4JI6L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLLGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 12
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji6L00
3OTOQ 2R6GA 4AIMA 2Y0SE 3CCSA 4GLAC 4B3RQ 2JA6G 3HKZE 4JI7L 4DR7L 1O7IA 1HR0Q 2ZJPA 1A0IA 4QJFA 4HJ7A 2OWOA 3M7NA 1J5EQ 4J15A 5M3MH 5JJKA 4A3LG 4A3BH 4FDBA 4UP7A 1QVFA 1VQNA 3HOWH 4JI1L 1B7YB 4GNXB 1VQ8A 1RIPA 1WCMG 3CCEA 1BKBA 3HOVG 4LF5L 2MO0A 1TWFH 4UP8A 4AQYQ 1XMQQ 5IWAL 4X65L 2CFMA 3I7FA 4YHHQ 1VQFA 4UPAA 4JI5L 1GO3E 3AEVA 5IP9G 3CQZH 4HJ8A 3D0FA 4DR5Q 4EX5A 3MEFA 3ZJYC 2E2HH 1ASYA 1U0LA 1IBMQ 5IE8A 2CCZA 3CC2A 4LF6Q 2IX1A 2GVAA 3CCRA 2UXCL 3DM3A 3SGIA 5IYCH 1K73C 4LF9Q 3CF5A 2HT1A 4XIGS 4IPCA 2CQOA 3U4ZA 1IBKL 2PI2A 3RLFA 2JEAI 2OQ0A 3GO5A 1HNXL 1L0WA 4A3IG 2YYZA 1G51A 3CW2C 1Y1WG 3CPWA 1XTDA 2F52A 4X66L 1IBKQ 3KDFB 1AE3A 2JA5G 1CSQA 4AYBE 4IOCA 1NY4A 2ZJRA 4POFA 1VQKA 1IXRA 2JA8H 3D31A 1G291 1JT8A 4OO1G 1Z47A 1SR3A 4A3CG 4ME3A 1XPOA 4QY7A 3NEMA 2Z6KA 3L2PA 1YJ9A 1NMGA 1VQLA 2YTYA 4XTCS 1YHBA 1S72A 2ES2A 4OX9L 3NELA 4IPDA 2Z0SA 4A3FG 1Q1EA 4BXXH 4LF9L 2NVQH 1LTLA 3H15A 1SROA 2OQKA 1PH4A 2JA7G 5GQOA 3CCVA 2R7ZH 2R93H 4LF8Q 2PQAB 4DK6C 3JAMc 4DV3Q 4DR3L 4A75A 1N34L 4DR2L 4DUYQ 3PUZA 3A5UA 1CKNA 4MNOA 3OW2A 1JJ2A 4GOPC 1N36Q 3WWVA 2UUCL 4UP9A 4HJ5A 1X3EA 1E1TA 2R7DA 3E9IA 1JJGA 1HZ9A 1VCIA 4X6AH 4JBMA 1C0AA 1E1OA 5C0XJ 5LMUQ 1CKNB 1VQ4A 4K0KL 1YHAA 5C4XH 4JCVE 2UUAQ 1HZBA 2JEBI 4BBSH 3PUXA 2WAQG 3KLWA 1UE7A 4NXML 3S17H 1K83H 1GVPA 3M9BA 4MTNA 4L5SA 1VQBA 1Q8KA 3A5ZB 4YCWA 3U4VA 1I94L 1IBML 2DUDA 1IYJB 5FJ8H 4JI0Q 2YU9H 2RCNA 2K75A 5IT9c 3GTJH 1GKHA 3PO3G 1SLJA 3NENA 4DV1L 1QUQB 1LM0A 1K3RA 1LUZA 3JAMi 3H0GG 5ELNA 4A3LH 2L15A 4JBJA 1XNRL 3GD7A 5C0XI 3FP9A 4GN3B 3T1HL 2F4VL 3PO2G 2VZAA 2RHQB 1G6PA 4GKKQ 3FKIH 4P75A 4TVAB 3UDFA 3HOVH 1X65A 3CCUA 2K50A 2KHIA 2NZHA 2VL6A 1PA6A 2JE6I 5LMNL 1KL9A 2UU9Q 1E22A 2WAQE 4L5RC 3F1ZA 4AH6A 4PZ7A 2B63G 3BU2A 2UUBQ 3HKZG 4GLVB 3HOUG 3K81C 1I3QH 4NXMQ 4LF7L 3CD6A 2XTIA 5E7NA 2JA7H 2R7ZG 3HOYG 3KDFA 1PV4A 2VS1A 1Q7YC 1VQ9A 2AHOB 4JI1Q 3KJOA 1Y1VH 2HHHQ 1AH9A 4JBWA 4JI0L 5M5WH 3KF6A 1Z9FA 4KLKA 4QGUA 1PHJA 2N78A 5K36G 1MIUA 1HH2P 1GD7A 3KF8B 1PYSB 3CCJA 1EQRA 1IZ6A 2IY5B 1X9NA 4DUYL 2QA4A 1J6QA 4LF6L 1L1OA 1R9TH 4WJ4A 3EIVA 2Q2HA 2YTVA 1KIXA 1HNZL 1TWAH 1W2BA 3K80C 2OTLA 3ERSX 2K14A 5EAYA 4NB3A 1VQEA 2KCTA 1OXXK 4LFCQ 3RLOA 1HR0W 1FJGQ 4GKJQ 4X64Q 1HNZQ 1I5FA 3PUWA 4BXXG 4A3GG 1N36L 3GTPH 4BY1G 3IRBA 4AYBG 2UUBL 1OXVA 5AJ3Q 4OWXB 1NMFA 4JC0A 2CWAA 2Z6KC 3RN5A 4JI3L 1I6HH 4YWLA 3M3YH 2NVXH 1YVCA 5GAGC 5FLXc 4LF5Q 4NXNL 3CPFA 1IBLQ 2JA5H 3J7A5 1KAWA 2JQOA 2WFWA 4A3JH 4YCUA 2PMZE 2NZOA 3STBD 4LFAQ 5HGQA 5IYDG 3H3VH 2C35B 2UXDQ 2LXJA 1VQGA 4C3HH 4YY3L 4X62Q 2R7FA 5C44H 1V1QA 4EQ5A 2AWNA 1PH9A 1C9OA 1WI5A 2D0OA 4GN4B 2EQSA 4BBRG 2VQEQ 4DR1Q 4BBSG 3BJUA 3LGJA 1Y1VG 2YV5A 4JI2L 1YEZA 2JA9A 2NN6G 5JJIA 2DGYA 4YY3Q 4X62L 1VQ7A 1OXSC 5DLQE 1YIJA 1N32L 3DLLA 3PUVA 3CMAA 1PH1A 1HNXQ 3PSIA 1TWCH 1X3FA 1S40A 1B8AA 3UDGA 2R93G 5LMUL 3W1BA 3JC66 4JI3Q 3HOXH 1CKMA 1L2FA 1JJCB 2H5XA 3FKIG 4R4QA 4HIKA 1L1OC 1V43A 1X3GA 5C3EG 2OTJA 4HIMA 4TQUS 2ZTCA 3G48A 4DR5L 1KQSA 2Q2TA 2HIXA 4ALPA 4DV2Q 2HHHL 4JI5Q 4R4CA 2VQFL 2PNHA 5GAHC 1IBLL 4A3GH 3UE1A 3GTOH 1VQPA 4A3EG 1VQOA 1XNRQ 2KENA 1K9MC 3H3VI 2A8VA 1N32Q 4DV5Q 2LXKA 5M5XH 2E5LL 2I5MX 3HOWG 1NTGA 1Q1BA 4IJLA 4L5TA 4DAYB 1TWGH 4C3IH 3GTGH 4KHZA 2D62A 3CCMA 3PO3H 1I50H 1FGUA 1Q46A 3I55A 3CCQA 3VDYA 2OCEA 5GAEC 3HFZB 3M85A 2UUCQ 4JI4L 4JI7Q 4DR7Q 2K5NA 1WOCA 4H02A 3PIOA 4BA2I 3M4OH 3W5OA 1QVGA 1Q86C 5C44G 4K0KQ 5FLMH 2VW9A 3S2HH 2FXQA 3PUYA 1SFOH 2VUMH 2E2IH 4DR4Q 1MJCA 2VNUD 1VQHA 1XMOQ 3L7ZC 5IYCG 4DUZQ 1B70B 5C4JH 3EN2A 2B63H 4OX9Q 4A93G 4QQBX 2AMCB 4IPHA 1PVOA 3S1MH 4LFBQ 2KHJA 2ZM6Q 1VQJA 1V9PA 2IHFA 2K5HA 3PIPA 3PGZA 1QVCA 1L1OB 2CWPA 4JG2A 4LNQA 4A3MG 3K8AA 1Y14B 1S3OA 3I4NH 3T1HQ 3S2DH 3KYHC 4B3RL 3S1NH 5JJLA 1FL0A 2GVBA 2F4VQ 4A3CH 2R92H 4IJHA 3GTQH 4DV6Q 3F2CA 3W1GA 4GLXA 2ZTDA 4JI6L 1EIFA 3TEHB 2PQAA 1PH7A 1VQIA 5IYBG 5BR8L 1QZGA 4YCVA 1N9WA 4B3ML 4DV4Q 1X54A 4KHPQ 3BZKA 2YTXA 4PZ6A 4A3KG 4GOPA 1N33L 4DV7L 1MJEA 1EOVA 4GOPB 1VS0A 4BY7H 3Q8DA 4DV4L 4B3TL 4GNXC 4DR4L 1YBYA 3CAMA 3NBHB 4R4TA 1XMOL 3GTLH 4R4OA 3G6EA 1IL2A 4JYAQ 3EBEA 3S16H 1CKOA 2RHSB 5JEAG 5M3MG 4RMFA 4B3TQ 1UWVA 4NXNQ 3HKSA 4C3JH 4HJ9A 1XJVA 4APVA 3KJPA 4DR1L 2UXCQ 1AE2A 2JJQA 2VQEL 3G4SA 4DV2L 3HOXG 1KC8C 1FVIA 1YJWA 3RNUA 1D7QA 4YWKA 2Q2UA 5C4XG 3U50C 1WJJA 2UU9L 5ELOA 2F3IA 3ER0A 4IO9A 5LMNQ 4JI6Q 1QUQA 4RG1A 4DV3L 5BR8Q 1SRUA 2HQLA 4LF8L 3ULJA 1YI2A 4JV5L 1PFSA 2K52A 2KCMA 4DR6Q 1TWHH 3STBC 5IP7G 1PH5A 1KRTA 2I0QA 4A76A 3AFQA 2EXDA 1QZHA 4LUVA 1ASZA 4A4IA 5FJ8G 1WFQA 5H1SE 4WJ3M 2I5LX 4JV5Q 3BZCA 4JOIC 4DR6L 4A3EH 4KHPL 2N49A 4DKAC 4L5QA 5AJ3L 1J5EL 3I4NG 1SE8A 3K7AH 3I4MH 3CC7A 4LFBL 1W3SA 2EIFA 4YHHL 1HZAA 2R92G 3J80i 4HIDA 3S1RH 3ICEA 4GNXA 1I94Q 4GS3A 1EYGA 4OO1I 2QGQA 3KF6B 4DUZL 1UE1A 2MQHA 1E3PA 1EWIA 2JA8G 2BA0A 1VQMA 4A3KH 3ULPA 1M1KC 1SMXA 5FLMG 3HOUH 3G71A 2VUMG 3J80c 2WB1E 2ZJQA 1X56A 1HR0L 2AWOA 3CCLA 2WB1G 4JI4Q 4POGA 1BVSA 2NN6I 4LW1A 1XNQL 3E9HA 4OWWB 5M3FH 3AYHB 4A93H 4X66Q 2IX0A 4HJAA 4P71A 5GADC 3F8TA 2BH8A 1OTCA 4PMWA 2LSSA 4DV6L 1VQ6A 1EFWA 1PH6A 4YWMA 3TS2A 4AQYL 1WYDA 3M4QA 3PF4A 5HY6A 3UDIA 2KBNA 4DV0Q 2HIVA 4C2MH 2I5HA 3M4PA 4QIWE 3UDXA 1E7ZA 1A8VA 3J81j 1UE5A 1YZ6A 2ZM6L 3B6YA 5IYBH 3KOJA 3PF5A 3GTKH 3MXNB 3OYYA 1XPRA 2Y0SG 2UXBQ 4LF4L 3HOZG 4A3DH 4GKKL 4BY1H 1CSPA 1Q12A 1BBUA 3CMEA 3I4MG 2ASBA 1VQDA 5JEAJ 1WCMH 2RF4A 4GN5A 1NJIC 3J7ZC 1OXTA 1X6OA 4DNIA 1XNQQ 4O0AA 4B3SQ 4Y52H 4Y7NH 3GTMH 2N8NA 2NVTH 3TREA 1U5KA 4R1JA 2VY3A 4DPGA 5IP9H 1K8AC 2BA1A 4DV7Q 4OXPA 3J81c 4A3JG 1YHQA 4B3MQ 3FHWA 5GROA 4B3SL 1JMCA 5IYDH 2IHEA 4NPSA 3TS0A 3AFPA 1Q81C 4JYAL 4DV0L 4LUZA 4KI0A 1KXLA 3ULLA 4BA1I 4DAMA 3S24A 2PI2E 1PH2A 1OXUA 3CP0A 2JA6H 1Q82C 2IT1A 4LUOA 3E0EA 5IWAQ 4X65Q 3AQQA 3KFUA 1NBWA 1P16A 2D0PA 4JOIA 3J81i 1N8RC 4LF4Q 4QL5A 4A3IH 4IFDJ 1K0RA 5IY0A 3GDEA 1Y1WH 2VQFQ 4DR3Q 1C7YA 3HOYH 1EUJA 1HJPA 4DR2Q 3S1QH 4BY7G 3F2DA 1CUKA 1YITA 4DV5L 1VQ5A 2A19A 2B29A 4MZ9A 4LFCL 1FJGL 1BBWA 3PCOB 1P8LA 4X64L 1KD1C 4GKJL 1HNWQ 3T1YL 3TQYA 5C3EH 2BH2A 5C0XG 2UUAL 4OONA 2MFIA 3I56A 3S15H 2JK8A 1JB7A 4A3DG 4IFDI 1TXYA 3RR5A 4LF7Q 1DGSA 3RZDH 1N33Q 2ID0A 3RLNA 1A63A 3A0JA 2MNAA 3F2BA 1JE5A 1HNWL 1HZCA 1LYLA 5IP7H 3A74A 5M3FG 4OWTB 4JI8L 3CXCA 1T9HA 2QEXA 1XMQL 1XPUA 4IFDG 2NVYH 4A3BG 1E24A 1X55A 4IOAA 4JI2Q 1M90C 2AKWB 3I2ZA 3UE0A 1H95A 2E2JH 1KHIA 1A62A 4LWCA 2UXBL 1PH3A 3I4OA 2WP8J 4P73A 1N34Q 3CC4A 3U58A 1SN8A 5J3BA 2E5LQ 3PV0A 2Q2IA 5LMNW 1KRSA 3K0XA 2ZTEA 2E8GA 4A3FH 3L0OA 4DK3C 4BBRH 4P74A 3HOZH 1NE3A 1RL2A 1UE6A 1PYBA 3H0GH 3RN2A 1EIYB 2MO1A 4UY8C 3TRZA 4IPGA 3PO2H 2XGTA 1MKHA 2N3SA 2K4KA 4HIOA 1EQQA 1VQCA 4O2DA 4PG3A 4JI8Q 4A3MH 1PH8A 3RZOH 3S14H 1YNXA 1K8GA 4PZ8A 4R4IA 1GM5A 1YJNA 2ATWA 2K5VA 5M5YH 2B3GA 2CKZB 4P72A 3OTOL 2ALYB 3K7UC 1VQAA 1UEBA 4JBKA 2V1CC 2UXDL 2A1AA 2GN5A 4DV1Q 4LFAL 1D8LA 3T1YQ
chains in the Genus database with same CATH superfamily
3OTOQ 2QILA 1PRTF 2LKVA 3CCSA 4GLAC 4B3RQ 2L9HA 4JI7L 3M4OB 3BVMA 2IPKD 2EOTA 1BCPC 4K8JA 1K28A 1S5ED 4QJFA 5L37A 3M7NA 1H9SB 2NZ1D 5M3MH 2B2WC 1ZEQX 2K03A 4FDBA 1QVFA 4K5VA 4GNXB 1RIPA 4A3FB 4AQYQ 3O13A 4X65L 2CQAA 4YHHQ 4JI5L 1GO3E 3CQZH 4HJ8A 3FRPB 2IX3A 1GOZA 2E2HH 2L5TA 1U0LA 3CC2A 2GVAA 1IW7D 3CF5A 1MHWC 3E3XA 2PI2A 1HNXL 1B44D 4A3IG 4UDUC 1PTOC 4F8MA 4DN4M 5KEEA 1AE3A 5DM73 3TBIB 2JA8H 3P20A 1I3QB 1SR3A 4A3CG 2F0JA 4C3JB 4CKBA 4QY7A 5ELBA 3L2PA 1NMGA 4XTCS 3IFDA 5AFWA 4OX9L 3NELA 3HP3A 2BCOA 3T4AC 4LF9L 2NVQH 1LTLA 3H15A 3QJYA 5EBDA 5GQOA 3GTKB 4FXDA 2FFKB 4OIKA 4C1NK 1WTHA 4DUYQ 4IALA 3A5UA 1CKNA 3NQTA 2D9UA 1F9PA 5I2YA 3MWYW 2R7DA 4PMCA 2R7ZB 1HZ9A 1VCIA 5I6YA 1EY0A 2DN8A 4JBMA 1C0AA 5C0XJ 3U9OA 5CBEE 1VQ4A 1EQVA 2UUAQ 4G4KA 4BBSH 1K83H 1DZ1A 2OF1A 1VQBA 5LHY1 1D6EC 3A5ZB 2DUDA 5FJ8H 3MHBA 5IT9c 2R3ZA 3GTJH 2A6HC 3PO3G 1SLJA 1B2TA 3OPOA 4HMIA 4I65A 1LUZA 3HGBA 5IGGA 1U9RA 2PZWA 3H0GG 5ELNA 2L15A 4JBJA 4RH6A 4DA2A 2HUGA 2VZAA 1G6PA 2K50A 4KY6A 3OW7A 1SJHD 1E22A 2K5QA 3F1ZA 4BBRB 4PZ7A 4KMUC 2UUBQ 2ZT9C 3HKZG 5JPMC 3HOUG 3GV6A 3CD6A 3OWEB 4IUPA 1I4GA 3TP7A 1ENAA 1VQ9A 2NTSA 3KJOA 3S1MB 4G57A 1NAPA 1Z9FA 2WAQB 1MIUA 2Z9HA 3I8ZA 1BR9A 3KF8B 1PYSB 3K5OA 1EQRA 4XYOA 1WTPA 2ICEC 3QB3A 1J6QA 4J6HA 4Q0FA 3VYTA 4WJ4A 2K05A 4FXGC 1W2BA 5I9OA 1XYIA 3OHXC 2P5ZX 2KCTA 4LFCQ 1FJGQ 1HR0W 4DAYA 1I5FA 3PUWA 4CJ2C 2YU9B 2H4OA 1EYCA 4R8NA 3J7AF 4JC0A 2F0KA 2CWAA 3RN5A 1ZXTA 4JI3L 1I6HH 4WFN3 2NWGA 3KBGA 3K57A 2KUMA 5T1GA 2JA7B 3CPFA 2JA5H 1KAWA 2JQOA 2EJGC 1B50A 1Q90A 1HFNA 2C35B 2LXJA 1VQGA 3A54A 3VR6A 2NVXB 2VQEQ 4BBRG 4BBSG 5IT9E 3BJUA 4FXKC 2EJMA 3HRZC 5M5YB 2JA9A 1CTMA 2NN6G 3TP8A 1VQ7A 1OXSC 2CW0D 5IOCA 1N32L 3DLLA 3PUVA 3CMAA 1HNXQ 2EJFC 3PSIA 3I4LA 1B8AA 2M00A 3ONAB 1ZKOA 3JC66 1JJCB 2JYOA 2PYKA 2QF7A 1DJRD 4ALPA 4DV2Q 3EA6A 2HHHL 4JI5Q 1DYQA 5GAHC 5E4XA 3Q23A 3QR8A 3C1EA 1VQPA 1CHQD 2J7ZA 1ENCA 3MFYA 1LABA 1K9MC 3JAML 3DEPA 1N32Q 2HQEA 3MXUA 2GA4B 2I5MX 5M5XH 3HOWG 1LTTD 3GP7A 3OOCA 4L5TA 1FGBD 4KHZA 1FGUA 1GJXA 3VYRA 4JI7Q 3NTKA 3HOVB 4N9TA 4JVZA 4H02A 3H6MA 4BA2I 5C44G 3H3VC 4K0KQ 2VW9A 1SFOH 3PUYA 2E2IH 2VNUD 2R93B 3P75A 1JICA 4DUZQ 2B63H 2K7VA 4QQBX 1EFID 1PLFA 4BBSB 2V4DA 1LTBD 4IPHA 2K5DA 4LFBQ 3BDOA 1QNKA 5JAVA 1RDPD 1V9PA 5I4DA 3DUZA 2ENBA 4B3RL 1S4ZA 2XRSD 2MUYA 4PMBA 5JJLA 3MEHA 4GLXA 3MC0B 1QZGA 1LTRD 1N9WA 1X54A 1PTOB 1VS0A 3MXPA 4B3TL 4GNXC 1KNEA 2EE1A 1XMOL 1V8QA 3KLSA 4QB4A 4C3IG 1G2SA 2XRQD 5FO7B 3S16H 1CKOA 5I9PA 2A6EC 4CDEC 5M3MG 5JEAG 3PO2B 3HKSA 1WTVA 2UXCQ 2VXWA 2H1EA 3G4SA 1S5DD 3NBIA 1D7QA 2AQ3B 5C4XG 3U50C 3NTIA 3KLRA 3ER0A 4JI6Q 1SYFA 4DV3L 1SRUA 1QILA 2SOBA 4LF8L 1YI2A 1HHVA 3NTHA 1KLGD 3NXWA 1PH5A 4A76A 3AFQA 1ASZA 4LUVA 2F0SA 5H1SE 4WJ3M 4JV5Q 5HGTA 3VR5A 5DAUA 4DU9A 4LFBL 1GUOA 3GTMB 1KLUD 2EYFA 3J80i 2M2LA 4HIDA 3S1RH 1UNSA 4C1NI 2IJ0A 4DUZL 2JA8G 5K5PA 3M7GA 4A3KH 1SMXA 3NHHA 3MA2B 2EY5A 1SNQA 2AWOA 5F2DA 3CCLA 5IGBA 3D6WA 4POGA 1U4RA 2NN6I 3CQZB 5KIXA 3E9HA 1XNQL 5M3FH 2IX0A 1OO9B 4P71A 1HUMA 2XVSA 5M9OA 4DV6L 2CH4W 4DAPA 4TKOB 2KBNA 5EBCA 4A3JB 4B9WA 4C2MH 2I5HA 4QIWE 3J81j 1E7ZA 1AZQA 1UE5A 1YZ6A 1GHKA 3GTKH 3PF5A 3MXNB 1XPRA 2UXBQ 2Y0SG 4G7OC 3HOZG 4DNRB 5CORA 4BY1H 3DHQA 1Q12A 1PDQA 2HCIA 3CMEA 2ASBA 1H9RA 2WINB 2RF4A 1NJIC 4DF7A 5EJWA 4Y52H 1A15A 1D5MC 1PFNA 1U5KA 4OXPA 4A3JG 4B3MQ 3FHWA 4DXFA 4FO2A 2K04A 1CA5A 5IGEA 3TS0A 1DONA 4KI0A 2J4XA 3ULLA 1OXUA 4LUOA 4JW0A 1HNWQ 4X65Q 2D0PA 4DAVA 1PXUA 4LF4Q 5IY0A 1A2TA 2VQFQ 2C5CA 3S1QH 1W6KA 3F2DA 3SK6A 3WOEA 3VR2A 5CV5A 1P8LA 4BS9A 1TS3A 2MFIA 3CRKC 3S9WA 2JK8A 1PFBA 2QEJC 4A3DG 3D6CA 1TXYA 1AEXA 1LACA 1STBA 3AMUA 2KEDA 1SNOA 3RLNA 3A0JA 3OSOA 1WD0A 1HNWL 1HZCA 2NVYB 1LYLA 5IP7H 5M3FG 5D14A 1PMRA 2QEXA 2F0LA 2JA6B 1E24A 1X55A 1YNJD 1H95A 2EYJA 5EKLA 5A35A 1QE6A 2A74C 4H44C 3SK4A 1N34Q 3CC4A 1SN8A 1TS4A 1SNDA 3PV0A 2CH4A 4A3FH 2PZTA 3L0OA 3T16A 1XTCD 1SEBD 4BBRH 3RMHA 3HOZH 2QW7A 3BYYB 3RN2A 2AUJD 1BO0A 3DXJC 4FF1A 3TRZA 1MKHA 3S2HB 4A3MH 3IKJA 1S5BD 2XNAC 2F0GA 3HOYB 4PZ8A 4R4IA 1WCMB 4IUTA 2MGSA 2K5VA 5M5YH 3BDCA 1VQAA 4C2MB 2V1CC 2UXDL 2A1AA 4DV1Q 4FF2A 1PZJD 3A7LA 4ZUJA 3A8KE 2R6GA 4AIMA 4KKUA 3DWPA 4QCLA 4A3BB 2F0QA 4DR7L 3N52A 1A0IA 4MIUA 1SJED 1DM0B 4IFDH 2PCFB 4O1NA 3CU7A 4U673 1GUNA 3HOWH 1B7YB 3A8JE 4M1UB 1WCMG 1K8OA 4LAAA 1XMQQ 1B9MA 2NYZD 4MHEA 4EQOA 4DNTB 5C3XA 3K5MA 3ZJYC 3NE5B 4XT1B 1IL8A 5IE8A 4LF6Q 2IX1A 3CCRA 1ICWA 4XIGS 1U4PA 3U4ZA 2CQOA 3RLFA 1MD2D 3GO5A 3PMFA 2YYZA 1Y1WG 5M5XB 4G7ZC 1ILPA 5BN5A 2B2YA 4CDCC 4AYBE 3Q22A 1L0YB 4POFA 1IXRA 1G291 1F9QA 2JSOA 1JT8A 2NVQB 1Z47A 1STAA 2QDLA 5DNFA 1DOKA 4KKTA 4H13C 4L6TB 3D3RA 1EQTA 4A3FG 1PH4A 1SROA 2OQKA 1SFOB 2R93H 4LF8Q 1TIID 5KYLA 4DV3Q 1N34L 3PUZA 4MNOA 1JJ2A 5JEAH 5A2QL 4GOPC 4RGMA 1X3EA 3E9IA 3MVVA 1MSGA 1M8AA 5FO9B 1CKNB 1YHAA 5C4XH 4JCVE 4A3IB 4R9WA 5IIFA 3W3AA 3S17H 1GVPA 4MTNA 4L5SA 1JE4A 1IBML 1FD7D 2CW0C 3U9SA 1LT6D 4X3TA 2KHSA 1LM0A 1AZPA 2FMCA 5HURA 1LT3D 2RHQB 4GKKQ 4TVAB 3UDFA 3E5SA 1X65A 2JE6I 5LL6S 1KL9A 1TWFB 1II3A 2WAQE 5ISRA 1D2BA 4M8AA 1GXDC 4ZUIA 1CHPD 2JA7H 2R7ZG 2SEBD 4RCNA 2HHHQ 4FNFA 1LT5D 3OWFA 4I7AA 5M5WH 4KLKA 1B53A 4X3SA 2N78A 1PHJA 5K36G 4QMGA 1LTID 1SXTA 3ND9A 3CCJA 2F0MA 2RBMA 2IY5B 4DUYL 2EYOA 1CA6A 3V96A 1R9TH 3EIVA 2YTVA 1KIXA 1HNZL 2OTLA 4ME5A 1GUSA 5EAYA 1VQEA 3RLOA 4X64Q 1N36L 3GTPH 4BY1G 1OXVA 4H7BA 4OGQC 5COYA 5CBAE 2HDMA 5AJ3Q 4OWXB 1NMFA 2G5DA 1STEA 4YWLA 2KEEA 3M3YH 1YVCA 5GAGC 2SNSA 1JORA 3K5LA 5DM63 2WFWA 4A3JH 4YCUA 5C5LA 2SNMA 3NBHA 5CV9A 1EWCA 4EQ5A 5C4JB 3LGJA 1Y1VG 2YV5A 5IGDA 2K28A 3Q0AA 5C4ZA 5IODA 1YIJA 3G6JB 1PH1A 1KDAA 4F7XA 5JOBA 4C3JG 3RZDB 1X3FA 5LMUL 4JI3Q 3HOXH 1CKMA 1H9MA 1KAAA 2KECA 2OTJA 1TWHB 1VMPA 1KQSA 2ZTCA 3G48A 4DR5L 2Q2TA 2HIXA 4R4CA 1BQQT 2PNHA 1IBLL 4A3GH 3GTOH 4NW2A 1JOQA 4WRDA 3C46A 1D5ZC 4CHTB 4HMJA 4JPBW 1LLRD 3P1HA 3H3VI 2N88A 2K1BA 2E5LL 1EYDA 1B1ZA 2G9HD 1I50H 2F1MA 3VDYA 3I55A 3CCQA 1NUCA 2OCEA 5GAEC 3HFZB 2UUCQ 1TY2A 2AQ2B 3EQLC 1QVGA 3S2HH 1EY8A 1V1PA 1XMOQ 2OT2A 5FLXL 2DNEA 3EN2A 4X3KA 1MSHA 2ZXOA 1C4QA 4QUCA 3TDQA 5CV6A 4JG2A 4A3MG 2F0OA 3K8AA 2PO4A 3ERQA 3KYHC 4IZ8A 1KABA 4U68A 1R4QB 3E6ZX 3F2CA 3GV3A 1PH7A 1VF7A 2F0VA 2RSNA 4YCVA 4B3ML 4IUQA 3S16B 4K6DA 2YTXA 4DV7L 3C2PA 1UEAB 4MTKA 4BY7H 3SEBA 1YNND 4B08A 1I4XA 2RHSB 4NXNQ 1SYBA 1UWVA 4C3JH 5IGFA 1I4RA 4HSVA 2B2VC 2LS01 2VQEL 5M5WB 1XXGA 3HOXG 3RNUA 3J80L 1WTRA 5ELOA 2F3IA 4IO9A 1QUQA 5BR8Q 2HQLA 1Y8PB 2K52A 2KCMA 1I6VC 2QCPX 1QZHA 3J7YW 4A4IA 3H91A 2I5LX 5FO8B 3BZCA 4JOIC 4DR6L 2FHTA 1YNJC 1TS5A 3I4NG 5AJ3L 1W3SA 4YHHL 2R92G 1B3QA 4GNXA 1I94Q 4GS3A 1EYGA 4OO1I 4HCEA 2QGQA 5CYUA 1UE1A 2MQHA 1E3PA 1Z7TA 5CC4A 4FF3A 3HOWB 1EWHA 2WKDA 4CDFC 4CDDC 1CI3M 3GTJB 3J80c 2WB1E 2ZJQA 2HDLA 1BVSA 4LW1A 2F0NA 2IW3A 5GADC 3I4NB 3F8TA 4CKCA 4PMWA 3BVZA 3I72A 4RHRA 1EFWA 3TS2A 4AQYL 1WYDA 3M4QA 3GTLB 3PF4A 3EVQA 1PZKD 3UDIA 1EZ8A 2HIVA 1WTQA 3M4PA 3HOXB 1A8VA 1LV9A 2ZM6L 3B6YA 3W2DA 1TU2B 5C0XH 2Q8IB 3OYYA 2BE5C 4GKKL 3EFXD 1BBXC 5TSSA 2NVTB 3KUPA 2R61A 3I4MG 1FNUA 5C4HA 4F87A 1DCZA 2O4XA 4GN5A 4O0AA 3LNNA 2N8NA 5E1FA 1Y1VB 4DPGA 4DV7Q 1YHQA 2R92B 1AP0A 2I07B 4J1MA 5GROA 2I46A 2IWHA 2EY6A 4LK1C 3AFPA 1HTPA 3NPPA 3D4RA 4DV0L 3MXGA 4LUZA 4BA1I 4DAMA 3HKZB 2JA6H 1IHZA 3CP0A 4QUFA 4IUVA 4A3EB 5JJIA 5IWAQ 3AQQA 1CT1D 4IFDJ 4A3IH 5C4XB 1K0RA 1J9OA 3GDEA 3SXHA 1HJPA 4I7ZC 1CUKA 1CK1A 4K5XA 1TT2A 4NDXA 1SNPA 2DJGC 5D65A 2JN4A 1BBWA 3PCOB 1KD1C 1KTKA 3SDZA 3HOZB 3GQBA 4CJ0B 3T1YL 1CZWA 2NUCA 2B2YC 4OONA 3S15H 1SNCA 2EYHA 4C3IB 1JB7A 2RDFA 1TWCB 1Y8OB 3RR5A 1DGSA 3TP6A 3TZDA 3Q24A 1EY6A 1SYEA 2MNAA 1SNMA 3F2BA 4JI8L 2DJFC 3T56B 1XPUA 1RF2D 3IL8A 2NVYH 3K58A 4IOAA 1NSNS 2AKWB 3I2ZA 3R2TA 1U4MA 2E2JH 1KHIA 2UXBL 4LWCA 1BNZA 4PQXA 4V190 2TMPA 1QCBD 3U58A 4DK0A 3AU7A 5LMNW 1KRSA 2ZTEA 2E8GA 5C6AA 1GHJA 5J22A 1R9TB 3X3MA 4A93B 3GTQB 1A3UA 1NE3A 3SK8A 1RL2A 3H0GH 2MO1A 2B2UC 4IPGA 2K4KA 2XGTA 1EQQA 3S14H 2X6GA 1K8GA 5CR3A 1BDOA 3D8GA 3DM1A 2K01A 3I70A 2CKZB 2F3VA 2WACA 4P72A 2ALYB 3ITPA 1UEBA 3KBXA 1TWGB 4JBKA 3GTGB 5C5MA 2GN5A 3IFTA 2AUKA 5FLXE 3A55A 4RWSC 4ZRZA 2KCCA 2JA6G 3HKZE 4KV6A 1HR0Q 4FP5D 1JCKB 4J15A 2A5HA 1TY0A 5JJKA 3H09A 4A3LG 4NP5A 4A3BH 1EU3A 1VQNA 3SVMA 1BKBA 3HOVG 2MO0A 4UP8A 4KN4C 4TRDA 1BCPF 2E75C 2N55A 1WD1A 2MPMA 2XWJB 3FPPA 5IP9G 3AEVA 4EX5A 3MEFA 1W6JA 1IBMQ 4ULLA 3VYSA 2HCCA 2UXCL 3DM3A 3SGIA 5J1ZA 1CFMA 3R2IA 2KJXA 4IPCA 3DMUA 1IBKL 2OQ0A 2PNRC 1L0WA 1G51A 3DWQA 3S17B 5LL6X 3RZOB 4X66L 5I2XA 3KDFB 1D1KA 2L0CA 2JA5G 1CSQA 1NY4A 2B2TC 1STYA 1B4OA 3D31A 4XDXA 1RODA 4OO1G 4HR7B 4HCSA 4ZKBB 4ME3A 5JPNC 1HA6A 3NEMA 5CMDA 5C44B 1YJ9A 2EY1A 1VQLA 2YTYA 2ES2A 4OL7A 2DY7A 1S72A 4V0BA 2Z0SA 4RGTA 1Q1EA 1SYCA 2B2UA 3S1RB 5J39A 2WIIB 3CCVA 2DY8A 3BVGA 3SK5A 2XWBB 4IUNA 2UUCL 2DNCA 5BN4A 2FJ2A 3NWTA 1JJGA 3J81E 5LMUQ 1I50B 3MZ5A 1RCVD 4K0KL 1X3PA 5KNCA 2E74C 5M3FB 2F4IA 2JEBI 5JJZA 2PW7A 2G9DA 1UE7A 4ZYSA 1J8IA 3U4VA 4JI0Q 2YU9H 2RCNA 2K75A 1O7ZA 3NENA 5EQ0A 4DV1L 1QUQB 1G6ZA 1K3RA 3E0JA 1F9SA 4A3LH 1K0SA 5C0XI 3T1HL 3PO2G 2FMMA 4NKLA 3HOVH 2JA5B 1ET9A 2Z4HA 3WOFA 3CCUA 2JA8B 2VL6A 2EYPA 5LMNL 1F2ZA 1E2VA 2UU9Q 2B63G 4AH6A 1JWUD 4KK7A 2FINB 4GLVB 3K81C 1I3QH 1IKMA 4NXMQ 4LF7L 3LX0A 5E7NA 3HOYG 3I73A 3KDFA 2VS1A 1Q7YC 1PV4A 2X69A 5A2QE 2AHOB 1HPCA 1AH9A 2ZXRA 4JBWA 3BYTB 2NN6H 3R8BA 4HEDA 4JI0L 4HAEA 5ELFA 4QGUA 3KF6A 3NSWA 1HH2P 1GD7A 2WB1B 4DK1A 2CVRA 1X9NA 3BDLA 2QA4A 1GUGA 4LMQD 2A68D 1PZID 4LF6L 2NTTA 3AB9A 3GTPB 2Q2HA 2PMZB 1RTNA 2E2HB 3ERSX 1JB3A 4WORA 3J80E 1OXXK 4GKJQ 4JK1C 1HNZQ 2O5JC 3KLSX 3IRBA 4N8X1 1RKNA 1ICFB 2Z6KC 4XQNA 3GTOB 4BWGB 2E2IB 4LF5Q 5FLXc 2C9OA 4NXNL 4O42A 2AQ1B 3J7A5 2M9VA 3TP5A 3STBD 2PMZE 2NZOA 4EQNA 4OEMB 3H3VH 2UXDQ 4C3HH 2R7FA 5C44H 1ESRA 2AWNA 4GN4B 1PTOF 2B63B 1QJOA 1H9JA 3N6RA 1G91A 1YEZA 2DGYA 4YY3Q 4X62L 1AN8A 5DLQE 1PFMA 2LFNA 4OELB 1BUVT 4NMZA 2QKIC 1JC7A 1S40A 1SMYD 1NR2A 3W1BA 2BOSA 2A68C 2H5XA 1I4QA 4KKSA 4R4QA 1D5XC 1V43A 1X3GA 4HIMA 5KRUA 1K83B 1A6XA 1AW7A 4ABNA 4KY5A 2B8GA 4KTAA 1VQOA 3K5NA 3PIP3 1K3BC 1TS2A 2D5DA 2LXKA 4RHSA 1CZGA 4K14A 4DAYB 4C3IH 2D62A 3TZUA 3PO3H 1Q46A 1QNUA 4JI4L 2MP1A 3C1FA 1UAPA 3W5OA 1O7LA 1Q86C 5FLMH 4QF4A 2FXQA 4KHVA 2VUMH 4DR4Q 2K6AA 1MJCA 2RKSA 2CHBD 1VQHA 3L7ZC 5IYCG 1ILQA 2IL8A 3P7JA 1FR3A 2B2VA 1PVOA 3S1MH 2ZM6Q 1LTGD 1VQJA 4RCOA 1HQRD 2K5HA 3PIPA 3PGZA 3NWSA 1QVCA 3OMCA 1L1OB 4F88A 1F2LA 2CWPA 4LNQA 2WKCA 1S3OA 3S1NH 2VB2X 2F4VQ 4KN7C 3GTQH 1I6HB 3W1GA 2JEAI 1EIFA 3TEHB 2PQAA 1VQIA 1O78A 5FK9C 4DV4Q 2KOLA 3JAME 2KA7A 3BZKA 4PZ6A 4A3KG 4GOPA 1N33L 1MJEA 2F0DA 1DOLA 1SAPA 3Q8DA 2VB3X 4DR4L 3CAMA 3CHBD 3NBHB 1IYVA 2A69C 4R4TA 4R8IA 3G6EA 4JYAQ 1ML0D 4RMFA 4HJ9A 3G7LA 1O80A 3KJPA 4DR1L 1VDZA 1QB5D 4DV2L 3QOJA 1FVIA 1KC8C 3SE0A 2EDGA 2Q2UA 2UU9L 5EPJA 1R4PB 5LMNQ 2E2JB 4JV5L 1JOOA 4DR6Q 5T1IA 4IN3A 1RD9D 3STBC 5IP7G 2MHVA 1KRTA 1NNXA 2EXDA 3HZXA 4Z9CB 5EPKA 2EPBA 2A6HD 1E0BA 3PIO3 1TKWB 2N49A 2JXMB 1SE8A 3H0GB 2EIFA 5FKAC 3ICEA 5I6WA 1QG7A 2B39A 5EGTA 1EZ6A 1BXTA 3MAQA 2BA0A 2WV6D 5FLMG 3G71A 1VF5C 2VUMG 1SYGA 2Z1CA 4OIJA 5CV7A 2WB1G 4JI4Q 2A69D 4OWWB 4QIWB 1V1PB 4X66Q 3NK9A 4K6LA 1A3TA 1MGSA 4YWMA 3T51B 3DWAA 5FOBB 2KCNA 4DV0Q 2EYMA 2L4NA 4ID6A 1JR0D 2ZXPA 3KF8A 4LF4L 3I90A 4A3DH 2K5WA 1F77A 1FYCA 3S15B 1BBUA 1PTOH 1VQDA 1WCMH 2A6ED 3J7ZC 1OXTA 2LMCB 4N9PA 2Z8LA 3OIQA 1TWAB 2Z4IA 3GTMH 2NVTH 3TREA 4OHJA 4R1JA 2VY3A 1K8AC 2BA1A 3J81c 1STNA 2Q8RE 1JMCA 5IYDH 2IHEA 2O2LD 4HTHA 4NPSA 4JYAL 1KXLA 1EYAA 4RKLA 1SSOA 4ZQ3A 3WDNA 1Q82C 1EIGA 3KFUA 1DXMA 1NBWA 1P16A 4A3MB 1N8RC 4QL5A 1Y1WH 1C7YA 4DR3Q 3HOYH 1HQMC 1YITA 4DV5L 1VQ5A 2A19A 2B29A 4MZ9A 1E2ZA 3M4YA 2RA4A 4GKJL 3RD4A 5CGKA 4ODGA 1UUPA 3FVQA 3ZYYX 3CRLC 3TQYA 1G8ZD 5C3EH 2UUAL 4C56C 4XT3B 3J81L 4GZYC 3RZDH 1N33Q 1HXYD 1A63A 3DEOA 1T5XD 1Z6HA 4ILWA 3QG1A 1Y8NB 1PYWD 4OWTB 1WVLA 4K5WA 5KGUA 3CXCA 1WTXA 1T9HA 1XMQL 4IFDG 1EIHA 1XX8A 3S2DB 4JI2Q 3UE0A 1HFGA 1A62A 1O7YA 2WP8J 1I4PA 4P73A 5D3DA 2PW5A 3EROA 5J3BA 1EOTA 4K2KA 2F0WA 2XN9C 2B2WA 1RJTA 3K0XA 4C3HG 2BDNA 1PRTB 4DK3C 4P74A 5NUCA 1PYBA 3OMGA 4UY8C 1I4HA 3URYA 4BY1B 2N3SA 1PH8A 1VQCA 4PG3A 4JI8Q 1YNXA 1SBBB 3FPUB 1HRJA 2D2CC 1EEFD 1T5EA 2B3GA 3OTOL 3CKIB 3K7UC 1D8LA 3T1YQ 1C48A 2Y0SE 1SYDA 1LTAD 1K8MA 1O7IA 2B2TA 2ZJPA 4HJ7A 2OWOA 1J5EQ 1ZYRC 4UP7A 3HS0C 4JI1L 1VQ8A 1SDFA 3CCEA 4RFBA 4LF5L 3HOUB 1TWFH 5IWAL 2CFMA 3I7FA 1VQFA 2E76C 4UPAA 3X3NA 3D0FA 4DR5Q 3K7AB 5CV8A 2QDBA 1ASYA 5IT9L 1L0XB 2CCZA 3VYUA 1F9RA 3V05A 3A56A 5IYCH 4EQPA 1K73C 4LF9Q 2HT1A 4C3HB 3J7AV 2PQEA 5JVG3 3CW2C 3CPWA 1XTDA 1PRTD 2F52A 2VUMB 1IBKQ 2JP1A 2KQ3A 1B9NA 4IOCA 3EJIA 1SE3A 2ZJRA 4G7HC 1TVXA 3T53B 1VQKA 2K33A 1BF4A 1FNWA 1XPOA 3NUCA 1WTOA 3PO3B 2Y0SB 2Z6KA 1YHBA 2BDOA 3VA7A 4IPDA 3BS1A 4BXXH 1BCPD 1FNVA 2OXPA 2JA7G 2R7ZH 1EY4A 5G3LF 2Z6BA 2PQAB 2RCFA 4DK6C 3JAMc 4DR3L 4A75A 3L3OC 1VMCA 4DR2L 2F0PA 3OW2A 4K2LA 3WWVA 1MI2A 1H9KA 1KNAA 4UP9A 1JQYD 4HJ5A 1N36Q 1E1TA 5E4WC 3S1NB 2RDHA 4X6AH 1E1OA 2Q8TA 3VA5A 4ZLTF 1HZBA 2K32A 1Q8IA 3PUXA 2WAQG 3KLWA 3K6OA 4NXML 3M9BA 1RHPA 1Q8KA 4AYBB 4YCWA 1I94L 5KYIA 3LWUA 1IYJB 3OIPA 1GKHA 4KY7A 1A3VA 3R93A 1PRTC 3TN2A 3K59A 3JAMi 1SMYC 3QIAA 1XNRL 3GD7A 2XIWA 3FP9A 4GN3B 2F4VL 3FKIH 4P75A 2KHIA 2NZHA 1PA6A 5D3IB 2RVLA 4L5RC 3SHLA 3BU2A 1C8CA 2XTIA 2ICIA 4JI1Q 4A3GB 1Y1VH 5DEHA 3BZDB 1X32A 2L12A 5BN3A 1IZ6A 4IURA 4EGVA 5C3WA 1L1OA 2X6LA 3VR4A 5JVH3 4HN7A 1TWAH 3K80C 2K14A 1MBYA 1S5FD 1KDCA 4NB3A 2F0EA 1QWYA 4BXXG 4A3GG 3HEJA 4AYBG 2UUBL 1STGA 2BE5D 2XSCA 4WJWA 4LJZC 2NVXH 3C3LA 1IBLQ 3V2TA 1STHA 4LFAQ 5HGQA 5IYDG 5ELCA 4YY3L 4X62Q 4K8IA 4FYDA 1V1QA 1PH9A 1WTWA 1V1OA 1C9OA 1WI5A 2D0OA 5M3MB 2EQSA 4DR1Q 4JI2L 1XWEA 1TR5A 1CQFA 4ZAIA 5K36H 4DFAA 3F2UA 1TWCH 3H94A 3I4MB 4CGYB 3UDGA 2R93G 1IYUA 5EPLA 1L2FA 4MN3A 3FKIG 3I3CA 4HIKA 1L1OC 1H9SA 3A7AB 5C3EG 4BY7B 1LT4D 1HA5A 4TQUS 2O5IC 2VQFL 1BCPB 3LWEA 1BOSA 3UE1A 4A3EG 1XNRQ 2KENA 1Y1WB 2A8VA 4Y7NB 4DV5Q 1Q1BA 1NTGA 4IJLA 1TWGH 3GTGH 3CCMA 3M85A 2L11A 4DR7Q 2K5NA 1WOCA 3PIOA 3M4OH 1SE2A 1EY7A 1JOKA 3M3YB 4RAUC 4UAIA 1B70B 2F0IA 4IQZA 4E6IA 5C4JH 4OX9Q 4A93G 1HTLD 2AMCB 4IUUA 2F0TA 2KHJA 1JWMD 2F3WA 4KD4A 3FMCA 2IHFA 2J0TD 3FEWX 3NP8A 4RGOS 3QOLA 3I4NH 1Y14B 3S2DH 3T1HQ 1FL0A 2A73B 2GVBA 3MXNA 4TSSA 2R92H 4A3CH 4IJHA 4HSPA 4S3SA 4DV6Q 4JI6L 3PQIA 2ZTDA 5BR8L 5IYBG 4KHPQ 1EOVA 4GOPB 1ENFA 4DV4L 1F2MA 1YBYA 3VR3A 5CV4A 4XQJA 3GTLH 3D4DA 2PPBC 4R4OA 1IL2A 3EBEA 1RTOA 4DGZA 4B3TQ 3IAYA 2L55A 4PV1C 1XJVA 4APVA 2EYLA 1AE2A 1B3AA 2JJQA 3QWNA 4L63B 1U4LA 1YJWA 4YWKA 1LTSD 1WJJA 5ELDA 2RDGA 4RG1A 3ULJA 1PFSA 1TWHH 2I0QA 5FJ8G 1WFQA 3I91A 4A3EH 4KHPL 4DKAC 4L5QA 1J5EL 5KNBA 3K7AH 3I4MH 3CC7A 3MFGA 1HZAA 1SE4A 2RSOA 3KF6B 3K0YA 1CQVA 1EWIA 2OEOA 1VQMA 5EKKA 3ULPA 4XYQA 1M1KC 3HOUH 4ZK9B 1DD2A 1X56A 1HR0L 1D1IA 3L9AX 1HCZA 4A93H 1TQOA 3AYHB 4KD3A 1LO5D 4HJAA 1NR4A 1EU4A 2BH8A 1ET6A 4XQQA 1OTCA 1A2UA 2LSSA 4ZKCB 1VQ6A 1ESFA 1PH6A 1EY5A 4B9XA 3A8IE 5HY6A 4EVOA 5KNDA 3MTSA 3UDXA 3UI2A 5IYBH 3KOJA 4L8JA 2F0UA 5EKIA 2F0FA 2NB0A 1E2WA 1CSPA 4X3UA 1QOHA 1YNNC 1GUWA 5JEAJ 3QO2A 1Y69U 5E3FA 4A3KB 4A3DB 1XNQQ 1EY9A 1X6OA 4DNIA 4B3SQ 2HD3A 2F0HA 3SR1A 4Y7NH 5IP9H 2NBFA 3TSSA 4B3SL 1IW7C 3HG9A 4ZCKA 4FVMA 1Q81C 2SDFA 1G2TA 3S24A 2PI2E 1PH2A 1KDBA 2EY2A 2IT1A 2E2DC 3E0EA 4RGNA 2EXZA 3S14B 4JOIA 3J81i 4RA8A 2KVMA 3FKIB 5G3LD 1EUJA 4DR2Q 5C3EB 4BY7G 3BG3A 1GUTA 4H0LC 2PZUA 4LFCL 1FJGL 3Q6SA 4OO1H 4X64L 3RUZA 1JWSD 1NCVA 1ONLA 5IGCA 3S1QB 2BH2A 5C0XG 3I56A 4Q5VA 1AFPA 2RQXA 4IFDI 4N8FA 4LF7Q 2ID0A 1JE5A 4XXEA 2LY7A 3A74A 4YIJA 5ELEA 2MJ8A 4DXGA 1ZYRD 2EZVA 4A3BG 1F2YA 1M90C 4RKBA 3T13A 1S5CD 3R3OA 1PH3A 3I4OA 4UHVA 1Q3LA 3TMEA 4CJ1B 1HUNA 3ND8A 2TSSA 2E5LQ 2Q2IA 4CBVA 2F03A 1EEID 3D4WA 3KK7A 1M4VA 1UE6A 2EVBA 1EIYB 4FF4A 1IKLA 3FDTA 3PO2H 4CKEA 4KJNA 4HIOA 3RZOH 4O2DA 1PTOD 1X3QA 4P2CB 1DOMA 1GM5A 2L1BA 4J8QA 1CM9A 1YJNA 2ATWA 2B8FA 4PNYA 4KJOA 1EL0A 4LFAL 3NQIA
chains in the Genus database with same CATH topology
3OTOQ 2R6GA 4AIMA 2Y0SE 3CCSA 4GLAC 4B3RQ 2JA6G 3HKZE 4JI7L 4DR7L 1O7IA 1HR0Q 2ZJPA 1A0IA 4QJFA 4HJ7A 2OWOA 3M7NA 1J5EQ 4J15A 5M3MH 5JJKA 4A3LG 4A3BH 4FDBA 4UP7A 1QVFA 1VQNA 3HOWH 4JI1L 1B7YB 4GNXB 1VQ8A 1RIPA 1WCMG 3CCEA 1BKBA 3HOVG 4LF5L 2MO0A 1TWFH 4UP8A 4AQYQ 1XMQQ 5IWAL 4X65L 2CFMA 3I7FA 4YHHQ 1VQFA 4UPAA 4JI5L 1GO3E 3AEVA 5IP9G 3CQZH 4HJ8A 3D0FA 4DR5Q 4EX5A 3MEFA 3ZJYC 2E2HH 1ASYA 1U0LA 1IBMQ 5IE8A 2CCZA 3CC2A 4LF6Q 2IX1A 2GVAA 3CCRA 2UXCL 3DM3A 3SGIA 5IYCH 1K73C 4LF9Q 3CF5A 2HT1A 4XIGS 4IPCA 2CQOA 3U4ZA 1IBKL 2PI2A 3RLFA 2JEAI 2OQ0A 3GO5A 1HNXL 1L0WA 4A3IG 2YYZA 1G51A 3CW2C 1Y1WG 3CPWA 1XTDA 2F52A 4X66L 1IBKQ 3KDFB 1AE3A 2JA5G 1CSQA 4AYBE 4IOCA 1NY4A 2ZJRA 4POFA 1VQKA 1IXRA 2JA8H 3D31A 1G291 1JT8A 4OO1G 1Z47A 1SR3A 4A3CG 4ME3A 1XPOA 4QY7A 3NEMA 2Z6KA 3L2PA 1YJ9A 1NMGA 1VQLA 2YTYA 4XTCS 1YHBA 1S72A 2ES2A 4OX9L 3NELA 4IPDA 2Z0SA 4A3FG 1Q1EA 4BXXH 4LF9L 2NVQH 1LTLA 3H15A 1SROA 2OQKA 1PH4A 2JA7G 5GQOA 3CCVA 2R7ZH 2R93H 4LF8Q 2PQAB 4DK6C 3JAMc 4DV3Q 4DR3L 4A75A 1N34L 4DR2L 4DUYQ 3PUZA 3A5UA 1CKNA 4MNOA 3OW2A 1JJ2A 4GOPC 1N36Q 3WWVA 2UUCL 4UP9A 4HJ5A 1X3EA 1E1TA 2R7DA 3E9IA 1JJGA 1HZ9A 1VCIA 4X6AH 4JBMA 1C0AA 1E1OA 5C0XJ 5LMUQ 1CKNB 1VQ4A 4K0KL 1YHAA 5C4XH 4JCVE 2UUAQ 1HZBA 2JEBI 4BBSH 3PUXA 2WAQG 3KLWA 1UE7A 4NXML 3S17H 1K83H 1GVPA 3M9BA 4MTNA 4L5SA 1VQBA 1Q8KA 3A5ZB 4YCWA 3U4VA 1I94L 1IBML 2DUDA 1IYJB 5FJ8H 4JI0Q 2YU9H 2RCNA 2K75A 5IT9c 3GTJH 1GKHA 3PO3G 1SLJA 3NENA 4DV1L 1QUQB 1LM0A 1K3RA 1LUZA 3JAMi 3H0GG 5ELNA 4A3LH 2L15A 4JBJA 1XNRL 3GD7A 5C0XI 3FP9A 4GN3B 3T1HL 2F4VL 3PO2G 2VZAA 2RHQB 1G6PA 4GKKQ 3FKIH 4P75A 4TVAB 3UDFA 3HOVH 1X65A 3CCUA 2K50A 2KHIA 2NZHA 2VL6A 1PA6A 2JE6I 5LMNL 1KL9A 2UU9Q 1E22A 2WAQE 4L5RC 3F1ZA 4AH6A 4PZ7A 2B63G 3BU2A 2UUBQ 3HKZG 4GLVB 3HOUG 3K81C 1I3QH 4NXMQ 4LF7L 3CD6A 2XTIA 5E7NA 2JA7H 2R7ZG 3HOYG 3KDFA 1PV4A 2VS1A 1Q7YC 1VQ9A 2AHOB 4JI1Q 3KJOA 1Y1VH 2HHHQ 1AH9A 4JBWA 4JI0L 5M5WH 3KF6A 1Z9FA 4KLKA 4QGUA 1PHJA 2N78A 5K36G 1MIUA 1HH2P 1GD7A 3KF8B 1PYSB 3CCJA 1EQRA 1IZ6A 2IY5B 1X9NA 4DUYL 2QA4A 1J6QA 4LF6L 1L1OA 1R9TH 4WJ4A 3EIVA 2Q2HA 2YTVA 1KIXA 1HNZL 1TWAH 1W2BA 3K80C 2OTLA 3ERSX 2K14A 5EAYA 4NB3A 1VQEA 2KCTA 1OXXK 4LFCQ 3RLOA 1HR0W 1FJGQ 4GKJQ 4X64Q 1HNZQ 1I5FA 3PUWA 4BXXG 4A3GG 1N36L 3GTPH 4BY1G 3IRBA 4AYBG 2UUBL 1OXVA 5AJ3Q 4OWXB 1NMFA 4JC0A 2CWAA 2Z6KC 3RN5A 4JI3L 1I6HH 4YWLA 3M3YH 2NVXH 1YVCA 5GAGC 5FLXc 4LF5Q 4NXNL 3CPFA 1IBLQ 2JA5H 3J7A5 1KAWA 2JQOA 2WFWA 4A3JH 4YCUA 2PMZE 2NZOA 3STBD 4LFAQ 5HGQA 5IYDG 3H3VH 2C35B 2UXDQ 2LXJA 1VQGA 4C3HH 4YY3L 4X62Q 2R7FA 5C44H 1V1QA 4EQ5A 2AWNA 1PH9A 1C9OA 1WI5A 2D0OA 4GN4B 2EQSA 4BBRG 2VQEQ 4DR1Q 4BBSG 3BJUA 3LGJA 1Y1VG 2YV5A 4JI2L 1YEZA 2JA9A 2NN6G 5JJIA 2DGYA 4YY3Q 4X62L 1VQ7A 1OXSC 5DLQE 1YIJA 1N32L 3DLLA 3PUVA 3CMAA 1PH1A 1HNXQ 3PSIA 1TWCH 1X3FA 1S40A 1B8AA 3UDGA 2R93G 5LMUL 3W1BA 3JC66 4JI3Q 3HOXH 1CKMA 1L2FA 1JJCB 2H5XA 3FKIG 4R4QA 4HIKA 1L1OC 1V43A 1X3GA 5C3EG 2OTJA 4HIMA 4TQUS 2ZTCA 3G48A 4DR5L 1KQSA 2Q2TA 2HIXA 4ALPA 4DV2Q 2HHHL 4JI5Q 4R4CA 2VQFL 2PNHA 5GAHC 1IBLL 4A3GH 3UE1A 3GTOH 1VQPA 4A3EG 1VQOA 1XNRQ 2KENA 1K9MC 3H3VI 2A8VA 1N32Q 4DV5Q 2LXKA 5M5XH 2E5LL 2I5MX 3HOWG 1NTGA 1Q1BA 4IJLA 4L5TA 4DAYB 1TWGH 4C3IH 3GTGH 4KHZA 2D62A 3CCMA 3PO3H 1I50H 1FGUA 1Q46A 3I55A 3CCQA 3VDYA 2OCEA 5GAEC 3HFZB 3M85A 2UUCQ 4JI4L 4JI7Q 4DR7Q 2K5NA 1WOCA 4H02A 3PIOA 4BA2I 3M4OH 3W5OA 1QVGA 1Q86C 5C44G 4K0KQ 5FLMH 2VW9A 3S2HH 2FXQA 3PUYA 1SFOH 2VUMH 2E2IH 4DR4Q 1MJCA 2VNUD 1VQHA 1XMOQ 3L7ZC 5IYCG 4DUZQ 1B70B 5C4JH 3EN2A 2B63H 4OX9Q 4A93G 4QQBX 2AMCB 4IPHA 1PVOA 3S1MH 4LFBQ 2KHJA 2ZM6Q 1VQJA 1V9PA 2IHFA 2K5HA 3PIPA 3PGZA 1QVCA 1L1OB 2CWPA 4JG2A 4LNQA 4A3MG 3K8AA 1Y14B 1S3OA 3I4NH 3T1HQ 3S2DH 3KYHC 4B3RL 3S1NH 5JJLA 1FL0A 2GVBA 2F4VQ 4A3CH 2R92H 4IJHA 3GTQH 4DV6Q 3F2CA 3W1GA 4GLXA 2ZTDA 4JI6L 1EIFA 3TEHB 2PQAA 1PH7A 1VQIA 5IYBG 5BR8L 1QZGA 4YCVA 1N9WA 4B3ML 4DV4Q 1X54A 4KHPQ 3BZKA 2YTXA 4PZ6A 4A3KG 4GOPA 1N33L 4DV7L 1MJEA 1EOVA 4GOPB 1VS0A 4BY7H 3Q8DA 4DV4L 4B3TL 4GNXC 4DR4L 1YBYA 3CAMA 3NBHB 4R4TA 1XMOL 3GTLH 4R4OA 3G6EA 1IL2A 4JYAQ 3EBEA 3S16H 1CKOA 2RHSB 5JEAG 5M3MG 4RMFA 4B3TQ 1UWVA 4NXNQ 3HKSA 4C3JH 4HJ9A 1XJVA 4APVA 3KJPA 4DR1L 2UXCQ 1AE2A 2JJQA 2VQEL 3G4SA 4DV2L 3HOXG 1KC8C 1FVIA 1YJWA 3RNUA 1D7QA 4YWKA 2Q2UA 5C4XG 3U50C 1WJJA 2UU9L 5ELOA 2F3IA 3ER0A 4IO9A 5LMNQ 4JI6Q 1QUQA 4RG1A 4DV3L 5BR8Q 1SRUA 2HQLA 4LF8L 3ULJA 1YI2A 4JV5L 1PFSA 2K52A 2KCMA 4DR6Q 1TWHH 3STBC 5IP7G 1PH5A 1KRTA 2I0QA 4A76A 3AFQA 2EXDA 1QZHA 4LUVA 1ASZA 4A4IA 5FJ8G 1WFQA 5H1SE 4WJ3M 2I5LX 4JV5Q 3BZCA 4JOIC 4DR6L 4A3EH 4KHPL 2N49A 4DKAC 4L5QA 5AJ3L 1J5EL 3I4NG 1SE8A 3K7AH 3I4MH 3CC7A 4LFBL 1W3SA 2EIFA 4YHHL 1HZAA 2R92G 3J80i 4HIDA 3S1RH 3ICEA 4GNXA 1I94Q 4GS3A 1EYGA 4OO1I 2QGQA 3KF6B 4DUZL 1UE1A 2MQHA 1E3PA 1EWIA 2JA8G 2BA0A 1VQMA 4A3KH 3ULPA 1M1KC 1SMXA 5FLMG 3HOUH 3G71A 2VUMG 3J80c 2WB1E 2ZJQA 1X56A 1HR0L 2AWOA 3CCLA 2WB1G 4JI4Q 4POGA 1BVSA 2NN6I 4LW1A 1XNQL 3E9HA 4OWWB 5M3FH 3AYHB 4A93H 4X66Q 2IX0A 4HJAA 4P71A 5GADC 3F8TA 2BH8A 1OTCA 4PMWA 2LSSA 4DV6L 1VQ6A 1EFWA 1PH6A 4YWMA 3TS2A 4AQYL 1WYDA 3M4QA 3PF4A 5HY6A 3UDIA 2KBNA 4DV0Q 2HIVA 4C2MH 2I5HA 3M4PA 4QIWE 3UDXA 1E7ZA 1A8VA 3J81j 1UE5A 1YZ6A 2ZM6L 3B6YA 5IYBH 3KOJA 3PF5A 3GTKH 3MXNB 3OYYA 1XPRA 2Y0SG 2UXBQ 4LF4L 3HOZG 4A3DH 4GKKL 4BY1H 1CSPA 1Q12A 1BBUA 3CMEA 3I4MG 2ASBA 1VQDA 5JEAJ 1WCMH 2RF4A 4GN5A 1NJIC 3J7ZC 1OXTA 1X6OA 4DNIA 1XNQQ 4O0AA 4B3SQ 4Y52H 4Y7NH 3GTMH 2N8NA 2NVTH 3TREA 1U5KA 4R1JA 2VY3A 4DPGA 5IP9H 1K8AC 2BA1A 4DV7Q 4OXPA 3J81c 4A3JG 1YHQA 4B3MQ 3FHWA 5GROA 4B3SL 1JMCA 5IYDH 2IHEA 4NPSA 3TS0A 3AFPA 1Q81C 4JYAL 4DV0L 4LUZA 4KI0A 1KXLA 3ULLA 4BA1I 4DAMA 3S24A 2PI2E 1PH2A 1OXUA 3CP0A 2JA6H 1Q82C 2IT1A 4LUOA 3E0EA 5IWAQ 4X65Q 3AQQA 3KFUA 1NBWA 1P16A 2D0PA 4JOIA 3J81i 1N8RC 4LF4Q 4QL5A 4A3IH 4IFDJ 1K0RA 5IY0A 3GDEA 1Y1WH 2VQFQ 4DR3Q 1C7YA 3HOYH 1EUJA 1HJPA 4DR2Q 3S1QH 4BY7G 3F2DA 1CUKA 1YITA 4DV5L 1VQ5A 2A19A 2B29A 4MZ9A 4LFCL 1FJGL 1BBWA 3PCOB 1P8LA 4X64L 1KD1C 4GKJL 1HNWQ 3T1YL 3TQYA 5C3EH 2BH2A 5C0XG 2UUAL 4OONA 2MFIA 3I56A 3S15H 2JK8A 1JB7A 4A3DG 4IFDI 1TXYA 3RR5A 4LF7Q 1DGSA 3RZDH 1N33Q 2ID0A 3RLNA 1A63A 3A0JA 2MNAA 3F2BA 1JE5A 1HNWL 1HZCA 1LYLA 5IP7H 3A74A 5M3FG 4OWTB 4JI8L 3CXCA 1T9HA 2QEXA 1XMQL 1XPUA 4IFDG 2NVYH 4A3BG 1E24A 1X55A 4IOAA 4JI2Q 1M90C 2AKWB 3I2ZA 3UE0A 1H95A 2E2JH 1KHIA 1A62A 4LWCA 2UXBL 1PH3A 3I4OA 2WP8J 4P73A 1N34Q 3CC4A 3U58A 1SN8A 5J3BA 2E5LQ 3PV0A 2Q2IA 5LMNW 1KRSA 3K0XA 2ZTEA 2E8GA 4A3FH 3L0OA 4DK3C 4BBRH 4P74A 3HOZH 1NE3A 1RL2A 1UE6A 1PYBA 3H0GH 3RN2A 1EIYB 2MO1A 4UY8C 3TRZA 4IPGA 3PO2H 2XGTA 1MKHA 2N3SA 2K4KA 4HIOA 1EQQA 1VQCA 4O2DA 4PG3A 4JI8Q 4A3MH 1PH8A 3RZOH 3S14H 1YNXA 1K8GA 4PZ8A 4R4IA 1GM5A 1YJNA 2ATWA 2K5VA 5M5YH 2B3GA 2CKZB 4P72A 3OTOL 2ALYB 3K7UC 1VQAA 1UEBA 4JBKA 2V1CC 2UXDL 2A1AA 2GN5A 4DV1Q 4LFAL 1D8LA 3T1YQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OTO Q;  2R6G A;  4AIM A;  2Y0S E;  3CCS A;  4GLA C;  4B3R Q;  2JA6 G;  3HKZ E;  4JI7 L;  4DR7 L;  1O7I A;  1HR0 Q;  2ZJP A;  1A0I A;  4QJF A;  4HJ7 A;  2OWO A;  3M7N A;  1J5E Q;  4J15 A;  5M3M H;  5JJK A;  4A3L G;  4A3B H;  4FDB A;  4UP7 A;  1QVF A;  1VQN A;  3HOW H;  4JI1 L;  1B7Y B;  4GNX B;  1VQ8 A;  1RIP A;  1WCM G;  3CCE A;  1BKB A;  3HOV G;  4LF5 L;  2MO0 A;  1TWF H;  4UP8 A;  4AQY Q;  1XMQ Q;  5IWA L;  4X65 L;  2CFM A;  3I7F A;  4YHH Q;  1VQF A;  4UPA A;  4JI5 L;  1GO3 E;  3AEV A;  5IP9 G;  3CQZ H;  4HJ8 A;  3D0F A;  4DR5 Q;  4EX5 A;  3MEF A;  3ZJY C;  2E2H H;  1ASY A;  1U0L A;  1IBM Q;  5IE8 A;  2CCZ A;  3CC2 A;  4LF6 Q;  2IX1 A;  2GVA A;  3CCR A;  2UXC L;  3DM3 A;  3SGI A;  5IYC H;  1K73 C;  4LF9 Q;  3CF5 A;  2HT1 A;  4XIG S;  4IPC A;  2CQO A;  3U4Z A;  1IBK L;  2PI2 A;  3RLF A;  2JEA I;  2OQ0 A;  3GO5 A;  1HNX L;  1L0W A;  4A3I G;  2YYZ A;  1G51 A;  3CW2 C;  1Y1W G;  3CPW A;  1XTD A;  2F52 A;  4X66 L;  1IBK Q;  3KDF B;  1AE3 A;  2JA5 G;  1CSQ A;  4AYB E;  4IOC A;  1NY4 A;  2ZJR A;  4POF A;  1VQK A;  1IXR A;  2JA8 H;  3D31 A;  1G29 1;  1JT8 A;  4OO1 G;  1Z47 A;  1SR3 A;  4A3C G;  4ME3 A;  1XPO A;  4QY7 A;  3NEM A;  2Z6K A;  3L2P A;  1YJ9 A;  1NMG A;  1VQL A;  2YTY A;  4XTC S;  1YHB A;  1S72 A;  2ES2 A;  4OX9 L;  3NEL A;  4IPD A;  2Z0S A;  4A3F G;  1Q1E A;  4BXX H;  4LF9 L;  2NVQ H;  1LTL A;  3H15 A;  1SRO A;  2OQK A;  1PH4 A;  2JA7 G;  5GQO A;  3CCV A;  2R7Z H;  2R93 H;  4LF8 Q;  2PQA B;  4DK6 C;  3JAM c;  4DV3 Q;  4DR3 L;  4A75 A;  1N34 L;  4DR2 L;  4DUY Q;  3PUZ A;  3A5U A;  1CKN A;  4MNO A;  3OW2 A;  1JJ2 A;  4GOP C;  1N36 Q;  3WWV A;  2UUC L;  4UP9 A;  4HJ5 A;  1X3E A;  1E1T A;  2R7D A;  3E9I A;  1JJG A;  1HZ9 A;  1VCI A;  4X6A H;  4JBM A;  1C0A A;  1E1O A;  5C0X J;  5LMU Q;  1CKN B;  1VQ4 A;  4K0K L;  1YHA A;  5C4X H;  4JCV E;  2UUA Q;  1HZB A;  2JEB I;  4BBS H;  3PUX A;  2WAQ G;  3KLW A;  1UE7 A;  4NXM L;  3S17 H;  1K83 H;  1GVP A;  3M9B A;  4MTN A;  4L5S A;  1VQB A;  1Q8K A;  3A5Z B;  4YCW A;  3U4V A;  1I94 L;  1IBM L;  2DUD A;  1IYJ B;  5FJ8 H;  4JI0 Q;  2YU9 H;  2RCN A;  2K75 A;  5IT9 c;  3GTJ H;  1GKH A;  3PO3 G;  1SLJ A;  3NEN A;  4DV1 L;  1QUQ B;  1LM0 A;  1K3R A;  1LUZ A;  3JAM i;  3H0G G;  5ELN A;  4A3L H;  2L15 A;  4JBJ A;  1XNR L;  3GD7 A;  5C0X I;  3FP9 A;  4GN3 B;  3T1H L;  2F4V L;  3PO2 G;  2VZA A;  2RHQ B;  1G6P A;  4GKK Q;  3FKI H;  4P75 A;  4TVA B;  3UDF A;  3HOV H;  1X65 A;  3CCU A;  2K50 A;  2KHI A;  2NZH A;  2VL6 A;  1PA6 A;  2JE6 I;  5LMN L;  1KL9 A;  2UU9 Q;  1E22 A;  2WAQ E;  4L5R C;  3F1Z A;  4AH6 A;  4PZ7 A;  2B63 G;  3BU2 A;  2UUB Q;  3HKZ G;  4GLV B;  3HOU G;  3K81 C;  1I3Q H;  4NXM Q;  4LF7 L;  3CD6 A;  2XTI A;  5E7N A;  2JA7 H;  2R7Z G;  3HOY G;  3KDF A;  1PV4 A;  2VS1 A;  1Q7Y C;  1VQ9 A;  2AHO B;  4JI1 Q;  3KJO A;  1Y1V H;  2HHH Q;  1AH9 A;  4JBW A;  4JI0 L;  5M5W H;  3KF6 A;  1Z9F A;  4KLK A;  4QGU A;  1PHJ A;  2N78 A;  5K36 G;  1MIU A;  1HH2 P;  1GD7 A;  3KF8 B;  1PYS B;  3CCJ A;  1EQR A;  1IZ6 A;  2IY5 B;  1X9N A;  4DUY L;  2QA4 A;  1J6Q A;  4LF6 L;  1L1O A;  1R9T H;  4WJ4 A;  3EIV A;  2Q2H A;  2YTV A;  1KIX A;  1HNZ L;  1TWA H;  1W2B A;  3K80 C;  2OTL A;  3ERS X;  2K14 A;  5EAY A;  4NB3 A;  1VQE A;  2KCT A;  1OXX K;  4LFC Q;  3RLO A;  1HR0 W;  1FJG Q;  4GKJ Q;  4X64 Q;  1HNZ Q;  1I5F A;  3PUW A;  4BXX G;  4A3G G;  1N36 L;  3GTP H;  4BY1 G;  3IRB A;  4AYB G;  2UUB L;  1OXV A;  5AJ3 Q;  4OWX B;  1NMF A;  4JC0 A;  2CWA A;  2Z6K C;  3RN5 A;  4JI3 L;  1I6H H;  4YWL A;  3M3Y H;  2NVX H;  1YVC A;  5GAG C;  5FLX c;  4LF5 Q;  4NXN L;  3CPF A;  1IBL Q;  2JA5 H;  3J7A 5;  1KAW A;  2JQO A;  2WFW A;  4A3J H;  4YCU A;  2PMZ E;  2NZO A;  3STB D;  4LFA Q;  5HGQ A;  5IYD G;  3H3V H;  2C35 B;  2UXD Q;  2LXJ A;  1VQG A;  4C3H H;  4YY3 L;  4X62 Q;  2R7F A;  5C44 H;  1V1Q A;  4EQ5 A;  2AWN A;  1PH9 A;  1C9O A;  1WI5 A;  2D0O A;  4GN4 B;  2EQS A;  4BBR G;  2VQE Q;  4DR1 Q;  4BBS G;  3BJU A;  3LGJ A;  1Y1V G;  2YV5 A;  4JI2 L;  1YEZ A;  2JA9 A;  2NN6 G;  5JJI A;  2DGY A;  4YY3 Q;  4X62 L;  1VQ7 A;  1OXS C;  5DLQ E;  1YIJ A;  1N32 L;  3DLL A;  3PUV A;  3CMA A;  1PH1 A;  1HNX Q;  3PSI A;  1TWC H;  1X3F A;  1S40 A;  1B8A A;  3UDG A;  2R93 G;  5LMU L;  3W1B A;  3JC6 6;  4JI3 Q;  3HOX H;  1CKM A;  1L2F A;  1JJC B;  2H5X A;  3FKI G;  4R4Q A;  4HIK A;  1L1O C;  1V43 A;  1X3G A;  5C3E G;  2OTJ A;  4HIM A;  4TQU S;  2ZTC A;  3G48 A;  4DR5 L;  1KQS A;  2Q2T A;  2HIX A;  4ALP A;  4DV2 Q;  2HHH L;  4JI5 Q;  4R4C A;  2VQF L;  2PNH A;  5GAH C;  1IBL L;  4A3G H;  3UE1 A;  3GTO H;  1VQP A;  4A3E G;  1VQO A;  1XNR Q;  2KEN A;  1K9M C;  3H3V I;  2A8V A;  1N32 Q;  4DV5 Q;  2LXK A;  5M5X H;  2E5L L;  2I5M X;  3HOW G;  1NTG A;  1Q1B A;  4IJL A;  4L5T A;  4DAY B;  1TWG H;  4C3I H;  3GTG H;  4KHZ A;  2D62 A;  3CCM A;  3PO3 H;  1I50 H;  1FGU A;  1Q46 A;  3I55 A;  3CCQ A;  3VDY A;  2OCE A;  5GAE C;  3HFZ B;  3M85 A;  2UUC Q;  4JI4 L;  4JI7 Q;  4DR7 Q;  2K5N A;  1WOC A;  4H02 A;  3PIO A;  4BA2 I;  3M4O H;  3W5O A;  1QVG A;  1Q86 C;  5C44 G;  4K0K Q;  5FLM H;  2VW9 A;  3S2H H;  2FXQ A;  3PUY A;  1SFO H;  2VUM H;  2E2I H;  4DR4 Q;  1MJC A;  2VNU D;  1VQH A;  1XMO Q;  3L7Z C;  5IYC G;  4DUZ Q;  1B70 B;  5C4J H;  3EN2 A;  2B63 H;  4OX9 Q;  4A93 G;  4QQB X;  2AMC B;  4IPH A;  1PVO A;  3S1M H;  4LFB Q;  2KHJ A;  2ZM6 Q;  1VQJ A;  1V9P A;  2IHF A;  2K5H A;  3PIP A;  3PGZ A;  1QVC A;  1L1O B;  2CWP A;  4JG2 A;  4LNQ A;  4A3M G;  3K8A A;  1Y14 B;  1S3O A;  3I4N H;  3T1H Q;  3S2D H;  3KYH C;  4B3R L;  3S1N H;  5JJL A;  1FL0 A;  2GVB A;  2F4V Q;  4A3C H;  2R92 H;  4IJH A;  3GTQ H;  4DV6 Q;  3F2C A;  3W1G A;  4GLX A;  2ZTD A;  4JI6 L;  1EIF A;  3TEH B;  2PQA A;  1PH7 A;  1VQI A;  5IYB G;  5BR8 L;  1QZG A;  4YCV A;  1N9W A;  4B3M L;  4DV4 Q;  1X54 A;  4KHP Q;  3BZK A;  2YTX A;  4PZ6 A;  4A3K G;  4GOP A;  1N33 L;  4DV7 L;  1MJE A;  1EOV A;  4GOP B;  1VS0 A;  4BY7 H;  3Q8D A;  4DV4 L;  4B3T L;  4GNX C;  4DR4 L;  1YBY A;  3CAM A;  3NBH B;  4R4T A;  1XMO L;  3GTL H;  4R4O A;  3G6E A;  1IL2 A;  4JYA Q;  3EBE A;  3S16 H;  1CKO A;  2RHS B;  5JEA G;  5M3M G;  4RMF A;  4B3T Q;  1UWV A;  4NXN Q;  3HKS A;  4C3J H;  4HJ9 A;  1XJV A;  4APV A;  3KJP A;  4DR1 L;  2UXC Q;  1AE2 A;  2JJQ A;  2VQE L;  3G4S A;  4DV2 L;  3HOX G;  1KC8 C;  1FVI A;  1YJW A;  3RNU A;  1D7Q A;  4YWK A;  2Q2U A;  5C4X G;  3U50 C;  1WJJ A;  2UU9 L;  5ELO A;  2F3I A;  3ER0 A;  4IO9 A;  5LMN Q;  4JI6 Q;  1QUQ A;  4RG1 A;  4DV3 L;  5BR8 Q;  1SRU A;  2HQL A;  4LF8 L;  3ULJ A;  1YI2 A;  4JV5 L;  1PFS A;  2K52 A;  2KCM A;  4DR6 Q;  1TWH H;  3STB C;  5IP7 G;  1PH5 A;  1KRT A;  2I0Q A;  4A76 A;  3AFQ A;  2EXD A;  1QZH A;  4LUV A;  1ASZ A;  4A4I A;  5FJ8 G;  1WFQ A;  5H1S E;  4WJ3 M;  2I5L X;  4JV5 Q;  3BZC A;  4JOI C;  4DR6 L;  4A3E H;  4KHP L;  2N49 A;  4DKA C;  4L5Q A;  5AJ3 L;  1J5E L;  3I4N G;  1SE8 A;  3K7A H;  3I4M H;  3CC7 A;  4LFB L;  1W3S A;  2EIF A;  4YHH L;  1HZA A;  2R92 G;  3J80 i;  4HID A;  3S1R H;  3ICE A;  4GNX A;  1I94 Q;  4GS3 A;  1EYG A;  4OO1 I;  2QGQ A;  3KF6 B;  4DUZ L;  1UE1 A;  2MQH A;  1E3P A;  1EWI A;  2JA8 G;  2BA0 A;  1VQM A;  4A3K H;  3ULP A;  1M1K C;  1SMX A;  5FLM G;  3HOU H;  3G71 A;  2VUM G;  3J80 c;  2WB1 E;  2ZJQ A;  1X56 A;  1HR0 L;  2AWO A;  3CCL A;  2WB1 G;  4JI4 Q;  4POG A;  1BVS A;  2NN6 I;  4LW1 A;  1XNQ L;  3E9H A;  4OWW B;  5M3F H;  3AYH B;  4A93 H;  4X66 Q;  2IX0 A;  4HJA A;  4P71 A;  5GAD C;  3F8T A;  2BH8 A;  1OTC A;  4PMW A;  2LSS A;  4DV6 L;  1VQ6 A;  1EFW A;  1PH6 A;  4YWM A;  3TS2 A;  4AQY L;  1WYD A;  3M4Q A;  3PF4 A;  5HY6 A;  3UDI A;  2KBN A;  4DV0 Q;  2HIV A;  4C2M H;  2I5H A;  3M4P A;  4QIW E;  3UDX A;  1E7Z A;  1A8V A;  3J81 j;  1UE5 A;  1YZ6 A;  2ZM6 L;  3B6Y A;  5IYB H;  3KOJ A;  3PF5 A;  3GTK H;  3MXN B;  3OYY A;  1XPR A;  2Y0S G;  2UXB Q;  4LF4 L;  3HOZ G;  4A3D H;  4GKK L;  4BY1 H;  1CSP A;  1Q12 A;  1BBU A;  3CME A;  3I4M G;  2ASB A;  1VQD A;  5JEA J;  1WCM H;  2RF4 A;  4GN5 A;  1NJI C;  3J7Z C;  1OXT A;  1X6O A;  4DNI A;  1XNQ Q;  4O0A A;  4B3S Q;  4Y52 H;  4Y7N H;  3GTM H;  2N8N A;  2NVT H;  3TRE A;  1U5K A;  4R1J A;  2VY3 A;  4DPG A;  5IP9 H;  1K8A C;  2BA1 A;  4DV7 Q;  4OXP A;  3J81 c;  4A3J G;  1YHQ A;  4B3M Q;  3FHW A;  5GRO A;  4B3S L;  1JMC A;  5IYD H;  2IHE A;  4NPS A;  3TS0 A;  3AFP A;  1Q81 C;  4JYA L;  4DV0 L;  4LUZ A;  4KI0 A;  1KXL A;  3ULL A;  4BA1 I;  4DAM A;  3S24 A;  2PI2 E;  1PH2 A;  1OXU A;  3CP0 A;  2JA6 H;  1Q82 C;  2IT1 A;  4LUO A;  3E0E A;  5IWA Q;  4X65 Q;  3AQQ A;  3KFU A;  1NBW A;  1P16 A;  2D0P A;  4JOI A;  3J81 i;  1N8R C;  4LF4 Q;  4QL5 A;  4A3I H;  4IFD J;  1K0R A;  5IY0 A;  3GDE A;  1Y1W H;  2VQF Q;  4DR3 Q;  1C7Y A;  3HOY H;  1EUJ A;  1HJP A;  4DR2 Q;  3S1Q H;  4BY7 G;  3F2D A;  1CUK A;  1YIT A;  4DV5 L;  1VQ5 A;  2A19 A;  2B29 A;  4MZ9 A;  4LFC L;  1FJG L;  1BBW A;  3PCO B;  1P8L A;  4X64 L;  1KD1 C;  4GKJ L;  1HNW Q;  3T1Y L;  3TQY A;  5C3E H;  2BH2 A;  5C0X G;  2UUA L;  4OON A;  2MFI A;  3I56 A;  3S15 H;  2JK8 A;  1JB7 A;  4A3D G;  4IFD I;  1TXY A;  3RR5 A;  4LF7 Q;  1DGS A;  3RZD H;  1N33 Q;  2ID0 A;  3RLN A;  1A63 A;  3A0J A;  2MNA A;  3F2B A;  1JE5 A;  1HNW L;  1HZC A;  1LYL A;  5IP7 H;  3A74 A;  5M3F G;  4OWT B;  4JI8 L;  3CXC A;  1T9H A;  2QEX A;  1XMQ L;  1XPU A;  4IFD G;  2NVY H;  4A3B G;  1E24 A;  1X55 A;  4IOA A;  4JI2 Q;  1M90 C;  2AKW B;  3I2Z A;  3UE0 A;  1H95 A;  2E2J H;  1KHI A;  1A62 A;  4LWC A;  2UXB L;  1PH3 A;  3I4O A;  2WP8 J;  4P73 A;  1N34 Q;  3CC4 A;  3U58 A;  1SN8 A;  5J3B A;  2E5L Q;  3PV0 A;  2Q2I A;  5LMN W;  1KRS A;  3K0X A;  2ZTE A;  2E8G A;  4A3F H;  3L0O A;  4DK3 C;  4BBR H;  4P74 A;  3HOZ H;  1NE3 A;  1RL2 A;  1UE6 A;  1PYB A;  3H0G H;  3RN2 A;  1EIY B;  2MO1 A;  4UY8 C;  3TRZ A;  4IPG A;  3PO2 H;  2XGT A;  1MKH A;  2N3S A;  2K4K A;  4HIO A;  1EQQ A;  1VQC A;  4O2D A;  4PG3 A;  4JI8 Q;  4A3M H;  1PH8 A;  3RZO H;  3S14 H;  1YNX A;  1K8G A;  4PZ8 A;  4R4I A;  1GM5 A;  1YJN A;  2ATW A;  2K5V A;  5M5Y H;  2B3G A;  2CKZ B;  4P72 A;  3OTO L;  2ALY B;  3K7U C;  1VQA A;  1UEB A;  4JBK A;  2V1C C;  2UXD L;  2A1A A;  2GN5 A;  4DV1 Q;  4LFA L;  1D8L A;  3T1Y Q; 
#chains in the Genus database with same CATH topology
 3OTO Q;  2QIL A;  1PRT F;  2LKV A;  3CCS A;  4GLA C;  4B3R Q;  2L9H A;  4JI7 L;  3M4O B;  3BVM A;  2IPK D;  2EOT A;  1BCP C;  4K8J A;  1K28 A;  1S5E D;  4QJF A;  5L37 A;  3M7N A;  1H9S B;  2NZ1 D;  5M3M H;  2B2W C;  1ZEQ X;  2K03 A;  4FDB A;  1QVF A;  4K5V A;  4GNX B;  1RIP A;  4A3F B;  4AQY Q;  3O13 A;  4X65 L;  2CQA A;  4YHH Q;  4JI5 L;  1GO3 E;  3CQZ H;  4HJ8 A;  3FRP B;  2IX3 A;  1GOZ A;  2E2H H;  2L5T A;  1U0L A;  3CC2 A;  2GVA A;  1IW7 D;  3CF5 A;  1MHW C;  3E3X A;  2PI2 A;  1HNX L;  1B44 D;  4A3I G;  4UDU C;  1PTO C;  4F8M A;  4DN4 M;  5KEE A;  1AE3 A;  5DM7 3;  3TBI B;  2JA8 H;  3P20 A;  1I3Q B;  1SR3 A;  4A3C G;  2F0J A;  4C3J B;  4CKB A;  4QY7 A;  5ELB A;  3L2P A;  1NMG A;  4XTC S;  3IFD A;  5AFW A;  4OX9 L;  3NEL A;  3HP3 A;  2BCO A;  3T4A C;  4LF9 L;  2NVQ H;  1LTL A;  3H15 A;  3QJY A;  5EBD A;  5GQO A;  3GTK B;  4FXD A;  2FFK B;  4OIK A;  4C1N K;  1WTH A;  4DUY Q;  4IAL A;  3A5U A;  1CKN A;  3NQT A;  2D9U A;  1F9P A;  5I2Y A;  3MWY W;  2R7D A;  4PMC A;  2R7Z B;  1HZ9 A;  1VCI A;  5I6Y A;  1EY0 A;  2DN8 A;  4JBM A;  1C0A A;  5C0X J;  3U9O A;  5CBE E;  1VQ4 A;  1EQV A;  2UUA Q;  4G4K A;  4BBS H;  1K83 H;  1DZ1 A;  2OF1 A;  1VQB A;  5LHY 1;  1D6E C;  3A5Z B;  2DUD A;  5FJ8 H;  3MHB A;  5IT9 c;  2R3Z A;  3GTJ H;  2A6H C;  3PO3 G;  1SLJ A;  1B2T A;  3OPO A;  4HMI A;  4I65 A;  1LUZ A;  3HGB A;  5IGG A;  1U9R A;  2PZW A;  3H0G G;  5ELN A;  2L15 A;  4JBJ A;  4RH6 A;  4DA2 A;  2HUG A;  2VZA A;  1G6P A;  2K50 A;  4KY6 A;  3OW7 A;  1SJH D;  1E22 A;  2K5Q A;  3F1Z A;  4BBR B;  4PZ7 A;  4KMU C;  2UUB Q;  2ZT9 C;  3HKZ G;  5JPM C;  3HOU G;  3GV6 A;  3CD6 A;  3OWE B;  4IUP A;  1I4G A;  3TP7 A;  1ENA A;  1VQ9 A;  2NTS A;  3KJO A;  3S1M B;  4G57 A;  1NAP A;  1Z9F A;  2WAQ B;  1MIU A;  2Z9H A;  3I8Z A;  1BR9 A;  3KF8 B;  1PYS B;  3K5O A;  1EQR A;  4XYO A;  1WTP A;  2ICE C;  3QB3 A;  1J6Q A;  4J6H A;  4Q0F A;  3VYT A;  4WJ4 A;  2K05 A;  4FXG C;  1W2B A;  5I9O A;  1XYI A;  3OHX C;  2P5Z X;  2KCT A;  4LFC Q;  1FJG Q;  1HR0 W;  4DAY A;  1I5F A;  3PUW A;  4CJ2 C;  2YU9 B;  2H4O A;  1EYC A;  4R8N A;  3J7A F;  4JC0 A;  2F0K A;  2CWA A;  3RN5 A;  1ZXT A;  4JI3 L;  1I6H H;  4WFN 3;  2NWG A;  3KBG A;  3K57 A;  2KUM A;  5T1G A;  2JA7 B;  3CPF A;  2JA5 H;  1KAW A;  2JQO A;  2EJG C;  1B50 A;  1Q90 A;  1HFN A;  2C35 B;  2LXJ A;  1VQG A;  3A54 A;  3VR6 A;  2NVX B;  2VQE Q;  4BBR G;  4BBS G;  5IT9 E;  3BJU A;  4FXK C;  2EJM A;  3HRZ C;  5M5Y B;  2JA9 A;  1CTM A;  2NN6 G;  3TP8 A;  1VQ7 A;  1OXS C;  2CW0 D;  5IOC A;  1N32 L;  3DLL A;  3PUV A;  3CMA A;  1HNX Q;  2EJF C;  3PSI A;  3I4L A;  1B8A A;  2M00 A;  3ONA B;  1ZKO A;  3JC6 6;  1JJC B;  2JYO A;  2PYK A;  2QF7 A;  1DJR D;  4ALP A;  4DV2 Q;  3EA6 A;  2HHH L;  4JI5 Q;  1DYQ A;  5GAH C;  5E4X A;  3Q23 A;  3QR8 A;  3C1E A;  1VQP A;  1CHQ D;  2J7Z A;  1ENC A;  3MFY A;  1LAB A;  1K9M C;  3JAM L;  3DEP A;  1N32 Q;  2HQE A;  3MXU A;  2GA4 B;  2I5M X;  5M5X H;  3HOW G;  1LTT D;  3GP7 A;  3OOC A;  4L5T A;  1FGB D;  4KHZ A;  1FGU A;  1GJX A;  3VYR A;  4JI7 Q;  3NTK A;  3HOV B;  4N9T A;  4JVZ A;  4H02 A;  3H6M A;  4BA2 I;  5C44 G;  3H3V C;  4K0K Q;  2VW9 A;  1SFO H;  3PUY A;  2E2I H;  2VNU D;  2R93 B;  3P75 A;  1JIC A;  4DUZ Q;  2B63 H;  2K7V A;  4QQB X;  1EFI D;  1PLF A;  4BBS B;  2V4D A;  1LTB D;  4IPH A;  2K5D A;  4LFB Q;  3BDO A;  1QNK A;  5JAV A;  1RDP D;  1V9P A;  5I4D A;  3DUZ A;  2ENB A;  4B3R L;  1S4Z A;  2XRS D;  2MUY A;  4PMB A;  5JJL A;  3MEH A;  4GLX A;  3MC0 B;  1QZG A;  1LTR D;  1N9W A;  1X54 A;  1PTO B;  1VS0 A;  3MXP A;  4B3T L;  4GNX C;  1KNE A;  2EE1 A;  1XMO L;  1V8Q A;  3KLS A;  4QB4 A;  4C3I G;  1G2S A;  2XRQ D;  5FO7 B;  3S16 H;  1CKO A;  5I9P A;  2A6E C;  4CDE C;  5M3M G;  5JEA G;  3PO2 B;  3HKS A;  1WTV A;  2UXC Q;  2VXW A;  2H1E A;  3G4S A;  1S5D D;  3NBI A;  1D7Q A;  2AQ3 B;  5C4X G;  3U50 C;  3NTI A;  3KLR A;  3ER0 A;  4JI6 Q;  1SYF A;  4DV3 L;  1SRU A;  1QIL A;  2SOB A;  4LF8 L;  1YI2 A;  1HHV A;  3NTH A;  1KLG D;  3NXW A;  1PH5 A;  4A76 A;  3AFQ A;  1ASZ A;  4LUV A;  2F0S A;  5H1S E;  4WJ3 M;  4JV5 Q;  5HGT A;  3VR5 A;  5DAU A;  4DU9 A;  4LFB L;  1GUO A;  3GTM B;  1KLU D;  2EYF A;  3J80 i;  2M2L A;  4HID A;  3S1R H;  1UNS A;  4C1N I;  2IJ0 A;  4DUZ L;  2JA8 G;  5K5P A;  3M7G A;  4A3K H;  1SMX A;  3NHH A;  3MA2 B;  2EY5 A;  1SNQ A;  2AWO A;  5F2D A;  3CCL A;  5IGB A;  3D6W A;  4POG A;  1U4R A;  2NN6 I;  3CQZ B;  5KIX A;  3E9H A;  1XNQ L;  5M3F H;  2IX0 A;  1OO9 B;  4P71 A;  1HUM A;  2XVS A;  5M9O A;  4DV6 L;  2CH4 W;  4DAP A;  4TKO B;  2KBN A;  5EBC A;  4A3J B;  4B9W A;  4C2M H;  2I5H A;  4QIW E;  3J81 j;  1E7Z A;  1AZQ A;  1UE5 A;  1YZ6 A;  1GHK A;  3GTK H;  3PF5 A;  3MXN B;  1XPR A;  2UXB Q;  2Y0S G;  4G7O C;  3HOZ G;  4DNR B;  5COR A;  4BY1 H;  3DHQ A;  1Q12 A;  1PDQ A;  2HCI A;  3CME A;  2ASB A;  1H9R A;  2WIN B;  2RF4 A;  1NJI C;  4DF7 A;  5EJW A;  4Y52 H;  1A15 A;  1D5M C;  1PFN A;  1U5K A;  4OXP A;  4A3J G;  4B3M Q;  3FHW A;  4DXF A;  4FO2 A;  2K04 A;  1CA5 A;  5IGE A;  3TS0 A;  1DON A;  4KI0 A;  2J4X A;  3ULL A;  1OXU A;  4LUO A;  4JW0 A;  1HNW Q;  4X65 Q;  2D0P A;  4DAV A;  1PXU A;  4LF4 Q;  5IY0 A;  1A2T A;  2VQF Q;  2C5C A;  3S1Q H;  1W6K A;  3F2D A;  3SK6 A;  3WOE A;  3VR2 A;  5CV5 A;  1P8L A;  4BS9 A;  1TS3 A;  2MFI A;  3CRK C;  3S9W A;  2JK8 A;  1PFB A;  2QEJ C;  4A3D G;  3D6C A;  1TXY A;  1AEX A;  1LAC A;  1STB A;  3AMU A;  2KED A;  1SNO A;  3RLN A;  3A0J A;  3OSO A;  1WD0 A;  1HNW L;  1HZC A;  2NVY B;  1LYL A;  5IP7 H;  5M3F G;  5D14 A;  1PMR A;  2QEX A;  2F0L A;  2JA6 B;  1E24 A;  1X55 A;  1YNJ D;  1H95 A;  2EYJ A;  5EKL A;  5A35 A;  1QE6 A;  2A74 C;  4H44 C;  3SK4 A;  1N34 Q;  3CC4 A;  1SN8 A;  1TS4 A;  1SND A;  3PV0 A;  2CH4 A;  4A3F H;  2PZT A;  3L0O A;  3T16 A;  1XTC D;  1SEB D;  4BBR H;  3RMH A;  3HOZ H;  2QW7 A;  3BYY B;  3RN2 A;  2AUJ D;  1BO0 A;  3DXJ C;  4FF1 A;  3TRZ A;  1MKH A;  3S2H B;  4A3M H;  3IKJ A;  1S5B D;  2XNA C;  2F0G A;  3HOY B;  4PZ8 A;  4R4I A;  1WCM B;  4IUT A;  2MGS A;  2K5V A;  5M5Y H;  3BDC A;  1VQA A;  4C2M B;  2V1C C;  2UXD L;  2A1A A;  4DV1 Q;  4FF2 A;  1PZJ D;  3A7L A;  4ZUJ A;  3A8K E;  2R6G A;  4AIM A;  4KKU A;  3DWP A;  4QCL A;  4A3B B;  2F0Q A;  4DR7 L;  3N52 A;  1A0I A;  4MIU A;  1SJE D;  1DM0 B;  4IFD H;  2PCF B;  4O1N A;  3CU7 A;  4U67 3;  1GUN A;  3HOW H;  1B7Y B;  3A8J E;  4M1U B;  1WCM G;  1K8O A;  4LAA A;  1XMQ Q;  1B9M A;  2NYZ D;  4MHE A;  4EQO A;  4DNT B;  5C3X A;  3K5M A;  3ZJY C;  3NE5 B;  4XT1 B;  1IL8 A;  5IE8 A;  4LF6 Q;  2IX1 A;  3CCR A;  1ICW A;  4XIG S;  1U4P A;  3U4Z A;  2CQO A;  3RLF A;  1MD2 D;  3GO5 A;  3PMF A;  2YYZ A;  1Y1W G;  5M5X B;  4G7Z C;  1ILP A;  5BN5 A;  2B2Y A;  4CDC C;  4AYB E;  3Q22 A;  1L0Y B;  4POF A;  1IXR A;  1G29 1;  1F9Q A;  2JSO A;  1JT8 A;  2NVQ B;  1Z47 A;  1STA A;  2QDL A;  5DNF A;  1DOK A;  4KKT A;  4H13 C;  4L6T B;  3D3R A;  1EQT A;  4A3F G;  1PH4 A;  1SRO A;  2OQK A;  1SFO B;  2R93 H;  4LF8 Q;  1TII D;  5KYL A;  4DV3 Q;  1N34 L;  3PUZ A;  4MNO A;  1JJ2 A;  5JEA H;  5A2Q L;  4GOP C;  4RGM A;  1X3E A;  3E9I A;  3MVV A;  1MSG A;  1M8A A;  5FO9 B;  1CKN B;  1YHA A;  5C4X H;  4JCV E;  4A3I B;  4R9W A;  5IIF A;  3W3A A;  3S17 H;  1GVP A;  4MTN A;  4L5S A;  1JE4 A;  1IBM L;  1FD7 D;  2CW0 C;  3U9S A;  1LT6 D;  4X3T A;  2KHS A;  1LM0 A;  1AZP A;  2FMC A;  5HUR A;  1LT3 D;  2RHQ B;  4GKK Q;  4TVA B;  3UDF A;  3E5S A;  1X65 A;  2JE6 I;  5LL6 S;  1KL9 A;  1TWF B;  1II3 A;  2WAQ E;  5ISR A;  1D2B A;  4M8A A;  1GXD C;  4ZUI A;  1CHP D;  2JA7 H;  2R7Z G;  2SEB D;  4RCN A;  2HHH Q;  4FNF A;  1LT5 D;  3OWF A;  4I7A A;  5M5W H;  4KLK A;  1B53 A;  4X3S A;  2N78 A;  1PHJ A;  5K36 G;  4QMG A;  1LTI D;  1SXT A;  3ND9 A;  3CCJ A;  2F0M A;  2RBM A;  2IY5 B;  4DUY L;  2EYO A;  1CA6 A;  3V96 A;  1R9T H;  3EIV A;  2YTV A;  1KIX A;  1HNZ L;  2OTL A;  4ME5 A;  1GUS A;  5EAY A;  1VQE A;  3RLO A;  4X64 Q;  1N36 L;  3GTP H;  4BY1 G;  1OXV A;  4H7B A;  4OGQ C;  5COY A;  5CBA E;  2HDM A;  5AJ3 Q;  4OWX B;  1NMF A;  2G5D A;  1STE A;  4YWL A;  2KEE A;  3M3Y H;  1YVC A;  5GAG C;  2SNS A;  1JOR A;  3K5L A;  5DM6 3;  2WFW A;  4A3J H;  4YCU A;  5C5L A;  2SNM A;  3NBH A;  5CV9 A;  1EWC A;  4EQ5 A;  5C4J B;  3LGJ A;  1Y1V G;  2YV5 A;  5IGD A;  2K28 A;  3Q0A A;  5C4Z A;  5IOD A;  1YIJ A;  3G6J B;  1PH1 A;  1KDA A;  4F7X A;  5JOB A;  4C3J G;  3RZD B;  1X3F A;  5LMU L;  4JI3 Q;  3HOX H;  1CKM A;  1H9M A;  1KAA A;  2KEC A;  2OTJ A;  1TWH B;  1VMP A;  1KQS A;  2ZTC A;  3G48 A;  4DR5 L;  2Q2T A;  2HIX A;  4R4C A;  1BQQ T;  2PNH A;  1IBL L;  4A3G H;  3GTO H;  4NW2 A;  1JOQ A;  4WRD A;  3C46 A;  1D5Z C;  4CHT B;  4HMJ A;  4JPB W;  1LLR D;  3P1H A;  3H3V I;  2N88 A;  2K1B A;  2E5L L;  1EYD A;  1B1Z A;  2G9H D;  1I50 H;  2F1M A;  3VDY A;  3I55 A;  3CCQ A;  1NUC A;  2OCE A;  5GAE C;  3HFZ B;  2UUC Q;  1TY2 A;  2AQ2 B;  3EQL C;  1QVG A;  3S2H H;  1EY8 A;  1V1P A;  1XMO Q;  2OT2 A;  5FLX L;  2DNE A;  3EN2 A;  4X3K A;  1MSH A;  2ZXO A;  1C4Q A;  4QUC A;  3TDQ A;  5CV6 A;  4JG2 A;  4A3M G;  2F0O A;  3K8A A;  2PO4 A;  3ERQ A;  3KYH C;  4IZ8 A;  1KAB A;  4U68 A;  1R4Q B;  3E6Z X;  3F2C A;  3GV3 A;  1PH7 A;  1VF7 A;  2F0V A;  2RSN A;  4YCV A;  4B3M L;  4IUQ A;  3S16 B;  4K6D A;  2YTX A;  4DV7 L;  3C2P A;  1UEA B;  4MTK A;  4BY7 H;  3SEB A;  1YNN D;  4B08 A;  1I4X A;  2RHS B;  4NXN Q;  1SYB A;  1UWV A;  4C3J H;  5IGF A;  1I4R A;  4HSV A;  2B2V C;  2LS0 1;  2VQE L;  5M5W B;  1XXG A;  3HOX G;  3RNU A;  3J80 L;  1WTR A;  5ELO A;  2F3I A;  4IO9 A;  1QUQ A;  5BR8 Q;  2HQL A;  1Y8P B;  2K52 A;  2KCM A;  1I6V C;  2QCP X;  1QZH A;  3J7Y W;  4A4I A;  3H91 A;  2I5L X;  5FO8 B;  3BZC A;  4JOI C;  4DR6 L;  2FHT A;  1YNJ C;  1TS5 A;  3I4N G;  5AJ3 L;  1W3S A;  4YHH L;  2R92 G;  1B3Q A;  4GNX A;  1I94 Q;  4GS3 A;  1EYG A;  4OO1 I;  4HCE A;  2QGQ A;  5CYU A;  1UE1 A;  2MQH A;  1E3P A;  1Z7T A;  5CC4 A;  4FF3 A;  3HOW B;  1EWH A;  2WKD A;  4CDF C;  4CDD C;  1CI3 M;  3GTJ B;  3J80 c;  2WB1 E;  2ZJQ A;  2HDL A;  1BVS A;  4LW1 A;  2F0N A;  2IW3 A;  5GAD C;  3I4N B;  3F8T A;  4CKC A;  4PMW A;  3BVZ A;  3I72 A;  4RHR A;  1EFW A;  3TS2 A;  4AQY L;  1WYD A;  3M4Q A;  3GTL B;  3PF4 A;  3EVQ A;  1PZK D;  3UDI A;  1EZ8 A;  2HIV A;  1WTQ A;  3M4P A;  3HOX B;  1A8V A;  1LV9 A;  2ZM6 L;  3B6Y A;  3W2D A;  1TU2 B;  5C0X H;  2Q8I B;  3OYY A;  2BE5 C;  4GKK L;  3EFX D;  1BBX C;  5TSS A;  2NVT B;  3KUP A;  2R61 A;  3I4M G;  1FNU A;  5C4H A;  4F87 A;  1DCZ A;  2O4X A;  4GN5 A;  4O0A A;  3LNN A;  2N8N A;  5E1F A;  1Y1V B;  4DPG A;  4DV7 Q;  1YHQ A;  2R92 B;  1AP0 A;  2I07 B;  4J1M A;  5GRO A;  2I46 A;  2IWH A;  2EY6 A;  4LK1 C;  3AFP A;  1HTP A;  3NPP A;  3D4R A;  4DV0 L;  3MXG A;  4LUZ A;  4BA1 I;  4DAM A;  3HKZ B;  2JA6 H;  1IHZ A;  3CP0 A;  4QUF A;  4IUV A;  4A3E B;  5JJI A;  5IWA Q;  3AQQ A;  1CT1 D;  4IFD J;  4A3I H;  5C4X B;  1K0R A;  1J9O A;  3GDE A;  3SXH A;  1HJP A;  4I7Z C;  1CUK A;  1CK1 A;  4K5X A;  1TT2 A;  4NDX A;  1SNP A;  2DJG C;  5D65 A;  2JN4 A;  1BBW A;  3PCO B;  1KD1 C;  1KTK A;  3SDZ A;  3HOZ B;  3GQB A;  4CJ0 B;  3T1Y L;  1CZW A;  2NUC A;  2B2Y C;  4OON A;  3S15 H;  1SNC A;  2EYH A;  4C3I B;  1JB7 A;  2RDF A;  1TWC B;  1Y8O B;  3RR5 A;  1DGS A;  3TP6 A;  3TZD A;  3Q24 A;  1EY6 A;  1SYE A;  2MNA A;  1SNM A;  3F2B A;  4JI8 L;  2DJF C;  3T56 B;  1XPU A;  1RF2 D;  3IL8 A;  2NVY H;  3K58 A;  4IOA A;  1NSN S;  2AKW B;  3I2Z A;  3R2T A;  1U4M A;  2E2J H;  1KHI A;  2UXB L;  4LWC A;  1BNZ A;  4PQX A;  4V19 0;  2TMP A;  1QCB D;  3U58 A;  4DK0 A;  3AU7 A;  5LMN W;  1KRS A;  2ZTE A;  2E8G A;  5C6A A;  1GHJ A;  5J22 A;  1R9T B;  3X3M A;  4A93 B;  3GTQ B;  1A3U A;  1NE3 A;  3SK8 A;  1RL2 A;  3H0G H;  2MO1 A;  2B2U C;  4IPG A;  2K4K A;  2XGT A;  1EQQ A;  3S14 H;  2X6G A;  1K8G A;  5CR3 A;  1BDO A;  3D8G A;  3DM1 A;  2K01 A;  3I70 A;  2CKZ B;  2F3V A;  2WAC A;  4P72 A;  2ALY B;  3ITP A;  1UEB A;  3KBX A;  1TWG B;  4JBK A;  3GTG B;  5C5M A;  2GN5 A;  3IFT A;  2AUK A;  5FLX E;  3A55 A;  4RWS C;  4ZRZ A;  2KCC A;  2JA6 G;  3HKZ E;  4KV6 A;  1HR0 Q;  4FP5 D;  1JCK B;  4J15 A;  2A5H A;  1TY0 A;  5JJK A;  3H09 A;  4A3L G;  4NP5 A;  4A3B H;  1EU3 A;  1VQN A;  3SVM A;  1BKB A;  3HOV G;  2MO0 A;  4UP8 A;  4KN4 C;  4TRD A;  1BCP F;  2E75 C;  2N55 A;  1WD1 A;  2MPM A;  2XWJ B;  3FPP A;  5IP9 G;  3AEV A;  4EX5 A;  3MEF A;  1W6J A;  1IBM Q;  4ULL A;  3VYS A;  2HCC A;  2UXC L;  3DM3 A;  3SGI A;  5J1Z A;  1CFM A;  3R2I A;  2KJX A;  4IPC A;  3DMU A;  1IBK L;  2OQ0 A;  2PNR C;  1L0W A;  1G51 A;  3DWQ A;  3S17 B;  5LL6 X;  3RZO B;  4X66 L;  5I2X A;  3KDF B;  1D1K A;  2L0C A;  2JA5 G;  1CSQ A;  1NY4 A;  2B2T C;  1STY A;  1B4O A;  3D31 A;  4XDX A;  1ROD A;  4OO1 G;  4HR7 B;  4HCS A;  4ZKB B;  4ME3 A;  5JPN C;  1HA6 A;  3NEM A;  5CMD A;  5C44 B;  1YJ9 A;  2EY1 A;  1VQL A;  2YTY A;  2ES2 A;  4OL7 A;  2DY7 A;  1S72 A;  4V0B A;  2Z0S A;  4RGT A;  1Q1E A;  1SYC A;  2B2U A;  3S1R B;  5J39 A;  2WII B;  3CCV A;  2DY8 A;  3BVG A;  3SK5 A;  2XWB B;  4IUN A;  2UUC L;  2DNC A;  5BN4 A;  2FJ2 A;  3NWT A;  1JJG A;  3J81 E;  5LMU Q;  1I50 B;  3MZ5 A;  1RCV D;  4K0K L;  1X3P A;  5KNC A;  2E74 C;  5M3F B;  2F4I A;  2JEB I;  5JJZ A;  2PW7 A;  2G9D A;  1UE7 A;  4ZYS A;  1J8I A;  3U4V A;  4JI0 Q;  2YU9 H;  2RCN A;  2K75 A;  1O7Z A;  3NEN A;  5EQ0 A;  4DV1 L;  1QUQ B;  1G6Z A;  1K3R A;  3E0J A;  1F9S A;  4A3L H;  1K0S A;  5C0X I;  3T1H L;  3PO2 G;  2FMM A;  4NKL A;  3HOV H;  2JA5 B;  1ET9 A;  2Z4H A;  3WOF A;  3CCU A;  2JA8 B;  2VL6 A;  2EYP A;  5LMN L;  1F2Z A;  1E2V A;  2UU9 Q;  2B63 G;  4AH6 A;  1JWU D;  4KK7 A;  2FIN B;  4GLV B;  3K81 C;  1I3Q H;  1IKM A;  4NXM Q;  4LF7 L;  3LX0 A;  5E7N A;  3HOY G;  3I73 A;  3KDF A;  2VS1 A;  1Q7Y C;  1PV4 A;  2X69 A;  5A2Q E;  2AHO B;  1HPC A;  1AH9 A;  2ZXR A;  4JBW A;  3BYT B;  2NN6 H;  3R8B A;  4HED A;  4JI0 L;  4HAE A;  5ELF A;  4QGU A;  3KF6 A;  3NSW A;  1HH2 P;  1GD7 A;  2WB1 B;  4DK1 A;  2CVR A;  1X9N A;  3BDL A;  2QA4 A;  1GUG A;  4LMQ D;  2A68 D;  1PZI D;  4LF6 L;  2NTT A;  3AB9 A;  3GTP B;  2Q2H A;  2PMZ B;  1RTN A;  2E2H B;  3ERS X;  1JB3 A;  4WOR A;  3J80 E;  1OXX K;  4GKJ Q;  4JK1 C;  1HNZ Q;  2O5J C;  3KLS X;  3IRB A;  4N8X 1;  1RKN A;  1ICF B;  2Z6K C;  4XQN A;  3GTO B;  4BWG B;  2E2I B;  4LF5 Q;  5FLX c;  2C9O A;  4NXN L;  4O42 A;  2AQ1 B;  3J7A 5;  2M9V A;  3TP5 A;  3STB D;  2PMZ E;  2NZO A;  4EQN A;  4OEM B;  3H3V H;  2UXD Q;  4C3H H;  2R7F A;  5C44 H;  1ESR A;  2AWN A;  4GN4 B;  1PTO F;  2B63 B;  1QJO A;  1H9J A;  3N6R A;  1G91 A;  1YEZ A;  2DGY A;  4YY3 Q;  4X62 L;  1AN8 A;  5DLQ E;  1PFM A;  2LFN A;  4OEL B;  1BUV T;  4NMZ A;  2QKI C;  1JC7 A;  1S40 A;  1SMY D;  1NR2 A;  3W1B A;  2BOS A;  2A68 C;  2H5X A;  1I4Q A;  4KKS A;  4R4Q A;  1D5X C;  1V43 A;  1X3G A;  4HIM A;  5KRU A;  1K83 B;  1A6X A;  1AW7 A;  4ABN A;  4KY5 A;  2B8G A;  4KTA A;  1VQO A;  3K5N A;  3PIP 3;  1K3B C;  1TS2 A;  2D5D A;  2LXK A;  4RHS A;  1CZG A;  4K14 A;  4DAY B;  4C3I H;  2D62 A;  3TZU A;  3PO3 H;  1Q46 A;  1QNU A;  4JI4 L;  2MP1 A;  3C1F A;  1UAP A;  3W5O A;  1O7L A;  1Q86 C;  5FLM H;  4QF4 A;  2FXQ A;  4KHV A;  2VUM H;  4DR4 Q;  2K6A A;  1MJC A;  2RKS A;  2CHB D;  1VQH A;  3L7Z C;  5IYC G;  1ILQ A;  2IL8 A;  3P7J A;  1FR3 A;  2B2V A;  1PVO A;  3S1M H;  2ZM6 Q;  1LTG D;  1VQJ A;  4RCO A;  1HQR D;  2K5H A;  3PIP A;  3PGZ A;  3NWS A;  1QVC A;  3OMC A;  1L1O B;  4F88 A;  1F2L A;  2CWP A;  4LNQ A;  2WKC A;  1S3O A;  3S1N H;  2VB2 X;  2F4V Q;  4KN7 C;  3GTQ H;  1I6H B;  3W1G A;  2JEA I;  1EIF A;  3TEH B;  2PQA A;  1VQI A;  1O78 A;  5FK9 C;  4DV4 Q;  2KOL A;  3JAM E;  2KA7 A;  3BZK A;  4PZ6 A;  4A3K G;  4GOP A;  1N33 L;  1MJE A;  2F0D A;  1DOL A;  1SAP A;  3Q8D A;  2VB3 X;  4DR4 L;  3CAM A;  3CHB D;  3NBH B;  1IYV A;  2A69 C;  4R4T A;  4R8I A;  3G6E A;  4JYA Q;  1ML0 D;  4RMF A;  4HJ9 A;  3G7L A;  1O80 A;  3KJP A;  4DR1 L;  1VDZ A;  1QB5 D;  4DV2 L;  3QOJ A;  1FVI A;  1KC8 C;  3SE0 A;  2EDG A;  2Q2U A;  2UU9 L;  5EPJ A;  1R4P B;  5LMN Q;  2E2J B;  4JV5 L;  1JOO A;  4DR6 Q;  5T1I A;  4IN3 A;  1RD9 D;  3STB C;  5IP7 G;  2MHV A;  1KRT A;  1NNX A;  2EXD A;  3HZX A;  4Z9C B;  5EPK A;  2EPB A;  2A6H D;  1E0B A;  3PIO 3;  1TKW B;  2N49 A;  2JXM B;  1SE8 A;  3H0G B;  2EIF A;  5FKA C;  3ICE A;  5I6W A;  1QG7 A;  2B39 A;  5EGT A;  1EZ6 A;  1BXT A;  3MAQ A;  2BA0 A;  2WV6 D;  5FLM G;  3G71 A;  1VF5 C;  2VUM G;  1SYG A;  2Z1C A;  4OIJ A;  5CV7 A;  2WB1 G;  4JI4 Q;  2A69 D;  4OWW B;  4QIW B;  1V1P B;  4X66 Q;  3NK9 A;  4K6L A;  1A3T A;  1MGS A;  4YWM A;  3T51 B;  3DWA A;  5FOB B;  2KCN A;  4DV0 Q;  2EYM A;  2L4N A;  4ID6 A;  1JR0 D;  2ZXP A;  3KF8 A;  4LF4 L;  3I90 A;  4A3D H;  2K5W A;  1F77 A;  1FYC A;  3S15 B;  1BBU A;  1PTO H;  1VQD A;  1WCM H;  2A6E D;  3J7Z C;  1OXT A;  2LMC B;  4N9P A;  2Z8L A;  3OIQ A;  1TWA B;  2Z4I A;  3GTM H;  2NVT H;  3TRE A;  4OHJ A;  4R1J A;  2VY3 A;  1K8A C;  2BA1 A;  3J81 c;  1STN A;  2Q8R E;  1JMC A;  5IYD H;  2IHE A;  2O2L D;  4HTH A;  4NPS A;  4JYA L;  1KXL A;  1EYA A;  4RKL A;  1SSO A;  4ZQ3 A;  3WDN A;  1Q82 C;  1EIG A;  3KFU A;  1DXM A;  1NBW A;  1P16 A;  4A3M B;  1N8R C;  4QL5 A;  1Y1W H;  1C7Y A;  4DR3 Q;  3HOY H;  1HQM C;  1YIT A;  4DV5 L;  1VQ5 A;  2A19 A;  2B29 A;  4MZ9 A;  1E2Z A;  3M4Y A;  2RA4 A;  4GKJ L;  3RD4 A;  5CGK A;  4ODG A;  1UUP A;  3FVQ A;  3ZYY X;  3CRL C;  3TQY A;  1G8Z D;  5C3E H;  2UUA L;  4C56 C;  4XT3 B;  3J81 L;  4GZY C;  3RZD H;  1N33 Q;  1HXY D;  1A63 A;  3DEO A;  1T5X D;  1Z6H A;  4ILW A;  3QG1 A;  1Y8N B;  1PYW D;  4OWT B;  1WVL A;  4K5W A;  5KGU A;  3CXC A;  1WTX A;  1T9H A;  1XMQ L;  4IFD G;  1EIH A;  1XX8 A;  3S2D B;  4JI2 Q;  3UE0 A;  1HFG A;  1A62 A;  1O7Y A;  2WP8 J;  1I4P A;  4P73 A;  5D3D A;  2PW5 A;  3ERO A;  5J3B A;  1EOT A;  4K2K A;  2F0W A;  2XN9 C;  2B2W A;  1RJT A;  3K0X A;  4C3H G;  2BDN A;  1PRT B;  4DK3 C;  4P74 A;  5NUC A;  1PYB A;  3OMG A;  4UY8 C;  1I4H A;  3URY A;  4BY1 B;  2N3S A;  1PH8 A;  1VQC A;  4PG3 A;  4JI8 Q;  1YNX A;  1SBB B;  3FPU B;  1HRJ A;  2D2C C;  1EEF D;  1T5E A;  2B3G A;  3OTO L;  3CKI B;  3K7U C;  1D8L A;  3T1Y Q;  1C48 A;  2Y0S E;  1SYD A;  1LTA D;  1K8M A;  1O7I A;  2B2T A;  2ZJP A;  4HJ7 A;  2OWO A;  1J5E Q;  1ZYR C;  4UP7 A;  3HS0 C;  4JI1 L;  1VQ8 A;  1SDF A;  3CCE A;  4RFB A;  4LF5 L;  3HOU B;  1TWF H;  5IWA L;  2CFM A;  3I7F A;  1VQF A;  2E76 C;  4UPA A;  3X3N A;  3D0F A;  4DR5 Q;  3K7A B;  5CV8 A;  2QDB A;  1ASY A;  5IT9 L;  1L0X B;  2CCZ A;  3VYU A;  1F9R A;  3V05 A;  3A56 A;  5IYC H;  4EQP A;  1K73 C;  4LF9 Q;  2HT1 A;  4C3H B;  3J7A V;  2PQE A;  5JVG 3;  3CW2 C;  3CPW A;  1XTD A;  1PRT D;  2F52 A;  2VUM B;  1IBK Q;  2JP1 A;  2KQ3 A;  1B9N A;  4IOC A;  3EJI A;  1SE3 A;  2ZJR A;  4G7H C;  1TVX A;  3T53 B;  1VQK A;  2K33 A;  1BF4 A;  1FNW A;  1XPO A;  3NUC A;  1WTO A;  3PO3 B;  2Y0S B;  2Z6K A;  1YHB A;  2BDO A;  3VA7 A;  4IPD A;  3BS1 A;  4BXX H;  1BCP D;  1FNV A;  2OXP A;  2JA7 G;  2R7Z H;  1EY4 A;  5G3L F;  2Z6B A;  2PQA B;  2RCF A;  4DK6 C;  3JAM c;  4DR3 L;  4A75 A;  3L3O C;  1VMC A;  4DR2 L;  2F0P A;  3OW2 A;  4K2L A;  3WWV A;  1MI2 A;  1H9K A;  1KNA A;  4UP9 A;  1JQY D;  4HJ5 A;  1N36 Q;  1E1T A;  5E4W C;  3S1N B;  2RDH A;  4X6A H;  1E1O A;  2Q8T A;  3VA5 A;  4ZLT F;  1HZB A;  2K32 A;  1Q8I A;  3PUX A;  2WAQ G;  3KLW A;  3K6O A;  4NXM L;  3M9B A;  1RHP A;  1Q8K A;  4AYB B;  4YCW A;  1I94 L;  5KYI A;  3LWU A;  1IYJ B;  3OIP A;  1GKH A;  4KY7 A;  1A3V A;  3R93 A;  1PRT C;  3TN2 A;  3K59 A;  3JAM i;  1SMY C;  3QIA A;  1XNR L;  3GD7 A;  2XIW A;  3FP9 A;  4GN3 B;  2F4V L;  3FKI H;  4P75 A;  2KHI A;  2NZH A;  1PA6 A;  5D3I B;  2RVL A;  4L5R C;  3SHL A;  3BU2 A;  1C8C A;  2XTI A;  2ICI A;  4JI1 Q;  4A3G B;  1Y1V H;  5DEH A;  3BZD B;  1X32 A;  2L12 A;  5BN3 A;  1IZ6 A;  4IUR A;  4EGV A;  5C3W A;  1L1O A;  2X6L A;  3VR4 A;  5JVH 3;  4HN7 A;  1TWA H;  3K80 C;  2K14 A;  1MBY A;  1S5F D;  1KDC A;  4NB3 A;  2F0E A;  1QWY A;  4BXX G;  4A3G G;  3HEJ A;  4AYB G;  2UUB L;  1STG A;  2BE5 D;  2XSC A;  4WJW A;  4LJZ C;  2NVX H;  3C3L A;  1IBL Q;  3V2T A;  1STH A;  4LFA Q;  5HGQ A;  5IYD G;  5ELC A;  4YY3 L;  4X62 Q;  4K8I A;  4FYD A;  1V1Q A;  1PH9 A;  1WTW A;  1V1O A;  1C9O A;  1WI5 A;  2D0O A;  5M3M B;  2EQS A;  4DR1 Q;  4JI2 L;  1XWE A;  1TR5 A;  1CQF A;  4ZAI A;  5K36 H;  4DFA A;  3F2U A;  1TWC H;  3H94 A;  3I4M B;  4CGY B;  3UDG A;  2R93 G;  1IYU A;  5EPL A;  1L2F A;  4MN3 A;  3FKI G;  3I3C A;  4HIK A;  1L1O C;  1H9S A;  3A7A B;  5C3E G;  4BY7 B;  1LT4 D;  1HA5 A;  4TQU S;  2O5I C;  2VQF L;  1BCP B;  3LWE A;  1BOS A;  3UE1 A;  4A3E G;  1XNR Q;  2KEN A;  1Y1W B;  2A8V A;  4Y7N B;  4DV5 Q;  1Q1B A;  1NTG A;  4IJL A;  1TWG H;  3GTG H;  3CCM A;  3M85 A;  2L11 A;  4DR7 Q;  2K5N A;  1WOC A;  3PIO A;  3M4O H;  1SE2 A;  1EY7 A;  1JOK A;  3M3Y B;  4RAU C;  4UAI A;  1B70 B;  2F0I A;  4IQZ A;  4E6I A;  5C4J H;  4OX9 Q;  4A93 G;  1HTL D;  2AMC B;  4IUU A;  2F0T A;  2KHJ A;  1JWM D;  2F3W A;  4KD4 A;  3FMC A;  2IHF A;  2J0T D;  3FEW X;  3NP8 A;  4RGO S;  3QOL A;  3I4N H;  1Y14 B;  3S2D H;  3T1H Q;  1FL0 A;  2A73 B;  2GVB A;  3MXN A;  4TSS A;  2R92 H;  4A3C H;  4IJH A;  4HSP A;  4S3S A;  4DV6 Q;  4JI6 L;  3PQI A;  2ZTD A;  5BR8 L;  5IYB G;  4KHP Q;  1EOV A;  4GOP B;  1ENF A;  4DV4 L;  1F2M A;  1YBY A;  3VR3 A;  5CV4 A;  4XQJ A;  3GTL H;  3D4D A;  2PPB C;  4R4O A;  1IL2 A;  3EBE A;  1RTO A;  4DGZ A;  4B3T Q;  3IAY A;  2L55 A;  4PV1 C;  1XJV A;  4APV A;  2EYL A;  1AE2 A;  1B3A A;  2JJQ A;  3QWN A;  4L63 B;  1U4L A;  1YJW A;  4YWK A;  1LTS D;  1WJJ A;  5ELD A;  2RDG A;  4RG1 A;  3ULJ A;  1PFS A;  1TWH H;  2I0Q A;  5FJ8 G;  1WFQ A;  3I91 A;  4A3E H;  4KHP L;  4DKA C;  4L5Q A;  1J5E L;  5KNB A;  3K7A H;  3I4M H;  3CC7 A;  3MFG A;  1HZA A;  1SE4 A;  2RSO A;  3KF6 B;  3K0Y A;  1CQV A;  1EWI A;  2OEO A;  1VQM A;  5EKK A;  3ULP A;  4XYQ A;  1M1K C;  3HOU H;  4ZK9 B;  1DD2 A;  1X56 A;  1HR0 L;  1D1I A;  3L9A X;  1HCZ A;  4A93 H;  1TQO A;  3AYH B;  4KD3 A;  1LO5 D;  4HJA A;  1NR4 A;  1EU4 A;  2BH8 A;  1ET6 A;  4XQQ A;  1OTC A;  1A2U A;  2LSS A;  4ZKC B;  1VQ6 A;  1ESF A;  1PH6 A;  1EY5 A;  4B9X A;  3A8I E;  5HY6 A;  4EVO A;  5KND A;  3MTS A;  3UDX A;  3UI2 A;  5IYB H;  3KOJ A;  4L8J A;  2F0U A;  5EKI A;  2F0F A;  2NB0 A;  1E2W A;  1CSP A;  4X3U A;  1QOH A;  1YNN C;  1GUW A;  5JEA J;  3QO2 A;  1Y69 U;  5E3F A;  4A3K B;  4A3D B;  1XNQ Q;  1EY9 A;  1X6O A;  4DNI A;  4B3S Q;  2HD3 A;  2F0H A;  3SR1 A;  4Y7N H;  5IP9 H;  2NBF A;  3TSS A;  4B3S L;  1IW7 C;  3HG9 A;  4ZCK A;  4FVM A;  1Q81 C;  2SDF A;  1G2T A;  3S24 A;  2PI2 E;  1PH2 A;  1KDB A;  2EY2 A;  2IT1 A;  2E2D C;  3E0E A;  4RGN A;  2EXZ A;  3S14 B;  4JOI A;  3J81 i;  4RA8 A;  2KVM A;  3FKI B;  5G3L D;  1EUJ A;  4DR2 Q;  5C3E B;  4BY7 G;  3BG3 A;  1GUT A;  4H0L C;  2PZU A;  4LFC L;  1FJG L;  3Q6S A;  4OO1 H;  4X64 L;  3RUZ A;  1JWS D;  1NCV A;  1ONL A;  5IGC A;  3S1Q B;  2BH2 A;  5C0X G;  3I56 A;  4Q5V A;  1AFP A;  2RQX A;  4IFD I;  4N8F A;  4LF7 Q;  2ID0 A;  1JE5 A;  4XXE A;  2LY7 A;  3A74 A;  4YIJ A;  5ELE A;  2MJ8 A;  4DXG A;  1ZYR D;  2EZV A;  4A3B G;  1F2Y A;  1M90 C;  4RKB A;  3T13 A;  1S5C D;  3R3O A;  1PH3 A;  3I4O A;  4UHV A;  1Q3L A;  3TME A;  4CJ1 B;  1HUN A;  3ND8 A;  2TSS A;  2E5L Q;  2Q2I A;  4CBV A;  2F03 A;  1EEI D;  3D4W A;  3KK7 A;  1M4V A;  1UE6 A;  2EVB A;  1EIY B;  4FF4 A;  1IKL A;  3FDT A;  3PO2 H;  4CKE A;  4KJN A;  4HIO A;  3RZO H;  4O2D A;  1PTO D;  1X3Q A;  4P2C B;  1DOM A;  1GM5 A;  2L1B A;  4J8Q A;  1CM9 A;  1YJN A;  2ATW A;  2B8F A;  4PNY A;  4KJO A;  1EL0 A;  4LFA L;  3NQI A; 
#chains in the Genus database with same CATH homology
 3OTO Q;  2R6G A;  4AIM A;  2Y0S E;  3CCS A;  4GLA C;  4B3R Q;  2JA6 G;  3HKZ E;  4JI7 L;  4DR7 L;  1O7I A;  1HR0 Q;  2ZJP A;  1A0I A;  4QJF A;  4HJ7 A;  2OWO A;  3M7N A;  1J5E Q;  4J15 A;  5M3M H;  5JJK A;  4A3L G;  4A3B H;  4FDB A;  4UP7 A;  1QVF A;  1VQN A;  3HOW H;  4JI1 L;  1B7Y B;  4GNX B;  1VQ8 A;  1RIP A;  1WCM G;  3CCE A;  1BKB A;  3HOV G;  4LF5 L;  2MO0 A;  1TWF H;  4UP8 A;  4AQY Q;  1XMQ Q;  5IWA L;  4X65 L;  2CFM A;  3I7F A;  4YHH Q;  1VQF A;  4UPA A;  4JI5 L;  1GO3 E;  3AEV A;  5IP9 G;  3CQZ H;  4HJ8 A;  3D0F A;  4DR5 Q;  4EX5 A;  3MEF A;  3ZJY C;  2E2H H;  1ASY A;  1U0L A;  1IBM Q;  5IE8 A;  2CCZ A;  3CC2 A;  4LF6 Q;  2IX1 A;  2GVA A;  3CCR A;  2UXC L;  3DM3 A;  3SGI A;  5IYC H;  1K73 C;  4LF9 Q;  3CF5 A;  2HT1 A;  4XIG S;  4IPC A;  2CQO A;  3U4Z A;  1IBK L;  2PI2 A;  3RLF A;  2JEA I;  2OQ0 A;  3GO5 A;  1HNX L;  1L0W A;  4A3I G;  2YYZ A;  1G51 A;  3CW2 C;  1Y1W G;  3CPW A;  1XTD A;  2F52 A;  4X66 L;  1IBK Q;  3KDF B;  1AE3 A;  2JA5 G;  1CSQ A;  4AYB E;  4IOC A;  1NY4 A;  2ZJR A;  4POF A;  1VQK A;  1IXR A;  2JA8 H;  3D31 A;  1G29 1;  1JT8 A;  4OO1 G;  1Z47 A;  1SR3 A;  4A3C G;  4ME3 A;  1XPO A;  4QY7 A;  3NEM A;  2Z6K A;  3L2P A;  1YJ9 A;  1NMG A;  1VQL A;  2YTY A;  4XTC S;  1YHB A;  1S72 A;  2ES2 A;  4OX9 L;  3NEL A;  4IPD A;  2Z0S A;  4A3F G;  1Q1E A;  4BXX H;  4LF9 L;  2NVQ H;  1LTL A;  3H15 A;  1SRO A;  2OQK A;  1PH4 A;  2JA7 G;  5GQO A;  3CCV A;  2R7Z H;  2R93 H;  4LF8 Q;  2PQA B;  4DK6 C;  3JAM c;  4DV3 Q;  4DR3 L;  4A75 A;  1N34 L;  4DR2 L;  4DUY Q;  3PUZ A;  3A5U A;  1CKN A;  4MNO A;  3OW2 A;  1JJ2 A;  4GOP C;  1N36 Q;  3WWV A;  2UUC L;  4UP9 A;  4HJ5 A;  1X3E A;  1E1T A;  2R7D A;  3E9I A;  1JJG A;  1HZ9 A;  1VCI A;  4X6A H;  4JBM A;  1C0A A;  1E1O A;  5C0X J;  5LMU Q;  1CKN B;  1VQ4 A;  4K0K L;  1YHA A;  5C4X H;  4JCV E;  2UUA Q;  1HZB A;  2JEB I;  4BBS H;  3PUX A;  2WAQ G;  3KLW A;  1UE7 A;  4NXM L;  3S17 H;  1K83 H;  1GVP A;  3M9B A;  4MTN A;  4L5S A;  1VQB A;  1Q8K A;  3A5Z B;  4YCW A;  3U4V A;  1I94 L;  1IBM L;  2DUD A;  1IYJ B;  5FJ8 H;  4JI0 Q;  2YU9 H;  2RCN A;  2K75 A;  5IT9 c;  3GTJ H;  1GKH A;  3PO3 G;  1SLJ A;  3NEN A;  4DV1 L;  1QUQ B;  1LM0 A;  1K3R A;  1LUZ A;  3JAM i;  3H0G G;  5ELN A;  4A3L H;  2L15 A;  4JBJ A;  1XNR L;  3GD7 A;  5C0X I;  3FP9 A;  4GN3 B;  3T1H L;  2F4V L;  3PO2 G;  2VZA A;  2RHQ B;  1G6P A;  4GKK Q;  3FKI H;  4P75 A;  4TVA B;  3UDF A;  3HOV H;  1X65 A;  3CCU A;  2K50 A;  2KHI A;  2NZH A;  2VL6 A;  1PA6 A;  2JE6 I;  5LMN L;  1KL9 A;  2UU9 Q;  1E22 A;  2WAQ E;  4L5R C;  3F1Z A;  4AH6 A;  4PZ7 A;  2B63 G;  3BU2 A;  2UUB Q;  3HKZ G;  4GLV B;  3HOU G;  3K81 C;  1I3Q H;  4NXM Q;  4LF7 L;  3CD6 A;  2XTI A;  5E7N A;  2JA7 H;  2R7Z G;  3HOY G;  3KDF A;  1PV4 A;  2VS1 A;  1Q7Y C;  1VQ9 A;  2AHO B;  4JI1 Q;  3KJO A;  1Y1V H;  2HHH Q;  1AH9 A;  4JBW A;  4JI0 L;  5M5W H;  3KF6 A;  1Z9F A;  4KLK A;  4QGU A;  1PHJ A;  2N78 A;  5K36 G;  1MIU A;  1HH2 P;  1GD7 A;  3KF8 B;  1PYS B;  3CCJ A;  1EQR A;  1IZ6 A;  2IY5 B;  1X9N A;  4DUY L;  2QA4 A;  1J6Q A;  4LF6 L;  1L1O A;  1R9T H;  4WJ4 A;  3EIV A;  2Q2H A;  2YTV A;  1KIX A;  1HNZ L;  1TWA H;  1W2B A;  3K80 C;  2OTL A;  3ERS X;  2K14 A;  5EAY A;  4NB3 A;  1VQE A;  2KCT A;  1OXX K;  4LFC Q;  3RLO A;  1HR0 W;  1FJG Q;  4GKJ Q;  4X64 Q;  1HNZ Q;  1I5F A;  3PUW A;  4BXX G;  4A3G G;  1N36 L;  3GTP H;  4BY1 G;  3IRB A;  4AYB G;  2UUB L;  1OXV A;  5AJ3 Q;  4OWX B;  1NMF A;  4JC0 A;  2CWA A;  2Z6K C;  3RN5 A;  4JI3 L;  1I6H H;  4YWL A;  3M3Y H;  2NVX H;  1YVC A;  5GAG C;  5FLX c;  4LF5 Q;  4NXN L;  3CPF A;  1IBL Q;  2JA5 H;  3J7A 5;  1KAW A;  2JQO A;  2WFW A;  4A3J H;  4YCU A;  2PMZ E;  2NZO A;  3STB D;  4LFA Q;  5HGQ A;  5IYD G;  3H3V H;  2C35 B;  2UXD Q;  2LXJ A;  1VQG A;  4C3H H;  4YY3 L;  4X62 Q;  2R7F A;  5C44 H;  1V1Q A;  4EQ5 A;  2AWN A;  1PH9 A;  1C9O A;  1WI5 A;  2D0O A;  4GN4 B;  2EQS A;  4BBR G;  2VQE Q;  4DR1 Q;  4BBS G;  3BJU A;  3LGJ A;  1Y1V G;  2YV5 A;  4JI2 L;  1YEZ A;  2JA9 A;  2NN6 G;  5JJI A;  2DGY A;  4YY3 Q;  4X62 L;  1VQ7 A;  1OXS C;  5DLQ E;  1YIJ A;  1N32 L;  3DLL A;  3PUV A;  3CMA A;  1PH1 A;  1HNX Q;  3PSI A;  1TWC H;  1X3F A;  1S40 A;  1B8A A;  3UDG A;  2R93 G;  5LMU L;  3W1B A;  3JC6 6;  4JI3 Q;  3HOX H;  1CKM A;  1L2F A;  1JJC B;  2H5X A;  3FKI G;  4R4Q A;  4HIK A;  1L1O C;  1V43 A;  1X3G A;  5C3E G;  2OTJ A;  4HIM A;  4TQU S;  2ZTC A;  3G48 A;  4DR5 L;  1KQS A;  2Q2T A;  2HIX A;  4ALP A;  4DV2 Q;  2HHH L;  4JI5 Q;  4R4C A;  2VQF L;  2PNH A;  5GAH C;  1IBL L;  4A3G H;  3UE1 A;  3GTO H;  1VQP A;  4A3E G;  1VQO A;  1XNR Q;  2KEN A;  1K9M C;  3H3V I;  2A8V A;  1N32 Q;  4DV5 Q;  2LXK A;  5M5X H;  2E5L L;  2I5M X;  3HOW G;  1NTG A;  1Q1B A;  4IJL A;  4L5T A;  4DAY B;  1TWG H;  4C3I H;  3GTG H;  4KHZ A;  2D62 A;  3CCM A;  3PO3 H;  1I50 H;  1FGU A;  1Q46 A;  3I55 A;  3CCQ A;  3VDY A;  2OCE A;  5GAE C;  3HFZ B;  3M85 A;  2UUC Q;  4JI4 L;  4JI7 Q;  4DR7 Q;  2K5N A;  1WOC A;  4H02 A;  3PIO A;  4BA2 I;  3M4O H;  3W5O A;  1QVG A;  1Q86 C;  5C44 G;  4K0K Q;  5FLM H;  2VW9 A;  3S2H H;  2FXQ A;  3PUY A;  1SFO H;  2VUM H;  2E2I H;  4DR4 Q;  1MJC A;  2VNU D;  1VQH A;  1XMO Q;  3L7Z C;  5IYC G;  4DUZ Q;  1B70 B;  5C4J H;  3EN2 A;  2B63 H;  4OX9 Q;  4A93 G;  4QQB X;  2AMC B;  4IPH A;  1PVO A;  3S1M H;  4LFB Q;  2KHJ A;  2ZM6 Q;  1VQJ A;  1V9P A;  2IHF A;  2K5H A;  3PIP A;  3PGZ A;  1QVC A;  1L1O B;  2CWP A;  4JG2 A;  4LNQ A;  4A3M G;  3K8A A;  1Y14 B;  1S3O A;  3I4N H;  3T1H Q;  3S2D H;  3KYH C;  4B3R L;  3S1N H;  5JJL A;  1FL0 A;  2GVB A;  2F4V Q;  4A3C H;  2R92 H;  4IJH A;  3GTQ H;  4DV6 Q;  3F2C A;  3W1G A;  4GLX A;  2ZTD A;  4JI6 L;  1EIF A;  3TEH B;  2PQA A;  1PH7 A;  1VQI A;  5IYB G;  5BR8 L;  1QZG A;  4YCV A;  1N9W A;  4B3M L;  4DV4 Q;  1X54 A;  4KHP Q;  3BZK A;  2YTX A;  4PZ6 A;  4A3K G;  4GOP A;  1N33 L;  4DV7 L;  1MJE A;  1EOV A;  4GOP B;  1VS0 A;  4BY7 H;  3Q8D A;  4DV4 L;  4B3T L;  4GNX C;  4DR4 L;  1YBY A;  3CAM A;  3NBH B;  4R4T A;  1XMO L;  3GTL H;  4R4O A;  3G6E A;  1IL2 A;  4JYA Q;  3EBE A;  3S16 H;  1CKO A;  2RHS B;  5JEA G;  5M3M G;  4RMF A;  4B3T Q;  1UWV A;  4NXN Q;  3HKS A;  4C3J H;  4HJ9 A;  1XJV A;  4APV A;  3KJP A;  4DR1 L;  2UXC Q;  1AE2 A;  2JJQ A;  2VQE L;  3G4S A;  4DV2 L;  3HOX G;  1KC8 C;  1FVI A;  1YJW A;  3RNU A;  1D7Q A;  4YWK A;  2Q2U A;  5C4X G;  3U50 C;  1WJJ A;  2UU9 L;  5ELO A;  2F3I A;  3ER0 A;  4IO9 A;  5LMN Q;  4JI6 Q;  1QUQ A;  4RG1 A;  4DV3 L;  5BR8 Q;  1SRU A;  2HQL A;  4LF8 L;  3ULJ A;  1YI2 A;  4JV5 L;  1PFS A;  2K52 A;  2KCM A;  4DR6 Q;  1TWH H;  3STB C;  5IP7 G;  1PH5 A;  1KRT A;  2I0Q A;  4A76 A;  3AFQ A;  2EXD A;  1QZH A;  4LUV A;  1ASZ A;  4A4I A;  5FJ8 G;  1WFQ A;  5H1S E;  4WJ3 M;  2I5L X;  4JV5 Q;  3BZC A;  4JOI C;  4DR6 L;  4A3E H;  4KHP L;  2N49 A;  4DKA C;  4L5Q A;  5AJ3 L;  1J5E L;  3I4N G;  1SE8 A;  3K7A H;  3I4M H;  3CC7 A;  4LFB L;  1W3S A;  2EIF A;  4YHH L;  1HZA A;  2R92 G;  3J80 i;  4HID A;  3S1R H;  3ICE A;  4GNX A;  1I94 Q;  4GS3 A;  1EYG A;  4OO1 I;  2QGQ A;  3KF6 B;  4DUZ L;  1UE1 A;  2MQH A;  1E3P A;  1EWI A;  2JA8 G;  2BA0 A;  1VQM A;  4A3K H;  3ULP A;  1M1K C;  1SMX A;  5FLM G;  3HOU H;  3G71 A;  2VUM G;  3J80 c;  2WB1 E;  2ZJQ A;  1X56 A;  1HR0 L;  2AWO A;  3CCL A;  2WB1 G;  4JI4 Q;  4POG A;  1BVS A;  2NN6 I;  4LW1 A;  1XNQ L;  3E9H A;  4OWW B;  5M3F H;  3AYH B;  4A93 H;  4X66 Q;  2IX0 A;  4HJA A;  4P71 A;  5GAD C;  3F8T A;  2BH8 A;  1OTC A;  4PMW A;  2LSS A;  4DV6 L;  1VQ6 A;  1EFW A;  1PH6 A;  4YWM A;  3TS2 A;  4AQY L;  1WYD A;  3M4Q A;  3PF4 A;  5HY6 A;  3UDI A;  2KBN A;  4DV0 Q;  2HIV A;  4C2M H;  2I5H A;  3M4P A;  4QIW E;  3UDX A;  1E7Z A;  1A8V A;  3J81 j;  1UE5 A;  1YZ6 A;  2ZM6 L;  3B6Y A;  5IYB H;  3KOJ A;  3PF5 A;  3GTK H;  3MXN B;  3OYY A;  1XPR A;  2Y0S G;  2UXB Q;  4LF4 L;  3HOZ G;  4A3D H;  4GKK L;  4BY1 H;  1CSP A;  1Q12 A;  1BBU A;  3CME A;  3I4M G;  2ASB A;  1VQD A;  5JEA J;  1WCM H;  2RF4 A;  4GN5 A;  1NJI C;  3J7Z C;  1OXT A;  1X6O A;  4DNI A;  1XNQ Q;  4O0A A;  4B3S Q;  4Y52 H;  4Y7N H;  3GTM H;  2N8N A;  2NVT H;  3TRE A;  1U5K A;  4R1J A;  2VY3 A;  4DPG A;  5IP9 H;  1K8A C;  2BA1 A;  4DV7 Q;  4OXP A;  3J81 c;  4A3J G;  1YHQ A;  4B3M Q;  3FHW A;  5GRO A;  4B3S L;  1JMC A;  5IYD H;  2IHE A;  4NPS A;  3TS0 A;  3AFP A;  1Q81 C;  4JYA L;  4DV0 L;  4LUZ A;  4KI0 A;  1KXL A;  3ULL A;  4BA1 I;  4DAM A;  3S24 A;  2PI2 E;  1PH2 A;  1OXU A;  3CP0 A;  2JA6 H;  1Q82 C;  2IT1 A;  4LUO A;  3E0E A;  5IWA Q;  4X65 Q;  3AQQ A;  3KFU A;  1NBW A;  1P16 A;  2D0P A;  4JOI A;  3J81 i;  1N8R C;  4LF4 Q;  4QL5 A;  4A3I H;  4IFD J;  1K0R A;  5IY0 A;  3GDE A;  1Y1W H;  2VQF Q;  4DR3 Q;  1C7Y A;  3HOY H;  1EUJ A;  1HJP A;  4DR2 Q;  3S1Q H;  4BY7 G;  3F2D A;  1CUK A;  1YIT A;  4DV5 L;  1VQ5 A;  2A19 A;  2B29 A;  4MZ9 A;  4LFC L;  1FJG L;  1BBW A;  3PCO B;  1P8L A;  4X64 L;  1KD1 C;  4GKJ L;  1HNW Q;  3T1Y L;  3TQY A;  5C3E H;  2BH2 A;  5C0X G;  2UUA L;  4OON A;  2MFI A;  3I56 A;  3S15 H;  2JK8 A;  1JB7 A;  4A3D G;  4IFD I;  1TXY A;  3RR5 A;  4LF7 Q;  1DGS A;  3RZD H;  1N33 Q;  2ID0 A;  3RLN A;  1A63 A;  3A0J A;  2MNA A;  3F2B A;  1JE5 A;  1HNW L;  1HZC A;  1LYL A;  5IP7 H;  3A74 A;  5M3F G;  4OWT B;  4JI8 L;  3CXC A;  1T9H A;  2QEX A;  1XMQ L;  1XPU A;  4IFD G;  2NVY H;  4A3B G;  1E24 A;  1X55 A;  4IOA A;  4JI2 Q;  1M90 C;  2AKW B;  3I2Z A;  3UE0 A;  1H95 A;  2E2J H;  1KHI A;  1A62 A;  4LWC A;  2UXB L;  1PH3 A;  3I4O A;  2WP8 J;  4P73 A;  1N34 Q;  3CC4 A;  3U58 A;  1SN8 A;  5J3B A;  2E5L Q;  3PV0 A;  2Q2I A;  5LMN W;  1KRS A;  3K0X A;  2ZTE A;  2E8G A;  4A3F H;  3L0O A;  4DK3 C;  4BBR H;  4P74 A;  3HOZ H;  1NE3 A;  1RL2 A;  1UE6 A;  1PYB A;  3H0G H;  3RN2 A;  1EIY B;  2MO1 A;  4UY8 C;  3TRZ A;  4IPG A;  3PO2 H;  2XGT A;  1MKH A;  2N3S A;  2K4K A;  4HIO A;  1EQQ A;  1VQC A;  4O2D A;  4PG3 A;  4JI8 Q;  4A3M H;  1PH8 A;  3RZO H;  3S14 H;  1YNX A;  1K8G A;  4PZ8 A;  4R4I A;  1GM5 A;  1YJN A;  2ATW A;  2K5V A;  5M5Y H;  2B3G A;  2CKZ B;  4P72 A;  3OTO L;  2ALY B;  3K7U C;  1VQA A;  1UEB A;  4JBK A;  2V1C C;  2UXD L;  2A1A A;  2GN5 A;  4DV1 Q;  4LFA L;  1D8L A;  3T1Y Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...