5CBAE

3b4 in complex with cxcl13 - 3b4-cxcl13
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
61
structure length
61
Chain Sequence
RCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 3b4 heavy chain
publication title A Combination of Structural and Empirical Analyses Delineates the Key Contacts Mediating Stability and Affinity Increases in an Optimized Biotherapeutic Single-chain Fv (scFv).
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 61
sequence length 61
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5cbaE00
1BO0A 5EKIA 2RSNA 1G6ZA 4U68A 1F9QA 5EQ0A 2CVRA 2K1BA 4UAIA 3TZDA 5JJZA 4ZKBB 1WD0A 1RTNA 2N55A 1ICWA 4CJ2C 5E4XA 1EIHA 2KEEA 4CJ1B 1WTQA 1RODA 1O7YA 2K03A 1CA5A 2IL8A 1EOTA 3F2UA 1X3QA 3MWYW 4RAUC 2K04A 1LV9A 4X3KA 5EPLA 1U4MA 3MTSA 1QG7A 1DOKA 3KUPA 3KBXA 1SDFA 3TN2A 1U4PA 2K28A 2L4NA 1CM9A 3SVMA 1HRJA 1WTWA 1E0BA 5E4WC 1O80A 1KNAA 5CBAE 1M8AA 1AZQA 4NW2A 1CA6A 1ESRA 4IUUA 4DN4M 1F9RA 1WTRA 2HDMA 2R3ZA 1JICA 4HCSA 3HP3A 1XYIA 1VMPA 4XT1B 2HDLA 3IFDA 5AFWA 1O7ZA 3FPUB 4RA8A 2DY8A 4ZLTF 2B2UA 2MPMA 2X6GA 4IURA 3QO2A 1F9SA 4X3TA 4OIJA 2Q8RE 1S4ZA 1BF4A 2B2YC 1GUWA 4ZAIA 3DEPA 1DZ1A 1ZXTA 3I91A 1B50A 2KUMA 5COYA 1DOMA 2NYZD 2B2WA 4LMQD 4R9WA 4HSVA 4ZK9B 2B2YA 1U4RA 2J7ZA 2BDNA 2EPBA 5CORA 4O42A 1X3PA 4IUTA 3R93A 1MSHA 1NR2A 2Q8TA 1SSOA 1B2TA 4ZKCB 3FDTA 5EJWA 1PFMA 2RA4A 5CBEE 2DY7A 1AP0A 2L11A 5EPJA 2FMMA 1WD1A 1RJTA 2SDFA 1IL8A 3P7JA 2JP1A 1PFBA 2X69A 5D65A 2KOLA 5DNFA 2HCIA 5CMDA 1Q3LA 1J9OA 2L1BA 1B53A 2K05A 2B2UC 1VMCA 2EOTA 4IUQA 4CJ0B 4MHEA 1HA6A 1HUNA 1J8IA 1B3AA 1F2LA 1QE6A 3LWEA 1NAPA 1BBXC 2RSOA 1HFNA 3DM1A 5D14A 5T1IA 1XX8A 2B2WC 2B2VA 1EIGA 2H1EA 4HAEA 1MI2A 4HEDA 1TVXA 1EQTA 4R8IA 2MJ8A 1ML0D 2N88A 1MSGA 4X3SA 1U4LA 2HUGA 1IKMA 4MN3A 4OIKA 1RHPA 5T1GA 1B4OA 3N52A 1PDQA 3DEOA 3UI2A 1F9PA 1EL0A 2KEDA 2D9UA 1WTVA 2KECA 2NWGA 3D6WA 2VXWA 3H91A 1WTXA 1PLFA 3I8ZA 1HUMA 2B2TA 2XIWA 3GV6A 4RWSC 1WTPA 1G91A 1WTOA 2HCCA 1C8CA 1G2TA 1NR4A 1ILQA 5EPKA 1NCVA 2B2VC 2JYOA 2K01A 1QNKA 4XT3B 1KNEA 2L12A 2FINB 2NZ1D 2FHTA 2FFKB 2L9HA 1SAPA 1ILPA 1PFNA 2EE1A 4QUCA 3Q6SA 3GV3A 4QUFA 1AZPA 2MP1A 2MGSA 1MGSA 3I90A 1IKLA 1HFGA 2M2LA 4IUPA 2FJ2A 1DONA 1G2SA 1A15A 1X32A 2X6LA 3IL8A 4XDXA 4IUVA 2KVMA 2RVLA 1HHVA 3ONAB 4X3UA 1RTOA 2B2TC 3G7LA 1WVLA 1DOLA 1BNZA 1JE4A 3I3CA
chains in the Genus database with same CATH superfamily
4N9TA 3K81C 5JJZA 5EQ0A 1VQIA 4RKBA 5E4XA 4DV0Q 2EY1A 2I46A 2PZUA 3J80L 4MIUA 1MHWC 1ZKOA 4LF7L 3GTKB 1HJPA 4A3EB 2F3VA 3KK7A 1VQMA 1FL0A 2M9VA 1ENFA 1WTWA 2D62A 1PTOB 1FJGL 4JBJA 4LF6Q 4K5WA 3K6OA 4R4QA 4HCSA 2Z4IA 1Q1EA 1LTAD 1V1QA 4JI6L 1DXMA 1YNXA 2BE5C 2K5VA 2HT1A 2QEXA 1I4RA 4IURA 3PO3B 1FNVA 2UUBL 3M3YH 1PYBA 1STAA 3KLSX 4QB4A 4B3RL 4APVA 2YTVA 2AWOA 3E6ZX 1IYVA 1EUJA 5HY6A 5BN5A 4OXPA 1FNWA 1MSHA 4RHRA 4K5VA 4TKOB 1X54A 2F0MA 3U4ZA 2DY7A 2RBMA 5EPJA 2FMMA 4JG2A 2E2IH 1N36Q 4GNXA 4IZ8A 5AJ3Q 1Q3LA 1TS3A 2E74C 4QY7A 4CBVA 1SXTA 3HG9A 4KLKA 4WJ4A 3C46A 1EIGA 3OTOQ 1E22A 3M9BA 2JA8G 1EQTA 4DAMA 1K8AC 3NTKA 1SNCA 5IT9L 4YCUA 1ENCA 2YV5A 1K8GA 1IKMA 2VUMH 3GTKH 1CZGA 4A3EH 1Z6HA 2ZJPA 4L5QA 1HR0L 1BQQT 3DM3A 1JWMD 4RWSC 4JI5Q 3MXNA 3LGJA 4IFDJ 2OTJA 3ITPA 2A68C 3VA5A 2JYOA 2C35B 2L12A 5FO9B 1B70B 4DR4L 4DU9A 1OXTA 2JA7G 1GHJA 3S16H 4OWTB 5JAVA 2R7ZH 3EA6A 4BBSG 1I5FA 2AUKA 5EBDA 2KHSA 4KY5A 4A3KB 1VQOA 4L5RC 4R4IA 4XDXA 4DAVA 3SR1A 2JEAI 3T16A 2CQOA 5EKIA 2VB3X 4E6IA 1ICWA 5M5XB 4X65L 1O7LA 3X3MA 4RAUC 4K0KL 1VQFA 1MKHA 2K04A 3AB9A 4A3MH 1MJCA 1VQ4A 4B3MQ 3OMGA 3HEJA 1MJEA 3F8TA 1M8AA 2ZTDA 5DEHA 1BBWA 1V8QA 5LMNL 1CA6A 3MAQA 5M9OA 4X64Q 1IBLQ 4NXML 1EOVA 5C5MA 2NVQH 5AFWA 3FPUB 2RF4A 5H1SE 3AFPA 2WB1B 1F9SA 1S4ZA 1Q12A 2HHHL 1E7ZA 3PUVA 4LW1A 2F52A 4XQNA 3NSWA 4R1JA 4LF5Q 4A3BG 1I4HA 4HCEA 3BS1A 4A3GH 1O78A 5BR8L 2PNHA 3M85A 3CPWA 4V190 2BCOA 4OO1I 2X69A 1FJGQ 4RCOA 2A6EC 3CMAA 1J8IA 1B53A 1C7YA 1HA6A 4MHEA 1PZJD 4ID6A 2K5NA 3DM1A 4FXKC 3PUZA 4JI6Q 1EYCA 5CV7A 1IW7C 2VQEL 1G6PA 5IGCA 4L5TA 4C2MB 4B3RQ 5FLXL 5FKAC 3CRLC 3DEOA 1W6KA 3RN5A 5IYCG 1L0WA 3CHBD 1WCMH 3S17B 3TP8A 1EU3A 4EQPA 4EX5A 3PO2G 3RLNA 1A6XA 1NE3A 4K6LA 1ILQA 2B8FA 4DGZA 2R93G 3L0OA 2GA4B 1OO9B 4P74A 2FJ2A 5C0XI 4Z9CB 5IODA 1BR9A 1YITA 1NBWA 4LUVA 1IBML 5JJLA 4FVMA 2F1MA 3I72A 4BBRG 2KQ3A 1JR0D 1HR0Q 3TZDA 1CI3M 4IPDA 4JI2L 4DR5L 1VQBA 2ASBA 3S14B 4ILWA 1SFOB 2PMZE 1TWAB 3K7AH 3J80E 2EYPA 1SYDA 2BH2A 4AQYL 1CM9A 3NENA 3ICEA 1A8VA 1E0BA 4C2MH 1HCZA 1K8OA 4NW2A 1PH3A 5FLMH 2D5DA 1XPRA 5C4XH 5FOBB 1VMPA 1FGUA 2HDLA 4TRDA 1Y1VB 3R8BA 3NQTA 3DWAA 3NWTA 4AH6A 3KJPA 1DOMA 3NXWA 5JEAH 2B2WA 4X65Q 1OXUA 2J7ZA 4RMFA 5CORA 4K0KQ 4JI7L 1FR3A 1P16A 3T4AC 4A3CG 1SSOA 3E9HA 2V1CC 4KK7A 4ZKCB 1PH4A 1PFMA 1CSQA 1SYCA 3CCLA 5EAYA 4GLAC 4DR7L 4RCNA 2N49A 1BOSA 4FP5D 2JE6I 1ASYA 3OWFA 4KN4C 2AUJD 1SN8A 5LMNQ 3HOZH 2NVYB 4NXMQ 1HR0W 3QG1A 2JA6G 4LJZC 5C6AA 1EWCA 2F3IA 2UU9L 4UY8C 5C4ZA 2Z8LA 2E76C 1SLJA 4DV5L 4R8NA 3HKZG 1VQ6A 3S1MB 2G9HD 5BR8Q 4KHVA 3GV6A 4LF9L 1YVCA 5GQOA 3GTLH 1F2ZA 2R92H 4XT3B 4C3IG 1H9SB 3TEHB 1VQ9A 2UXDL 1FNUA 2FFKB 3CC2A 3RMHA 1V43A 4DK1A 4A3FG 3P75A 3K5NA 1YI2A 2VQEQ 4O2DA 2X6LA 1JT8A 1VCIA 1DJRD 1L2FA 5CV9A 3T1HL 3I4MG 1S3OA 4DXGA 5ELFA 2DJGC 1YJNA 2MFIA 3G6JB 4LFAL 2B63B 1WYDA 5FK9C 4P2CB 5KGUA 3S1QH 3NE5B 4Y7NB 1GHKA 2ZJQA 1RODA 1CQVA 5LMNW 4C3JH 2A69D 1EFID 1BCPB 1QG7A 1Y8PB 4I7ZC 4JC0A 5EBCA 5DM63 5GAGC 2SEBD 1K73C 4DAYB 4FDBA 3OMCA 1NJIC 1PFSA 4A3DH 5IOCA 3Q23A 3O13A 3JAMi 1KNAA 2D2CC 4LAAA 1PYSB 4S3SA 3ULJA 2I5MX 1D5MC 4H44C 1IBMQ 1RDPD 3IFDA 4PNYA 4RA8A 2DY8A 1A3VA 2Q2UA 2K6AA 5C4JH 2F0JA 5I4DA 1GUOA 1FVIA 3NELA 3ZJYC 1CKOA 2EY6A 4JI2Q 2NYZD 5C3EB 4DR5Q 4R9WA 1STBA 4JCVE 4O1NA 3L3OC 2KENA 2R7FA 1SNOA 5I6YA 3TSSA 4AQYQ 3FDTA 3RZOB 2L11A 2ID0A 5LL6X 2JP1A 2O4XA 1IL2A 4HIMA 3HOUH 2WAQB 2CCZA 2E2JB 1QOHA 2Z4HA 4IUQA 4CDCC 1DGSA 2QA4A 3MXPA 1KD1C 5JVG3 1TQOA 2LFNA 3BJUA 1BBXC 1VF7A 2XNAC 2CW0D 1HNXQ 1N34L 2RKSA 5C44G 3HOVH 4C3HG 4R8IA 1GXDC 3NBIA 3FVQA 1PRTD 5DLQE 4U673 4JI7Q 3J7A5 2IHEA 3GTMB 3D6WA 1O7IA 1QCBD 3FKIG 2DJFC 3LX0A 1VQPA 4A93G 1KIXA 5M3MG 2ES2A 2FINB 3J81j 1HZAA 3GD7A 1C4QA 2A73B 5J3BA 1JC7A 3SHLA 5IYBH 3EN2A 2QDLA 5M5WH 1TY0A 1I94Q 1SRUA 2OT2A 1A15A 3R2TA 3W5OA 2CHBD 4X62L 2UU9Q 3TP5A 2K52A 3EROA 3HOXB 1RTOA 3KF8A 3HOYH 2O2LD 4IQZA 2GVBA 1YHBA 1PVOA 4WORA 1G6ZA 1VQHA 3K58A 4BY7G 4CJ2C 4L63B 5LL6S 3TRZA 1MIUA 2RHQB 2PQAB 3OYYA 5KIXA 1SNDA 2E2JH 4DNIA 4X3KA 3MTSA 2F0VA 1EWHA 1Y1WG 2UXDQ 2MO0A 2NTTA 1JQYD 1EYGA 2F0NA 2WKCA 3SVMA 1HRJA 1EWIA 5CBAE 3VYSA 3J7YW 2JA5B 1STNA 1Y8NB 2DUDA 3CCEA 2IX3A 1HNZQ 4IUUA 4HJ9A 3KLSA 3T1HQ 5IP7H 1XYIA 3WOFA 2OWOA 1EY0A 3H0GB 4GLVB 1K3BC 4LFAQ 1N33L 3F2BA 5M3FG 2KUMA 4MTKA 1LYLA 3RNUA 4ZK9B 5IGBA 4IFDG 2BDNA 4KKTA 4O42A 4ODGA 2ICEC 1NR2A 2F0QA 2CWPA 2I5HA 3C3LA 2RQXA 1PMRA 4HR7B 5IP9G 5I9PA 2YU9H 1YHAA 1ENAA 5E1FA 1JJGA 2B2UC 4J8QA 3KDFA 1QVCA 1TWCB 3RD4A 1NAPA 3HOXH 1XMOL 5EGTA 3M7NA 4LNQA 2B2VA 4HAEA 4RHSA 4XQQA 5I2YA 4HEDA 3TS0A 1TVXA 4KN7C 3DUZA 3MFGA 3HZXA 2PI2A 1KHIA 4BXXH 3CPFA 2LSSA 1HTLD 3W1GA 1NMGA 2NWGA 5HURA 3ND8A 2IPKD 5KRUA 4JI4Q 2AKWB 3OHXC 2OCEA 1XWEA 2JA5H 4WJWA 2XGTA 2BDOA 1IHZA 1B9NA 1QUQB 2F4VL 4RH6A 5FO7B 3I2ZA 4EQNA 2L0CA 3H0GH 1N34Q 3I4NH 3H15A 3A7AB 3WDNA 3CCQA 1DONA 1W2BA 1HXYD 2F3WA 2OQ0A 4A3JB 3AEVA 2IW3A 1STGA 1C0AA 1WVLA 3TQYA 1NUCA 1BO0A 3M3YB 4A3IH 1QZGA 4LFBL 1WTQA 5IYDG 4FXGC 3STBD 5EPLA 4QIWB 3PF5A 1P8LA 4OO1H 2EJFC 1GJXA 4DV7L 4LWCA 4CGYB 4DR2L 1W6JA 3HOWG 2LXKA 4DR1L 2F03A 2E2IB 3FEWX 2R61A 3W2DA 4BY1H 1G51A 3BU2A 4JI8L 1YEZA 2TMPA 3HS0C 4X62Q 4FF3A 1JJCB 1LM0A 4LFCL 2EYHA 2KCTA 4HJAA 4EQOA 3ERSX 4ABNA 4OX9L 4DXFA 1JWUD 1EQVA 2K14A 4GN4B 2VUMB 3LWUA 4TVAB 1CQFA 2ZXRA 2DNEA 3D4WA 2A19A 4ALPA 3NWSA 4KHPL 4Q0FA 1TWHH 3CKIB 1A63A 1VQJA 1U9RA 2Q8TA 1IYJB 1X3EA 4A3LG 3G48A 1QWYA 1RJTA 5IGDA 2B8GA 4A3JH 4YHHL 2GVAA 1XMQL 1CFMA 1OXXK 4K2KA 2KBNA 5DAUA 3DXJC 3S16B 2F0FA 5C0XH 4ZUJA 5A2QL 5KNDA 2R7ZB 1ESFA 1N33Q 1D5ZC 3PO3G 1VQEA 2QKIC 4GN3B 4DR6L 4MN3A 4K8JA 3SE0A 2EQSA 3OPOA 1SJED 4PG3A 2QILA 4JI3L 1GKHA 1SE8A 2Z9HA 1L1OC 1HUMA 2A69C 2IT1A 1WTPA 1K83B 3PV0A 4DV1L 2IX0A 1OXSC 3CQZH 4A3MB 4DNTB 2O5IC 2YYZA 1XMOQ 1LABA 2EE1A 3D31A 5F2DA 2UXBQ 2G9DA 1IKLA 4PQXA 1YJ9A 2F0UA 4X66L 3GP7A 1D6EC 1MD2D 5GAEC 2F0HA 2ALYB 2NVQB 5J39A 1TIID 5IIFA 1DOLA 1C48A 1BDOA 2VNUD 4XQJA 1G91A 1RTNA 4KJNA 2J4XA 1BBUA 4M1UB 2PW5A 3S2DB 4A3GB 3KBXA 1TWFH 3IAYA 3CCMA 1E2VA 3D4RA 3CD6A 1O80A 5HGQA 2Z1CA 4KI0A 4A3KG 1WI5A 3ULLA 3JAMc 4XT1B 1D8LA 2NZOA 1IBKL 2ZT9C 2X6GA 4NP5A 3J7AV 4IOAA 4XIGS 5J22A 2M00A 4G4KA 4LFBQ 1K83H 1V1PB 1AH9A 2BH8A 3BG3A 4LMQD 1XPUA 3NUCA 2PI2E 5CV6A 3CCJA 1AE2A 4POFA 3TP6A 1WCMB 4DR2Q 1XXGA 4R4OA 5BN4A 3M4QA 2TSSA 3PIO3 4DR1Q 1KRTA 1RL2A 2SDFA 4G7ZC 1U0LA 2CWAA 4JI8Q 1L1OB 1HNWL 1V1OA 1SR3A 4KKSA 2BA1A 4LFCQ 3D3RA 2A8VA 4OEMB 2OQKA 4OX9Q 2WB1G 3K0XA 2JA8H 3BDLA 4X3SA 3M4OB 4LF7Q 1YHQA 1Q86C 3H6MA 1XTDA 1PYWD 1J5EL 1PDQA 4KHPQ 3S2DH 3Q0AA 3A8JE 2UUAL 4IFDI 1PV4A 2HQLA 2I5LX 1W3SA 4RGTA 3K7AB 4HN7A 1WTOA 1NR4A 1M90C 2F0WA 2KHJA 1JCKB 1TXYA 3BZKA 2FHTA 1SNQA 2L9HA 1SAPA 3RLFA 2JA7H 3Q6SA 5IGEA 1AZPA 2UUBQ 5KYIA 2Q2IA 1HFGA 4BBSH 5KYLA 2PZWA 4DR3L 1SE2A 2JQOA 1PH5A 5C4XB 2XTIA 1X56A 4DV2L 4DA2A 1AE3A 3OW7A 3G7LA 2WP8J 4JI3Q 2ZXPA 4JV5L 2CVRA 2K1BA 3K80C 3TDQA 3UE0A 3RR5A 1LACA 4ZKBB 2WB1E 2Y0SG 1PRTB 3NEMA 3B6YA 4UP9A 1SROA 4HJ8A 3OW2A 1HZBA 1YNNC 4DAYA 1Q8IA 4X66Q 2VQFL 3HOZB 1ESRA 3M4OH 3T13A 3G71A 4A4IA 1JICA 2SOBA 3OOCA 2A6HC 4ZLTF 1X3GA 2VZAA 5CV4A 1K8MA 1JE5A 1EY7A 4C56C 3NBHA 2K32A 2K33A 4RKLA 3GTPH 5IGGA 3V96A 4FYDA 4ME3A 3TREA 2IWHA 1X55A 4DR4Q 4IN3A 1VQGA 4IUTA 1LTID 4A3BH 1CUKA 2EY5A 2ENBA 3GTLB 2FMCA 3ND9A 4KMUC 3MXNB 2R92B 3HRZC 2Y0SE 4FF1A 4DNRB 1S5BD 4OWXB 1LTRD 2NN6G 3LWEA 5C4HA 3A8KE 1EZ8A 1HFNA 1VQLA 1Y1VG 1IBKQ 5A2QE 1BCPC 2IX1A 1WJJA 1UE6A 3DMUA 1TY2A 3RZDH 2QEJC 2Z6BA 1Y8OB 3PIOA 1SE3A 2QDBA 4C1NK 4DFAA 3A56A 5IYCH 1SNPA 3E0JA 3S1QB 3D0FA 2I0QA 1GUGA 2HIVA 1KAWA 3STBC 3PO2H 1B44D 2IJ0A 2E5LL 1I4PA 4C3JB 1KRSA 2C5CA 1YZ6A 4DK6C 4BA1I 1EY9A 3FRPB 2R93H 4B3SL 3QIAA 2LMCB 2JN4A 4A3DB 1B1ZA 4KV6A 2LS01 3BDOA 3DHQA 4PZ8A 2HHHQ 2K5DA 5ELBA 4KKUA 4DK0A 1OXVA 2NVXH 4IUVA 2JA9A 4WJ3M 2VB2X 3I70A 1PZKD 2KCCA 1J5EQ 2SNSA 1BUVT 2R7DA 3SGIA 4CKEA 4DUYL 1A0IA 4BBRH 1J6QA 5C4JB 3G4SA 2UUAQ 1A2TA 3SK5A 1EY5A 2K4KA 5FJ8G 2PQAA 3W3AA 1TS4A 1XPOA 1BXTA 1X3QA 1ZEQX 2N78A 1SEBD 2NTSA 1D2BA 3F2CA 3AFQA 1Q8KA 3AU7A 3HOUB 3UDIA 2F0TA 1KXLA 3HKSA 4AYBB 4DR3Q 2K5QA 2XSCA 2R3ZA 4DV2Q 3HP3A 1EY6A 3S24A 1CHQD 3HOVB 4KJOA 4JV5Q 2B63G 5K36H 4OIJA 4LF8L 2BE5D 4RFBA 2B2YA 1UE1A 5I9OA 3L7ZC 3HKZE 4A3CH 2KCMA 3UE1A 3C1EA 3GO5A 2ZJRA 1LLRD 1UE5A 3P7JA 3U58A 2L1BA 2VQFQ 3CMEA 3A55A 2L5TA 4GKKL 2OTLA 4NDXA 4DV3L 5M5WB 1PH2A 1XX8A 3H3VH 4F88A 2JA6H 4GOPC 2YTYA 1WTHA 3TMEA 3KOJA 3VYUA 2OEOA 3NQIA 3KF6B 3PIP3 1K28A 4P75A 3NK9A 3NP8A 4FF2A 4JYAL 5C3EG 3AQQA 3HOYB 2ZTEA 2R6GA 1G8ZD 1LO5D 2KJXA 4CKCA 1OTCA 3H91A 3I7FA 1GO3E 5JEAJ 1I3QH 4ZYSA 4UPAA 2WAQG 4HSPA 2EYMA 3K8AA 3TP7A 3GV3A 4A3FH 2M2LA 4M8AA 3F1ZA 4ZRZA 3IL8A 3T53B 4OHJA 2K50A 5LHY1 3FMCA 2KVMA 3OSOA 3I4MH 4N9PA 2QCPX 3E5SA 4DR7Q 1PTOF 4IPCA 2BOSA 4U68A 4H02A 3F2DA 3KLRA 1A62A 1WD0A 5IE8A 1TKWB 2E5LQ 2QF7A 3D8GA 1RF2D 3S9WA 1JOOA 2RDHA 4MNOA 3JAME 2PNRC 4B3SQ 1SDFA 1U4PA 2YU9B 1D5XC 1S72A 4OL7A 1V9PA 3FP9A 3KLWA 1QVFA 5GROA 2H5XA 4DN4M 2WAQE 1WTRA 3VR6A 3PUWA 1STYA 3VYTA 4X6AH 4CKBA 4JOIC 4B9XA 4DV5Q 4DUYQ 1XTCD 3EJIA 2B2UA 4IJHA 3W1BA 1NNXA 4LF9Q 1PZID 4YIJA 1B9MA 2JJQA 1ZXTA 3R2IA 4PMWA 1B50A 4XXEA 1SNMA 4Q5VA 5CV8A 4GOPB 2YTXA 4NKLA 1VQ5A 2JXMB 1CZWA 4TQUS 1QILA 1BVSA 1Z7TA 1LTTD 1KABA 1PFBA 5D65A 2PPBC 5CMDA 3MVVA 4JI0L 1UEBA 2I07B 3QB3A 1VF5C 1B7YB 4DAPA 1CKNB 4YCVA 1K3RA 2ZXOA 3I4NB 5T1IA 5C3XA 1VQCA 2LY7A 5C44H 4O0AA 4C3HH 1ML0D 4GKJL 2PO4A 4LF8Q 3J81c 4UHVA 5A35A 5T1GA 1EL0A 1SYBA 1CSPA 1F9PA 3UI2A 2KEDA 4H13C 4A3IB 3CC4A 4QQBX 3BVGA 3EBEA 1DYQA 1KLGD 1EQQA 1STEA 2NZHA 5ELDA 1HTPA 2PZTA 3FKIH 3V05A 5M3MH 4GKKQ 3VR3A 5M5YH 3PIPA 4DV3Q 4KY6A 3R3OA 4BY1B 2NN6I 4YWKA 3U9SA 3D4DA 3L9AX 4RG1A 4JYAQ 3I73A 3J80c 1H9KA 4F87A 1KL9A 4BY7H 2IL8A 1TWHB 3WWVA 4JBWA 3K57A 1A2UA 1HZ9A 4KY7A 1Y1WH 3VDYA 5KEEA 1TS5A 2L4NA 1YBYA 3Q24A 1D1KA 1TR5A 3I4LA 4YWMA 4AIMA 1JORA 3U4VA 2MQHA 4JPBW 3VR5A 2EYOA 4A3JG 1SMYD 4KD3A 4ZQ3A 2AQ1B 1KDAA 3GQBA 5FO8B 3FHWA 5M3FH 4JBKA 1RD9D 1V1PA 4K6DA 3CAMA 4IFDH 1K0RA 4I65A 1UUPA 3IKJA 5I2XA 1B2TA 2A1AA 2K5HA 5EJWA 3SXHA 1UAPA 5IP9H 5CV5A 3GTGH 3GTQH 5I6WA 4RGOS 5CGKA 3CQZB 1J9OA 1JMCA 2XWJB 1JB7A 3QR8A 1B3AA 3TS2A 5IT9c 1L1OA 3OWEB 2MO1A 3CCRA 5D14A 1PH1A 2ZM6L 2XRSD 1PH9A 1JOKA 1U4LA 5ISRA 2VUMG 5E3FA 2A74C 2Q2TA 2B39A 1RHPA 4A3EG 2RDFA 3CW2C 4X64L 5JPMC 3KF8B 1CK1A 4QGUA 2D0PA 1L0XB 3ERQA 3S1NH 2CH4A 5EKKA 2NVTH 4UP8A 2D0OA 4K5XA 2Z6KC 4G57A 1LT4D 4JI0Q 3ZYYX 4UP7A 2NZ1D 2VS1A 3I4OA 1TWFB 4QIWE 4LF5L 3A5UA 4J1MA 5DM73 4BA2I 1ZYRD 1IXRA 2R7ZG 1VQ8A 1S5ED 2SNMA 1M1KC 4GKJQ 3G6EA 1NSNS 3QJYA 4IPHA 1NY4A 2B2TC 1HA5A 2Q2HA 4JBMA 1JE4A 4GZYC 1MBYA 2RSNA 4GN5A 5NUCA 4OONA 2N55A 3D6CA 5IYDH 2F0KA 3MWYW 4A3MG 3SDZA 5G3LF 3TN2A 4J6HA 1LTLA 1YIJA 1K9MC 1I50H 2K28A 3S2HH 3HOWH 3C2PA 1STHA 1ICFB 3BZDB 1Q46A 3URYA 1CHPD 1JWSD 1YNJD 1E1TA 1IZ6A 1TU2B 3KDFB 5TSSA 5J1ZA 4EVOA 2EZVA 2JSOA 1KQSA 1S5FD 3A54A 1SYGA 2L15A 2JA8B 4X3TA 2UXCL 4ZAIA 1EEFD 3HFZB 2F4VQ 1GM5A 2F0GA 3TZUA 1BKBA 1X3PA 3QWNA 1UEAB 1KLUD 3Q8DA 4P72A 4A3GG 1PH6A 1ET9A 1T9HA 4A3LH 5LMUL 1WOCA 3NTIA 4IO9A 1PTOH 1N8RC 1I4GA 2HCIA 4KTAA 2CW0C 2OF1A 1DZ1A 5JPNC 4IALA 3GDEA 2A5HA 4CDEC 3KYHC 2JA7B 3A7LA 1PHJA 1PRTC 1SYEA 5FLXc 4BBSB 3KJOA 4I7AA 4YCWA 4OELB 3PO3H 5KNBA 1MSGA 4QL5A 4PMCA 4G7HC 4MTNA 3K5LA 2E2DC 3A0JA 5K5PA 3BZCA 4DV7Q 5EKLA 2D9UA 4B3TL 4GNXC 2KECA 1WCMG 3RLOA 1GUNA 1WTXA 3I8ZA 4DUZL 1NTGA 2HCCA 4DPGA 1NCVA 3T56B 2UUCL 1CT1D 1QNKA 4L6TB 1I6VC 3J81i 1ILPA 2P5ZX 1PFNA 4EQ5A 3I55A 3T1YL 4QUCA 2IHFA 2ZM6Q 2MGSA 3I90A 3ER0A 4IUPA 4IUNA 4HMIA 1BCPF 1B8AA 2CQAA 4HIDA 5C0XJ 1HHVA 2C9OA 1FYCA 4FNFA 2PYKA 2QW7A 4UDUC 1FD7D 4P71A 3I3CA 3MFYA 1F9QA 3H09A 3GTPB 4NXNL 1EIHA 4PZ6A 3AMUA 1VQKA 4YHHQ 1LT3D 2K03A 2AQ3B 4IJLA 1XMQQ 3F2UA 1H9SA 1LV9A 4RGMA 1U4MA 3CRKC 4A3BB 3PUXA 3PGZA 1PXUA 3J80i 5E4WC 3H94A 4DR6Q 5IWAL 3J7AF 5FLMG 4A3KH 3U50C 5CR3A 1DD2A 5C4XG 3HGBA 2K7VA 4XTCS 3A5ZB 1LT6D 2MPMA 2CH4W 1EQRA 4H7BA 3NPPA 1WFQA 2AHOB 4DV4L 4LK1C 3RZDB 4YWLA 1BF4A 1GUWA 3JAML 3KBGA 4DV1Q 2PMZB 5M5XH 5JEAG 1AEXA 3K5MA 3DWPA 2DGYA 2WACA 3R93A 5CYUA 3EVQA 2KHIA 2N3SA 2L55A 1DCZA 2WIIB 3PO2B 5GAHC 4K2LA 2F0IA 4GNXB 2PQEA 2JK8A 3J81E 3H3VC 2Y0SB 5IGFA 3HOZG 2R93B 3RN2A 1E1OA 1N32L 1EYAA 1Q1BA 2UXCQ 1UWVA 2NVXB 1DM0B 4A76A 3KF6A 1AW7A 1CKMA 1B4OA 4BBRB 1S5DD 2BA0A 2VXWA 4OGQC 1PTOD 4DKAC 3DWQA 5LMUQ 1I6HB 4KHZA 3MEFA 1G2TA 2R92G 3BDCA 1E3PA 2RCFA 5JOBA 4TSSA 2O5JC 4QUFA 1LUZA 3N6RA 1MGSA 5ELOA 1SMYC 1G2SA 1RCVD 4H0LC 3K59A 4QCLA 1XJVA 2NB0A 3KFUA 3JC66 4B3TQ 1PH7A 3MXGA 1HNXL 3NTHA 3S17H 4L8JA 3S15B 5K36G 1AN8A 4DUZQ 1GOZA 2KEEA 3C1FA 4C3JG 3QOJA 1KC8C 3BYYB 4HIOA 1HNWQ 4JW0A 2UUCQ 2F0EA 1UNSA 2F0PA 3UDGA 1VQAA 1GVPA 4CHTB 4G7OC 2WFWA 3T1YQ 4A3DG 3MHBA 4HIKA 4Y52H 4A75A 3OIQA 4PV1C 2VW9A 1ONLA 1RIPA 1A3TA 3WOEA 4R4TA 1F9RA 5HGTA 1VQ7A 3PUYA 1KTKA 4FF4A 1N9WA 4FO2A 2JA6B 2E75C 4C1NI 3AYHB 2B29A 4NXNQ 2JEBI 3DEPA 1SBBB 2LKVA 1I94L 1I6HH 2NBFA 4HTHA 1KDCA 4J15A 1HH2P 2HD3A 4BWGB 1U4RA 3EFXD 4GOPA 5IT9E 3S14H 3PMFA 1Y69U 1SFOH 1TWAH 4OWWB 1LT5D 3VR4A 3HKZB 2EXDA 1I3QB 5CBEE 4B08A 4ULLA 1XNRL 1H9JA 4IOCA 2XN9C 1X9NA 1IL8A 3HOUG 5DNFA 3CF5A 3IRBA 5IWAQ 4C3IB 4AYBG 4LF4L 1ET6A 1R9TB 2NN6H 1ZYRC 1CKNA 2RSOA 4A3FB 1QZHA 2B2WC 4HJ5A 1Y1VH 2H1EA 2ATWA 4QJFA 3BVMA 3HOVG 3S15H 4DV4Q 3BVZA 2N88A 4XYQA 3CC7A 2AMCB 3I4MB 4BS9A 1L0YB 1HNZL 3EIVA 1I4QA 3A8IE 2GN5A 1X6OA 1F2YA 3X3NA 2IY5B 1I4XA 2WINB 1PLFA 2Q8IB 4CDFC 2XIWA 1EFWA 2EDGA 5EPKA 1Q90A 3MEHA 1IYUA 2NUCA 3P20A 2K75A 1CTMA 1GD7A 2FXQA 2NVYH 3A74A 3P1HA 5IYBG 3QOLA 2E8GA 2K5WA 2MP1A 1N32Q 2F0OA 3FPPA 1YNJC 1D7QA 4NB3A 4GLXA 2EY2A 4L5SA 2F0DA 4AYBE 1E24A 4ZCKA 4HJ7A 3ONAB 3HOYG 1XNQL 1ASZA 3CU7A 3MA2B 3NBHB 1U5KA 2AQ2B 3S1MH 5JVH3 4JOIA 2F4IA 2ZTCA 5FJ8H 1CA5A 1QUQA 1T5EA 4C3IH 3MXUA 4V0BA 1HQRD 1R9TH 1EIFA 3KUPA 2A68D 1SYFA 3M4PA 1S40A 3MC0B 2RDGA 4DV6L 1RKNA 1UE7A 4JI4L 1X65A 1LTSD 2MNAA 1AZQA 4YY3L 1KDBA 4QMGA 2HIXA 3GTOB 2WV6D 2WKDA 5IP7G 3S1RB 4GS3A 1VQDA 2KA7A 5C44B 3ULPA 1O7ZA 5C5LA 2E2HB 5L37A 1VDZA 3PQIA 1GUSA 3QO2A 4C3HB 2B63H 1VS0A 2Q8RE 2VL6A 4CDDC 2B2YC 2J0TD 1QJOA 1H95A 3I91A 4Y7NH 1EYDA 5COYA 5GADC 4HSVA 1EU4A 1HZCA 3K0YA 2EPBA 4LUOA 5E7NA 4N8FA 1G291 1TS2A 2RA4A 5FLXE 4POGA 1AP0A 5ELNA 1NMFA 1F77A 1WD1A 4B9WA 3FKIB 4K14A 2KOLA 4A93B 2K05A 2EYLA 4IPGA 3E0EA 5M3MB 4CJ0B 4JI1L 1KAAA 1F2LA 1QE6A 4DF7A 2DN8A 3HOXG 5M5YB 4R4CA 4MZ9A 4WFN3 1JJ2A 1MI2A 2MHVA 3SK4A 2XRQD 1Y14B 2HUGA 4BXXG 1A3UA 3M7GA 1T5XD 5C3EH 2OXPA 2QGQA 1SE4A 3PF4A 1WTVA 1EIYB 2CFMA 1LTGD 1H9MA 1TWGB 4BY7B 3RZOH 2RHSB 4DV0L 1XNRQ 2JA5G 5JJIA 5KNCA 1M4VA 1Q7YC 1R4PB 2EJGC 1HPCA 5D3IB 4F7XA 5BN3A 2K01A 3LNNA 4LF4Q 3GTOH 1KNEA 3S1RH 1Y1WB 2A6ED 3H0GG 3IFTA 5G3LD 2E2HH 2H4OA 1R4QB 2EIFA 3CP0A 3I4NG 1GUTA 3GTJB 5C3WA 4RGNA 1Q82C 1E2WA 4LF6L 1IW7D 4KD4A 2N8NA 4X3UA 3Q22A 2EVBA 3I56A 1BNZA 1C9OA 2XWBB 1AFPA 3GTMH 2EYFA 4JVZA 4A3IG 4UAIA 3NHHA 5M3FB 1EEID 3CCUA 2AWNA 4CJ1B 2MUYA 1F2MA 4A93H 1O7YA 3TBIB 1S5CD 4XYOA 1EOTA 4ME5A 3EQLC 4LUZA 4OO1G 4ZUIA 1DOKA 5ELEA 2EXZA 1JOQA 1E2ZA 3UDFA 3GTGB 2CKZB 3GTQB 4HMJA 4BY1G 1EZ6A 1N36L 3OIPA 3SEBA 5AJ3L 1SJHD 2F0LA 4NMZA 1YNND 3BYTB 1X3FA 1B3QA 1Q81C 1EY4A 2F0SA 2HDMA 3L2PA 1PA6A 1VQNA 1XNQQ 1LTBD 3RUZA 1TWGH 3OTOL 3M4YA 4DK3C 2UXBL 3SK8A 1PH8A 2A6HD 3PCOB 1JB3A 4N8X1 2PCFB 3CCVA 3SK6A 3UDXA 1TT2A 2VY3A 1QVGA 1PTOC 3S1NB 3DLLA 3T51B 1II3A 2LXJA 2DNCA 3GTJH 4DV6Q 2NVTB 3CCSA 1H9RA 2EJMA 2KCNA 2EYJA 4PZ7A 4JI5L 1Z47A 4K8IA 1HUNA 4YY3Q 1VMCA 2EOTA 2G5DA 2B3GA 4F8MA 5C0XG 2Z6KA 4NPSA 1HQMC 1D1IA 3PSIA 1QB5D 2PW7A 2RCNA 2MJ8A 2ICIA 4WRDA 3H3VI 4OIKA 1BCPD 3N52A 3U9OA 3VR2A 3K7UC 3J81L 4PMBA 3E3XA 2B2TA 4FXDA 3J7ZC 3VA7A 5IY0A 4EGVA 1C8CA 1SMXA 1EY8A 2B2VC 3VYRA 1FGBD 4JI1Q 5JJKA 1K0SA 5CC4A 5D3DA 1TWCH 1I50B 4B3ML 5ELCA 3S2HB 3HOWB 1QNUA 3V2TA 2Z0SA 2XVSA 2HQEA 1PRTF 4JK1C 1X32A 4P73A 1Z9FA 2RVLA 1IBLL 3K5OA 3CXCA 3MZ5A 1YJWA 3E9IA 4QF4A 2V4DA
chains in the Genus database with same CATH topology
4N9TA 5JJZA 5EQ0A 4RKBA 5E4XA 2EY1A 2I46A 2PZUA 3J80L 4MIUA 1ZKOA 3GTKB 4A3EB 2F3VA 3KK7A 2M9VA 1ENFA 1WTWA 2D62A 1PTOB 4K5WA 3K6OA 4HCSA 2Z4IA 1Q1EA 1LTAD 1DXMA 2BE5C 1I4RA 4IURA 3PO3B 1FNVA 1STAA 3KLSX 4QB4A 2AWOA 3E6ZX 1IYVA 5BN5A 1FNWA 1MSHA 4RHRA 4K5VA 4TKOB 2F0MA 2DY7A 2RBMA 5EPJA 2FMMA 4IZ8A 1Q3LA 1TS3A 2E74C 4CBVA 1SXTA 3HG9A 3C46A 1EIGA 1EQTA 3NTKA 1SNCA 5IT9L 1ENCA 1IKMA 1CZGA 1Z6HA 1BQQT 1JWMD 4RWSC 3MXNA 4IFDJ 3ITPA 2A68C 3VA5A 2JYOA 2L12A 5FO9B 4DU9A 1OXTA 1GHJA 5JAVA 3EA6A 2AUKA 5EBDA 4A3KB 2KHSA 4KY5A 4XDXA 4DAVA 3SR1A 2JEAI 3T16A 5EKIA 2VB3X 4E6IA 1ICWA 5M5XB 1O7LA 3X3MA 4RAUC 2K04A 3AB9A 3OMGA 3HEJA 1M8AA 5DEHA 1V8QA 1CA6A 3MAQA 5M9OA 5C5MA 5AFWA 3FPUB 2WB1B 1F9SA 1S4ZA 1Q12A 3PUVA 4XQNA 3NSWA 1I4HA 4HCEA 3BS1A 1O78A 3M85A 4V190 2BCOA 4OO1I 2X69A 4RCOA 2A6EC 1J8IA 1B53A 1HA6A 4MHEA 1PZJD 4ID6A 3DM1A 4FXKC 3PUZA 1EYCA 5CV7A 1IW7C 5IGCA 4C2MB 5FLXL 5FKAC 3CRLC 3DEOA 1W6KA 3CHBD 3S17B 3TP8A 1EU3A 4EQPA 1A6XA 4K6LA 1ILQA 2B8FA 4DGZA 2GA4B 1OO9B 2FJ2A 5C0XI 4Z9CB 5IODA 1BR9A 4FVMA 2F1MA 3I72A 2KQ3A 1JR0D 3TZDA 1CI3M 3S14B 4ILWA 1SFOB 1TWAB 3J80E 2EYPA 1SYDA 1CM9A 1E0BA 1HCZA 1K8OA 4NW2A 2D5DA 5FOBB 1VMPA 2HDLA 4TRDA 1Y1VB 3R8BA 3NQTA 3DWAA 3NWTA 1DOMA 3NXWA 5JEAH 2B2WA 1OXUA 2J7ZA 5CORA 1FR3A 3T4AC 1SSOA 4KK7A 4ZKCB 1PFMA 1SYCA 4RCNA 1BOSA 4FP5D 2JE6I 3OWFA 4KN4C 2AUJD 2NVYB 3QG1A 4LJZC 5C6AA 1EWCA 5C4ZA 2Z8LA 2E76C 4R8NA 3S1MB 2G9HD 4KHVA 3GV6A 1F2ZA 4XT3B 4C3IG 1H9SB 1FNUA 2FFKB 3RMHA 1V43A 4DK1A 3P75A 3K5NA 2X6LA 1VCIA 1DJRD 5CV9A 4DXGA 5ELFA 3G6JB 2B63B 5FK9C 5KGUA 4P2CB 3NE5B 4Y7NB 1GHKA 1RODA 1CQVA 2A69D 1EFID 1BCPB 1QG7A 1Y8PB 4I7ZC 5EBCA 5DM63 2SEBD 3OMCA 5IOCA 3Q23A 3O13A 1KNAA 2D2CC 4LAAA 4S3SA 1D5MC 4H44C 1RDPD 3IFDA 4PNYA 4RA8A 2DY8A 1A3VA 2K6AA 2F0JA 5I4DA 1GUOA 2EY6A 2NYZD 5C3EB 4R9WA 1STBA 4O1NA 3L3OC 1SNOA 5I6YA 3TSSA 3FDTA 3RZOB 2L11A 2ID0A 5LL6X 2JP1A 2O4XA 2WAQB 2E2JB 1QOHA 2Z4HA 4IUQA 3MXPA 5JVG3 1TQOA 2LFNA 1BBXC 1VF7A 2XNAC 2CW0D 2RKSA 4C3HG 4R8IA 1GXDC 3NBIA 3FVQA 1PRTD 4U673 3GTMB 3D6WA 1QCBD 3LX0A 2FINB 3GD7A 1C4QA 2A73B 1JC7A 3SHLA 1TY0A 2OT2A 1A15A 3R2TA 2CHBD 3TP5A 3EROA 3HOXB 1RTOA 3KF8A 2O2LD 4IQZA 1G6ZA 4WORA 3K58A 4CJ2C 4L63B 5LL6S 5KIXA 1SNDA 4X3KA 3MTSA 2F0VA 1EWHA 2NTTA 1JQYD 2F0NA 2WKCA 3SVMA 1HRJA 5CBAE 3VYSA 3J7YW 2JA5B 1STNA 1Y8NB 2IX3A 4IUUA 3KLSA 1XYIA 3WOFA 1EY0A 3H0GB 2KUMA 4ZK9B 5IGBA 4IFDG 2BDNA 4KKTA 4O42A 4ODGA 2ICEC 1NR2A 2F0QA 3C3LA 2RQXA 1PMRA 4HR7B 5I9PA 1ENAA 5E1FA 2B2UC 4J8QA 1TWCB 3RD4A 1NAPA 5EGTA 3M7NA 2B2VA 4HAEA 4RHSA 4XQQA 5I2YA 4HEDA 1TVXA 4KN7C 3DUZA 3MFGA 3HZXA 1HTLD 2NWGA 5HURA 3ND8A 2IPKD 5KRUA 3OHXC 1XWEA 4WJWA 2BDOA 1IHZA 1B9NA 4RH6A 5FO7B 4EQNA 2L0CA 3A7AB 3WDNA 1DONA 1HXYD 2F3WA 4A3JB 2IW3A 1STGA 1WVLA 1NUCA 1BO0A 3M3YB 1WTQA 4FXGC 5EPLA 4QIWB 4OO1H 2EJFC 1GJXA 4CGYB 1W6JA 2F03A 2E2IB 3FEWX 2R61A 3W2DA 2TMPA 3HS0C 4FF3A 2EYHA 4EQOA 4ABNA 4DXFA 1JWUD 1EQVA 2VUMB 3LWUA 1CQFA 2ZXRA 2DNEA 3D4WA 3NWSA 4Q0FA 3CKIB 1U9RA 2Q8TA 1QWYA 1RJTA 5IGDA 2B8GA 1CFMA 1OXXK 4K2KA 5DAUA 3DXJC 3S16B 2F0FA 5C0XH 4ZUJA 5A2QL 5KNDA 2R7ZB 1ESFA 1D5ZC 2QKIC 4MN3A 4K8JA 3SE0A 3OPOA 1SJED 2QILA 2A69C 1HUMA 2IT1A 1WTPA 1K83B 3PV0A 2IX0A 1OXSC 4A3MB 4DNTB 2O5IC 2YYZA 1LABA 2EE1A 3D31A 5F2DA 2G9DA 1IKLA 4PQXA 2F0UA 3GP7A 1D6EC 1MD2D 2F0HA 2NVQB 5J39A 1TIID 5IIFA 1C48A 1DOLA 1BDOA 2VNUD 4XQJA 1G91A 1RTNA 4KJNA 2J4XA 4M1UB 2PW5A 3S2DB 4A3GB 3KBXA 3IAYA 1E2VA 3D4RA 1O80A 2Z1CA 4KI0A 4XT1B 2ZT9C 2X6GA 4NP5A 3J7AV 4XIGS 5J22A 2M00A 4G4KA 1V1PB 3BG3A 4LMQD 3NUCA 5CV6A 3TP6A 1WCMB 1XXGA 5BN4A 2TSSA 3PIO3 2SDFA 4G7ZC 1V1OA 4KKSA 2BA1A 3D3RA 3BDLA 4X3SA 3M4OB 3H6MA 1PYWD 1PDQA 3Q0AA 3A8JE 4IFDI 4RGTA 3K7AB 4HN7A 1WTOA 1NR4A 2F0WA 1JCKB 2FHTA 1SNQA 2L9HA 1SAPA 3RLFA 3Q6SA 5IGEA 1AZPA 5KYIA 1HFGA 5KYLA 2PZWA 1SE2A 5C4XB 4DA2A 3OW7A 3G7LA 2WP8J 2ZXPA 2CVRA 2K1BA 3TDQA 4ZKBB 1LACA 1PRTB 1YNNC 4DAYA 1Q8IA 3HOZB 1ESRA 3T13A 1JICA 2SOBA 3OOCA 2A6HC 4ZLTF 5CV4A 1K8MA 1EY7A 4C56C 3NBHA 2K32A 2K33A 4RKLA 5IGGA 3V96A 4FYDA 2IWHA 4IN3A 4IUTA 1LTID 2EY5A 2ENBA 3GTLB 2FMCA 3ND9A 4KMUC 2R92B 3HRZC 4FF1A 4DNRB 1S5BD 1LTRD 2NN6G 3LWEA 5C4HA 3A8KE 1EZ8A 1HFNA 5A2QE 1BCPC 2IX1A 3DMUA 1TY2A 2QEJC 1Y8OB 1SE3A 2QDBA 4C1NK 4DFAA 3A56A 1SNPA 3E0JA 3S1QB 1GUGA 1B44D 2IJ0A 1I4PA 4C3JB 2C5CA 4BA1I 1EY9A 3FRPB 3QIAA 2LMCB 4A3DB 1B1ZA 4KV6A 2LS01 3BDOA 3DHQA 2K5DA 5ELBA 4KKUA 4DK0A 1OXVA 4IUVA 2VB2X 3I70A 1PZKD 2KCCA 2SNSA 1BUVT 4CKEA 5C4JB 1A2TA 3SK5A 1EY5A 3W3AA 1TS4A 1BXTA 1X3QA 1ZEQX 1SEBD 2NTSA 1D2BA 3AU7A 3HOUB 2F0TA 4AYBB 2K5QA 2XSCA 2R3ZA 3HP3A 1EY6A 1CHQD 3HOVB 4KJOA 5K36H 4OIJA 2BE5D 4RFBA 2B2YA 5I9OA 3L7ZC 3C1EA 3GO5A 1LLRD 3P7JA 2L1BA 3A55A 2L5TA 4NDXA 5M5WB 1XX8A 4F88A 3TMEA 3VYUA 2OEOA 3NQIA 3PIP3 3NK9A 3NP8A 4FF2A 3HOYB 2R6GA 1G8ZD 1LO5D 2KJXA 4CKCA 3H91A 5JEAJ 4ZYSA 4HSPA 2EYMA 3TP7A 3GV3A 2M2LA 4M8AA 4ZRZA 3IL8A 3T53B 4OHJA 5LHY1 3FMCA 2KVMA 3OSOA 4N9PA 2QCPX 3E5SA 1PTOF 2BOSA 4U68A 3KLRA 1WD0A 1TKWB 2QF7A 3D8GA 1RF2D 3S9WA 1JOOA 2RDHA 3JAME 2PNRC 1SDFA 1U4PA 2YU9B 1D5XC 4OL7A 4DN4M 1WTRA 3VR6A 3PUWA 1STYA 3VYTA 4CKBA 4B9XA 1XTCD 3EJIA 2B2UA 1PZID 4YIJA 1B9MA 1ZXTA 3R2IA 4PMWA 1B50A 4XXEA 1SNMA 4Q5VA 5CV8A 4NKLA 2JXMB 1CZWA 4TQUS 1QILA 1Z7TA 1LTTD 1KABA 1PFBA 5D65A 2PPBC 5CMDA 3MVVA 2I07B 3QB3A 1VF5C 4DAPA 2ZXOA 3I4NB 5T1IA 5C3XA 2LY7A 1ML0D 2PO4A 5A35A 5T1GA 1EL0A 1SYBA 1F9PA 3UI2A 2KEDA 4H13C 4A3IB 3BVGA 1DYQA 1KLGD 1STEA 5ELDA 1HTPA 2PZTA 3V05A 3VR3A 4KY6A 3R3OA 4BY1B 2NN6I 3U9SA 3D4DA 3L9AX 3I73A 1H9KA 4F87A 2IL8A 1TWHB 3K57A 4JBWA 1A2UA 4KY7A 5KEEA 1TS5A 2L4NA 3Q24A 1D1KA 1TR5A 3I4LA 1JORA 3VR5A 2EYOA 1SMYD 4KD3A 4ZQ3A 2AQ1B 1KDAA 3GQBA 5FO8B 1RD9D 1V1PA 4K6DA 4IFDH 4I65A 1UUPA 3IKJA 5I2XA 1B2TA 5EJWA 3SXHA 1UAPA 5CV5A 5I6WA 4RGOS 5CGKA 3CQZB 1J9OA 2XWJB 1B3AA 3OWEB 5D14A 2XRSD 1JOKA 1U4LA 5ISRA 5E3FA 2A74C 2B39A 1RHPA 2RDFA 5JPMC 1CK1A 1L0XB 3ERQA 5EKKA 4K5XA 4G57A 1LT4D 3ZYYX 2NZ1D 1TWFB 4J1MA 5DM73 4BA2I 1ZYRD 1S5ED 2SNMA 1NSNS 3QJYA 2B2TC 1HA5A 1JE4A 4GZYC 1MBYA 2RSNA 5NUCA 2N55A 3D6CA 2F0KA 3MWYW 3SDZA 5G3LF 3TN2A 4J6HA 2K28A 3C2PA 1STHA 3BZDB 3URYA 1CHPD 1JWSD 1YNJD 1TU2B 5TSSA 5J1ZA 4EVOA 2EZVA 2JSOA 1S5FD 3A54A 1SYGA 2JA8B 4X3TA 4ZAIA 1EEFD 2F0GA 3TZUA 1X3PA 3QWNA 1UEAB 1KLUD 1ET9A 3NTIA 1PTOH 1I4GA 2HCIA 4KTAA 2CW0C 2OF1A 1DZ1A 5JPNC 4IALA 2A5HA 2JA7B 3A7LA 1PRTC 1SYEA 4BBSB 5KNBA 1MSGA 4G7HC 4PMCA 3K5LA 2E2DC 5K5PA 5EKLA 2D9UA 2KECA 1GUNA 1WTXA 3I8ZA 2HCCA 1NCVA 3T56B 1CT1D 1QNKA 4L6TB 1I6VC 1ILPA 1PFNA 4QUCA 2MGSA 3I90A 4IUPA 4IUNA 4HMIA 1BCPF 2CQAA 5C0XJ 1HHVA 2C9OA 1FYCA 4FNFA 2PYKA 4UDUC 1FD7D 3I3CA 3MFYA 1F9QA 3H09A 3GTPB 1EIHA 3AMUA 1LT3D 2K03A 2AQ3B 3F2UA 1H9SA 1LV9A 4RGMA 1U4MA 3CRKC 4A3BB 3PUXA 1PXUA 5E4WC 3H94A 3J7AF 5CR3A 1DD2A 3HGBA 2K7VA 4XTCS 1LT6D 2MPMA 4H7BA 3NPPA 4LK1C 3RZDB 1BF4A 1GUWA 3JAML 3KBGA 2PMZB 5JEAG 1AEXA 3K5MA 3DWPA 2WACA 3R93A 5CYUA 3EVQA 2L55A 1DCZA 2WIIB 3PO2B 4K2LA 2F0IA 2PQEA 3J81E 3H3VC 2Y0SB 5IGFA 2R93B 1EYAA 1Q1BA 2NVXB 1DM0B 1AW7A 1B4OA 4BBRB 1S5DD 2BA0A 2VXWA 4OGQC 1PTOD 3DWQA 1I6HB 4KHZA 1G2TA 3BDCA 5JOBA 4TSSA 2O5JC 4QUFA 3N6RA 1MGSA 1SMYC 1G2SA 1RCVD 4H0LC 3K59A 4QCLA 2NB0A 3MXGA 3NTHA 3S15B 4L8JA 5K36G 1AN8A 1GOZA 2KEEA 3C1FA 4C3JG 3QOJA 3BYYB 2F0EA 1UNSA 2F0PA 4CHTB 4G7OC 3MHBA 3OIQA 4PV1C 1ONLA 1A3TA 3WOEA 1F9RA 5HGTA 3PUYA 1KTKA 4FF4A 4FO2A 2JA6B 2E75C 4C1NI 2JEBI 3DEPA 1SBBB 2LKVA 2NBFA 4HTHA 1KDCA 4BWGB 1U4RA 3EFXD 5IT9E 3PMFA 1Y69U 1LT5D 3VR4A 3HKZB 1I3QB 5CBEE 4B08A 4ULLA 1H9JA 2XN9C 1IL8A 5DNFA 4C3IB 1ET6A 1R9TB 2NN6H 1ZYRC 2RSOA 4A3FB 2B2WC 2H1EA 3BVMA 3BVZA 2N88A 4XYQA 3I4MB 4BS9A 1L0YB 1I4QA 3A8IE 1F2YA 3X3NA 1I4XA 2WINB 1PLFA 2Q8IB 2XIWA 2EDGA 5EPKA 1Q90A 3MEHA 1IYUA 2NUCA 3P20A 1CTMA 3P1HA 3QOLA 2K5WA 2MP1A 2F0OA 3FPPA 1YNJC 2EY2A 2F0DA 3ONAB 3CU7A 3MA2B 2AQ2B 5JVH3 2F4IA 1CA5A 1T5EA 3MXUA 4V0BA 1HQRD 3KUPA 2A68D 1SYFA 3MC0B 2RDGA 1RKNA 1LTSD 1AZQA 1KDBA 4QMGA 3GTOB 2WV6D 2WKDA 3S1RB 2KA7A 5C44B 1O7ZA 5C5LA 2E2HB 1VDZA 1GUSA 3QO2A 4C3HB 2Q8RE 2B2YC 2J0TD 1QJOA 3I91A 1EYDA 5COYA 4HSVA 1EU4A 3K0YA 2EPBA 1G291 1TS2A 2RA4A 5FLXE 1AP0A 1F77A 1WD1A 4B9WA 3FKIB 4K14A 2KOLA 4A93B 2K05A 2EYLA 5M3MB 4CJ0B 1KAAA 1F2LA 1QE6A 4DF7A 2DN8A 5M5YB 4WFN3 1MI2A 2MHVA 3SK4A 2XRQD 2HUGA 1A3UA 1T5XD 3M7GA 2OXPA 1SE4A 1WTVA 1LTGD 1H9MA 1TWGB 4BY7B 5KNCA 1M4VA 1R4PB 2EJGC 4F7XA 1HPCA 5D3IB 5BN3A 2K01A 3LNNA 1KNEA 1Y1WB 2A6ED 3IFTA 5G3LD 2H4OA 1R4QB 1GUTA 3GTJB 5C3WA 4RGNA 1E2WA 1IW7D 4KD4A 4X3UA 3Q22A 2EVBA 1BNZA 2XWBB 1AFPA 2EYFA 4UAIA 3NHHA 5M3FB 1EEID 2AWNA 4CJ1B 2MUYA 1F2MA 1O7YA 3TBIB 1S5CD 4XYOA 1EOTA 4ME5A 3EQLC 4OO1G 4ZUIA 1DOKA 5ELEA 2EXZA 1JOQA 1E2ZA 3GTGB 3GTQB 4HMJA 1EZ6A 3OIPA 3SEBA 1SJHD 2F0LA 4NMZA 1YNND 3BYTB 1EY4A 2F0SA 2HDMA 1LTBD 3RUZA 3M4YA 3SK8A 2A6HD 1JB3A 2PCFB 3SK6A 1TT2A 1PTOC 3S1NB 3T51B 1II3A 2DNCA 2NVTB 1H9RA 2EJMA 2KCNA 2EYJA 1Z47A 4K8IA 1HUNA 1VMCA 2EOTA 4F8MA 5C0XG 1HQMC 1D1IA 1QB5D 2PW7A 2MJ8A 2ICIA 4WRDA 4OIKA 1BCPD 3N52A 3U9OA 3VR2A 3J81L 4PMBA 2B2TA 4FXDA 3VA7A 4EGVA 1C8CA 1EY8A 2B2VC 3VYRA 1FGBD 5CC4A 5D3DA 3S2HB 1I50B 5ELCA 3HOWB 1QNUA 3V2TA 2XVSA 2HQEA 1PRTF 4JK1C 1X32A 2RVLA 3K5OA 3MZ5A 4QF4A 2V4DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BO0 A;  5EKI A;  2RSN A;  1G6Z A;  4U68 A;  1F9Q A;  5EQ0 A;  2CVR A;  2K1B A;  4UAI A;  3TZD A;  5JJZ A;  4ZKB B;  1WD0 A;  1RTN A;  2N55 A;  1ICW A;  4CJ2 C;  5E4X A;  1EIH A;  2KEE A;  4CJ1 B;  1WTQ A;  1ROD A;  1O7Y A;  2K03 A;  1CA5 A;  2IL8 A;  1EOT A;  3F2U A;  1X3Q A;  3MWY W;  4RAU C;  2K04 A;  1LV9 A;  4X3K A;  5EPL A;  1U4M A;  3MTS A;  1QG7 A;  1DOK A;  3KUP A;  3KBX A;  1SDF A;  3TN2 A;  1U4P A;  2K28 A;  2L4N A;  1CM9 A;  3SVM A;  1HRJ A;  1WTW A;  1E0B A;  5E4W C;  1O80 A;  1KNA A;  5CBA E;  1M8A A;  1AZQ A;  4NW2 A;  1CA6 A;  1ESR A;  4IUU A;  4DN4 M;  1F9R A;  1WTR A;  2HDM A;  2R3Z A;  1JIC A;  4HCS A;  3HP3 A;  1XYI A;  1VMP A;  4XT1 B;  2HDL A;  3IFD A;  5AFW A;  1O7Z A;  3FPU B;  4RA8 A;  2DY8 A;  4ZLT F;  2B2U A;  2MPM A;  2X6G A;  4IUR A;  3QO2 A;  1F9S A;  4X3T A;  4OIJ A;  2Q8R E;  1S4Z A;  1BF4 A;  2B2Y C;  1GUW A;  4ZAI A;  3DEP A;  1DZ1 A;  1ZXT A;  3I91 A;  1B50 A;  2KUM A;  5COY A;  1DOM A;  2NYZ D;  2B2W A;  4LMQ D;  4R9W A;  4HSV A;  4ZK9 B;  2B2Y A;  1U4R A;  2J7Z A;  2BDN A;  2EPB A;  5COR A;  4O42 A;  1X3P A;  4IUT A;  3R93 A;  1MSH A;  1NR2 A;  2Q8T A;  1SSO A;  1B2T A;  4ZKC B;  3FDT A;  5EJW A;  1PFM A;  2RA4 A;  5CBE E;  2DY7 A;  1AP0 A;  2L11 A;  5EPJ A;  2FMM A;  1WD1 A;  1RJT A;  2SDF A;  1IL8 A;  3P7J A;  2JP1 A;  1PFB A;  2X69 A;  5D65 A;  2KOL A;  5DNF A;  2HCI A;  5CMD A;  1Q3L A;  1J9O A;  2L1B A;  1B53 A;  2K05 A;  2B2U C;  1VMC A;  2EOT A;  4IUQ A;  4CJ0 B;  4MHE A;  1HA6 A;  1HUN A;  1J8I A;  1B3A A;  1F2L A;  1QE6 A;  3LWE A;  1NAP A;  1BBX C;  2RSO A;  1HFN A;  3DM1 A;  5D14 A;  5T1I A;  1XX8 A;  2B2W C;  2B2V A;  1EIG A;  2H1E A;  4HAE A;  1MI2 A;  4HED A;  1TVX A;  1EQT A;  4R8I A;  2MJ8 A;  1ML0 D;  2N88 A;  1MSG A;  4X3S A;  1U4L A;  2HUG A;  1IKM A;  4MN3 A;  4OIK A;  1RHP A;  5T1G A;  1B4O A;  3N52 A;  1PDQ A;  3DEO A;  3UI2 A;  1F9P A;  1EL0 A;  2KED A;  2D9U A;  1WTV A;  2KEC A;  2NWG A;  3D6W A;  2VXW A;  3H91 A;  1WTX A;  1PLF A;  3I8Z A;  1HUM A;  2B2T A;  2XIW A;  3GV6 A;  4RWS C;  1WTP A;  1G91 A;  1WTO A;  2HCC A;  1C8C A;  1G2T A;  1NR4 A;  1ILQ A;  5EPK A;  1NCV A;  2B2V C;  2JYO A;  2K01 A;  1QNK A;  4XT3 B;  1KNE A;  2L12 A;  2FIN B;  2NZ1 D;  2FHT A;  2FFK B;  2L9H A;  1SAP A;  1ILP A;  1PFN A;  2EE1 A;  4QUC A;  3Q6S A;  3GV3 A;  4QUF A;  1AZP A;  2MP1 A;  2MGS A;  1MGS A;  3I90 A;  1IKL A;  1HFG A;  2M2L A;  4IUP A;  2FJ2 A;  1DON A;  1G2S A;  1A15 A;  1X32 A;  2X6L A;  3IL8 A;  4XDX A;  4IUV A;  2KVM A;  2RVL A;  1HHV A;  3ONA B;  4X3U A;  1RTO A;  2B2T C;  3G7L A;  1WVL A;  1DOL A;  1BNZ A;  1JE4 A;  3I3C A; 
#chains in the Genus database with same CATH topology
 4N9T A;  3K81 C;  5JJZ A;  5EQ0 A;  1VQI A;  4RKB A;  5E4X A;  4DV0 Q;  2EY1 A;  2I46 A;  2PZU A;  3J80 L;  4MIU A;  1MHW C;  1ZKO A;  4LF7 L;  3GTK B;  1HJP A;  4A3E B;  2F3V A;  3KK7 A;  1VQM A;  1FL0 A;  2M9V A;  1ENF A;  1WTW A;  2D62 A;  1PTO B;  1FJG L;  4JBJ A;  4LF6 Q;  4K5W A;  3K6O A;  4R4Q A;  4HCS A;  2Z4I A;  1Q1E A;  1LTA D;  1V1Q A;  4JI6 L;  1DXM A;  1YNX A;  2BE5 C;  2K5V A;  2HT1 A;  2QEX A;  1I4R A;  4IUR A;  3PO3 B;  1FNV A;  2UUB L;  3M3Y H;  1PYB A;  1STA A;  3KLS X;  4QB4 A;  4B3R L;  4APV A;  2YTV A;  2AWO A;  3E6Z X;  1IYV A;  1EUJ A;  5HY6 A;  5BN5 A;  4OXP A;  1FNW A;  1MSH A;  4RHR A;  4K5V A;  4TKO B;  1X54 A;  2F0M A;  3U4Z A;  2DY7 A;  2RBM A;  5EPJ A;  2FMM A;  4JG2 A;  2E2I H;  1N36 Q;  4GNX A;  4IZ8 A;  5AJ3 Q;  1Q3L A;  1TS3 A;  2E74 C;  4QY7 A;  4CBV A;  1SXT A;  3HG9 A;  4KLK A;  4WJ4 A;  3C46 A;  1EIG A;  3OTO Q;  1E22 A;  3M9B A;  2JA8 G;  1EQT A;  4DAM A;  1K8A C;  3NTK A;  1SNC A;  5IT9 L;  4YCU A;  1ENC A;  2YV5 A;  1K8G A;  1IKM A;  2VUM H;  3GTK H;  1CZG A;  4A3E H;  1Z6H A;  2ZJP A;  4L5Q A;  1HR0 L;  1BQQ T;  3DM3 A;  1JWM D;  4RWS C;  4JI5 Q;  3MXN A;  3LGJ A;  4IFD J;  2OTJ A;  3ITP A;  2A68 C;  3VA5 A;  2JYO A;  2C35 B;  2L12 A;  5FO9 B;  1B70 B;  4DR4 L;  4DU9 A;  1OXT A;  2JA7 G;  1GHJ A;  3S16 H;  4OWT B;  5JAV A;  2R7Z H;  3EA6 A;  4BBS G;  1I5F A;  2AUK A;  5EBD A;  2KHS A;  4KY5 A;  4A3K B;  1VQO A;  4L5R C;  4R4I A;  4XDX A;  4DAV A;  3SR1 A;  2JEA I;  3T16 A;  2CQO A;  5EKI A;  2VB3 X;  4E6I A;  1ICW A;  5M5X B;  4X65 L;  1O7L A;  3X3M A;  4RAU C;  4K0K L;  1VQF A;  1MKH A;  2K04 A;  3AB9 A;  4A3M H;  1MJC A;  1VQ4 A;  4B3M Q;  3OMG A;  3HEJ A;  1MJE A;  3F8T A;  1M8A A;  2ZTD A;  5DEH A;  1BBW A;  1V8Q A;  5LMN L;  1CA6 A;  3MAQ A;  5M9O A;  4X64 Q;  1IBL Q;  4NXM L;  1EOV A;  5C5M A;  2NVQ H;  5AFW A;  3FPU B;  2RF4 A;  5H1S E;  3AFP A;  2WB1 B;  1F9S A;  1S4Z A;  1Q12 A;  2HHH L;  1E7Z A;  3PUV A;  4LW1 A;  2F52 A;  4XQN A;  3NSW A;  4R1J A;  4LF5 Q;  4A3B G;  1I4H A;  4HCE A;  3BS1 A;  4A3G H;  1O78 A;  5BR8 L;  2PNH A;  3M85 A;  3CPW A;  4V19 0;  2BCO A;  4OO1 I;  2X69 A;  1FJG Q;  4RCO A;  2A6E C;  3CMA A;  1J8I A;  1B53 A;  1C7Y A;  1HA6 A;  4MHE A;  1PZJ D;  4ID6 A;  2K5N A;  3DM1 A;  4FXK C;  3PUZ A;  4JI6 Q;  1EYC A;  5CV7 A;  1IW7 C;  2VQE L;  1G6P A;  5IGC A;  4L5T A;  4C2M B;  4B3R Q;  5FLX L;  5FKA C;  3CRL C;  3DEO A;  1W6K A;  3RN5 A;  5IYC G;  1L0W A;  3CHB D;  1WCM H;  3S17 B;  3TP8 A;  1EU3 A;  4EQP A;  4EX5 A;  3PO2 G;  3RLN A;  1A6X A;  1NE3 A;  4K6L A;  1ILQ A;  2B8F A;  4DGZ A;  2R93 G;  3L0O A;  2GA4 B;  1OO9 B;  4P74 A;  2FJ2 A;  5C0X I;  4Z9C B;  5IOD A;  1BR9 A;  1YIT A;  1NBW A;  4LUV A;  1IBM L;  5JJL A;  4FVM A;  2F1M A;  3I72 A;  4BBR G;  2KQ3 A;  1JR0 D;  1HR0 Q;  3TZD A;  1CI3 M;  4IPD A;  4JI2 L;  4DR5 L;  1VQB A;  2ASB A;  3S14 B;  4ILW A;  1SFO B;  2PMZ E;  1TWA B;  3K7A H;  3J80 E;  2EYP A;  1SYD A;  2BH2 A;  4AQY L;  1CM9 A;  3NEN A;  3ICE A;  1A8V A;  1E0B A;  4C2M H;  1HCZ A;  1K8O A;  4NW2 A;  1PH3 A;  5FLM H;  2D5D A;  1XPR A;  5C4X H;  5FOB B;  1VMP A;  1FGU A;  2HDL A;  4TRD A;  1Y1V B;  3R8B A;  3NQT A;  3DWA A;  3NWT A;  4AH6 A;  3KJP A;  1DOM A;  3NXW A;  5JEA H;  2B2W A;  4X65 Q;  1OXU A;  2J7Z A;  4RMF A;  5COR A;  4K0K Q;  4JI7 L;  1FR3 A;  1P16 A;  3T4A C;  4A3C G;  1SSO A;  3E9H A;  2V1C C;  4KK7 A;  4ZKC B;  1PH4 A;  1PFM A;  1CSQ A;  1SYC A;  3CCL A;  5EAY A;  4GLA C;  4DR7 L;  4RCN A;  2N49 A;  1BOS A;  4FP5 D;  2JE6 I;  1ASY A;  3OWF A;  4KN4 C;  2AUJ D;  1SN8 A;  5LMN Q;  3HOZ H;  2NVY B;  4NXM Q;  1HR0 W;  3QG1 A;  2JA6 G;  4LJZ C;  5C6A A;  1EWC A;  2F3I A;  2UU9 L;  4UY8 C;  5C4Z A;  2Z8L A;  2E76 C;  1SLJ A;  4DV5 L;  4R8N A;  3HKZ G;  1VQ6 A;  3S1M B;  2G9H D;  5BR8 Q;  4KHV A;  3GV6 A;  4LF9 L;  1YVC A;  5GQO A;  3GTL H;  1F2Z A;  2R92 H;  4XT3 B;  4C3I G;  1H9S B;  3TEH B;  1VQ9 A;  2UXD L;  1FNU A;  2FFK B;  3CC2 A;  3RMH A;  1V43 A;  4DK1 A;  4A3F G;  3P75 A;  3K5N A;  1YI2 A;  2VQE Q;  4O2D A;  2X6L A;  1JT8 A;  1VCI A;  1DJR D;  1L2F A;  5CV9 A;  3T1H L;  3I4M G;  1S3O A;  4DXG A;  5ELF A;  2DJG C;  1YJN A;  2MFI A;  3G6J B;  4LFA L;  2B63 B;  1WYD A;  5FK9 C;  4P2C B;  5KGU A;  3S1Q H;  3NE5 B;  4Y7N B;  1GHK A;  2ZJQ A;  1ROD A;  1CQV A;  5LMN W;  4C3J H;  2A69 D;  1EFI D;  1BCP B;  1QG7 A;  1Y8P B;  4I7Z C;  4JC0 A;  5EBC A;  5DM6 3;  5GAG C;  2SEB D;  1K73 C;  4DAY B;  4FDB A;  3OMC A;  1NJI C;  1PFS A;  4A3D H;  5IOC A;  3Q23 A;  3O13 A;  3JAM i;  1KNA A;  2D2C C;  4LAA A;  1PYS B;  4S3S A;  3ULJ A;  2I5M X;  1D5M C;  4H44 C;  1IBM Q;  1RDP D;  3IFD A;  4PNY A;  4RA8 A;  2DY8 A;  1A3V A;  2Q2U A;  2K6A A;  5C4J H;  2F0J A;  5I4D A;  1GUO A;  1FVI A;  3NEL A;  3ZJY C;  1CKO A;  2EY6 A;  4JI2 Q;  2NYZ D;  5C3E B;  4DR5 Q;  4R9W A;  1STB A;  4JCV E;  4O1N A;  3L3O C;  2KEN A;  2R7F A;  1SNO A;  5I6Y A;  3TSS A;  4AQY Q;  3FDT A;  3RZO B;  2L11 A;  2ID0 A;  5LL6 X;  2JP1 A;  2O4X A;  1IL2 A;  4HIM A;  3HOU H;  2WAQ B;  2CCZ A;  2E2J B;  1QOH A;  2Z4H A;  4IUQ A;  4CDC C;  1DGS A;  2QA4 A;  3MXP A;  1KD1 C;  5JVG 3;  1TQO A;  2LFN A;  3BJU A;  1BBX C;  1VF7 A;  2XNA C;  2CW0 D;  1HNX Q;  1N34 L;  2RKS A;  5C44 G;  3HOV H;  4C3H G;  4R8I A;  1GXD C;  3NBI A;  3FVQ A;  1PRT D;  5DLQ E;  4U67 3;  4JI7 Q;  3J7A 5;  2IHE A;  3GTM B;  3D6W A;  1O7I A;  1QCB D;  3FKI G;  2DJF C;  3LX0 A;  1VQP A;  4A93 G;  1KIX A;  5M3M G;  2ES2 A;  2FIN B;  3J81 j;  1HZA A;  3GD7 A;  1C4Q A;  2A73 B;  5J3B A;  1JC7 A;  3SHL A;  5IYB H;  3EN2 A;  2QDL A;  5M5W H;  1TY0 A;  1I94 Q;  1SRU A;  2OT2 A;  1A15 A;  3R2T A;  3W5O A;  2CHB D;  4X62 L;  2UU9 Q;  3TP5 A;  2K52 A;  3ERO A;  3HOX B;  1RTO A;  3KF8 A;  3HOY H;  2O2L D;  4IQZ A;  2GVB A;  1YHB A;  1PVO A;  4WOR A;  1G6Z A;  1VQH A;  3K58 A;  4BY7 G;  4CJ2 C;  4L63 B;  5LL6 S;  3TRZ A;  1MIU A;  2RHQ B;  2PQA B;  3OYY A;  5KIX A;  1SND A;  2E2J H;  4DNI A;  4X3K A;  3MTS A;  2F0V A;  1EWH A;  1Y1W G;  2UXD Q;  2MO0 A;  2NTT A;  1JQY D;  1EYG A;  2F0N A;  2WKC A;  3SVM A;  1HRJ A;  1EWI A;  5CBA E;  3VYS A;  3J7Y W;  2JA5 B;  1STN A;  1Y8N B;  2DUD A;  3CCE A;  2IX3 A;  1HNZ Q;  4IUU A;  4HJ9 A;  3KLS A;  3T1H Q;  5IP7 H;  1XYI A;  3WOF A;  2OWO A;  1EY0 A;  3H0G B;  4GLV B;  1K3B C;  4LFA Q;  1N33 L;  3F2B A;  5M3F G;  2KUM A;  4MTK A;  1LYL A;  3RNU A;  4ZK9 B;  5IGB A;  4IFD G;  2BDN A;  4KKT A;  4O42 A;  4ODG A;  2ICE C;  1NR2 A;  2F0Q A;  2CWP A;  2I5H A;  3C3L A;  2RQX A;  1PMR A;  4HR7 B;  5IP9 G;  5I9P A;  2YU9 H;  1YHA A;  1ENA A;  5E1F A;  1JJG A;  2B2U C;  4J8Q A;  3KDF A;  1QVC A;  1TWC B;  3RD4 A;  1NAP A;  3HOX H;  1XMO L;  5EGT A;  3M7N A;  4LNQ A;  2B2V A;  4HAE A;  4RHS A;  4XQQ A;  5I2Y A;  4HED A;  3TS0 A;  1TVX A;  4KN7 C;  3DUZ A;  3MFG A;  3HZX A;  2PI2 A;  1KHI A;  4BXX H;  3CPF A;  2LSS A;  1HTL D;  3W1G A;  1NMG A;  2NWG A;  5HUR A;  3ND8 A;  2IPK D;  5KRU A;  4JI4 Q;  2AKW B;  3OHX C;  2OCE A;  1XWE A;  2JA5 H;  4WJW A;  2XGT A;  2BDO A;  1IHZ A;  1B9N A;  1QUQ B;  2F4V L;  4RH6 A;  5FO7 B;  3I2Z A;  4EQN A;  2L0C A;  3H0G H;  1N34 Q;  3I4N H;  3H15 A;  3A7A B;  3WDN A;  3CCQ A;  1DON A;  1W2B A;  1HXY D;  2F3W A;  2OQ0 A;  4A3J B;  3AEV A;  2IW3 A;  1STG A;  1C0A A;  1WVL A;  3TQY A;  1NUC A;  1BO0 A;  3M3Y B;  4A3I H;  1QZG A;  4LFB L;  1WTQ A;  5IYD G;  4FXG C;  3STB D;  5EPL A;  4QIW B;  3PF5 A;  1P8L A;  4OO1 H;  2EJF C;  1GJX A;  4DV7 L;  4LWC A;  4CGY B;  4DR2 L;  1W6J A;  3HOW G;  2LXK A;  4DR1 L;  2F03 A;  2E2I B;  3FEW X;  2R61 A;  3W2D A;  4BY1 H;  1G51 A;  3BU2 A;  4JI8 L;  1YEZ A;  2TMP A;  3HS0 C;  4X62 Q;  4FF3 A;  1JJC B;  1LM0 A;  4LFC L;  2EYH A;  2KCT A;  4HJA A;  4EQO A;  3ERS X;  4ABN A;  4OX9 L;  4DXF A;  1JWU D;  1EQV A;  2K14 A;  4GN4 B;  2VUM B;  3LWU A;  4TVA B;  1CQF A;  2ZXR A;  2DNE A;  3D4W A;  2A19 A;  4ALP A;  3NWS A;  4KHP L;  4Q0F A;  1TWH H;  3CKI B;  1A63 A;  1VQJ A;  1U9R A;  2Q8T A;  1IYJ B;  1X3E A;  4A3L G;  3G48 A;  1QWY A;  1RJT A;  5IGD A;  2B8G A;  4A3J H;  4YHH L;  2GVA A;  1XMQ L;  1CFM A;  1OXX K;  4K2K A;  2KBN A;  5DAU A;  3DXJ C;  3S16 B;  2F0F A;  5C0X H;  4ZUJ A;  5A2Q L;  5KND A;  2R7Z B;  1ESF A;  1N33 Q;  1D5Z C;  3PO3 G;  1VQE A;  2QKI C;  4GN3 B;  4DR6 L;  4MN3 A;  4K8J A;  3SE0 A;  2EQS A;  3OPO A;  1SJE D;  4PG3 A;  2QIL A;  4JI3 L;  1GKH A;  1SE8 A;  2Z9H A;  1L1O C;  1HUM A;  2A69 C;  2IT1 A;  1WTP A;  1K83 B;  3PV0 A;  4DV1 L;  2IX0 A;  1OXS C;  3CQZ H;  4A3M B;  4DNT B;  2O5I C;  2YYZ A;  1XMO Q;  1LAB A;  2EE1 A;  3D31 A;  5F2D A;  2UXB Q;  2G9D A;  1IKL A;  4PQX A;  1YJ9 A;  2F0U A;  4X66 L;  3GP7 A;  1D6E C;  1MD2 D;  5GAE C;  2F0H A;  2ALY B;  2NVQ B;  5J39 A;  1TII D;  5IIF A;  1DOL A;  1C48 A;  1BDO A;  2VNU D;  4XQJ A;  1G91 A;  1RTN A;  4KJN A;  2J4X A;  1BBU A;  4M1U B;  2PW5 A;  3S2D B;  4A3G B;  3KBX A;  1TWF H;  3IAY A;  3CCM A;  1E2V A;  3D4R A;  3CD6 A;  1O80 A;  5HGQ A;  2Z1C A;  4KI0 A;  4A3K G;  1WI5 A;  3ULL A;  3JAM c;  4XT1 B;  1D8L A;  2NZO A;  1IBK L;  2ZT9 C;  2X6G A;  4NP5 A;  3J7A V;  4IOA A;  4XIG S;  5J22 A;  2M00 A;  4G4K A;  4LFB Q;  1K83 H;  1V1P B;  1AH9 A;  2BH8 A;  3BG3 A;  4LMQ D;  1XPU A;  3NUC A;  2PI2 E;  5CV6 A;  3CCJ A;  1AE2 A;  4POF A;  3TP6 A;  1WCM B;  4DR2 Q;  1XXG A;  4R4O A;  5BN4 A;  3M4Q A;  2TSS A;  3PIO 3;  4DR1 Q;  1KRT A;  1RL2 A;  2SDF A;  4G7Z C;  1U0L A;  2CWA A;  4JI8 Q;  1L1O B;  1HNW L;  1V1O A;  1SR3 A;  4KKS A;  2BA1 A;  4LFC Q;  3D3R A;  2A8V A;  4OEM B;  2OQK A;  4OX9 Q;  2WB1 G;  3K0X A;  2JA8 H;  3BDL A;  4X3S A;  3M4O B;  4LF7 Q;  1YHQ A;  1Q86 C;  3H6M A;  1XTD A;  1PYW D;  1J5E L;  1PDQ A;  4KHP Q;  3S2D H;  3Q0A A;  3A8J E;  2UUA L;  4IFD I;  1PV4 A;  2HQL A;  2I5L X;  1W3S A;  4RGT A;  3K7A B;  4HN7 A;  1WTO A;  1NR4 A;  1M90 C;  2F0W A;  2KHJ A;  1JCK B;  1TXY A;  3BZK A;  2FHT A;  1SNQ A;  2L9H A;  1SAP A;  3RLF A;  2JA7 H;  3Q6S A;  5IGE A;  1AZP A;  2UUB Q;  5KYI A;  2Q2I A;  1HFG A;  4BBS H;  5KYL A;  2PZW A;  4DR3 L;  1SE2 A;  2JQO A;  1PH5 A;  5C4X B;  2XTI A;  1X56 A;  4DV2 L;  4DA2 A;  1AE3 A;  3OW7 A;  3G7L A;  2WP8 J;  4JI3 Q;  2ZXP A;  4JV5 L;  2CVR A;  2K1B A;  3K80 C;  3TDQ A;  3UE0 A;  3RR5 A;  1LAC A;  4ZKB B;  2WB1 E;  2Y0S G;  1PRT B;  3NEM A;  3B6Y A;  4UP9 A;  1SRO A;  4HJ8 A;  3OW2 A;  1HZB A;  1YNN C;  4DAY A;  1Q8I A;  4X66 Q;  2VQF L;  3HOZ B;  1ESR A;  3M4O H;  3T13 A;  3G71 A;  4A4I A;  1JIC A;  2SOB A;  3OOC A;  2A6H C;  4ZLT F;  1X3G A;  2VZA A;  5CV4 A;  1K8M A;  1JE5 A;  1EY7 A;  4C56 C;  3NBH A;  2K32 A;  2K33 A;  4RKL A;  3GTP H;  5IGG A;  3V96 A;  4FYD A;  4ME3 A;  3TRE A;  2IWH A;  1X55 A;  4DR4 Q;  4IN3 A;  1VQG A;  4IUT A;  1LTI D;  4A3B H;  1CUK A;  2EY5 A;  2ENB A;  3GTL B;  2FMC A;  3ND9 A;  4KMU C;  3MXN B;  2R92 B;  3HRZ C;  2Y0S E;  4FF1 A;  4DNR B;  1S5B D;  4OWX B;  1LTR D;  2NN6 G;  3LWE A;  5C4H A;  3A8K E;  1EZ8 A;  1HFN A;  1VQL A;  1Y1V G;  1IBK Q;  5A2Q E;  1BCP C;  2IX1 A;  1WJJ A;  1UE6 A;  3DMU A;  1TY2 A;  3RZD H;  2QEJ C;  2Z6B A;  1Y8O B;  3PIO A;  1SE3 A;  2QDB A;  4C1N K;  4DFA A;  3A56 A;  5IYC H;  1SNP A;  3E0J A;  3S1Q B;  3D0F A;  2I0Q A;  1GUG A;  2HIV A;  1KAW A;  3STB C;  3PO2 H;  1B44 D;  2IJ0 A;  2E5L L;  1I4P A;  4C3J B;  1KRS A;  2C5C A;  1YZ6 A;  4DK6 C;  4BA1 I;  1EY9 A;  3FRP B;  2R93 H;  4B3S L;  3QIA A;  2LMC B;  2JN4 A;  4A3D B;  1B1Z A;  4KV6 A;  2LS0 1;  3BDO A;  3DHQ A;  4PZ8 A;  2HHH Q;  2K5D A;  5ELB A;  4KKU A;  4DK0 A;  1OXV A;  2NVX H;  4IUV A;  2JA9 A;  4WJ3 M;  2VB2 X;  3I70 A;  1PZK D;  2KCC A;  1J5E Q;  2SNS A;  1BUV T;  2R7D A;  3SGI A;  4CKE A;  4DUY L;  1A0I A;  4BBR H;  1J6Q A;  5C4J B;  3G4S A;  2UUA Q;  1A2T A;  3SK5 A;  1EY5 A;  2K4K A;  5FJ8 G;  2PQA A;  3W3A A;  1TS4 A;  1XPO A;  1BXT A;  1X3Q A;  1ZEQ X;  2N78 A;  1SEB D;  2NTS A;  1D2B A;  3F2C A;  3AFQ A;  1Q8K A;  3AU7 A;  3HOU B;  3UDI A;  2F0T A;  1KXL A;  3HKS A;  4AYB B;  4DR3 Q;  2K5Q A;  2XSC A;  2R3Z A;  4DV2 Q;  3HP3 A;  1EY6 A;  3S24 A;  1CHQ D;  3HOV B;  4KJO A;  4JV5 Q;  2B63 G;  5K36 H;  4OIJ A;  4LF8 L;  2BE5 D;  4RFB A;  2B2Y A;  1UE1 A;  5I9O A;  3L7Z C;  3HKZ E;  4A3C H;  2KCM A;  3UE1 A;  3C1E A;  3GO5 A;  2ZJR A;  1LLR D;  1UE5 A;  3P7J A;  3U58 A;  2L1B A;  2VQF Q;  3CME A;  3A55 A;  2L5T A;  4GKK L;  2OTL A;  4NDX A;  4DV3 L;  5M5W B;  1PH2 A;  1XX8 A;  3H3V H;  4F88 A;  2JA6 H;  4GOP C;  2YTY A;  1WTH A;  3TME A;  3KOJ A;  3VYU A;  2OEO A;  3NQI A;  3KF6 B;  3PIP 3;  1K28 A;  4P75 A;  3NK9 A;  3NP8 A;  4FF2 A;  4JYA L;  5C3E G;  3AQQ A;  3HOY B;  2ZTE A;  2R6G A;  1G8Z D;  1LO5 D;  2KJX A;  4CKC A;  1OTC A;  3H91 A;  3I7F A;  1GO3 E;  5JEA J;  1I3Q H;  4ZYS A;  4UPA A;  2WAQ G;  4HSP A;  2EYM A;  3K8A A;  3TP7 A;  3GV3 A;  4A3F H;  2M2L A;  4M8A A;  3F1Z A;  4ZRZ A;  3IL8 A;  3T53 B;  4OHJ A;  2K50 A;  5LHY 1;  3FMC A;  2KVM A;  3OSO A;  3I4M H;  4N9P A;  2QCP X;  3E5S A;  4DR7 Q;  1PTO F;  4IPC A;  2BOS A;  4U68 A;  4H02 A;  3F2D A;  3KLR A;  1A62 A;  1WD0 A;  5IE8 A;  1TKW B;  2E5L Q;  2QF7 A;  3D8G A;  1RF2 D;  3S9W A;  1JOO A;  2RDH A;  4MNO A;  3JAM E;  2PNR C;  4B3S Q;  1SDF A;  1U4P A;  2YU9 B;  1D5X C;  1S72 A;  4OL7 A;  1V9P A;  3FP9 A;  3KLW A;  1QVF A;  5GRO A;  2H5X A;  4DN4 M;  2WAQ E;  1WTR A;  3VR6 A;  3PUW A;  1STY A;  3VYT A;  4X6A H;  4CKB A;  4JOI C;  4B9X A;  4DV5 Q;  4DUY Q;  1XTC D;  3EJI A;  2B2U A;  4IJH A;  3W1B A;  1NNX A;  4LF9 Q;  1PZI D;  4YIJ A;  1B9M A;  2JJQ A;  1ZXT A;  3R2I A;  4PMW A;  1B50 A;  4XXE A;  1SNM A;  4Q5V A;  5CV8 A;  4GOP B;  2YTX A;  4NKL A;  1VQ5 A;  2JXM B;  1CZW A;  4TQU S;  1QIL A;  1BVS A;  1Z7T A;  1LTT D;  1KAB A;  1PFB A;  5D65 A;  2PPB C;  5CMD A;  3MVV A;  4JI0 L;  1UEB A;  2I07 B;  3QB3 A;  1VF5 C;  1B7Y B;  4DAP A;  1CKN B;  4YCV A;  1K3R A;  2ZXO A;  3I4N B;  5T1I A;  5C3X A;  1VQC A;  2LY7 A;  5C44 H;  4O0A A;  4C3H H;  1ML0 D;  4GKJ L;  2PO4 A;  4LF8 Q;  3J81 c;  4UHV A;  5A35 A;  5T1G A;  1EL0 A;  1SYB A;  1CSP A;  1F9P A;  3UI2 A;  2KED A;  4H13 C;  4A3I B;  3CC4 A;  4QQB X;  3BVG A;  3EBE A;  1DYQ A;  1KLG D;  1EQQ A;  1STE A;  2NZH A;  5ELD A;  1HTP A;  2PZT A;  3FKI H;  3V05 A;  5M3M H;  4GKK Q;  3VR3 A;  5M5Y H;  3PIP A;  4DV3 Q;  4KY6 A;  3R3O A;  4BY1 B;  2NN6 I;  4YWK A;  3U9S A;  3D4D A;  3L9A X;  4RG1 A;  4JYA Q;  3I73 A;  3J80 c;  1H9K A;  4F87 A;  1KL9 A;  4BY7 H;  2IL8 A;  1TWH B;  3WWV A;  4JBW A;  3K57 A;  1A2U A;  1HZ9 A;  4KY7 A;  1Y1W H;  3VDY A;  5KEE A;  1TS5 A;  2L4N A;  1YBY A;  3Q24 A;  1D1K A;  1TR5 A;  3I4L A;  4YWM A;  4AIM A;  1JOR A;  3U4V A;  2MQH A;  4JPB W;  3VR5 A;  2EYO A;  4A3J G;  1SMY D;  4KD3 A;  4ZQ3 A;  2AQ1 B;  1KDA A;  3GQB A;  5FO8 B;  3FHW A;  5M3F H;  4JBK A;  1RD9 D;  1V1P A;  4K6D A;  3CAM A;  4IFD H;  1K0R A;  4I65 A;  1UUP A;  3IKJ A;  5I2X A;  1B2T A;  2A1A A;  2K5H A;  5EJW A;  3SXH A;  1UAP A;  5IP9 H;  5CV5 A;  3GTG H;  3GTQ H;  5I6W A;  4RGO S;  5CGK A;  3CQZ B;  1J9O A;  1JMC A;  2XWJ B;  1JB7 A;  3QR8 A;  1B3A A;  3TS2 A;  5IT9 c;  1L1O A;  3OWE B;  2MO1 A;  3CCR A;  5D14 A;  1PH1 A;  2ZM6 L;  2XRS D;  1PH9 A;  1JOK A;  1U4L A;  5ISR A;  2VUM G;  5E3F A;  2A74 C;  2Q2T A;  2B39 A;  1RHP A;  4A3E G;  2RDF A;  3CW2 C;  4X64 L;  5JPM C;  3KF8 B;  1CK1 A;  4QGU A;  2D0P A;  1L0X B;  3ERQ A;  3S1N H;  2CH4 A;  5EKK A;  2NVT H;  4UP8 A;  2D0O A;  4K5X A;  2Z6K C;  4G57 A;  1LT4 D;  4JI0 Q;  3ZYY X;  4UP7 A;  2NZ1 D;  2VS1 A;  3I4O A;  1TWF B;  4QIW E;  4LF5 L;  3A5U A;  4J1M A;  5DM7 3;  4BA2 I;  1ZYR D;  1IXR A;  2R7Z G;  1VQ8 A;  1S5E D;  2SNM A;  1M1K C;  4GKJ Q;  3G6E A;  1NSN S;  3QJY A;  4IPH A;  1NY4 A;  2B2T C;  1HA5 A;  2Q2H A;  4JBM A;  1JE4 A;  4GZY C;  1MBY A;  2RSN A;  4GN5 A;  5NUC A;  4OON A;  2N55 A;  3D6C A;  5IYD H;  2F0K A;  3MWY W;  4A3M G;  3SDZ A;  5G3L F;  3TN2 A;  4J6H A;  1LTL A;  1YIJ A;  1K9M C;  1I50 H;  2K28 A;  3S2H H;  3HOW H;  3C2P A;  1STH A;  1ICF B;  3BZD B;  1Q46 A;  3URY A;  1CHP D;  1JWS D;  1YNJ D;  1E1T A;  1IZ6 A;  1TU2 B;  3KDF B;  5TSS A;  5J1Z A;  4EVO A;  2EZV A;  2JSO A;  1KQS A;  1S5F D;  3A54 A;  1SYG A;  2L15 A;  2JA8 B;  4X3T A;  2UXC L;  4ZAI A;  1EEF D;  3HFZ B;  2F4V Q;  1GM5 A;  2F0G A;  3TZU A;  1BKB A;  1X3P A;  3QWN A;  1UEA B;  1KLU D;  3Q8D A;  4P72 A;  4A3G G;  1PH6 A;  1ET9 A;  1T9H A;  4A3L H;  5LMU L;  1WOC A;  3NTI A;  4IO9 A;  1PTO H;  1N8R C;  1I4G A;  2HCI A;  4KTA A;  2CW0 C;  2OF1 A;  1DZ1 A;  5JPN C;  4IAL A;  3GDE A;  2A5H A;  4CDE C;  3KYH C;  2JA7 B;  3A7L A;  1PHJ A;  1PRT C;  1SYE A;  5FLX c;  4BBS B;  3KJO A;  4I7A A;  4YCW A;  4OEL B;  3PO3 H;  5KNB A;  1MSG A;  4QL5 A;  4PMC A;  4G7H C;  4MTN A;  3K5L A;  2E2D C;  3A0J A;  5K5P A;  3BZC A;  4DV7 Q;  5EKL A;  2D9U A;  4B3T L;  4GNX C;  2KEC A;  1WCM G;  3RLO A;  1GUN A;  1WTX A;  3I8Z A;  4DUZ L;  1NTG A;  2HCC A;  4DPG A;  1NCV A;  3T56 B;  2UUC L;  1CT1 D;  1QNK A;  4L6T B;  1I6V C;  3J81 i;  1ILP A;  2P5Z X;  1PFN A;  4EQ5 A;  3I55 A;  3T1Y L;  4QUC A;  2IHF A;  2ZM6 Q;  2MGS A;  3I90 A;  3ER0 A;  4IUP A;  4IUN A;  4HMI A;  1BCP F;  1B8A A;  2CQA A;  4HID A;  5C0X J;  1HHV A;  2C9O A;  1FYC A;  4FNF A;  2PYK A;  2QW7 A;  4UDU C;  1FD7 D;  4P71 A;  3I3C A;  3MFY A;  1F9Q A;  3H09 A;  3GTP B;  4NXN L;  1EIH A;  4PZ6 A;  3AMU A;  1VQK A;  4YHH Q;  1LT3 D;  2K03 A;  2AQ3 B;  4IJL A;  1XMQ Q;  3F2U A;  1H9S A;  1LV9 A;  4RGM A;  1U4M A;  3CRK C;  4A3B B;  3PUX A;  3PGZ A;  1PXU A;  3J80 i;  5E4W C;  3H94 A;  4DR6 Q;  5IWA L;  3J7A F;  5FLM G;  4A3K H;  3U50 C;  5CR3 A;  1DD2 A;  5C4X G;  3HGB A;  2K7V A;  4XTC S;  3A5Z B;  1LT6 D;  2MPM A;  2CH4 W;  1EQR A;  4H7B A;  3NPP A;  1WFQ A;  2AHO B;  4DV4 L;  4LK1 C;  3RZD B;  4YWL A;  1BF4 A;  1GUW A;  3JAM L;  3KBG A;  4DV1 Q;  2PMZ B;  5M5X H;  5JEA G;  1AEX A;  3K5M A;  3DWP A;  2DGY A;  2WAC A;  3R93 A;  5CYU A;  3EVQ A;  2KHI A;  2N3S A;  2L55 A;  1DCZ A;  2WII B;  3PO2 B;  5GAH C;  4K2L A;  2F0I A;  4GNX B;  2PQE A;  2JK8 A;  3J81 E;  3H3V C;  2Y0S B;  5IGF A;  3HOZ G;  2R93 B;  3RN2 A;  1E1O A;  1N32 L;  1EYA A;  1Q1B A;  2UXC Q;  1UWV A;  2NVX B;  1DM0 B;  4A76 A;  3KF6 A;  1AW7 A;  1CKM A;  1B4O A;  4BBR B;  1S5D D;  2BA0 A;  2VXW A;  4OGQ C;  1PTO D;  4DKA C;  3DWQ A;  5LMU Q;  1I6H B;  4KHZ A;  3MEF A;  1G2T A;  2R92 G;  3BDC A;  1E3P A;  2RCF A;  5JOB A;  4TSS A;  2O5J C;  4QUF A;  1LUZ A;  3N6R A;  1MGS A;  5ELO A;  1SMY C;  1G2S A;  1RCV D;  4H0L C;  3K59 A;  4QCL A;  1XJV A;  2NB0 A;  3KFU A;  3JC6 6;  4B3T Q;  1PH7 A;  3MXG A;  1HNX L;  3NTH A;  3S17 H;  4L8J A;  3S15 B;  5K36 G;  1AN8 A;  4DUZ Q;  1GOZ A;  2KEE A;  3C1F A;  4C3J G;  3QOJ A;  1KC8 C;  3BYY B;  4HIO A;  1HNW Q;  4JW0 A;  2UUC Q;  2F0E A;  1UNS A;  2F0P A;  3UDG A;  1VQA A;  1GVP A;  4CHT B;  4G7O C;  2WFW A;  3T1Y Q;  4A3D G;  3MHB A;  4HIK A;  4Y52 H;  4A75 A;  3OIQ A;  4PV1 C;  2VW9 A;  1ONL A;  1RIP A;  1A3T A;  3WOE A;  4R4T A;  1F9R A;  5HGT A;  1VQ7 A;  3PUY A;  1KTK A;  4FF4 A;  1N9W A;  4FO2 A;  2JA6 B;  2E75 C;  4C1N I;  3AYH B;  2B29 A;  4NXN Q;  2JEB I;  3DEP A;  1SBB B;  2LKV A;  1I94 L;  1I6H H;  2NBF A;  4HTH A;  1KDC A;  4J15 A;  1HH2 P;  2HD3 A;  4BWG B;  1U4R A;  3EFX D;  4GOP A;  5IT9 E;  3S14 H;  3PMF A;  1Y69 U;  1SFO H;  1TWA H;  4OWW B;  1LT5 D;  3VR4 A;  3HKZ B;  2EXD A;  1I3Q B;  5CBE E;  4B08 A;  4ULL A;  1XNR L;  1H9J A;  4IOC A;  2XN9 C;  1X9N A;  1IL8 A;  3HOU G;  5DNF A;  3CF5 A;  3IRB A;  5IWA Q;  4C3I B;  4AYB G;  4LF4 L;  1ET6 A;  1R9T B;  2NN6 H;  1ZYR C;  1CKN A;  2RSO A;  4A3F B;  1QZH A;  2B2W C;  4HJ5 A;  1Y1V H;  2H1E A;  2ATW A;  4QJF A;  3BVM A;  3HOV G;  3S15 H;  4DV4 Q;  3BVZ A;  2N88 A;  4XYQ A;  3CC7 A;  2AMC B;  3I4M B;  4BS9 A;  1L0Y B;  1HNZ L;  3EIV A;  1I4Q A;  3A8I E;  2GN5 A;  1X6O A;  1F2Y A;  3X3N A;  2IY5 B;  1I4X A;  2WIN B;  1PLF A;  2Q8I B;  4CDF C;  2XIW A;  1EFW A;  2EDG A;  5EPK A;  1Q90 A;  3MEH A;  1IYU A;  2NUC A;  3P20 A;  2K75 A;  1CTM A;  1GD7 A;  2FXQ A;  2NVY H;  3A74 A;  3P1H A;  5IYB G;  3QOL A;  2E8G A;  2K5W A;  2MP1 A;  1N32 Q;  2F0O A;  3FPP A;  1YNJ C;  1D7Q A;  4NB3 A;  4GLX A;  2EY2 A;  4L5S A;  2F0D A;  4AYB E;  1E24 A;  4ZCK A;  4HJ7 A;  3ONA B;  3HOY G;  1XNQ L;  1ASZ A;  3CU7 A;  3MA2 B;  3NBH B;  1U5K A;  2AQ2 B;  3S1M H;  5JVH 3;  4JOI A;  2F4I A;  2ZTC A;  5FJ8 H;  1CA5 A;  1QUQ A;  1T5E A;  4C3I H;  3MXU A;  4V0B A;  1HQR D;  1R9T H;  1EIF A;  3KUP A;  2A68 D;  1SYF A;  3M4P A;  1S40 A;  3MC0 B;  2RDG A;  4DV6 L;  1RKN A;  1UE7 A;  4JI4 L;  1X65 A;  1LTS D;  2MNA A;  1AZQ A;  4YY3 L;  1KDB A;  4QMG A;  2HIX A;  3GTO B;  2WV6 D;  2WKD A;  5IP7 G;  3S1R B;  4GS3 A;  1VQD A;  2KA7 A;  5C44 B;  3ULP A;  1O7Z A;  5C5L A;  2E2H B;  5L37 A;  1VDZ A;  3PQI A;  1GUS A;  3QO2 A;  4C3H B;  2B63 H;  1VS0 A;  2Q8R E;  2VL6 A;  4CDD C;  2B2Y C;  2J0T D;  1QJO A;  1H95 A;  3I91 A;  4Y7N H;  1EYD A;  5COY A;  5GAD C;  4HSV A;  1EU4 A;  1HZC A;  3K0Y A;  2EPB A;  4LUO A;  5E7N A;  4N8F A;  1G29 1;  1TS2 A;  2RA4 A;  5FLX E;  4POG A;  1AP0 A;  5ELN A;  1NMF A;  1F77 A;  1WD1 A;  4B9W A;  3FKI B;  4K14 A;  2KOL A;  4A93 B;  2K05 A;  2EYL A;  4IPG A;  3E0E A;  5M3M B;  4CJ0 B;  4JI1 L;  1KAA A;  1F2L A;  1QE6 A;  4DF7 A;  2DN8 A;  3HOX G;  5M5Y B;  4R4C A;  4MZ9 A;  4WFN 3;  1JJ2 A;  1MI2 A;  2MHV A;  3SK4 A;  2XRQ D;  1Y14 B;  2HUG A;  4BXX G;  1A3U A;  3M7G A;  1T5X D;  5C3E H;  2OXP A;  2QGQ A;  1SE4 A;  3PF4 A;  1WTV A;  1EIY B;  2CFM A;  1LTG D;  1H9M A;  1TWG B;  4BY7 B;  3RZO H;  2RHS B;  4DV0 L;  1XNR Q;  2JA5 G;  5JJI A;  5KNC A;  1M4V A;  1Q7Y C;  1R4P B;  2EJG C;  1HPC A;  5D3I B;  4F7X A;  5BN3 A;  2K01 A;  3LNN A;  4LF4 Q;  3GTO H;  1KNE A;  3S1R H;  1Y1W B;  2A6E D;  3H0G G;  3IFT A;  5G3L D;  2E2H H;  2H4O A;  1R4Q B;  2EIF A;  3CP0 A;  3I4N G;  1GUT A;  3GTJ B;  5C3W A;  4RGN A;  1Q82 C;  1E2W A;  4LF6 L;  1IW7 D;  4KD4 A;  2N8N A;  4X3U A;  3Q22 A;  2EVB A;  3I56 A;  1BNZ A;  1C9O A;  2XWB B;  1AFP A;  3GTM H;  2EYF A;  4JVZ A;  4A3I G;  4UAI A;  3NHH A;  5M3F B;  1EEI D;  3CCU A;  2AWN A;  4CJ1 B;  2MUY A;  1F2M A;  4A93 H;  1O7Y A;  3TBI B;  1S5C D;  4XYO A;  1EOT A;  4ME5 A;  3EQL C;  4LUZ A;  4OO1 G;  4ZUI A;  1DOK A;  5ELE A;  2EXZ A;  1JOQ A;  1E2Z A;  3UDF A;  3GTG B;  2CKZ B;  3GTQ B;  4HMJ A;  4BY1 G;  1EZ6 A;  1N36 L;  3OIP A;  3SEB A;  5AJ3 L;  1SJH D;  2F0L A;  4NMZ A;  1YNN D;  3BYT B;  1X3F A;  1B3Q A;  1Q81 C;  1EY4 A;  2F0S A;  2HDM A;  3L2P A;  1PA6 A;  1VQN A;  1XNQ Q;  1LTB D;  3RUZ A;  1TWG H;  3OTO L;  3M4Y A;  4DK3 C;  2UXB L;  3SK8 A;  1PH8 A;  2A6H D;  3PCO B;  1JB3 A;  4N8X 1;  2PCF B;  3CCV A;  3SK6 A;  3UDX A;  1TT2 A;  2VY3 A;  1QVG A;  1PTO C;  3S1N B;  3DLL A;  3T51 B;  1II3 A;  2LXJ A;  2DNC A;  3GTJ H;  4DV6 Q;  2NVT B;  3CCS A;  1H9R A;  2EJM A;  2KCN A;  2EYJ A;  4PZ7 A;  4JI5 L;  1Z47 A;  4K8I A;  1HUN A;  4YY3 Q;  1VMC A;  2EOT A;  2G5D A;  2B3G A;  4F8M A;  5C0X G;  2Z6K A;  4NPS A;  1HQM C;  1D1I A;  3PSI A;  1QB5 D;  2PW7 A;  2RCN A;  2MJ8 A;  2ICI A;  4WRD A;  3H3V I;  4OIK A;  1BCP D;  3N52 A;  3U9O A;  3VR2 A;  3K7U C;  3J81 L;  4PMB A;  3E3X A;  2B2T A;  4FXD A;  3J7Z C;  3VA7 A;  5IY0 A;  4EGV A;  1C8C A;  1SMX A;  1EY8 A;  2B2V C;  3VYR A;  1FGB D;  4JI1 Q;  5JJK A;  1K0S A;  5CC4 A;  5D3D A;  1TWC H;  1I50 B;  4B3M L;  5ELC A;  3S2H B;  3HOW B;  1QNU A;  3V2T A;  2Z0S A;  2XVS A;  2HQE A;  1PRT F;  4JK1 C;  1X32 A;  4P73 A;  1Z9F A;  2RVL A;  1IBL L;  3K5O A;  3CXC A;  3MZ5 A;  1YJW A;  3E9I A;  4QF4 A;  2V4D A; 
#chains in the Genus database with same CATH homology
 4N9T A;  5JJZ A;  5EQ0 A;  4RKB A;  5E4X A;  2EY1 A;  2I46 A;  2PZU A;  3J80 L;  4MIU A;  1ZKO A;  3GTK B;  4A3E B;  2F3V A;  3KK7 A;  2M9V A;  1ENF A;  1WTW A;  2D62 A;  1PTO B;  4K5W A;  3K6O A;  4HCS A;  2Z4I A;  1Q1E A;  1LTA D;  1DXM A;  2BE5 C;  1I4R A;  4IUR A;  3PO3 B;  1FNV A;  1STA A;  3KLS X;  4QB4 A;  2AWO A;  3E6Z X;  1IYV A;  5BN5 A;  1FNW A;  1MSH A;  4RHR A;  4K5V A;  4TKO B;  2F0M A;  2DY7 A;  2RBM A;  5EPJ A;  2FMM A;  4IZ8 A;  1Q3L A;  1TS3 A;  2E74 C;  4CBV A;  1SXT A;  3HG9 A;  3C46 A;  1EIG A;  1EQT A;  3NTK A;  1SNC A;  5IT9 L;  1ENC A;  1IKM A;  1CZG A;  1Z6H A;  1BQQ T;  1JWM D;  4RWS C;  3MXN A;  4IFD J;  3ITP A;  2A68 C;  3VA5 A;  2JYO A;  2L12 A;  5FO9 B;  4DU9 A;  1OXT A;  1GHJ A;  5JAV A;  3EA6 A;  2AUK A;  5EBD A;  4A3K B;  2KHS A;  4KY5 A;  4XDX A;  4DAV A;  3SR1 A;  2JEA I;  3T16 A;  5EKI A;  2VB3 X;  4E6I A;  1ICW A;  5M5X B;  1O7L A;  3X3M A;  4RAU C;  2K04 A;  3AB9 A;  3OMG A;  3HEJ A;  1M8A A;  5DEH A;  1V8Q A;  1CA6 A;  3MAQ A;  5M9O A;  5C5M A;  5AFW A;  3FPU B;  2WB1 B;  1F9S A;  1S4Z A;  1Q12 A;  3PUV A;  4XQN A;  3NSW A;  1I4H A;  4HCE A;  3BS1 A;  1O78 A;  3M85 A;  4V19 0;  2BCO A;  4OO1 I;  2X69 A;  4RCO A;  2A6E C;  1J8I A;  1B53 A;  1HA6 A;  4MHE A;  1PZJ D;  4ID6 A;  3DM1 A;  4FXK C;  3PUZ A;  1EYC A;  5CV7 A;  1IW7 C;  5IGC A;  4C2M B;  5FLX L;  5FKA C;  3CRL C;  3DEO A;  1W6K A;  3CHB D;  3S17 B;  3TP8 A;  1EU3 A;  4EQP A;  1A6X A;  4K6L A;  1ILQ A;  2B8F A;  4DGZ A;  2GA4 B;  1OO9 B;  2FJ2 A;  5C0X I;  4Z9C B;  5IOD A;  1BR9 A;  4FVM A;  2F1M A;  3I72 A;  2KQ3 A;  1JR0 D;  3TZD A;  1CI3 M;  3S14 B;  4ILW A;  1SFO B;  1TWA B;  3J80 E;  2EYP A;  1SYD A;  1CM9 A;  1E0B A;  1HCZ A;  1K8O A;  4NW2 A;  2D5D A;  5FOB B;  1VMP A;  2HDL A;  4TRD A;  1Y1V B;  3R8B A;  3NQT A;  3DWA A;  3NWT A;  1DOM A;  3NXW A;  5JEA H;  2B2W A;  1OXU A;  2J7Z A;  5COR A;  1FR3 A;  3T4A C;  1SSO A;  4KK7 A;  4ZKC B;  1PFM A;  1SYC A;  4RCN A;  1BOS A;  4FP5 D;  2JE6 I;  3OWF A;  4KN4 C;  2AUJ D;  2NVY B;  3QG1 A;  4LJZ C;  5C6A A;  1EWC A;  5C4Z A;  2Z8L A;  2E76 C;  4R8N A;  3S1M B;  2G9H D;  4KHV A;  3GV6 A;  1F2Z A;  4XT3 B;  4C3I G;  1H9S B;  1FNU A;  2FFK B;  3RMH A;  1V43 A;  4DK1 A;  3P75 A;  3K5N A;  2X6L A;  1VCI A;  1DJR D;  5CV9 A;  4DXG A;  5ELF A;  3G6J B;  2B63 B;  5FK9 C;  5KGU A;  4P2C B;  3NE5 B;  4Y7N B;  1GHK A;  1ROD A;  1CQV A;  2A69 D;  1EFI D;  1BCP B;  1QG7 A;  1Y8P B;  4I7Z C;  5EBC A;  5DM6 3;  2SEB D;  3OMC A;  5IOC A;  3Q23 A;  3O13 A;  1KNA A;  2D2C C;  4LAA A;  4S3S A;  1D5M C;  4H44 C;  1RDP D;  3IFD A;  4PNY A;  4RA8 A;  2DY8 A;  1A3V A;  2K6A A;  2F0J A;  5I4D A;  1GUO A;  2EY6 A;  2NYZ D;  5C3E B;  4R9W A;  1STB A;  4O1N A;  3L3O C;  1SNO A;  5I6Y A;  3TSS A;  3FDT A;  3RZO B;  2L11 A;  2ID0 A;  5LL6 X;  2JP1 A;  2O4X A;  2WAQ B;  2E2J B;  1QOH A;  2Z4H A;  4IUQ A;  3MXP A;  5JVG 3;  1TQO A;  2LFN A;  1BBX C;  1VF7 A;  2XNA C;  2CW0 D;  2RKS A;  4C3H G;  4R8I A;  1GXD C;  3NBI A;  3FVQ A;  1PRT D;  4U67 3;  3GTM B;  3D6W A;  1QCB D;  3LX0 A;  2FIN B;  3GD7 A;  1C4Q A;  2A73 B;  1JC7 A;  3SHL A;  1TY0 A;  2OT2 A;  1A15 A;  3R2T A;  2CHB D;  3TP5 A;  3ERO A;  3HOX B;  1RTO A;  3KF8 A;  2O2L D;  4IQZ A;  1G6Z A;  4WOR A;  3K58 A;  4CJ2 C;  4L63 B;  5LL6 S;  5KIX A;  1SND A;  4X3K A;  3MTS A;  2F0V A;  1EWH A;  2NTT A;  1JQY D;  2F0N A;  2WKC A;  3SVM A;  1HRJ A;  5CBA E;  3VYS A;  3J7Y W;  2JA5 B;  1STN A;  1Y8N B;  2IX3 A;  4IUU A;  3KLS A;  1XYI A;  3WOF A;  1EY0 A;  3H0G B;  2KUM A;  4ZK9 B;  5IGB A;  4IFD G;  2BDN A;  4KKT A;  4O42 A;  4ODG A;  2ICE C;  1NR2 A;  2F0Q A;  3C3L A;  2RQX A;  1PMR A;  4HR7 B;  5I9P A;  1ENA A;  5E1F A;  2B2U C;  4J8Q A;  1TWC B;  3RD4 A;  1NAP A;  5EGT A;  3M7N A;  2B2V A;  4HAE A;  4RHS A;  4XQQ A;  5I2Y A;  4HED A;  1TVX A;  4KN7 C;  3DUZ A;  3MFG A;  3HZX A;  1HTL D;  2NWG A;  5HUR A;  3ND8 A;  2IPK D;  5KRU A;  3OHX C;  1XWE A;  4WJW A;  2BDO A;  1IHZ A;  1B9N A;  4RH6 A;  5FO7 B;  4EQN A;  2L0C A;  3A7A B;  3WDN A;  1DON A;  1HXY D;  2F3W A;  4A3J B;  2IW3 A;  1STG A;  1WVL A;  1NUC A;  1BO0 A;  3M3Y B;  1WTQ A;  4FXG C;  5EPL A;  4QIW B;  4OO1 H;  2EJF C;  1GJX A;  4CGY B;  1W6J A;  2F03 A;  2E2I B;  3FEW X;  2R61 A;  3W2D A;  2TMP A;  3HS0 C;  4FF3 A;  2EYH A;  4EQO A;  4ABN A;  4DXF A;  1JWU D;  1EQV A;  2VUM B;  3LWU A;  1CQF A;  2ZXR A;  2DNE A;  3D4W A;  3NWS A;  4Q0F A;  3CKI B;  1U9R A;  2Q8T A;  1QWY A;  1RJT A;  5IGD A;  2B8G A;  1CFM A;  1OXX K;  4K2K A;  5DAU A;  3DXJ C;  3S16 B;  2F0F A;  5C0X H;  4ZUJ A;  5A2Q L;  5KND A;  2R7Z B;  1ESF A;  1D5Z C;  2QKI C;  4MN3 A;  4K8J A;  3SE0 A;  3OPO A;  1SJE D;  2QIL A;  2A69 C;  1HUM A;  2IT1 A;  1WTP A;  1K83 B;  3PV0 A;  2IX0 A;  1OXS C;  4A3M B;  4DNT B;  2O5I C;  2YYZ A;  1LAB A;  2EE1 A;  3D31 A;  5F2D A;  2G9D A;  1IKL A;  4PQX A;  2F0U A;  3GP7 A;  1D6E C;  1MD2 D;  2F0H A;  2NVQ B;  5J39 A;  1TII D;  5IIF A;  1C48 A;  1DOL A;  1BDO A;  2VNU D;  4XQJ A;  1G91 A;  1RTN A;  4KJN A;  2J4X A;  4M1U B;  2PW5 A;  3S2D B;  4A3G B;  3KBX A;  3IAY A;  1E2V A;  3D4R A;  1O80 A;  2Z1C A;  4KI0 A;  4XT1 B;  2ZT9 C;  2X6G A;  4NP5 A;  3J7A V;  4XIG S;  5J22 A;  2M00 A;  4G4K A;  1V1P B;  3BG3 A;  4LMQ D;  3NUC A;  5CV6 A;  3TP6 A;  1WCM B;  1XXG A;  5BN4 A;  2TSS A;  3PIO 3;  2SDF A;  4G7Z C;  1V1O A;  4KKS A;  2BA1 A;  3D3R A;  3BDL A;  4X3S A;  3M4O B;  3H6M A;  1PYW D;  1PDQ A;  3Q0A A;  3A8J E;  4IFD I;  4RGT A;  3K7A B;  4HN7 A;  1WTO A;  1NR4 A;  2F0W A;  1JCK B;  2FHT A;  1SNQ A;  2L9H A;  1SAP A;  3RLF A;  3Q6S A;  5IGE A;  1AZP A;  5KYI A;  1HFG A;  5KYL A;  2PZW A;  1SE2 A;  5C4X B;  4DA2 A;  3OW7 A;  3G7L A;  2WP8 J;  2ZXP A;  2CVR A;  2K1B A;  3TDQ A;  4ZKB B;  1LAC A;  1PRT B;  1YNN C;  4DAY A;  1Q8I A;  3HOZ B;  1ESR A;  3T13 A;  1JIC A;  2SOB A;  3OOC A;  2A6H C;  4ZLT F;  5CV4 A;  1K8M A;  1EY7 A;  4C56 C;  3NBH A;  2K32 A;  2K33 A;  4RKL A;  5IGG A;  3V96 A;  4FYD A;  2IWH A;  4IN3 A;  4IUT A;  1LTI D;  2EY5 A;  2ENB A;  3GTL B;  2FMC A;  3ND9 A;  4KMU C;  2R92 B;  3HRZ C;  4FF1 A;  4DNR B;  1S5B D;  1LTR D;  2NN6 G;  3LWE A;  5C4H A;  3A8K E;  1EZ8 A;  1HFN A;  5A2Q E;  1BCP C;  2IX1 A;  3DMU A;  1TY2 A;  2QEJ C;  1Y8O B;  1SE3 A;  2QDB A;  4C1N K;  4DFA A;  3A56 A;  1SNP A;  3E0J A;  3S1Q B;  1GUG A;  1B44 D;  2IJ0 A;  1I4P A;  4C3J B;  2C5C A;  4BA1 I;  1EY9 A;  3FRP B;  3QIA A;  2LMC B;  4A3D B;  1B1Z A;  4KV6 A;  2LS0 1;  3BDO A;  3DHQ A;  2K5D A;  5ELB A;  4KKU A;  4DK0 A;  1OXV A;  4IUV A;  2VB2 X;  3I70 A;  1PZK D;  2KCC A;  2SNS A;  1BUV T;  4CKE A;  5C4J B;  1A2T A;  3SK5 A;  1EY5 A;  3W3A A;  1TS4 A;  1BXT A;  1X3Q A;  1ZEQ X;  1SEB D;  2NTS A;  1D2B A;  3AU7 A;  3HOU B;  2F0T A;  4AYB B;  2K5Q A;  2XSC A;  2R3Z A;  3HP3 A;  1EY6 A;  1CHQ D;  3HOV B;  4KJO A;  5K36 H;  4OIJ A;  2BE5 D;  4RFB A;  2B2Y A;  5I9O A;  3L7Z C;  3C1E A;  3GO5 A;  1LLR D;  3P7J A;  2L1B A;  3A55 A;  2L5T A;  4NDX A;  5M5W B;  1XX8 A;  4F88 A;  3TME A;  3VYU A;  2OEO A;  3NQI A;  3PIP 3;  3NK9 A;  3NP8 A;  4FF2 A;  3HOY B;  2R6G A;  1G8Z D;  1LO5 D;  2KJX A;  4CKC A;  3H91 A;  5JEA J;  4ZYS A;  4HSP A;  2EYM A;  3TP7 A;  3GV3 A;  2M2L A;  4M8A A;  4ZRZ A;  3IL8 A;  3T53 B;  4OHJ A;  5LHY 1;  3FMC A;  2KVM A;  3OSO A;  4N9P A;  2QCP X;  3E5S A;  1PTO F;  2BOS A;  4U68 A;  3KLR A;  1WD0 A;  1TKW B;  2QF7 A;  3D8G A;  1RF2 D;  3S9W A;  1JOO A;  2RDH A;  3JAM E;  2PNR C;  1SDF A;  1U4P A;  2YU9 B;  1D5X C;  4OL7 A;  4DN4 M;  1WTR A;  3VR6 A;  3PUW A;  1STY A;  3VYT A;  4CKB A;  4B9X A;  1XTC D;  3EJI A;  2B2U A;  1PZI D;  4YIJ A;  1B9M A;  1ZXT A;  3R2I A;  4PMW A;  1B50 A;  4XXE A;  1SNM A;  4Q5V A;  5CV8 A;  4NKL A;  2JXM B;  1CZW A;  4TQU S;  1QIL A;  1Z7T A;  1LTT D;  1KAB A;  1PFB A;  5D65 A;  2PPB C;  5CMD A;  3MVV A;  2I07 B;  3QB3 A;  1VF5 C;  4DAP A;  2ZXO A;  3I4N B;  5T1I A;  5C3X A;  2LY7 A;  1ML0 D;  2PO4 A;  5A35 A;  5T1G A;  1EL0 A;  1SYB A;  1F9P A;  3UI2 A;  2KED A;  4H13 C;  4A3I B;  3BVG A;  1DYQ A;  1KLG D;  1STE A;  5ELD A;  1HTP A;  2PZT A;  3V05 A;  3VR3 A;  4KY6 A;  3R3O A;  4BY1 B;  2NN6 I;  3U9S A;  3D4D A;  3L9A X;  3I73 A;  1H9K A;  4F87 A;  2IL8 A;  1TWH B;  3K57 A;  4JBW A;  1A2U A;  4KY7 A;  5KEE A;  1TS5 A;  2L4N A;  3Q24 A;  1D1K A;  1TR5 A;  3I4L A;  1JOR A;  3VR5 A;  2EYO A;  1SMY D;  4KD3 A;  4ZQ3 A;  2AQ1 B;  1KDA A;  3GQB A;  5FO8 B;  1RD9 D;  1V1P A;  4K6D A;  4IFD H;  4I65 A;  1UUP A;  3IKJ A;  5I2X A;  1B2T A;  5EJW A;  3SXH A;  1UAP A;  5CV5 A;  5I6W A;  4RGO S;  5CGK A;  3CQZ B;  1J9O A;  2XWJ B;  1B3A A;  3OWE B;  5D14 A;  2XRS D;  1JOK A;  1U4L A;  5ISR A;  5E3F A;  2A74 C;  2B39 A;  1RHP A;  2RDF A;  5JPM C;  1CK1 A;  1L0X B;  3ERQ A;  5EKK A;  4K5X A;  4G57 A;  1LT4 D;  3ZYY X;  2NZ1 D;  1TWF B;  4J1M A;  5DM7 3;  4BA2 I;  1ZYR D;  1S5E D;  2SNM A;  1NSN S;  3QJY A;  2B2T C;  1HA5 A;  1JE4 A;  4GZY C;  1MBY A;  2RSN A;  5NUC A;  2N55 A;  3D6C A;  2F0K A;  3MWY W;  3SDZ A;  5G3L F;  3TN2 A;  4J6H A;  2K28 A;  3C2P A;  1STH A;  3BZD B;  3URY A;  1CHP D;  1JWS D;  1YNJ D;  1TU2 B;  5TSS A;  5J1Z A;  4EVO A;  2EZV A;  2JSO A;  1S5F D;  3A54 A;  1SYG A;  2JA8 B;  4X3T A;  4ZAI A;  1EEF D;  2F0G A;  3TZU A;  1X3P A;  3QWN A;  1UEA B;  1KLU D;  1ET9 A;  3NTI A;  1PTO H;  1I4G A;  2HCI A;  4KTA A;  2CW0 C;  2OF1 A;  1DZ1 A;  5JPN C;  4IAL A;  2A5H A;  2JA7 B;  3A7L A;  1PRT C;  1SYE A;  4BBS B;  5KNB A;  1MSG A;  4G7H C;  4PMC A;  3K5L A;  2E2D C;  5K5P A;  5EKL A;  2D9U A;  2KEC A;  1GUN A;  1WTX A;  3I8Z A;  2HCC A;  1NCV A;  3T56 B;  1CT1 D;  1QNK A;  4L6T B;  1I6V C;  1ILP A;  1PFN A;  4QUC A;  2MGS A;  3I90 A;  4IUP A;  4IUN A;  4HMI A;  1BCP F;  2CQA A;  5C0X J;  1HHV A;  2C9O A;  1FYC A;  4FNF A;  2PYK A;  4UDU C;  1FD7 D;  3I3C A;  3MFY A;  1F9Q A;  3H09 A;  3GTP B;  1EIH A;  3AMU A;  1LT3 D;  2K03 A;  2AQ3 B;  3F2U A;  1H9S A;  1LV9 A;  4RGM A;  1U4M A;  3CRK C;  4A3B B;  3PUX A;  1PXU A;  5E4W C;  3H94 A;  3J7A F;  5CR3 A;  1DD2 A;  3HGB A;  2K7V A;  4XTC S;  1LT6 D;  2MPM A;  4H7B A;  3NPP A;  4LK1 C;  3RZD B;  1BF4 A;  1GUW A;  3JAM L;  3KBG A;  2PMZ B;  5JEA G;  1AEX A;  3K5M A;  3DWP A;  2WAC A;  3R93 A;  5CYU A;  3EVQ A;  2L55 A;  1DCZ A;  2WII B;  3PO2 B;  4K2L A;  2F0I A;  2PQE A;  3J81 E;  3H3V C;  2Y0S B;  5IGF A;  2R93 B;  1EYA A;  1Q1B A;  2NVX B;  1DM0 B;  1AW7 A;  1B4O A;  4BBR B;  1S5D D;  2BA0 A;  2VXW A;  4OGQ C;  1PTO D;  3DWQ A;  1I6H B;  4KHZ A;  1G2T A;  3BDC A;  5JOB A;  4TSS A;  2O5J C;  4QUF A;  3N6R A;  1MGS A;  1SMY C;  1G2S A;  1RCV D;  4H0L C;  3K59 A;  4QCL A;  2NB0 A;  3MXG A;  3NTH A;  3S15 B;  4L8J A;  5K36 G;  1AN8 A;  1GOZ A;  2KEE A;  3C1F A;  4C3J G;  3QOJ A;  3BYY B;  2F0E A;  1UNS A;  2F0P A;  4CHT B;  4G7O C;  3MHB A;  3OIQ A;  4PV1 C;  1ONL A;  1A3T A;  3WOE A;  1F9R A;  5HGT A;  3PUY A;  1KTK A;  4FF4 A;  4FO2 A;  2JA6 B;  2E75 C;  4C1N I;  2JEB I;  3DEP A;  1SBB B;  2LKV A;  2NBF A;  4HTH A;  1KDC A;  4BWG B;  1U4R A;  3EFX D;  5IT9 E;  3PMF A;  1Y69 U;  1LT5 D;  3VR4 A;  3HKZ B;  1I3Q B;  5CBE E;  4B08 A;  4ULL A;  1H9J A;  2XN9 C;  1IL8 A;  5DNF A;  4C3I B;  1ET6 A;  1R9T B;  2NN6 H;  1ZYR C;  2RSO A;  4A3F B;  2B2W C;  2H1E A;  3BVM A;  3BVZ A;  2N88 A;  4XYQ A;  3I4M B;  4BS9 A;  1L0Y B;  1I4Q A;  3A8I E;  1F2Y A;  3X3N A;  1I4X A;  2WIN B;  1PLF A;  2Q8I B;  2XIW A;  2EDG A;  5EPK A;  1Q90 A;  3MEH A;  1IYU A;  2NUC A;  3P20 A;  1CTM A;  3P1H A;  3QOL A;  2K5W A;  2MP1 A;  2F0O A;  3FPP A;  1YNJ C;  2EY2 A;  2F0D A;  3ONA B;  3CU7 A;  3MA2 B;  2AQ2 B;  5JVH 3;  2F4I A;  1CA5 A;  1T5E A;  3MXU A;  4V0B A;  1HQR D;  3KUP A;  2A68 D;  1SYF A;  3MC0 B;  2RDG A;  1RKN A;  1LTS D;  1AZQ A;  1KDB A;  4QMG A;  3GTO B;  2WV6 D;  2WKD A;  3S1R B;  2KA7 A;  5C44 B;  1O7Z A;  5C5L A;  2E2H B;  1VDZ A;  1GUS A;  3QO2 A;  4C3H B;  2Q8R E;  2B2Y C;  2J0T D;  1QJO A;  3I91 A;  1EYD A;  5COY A;  4HSV A;  1EU4 A;  3K0Y A;  2EPB A;  1G29 1;  1TS2 A;  2RA4 A;  5FLX E;  1AP0 A;  1F77 A;  1WD1 A;  4B9W A;  3FKI B;  4K14 A;  2KOL A;  4A93 B;  2K05 A;  2EYL A;  5M3M B;  4CJ0 B;  1KAA A;  1F2L A;  1QE6 A;  4DF7 A;  2DN8 A;  5M5Y B;  4WFN 3;  1MI2 A;  2MHV A;  3SK4 A;  2XRQ D;  2HUG A;  1A3U A;  1T5X D;  3M7G A;  2OXP A;  1SE4 A;  1WTV A;  1LTG D;  1H9M A;  1TWG B;  4BY7 B;  5KNC A;  1M4V A;  1R4P B;  2EJG C;  4F7X A;  1HPC A;  5D3I B;  5BN3 A;  2K01 A;  3LNN A;  1KNE A;  1Y1W B;  2A6E D;  3IFT A;  5G3L D;  2H4O A;  1R4Q B;  1GUT A;  3GTJ B;  5C3W A;  4RGN A;  1E2W A;  1IW7 D;  4KD4 A;  4X3U A;  3Q22 A;  2EVB A;  1BNZ A;  2XWB B;  1AFP A;  2EYF A;  4UAI A;  3NHH A;  5M3F B;  1EEI D;  2AWN A;  4CJ1 B;  2MUY A;  1F2M A;  1O7Y A;  3TBI B;  1S5C D;  4XYO A;  1EOT A;  4ME5 A;  3EQL C;  4OO1 G;  4ZUI A;  1DOK A;  5ELE A;  2EXZ A;  1JOQ A;  1E2Z A;  3GTG B;  3GTQ B;  4HMJ A;  1EZ6 A;  3OIP A;  3SEB A;  1SJH D;  2F0L A;  4NMZ A;  1YNN D;  3BYT B;  1EY4 A;  2F0S A;  2HDM A;  1LTB D;  3RUZ A;  3M4Y A;  3SK8 A;  2A6H D;  1JB3 A;  2PCF B;  3SK6 A;  1TT2 A;  1PTO C;  3S1N B;  3T51 B;  1II3 A;  2DNC A;  2NVT B;  1H9R A;  2EJM A;  2KCN A;  2EYJ A;  1Z47 A;  4K8I A;  1HUN A;  1VMC A;  2EOT A;  4F8M A;  5C0X G;  1HQM C;  1D1I A;  1QB5 D;  2PW7 A;  2MJ8 A;  2ICI A;  4WRD A;  4OIK A;  1BCP D;  3N52 A;  3U9O A;  3VR2 A;  3J81 L;  4PMB A;  2B2T A;  4FXD A;  3VA7 A;  4EGV A;  1C8C A;  1EY8 A;  2B2V C;  3VYR A;  1FGB D;  5CC4 A;  5D3D A;  3S2H B;  1I50 B;  5ELC A;  3HOW B;  1QNU A;  3V2T A;  2XVS A;  2HQE A;  1PRT F;  4JK1 C;  1X32 A;  2RVL A;  3K5O A;  3MZ5 A;  4QF4 A;  2V4D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...