4JI6L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
124
structure length
123
Chain Sequence
b'PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLLGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 12
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji6L00
3EBEA 1QVFA 5IYCG 4JI7L 3M3YH 3AFPA 1JE5A 1UE1A 2PI2E 4OXPA 4JI5Q 4YY3L 1OTCA 3GTOH 1Y1VG 2JE6I 4UP8A 4LW1A 2UUBL 4XTCS 5IY0A 5JEAJ 1FL0A 1M90C 1VQ7A 2IHFA 2UUCQ 4LFCL 4JI3Q 3CD6A 4R4CA 1HNWQ 4PG3A 1NY4A 5IP9G 4MTNA 2K5VA 4TQUS 2B63H 5C44G 4P72A 1NE3A 1X3GA 4HJ9A 1PH1A 4GOPC 1WFQA 3I4NH 1SN8A 3S1QH 4A3LH 3G4SA 4A3FH 1VCIA 4B3SQ 5M5YH 2CWPA 2DUDA 3MEFA 3PUVA 4BY1G 3D0FA 1LUZA 3E9IA 4LWCA 4P71A 4JI5L 4GOPB 3KF8B 1VQ8A 1VQAA 2R7ZG 4J15A 2OWOA 2VL6A 4DUZL 2R7DA 4YWMA 4A3KG 2YV5A 4JI2Q 1WCMG 5IYDH 1VQ9A 1TWCH 4DV3L 1PYSB 1N34Q 3GTGH 3KF6A 1HNZL 2LXKA 1KL9A 4K0KQ 4H02A 4B3SL 5M3FG 4DR4L 2HIXA 3CC4A 1WI5A 1IBLQ 3S15H 1A8VA 4DV1L 2E5LL 1EOVA 1RIPA 1VQEA 2JA7G 3EIVA 4GN3B 3FKIG 4OX9L 1HH2P 1XNRQ 4DV0L 1I94Q 3F8TA 2N49A 1K8AC 1VQKA 1A63A 1D8LA 2PMZE 4UP9A 1HR0W 5GROA 1VQFA 5IWAQ 5C3EH 4OX9Q 2B63G 2FXQA 4KLKA 1ASZA 1P16A 4DV1Q 5IYBG 4X65Q 2E5LQ 1XPUA 5ELOA 4DR4Q 3J81i 1Q7YC 4LNQA 1NTGA 2Q2IA 4BY1H 4JI1L 1SFOH 1KIXA 4BY7H 4JV5L 4A3DG 4X66Q 3KDFB 4X66L 1S40A 4DR7L 3CXCA 4A75A 4DR5Q 4BBSH 4L5QA 5IE8A 3RLOA 5M3MH 1K0RA 3CMEA 5H1SE 3VDYA 1EUJA 1YVCA 3K8AA 4O0AA 1VS0A 3HKSA 1IBKQ 2Z6KA 4X65L 4HJ8A 1XJVA 4GNXA 3H0GG 2VW9A 3U4VA 4O2DA 4MZ9A 5FJ8H 4FDBA 3J80i 3SGIA 2AWNA 2JA8H 2KCMA 2D0OA 1PYBA 1FJGL 1HNXQ 1KXLA 2MQHA 1X56A 1P8LA 3HKZG 5DLQE 2PQAA 1HJPA 2NVXH 4K0KL 4DAYB 3H0GH 3H3VH 1OXVA 3OW2A 3K7UC 3KJPA 1E22A 1SRUA 2JA8G 4LFBL 1R9TH 3TS2A 3UDFA 4YHHQ 1YHQA 1Y1VH 3RLNA 3LGJA 1Z9FA 4R4IA 4DR2Q 1XMOL 2WP8J 1VQNA 1VQPA 4DUYL 1K83H 1VQDA 2NN6I 3M85A 2VQFL 4X64L 4DR1Q 4JI0L 1N36L 3DLLA 3GTQH 3PO3H 5C4XG 1KQSA 1QVGA 4B3RL 3CMAA 1QZGA 4GNXB 4LF5L 2H5XA 4L5TA 2ZTEA 4PZ8A 3T1HQ 5BR8Q 2E2IH 3PF4A 1BBUA 1HNWL 2OTJA 1AH9A 1OXUA 4LF8Q 3S1RH 1M1KC 3HFZB 3PO2G 5M5WH 4X6AH 4IJLA 1VQOA 3ZJYC 3M9BA 1K8GA 1G291 1WCMH 3IRBA 3UE0A 5IYDG 4DV4Q 4BXXG 1UE7A 4JI7Q 4IPGA 2ZTDA 4LF7L 2R93H 4R4QA 1YIJA 3I56A 3MXNB 3M4OH 5GAHC 1IXRA 1X9NA 4YWLA 4A3GH 1Q86C 3L2PA 2K5HA 1E7ZA 4JI1Q 3CPWA 3PO2H 1H95A 2K5NA 3M4QA 5C0XJ 4JBKA 1UE6A 4GKKQ 1VQGA 2YTYA 1YZ6A 3D31A 3W1GA 1BVSA 2JJQA 4DK3C 3HOXH 2ZJPA 4AQYL 3BZKA 1J5EL 1CKNB 4JYAQ 5IP9H 4JOIA 4A76A 4GLAC 3TS0A 2ZJQA 1VQBA 3J81c 1Q81C 4JI4L 1YI2A 4NXMQ 2N3SA 4GS3A 3CCJA 3CCVA 3M7NA 1HZBA 4BA1I 3S14H 1UWVA 4DV0Q 3BZCA 1KC8C 4A4IA 3T1HL 4UP7A 1I50H 5LMNL 2NZOA 5C0XG 3UDXA 3PIOA 3CW2C 3ERSX 5IP7H 3TEHB 3Q8DA 1IYJB 1HR0Q 2Q2TA 1RL2A 3GTPH 1PA6A 5LMNW 1BKBA 3TRZA 1XMQQ 4JI0Q 3J7A5 1EIFA 1G51A 4A3MG 2JK8A 1VQLA 2NVTH 3I55A 2B29A 3PSIA 3HOZH 5EAYA 1YJ9A 3HOWG 4UPAA 4LF9Q 1MJCA 3H15A 1EIYB 4JI2L 2R92G 4A3EH 4DK6C 4DUZQ 4IFDI 3F2CA 1B70B 1EQQA 2CFMA 1PH4A 1CSPA 3KLWA 4GN4B 2NZHA 4QIWE 1E24A 3GTKH 5FLMH 2NVQH 2VUMH 4LF4Q 4A93G 1HZ9A 1TWFH 3NENA 1QVCA 4LUVA 3NELA 3I4MG 1L1OA 1CKNA 2Y0SE 1Y1WG 1E3PA 3KFUA 3PUWA 4NXNL 1E1OA 2PI2A 4IJHA 3KDFA 1NBWA 1Z47A 2DGYA 4KI0A 3FHWA 4A3CG 1N32L 2ATWA 1V9PA 1TWGH 1QZHA 4L5SA 3I2ZA 4OWTB 3UDGA 2WFWA 2D0PA 4YY3Q 3ULPA 1QUQB 1PHJA 2CCZA 4YCUA 4A3DH 4DV6Q 2E8GA 1MJEA 1EFWA 1TWHH 1VQIA 3FKIH 1SLJA 1J5EQ 1YNXA 3J81j 1AE2A 4BBSG 4IO9A 1HZAA 4JYAL 3HKZE 2UXCQ 4AQYQ 3KOJA 1SROA 3I7FA 3G6EA 1FGUA 4X62L 2QEXA 2EQSA 4IOAA 3OTOQ 1PH2A 2ZM6L 3W1BA 3RNUA 3U58A 2I5HA 1KHIA 2A1AA 1BBWA 4R4OA 4OONA 3S16H 1JMCA 2UU9L 1YBYA 3HOVH 2GVBA 5GADC 4Y7NH 5FLMG 1PH8A 4DV6L 1C9OA 1X6OA 4DV4L 4EQ5A 4DV5L 4DR6Q 2JQOA 1I94L 3AYHB 4IPCA 1EQRA 1K73C 1AE3A 1WYDA 4R1JA 1LTLA 3AFQA 1Q46A 5C44H 4JC0A 1KD1C 2I5MX 1IBLL 2K50A 3GO5A 4IPHA 1GVPA 4NXNQ 1IL2A 2Q2HA 4A3CH 4GKJQ 3RN5A 2IX0A 1W2BA 4JI8Q 4JBMA 2R7ZH 5HGQA 1IBML 3RZDH 2KENA 1JB7A 2HT1A 3RZOH 2L15A 3E9HA 1NMGA 3KYHC 3TREA 1EYGA 4DR2L 1XMOQ 2VZAA 4QY7A 3GD7A 3UDIA 4QGUA 5LMUL 4QQBX 4WJ3M 1E1TA 1OXTA 1CSQA 5IYBH 4PZ7A 4LFAQ 4LFBQ 3CCSA 1A0IA 5HY6A 3M4PA 2N8NA 3GTJH 4DNIA 3PGZA 3BU2A 3I4OA 4MNOA 2N78A 1B7YB 2NN6G 4YCVA 3STBD 2JEAI 3A0JA 1SE8A 1N33L 4JI8L 1YHAA 1JJCB 3A5ZB 3RR5A 1XMQL 3ICEA 4GKJL 2EXDA 3ULJA 3DM3A 2D62A 4DV7Q 1Q12A 2UUCL 3CQZH 2Z6KC 2ZTCA 4P75A 1S3OA 1HNXL 4A3BH 4IFDG 2B3GA 4KHPL 1W3SA 3PO3G 2R93G 4OO1I 3BJUA 4GLXA 2QGQA 4ALPA 2OQ0A 3NEMA 1NJIC 4B3TL 3CCQA 4HJ7A 4BA2I 4DR6L 2XGTA 3G48A 2CKZB 3PV0A 2HQLA 2R92H 1GKHA 1O7IA 5FJ8G 3NBHB 1JJGA 2MO0A 3K0XA 2AMCB 3CCEA 1PV4A 2BH8A 4B3ML 3CC2A 2OTLA 4BY7G 1V1QA 4NPSA 4YWKA 2ID0A 1L0WA 3ULLA 3K7AH 1YHBA 1A62A 2VUMG 1LM0A 1S72A 2HHHL 2CQOA 1G6PA 3L7ZC 2ALYB 2QA4A 4JV5Q 2I5LX 3CCRA 2UXCL 1HZCA 3PUXA 4KHZA 2I0QA 2CWAA 5GAEC 3I4NG 4A3LG 1UE5A 2Q2UA 4QJFA 4XIGS 3E0EA 3CP0A 3HOYH 4GOPA 4PZ6A 4JBJA 1PH5A 1VQHA 2R7FA 2VS1A 2JA5H 2UUAL 2UUAQ 4A3KH 1PFSA 3GDEA 3K80C 2E2HH 4L5RC 3WWVA 2OCEA 4LF8L 1N32Q 3G71A 2F4VL 1CUKA 4Y52H 2IX1A 5JJLA 2F3IA 1QUQA 3STBC 5C4JH 5K36G 2IY5B 3HOWH 2YTVA 1XNQQ 3U4ZA 3F1ZA 1N33Q 4A3EG 1NMFA 4AYBE 4LF4L 4HJAA 3H3VI 1L1OB 5JJIA 4JG2A 2K4KA 4X64Q 1JT8A 3AQQA 4EX5A 1HNZQ 1VQMA 2HHHQ 1YITA 2JA7H 1N9WA 1N34L 4OWXB 4DV3Q 4BXXH 5GQOA 2ES2A 4LF9L 1K3RA 2YYZA 3J7ZC 2R6GA 4P74A 4DAMA 3CC7A 2OQKA 5E7NA 2A19A 1JJ2A 1IBMQ 5C3EG 4POGA 1D7QA 4HIDA 1PH9A 4AH6A 4B3TQ 2WAQE 2JA6H 3HOUG 1C0AA 1Q8KA 1Q1BA 1HR0L 1L2FA 5IYCH 3PIPA 3F2DA 1PH3A 4DV7L 5LMNQ 1GM5A 1VQCA 4A3IH 1FJGQ 2K52A 1U0LA 1FVIA 4NB3A 2AWOA 2GVAA 4LFCQ 2UXBL 2Y0SG 4GNXC 4BBRG 2PQAB 3UE1A 2AHOB 2IT1A 2MFIA 3S1MH 1KRTA 1TWAH 1YEZA 4LFAL 2JA6G 1SR3A 1IBKL 4JI6Q 2KHIA 3CCMA 2MO1A 3RLFA 1Q82C 1X65A 1DGSA 3A74A 4LUZA 4ME3A 2UXDL 3CPFA 2ZM6Q 2RHQB 1XTDA 5IP7G 2WB1E 4JBWA 1J6QA 2WB1G 4C3JH 4X62Q 3F2BA 1YJNA 1GO3E 4WJ4A 4OWWB 5IT9c 4DV2L 4IPDA 1XNQL 3ER0A 1B8AA 3HOZG 1EWIA 1UEBA 4POFA 2F4VQ 5AJ3Q 3S17H 3CCLA 5IWAL 1X55A 4C2MH 3HOYG 3S1NH 1ASYA 4DV5Q 3GTLH 3CF5A 2ZJRA 1PVOA 4NXML 1XNRL 4APVA 1U5KA 3T1YL 4A3IG 2UU9Q 3OYYA 1WOCA 4LF5Q 3CCUA 2VNUD 4GLVB 1X3EA 5M3MG 1Y1WH 1XPRA 5JJKA 4OO1G 4DR3Q 4A3MH 2BH2A 1VQ5A 5C4XH 4A3FG 1PH7A 3TQYA 2KBNA 3CAMA 5C0XI 4YHHL 4A3JH 2A8VA 4JCVE 4JI6L 1VQ6A 4B3MQ 2RHSB 2EIFA 3FP9A 3KF6B 4YCWA 5GAGC 1N8RC 1CKMA 4TVAB 1KAWA 3HOXG 2JA5G 4A93H 2Z0SA 2IHEA 2VQEL 1CKOA 4P73A 2K14A 1WJJA 1PH6A 1I5FA 3I4MH 4HIMA 4QL5A 1XPOA 4KHPQ 2UXBQ 1VQ4A 1K9MC 2XTIA 3B6YA 2LSSA 4IOCA 2JA9A 1VQJA 4A3JG 2YU9H 5J3BA 4C3HH 4JI3L 2C35B 3S2DH 2UUBQ 1I3QH 4JI4Q 2LXJA 1N36Q 2VQFQ 5M5XH 3W5OA 4BBRH 3JAMc 4DR1L 4UY8C 2VQEQ 4DKAC 2GN5A 4HIKA 1C7YA 4A3BG 4GKKL 1MIUA 3KJOA 3PUYA 5LMUQ 2MNAA 1LYLA 4JOIC 3U50C 5ELNA 3EN2A 3HOUH 3JAMi 1YJWA 5M3FH 1OXSC 2WAQG 3K81C 2NVYH 2BA0A 4LF6Q 5JEAG 1I6HH 4PMWA 1T9HA 4DR3L 4LF7Q 3HOVG 2UXDQ 1KRSA 2JEBI 1Y14B 2AKWB 1TXYA 1MKHA 2E2JH 2VY3A 3A5UA 4HJ5A 3T1YQ 3PF5A 3PUZA 4R4TA 1GD7A 2KHJA 2RCNA 4A3GG 3GTMH 2F52A 2V1CC 5BR8L 2RF4A 3J80c 3S24A 1L1OC 4AYBG 2BA1A 5AJ3L 3AEVA 1X3FA 1Q1EA 1SMXA 2K75A 3PCOB 4GN5A 4AIMA 4B3RQ 4C3IH 4LF6L 2HIVA 3S2HH 4RG1A 3OTOL 4DUYQ 4DV2Q 4IFDJ 4DPGA 2PNHA 2KCTA 4DR5L 4RMFA 5FLXc 4HIOA 1X54A 2YTXA 4DR7Q 2ASBA 3JC66 4LUOA 3L0OA 1IZ6A 1V43A 1OXXK 3RN2A
chains in the Genus database with same CATH superfamily
1W6KA 5IYCG 3AFPA 1UE1A 2EPBA 3TP6A 1Y1VG 2PYKA 4UP8A 4LW1A 4XTCS 3CD6A 1NNXA 2UUCQ 4C1NK 4HMIA 1NY4A 2B39A 2K5VA 2F0SA 3GTGB 2NVXB 3I4NH 3Q0AA 4A3LH 5JPMC 2K28A 1VCIA 4B3SQ 4ZUJA 5M5YH 1VQ8A 1ET9A 3E9IA 3KF8B 4K8JA 4YWMA 2YV5A 5K5PA 5IYDH 4Y7NB 2KJXA 4DV3L 3HP3A 2AQ3B 1WVLA 3GTGH 1DOMA 1HNZL 5AFWA 2FMMA 3MFYA 3OWEB 2JP1A 5M3FG 3BDCA 4OEMB 2HIXA 3BVZA 1B4OA 2F0OA 2VXWA 4DV0L 5EJWA 2N49A 1VQKA 3L9AX 1HFGA 1CM9A 2B63G 1PFNA 4KLKA 2H1EA 1XPUA 4X65Q 2F0JA 2R3ZA 2LKVA 4CKBA 2B63B 1NTGA 3K5LA 1JICA 4JI1L 1KIXA 3VR4A 4KY6A 4A3DG 2WACA 4A75A 1KAAA 4L5QA 2EY6A 3CMEA 5H1SE 2Z6KA 1TWCB 3H0GG 3U4VA 2F0TA 4MZ9A 4KK7A 2AWNA 1DOKA 3H0GB 2F1MA 4WFN3 1FJGL 1KXLA 1IKMA 3I4LA 1CHQD 1HJPA 3A7LA 3H3VH 1S4ZA 4OHJA 2X69A 3OW2A 3KJPA 1EU4A 3C1EA 2EXZA 3TS2A 2F3VA 4YHHQ 4CDFC 1Y1VH 1Z9FA 3W3AA 4RHSA 4DR1Q 1MSHA 1H9SB 2HCIA 3ND9A 1SBBB 1DD2A 2LMCB 2HUGA 1CTMA 2RCFA 2H5XA 1QZGA 5C5MA 4G7HC 5BR8Q 4FXGC 2Z4IA 4FO2A 1H9JA 4LF8Q 2RQXA 5I9PA 3HFZB 4KN4C 1STAA 5M5WH 3PO2G 2MHVA 1F2LA 1VQOA 4ULLA 3M9BA 1K8GA 2E76C 2BDNA 1TWAB 4HTHA 4IZ8A 1H9MA 1PMRA 5G3LD 2E2IB 2Y0SB 3ONAB 3M4OH 1IXRA 2G5DA 4YWLA 3L2PA 1B44D 2K5HA 4KD3A 4EVOA 1HUNA 4JBKA 5C0XJ 1UE6A 1VQGA 2YTYA 1YITA 2EZVA 5JAVA 1ICWA 1PTOH 3VYSA 3V2TA 4TRDA 4C56C 3X3NA 4GS3A 1ZYRC 3A56A 1PRTC 4QB4A 1LLRD 1KC8C 5LMNL 3HOZB 3ERSX 3TEHB 1CK1A 1TWHB 1IYJB 5E4WC 3J7A5 3TP7A 5JOBA 1VQLA 1ML0D 5K36H 1SNOA 1BO0A 3PSIA 3IFDA 4GZYC 1NUCA 5EAYA 4I7AA 3H15A 3QJYA 2K04A 4JI2L 2E75C 2NZ1D 1PH4A 3KLWA 2NZHA 4LF4Q 4LUVA 4NP5A 3PO3B 3R2TA 1E3PA 2IPKD 3PUWA 2PI2A 4IJHA 1LTAD 5C4XB 1V9PA 3SDZA 1TWGH 4JK1C 5EKKA 4E6IA 4OWTB 4BY1B 2N88A 4JW0A 3CRLC 1SJHD 5T1IA 5M5WB 1MJEA 2A73B 1VQIA 1WCMB 2G9HD 4A3IB 3J81j 1AE2A 4IO9A 3HKZE 1B53A 5KGUA 4RAUC 3C2PA 3G6EA 1FGUA 5CC4A 3ND8A 1PTOC 2IJ0A 2I5HA 4RGMA 4R4OA 2XN9C 4OONA 3BS1A 1CA5A 5FLMG 1C9OA 4EQ5A 4IPCA 1BQQT 3R3OA 1AE3A 1WYDA 2DY8A 1EOTA 5TSSA 4IPHA 3GO5A 1II3A 5I4DA 3RN5A 1W2BA 4QCLA 5HGQA 2EYJA 2KENA 3RZOH 2L15A 5IOCA 5KNDA 5D14A 4WJ3M 2VZAA 4QY7A 2DJGC 1E1TA 3P20A 3J81E 3URYA 4PZ7A 5EPJA 3M4PA 3GTJH 1R9TH 4MNOA 3PGZA 4YCVA 2JEAI 4B9XA 3STBD 3OWFA 3MTSA 4MHEA 3K58A 1YHAA 1JJCB 3NTIA 3ICEA 4GKJL 1YNJD 4KKUA 1SE3A 1Q12A 2KUMA 2UUCL 2ZTCA 1MGSA 2B3GA 1W3SA 2EYFA 3BJUA 4B3TL 3NEMA 3S1MB 1STHA 2IL8A 1I4XA 3BG3A 3G48A 3PV0A 2HQLA 2R92H 1GKHA 3CCEA 3DMUA 4X3TA 2BH8A 1I4GA 5DM63 3ULLA 4J1MA 2CQOA 2I46A 4K6DA 2QA4A 1S5DD 5GAEC 3I4NG 4A3LG 1UE5A 1HRJA 5CV7A 4XIGS 1VF5C 3CP0A 1IYUA 1VQHA 2UUAL 2VS1A 4A3KH 1PFSA 4LK1C 3OPOA 1N32Q 1JOQA 3STBC 2YTVA 1CA6A 1N33Q 4QMGA 1NMFA 5JJIA 3D8GA 3P1HA 3H3VI 4UHVA 2L55A 3AQQA 4EX5A 1HNZQ 3Q24A 3DXJC 3HRZC 4KMUC 4G57A 1QOHA 4DV3Q 4TKOB 1I50B 1SNQA 2YYZA 1AP0A 1SNCA 5FO9B 1JJ2A 5C3EG 4POGA 1RD9D 4N8X1 4AH6A 1C0AA 5EKLA 1UUPA 3KLSX 1HR0L 5C3WA 3PIPA 2K33A 1STGA 2PW7A 1IYVA 1L0YB 2OXPA 4A3IH 2K52A 1FVIA 4NB3A 2UXBL 3FEWX 4ZRZA 2PQAB 4UAIA 1RTNA 2MFIA 2NTTA 2BCOA 1KRTA 2E2HB 3A8IE 4LFAL 1SR3A 2R92B 3RLFA 2NN6H 3CPFA 3SHLA 1G91A 3NE5B 4K6LA 2WB1G 4C3JH 4X62Q 3HGBA 1HTPA 1GO3E 4CJ0B 2AUJD 5L37A 2HDMA 5DAUA 1HXYD 5FLXE 1B50A 1UEBA 4POFA 3E3XA 4K5XA 3IKJA 4R8NA 5CORA 5EBCA 3QO2A 2J0TD 3MEHA 1ASYA 4DV5Q 3GTLH 3CF5A 5M3MB 4G7ZC 5M9OA 1EWHA 1O80A 3T1YL 1XNRL 3HOWB 1TKWB 2BE5C 4LF5Q 2CHBD 1SNPA 1EQVA 5ISRA 3V96A 5M3MG 3S9WA 4XYOA 2F0HA 2F0QA 2BH2A 1SYEA 1EQTA 5IT9L 3OOCA 2PQEA 1ENCA 2DY7A 2A8VA 5C0XI 4JCVE 4JI6L 5GAGC 3FP9A 4YCWA 1HCZA 1CKMA 4TVAB 1A3VA 2JA5G 1O7ZA 1PZID 4A93H 2K14A 2M9VA 1I5FA 1UAPA 1XPOA 1K9MC 3T51B 4IOCA 2RKSA 2QF7A 3MXNA 1VQJA 1TVXA 1EWCA 3WOEA 1RF2D 5BN3A 4C3HH 1S5FD 2C35B 3VR3A 1F9RA 1TIID 3W5OA 2AQ1B 4DR1L 3S1NB 2GN5A 1C7YA 4A3BG 4GKKL 1F9SA 4H7BA 3KJOA 3J80L 4DGZA 1XXGA 2OF1A 2NVYH 4RCNA 4LF6Q 4DR3L 4CJ2C 3HOVG 5IIFA 2QKIC 4KKTA 2MPMA 1EYCA 1SNDA 4A93B 1ET6A 1K28A 1PTOF 2LY7A 5KNCA 1PFMA 1TS2A 2V1CC 3MC0B 5AJ3L 2BA1A 2A68D 1SMXA 4GN5A 4RKBA 1NAPA 4K14A 2HDLA 3TMEA 4LF6L 2PZWA 1AZPA 4RMFA 2XNAC 4MIUA 2ASBA 1HUMA 4LUOA 1IZ6A 2FFKB 3T53B 1OXXK 4WRDA 4JI7L 1A3UA 1DONA 4EQOA 1FYCA 5HGTA 3FPUB 1XYIA 3X3MA 5IY0A 1LTTD 4ZUIA 2B63H 4TQUS 3I90A 5C44G 1V1OA 3VR2A 1PH1A 3H91A 2F0UA 1WFQA 5IGGA 1SN8A 3DEOA 3K5NA 3S1QH 1U9RA 3MXPA 2DUDA 3MEFA 3PUVA 4BY1G 1M1KC 4LWCA 4GOPB 4JI5L 3S1RB 1VQAA 2A74C 4J15A 2OWOA 1EIHA 2K01A 2RBMA 4O1NA 1WCMG 1QJOA 1TWCH 4X3SA 2B2WA 4FVMA 3KF6A 3GTLB 2A68C 2F0LA 2NWGA 5FKAC 4K0KQ 4RFBA 2XRSD 4B3SL 4DR4L 2C5CA 3M7GA 3C46A 5CBEE 1WI5A 5J1ZA 3CC4A 1A8VA 3G7LA 2JA7G 1U4LA 1VQEA 2HQEA 4OX9L 3FKIG 5LL6X 1XNRQ 3A55A 3F8TA 1SEBD 1K8AC 1A63A 2EYLA 3SR1A 5C3EH 3BZDB 1P16A 5M5XB 5IYBG 5CV5A 2B2YC 2Q2IA 4BY1H 1K8OA 2Q8RE 1SFOH 5HURA 4JV5L 1S40A 2SOBA 1WTOA 4BBSH 1K0RA 3P7JA 3VDYA 5DM73 1EUJA 1VS0A 3PMFA 2TSSA 4FF3A 4HJ8A 3NWSA 1F2ZA 5IGBA 4DXFA 3J80i 3T56B 3RZDB 1QB5D 2QILA 2B2VC 3LX0A 1HNXQ 2MQHA 1KLGD 2F0FA 5DLQE 1WTXA 2PQAA 3EA6A 2NVXH 3HEJA 4K0KL 4DAYB 1FR3A 2XWJB 4JPBW 2XWBB 1KNEA 3K7UC 1SRUA 1OO9B 2L11A 3UDFA 3FVQA 2H4OA 4A3KB 4DUYL 3M85A 3TN2A 3F2UA 1EL0A 2CQAA 1KQSA 2SNSA 3JAML 4GNXB 3T1HQ 5CV4A 2OTJA 2RSNA 1OXUA 1Z6HA 3S1RH 1LACA 3ZJYC 3BYYB 4JI7Q 4LF7L 3NK9A 1YIJA 3I56A 4CDDC 2RDHA 2X6LA 3DHQA 5FO7B 5A35A 3PO2H 1H95A 1VMCA 3E0JA 1B2TA 1W6JA 1YZ6A 3NQTA 5DNFA 1BVSA 3W1GA 2ZJPA 4AQYL 4B9WA 3BZKA 1J5EL 4JYAQ 3J81c 1BCPC 1YI2A 1GOZA 3CCJA 1UWVA 2SNMA 1RODA 3VYTA 3BZCA 5FLXL 3CKIB 1IHZA 5C3XA 4UP7A 5C0XG 3PIOA 5ELDA 3C1FA 1PA6A 4JI0Q 1SAPA 1EIFA 4C3HB 4RGNA 2JK8A 1B1ZA 4UPAA 3K5MA 4K8IA 2B8FA 2R92G 4A3EH 1JR0D 4DUZQ 1CHPD 4IFDI 3D3RA 1B70B 3SK8A 1EZ6A 1X3QA 2BE5D 2WB1B 2NVQH 2F0WA 4DXGA 1QVCA 3NELA 1L1OA 1Y1WG 3H6MA 3SK5A 3BVGA 1E1OA 3VR5A 2I07B 4A3CG 1K8MA 1Y1WB 1R4PB 3I2ZA 3NBIA 3UDGA 4YY3Q 4EQNA 1QUQB 1PHJA 4YCUA 4A3DH 2E8GA 1CQFA 1EEFD 3A8JE 1EFWA 1WTRA 2RDGA 5EPLA 2UXCQ 1JC7A 1STYA 3BVMA 1NR2A 2P5ZX 2QEXA 3I73A 1PH2A 3R2IA 2ZM6L 3W1BA 3RNUA 3U58A 2A1AA 3TSSA 4OGQC 1BBWA 1JMCA 1YBYA 5GADC 3TZUA 4C3JB 1PH8A 1X6OA 4OL7A 4DV5L 4DR6Q 2JQOA 1I94L 2WAQB 1LT4D 1EQRA 1LTLA 4A3CH 1GVPA 5JVG3 5C4JB 3H3VC 2NB0A 4JI8Q 1A2UA 2R7ZH 3KK7A 1IBML 2HT1A 1JB7A 3KYHC 1XMOQ 5LMUL 3UDIA 2E2JB 3OSOA 1M8AA 4A3BB 1EY6A 4ZAIA 4LFBQ 4LFAQ 4KV6A 5HY6A 1GUTA 2N8NA 4DNIA 1AH9A 3BU2A 3I4OA 2NN6G 1JORA 3GTKB 1SE8A 4JI8L 2EXDA 1VF7A 2D62A 3DM3A 1TQOA 5FO8B 2A6HD 4A3BH 2R93G 5K36G 4OO1I 4GLXA 2HD3A 1NJIC 1Y1VB 2OQ0A 3CCQA 4HJ7A 5LL6S 4DR6L 2XGTA 3NUCA 1GHJA 4S3SA 5I9OA 1X32A 2F0KA 1Y69U 1O7IA 3D4RA 3K0XA 2MO0A 4IUVA 1PV4A 4B3ML 1LT6D 3CC2A 5JEAH 3S2DB 4BY7G 2ID0A 1S5ED 4FNFA 2VUMG 1O7LA 1G2SA 1G6PA 1RCVD 3L7ZC 4KJOA 4RGOS 3TP5A 2VUMB 3KBGA 3S16B 1TWFB 2O4XA 2UXCL 1QCBD 2Q2UA 4QJFA 2JXMB 1PH5A 2UUAQ 3V05A 1DCZA 2E2HH 4LF8L 1TU2B 3WWVA 3G71A 2F4VL 3OIQA 4A3EB 2K6AA 2F3IA 1EYAA 3DWPA 1KNAA 3T13A 4A3EG 4M8AA 4JG2A 2F0VA 4NW2A 1JT8A 1LT5D 1VQMA 1PTOD 1RTOA 1N34L 4OWXB 1D1IA 1F77A 3CC7A 2OQKA 5KRUA 1UEAB 1ZXTA 1GUOA 1ONLA 2NVYB 4QUFA 4B3TQ 2JA6H 3VYUA 3VR6A 1Q8KA 1Q1BA 4H13C 1SMYD 5EKIA 5KNBA 1FJGQ 1LO5D 2E74C 5CV8A 4BBRG 2IT1A 4K5VA 3S1MH 2CW0C 2Z8LA 2JA6G 1X65A 1DGSA 3A74A 4IN3A 2NYZD 2ZXPA 3EROA 2KCCA 4QIWB 4B08A 1EY9A 5E1FA 4CKEA 3F2BA 4OWWB 2KA7A 4DV2L 1H9SA 4IPDA 1ENFA 3M3YB 2EYPA 4RCOA 4DK1A 2F4VQ 3S17H 2K32A 1EIGA 1X55A 3MXUA 1J8IA 1V8QA 5I2YA 3EJIA 1PVOA 4NXML 4APVA 4BBSB 3MA2B 2N55A 3OYYA 3GTPB 1SYBA 1FNWA 4A3FB 5LHY1 1VQ5A 5C4XH 4A3FG 1PH7A 3I3CA 1TY2A 3TQYA 4ZCKA 3CAMA 4B3MQ 3KF6B 3C3LA 2VQEL 4QF4A 4P73A 2KECA 1BBXC 1B3AA 1VQ4A 1DZ1A 2PZUA 2YU9H 2R61A 3HOUB 5J3BA 4CGYB 4JI4Q 1HPCA 4U68A 1HHVA 2VQFQ 4BBRH 3JAMc 4UY8C 1MBYA 1Q90A 3NTKA 2YU9B 5LMUQ 1WD0A 2ZXRA 3U50C 5I6WA 5G3LF 5M3FH 4HAEA 2EE1A 5JEAG 1CI3M 4PMWA 1T9HA 1KRSA 2JEBI 1Y14B 2E2JH 1I4QA 3BYTB 3A5UA 1DOLA 3J80E 3GTQB 3PF5A 3GQBA 3PUZA 2F0PA 2XSCA 2QDLA 1I4PA 3S24A 3GTOH 3NXWA 1PRTF 3BDLA 1Q1EA 1Q3LA 1RDPD 2K75A 2KEEA 4B3RQ 4C3IH 3GP7A 1NR4A 3S2HH 4RG1A 4DPGA 4DR5L 4RGTA 1KLUD 3NWTA 3JC66 4XT1B 2PPBC 3K5OA 3OMCA 3KBXA 2UXDQ 3EBEA 1D5ZC 3R93A 3M3YH 2PI2E 4JI5Q 4YY3L 1OTCA 3ERQA 3CHBD 2Z1CA 2JE6I 4IUTA 5J22A 3W2DA 1ENAA 1M90C 5JEAJ 1FL0A 5JPNC 1VQ7A 2IHFA 3HOXB 4LFCL 4JI3Q 4FYDA 4R4CA 4XQJA 4PG3A 3U9SA 4HR7B 5T1GA 1LTGD 1G6ZA 1C4QA 3G4SA 4A3FH 3NP8A 3D0FA 4P71A 4RWSC 2QEJC 3DWAA 2B2UA 1NSNS 4DUZL 2IX3A 1VQ9A 1SJED 1XTCD 4ABNA 3MWYW 2K5DA 2LXKA 1KL9A 2G9DA 4H02A 3SE0A 3M4YA 1IBLQ 1FNVA 1BCPF 4DV1L 2E5LL 1RIPA 1WTQA 3EIVA 4V0BA 1HH2P 1AEXA 2M2LA 4UP9A 1A15A 1B9MA 4OIJA 4IUNA 5GROA 5C4ZA 5IWAQ 5IGEA 3RZOB 1EY4A 1TS5A 2EYOA 1ASZA 4DV1Q 2E5LQ 2CVRA 3KLSA 3RMHA 1Q7YC 1KABA 4LNQA 4ZK9B 1ILPA 1A6XA 1HTLD 1WTPA 4DR7L 3CXCA 2BOSA 1DJRD 3RLOA 5M3MH 1YVCA 3HKSA 1IBKQ 4X65L 1XJVA 4GNXA 1QWYA 4O2DA 1BOSA 1LABA 1NCVA 1RKNA 4J6HA 5DEHA 3SGIA 2KCMA 2D0OA 2CH4W 4CDEC 1JOOA 2KEDA 3FPPA 1P8LA 5M5YB 2V4DA 2L12A 5NUCA 4CBVA 3S2HB 3H0GH 1OXVA 1E22A 2JA8G 1I4RA 4ZKCB 4KJNA 2L1BA 3NTHA 3AB9A 1YHQA 3K6OA 4DR2Q 1VQPA 1K83H 2NBFA 2NN6I 4ODGA 4QUCA 4X64L 3GTQH 3PO3H 1N36L 3DLLA 5C4XG 4B3RL 3CMAA 4LF5L 4A3JB 2ZTEA 4PZ8A 1KDBA 4F88A 5M3FB 5F2DA 5EBDA 4X6AH 3MXGA 2JN4A 4YIJA 1WCMH 3IRBA 3UE0A 5JVH3 4DV4Q 5EPKA 2ZTDA 1HFNA 1JWMD 2WINB 4N9TA 3H94A 3MXNB 1G2TA 1X9NA 3J7AV 1EYDA 1E7ZA 4CDCC 4F87A 3CPWA 1BUVT 2K5NA 3M4QA 4K2KA 2FHTA 3D31A 2A6ED 3S15B 2D2CC 1CKNB 2JYOA 4K2LA 5IP9H 4GLAC 2ZJQA 1VQBA 4JI4L 3OHXC 2N3SA 3M7NA 4FF1A 1HZBA 4BA1I 2O2LD 4A4IA 2DNCA 3S14B 4HEDA 1I50H 5IP7H 3Q8DA 2FJ2A 1HR0Q 2Q2TA 1RL2A 1SSOA 2B2WC 3AU7A 1BKBA 3TRZA 4BBRB 1WTVA 3I55A 1SYFA 3HOZH 1YJ9A 3HOWG 2VB3X 4P2CB 4DK6C 3F2CA 3I4MB 1A2TA 1EQQA 3GTKH 4GN4B 4QIWE 1E24A 4IUPA 5FLMH 2VUMH 4DNTB 1LTSD 1HZ9A 1EZ8A 3EQLC 3I4MG 1LTBD 1VDZA 4PMBA 2Y0SE 5D3IB 3KFUA 4R9WA 4NXNL 3KUPA 4XYQA 3KDFA 1NBWA 4KI0A 1N32L 1EU3A 4L5SA 2QW7A 1FD7D 2WFWA 2R7ZB 3K57A 3ULPA 2CCZA 3TP8A 4DV6Q 1T5EA 3HG9A 2L0CA 4CHTB 1TWHH 4BBSG 1SLJA 1SXTA 1YNXA 2EYMA 1ESRA 3CU7A 3I7FA 3OMGA 3RD4A 1QG7A 1F2YA 2B2YA 3IL8A 2L9HA 1I6HB 1E0BA 2CW0D 3LWEA 3A7AB 3QIAA 1CZGA 3HOVH 2GVBA 1D1KA 1MI2A 2XRQD 4DV4L 2K1BA 2A69C 5COYA 5I6YA 1CZWA 4R1JA 5C44H 3AFQA 3H09A 4H44C 4JC0A 1IL2A 2I5MX 1IBLL 3SEBA 4ME5A 5JJZA 4GKJQ 1STEA 2F0GA 1IL8A 1PXUA 1SNMA 3D4WA 3J7AF 4LAAA 1NMGA 1U4PA 1EYGA 1EFID 4DR2L 4J8QA 4QGUA 4OO1H 1Y8PB 5IODA 1OXTA 1CSQA 5IYBH 4OELB 1A0IA 2N78A 1D6EC 3A0JA 4F7XA 1LTRD 2OEOA 2RA4A 1XMQL 5KYIA 2O5IC 1WD1A 1LTID 1L0XB 3CQZH 4NKLA 1S3OA 4NDXA 3PO3G 4FP5D 1IW7D 2QGQA 4ALPA 4BA2I 3U9OA 4A3DB 2CKZB 1YNND 2DNEA 2RVLA 5FJ8G 3NBHB 2AMCB 4O42A 1J9OA 3NHHA 5C44B 1QNUA 4YWKA 1L0WA 1YHBA 1A62A 2AUKA 2KQ3A 1LM0A 2B8GA 2F0NA 3K0YA 2ALYB 5A2QE 2B2TC 3TDQA 2NVQB 2I5LX 1YNNC 1HZCA 3PUXA 2I0QA 4WJWA 1PZKD 2M00A 1AZQA 1PRTB 3UI2A 3HOYH 5D3DA 5ELFA 4PZ6A 4JBJA 3K7AB 4IURA 1YNJC 3K80C 2OCEA 3IAYA 3WDNA 5ELBA 1CUKA 4Y52H 1BCPB 2JA7B 1QUQA 2IY5B 3HOWH 2D9UA 1B3QA 3U4ZA 4LF4L 4AYBE 4HJAA 1L1OB 2K4KA 2CH4A 1ZEQX 2JA5B 2HHHQ 2JA7H 1N9WA 2Q8IB 5IGDA 4BXXH 2ES2A 1K3RA 5E4XA 1C48A 2FMCA 2MP1A 4RHRA 5A2QL 5C4HA 2A19A 1IBMQ 3SXHA 4EGVA 1D7QA 3PO2B 2WAQE 3ZYYX 5IYCH 4DFAA 1MHWC 1IW7C 2PCFB 5LMNQ 4DV7L 1GM5A 1F9QA 1VQCA 4G7OC 1SFOB 1U0LA 2AWOA 2GVAA 4LFCQ 4FF2A 2Y0SG 4A3MB 3UE1A 1DXMA 2SEBD 2MUYA 2KVMA 4LJZC 4U673 1JWUD 3GV3A 1TWAH 1YEZA 3GTMB 2MO1A 1Q82C 1HA5A 4ME3A 2UXDL 4HSPA 2EY2A 2ZM6Q 1S5CD 1XTDA 5IP7G 2WB1E 4JBWA 5CMDA 3HOVB 1J6QA 1Q8IA 4DK0A 1YJNA 1JOKA 3ER0A 4L8JA 4L63B 3HOZG 2J4XA 3K59A 2O5JC 1D5MC 3SK6A 3VYRA 4C2MH 1DM0B 4BWGB 4C3IG 2UU9Q 4RA8A 3CCUA 2VNUD 3QWNA 1BCPD 1K3BC 5JJKA 1XPRA 4OO1G 4N9PA 4A3MH 3KF8A 4PNYA 3LNNA 1CQVA 1QE6A 4UDUC 2B2TA 3MHBA 1ICFB 2KBNA 4YHHL 4A3JH 1VQ6A 2RHSB 3MFGA 4KTAA 2ZT9C 2RDFA 1WJJA 3RUZA 4IFDH 4HIMA 4QL5A 4KHPQ 4PQXA 2EJFC 3OW7A 2F3WA 1DYQA 1XWEA 1AFPA 2JA9A 4A3JG 2BDOA 4N8FA 3Q22A 3HZXA 2UUBQ 1I3QH 2A6EC 2LXJA 2NUCA 1N36Q 1KDCA 3FDTA 2VQEQ 4DKAC 1TS3A 1MIUA 1KTKA 3PUYA 2MNAA 3CQZB 5ELNA 3EN2A 3JAMi 1YJWA 2WV6D 1ESFA 4ID6A 1RJTA 1S5BD 3K81C 2BA0A 4LF7Q 4ZKBB 2AKWB 1TXYA 1MKHA 5CBAE 3Q6SA 4CJ1B 4HJ5A 4A3GB 3D4DA 1BF4A 2NVTB 4R4TA 4A3GG 2F03A 1H9RA 2RF4A 1L1OC 3PIP3 1X3FA 4AIMA 3PCOB 2EOTA 5I2XA 5IT9E 5KYLA 4DUYQ 4DV2Q 5EQ0A 3QOLA 2PNHA 1V1PA 4DR7Q 1X54A 2EYHA 3L0OA 3NSWA 1V43A 3S14H 4MTKA 2C9OA 3RN2A 1QVFA 4DAPA 1JE5A 4OXPA 2MJ8A 3AMUA 3T4AC 2UUBL 1HNWQ 5IP9G 4MTNA 4ZQ3A 1UNSA 4P72A 1U4MA 4TSSA 1NE3A 1X3GA 2ICIA 1GUNA 4HJ9A 4GOPC 1XX8A 2CWPA 3TS0A 4KHPL 4PV1C 1LUZA 2R7ZG 2VL6A 3MZ5A 1E2VA 2R7DA 4A3KG 5CV6A 4JI2Q 3I4NB 5CV9A 4XDXA 1PYSB 1N34Q 2Z4HA 2IWHA 3LWUA 3L3OC 3Q23A 5KIXA 2SDFA 3S15H 3DUZA 3J7YW 1EOVA 5CYUA 3A54A 4GN3B 2L5TA 1I94Q 4DF7A 3R8BA 1D8LA 2PMZE 1HR0W 1E2WA 1VQFA 4OX9Q 2FXQA 4Q0FA 2AQ2B 5D65A 5ELOA 4DR4Q 1GUGA 3J81i 3J81L 3FMCA 4BY7H 2JSOA 1BDOA 1TY0A 4X66Q 5C3EB 3KDFB 4X66L 3S1QB 1PZJD 4DR5Q 1VMPA 3D6CA 5IE8A 3E5SA 3K8AA 4O0AA 2X6GA 1JWSD 5CR3A 4KY7A 2QCPX 3P75A 4MN3A 2VW9A 3HOYB 2F0DA 5FJ8H 4FDBA 2JA8H 1M4VA 2EJMA 4F8MA 1PYBA 1TS4A 5ELCA 1X56A 1GUSA 3HKZG 1X3PA 3IFTA 3HKZB 1F9PA 2LS01 4R8IA 4LFBL 1G8ZD 3PIO3 3ITPA 3RLNA 2A5HA 3LGJA 1GJXA 3I8ZA 4R4IA 1XMOL 2WP8J 3CRKC 1VQNA 1VQDA 4IUUA 1TT2A 2VQFL 4JI0L 5IGCA 5EGTA 1QVGA 3NPPA 4L5TA 3PF4A 2E2IH 1HNWL 1BBUA 3EVQA 1BXTA 4V190 1C8CA 1V1PB 4Z9CB 4IJLA 1G291 3FKIB 5IYDG 4BXXG 1UE7A 4IPGA 3T16A 1HQMC 4KKSA 2R93H 4R4QA 1JB3A 3SK4A 2EVBA 5GAHC 3O13A 4A3GH 1Q86C 4JI1Q 1F2MA 4C3JG 2JA6B 4GKKQ 3HOXH 2JJQA 4DK3C 2D5DA 4JOIA 4A76A 1K83B 4NXMQ 1Q81C 4I65A 3DM1A 2F0IA 3CCVA 4IUQA 4DV0Q 1SE2A 3T1HL 2NZOA 3UDXA 3CW2C 2EJGC 2K5WA 3SVMA 3I70A 3GTPH 5LMNW 1LT3D 1XMQQ 4XXEA 1G51A 5BN4A 4A3MG 2NVTH 3QB3A 2B29A 2K7VA 1FGBD 4LF9Q 1MJCA 1R4QB 1D2BA 2Z6BA 3EFXD 2CFMA 1CSPA 4A93G 1TWFH 3NENA 1CKNA 3QR8A 1GUWA 5BN5A 1Z47A 2DGYA 3FHWA 1BR9A 2ATWA 1QZHA 1SE4A 1SMYC 1EY0A 2D0PA 4BY7B 1TR5A 1I3QB 4HSVA 2ICEC 3FKIH 4C3IB 1J5EQ 4JYAL 4K5WA 3VA5A 1HZAA 2TMPA 3GTOB 4AQYQ 4DN4M 3KOJA 1EY8A 1SROA 4CKCA 4C2MB 4X62L 1JE4A 2EQSA 2NTSA 4X3KA 3OTOQ 4IOAA 4FXDA 1SYCA 3QOJA 2K03A 1QNKA 1KHIA 3S16H 2UU9L 1Y8NB 3D6WA 4Y7NH 4DV6L 2A6HC 1RHPA 3AYHB 1K73C 1Q46A 2PZTA 1KD1C 2K50A 4NXNQ 2Q2HA 3NBHA 5CGKA 2IX0A 4JBMA 5C6AA 3RZDH 1TWGB 4ZYSA 3E9HA 2HCCA 3TREA 1Z7TA 2XIWA 3GD7A 5FOBB 4QQBX 3MAQA 4OIKA 1AW7A 2Z9HA 5IGFA 2PNRC 3DWQA 2F4IA 1D5XC 1I6VC 3CCSA 1WTWA 1ILQA 2ZXOA 4HCSA 1B7YB 1N33L 3A5ZB 3RR5A 1Y8OB 3ULJA 4DV7Q 2A69D 2Z6KC 1R9TB 4P75A 1HNXL 2ENBA 4IFDG 2EY5A 1MSGA 3HS0C 1CT1D 4C1NI 5J39A 1ZKOA 5FK9C 2VB2X 2PMZB 3MVVA 3VA7A 1JJGA 1PFBA 2FINB 2DJFC 2QDBA 2OTLA 1V1QA 4NPSA 3K7AH 4BS9A 3N52A 3NQIA 1S72A 2HHHL 1JQYD 2WKDA 3TZDA 2F0EA 2KCNA 2J7ZA 4JV5Q 4HMJA 3CCRA 2B2VA 2B2UC 4KHZA 2CWAA 2WKCA 3E0EA 4GOPA 3I91A 3E6ZX 4HN7A 2JA5H 2R7FA 3GTJB 3BDOA 3M4OB 3GDEA 4L5RC 3N6RA 1K0SA 4FXKC 4DAVA 5JJLA 2IX1A 4DNRB 5C4JH 4XQNA 4KHVA 1XNQQ 3F1ZA 4X64Q 1KDAA 3GV6A 5GQOA 4LF9L 3J7ZC 2R6GA 4P74A 4DAMA 5E7NA 4HIDA 1T5XD 1PH9A 3DEPA 3HOUG 2WIIB 1PDQA 1L2FA 1PLFA 4Q5VA 3F2DA 4KY5A 1PH3A 4XQQA 1U4RA 3PQIA 4RH6A 4GNXC 4IQZA 2AHOB 3I72A 1GXDC 1PYWD 4IALA 4DA2A 2R93B 3A8KE 1IBKL 4JI6Q 2KHIA 4DU9A 3CCMA 2OT2A 2E2DC 2MGSA 4LUZA 2K05A 2RHQB 1JCKB 4ZLTF 4M1UB 1LV9A 1AN8A 3S17B 3KLRA 4WJ4A 5IT9c 1XNQL 3TBIB 5KEEA 2JA8B 2KHSA 1B8AA 1EWIA 5AJ3Q 4KN7C 2K5QA 1PTOB 3CCLA 5IWAL 1WTHA 3HOYG 4C3HG 3S1NH 2LFNA 1BNZA 2ZJRA 1QILA 2PW5A 1EEID 1U5KA 1STBA 4A3IG 4LMQD 1WOCA 5ELEA 4GLVB 1X3EA 4NMZA 1STNA 1Y1WH 4DR3Q 1E2ZA 4ILWA 4FF4A 2EIFA 1N8RC 1KAWA 4WORA 3HOXG 2Z0SA 2IHEA 1CKOA 3QG1A 1PH6A 3I4MH 2UXBQ 1GHKA 2XTIA 4KD4A 1ZYRD 3B6YA 3OIPA 2LSSA 2XVSA 5C0XH 2DN8A 1SYGA 4JI3L 1FNUA 3S2DH 2L4NA 1HQRD 3WOFA 2PO4A 5M5XH 4PMCA 1EY7A 4XT3B 1B9NA 1MD2D 4H0LC 4HIKA 2IW3A 2EY1A 3G6JB 4G4KA 1LYLA 4JOIC 1H9KA 4X3UA 3JAME 1SYDA 3HOUH 1CFMA 1OXSC 2F0MA 1EY5A 2WAQG 4HCEA 2Q8TA 1I6HH 3FRPB 4JVZA 1HA6A 2VY3A 4L6TB 3T1YQ 5E3FA 1GD7A 2RSOA 1I4HA 1IKLA 2GA4B 2KHJA 2EDGA 2RCNA 2F52A 5BR8L 3GTMH 1PRTD 3J80c 4AYBG 1O78A 3AEVA 2KOLA 4DAYA 2HIVA 1SDFA 4RKLA 1A3TA 4AYBB 3OTOL 4IFDJ 4EQPA 2KCTA 5FLXc 4HIOA 2YTXA 4I7ZC 5C5LA 1O7YA 1EIYB
chains in the Genus database with same CATH topology
3EBEA 1QVFA 5IYCG 4JI7L 3M3YH 3AFPA 1JE5A 1UE1A 2PI2E 4OXPA 4JI5Q 4YY3L 1OTCA 3GTOH 1Y1VG 2JE6I 4UP8A 4LW1A 2UUBL 4XTCS 5IY0A 5JEAJ 1FL0A 1M90C 1VQ7A 2IHFA 2UUCQ 4LFCL 4JI3Q 3CD6A 4R4CA 1HNWQ 4PG3A 1NY4A 5IP9G 4MTNA 2K5VA 4TQUS 2B63H 5C44G 4P72A 1NE3A 1X3GA 4HJ9A 1PH1A 4GOPC 1WFQA 3I4NH 1SN8A 3S1QH 4A3LH 3G4SA 4A3FH 1VCIA 4B3SQ 5M5YH 2CWPA 2DUDA 3MEFA 3PUVA 4BY1G 3D0FA 1LUZA 3E9IA 4LWCA 4P71A 4JI5L 4GOPB 3KF8B 1VQ8A 1VQAA 2R7ZG 4J15A 2OWOA 2VL6A 4DUZL 2R7DA 4YWMA 4A3KG 2YV5A 4JI2Q 1WCMG 5IYDH 1VQ9A 1TWCH 4DV3L 1PYSB 1N34Q 3GTGH 3KF6A 1HNZL 2LXKA 1KL9A 4K0KQ 4H02A 4B3SL 5M3FG 4DR4L 2HIXA 3CC4A 1WI5A 1IBLQ 3S15H 1A8VA 4DV1L 2E5LL 1EOVA 1RIPA 1VQEA 2JA7G 3EIVA 4GN3B 3FKIG 4OX9L 1HH2P 1XNRQ 4DV0L 1I94Q 3F8TA 2N49A 1K8AC 1VQKA 1A63A 1D8LA 2PMZE 4UP9A 1HR0W 5GROA 1VQFA 5IWAQ 5C3EH 4OX9Q 2B63G 2FXQA 4KLKA 1ASZA 1P16A 4DV1Q 5IYBG 4X65Q 2E5LQ 1XPUA 5ELOA 4DR4Q 3J81i 1Q7YC 4LNQA 1NTGA 2Q2IA 4BY1H 4JI1L 1SFOH 1KIXA 4BY7H 4JV5L 4A3DG 4X66Q 3KDFB 4X66L 1S40A 4DR7L 3CXCA 4A75A 4DR5Q 4BBSH 4L5QA 5IE8A 3RLOA 5M3MH 1K0RA 3CMEA 5H1SE 3VDYA 1EUJA 1YVCA 3K8AA 4O0AA 1VS0A 3HKSA 1IBKQ 2Z6KA 4X65L 4HJ8A 1XJVA 4GNXA 3H0GG 2VW9A 3U4VA 4O2DA 4MZ9A 5FJ8H 4FDBA 3J80i 3SGIA 2AWNA 2JA8H 2KCMA 2D0OA 1PYBA 1FJGL 1HNXQ 1KXLA 2MQHA 1X56A 1P8LA 3HKZG 5DLQE 2PQAA 1HJPA 2NVXH 4K0KL 4DAYB 3H0GH 3H3VH 1OXVA 3OW2A 3K7UC 3KJPA 1E22A 1SRUA 2JA8G 4LFBL 1R9TH 3TS2A 3UDFA 4YHHQ 1YHQA 1Y1VH 3RLNA 3LGJA 1Z9FA 4R4IA 4DR2Q 1XMOL 2WP8J 1VQNA 1VQPA 4DUYL 1K83H 1VQDA 2NN6I 3M85A 2VQFL 4X64L 4DR1Q 4JI0L 1N36L 3DLLA 3GTQH 3PO3H 5C4XG 1KQSA 1QVGA 4B3RL 3CMAA 1QZGA 4GNXB 4LF5L 2H5XA 4L5TA 2ZTEA 4PZ8A 3T1HQ 5BR8Q 2E2IH 3PF4A 1BBUA 1HNWL 2OTJA 1AH9A 1OXUA 4LF8Q 3S1RH 1M1KC 3HFZB 3PO2G 5M5WH 4X6AH 4IJLA 1VQOA 3ZJYC 3M9BA 1K8GA 1G291 1WCMH 3IRBA 3UE0A 5IYDG 4DV4Q 4BXXG 1UE7A 4JI7Q 4IPGA 2ZTDA 4LF7L 2R93H 4R4QA 1YIJA 3I56A 3MXNB 3M4OH 5GAHC 1IXRA 1X9NA 4YWLA 4A3GH 1Q86C 3L2PA 2K5HA 1E7ZA 4JI1Q 3CPWA 3PO2H 1H95A 2K5NA 3M4QA 5C0XJ 4JBKA 1UE6A 4GKKQ 1VQGA 2YTYA 1YZ6A 3D31A 3W1GA 1BVSA 2JJQA 4DK3C 3HOXH 2ZJPA 4AQYL 3BZKA 1J5EL 1CKNB 4JYAQ 5IP9H 4JOIA 4A76A 4GLAC 3TS0A 2ZJQA 1VQBA 3J81c 1Q81C 4JI4L 1YI2A 4NXMQ 2N3SA 4GS3A 3CCJA 3CCVA 3M7NA 1HZBA 4BA1I 3S14H 1UWVA 4DV0Q 3BZCA 1KC8C 4A4IA 3T1HL 4UP7A 1I50H 5LMNL 2NZOA 5C0XG 3UDXA 3PIOA 3CW2C 3ERSX 5IP7H 3TEHB 3Q8DA 1IYJB 1HR0Q 2Q2TA 1RL2A 3GTPH 1PA6A 5LMNW 1BKBA 3TRZA 1XMQQ 4JI0Q 3J7A5 1EIFA 1G51A 4A3MG 2JK8A 1VQLA 2NVTH 3I55A 2B29A 3PSIA 3HOZH 5EAYA 1YJ9A 3HOWG 4UPAA 4LF9Q 1MJCA 3H15A 1EIYB 4JI2L 2R92G 4A3EH 4DK6C 4DUZQ 4IFDI 3F2CA 1B70B 1EQQA 2CFMA 1PH4A 1CSPA 3KLWA 4GN4B 2NZHA 4QIWE 1E24A 3GTKH 5FLMH 2NVQH 2VUMH 4LF4Q 4A93G 1HZ9A 1TWFH 3NENA 1QVCA 4LUVA 3NELA 3I4MG 1L1OA 1CKNA 2Y0SE 1Y1WG 1E3PA 3KFUA 3PUWA 4NXNL 1E1OA 2PI2A 4IJHA 3KDFA 1NBWA 1Z47A 2DGYA 4KI0A 3FHWA 4A3CG 1N32L 2ATWA 1V9PA 1TWGH 1QZHA 4L5SA 3I2ZA 4OWTB 3UDGA 2WFWA 2D0PA 4YY3Q 3ULPA 1QUQB 1PHJA 2CCZA 4YCUA 4A3DH 4DV6Q 2E8GA 1MJEA 1EFWA 1TWHH 1VQIA 3FKIH 1SLJA 1J5EQ 1YNXA 3J81j 1AE2A 4BBSG 4IO9A 1HZAA 4JYAL 3HKZE 2UXCQ 4AQYQ 3KOJA 1SROA 3I7FA 3G6EA 1FGUA 4X62L 2QEXA 2EQSA 4IOAA 3OTOQ 1PH2A 2ZM6L 3W1BA 3RNUA 3U58A 2I5HA 1KHIA 2A1AA 1BBWA 4R4OA 4OONA 3S16H 1JMCA 2UU9L 1YBYA 3HOVH 2GVBA 5GADC 4Y7NH 5FLMG 1PH8A 4DV6L 1C9OA 1X6OA 4DV4L 4EQ5A 4DV5L 4DR6Q 2JQOA 1I94L 3AYHB 4IPCA 1EQRA 1K73C 1AE3A 1WYDA 4R1JA 1LTLA 3AFQA 1Q46A 5C44H 4JC0A 1KD1C 2I5MX 1IBLL 2K50A 3GO5A 4IPHA 1GVPA 4NXNQ 1IL2A 2Q2HA 4A3CH 4GKJQ 3RN5A 2IX0A 1W2BA 4JI8Q 4JBMA 2R7ZH 5HGQA 1IBML 3RZDH 2KENA 1JB7A 2HT1A 3RZOH 2L15A 3E9HA 1NMGA 3KYHC 3TREA 1EYGA 4DR2L 1XMOQ 2VZAA 4QY7A 3GD7A 3UDIA 4QGUA 5LMUL 4QQBX 4WJ3M 1E1TA 1OXTA 1CSQA 5IYBH 4PZ7A 4LFAQ 4LFBQ 3CCSA 1A0IA 5HY6A 3M4PA 2N8NA 3GTJH 4DNIA 3PGZA 3BU2A 3I4OA 4MNOA 2N78A 1B7YB 2NN6G 4YCVA 3STBD 2JEAI 3A0JA 1SE8A 1N33L 4JI8L 1YHAA 1JJCB 3A5ZB 3RR5A 1XMQL 3ICEA 4GKJL 2EXDA 3ULJA 3DM3A 2D62A 4DV7Q 1Q12A 2UUCL 3CQZH 2Z6KC 2ZTCA 4P75A 1S3OA 1HNXL 4A3BH 4IFDG 2B3GA 4KHPL 1W3SA 3PO3G 2R93G 4OO1I 3BJUA 4GLXA 2QGQA 4ALPA 2OQ0A 3NEMA 1NJIC 4B3TL 3CCQA 4HJ7A 4BA2I 4DR6L 2XGTA 3G48A 2CKZB 3PV0A 2HQLA 2R92H 1GKHA 1O7IA 5FJ8G 3NBHB 1JJGA 2MO0A 3K0XA 2AMCB 3CCEA 1PV4A 2BH8A 4B3ML 3CC2A 2OTLA 4BY7G 1V1QA 4NPSA 4YWKA 2ID0A 1L0WA 3ULLA 3K7AH 1YHBA 1A62A 2VUMG 1LM0A 1S72A 2HHHL 2CQOA 1G6PA 3L7ZC 2ALYB 2QA4A 4JV5Q 2I5LX 3CCRA 2UXCL 1HZCA 3PUXA 4KHZA 2I0QA 2CWAA 5GAEC 3I4NG 4A3LG 1UE5A 2Q2UA 4QJFA 4XIGS 3E0EA 3CP0A 3HOYH 4GOPA 4PZ6A 4JBJA 1PH5A 1VQHA 2R7FA 2VS1A 2JA5H 2UUAL 2UUAQ 4A3KH 1PFSA 3GDEA 3K80C 2E2HH 4L5RC 3WWVA 2OCEA 4LF8L 1N32Q 3G71A 2F4VL 1CUKA 4Y52H 2IX1A 5JJLA 2F3IA 1QUQA 3STBC 5C4JH 5K36G 2IY5B 3HOWH 2YTVA 1XNQQ 3U4ZA 3F1ZA 1N33Q 4A3EG 1NMFA 4AYBE 4LF4L 4HJAA 3H3VI 1L1OB 5JJIA 4JG2A 2K4KA 4X64Q 1JT8A 3AQQA 4EX5A 1HNZQ 1VQMA 2HHHQ 1YITA 2JA7H 1N9WA 1N34L 4OWXB 4DV3Q 4BXXH 5GQOA 2ES2A 4LF9L 1K3RA 2YYZA 3J7ZC 2R6GA 4P74A 4DAMA 3CC7A 2OQKA 5E7NA 2A19A 1JJ2A 1IBMQ 5C3EG 4POGA 1D7QA 4HIDA 1PH9A 4AH6A 4B3TQ 2WAQE 2JA6H 3HOUG 1C0AA 1Q8KA 1Q1BA 1HR0L 1L2FA 5IYCH 3PIPA 3F2DA 1PH3A 4DV7L 5LMNQ 1GM5A 1VQCA 4A3IH 1FJGQ 2K52A 1U0LA 1FVIA 4NB3A 2AWOA 2GVAA 4LFCQ 2UXBL 2Y0SG 4GNXC 4BBRG 2PQAB 3UE1A 2AHOB 2IT1A 2MFIA 3S1MH 1KRTA 1TWAH 1YEZA 4LFAL 2JA6G 1SR3A 1IBKL 4JI6Q 2KHIA 3CCMA 2MO1A 3RLFA 1Q82C 1X65A 1DGSA 3A74A 4LUZA 4ME3A 2UXDL 3CPFA 2ZM6Q 2RHQB 1XTDA 5IP7G 2WB1E 4JBWA 1J6QA 2WB1G 4C3JH 4X62Q 3F2BA 1YJNA 1GO3E 4WJ4A 4OWWB 5IT9c 4DV2L 4IPDA 1XNQL 3ER0A 1B8AA 3HOZG 1EWIA 1UEBA 4POFA 2F4VQ 5AJ3Q 3S17H 3CCLA 5IWAL 1X55A 4C2MH 3HOYG 3S1NH 1ASYA 4DV5Q 3GTLH 3CF5A 2ZJRA 1PVOA 4NXML 1XNRL 4APVA 1U5KA 3T1YL 4A3IG 2UU9Q 3OYYA 1WOCA 4LF5Q 3CCUA 2VNUD 4GLVB 1X3EA 5M3MG 1Y1WH 1XPRA 5JJKA 4OO1G 4DR3Q 4A3MH 2BH2A 1VQ5A 5C4XH 4A3FG 1PH7A 3TQYA 2KBNA 3CAMA 5C0XI 4YHHL 4A3JH 2A8VA 4JCVE 4JI6L 1VQ6A 4B3MQ 2RHSB 2EIFA 3FP9A 3KF6B 4YCWA 5GAGC 1N8RC 1CKMA 4TVAB 1KAWA 3HOXG 2JA5G 4A93H 2Z0SA 2IHEA 2VQEL 1CKOA 4P73A 2K14A 1WJJA 1PH6A 1I5FA 3I4MH 4HIMA 4QL5A 1XPOA 4KHPQ 2UXBQ 1VQ4A 1K9MC 2XTIA 3B6YA 2LSSA 4IOCA 2JA9A 1VQJA 4A3JG 2YU9H 5J3BA 4C3HH 4JI3L 2C35B 3S2DH 2UUBQ 1I3QH 4JI4Q 2LXJA 1N36Q 2VQFQ 5M5XH 3W5OA 4BBRH 3JAMc 4DR1L 4UY8C 2VQEQ 4DKAC 2GN5A 4HIKA 1C7YA 4A3BG 4GKKL 1MIUA 3KJOA 3PUYA 5LMUQ 2MNAA 1LYLA 4JOIC 3U50C 5ELNA 3EN2A 3HOUH 3JAMi 1YJWA 5M3FH 1OXSC 2WAQG 3K81C 2NVYH 2BA0A 4LF6Q 5JEAG 1I6HH 4PMWA 1T9HA 4DR3L 4LF7Q 3HOVG 2UXDQ 1KRSA 2JEBI 1Y14B 2AKWB 1TXYA 1MKHA 2E2JH 2VY3A 3A5UA 4HJ5A 3T1YQ 3PF5A 3PUZA 4R4TA 1GD7A 2KHJA 2RCNA 4A3GG 3GTMH 2F52A 2V1CC 5BR8L 2RF4A 3J80c 3S24A 1L1OC 4AYBG 2BA1A 5AJ3L 3AEVA 1X3FA 1Q1EA 1SMXA 2K75A 3PCOB 4GN5A 4AIMA 4B3RQ 4C3IH 4LF6L 2HIVA 3S2HH 4RG1A 3OTOL 4DUYQ 4DV2Q 4IFDJ 4DPGA 2PNHA 2KCTA 4DR5L 4RMFA 5FLXc 4HIOA 1X54A 2YTXA 4DR7Q 2ASBA 3JC66 4LUOA 3L0OA 1IZ6A 1V43A 1OXXK 3RN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EBE A;  1QVF A;  5IYC G;  4JI7 L;  3M3Y H;  3AFP A;  1JE5 A;  1UE1 A;  2PI2 E;  4OXP A;  4JI5 Q;  4YY3 L;  1OTC A;  3GTO H;  1Y1V G;  2JE6 I;  4UP8 A;  4LW1 A;  2UUB L;  4XTC S;  5IY0 A;  5JEA J;  1FL0 A;  1M90 C;  1VQ7 A;  2IHF A;  2UUC Q;  4LFC L;  4JI3 Q;  3CD6 A;  4R4C A;  1HNW Q;  4PG3 A;  1NY4 A;  5IP9 G;  4MTN A;  2K5V A;  4TQU S;  2B63 H;  5C44 G;  4P72 A;  1NE3 A;  1X3G A;  4HJ9 A;  1PH1 A;  4GOP C;  1WFQ A;  3I4N H;  1SN8 A;  3S1Q H;  4A3L H;  3G4S A;  4A3F H;  1VCI A;  4B3S Q;  5M5Y H;  2CWP A;  2DUD A;  3MEF A;  3PUV A;  4BY1 G;  3D0F A;  1LUZ A;  3E9I A;  4LWC A;  4P71 A;  4JI5 L;  4GOP B;  3KF8 B;  1VQ8 A;  1VQA A;  2R7Z G;  4J15 A;  2OWO A;  2VL6 A;  4DUZ L;  2R7D A;  4YWM A;  4A3K G;  2YV5 A;  4JI2 Q;  1WCM G;  5IYD H;  1VQ9 A;  1TWC H;  4DV3 L;  1PYS B;  1N34 Q;  3GTG H;  3KF6 A;  1HNZ L;  2LXK A;  1KL9 A;  4K0K Q;  4H02 A;  4B3S L;  5M3F G;  4DR4 L;  2HIX A;  3CC4 A;  1WI5 A;  1IBL Q;  3S15 H;  1A8V A;  4DV1 L;  2E5L L;  1EOV A;  1RIP A;  1VQE A;  2JA7 G;  3EIV A;  4GN3 B;  3FKI G;  4OX9 L;  1HH2 P;  1XNR Q;  4DV0 L;  1I94 Q;  3F8T A;  2N49 A;  1K8A C;  1VQK A;  1A63 A;  1D8L A;  2PMZ E;  4UP9 A;  1HR0 W;  5GRO A;  1VQF A;  5IWA Q;  5C3E H;  4OX9 Q;  2B63 G;  2FXQ A;  4KLK A;  1ASZ A;  1P16 A;  4DV1 Q;  5IYB G;  4X65 Q;  2E5L Q;  1XPU A;  5ELO A;  4DR4 Q;  3J81 i;  1Q7Y C;  4LNQ A;  1NTG A;  2Q2I A;  4BY1 H;  4JI1 L;  1SFO H;  1KIX A;  4BY7 H;  4JV5 L;  4A3D G;  4X66 Q;  3KDF B;  4X66 L;  1S40 A;  4DR7 L;  3CXC A;  4A75 A;  4DR5 Q;  4BBS H;  4L5Q A;  5IE8 A;  3RLO A;  5M3M H;  1K0R A;  3CME A;  5H1S E;  3VDY A;  1EUJ A;  1YVC A;  3K8A A;  4O0A A;  1VS0 A;  3HKS A;  1IBK Q;  2Z6K A;  4X65 L;  4HJ8 A;  1XJV A;  4GNX A;  3H0G G;  2VW9 A;  3U4V A;  4O2D A;  4MZ9 A;  5FJ8 H;  4FDB A;  3J80 i;  3SGI A;  2AWN A;  2JA8 H;  2KCM A;  2D0O A;  1PYB A;  1FJG L;  1HNX Q;  1KXL A;  2MQH A;  1X56 A;  1P8L A;  3HKZ G;  5DLQ E;  2PQA A;  1HJP A;  2NVX H;  4K0K L;  4DAY B;  3H0G H;  3H3V H;  1OXV A;  3OW2 A;  3K7U C;  3KJP A;  1E22 A;  1SRU A;  2JA8 G;  4LFB L;  1R9T H;  3TS2 A;  3UDF A;  4YHH Q;  1YHQ A;  1Y1V H;  3RLN A;  3LGJ A;  1Z9F A;  4R4I A;  4DR2 Q;  1XMO L;  2WP8 J;  1VQN A;  1VQP A;  4DUY L;  1K83 H;  1VQD A;  2NN6 I;  3M85 A;  2VQF L;  4X64 L;  4DR1 Q;  4JI0 L;  1N36 L;  3DLL A;  3GTQ H;  3PO3 H;  5C4X G;  1KQS A;  1QVG A;  4B3R L;  3CMA A;  1QZG A;  4GNX B;  4LF5 L;  2H5X A;  4L5T A;  2ZTE A;  4PZ8 A;  3T1H Q;  5BR8 Q;  2E2I H;  3PF4 A;  1BBU A;  1HNW L;  2OTJ A;  1AH9 A;  1OXU A;  4LF8 Q;  3S1R H;  1M1K C;  3HFZ B;  3PO2 G;  5M5W H;  4X6A H;  4IJL A;  1VQO A;  3ZJY C;  3M9B A;  1K8G A;  1G29 1;  1WCM H;  3IRB A;  3UE0 A;  5IYD G;  4DV4 Q;  4BXX G;  1UE7 A;  4JI7 Q;  4IPG A;  2ZTD A;  4LF7 L;  2R93 H;  4R4Q A;  1YIJ A;  3I56 A;  3MXN B;  3M4O H;  5GAH C;  1IXR A;  1X9N A;  4YWL A;  4A3G H;  1Q86 C;  3L2P A;  2K5H A;  1E7Z A;  4JI1 Q;  3CPW A;  3PO2 H;  1H95 A;  2K5N A;  3M4Q A;  5C0X J;  4JBK A;  1UE6 A;  4GKK Q;  1VQG A;  2YTY A;  1YZ6 A;  3D31 A;  3W1G A;  1BVS A;  2JJQ A;  4DK3 C;  3HOX H;  2ZJP A;  4AQY L;  3BZK A;  1J5E L;  1CKN B;  4JYA Q;  5IP9 H;  4JOI A;  4A76 A;  4GLA C;  3TS0 A;  2ZJQ A;  1VQB A;  3J81 c;  1Q81 C;  4JI4 L;  1YI2 A;  4NXM Q;  2N3S A;  4GS3 A;  3CCJ A;  3CCV A;  3M7N A;  1HZB A;  4BA1 I;  3S14 H;  1UWV A;  4DV0 Q;  3BZC A;  1KC8 C;  4A4I A;  3T1H L;  4UP7 A;  1I50 H;  5LMN L;  2NZO A;  5C0X G;  3UDX A;  3PIO A;  3CW2 C;  3ERS X;  5IP7 H;  3TEH B;  3Q8D A;  1IYJ B;  1HR0 Q;  2Q2T A;  1RL2 A;  3GTP H;  1PA6 A;  5LMN W;  1BKB A;  3TRZ A;  1XMQ Q;  4JI0 Q;  3J7A 5;  1EIF A;  1G51 A;  4A3M G;  2JK8 A;  1VQL A;  2NVT H;  3I55 A;  2B29 A;  3PSI A;  3HOZ H;  5EAY A;  1YJ9 A;  3HOW G;  4UPA A;  4LF9 Q;  1MJC A;  3H15 A;  1EIY B;  4JI2 L;  2R92 G;  4A3E H;  4DK6 C;  4DUZ Q;  4IFD I;  3F2C A;  1B70 B;  1EQQ A;  2CFM A;  1PH4 A;  1CSP A;  3KLW A;  4GN4 B;  2NZH A;  4QIW E;  1E24 A;  3GTK H;  5FLM H;  2NVQ H;  2VUM H;  4LF4 Q;  4A93 G;  1HZ9 A;  1TWF H;  3NEN A;  1QVC A;  4LUV A;  3NEL A;  3I4M G;  1L1O A;  1CKN A;  2Y0S E;  1Y1W G;  1E3P A;  3KFU A;  3PUW A;  4NXN L;  1E1O A;  2PI2 A;  4IJH A;  3KDF A;  1NBW A;  1Z47 A;  2DGY A;  4KI0 A;  3FHW A;  4A3C G;  1N32 L;  2ATW A;  1V9P A;  1TWG H;  1QZH A;  4L5S A;  3I2Z A;  4OWT B;  3UDG A;  2WFW A;  2D0P A;  4YY3 Q;  3ULP A;  1QUQ B;  1PHJ A;  2CCZ A;  4YCU A;  4A3D H;  4DV6 Q;  2E8G A;  1MJE A;  1EFW A;  1TWH H;  1VQI A;  3FKI H;  1SLJ A;  1J5E Q;  1YNX A;  3J81 j;  1AE2 A;  4BBS G;  4IO9 A;  1HZA A;  4JYA L;  3HKZ E;  2UXC Q;  4AQY Q;  3KOJ A;  1SRO A;  3I7F A;  3G6E A;  1FGU A;  4X62 L;  2QEX A;  2EQS A;  4IOA A;  3OTO Q;  1PH2 A;  2ZM6 L;  3W1B A;  3RNU A;  3U58 A;  2I5H A;  1KHI A;  2A1A A;  1BBW A;  4R4O A;  4OON A;  3S16 H;  1JMC A;  2UU9 L;  1YBY A;  3HOV H;  2GVB A;  5GAD C;  4Y7N H;  5FLM G;  1PH8 A;  4DV6 L;  1C9O A;  1X6O A;  4DV4 L;  4EQ5 A;  4DV5 L;  4DR6 Q;  2JQO A;  1I94 L;  3AYH B;  4IPC A;  1EQR A;  1K73 C;  1AE3 A;  1WYD A;  4R1J A;  1LTL A;  3AFQ A;  1Q46 A;  5C44 H;  4JC0 A;  1KD1 C;  2I5M X;  1IBL L;  2K50 A;  3GO5 A;  4IPH A;  1GVP A;  4NXN Q;  1IL2 A;  2Q2H A;  4A3C H;  4GKJ Q;  3RN5 A;  2IX0 A;  1W2B A;  4JI8 Q;  4JBM A;  2R7Z H;  5HGQ A;  1IBM L;  3RZD H;  2KEN A;  1JB7 A;  2HT1 A;  3RZO H;  2L15 A;  3E9H A;  1NMG A;  3KYH C;  3TRE A;  1EYG A;  4DR2 L;  1XMO Q;  2VZA A;  4QY7 A;  3GD7 A;  3UDI A;  4QGU A;  5LMU L;  4QQB X;  4WJ3 M;  1E1T A;  1OXT A;  1CSQ A;  5IYB H;  4PZ7 A;  4LFA Q;  4LFB Q;  3CCS A;  1A0I A;  5HY6 A;  3M4P A;  2N8N A;  3GTJ H;  4DNI A;  3PGZ A;  3BU2 A;  3I4O A;  4MNO A;  2N78 A;  1B7Y B;  2NN6 G;  4YCV A;  3STB D;  2JEA I;  3A0J A;  1SE8 A;  1N33 L;  4JI8 L;  1YHA A;  1JJC B;  3A5Z B;  3RR5 A;  1XMQ L;  3ICE A;  4GKJ L;  2EXD A;  3ULJ A;  3DM3 A;  2D62 A;  4DV7 Q;  1Q12 A;  2UUC L;  3CQZ H;  2Z6K C;  2ZTC A;  4P75 A;  1S3O A;  1HNX L;  4A3B H;  4IFD G;  2B3G A;  4KHP L;  1W3S A;  3PO3 G;  2R93 G;  4OO1 I;  3BJU A;  4GLX A;  2QGQ A;  4ALP A;  2OQ0 A;  3NEM A;  1NJI C;  4B3T L;  3CCQ A;  4HJ7 A;  4BA2 I;  4DR6 L;  2XGT A;  3G48 A;  2CKZ B;  3PV0 A;  2HQL A;  2R92 H;  1GKH A;  1O7I A;  5FJ8 G;  3NBH B;  1JJG A;  2MO0 A;  3K0X A;  2AMC B;  3CCE A;  1PV4 A;  2BH8 A;  4B3M L;  3CC2 A;  2OTL A;  4BY7 G;  1V1Q A;  4NPS A;  4YWK A;  2ID0 A;  1L0W A;  3ULL A;  3K7A H;  1YHB A;  1A62 A;  2VUM G;  1LM0 A;  1S72 A;  2HHH L;  2CQO A;  1G6P A;  3L7Z C;  2ALY B;  2QA4 A;  4JV5 Q;  2I5L X;  3CCR A;  2UXC L;  1HZC A;  3PUX A;  4KHZ A;  2I0Q A;  2CWA A;  5GAE C;  3I4N G;  4A3L G;  1UE5 A;  2Q2U A;  4QJF A;  4XIG S;  3E0E A;  3CP0 A;  3HOY H;  4GOP A;  4PZ6 A;  4JBJ A;  1PH5 A;  1VQH A;  2R7F A;  2VS1 A;  2JA5 H;  2UUA L;  2UUA Q;  4A3K H;  1PFS A;  3GDE A;  3K80 C;  2E2H H;  4L5R C;  3WWV A;  2OCE A;  4LF8 L;  1N32 Q;  3G71 A;  2F4V L;  1CUK A;  4Y52 H;  2IX1 A;  5JJL A;  2F3I A;  1QUQ A;  3STB C;  5C4J H;  5K36 G;  2IY5 B;  3HOW H;  2YTV A;  1XNQ Q;  3U4Z A;  3F1Z A;  1N33 Q;  4A3E G;  1NMF A;  4AYB E;  4LF4 L;  4HJA A;  3H3V I;  1L1O B;  5JJI A;  4JG2 A;  2K4K A;  4X64 Q;  1JT8 A;  3AQQ A;  4EX5 A;  1HNZ Q;  1VQM A;  2HHH Q;  1YIT A;  2JA7 H;  1N9W A;  1N34 L;  4OWX B;  4DV3 Q;  4BXX H;  5GQO A;  2ES2 A;  4LF9 L;  1K3R A;  2YYZ A;  3J7Z C;  2R6G A;  4P74 A;  4DAM A;  3CC7 A;  2OQK A;  5E7N A;  2A19 A;  1JJ2 A;  1IBM Q;  5C3E G;  4POG A;  1D7Q A;  4HID A;  1PH9 A;  4AH6 A;  4B3T Q;  2WAQ E;  2JA6 H;  3HOU G;  1C0A A;  1Q8K A;  1Q1B A;  1HR0 L;  1L2F A;  5IYC H;  3PIP A;  3F2D A;  1PH3 A;  4DV7 L;  5LMN Q;  1GM5 A;  1VQC A;  4A3I H;  1FJG Q;  2K52 A;  1U0L A;  1FVI A;  4NB3 A;  2AWO A;  2GVA A;  4LFC Q;  2UXB L;  2Y0S G;  4GNX C;  4BBR G;  2PQA B;  3UE1 A;  2AHO B;  2IT1 A;  2MFI A;  3S1M H;  1KRT A;  1TWA H;  1YEZ A;  4LFA L;  2JA6 G;  1SR3 A;  1IBK L;  4JI6 Q;  2KHI A;  3CCM A;  2MO1 A;  3RLF A;  1Q82 C;  1X65 A;  1DGS A;  3A74 A;  4LUZ A;  4ME3 A;  2UXD L;  3CPF A;  2ZM6 Q;  2RHQ B;  1XTD A;  5IP7 G;  2WB1 E;  4JBW A;  1J6Q A;  2WB1 G;  4C3J H;  4X62 Q;  3F2B A;  1YJN A;  1GO3 E;  4WJ4 A;  4OWW B;  5IT9 c;  4DV2 L;  4IPD A;  1XNQ L;  3ER0 A;  1B8A A;  3HOZ G;  1EWI A;  1UEB A;  4POF A;  2F4V Q;  5AJ3 Q;  3S17 H;  3CCL A;  5IWA L;  1X55 A;  4C2M H;  3HOY G;  3S1N H;  1ASY A;  4DV5 Q;  3GTL H;  3CF5 A;  2ZJR A;  1PVO A;  4NXM L;  1XNR L;  4APV A;  1U5K A;  3T1Y L;  4A3I G;  2UU9 Q;  3OYY A;  1WOC A;  4LF5 Q;  3CCU A;  2VNU D;  4GLV B;  1X3E A;  5M3M G;  1Y1W H;  1XPR A;  5JJK A;  4OO1 G;  4DR3 Q;  4A3M H;  2BH2 A;  1VQ5 A;  5C4X H;  4A3F G;  1PH7 A;  3TQY A;  2KBN A;  3CAM A;  5C0X I;  4YHH L;  4A3J H;  2A8V A;  4JCV E;  4JI6 L;  1VQ6 A;  4B3M Q;  2RHS B;  2EIF A;  3FP9 A;  3KF6 B;  4YCW A;  5GAG C;  1N8R C;  1CKM A;  4TVA B;  1KAW A;  3HOX G;  2JA5 G;  4A93 H;  2Z0S A;  2IHE A;  2VQE L;  1CKO A;  4P73 A;  2K14 A;  1WJJ A;  1PH6 A;  1I5F A;  3I4M H;  4HIM A;  4QL5 A;  1XPO A;  4KHP Q;  2UXB Q;  1VQ4 A;  1K9M C;  2XTI A;  3B6Y A;  2LSS A;  4IOC A;  2JA9 A;  1VQJ A;  4A3J G;  2YU9 H;  5J3B A;  4C3H H;  4JI3 L;  2C35 B;  3S2D H;  2UUB Q;  1I3Q H;  4JI4 Q;  2LXJ A;  1N36 Q;  2VQF Q;  5M5X H;  3W5O A;  4BBR H;  3JAM c;  4DR1 L;  4UY8 C;  2VQE Q;  4DKA C;  2GN5 A;  4HIK A;  1C7Y A;  4A3B G;  4GKK L;  1MIU A;  3KJO A;  3PUY A;  5LMU Q;  2MNA A;  1LYL A;  4JOI C;  3U50 C;  5ELN A;  3EN2 A;  3HOU H;  3JAM i;  1YJW A;  5M3F H;  1OXS C;  2WAQ G;  3K81 C;  2NVY H;  2BA0 A;  4LF6 Q;  5JEA G;  1I6H H;  4PMW A;  1T9H A;  4DR3 L;  4LF7 Q;  3HOV G;  2UXD Q;  1KRS A;  2JEB I;  1Y14 B;  2AKW B;  1TXY A;  1MKH A;  2E2J H;  2VY3 A;  3A5U A;  4HJ5 A;  3T1Y Q;  3PF5 A;  3PUZ A;  4R4T A;  1GD7 A;  2KHJ A;  2RCN A;  4A3G G;  3GTM H;  2F52 A;  2V1C C;  5BR8 L;  2RF4 A;  3J80 c;  3S24 A;  1L1O C;  4AYB G;  2BA1 A;  5AJ3 L;  3AEV A;  1X3F A;  1Q1E A;  1SMX A;  2K75 A;  3PCO B;  4GN5 A;  4AIM A;  4B3R Q;  4C3I H;  4LF6 L;  2HIV A;  3S2H H;  4RG1 A;  3OTO L;  4DUY Q;  4DV2 Q;  4IFD J;  4DPG A;  2PNH A;  2KCT A;  4DR5 L;  4RMF A;  5FLX c;  4HIO A;  1X54 A;  2YTX A;  4DR7 Q;  2ASB A;  3JC6 6;  4LUO A;  3L0O A;  1IZ6 A;  1V43 A;  1OXX K;  3RN2 A; 
#chains in the Genus database with same CATH topology
 1W6K A;  5IYC G;  3AFP A;  1UE1 A;  2EPB A;  3TP6 A;  1Y1V G;  2PYK A;  4UP8 A;  4LW1 A;  4XTC S;  3CD6 A;  1NNX A;  2UUC Q;  4C1N K;  4HMI A;  1NY4 A;  2B39 A;  2K5V A;  2F0S A;  3GTG B;  2NVX B;  3I4N H;  3Q0A A;  4A3L H;  5JPM C;  2K28 A;  1VCI A;  4B3S Q;  4ZUJ A;  5M5Y H;  1VQ8 A;  1ET9 A;  3E9I A;  3KF8 B;  4K8J A;  4YWM A;  2YV5 A;  5K5P A;  5IYD H;  4Y7N B;  2KJX A;  4DV3 L;  3HP3 A;  2AQ3 B;  1WVL A;  3GTG H;  1DOM A;  1HNZ L;  5AFW A;  2FMM A;  3MFY A;  3OWE B;  2JP1 A;  5M3F G;  3BDC A;  4OEM B;  2HIX A;  3BVZ A;  1B4O A;  2F0O A;  2VXW A;  4DV0 L;  5EJW A;  2N49 A;  1VQK A;  3L9A X;  1HFG A;  1CM9 A;  2B63 G;  1PFN A;  4KLK A;  2H1E A;  1XPU A;  4X65 Q;  2F0J A;  2R3Z A;  2LKV A;  4CKB A;  2B63 B;  1NTG A;  3K5L A;  1JIC A;  4JI1 L;  1KIX A;  3VR4 A;  4KY6 A;  4A3D G;  2WAC A;  4A75 A;  1KAA A;  4L5Q A;  2EY6 A;  3CME A;  5H1S E;  2Z6K A;  1TWC B;  3H0G G;  3U4V A;  2F0T A;  4MZ9 A;  4KK7 A;  2AWN A;  1DOK A;  3H0G B;  2F1M A;  4WFN 3;  1FJG L;  1KXL A;  1IKM A;  3I4L A;  1CHQ D;  1HJP A;  3A7L A;  3H3V H;  1S4Z A;  4OHJ A;  2X69 A;  3OW2 A;  3KJP A;  1EU4 A;  3C1E A;  2EXZ A;  3TS2 A;  2F3V A;  4YHH Q;  4CDF C;  1Y1V H;  1Z9F A;  3W3A A;  4RHS A;  4DR1 Q;  1MSH A;  1H9S B;  2HCI A;  3ND9 A;  1SBB B;  1DD2 A;  2LMC B;  2HUG A;  1CTM A;  2RCF A;  2H5X A;  1QZG A;  5C5M A;  4G7H C;  5BR8 Q;  4FXG C;  2Z4I A;  4FO2 A;  1H9J A;  4LF8 Q;  2RQX A;  5I9P A;  3HFZ B;  4KN4 C;  1STA A;  5M5W H;  3PO2 G;  2MHV A;  1F2L A;  1VQO A;  4ULL A;  3M9B A;  1K8G A;  2E76 C;  2BDN A;  1TWA B;  4HTH A;  4IZ8 A;  1H9M A;  1PMR A;  5G3L D;  2E2I B;  2Y0S B;  3ONA B;  3M4O H;  1IXR A;  2G5D A;  4YWL A;  3L2P A;  1B44 D;  2K5H A;  4KD3 A;  4EVO A;  1HUN A;  4JBK A;  5C0X J;  1UE6 A;  1VQG A;  2YTY A;  1YIT A;  2EZV A;  5JAV A;  1ICW A;  1PTO H;  3VYS A;  3V2T A;  4TRD A;  4C56 C;  3X3N A;  4GS3 A;  1ZYR C;  3A56 A;  1PRT C;  4QB4 A;  1LLR D;  1KC8 C;  5LMN L;  3HOZ B;  3ERS X;  3TEH B;  1CK1 A;  1TWH B;  1IYJ B;  5E4W C;  3J7A 5;  3TP7 A;  5JOB A;  1VQL A;  1ML0 D;  5K36 H;  1SNO A;  1BO0 A;  3PSI A;  3IFD A;  4GZY C;  1NUC A;  5EAY A;  4I7A A;  3H15 A;  3QJY A;  2K04 A;  4JI2 L;  2E75 C;  2NZ1 D;  1PH4 A;  3KLW A;  2NZH A;  4LF4 Q;  4LUV A;  4NP5 A;  3PO3 B;  3R2T A;  1E3P A;  2IPK D;  3PUW A;  2PI2 A;  4IJH A;  1LTA D;  5C4X B;  1V9P A;  3SDZ A;  1TWG H;  4JK1 C;  5EKK A;  4E6I A;  4OWT B;  4BY1 B;  2N88 A;  4JW0 A;  3CRL C;  1SJH D;  5T1I A;  5M5W B;  1MJE A;  2A73 B;  1VQI A;  1WCM B;  2G9H D;  4A3I B;  3J81 j;  1AE2 A;  4IO9 A;  3HKZ E;  1B53 A;  5KGU A;  4RAU C;  3C2P A;  3G6E A;  1FGU A;  5CC4 A;  3ND8 A;  1PTO C;  2IJ0 A;  2I5H A;  4RGM A;  4R4O A;  2XN9 C;  4OON A;  3BS1 A;  1CA5 A;  5FLM G;  1C9O A;  4EQ5 A;  4IPC A;  1BQQ T;  3R3O A;  1AE3 A;  1WYD A;  2DY8 A;  1EOT A;  5TSS A;  4IPH A;  3GO5 A;  1II3 A;  5I4D A;  3RN5 A;  1W2B A;  4QCL A;  5HGQ A;  2EYJ A;  2KEN A;  3RZO H;  2L15 A;  5IOC A;  5KND A;  5D14 A;  4WJ3 M;  2VZA A;  4QY7 A;  2DJG C;  1E1T A;  3P20 A;  3J81 E;  3URY A;  4PZ7 A;  5EPJ A;  3M4P A;  3GTJ H;  1R9T H;  4MNO A;  3PGZ A;  4YCV A;  2JEA I;  4B9X A;  3STB D;  3OWF A;  3MTS A;  4MHE A;  3K58 A;  1YHA A;  1JJC B;  3NTI A;  3ICE A;  4GKJ L;  1YNJ D;  4KKU A;  1SE3 A;  1Q12 A;  2KUM A;  2UUC L;  2ZTC A;  1MGS A;  2B3G A;  1W3S A;  2EYF A;  3BJU A;  4B3T L;  3NEM A;  3S1M B;  1STH A;  2IL8 A;  1I4X A;  3BG3 A;  3G48 A;  3PV0 A;  2HQL A;  2R92 H;  1GKH A;  3CCE A;  3DMU A;  4X3T A;  2BH8 A;  1I4G A;  5DM6 3;  3ULL A;  4J1M A;  2CQO A;  2I46 A;  4K6D A;  2QA4 A;  1S5D D;  5GAE C;  3I4N G;  4A3L G;  1UE5 A;  1HRJ A;  5CV7 A;  4XIG S;  1VF5 C;  3CP0 A;  1IYU A;  1VQH A;  2UUA L;  2VS1 A;  4A3K H;  1PFS A;  4LK1 C;  3OPO A;  1N32 Q;  1JOQ A;  3STB C;  2YTV A;  1CA6 A;  1N33 Q;  4QMG A;  1NMF A;  5JJI A;  3D8G A;  3P1H A;  3H3V I;  4UHV A;  2L55 A;  3AQQ A;  4EX5 A;  1HNZ Q;  3Q24 A;  3DXJ C;  3HRZ C;  4KMU C;  4G57 A;  1QOH A;  4DV3 Q;  4TKO B;  1I50 B;  1SNQ A;  2YYZ A;  1AP0 A;  1SNC A;  5FO9 B;  1JJ2 A;  5C3E G;  4POG A;  1RD9 D;  4N8X 1;  4AH6 A;  1C0A A;  5EKL A;  1UUP A;  3KLS X;  1HR0 L;  5C3W A;  3PIP A;  2K33 A;  1STG A;  2PW7 A;  1IYV A;  1L0Y B;  2OXP A;  4A3I H;  2K52 A;  1FVI A;  4NB3 A;  2UXB L;  3FEW X;  4ZRZ A;  2PQA B;  4UAI A;  1RTN A;  2MFI A;  2NTT A;  2BCO A;  1KRT A;  2E2H B;  3A8I E;  4LFA L;  1SR3 A;  2R92 B;  3RLF A;  2NN6 H;  3CPF A;  3SHL A;  1G91 A;  3NE5 B;  4K6L A;  2WB1 G;  4C3J H;  4X62 Q;  3HGB A;  1HTP A;  1GO3 E;  4CJ0 B;  2AUJ D;  5L37 A;  2HDM A;  5DAU A;  1HXY D;  5FLX E;  1B50 A;  1UEB A;  4POF A;  3E3X A;  4K5X A;  3IKJ A;  4R8N A;  5COR A;  5EBC A;  3QO2 A;  2J0T D;  3MEH A;  1ASY A;  4DV5 Q;  3GTL H;  3CF5 A;  5M3M B;  4G7Z C;  5M9O A;  1EWH A;  1O80 A;  3T1Y L;  1XNR L;  3HOW B;  1TKW B;  2BE5 C;  4LF5 Q;  2CHB D;  1SNP A;  1EQV A;  5ISR A;  3V96 A;  5M3M G;  3S9W A;  4XYO A;  2F0H A;  2F0Q A;  2BH2 A;  1SYE A;  1EQT A;  5IT9 L;  3OOC A;  2PQE A;  1ENC A;  2DY7 A;  2A8V A;  5C0X I;  4JCV E;  4JI6 L;  5GAG C;  3FP9 A;  4YCW A;  1HCZ A;  1CKM A;  4TVA B;  1A3V A;  2JA5 G;  1O7Z A;  1PZI D;  4A93 H;  2K14 A;  2M9V A;  1I5F A;  1UAP A;  1XPO A;  1K9M C;  3T51 B;  4IOC A;  2RKS A;  2QF7 A;  3MXN A;  1VQJ A;  1TVX A;  1EWC A;  3WOE A;  1RF2 D;  5BN3 A;  4C3H H;  1S5F D;  2C35 B;  3VR3 A;  1F9R A;  1TII D;  3W5O A;  2AQ1 B;  4DR1 L;  3S1N B;  2GN5 A;  1C7Y A;  4A3B G;  4GKK L;  1F9S A;  4H7B A;  3KJO A;  3J80 L;  4DGZ A;  1XXG A;  2OF1 A;  2NVY H;  4RCN A;  4LF6 Q;  4DR3 L;  4CJ2 C;  3HOV G;  5IIF A;  2QKI C;  4KKT A;  2MPM A;  1EYC A;  1SND A;  4A93 B;  1ET6 A;  1K28 A;  1PTO F;  2LY7 A;  5KNC A;  1PFM A;  1TS2 A;  2V1C C;  3MC0 B;  5AJ3 L;  2BA1 A;  2A68 D;  1SMX A;  4GN5 A;  4RKB A;  1NAP A;  4K14 A;  2HDL A;  3TME A;  4LF6 L;  2PZW A;  1AZP A;  4RMF A;  2XNA C;  4MIU A;  2ASB A;  1HUM A;  4LUO A;  1IZ6 A;  2FFK B;  3T53 B;  1OXX K;  4WRD A;  4JI7 L;  1A3U A;  1DON A;  4EQO A;  1FYC A;  5HGT A;  3FPU B;  1XYI A;  3X3M A;  5IY0 A;  1LTT D;  4ZUI A;  2B63 H;  4TQU S;  3I90 A;  5C44 G;  1V1O A;  3VR2 A;  1PH1 A;  3H91 A;  2F0U A;  1WFQ A;  5IGG A;  1SN8 A;  3DEO A;  3K5N A;  3S1Q H;  1U9R A;  3MXP A;  2DUD A;  3MEF A;  3PUV A;  4BY1 G;  1M1K C;  4LWC A;  4GOP B;  4JI5 L;  3S1R B;  1VQA A;  2A74 C;  4J15 A;  2OWO A;  1EIH A;  2K01 A;  2RBM A;  4O1N A;  1WCM G;  1QJO A;  1TWC H;  4X3S A;  2B2W A;  4FVM A;  3KF6 A;  3GTL B;  2A68 C;  2F0L A;  2NWG A;  5FKA C;  4K0K Q;  4RFB A;  2XRS D;  4B3S L;  4DR4 L;  2C5C A;  3M7G A;  3C46 A;  5CBE E;  1WI5 A;  5J1Z A;  3CC4 A;  1A8V A;  3G7L A;  2JA7 G;  1U4L A;  1VQE A;  2HQE A;  4OX9 L;  3FKI G;  5LL6 X;  1XNR Q;  3A55 A;  3F8T A;  1SEB D;  1K8A C;  1A63 A;  2EYL A;  3SR1 A;  5C3E H;  3BZD B;  1P16 A;  5M5X B;  5IYB G;  5CV5 A;  2B2Y C;  2Q2I A;  4BY1 H;  1K8O A;  2Q8R E;  1SFO H;  5HUR A;  4JV5 L;  1S40 A;  2SOB A;  1WTO A;  4BBS H;  1K0R A;  3P7J A;  3VDY A;  5DM7 3;  1EUJ A;  1VS0 A;  3PMF A;  2TSS A;  4FF3 A;  4HJ8 A;  3NWS A;  1F2Z A;  5IGB A;  4DXF A;  3J80 i;  3T56 B;  3RZD B;  1QB5 D;  2QIL A;  2B2V C;  3LX0 A;  1HNX Q;  2MQH A;  1KLG D;  2F0F A;  5DLQ E;  1WTX A;  2PQA A;  3EA6 A;  2NVX H;  3HEJ A;  4K0K L;  4DAY B;  1FR3 A;  2XWJ B;  4JPB W;  2XWB B;  1KNE A;  3K7U C;  1SRU A;  1OO9 B;  2L11 A;  3UDF A;  3FVQ A;  2H4O A;  4A3K B;  4DUY L;  3M85 A;  3TN2 A;  3F2U A;  1EL0 A;  2CQA A;  1KQS A;  2SNS A;  3JAM L;  4GNX B;  3T1H Q;  5CV4 A;  2OTJ A;  2RSN A;  1OXU A;  1Z6H A;  3S1R H;  1LAC A;  3ZJY C;  3BYY B;  4JI7 Q;  4LF7 L;  3NK9 A;  1YIJ A;  3I56 A;  4CDD C;  2RDH A;  2X6L A;  3DHQ A;  5FO7 B;  5A35 A;  3PO2 H;  1H95 A;  1VMC A;  3E0J A;  1B2T A;  1W6J A;  1YZ6 A;  3NQT A;  5DNF A;  1BVS A;  3W1G A;  2ZJP A;  4AQY L;  4B9W A;  3BZK A;  1J5E L;  4JYA Q;  3J81 c;  1BCP C;  1YI2 A;  1GOZ A;  3CCJ A;  1UWV A;  2SNM A;  1ROD A;  3VYT A;  3BZC A;  5FLX L;  3CKI B;  1IHZ A;  5C3X A;  4UP7 A;  5C0X G;  3PIO A;  5ELD A;  3C1F A;  1PA6 A;  4JI0 Q;  1SAP A;  1EIF A;  4C3H B;  4RGN A;  2JK8 A;  1B1Z A;  4UPA A;  3K5M A;  4K8I A;  2B8F A;  2R92 G;  4A3E H;  1JR0 D;  4DUZ Q;  1CHP D;  4IFD I;  3D3R A;  1B70 B;  3SK8 A;  1EZ6 A;  1X3Q A;  2BE5 D;  2WB1 B;  2NVQ H;  2F0W A;  4DXG A;  1QVC A;  3NEL A;  1L1O A;  1Y1W G;  3H6M A;  3SK5 A;  3BVG A;  1E1O A;  3VR5 A;  2I07 B;  4A3C G;  1K8M A;  1Y1W B;  1R4P B;  3I2Z A;  3NBI A;  3UDG A;  4YY3 Q;  4EQN A;  1QUQ B;  1PHJ A;  4YCU A;  4A3D H;  2E8G A;  1CQF A;  1EEF D;  3A8J E;  1EFW A;  1WTR A;  2RDG A;  5EPL A;  2UXC Q;  1JC7 A;  1STY A;  3BVM A;  1NR2 A;  2P5Z X;  2QEX A;  3I73 A;  1PH2 A;  3R2I A;  2ZM6 L;  3W1B A;  3RNU A;  3U58 A;  2A1A A;  3TSS A;  4OGQ C;  1BBW A;  1JMC A;  1YBY A;  5GAD C;  3TZU A;  4C3J B;  1PH8 A;  1X6O A;  4OL7 A;  4DV5 L;  4DR6 Q;  2JQO A;  1I94 L;  2WAQ B;  1LT4 D;  1EQR A;  1LTL A;  4A3C H;  1GVP A;  5JVG 3;  5C4J B;  3H3V C;  2NB0 A;  4JI8 Q;  1A2U A;  2R7Z H;  3KK7 A;  1IBM L;  2HT1 A;  1JB7 A;  3KYH C;  1XMO Q;  5LMU L;  3UDI A;  2E2J B;  3OSO A;  1M8A A;  4A3B B;  1EY6 A;  4ZAI A;  4LFB Q;  4LFA Q;  4KV6 A;  5HY6 A;  1GUT A;  2N8N A;  4DNI A;  1AH9 A;  3BU2 A;  3I4O A;  2NN6 G;  1JOR A;  3GTK B;  1SE8 A;  4JI8 L;  2EXD A;  1VF7 A;  2D62 A;  3DM3 A;  1TQO A;  5FO8 B;  2A6H D;  4A3B H;  2R93 G;  5K36 G;  4OO1 I;  4GLX A;  2HD3 A;  1NJI C;  1Y1V B;  2OQ0 A;  3CCQ A;  4HJ7 A;  5LL6 S;  4DR6 L;  2XGT A;  3NUC A;  1GHJ A;  4S3S A;  5I9O A;  1X32 A;  2F0K A;  1Y69 U;  1O7I A;  3D4R A;  3K0X A;  2MO0 A;  4IUV A;  1PV4 A;  4B3M L;  1LT6 D;  3CC2 A;  5JEA H;  3S2D B;  4BY7 G;  2ID0 A;  1S5E D;  4FNF A;  2VUM G;  1O7L A;  1G2S A;  1G6P A;  1RCV D;  3L7Z C;  4KJO A;  4RGO S;  3TP5 A;  2VUM B;  3KBG A;  3S16 B;  1TWF B;  2O4X A;  2UXC L;  1QCB D;  2Q2U A;  4QJF A;  2JXM B;  1PH5 A;  2UUA Q;  3V05 A;  1DCZ A;  2E2H H;  4LF8 L;  1TU2 B;  3WWV A;  3G71 A;  2F4V L;  3OIQ A;  4A3E B;  2K6A A;  2F3I A;  1EYA A;  3DWP A;  1KNA A;  3T13 A;  4A3E G;  4M8A A;  4JG2 A;  2F0V A;  4NW2 A;  1JT8 A;  1LT5 D;  1VQM A;  1PTO D;  1RTO A;  1N34 L;  4OWX B;  1D1I A;  1F77 A;  3CC7 A;  2OQK A;  5KRU A;  1UEA B;  1ZXT A;  1GUO A;  1ONL A;  2NVY B;  4QUF A;  4B3T Q;  2JA6 H;  3VYU A;  3VR6 A;  1Q8K A;  1Q1B A;  4H13 C;  1SMY D;  5EKI A;  5KNB A;  1FJG Q;  1LO5 D;  2E74 C;  5CV8 A;  4BBR G;  2IT1 A;  4K5V A;  3S1M H;  2CW0 C;  2Z8L A;  2JA6 G;  1X65 A;  1DGS A;  3A74 A;  4IN3 A;  2NYZ D;  2ZXP A;  3ERO A;  2KCC A;  4QIW B;  4B08 A;  1EY9 A;  5E1F A;  4CKE A;  3F2B A;  4OWW B;  2KA7 A;  4DV2 L;  1H9S A;  4IPD A;  1ENF A;  3M3Y B;  2EYP A;  4RCO A;  4DK1 A;  2F4V Q;  3S17 H;  2K32 A;  1EIG A;  1X55 A;  3MXU A;  1J8I A;  1V8Q A;  5I2Y A;  3EJI A;  1PVO A;  4NXM L;  4APV A;  4BBS B;  3MA2 B;  2N55 A;  3OYY A;  3GTP B;  1SYB A;  1FNW A;  4A3F B;  5LHY 1;  1VQ5 A;  5C4X H;  4A3F G;  1PH7 A;  3I3C A;  1TY2 A;  3TQY A;  4ZCK A;  3CAM A;  4B3M Q;  3KF6 B;  3C3L A;  2VQE L;  4QF4 A;  4P73 A;  2KEC A;  1BBX C;  1B3A A;  1VQ4 A;  1DZ1 A;  2PZU A;  2YU9 H;  2R61 A;  3HOU B;  5J3B A;  4CGY B;  4JI4 Q;  1HPC A;  4U68 A;  1HHV A;  2VQF Q;  4BBR H;  3JAM c;  4UY8 C;  1MBY A;  1Q90 A;  3NTK A;  2YU9 B;  5LMU Q;  1WD0 A;  2ZXR A;  3U50 C;  5I6W A;  5G3L F;  5M3F H;  4HAE A;  2EE1 A;  5JEA G;  1CI3 M;  4PMW A;  1T9H A;  1KRS A;  2JEB I;  1Y14 B;  2E2J H;  1I4Q A;  3BYT B;  3A5U A;  1DOL A;  3J80 E;  3GTQ B;  3PF5 A;  3GQB A;  3PUZ A;  2F0P A;  2XSC A;  2QDL A;  1I4P A;  3S24 A;  3GTO H;  3NXW A;  1PRT F;  3BDL A;  1Q1E A;  1Q3L A;  1RDP D;  2K75 A;  2KEE A;  4B3R Q;  4C3I H;  3GP7 A;  1NR4 A;  3S2H H;  4RG1 A;  4DPG A;  4DR5 L;  4RGT A;  1KLU D;  3NWT A;  3JC6 6;  4XT1 B;  2PPB C;  3K5O A;  3OMC A;  3KBX A;  2UXD Q;  3EBE A;  1D5Z C;  3R93 A;  3M3Y H;  2PI2 E;  4JI5 Q;  4YY3 L;  1OTC A;  3ERQ A;  3CHB D;  2Z1C A;  2JE6 I;  4IUT A;  5J22 A;  3W2D A;  1ENA A;  1M90 C;  5JEA J;  1FL0 A;  5JPN C;  1VQ7 A;  2IHF A;  3HOX B;  4LFC L;  4JI3 Q;  4FYD A;  4R4C A;  4XQJ A;  4PG3 A;  3U9S A;  4HR7 B;  5T1G A;  1LTG D;  1G6Z A;  1C4Q A;  3G4S A;  4A3F H;  3NP8 A;  3D0F A;  4P71 A;  4RWS C;  2QEJ C;  3DWA A;  2B2U A;  1NSN S;  4DUZ L;  2IX3 A;  1VQ9 A;  1SJE D;  1XTC D;  4ABN A;  3MWY W;  2K5D A;  2LXK A;  1KL9 A;  2G9D A;  4H02 A;  3SE0 A;  3M4Y A;  1IBL Q;  1FNV A;  1BCP F;  4DV1 L;  2E5L L;  1RIP A;  1WTQ A;  3EIV A;  4V0B A;  1HH2 P;  1AEX A;  2M2L A;  4UP9 A;  1A15 A;  1B9M A;  4OIJ A;  4IUN A;  5GRO A;  5C4Z A;  5IWA Q;  5IGE A;  3RZO B;  1EY4 A;  1TS5 A;  2EYO A;  1ASZ A;  4DV1 Q;  2E5L Q;  2CVR A;  3KLS A;  3RMH A;  1Q7Y C;  1KAB A;  4LNQ A;  4ZK9 B;  1ILP A;  1A6X A;  1HTL D;  1WTP A;  4DR7 L;  3CXC A;  2BOS A;  1DJR D;  3RLO A;  5M3M H;  1YVC A;  3HKS A;  1IBK Q;  4X65 L;  1XJV A;  4GNX A;  1QWY A;  4O2D A;  1BOS A;  1LAB A;  1NCV A;  1RKN A;  4J6H A;  5DEH A;  3SGI A;  2KCM A;  2D0O A;  2CH4 W;  4CDE C;  1JOO A;  2KED A;  3FPP A;  1P8L A;  5M5Y B;  2V4D A;  2L12 A;  5NUC A;  4CBV A;  3S2H B;  3H0G H;  1OXV A;  1E22 A;  2JA8 G;  1I4R A;  4ZKC B;  4KJN A;  2L1B A;  3NTH A;  3AB9 A;  1YHQ A;  3K6O A;  4DR2 Q;  1VQP A;  1K83 H;  2NBF A;  2NN6 I;  4ODG A;  4QUC A;  4X64 L;  3GTQ H;  3PO3 H;  1N36 L;  3DLL A;  5C4X G;  4B3R L;  3CMA A;  4LF5 L;  4A3J B;  2ZTE A;  4PZ8 A;  1KDB A;  4F88 A;  5M3F B;  5F2D A;  5EBD A;  4X6A H;  3MXG A;  2JN4 A;  4YIJ A;  1WCM H;  3IRB A;  3UE0 A;  5JVH 3;  4DV4 Q;  5EPK A;  2ZTD A;  1HFN A;  1JWM D;  2WIN B;  4N9T A;  3H94 A;  3MXN B;  1G2T A;  1X9N A;  3J7A V;  1EYD A;  1E7Z A;  4CDC C;  4F87 A;  3CPW A;  1BUV T;  2K5N A;  3M4Q A;  4K2K A;  2FHT A;  3D31 A;  2A6E D;  3S15 B;  2D2C C;  1CKN B;  2JYO A;  4K2L A;  5IP9 H;  4GLA C;  2ZJQ A;  1VQB A;  4JI4 L;  3OHX C;  2N3S A;  3M7N A;  4FF1 A;  1HZB A;  4BA1 I;  2O2L D;  4A4I A;  2DNC A;  3S14 B;  4HED A;  1I50 H;  5IP7 H;  3Q8D A;  2FJ2 A;  1HR0 Q;  2Q2T A;  1RL2 A;  1SSO A;  2B2W C;  3AU7 A;  1BKB A;  3TRZ A;  4BBR B;  1WTV A;  3I55 A;  1SYF A;  3HOZ H;  1YJ9 A;  3HOW G;  2VB3 X;  4P2C B;  4DK6 C;  3F2C A;  3I4M B;  1A2T A;  1EQQ A;  3GTK H;  4GN4 B;  4QIW E;  1E24 A;  4IUP A;  5FLM H;  2VUM H;  4DNT B;  1LTS D;  1HZ9 A;  1EZ8 A;  3EQL C;  3I4M G;  1LTB D;  1VDZ A;  4PMB A;  2Y0S E;  5D3I B;  3KFU A;  4R9W A;  4NXN L;  3KUP A;  4XYQ A;  3KDF A;  1NBW A;  4KI0 A;  1N32 L;  1EU3 A;  4L5S A;  2QW7 A;  1FD7 D;  2WFW A;  2R7Z B;  3K57 A;  3ULP A;  2CCZ A;  3TP8 A;  4DV6 Q;  1T5E A;  3HG9 A;  2L0C A;  4CHT B;  1TWH H;  4BBS G;  1SLJ A;  1SXT A;  1YNX A;  2EYM A;  1ESR A;  3CU7 A;  3I7F A;  3OMG A;  3RD4 A;  1QG7 A;  1F2Y A;  2B2Y A;  3IL8 A;  2L9H A;  1I6H B;  1E0B A;  2CW0 D;  3LWE A;  3A7A B;  3QIA A;  1CZG A;  3HOV H;  2GVB A;  1D1K A;  1MI2 A;  2XRQ D;  4DV4 L;  2K1B A;  2A69 C;  5COY A;  5I6Y A;  1CZW A;  4R1J A;  5C44 H;  3AFQ A;  3H09 A;  4H44 C;  4JC0 A;  1IL2 A;  2I5M X;  1IBL L;  3SEB A;  4ME5 A;  5JJZ A;  4GKJ Q;  1STE A;  2F0G A;  1IL8 A;  1PXU A;  1SNM A;  3D4W A;  3J7A F;  4LAA A;  1NMG A;  1U4P A;  1EYG A;  1EFI D;  4DR2 L;  4J8Q A;  4QGU A;  4OO1 H;  1Y8P B;  5IOD A;  1OXT A;  1CSQ A;  5IYB H;  4OEL B;  1A0I A;  2N78 A;  1D6E C;  3A0J A;  4F7X A;  1LTR D;  2OEO A;  2RA4 A;  1XMQ L;  5KYI A;  2O5I C;  1WD1 A;  1LTI D;  1L0X B;  3CQZ H;  4NKL A;  1S3O A;  4NDX A;  3PO3 G;  4FP5 D;  1IW7 D;  2QGQ A;  4ALP A;  4BA2 I;  3U9O A;  4A3D B;  2CKZ B;  1YNN D;  2DNE A;  2RVL A;  5FJ8 G;  3NBH B;  2AMC B;  4O42 A;  1J9O A;  3NHH A;  5C44 B;  1QNU A;  4YWK A;  1L0W A;  1YHB A;  1A62 A;  2AUK A;  2KQ3 A;  1LM0 A;  2B8G A;  2F0N A;  3K0Y A;  2ALY B;  5A2Q E;  2B2T C;  3TDQ A;  2NVQ B;  2I5L X;  1YNN C;  1HZC A;  3PUX A;  2I0Q A;  4WJW A;  1PZK D;  2M00 A;  1AZQ A;  1PRT B;  3UI2 A;  3HOY H;  5D3D A;  5ELF A;  4PZ6 A;  4JBJ A;  3K7A B;  4IUR A;  1YNJ C;  3K80 C;  2OCE A;  3IAY A;  3WDN A;  5ELB A;  1CUK A;  4Y52 H;  1BCP B;  2JA7 B;  1QUQ A;  2IY5 B;  3HOW H;  2D9U A;  1B3Q A;  3U4Z A;  4LF4 L;  4AYB E;  4HJA A;  1L1O B;  2K4K A;  2CH4 A;  1ZEQ X;  2JA5 B;  2HHH Q;  2JA7 H;  1N9W A;  2Q8I B;  5IGD A;  4BXX H;  2ES2 A;  1K3R A;  5E4X A;  1C48 A;  2FMC A;  2MP1 A;  4RHR A;  5A2Q L;  5C4H A;  2A19 A;  1IBM Q;  3SXH A;  4EGV A;  1D7Q A;  3PO2 B;  2WAQ E;  3ZYY X;  5IYC H;  4DFA A;  1MHW C;  1IW7 C;  2PCF B;  5LMN Q;  4DV7 L;  1GM5 A;  1F9Q A;  1VQC A;  4G7O C;  1SFO B;  1U0L A;  2AWO A;  2GVA A;  4LFC Q;  4FF2 A;  2Y0S G;  4A3M B;  3UE1 A;  1DXM A;  2SEB D;  2MUY A;  2KVM A;  4LJZ C;  4U67 3;  1JWU D;  3GV3 A;  1TWA H;  1YEZ A;  3GTM B;  2MO1 A;  1Q82 C;  1HA5 A;  4ME3 A;  2UXD L;  4HSP A;  2EY2 A;  2ZM6 Q;  1S5C D;  1XTD A;  5IP7 G;  2WB1 E;  4JBW A;  5CMD A;  3HOV B;  1J6Q A;  1Q8I A;  4DK0 A;  1YJN A;  1JOK A;  3ER0 A;  4L8J A;  4L63 B;  3HOZ G;  2J4X A;  3K59 A;  2O5J C;  1D5M C;  3SK6 A;  3VYR A;  4C2M H;  1DM0 B;  4BWG B;  4C3I G;  2UU9 Q;  4RA8 A;  3CCU A;  2VNU D;  3QWN A;  1BCP D;  1K3B C;  5JJK A;  1XPR A;  4OO1 G;  4N9P A;  4A3M H;  3KF8 A;  4PNY A;  3LNN A;  1CQV A;  1QE6 A;  4UDU C;  2B2T A;  3MHB A;  1ICF B;  2KBN A;  4YHH L;  4A3J H;  1VQ6 A;  2RHS B;  3MFG A;  4KTA A;  2ZT9 C;  2RDF A;  1WJJ A;  3RUZ A;  4IFD H;  4HIM A;  4QL5 A;  4KHP Q;  4PQX A;  2EJF C;  3OW7 A;  2F3W A;  1DYQ A;  1XWE A;  1AFP A;  2JA9 A;  4A3J G;  2BDO A;  4N8F A;  3Q22 A;  3HZX A;  2UUB Q;  1I3Q H;  2A6E C;  2LXJ A;  2NUC A;  1N36 Q;  1KDC A;  3FDT A;  2VQE Q;  4DKA C;  1TS3 A;  1MIU A;  1KTK A;  3PUY A;  2MNA A;  3CQZ B;  5ELN A;  3EN2 A;  3JAM i;  1YJW A;  2WV6 D;  1ESF A;  4ID6 A;  1RJT A;  1S5B D;  3K81 C;  2BA0 A;  4LF7 Q;  4ZKB B;  2AKW B;  1TXY A;  1MKH A;  5CBA E;  3Q6S A;  4CJ1 B;  4HJ5 A;  4A3G B;  3D4D A;  1BF4 A;  2NVT B;  4R4T A;  4A3G G;  2F03 A;  1H9R A;  2RF4 A;  1L1O C;  3PIP 3;  1X3F A;  4AIM A;  3PCO B;  2EOT A;  5I2X A;  5IT9 E;  5KYL A;  4DUY Q;  4DV2 Q;  5EQ0 A;  3QOL A;  2PNH A;  1V1P A;  4DR7 Q;  1X54 A;  2EYH A;  3L0O A;  3NSW A;  1V43 A;  3S14 H;  4MTK A;  2C9O A;  3RN2 A;  1QVF A;  4DAP A;  1JE5 A;  4OXP A;  2MJ8 A;  3AMU A;  3T4A C;  2UUB L;  1HNW Q;  5IP9 G;  4MTN A;  4ZQ3 A;  1UNS A;  4P72 A;  1U4M A;  4TSS A;  1NE3 A;  1X3G A;  2ICI A;  1GUN A;  4HJ9 A;  4GOP C;  1XX8 A;  2CWP A;  3TS0 A;  4KHP L;  4PV1 C;  1LUZ A;  2R7Z G;  2VL6 A;  3MZ5 A;  1E2V A;  2R7D A;  4A3K G;  5CV6 A;  4JI2 Q;  3I4N B;  5CV9 A;  4XDX A;  1PYS B;  1N34 Q;  2Z4H A;  2IWH A;  3LWU A;  3L3O C;  3Q23 A;  5KIX A;  2SDF A;  3S15 H;  3DUZ A;  3J7Y W;  1EOV A;  5CYU A;  3A54 A;  4GN3 B;  2L5T A;  1I94 Q;  4DF7 A;  3R8B A;  1D8L A;  2PMZ E;  1HR0 W;  1E2W A;  1VQF A;  4OX9 Q;  2FXQ A;  4Q0F A;  2AQ2 B;  5D65 A;  5ELO A;  4DR4 Q;  1GUG A;  3J81 i;  3J81 L;  3FMC A;  4BY7 H;  2JSO A;  1BDO A;  1TY0 A;  4X66 Q;  5C3E B;  3KDF B;  4X66 L;  3S1Q B;  1PZJ D;  4DR5 Q;  1VMP A;  3D6C A;  5IE8 A;  3E5S A;  3K8A A;  4O0A A;  2X6G A;  1JWS D;  5CR3 A;  4KY7 A;  2QCP X;  3P75 A;  4MN3 A;  2VW9 A;  3HOY B;  2F0D A;  5FJ8 H;  4FDB A;  2JA8 H;  1M4V A;  2EJM A;  4F8M A;  1PYB A;  1TS4 A;  5ELC A;  1X56 A;  1GUS A;  3HKZ G;  1X3P A;  3IFT A;  3HKZ B;  1F9P A;  2LS0 1;  4R8I A;  4LFB L;  1G8Z D;  3PIO 3;  3ITP A;  3RLN A;  2A5H A;  3LGJ A;  1GJX A;  3I8Z A;  4R4I A;  1XMO L;  2WP8 J;  3CRK C;  1VQN A;  1VQD A;  4IUU A;  1TT2 A;  2VQF L;  4JI0 L;  5IGC A;  5EGT A;  1QVG A;  3NPP A;  4L5T A;  3PF4 A;  2E2I H;  1HNW L;  1BBU A;  3EVQ A;  1BXT A;  4V19 0;  1C8C A;  1V1P B;  4Z9C B;  4IJL A;  1G29 1;  3FKI B;  5IYD G;  4BXX G;  1UE7 A;  4IPG A;  3T16 A;  1HQM C;  4KKS A;  2R93 H;  4R4Q A;  1JB3 A;  3SK4 A;  2EVB A;  5GAH C;  3O13 A;  4A3G H;  1Q86 C;  4JI1 Q;  1F2M A;  4C3J G;  2JA6 B;  4GKK Q;  3HOX H;  2JJQ A;  4DK3 C;  2D5D A;  4JOI A;  4A76 A;  1K83 B;  4NXM Q;  1Q81 C;  4I65 A;  3DM1 A;  2F0I A;  3CCV A;  4IUQ A;  4DV0 Q;  1SE2 A;  3T1H L;  2NZO A;  3UDX A;  3CW2 C;  2EJG C;  2K5W A;  3SVM A;  3I70 A;  3GTP H;  5LMN W;  1LT3 D;  1XMQ Q;  4XXE A;  1G51 A;  5BN4 A;  4A3M G;  2NVT H;  3QB3 A;  2B29 A;  2K7V A;  1FGB D;  4LF9 Q;  1MJC A;  1R4Q B;  1D2B A;  2Z6B A;  3EFX D;  2CFM A;  1CSP A;  4A93 G;  1TWF H;  3NEN A;  1CKN A;  3QR8 A;  1GUW A;  5BN5 A;  1Z47 A;  2DGY A;  3FHW A;  1BR9 A;  2ATW A;  1QZH A;  1SE4 A;  1SMY C;  1EY0 A;  2D0P A;  4BY7 B;  1TR5 A;  1I3Q B;  4HSV A;  2ICE C;  3FKI H;  4C3I B;  1J5E Q;  4JYA L;  4K5W A;  3VA5 A;  1HZA A;  2TMP A;  3GTO B;  4AQY Q;  4DN4 M;  3KOJ A;  1EY8 A;  1SRO A;  4CKC A;  4C2M B;  4X62 L;  1JE4 A;  2EQS A;  2NTS A;  4X3K A;  3OTO Q;  4IOA A;  4FXD A;  1SYC A;  3QOJ A;  2K03 A;  1QNK A;  1KHI A;  3S16 H;  2UU9 L;  1Y8N B;  3D6W A;  4Y7N H;  4DV6 L;  2A6H C;  1RHP A;  3AYH B;  1K73 C;  1Q46 A;  2PZT A;  1KD1 C;  2K50 A;  4NXN Q;  2Q2H A;  3NBH A;  5CGK A;  2IX0 A;  4JBM A;  5C6A A;  3RZD H;  1TWG B;  4ZYS A;  3E9H A;  2HCC A;  3TRE A;  1Z7T A;  2XIW A;  3GD7 A;  5FOB B;  4QQB X;  3MAQ A;  4OIK A;  1AW7 A;  2Z9H A;  5IGF A;  2PNR C;  3DWQ A;  2F4I A;  1D5X C;  1I6V C;  3CCS A;  1WTW A;  1ILQ A;  2ZXO A;  4HCS A;  1B7Y B;  1N33 L;  3A5Z B;  3RR5 A;  1Y8O B;  3ULJ A;  4DV7 Q;  2A69 D;  2Z6K C;  1R9T B;  4P75 A;  1HNX L;  2ENB A;  4IFD G;  2EY5 A;  1MSG A;  3HS0 C;  1CT1 D;  4C1N I;  5J39 A;  1ZKO A;  5FK9 C;  2VB2 X;  2PMZ B;  3MVV A;  3VA7 A;  1JJG A;  1PFB A;  2FIN B;  2DJF C;  2QDB A;  2OTL A;  1V1Q A;  4NPS A;  3K7A H;  4BS9 A;  3N52 A;  3NQI A;  1S72 A;  2HHH L;  1JQY D;  2WKD A;  3TZD A;  2F0E A;  2KCN A;  2J7Z A;  4JV5 Q;  4HMJ A;  3CCR A;  2B2V A;  2B2U C;  4KHZ A;  2CWA A;  2WKC A;  3E0E A;  4GOP A;  3I91 A;  3E6Z X;  4HN7 A;  2JA5 H;  2R7F A;  3GTJ B;  3BDO A;  3M4O B;  3GDE A;  4L5R C;  3N6R A;  1K0S A;  4FXK C;  4DAV A;  5JJL A;  2IX1 A;  4DNR B;  5C4J H;  4XQN A;  4KHV A;  1XNQ Q;  3F1Z A;  4X64 Q;  1KDA A;  3GV6 A;  5GQO A;  4LF9 L;  3J7Z C;  2R6G A;  4P74 A;  4DAM A;  5E7N A;  4HID A;  1T5X D;  1PH9 A;  3DEP A;  3HOU G;  2WII B;  1PDQ A;  1L2F A;  1PLF A;  4Q5V A;  3F2D A;  4KY5 A;  1PH3 A;  4XQQ A;  1U4R A;  3PQI A;  4RH6 A;  4GNX C;  4IQZ A;  2AHO B;  3I72 A;  1GXD C;  1PYW D;  4IAL A;  4DA2 A;  2R93 B;  3A8K E;  1IBK L;  4JI6 Q;  2KHI A;  4DU9 A;  3CCM A;  2OT2 A;  2E2D C;  2MGS A;  4LUZ A;  2K05 A;  2RHQ B;  1JCK B;  4ZLT F;  4M1U B;  1LV9 A;  1AN8 A;  3S17 B;  3KLR A;  4WJ4 A;  5IT9 c;  1XNQ L;  3TBI B;  5KEE A;  2JA8 B;  2KHS A;  1B8A A;  1EWI A;  5AJ3 Q;  4KN7 C;  2K5Q A;  1PTO B;  3CCL A;  5IWA L;  1WTH A;  3HOY G;  4C3H G;  3S1N H;  2LFN A;  1BNZ A;  2ZJR A;  1QIL A;  2PW5 A;  1EEI D;  1U5K A;  1STB A;  4A3I G;  4LMQ D;  1WOC A;  5ELE A;  4GLV B;  1X3E A;  4NMZ A;  1STN A;  1Y1W H;  4DR3 Q;  1E2Z A;  4ILW A;  4FF4 A;  2EIF A;  1N8R C;  1KAW A;  4WOR A;  3HOX G;  2Z0S A;  2IHE A;  1CKO A;  3QG1 A;  1PH6 A;  3I4M H;  2UXB Q;  1GHK A;  2XTI A;  4KD4 A;  1ZYR D;  3B6Y A;  3OIP A;  2LSS A;  2XVS A;  5C0X H;  2DN8 A;  1SYG A;  4JI3 L;  1FNU A;  3S2D H;  2L4N A;  1HQR D;  3WOF A;  2PO4 A;  5M5X H;  4PMC A;  1EY7 A;  4XT3 B;  1B9N A;  1MD2 D;  4H0L C;  4HIK A;  2IW3 A;  2EY1 A;  3G6J B;  4G4K A;  1LYL A;  4JOI C;  1H9K A;  4X3U A;  3JAM E;  1SYD A;  3HOU H;  1CFM A;  1OXS C;  2F0M A;  1EY5 A;  2WAQ G;  4HCE A;  2Q8T A;  1I6H H;  3FRP B;  4JVZ A;  1HA6 A;  2VY3 A;  4L6T B;  3T1Y Q;  5E3F A;  1GD7 A;  2RSO A;  1I4H A;  1IKL A;  2GA4 B;  2KHJ A;  2EDG A;  2RCN A;  2F52 A;  5BR8 L;  3GTM H;  1PRT D;  3J80 c;  4AYB G;  1O78 A;  3AEV A;  2KOL A;  4DAY A;  2HIV A;  1SDF A;  4RKL A;  1A3T A;  4AYB B;  3OTO L;  4IFD J;  4EQP A;  2KCT A;  5FLX c;  4HIO A;  2YTX A;  4I7Z C;  5C5L A;  1O7Y A;  1EIY B; 
#chains in the Genus database with same CATH homology
 3EBE A;  1QVF A;  5IYC G;  4JI7 L;  3M3Y H;  3AFP A;  1JE5 A;  1UE1 A;  2PI2 E;  4OXP A;  4JI5 Q;  4YY3 L;  1OTC A;  3GTO H;  1Y1V G;  2JE6 I;  4UP8 A;  4LW1 A;  2UUB L;  4XTC S;  5IY0 A;  5JEA J;  1FL0 A;  1M90 C;  1VQ7 A;  2IHF A;  2UUC Q;  4LFC L;  4JI3 Q;  3CD6 A;  4R4C A;  1HNW Q;  4PG3 A;  1NY4 A;  5IP9 G;  4MTN A;  2K5V A;  4TQU S;  2B63 H;  5C44 G;  4P72 A;  1NE3 A;  1X3G A;  4HJ9 A;  1PH1 A;  4GOP C;  1WFQ A;  3I4N H;  1SN8 A;  3S1Q H;  4A3L H;  3G4S A;  4A3F H;  1VCI A;  4B3S Q;  5M5Y H;  2CWP A;  2DUD A;  3MEF A;  3PUV A;  4BY1 G;  3D0F A;  1LUZ A;  3E9I A;  4LWC A;  4P71 A;  4JI5 L;  4GOP B;  3KF8 B;  1VQ8 A;  1VQA A;  2R7Z G;  4J15 A;  2OWO A;  2VL6 A;  4DUZ L;  2R7D A;  4YWM A;  4A3K G;  2YV5 A;  4JI2 Q;  1WCM G;  5IYD H;  1VQ9 A;  1TWC H;  4DV3 L;  1PYS B;  1N34 Q;  3GTG H;  3KF6 A;  1HNZ L;  2LXK A;  1KL9 A;  4K0K Q;  4H02 A;  4B3S L;  5M3F G;  4DR4 L;  2HIX A;  3CC4 A;  1WI5 A;  1IBL Q;  3S15 H;  1A8V A;  4DV1 L;  2E5L L;  1EOV A;  1RIP A;  1VQE A;  2JA7 G;  3EIV A;  4GN3 B;  3FKI G;  4OX9 L;  1HH2 P;  1XNR Q;  4DV0 L;  1I94 Q;  3F8T A;  2N49 A;  1K8A C;  1VQK A;  1A63 A;  1D8L A;  2PMZ E;  4UP9 A;  1HR0 W;  5GRO A;  1VQF A;  5IWA Q;  5C3E H;  4OX9 Q;  2B63 G;  2FXQ A;  4KLK A;  1ASZ A;  1P16 A;  4DV1 Q;  5IYB G;  4X65 Q;  2E5L Q;  1XPU A;  5ELO A;  4DR4 Q;  3J81 i;  1Q7Y C;  4LNQ A;  1NTG A;  2Q2I A;  4BY1 H;  4JI1 L;  1SFO H;  1KIX A;  4BY7 H;  4JV5 L;  4A3D G;  4X66 Q;  3KDF B;  4X66 L;  1S40 A;  4DR7 L;  3CXC A;  4A75 A;  4DR5 Q;  4BBS H;  4L5Q A;  5IE8 A;  3RLO A;  5M3M H;  1K0R A;  3CME A;  5H1S E;  3VDY A;  1EUJ A;  1YVC A;  3K8A A;  4O0A A;  1VS0 A;  3HKS A;  1IBK Q;  2Z6K A;  4X65 L;  4HJ8 A;  1XJV A;  4GNX A;  3H0G G;  2VW9 A;  3U4V A;  4O2D A;  4MZ9 A;  5FJ8 H;  4FDB A;  3J80 i;  3SGI A;  2AWN A;  2JA8 H;  2KCM A;  2D0O A;  1PYB A;  1FJG L;  1HNX Q;  1KXL A;  2MQH A;  1X56 A;  1P8L A;  3HKZ G;  5DLQ E;  2PQA A;  1HJP A;  2NVX H;  4K0K L;  4DAY B;  3H0G H;  3H3V H;  1OXV A;  3OW2 A;  3K7U C;  3KJP A;  1E22 A;  1SRU A;  2JA8 G;  4LFB L;  1R9T H;  3TS2 A;  3UDF A;  4YHH Q;  1YHQ A;  1Y1V H;  3RLN A;  3LGJ A;  1Z9F A;  4R4I A;  4DR2 Q;  1XMO L;  2WP8 J;  1VQN A;  1VQP A;  4DUY L;  1K83 H;  1VQD A;  2NN6 I;  3M85 A;  2VQF L;  4X64 L;  4DR1 Q;  4JI0 L;  1N36 L;  3DLL A;  3GTQ H;  3PO3 H;  5C4X G;  1KQS A;  1QVG A;  4B3R L;  3CMA A;  1QZG A;  4GNX B;  4LF5 L;  2H5X A;  4L5T A;  2ZTE A;  4PZ8 A;  3T1H Q;  5BR8 Q;  2E2I H;  3PF4 A;  1BBU A;  1HNW L;  2OTJ A;  1AH9 A;  1OXU A;  4LF8 Q;  3S1R H;  1M1K C;  3HFZ B;  3PO2 G;  5M5W H;  4X6A H;  4IJL A;  1VQO A;  3ZJY C;  3M9B A;  1K8G A;  1G29 1;  1WCM H;  3IRB A;  3UE0 A;  5IYD G;  4DV4 Q;  4BXX G;  1UE7 A;  4JI7 Q;  4IPG A;  2ZTD A;  4LF7 L;  2R93 H;  4R4Q A;  1YIJ A;  3I56 A;  3MXN B;  3M4O H;  5GAH C;  1IXR A;  1X9N A;  4YWL A;  4A3G H;  1Q86 C;  3L2P A;  2K5H A;  1E7Z A;  4JI1 Q;  3CPW A;  3PO2 H;  1H95 A;  2K5N A;  3M4Q A;  5C0X J;  4JBK A;  1UE6 A;  4GKK Q;  1VQG A;  2YTY A;  1YZ6 A;  3D31 A;  3W1G A;  1BVS A;  2JJQ A;  4DK3 C;  3HOX H;  2ZJP A;  4AQY L;  3BZK A;  1J5E L;  1CKN B;  4JYA Q;  5IP9 H;  4JOI A;  4A76 A;  4GLA C;  3TS0 A;  2ZJQ A;  1VQB A;  3J81 c;  1Q81 C;  4JI4 L;  1YI2 A;  4NXM Q;  2N3S A;  4GS3 A;  3CCJ A;  3CCV A;  3M7N A;  1HZB A;  4BA1 I;  3S14 H;  1UWV A;  4DV0 Q;  3BZC A;  1KC8 C;  4A4I A;  3T1H L;  4UP7 A;  1I50 H;  5LMN L;  2NZO A;  5C0X G;  3UDX A;  3PIO A;  3CW2 C;  3ERS X;  5IP7 H;  3TEH B;  3Q8D A;  1IYJ B;  1HR0 Q;  2Q2T A;  1RL2 A;  3GTP H;  1PA6 A;  5LMN W;  1BKB A;  3TRZ A;  1XMQ Q;  4JI0 Q;  3J7A 5;  1EIF A;  1G51 A;  4A3M G;  2JK8 A;  1VQL A;  2NVT H;  3I55 A;  2B29 A;  3PSI A;  3HOZ H;  5EAY A;  1YJ9 A;  3HOW G;  4UPA A;  4LF9 Q;  1MJC A;  3H15 A;  1EIY B;  4JI2 L;  2R92 G;  4A3E H;  4DK6 C;  4DUZ Q;  4IFD I;  3F2C A;  1B70 B;  1EQQ A;  2CFM A;  1PH4 A;  1CSP A;  3KLW A;  4GN4 B;  2NZH A;  4QIW E;  1E24 A;  3GTK H;  5FLM H;  2NVQ H;  2VUM H;  4LF4 Q;  4A93 G;  1HZ9 A;  1TWF H;  3NEN A;  1QVC A;  4LUV A;  3NEL A;  3I4M G;  1L1O A;  1CKN A;  2Y0S E;  1Y1W G;  1E3P A;  3KFU A;  3PUW A;  4NXN L;  1E1O A;  2PI2 A;  4IJH A;  3KDF A;  1NBW A;  1Z47 A;  2DGY A;  4KI0 A;  3FHW A;  4A3C G;  1N32 L;  2ATW A;  1V9P A;  1TWG H;  1QZH A;  4L5S A;  3I2Z A;  4OWT B;  3UDG A;  2WFW A;  2D0P A;  4YY3 Q;  3ULP A;  1QUQ B;  1PHJ A;  2CCZ A;  4YCU A;  4A3D H;  4DV6 Q;  2E8G A;  1MJE A;  1EFW A;  1TWH H;  1VQI A;  3FKI H;  1SLJ A;  1J5E Q;  1YNX A;  3J81 j;  1AE2 A;  4BBS G;  4IO9 A;  1HZA A;  4JYA L;  3HKZ E;  2UXC Q;  4AQY Q;  3KOJ A;  1SRO A;  3I7F A;  3G6E A;  1FGU A;  4X62 L;  2QEX A;  2EQS A;  4IOA A;  3OTO Q;  1PH2 A;  2ZM6 L;  3W1B A;  3RNU A;  3U58 A;  2I5H A;  1KHI A;  2A1A A;  1BBW A;  4R4O A;  4OON A;  3S16 H;  1JMC A;  2UU9 L;  1YBY A;  3HOV H;  2GVB A;  5GAD C;  4Y7N H;  5FLM G;  1PH8 A;  4DV6 L;  1C9O A;  1X6O A;  4DV4 L;  4EQ5 A;  4DV5 L;  4DR6 Q;  2JQO A;  1I94 L;  3AYH B;  4IPC A;  1EQR A;  1K73 C;  1AE3 A;  1WYD A;  4R1J A;  1LTL A;  3AFQ A;  1Q46 A;  5C44 H;  4JC0 A;  1KD1 C;  2I5M X;  1IBL L;  2K50 A;  3GO5 A;  4IPH A;  1GVP A;  4NXN Q;  1IL2 A;  2Q2H A;  4A3C H;  4GKJ Q;  3RN5 A;  2IX0 A;  1W2B A;  4JI8 Q;  4JBM A;  2R7Z H;  5HGQ A;  1IBM L;  3RZD H;  2KEN A;  1JB7 A;  2HT1 A;  3RZO H;  2L15 A;  3E9H A;  1NMG A;  3KYH C;  3TRE A;  1EYG A;  4DR2 L;  1XMO Q;  2VZA A;  4QY7 A;  3GD7 A;  3UDI A;  4QGU A;  5LMU L;  4QQB X;  4WJ3 M;  1E1T A;  1OXT A;  1CSQ A;  5IYB H;  4PZ7 A;  4LFA Q;  4LFB Q;  3CCS A;  1A0I A;  5HY6 A;  3M4P A;  2N8N A;  3GTJ H;  4DNI A;  3PGZ A;  3BU2 A;  3I4O A;  4MNO A;  2N78 A;  1B7Y B;  2NN6 G;  4YCV A;  3STB D;  2JEA I;  3A0J A;  1SE8 A;  1N33 L;  4JI8 L;  1YHA A;  1JJC B;  3A5Z B;  3RR5 A;  1XMQ L;  3ICE A;  4GKJ L;  2EXD A;  3ULJ A;  3DM3 A;  2D62 A;  4DV7 Q;  1Q12 A;  2UUC L;  3CQZ H;  2Z6K C;  2ZTC A;  4P75 A;  1S3O A;  1HNX L;  4A3B H;  4IFD G;  2B3G A;  4KHP L;  1W3S A;  3PO3 G;  2R93 G;  4OO1 I;  3BJU A;  4GLX A;  2QGQ A;  4ALP A;  2OQ0 A;  3NEM A;  1NJI C;  4B3T L;  3CCQ A;  4HJ7 A;  4BA2 I;  4DR6 L;  2XGT A;  3G48 A;  2CKZ B;  3PV0 A;  2HQL A;  2R92 H;  1GKH A;  1O7I A;  5FJ8 G;  3NBH B;  1JJG A;  2MO0 A;  3K0X A;  2AMC B;  3CCE A;  1PV4 A;  2BH8 A;  4B3M L;  3CC2 A;  2OTL A;  4BY7 G;  1V1Q A;  4NPS A;  4YWK A;  2ID0 A;  1L0W A;  3ULL A;  3K7A H;  1YHB A;  1A62 A;  2VUM G;  1LM0 A;  1S72 A;  2HHH L;  2CQO A;  1G6P A;  3L7Z C;  2ALY B;  2QA4 A;  4JV5 Q;  2I5L X;  3CCR A;  2UXC L;  1HZC A;  3PUX A;  4KHZ A;  2I0Q A;  2CWA A;  5GAE C;  3I4N G;  4A3L G;  1UE5 A;  2Q2U A;  4QJF A;  4XIG S;  3E0E A;  3CP0 A;  3HOY H;  4GOP A;  4PZ6 A;  4JBJ A;  1PH5 A;  1VQH A;  2R7F A;  2VS1 A;  2JA5 H;  2UUA L;  2UUA Q;  4A3K H;  1PFS A;  3GDE A;  3K80 C;  2E2H H;  4L5R C;  3WWV A;  2OCE A;  4LF8 L;  1N32 Q;  3G71 A;  2F4V L;  1CUK A;  4Y52 H;  2IX1 A;  5JJL A;  2F3I A;  1QUQ A;  3STB C;  5C4J H;  5K36 G;  2IY5 B;  3HOW H;  2YTV A;  1XNQ Q;  3U4Z A;  3F1Z A;  1N33 Q;  4A3E G;  1NMF A;  4AYB E;  4LF4 L;  4HJA A;  3H3V I;  1L1O B;  5JJI A;  4JG2 A;  2K4K A;  4X64 Q;  1JT8 A;  3AQQ A;  4EX5 A;  1HNZ Q;  1VQM A;  2HHH Q;  1YIT A;  2JA7 H;  1N9W A;  1N34 L;  4OWX B;  4DV3 Q;  4BXX H;  5GQO A;  2ES2 A;  4LF9 L;  1K3R A;  2YYZ A;  3J7Z C;  2R6G A;  4P74 A;  4DAM A;  3CC7 A;  2OQK A;  5E7N A;  2A19 A;  1JJ2 A;  1IBM Q;  5C3E G;  4POG A;  1D7Q A;  4HID A;  1PH9 A;  4AH6 A;  4B3T Q;  2WAQ E;  2JA6 H;  3HOU G;  1C0A A;  1Q8K A;  1Q1B A;  1HR0 L;  1L2F A;  5IYC H;  3PIP A;  3F2D A;  1PH3 A;  4DV7 L;  5LMN Q;  1GM5 A;  1VQC A;  4A3I H;  1FJG Q;  2K52 A;  1U0L A;  1FVI A;  4NB3 A;  2AWO A;  2GVA A;  4LFC Q;  2UXB L;  2Y0S G;  4GNX C;  4BBR G;  2PQA B;  3UE1 A;  2AHO B;  2IT1 A;  2MFI A;  3S1M H;  1KRT A;  1TWA H;  1YEZ A;  4LFA L;  2JA6 G;  1SR3 A;  1IBK L;  4JI6 Q;  2KHI A;  3CCM A;  2MO1 A;  3RLF A;  1Q82 C;  1X65 A;  1DGS A;  3A74 A;  4LUZ A;  4ME3 A;  2UXD L;  3CPF A;  2ZM6 Q;  2RHQ B;  1XTD A;  5IP7 G;  2WB1 E;  4JBW A;  1J6Q A;  2WB1 G;  4C3J H;  4X62 Q;  3F2B A;  1YJN A;  1GO3 E;  4WJ4 A;  4OWW B;  5IT9 c;  4DV2 L;  4IPD A;  1XNQ L;  3ER0 A;  1B8A A;  3HOZ G;  1EWI A;  1UEB A;  4POF A;  2F4V Q;  5AJ3 Q;  3S17 H;  3CCL A;  5IWA L;  1X55 A;  4C2M H;  3HOY G;  3S1N H;  1ASY A;  4DV5 Q;  3GTL H;  3CF5 A;  2ZJR A;  1PVO A;  4NXM L;  1XNR L;  4APV A;  1U5K A;  3T1Y L;  4A3I G;  2UU9 Q;  3OYY A;  1WOC A;  4LF5 Q;  3CCU A;  2VNU D;  4GLV B;  1X3E A;  5M3M G;  1Y1W H;  1XPR A;  5JJK A;  4OO1 G;  4DR3 Q;  4A3M H;  2BH2 A;  1VQ5 A;  5C4X H;  4A3F G;  1PH7 A;  3TQY A;  2KBN A;  3CAM A;  5C0X I;  4YHH L;  4A3J H;  2A8V A;  4JCV E;  4JI6 L;  1VQ6 A;  4B3M Q;  2RHS B;  2EIF A;  3FP9 A;  3KF6 B;  4YCW A;  5GAG C;  1N8R C;  1CKM A;  4TVA B;  1KAW A;  3HOX G;  2JA5 G;  4A93 H;  2Z0S A;  2IHE A;  2VQE L;  1CKO A;  4P73 A;  2K14 A;  1WJJ A;  1PH6 A;  1I5F A;  3I4M H;  4HIM A;  4QL5 A;  1XPO A;  4KHP Q;  2UXB Q;  1VQ4 A;  1K9M C;  2XTI A;  3B6Y A;  2LSS A;  4IOC A;  2JA9 A;  1VQJ A;  4A3J G;  2YU9 H;  5J3B A;  4C3H H;  4JI3 L;  2C35 B;  3S2D H;  2UUB Q;  1I3Q H;  4JI4 Q;  2LXJ A;  1N36 Q;  2VQF Q;  5M5X H;  3W5O A;  4BBR H;  3JAM c;  4DR1 L;  4UY8 C;  2VQE Q;  4DKA C;  2GN5 A;  4HIK A;  1C7Y A;  4A3B G;  4GKK L;  1MIU A;  3KJO A;  3PUY A;  5LMU Q;  2MNA A;  1LYL A;  4JOI C;  3U50 C;  5ELN A;  3EN2 A;  3HOU H;  3JAM i;  1YJW A;  5M3F H;  1OXS C;  2WAQ G;  3K81 C;  2NVY H;  2BA0 A;  4LF6 Q;  5JEA G;  1I6H H;  4PMW A;  1T9H A;  4DR3 L;  4LF7 Q;  3HOV G;  2UXD Q;  1KRS A;  2JEB I;  1Y14 B;  2AKW B;  1TXY A;  1MKH A;  2E2J H;  2VY3 A;  3A5U A;  4HJ5 A;  3T1Y Q;  3PF5 A;  3PUZ A;  4R4T A;  1GD7 A;  2KHJ A;  2RCN A;  4A3G G;  3GTM H;  2F52 A;  2V1C C;  5BR8 L;  2RF4 A;  3J80 c;  3S24 A;  1L1O C;  4AYB G;  2BA1 A;  5AJ3 L;  3AEV A;  1X3F A;  1Q1E A;  1SMX A;  2K75 A;  3PCO B;  4GN5 A;  4AIM A;  4B3R Q;  4C3I H;  4LF6 L;  2HIV A;  3S2H H;  4RG1 A;  3OTO L;  4DUY Q;  4DV2 Q;  4IFD J;  4DPG A;  2PNH A;  2KCT A;  4DR5 L;  4RMF A;  5FLX c;  4HIO A;  1X54 A;  2YTX A;  4DR7 Q;  2ASB A;  3JC6 6;  4LUO A;  3L0O A;  1IZ6 A;  1V43 A;  1OXX K;  3RN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...