4JI6L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLLGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 12
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji6L00
5HGQA 1GKHA 2OTJA 3CMEA 1WOCA 5JEAG 4DV4L 2I0QA 1YHAA 5IYBH 1IL2A 4GLXA 3K80C 2YYZA 2AMCB 1WJJA 4A3JH 2IX0A 3PF4A 4BY1G 4GN3B 5AJ3L 4GOPC 4JI4L 1YIJA 1WFQA 1DGSA 4POFA 4LFBQ 4JYAQ 4LF6Q 4LF9L 1V1QA 1HNZL 4IPGA 1KXLA 1MIUA 4QY7A 5EAYA 1K83H 1P16A 4LF4L 3PIPA 1OXVA 2NVQH 3KDFA 1K3RA 3U50C 4JG2A 1PYBA 2DGYA 4LUVA 2E8GA 3GTMH 1Q8KA 1X65A 2UU9L 1VQ6A 4J15A 3PGZA 1XNQL 3I7FA 4O0AA 5AJ3Q 2VQFL 2E5LL 4A3BG 3GTGH 2WAQG 5FJ8H 1FVIA 4A93H 2DUDA 4LF9Q 1SROA 2HHHL 4MZ9A 1WYDA 4LF4Q 4A3FH 3TREA 3UDXA 4DV6L 3HOWH 3J7ZC 4DV0Q 1PFSA 2Q2UA 4B3SQ 4A3GH 3F2CA 1VQ5A 3PIOA 4IPHA 3JAMi 2UU9Q 3KOJA 4IJHA 2VQFQ 3PUZA 4DR2L 4BBSH 4HJ9A 1EFWA 4A3LG 4BXXH 2V1CC 5FLXc 2IHEA 2VY3A 2N8NA 2HHHQ 1P8LA 3S17H 4BBSG 1E22A 2ZJQA 4P72A 4A3EH 1YJNA 2PQAB 4DV6Q 4HJAA 2E2HH 4HIMA 1CKNA 4A3KG 3S24A 1BBWA 3PUXA 5JJLA 1E24A 1SLJA 4L5RC 2CFMA 3AQQA 3KJOA 4DUZQ 1PH1A 4A3MG 4IJLA 4DR2Q 2UUBL 1K0RA 5IP7H 2PI2A 1PV4A 1YJWA 2UUAL 4DPGA 3E9IA 2PI2E 3BZCA 1I94L 3L7ZC 4IFDI 5C4JH 3PF5A 5IP9H 1LYLA 1SRUA 1TWHH 3F2DA 1AE2A 1PH8A 2MO0A 5M3FG 4X66L 4DR7L 1VQDA 2RCNA 1EOVA 1YHBA 2UXBL 3H3VI 1VQ9A 1JB7A 2Q2IA 1GD7A 1S40A 3HOXH 2Z6KC 2AHOB 4LF5L 1EQQA 1I94Q 4JCVE 1X56A 3STBC 2CWPA 3LGJA 4DR5L 3U58A 3KFUA 2B3GA 4A3DH 1CUKA 3TRZA 1XPRA 3F2BA 4X66Q 1KIXA 4DR3L 4JI6L 4A3IG 1C9OA 2QA4A 4DR7Q 2UXBQ 2K4KA 3AYHB 1B8AA 2H5XA 3PCOB 1BVSA 4JI5L 3WWVA 4B3RQ 2VW9A 2K50A 3PUWA 2BA1A 3DM3A 3ERSX 1XMOL 1Y1VH 3CQZH 5C44G 4DR5Q 3K8AA 3T1YQ 2YTXA 1BKBA 2VQEL 1QUQB 1Q12A 1PYSB 5BR8Q 4JI6Q 4DR3Q 3S16H 1YEZA 3K81C 3D0FA 2MFIA 4APVA 3TQYA 3L2PA 4DR1L 2NVXH 2RHQB 2YU9H 4GNXA 2ZM6Q 2JA6H 5JEAJ 2CQOA 4UP7A 2A19A 1Q1EA 2JA8H 1XMOQ 4L5TA 1RL2A 2R93G 2N3SA 4OWTB 4EX5A 1M90C 1OXTA 4XIGS 3ICEA 3MXNB 1T9HA 2VQEQ 3G71A 3RLOA 2IX1A 2ID0A 2PNHA 4DR1Q 2JJQA 2VS1A 2OTLA 4YCUA 4OX9Q 1K8AC 1HNXQ 1D7QA 2EXDA 5JJKA 1VQEA 2JQOA 1UEBA 2WB1E 1VQJA 3FKIH 3U4ZA 4X65Q 3J81c 2B63G 4NB3A 4A76A 1QVGA 2JA7G 1G6PA 2B29A 2HIVA 1M1KC 2ZTDA 2JA9A 1G51A 4DK6C 3G4SA 3GTPH 3HOUH 2D0PA 2LXKA 3BJUA 1LUZA 4B3MQ 1PH2A 1SN8A 5C0XG 4P74A 3DLLA 2LSSA 4QIWE 2ZTCA 3I2ZA 1PH5A 2YTVA 1CKMA 1IBKL 3PO3G 4LUZA 1UE7A 2Z0SA 3W1GA 2XTIA 3K7UC 4GN5A 2MQHA 1KC8C 2EQSA 2GVBA 2NZOA 1K9MC 2NN6I 1PHJA 1WCMH 1Y14B 2PQAA 4ME3A 1HR0W 1C7YA 2UUCL 3H3VH 1IBLL 1PH9A 2K14A 2WB1G 2RF4A 5IYBG 2CCZA 3S2DH 1EUJA 1VQNA 3TS2A 1IBKQ 1JMCA 4A3JG 1ASZA 1I50H 4B3TQ 4DR4L 3NENA 1XPOA 4KLKA 1SR3A 4JBWA 3RNUA 3CCUA 4MNOA 4BA1I 2OQ0A 4C3HH 4DV4Q 3S1QH 3RZOH 1S3OA 2UUCQ 1QVCA 1NE3A 1MJCA 3EIVA 1L1OA 1VQHA 4AH6A 1IBLQ 2VUMH 2BH2A 4BBRH 3A0JA 4JI4Q 3A74A 1VQFA 2HQLA 5K36G 4AYBE 5C4XH 1HNZQ 1X6OA 2VL6A 4DR4Q 5IWAL 1GVPA 1VQCA 1MJEA 5FJ8G 1CSQA 4A93G 4GS3A 2N49A 3NBHB 4UP9A 2WP8J 2A1AA 3Q8DA 4DV5L 2AWOA 4A3FG 2AKWB 5LMUL 1S72A 2UXCL 1UWVA 3HOWG 1XNQQ 2E5LQ 3RR5A 1N36L 1X3EA 4A3GG 3ULPA 5E7NA 1I5FA 2QEXA 5IWAQ 1IZ6A 4JI1L 1UE5A 2OCEA 1N33L 2HT1A 3S15H 4DV3L 3EN2A 4TVAB 4BXXG 1J5EL 4DV5Q 3CCSA 4JV5L 4GOPB 3FP9A 1FL0A 1CKOA 2KCMA 1QUQA 2R7ZH 3OTOL 4A3EG 1GM5A 1I3QH 3ER0A 3KF6A 2R7ZG 1N36Q 3PO2H 1EYGA 3M4QA 3I4NH 4AYBG 1YI2A 4PZ6A 3CCVA 3ULLA 4JI1Q 3J81i 2LXJA 1N33Q 4DV3Q 5IP7G 4NXNL 3CD6A 3M3YH 3L0OA 1J5EQ 4LF8L 4KI0A 4JI0L 4OWXB 1UE1A 5M3MH 5IP9G 5IYCH 4POGA 5ELOA 4L5SA 2EIFA 4LNQA 2R7FA 4A75A 4X62L 5IYCG 2UUBQ 3CMAA 1HZAA 4YY3L 2UUAQ 4LFCL 3M9BA 3H15A 2CWAA 4GLVB 4JC0A 4R4OA 3HOXG 4HJ7A 4NXNQ 1VQ7A 4LF8Q 2KCTA 3NELA 3T1HL 4JI0Q 2R6GA 1N34L 2IT1A 4A3DG 1PH7A 1ASYA 1CSPA 4RMFA 2D0OA 4C3JH 1VQLA 5IYDH 4X62Q 1NMGA 3KDFB 2ES2A 1Y1WH 4LF5Q 4YY3Q 5C0XJ 1K73C 3CCJA 1JJGA 1OXXK 5GAEC 4JOIA 4YWKA 2K5NA 3H0GH 4UPAA 3A5UA 3RN5A 1KQSA 3T1HQ 3CCLA 2VNUD 1B7YB 1Y1VG 5M5WH 4RG1A 2F3IA 1N34Q 4R4CA 4P71A 3ZJYC 1X9NA 1XNRL 3H0GG 3M4PA 3RZDH 4JI5Q 1X54A 2K5VA 5C3EH 2KHJA 3F8TA 3JC66 4BY7H 1VCIA 3SGIA 2JA6G 5C3EG 3J80c 5LMNW 3KF8B 1QZHA 2IY5B 3RN2A 4R4TA 2JA8G 3GTOH 1JJ2A 2I5LX 1PA6A 1X3GA 1XNRQ 2JEAI 2XGTA 4DAMA 5J3BA 3BZKA 3CPFA 3CC7A 2ASBA 4OONA 2UXDL 4NXML 4DNIA 3S1MH 3CW2C 3STBD 1CKNB 1I6HH 1EIYB 1IXRA 1HZCA 3AEVA 1VQIA 1GO3E 1JT8A 5JJIA 4HJ5A 1N9WA 1AE3A 2K5HA 4KHPL 4A4IA 3FKIG 2ALYB 4AQYL 4JBKA 1XMQL 1TWFH 4PZ8A 1OXSC 1YVCA 1SE8A 1U0LA 4GNXC 4LF7L 4FDBA 1XJVA 4NXMQ 2R92H 5GROA 3CXCA 3HOUG 1N8RC 3M85A 1VQPA 4L5QA 1YITA 4Y7NH 4Y52H 3ULJA 3S1NH 4KHPQ 4MTNA 1HNWL 3J81j 4DV7L 4GKKL 3CP0A 3D31A 4AQYQ 1X3FA 1XMQQ 2FXQA 2ATWA 1HZ9A 1IBML 1NBWA 4LF7Q 3GTJH 4IFDG 4IO9A 3NEMA 1OXUA 3CCRA 4GOPA 3MEFA 1HJPA 1V9PA 2NVYH 1Q46A 1TWAH 1WCMG 1VQ8A 3GTLH 2E2IH 4BA2I 3PUYA 1HNWQ 4P73A 3HKSA 3CCQA 4XTCS 5IY0A 2MNAA 3CF5A 2JA5H 3HOVH 4IOCA 1IBMQ 1YBYA 1QVFA 1VQKA 3G48A 4UP8A 3I4OA 1NJIC 1FJGL 1KD1C 1HR0L 4JYAL 2GVAA 5FLMH 2OWOA 1EWIA 3GD7A 1H95A 3I55A 2VUMG 4GNXB 5FLMG 4BY1H 2HIXA 2IHFA 4BBRG 3OYYA 4HIDA 4DV2L 1Q1BA 3S2HH 1TXYA 4YWMA 3W1BA 4DKAC 1XTDA 1UE6A 3PUVA 4DR6L 2K75A 2ZTEA 2ZJRA 5C4XG 1FJGQ 1HR0Q 2MO1A 5H1SE 1VQGA 3HOZH 1A63A 3KYHC 4GN4B 4YCVA 2NZHA 1TWGH 4R4IA 1X55A 2KENA 4X6AH 3HOZG 4PG3A 4GLAC 3HOYH 1PH4A 4DV0L 1L0WA 4B3SL 4O2DA 1HH2P 3CC4A 1V43A 3PV0A 4A3BH 1VS0A 4OXPA 3J80i 4DUYL 3TEHB 3E9HA 4KHZA 4DV2Q 2Q2TA 3HOYG 2Q2HA 3RLNA 1Z9FA 1Q82C 4DR6Q 3F1ZA 1L1OC 4OWWB 2KHIA 4DAYB 1PVOA 5ELNA 4GKJL 2UXCQ 5LMUQ 1IYJB 3AFPA 1KL9A 3M7NA 1E3PA 4JBJA 1O7IA 4YHHL 1A62A 1WI5A 1SMXA 1SFOH 3PO2G 3KJPA 4DUYQ 4QJFA 3I4NG 2QGQA 3I56A 4DUZL 3TS0A 4JBMA 1W3SA 4A3LH 3UDFA 4JV5Q 1BBUA 1U5KA 4YCWA 3OTOQ 1JE5A 3W5OA 5GAGC 2Z6KA 5IT9c 4GKJQ 4A3KH 4K0KL 3G6EA 4OO1I 2JEBI 4PMWA 5M3MG 2WFWA 4YHHQ 5C0XI 2C35B 4A3MH 4A3CH 5GADC 2JK8A 2NVTH 3S14H 1Q86C 3CC2A 3GTKH 4A3CG 4WJ3M 1VQMA 4JI7L 3CCEA 4R1JA 1VQBA 1HZBA 4HJ8A 4JI3L 2ZJPA 5M3FH 4DV1L 4K0KQ 1YHQA 3M4OH 2NN6G 3UDGA 3CCMA 5GQOA 2Y0SE 1NMFA 1L1OB 4LFCQ 5DLQE 5IYDG 4YWLA 1J6QA 2GN5A 1EIFA 2R7DA 3KLWA 5IE8A 3OW2A 1Y1WG 3AFQA 3S1RH 4B3RL 1N32L 4JI7Q 2BA0A 1E1OA 2F52A 2KBNA 1YZ6A 2OQKA 3BU2A 5M5YH 4JI3Q 2CKZB 3FHWA 4R4QA 4DV1Q 4EQ5A 4IPCA 2A8VA 1LTLA 3CPWA 3PSIA 4HIKA 4A3IH 2E2JH 1A0IA 2VZAA 3CAMA 3HFZB 4X64L 5HY6A 3T1YL 4IFDJ 1L2FA 1C0AA 5BR8L 4LW1A 4DK3C 4WJ4A 4BY7G 3RLFA 2ZM6L 4C2MH 4LUOA 1KHIA 2PMZE 2AWNA 5GAHC 5C44H 4JI2L 2K52A 4NPSA 4HIOA 1FGUA 1Q81C 3UE1A 2RHSB 3B6YA 1N32Q 4JI8L 4X64Q 3UDIA 2Y0SG 1AH9A 4PZ7A 4C3IH 3HKZE 4JOIC 1KRTA 1W2BA 1D8LA 3GO5A 3JAMc 5LMNL 4LFAL 3KF6B 3K0XA 4OX9L 3I4MH 1LM0A 1RIPA 1QZGA 2R93H 1YJ9A 1HNXL 4JI2Q 4AIMA 2YTYA 3VDYA 1B70B 4H02A 4LWCA 1EQRA 4P75A 1R9TH 3J7A5 4X65L 3I4MG 3GDEA 2F4VL 2N78A 2UXDQ 4QGUA 4JI8Q 3U4VA 3GTQH 1MKHA 4LFAQ 4ALPA 2BH8A 1E1TA 4TQUS 5LMNQ 1K8GA 2I5HA 2R92G 4UY8C 1G291 3A5ZB 2B63H 1VQOA 1PH3A 4B3ML 1TWCH 2JA7H 3EBEA 2F4VQ 2L15A 5M5XH 3E0EA 1VQ4A 1XPUA 1NTGA 3HKZG 3IRBA 1NY4A 1KRSA 3K7AH 4DV7Q 1Z47A 4QL5A 4GKKQ 4OO1G 1OTCA 2D62A 2I5MX 3PO3H 2JE6I 1E7ZA 1Q7YC 1VQAA 2JA5G 1JJCB 1A8VA 3HOVG 1PH6A 2WAQE 4IOAA 4IPDA 2YV5A 3UE0A 4LFBL 4LF6L 1YNXA 1KAWA 4B3TL 4QQBX
chains in the Genus database with same CATH superfamily
4H0LC 5IYBH 1D1KA 1JR0D 1OO9B 2NTTA 5AJ3L 3S9WA 4GOPC 1YIJA 5DEHA 1WFQA 1HNZL 5EAYA 3FPUB 1F9RA 2LKVA 2NVQH 4G7ZC 1K3RA 3U50C 4JG2A 1PYBA 2EYHA 4IUUA 2E8GA 4EQNA 1PZJD 2UU9L 4J15A 5AJ3Q 2E5LL 4A3BG 1XXGA 4RKBA 2KJXA 5COYA 2CQAA 1FVIA 4A93H 2B2VA 4CDCC 2EYMA 3D6WA 1CT1D 2EYJA 3DWQA 4DNRB 1KNAA 4C3HB 3S1QB 1AEXA 2NVQB 4DV0Q 3PIP3 3F2CA 1SEBD 4IPHA 3NK9A 4KTAA 2UU9Q 1LTAD 1FNWA 2NUCA 4DR2L 4BBSH 2EY5A 5IGBA 2VY3A 1E22A 4HIMA 3VYTA 1I6VC 5JJLA 1F9SA 3EFXD 4ZK9B 4DUZQ 3EROA 4IJLA 4DR2Q 3EA6A 4XYQA 4DPGA 3KLSA 1JOKA 3PF5A 1LYLA 2TMPA 4ID6A 3F2DA 1PH8A 3AMUA 1K8MA 5A2QE 3FRPB 4K2LA 1VQDA 2KQ3A 3R2IA 2Z8LA 3H3VI 2A6ED 4OIJA 1BR9A 1S40A 2Z6KC 3I4NB 3MZ5A 1EQQA 3HZXA 1BQQT 2Q8TA 2CWPA 4OELB 2Z4HA 2B3GA 1RKNA 2RSNA 1CUKA 5E4WC 1MSGA 4JI6L 2OF1A 3AYHB 4JI5L 4B3RQ 1FD7D 2F0TA 3E5SA 3W2DA 1S5BD 1TY0A 5CBEE 3CQZH 5C44G 3QR8A 3K8AA 5BR8Q 1HTLD 1PYSB 2CH4W 4IQZA 4JI6Q 2MFIA 4APVA 4DR1L 2RHQB 5C6AA 4C3JB 2ZM6Q 1Q1EA 1STEA 1EY5A 4FP5D 2JN4A 4EX5A 3ICEA 3MXNB 1B4OA 3CKIB 2KCNA 4DR1Q 1KNEA 4OX9Q 3G7LA 1E0BA 1QILA 3OSOA 4X65Q 5FK9C 1K8OA 2SNSA 5E1FA 2B29A 2B39A 2BOSA 1CFMA 4FF4A 2B2TA 2Y0SB 2PW5A 4LJZC 1F2LA 2B2WA 1I6HB 1Y8PB 1R4PB 1UE7A 2A68D 3CRLC 3I73A 1G2TA 1NNXA 3K5NA 1K9MC 2NN6I 1EYDA 2MP1A 1SMYD 5G3LD 5M9OA 1HR0W 2R92B 2FHTA 5CORA 2K14A 2PMZB 4Y7NB 3O13A 1JMCA 5J1ZA 1ZYRD 4LMQD 1GUGA 1SR3A 4NDXA 3CCUA 3EIVA 1QNKA 5JVH3 5EPKA 1TVXA 1A3UA 1TWAB 5D65A 1WTVA 1GHKA 4JI4Q 3A74A 1VQFA 5K36G 4CDDC 2VL6A 2JA5B 1O78A 4U68A 1CSQA 4UP9A 4DV5L 2M00A 3Q8DA 2AKWB 2UXCL 1UWVA 2OEOA 3VR4A 1N36L 1X3EA 4A3GG 1EY6A 1I5FA 4HSPA 1IZ6A 4JI1L 1EZ8A 4TVAB 4DV5Q 3CCSA 1ESFA 2F0OA 2O5JC 1GM5A 2R7ZG 1TWGB 1N36Q 1EYGA 3PO2H 1HUNA 4IUNA 4KKUA 3CCVA 4KMUC 3J81i 4JI1Q 3CD6A 2BCOA 3M3YH 1UE1A 1LT5D 3NUCA 2L12A 4POGA 3AB9A 3TSSA 3I3CA 2R7FA 4B08A 4A75A 5LHY1 4X62L 2UUBQ 4LNQA 1HFNA 3CMAA 4G57A 1LTID 3M9BA 3H15A 4V190 1SFOB 1PTOC 3ZYYX 1CZGA 1MHWC 5EQ0A 2IT1A 3FPPA 1CA5A 5I2YA 4X62Q 3W3AA 2ZXRA 1UEAB 4A3MB 4MIUA 1K73C 1JJGA 5GAEC 4JOIA 1QB5D 3S14B 4YWKA 2VNUD 3A5UA 1KQSA 5ELCA 1B7YB 1Y1VG 5M5WH 2KEEA 3ZJYC 3H0GG 3M4PA 2TSSA 5M3FB 5C3EH 3M4OB 4BY7H 2RCFA 2JA6G 3SGIA 3J80c 4RKLA 3RN2A 3TP6A 1PA6A 3DMUA 2JEAI 3QJYA 1T5EA 2HD3A 4ODGA 1IXRA 2M9VA 1STHA 1JT8A 1N9WA 4PZ8A 1OXSC 4HCEA 4LF7L 1EL0A 1CHPD 3CXCA 4OL7A 3KUPA 3M85A 1JOQA 4L5QA 4C3IB 4IUQA 1Y8NB 4ME5A 1HNWL 4UDUC 5CBAE 3J81j 4DV7L 4HEDA 3MFYA 3CP0A 1CZWA 1SYCA 3GP7A 4LF7Q 3X3NA 3D4WA 4L63B 4GOPA 1DCZA 1HJPA 4BA2I 1AZPA 1HNWQ 3TBIB 3CF5A 2ZT9C 2F0FA 3ITPA 3P20A 1CA6A 1QVFA 1VQKA 3G48A 1H9SA 1DZ1A 2WACA 5NUCA 1NJIC 1FJGL 2RBMA 4QCLA 4C3HG 4QUFA 1C4QA 3GD7A 3Q23A 4DXFA 1A3VA 2F3VA 5EKIA 1A2UA 4EQOA 4GZYC 2HIXA 2IHFA 3P75A 4PMBA 1RODA 1SSOA 2PCFB 3QWNA 3W1BA 4DR6L 1XTDA 3PUVA 1FJGQ 1VF5C 3HOZH 4O1NA 4HN7A 2KHSA 4ABNA 1IL8A 4GLAC 1EU4A 1L0WA 4B3SL 4A3BH 2Q2TA 3I70A 4DR6Q 1Z9FA 3F1ZA 2KHIA 1PVOA 4GKJL 3A55A 3AFPA 4ZUJA 1PFBA 1TU2B 4DA2A 1E3PA 3I90A 1HPCA 1O7IA 2EYFA 4QIWB 3HRZC 4ZYSA 3I4NG 1W3SA 5BN4A 4KJNA 4FXDA 5LL6S 4H13C 3X3MA 5KYIA 3OTOQ 4GKJQ 2Z6KA 1ZXTA 4KHVA 1IHZA 4A3CH 3QOJA 5GADC 3HOWB 3NP8A 2A73B 4OEMB 1VQMA 1HZBA 4HJ8A 4DV1L 1EIHA 3GV3A 3CCMA 2Y0SE 2E2HB 4C3JG 4YWLA 4XQQA 4AYBB 5IE8A 3J7AV 4LAAA 2F52A 3HP3A 2OQKA 5M5YH 3FHWA 4R4QA 4DV1Q 4EQ5A 3PSIA 4HIKA 1G2SA 1FYCA 1TWHB 1L2FA 3HG9A 3RLFA 4C2MH 2PMZE 5C44H 2AWNA 4FYDA 4RCOA 4HIOA 1FGUA 4BS9A 1B50A 4ZCKA 3NTIA 3NTHA 4JI8L 1F77A 2Y0SG 1PTOD 1W2BA 5EKKA 3VA5A 1LM0A 1G8ZD 1RIPA 1B70B 1XTCD 2LMCB 1R9TH 5C5MA 4WJWA 4JI8Q 2N55A 5CV8A 1K8GA 2BH8A 2R92G 2N88A 1G291 2NVXB 3A8JE 1EWCA 5FLXL 1TWCH 3EBEA 4DAVA 1SNQA 2L15A 1R9TB 1MSHA 2XRQD 4N9TA 3ERQA 3H3VC 3E0EA 1O7LA 3IRBA 2B8FA 1Z47A 4OO1G 3U9SA 2D62A 2I5MX 1SE2A 1GUWA 1E7ZA 3FKIB 2JA5G 1JJCB 1A8VA 1PH6A 1SXTA 1FNUA 4LFBL 1KAWA 4QQBX 4CKCA 4IURA 4RWSC 2OTJA 2K5QA 1WOCA 5JEAG 4DV4L 3GTPB 3HOUB 3K80C 2Z6BA 5I6WA 3M4YA 3SDZA 4POFA 4LFBQ 5I6YA 4QMGA 2F0LA 4JYAQ 4LF9L 3NWSA 4QY7A 1K83H 1K28A 1KLUD 4LF4L 3KDFA 2DGYA 1FNVA 4J1MA 3GTMH 3I7FA 3MXUA 4O0AA 2VQFL 3S2DB 3OIQA 3GTGH 2XIWA 1X32A 4LF9Q 1SROA 2ZXOA 4LF4Q 4KJOA 4UHVA 3WDNA 3J7ZC 2G9HD 3HS0C 4A3GH 1VQ5A 3IFTA 2XWBB 3GTMB 2EY2A 2VQFQ 3PUZA 4BBRB 4BWGB 2H4OA 3OOCA 4K6LA 1EFWA 2V1CC 5FLXc 2N8NA 1X3PA 3M7GA 1CI3M 2L11A 3J81L 1PZKD 4O42A 3AQQA 4A3MG 2MHVA 3PIO3 2PI2A 1MBYA 3E9IA 5C4JH 3S15B 2X6GA 5AFWA 4RAUC 1H9SB 1AW7A 5M3FG 1ENAA 2R7ZB 5JAVA 1EOVA 1H9JA 4ZKCB 1RF2D 2EXZA 1SBBB 2AHOB 4LF5L 5J22A 1X56A 4XT3B 3LGJA 3EQLC 3U58A 2VXWA 3KFUA 3DM1A 2KUMA 4B9XA 5C4HA 5M3MB 2K4KA 3A7LA 1U4LA 2H5XA 1Y8OB 2AQ3B 3PCOB 3WWVA 2VW9A 3PUWA 2BA1A 3DM3A 1ESRA 5ELFA 3ERSX 1U4PA 1Y1VH 3K5LA 3T1YQ 1VDZA 2YTXA 1BKBA 1CQVA 3T13A 2F0VA 2SDFA 1YEZA 3QG1A 3D0FA 2C5CA 2YU9H 3URYA 2JA6H 2D5DA 4C3IG 2CQOA 2A19A 3T53B 1Y1WB 2OXPA 1BDOA 4L5TA 3T56B 2N3SA 4OWTB 3H0GB 1EOTA 3G71A 2IX1A 1I4PA 2JJQA 2VS1A 2VB3X 4YCUA 2OTLA 1ILPA 1PRTF 5JJKA 1J9OA 1JE4A 1WTXA 3J81c 1HHVA 5E3FA 2B2UC 1QVGA 3TZUA 1M1KC 3GTOB 2HUGA 2JA9A 1EWHA 4QF4A 1G51A 3G4SA 2D0PA 4B3MQ 1C8CA 1SN8A 5C0XG 3T4AC 1QWYA 4QIWE 2YTVA 3W1GA 2Z0SA 1EFID 1KAAA 2MJ8A 3A8KE 5IT9L 4FXKC 1I4RA 1TWFB 4FXGC 1PHJA 3A7AB 1Y14B 2EDGA 2PQAA 2DN8A 1PH9A 1SDFA 1V8QA 3MXGA 4K8JA 1I4HA 1ASZA 4H7BA 4B3TQ 4DR4L 4C3HH 4BA1I 2OQ0A 2NB0A 3S1QH 3GTJB 2AQ1B 5KEEA 3HKZB 1NE3A 1VQHA 2MGSA 4AH6A 2NVYB 3EVQA 3GTLB 2E2IB 3A0JA 1I4XA 3U9OA 2HQLA 5I9OA 4AYBE 1EY0A 1HNZQ 4DR4Q 5IWAL 1G6ZA 2D2CC 3HOVB 4DXGA 5FJ8G 2WP8J 3QIAA 2JXMB 5FO9B 3SE0A 1RCVD 4G7HC 4A3FG 1LTTD 1S72A 3HOWG 2E5LQ 2LFNA 1HCZA 3MEHA 5IWAQ 1SYFA 2OCEA 1LLRD 4JW0A 2HT1A 4DV3L 3EN2A 4BXXG 3VR5A 1QUQA 4A3EG 3JAML 3ER0A 1V1PA 3KF6A 3I4NH 3R8BA 4AYBG 1TS2A 4DV3Q 3H6MA 2WAQB 5IP7G 4RGNA 1ET9A 1TR5A 3BVGA 5IP9G 5ELOA 4L5SA 1V1OA 5IYCG 4LFCL 1J8IA 2CWAA 2A5HA 3C2PA 1VQ7A 2KCTA 1BXTA 1PH7A 2AUJD 4C3JH 4A3KB 3P1HA 3KBXA 3KDFB 5C5LA 3CCJA 4LK1C 1OXXK 3SEBA 3CHBD 2K5NA 3RN5A 3GTKB 3QO2A 2F3IA 1XNRL 1NSNS 4JI5Q 2K5VA 1BCPC 4G4KA 1ILQA 1VCIA 1LV9A 3F2UA 1NR4A 2IY5B 2JA8G 4TSSA 1E2VA 2I5LX 3DHQA 1F9PA 1BCPF 1XNRQ 2F0JA 3IL8A 4C56C 2O2LD 2G5DA 2F03A 3HEJA 2UXDL 1PTOB 5F2DA 4DNIA 4A3IB 1I6HH 2K28A 1HZCA 3AEVA 1GO3E 5JJIA 1AE3A 2EY6A 2K5HA 1HQRD 3FKIG 3J7AF 5CV4A 5A2QL 2R92H 3I91A 3HOUG 1YITA 4KK7A 4Y7NH 4X3SA 4MTNA 4GKKL 5IGEA 1BO0A 1X3FA 3J80E 1NBWA 3SR1A 1JICA 4IFDG 3K58A 4F8MA 3NEMA 1V9PA 1Q46A 1TWAH 2L5TA 3PUYA 2WINB 3CCQA 4XTCS 5IY0A 2JA5H 1WTWA 1DOLA 4IOCA 1YBYA 2JA7B 1B3QA 5M5XB 1KD1C 1HR0L 5JEAH 2GVAA 1YNNC 5FO7B 1EWIA 3I55A 5FLMG 1Q90A 4BBRG 4DV2L 2FJ2A 1Q1BA 1HXYD 4DKAC 1TS5A 2RVLA 2ZTEA 1HR0Q 2MO1A 1CK1A 3KK7A 3KYHC 1JB3A 5IIFA 1A63A 3SXHA 1TWGH 2KENA 1VMCA 1PH4A 4RHSA 3D4RA 4ZRZA 3MAQA 3CC4A 1VS0A 4DV2Q 3HOYG 4KHZA 4XT1B 4A3JB 1Q82C 5D3DA 1L1OC 4OWWB 3H91A 5IGCA 1WVLA 2UXCQ 1RJTA 4Q0FA 3LX0A 3M7NA 1BOSA 4YHHL 4HMIA 3Q24A 1SMXA 1SFOH 3MA2B 4DU9A 3KJPA 3NWTA 3TS0A 4KN4C 3UDFA 2EJMA 1K0SA 1JE5A 5GAGC 4K0KL 5M3MG 4YHHQ 2CH4A 4A3MH 2IX3A 2JK8A 3S14H 2KECA 2K5DA 4R1JA 1KTKA 4JI3L 4R8NA 5M3FH 4K0KQ 3S17B 3M4OH 1CHQD 5GQOA 4K5XA 1EY8A 2V4DA 2X69A 1SJED 4FF2A 1EIFA 1Y1WG 1BNZA 2BA0A 1E1OA 4XXEA 3BU2A 1EYAA 1LTBD 3OHXC 4JI3Q 2CKZB 4CJ2C 1N32L 3CAMA 4X64L 1C0AA 2K04A 3NXWA 2F4IA 4DK3C 4EGVA 4WJ4A 3DEOA 2E74C 1KHIA 2JP1A 4JI2L 2K52A 2KA7A 4NPSA 3UE1A 5IGDA 2QF7A 1N32Q 4X64Q 3ND8A 4A3DB 2B2UA 3SK8A 4L8JA 1HA5A 3HKZE 4C3IH 4LFAL 1F2YA 3KF6B 3MFGA 1HNXL 4JI2Q 5C4ZA 3VDYA 4H02A 3OWFA 1EQRA 2BDNA 3J7A5 3I4MG 1AN8A 3K0YA 4QGUA 1L0YB 3U4VA 1WTPA 4LFAQ 2VB2X 4ALPA 4TQUS 4UY8C 3A5ZB 5IGGA 2QILA 5JVG3 5FKAC 1BCPD 3UI2A 4RGTA 1O7ZA 1HQMC 3K6OA 1U4MA 3NPPA 1VQ4A 5T1GA 1XPUA 3HKZG 1KDCA 3SK5A 4HAEA 3BZDB 5C0XH 3RUZA 4DV7Q 4DK1A 4V0BA 3MVVA 1EY4A 1OTCA 3LWUA 2EPBA 1VQAA 1IW7C 3HOVG 2WAQE 3T16A 4IPDA 4IOAA 1YNXA 5HGQA 1GKHA 4J8QA 1CM9A 3CMEA 5IODA 3HGBA 1IL2A 5CV6A 4KD4A 2PNRC 2IX0A 3PF4A 4GN3B 1D1IA 1A2TA 4IPGA 1MIUA 1P16A 3PIPA 3D6CA 1OXVA 2FMMA 1HFGA 1WCMB 1A6XA 1GOZA 2R61A 4X3UA 1Q8KA 3PGZA 1K3BC 1SNMA 4FF3A 1XNQL 2RQXA 2F0IA 4HR7B 1LT3D 2WAQG 5FJ8H 2DUDA 1I50B 1B2TA 4A3FH 3TREA 3UDXA 1B9MA 4DV6L 3HOWH 1DYQA 2Q2UA 4B3SQ 1PFSA 3RZOB 2VUMB 3NSWA 3JAMi 5ELBA 3KF8A 1YNND 5JPMC 4DK0A 4ZKBB 4A3LG 4BXXH 4KN7C 5HGTA 5C4XB 4NMZA 4BBSG 4CGYB 4A3EH 2E2HH 3ND9A 1YJNA 4DV6Q 4HJAA 4A3FB 1LO5D 4A3KG 3S24A 4KKSA 2D9UA 3KJOA 1EY7A 1PH1A 1EZ6A 2JSOA 5IP7H 1YJWA 2UUAL 2PI2E 2IWHA 3L7ZC 4JK1C 5IP9H 3CU7A 1TWHH 3VA7A 3D3RA 2SOBA 4A3EB 2MO0A 4X66L 4N9PA 2RCNA 4JPBW 1YHBA 2F0EA 2UXBL 1DD2A 1L0XB 1JB7A 2B2YC 1I3QB 2PYKA 1GD7A 2Z4IA 1PXUA 1TT2A 1GXDC 4JCVE 3STBC 4PMCA 1B3AA 4NP5A 3TRZA 1YNJC 1XPRA 5FLXE 4DNTB 4X66Q 3F2BA 4A3IG 2QA4A 4NW2A 2UXBQ 1B8AA 1BVSA 1QE6A 4XQNA 1DOMA 3BVMA 3N6RA 1XMOL 3I4LA 4U673 1PYWD 2NYZD 1Q12A 2XVSA 3K81C 2EOTA 3TP5A 2G9DA 3TQYA 3L2PA 2NVXH 2PZTA 5JEAJ 4UP7A 1O7YA 2JA8H 1XMOQ 1RL2A 3FVQA 1M90C 1HRJA 3KLSX 1OXTA 1T9HA 2SNMA 1SYEA 4XDXA 5E4XA 1U4RA 2QEJC 3WOEA 4CDFC 3RLOA 2ID0A 2KOLA 4CJ0B 2BDOA 2FMCA 3RZDB 1PLFA 1VQEA 2EJGC 2JQOA 3FKIH 1VQJA 2JA8B 1XYIA 4QB4A 4B9WA 4NB3A 4A76A 2JA7G 3EJIA 4DAYA 4FF1A 2ZTDA 3C1EA 1A15A 3BG3A 3MC0B 4K2KA 4DK6C 3GTPH 3HOUH 2LXKA 3S1MB 4F88A 1EY9A 2F0GA 4K8IA 4LUZA 5D14A 2PO4A 3K7UC 4IFDH 4GN5A 3I72A 2EQSA 5EJWA 2NZOA 4TKOB 4PV1C 1ML0D 1ONLA 3S2DH 1EUJA 3TS2A 4FVMA 2IL8A 3C3LA 4A3JG 2RDHA 3J81E 2QKIC 3QB3A 3NENA 1QOHA 1S5FD 4KLKA 4JBWA 4EQPA 4MNOA 4DV4Q 2ENBA 1S3OA 1QVCA 1L1OA 5K36H 3OMGA 1AFPA 2BH2A 1G91A 4BBRH 1DXMA 1X6OA 1VQCA 4GS3A 2N49A 2CW0C 2A1AA 2F0UA 2AWOA 1IW7D 5LMUL 1MI2A 5CR3A 3CRKC 5E7NA 2C9OA 2HDLA 2QEXA 4BY1B 5JJZA 3S15H 1N33L 4JVZA 5ELEA 1DOKA 5CV9A 1J5EL 3S2HB 4RCNA 4JV5L 4GOPB 2ZXPA 2KCMA 2R7ZH 1KLGD 5CV7A 2K32A 3M4QA 3HOYB 3ULLA 2LXJA 1N33Q 3N52A 4NXNL 5J39A 1WTOA 1J5EQ 2EE1A 4LF8L 4KI0A 4JI0L 5M3MH 2O4XA 1QCBD 4IN3A 2EIFA 5I9PA 1BUVT 1HZAA 4YY3L 4GLVB 4JC0A 3NTKA 1KDBA 2LY7A 3R93A 3HOXG 4HJ7A 4NXNQ 2NTSA 2J7ZA 4LF8Q 1CTMA 1ENCA 3NELA 3T1HL 1AZQA 4JI0Q 4K5VA 1B53A 4A3DG 1ASYA 4MHEA 1CSPA 2D0OA 4KD3A 1VQLA 1NMGA 2Q8IB 5KGUA 2ES2A 3L3OC 1Y1WH 4LF5Q 4YY3Q 5C0XJ 1RDPD 2NVTB 1IKMA 4KY7A 3H0GH 4UPAA 3CCLA 3T1HQ 4RG1A 2XNAC 1S5DD 1X9NA 4WFN3 4QUCA 4KY5A 3F8TA 1B44D 2A74C 2K6AA 5C3EG 5LMNW 3KF8B 1PRTC 2EYOA 3E3XA 3GTOH 3S1RB 1X3GA 1PDQA 1GUSA 5J3BA 5FO8B 4K6DA 5I4DA 2E2JB 2QDBA 3STBD 1VQIA 1YNJD 4KHPL 1RTOA 4A4IA 2ALYB 4AQYL 4JBKA 1XMQL 1TWFH 1M8AA 1YVCA 1SE8A 1SNCA 3DUZA 1U0LA 4GNXC 2WKCA 4FDBA 1PZID 1ZKOA 4Q5VA 4PQXA 5GROA 2DY8A 1VQPA 4Y52H 1JCKB 5G3LF 3S1NH 5KNCA 4KHPQ 2L1BA 4ZAIA 4AQYQ 3I4MB 1XMQQ 2ATWA 1HZ9A 1BCPB 1IBML 3GTJH 2FINB 2NVYH 1X3QA 2AQ2B 1VQ8A 3GTLH 1WCMG 3GTQB 2E2IH 1JOOA 2MUYA 2I07B 3S1NB 2B63B 3HOVH 1IBMQ 5I2XA 3TDQA 1GJXA 1NAPA 2JYOA 3RMHA 1D6EC 2OWOA 2K33A 3MTSA 2VUMG 3K7AB 3DWAA 3OYYA 3PO3B 1TXYA 5C4XG 2F0DA 5H1SE 1VQGA 4GN4B 5BN3A 5IOCA 3H09A 5T1IA 4X6AH 3HOZG 2QW7A 1TS4A 2WB1B 5KNDA 4DV0L 4O2DA 4H44C 3PV0A 5CYUA 4DUYL 1D5ZC 3RLNA 4DAYB 1IYJB 1KL9A 2O5IC 1SYDA 4JBJA 1A62A 1WI5A 2F3WA 1STGA 1EEID 3NHHA 4DUYQ 4QJFA 4A3LH 3I56A 4DUZL 4JBMA 4N8FA 1U5KA 4OGQC 2B2YA 5IT9c 4A93B 4A3KH 2M2LA 2HCCA 5C0XI 3GV6A 1SYBA 2RDGA 2CW0D 3IAYA 1H9MA 1Q86C 3CC2A 3GTKH 4A3CG 4KKTA 2F0PA 4BBSB 1NUCA 3GQBA 1NCVA 2F0QA 4IZ8A 1YHQA 2NN6G 1I4GA 1NMFA 1L1OB 1Q3LA 4LFCQ 5IYDG 3I8ZA 2GN5A 4IALA 1ICWA 2R7DA 3KLWA 1JC7A 3OW2A 4B3RL 3A8IE 2KBNA 1YZ6A 3TZDA 1GUOA 4MN3A 4C1NK 4IPCA 2A8VA 1LTLA 1PTOH 4A3IH 4IFDJ 3HFZB 2VZAA 5JOBA 1D5XC 1QNUA 5HY6A 2ICEC 1NR2A 5BR8L 4LW1A 3C46A 2E75C 2ZM6L 2L0CA 2RHSB 3B6YA 3UDIA 1AH9A 3L9AX 4PZ7A 1KRTA 1Y69U 3GO5A 3JAMc 4OX9L 1YJ9A 4LWCA 4P75A 4X65L 1SNOA 3GDEA 3OW7A 2N78A 2F4VL 2UXDQ 3CQZB 3NBHA 1RD9D 1QJOA 1CQFA 4K14A 5DM63 1PH3A 4KV6A 2SEBD 2J4XA 2JA7H 2IW3A 1I4QA 2WV6D 2F4VQ 5M5XH 4KY6A 1F9QA 1PRTD 4OO1H 1O80A 1D2BA 1NY4A 4CKEA 4GKKQ 5DNFA 4DGZA 1STBA 4I7ZC 3G6JB 1HA6A 3BYTB 4C1NI 2JE6I 4OIKA 2EVBA 4YIJA 4X3TA 1UNSA 3UE0A 2YV5A 3H94A 4LF6L 1LTRD 4RFBA 4XQJA 2I0QA 1YHAA 2BE5C 4GLXA 3SK6A 2YYZA 2AMCB 1WJJA 4CJ1B 4A3JH 4BY1G 4JI4L 4DF7A 2RA4A 1DGSA 1Q8IA 1LABA 4LF6Q 1V1QA 4FNFA 1KXLA 4CBVA 4CHTB 4ZLTF 2QCPX 4LUVA 4ZUIA 1TIID 1X65A 1VQ6A 1SE3A 1ICFB 5CC4A 2HHHL 2XN9C 3OIPA 4MZ9A 1WYDA 3PMFA 1WTRA 2RSOA 2IJ0A 5TSSA 3J80L 1STYA 3PIOA 4DAPA 3IKJA 3KOJA 1HTPA 4IJHA 2PQEA 4HJ9A 5EPLA 2HHHQ 2IHEA 3S17H 1P8LA 5CMDA 2ZJQA 1S5CD 2DNCA 5EGTA 4P72A 1BBXC 2PQAB 3OMCA 2I46A 1CKNA 1TY2A 1BBWA 3PUXA 1E24A 1SLJA 4L5RC 2F0KA 2CFMA 3VR3A 4RGOS 3BDCA 1ENFA 2UUBL 1K0RA 1E2WA 1PV4A 3SHLA 2F0HA 1GHJA 3BZCA 5L37A 1I94L 4IFDI 1SRUA 1AE2A 3NQTA 4DR7L 5KIXA 1SYGA 5DAUA 1VQ9A 2Q2IA 3HOXH 3PO2B 3FDTA 1H9RA 1I94Q 2PW7A 4RA8A 3V96A 2L9HA 4DR5L 4A3DH 4ILWA 3E0JA 3M3YB 3NQIA 1KIXA 4DR7Q 4DR3L 1C9OA 5KRUA 4L6TB 2K50A 1PTOF 1JORA 3HOXB 1QG7A 4X3KA 2A6HC 2ICIA 4DR5Q 1EEFD 4CDEC 2VQEL 1QUQB 1PFNA 3S16H 4DR3Q 1V1PB 3V2TA 2PPBC 3Q0AA 4GNXA 1S4ZA 1IYVA 2R93G 2H1EA 5BN5A 4XIGS 2VQEQ 5M5WB 3S16B 2PNHA 5A35A 5FOBB 1K8AC 5C3EB 1HNXQ 1D7QA 2EXDA 2HQEA 3AU7A 1H9KA 2KCCA 1UEBA 2WB1E 1SNPA 3U4ZA 2B63G 4BY7B 1G6PA 2E2DC 3TP8A 2HIVA 3MXPA 3LNNA 3K57A 1LACA 1ZEQX 5KNBA 1RHPA 3BJUA 1IYUA 1LUZA 1PH2A 2EY1A 3VYRA 4P74A 3DLLA 2LSSA 3BYYB 1PH5A 2ZTCA 3I2ZA 5KYLA 3K5MA 1CKMA 1IBKL 2CHBD 3PO3G 3Q22A 2XTIA 2NBFA 2MQHA 1KC8C 1FGBD 2GVBA 4IUTA 1EIGA 3TN2A 1D5MC 1WCMH 3A56A 1LTSD 4ME3A 2UUCL 1C7YA 2HCIA 3H3VH 1IBLL 4FO2A 2WB1G 2RF4A 3D8GA 5IYBG 2CCZA 1VQNA 1IBKQ 3BDLA 3RD4A 3VR2A 1I50H 2K5WA 4M8AA 1XPOA 3RNUA 1TS3A 1UUPA 1PMRA 3RZOH 4N8X1 3NE5B 2UUCQ 2VUMH 1MJCA 1HUMA 1IBLQ 3ONAB 1DJRD 2QDLA 2WIIB 1XWEA 5C4XH 1GVPA 1MJEA 2Z1CA 4A93G 1VF7A 3NBHB 2EJFC 2HDMA 4DFAA 1LT4D 1TKWB 2F1MA 1XNQQ 3E6ZX 4RGMA 3RR5A 5K5PA 3Q6SA 3ULPA 1WTHA 1UE5A 2BE5D 1M4VA 1WD1A 4J6HA 5C3XA 1B1ZA 3FP9A 1FL0A 1CKOA 3OTOL 1MD2D 3HOZB 1I3QH 1ET6A 3BDOA 2B2VC 4K5WA 4PZ6A 1YI2A 4A3BB 1II3A 1WD0A 3VR6A 3L0OA 4OWXB 5IYCH 2K7VA 2KEDA 1SNDA 1DONA 1W6KA 2EZVA 4WORA 2UUAQ 2A69C 4R4OA 5EBCA 2R6GA 1N34L 1EQVA 2NN6H 1B9NA 4RMFA 1JWMD 5IYDH 1AP0A 1T5XD 1KDAA 1XX8A 2K03A 3DEPA 3C1FA 3LWEA 2PZWA 1N34Q 2NZ1D 4R4CA 4P71A 1R4QB 1UAPA 5EBDA 3RZDH 1X54A 1STAA 2KHJA 3JC66 5D3IB 1JWSD 5EPJA 4EVOA 5CGKA 1QZHA 2GA4B 2RKSA 4R4TA 4UAIA 2IPKD 1JWUD 1JJ2A 4M1UB 4RH6A 2XGTA 3VYSA 4DAMA 5M5YB 3BZKA 3CPFA 2F0NA 3CC7A 2ASBA 4OONA 1IKLA 4NXML 4R8IA 3S1MH 3CW2C 1CKNB 1EIYB 3SVMA 3KBGA 4HJ5A 5DM73 3QOLA 2F0WA 2DNEA 1U9RA 4C2MB 5C44B 2K05A 3A54A 1Z7TA 1XJVA 4NXMQ 2A6HD 1S5ED 3OWEB 2DJGC 1N8RC 3FMCA 2OT2A 3K5OA 3ULJA 3D31A 2FXQA 4XYOA 3J7YW 4IO9A 4ULLA 1OXUA 5CV5A 1PRTB 3CCRA 3MEFA 4MTKA 4OHJA 1EU3A 3D4DA 3R2TA 4P73A 3HKSA 1C48A 2MNAA 2B2TC 2MPMA 1TWCB 2CVRA 4UP8A 2B2WC 3I4OA 2PZUA 2K1BA 3PQIA 4JYAL 5FLMH 4P2CB 1H95A 1EYCA 4GNXB 4NKLA 1SE4A 4TRDA 1VMPA 4BY1H 4S3SA 4E6IA 1RTNA 4HIDA 3S2HH 4YWMA 1A3TA 1UE6A 2K75A 2ZJRA 3TP7A 2XWJB 2J0TD 3K59A 1MGSA 4YCVA 2NZHA 4R4IA 1X55A 2Q8RE 3WOFA 3BVZA 3VYUA 4PG3A 3HOYH 3TMEA 1BF4A 1HH2P 5LL6X 1V43A 4HTHA 4OXPA 3J80i 3TEHB 3E9HA 2Q2HA 2AUKA 2A6EC 5ELNA 5JPNC 2R3ZA 5LMUQ 1SAPA 1STNA 4IUVA 4PNYA 1GUTA 1K83B 3T51B 2F0MA 2L4NA 1WTQA 3BS1A 2WKDA 3PO2G 1EQTA 4G7OC 4HCSA 2QGQA 3MXNA 4JV5Q 1BBUA 2DY7A 1F2ZA 4ZQ3A 4YCWA 3GTGB 3W5OA 2P5ZX 3FEWX 2EYLA 3G6EA 4WRDA 2JEBI 2L55A 4PMWA 4F7XA 4OO1I 2WFWA 2C35B 1SJHD 2NVTH 1LT6D 2B8GA 4A3GB 1DM0B 4WJ3M 4JI7L 3CCEA 5C3WA 1VQBA 4HSVA 1GUNA 2ZJPA 3UDGA 3R3OA 5DLQE 1J6QA 2E76C 3IFDA 3AFQA 3S1RH 4JI7Q 1TQOA 2RDFA 2E2JH 2XSCA 5C4JB 3CPWA 1A0IA 3T1YL 2EYPA 2X6LA 5IT9E 4Z9CB 5ELDA 4BY7G 4LUOA 2F0SA 3DXJC 5HURA 5GAHC 1JQYD 3OPOA 1Q81C 4I65A 2LS01 2A69D 2KVMA 2A68C 4JOIC 1D8LA 5LMNL 5EKLA 3K0XA 3KLRA 3I4MH 2R93H 1QZGA 4IUPA 3MWYW 2FFKB 4AIMA 1SMYC 2DJFC 2YTYA 1W6JA 1Z6HA 4R9WA 3SK4A 1Y1VB 3GTQH 1MKHA 1E2ZA 4RHRA 3DWPA 1E1TA 5LMNQ 2I5HA 1ZYRC 3P7JA 2B63H 2YU9B 2JA6B 1VQOA 4B3ML 2R93B 1LTGD 5ISRA 3V05A 1F2MA 4CKBA 4HMJA 4DN4M 2NWGA 3MHBA 1NTGA 3NBIA 1KRSA 3K7AH 4F87A 5IGFA 4QL5A 3PO3H 3JAME 1Q7YC 4I7AA 1KABA 2K01A 1PFMA 2Z9HA 2XRSD 4B3TL 1FR3A
chains in the Genus database with same CATH topology
5HGQA 1GKHA 2OTJA 3CMEA 1WOCA 5JEAG 4DV4L 2I0QA 1YHAA 5IYBH 1IL2A 4GLXA 3K80C 2YYZA 2AMCB 1WJJA 4A3JH 2IX0A 3PF4A 4BY1G 4GN3B 5AJ3L 4GOPC 4JI4L 1YIJA 1WFQA 1DGSA 4POFA 4LFBQ 4JYAQ 4LF6Q 4LF9L 1V1QA 1HNZL 4IPGA 1KXLA 1MIUA 4QY7A 5EAYA 1K83H 1P16A 4LF4L 3PIPA 1OXVA 2NVQH 3KDFA 1K3RA 3U50C 4JG2A 1PYBA 2DGYA 4LUVA 2E8GA 3GTMH 1Q8KA 1X65A 2UU9L 1VQ6A 4J15A 3PGZA 1XNQL 3I7FA 4O0AA 5AJ3Q 2VQFL 2E5LL 4A3BG 3GTGH 2WAQG 5FJ8H 1FVIA 4A93H 2DUDA 4LF9Q 1SROA 2HHHL 4MZ9A 1WYDA 4LF4Q 4A3FH 3TREA 3UDXA 4DV6L 3HOWH 3J7ZC 4DV0Q 1PFSA 2Q2UA 4B3SQ 4A3GH 3F2CA 1VQ5A 3PIOA 4IPHA 3JAMi 2UU9Q 3KOJA 4IJHA 2VQFQ 3PUZA 4DR2L 4BBSH 4HJ9A 1EFWA 4A3LG 4BXXH 2V1CC 5FLXc 2IHEA 2VY3A 2N8NA 2HHHQ 1P8LA 3S17H 4BBSG 1E22A 2ZJQA 4P72A 4A3EH 1YJNA 2PQAB 4DV6Q 4HJAA 2E2HH 4HIMA 1CKNA 4A3KG 3S24A 1BBWA 3PUXA 5JJLA 1E24A 1SLJA 4L5RC 2CFMA 3AQQA 3KJOA 4DUZQ 1PH1A 4A3MG 4IJLA 4DR2Q 2UUBL 1K0RA 5IP7H 2PI2A 1PV4A 1YJWA 2UUAL 4DPGA 3E9IA 2PI2E 3BZCA 1I94L 3L7ZC 4IFDI 5C4JH 3PF5A 5IP9H 1LYLA 1SRUA 1TWHH 3F2DA 1AE2A 1PH8A 2MO0A 5M3FG 4X66L 4DR7L 1VQDA 2RCNA 1EOVA 1YHBA 2UXBL 3H3VI 1VQ9A 1JB7A 2Q2IA 1GD7A 1S40A 3HOXH 2Z6KC 2AHOB 4LF5L 1EQQA 1I94Q 4JCVE 1X56A 3STBC 2CWPA 3LGJA 4DR5L 3U58A 3KFUA 2B3GA 4A3DH 1CUKA 3TRZA 1XPRA 3F2BA 4X66Q 1KIXA 4DR3L 4JI6L 4A3IG 1C9OA 2QA4A 4DR7Q 2UXBQ 2K4KA 3AYHB 1B8AA 2H5XA 3PCOB 1BVSA 4JI5L 3WWVA 4B3RQ 2VW9A 2K50A 3PUWA 2BA1A 3DM3A 3ERSX 1XMOL 1Y1VH 3CQZH 5C44G 4DR5Q 3K8AA 3T1YQ 2YTXA 1BKBA 2VQEL 1QUQB 1Q12A 1PYSB 5BR8Q 4JI6Q 4DR3Q 3S16H 1YEZA 3K81C 3D0FA 2MFIA 4APVA 3TQYA 3L2PA 4DR1L 2NVXH 2RHQB 2YU9H 4GNXA 2ZM6Q 2JA6H 5JEAJ 2CQOA 4UP7A 2A19A 1Q1EA 2JA8H 1XMOQ 4L5TA 1RL2A 2R93G 2N3SA 4OWTB 4EX5A 1M90C 1OXTA 4XIGS 3ICEA 3MXNB 1T9HA 2VQEQ 3G71A 3RLOA 2IX1A 2ID0A 2PNHA 4DR1Q 2JJQA 2VS1A 2OTLA 4YCUA 4OX9Q 1K8AC 1HNXQ 1D7QA 2EXDA 5JJKA 1VQEA 2JQOA 1UEBA 2WB1E 1VQJA 3FKIH 3U4ZA 4X65Q 3J81c 2B63G 4NB3A 4A76A 1QVGA 2JA7G 1G6PA 2B29A 2HIVA 1M1KC 2ZTDA 2JA9A 1G51A 4DK6C 3G4SA 3GTPH 3HOUH 2D0PA 2LXKA 3BJUA 1LUZA 4B3MQ 1PH2A 1SN8A 5C0XG 4P74A 3DLLA 2LSSA 4QIWE 2ZTCA 3I2ZA 1PH5A 2YTVA 1CKMA 1IBKL 3PO3G 4LUZA 1UE7A 2Z0SA 3W1GA 2XTIA 3K7UC 4GN5A 2MQHA 1KC8C 2EQSA 2GVBA 2NZOA 1K9MC 2NN6I 1PHJA 1WCMH 1Y14B 2PQAA 4ME3A 1HR0W 1C7YA 2UUCL 3H3VH 1IBLL 1PH9A 2K14A 2WB1G 2RF4A 5IYBG 2CCZA 3S2DH 1EUJA 1VQNA 3TS2A 1IBKQ 1JMCA 4A3JG 1ASZA 1I50H 4B3TQ 4DR4L 3NENA 1XPOA 4KLKA 1SR3A 4JBWA 3RNUA 3CCUA 4MNOA 4BA1I 2OQ0A 4C3HH 4DV4Q 3S1QH 3RZOH 1S3OA 2UUCQ 1QVCA 1NE3A 1MJCA 3EIVA 1L1OA 1VQHA 4AH6A 1IBLQ 2VUMH 2BH2A 4BBRH 3A0JA 4JI4Q 3A74A 1VQFA 2HQLA 5K36G 4AYBE 5C4XH 1HNZQ 1X6OA 2VL6A 4DR4Q 5IWAL 1GVPA 1VQCA 1MJEA 5FJ8G 1CSQA 4A93G 4GS3A 2N49A 3NBHB 4UP9A 2WP8J 2A1AA 3Q8DA 4DV5L 2AWOA 4A3FG 2AKWB 5LMUL 1S72A 2UXCL 1UWVA 3HOWG 1XNQQ 2E5LQ 3RR5A 1N36L 1X3EA 4A3GG 3ULPA 5E7NA 1I5FA 2QEXA 5IWAQ 1IZ6A 4JI1L 1UE5A 2OCEA 1N33L 2HT1A 3S15H 4DV3L 3EN2A 4TVAB 4BXXG 1J5EL 4DV5Q 3CCSA 4JV5L 4GOPB 3FP9A 1FL0A 1CKOA 2KCMA 1QUQA 2R7ZH 3OTOL 4A3EG 1GM5A 1I3QH 3ER0A 3KF6A 2R7ZG 1N36Q 3PO2H 1EYGA 3M4QA 3I4NH 4AYBG 1YI2A 4PZ6A 3CCVA 3ULLA 4JI1Q 3J81i 2LXJA 1N33Q 4DV3Q 5IP7G 4NXNL 3CD6A 3M3YH 3L0OA 1J5EQ 4LF8L 4KI0A 4JI0L 4OWXB 1UE1A 5M3MH 5IP9G 5IYCH 4POGA 5ELOA 4L5SA 2EIFA 4LNQA 2R7FA 4A75A 4X62L 5IYCG 2UUBQ 3CMAA 1HZAA 4YY3L 2UUAQ 4LFCL 3M9BA 3H15A 2CWAA 4GLVB 4JC0A 4R4OA 3HOXG 4HJ7A 4NXNQ 1VQ7A 4LF8Q 2KCTA 3NELA 3T1HL 4JI0Q 2R6GA 1N34L 2IT1A 4A3DG 1PH7A 1ASYA 1CSPA 4RMFA 2D0OA 4C3JH 1VQLA 5IYDH 4X62Q 1NMGA 3KDFB 2ES2A 1Y1WH 4LF5Q 4YY3Q 5C0XJ 1K73C 3CCJA 1JJGA 1OXXK 5GAEC 4JOIA 4YWKA 2K5NA 3H0GH 4UPAA 3A5UA 3RN5A 1KQSA 3T1HQ 3CCLA 2VNUD 1B7YB 1Y1VG 5M5WH 4RG1A 2F3IA 1N34Q 4R4CA 4P71A 3ZJYC 1X9NA 1XNRL 3H0GG 3M4PA 3RZDH 4JI5Q 1X54A 2K5VA 5C3EH 2KHJA 3F8TA 3JC66 4BY7H 1VCIA 3SGIA 2JA6G 5C3EG 3J80c 5LMNW 3KF8B 1QZHA 2IY5B 3RN2A 4R4TA 2JA8G 3GTOH 1JJ2A 2I5LX 1PA6A 1X3GA 1XNRQ 2JEAI 2XGTA 4DAMA 5J3BA 3BZKA 3CPFA 3CC7A 2ASBA 4OONA 2UXDL 4NXML 4DNIA 3S1MH 3CW2C 3STBD 1CKNB 1I6HH 1EIYB 1IXRA 1HZCA 3AEVA 1VQIA 1GO3E 1JT8A 5JJIA 4HJ5A 1N9WA 1AE3A 2K5HA 4KHPL 4A4IA 3FKIG 2ALYB 4AQYL 4JBKA 1XMQL 1TWFH 4PZ8A 1OXSC 1YVCA 1SE8A 1U0LA 4GNXC 4LF7L 4FDBA 1XJVA 4NXMQ 2R92H 5GROA 3CXCA 3HOUG 1N8RC 3M85A 1VQPA 4L5QA 1YITA 4Y7NH 4Y52H 3ULJA 3S1NH 4KHPQ 4MTNA 1HNWL 3J81j 4DV7L 4GKKL 3CP0A 3D31A 4AQYQ 1X3FA 1XMQQ 2FXQA 2ATWA 1HZ9A 1IBML 1NBWA 4LF7Q 3GTJH 4IFDG 4IO9A 3NEMA 1OXUA 3CCRA 4GOPA 3MEFA 1HJPA 1V9PA 2NVYH 1Q46A 1TWAH 1WCMG 1VQ8A 3GTLH 2E2IH 4BA2I 3PUYA 1HNWQ 4P73A 3HKSA 3CCQA 4XTCS 5IY0A 2MNAA 3CF5A 2JA5H 3HOVH 4IOCA 1IBMQ 1YBYA 1QVFA 1VQKA 3G48A 4UP8A 3I4OA 1NJIC 1FJGL 1KD1C 1HR0L 4JYAL 2GVAA 5FLMH 2OWOA 1EWIA 3GD7A 1H95A 3I55A 2VUMG 4GNXB 5FLMG 4BY1H 2HIXA 2IHFA 4BBRG 3OYYA 4HIDA 4DV2L 1Q1BA 3S2HH 1TXYA 4YWMA 3W1BA 4DKAC 1XTDA 1UE6A 3PUVA 4DR6L 2K75A 2ZTEA 2ZJRA 5C4XG 1FJGQ 1HR0Q 2MO1A 5H1SE 1VQGA 3HOZH 1A63A 3KYHC 4GN4B 4YCVA 2NZHA 1TWGH 4R4IA 1X55A 2KENA 4X6AH 3HOZG 4PG3A 4GLAC 3HOYH 1PH4A 4DV0L 1L0WA 4B3SL 4O2DA 1HH2P 3CC4A 1V43A 3PV0A 4A3BH 1VS0A 4OXPA 3J80i 4DUYL 3TEHB 3E9HA 4KHZA 4DV2Q 2Q2TA 3HOYG 2Q2HA 3RLNA 1Z9FA 1Q82C 4DR6Q 3F1ZA 1L1OC 4OWWB 2KHIA 4DAYB 1PVOA 5ELNA 4GKJL 2UXCQ 5LMUQ 1IYJB 3AFPA 1KL9A 3M7NA 1E3PA 4JBJA 1O7IA 4YHHL 1A62A 1WI5A 1SMXA 1SFOH 3PO2G 3KJPA 4DUYQ 4QJFA 3I4NG 2QGQA 3I56A 4DUZL 3TS0A 4JBMA 1W3SA 4A3LH 3UDFA 4JV5Q 1BBUA 1U5KA 4YCWA 3OTOQ 1JE5A 3W5OA 5GAGC 2Z6KA 5IT9c 4GKJQ 4A3KH 4K0KL 3G6EA 4OO1I 2JEBI 4PMWA 5M3MG 2WFWA 4YHHQ 5C0XI 2C35B 4A3MH 4A3CH 5GADC 2JK8A 2NVTH 3S14H 1Q86C 3CC2A 3GTKH 4A3CG 4WJ3M 1VQMA 4JI7L 3CCEA 4R1JA 1VQBA 1HZBA 4HJ8A 4JI3L 2ZJPA 5M3FH 4DV1L 4K0KQ 1YHQA 3M4OH 2NN6G 3UDGA 3CCMA 5GQOA 2Y0SE 1NMFA 1L1OB 4LFCQ 5DLQE 5IYDG 4YWLA 1J6QA 2GN5A 1EIFA 2R7DA 3KLWA 5IE8A 3OW2A 1Y1WG 3AFQA 3S1RH 4B3RL 1N32L 4JI7Q 2BA0A 1E1OA 2F52A 2KBNA 1YZ6A 2OQKA 3BU2A 5M5YH 4JI3Q 2CKZB 3FHWA 4R4QA 4DV1Q 4EQ5A 4IPCA 2A8VA 1LTLA 3CPWA 3PSIA 4HIKA 4A3IH 2E2JH 1A0IA 2VZAA 3CAMA 3HFZB 4X64L 5HY6A 3T1YL 4IFDJ 1L2FA 1C0AA 5BR8L 4LW1A 4DK3C 4WJ4A 4BY7G 3RLFA 2ZM6L 4C2MH 4LUOA 1KHIA 2PMZE 2AWNA 5GAHC 5C44H 4JI2L 2K52A 4NPSA 4HIOA 1FGUA 1Q81C 3UE1A 2RHSB 3B6YA 1N32Q 4JI8L 4X64Q 3UDIA 2Y0SG 1AH9A 4PZ7A 4C3IH 3HKZE 4JOIC 1KRTA 1W2BA 1D8LA 3GO5A 3JAMc 5LMNL 4LFAL 3KF6B 3K0XA 4OX9L 3I4MH 1LM0A 1RIPA 1QZGA 2R93H 1YJ9A 1HNXL 4JI2Q 4AIMA 2YTYA 3VDYA 1B70B 4H02A 4LWCA 1EQRA 4P75A 1R9TH 3J7A5 4X65L 3I4MG 3GDEA 2F4VL 2N78A 2UXDQ 4QGUA 4JI8Q 3U4VA 3GTQH 1MKHA 4LFAQ 4ALPA 2BH8A 1E1TA 4TQUS 5LMNQ 1K8GA 2I5HA 2R92G 4UY8C 1G291 3A5ZB 2B63H 1VQOA 1PH3A 4B3ML 1TWCH 2JA7H 3EBEA 2F4VQ 2L15A 5M5XH 3E0EA 1VQ4A 1XPUA 1NTGA 3HKZG 3IRBA 1NY4A 1KRSA 3K7AH 4DV7Q 1Z47A 4QL5A 4GKKQ 4OO1G 1OTCA 2D62A 2I5MX 3PO3H 2JE6I 1E7ZA 1Q7YC 1VQAA 2JA5G 1JJCB 1A8VA 3HOVG 1PH6A 2WAQE 4IOAA 4IPDA 2YV5A 3UE0A 4LFBL 4LF6L 1YNXA 1KAWA 4B3TL 4QQBX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HGQ A;  1GKH A;  2OTJ A;  3CME A;  1WOC A;  5JEA G;  4DV4 L;  2I0Q A;  1YHA A;  5IYB H;  1IL2 A;  4GLX A;  3K80 C;  2YYZ A;  2AMC B;  1WJJ A;  4A3J H;  2IX0 A;  3PF4 A;  4BY1 G;  4GN3 B;  5AJ3 L;  4GOP C;  4JI4 L;  1YIJ A;  1WFQ A;  1DGS A;  4POF A;  4LFB Q;  4JYA Q;  4LF6 Q;  4LF9 L;  1V1Q A;  1HNZ L;  4IPG A;  1KXL A;  1MIU A;  4QY7 A;  5EAY A;  1K83 H;  1P16 A;  4LF4 L;  3PIP A;  1OXV A;  2NVQ H;  3KDF A;  1K3R A;  3U50 C;  4JG2 A;  1PYB A;  2DGY A;  4LUV A;  2E8G A;  3GTM H;  1Q8K A;  1X65 A;  2UU9 L;  1VQ6 A;  4J15 A;  3PGZ A;  1XNQ L;  3I7F A;  4O0A A;  5AJ3 Q;  2VQF L;  2E5L L;  4A3B G;  3GTG H;  2WAQ G;  5FJ8 H;  1FVI A;  4A93 H;  2DUD A;  4LF9 Q;  1SRO A;  2HHH L;  4MZ9 A;  1WYD A;  4LF4 Q;  4A3F H;  3TRE A;  3UDX A;  4DV6 L;  3HOW H;  3J7Z C;  4DV0 Q;  1PFS A;  2Q2U A;  4B3S Q;  4A3G H;  3F2C A;  1VQ5 A;  3PIO A;  4IPH A;  3JAM i;  2UU9 Q;  3KOJ A;  4IJH A;  2VQF Q;  3PUZ A;  4DR2 L;  4BBS H;  4HJ9 A;  1EFW A;  4A3L G;  4BXX H;  2V1C C;  5FLX c;  2IHE A;  2VY3 A;  2N8N A;  2HHH Q;  1P8L A;  3S17 H;  4BBS G;  1E22 A;  2ZJQ A;  4P72 A;  4A3E H;  1YJN A;  2PQA B;  4DV6 Q;  4HJA A;  2E2H H;  4HIM A;  1CKN A;  4A3K G;  3S24 A;  1BBW A;  3PUX A;  5JJL A;  1E24 A;  1SLJ A;  4L5R C;  2CFM A;  3AQQ A;  3KJO A;  4DUZ Q;  1PH1 A;  4A3M G;  4IJL A;  4DR2 Q;  2UUB L;  1K0R A;  5IP7 H;  2PI2 A;  1PV4 A;  1YJW A;  2UUA L;  4DPG A;  3E9I A;  2PI2 E;  3BZC A;  1I94 L;  3L7Z C;  4IFD I;  5C4J H;  3PF5 A;  5IP9 H;  1LYL A;  1SRU A;  1TWH H;  3F2D A;  1AE2 A;  1PH8 A;  2MO0 A;  5M3F G;  4X66 L;  4DR7 L;  1VQD A;  2RCN A;  1EOV A;  1YHB A;  2UXB L;  3H3V I;  1VQ9 A;  1JB7 A;  2Q2I A;  1GD7 A;  1S40 A;  3HOX H;  2Z6K C;  2AHO B;  4LF5 L;  1EQQ A;  1I94 Q;  4JCV E;  1X56 A;  3STB C;  2CWP A;  3LGJ A;  4DR5 L;  3U58 A;  3KFU A;  2B3G A;  4A3D H;  1CUK A;  3TRZ A;  1XPR A;  3F2B A;  4X66 Q;  1KIX A;  4DR3 L;  4JI6 L;  4A3I G;  1C9O A;  2QA4 A;  4DR7 Q;  2UXB Q;  2K4K A;  3AYH B;  1B8A A;  2H5X A;  3PCO B;  1BVS A;  4JI5 L;  3WWV A;  4B3R Q;  2VW9 A;  2K50 A;  3PUW A;  2BA1 A;  3DM3 A;  3ERS X;  1XMO L;  1Y1V H;  3CQZ H;  5C44 G;  4DR5 Q;  3K8A A;  3T1Y Q;  2YTX A;  1BKB A;  2VQE L;  1QUQ B;  1Q12 A;  1PYS B;  5BR8 Q;  4JI6 Q;  4DR3 Q;  3S16 H;  1YEZ A;  3K81 C;  3D0F A;  2MFI A;  4APV A;  3TQY A;  3L2P A;  4DR1 L;  2NVX H;  2RHQ B;  2YU9 H;  4GNX A;  2ZM6 Q;  2JA6 H;  5JEA J;  2CQO A;  4UP7 A;  2A19 A;  1Q1E A;  2JA8 H;  1XMO Q;  4L5T A;  1RL2 A;  2R93 G;  2N3S A;  4OWT B;  4EX5 A;  1M90 C;  1OXT A;  4XIG S;  3ICE A;  3MXN B;  1T9H A;  2VQE Q;  3G71 A;  3RLO A;  2IX1 A;  2ID0 A;  2PNH A;  4DR1 Q;  2JJQ A;  2VS1 A;  2OTL A;  4YCU A;  4OX9 Q;  1K8A C;  1HNX Q;  1D7Q A;  2EXD A;  5JJK A;  1VQE A;  2JQO A;  1UEB A;  2WB1 E;  1VQJ A;  3FKI H;  3U4Z A;  4X65 Q;  3J81 c;  2B63 G;  4NB3 A;  4A76 A;  1QVG A;  2JA7 G;  1G6P A;  2B29 A;  2HIV A;  1M1K C;  2ZTD A;  2JA9 A;  1G51 A;  4DK6 C;  3G4S A;  3GTP H;  3HOU H;  2D0P A;  2LXK A;  3BJU A;  1LUZ A;  4B3M Q;  1PH2 A;  1SN8 A;  5C0X G;  4P74 A;  3DLL A;  2LSS A;  4QIW E;  2ZTC A;  3I2Z A;  1PH5 A;  2YTV A;  1CKM A;  1IBK L;  3PO3 G;  4LUZ A;  1UE7 A;  2Z0S A;  3W1G A;  2XTI A;  3K7U C;  4GN5 A;  2MQH A;  1KC8 C;  2EQS A;  2GVB A;  2NZO A;  1K9M C;  2NN6 I;  1PHJ A;  1WCM H;  1Y14 B;  2PQA A;  4ME3 A;  1HR0 W;  1C7Y A;  2UUC L;  3H3V H;  1IBL L;  1PH9 A;  2K14 A;  2WB1 G;  2RF4 A;  5IYB G;  2CCZ A;  3S2D H;  1EUJ A;  1VQN A;  3TS2 A;  1IBK Q;  1JMC A;  4A3J G;  1ASZ A;  1I50 H;  4B3T Q;  4DR4 L;  3NEN A;  1XPO A;  4KLK A;  1SR3 A;  4JBW A;  3RNU A;  3CCU A;  4MNO A;  4BA1 I;  2OQ0 A;  4C3H H;  4DV4 Q;  3S1Q H;  3RZO H;  1S3O A;  2UUC Q;  1QVC A;  1NE3 A;  1MJC A;  3EIV A;  1L1O A;  1VQH A;  4AH6 A;  1IBL Q;  2VUM H;  2BH2 A;  4BBR H;  3A0J A;  4JI4 Q;  3A74 A;  1VQF A;  2HQL A;  5K36 G;  4AYB E;  5C4X H;  1HNZ Q;  1X6O A;  2VL6 A;  4DR4 Q;  5IWA L;  1GVP A;  1VQC A;  1MJE A;  5FJ8 G;  1CSQ A;  4A93 G;  4GS3 A;  2N49 A;  3NBH B;  4UP9 A;  2WP8 J;  2A1A A;  3Q8D A;  4DV5 L;  2AWO A;  4A3F G;  2AKW B;  5LMU L;  1S72 A;  2UXC L;  1UWV A;  3HOW G;  1XNQ Q;  2E5L Q;  3RR5 A;  1N36 L;  1X3E A;  4A3G G;  3ULP A;  5E7N A;  1I5F A;  2QEX A;  5IWA Q;  1IZ6 A;  4JI1 L;  1UE5 A;  2OCE A;  1N33 L;  2HT1 A;  3S15 H;  4DV3 L;  3EN2 A;  4TVA B;  4BXX G;  1J5E L;  4DV5 Q;  3CCS A;  4JV5 L;  4GOP B;  3FP9 A;  1FL0 A;  1CKO A;  2KCM A;  1QUQ A;  2R7Z H;  3OTO L;  4A3E G;  1GM5 A;  1I3Q H;  3ER0 A;  3KF6 A;  2R7Z G;  1N36 Q;  3PO2 H;  1EYG A;  3M4Q A;  3I4N H;  4AYB G;  1YI2 A;  4PZ6 A;  3CCV A;  3ULL A;  4JI1 Q;  3J81 i;  2LXJ A;  1N33 Q;  4DV3 Q;  5IP7 G;  4NXN L;  3CD6 A;  3M3Y H;  3L0O A;  1J5E Q;  4LF8 L;  4KI0 A;  4JI0 L;  4OWX B;  1UE1 A;  5M3M H;  5IP9 G;  5IYC H;  4POG A;  5ELO A;  4L5S A;  2EIF A;  4LNQ A;  2R7F A;  4A75 A;  4X62 L;  5IYC G;  2UUB Q;  3CMA A;  1HZA A;  4YY3 L;  2UUA Q;  4LFC L;  3M9B A;  3H15 A;  2CWA A;  4GLV B;  4JC0 A;  4R4O A;  3HOX G;  4HJ7 A;  4NXN Q;  1VQ7 A;  4LF8 Q;  2KCT A;  3NEL A;  3T1H L;  4JI0 Q;  2R6G A;  1N34 L;  2IT1 A;  4A3D G;  1PH7 A;  1ASY A;  1CSP A;  4RMF A;  2D0O A;  4C3J H;  1VQL A;  5IYD H;  4X62 Q;  1NMG A;  3KDF B;  2ES2 A;  1Y1W H;  4LF5 Q;  4YY3 Q;  5C0X J;  1K73 C;  3CCJ A;  1JJG A;  1OXX K;  5GAE C;  4JOI A;  4YWK A;  2K5N A;  3H0G H;  4UPA A;  3A5U A;  3RN5 A;  1KQS A;  3T1H Q;  3CCL A;  2VNU D;  1B7Y B;  1Y1V G;  5M5W H;  4RG1 A;  2F3I A;  1N34 Q;  4R4C A;  4P71 A;  3ZJY C;  1X9N A;  1XNR L;  3H0G G;  3M4P A;  3RZD H;  4JI5 Q;  1X54 A;  2K5V A;  5C3E H;  2KHJ A;  3F8T A;  3JC6 6;  4BY7 H;  1VCI A;  3SGI A;  2JA6 G;  5C3E G;  3J80 c;  5LMN W;  3KF8 B;  1QZH A;  2IY5 B;  3RN2 A;  4R4T A;  2JA8 G;  3GTO H;  1JJ2 A;  2I5L X;  1PA6 A;  1X3G A;  1XNR Q;  2JEA I;  2XGT A;  4DAM A;  5J3B A;  3BZK A;  3CPF A;  3CC7 A;  2ASB A;  4OON A;  2UXD L;  4NXM L;  4DNI A;  3S1M H;  3CW2 C;  3STB D;  1CKN B;  1I6H H;  1EIY B;  1IXR A;  1HZC A;  3AEV A;  1VQI A;  1GO3 E;  1JT8 A;  5JJI A;  4HJ5 A;  1N9W A;  1AE3 A;  2K5H A;  4KHP L;  4A4I A;  3FKI G;  2ALY B;  4AQY L;  4JBK A;  1XMQ L;  1TWF H;  4PZ8 A;  1OXS C;  1YVC A;  1SE8 A;  1U0L A;  4GNX C;  4LF7 L;  4FDB A;  1XJV A;  4NXM Q;  2R92 H;  5GRO A;  3CXC A;  3HOU G;  1N8R C;  3M85 A;  1VQP A;  4L5Q A;  1YIT A;  4Y7N H;  4Y52 H;  3ULJ A;  3S1N H;  4KHP Q;  4MTN A;  1HNW L;  3J81 j;  4DV7 L;  4GKK L;  3CP0 A;  3D31 A;  4AQY Q;  1X3F A;  1XMQ Q;  2FXQ A;  2ATW A;  1HZ9 A;  1IBM L;  1NBW A;  4LF7 Q;  3GTJ H;  4IFD G;  4IO9 A;  3NEM A;  1OXU A;  3CCR A;  4GOP A;  3MEF A;  1HJP A;  1V9P A;  2NVY H;  1Q46 A;  1TWA H;  1WCM G;  1VQ8 A;  3GTL H;  2E2I H;  4BA2 I;  3PUY A;  1HNW Q;  4P73 A;  3HKS A;  3CCQ A;  4XTC S;  5IY0 A;  2MNA A;  3CF5 A;  2JA5 H;  3HOV H;  4IOC A;  1IBM Q;  1YBY A;  1QVF A;  1VQK A;  3G48 A;  4UP8 A;  3I4O A;  1NJI C;  1FJG L;  1KD1 C;  1HR0 L;  4JYA L;  2GVA A;  5FLM H;  2OWO A;  1EWI A;  3GD7 A;  1H95 A;  3I55 A;  2VUM G;  4GNX B;  5FLM G;  4BY1 H;  2HIX A;  2IHF A;  4BBR G;  3OYY A;  4HID A;  4DV2 L;  1Q1B A;  3S2H H;  1TXY A;  4YWM A;  3W1B A;  4DKA C;  1XTD A;  1UE6 A;  3PUV A;  4DR6 L;  2K75 A;  2ZTE A;  2ZJR A;  5C4X G;  1FJG Q;  1HR0 Q;  2MO1 A;  5H1S E;  1VQG A;  3HOZ H;  1A63 A;  3KYH C;  4GN4 B;  4YCV A;  2NZH A;  1TWG H;  4R4I A;  1X55 A;  2KEN A;  4X6A H;  3HOZ G;  4PG3 A;  4GLA C;  3HOY H;  1PH4 A;  4DV0 L;  1L0W A;  4B3S L;  4O2D A;  1HH2 P;  3CC4 A;  1V43 A;  3PV0 A;  4A3B H;  1VS0 A;  4OXP A;  3J80 i;  4DUY L;  3TEH B;  3E9H A;  4KHZ A;  4DV2 Q;  2Q2T A;  3HOY G;  2Q2H A;  3RLN A;  1Z9F A;  1Q82 C;  4DR6 Q;  3F1Z A;  1L1O C;  4OWW B;  2KHI A;  4DAY B;  1PVO A;  5ELN A;  4GKJ L;  2UXC Q;  5LMU Q;  1IYJ B;  3AFP A;  1KL9 A;  3M7N A;  1E3P A;  4JBJ A;  1O7I A;  4YHH L;  1A62 A;  1WI5 A;  1SMX A;  1SFO H;  3PO2 G;  3KJP A;  4DUY Q;  4QJF A;  3I4N G;  2QGQ A;  3I56 A;  4DUZ L;  3TS0 A;  4JBM A;  1W3S A;  4A3L H;  3UDF A;  4JV5 Q;  1BBU A;  1U5K A;  4YCW A;  3OTO Q;  1JE5 A;  3W5O A;  5GAG C;  2Z6K A;  5IT9 c;  4GKJ Q;  4A3K H;  4K0K L;  3G6E A;  4OO1 I;  2JEB I;  4PMW A;  5M3M G;  2WFW A;  4YHH Q;  5C0X I;  2C35 B;  4A3M H;  4A3C H;  5GAD C;  2JK8 A;  2NVT H;  3S14 H;  1Q86 C;  3CC2 A;  3GTK H;  4A3C G;  4WJ3 M;  1VQM A;  4JI7 L;  3CCE A;  4R1J A;  1VQB A;  1HZB A;  4HJ8 A;  4JI3 L;  2ZJP A;  5M3F H;  4DV1 L;  4K0K Q;  1YHQ A;  3M4O H;  2NN6 G;  3UDG A;  3CCM A;  5GQO A;  2Y0S E;  1NMF A;  1L1O B;  4LFC Q;  5DLQ E;  5IYD G;  4YWL A;  1J6Q A;  2GN5 A;  1EIF A;  2R7D A;  3KLW A;  5IE8 A;  3OW2 A;  1Y1W G;  3AFQ A;  3S1R H;  4B3R L;  1N32 L;  4JI7 Q;  2BA0 A;  1E1O A;  2F52 A;  2KBN A;  1YZ6 A;  2OQK A;  3BU2 A;  5M5Y H;  4JI3 Q;  2CKZ B;  3FHW A;  4R4Q A;  4DV1 Q;  4EQ5 A;  4IPC A;  2A8V A;  1LTL A;  3CPW A;  3PSI A;  4HIK A;  4A3I H;  2E2J H;  1A0I A;  2VZA A;  3CAM A;  3HFZ B;  4X64 L;  5HY6 A;  3T1Y L;  4IFD J;  1L2F A;  1C0A A;  5BR8 L;  4LW1 A;  4DK3 C;  4WJ4 A;  4BY7 G;  3RLF A;  2ZM6 L;  4C2M H;  4LUO A;  1KHI A;  2PMZ E;  2AWN A;  5GAH C;  5C44 H;  4JI2 L;  2K52 A;  4NPS A;  4HIO A;  1FGU A;  1Q81 C;  3UE1 A;  2RHS B;  3B6Y A;  1N32 Q;  4JI8 L;  4X64 Q;  3UDI A;  2Y0S G;  1AH9 A;  4PZ7 A;  4C3I H;  3HKZ E;  4JOI C;  1KRT A;  1W2B A;  1D8L A;  3GO5 A;  3JAM c;  5LMN L;  4LFA L;  3KF6 B;  3K0X A;  4OX9 L;  3I4M H;  1LM0 A;  1RIP A;  1QZG A;  2R93 H;  1YJ9 A;  1HNX L;  4JI2 Q;  4AIM A;  2YTY A;  3VDY A;  1B70 B;  4H02 A;  4LWC A;  1EQR A;  4P75 A;  1R9T H;  3J7A 5;  4X65 L;  3I4M G;  3GDE A;  2F4V L;  2N78 A;  2UXD Q;  4QGU A;  4JI8 Q;  3U4V A;  3GTQ H;  1MKH A;  4LFA Q;  4ALP A;  2BH8 A;  1E1T A;  4TQU S;  5LMN Q;  1K8G A;  2I5H A;  2R92 G;  4UY8 C;  1G29 1;  3A5Z B;  2B63 H;  1VQO A;  1PH3 A;  4B3M L;  1TWC H;  2JA7 H;  3EBE A;  2F4V Q;  2L15 A;  5M5X H;  3E0E A;  1VQ4 A;  1XPU A;  1NTG A;  3HKZ G;  3IRB A;  1NY4 A;  1KRS A;  3K7A H;  4DV7 Q;  1Z47 A;  4QL5 A;  4GKK Q;  4OO1 G;  1OTC A;  2D62 A;  2I5M X;  3PO3 H;  2JE6 I;  1E7Z A;  1Q7Y C;  1VQA A;  2JA5 G;  1JJC B;  1A8V A;  3HOV G;  1PH6 A;  2WAQ E;  4IOA A;  4IPD A;  2YV5 A;  3UE0 A;  4LFB L;  4LF6 L;  1YNX A;  1KAW A;  4B3T L;  4QQB X; 
#chains in the Genus database with same CATH topology
 4H0L C;  5IYB H;  1D1K A;  1JR0 D;  1OO9 B;  2NTT A;  5AJ3 L;  3S9W A;  4GOP C;  1YIJ A;  5DEH A;  1WFQ A;  1HNZ L;  5EAY A;  3FPU B;  1F9R A;  2LKV A;  2NVQ H;  4G7Z C;  1K3R A;  3U50 C;  4JG2 A;  1PYB A;  2EYH A;  4IUU A;  2E8G A;  4EQN A;  1PZJ D;  2UU9 L;  4J15 A;  5AJ3 Q;  2E5L L;  4A3B G;  1XXG A;  4RKB A;  2KJX A;  5COY A;  2CQA A;  1FVI A;  4A93 H;  2B2V A;  4CDC C;  2EYM A;  3D6W A;  1CT1 D;  2EYJ A;  3DWQ A;  4DNR B;  1KNA A;  4C3H B;  3S1Q B;  1AEX A;  2NVQ B;  4DV0 Q;  3PIP 3;  3F2C A;  1SEB D;  4IPH A;  3NK9 A;  4KTA A;  2UU9 Q;  1LTA D;  1FNW A;  2NUC A;  4DR2 L;  4BBS H;  2EY5 A;  5IGB A;  2VY3 A;  1E22 A;  4HIM A;  3VYT A;  1I6V C;  5JJL A;  1F9S A;  3EFX D;  4ZK9 B;  4DUZ Q;  3ERO A;  4IJL A;  4DR2 Q;  3EA6 A;  4XYQ A;  4DPG A;  3KLS A;  1JOK A;  3PF5 A;  1LYL A;  2TMP A;  4ID6 A;  3F2D A;  1PH8 A;  3AMU A;  1K8M A;  5A2Q E;  3FRP B;  4K2L A;  1VQD A;  2KQ3 A;  3R2I A;  2Z8L A;  3H3V I;  2A6E D;  4OIJ A;  1BR9 A;  1S40 A;  2Z6K C;  3I4N B;  3MZ5 A;  1EQQ A;  3HZX A;  1BQQ T;  2Q8T A;  2CWP A;  4OEL B;  2Z4H A;  2B3G A;  1RKN A;  2RSN A;  1CUK A;  5E4W C;  1MSG A;  4JI6 L;  2OF1 A;  3AYH B;  4JI5 L;  4B3R Q;  1FD7 D;  2F0T A;  3E5S A;  3W2D A;  1S5B D;  1TY0 A;  5CBE E;  3CQZ H;  5C44 G;  3QR8 A;  3K8A A;  5BR8 Q;  1HTL D;  1PYS B;  2CH4 W;  4IQZ A;  4JI6 Q;  2MFI A;  4APV A;  4DR1 L;  2RHQ B;  5C6A A;  4C3J B;  2ZM6 Q;  1Q1E A;  1STE A;  1EY5 A;  4FP5 D;  2JN4 A;  4EX5 A;  3ICE A;  3MXN B;  1B4O A;  3CKI B;  2KCN A;  4DR1 Q;  1KNE A;  4OX9 Q;  3G7L A;  1E0B A;  1QIL A;  3OSO A;  4X65 Q;  5FK9 C;  1K8O A;  2SNS A;  5E1F A;  2B29 A;  2B39 A;  2BOS A;  1CFM A;  4FF4 A;  2B2T A;  2Y0S B;  2PW5 A;  4LJZ C;  1F2L A;  2B2W A;  1I6H B;  1Y8P B;  1R4P B;  1UE7 A;  2A68 D;  3CRL C;  3I73 A;  1G2T A;  1NNX A;  3K5N A;  1K9M C;  2NN6 I;  1EYD A;  2MP1 A;  1SMY D;  5G3L D;  5M9O A;  1HR0 W;  2R92 B;  2FHT A;  5COR A;  2K14 A;  2PMZ B;  4Y7N B;  3O13 A;  1JMC A;  5J1Z A;  1ZYR D;  4LMQ D;  1GUG A;  1SR3 A;  4NDX A;  3CCU A;  3EIV A;  1QNK A;  5JVH 3;  5EPK A;  1TVX A;  1A3U A;  1TWA B;  5D65 A;  1WTV A;  1GHK A;  4JI4 Q;  3A74 A;  1VQF A;  5K36 G;  4CDD C;  2VL6 A;  2JA5 B;  1O78 A;  4U68 A;  1CSQ A;  4UP9 A;  4DV5 L;  2M00 A;  3Q8D A;  2AKW B;  2UXC L;  1UWV A;  2OEO A;  3VR4 A;  1N36 L;  1X3E A;  4A3G G;  1EY6 A;  1I5F A;  4HSP A;  1IZ6 A;  4JI1 L;  1EZ8 A;  4TVA B;  4DV5 Q;  3CCS A;  1ESF A;  2F0O A;  2O5J C;  1GM5 A;  2R7Z G;  1TWG B;  1N36 Q;  1EYG A;  3PO2 H;  1HUN A;  4IUN A;  4KKU A;  3CCV A;  4KMU C;  3J81 i;  4JI1 Q;  3CD6 A;  2BCO A;  3M3Y H;  1UE1 A;  1LT5 D;  3NUC A;  2L12 A;  4POG A;  3AB9 A;  3TSS A;  3I3C A;  2R7F A;  4B08 A;  4A75 A;  5LHY 1;  4X62 L;  2UUB Q;  4LNQ A;  1HFN A;  3CMA A;  4G57 A;  1LTI D;  3M9B A;  3H15 A;  4V19 0;  1SFO B;  1PTO C;  3ZYY X;  1CZG A;  1MHW C;  5EQ0 A;  2IT1 A;  3FPP A;  1CA5 A;  5I2Y A;  4X62 Q;  3W3A A;  2ZXR A;  1UEA B;  4A3M B;  4MIU A;  1K73 C;  1JJG A;  5GAE C;  4JOI A;  1QB5 D;  3S14 B;  4YWK A;  2VNU D;  3A5U A;  1KQS A;  5ELC A;  1B7Y B;  1Y1V G;  5M5W H;  2KEE A;  3ZJY C;  3H0G G;  3M4P A;  2TSS A;  5M3F B;  5C3E H;  3M4O B;  4BY7 H;  2RCF A;  2JA6 G;  3SGI A;  3J80 c;  4RKL A;  3RN2 A;  3TP6 A;  1PA6 A;  3DMU A;  2JEA I;  3QJY A;  1T5E A;  2HD3 A;  4ODG A;  1IXR A;  2M9V A;  1STH A;  1JT8 A;  1N9W A;  4PZ8 A;  1OXS C;  4HCE A;  4LF7 L;  1EL0 A;  1CHP D;  3CXC A;  4OL7 A;  3KUP A;  3M85 A;  1JOQ A;  4L5Q A;  4C3I B;  4IUQ A;  1Y8N B;  4ME5 A;  1HNW L;  4UDU C;  5CBA E;  3J81 j;  4DV7 L;  4HED A;  3MFY A;  3CP0 A;  1CZW A;  1SYC A;  3GP7 A;  4LF7 Q;  3X3N A;  3D4W A;  4L63 B;  4GOP A;  1DCZ A;  1HJP A;  4BA2 I;  1AZP A;  1HNW Q;  3TBI B;  3CF5 A;  2ZT9 C;  2F0F A;  3ITP A;  3P20 A;  1CA6 A;  1QVF A;  1VQK A;  3G48 A;  1H9S A;  1DZ1 A;  2WAC A;  5NUC A;  1NJI C;  1FJG L;  2RBM A;  4QCL A;  4C3H G;  4QUF A;  1C4Q A;  3GD7 A;  3Q23 A;  4DXF A;  1A3V A;  2F3V A;  5EKI A;  1A2U A;  4EQO A;  4GZY C;  2HIX A;  2IHF A;  3P75 A;  4PMB A;  1ROD A;  1SSO A;  2PCF B;  3QWN A;  3W1B A;  4DR6 L;  1XTD A;  3PUV A;  1FJG Q;  1VF5 C;  3HOZ H;  4O1N A;  4HN7 A;  2KHS A;  4ABN A;  1IL8 A;  4GLA C;  1EU4 A;  1L0W A;  4B3S L;  4A3B H;  2Q2T A;  3I70 A;  4DR6 Q;  1Z9F A;  3F1Z A;  2KHI A;  1PVO A;  4GKJ L;  3A55 A;  3AFP A;  4ZUJ A;  1PFB A;  1TU2 B;  4DA2 A;  1E3P A;  3I90 A;  1HPC A;  1O7I A;  2EYF A;  4QIW B;  3HRZ C;  4ZYS A;  3I4N G;  1W3S A;  5BN4 A;  4KJN A;  4FXD A;  5LL6 S;  4H13 C;  3X3M A;  5KYI A;  3OTO Q;  4GKJ Q;  2Z6K A;  1ZXT A;  4KHV A;  1IHZ A;  4A3C H;  3QOJ A;  5GAD C;  3HOW B;  3NP8 A;  2A73 B;  4OEM B;  1VQM A;  1HZB A;  4HJ8 A;  4DV1 L;  1EIH A;  3GV3 A;  3CCM A;  2Y0S E;  2E2H B;  4C3J G;  4YWL A;  4XQQ A;  4AYB B;  5IE8 A;  3J7A V;  4LAA A;  2F52 A;  3HP3 A;  2OQK A;  5M5Y H;  3FHW A;  4R4Q A;  4DV1 Q;  4EQ5 A;  3PSI A;  4HIK A;  1G2S A;  1FYC A;  1TWH B;  1L2F A;  3HG9 A;  3RLF A;  4C2M H;  2PMZ E;  5C44 H;  2AWN A;  4FYD A;  4RCO A;  4HIO A;  1FGU A;  4BS9 A;  1B50 A;  4ZCK A;  3NTI A;  3NTH A;  4JI8 L;  1F77 A;  2Y0S G;  1PTO D;  1W2B A;  5EKK A;  3VA5 A;  1LM0 A;  1G8Z D;  1RIP A;  1B70 B;  1XTC D;  2LMC B;  1R9T H;  5C5M A;  4WJW A;  4JI8 Q;  2N55 A;  5CV8 A;  1K8G A;  2BH8 A;  2R92 G;  2N88 A;  1G29 1;  2NVX B;  3A8J E;  1EWC A;  5FLX L;  1TWC H;  3EBE A;  4DAV A;  1SNQ A;  2L15 A;  1R9T B;  1MSH A;  2XRQ D;  4N9T A;  3ERQ A;  3H3V C;  3E0E A;  1O7L A;  3IRB A;  2B8F A;  1Z47 A;  4OO1 G;  3U9S A;  2D62 A;  2I5M X;  1SE2 A;  1GUW A;  1E7Z A;  3FKI B;  2JA5 G;  1JJC B;  1A8V A;  1PH6 A;  1SXT A;  1FNU A;  4LFB L;  1KAW A;  4QQB X;  4CKC A;  4IUR A;  4RWS C;  2OTJ A;  2K5Q A;  1WOC A;  5JEA G;  4DV4 L;  3GTP B;  3HOU B;  3K80 C;  2Z6B A;  5I6W A;  3M4Y A;  3SDZ A;  4POF A;  4LFB Q;  5I6Y A;  4QMG A;  2F0L A;  4JYA Q;  4LF9 L;  3NWS A;  4QY7 A;  1K83 H;  1K28 A;  1KLU D;  4LF4 L;  3KDF A;  2DGY A;  1FNV A;  4J1M A;  3GTM H;  3I7F A;  3MXU A;  4O0A A;  2VQF L;  3S2D B;  3OIQ A;  3GTG H;  2XIW A;  1X32 A;  4LF9 Q;  1SRO A;  2ZXO A;  4LF4 Q;  4KJO A;  4UHV A;  3WDN A;  3J7Z C;  2G9H D;  3HS0 C;  4A3G H;  1VQ5 A;  3IFT A;  2XWB B;  3GTM B;  2EY2 A;  2VQF Q;  3PUZ A;  4BBR B;  4BWG B;  2H4O A;  3OOC A;  4K6L A;  1EFW A;  2V1C C;  5FLX c;  2N8N A;  1X3P A;  3M7G A;  1CI3 M;  2L11 A;  3J81 L;  1PZK D;  4O42 A;  3AQQ A;  4A3M G;  2MHV A;  3PIO 3;  2PI2 A;  1MBY A;  3E9I A;  5C4J H;  3S15 B;  2X6G A;  5AFW A;  4RAU C;  1H9S B;  1AW7 A;  5M3F G;  1ENA A;  2R7Z B;  5JAV A;  1EOV A;  1H9J A;  4ZKC B;  1RF2 D;  2EXZ A;  1SBB B;  2AHO B;  4LF5 L;  5J22 A;  1X56 A;  4XT3 B;  3LGJ A;  3EQL C;  3U58 A;  2VXW A;  3KFU A;  3DM1 A;  2KUM A;  4B9X A;  5C4H A;  5M3M B;  2K4K A;  3A7L A;  1U4L A;  2H5X A;  1Y8O B;  2AQ3 B;  3PCO B;  3WWV A;  2VW9 A;  3PUW A;  2BA1 A;  3DM3 A;  1ESR A;  5ELF A;  3ERS X;  1U4P A;  1Y1V H;  3K5L A;  3T1Y Q;  1VDZ A;  2YTX A;  1BKB A;  1CQV A;  3T13 A;  2F0V A;  2SDF A;  1YEZ A;  3QG1 A;  3D0F A;  2C5C A;  2YU9 H;  3URY A;  2JA6 H;  2D5D A;  4C3I G;  2CQO A;  2A19 A;  3T53 B;  1Y1W B;  2OXP A;  1BDO A;  4L5T A;  3T56 B;  2N3S A;  4OWT B;  3H0G B;  1EOT A;  3G71 A;  2IX1 A;  1I4P A;  2JJQ A;  2VS1 A;  2VB3 X;  4YCU A;  2OTL A;  1ILP A;  1PRT F;  5JJK A;  1J9O A;  1JE4 A;  1WTX A;  3J81 c;  1HHV A;  5E3F A;  2B2U C;  1QVG A;  3TZU A;  1M1K C;  3GTO B;  2HUG A;  2JA9 A;  1EWH A;  4QF4 A;  1G51 A;  3G4S A;  2D0P A;  4B3M Q;  1C8C A;  1SN8 A;  5C0X G;  3T4A C;  1QWY A;  4QIW E;  2YTV A;  3W1G A;  2Z0S A;  1EFI D;  1KAA A;  2MJ8 A;  3A8K E;  5IT9 L;  4FXK C;  1I4R A;  1TWF B;  4FXG C;  1PHJ A;  3A7A B;  1Y14 B;  2EDG A;  2PQA A;  2DN8 A;  1PH9 A;  1SDF A;  1V8Q A;  3MXG A;  4K8J A;  1I4H A;  1ASZ A;  4H7B A;  4B3T Q;  4DR4 L;  4C3H H;  4BA1 I;  2OQ0 A;  2NB0 A;  3S1Q H;  3GTJ B;  2AQ1 B;  5KEE A;  3HKZ B;  1NE3 A;  1VQH A;  2MGS A;  4AH6 A;  2NVY B;  3EVQ A;  3GTL B;  2E2I B;  3A0J A;  1I4X A;  3U9O A;  2HQL A;  5I9O A;  4AYB E;  1EY0 A;  1HNZ Q;  4DR4 Q;  5IWA L;  1G6Z A;  2D2C C;  3HOV B;  4DXG A;  5FJ8 G;  2WP8 J;  3QIA A;  2JXM B;  5FO9 B;  3SE0 A;  1RCV D;  4G7H C;  4A3F G;  1LTT D;  1S72 A;  3HOW G;  2E5L Q;  2LFN A;  1HCZ A;  3MEH A;  5IWA Q;  1SYF A;  2OCE A;  1LLR D;  4JW0 A;  2HT1 A;  4DV3 L;  3EN2 A;  4BXX G;  3VR5 A;  1QUQ A;  4A3E G;  3JAM L;  3ER0 A;  1V1P A;  3KF6 A;  3I4N H;  3R8B A;  4AYB G;  1TS2 A;  4DV3 Q;  3H6M A;  2WAQ B;  5IP7 G;  4RGN A;  1ET9 A;  1TR5 A;  3BVG A;  5IP9 G;  5ELO A;  4L5S A;  1V1O A;  5IYC G;  4LFC L;  1J8I A;  2CWA A;  2A5H A;  3C2P A;  1VQ7 A;  2KCT A;  1BXT A;  1PH7 A;  2AUJ D;  4C3J H;  4A3K B;  3P1H A;  3KBX A;  3KDF B;  5C5L A;  3CCJ A;  4LK1 C;  1OXX K;  3SEB A;  3CHB D;  2K5N A;  3RN5 A;  3GTK B;  3QO2 A;  2F3I A;  1XNR L;  1NSN S;  4JI5 Q;  2K5V A;  1BCP C;  4G4K A;  1ILQ A;  1VCI A;  1LV9 A;  3F2U A;  1NR4 A;  2IY5 B;  2JA8 G;  4TSS A;  1E2V A;  2I5L X;  3DHQ A;  1F9P A;  1BCP F;  1XNR Q;  2F0J A;  3IL8 A;  4C56 C;  2O2L D;  2G5D A;  2F03 A;  3HEJ A;  2UXD L;  1PTO B;  5F2D A;  4DNI A;  4A3I B;  1I6H H;  2K28 A;  1HZC A;  3AEV A;  1GO3 E;  5JJI A;  1AE3 A;  2EY6 A;  2K5H A;  1HQR D;  3FKI G;  3J7A F;  5CV4 A;  5A2Q L;  2R92 H;  3I91 A;  3HOU G;  1YIT A;  4KK7 A;  4Y7N H;  4X3S A;  4MTN A;  4GKK L;  5IGE A;  1BO0 A;  1X3F A;  3J80 E;  1NBW A;  3SR1 A;  1JIC A;  4IFD G;  3K58 A;  4F8M A;  3NEM A;  1V9P A;  1Q46 A;  1TWA H;  2L5T A;  3PUY A;  2WIN B;  3CCQ A;  4XTC S;  5IY0 A;  2JA5 H;  1WTW A;  1DOL A;  4IOC A;  1YBY A;  2JA7 B;  1B3Q A;  5M5X B;  1KD1 C;  1HR0 L;  5JEA H;  2GVA A;  1YNN C;  5FO7 B;  1EWI A;  3I55 A;  5FLM G;  1Q90 A;  4BBR G;  4DV2 L;  2FJ2 A;  1Q1B A;  1HXY D;  4DKA C;  1TS5 A;  2RVL A;  2ZTE A;  1HR0 Q;  2MO1 A;  1CK1 A;  3KK7 A;  3KYH C;  1JB3 A;  5IIF A;  1A63 A;  3SXH A;  1TWG H;  2KEN A;  1VMC A;  1PH4 A;  4RHS A;  3D4R A;  4ZRZ A;  3MAQ A;  3CC4 A;  1VS0 A;  4DV2 Q;  3HOY G;  4KHZ A;  4XT1 B;  4A3J B;  1Q82 C;  5D3D A;  1L1O C;  4OWW B;  3H91 A;  5IGC A;  1WVL A;  2UXC Q;  1RJT A;  4Q0F A;  3LX0 A;  3M7N A;  1BOS A;  4YHH L;  4HMI A;  3Q24 A;  1SMX A;  1SFO H;  3MA2 B;  4DU9 A;  3KJP A;  3NWT A;  3TS0 A;  4KN4 C;  3UDF A;  2EJM A;  1K0S A;  1JE5 A;  5GAG C;  4K0K L;  5M3M G;  4YHH Q;  2CH4 A;  4A3M H;  2IX3 A;  2JK8 A;  3S14 H;  2KEC A;  2K5D A;  4R1J A;  1KTK A;  4JI3 L;  4R8N A;  5M3F H;  4K0K Q;  3S17 B;  3M4O H;  1CHQ D;  5GQO A;  4K5X A;  1EY8 A;  2V4D A;  2X69 A;  1SJE D;  4FF2 A;  1EIF A;  1Y1W G;  1BNZ A;  2BA0 A;  1E1O A;  4XXE A;  3BU2 A;  1EYA A;  1LTB D;  3OHX C;  4JI3 Q;  2CKZ B;  4CJ2 C;  1N32 L;  3CAM A;  4X64 L;  1C0A A;  2K04 A;  3NXW A;  2F4I A;  4DK3 C;  4EGV A;  4WJ4 A;  3DEO A;  2E74 C;  1KHI A;  2JP1 A;  4JI2 L;  2K52 A;  2KA7 A;  4NPS A;  3UE1 A;  5IGD A;  2QF7 A;  1N32 Q;  4X64 Q;  3ND8 A;  4A3D B;  2B2U A;  3SK8 A;  4L8J A;  1HA5 A;  3HKZ E;  4C3I H;  4LFA L;  1F2Y A;  3KF6 B;  3MFG A;  1HNX L;  4JI2 Q;  5C4Z A;  3VDY A;  4H02 A;  3OWF A;  1EQR A;  2BDN A;  3J7A 5;  3I4M G;  1AN8 A;  3K0Y A;  4QGU A;  1L0Y B;  3U4V A;  1WTP A;  4LFA Q;  2VB2 X;  4ALP A;  4TQU S;  4UY8 C;  3A5Z B;  5IGG A;  2QIL A;  5JVG 3;  5FKA C;  1BCP D;  3UI2 A;  4RGT A;  1O7Z A;  1HQM C;  3K6O A;  1U4M A;  3NPP A;  1VQ4 A;  5T1G A;  1XPU A;  3HKZ G;  1KDC A;  3SK5 A;  4HAE A;  3BZD B;  5C0X H;  3RUZ A;  4DV7 Q;  4DK1 A;  4V0B A;  3MVV A;  1EY4 A;  1OTC A;  3LWU A;  2EPB A;  1VQA A;  1IW7 C;  3HOV G;  2WAQ E;  3T16 A;  4IPD A;  4IOA A;  1YNX A;  5HGQ A;  1GKH A;  4J8Q A;  1CM9 A;  3CME A;  5IOD A;  3HGB A;  1IL2 A;  5CV6 A;  4KD4 A;  2PNR C;  2IX0 A;  3PF4 A;  4GN3 B;  1D1I A;  1A2T A;  4IPG A;  1MIU A;  1P16 A;  3PIP A;  3D6C A;  1OXV A;  2FMM A;  1HFG A;  1WCM B;  1A6X A;  1GOZ A;  2R61 A;  4X3U A;  1Q8K A;  3PGZ A;  1K3B C;  1SNM A;  4FF3 A;  1XNQ L;  2RQX A;  2F0I A;  4HR7 B;  1LT3 D;  2WAQ G;  5FJ8 H;  2DUD A;  1I50 B;  1B2T A;  4A3F H;  3TRE A;  3UDX A;  1B9M A;  4DV6 L;  3HOW H;  1DYQ A;  2Q2U A;  4B3S Q;  1PFS A;  3RZO B;  2VUM B;  3NSW A;  3JAM i;  5ELB A;  3KF8 A;  1YNN D;  5JPM C;  4DK0 A;  4ZKB B;  4A3L G;  4BXX H;  4KN7 C;  5HGT A;  5C4X B;  4NMZ A;  4BBS G;  4CGY B;  4A3E H;  2E2H H;  3ND9 A;  1YJN A;  4DV6 Q;  4HJA A;  4A3F B;  1LO5 D;  4A3K G;  3S24 A;  4KKS A;  2D9U A;  3KJO A;  1EY7 A;  1PH1 A;  1EZ6 A;  2JSO A;  5IP7 H;  1YJW A;  2UUA L;  2PI2 E;  2IWH A;  3L7Z C;  4JK1 C;  5IP9 H;  3CU7 A;  1TWH H;  3VA7 A;  3D3R A;  2SOB A;  4A3E B;  2MO0 A;  4X66 L;  4N9P A;  2RCN A;  4JPB W;  1YHB A;  2F0E A;  2UXB L;  1DD2 A;  1L0X B;  1JB7 A;  2B2Y C;  1I3Q B;  2PYK A;  1GD7 A;  2Z4I A;  1PXU A;  1TT2 A;  1GXD C;  4JCV E;  3STB C;  4PMC A;  1B3A A;  4NP5 A;  3TRZ A;  1YNJ C;  1XPR A;  5FLX E;  4DNT B;  4X66 Q;  3F2B A;  4A3I G;  2QA4 A;  4NW2 A;  2UXB Q;  1B8A A;  1BVS A;  1QE6 A;  4XQN A;  1DOM A;  3BVM A;  3N6R A;  1XMO L;  3I4L A;  4U67 3;  1PYW D;  2NYZ D;  1Q12 A;  2XVS A;  3K81 C;  2EOT A;  3TP5 A;  2G9D A;  3TQY A;  3L2P A;  2NVX H;  2PZT A;  5JEA J;  4UP7 A;  1O7Y A;  2JA8 H;  1XMO Q;  1RL2 A;  3FVQ A;  1M90 C;  1HRJ A;  3KLS X;  1OXT A;  1T9H A;  2SNM A;  1SYE A;  4XDX A;  5E4X A;  1U4R A;  2QEJ C;  3WOE A;  4CDF C;  3RLO A;  2ID0 A;  2KOL A;  4CJ0 B;  2BDO A;  2FMC A;  3RZD B;  1PLF A;  1VQE A;  2EJG C;  2JQO A;  3FKI H;  1VQJ A;  2JA8 B;  1XYI A;  4QB4 A;  4B9W A;  4NB3 A;  4A76 A;  2JA7 G;  3EJI A;  4DAY A;  4FF1 A;  2ZTD A;  3C1E A;  1A15 A;  3BG3 A;  3MC0 B;  4K2K A;  4DK6 C;  3GTP H;  3HOU H;  2LXK A;  3S1M B;  4F88 A;  1EY9 A;  2F0G A;  4K8I A;  4LUZ A;  5D14 A;  2PO4 A;  3K7U C;  4IFD H;  4GN5 A;  3I72 A;  2EQS A;  5EJW A;  2NZO A;  4TKO B;  4PV1 C;  1ML0 D;  1ONL A;  3S2D H;  1EUJ A;  3TS2 A;  4FVM A;  2IL8 A;  3C3L A;  4A3J G;  2RDH A;  3J81 E;  2QKI C;  3QB3 A;  3NEN A;  1QOH A;  1S5F D;  4KLK A;  4JBW A;  4EQP A;  4MNO A;  4DV4 Q;  2ENB A;  1S3O A;  1QVC A;  1L1O A;  5K36 H;  3OMG A;  1AFP A;  2BH2 A;  1G91 A;  4BBR H;  1DXM A;  1X6O A;  1VQC A;  4GS3 A;  2N49 A;  2CW0 C;  2A1A A;  2F0U A;  2AWO A;  1IW7 D;  5LMU L;  1MI2 A;  5CR3 A;  3CRK C;  5E7N A;  2C9O A;  2HDL A;  2QEX A;  4BY1 B;  5JJZ A;  3S15 H;  1N33 L;  4JVZ A;  5ELE A;  1DOK A;  5CV9 A;  1J5E L;  3S2H B;  4RCN A;  4JV5 L;  4GOP B;  2ZXP A;  2KCM A;  2R7Z H;  1KLG D;  5CV7 A;  2K32 A;  3M4Q A;  3HOY B;  3ULL A;  2LXJ A;  1N33 Q;  3N52 A;  4NXN L;  5J39 A;  1WTO A;  1J5E Q;  2EE1 A;  4LF8 L;  4KI0 A;  4JI0 L;  5M3M H;  2O4X A;  1QCB D;  4IN3 A;  2EIF A;  5I9P A;  1BUV T;  1HZA A;  4YY3 L;  4GLV B;  4JC0 A;  3NTK A;  1KDB A;  2LY7 A;  3R93 A;  3HOX G;  4HJ7 A;  4NXN Q;  2NTS A;  2J7Z A;  4LF8 Q;  1CTM A;  1ENC A;  3NEL A;  3T1H L;  1AZQ A;  4JI0 Q;  4K5V A;  1B53 A;  4A3D G;  1ASY A;  4MHE A;  1CSP A;  2D0O A;  4KD3 A;  1VQL A;  1NMG A;  2Q8I B;  5KGU A;  2ES2 A;  3L3O C;  1Y1W H;  4LF5 Q;  4YY3 Q;  5C0X J;  1RDP D;  2NVT B;  1IKM A;  4KY7 A;  3H0G H;  4UPA A;  3CCL A;  3T1H Q;  4RG1 A;  2XNA C;  1S5D D;  1X9N A;  4WFN 3;  4QUC A;  4KY5 A;  3F8T A;  1B44 D;  2A74 C;  2K6A A;  5C3E G;  5LMN W;  3KF8 B;  1PRT C;  2EYO A;  3E3X A;  3GTO H;  3S1R B;  1X3G A;  1PDQ A;  1GUS A;  5J3B A;  5FO8 B;  4K6D A;  5I4D A;  2E2J B;  2QDB A;  3STB D;  1VQI A;  1YNJ D;  4KHP L;  1RTO A;  4A4I A;  2ALY B;  4AQY L;  4JBK A;  1XMQ L;  1TWF H;  1M8A A;  1YVC A;  1SE8 A;  1SNC A;  3DUZ A;  1U0L A;  4GNX C;  2WKC A;  4FDB A;  1PZI D;  1ZKO A;  4Q5V A;  4PQX A;  5GRO A;  2DY8 A;  1VQP A;  4Y52 H;  1JCK B;  5G3L F;  3S1N H;  5KNC A;  4KHP Q;  2L1B A;  4ZAI A;  4AQY Q;  3I4M B;  1XMQ Q;  2ATW A;  1HZ9 A;  1BCP B;  1IBM L;  3GTJ H;  2FIN B;  2NVY H;  1X3Q A;  2AQ2 B;  1VQ8 A;  3GTL H;  1WCM G;  3GTQ B;  2E2I H;  1JOO A;  2MUY A;  2I07 B;  3S1N B;  2B63 B;  3HOV H;  1IBM Q;  5I2X A;  3TDQ A;  1GJX A;  1NAP A;  2JYO A;  3RMH A;  1D6E C;  2OWO A;  2K33 A;  3MTS A;  2VUM G;  3K7A B;  3DWA A;  3OYY A;  3PO3 B;  1TXY A;  5C4X G;  2F0D A;  5H1S E;  1VQG A;  4GN4 B;  5BN3 A;  5IOC A;  3H09 A;  5T1I A;  4X6A H;  3HOZ G;  2QW7 A;  1TS4 A;  2WB1 B;  5KND A;  4DV0 L;  4O2D A;  4H44 C;  3PV0 A;  5CYU A;  4DUY L;  1D5Z C;  3RLN A;  4DAY B;  1IYJ B;  1KL9 A;  2O5I C;  1SYD A;  4JBJ A;  1A62 A;  1WI5 A;  2F3W A;  1STG A;  1EEI D;  3NHH A;  4DUY Q;  4QJF A;  4A3L H;  3I56 A;  4DUZ L;  4JBM A;  4N8F A;  1U5K A;  4OGQ C;  2B2Y A;  5IT9 c;  4A93 B;  4A3K H;  2M2L A;  2HCC A;  5C0X I;  3GV6 A;  1SYB A;  2RDG A;  2CW0 D;  3IAY A;  1H9M A;  1Q86 C;  3CC2 A;  3GTK H;  4A3C G;  4KKT A;  2F0P A;  4BBS B;  1NUC A;  3GQB A;  1NCV A;  2F0Q A;  4IZ8 A;  1YHQ A;  2NN6 G;  1I4G A;  1NMF A;  1L1O B;  1Q3L A;  4LFC Q;  5IYD G;  3I8Z A;  2GN5 A;  4IAL A;  1ICW A;  2R7D A;  3KLW A;  1JC7 A;  3OW2 A;  4B3R L;  3A8I E;  2KBN A;  1YZ6 A;  3TZD A;  1GUO A;  4MN3 A;  4C1N K;  4IPC A;  2A8V A;  1LTL A;  1PTO H;  4A3I H;  4IFD J;  3HFZ B;  2VZA A;  5JOB A;  1D5X C;  1QNU A;  5HY6 A;  2ICE C;  1NR2 A;  5BR8 L;  4LW1 A;  3C46 A;  2E75 C;  2ZM6 L;  2L0C A;  2RHS B;  3B6Y A;  3UDI A;  1AH9 A;  3L9A X;  4PZ7 A;  1KRT A;  1Y69 U;  3GO5 A;  3JAM c;  4OX9 L;  1YJ9 A;  4LWC A;  4P75 A;  4X65 L;  1SNO A;  3GDE A;  3OW7 A;  2N78 A;  2F4V L;  2UXD Q;  3CQZ B;  3NBH A;  1RD9 D;  1QJO A;  1CQF A;  4K14 A;  5DM6 3;  1PH3 A;  4KV6 A;  2SEB D;  2J4X A;  2JA7 H;  2IW3 A;  1I4Q A;  2WV6 D;  2F4V Q;  5M5X H;  4KY6 A;  1F9Q A;  1PRT D;  4OO1 H;  1O80 A;  1D2B A;  1NY4 A;  4CKE A;  4GKK Q;  5DNF A;  4DGZ A;  1STB A;  4I7Z C;  3G6J B;  1HA6 A;  3BYT B;  4C1N I;  2JE6 I;  4OIK A;  2EVB A;  4YIJ A;  4X3T A;  1UNS A;  3UE0 A;  2YV5 A;  3H94 A;  4LF6 L;  1LTR D;  4RFB A;  4XQJ A;  2I0Q A;  1YHA A;  2BE5 C;  4GLX A;  3SK6 A;  2YYZ A;  2AMC B;  1WJJ A;  4CJ1 B;  4A3J H;  4BY1 G;  4JI4 L;  4DF7 A;  2RA4 A;  1DGS A;  1Q8I A;  1LAB A;  4LF6 Q;  1V1Q A;  4FNF A;  1KXL A;  4CBV A;  4CHT B;  4ZLT F;  2QCP X;  4LUV A;  4ZUI A;  1TII D;  1X65 A;  1VQ6 A;  1SE3 A;  1ICF B;  5CC4 A;  2HHH L;  2XN9 C;  3OIP A;  4MZ9 A;  1WYD A;  3PMF A;  1WTR A;  2RSO A;  2IJ0 A;  5TSS A;  3J80 L;  1STY A;  3PIO A;  4DAP A;  3IKJ A;  3KOJ A;  1HTP A;  4IJH A;  2PQE A;  4HJ9 A;  5EPL A;  2HHH Q;  2IHE A;  3S17 H;  1P8L A;  5CMD A;  2ZJQ A;  1S5C D;  2DNC A;  5EGT A;  4P72 A;  1BBX C;  2PQA B;  3OMC A;  2I46 A;  1CKN A;  1TY2 A;  1BBW A;  3PUX A;  1E24 A;  1SLJ A;  4L5R C;  2F0K A;  2CFM A;  3VR3 A;  4RGO S;  3BDC A;  1ENF A;  2UUB L;  1K0R A;  1E2W A;  1PV4 A;  3SHL A;  2F0H A;  1GHJ A;  3BZC A;  5L37 A;  1I94 L;  4IFD I;  1SRU A;  1AE2 A;  3NQT A;  4DR7 L;  5KIX A;  1SYG A;  5DAU A;  1VQ9 A;  2Q2I A;  3HOX H;  3PO2 B;  3FDT A;  1H9R A;  1I94 Q;  2PW7 A;  4RA8 A;  3V96 A;  2L9H A;  4DR5 L;  4A3D H;  4ILW A;  3E0J A;  3M3Y B;  3NQI A;  1KIX A;  4DR7 Q;  4DR3 L;  1C9O A;  5KRU A;  4L6T B;  2K50 A;  1PTO F;  1JOR A;  3HOX B;  1QG7 A;  4X3K A;  2A6H C;  2ICI A;  4DR5 Q;  1EEF D;  4CDE C;  2VQE L;  1QUQ B;  1PFN A;  3S16 H;  4DR3 Q;  1V1P B;  3V2T A;  2PPB C;  3Q0A A;  4GNX A;  1S4Z A;  1IYV A;  2R93 G;  2H1E A;  5BN5 A;  4XIG S;  2VQE Q;  5M5W B;  3S16 B;  2PNH A;  5A35 A;  5FOB B;  1K8A C;  5C3E B;  1HNX Q;  1D7Q A;  2EXD A;  2HQE A;  3AU7 A;  1H9K A;  2KCC A;  1UEB A;  2WB1 E;  1SNP A;  3U4Z A;  2B63 G;  4BY7 B;  1G6P A;  2E2D C;  3TP8 A;  2HIV A;  3MXP A;  3LNN A;  3K57 A;  1LAC A;  1ZEQ X;  5KNB A;  1RHP A;  3BJU A;  1IYU A;  1LUZ A;  1PH2 A;  2EY1 A;  3VYR A;  4P74 A;  3DLL A;  2LSS A;  3BYY B;  1PH5 A;  2ZTC A;  3I2Z A;  5KYL A;  3K5M A;  1CKM A;  1IBK L;  2CHB D;  3PO3 G;  3Q22 A;  2XTI A;  2NBF A;  2MQH A;  1KC8 C;  1FGB D;  2GVB A;  4IUT A;  1EIG A;  3TN2 A;  1D5M C;  1WCM H;  3A56 A;  1LTS D;  4ME3 A;  2UUC L;  1C7Y A;  2HCI A;  3H3V H;  1IBL L;  4FO2 A;  2WB1 G;  2RF4 A;  3D8G A;  5IYB G;  2CCZ A;  1VQN A;  1IBK Q;  3BDL A;  3RD4 A;  3VR2 A;  1I50 H;  2K5W A;  4M8A A;  1XPO A;  3RNU A;  1TS3 A;  1UUP A;  1PMR A;  3RZO H;  4N8X 1;  3NE5 B;  2UUC Q;  2VUM H;  1MJC A;  1HUM A;  1IBL Q;  3ONA B;  1DJR D;  2QDL A;  2WII B;  1XWE A;  5C4X H;  1GVP A;  1MJE A;  2Z1C A;  4A93 G;  1VF7 A;  3NBH B;  2EJF C;  2HDM A;  4DFA A;  1LT4 D;  1TKW B;  2F1M A;  1XNQ Q;  3E6Z X;  4RGM A;  3RR5 A;  5K5P A;  3Q6S A;  3ULP A;  1WTH A;  1UE5 A;  2BE5 D;  1M4V A;  1WD1 A;  4J6H A;  5C3X A;  1B1Z A;  3FP9 A;  1FL0 A;  1CKO A;  3OTO L;  1MD2 D;  3HOZ B;  1I3Q H;  1ET6 A;  3BDO A;  2B2V C;  4K5W A;  4PZ6 A;  1YI2 A;  4A3B B;  1II3 A;  1WD0 A;  3VR6 A;  3L0O A;  4OWX B;  5IYC H;  2K7V A;  2KED A;  1SND A;  1DON A;  1W6K A;  2EZV A;  4WOR A;  2UUA Q;  2A69 C;  4R4O A;  5EBC A;  2R6G A;  1N34 L;  1EQV A;  2NN6 H;  1B9N A;  4RMF A;  1JWM D;  5IYD H;  1AP0 A;  1T5X D;  1KDA A;  1XX8 A;  2K03 A;  3DEP A;  3C1F A;  3LWE A;  2PZW A;  1N34 Q;  2NZ1 D;  4R4C A;  4P71 A;  1R4Q B;  1UAP A;  5EBD A;  3RZD H;  1X54 A;  1STA A;  2KHJ A;  3JC6 6;  5D3I B;  1JWS D;  5EPJ A;  4EVO A;  5CGK A;  1QZH A;  2GA4 B;  2RKS A;  4R4T A;  4UAI A;  2IPK D;  1JWU D;  1JJ2 A;  4M1U B;  4RH6 A;  2XGT A;  3VYS A;  4DAM A;  5M5Y B;  3BZK A;  3CPF A;  2F0N A;  3CC7 A;  2ASB A;  4OON A;  1IKL A;  4NXM L;  4R8I A;  3S1M H;  3CW2 C;  1CKN B;  1EIY B;  3SVM A;  3KBG A;  4HJ5 A;  5DM7 3;  3QOL A;  2F0W A;  2DNE A;  1U9R A;  4C2M B;  5C44 B;  2K05 A;  3A54 A;  1Z7T A;  1XJV A;  4NXM Q;  2A6H D;  1S5E D;  3OWE B;  2DJG C;  1N8R C;  3FMC A;  2OT2 A;  3K5O A;  3ULJ A;  3D31 A;  2FXQ A;  4XYO A;  3J7Y W;  4IO9 A;  4ULL A;  1OXU A;  5CV5 A;  1PRT B;  3CCR A;  3MEF A;  4MTK A;  4OHJ A;  1EU3 A;  3D4D A;  3R2T A;  4P73 A;  3HKS A;  1C48 A;  2MNA A;  2B2T C;  2MPM A;  1TWC B;  2CVR A;  4UP8 A;  2B2W C;  3I4O A;  2PZU A;  2K1B A;  3PQI A;  4JYA L;  5FLM H;  4P2C B;  1H95 A;  1EYC A;  4GNX B;  4NKL A;  1SE4 A;  4TRD A;  1VMP A;  4BY1 H;  4S3S A;  4E6I A;  1RTN A;  4HID A;  3S2H H;  4YWM A;  1A3T A;  1UE6 A;  2K75 A;  2ZJR A;  3TP7 A;  2XWJ B;  2J0T D;  3K59 A;  1MGS A;  4YCV A;  2NZH A;  4R4I A;  1X55 A;  2Q8R E;  3WOF A;  3BVZ A;  3VYU A;  4PG3 A;  3HOY H;  3TME A;  1BF4 A;  1HH2 P;  5LL6 X;  1V43 A;  4HTH A;  4OXP A;  3J80 i;  3TEH B;  3E9H A;  2Q2H A;  2AUK A;  2A6E C;  5ELN A;  5JPN C;  2R3Z A;  5LMU Q;  1SAP A;  1STN A;  4IUV A;  4PNY A;  1GUT A;  1K83 B;  3T51 B;  2F0M A;  2L4N A;  1WTQ A;  3BS1 A;  2WKD A;  3PO2 G;  1EQT A;  4G7O C;  4HCS A;  2QGQ A;  3MXN A;  4JV5 Q;  1BBU A;  2DY7 A;  1F2Z A;  4ZQ3 A;  4YCW A;  3GTG B;  3W5O A;  2P5Z X;  3FEW X;  2EYL A;  3G6E A;  4WRD A;  2JEB I;  2L55 A;  4PMW A;  4F7X A;  4OO1 I;  2WFW A;  2C35 B;  1SJH D;  2NVT H;  1LT6 D;  2B8G A;  4A3G B;  1DM0 B;  4WJ3 M;  4JI7 L;  3CCE A;  5C3W A;  1VQB A;  4HSV A;  1GUN A;  2ZJP A;  3UDG A;  3R3O A;  5DLQ E;  1J6Q A;  2E76 C;  3IFD A;  3AFQ A;  3S1R H;  4JI7 Q;  1TQO A;  2RDF A;  2E2J H;  2XSC A;  5C4J B;  3CPW A;  1A0I A;  3T1Y L;  2EYP A;  2X6L A;  5IT9 E;  4Z9C B;  5ELD A;  4BY7 G;  4LUO A;  2F0S A;  3DXJ C;  5HUR A;  5GAH C;  1JQY D;  3OPO A;  1Q81 C;  4I65 A;  2LS0 1;  2A69 D;  2KVM A;  2A68 C;  4JOI C;  1D8L A;  5LMN L;  5EKL A;  3K0X A;  3KLR A;  3I4M H;  2R93 H;  1QZG A;  4IUP A;  3MWY W;  2FFK B;  4AIM A;  1SMY C;  2DJF C;  2YTY A;  1W6J A;  1Z6H A;  4R9W A;  3SK4 A;  1Y1V B;  3GTQ H;  1MKH A;  1E2Z A;  4RHR A;  3DWP A;  1E1T A;  5LMN Q;  2I5H A;  1ZYR C;  3P7J A;  2B63 H;  2YU9 B;  2JA6 B;  1VQO A;  4B3M L;  2R93 B;  1LTG D;  5ISR A;  3V05 A;  1F2M A;  4CKB A;  4HMJ A;  4DN4 M;  2NWG A;  3MHB A;  1NTG A;  3NBI A;  1KRS A;  3K7A H;  4F87 A;  5IGF A;  4QL5 A;  3PO3 H;  3JAM E;  1Q7Y C;  4I7A A;  1KAB A;  2K01 A;  1PFM A;  2Z9H A;  2XRS D;  4B3T L;  1FR3 A; 
#chains in the Genus database with same CATH homology
 5HGQ A;  1GKH A;  2OTJ A;  3CME A;  1WOC A;  5JEA G;  4DV4 L;  2I0Q A;  1YHA A;  5IYB H;  1IL2 A;  4GLX A;  3K80 C;  2YYZ A;  2AMC B;  1WJJ A;  4A3J H;  2IX0 A;  3PF4 A;  4BY1 G;  4GN3 B;  5AJ3 L;  4GOP C;  4JI4 L;  1YIJ A;  1WFQ A;  1DGS A;  4POF A;  4LFB Q;  4JYA Q;  4LF6 Q;  4LF9 L;  1V1Q A;  1HNZ L;  4IPG A;  1KXL A;  1MIU A;  4QY7 A;  5EAY A;  1K83 H;  1P16 A;  4LF4 L;  3PIP A;  1OXV A;  2NVQ H;  3KDF A;  1K3R A;  3U50 C;  4JG2 A;  1PYB A;  2DGY A;  4LUV A;  2E8G A;  3GTM H;  1Q8K A;  1X65 A;  2UU9 L;  1VQ6 A;  4J15 A;  3PGZ A;  1XNQ L;  3I7F A;  4O0A A;  5AJ3 Q;  2VQF L;  2E5L L;  4A3B G;  3GTG H;  2WAQ G;  5FJ8 H;  1FVI A;  4A93 H;  2DUD A;  4LF9 Q;  1SRO A;  2HHH L;  4MZ9 A;  1WYD A;  4LF4 Q;  4A3F H;  3TRE A;  3UDX A;  4DV6 L;  3HOW H;  3J7Z C;  4DV0 Q;  1PFS A;  2Q2U A;  4B3S Q;  4A3G H;  3F2C A;  1VQ5 A;  3PIO A;  4IPH A;  3JAM i;  2UU9 Q;  3KOJ A;  4IJH A;  2VQF Q;  3PUZ A;  4DR2 L;  4BBS H;  4HJ9 A;  1EFW A;  4A3L G;  4BXX H;  2V1C C;  5FLX c;  2IHE A;  2VY3 A;  2N8N A;  2HHH Q;  1P8L A;  3S17 H;  4BBS G;  1E22 A;  2ZJQ A;  4P72 A;  4A3E H;  1YJN A;  2PQA B;  4DV6 Q;  4HJA A;  2E2H H;  4HIM A;  1CKN A;  4A3K G;  3S24 A;  1BBW A;  3PUX A;  5JJL A;  1E24 A;  1SLJ A;  4L5R C;  2CFM A;  3AQQ A;  3KJO A;  4DUZ Q;  1PH1 A;  4A3M G;  4IJL A;  4DR2 Q;  2UUB L;  1K0R A;  5IP7 H;  2PI2 A;  1PV4 A;  1YJW A;  2UUA L;  4DPG A;  3E9I A;  2PI2 E;  3BZC A;  1I94 L;  3L7Z C;  4IFD I;  5C4J H;  3PF5 A;  5IP9 H;  1LYL A;  1SRU A;  1TWH H;  3F2D A;  1AE2 A;  1PH8 A;  2MO0 A;  5M3F G;  4X66 L;  4DR7 L;  1VQD A;  2RCN A;  1EOV A;  1YHB A;  2UXB L;  3H3V I;  1VQ9 A;  1JB7 A;  2Q2I A;  1GD7 A;  1S40 A;  3HOX H;  2Z6K C;  2AHO B;  4LF5 L;  1EQQ A;  1I94 Q;  4JCV E;  1X56 A;  3STB C;  2CWP A;  3LGJ A;  4DR5 L;  3U58 A;  3KFU A;  2B3G A;  4A3D H;  1CUK A;  3TRZ A;  1XPR A;  3F2B A;  4X66 Q;  1KIX A;  4DR3 L;  4JI6 L;  4A3I G;  1C9O A;  2QA4 A;  4DR7 Q;  2UXB Q;  2K4K A;  3AYH B;  1B8A A;  2H5X A;  3PCO B;  1BVS A;  4JI5 L;  3WWV A;  4B3R Q;  2VW9 A;  2K50 A;  3PUW A;  2BA1 A;  3DM3 A;  3ERS X;  1XMO L;  1Y1V H;  3CQZ H;  5C44 G;  4DR5 Q;  3K8A A;  3T1Y Q;  2YTX A;  1BKB A;  2VQE L;  1QUQ B;  1Q12 A;  1PYS B;  5BR8 Q;  4JI6 Q;  4DR3 Q;  3S16 H;  1YEZ A;  3K81 C;  3D0F A;  2MFI A;  4APV A;  3TQY A;  3L2P A;  4DR1 L;  2NVX H;  2RHQ B;  2YU9 H;  4GNX A;  2ZM6 Q;  2JA6 H;  5JEA J;  2CQO A;  4UP7 A;  2A19 A;  1Q1E A;  2JA8 H;  1XMO Q;  4L5T A;  1RL2 A;  2R93 G;  2N3S A;  4OWT B;  4EX5 A;  1M90 C;  1OXT A;  4XIG S;  3ICE A;  3MXN B;  1T9H A;  2VQE Q;  3G71 A;  3RLO A;  2IX1 A;  2ID0 A;  2PNH A;  4DR1 Q;  2JJQ A;  2VS1 A;  2OTL A;  4YCU A;  4OX9 Q;  1K8A C;  1HNX Q;  1D7Q A;  2EXD A;  5JJK A;  1VQE A;  2JQO A;  1UEB A;  2WB1 E;  1VQJ A;  3FKI H;  3U4Z A;  4X65 Q;  3J81 c;  2B63 G;  4NB3 A;  4A76 A;  1QVG A;  2JA7 G;  1G6P A;  2B29 A;  2HIV A;  1M1K C;  2ZTD A;  2JA9 A;  1G51 A;  4DK6 C;  3G4S A;  3GTP H;  3HOU H;  2D0P A;  2LXK A;  3BJU A;  1LUZ A;  4B3M Q;  1PH2 A;  1SN8 A;  5C0X G;  4P74 A;  3DLL A;  2LSS A;  4QIW E;  2ZTC A;  3I2Z A;  1PH5 A;  2YTV A;  1CKM A;  1IBK L;  3PO3 G;  4LUZ A;  1UE7 A;  2Z0S A;  3W1G A;  2XTI A;  3K7U C;  4GN5 A;  2MQH A;  1KC8 C;  2EQS A;  2GVB A;  2NZO A;  1K9M C;  2NN6 I;  1PHJ A;  1WCM H;  1Y14 B;  2PQA A;  4ME3 A;  1HR0 W;  1C7Y A;  2UUC L;  3H3V H;  1IBL L;  1PH9 A;  2K14 A;  2WB1 G;  2RF4 A;  5IYB G;  2CCZ A;  3S2D H;  1EUJ A;  1VQN A;  3TS2 A;  1IBK Q;  1JMC A;  4A3J G;  1ASZ A;  1I50 H;  4B3T Q;  4DR4 L;  3NEN A;  1XPO A;  4KLK A;  1SR3 A;  4JBW A;  3RNU A;  3CCU A;  4MNO A;  4BA1 I;  2OQ0 A;  4C3H H;  4DV4 Q;  3S1Q H;  3RZO H;  1S3O A;  2UUC Q;  1QVC A;  1NE3 A;  1MJC A;  3EIV A;  1L1O A;  1VQH A;  4AH6 A;  1IBL Q;  2VUM H;  2BH2 A;  4BBR H;  3A0J A;  4JI4 Q;  3A74 A;  1VQF A;  2HQL A;  5K36 G;  4AYB E;  5C4X H;  1HNZ Q;  1X6O A;  2VL6 A;  4DR4 Q;  5IWA L;  1GVP A;  1VQC A;  1MJE A;  5FJ8 G;  1CSQ A;  4A93 G;  4GS3 A;  2N49 A;  3NBH B;  4UP9 A;  2WP8 J;  2A1A A;  3Q8D A;  4DV5 L;  2AWO A;  4A3F G;  2AKW B;  5LMU L;  1S72 A;  2UXC L;  1UWV A;  3HOW G;  1XNQ Q;  2E5L Q;  3RR5 A;  1N36 L;  1X3E A;  4A3G G;  3ULP A;  5E7N A;  1I5F A;  2QEX A;  5IWA Q;  1IZ6 A;  4JI1 L;  1UE5 A;  2OCE A;  1N33 L;  2HT1 A;  3S15 H;  4DV3 L;  3EN2 A;  4TVA B;  4BXX G;  1J5E L;  4DV5 Q;  3CCS A;  4JV5 L;  4GOP B;  3FP9 A;  1FL0 A;  1CKO A;  2KCM A;  1QUQ A;  2R7Z H;  3OTO L;  4A3E G;  1GM5 A;  1I3Q H;  3ER0 A;  3KF6 A;  2R7Z G;  1N36 Q;  3PO2 H;  1EYG A;  3M4Q A;  3I4N H;  4AYB G;  1YI2 A;  4PZ6 A;  3CCV A;  3ULL A;  4JI1 Q;  3J81 i;  2LXJ A;  1N33 Q;  4DV3 Q;  5IP7 G;  4NXN L;  3CD6 A;  3M3Y H;  3L0O A;  1J5E Q;  4LF8 L;  4KI0 A;  4JI0 L;  4OWX B;  1UE1 A;  5M3M H;  5IP9 G;  5IYC H;  4POG A;  5ELO A;  4L5S A;  2EIF A;  4LNQ A;  2R7F A;  4A75 A;  4X62 L;  5IYC G;  2UUB Q;  3CMA A;  1HZA A;  4YY3 L;  2UUA Q;  4LFC L;  3M9B A;  3H15 A;  2CWA A;  4GLV B;  4JC0 A;  4R4O A;  3HOX G;  4HJ7 A;  4NXN Q;  1VQ7 A;  4LF8 Q;  2KCT A;  3NEL A;  3T1H L;  4JI0 Q;  2R6G A;  1N34 L;  2IT1 A;  4A3D G;  1PH7 A;  1ASY A;  1CSP A;  4RMF A;  2D0O A;  4C3J H;  1VQL A;  5IYD H;  4X62 Q;  1NMG A;  3KDF B;  2ES2 A;  1Y1W H;  4LF5 Q;  4YY3 Q;  5C0X J;  1K73 C;  3CCJ A;  1JJG A;  1OXX K;  5GAE C;  4JOI A;  4YWK A;  2K5N A;  3H0G H;  4UPA A;  3A5U A;  3RN5 A;  1KQS A;  3T1H Q;  3CCL A;  2VNU D;  1B7Y B;  1Y1V G;  5M5W H;  4RG1 A;  2F3I A;  1N34 Q;  4R4C A;  4P71 A;  3ZJY C;  1X9N A;  1XNR L;  3H0G G;  3M4P A;  3RZD H;  4JI5 Q;  1X54 A;  2K5V A;  5C3E H;  2KHJ A;  3F8T A;  3JC6 6;  4BY7 H;  1VCI A;  3SGI A;  2JA6 G;  5C3E G;  3J80 c;  5LMN W;  3KF8 B;  1QZH A;  2IY5 B;  3RN2 A;  4R4T A;  2JA8 G;  3GTO H;  1JJ2 A;  2I5L X;  1PA6 A;  1X3G A;  1XNR Q;  2JEA I;  2XGT A;  4DAM A;  5J3B A;  3BZK A;  3CPF A;  3CC7 A;  2ASB A;  4OON A;  2UXD L;  4NXM L;  4DNI A;  3S1M H;  3CW2 C;  3STB D;  1CKN B;  1I6H H;  1EIY B;  1IXR A;  1HZC A;  3AEV A;  1VQI A;  1GO3 E;  1JT8 A;  5JJI A;  4HJ5 A;  1N9W A;  1AE3 A;  2K5H A;  4KHP L;  4A4I A;  3FKI G;  2ALY B;  4AQY L;  4JBK A;  1XMQ L;  1TWF H;  4PZ8 A;  1OXS C;  1YVC A;  1SE8 A;  1U0L A;  4GNX C;  4LF7 L;  4FDB A;  1XJV A;  4NXM Q;  2R92 H;  5GRO A;  3CXC A;  3HOU G;  1N8R C;  3M85 A;  1VQP A;  4L5Q A;  1YIT A;  4Y7N H;  4Y52 H;  3ULJ A;  3S1N H;  4KHP Q;  4MTN A;  1HNW L;  3J81 j;  4DV7 L;  4GKK L;  3CP0 A;  3D31 A;  4AQY Q;  1X3F A;  1XMQ Q;  2FXQ A;  2ATW A;  1HZ9 A;  1IBM L;  1NBW A;  4LF7 Q;  3GTJ H;  4IFD G;  4IO9 A;  3NEM A;  1OXU A;  3CCR A;  4GOP A;  3MEF A;  1HJP A;  1V9P A;  2NVY H;  1Q46 A;  1TWA H;  1WCM G;  1VQ8 A;  3GTL H;  2E2I H;  4BA2 I;  3PUY A;  1HNW Q;  4P73 A;  3HKS A;  3CCQ A;  4XTC S;  5IY0 A;  2MNA A;  3CF5 A;  2JA5 H;  3HOV H;  4IOC A;  1IBM Q;  1YBY A;  1QVF A;  1VQK A;  3G48 A;  4UP8 A;  3I4O A;  1NJI C;  1FJG L;  1KD1 C;  1HR0 L;  4JYA L;  2GVA A;  5FLM H;  2OWO A;  1EWI A;  3GD7 A;  1H95 A;  3I55 A;  2VUM G;  4GNX B;  5FLM G;  4BY1 H;  2HIX A;  2IHF A;  4BBR G;  3OYY A;  4HID A;  4DV2 L;  1Q1B A;  3S2H H;  1TXY A;  4YWM A;  3W1B A;  4DKA C;  1XTD A;  1UE6 A;  3PUV A;  4DR6 L;  2K75 A;  2ZTE A;  2ZJR A;  5C4X G;  1FJG Q;  1HR0 Q;  2MO1 A;  5H1S E;  1VQG A;  3HOZ H;  1A63 A;  3KYH C;  4GN4 B;  4YCV A;  2NZH A;  1TWG H;  4R4I A;  1X55 A;  2KEN A;  4X6A H;  3HOZ G;  4PG3 A;  4GLA C;  3HOY H;  1PH4 A;  4DV0 L;  1L0W A;  4B3S L;  4O2D A;  1HH2 P;  3CC4 A;  1V43 A;  3PV0 A;  4A3B H;  1VS0 A;  4OXP A;  3J80 i;  4DUY L;  3TEH B;  3E9H A;  4KHZ A;  4DV2 Q;  2Q2T A;  3HOY G;  2Q2H A;  3RLN A;  1Z9F A;  1Q82 C;  4DR6 Q;  3F1Z A;  1L1O C;  4OWW B;  2KHI A;  4DAY B;  1PVO A;  5ELN A;  4GKJ L;  2UXC Q;  5LMU Q;  1IYJ B;  3AFP A;  1KL9 A;  3M7N A;  1E3P A;  4JBJ A;  1O7I A;  4YHH L;  1A62 A;  1WI5 A;  1SMX A;  1SFO H;  3PO2 G;  3KJP A;  4DUY Q;  4QJF A;  3I4N G;  2QGQ A;  3I56 A;  4DUZ L;  3TS0 A;  4JBM A;  1W3S A;  4A3L H;  3UDF A;  4JV5 Q;  1BBU A;  1U5K A;  4YCW A;  3OTO Q;  1JE5 A;  3W5O A;  5GAG C;  2Z6K A;  5IT9 c;  4GKJ Q;  4A3K H;  4K0K L;  3G6E A;  4OO1 I;  2JEB I;  4PMW A;  5M3M G;  2WFW A;  4YHH Q;  5C0X I;  2C35 B;  4A3M H;  4A3C H;  5GAD C;  2JK8 A;  2NVT H;  3S14 H;  1Q86 C;  3CC2 A;  3GTK H;  4A3C G;  4WJ3 M;  1VQM A;  4JI7 L;  3CCE A;  4R1J A;  1VQB A;  1HZB A;  4HJ8 A;  4JI3 L;  2ZJP A;  5M3F H;  4DV1 L;  4K0K Q;  1YHQ A;  3M4O H;  2NN6 G;  3UDG A;  3CCM A;  5GQO A;  2Y0S E;  1NMF A;  1L1O B;  4LFC Q;  5DLQ E;  5IYD G;  4YWL A;  1J6Q A;  2GN5 A;  1EIF A;  2R7D A;  3KLW A;  5IE8 A;  3OW2 A;  1Y1W G;  3AFQ A;  3S1R H;  4B3R L;  1N32 L;  4JI7 Q;  2BA0 A;  1E1O A;  2F52 A;  2KBN A;  1YZ6 A;  2OQK A;  3BU2 A;  5M5Y H;  4JI3 Q;  2CKZ B;  3FHW A;  4R4Q A;  4DV1 Q;  4EQ5 A;  4IPC A;  2A8V A;  1LTL A;  3CPW A;  3PSI A;  4HIK A;  4A3I H;  2E2J H;  1A0I A;  2VZA A;  3CAM A;  3HFZ B;  4X64 L;  5HY6 A;  3T1Y L;  4IFD J;  1L2F A;  1C0A A;  5BR8 L;  4LW1 A;  4DK3 C;  4WJ4 A;  4BY7 G;  3RLF A;  2ZM6 L;  4C2M H;  4LUO A;  1KHI A;  2PMZ E;  2AWN A;  5GAH C;  5C44 H;  4JI2 L;  2K52 A;  4NPS A;  4HIO A;  1FGU A;  1Q81 C;  3UE1 A;  2RHS B;  3B6Y A;  1N32 Q;  4JI8 L;  4X64 Q;  3UDI A;  2Y0S G;  1AH9 A;  4PZ7 A;  4C3I H;  3HKZ E;  4JOI C;  1KRT A;  1W2B A;  1D8L A;  3GO5 A;  3JAM c;  5LMN L;  4LFA L;  3KF6 B;  3K0X A;  4OX9 L;  3I4M H;  1LM0 A;  1RIP A;  1QZG A;  2R93 H;  1YJ9 A;  1HNX L;  4JI2 Q;  4AIM A;  2YTY A;  3VDY A;  1B70 B;  4H02 A;  4LWC A;  1EQR A;  4P75 A;  1R9T H;  3J7A 5;  4X65 L;  3I4M G;  3GDE A;  2F4V L;  2N78 A;  2UXD Q;  4QGU A;  4JI8 Q;  3U4V A;  3GTQ H;  1MKH A;  4LFA Q;  4ALP A;  2BH8 A;  1E1T A;  4TQU S;  5LMN Q;  1K8G A;  2I5H A;  2R92 G;  4UY8 C;  1G29 1;  3A5Z B;  2B63 H;  1VQO A;  1PH3 A;  4B3M L;  1TWC H;  2JA7 H;  3EBE A;  2F4V Q;  2L15 A;  5M5X H;  3E0E A;  1VQ4 A;  1XPU A;  1NTG A;  3HKZ G;  3IRB A;  1NY4 A;  1KRS A;  3K7A H;  4DV7 Q;  1Z47 A;  4QL5 A;  4GKK Q;  4OO1 G;  1OTC A;  2D62 A;  2I5M X;  3PO3 H;  2JE6 I;  1E7Z A;  1Q7Y C;  1VQA A;  2JA5 G;  1JJC B;  1A8V A;  3HOV G;  1PH6 A;  2WAQ E;  4IOA A;  4IPD A;  2YV5 A;  3UE0 A;  4LFB L;  4LF6 L;  1YNX A;  1KAW A;  4B3T L;  4QQB X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...