5CBAE

3b4 in complex with cxcl13 - 3b4-cxcl13
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
61
structure length
61
Chain Sequence
RCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3b4 heavy chain
publication title A Combination of Structural and Empirical Analyses Delineates the Key Contacts Mediating Stability and Affinity Increases in an Optimized Biotherapeutic Single-chain Fv (scFv).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 15
structure length 61
sequence length 61
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5cbaE00
5EPKA 1TVXA 1E0BA 3TZDA 4QUFA 4ZK9B 1NR2A 5JJZA 1CA5A 2MP1A 3DEPA 1C8CA 2K1BA 1O80A 1B2TA 2HCCA 2EE1A 3DEOA 3LWEA 4MHEA 1MSHA 2K04A 5D14A 1DOKA 1PFBA 1BBXC 2B2WC 2DY7A 3KBXA 3MWYW 4CJ1B 2FMMA 1ESRA 2L9HA 2JP1A 4ZKBB 1O7ZA 1PLFA 4XT3B 3SVMA 2Q8RE 5E4XA 1HUNA 4CJ0B 2B2VA 2X6LA 1EIGA 2HDMA 3I90A 5DNFA 1XX8A 1DOLA 2HUGA 2SDFA 4U68A 4ZKCB 1B4OA 2L1BA 1G91A 3G7LA 1NCVA 1WTWA 1J8IA 1X3QA 1RTNA 1DONA 1G6ZA 2FINB 5CORA 1BO0A 1PFNA 2VXWA 2EOTA 1MI2A 1J9OA 2FFKB 5EPLA 3QO2A 1ILQA 2B2YC 3Q6SA 4X3SA 1SSOA 1WTQA 1A15A 2L11A 3D6WA 5COYA 4RAUC 1BNZA 1MGSA 3KUPA 2XIWA 2L4NA 2CVRA 4IUUA 1IL8A 1ICWA 3IL8A 1PFMA 2MGSA 1S4ZA 1X3PA 3H91A 1XYIA 1EL0A 1F9RA 2RA4A 1U4RA 1HA6A 2NYZD 2HCIA 4IURA 4HCSA 5E4WC 1LV9A 1G2SA 3IFDA 2N88A 1DOMA 3GV6A 1WVLA 1Q3LA 4IUTA 3P7JA 1NAPA 3F2UA 2N55A 2B2VC 3TN2A 2D9UA 1IKMA 4IUPA 1EIHA 2KECA 1HFNA 1RTOA 1HFGA 1KNAA 5CBAE 1VMPA 1MSGA 2DY8A 2KEDA 2MJ8A 1PDQA 5D65A 3I8ZA 1O7YA 2MPMA 2JYOA 2FHTA 1AZPA 1U4PA 2M2LA 4MN3A 1AZQA 3HP3A 1SDFA 2NWGA 1VMCA 1X32A 1B3AA 2KVMA 4O42A 1G2TA 4UAIA 1M8AA 4HAEA 1RODA 3MTSA 5AFWA 5CMDA 1EOTA 1JICA 1DZ1A 1QNKA 4X3TA 4X3UA 1WD1A 1CM9A 2IL8A 2K01A 2K03A 4XT1B 1ZXTA 5CBEE 1QG7A 2K05A 4R8IA 2L12A 1F9SA 5T1IA 2R3ZA 5EQ0A 1HUMA 4XDXA 1WTOA 2KEEA 1F9QA 1U4MA 4HSVA 1GUWA 3I3CA 1SAPA 2X6GA 3DM1A 2KOLA 4HEDA 1BF4A 3FPUB 2NZ1D 4CJ2C 1NR4A 4LMQD 4OIKA 1B53A 1B50A 4ZAIA 2H1EA 1KNEA 4RA8A 4IUVA 4ZLTF 2X69A 1JE4A 1WD0A 4OIJA 2B2WA 5EKIA 1HHVA 3FDTA 3GV3A 2EPBA 4NW2A 3I91A 5EJWA 1WTPA 1HRJA 1F2LA 2KUMA 1WTVA 4R9WA 4RWSC 2Q8TA 3R93A 4DN4M 1WTRA 2FJ2A 1F9PA 2B2UA 2B2TA 1CA6A 2J7ZA 2HDLA 3N52A 1AP0A 2B2UC 1IKLA 2RSNA 4X3KA 1U4LA 2B2TC 1WTXA 2RSOA 1ML0D 1EQTA 2RVLA 2K28A 4IUQA 1ILPA 1RHPA 1QE6A 3ONAB 1RJTA 4QUCA 5T1GA 2BDNA 3UI2A 5EPJA 2B2YA
chains in the Genus database with same CATH superfamily
3OIPA 3SHLA 3F2CA 3L9AX 1R4PB 4BBSB 1YVCA 2MP1A 1I50H 2A8VA 1IHZA 1TY2A 2XNAC 4QCLA 3KF6A 4DR2L 3CU7A 1VQ5A 1TWGH 5C6AA 4BS9A 5KGUA 1IBML 4QIWB 5EKKA 2CFMA 3GTPB 2B8FA 1ONLA 2NVYH 5FLXE 1UE5A 4ULLA 1FNVA 5DLQE 3I90A 4A93G 5AJ3Q 2SNSA 2KBNA 1BVSA 1PRTD 3I4NG 4A3GG 1EWCA 1L1OC 4KLKA 2C9OA 4B9WA 1LO5D 4KY7A 1XXGA 4P2CB 3TP8A 2K4KA 3Q6SA 1EZ8A 1Y8PB 2TSSA 4H0LC 1WTQA 1A15A 4RAUC 1MGSA 2L4NA 2K5HA 4HN7A 4PZ8A 5C3WA 1VF5C 3SXHA 4Y52H 1PFSA 2TMPA 4G7HC 2JA5G 2HHHL 4A3LH 1XMQL 4LF9L 1CKMA 4IUPA 2F0WA 3T16A 2K5QA 1LTSD 1EU4A 4AIMA 1CI3M 2A6HD 1GM5A 1HQRD 3T1HQ 1L0XB 1RD9D 1STGA 1X9NA 4BBSG 4C2MH 5KRUA 2VUMB 1D1KA 1YJ9A 1V1PB 3BDCA 1T5XD 2HD3A 2K03A 4LFCL 1H9SA 2VW9A 3NBHA 4DV6Q 2EYMA 2HIVA 1X6OA 4LFBL 5LMNQ 1CKNB 1HR0W 3MXNB 1SAPA 4HEDA 1OXUA 2K33A 4L8JA 1VF7A 4BBRH 4KN7C 4UDUC 5C4XB 3HOVH 1X3GA 3S2DH 4OO1H 4DK6C 4UP7A 5EKIA 4H13C 1DM0B 4TKOB 5E3FA 1LTID 5GQOA 3PV0A 1N34L 1PHJA 1IXRA 2D2CC 2LY7A 4DUYL 1N32Q 1AEXA 5JJKA 4K2KA 4IJLA 2K52A 1A6XA 1RHPA 4DKAC 4J8QA 2NTSA 1TWHH 2PYKA 4QUCA 4JI0L 3KDFB 1HZAA 1LT3D 3CW2C 4JV5Q 1SNQA 5IT9E 4JI8L 3GTJB 1K3RA 1QCBD 4PNYA 3L0OA 5ELDA 2VUMG 4A3JH 1PH8A 1JOQA 3W2DA 2L9HA 3S14B 2RHQB 1BQQT 4BY7B 1B4OA 2NVTH 4IO9A 2UXDQ 1HCZA 2EYPA 3FPPA 4XXEA 2EOTA 1MI2A 5EPLA 1TU2B 1D5ZC 1Z6HA 5C3EH 2VQFQ 2CVRA 4MZ9A 3EROA 2XTIA 4X65Q 4ZRZA 3H3VC 4IURA 4HCSA 4R1JA 5BN5A 3CQZB 2ZM6Q 2EYFA 2KJXA 1WVLA 5F2DA 5I2YA 3I4MH 4PQXA 4NP5A 5KNBA 4OWXB 2PQAB 5I2XA 3H0GB 3BZDB 1VQOA 5FLXL 2KEDA 1ZYRC 1EWHA 4K6DA 2FMCA 2FHTA 4B3MQ 1VQKA 4P72A 3PF5A 1H9RA 1EOVA 2HQEA 1KAAA 5ELOA 2R92H 1TR5A 1Y8OB 4GLVB 1B3QA 5AFWA 1VCIA 1QJOA 3HOXG 1I94L 1N9WA 1QNKA 1LTGD 2VQEQ 2KHSA 4JOIA 1SEBD 3C1FA 3MHBA 5C4ZA 3PO2H 2K5DA 2Y0SE 3BG3A 3PIOA 1NTGA 1V1QA 2BA0A 3ZJYC 4DK1A 4BY7G 1MIUA 1NR4A 4CGYB 4NMZA 3W5OA 1I3QB 1STEA 4A3IB 5HY6A 4DV2L 4UP9A 1YJNA 5J1ZA 2Z6KA 4OO1I 2MNAA 1BCPD 3KJPA 1QZHA 1D8LA 4A3CG 3T51B 2N3SA 1FYCA 4DV7L 3A8IE 3RD4A 5J22A 1UEBA 3MZ5A 1KRTA 3IFTA 3GTKB 1K28A 1BUVT 4DV0L 1SNPA 2QEJC 2SEBD 3G71A 1JT8A 2HCCA 4LJZC 4B3SL 1MSHA 3S2HB 5EBCA 1EUJA 4RCOA 4IN3A 1HTLD 2HQLA 3PIPA 2PPBC 2C5CA 1X54A 3SK8A 4GKKQ 2NVXH 2AUKA 2ES2A 3S15H 3ER0A 1XTDA 5FO8B 2ZXOA 4IUUA 3E5SA 1IL8A 4A3IG 4R4TA 1HNWL 1XYIA 1S4ZA 1P16A 3H94A 1XMOL 5IT9L 4A3EB 3RUZA 2AQ1B 1PTOF 4FXGC 4LF5L 1PH1A 1KRSA 1IW7C 2YTVA 1PH4A 4G7ZC 1RIPA 1RTOA 2H5XA 5H1SE 1KNAA 2PZTA 3J80i 1RKNA 1K8GA 3TS0A 4MN3A 4BY1B 2WIIB 4A93H 4C3HB 3I4NH 3TS2A 4A3GH 3KLSA 3CPWA 3PGZA 3HRZC 4JI4Q 4RGOS 4GKJL 2QF7A 3OTOQ 4G7OC 1QG7A 3K81C 4C1NI 4MTNA 2Z4HA 1F2ZA 4FNFA 4OIKA 2UXBQ 4PG3A 2L0CA 1CQVA 4IUVA 3VR5A 1HA5A 2EYOA 3FKIG 3GD7A 4IJHA 5EJWA 3GTMB 2AWNA 1JB7A 2V4DA 3NE5B 2AQ3B 2EY2A 4RWSC 5DM73 4A3EG 1PVOA 5IYDH 4PZ6A 2AKWB 3J7AV 1I4PA 1JJGA 1G291 4BBSH 3Q23A 4X64Q 3Q0AA 3D4RA 2UUCL 1L1OB 4C3JB 3UDGA 3UI2A 5EPJA 3U50C 4JYAQ 4DV3Q 1A3VA 3UDIA 1Q82C 4R4QA 2QEXA 2MUYA 3OWEB 1FGBD 2KQ3A 2RKSA 1EY8A 4BY1G 3GTPH 3NUCA 4M1UB 4DR6L 1BBXC 2B2WC 3J80E 5ELCA 1XWEA 4C3HG 1V9PA 5IP9G 3VR3A 4LF4Q 4IQZA 3RN2A 3GO5A 3VYSA 4JCVE 4PMCA 3NK9A 1EFWA 2EXDA 3OSOA 5KNCA 2A6EC 2LFNA 4M8AA 3MAQA 4Q5VA 3TP7A 1YNXA 3M4OB 4FF4A 3EBEA 4NB3A 3L7ZC 2GVAA 2N78A 5DEHA 3CMAA 4RKLA 4A3DB 2E2DC 4GN4B 3STBC 3SDZA 1PTOC 1M90C 4NXMQ 3WWVA 3KF8B 1K73C 1GO3E 4I7ZC 3E0JA 3URYA 4X62Q 3F2UA 2BA1A 4GOPC 3QR8A 1IKMA 3FP9A 2MO1A 4LUOA 1STYA 2XN9C 2VUMH 4LF8Q 3RZOB 4C3JG 5EAYA 4KJNA 2J0TD 2NN6I 4IALA 2ZXPA 4FVMA 4ZUJA 1H95A 4AH6A 4UY8C 1G2TA 2VS1A 2B8GA 1VQEA 3A8JE 5M5YB 3DWAA 4J15A 4BBRG 2QA4A 1LABA 2A19A 2F0JA 4LF6Q 2M00A 5KYLA 3C46A 2L12A 5JEAJ 1VQDA 1K0RA 1U0LA 2KEEA 3M4QA 5C4JB 3M85A 3I3CA 3HOZG 3FPUB 5A35A 4ZUIA 1MJEA 1Q86C 2NVQB 4WJWA 3CHBD 3BVMA 1RL2A 2OQ0A 4LAAA 3I73A 2JA8B 1KC8C 5GAHC 4WORA 1JJCB 4A3DG 1WTVA 3A0JA 2EQSA 4DR3Q 4DV1L 3CCSA 3U58A 1A63A 4IFDI 3BYYB 1BBWA 2IHFA 4JBKA 1WI5A 2B2YA 4YHHL 3GTJH 1FNWA 1QUQA 3RR5A 2E5LQ 3S14H 3CMEA 4GLAC 4X66Q 1OXVA 2FXQA 1J5EL 2Z0SA 3PIO3 1ESRA 4BY7H 3LGJA 5M9OA 3K59A 5BR8Q 1LUZA 1E22A 1Y1VB 2EYHA 1VQJA 1BO0A 4XQNA 4LF7L 4A3CH 1SLJA 2JSOA 3CQZH 4F87A 1TWCB 1BOSA 2B63G 4CKBA 2JA8G 3UE1A 4Z9CB 4GZYC 4RH6A 1IL2A 1KAWA 5JOBA 1GUNA 2VNUD 1WYDA 4FDBA 1A2TA 2L15A 2F0KA 3J80L 1FJGQ 3PSIA 4LUVA 1K3BC 3ULLA 1II3A 3FHWA 3K58A 5GROA 4DK0A 1CHPD 3PUXA 2LSSA 5CV7A 4DNIA 1YNJC 3PIP3 4R4CA 3J81E 1E2ZA 2EY1A 4DUZQ 2F0LA 4HR7B 3A5UA 1X56A 4HJ9A 2AWOA 5IWAL 3HOUB 2CH4A 4LUZA 5CMDA 1EOTA 4HJ5A 4A3KB 2UUAQ 1EFID 2JA9A 3W3AA 1B1ZA 4X3TA 2R93B 4OL7A 2RCNA 3CC7A 4EGVA 5E1FA 5T1IA 1STAA 2QCPX 2JA7B 1I3QH 1VQFA 3A8KE 3E6ZX 1U4MA 2IX3A 4A3IH 1G51A 4ID6A 1VS0A 3MEFA 4TSSA 1KABA 1BXTA 2WINB 3QWNA 1OO9B 1N36Q 3K5NA 3H09A 3VA7A 4DR2Q 3R3OA 2Z4IA 1SMXA 3DWPA 1CA6A 4DAYB 1ZEQX 3RZDB 1YJWA 3F1ZA 2Z9HA 4DR4Q 4DR1L 2LKVA 3ONAB 1L2FA 1IBLL 1Y14B 4C56C 1NBWA 3S2HH 4AQYQ 5IIFA 1O80A 2ENBA 3BVGA 3P20A 3BU2A 4MHEA 2MQHA 2DY7A 3MWYW 1JJ2A 4JI2L 3TBIB 1NNXA 3GTGB 2E74C 1EIGA 1YHQA 1OTCA 2OT2A 3QJYA 4A3KG 2R93G 2HHHQ 1XMQQ 2I07B 4LF9Q 4POGA 2A68C 2JA7G 4QIWE 3FKIH 2WV6D 4OELB 2CQOA 1AE2A 3E0EA 1GUTA 3NSWA 1J9OA 1N8RC 4DV5L 3NWTA 1N33L 4YCUA 4A3EH 1VQNA 1DXMA 1TS4A 4JI3L 3U9OA 4EVOA 2MFIA 1TWAH 1LT4D 3ND8A 2HCIA 5E4WC 1LV9A 2Q2HA 3MXGA 2NN6G 3P7JA 1NAPA 1Z47A 4OXPA 1KL9A 4LFCQ 4XYQA 4BY1H 2R7ZG 5C0XJ 3MFGA 2DY8A 4LFBQ 1EWIA 3TEHB 1CTMA 1D6EC 3B6YA 4C3HH 5IP9H 1AZPA 2EJMA 5GADC 1QVGA 1GHKA 1X32A 2F4VL 1B3AA 3DHQA 4CHTB 1OXSC 5KYIA 5CV6A 2AQ2B 1JICA 2EIFA 1S5BD 2NZOA 4K8IA 3TZUA 2K01A 4XT1B 3HOWG 1I4XA 2CH4W 1YNNC 3BVZA 2DN8A 1SYGA 4KHPQ 3D31A 4DUYQ 1F9QA 3EVQA 2KOLA 5A2QE 1L0YB 4DFAA 1A3UA 3QOLA 4JI0Q 2Q2UA 4NXNL 1CFMA 1TS5A 4XIGS 4JI6L 2EXZA 3L3OC 2QKIC 3QG1A 5JVG3 1XNQL 4XYOA 4IFDG 1SFOB 3NTHA 1A2UA 4JI8Q 1WTPA 5NUCA 3SGIA 4KI0A 1AN8A 4CDEC 3J81L 3GTOB 3R93A 5JPMC 3KFUA 4C3JH 1WCMB 1C48A 3WOFA 3KOJA 1ML0D 4HSPA 1EQTA 3K5LA 2OCEA 1EQVA 4P74A 3UDFA 5IGEA 1WD1A 2A74C 1IBKQ 3TQYA 3T13A 1OXXK 2QDBA 1UNSA 2AHOB 3NELA 3S1RH 1PTOB 4HJ8A 1JWUD 2IHEA 1DD2A 1EY7A 3MC0B 3HOZH 4JI1L 4XT3B 1SJHD 3OYYA 2B2VA 4KKUA 4GOPB 2IW3A 3K7AB 2EY5A 3M4OH 4U673 2L1BA 3NXWA 4A3DH 2VXWA 4QL5A 3K0XA 1YEZA 5COYA 4K0KQ 1JMCA 3GDEA 3VYUA 2F0EA 5IGGA 4A3FB 3M9BA 4YCWA 2WAQB 3CF5A 1F9RA 4PZ7A 2ALYB 4RG1A 1PH9A 2F52A 1LYLA 5HGTA 3U9SA 4IUTA 1X3FA 3PMFA 1O78A 1VQ7A 3RZOH 1HZ9A 2E2JB 4V190 1SJED 1M4VA 2DJGC 2ATWA 1I6HB 3KLWA 1CZWA 1KLUD 1E2VA 5IGDA 4QMGA 3HKZB 2E76C 3T1HL 4XTCS 1BBUA 4TQUS 4CDDC 5K36G 2GA4B 3VYRA 5M5YH 1JORA 1I4HA 2CW0D 2ZT9C 5C4XG 4UAIA 3T1YL 3MTSA 3I7FA 4LNQA 5C4JH 4DAPA 4X3UA 4IPGA 4DV7Q 4HIKA 4UP8A 1SMYD 5ISRA 2F0SA 1F9SA 4IPCA 2EYLA 5CC4A 3CCEA 1HUMA 2NVQH 4HSVA 2B63H 3M4YA 1F2YA 2E75C 3PF4A 4KY5A 2JA8H 2NZ1D 1SRUA 1KDCA 1JB3A 2AMCB 1PMRA 2EJFC 1TXYA 3NBIA 2EYJA 1RDPD 3I2ZA 1EQQA 1D1IA 1HNXQ 2YTXA 1K8OA 1SE3A 2KUMA 1DCZA 4BA1I 1N32L 2BE5C 5IODA 1F9PA 3CKIB 5FLMG 3AFPA 4WJ4A 4JV5L 3HZXA 2KA7A 4AYBB 1PZID 3W1GA 3H3VH 3LX0A 1GUGA 1V43A 3V2TA 1Q8KA 4EQNA 1VQ9A 5A2QL 2K04A 3EN2A 1XJVA 1HNWQ 2D0PA 1TKWB 1XMOQ 4CJ0B 1I6VC 2X6LA 5C5MA 4LF5Q 3BZCA 4KV6A 1EEID 3TP6A 3VR2A 4K5VA 2KCCA 4KHVA 4K5WA 4JBWA 3K6OA 1TWCH 2I5HA 2C35B 2H4OA 3H0GG 1R9TH 1Q7YC 1E3PA 2I5MX 4X65L 1W6KA 4H02A 2HT1A 3OIQA 3KBGA 1PFMA 1IYVA 2PCFB 2ZM6L 1IYJB 4FF3A 2RA4A 1AH9A 1XPOA 3S17B 4CKCA 2N88A 1UAPA 4YY3L 4KMUC 1VQMA 3IRBA 4GNXB 3K80C 2F0MA 1W2BA 4P75A 5L37A 5IP7G 4B3ML 4R4OA 4FF2A 3U4ZA 1S3OA 1TS2A 3H6MA 3KK7A 2CCZA 3HOUH 5KEEA 2JA6B 1I4QA 3TMEA 4A3KH 2R93H 2F0QA 1V1PA 1YBYA 3QB3A 1C4QA 2G9HD 2JA7H 4POFA 5DAUA 2N8NA 2BOSA 1VQCA 3FMCA 3R2TA 1A8VA 1CKNA 3EJIA 3MXNA 4MTKA 3AB9A 4YWMA 1BF4A 1LTRD 2M9VA 2UUCQ 1Z9FA 4CJ2C 1E1TA 1B50A 2H1EA 2NN6H 2RBMA 3E9IA 4UHVA 2LS01 2EPBA 2R7ZH 4CDCC 1HRJA 1ET6A 4GN5A 3RZDH 1YHAA 4DR5L 1ENCA 2K75A 4DR6Q 1ICFB 2ASBA 2RQXA 4DGZA 5KIXA 5I6WA 4JOIC 2XRSD 3S1MB 3HFZB 1ILPA 5JJIA 1HH2P 3KDFA 2F3VA 4RMFA 1SROA 2A69C 5CYUA 4DU9A 1Z7TA 3H3VI 5JJZA 1X55A 2GN5A 3HOWH 3S1NB 5J39A 5LL6S 2Z6KC 2E2HH 3F2BA 5M5WB 3S16B 1XPUA 3O13A 2I0QA 2EDGA 3S1QB 4BXXG 4RKBA 4IFDH 2ZTCA 4K14A 1PRTC 5GAEC 5CGKA 2N49A 5DM63 4FP5D 1HNZQ 4JBJA 3JAMc 1X3PA 2F1MA 2F0PA 2EZVA 1GJXA 3RLNA 1RF2D 5EBDA 1Q3LA 3CXCA 2R7FA 1ASZA 4QY7A 3SK4A 2PQAA 2YYZA 1A62A 3I4LA 4EX5A 2KENA 3CCQA 5M5XB 4N8FA 2RF4A 3KLSX 1LTTD 3JAMi 1SDFA 3VR4A 4L63B 2A6HC 1XNRQ 2XWJB 4JI4L 3C3LA 2PI2A 4ZQ3A 1CM9A 2DGYA 2RCFA 4N8X1 4XQJA 2UU9Q 4C3IB 4LFAL 2CWAA 1V8QA 1JOOA 2UXCL 3OW2A 2UXBL 1JOKA 3JC66 1SFOH 2LXJA 4YHHQ 4O0AA 1S40A 4FF1A 2QW7A 4ZAIA 1H9MA 4ZLTF 2WB1B 3GTOH 1YHBA 3FDTA 3GV3A 3I91A 5ELBA 3KYHC 3CPFA 3WDNA 4ZYSA 2WKDA 1XTCD 1FGUA 3NP8A 5LMUQ 4A3JB 1VQ4A 5K36H 1E7ZA 4A3BB 3V96A 2RSOA 4JYAL 1D2BA 2GVBA 1C7YA 1QE6A 3OW7A 2E8GA 2BDNA 4J6HA 5C4XH 4NDXA 1TY0A 3BDOA 1PTOH 5HGQA 3IKJA 4PV1C 3FRPB 1KIXA 4LF7Q 1FNUA 4C1NK 3KF6B 1CHQD 3CCMA 1DOKA 4B3RL 4CJ1B 1F2MA 3CP0A 1HPCA 5KNDA 5E7NA 1I5FA 1HR0Q 3JAME 4GNXA 2OTLA 1A3TA 3NENA 1EQRA 3K8AA 4F88A 4C3IG 1X3EA 1PH6A 1NCVA 3OMGA 1PH3A 1EIFA 1DONA 1DGSA 2DNCA 4A3FH 1NUCA 3DWQA 1ILQA 4RHSA 2L11A 5FLMH 3MXUA 4OEMB 4NXML 3IL8A 4DF7A 2WB1G 5D3DA 2B29A 3G4SA 1SYFA 2E2JH 3UDXA 1CK1A 3OHXC 3R8BA 5IWAQ 3IFDA 3A54A 3T56B 1SYEA 2R92B 4Y7NB 5CV9A 1JR0D 3OMCA 1ZYRD 3VA5A 4DV4Q 4A3BG 1MSGA 2F0HA 2MJ8A 4HTHA 3I8ZA 1NMFA 3D6CA 1WFQA 2F0UA 4MIUA 1YIJA 1CSQA 5D3IB 1IZ6A 2O5JC 4O42A 2CQAA 4OWTB 4HAEA 4HMIA 5M3MB 4JI5Q 4LF6L 1CSPA 1SYCA 3TRZA 3NQTA 3H0GH 1ZXTA 5FJ8H 4R8IA 3NEMA 4YWLA 1ASYA 3RLFA 2F0GA 5TSSA 3NBHB 5C0XI 4EQPA 5JPNC 1TIID 4DR1Q 4LMQD 3NWSA 1CUKA 5JEAG 1IBLQ 3ERSX 1KNEA 4RA8A 2CKZB 2RDHA 4HJ7A 4R8NA 1QWYA 4DR3L 5IP7H 4N9TA 2XGTA 1BCPC 3CCJA 2B2UA 3PO3B 2RSNA 3PQIA 4X3KA 1L1OA 4JI7Q 1SYDA 4LW1A 2JXMB 5IYBG 3AFQA 1Y1WB 4DR7L 2ICIA 1Y1VG 3BDLA 1E0BA 1CA5A 1KQSA 3L2PA 2K6AA 2DJFC 3D4WA 3HOYB 4R4IA 2DNEA 5FLXc 3H15A 2VL6A 4JI3Q 3LWEA 4J1MA 5D14A 4B3TL 1GUSA 1KHIA 1PFBA 5BR8L 1ENFA 4IUNA 2JEBI 5M3MG 3CD6A 1IBMQ 2HUGA 3GTKH 1K83B 4V0BA 4H44C 3A5ZB 5BN3A 3AU7A 5C3XA 2NUCA 2HIXA 1NJIC 3F8TA 1I4RA 3DXJC 2B2YC 4X3SA 3NHHA 1IYUA 1SNOA 3HGBA 1BNZA 2OWOA 3NTIA 3GTQB 2F0FA 3S17H 5I9PA 4GLXA 4A3MB 3SR1A 2LXKA 2YV5A 1EU3A 2E2IB 3KF8A 2PW7A 1IW7D 2ZJPA 1PZJD 1I4GA 2UUBL 4A93B 3LWUA 3HOUG 3I4NB 1WOCA 2YTYA 4HJAA 1K0SA 5G3LF 3PO3G 1PH2A 1Q46A 4KKTA 2JA6H 1HFNA 2A5HA 3GP7A 2XWBB 4IFDJ 1VMPA 4X6AH 2VB2X 4HIMA 2O2LD 4S3SA 3CRKC 1Y1WG 2JYOA 1U4PA 1B7YB 1KTKA 3J7ZC 3K5OA 4NXNQ 4JI6Q 3HOYG 1PYWD 4BXXH 3ND9A 4KJOA 1XNQQ 2UUAL 2JA5B 3I55A 2ZXRA 4I65A 2A73B 3T53B 2IL8A 2PMZB 3QOJA 2G9DA 2R3ZA 1X65A 4A76A 1JQYD 5ELEA 2JJQA 2OF1A 1N36L 4APVA 1E24A 1E1OA 2OQKA 2F3WA 1SE2A 4NW2A 5JVH3 5BN4A 4A3MG 1QVCA 3LNNA 1WTHA 3S1MH 3U4VA 4DR4L 4JI1Q 1PZKD 5FKAC 2B2UC 5IT9c 3ULPA 2A1AA 1N34Q 4A75A 2XVSA 3C1EA 2K28A 1D7QA 4K5XA 4AQYL 3S1NH 1SE8A 4H7BA 1TVXA 1PRTB 1A0IA 3D0FA 3TZDA 2K5WA 2WFWA 1C8CA 3GTMH 5M5WH 3S16H 3SEBA 4DAVA 1B2TA 4OX9L 2EE1A 3DEOA 2JE6I 3S1QH 5CV4A 3G48A 1LTBD 2JP1A 3AQQA 1O7ZA 3SVMA 3MFYA 2OTJA 5E4XA 2A6ED 2NTTA 1B70B 2D62A 2ID0A 1QNUA 1JWSD 4WRDA 1QB5D 2NB0A 1G6ZA 2LMCB 5IY0A 1V1OA 3STBD 4TRDA 2K32A 2V1CC 1PTOD 2XIWA 1F77A 5EGTA 4ILWA 1C0AA 2B39A 1GKHA 3S9WA 2NYZD 3T1YQ 2IX0A 2F3IA 5AJ3L 4DAMA 5M5XH 3I70A 2D9UA 1MHWC 2R7DA 2WAQE 1EIHA 4JVZA 1MKHA 1S5DD 4JPBW 3A56A 4F8MA 1DYQA 2K14A 5D65A 5K5PA 2P5ZX 4KD3A 3OWFA 2M2LA 1AZQA 1U5KA 1SXTA 3HP3A 2NWGA 1VMCA 5C0XG 3HKZE 4C3IH 1M8AA 2JQOA 3BYTB 2JN4A 5CV5A 1NE3A 5ELFA 1GVPA 1EY4A 3QIAA 2F0OA 4KHPL 1DJRD 3K5MA 5C44B 2K05A 4IPHA 1I94Q 5J3BA 5EQ0A 3HS0C 1WCMG 1CT1D 4XDXA 1GUWA 1VQIA 4PMBA 2K7VA 3DLLA 4QQBX 3G6JB 2QILA 3CC2A 1K8AC 3ICEA 3VR6A 2WKCA 1HXYD 3FVQA 2J4XA 3TREA 3M7GA 4EQ5A 5M3FB 3DUZA 4OIJA 1HHVA 2F0IA 5IOCA 3HOXB 4WFN3 5EKLA 4DV2Q 4WJ3M 4A3BH 1FR3A 3KJOA 2F0NA 3BJUA 4DAYA 4DV6L 3N52A 3J7YW 5LMNL 3R2IA 1M1KC 2PW5A 1IBKL 2K50A 1PXUA 1JCKB 4FO2A 2R6GA 5EPKA 4DXFA 3I72A 1B8AA 2PI2E 1H9JA 4DV0Q 2IT1A 4JBMA 4K8JA 4AYBE 1GHJA 4G57A 1MJCA 3I4OA 4A3FG 4B3SQ 4K2LA 4OHJA 3IAYA 2WAQG 4ZKBB 3RLOA 3DM3A 4KHZA 3BZKA 1ENAA 4O1NA 5JEAH 1SYBA 4IZ8A 4JK1C 1EYDA 3ITPA 2XSCA 4YY3Q 1DOLA 2SDFA 1B44D 1K8MA 5C44G 3CCRA 1J8IA 1GOZA 5CORA 1VQ6A 4KTAA 4K0KL 1W3SA 3Q24A 3QO2A 2NBFA 2NZHA 3D6WA 3HKZG 2Q2TA 4RHRA 3AEVA 3V05A 3S24A 2ZJRA 3FEWX 5M3FG 4RGTA 4DXGA 4Y7NH 1EY0A 5IYBH 3CAMA 5IGBA 1Y69U 2IY5B 4YWKA 1DOMA 3VYTA 1Y1VH 1TWFB 2Z1CA 2IX1A 3K0YA 4BWGB 2B2VC 2UXDL 3K57A 5I6YA 4ODGA 1EYCA 3W1BA 1YNJD 1O7YA 3A7LA 2VQFL 3SE0A 1SNCA 5M3MH 3F2DA 1EEFD 5FJ8G 1GD7A 1PRTF 2O5IC 2VB3X 2CWPA 2MHVA 2Y0SB 1C9OA 2OEOA 4QJFA 1LTAD 2ICEC 3EIVA 4NPSA 2VY3A 2YU9B 3SK5A 1BCPB 1WJJA 1Y8NB 3E9HA 4DR5Q 2K5VA 3Q22A 5IYCG 4BA2I 1LTLA 4YIJA 4GKJQ 2JEAI 1T5EA 3ZYYX 3DM1A 2RDGA 4ALPA 2MO0A 2BH8A 3D4DA 1J6QA 1VQGA 1SNMA 2WACA 4AYBG 3TSSA 4IPDA 1HNXL 2QGQA 1Q81C 2B2WA 1JE5A 3PO3H 2VQEL 1GXDC 1SE4A 4R9WA 5CV8A 3K7UC 1Y1WH 4JG2A 4L5TA 2B2TA 1QVFA 1U4LA 3MA2B 2L55A 2PNHA 2Q2IA 3HOYH 4NKLA 3GTLB 3M3YB 4B08A 3CCUA 2B3GA 3J80c 4GN3B 4QUFA 4ZK9B 1YI2A 1NR2A 4ME3A 1YITA 1QUQB 3CRLC 4JC0A 4RFBA 3FKIB 3P75A 1HJPA 4L5SA 2BCOA 3EA6A 2I46A 3C2PA 1I50B 3EQLC 1K83H 2Y0SG 1HUNA 1S72A 1TWAB 4GOPA 4IOCA 1PYBA 1HTPA 2A68D 1TWGB 2EY6A 4CBVA 1SBBB 1G91A 3DMUA 3GTQH 1WTWA 1FD7D 1MBYA 1TS3A 2NVYB 3EFXD 1PFNA 4A3MH 4LK1C 4KY6A 5GAGC 2E2IH 3RN5A 2OXPA 3PUZA 2D0OA 1ET9A 4QF4A 1Q90A 1ICWA 3GTGH 2JA6G 1EIYB 1SR3A 1U9RA 1U4RA 5FO7B 2Z6BA 3BS1A 1B9NA 3GV6A 4GKKL 1G8ZD 3PUWA 4O2DA 2N55A 2XRQD 2KECA 1SNDA 4UPAA 4LFAQ 4DNTB 3AMUA 1HFGA 5C4HA 1VQBA 5CBAE 4FYDA 5FOBB 2UXCQ 2JA5H 4G4KA 5LMNW 1PA6A 4OONA 4MNOA 2SOBA 3VDYA 5IYDG 3PUYA 4K6LA 1YNND 2DUDA 4C2MB 1TQOA 5CBEE 1E2WA 3RMHA 3HG9A 4PMWA 1Q1EA 4P73A 4YCVA 1JC7A 2PNRC 1VQLA 3X3NA 1GUOA 1YZ6A 1B9MA 3OPOA 1BR9A 1O7LA 4L5RC 1FVIA 1WD0A 4B9XA 2L5TA 2I5LX 4BBRB 4Q0FA 1UE6A 1ZKOA 3HOVB 3SK6A 4FXKC 3S2DB 3S1RB 4DN4M 3OTOL 1WTRA 4B3RQ 2F03A 1LT5D 2WB1E 1QILA 3MEHA 1ESFA 5FO9B 1PH7A 2B2TC 3HOZB 2PZWA 5C0XH 3NTKA 1H9KA 2O4XA 4IUQA 4DV1Q 2F0VA 1MD2D 1S5CD 1NMGA 2JK8A 3J7A5 4HIOA 4A3LG 1CZGA 3DEPA 1AW7A 3T4AC 2K1BA 1KLGD 1TWHB 4FXDA 3CC4A 5G3LD 3OOCA 1WCMH 3KBXA 2FMMA 3GQBA 1PLFA 1J5EQ 2Q8RE 1XPRA 1TT2A 4I7AA 2D5DA 1KDAA 5DNFA 2KHIA 4X64L 1XX8A 5HURA 3CCLA 3ULJA 1BCPF 2RDFA 4ZKCB 4E6IA 1RTNA 4OGQC 5IE8A 4DV3L 2FINB 1FL0A 1HNZL 1LT6D 2FFKB 1NY4A 4KK7A 1SSOA 2F0TA 2NVTB 3N6RA 3KUPA 4LWCA 2MGSA 1EL0A 4LF4L 3K7AH 1L0WA 5C3EB 1HA6A 2SNMA 3D8GA 1G2SA 3A74A 1PYSB 4JW0A 1PV4A 3HOVG 1K9MC 4OO1G 1VQAA 3M7NA 3J81c 1JWMD 1VDZA 5IGFA 2KHJA 4F7XA 1UE1A 1VQPA 3I4MB 2MPMA 3HEJA 1Q8IA 2B63B 2KCMA 1T9HA 4QB4A 1XNRL 1VQ8A 2KVMA 5IGCA 5C44H 3NPPA 1HQMC 1QZGA 2BH2A 1OXTA 2UU9L 4X62L 2CW0C 1DZ1A 1I6HH 5CR3A 4CKEA 3J81i 4HCEA 1WTOA 5M3FH 4OWWB 4A3JG 4LF8L 1SMYC 5C5LA 3MVVA 1KDBA 2AUJD 3HOXH 3PO2B 4DR7Q 1B53A 1HZBA 2X69A 1JE4A 1EYGA 1LM0A 2BE5D 1STNA 1EZ6A 2KCTA 1CQFA 4EQOA 3WOEA 1F2LA 2EVBA 5I4DA 5LMUL 4B3TQ 3AYHB 2Z8LA 2Q8TA 2VZAA 5C3EG 3PCOB 4XQQA 1CKOA 3E3XA 2RHSB 5ELNA 3J81j 3TDQA 1SN8A 1UUPA 4RCNA 1RCVD 3A55A 1H9SB 2IWHA 1KXLA 1UWVA 1AE3A 1BKBA 2G5DA 3X3MA 3J7AF 2ZJQA 1LACA 3RNUA 4KN4C 3I4MG 5IYCH 1Q1BA 4KKSA 3UE0A 1R9TB 2R61A 1HR0L 3MXPA 1S5FD 2PO4A 2F0DA 1P8LA 2UUBQ 2HDMA 4JI2Q 1VQHA 1Q12A 3CCVA 1W6JA 4U68A 4ABNA 2R92G 3G7LA 1KD1C 1EY5A 2F4IA 2ZTEA 1X3QA 1EY6A 1D5XC 2E5LL 3M4PA 2K5NA 1LLRD 4X66L 2NVXB 3Q8DA 3PO2G 3KLRA 2PQEA 2QDLA 4DV5Q 1N33Q 5JJLA 2IJ0A 1TWFH 1UEAB 3H91A 3S15B 3TP5A 3I56A 1EYAA 3P1HA 3G6EA 4ZCKA 1STBA 2IPKD 4QGUA 4GS3A 4RGNA 4DV4L 4GNXC 3TN2A 2ZTDA 3HKSA 4RGMA 1QOHA 1UE7A 1PDQA 4HMJA 1PH5A 2YU9H 4L6TB 1R4QB 4JI5L 4CDFC 1RODA 2F4VQ 5LHY1 1AFPA 2KCNA 1O7IA 1S5ED 4P71A 3PUVA 2R7ZB 1FJGL 5JAVA 4L5QA 2CHBD 2EJGC 4A3GB 1STHA 3D3RA 4ME5A 2X6GA 3JAML 3A7AB 4DNRB 1D5MC 1EY9A 2PMZE 4N9PA 4DUZL 4DPGA 1G6PA 4DK3C 4HIDA 5I9OA 2BDOA 4OX9Q 4KD4A 2Q8IB 3HOWB 3ERQA 1HZCA 5FK9C 2FJ2A 4JI7L 2WP8J 3GTLH 3M3YH 2E2HB 2PZUA 2J7ZA 2HDLA 4TVAB 1AP0A 1IKLA 4DA2A 2A69D 1BDOA 1WTXA 2RVLA 1RJTA 4IOAA 5T1GA 5LL6X 4A4IA 3NQIA 1NSNS
chains in the Genus database with same CATH topology
3OIPA 3SHLA 3L9AX 1R4PB 4BBSB 2MP1A 1IHZA 1TY2A 2XNAC 4QCLA 3CU7A 5C6AA 4BS9A 5KGUA 4QIWB 5EKKA 3GTPB 2B8FA 1ONLA 5FLXE 4ULLA 1FNVA 3I90A 2SNSA 1PRTD 1EWCA 2C9OA 4B9WA 1LO5D 4KY7A 1XXGA 4P2CB 3TP8A 3Q6SA 1EZ8A 1Y8PB 2TSSA 4H0LC 1WTQA 1A15A 4RAUC 1MGSA 2L4NA 4HN7A 5C3WA 1VF5C 3SXHA 2TMPA 4G7HC 4IUPA 2F0WA 3T16A 2K5QA 1LTSD 1EU4A 1CI3M 2A6HD 1HQRD 1L0XB 1RD9D 1STGA 5KRUA 2VUMB 1D1KA 1V1PB 3BDCA 1T5XD 2K03A 1H9SA 3NBHA 2EYMA 1SAPA 4HEDA 1OXUA 2K33A 4L8JA 1VF7A 4KN7C 4UDUC 5C4XB 4OO1H 5EKIA 4H13C 1DM0B 4TKOB 5E3FA 1LTID 3PV0A 2D2CC 2LY7A 1AEXA 4K2KA 1A6XA 1RHPA 4J8QA 2NTSA 4QUCA 2PYKA 1LT3D 1SNQA 5IT9E 3GTJB 1QCBD 4PNYA 5ELDA 1JOQA 3W2DA 2L9HA 3S14B 1BQQT 4BY7B 1B4OA 1HCZA 2EYPA 3FPPA 4XXEA 2EOTA 1MI2A 5EPLA 1TU2B 1D5ZC 1Z6HA 2CVRA 3EROA 4ZRZA 3H3VC 4IURA 4HCSA 5BN5A 3CQZB 2EYFA 2KJXA 1WVLA 5F2DA 5I2YA 4PQXA 4NP5A 5KNBA 5I2XA 3H0GB 3BZDB 5FLXL 2KEDA 1ZYRC 1EWHA 4K6DA 2FMCA 2FHTA 1H9RA 2HQEA 1KAAA 1TR5A 1Y8OB 5AFWA 1VCIA 1QJOA 1QNKA 1LTGD 2KHSA 1SEBD 3C1FA 3MHBA 5C4ZA 2K5DA 3BG3A 2BA0A 4DK1A 1NR4A 4CGYB 4NMZA 1I3QB 1STEA 4A3IB 5J1ZA 4OO1I 1BCPD 3T51B 1FYCA 3A8IE 3RD4A 5J22A 3MZ5A 3IFTA 3GTKB 1BUVT 1SNPA 2QEJC 2SEBD 2HCCA 4LJZC 1MSHA 3S2HB 5EBCA 4RCOA 4IN3A 1HTLD 2PPBC 2C5CA 3SK8A 2AUKA 5FO8B 2ZXOA 4IUUA 3E5SA 1IL8A 1XYIA 1S4ZA 3H94A 5IT9L 4A3EB 3RUZA 2AQ1B 1PTOF 4FXGC 1IW7C 4G7ZC 1RTOA 1KNAA 2PZTA 1RKNA 4MN3A 4BY1B 2WIIB 4C3HB 3KLSA 3HRZC 4RGOS 4G7OC 2QF7A 1QG7A 4C1NI 2Z4HA 1F2ZA 4FNFA 4OIKA 2L0CA 1CQVA 4IUVA 3VR5A 1HA5A 2EYOA 3GD7A 5EJWA 3GTMB 2AWNA 2V4DA 3NE5B 2AQ3B 2EY2A 4RWSC 5DM73 3J7AV 1I4PA 1G291 3Q23A 3Q0AA 3D4RA 4C3JB 3UI2A 5EPJA 1A3VA 2MUYA 3OWEB 1FGBD 2KQ3A 2RKSA 1EY8A 3NUCA 4M1UB 1BBXC 2B2WC 3J80E 5ELCA 1XWEA 4C3HG 3VR3A 4IQZA 3GO5A 3VYSA 4PMCA 3NK9A 3OSOA 5KNCA 2A6EC 2LFNA 4M8AA 3MAQA 4Q5VA 3TP7A 3M4OB 4FF4A 3L7ZC 5DEHA 4RKLA 4A3DB 2E2DC 3SDZA 1PTOC 4I7ZC 3E0JA 3URYA 3F2UA 2BA1A 1IKMA 1STYA 2XN9C 3RZOB 4C3JG 4KJNA 2J0TD 2NN6I 4IALA 2ZXPA 4FVMA 4ZUJA 1G2TA 2B8GA 3A8JE 5M5YB 3DWAA 1LABA 2F0JA 2M00A 5KYLA 3C46A 2L12A 5JEAJ 2KEEA 5C4JB 3M85A 3I3CA 3FPUB 5A35A 4ZUIA 2NVQB 4WJWA 3CHBD 3BVMA 4LAAA 3I73A 2JA8B 4WORA 1WTVA 4IFDI 3BYYB 2B2YA 1FNWA 1OXVA 3PIO3 1ESRA 5M9OA 3K59A 1Y1VB 2EYHA 1BO0A 4XQNA 2JSOA 4F87A 1TWCB 1BOSA 4CKBA 4Z9CB 4GZYC 4RH6A 5JOBA 1GUNA 2VNUD 1A2TA 2F0KA 3J80L 1II3A 3K58A 4DK0A 1CHPD 3PUXA 5CV7A 1YNJC 3PIP3 3J81E 1E2ZA 2EY1A 2F0LA 4HR7B 2AWOA 3HOUB 5CMDA 1EOTA 4A3KB 1EFID 4X3TA 3W3AA 1B1ZA 2R93B 4OL7A 4EGVA 5E1FA 5T1IA 1STAA 2QCPX 2JA7B 3A8KE 3E6ZX 1U4MA 2IX3A 4ID6A 4TSSA 1KABA 1BXTA 2WINB 3QWNA 1OO9B 3K5NA 3H09A 3VA7A 3R3OA 2Z4IA 3DWPA 1CA6A 1ZEQX 3RZDB 2LKVA 3ONAB 4C56C 5IIFA 1O80A 2ENBA 3BVGA 3P20A 4MHEA 2DY7A 3MWYW 3TBIB 3GTGB 2E74C 1EIGA 2OT2A 3QJYA 2I07B 2A68C 2WV6D 3NSWA 1GUTA 1J9OA 3NWTA 1DXMA 1TS4A 3U9OA 4EVOA 1LT4D 3ND8A 2HCIA 5E4WC 1LV9A 3MXGA 2NN6G 3P7JA 1NAPA 1Z47A 4XYQA 5C0XJ 3MFGA 2DY8A 1CTMA 1D6EC 1AZPA 2EJMA 1GHKA 1X32A 1B3AA 3DHQA 4CHTB 1OXSC 5KYIA 5CV6A 2AQ2B 1JICA 1S5BD 4K8IA 3TZUA 2K01A 4XT1B 1I4XA 1YNNC 3BVZA 2DN8A 1SYGA 3D31A 1F9QA 3EVQA 2KOLA 5A2QE 1L0YB 4DFAA 1A3UA 3QOLA 1CFMA 1TS5A 4XIGS 2EXZA 3L3OC 2QKIC 3QG1A 5JVG3 4XYOA 4IFDG 1SFOB 3NTHA 1A2UA 1WTPA 5NUCA 4KI0A 1AN8A 3J81L 3GTOB 3R93A 5JPMC 1WCMB 1C48A 3WOFA 1ML0D 4HSPA 1EQTA 3K5LA 1EQVA 5IGEA 1WD1A 2A74C 3T13A 1OXXK 2QDBA 1UNSA 1PTOB 1JWUD 1DD2A 1EY7A 3MC0B 4XT3B 1SJHD 2B2VA 4KKUA 2IW3A 3K7AB 2EY5A 4U673 2L1BA 3NXWA 2VXWA 5COYA 3VYUA 2F0EA 5IGGA 4A3FB 2WAQB 1F9RA 5HGTA 3U9SA 4IUTA 3PMFA 1O78A 2E2JB 4V190 1SJED 1M4VA 1I6HB 1CZWA 1KLUD 1E2VA 5IGDA 4QMGA 3HKZB 2E76C 4XTCS 4TQUS 5K36G 2GA4B 3VYRA 1JORA 1I4HA 2CW0D 2ZT9C 4UAIA 3MTSA 4DAPA 4X3UA 1SMYD 5ISRA 2F0SA 1F9SA 2EYLA 5CC4A 1HUMA 4HSVA 3M4YA 1F2YA 2E75C 4KY5A 2NZ1D 1KDCA 1JB3A 1PMRA 2EJFC 3NBIA 2EYJA 1RDPD 1D1IA 1K8OA 1SE3A 2KUMA 1DCZA 4BA1I 2BE5C 5IODA 1F9PA 3CKIB 3HZXA 2KA7A 4AYBB 1PZID 3LX0A 1GUGA 1V43A 3V2TA 4EQNA 5A2QL 2K04A 1TKWB 4CJ0B 1I6VC 2X6LA 5C5MA 4KV6A 1EEID 3TP6A 3VR2A 4K5VA 2KCCA 4KHVA 4K5WA 4JBWA 3K6OA 2H4OA 1W6KA 3OIQA 3KBGA 1PFMA 1IYVA 2PCFB 4FF3A 2RA4A 3S17B 4CKCA 2N88A 1UAPA 4KMUC 2F0MA 4FF2A 1TS2A 3H6MA 3KK7A 5KEEA 2JA6B 1I4QA 3TMEA 2F0QA 1V1PA 3QB3A 1C4QA 2G9HD 5DAUA 2BOSA 3FMCA 3R2TA 3EJIA 3MXNA 3AB9A 1BF4A 1LTRD 2M9VA 4CJ2C 1B50A 2H1EA 2NN6H 2RBMA 2LS01 2EPBA 1HRJA 1ET6A 1ENCA 2RQXA 4DGZA 5KIXA 5I6WA 2XRSD 3S1MB 1ILPA 2F3VA 2A69C 5CYUA 4DU9A 1Z7TA 5JJZA 3S1NB 5J39A 5LL6S 5M5WB 3S16B 3O13A 2EDGA 3S1QB 4RKBA 4IFDH 4K14A 1PRTC 5CGKA 5DM63 4FP5D 1X3PA 2F1MA 2F0PA 2EZVA 1GJXA 1RF2D 5EBDA 1Q3LA 3SK4A 2YYZA 3I4LA 5M5XB 3KLSX 1LTTD 1SDFA 3VR4A 4L63B 2A6HC 2XWJB 3C3LA 4ZQ3A 1CM9A 4XQJA 4C3IB 1V8QA 1JOOA 1JOKA 4FF1A 4ZAIA 1H9MA 4ZLTF 2WB1B 3FDTA 3GV3A 3I91A 5ELBA 4ZYSA 3WDNA 2WKDA 1XTCD 3NP8A 4A3JB 5K36H 4A3BB 3V96A 2RSOA 1D2BA 1QE6A 3OW7A 2BDNA 4J6HA 4NDXA 1TY0A 3BDOA 1PTOH 3IKJA 4PV1C 3FRPB 1FNUA 4C1NK 1CHQD 1DOKA 4CJ1B 1F2MA 1HPCA 5KNDA 3JAME 1A3TA 4F88A 4C3IG 1NCVA 3OMGA 1DONA 2DNCA 1NUCA 3DWQA 1ILQA 4RHSA 2L11A 3MXUA 3IL8A 4DF7A 5D3DA 1SYFA 1CK1A 3OHXC 3R8BA 3IFDA 3A54A 3T56B 1SYEA 2R92B 4Y7NB 5CV9A 1JR0D 3OMCA 1ZYRD 3VA5A 1MSGA 2F0HA 2MJ8A 4HTHA 3I8ZA 3D6CA 2F0UA 4MIUA 5D3IB 2O5JC 4O42A 2CQAA 4HAEA 4HMIA 5M3MB 1SYCA 3NQTA 1ZXTA 4R8IA 3RLFA 2F0GA 5TSSA 5C0XI 4EQPA 5JPNC 1TIID 4LMQD 3NWSA 5JEAG 1KNEA 4RA8A 2RDHA 4R8NA 1QWYA 4N9TA 1BCPC 2B2UA 3PO3B 2RSNA 4X3KA 1SYDA 2JXMB 1Y1WB 2ICIA 3BDLA 1E0BA 1CA5A 2K6AA 3D4WA 3HOYB 2DNEA 3LWEA 4J1MA 5D14A 1GUSA 1PFBA 1ENFA 4IUNA 2JEBI 2HUGA 1K83B 4V0BA 4H44C 5BN3A 3AU7A 5C3XA 2NUCA 1I4RA 3DXJC 2B2YC 4X3SA 1IYUA 1SNOA 3HGBA 3NHHA 1BNZA 3NTIA 3GTQB 2F0FA 5I9PA 4A3MB 3SR1A 1EU3A 2E2IB 3KF8A 2PW7A 1IW7D 1PZJD 1I4GA 4A93B 3LWUA 3I4NB 5G3LF 4KKTA 1HFNA 2A5HA 3GP7A 2XWBB 4IFDJ 1VMPA 2VB2X 2O2LD 4S3SA 3CRKC 2JYOA 1U4PA 1KTKA 3K5OA 1PYWD 3ND9A 4KJOA 2JA5B 2ZXRA 4I65A 2A73B 3T53B 2IL8A 2PMZB 3QOJA 2G9DA 2R3ZA 1JQYD 5ELEA 2OF1A 2F3WA 1SE2A 4NW2A 5JVH3 5BN4A 3LNNA 1PZKD 5FKAC 2B2UC 2XVSA 3C1EA 2K28A 4K5XA 4H7BA 1TVXA 1PRTB 3TZDA 2K5WA 1C8CA 3SEBA 4DAVA 1B2TA 2EE1A 3DEOA 2JE6I 5CV4A 1LTBD 2JP1A 3SVMA 1O7ZA 3MFYA 5E4XA 2A6ED 2NTTA 2D62A 2ID0A 1QNUA 1JWSD 4WRDA 1QB5D 2NB0A 1G6ZA 2LMCB 1V1OA 4TRDA 2K32A 1PTOD 2XIWA 1F77A 5EGTA 4ILWA 2B39A 3S9WA 2NYZD 2IX0A 3I70A 2D9UA 1EIHA 1S5DD 3A56A 4F8MA 1DYQA 5D65A 5K5PA 4KD3A 3OWFA 2M2LA 1AZQA 1SXTA 3HP3A 2NWGA 1VMCA 5C0XG 1M8AA 3BYTB 5CV5A 5ELFA 1EY4A 3QIAA 2F0OA 1DJRD 3K5MA 5C44B 2K05A 5EQ0A 3HS0C 1CT1D 4XDXA 1GUWA 4PMBA 2K7VA 3G6JB 2QILA 3VR6A 2WKCA 1HXYD 3FVQA 2J4XA 3M7GA 5M3FB 3DUZA 4OIJA 1HHVA 2F0IA 5IOCA 3HOXB 4WFN3 5EKLA 1FR3A 2F0NA 4DAYA 3N52A 3J7YW 3R2IA 2PW5A 1PXUA 1JCKB 4FO2A 2R6GA 5EPKA 4DXFA 3I72A 1H9JA 2IT1A 4K8JA 1GHJA 4G57A 4K2LA 4OHJA 3IAYA 4ZKBB 4KHZA 1ENAA 4O1NA 5JEAH 1SYBA 4IZ8A 4JK1C 1EYDA 3ITPA 2XSCA 1DOLA 2SDFA 1B44D 1K8MA 1J8IA 1GOZA 5CORA 4KTAA 3Q24A 3QO2A 2NBFA 3D6WA 4RHRA 3V05A 3FEWX 4RGTA 4DXGA 1EY0A 5IGBA 1Y69U 1DOMA 3VYTA 1TWFB 2Z1CA 2IX1A 3K0YA 4BWGB 2B2VC 3K57A 5I6YA 4ODGA 1EYCA 1YNJD 1O7YA 3A7LA 3SE0A 1SNCA 1EEFD 1PRTF 2O5IC 2VB3X 2MHVA 2Y0SB 2OEOA 1LTAD 2ICEC 2YU9B 3SK5A 1BCPB 1Y8NB 3Q22A 4BA2I 4YIJA 2JEAI 1T5EA 3ZYYX 3DM1A 2RDGA 3D4DA 1SNMA 2WACA 3TSSA 2B2WA 1GXDC 1SE4A 4R9WA 5CV8A 2B2TA 1U4LA 3MA2B 2L55A 4NKLA 3GTLB 3M3YB 4B08A 4QUFA 4ZK9B 1NR2A 3CRLC 4RFBA 3FKIB 3P75A 2BCOA 3EA6A 2I46A 3C2PA 1I50B 3EQLC 1HUNA 1TWAB 1HTPA 2A68D 1TWGB 2EY6A 4CBVA 1SBBB 1G91A 3DMUA 1WTWA 1FD7D 1MBYA 1TS3A 2NVYB 3EFXD 1PFNA 4LK1C 4KY6A 2OXPA 3PUZA 1ET9A 4QF4A 1Q90A 1ICWA 1U9RA 1U4RA 5FO7B 3BS1A 1B9NA 3GV6A 1G8ZD 3PUWA 2N55A 2XRQD 2KECA 1SNDA 4DNTB 3AMUA 1HFGA 5C4HA 5CBAE 4FYDA 5FOBB 4G4KA 2SOBA 3PUYA 4K6LA 1YNND 4C2MB 1TQOA 5CBEE 1E2WA 3RMHA 3HG9A 4PMWA 1Q1EA 1JC7A 2PNRC 3X3NA 1GUOA 1B9MA 3OPOA 1BR9A 1O7LA 1WD0A 4B9XA 2L5TA 4BBRB 4Q0FA 1ZKOA 3HOVB 3SK6A 4FXKC 3S2DB 3S1RB 4DN4M 1WTRA 2F03A 1LT5D 1QILA 3MEHA 1ESFA 5FO9B 3HOZB 2B2TC 2PZWA 5C0XH 3NTKA 1H9KA 2O4XA 4IUQA 2F0VA 1S5CD 1MD2D 1CZGA 3DEPA 1AW7A 3T4AC 2K1BA 1KLGD 1TWHB 4FXDA 5G3LD 3OOCA 3KBXA 2FMMA 3GQBA 1PLFA 2Q8RE 1TT2A 2D5DA 1KDAA 5DNFA 1XX8A 5HURA 1BCPF 2RDFA 4ZKCB 4E6IA 1RTNA 4OGQC 2FINB 1LT6D 2FFKB 4KK7A 1SSOA 2F0TA 2NVTB 3N6RA 3KUPA 2MGSA 1EL0A 5C3EB 1HA6A 2SNMA 3D8GA 1G2SA 4OO1G 3M7NA 1JWMD 5IGFA 1VDZA 4F7XA 3I4MB 2MPMA 3HEJA 1Q8IA 2B63B 4QB4A 2KVMA 5IGCA 3NPPA 1HQMC 1OXTA 2CW0C 1DZ1A 5CR3A 4CKEA 4HCEA 1WTOA 1SMYC 5C5LA 3MVVA 1KDBA 2AUJD 3PO2B 1B53A 2X69A 1JE4A 2BE5D 1STNA 1EZ6A 1CQFA 4EQOA 3WOEA 1F2LA 2EVBA 5I4DA 2Z8LA 2Q8TA 4XQQA 3TDQA 1UUPA 4RCNA 1RCVD 3A55A 1H9SB 2IWHA 3X3MA 3J7AF 1LACA 4KN4C 1Q1BA 4KKSA 1R9TB 2R61A 3MXPA 1S5FD 2PO4A 2F0DA 2HDMA 1Q12A 1W6JA 4U68A 4ABNA 3G7LA 1EY5A 2F4IA 1X3QA 1EY6A 1D5XC 1LLRD 2NVXB 3KLRA 2PQEA 2IJ0A 1UEAB 3H91A 3S15B 3TP5A 1EYAA 3P1HA 1STBA 2IPKD 4RGNA 3TN2A 4RGMA 1QOHA 1PDQA 4HMJA 4L6TB 1R4QB 1RODA 1AFPA 5LHY1 2KCNA 1S5ED 3PUVA 2R7ZB 5JAVA 2CHBD 2EJGC 4A3GB 1STHA 3D3RA 4ME5A 2X6GA 3JAML 3A7AB 4DNRB 1D5MC 1EY9A 4N9PA 5I9OA 2BDOA 4KD4A 2Q8IB 3HOWB 3ERQA 5FK9C 2FJ2A 2WP8J 2E2HB 2PZUA 2J7ZA 2HDLA 1AP0A 1IKLA 4DA2A 2A69D 1BDOA 1WTXA 2RVLA 1RJTA 5T1GA 5LL6X 3NQIA 1NSNS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EPK A;  1TVX A;  1E0B A;  3TZD A;  4QUF A;  4ZK9 B;  1NR2 A;  5JJZ A;  1CA5 A;  2MP1 A;  3DEP A;  1C8C A;  2K1B A;  1O80 A;  1B2T A;  2HCC A;  2EE1 A;  3DEO A;  3LWE A;  4MHE A;  1MSH A;  2K04 A;  5D14 A;  1DOK A;  1PFB A;  1BBX C;  2B2W C;  2DY7 A;  3KBX A;  3MWY W;  4CJ1 B;  2FMM A;  1ESR A;  2L9H A;  2JP1 A;  4ZKB B;  1O7Z A;  1PLF A;  4XT3 B;  3SVM A;  2Q8R E;  5E4X A;  1HUN A;  4CJ0 B;  2B2V A;  2X6L A;  1EIG A;  2HDM A;  3I90 A;  5DNF A;  1XX8 A;  1DOL A;  2HUG A;  2SDF A;  4U68 A;  4ZKC B;  1B4O A;  2L1B A;  1G91 A;  3G7L A;  1NCV A;  1WTW A;  1J8I A;  1X3Q A;  1RTN A;  1DON A;  1G6Z A;  2FIN B;  5COR A;  1BO0 A;  1PFN A;  2VXW A;  2EOT A;  1MI2 A;  1J9O A;  2FFK B;  5EPL A;  3QO2 A;  1ILQ A;  2B2Y C;  3Q6S A;  4X3S A;  1SSO A;  1WTQ A;  1A15 A;  2L11 A;  3D6W A;  5COY A;  4RAU C;  1BNZ A;  1MGS A;  3KUP A;  2XIW A;  2L4N A;  2CVR A;  4IUU A;  1IL8 A;  1ICW A;  3IL8 A;  1PFM A;  2MGS A;  1S4Z A;  1X3P A;  3H91 A;  1XYI A;  1EL0 A;  1F9R A;  2RA4 A;  1U4R A;  1HA6 A;  2NYZ D;  2HCI A;  4IUR A;  4HCS A;  5E4W C;  1LV9 A;  1G2S A;  3IFD A;  2N88 A;  1DOM A;  3GV6 A;  1WVL A;  1Q3L A;  4IUT A;  3P7J A;  1NAP A;  3F2U A;  2N55 A;  2B2V C;  3TN2 A;  2D9U A;  1IKM A;  4IUP A;  1EIH A;  2KEC A;  1HFN A;  1RTO A;  1HFG A;  1KNA A;  5CBA E;  1VMP A;  1MSG A;  2DY8 A;  2KED A;  2MJ8 A;  1PDQ A;  5D65 A;  3I8Z A;  1O7Y A;  2MPM A;  2JYO A;  2FHT A;  1AZP A;  1U4P A;  2M2L A;  4MN3 A;  1AZQ A;  3HP3 A;  1SDF A;  2NWG A;  1VMC A;  1X32 A;  1B3A A;  2KVM A;  4O42 A;  1G2T A;  4UAI A;  1M8A A;  4HAE A;  1ROD A;  3MTS A;  5AFW A;  5CMD A;  1EOT A;  1JIC A;  1DZ1 A;  1QNK A;  4X3T A;  4X3U A;  1WD1 A;  1CM9 A;  2IL8 A;  2K01 A;  2K03 A;  4XT1 B;  1ZXT A;  5CBE E;  1QG7 A;  2K05 A;  4R8I A;  2L12 A;  1F9S A;  5T1I A;  2R3Z A;  5EQ0 A;  1HUM A;  4XDX A;  1WTO A;  2KEE A;  1F9Q A;  1U4M A;  4HSV A;  1GUW A;  3I3C A;  1SAP A;  2X6G A;  3DM1 A;  2KOL A;  4HED A;  1BF4 A;  3FPU B;  2NZ1 D;  4CJ2 C;  1NR4 A;  4LMQ D;  4OIK A;  1B53 A;  1B50 A;  4ZAI A;  2H1E A;  1KNE A;  4RA8 A;  4IUV A;  4ZLT F;  2X69 A;  1JE4 A;  1WD0 A;  4OIJ A;  2B2W A;  5EKI A;  1HHV A;  3FDT A;  3GV3 A;  2EPB A;  4NW2 A;  3I91 A;  5EJW A;  1WTP A;  1HRJ A;  1F2L A;  2KUM A;  1WTV A;  4R9W A;  4RWS C;  2Q8T A;  3R93 A;  4DN4 M;  1WTR A;  2FJ2 A;  1F9P A;  2B2U A;  2B2T A;  1CA6 A;  2J7Z A;  2HDL A;  3N52 A;  1AP0 A;  2B2U C;  1IKL A;  2RSN A;  4X3K A;  1U4L A;  2B2T C;  1WTX A;  2RSO A;  1ML0 D;  1EQT A;  2RVL A;  2K28 A;  4IUQ A;  1ILP A;  1RHP A;  1QE6 A;  3ONA B;  1RJT A;  4QUC A;  5T1G A;  2BDN A;  3UI2 A;  5EPJ A;  2B2Y A; 
#chains in the Genus database with same CATH topology
 3OIP A;  3SHL A;  3F2C A;  3L9A X;  1R4P B;  4BBS B;  1YVC A;  2MP1 A;  1I50 H;  2A8V A;  1IHZ A;  1TY2 A;  2XNA C;  4QCL A;  3KF6 A;  4DR2 L;  3CU7 A;  1VQ5 A;  1TWG H;  5C6A A;  4BS9 A;  5KGU A;  1IBM L;  4QIW B;  5EKK A;  2CFM A;  3GTP B;  2B8F A;  1ONL A;  2NVY H;  5FLX E;  1UE5 A;  4ULL A;  1FNV A;  5DLQ E;  3I90 A;  4A93 G;  5AJ3 Q;  2SNS A;  2KBN A;  1BVS A;  1PRT D;  3I4N G;  4A3G G;  1EWC A;  1L1O C;  4KLK A;  2C9O A;  4B9W A;  1LO5 D;  4KY7 A;  1XXG A;  4P2C B;  3TP8 A;  2K4K A;  3Q6S A;  1EZ8 A;  1Y8P B;  2TSS A;  4H0L C;  1WTQ A;  1A15 A;  4RAU C;  1MGS A;  2L4N A;  2K5H A;  4HN7 A;  4PZ8 A;  5C3W A;  1VF5 C;  3SXH A;  4Y52 H;  1PFS A;  2TMP A;  4G7H C;  2JA5 G;  2HHH L;  4A3L H;  1XMQ L;  4LF9 L;  1CKM A;  4IUP A;  2F0W A;  3T16 A;  2K5Q A;  1LTS D;  1EU4 A;  4AIM A;  1CI3 M;  2A6H D;  1GM5 A;  1HQR D;  3T1H Q;  1L0X B;  1RD9 D;  1STG A;  1X9N A;  4BBS G;  4C2M H;  5KRU A;  2VUM B;  1D1K A;  1YJ9 A;  1V1P B;  3BDC A;  1T5X D;  2HD3 A;  2K03 A;  4LFC L;  1H9S A;  2VW9 A;  3NBH A;  4DV6 Q;  2EYM A;  2HIV A;  1X6O A;  4LFB L;  5LMN Q;  1CKN B;  1HR0 W;  3MXN B;  1SAP A;  4HED A;  1OXU A;  2K33 A;  4L8J A;  1VF7 A;  4BBR H;  4KN7 C;  4UDU C;  5C4X B;  3HOV H;  1X3G A;  3S2D H;  4OO1 H;  4DK6 C;  4UP7 A;  5EKI A;  4H13 C;  1DM0 B;  4TKO B;  5E3F A;  1LTI D;  5GQO A;  3PV0 A;  1N34 L;  1PHJ A;  1IXR A;  2D2C C;  2LY7 A;  4DUY L;  1N32 Q;  1AEX A;  5JJK A;  4K2K A;  4IJL A;  2K52 A;  1A6X A;  1RHP A;  4DKA C;  4J8Q A;  2NTS A;  1TWH H;  2PYK A;  4QUC A;  4JI0 L;  3KDF B;  1HZA A;  1LT3 D;  3CW2 C;  4JV5 Q;  1SNQ A;  5IT9 E;  4JI8 L;  3GTJ B;  1K3R A;  1QCB D;  4PNY A;  3L0O A;  5ELD A;  2VUM G;  4A3J H;  1PH8 A;  1JOQ A;  3W2D A;  2L9H A;  3S14 B;  2RHQ B;  1BQQ T;  4BY7 B;  1B4O A;  2NVT H;  4IO9 A;  2UXD Q;  1HCZ A;  2EYP A;  3FPP A;  4XXE A;  2EOT A;  1MI2 A;  5EPL A;  1TU2 B;  1D5Z C;  1Z6H A;  5C3E H;  2VQF Q;  2CVR A;  4MZ9 A;  3ERO A;  2XTI A;  4X65 Q;  4ZRZ A;  3H3V C;  4IUR A;  4HCS A;  4R1J A;  5BN5 A;  3CQZ B;  2ZM6 Q;  2EYF A;  2KJX A;  1WVL A;  5F2D A;  5I2Y A;  3I4M H;  4PQX A;  4NP5 A;  5KNB A;  4OWX B;  2PQA B;  5I2X A;  3H0G B;  3BZD B;  1VQO A;  5FLX L;  2KED A;  1ZYR C;  1EWH A;  4K6D A;  2FMC A;  2FHT A;  4B3M Q;  1VQK A;  4P72 A;  3PF5 A;  1H9R A;  1EOV A;  2HQE A;  1KAA A;  5ELO A;  2R92 H;  1TR5 A;  1Y8O B;  4GLV B;  1B3Q A;  5AFW A;  1VCI A;  1QJO A;  3HOX G;  1I94 L;  1N9W A;  1QNK A;  1LTG D;  2VQE Q;  2KHS A;  4JOI A;  1SEB D;  3C1F A;  3MHB A;  5C4Z A;  3PO2 H;  2K5D A;  2Y0S E;  3BG3 A;  3PIO A;  1NTG A;  1V1Q A;  2BA0 A;  3ZJY C;  4DK1 A;  4BY7 G;  1MIU A;  1NR4 A;  4CGY B;  4NMZ A;  3W5O A;  1I3Q B;  1STE A;  4A3I B;  5HY6 A;  4DV2 L;  4UP9 A;  1YJN A;  5J1Z A;  2Z6K A;  4OO1 I;  2MNA A;  1BCP D;  3KJP A;  1QZH A;  1D8L A;  4A3C G;  3T51 B;  2N3S A;  1FYC A;  4DV7 L;  3A8I E;  3RD4 A;  5J22 A;  1UEB A;  3MZ5 A;  1KRT A;  3IFT A;  3GTK B;  1K28 A;  1BUV T;  4DV0 L;  1SNP A;  2QEJ C;  2SEB D;  3G71 A;  1JT8 A;  2HCC A;  4LJZ C;  4B3S L;  1MSH A;  3S2H B;  5EBC A;  1EUJ A;  4RCO A;  4IN3 A;  1HTL D;  2HQL A;  3PIP A;  2PPB C;  2C5C A;  1X54 A;  3SK8 A;  4GKK Q;  2NVX H;  2AUK A;  2ES2 A;  3S15 H;  3ER0 A;  1XTD A;  5FO8 B;  2ZXO A;  4IUU A;  3E5S A;  1IL8 A;  4A3I G;  4R4T A;  1HNW L;  1XYI A;  1S4Z A;  1P16 A;  3H94 A;  1XMO L;  5IT9 L;  4A3E B;  3RUZ A;  2AQ1 B;  1PTO F;  4FXG C;  4LF5 L;  1PH1 A;  1KRS A;  1IW7 C;  2YTV A;  1PH4 A;  4G7Z C;  1RIP A;  1RTO A;  2H5X A;  5H1S E;  1KNA A;  2PZT A;  3J80 i;  1RKN A;  1K8G A;  3TS0 A;  4MN3 A;  4BY1 B;  2WII B;  4A93 H;  4C3H B;  3I4N H;  3TS2 A;  4A3G H;  3KLS A;  3CPW A;  3PGZ A;  3HRZ C;  4JI4 Q;  4RGO S;  4GKJ L;  2QF7 A;  3OTO Q;  4G7O C;  1QG7 A;  3K81 C;  4C1N I;  4MTN A;  2Z4H A;  1F2Z A;  4FNF A;  4OIK A;  2UXB Q;  4PG3 A;  2L0C A;  1CQV A;  4IUV A;  3VR5 A;  1HA5 A;  2EYO A;  3FKI G;  3GD7 A;  4IJH A;  5EJW A;  3GTM B;  2AWN A;  1JB7 A;  2V4D A;  3NE5 B;  2AQ3 B;  2EY2 A;  4RWS C;  5DM7 3;  4A3E G;  1PVO A;  5IYD H;  4PZ6 A;  2AKW B;  3J7A V;  1I4P A;  1JJG A;  1G29 1;  4BBS H;  3Q23 A;  4X64 Q;  3Q0A A;  3D4R A;  2UUC L;  1L1O B;  4C3J B;  3UDG A;  3UI2 A;  5EPJ A;  3U50 C;  4JYA Q;  4DV3 Q;  1A3V A;  3UDI A;  1Q82 C;  4R4Q A;  2QEX A;  2MUY A;  3OWE B;  1FGB D;  2KQ3 A;  2RKS A;  1EY8 A;  4BY1 G;  3GTP H;  3NUC A;  4M1U B;  4DR6 L;  1BBX C;  2B2W C;  3J80 E;  5ELC A;  1XWE A;  4C3H G;  1V9P A;  5IP9 G;  3VR3 A;  4LF4 Q;  4IQZ A;  3RN2 A;  3GO5 A;  3VYS A;  4JCV E;  4PMC A;  3NK9 A;  1EFW A;  2EXD A;  3OSO A;  5KNC A;  2A6E C;  2LFN A;  4M8A A;  3MAQ A;  4Q5V A;  3TP7 A;  1YNX A;  3M4O B;  4FF4 A;  3EBE A;  4NB3 A;  3L7Z C;  2GVA A;  2N78 A;  5DEH A;  3CMA A;  4RKL A;  4A3D B;  2E2D C;  4GN4 B;  3STB C;  3SDZ A;  1PTO C;  1M90 C;  4NXM Q;  3WWV A;  3KF8 B;  1K73 C;  1GO3 E;  4I7Z C;  3E0J A;  3URY A;  4X62 Q;  3F2U A;  2BA1 A;  4GOP C;  3QR8 A;  1IKM A;  3FP9 A;  2MO1 A;  4LUO A;  1STY A;  2XN9 C;  2VUM H;  4LF8 Q;  3RZO B;  4C3J G;  5EAY A;  4KJN A;  2J0T D;  2NN6 I;  4IAL A;  2ZXP A;  4FVM A;  4ZUJ A;  1H95 A;  4AH6 A;  4UY8 C;  1G2T A;  2VS1 A;  2B8G A;  1VQE A;  3A8J E;  5M5Y B;  3DWA A;  4J15 A;  4BBR G;  2QA4 A;  1LAB A;  2A19 A;  2F0J A;  4LF6 Q;  2M00 A;  5KYL A;  3C46 A;  2L12 A;  5JEA J;  1VQD A;  1K0R A;  1U0L A;  2KEE A;  3M4Q A;  5C4J B;  3M85 A;  3I3C A;  3HOZ G;  3FPU B;  5A35 A;  4ZUI A;  1MJE A;  1Q86 C;  2NVQ B;  4WJW A;  3CHB D;  3BVM A;  1RL2 A;  2OQ0 A;  4LAA A;  3I73 A;  2JA8 B;  1KC8 C;  5GAH C;  4WOR A;  1JJC B;  4A3D G;  1WTV A;  3A0J A;  2EQS A;  4DR3 Q;  4DV1 L;  3CCS A;  3U58 A;  1A63 A;  4IFD I;  3BYY B;  1BBW A;  2IHF A;  4JBK A;  1WI5 A;  2B2Y A;  4YHH L;  3GTJ H;  1FNW A;  1QUQ A;  3RR5 A;  2E5L Q;  3S14 H;  3CME A;  4GLA C;  4X66 Q;  1OXV A;  2FXQ A;  1J5E L;  2Z0S A;  3PIO 3;  1ESR A;  4BY7 H;  3LGJ A;  5M9O A;  3K59 A;  5BR8 Q;  1LUZ A;  1E22 A;  1Y1V B;  2EYH A;  1VQJ A;  1BO0 A;  4XQN A;  4LF7 L;  4A3C H;  1SLJ A;  2JSO A;  3CQZ H;  4F87 A;  1TWC B;  1BOS A;  2B63 G;  4CKB A;  2JA8 G;  3UE1 A;  4Z9C B;  4GZY C;  4RH6 A;  1IL2 A;  1KAW A;  5JOB A;  1GUN A;  2VNU D;  1WYD A;  4FDB A;  1A2T A;  2L15 A;  2F0K A;  3J80 L;  1FJG Q;  3PSI A;  4LUV A;  1K3B C;  3ULL A;  1II3 A;  3FHW A;  3K58 A;  5GRO A;  4DK0 A;  1CHP D;  3PUX A;  2LSS A;  5CV7 A;  4DNI A;  1YNJ C;  3PIP 3;  4R4C A;  3J81 E;  1E2Z A;  2EY1 A;  4DUZ Q;  2F0L A;  4HR7 B;  3A5U A;  1X56 A;  4HJ9 A;  2AWO A;  5IWA L;  3HOU B;  2CH4 A;  4LUZ A;  5CMD A;  1EOT A;  4HJ5 A;  4A3K B;  2UUA Q;  1EFI D;  2JA9 A;  3W3A A;  1B1Z A;  4X3T A;  2R93 B;  4OL7 A;  2RCN A;  3CC7 A;  4EGV A;  5E1F A;  5T1I A;  1STA A;  2QCP X;  2JA7 B;  1I3Q H;  1VQF A;  3A8K E;  3E6Z X;  1U4M A;  2IX3 A;  4A3I H;  1G51 A;  4ID6 A;  1VS0 A;  3MEF A;  4TSS A;  1KAB A;  1BXT A;  2WIN B;  3QWN A;  1OO9 B;  1N36 Q;  3K5N A;  3H09 A;  3VA7 A;  4DR2 Q;  3R3O A;  2Z4I A;  1SMX A;  3DWP A;  1CA6 A;  4DAY B;  1ZEQ X;  3RZD B;  1YJW A;  3F1Z A;  2Z9H A;  4DR4 Q;  4DR1 L;  2LKV A;  3ONA B;  1L2F A;  1IBL L;  1Y14 B;  4C56 C;  1NBW A;  3S2H H;  4AQY Q;  5IIF A;  1O80 A;  2ENB A;  3BVG A;  3P20 A;  3BU2 A;  4MHE A;  2MQH A;  2DY7 A;  3MWY W;  1JJ2 A;  4JI2 L;  3TBI B;  1NNX A;  3GTG B;  2E74 C;  1EIG A;  1YHQ A;  1OTC A;  2OT2 A;  3QJY A;  4A3K G;  2R93 G;  2HHH Q;  1XMQ Q;  2I07 B;  4LF9 Q;  4POG A;  2A68 C;  2JA7 G;  4QIW E;  3FKI H;  2WV6 D;  4OEL B;  2CQO A;  1AE2 A;  3E0E A;  1GUT A;  3NSW A;  1J9O A;  1N8R C;  4DV5 L;  3NWT A;  1N33 L;  4YCU A;  4A3E H;  1VQN A;  1DXM A;  1TS4 A;  4JI3 L;  3U9O A;  4EVO A;  2MFI A;  1TWA H;  1LT4 D;  3ND8 A;  2HCI A;  5E4W C;  1LV9 A;  2Q2H A;  3MXG A;  2NN6 G;  3P7J A;  1NAP A;  1Z47 A;  4OXP A;  1KL9 A;  4LFC Q;  4XYQ A;  4BY1 H;  2R7Z G;  5C0X J;  3MFG A;  2DY8 A;  4LFB Q;  1EWI A;  3TEH B;  1CTM A;  1D6E C;  3B6Y A;  4C3H H;  5IP9 H;  1AZP A;  2EJM A;  5GAD C;  1QVG A;  1GHK A;  1X32 A;  2F4V L;  1B3A A;  3DHQ A;  4CHT B;  1OXS C;  5KYI A;  5CV6 A;  2AQ2 B;  1JIC A;  2EIF A;  1S5B D;  2NZO A;  4K8I A;  3TZU A;  2K01 A;  4XT1 B;  3HOW G;  1I4X A;  2CH4 W;  1YNN C;  3BVZ A;  2DN8 A;  1SYG A;  4KHP Q;  3D31 A;  4DUY Q;  1F9Q A;  3EVQ A;  2KOL A;  5A2Q E;  1L0Y B;  4DFA A;  1A3U A;  3QOL A;  4JI0 Q;  2Q2U A;  4NXN L;  1CFM A;  1TS5 A;  4XIG S;  4JI6 L;  2EXZ A;  3L3O C;  2QKI C;  3QG1 A;  5JVG 3;  1XNQ L;  4XYO A;  4IFD G;  1SFO B;  3NTH A;  1A2U A;  4JI8 Q;  1WTP A;  5NUC A;  3SGI A;  4KI0 A;  1AN8 A;  4CDE C;  3J81 L;  3GTO B;  3R93 A;  5JPM C;  3KFU A;  4C3J H;  1WCM B;  1C48 A;  3WOF A;  3KOJ A;  1ML0 D;  4HSP A;  1EQT A;  3K5L A;  2OCE A;  1EQV A;  4P74 A;  3UDF A;  5IGE A;  1WD1 A;  2A74 C;  1IBK Q;  3TQY A;  3T13 A;  1OXX K;  2QDB A;  1UNS A;  2AHO B;  3NEL A;  3S1R H;  1PTO B;  4HJ8 A;  1JWU D;  2IHE A;  1DD2 A;  1EY7 A;  3MC0 B;  3HOZ H;  4JI1 L;  4XT3 B;  1SJH D;  3OYY A;  2B2V A;  4KKU A;  4GOP B;  2IW3 A;  3K7A B;  2EY5 A;  3M4O H;  4U67 3;  2L1B A;  3NXW A;  4A3D H;  2VXW A;  4QL5 A;  3K0X A;  1YEZ A;  5COY A;  4K0K Q;  1JMC A;  3GDE A;  3VYU A;  2F0E A;  5IGG A;  4A3F B;  3M9B A;  4YCW A;  2WAQ B;  3CF5 A;  1F9R A;  4PZ7 A;  2ALY B;  4RG1 A;  1PH9 A;  2F52 A;  1LYL A;  5HGT A;  3U9S A;  4IUT A;  1X3F A;  3PMF A;  1O78 A;  1VQ7 A;  3RZO H;  1HZ9 A;  2E2J B;  4V19 0;  1SJE D;  1M4V A;  2DJG C;  2ATW A;  1I6H B;  3KLW A;  1CZW A;  1KLU D;  1E2V A;  5IGD A;  4QMG A;  3HKZ B;  2E76 C;  3T1H L;  4XTC S;  1BBU A;  4TQU S;  4CDD C;  5K36 G;  2GA4 B;  3VYR A;  5M5Y H;  1JOR A;  1I4H A;  2CW0 D;  2ZT9 C;  5C4X G;  4UAI A;  3T1Y L;  3MTS A;  3I7F A;  4LNQ A;  5C4J H;  4DAP A;  4X3U A;  4IPG A;  4DV7 Q;  4HIK A;  4UP8 A;  1SMY D;  5ISR A;  2F0S A;  1F9S A;  4IPC A;  2EYL A;  5CC4 A;  3CCE A;  1HUM A;  2NVQ H;  4HSV A;  2B63 H;  3M4Y A;  1F2Y A;  2E75 C;  3PF4 A;  4KY5 A;  2JA8 H;  2NZ1 D;  1SRU A;  1KDC A;  1JB3 A;  2AMC B;  1PMR A;  2EJF C;  1TXY A;  3NBI A;  2EYJ A;  1RDP D;  3I2Z A;  1EQQ A;  1D1I A;  1HNX Q;  2YTX A;  1K8O A;  1SE3 A;  2KUM A;  1DCZ A;  4BA1 I;  1N32 L;  2BE5 C;  5IOD A;  1F9P A;  3CKI B;  5FLM G;  3AFP A;  4WJ4 A;  4JV5 L;  3HZX A;  2KA7 A;  4AYB B;  1PZI D;  3W1G A;  3H3V H;  3LX0 A;  1GUG A;  1V43 A;  3V2T A;  1Q8K A;  4EQN A;  1VQ9 A;  5A2Q L;  2K04 A;  3EN2 A;  1XJV A;  1HNW Q;  2D0P A;  1TKW B;  1XMO Q;  4CJ0 B;  1I6V C;  2X6L A;  5C5M A;  4LF5 Q;  3BZC A;  4KV6 A;  1EEI D;  3TP6 A;  3VR2 A;  4K5V A;  2KCC A;  4KHV A;  4K5W A;  4JBW A;  3K6O A;  1TWC H;  2I5H A;  2C35 B;  2H4O A;  3H0G G;  1R9T H;  1Q7Y C;  1E3P A;  2I5M X;  4X65 L;  1W6K A;  4H02 A;  2HT1 A;  3OIQ A;  3KBG A;  1PFM A;  1IYV A;  2PCF B;  2ZM6 L;  1IYJ B;  4FF3 A;  2RA4 A;  1AH9 A;  1XPO A;  3S17 B;  4CKC A;  2N88 A;  1UAP A;  4YY3 L;  4KMU C;  1VQM A;  3IRB A;  4GNX B;  3K80 C;  2F0M A;  1W2B A;  4P75 A;  5L37 A;  5IP7 G;  4B3M L;  4R4O A;  4FF2 A;  3U4Z A;  1S3O A;  1TS2 A;  3H6M A;  3KK7 A;  2CCZ A;  3HOU H;  5KEE A;  2JA6 B;  1I4Q A;  3TME A;  4A3K H;  2R93 H;  2F0Q A;  1V1P A;  1YBY A;  3QB3 A;  1C4Q A;  2G9H D;  2JA7 H;  4POF A;  5DAU A;  2N8N A;  2BOS A;  1VQC A;  3FMC A;  3R2T A;  1A8V A;  1CKN A;  3EJI A;  3MXN A;  4MTK A;  3AB9 A;  4YWM A;  1BF4 A;  1LTR D;  2M9V A;  2UUC Q;  1Z9F A;  4CJ2 C;  1E1T A;  1B50 A;  2H1E A;  2NN6 H;  2RBM A;  3E9I A;  4UHV A;  2LS0 1;  2EPB A;  2R7Z H;  4CDC C;  1HRJ A;  1ET6 A;  4GN5 A;  3RZD H;  1YHA A;  4DR5 L;  1ENC A;  2K75 A;  4DR6 Q;  1ICF B;  2ASB A;  2RQX A;  4DGZ A;  5KIX A;  5I6W A;  4JOI C;  2XRS D;  3S1M B;  3HFZ B;  1ILP A;  5JJI A;  1HH2 P;  3KDF A;  2F3V A;  4RMF A;  1SRO A;  2A69 C;  5CYU A;  4DU9 A;  1Z7T A;  3H3V I;  5JJZ A;  1X55 A;  2GN5 A;  3HOW H;  3S1N B;  5J39 A;  5LL6 S;  2Z6K C;  2E2H H;  3F2B A;  5M5W B;  3S16 B;  1XPU A;  3O13 A;  2I0Q A;  2EDG A;  3S1Q B;  4BXX G;  4RKB A;  4IFD H;  2ZTC A;  4K14 A;  1PRT C;  5GAE C;  5CGK A;  2N49 A;  5DM6 3;  4FP5 D;  1HNZ Q;  4JBJ A;  3JAM c;  1X3P A;  2F1M A;  2F0P A;  2EZV A;  1GJX A;  3RLN A;  1RF2 D;  5EBD A;  1Q3L A;  3CXC A;  2R7F A;  1ASZ A;  4QY7 A;  3SK4 A;  2PQA A;  2YYZ A;  1A62 A;  3I4L A;  4EX5 A;  2KEN A;  3CCQ A;  5M5X B;  4N8F A;  2RF4 A;  3KLS X;  1LTT D;  3JAM i;  1SDF A;  3VR4 A;  4L63 B;  2A6H C;  1XNR Q;  2XWJ B;  4JI4 L;  3C3L A;  2PI2 A;  4ZQ3 A;  1CM9 A;  2DGY A;  2RCF A;  4N8X 1;  4XQJ A;  2UU9 Q;  4C3I B;  4LFA L;  2CWA A;  1V8Q A;  1JOO A;  2UXC L;  3OW2 A;  2UXB L;  1JOK A;  3JC6 6;  1SFO H;  2LXJ A;  4YHH Q;  4O0A A;  1S40 A;  4FF1 A;  2QW7 A;  4ZAI A;  1H9M A;  4ZLT F;  2WB1 B;  3GTO H;  1YHB A;  3FDT A;  3GV3 A;  3I91 A;  5ELB A;  3KYH C;  3CPF A;  3WDN A;  4ZYS A;  2WKD A;  1XTC D;  1FGU A;  3NP8 A;  5LMU Q;  4A3J B;  1VQ4 A;  5K36 H;  1E7Z A;  4A3B B;  3V96 A;  2RSO A;  4JYA L;  1D2B A;  2GVB A;  1C7Y A;  1QE6 A;  3OW7 A;  2E8G A;  2BDN A;  4J6H A;  5C4X H;  4NDX A;  1TY0 A;  3BDO A;  1PTO H;  5HGQ A;  3IKJ A;  4PV1 C;  3FRP B;  1KIX A;  4LF7 Q;  1FNU A;  4C1N K;  3KF6 B;  1CHQ D;  3CCM A;  1DOK A;  4B3R L;  4CJ1 B;  1F2M A;  3CP0 A;  1HPC A;  5KND A;  5E7N A;  1I5F A;  1HR0 Q;  3JAM E;  4GNX A;  2OTL A;  1A3T A;  3NEN A;  1EQR A;  3K8A A;  4F88 A;  4C3I G;  1X3E A;  1PH6 A;  1NCV A;  3OMG A;  1PH3 A;  1EIF A;  1DON A;  1DGS A;  2DNC A;  4A3F H;  1NUC A;  3DWQ A;  1ILQ A;  4RHS A;  2L11 A;  5FLM H;  3MXU A;  4OEM B;  4NXM L;  3IL8 A;  4DF7 A;  2WB1 G;  5D3D A;  2B29 A;  3G4S A;  1SYF A;  2E2J H;  3UDX A;  1CK1 A;  3OHX C;  3R8B A;  5IWA Q;  3IFD A;  3A54 A;  3T56 B;  1SYE A;  2R92 B;  4Y7N B;  5CV9 A;  1JR0 D;  3OMC A;  1ZYR D;  3VA5 A;  4DV4 Q;  4A3B G;  1MSG A;  2F0H A;  2MJ8 A;  4HTH A;  3I8Z A;  1NMF A;  3D6C A;  1WFQ A;  2F0U A;  4MIU A;  1YIJ A;  1CSQ A;  5D3I B;  1IZ6 A;  2O5J C;  4O42 A;  2CQA A;  4OWT B;  4HAE A;  4HMI A;  5M3M B;  4JI5 Q;  4LF6 L;  1CSP A;  1SYC A;  3TRZ A;  3NQT A;  3H0G H;  1ZXT A;  5FJ8 H;  4R8I A;  3NEM A;  4YWL A;  1ASY A;  3RLF A;  2F0G A;  5TSS A;  3NBH B;  5C0X I;  4EQP A;  5JPN C;  1TII D;  4DR1 Q;  4LMQ D;  3NWS A;  1CUK A;  5JEA G;  1IBL Q;  3ERS X;  1KNE A;  4RA8 A;  2CKZ B;  2RDH A;  4HJ7 A;  4R8N A;  1QWY A;  4DR3 L;  5IP7 H;  4N9T A;  2XGT A;  1BCP C;  3CCJ A;  2B2U A;  3PO3 B;  2RSN A;  3PQI A;  4X3K A;  1L1O A;  4JI7 Q;  1SYD A;  4LW1 A;  2JXM B;  5IYB G;  3AFQ A;  1Y1W B;  4DR7 L;  2ICI A;  1Y1V G;  3BDL A;  1E0B A;  1CA5 A;  1KQS A;  3L2P A;  2K6A A;  2DJF C;  3D4W A;  3HOY B;  4R4I A;  2DNE A;  5FLX c;  3H15 A;  2VL6 A;  4JI3 Q;  3LWE A;  4J1M A;  5D14 A;  4B3T L;  1GUS A;  1KHI A;  1PFB A;  5BR8 L;  1ENF A;  4IUN A;  2JEB I;  5M3M G;  3CD6 A;  1IBM Q;  2HUG A;  3GTK H;  1K83 B;  4V0B A;  4H44 C;  3A5Z B;  5BN3 A;  3AU7 A;  5C3X A;  2NUC A;  2HIX A;  1NJI C;  3F8T A;  1I4R A;  3DXJ C;  2B2Y C;  4X3S A;  3NHH A;  1IYU A;  1SNO A;  3HGB A;  1BNZ A;  2OWO A;  3NTI A;  3GTQ B;  2F0F A;  3S17 H;  5I9P A;  4GLX A;  4A3M B;  3SR1 A;  2LXK A;  2YV5 A;  1EU3 A;  2E2I B;  3KF8 A;  2PW7 A;  1IW7 D;  2ZJP A;  1PZJ D;  1I4G A;  2UUB L;  4A93 B;  3LWU A;  3HOU G;  3I4N B;  1WOC A;  2YTY A;  4HJA A;  1K0S A;  5G3L F;  3PO3 G;  1PH2 A;  1Q46 A;  4KKT A;  2JA6 H;  1HFN A;  2A5H A;  3GP7 A;  2XWB B;  4IFD J;  1VMP A;  4X6A H;  2VB2 X;  4HIM A;  2O2L D;  4S3S A;  3CRK C;  1Y1W G;  2JYO A;  1U4P A;  1B7Y B;  1KTK A;  3J7Z C;  3K5O A;  4NXN Q;  4JI6 Q;  3HOY G;  1PYW D;  4BXX H;  3ND9 A;  4KJO A;  1XNQ Q;  2UUA L;  2JA5 B;  3I55 A;  2ZXR A;  4I65 A;  2A73 B;  3T53 B;  2IL8 A;  2PMZ B;  3QOJ A;  2G9D A;  2R3Z A;  1X65 A;  4A76 A;  1JQY D;  5ELE A;  2JJQ A;  2OF1 A;  1N36 L;  4APV A;  1E24 A;  1E1O A;  2OQK A;  2F3W A;  1SE2 A;  4NW2 A;  5JVH 3;  5BN4 A;  4A3M G;  1QVC A;  3LNN A;  1WTH A;  3S1M H;  3U4V A;  4DR4 L;  4JI1 Q;  1PZK D;  5FKA C;  2B2U C;  5IT9 c;  3ULP A;  2A1A A;  1N34 Q;  4A75 A;  2XVS A;  3C1E A;  2K28 A;  1D7Q A;  4K5X A;  4AQY L;  3S1N H;  1SE8 A;  4H7B A;  1TVX A;  1PRT B;  1A0I A;  3D0F A;  3TZD A;  2K5W A;  2WFW A;  1C8C A;  3GTM H;  5M5W H;  3S16 H;  3SEB A;  4DAV A;  1B2T A;  4OX9 L;  2EE1 A;  3DEO A;  2JE6 I;  3S1Q H;  5CV4 A;  3G48 A;  1LTB D;  2JP1 A;  3AQQ A;  1O7Z A;  3SVM A;  3MFY A;  2OTJ A;  5E4X A;  2A6E D;  2NTT A;  1B70 B;  2D62 A;  2ID0 A;  1QNU A;  1JWS D;  4WRD A;  1QB5 D;  2NB0 A;  1G6Z A;  2LMC B;  5IY0 A;  1V1O A;  3STB D;  4TRD A;  2K32 A;  2V1C C;  1PTO D;  2XIW A;  1F77 A;  5EGT A;  4ILW A;  1C0A A;  2B39 A;  1GKH A;  3S9W A;  2NYZ D;  3T1Y Q;  2IX0 A;  2F3I A;  5AJ3 L;  4DAM A;  5M5X H;  3I70 A;  2D9U A;  1MHW C;  2R7D A;  2WAQ E;  1EIH A;  4JVZ A;  1MKH A;  1S5D D;  4JPB W;  3A56 A;  4F8M A;  1DYQ A;  2K14 A;  5D65 A;  5K5P A;  2P5Z X;  4KD3 A;  3OWF A;  2M2L A;  1AZQ A;  1U5K A;  1SXT A;  3HP3 A;  2NWG A;  1VMC A;  5C0X G;  3HKZ E;  4C3I H;  1M8A A;  2JQO A;  3BYT B;  2JN4 A;  5CV5 A;  1NE3 A;  5ELF A;  1GVP A;  1EY4 A;  3QIA A;  2F0O A;  4KHP L;  1DJR D;  3K5M A;  5C44 B;  2K05 A;  4IPH A;  1I94 Q;  5J3B A;  5EQ0 A;  3HS0 C;  1WCM G;  1CT1 D;  4XDX A;  1GUW A;  1VQI A;  4PMB A;  2K7V A;  3DLL A;  4QQB X;  3G6J B;  2QIL A;  3CC2 A;  1K8A C;  3ICE A;  3VR6 A;  2WKC A;  1HXY D;  3FVQ A;  2J4X A;  3TRE A;  3M7G A;  4EQ5 A;  5M3F B;  3DUZ A;  4OIJ A;  1HHV A;  2F0I A;  5IOC A;  3HOX B;  4WFN 3;  5EKL A;  4DV2 Q;  4WJ3 M;  4A3B H;  1FR3 A;  3KJO A;  2F0N A;  3BJU A;  4DAY A;  4DV6 L;  3N52 A;  3J7Y W;  5LMN L;  3R2I A;  1M1K C;  2PW5 A;  1IBK L;  2K50 A;  1PXU A;  1JCK B;  4FO2 A;  2R6G A;  5EPK A;  4DXF A;  3I72 A;  1B8A A;  2PI2 E;  1H9J A;  4DV0 Q;  2IT1 A;  4JBM A;  4K8J A;  4AYB E;  1GHJ A;  4G57 A;  1MJC A;  3I4O A;  4A3F G;  4B3S Q;  4K2L A;  4OHJ A;  3IAY A;  2WAQ G;  4ZKB B;  3RLO A;  3DM3 A;  4KHZ A;  3BZK A;  1ENA A;  4O1N A;  5JEA H;  1SYB A;  4IZ8 A;  4JK1 C;  1EYD A;  3ITP A;  2XSC A;  4YY3 Q;  1DOL A;  2SDF A;  1B44 D;  1K8M A;  5C44 G;  3CCR A;  1J8I A;  1GOZ A;  5COR A;  1VQ6 A;  4KTA A;  4K0K L;  1W3S A;  3Q24 A;  3QO2 A;  2NBF A;  2NZH A;  3D6W A;  3HKZ G;  2Q2T A;  4RHR A;  3AEV A;  3V05 A;  3S24 A;  2ZJR A;  3FEW X;  5M3F G;  4RGT A;  4DXG A;  4Y7N H;  1EY0 A;  5IYB H;  3CAM A;  5IGB A;  1Y69 U;  2IY5 B;  4YWK A;  1DOM A;  3VYT A;  1Y1V H;  1TWF B;  2Z1C A;  2IX1 A;  3K0Y A;  4BWG B;  2B2V C;  2UXD L;  3K57 A;  5I6Y A;  4ODG A;  1EYC A;  3W1B A;  1YNJ D;  1O7Y A;  3A7L A;  2VQF L;  3SE0 A;  1SNC A;  5M3M H;  3F2D A;  1EEF D;  5FJ8 G;  1GD7 A;  1PRT F;  2O5I C;  2VB3 X;  2CWP A;  2MHV A;  2Y0S B;  1C9O A;  2OEO A;  4QJF A;  1LTA D;  2ICE C;  3EIV A;  4NPS A;  2VY3 A;  2YU9 B;  3SK5 A;  1BCP B;  1WJJ A;  1Y8N B;  3E9H A;  4DR5 Q;  2K5V A;  3Q22 A;  5IYC G;  4BA2 I;  1LTL A;  4YIJ A;  4GKJ Q;  2JEA I;  1T5E A;  3ZYY X;  3DM1 A;  2RDG A;  4ALP A;  2MO0 A;  2BH8 A;  3D4D A;  1J6Q A;  1VQG A;  1SNM A;  2WAC A;  4AYB G;  3TSS A;  4IPD A;  1HNX L;  2QGQ A;  1Q81 C;  2B2W A;  1JE5 A;  3PO3 H;  2VQE L;  1GXD C;  1SE4 A;  4R9W A;  5CV8 A;  3K7U C;  1Y1W H;  4JG2 A;  4L5T A;  2B2T A;  1QVF A;  1U4L A;  3MA2 B;  2L55 A;  2PNH A;  2Q2I A;  3HOY H;  4NKL A;  3GTL B;  3M3Y B;  4B08 A;  3CCU A;  2B3G A;  3J80 c;  4GN3 B;  4QUF A;  4ZK9 B;  1YI2 A;  1NR2 A;  4ME3 A;  1YIT A;  1QUQ B;  3CRL C;  4JC0 A;  4RFB A;  3FKI B;  3P75 A;  1HJP A;  4L5S A;  2BCO A;  3EA6 A;  2I46 A;  3C2P A;  1I50 B;  3EQL C;  1K83 H;  2Y0S G;  1HUN A;  1S72 A;  1TWA B;  4GOP A;  4IOC A;  1PYB A;  1HTP A;  2A68 D;  1TWG B;  2EY6 A;  4CBV A;  1SBB B;  1G91 A;  3DMU A;  3GTQ H;  1WTW A;  1FD7 D;  1MBY A;  1TS3 A;  2NVY B;  3EFX D;  1PFN A;  4A3M H;  4LK1 C;  4KY6 A;  5GAG C;  2E2I H;  3RN5 A;  2OXP A;  3PUZ A;  2D0O A;  1ET9 A;  4QF4 A;  1Q90 A;  1ICW A;  3GTG H;  2JA6 G;  1EIY B;  1SR3 A;  1U9R A;  1U4R A;  5FO7 B;  2Z6B A;  3BS1 A;  1B9N A;  3GV6 A;  4GKK L;  1G8Z D;  3PUW A;  4O2D A;  2N55 A;  2XRQ D;  2KEC A;  1SND A;  4UPA A;  4LFA Q;  4DNT B;  3AMU A;  1HFG A;  5C4H A;  1VQB A;  5CBA E;  4FYD A;  5FOB B;  2UXC Q;  2JA5 H;  4G4K A;  5LMN W;  1PA6 A;  4OON A;  4MNO A;  2SOB A;  3VDY A;  5IYD G;  3PUY A;  4K6L A;  1YNN D;  2DUD A;  4C2M B;  1TQO A;  5CBE E;  1E2W A;  3RMH A;  3HG9 A;  4PMW A;  1Q1E A;  4P73 A;  4YCV A;  1JC7 A;  2PNR C;  1VQL A;  3X3N A;  1GUO A;  1YZ6 A;  1B9M A;  3OPO A;  1BR9 A;  1O7L A;  4L5R C;  1FVI A;  1WD0 A;  4B9X A;  2L5T A;  2I5L X;  4BBR B;  4Q0F A;  1UE6 A;  1ZKO A;  3HOV B;  3SK6 A;  4FXK C;  3S2D B;  3S1R B;  4DN4 M;  3OTO L;  1WTR A;  4B3R Q;  2F03 A;  1LT5 D;  2WB1 E;  1QIL A;  3MEH A;  1ESF A;  5FO9 B;  1PH7 A;  2B2T C;  3HOZ B;  2PZW A;  5C0X H;  3NTK A;  1H9K A;  2O4X A;  4IUQ A;  4DV1 Q;  2F0V A;  1MD2 D;  1S5C D;  1NMG A;  2JK8 A;  3J7A 5;  4HIO A;  4A3L G;  1CZG A;  3DEP A;  1AW7 A;  3T4A C;  2K1B A;  1KLG D;  1TWH B;  4FXD A;  3CC4 A;  5G3L D;  3OOC A;  1WCM H;  3KBX A;  2FMM A;  3GQB A;  1PLF A;  1J5E Q;  2Q8R E;  1XPR A;  1TT2 A;  4I7A A;  2D5D A;  1KDA A;  5DNF A;  2KHI A;  4X64 L;  1XX8 A;  5HUR A;  3CCL A;  3ULJ A;  1BCP F;  2RDF A;  4ZKC B;  4E6I A;  1RTN A;  4OGQ C;  5IE8 A;  4DV3 L;  2FIN B;  1FL0 A;  1HNZ L;  1LT6 D;  2FFK B;  1NY4 A;  4KK7 A;  1SSO A;  2F0T A;  2NVT B;  3N6R A;  3KUP A;  4LWC A;  2MGS A;  1EL0 A;  4LF4 L;  3K7A H;  1L0W A;  5C3E B;  1HA6 A;  2SNM A;  3D8G A;  1G2S A;  3A74 A;  1PYS B;  4JW0 A;  1PV4 A;  3HOV G;  1K9M C;  4OO1 G;  1VQA A;  3M7N A;  3J81 c;  1JWM D;  1VDZ A;  5IGF A;  2KHJ A;  4F7X A;  1UE1 A;  1VQP A;  3I4M B;  2MPM A;  3HEJ A;  1Q8I A;  2B63 B;  2KCM A;  1T9H A;  4QB4 A;  1XNR L;  1VQ8 A;  2KVM A;  5IGC A;  5C44 H;  3NPP A;  1HQM C;  1QZG A;  2BH2 A;  1OXT A;  2UU9 L;  4X62 L;  2CW0 C;  1DZ1 A;  1I6H H;  5CR3 A;  4CKE A;  3J81 i;  4HCE A;  1WTO A;  5M3F H;  4OWW B;  4A3J G;  4LF8 L;  1SMY C;  5C5L A;  3MVV A;  1KDB A;  2AUJ D;  3HOX H;  3PO2 B;  4DR7 Q;  1B53 A;  1HZB A;  2X69 A;  1JE4 A;  1EYG A;  1LM0 A;  2BE5 D;  1STN A;  1EZ6 A;  2KCT A;  1CQF A;  4EQO A;  3WOE A;  1F2L A;  2EVB A;  5I4D A;  5LMU L;  4B3T Q;  3AYH B;  2Z8L A;  2Q8T A;  2VZA A;  5C3E G;  3PCO B;  4XQQ A;  1CKO A;  3E3X A;  2RHS B;  5ELN A;  3J81 j;  3TDQ A;  1SN8 A;  1UUP A;  4RCN A;  1RCV D;  3A55 A;  1H9S B;  2IWH A;  1KXL A;  1UWV A;  1AE3 A;  1BKB A;  2G5D A;  3X3M A;  3J7A F;  2ZJQ A;  1LAC A;  3RNU A;  4KN4 C;  3I4M G;  5IYC H;  1Q1B A;  4KKS A;  3UE0 A;  1R9T B;  2R61 A;  1HR0 L;  3MXP A;  1S5F D;  2PO4 A;  2F0D A;  1P8L A;  2UUB Q;  2HDM A;  4JI2 Q;  1VQH A;  1Q12 A;  3CCV A;  1W6J A;  4U68 A;  4ABN A;  2R92 G;  3G7L A;  1KD1 C;  1EY5 A;  2F4I A;  2ZTE A;  1X3Q A;  1EY6 A;  1D5X C;  2E5L L;  3M4P A;  2K5N A;  1LLR D;  4X66 L;  2NVX B;  3Q8D A;  3PO2 G;  3KLR A;  2PQE A;  2QDL A;  4DV5 Q;  1N33 Q;  5JJL A;  2IJ0 A;  1TWF H;  1UEA B;  3H91 A;  3S15 B;  3TP5 A;  3I56 A;  1EYA A;  3P1H A;  3G6E A;  4ZCK A;  1STB A;  2IPK D;  4QGU A;  4GS3 A;  4RGN A;  4DV4 L;  4GNX C;  3TN2 A;  2ZTD A;  3HKS A;  4RGM A;  1QOH A;  1UE7 A;  1PDQ A;  4HMJ A;  1PH5 A;  2YU9 H;  4L6T B;  1R4Q B;  4JI5 L;  4CDF C;  1ROD A;  2F4V Q;  5LHY 1;  1AFP A;  2KCN A;  1O7I A;  1S5E D;  4P71 A;  3PUV A;  2R7Z B;  1FJG L;  5JAV A;  4L5Q A;  2CHB D;  2EJG C;  4A3G B;  1STH A;  3D3R A;  4ME5 A;  2X6G A;  3JAM L;  3A7A B;  4DNR B;  1D5M C;  1EY9 A;  2PMZ E;  4N9P A;  4DUZ L;  4DPG A;  1G6P A;  4DK3 C;  4HID A;  5I9O A;  2BDO A;  4OX9 Q;  4KD4 A;  2Q8I B;  3HOW B;  3ERQ A;  1HZC A;  5FK9 C;  2FJ2 A;  4JI7 L;  2WP8 J;  3GTL H;  3M3Y H;  2E2H B;  2PZU A;  2J7Z A;  2HDL A;  4TVA B;  1AP0 A;  1IKL A;  4DA2 A;  2A69 D;  1BDO A;  1WTX A;  2RVL A;  1RJT A;  4IOA A;  5T1G A;  5LL6 X;  4A4I A;  3NQI A;  1NSN S; 
#chains in the Genus database with same CATH homology
 3OIP A;  3SHL A;  3L9A X;  1R4P B;  4BBS B;  2MP1 A;  1IHZ A;  1TY2 A;  2XNA C;  4QCL A;  3CU7 A;  5C6A A;  4BS9 A;  5KGU A;  4QIW B;  5EKK A;  3GTP B;  2B8F A;  1ONL A;  5FLX E;  4ULL A;  1FNV A;  3I90 A;  2SNS A;  1PRT D;  1EWC A;  2C9O A;  4B9W A;  1LO5 D;  4KY7 A;  1XXG A;  4P2C B;  3TP8 A;  3Q6S A;  1EZ8 A;  1Y8P B;  2TSS A;  4H0L C;  1WTQ A;  1A15 A;  4RAU C;  1MGS A;  2L4N A;  4HN7 A;  5C3W A;  1VF5 C;  3SXH A;  2TMP A;  4G7H C;  4IUP A;  2F0W A;  3T16 A;  2K5Q A;  1LTS D;  1EU4 A;  1CI3 M;  2A6H D;  1HQR D;  1L0X B;  1RD9 D;  1STG A;  5KRU A;  2VUM B;  1D1K A;  1V1P B;  3BDC A;  1T5X D;  2K03 A;  1H9S A;  3NBH A;  2EYM A;  1SAP A;  4HED A;  1OXU A;  2K33 A;  4L8J A;  1VF7 A;  4KN7 C;  4UDU C;  5C4X B;  4OO1 H;  5EKI A;  4H13 C;  1DM0 B;  4TKO B;  5E3F A;  1LTI D;  3PV0 A;  2D2C C;  2LY7 A;  1AEX A;  4K2K A;  1A6X A;  1RHP A;  4J8Q A;  2NTS A;  4QUC A;  2PYK A;  1LT3 D;  1SNQ A;  5IT9 E;  3GTJ B;  1QCB D;  4PNY A;  5ELD A;  1JOQ A;  3W2D A;  2L9H A;  3S14 B;  1BQQ T;  4BY7 B;  1B4O A;  1HCZ A;  2EYP A;  3FPP A;  4XXE A;  2EOT A;  1MI2 A;  5EPL A;  1TU2 B;  1D5Z C;  1Z6H A;  2CVR A;  3ERO A;  4ZRZ A;  3H3V C;  4IUR A;  4HCS A;  5BN5 A;  3CQZ B;  2EYF A;  2KJX A;  1WVL A;  5F2D A;  5I2Y A;  4PQX A;  4NP5 A;  5KNB A;  5I2X A;  3H0G B;  3BZD B;  5FLX L;  2KED A;  1ZYR C;  1EWH A;  4K6D A;  2FMC A;  2FHT A;  1H9R A;  2HQE A;  1KAA A;  1TR5 A;  1Y8O B;  5AFW A;  1VCI A;  1QJO A;  1QNK A;  1LTG D;  2KHS A;  1SEB D;  3C1F A;  3MHB A;  5C4Z A;  2K5D A;  3BG3 A;  2BA0 A;  4DK1 A;  1NR4 A;  4CGY B;  4NMZ A;  1I3Q B;  1STE A;  4A3I B;  5J1Z A;  4OO1 I;  1BCP D;  3T51 B;  1FYC A;  3A8I E;  3RD4 A;  5J22 A;  3MZ5 A;  3IFT A;  3GTK B;  1BUV T;  1SNP A;  2QEJ C;  2SEB D;  2HCC A;  4LJZ C;  1MSH A;  3S2H B;  5EBC A;  4RCO A;  4IN3 A;  1HTL D;  2PPB C;  2C5C A;  3SK8 A;  2AUK A;  5FO8 B;  2ZXO A;  4IUU A;  3E5S A;  1IL8 A;  1XYI A;  1S4Z A;  3H94 A;  5IT9 L;  4A3E B;  3RUZ A;  2AQ1 B;  1PTO F;  4FXG C;  1IW7 C;  4G7Z C;  1RTO A;  1KNA A;  2PZT A;  1RKN A;  4MN3 A;  4BY1 B;  2WII B;  4C3H B;  3KLS A;  3HRZ C;  4RGO S;  4G7O C;  2QF7 A;  1QG7 A;  4C1N I;  2Z4H A;  1F2Z A;  4FNF A;  4OIK A;  2L0C A;  1CQV A;  4IUV A;  3VR5 A;  1HA5 A;  2EYO A;  3GD7 A;  5EJW A;  3GTM B;  2AWN A;  2V4D A;  3NE5 B;  2AQ3 B;  2EY2 A;  4RWS C;  5DM7 3;  3J7A V;  1I4P A;  1G29 1;  3Q23 A;  3Q0A A;  3D4R A;  4C3J B;  3UI2 A;  5EPJ A;  1A3V A;  2MUY A;  3OWE B;  1FGB D;  2KQ3 A;  2RKS A;  1EY8 A;  3NUC A;  4M1U B;  1BBX C;  2B2W C;  3J80 E;  5ELC A;  1XWE A;  4C3H G;  3VR3 A;  4IQZ A;  3GO5 A;  3VYS A;  4PMC A;  3NK9 A;  3OSO A;  5KNC A;  2A6E C;  2LFN A;  4M8A A;  3MAQ A;  4Q5V A;  3TP7 A;  3M4O B;  4FF4 A;  3L7Z C;  5DEH A;  4RKL A;  4A3D B;  2E2D C;  3SDZ A;  1PTO C;  4I7Z C;  3E0J A;  3URY A;  3F2U A;  2BA1 A;  1IKM A;  1STY A;  2XN9 C;  3RZO B;  4C3J G;  4KJN A;  2J0T D;  2NN6 I;  4IAL A;  2ZXP A;  4FVM A;  4ZUJ A;  1G2T A;  2B8G A;  3A8J E;  5M5Y B;  3DWA A;  1LAB A;  2F0J A;  2M00 A;  5KYL A;  3C46 A;  2L12 A;  5JEA J;  2KEE A;  5C4J B;  3M85 A;  3I3C A;  3FPU B;  5A35 A;  4ZUI A;  2NVQ B;  4WJW A;  3CHB D;  3BVM A;  4LAA A;  3I73 A;  2JA8 B;  4WOR A;  1WTV A;  4IFD I;  3BYY B;  2B2Y A;  1FNW A;  1OXV A;  3PIO 3;  1ESR A;  5M9O A;  3K59 A;  1Y1V B;  2EYH A;  1BO0 A;  4XQN A;  2JSO A;  4F87 A;  1TWC B;  1BOS A;  4CKB A;  4Z9C B;  4GZY C;  4RH6 A;  5JOB A;  1GUN A;  2VNU D;  1A2T A;  2F0K A;  3J80 L;  1II3 A;  3K58 A;  4DK0 A;  1CHP D;  3PUX A;  5CV7 A;  1YNJ C;  3PIP 3;  3J81 E;  1E2Z A;  2EY1 A;  2F0L A;  4HR7 B;  2AWO A;  3HOU B;  5CMD A;  1EOT A;  4A3K B;  1EFI D;  4X3T A;  3W3A A;  1B1Z A;  2R93 B;  4OL7 A;  4EGV A;  5E1F A;  5T1I A;  1STA A;  2QCP X;  2JA7 B;  3A8K E;  3E6Z X;  1U4M A;  2IX3 A;  4ID6 A;  4TSS A;  1KAB A;  1BXT A;  2WIN B;  3QWN A;  1OO9 B;  3K5N A;  3H09 A;  3VA7 A;  3R3O A;  2Z4I A;  3DWP A;  1CA6 A;  1ZEQ X;  3RZD B;  2LKV A;  3ONA B;  4C56 C;  5IIF A;  1O80 A;  2ENB A;  3BVG A;  3P20 A;  4MHE A;  2DY7 A;  3MWY W;  3TBI B;  3GTG B;  2E74 C;  1EIG A;  2OT2 A;  3QJY A;  2I07 B;  2A68 C;  2WV6 D;  3NSW A;  1GUT A;  1J9O A;  3NWT A;  1DXM A;  1TS4 A;  3U9O A;  4EVO A;  1LT4 D;  3ND8 A;  2HCI A;  5E4W C;  1LV9 A;  3MXG A;  2NN6 G;  3P7J A;  1NAP A;  1Z47 A;  4XYQ A;  5C0X J;  3MFG A;  2DY8 A;  1CTM A;  1D6E C;  1AZP A;  2EJM A;  1GHK A;  1X32 A;  1B3A A;  3DHQ A;  4CHT B;  1OXS C;  5KYI A;  5CV6 A;  2AQ2 B;  1JIC A;  1S5B D;  4K8I A;  3TZU A;  2K01 A;  4XT1 B;  1I4X A;  1YNN C;  3BVZ A;  2DN8 A;  1SYG A;  3D31 A;  1F9Q A;  3EVQ A;  2KOL A;  5A2Q E;  1L0Y B;  4DFA A;  1A3U A;  3QOL A;  1CFM A;  1TS5 A;  4XIG S;  2EXZ A;  3L3O C;  2QKI C;  3QG1 A;  5JVG 3;  4XYO A;  4IFD G;  1SFO B;  3NTH A;  1A2U A;  1WTP A;  5NUC A;  4KI0 A;  1AN8 A;  3J81 L;  3GTO B;  3R93 A;  5JPM C;  1WCM B;  1C48 A;  3WOF A;  1ML0 D;  4HSP A;  1EQT A;  3K5L A;  1EQV A;  5IGE A;  1WD1 A;  2A74 C;  3T13 A;  1OXX K;  2QDB A;  1UNS A;  1PTO B;  1JWU D;  1DD2 A;  1EY7 A;  3MC0 B;  4XT3 B;  1SJH D;  2B2V A;  4KKU A;  2IW3 A;  3K7A B;  2EY5 A;  4U67 3;  2L1B A;  3NXW A;  2VXW A;  5COY A;  3VYU A;  2F0E A;  5IGG A;  4A3F B;  2WAQ B;  1F9R A;  5HGT A;  3U9S A;  4IUT A;  3PMF A;  1O78 A;  2E2J B;  4V19 0;  1SJE D;  1M4V A;  1I6H B;  1CZW A;  1KLU D;  1E2V A;  5IGD A;  4QMG A;  3HKZ B;  2E76 C;  4XTC S;  4TQU S;  5K36 G;  2GA4 B;  3VYR A;  1JOR A;  1I4H A;  2CW0 D;  2ZT9 C;  4UAI A;  3MTS A;  4DAP A;  4X3U A;  1SMY D;  5ISR A;  2F0S A;  1F9S A;  2EYL A;  5CC4 A;  1HUM A;  4HSV A;  3M4Y A;  1F2Y A;  2E75 C;  4KY5 A;  2NZ1 D;  1KDC A;  1JB3 A;  1PMR A;  2EJF C;  3NBI A;  2EYJ A;  1RDP D;  1D1I A;  1K8O A;  1SE3 A;  2KUM A;  1DCZ A;  4BA1 I;  2BE5 C;  5IOD A;  1F9P A;  3CKI B;  3HZX A;  2KA7 A;  4AYB B;  1PZI D;  3LX0 A;  1GUG A;  1V43 A;  3V2T A;  4EQN A;  5A2Q L;  2K04 A;  1TKW B;  4CJ0 B;  1I6V C;  2X6L A;  5C5M A;  4KV6 A;  1EEI D;  3TP6 A;  3VR2 A;  4K5V A;  2KCC A;  4KHV A;  4K5W A;  4JBW A;  3K6O A;  2H4O A;  1W6K A;  3OIQ A;  3KBG A;  1PFM A;  1IYV A;  2PCF B;  4FF3 A;  2RA4 A;  3S17 B;  4CKC A;  2N88 A;  1UAP A;  4KMU C;  2F0M A;  4FF2 A;  1TS2 A;  3H6M A;  3KK7 A;  5KEE A;  2JA6 B;  1I4Q A;  3TME A;  2F0Q A;  1V1P A;  3QB3 A;  1C4Q A;  2G9H D;  5DAU A;  2BOS A;  3FMC A;  3R2T A;  3EJI A;  3MXN A;  3AB9 A;  1BF4 A;  1LTR D;  2M9V A;  4CJ2 C;  1B50 A;  2H1E A;  2NN6 H;  2RBM A;  2LS0 1;  2EPB A;  1HRJ A;  1ET6 A;  1ENC A;  2RQX A;  4DGZ A;  5KIX A;  5I6W A;  2XRS D;  3S1M B;  1ILP A;  2F3V A;  2A69 C;  5CYU A;  4DU9 A;  1Z7T A;  5JJZ A;  3S1N B;  5J39 A;  5LL6 S;  5M5W B;  3S16 B;  3O13 A;  2EDG A;  3S1Q B;  4RKB A;  4IFD H;  4K14 A;  1PRT C;  5CGK A;  5DM6 3;  4FP5 D;  1X3P A;  2F1M A;  2F0P A;  2EZV A;  1GJX A;  1RF2 D;  5EBD A;  1Q3L A;  3SK4 A;  2YYZ A;  3I4L A;  5M5X B;  3KLS X;  1LTT D;  1SDF A;  3VR4 A;  4L63 B;  2A6H C;  2XWJ B;  3C3L A;  4ZQ3 A;  1CM9 A;  4XQJ A;  4C3I B;  1V8Q A;  1JOO A;  1JOK A;  4FF1 A;  4ZAI A;  1H9M A;  4ZLT F;  2WB1 B;  3FDT A;  3GV3 A;  3I91 A;  5ELB A;  4ZYS A;  3WDN A;  2WKD A;  1XTC D;  3NP8 A;  4A3J B;  5K36 H;  4A3B B;  3V96 A;  2RSO A;  1D2B A;  1QE6 A;  3OW7 A;  2BDN A;  4J6H A;  4NDX A;  1TY0 A;  3BDO A;  1PTO H;  3IKJ A;  4PV1 C;  3FRP B;  1FNU A;  4C1N K;  1CHQ D;  1DOK A;  4CJ1 B;  1F2M A;  1HPC A;  5KND A;  3JAM E;  1A3T A;  4F88 A;  4C3I G;  1NCV A;  3OMG A;  1DON A;  2DNC A;  1NUC A;  3DWQ A;  1ILQ A;  4RHS A;  2L11 A;  3MXU A;  3IL8 A;  4DF7 A;  5D3D A;  1SYF A;  1CK1 A;  3OHX C;  3R8B A;  3IFD A;  3A54 A;  3T56 B;  1SYE A;  2R92 B;  4Y7N B;  5CV9 A;  1JR0 D;  3OMC A;  1ZYR D;  3VA5 A;  1MSG A;  2F0H A;  2MJ8 A;  4HTH A;  3I8Z A;  3D6C A;  2F0U A;  4MIU A;  5D3I B;  2O5J C;  4O42 A;  2CQA A;  4HAE A;  4HMI A;  5M3M B;  1SYC A;  3NQT A;  1ZXT A;  4R8I A;  3RLF A;  2F0G A;  5TSS A;  5C0X I;  4EQP A;  5JPN C;  1TII D;  4LMQ D;  3NWS A;  5JEA G;  1KNE A;  4RA8 A;  2RDH A;  4R8N A;  1QWY A;  4N9T A;  1BCP C;  2B2U A;  3PO3 B;  2RSN A;  4X3K A;  1SYD A;  2JXM B;  1Y1W B;  2ICI A;  3BDL A;  1E0B A;  1CA5 A;  2K6A A;  3D4W A;  3HOY B;  2DNE A;  3LWE A;  4J1M A;  5D14 A;  1GUS A;  1PFB A;  1ENF A;  4IUN A;  2JEB I;  2HUG A;  1K83 B;  4V0B A;  4H44 C;  5BN3 A;  3AU7 A;  5C3X A;  2NUC A;  1I4R A;  3DXJ C;  2B2Y C;  4X3S A;  1IYU A;  1SNO A;  3HGB A;  3NHH A;  1BNZ A;  3NTI A;  3GTQ B;  2F0F A;  5I9P A;  4A3M B;  3SR1 A;  1EU3 A;  2E2I B;  3KF8 A;  2PW7 A;  1IW7 D;  1PZJ D;  1I4G A;  4A93 B;  3LWU A;  3I4N B;  5G3L F;  4KKT A;  1HFN A;  2A5H A;  3GP7 A;  2XWB B;  4IFD J;  1VMP A;  2VB2 X;  2O2L D;  4S3S A;  3CRK C;  2JYO A;  1U4P A;  1KTK A;  3K5O A;  1PYW D;  3ND9 A;  4KJO A;  2JA5 B;  2ZXR A;  4I65 A;  2A73 B;  3T53 B;  2IL8 A;  2PMZ B;  3QOJ A;  2G9D A;  2R3Z A;  1JQY D;  5ELE A;  2OF1 A;  2F3W A;  1SE2 A;  4NW2 A;  5JVH 3;  5BN4 A;  3LNN A;  1PZK D;  5FKA C;  2B2U C;  2XVS A;  3C1E A;  2K28 A;  4K5X A;  4H7B A;  1TVX A;  1PRT B;  3TZD A;  2K5W A;  1C8C A;  3SEB A;  4DAV A;  1B2T A;  2EE1 A;  3DEO A;  2JE6 I;  5CV4 A;  1LTB D;  2JP1 A;  3SVM A;  1O7Z A;  3MFY A;  5E4X A;  2A6E D;  2NTT A;  2D62 A;  2ID0 A;  1QNU A;  1JWS D;  4WRD A;  1QB5 D;  2NB0 A;  1G6Z A;  2LMC B;  1V1O A;  4TRD A;  2K32 A;  1PTO D;  2XIW A;  1F77 A;  5EGT A;  4ILW A;  2B39 A;  3S9W A;  2NYZ D;  2IX0 A;  3I70 A;  2D9U A;  1EIH A;  1S5D D;  3A56 A;  4F8M A;  1DYQ A;  5D65 A;  5K5P A;  4KD3 A;  3OWF A;  2M2L A;  1AZQ A;  1SXT A;  3HP3 A;  2NWG A;  1VMC A;  5C0X G;  1M8A A;  3BYT B;  5CV5 A;  5ELF A;  1EY4 A;  3QIA A;  2F0O A;  1DJR D;  3K5M A;  5C44 B;  2K05 A;  5EQ0 A;  3HS0 C;  1CT1 D;  4XDX A;  1GUW A;  4PMB A;  2K7V A;  3G6J B;  2QIL A;  3VR6 A;  2WKC A;  1HXY D;  3FVQ A;  2J4X A;  3M7G A;  5M3F B;  3DUZ A;  4OIJ A;  1HHV A;  2F0I A;  5IOC A;  3HOX B;  4WFN 3;  5EKL A;  1FR3 A;  2F0N A;  4DAY A;  3N52 A;  3J7Y W;  3R2I A;  2PW5 A;  1PXU A;  1JCK B;  4FO2 A;  2R6G A;  5EPK A;  4DXF A;  3I72 A;  1H9J A;  2IT1 A;  4K8J A;  1GHJ A;  4G57 A;  4K2L A;  4OHJ A;  3IAY A;  4ZKB B;  4KHZ A;  1ENA A;  4O1N A;  5JEA H;  1SYB A;  4IZ8 A;  4JK1 C;  1EYD A;  3ITP A;  2XSC A;  1DOL A;  2SDF A;  1B44 D;  1K8M A;  1J8I A;  1GOZ A;  5COR A;  4KTA A;  3Q24 A;  3QO2 A;  2NBF A;  3D6W A;  4RHR A;  3V05 A;  3FEW X;  4RGT A;  4DXG A;  1EY0 A;  5IGB A;  1Y69 U;  1DOM A;  3VYT A;  1TWF B;  2Z1C A;  2IX1 A;  3K0Y A;  4BWG B;  2B2V C;  3K57 A;  5I6Y A;  4ODG A;  1EYC A;  1YNJ D;  1O7Y A;  3A7L A;  3SE0 A;  1SNC A;  1EEF D;  1PRT F;  2O5I C;  2VB3 X;  2MHV A;  2Y0S B;  2OEO A;  1LTA D;  2ICE C;  2YU9 B;  3SK5 A;  1BCP B;  1Y8N B;  3Q22 A;  4BA2 I;  4YIJ A;  2JEA I;  1T5E A;  3ZYY X;  3DM1 A;  2RDG A;  3D4D A;  1SNM A;  2WAC A;  3TSS A;  2B2W A;  1GXD C;  1SE4 A;  4R9W A;  5CV8 A;  2B2T A;  1U4L A;  3MA2 B;  2L55 A;  4NKL A;  3GTL B;  3M3Y B;  4B08 A;  4QUF A;  4ZK9 B;  1NR2 A;  3CRL C;  4RFB A;  3FKI B;  3P75 A;  2BCO A;  3EA6 A;  2I46 A;  3C2P A;  1I50 B;  3EQL C;  1HUN A;  1TWA B;  1HTP A;  2A68 D;  1TWG B;  2EY6 A;  4CBV A;  1SBB B;  1G91 A;  3DMU A;  1WTW A;  1FD7 D;  1MBY A;  1TS3 A;  2NVY B;  3EFX D;  1PFN A;  4LK1 C;  4KY6 A;  2OXP A;  3PUZ A;  1ET9 A;  4QF4 A;  1Q90 A;  1ICW A;  1U9R A;  1U4R A;  5FO7 B;  3BS1 A;  1B9N A;  3GV6 A;  1G8Z D;  3PUW A;  2N55 A;  2XRQ D;  2KEC A;  1SND A;  4DNT B;  3AMU A;  1HFG A;  5C4H A;  5CBA E;  4FYD A;  5FOB B;  4G4K A;  2SOB A;  3PUY A;  4K6L A;  1YNN D;  4C2M B;  1TQO A;  5CBE E;  1E2W A;  3RMH A;  3HG9 A;  4PMW A;  1Q1E A;  1JC7 A;  2PNR C;  3X3N A;  1GUO A;  1B9M A;  3OPO A;  1BR9 A;  1O7L A;  1WD0 A;  4B9X A;  2L5T A;  4BBR B;  4Q0F A;  1ZKO A;  3HOV B;  3SK6 A;  4FXK C;  3S2D B;  3S1R B;  4DN4 M;  1WTR A;  2F03 A;  1LT5 D;  1QIL A;  3MEH A;  1ESF A;  5FO9 B;  3HOZ B;  2B2T C;  2PZW A;  5C0X H;  3NTK A;  1H9K A;  2O4X A;  4IUQ A;  2F0V A;  1S5C D;  1MD2 D;  1CZG A;  3DEP A;  1AW7 A;  3T4A C;  2K1B A;  1KLG D;  1TWH B;  4FXD A;  5G3L D;  3OOC A;  3KBX A;  2FMM A;  3GQB A;  1PLF A;  2Q8R E;  1TT2 A;  2D5D A;  1KDA A;  5DNF A;  1XX8 A;  5HUR A;  1BCP F;  2RDF A;  4ZKC B;  4E6I A;  1RTN A;  4OGQ C;  2FIN B;  1LT6 D;  2FFK B;  4KK7 A;  1SSO A;  2F0T A;  2NVT B;  3N6R A;  3KUP A;  2MGS A;  1EL0 A;  5C3E B;  1HA6 A;  2SNM A;  3D8G A;  1G2S A;  4OO1 G;  3M7N A;  1JWM D;  5IGF A;  1VDZ A;  4F7X A;  3I4M B;  2MPM A;  3HEJ A;  1Q8I A;  2B63 B;  4QB4 A;  2KVM A;  5IGC A;  3NPP A;  1HQM C;  1OXT A;  2CW0 C;  1DZ1 A;  5CR3 A;  4CKE A;  4HCE A;  1WTO A;  1SMY C;  5C5L A;  3MVV A;  1KDB A;  2AUJ D;  3PO2 B;  1B53 A;  2X69 A;  1JE4 A;  2BE5 D;  1STN A;  1EZ6 A;  1CQF A;  4EQO A;  3WOE A;  1F2L A;  2EVB A;  5I4D A;  2Z8L A;  2Q8T A;  4XQQ A;  3TDQ A;  1UUP A;  4RCN A;  1RCV D;  3A55 A;  1H9S B;  2IWH A;  3X3M A;  3J7A F;  1LAC A;  4KN4 C;  1Q1B A;  4KKS A;  1R9T B;  2R61 A;  3MXP A;  1S5F D;  2PO4 A;  2F0D A;  2HDM A;  1Q12 A;  1W6J A;  4U68 A;  4ABN A;  3G7L A;  1EY5 A;  2F4I A;  1X3Q A;  1EY6 A;  1D5X C;  1LLR D;  2NVX B;  3KLR A;  2PQE A;  2IJ0 A;  1UEA B;  3H91 A;  3S15 B;  3TP5 A;  1EYA A;  3P1H A;  1STB A;  2IPK D;  4RGN A;  3TN2 A;  4RGM A;  1QOH A;  1PDQ A;  4HMJ A;  4L6T B;  1R4Q B;  1ROD A;  1AFP A;  5LHY 1;  2KCN A;  1S5E D;  3PUV A;  2R7Z B;  5JAV A;  2CHB D;  2EJG C;  4A3G B;  1STH A;  3D3R A;  4ME5 A;  2X6G A;  3JAM L;  3A7A B;  4DNR B;  1D5M C;  1EY9 A;  4N9P A;  5I9O A;  2BDO A;  4KD4 A;  2Q8I B;  3HOW B;  3ERQ A;  5FK9 C;  2FJ2 A;  2WP8 J;  2E2H B;  2PZU A;  2J7Z A;  2HDL A;  1AP0 A;  1IKL A;  4DA2 A;  2A69 D;  1BDO A;  1WTX A;  2RVL A;  1RJT A;  5T1G A;  5LL6 X;  3NQI A;  1NSN S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...