4JI6L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLLGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 12
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji6L00
1S72A 5JEAJ 1Z47A 2YU9H 1Q46A 1NMFA 4JG2A 2PNHA 2K5NA 4A3IG 1N36Q 2UXCQ 1L1OA 1RIPA 4A3LH 5AJ3Q 4JI1L 4JBWA 3RZOH 1X3GA 3MXNB 3HFZB 4DR6Q 1S3OA 1I94Q 2JQOA 4A3EG 4LF6L 4DV5Q 2WAQG 3KOJA 4KI0A 4Y52H 1MKHA 1JJCB 3ULJA 2FXQA 2JJQA 2UUAQ 4JI0L 2VNUD 4ME3A 1XMQL 4JCVE 1CKMA 4GLAC 2VY3A 5K36G 1VQ8A 2QEXA 2UXDQ 5M5WH 4O2DA 3PUXA 5C0XG 5C44H 1SFOH 1HH2P 2NN6G 4EX5A 1Q1EA 2UXBQ 1XNQQ 3RLNA 4A3FH 2B29A 3GTPH 4A3MH 3S1MH 3S1NH 3S2DH 2N49A 4DK6C 2EXDA 4GN5A 3HOYH 1L2FA 3K81C 4B3TL 1MIUA 3L0OA 5GROA 1XMOL 1HZAA 4C3JH 4BY1H 2DGYA 2PMZE 4X64L 3HOXG 4OX9Q 3CCVA 1EWIA 4JYAQ 1IBKL 1G6PA 3CW2C 1Y1WH 5LMNW 4GLVB 4BY7H 1DGSA 2RHQB 2NVYH 1Y1VG 1SRUA 3PIOA 3FKIG 3GTJH 2R93H 3K0XA 4WJ3M 2IT1A 1PH4A 1E3PA 5HY6A 4QL5A 4YWMA 2ASBA 1KXLA 3EN2A 1PH8A 1NBWA 5E7NA 4IPDA 4R4IA 3E0EA 4GN4B 4OO1I 2GVBA 1SLJA 1LUZA 1NMGA 4DAYB 2KCTA 1A0IA 5ELOA 4JI6L 2V1CC 4DV1L 2OWOA 1UEBA 1X55A 3SGIA 4LFBQ 5IY0A 1VQKA 2MFIA 3CCJA 1VQ9A 4HJ7A 4DR3Q 1N32L 1LTLA 4HIMA 5JEAG 1VQ6A 3TREA 4HJ8A 4A3CG 1X3FA 4BBRH 1YITA 1WI5A 4OWXB 1E1TA 2UUBQ 3J81j 5IYDG 4L5RC 3HOUG 5JJLA 4DR4Q 1AH9A 1E7ZA 1BVSA 1VQIA 3TS0A 1VQNA 2E2IH 2YV5A 2BH2A 4KHPQ 2RHSB 4DPGA 2GVAA 3CAMA 3W1BA 5C3EG 2HIVA 2VQEQ 3LGJA 1N33L 1W2BA 4DV2L 4GKKQ 1EOVA 1V9PA 4FDBA 3CXCA 3RN2A 2I5MX 2K4KA 1VCIA 4LF4L 3A5UA 3CCRA 4NXML 4LF9Q 4DR2Q 4OONA 3UE0A 4B3SQ 3K7AH 4BXXH 1HNXQ 1I5FA 5M3FG 5DLQE 3UDFA 4X62L 5FJ8G 2E2HH 4RG1A 4UPAA 3CP0A 4B3RL 4A76A 1P8LA 1K0RA 1CKOA 3EIVA 4AYBG 4A3IH 4POFA 1TWAH 2D0PA 1B70B 3PSIA 3OTOQ 2F4VL 1HZCA 4R4OA 4BBSH 1C7YA 2MO0A 1KD1C 2KCMA 4QGUA 2MO1A 5FLXc 5IP7G 1HR0Q 4A3EH 1QUQA 1VQ4A 3PUVA 4L5SA 4K0KQ 5IT9c 2QGQA 4X65Q 1WYDA 3K80C 3GTGH 2D62A 4LFAQ 3UDIA 3ICEA 4JOIC 1PH7A 1Z9FA 1V43A 1WCMH 1K83H 2LSSA 2I5LX 2K50A 1VQEA 4DR5L 3K7UC 3G48A 1PH6A 4X66L 3OYYA 5IWAQ 4A3JH 4JI7Q 2H5XA 2R92H 4HJAA 1E24A 4GKJQ 4PZ8A 2Q2TA 4POGA 4JI8Q 3I2ZA 3RLFA 4OO1G 4YWLA 4DR1Q 3PO3G 2OTJA 4DV7Q 2K75A 2R7DA 1MJEA 4B3ML 2UUCQ 2ZJQA 2EQSA 1VQPA 2YTXA 1HNZL 2OQKA 3I4OA 2HHHL 4MNOA 1M1KC 1R9TH 1TWHH 1MJCA 4DUZL 3DLLA 1QZHA 4NXNQ 1D8LA 3B6YA 3JC66 4XTCS 3HOXH 3PF5A 1YJWA 2NVXH 1FJGQ 1IL2A 1VQFA 1JJGA 5FLMG 1OXVA 2AMCB 4YCUA 1TWCH 2EIFA 3ULLA 2UXCL 5GAHC 3M4PA 1N36L 2A8VA 1VQDA 2R6GA 4DNIA 2N8NA 3GTLH 3OW2A 2LXKA 1A8VA 5AJ3L 1E1OA 1AE2A 1QZGA 1UE7A 2B63H 3A74A 1CKNB 2Z6KA 2R7ZG 3PO2G 2AHOB 3HKZG 4DR6L 1I94L 3Q8DA 4YWKA 3I4MG 4DV5L 4OWWB 3JAMc 1J5EQ 4JV5Q 5M5YH 2ZJPA 4QJFA 4C2MH 4P73A 2UUAL 2KENA 2DUDA 2N78A 2PI2E 1EFWA 3AFQA 3NBHB 4IPGA 1G291 2ZJRA 1VQ7A 1GVPA 3MEFA 1Y14B 4A3CH 1PFSA 1L1OC 2Y0SG 3J80c 2UXDL 1GD7A 5IYDH 1YBYA 1GKHA 3D0FA 2UXBL 3PF4A 1XPUA 2JA8G 4GLXA 1XNQL 1PH1A 1Q12A 4DV3Q 3DM3A 5IYCH 1OXSC 3PIPA 1CKNA 2ATWA 4R4QA 1BKBA 3RNUA 3S1QH 1Q82C 4LF8Q 2VQFQ 3F2CA 1U5KA 5C3EH 3M9BA 1YHAA 4HIDA 1HZBA 3IRBA 4DR7Q 3E9IA 3KF6B 3STBD 1Q8KA 1TXYA 4JI4Q 4LF5Q 4DR7L 4DAMA 2JK8A 2RF4A 4GNXB 4IOAA 2OTLA 1IZ6A 2E8GA 1PYSB 2NZHA 1A63A 4AQYQ 4DV6Q 4HIKA 2KHJA 1KIXA 4OX9L 4JYAL 4DV4Q 3HOVH 1A62A 1SN8A 5FJ8H 2HQLA 3PV0A 4TVAB 2ZM6Q 3J7A5 1IBLQ 2BH8A 1JE5A 3M3YH 1KRSA 1Q1BA 4QY7A 2JA6G 4A3GH 1UWVA 3AEVA 1QVFA 2ZM6L 1IXRA 4PG3A 3HOZG 2ID0A 4P71A 3L2PA 2ALYB 1P16A 3KF6A 1QVCA 3HKSA 4HJ5A 3CMEA 3NENA 3A0JA 3I55A 4JI5Q 2K5HA 2JE6I 3CMAA 4LFBL 4GNXA 1W3SA 3T1YQ 3D31A 4JBJA 3ERSX 4JI5L 5IP9G 4DR3L 3GTOH 3F2DA 3ULPA 2UUBL 3ZJYC 1YIJA 4LUZA 2ZTCA 3CC4A 2JA7H 3STBC 2NVQH 4DR4L 1IYJB 4APVA 3HOWG 4A93H 3G6EA 2YTYA 2PQAA 3JAMi 4JBKA 4KHPL 1VQGA 1EUJA 1OTCA 1K3RA 1Q7YC 1QUQB 2F3IA 2UU9Q 2VQEL 4C3IH 3PUZA 4MTNA 4YHHQ 3CCEA 1X65A 5IYBH 3J80i 3FP9A 2BA0A 3CF5A 3H0GH 2QA4A 4ALPA 2IY5B 3L7ZC 3AQQA 4YHHL 4YCVA 1YNXA 2MNAA 4DR2L 4B3SL 4LF9L 4LUOA 1GM5A 2Z0SA 1BBUA 1YHBA 1PVOA 1HNXL 3RN5A 5FLMH 1X6OA 2Q2IA 2Q2HA 4H02A 4UP7A 4GOPB 3AYHB 3T1HQ 2WAQE 3CPWA 2IX0A 1PH5A 1L0WA 2IX1A 3OTOL 5LMNQ 2VL6A 1TWGH 4AIMA 1N8RC 2R7ZH 3J7ZC 4X6AH 1ASZA 4LUVA 3CC2A 5M5XH 1VQBA 1HR0L 3I4MH 3H3VH 3KFUA 4K0KL 3K8AA 4X65L 3I7FA 1WOCA 4NPSA 3FHWA 4L5QA 2F52A 3NELA 4LFAL 4GS3A 4PZ7A 3I4NG 2K52A 5C0XJ 4YY3Q 1SMXA 2K14A 2NN6I 2NVTH 1IBMQ 4GOPA 1EYGA 3GD7A 3GTKH 2VW9A 1Q81C 1JT8A 2CQOA 5M3MG 5IWAL 1U0LA 1YI2A 1XPRA 2E5LQ 4JI7L 4QQBX 4LF7Q 2JEBI 3CD6A 4GKJL 2CKZB 2CWAA 4JI8L 1T9HA 4LFCQ 2VUMG 4DR1L 3BZCA 5IE8A 4UP8A 1FGUA 1KC8C 3ER0A 4DV7L 1WFQA 4IFDJ 3U4VA 3M85A 3BJUA 4BBRG 4IFDI 2UUCL 1LM0A 2WB1E 1UE6A 1JB7A 4BA1I 1YHQA 1NY4A 3RZDH 4OWTB 2ES2A 2JA5G 1CUKA 4KLKA 2L15A 2OCEA 5JJIA 2B3GA 4NXNL 1FJGL 1BBWA 1HNWQ 1Y1VH 3CCUA 4JI2Q 2ZTDA 3FKIH 1YZ6A 4R4TA 5BR8Q 4JBMA 3S16H 3BZKA 4EQ5A 4DK3C 4IPHA 4DV0Q 2JA6H 1N34Q 3S14H 2IHEA 1YVCA 3HOZH 1VQLA 3WWVA 1XTDA 3CCLA 4MZ9A 1NJIC 2WP8J 2WFWA 3CQZH 4P75A 3PUWA 4BXXG 4IJLA 5HGQA 1UE5A 1EQRA 1I50H 1J5EL 3GDEA 1VS0A 4JV5L 5GADC 3H15A 4NB3A 1VQCA 4JI1Q 4JI3Q 3F8TA 5C4XG 2N3SA 3HOUH 1KQSA 5IP9H 4BBSG 1OXTA 4JI3L 4LF6Q 1E22A 1KHIA 4A3DG 3W1GA 1QVGA 2D0OA 3S15H 2Z6KC 3RLOA 4J15A 2AWOA 4JI0Q 4LNQA 1S40A 3CCQA 1J6QA 4DV3L 1XMQQ 3HOWH 4GKKL 1PH2A 4XIGS 4LF8L 4PZ6A 4TQUS 2VQFL 1WCMG 1K73C 2VS1A 1SROA 1PA6A 3PUYA 1UE1A 1CSPA 3W5OA 3J81c 3UE1A 4A3JG 1EQQA 4JI4L 4LF5L 4AYBE 2R92G 5H1SE 1VQ5A 2PI2A 1SR3A 5M3FH 1EIYB 4A3BG 2YYZA 4AQYL 4AH6A 4DV6L 1K8GA 2OQ0A 1CSQA 4DV4L 1N9WA 5EAYA 4R4CA 4B3TQ 2KHIA 1SE8A 1XMOQ 4A3KG 1IBLL 3TS2A 2PQAB 4X64Q 2I0QA 4IFDG 4BA2I 5GAEC 1LYLA 1RL2A 5IP7H 1IBKQ 1VQHA 1AE3A 1OXUA 3PGZA 1PHJA 1NE3A 1G51A 2WB1G 3CCMA 2HIXA 3U58A 4DUYQ 4A3LG 3GO5A 3S2HH 4IOCA 1HR0W 3KJOA 2XTIA 1M90C 3T1YL 3PCOB 3U50C 4DUYL 3GTQH 3I4NH 1WJJA 2B63G 3GTMH 2E2JH 1B7YB 3M4QA 1Q86C 4JI6Q 4PMWA 4DV1Q 5J3BA 3U4ZA 2AKWB 4IO9A 3KF8B 5M3MH 3CCSA 3PO3H 2CFMA 2KBNA 1ASYA 1N32Q 2VUMH 3RR5A 5JJKA 4L5TA 4P72A 1X54A 1XPOA 1HJPA 4IPCA 5C44G 2UU9L 4GNXC 2YTVA 4QIWE 3G4SA 4OXPA 1X9NA 1O7IA 2AWNA 4A3FG 2XGTA 3S1RH 1K9MC 4A3MG 2A19A 3KLWA 5LMUL 2JA5H 1KRTA 5IYCG 2GN5A 5ELNA 3HOYG 1N33Q 2R7FA 1YJNA 4DV2Q 3NEMA 4LF4Q 3CPFA 4DKAC 3T1HL 3HKZE 3TRZA 5GAGC 2C35B 1K8AC 3EBEA 4NXMQ 1X56A 2VZAA 4BY1G 4LW1A 3TQYA 3F2BA 2RCNA 5LMNL 3PO2H 1H95A 3BU2A 3H3VI 4HJ9A 3J81i 1Y1WG 4X62Q 1KL9A 4BY7G 4JOIA 4B3RQ 3KYHC 2R93G 3S24A 1PH3A 3VDYA 3HOVG 2Y0SE 4IJHA 1FVIA 5C0XI 4WJ4A 3F1ZA 2F4VQ 2NZOA 1JJ2A 2BA1A 1VQMA 4GN3B 4A3GG 4RMFA 5C4XH 3UDGA 1C9OA 4YY3L 2HT1A 1VQOA 4LWCA 2IHFA 2CWPA 3KDFB 4A3DH 3AFPA 5C4JH 1IBML 2JA8H 3I56A 3E9HA 4KHZA 3UDXA 3CC7A 5LMUQ 2E5LL 4LF7L 2JEAI 3M7NA 1TWFH 2Q2UA 4LFCL 1OXXK 1KAWA 3G71A 1EIFA 1FL0A 1X3EA 5GQOA 1V1QA 4R1JA 1PYBA 4UP9A 4Y7NH 4DR5Q 2K5VA 1I6HH 1B8AA 1VQJA 4X66Q 1D7QA 2I5HA 1PH9A 2CCZA 1C0AA 2LXJA 2JA7G 1JMCA 3M4OH 1XNRQ 1L1OB 4O0AA 4UY8C 4C3HH 1GO3E 3S17H 4GOPC 1I3QH 2JA9A 2MQHA 2ZTEA 4YCWA 1PV4A 4A93G 4A3BH 3KDFA 3KJPA 4B3MQ 1XNRL 1HNWL 1XJVA 5BR8L 1YJ9A 4JI2L 4A75A 1HNZQ 1VQAA 2HHHQ 1NTGA 1HZ9A 4JC0A 3A5ZB 4A3KH 4DUZQ 4DV0L 4P74A 4A4IA 5IYBG 2A1AA 1N34L 3H0GG 4HIOA 1YEZA 3TEHB
chains in the Genus database with same CATH superfamily
3HS0C 2K32A 4RFBA 1Q46A 2UXCQ 2ICEC 1M4VA 1BF4A 4PQXA 3C46A 4JI1L 3KBGA 1WD0A 4A3MB 2DN8A 1WTQA 3S2DB 4DV5Q 2WAQG 1NCVA 4KY7A 5IGFA 4Y52H 1MKHA 1JJCB 3U9SA 2JJQA 2VNUD 1R4QB 4ZCKA 4ME3A 1CKMA 3EVQA 1VQ8A 4B9XA 2UXDQ 5M5WH 3PUXA 5DEHA 1AN8A 2R93B 3GTPH 1WTOA 1RJTA 3M3YB 3S1NH 2EXDA 4GN5A 3K81C 3NTKA 1XMOL 1H9SB 1HZAA 2K6AA 4BY1H 1STEA 4X64L 2PMZE 1JQYD 1PRTF 4JW0A 4OX9Q 4JYAQ 1Y1WH 2EY1A 5LMNW 2RHQB 1TT2A 1Y1VG 3SK6A 1PH4A 1E3PA 5HY6A 4QL5A 1KXLA 1PH8A 3TSSA 4IPDA 4R4IA 4GN4B 1GUOA 3TDQA 1SLJA 1HHVA 4DAYB 2MPMA 5ELOA 1TY2A 1JWMD 1H9SA 4RAUC 4LFBQ 2K03A 2RSNA 1S5DD 2OF1A 5IY0A 1NSNS 1PDQA 3TREA 4QUFA 1D1IA 4HJ8A 4A3CG 1WI5A 1E1TA 1LTBD 4XYOA 3VR4A 3TS0A 4DNRB 2F3WA 3U9OA 1CK1A 5HURA 1VQNA 2R61A 2CH4W 4QIWB 3R3OA 2BH2A 4KHPQ 2RHSB 3P20A 1SNPA 1DCZA 4DAYA 2QF7A 1STYA 1B44D 4DV2L 1V9PA 4EGVA 3CXCA 3RN2A 2WAQB 3CCRA 1PZID 4LF9Q 2V4DA 4Q5VA 1I5FA 2FFKB 3PMFA 1HNXQ 4X62L 1K83B 2BOSA 3CP0A 3FMCA 3FRPB 2D0PA 2PW5A 2EYJA 1HZCA 4R4OA 4BBSH 4ZKBB 2IJ0A 5FOBB 2LY7A 4A3EH 3E6ZX 3PUVA 4L5SA 1E0BA 5IT9c 3I4LA 3UDIA 4LFAQ 3ICEA 1EQVA 4E6IA 1Q3LA 1Z9FA 4N9TA 4DR5L 2C9OA 3G48A 4X66L 5C0XH 4JI7Q 2H5XA 1K28A 1TWCB 2KECA 4HJAA 4PZ8A 1Y1VB 3A55A 3OMCA 2OTJA 1SNQA 2K75A 5CV4A 3FPPA 4N8FA 2UUCQ 4PMBA 3MFGA 2ZJQA 2EQSA 3S14B 2SNSA 4U673 2OQKA 4B08A 1M1KC 3OPOA 3H09A 4BWGB 5M5YB 4NXNQ 4CDFC 3DEPA 5C4HA 1YJWA 2NVXH 1VQFA 2K5DA 1PZJD 4YCUA 1N36L 5A2QL 2R6GA 3GTLH 2N8NA 1WD1A 3OW2A 2LXKA 1A8VA 1AE2A 3S15B 1D1KA 1UE7A 3QWNA 1KDCA 4IQZA 1DJRD 2EYPA 1HQMC 4OWWB 2ZJPA 4X3TA 2UUAL 2DUDA 4IPGA 3ITPA 4RHRA 3NPPA 1VQ7A 5IT9E 1YBYA 2L4NA 1G2TA 2UXBL 4C56C 2WV6D 4GLXA 1XNQL 4DV3Q 3DM3A 2XN9C 4DFAA 1BKBA 3RNUA 3VA5A 1PRTB 5C3EH 3KF6B 2FINB 1VMCA 1IZ6A 4M1UB 4S3SA 4DV6Q 2KHJA 1SN8A 1A3UA 5FJ8H 2EY5A 3M3YH 3KBXA 3TMEA 2O4XA 1ILPA 1TY0A 4NDXA 4HN7A 4P71A 1K8OA 1TU2B 3KF6A 1TS5A 3EJIA 3A0JA 3I55A 1D6EC 2AUJD 1WVLA 4ABNA 5IGGA 1CZWA 3S1RB 2O5IC 2Z8LA 3BG3A 3A8JE 1IYJB 3M4YA 2PQAA 5FO8B 5CC4A 1VQGA 1EUJA 3NTHA 2A68C 4HSPA 1CHQD 3VYTA 5KYLA 3I8ZA 2BE5D 3EROA 2BA0A 4ALPA 2AQ2B 1CFMA 4K5VA 1BR9A 1PFBA 4LUOA 1SNCA 1LV9A 1X6OA 4DU9A 4DF7A 4ZK9B 1IYVA 1PH5A 1BDOA 1NUCA 1L0WA 2HD3A 3OTOL 4C1NI 4C3JG 4AIMA 1N8RC 2R7ZH 4OELB 1ASZA 5NUCA 4LUVA 2PZWA 3M7GA 3KFUA 1GHKA 3K8AA 4X65L 3VR2A 4Y7NB 3FHWA 4L5QA 2F52A 3NELA 4FXDA 4PZ7A 5CV8A 4I65A 2NN6I 2PCFB 1C4QA 4IUUA 3FEWX 1EYGA 1MBYA 2CQOA 5IWAL 4QQBX 1U0LA 3P1HA 1YI2A 3E0JA 4GKJL 2CWAA 3NTIA 2VUMG 4BBRG 1S5CD 1T5EA 3C1EA 1DD2A 2JA5G 1CUKA 4ZYSA 1BBWA 4CKBA 1Y1VH 2ZTDA 1D5ZC 1LTRD 4EQ5A 4DK3C 1HXYD 1TQOA 2A73B 5A35A 3S14H 4OHJA 3HOZH 3AB9A 1VQLA 3D4WA 2WFWA 5I4DA 4JVZA 5HGQA 1UE5A 1I50H 2Z1CA 1LTSD 2QW7A 4JV5L 3H15A 4NB3A 3FPUB 4JI3Q 5E4WC 5C44B 1BQQT 1OXTA 4LF6Q 5EJWA 3W1GA 1QVGA 3S15H 3S1MB 1CQVA 3QB3A 1YNJC 3HOWH 1PH2A 4C3JB 3DHQA 4P2CB 2VQFL 3HEJA 3NUCA 1K73C 3URYA 1SROA 1PA6A 3Q23A 3UE1A 4A3JG 4C3HG 1EQQA 4LF5L 2R92G 4BY7B 1VQ5A 2NVYB 3A8KE 2NYZD 2B2UA 2OQ0A 1LTGD 4U68A 1N9WA 4B3TQ 4K6DA 3QR8A 1IBLL 5IODA 5C3WA 5JJZA 1IBKQ 1CZGA 1VQHA 5AFWA 1CA6A 3P75A 3PGZA 1NE3A 1G51A 3I70A 4X3UA 3D4DA 3GO5A 3QJYA 4BBRB 1H9KA 5I2YA 3KJOA 1HR0W 3PCOB 3U50C 4EQOA 1LLRD 2JA5B 4G7OC 2B63G 1B7YB 1Q86C 3DXJC 2J4XA 3J80E 3KF8B 5M3MH 3CCSA 1PRTC 2JN4A 4P72A 2UU9L 5DAUA 2MJ8A 2RDFA 4OXPA 1FNVA 1O7IA 2AWNA 4NW2A 4Z9CB 3S1RH 1K9MC 1C8CA 3E5SA 2A19A 3KLWA 4ZQ3A 5IYCG 1Z7TA 2E2DC 2GN5A 3SDZA 2R7FA 1S4ZA 1YJNA 1X3QA 4FF1A 1ZKOA 4LF4Q 3KF8A 3HKZE 5C4JB 4XYQA 5KNCA 5E3FA 4BY1G 3T13A 1HQRD 5LMNL 5ELCA 3BU2A 3X3NA 1Y1WG 2MGSA 3KYHC 5M9OA 3MXPA 5C0XI 1JJ2A 1EYDA 4LAAA 4A3GG 4YY3L 4A3JB 2HT1A 1STHA 2R92B 4MN3A 3I56A 1WTRA 2E5LL 2K7VA 1SDFA 2OEOA 1KABA 3G71A 5LMUL 1V1QA 4Y7NH 1PYBA 4UP9A 2AUKA 2A6ED 1R9TB 1D7QA 2BDNA 1VDZA 1H9JA 2JA7G 1JMCA 4KKSA 2ZTEA 4FF2A 4B3MQ 1HNWL 3N6RA 2B63B 2HHHQ 1HZ9A 4JC0A 3A5ZB 4DV0L 2F1MA 5IYBG 1N34L 3H0GG 1XX8A 2D2CC 1S72A 4JG2A 2PNHA 5M5WB 1RIPA 4A3LH 5C3XA 5AJ3Q 4O1NA 1CTMA 1X3GA 2RCFA 3MXNB 4IUQA 3HFZB 4DR6Q 1I94Q 4A3EG 2ZXOA 2DNEA 1SBBB 4DXGA 1STBA 1XMQL 4JCVE 4KY6A 2VY3A 2ENBA 3BYTB 2QEXA 4H13C 2M9VA 1EU3A 2KOLA 5C0XG 1SFOH 5C44H 1HH2P 2SDFA 2RVLA 4ID6A 1F9PA 3AU7A 3SK5A 4KJNA 2QILA 3MXNA 3S1MH 3KUPA 1SNMA 4DK6C 4A3GB 3HOYH 1GJXA 4UDUC 4F88A 4F87A 1LACA 1MIUA 2EYHA 1DOKA 4C3JH 4DGZA 1SYBA 1WTXA 3CCVA 1G6PA 3CW2C 3MFYA 1GUTA 4GLVB 4BY7H 1DGSA 2KEEA 2NVYH 5LHY1 3PIOA 4ILWA 2F0NA 4WJ3M 2HQEA 5CORA 2DY7A 4OL7A 2B2UC 5E7NA 2JA7B 4OO1I 4J1MA 3G7LA 1LUZA 1NMGA 2F0UA 1A0IA 4K14A 4JI6L 2V1CC 2OWOA 3NK9A 2MFIA 5CGKA 1VQ9A 4DR3Q 1N32L 4HIMA 2QCPX 1GUGA 1X3FA 4BBRH 5LL6X 3HOUG 3SEBA 1ONLA 3H0GB 4QCLA 5EKKA 5CMDA 2K01A 4J8QA 2GVAA 2EYMA 3CAMA 5C3EG 2VQEQ 1N33L 1YNND 2J7ZA 4GKKQ 2L9HA 2I5MX 5CYUA 1VCIA 3A5UA 4NXML 5D3IB 3OIPA 2CH4A 3UDFA 3VYRA 5FJ8G 1P8LA 3IFDA 4POFA 4KN7C 1B70B 1QOHA 1C7YA 2MO0A 2KCMA 3MXGA 4HEDA 4QGUA 2EZVA 5FLXc 5IP7G 3Q6SA 1EIHA 4K0KQ 1VQ4A 2QGQA 3K80C 1BUVT 1V43A 5K36H 2LSSA 1PXUA 2NN6H 2PZTA 3TBIB 4A3JH 2R92H 3BVGA 4JI8Q 4OO1G 4YWLA 3PO3G 2RA4A 4H7BA 2R7DA 1MJEA 3A7LA 5COYA 1VQPA 3TZDA 1R9TH 3CQZB 4KTAA 2WKDA 1QZHA 4G57A 1G8ZD 2Q8TA 1D8LA 1FGBD 3JC66 3HOXH 1KNEA 1FJGQ 1AP0A 1DYQA 4IN3A 1OXVA 2EIFA 3HOUB 2A8VA 2X69A 3I3CA 1GUWA 1WTPA 1E1OA 2A6HD 2L11A 4ZLTF 2B63H 2R7ZG 3A74A 2Z6KA 1B50A 3PO2G 1PTOD 3Q8DA 1GXDC 1RKNA 4IZ8A 2LMCB 1J5EQ 5C3EB 2K28A 2F3VA 2B2TA 1GUNA 2KENA 2HCIA 2PI2E 1RF2D 1EFWA 3AFQA 5FLXE 3DMUA 1G291 4GZYC 3CHBD 1E2VA 1QB5D 1EL0A 1GKHA 1JOKA 1ZYRD 3Q22A 1EU4A 4XXEA 2JA8G 3TP6A 4CKCA 5IYCH 3PIPA 2ATWA 1EY5A 4QF4A 1O7YA 2HDLA 5DNFA 1HZBA 4DR7Q 3OOCA 1Q8KA 1TXYA 4JI4Q 2K04A 4DAMA 2E8GA 5KNDA 2F0JA 1A63A 1KIXA 4IUPA 2XSCA 2A69D 2ZM6Q 3J7A5 2KQ3A 4DK1A 1U4MA 1KRSA 4QY7A 4A3GH 2K5WA 1QWYA 1IXRA 3HOZG 5KEEA 4K5XA 3WOEA 5DM63 2GA4B 3PO3B 4ODGA 1BBXC 1O7LA 3QG1A 3HKSA 2NBFA 3CMEA 1J8IA 3NENA 1JOQA 3CMAA 3OWEB 4IURA 1NR4A 1U9RA 3BS1A 4KJOA 2KVMA 3F2DA 2K5QA 2UUBL 3GQBA 3ZJYC 4LUZA 1HRJA 2JA7H 4DR4L 3NSWA 3DWAA 5I2XA 4K8IA 1SYEA 3HOWG 1HA6A 3JAMi 4IUVA 2R7ZB 3PUZA 3PO2B 3D8GA 4YHHQ 5IYBH 2IY5B 3H0GH 2Z4IA 4CJ2C 4DR2L 4B3SL 1AFPA 1GM5A 2Z0SA 3RN5A 3F2UA 2Q2IA 4GOPB 4V0BA 1F9SA 2WAQE 2IX0A 1HFGA 1MHWC 2C5CA 2IX1A 2X6LA 2G5DA 1TWGH 2JA8B 3Q24A 5D14A 3J7ZC 3J7AV 1HR0L 1VQBA 5CBEE 1KTKA 2G9DA 4TRDA 4KD4A 5I6WA 3I91A 1IBMQ 4GOPA 2BE5C 2VW9A 1I3QB 2F0IA 3GTKH 5M3MG 1FD7D 3L3OC 3IL8A 4H44C 4LF7Q 3SK8A 1EFID 2EOTA 4LFCQ 4DR1L 5K5PA 4UP8A 4KD3A 1KC8C 1X32A 4DV7L 3HOZB 1UUPA 4IFDJ 2F0OA 3BJUA 1JB7A 5IOCA 4BA1I 1I50B 1XTCD 1YHQA 1B9MA 2LFNA 5ELDA 3QOLA 2L15A 2OCEA 5JJIA 3QOJA 2L5TA 1BXTA 4WJWA 4JI2Q 5BR8Q 4JBMA 1BOSA 3KK7A 3RZOB 1A6XA 3T16A 4IPHA 2JA6H 1IW7C 4QUCA 2IHEA 3HOWB 4MZ9A 2K05A 3CQZH 4P75A 4BXXG 2F03A 1EQRA 4TSSA 3D3RA 1EY4A 2F0SA 3GDEA 4LMQD 2F0EA 4JI1Q 3HOUH 5IP9H 1VMPA 4A3FB 4JI3L 1E22A 2D0OA 1PTOF 2Z6KC 1SSOA 2AWOA 2KHSA 3CCQA 5EPJA 3UI2A 3GV3A 4LF8L 1ZEQX 4TQUS 2B2TC 2HCCA 3W5OA 1QILA 1SR3A 1SNOA 1EIYB 2YYZA 1MSHA 4AQYL 1CSQA 4DV4L 2KHIA 1XMOQ 1EYCA 2PQAB 4PV1C 4X64Q 5M3MB 1ICFB 4BA2I 1LYLA 1RL2A 5IP7H 3R2TA 5C4ZA 1AE3A 3TP8A 4XQNA 1B3QA 3BZDB 1RODA 4MTKA 3MC0B 1CA5A 4A3LG 5ISRA 4IOCA 2WACA 1M90C 3T1YL 4CJ1B 2E2IB 3M4QA 2XRSD 1AEXA 3U4ZA 2ICIA 4XQQA 4OO1H 4IO9A 3PO3H 2H4OA 4QMGA 1ASYA 2QKIC 4WFN3 3RR5A 1O7ZA 5JJKA 1X54A 5C44G 3G4SA 2XGTA 2E2HB 3IFTA 3HOYG 2I07B 1TWAB 4NMZA 2JSOA 4CDCC 4DV2Q 1JOOA 3NEMA 3CPFA 3T1HL 1QCBD 2RBMA 5CBAE 1JE4A 1X56A 1RD9D 2VZAA 4LW1A 3F2BA 4V190 3PO2H 1LTAD 2A5HA 4X62Q 3CRLC 1KL9A 3GTGB 4BY7G 3OMGA 1EZ6A 2PZUA 3HOVG 3VDYA 1IW7D 1NR2A 4IJHA 5A2QE 4FO2A 1CI3M 1SE3A 3F1ZA 4WJ4A 2NZOA 2AQ3B 4GN3B 5C4XH 3UDGA 1C9OA 4RGOS 2IHFA 4MHEA 2JA8H 4I7AA 3E9HA 3CC7A 3CKIB 2EVBA 1Y69U 5CR3A 3NQIA 3J80L 1S5ED 1OXXK 1KAWA 4XDXA 4R1JA 4DR5Q 3ONAB 1TWHB 1SYDA 2EYOA 1D5MC 4X66Q 2I5HA 2LXJA 3OSOA 1XNRQ 1L1OB 1GO3E 4GOPC 1I3QH 2JA9A 2MQHA 4NKLA 4A3BH 2L12A 1XJVA 1YJ9A 2BCOA 1PFNA 5BN4A 4P74A 4CBVA 3L9AX 3TEHB 4C2MB 5JEAJ 1Z47A 1NMFA 1N36Q 2K5NA 1SFOB 1L1OA 5I9PA 1QG7A 4UAIA 1PTOB 3K5MA 4JBWA 3RZOH 2O5JC 4JK1C 1S3OA 2A6EC 2JQOA 2JP1A 4G7ZC 3KOJA 3HOYB 2IPKD 2KCCA 4RHSA 4TKOB 2UUAQ 4JI0L 2FMCA 1II3A 2ZT9C 1KNAA 3WDNA 5HGTA 5K36G 1QE6A 4O2DA 3V05A 2RDGA 2NN6G 1I4XA 4EX5A 2UXBQ 1XNQQ 1STAA 3BVMA 5JVG3 4A3FH 4HAEA 4ZRZA 4DXFA 3HOVB 5J1ZA 2F0WA 1L2FA 3L0OA 1B3AA 1PFMA 2DGYA 3ND9A 3HOXG 4HTHA 2CHBD 3MEHA 4M8AA 2QDLA 1SRUA 3FKIG 2IT1A 5C5LA 1I4PA 2ASBA 2KCNA 1NBWA 4K5WA 1SMYD 3NBIA 5IIFA 1QNUA 3K5LA 4DV1L 4FP5D 1UEBA 1X55A 5D3DA 1SYCA 1VQKA 1ESRA 3CCJA 4C3IB 2M00A 1LTLA 1VQ6A 2NTSA 2F0TA 1YITA 4OWXB 3J81j 1A2TA 3SE0A 1BVSA 1VQIA 3K59A 2E2IH 2Z6BA 4F7XA 2HIVA 1W2BA 3VYSA 1EOVA 3AMUA 4FDBA 2K4KA 4YIJA 2E74C 4R9WA 3HKZB 3NWSA 4OONA 1GHJA 3OWFA 4BXXH 3K5OA 2E2HH 5DLQE 4B3RL 4UPAA 3HRZC 5T1IA 4DN4M 4A76A 2WINB 4AYBG 1I4RA 4A3IH 1TWAH 3PSIA 2XWBB 3OTOQ 4G4KA 3JAML 2F4VL 1KD1C 1RDPD 2WKCA 4RWSC 2MO1A 3NXWA 1QUQA 4X65Q 2FJ2A 3GTGH 3VYUA 5L37A 4B9WA 2D9UA 2K50A 1IKMA 3HOXB 3HG9A 4N8X1 1YNNC 5J22A 1TR5A 5IWAQ 2P5ZX 3O13A 1E24A 4GKJQ 2Q2TA 3NWTA 3I2ZA 3FKIB 3RLFA 3S16B 4DK0A 4EVOA 1ENFA 2OT2A 3J81L 2YTXA 3HZXA 1VF5C 1HNZL 3I4OA 1TWHH 1E2ZA 1ET9A 1MJCA 4DUZL 4MIUA 3DLLA 1EYAA 4XTCS 3PF5A 5JOBA 1IL2A 1JJGA 2UXCL 1VQDA 2Z4HA 4DNIA 4CGYB 3BDOA 1QZGA 1CKNB 4ZUJA 2AHOB 1HA5A 3EFXD 1B2TA 4DV5L 1EOTA 1Y8OB 3JAMc 4JV5Q 2K1BA 4QJFA 4C2MH 3NBHB 3SR1A 2DY8A 2ZXRA 2ZJRA 1GVPA 3MEFA 3MHBA 1PFSA 1L1OC 2Y0SG 1PTOH 3S9WA 2UXDL 5IYDH 3KLSA 1BCPD 1JR0D 3FDTA 5JAVA 4ZUIA 1Q12A 1XPUA 2H1EA 3SXHA 4AYBB 5J39A 1CKNA 2D5DA 3KLSX 1Q82C 2VQFQ 2NWGA 2RQXA 5EBDA 3F2CA 1YHAA 2MUYA 1F2ZA 3IRBA 3E9IA 3STBD 4LF5Q 4DR7L 3NBHA 4GNXB 2A6HC 2OTLA 3FVQA 4HIKA 4OX9L 4JYAL 3S2HB 3HOVH 1PTOC 2L0CA 4HCSA 1SE4A 4TVAB 1IBLQ 2BH8A 3I4NB 4PMCA 2JA6G 3AEVA 3GTMB 1QVFA 2ZM6L 2PW7A 2B8FA 4PG3A 3I73A 3VR5A 2F0PA 1U4PA 3N52A 2ALYB 1P16A 2XRQD 1QVCA 1ZYRC 3Q0AA 4HJ5A 1EWCA 4JI5Q 4LFBL 4GNXA 1W3SA 2TSSA 4R8IA 4JBJA 5IP9G 1TVXA 1YIJA 2ZTCA 4ZAIA 3CC4A 2AQ1B 2EJFC 2SNMA 3LX0A 1SJHD 1IYUA 2ZXPA 4JBKA 3D6CA 4KHPL 4C1NK 2EYFA 1OTCA 1Q7YC 1WTVA 1TWGB 1FR3A 2UU9Q 1ENCA 2A69C 3A54A 1NNXA 4C3IH 1MGSA 3CCEA 3J80i 3FP9A 3CF5A 2QA4A 3L7ZC 3AQQA 2HDMA 4YCVA 4YHHL 2MNAA 1TS4A 4LF9L 3W2DA 1GUSA 1BBUA 1YHBA 4K2LA 1V1PB 1HNXL 5FLMH 1F2LA 5E4XA 2Q2HA 4H02A 2Y0SB 4UP7A 3H94A 3GTKB 2QEJC 5LMNQ 1EY9A 2E76C 4X6AH 5FO9B 1TWFB 5T1GA 3I4MH 1XWEA 2KA7A 3I7FA 1WOCA 2CVRA 5ELFA 1I6HB 1RHPA 4GS3A 4LFAL 2K52A 5C0XJ 4YY3Q 3K6OA 1V1PA 2OXPA 3ZYYX 3S17B 1JT8A 1XPRA 4JI7L 2E5LQ 2CKZB 5JPMC 1UAPA 1T9HA 3BZCA 2JA6B 1F9RA 1FGUA 3ER0A 1EWHA 1WFQA 1HFNA 1DOLA 4HMJA 1SJED 3U4VA 3M85A 4IFDI 2I46A 2UUCL 2WB1E 1UE6A 2YU9B 4NXNL 1HNWQ 1BO0A 1H9MA 1MD2D 4K2KA 3FKIH 1QNKA 1YZ6A 3S16H 3CRKC 2Z9HA 3OHXC 3A7AB 5EQ0A 4DV0Q 1N34Q 1YVCA 3WWVA 1S5BD 1XTDA 3T51B 3CCLA 1NJIC 2WP8J 3PUWA 1EIGA 4DA2A 5JVH3 1XYIA 4CDDC 4N9PA 1DONA 5C4XG 3VR6A 1U4RA 1I6VC 1HUMA 1KLGD 2XNAC 4BS9A 2K33A 2XVSA 2B8GA 4ME5A 1LT6D 2F0HA 2B2VA 4LNQA 1EY6A 1S40A 1XMQQ 4DV3L 2KUMA 5LL6S 1O80A 5CV9A 3OW7A 1WCMG 3RUZA 2VS1A 4OIJA 1CSPA 2PMZB 1BCPF 5H1SE 2PI2A 4A3BG 3GTJB 4DV6L 1K8GA 3TP5A 4R4CA 2F0DA 2FHTA 2NUCA 1SE8A 1Z6HA 3GV6A 1LT5D 2I0QA 4IFDG 5GAEC 4FF4A 1OXUA 2B2WA 1PHJA 1PYWD 1B4OA 3CCMA 2HIXA 3J7YW 4DUYQ 3S2HH 2CW0D 1B53A 5KIXA 3I4NH 3GTQH 1F2MA 1DM0B 4I7ZC 1WJJA 5IT9L 3GTMH 2E2JH 3SK4A 4L63B 4JI6Q 4PMWA 2AKWB 4F8MA 1HCZA 1WTHA 2CFMA 2KBNA 1N32Q 4XT3B 1RTNA 2L1BA 4GNXC 4QIWE 4KHVA 3K7AB 1X9NA 3T53B 4A3FG 3VA7A 3SVMA 3TN2A 5ELNA 5C4XB 1AZPA 1N33Q 3MTSA 4DKAC 1ICWA 3EBEA 4NXMQ 4L8JA 2G9HD 5FK9C 3H3VI 4HJ9A 3J81i 3BDLA 3V96A 2F0VA 2JXMB 4JOIA 3S24A 5DM73 1UNSA 4K6LA 3PIP3 4UHVA 1WCMB 2LS01 1A3VA 1VQMA 2EYLA 2RSOA 1EZ8A 1H9RA 1VQOA 4LWCA 2CWPA 4A3BB 4A3DH 1C48A 3LNNA 4FNFA 2PPBC 4KHZA 5EBCA 1XXGA 1UEAB 1DXMA 1TWFH 4DAVA 2Q2UA 1ET6A 1PLFA 4RGTA 4X3KA 1I6HH 1VQJA 1PH9A 1C0AA 1EY8A 2N88A 3K58A 3MA2B 4G7HC 3M4OH 1A15A 2VB2X 3S17H 1PV4A 4A93G 3KJPA 1XNRL 1B1ZA 4A75A 1VQAA 4A3KH 1CT1D 1LT3D 4KY5A 1SE2A 4HIOA 2F0GA 1FNWA 3NP8A 2YU9H 4A3IG 5FO7B 1RCVD 3T56B 1KDAA 1F2YA 3EQLC 4EQPA 1ENAA 1U4LA 5I6YA 3DWQA 2F0LA 1L0XB 2MHVA 5JPNC 3NE5B 4LF6L 1K8MA 1HPCA 4KI0A 3S1QB 4DAPA 3ULJA 2FXQA 4KKTA 2NTTA 1I4GA 4GLAC 5CV7A 1ILQA 1BCPB 3VR3A 1IKLA 1Q1EA 3RLNA 1TIID 1CHPD 4HCEA 1LABA 1JB3A 2B29A 4A3MH 1JICA 5EKIA 3S2DH 4FXKC 2N49A 2B2VC 3P7JA 1AZQA 2CQAA 4B3TL 5GROA 3EA6A 1X3PA 4HMIA 5ELBA 1EWIA 4IUNA 1IBKL 5G3LD 4IUTA 1K0SA 1ZXTA 2R93H 3GTJH 2XIWA 3K0XA 4IALA 3RD4A 3GTOB 1WTWA 4YWMA 3EN2A 2NVQB 1A3TA 2PQEA 3E0EA 3GP7A 2GVBA 2MP1A 4A93B 2KCTA 3I90A 3SGIA 4QB4A 2B2WC 4HJ7A 4NP5A 3G6JB 3H6MA 5JEAG 2UUBQ 5JJLA 1E2WA 4L5RC 5IYDG 4DR4Q 1AH9A 1E7ZA 1T5XD 4KMUC 2YV5A 4A3IB 2DNCA 4DPGA 2EY6A 3W1BA 1F9QA 3LGJA 4LF4L 4OGQC 2SEBD 5M5XB 4DR2Q 4B3SQ 3UE0A 1SMYC 3K7AH 5M3FG 1JWUD 1I4QA 3DEOA 4RG1A 1K0RA 1CKOA 3EIVA 2XWJB 2NVTB 4KK7A 1HR0Q 5CV5A 3KLRA 1G91A 1WYDA 5BN3A 2D62A 2KEDA 4JOIC 3T4AC 1PH7A 2EY2A 1WCMH 1K83H 2I5LX 1VQEA 3K7UC 3RZDB 1PH6A 1MSGA 3OYYA 1ML0D 4X3SA 1H95A 4POGA 4DR1Q 3QO2A 2RDHA 4DV7Q 4B3ML 5D65A 4C3IG 4WORA 2HHHL 4MNOA 3V2TA 4IFDH 2FMMA 3R93A 3IAYA 3B6YA 2B2YA 2PYKA 1NAPA 5FLMG 1TS2A 3A8IE 2AMCB 1TWCH 3ULLA 5GAHC 3M4PA 3W3AA 3A56A 3K57A 5AJ3L 1EQTA 1A2UA 3HKZG 4DR6L 2DJGC 2NB0A 4YWKA 2PNRC 2TMPA 3X3MA 4XQJA 1I94L 3I4MG 5M5YH 4R8NA 2KJXA 4P73A 2N78A 1G6ZA 2M2LA 5FKAC 1Q8IA 1Y14B 4A3CH 1HUNA 2F0QA 3J80c 1GD7A 5KYIA 3D0FA 5M3FB 3PF4A 1O78A 1PH1A 1JORA 1I4HA 4K8JA 1OXSC 3S1QH 4R4QA 4LF8Q 2E75C 1U5KA 3M9BA 1LTID 2F0KA 4HIDA 2EJGC 5IGCA 3K5NA 3SHLA 2JK8A 2RF4A 4IOAA 4FYDA 1R4PB 4O42A 1PYSB 2NZHA 3BYYB 4AQYQ 2A68D 5E1FA 4DV4Q 1A62A 1CQFA 2HQLA 3PV0A 1JE5A 2PO4A 4RH6A 5KRUA 1Q1BA 1UWVA 1QJOA 2ID0A 3L2PA 1SYFA 4LJZC 2VUMB 5G3LF 1BCPC 2K5HA 4DNTB 2JE6I 2L55A 3I72A 3T1YQ 3D31A 3ERSX 4JI5L 4DR3L 1M8AA 3GTOH 3ULPA 3STBC 2NVQH 1CM9A 2BDOA 4RKLA 4APVA 4A93H 3G6EA 2YTYA 1EY7A 1K3RA 1QUQB 2F3IA 2VQEL 4MTNA 3LWEA 5CV6A 1JWSD 4GKKL 1X65A 4LK1C 3I4MB 3C1FA 1K3BC 1YNXA 1VF7A 1PVOA 1SEBD 1SXTA 4RCOA 5I9OA 4J6HA 3T1HQ 1MI2A 5KGUA 3AYHB 1FYCA 3H91A 3CPWA 2VL6A 1RTOA 1TS3A 1LTTD 1STGA 4OIKA 3CC2A 5M5XH 3H3VH 4K0KL 1L0YB 1W6JA 4NPSA 2IX3A 3I4NG 2F0MA 1LT4D 1HTPA 2O2LD 1SMXA 2K14A 4HSVA 5KNBA 3MXUA 2IWHA 5TSSA 2NVTH 4C3HB 3GD7A 2RKSA 3MZ5A 1Q81C 1AW7A 2HUGA 2JEBI 3CD6A 2EDGA 4JI8L 2EE1A 5IE8A 3C2PA 1PMRA 4RKBA 2DJFC 4L6TB 3H3VC 1LM0A 2VB3X 1JC7A 3TZUA 1W6KA 1V1OA 1NY4A 1YNJD 4OWTB 3RZDH 2ES2A 1SAPA 4KLKA 4PNYA 2B3GA 1FJGL 4XT1B 1G2SA 1IHZA 3CCUA 1ESFA 4R4TA 3QIAA 3BZKA 3BDCA 3R2IA 3RMHA 2B39A 1DZ1A 4RA8A 1V8QA 1J9OA 4EQNA 4IJLA 1J5EL 1VS0A 2B2YC 5BN5A 5GADC 1D2BA 1VQCA 5JEAH 3F8TA 2N3SA 1KQSA 4BBSG 1KHIA 4A3DG 3GTPB 1KDBA 3RLOA 3S1NB 4J15A 4JI0Q 1LO5D 1J6QA 1DOMA 4XIGS 4PZ6A 1OO9B 1Y8NB 2VXWA 3WOFA 4BY1B 1Y8PB 3PUYA 1UE1A 3HGBA 1S5FD 3CU7A 1BNZA 1SYGA 5C5MA 3J81c 1PRTD 4ZKCB 1Y1WB 4JI4L 4AYBE 3NHHA 1TKWB 5M3FH 2EPBA 4FXGC 4AH6A 3GTQB 3BVZA 3DUZA 5EAYA 2E2JB 4A3KG 3OIQA 4RGMA 5F2DA 3TS2A 3LWUA 1KAAA 4CHTB 3R8BA 3C3LA 3J7AF 2Q8IB 5EPLA 2WB1G 3U58A 2XTIA 5ELEA 3JAME 2SOBA 1EY0A 5FLXL 3D4RA 4KKUA 4DUYL 1PZKD 2JYOA 3MAQA 2LKVA 4DV1Q 5J3BA 4OEMB 4KV6A 4RCNA 2EXZA 2VUMH 4FVMA 4L5TA 1XPOA 1HJPA 4IPCA 2N55A 4RGNA 2IL8A 2NZ1D 2YTVA 2J0TD 5C6AA 1FNUA 4CDEC 1STNA 4A3MG 2JA5H 1KRTA 2IW3A 3K0YA 4Q0FA 1GOZA 3J81E 2Q8RE 4BBSB 3TRZA 5GAGC 4A3DB 2C35B 1K8AC 2CW0C 3NQTA 3TQYA 2F0FA 4A3EB 2RCNA 4H0LC 1JCKB 3PQIA 5EGTA 1D5XC 4CJ0B 4ULLA 3E3XA 3MVVA 4JPBW 4B3RQ 4CKEA 5EPKA 2R93G 1PH3A 2Y0SE 4KN4C 1FVIA 3ND8A 5EKLA 2F4VQ 2BA1A 3M4OB 4RMFA 2EJMA 2R3ZA 3MWYW 3KDFB 4HR7B 3ERQA 3AFPA 5C4JH 1IBML 4FF3A 3UDXA 4WRDA 5LMUQ 4LF7L 2JEAI 4A3KB 3M7NA 5IGEA 4LFCL 3PIO3 3TP7A 1EIFA 1FL0A 1X3EA 2QDBA 5GQOA 2K5VA 1B8AA 2CCZA 2X6GA 1KLUD 2NVXB 5IGDA 1EEFD 2WB1B 4O0AA 4UY8C 4C3HH 3DM1A 3D6WA 5IGBA 1SNDA 3DWPA 4YCWA 2F4IA 3KDFA 3GTLB 2WIIB 5BR8L 2A74C 4JI2L 1HNZQ 1IL8A 1NTGA 4DUZQ 4A4IA 2A1AA 3HP3A 1Q90A 1YEZA 3IKJA 1HTLD 1F77A 1B9NA 1EEID
chains in the Genus database with same CATH topology
1S72A 5JEAJ 1Z47A 2YU9H 1Q46A 1NMFA 4JG2A 2PNHA 2K5NA 4A3IG 1N36Q 2UXCQ 1L1OA 1RIPA 4A3LH 5AJ3Q 4JI1L 4JBWA 3RZOH 1X3GA 3MXNB 3HFZB 4DR6Q 1S3OA 1I94Q 2JQOA 4A3EG 4LF6L 4DV5Q 2WAQG 3KOJA 4KI0A 4Y52H 1MKHA 1JJCB 3ULJA 2FXQA 2JJQA 2UUAQ 4JI0L 2VNUD 4ME3A 1XMQL 4JCVE 1CKMA 4GLAC 2VY3A 5K36G 1VQ8A 2QEXA 2UXDQ 5M5WH 4O2DA 3PUXA 5C0XG 5C44H 1SFOH 1HH2P 2NN6G 4EX5A 1Q1EA 2UXBQ 1XNQQ 3RLNA 4A3FH 2B29A 3GTPH 4A3MH 3S1MH 3S1NH 3S2DH 2N49A 4DK6C 2EXDA 4GN5A 3HOYH 1L2FA 3K81C 4B3TL 1MIUA 3L0OA 5GROA 1XMOL 1HZAA 4C3JH 4BY1H 2DGYA 2PMZE 4X64L 3HOXG 4OX9Q 3CCVA 1EWIA 4JYAQ 1IBKL 1G6PA 3CW2C 1Y1WH 5LMNW 4GLVB 4BY7H 1DGSA 2RHQB 2NVYH 1Y1VG 1SRUA 3PIOA 3FKIG 3GTJH 2R93H 3K0XA 4WJ3M 2IT1A 1PH4A 1E3PA 5HY6A 4QL5A 4YWMA 2ASBA 1KXLA 3EN2A 1PH8A 1NBWA 5E7NA 4IPDA 4R4IA 3E0EA 4GN4B 4OO1I 2GVBA 1SLJA 1LUZA 1NMGA 4DAYB 2KCTA 1A0IA 5ELOA 4JI6L 2V1CC 4DV1L 2OWOA 1UEBA 1X55A 3SGIA 4LFBQ 5IY0A 1VQKA 2MFIA 3CCJA 1VQ9A 4HJ7A 4DR3Q 1N32L 1LTLA 4HIMA 5JEAG 1VQ6A 3TREA 4HJ8A 4A3CG 1X3FA 4BBRH 1YITA 1WI5A 4OWXB 1E1TA 2UUBQ 3J81j 5IYDG 4L5RC 3HOUG 5JJLA 4DR4Q 1AH9A 1E7ZA 1BVSA 1VQIA 3TS0A 1VQNA 2E2IH 2YV5A 2BH2A 4KHPQ 2RHSB 4DPGA 2GVAA 3CAMA 3W1BA 5C3EG 2HIVA 2VQEQ 3LGJA 1N33L 1W2BA 4DV2L 4GKKQ 1EOVA 1V9PA 4FDBA 3CXCA 3RN2A 2I5MX 2K4KA 1VCIA 4LF4L 3A5UA 3CCRA 4NXML 4LF9Q 4DR2Q 4OONA 3UE0A 4B3SQ 3K7AH 4BXXH 1HNXQ 1I5FA 5M3FG 5DLQE 3UDFA 4X62L 5FJ8G 2E2HH 4RG1A 4UPAA 3CP0A 4B3RL 4A76A 1P8LA 1K0RA 1CKOA 3EIVA 4AYBG 4A3IH 4POFA 1TWAH 2D0PA 1B70B 3PSIA 3OTOQ 2F4VL 1HZCA 4R4OA 4BBSH 1C7YA 2MO0A 1KD1C 2KCMA 4QGUA 2MO1A 5FLXc 5IP7G 1HR0Q 4A3EH 1QUQA 1VQ4A 3PUVA 4L5SA 4K0KQ 5IT9c 2QGQA 4X65Q 1WYDA 3K80C 3GTGH 2D62A 4LFAQ 3UDIA 3ICEA 4JOIC 1PH7A 1Z9FA 1V43A 1WCMH 1K83H 2LSSA 2I5LX 2K50A 1VQEA 4DR5L 3K7UC 3G48A 1PH6A 4X66L 3OYYA 5IWAQ 4A3JH 4JI7Q 2H5XA 2R92H 4HJAA 1E24A 4GKJQ 4PZ8A 2Q2TA 4POGA 4JI8Q 3I2ZA 3RLFA 4OO1G 4YWLA 4DR1Q 3PO3G 2OTJA 4DV7Q 2K75A 2R7DA 1MJEA 4B3ML 2UUCQ 2ZJQA 2EQSA 1VQPA 2YTXA 1HNZL 2OQKA 3I4OA 2HHHL 4MNOA 1M1KC 1R9TH 1TWHH 1MJCA 4DUZL 3DLLA 1QZHA 4NXNQ 1D8LA 3B6YA 3JC66 4XTCS 3HOXH 3PF5A 1YJWA 2NVXH 1FJGQ 1IL2A 1VQFA 1JJGA 5FLMG 1OXVA 2AMCB 4YCUA 1TWCH 2EIFA 3ULLA 2UXCL 5GAHC 3M4PA 1N36L 2A8VA 1VQDA 2R6GA 4DNIA 2N8NA 3GTLH 3OW2A 2LXKA 1A8VA 5AJ3L 1E1OA 1AE2A 1QZGA 1UE7A 2B63H 3A74A 1CKNB 2Z6KA 2R7ZG 3PO2G 2AHOB 3HKZG 4DR6L 1I94L 3Q8DA 4YWKA 3I4MG 4DV5L 4OWWB 3JAMc 1J5EQ 4JV5Q 5M5YH 2ZJPA 4QJFA 4C2MH 4P73A 2UUAL 2KENA 2DUDA 2N78A 2PI2E 1EFWA 3AFQA 3NBHB 4IPGA 1G291 2ZJRA 1VQ7A 1GVPA 3MEFA 1Y14B 4A3CH 1PFSA 1L1OC 2Y0SG 3J80c 2UXDL 1GD7A 5IYDH 1YBYA 1GKHA 3D0FA 2UXBL 3PF4A 1XPUA 2JA8G 4GLXA 1XNQL 1PH1A 1Q12A 4DV3Q 3DM3A 5IYCH 1OXSC 3PIPA 1CKNA 2ATWA 4R4QA 1BKBA 3RNUA 3S1QH 1Q82C 4LF8Q 2VQFQ 3F2CA 1U5KA 5C3EH 3M9BA 1YHAA 4HIDA 1HZBA 3IRBA 4DR7Q 3E9IA 3KF6B 3STBD 1Q8KA 1TXYA 4JI4Q 4LF5Q 4DR7L 4DAMA 2JK8A 2RF4A 4GNXB 4IOAA 2OTLA 1IZ6A 2E8GA 1PYSB 2NZHA 1A63A 4AQYQ 4DV6Q 4HIKA 2KHJA 1KIXA 4OX9L 4JYAL 4DV4Q 3HOVH 1A62A 1SN8A 5FJ8H 2HQLA 3PV0A 4TVAB 2ZM6Q 3J7A5 1IBLQ 2BH8A 1JE5A 3M3YH 1KRSA 1Q1BA 4QY7A 2JA6G 4A3GH 1UWVA 3AEVA 1QVFA 2ZM6L 1IXRA 4PG3A 3HOZG 2ID0A 4P71A 3L2PA 2ALYB 1P16A 3KF6A 1QVCA 3HKSA 4HJ5A 3CMEA 3NENA 3A0JA 3I55A 4JI5Q 2K5HA 2JE6I 3CMAA 4LFBL 4GNXA 1W3SA 3T1YQ 3D31A 4JBJA 3ERSX 4JI5L 5IP9G 4DR3L 3GTOH 3F2DA 3ULPA 2UUBL 3ZJYC 1YIJA 4LUZA 2ZTCA 3CC4A 2JA7H 3STBC 2NVQH 4DR4L 1IYJB 4APVA 3HOWG 4A93H 3G6EA 2YTYA 2PQAA 3JAMi 4JBKA 4KHPL 1VQGA 1EUJA 1OTCA 1K3RA 1Q7YC 1QUQB 2F3IA 2UU9Q 2VQEL 4C3IH 3PUZA 4MTNA 4YHHQ 3CCEA 1X65A 5IYBH 3J80i 3FP9A 2BA0A 3CF5A 3H0GH 2QA4A 4ALPA 2IY5B 3L7ZC 3AQQA 4YHHL 4YCVA 1YNXA 2MNAA 4DR2L 4B3SL 4LF9L 4LUOA 1GM5A 2Z0SA 1BBUA 1YHBA 1PVOA 1HNXL 3RN5A 5FLMH 1X6OA 2Q2IA 2Q2HA 4H02A 4UP7A 4GOPB 3AYHB 3T1HQ 2WAQE 3CPWA 2IX0A 1PH5A 1L0WA 2IX1A 3OTOL 5LMNQ 2VL6A 1TWGH 4AIMA 1N8RC 2R7ZH 3J7ZC 4X6AH 1ASZA 4LUVA 3CC2A 5M5XH 1VQBA 1HR0L 3I4MH 3H3VH 3KFUA 4K0KL 3K8AA 4X65L 3I7FA 1WOCA 4NPSA 3FHWA 4L5QA 2F52A 3NELA 4LFAL 4GS3A 4PZ7A 3I4NG 2K52A 5C0XJ 4YY3Q 1SMXA 2K14A 2NN6I 2NVTH 1IBMQ 4GOPA 1EYGA 3GD7A 3GTKH 2VW9A 1Q81C 1JT8A 2CQOA 5M3MG 5IWAL 1U0LA 1YI2A 1XPRA 2E5LQ 4JI7L 4QQBX 4LF7Q 2JEBI 3CD6A 4GKJL 2CKZB 2CWAA 4JI8L 1T9HA 4LFCQ 2VUMG 4DR1L 3BZCA 5IE8A 4UP8A 1FGUA 1KC8C 3ER0A 4DV7L 1WFQA 4IFDJ 3U4VA 3M85A 3BJUA 4BBRG 4IFDI 2UUCL 1LM0A 2WB1E 1UE6A 1JB7A 4BA1I 1YHQA 1NY4A 3RZDH 4OWTB 2ES2A 2JA5G 1CUKA 4KLKA 2L15A 2OCEA 5JJIA 2B3GA 4NXNL 1FJGL 1BBWA 1HNWQ 1Y1VH 3CCUA 4JI2Q 2ZTDA 3FKIH 1YZ6A 4R4TA 5BR8Q 4JBMA 3S16H 3BZKA 4EQ5A 4DK3C 4IPHA 4DV0Q 2JA6H 1N34Q 3S14H 2IHEA 1YVCA 3HOZH 1VQLA 3WWVA 1XTDA 3CCLA 4MZ9A 1NJIC 2WP8J 2WFWA 3CQZH 4P75A 3PUWA 4BXXG 4IJLA 5HGQA 1UE5A 1EQRA 1I50H 1J5EL 3GDEA 1VS0A 4JV5L 5GADC 3H15A 4NB3A 1VQCA 4JI1Q 4JI3Q 3F8TA 5C4XG 2N3SA 3HOUH 1KQSA 5IP9H 4BBSG 1OXTA 4JI3L 4LF6Q 1E22A 1KHIA 4A3DG 3W1GA 1QVGA 2D0OA 3S15H 2Z6KC 3RLOA 4J15A 2AWOA 4JI0Q 4LNQA 1S40A 3CCQA 1J6QA 4DV3L 1XMQQ 3HOWH 4GKKL 1PH2A 4XIGS 4LF8L 4PZ6A 4TQUS 2VQFL 1WCMG 1K73C 2VS1A 1SROA 1PA6A 3PUYA 1UE1A 1CSPA 3W5OA 3J81c 3UE1A 4A3JG 1EQQA 4JI4L 4LF5L 4AYBE 2R92G 5H1SE 1VQ5A 2PI2A 1SR3A 5M3FH 1EIYB 4A3BG 2YYZA 4AQYL 4AH6A 4DV6L 1K8GA 2OQ0A 1CSQA 4DV4L 1N9WA 5EAYA 4R4CA 4B3TQ 2KHIA 1SE8A 1XMOQ 4A3KG 1IBLL 3TS2A 2PQAB 4X64Q 2I0QA 4IFDG 4BA2I 5GAEC 1LYLA 1RL2A 5IP7H 1IBKQ 1VQHA 1AE3A 1OXUA 3PGZA 1PHJA 1NE3A 1G51A 2WB1G 3CCMA 2HIXA 3U58A 4DUYQ 4A3LG 3GO5A 3S2HH 4IOCA 1HR0W 3KJOA 2XTIA 1M90C 3T1YL 3PCOB 3U50C 4DUYL 3GTQH 3I4NH 1WJJA 2B63G 3GTMH 2E2JH 1B7YB 3M4QA 1Q86C 4JI6Q 4PMWA 4DV1Q 5J3BA 3U4ZA 2AKWB 4IO9A 3KF8B 5M3MH 3CCSA 3PO3H 2CFMA 2KBNA 1ASYA 1N32Q 2VUMH 3RR5A 5JJKA 4L5TA 4P72A 1X54A 1XPOA 1HJPA 4IPCA 5C44G 2UU9L 4GNXC 2YTVA 4QIWE 3G4SA 4OXPA 1X9NA 1O7IA 2AWNA 4A3FG 2XGTA 3S1RH 1K9MC 4A3MG 2A19A 3KLWA 5LMUL 2JA5H 1KRTA 5IYCG 2GN5A 5ELNA 3HOYG 1N33Q 2R7FA 1YJNA 4DV2Q 3NEMA 4LF4Q 3CPFA 4DKAC 3T1HL 3HKZE 3TRZA 5GAGC 2C35B 1K8AC 3EBEA 4NXMQ 1X56A 2VZAA 4BY1G 4LW1A 3TQYA 3F2BA 2RCNA 5LMNL 3PO2H 1H95A 3BU2A 3H3VI 4HJ9A 3J81i 1Y1WG 4X62Q 1KL9A 4BY7G 4JOIA 4B3RQ 3KYHC 2R93G 3S24A 1PH3A 3VDYA 3HOVG 2Y0SE 4IJHA 1FVIA 5C0XI 4WJ4A 3F1ZA 2F4VQ 2NZOA 1JJ2A 2BA1A 1VQMA 4GN3B 4A3GG 4RMFA 5C4XH 3UDGA 1C9OA 4YY3L 2HT1A 1VQOA 4LWCA 2IHFA 2CWPA 3KDFB 4A3DH 3AFPA 5C4JH 1IBML 2JA8H 3I56A 3E9HA 4KHZA 3UDXA 3CC7A 5LMUQ 2E5LL 4LF7L 2JEAI 3M7NA 1TWFH 2Q2UA 4LFCL 1OXXK 1KAWA 3G71A 1EIFA 1FL0A 1X3EA 5GQOA 1V1QA 4R1JA 1PYBA 4UP9A 4Y7NH 4DR5Q 2K5VA 1I6HH 1B8AA 1VQJA 4X66Q 1D7QA 2I5HA 1PH9A 2CCZA 1C0AA 2LXJA 2JA7G 1JMCA 3M4OH 1XNRQ 1L1OB 4O0AA 4UY8C 4C3HH 1GO3E 3S17H 4GOPC 1I3QH 2JA9A 2MQHA 2ZTEA 4YCWA 1PV4A 4A93G 4A3BH 3KDFA 3KJPA 4B3MQ 1XNRL 1HNWL 1XJVA 5BR8L 1YJ9A 4JI2L 4A75A 1HNZQ 1VQAA 2HHHQ 1NTGA 1HZ9A 4JC0A 3A5ZB 4A3KH 4DUZQ 4DV0L 4P74A 4A4IA 5IYBG 2A1AA 1N34L 3H0GG 4HIOA 1YEZA 3TEHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S72 A;  5JEA J;  1Z47 A;  2YU9 H;  1Q46 A;  1NMF A;  4JG2 A;  2PNH A;  2K5N A;  4A3I G;  1N36 Q;  2UXC Q;  1L1O A;  1RIP A;  4A3L H;  5AJ3 Q;  4JI1 L;  4JBW A;  3RZO H;  1X3G A;  3MXN B;  3HFZ B;  4DR6 Q;  1S3O A;  1I94 Q;  2JQO A;  4A3E G;  4LF6 L;  4DV5 Q;  2WAQ G;  3KOJ A;  4KI0 A;  4Y52 H;  1MKH A;  1JJC B;  3ULJ A;  2FXQ A;  2JJQ A;  2UUA Q;  4JI0 L;  2VNU D;  4ME3 A;  1XMQ L;  4JCV E;  1CKM A;  4GLA C;  2VY3 A;  5K36 G;  1VQ8 A;  2QEX A;  2UXD Q;  5M5W H;  4O2D A;  3PUX A;  5C0X G;  5C44 H;  1SFO H;  1HH2 P;  2NN6 G;  4EX5 A;  1Q1E A;  2UXB Q;  1XNQ Q;  3RLN A;  4A3F H;  2B29 A;  3GTP H;  4A3M H;  3S1M H;  3S1N H;  3S2D H;  2N49 A;  4DK6 C;  2EXD A;  4GN5 A;  3HOY H;  1L2F A;  3K81 C;  4B3T L;  1MIU A;  3L0O A;  5GRO A;  1XMO L;  1HZA A;  4C3J H;  4BY1 H;  2DGY A;  2PMZ E;  4X64 L;  3HOX G;  4OX9 Q;  3CCV A;  1EWI A;  4JYA Q;  1IBK L;  1G6P A;  3CW2 C;  1Y1W H;  5LMN W;  4GLV B;  4BY7 H;  1DGS A;  2RHQ B;  2NVY H;  1Y1V G;  1SRU A;  3PIO A;  3FKI G;  3GTJ H;  2R93 H;  3K0X A;  4WJ3 M;  2IT1 A;  1PH4 A;  1E3P A;  5HY6 A;  4QL5 A;  4YWM A;  2ASB A;  1KXL A;  3EN2 A;  1PH8 A;  1NBW A;  5E7N A;  4IPD A;  4R4I A;  3E0E A;  4GN4 B;  4OO1 I;  2GVB A;  1SLJ A;  1LUZ A;  1NMG A;  4DAY B;  2KCT A;  1A0I A;  5ELO A;  4JI6 L;  2V1C C;  4DV1 L;  2OWO A;  1UEB A;  1X55 A;  3SGI A;  4LFB Q;  5IY0 A;  1VQK A;  2MFI A;  3CCJ A;  1VQ9 A;  4HJ7 A;  4DR3 Q;  1N32 L;  1LTL A;  4HIM A;  5JEA G;  1VQ6 A;  3TRE A;  4HJ8 A;  4A3C G;  1X3F A;  4BBR H;  1YIT A;  1WI5 A;  4OWX B;  1E1T A;  2UUB Q;  3J81 j;  5IYD G;  4L5R C;  3HOU G;  5JJL A;  4DR4 Q;  1AH9 A;  1E7Z A;  1BVS A;  1VQI A;  3TS0 A;  1VQN A;  2E2I H;  2YV5 A;  2BH2 A;  4KHP Q;  2RHS B;  4DPG A;  2GVA A;  3CAM A;  3W1B A;  5C3E G;  2HIV A;  2VQE Q;  3LGJ A;  1N33 L;  1W2B A;  4DV2 L;  4GKK Q;  1EOV A;  1V9P A;  4FDB A;  3CXC A;  3RN2 A;  2I5M X;  2K4K A;  1VCI A;  4LF4 L;  3A5U A;  3CCR A;  4NXM L;  4LF9 Q;  4DR2 Q;  4OON A;  3UE0 A;  4B3S Q;  3K7A H;  4BXX H;  1HNX Q;  1I5F A;  5M3F G;  5DLQ E;  3UDF A;  4X62 L;  5FJ8 G;  2E2H H;  4RG1 A;  4UPA A;  3CP0 A;  4B3R L;  4A76 A;  1P8L A;  1K0R A;  1CKO A;  3EIV A;  4AYB G;  4A3I H;  4POF A;  1TWA H;  2D0P A;  1B70 B;  3PSI A;  3OTO Q;  2F4V L;  1HZC A;  4R4O A;  4BBS H;  1C7Y A;  2MO0 A;  1KD1 C;  2KCM A;  4QGU A;  2MO1 A;  5FLX c;  5IP7 G;  1HR0 Q;  4A3E H;  1QUQ A;  1VQ4 A;  3PUV A;  4L5S A;  4K0K Q;  5IT9 c;  2QGQ A;  4X65 Q;  1WYD A;  3K80 C;  3GTG H;  2D62 A;  4LFA Q;  3UDI A;  3ICE A;  4JOI C;  1PH7 A;  1Z9F A;  1V43 A;  1WCM H;  1K83 H;  2LSS A;  2I5L X;  2K50 A;  1VQE A;  4DR5 L;  3K7U C;  3G48 A;  1PH6 A;  4X66 L;  3OYY A;  5IWA Q;  4A3J H;  4JI7 Q;  2H5X A;  2R92 H;  4HJA A;  1E24 A;  4GKJ Q;  4PZ8 A;  2Q2T A;  4POG A;  4JI8 Q;  3I2Z A;  3RLF A;  4OO1 G;  4YWL A;  4DR1 Q;  3PO3 G;  2OTJ A;  4DV7 Q;  2K75 A;  2R7D A;  1MJE A;  4B3M L;  2UUC Q;  2ZJQ A;  2EQS A;  1VQP A;  2YTX A;  1HNZ L;  2OQK A;  3I4O A;  2HHH L;  4MNO A;  1M1K C;  1R9T H;  1TWH H;  1MJC A;  4DUZ L;  3DLL A;  1QZH A;  4NXN Q;  1D8L A;  3B6Y A;  3JC6 6;  4XTC S;  3HOX H;  3PF5 A;  1YJW A;  2NVX H;  1FJG Q;  1IL2 A;  1VQF A;  1JJG A;  5FLM G;  1OXV A;  2AMC B;  4YCU A;  1TWC H;  2EIF A;  3ULL A;  2UXC L;  5GAH C;  3M4P A;  1N36 L;  2A8V A;  1VQD A;  2R6G A;  4DNI A;  2N8N A;  3GTL H;  3OW2 A;  2LXK A;  1A8V A;  5AJ3 L;  1E1O A;  1AE2 A;  1QZG A;  1UE7 A;  2B63 H;  3A74 A;  1CKN B;  2Z6K A;  2R7Z G;  3PO2 G;  2AHO B;  3HKZ G;  4DR6 L;  1I94 L;  3Q8D A;  4YWK A;  3I4M G;  4DV5 L;  4OWW B;  3JAM c;  1J5E Q;  4JV5 Q;  5M5Y H;  2ZJP A;  4QJF A;  4C2M H;  4P73 A;  2UUA L;  2KEN A;  2DUD A;  2N78 A;  2PI2 E;  1EFW A;  3AFQ A;  3NBH B;  4IPG A;  1G29 1;  2ZJR A;  1VQ7 A;  1GVP A;  3MEF A;  1Y14 B;  4A3C H;  1PFS A;  1L1O C;  2Y0S G;  3J80 c;  2UXD L;  1GD7 A;  5IYD H;  1YBY A;  1GKH A;  3D0F A;  2UXB L;  3PF4 A;  1XPU A;  2JA8 G;  4GLX A;  1XNQ L;  1PH1 A;  1Q12 A;  4DV3 Q;  3DM3 A;  5IYC H;  1OXS C;  3PIP A;  1CKN A;  2ATW A;  4R4Q A;  1BKB A;  3RNU A;  3S1Q H;  1Q82 C;  4LF8 Q;  2VQF Q;  3F2C A;  1U5K A;  5C3E H;  3M9B A;  1YHA A;  4HID A;  1HZB A;  3IRB A;  4DR7 Q;  3E9I A;  3KF6 B;  3STB D;  1Q8K A;  1TXY A;  4JI4 Q;  4LF5 Q;  4DR7 L;  4DAM A;  2JK8 A;  2RF4 A;  4GNX B;  4IOA A;  2OTL A;  1IZ6 A;  2E8G A;  1PYS B;  2NZH A;  1A63 A;  4AQY Q;  4DV6 Q;  4HIK A;  2KHJ A;  1KIX A;  4OX9 L;  4JYA L;  4DV4 Q;  3HOV H;  1A62 A;  1SN8 A;  5FJ8 H;  2HQL A;  3PV0 A;  4TVA B;  2ZM6 Q;  3J7A 5;  1IBL Q;  2BH8 A;  1JE5 A;  3M3Y H;  1KRS A;  1Q1B A;  4QY7 A;  2JA6 G;  4A3G H;  1UWV A;  3AEV A;  1QVF A;  2ZM6 L;  1IXR A;  4PG3 A;  3HOZ G;  2ID0 A;  4P71 A;  3L2P A;  2ALY B;  1P16 A;  3KF6 A;  1QVC A;  3HKS A;  4HJ5 A;  3CME A;  3NEN A;  3A0J A;  3I55 A;  4JI5 Q;  2K5H A;  2JE6 I;  3CMA A;  4LFB L;  4GNX A;  1W3S A;  3T1Y Q;  3D31 A;  4JBJ A;  3ERS X;  4JI5 L;  5IP9 G;  4DR3 L;  3GTO H;  3F2D A;  3ULP A;  2UUB L;  3ZJY C;  1YIJ A;  4LUZ A;  2ZTC A;  3CC4 A;  2JA7 H;  3STB C;  2NVQ H;  4DR4 L;  1IYJ B;  4APV A;  3HOW G;  4A93 H;  3G6E A;  2YTY A;  2PQA A;  3JAM i;  4JBK A;  4KHP L;  1VQG A;  1EUJ A;  1OTC A;  1K3R A;  1Q7Y C;  1QUQ B;  2F3I A;  2UU9 Q;  2VQE L;  4C3I H;  3PUZ A;  4MTN A;  4YHH Q;  3CCE A;  1X65 A;  5IYB H;  3J80 i;  3FP9 A;  2BA0 A;  3CF5 A;  3H0G H;  2QA4 A;  4ALP A;  2IY5 B;  3L7Z C;  3AQQ A;  4YHH L;  4YCV A;  1YNX A;  2MNA A;  4DR2 L;  4B3S L;  4LF9 L;  4LUO A;  1GM5 A;  2Z0S A;  1BBU A;  1YHB A;  1PVO A;  1HNX L;  3RN5 A;  5FLM H;  1X6O A;  2Q2I A;  2Q2H A;  4H02 A;  4UP7 A;  4GOP B;  3AYH B;  3T1H Q;  2WAQ E;  3CPW A;  2IX0 A;  1PH5 A;  1L0W A;  2IX1 A;  3OTO L;  5LMN Q;  2VL6 A;  1TWG H;  4AIM A;  1N8R C;  2R7Z H;  3J7Z C;  4X6A H;  1ASZ A;  4LUV A;  3CC2 A;  5M5X H;  1VQB A;  1HR0 L;  3I4M H;  3H3V H;  3KFU A;  4K0K L;  3K8A A;  4X65 L;  3I7F A;  1WOC A;  4NPS A;  3FHW A;  4L5Q A;  2F52 A;  3NEL A;  4LFA L;  4GS3 A;  4PZ7 A;  3I4N G;  2K52 A;  5C0X J;  4YY3 Q;  1SMX A;  2K14 A;  2NN6 I;  2NVT H;  1IBM Q;  4GOP A;  1EYG A;  3GD7 A;  3GTK H;  2VW9 A;  1Q81 C;  1JT8 A;  2CQO A;  5M3M G;  5IWA L;  1U0L A;  1YI2 A;  1XPR A;  2E5L Q;  4JI7 L;  4QQB X;  4LF7 Q;  2JEB I;  3CD6 A;  4GKJ L;  2CKZ B;  2CWA A;  4JI8 L;  1T9H A;  4LFC Q;  2VUM G;  4DR1 L;  3BZC A;  5IE8 A;  4UP8 A;  1FGU A;  1KC8 C;  3ER0 A;  4DV7 L;  1WFQ A;  4IFD J;  3U4V A;  3M85 A;  3BJU A;  4BBR G;  4IFD I;  2UUC L;  1LM0 A;  2WB1 E;  1UE6 A;  1JB7 A;  4BA1 I;  1YHQ A;  1NY4 A;  3RZD H;  4OWT B;  2ES2 A;  2JA5 G;  1CUK A;  4KLK A;  2L15 A;  2OCE A;  5JJI A;  2B3G A;  4NXN L;  1FJG L;  1BBW A;  1HNW Q;  1Y1V H;  3CCU A;  4JI2 Q;  2ZTD A;  3FKI H;  1YZ6 A;  4R4T A;  5BR8 Q;  4JBM A;  3S16 H;  3BZK A;  4EQ5 A;  4DK3 C;  4IPH A;  4DV0 Q;  2JA6 H;  1N34 Q;  3S14 H;  2IHE A;  1YVC A;  3HOZ H;  1VQL A;  3WWV A;  1XTD A;  3CCL A;  4MZ9 A;  1NJI C;  2WP8 J;  2WFW A;  3CQZ H;  4P75 A;  3PUW A;  4BXX G;  4IJL A;  5HGQ A;  1UE5 A;  1EQR A;  1I50 H;  1J5E L;  3GDE A;  1VS0 A;  4JV5 L;  5GAD C;  3H15 A;  4NB3 A;  1VQC A;  4JI1 Q;  4JI3 Q;  3F8T A;  5C4X G;  2N3S A;  3HOU H;  1KQS A;  5IP9 H;  4BBS G;  1OXT A;  4JI3 L;  4LF6 Q;  1E22 A;  1KHI A;  4A3D G;  3W1G A;  1QVG A;  2D0O A;  3S15 H;  2Z6K C;  3RLO A;  4J15 A;  2AWO A;  4JI0 Q;  4LNQ A;  1S40 A;  3CCQ A;  1J6Q A;  4DV3 L;  1XMQ Q;  3HOW H;  4GKK L;  1PH2 A;  4XIG S;  4LF8 L;  4PZ6 A;  4TQU S;  2VQF L;  1WCM G;  1K73 C;  2VS1 A;  1SRO A;  1PA6 A;  3PUY A;  1UE1 A;  1CSP A;  3W5O A;  3J81 c;  3UE1 A;  4A3J G;  1EQQ A;  4JI4 L;  4LF5 L;  4AYB E;  2R92 G;  5H1S E;  1VQ5 A;  2PI2 A;  1SR3 A;  5M3F H;  1EIY B;  4A3B G;  2YYZ A;  4AQY L;  4AH6 A;  4DV6 L;  1K8G A;  2OQ0 A;  1CSQ A;  4DV4 L;  1N9W A;  5EAY A;  4R4C A;  4B3T Q;  2KHI A;  1SE8 A;  1XMO Q;  4A3K G;  1IBL L;  3TS2 A;  2PQA B;  4X64 Q;  2I0Q A;  4IFD G;  4BA2 I;  5GAE C;  1LYL A;  1RL2 A;  5IP7 H;  1IBK Q;  1VQH A;  1AE3 A;  1OXU A;  3PGZ A;  1PHJ A;  1NE3 A;  1G51 A;  2WB1 G;  3CCM A;  2HIX A;  3U58 A;  4DUY Q;  4A3L G;  3GO5 A;  3S2H H;  4IOC A;  1HR0 W;  3KJO A;  2XTI A;  1M90 C;  3T1Y L;  3PCO B;  3U50 C;  4DUY L;  3GTQ H;  3I4N H;  1WJJ A;  2B63 G;  3GTM H;  2E2J H;  1B7Y B;  3M4Q A;  1Q86 C;  4JI6 Q;  4PMW A;  4DV1 Q;  5J3B A;  3U4Z A;  2AKW B;  4IO9 A;  3KF8 B;  5M3M H;  3CCS A;  3PO3 H;  2CFM A;  2KBN A;  1ASY A;  1N32 Q;  2VUM H;  3RR5 A;  5JJK A;  4L5T A;  4P72 A;  1X54 A;  1XPO A;  1HJP A;  4IPC A;  5C44 G;  2UU9 L;  4GNX C;  2YTV A;  4QIW E;  3G4S A;  4OXP A;  1X9N A;  1O7I A;  2AWN A;  4A3F G;  2XGT A;  3S1R H;  1K9M C;  4A3M G;  2A19 A;  3KLW A;  5LMU L;  2JA5 H;  1KRT A;  5IYC G;  2GN5 A;  5ELN A;  3HOY G;  1N33 Q;  2R7F A;  1YJN A;  4DV2 Q;  3NEM A;  4LF4 Q;  3CPF A;  4DKA C;  3T1H L;  3HKZ E;  3TRZ A;  5GAG C;  2C35 B;  1K8A C;  3EBE A;  4NXM Q;  1X56 A;  2VZA A;  4BY1 G;  4LW1 A;  3TQY A;  3F2B A;  2RCN A;  5LMN L;  3PO2 H;  1H95 A;  3BU2 A;  3H3V I;  4HJ9 A;  3J81 i;  1Y1W G;  4X62 Q;  1KL9 A;  4BY7 G;  4JOI A;  4B3R Q;  3KYH C;  2R93 G;  3S24 A;  1PH3 A;  3VDY A;  3HOV G;  2Y0S E;  4IJH A;  1FVI A;  5C0X I;  4WJ4 A;  3F1Z A;  2F4V Q;  2NZO A;  1JJ2 A;  2BA1 A;  1VQM A;  4GN3 B;  4A3G G;  4RMF A;  5C4X H;  3UDG A;  1C9O A;  4YY3 L;  2HT1 A;  1VQO A;  4LWC A;  2IHF A;  2CWP A;  3KDF B;  4A3D H;  3AFP A;  5C4J H;  1IBM L;  2JA8 H;  3I56 A;  3E9H A;  4KHZ A;  3UDX A;  3CC7 A;  5LMU Q;  2E5L L;  4LF7 L;  2JEA I;  3M7N A;  1TWF H;  2Q2U A;  4LFC L;  1OXX K;  1KAW A;  3G71 A;  1EIF A;  1FL0 A;  1X3E A;  5GQO A;  1V1Q A;  4R1J A;  1PYB A;  4UP9 A;  4Y7N H;  4DR5 Q;  2K5V A;  1I6H H;  1B8A A;  1VQJ A;  4X66 Q;  1D7Q A;  2I5H A;  1PH9 A;  2CCZ A;  1C0A A;  2LXJ A;  2JA7 G;  1JMC A;  3M4O H;  1XNR Q;  1L1O B;  4O0A A;  4UY8 C;  4C3H H;  1GO3 E;  3S17 H;  4GOP C;  1I3Q H;  2JA9 A;  2MQH A;  2ZTE A;  4YCW A;  1PV4 A;  4A93 G;  4A3B H;  3KDF A;  3KJP A;  4B3M Q;  1XNR L;  1HNW L;  1XJV A;  5BR8 L;  1YJ9 A;  4JI2 L;  4A75 A;  1HNZ Q;  1VQA A;  2HHH Q;  1NTG A;  1HZ9 A;  4JC0 A;  3A5Z B;  4A3K H;  4DUZ Q;  4DV0 L;  4P74 A;  4A4I A;  5IYB G;  2A1A A;  1N34 L;  3H0G G;  4HIO A;  1YEZ A;  3TEH B; 
#chains in the Genus database with same CATH topology
 3HS0 C;  2K32 A;  4RFB A;  1Q46 A;  2UXC Q;  2ICE C;  1M4V A;  1BF4 A;  4PQX A;  3C46 A;  4JI1 L;  3KBG A;  1WD0 A;  4A3M B;  2DN8 A;  1WTQ A;  3S2D B;  4DV5 Q;  2WAQ G;  1NCV A;  4KY7 A;  5IGF A;  4Y52 H;  1MKH A;  1JJC B;  3U9S A;  2JJQ A;  2VNU D;  1R4Q B;  4ZCK A;  4ME3 A;  1CKM A;  3EVQ A;  1VQ8 A;  4B9X A;  2UXD Q;  5M5W H;  3PUX A;  5DEH A;  1AN8 A;  2R93 B;  3GTP H;  1WTO A;  1RJT A;  3M3Y B;  3S1N H;  2EXD A;  4GN5 A;  3K81 C;  3NTK A;  1XMO L;  1H9S B;  1HZA A;  2K6A A;  4BY1 H;  1STE A;  4X64 L;  2PMZ E;  1JQY D;  1PRT F;  4JW0 A;  4OX9 Q;  4JYA Q;  1Y1W H;  2EY1 A;  5LMN W;  2RHQ B;  1TT2 A;  1Y1V G;  3SK6 A;  1PH4 A;  1E3P A;  5HY6 A;  4QL5 A;  1KXL A;  1PH8 A;  3TSS A;  4IPD A;  4R4I A;  4GN4 B;  1GUO A;  3TDQ A;  1SLJ A;  1HHV A;  4DAY B;  2MPM A;  5ELO A;  1TY2 A;  1JWM D;  1H9S A;  4RAU C;  4LFB Q;  2K03 A;  2RSN A;  1S5D D;  2OF1 A;  5IY0 A;  1NSN S;  1PDQ A;  3TRE A;  4QUF A;  1D1I A;  4HJ8 A;  4A3C G;  1WI5 A;  1E1T A;  1LTB D;  4XYO A;  3VR4 A;  3TS0 A;  4DNR B;  2F3W A;  3U9O A;  1CK1 A;  5HUR A;  1VQN A;  2R61 A;  2CH4 W;  4QIW B;  3R3O A;  2BH2 A;  4KHP Q;  2RHS B;  3P20 A;  1SNP A;  1DCZ A;  4DAY A;  2QF7 A;  1STY A;  1B44 D;  4DV2 L;  1V9P A;  4EGV A;  3CXC A;  3RN2 A;  2WAQ B;  3CCR A;  1PZI D;  4LF9 Q;  2V4D A;  4Q5V A;  1I5F A;  2FFK B;  3PMF A;  1HNX Q;  4X62 L;  1K83 B;  2BOS A;  3CP0 A;  3FMC A;  3FRP B;  2D0P A;  2PW5 A;  2EYJ A;  1HZC A;  4R4O A;  4BBS H;  4ZKB B;  2IJ0 A;  5FOB B;  2LY7 A;  4A3E H;  3E6Z X;  3PUV A;  4L5S A;  1E0B A;  5IT9 c;  3I4L A;  3UDI A;  4LFA Q;  3ICE A;  1EQV A;  4E6I A;  1Q3L A;  1Z9F A;  4N9T A;  4DR5 L;  2C9O A;  3G48 A;  4X66 L;  5C0X H;  4JI7 Q;  2H5X A;  1K28 A;  1TWC B;  2KEC A;  4HJA A;  4PZ8 A;  1Y1V B;  3A55 A;  3OMC A;  2OTJ A;  1SNQ A;  2K75 A;  5CV4 A;  3FPP A;  4N8F A;  2UUC Q;  4PMB A;  3MFG A;  2ZJQ A;  2EQS A;  3S14 B;  2SNS A;  4U67 3;  2OQK A;  4B08 A;  1M1K C;  3OPO A;  3H09 A;  4BWG B;  5M5Y B;  4NXN Q;  4CDF C;  3DEP A;  5C4H A;  1YJW A;  2NVX H;  1VQF A;  2K5D A;  1PZJ D;  4YCU A;  1N36 L;  5A2Q L;  2R6G A;  3GTL H;  2N8N A;  1WD1 A;  3OW2 A;  2LXK A;  1A8V A;  1AE2 A;  3S15 B;  1D1K A;  1UE7 A;  3QWN A;  1KDC A;  4IQZ A;  1DJR D;  2EYP A;  1HQM C;  4OWW B;  2ZJP A;  4X3T A;  2UUA L;  2DUD A;  4IPG A;  3ITP A;  4RHR A;  3NPP A;  1VQ7 A;  5IT9 E;  1YBY A;  2L4N A;  1G2T A;  2UXB L;  4C56 C;  2WV6 D;  4GLX A;  1XNQ L;  4DV3 Q;  3DM3 A;  2XN9 C;  4DFA A;  1BKB A;  3RNU A;  3VA5 A;  1PRT B;  5C3E H;  3KF6 B;  2FIN B;  1VMC A;  1IZ6 A;  4M1U B;  4S3S A;  4DV6 Q;  2KHJ A;  1SN8 A;  1A3U A;  5FJ8 H;  2EY5 A;  3M3Y H;  3KBX A;  3TME A;  2O4X A;  1ILP A;  1TY0 A;  4NDX A;  4HN7 A;  4P71 A;  1K8O A;  1TU2 B;  3KF6 A;  1TS5 A;  3EJI A;  3A0J A;  3I55 A;  1D6E C;  2AUJ D;  1WVL A;  4ABN A;  5IGG A;  1CZW A;  3S1R B;  2O5I C;  2Z8L A;  3BG3 A;  3A8J E;  1IYJ B;  3M4Y A;  2PQA A;  5FO8 B;  5CC4 A;  1VQG A;  1EUJ A;  3NTH A;  2A68 C;  4HSP A;  1CHQ D;  3VYT A;  5KYL A;  3I8Z A;  2BE5 D;  3ERO A;  2BA0 A;  4ALP A;  2AQ2 B;  1CFM A;  4K5V A;  1BR9 A;  1PFB A;  4LUO A;  1SNC A;  1LV9 A;  1X6O A;  4DU9 A;  4DF7 A;  4ZK9 B;  1IYV A;  1PH5 A;  1BDO A;  1NUC A;  1L0W A;  2HD3 A;  3OTO L;  4C1N I;  4C3J G;  4AIM A;  1N8R C;  2R7Z H;  4OEL B;  1ASZ A;  5NUC A;  4LUV A;  2PZW A;  3M7G A;  3KFU A;  1GHK A;  3K8A A;  4X65 L;  3VR2 A;  4Y7N B;  3FHW A;  4L5Q A;  2F52 A;  3NEL A;  4FXD A;  4PZ7 A;  5CV8 A;  4I65 A;  2NN6 I;  2PCF B;  1C4Q A;  4IUU A;  3FEW X;  1EYG A;  1MBY A;  2CQO A;  5IWA L;  4QQB X;  1U0L A;  3P1H A;  1YI2 A;  3E0J A;  4GKJ L;  2CWA A;  3NTI A;  2VUM G;  4BBR G;  1S5C D;  1T5E A;  3C1E A;  1DD2 A;  2JA5 G;  1CUK A;  4ZYS A;  1BBW A;  4CKB A;  1Y1V H;  2ZTD A;  1D5Z C;  1LTR D;  4EQ5 A;  4DK3 C;  1HXY D;  1TQO A;  2A73 B;  5A35 A;  3S14 H;  4OHJ A;  3HOZ H;  3AB9 A;  1VQL A;  3D4W A;  2WFW A;  5I4D A;  4JVZ A;  5HGQ A;  1UE5 A;  1I50 H;  2Z1C A;  1LTS D;  2QW7 A;  4JV5 L;  3H15 A;  4NB3 A;  3FPU B;  4JI3 Q;  5E4W C;  5C44 B;  1BQQ T;  1OXT A;  4LF6 Q;  5EJW A;  3W1G A;  1QVG A;  3S15 H;  3S1M B;  1CQV A;  3QB3 A;  1YNJ C;  3HOW H;  1PH2 A;  4C3J B;  3DHQ A;  4P2C B;  2VQF L;  3HEJ A;  3NUC A;  1K73 C;  3URY A;  1SRO A;  1PA6 A;  3Q23 A;  3UE1 A;  4A3J G;  4C3H G;  1EQQ A;  4LF5 L;  2R92 G;  4BY7 B;  1VQ5 A;  2NVY B;  3A8K E;  2NYZ D;  2B2U A;  2OQ0 A;  1LTG D;  4U68 A;  1N9W A;  4B3T Q;  4K6D A;  3QR8 A;  1IBL L;  5IOD A;  5C3W A;  5JJZ A;  1IBK Q;  1CZG A;  1VQH A;  5AFW A;  1CA6 A;  3P75 A;  3PGZ A;  1NE3 A;  1G51 A;  3I70 A;  4X3U A;  3D4D A;  3GO5 A;  3QJY A;  4BBR B;  1H9K A;  5I2Y A;  3KJO A;  1HR0 W;  3PCO B;  3U50 C;  4EQO A;  1LLR D;  2JA5 B;  4G7O C;  2B63 G;  1B7Y B;  1Q86 C;  3DXJ C;  2J4X A;  3J80 E;  3KF8 B;  5M3M H;  3CCS A;  1PRT C;  2JN4 A;  4P72 A;  2UU9 L;  5DAU A;  2MJ8 A;  2RDF A;  4OXP A;  1FNV A;  1O7I A;  2AWN A;  4NW2 A;  4Z9C B;  3S1R H;  1K9M C;  1C8C A;  3E5S A;  2A19 A;  3KLW A;  4ZQ3 A;  5IYC G;  1Z7T A;  2E2D C;  2GN5 A;  3SDZ A;  2R7F A;  1S4Z A;  1YJN A;  1X3Q A;  4FF1 A;  1ZKO A;  4LF4 Q;  3KF8 A;  3HKZ E;  5C4J B;  4XYQ A;  5KNC A;  5E3F A;  4BY1 G;  3T13 A;  1HQR D;  5LMN L;  5ELC A;  3BU2 A;  3X3N A;  1Y1W G;  2MGS A;  3KYH C;  5M9O A;  3MXP A;  5C0X I;  1JJ2 A;  1EYD A;  4LAA A;  4A3G G;  4YY3 L;  4A3J B;  2HT1 A;  1STH A;  2R92 B;  4MN3 A;  3I56 A;  1WTR A;  2E5L L;  2K7V A;  1SDF A;  2OEO A;  1KAB A;  3G71 A;  5LMU L;  1V1Q A;  4Y7N H;  1PYB A;  4UP9 A;  2AUK A;  2A6E D;  1R9T B;  1D7Q A;  2BDN A;  1VDZ A;  1H9J A;  2JA7 G;  1JMC A;  4KKS A;  2ZTE A;  4FF2 A;  4B3M Q;  1HNW L;  3N6R A;  2B63 B;  2HHH Q;  1HZ9 A;  4JC0 A;  3A5Z B;  4DV0 L;  2F1M A;  5IYB G;  1N34 L;  3H0G G;  1XX8 A;  2D2C C;  1S72 A;  4JG2 A;  2PNH A;  5M5W B;  1RIP A;  4A3L H;  5C3X A;  5AJ3 Q;  4O1N A;  1CTM A;  1X3G A;  2RCF A;  3MXN B;  4IUQ A;  3HFZ B;  4DR6 Q;  1I94 Q;  4A3E G;  2ZXO A;  2DNE A;  1SBB B;  4DXG A;  1STB A;  1XMQ L;  4JCV E;  4KY6 A;  2VY3 A;  2ENB A;  3BYT B;  2QEX A;  4H13 C;  2M9V A;  1EU3 A;  2KOL A;  5C0X G;  1SFO H;  5C44 H;  1HH2 P;  2SDF A;  2RVL A;  4ID6 A;  1F9P A;  3AU7 A;  3SK5 A;  4KJN A;  2QIL A;  3MXN A;  3S1M H;  3KUP A;  1SNM A;  4DK6 C;  4A3G B;  3HOY H;  1GJX A;  4UDU C;  4F88 A;  4F87 A;  1LAC A;  1MIU A;  2EYH A;  1DOK A;  4C3J H;  4DGZ A;  1SYB A;  1WTX A;  3CCV A;  1G6P A;  3CW2 C;  3MFY A;  1GUT A;  4GLV B;  4BY7 H;  1DGS A;  2KEE A;  2NVY H;  5LHY 1;  3PIO A;  4ILW A;  2F0N A;  4WJ3 M;  2HQE A;  5COR A;  2DY7 A;  4OL7 A;  2B2U C;  5E7N A;  2JA7 B;  4OO1 I;  4J1M A;  3G7L A;  1LUZ A;  1NMG A;  2F0U A;  1A0I A;  4K14 A;  4JI6 L;  2V1C C;  2OWO A;  3NK9 A;  2MFI A;  5CGK A;  1VQ9 A;  4DR3 Q;  1N32 L;  4HIM A;  2QCP X;  1GUG A;  1X3F A;  4BBR H;  5LL6 X;  3HOU G;  3SEB A;  1ONL A;  3H0G B;  4QCL A;  5EKK A;  5CMD A;  2K01 A;  4J8Q A;  2GVA A;  2EYM A;  3CAM A;  5C3E G;  2VQE Q;  1N33 L;  1YNN D;  2J7Z A;  4GKK Q;  2L9H A;  2I5M X;  5CYU A;  1VCI A;  3A5U A;  4NXM L;  5D3I B;  3OIP A;  2CH4 A;  3UDF A;  3VYR A;  5FJ8 G;  1P8L A;  3IFD A;  4POF A;  4KN7 C;  1B70 B;  1QOH A;  1C7Y A;  2MO0 A;  2KCM A;  3MXG A;  4HED A;  4QGU A;  2EZV A;  5FLX c;  5IP7 G;  3Q6S A;  1EIH A;  4K0K Q;  1VQ4 A;  2QGQ A;  3K80 C;  1BUV T;  1V43 A;  5K36 H;  2LSS A;  1PXU A;  2NN6 H;  2PZT A;  3TBI B;  4A3J H;  2R92 H;  3BVG A;  4JI8 Q;  4OO1 G;  4YWL A;  3PO3 G;  2RA4 A;  4H7B A;  2R7D A;  1MJE A;  3A7L A;  5COY A;  1VQP A;  3TZD A;  1R9T H;  3CQZ B;  4KTA A;  2WKD A;  1QZH A;  4G57 A;  1G8Z D;  2Q8T A;  1D8L A;  1FGB D;  3JC6 6;  3HOX H;  1KNE A;  1FJG Q;  1AP0 A;  1DYQ A;  4IN3 A;  1OXV A;  2EIF A;  3HOU B;  2A8V A;  2X69 A;  3I3C A;  1GUW A;  1WTP A;  1E1O A;  2A6H D;  2L11 A;  4ZLT F;  2B63 H;  2R7Z G;  3A74 A;  2Z6K A;  1B50 A;  3PO2 G;  1PTO D;  3Q8D A;  1GXD C;  1RKN A;  4IZ8 A;  2LMC B;  1J5E Q;  5C3E B;  2K28 A;  2F3V A;  2B2T A;  1GUN A;  2KEN A;  2HCI A;  2PI2 E;  1RF2 D;  1EFW A;  3AFQ A;  5FLX E;  3DMU A;  1G29 1;  4GZY C;  3CHB D;  1E2V A;  1QB5 D;  1EL0 A;  1GKH A;  1JOK A;  1ZYR D;  3Q22 A;  1EU4 A;  4XXE A;  2JA8 G;  3TP6 A;  4CKC A;  5IYC H;  3PIP A;  2ATW A;  1EY5 A;  4QF4 A;  1O7Y A;  2HDL A;  5DNF A;  1HZB A;  4DR7 Q;  3OOC A;  1Q8K A;  1TXY A;  4JI4 Q;  2K04 A;  4DAM A;  2E8G A;  5KND A;  2F0J A;  1A63 A;  1KIX A;  4IUP A;  2XSC A;  2A69 D;  2ZM6 Q;  3J7A 5;  2KQ3 A;  4DK1 A;  1U4M A;  1KRS A;  4QY7 A;  4A3G H;  2K5W A;  1QWY A;  1IXR A;  3HOZ G;  5KEE A;  4K5X A;  3WOE A;  5DM6 3;  2GA4 B;  3PO3 B;  4ODG A;  1BBX C;  1O7L A;  3QG1 A;  3HKS A;  2NBF A;  3CME A;  1J8I A;  3NEN A;  1JOQ A;  3CMA A;  3OWE B;  4IUR A;  1NR4 A;  1U9R A;  3BS1 A;  4KJO A;  2KVM A;  3F2D A;  2K5Q A;  2UUB L;  3GQB A;  3ZJY C;  4LUZ A;  1HRJ A;  2JA7 H;  4DR4 L;  3NSW A;  3DWA A;  5I2X A;  4K8I A;  1SYE A;  3HOW G;  1HA6 A;  3JAM i;  4IUV A;  2R7Z B;  3PUZ A;  3PO2 B;  3D8G A;  4YHH Q;  5IYB H;  2IY5 B;  3H0G H;  2Z4I A;  4CJ2 C;  4DR2 L;  4B3S L;  1AFP A;  1GM5 A;  2Z0S A;  3RN5 A;  3F2U A;  2Q2I A;  4GOP B;  4V0B A;  1F9S A;  2WAQ E;  2IX0 A;  1HFG A;  1MHW C;  2C5C A;  2IX1 A;  2X6L A;  2G5D A;  1TWG H;  2JA8 B;  3Q24 A;  5D14 A;  3J7Z C;  3J7A V;  1HR0 L;  1VQB A;  5CBE E;  1KTK A;  2G9D A;  4TRD A;  4KD4 A;  5I6W A;  3I91 A;  1IBM Q;  4GOP A;  2BE5 C;  2VW9 A;  1I3Q B;  2F0I A;  3GTK H;  5M3M G;  1FD7 D;  3L3O C;  3IL8 A;  4H44 C;  4LF7 Q;  3SK8 A;  1EFI D;  2EOT A;  4LFC Q;  4DR1 L;  5K5P A;  4UP8 A;  4KD3 A;  1KC8 C;  1X32 A;  4DV7 L;  3HOZ B;  1UUP A;  4IFD J;  2F0O A;  3BJU A;  1JB7 A;  5IOC A;  4BA1 I;  1I50 B;  1XTC D;  1YHQ A;  1B9M A;  2LFN A;  5ELD A;  3QOL A;  2L15 A;  2OCE A;  5JJI A;  3QOJ A;  2L5T A;  1BXT A;  4WJW A;  4JI2 Q;  5BR8 Q;  4JBM A;  1BOS A;  3KK7 A;  3RZO B;  1A6X A;  3T16 A;  4IPH A;  2JA6 H;  1IW7 C;  4QUC A;  2IHE A;  3HOW B;  4MZ9 A;  2K05 A;  3CQZ H;  4P75 A;  4BXX G;  2F03 A;  1EQR A;  4TSS A;  3D3R A;  1EY4 A;  2F0S A;  3GDE A;  4LMQ D;  2F0E A;  4JI1 Q;  3HOU H;  5IP9 H;  1VMP A;  4A3F B;  4JI3 L;  1E22 A;  2D0O A;  1PTO F;  2Z6K C;  1SSO A;  2AWO A;  2KHS A;  3CCQ A;  5EPJ A;  3UI2 A;  3GV3 A;  4LF8 L;  1ZEQ X;  4TQU S;  2B2T C;  2HCC A;  3W5O A;  1QIL A;  1SR3 A;  1SNO A;  1EIY B;  2YYZ A;  1MSH A;  4AQY L;  1CSQ A;  4DV4 L;  2KHI A;  1XMO Q;  1EYC A;  2PQA B;  4PV1 C;  4X64 Q;  5M3M B;  1ICF B;  4BA2 I;  1LYL A;  1RL2 A;  5IP7 H;  3R2T A;  5C4Z A;  1AE3 A;  3TP8 A;  4XQN A;  1B3Q A;  3BZD B;  1ROD A;  4MTK A;  3MC0 B;  1CA5 A;  4A3L G;  5ISR A;  4IOC A;  2WAC A;  1M90 C;  3T1Y L;  4CJ1 B;  2E2I B;  3M4Q A;  2XRS D;  1AEX A;  3U4Z A;  2ICI A;  4XQQ A;  4OO1 H;  4IO9 A;  3PO3 H;  2H4O A;  4QMG A;  1ASY A;  2QKI C;  4WFN 3;  3RR5 A;  1O7Z A;  5JJK A;  1X54 A;  5C44 G;  3G4S A;  2XGT A;  2E2H B;  3IFT A;  3HOY G;  2I07 B;  1TWA B;  4NMZ A;  2JSO A;  4CDC C;  4DV2 Q;  1JOO A;  3NEM A;  3CPF A;  3T1H L;  1QCB D;  2RBM A;  5CBA E;  1JE4 A;  1X56 A;  1RD9 D;  2VZA A;  4LW1 A;  3F2B A;  4V19 0;  3PO2 H;  1LTA D;  2A5H A;  4X62 Q;  3CRL C;  1KL9 A;  3GTG B;  4BY7 G;  3OMG A;  1EZ6 A;  2PZU A;  3HOV G;  3VDY A;  1IW7 D;  1NR2 A;  4IJH A;  5A2Q E;  4FO2 A;  1CI3 M;  1SE3 A;  3F1Z A;  4WJ4 A;  2NZO A;  2AQ3 B;  4GN3 B;  5C4X H;  3UDG A;  1C9O A;  4RGO S;  2IHF A;  4MHE A;  2JA8 H;  4I7A A;  3E9H A;  3CC7 A;  3CKI B;  2EVB A;  1Y69 U;  5CR3 A;  3NQI A;  3J80 L;  1S5E D;  1OXX K;  1KAW A;  4XDX A;  4R1J A;  4DR5 Q;  3ONA B;  1TWH B;  1SYD A;  2EYO A;  1D5M C;  4X66 Q;  2I5H A;  2LXJ A;  3OSO A;  1XNR Q;  1L1O B;  1GO3 E;  4GOP C;  1I3Q H;  2JA9 A;  2MQH A;  4NKL A;  4A3B H;  2L12 A;  1XJV A;  1YJ9 A;  2BCO A;  1PFN A;  5BN4 A;  4P74 A;  4CBV A;  3L9A X;  3TEH B;  4C2M B;  5JEA J;  1Z47 A;  1NMF A;  1N36 Q;  2K5N A;  1SFO B;  1L1O A;  5I9P A;  1QG7 A;  4UAI A;  1PTO B;  3K5M A;  4JBW A;  3RZO H;  2O5J C;  4JK1 C;  1S3O A;  2A6E C;  2JQO A;  2JP1 A;  4G7Z C;  3KOJ A;  3HOY B;  2IPK D;  2KCC A;  4RHS A;  4TKO B;  2UUA Q;  4JI0 L;  2FMC A;  1II3 A;  2ZT9 C;  1KNA A;  3WDN A;  5HGT A;  5K36 G;  1QE6 A;  4O2D A;  3V05 A;  2RDG A;  2NN6 G;  1I4X A;  4EX5 A;  2UXB Q;  1XNQ Q;  1STA A;  3BVM A;  5JVG 3;  4A3F H;  4HAE A;  4ZRZ A;  4DXF A;  3HOV B;  5J1Z A;  2F0W A;  1L2F A;  3L0O A;  1B3A A;  1PFM A;  2DGY A;  3ND9 A;  3HOX G;  4HTH A;  2CHB D;  3MEH A;  4M8A A;  2QDL A;  1SRU A;  3FKI G;  2IT1 A;  5C5L A;  1I4P A;  2ASB A;  2KCN A;  1NBW A;  4K5W A;  1SMY D;  3NBI A;  5IIF A;  1QNU A;  3K5L A;  4DV1 L;  4FP5 D;  1UEB A;  1X55 A;  5D3D A;  1SYC A;  1VQK A;  1ESR A;  3CCJ A;  4C3I B;  2M00 A;  1LTL A;  1VQ6 A;  2NTS A;  2F0T A;  1YIT A;  4OWX B;  3J81 j;  1A2T A;  3SE0 A;  1BVS A;  1VQI A;  3K59 A;  2E2I H;  2Z6B A;  4F7X A;  2HIV A;  1W2B A;  3VYS A;  1EOV A;  3AMU A;  4FDB A;  2K4K A;  4YIJ A;  2E74 C;  4R9W A;  3HKZ B;  3NWS A;  4OON A;  1GHJ A;  3OWF A;  4BXX H;  3K5O A;  2E2H H;  5DLQ E;  4B3R L;  4UPA A;  3HRZ C;  5T1I A;  4DN4 M;  4A76 A;  2WIN B;  4AYB G;  1I4R A;  4A3I H;  1TWA H;  3PSI A;  2XWB B;  3OTO Q;  4G4K A;  3JAM L;  2F4V L;  1KD1 C;  1RDP D;  2WKC A;  4RWS C;  2MO1 A;  3NXW A;  1QUQ A;  4X65 Q;  2FJ2 A;  3GTG H;  3VYU A;  5L37 A;  4B9W A;  2D9U A;  2K50 A;  1IKM A;  3HOX B;  3HG9 A;  4N8X 1;  1YNN C;  5J22 A;  1TR5 A;  5IWA Q;  2P5Z X;  3O13 A;  1E24 A;  4GKJ Q;  2Q2T A;  3NWT A;  3I2Z A;  3FKI B;  3RLF A;  3S16 B;  4DK0 A;  4EVO A;  1ENF A;  2OT2 A;  3J81 L;  2YTX A;  3HZX A;  1VF5 C;  1HNZ L;  3I4O A;  1TWH H;  1E2Z A;  1ET9 A;  1MJC A;  4DUZ L;  4MIU A;  3DLL A;  1EYA A;  4XTC S;  3PF5 A;  5JOB A;  1IL2 A;  1JJG A;  2UXC L;  1VQD A;  2Z4H A;  4DNI A;  4CGY B;  3BDO A;  1QZG A;  1CKN B;  4ZUJ A;  2AHO B;  1HA5 A;  3EFX D;  1B2T A;  4DV5 L;  1EOT A;  1Y8O B;  3JAM c;  4JV5 Q;  2K1B A;  4QJF A;  4C2M H;  3NBH B;  3SR1 A;  2DY8 A;  2ZXR A;  2ZJR A;  1GVP A;  3MEF A;  3MHB A;  1PFS A;  1L1O C;  2Y0S G;  1PTO H;  3S9W A;  2UXD L;  5IYD H;  3KLS A;  1BCP D;  1JR0 D;  3FDT A;  5JAV A;  4ZUI A;  1Q12 A;  1XPU A;  2H1E A;  3SXH A;  4AYB B;  5J39 A;  1CKN A;  2D5D A;  3KLS X;  1Q82 C;  2VQF Q;  2NWG A;  2RQX A;  5EBD A;  3F2C A;  1YHA A;  2MUY A;  1F2Z A;  3IRB A;  3E9I A;  3STB D;  4LF5 Q;  4DR7 L;  3NBH A;  4GNX B;  2A6H C;  2OTL A;  3FVQ A;  4HIK A;  4OX9 L;  4JYA L;  3S2H B;  3HOV H;  1PTO C;  2L0C A;  4HCS A;  1SE4 A;  4TVA B;  1IBL Q;  2BH8 A;  3I4N B;  4PMC A;  2JA6 G;  3AEV A;  3GTM B;  1QVF A;  2ZM6 L;  2PW7 A;  2B8F A;  4PG3 A;  3I73 A;  3VR5 A;  2F0P A;  1U4P A;  3N52 A;  2ALY B;  1P16 A;  2XRQ D;  1QVC A;  1ZYR C;  3Q0A A;  4HJ5 A;  1EWC A;  4JI5 Q;  4LFB L;  4GNX A;  1W3S A;  2TSS A;  4R8I A;  4JBJ A;  5IP9 G;  1TVX A;  1YIJ A;  2ZTC A;  4ZAI A;  3CC4 A;  2AQ1 B;  2EJF C;  2SNM A;  3LX0 A;  1SJH D;  1IYU A;  2ZXP A;  4JBK A;  3D6C A;  4KHP L;  4C1N K;  2EYF A;  1OTC A;  1Q7Y C;  1WTV A;  1TWG B;  1FR3 A;  2UU9 Q;  1ENC A;  2A69 C;  3A54 A;  1NNX A;  4C3I H;  1MGS A;  3CCE A;  3J80 i;  3FP9 A;  3CF5 A;  2QA4 A;  3L7Z C;  3AQQ A;  2HDM A;  4YCV A;  4YHH L;  2MNA A;  1TS4 A;  4LF9 L;  3W2D A;  1GUS A;  1BBU A;  1YHB A;  4K2L A;  1V1P B;  1HNX L;  5FLM H;  1F2L A;  5E4X A;  2Q2H A;  4H02 A;  2Y0S B;  4UP7 A;  3H94 A;  3GTK B;  2QEJ C;  5LMN Q;  1EY9 A;  2E76 C;  4X6A H;  5FO9 B;  1TWF B;  5T1G A;  3I4M H;  1XWE A;  2KA7 A;  3I7F A;  1WOC A;  2CVR A;  5ELF A;  1I6H B;  1RHP A;  4GS3 A;  4LFA L;  2K52 A;  5C0X J;  4YY3 Q;  3K6O A;  1V1P A;  2OXP A;  3ZYY X;  3S17 B;  1JT8 A;  1XPR A;  4JI7 L;  2E5L Q;  2CKZ B;  5JPM C;  1UAP A;  1T9H A;  3BZC A;  2JA6 B;  1F9R A;  1FGU A;  3ER0 A;  1EWH A;  1WFQ A;  1HFN A;  1DOL A;  4HMJ A;  1SJE D;  3U4V A;  3M85 A;  4IFD I;  2I46 A;  2UUC L;  2WB1 E;  1UE6 A;  2YU9 B;  4NXN L;  1HNW Q;  1BO0 A;  1H9M A;  1MD2 D;  4K2K A;  3FKI H;  1QNK A;  1YZ6 A;  3S16 H;  3CRK C;  2Z9H A;  3OHX C;  3A7A B;  5EQ0 A;  4DV0 Q;  1N34 Q;  1YVC A;  3WWV A;  1S5B D;  1XTD A;  3T51 B;  3CCL A;  1NJI C;  2WP8 J;  3PUW A;  1EIG A;  4DA2 A;  5JVH 3;  1XYI A;  4CDD C;  4N9P A;  1DON A;  5C4X G;  3VR6 A;  1U4R A;  1I6V C;  1HUM A;  1KLG D;  2XNA C;  4BS9 A;  2K33 A;  2XVS A;  2B8G A;  4ME5 A;  1LT6 D;  2F0H A;  2B2V A;  4LNQ A;  1EY6 A;  1S40 A;  1XMQ Q;  4DV3 L;  2KUM A;  5LL6 S;  1O80 A;  5CV9 A;  3OW7 A;  1WCM G;  3RUZ A;  2VS1 A;  4OIJ A;  1CSP A;  2PMZ B;  1BCP F;  5H1S E;  2PI2 A;  4A3B G;  3GTJ B;  4DV6 L;  1K8G A;  3TP5 A;  4R4C A;  2F0D A;  2FHT A;  2NUC A;  1SE8 A;  1Z6H A;  3GV6 A;  1LT5 D;  2I0Q A;  4IFD G;  5GAE C;  4FF4 A;  1OXU A;  2B2W A;  1PHJ A;  1PYW D;  1B4O A;  3CCM A;  2HIX A;  3J7Y W;  4DUY Q;  3S2H H;  2CW0 D;  1B53 A;  5KIX A;  3I4N H;  3GTQ H;  1F2M A;  1DM0 B;  4I7Z C;  1WJJ A;  5IT9 L;  3GTM H;  2E2J H;  3SK4 A;  4L63 B;  4JI6 Q;  4PMW A;  2AKW B;  4F8M A;  1HCZ A;  1WTH A;  2CFM A;  2KBN A;  1N32 Q;  4XT3 B;  1RTN A;  2L1B A;  4GNX C;  4QIW E;  4KHV A;  3K7A B;  1X9N A;  3T53 B;  4A3F G;  3VA7 A;  3SVM A;  3TN2 A;  5ELN A;  5C4X B;  1AZP A;  1N33 Q;  3MTS A;  4DKA C;  1ICW A;  3EBE A;  4NXM Q;  4L8J A;  2G9H D;  5FK9 C;  3H3V I;  4HJ9 A;  3J81 i;  3BDL A;  3V96 A;  2F0V A;  2JXM B;  4JOI A;  3S24 A;  5DM7 3;  1UNS A;  4K6L A;  3PIP 3;  4UHV A;  1WCM B;  2LS0 1;  1A3V A;  1VQM A;  2EYL A;  2RSO A;  1EZ8 A;  1H9R A;  1VQO A;  4LWC A;  2CWP A;  4A3B B;  4A3D H;  1C48 A;  3LNN A;  4FNF A;  2PPB C;  4KHZ A;  5EBC A;  1XXG A;  1UEA B;  1DXM A;  1TWF H;  4DAV A;  2Q2U A;  1ET6 A;  1PLF A;  4RGT A;  4X3K A;  1I6H H;  1VQJ A;  1PH9 A;  1C0A A;  1EY8 A;  2N88 A;  3K58 A;  3MA2 B;  4G7H C;  3M4O H;  1A15 A;  2VB2 X;  3S17 H;  1PV4 A;  4A93 G;  3KJP A;  1XNR L;  1B1Z A;  4A75 A;  1VQA A;  4A3K H;  1CT1 D;  1LT3 D;  4KY5 A;  1SE2 A;  4HIO A;  2F0G A;  1FNW A;  3NP8 A;  2YU9 H;  4A3I G;  5FO7 B;  1RCV D;  3T56 B;  1KDA A;  1F2Y A;  3EQL C;  4EQP A;  1ENA A;  1U4L A;  5I6Y A;  3DWQ A;  2F0L A;  1L0X B;  2MHV A;  5JPN C;  3NE5 B;  4LF6 L;  1K8M A;  1HPC A;  4KI0 A;  3S1Q B;  4DAP A;  3ULJ A;  2FXQ A;  4KKT A;  2NTT A;  1I4G A;  4GLA C;  5CV7 A;  1ILQ A;  1BCP B;  3VR3 A;  1IKL A;  1Q1E A;  3RLN A;  1TII D;  1CHP D;  4HCE A;  1LAB A;  1JB3 A;  2B29 A;  4A3M H;  1JIC A;  5EKI A;  3S2D H;  4FXK C;  2N49 A;  2B2V C;  3P7J A;  1AZQ A;  2CQA A;  4B3T L;  5GRO A;  3EA6 A;  1X3P A;  4HMI A;  5ELB A;  1EWI A;  4IUN A;  1IBK L;  5G3L D;  4IUT A;  1K0S A;  1ZXT A;  2R93 H;  3GTJ H;  2XIW A;  3K0X A;  4IAL A;  3RD4 A;  3GTO B;  1WTW A;  4YWM A;  3EN2 A;  2NVQ B;  1A3T A;  2PQE A;  3E0E A;  3GP7 A;  2GVB A;  2MP1 A;  4A93 B;  2KCT A;  3I90 A;  3SGI A;  4QB4 A;  2B2W C;  4HJ7 A;  4NP5 A;  3G6J B;  3H6M A;  5JEA G;  2UUB Q;  5JJL A;  1E2W A;  4L5R C;  5IYD G;  4DR4 Q;  1AH9 A;  1E7Z A;  1T5X D;  4KMU C;  2YV5 A;  4A3I B;  2DNC A;  4DPG A;  2EY6 A;  3W1B A;  1F9Q A;  3LGJ A;  4LF4 L;  4OGQ C;  2SEB D;  5M5X B;  4DR2 Q;  4B3S Q;  3UE0 A;  1SMY C;  3K7A H;  5M3F G;  1JWU D;  1I4Q A;  3DEO A;  4RG1 A;  1K0R A;  1CKO A;  3EIV A;  2XWJ B;  2NVT B;  4KK7 A;  1HR0 Q;  5CV5 A;  3KLR A;  1G91 A;  1WYD A;  5BN3 A;  2D62 A;  2KED A;  4JOI C;  3T4A C;  1PH7 A;  2EY2 A;  1WCM H;  1K83 H;  2I5L X;  1VQE A;  3K7U C;  3RZD B;  1PH6 A;  1MSG A;  3OYY A;  1ML0 D;  4X3S A;  1H95 A;  4POG A;  4DR1 Q;  3QO2 A;  2RDH A;  4DV7 Q;  4B3M L;  5D65 A;  4C3I G;  4WOR A;  2HHH L;  4MNO A;  3V2T A;  4IFD H;  2FMM A;  3R93 A;  3IAY A;  3B6Y A;  2B2Y A;  2PYK A;  1NAP A;  5FLM G;  1TS2 A;  3A8I E;  2AMC B;  1TWC H;  3ULL A;  5GAH C;  3M4P A;  3W3A A;  3A56 A;  3K57 A;  5AJ3 L;  1EQT A;  1A2U A;  3HKZ G;  4DR6 L;  2DJG C;  2NB0 A;  4YWK A;  2PNR C;  2TMP A;  3X3M A;  4XQJ A;  1I94 L;  3I4M G;  5M5Y H;  4R8N A;  2KJX A;  4P73 A;  2N78 A;  1G6Z A;  2M2L A;  5FKA C;  1Q8I A;  1Y14 B;  4A3C H;  1HUN A;  2F0Q A;  3J80 c;  1GD7 A;  5KYI A;  3D0F A;  5M3F B;  3PF4 A;  1O78 A;  1PH1 A;  1JOR A;  1I4H A;  4K8J A;  1OXS C;  3S1Q H;  4R4Q A;  4LF8 Q;  2E75 C;  1U5K A;  3M9B A;  1LTI D;  2F0K A;  4HID A;  2EJG C;  5IGC A;  3K5N A;  3SHL A;  2JK8 A;  2RF4 A;  4IOA A;  4FYD A;  1R4P B;  4O42 A;  1PYS B;  2NZH A;  3BYY B;  4AQY Q;  2A68 D;  5E1F A;  4DV4 Q;  1A62 A;  1CQF A;  2HQL A;  3PV0 A;  1JE5 A;  2PO4 A;  4RH6 A;  5KRU A;  1Q1B A;  1UWV A;  1QJO A;  2ID0 A;  3L2P A;  1SYF A;  4LJZ C;  2VUM B;  5G3L F;  1BCP C;  2K5H A;  4DNT B;  2JE6 I;  2L55 A;  3I72 A;  3T1Y Q;  3D31 A;  3ERS X;  4JI5 L;  4DR3 L;  1M8A A;  3GTO H;  3ULP A;  3STB C;  2NVQ H;  1CM9 A;  2BDO A;  4RKL A;  4APV A;  4A93 H;  3G6E A;  2YTY A;  1EY7 A;  1K3R A;  1QUQ B;  2F3I A;  2VQE L;  4MTN A;  3LWE A;  5CV6 A;  1JWS D;  4GKK L;  1X65 A;  4LK1 C;  3I4M B;  3C1F A;  1K3B C;  1YNX A;  1VF7 A;  1PVO A;  1SEB D;  1SXT A;  4RCO A;  5I9O A;  4J6H A;  3T1H Q;  1MI2 A;  5KGU A;  3AYH B;  1FYC A;  3H91 A;  3CPW A;  2VL6 A;  1RTO A;  1TS3 A;  1LTT D;  1STG A;  4OIK A;  3CC2 A;  5M5X H;  3H3V H;  4K0K L;  1L0Y B;  1W6J A;  4NPS A;  2IX3 A;  3I4N G;  2F0M A;  1LT4 D;  1HTP A;  2O2L D;  1SMX A;  2K14 A;  4HSV A;  5KNB A;  3MXU A;  2IWH A;  5TSS A;  2NVT H;  4C3H B;  3GD7 A;  2RKS A;  3MZ5 A;  1Q81 C;  1AW7 A;  2HUG A;  2JEB I;  3CD6 A;  2EDG A;  4JI8 L;  2EE1 A;  5IE8 A;  3C2P A;  1PMR A;  4RKB A;  2DJF C;  4L6T B;  3H3V C;  1LM0 A;  2VB3 X;  1JC7 A;  3TZU A;  1W6K A;  1V1O A;  1NY4 A;  1YNJ D;  4OWT B;  3RZD H;  2ES2 A;  1SAP A;  4KLK A;  4PNY A;  2B3G A;  1FJG L;  4XT1 B;  1G2S A;  1IHZ A;  3CCU A;  1ESF A;  4R4T A;  3QIA A;  3BZK A;  3BDC A;  3R2I A;  3RMH A;  2B39 A;  1DZ1 A;  4RA8 A;  1V8Q A;  1J9O A;  4EQN A;  4IJL A;  1J5E L;  1VS0 A;  2B2Y C;  5BN5 A;  5GAD C;  1D2B A;  1VQC A;  5JEA H;  3F8T A;  2N3S A;  1KQS A;  4BBS G;  1KHI A;  4A3D G;  3GTP B;  1KDB A;  3RLO A;  3S1N B;  4J15 A;  4JI0 Q;  1LO5 D;  1J6Q A;  1DOM A;  4XIG S;  4PZ6 A;  1OO9 B;  1Y8N B;  2VXW A;  3WOF A;  4BY1 B;  1Y8P B;  3PUY A;  1UE1 A;  3HGB A;  1S5F D;  3CU7 A;  1BNZ A;  1SYG A;  5C5M A;  3J81 c;  1PRT D;  4ZKC B;  1Y1W B;  4JI4 L;  4AYB E;  3NHH A;  1TKW B;  5M3F H;  2EPB A;  4FXG C;  4AH6 A;  3GTQ B;  3BVZ A;  3DUZ A;  5EAY A;  2E2J B;  4A3K G;  3OIQ A;  4RGM A;  5F2D A;  3TS2 A;  3LWU A;  1KAA A;  4CHT B;  3R8B A;  3C3L A;  3J7A F;  2Q8I B;  5EPL A;  2WB1 G;  3U58 A;  2XTI A;  5ELE A;  3JAM E;  2SOB A;  1EY0 A;  5FLX L;  3D4R A;  4KKU A;  4DUY L;  1PZK D;  2JYO A;  3MAQ A;  2LKV A;  4DV1 Q;  5J3B A;  4OEM B;  4KV6 A;  4RCN A;  2EXZ A;  2VUM H;  4FVM A;  4L5T A;  1XPO A;  1HJP A;  4IPC A;  2N55 A;  4RGN A;  2IL8 A;  2NZ1 D;  2YTV A;  2J0T D;  5C6A A;  1FNU A;  4CDE C;  1STN A;  4A3M G;  2JA5 H;  1KRT A;  2IW3 A;  3K0Y A;  4Q0F A;  1GOZ A;  3J81 E;  2Q8R E;  4BBS B;  3TRZ A;  5GAG C;  4A3D B;  2C35 B;  1K8A C;  2CW0 C;  3NQT A;  3TQY A;  2F0F A;  4A3E B;  2RCN A;  4H0L C;  1JCK B;  3PQI A;  5EGT A;  1D5X C;  4CJ0 B;  4ULL A;  3E3X A;  3MVV A;  4JPB W;  4B3R Q;  4CKE A;  5EPK A;  2R93 G;  1PH3 A;  2Y0S E;  4KN4 C;  1FVI A;  3ND8 A;  5EKL A;  2F4V Q;  2BA1 A;  3M4O B;  4RMF A;  2EJM A;  2R3Z A;  3MWY W;  3KDF B;  4HR7 B;  3ERQ A;  3AFP A;  5C4J H;  1IBM L;  4FF3 A;  3UDX A;  4WRD A;  5LMU Q;  4LF7 L;  2JEA I;  4A3K B;  3M7N A;  5IGE A;  4LFC L;  3PIO 3;  3TP7 A;  1EIF A;  1FL0 A;  1X3E A;  2QDB A;  5GQO A;  2K5V A;  1B8A A;  2CCZ A;  2X6G A;  1KLU D;  2NVX B;  5IGD A;  1EEF D;  2WB1 B;  4O0A A;  4UY8 C;  4C3H H;  3DM1 A;  3D6W A;  5IGB A;  1SND A;  3DWP A;  4YCW A;  2F4I A;  3KDF A;  3GTL B;  2WII B;  5BR8 L;  2A74 C;  4JI2 L;  1HNZ Q;  1IL8 A;  1NTG A;  4DUZ Q;  4A4I A;  2A1A A;  3HP3 A;  1Q90 A;  1YEZ A;  3IKJ A;  1HTL D;  1F77 A;  1B9N A;  1EEI D; 
#chains in the Genus database with same CATH homology
 1S72 A;  5JEA J;  1Z47 A;  2YU9 H;  1Q46 A;  1NMF A;  4JG2 A;  2PNH A;  2K5N A;  4A3I G;  1N36 Q;  2UXC Q;  1L1O A;  1RIP A;  4A3L H;  5AJ3 Q;  4JI1 L;  4JBW A;  3RZO H;  1X3G A;  3MXN B;  3HFZ B;  4DR6 Q;  1S3O A;  1I94 Q;  2JQO A;  4A3E G;  4LF6 L;  4DV5 Q;  2WAQ G;  3KOJ A;  4KI0 A;  4Y52 H;  1MKH A;  1JJC B;  3ULJ A;  2FXQ A;  2JJQ A;  2UUA Q;  4JI0 L;  2VNU D;  4ME3 A;  1XMQ L;  4JCV E;  1CKM A;  4GLA C;  2VY3 A;  5K36 G;  1VQ8 A;  2QEX A;  2UXD Q;  5M5W H;  4O2D A;  3PUX A;  5C0X G;  5C44 H;  1SFO H;  1HH2 P;  2NN6 G;  4EX5 A;  1Q1E A;  2UXB Q;  1XNQ Q;  3RLN A;  4A3F H;  2B29 A;  3GTP H;  4A3M H;  3S1M H;  3S1N H;  3S2D H;  2N49 A;  4DK6 C;  2EXD A;  4GN5 A;  3HOY H;  1L2F A;  3K81 C;  4B3T L;  1MIU A;  3L0O A;  5GRO A;  1XMO L;  1HZA A;  4C3J H;  4BY1 H;  2DGY A;  2PMZ E;  4X64 L;  3HOX G;  4OX9 Q;  3CCV A;  1EWI A;  4JYA Q;  1IBK L;  1G6P A;  3CW2 C;  1Y1W H;  5LMN W;  4GLV B;  4BY7 H;  1DGS A;  2RHQ B;  2NVY H;  1Y1V G;  1SRU A;  3PIO A;  3FKI G;  3GTJ H;  2R93 H;  3K0X A;  4WJ3 M;  2IT1 A;  1PH4 A;  1E3P A;  5HY6 A;  4QL5 A;  4YWM A;  2ASB A;  1KXL A;  3EN2 A;  1PH8 A;  1NBW A;  5E7N A;  4IPD A;  4R4I A;  3E0E A;  4GN4 B;  4OO1 I;  2GVB A;  1SLJ A;  1LUZ A;  1NMG A;  4DAY B;  2KCT A;  1A0I A;  5ELO A;  4JI6 L;  2V1C C;  4DV1 L;  2OWO A;  1UEB A;  1X55 A;  3SGI A;  4LFB Q;  5IY0 A;  1VQK A;  2MFI A;  3CCJ A;  1VQ9 A;  4HJ7 A;  4DR3 Q;  1N32 L;  1LTL A;  4HIM A;  5JEA G;  1VQ6 A;  3TRE A;  4HJ8 A;  4A3C G;  1X3F A;  4BBR H;  1YIT A;  1WI5 A;  4OWX B;  1E1T A;  2UUB Q;  3J81 j;  5IYD G;  4L5R C;  3HOU G;  5JJL A;  4DR4 Q;  1AH9 A;  1E7Z A;  1BVS A;  1VQI A;  3TS0 A;  1VQN A;  2E2I H;  2YV5 A;  2BH2 A;  4KHP Q;  2RHS B;  4DPG A;  2GVA A;  3CAM A;  3W1B A;  5C3E G;  2HIV A;  2VQE Q;  3LGJ A;  1N33 L;  1W2B A;  4DV2 L;  4GKK Q;  1EOV A;  1V9P A;  4FDB A;  3CXC A;  3RN2 A;  2I5M X;  2K4K A;  1VCI A;  4LF4 L;  3A5U A;  3CCR A;  4NXM L;  4LF9 Q;  4DR2 Q;  4OON A;  3UE0 A;  4B3S Q;  3K7A H;  4BXX H;  1HNX Q;  1I5F A;  5M3F G;  5DLQ E;  3UDF A;  4X62 L;  5FJ8 G;  2E2H H;  4RG1 A;  4UPA A;  3CP0 A;  4B3R L;  4A76 A;  1P8L A;  1K0R A;  1CKO A;  3EIV A;  4AYB G;  4A3I H;  4POF A;  1TWA H;  2D0P A;  1B70 B;  3PSI A;  3OTO Q;  2F4V L;  1HZC A;  4R4O A;  4BBS H;  1C7Y A;  2MO0 A;  1KD1 C;  2KCM A;  4QGU A;  2MO1 A;  5FLX c;  5IP7 G;  1HR0 Q;  4A3E H;  1QUQ A;  1VQ4 A;  3PUV A;  4L5S A;  4K0K Q;  5IT9 c;  2QGQ A;  4X65 Q;  1WYD A;  3K80 C;  3GTG H;  2D62 A;  4LFA Q;  3UDI A;  3ICE A;  4JOI C;  1PH7 A;  1Z9F A;  1V43 A;  1WCM H;  1K83 H;  2LSS A;  2I5L X;  2K50 A;  1VQE A;  4DR5 L;  3K7U C;  3G48 A;  1PH6 A;  4X66 L;  3OYY A;  5IWA Q;  4A3J H;  4JI7 Q;  2H5X A;  2R92 H;  4HJA A;  1E24 A;  4GKJ Q;  4PZ8 A;  2Q2T A;  4POG A;  4JI8 Q;  3I2Z A;  3RLF A;  4OO1 G;  4YWL A;  4DR1 Q;  3PO3 G;  2OTJ A;  4DV7 Q;  2K75 A;  2R7D A;  1MJE A;  4B3M L;  2UUC Q;  2ZJQ A;  2EQS A;  1VQP A;  2YTX A;  1HNZ L;  2OQK A;  3I4O A;  2HHH L;  4MNO A;  1M1K C;  1R9T H;  1TWH H;  1MJC A;  4DUZ L;  3DLL A;  1QZH A;  4NXN Q;  1D8L A;  3B6Y A;  3JC6 6;  4XTC S;  3HOX H;  3PF5 A;  1YJW A;  2NVX H;  1FJG Q;  1IL2 A;  1VQF A;  1JJG A;  5FLM G;  1OXV A;  2AMC B;  4YCU A;  1TWC H;  2EIF A;  3ULL A;  2UXC L;  5GAH C;  3M4P A;  1N36 L;  2A8V A;  1VQD A;  2R6G A;  4DNI A;  2N8N A;  3GTL H;  3OW2 A;  2LXK A;  1A8V A;  5AJ3 L;  1E1O A;  1AE2 A;  1QZG A;  1UE7 A;  2B63 H;  3A74 A;  1CKN B;  2Z6K A;  2R7Z G;  3PO2 G;  2AHO B;  3HKZ G;  4DR6 L;  1I94 L;  3Q8D A;  4YWK A;  3I4M G;  4DV5 L;  4OWW B;  3JAM c;  1J5E Q;  4JV5 Q;  5M5Y H;  2ZJP A;  4QJF A;  4C2M H;  4P73 A;  2UUA L;  2KEN A;  2DUD A;  2N78 A;  2PI2 E;  1EFW A;  3AFQ A;  3NBH B;  4IPG A;  1G29 1;  2ZJR A;  1VQ7 A;  1GVP A;  3MEF A;  1Y14 B;  4A3C H;  1PFS A;  1L1O C;  2Y0S G;  3J80 c;  2UXD L;  1GD7 A;  5IYD H;  1YBY A;  1GKH A;  3D0F A;  2UXB L;  3PF4 A;  1XPU A;  2JA8 G;  4GLX A;  1XNQ L;  1PH1 A;  1Q12 A;  4DV3 Q;  3DM3 A;  5IYC H;  1OXS C;  3PIP A;  1CKN A;  2ATW A;  4R4Q A;  1BKB A;  3RNU A;  3S1Q H;  1Q82 C;  4LF8 Q;  2VQF Q;  3F2C A;  1U5K A;  5C3E H;  3M9B A;  1YHA A;  4HID A;  1HZB A;  3IRB A;  4DR7 Q;  3E9I A;  3KF6 B;  3STB D;  1Q8K A;  1TXY A;  4JI4 Q;  4LF5 Q;  4DR7 L;  4DAM A;  2JK8 A;  2RF4 A;  4GNX B;  4IOA A;  2OTL A;  1IZ6 A;  2E8G A;  1PYS B;  2NZH A;  1A63 A;  4AQY Q;  4DV6 Q;  4HIK A;  2KHJ A;  1KIX A;  4OX9 L;  4JYA L;  4DV4 Q;  3HOV H;  1A62 A;  1SN8 A;  5FJ8 H;  2HQL A;  3PV0 A;  4TVA B;  2ZM6 Q;  3J7A 5;  1IBL Q;  2BH8 A;  1JE5 A;  3M3Y H;  1KRS A;  1Q1B A;  4QY7 A;  2JA6 G;  4A3G H;  1UWV A;  3AEV A;  1QVF A;  2ZM6 L;  1IXR A;  4PG3 A;  3HOZ G;  2ID0 A;  4P71 A;  3L2P A;  2ALY B;  1P16 A;  3KF6 A;  1QVC A;  3HKS A;  4HJ5 A;  3CME A;  3NEN A;  3A0J A;  3I55 A;  4JI5 Q;  2K5H A;  2JE6 I;  3CMA A;  4LFB L;  4GNX A;  1W3S A;  3T1Y Q;  3D31 A;  4JBJ A;  3ERS X;  4JI5 L;  5IP9 G;  4DR3 L;  3GTO H;  3F2D A;  3ULP A;  2UUB L;  3ZJY C;  1YIJ A;  4LUZ A;  2ZTC A;  3CC4 A;  2JA7 H;  3STB C;  2NVQ H;  4DR4 L;  1IYJ B;  4APV A;  3HOW G;  4A93 H;  3G6E A;  2YTY A;  2PQA A;  3JAM i;  4JBK A;  4KHP L;  1VQG A;  1EUJ A;  1OTC A;  1K3R A;  1Q7Y C;  1QUQ B;  2F3I A;  2UU9 Q;  2VQE L;  4C3I H;  3PUZ A;  4MTN A;  4YHH Q;  3CCE A;  1X65 A;  5IYB H;  3J80 i;  3FP9 A;  2BA0 A;  3CF5 A;  3H0G H;  2QA4 A;  4ALP A;  2IY5 B;  3L7Z C;  3AQQ A;  4YHH L;  4YCV A;  1YNX A;  2MNA A;  4DR2 L;  4B3S L;  4LF9 L;  4LUO A;  1GM5 A;  2Z0S A;  1BBU A;  1YHB A;  1PVO A;  1HNX L;  3RN5 A;  5FLM H;  1X6O A;  2Q2I A;  2Q2H A;  4H02 A;  4UP7 A;  4GOP B;  3AYH B;  3T1H Q;  2WAQ E;  3CPW A;  2IX0 A;  1PH5 A;  1L0W A;  2IX1 A;  3OTO L;  5LMN Q;  2VL6 A;  1TWG H;  4AIM A;  1N8R C;  2R7Z H;  3J7Z C;  4X6A H;  1ASZ A;  4LUV A;  3CC2 A;  5M5X H;  1VQB A;  1HR0 L;  3I4M H;  3H3V H;  3KFU A;  4K0K L;  3K8A A;  4X65 L;  3I7F A;  1WOC A;  4NPS A;  3FHW A;  4L5Q A;  2F52 A;  3NEL A;  4LFA L;  4GS3 A;  4PZ7 A;  3I4N G;  2K52 A;  5C0X J;  4YY3 Q;  1SMX A;  2K14 A;  2NN6 I;  2NVT H;  1IBM Q;  4GOP A;  1EYG A;  3GD7 A;  3GTK H;  2VW9 A;  1Q81 C;  1JT8 A;  2CQO A;  5M3M G;  5IWA L;  1U0L A;  1YI2 A;  1XPR A;  2E5L Q;  4JI7 L;  4QQB X;  4LF7 Q;  2JEB I;  3CD6 A;  4GKJ L;  2CKZ B;  2CWA A;  4JI8 L;  1T9H A;  4LFC Q;  2VUM G;  4DR1 L;  3BZC A;  5IE8 A;  4UP8 A;  1FGU A;  1KC8 C;  3ER0 A;  4DV7 L;  1WFQ A;  4IFD J;  3U4V A;  3M85 A;  3BJU A;  4BBR G;  4IFD I;  2UUC L;  1LM0 A;  2WB1 E;  1UE6 A;  1JB7 A;  4BA1 I;  1YHQ A;  1NY4 A;  3RZD H;  4OWT B;  2ES2 A;  2JA5 G;  1CUK A;  4KLK A;  2L15 A;  2OCE A;  5JJI A;  2B3G A;  4NXN L;  1FJG L;  1BBW A;  1HNW Q;  1Y1V H;  3CCU A;  4JI2 Q;  2ZTD A;  3FKI H;  1YZ6 A;  4R4T A;  5BR8 Q;  4JBM A;  3S16 H;  3BZK A;  4EQ5 A;  4DK3 C;  4IPH A;  4DV0 Q;  2JA6 H;  1N34 Q;  3S14 H;  2IHE A;  1YVC A;  3HOZ H;  1VQL A;  3WWV A;  1XTD A;  3CCL A;  4MZ9 A;  1NJI C;  2WP8 J;  2WFW A;  3CQZ H;  4P75 A;  3PUW A;  4BXX G;  4IJL A;  5HGQ A;  1UE5 A;  1EQR A;  1I50 H;  1J5E L;  3GDE A;  1VS0 A;  4JV5 L;  5GAD C;  3H15 A;  4NB3 A;  1VQC A;  4JI1 Q;  4JI3 Q;  3F8T A;  5C4X G;  2N3S A;  3HOU H;  1KQS A;  5IP9 H;  4BBS G;  1OXT A;  4JI3 L;  4LF6 Q;  1E22 A;  1KHI A;  4A3D G;  3W1G A;  1QVG A;  2D0O A;  3S15 H;  2Z6K C;  3RLO A;  4J15 A;  2AWO A;  4JI0 Q;  4LNQ A;  1S40 A;  3CCQ A;  1J6Q A;  4DV3 L;  1XMQ Q;  3HOW H;  4GKK L;  1PH2 A;  4XIG S;  4LF8 L;  4PZ6 A;  4TQU S;  2VQF L;  1WCM G;  1K73 C;  2VS1 A;  1SRO A;  1PA6 A;  3PUY A;  1UE1 A;  1CSP A;  3W5O A;  3J81 c;  3UE1 A;  4A3J G;  1EQQ A;  4JI4 L;  4LF5 L;  4AYB E;  2R92 G;  5H1S E;  1VQ5 A;  2PI2 A;  1SR3 A;  5M3F H;  1EIY B;  4A3B G;  2YYZ A;  4AQY L;  4AH6 A;  4DV6 L;  1K8G A;  2OQ0 A;  1CSQ A;  4DV4 L;  1N9W A;  5EAY A;  4R4C A;  4B3T Q;  2KHI A;  1SE8 A;  1XMO Q;  4A3K G;  1IBL L;  3TS2 A;  2PQA B;  4X64 Q;  2I0Q A;  4IFD G;  4BA2 I;  5GAE C;  1LYL A;  1RL2 A;  5IP7 H;  1IBK Q;  1VQH A;  1AE3 A;  1OXU A;  3PGZ A;  1PHJ A;  1NE3 A;  1G51 A;  2WB1 G;  3CCM A;  2HIX A;  3U58 A;  4DUY Q;  4A3L G;  3GO5 A;  3S2H H;  4IOC A;  1HR0 W;  3KJO A;  2XTI A;  1M90 C;  3T1Y L;  3PCO B;  3U50 C;  4DUY L;  3GTQ H;  3I4N H;  1WJJ A;  2B63 G;  3GTM H;  2E2J H;  1B7Y B;  3M4Q A;  1Q86 C;  4JI6 Q;  4PMW A;  4DV1 Q;  5J3B A;  3U4Z A;  2AKW B;  4IO9 A;  3KF8 B;  5M3M H;  3CCS A;  3PO3 H;  2CFM A;  2KBN A;  1ASY A;  1N32 Q;  2VUM H;  3RR5 A;  5JJK A;  4L5T A;  4P72 A;  1X54 A;  1XPO A;  1HJP A;  4IPC A;  5C44 G;  2UU9 L;  4GNX C;  2YTV A;  4QIW E;  3G4S A;  4OXP A;  1X9N A;  1O7I A;  2AWN A;  4A3F G;  2XGT A;  3S1R H;  1K9M C;  4A3M G;  2A19 A;  3KLW A;  5LMU L;  2JA5 H;  1KRT A;  5IYC G;  2GN5 A;  5ELN A;  3HOY G;  1N33 Q;  2R7F A;  1YJN A;  4DV2 Q;  3NEM A;  4LF4 Q;  3CPF A;  4DKA C;  3T1H L;  3HKZ E;  3TRZ A;  5GAG C;  2C35 B;  1K8A C;  3EBE A;  4NXM Q;  1X56 A;  2VZA A;  4BY1 G;  4LW1 A;  3TQY A;  3F2B A;  2RCN A;  5LMN L;  3PO2 H;  1H95 A;  3BU2 A;  3H3V I;  4HJ9 A;  3J81 i;  1Y1W G;  4X62 Q;  1KL9 A;  4BY7 G;  4JOI A;  4B3R Q;  3KYH C;  2R93 G;  3S24 A;  1PH3 A;  3VDY A;  3HOV G;  2Y0S E;  4IJH A;  1FVI A;  5C0X I;  4WJ4 A;  3F1Z A;  2F4V Q;  2NZO A;  1JJ2 A;  2BA1 A;  1VQM A;  4GN3 B;  4A3G G;  4RMF A;  5C4X H;  3UDG A;  1C9O A;  4YY3 L;  2HT1 A;  1VQO A;  4LWC A;  2IHF A;  2CWP A;  3KDF B;  4A3D H;  3AFP A;  5C4J H;  1IBM L;  2JA8 H;  3I56 A;  3E9H A;  4KHZ A;  3UDX A;  3CC7 A;  5LMU Q;  2E5L L;  4LF7 L;  2JEA I;  3M7N A;  1TWF H;  2Q2U A;  4LFC L;  1OXX K;  1KAW A;  3G71 A;  1EIF A;  1FL0 A;  1X3E A;  5GQO A;  1V1Q A;  4R1J A;  1PYB A;  4UP9 A;  4Y7N H;  4DR5 Q;  2K5V A;  1I6H H;  1B8A A;  1VQJ A;  4X66 Q;  1D7Q A;  2I5H A;  1PH9 A;  2CCZ A;  1C0A A;  2LXJ A;  2JA7 G;  1JMC A;  3M4O H;  1XNR Q;  1L1O B;  4O0A A;  4UY8 C;  4C3H H;  1GO3 E;  3S17 H;  4GOP C;  1I3Q H;  2JA9 A;  2MQH A;  2ZTE A;  4YCW A;  1PV4 A;  4A93 G;  4A3B H;  3KDF A;  3KJP A;  4B3M Q;  1XNR L;  1HNW L;  1XJV A;  5BR8 L;  1YJ9 A;  4JI2 L;  4A75 A;  1HNZ Q;  1VQA A;  2HHH Q;  1NTG A;  1HZ9 A;  4JC0 A;  3A5Z B;  4A3K H;  4DUZ Q;  4DV0 L;  4P74 A;  4A4I A;  5IYB G;  2A1A A;  1N34 L;  3H0G G;  4HIO A;  1YEZ A;  3TEH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...