4JI6L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
124
structure length
123
Chain Sequence
b'PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLLGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 12
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji6L00
4LF9L 1LM0A 1E22A 1S3OA 3S16H 1VQEA 4A75A 1E3PA 4NB3A 2UUCQ 4JG2A 3I7FA 4DV3L 2AKWB 5M3MH 2GVBA 4YY3Q 1Q46A 3E0EA 2WAQG 3CQZH 1NMFA 1Y14B 3G48A 4JI1L 3U50C 4DV7Q 3MEFA 1IBKL 2JA6G 2JA8G 4JI3Q 3HOUG 3S24A 2AHOB 1VQOA 1N36Q 1K8AC 2BA0A 3JC66 2Z6KC 1D7QA 1KAWA 4GKJL 1PH3A 1WJJA 4A3FG 1FJGL 3F1ZA 4HJ9A 3K0XA 3HFZB 5FLXc 1VQ5A 1J6QA 4LF6Q 2F3IA 3CCSA 3AQQA 2PI2A 4L5TA 1PYBA 5GAHC 4DUYQ 4X65Q 4B3RQ 4H02A 3HOYG 3G71A 1EQQA 2RHQB 1L2FA 2EIFA 2I5LX 4C3IH 5IP7G 2KCMA 4POFA 4DV6L 4NXMQ 1CKNB 3M4QA 1JJ2A 1UWVA 4DV2Q 4YCVA 4A3DG 4IOAA 2IHFA 1R9TH 2OCEA 1PH8A 2KBNA 3A5ZB 5C3EG 3ICEA 2ES2A 2QGQA 1KIXA 1IBMQ 4DV3Q 4LF7L 1WI5A 3JAMc 5GAGC 4DV4L 4PZ8A 1VQGA 1C9OA 3KOJA 2D62A 1XPUA 3CC4A 3IRBA 4C3HH 2I0QA 2KHIA 4QIWE 3H0GH 4JI1Q 5M5WH 1XTDA 3E9IA 4C3JH 2KHJA 2N3SA 3FP9A 3M85A 4HIOA 1VQ9A 1M1KC 5FJ8H 1EIYB 2VS1A 4QY7A 2NZHA 1PFSA 1A63A 3CC7A 4A3MG 1HJPA 2CFMA 3F2CA 4B3ML 1MJCA 1QUQB 4GOPA 2LSSA 3PUVA 5HGQA 3VDYA 3GTLH 1HZ9A 4GKJQ 2RHSB 4GLAC 3S1RH 1CUKA 1PHJA 2JEBI 1V9PA 1X65A 3RR5A 4P71A 1CSQA 1EWIA 4JCVE 5E7NA 3PIOA 4QL5A 4R4TA 3DM3A 2JQOA 4JV5L 1ASYA 3RN2A 5IYBH 1HNWQ 3KJOA 4JI4L 5LMNW 4BY1G 3GTQH 3U4VA 4PMWA 2NN6G 3PUWA 4BA1I 4DR1Q 1SMXA 4AYBE 3L2PA 3RLFA 1TWCH 5IYDG 1JJCB 1AE2A 3CD6A 1IYJB 2R93H 4UPAA 4LF4L 1CKOA 4TQUS 4YHHL 2QEXA 1VQ7A 3OTOQ 4LW1A 1KRSA 2N8NA 3PUYA 3ULJA 2BH8A 1Y1WG 3HOZH 5AJ3Q 2R92G 4A3LG 4LF7Q 4R4IA 3J7ZC 1XJVA 5IP9G 4HIMA 4R4OA 1KC8C 1GD7A 1UE5A 3CMAA 2UU9Q 1PYSB 2MO1A 3PO2G 1KRTA 5BR8L 2Q2HA 2UXDQ 2CWAA 4DV5L 1RIPA 4O2DA 4OWWB 2K5VA 2N49A 3T1HL 2UXCL 3D0FA 3I4NG 4JBKA 4GNXC 4HJ5A 4A3GG 1VQBA 4ME3A 3HOVG 4DKAC 1X3GA 3GTPH 3B6YA 1B8AA 4IO9A 4A4IA 3EN2A 2JA7H 5LMUL 4BBRH 1JJGA 2PQAA 3AYHB 2QA4A 1Q7YC 1BBWA 4JI4Q 3BZCA 3S2DH 4DUZL 3NBHB 1LYLA 5M3MG 4NXNL 3CCEA 1L0WA 3PSIA 4APVA 4B3SL 1TWFH 3S2HH 4LF4Q 4K0KL 1C0AA 1E24A 4DK3C 2F52A 3HKSA 1VQNA 2CCZA 1E1OA 1E1TA 3M4OH 3K7AH 4R1JA 5IWAL 1OTCA 5H1SE 2YV5A 1G6PA 1LTLA 3BZKA 4QQBX 4JBJA 5C44H 4LFCL 4R4QA 4A3CH 4JI6L 5K36G 5BR8Q 2E5LL 3KYHC 4EX5A 4KHPL 2VQFL 3T1YL 2IY5B 1Q12A 1Y1VH 2UXCQ 1PH5A 4Y7NH 3KDFA 4LUVA 1V43A 1X3EA 1EIFA 3KF6B 1Q86C 1N8RC 3W5OA 4JI7Q 3PV0A 3NENA 2VUMH 4IPCA 2A1AA 4P72A 4LF5L 2R6GA 2MO0A 5C4JH 4A3IH 1VQKA 2AMCB 5M3FH 1YJNA 2VQEQ 3Q8DA 2D0OA 4LWCA 4GKKQ 1OXSC 2L15A 4NXNQ 4DR3Q 4JI0L 1J5EL 3H0GG 3ULPA 3OW2A 2HHHL 3J81i 4LFBQ 4K0KQ 2B63H 5FJ8G 4AYBG 4Y52H 1VQIA 1YVCA 2E8GA 1L1OB 1IXRA 5IWAQ 3WWVA 2JA9A 1XNQL 3AEVA 4A93H 4JBWA 1N34Q 2OTJA 4FDBA 4OONA 3A5UA 3AFPA 2DUDA 2NN6I 1CKMA 4OWTB 5IY0A 5M5XH 3U58A 3K8AA 4DR7Q 1PH7A 3J80i 4GNXA 1HZAA 4YWKA 1XMQQ 4JI6Q 3M7NA 4LF9Q 1YITA 4MZ9A 1EFWA 1A62A 4YWLA 1HR0L 1TXYA 4KHZA 3T1YQ 3CPWA 3G4SA 1MKHA 2MNAA 3HOXH 1HNXL 1UE7A 5IYBG 1BVSA 3UDFA 1G291 1N32L 1IBKQ 1D8LA 1WCMH 2K5HA 1OXXK 1SE8A 2E2JH 4UY8C 1M90C 3UDIA 4DV0L 1IL2A 2R93G 4GN4B 4LF5Q 3EIVA 2K75A 1VQLA 1PA6A 3HOZG 2HIVA 2Q2IA 3J81j 2UUAL 4IJLA 1S40A 1FJGQ 1I6HH 1VQ6A 3PF4A 4BY7H 2OWOA 4JI0Q 5JJLA 1VQ8A 2JA8H 2HT1A 1W3SA 2HHHQ 4JYAL 2PNHA 1UE1A 1YIJA 4GLVB 4RG1A 4DR2L 2FXQA 2HIXA 1JMCA 1TWGH 2LXKA 3UE0A 2UXBL 1XPOA 3STBD 3CPFA 2HQLA 1X6OA 2WFWA 3H15A 4DV6Q 1U5KA 1FGUA 4HJ7A 1Q82C 4A3EH 4OX9L 1B70B 3I2ZA 2I5MX 5IYCH 1CKNA 1HH2P 1MIUA 5C4XH 3PGZA 1X9NA 4DK6C 3RZOH 1NMGA 1N33L 4A3BH 3CAMA 4L5QA 5IT9c 3K80C 1C7YA 1QVFA 2JA7G 2ZJRA 1Z47A 4DV4Q 3GTKH 4KLKA 4X62L 4BBRG 2YU9H 4JI2L 3M3YH 4IFDJ 1NY4A 4DPGA 1N32Q 4X64L 2BA1A 1XNRL 3TREA 5IE8A 3PUXA 4JI5L 4JBMA 2VY3A 2YYZA 1BBUA 2VL6A 3GDEA 4DV0Q 3EBEA 3TQYA 4B3MQ 3PUZA 1XMOL 3W1GA 1IZ6A 4DR4L 4AIMA 4A76A 1QUQA 2UUAQ 3TEHB 1QZHA 4IJHA 1X54A 3MXNB 3RZDH 3CCRA 5M5YH 5C44G 4B3TL 2XTIA 4R4CA 2DGYA 1JT8A 4QGUA 2ZTCA 2K14A 3PO3H 4JYAQ 1CSPA 3ERSX 4DV1L 4A3CG 4JV5Q 4WJ3M 2VNUD 5ELOA 3RLOA 2JE6I 3LGJA 2JA5H 2A19A 3L7ZC 2UXBQ 2OQKA 4TVAB 4X6AH 3CXCA 1Y1VG 3K81C 3D31A 1VQCA 2EXDA 1KXLA 4DAYB 3I4MH 4DAMA 1EOVA 3CMEA 4OX9Q 4UP7A 3PF5A 3J7A5 4OO1G 1KD1C 3JAMi 1SN8A 3CW2C 1TWHH 2YTVA 1VQMA 1VS0A 4YHHQ 1VQHA 4BBSH 3FHWA 2VUMG 1N33Q 2K5NA 1VQPA 3KF8B 2MFIA 4HIKA 1X3FA 4A3IG 4DNIA 3M9BA 2IHEA 5M3FG 4JI2Q 3S15H 1O7IA 2KCTA 4JI8L 4MTNA 3A74A 3HKZE 4UP9A 1XNRQ 3GO5A 1QZGA 2XGTA 4DR6L 4A3JH 1IBLL 4JI5Q 4UP8A 4DV5Q 1L1OC 2B63G 2OQ0A 1P16A 2ZTDA 3CF5A 4IPGA 2Y0SE 4LNQA 4GLXA 3T1HQ 1XMOQ 2AWNA 1NBWA 3K7UC 4DR5L 1PH4A 2ZM6L 2Q2UA 4A93G 1VQJA 3FKIH 3S1MH 2WB1E 3BU2A 3PCOB 2PI2E 3GTJH 1Q1EA 2ALYB 3OYYA 4DV1Q 1K8GA 3S17H 1HZCA 2NVYH 2V1CC 3M4PA 2F4VL 4L5SA 5LMUQ 1Q1BA 1NE3A 3GD7A 3UDXA 1PH6A 3NELA 4L5RC 2EQSA 4DUZQ 4BXXH 2NVQH 4IFDI 3HOXG 1KL9A 1PVOA 2E2IH 1I50H 4B3SQ 4IPDA 1YEZA 4HJAA 1WCMG 1SRUA 3H3VH 1IBML 5C0XJ 3UDGA 5FLMH 5GADC 5JJKA 2R7ZH 1AE3A 1JB7A 4J15A 2D0PA 1YNXA 3RLNA 2IT1A 2CKZB 1MJEA 1GM5A 3S1NH 1PV4A 1I94L 1QVGA 3HOWH 4JI8Q 2PMZE 5GROA 1B7YB 4LFCQ 1U0LA 5LMNL 4BY7G 4GOPB 1K9MC 2GVAA 2H5XA 4KI0A 3AFQA 4YCUA 5DLQE 2ZJPA 1K73C 1HNZL 1IBLQ 2UUBL 4DR6Q 2E5LQ 2RF4A 3A0JA 4GN5A 1Q81C 1JE5A 2VQFQ 4KHPQ 4WJ4A 1EYGA 3UE1A 2K50A 3TS2A 1E7ZA 4DR5Q 3PIPA 2ZM6Q 4GN3B 1VQDA 2Z0SA 3E9HA 1WYDA 1N9WA 4QJFA 1GVPA 2LXJA 4A3EG 3KF6A 2YTXA 4JOIC 2E2HH 5HY6A 5IYCG 2A8VA 2R7DA 1HNWL 5C4XG 1YHQA 4POGA 2JK8A 4A3KH 1S72A 2F4VQ 2JA6H 1OXUA 3GTOH 3GTGH 4A3BG 4DR1L 3RN5A 1FL0A 3HOUH 1BKBA 4PZ7A 1UE6A 2I5HA 4IFDG 1K3RA 1VQFA 3L0OA 3CP0A 2NVXH 2IX1A 3OTOL 1J5EQ 5AJ3L 1GKHA 4LUOA 4O0AA 1ASZA 3CCQA 3TS0A 1A0IA 4A3FH 3TRZA 1WOCA 4XIGS 4PZ6A 4LF8L 5JEAG 1XNQQ 2B3GA 1L1OA 1YI2A 2K4KA 4HJ8A 4RMFA 2UU9L 2AWOA 1I94Q 3SGIA 1K0RA 1WFQA 4OXPA 2UXDL 1X56A 5LMNQ 4OO1I 1OXVA 3HOYH 2VW9A 3ULLA 1OXTA 5IP7H 1LUZA 2WAQE 3HKZG 4YCWA 1YJ9A 1NJIC 1HNZQ 2UUBQ 3PO3G 1HR0Q 4AQYL 2NZOA 3ER0A 2MQHA 4A3DH 2JA5G 1HNXQ 1EUJA 1SR3A 2Y0SG 5C3EH 1YZ6A 1UEBA 3I4MG 5J3BA 4LFAL 3CC2A 2WP8J 2PQAB 4HIDA 3S1QH 5C0XI 1AH9A 5ELNA 1K83H 2WB1G 1I3QH 3KJPA 3H3VI 3GTMH 1Z9FA 1YJWA 4BBSG 2ASBA 1W2BA 5JEAJ 4A3KG 2VZAA 1H95A 4PG3A 4AH6A 3CCUA 3RNUA 2BH2A 3G6EA 1PH2A 1PH1A 3BJUA 1HR0W 3CCMA 2B29A 3ZJYC 1T9HA 4A3MH 2JEAI 1NTGA 1VQAA 4LUZA 2K52A 1KHIA 4YWMA 2KENA 4OWXB 4X66L 3STBC 3J81c 4A3JG 5EAYA 1I5FA 4GS3A 4DR2Q 3S14H 4LF8Q 2Z6KA 1QVCA 1VQ4A 2OTLA 4P75A 1XMQL 1EQRA 1SROA 2ATWA 3F2DA 1DGSA 3F2BA 3FKIG 1HZBA 3KFUA 2UUCL 3J80c 2ZJQA 4P74A 1PH9A 3KDFB 4BY1H 4BA2I 2JJQA 4YY3L 4JOIA 1KQSA 1FVIA 2N78A 4ALPA 3DLLA 4DV7L 4AQYQ 2NVTH 5IYDH 4X62Q 1TWAH 4JI3L 2IX0A 2CWPA 3KLWA 4JI7L 4BXXG 2GN5A 1RL2A 3NEMA 4X64Q 1Y1WH 1N36L 4EQ5A 2R92H 4LFAQ 4A3LH 5JJIA 5C0XG 3CCLA 1XPRA 5IP9H 2VQEL 4C2MH 4JC0A 3U4ZA 2C35B 3I4OA 5FLMG 3CCJA 4GKKL 2R7ZG 3F8TA 1Q8KA 2YTYA 3PO2H 4LF6L 1P8LA 4DR3L 3I56A 2ID0A 4DR4Q 3I55A 4LFBL 4MNOA 1A8VA 3HOWG 1V1QA 1YHAA 4B3TQ 4DUYL 4GOPC 4X65L 4B3RL 1SLJA 3W1BA 2R7FA 5GQOA 4A3GH 4X66Q 5GAEC 1YBYA 4NPSA 3CCVA 3I4NH 1N34L 1G51A 4XTCS 1YHBA 4IOCA 2Q2TA 1GO3E 2CQOA 1X55A 2RCNA 2ZTEA 4IPHA 4GNXB 4NXML 4P73A 3HOVH 4DR7L 4DV2L 1SFOH 1VCIA
chains in the Genus database with same CATH superfamily
4LF9L 1LM0A 1LT5D 2ZXRA 4NB3A 3DWPA 4DV3L 1QOHA 2AKWB 5T1IA 5M3MH 2GVBA 4A3KG 2F0PA 2WAQG 4NDXA 2JA6G 3TS2A 3OMCA 1G91A 5E4WC 2KECA 1VQOA 3J80E 4F87A 3Q0AA 1NR4A 1HTLD 3F1ZA 5FLXc 4LF6Q 2F3IA 3KBGA 2PI2A 4F8MA 1STNA 1TKWB 4H02A 3HOYG 2M2LA 2RHQB 4B9WA 4ILWA 1JJ2A 1X32A 1HHVA 4FF1A 2KBNA 1ZEQX 1WTXA 4DV4L 1YNNC 1C9OA 3D3RA 1LTGD 1XPUA 3IRBA 4JI1Q 5CV7A 2E2HB 2K32A 2N3SA 4HIOA 3FDTA 2KUMA 4FXKC 2QF7A 4G4KA 1BUVT 1IL8A 3EVQA 1A63A 3MAQA 5LHY1 3SK6A 3CC7A 4A3MG 4B3ML 3PUVA 5HGQA 2K03A 3RD4A 1HZ9A 1RF2D 2F0OA 4GLAC 3DM1A 1V9PA 1X65A 3RR5A 5G3LF 1EWIA 3E6ZX 5E7NA 2F0TA 1CK1A 1T5EA 3H0GB 1VMPA 1ASYA 4C3JB 2WIIB 3J7AV 4QCLA 2B2TC 1HNWQ 4JI4L 1G6ZA 3ERQA 5LMNW 4DR1Q 5EQ0A 3ITPA 4V190 5JVG3 1JJCB 1AE2A 3QO2A 3T16A 5IOCA 4YHHL 2CHBD 4R4IA 1KC8C 1NUCA 4XT3B 1GD7A 3WOFA 2DNEA 2MO1A 3GTMB 2UXDQ 2CWAA 2Q8IB 4DV5L 3TP7A 2EYOA 2N49A 1SE2A 1LV9A 4IUVA 1PDQA 1IKLA 1EY6A 1M4VA 2JA7H 1SYFA 4I7ZC 4BBRH 2QA4A 1Q7YC 3NBHB 4N8FA 3CCEA 1HFGA 2BCOA 3TN2A 1JORA 3S2HH 1KABA 3HKSA 3K7AH 4CJ2C 4X3UA 5FOBB 3K57A 4DAVA 4RGTA 4A3CH 3S2DB 4JI6L 1TY2A 3KYHC 2E74C 1Q12A 1K8MA 1S5DD 1PH5A 1B50A 1B1ZA 3SDZA 1X3EA 1N8RC 4Z9CB 2Z6BA 4DXFA 2VUMH 2A1AA 3J80L 2R6GA 2MO0A 5C4JH 3Q8DA 2D0OA 4NXNQ 2AQ3B 3BVGA 4C3HG 4DR3Q 2IPKD 1DXMA 2PZUA 1J5EL 4MTKA 3OW2A 3J81i 2O2LD 2B63H 4AYBG 1YVCA 2L55A 1IXRA 2P5ZX 1XNQL 3A56A 2F0FA 3OHXC 2DUDA 1V1PA 1CKMA 2NN6I 5M5XH 4LMQD 1YNJC 1PH7A 4X3SA 4CDFC 4LF9Q 4MZ9A 1EFWA 2XWJB 4KHZA 4L63B 1E2WA 3T1YQ 1A3TA 1MKHA 1HNXL 2RCFA 1BVSA 1KTKA 1G291 1ICFB 1D8LA 1SE8A 5C5LA 1FR3A 5TSSA 1R4QB 3UDIA 1M90C 2R93G 1VQLA 1DOMA 2B39A 3HOZG 1GHKA 1EY4A 4JI0Q 1F2YA 2XRQD 2X6LA 1I6VC 2HHHQ 3NP8A 3HOXB 2PNHA 4DR2L 2FXQA 2HIXA 2UXBL 1TWGH 3UE0A 2E2JB 5I6WA 3CPFA 3TBIB 2WFWA 5C4ZA 4U68A 4HJ7A 1Q82C 3SR1A 3I2ZA 2WACA 3VYSA 1I6HB 4JPBW 4BY7B 1IW7D 3CAMA 1QVFA 3D4WA 3K80C 1WVLA 1Z47A 1PRTD 4DV4Q 3GTKH 4IFDH 4KLKA 4X62L 2YU9H 3DHQA 1C48A 1CQFA 1N32Q 2NTTA 4R8NA 2VY3A 2VL6A 3GDEA 5JEAH 3H09A 2K01A 2MUYA 2Z4HA 1ET9A 4B3MQ 2EJMA 1ZKOA 3W1GA 1EYDA 2QEJC 3D6WA 5EKKA 3CCRA 5C44G 4R4CA 3MVVA 3ERSX 2A73B 1HRJA 1DYQA 5ELOA 2IWHA 2JE6I 2OQKA 4TVAB 2EXDA 4DAYB 3E5SA 1GXDC 4OX9Q 4UP7A 3PF5A 5C6AA 3J7A5 4XDXA 1KD1C 1SN8A 1D5XC 4YHHQ 3GV3A 3RZDB 2JYOA 1VQPA 3IL8A 3BG3A 1ONLA 1PZID 2IHEA 5E1FA 5M3FG 3A74A 2JA5B 2Y0SB 1I4RA 4JI5Q 5IT9L 4DV5Q 5KYIA 4DNTB 3CF5A 4IPGA 4LNQA 1TWHB 1XMOQ 1SYDA 1NBWA 2AWNA 3K7UC 1Y8NB 1HPCA 1VQJA 2K5QA 3P75A 2Q2UA 4A93G 4J8QA 2WB1E 3BU2A 3PCOB 3OYYA 3S17H 1D1KA 1HZCA 2B2WC 4L5SA 3EFXD 3SVMA 3UDXA 4L5RC 2NVQH 2F0GA 1KL9A 3NBHA 1WCMG 1LTSD 3FKIB 4H44C 3UDGA 2EYPA 1JB7A 2SEBD 1H9JA 2D0PA 3GTJB 2N55A 2FINB 2CKZB 1TR5A 1MJEA 1GM5A 1YNND 1LT3D 3HOWH 1PZJD 2PMZE 1B7YB 5GROA 1DD2A 5L37A 1ENFA 2GVAA 2PW5A 4KI0A 5DLQE 2ZJPA 1K9MC 2JA8G 4DR6Q 2UUBL 4KTAA 3OPOA 1A3VA 1BXTA 1JOOA 3WOEA 1RHPA 4GN5A 1E7ZA 2XSCA 4GN3B 2Z0SA 1UAPA 1WYDA 1XYIA 1N9WA 1F2LA 1RJTA 3KK7A 4QJFA 1GVPA 3S1NB 1DJRD 1CTMA 5M5XB 5C4XG 4POGA 1B3QA 1EU4A 4FF2A 1BKBA 4PZ7A 4HEDA 1VQFA 4CKEA 1EFID 1PTOF 3OTOL 1J5EQ 2SDFA 1ASZA 3I8ZA 4HCEA 1WOCA 4XIGS 4LF8L 4DK1A 1XNQQ 2B3GA 1H9SA 4A3KB 2WAQB 2DJGC 4OO1I 5LMNQ 1HNZQ 4BWGB 1LUZA 3PO3G 3HKZG 5E4XA 3EQLC 1ESRA 1MBYA 2NZOA 2B2WA 1M8AA 1HNXQ 4FXDA 5C3EH 4LFAL 3RUZA 4DXGA 4HIDA 3S1QH 5C0XI 2XN9C 5ELNA 3KJPA 4N8X1 2F0EA 4BBSG 3X3MA 3GQBA 3HOYB 2VZAA 1ML0D 1GOZA 4IUUA 3G6EA 1PH1A 3NTHA 1HR0W 2B29A 2KEDA 1NTGA 4G57A 4OWXB 3MZ5A 4Q5VA 4A3JG 5EAYA 1I5FA 4GS3A 4DR2Q 1QVCA 4DU9A 1DGSA 4ZUIA 3U9OA 5ELCA 2KVMA 1WTVA 2EYMA 3J80c 1BOSA 2NN6H 4A3MB 2N78A 3DLLA 4AQYQ 4X62Q 2D2CC 2IX0A 4KHVA 1HTPA 5J39A 5CV5A 1Y1WH 4FXGC 1PFNA 5JJIA 5C0XG 3CCLA 1XPRA 2VQEL 5FLMG 1KAAA 1PZKD 3F8TA 4LF6L 3A7AB 3HRZC 3I56A 1VDZA 1STYA 4LFBL 1CFMA 1A8VA 1V1QA 3BDLA 1I4PA 1HQMC 1SLJA 5I6YA 1YBYA 1G51A 1PYWD 2CQOA 1X55A 2ZTEA 1QG7A 2QCPX 3SEBA 4GNXB 3H3VC 4A3GH 3TZUA 1VCIA 1XMQL 1E22A 1ET6A 4DAYA 2UUCQ 4JG2A 3J81E 4TRDA 5JPMC 1Q46A 1VF5C 3G48A 4JI1L 3SE0A 2OTJA 5JAVA 3S17B 1LT6D 3NUCA 4JVZA 1ZXTA 1D7QA 2SNMA 3HFZB 1FNUA 4CGYB 5KNBA 3CCSA 5K36H 3QOJA 1RCVD 1KNAA 1AP0A 2AUJD 3CQZB 4RH6A 4B3RQ 4B9XA 4UAIA 1LACA 2KCMA 4POFA 4C1NK 4DV2Q 4A3DG 2TSSA 1PH8A 4EGVA 3A5ZB 5JVH3 2X6GA 2QGQA 3HG9A 5CORA 3N52A 5GAGC 2L1BA 3KOJA 2D62A 2A68C 4QIWE 3H0GH 3M85A 1L0YB 4C3JH 3VR5A 3I73A 4NMZA 1M1KC 5FJ8H 3CHBD 4QY7A 2NZHA 4O1NA 1HJPA 2CFMA 3F2CA 1K0SA 4G7OC 2RHSB 1CUKA 1JICA 2OT2A 1J8IA 2AQ2B 4GZYC 1CSQA 3PIOA 4XYQA 2OEOA 4C3HB 2JQOA 5CV6A 2EVBA 3ZYYX 1ILQA 1BNZA 4ZQ3A 3RN2A 1TU2B 4AYBB 3KJOA 2ZXOA 4XT1B 3PUWA 1SMXA 3GTLB 2A6EC 1CKOA 1GUTA 4DGZA 2E75C 3OTOQ 1RD9D 1KRSA 2N8NA 3ULJA 4A3LG 2R92G 1O7ZA 3AB9A 2C9OA 2WINB 2FFKB 3J7ZC 4HIMA 4KKSA 1A15A 1UE5A 2J7ZA 3T51B 4IN3A 1I4GA 5CGKA 3JAML 4OWWB 1TWCB 2R93B 3I4NG 4JBKA 2A69C 1PTOB 4GNXC 3HS0C 4HJ5A 3HOZB 2TMPA 1VQBA 4ME3A 3HOVG 2HDLA 3MFYA 4DKAC 4IO9A 4RCNA 1DONA 1J9OA 4WJWA 2F0WA 4ODGA 5BN3A 3S2DH 2RDFA 3BZCA 1LYLA 3NBIA 4NXNL 1DCZA 3A7LA 4K5WA 2JXMB 2EJFC 2XVSA 3D4RA 3PSIA 4QMGA 3PIO3 3C2PA 4LF4Q 4N9PA 4DK3C 1VQNA 1Y8PB 2CCZA 1E1OA 5H1SE 3H6MA 3GTPB 3BZKA 2FMCA 3F2UA 4QQBX 1EIHA 4CKCA 4R4QA 3DEPA 1V1OA 5BR8Q 4DA2A 3J81L 5CR3A 3T1YL 3K5OA 4L8JA 4ID6A 2UXCQ 3MHBA 4DNRB 4LUVA 4C3IG 4OO1H 4MHEA 1EIFA 4V0BA 1OO9B 5FO8B 2I46A 3W5OA 2E76C 2K05A 5LL6X 4P72A 4A3GB 5C44B 1HXYD 3TP5A 5EKLA 2AMCB 2VQEQ 1Q3LA 4LJZC 4EQNA 1DZ1A 2F0DA 4JI0L 3ULPA 2PCFB 2HHHL 4LFBQ 3OWFA 4Y7NB 2HCCA 3Q6SA 2K28A 5IWAQ 2JA9A 3AEVA 4JBWA 1B9NA 3HEJA 4FDBA 1B3AA 3AFPA 4OWTB 5IY0A 2RDGA 1WTQA 5M3FB 4GNXA 2V4DA 4YWKA 1XMQQ 1YITA 1A62A 4JW0A 3NXWA 2MNAA 3HOXH 1Y8OB 5IYBG 2QDLA 5F2DA 1N32L 4NP5A 4RAUC 1OXXK 2K5HA 4A93B 1U4PA 2E2JH 5EJWA 3EIVA 1SYEA 2K75A 4HTHA 1AZPA 1PA6A 2HIVA 2VB3X 1XX8A 1I6HH 4BY7H 1O80A 1VQ8A 5DNFA 5G3LD 1TT2A 1MI2A 3KUPA 2RQXA 1YIJA 4GLVB 4RG1A 1EWCA 1WCMB 1AN8A 2F0SA 4FO2A 2LXKA 1XPOA 1PTOC 5BN5A 4TKOB 4OX9L 5IYCH 4IALA 2PQEA 1MIUA 3PGZA 1X9NA 4L5QA 2F0KA 4ZUJA 1C7YA 2JA8B 2ZJRA 1RODA 3M4YA 3SK5A 4IFDJ 1NAPA 4QUFA 4DPGA 3MTSA 4RWSC 4X64L 2BA1A 4C56C 3PUXA 3T56B 2O5JC 4JI5L 1HQRD 4RGNA 3EBEA 3PUZA 4PMCA 1XMOL 5C4XB 2UUAQ 1F77A 3RZOB 1QZHA 4FF3A 3RZDH 3OIQA 1QJOA 2ZTCA 1EOTA 3NTKA 3FPPA 3HP3A 2JA5H 2A19A 3L7ZC 3CXCA 3K81C 1Y1VG 1BR9A 3VA5A 1VQCA 3W3AA 4QUCA 3CMEA 3JAMi 1TWHH 3I4LA 1VQMA 5D14A 3FHWA 1N33Q 5M5YB 1ENAA 1VF7A 3VR3A 2MFIA 3PO3B 3HKZB 4A3IG 1WD1A 1O7IA 1FNWA 4MTNA 3GO5A 1QZGA 2XGTA 4DR6L 5IT9E 3DXJC 1EY5A 1JOKA 3I91A 1PH4A 4BBSB 3FKIH 2PI2E 3GTJH 3NQTA 1S5FD 3I90A 2PW7A 3NHHA 4Q0FA 1A2UA 4A3JB 1TS2A 3NELA 5LL6S 3Q24A 3VA7A 1F9RA 4K14A 2EPBA 1SRUA 3H3VH 4OEMB 3LWUA 4ZKBB 5GADC 5JJKA 2CH4W 4CDDC 3S1NH 2L11A 2NVYB 4JI8Q 2A68D 1K3BC 1U0LA 4XQNA 5LMNL 4J6HA 1B4OA 2SOBA 3AFQA 1HNZL 2IJ0A 1I50B 2K50A 4MIUA 2KQ3A 1A3UA 2ZM6Q 3K58A 3E9HA 3FPUB 2B8GA 2LXJA 3T53B 4A3EG 3OOCA 4JOIC 2A8VA 2K7VA 1YHQA 2NWGA 2JK8A 3URYA 4A3KH 2F4VQ 2JA6H 4A3BG 1EY8A 2EY1A 1MSHA 1UE6A 4KN7C 3A8IE 2D5DA 1IKMA 1AZQA 5AJ3L 2A6ED 1GKHA 4K6DA 4O0AA 3CCQA 3TS0A 1A0IA 3TRZA 4RHRA 4OHJA 5JPNC 1WTRA 4PZ6A 1YI2A 2K4KA 5ELEA 1XWEA 1WFQA 5C3XA 4OXPA 1X56A 3HOYH 2VW9A 1C4QA 2Q8TA 3KLSA 3ULLA 1OXTA 1F9QA 2IW3A 5IODA 1NJIC 4YCWA 4KD4A 1ENCA 3M7GA 3K5MA 4AQYL 2MQHA 1QE6A 4XQQA 1SR3A 5J1ZA 1HUNA 1YZ6A 2A69D 3OSOA 3I4MG 2PQAB 5JJZA 3IFTA 1AH9A 1B2TA 2WB1G 4PMBA 2EYHA 3R93A 1ESFA 4P2CB 2ASBA 1W2BA 4IZ8A 3P1HA 3CCUA 4XXEA 2BH2A 3MEHA 5ELFA 1PH2A 1QNKA 3V2TA 2JEAI 4A3MH 3NK9A 4A3DB 5FK9C 4YWMA 4LAAA 2ZXPA 3J81c 1B44D 2Z6KA 1ICWA 3DUZA 5K5PA 1K83B 1I3QB 3BDOA 3F2BA 2KEEA 3KFUA 2UUCL 4P74A 1S5CD 2JJQA 1CQVA 4JOIA 2N88A 3ND8A 1KQSA 2NUCA 1GHJA 3C1FA 5I9OA 2CWPA 4BXXG 2GN5A 4PNYA 4X64Q 1KDCA 3LWEA 4CHTB 4X6AH 3I4OA 2R7ZG 1E0BA 4K6LA 2F0MA 3NPPA 4KY6A 5IGBA 4IQZA 2J4XA 1D2BA 4RHSA 4J1MA 4B3RL 2R7FA 3CCVA 1N34L 5CBEE 4IOCA 1GO3E 2RSNA 2R92B 4P73A 4DV2L 1J6QA 2MHVA 3S16H 5EGTA 1VQEA 4A75A 1GUWA 4RCOA 1SNDA 3E0EA 3CQZH 4DV7Q 1NMFA 1IBKL 3A8KE 3MEFA 3HOUG 4FF4A 3SK8A 3HOVB 4CBVA 3Q23A 3JC66 4X3TA 4A3FG 1FJGL 1EEFD 4KJNA 1SE3A 1SEBD 2LY7A 4L5TA 4S3SA 1W6KA 1PYBA 4R9WA 2EY5A 3G71A 1EQQA 1L2FA 5IP7G 2I5LX 1QCBD 3BVMA 4DV6L 4NXMQ 1UWVA 1R9TH 1W6JA 2OCEA 1PTOD 3L3OC 2ES2A 1KIXA 3EJIA 3X3NA 2K1BA 3CC4A 4C3HH 2I0QA 2KHIA 2F0HA 1HA5A 1XTDA 5CMDA 3FP9A 1VQ9A 1B9MA 2PZTA 1SJHD 4C3IB 1EIYB 2JA6B 2I07B 2F3WA 1EL0A 1QUQB 3GTLH 2L9HA 1H9MA 4HN7A 4GKJQ 4HMIA 1PHJA 2JEBI 1O7YA 4ZKCB 4QL5A 4R4TA 2A6HC 5M5WB 2SNSA 3D4DA 5FLXL 3S9WA 1A6XA 4BY1G 1NCVA 3L2PA 4NW2A 1TWCH 5IYDG 2XWBB 1IYJB 3S1RB 4UPAA 4LF4L 1TY0A 3NWSA 4TQUS 1SXTA 2QEXA 2R93H 1PTOH 3HOZH 2BH8A 5AJ3Q 4LF7Q 3QG1A 5IP9G 2AUKA 1JE4A 5IGGA 4I7AA 1SNMA 3CMAA 1PYSB 2QILA 3PO2G 1KRTA 5BR8L 1WTOA 3UI2A 1RIPA 4O2DA 3JAME 3T1HL 2D9UA 3A54A 3AMUA 2UXCL 3D0FA 3BDCA 2K5WA 2F0IA 1F2MA 1X3GA 3GTPH 2MP1A 1LTAD 3EN2A 1Z6HA 5LMUL 2RA4A 4G7HC 2PQAA 1BBWA 2BE5C 5M3MG 1SNQA 4KN4C 1WTWA 1Z7TA 1GUGA 3FVQA 4KK7A 1C0AA 1E1TA 4R1JA 4DN4M 5IWAL 1WD0A 2YV5A 1G6PA 2VXWA 2B8FA 3SK4A 2X69A 5JOBA 4JBJA 5C44H 3K59A 4PV1C 4ZRZA 4DFAA 4KHPL 4Y7NH 2DNCA 3M4OB 3P7JA 3KF6B 1Q86C 1O78A 3PV0A 4HMJA 4IPCA 3L9AX 2PPBC 1SDFA 5M3FH 1YJNA 3N6RA 3DMUA 4ZCKA 3S16B 4LWCA 2DY7A 1OXSC 2L15A 1Y1VB 1BCPF 4K0KQ 4ZYSA 2E8GA 1L1OB 3C46A 4I65A 3WWVA 4KD3A 5ELBA 4A93H 3MXGA 1N34Q 4OL7A 2PNRC 3A5UA 3U58A 4A3IB 1FGBD 4EQPA 3M7NA 2BDNA 4KJOA 3G6JB 3BS1A 1HR0L 1TXYA 3KLRA 2HCIA 4OGQC 3MXUA 1G2TA 3UDFA 3E0JA 1IBKQ 1X3QA 1WCMH 1E2ZA 4OIJA 4C1NI 4GN4B 4LF5Q 2MPMA 1CI3M 2OXPA 2Q2IA 1R9TB 5IGDA 3J81j 1HA6A 1CA5A 2UUAL 1K8OA 4IJLA 1FJGQ 1GJXA 1JB3A 1U9RA 2JA8H 3GP7A 4RKLA 1W3SA 4N9TA 4H0LC 5IIFA 5AFWA 1JMCA 2O4XA 1B53A 2HQLA 4DV6Q 1B70B 2I5MX 1FNVA 5C4XH 1H9KA 3RZOH 1N33L 2XIWA 5IT9c 2JA7G 1EEID 1V8QA 5FKAC 3T13A 4BBRG 2WV6D 5I2XA 3AU7A 1C8CA 4K5XA 4FVMA 1JR0D 1BBUA 2YYZA 4U673 4DV0Q 3FRPB 5ELDA 4A3EB 3W2DA 4DR4L 3PQIA 4A76A 1QUQA 3TEHB 4A3BB 4IJHA 2L5TA 5M5YH 5DM73 4CJ0B 4B3TL 1TS4A 2DGYA 2G9HD 1JT8A 3PO3H 3M3YB 4JYAQ 4A3CG 2VNUD 3RLOA 1L0XB 1DOLA 1STHA 1CM9A 1SE4A 2KCCA 2FHTA 1KXLA 2FMMA 1STGA 3LX0A 3CW2C 1VQHA 4BBSH 2VUMG 1JWSD 3KF8B 4HIKA 1X3FA 1SMYC 4DNIA 3M9BA 4JI2Q 2WKDA 4JI8L 1VMCA 3J7AF 2B2YC 4UP9A 3VR4A 1XNRQ 1U4LA 5I4DA 4A3JH 1L1OC 2B63G 2OQ0A 1P16A 2WB1B 2Y0SE 4OIKA 3T1HQ 3A55A 2ZM6L 1QNUA 3MA2B 2CH4A 2O5IC 1EY9A 1EIGA 3DEOA 3S15B 1Q1EA 2K6AA 2JN4A 4DV1Q 1K8GA 5BN4A 2NVYH 2V1CC 2F4VL 4FNFA 5LMUQ 1Q1BA 1MD2D 3QJYA 1BBXC 3IAYA 3GD7A 2EZVA 1PH6A 4IFDI 2B2VC 1F2ZA 2EQSA 4K2KA 1UEAB 1PVOA 4KV6A 1I50H 4IPDA 2J0TD 5C0XH 1YEZA 1TQOA 1IBML 5CV4A 5A2QL 5FLMH 3S1MB 1AE3A 1STEA 2PMZB 3RLNA 1Q8IA 4X3KA 2IT1A 2RDHA 1PV4A 1KLGD 5E3FA 1QVGA 3I70A 1MSGA 2EE1A 2M00A 4GOPB 3BZDB 4CDCC 1IBLQ 4HAEA 4RGOS 3A0JA 4K8IA 2E2IB 2CW0C 2F1MA 1JE5A 1EY7A 1EZ8A 3IKJA 3QIAA 3UE1A 1EYGA 4KHPQ 1K28A 3TP8A 4DR5Q 3PIPA 2R7ZB 1VQDA 1KNEA 4ZK9B 2PZWA 2A74C 3H91A 3MFGA 3KF6A 5HY6A 1FD7D 3C3LA 2R7DA 1CHPD 3OMGA 2A6HD 1S72A 4BS9A 3RN5A 1FL0A 2I5HA 4UDUC 4IFDG 1K3RA 3L0OA 2NVXH 3QR8A 2FJ2A 3SXHA 1AFPA 4LUOA 1IHZA 2B2YA 2K5DA 5D3IB 3I72A 2F0JA 1QWYA 2EYFA 1T5XD 5JEAG 1LABA 1BF4A 1L1OA 1SSOA 4RMFA 2UU9L 1I94Q 3SGIA 1K0RA 3GTOB 3R2IA 2IL8A 3GTGB 1UNSA 1OXVA 3BYYB 3OW7A 3HOUB 3P20A 1YJ9A 2WAQE 2F0QA 1DM0B 1HR0Q 5D65A 2K04A 4A3DH 1BCPB 1CHQD 4A3FB 3H94A 1R4PB 4RFBA 2B2VA 1CA6A 5J3BA 3CC2A 1K83H 1I3QH 4ULLA 5J22A 1RDPD 5JEAJ 3PIP3 5HURA 1GUNA 4E6IA 4PG3A 4AH6A 3RNUA 2ENBA 3E3XA 1XTCD 2F0NA 4ME5A 1QB5D 3CCMA 2BE5D 3ZJYC 1T9HA 4LUZA 4XYOA 2K52A 2KENA 3STBC 2LFNA 1G8ZD 1VQ4A 2OTLA 1EQRA 1SROA 2ATWA 3F2DA 3K0YA 2VB2X 3VYTA 1RTNA 3KDFB 2Z1CA 3R8BA 4H13C 4ALPA 4DV7L 4HSVA 4JI7L 3S14B 4KY7A 4A3LH 4EQ5A 3MXPA 2R92H 1UUPA 2KHSA 2C35B 4GKKL 3A8JE 1Q8KA 2YTYA 1P8LA 2NYZD 4DR4Q 2ID0A 4BY1B 3I55A 5KEEA 4MNOA 1MGSA 3HOWG 4B3TQ 2AQ1B 4GOPC 2NVTB 3HZXA 1TWAB 5GQOA 4X66Q 5GAEC 3I4NH 1YHBA 1JWUD 1LO5D 2Q2TA 2RCNA 4IPHA 4DR7L 4NXML 5KNDA 3HOVH 2Z9HA 4C2MB 4IUQA 1SJED 1S3OA 3OIPA 1EQTA 4IUTA 5EBCA 1E3PA 1X3PA 4HCSA 3PO2B 5IGCA 3I7FA 2NBFA 2LS01 5DM63 5KYLA 2B2TA 4YY3Q 5CV9A 1Y14B 2EY6A 3U50C 2EJGC 2L12A 3KF8A 4JI3Q 3S24A 2AHOB 2BDOA 2Z4IA 1N36Q 1K8AC 1SYGA 2BA0A 4RA8A 1SFOB 5ISRA 1LTID 2Z6KC 1KAWA 4GKJL 4FYDA 1PH3A 1WJJA 1II3A 4HJ9A 3K0XA 1VQ5A 3DWQA 3TSSA 1S5ED 5CYUA 1KDBA 3AQQA 4TSSA 5M3MB 1KDAA 4RGMA 5GAHC 4DUYQ 4X65Q 1HUMA 1H9SB 2QW7A 1SNCA 2EIFA 4C3IH 2F0UA 4DK0A 1CKNB 3M4QA 1BCPC 4YCVA 4IOAA 2IHFA 5C3EG 3ICEA 3K5NA 4IUNA 4QIWB 1IBMQ 4DV3Q 4LF7L 1WI5A 3JAMc 4PZ8A 1EZ6A 1VQGA 1PMRA 2ICIA 3MWYW 3NSWA 5M5WH 3E9IA 2KHJA 2PO4A 4R8IA 2BOSA 2VS1A 1PFSA 2QDBA 4O42A 2F0VA 3O13A 1MJCA 4GOPA 2LSSA 2CVRA 4ZAIA 3VDYA 2NVXB 3S1RH 4H7BA 2F4IA 3NWTA 4P71A 4JCVE 4K2LA 3DM3A 4JV5L 2EYJA 5NUCA 5IYBH 5FLXE 3GTQH 3U4VA 4PMWA 2NN6G 2EDGA 4BA1I 1Y69U 4AYBE 3RLFA 4F7XA 3CD6A 1SBBB 1VQ7A 3U9SA 4LW1A 3PUYA 1Y1WG 1PRTF 4MN3A 2HDMA 1XJVA 1EU3A 2EOTA 3TZDA 4R4OA 4IURA 4CKBA 3K5LA 2UU9Q 2HUGA 1SMYD 2Q2HA 2HD3A 1STAA 2NTSA 2JSOA 2XRSD 5FO7B 2K5VA 2MGSA 5CC4A 1JOQA 1HCZA 5CBAE 1LTBD 4A3GG 3Q22A 5COYA 3V96A 3RMHA 3B6YA 1B8AA 1ZYRC 4A4IA 1I4XA 4ABNA 1BQQT 3G7LA 1JJGA 4ZLTF 3AYHB 4DF7A 4JI4Q 1I4QA 4DUZL 2M9VA 1JC7A 1JCKB 1L0WA 4APVA 4B3SL 2F3VA 3GV6A 1TWFH 4K0KL 1E24A 2F52A 2PYKA 1XXGA 3M4OH 1OTCA 1LTLA 3HGBA 4M1UB 3VYRA 1F9PA 2JA7B 4LFCL 1TVXA 4BBRB 2F0LA 5K36G 1LT4D 1O7LA 2R3ZA 1D6EC 2E5LL 4EX5A 1SNOA 5KGUA 2VQFL 4HR7B 2IY5B 1NSNS 3PMFA 1Y1VH 3S2HB 1LTRD 3KDFA 1V43A 2CW0D 3K7AB 5KIXA 3KLSX 3I4NB 1H9RA 1RTOA 3D8GA 1PFMA 4JI7Q 2KCNA 2EYLA 3NENA 1EY0A 4LF5L 1DOKA 2NB0A 2OF1A 4A3IH 1VQKA 5A35A 5HGTA 4GKKQ 3H0GG 4C3JG 5EKIA 3CU7A 5FJ8G 4Y52H 1VQIA 3TMEA 4RKBA 2VUMB 5DEHA 4OONA 4DR7Q 5C4JB 3K8AA 3J80i 1TS5A 1HZAA 1TS3A 4OELB 4JI6Q 3ND9A 4YWLA 4F88A 3CPWA 3G4SA 2G9DA 2B63B 1I4HA 1UE7A 3J7YW 4CJ1B 4K8JA 3R3OA 1SYBA 2G5DA 1JWMD 2B2UC 2Q8RE 3CKIB 4UY8C 1IL2A 4DV0L 4HSPA 1CT1D 1LTTD 4WFN3 1EQVA 1Q90A 1S40A 1VQ6A 5IGFA 3PF4A 2JP1A 2OWOA 2RBMA 5JJLA 2HT1A 2DY8A 3WDNA 4JYAL 1UE1A 3LNNA 2L0CA 1KLUD 1PFBA 2HQEA 4KY5A 3STBD 5KRUA 3H15A 1X6OA 1U5KA 1FGUA 3SHLA 4XQJA 1WTHA 2RVLA 4A3EH 1CKNA 1HH2P 4L6TB 4DK6C 1NMGA 4A3BH 2QKIC 1BDOA 4KKUA 2E2DC 2CQAA 4JI2L 3M3YH 3BVZA 1NY4A 1XNRL 3EA6A 3TREA 1TWGB 3CRLC 5IE8A 4JBMA 3GTQB 3TQYA 1HFNA 1IZ6A 4AIMA 4WORA 5I9PA 1X54A 1RKNA 3MXNB 5C4HA 2IX3A 1MHWC 3R2TA 2XTIA 3GTKB 2YU9B 3IFDA 4QGUA 2K14A 1CSPA 4DV1L 4JV5Q 4WJ3M 2KJXA 3LGJA 4KMUC 2UXBQ 4EVOA 1D5MC 3D31A 4EQOA 1SYCA 3I4MH 4IUPA 1EOVA 4CDEC 4DAMA 4OO1G 3I3CA 2YTVA 3ONAB 1VS0A 3KBXA 2C5CA 2B2UA 2K5NA 3S15H 2KCTA 1CZGA 3VR2A 3HKZE 2NZ1D 3QOLA 1SAPA 1IBLL 1E2VA 4UP8A 3MC0B 2ZTDA 4JK1C 5I2YA 4GLXA 2GA4B 1TWFB 1SNPA 4M8AA 4DR5L 3S1MH 2ZT9C 1PRTB 2ALYB 3QWNA 3TP6A 1AEXA 3VR6A 4B08A 3M4PA 2MJ8A 1NE3A 4BXXH 4QF4A 4DUZQ 1QILA 3V05A 4LK1C 3HOXG 1TIID 2E2IH 4B3SQ 4HJAA 1YNJD 1BCPD 3TDQA 5C0XJ 5A2QE 2R7ZH 4J15A 1YNXA 1D1IA 1I94L 2K33A 1EWHA 4LFCQ 3C1EA 4NKLA 4BY7G 4YCUA 2H5XA 1PXUA 1K73C 1AW7A 2NVQB 2E5LQ 2RF4A 1Q81C 2VQFQ 4WJ4A 4YIJA 5CV8A 4WRDA 1GUSA 1F9SA 1WTPA 5EPLA 5IGEA 3DWAA 2H1EA 3T4AC 2YTXA 2E2HH 5IYCG 3HOWB 1HNWL 2DJFC 3GTOH 1OXUA 2L4NA 3GTGH 4DR1L 1U4MA 1FYCA 5T1GA 3HOUH 3CP0A 1CZWA 2IX1A 1NNXA 1IYVA 3FEWX 2RSOA 4A3FH 3NE5B 2ICEC 4UHVA 5EBDA 2EXZA 3D6CA 4HJ8A 2AWOA 5M9OA 5DAUA 2UXDL 1S5BD 1U4RA 1IYUA 5IP7H 3CRKC 2UUBQ 3EROA 3K6OA 3NQIA 4DAPA 3FMCA 3ER0A 3OWEB 2JA5G 2RKSA 1EUJA 1D5ZC 2Y0SG 1UEBA 2LMCB 2WP8J 3H3VI 3GTMH 2F03A 1ZYRD 1Z9FA 1GUOA 1YJWA 3BYTB 2LKVA 1H95A 5EPJA 3BJUA 4QB4A 1VQAA 1KHIA 4X66L 5C3EB 3S14H 4LF8Q 3S1QB 4P75A 3QB3A 2EY2A 2DN8A 3FKIG 1HZBA 1IW7C 1EYAA 1A2TA 4K5VA 5D3DA 1PRTC 3NTIA 5FO9B 2ZJQA 2XNAC 1PH9A 3VYUA 4BY1H 4BA2I 4YY3L 2H4OA 2R61A 1FVIA 5KNCA 2NVTH 5IYDH 1TWAH 4JI3L 3KLWA 1NR2A 1JQYD 5EPKA 1RL2A 3NEMA 1LLRD 1N36L 4LFAQ 4PQXA 5IP9H 1EYCA 4FP5D 1S4ZA 2KA7A 4C2MH 4JC0A 2Z8LA 5C5MA 3U4ZA 3CCJA 3I4MB 1G2SA 3PO2H 4DR3L 2KOLA 2A5HA 4G7ZC 1ILPA 1YHAA 1PLFA 3MXNA 4DUYL 4X65L 3W1BA 1BO0A 4NPSA 1V1PB 4XTCS 2WKCA 1Y1WB 1STBA 4KKTA 5C3WA 1SFOH
chains in the Genus database with same CATH topology
4LF9L 1LM0A 1E22A 1S3OA 3S16H 1VQEA 4A75A 1E3PA 4NB3A 2UUCQ 4JG2A 3I7FA 4DV3L 2AKWB 5M3MH 2GVBA 4YY3Q 1Q46A 3E0EA 2WAQG 3CQZH 1NMFA 1Y14B 3G48A 4JI1L 3U50C 4DV7Q 3MEFA 1IBKL 2JA6G 2JA8G 4JI3Q 3HOUG 3S24A 2AHOB 1VQOA 1N36Q 1K8AC 2BA0A 3JC66 2Z6KC 1D7QA 1KAWA 4GKJL 1PH3A 1WJJA 4A3FG 1FJGL 3F1ZA 4HJ9A 3K0XA 3HFZB 5FLXc 1VQ5A 1J6QA 4LF6Q 2F3IA 3CCSA 3AQQA 2PI2A 4L5TA 1PYBA 5GAHC 4DUYQ 4X65Q 4B3RQ 4H02A 3HOYG 3G71A 1EQQA 2RHQB 1L2FA 2EIFA 2I5LX 4C3IH 5IP7G 2KCMA 4POFA 4DV6L 4NXMQ 1CKNB 3M4QA 1JJ2A 1UWVA 4DV2Q 4YCVA 4A3DG 4IOAA 2IHFA 1R9TH 2OCEA 1PH8A 2KBNA 3A5ZB 5C3EG 3ICEA 2ES2A 2QGQA 1KIXA 1IBMQ 4DV3Q 4LF7L 1WI5A 3JAMc 5GAGC 4DV4L 4PZ8A 1VQGA 1C9OA 3KOJA 2D62A 1XPUA 3CC4A 3IRBA 4C3HH 2I0QA 2KHIA 4QIWE 3H0GH 4JI1Q 5M5WH 1XTDA 3E9IA 4C3JH 2KHJA 2N3SA 3FP9A 3M85A 4HIOA 1VQ9A 1M1KC 5FJ8H 1EIYB 2VS1A 4QY7A 2NZHA 1PFSA 1A63A 3CC7A 4A3MG 1HJPA 2CFMA 3F2CA 4B3ML 1MJCA 1QUQB 4GOPA 2LSSA 3PUVA 5HGQA 3VDYA 3GTLH 1HZ9A 4GKJQ 2RHSB 4GLAC 3S1RH 1CUKA 1PHJA 2JEBI 1V9PA 1X65A 3RR5A 4P71A 1CSQA 1EWIA 4JCVE 5E7NA 3PIOA 4QL5A 4R4TA 3DM3A 2JQOA 4JV5L 1ASYA 3RN2A 5IYBH 1HNWQ 3KJOA 4JI4L 5LMNW 4BY1G 3GTQH 3U4VA 4PMWA 2NN6G 3PUWA 4BA1I 4DR1Q 1SMXA 4AYBE 3L2PA 3RLFA 1TWCH 5IYDG 1JJCB 1AE2A 3CD6A 1IYJB 2R93H 4UPAA 4LF4L 1CKOA 4TQUS 4YHHL 2QEXA 1VQ7A 3OTOQ 4LW1A 1KRSA 2N8NA 3PUYA 3ULJA 2BH8A 1Y1WG 3HOZH 5AJ3Q 2R92G 4A3LG 4LF7Q 4R4IA 3J7ZC 1XJVA 5IP9G 4HIMA 4R4OA 1KC8C 1GD7A 1UE5A 3CMAA 2UU9Q 1PYSB 2MO1A 3PO2G 1KRTA 5BR8L 2Q2HA 2UXDQ 2CWAA 4DV5L 1RIPA 4O2DA 4OWWB 2K5VA 2N49A 3T1HL 2UXCL 3D0FA 3I4NG 4JBKA 4GNXC 4HJ5A 4A3GG 1VQBA 4ME3A 3HOVG 4DKAC 1X3GA 3GTPH 3B6YA 1B8AA 4IO9A 4A4IA 3EN2A 2JA7H 5LMUL 4BBRH 1JJGA 2PQAA 3AYHB 2QA4A 1Q7YC 1BBWA 4JI4Q 3BZCA 3S2DH 4DUZL 3NBHB 1LYLA 5M3MG 4NXNL 3CCEA 1L0WA 3PSIA 4APVA 4B3SL 1TWFH 3S2HH 4LF4Q 4K0KL 1C0AA 1E24A 4DK3C 2F52A 3HKSA 1VQNA 2CCZA 1E1OA 1E1TA 3M4OH 3K7AH 4R1JA 5IWAL 1OTCA 5H1SE 2YV5A 1G6PA 1LTLA 3BZKA 4QQBX 4JBJA 5C44H 4LFCL 4R4QA 4A3CH 4JI6L 5K36G 5BR8Q 2E5LL 3KYHC 4EX5A 4KHPL 2VQFL 3T1YL 2IY5B 1Q12A 1Y1VH 2UXCQ 1PH5A 4Y7NH 3KDFA 4LUVA 1V43A 1X3EA 1EIFA 3KF6B 1Q86C 1N8RC 3W5OA 4JI7Q 3PV0A 3NENA 2VUMH 4IPCA 2A1AA 4P72A 4LF5L 2R6GA 2MO0A 5C4JH 4A3IH 1VQKA 2AMCB 5M3FH 1YJNA 2VQEQ 3Q8DA 2D0OA 4LWCA 4GKKQ 1OXSC 2L15A 4NXNQ 4DR3Q 4JI0L 1J5EL 3H0GG 3ULPA 3OW2A 2HHHL 3J81i 4LFBQ 4K0KQ 2B63H 5FJ8G 4AYBG 4Y52H 1VQIA 1YVCA 2E8GA 1L1OB 1IXRA 5IWAQ 3WWVA 2JA9A 1XNQL 3AEVA 4A93H 4JBWA 1N34Q 2OTJA 4FDBA 4OONA 3A5UA 3AFPA 2DUDA 2NN6I 1CKMA 4OWTB 5IY0A 5M5XH 3U58A 3K8AA 4DR7Q 1PH7A 3J80i 4GNXA 1HZAA 4YWKA 1XMQQ 4JI6Q 3M7NA 4LF9Q 1YITA 4MZ9A 1EFWA 1A62A 4YWLA 1HR0L 1TXYA 4KHZA 3T1YQ 3CPWA 3G4SA 1MKHA 2MNAA 3HOXH 1HNXL 1UE7A 5IYBG 1BVSA 3UDFA 1G291 1N32L 1IBKQ 1D8LA 1WCMH 2K5HA 1OXXK 1SE8A 2E2JH 4UY8C 1M90C 3UDIA 4DV0L 1IL2A 2R93G 4GN4B 4LF5Q 3EIVA 2K75A 1VQLA 1PA6A 3HOZG 2HIVA 2Q2IA 3J81j 2UUAL 4IJLA 1S40A 1FJGQ 1I6HH 1VQ6A 3PF4A 4BY7H 2OWOA 4JI0Q 5JJLA 1VQ8A 2JA8H 2HT1A 1W3SA 2HHHQ 4JYAL 2PNHA 1UE1A 1YIJA 4GLVB 4RG1A 4DR2L 2FXQA 2HIXA 1JMCA 1TWGH 2LXKA 3UE0A 2UXBL 1XPOA 3STBD 3CPFA 2HQLA 1X6OA 2WFWA 3H15A 4DV6Q 1U5KA 1FGUA 4HJ7A 1Q82C 4A3EH 4OX9L 1B70B 3I2ZA 2I5MX 5IYCH 1CKNA 1HH2P 1MIUA 5C4XH 3PGZA 1X9NA 4DK6C 3RZOH 1NMGA 1N33L 4A3BH 3CAMA 4L5QA 5IT9c 3K80C 1C7YA 1QVFA 2JA7G 2ZJRA 1Z47A 4DV4Q 3GTKH 4KLKA 4X62L 4BBRG 2YU9H 4JI2L 3M3YH 4IFDJ 1NY4A 4DPGA 1N32Q 4X64L 2BA1A 1XNRL 3TREA 5IE8A 3PUXA 4JI5L 4JBMA 2VY3A 2YYZA 1BBUA 2VL6A 3GDEA 4DV0Q 3EBEA 3TQYA 4B3MQ 3PUZA 1XMOL 3W1GA 1IZ6A 4DR4L 4AIMA 4A76A 1QUQA 2UUAQ 3TEHB 1QZHA 4IJHA 1X54A 3MXNB 3RZDH 3CCRA 5M5YH 5C44G 4B3TL 2XTIA 4R4CA 2DGYA 1JT8A 4QGUA 2ZTCA 2K14A 3PO3H 4JYAQ 1CSPA 3ERSX 4DV1L 4A3CG 4JV5Q 4WJ3M 2VNUD 5ELOA 3RLOA 2JE6I 3LGJA 2JA5H 2A19A 3L7ZC 2UXBQ 2OQKA 4TVAB 4X6AH 3CXCA 1Y1VG 3K81C 3D31A 1VQCA 2EXDA 1KXLA 4DAYB 3I4MH 4DAMA 1EOVA 3CMEA 4OX9Q 4UP7A 3PF5A 3J7A5 4OO1G 1KD1C 3JAMi 1SN8A 3CW2C 1TWHH 2YTVA 1VQMA 1VS0A 4YHHQ 1VQHA 4BBSH 3FHWA 2VUMG 1N33Q 2K5NA 1VQPA 3KF8B 2MFIA 4HIKA 1X3FA 4A3IG 4DNIA 3M9BA 2IHEA 5M3FG 4JI2Q 3S15H 1O7IA 2KCTA 4JI8L 4MTNA 3A74A 3HKZE 4UP9A 1XNRQ 3GO5A 1QZGA 2XGTA 4DR6L 4A3JH 1IBLL 4JI5Q 4UP8A 4DV5Q 1L1OC 2B63G 2OQ0A 1P16A 2ZTDA 3CF5A 4IPGA 2Y0SE 4LNQA 4GLXA 3T1HQ 1XMOQ 2AWNA 1NBWA 3K7UC 4DR5L 1PH4A 2ZM6L 2Q2UA 4A93G 1VQJA 3FKIH 3S1MH 2WB1E 3BU2A 3PCOB 2PI2E 3GTJH 1Q1EA 2ALYB 3OYYA 4DV1Q 1K8GA 3S17H 1HZCA 2NVYH 2V1CC 3M4PA 2F4VL 4L5SA 5LMUQ 1Q1BA 1NE3A 3GD7A 3UDXA 1PH6A 3NELA 4L5RC 2EQSA 4DUZQ 4BXXH 2NVQH 4IFDI 3HOXG 1KL9A 1PVOA 2E2IH 1I50H 4B3SQ 4IPDA 1YEZA 4HJAA 1WCMG 1SRUA 3H3VH 1IBML 5C0XJ 3UDGA 5FLMH 5GADC 5JJKA 2R7ZH 1AE3A 1JB7A 4J15A 2D0PA 1YNXA 3RLNA 2IT1A 2CKZB 1MJEA 1GM5A 3S1NH 1PV4A 1I94L 1QVGA 3HOWH 4JI8Q 2PMZE 5GROA 1B7YB 4LFCQ 1U0LA 5LMNL 4BY7G 4GOPB 1K9MC 2GVAA 2H5XA 4KI0A 3AFQA 4YCUA 5DLQE 2ZJPA 1K73C 1HNZL 1IBLQ 2UUBL 4DR6Q 2E5LQ 2RF4A 3A0JA 4GN5A 1Q81C 1JE5A 2VQFQ 4KHPQ 4WJ4A 1EYGA 3UE1A 2K50A 3TS2A 1E7ZA 4DR5Q 3PIPA 2ZM6Q 4GN3B 1VQDA 2Z0SA 3E9HA 1WYDA 1N9WA 4QJFA 1GVPA 2LXJA 4A3EG 3KF6A 2YTXA 4JOIC 2E2HH 5HY6A 5IYCG 2A8VA 2R7DA 1HNWL 5C4XG 1YHQA 4POGA 2JK8A 4A3KH 1S72A 2F4VQ 2JA6H 1OXUA 3GTOH 3GTGH 4A3BG 4DR1L 3RN5A 1FL0A 3HOUH 1BKBA 4PZ7A 1UE6A 2I5HA 4IFDG 1K3RA 1VQFA 3L0OA 3CP0A 2NVXH 2IX1A 3OTOL 1J5EQ 5AJ3L 1GKHA 4LUOA 4O0AA 1ASZA 3CCQA 3TS0A 1A0IA 4A3FH 3TRZA 1WOCA 4XIGS 4PZ6A 4LF8L 5JEAG 1XNQQ 2B3GA 1L1OA 1YI2A 2K4KA 4HJ8A 4RMFA 2UU9L 2AWOA 1I94Q 3SGIA 1K0RA 1WFQA 4OXPA 2UXDL 1X56A 5LMNQ 4OO1I 1OXVA 3HOYH 2VW9A 3ULLA 1OXTA 5IP7H 1LUZA 2WAQE 3HKZG 4YCWA 1YJ9A 1NJIC 1HNZQ 2UUBQ 3PO3G 1HR0Q 4AQYL 2NZOA 3ER0A 2MQHA 4A3DH 2JA5G 1HNXQ 1EUJA 1SR3A 2Y0SG 5C3EH 1YZ6A 1UEBA 3I4MG 5J3BA 4LFAL 3CC2A 2WP8J 2PQAB 4HIDA 3S1QH 5C0XI 1AH9A 5ELNA 1K83H 2WB1G 1I3QH 3KJPA 3H3VI 3GTMH 1Z9FA 1YJWA 4BBSG 2ASBA 1W2BA 5JEAJ 4A3KG 2VZAA 1H95A 4PG3A 4AH6A 3CCUA 3RNUA 2BH2A 3G6EA 1PH2A 1PH1A 3BJUA 1HR0W 3CCMA 2B29A 3ZJYC 1T9HA 4A3MH 2JEAI 1NTGA 1VQAA 4LUZA 2K52A 1KHIA 4YWMA 2KENA 4OWXB 4X66L 3STBC 3J81c 4A3JG 5EAYA 1I5FA 4GS3A 4DR2Q 3S14H 4LF8Q 2Z6KA 1QVCA 1VQ4A 2OTLA 4P75A 1XMQL 1EQRA 1SROA 2ATWA 3F2DA 1DGSA 3F2BA 3FKIG 1HZBA 3KFUA 2UUCL 3J80c 2ZJQA 4P74A 1PH9A 3KDFB 4BY1H 4BA2I 2JJQA 4YY3L 4JOIA 1KQSA 1FVIA 2N78A 4ALPA 3DLLA 4DV7L 4AQYQ 2NVTH 5IYDH 4X62Q 1TWAH 4JI3L 2IX0A 2CWPA 3KLWA 4JI7L 4BXXG 2GN5A 1RL2A 3NEMA 4X64Q 1Y1WH 1N36L 4EQ5A 2R92H 4LFAQ 4A3LH 5JJIA 5C0XG 3CCLA 1XPRA 5IP9H 2VQEL 4C2MH 4JC0A 3U4ZA 2C35B 3I4OA 5FLMG 3CCJA 4GKKL 2R7ZG 3F8TA 1Q8KA 2YTYA 3PO2H 4LF6L 1P8LA 4DR3L 3I56A 2ID0A 4DR4Q 3I55A 4LFBL 4MNOA 1A8VA 3HOWG 1V1QA 1YHAA 4B3TQ 4DUYL 4GOPC 4X65L 4B3RL 1SLJA 3W1BA 2R7FA 5GQOA 4A3GH 4X66Q 5GAEC 1YBYA 4NPSA 3CCVA 3I4NH 1N34L 1G51A 4XTCS 1YHBA 4IOCA 2Q2TA 1GO3E 2CQOA 1X55A 2RCNA 2ZTEA 4IPHA 4GNXB 4NXML 4P73A 3HOVH 4DR7L 4DV2L 1SFOH 1VCIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF9 L;  1LM0 A;  1E22 A;  1S3O A;  3S16 H;  1VQE A;  4A75 A;  1E3P A;  4NB3 A;  2UUC Q;  4JG2 A;  3I7F A;  4DV3 L;  2AKW B;  5M3M H;  2GVB A;  4YY3 Q;  1Q46 A;  3E0E A;  2WAQ G;  3CQZ H;  1NMF A;  1Y14 B;  3G48 A;  4JI1 L;  3U50 C;  4DV7 Q;  3MEF A;  1IBK L;  2JA6 G;  2JA8 G;  4JI3 Q;  3HOU G;  3S24 A;  2AHO B;  1VQO A;  1N36 Q;  1K8A C;  2BA0 A;  3JC6 6;  2Z6K C;  1D7Q A;  1KAW A;  4GKJ L;  1PH3 A;  1WJJ A;  4A3F G;  1FJG L;  3F1Z A;  4HJ9 A;  3K0X A;  3HFZ B;  5FLX c;  1VQ5 A;  1J6Q A;  4LF6 Q;  2F3I A;  3CCS A;  3AQQ A;  2PI2 A;  4L5T A;  1PYB A;  5GAH C;  4DUY Q;  4X65 Q;  4B3R Q;  4H02 A;  3HOY G;  3G71 A;  1EQQ A;  2RHQ B;  1L2F A;  2EIF A;  2I5L X;  4C3I H;  5IP7 G;  2KCM A;  4POF A;  4DV6 L;  4NXM Q;  1CKN B;  3M4Q A;  1JJ2 A;  1UWV A;  4DV2 Q;  4YCV A;  4A3D G;  4IOA A;  2IHF A;  1R9T H;  2OCE A;  1PH8 A;  2KBN A;  3A5Z B;  5C3E G;  3ICE A;  2ES2 A;  2QGQ A;  1KIX A;  1IBM Q;  4DV3 Q;  4LF7 L;  1WI5 A;  3JAM c;  5GAG C;  4DV4 L;  4PZ8 A;  1VQG A;  1C9O A;  3KOJ A;  2D62 A;  1XPU A;  3CC4 A;  3IRB A;  4C3H H;  2I0Q A;  2KHI A;  4QIW E;  3H0G H;  4JI1 Q;  5M5W H;  1XTD A;  3E9I A;  4C3J H;  2KHJ A;  2N3S A;  3FP9 A;  3M85 A;  4HIO A;  1VQ9 A;  1M1K C;  5FJ8 H;  1EIY B;  2VS1 A;  4QY7 A;  2NZH A;  1PFS A;  1A63 A;  3CC7 A;  4A3M G;  1HJP A;  2CFM A;  3F2C A;  4B3M L;  1MJC A;  1QUQ B;  4GOP A;  2LSS A;  3PUV A;  5HGQ A;  3VDY A;  3GTL H;  1HZ9 A;  4GKJ Q;  2RHS B;  4GLA C;  3S1R H;  1CUK A;  1PHJ A;  2JEB I;  1V9P A;  1X65 A;  3RR5 A;  4P71 A;  1CSQ A;  1EWI A;  4JCV E;  5E7N A;  3PIO A;  4QL5 A;  4R4T A;  3DM3 A;  2JQO A;  4JV5 L;  1ASY A;  3RN2 A;  5IYB H;  1HNW Q;  3KJO A;  4JI4 L;  5LMN W;  4BY1 G;  3GTQ H;  3U4V A;  4PMW A;  2NN6 G;  3PUW A;  4BA1 I;  4DR1 Q;  1SMX A;  4AYB E;  3L2P A;  3RLF A;  1TWC H;  5IYD G;  1JJC B;  1AE2 A;  3CD6 A;  1IYJ B;  2R93 H;  4UPA A;  4LF4 L;  1CKO A;  4TQU S;  4YHH L;  2QEX A;  1VQ7 A;  3OTO Q;  4LW1 A;  1KRS A;  2N8N A;  3PUY A;  3ULJ A;  2BH8 A;  1Y1W G;  3HOZ H;  5AJ3 Q;  2R92 G;  4A3L G;  4LF7 Q;  4R4I A;  3J7Z C;  1XJV A;  5IP9 G;  4HIM A;  4R4O A;  1KC8 C;  1GD7 A;  1UE5 A;  3CMA A;  2UU9 Q;  1PYS B;  2MO1 A;  3PO2 G;  1KRT A;  5BR8 L;  2Q2H A;  2UXD Q;  2CWA A;  4DV5 L;  1RIP A;  4O2D A;  4OWW B;  2K5V A;  2N49 A;  3T1H L;  2UXC L;  3D0F A;  3I4N G;  4JBK A;  4GNX C;  4HJ5 A;  4A3G G;  1VQB A;  4ME3 A;  3HOV G;  4DKA C;  1X3G A;  3GTP H;  3B6Y A;  1B8A A;  4IO9 A;  4A4I A;  3EN2 A;  2JA7 H;  5LMU L;  4BBR H;  1JJG A;  2PQA A;  3AYH B;  2QA4 A;  1Q7Y C;  1BBW A;  4JI4 Q;  3BZC A;  3S2D H;  4DUZ L;  3NBH B;  1LYL A;  5M3M G;  4NXN L;  3CCE A;  1L0W A;  3PSI A;  4APV A;  4B3S L;  1TWF H;  3S2H H;  4LF4 Q;  4K0K L;  1C0A A;  1E24 A;  4DK3 C;  2F52 A;  3HKS A;  1VQN A;  2CCZ A;  1E1O A;  1E1T A;  3M4O H;  3K7A H;  4R1J A;  5IWA L;  1OTC A;  5H1S E;  2YV5 A;  1G6P A;  1LTL A;  3BZK A;  4QQB X;  4JBJ A;  5C44 H;  4LFC L;  4R4Q A;  4A3C H;  4JI6 L;  5K36 G;  5BR8 Q;  2E5L L;  3KYH C;  4EX5 A;  4KHP L;  2VQF L;  3T1Y L;  2IY5 B;  1Q12 A;  1Y1V H;  2UXC Q;  1PH5 A;  4Y7N H;  3KDF A;  4LUV A;  1V43 A;  1X3E A;  1EIF A;  3KF6 B;  1Q86 C;  1N8R C;  3W5O A;  4JI7 Q;  3PV0 A;  3NEN A;  2VUM H;  4IPC A;  2A1A A;  4P72 A;  4LF5 L;  2R6G A;  2MO0 A;  5C4J H;  4A3I H;  1VQK A;  2AMC B;  5M3F H;  1YJN A;  2VQE Q;  3Q8D A;  2D0O A;  4LWC A;  4GKK Q;  1OXS C;  2L15 A;  4NXN Q;  4DR3 Q;  4JI0 L;  1J5E L;  3H0G G;  3ULP A;  3OW2 A;  2HHH L;  3J81 i;  4LFB Q;  4K0K Q;  2B63 H;  5FJ8 G;  4AYB G;  4Y52 H;  1VQI A;  1YVC A;  2E8G A;  1L1O B;  1IXR A;  5IWA Q;  3WWV A;  2JA9 A;  1XNQ L;  3AEV A;  4A93 H;  4JBW A;  1N34 Q;  2OTJ A;  4FDB A;  4OON A;  3A5U A;  3AFP A;  2DUD A;  2NN6 I;  1CKM A;  4OWT B;  5IY0 A;  5M5X H;  3U58 A;  3K8A A;  4DR7 Q;  1PH7 A;  3J80 i;  4GNX A;  1HZA A;  4YWK A;  1XMQ Q;  4JI6 Q;  3M7N A;  4LF9 Q;  1YIT A;  4MZ9 A;  1EFW A;  1A62 A;  4YWL A;  1HR0 L;  1TXY A;  4KHZ A;  3T1Y Q;  3CPW A;  3G4S A;  1MKH A;  2MNA A;  3HOX H;  1HNX L;  1UE7 A;  5IYB G;  1BVS A;  3UDF A;  1G29 1;  1N32 L;  1IBK Q;  1D8L A;  1WCM H;  2K5H A;  1OXX K;  1SE8 A;  2E2J H;  4UY8 C;  1M90 C;  3UDI A;  4DV0 L;  1IL2 A;  2R93 G;  4GN4 B;  4LF5 Q;  3EIV A;  2K75 A;  1VQL A;  1PA6 A;  3HOZ G;  2HIV A;  2Q2I A;  3J81 j;  2UUA L;  4IJL A;  1S40 A;  1FJG Q;  1I6H H;  1VQ6 A;  3PF4 A;  4BY7 H;  2OWO A;  4JI0 Q;  5JJL A;  1VQ8 A;  2JA8 H;  2HT1 A;  1W3S A;  2HHH Q;  4JYA L;  2PNH A;  1UE1 A;  1YIJ A;  4GLV B;  4RG1 A;  4DR2 L;  2FXQ A;  2HIX A;  1JMC A;  1TWG H;  2LXK A;  3UE0 A;  2UXB L;  1XPO A;  3STB D;  3CPF A;  2HQL A;  1X6O A;  2WFW A;  3H15 A;  4DV6 Q;  1U5K A;  1FGU A;  4HJ7 A;  1Q82 C;  4A3E H;  4OX9 L;  1B70 B;  3I2Z A;  2I5M X;  5IYC H;  1CKN A;  1HH2 P;  1MIU A;  5C4X H;  3PGZ A;  1X9N A;  4DK6 C;  3RZO H;  1NMG A;  1N33 L;  4A3B H;  3CAM A;  4L5Q A;  5IT9 c;  3K80 C;  1C7Y A;  1QVF A;  2JA7 G;  2ZJR A;  1Z47 A;  4DV4 Q;  3GTK H;  4KLK A;  4X62 L;  4BBR G;  2YU9 H;  4JI2 L;  3M3Y H;  4IFD J;  1NY4 A;  4DPG A;  1N32 Q;  4X64 L;  2BA1 A;  1XNR L;  3TRE A;  5IE8 A;  3PUX A;  4JI5 L;  4JBM A;  2VY3 A;  2YYZ A;  1BBU A;  2VL6 A;  3GDE A;  4DV0 Q;  3EBE A;  3TQY A;  4B3M Q;  3PUZ A;  1XMO L;  3W1G A;  1IZ6 A;  4DR4 L;  4AIM A;  4A76 A;  1QUQ A;  2UUA Q;  3TEH B;  1QZH A;  4IJH A;  1X54 A;  3MXN B;  3RZD H;  3CCR A;  5M5Y H;  5C44 G;  4B3T L;  2XTI A;  4R4C A;  2DGY A;  1JT8 A;  4QGU A;  2ZTC A;  2K14 A;  3PO3 H;  4JYA Q;  1CSP A;  3ERS X;  4DV1 L;  4A3C G;  4JV5 Q;  4WJ3 M;  2VNU D;  5ELO A;  3RLO A;  2JE6 I;  3LGJ A;  2JA5 H;  2A19 A;  3L7Z C;  2UXB Q;  2OQK A;  4TVA B;  4X6A H;  3CXC A;  1Y1V G;  3K81 C;  3D31 A;  1VQC A;  2EXD A;  1KXL A;  4DAY B;  3I4M H;  4DAM A;  1EOV A;  3CME A;  4OX9 Q;  4UP7 A;  3PF5 A;  3J7A 5;  4OO1 G;  1KD1 C;  3JAM i;  1SN8 A;  3CW2 C;  1TWH H;  2YTV A;  1VQM A;  1VS0 A;  4YHH Q;  1VQH A;  4BBS H;  3FHW A;  2VUM G;  1N33 Q;  2K5N A;  1VQP A;  3KF8 B;  2MFI A;  4HIK A;  1X3F A;  4A3I G;  4DNI A;  3M9B A;  2IHE A;  5M3F G;  4JI2 Q;  3S15 H;  1O7I A;  2KCT A;  4JI8 L;  4MTN A;  3A74 A;  3HKZ E;  4UP9 A;  1XNR Q;  3GO5 A;  1QZG A;  2XGT A;  4DR6 L;  4A3J H;  1IBL L;  4JI5 Q;  4UP8 A;  4DV5 Q;  1L1O C;  2B63 G;  2OQ0 A;  1P16 A;  2ZTD A;  3CF5 A;  4IPG A;  2Y0S E;  4LNQ A;  4GLX A;  3T1H Q;  1XMO Q;  2AWN A;  1NBW A;  3K7U C;  4DR5 L;  1PH4 A;  2ZM6 L;  2Q2U A;  4A93 G;  1VQJ A;  3FKI H;  3S1M H;  2WB1 E;  3BU2 A;  3PCO B;  2PI2 E;  3GTJ H;  1Q1E A;  2ALY B;  3OYY A;  4DV1 Q;  1K8G A;  3S17 H;  1HZC A;  2NVY H;  2V1C C;  3M4P A;  2F4V L;  4L5S A;  5LMU Q;  1Q1B A;  1NE3 A;  3GD7 A;  3UDX A;  1PH6 A;  3NEL A;  4L5R C;  2EQS A;  4DUZ Q;  4BXX H;  2NVQ H;  4IFD I;  3HOX G;  1KL9 A;  1PVO A;  2E2I H;  1I50 H;  4B3S Q;  4IPD A;  1YEZ A;  4HJA A;  1WCM G;  1SRU A;  3H3V H;  1IBM L;  5C0X J;  3UDG A;  5FLM H;  5GAD C;  5JJK A;  2R7Z H;  1AE3 A;  1JB7 A;  4J15 A;  2D0P A;  1YNX A;  3RLN A;  2IT1 A;  2CKZ B;  1MJE A;  1GM5 A;  3S1N H;  1PV4 A;  1I94 L;  1QVG A;  3HOW H;  4JI8 Q;  2PMZ E;  5GRO A;  1B7Y B;  4LFC Q;  1U0L A;  5LMN L;  4BY7 G;  4GOP B;  1K9M C;  2GVA A;  2H5X A;  4KI0 A;  3AFQ A;  4YCU A;  5DLQ E;  2ZJP A;  1K73 C;  1HNZ L;  1IBL Q;  2UUB L;  4DR6 Q;  2E5L Q;  2RF4 A;  3A0J A;  4GN5 A;  1Q81 C;  1JE5 A;  2VQF Q;  4KHP Q;  4WJ4 A;  1EYG A;  3UE1 A;  2K50 A;  3TS2 A;  1E7Z A;  4DR5 Q;  3PIP A;  2ZM6 Q;  4GN3 B;  1VQD A;  2Z0S A;  3E9H A;  1WYD A;  1N9W A;  4QJF A;  1GVP A;  2LXJ A;  4A3E G;  3KF6 A;  2YTX A;  4JOI C;  2E2H H;  5HY6 A;  5IYC G;  2A8V A;  2R7D A;  1HNW L;  5C4X G;  1YHQ A;  4POG A;  2JK8 A;  4A3K H;  1S72 A;  2F4V Q;  2JA6 H;  1OXU A;  3GTO H;  3GTG H;  4A3B G;  4DR1 L;  3RN5 A;  1FL0 A;  3HOU H;  1BKB A;  4PZ7 A;  1UE6 A;  2I5H A;  4IFD G;  1K3R A;  1VQF A;  3L0O A;  3CP0 A;  2NVX H;  2IX1 A;  3OTO L;  1J5E Q;  5AJ3 L;  1GKH A;  4LUO A;  4O0A A;  1ASZ A;  3CCQ A;  3TS0 A;  1A0I A;  4A3F H;  3TRZ A;  1WOC A;  4XIG S;  4PZ6 A;  4LF8 L;  5JEA G;  1XNQ Q;  2B3G A;  1L1O A;  1YI2 A;  2K4K A;  4HJ8 A;  4RMF A;  2UU9 L;  2AWO A;  1I94 Q;  3SGI A;  1K0R A;  1WFQ A;  4OXP A;  2UXD L;  1X56 A;  5LMN Q;  4OO1 I;  1OXV A;  3HOY H;  2VW9 A;  3ULL A;  1OXT A;  5IP7 H;  1LUZ A;  2WAQ E;  3HKZ G;  4YCW A;  1YJ9 A;  1NJI C;  1HNZ Q;  2UUB Q;  3PO3 G;  1HR0 Q;  4AQY L;  2NZO A;  3ER0 A;  2MQH A;  4A3D H;  2JA5 G;  1HNX Q;  1EUJ A;  1SR3 A;  2Y0S G;  5C3E H;  1YZ6 A;  1UEB A;  3I4M G;  5J3B A;  4LFA L;  3CC2 A;  2WP8 J;  2PQA B;  4HID A;  3S1Q H;  5C0X I;  1AH9 A;  5ELN A;  1K83 H;  2WB1 G;  1I3Q H;  3KJP A;  3H3V I;  3GTM H;  1Z9F A;  1YJW A;  4BBS G;  2ASB A;  1W2B A;  5JEA J;  4A3K G;  2VZA A;  1H95 A;  4PG3 A;  4AH6 A;  3CCU A;  3RNU A;  2BH2 A;  3G6E A;  1PH2 A;  1PH1 A;  3BJU A;  1HR0 W;  3CCM A;  2B29 A;  3ZJY C;  1T9H A;  4A3M H;  2JEA I;  1NTG A;  1VQA A;  4LUZ A;  2K52 A;  1KHI A;  4YWM A;  2KEN A;  4OWX B;  4X66 L;  3STB C;  3J81 c;  4A3J G;  5EAY A;  1I5F A;  4GS3 A;  4DR2 Q;  3S14 H;  4LF8 Q;  2Z6K A;  1QVC A;  1VQ4 A;  2OTL A;  4P75 A;  1XMQ L;  1EQR A;  1SRO A;  2ATW A;  3F2D A;  1DGS A;  3F2B A;  3FKI G;  1HZB A;  3KFU A;  2UUC L;  3J80 c;  2ZJQ A;  4P74 A;  1PH9 A;  3KDF B;  4BY1 H;  4BA2 I;  2JJQ A;  4YY3 L;  4JOI A;  1KQS A;  1FVI A;  2N78 A;  4ALP A;  3DLL A;  4DV7 L;  4AQY Q;  2NVT H;  5IYD H;  4X62 Q;  1TWA H;  4JI3 L;  2IX0 A;  2CWP A;  3KLW A;  4JI7 L;  4BXX G;  2GN5 A;  1RL2 A;  3NEM A;  4X64 Q;  1Y1W H;  1N36 L;  4EQ5 A;  2R92 H;  4LFA Q;  4A3L H;  5JJI A;  5C0X G;  3CCL A;  1XPR A;  5IP9 H;  2VQE L;  4C2M H;  4JC0 A;  3U4Z A;  2C35 B;  3I4O A;  5FLM G;  3CCJ A;  4GKK L;  2R7Z G;  3F8T A;  1Q8K A;  2YTY A;  3PO2 H;  4LF6 L;  1P8L A;  4DR3 L;  3I56 A;  2ID0 A;  4DR4 Q;  3I55 A;  4LFB L;  4MNO A;  1A8V A;  3HOW G;  1V1Q A;  1YHA A;  4B3T Q;  4DUY L;  4GOP C;  4X65 L;  4B3R L;  1SLJ A;  3W1B A;  2R7F A;  5GQO A;  4A3G H;  4X66 Q;  5GAE C;  1YBY A;  4NPS A;  3CCV A;  3I4N H;  1N34 L;  1G51 A;  4XTC S;  1YHB A;  4IOC A;  2Q2T A;  1GO3 E;  2CQO A;  1X55 A;  2RCN A;  2ZTE A;  4IPH A;  4GNX B;  4NXM L;  4P73 A;  3HOV H;  4DR7 L;  4DV2 L;  1SFO H;  1VCI A; 
#chains in the Genus database with same CATH topology
 4LF9 L;  1LM0 A;  1LT5 D;  2ZXR A;  4NB3 A;  3DWP A;  4DV3 L;  1QOH A;  2AKW B;  5T1I A;  5M3M H;  2GVB A;  4A3K G;  2F0P A;  2WAQ G;  4NDX A;  2JA6 G;  3TS2 A;  3OMC A;  1G91 A;  5E4W C;  2KEC A;  1VQO A;  3J80 E;  4F87 A;  3Q0A A;  1NR4 A;  1HTL D;  3F1Z A;  5FLX c;  4LF6 Q;  2F3I A;  3KBG A;  2PI2 A;  4F8M A;  1STN A;  1TKW B;  4H02 A;  3HOY G;  2M2L A;  2RHQ B;  4B9W A;  4ILW A;  1JJ2 A;  1X32 A;  1HHV A;  4FF1 A;  2KBN A;  1ZEQ X;  1WTX A;  4DV4 L;  1YNN C;  1C9O A;  3D3R A;  1LTG D;  1XPU A;  3IRB A;  4JI1 Q;  5CV7 A;  2E2H B;  2K32 A;  2N3S A;  4HIO A;  3FDT A;  2KUM A;  4FXK C;  2QF7 A;  4G4K A;  1BUV T;  1IL8 A;  3EVQ A;  1A63 A;  3MAQ A;  5LHY 1;  3SK6 A;  3CC7 A;  4A3M G;  4B3M L;  3PUV A;  5HGQ A;  2K03 A;  3RD4 A;  1HZ9 A;  1RF2 D;  2F0O A;  4GLA C;  3DM1 A;  1V9P A;  1X65 A;  3RR5 A;  5G3L F;  1EWI A;  3E6Z X;  5E7N A;  2F0T A;  1CK1 A;  1T5E A;  3H0G B;  1VMP A;  1ASY A;  4C3J B;  2WII B;  3J7A V;  4QCL A;  2B2T C;  1HNW Q;  4JI4 L;  1G6Z A;  3ERQ A;  5LMN W;  4DR1 Q;  5EQ0 A;  3ITP A;  4V19 0;  5JVG 3;  1JJC B;  1AE2 A;  3QO2 A;  3T16 A;  5IOC A;  4YHH L;  2CHB D;  4R4I A;  1KC8 C;  1NUC A;  4XT3 B;  1GD7 A;  3WOF A;  2DNE A;  2MO1 A;  3GTM B;  2UXD Q;  2CWA A;  2Q8I B;  4DV5 L;  3TP7 A;  2EYO A;  2N49 A;  1SE2 A;  1LV9 A;  4IUV A;  1PDQ A;  1IKL A;  1EY6 A;  1M4V A;  2JA7 H;  1SYF A;  4I7Z C;  4BBR H;  2QA4 A;  1Q7Y C;  3NBH B;  4N8F A;  3CCE A;  1HFG A;  2BCO A;  3TN2 A;  1JOR A;  3S2H H;  1KAB A;  3HKS A;  3K7A H;  4CJ2 C;  4X3U A;  5FOB B;  3K57 A;  4DAV A;  4RGT A;  4A3C H;  3S2D B;  4JI6 L;  1TY2 A;  3KYH C;  2E74 C;  1Q12 A;  1K8M A;  1S5D D;  1PH5 A;  1B50 A;  1B1Z A;  3SDZ A;  1X3E A;  1N8R C;  4Z9C B;  2Z6B A;  4DXF A;  2VUM H;  2A1A A;  3J80 L;  2R6G A;  2MO0 A;  5C4J H;  3Q8D A;  2D0O A;  4NXN Q;  2AQ3 B;  3BVG A;  4C3H G;  4DR3 Q;  2IPK D;  1DXM A;  2PZU A;  1J5E L;  4MTK A;  3OW2 A;  3J81 i;  2O2L D;  2B63 H;  4AYB G;  1YVC A;  2L55 A;  1IXR A;  2P5Z X;  1XNQ L;  3A56 A;  2F0F A;  3OHX C;  2DUD A;  1V1P A;  1CKM A;  2NN6 I;  5M5X H;  4LMQ D;  1YNJ C;  1PH7 A;  4X3S A;  4CDF C;  4LF9 Q;  4MZ9 A;  1EFW A;  2XWJ B;  4KHZ A;  4L63 B;  1E2W A;  3T1Y Q;  1A3T A;  1MKH A;  1HNX L;  2RCF A;  1BVS A;  1KTK A;  1G29 1;  1ICF B;  1D8L A;  1SE8 A;  5C5L A;  1FR3 A;  5TSS A;  1R4Q B;  3UDI A;  1M90 C;  2R93 G;  1VQL A;  1DOM A;  2B39 A;  3HOZ G;  1GHK A;  1EY4 A;  4JI0 Q;  1F2Y A;  2XRQ D;  2X6L A;  1I6V C;  2HHH Q;  3NP8 A;  3HOX B;  2PNH A;  4DR2 L;  2FXQ A;  2HIX A;  2UXB L;  1TWG H;  3UE0 A;  2E2J B;  5I6W A;  3CPF A;  3TBI B;  2WFW A;  5C4Z A;  4U68 A;  4HJ7 A;  1Q82 C;  3SR1 A;  3I2Z A;  2WAC A;  3VYS A;  1I6H B;  4JPB W;  4BY7 B;  1IW7 D;  3CAM A;  1QVF A;  3D4W A;  3K80 C;  1WVL A;  1Z47 A;  1PRT D;  4DV4 Q;  3GTK H;  4IFD H;  4KLK A;  4X62 L;  2YU9 H;  3DHQ A;  1C48 A;  1CQF A;  1N32 Q;  2NTT A;  4R8N A;  2VY3 A;  2VL6 A;  3GDE A;  5JEA H;  3H09 A;  2K01 A;  2MUY A;  2Z4H A;  1ET9 A;  4B3M Q;  2EJM A;  1ZKO A;  3W1G A;  1EYD A;  2QEJ C;  3D6W A;  5EKK A;  3CCR A;  5C44 G;  4R4C A;  3MVV A;  3ERS X;  2A73 B;  1HRJ A;  1DYQ A;  5ELO A;  2IWH A;  2JE6 I;  2OQK A;  4TVA B;  2EXD A;  4DAY B;  3E5S A;  1GXD C;  4OX9 Q;  4UP7 A;  3PF5 A;  5C6A A;  3J7A 5;  4XDX A;  1KD1 C;  1SN8 A;  1D5X C;  4YHH Q;  3GV3 A;  3RZD B;  2JYO A;  1VQP A;  3IL8 A;  3BG3 A;  1ONL A;  1PZI D;  2IHE A;  5E1F A;  5M3F G;  3A74 A;  2JA5 B;  2Y0S B;  1I4R A;  4JI5 Q;  5IT9 L;  4DV5 Q;  5KYI A;  4DNT B;  3CF5 A;  4IPG A;  4LNQ A;  1TWH B;  1XMO Q;  1SYD A;  1NBW A;  2AWN A;  3K7U C;  1Y8N B;  1HPC A;  1VQJ A;  2K5Q A;  3P75 A;  2Q2U A;  4A93 G;  4J8Q A;  2WB1 E;  3BU2 A;  3PCO B;  3OYY A;  3S17 H;  1D1K A;  1HZC A;  2B2W C;  4L5S A;  3EFX D;  3SVM A;  3UDX A;  4L5R C;  2NVQ H;  2F0G A;  1KL9 A;  3NBH A;  1WCM G;  1LTS D;  3FKI B;  4H44 C;  3UDG A;  2EYP A;  1JB7 A;  2SEB D;  1H9J A;  2D0P A;  3GTJ B;  2N55 A;  2FIN B;  2CKZ B;  1TR5 A;  1MJE A;  1GM5 A;  1YNN D;  1LT3 D;  3HOW H;  1PZJ D;  2PMZ E;  1B7Y B;  5GRO A;  1DD2 A;  5L37 A;  1ENF A;  2GVA A;  2PW5 A;  4KI0 A;  5DLQ E;  2ZJP A;  1K9M C;  2JA8 G;  4DR6 Q;  2UUB L;  4KTA A;  3OPO A;  1A3V A;  1BXT A;  1JOO A;  3WOE A;  1RHP A;  4GN5 A;  1E7Z A;  2XSC A;  4GN3 B;  2Z0S A;  1UAP A;  1WYD A;  1XYI A;  1N9W A;  1F2L A;  1RJT A;  3KK7 A;  4QJF A;  1GVP A;  3S1N B;  1DJR D;  1CTM A;  5M5X B;  5C4X G;  4POG A;  1B3Q A;  1EU4 A;  4FF2 A;  1BKB A;  4PZ7 A;  4HED A;  1VQF A;  4CKE A;  1EFI D;  1PTO F;  3OTO L;  1J5E Q;  2SDF A;  1ASZ A;  3I8Z A;  4HCE A;  1WOC A;  4XIG S;  4LF8 L;  4DK1 A;  1XNQ Q;  2B3G A;  1H9S A;  4A3K B;  2WAQ B;  2DJG C;  4OO1 I;  5LMN Q;  1HNZ Q;  4BWG B;  1LUZ A;  3PO3 G;  3HKZ G;  5E4X A;  3EQL C;  1ESR A;  1MBY A;  2NZO A;  2B2W A;  1M8A A;  1HNX Q;  4FXD A;  5C3E H;  4LFA L;  3RUZ A;  4DXG A;  4HID A;  3S1Q H;  5C0X I;  2XN9 C;  5ELN A;  3KJP A;  4N8X 1;  2F0E A;  4BBS G;  3X3M A;  3GQB A;  3HOY B;  2VZA A;  1ML0 D;  1GOZ A;  4IUU A;  3G6E A;  1PH1 A;  3NTH A;  1HR0 W;  2B29 A;  2KED A;  1NTG A;  4G57 A;  4OWX B;  3MZ5 A;  4Q5V A;  4A3J G;  5EAY A;  1I5F A;  4GS3 A;  4DR2 Q;  1QVC A;  4DU9 A;  1DGS A;  4ZUI A;  3U9O A;  5ELC A;  2KVM A;  1WTV A;  2EYM A;  3J80 c;  1BOS A;  2NN6 H;  4A3M B;  2N78 A;  3DLL A;  4AQY Q;  4X62 Q;  2D2C C;  2IX0 A;  4KHV A;  1HTP A;  5J39 A;  5CV5 A;  1Y1W H;  4FXG C;  1PFN A;  5JJI A;  5C0X G;  3CCL A;  1XPR A;  2VQE L;  5FLM G;  1KAA A;  1PZK D;  3F8T A;  4LF6 L;  3A7A B;  3HRZ C;  3I56 A;  1VDZ A;  1STY A;  4LFB L;  1CFM A;  1A8V A;  1V1Q A;  3BDL A;  1I4P A;  1HQM C;  1SLJ A;  5I6Y A;  1YBY A;  1G51 A;  1PYW D;  2CQO A;  1X55 A;  2ZTE A;  1QG7 A;  2QCP X;  3SEB A;  4GNX B;  3H3V C;  4A3G H;  3TZU A;  1VCI A;  1XMQ L;  1E22 A;  1ET6 A;  4DAY A;  2UUC Q;  4JG2 A;  3J81 E;  4TRD A;  5JPM C;  1Q46 A;  1VF5 C;  3G48 A;  4JI1 L;  3SE0 A;  2OTJ A;  5JAV A;  3S17 B;  1LT6 D;  3NUC A;  4JVZ A;  1ZXT A;  1D7Q A;  2SNM A;  3HFZ B;  1FNU A;  4CGY B;  5KNB A;  3CCS A;  5K36 H;  3QOJ A;  1RCV D;  1KNA A;  1AP0 A;  2AUJ D;  3CQZ B;  4RH6 A;  4B3R Q;  4B9X A;  4UAI A;  1LAC A;  2KCM A;  4POF A;  4C1N K;  4DV2 Q;  4A3D G;  2TSS A;  1PH8 A;  4EGV A;  3A5Z B;  5JVH 3;  2X6G A;  2QGQ A;  3HG9 A;  5COR A;  3N52 A;  5GAG C;  2L1B A;  3KOJ A;  2D62 A;  2A68 C;  4QIW E;  3H0G H;  3M85 A;  1L0Y B;  4C3J H;  3VR5 A;  3I73 A;  4NMZ A;  1M1K C;  5FJ8 H;  3CHB D;  4QY7 A;  2NZH A;  4O1N A;  1HJP A;  2CFM A;  3F2C A;  1K0S A;  4G7O C;  2RHS B;  1CUK A;  1JIC A;  2OT2 A;  1J8I A;  2AQ2 B;  4GZY C;  1CSQ A;  3PIO A;  4XYQ A;  2OEO A;  4C3H B;  2JQO A;  5CV6 A;  2EVB A;  3ZYY X;  1ILQ A;  1BNZ A;  4ZQ3 A;  3RN2 A;  1TU2 B;  4AYB B;  3KJO A;  2ZXO A;  4XT1 B;  3PUW A;  1SMX A;  3GTL B;  2A6E C;  1CKO A;  1GUT A;  4DGZ A;  2E75 C;  3OTO Q;  1RD9 D;  1KRS A;  2N8N A;  3ULJ A;  4A3L G;  2R92 G;  1O7Z A;  3AB9 A;  2C9O A;  2WIN B;  2FFK B;  3J7Z C;  4HIM A;  4KKS A;  1A15 A;  1UE5 A;  2J7Z A;  3T51 B;  4IN3 A;  1I4G A;  5CGK A;  3JAM L;  4OWW B;  1TWC B;  2R93 B;  3I4N G;  4JBK A;  2A69 C;  1PTO B;  4GNX C;  3HS0 C;  4HJ5 A;  3HOZ B;  2TMP A;  1VQB A;  4ME3 A;  3HOV G;  2HDL A;  3MFY A;  4DKA C;  4IO9 A;  4RCN A;  1DON A;  1J9O A;  4WJW A;  2F0W A;  4ODG A;  5BN3 A;  3S2D H;  2RDF A;  3BZC A;  1LYL A;  3NBI A;  4NXN L;  1DCZ A;  3A7L A;  4K5W A;  2JXM B;  2EJF C;  2XVS A;  3D4R A;  3PSI A;  4QMG A;  3PIO 3;  3C2P A;  4LF4 Q;  4N9P A;  4DK3 C;  1VQN A;  1Y8P B;  2CCZ A;  1E1O A;  5H1S E;  3H6M A;  3GTP B;  3BZK A;  2FMC A;  3F2U A;  4QQB X;  1EIH A;  4CKC A;  4R4Q A;  3DEP A;  1V1O A;  5BR8 Q;  4DA2 A;  3J81 L;  5CR3 A;  3T1Y L;  3K5O A;  4L8J A;  4ID6 A;  2UXC Q;  3MHB A;  4DNR B;  4LUV A;  4C3I G;  4OO1 H;  4MHE A;  1EIF A;  4V0B A;  1OO9 B;  5FO8 B;  2I46 A;  3W5O A;  2E76 C;  2K05 A;  5LL6 X;  4P72 A;  4A3G B;  5C44 B;  1HXY D;  3TP5 A;  5EKL A;  2AMC B;  2VQE Q;  1Q3L A;  4LJZ C;  4EQN A;  1DZ1 A;  2F0D A;  4JI0 L;  3ULP A;  2PCF B;  2HHH L;  4LFB Q;  3OWF A;  4Y7N B;  2HCC A;  3Q6S A;  2K28 A;  5IWA Q;  2JA9 A;  3AEV A;  4JBW A;  1B9N A;  3HEJ A;  4FDB A;  1B3A A;  3AFP A;  4OWT B;  5IY0 A;  2RDG A;  1WTQ A;  5M3F B;  4GNX A;  2V4D A;  4YWK A;  1XMQ Q;  1YIT A;  1A62 A;  4JW0 A;  3NXW A;  2MNA A;  3HOX H;  1Y8O B;  5IYB G;  2QDL A;  5F2D A;  1N32 L;  4NP5 A;  4RAU C;  1OXX K;  2K5H A;  4A93 B;  1U4P A;  2E2J H;  5EJW A;  3EIV A;  1SYE A;  2K75 A;  4HTH A;  1AZP A;  1PA6 A;  2HIV A;  2VB3 X;  1XX8 A;  1I6H H;  4BY7 H;  1O80 A;  1VQ8 A;  5DNF A;  5G3L D;  1TT2 A;  1MI2 A;  3KUP A;  2RQX A;  1YIJ A;  4GLV B;  4RG1 A;  1EWC A;  1WCM B;  1AN8 A;  2F0S A;  4FO2 A;  2LXK A;  1XPO A;  1PTO C;  5BN5 A;  4TKO B;  4OX9 L;  5IYC H;  4IAL A;  2PQE A;  1MIU A;  3PGZ A;  1X9N A;  4L5Q A;  2F0K A;  4ZUJ A;  1C7Y A;  2JA8 B;  2ZJR A;  1ROD A;  3M4Y A;  3SK5 A;  4IFD J;  1NAP A;  4QUF A;  4DPG A;  3MTS A;  4RWS C;  4X64 L;  2BA1 A;  4C56 C;  3PUX A;  3T56 B;  2O5J C;  4JI5 L;  1HQR D;  4RGN A;  3EBE A;  3PUZ A;  4PMC A;  1XMO L;  5C4X B;  2UUA Q;  1F77 A;  3RZO B;  1QZH A;  4FF3 A;  3RZD H;  3OIQ A;  1QJO A;  2ZTC A;  1EOT A;  3NTK A;  3FPP A;  3HP3 A;  2JA5 H;  2A19 A;  3L7Z C;  3CXC A;  3K81 C;  1Y1V G;  1BR9 A;  3VA5 A;  1VQC A;  3W3A A;  4QUC A;  3CME A;  3JAM i;  1TWH H;  3I4L A;  1VQM A;  5D14 A;  3FHW A;  1N33 Q;  5M5Y B;  1ENA A;  1VF7 A;  3VR3 A;  2MFI A;  3PO3 B;  3HKZ B;  4A3I G;  1WD1 A;  1O7I A;  1FNW A;  4MTN A;  3GO5 A;  1QZG A;  2XGT A;  4DR6 L;  5IT9 E;  3DXJ C;  1EY5 A;  1JOK A;  3I91 A;  1PH4 A;  4BBS B;  3FKI H;  2PI2 E;  3GTJ H;  3NQT A;  1S5F D;  3I90 A;  2PW7 A;  3NHH A;  4Q0F A;  1A2U A;  4A3J B;  1TS2 A;  3NEL A;  5LL6 S;  3Q24 A;  3VA7 A;  1F9R A;  4K14 A;  2EPB A;  1SRU A;  3H3V H;  4OEM B;  3LWU A;  4ZKB B;  5GAD C;  5JJK A;  2CH4 W;  4CDD C;  3S1N H;  2L11 A;  2NVY B;  4JI8 Q;  2A68 D;  1K3B C;  1U0L A;  4XQN A;  5LMN L;  4J6H A;  1B4O A;  2SOB A;  3AFQ A;  1HNZ L;  2IJ0 A;  1I50 B;  2K50 A;  4MIU A;  2KQ3 A;  1A3U A;  2ZM6 Q;  3K58 A;  3E9H A;  3FPU B;  2B8G A;  2LXJ A;  3T53 B;  4A3E G;  3OOC A;  4JOI C;  2A8V A;  2K7V A;  1YHQ A;  2NWG A;  2JK8 A;  3URY A;  4A3K H;  2F4V Q;  2JA6 H;  4A3B G;  1EY8 A;  2EY1 A;  1MSH A;  1UE6 A;  4KN7 C;  3A8I E;  2D5D A;  1IKM A;  1AZQ A;  5AJ3 L;  2A6E D;  1GKH A;  4K6D A;  4O0A A;  3CCQ A;  3TS0 A;  1A0I A;  3TRZ A;  4RHR A;  4OHJ A;  5JPN C;  1WTR A;  4PZ6 A;  1YI2 A;  2K4K A;  5ELE A;  1XWE A;  1WFQ A;  5C3X A;  4OXP A;  1X56 A;  3HOY H;  2VW9 A;  1C4Q A;  2Q8T A;  3KLS A;  3ULL A;  1OXT A;  1F9Q A;  2IW3 A;  5IOD A;  1NJI C;  4YCW A;  4KD4 A;  1ENC A;  3M7G A;  3K5M A;  4AQY L;  2MQH A;  1QE6 A;  4XQQ A;  1SR3 A;  5J1Z A;  1HUN A;  1YZ6 A;  2A69 D;  3OSO A;  3I4M G;  2PQA B;  5JJZ A;  3IFT A;  1AH9 A;  1B2T A;  2WB1 G;  4PMB A;  2EYH A;  3R93 A;  1ESF A;  4P2C B;  2ASB A;  1W2B A;  4IZ8 A;  3P1H A;  3CCU A;  4XXE A;  2BH2 A;  3MEH A;  5ELF A;  1PH2 A;  1QNK A;  3V2T A;  2JEA I;  4A3M H;  3NK9 A;  4A3D B;  5FK9 C;  4YWM A;  4LAA A;  2ZXP A;  3J81 c;  1B44 D;  2Z6K A;  1ICW A;  3DUZ A;  5K5P A;  1K83 B;  1I3Q B;  3BDO A;  3F2B A;  2KEE A;  3KFU A;  2UUC L;  4P74 A;  1S5C D;  2JJQ A;  1CQV A;  4JOI A;  2N88 A;  3ND8 A;  1KQS A;  2NUC A;  1GHJ A;  3C1F A;  5I9O A;  2CWP A;  4BXX G;  2GN5 A;  4PNY A;  4X64 Q;  1KDC A;  3LWE A;  4CHT B;  4X6A H;  3I4O A;  2R7Z G;  1E0B A;  4K6L A;  2F0M A;  3NPP A;  4KY6 A;  5IGB A;  4IQZ A;  2J4X A;  1D2B A;  4RHS A;  4J1M A;  4B3R L;  2R7F A;  3CCV A;  1N34 L;  5CBE E;  4IOC A;  1GO3 E;  2RSN A;  2R92 B;  4P73 A;  4DV2 L;  1J6Q A;  2MHV A;  3S16 H;  5EGT A;  1VQE A;  4A75 A;  1GUW A;  4RCO A;  1SND A;  3E0E A;  3CQZ H;  4DV7 Q;  1NMF A;  1IBK L;  3A8K E;  3MEF A;  3HOU G;  4FF4 A;  3SK8 A;  3HOV B;  4CBV A;  3Q23 A;  3JC6 6;  4X3T A;  4A3F G;  1FJG L;  1EEF D;  4KJN A;  1SE3 A;  1SEB D;  2LY7 A;  4L5T A;  4S3S A;  1W6K A;  1PYB A;  4R9W A;  2EY5 A;  3G71 A;  1EQQ A;  1L2F A;  5IP7 G;  2I5L X;  1QCB D;  3BVM A;  4DV6 L;  4NXM Q;  1UWV A;  1R9T H;  1W6J A;  2OCE A;  1PTO D;  3L3O C;  2ES2 A;  1KIX A;  3EJI A;  3X3N A;  2K1B A;  3CC4 A;  4C3H H;  2I0Q A;  2KHI A;  2F0H A;  1HA5 A;  1XTD A;  5CMD A;  3FP9 A;  1VQ9 A;  1B9M A;  2PZT A;  1SJH D;  4C3I B;  1EIY B;  2JA6 B;  2I07 B;  2F3W A;  1EL0 A;  1QUQ B;  3GTL H;  2L9H A;  1H9M A;  4HN7 A;  4GKJ Q;  4HMI A;  1PHJ A;  2JEB I;  1O7Y A;  4ZKC B;  4QL5 A;  4R4T A;  2A6H C;  5M5W B;  2SNS A;  3D4D A;  5FLX L;  3S9W A;  1A6X A;  4BY1 G;  1NCV A;  3L2P A;  4NW2 A;  1TWC H;  5IYD G;  2XWB B;  1IYJ B;  3S1R B;  4UPA A;  4LF4 L;  1TY0 A;  3NWS A;  4TQU S;  1SXT A;  2QEX A;  2R93 H;  1PTO H;  3HOZ H;  2BH8 A;  5AJ3 Q;  4LF7 Q;  3QG1 A;  5IP9 G;  2AUK A;  1JE4 A;  5IGG A;  4I7A A;  1SNM A;  3CMA A;  1PYS B;  2QIL A;  3PO2 G;  1KRT A;  5BR8 L;  1WTO A;  3UI2 A;  1RIP A;  4O2D A;  3JAM E;  3T1H L;  2D9U A;  3A54 A;  3AMU A;  2UXC L;  3D0F A;  3BDC A;  2K5W A;  2F0I A;  1F2M A;  1X3G A;  3GTP H;  2MP1 A;  1LTA D;  3EN2 A;  1Z6H A;  5LMU L;  2RA4 A;  4G7H C;  2PQA A;  1BBW A;  2BE5 C;  5M3M G;  1SNQ A;  4KN4 C;  1WTW A;  1Z7T A;  1GUG A;  3FVQ A;  4KK7 A;  1C0A A;  1E1T A;  4R1J A;  4DN4 M;  5IWA L;  1WD0 A;  2YV5 A;  1G6P A;  2VXW A;  2B8F A;  3SK4 A;  2X69 A;  5JOB A;  4JBJ A;  5C44 H;  3K59 A;  4PV1 C;  4ZRZ A;  4DFA A;  4KHP L;  4Y7N H;  2DNC A;  3M4O B;  3P7J A;  3KF6 B;  1Q86 C;  1O78 A;  3PV0 A;  4HMJ A;  4IPC A;  3L9A X;  2PPB C;  1SDF A;  5M3F H;  1YJN A;  3N6R A;  3DMU A;  4ZCK A;  3S16 B;  4LWC A;  2DY7 A;  1OXS C;  2L15 A;  1Y1V B;  1BCP F;  4K0K Q;  4ZYS A;  2E8G A;  1L1O B;  3C46 A;  4I65 A;  3WWV A;  4KD3 A;  5ELB A;  4A93 H;  3MXG A;  1N34 Q;  4OL7 A;  2PNR C;  3A5U A;  3U58 A;  4A3I B;  1FGB D;  4EQP A;  3M7N A;  2BDN A;  4KJO A;  3G6J B;  3BS1 A;  1HR0 L;  1TXY A;  3KLR A;  2HCI A;  4OGQ C;  3MXU A;  1G2T A;  3UDF A;  3E0J A;  1IBK Q;  1X3Q A;  1WCM H;  1E2Z A;  4OIJ A;  4C1N I;  4GN4 B;  4LF5 Q;  2MPM A;  1CI3 M;  2OXP A;  2Q2I A;  1R9T B;  5IGD A;  3J81 j;  1HA6 A;  1CA5 A;  2UUA L;  1K8O A;  4IJL A;  1FJG Q;  1GJX A;  1JB3 A;  1U9R A;  2JA8 H;  3GP7 A;  4RKL A;  1W3S A;  4N9T A;  4H0L C;  5IIF A;  5AFW A;  1JMC A;  2O4X A;  1B53 A;  2HQL A;  4DV6 Q;  1B70 B;  2I5M X;  1FNV A;  5C4X H;  1H9K A;  3RZO H;  1N33 L;  2XIW A;  5IT9 c;  2JA7 G;  1EEI D;  1V8Q A;  5FKA C;  3T13 A;  4BBR G;  2WV6 D;  5I2X A;  3AU7 A;  1C8C A;  4K5X A;  4FVM A;  1JR0 D;  1BBU A;  2YYZ A;  4U67 3;  4DV0 Q;  3FRP B;  5ELD A;  4A3E B;  3W2D A;  4DR4 L;  3PQI A;  4A76 A;  1QUQ A;  3TEH B;  4A3B B;  4IJH A;  2L5T A;  5M5Y H;  5DM7 3;  4CJ0 B;  4B3T L;  1TS4 A;  2DGY A;  2G9H D;  1JT8 A;  3PO3 H;  3M3Y B;  4JYA Q;  4A3C G;  2VNU D;  3RLO A;  1L0X B;  1DOL A;  1STH A;  1CM9 A;  1SE4 A;  2KCC A;  2FHT A;  1KXL A;  2FMM A;  1STG A;  3LX0 A;  3CW2 C;  1VQH A;  4BBS H;  2VUM G;  1JWS D;  3KF8 B;  4HIK A;  1X3F A;  1SMY C;  4DNI A;  3M9B A;  4JI2 Q;  2WKD A;  4JI8 L;  1VMC A;  3J7A F;  2B2Y C;  4UP9 A;  3VR4 A;  1XNR Q;  1U4L A;  5I4D A;  4A3J H;  1L1O C;  2B63 G;  2OQ0 A;  1P16 A;  2WB1 B;  2Y0S E;  4OIK A;  3T1H Q;  3A55 A;  2ZM6 L;  1QNU A;  3MA2 B;  2CH4 A;  2O5I C;  1EY9 A;  1EIG A;  3DEO A;  3S15 B;  1Q1E A;  2K6A A;  2JN4 A;  4DV1 Q;  1K8G A;  5BN4 A;  2NVY H;  2V1C C;  2F4V L;  4FNF A;  5LMU Q;  1Q1B A;  1MD2 D;  3QJY A;  1BBX C;  3IAY A;  3GD7 A;  2EZV A;  1PH6 A;  4IFD I;  2B2V C;  1F2Z A;  2EQS A;  4K2K A;  1UEA B;  1PVO A;  4KV6 A;  1I50 H;  4IPD A;  2J0T D;  5C0X H;  1YEZ A;  1TQO A;  1IBM L;  5CV4 A;  5A2Q L;  5FLM H;  3S1M B;  1AE3 A;  1STE A;  2PMZ B;  3RLN A;  1Q8I A;  4X3K A;  2IT1 A;  2RDH A;  1PV4 A;  1KLG D;  5E3F A;  1QVG A;  3I70 A;  1MSG A;  2EE1 A;  2M00 A;  4GOP B;  3BZD B;  4CDC C;  1IBL Q;  4HAE A;  4RGO S;  3A0J A;  4K8I A;  2E2I B;  2CW0 C;  2F1M A;  1JE5 A;  1EY7 A;  1EZ8 A;  3IKJ A;  3QIA A;  3UE1 A;  1EYG A;  4KHP Q;  1K28 A;  3TP8 A;  4DR5 Q;  3PIP A;  2R7Z B;  1VQD A;  1KNE A;  4ZK9 B;  2PZW A;  2A74 C;  3H91 A;  3MFG A;  3KF6 A;  5HY6 A;  1FD7 D;  3C3L A;  2R7D A;  1CHP D;  3OMG A;  2A6H D;  1S72 A;  4BS9 A;  3RN5 A;  1FL0 A;  2I5H A;  4UDU C;  4IFD G;  1K3R A;  3L0O A;  2NVX H;  3QR8 A;  2FJ2 A;  3SXH A;  1AFP A;  4LUO A;  1IHZ A;  2B2Y A;  2K5D A;  5D3I B;  3I72 A;  2F0J A;  1QWY A;  2EYF A;  1T5X D;  5JEA G;  1LAB A;  1BF4 A;  1L1O A;  1SSO A;  4RMF A;  2UU9 L;  1I94 Q;  3SGI A;  1K0R A;  3GTO B;  3R2I A;  2IL8 A;  3GTG B;  1UNS A;  1OXV A;  3BYY B;  3OW7 A;  3HOU B;  3P20 A;  1YJ9 A;  2WAQ E;  2F0Q A;  1DM0 B;  1HR0 Q;  5D65 A;  2K04 A;  4A3D H;  1BCP B;  1CHQ D;  4A3F B;  3H94 A;  1R4P B;  4RFB A;  2B2V A;  1CA6 A;  5J3B A;  3CC2 A;  1K83 H;  1I3Q H;  4ULL A;  5J22 A;  1RDP D;  5JEA J;  3PIP 3;  5HUR A;  1GUN A;  4E6I A;  4PG3 A;  4AH6 A;  3RNU A;  2ENB A;  3E3X A;  1XTC D;  2F0N A;  4ME5 A;  1QB5 D;  3CCM A;  2BE5 D;  3ZJY C;  1T9H A;  4LUZ A;  4XYO A;  2K52 A;  2KEN A;  3STB C;  2LFN A;  1G8Z D;  1VQ4 A;  2OTL A;  1EQR A;  1SRO A;  2ATW A;  3F2D A;  3K0Y A;  2VB2 X;  3VYT A;  1RTN A;  3KDF B;  2Z1C A;  3R8B A;  4H13 C;  4ALP A;  4DV7 L;  4HSV A;  4JI7 L;  3S14 B;  4KY7 A;  4A3L H;  4EQ5 A;  3MXP A;  2R92 H;  1UUP A;  2KHS A;  2C35 B;  4GKK L;  3A8J E;  1Q8K A;  2YTY A;  1P8L A;  2NYZ D;  4DR4 Q;  2ID0 A;  4BY1 B;  3I55 A;  5KEE A;  4MNO A;  1MGS A;  3HOW G;  4B3T Q;  2AQ1 B;  4GOP C;  2NVT B;  3HZX A;  1TWA B;  5GQO A;  4X66 Q;  5GAE C;  3I4N H;  1YHB A;  1JWU D;  1LO5 D;  2Q2T A;  2RCN A;  4IPH A;  4DR7 L;  4NXM L;  5KND A;  3HOV H;  2Z9H A;  4C2M B;  4IUQ A;  1SJE D;  1S3O A;  3OIP A;  1EQT A;  4IUT A;  5EBC A;  1E3P A;  1X3P A;  4HCS A;  3PO2 B;  5IGC A;  3I7F A;  2NBF A;  2LS0 1;  5DM6 3;  5KYL A;  2B2T A;  4YY3 Q;  5CV9 A;  1Y14 B;  2EY6 A;  3U50 C;  2EJG C;  2L12 A;  3KF8 A;  4JI3 Q;  3S24 A;  2AHO B;  2BDO A;  2Z4I A;  1N36 Q;  1K8A C;  1SYG A;  2BA0 A;  4RA8 A;  1SFO B;  5ISR A;  1LTI D;  2Z6K C;  1KAW A;  4GKJ L;  4FYD A;  1PH3 A;  1WJJ A;  1II3 A;  4HJ9 A;  3K0X A;  1VQ5 A;  3DWQ A;  3TSS A;  1S5E D;  5CYU A;  1KDB A;  3AQQ A;  4TSS A;  5M3M B;  1KDA A;  4RGM A;  5GAH C;  4DUY Q;  4X65 Q;  1HUM A;  1H9S B;  2QW7 A;  1SNC A;  2EIF A;  4C3I H;  2F0U A;  4DK0 A;  1CKN B;  3M4Q A;  1BCP C;  4YCV A;  4IOA A;  2IHF A;  5C3E G;  3ICE A;  3K5N A;  4IUN A;  4QIW B;  1IBM Q;  4DV3 Q;  4LF7 L;  1WI5 A;  3JAM c;  4PZ8 A;  1EZ6 A;  1VQG A;  1PMR A;  2ICI A;  3MWY W;  3NSW A;  5M5W H;  3E9I A;  2KHJ A;  2PO4 A;  4R8I A;  2BOS A;  2VS1 A;  1PFS A;  2QDB A;  4O42 A;  2F0V A;  3O13 A;  1MJC A;  4GOP A;  2LSS A;  2CVR A;  4ZAI A;  3VDY A;  2NVX B;  3S1R H;  4H7B A;  2F4I A;  3NWT A;  4P71 A;  4JCV E;  4K2L A;  3DM3 A;  4JV5 L;  2EYJ A;  5NUC A;  5IYB H;  5FLX E;  3GTQ H;  3U4V A;  4PMW A;  2NN6 G;  2EDG A;  4BA1 I;  1Y69 U;  4AYB E;  3RLF A;  4F7X A;  3CD6 A;  1SBB B;  1VQ7 A;  3U9S A;  4LW1 A;  3PUY A;  1Y1W G;  1PRT F;  4MN3 A;  2HDM A;  1XJV A;  1EU3 A;  2EOT A;  3TZD A;  4R4O A;  4IUR A;  4CKB A;  3K5L A;  2UU9 Q;  2HUG A;  1SMY D;  2Q2H A;  2HD3 A;  1STA A;  2NTS A;  2JSO A;  2XRS D;  5FO7 B;  2K5V A;  2MGS A;  5CC4 A;  1JOQ A;  1HCZ A;  5CBA E;  1LTB D;  4A3G G;  3Q22 A;  5COY A;  3V96 A;  3RMH A;  3B6Y A;  1B8A A;  1ZYR C;  4A4I A;  1I4X A;  4ABN A;  1BQQ T;  3G7L A;  1JJG A;  4ZLT F;  3AYH B;  4DF7 A;  4JI4 Q;  1I4Q A;  4DUZ L;  2M9V A;  1JC7 A;  1JCK B;  1L0W A;  4APV A;  4B3S L;  2F3V A;  3GV6 A;  1TWF H;  4K0K L;  1E24 A;  2F52 A;  2PYK A;  1XXG A;  3M4O H;  1OTC A;  1LTL A;  3HGB A;  4M1U B;  3VYR A;  1F9P A;  2JA7 B;  4LFC L;  1TVX A;  4BBR B;  2F0L A;  5K36 G;  1LT4 D;  1O7L A;  2R3Z A;  1D6E C;  2E5L L;  4EX5 A;  1SNO A;  5KGU A;  2VQF L;  4HR7 B;  2IY5 B;  1NSN S;  3PMF A;  1Y1V H;  3S2H B;  1LTR D;  3KDF A;  1V43 A;  2CW0 D;  3K7A B;  5KIX A;  3KLS X;  3I4N B;  1H9R A;  1RTO A;  3D8G A;  1PFM A;  4JI7 Q;  2KCN A;  2EYL A;  3NEN A;  1EY0 A;  4LF5 L;  1DOK A;  2NB0 A;  2OF1 A;  4A3I H;  1VQK A;  5A35 A;  5HGT A;  4GKK Q;  3H0G G;  4C3J G;  5EKI A;  3CU7 A;  5FJ8 G;  4Y52 H;  1VQI A;  3TME A;  4RKB A;  2VUM B;  5DEH A;  4OON A;  4DR7 Q;  5C4J B;  3K8A A;  3J80 i;  1TS5 A;  1HZA A;  1TS3 A;  4OEL B;  4JI6 Q;  3ND9 A;  4YWL A;  4F88 A;  3CPW A;  3G4S A;  2G9D A;  2B63 B;  1I4H A;  1UE7 A;  3J7Y W;  4CJ1 B;  4K8J A;  3R3O A;  1SYB A;  2G5D A;  1JWM D;  2B2U C;  2Q8R E;  3CKI B;  4UY8 C;  1IL2 A;  4DV0 L;  4HSP A;  1CT1 D;  1LTT D;  4WFN 3;  1EQV A;  1Q90 A;  1S40 A;  1VQ6 A;  5IGF A;  3PF4 A;  2JP1 A;  2OWO A;  2RBM A;  5JJL A;  2HT1 A;  2DY8 A;  3WDN A;  4JYA L;  1UE1 A;  3LNN A;  2L0C A;  1KLU D;  1PFB A;  2HQE A;  4KY5 A;  3STB D;  5KRU A;  3H15 A;  1X6O A;  1U5K A;  1FGU A;  3SHL A;  4XQJ A;  1WTH A;  2RVL A;  4A3E H;  1CKN A;  1HH2 P;  4L6T B;  4DK6 C;  1NMG A;  4A3B H;  2QKI C;  1BDO A;  4KKU A;  2E2D C;  2CQA A;  4JI2 L;  3M3Y H;  3BVZ A;  1NY4 A;  1XNR L;  3EA6 A;  3TRE A;  1TWG B;  3CRL C;  5IE8 A;  4JBM A;  3GTQ B;  3TQY A;  1HFN A;  1IZ6 A;  4AIM A;  4WOR A;  5I9P A;  1X54 A;  1RKN A;  3MXN B;  5C4H A;  2IX3 A;  1MHW C;  3R2T A;  2XTI A;  3GTK B;  2YU9 B;  3IFD A;  4QGU A;  2K14 A;  1CSP A;  4DV1 L;  4JV5 Q;  4WJ3 M;  2KJX A;  3LGJ A;  4KMU C;  2UXB Q;  4EVO A;  1D5M C;  3D31 A;  4EQO A;  1SYC A;  3I4M H;  4IUP A;  1EOV A;  4CDE C;  4DAM A;  4OO1 G;  3I3C A;  2YTV A;  3ONA B;  1VS0 A;  3KBX A;  2C5C A;  2B2U A;  2K5N A;  3S15 H;  2KCT A;  1CZG A;  3VR2 A;  3HKZ E;  2NZ1 D;  3QOL A;  1SAP A;  1IBL L;  1E2V A;  4UP8 A;  3MC0 B;  2ZTD A;  4JK1 C;  5I2Y A;  4GLX A;  2GA4 B;  1TWF B;  1SNP A;  4M8A A;  4DR5 L;  3S1M H;  2ZT9 C;  1PRT B;  2ALY B;  3QWN A;  3TP6 A;  1AEX A;  3VR6 A;  4B08 A;  3M4P A;  2MJ8 A;  1NE3 A;  4BXX H;  4QF4 A;  4DUZ Q;  1QIL A;  3V05 A;  4LK1 C;  3HOX G;  1TII D;  2E2I H;  4B3S Q;  4HJA A;  1YNJ D;  1BCP D;  3TDQ A;  5C0X J;  5A2Q E;  2R7Z H;  4J15 A;  1YNX A;  1D1I A;  1I94 L;  2K33 A;  1EWH A;  4LFC Q;  3C1E A;  4NKL A;  4BY7 G;  4YCU A;  2H5X A;  1PXU A;  1K73 C;  1AW7 A;  2NVQ B;  2E5L Q;  2RF4 A;  1Q81 C;  2VQF Q;  4WJ4 A;  4YIJ A;  5CV8 A;  4WRD A;  1GUS A;  1F9S A;  1WTP A;  5EPL A;  5IGE A;  3DWA A;  2H1E A;  3T4A C;  2YTX A;  2E2H H;  5IYC G;  3HOW B;  1HNW L;  2DJF C;  3GTO H;  1OXU A;  2L4N A;  3GTG H;  4DR1 L;  1U4M A;  1FYC A;  5T1G A;  3HOU H;  3CP0 A;  1CZW A;  2IX1 A;  1NNX A;  1IYV A;  3FEW X;  2RSO A;  4A3F H;  3NE5 B;  2ICE C;  4UHV A;  5EBD A;  2EXZ A;  3D6C A;  4HJ8 A;  2AWO A;  5M9O A;  5DAU A;  2UXD L;  1S5B D;  1U4R A;  1IYU A;  5IP7 H;  3CRK C;  2UUB Q;  3ERO A;  3K6O A;  3NQI A;  4DAP A;  3FMC A;  3ER0 A;  3OWE B;  2JA5 G;  2RKS A;  1EUJ A;  1D5Z C;  2Y0S G;  1UEB A;  2LMC B;  2WP8 J;  3H3V I;  3GTM H;  2F03 A;  1ZYR D;  1Z9F A;  1GUO A;  1YJW A;  3BYT B;  2LKV A;  1H95 A;  5EPJ A;  3BJU A;  4QB4 A;  1VQA A;  1KHI A;  4X66 L;  5C3E B;  3S14 H;  4LF8 Q;  3S1Q B;  4P75 A;  3QB3 A;  2EY2 A;  2DN8 A;  3FKI G;  1HZB A;  1IW7 C;  1EYA A;  1A2T A;  4K5V A;  5D3D A;  1PRT C;  3NTI A;  5FO9 B;  2ZJQ A;  2XNA C;  1PH9 A;  3VYU A;  4BY1 H;  4BA2 I;  4YY3 L;  2H4O A;  2R61 A;  1FVI A;  5KNC A;  2NVT H;  5IYD H;  1TWA H;  4JI3 L;  3KLW A;  1NR2 A;  1JQY D;  5EPK A;  1RL2 A;  3NEM A;  1LLR D;  1N36 L;  4LFA Q;  4PQX A;  5IP9 H;  1EYC A;  4FP5 D;  1S4Z A;  2KA7 A;  4C2M H;  4JC0 A;  2Z8L A;  5C5M A;  3U4Z A;  3CCJ A;  3I4M B;  1G2S A;  3PO2 H;  4DR3 L;  2KOL A;  2A5H A;  4G7Z C;  1ILP A;  1YHA A;  1PLF A;  3MXN A;  4DUY L;  4X65 L;  3W1B A;  1BO0 A;  4NPS A;  1V1P B;  4XTC S;  2WKC A;  1Y1W B;  1STB A;  4KKT A;  5C3W A;  1SFO H; 
#chains in the Genus database with same CATH homology
 4LF9 L;  1LM0 A;  1E22 A;  1S3O A;  3S16 H;  1VQE A;  4A75 A;  1E3P A;  4NB3 A;  2UUC Q;  4JG2 A;  3I7F A;  4DV3 L;  2AKW B;  5M3M H;  2GVB A;  4YY3 Q;  1Q46 A;  3E0E A;  2WAQ G;  3CQZ H;  1NMF A;  1Y14 B;  3G48 A;  4JI1 L;  3U50 C;  4DV7 Q;  3MEF A;  1IBK L;  2JA6 G;  2JA8 G;  4JI3 Q;  3HOU G;  3S24 A;  2AHO B;  1VQO A;  1N36 Q;  1K8A C;  2BA0 A;  3JC6 6;  2Z6K C;  1D7Q A;  1KAW A;  4GKJ L;  1PH3 A;  1WJJ A;  4A3F G;  1FJG L;  3F1Z A;  4HJ9 A;  3K0X A;  3HFZ B;  5FLX c;  1VQ5 A;  1J6Q A;  4LF6 Q;  2F3I A;  3CCS A;  3AQQ A;  2PI2 A;  4L5T A;  1PYB A;  5GAH C;  4DUY Q;  4X65 Q;  4B3R Q;  4H02 A;  3HOY G;  3G71 A;  1EQQ A;  2RHQ B;  1L2F A;  2EIF A;  2I5L X;  4C3I H;  5IP7 G;  2KCM A;  4POF A;  4DV6 L;  4NXM Q;  1CKN B;  3M4Q A;  1JJ2 A;  1UWV A;  4DV2 Q;  4YCV A;  4A3D G;  4IOA A;  2IHF A;  1R9T H;  2OCE A;  1PH8 A;  2KBN A;  3A5Z B;  5C3E G;  3ICE A;  2ES2 A;  2QGQ A;  1KIX A;  1IBM Q;  4DV3 Q;  4LF7 L;  1WI5 A;  3JAM c;  5GAG C;  4DV4 L;  4PZ8 A;  1VQG A;  1C9O A;  3KOJ A;  2D62 A;  1XPU A;  3CC4 A;  3IRB A;  4C3H H;  2I0Q A;  2KHI A;  4QIW E;  3H0G H;  4JI1 Q;  5M5W H;  1XTD A;  3E9I A;  4C3J H;  2KHJ A;  2N3S A;  3FP9 A;  3M85 A;  4HIO A;  1VQ9 A;  1M1K C;  5FJ8 H;  1EIY B;  2VS1 A;  4QY7 A;  2NZH A;  1PFS A;  1A63 A;  3CC7 A;  4A3M G;  1HJP A;  2CFM A;  3F2C A;  4B3M L;  1MJC A;  1QUQ B;  4GOP A;  2LSS A;  3PUV A;  5HGQ A;  3VDY A;  3GTL H;  1HZ9 A;  4GKJ Q;  2RHS B;  4GLA C;  3S1R H;  1CUK A;  1PHJ A;  2JEB I;  1V9P A;  1X65 A;  3RR5 A;  4P71 A;  1CSQ A;  1EWI A;  4JCV E;  5E7N A;  3PIO A;  4QL5 A;  4R4T A;  3DM3 A;  2JQO A;  4JV5 L;  1ASY A;  3RN2 A;  5IYB H;  1HNW Q;  3KJO A;  4JI4 L;  5LMN W;  4BY1 G;  3GTQ H;  3U4V A;  4PMW A;  2NN6 G;  3PUW A;  4BA1 I;  4DR1 Q;  1SMX A;  4AYB E;  3L2P A;  3RLF A;  1TWC H;  5IYD G;  1JJC B;  1AE2 A;  3CD6 A;  1IYJ B;  2R93 H;  4UPA A;  4LF4 L;  1CKO A;  4TQU S;  4YHH L;  2QEX A;  1VQ7 A;  3OTO Q;  4LW1 A;  1KRS A;  2N8N A;  3PUY A;  3ULJ A;  2BH8 A;  1Y1W G;  3HOZ H;  5AJ3 Q;  2R92 G;  4A3L G;  4LF7 Q;  4R4I A;  3J7Z C;  1XJV A;  5IP9 G;  4HIM A;  4R4O A;  1KC8 C;  1GD7 A;  1UE5 A;  3CMA A;  2UU9 Q;  1PYS B;  2MO1 A;  3PO2 G;  1KRT A;  5BR8 L;  2Q2H A;  2UXD Q;  2CWA A;  4DV5 L;  1RIP A;  4O2D A;  4OWW B;  2K5V A;  2N49 A;  3T1H L;  2UXC L;  3D0F A;  3I4N G;  4JBK A;  4GNX C;  4HJ5 A;  4A3G G;  1VQB A;  4ME3 A;  3HOV G;  4DKA C;  1X3G A;  3GTP H;  3B6Y A;  1B8A A;  4IO9 A;  4A4I A;  3EN2 A;  2JA7 H;  5LMU L;  4BBR H;  1JJG A;  2PQA A;  3AYH B;  2QA4 A;  1Q7Y C;  1BBW A;  4JI4 Q;  3BZC A;  3S2D H;  4DUZ L;  3NBH B;  1LYL A;  5M3M G;  4NXN L;  3CCE A;  1L0W A;  3PSI A;  4APV A;  4B3S L;  1TWF H;  3S2H H;  4LF4 Q;  4K0K L;  1C0A A;  1E24 A;  4DK3 C;  2F52 A;  3HKS A;  1VQN A;  2CCZ A;  1E1O A;  1E1T A;  3M4O H;  3K7A H;  4R1J A;  5IWA L;  1OTC A;  5H1S E;  2YV5 A;  1G6P A;  1LTL A;  3BZK A;  4QQB X;  4JBJ A;  5C44 H;  4LFC L;  4R4Q A;  4A3C H;  4JI6 L;  5K36 G;  5BR8 Q;  2E5L L;  3KYH C;  4EX5 A;  4KHP L;  2VQF L;  3T1Y L;  2IY5 B;  1Q12 A;  1Y1V H;  2UXC Q;  1PH5 A;  4Y7N H;  3KDF A;  4LUV A;  1V43 A;  1X3E A;  1EIF A;  3KF6 B;  1Q86 C;  1N8R C;  3W5O A;  4JI7 Q;  3PV0 A;  3NEN A;  2VUM H;  4IPC A;  2A1A A;  4P72 A;  4LF5 L;  2R6G A;  2MO0 A;  5C4J H;  4A3I H;  1VQK A;  2AMC B;  5M3F H;  1YJN A;  2VQE Q;  3Q8D A;  2D0O A;  4LWC A;  4GKK Q;  1OXS C;  2L15 A;  4NXN Q;  4DR3 Q;  4JI0 L;  1J5E L;  3H0G G;  3ULP A;  3OW2 A;  2HHH L;  3J81 i;  4LFB Q;  4K0K Q;  2B63 H;  5FJ8 G;  4AYB G;  4Y52 H;  1VQI A;  1YVC A;  2E8G A;  1L1O B;  1IXR A;  5IWA Q;  3WWV A;  2JA9 A;  1XNQ L;  3AEV A;  4A93 H;  4JBW A;  1N34 Q;  2OTJ A;  4FDB A;  4OON A;  3A5U A;  3AFP A;  2DUD A;  2NN6 I;  1CKM A;  4OWT B;  5IY0 A;  5M5X H;  3U58 A;  3K8A A;  4DR7 Q;  1PH7 A;  3J80 i;  4GNX A;  1HZA A;  4YWK A;  1XMQ Q;  4JI6 Q;  3M7N A;  4LF9 Q;  1YIT A;  4MZ9 A;  1EFW A;  1A62 A;  4YWL A;  1HR0 L;  1TXY A;  4KHZ A;  3T1Y Q;  3CPW A;  3G4S A;  1MKH A;  2MNA A;  3HOX H;  1HNX L;  1UE7 A;  5IYB G;  1BVS A;  3UDF A;  1G29 1;  1N32 L;  1IBK Q;  1D8L A;  1WCM H;  2K5H A;  1OXX K;  1SE8 A;  2E2J H;  4UY8 C;  1M90 C;  3UDI A;  4DV0 L;  1IL2 A;  2R93 G;  4GN4 B;  4LF5 Q;  3EIV A;  2K75 A;  1VQL A;  1PA6 A;  3HOZ G;  2HIV A;  2Q2I A;  3J81 j;  2UUA L;  4IJL A;  1S40 A;  1FJG Q;  1I6H H;  1VQ6 A;  3PF4 A;  4BY7 H;  2OWO A;  4JI0 Q;  5JJL A;  1VQ8 A;  2JA8 H;  2HT1 A;  1W3S A;  2HHH Q;  4JYA L;  2PNH A;  1UE1 A;  1YIJ A;  4GLV B;  4RG1 A;  4DR2 L;  2FXQ A;  2HIX A;  1JMC A;  1TWG H;  2LXK A;  3UE0 A;  2UXB L;  1XPO A;  3STB D;  3CPF A;  2HQL A;  1X6O A;  2WFW A;  3H15 A;  4DV6 Q;  1U5K A;  1FGU A;  4HJ7 A;  1Q82 C;  4A3E H;  4OX9 L;  1B70 B;  3I2Z A;  2I5M X;  5IYC H;  1CKN A;  1HH2 P;  1MIU A;  5C4X H;  3PGZ A;  1X9N A;  4DK6 C;  3RZO H;  1NMG A;  1N33 L;  4A3B H;  3CAM A;  4L5Q A;  5IT9 c;  3K80 C;  1C7Y A;  1QVF A;  2JA7 G;  2ZJR A;  1Z47 A;  4DV4 Q;  3GTK H;  4KLK A;  4X62 L;  4BBR G;  2YU9 H;  4JI2 L;  3M3Y H;  4IFD J;  1NY4 A;  4DPG A;  1N32 Q;  4X64 L;  2BA1 A;  1XNR L;  3TRE A;  5IE8 A;  3PUX A;  4JI5 L;  4JBM A;  2VY3 A;  2YYZ A;  1BBU A;  2VL6 A;  3GDE A;  4DV0 Q;  3EBE A;  3TQY A;  4B3M Q;  3PUZ A;  1XMO L;  3W1G A;  1IZ6 A;  4DR4 L;  4AIM A;  4A76 A;  1QUQ A;  2UUA Q;  3TEH B;  1QZH A;  4IJH A;  1X54 A;  3MXN B;  3RZD H;  3CCR A;  5M5Y H;  5C44 G;  4B3T L;  2XTI A;  4R4C A;  2DGY A;  1JT8 A;  4QGU A;  2ZTC A;  2K14 A;  3PO3 H;  4JYA Q;  1CSP A;  3ERS X;  4DV1 L;  4A3C G;  4JV5 Q;  4WJ3 M;  2VNU D;  5ELO A;  3RLO A;  2JE6 I;  3LGJ A;  2JA5 H;  2A19 A;  3L7Z C;  2UXB Q;  2OQK A;  4TVA B;  4X6A H;  3CXC A;  1Y1V G;  3K81 C;  3D31 A;  1VQC A;  2EXD A;  1KXL A;  4DAY B;  3I4M H;  4DAM A;  1EOV A;  3CME A;  4OX9 Q;  4UP7 A;  3PF5 A;  3J7A 5;  4OO1 G;  1KD1 C;  3JAM i;  1SN8 A;  3CW2 C;  1TWH H;  2YTV A;  1VQM A;  1VS0 A;  4YHH Q;  1VQH A;  4BBS H;  3FHW A;  2VUM G;  1N33 Q;  2K5N A;  1VQP A;  3KF8 B;  2MFI A;  4HIK A;  1X3F A;  4A3I G;  4DNI A;  3M9B A;  2IHE A;  5M3F G;  4JI2 Q;  3S15 H;  1O7I A;  2KCT A;  4JI8 L;  4MTN A;  3A74 A;  3HKZ E;  4UP9 A;  1XNR Q;  3GO5 A;  1QZG A;  2XGT A;  4DR6 L;  4A3J H;  1IBL L;  4JI5 Q;  4UP8 A;  4DV5 Q;  1L1O C;  2B63 G;  2OQ0 A;  1P16 A;  2ZTD A;  3CF5 A;  4IPG A;  2Y0S E;  4LNQ A;  4GLX A;  3T1H Q;  1XMO Q;  2AWN A;  1NBW A;  3K7U C;  4DR5 L;  1PH4 A;  2ZM6 L;  2Q2U A;  4A93 G;  1VQJ A;  3FKI H;  3S1M H;  2WB1 E;  3BU2 A;  3PCO B;  2PI2 E;  3GTJ H;  1Q1E A;  2ALY B;  3OYY A;  4DV1 Q;  1K8G A;  3S17 H;  1HZC A;  2NVY H;  2V1C C;  3M4P A;  2F4V L;  4L5S A;  5LMU Q;  1Q1B A;  1NE3 A;  3GD7 A;  3UDX A;  1PH6 A;  3NEL A;  4L5R C;  2EQS A;  4DUZ Q;  4BXX H;  2NVQ H;  4IFD I;  3HOX G;  1KL9 A;  1PVO A;  2E2I H;  1I50 H;  4B3S Q;  4IPD A;  1YEZ A;  4HJA A;  1WCM G;  1SRU A;  3H3V H;  1IBM L;  5C0X J;  3UDG A;  5FLM H;  5GAD C;  5JJK A;  2R7Z H;  1AE3 A;  1JB7 A;  4J15 A;  2D0P A;  1YNX A;  3RLN A;  2IT1 A;  2CKZ B;  1MJE A;  1GM5 A;  3S1N H;  1PV4 A;  1I94 L;  1QVG A;  3HOW H;  4JI8 Q;  2PMZ E;  5GRO A;  1B7Y B;  4LFC Q;  1U0L A;  5LMN L;  4BY7 G;  4GOP B;  1K9M C;  2GVA A;  2H5X A;  4KI0 A;  3AFQ A;  4YCU A;  5DLQ E;  2ZJP A;  1K73 C;  1HNZ L;  1IBL Q;  2UUB L;  4DR6 Q;  2E5L Q;  2RF4 A;  3A0J A;  4GN5 A;  1Q81 C;  1JE5 A;  2VQF Q;  4KHP Q;  4WJ4 A;  1EYG A;  3UE1 A;  2K50 A;  3TS2 A;  1E7Z A;  4DR5 Q;  3PIP A;  2ZM6 Q;  4GN3 B;  1VQD A;  2Z0S A;  3E9H A;  1WYD A;  1N9W A;  4QJF A;  1GVP A;  2LXJ A;  4A3E G;  3KF6 A;  2YTX A;  4JOI C;  2E2H H;  5HY6 A;  5IYC G;  2A8V A;  2R7D A;  1HNW L;  5C4X G;  1YHQ A;  4POG A;  2JK8 A;  4A3K H;  1S72 A;  2F4V Q;  2JA6 H;  1OXU A;  3GTO H;  3GTG H;  4A3B G;  4DR1 L;  3RN5 A;  1FL0 A;  3HOU H;  1BKB A;  4PZ7 A;  1UE6 A;  2I5H A;  4IFD G;  1K3R A;  1VQF A;  3L0O A;  3CP0 A;  2NVX H;  2IX1 A;  3OTO L;  1J5E Q;  5AJ3 L;  1GKH A;  4LUO A;  4O0A A;  1ASZ A;  3CCQ A;  3TS0 A;  1A0I A;  4A3F H;  3TRZ A;  1WOC A;  4XIG S;  4PZ6 A;  4LF8 L;  5JEA G;  1XNQ Q;  2B3G A;  1L1O A;  1YI2 A;  2K4K A;  4HJ8 A;  4RMF A;  2UU9 L;  2AWO A;  1I94 Q;  3SGI A;  1K0R A;  1WFQ A;  4OXP A;  2UXD L;  1X56 A;  5LMN Q;  4OO1 I;  1OXV A;  3HOY H;  2VW9 A;  3ULL A;  1OXT A;  5IP7 H;  1LUZ A;  2WAQ E;  3HKZ G;  4YCW A;  1YJ9 A;  1NJI C;  1HNZ Q;  2UUB Q;  3PO3 G;  1HR0 Q;  4AQY L;  2NZO A;  3ER0 A;  2MQH A;  4A3D H;  2JA5 G;  1HNX Q;  1EUJ A;  1SR3 A;  2Y0S G;  5C3E H;  1YZ6 A;  1UEB A;  3I4M G;  5J3B A;  4LFA L;  3CC2 A;  2WP8 J;  2PQA B;  4HID A;  3S1Q H;  5C0X I;  1AH9 A;  5ELN A;  1K83 H;  2WB1 G;  1I3Q H;  3KJP A;  3H3V I;  3GTM H;  1Z9F A;  1YJW A;  4BBS G;  2ASB A;  1W2B A;  5JEA J;  4A3K G;  2VZA A;  1H95 A;  4PG3 A;  4AH6 A;  3CCU A;  3RNU A;  2BH2 A;  3G6E A;  1PH2 A;  1PH1 A;  3BJU A;  1HR0 W;  3CCM A;  2B29 A;  3ZJY C;  1T9H A;  4A3M H;  2JEA I;  1NTG A;  1VQA A;  4LUZ A;  2K52 A;  1KHI A;  4YWM A;  2KEN A;  4OWX B;  4X66 L;  3STB C;  3J81 c;  4A3J G;  5EAY A;  1I5F A;  4GS3 A;  4DR2 Q;  3S14 H;  4LF8 Q;  2Z6K A;  1QVC A;  1VQ4 A;  2OTL A;  4P75 A;  1XMQ L;  1EQR A;  1SRO A;  2ATW A;  3F2D A;  1DGS A;  3F2B A;  3FKI G;  1HZB A;  3KFU A;  2UUC L;  3J80 c;  2ZJQ A;  4P74 A;  1PH9 A;  3KDF B;  4BY1 H;  4BA2 I;  2JJQ A;  4YY3 L;  4JOI A;  1KQS A;  1FVI A;  2N78 A;  4ALP A;  3DLL A;  4DV7 L;  4AQY Q;  2NVT H;  5IYD H;  4X62 Q;  1TWA H;  4JI3 L;  2IX0 A;  2CWP A;  3KLW A;  4JI7 L;  4BXX G;  2GN5 A;  1RL2 A;  3NEM A;  4X64 Q;  1Y1W H;  1N36 L;  4EQ5 A;  2R92 H;  4LFA Q;  4A3L H;  5JJI A;  5C0X G;  3CCL A;  1XPR A;  5IP9 H;  2VQE L;  4C2M H;  4JC0 A;  3U4Z A;  2C35 B;  3I4O A;  5FLM G;  3CCJ A;  4GKK L;  2R7Z G;  3F8T A;  1Q8K A;  2YTY A;  3PO2 H;  4LF6 L;  1P8L A;  4DR3 L;  3I56 A;  2ID0 A;  4DR4 Q;  3I55 A;  4LFB L;  4MNO A;  1A8V A;  3HOW G;  1V1Q A;  1YHA A;  4B3T Q;  4DUY L;  4GOP C;  4X65 L;  4B3R L;  1SLJ A;  3W1B A;  2R7F A;  5GQO A;  4A3G H;  4X66 Q;  5GAE C;  1YBY A;  4NPS A;  3CCV A;  3I4N H;  1N34 L;  1G51 A;  4XTC S;  1YHB A;  4IOC A;  2Q2T A;  1GO3 E;  2CQO A;  1X55 A;  2RCN A;  2ZTE A;  4IPH A;  4GNX B;  4NXM L;  4P73 A;  3HOV H;  4DR7 L;  4DV2 L;  1SFO H;  1VCI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...