;  1D7Q A;  1WCM G;  3Q8D A;  4QF4 A;  4YHH Q;  4GKJ Q;  4BY1 H;  1CZW A;  2N78 A;  4O0A A;  5DLQ E;  1BBU A;  1TWF B;  2GN5 A;  2MFI A;  2HUG A;  3RZD H;  4A76 A;  5JJK A;  1X32 A;  4ZKC B;  2R7F A;  4ME5 A;  3KJP A;  2QEJ C;  1TS5 A;  3TP6 A;  3LGJ A;  1LTI D;  4XT1 B;  2R92 B;  4CGY B;  1SNQ A;  4J1M A;  1TKW B;  2EE1 A;  5IP7 H;  2A68 D;  1SR3 A;  1AW7 A;  3CAM A;  4YY3 Q;  2JA6 H;  5I9P A;  4LF7 L;  3QWN A;  2Q2U A;  2BH8 A;  4LFA L;  4DR3 L;  4XYO A;  1F2L A;  3HOX B;  5E1F A;  4HJA A;  4BBR H;  4G7H C;  5IIF A;  3OOC A;  4ODG A;  2BA0 A;  2F1M A;  2OWO A;  1B8A A;  1R4P B;  2VQE Q;  4FYD A;  4JI4 L;  1FNV A;  3N6R A;  5COY A;  1FVI A;  5C44 H;  4OL7 A;  3O13 A;  1IXR A;  1CM9 A;  2WB1 G;  4LF9 L;  2NVY B;  1BUV T;  1EU4 A;  3CPF A;  4A93 G;  4KY6 A;  5I6W A;  3N52 A;  1FYC A;  2PMZ B;  4DR2 Q;  3LX0 A;  1AZQ A;  1D5Z C;  3AU7 A;  4EQO A;  5EQ0 A;  3KF6 B;  2PW7 A;  2O4X A;  4LK1 C;  3SR1 A;  1T9H A;  3NE5 B;  1PRT C;  4LFC Q;  1EIG A;  1L0X B;  2E2J B;  2OQK A;  2JP1 A;  3UI2 A;  1CK1 A;  3HGB A;  1TWG B;  1CFM A;  5KGU A;  4ABN A;  2RVL A;  5CV6 A;  4GN4 B;  4R9W A;  1Q81 C;  3RN2 A;  3D6C A;  1ILQ A;  1VQM A;  2AHO B;  3EQL C;  4DUY Q;  3HKZ G;  2B2V A;  4ID6 A;  4L8J A;  1N33 L;  4CKC A;  4P75 A;  1TWF H;  1AP0 A;  2O2L D;  4WJ3 M;  1X55 A;  1DXM A;  1VQ5 A;  3BVM A;  3GTK B;  2HQL A;  4A3M G;  3F2C A;  2L5T A;  2ICI A;  1AE3 A;  3ZYY X;  1KAB A;  3J81 j;  2F0E A;  4JI1 L;  1L1O C;  3K5L A;  3W1B A;  2R92 H;  3GTQ B;  3OWF A;  4DR6 Q;  3V05 A;  4DPG A;  2R93 G;  1TII D;  1UEA B;  3A74 A;  4MIU A;  4Q0F A;  4WJW A;  1F2Z A;  1EFI D;  1K73 C;  3I4N G;  2NVX H;  2CFM A;  4BBS H;  3S16 B;  2OT2 A;  1ICF B;  3I70 A;  5CV5 A;  1FR3 A;  1X9N A;  4EGV A;  3Q23 A;  3HOX H;  2UXB Q;  2JA7 B;  2KCM A;  3E0E A;  1JT8 A;  3UDI A;  1SRU A;  1ENA A;  5JEA H;  1SE4 A;  3KLR A;  1NBW A;  4DXG A;  2FIN B;  4MNO A;  1X56 A;  4RKB A;  3OTO L;  1BXT A;  1CQV A;  5IWA Q;  2R7Z B;  1SYB A;  4A3I G;  2N88 A;  1LT5 D;  2AQ2 B;  2NZ1 D;  3CPW A;  3TN2 A;  3AQQ A;  1PH2 A;  1JIC A;  3MZ5 A;  3SK5 A;  1VQ4 A;  4RHS A;  1VQB A;  3Q22 A;  1KAW A;  2B2Y C;  3FPU B;  1HZA A;  3M4O H;  4X64 Q;  4JI3 Q;  4JI2 Q;  4A3L G;  3C1E A;  4IJL A;  1NUC A;  3RR5 A;  5LL6 S;  1JQY D;  2RSN A;  1D6E C;  3UDF A;  4L63 B;  4DN4 M;  2EYL A;  3I2Z A;  5BR8 L;  2VB3 X;  3JAM i;  1LTB D;  4HN7 A;  1D5M C;  3RLO A;  1TWG H;  4RAU C;  1K83 B;  2VL6 A;  1FJG L;  1TS4 A;  5CR3 A;  3OW7 A;  2JA8 G;  3MEH A;  1E3P A;  1Z47 A;  2ENB A;  1SMX A;  3GV6 A;  4DAP A;  3QG1 A;  1PTO C;  1V43 A;  5ELN A;  2FXQ A;  1UE1 A;  3J80 c;  4DKA C;  4Y7N B;  3KOJ A;  5GAH C;  2QGQ A;  4A3G B;  1I94 Q;  3T56 B;  3HOV B;  2I46 A;  4OEM B;  1IZ6 A;  3Q24 A;  1G6P A;  2V1C C;  5CV4 A;  1U4M A;  3BDO A;  3J7A F;  1Z9F A;  4F7X A;  4A3F H;  1II3 A;  1KLU D;  1I4P A;  5EBD A;  3STB C;  1R9T H;  2A68 C;  3PO3 B;  2I0Q A;  3GTQ H;  1PYS B;  1KHI A;  1YHB A;  1VQJ A;  2UUA L;  1U9R A;  2J0T D;  3J7A V;  3SEB A;  3S1Q H;  4DV7 Q;  1K8A C;  3S16 H;  2EJF C;  4LFB Q;  3MXN A;  3PCO B;  1ET9 A;  3TSS A;  1WTH A;  1HRJ A;  2EYF A;  4JV5 Q;  2JA7 H;  4OO1 H;  3VR3 A;  3NK9 A;  1EQQ A;  4YHH L;  1QOH A;  1BCP F;  1IL8 A;  2QIL A;  1Y1W G;  4GKJ L;  2MQH A;  4WOR A;  4RGT A;  4YCW A;  4A3I B;  3GTP B;  1QB5 D;  3I3C A;  1EYG A;  5M5W H;  1HFN A;  1K8O A;  3K7U C;  2R7Z H;  3W2D A;  3CD6 A;  1J5E Q;  1SNM A;  2SEB D;  4OHJ A;  3TP8 A;  4DK0 A;  3TRZ A;  3FVQ A;  5DNF A;  3TME A;  1XMQ Q;  2DY7 A;  3EA6 A;  5A2Q E;  2E8G A;  4JOI A;  4HTH A;  4KV6 A;  2KED A;  2OCE A;  1T5X D;  3PF5 A;  1DJR D;  4ZCK A;  2EOT A;  1Q8K A;  2WB1 E;  2NVQ B;  1WTP A;  1EY9 A;  2WAC A;  1ZYR D;  1HZ9 A;  1EQR A;  1Z7T A;  5IYD G;  1IBL Q;  4O1N A;  1XPR A;  3GTJ B;  5IT9 L;  2MPM A;  4HIM A;  3W3A A;  3GTG H;  2UXC Q;  2P5Z X;  3P7J A;  1AEX A;  5IGB A;  4WRD A;  2Z8L A;  4JBJ A;  4Y7N H;  4A3G H;  1F9R A;  1L2F A;  3HOV H;  2GVA A;  4UAI A;  2LSS A;  2NN6 H;  4R8N A;  1RIP A;  2M2L A;  5IYC G;  1YHQ A;  3HKZ E;  2NZO A;  4K8I A;  2A74 C;  4NW2 A;  3A8J E;  1IBM Q;  2Z6K C;  4LUV A;  1TWH B;  5C3X A;  5M9O A;  5HY6 A;  4YIJ A;  3PUY A;  5F2D A;  1ENF A;  4K0K Q;  1EWH A;  1HTP A;  1NY4 A;  4C3J G;  1KNE A;  3FKI G;  1LYL A;  2J4X A;  1SN8 A;  4XYQ A;  4LFC L;  3CCR A;  1I4R A;  1HUM A;  1E22 A;  4IUR A;  3CU7 A;  1S5E D;  4R4T A;  4A3C G;  5HGQ A;  4BY7 G;  1XNR L;  1I3Q B;  5A2Q L;  2MO1 A;  2ZTE A;  1WTO A;  1NE3 A;  3NWT A;  4EX5 A;  3S2H B;  2Q8R E;  2RA4 A;  1KDC A;  3KLS X;  4DUY L;  2KCT A;  3HOY G;  4O42 A;  4DV3 Q;  1G6Z A;  3GTP H;  4IPD A;  3H0G G;  2JN4 A;  1KDB A;  3K0Y A;  2PQA A;  2Z9H A;  4MHE A;  3S1M H;  2LKV A;  3HOZ G;  4K2L A;  4JI6 Q;  4IQZ A;  2F0I A;  1HNZ Q;  3HEJ A;  5C4X H;  4B3R Q;  4LMQ D;  1NAP A;  1JE4 A;  3P1H A;  5D3D A;  5M5Y B;  2KUM A;  2NVQ H;  4K5V A;  3J7Y W;  2M9V A;  3T13 A;  3I4M G;  3WDN A;  1QJO A;  2Z6B A;  4H02 A;  4DK6 C;  5JVG 3;  1W6J A;  4OGQ C;  2F0T A;  1K0R A;  5FKA C;  1SEB D;  2VUM G;  2UXB L;  2MHV A;  1RJT A;  1S5C D;  3R2T A;  3MC0 B;  4JBW A;  1KRT A;  3DXJ C;  4DF7 A;  4A3E B;  1D2B A;  1G2T A;  2IX3 A;  4IZ8 A;  1Z6H A;  2F0N A;  5JEA J;  3G4S A;  4XXE A;  4GOP A;  4C3I G;  5LMU Q;  5LMN Q;  1WD1 A;  5CC4 A;  4JI8 L;  4X66 L;  4PNY A;  2BOS A;  5BN4 A;  2H4O A;  1SNP A;  2A6H D;  2B8G A;  3V2T A;  4HIK A;  3HRZ C;  2LY7 A;  3K7A B;  1TWH H;  2YU9 B;  1VMP A;  3PIO A;  4X64 L;  4OWW B;  3AYH B;  3QJY A;  4PZ7 A;  2CW0 C;  4JI2 L;  4X6A H;  1Q12 A;  3C3L A;  2F52 A;  1BR9 A;  4KHP Q;  1KNA A;  2XWB B;  3L2P A;  1LAB A;  1SJE D;  1M4V A;  1EYD A;  1GUG A;  3HOY B;  1IW7 D;  1I3Q H;  3F2D A;  3M9B A;  2EYM A;  2HHH Q;  1C48 A;  1Q46 A;  4BY1 G;  3DEP A;  1AZP A;  3ZJY C;  2F0H A;  2ASB A;  3GTL B;  5T1G A;  4CJ2 C;  4YCU A;  1I94 L;  2E76 C;  2EXZ A;  3HOZ B;  1V1P A;  2K7V A;  3CCM A;  1JC7 A;  2L0C A;  1LTL A;  1QUQ B;  3GD7 A;  3K8A A;  4RFB A;  3H6M A;  4NPS A;  1ASY A;  1PXU A;  3W1G A;  4NKL A;  4DGZ A;  5IP7 G;  1AH9 A;  2VNU D;  2MJ8 A;  2X6L A;  5M5Y H;  4IFD I;  3BZK A;  2JA6 G;  4B9X A;  3F2U A;  4KD4 A;  3KLW A;  1XMO Q;  3JC6 6;  4DV7 L;  1I6H B;  4QB4 A;  1A3T A;  4BBR G;  1EY5 A;  4JV5 L;  1U5K A;  4DR4 Q;  3CC7 A;  2EIF A;  1HHV A;  2IW3 A;  3DMU A;  3TBI B;  1EQT A;  1U0L A;  3H91 A;  1JWS D;  4IOA A;  1I4G A;  4DAY A;  3AFP A;  3X3N A;  3NEN A;  1NJI C;  2IY5 B;  1GJX A;  1BCP C;  1HH2 P;  1PH1 A;  2RCN A;  5LL6 X;  5C44 G;  1XXG A;  4B3M Q;  1J5E L;  4LF5 Q;  4IUU A;  4DAV A;  1XMQ L;  2OXP A;  2RKS A;  1Q3L A;  2KCC A;  1O7L A;  1TR5 A;  3BZC A;  3K7A H;  4NDX A;  4XDX A;  1S3O A;  3PUW A;  3RUZ A;  4UY8 C;  3E6Z X;  1Q82 C;  5K36 H;  2EYP A;  4E6I A;  5I2X A;  1U4R A;  1Y8N B;  4CKE A;  2PZT A;  1CKN A;  3D4D A;  1MSH A;  2CVR A;  4BY1 B;  3P75 A;  4F88 A;  4R1J A;  3KK7 A;  3BDC A;  3RZD B;  2UXC L;  1X3E A;  4ILW A;  5G3L D;  1FL0 A;  3T1H Q;  3T1Y Q;  5ELD A;  4RCN A;  3H3V C;  5EKK A;  1GUW A;  4I7A A;  4OWX B;  4DAM A;  4GLV B;  1PH6 A;  4P71 A;  4EQN A;  1STG A;  1PZI D;  2A5H A;  1LT4 D;  2QW7 A;  3I90 A;  2J7Z A;  3NSW A;  1SNC A;  3G48 A;  3I8Z A;  2R92 G;  1H9S A;  4A3K B;  4JOI C;  1KDA A;  1DM0 B;  3D0F A;  4XT3 B;  3U58 A;  2PW5 A;  2KHJ A;  2ZJP A;  3BVG A;  1V1O A;  2FMM A;  4LW1 A;  4JYA Q;  4K0K L;  2PO4 A;  2KQ3 A;  1YIT A;  4B3T L;  1SYG A;  4GNX B;  4YCV A;  4A3J B;  4BBS G;  1ET6 A;  4IOC A;  1PHJ A;  3HOX G;  5IOC A;  1ROD A;  3OWE B;  4X65 L;  3CKI B;  2F4V Q;  4MZ9 A;  5JEA G;  5KRU A;  1PVO A;  1HZB A;  2Q2I A;  4DV3 L;  4CDC C;  2MUY A;  4DU9 A;  3I72 A;  4EVO A;  2I5L X;  2AKW B;  5ELE A;  1SFO H;  1Y8P B;  4IPH A;  5AFW A;  1Q7Y C;  4JI6 L;  5E7N A;  3I7F A;  1HNZ L;  2NZH A;  4HID A;  2CH4 W;  4B3R L;  2ATW A;  2CHB D;  5K5P A;  4DV1 Q;  1HTL D;  4DV0 Q;  3J80 i;  4AIM A;  1TWC H;  1IYJ B;  3NBH A;  1IW7 C;  4QMG A;  5JOB A;  3I91 A;  3M3Y B;  4QJF A;  2KHS A;  4A4I A;  4QIW B;  4EQ5 A;  2QCP X;  5A35 A;  3KDF A;  1WOC A;  5C4J B;  1KIX A;  5KYI A;  1EQV A;  1TWA H;  3TS0 A;  3GO5 A;  1LTT D;  3HS0 C;  1QVG A;  4FXD A;  5JPN C;  4NXM Q;  4JVZ A;  3RLF A;  1BO0 A;  1YNN C;  1X3F A;  2Z6K A;  5LMN L;  4A3F G;  1UE5 A;  3VR4 A;  5D65 A;  3CCU A;  3UDX A;  2UUC Q;  3CF5 A;  2VQF L;  3BVZ A;  1PTO B;  1MJE A;  4A3B H;  4B3S Q;  4XTC S;  1F9S A;  4JC0 A;  4A3K H;  3PUV A;  4L5S A;  2NVX B;  4CDD C;  4BBS B;  4OX9 Q;  2UUB Q;  1AN8 A;  1Y1V H;  2HQE A;  4Z9C B;  4A3J H;  1Q1B A;  2C5C A;  2PCF B;  3H3V I;  5M5X B;  1QG7 A;  4KHZ A;  3MXG A;  3LWU A;  1NNX A;  2CWP A;  3FPP A;  2JA7 G;  4OO1 G;  1LUZ A;  5ISR A;  1XYI A;  2HHH L;  3TQY A;  4RG1 A;  1J6Q A;  1HFG A;  3FMC A;  3URY A;  5IP9 H;  3GV3 A;  1DZ1 A;  1VCI A;  4UP8 A;  2R7Z G;  2K4K A;  2R6G A;  4GOP C;  4DR1 Q;  4GN3 B;  3I4O A;  3K6O A;  3M4O B;  3R2I A;  1JB7 A;  3D8G A;  2JA5 H;  4WJ4 A;  3MVV A;  3G6J B;  4HSV A;  1A3U A;  1Y14 B;  4R4O A;  2OTL A;  4X3S A;  1X3P A;  1X65 A;  3DEO A;  3E5S A;  2YTY A;  4K6D A;  2K5Q A;  1Q8I A;  4CKB A;  2N3S A;  3ND9 A;  3P20 A;  2B39 A;  4DR5 L;  2Z4I A;  3L3O C;  4KHV A;  3M3Y H;  3NEM A;  1XMO L;  3A5Z B;  2F0M A;  1E0B A;  4F8M A;  5DAU A;  2TSS A;  2EJM A;  4GN5 A;  3NPP A;  1N34 Q;  4DR4 L;  4ZKB B;  2Y0S B;  1KC8 C;  5C4J H;  5I4D A;  3NWS A;  3J81 i;  1M8A A;  2B3G A;  4A3G G;  4P74 A;  4A3F B;  1E24 A;  1I4Q A;  1WTX A;  3HOV G;  1V1Q A;  1KAA A;  2NN6 G;  1R9T B;  1J8I A;  1WVL A;  1KXL A;  1BOS A;  3SE0 A;  3DM1 A;  1JJC B;  3T53 B;  1JMC A;  4B3M L;  1OTC A;  4LF5 L;  1B7Y B;  5FLX L;  1MGS A;  2AWO A;  3PUZ A;  3PO3 G;  1JR0 D;  1PTO H;  1EWI A;  1PZK D;  1BF4 A;  4IUT A;  3IFD A;  3G7L A;  3GTO H;  4DA2 A;  3S1Q B;  2F3I A;  5C3W A;  2E5L Q;  1JOK A;  3SK6 A;  2ES2 A;  2FHT A;  2VW9 A;  1VQ6 A;  1DCZ A;  3DHQ A;  1HA5 A;  4PMW A;  4ALP A;  3BU2 A;  3CW2 C;  3S17 B;  5M5X H;  1UEB A;  4JI5 Q;  1C4Q A;  2IL8 A;  3BYY B;  2WKC A;  2HCI A;  5M5W B;  2KHI A;  4HJ8 A;  4PMC A;  3E3X A;  3T1H L;  3T1Y L;  2ZJR A;  3HOU H;  4MN3 A;  4ZQ3 A;  2EJG C;  4EQP A;  4GNX C;  4P72 A;  1DD2 A;  3CCJ A;  4AYB E;  1ASZ A;  1QIL A;  2PZU A;  2WKD A;  5H1S E;  5FO8 B;  2F3W A;  3KF8 A;  3U4Z A;  1CI3 M;  2JQO A;  5C4X G;  3OIQ A;  3OYY A;  3NTH A;  4X62 Q;  3OSO A;  3CCQ A;  3NQT A;  4K5W A;  4ZLT F;  3QO2 A;  5C0X I;  1YIJ A;  2D0P A;  2BH2 A;  5L37 A;  3KBX A;  3GTG B;  1B2T A;  2VXW A;  4RHR A;  2PMZ E;  4LAA A;  3HZX A;  3CME A;  4HCS A;  1DOL A;  2HD3 A;  1A6X A;  1A62 A;  5KNB A;  1VQL A;  1SRO A;  5FLM H;  2JJQ A;  1HR0 L;  1VQC A;  2I5M X;  2QEX A;  2E2I B;  5IT9 E;  2XN9 C;  5E3F A;  4JI7 Q;  3H94 A;  1Y8O B;  2PYK A;  1JWU D;  4KJO A;  5IY0 A;  2K5V A;  1PH9 A;  1QVC A;  3ULL A;  2EPB A;  1STA A;  2GVB A;  3HOW B;  1STN A;  4LF8 L;  1MIU A;  5J39 A;  2DNE A;  1LTG D;  1SNO A;  3L7Z C;  1IKL A;  2NB0 A;  3ULP A;  4DV1 L;  4ZK9 B;  2BDO A;  3HKS A;  3ITP A;  1SMY D;  2HIV A;  4IUN A;  4DR7 Q;  3S17 H;  3NUC A;  3K58 A;  1YJN A;  4PQX A;  4V0B A;  4DUZ Q;  1HQR D;  4FF1 A;  4L5T A;  1M1K C;  3S1M B;  1EUJ A;  3L9A X;  1LV9 A;  3MFY A;  1WTV A;  1K3B C;  4CBV A;  2MO0 A;  4NXN Q;  4NXM L;  4LUO A;  3SK4 A;  2R61 A;  1E1T A;  1SDF A;  3M85 A;  4AH6 A;  5JJZ A;  4IFD H;  4FF3 A;  5C4X B;  3LNN A;  5EPK A;  4RA8 A;  3DWP A;  3TZD A;  1NMF A;  1X3G A;  4KKU A;  1I50 H;  4KY7 A;  4OWT B;  1G8Z D;  4B3S L;  1HUN A;  2YYZ A;  1QCB D;  4YY3 L;  1K28 A;  1W2B A;  2Q2T A;  3W5O A;  3EVQ A;  2UUB L;  4OX9 L;  4C56 C;  2K75 A;  4QUF A;  3FEW X;  2KCN A;  3G71 A;  2EYO A;  1J9O A;  2FMC A;  2YV5 A;  4BA1 I;  5M3F B;  3RZO H;  2IHF A;  2ICE C;  1XPO A;  2L12 A;  3VA5 A;  4H7B A;  2VQE L;  3OMG A;  4A3E G;  5IGD A;  4L6T B;  3EFX D;  1GXD C;  3I73 A;  3K80 C;  4RH6 A;  1UNS A;  4QGU A;  2E2I H;  2WAQ B;  2ZT9 C;  1KLG D;  2NTS A;  5FK9 C;  2L1B A;  1RD9 D;  4DR2 L;  2WII B;  1YJ9 A;  2UU9 Q;  1TU2 B;  4J8Q A;  3J7Z C;  1D5X C;  3HOW H;  2F0Q A;  2KA7 A;  2ZTD A;  3DWA A;  1VQO A;  1BCP B;  3SXH A;  1X3Q A;  5K36 G;  1PFB A;  1S5D D;  1FNW A;  4B08 A;  5J3B A;  1QNK A;  2X6G A;  2A19 A;  1HNX Q;  1CT1 D;  1RHP A;  2N8N A;  2QKI C;  1N34 L;  2EY5 A;  5EJW A;  1CZG A;  3CP0 A;  2L9H A;  1QWY A;  1TY2 A;  3QIA A;  3CCL A;  3ER0 A;  1CSP A;  3AB9 A;  3OIP A;  1YHA A;  4G4K A;  4A3D H;  3CMA A;  5C3E B;  1ONL A;  4ZUI A;  4HSP A;  5TSS A;  2JEA I;  2IPK D;  3MXN B;  3K5O A;  1FGB D;  1H9M A;  4BXX H;  4IN3 A;  4L5Q A;  4DR6 L;  3D31 A;  1PA6 A;  4C3H B;  4G7Z C;  1UE7 A;  1F2M A;  2IT1 A;  1EY4 A;  4KJN A;  2E5L L;  4OEL B;  1MSG A;  1RDP D;  1CSQ A;  3PV0 A;  4YWK A;  4OXP A;  2K33 A;  1EY0 A;  2JYO A;  4C2M B;  1DOK A;  5M3F H;  4C1N K;  1O7Y A;  5IYB H;  2HDM A;  4MTN A;  1VQE A;  4BS9 A;  3BDL A;  4APV A;  5IWA L;  1O78 A;  1LTR D;  4JBK A;  3G6E A;  2RDG A;  3S1R H;  2Q8T A;  4IUP A;  1EY6 A;  2OEO A;  2H1E A;  3WOF A;  3KUP A;  4BWG B;  1VQH A;  2ID0 A;  1LM0 A;  1EOT A;  1HPC A;  3OMC A;  4PG3 A;  4JI3 L;  1JB3 A;  1QVF A;  1TQO A;  1HNW Q;  4UPA A;  4KY5 A;  4GS3 A;  4NB3 A;  4X62 L;  4FF2 A;  4XQQ A;  1S40 A;  3ND8 A;  4K6L A;  4YWL A;  2K1B A;  1IKM A;  2HCC A;  2F4I A;  1AE2 A;  3A56 A;  1Q90 A;  1VDZ A;  3TRE A;  5IT9 c;  3KJO A;  1G91 A;  2KEC A;  2QF7 A;  4I7Z C;  4QL5 A;  1UUP A;  5EPL A;  4LFA Q;  3IAY A;  4R8I A;  1SYF A;  4DK1 A;  2K28 A;  1EWC A;  1X54 A;  3BG3 A;  3VR6 A;  1KD1 C;  5C3E H;  4JI7 L;  2BE5 D;  3BZD B;  1B53 A;  2NWG A;  4KMU C;  1AFP A;  3SK8 A;  2K04 A;  1S72 A;  1ENC A;  1ZYR C;  1E2Z A;  4OO1 I;  3MWY W;  4A3B G;  5G3L F;  2EY1 A;  4DV2 Q;  3PMF A;  2DUD A;  4A3K G;  4L5R C;  2Z1C A;  3H3V H;  1JOQ A;  3ULJ A;  3VR2 A;  4C3H H;  1XPU A;  4TKO B;  5AJ3 Q;  2ZXP A;  5KIX A;  2A69 D;  3PSI A;  4LFB L;  1IBK Q;  2JXM B;  1JWM D;  4A3J G;  2PQA B;  1VMC A;  3CRK C;  4DR7 L;  1JJG A;  2B2T A;  2K03 A;  4C2M H;  1OXV A;  4U68 A;  3J7A 5;  4RGM A;  5FJ8 H;  5JVH 3;  2B2W A;  4DUZ L;  3VYS A;  2EZV A;  3EJI A;  3MTS A;  3RN5 A;  1JOO A;  2JA9 A;  4H44 C;  1Q1E A;  1SFO B;  3IL8 A;  4NXN L;  5I9O A;  1PFM A;  2R7D A;  4ZUJ A;  4PZ6 A;  1A2T A;  3GTM B;  1ILP A;  4KK7 A;  1MHW C;  2JK8 A;  3Q0A A;  1QE6 A;  2XIW A;  4ZYS A;  4FXG C;  2IWH A;  4IFD J;  1TWC B;  4CHT B;  1SE3 A;  1B1Z A;  1CQF A;  2LFN A;  1HXY D;  4FF4 A;  3BJU A;  1IBL L;  4TSS A;  4GOP B;  1F9Q A;  2E2H B;  1H9K A;  3QOL A;  1TS3 A;  1TWA B;  2UXD Q;  1STY A;  1PRT B;  4OIJ A;  1RF2 D;  5C4Z A;  1C8C A;  1H9R A;  2D9U A;  2JE6 I;  1WFQ A;  4UDU C;  3IFT A;  5ELF A;  5EAY A;  3K0X A;  4JBM A;  2QDB A;  2F03 A;  1WTW A;  4HCE A;  3QR8 A;  4A3B B;  1A8V A;  2ALY B;  1IBM L;  2NVT H;  2CWA A;  1PDQ A;  1TS2 A;  4FXK C;  4NP5 A;  3R3O A;  4FVM A;  1B70 B;  2HIX A;  1S5F D;  5KND A;  2IJ0 A;  1Y1V B;  4N9P A;  3M4Y A;  4IPC A;  2KEE A;  3D4R A;  4LWC A;  3U9S A;  1GHJ A;  1L1O B;  1CTM A;  3SGI A;  4Y52 H;  1V1P B;  1SAP A;  4POG A;  1EEF D;  2XGT A;  3NP8 A;  3HG9 A;  5GRO A;  3T16 A;  1FNU A;  5M3M H;  4DV6 Q;  3I4M H;  1JOR A;  1O7I A;  2OQ0 A;  4CDE C;  1HNX L;  2KVM A;  2A6H C;  2L4N A;  1FJG Q;  4DNI A;  2Q8I B;  3KF6 A;  3HOU G;  3M7N A;  4M8A A;  4AQY Q;  1EY7 A;  4KKT A;  1EIF A;  4KD3 A;  4N8F A;  2JA5 B;  3GTM H;  3S1N H;  2R3Z A;  1N32 Q;  3T51 B;  5C0X H;  4RGO S;  5ELB A;  1MKH A;  1YNJ D;  4C3I H;  1HA6 A;  2G9D A;  5GAG C;  4HIO A;  3R93 A;  2MP1 A;  3DM3 A;  1W3S A;  2PI2 E;  2BCO A;  2K5N A;  1SLJ A;  1WI5 A;  4XQN A;  4DV5 Q;  4DAY B;  5IE8 A;  1S4Z A;  3RLN A;  4KKS A;  2E2H H;  3LWE A;  1GO3 E;  2CKZ B;  5I6Y A;  3R8B A;  2XNA C;  1T5E A;  3T4A C;  4RMF A;  4PZ8 A;  2EYJ A;  2RCF A;  3KBG A;  3SDZ A;  3FP9 A;  2Y0S G;  1CUK A;  5FLM G;  2BE5 C;  1B9N A;  5LMU L;  2F0L A;  2C9O A;  5CYU A;  1R4Q B;  3U9O A;  1PFS A;  3VA7 A;  3X3M A;  1N8R C;  4QQB X;  1CKN B;  3GTO B;  4N8X 1;  1PTO D;  4JK1 C;  1X6O A;  4M1U B;  2A69 C;  1M90 C;  1PYW D;  1HNW L;  2EY6 A;  3QB3 A;  1WTR A;  4KHP L;  2A8V A;  4POF A;  5FLX E;  4IPG A;  3STB D;  2VS1 A;  3RD4 A;  4LUZ A;  2B63 B;  4ZAI A;  1PZJ D;  3HOU B;  1TVX A;  1A2U A;  3UE1 A;  4Q5V A;  2AQ3 B;  4DNT B;  5GAD C;  1H9S B;  3CCV A;  1CKO A;  1TT2 A;  2ZJQ A;  3D3R A;  1EZ6 A;  4JI0 Q;  3CQZ H;  4AYB B;  3S9W A;  2A1A A;  3J80 L;  1B3Q A;  4KTA A;  1B44 D;  2XTI A;  3UE0 A;  3EIV A;  4CDF C;  5E4W C;  2K14 A;  1WTQ A;  5IGF A;  3K59 A;  2OTJ A;  5JAV A;  4IFD G;  3B6Y A;  1YI2 A;  2ZXO A;  1DYQ A;  2H5X A;  3VR5 A;  1F77 A;  3BS1 A;  2L55 A;  1XJV A;  4DV2 L;  3I4L A;  4HJ9 A;  4J6H A;  2DJF C;  1EZ8 A;  1DGS A;  5JPM C;  1DON A;  5AJ3 L;  2TMP A;  3F8T A;  4G57 A;  1IBK L;  1OO9 B;  1VQD A;  2K5W A;  1HR0 W;  4LF6 Q;  4HJ7 A;  3PIP 3;  1YBY A;  1IYV A;  1VQ9 A;  2XRS D;  1VQI A;  2C35 B;  1WCM B;  5C5M A;  2G5D A;  1K8M A;  4DXF A;  5EKI A;  1XNR Q;  4PV1 C;  2AQ1 B;  3J81 E;  3UDG A;  4QIW E;  1L0Y B;  1RCV D;  4DV4 Q;  3PO2 H;  1I6V C;  5ELO A;  1MJC A;  1CA6 A;  1VF5 C;  2AWN A;  2B29 A;  3NBH B;  1KL9 A;  5GQO A;  2N49 A;  3K81 C;  4K2K A;  4S3S A;  1ZEQ X;  2D5D A;  1SYE A;  3HOW G;  3A5U A;  3HFZ B;  3KDF B;  1TY0 A;  2F0D A;  1PMR A; 
#chains in the Genus database with same CATH homology
 2YV5 A;  2JEB I;  4BA1 I;  4YCU A;  3RZO H;  1I94 L;  1VQK A;  2IHF A;  3TEH B;  1XPO A;  3CC2 A;  3CCM A;  3I55 A;  1PV4 A;  2VQE L;  3FHW A;  4A3E G;  1LTL A;  1QUQ B;  3GD7 A;  1VQF A;  3K8A A;  3S2D H;  2B63 H;  4OON A;  4NPS A;  3K80 C;  4LF8 Q;  3EBE A;  2UUA Q;  1ASY A;  1NTG A;  3GDE A;  2UXD L;  3W1G A;  4QGU A;  2E2I H;  1GD7 A;  2YTX A;  5IP7 G;  1YEZ A;  1AH9 A;  4DR2 L;  2VZA A;  1YJ9 A;  1G29 1;  2UU9 Q;  2VNU D;  2IX1 A;  1HZC A;  5M5Y H;  4IFD I;  3S14 H;  2AMC B;  3BZK A;  4A3D G;  3J7Z C;  2JA6 G;  1D7Q A;  3HOW H;  4O2D A;  1WCM G;  3Q8D A;  4YHH Q;  4GKJ Q;  4BY1 H;  3KLW A;  1E1O A;  1SE8 A;  3JC6 6;  4DV7 L;  2ZTD A;  1XMO Q;  2N78 A;  4LF4 Q;  4O0A A;  5DLQ E;  1VQO A;  1BBU A;  2MFI A;  2GN5 A;  4BBR G;  4BXX G;  3RZD H;  4JV5 L;  5K36 G;  1U5K A;  4A76 A;  5JJK A;  4JI8 Q;  3I56 A;  4X66 Q;  4DR4 Q;  3CC7 A;  2EIF A;  2R7F A;  3KJP A;  4JYA L;  1L0W A;  2NVY H;  1U0L A;  5J3B A;  4IOA A;  3AFP A;  2IY5 B;  3LGJ A;  3NEN A;  2A19 A;  1NJI C;  1HNX Q;  4JI3 Q;  2D62 A;  2N8N A;  1N34 L;  3AEV A;  1HH2 P;  1PH1 A;  2RCN A;  5C44 G;  4B3M Q;  3CP0 A;  1J5E L;  4LF5 Q;  3CCL A;  5IP7 H;  2F4V L;  1SR3 A;  3ER0 A;  5M3F G;  1XMQ L;  1CSP A;  4DV6 L;  3S24 A;  1YHA A;  4R4Q A;  3CAM A;  4A3D H;  5IYB G;  4YY3 Q;  3CMA A;  2E2J H;  2JA6 H;  1WCM H;  3IRB A;  2JEA I;  4LF7 L;  2IX0 A;  3AFQ A;  3BZC A;  3K7A H;  2BH8 A;  2Q2U A;  4LFA L;  3DLL A;  3MXN B;  4DR3 L;  1S3O A;  3PUW A;  1Q86 C;  4UY8 C;  4AQY L;  4HJA A;  4BBR H;  4BXX H;  4L5Q A;  4DR6 L;  3D31 A;  1Q82 C;  2WAQ G;  1PA6 A;  2BA0 A;  1VQP A;  2OWO A;  1CKN A;  1UE7 A;  2Y0S E;  1N32 L;  4GKK Q;  2IT1 A;  1B8A A;  1YVC A;  2E5L L;  4R1J A;  3F2B A;  2VQE Q;  4JI4 L;  3GTK H;  5C0X J;  4DV0 L;  2UXC L;  1X3E A;  1FVI A;  1CSQ A;  5C44 H;  3PV0 A;  1FL0 A;  4YWK A;  3T1H Q;  3T1Y Q;  4OXP A;  1IXR A;  2WB1 G;  4LF9 L;  5M3F H;  4DV5 L;  3CPF A;  1TXY A;  4A93 G;  4DAM A;  4OWX B;  5IYB H;  4GLV B;  1VQE A;  4MTN A;  1PH6 A;  4DR2 Q;  4P71 A;  4APV A;  1K9M C;  5IWA L;  1PH5 A;  4JBK A;  3KF6 B;  1WYD A;  3G6E A;  3S15 H;  1T9H A;  1G51 A;  3S1R H;  3G48 A;  3RNU A;  3L0O A;  4LFC Q;  2R92 G;  1JJ2 A;  1N36 Q;  2OQK A;  2D0O A;  4JOI C;  3D0F A;  3U58 A;  1VQH A;  2ID0 A;  2KHJ A;  2ZJP A;  1LM0 A;  1D8L A;  1YNX A;  4GN4 B;  4LW1 A;  4PG3 A;  4JI3 L;  5C3E G;  1Q81 C;  2UUC L;  4JYA Q;  3RN2 A;  1QVF A;  1YIT A;  4B3T L;  2DGY A;  4GNX B;  1VQM A;  4YCV A;  2AHO B;  1PH7 A;  4UPA A;  5FLX c;  4DUY Q;  1HNW Q;  3HKZ G;  4GS3 A;  4NB3 A;  2VY3 A;  4X62 L;  4IOC A;  1PHJ A;  1S40 A;  1N33 L;  4K0K L;  4P75 A;  1TWF H;  4YWL A;  3HOX G;  4WJ3 M;  2CQO A;  1X55 A;  4X65 L;  4A93 H;  1AE2 A;  2BA1 A;  1VQ5 A;  4MZ9 A;  5JEA G;  3TRE A;  2F4V Q;  1PVO A;  2HQL A;  5IT9 c;  4A75 A;  4A3M G;  4XIG S;  1HZB A;  2Q2I A;  3F2C A;  4DV3 L;  3KJO A;  1AE3 A;  4R4I A;  2HT1 A;  3J81 j;  4QL5 A;  4JI1 L;  1L1O C;  4LFA Q;  3E9I A;  2I5L X;  3A0J A;  3W1B A;  2R92 H;  2AKW B;  1VQ8 A;  1H95 A;  3H15 A;  1X54 A;  4DR6 Q;  1BVS A;  4DPG A;  1SFO H;  4IPH A;  1UE6 A;  1Q7Y C;  4JI6 L;  2R93 G;  3KF8 B;  5E7N A;  3A74 A;  3I7F A;  1K73 C;  1KD1 C;  5FJ8 G;  3I4N G;  5C3E H;  2NVX H;  2CFM A;  4JI7 L;  1HNZ L;  4KI0 A;  2NZH A;  4HID A;  4BBS H;  1C7Y A;  4B3R L;  1K83 H;  2ATW A;  1GM5 A;  4DV1 Q;  1X9N A;  1S72 A;  4DV0 Q;  2ZM6 Q;  4JI0 L;  3HOX H;  3J80 i;  4AIM A;  2UXB Q;  2KCM A;  4OO1 I;  4DR1 L;  3E0E A;  2YTV A;  4ME3 A;  1TWC H;  4UP9 A;  1IYJ B;  3UDI A;  1SRU A;  4DV2 Q;  1KRS A;  4A3B G;  2DUD A;  4QJF A;  1GVP A;  4A3K G;  4L5R C;  3H3V H;  4A4I A;  3ULJ A;  4C3H H;  1NBW A;  1XPU A;  4A3M H;  5AJ3 Q;  4EQ5 A;  4MNO A;  1FGU A;  1X56 A;  3PSI A;  3OTO L;  4LFB L;  1V9P A;  1IBK Q;  5IWA Q;  1JT8 A;  1KQS A;  3KDF A;  1QZG A;  1WOC A;  4A3I G;  2PQA B;  4A3J G;  1PH4 A;  1KIX A;  3CPW A;  1TWA H;  1NMG A;  4JCV E;  3TS0 A;  4DR7 L;  1JJG A;  3GO5 A;  4C2M H;  3PO3 H;  2R93 H;  1OXV A;  1QVG A;  4JG2 A;  3AQQ A;  4NXM Q;  3J7A 5;  1PH2 A;  3RLF A;  3J81 c;  1X3F A;  5FJ8 H;  1VQ4 A;  2Z6K A;  3I4N H;  2QA4 A;  4DUZ L;  1VQB A;  5LMN L;  1KAW A;  3RN5 A;  1UE5 A;  4A3F G;  4LF6 L;  1UWV A;  1QUQ A;  1HZA A;  2WFW A;  3M4O H;  2JA9 A;  4X64 Q;  3UDX A;  3CCU A;  1Q1E A;  1VQA A;  3CF5 A;  1JE5 A;  4JI2 Q;  1GKH A;  2VQF L;  2UUC Q;  4A3L G;  4B3T Q;  1E7Z A;  1C0A A;  4NXN L;  4IJL A;  2MNA A;  1CKM A;  1EIY B;  3RR5 A;  1MJE A;  4A3B H;  2R7D A;  3UDF A;  4B3S Q;  1VQN A;  4XTC S;  4PZ6 A;  3I2Z A;  4JC0 A;  5BR8 L;  4A3K H;  3PUV A;  3JAM i;  4L5S A;  1XNQ Q;  3RLO A;  1XTD A;  4X65 Q;  1TWG H;  2JK8 A;  2VL6 A;  3M4Q A;  1FJG L;  4OX9 Q;  2UUB Q;  4J15 A;  4DV4 L;  4TQU S;  2JA8 G;  1E3P A;  1Z47 A;  4IFD J;  1SMX A;  4R4C A;  2LXK A;  1V43 A;  1Y1V H;  5ELN A;  2FXQ A;  4A3I H;  4A3J H;  1UE1 A;  1Q1B A;  3J80 c;  4DKA C;  3KOJ A;  5GAH C;  2QGQ A;  3H3V I;  4KHZ A;  1I94 Q;  2CWP A;  4DK3 C;  2JA7 G;  3BJU A;  2ZTC A;  4OO1 G;  1LUZ A;  1I5F A;  1IBL L;  2HHH L;  1IZ6 A;  4GOP B;  3TQY A;  1BBW A;  1EOV A;  2V1C C;  1G6P A;  4RG1 A;  2PNH A;  1Z9F A;  1J6Q A;  3PUX A;  4A3F H;  4YWM A;  3E9H A;  5IP9 H;  3STB C;  1VS0 A;  1R9T H;  4A3L H;  2UXD Q;  1VCI A;  4JI5 L;  4UP8 A;  2R7Z G;  2K4K A;  2R6G A;  2I0Q A;  3GTQ H;  2PI2 A;  1PYS B;  1QZH A;  5JJL A;  4GOP C;  1KHI A;  4DR1 Q;  1YHB A;  1VQJ A;  4GN3 B;  5M3M G;  2JE6 I;  3I4O A;  1WFQ A;  2UUA L;  5EAY A;  1JB7 A;  3K0X A;  2JA8 H;  3U4V A;  2JA5 H;  4JBM A;  4WJ4 A;  2LXJ A;  3PF4 A;  3S1Q H;  4QY7 A;  1Y14 B;  4DV7 Q;  4R4O A;  1K8A C;  3S16 H;  2OTL A;  4LFB Q;  1A8V A;  3PCO B;  1X65 A;  2ALY B;  3GTJ H;  1IBM L;  3CC4 A;  2YTY A;  2NVT H;  2CWA A;  3ICE A;  4BBS G;  4JV5 Q;  2JA7 H;  2N3S A;  3JAM c;  1EQQ A;  4LNQ A;  4DR5 L;  1B70 B;  2HIX A;  2I5H A;  4YHH L;  1Y1W G;  3M3Y H;  4GKJ L;  3NEM A;  1XMO L;  4LF4 L;  2MQH A;  3U50 C;  5C0X G;  3A5Z B;  4YCW A;  4IJH A;  4IPC A;  4P73 A;  4LWC A;  3M4P A;  1EYG A;  5M5W H;  1L1O B;  3SGI A;  4Y52 H;  4GN5 A;  3K7U C;  1N34 Q;  2R7Z H;  3KFU A;  2WAQ E;  4DR4 L;  1VQG A;  1KC8 C;  5C4J H;  4POG A;  3CD6 A;  2VQF Q;  1J5E Q;  2XGT A;  2CCZ A;  3TRZ A;  4A3G G;  3J81 i;  2B3G A;  5GRO A;  4P74 A;  1XMQ Q;  4DV6 Q;  5M3M H;  1E24 A;  3I4M H;  1A0I A;  3HOV G;  1V1Q A;  3EN2 A;  1O7I A;  2OQ0 A;  2E8G A;  4JOI A;  2NN6 G;  1HNX L;  1KXL A;  2OCE A;  1FJG Q;  4DNI A;  4LF7 Q;  1JJC B;  1JMC A;  3PF5 A;  4B3M L;  1OTC A;  4LF5 L;  1B7Y B;  3KF6 A;  4DR3 Q;  3HOU G;  3M7N A;  4AQY Q;  1YJW A;  1Q8K A;  2WB1 E;  2AWO A;  3PUZ A;  3PO3 G;  1EIF A;  1EWI A;  1C9O A;  3GTO H;  1HZ9 A;  1Y1W H;  3NEL A;  3GTM H;  3S1N H;  1N32 Q;  1EQR A;  2Q2H A;  3F1Z A;  5IYD G;  1IBL Q;  1IL2 A;  2F3I A;  2E5L Q;  1XPR A;  1MKH A;  2VW9 A;  2ES2 A;  4C3I H;  4HIM A;  1VQ6 A;  3GTG H;  4JI4 Q;  5GAG C;  2UXC Q;  3S2H H;  2IHE A;  4GNX A;  4HIO A;  4PMW A;  4ALP A;  3BU2 A;  3CW2 C;  2KEN A;  3DM3 A;  4JBJ A;  4Y7N H;  1W3S A;  2PI2 E;  4GKK L;  1L1O A;  2K5N A;  4LF9 Q;  5M5X H;  1SLJ A;  1UEB A;  1WI5 A;  1L2F A;  4JI5 Q;  4DV5 Q;  4A3G H;  4DAY B;  4GLX A;  3HOV H;  5JJI A;  5IE8 A;  2GVA A;  2LSS A;  3RLN A;  2KHI A;  2E2H H;  4HJ8 A;  1GO3 E;  2CKZ B;  1RIP A;  3T1H L;  3T1Y L;  5IYC G;  1Y1V G;  3HKZ E;  2NZO A;  3CCS A;  2ZJR A;  1YHQ A;  3HOU H;  4KLK A;  4RMF A;  2WP8 J;  4PZ8 A;  4P72 A;  3CCJ A;  4AYB E;  3FP9 A;  1IBM Q;  2Z6K C;  2Y0S G;  4LUV A;  1ASZ A;  3TS2 A;  1CUK A;  5FLM G;  3PGZ A;  5LMU L;  2L15 A;  5HY6 A;  5H1S E;  5IYD H;  3PUY A;  3VDY A;  4DR5 Q;  5IP9 G;  4K0K Q;  3U4Z A;  1NY4 A;  1PFS A;  2JQO A;  3FKI G;  1LYL A;  3CCR A;  1SN8 A;  5C4X G;  4LFC L;  1N8R C;  1E22 A;  3OYY A;  1N36 L;  4QQB X;  1CKN B;  1PYB A;  4X62 Q;  1N33 Q;  4R4T A;  3CCQ A;  4A3C G;  5HGQ A;  4BY7 G;  1XNR L;  1YIJ A;  2K5H A;  1X6O A;  5C0X I;  2D0P A;  3CCE A;  2BH2 A;  2MO1 A;  2ZTE A;  1M90 C;  4A3E H;  1NE3 A;  1HNW L;  4EX5 A;  2PMZ E;  3KYH C;  2JA5 G;  4DUY L;  2KCT A;  3CME A;  3HOY G;  3WWV A;  4KHP L;  4DV3 Q;  5IYC H;  2A8V A;  3GTP H;  1K8G A;  1VQ7 A;  4IPD A;  4POF A;  1A62 A;  3H0G G;  4JI1 Q;  4IPG A;  3STB D;  2VS1 A;  2PQA A;  1OXT A;  3S1M H;  1VQL A;  1SRO A;  1RL2 A;  2NN6 I;  4LUZ A;  5FLM H;  2JJQ A;  3HOZ G;  4JI6 Q;  1HR0 L;  1HJP A;  1VQC A;  2I5M X;  2QEX A;  4HJ5 A;  1PH3 A;  3UE1 A;  5LMN W;  4C3J H;  4JI7 Q;  1N9W A;  1HNZ Q;  3FKI H;  5C4X H;  5GAD C;  2YU9 H;  4B3R Q;  3CCV A;  1CKO A;  2ZJQ A;  5IY0 A;  1WJJ A;  2K5V A;  1PH9 A;  1QVC A;  3CQZ H;  4JI0 Q;  4A3C H;  3ULL A;  2A1A A;  4BY7 H;  2GVB A;  2NVQ H;  2XTI A;  3I4M G;  3UE0 A;  4LF8 L;  3EIV A;  1MIU A;  4IO9 A;  2K14 A;  2K50 A;  4H02 A;  4DK6 C;  2OTJ A;  1YZ6 A;  3B6Y A;  2RHS B;  3L7Z C;  1YI2 A;  3HOY H;  2RF4 A;  4IFD G;  2H5X A;  3ULP A;  4DV1 L;  4TVA B;  3PO2 G;  1K0R A;  4BA2 I;  2ZM6 L;  3OTO Q;  2VUM G;  2UXB L;  2UU9 L;  3H0G H;  1XJV A;  4DV2 L;  3GTL H;  3HKS A;  4HJ9 A;  2Z0S A;  1P16 A;  1OXS C;  4JBW A;  4UP7 A;  1KRT A;  2HIV A;  1DGS A;  4DR7 Q;  3S17 H;  5AJ3 L;  3HOZ H;  3F8T A;  1K3R A;  4FDB A;  5JEA J;  3G4S A;  1YJN A;  1IBK L;  1PH8 A;  4GOP A;  2EXD A;  4DUZ Q;  5LMU Q;  5LMN Q;  1VQD A;  1HR0 W;  2K52 A;  4LF6 Q;  4HJ7 A;  4JI8 L;  1YBY A;  4X66 L;  4L5T A;  1M1K C;  1EUJ A;  3OW2 A;  1VQ9 A;  5GAE C;  2MO0 A;  4NXN Q;  1VQI A;  4NXM L;  1BKB A;  4LUO A;  2C35 B;  3PIP A;  1E1T A;  4HIK A;  5BR8 Q;  1P8L A;  1TWH H;  1XNR Q;  3M85 A;  4AH6 A;  3UDG A;  3PIO A;  4QIW E;  2B63 G;  2KBN A;  4X64 L;  4OWW B;  4DV4 Q;  3PO2 H;  3AYH B;  4PZ7 A;  4JI2 L;  3MEF A;  4X6A H;  2VUM H;  4GLA C;  5ELO A;  1MJC A;  1Q12 A;  2F52 A;  1NMF A;  1X3G A;  2AWN A;  1I50 H;  2B29 A;  3NBH B;  4OWT B;  4B3S L;  4KHP Q;  1I6H H;  2YYZ A;  1KL9 A;  3L2P A;  1EFW A;  1XNQ L;  4YY3 L;  5GQO A;  2N49 A;  3K81 C;  1W2B A;  1OXX K;  2Q2T A;  1A63 A;  3W5O A;  4AYB G;  2UUB L;  4OX9 L;  3CXC A;  1I3Q H;  2K75 A;  3F2D A;  3M9B A;  3HOW G;  2HHH Q;  3A5U A;  1Q46 A;  3HFZ B;  3KDF B;  4BY1 G;  2EQS A;  2RHQ B;  3ERS X;  4GNX C;  3G71 A;  3ZJY C;  2ASB A;  1OXU A;  1HR0 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...