2LXKA

Backbone 1h, 13c, and 15n chemical shift assignments for cold shock protein, lmcsp
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
66
structure length
66
Chain Sequence
MEQGTVKWFNAEKGFGFIERENGDDVFVHFSAIQGDGFKSLDEGQAVTFDVEEGQRGPQAANVQKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cold shock-like protein CspLA
publication title Structural and Dynamic Features of Cold-Shock Proteins of Listeriamonocytogenes, a Psychrophilic Bacterium
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Transcription
total genus 10
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2012-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2lxkA00
1L1OB 1HZAA 2Q2TA 4GNXB 4AYBG 2ZM6Q 1YITA 1I94L 4UY8C 3JC66 4JOIA 3S14H 3FKIH 2A1AA 1L0WA 2UUCL 2NVTH 1E24A 3HOXG 5GQOA 4DK6C 2OTLA 2JJQA 2RCNA 2YYZA 4DR3Q 1VQ8A 3W1GA 2HHHQ 4GKJQ 1C9OA 1L2FA 2XGTA 2C35B 4BY1G 5FLMG 2VQFL 2ZJRA 4A3KG 1CKOA 4LF6Q 1EQRA 4B3TQ 1VQ4A 4HIDA 4A3LH 3CCUA 2JK8A 3CCMA 4LUVA 3J7ZC 4A3BH 1GO3E 1I3QH 1N33L 1IXRA 1VQAA 2IHEA 4R4OA 3CP0A 1CSQA 4HJ8A 2YU9H 4DR6L 4R4TA 1AE3A 4RMFA 5BR8L 3F2BA 1VQFA 4DUYQ 4JI7Q 3RR5A 1HJPA 3E0EA 3S1NH 1CUKA 2LXJA 3H0GH 1WOCA 4LFBL 4X65L 3CC4A 2UXCL 4B3SL 5C4JH 2JA9A 4DV2L 4LUOA 1UE6A 3L7ZC 1GVPA 4IJLA 1QZHA 4LF7Q 1B70B 1JE5A 1I50H 2I5MX 3CPWA 1EIYB 3CC2A 4YWLA 2CCZA 1VQ9A 5IYCG 3PSIA 1XNQQ 3PUWA 3EN2A 4JV5L 4OWTB 1XMQL 1Y1VH 5HGQA 3JAMc 3HOZG 1JJGA 4A93H 1KL9A 1GKHA 2CQOA 2LXKA 1VQ5A 1SN8A 5GADC 1M1KC 3PF4A 3K7AH 4H02A 4KHZA 3TREA 2UUAL 3PIPA 3KYHC 2JA7G 1Q1EA 3EIVA 4JI8L 2ALYB 2IT1A 1B7YB 2LSSA 4AIMA 2MNAA 4DV7L 4X65Q 4P74A 1XMOQ 1EFWA 2NVQH 1FJGL 5IP9H 4HJAA 2JEBI 4EQ5A 1QVCA 4X66L 4DV2Q 3FKIG 3TEHB 2IX1A 4JI4L 3HOWH 1RL2A 3E9HA 1JMCA 3I4NH 5IE8A 3S2DH 1OXTA 1Q1BA 4POGA 2NZOA 3I4OA 1YJ9A 2AWOA 3AEVA 1P16A 1AE2A 1YNXA 1WFQA 4P73A 4K0KL 4JI0L 4MTNA 4A3LG 4JV5Q 1XMQQ 3CQZH 4B3ML 4O2DA 4P75A 4GOPC 3J80i 2VY3A 4NXNQ 4DV0Q 5C3EH 4POFA 1PH5A 5JJKA 2BA0A 5E7NA 1JT8A 4IO9A 4P71A 4R4IA 1SFOH 1LYLA 4JI8Q 5GROA 2ZTDA 3TS2A 3CF5A 1IBLL 2ATWA 1XPUA 3UDXA 5EAYA 3CPFA 5J3BA 5ELOA 4X66Q 4TVAB 2R7DA 3ERSX 3CXCA 4IPCA 3GO5A 3CMAA 1PH8A 1K9MC 4WJ4A 1OTCA 4A3FH 3RZOH 4LF4Q 4YWMA 3KJOA 4GLXA 4A3DH 1VQKA 2K5HA 4B3RL 2HIXA 1YEZA 3W1BA 4L5SA 2WP8J 4B3MQ 3LGJA 2GVAA 4JOIC 1TWCH 5M5XH 2VUMG 1XPOA 2A19A 4OO1I 3PGZA 1Y1VG 4JI6L 1XNRL 5IYDH 1Q7YC 4A93G 3FHWA 2OQ0A 2MO0A 1E22A 3UE0A 2VQEQ 2JA6H 2OTJA 4LWCA 5FJ8G 2UXDQ 4A3CH 4GN3B 3CMEA 1XPRA 4GOPB 2PQAA 1K3RA 3DM3A 1YZ6A 3W5OA 4L5TA 5IP9G 4A3MG 1QUQB 4DV3Q 4BY7H 4DPGA 2IY5B 2DGYA 1Y1WH 4JI1Q 4GOPA 2PI2A 2QA4A 3GTQH 2N49A 1QUQA 3I56A 2UXBQ 4PZ7A 3H15A 4LF8L 4B3RQ 3HFZB 4LFAL 1TWHH 3RZDH 2K14A 3DLLA 1KC8C 4LF9L 1PYSB 3UDFA 1N9WA 2RHSB 1Q82C 4OX9L 3M4PA 1XNRQ 2F4VL 4IFDI 1X54A 4GLVB 1TWAH 1HNXQ 2XTIA 2R93H 2R7ZH 3J80c 4A3JG 1EQQA 1X9NA 1Z47A 5IP7H 1PH6A 3HKZG 4YCVA 1K8GA 1N36L 1GM5A 1HNWQ 4A3EH 3G71A 4DV5L 2JA8H 4IJHA 3AYHB 3A5UA 1VS0A 2K4KA 3T1YL 4ALPA 4LFCL 3RLFA 1VQDA 3TRZA 1PH3A 3UDIA 2YTXA 4A3FG 4LF8Q 3GTPH 2E2IH 2NVXH 2I5HA 3F2DA 4A3DG 2GN5A 3BZCA 1UWVA 4IPDA 2L15A 4A3IH 4HIKA 1X3EA 4OX9Q 1YHAA 4X64Q 2F4VQ 3GTOH 4DR1Q 1IL2A 2IX0A 3S1QH 1TWFH 2B63H 1X65A 2K5VA 3GTMH 5GAEC 4YY3L 1BVSA 4C3JH 1ASYA 2E2JH 2D0PA 1OXXK 1H95A 2JA6G 1N36Q 2KHJA 4A3CG 1YI2A 3M4OH 1TWGH 1I94Q 5LMUL 3I55A 3T1YQ 4OO1G 1KQSA 2K5NA 3J81j 2UUCQ 4YCWA 2V1CC 1Y1WG 3S16H 3KDFB 3EBEA 4DV6L 1YHQA 2VQFQ 4OONA 2N8NA 1FVIA 2Q2IA 3I2ZA 1Q86C 2HT1A 3I4MH 3KDFA 2VW9A 1PA6A 3S1RH 2HQLA 4A3GH 3GD7A 3G4SA 1QZGA 1E3PA 5HY6A 2H5XA 1C7YA 1YHBA 2CFMA 1VQJA 1N33Q 4QQBX 3M85A 4L5QA 2K52A 4YY3Q 2BH2A 4P72A 2F52A 4JBMA 1WCMH 4R4CA 2R93G 4DR6Q 4DV1L 5BR8Q 5LMNL 5IP7G 2RHQB 5C44H 5LMUQ 1PH7A 1JJ2A 2JA5H 3CD6A 1VCIA 2UXCQ 1YVCA 3KOJA 4B3SQ 5C0XJ 4FDBA 2ZJPA 1OXVA 1DGSA 2IHFA 2WB1E 3CW2C 5IWAL 4DV6Q 4HJ5A 1WYDA 2B29A 1KRTA 2K75A 1VQBA 4X6AH 4LNQA 2WAQE 2OCEA 3PUZA 2N3SA 4BBSH 1A62A 3NENA 1LUZA 3BJUA 3OW2A 3H3VH 4R4QA 3K0XA 2KENA 1W2BA 1YIJA 1JB7A 2AHOB 3NBHB 4A3BG 2NVYH 2PI2E 2Z0SA 2B63G 2WAQG 4IFDJ 1PH1A 1PH4A 2NN6I 3K80C 3S15H 2UUAQ 5M3MH 4MZ9A 4DUZL 3F2CA 3NEMA 1VQMA 1P8LA 1J6QA 1PH9A 2E5LL 4DV7Q 2WFWA 1N32Q 1J5EL 1FJGQ 3STBD 3H0GG 2ZTCA 4PMWA 4DR5L 4JI4Q 2UU9L 1B8AA 4XIGS 1KAWA 3IRBA 2OWOA 3ER0A 3F1ZA 3M3YH 4BBRH 1C0AA 1BBWA 3CCVA 1UE1A 1SRUA 1MIUA 1XJVA 4K0KQ 4JI0Q 5JEAG 4JI2L 3CCLA 3SGIA 1YJNA 2ZTEA 3RLOA 5LMNW 4A3GG 3PO2H 3PUYA 4DAYB 1VQGA 1OXUA 4XTCS 3WWVA 4JYAL 3AFPA 4OWXB 1U5KA 4DUZQ 4DR2L 1WCMG 2E8GA 1LM0A 2PQAB 1S40A 3KLWA 2BA1A 2E5LQ 1J5EQ 1IBLQ 1X56A 1X55A 1KHIA 3PV0A 1Q12A 4QL5A 5C0XI 5AJ3L 4DR5Q 2UU9Q 3HOXH 5JEAJ 1SROA 3K8AA 4LF5L 2ASBA 2R92H 3HOWG 2UUBL 4APVA 2QEXA 3I4NG 4DR4L 1YBYA 2VL6A 4IPGA 1BKBA 2PMZE 2Y0SE 4JG2A 1X6OA 4KHPL 2B3GA 1IBKL 1X3FA 3KF6B 2MQHA 2BH8A 4LW1A 4OXPA 3PF5A 4BBSG 3U50C 4DR7L 1PH2A 4DKAC 1HNZL 2EQSA 5C4XH 4JI6Q 4UP8A 3KF6A 4A76A 4GKKL 4GLAC 1FL0A 3TQYA 3HOVH 2Y0SG 3RLNA 2KCMA 1XTDA 5C3EG 3KFUA 3NELA 2D0OA 4JI5L 5M3MG 4JI3L 1N34L 4DR1L 1T9HA 3GTLH 3GDEA 5AJ3Q 3M9BA 1M90C 1PYBA 2CWPA 1NJIC 2NZHA 4NXML 1G6PA 2I5LX 3PUVA 5M5WH 1QVGA 3ULJA 3U4ZA 4LF5Q 1VQIA 2Q2UA 3K7UC 4KLKA 3S17H 4Y7NH 3FP9A 4KI0A 1A0IA 2NN6G 4BBRG 4NB3A 1Q46A 4GKJL 1VQLA 4KHPQ 4LF6L 4IOCA 1S3OA 1K83H 4LFAQ 5IYCH 2AMCB 5IYBH 4WJ3M 4B3TL 4LF9Q 4IPHA 4AQYL 1HNZQ 4ME3A 5FLXc 3J7A5 2Q2HA 3HOZH 1CKMA 4DAMA 4GKKQ 1WI5A 3L0OA 3CAMA 2JEAI 4IOAA 5IYDG 2Z6KC 4DV4L 3M7NA 2GVBA 1R9TH 1UE7A 4QY7A 2JA7H 3GTGH 1LTLA 4DUYL 3I7FA 3OYYA 4NXMQ 3BU2A 4YHHL 3PIOA 2N78A 1FGUA 4DV5Q 4A4IA 1UE5A 2OQKA 3RN5A 3ULPA 4C3IH 1L1OA 4L5RC 5JJLA 3D31A 4GNXA 4LFCQ 1YJWA 4BY7G 4MNOA 1A8VA 2R92G 1VQ6A 2PNHA 4NPSA 3HOUH 4LF7L 3OTOL 1WJJA 4R1JA 1HR0L 2QGQA 4AQYQ 4JBKA 1EWIA 4PG3A 3PO3H 2F3IA 5C0XG 4YWKA 1XNQL 3D0FA 2D62A 1KIXA 3CCRA 1E7ZA 1EIFA 2HIVA 3RN2A 5C4XG 4DV4Q 3MXNB 4RG1A 3ZJYC 1AH9A 3HOVG 2EIFA 4DNIA 1UEBA 3CC7A 2RF4A 2DUDA 3VDYA 2R7ZG 1I5FA 1G291 4YHHQ 1XMOL 1N32L 3AQQA 3UE1A 1VQ7A 2A8VA 1A63A 4A3EG 3ULLA 5M3FH 2JA8G 3H3VI 4GN4B 4JC0A 4IFDG 2CWAA 4HIMA 1KXLA 3CCSA 3OTOQ 1NTGA 1EUJA 2EXDA 2Z6KA 1HR0Q 1HZCA 2R6GA 1K73C 1JJCB 3A74A 1Y14B 5IYBG 4BXXH 2VUMH 1EOVA 3CCQA 4A3IG 2KHIA 3GTKH 2WB1G 4NXNL 4DV0L 4X62L 5H1SE 2I0QA 2R7FA 4UPAA 5FJ8H 3KF8B 4DV1Q 1PVOA 4TQUS 1SLJA 1PFSA 4QIWE 5LMNQ 2ZJQA 5GAHC 1O7IA 4A3MH 5JJIA 4PZ8A 1HR0W 4HJ9A 3TS0A 3U58A 4YCUA 1E1TA 1OXSC 1RIPA 1TXYA 1Z9FA 2CKZB 4Y52H 1D8LA 1NMFA 2E2HH 5GAGC 5IWAQ 3HOYH 1NY4A 1VQHA 3Q8DA 4LF4L 3K81C 3RNUA 3HOUG 3ICEA 1V43A 3G6EA 3M4QA 3PO3G 1G51A 1VQNA 3I4MG 1I6HH 3F8TA 2VNUD 4QJFA 3J81i 3G48A 1SE8A 1SR3A 1X3GA 3B6YA 2ID0A 4X62Q 4HJ7A 5IY0A 4C2MH 4A3JH 2VZAA 4EX5A 2VQEL 3HKSA 1EYGA 2UXDL 3GTJH 3A5ZB 1VQPA 3S2HH 2JA5G 2JQOA 1VQCA 5C44G 3UDGA 1N8RC 4DV3L 4BA2I 4A75A 1V9PA 1SMXA 2K50A 5M3FG 1HH2P 1CKNB 1VQOA 1Q81C 4J15A 4JI1L 4DK3C 1PHJA 1U0LA 3BZKA 3PCOB 3L2PA 5FLMH 3CCJA 4BY1H 4A3KH 1IBML 3S1MH 2UXBL 1CKNA 3T1HL 5K36G 2VS1A 1QVFA 4JBWA 1S72A 2JE6I 4BXXG 3S24A 4JI2Q 5M5YH 1L1OC 2AKWB 4UP7A 1D7QA 4GNXC 1KRSA 4O0AA 1ASZA 2YTVA 4HIOA 1BBUA 1V1QA 2YV5A 1K8AC 4JYAQ 1HNXL 1NMGA 4DR2Q 4PZ6A 2KBNA 1MJEA 2MFIA 1IZ6A 4QGUA 1Q8KA 1GD7A 3MEFA 1PV4A 2KCTA 1HNWL 2ZM6L 1MKHA 4JBJA 4LUZA 4JCVE 1HZ9A 1MJCA 3A0JA 4OWWB 2UUBQ 1IBMQ 3U4VA 3HOYG 1NBWA 5DLQE 4DR3L 4DR4Q 3T1HQ 2HHHL 5IT9c 1HZBA 1IBKQ 5ELNA 3CCEA 3KJPA 4C3HH 3JAMi 1KD1C 3PUXA 4DR7Q 4X64L 3HKZE 4BA1I 2YTYA 1CSPA 1E1OA 3STBC 4AH6A 2ES2A 4UP9A 4AYBE 4GN5A 2FXQA 3PO2G 1K0RA 3E9IA 3AFQA 2MO1A 3J81c 2AWNA 4JI5Q 4JI3Q 4GS3A 1N34Q 1IYJB 1VQEA 4JI7L 1W3SA 4LFBQ 1NE3A
chains in the Genus database with same CATH superfamily
1HZAA 3SR1A 2ZM6Q 4JOIA 3S14H 1SE4A 3R8BA 2JJQA 1VQ8A 2HHHQ 2XWBB 3I8ZA 3T53B 3J7AF 3NHHA 1EQRA 1VQ4A 3SVMA 5C6AA 3CCMA 4UDUC 1LTAD 1N33L 2IHEA 1PYWD 1CSQA 2R61A 2D9UA 4C2MB 2KA7A 3NP8A 2ENBA 3RUZA 1AE3A 3TBIB 5BR8L 4DUYQ 1VQFA 3RR5A 2D5DA 3HKZB 4WJWA 1CUKA 2LXJA 2WKCA 1EY5A 3HOXB 5C5MA 1TS3A 5CC4A 1U4LA 4NMZA 2EJGC 3K5LA 4LF7Q 4DXFA 4A3KB 1EIYB 4YWLA 2CCZA 1JQYD 1SNDA 1TY2A 4JV5L 4OWTB 1JJGA 1CM9A 4A93H 5J1ZA 1DOKA 1GKHA 3BZDB 4B9XA 1M1KC 3PF4A 4KHZA 3E5SA 3EIVA 4DV7L 4V190 1N32Q 2NVQH 1RTOA 2CHBD 3K59A 4LFBQ 4X65Q 1Q8IA 4HSVA 4K14A 4HJAA 3GTLB 1SYBA 3HOWH 4DV2Q 1B53A 3Q22A 4HR7B 4POGA 1CZGA 2DN8A 1PXUA 3PIP3 2WIIB 1P16A 1YNXA 2B2WC 2HUGA 4MTNA 3QO2A 3TZDA 3MXGA 1S5CD 4EQNA 4J1MA 5ELEA 3HOZB 3TN2A 5JJKA 2VB2X 4QB4A 4R4IA 1SFOH 1LYLA 2LY7A 1KABA 1HTLD 2ZTDA 5GROA 1IBLL 2JA7B 2ATWA 4OHJA 3CPFA 5ELOA 3ERSX 3GO5A 1K9MC 1EY0A 3FKIB 3K57A 3IKJA 2EOTA 4YWMA 4L6TB 2K5HA 3OOCA 4B3RL 2HIXA 4ZUIA 4S3SA 4B3MQ 4JOIC 1AZQA 4OO1I 1HCZA 2SNSA 4A93G 2JN4A 3CKIB 4DAYA 1E22A 2PZUA 4OELB 3UE0A 2VQEQ 2YU9B 4KJNA 4A3CH 2F0OA 4UHVA 1K3RA 2X6GA 1EFID 3W5OA 4RGNA 2QDLA 4JI1Q 4GOPA 1U4RA 4PZ7A 4EQPA 4LF8L 5C0XH 4ZAIA 1ENCA 1Q82C 4OX9L 2F4VL 1ESRA 3ITPA 1Y1VB 1HNXQ 3LNNA 4O1NA 3J80c 2EYMA 1F9PA 3HKZG 1K8GA 1KLGD 2JA8H 3C1FA 3AYHB 3A5UA 2XNAC 2XVSA 3T1YL 1C4QA 5TSSA 3UDIA 4N8FA 4QUCA 1JOKA 3K5MA 2F0UA 2XWJB 1DOLA 5JOBA 5EPKA 2IX0A 5CBAE 1B2TA 2A68D 4C3JH 2D0PA 1ET6A 4RHRA 4A3CG 1YI2A 1UNSA 1STYA 5KRUA 2ZXOA 3I55A 3S2HB 1B1ZA 1EWCA 5KNDA 1KQSA 2K5NA 1STAA 1NAPA 3EBEA 4DV6L 1UEAB 2VQFQ 3RZOB 4OONA 2N8NA 1Q86C 4A3DB 4XT1B 3I4MH 3KDFA 1PA6A 3D4RA 2RCFA 2RQXA 3GD7A 4CKBA 4RCOA 1TWCB 2H5XA 4QQBX 3OMCA 1TT2A 2F52A 4DR6Q 4DV1L 2XSCA 3D8GA 1T5EA 5J22A 2RHQB 3CD6A 3K6OA 1YVCA 2ZJPA 1OXVA 3IL8A 2WB1E 4CJ0B 1Y1WB 2OXPA 3GTQB 1WYDA 2B29A 5DNFA 4X6AH 2NTSA 2Z1CA 3G6JB 1F9RA 5C4HA 1LUZA 2XRSD 2EPBA 2AHOB 1RTNA 3OHXC 5KYIA 1PH1A 2NN6I 1A3TA 4C3JG 4DUZL 5KGUA 3NEMA 1VQMA 1P8LA 2WFWA 3VA7A 2K6AA 2IJ0A 1DJRD 4PMWA 4PMCA 4XIGS 3WDNA 2A68C 3IRBA 4XDXA 2OWOA 2CVRA 4WFN3 3H09A 3M3YH 3I70A 1BBWA 2F3VA 1MIUA 5DM63 3GTPB 2E2IB 3PQIA 1BQQT 1MGSA 4EVOA 4JI2L 3SGIA 3VYUA 2WB1B 4DAYB 1VQGA 4DF7A 1TWFB 3DHQA 4DNTB 1E2ZA 1LM0A 2DJGC 1J5EQ 4V0BA 1CTMA 1Q12A 5C0XI 1TWGB 4F7XA 5I9PA 1IYVA 2KQ3A 3H0GB 4LF5L 2UUBL 3S16B 4FO2A 3I4NG 4DR4L 3BYTB 4R8NA 2PMZE 1KDCA 3W2DA 3DWAA 4OXPA 4MHEA 5I6WA 1PH2A 1HNZL 2EQSA 3KF6A 3BG3A 1FL0A 3BS1A 1XTDA 1EWHA 4DR1L 2N55A 3GDEA 2CWPA 4NW2A 2ZT9C 1Y8NB 1VQIA 2KCCA 3MXUA 2J7ZA 4OL7A 5IGGA 2Q2UA 3S17H 3FP9A 4ZQ3A 1A0IA 1EY9A 4IOCA 3QIAA 4AQYL 4IUUA 3J7A5 1I4HA 1CKMA 4GKKQ 2L12A 3CAMA 2JEAI 4MN3A 3NK9A 2NVYB 2PMZB 1F2ZA 1XXGA 1R9TH 4QY7A 5M3MB 4DUYL 4RWSC 4NXMQ 3BU2A 2I07B 1FGUA 3ULPA 3D4WA 4CJ1B 1K8MA 1L1OA 3CRKC 4HAEA 3D31A 3BDLA 1YJWA 1G6ZA 2PNHA 4I65A 4NPSA 4BBRB 4LF7L 1SJHD 3C46A 4JBKA 1FNVA 4DA2A 4PG3A 3PO3H 5CV8A 1B44D 3RN2A 3ZJYC 2EE1A 2EZVA 1UEBA 3EQLC 3L9AX 4DU9A 2DUDA 1W6JA 1IW7C 1N32L 1HFGA 1VQ7A 4C56C 3NWTA 5JJZA 2EY1A 5M3FH 4GN4B 2CWAA 5JPMC 2R92B 2EXDA 2Z6KA 3OIQA 1HZCA 1MSHA 2NBFA 4OGQC 1Y14B 1WTXA 3U9OA 2VUMH 1EOVA 1B4OA 2WB1G 4NDXA 2EXZA 4KJOA 1PVOA 3BDOA 1K3BC 3ZYYX 4A3MH 4L8JA 3R2IA 1HR0W 3TS0A 1E1TA 1OXSC 1RIPA 1TXYA 4K2KA 3J81E 5M5WB 5CYUA 4Y52H 2E2HH 4B9WA 1FGBD 1H9SB 2KCNA 4Y7NB 1BCPF 3I73A 2NVXB 4IALA 3PO3G 1I6HH 2L0CA 4A3IB 2HDMA 3G48A 1EQVA 3J81i 1XTCD 5LL6X 4PNYA 3S1QB 2F0WA 2EYFA 2VZAA 3QB3A 3G7LA 2VQEL 3HKSA 4LAAA 5F2DA 4BA2I 5M3FG 1Q81C 4CBVA 4JI1L 3GQBA 3PCOB 1TU2B 3SE0A 4E6IA 3H3VC 4DK0A 4BY1H 3S1MH 1TR5A 1AN8A 2K5WA 1L1OC 2AKWB 3MTSA 1KRSA 2K01A 1SMYC 4HIOA 2YV5A 1HNXL 4KD3A 1MJEA 2MFIA 5K5PA 1BOSA 1BXTA 2NB0A 3JAME 5J39A 2JA5B 5C44B 4JBJA 1HZ9A 1LTSD 3KBXA 1MJCA 4XXEA 4OWWB 2K03A 3HS0C 4FP5D 2P5ZX 4C3HH 3JAMi 3PUXA 3T56B 4IQZA 3STBC 1CSPA 1U9RA 1YNND 3GTKB 1FD7D 3E9IA 2MO1A 2RA4A 4GS3A 2HQEA 1PHJA 1W3SA 1L1OB 3DMUA 4R9WA 4UY8C 3JC66 1EY6A 1NR4A 4CJ2C 2NVTH 5GQOA 4DK6C 2OTLA 2RCNA 2VQFL 2C35B 1NR2A 4BY1G 1EZ8A 4DXGA 4HIDA 4A3LH 3SHLA 2JK8A 1A2UA 1I3QH 3NQIA 4TSSA 1E2WA 2WACA 3H6MA 4HJ8A 5JPNC 2EYOA 4DR6L 4JI7Q 5JVH3 1QJOA 3E0EA 1JCKB 3GTJB 4N9TA 1D5MC 4QMGA 2XN9C 3CC4A 5C4JH 2JA9A 5T1GA 1UE6A 4IJLA 1BCPC 1O80A 2I5MX 1WD1A 3CC2A 4C3HG 1VQ9A 3PSIA 4OEMB 1XNQQ 3PUWA 5M5YB 1XMQL 1LTBD 2LXKA 3S9WA 3K7AH 3TREA 1WTWA 2LKVA 1Q1EA 4JI8L 3SK5A 2IT1A 1B7YB 3VR4A 1EFWA 1PTOD 1ILPA 5IP9H 1YNJD 1QVCA 5A35A 2IX1A 1U4PA 4G7HC 1RL2A 4C3IG 4ULLA 1NSNS 3FPUB 1L0XB 4J6HA 5IE8A 3J7AV 3S2DH 1OXTA 4QF4A 2NZOA 1YJ9A 4RHSA 1AE2A 4P73A 2K33A 1K0SA 1A15A 5AFWA 5CV6A 4A3LG 1QG7A 2A6HC 4P75A 2NYZD 1DYQA 1BCPB 1ICWA 4NXNQ 4DV0Q 1S5BD 3UI2A 2M9VA 3VR3A 2QKIC 4IO9A 1UUPA 4M1UB 3CF5A 2QILA 1XPUA 3DWQA 3S15B 2SNMA 4X66Q 1TS2A 3ND8A 4IPCA 3NUCA 3S14B 1OTCA 1QWYA 4A3FH 5KIXA 4LF4Q 4JPBW 1VQKA 1D1IA 3MFYA 3VYRA 3GV6A 1XPOA 3PGZA 1XNRL 3AU7A 3U9SA 2KEEA 5EKLA 1IYUA 1Q90A 4LWCA 5FJ8G 3SK4A 3CMEA 2WKDA 5I6YA 1K8OA 3DM3A 2B2WA 5IGBA 5IP9G 3IFDA 1QUQB 4DV3Q 4BY7H 4KY6A 2DGYA 1EYAA 3H91A 3H94A 2N49A 5EGTA 5EKKA 3I56A 2UXBQ 4DNRB 1TWHH 1Y8OB 3RZDH 1Q3LA 3NSWA 4CDCC 3M4PA 3ERQA 3T4AC 4IFDI 2M00A 1TWAH 3MVVA 4A93B 2R93H 2R7ZH 2E75C 4A3JG 1Z47A 3VYSA 1BF4A 1Y69U 4YCVA 1N36L 4A3EH 2K05A 1MHWC 4HCSA 2K4KA 4ALPA 1FYCA 3TRZA 1DZ1A 4OIKA 4A3FG 3P75A 1V1PA 5JVG3 2I5HA 3F2DA 4KV6A 1ZEQX 1HUMA 1X3EA 5ELDA 4X64Q 3GTOH 3HG9A 1SYCA 2B63H 2MHVA 1X65A 3GTMH 3N52A 1ASYA 4K5VA 2E2JH 1PFBA 1SFOB 3I90A 2A6EC 3X3NA 5CBEE 2KHJA 2F4IA 1BO0A 4B08A 1I94Q 4OO1G 2C9OA 2UUCQ 2NZ1D 2BE5C 2V1CC 2L4NA 4DFAA 3E0JA 3Q0AA 5JEAH 3TP5A 3S1RH 2HQLA 2FINB 2AUJD 1QZGA 1YHBA 2CFMA 2M2LA 4L5QA 4YY3Q 4P72A 4JBMA 2EYHA 2R93G 2HD3A 2K5DA 4HTHA 5LMUQ 3C3LA 2UXCQ 1S5DD 3KOJA 5C0XJ 1DGSA 1LLRD 4KKUA 4HJ5A 1U4MA 2A74C 4U673 1B9NA 1SE2A 5COYA 2OCEA 3PUZA 1AP0A 3OW2A 4R4QA 3K0XA 3T16A 3TP8A 4XYOA 4RKLA 5IODA 2Z0SA 1JOOA 3TP6A 2B63G 2WAQG 3Q24A 1PTOH 5E4XA 4ABNA 3F2CA 2L11A 2E5LL 1J8IA 2L55A 3KF8A 1FJGQ 2FMCA 1HTPA 2JA8B 4DR5L 4JI4Q 5IT9L 2EYPA 1DONA 3KUPA 2NN6H 2EY5A 4K0KQ 4JI0Q 5JEAG 2OT2A 4C1NK 3CCLA 5E3FA 3RLOA 5LMNW 3PUYA 3N6RA 1OXUA 4XTCS 1SYGA 2JXMB 3AFPA 2F0NA 3K5OA 4OWXB 3WWVA 2E8GA 1B3AA 4C3JB 3KLWA 1X55A 1KHIA 3PV0A 5AJ3L 4QL5A 2LMCB 2UU9Q 3HOXH 1LTTD 1Y8PB 3K8AA 3HOWG 4APVA 2LFNA 2AQ2B 1HQRD 1WTHA 4KHPL 2JYOA 2MQHA 3I4MB 1NCVA 3U50C 4QUFA 2F0KA 4JI6Q 4A76A 3HOVH 2VXWA 5EKIA 1LT5D 3P1HA 3NELA 1SYEA 2A73B 3GTLH 2NZHA 5T1IA 2KJXA 4KKSA 3PUVA 4H13C 1D1KA 2CW0D 2Q8RE 3ULJA 1V1PB 2NN6G 4RH6A 1SJED 3I4NB 1S3OA 1SNQA 1K83H 5IYCH 4WJ3M 1CI3M 3HOZH 2EVBA 3EFXD 2V4DA 4TKOB 3Q6SA 1WI5A 3M7NA 2JA7H 3GTGH 3TDQA 2B2VA 3FVQA 3X3MA 1AFPA 3GP7A 5JJLA 4LFCQ 2F0FA 1A3UA 4MNOA 1A8VA 1VQ6A 4KN7C 3M3YB 1WJJA 5ISRA 1KNAA 1STNA 2QGQA 3PIO3 2JSOA 1EWIA 3M7GA 1HR0L 2F3IA 5C0XG 1XNQL 3D0FA 1KIXA 1E7ZA 2PCFB 4DV4Q 3MXNB 3HOVG 2E2DC 3CC7A 2RF4A 1KTKA 1QILA 1I5FA 2E74C 4YHHQ 3AQQA 5CR3A 3UE1A 1STBA 3ULLA 3EJIA 2A5HA 2JA8G 4RA8A 2R3ZA 4JC0A 4HIMA 4UAIA 4U68A 3OTOQ 5FKAC 5K36H 2DY8A 2JP1A 2R6GA 1K73C 1JJCB 3A74A 3BVZA 1D5XC 3L3OC 4NXNL 4DV0L 5H1SE 5EJWA 2I0QA 1PFMA 4UPAA 3KF8B 1A2TA 4RCNA 5LMNQ 5GAHC 1O7IA 4HJ9A 1ENFA 3U58A 2DY7A 1Z9FA 3A8JE 2F3WA 5IWAQ 3HOYH 3S17B 4LF4L 3ICEA 1V43A 1H9SA 3TZUA 3I4MG 4QJFA 1SE8A 2ID0A 4X62Q 2F1MA 1DCZA 1R9TB 3QWNA 3E6ZX 3URYA 1SSOA 3S2HH 1O7YA 2EY6A 2JQOA 3UDGA 3DUZA 4DV3L 1V9PA 1VQOA 2IL8A 1MI2A 1CKNB 4XT3B 5D3DA 3L2PA 5FLMH 2A69D 3CCJA 1IBML 2UXBL 2B2VC 4N9PA 5K36G 4JBWA 4IUPA 1S72A 4CHTB 2K1BA 1EQTA 3PO3B 3A8IE 4UP7A 1R4QB 4O0AA 1ASZA 5A2QE 1K8AC 1V1QA 2TMPA 4DR2Q 3A56A 4PZ6A 5EBDA 4QGUA 1Q8KA 1JE4A 1PV4A 1CA6A 2Q8IB 1QB5D 2ZM6L 4LUZA 2IPKD 5M3FB 3U4VA 3HOYG 1EIGA 3T1HQ 2HHHL 1E0BA 5IT9c 1HZBA 2AUKA 3CCEA 5IOCA 4DR7Q 4X64L 4CKCA 2WINB 2YTYA 3NQTA 2ES2A 1WTRA 4IUVA 4GN5A 4FF3A 1K0RA 1EZ6A 3GV3A 2AWNA 2EY2A 1N34Q 1VQEA 3S1NH 3P20A 1I94L 4AYBG 3MEHA 4A3MB 3WOEA 3NWSA 2A1AA 1L0WA 2UUCL 1TQOA 3BVGA 3FRPB 2YYZA 4DR3Q 2E2HB 2L1BA 1HA6A 1X3PA 3W1GA 4GKJQ 1C9OA 2XGTA 5FLMG 2ZJRA 1EYCA 1MSGA 1BR9A 1CKOA 4B3TQ 2QDBA 3CCUA 4G7ZC 2J0TD 1I6HB 5DEHA 1GO3E 4G57A 4I7AA 4A3BH 1IXRA 2L5TA 2F0HA 4R4OA 3CP0A 1WTQA 1WTPA 4R4TA 4RMFA 3F2BA 3K0YA 3CHBD 1LTID 1EU4A 5D65A 2F0VA 3H0GH 4LFBL 1GHJA 4X65L 2UXCL 4K8IA 1A3VA 1PMRA 4DV2L 3L7ZC 3QG1A 1GVPA 1RDPD 1QCBD 1I50H 4BY1B 1STEA 3CPWA 1QNKA 3EN2A 3AMUA 4K5WA 2CQOA 1VQ5A 5GADC 4H02A 3R3OA 4Q0FA 1FNUA 3PIPA 3KYHC 2ICIA 2ALYB 3A7LA 5KEEA 2MNAA 1XMOQ 4P2CB 1FJGL 1B50A 1TIID 1RHPA 3TEHB 4JI4L 3J80E 3E9HA 2F0SA 2AWOA 4ZUJA 4K0KL 2G9HD 4JI0L 1BNZA 4C3HB 5I9OA 4JV5Q 3CQZH 4B3ML 1EY4A 3J80i 4ILWA 2QF7A 5C3EH 1PH5A 2BA0A 1JT8A 4P71A 1AEXA 3K5NA 1WTOA 4O42A 3RD4A 2NWGA 3V2TA 4BS9A 2KECA 3UDXA 5C5LA 5EAYA 5J3BA 1JOQA 2B2UA 4TVAB 2R7DA 3CXCA 1PH8A 3M4YA 1T5XD 2IWHA 3NTKA 4HSPA 4C3IB 2NVTB 4NKLA 2WV6D 5FLXL 4K2LA 1W6KA 2F0TA 1JICA 2ICEC 1YEZA 3W1BA 4L5SA 2WP8J 1PRTD 2FFKB 5M5XH 3FEWX 2VUMG 5IYDH 4JI6L 1I3QB 1II3A 5BN4A 2OQ0A 2MO0A 3T51B 2JA6H 2OTJA 3MWYW 2UXDQ 4GN3B 4NP5A 1XPRA 4MIUA 1CHPD 2PQAA 2Z4HA 1M8AA 4L5TA 4A3MG 3F2UA 2F0QA 2K32A 5C4JB 1BBXC 2QA4A 3KK7A 1QUQA 3EROA 3SDZA 4B3RQ 3HFZB 2TSSA 2K14A 3DLLA 1PYSB 4KKTA 3UDFA 1N9WA 2N88A 1GOZA 3HRZC 3R2TA 4RGOS 3DM1A 4ID6A 1R4PB 1H9RA 3DEPA 4TRDA 4XQJA 1CK1A 1D6EC 1EQQA 3K7AB 4KHVA 2F0PA 1HPCA 1HNWQ 3G71A 1BDOA 3J7YW 2QW7A 4IFDH 1VS0A 1FR3A 1I4XA 4LFCL 1PH3A 3D6CA 2PNRC 4LF8Q 3S2DB 5G3LD 2NVXH 1HFNA 4IZ8A 4RFBA 3BDCA 4A3IH 2VB3X 4OX9Q 2F4VQ 1M4VA 1PTOF 1I4PA 3NE5B 1CHQD 5HURA 3HZXA 1IL2A 3S1QH 2K5VA 4PQXA 5C4ZA 5GAEC 1J9OA 1BVSA 3FPPA 4LMQD 1ZYRD 1OXXK 4A3JB 2JA6G 1DXMA 3MXPA 2K28A 4N8X1 3M4OH 3OSOA 4HMIA 3TP7A 3T1YQ 2E76C 4A3FB 1BUVT 1FVIA 2Q2IA 4IUTA 2HT1A 3BYYB 1SYDA 4J8QA 2VW9A 2B2UC 1V8QA 3V96A 3QOLA 4BWGB 4A3GH 3G4SA 1C7YA 1E3PA 5HY6A 1LABA 3D6WA 1VQJA 3M85A 2K52A 2BH2A 1WCMH 4R4CA 4IUNA 2FMMA 5JAVA 5DAUA 1I6VC 5LMNL 2KHSA 2JA5H 5C44H 1JJ2A 4FXGC 1VCIA 4B3SQ 1V1OA 4BY7B 4IUQA 1OO9B 1YNNC 2PZWA 2IHFA 4DV6Q 5IWAL 1SDFA 2Z4IA 2Z8LA 1O7ZA 1EEFD 1F9SA 1XX8A 2HCCA 3BVMA 2WAQE 4WORA 5CV9A 4LNQA 4BBSH 2N3SA 5IGDA 1TWHB 1A62A 3LX0A 3BJUA 3H3VH 2KENA 1F2YA 1I4GA 3NBHB 4XYQA 1PH4A 1TWAB 1G91A 3K80C 2R93B 2UUAQ 2R7ZB 1SNMA 1J6QA 5EPJA 1J5EL 3EA6A 2HCIA 2B2TC 3IAYA 1S4ZA 3VA5A 1B8AA 1XYIA 3ER0A 3F1ZA 1C0AA 2G9DA 4KK7A 3CCVA 1ZYRC 1GUOA 1L0YB 1XJVA 3J81L 2ZTEA 4A3GG 3PO2H 2F0EA 3GTOB 2RDFA 1MBYA 4RGMA 2B63B 2WAQB 1U5KA 4XQNA 5E4WC 4DUZQ 1WCMG 3SEBA 2B39A 4DR2L 2E2JB 2PQAB 3CRLC 3D3RA 1LV9A 5JEAJ 2F0LA 2ASBA 3CU7A 4Z9CB 1FNWA 2MUYA 4CGYB 1RODA 1YBYA 1I4QA 1BKBA 1SNCA 1LO5D 4BBSG 3PF5A 2BH8A 4LW1A 2CH4A 1PTOC 3S1RB 4DR7L 1ET9A 4DAPA 1YNJC 5C4XH 5I4DA 2KUMA 4GKKL 2PQEA 4GLAC 1C8CA 2H4OA 1D2BA 2Y0SG 2O5JC 5NUCA 3RLNA 3K58A 1IKMA 3D4DA 3KFUA 1N34L 4KTAA 1X3QA 4KY5A 3M9BA 1M90C 4NXML 3DXJC 1MD2D 1F2LA 2NVQB 1QVGA 3NXWA 3U4ZA 3QR8A 3DEOA 4LF5Q 1QE6A 3K7UC 4KLKA 2QEJC 3HOWB 4GKJL 2PPBC 5CMDA 1VQLA 4LFAQ 3JAML 2AMCB 4B3TL 4LF9Q 3PMFA 4ME3A 5FLXc 1HNZQ 5IIFA 4DAMA 4HEDA 3L0OA 3SXHA 2GVBA 4H7BA 1UE7A 1EU3A 1I4RA 1LTLA 1X32A 3I7FA 1PTOB 3OYYA 2N78A 3A55A 4DV5Q 1NUCA 4A4IA 2OQKA 1TS5A 3OPOA 4L5RC 4GNXA 3KLRA 4BY7G 1IKLA 3HOUH 4DN4M 4PV1C 1SE3A 1G2TA 4AQYQ 3A54A 5IGCA 2RKSA 3NTIA 4KY7A 2D62A 2PW7A 1EIFA 5C4XG 2X6LA 1AH9A 4KD4A 4ZRZA 4DNIA 2R7ZG 3MXNA 1XMOL 2A8VA 1A63A 4A3EG 3H3VI 2GA4B 1SBBB 1LT4D 1KXLA 3CCSA 1TKWB 1ENAA 2QCPX 3O13A 1HRJA 1IHZA 1S5FD 3RMHA 3HOVB 2R7FA 3KLSX 2X69A 1S5ED 4TQUS 1LT6D 1SLJA 2AQ3B 5C3WA 2ZJQA 4G4KA 5JJIA 5EBCA 1D8LA 3NTHA 1H9MA 1SYFA 2MPMA 1VQHA 3Q8DA 1WVLA 2B2YA 3K81C 3HOUG 4EGVA 5KNCA 2PZTA 3M4QA 1K83B 2KEDA 1G51A 1VQNA 2VNUD 1X3GA 1KAAA 4C2MH 4EX5A 3GTGB 2IW3A 5I2XA 1F2MA 3A5ZB 1VQPA 2UXDL 1QNUA 1XWEA 1ILQA 4FNFA 1K28A 1PFNA 4A75A 2K50A 4J15A 1U0LA 3BZKA 4A3KH 2Z9HA 3MAQA 1TS4A 1CKNA 1ZXTA 2FJ2A 3TMEA 1VMPA 2PW5A 1D7QA 4GNXC 1CFMA 1WTVA 3NPPA 1BBUA 4JYAQ 3R93A 4LJZC 3HP3A 1IZ6A 3MEFA 1ICFB 2KCTA 1HNWL 2O5IC 1MKHA 5FO8B 1GUGA 2O2LD 2F0IA 1IBKQ 4HMJA 2D2CC 1E2VA 3SK8A 1JORA 1ONLA 1E1OA 4CDDC 4UP9A 4AYBE 2FXQA 5CORA 1CZWA 3J81c 4JI5Q 4JI3Q 4FDBA 1IYJB 4JI7L 2Q2TA 1EY8A 4GNXB 1YITA 3I4LA 3FKIH 2XRQD 4CKEA 1E24A 3HOXG 4Q5VA 4X3SA 3HOYB 1L2FA 4A3KG 4LF6Q 1Z7TA 5KYLA 4ZLTF 5IGFA 4LUVA 3J7ZC 2F0MA 1VQAA 2B2YC 2YU9H 1LTGD 1HJPA 3I3CA 4FF2A 1WOCA 4AYBB 1B3QA 3IFTA 4B3SL 2BOSA 3OW7A 1PLFA 1O7LA 4LUOA 4X3KA 1GUWA 1QZHA 5BN5A 1B70B 2KOLA 1JE5A 4ZKCB 4CDFC 1GJXA 3WOFA 4XQQA 5IYCG 3T13A 3MC0B 4JVZA 3Q23A 1Y1VH 2EYLA 5HGQA 2CW0C 3JAMc 2F03A 3HOZG 1KL9A 4PMBA 1SN8A 4WRDA 2EDGA 1PDQA 1RF2D 4IURA 2UUAL 2RSNA 2JA7G 1KLUD 4RKBA 4AIMA 2LSSA 4P74A 3ONAB 4H44C 2JEBI 4EQ5A 4X66L 2MJ8A 3FKIG 3VYTA 4ZKBB 1JMCA 3I4NH 1Q1BA 3I4OA 3AEVA 1VMCA 1WFQA 3LWEA 4ZK9B 5FOBB 2PO4A 4I7ZC 1XMQQ 4O2DA 4FYDA 1DOMA 4GOPC 2VY3A 2J4XA 4POFA 5E7NA 5FLXE 3A8KE 4JI8Q 3TS2A 2NUCA 3S1NB 3EVQA 1EEID 3CMAA 4WJ4A 4MTKA 3RZOH 3KJOA 1EY7A 4GLXA 4A3DH 1Z6HA 1JR0D 1HUNA 2DJFC 2KVMA 1LACA 3LGJA 2GVAA 1TWCH 2A19A 2OEOA 1Y1VG 4A3BB 1Q7YC 3C1EA 3FHWA 4G7OC 1PZJD 2EYJA 4GOPB 1GUNA 5ELFA 1YZ6A 2IX3A 2DNEA 3FMCA 4DPGA 2IY5B 1Y1WH 3GTQH 2PI2A 5IGEA 3H15A 4HN7A 1IW7D 4LFAL 1I50B 1KC8C 1CA5A 4LF9L 2RHSB 1XNRQ 2VUMB 5KNBA 1X54A 4GLVB 2XTIA 4LK1C 2BDNA 4IN3A 1X9NA 5IP7H 1PH6A 1GM5A 2XIWA 4DV5L 4IJHA 2RDGA 2BCOA 3FDTA 3RLFA 1VQDA 1EL0A 2YTXA 5DM73 3V05A 3GTPH 2E2IH 4A3DG 2GN5A 3BZCA 1UWVA 4IPDA 4K5XA 2L15A 1PZKD 4HIKA 3MFGA 1GXDC 1YHAA 1SXTA 2RSOA 2LS01 4RGTA 3CQZB 4L63B 4K8JA 1TWFH 3VR2A 3OMGA 5C3EB 4YY3L 2A69C 1H95A 1N36Q 1TWGH 5LMUL 4JW0A 5BN3A 2DNCA 3J81j 5CV5A 5D14A 4YCWA 1Y1WG 3S16H 3KDFB 3I91A 4FVMA 2EJFC 1YHQA 1UAPA 4K6DA 5FO7B 3I2ZA 2K04A 3S1MB 3SK6A 1CQVA 5M5XB 1N33Q 5LHY1 5BR8Q 2JA6B 5IP7G 3MHBA 1PH7A 3E3XA 5ELCA 3QOJA 5ELBA 1SMYD 1TY0A 1PRTF 3CW2C 3OWEB 1KRTA 2K75A 1VQBA 4M8AA 1G8ZD 3NENA 4KMUC 1D5ZC 1W2BA 1YIJA 1JB7A 4ODGA 4A3BG 2NVYH 2PI2E 4HCEA 3C2PA 2ZXRA 4IFDJ 3S15H 1JB3A 2K5QA 4DK1A 1GUSA 3MZ5A 4MZ9A 5M3MH 3NBHA 1PH9A 4DV7Q 3QJYA 3STBD 3H0GG 2ZTCA 2UU9L 2RDHA 1KAWA 4BBRH 3I72A 1UE1A 1SRUA 1CT1D 2AQ1B 2G5DA 3A7AB 3DWPA 1YJNA 4QCLA 4DAVA 4JYAL 1VF5C 1S40A 2E5LQ 1B9MA 2BA1A 1IBLQ 5G3LF 1X56A 5EPLA 4FXDA 4DGZA 3M4OB 1JC7A 1RJTA 4CDEC 1SNPA 4DR5Q 3AB9A 1SROA 1NNXA 2CQAA 1VF7A 2R92H 1JWUD 2NTTA 2QEXA 2VL6A 4IPGA 4JG2A 2Y0SE 5C3XA 1X6OA 2B3GA 1IBKL 1X3FA 3KF6B 1CQFA 1F77A 4DKAC 4A3GB 2BDOA 2B2TA 1HHVA 4UP8A 2F0GA 3TQYA 5LL6S 1BCPD 1G2SA 2KCMA 4RAUC 5C3EG 1WCMB 2D0OA 4JI5L 5M3MG 4JI3L 5CV7A 1T9HA 5AJ3Q 1G6PA 1PYBA 1NJIC 1AW7A 2I5LX 5M5WH 2CH4W 2C5CA 5A2QL 2EJMA 2K7VA 4Y7NH 2Z6BA 4KI0A 4BBRG 4NB3A 1Q46A 4KHPQ 1JWMD 4LF6L 5IYBH 4IPHA 4BBSB 2Q2HA 2RBMA 1EIHA 4IOAA 5IYDG 1ZKOA 2Y0SB 2Z6KC 3KBGA 4DV4L 1KDBA 3HGBA 1ML0D 4YHHL 3VR6A 3PIOA 2A6HD 1UE5A 3RN5A 4C3IH 1PRTC 3KLSA 4R8IA 3OIPA 2R92G 2ZXPA 1STGA 4H0LC 1H9JA 2HDLA 3OTOL 2B8GA 4R1JA 3MA2B 3OWFA 1ESFA 4YWKA 2H1EA 1EOTA 3CCRA 4FF4A 1C48A 2HIVA 3PO2B 3W3AA 4RG1A 2I46A 2EIFA 2F0DA 1RKNA 1JWSD 3VDYA 5D3IB 1G291 2SDFA 1SAPA 4F87A 5HGTA 4IFDG 4FXKC 2L9HA 1DM0B 5FK9C 1TVXA 1NTGA 1EUJA 2PYKA 2SEBD 1HR0Q 2SOBA 4KN4C 4BXXH 5IYBG 1WD0A 1PRTB 3CCQA 4A3IG 1HA5A 5FO9B 2KHIA 3RZDB 5EQ0A 3VR5A 3GTKH 5I2YA 5C4XB 4X62L 5IT9E 1IL8A 1PZID 1AZPA 5FJ8H 4DV1Q 4YIJA 1PFSA 2O4XA 4QIWE 1RD9D 1A6XA 3TSSA 4ME5A 4PZ8A 4YCUA 4A3EB 2CKZB 1GHKA 1NMFA 5GAGC 2Q8TA 1NY4A 3RNUA 1KNEA 2OF1A 1KDAA 1RCVD 3G6EA 1HXYD 4K6LA 4OIJA 2FHTA 2MP1A 4F88A 3F8TA 1GUTA 3J80L 1SR3A 3B6YA 4HJ7A 5IY0A 4A3JH 1H9KA 4F8MA 2MGSA 3GTMB 1EYGA 3GTJH 1F9QA 4X3TA 1DD2A 2JA5G 3ND9A 1VQCA 1SEBD 5C44G 1N8RC 1QOHA 1SMXA 1HH2P 3HEJA 4DK3C 4X3UA 5CV4A 4QIWB 4EQOA 3HOUB 2A6ED 3T1HL 2VS1A 1QVFA 2JE6I 4BXXG 3S24A 4JI2Q 5M5YH 1SNOA 4JK1C 5L37A 2BE5D 2YTVA 3NBIA 1NMGA 4FF1A 2KBNA 4GZYC 1EYDA 3P7JA 5E1FA 1GD7A 1LTRD 4OO1H 1STHA 4JCVE 4ZYSA 5CGKA 3A0JA 4C1NI 1VDZA 2UUBQ 4ZCKA 1IBMQ 1NBWA 5DLQE 4DR3L 4DR4Q 2RVLA 5ELNA 3KJPA 1KD1C 2F0JA 1HQMC 3HKZE 4BA1I 4AH6A 3PO2G 3AFQA 1LT3D 5M9OA 2B8FA 4DR1Q 3LWUA 1O78A 1NE3A
chains in the Genus database with same CATH topology
1L1OB 1HZAA 2Q2TA 4GNXB 4AYBG 2ZM6Q 1YITA 1I94L 4UY8C 3JC66 4JOIA 3S14H 3FKIH 2A1AA 1L0WA 2UUCL 2NVTH 1E24A 3HOXG 5GQOA 4DK6C 2OTLA 2JJQA 2RCNA 2YYZA 4DR3Q 1VQ8A 3W1GA 2HHHQ 4GKJQ 1C9OA 1L2FA 2XGTA 2C35B 4BY1G 5FLMG 2VQFL 2ZJRA 4A3KG 1CKOA 4LF6Q 1EQRA 4B3TQ 1VQ4A 4HIDA 4A3LH 3CCUA 2JK8A 3CCMA 4LUVA 3J7ZC 4A3BH 1GO3E 1I3QH 1N33L 1IXRA 1VQAA 2IHEA 4R4OA 3CP0A 1CSQA 4HJ8A 2YU9H 4DR6L 4R4TA 1AE3A 4RMFA 5BR8L 3F2BA 1VQFA 4DUYQ 4JI7Q 3RR5A 1HJPA 3E0EA 3S1NH 1CUKA 2LXJA 3H0GH 1WOCA 4LFBL 4X65L 3CC4A 2UXCL 4B3SL 5C4JH 2JA9A 4DV2L 4LUOA 1UE6A 3L7ZC 1GVPA 4IJLA 1QZHA 4LF7Q 1B70B 1JE5A 1I50H 2I5MX 3CPWA 1EIYB 3CC2A 4YWLA 2CCZA 1VQ9A 5IYCG 3PSIA 1XNQQ 3PUWA 3EN2A 4JV5L 4OWTB 1XMQL 1Y1VH 5HGQA 3JAMc 3HOZG 1JJGA 4A93H 1KL9A 1GKHA 2CQOA 2LXKA 1VQ5A 1SN8A 5GADC 1M1KC 3PF4A 3K7AH 4H02A 4KHZA 3TREA 2UUAL 3PIPA 3KYHC 2JA7G 1Q1EA 3EIVA 4JI8L 2ALYB 2IT1A 1B7YB 2LSSA 4AIMA 2MNAA 4DV7L 4X65Q 4P74A 1XMOQ 1EFWA 2NVQH 1FJGL 5IP9H 4HJAA 2JEBI 4EQ5A 1QVCA 4X66L 4DV2Q 3FKIG 3TEHB 2IX1A 4JI4L 3HOWH 1RL2A 3E9HA 1JMCA 3I4NH 5IE8A 3S2DH 1OXTA 1Q1BA 4POGA 2NZOA 3I4OA 1YJ9A 2AWOA 3AEVA 1P16A 1AE2A 1YNXA 1WFQA 4P73A 4K0KL 4JI0L 4MTNA 4A3LG 4JV5Q 1XMQQ 3CQZH 4B3ML 4O2DA 4P75A 4GOPC 3J80i 2VY3A 4NXNQ 4DV0Q 5C3EH 4POFA 1PH5A 5JJKA 2BA0A 5E7NA 1JT8A 4IO9A 4P71A 4R4IA 1SFOH 1LYLA 4JI8Q 5GROA 2ZTDA 3TS2A 3CF5A 1IBLL 2ATWA 1XPUA 3UDXA 5EAYA 3CPFA 5J3BA 5ELOA 4X66Q 4TVAB 2R7DA 3ERSX 3CXCA 4IPCA 3GO5A 3CMAA 1PH8A 1K9MC 4WJ4A 1OTCA 4A3FH 3RZOH 4LF4Q 4YWMA 3KJOA 4GLXA 4A3DH 1VQKA 2K5HA 4B3RL 2HIXA 1YEZA 3W1BA 4L5SA 2WP8J 4B3MQ 3LGJA 2GVAA 4JOIC 1TWCH 5M5XH 2VUMG 1XPOA 2A19A 4OO1I 3PGZA 1Y1VG 4JI6L 1XNRL 5IYDH 1Q7YC 4A93G 3FHWA 2OQ0A 2MO0A 1E22A 3UE0A 2VQEQ 2JA6H 2OTJA 4LWCA 5FJ8G 2UXDQ 4A3CH 4GN3B 3CMEA 1XPRA 4GOPB 2PQAA 1K3RA 3DM3A 1YZ6A 3W5OA 4L5TA 5IP9G 4A3MG 1QUQB 4DV3Q 4BY7H 4DPGA 2IY5B 2DGYA 1Y1WH 4JI1Q 4GOPA 2PI2A 2QA4A 3GTQH 2N49A 1QUQA 3I56A 2UXBQ 4PZ7A 3H15A 4LF8L 4B3RQ 3HFZB 4LFAL 1TWHH 3RZDH 2K14A 3DLLA 1KC8C 4LF9L 1PYSB 3UDFA 1N9WA 2RHSB 1Q82C 4OX9L 3M4PA 1XNRQ 2F4VL 4IFDI 1X54A 4GLVB 1TWAH 1HNXQ 2XTIA 2R93H 2R7ZH 3J80c 4A3JG 1EQQA 1X9NA 1Z47A 5IP7H 1PH6A 3HKZG 4YCVA 1K8GA 1N36L 1GM5A 1HNWQ 4A3EH 3G71A 4DV5L 2JA8H 4IJHA 3AYHB 3A5UA 1VS0A 2K4KA 3T1YL 4ALPA 4LFCL 3RLFA 1VQDA 3TRZA 1PH3A 3UDIA 2YTXA 4A3FG 4LF8Q 3GTPH 2E2IH 2NVXH 2I5HA 3F2DA 4A3DG 2GN5A 3BZCA 1UWVA 4IPDA 2L15A 4A3IH 4HIKA 1X3EA 4OX9Q 1YHAA 4X64Q 2F4VQ 3GTOH 4DR1Q 1IL2A 2IX0A 3S1QH 1TWFH 2B63H 1X65A 2K5VA 3GTMH 5GAEC 4YY3L 1BVSA 4C3JH 1ASYA 2E2JH 2D0PA 1OXXK 1H95A 2JA6G 1N36Q 2KHJA 4A3CG 1YI2A 3M4OH 1TWGH 1I94Q 5LMUL 3I55A 3T1YQ 4OO1G 1KQSA 2K5NA 3J81j 2UUCQ 4YCWA 2V1CC 1Y1WG 3S16H 3KDFB 3EBEA 4DV6L 1YHQA 2VQFQ 4OONA 2N8NA 1FVIA 2Q2IA 3I2ZA 1Q86C 2HT1A 3I4MH 3KDFA 2VW9A 1PA6A 3S1RH 2HQLA 4A3GH 3GD7A 3G4SA 1QZGA 1E3PA 5HY6A 2H5XA 1C7YA 1YHBA 2CFMA 1VQJA 1N33Q 4QQBX 3M85A 4L5QA 2K52A 4YY3Q 2BH2A 4P72A 2F52A 4JBMA 1WCMH 4R4CA 2R93G 4DR6Q 4DV1L 5BR8Q 5LMNL 5IP7G 2RHQB 5C44H 5LMUQ 1PH7A 1JJ2A 2JA5H 3CD6A 1VCIA 2UXCQ 1YVCA 3KOJA 4B3SQ 5C0XJ 4FDBA 2ZJPA 1OXVA 1DGSA 2IHFA 2WB1E 3CW2C 5IWAL 4DV6Q 4HJ5A 1WYDA 2B29A 1KRTA 2K75A 1VQBA 4X6AH 4LNQA 2WAQE 2OCEA 3PUZA 2N3SA 4BBSH 1A62A 3NENA 1LUZA 3BJUA 3OW2A 3H3VH 4R4QA 3K0XA 2KENA 1W2BA 1YIJA 1JB7A 2AHOB 3NBHB 4A3BG 2NVYH 2PI2E 2Z0SA 2B63G 2WAQG 4IFDJ 1PH1A 1PH4A 2NN6I 3K80C 3S15H 2UUAQ 5M3MH 4MZ9A 4DUZL 3F2CA 3NEMA 1VQMA 1P8LA 1J6QA 1PH9A 2E5LL 4DV7Q 2WFWA 1N32Q 1J5EL 1FJGQ 3STBD 3H0GG 2ZTCA 4PMWA 4DR5L 4JI4Q 2UU9L 1B8AA 4XIGS 1KAWA 3IRBA 2OWOA 3ER0A 3F1ZA 3M3YH 4BBRH 1C0AA 1BBWA 3CCVA 1UE1A 1SRUA 1MIUA 1XJVA 4K0KQ 4JI0Q 5JEAG 4JI2L 3CCLA 3SGIA 1YJNA 2ZTEA 3RLOA 5LMNW 4A3GG 3PO2H 3PUYA 4DAYB 1VQGA 1OXUA 4XTCS 3WWVA 4JYAL 3AFPA 4OWXB 1U5KA 4DUZQ 4DR2L 1WCMG 2E8GA 1LM0A 2PQAB 1S40A 3KLWA 2BA1A 2E5LQ 1J5EQ 1IBLQ 1X56A 1X55A 1KHIA 3PV0A 1Q12A 4QL5A 5C0XI 5AJ3L 4DR5Q 2UU9Q 3HOXH 5JEAJ 1SROA 3K8AA 4LF5L 2ASBA 2R92H 3HOWG 2UUBL 4APVA 2QEXA 3I4NG 4DR4L 1YBYA 2VL6A 4IPGA 1BKBA 2PMZE 2Y0SE 4JG2A 1X6OA 4KHPL 2B3GA 1IBKL 1X3FA 3KF6B 2MQHA 2BH8A 4LW1A 4OXPA 3PF5A 4BBSG 3U50C 4DR7L 1PH2A 4DKAC 1HNZL 2EQSA 5C4XH 4JI6Q 4UP8A 3KF6A 4A76A 4GKKL 4GLAC 1FL0A 3TQYA 3HOVH 2Y0SG 3RLNA 2KCMA 1XTDA 5C3EG 3KFUA 3NELA 2D0OA 4JI5L 5M3MG 4JI3L 1N34L 4DR1L 1T9HA 3GTLH 3GDEA 5AJ3Q 3M9BA 1M90C 1PYBA 2CWPA 1NJIC 2NZHA 4NXML 1G6PA 2I5LX 3PUVA 5M5WH 1QVGA 3ULJA 3U4ZA 4LF5Q 1VQIA 2Q2UA 3K7UC 4KLKA 3S17H 4Y7NH 3FP9A 4KI0A 1A0IA 2NN6G 4BBRG 4NB3A 1Q46A 4GKJL 1VQLA 4KHPQ 4LF6L 4IOCA 1S3OA 1K83H 4LFAQ 5IYCH 2AMCB 5IYBH 4WJ3M 4B3TL 4LF9Q 4IPHA 4AQYL 1HNZQ 4ME3A 5FLXc 3J7A5 2Q2HA 3HOZH 1CKMA 4DAMA 4GKKQ 1WI5A 3L0OA 3CAMA 2JEAI 4IOAA 5IYDG 2Z6KC 4DV4L 3M7NA 2GVBA 1R9TH 1UE7A 4QY7A 2JA7H 3GTGH 1LTLA 4DUYL 3I7FA 3OYYA 4NXMQ 3BU2A 4YHHL 3PIOA 2N78A 1FGUA 4DV5Q 4A4IA 1UE5A 2OQKA 3RN5A 3ULPA 4C3IH 1L1OA 4L5RC 5JJLA 3D31A 4GNXA 4LFCQ 1YJWA 4BY7G 4MNOA 1A8VA 2R92G 1VQ6A 2PNHA 4NPSA 3HOUH 4LF7L 3OTOL 1WJJA 4R1JA 1HR0L 2QGQA 4AQYQ 4JBKA 1EWIA 4PG3A 3PO3H 2F3IA 5C0XG 4YWKA 1XNQL 3D0FA 2D62A 1KIXA 3CCRA 1E7ZA 1EIFA 2HIVA 3RN2A 5C4XG 4DV4Q 3MXNB 4RG1A 3ZJYC 1AH9A 3HOVG 2EIFA 4DNIA 1UEBA 3CC7A 2RF4A 2DUDA 3VDYA 2R7ZG 1I5FA 1G291 4YHHQ 1XMOL 1N32L 3AQQA 3UE1A 1VQ7A 2A8VA 1A63A 4A3EG 3ULLA 5M3FH 2JA8G 3H3VI 4GN4B 4JC0A 4IFDG 2CWAA 4HIMA 1KXLA 3CCSA 3OTOQ 1NTGA 1EUJA 2EXDA 2Z6KA 1HR0Q 1HZCA 2R6GA 1K73C 1JJCB 3A74A 1Y14B 5IYBG 4BXXH 2VUMH 1EOVA 3CCQA 4A3IG 2KHIA 3GTKH 2WB1G 4NXNL 4DV0L 4X62L 5H1SE 2I0QA 2R7FA 4UPAA 5FJ8H 3KF8B 4DV1Q 1PVOA 4TQUS 1SLJA 1PFSA 4QIWE 5LMNQ 2ZJQA 5GAHC 1O7IA 4A3MH 5JJIA 4PZ8A 1HR0W 4HJ9A 3TS0A 3U58A 4YCUA 1E1TA 1OXSC 1RIPA 1TXYA 1Z9FA 2CKZB 4Y52H 1D8LA 1NMFA 2E2HH 5GAGC 5IWAQ 3HOYH 1NY4A 1VQHA 3Q8DA 4LF4L 3K81C 3RNUA 3HOUG 3ICEA 1V43A 3G6EA 3M4QA 3PO3G 1G51A 1VQNA 3I4MG 1I6HH 3F8TA 2VNUD 4QJFA 3J81i 3G48A 1SE8A 1SR3A 1X3GA 3B6YA 2ID0A 4X62Q 4HJ7A 5IY0A 4C2MH 4A3JH 2VZAA 4EX5A 2VQEL 3HKSA 1EYGA 2UXDL 3GTJH 3A5ZB 1VQPA 3S2HH 2JA5G 2JQOA 1VQCA 5C44G 3UDGA 1N8RC 4DV3L 4BA2I 4A75A 1V9PA 1SMXA 2K50A 5M3FG 1HH2P 1CKNB 1VQOA 1Q81C 4J15A 4JI1L 4DK3C 1PHJA 1U0LA 3BZKA 3PCOB 3L2PA 5FLMH 3CCJA 4BY1H 4A3KH 1IBML 3S1MH 2UXBL 1CKNA 3T1HL 5K36G 2VS1A 1QVFA 4JBWA 1S72A 2JE6I 4BXXG 3S24A 4JI2Q 5M5YH 1L1OC 2AKWB 4UP7A 1D7QA 4GNXC 1KRSA 4O0AA 1ASZA 2YTVA 4HIOA 1BBUA 1V1QA 2YV5A 1K8AC 4JYAQ 1HNXL 1NMGA 4DR2Q 4PZ6A 2KBNA 1MJEA 2MFIA 1IZ6A 4QGUA 1Q8KA 1GD7A 3MEFA 1PV4A 2KCTA 1HNWL 2ZM6L 1MKHA 4JBJA 4LUZA 4JCVE 1HZ9A 1MJCA 3A0JA 4OWWB 2UUBQ 1IBMQ 3U4VA 3HOYG 1NBWA 5DLQE 4DR3L 4DR4Q 3T1HQ 2HHHL 5IT9c 1HZBA 1IBKQ 5ELNA 3CCEA 3KJPA 4C3HH 3JAMi 1KD1C 3PUXA 4DR7Q 4X64L 3HKZE 4BA1I 2YTYA 1CSPA 1E1OA 3STBC 4AH6A 2ES2A 4UP9A 4AYBE 4GN5A 2FXQA 3PO2G 1K0RA 3E9IA 3AFQA 2MO1A 3J81c 2AWNA 4JI5Q 4JI3Q 4GS3A 1N34Q 1IYJB 1VQEA 4JI7L 1W3SA 4LFBQ 1NE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L1O B;  1HZA A;  2Q2T A;  4GNX B;  4AYB G;  2ZM6 Q;  1YIT A;  1I94 L;  4UY8 C;  3JC6 6;  4JOI A;  3S14 H;  3FKI H;  2A1A A;  1L0W A;  2UUC L;  2NVT H;  1E24 A;  3HOX G;  5GQO A;  4DK6 C;  2OTL A;  2JJQ A;  2RCN A;  2YYZ A;  4DR3 Q;  1VQ8 A;  3W1G A;  2HHH Q;  4GKJ Q;  1C9O A;  1L2F A;  2XGT A;  2C35 B;  4BY1 G;  5FLM G;  2VQF L;  2ZJR A;  4A3K G;  1CKO A;  4LF6 Q;  1EQR A;  4B3T Q;  1VQ4 A;  4HID A;  4A3L H;  3CCU A;  2JK8 A;  3CCM A;  4LUV A;  3J7Z C;  4A3B H;  1GO3 E;  1I3Q H;  1N33 L;  1IXR A;  1VQA A;  2IHE A;  4R4O A;  3CP0 A;  1CSQ A;  4HJ8 A;  2YU9 H;  4DR6 L;  4R4T A;  1AE3 A;  4RMF A;  5BR8 L;  3F2B A;  1VQF A;  4DUY Q;  4JI7 Q;  3RR5 A;  1HJP A;  3E0E A;  3S1N H;  1CUK A;  2LXJ A;  3H0G H;  1WOC A;  4LFB L;  4X65 L;  3CC4 A;  2UXC L;  4B3S L;  5C4J H;  2JA9 A;  4DV2 L;  4LUO A;  1UE6 A;  3L7Z C;  1GVP A;  4IJL A;  1QZH A;  4LF7 Q;  1B70 B;  1JE5 A;  1I50 H;  2I5M X;  3CPW A;  1EIY B;  3CC2 A;  4YWL A;  2CCZ A;  1VQ9 A;  5IYC G;  3PSI A;  1XNQ Q;  3PUW A;  3EN2 A;  4JV5 L;  4OWT B;  1XMQ L;  1Y1V H;  5HGQ A;  3JAM c;  3HOZ G;  1JJG A;  4A93 H;  1KL9 A;  1GKH A;  2CQO A;  2LXK A;  1VQ5 A;  1SN8 A;  5GAD C;  1M1K C;  3PF4 A;  3K7A H;  4H02 A;  4KHZ A;  3TRE A;  2UUA L;  3PIP A;  3KYH C;  2JA7 G;  1Q1E A;  3EIV A;  4JI8 L;  2ALY B;  2IT1 A;  1B7Y B;  2LSS A;  4AIM A;  2MNA A;  4DV7 L;  4X65 Q;  4P74 A;  1XMO Q;  1EFW A;  2NVQ H;  1FJG L;  5IP9 H;  4HJA A;  2JEB I;  4EQ5 A;  1QVC A;  4X66 L;  4DV2 Q;  3FKI G;  3TEH B;  2IX1 A;  4JI4 L;  3HOW H;  1RL2 A;  3E9H A;  1JMC A;  3I4N H;  5IE8 A;  3S2D H;  1OXT A;  1Q1B A;  4POG A;  2NZO A;  3I4O A;  1YJ9 A;  2AWO A;  3AEV A;  1P16 A;  1AE2 A;  1YNX A;  1WFQ A;  4P73 A;  4K0K L;  4JI0 L;  4MTN A;  4A3L G;  4JV5 Q;  1XMQ Q;  3CQZ H;  4B3M L;  4O2D A;  4P75 A;  4GOP C;  3J80 i;  2VY3 A;  4NXN Q;  4DV0 Q;  5C3E H;  4POF A;  1PH5 A;  5JJK A;  2BA0 A;  5E7N A;  1JT8 A;  4IO9 A;  4P71 A;  4R4I A;  1SFO H;  1LYL A;  4JI8 Q;  5GRO A;  2ZTD A;  3TS2 A;  3CF5 A;  1IBL L;  2ATW A;  1XPU A;  3UDX A;  5EAY A;  3CPF A;  5J3B A;  5ELO A;  4X66 Q;  4TVA B;  2R7D A;  3ERS X;  3CXC A;  4IPC A;  3GO5 A;  3CMA A;  1PH8 A;  1K9M C;  4WJ4 A;  1OTC A;  4A3F H;  3RZO H;  4LF4 Q;  4YWM A;  3KJO A;  4GLX A;  4A3D H;  1VQK A;  2K5H A;  4B3R L;  2HIX A;  1YEZ A;  3W1B A;  4L5S A;  2WP8 J;  4B3M Q;  3LGJ A;  2GVA A;  4JOI C;  1TWC H;  5M5X H;  2VUM G;  1XPO A;  2A19 A;  4OO1 I;  3PGZ A;  1Y1V G;  4JI6 L;  1XNR L;  5IYD H;  1Q7Y C;  4A93 G;  3FHW A;  2OQ0 A;  2MO0 A;  1E22 A;  3UE0 A;  2VQE Q;  2JA6 H;  2OTJ A;  4LWC A;  5FJ8 G;  2UXD Q;  4A3C H;  4GN3 B;  3CME A;  1XPR A;  4GOP B;  2PQA A;  1K3R A;  3DM3 A;  1YZ6 A;  3W5O A;  4L5T A;  5IP9 G;  4A3M G;  1QUQ B;  4DV3 Q;  4BY7 H;  4DPG A;  2IY5 B;  2DGY A;  1Y1W H;  4JI1 Q;  4GOP A;  2PI2 A;  2QA4 A;  3GTQ H;  2N49 A;  1QUQ A;  3I56 A;  2UXB Q;  4PZ7 A;  3H15 A;  4LF8 L;  4B3R Q;  3HFZ B;  4LFA L;  1TWH H;  3RZD H;  2K14 A;  3DLL A;  1KC8 C;  4LF9 L;  1PYS B;  3UDF A;  1N9W A;  2RHS B;  1Q82 C;  4OX9 L;  3M4P A;  1XNR Q;  2F4V L;  4IFD I;  1X54 A;  4GLV B;  1TWA H;  1HNX Q;  2XTI A;  2R93 H;  2R7Z H;  3J80 c;  4A3J G;  1EQQ A;  1X9N A;  1Z47 A;  5IP7 H;  1PH6 A;  3HKZ G;  4YCV A;  1K8G A;  1N36 L;  1GM5 A;  1HNW Q;  4A3E H;  3G71 A;  4DV5 L;  2JA8 H;  4IJH A;  3AYH B;  3A5U A;  1VS0 A;  2K4K A;  3T1Y L;  4ALP A;  4LFC L;  3RLF A;  1VQD A;  3TRZ A;  1PH3 A;  3UDI A;  2YTX A;  4A3F G;  4LF8 Q;  3GTP H;  2E2I H;  2NVX H;  2I5H A;  3F2D A;  4A3D G;  2GN5 A;  3BZC A;  1UWV A;  4IPD A;  2L15 A;  4A3I H;  4HIK A;  1X3E A;  4OX9 Q;  1YHA A;  4X64 Q;  2F4V Q;  3GTO H;  4DR1 Q;  1IL2 A;  2IX0 A;  3S1Q H;  1TWF H;  2B63 H;  1X65 A;  2K5V A;  3GTM H;  5GAE C;  4YY3 L;  1BVS A;  4C3J H;  1ASY A;  2E2J H;  2D0P A;  1OXX K;  1H95 A;  2JA6 G;  1N36 Q;  2KHJ A;  4A3C G;  1YI2 A;  3M4O H;  1TWG H;  1I94 Q;  5LMU L;  3I55 A;  3T1Y Q;  4OO1 G;  1KQS A;  2K5N A;  3J81 j;  2UUC Q;  4YCW A;  2V1C C;  1Y1W G;  3S16 H;  3KDF B;  3EBE A;  4DV6 L;  1YHQ A;  2VQF Q;  4OON A;  2N8N A;  1FVI A;  2Q2I A;  3I2Z A;  1Q86 C;  2HT1 A;  3I4M H;  3KDF A;  2VW9 A;  1PA6 A;  3S1R H;  2HQL A;  4A3G H;  3GD7 A;  3G4S A;  1QZG A;  1E3P A;  5HY6 A;  2H5X A;  1C7Y A;  1YHB A;  2CFM A;  1VQJ A;  1N33 Q;  4QQB X;  3M85 A;  4L5Q A;  2K52 A;  4YY3 Q;  2BH2 A;  4P72 A;  2F52 A;  4JBM A;  1WCM H;  4R4C A;  2R93 G;  4DR6 Q;  4DV1 L;  5BR8 Q;  5LMN L;  5IP7 G;  2RHQ B;  5C44 H;  5LMU Q;  1PH7 A;  1JJ2 A;  2JA5 H;  3CD6 A;  1VCI A;  2UXC Q;  1YVC A;  3KOJ A;  4B3S Q;  5C0X J;  4FDB A;  2ZJP A;  1OXV A;  1DGS A;  2IHF A;  2WB1 E;  3CW2 C;  5IWA L;  4DV6 Q;  4HJ5 A;  1WYD A;  2B29 A;  1KRT A;  2K75 A;  1VQB A;  4X6A H;  4LNQ A;  2WAQ E;  2OCE A;  3PUZ A;  2N3S A;  4BBS H;  1A62 A;  3NEN A;  1LUZ A;  3BJU A;  3OW2 A;  3H3V H;  4R4Q A;  3K0X A;  2KEN A;  1W2B A;  1YIJ A;  1JB7 A;  2AHO B;  3NBH B;  4A3B G;  2NVY H;  2PI2 E;  2Z0S A;  2B63 G;  2WAQ G;  4IFD J;  1PH1 A;  1PH4 A;  2NN6 I;  3K80 C;  3S15 H;  2UUA Q;  5M3M H;  4MZ9 A;  4DUZ L;  3F2C A;  3NEM A;  1VQM A;  1P8L A;  1J6Q A;  1PH9 A;  2E5L L;  4DV7 Q;  2WFW A;  1N32 Q;  1J5E L;  1FJG Q;  3STB D;  3H0G G;  2ZTC A;  4PMW A;  4DR5 L;  4JI4 Q;  2UU9 L;  1B8A A;  4XIG S;  1KAW A;  3IRB A;  2OWO A;  3ER0 A;  3F1Z A;  3M3Y H;  4BBR H;  1C0A A;  1BBW A;  3CCV A;  1UE1 A;  1SRU A;  1MIU A;  1XJV A;  4K0K Q;  4JI0 Q;  5JEA G;  4JI2 L;  3CCL A;  3SGI A;  1YJN A;  2ZTE A;  3RLO A;  5LMN W;  4A3G G;  3PO2 H;  3PUY A;  4DAY B;  1VQG A;  1OXU A;  4XTC S;  3WWV A;  4JYA L;  3AFP A;  4OWX B;  1U5K A;  4DUZ Q;  4DR2 L;  1WCM G;  2E8G A;  1LM0 A;  2PQA B;  1S40 A;  3KLW A;  2BA1 A;  2E5L Q;  1J5E Q;  1IBL Q;  1X56 A;  1X55 A;  1KHI A;  3PV0 A;  1Q12 A;  4QL5 A;  5C0X I;  5AJ3 L;  4DR5 Q;  2UU9 Q;  3HOX H;  5JEA J;  1SRO A;  3K8A A;  4LF5 L;  2ASB A;  2R92 H;  3HOW G;  2UUB L;  4APV A;  2QEX A;  3I4N G;  4DR4 L;  1YBY A;  2VL6 A;  4IPG A;  1BKB A;  2PMZ E;  2Y0S E;  4JG2 A;  1X6O A;  4KHP L;  2B3G A;  1IBK L;  1X3F A;  3KF6 B;  2MQH A;  2BH8 A;  4LW1 A;  4OXP A;  3PF5 A;  4BBS G;  3U50 C;  4DR7 L;  1PH2 A;  4DKA C;  1HNZ L;  2EQS A;  5C4X H;  4JI6 Q;  4UP8 A;  3KF6 A;  4A76 A;  4GKK L;  4GLA C;  1FL0 A;  3TQY A;  3HOV H;  2Y0S G;  3RLN A;  2KCM A;  1XTD A;  5C3E G;  3KFU A;  3NEL A;  2D0O A;  4JI5 L;  5M3M G;  4JI3 L;  1N34 L;  4DR1 L;  1T9H A;  3GTL H;  3GDE A;  5AJ3 Q;  3M9B A;  1M90 C;  1PYB A;  2CWP A;  1NJI C;  2NZH A;  4NXM L;  1G6P A;  2I5L X;  3PUV A;  5M5W H;  1QVG A;  3ULJ A;  3U4Z A;  4LF5 Q;  1VQI A;  2Q2U A;  3K7U C;  4KLK A;  3S17 H;  4Y7N H;  3FP9 A;  4KI0 A;  1A0I A;  2NN6 G;  4BBR G;  4NB3 A;  1Q46 A;  4GKJ L;  1VQL A;  4KHP Q;  4LF6 L;  4IOC A;  1S3O A;  1K83 H;  4LFA Q;  5IYC H;  2AMC B;  5IYB H;  4WJ3 M;  4B3T L;  4LF9 Q;  4IPH A;  4AQY L;  1HNZ Q;  4ME3 A;  5FLX c;  3J7A 5;  2Q2H A;  3HOZ H;  1CKM A;  4DAM A;  4GKK Q;  1WI5 A;  3L0O A;  3CAM A;  2JEA I;  4IOA A;  5IYD G;  2Z6K C;  4DV4 L;  3M7N A;  2GVB A;  1R9T H;  1UE7 A;  4QY7 A;  2JA7 H;  3GTG H;  1LTL A;  4DUY L;  3I7F A;  3OYY A;  4NXM Q;  3BU2 A;  4YHH L;  3PIO A;  2N78 A;  1FGU A;  4DV5 Q;  4A4I A;  1UE5 A;  2OQK A;  3RN5 A;  3ULP A;  4C3I H;  1L1O A;  4L5R C;  5JJL A;  3D31 A;  4GNX A;  4LFC Q;  1YJW A;  4BY7 G;  4MNO A;  1A8V A;  2R92 G;  1VQ6 A;  2PNH A;  4NPS A;  3HOU H;  4LF7 L;  3OTO L;  1WJJ A;  4R1J A;  1HR0 L;  2QGQ A;  4AQY Q;  4JBK A;  1EWI A;  4PG3 A;  3PO3 H;  2F3I A;  5C0X G;  4YWK A;  1XNQ L;  3D0F A;  2D62 A;  1KIX A;  3CCR A;  1E7Z A;  1EIF A;  2HIV A;  3RN2 A;  5C4X G;  4DV4 Q;  3MXN B;  4RG1 A;  3ZJY C;  1AH9 A;  3HOV G;  2EIF A;  4DNI A;  1UEB A;  3CC7 A;  2RF4 A;  2DUD A;  3VDY A;  2R7Z G;  1I5F A;  1G29 1;  4YHH Q;  1XMO L;  1N32 L;  3AQQ A;  3UE1 A;  1VQ7 A;  2A8V A;  1A63 A;  4A3E G;  3ULL A;  5M3F H;  2JA8 G;  3H3V I;  4GN4 B;  4JC0 A;  4IFD G;  2CWA A;  4HIM A;  1KXL A;  3CCS A;  3OTO Q;  1NTG A;  1EUJ A;  2EXD A;  2Z6K A;  1HR0 Q;  1HZC A;  2R6G A;  1K73 C;  1JJC B;  3A74 A;  1Y14 B;  5IYB G;  4BXX H;  2VUM H;  1EOV A;  3CCQ A;  4A3I G;  2KHI A;  3GTK H;  2WB1 G;  4NXN L;  4DV0 L;  4X62 L;  5H1S E;  2I0Q A;  2R7F A;  4UPA A;  5FJ8 H;  3KF8 B;  4DV1 Q;  1PVO A;  4TQU S;  1SLJ A;  1PFS A;  4QIW E;  5LMN Q;  2ZJQ A;  5GAH C;  1O7I A;  4A3M H;  5JJI A;  4PZ8 A;  1HR0 W;  4HJ9 A;  3TS0 A;  3U58 A;  4YCU A;  1E1T A;  1OXS C;  1RIP A;  1TXY A;  1Z9F A;  2CKZ B;  4Y52 H;  1D8L A;  1NMF A;  2E2H H;  5GAG C;  5IWA Q;  3HOY H;  1NY4 A;  1VQH A;  3Q8D A;  4LF4 L;  3K81 C;  3RNU A;  3HOU G;  3ICE A;  1V43 A;  3G6E A;  3M4Q A;  3PO3 G;  1G51 A;  1VQN A;  3I4M G;  1I6H H;  3F8T A;  2VNU D;  4QJF A;  3J81 i;  3G48 A;  1SE8 A;  1SR3 A;  1X3G A;  3B6Y A;  2ID0 A;  4X62 Q;  4HJ7 A;  5IY0 A;  4C2M H;  4A3J H;  2VZA A;  4EX5 A;  2VQE L;  3HKS A;  1EYG A;  2UXD L;  3GTJ H;  3A5Z B;  1VQP A;  3S2H H;  2JA5 G;  2JQO A;  1VQC A;  5C44 G;  3UDG A;  1N8R C;  4DV3 L;  4BA2 I;  4A75 A;  1V9P A;  1SMX A;  2K50 A;  5M3F G;  1HH2 P;  1CKN B;  1VQO A;  1Q81 C;  4J15 A;  4JI1 L;  4DK3 C;  1PHJ A;  1U0L A;  3BZK A;  3PCO B;  3L2P A;  5FLM H;  3CCJ A;  4BY1 H;  4A3K H;  1IBM L;  3S1M H;  2UXB L;  1CKN A;  3T1H L;  5K36 G;  2VS1 A;  1QVF A;  4JBW A;  1S72 A;  2JE6 I;  4BXX G;  3S24 A;  4JI2 Q;  5M5Y H;  1L1O C;  2AKW B;  4UP7 A;  1D7Q A;  4GNX C;  1KRS A;  4O0A A;  1ASZ A;  2YTV A;  4HIO A;  1BBU A;  1V1Q A;  2YV5 A;  1K8A C;  4JYA Q;  1HNX L;  1NMG A;  4DR2 Q;  4PZ6 A;  2KBN A;  1MJE A;  2MFI A;  1IZ6 A;  4QGU A;  1Q8K A;  1GD7 A;  3MEF A;  1PV4 A;  2KCT A;  1HNW L;  2ZM6 L;  1MKH A;  4JBJ A;  4LUZ A;  4JCV E;  1HZ9 A;  1MJC A;  3A0J A;  4OWW B;  2UUB Q;  1IBM Q;  3U4V A;  3HOY G;  1NBW A;  5DLQ E;  4DR3 L;  4DR4 Q;  3T1H Q;  2HHH L;  5IT9 c;  1HZB A;  1IBK Q;  5ELN A;  3CCE A;  3KJP A;  4C3H H;  3JAM i;  1KD1 C;  3PUX A;  4DR7 Q;  4X64 L;  3HKZ E;  4BA1 I;  2YTY A;  1CSP A;  1E1O A;  3STB C;  4AH6 A;  2ES2 A;  4UP9 A;  4AYB E;  4GN5 A;  2FXQ A;  3PO2 G;  1K0R A;  3E9I A;  3AFQ A;  2MO1 A;  3J81 c;  2AWN A;  4JI5 Q;  4JI3 Q;  4GS3 A;  1N34 Q;  1IYJ B;  1VQE A;  4JI7 L;  1W3S A;  4LFB Q;  1NE3 A; 
#chains in the Genus database with same CATH topology
 1HZA A;  3SR1 A;  2ZM6 Q;  4JOI A;  3S14 H;  1SE4 A;  3R8B A;  2JJQ A;  1VQ8 A;  2HHH Q;  2XWB B;  3I8Z A;  3T53 B;  3J7A F;  3NHH A;  1EQR A;  1VQ4 A;  3SVM A;  5C6A A;  3CCM A;  4UDU C;  1LTA D;  1N33 L;  2IHE A;  1PYW D;  1CSQ A;  2R61 A;  2D9U A;  4C2M B;  2KA7 A;  3NP8 A;  2ENB A;  3RUZ A;  1AE3 A;  3TBI B;  5BR8 L;  4DUY Q;  1VQF A;  3RR5 A;  2D5D A;  3HKZ B;  4WJW A;  1CUK A;  2LXJ A;  2WKC A;  1EY5 A;  3HOX B;  5C5M A;  1TS3 A;  5CC4 A;  1U4L A;  4NMZ A;  2EJG C;  3K5L A;  4LF7 Q;  4DXF A;  4A3K B;  1EIY B;  4YWL A;  2CCZ A;  1JQY D;  1SND A;  1TY2 A;  4JV5 L;  4OWT B;  1JJG A;  1CM9 A;  4A93 H;  5J1Z A;  1DOK A;  1GKH A;  3BZD B;  4B9X A;  1M1K C;  3PF4 A;  4KHZ A;  3E5S A;  3EIV A;  4DV7 L;  4V19 0;  1N32 Q;  2NVQ H;  1RTO A;  2CHB D;  3K59 A;  4LFB Q;  4X65 Q;  1Q8I A;  4HSV A;  4K14 A;  4HJA A;  3GTL B;  1SYB A;  3HOW H;  4DV2 Q;  1B53 A;  3Q22 A;  4HR7 B;  4POG A;  1CZG A;  2DN8 A;  1PXU A;  3PIP 3;  2WII B;  1P16 A;  1YNX A;  2B2W C;  2HUG A;  4MTN A;  3QO2 A;  3TZD A;  3MXG A;  1S5C D;  4EQN A;  4J1M A;  5ELE A;  3HOZ B;  3TN2 A;  5JJK A;  2VB2 X;  4QB4 A;  4R4I A;  1SFO H;  1LYL A;  2LY7 A;  1KAB A;  1HTL D;  2ZTD A;  5GRO A;  1IBL L;  2JA7 B;  2ATW A;  4OHJ A;  3CPF A;  5ELO A;  3ERS X;  3GO5 A;  1K9M C;  1EY0 A;  3FKI B;  3K57 A;  3IKJ A;  2EOT A;  4YWM A;  4L6T B;  2K5H A;  3OOC A;  4B3R L;  2HIX A;  4ZUI A;  4S3S A;  4B3M Q;  4JOI C;  1AZQ A;  4OO1 I;  1HCZ A;  2SNS A;  4A93 G;  2JN4 A;  3CKI B;  4DAY A;  1E22 A;  2PZU A;  4OEL B;  3UE0 A;  2VQE Q;  2YU9 B;  4KJN A;  4A3C H;  2F0O A;  4UHV A;  1K3R A;  2X6G A;  1EFI D;  3W5O A;  4RGN A;  2QDL A;  4JI1 Q;  4GOP A;  1U4R A;  4PZ7 A;  4EQP A;  4LF8 L;  5C0X H;  4ZAI A;  1ENC A;  1Q82 C;  4OX9 L;  2F4V L;  1ESR A;  3ITP A;  1Y1V B;  1HNX Q;  3LNN A;  4O1N A;  3J80 c;  2EYM A;  1F9P A;  3HKZ G;  1K8G A;  1KLG D;  2JA8 H;  3C1F A;  3AYH B;  3A5U A;  2XNA C;  2XVS A;  3T1Y L;  1C4Q A;  5TSS A;  3UDI A;  4N8F A;  4QUC A;  1JOK A;  3K5M A;  2F0U A;  2XWJ B;  1DOL A;  5JOB A;  5EPK A;  2IX0 A;  5CBA E;  1B2T A;  2A68 D;  4C3J H;  2D0P A;  1ET6 A;  4RHR A;  4A3C G;  1YI2 A;  1UNS A;  1STY A;  5KRU A;  2ZXO A;  3I55 A;  3S2H B;  1B1Z A;  1EWC A;  5KND A;  1KQS A;  2K5N A;  1STA A;  1NAP A;  3EBE A;  4DV6 L;  1UEA B;  2VQF Q;  3RZO B;  4OON A;  2N8N A;  1Q86 C;  4A3D B;  4XT1 B;  3I4M H;  3KDF A;  1PA6 A;  3D4R A;  2RCF A;  2RQX A;  3GD7 A;  4CKB A;  4RCO A;  1TWC B;  2H5X A;  4QQB X;  3OMC A;  1TT2 A;  2F52 A;  4DR6 Q;  4DV1 L;  2XSC A;  3D8G A;  1T5E A;  5J22 A;  2RHQ B;  3CD6 A;  3K6O A;  1YVC A;  2ZJP A;  1OXV A;  3IL8 A;  2WB1 E;  4CJ0 B;  1Y1W B;  2OXP A;  3GTQ B;  1WYD A;  2B29 A;  5DNF A;  4X6A H;  2NTS A;  2Z1C A;  3G6J B;  1F9R A;  5C4H A;  1LUZ A;  2XRS D;  2EPB A;  2AHO B;  1RTN A;  3OHX C;  5KYI A;  1PH1 A;  2NN6 I;  1A3T A;  4C3J G;  4DUZ L;  5KGU A;  3NEM A;  1VQM A;  1P8L A;  2WFW A;  3VA7 A;  2K6A A;  2IJ0 A;  1DJR D;  4PMW A;  4PMC A;  4XIG S;  3WDN A;  2A68 C;  3IRB A;  4XDX A;  2OWO A;  2CVR A;  4WFN 3;  3H09 A;  3M3Y H;  3I70 A;  1BBW A;  2F3V A;  1MIU A;  5DM6 3;  3GTP B;  2E2I B;  3PQI A;  1BQQ T;  1MGS A;  4EVO A;  4JI2 L;  3SGI A;  3VYU A;  2WB1 B;  4DAY B;  1VQG A;  4DF7 A;  1TWF B;  3DHQ A;  4DNT B;  1E2Z A;  1LM0 A;  2DJG C;  1J5E Q;  4V0B A;  1CTM A;  1Q12 A;  5C0X I;  1TWG B;  4F7X A;  5I9P A;  1IYV A;  2KQ3 A;  3H0G B;  4LF5 L;  2UUB L;  3S16 B;  4FO2 A;  3I4N G;  4DR4 L;  3BYT B;  4R8N A;  2PMZ E;  1KDC A;  3W2D A;  3DWA A;  4OXP A;  4MHE A;  5I6W A;  1PH2 A;  1HNZ L;  2EQS A;  3KF6 A;  3BG3 A;  1FL0 A;  3BS1 A;  1XTD A;  1EWH A;  4DR1 L;  2N55 A;  3GDE A;  2CWP A;  4NW2 A;  2ZT9 C;  1Y8N B;  1VQI A;  2KCC A;  3MXU A;  2J7Z A;  4OL7 A;  5IGG A;  2Q2U A;  3S17 H;  3FP9 A;  4ZQ3 A;  1A0I A;  1EY9 A;  4IOC A;  3QIA A;  4AQY L;  4IUU A;  3J7A 5;  1I4H A;  1CKM A;  4GKK Q;  2L12 A;  3CAM A;  2JEA I;  4MN3 A;  3NK9 A;  2NVY B;  2PMZ B;  1F2Z A;  1XXG A;  1R9T H;  4QY7 A;  5M3M B;  4DUY L;  4RWS C;  4NXM Q;  3BU2 A;  2I07 B;  1FGU A;  3ULP A;  3D4W A;  4CJ1 B;  1K8M A;  1L1O A;  3CRK C;  4HAE A;  3D31 A;  3BDL A;  1YJW A;  1G6Z A;  2PNH A;  4I65 A;  4NPS A;  4BBR B;  4LF7 L;  1SJH D;  3C46 A;  4JBK A;  1FNV A;  4DA2 A;  4PG3 A;  3PO3 H;  5CV8 A;  1B44 D;  3RN2 A;  3ZJY C;  2EE1 A;  2EZV A;  1UEB A;  3EQL C;  3L9A X;  4DU9 A;  2DUD A;  1W6J A;  1IW7 C;  1N32 L;  1HFG A;  1VQ7 A;  4C56 C;  3NWT A;  5JJZ A;  2EY1 A;  5M3F H;  4GN4 B;  2CWA A;  5JPM C;  2R92 B;  2EXD A;  2Z6K A;  3OIQ A;  1HZC A;  1MSH A;  2NBF A;  4OGQ C;  1Y14 B;  1WTX A;  3U9O A;  2VUM H;  1EOV A;  1B4O A;  2WB1 G;  4NDX A;  2EXZ A;  4KJO A;  1PVO A;  3BDO A;  1K3B C;  3ZYY X;  4A3M H;  4L8J A;  3R2I A;  1HR0 W;  3TS0 A;  1E1T A;  1OXS C;  1RIP A;  1TXY A;  4K2K A;  3J81 E;  5M5W B;  5CYU A;  4Y52 H;  2E2H H;  4B9W A;  1FGB D;  1H9S B;  2KCN A;  4Y7N B;  1BCP F;  3I73 A;  2NVX B;  4IAL A;  3PO3 G;  1I6H H;  2L0C A;  4A3I B;  2HDM A;  3G48 A;  1EQV A;  3J81 i;  1XTC D;  5LL6 X;  4PNY A;  3S1Q B;  2F0W A;  2EYF A;  2VZA A;  3QB3 A;  3G7L A;  2VQE L;  3HKS A;  4LAA A;  5F2D A;  4BA2 I;  5M3F G;  1Q81 C;  4CBV A;  4JI1 L;  3GQB A;  3PCO B;  1TU2 B;  3SE0 A;  4E6I A;  3H3V C;  4DK0 A;  4BY1 H;  3S1M H;  1TR5 A;  1AN8 A;  2K5W A;  1L1O C;  2AKW B;  3MTS A;  1KRS A;  2K01 A;  1SMY C;  4HIO A;  2YV5 A;  1HNX L;  4KD3 A;  1MJE A;  2MFI A;  5K5P A;  1BOS A;  1BXT A;  2NB0 A;  3JAM E;  5J39 A;  2JA5 B;  5C44 B;  4JBJ A;  1HZ9 A;  1LTS D;  3KBX A;  1MJC A;  4XXE A;  4OWW B;  2K03 A;  3HS0 C;  4FP5 D;  2P5Z X;  4C3H H;  3JAM i;  3PUX A;  3T56 B;  4IQZ A;  3STB C;  1CSP A;  1U9R A;  1YNN D;  3GTK B;  1FD7 D;  3E9I A;  2MO1 A;  2RA4 A;  4GS3 A;  2HQE A;  1PHJ A;  1W3S A;  1L1O B;  3DMU A;  4R9W A;  4UY8 C;  3JC6 6;  1EY6 A;  1NR4 A;  4CJ2 C;  2NVT H;  5GQO A;  4DK6 C;  2OTL A;  2RCN A;  2VQF L;  2C35 B;  1NR2 A;  4BY1 G;  1EZ8 A;  4DXG A;  4HID A;  4A3L H;  3SHL A;  2JK8 A;  1A2U A;  1I3Q H;  3NQI A;  4TSS A;  1E2W A;  2WAC A;  3H6M A;  4HJ8 A;  5JPN C;  2EYO A;  4DR6 L;  4JI7 Q;  5JVH 3;  1QJO A;  3E0E A;  1JCK B;  3GTJ B;  4N9T A;  1D5M C;  4QMG A;  2XN9 C;  3CC4 A;  5C4J H;  2JA9 A;  5T1G A;  1UE6 A;  4IJL A;  1BCP C;  1O80 A;  2I5M X;  1WD1 A;  3CC2 A;  4C3H G;  1VQ9 A;  3PSI A;  4OEM B;  1XNQ Q;  3PUW A;  5M5Y B;  1XMQ L;  1LTB D;  2LXK A;  3S9W A;  3K7A H;  3TRE A;  1WTW A;  2LKV A;  1Q1E A;  4JI8 L;  3SK5 A;  2IT1 A;  1B7Y B;  3VR4 A;  1EFW A;  1PTO D;  1ILP A;  5IP9 H;  1YNJ D;  1QVC A;  5A35 A;  2IX1 A;  1U4P A;  4G7H C;  1RL2 A;  4C3I G;  4ULL A;  1NSN S;  3FPU B;  1L0X B;  4J6H A;  5IE8 A;  3J7A V;  3S2D H;  1OXT A;  4QF4 A;  2NZO A;  1YJ9 A;  4RHS A;  1AE2 A;  4P73 A;  2K33 A;  1K0S A;  1A15 A;  5AFW A;  5CV6 A;  4A3L G;  1QG7 A;  2A6H C;  4P75 A;  2NYZ D;  1DYQ A;  1BCP B;  1ICW A;  4NXN Q;  4DV0 Q;  1S5B D;  3UI2 A;  2M9V A;  3VR3 A;  2QKI C;  4IO9 A;  1UUP A;  4M1U B;  3CF5 A;  2QIL A;  1XPU A;  3DWQ A;  3S15 B;  2SNM A;  4X66 Q;  1TS2 A;  3ND8 A;  4IPC A;  3NUC A;  3S14 B;  1OTC A;  1QWY A;  4A3F H;  5KIX A;  4LF4 Q;  4JPB W;  1VQK A;  1D1I A;  3MFY A;  3VYR A;  3GV6 A;  1XPO A;  3PGZ A;  1XNR L;  3AU7 A;  3U9S A;  2KEE A;  5EKL A;  1IYU A;  1Q90 A;  4LWC A;  5FJ8 G;  3SK4 A;  3CME A;  2WKD A;  5I6Y A;  1K8O A;  3DM3 A;  2B2W A;  5IGB A;  5IP9 G;  3IFD A;  1QUQ B;  4DV3 Q;  4BY7 H;  4KY6 A;  2DGY A;  1EYA A;  3H91 A;  3H94 A;  2N49 A;  5EGT A;  5EKK A;  3I56 A;  2UXB Q;  4DNR B;  1TWH H;  1Y8O B;  3RZD H;  1Q3L A;  3NSW A;  4CDC C;  3M4P A;  3ERQ A;  3T4A C;  4IFD I;  2M00 A;  1TWA H;  3MVV A;  4A93 B;  2R93 H;  2R7Z H;  2E75 C;  4A3J G;  1Z47 A;  3VYS A;  1BF4 A;  1Y69 U;  4YCV A;  1N36 L;  4A3E H;  2K05 A;  1MHW C;  4HCS A;  2K4K A;  4ALP A;  1FYC A;  3TRZ A;  1DZ1 A;  4OIK A;  4A3F G;  3P75 A;  1V1P A;  5JVG 3;  2I5H A;  3F2D A;  4KV6 A;  1ZEQ X;  1HUM A;  1X3E A;  5ELD A;  4X64 Q;  3GTO H;  3HG9 A;  1SYC A;  2B63 H;  2MHV A;  1X65 A;  3GTM H;  3N52 A;  1ASY A;  4K5V A;  2E2J H;  1PFB A;  1SFO B;  3I90 A;  2A6E C;  3X3N A;  5CBE E;  2KHJ A;  2F4I A;  1BO0 A;  4B08 A;  1I94 Q;  4OO1 G;  2C9O A;  2UUC Q;  2NZ1 D;  2BE5 C;  2V1C C;  2L4N A;  4DFA A;  3E0J A;  3Q0A A;  5JEA H;  3TP5 A;  3S1R H;  2HQL A;  2FIN B;  2AUJ D;  1QZG A;  1YHB A;  2CFM A;  2M2L A;  4L5Q A;  4YY3 Q;  4P72 A;  4JBM A;  2EYH A;  2R93 G;  2HD3 A;  2K5D A;  4HTH A;  5LMU Q;  3C3L A;  2UXC Q;  1S5D D;  3KOJ A;  5C0X J;  1DGS A;  1LLR D;  4KKU A;  4HJ5 A;  1U4M A;  2A74 C;  4U67 3;  1B9N A;  1SE2 A;  5COY A;  2OCE A;  3PUZ A;  1AP0 A;  3OW2 A;  4R4Q A;  3K0X A;  3T16 A;  3TP8 A;  4XYO A;  4RKL A;  5IOD A;  2Z0S A;  1JOO A;  3TP6 A;  2B63 G;  2WAQ G;  3Q24 A;  1PTO H;  5E4X A;  4ABN A;  3F2C A;  2L11 A;  2E5L L;  1J8I A;  2L55 A;  3KF8 A;  1FJG Q;  2FMC A;  1HTP A;  2JA8 B;  4DR5 L;  4JI4 Q;  5IT9 L;  2EYP A;  1DON A;  3KUP A;  2NN6 H;  2EY5 A;  4K0K Q;  4JI0 Q;  5JEA G;  2OT2 A;  4C1N K;  3CCL A;  5E3F A;  3RLO A;  5LMN W;  3PUY A;  3N6R A;  1OXU A;  4XTC S;  1SYG A;  2JXM B;  3AFP A;  2F0N A;  3K5O A;  4OWX B;  3WWV A;  2E8G A;  1B3A A;  4C3J B;  3KLW A;  1X55 A;  1KHI A;  3PV0 A;  5AJ3 L;  4QL5 A;  2LMC B;  2UU9 Q;  3HOX H;  1LTT D;  1Y8P B;  3K8A A;  3HOW G;  4APV A;  2LFN A;  2AQ2 B;  1HQR D;  1WTH A;  4KHP L;  2JYO A;  2MQH A;  3I4M B;  1NCV A;  3U50 C;  4QUF A;  2F0K A;  4JI6 Q;  4A76 A;  3HOV H;  2VXW A;  5EKI A;  1LT5 D;  3P1H A;  3NEL A;  1SYE A;  2A73 B;  3GTL H;  2NZH A;  5T1I A;  2KJX A;  4KKS A;  3PUV A;  4H13 C;  1D1K A;  2CW0 D;  2Q8R E;  3ULJ A;  1V1P B;  2NN6 G;  4RH6 A;  1SJE D;  3I4N B;  1S3O A;  1SNQ A;  1K83 H;  5IYC H;  4WJ3 M;  1CI3 M;  3HOZ H;  2EVB A;  3EFX D;  2V4D A;  4TKO B;  3Q6S A;  1WI5 A;  3M7N A;  2JA7 H;  3GTG H;  3TDQ A;  2B2V A;  3FVQ A;  3X3M A;  1AFP A;  3GP7 A;  5JJL A;  4LFC Q;  2F0F A;  1A3U A;  4MNO A;  1A8V A;  1VQ6 A;  4KN7 C;  3M3Y B;  1WJJ A;  5ISR A;  1KNA A;  1STN A;  2QGQ A;  3PIO 3;  2JSO A;  1EWI A;  3M7G A;  1HR0 L;  2F3I A;  5C0X G;  1XNQ L;  3D0F A;  1KIX A;  1E7Z A;  2PCF B;  4DV4 Q;  3MXN B;  3HOV G;  2E2D C;  3CC7 A;  2RF4 A;  1KTK A;  1QIL A;  1I5F A;  2E74 C;  4YHH Q;  3AQQ A;  5CR3 A;  3UE1 A;  1STB A;  3ULL A;  3EJI A;  2A5H A;  2JA8 G;  4RA8 A;  2R3Z A;  4JC0 A;  4HIM A;  4UAI A;  4U68 A;  3OTO Q;  5FKA C;  5K36 H;  2DY8 A;  2JP1 A;  2R6G A;  1K73 C;  1JJC B;  3A74 A;  3BVZ A;  1D5X C;  3L3O C;  4NXN L;  4DV0 L;  5H1S E;  5EJW A;  2I0Q A;  1PFM A;  4UPA A;  3KF8 B;  1A2T A;  4RCN A;  5LMN Q;  5GAH C;  1O7I A;  4HJ9 A;  1ENF A;  3U58 A;  2DY7 A;  1Z9F A;  3A8J E;  2F3W A;  5IWA Q;  3HOY H;  3S17 B;  4LF4 L;  3ICE A;  1V43 A;  1H9S A;  3TZU A;  3I4M G;  4QJF A;  1SE8 A;  2ID0 A;  4X62 Q;  2F1M A;  1DCZ A;  1R9T B;  3QWN A;  3E6Z X;  3URY A;  1SSO A;  3S2H H;  1O7Y A;  2EY6 A;  2JQO A;  3UDG A;  3DUZ A;  4DV3 L;  1V9P A;  1VQO A;  2IL8 A;  1MI2 A;  1CKN B;  4XT3 B;  5D3D A;  3L2P A;  5FLM H;  2A69 D;  3CCJ A;  1IBM L;  2UXB L;  2B2V C;  4N9P A;  5K36 G;  4JBW A;  4IUP A;  1S72 A;  4CHT B;  2K1B A;  1EQT A;  3PO3 B;  3A8I E;  4UP7 A;  1R4Q B;  4O0A A;  1ASZ A;  5A2Q E;  1K8A C;  1V1Q A;  2TMP A;  4DR2 Q;  3A56 A;  4PZ6 A;  5EBD A;  4QGU A;  1Q8K A;  1JE4 A;  1PV4 A;  1CA6 A;  2Q8I B;  1QB5 D;  2ZM6 L;  4LUZ A;  2IPK D;  5M3F B;  3U4V A;  3HOY G;  1EIG A;  3T1H Q;  2HHH L;  1E0B A;  5IT9 c;  1HZB A;  2AUK A;  3CCE A;  5IOC A;  4DR7 Q;  4X64 L;  4CKC A;  2WIN B;  2YTY A;  3NQT A;  2ES2 A;  1WTR A;  4IUV A;  4GN5 A;  4FF3 A;  1K0R A;  1EZ6 A;  3GV3 A;  2AWN A;  2EY2 A;  1N34 Q;  1VQE A;  3S1N H;  3P20 A;  1I94 L;  4AYB G;  3MEH A;  4A3M B;  3WOE A;  3NWS A;  2A1A A;  1L0W A;  2UUC L;  1TQO A;  3BVG A;  3FRP B;  2YYZ A;  4DR3 Q;  2E2H B;  2L1B A;  1HA6 A;  1X3P A;  3W1G A;  4GKJ Q;  1C9O A;  2XGT A;  5FLM G;  2ZJR A;  1EYC A;  1MSG A;  1BR9 A;  1CKO A;  4B3T Q;  2QDB A;  3CCU A;  4G7Z C;  2J0T D;  1I6H B;  5DEH A;  1GO3 E;  4G57 A;  4I7A A;  4A3B H;  1IXR A;  2L5T A;  2F0H A;  4R4O A;  3CP0 A;  1WTQ A;  1WTP A;  4R4T A;  4RMF A;  3F2B A;  3K0Y A;  3CHB D;  1LTI D;  1EU4 A;  5D65 A;  2F0V A;  3H0G H;  4LFB L;  1GHJ A;  4X65 L;  2UXC L;  4K8I A;  1A3V A;  1PMR A;  4DV2 L;  3L7Z C;  3QG1 A;  1GVP A;  1RDP D;  1QCB D;  1I50 H;  4BY1 B;  1STE A;  3CPW A;  1QNK A;  3EN2 A;  3AMU A;  4K5W A;  2CQO A;  1VQ5 A;  5GAD C;  4H02 A;  3R3O A;  4Q0F A;  1FNU A;  3PIP A;  3KYH C;  2ICI A;  2ALY B;  3A7L A;  5KEE A;  2MNA A;  1XMO Q;  4P2C B;  1FJG L;  1B50 A;  1TII D;  1RHP A;  3TEH B;  4JI4 L;  3J80 E;  3E9H A;  2F0S A;  2AWO A;  4ZUJ A;  4K0K L;  2G9H D;  4JI0 L;  1BNZ A;  4C3H B;  5I9O A;  4JV5 Q;  3CQZ H;  4B3M L;  1EY4 A;  3J80 i;  4ILW A;  2QF7 A;  5C3E H;  1PH5 A;  2BA0 A;  1JT8 A;  4P71 A;  1AEX A;  3K5N A;  1WTO A;  4O42 A;  3RD4 A;  2NWG A;  3V2T A;  4BS9 A;  2KEC A;  3UDX A;  5C5L A;  5EAY A;  5J3B A;  1JOQ A;  2B2U A;  4TVA B;  2R7D A;  3CXC A;  1PH8 A;  3M4Y A;  1T5X D;  2IWH A;  3NTK A;  4HSP A;  4C3I B;  2NVT B;  4NKL A;  2WV6 D;  5FLX L;  4K2L A;  1W6K A;  2F0T A;  1JIC A;  2ICE C;  1YEZ A;  3W1B A;  4L5S A;  2WP8 J;  1PRT D;  2FFK B;  5M5X H;  3FEW X;  2VUM G;  5IYD H;  4JI6 L;  1I3Q B;  1II3 A;  5BN4 A;  2OQ0 A;  2MO0 A;  3T51 B;  2JA6 H;  2OTJ A;  3MWY W;  2UXD Q;  4GN3 B;  4NP5 A;  1XPR A;  4MIU A;  1CHP D;  2PQA A;  2Z4H A;  1M8A A;  4L5T A;  4A3M G;  3F2U A;  2F0Q A;  2K32 A;  5C4J B;  1BBX C;  2QA4 A;  3KK7 A;  1QUQ A;  3ERO A;  3SDZ A;  4B3R Q;  3HFZ B;  2TSS A;  2K14 A;  3DLL A;  1PYS B;  4KKT A;  3UDF A;  1N9W A;  2N88 A;  1GOZ A;  3HRZ C;  3R2T A;  4RGO S;  3DM1 A;  4ID6 A;  1R4P B;  1H9R A;  3DEP A;  4TRD A;  4XQJ A;  1CK1 A;  1D6E C;  1EQQ A;  3K7A B;  4KHV A;  2F0P A;  1HPC A;  1HNW Q;  3G71 A;  1BDO A;  3J7Y W;  2QW7 A;  4IFD H;  1VS0 A;  1FR3 A;  1I4X A;  4LFC L;  1PH3 A;  3D6C A;  2PNR C;  4LF8 Q;  3S2D B;  5G3L D;  2NVX H;  1HFN A;  4IZ8 A;  4RFB A;  3BDC A;  4A3I H;  2VB3 X;  4OX9 Q;  2F4V Q;  1M4V A;  1PTO F;  1I4P A;  3NE5 B;  1CHQ D;  5HUR A;  3HZX A;  1IL2 A;  3S1Q H;  2K5V A;  4PQX A;  5C4Z A;  5GAE C;  1J9O A;  1BVS A;  3FPP A;  4LMQ D;  1ZYR D;  1OXX K;  4A3J B;  2JA6 G;  1DXM A;  3MXP A;  2K28 A;  4N8X 1;  3M4O H;  3OSO A;  4HMI A;  3TP7 A;  3T1Y Q;  2E76 C;  4A3F B;  1BUV T;  1FVI A;  2Q2I A;  4IUT A;  2HT1 A;  3BYY B;  1SYD A;  4J8Q A;  2VW9 A;  2B2U C;  1V8Q A;  3V96 A;  3QOL A;  4BWG B;  4A3G H;  3G4S A;  1C7Y A;  1E3P A;  5HY6 A;  1LAB A;  3D6W A;  1VQJ A;  3M85 A;  2K52 A;  2BH2 A;  1WCM H;  4R4C A;  4IUN A;  2FMM A;  5JAV A;  5DAU A;  1I6V C;  5LMN L;  2KHS A;  2JA5 H;  5C44 H;  1JJ2 A;  4FXG C;  1VCI A;  4B3S Q;  1V1O A;  4BY7 B;  4IUQ A;  1OO9 B;  1YNN C;  2PZW A;  2IHF A;  4DV6 Q;  5IWA L;  1SDF A;  2Z4I A;  2Z8L A;  1O7Z A;  1EEF D;  1F9S A;  1XX8 A;  2HCC A;  3BVM A;  2WAQ E;  4WOR A;  5CV9 A;  4LNQ A;  4BBS H;  2N3S A;  5IGD A;  1TWH B;  1A62 A;  3LX0 A;  3BJU A;  3H3V H;  2KEN A;  1F2Y A;  1I4G A;  3NBH B;  4XYQ A;  1PH4 A;  1TWA B;  1G91 A;  3K80 C;  2R93 B;  2UUA Q;  2R7Z B;  1SNM A;  1J6Q A;  5EPJ A;  1J5E L;  3EA6 A;  2HCI A;  2B2T C;  3IAY A;  1S4Z A;  3VA5 A;  1B8A A;  1XYI A;  3ER0 A;  3F1Z A;  1C0A A;  2G9D A;  4KK7 A;  3CCV A;  1ZYR C;  1GUO A;  1L0Y B;  1XJV A;  3J81 L;  2ZTE A;  4A3G G;  3PO2 H;  2F0E A;  3GTO B;  2RDF A;  1MBY A;  4RGM A;  2B63 B;  2WAQ B;  1U5K A;  4XQN A;  5E4W C;  4DUZ Q;  1WCM G;  3SEB A;  2B39 A;  4DR2 L;  2E2J B;  2PQA B;  3CRL C;  3D3R A;  1LV9 A;  5JEA J;  2F0L A;  2ASB A;  3CU7 A;  4Z9C B;  1FNW A;  2MUY A;  4CGY B;  1ROD A;  1YBY A;  1I4Q A;  1BKB A;  1SNC A;  1LO5 D;  4BBS G;  3PF5 A;  2BH8 A;  4LW1 A;  2CH4 A;  1PTO C;  3S1R B;  4DR7 L;  1ET9 A;  4DAP A;  1YNJ C;  5C4X H;  5I4D A;  2KUM A;  4GKK L;  2PQE A;  4GLA C;  1C8C A;  2H4O A;  1D2B A;  2Y0S G;  2O5J C;  5NUC A;  3RLN A;  3K58 A;  1IKM A;  3D4D A;  3KFU A;  1N34 L;  4KTA A;  1X3Q A;  4KY5 A;  3M9B A;  1M90 C;  4NXM L;  3DXJ C;  1MD2 D;  1F2L A;  2NVQ B;  1QVG A;  3NXW A;  3U4Z A;  3QR8 A;  3DEO A;  4LF5 Q;  1QE6 A;  3K7U C;  4KLK A;  2QEJ C;  3HOW B;  4GKJ L;  2PPB C;  5CMD A;  1VQL A;  4LFA Q;  3JAM L;  2AMC B;  4B3T L;  4LF9 Q;  3PMF A;  4ME3 A;  5FLX c;  1HNZ Q;  5IIF A;  4DAM A;  4HED A;  3L0O A;  3SXH A;  2GVB A;  4H7B A;  1UE7 A;  1EU3 A;  1I4R A;  1LTL A;  1X32 A;  3I7F A;  1PTO B;  3OYY A;  2N78 A;  3A55 A;  4DV5 Q;  1NUC A;  4A4I A;  2OQK A;  1TS5 A;  3OPO A;  4L5R C;  4GNX A;  3KLR A;  4BY7 G;  1IKL A;  3HOU H;  4DN4 M;  4PV1 C;  1SE3 A;  1G2T A;  4AQY Q;  3A54 A;  5IGC A;  2RKS A;  3NTI A;  4KY7 A;  2D62 A;  2PW7 A;  1EIF A;  5C4X G;  2X6L A;  1AH9 A;  4KD4 A;  4ZRZ A;  4DNI A;  2R7Z G;  3MXN A;  1XMO L;  2A8V A;  1A63 A;  4A3E G;  3H3V I;  2GA4 B;  1SBB B;  1LT4 D;  1KXL A;  3CCS A;  1TKW B;  1ENA A;  2QCP X;  3O13 A;  1HRJ A;  1IHZ A;  1S5F D;  3RMH A;  3HOV B;  2R7F A;  3KLS X;  2X69 A;  1S5E D;  4TQU S;  1LT6 D;  1SLJ A;  2AQ3 B;  5C3W A;  2ZJQ A;  4G4K A;  5JJI A;  5EBC A;  1D8L A;  3NTH A;  1H9M A;  1SYF A;  2MPM A;  1VQH A;  3Q8D A;  1WVL A;  2B2Y A;  3K81 C;  3HOU G;  4EGV A;  5KNC A;  2PZT A;  3M4Q A;  1K83 B;  2KED A;  1G51 A;  1VQN A;  2VNU D;  1X3G A;  1KAA A;  4C2M H;  4EX5 A;  3GTG B;  2IW3 A;  5I2X A;  1F2M A;  3A5Z B;  1VQP A;  2UXD L;  1QNU A;  1XWE A;  1ILQ A;  4FNF A;  1K28 A;  1PFN A;  4A75 A;  2K50 A;  4J15 A;  1U0L A;  3BZK A;  4A3K H;  2Z9H A;  3MAQ A;  1TS4 A;  1CKN A;  1ZXT A;  2FJ2 A;  3TME A;  1VMP A;  2PW5 A;  1D7Q A;  4GNX C;  1CFM A;  1WTV A;  3NPP A;  1BBU A;  4JYA Q;  3R93 A;  4LJZ C;  3HP3 A;  1IZ6 A;  3MEF A;  1ICF B;  2KCT A;  1HNW L;  2O5I C;  1MKH A;  5FO8 B;  1GUG A;  2O2L D;  2F0I A;  1IBK Q;  4HMJ A;  2D2C C;  1E2V A;  3SK8 A;  1JOR A;  1ONL A;  1E1O A;  4CDD C;  4UP9 A;  4AYB E;  2FXQ A;  5COR A;  1CZW A;  3J81 c;  4JI5 Q;  4JI3 Q;  4FDB A;  1IYJ B;  4JI7 L;  2Q2T A;  1EY8 A;  4GNX B;  1YIT A;  3I4L A;  3FKI H;  2XRQ D;  4CKE A;  1E24 A;  3HOX G;  4Q5V A;  4X3S A;  3HOY B;  1L2F A;  4A3K G;  4LF6 Q;  1Z7T A;  5KYL A;  4ZLT F;  5IGF A;  4LUV A;  3J7Z C;  2F0M A;  1VQA A;  2B2Y C;  2YU9 H;  1LTG D;  1HJP A;  3I3C A;  4FF2 A;  1WOC A;  4AYB B;  1B3Q A;  3IFT A;  4B3S L;  2BOS A;  3OW7 A;  1PLF A;  1O7L A;  4LUO A;  4X3K A;  1GUW A;  1QZH A;  5BN5 A;  1B70 B;  2KOL A;  1JE5 A;  4ZKC B;  4CDF C;  1GJX A;  3WOF A;  4XQQ A;  5IYC G;  3T13 A;  3MC0 B;  4JVZ A;  3Q23 A;  1Y1V H;  2EYL A;  5HGQ A;  2CW0 C;  3JAM c;  2F03 A;  3HOZ G;  1KL9 A;  4PMB A;  1SN8 A;  4WRD A;  2EDG A;  1PDQ A;  1RF2 D;  4IUR A;  2UUA L;  2RSN A;  2JA7 G;  1KLU D;  4RKB A;  4AIM A;  2LSS A;  4P74 A;  3ONA B;  4H44 C;  2JEB I;  4EQ5 A;  4X66 L;  2MJ8 A;  3FKI G;  3VYT A;  4ZKB B;  1JMC A;  3I4N H;  1Q1B A;  3I4O A;  3AEV A;  1VMC A;  1WFQ A;  3LWE A;  4ZK9 B;  5FOB B;  2PO4 A;  4I7Z C;  1XMQ Q;  4O2D A;  4FYD A;  1DOM A;  4GOP C;  2VY3 A;  2J4X A;  4POF A;  5E7N A;  5FLX E;  3A8K E;  4JI8 Q;  3TS2 A;  2NUC A;  3S1N B;  3EVQ A;  1EEI D;  3CMA A;  4WJ4 A;  4MTK A;  3RZO H;  3KJO A;  1EY7 A;  4GLX A;  4A3D H;  1Z6H A;  1JR0 D;  1HUN A;  2DJF C;  2KVM A;  1LAC A;  3LGJ A;  2GVA A;  1TWC H;  2A19 A;  2OEO A;  1Y1V G;  4A3B B;  1Q7Y C;  3C1E A;  3FHW A;  4G7O C;  1PZJ D;  2EYJ A;  4GOP B;  1GUN A;  5ELF A;  1YZ6 A;  2IX3 A;  2DNE A;  3FMC A;  4DPG A;  2IY5 B;  1Y1W H;  3GTQ H;  2PI2 A;  5IGE A;  3H15 A;  4HN7 A;  1IW7 D;  4LFA L;  1I50 B;  1KC8 C;  1CA5 A;  4LF9 L;  2RHS B;  1XNR Q;  2VUM B;  5KNB A;  1X54 A;  4GLV B;  2XTI A;  4LK1 C;  2BDN A;  4IN3 A;  1X9N A;  5IP7 H;  1PH6 A;  1GM5 A;  2XIW A;  4DV5 L;  4IJH A;  2RDG A;  2BCO A;  3FDT A;  3RLF A;  1VQD A;  1EL0 A;  2YTX A;  5DM7 3;  3V05 A;  3GTP H;  2E2I H;  4A3D G;  2GN5 A;  3BZC A;  1UWV A;  4IPD A;  4K5X A;  2L15 A;  1PZK D;  4HIK A;  3MFG A;  1GXD C;  1YHA A;  1SXT A;  2RSO A;  2LS0 1;  4RGT A;  3CQZ B;  4L63 B;  4K8J A;  1TWF H;  3VR2 A;  3OMG A;  5C3E B;  4YY3 L;  2A69 C;  1H95 A;  1N36 Q;  1TWG H;  5LMU L;  4JW0 A;  5BN3 A;  2DNC A;  3J81 j;  5CV5 A;  5D14 A;  4YCW A;  1Y1W G;  3S16 H;  3KDF B;  3I91 A;  4FVM A;  2EJF C;  1YHQ A;  1UAP A;  4K6D A;  5FO7 B;  3I2Z A;  2K04 A;  3S1M B;  3SK6 A;  1CQV A;  5M5X B;  1N33 Q;  5LHY 1;  5BR8 Q;  2JA6 B;  5IP7 G;  3MHB A;  1PH7 A;  3E3X A;  5ELC A;  3QOJ A;  5ELB A;  1SMY D;  1TY0 A;  1PRT F;  3CW2 C;  3OWE B;  1KRT A;  2K75 A;  1VQB A;  4M8A A;  1G8Z D;  3NEN A;  4KMU C;  1D5Z C;  1W2B A;  1YIJ A;  1JB7 A;  4ODG A;  4A3B G;  2NVY H;  2PI2 E;  4HCE A;  3C2P A;  2ZXR A;  4IFD J;  3S15 H;  1JB3 A;  2K5Q A;  4DK1 A;  1GUS A;  3MZ5 A;  4MZ9 A;  5M3M H;  3NBH A;  1PH9 A;  4DV7 Q;  3QJY A;  3STB D;  3H0G G;  2ZTC A;  2UU9 L;  2RDH A;  1KAW A;  4BBR H;  3I72 A;  1UE1 A;  1SRU A;  1CT1 D;  2AQ1 B;  2G5D A;  3A7A B;  3DWP A;  1YJN A;  4QCL A;  4DAV A;  4JYA L;  1VF5 C;  1S40 A;  2E5L Q;  1B9M A;  2BA1 A;  1IBL Q;  5G3L F;  1X56 A;  5EPL A;  4FXD A;  4DGZ A;  3M4O B;  1JC7 A;  1RJT A;  4CDE C;  1SNP A;  4DR5 Q;  3AB9 A;  1SRO A;  1NNX A;  2CQA A;  1VF7 A;  2R92 H;  1JWU D;  2NTT A;  2QEX A;  2VL6 A;  4IPG A;  4JG2 A;  2Y0S E;  5C3X A;  1X6O A;  2B3G A;  1IBK L;  1X3F A;  3KF6 B;  1CQF A;  1F77 A;  4DKA C;  4A3G B;  2BDO A;  2B2T A;  1HHV A;  4UP8 A;  2F0G A;  3TQY A;  5LL6 S;  1BCP D;  1G2S A;  2KCM A;  4RAU C;  5C3E G;  1WCM B;  2D0O A;  4JI5 L;  5M3M G;  4JI3 L;  5CV7 A;  1T9H A;  5AJ3 Q;  1G6P A;  1PYB A;  1NJI C;  1AW7 A;  2I5L X;  5M5W H;  2CH4 W;  2C5C A;  5A2Q L;  2EJM A;  2K7V A;  4Y7N H;  2Z6B A;  4KI0 A;  4BBR G;  4NB3 A;  1Q46 A;  4KHP Q;  1JWM D;  4LF6 L;  5IYB H;  4IPH A;  4BBS B;  2Q2H A;  2RBM A;  1EIH A;  4IOA A;  5IYD G;  1ZKO A;  2Y0S B;  2Z6K C;  3KBG A;  4DV4 L;  1KDB A;  3HGB A;  1ML0 D;  4YHH L;  3VR6 A;  3PIO A;  2A6H D;  1UE5 A;  3RN5 A;  4C3I H;  1PRT C;  3KLS A;  4R8I A;  3OIP A;  2R92 G;  2ZXP A;  1STG A;  4H0L C;  1H9J A;  2HDL A;  3OTO L;  2B8G A;  4R1J A;  3MA2 B;  3OWF A;  1ESF A;  4YWK A;  2H1E A;  1EOT A;  3CCR A;  4FF4 A;  1C48 A;  2HIV A;  3PO2 B;  3W3A A;  4RG1 A;  2I46 A;  2EIF A;  2F0D A;  1RKN A;  1JWS D;  3VDY A;  5D3I B;  1G29 1;  2SDF A;  1SAP A;  4F87 A;  5HGT A;  4IFD G;  4FXK C;  2L9H A;  1DM0 B;  5FK9 C;  1TVX A;  1NTG A;  1EUJ A;  2PYK A;  2SEB D;  1HR0 Q;  2SOB A;  4KN4 C;  4BXX H;  5IYB G;  1WD0 A;  1PRT B;  3CCQ A;  4A3I G;  1HA5 A;  5FO9 B;  2KHI A;  3RZD B;  5EQ0 A;  3VR5 A;  3GTK H;  5I2Y A;  5C4X B;  4X62 L;  5IT9 E;  1IL8 A;  1PZI D;  1AZP A;  5FJ8 H;  4DV1 Q;  4YIJ A;  1PFS A;  2O4X A;  4QIW E;  1RD9 D;  1A6X A;  3TSS A;  4ME5 A;  4PZ8 A;  4YCU A;  4A3E B;  2CKZ B;  1GHK A;  1NMF A;  5GAG C;  2Q8T A;  1NY4 A;  3RNU A;  1KNE A;  2OF1 A;  1KDA A;  1RCV D;  3G6E A;  1HXY D;  4K6L A;  4OIJ A;  2FHT A;  2MP1 A;  4F88 A;  3F8T A;  1GUT A;  3J80 L;  1SR3 A;  3B6Y A;  4HJ7 A;  5IY0 A;  4A3J H;  1H9K A;  4F8M A;  2MGS A;  3GTM B;  1EYG A;  3GTJ H;  1F9Q A;  4X3T A;  1DD2 A;  2JA5 G;  3ND9 A;  1VQC A;  1SEB D;  5C44 G;  1N8R C;  1QOH A;  1SMX A;  1HH2 P;  3HEJ A;  4DK3 C;  4X3U A;  5CV4 A;  4QIW B;  4EQO A;  3HOU B;  2A6E D;  3T1H L;  2VS1 A;  1QVF A;  2JE6 I;  4BXX G;  3S24 A;  4JI2 Q;  5M5Y H;  1SNO A;  4JK1 C;  5L37 A;  2BE5 D;  2YTV A;  3NBI A;  1NMG A;  4FF1 A;  2KBN A;  4GZY C;  1EYD A;  3P7J A;  5E1F A;  1GD7 A;  1LTR D;  4OO1 H;  1STH A;  4JCV E;  4ZYS A;  5CGK A;  3A0J A;  4C1N I;  1VDZ A;  2UUB Q;  4ZCK A;  1IBM Q;  1NBW A;  5DLQ E;  4DR3 L;  4DR4 Q;  2RVL A;  5ELN A;  3KJP A;  1KD1 C;  2F0J A;  1HQM C;  3HKZ E;  4BA1 I;  4AH6 A;  3PO2 G;  3AFQ A;  1LT3 D;  5M9O A;  2B8F A;  4DR1 Q;  3LWU A;  1O78 A;  1NE3 A; 
#chains in the Genus database with same CATH homology
 1L1O B;  1HZA A;  2Q2T A;  4GNX B;  4AYB G;  2ZM6 Q;  1YIT A;  1I94 L;  4UY8 C;  3JC6 6;  4JOI A;  3S14 H;  3FKI H;  2A1A A;  1L0W A;  2UUC L;  2NVT H;  1E24 A;  3HOX G;  5GQO A;  4DK6 C;  2OTL A;  2JJQ A;  2RCN A;  2YYZ A;  4DR3 Q;  1VQ8 A;  3W1G A;  2HHH Q;  4GKJ Q;  1C9O A;  1L2F A;  2XGT A;  2C35 B;  4BY1 G;  5FLM G;  2VQF L;  2ZJR A;  4A3K G;  1CKO A;  4LF6 Q;  1EQR A;  4B3T Q;  1VQ4 A;  4HID A;  4A3L H;  3CCU A;  2JK8 A;  3CCM A;  4LUV A;  3J7Z C;  4A3B H;  1GO3 E;  1I3Q H;  1N33 L;  1IXR A;  1VQA A;  2IHE A;  4R4O A;  3CP0 A;  1CSQ A;  4HJ8 A;  2YU9 H;  4DR6 L;  4R4T A;  1AE3 A;  4RMF A;  5BR8 L;  3F2B A;  1VQF A;  4DUY Q;  4JI7 Q;  3RR5 A;  1HJP A;  3E0E A;  3S1N H;  1CUK A;  2LXJ A;  3H0G H;  1WOC A;  4LFB L;  4X65 L;  3CC4 A;  2UXC L;  4B3S L;  5C4J H;  2JA9 A;  4DV2 L;  4LUO A;  1UE6 A;  3L7Z C;  1GVP A;  4IJL A;  1QZH A;  4LF7 Q;  1B70 B;  1JE5 A;  1I50 H;  2I5M X;  3CPW A;  1EIY B;  3CC2 A;  4YWL A;  2CCZ A;  1VQ9 A;  5IYC G;  3PSI A;  1XNQ Q;  3PUW A;  3EN2 A;  4JV5 L;  4OWT B;  1XMQ L;  1Y1V H;  5HGQ A;  3JAM c;  3HOZ G;  1JJG A;  4A93 H;  1KL9 A;  1GKH A;  2CQO A;  2LXK A;  1VQ5 A;  1SN8 A;  5GAD C;  1M1K C;  3PF4 A;  3K7A H;  4H02 A;  4KHZ A;  3TRE A;  2UUA L;  3PIP A;  3KYH C;  2JA7 G;  1Q1E A;  3EIV A;  4JI8 L;  2ALY B;  2IT1 A;  1B7Y B;  2LSS A;  4AIM A;  2MNA A;  4DV7 L;  4X65 Q;  4P74 A;  1XMO Q;  1EFW A;  2NVQ H;  1FJG L;  5IP9 H;  4HJA A;  2JEB I;  4EQ5 A;  1QVC A;  4X66 L;  4DV2 Q;  3FKI G;  3TEH B;  2IX1 A;  4JI4 L;  3HOW H;  1RL2 A;  3E9H A;  1JMC A;  3I4N H;  5IE8 A;  3S2D H;  1OXT A;  1Q1B A;  4POG A;  2NZO A;  3I4O A;  1YJ9 A;  2AWO A;  3AEV A;  1P16 A;  1AE2 A;  1YNX A;  1WFQ A;  4P73 A;  4K0K L;  4JI0 L;  4MTN A;  4A3L G;  4JV5 Q;  1XMQ Q;  3CQZ H;  4B3M L;  4O2D A;  4P75 A;  4GOP C;  3J80 i;  2VY3 A;  4NXN Q;  4DV0 Q;  5C3E H;  4POF A;  1PH5 A;  5JJK A;  2BA0 A;  5E7N A;  1JT8 A;  4IO9 A;  4P71 A;  4R4I A;  1SFO H;  1LYL A;  4JI8 Q;  5GRO A;  2ZTD A;  3TS2 A;  3CF5 A;  1IBL L;  2ATW A;  1XPU A;  3UDX A;  5EAY A;  3CPF A;  5J3B A;  5ELO A;  4X66 Q;  4TVA B;  2R7D A;  3ERS X;  3CXC A;  4IPC A;  3GO5 A;  3CMA A;  1PH8 A;  1K9M C;  4WJ4 A;  1OTC A;  4A3F H;  3RZO H;  4LF4 Q;  4YWM A;  3KJO A;  4GLX A;  4A3D H;  1VQK A;  2K5H A;  4B3R L;  2HIX A;  1YEZ A;  3W1B A;  4L5S A;  2WP8 J;  4B3M Q;  3LGJ A;  2GVA A;  4JOI C;  1TWC H;  5M5X H;  2VUM G;  1XPO A;  2A19 A;  4OO1 I;  3PGZ A;  1Y1V G;  4JI6 L;  1XNR L;  5IYD H;  1Q7Y C;  4A93 G;  3FHW A;  2OQ0 A;  2MO0 A;  1E22 A;  3UE0 A;  2VQE Q;  2JA6 H;  2OTJ A;  4LWC A;  5FJ8 G;  2UXD Q;  4A3C H;  4GN3 B;  3CME A;  1XPR A;  4GOP B;  2PQA A;  1K3R A;  3DM3 A;  1YZ6 A;  3W5O A;  4L5T A;  5IP9 G;  4A3M G;  1QUQ B;  4DV3 Q;  4BY7 H;  4DPG A;  2IY5 B;  2DGY A;  1Y1W H;  4JI1 Q;  4GOP A;  2PI2 A;  2QA4 A;  3GTQ H;  2N49 A;  1QUQ A;  3I56 A;  2UXB Q;  4PZ7 A;  3H15 A;  4LF8 L;  4B3R Q;  3HFZ B;  4LFA L;  1TWH H;  3RZD H;  2K14 A;  3DLL A;  1KC8 C;  4LF9 L;  1PYS B;  3UDF A;  1N9W A;  2RHS B;  1Q82 C;  4OX9 L;  3M4P A;  1XNR Q;  2F4V L;  4IFD I;  1X54 A;  4GLV B;  1TWA H;  1HNX Q;  2XTI A;  2R93 H;  2R7Z H;  3J80 c;  4A3J G;  1EQQ A;  1X9N A;  1Z47 A;  5IP7 H;  1PH6 A;  3HKZ G;  4YCV A;  1K8G A;  1N36 L;  1GM5 A;  1HNW Q;  4A3E H;  3G71 A;  4DV5 L;  2JA8 H;  4IJH A;  3AYH B;  3A5U A;  1VS0 A;  2K4K A;  3T1Y L;  4ALP A;  4LFC L;  3RLF A;  1VQD A;  3TRZ A;  1PH3 A;  3UDI A;  2YTX A;  4A3F G;  4LF8 Q;  3GTP H;  2E2I H;  2NVX H;  2I5H A;  3F2D A;  4A3D G;  2GN5 A;  3BZC A;  1UWV A;  4IPD A;  2L15 A;  4A3I H;  4HIK A;  1X3E A;  4OX9 Q;  1YHA A;  4X64 Q;  2F4V Q;  3GTO H;  4DR1 Q;  1IL2 A;  2IX0 A;  3S1Q H;  1TWF H;  2B63 H;  1X65 A;  2K5V A;  3GTM H;  5GAE C;  4YY3 L;  1BVS A;  4C3J H;  1ASY A;  2E2J H;  2D0P A;  1OXX K;  1H95 A;  2JA6 G;  1N36 Q;  2KHJ A;  4A3C G;  1YI2 A;  3M4O H;  1TWG H;  1I94 Q;  5LMU L;  3I55 A;  3T1Y Q;  4OO1 G;  1KQS A;  2K5N A;  3J81 j;  2UUC Q;  4YCW A;  2V1C C;  1Y1W G;  3S16 H;  3KDF B;  3EBE A;  4DV6 L;  1YHQ A;  2VQF Q;  4OON A;  2N8N A;  1FVI A;  2Q2I A;  3I2Z A;  1Q86 C;  2HT1 A;  3I4M H;  3KDF A;  2VW9 A;  1PA6 A;  3S1R H;  2HQL A;  4A3G H;  3GD7 A;  3G4S A;  1QZG A;  1E3P A;  5HY6 A;  2H5X A;  1C7Y A;  1YHB A;  2CFM A;  1VQJ A;  1N33 Q;  4QQB X;  3M85 A;  4L5Q A;  2K52 A;  4YY3 Q;  2BH2 A;  4P72 A;  2F52 A;  4JBM A;  1WCM H;  4R4C A;  2R93 G;  4DR6 Q;  4DV1 L;  5BR8 Q;  5LMN L;  5IP7 G;  2RHQ B;  5C44 H;  5LMU Q;  1PH7 A;  1JJ2 A;  2JA5 H;  3CD6 A;  1VCI A;  2UXC Q;  1YVC A;  3KOJ A;  4B3S Q;  5C0X J;  4FDB A;  2ZJP A;  1OXV A;  1DGS A;  2IHF A;  2WB1 E;  3CW2 C;  5IWA L;  4DV6 Q;  4HJ5 A;  1WYD A;  2B29 A;  1KRT A;  2K75 A;  1VQB A;  4X6A H;  4LNQ A;  2WAQ E;  2OCE A;  3PUZ A;  2N3S A;  4BBS H;  1A62 A;  3NEN A;  1LUZ A;  3BJU A;  3OW2 A;  3H3V H;  4R4Q A;  3K0X A;  2KEN A;  1W2B A;  1YIJ A;  1JB7 A;  2AHO B;  3NBH B;  4A3B G;  2NVY H;  2PI2 E;  2Z0S A;  2B63 G;  2WAQ G;  4IFD J;  1PH1 A;  1PH4 A;  2NN6 I;  3K80 C;  3S15 H;  2UUA Q;  5M3M H;  4MZ9 A;  4DUZ L;  3F2C A;  3NEM A;  1VQM A;  1P8L A;  1J6Q A;  1PH9 A;  2E5L L;  4DV7 Q;  2WFW A;  1N32 Q;  1J5E L;  1FJG Q;  3STB D;  3H0G G;  2ZTC A;  4PMW A;  4DR5 L;  4JI4 Q;  2UU9 L;  1B8A A;  4XIG S;  1KAW A;  3IRB A;  2OWO A;  3ER0 A;  3F1Z A;  3M3Y H;  4BBR H;  1C0A A;  1BBW A;  3CCV A;  1UE1 A;  1SRU A;  1MIU A;  1XJV A;  4K0K Q;  4JI0 Q;  5JEA G;  4JI2 L;  3CCL A;  3SGI A;  1YJN A;  2ZTE A;  3RLO A;  5LMN W;  4A3G G;  3PO2 H;  3PUY A;  4DAY B;  1VQG A;  1OXU A;  4XTC S;  3WWV A;  4JYA L;  3AFP A;  4OWX B;  1U5K A;  4DUZ Q;  4DR2 L;  1WCM G;  2E8G A;  1LM0 A;  2PQA B;  1S40 A;  3KLW A;  2BA1 A;  2E5L Q;  1J5E Q;  1IBL Q;  1X56 A;  1X55 A;  1KHI A;  3PV0 A;  1Q12 A;  4QL5 A;  5C0X I;  5AJ3 L;  4DR5 Q;  2UU9 Q;  3HOX H;  5JEA J;  1SRO A;  3K8A A;  4LF5 L;  2ASB A;  2R92 H;  3HOW G;  2UUB L;  4APV A;  2QEX A;  3I4N G;  4DR4 L;  1YBY A;  2VL6 A;  4IPG A;  1BKB A;  2PMZ E;  2Y0S E;  4JG2 A;  1X6O A;  4KHP L;  2B3G A;  1IBK L;  1X3F A;  3KF6 B;  2MQH A;  2BH8 A;  4LW1 A;  4OXP A;  3PF5 A;  4BBS G;  3U50 C;  4DR7 L;  1PH2 A;  4DKA C;  1HNZ L;  2EQS A;  5C4X H;  4JI6 Q;  4UP8 A;  3KF6 A;  4A76 A;  4GKK L;  4GLA C;  1FL0 A;  3TQY A;  3HOV H;  2Y0S G;  3RLN A;  2KCM A;  1XTD A;  5C3E G;  3KFU A;  3NEL A;  2D0O A;  4JI5 L;  5M3M G;  4JI3 L;  1N34 L;  4DR1 L;  1T9H A;  3GTL H;  3GDE A;  5AJ3 Q;  3M9B A;  1M90 C;  1PYB A;  2CWP A;  1NJI C;  2NZH A;  4NXM L;  1G6P A;  2I5L X;  3PUV A;  5M5W H;  1QVG A;  3ULJ A;  3U4Z A;  4LF5 Q;  1VQI A;  2Q2U A;  3K7U C;  4KLK A;  3S17 H;  4Y7N H;  3FP9 A;  4KI0 A;  1A0I A;  2NN6 G;  4BBR G;  4NB3 A;  1Q46 A;  4GKJ L;  1VQL A;  4KHP Q;  4LF6 L;  4IOC A;  1S3O A;  1K83 H;  4LFA Q;  5IYC H;  2AMC B;  5IYB H;  4WJ3 M;  4B3T L;  4LF9 Q;  4IPH A;  4AQY L;  1HNZ Q;  4ME3 A;  5FLX c;  3J7A 5;  2Q2H A;  3HOZ H;  1CKM A;  4DAM A;  4GKK Q;  1WI5 A;  3L0O A;  3CAM A;  2JEA I;  4IOA A;  5IYD G;  2Z6K C;  4DV4 L;  3M7N A;  2GVB A;  1R9T H;  1UE7 A;  4QY7 A;  2JA7 H;  3GTG H;  1LTL A;  4DUY L;  3I7F A;  3OYY A;  4NXM Q;  3BU2 A;  4YHH L;  3PIO A;  2N78 A;  1FGU A;  4DV5 Q;  4A4I A;  1UE5 A;  2OQK A;  3RN5 A;  3ULP A;  4C3I H;  1L1O A;  4L5R C;  5JJL A;  3D31 A;  4GNX A;  4LFC Q;  1YJW A;  4BY7 G;  4MNO A;  1A8V A;  2R92 G;  1VQ6 A;  2PNH A;  4NPS A;  3HOU H;  4LF7 L;  3OTO L;  1WJJ A;  4R1J A;  1HR0 L;  2QGQ A;  4AQY Q;  4JBK A;  1EWI A;  4PG3 A;  3PO3 H;  2F3I A;  5C0X G;  4YWK A;  1XNQ L;  3D0F A;  2D62 A;  1KIX A;  3CCR A;  1E7Z A;  1EIF A;  2HIV A;  3RN2 A;  5C4X G;  4DV4 Q;  3MXN B;  4RG1 A;  3ZJY C;  1AH9 A;  3HOV G;  2EIF A;  4DNI A;  1UEB A;  3CC7 A;  2RF4 A;  2DUD A;  3VDY A;  2R7Z G;  1I5F A;  1G29 1;  4YHH Q;  1XMO L;  1N32 L;  3AQQ A;  3UE1 A;  1VQ7 A;  2A8V A;  1A63 A;  4A3E G;  3ULL A;  5M3F H;  2JA8 G;  3H3V I;  4GN4 B;  4JC0 A;  4IFD G;  2CWA A;  4HIM A;  1KXL A;  3CCS A;  3OTO Q;  1NTG A;  1EUJ A;  2EXD A;  2Z6K A;  1HR0 Q;  1HZC A;  2R6G A;  1K73 C;  1JJC B;  3A74 A;  1Y14 B;  5IYB G;  4BXX H;  2VUM H;  1EOV A;  3CCQ A;  4A3I G;  2KHI A;  3GTK H;  2WB1 G;  4NXN L;  4DV0 L;  4X62 L;  5H1S E;  2I0Q A;  2R7F A;  4UPA A;  5FJ8 H;  3KF8 B;  4DV1 Q;  1PVO A;  4TQU S;  1SLJ A;  1PFS A;  4QIW E;  5LMN Q;  2ZJQ A;  5GAH C;  1O7I A;  4A3M H;  5JJI A;  4PZ8 A;  1HR0 W;  4HJ9 A;  3TS0 A;  3U58 A;  4YCU A;  1E1T A;  1OXS C;  1RIP A;  1TXY A;  1Z9F A;  2CKZ B;  4Y52 H;  1D8L A;  1NMF A;  2E2H H;  5GAG C;  5IWA Q;  3HOY H;  1NY4 A;  1VQH A;  3Q8D A;  4LF4 L;  3K81 C;  3RNU A;  3HOU G;  3ICE A;  1V43 A;  3G6E A;  3M4Q A;  3PO3 G;  1G51 A;  1VQN A;  3I4M G;  1I6H H;  3F8T A;  2VNU D;  4QJF A;  3J81 i;  3G48 A;  1SE8 A;  1SR3 A;  1X3G A;  3B6Y A;  2ID0 A;  4X62 Q;  4HJ7 A;  5IY0 A;  4C2M H;  4A3J H;  2VZA A;  4EX5 A;  2VQE L;  3HKS A;  1EYG A;  2UXD L;  3GTJ H;  3A5Z B;  1VQP A;  3S2H H;  2JA5 G;  2JQO A;  1VQC A;  5C44 G;  3UDG A;  1N8R C;  4DV3 L;  4BA2 I;  4A75 A;  1V9P A;  1SMX A;  2K50 A;  5M3F G;  1HH2 P;  1CKN B;  1VQO A;  1Q81 C;  4J15 A;  4JI1 L;  4DK3 C;  1PHJ A;  1U0L A;  3BZK A;  3PCO B;  3L2P A;  5FLM H;  3CCJ A;  4BY1 H;  4A3K H;  1IBM L;  3S1M H;  2UXB L;  1CKN A;  3T1H L;  5K36 G;  2VS1 A;  1QVF A;  4JBW A;  1S72 A;  2JE6 I;  4BXX G;  3S24 A;  4JI2 Q;  5M5Y H;  1L1O C;  2AKW B;  4UP7 A;  1D7Q A;  4GNX C;  1KRS A;  4O0A A;  1ASZ A;  2YTV A;  4HIO A;  1BBU A;  1V1Q A;  2YV5 A;  1K8A C;  4JYA Q;  1HNX L;  1NMG A;  4DR2 Q;  4PZ6 A;  2KBN A;  1MJE A;  2MFI A;  1IZ6 A;  4QGU A;  1Q8K A;  1GD7 A;  3MEF A;  1PV4 A;  2KCT A;  1HNW L;  2ZM6 L;  1MKH A;  4JBJ A;  4LUZ A;  4JCV E;  1HZ9 A;  1MJC A;  3A0J A;  4OWW B;  2UUB Q;  1IBM Q;  3U4V A;  3HOY G;  1NBW A;  5DLQ E;  4DR3 L;  4DR4 Q;  3T1H Q;  2HHH L;  5IT9 c;  1HZB A;  1IBK Q;  5ELN A;  3CCE A;  3KJP A;  4C3H H;  3JAM i;  1KD1 C;  3PUX A;  4DR7 Q;  4X64 L;  3HKZ E;  4BA1 I;  2YTY A;  1CSP A;  1E1O A;  3STB C;  4AH6 A;  2ES2 A;  4UP9 A;  4AYB E;  4GN5 A;  2FXQ A;  3PO2 G;  1K0R A;  3E9I A;  3AFQ A;  2MO1 A;  3J81 c;  2AWN A;  4JI5 Q;  4JI3 Q;  4GS3 A;  1N34 Q;  1IYJ B;  1VQE A;  4JI7 L;  1W3S A;  4LFB Q;  1NE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...