3M3YH

Rna polymerase ii elongation complex c
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title X-ray structure and mechanism of RNA polymerase II stalled at an antineoplastic monofunctional platinum-DNA adduct.
pubmed doi rcsb
molecule tags Transferase/dna-rna hybrid
total genus 18
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2010-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3m3yH00
1KHIA 1HH2P 2B3GA 4JI8L 5GAHC 3F8TA 1N34Q 4GN5A 3TS0A 1Q81C 3GTKH 4DUYL 5M3MH 3I4NG 3D31A 1PH6A 4KHPQ 5LMUL 2MFIA 1Y1WG 4WJ3M 3PO2G 3S1QH 1RL2A 2CWAA 3PGZA 2H5XA 1VQDA 4JOIA 1VQ5A 1CKMA 1VQ7A 4WJ4A 3EIVA 3PUYA 5J3BA 4B3ML 1A63A 2NN6I 2JA5G 2JA7H 3PV0A 4A3DG 1N32Q 2IHEA 2ASBA 3FHWA 1TXYA 2KCMA 4L5RC 1FJGL 1NMGA 3W1GA 4BY1H 2K52A 3CCQA 4DUZL 3GTOH 4JBJA 3SGIA 3PSIA 1VQJA 1NMFA 4YCWA 4BXXG 2PI2A 4JOIC 4OWXB 5C4XH 3M9BA 4DV6Q 1A62A 1EUJA 4X65Q 1P16A 2BA1A 3H3VH 5GAGC 2MNAA 5FLMG 2ZJRA 4ME3A 4UPAA 4HIMA 1VQGA 2CKZB 3TQYA 1K0RA 1KL9A 4DR7Q 1PH9A 3T1HL 3J7ZC 2C35B 4L5SA 2HT1A 1PFSA 1WFQA 3KLWA 2AWNA 3HKZG 1T9HA 2Q2IA 4JC0A 5IYCH 3STBC 1ASZA 1ASYA 4POFA 3UDIA 5M3FG 4APVA 4A3EH 4LNQA 4DV5L 4AQYQ 4IPGA 2YTVA 5C3EH 1VQBA 1N9WA 3ICEA 4JI5L 1VQHA 2CQOA 2WAQE 1HNZQ 4B3RQ 4A3MH 2K75A 1K3RA 1I6HH 4A3JG 1XMOQ 4GNXA 2EQSA 5JEAG 1LTLA 2D0PA 2ZTDA 4DV1Q 1VQMA 2WB1G 1KD1C 1WCMG 4JI0L 3CCSA 4KHPL 2F4VQ 2KCTA 4B3TL 3B6YA 5IT9c 1I5FA 3F2BA 4A3IG 5C0XG 4YWMA 4DK3C 3VDYA 3RN2A 4NXNQ 1A8VA 4UY8C 4GNXC 1OXSC 4LF6Q 1JT8A 2BH8A 1XPOA 1K83H 4GOPA 1VQ8A 1KIXA 3HOYH 2HQLA 3A5ZB 4OO1G 4J15A 2ZTCA 4DKAC 1VQPA 3M3YH 2NVTH 1QVGA 1K8GA 4BXXH 3E0EA 2NZHA 2F3IA 3M7NA 3JC66 3K8AA 4GNXB 4MTNA 3JAMc 4YCVA 4JI6Q 1YHBA 3H0GH 1Q1EA 4DV6L 4P75A 1A0IA 1TWAH 4X65L 1V43A 1CKOA 3LGJA 4O0AA 5FLMH 1E1OA 3T1YL 2JA7G 1L2FA 5LMNL 1X9NA 2OTJA 2I0QA 4DUZQ 1IXRA 1H95A 4GOPC 4O2DA 2CFMA 1GM5A 3GTPH 1Q86C 1G51A 2JQOA 1M90C 2CWPA 1Q12A 1FL0A 5M5XH 4LUVA 2E2IH 5C4XG 2HIVA 4DR1Q 1PYSB 4HIOA 4AQYL 4EQ5A 4NXMQ 1UE5A 1TWGH 1R9TH 4IFDI 3RR5A 2YTXA 3UDGA 4B3RL 5GADC 2GVAA 4A3JH 5M5WH 2ZJQA 1XNRL 3CPFA 4UP8A 1E7ZA 1YJWA 1IBMQ 1E24A 1XMOL 1VQNA 3S16H 3U4ZA 5H1SE 1XTDA 3OYYA 5IYCG 4GN3B 4DV1L 3IRBA 1Q7YC 3CC7A 1VQEA 3J81j 4DV4Q 4R4TA 2F4VL 2YTYA 1HNWQ 4RG1A 5C3EG 1S40A 3FP9A 4JBWA 5AJ3Q 4X64Q 1TWCH 3OTOL 5C4JH 4JBMA 4OWWB 2CCZA 2AHOB 2V1CC 4A3MG 1W2BA 2RCNA 2Q2HA 2I5HA 3TEHB 5GAEC 4X66Q 1PH7A 4DR6Q 3L2PA 1QUQA 2NVYH 4JI3L 5IYBH 3UE1A 3GTLH 2PNHA 4NXNL 4JI1Q 4BBSG 1Q8KA 3HKSA 1M1KC 4JI0Q 4LF6L 1VQ4A 2K5HA 4QY7A 4C3IH 5IP9H 4B3SQ 3A74A 3KJPA 1E1TA 4B3TQ 1AH9A 1BBWA 2RF4A 4A3BH 1UE6A 1VQLA 1V1QA 1EOVA 1CSPA 2YYZA 3AQQA 5M5YH 4DR2Q 4JI6L 2IX1A 1G6PA 2Z6KA 3M4PA 3D0FA 4MZ9A 5EAYA 1CKNA 4XIGS 2K4KA 3HFZB 4LF4Q 4LF9L 1E3PA 2K50A 3S1RH 4QQBX 2UXCQ 3STBD 3WWVA 2UUBQ 1BKBA 4AYBE 1X54A 4DR4Q 3HOYG 1CUKA 1VQCA 2R93G 1SE8A 3ERSX 2QA4A 4JI4Q 3CW2C 1LM0A 4LUOA 1HR0Q 1X56A 1IBLL 3S15H 5IYDH 1XMQQ 1P8LA 1B8AA 2GVBA 1EQQA 4DR1L 3AFQA 1V9PA 4IFDJ 1HJPA 3H0GG 4NXML 2VNUD 2E8GA 1IBKL 1QVCA 4YWLA 3T1YQ 2Z6KC 3I55A 5LMNQ 4IOCA 4LF7L 1YNXA 3KF6A 2BH2A 4JV5L 4K0KQ 3S1NH 4LFCL 3L0OA 3RN5A 4PZ8A 1EWIA 1AE3A 4A3CH 4K0KL 2WFWA 1IBML 4LUZA 1QZHA 1X3GA 1XNQQ 3PO3H 1FGUA 1PH5A 1CKNB 4NPSA 4PZ6A 3S1MH 3BU2A 4QL5A 2VQEL 4DV7Q 1L0WA 4DV4L 1XJVA 1HNWL 3F2DA 3DM3A 3CCMA 1LUZA 4UP7A 4L5QA 5AJ3L 4X64L 3S2HH 4A76A 1OTCA 3PUZA 4P73A 2WP8J 1XNRQ 1DGSA 2EXDA 4X66L 5HY6A 1PYBA 4R4IA 1PH1A 2OWOA 4DR6L 4BBSH 4JI1L 1VQ6A 2LXJA 2KENA 3JAMi 1JMCA 4C3HH 1EIYB 4B3SL 3TRZA 3CMEA 3KF6B 3M85A 5C0XJ 3HOZH 5IE8A 4YWKA 3RLOA 1NJIC 2LSSA 1YJ9A 2KHIA 2N3SA 1YITA 1E22A 2D62A 1YVCA 3OTOQ 1MJEA 4H02A 2KBNA 1YEZA 3MEFA 1PV4A 1N8RC 1PH3A 2JA6G 4OX9Q 4DR2L 5DLQE 4JI3Q 4LF4L 4BA1I 3HKZE 5IYBG 1SFOH 1PH4A 2UXCL 1VS0A 3CCVA 1JJCB 2N49A 2UUBL 2AWOA 5IP9G 1D8LA 1KAWA 1J5EQ 5BR8L 1EYGA 3PF5A 4DR4L 2R93H 1U0LA 5HGQA 2PQAA 3KOJA 1YBYA 4BBRH 1OXTA 1S3OA 4PG3A 5ELNA 2N8NA 1YIJA 4JI4L 4A3BG 4YHHL 3G71A 2A8VA 1HR0L 1XMQL 1FVIA 4RMFA 3FKIG 4NB3A 1IZ6A 3U50C 4LF9Q 2ID0A 4KLKA 5IP7H 3G4SA 1N36Q 2UXBQ 2E5LQ 3K80C 2B29A 1SROA 3KDFA 1Q46A 1C0AA 1PH8A 2K5VA 2XGTA 2NN6G 4TVAB 1OXUA 1AE2A 2A19A 5E7NA 4GLXA 5GQOA 2NVXH 1XNQL 3M4OH 4DV2Q 2UUAQ 1MIUA 3S24A 1IBLQ 2E2HH 3L7ZC 5IYDG 5C44H 4R4OA 1KQSA 1OXVA 3K7AH 2PMZE 1Y1VH 2FXQA 3KYHC 4DV7L 4HIDA 1IBKQ 1NE3A 4GOPB 1HNXQ 4POGA 4LF7Q 2OQ0A 1Q1BA 4DR3Q 4GKJQ 2IY5B 1Z9FA 2PQAB 3CCRA 4LFCQ 4DV3L 4IJHA 4LW1A 1Y14B 4P74A 4C2MH 3ULPA 2LXKA 2VQFQ 2NVQH 4A3CG 4JV5Q 5IY0A 4QIWE 1C9OA 4GLAC 3PO3G 4A3FG 1SMXA 4A3GG 2K5NA 1D7QA 1UE1A 1SR3A 2VL6A 2VQEQ 2E2JH 4LFBQ 1GKHA 1SRUA 1XPUA 2VUMH 2DUDA 1O7IA 3U4VA 4DNIA 4GLVB 1SN8A 1BVSA 1K8AC 2JA9A 3UE0A 4P71A 2JEAI 3I7FA 2JA6H 1VQAA 3I4MH 2XTIA 1VQIA 2JE6I 3K7UC 4OX9L 1I3QH 3CXCA 3GTJH 4KI0A 2VS1A 4X62Q 3KJOA 1J6QA 3DLLA 2ES2A 3I4OA 1YJNA 4GN4B 3S14H 1J5EL 4IOAA 3HOZG 4YCUA 3J80c 4LF8Q 2VZAA 1X55A 2D0OA 3BZCA 5IWAQ 5C0XI 3GDEA 4IPDA 4AYBG 5FJ8G 3PUWA 2IHFA 3FKIH 1IYJB 1JJGA 4IJLA 3CP0A 1NY4A 3RZOH 3GD7A 5FLXc 3F2CA 1RIPA 3CCUA 1YI2A 1N36L 3HOWG 2E5LL 4OO1I 2UXBL 2EIFA 3F1ZA 4PZ7A 4OXPA 2Y0SE 2N78A 4HIKA 5BR8Q 4HJ5A 3A5UA 3PUVA 3NELA 4BBRG 4JYAQ 4QJFA 4DV2L 2R92G 4YHHQ 2UUAL 1QUQB 3CPWA 2RHQB 2KHJA 3J81c 2VW9A 1HR0W 3E9HA 3AYHB 3J7A5 1X65A 3RLFA 2Q2TA 1UEBA 1HNXL 2L15A 3CF5A 5IP7G 4GKJL 4DR3L 1YZ6A 1KXLA 1S72A 3TREA 5LMNW 2MO0A 4HJ8A 5ELOA 2JK8A 1B70B 1GD7A 1KRSA 3NEMA 4QGUA 1CSQA 4Y7NH 2VQFL 2OTLA 2ALYB 2BA0A 3NBHB 1K73C 1LYLA 4AIMA 2R7ZH 4A3GH 2WAQG 4A3FH 3RZDH 1JE5A 2UU9L 1L1OA 4A4IA 4LFAL 3H3VI 5C44G 4LFBL 4ALPA 1I94Q 3E9IA 1Q82C 1Y1VG 3K0XA 4A93H 3CAMA 2YV5A 2DGYA 4AH6A 1VQOA 2ZTEA 2RHSB 3NENA 4R1JA 5JEAJ 2OCEA 3G6EA 3TS2A 4DV3Q 4A3KG 1VCIA 2R7DA 3RLNA 1N33Q 4PMWA 2NZOA 2ZM6Q 4X62L 3HOUG 1MKHA 1TWHH 2JA8G 4BA2I 4IFDG 2B63H 4BY7H 4DV0Q 4YY3Q 3CD6A 5K36G 1EIFA 3K81C 1L1OC 4LF5L 2UXDQ 3MXNB 3PF4A 1HZAA 4LF8L 4JI2L 1VQFA 4A3LH 3ER0A 2VUMG 4DK6C 5IWAL 1WI5A 5FJ8H 3W5OA 1VQKA 2IT1A 1B7YB 2ZJPA 2HHHL 2Q2UA 1KRTA 3PIPA 3I4MG 3S2DH 4OWTB 3HOXH 1L1OB 3CCJA 4X6AH 1X3FA 4IPHA 1HZ9A 4R4QA 3ULLA 3Q8DA 2UUCQ 4DR5Q 2YU9H 3HOVH 1I50H 3HOWH 3S17H 1K9MC 4DAYB 4LWCA 3PUXA 4JCVE 4JI7L 5JJIA 1W3SA 1N34L 2R92H 2I5MX 3CCLA 3I4NH 4GKKQ 3RNUA 4JYAL 2Z0SA 4HJAA 3CC4A 3I56A 1Y1WH 3GTGH 3PO2H 4TQUS 1PH2A 3BJUA 3H15A 3KFUA 1JJ2A 4Y52H 1SLJA 4MNOA 1X3EA 2VY3A 4JG2A 2JA5H 2WB1E 4A3DH 2R7FA 3CC2A 1GO3E 4R4CA 3UDFA 3EN2A 3AEVA 4JI8Q 1N32L 4C3JH 3CCEA 4UP9A 4DUYQ 1YHQA 2AKWB 5M3MG 1Z47A 1GVPA 2IX0A 4OONA 3UDXA 2AMCB 5LMUQ 1UE7A 2ATWA 4DAMA 1I94L 4L5TA 4HJ9A 1JB7A 3ULJA 1QVFA 4B3MQ 2MQHA 2QGQA 4XTCS 1KC8C 4A3KH 4HJ7A 1U5KA 3HOVG 2JEBI 1N33L 1OXXK 1MJCA 2K14A 3J80i 1C7YA 3GO5A 3KF8B 1IL2A 2ZM6L 2R7ZG 3AFPA 3HOUH 1YHAA 2JA8H 2PI2E 1FJGQ 2UU9Q 4P72A 4DR7L 4BY1G 4DV0L 4YY3L 4LFAQ 3CMAA 1HZBA 1PA6A 1G291 3I2ZA 2QEXA 2UXDL 4A93G 1WJJA 4FDBA 3KDFB 1VQ9A 5M3FH 5GROA 3EBEA 1WYDA 1WOCA 1NBWA 2JJQA 3G48A 3PCOB 2R6GA 1HZCA 2MO1A 4DPGA 3BZKA 1HNZL 2UUCL 4JBKA 3ZJYC 4DR5L 4IO9A 3J81i 3T1HQ 1EQRA 2OQKA 2B63G 4BY7G 1BBUA 3GTMH 3PIOA 4A75A 4LF5Q 3CQZH 1QZGA 2A1AA 4JI2Q 5JJLA 1WCMH 4EX5A 3A0JA 4A3LG 4GKKL 3OW2A 2Y0SG 4DV5Q 1PHJA 3GTQH 4A3EG 2HHHQ 4IPCA 4JI5Q 3HOXG 3W1BA 5JJKA 1NTGA 1PVOA 2HIXA 2I5LX 4GS3A 3M4QA 1TWFH 4A3IH 1UWVA 1X6OA 1XPRA 2F52A 4KHZA 1EFWA 2GN5A 3U58A 4JI7Q
chains in the Genus database with same CATH superfamily
4GN5A 2MJ8A 2QF7A 3Q6SA 3OWFA 4PV1C 1H9SB 2MFIA 3ZYYX 3PO2G 1RL2A 4JOIA 1JOKA 2H5XA 2XN9C 3TMEA 1CKMA 2EPBA 4A3DG 5M5XB 1QJOA 3C3LA 3FHWA 1TXYA 4L5RC 1FJGL 1HA5A 1NMGA 1SDFA 3VYSA 3W1GA 1MSGA 4DUZL 2B39A 4IUVA 4OEMB 1WTOA 1VQJA 1E2ZA 4YCWA 2PI2A 4JOIC 4OWXB 3DEOA 4XDXA 3M9BA 5JAVA 3S16B 1EUJA 4X65Q 1P16A 5GAGC 5FLMG 2ZJRA 3BZDB 1K0RA 4FXGC 5KNCA 1A2UA 1SNOA 1Z6HA 2C35B 1SMYD 1WFQA 2GA4B 4POFA 4A3EH 2NVYB 1X3QA 3GTLB 4IPGA 4NKLA 3MTSA 1BO0A 4L63B 4H7BA 2K75A 1I6HH 4QIWB 4ILWA 1LTLA 1B4OA 5CMDA 1TS3A 1HFNA 5IGCA 1TT2A 3K57A 3TZDA 3PIO3 4KKTA 5G3LF 5FO9B 4NW2A 1SE2A 2K5DA 4HSPA 4A3IG 1PFBA 4YWMA 2L5TA 1PRTC 3VDYA 3RN2A 1A8VA 4UY8C 2RQXA 1NR2A 1KIXA 4DK0A 1VQPA 3M3YH 4XT3B 1QVGA 2NZHA 2RKSA 4GNXB 2Z1CA 4YCVA 4JI6Q 1VF5C 3PO3B 4F88A 1A0IA 1VQ6A 1V43A 1Y8NB 4O0AA 2DN8A 3Q23A 1DOMA 1TY0A 2B2TA 5KRUA 2OTJA 1GHKA 1FYCA 1O80A 1IXRA 4DUZQ 1FGBD 1S5ED 4DXFA 4O2DA 2XNAC 3S2HB 1LTID 1M90C 2CWPA 5HURA 1PFMA 4DR1Q 1PYSB 4AQYL 4EQ5A 5A35A 4NXMQ 3DXJC 1ZEQX 4N9TA 4ODGA 3NBIA 2GVAA 3K5OA 2B2TC 1DJRD 3CPFA 1IBMQ 4HEDA 1E24A 1LTSD 1XTDA 3OYYA 4PNYA 4GN3B 2L55A 2B2YA 2CW0D 1VQEA 3OSOA 3FP9A 3CRLC 5AJ3Q 4X64Q 1TWCH 5C4JH 3OHXC 4OWWB 4V190 1F77A 4KTAA 4TRDA 4F8MA 2Q2HA 4X66Q 3MEHA 2D9UA 4NXNL 3HKSA 2DJGC 3I70A 4C3IH 2IW3A 2B2YC 3TBIB 3G7LA 1AH9A 2YYZA 1A2TA 5M5YH 4DR2Q 2DY8A 2K4KA 2D2CC 2K50A 4IUTA 4KJNA 3E0JA 4C1NI 2NN6H 1X54A 3HOYG 4JI4Q 1Q3LA 1X56A 1LTAD 1IBLL 5IYDH 1XMQQ 4XQQA 4IFDJ 2VNUD 1IBKL 1QVCA 4YWLA 5IIFA 4IOCA 4LF7L 1YNXA 1UAPA 1KLGD 3SDZA 3MWYW 5NUCA 4HCEA 1IW7D 1CKNB 4NPSA 3TZUA 3BU2A 3I4LA 1HNWL 5EBDA 3P75A 2PQEA 1JWMD 1B9MA 1EY7A 4P73A 3S14B 4DR6L 1DGSA 5HY6A 2JYOA 3K58A 1EY0A 3WOFA 1EIYB 1EYCA 3HOZH 3RLOA 1NJIC 1PTOC 1YJ9A 2V4DA 5CV5A 2KHIA 2N3SA 1YITA 2D62A 1FNUA 3MEFA 1PV4A 3DM1A 2OF1A 4FO2A 1N8RC 5JOBA 1GHJA 5J22A 5I4DA 1XWEA 3DWAA 1SFOH 2UXCL 2NTSA 3A56A 1VS0A 4KKUA 3KLSX 2N49A 2UUBL 5IP9G 1J5EQ 1EYGA 3PF5A 4DR4L 2SNSA 1YIJA 1UEAB 4A3BG 3HOVB 3G71A 2FHTA 4G7ZC 2Z4IA 4A3GB 1FVIA 2QCPX 3GQBA 4NB3A 4EVOA 1J8IA 5JPMC 2ID0A 5IOCA 3OW7A 1N36Q 4XT1B 2B29A 1PH8A 4GLXA 1MHWC 1HFGA 3SK8A 1LT3D 2NVXH 1XNQL 3N6RA 1IBLQ 1Z7TA 4S3SA 5C44H 1KQSA 1L0XB 4DV7L 1STNA 1DOKA 1TWHB 4HIDA 1IBKQ 1HNXQ 4LF7Q 4GKJQ 2IY5B 4IQZA 3S9WA 4DR3Q 1Z9FA 1R4QB 3GV3A 4IJHA 3ND9A 1M4VA 4P74A 4C2MH 4ZLTF 1EEFD 2VQFQ 4A3CG 4QIWE 4A3GG 4IFDH 3HOXB 2VL6A 2EYJA 3BG3A 4HCSA 2DUDA 1O7IA 3U4VA 4DNIA 4GLVB 4K6DA 5KGUA 1K8AC 4P71A 3J7AV 3VR6A 3HZXA 2XTIA 3VYUA 4DA2A 3GTJH 2R92B 4KI0A 3QIAA 3A8KE 1Y1WB 3D6WA 4V0BA 4X3KA 1TIID 3PMFA 3QOLA 3I4OA 3P1HA 1H9RA 3MVVA 1JORA 3J7AF 2PW5A 1WD0A 3NBHA 4FP5D 4MHEA 2IHFA 3RUZA 4IJLA 3RZOH 3GP7A 1G8ZD 2UXBL 2E74C 3OOCA 1ILQA 2DJFC 2O4XA 1SYBA 3A5UA 4FF2A 3NELA 4ZQ3A 2RDHA 4OIJA 4QJFA 1LT6D 4A3KB 2R92G 2DY7A 3I91A 1SEBD 1X65A 1A3UA 3RLFA 4EQOA 2L15A 3HKZB 3TREA 1YHQA 2MO0A 5CGKA 1KRSA 2A6HC 3EA6A 4JV5L 2ALYB 2BA0A 4OL7A 1HA6A 2Z6BA 3RZDH 1JE5A 2UU9L 1L1OA 1V1PB 3MFYA 4ALPA 1Y1VG 3NTHA 4DAYA 5D3IB 3NENA 2NB0A 2OCEA 3I3CA 5BN4A 4A3KG 1VCIA 2F0JA 1CZGA 2KQ3A 1FD7D 4WJWA 4BY7H 4DV0Q 3X3NA 1ILPA 1EIFA 1L1OC 5JVG3 5JVH3 4LF5L 3PF4A 4A3LH 2M2LA 2VUMG 4DK6C 1F9RA 2F0IA 3SEBA 1B7YB 2ZJPA 3I4MG 2L4NA 1HZ9A 4XQJA 1I50H 4TKOB 1K9MC 3H94A 1D2BA 4JCVE 2WACA 2JA7B 5DEHA 3PO2H 1ENAA 2I46A 3H15A 1PRTF 2BOSA 4I7AA 3AB9A 1JJ2A 1HPCA 2KHSA 4A3DH 3R3OA 2TMPA 4FNFA 4X3TA 1I4QA 4DUYQ 2AKWB 1GVPA 1UE7A 4E6IA 3GV6A 3T13A 4HJ9A 3ULJA 4XTCS 4HJ7A 1U5KA 2EYMA 2JEBI 1OXXK 2K14A 3NWTA 3KF8B 2Y0SB 2K32A 2R7ZG 3AFPA 1SXTA 5FO7B 5IGFA 3HOUH 2PI2E 2UU9Q 2EYFA 5C3EB 3K6OA 4HAEA 2UXDL 2A68D 3Q22A 1VQ9A 4FDBA 1J9OA 4A93G 5GROA 1CHPD 3EBEA 1WYDA 1F9SA 1NBWA 1WOCA 1RTOA 3PCOB 3SR1A 1H9SA 4JBKA 4IO9A 1EQRA 2XRQD 3R93A 2WINB 2B63G 3GTMH 3PIOA 4LF5Q 3CQZH 2XRSD 1O7YA 4EX5A 3A0JA 4GKKL 3OW2A 2Y0SG 4QUFA 4DV5Q 4NP5A 4IPCA 4JI5Q 3W1BA 1NTGA 1F9QA 1PVOA 5FK9C 3M4QA 3H91A 5EBCA 1UWVA 4A3IH 4KHZA 2K04A 1VQNA 1KHIA 3HGBA 4CDCC 3TS0A 1Q81C 3GTKH 3H0GB 2X6LA 1F2YA 2EYHA 5LMUL 4WJ3M 1SBBB 3S1QH 4KY7A 1EY9A 4DNRB 2NN6I 1A3VA 2JA5G 1LTBD 3GTPB 3RMHA 2SNMA 1EU3A 2J0TD 2IHEA 2C9OA 3V2TA 4BY1H 3CCQA 3GTOH 2F1MA 3VR3A 3J7YW 1LTTD 3PSIA 3PQIA 4A3JB 3ITPA 5M5WB 1WTVA 4QMGA 4RGOS 4QCLA 3BDCA 4DV6Q 1A62A 4G57A 5D65A 2BA1A 3H3VH 2MNAA 4UPAA 2KCCA 2Q8RE 3FRPB 4RCOA 4RFBA 5F2DA 3J7ZC 3DMUA 4L5SA 4R8NA 3KLWA 2AWNA 1ASZA 1JR0D 3UDIA 4APVA 4H0LC 4ABNA 1WD1A 2YTVA 1VQBA 1AW7A 1N9WA 2F0TA 2CQOA 4B3RQ 3L3OC 1TKWB 1K3RA 4A3JG 4GNXA 3R8BA 5JEAG 2D0PA 2ZTDA 1PTOF 2F3VA 3ND8A 1WCMG 3CCSA 4ZAIA 2F4VQ 1E2VA 1SMYC 3B6YA 3IL8A 1TS4A 2B2UC 3F2BA 4DK3C 2PZUA 1OO9B 3K0YA 5C4XB 4GNXC 1OXSC 2QDLA 4LF6Q 2BCOA 1K83H 1VQ8A 3I90A 3HOYH 3A5ZB 4OO1G 2NVTH 1Q90A 4BXXH 4KN7C 3MXPA 4LJZC 3U9OA 1MD2D 1B1ZA 2VB3X 1YHBA 1Q1EA 3ONAB 2F0NA 1TWAH 4X65L 3LGJA 4EGVA 4CDEC 5LMNL 3HEJA 1X9NA 4G7OC 2F0DA 2I0QA 3NUCA 1NR4A 1H95A 3D3RA 3SK5A 2CFMA 1UUPA 3BYYB 2JQOA 3EQLC 1Q12A 2E2IH 5CORA 5C4XG 2HIVA 2IPKD 1KTKA 4BBSB 1ML0D 1R9TH 1TWGH 2ZXOA 3DEPA 4IFDI 4C3HB 4KKSA 2J4XA 2X69A 2ZJQA 1XNRL 4K0KQ 2E2DC 1TS5A 5H1SE 4C56C 4CKBA 3M7GA 3J81j 2AUKA 1S40A 4JBWA 4RGNA 2AHOB 2KCNA 2V1CC 4YIJA 4A3MG 4BBRB 1K8OA 4JI3L 4R8IA 4BBSG 1Q8KA 4PMBA 5IP9H 1EYDA 1AZQA 1ICWA 1SJED 3IFDA 1VQLA 4A3BH 1V1QA 3LX0A 1VDZA 4KJOA 1CSPA 1TR5A 2WAQB 4JI6L 2CW0C 2Z6KA 2JN4A 3M4OB 1DD2A 5EAYA 1CKNA 1KAAA 4LF4Q 3HFZB 3KBXA 4QQBX 2E2HB 3S1RH 5EKKA 5ELDA 2K5WA 4QB4A 1BKBA 1CUKA 1AEXA 4JK1C 1HR0Q 2NVQB 5LL6X 1P8LA 1EQQA 4DR1L 3AFQA 1V9PA 2HD3A 3E3XA 4NXML 2Z6KC 5LMNQ 4N8FA 1AZPA 1A15A 1HCZA 2E2JB 2H4OA 4LFCL 4RA8A 1UNSA 4A3CH 1AE3A 1ZYRD 4FVMA 2WFWA 5CC4A 3K5NA 1IBML 1QZHA 1X3GA 1EOTA 3CU7A 1FGUA 1MSHA 2KEEA 1BCPD 1I3QB 5IGEA 2VQEL 5AFWA 5IODA 3DM3A 2LFNA 4RGTA 5A2QE 5AJ3L 4X64L 4CKCA 2ZT9C 1QB5D 3NXWA 4LAAA 1FR3A 1WTWA 2EDGA 1K0SA 1QCBD 1SJHD 1XNRQ 4X66L 1LTGD 1PYBA 1PH1A 1VMPA 3KBGA 1NAPA 2LXJA 3FKIB 3TN2A 1JMCA 3VR2A 1H9MA 5C0XJ 5IE8A 4YWKA 3I8ZA 1IW7C 1E22A 1GOZA 1MJEA 2KBNA 1SYGA 4DR2L 5DLQE 1EQTA 4JI3Q 1JOQA 3MXGA 5IYBG 2LY7A 2N88A 1NUCA 1SNCA 1JJCB 1BCPB 1STHA 1KAWA 1YNJD 2R93H 1CK1A 5HGQA 3T53B 4EQPA 1YBYA 1PMRA 1MGSA 1OXTA 1S3OA 2PNRC 4OIKA 4JI4L 2A8VA 4IN3A 1XMQL 5CV7A 3K5MA 3FKIG 4A3FB 1IZ6A 3U50C 3G4SA 1BXTA 2E5LQ 4J6HA 2A19A 4RHRA 5C4ZA 2UUAQ 5I9OA 3L9AX 4CDDC 4R4OA 3K7AH 1Y1VH 2FXQA 3KYHC 1GUNA 1NE3A 1STAA 1TVXA 2A69D 2PQAB 2F0GA 3CCRA 4LFCQ 5I9PA 2L9HA 2E75C 3ULPA 2L0CA 4Q0FA 1I6VC 4AYBB 4NDXA 2NZ1D 3PO3G 1EEID 4A3FG 1SMXA 3IFTA 5KNBA 2VQEQ 4LFBQ 1GKHA 1B53A 1VMCA 2VUMH 3HOWB 3S17B 1SN8A 1BVSA 1D1IA 2JA9A 3UE0A 2JA6H 3I4MH 4PMCA 1Q8IA 2SDFA 2AQ1B 3CXCA 3I4NB 5E1FA 3KJOA 4X62Q 4HN7A 1NSNS 2A6ED 1B2TA 2LKVA 1J5EL 3FVQA 1LACA 4YCUA 4LF8Q 3NTKA 2VZAA 2R3ZA 1X55A 3BZCA 5C3WA 5A2QL 4AYBG 2EY6A 1V1PA 3WDNA 3CP0A 1RDPD 1RIPA 4UHVA 3CCUA 1N36L 3HOWG 4DNTB 4R9WA 2F0WA 3PUVA 3HS0C 1W6JA 4JYAQ 1PTOH 1U4LA 2KHJA 2RHQB 4H44C 4MTKA 2KVMA 2X6GA 2EJFC 1UEBA 1HNXL 4XYQA 4GKJL 4DR3L 1YZ6A 2B8GA 1KXLA 3S1NH 5ELOA 4QGUA 1GD7A 4Y7NH 2VQFL 2R7ZH 5M3FB 1LYLA 3R2TA 2I07B 1I4HA 2NTTA 3QJYA 4LFAL 3H3VI 1I94Q 5CV6A 4A93H 3K0XA 2YV5A 2RHSB 5JEAJ 3BVMA 2LS01 3G6EA 4KHVA 2R7DA 1N33Q 2ZM6Q 3OIPA 2EE1A 3GTQB 4ZCKA 4BA2I 2Z9HA 1F2MA 2B63H 4LK1C 4PQXA 4YY3Q 5K36G 3K81C 1B3AA 5C3XA 2M9VA 1ZXTA 1VQFA 2PMZB 1WI5A 3C1FA 1CTMA 5FJ8H 2IT1A 3MZ5A 1VQKA 5KYLA 3S2DH 4OWTB 2FJ2A 4CJ0B 3D4RA 3Q8DA 2XWJB 2YU9H 3NP8A 1T5XD 1RODA 5FO8B 3CCLA 2Z0SA 3CC4A 1DM0B 3I56A 3GTGH 3KF8A 3ERQA 4TQUS 4RGMA 3KFUA 3T56B 4EQNA 3D8GA 2JA5H 2R7FA 4R4CA 4JI8Q 3T4AC 1N32L 4C3JH 4UP9A 1EFID 4OONA 2IX0A 3UDXA 2F0KA 4L5TA 1JB7A 1QVFA 4ZKCB 4B3MQ 2MQHA 4B9WA 2H1EA 4ME5A 4BWGB 4CBVA 3HOVG 1C7YA 4KY5A 2PZWA 4HSVA 4A3EB 2JA8H 2R61A 4P72A 4DR7L 1IYUA 4DV0L 4LFAQ 3CMAA 1HZBA 1BNZA 1I6HB 2QKIC 1HUNA 2O5IC 4QUCA 2JJQA 5KEEA 1LLRD 5DAUA 4ZRZA 4RHSA 1K3BC 5T1IA 1F2ZA 2DNCA 3C46A 3BS1A 3T1HQ 2PCFB 1QG7A 1CQVA 1WCMH 1D5MC 3TP7A 1PHJA 4A3EG 2HDMA 2EOTA 3HOXG 2A68C 5JJKA 2Q8TA 1VF7A 2HIXA 2RDFA 1CZWA 1TWFH 1X6OA 2F52A 3M3YB 2GN5A 4WORA 1HH2P 5GAHC 4KN4C 4DUYL 5M3MH 3D31A 1PH6A 4KHPQ 4OO1H 1Y1WG 1U4PA 1BQQT 2CWAA 2WKCA 3PGZA 2DNEA 4X3SA 3EIVA 3PUYA 2K5QA 1U4MA 5J3BA 4H13C 3PV0A 4IUPA 2F0QA 1AP0A 1N32Q 4FF4A 2KCMA 5I2YA 5IGBA 1WVLA 4JBJA 4K6LA 3SHLA 1G6ZA 5C4XH 2ICEC 5IGGA 2EY2A 3DWPA 1JCKB 2WB1B 5E4XA 2RCFA 3DHQA 1JC7A 4ME3A 1VQGA 2CKZB 3TQYA 4DR7Q 3SK6A 5KIXA 1TWCB 1EU4A 3HKZG 4JC0A 1T9HA 2Q2IA 2MUYA 3STBC 1JWSD 3HP3A 3OMCA 1ASYA 5JJZA 4LNQA 4DV5L 1HHVA 2ENBA 1O78A 4JI5L 1VQHA 4FXKC 4C3IB 2QEJC 4A3MH 3X3MA 1DOLA 2HCCA 2XWBB 1XMOQ 5I2XA 2EQSA 5M5YB 4DV1Q 1VQMA 2WB1G 5CR3A 4IUNA 5EJWA 1EYAA 4B3TL 1ESFA 3QO2A 5C0XG 3QR8A 1H9KA 4GZYC 3K5LA 3KUPA 1W6KA 2BH8A 2MHVA 1KNAA 2HQLA 4MIUA 4J15A 4DKAC 1EWHA 1K8GA 4IZ8A 3M7NA 2EY1A 2HQEA 3JAMc 4O1NA 2SEBD 4DV6L 2JA7G 1CKOA 5FLMH 3T1YL 1E1OA 1L2FA 2G5DA 3QB3A 1PFNA 2OXPA 2RDGA 5M5XH 5E3FA 1EY5A 4OELB 1JWUD 2HUGA 2K05A 4HIOA 2QILA 1UE5A 3Q24A 4CHTB 3RR5A 1EZ6A 4B3RL 3T16A 1EZ8A 3HOZB 2KA7A 5GADC 1BR9A 4JPBW 1E7ZA 4UAIA 3S16H 3U4ZA 4F7XA 5IYCG 1RKNA 3IRBA 1K28A 3JAME 2XSCA 3CC7A 4DV4Q 2F4VL 3MA2B 1SFOB 4RG1A 2F0EA 5C3EG 1F9PA 3OTOL 4JBMA 1GUTA 2CCZA 1W2BA 1SYDA 3SVMA 1PH7A 3L2PA 1QNKA 2NVYH 5IYBH 2L12A 3UE1A 3GTLH 3FDTA 4JI1Q 1CA6A 2CVRA 4LF6L 2K5HA 5E4WC 4B3SQ 1KDBA 3A74A 4B3TQ 2FMCA 4OGQC 1EOVA 3AQQA 3WOEA 2IX1A 5J39A 1G6PA 2NVXB 3M4PA 2F03A 4U673 2EYLA 4XIGS 1E3PA 3STBD 5C44B 4DN4M 3E6ZX 1GUOA 1MBYA 3VA7A 5ELBA 1VQCA 1HXYD 3O13A 1E2WA 1LTRD 4C2MB 2RSOA 1B8AA 2GVBA 3H0GG 5COYA 3T1YQ 2XVSA 2F0UA 3K59A 2BH2A 1WTQA 5JPNC 3L0OA 3M4YA 1EWIA 5I6WA 4K0KL 1RHPA 4LUZA 3PO3H 5ISRA 4IURA 1PYWD 1EIGA 4PZ6A 4QL5A 5G3LD 3GTJB 3D4DA 2MP1A 1XJVA 3F2DA 1KNEA 2B2UA 4L5QA 4QF4A 3S2HH 4DGZA 1OTCA 3P7JA 5EPJA 2G9DA 2EXDA 1RF2D 3RD4A 1G2TA 1PZJD 3KLRA 1B50A 2KENA 3JAMi 4RKLA 3I72A 3TRZA 3CMEA 1ZYRC 3KF6B 3RZOB 4DK1A 1GXDC 3OTOQ 4H02A 1YEZA 1BCPC 4OX9Q 4OHJA 1QNUA 4LF4L 1STEA 1II3A 3HKZE 5EPKA 3S15B 1PH4A 3KK7A 3CCVA 1TS2A 2AWOA 4J8QA 1D8LA 3A7LA 1HQMC 1R4PB 2A74C 4KY6A 5BR8L 1ESRA 3JAML 2PQAA 3KOJA 5ELNA 2N8NA 4YHHL 1HR0L 2F0MA 3UI2A 3N52A 3KLSA 4RMFA 2IJ0A 3FPUB 3RZDB 2N55A 1XX8A 4KLKA 2PYKA 3S1MB 3H3VC 5ELCA 2F4IA 1SROA 1Q46A 3NHHA 5E7NA 1AE2A 5GQOA 2Z8LA 1TQOA 4DV2Q 2ICIA 4KMUC 1MIUA 1FNVA 3L7ZC 1JB3A 1YNJC 2RVLA 2CQAA 4BY7B 3C2PA 1CHQD 2OQ0A 1Q1BA 5TSSA 4KD4A 2P5ZX 4DV3L 1XYIA 5EPLA 1ONLA 1Y8OB 2K5NA 5J1ZA 1HTPA 1SR3A 2EYOA 1SRUA 1XPUA 4WRDA 1I50B 5DM73 2JEAI 4L6TB 4B08A 5ELEA 3K7UC 3PO2B 2A69C 5M9OA 4C3HG 3S14H 5T1GA 5C6AA 4IOAA 2F0SA 1ICFB 1CI3M 2D0OA 4A3DB 5IWAQ 3PUWA 5CV9A 1JOOA 1JJGA 3GD7A 3H6MA 2B2VC 1YI2A 4OO1I 2KECA 2E5LL 2VXWA 4PZ7A 1NNXA 3EVQA 4OXPA 2Y0SE 3T51B 4HIKA 5BR8Q 1ET6A 1CT1D 1A6XA 2EYPA 4BBRG 2A6EC 4YHHQ 2UUAL 3CPWA 3VYRA 3E9HA 3AYHB 4XQNA 2RA4A 3HOUB 3QWNA 2BDNA 2Q2TA 2K7VA 3BDOA 5IP7G 1S72A 3HOVH 3NEMA 2OTLA 1K73C 4AIMA 2VB2X 4A3GH 2WAQG 2AQ2B 4CGYB 3IAYA 4X3UA 4A4IA 4LFBL 4K5VA 1GJXA 3BVZA 3CAMA 2DGYA 3AMUA 4AH6A 1ENFA 1VQOA 3GTMB 3TS2A 2JP1A 3CQZB 4DV3Q 3RLNA 4M8AA 1L0YB 2O5JC 4X62L 3MXUA 3HOUG 1SAPA 1TWHH 2WIIB 1BBXC 1RCVD 1DXMA 2AQ3B 3NQIA 4A3IB 1HZAA 5EGTA 4LF8L 3ER0A 1I4GA 1LT4D 1EL0A 2HHHL 3HOXH 3CCJA 3FPPA 4X6AH 2KUMA 3BDLA 3GTKB 5LL6S 2UUCQ 1SNMA 1PLFA 4DR5Q 3S1QB 1PZKD 2FMMA 4LWCA 2C5CA 1IL8A 3PUXA 5JJIA 4ZKBB 1N34L 2R92H 4JYAL 1Y1WH 1G91A 3MHBA 4CDFC 3AU7A 1B3QA 1SLJA 3BVGA 2RSNA 4BY1B 4M1UB 3GTOB 4JG2A 3CC2A 1GO3E 3UDFA 2PZTA 3AEVA 3CCEA 5KYIA 4RAUC 1IHZA 4IUUA 1BUVT 2AMCB 4KK7A 2L11A 4DAMA 1I94L 4K8JA 4K14A 3TP5A 1S5FD 4FXDA 2QGQA 1Y69U 1KC8C 2EJMA 4A3KH 4J1MA 3MFGA 4K5XA 1N33L 1MJCA 2ZM6L 1YHAA 2B8FA 4L8JA 1FJGQ 4BY1G 4YY3L 3FMCA 1DZ1A 1G291 5K5PA 2WV6D 1KDCA 2EXZA 2F0OA 3G48A 3OPOA 1XTCD 1ZKOA 2OT2A 1HZCA 2MO1A 4ZK9B 4DPGA 1HNZL 1SNPA 3ZJYC 1D1KA 1SYFA 1QZGA 2FINB 4HR7B 1H9JA 3CHBD 2BE5C 2HHHQ 1O7LA 4RKBA 3QG1A 1K83B 4GS3A 5C0XH 3HOYB 3PIP3 2NVTB 1FNWA 4KV6A 2B3GA 3P20A 4JI8L 3F8TA 1N34Q 3I4NG 4ULLA 1TWAB 4JVZA 1ENCA 2F0VA 1HRJA 1WTHA 1VQDA 3NTIA 1VQ5A 1VQ7A 4WJ4A 2F0HA 4ZUJA 4B3ML 1A63A 4UDUC 3A54A 4G7HC 2JA7H 1BOSA 2JXMB 2NYZD 2E2IB 2K33A 1S5DD 2ASBA 2KJXA 2K52A 1R9TB 1TWGB 2IL8A 3A7AB 1AFPA 3SGIA 5DM63 1NMFA 3DWQA 4BXXG 1C4QA 2E76C 1YNNC 4I7ZC 4RH6A 3A55A 3HRZC 4HMJA 4HIMA 3W2DA 1KL9A 1PH9A 3T1HL 5BN5A 2HT1A 1PFSA 5EKLA 1LT5D 2Z4HA 5IYCH 2ZXPA 3NWSA 5L37A 5M3FG 3LWEA 4AQYQ 1PRTD 5C3EH 3MAQA 3VR5A 1JQYD 2QDBA 2WAQE 1HNZQ 1SNDA 1I4RA 1GUWA 4N8X1 4A3BB 2K1BA 5I6YA 4JI0L 1KD1C 4KHPL 1BCPF 3S1RB 2KCTA 1HTLD 5IT9c 1I5FA 3NE5B 1QOHA 2K6AA 2EVBA 5DNFA 1STGA 1S5BD 2B2WA 3V96A 4P2CB 4NXNQ 1JT8A 1XPOA 4K8IA 1EQVA 4GOPA 1WTXA 1S5CD 4WFN3 1O7ZA 1PRTB 2ZTCA 3D4WA 1E0BA 4XYOA 2NBFA 3E0EA 2F3IA 3JC66 3K8AA 2Q8IB 4MTNA 2RBMA 3H0GH 4P75A 4C1NK 3G6JB 1DCZA 2B2WC 1STYA 4O42A 2BE5D 2FFKB 5EKIA 4GOPC 1GM5A 3GTPH 1Q86C 1G51A 5IT9E 1FL0A 4LUVA 5C4HA 1PXUA 1EIHA 1EY8A 4TSSA 2YTXA 3UDGA 1STBA 4A3JH 5M5WH 4UP8A 1YJWA 2IWHA 1XMOL 5JEAH 1DYQA 4DV1L 1Q7YC 3V05A 1HNWQ 4R4TA 2YTYA 1SSOA 2PO4A 4K2KA 3VA5A 4DU9A 4CKEA 1SYEA 1B9NA 2R93B 2RCNA 5GAEC 2I5HA 3TEHB 4DR6Q 1QUQA 4CJ2C 2PNHA 1M1KC 4JI0Q 1VQ4A 4QY7A 3NQTA 1YNND 3CKIB 3KJPA 1E1TA 1I4XA 2EZVA 1BBWA 2RF4A 1UE6A 2NUCA 4DAVA 1JE4A 1PZID 3D0FA 4MZ9A 4LF9L 1CFMA 1KLUD 2UXCQ 3K7AB 3WWVA 1Y1VB 5IGDA 2UUBQ 4LMQD 3U9SA 4AYBE 2JSOA 4DR4Q 4ZUIA 2K03A 2R93G 1SE8A 3ERSX 2QA4A 3CW2C 1LM0A 4LUOA 5C5LA 3S15H 5D3DA 3FEWX 1PDQA 4K2LA 1T5EA 1HJPA 4DAPA 1WTPA 2E8GA 1IYVA 3I55A 1CQFA 3KF6A 3EJIA 3MXNA 3RN5A 4PZ8A 2VUMB 3OMGA 1PTOD 1XNQQ 5C4JB 2JA6B 2CH4W 1PH5A 3I4MB 3S1MH 4NMZA 1EWCA 4U68A 4DV7Q 1L0WA 4DV4L 3CCMA 1SNQA 1LUZA 4UP7A 4A76A 3PUZA 4IUQA 2WP8J 3A8IE 1BDOA 1SE4A 2OWOA 4R4IA 1KDAA 4BBSH 4JI1L 5CV4A 3SK4A 5IT9L 1D6EC 4C3HH 4B3SL 3M85A 4K5WA 1K8MA 2LSSA 2AUJD 1YVCA 3C1EA 5CV8A 1PH3A 2JA6G 2D5DA 1PTOB 2KOLA 4BA1I 4FF1A 2K28A 4C3IG 2MPMA 1U0LA 4BBRH 2F0PA 4DFAA 3TP6A 4PG3A 3S1NB 4Y7NB 3W3AA 3E5SA 5LHY1 2L1BA 2R7ZB 2PW7A 4XXEA 1QE6A 4LF9Q 1CA5A 3H09A 4HMIA 2EY5A 5IP7H 3CRKC 1JICA 2UXBQ 3K80C 3KDFA 4A93B 1C0AA 2K5VA 2XGTA 2NN6G 4TVAB 1OXUA 1RJTA 4Q5VA 3M4OH 1XXGA 3S24A 2E2HH 3D6CA 5IYDG 4RCNA 1OXVA 2CHBD 2PMZE 3VYTA 2K01A 4GOPB 4POGA 2B63B 2NVQH 4LW1A 1Y14B 4JV5Q 3TDQA 2LXKA 1SE3A 3LNNA 2F3WA 5IY0A 1C9OA 4GLAC 4DXGA 4BS9A 1D7QA 3S2DB 1UE1A 2E2JH 1ET9A 2YU9B 3OWEB 5KNDA 1D5XC 1GUSA 2TSSA 3I7FA 1VQAA 2WKDA 2JE6I 1VQIA 4OX9L 4DF7A 1I3QH 3MC0B 4Z9CB 2VS1A 2F0LA 1J6QA 2A73B 3DLLA 2OEOA 3GTGB 2ES2A 3R2IA 1QWYA 1YJNA 4GN4B 3HOZG 5HGTA 3J80c 2JA5B 1TY2A 1LO5D 4RWSC 5C0XI 5CBAE 3GDEA 4IPDA 5FJ8G 1X3PA 2KEDA 3FKIH 2A6HD 4C3JB 1IYJB 3HG9A 1NY4A 2NWGA 3F2CA 1M8AA 5FLXc 1S4ZA 2EIFA 3F1ZA 2N78A 2EJGC 2QW7A 4HJ5A 3VR4A 4DV2L 1U9RA 1QUQB 3EROA 3J81c 2VW9A 1HR0W 1Y8PB 3J7A5 4B9XA 2JA8B 4HTHA 3LWUA 3CF5A 5LMNW 4HJ8A 2JK8A 1B70B 1CSQA 3ICEA 2HDLA 3I73A 3NBHB 1V8QA 3J80E 4A3FH 4C3JG 1D5ZC 1RTNA 3F2UA 5BN3A 2PPBC 5C44G 3E9IA 1Q82C 5CYUA 1GUGA 5ELFA 1IKLA 4IALA 2ZTEA 4R1JA 5FLXE 1G2SA 4PMWA 1WCMB 2NZOA 1MKHA 2JA8G 4IFDG 3BYTB 4CJ1B 3CD6A 1KABA 3J81E 4F87A 2UXDQ 3MXNB 1TWFB 4JI2L 1SYCA 5IWAL 2Q2UA 3W5OA 5FOBB 1MI2A 1KRTA 3PIPA 1L1OB 1HQRD 5M3MB 1X3FA 1TU2B 4IPHA 4R4QA 3ULLA 1C48A 3S17H 3HOWH 3OIQA 4DAYB 3TSSA 4JI7L 1W3SA 5CBEE 1HUMA 2I5MX 3I4NH 4GKKQ 3RNUA 4HJAA 1C8CA 4FYDA 1PH2A 3QOJA 3BJUA 4ID6A 2BDOA 3NPPA 4Y52H 4MNOA 1DONA 1QILA 1X3EA 2VY3A 5FKAC 2CH4A 2WB1E 1V1OA 1EY6A 1EY4A 5C5MA 3EN2A 1WTRA 1CM9A 5M3MG 1Z47A 2IX3A 5LMUQ 2ATWA 3NK9A 3IKJA 3Q0AA 2O2LD 3TP8A 2HCIA 1BF4A 2LMCB 2MGSA 3J80i 3NSWA 4JW0A 3GO5A 1IL2A 1LABA 4N9PA 4I65A 4FF3A 2A5HA 5K36H 1IKMA 5EQ0A 1PA6A 3I2ZA 4KD3A 2QEXA 4A3MB 2SOBA 3SXHA 1WJJA 1LV9A 3KDFB 5M3FH 3SE0A 1X32A 2R6GA 2ZXRA 5D14A 2B2VA 3A8JE 3J80L 3BZKA 1F2LA 1NCVA 2UUCL 4DR5L 3DUZA 2M00A 3J81i 2XIWA 1AN8A 2OQKA 4BY7G 1BBUA 4A75A 1U4RA 3EFXD 2A1AA 4JI2Q 5JJLA 1B44D 4A3LG 1RD9D 5FLXL 3GTQH 2F0FA 1I4PA 4ZYSA 2G9HD 2I5LX 4G4KA 2J7ZA 4MN3A 1XPRA 3URYA 1EFWA 1A3TA 3J81L 3U58A 4JI7Q
chains in the Genus database with same CATH topology
1KHIA 1HH2P 2B3GA 4JI8L 5GAHC 3F8TA 1N34Q 4GN5A 3TS0A 1Q81C 3GTKH 4DUYL 5M3MH 3I4NG 3D31A 1PH6A 4KHPQ 5LMUL 2MFIA 1Y1WG 4WJ3M 3PO2G 3S1QH 1RL2A 2CWAA 3PGZA 2H5XA 1VQDA 4JOIA 1VQ5A 1CKMA 1VQ7A 4WJ4A 3EIVA 3PUYA 5J3BA 4B3ML 1A63A 2NN6I 2JA5G 2JA7H 3PV0A 4A3DG 1N32Q 2IHEA 2ASBA 3FHWA 1TXYA 2KCMA 4L5RC 1FJGL 1NMGA 3W1GA 4BY1H 2K52A 3CCQA 4DUZL 3GTOH 4JBJA 3SGIA 3PSIA 1VQJA 1NMFA 4YCWA 4BXXG 2PI2A 4JOIC 4OWXB 5C4XH 3M9BA 4DV6Q 1A62A 1EUJA 4X65Q 1P16A 2BA1A 3H3VH 5GAGC 2MNAA 5FLMG 2ZJRA 4ME3A 4UPAA 4HIMA 1VQGA 2CKZB 3TQYA 1K0RA 1KL9A 4DR7Q 1PH9A 3T1HL 3J7ZC 2C35B 4L5SA 2HT1A 1PFSA 1WFQA 3KLWA 2AWNA 3HKZG 1T9HA 2Q2IA 4JC0A 5IYCH 3STBC 1ASZA 1ASYA 4POFA 3UDIA 5M3FG 4APVA 4A3EH 4LNQA 4DV5L 4AQYQ 4IPGA 2YTVA 5C3EH 1VQBA 1N9WA 3ICEA 4JI5L 1VQHA 2CQOA 2WAQE 1HNZQ 4B3RQ 4A3MH 2K75A 1K3RA 1I6HH 4A3JG 1XMOQ 4GNXA 2EQSA 5JEAG 1LTLA 2D0PA 2ZTDA 4DV1Q 1VQMA 2WB1G 1KD1C 1WCMG 4JI0L 3CCSA 4KHPL 2F4VQ 2KCTA 4B3TL 3B6YA 5IT9c 1I5FA 3F2BA 4A3IG 5C0XG 4YWMA 4DK3C 3VDYA 3RN2A 4NXNQ 1A8VA 4UY8C 4GNXC 1OXSC 4LF6Q 1JT8A 2BH8A 1XPOA 1K83H 4GOPA 1VQ8A 1KIXA 3HOYH 2HQLA 3A5ZB 4OO1G 4J15A 2ZTCA 4DKAC 1VQPA 3M3YH 2NVTH 1QVGA 1K8GA 4BXXH 3E0EA 2NZHA 2F3IA 3M7NA 3JC66 3K8AA 4GNXB 4MTNA 3JAMc 4YCVA 4JI6Q 1YHBA 3H0GH 1Q1EA 4DV6L 4P75A 1A0IA 1TWAH 4X65L 1V43A 1CKOA 3LGJA 4O0AA 5FLMH 1E1OA 3T1YL 2JA7G 1L2FA 5LMNL 1X9NA 2OTJA 2I0QA 4DUZQ 1IXRA 1H95A 4GOPC 4O2DA 2CFMA 1GM5A 3GTPH 1Q86C 1G51A 2JQOA 1M90C 2CWPA 1Q12A 1FL0A 5M5XH 4LUVA 2E2IH 5C4XG 2HIVA 4DR1Q 1PYSB 4HIOA 4AQYL 4EQ5A 4NXMQ 1UE5A 1TWGH 1R9TH 4IFDI 3RR5A 2YTXA 3UDGA 4B3RL 5GADC 2GVAA 4A3JH 5M5WH 2ZJQA 1XNRL 3CPFA 4UP8A 1E7ZA 1YJWA 1IBMQ 1E24A 1XMOL 1VQNA 3S16H 3U4ZA 5H1SE 1XTDA 3OYYA 5IYCG 4GN3B 4DV1L 3IRBA 1Q7YC 3CC7A 1VQEA 3J81j 4DV4Q 4R4TA 2F4VL 2YTYA 1HNWQ 4RG1A 5C3EG 1S40A 3FP9A 4JBWA 5AJ3Q 4X64Q 1TWCH 3OTOL 5C4JH 4JBMA 4OWWB 2CCZA 2AHOB 2V1CC 4A3MG 1W2BA 2RCNA 2Q2HA 2I5HA 3TEHB 5GAEC 4X66Q 1PH7A 4DR6Q 3L2PA 1QUQA 2NVYH 4JI3L 5IYBH 3UE1A 3GTLH 2PNHA 4NXNL 4JI1Q 4BBSG 1Q8KA 3HKSA 1M1KC 4JI0Q 4LF6L 1VQ4A 2K5HA 4QY7A 4C3IH 5IP9H 4B3SQ 3A74A 3KJPA 1E1TA 4B3TQ 1AH9A 1BBWA 2RF4A 4A3BH 1UE6A 1VQLA 1V1QA 1EOVA 1CSPA 2YYZA 3AQQA 5M5YH 4DR2Q 4JI6L 2IX1A 1G6PA 2Z6KA 3M4PA 3D0FA 4MZ9A 5EAYA 1CKNA 4XIGS 2K4KA 3HFZB 4LF4Q 4LF9L 1E3PA 2K50A 3S1RH 4QQBX 2UXCQ 3STBD 3WWVA 2UUBQ 1BKBA 4AYBE 1X54A 4DR4Q 3HOYG 1CUKA 1VQCA 2R93G 1SE8A 3ERSX 2QA4A 4JI4Q 3CW2C 1LM0A 4LUOA 1HR0Q 1X56A 1IBLL 3S15H 5IYDH 1XMQQ 1P8LA 1B8AA 2GVBA 1EQQA 4DR1L 3AFQA 1V9PA 4IFDJ 1HJPA 3H0GG 4NXML 2VNUD 2E8GA 1IBKL 1QVCA 4YWLA 3T1YQ 2Z6KC 3I55A 5LMNQ 4IOCA 4LF7L 1YNXA 3KF6A 2BH2A 4JV5L 4K0KQ 3S1NH 4LFCL 3L0OA 3RN5A 4PZ8A 1EWIA 1AE3A 4A3CH 4K0KL 2WFWA 1IBML 4LUZA 1QZHA 1X3GA 1XNQQ 3PO3H 1FGUA 1PH5A 1CKNB 4NPSA 4PZ6A 3S1MH 3BU2A 4QL5A 2VQEL 4DV7Q 1L0WA 4DV4L 1XJVA 1HNWL 3F2DA 3DM3A 3CCMA 1LUZA 4UP7A 4L5QA 5AJ3L 4X64L 3S2HH 4A76A 1OTCA 3PUZA 4P73A 2WP8J 1XNRQ 1DGSA 2EXDA 4X66L 5HY6A 1PYBA 4R4IA 1PH1A 2OWOA 4DR6L 4BBSH 4JI1L 1VQ6A 2LXJA 2KENA 3JAMi 1JMCA 4C3HH 1EIYB 4B3SL 3TRZA 3CMEA 3KF6B 3M85A 5C0XJ 3HOZH 5IE8A 4YWKA 3RLOA 1NJIC 2LSSA 1YJ9A 2KHIA 2N3SA 1YITA 1E22A 2D62A 1YVCA 3OTOQ 1MJEA 4H02A 2KBNA 1YEZA 3MEFA 1PV4A 1N8RC 1PH3A 2JA6G 4OX9Q 4DR2L 5DLQE 4JI3Q 4LF4L 4BA1I 3HKZE 5IYBG 1SFOH 1PH4A 2UXCL 1VS0A 3CCVA 1JJCB 2N49A 2UUBL 2AWOA 5IP9G 1D8LA 1KAWA 1J5EQ 5BR8L 1EYGA 3PF5A 4DR4L 2R93H 1U0LA 5HGQA 2PQAA 3KOJA 1YBYA 4BBRH 1OXTA 1S3OA 4PG3A 5ELNA 2N8NA 1YIJA 4JI4L 4A3BG 4YHHL 3G71A 2A8VA 1HR0L 1XMQL 1FVIA 4RMFA 3FKIG 4NB3A 1IZ6A 3U50C 4LF9Q 2ID0A 4KLKA 5IP7H 3G4SA 1N36Q 2UXBQ 2E5LQ 3K80C 2B29A 1SROA 3KDFA 1Q46A 1C0AA 1PH8A 2K5VA 2XGTA 2NN6G 4TVAB 1OXUA 1AE2A 2A19A 5E7NA 4GLXA 5GQOA 2NVXH 1XNQL 3M4OH 4DV2Q 2UUAQ 1MIUA 3S24A 1IBLQ 2E2HH 3L7ZC 5IYDG 5C44H 4R4OA 1KQSA 1OXVA 3K7AH 2PMZE 1Y1VH 2FXQA 3KYHC 4DV7L 4HIDA 1IBKQ 1NE3A 4GOPB 1HNXQ 4POGA 4LF7Q 2OQ0A 1Q1BA 4DR3Q 4GKJQ 2IY5B 1Z9FA 2PQAB 3CCRA 4LFCQ 4DV3L 4IJHA 4LW1A 1Y14B 4P74A 4C2MH 3ULPA 2LXKA 2VQFQ 2NVQH 4A3CG 4JV5Q 5IY0A 4QIWE 1C9OA 4GLAC 3PO3G 4A3FG 1SMXA 4A3GG 2K5NA 1D7QA 1UE1A 1SR3A 2VL6A 2VQEQ 2E2JH 4LFBQ 1GKHA 1SRUA 1XPUA 2VUMH 2DUDA 1O7IA 3U4VA 4DNIA 4GLVB 1SN8A 1BVSA 1K8AC 2JA9A 3UE0A 4P71A 2JEAI 3I7FA 2JA6H 1VQAA 3I4MH 2XTIA 1VQIA 2JE6I 3K7UC 4OX9L 1I3QH 3CXCA 3GTJH 4KI0A 2VS1A 4X62Q 3KJOA 1J6QA 3DLLA 2ES2A 3I4OA 1YJNA 4GN4B 3S14H 1J5EL 4IOAA 3HOZG 4YCUA 3J80c 4LF8Q 2VZAA 1X55A 2D0OA 3BZCA 5IWAQ 5C0XI 3GDEA 4IPDA 4AYBG 5FJ8G 3PUWA 2IHFA 3FKIH 1IYJB 1JJGA 4IJLA 3CP0A 1NY4A 3RZOH 3GD7A 5FLXc 3F2CA 1RIPA 3CCUA 1YI2A 1N36L 3HOWG 2E5LL 4OO1I 2UXBL 2EIFA 3F1ZA 4PZ7A 4OXPA 2Y0SE 2N78A 4HIKA 5BR8Q 4HJ5A 3A5UA 3PUVA 3NELA 4BBRG 4JYAQ 4QJFA 4DV2L 2R92G 4YHHQ 2UUAL 1QUQB 3CPWA 2RHQB 2KHJA 3J81c 2VW9A 1HR0W 3E9HA 3AYHB 3J7A5 1X65A 3RLFA 2Q2TA 1UEBA 1HNXL 2L15A 3CF5A 5IP7G 4GKJL 4DR3L 1YZ6A 1KXLA 1S72A 3TREA 5LMNW 2MO0A 4HJ8A 5ELOA 2JK8A 1B70B 1GD7A 1KRSA 3NEMA 4QGUA 1CSQA 4Y7NH 2VQFL 2OTLA 2ALYB 2BA0A 3NBHB 1K73C 1LYLA 4AIMA 2R7ZH 4A3GH 2WAQG 4A3FH 3RZDH 1JE5A 2UU9L 1L1OA 4A4IA 4LFAL 3H3VI 5C44G 4LFBL 4ALPA 1I94Q 3E9IA 1Q82C 1Y1VG 3K0XA 4A93H 3CAMA 2YV5A 2DGYA 4AH6A 1VQOA 2ZTEA 2RHSB 3NENA 4R1JA 5JEAJ 2OCEA 3G6EA 3TS2A 4DV3Q 4A3KG 1VCIA 2R7DA 3RLNA 1N33Q 4PMWA 2NZOA 2ZM6Q 4X62L 3HOUG 1MKHA 1TWHH 2JA8G 4BA2I 4IFDG 2B63H 4BY7H 4DV0Q 4YY3Q 3CD6A 5K36G 1EIFA 3K81C 1L1OC 4LF5L 2UXDQ 3MXNB 3PF4A 1HZAA 4LF8L 4JI2L 1VQFA 4A3LH 3ER0A 2VUMG 4DK6C 5IWAL 1WI5A 5FJ8H 3W5OA 1VQKA 2IT1A 1B7YB 2ZJPA 2HHHL 2Q2UA 1KRTA 3PIPA 3I4MG 3S2DH 4OWTB 3HOXH 1L1OB 3CCJA 4X6AH 1X3FA 4IPHA 1HZ9A 4R4QA 3ULLA 3Q8DA 2UUCQ 4DR5Q 2YU9H 3HOVH 1I50H 3HOWH 3S17H 1K9MC 4DAYB 4LWCA 3PUXA 4JCVE 4JI7L 5JJIA 1W3SA 1N34L 2R92H 2I5MX 3CCLA 3I4NH 4GKKQ 3RNUA 4JYAL 2Z0SA 4HJAA 3CC4A 3I56A 1Y1WH 3GTGH 3PO2H 4TQUS 1PH2A 3BJUA 3H15A 3KFUA 1JJ2A 4Y52H 1SLJA 4MNOA 1X3EA 2VY3A 4JG2A 2JA5H 2WB1E 4A3DH 2R7FA 3CC2A 1GO3E 4R4CA 3UDFA 3EN2A 3AEVA 4JI8Q 1N32L 4C3JH 3CCEA 4UP9A 4DUYQ 1YHQA 2AKWB 5M3MG 1Z47A 1GVPA 2IX0A 4OONA 3UDXA 2AMCB 5LMUQ 1UE7A 2ATWA 4DAMA 1I94L 4L5TA 4HJ9A 1JB7A 3ULJA 1QVFA 4B3MQ 2MQHA 2QGQA 4XTCS 1KC8C 4A3KH 4HJ7A 1U5KA 3HOVG 2JEBI 1N33L 1OXXK 1MJCA 2K14A 3J80i 1C7YA 3GO5A 3KF8B 1IL2A 2ZM6L 2R7ZG 3AFPA 3HOUH 1YHAA 2JA8H 2PI2E 1FJGQ 2UU9Q 4P72A 4DR7L 4BY1G 4DV0L 4YY3L 4LFAQ 3CMAA 1HZBA 1PA6A 1G291 3I2ZA 2QEXA 2UXDL 4A93G 1WJJA 4FDBA 3KDFB 1VQ9A 5M3FH 5GROA 3EBEA 1WYDA 1WOCA 1NBWA 2JJQA 3G48A 3PCOB 2R6GA 1HZCA 2MO1A 4DPGA 3BZKA 1HNZL 2UUCL 4JBKA 3ZJYC 4DR5L 4IO9A 3J81i 3T1HQ 1EQRA 2OQKA 2B63G 4BY7G 1BBUA 3GTMH 3PIOA 4A75A 4LF5Q 3CQZH 1QZGA 2A1AA 4JI2Q 5JJLA 1WCMH 4EX5A 3A0JA 4A3LG 4GKKL 3OW2A 2Y0SG 4DV5Q 1PHJA 3GTQH 4A3EG 2HHHQ 4IPCA 4JI5Q 3HOXG 3W1BA 5JJKA 1NTGA 1PVOA 2HIXA 2I5LX 4GS3A 3M4QA 1TWFH 4A3IH 1UWVA 1X6OA 1XPRA 2F52A 4KHZA 1EFWA 2GN5A 3U58A 4JI7Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KHI A;  1HH2 P;  2B3G A;  4JI8 L;  5GAH C;  3F8T A;  1N34 Q;  4GN5 A;  3TS0 A;  1Q81 C;  3GTK H;  4DUY L;  5M3M H;  3I4N G;  3D31 A;  1PH6 A;  4KHP Q;  5LMU L;  2MFI A;  1Y1W G;  4WJ3 M;  3PO2 G;  3S1Q H;  1RL2 A;  2CWA A;  3PGZ A;  2H5X A;  1VQD A;  4JOI A;  1VQ5 A;  1CKM A;  1VQ7 A;  4WJ4 A;  3EIV A;  3PUY A;  5J3B A;  4B3M L;  1A63 A;  2NN6 I;  2JA5 G;  2JA7 H;  3PV0 A;  4A3D G;  1N32 Q;  2IHE A;  2ASB A;  3FHW A;  1TXY A;  2KCM A;  4L5R C;  1FJG L;  1NMG A;  3W1G A;  4BY1 H;  2K52 A;  3CCQ A;  4DUZ L;  3GTO H;  4JBJ A;  3SGI A;  3PSI A;  1VQJ A;  1NMF A;  4YCW A;  4BXX G;  2PI2 A;  4JOI C;  4OWX B;  5C4X H;  3M9B A;  4DV6 Q;  1A62 A;  1EUJ A;  4X65 Q;  1P16 A;  2BA1 A;  3H3V H;  5GAG C;  2MNA A;  5FLM G;  2ZJR A;  4ME3 A;  4UPA A;  4HIM A;  1VQG A;  2CKZ B;  3TQY A;  1K0R A;  1KL9 A;  4DR7 Q;  1PH9 A;  3T1H L;  3J7Z C;  2C35 B;  4L5S A;  2HT1 A;  1PFS A;  1WFQ A;  3KLW A;  2AWN A;  3HKZ G;  1T9H A;  2Q2I A;  4JC0 A;  5IYC H;  3STB C;  1ASZ A;  1ASY A;  4POF A;  3UDI A;  5M3F G;  4APV A;  4A3E H;  4LNQ A;  4DV5 L;  4AQY Q;  4IPG A;  2YTV A;  5C3E H;  1VQB A;  1N9W A;  3ICE A;  4JI5 L;  1VQH A;  2CQO A;  2WAQ E;  1HNZ Q;  4B3R Q;  4A3M H;  2K75 A;  1K3R A;  1I6H H;  4A3J G;  1XMO Q;  4GNX A;  2EQS A;  5JEA G;  1LTL A;  2D0P A;  2ZTD A;  4DV1 Q;  1VQM A;  2WB1 G;  1KD1 C;  1WCM G;  4JI0 L;  3CCS A;  4KHP L;  2F4V Q;  2KCT A;  4B3T L;  3B6Y A;  5IT9 c;  1I5F A;  3F2B A;  4A3I G;  5C0X G;  4YWM A;  4DK3 C;  3VDY A;  3RN2 A;  4NXN Q;  1A8V A;  4UY8 C;  4GNX C;  1OXS C;  4LF6 Q;  1JT8 A;  2BH8 A;  1XPO A;  1K83 H;  4GOP A;  1VQ8 A;  1KIX A;  3HOY H;  2HQL A;  3A5Z B;  4OO1 G;  4J15 A;  2ZTC A;  4DKA C;  1VQP A;  3M3Y H;  2NVT H;  1QVG A;  1K8G A;  4BXX H;  3E0E A;  2NZH A;  2F3I A;  3M7N A;  3JC6 6;  3K8A A;  4GNX B;  4MTN A;  3JAM c;  4YCV A;  4JI6 Q;  1YHB A;  3H0G H;  1Q1E A;  4DV6 L;  4P75 A;  1A0I A;  1TWA H;  4X65 L;  1V43 A;  1CKO A;  3LGJ A;  4O0A A;  5FLM H;  1E1O A;  3T1Y L;  2JA7 G;  1L2F A;  5LMN L;  1X9N A;  2OTJ A;  2I0Q A;  4DUZ Q;  1IXR A;  1H95 A;  4GOP C;  4O2D A;  2CFM A;  1GM5 A;  3GTP H;  1Q86 C;  1G51 A;  2JQO A;  1M90 C;  2CWP A;  1Q12 A;  1FL0 A;  5M5X H;  4LUV A;  2E2I H;  5C4X G;  2HIV A;  4DR1 Q;  1PYS B;  4HIO A;  4AQY L;  4EQ5 A;  4NXM Q;  1UE5 A;  1TWG H;  1R9T H;  4IFD I;  3RR5 A;  2YTX A;  3UDG A;  4B3R L;  5GAD C;  2GVA A;  4A3J H;  5M5W H;  2ZJQ A;  1XNR L;  3CPF A;  4UP8 A;  1E7Z A;  1YJW A;  1IBM Q;  1E24 A;  1XMO L;  1VQN A;  3S16 H;  3U4Z A;  5H1S E;  1XTD A;  3OYY A;  5IYC G;  4GN3 B;  4DV1 L;  3IRB A;  1Q7Y C;  3CC7 A;  1VQE A;  3J81 j;  4DV4 Q;  4R4T A;  2F4V L;  2YTY A;  1HNW Q;  4RG1 A;  5C3E G;  1S40 A;  3FP9 A;  4JBW A;  5AJ3 Q;  4X64 Q;  1TWC H;  3OTO L;  5C4J H;  4JBM A;  4OWW B;  2CCZ A;  2AHO B;  2V1C C;  4A3M G;  1W2B A;  2RCN A;  2Q2H A;  2I5H A;  3TEH B;  5GAE C;  4X66 Q;  1PH7 A;  4DR6 Q;  3L2P A;  1QUQ A;  2NVY H;  4JI3 L;  5IYB H;  3UE1 A;  3GTL H;  2PNH A;  4NXN L;  4JI1 Q;  4BBS G;  1Q8K A;  3HKS A;  1M1K C;  4JI0 Q;  4LF6 L;  1VQ4 A;  2K5H A;  4QY7 A;  4C3I H;  5IP9 H;  4B3S Q;  3A74 A;  3KJP A;  1E1T A;  4B3T Q;  1AH9 A;  1BBW A;  2RF4 A;  4A3B H;  1UE6 A;  1VQL A;  1V1Q A;  1EOV A;  1CSP A;  2YYZ A;  3AQQ A;  5M5Y H;  4DR2 Q;  4JI6 L;  2IX1 A;  1G6P A;  2Z6K A;  3M4P A;  3D0F A;  4MZ9 A;  5EAY A;  1CKN A;  4XIG S;  2K4K A;  3HFZ B;  4LF4 Q;  4LF9 L;  1E3P A;  2K50 A;  3S1R H;  4QQB X;  2UXC Q;  3STB D;  3WWV A;  2UUB Q;  1BKB A;  4AYB E;  1X54 A;  4DR4 Q;  3HOY G;  1CUK A;  1VQC A;  2R93 G;  1SE8 A;  3ERS X;  2QA4 A;  4JI4 Q;  3CW2 C;  1LM0 A;  4LUO A;  1HR0 Q;  1X56 A;  1IBL L;  3S15 H;  5IYD H;  1XMQ Q;  1P8L A;  1B8A A;  2GVB A;  1EQQ A;  4DR1 L;  3AFQ A;  1V9P A;  4IFD J;  1HJP A;  3H0G G;  4NXM L;  2VNU D;  2E8G A;  1IBK L;  1QVC A;  4YWL A;  3T1Y Q;  2Z6K C;  3I55 A;  5LMN Q;  4IOC A;  4LF7 L;  1YNX A;  3KF6 A;  2BH2 A;  4JV5 L;  4K0K Q;  3S1N H;  4LFC L;  3L0O A;  3RN5 A;  4PZ8 A;  1EWI A;  1AE3 A;  4A3C H;  4K0K L;  2WFW A;  1IBM L;  4LUZ A;  1QZH A;  1X3G A;  1XNQ Q;  3PO3 H;  1FGU A;  1PH5 A;  1CKN B;  4NPS A;  4PZ6 A;  3S1M H;  3BU2 A;  4QL5 A;  2VQE L;  4DV7 Q;  1L0W A;  4DV4 L;  1XJV A;  1HNW L;  3F2D A;  3DM3 A;  3CCM A;  1LUZ A;  4UP7 A;  4L5Q A;  5AJ3 L;  4X64 L;  3S2H H;  4A76 A;  1OTC A;  3PUZ A;  4P73 A;  2WP8 J;  1XNR Q;  1DGS A;  2EXD A;  4X66 L;  5HY6 A;  1PYB A;  4R4I A;  1PH1 A;  2OWO A;  4DR6 L;  4BBS H;  4JI1 L;  1VQ6 A;  2LXJ A;  2KEN A;  3JAM i;  1JMC A;  4C3H H;  1EIY B;  4B3S L;  3TRZ A;  3CME A;  3KF6 B;  3M85 A;  5C0X J;  3HOZ H;  5IE8 A;  4YWK A;  3RLO A;  1NJI C;  2LSS A;  1YJ9 A;  2KHI A;  2N3S A;  1YIT A;  1E22 A;  2D62 A;  1YVC A;  3OTO Q;  1MJE A;  4H02 A;  2KBN A;  1YEZ A;  3MEF A;  1PV4 A;  1N8R C;  1PH3 A;  2JA6 G;  4OX9 Q;  4DR2 L;  5DLQ E;  4JI3 Q;  4LF4 L;  4BA1 I;  3HKZ E;  5IYB G;  1SFO H;  1PH4 A;  2UXC L;  1VS0 A;  3CCV A;  1JJC B;  2N49 A;  2UUB L;  2AWO A;  5IP9 G;  1D8L A;  1KAW A;  1J5E Q;  5BR8 L;  1EYG A;  3PF5 A;  4DR4 L;  2R93 H;  1U0L A;  5HGQ A;  2PQA A;  3KOJ A;  1YBY A;  4BBR H;  1OXT A;  1S3O A;  4PG3 A;  5ELN A;  2N8N A;  1YIJ A;  4JI4 L;  4A3B G;  4YHH L;  3G71 A;  2A8V A;  1HR0 L;  1XMQ L;  1FVI A;  4RMF A;  3FKI G;  4NB3 A;  1IZ6 A;  3U50 C;  4LF9 Q;  2ID0 A;  4KLK A;  5IP7 H;  3G4S A;  1N36 Q;  2UXB Q;  2E5L Q;  3K80 C;  2B29 A;  1SRO A;  3KDF A;  1Q46 A;  1C0A A;  1PH8 A;  2K5V A;  2XGT A;  2NN6 G;  4TVA B;  1OXU A;  1AE2 A;  2A19 A;  5E7N A;  4GLX A;  5GQO A;  2NVX H;  1XNQ L;  3M4O H;  4DV2 Q;  2UUA Q;  1MIU A;  3S24 A;  1IBL Q;  2E2H H;  3L7Z C;  5IYD G;  5C44 H;  4R4O A;  1KQS A;  1OXV A;  3K7A H;  2PMZ E;  1Y1V H;  2FXQ A;  3KYH C;  4DV7 L;  4HID A;  1IBK Q;  1NE3 A;  4GOP B;  1HNX Q;  4POG A;  4LF7 Q;  2OQ0 A;  1Q1B A;  4DR3 Q;  4GKJ Q;  2IY5 B;  1Z9F A;  2PQA B;  3CCR A;  4LFC Q;  4DV3 L;  4IJH A;  4LW1 A;  1Y14 B;  4P74 A;  4C2M H;  3ULP A;  2LXK A;  2VQF Q;  2NVQ H;  4A3C G;  4JV5 Q;  5IY0 A;  4QIW E;  1C9O A;  4GLA C;  3PO3 G;  4A3F G;  1SMX A;  4A3G G;  2K5N A;  1D7Q A;  1UE1 A;  1SR3 A;  2VL6 A;  2VQE Q;  2E2J H;  4LFB Q;  1GKH A;  1SRU A;  1XPU A;  2VUM H;  2DUD A;  1O7I A;  3U4V A;  4DNI A;  4GLV B;  1SN8 A;  1BVS A;  1K8A C;  2JA9 A;  3UE0 A;  4P71 A;  2JEA I;  3I7F A;  2JA6 H;  1VQA A;  3I4M H;  2XTI A;  1VQI A;  2JE6 I;  3K7U C;  4OX9 L;  1I3Q H;  3CXC A;  3GTJ H;  4KI0 A;  2VS1 A;  4X62 Q;  3KJO A;  1J6Q A;  3DLL A;  2ES2 A;  3I4O A;  1YJN A;  4GN4 B;  3S14 H;  1J5E L;  4IOA A;  3HOZ G;  4YCU A;  3J80 c;  4LF8 Q;  2VZA A;  1X55 A;  2D0O A;  3BZC A;  5IWA Q;  5C0X I;  3GDE A;  4IPD A;  4AYB G;  5FJ8 G;  3PUW A;  2IHF A;  3FKI H;  1IYJ B;  1JJG A;  4IJL A;  3CP0 A;  1NY4 A;  3RZO H;  3GD7 A;  5FLX c;  3F2C A;  1RIP A;  3CCU A;  1YI2 A;  1N36 L;  3HOW G;  2E5L L;  4OO1 I;  2UXB L;  2EIF A;  3F1Z A;  4PZ7 A;  4OXP A;  2Y0S E;  2N78 A;  4HIK A;  5BR8 Q;  4HJ5 A;  3A5U A;  3PUV A;  3NEL A;  4BBR G;  4JYA Q;  4QJF A;  4DV2 L;  2R92 G;  4YHH Q;  2UUA L;  1QUQ B;  3CPW A;  2RHQ B;  2KHJ A;  3J81 c;  2VW9 A;  1HR0 W;  3E9H A;  3AYH B;  3J7A 5;  1X65 A;  3RLF A;  2Q2T A;  1UEB A;  1HNX L;  2L15 A;  3CF5 A;  5IP7 G;  4GKJ L;  4DR3 L;  1YZ6 A;  1KXL A;  1S72 A;  3TRE A;  5LMN W;  2MO0 A;  4HJ8 A;  5ELO A;  2JK8 A;  1B70 B;  1GD7 A;  1KRS A;  3NEM A;  4QGU A;  1CSQ A;  4Y7N H;  2VQF L;  2OTL A;  2ALY B;  2BA0 A;  3NBH B;  1K73 C;  1LYL A;  4AIM A;  2R7Z H;  4A3G H;  2WAQ G;  4A3F H;  3RZD H;  1JE5 A;  2UU9 L;  1L1O A;  4A4I A;  4LFA L;  3H3V I;  5C44 G;  4LFB L;  4ALP A;  1I94 Q;  3E9I A;  1Q82 C;  1Y1V G;  3K0X A;  4A93 H;  3CAM A;  2YV5 A;  2DGY A;  4AH6 A;  1VQO A;  2ZTE A;  2RHS B;  3NEN A;  4R1J A;  5JEA J;  2OCE A;  3G6E A;  3TS2 A;  4DV3 Q;  4A3K G;  1VCI A;  2R7D A;  3RLN A;  1N33 Q;  4PMW A;  2NZO A;  2ZM6 Q;  4X62 L;  3HOU G;  1MKH A;  1TWH H;  2JA8 G;  4BA2 I;  4IFD G;  2B63 H;  4BY7 H;  4DV0 Q;  4YY3 Q;  3CD6 A;  5K36 G;  1EIF A;  3K81 C;  1L1O C;  4LF5 L;  2UXD Q;  3MXN B;  3PF4 A;  1HZA A;  4LF8 L;  4JI2 L;  1VQF A;  4A3L H;  3ER0 A;  2VUM G;  4DK6 C;  5IWA L;  1WI5 A;  5FJ8 H;  3W5O A;  1VQK A;  2IT1 A;  1B7Y B;  2ZJP A;  2HHH L;  2Q2U A;  1KRT A;  3PIP A;  3I4M G;  3S2D H;  4OWT B;  3HOX H;  1L1O B;  3CCJ A;  4X6A H;  1X3F A;  4IPH A;  1HZ9 A;  4R4Q A;  3ULL A;  3Q8D A;  2UUC Q;  4DR5 Q;  2YU9 H;  3HOV H;  1I50 H;  3HOW H;  3S17 H;  1K9M C;  4DAY B;  4LWC A;  3PUX A;  4JCV E;  4JI7 L;  5JJI A;  1W3S A;  1N34 L;  2R92 H;  2I5M X;  3CCL A;  3I4N H;  4GKK Q;  3RNU A;  4JYA L;  2Z0S A;  4HJA A;  3CC4 A;  3I56 A;  1Y1W H;  3GTG H;  3PO2 H;  4TQU S;  1PH2 A;  3BJU A;  3H15 A;  3KFU A;  1JJ2 A;  4Y52 H;  1SLJ A;  4MNO A;  1X3E A;  2VY3 A;  4JG2 A;  2JA5 H;  2WB1 E;  4A3D H;  2R7F A;  3CC2 A;  1GO3 E;  4R4C A;  3UDF A;  3EN2 A;  3AEV A;  4JI8 Q;  1N32 L;  4C3J H;  3CCE A;  4UP9 A;  4DUY Q;  1YHQ A;  2AKW B;  5M3M G;  1Z47 A;  1GVP A;  2IX0 A;  4OON A;  3UDX A;  2AMC B;  5LMU Q;  1UE7 A;  2ATW A;  4DAM A;  1I94 L;  4L5T A;  4HJ9 A;  1JB7 A;  3ULJ A;  1QVF A;  4B3M Q;  2MQH A;  2QGQ A;  4XTC S;  1KC8 C;  4A3K H;  4HJ7 A;  1U5K A;  3HOV G;  2JEB I;  1N33 L;  1OXX K;  1MJC A;  2K14 A;  3J80 i;  1C7Y A;  3GO5 A;  3KF8 B;  1IL2 A;  2ZM6 L;  2R7Z G;  3AFP A;  3HOU H;  1YHA A;  2JA8 H;  2PI2 E;  1FJG Q;  2UU9 Q;  4P72 A;  4DR7 L;  4BY1 G;  4DV0 L;  4YY3 L;  4LFA Q;  3CMA A;  1HZB A;  1PA6 A;  1G29 1;  3I2Z A;  2QEX A;  2UXD L;  4A93 G;  1WJJ A;  4FDB A;  3KDF B;  1VQ9 A;  5M3F H;  5GRO A;  3EBE A;  1WYD A;  1WOC A;  1NBW A;  2JJQ A;  3G48 A;  3PCO B;  2R6G A;  1HZC A;  2MO1 A;  4DPG A;  3BZK A;  1HNZ L;  2UUC L;  4JBK A;  3ZJY C;  4DR5 L;  4IO9 A;  3J81 i;  3T1H Q;  1EQR A;  2OQK A;  2B63 G;  4BY7 G;  1BBU A;  3GTM H;  3PIO A;  4A75 A;  4LF5 Q;  3CQZ H;  1QZG A;  2A1A A;  4JI2 Q;  5JJL A;  1WCM H;  4EX5 A;  3A0J A;  4A3L G;  4GKK L;  3OW2 A;  2Y0S G;  4DV5 Q;  1PHJ A;  3GTQ H;  4A3E G;  2HHH Q;  4IPC A;  4JI5 Q;  3HOX G;  3W1B A;  5JJK A;  1NTG A;  1PVO A;  2HIX A;  2I5L X;  4GS3 A;  3M4Q A;  1TWF H;  4A3I H;  1UWV A;  1X6O A;  1XPR A;  2F52 A;  4KHZ A;  1EFW A;  2GN5 A;  3U58 A;  4JI7 Q; 
#chains in the Genus database with same CATH topology
 4GN5 A;  2MJ8 A;  2QF7 A;  3Q6S A;  3OWF A;  4PV1 C;  1H9S B;  2MFI A;  3ZYY X;  3PO2 G;  1RL2 A;  4JOI A;  1JOK A;  2H5X A;  2XN9 C;  3TME A;  1CKM A;  2EPB A;  4A3D G;  5M5X B;  1QJO A;  3C3L A;  3FHW A;  1TXY A;  4L5R C;  1FJG L;  1HA5 A;  1NMG A;  1SDF A;  3VYS A;  3W1G A;  1MSG A;  4DUZ L;  2B39 A;  4IUV A;  4OEM B;  1WTO A;  1VQJ A;  1E2Z A;  4YCW A;  2PI2 A;  4JOI C;  4OWX B;  3DEO A;  4XDX A;  3M9B A;  5JAV A;  3S16 B;  1EUJ A;  4X65 Q;  1P16 A;  5GAG C;  5FLM G;  2ZJR A;  3BZD B;  1K0R A;  4FXG C;  5KNC A;  1A2U A;  1SNO A;  1Z6H A;  2C35 B;  1SMY D;  1WFQ A;  2GA4 B;  4POF A;  4A3E H;  2NVY B;  1X3Q A;  3GTL B;  4IPG A;  4NKL A;  3MTS A;  1BO0 A;  4L63 B;  4H7B A;  2K75 A;  1I6H H;  4QIW B;  4ILW A;  1LTL A;  1B4O A;  5CMD A;  1TS3 A;  1HFN A;  5IGC A;  1TT2 A;  3K57 A;  3TZD A;  3PIO 3;  4KKT A;  5G3L F;  5FO9 B;  4NW2 A;  1SE2 A;  2K5D A;  4HSP A;  4A3I G;  1PFB A;  4YWM A;  2L5T A;  1PRT C;  3VDY A;  3RN2 A;  1A8V A;  4UY8 C;  2RQX A;  1NR2 A;  1KIX A;  4DK0 A;  1VQP A;  3M3Y H;  4XT3 B;  1QVG A;  2NZH A;  2RKS A;  4GNX B;  2Z1C A;  4YCV A;  4JI6 Q;  1VF5 C;  3PO3 B;  4F88 A;  1A0I A;  1VQ6 A;  1V43 A;  1Y8N B;  4O0A A;  2DN8 A;  3Q23 A;  1DOM A;  1TY0 A;  2B2T A;  5KRU A;  2OTJ A;  1GHK A;  1FYC A;  1O80 A;  1IXR A;  4DUZ Q;  1FGB D;  1S5E D;  4DXF A;  4O2D A;  2XNA C;  3S2H B;  1LTI D;  1M90 C;  2CWP A;  5HUR A;  1PFM A;  4DR1 Q;  1PYS B;  4AQY L;  4EQ5 A;  5A35 A;  4NXM Q;  3DXJ C;  1ZEQ X;  4N9T A;  4ODG A;  3NBI A;  2GVA A;  3K5O A;  2B2T C;  1DJR D;  3CPF A;  1IBM Q;  4HED A;  1E24 A;  1LTS D;  1XTD A;  3OYY A;  4PNY A;  4GN3 B;  2L55 A;  2B2Y A;  2CW0 D;  1VQE A;  3OSO A;  3FP9 A;  3CRL C;  5AJ3 Q;  4X64 Q;  1TWC H;  5C4J H;  3OHX C;  4OWW B;  4V19 0;  1F77 A;  4KTA A;  4TRD A;  4F8M A;  2Q2H A;  4X66 Q;  3MEH A;  2D9U A;  4NXN L;  3HKS A;  2DJG C;  3I70 A;  4C3I H;  2IW3 A;  2B2Y C;  3TBI B;  3G7L A;  1AH9 A;  2YYZ A;  1A2T A;  5M5Y H;  4DR2 Q;  2DY8 A;  2K4K A;  2D2C C;  2K50 A;  4IUT A;  4KJN A;  3E0J A;  4C1N I;  2NN6 H;  1X54 A;  3HOY G;  4JI4 Q;  1Q3L A;  1X56 A;  1LTA D;  1IBL L;  5IYD H;  1XMQ Q;  4XQQ A;  4IFD J;  2VNU D;  1IBK L;  1QVC A;  4YWL A;  5IIF A;  4IOC A;  4LF7 L;  1YNX A;  1UAP A;  1KLG D;  3SDZ A;  3MWY W;  5NUC A;  4HCE A;  1IW7 D;  1CKN B;  4NPS A;  3TZU A;  3BU2 A;  3I4L A;  1HNW L;  5EBD A;  3P75 A;  2PQE A;  1JWM D;  1B9M A;  1EY7 A;  4P73 A;  3S14 B;  4DR6 L;  1DGS A;  5HY6 A;  2JYO A;  3K58 A;  1EY0 A;  3WOF A;  1EIY B;  1EYC A;  3HOZ H;  3RLO A;  1NJI C;  1PTO C;  1YJ9 A;  2V4D A;  5CV5 A;  2KHI A;  2N3S A;  1YIT A;  2D62 A;  1FNU A;  3MEF A;  1PV4 A;  3DM1 A;  2OF1 A;  4FO2 A;  1N8R C;  5JOB A;  1GHJ A;  5J22 A;  5I4D A;  1XWE A;  3DWA A;  1SFO H;  2UXC L;  2NTS A;  3A56 A;  1VS0 A;  4KKU A;  3KLS X;  2N49 A;  2UUB L;  5IP9 G;  1J5E Q;  1EYG A;  3PF5 A;  4DR4 L;  2SNS A;  1YIJ A;  1UEA B;  4A3B G;  3HOV B;  3G71 A;  2FHT A;  4G7Z C;  2Z4I A;  4A3G B;  1FVI A;  2QCP X;  3GQB A;  4NB3 A;  4EVO A;  1J8I A;  5JPM C;  2ID0 A;  5IOC A;  3OW7 A;  1N36 Q;  4XT1 B;  2B29 A;  1PH8 A;  4GLX A;  1MHW C;  1HFG A;  3SK8 A;  1LT3 D;  2NVX H;  1XNQ L;  3N6R A;  1IBL Q;  1Z7T A;  4S3S A;  5C44 H;  1KQS A;  1L0X B;  4DV7 L;  1STN A;  1DOK A;  1TWH B;  4HID A;  1IBK Q;  1HNX Q;  4LF7 Q;  4GKJ Q;  2IY5 B;  4IQZ A;  3S9W A;  4DR3 Q;  1Z9F A;  1R4Q B;  3GV3 A;  4IJH A;  3ND9 A;  1M4V A;  4P74 A;  4C2M H;  4ZLT F;  1EEF D;  2VQF Q;  4A3C G;  4QIW E;  4A3G G;  4IFD H;  3HOX B;  2VL6 A;  2EYJ A;  3BG3 A;  4HCS A;  2DUD A;  1O7I A;  3U4V A;  4DNI A;  4GLV B;  4K6D A;  5KGU A;  1K8A C;  4P71 A;  3J7A V;  3VR6 A;  3HZX A;  2XTI A;  3VYU A;  4DA2 A;  3GTJ H;  2R92 B;  4KI0 A;  3QIA A;  3A8K E;  1Y1W B;  3D6W A;  4V0B A;  4X3K A;  1TII D;  3PMF A;  3QOL A;  3I4O A;  3P1H A;  1H9R A;  3MVV A;  1JOR A;  3J7A F;  2PW5 A;  1WD0 A;  3NBH A;  4FP5 D;  4MHE A;  2IHF A;  3RUZ A;  4IJL A;  3RZO H;  3GP7 A;  1G8Z D;  2UXB L;  2E74 C;  3OOC A;  1ILQ A;  2DJF C;  2O4X A;  1SYB A;  3A5U A;  4FF2 A;  3NEL A;  4ZQ3 A;  2RDH A;  4OIJ A;  4QJF A;  1LT6 D;  4A3K B;  2R92 G;  2DY7 A;  3I91 A;  1SEB D;  1X65 A;  1A3U A;  3RLF A;  4EQO A;  2L15 A;  3HKZ B;  3TRE A;  1YHQ A;  2MO0 A;  5CGK A;  1KRS A;  2A6H C;  3EA6 A;  4JV5 L;  2ALY B;  2BA0 A;  4OL7 A;  1HA6 A;  2Z6B A;  3RZD H;  1JE5 A;  2UU9 L;  1L1O A;  1V1P B;  3MFY A;  4ALP A;  1Y1V G;  3NTH A;  4DAY A;  5D3I B;  3NEN A;  2NB0 A;  2OCE A;  3I3C A;  5BN4 A;  4A3K G;  1VCI A;  2F0J A;  1CZG A;  2KQ3 A;  1FD7 D;  4WJW A;  4BY7 H;  4DV0 Q;  3X3N A;  1ILP A;  1EIF A;  1L1O C;  5JVG 3;  5JVH 3;  4LF5 L;  3PF4 A;  4A3L H;  2M2L A;  2VUM G;  4DK6 C;  1F9R A;  2F0I A;  3SEB A;  1B7Y B;  2ZJP A;  3I4M G;  2L4N A;  1HZ9 A;  4XQJ A;  1I50 H;  4TKO B;  1K9M C;  3H94 A;  1D2B A;  4JCV E;  2WAC A;  2JA7 B;  5DEH A;  3PO2 H;  1ENA A;  2I46 A;  3H15 A;  1PRT F;  2BOS A;  4I7A A;  3AB9 A;  1JJ2 A;  1HPC A;  2KHS A;  4A3D H;  3R3O A;  2TMP A;  4FNF A;  4X3T A;  1I4Q A;  4DUY Q;  2AKW B;  1GVP A;  1UE7 A;  4E6I A;  3GV6 A;  3T13 A;  4HJ9 A;  3ULJ A;  4XTC S;  4HJ7 A;  1U5K A;  2EYM A;  2JEB I;  1OXX K;  2K14 A;  3NWT A;  3KF8 B;  2Y0S B;  2K32 A;  2R7Z G;  3AFP A;  1SXT A;  5FO7 B;  5IGF A;  3HOU H;  2PI2 E;  2UU9 Q;  2EYF A;  5C3E B;  3K6O A;  4HAE A;  2UXD L;  2A68 D;  3Q22 A;  1VQ9 A;  4FDB A;  1J9O A;  4A93 G;  5GRO A;  1CHP D;  3EBE A;  1WYD A;  1F9S A;  1NBW A;  1WOC A;  1RTO A;  3PCO B;  3SR1 A;  1H9S A;  4JBK A;  4IO9 A;  1EQR A;  2XRQ D;  3R93 A;  2WIN B;  2B63 G;  3GTM H;  3PIO A;  4LF5 Q;  3CQZ H;  2XRS D;  1O7Y A;  4EX5 A;  3A0J A;  4GKK L;  3OW2 A;  2Y0S G;  4QUF A;  4DV5 Q;  4NP5 A;  4IPC A;  4JI5 Q;  3W1B A;  1NTG A;  1F9Q A;  1PVO A;  5FK9 C;  3M4Q A;  3H91 A;  5EBC A;  1UWV A;  4A3I H;  4KHZ A;  2K04 A;  1VQN A;  1KHI A;  3HGB A;  4CDC C;  3TS0 A;  1Q81 C;  3GTK H;  3H0G B;  2X6L A;  1F2Y A;  2EYH A;  5LMU L;  4WJ3 M;  1SBB B;  3S1Q H;  4KY7 A;  1EY9 A;  4DNR B;  2NN6 I;  1A3V A;  2JA5 G;  1LTB D;  3GTP B;  3RMH A;  2SNM A;  1EU3 A;  2J0T D;  2IHE A;  2C9O A;  3V2T A;  4BY1 H;  3CCQ A;  3GTO H;  2F1M A;  3VR3 A;  3J7Y W;  1LTT D;  3PSI A;  3PQI A;  4A3J B;  3ITP A;  5M5W B;  1WTV A;  4QMG A;  4RGO S;  4QCL A;  3BDC A;  4DV6 Q;  1A62 A;  4G57 A;  5D65 A;  2BA1 A;  3H3V H;  2MNA A;  4UPA A;  2KCC A;  2Q8R E;  3FRP B;  4RCO A;  4RFB A;  5F2D A;  3J7Z C;  3DMU A;  4L5S A;  4R8N A;  3KLW A;  2AWN A;  1ASZ A;  1JR0 D;  3UDI A;  4APV A;  4H0L C;  4ABN A;  1WD1 A;  2YTV A;  1VQB A;  1AW7 A;  1N9W A;  2F0T A;  2CQO A;  4B3R Q;  3L3O C;  1TKW B;  1K3R A;  4A3J G;  4GNX A;  3R8B A;  5JEA G;  2D0P A;  2ZTD A;  1PTO F;  2F3V A;  3ND8 A;  1WCM G;  3CCS A;  4ZAI A;  2F4V Q;  1E2V A;  1SMY C;  3B6Y A;  3IL8 A;  1TS4 A;  2B2U C;  3F2B A;  4DK3 C;  2PZU A;  1OO9 B;  3K0Y A;  5C4X B;  4GNX C;  1OXS C;  2QDL A;  4LF6 Q;  2BCO A;  1K83 H;  1VQ8 A;  3I90 A;  3HOY H;  3A5Z B;  4OO1 G;  2NVT H;  1Q90 A;  4BXX H;  4KN7 C;  3MXP A;  4LJZ C;  3U9O A;  1MD2 D;  1B1Z A;  2VB3 X;  1YHB A;  1Q1E A;  3ONA B;  2F0N A;  1TWA H;  4X65 L;  3LGJ A;  4EGV A;  4CDE C;  5LMN L;  3HEJ A;  1X9N A;  4G7O C;  2F0D A;  2I0Q A;  3NUC A;  1NR4 A;  1H95 A;  3D3R A;  3SK5 A;  2CFM A;  1UUP A;  3BYY B;  2JQO A;  3EQL C;  1Q12 A;  2E2I H;  5COR A;  5C4X G;  2HIV A;  2IPK D;  1KTK A;  4BBS B;  1ML0 D;  1R9T H;  1TWG H;  2ZXO A;  3DEP A;  4IFD I;  4C3H B;  4KKS A;  2J4X A;  2X69 A;  2ZJQ A;  1XNR L;  4K0K Q;  2E2D C;  1TS5 A;  5H1S E;  4C56 C;  4CKB A;  3M7G A;  3J81 j;  2AUK A;  1S40 A;  4JBW A;  4RGN A;  2AHO B;  2KCN A;  2V1C C;  4YIJ A;  4A3M G;  4BBR B;  1K8O A;  4JI3 L;  4R8I A;  4BBS G;  1Q8K A;  4PMB A;  5IP9 H;  1EYD A;  1AZQ A;  1ICW A;  1SJE D;  3IFD A;  1VQL A;  4A3B H;  1V1Q A;  3LX0 A;  1VDZ A;  4KJO A;  1CSP A;  1TR5 A;  2WAQ B;  4JI6 L;  2CW0 C;  2Z6K A;  2JN4 A;  3M4O B;  1DD2 A;  5EAY A;  1CKN A;  1KAA A;  4LF4 Q;  3HFZ B;  3KBX A;  4QQB X;  2E2H B;  3S1R H;  5EKK A;  5ELD A;  2K5W A;  4QB4 A;  1BKB A;  1CUK A;  1AEX A;  4JK1 C;  1HR0 Q;  2NVQ B;  5LL6 X;  1P8L A;  1EQQ A;  4DR1 L;  3AFQ A;  1V9P A;  2HD3 A;  3E3X A;  4NXM L;  2Z6K C;  5LMN Q;  4N8F A;  1AZP A;  1A15 A;  1HCZ A;  2E2J B;  2H4O A;  4LFC L;  4RA8 A;  1UNS A;  4A3C H;  1AE3 A;  1ZYR D;  4FVM A;  2WFW A;  5CC4 A;  3K5N A;  1IBM L;  1QZH A;  1X3G A;  1EOT A;  3CU7 A;  1FGU A;  1MSH A;  2KEE A;  1BCP D;  1I3Q B;  5IGE A;  2VQE L;  5AFW A;  5IOD A;  3DM3 A;  2LFN A;  4RGT A;  5A2Q E;  5AJ3 L;  4X64 L;  4CKC A;  2ZT9 C;  1QB5 D;  3NXW A;  4LAA A;  1FR3 A;  1WTW A;  2EDG A;  1K0S A;  1QCB D;  1SJH D;  1XNR Q;  4X66 L;  1LTG D;  1PYB A;  1PH1 A;  1VMP A;  3KBG A;  1NAP A;  2LXJ A;  3FKI B;  3TN2 A;  1JMC A;  3VR2 A;  1H9M A;  5C0X J;  5IE8 A;  4YWK A;  3I8Z A;  1IW7 C;  1E22 A;  1GOZ A;  1MJE A;  2KBN A;  1SYG A;  4DR2 L;  5DLQ E;  1EQT A;  4JI3 Q;  1JOQ A;  3MXG A;  5IYB G;  2LY7 A;  2N88 A;  1NUC A;  1SNC A;  1JJC B;  1BCP B;  1STH A;  1KAW A;  1YNJ D;  2R93 H;  1CK1 A;  5HGQ A;  3T53 B;  4EQP A;  1YBY A;  1PMR A;  1MGS A;  1OXT A;  1S3O A;  2PNR C;  4OIK A;  4JI4 L;  2A8V A;  4IN3 A;  1XMQ L;  5CV7 A;  3K5M A;  3FKI G;  4A3F B;  1IZ6 A;  3U50 C;  3G4S A;  1BXT A;  2E5L Q;  4J6H A;  2A19 A;  4RHR A;  5C4Z A;  2UUA Q;  5I9O A;  3L9A X;  4CDD C;  4R4O A;  3K7A H;  1Y1V H;  2FXQ A;  3KYH C;  1GUN A;  1NE3 A;  1STA A;  1TVX A;  2A69 D;  2PQA B;  2F0G A;  3CCR A;  4LFC Q;  5I9P A;  2L9H A;  2E75 C;  3ULP A;  2L0C A;  4Q0F A;  1I6V C;  4AYB B;  4NDX A;  2NZ1 D;  3PO3 G;  1EEI D;  4A3F G;  1SMX A;  3IFT A;  5KNB A;  2VQE Q;  4LFB Q;  1GKH A;  1B53 A;  1VMC A;  2VUM H;  3HOW B;  3S17 B;  1SN8 A;  1BVS A;  1D1I A;  2JA9 A;  3UE0 A;  2JA6 H;  3I4M H;  4PMC A;  1Q8I A;  2SDF A;  2AQ1 B;  3CXC A;  3I4N B;  5E1F A;  3KJO A;  4X62 Q;  4HN7 A;  1NSN S;  2A6E D;  1B2T A;  2LKV A;  1J5E L;  3FVQ A;  1LAC A;  4YCU A;  4LF8 Q;  3NTK A;  2VZA A;  2R3Z A;  1X55 A;  3BZC A;  5C3W A;  5A2Q L;  4AYB G;  2EY6 A;  1V1P A;  3WDN A;  3CP0 A;  1RDP D;  1RIP A;  4UHV A;  3CCU A;  1N36 L;  3HOW G;  4DNT B;  4R9W A;  2F0W A;  3PUV A;  3HS0 C;  1W6J A;  4JYA Q;  1PTO H;  1U4L A;  2KHJ A;  2RHQ B;  4H44 C;  4MTK A;  2KVM A;  2X6G A;  2EJF C;  1UEB A;  1HNX L;  4XYQ A;  4GKJ L;  4DR3 L;  1YZ6 A;  2B8G A;  1KXL A;  3S1N H;  5ELO A;  4QGU A;  1GD7 A;  4Y7N H;  2VQF L;  2R7Z H;  5M3F B;  1LYL A;  3R2T A;  2I07 B;  1I4H A;  2NTT A;  3QJY A;  4LFA L;  3H3V I;  1I94 Q;  5CV6 A;  4A93 H;  3K0X A;  2YV5 A;  2RHS B;  5JEA J;  3BVM A;  2LS0 1;  3G6E A;  4KHV A;  2R7D A;  1N33 Q;  2ZM6 Q;  3OIP A;  2EE1 A;  3GTQ B;  4ZCK A;  4BA2 I;  2Z9H A;  1F2M A;  2B63 H;  4LK1 C;  4PQX A;  4YY3 Q;  5K36 G;  3K81 C;  1B3A A;  5C3X A;  2M9V A;  1ZXT A;  1VQF A;  2PMZ B;  1WI5 A;  3C1F A;  1CTM A;  5FJ8 H;  2IT1 A;  3MZ5 A;  1VQK A;  5KYL A;  3S2D H;  4OWT B;  2FJ2 A;  4CJ0 B;  3D4R A;  3Q8D A;  2XWJ B;  2YU9 H;  3NP8 A;  1T5X D;  1ROD A;  5FO8 B;  3CCL A;  2Z0S A;  3CC4 A;  1DM0 B;  3I56 A;  3GTG H;  3KF8 A;  3ERQ A;  4TQU S;  4RGM A;  3KFU A;  3T56 B;  4EQN A;  3D8G A;  2JA5 H;  2R7F A;  4R4C A;  4JI8 Q;  3T4A C;  1N32 L;  4C3J H;  4UP9 A;  1EFI D;  4OON A;  2IX0 A;  3UDX A;  2F0K A;  4L5T A;  1JB7 A;  1QVF A;  4ZKC B;  4B3M Q;  2MQH A;  4B9W A;  2H1E A;  4ME5 A;  4BWG B;  4CBV A;  3HOV G;  1C7Y A;  4KY5 A;  2PZW A;  4HSV A;  4A3E B;  2JA8 H;  2R61 A;  4P72 A;  4DR7 L;  1IYU A;  4DV0 L;  4LFA Q;  3CMA A;  1HZB A;  1BNZ A;  1I6H B;  2QKI C;  1HUN A;  2O5I C;  4QUC A;  2JJQ A;  5KEE A;  1LLR D;  5DAU A;  4ZRZ A;  4RHS A;  1K3B C;  5T1I A;  1F2Z A;  2DNC A;  3C46 A;  3BS1 A;  3T1H Q;  2PCF B;  1QG7 A;  1CQV A;  1WCM H;  1D5M C;  3TP7 A;  1PHJ A;  4A3E G;  2HDM A;  2EOT A;  3HOX G;  2A68 C;  5JJK A;  2Q8T A;  1VF7 A;  2HIX A;  2RDF A;  1CZW A;  1TWF H;  1X6O A;  2F52 A;  3M3Y B;  2GN5 A;  4WOR A;  1HH2 P;  5GAH C;  4KN4 C;  4DUY L;  5M3M H;  3D31 A;  1PH6 A;  4KHP Q;  4OO1 H;  1Y1W G;  1U4P A;  1BQQ T;  2CWA A;  2WKC A;  3PGZ A;  2DNE A;  4X3S A;  3EIV A;  3PUY A;  2K5Q A;  1U4M A;  5J3B A;  4H13 C;  3PV0 A;  4IUP A;  2F0Q A;  1AP0 A;  1N32 Q;  4FF4 A;  2KCM A;  5I2Y A;  5IGB A;  1WVL A;  4JBJ A;  4K6L A;  3SHL A;  1G6Z A;  5C4X H;  2ICE C;  5IGG A;  2EY2 A;  3DWP A;  1JCK B;  2WB1 B;  5E4X A;  2RCF A;  3DHQ A;  1JC7 A;  4ME3 A;  1VQG A;  2CKZ B;  3TQY A;  4DR7 Q;  3SK6 A;  5KIX A;  1TWC B;  1EU4 A;  3HKZ G;  4JC0 A;  1T9H A;  2Q2I A;  2MUY A;  3STB C;  1JWS D;  3HP3 A;  3OMC A;  1ASY A;  5JJZ A;  4LNQ A;  4DV5 L;  1HHV A;  2ENB A;  1O78 A;  4JI5 L;  1VQH A;  4FXK C;  4C3I B;  2QEJ C;  4A3M H;  3X3M A;  1DOL A;  2HCC A;  2XWB B;  1XMO Q;  5I2X A;  2EQS A;  5M5Y B;  4DV1 Q;  1VQM A;  2WB1 G;  5CR3 A;  4IUN A;  5EJW A;  1EYA A;  4B3T L;  1ESF A;  3QO2 A;  5C0X G;  3QR8 A;  1H9K A;  4GZY C;  3K5L A;  3KUP A;  1W6K A;  2BH8 A;  2MHV A;  1KNA A;  2HQL A;  4MIU A;  4J15 A;  4DKA C;  1EWH A;  1K8G A;  4IZ8 A;  3M7N A;  2EY1 A;  2HQE A;  3JAM c;  4O1N A;  2SEB D;  4DV6 L;  2JA7 G;  1CKO A;  5FLM H;  3T1Y L;  1E1O A;  1L2F A;  2G5D A;  3QB3 A;  1PFN A;  2OXP A;  2RDG A;  5M5X H;  5E3F A;  1EY5 A;  4OEL B;  1JWU D;  2HUG A;  2K05 A;  4HIO A;  2QIL A;  1UE5 A;  3Q24 A;  4CHT B;  3RR5 A;  1EZ6 A;  4B3R L;  3T16 A;  1EZ8 A;  3HOZ B;  2KA7 A;  5GAD C;  1BR9 A;  4JPB W;  1E7Z A;  4UAI A;  3S16 H;  3U4Z A;  4F7X A;  5IYC G;  1RKN A;  3IRB A;  1K28 A;  3JAM E;  2XSC A;  3CC7 A;  4DV4 Q;  2F4V L;  3MA2 B;  1SFO B;  4RG1 A;  2F0E A;  5C3E G;  1F9P A;  3OTO L;  4JBM A;  1GUT A;  2CCZ A;  1W2B A;  1SYD A;  3SVM A;  1PH7 A;  3L2P A;  1QNK A;  2NVY H;  5IYB H;  2L12 A;  3UE1 A;  3GTL H;  3FDT A;  4JI1 Q;  1CA6 A;  2CVR A;  4LF6 L;  2K5H A;  5E4W C;  4B3S Q;  1KDB A;  3A74 A;  4B3T Q;  2FMC A;  4OGQ C;  1EOV A;  3AQQ A;  3WOE A;  2IX1 A;  5J39 A;  1G6P A;  2NVX B;  3M4P A;  2F03 A;  4U67 3;  2EYL A;  4XIG S;  1E3P A;  3STB D;  5C44 B;  4DN4 M;  3E6Z X;  1GUO A;  1MBY A;  3VA7 A;  5ELB A;  1VQC A;  1HXY D;  3O13 A;  1E2W A;  1LTR D;  4C2M B;  2RSO A;  1B8A A;  2GVB A;  3H0G G;  5COY A;  3T1Y Q;  2XVS A;  2F0U A;  3K59 A;  2BH2 A;  1WTQ A;  5JPN C;  3L0O A;  3M4Y A;  1EWI A;  5I6W A;  4K0K L;  1RHP A;  4LUZ A;  3PO3 H;  5ISR A;  4IUR A;  1PYW D;  1EIG A;  4PZ6 A;  4QL5 A;  5G3L D;  3GTJ B;  3D4D A;  2MP1 A;  1XJV A;  3F2D A;  1KNE A;  2B2U A;  4L5Q A;  4QF4 A;  3S2H H;  4DGZ A;  1OTC A;  3P7J A;  5EPJ A;  2G9D A;  2EXD A;  1RF2 D;  3RD4 A;  1G2T A;  1PZJ D;  3KLR A;  1B50 A;  2KEN A;  3JAM i;  4RKL A;  3I72 A;  3TRZ A;  3CME A;  1ZYR C;  3KF6 B;  3RZO B;  4DK1 A;  1GXD C;  3OTO Q;  4H02 A;  1YEZ A;  1BCP C;  4OX9 Q;  4OHJ A;  1QNU A;  4LF4 L;  1STE A;  1II3 A;  3HKZ E;  5EPK A;  3S15 B;  1PH4 A;  3KK7 A;  3CCV A;  1TS2 A;  2AWO A;  4J8Q A;  1D8L A;  3A7L A;  1HQM C;  1R4P B;  2A74 C;  4KY6 A;  5BR8 L;  1ESR A;  3JAM L;  2PQA A;  3KOJ A;  5ELN A;  2N8N A;  4YHH L;  1HR0 L;  2F0M A;  3UI2 A;  3N52 A;  3KLS A;  4RMF A;  2IJ0 A;  3FPU B;  3RZD B;  2N55 A;  1XX8 A;  4KLK A;  2PYK A;  3S1M B;  3H3V C;  5ELC A;  2F4I A;  1SRO A;  1Q46 A;  3NHH A;  5E7N A;  1AE2 A;  5GQO A;  2Z8L A;  1TQO A;  4DV2 Q;  2ICI A;  4KMU C;  1MIU A;  1FNV A;  3L7Z C;  1JB3 A;  1YNJ C;  2RVL A;  2CQA A;  4BY7 B;  3C2P A;  1CHQ D;  2OQ0 A;  1Q1B A;  5TSS A;  4KD4 A;  2P5Z X;  4DV3 L;  1XYI A;  5EPL A;  1ONL A;  1Y8O B;  2K5N A;  5J1Z A;  1HTP A;  1SR3 A;  2EYO A;  1SRU A;  1XPU A;  4WRD A;  1I50 B;  5DM7 3;  2JEA I;  4L6T B;  4B08 A;  5ELE A;  3K7U C;  3PO2 B;  2A69 C;  5M9O A;  4C3H G;  3S14 H;  5T1G A;  5C6A A;  4IOA A;  2F0S A;  1ICF B;  1CI3 M;  2D0O A;  4A3D B;  5IWA Q;  3PUW A;  5CV9 A;  1JOO A;  1JJG A;  3GD7 A;  3H6M A;  2B2V C;  1YI2 A;  4OO1 I;  2KEC A;  2E5L L;  2VXW A;  4PZ7 A;  1NNX A;  3EVQ A;  4OXP A;  2Y0S E;  3T51 B;  4HIK A;  5BR8 Q;  1ET6 A;  1CT1 D;  1A6X A;  2EYP A;  4BBR G;  2A6E C;  4YHH Q;  2UUA L;  3CPW A;  3VYR A;  3E9H A;  3AYH B;  4XQN A;  2RA4 A;  3HOU B;  3QWN A;  2BDN A;  2Q2T A;  2K7V A;  3BDO A;  5IP7 G;  1S72 A;  3HOV H;  3NEM A;  2OTL A;  1K73 C;  4AIM A;  2VB2 X;  4A3G H;  2WAQ G;  2AQ2 B;  4CGY B;  3IAY A;  4X3U A;  4A4I A;  4LFB L;  4K5V A;  1GJX A;  3BVZ A;  3CAM A;  2DGY A;  3AMU A;  4AH6 A;  1ENF A;  1VQO A;  3GTM B;  3TS2 A;  2JP1 A;  3CQZ B;  4DV3 Q;  3RLN A;  4M8A A;  1L0Y B;  2O5J C;  4X62 L;  3MXU A;  3HOU G;  1SAP A;  1TWH H;  2WII B;  1BBX C;  1RCV D;  1DXM A;  2AQ3 B;  3NQI A;  4A3I B;  1HZA A;  5EGT A;  4LF8 L;  3ER0 A;  1I4G A;  1LT4 D;  1EL0 A;  2HHH L;  3HOX H;  3CCJ A;  3FPP A;  4X6A H;  2KUM A;  3BDL A;  3GTK B;  5LL6 S;  2UUC Q;  1SNM A;  1PLF A;  4DR5 Q;  3S1Q B;  1PZK D;  2FMM A;  4LWC A;  2C5C A;  1IL8 A;  3PUX A;  5JJI A;  4ZKB B;  1N34 L;  2R92 H;  4JYA L;  1Y1W H;  1G91 A;  3MHB A;  4CDF C;  3AU7 A;  1B3Q A;  1SLJ A;  3BVG A;  2RSN A;  4BY1 B;  4M1U B;  3GTO B;  4JG2 A;  3CC2 A;  1GO3 E;  3UDF A;  2PZT A;  3AEV A;  3CCE A;  5KYI A;  4RAU C;  1IHZ A;  4IUU A;  1BUV T;  2AMC B;  4KK7 A;  2L11 A;  4DAM A;  1I94 L;  4K8J A;  4K14 A;  3TP5 A;  1S5F D;  4FXD A;  2QGQ A;  1Y69 U;  1KC8 C;  2EJM A;  4A3K H;  4J1M A;  3MFG A;  4K5X A;  1N33 L;  1MJC A;  2ZM6 L;  1YHA A;  2B8F A;  4L8J A;  1FJG Q;  4BY1 G;  4YY3 L;  3FMC A;  1DZ1 A;  1G29 1;  5K5P A;  2WV6 D;  1KDC A;  2EXZ A;  2F0O A;  3G48 A;  3OPO A;  1XTC D;  1ZKO A;  2OT2 A;  1HZC A;  2MO1 A;  4ZK9 B;  4DPG A;  1HNZ L;  1SNP A;  3ZJY C;  1D1K A;  1SYF A;  1QZG A;  2FIN B;  4HR7 B;  1H9J A;  3CHB D;  2BE5 C;  2HHH Q;  1O7L A;  4RKB A;  3QG1 A;  1K83 B;  4GS3 A;  5C0X H;  3HOY B;  3PIP 3;  2NVT B;  1FNW A;  4KV6 A;  2B3G A;  3P20 A;  4JI8 L;  3F8T A;  1N34 Q;  3I4N G;  4ULL A;  1TWA B;  4JVZ A;  1ENC A;  2F0V A;  1HRJ A;  1WTH A;  1VQD A;  3NTI A;  1VQ5 A;  1VQ7 A;  4WJ4 A;  2F0H A;  4ZUJ A;  4B3M L;  1A63 A;  4UDU C;  3A54 A;  4G7H C;  2JA7 H;  1BOS A;  2JXM B;  2NYZ D;  2E2I B;  2K33 A;  1S5D D;  2ASB A;  2KJX A;  2K52 A;  1R9T B;  1TWG B;  2IL8 A;  3A7A B;  1AFP A;  3SGI A;  5DM6 3;  1NMF A;  3DWQ A;  4BXX G;  1C4Q A;  2E76 C;  1YNN C;  4I7Z C;  4RH6 A;  3A55 A;  3HRZ C;  4HMJ A;  4HIM A;  3W2D A;  1KL9 A;  1PH9 A;  3T1H L;  5BN5 A;  2HT1 A;  1PFS A;  5EKL A;  1LT5 D;  2Z4H A;  5IYC H;  2ZXP A;  3NWS A;  5L37 A;  5M3F G;  3LWE A;  4AQY Q;  1PRT D;  5C3E H;  3MAQ A;  3VR5 A;  1JQY D;  2QDB A;  2WAQ E;  1HNZ Q;  1SND A;  1I4R A;  1GUW A;  4N8X 1;  4A3B B;  2K1B A;  5I6Y A;  4JI0 L;  1KD1 C;  4KHP L;  1BCP F;  3S1R B;  2KCT A;  1HTL D;  5IT9 c;  1I5F A;  3NE5 B;  1QOH A;  2K6A A;  2EVB A;  5DNF A;  1STG A;  1S5B D;  2B2W A;  3V96 A;  4P2C B;  4NXN Q;  1JT8 A;  1XPO A;  4K8I A;  1EQV A;  4GOP A;  1WTX A;  1S5C D;  4WFN 3;  1O7Z A;  1PRT B;  2ZTC A;  3D4W A;  1E0B A;  4XYO A;  2NBF A;  3E0E A;  2F3I A;  3JC6 6;  3K8A A;  2Q8I B;  4MTN A;  2RBM A;  3H0G H;  4P75 A;  4C1N K;  3G6J B;  1DCZ A;  2B2W C;  1STY A;  4O42 A;  2BE5 D;  2FFK B;  5EKI A;  4GOP C;  1GM5 A;  3GTP H;  1Q86 C;  1G51 A;  5IT9 E;  1FL0 A;  4LUV A;  5C4H A;  1PXU A;  1EIH A;  1EY8 A;  4TSS A;  2YTX A;  3UDG A;  1STB A;  4A3J H;  5M5W H;  4UP8 A;  1YJW A;  2IWH A;  1XMO L;  5JEA H;  1DYQ A;  4DV1 L;  1Q7Y C;  3V05 A;  1HNW Q;  4R4T A;  2YTY A;  1SSO A;  2PO4 A;  4K2K A;  3VA5 A;  4DU9 A;  4CKE A;  1SYE A;  1B9N A;  2R93 B;  2RCN A;  5GAE C;  2I5H A;  3TEH B;  4DR6 Q;  1QUQ A;  4CJ2 C;  2PNH A;  1M1K C;  4JI0 Q;  1VQ4 A;  4QY7 A;  3NQT A;  1YNN D;  3CKI B;  3KJP A;  1E1T A;  1I4X A;  2EZV A;  1BBW A;  2RF4 A;  1UE6 A;  2NUC A;  4DAV A;  1JE4 A;  1PZI D;  3D0F A;  4MZ9 A;  4LF9 L;  1CFM A;  1KLU D;  2UXC Q;  3K7A B;  3WWV A;  1Y1V B;  5IGD A;  2UUB Q;  4LMQ D;  3U9S A;  4AYB E;  2JSO A;  4DR4 Q;  4ZUI A;  2K03 A;  2R93 G;  1SE8 A;  3ERS X;  2QA4 A;  3CW2 C;  1LM0 A;  4LUO A;  5C5L A;  3S15 H;  5D3D A;  3FEW X;  1PDQ A;  4K2L A;  1T5E A;  1HJP A;  4DAP A;  1WTP A;  2E8G A;  1IYV A;  3I55 A;  1CQF A;  3KF6 A;  3EJI A;  3MXN A;  3RN5 A;  4PZ8 A;  2VUM B;  3OMG A;  1PTO D;  1XNQ Q;  5C4J B;  2JA6 B;  2CH4 W;  1PH5 A;  3I4M B;  3S1M H;  4NMZ A;  1EWC A;  4U68 A;  4DV7 Q;  1L0W A;  4DV4 L;  3CCM A;  1SNQ A;  1LUZ A;  4UP7 A;  4A76 A;  3PUZ A;  4IUQ A;  2WP8 J;  3A8I E;  1BDO A;  1SE4 A;  2OWO A;  4R4I A;  1KDA A;  4BBS H;  4JI1 L;  5CV4 A;  3SK4 A;  5IT9 L;  1D6E C;  4C3H H;  4B3S L;  3M85 A;  4K5W A;  1K8M A;  2LSS A;  2AUJ D;  1YVC A;  3C1E A;  5CV8 A;  1PH3 A;  2JA6 G;  2D5D A;  1PTO B;  2KOL A;  4BA1 I;  4FF1 A;  2K28 A;  4C3I G;  2MPM A;  1U0L A;  4BBR H;  2F0P A;  4DFA A;  3TP6 A;  4PG3 A;  3S1N B;  4Y7N B;  3W3A A;  3E5S A;  5LHY 1;  2L1B A;  2R7Z B;  2PW7 A;  4XXE A;  1QE6 A;  4LF9 Q;  1CA5 A;  3H09 A;  4HMI A;  2EY5 A;  5IP7 H;  3CRK C;  1JIC A;  2UXB Q;  3K80 C;  3KDF A;  4A93 B;  1C0A A;  2K5V A;  2XGT A;  2NN6 G;  4TVA B;  1OXU A;  1RJT A;  4Q5V A;  3M4O H;  1XXG A;  3S24 A;  2E2H H;  3D6C A;  5IYD G;  4RCN A;  1OXV A;  2CHB D;  2PMZ E;  3VYT A;  2K01 A;  4GOP B;  4POG A;  2B63 B;  2NVQ H;  4LW1 A;  1Y14 B;  4JV5 Q;  3TDQ A;  2LXK A;  1SE3 A;  3LNN A;  2F3W A;  5IY0 A;  1C9O A;  4GLA C;  4DXG A;  4BS9 A;  1D7Q A;  3S2D B;  1UE1 A;  2E2J H;  1ET9 A;  2YU9 B;  3OWE B;  5KND A;  1D5X C;  1GUS A;  2TSS A;  3I7F A;  1VQA A;  2WKD A;  2JE6 I;  1VQI A;  4OX9 L;  4DF7 A;  1I3Q H;  3MC0 B;  4Z9C B;  2VS1 A;  2F0L A;  1J6Q A;  2A73 B;  3DLL A;  2OEO A;  3GTG B;  2ES2 A;  3R2I A;  1QWY A;  1YJN A;  4GN4 B;  3HOZ G;  5HGT A;  3J80 c;  2JA5 B;  1TY2 A;  1LO5 D;  4RWS C;  5C0X I;  5CBA E;  3GDE A;  4IPD A;  5FJ8 G;  1X3P A;  2KED A;  3FKI H;  2A6H D;  4C3J B;  1IYJ B;  3HG9 A;  1NY4 A;  2NWG A;  3F2C A;  1M8A A;  5FLX c;  1S4Z A;  2EIF A;  3F1Z A;  2N78 A;  2EJG C;  2QW7 A;  4HJ5 A;  3VR4 A;  4DV2 L;  1U9R A;  1QUQ B;  3ERO A;  3J81 c;  2VW9 A;  1HR0 W;  1Y8P B;  3J7A 5;  4B9X A;  2JA8 B;  4HTH A;  3LWU A;  3CF5 A;  5LMN W;  4HJ8 A;  2JK8 A;  1B70 B;  1CSQ A;  3ICE A;  2HDL A;  3I73 A;  3NBH B;  1V8Q A;  3J80 E;  4A3F H;  4C3J G;  1D5Z C;  1RTN A;  3F2U A;  5BN3 A;  2PPB C;  5C44 G;  3E9I A;  1Q82 C;  5CYU A;  1GUG A;  5ELF A;  1IKL A;  4IAL A;  2ZTE A;  4R1J A;  5FLX E;  1G2S A;  4PMW A;  1WCM B;  2NZO A;  1MKH A;  2JA8 G;  4IFD G;  3BYT B;  4CJ1 B;  3CD6 A;  1KAB A;  3J81 E;  4F87 A;  2UXD Q;  3MXN B;  1TWF B;  4JI2 L;  1SYC A;  5IWA L;  2Q2U A;  3W5O A;  5FOB B;  1MI2 A;  1KRT A;  3PIP A;  1L1O B;  1HQR D;  5M3M B;  1X3F A;  1TU2 B;  4IPH A;  4R4Q A;  3ULL A;  1C48 A;  3S17 H;  3HOW H;  3OIQ A;  4DAY B;  3TSS A;  4JI7 L;  1W3S A;  5CBE E;  1HUM A;  2I5M X;  3I4N H;  4GKK Q;  3RNU A;  4HJA A;  1C8C A;  4FYD A;  1PH2 A;  3QOJ A;  3BJU A;  4ID6 A;  2BDO A;  3NPP A;  4Y52 H;  4MNO A;  1DON A;  1QIL A;  1X3E A;  2VY3 A;  5FKA C;  2CH4 A;  2WB1 E;  1V1O A;  1EY6 A;  1EY4 A;  5C5M A;  3EN2 A;  1WTR A;  1CM9 A;  5M3M G;  1Z47 A;  2IX3 A;  5LMU Q;  2ATW A;  3NK9 A;  3IKJ A;  3Q0A A;  2O2L D;  3TP8 A;  2HCI A;  1BF4 A;  2LMC B;  2MGS A;  3J80 i;  3NSW A;  4JW0 A;  3GO5 A;  1IL2 A;  1LAB A;  4N9P A;  4I65 A;  4FF3 A;  2A5H A;  5K36 H;  1IKM A;  5EQ0 A;  1PA6 A;  3I2Z A;  4KD3 A;  2QEX A;  4A3M B;  2SOB A;  3SXH A;  1WJJ A;  1LV9 A;  3KDF B;  5M3F H;  3SE0 A;  1X32 A;  2R6G A;  2ZXR A;  5D14 A;  2B2V A;  3A8J E;  3J80 L;  3BZK A;  1F2L A;  1NCV A;  2UUC L;  4DR5 L;  3DUZ A;  2M00 A;  3J81 i;  2XIW A;  1AN8 A;  2OQK A;  4BY7 G;  1BBU A;  4A75 A;  1U4R A;  3EFX D;  2A1A A;  4JI2 Q;  5JJL A;  1B44 D;  4A3L G;  1RD9 D;  5FLX L;  3GTQ H;  2F0F A;  1I4P A;  4ZYS A;  2G9H D;  2I5L X;  4G4K A;  2J7Z A;  4MN3 A;  1XPR A;  3URY A;  1EFW A;  1A3T A;  3J81 L;  3U58 A;  4JI7 Q; 
#chains in the Genus database with same CATH homology
 1KHI A;  1HH2 P;  2B3G A;  4JI8 L;  5GAH C;  3F8T A;  1N34 Q;  4GN5 A;  3TS0 A;  1Q81 C;  3GTK H;  4DUY L;  5M3M H;  3I4N G;  3D31 A;  1PH6 A;  4KHP Q;  5LMU L;  2MFI A;  1Y1W G;  4WJ3 M;  3PO2 G;  3S1Q H;  1RL2 A;  2CWA A;  3PGZ A;  2H5X A;  1VQD A;  4JOI A;  1VQ5 A;  1CKM A;  1VQ7 A;  4WJ4 A;  3EIV A;  3PUY A;  5J3B A;  4B3M L;  1A63 A;  2NN6 I;  2JA5 G;  2JA7 H;  3PV0 A;  4A3D G;  1N32 Q;  2IHE A;  2ASB A;  3FHW A;  1TXY A;  2KCM A;  4L5R C;  1FJG L;  1NMG A;  3W1G A;  4BY1 H;  2K52 A;  3CCQ A;  4DUZ L;  3GTO H;  4JBJ A;  3SGI A;  3PSI A;  1VQJ A;  1NMF A;  4YCW A;  4BXX G;  2PI2 A;  4JOI C;  4OWX B;  5C4X H;  3M9B A;  4DV6 Q;  1A62 A;  1EUJ A;  4X65 Q;  1P16 A;  2BA1 A;  3H3V H;  5GAG C;  2MNA A;  5FLM G;  2ZJR A;  4ME3 A;  4UPA A;  4HIM A;  1VQG A;  2CKZ B;  3TQY A;  1K0R A;  1KL9 A;  4DR7 Q;  1PH9 A;  3T1H L;  3J7Z C;  2C35 B;  4L5S A;  2HT1 A;  1PFS A;  1WFQ A;  3KLW A;  2AWN A;  3HKZ G;  1T9H A;  2Q2I A;  4JC0 A;  5IYC H;  3STB C;  1ASZ A;  1ASY A;  4POF A;  3UDI A;  5M3F G;  4APV A;  4A3E H;  4LNQ A;  4DV5 L;  4AQY Q;  4IPG A;  2YTV A;  5C3E H;  1VQB A;  1N9W A;  3ICE A;  4JI5 L;  1VQH A;  2CQO A;  2WAQ E;  1HNZ Q;  4B3R Q;  4A3M H;  2K75 A;  1K3R A;  1I6H H;  4A3J G;  1XMO Q;  4GNX A;  2EQS A;  5JEA G;  1LTL A;  2D0P A;  2ZTD A;  4DV1 Q;  1VQM A;  2WB1 G;  1KD1 C;  1WCM G;  4JI0 L;  3CCS A;  4KHP L;  2F4V Q;  2KCT A;  4B3T L;  3B6Y A;  5IT9 c;  1I5F A;  3F2B A;  4A3I G;  5C0X G;  4YWM A;  4DK3 C;  3VDY A;  3RN2 A;  4NXN Q;  1A8V A;  4UY8 C;  4GNX C;  1OXS C;  4LF6 Q;  1JT8 A;  2BH8 A;  1XPO A;  1K83 H;  4GOP A;  1VQ8 A;  1KIX A;  3HOY H;  2HQL A;  3A5Z B;  4OO1 G;  4J15 A;  2ZTC A;  4DKA C;  1VQP A;  3M3Y H;  2NVT H;  1QVG A;  1K8G A;  4BXX H;  3E0E A;  2NZH A;  2F3I A;  3M7N A;  3JC6 6;  3K8A A;  4GNX B;  4MTN A;  3JAM c;  4YCV A;  4JI6 Q;  1YHB A;  3H0G H;  1Q1E A;  4DV6 L;  4P75 A;  1A0I A;  1TWA H;  4X65 L;  1V43 A;  1CKO A;  3LGJ A;  4O0A A;  5FLM H;  1E1O A;  3T1Y L;  2JA7 G;  1L2F A;  5LMN L;  1X9N A;  2OTJ A;  2I0Q A;  4DUZ Q;  1IXR A;  1H95 A;  4GOP C;  4O2D A;  2CFM A;  1GM5 A;  3GTP H;  1Q86 C;  1G51 A;  2JQO A;  1M90 C;  2CWP A;  1Q12 A;  1FL0 A;  5M5X H;  4LUV A;  2E2I H;  5C4X G;  2HIV A;  4DR1 Q;  1PYS B;  4HIO A;  4AQY L;  4EQ5 A;  4NXM Q;  1UE5 A;  1TWG H;  1R9T H;  4IFD I;  3RR5 A;  2YTX A;  3UDG A;  4B3R L;  5GAD C;  2GVA A;  4A3J H;  5M5W H;  2ZJQ A;  1XNR L;  3CPF A;  4UP8 A;  1E7Z A;  1YJW A;  1IBM Q;  1E24 A;  1XMO L;  1VQN A;  3S16 H;  3U4Z A;  5H1S E;  1XTD A;  3OYY A;  5IYC G;  4GN3 B;  4DV1 L;  3IRB A;  1Q7Y C;  3CC7 A;  1VQE A;  3J81 j;  4DV4 Q;  4R4T A;  2F4V L;  2YTY A;  1HNW Q;  4RG1 A;  5C3E G;  1S40 A;  3FP9 A;  4JBW A;  5AJ3 Q;  4X64 Q;  1TWC H;  3OTO L;  5C4J H;  4JBM A;  4OWW B;  2CCZ A;  2AHO B;  2V1C C;  4A3M G;  1W2B A;  2RCN A;  2Q2H A;  2I5H A;  3TEH B;  5GAE C;  4X66 Q;  1PH7 A;  4DR6 Q;  3L2P A;  1QUQ A;  2NVY H;  4JI3 L;  5IYB H;  3UE1 A;  3GTL H;  2PNH A;  4NXN L;  4JI1 Q;  4BBS G;  1Q8K A;  3HKS A;  1M1K C;  4JI0 Q;  4LF6 L;  1VQ4 A;  2K5H A;  4QY7 A;  4C3I H;  5IP9 H;  4B3S Q;  3A74 A;  3KJP A;  1E1T A;  4B3T Q;  1AH9 A;  1BBW A;  2RF4 A;  4A3B H;  1UE6 A;  1VQL A;  1V1Q A;  1EOV A;  1CSP A;  2YYZ A;  3AQQ A;  5M5Y H;  4DR2 Q;  4JI6 L;  2IX1 A;  1G6P A;  2Z6K A;  3M4P A;  3D0F A;  4MZ9 A;  5EAY A;  1CKN A;  4XIG S;  2K4K A;  3HFZ B;  4LF4 Q;  4LF9 L;  1E3P A;  2K50 A;  3S1R H;  4QQB X;  2UXC Q;  3STB D;  3WWV A;  2UUB Q;  1BKB A;  4AYB E;  1X54 A;  4DR4 Q;  3HOY G;  1CUK A;  1VQC A;  2R93 G;  1SE8 A;  3ERS X;  2QA4 A;  4JI4 Q;  3CW2 C;  1LM0 A;  4LUO A;  1HR0 Q;  1X56 A;  1IBL L;  3S15 H;  5IYD H;  1XMQ Q;  1P8L A;  1B8A A;  2GVB A;  1EQQ A;  4DR1 L;  3AFQ A;  1V9P A;  4IFD J;  1HJP A;  3H0G G;  4NXM L;  2VNU D;  2E8G A;  1IBK L;  1QVC A;  4YWL A;  3T1Y Q;  2Z6K C;  3I55 A;  5LMN Q;  4IOC A;  4LF7 L;  1YNX A;  3KF6 A;  2BH2 A;  4JV5 L;  4K0K Q;  3S1N H;  4LFC L;  3L0O A;  3RN5 A;  4PZ8 A;  1EWI A;  1AE3 A;  4A3C H;  4K0K L;  2WFW A;  1IBM L;  4LUZ A;  1QZH A;  1X3G A;  1XNQ Q;  3PO3 H;  1FGU A;  1PH5 A;  1CKN B;  4NPS A;  4PZ6 A;  3S1M H;  3BU2 A;  4QL5 A;  2VQE L;  4DV7 Q;  1L0W A;  4DV4 L;  1XJV A;  1HNW L;  3F2D A;  3DM3 A;  3CCM A;  1LUZ A;  4UP7 A;  4L5Q A;  5AJ3 L;  4X64 L;  3S2H H;  4A76 A;  1OTC A;  3PUZ A;  4P73 A;  2WP8 J;  1XNR Q;  1DGS A;  2EXD A;  4X66 L;  5HY6 A;  1PYB A;  4R4I A;  1PH1 A;  2OWO A;  4DR6 L;  4BBS H;  4JI1 L;  1VQ6 A;  2LXJ A;  2KEN A;  3JAM i;  1JMC A;  4C3H H;  1EIY B;  4B3S L;  3TRZ A;  3CME A;  3KF6 B;  3M85 A;  5C0X J;  3HOZ H;  5IE8 A;  4YWK A;  3RLO A;  1NJI C;  2LSS A;  1YJ9 A;  2KHI A;  2N3S A;  1YIT A;  1E22 A;  2D62 A;  1YVC A;  3OTO Q;  1MJE A;  4H02 A;  2KBN A;  1YEZ A;  3MEF A;  1PV4 A;  1N8R C;  1PH3 A;  2JA6 G;  4OX9 Q;  4DR2 L;  5DLQ E;  4JI3 Q;  4LF4 L;  4BA1 I;  3HKZ E;  5IYB G;  1SFO H;  1PH4 A;  2UXC L;  1VS0 A;  3CCV A;  1JJC B;  2N49 A;  2UUB L;  2AWO A;  5IP9 G;  1D8L A;  1KAW A;  1J5E Q;  5BR8 L;  1EYG A;  3PF5 A;  4DR4 L;  2R93 H;  1U0L A;  5HGQ A;  2PQA A;  3KOJ A;  1YBY A;  4BBR H;  1OXT A;  1S3O A;  4PG3 A;  5ELN A;  2N8N A;  1YIJ A;  4JI4 L;  4A3B G;  4YHH L;  3G71 A;  2A8V A;  1HR0 L;  1XMQ L;  1FVI A;  4RMF A;  3FKI G;  4NB3 A;  1IZ6 A;  3U50 C;  4LF9 Q;  2ID0 A;  4KLK A;  5IP7 H;  3G4S A;  1N36 Q;  2UXB Q;  2E5L Q;  3K80 C;  2B29 A;  1SRO A;  3KDF A;  1Q46 A;  1C0A A;  1PH8 A;  2K5V A;  2XGT A;  2NN6 G;  4TVA B;  1OXU A;  1AE2 A;  2A19 A;  5E7N A;  4GLX A;  5GQO A;  2NVX H;  1XNQ L;  3M4O H;  4DV2 Q;  2UUA Q;  1MIU A;  3S24 A;  1IBL Q;  2E2H H;  3L7Z C;  5IYD G;  5C44 H;  4R4O A;  1KQS A;  1OXV A;  3K7A H;  2PMZ E;  1Y1V H;  2FXQ A;  3KYH C;  4DV7 L;  4HID A;  1IBK Q;  1NE3 A;  4GOP B;  1HNX Q;  4POG A;  4LF7 Q;  2OQ0 A;  1Q1B A;  4DR3 Q;  4GKJ Q;  2IY5 B;  1Z9F A;  2PQA B;  3CCR A;  4LFC Q;  4DV3 L;  4IJH A;  4LW1 A;  1Y14 B;  4P74 A;  4C2M H;  3ULP A;  2LXK A;  2VQF Q;  2NVQ H;  4A3C G;  4JV5 Q;  5IY0 A;  4QIW E;  1C9O A;  4GLA C;  3PO3 G;  4A3F G;  1SMX A;  4A3G G;  2K5N A;  1D7Q A;  1UE1 A;  1SR3 A;  2VL6 A;  2VQE Q;  2E2J H;  4LFB Q;  1GKH A;  1SRU A;  1XPU A;  2VUM H;  2DUD A;  1O7I A;  3U4V A;  4DNI A;  4GLV B;  1SN8 A;  1BVS A;  1K8A C;  2JA9 A;  3UE0 A;  4P71 A;  2JEA I;  3I7F A;  2JA6 H;  1VQA A;  3I4M H;  2XTI A;  1VQI A;  2JE6 I;  3K7U C;  4OX9 L;  1I3Q H;  3CXC A;  3GTJ H;  4KI0 A;  2VS1 A;  4X62 Q;  3KJO A;  1J6Q A;  3DLL A;  2ES2 A;  3I4O A;  1YJN A;  4GN4 B;  3S14 H;  1J5E L;  4IOA A;  3HOZ G;  4YCU A;  3J80 c;  4LF8 Q;  2VZA A;  1X55 A;  2D0O A;  3BZC A;  5IWA Q;  5C0X I;  3GDE A;  4IPD A;  4AYB G;  5FJ8 G;  3PUW A;  2IHF A;  3FKI H;  1IYJ B;  1JJG A;  4IJL A;  3CP0 A;  1NY4 A;  3RZO H;  3GD7 A;  5FLX c;  3F2C A;  1RIP A;  3CCU A;  1YI2 A;  1N36 L;  3HOW G;  2E5L L;  4OO1 I;  2UXB L;  2EIF A;  3F1Z A;  4PZ7 A;  4OXP A;  2Y0S E;  2N78 A;  4HIK A;  5BR8 Q;  4HJ5 A;  3A5U A;  3PUV A;  3NEL A;  4BBR G;  4JYA Q;  4QJF A;  4DV2 L;  2R92 G;  4YHH Q;  2UUA L;  1QUQ B;  3CPW A;  2RHQ B;  2KHJ A;  3J81 c;  2VW9 A;  1HR0 W;  3E9H A;  3AYH B;  3J7A 5;  1X65 A;  3RLF A;  2Q2T A;  1UEB A;  1HNX L;  2L15 A;  3CF5 A;  5IP7 G;  4GKJ L;  4DR3 L;  1YZ6 A;  1KXL A;  1S72 A;  3TRE A;  5LMN W;  2MO0 A;  4HJ8 A;  5ELO A;  2JK8 A;  1B70 B;  1GD7 A;  1KRS A;  3NEM A;  4QGU A;  1CSQ A;  4Y7N H;  2VQF L;  2OTL A;  2ALY B;  2BA0 A;  3NBH B;  1K73 C;  1LYL A;  4AIM A;  2R7Z H;  4A3G H;  2WAQ G;  4A3F H;  3RZD H;  1JE5 A;  2UU9 L;  1L1O A;  4A4I A;  4LFA L;  3H3V I;  5C44 G;  4LFB L;  4ALP A;  1I94 Q;  3E9I A;  1Q82 C;  1Y1V G;  3K0X A;  4A93 H;  3CAM A;  2YV5 A;  2DGY A;  4AH6 A;  1VQO A;  2ZTE A;  2RHS B;  3NEN A;  4R1J A;  5JEA J;  2OCE A;  3G6E A;  3TS2 A;  4DV3 Q;  4A3K G;  1VCI A;  2R7D A;  3RLN A;  1N33 Q;  4PMW A;  2NZO A;  2ZM6 Q;  4X62 L;  3HOU G;  1MKH A;  1TWH H;  2JA8 G;  4BA2 I;  4IFD G;  2B63 H;  4BY7 H;  4DV0 Q;  4YY3 Q;  3CD6 A;  5K36 G;  1EIF A;  3K81 C;  1L1O C;  4LF5 L;  2UXD Q;  3MXN B;  3PF4 A;  1HZA A;  4LF8 L;  4JI2 L;  1VQF A;  4A3L H;  3ER0 A;  2VUM G;  4DK6 C;  5IWA L;  1WI5 A;  5FJ8 H;  3W5O A;  1VQK A;  2IT1 A;  1B7Y B;  2ZJP A;  2HHH L;  2Q2U A;  1KRT A;  3PIP A;  3I4M G;  3S2D H;  4OWT B;  3HOX H;  1L1O B;  3CCJ A;  4X6A H;  1X3F A;  4IPH A;  1HZ9 A;  4R4Q A;  3ULL A;  3Q8D A;  2UUC Q;  4DR5 Q;  2YU9 H;  3HOV H;  1I50 H;  3HOW H;  3S17 H;  1K9M C;  4DAY B;  4LWC A;  3PUX A;  4JCV E;  4JI7 L;  5JJI A;  1W3S A;  1N34 L;  2R92 H;  2I5M X;  3CCL A;  3I4N H;  4GKK Q;  3RNU A;  4JYA L;  2Z0S A;  4HJA A;  3CC4 A;  3I56 A;  1Y1W H;  3GTG H;  3PO2 H;  4TQU S;  1PH2 A;  3BJU A;  3H15 A;  3KFU A;  1JJ2 A;  4Y52 H;  1SLJ A;  4MNO A;  1X3E A;  2VY3 A;  4JG2 A;  2JA5 H;  2WB1 E;  4A3D H;  2R7F A;  3CC2 A;  1GO3 E;  4R4C A;  3UDF A;  3EN2 A;  3AEV A;  4JI8 Q;  1N32 L;  4C3J H;  3CCE A;  4UP9 A;  4DUY Q;  1YHQ A;  2AKW B;  5M3M G;  1Z47 A;  1GVP A;  2IX0 A;  4OON A;  3UDX A;  2AMC B;  5LMU Q;  1UE7 A;  2ATW A;  4DAM A;  1I94 L;  4L5T A;  4HJ9 A;  1JB7 A;  3ULJ A;  1QVF A;  4B3M Q;  2MQH A;  2QGQ A;  4XTC S;  1KC8 C;  4A3K H;  4HJ7 A;  1U5K A;  3HOV G;  2JEB I;  1N33 L;  1OXX K;  1MJC A;  2K14 A;  3J80 i;  1C7Y A;  3GO5 A;  3KF8 B;  1IL2 A;  2ZM6 L;  2R7Z G;  3AFP A;  3HOU H;  1YHA A;  2JA8 H;  2PI2 E;  1FJG Q;  2UU9 Q;  4P72 A;  4DR7 L;  4BY1 G;  4DV0 L;  4YY3 L;  4LFA Q;  3CMA A;  1HZB A;  1PA6 A;  1G29 1;  3I2Z A;  2QEX A;  2UXD L;  4A93 G;  1WJJ A;  4FDB A;  3KDF B;  1VQ9 A;  5M3F H;  5GRO A;  3EBE A;  1WYD A;  1WOC A;  1NBW A;  2JJQ A;  3G48 A;  3PCO B;  2R6G A;  1HZC A;  2MO1 A;  4DPG A;  3BZK A;  1HNZ L;  2UUC L;  4JBK A;  3ZJY C;  4DR5 L;  4IO9 A;  3J81 i;  3T1H Q;  1EQR A;  2OQK A;  2B63 G;  4BY7 G;  1BBU A;  3GTM H;  3PIO A;  4A75 A;  4LF5 Q;  3CQZ H;  1QZG A;  2A1A A;  4JI2 Q;  5JJL A;  1WCM H;  4EX5 A;  3A0J A;  4A3L G;  4GKK L;  3OW2 A;  2Y0S G;  4DV5 Q;  1PHJ A;  3GTQ H;  4A3E G;  2HHH Q;  4IPC A;  4JI5 Q;  3HOX G;  3W1B A;  5JJK A;  1NTG A;  1PVO A;  2HIX A;  2I5L X;  4GS3 A;  3M4Q A;  1TWF H;  4A3I H;  1UWV A;  1X6O A;  1XPR A;  2F52 A;  4KHZ A;  1EFW A;  2GN5 A;  3U58 A;  4JI7 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...