3M3YH

Rna polymerase ii elongation complex c
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title X-ray structure and mechanism of RNA polymerase II stalled at an antineoplastic monofunctional platinum-DNA adduct.
pubmed doi rcsb
molecule tags Transferase/dna-rna hybrid
total genus 18
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2010-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3m3yH00
5J3BA 4JI1L 3J80i 4B3TQ 1IL2A 2F3IA 1EUJA 1MKHA 3OTOL 2K5HA 1IXRA 1VQ9A 4MNOA 3K80C 5IY0A 3HKZE 5E7NA 2ZJPA 1HR0L 1S3OA 1UE7A 2CQOA 3M9BA 1VQ5A 4JI2L 3TRZA 2UXDL 5JJLA 4OWWB 1Q82C 2I5HA 1TWCH 1X54A 2KBNA 1OXUA 4AH6A 1PA6A 3T1YQ 2XTIA 1XNRL 2HT1A 1Y1VH 1D7QA 4HJ7A 1WI5A 4YCUA 2BA1A 3KYHC 2MO0A 4IOAA 5LMUQ 4GKKQ 5C4XG 1S72A 2R7FA 1CKOA 4JI0L 2E2JH 2NN6G 3CCUA 1K3RA 3K8AA 4DUZQ 5DLQE 2NVYH 1O7IA 3OYYA 4B3SQ 4IFDG 3GTJH 2F4VQ 3HOVH 1P8LA 1G6PA 4NXMQ 3W1BA 1X6OA 2K4KA 1BVSA 3HOYG 2PQAB 3NEMA 3CAMA 2ZJRA 3U58A 3HOYH 3S16H 2WB1E 4LW1A 1NMFA 2Z6KC 3TS0A 2GVBA 4LF5L 3G48A 1GM5A 4J15A 4QJFA 3NBHB 1G291 2R7DA 4DV4L 1EFWA 2MQHA 4LF7L 1XMOL 3IRBA 4EQ5A 2JJQA 1L0WA 3W5OA 4DR7Q 4YWKA 4HJ8A 1LUZA 1HNXL 3RZDH 4MTNA 1VQKA 3S1MH 2K50A 2I5LX 4QL5A 4OXPA 1K73C 3PIPA 1LTLA 2OTJA 3PF5A 5BR8L 3S15H 3T1HQ 2RCNA 3RLNA 4L5TA 4LFBL 2WP8J 1UEBA 1YNXA 3CXCA 1Q8KA 2WAQE 4DPGA 3J80c 4DV3Q 2UXBL 4JYAQ 3G6EA 4LWCA 3FP9A 4C3JH 4X64Q 1NE3A 3BZCA 3ULJA 1HJPA 4HIDA 1VQ7A 1Z47A 4A3JG 2JA5G 2QEXA 1H95A 1N34L 4A3JH 2D0PA 3E9HA 4JI5L 4JI8Q 2OWOA 4AIMA 3M85A 2NVTH 1NJIC 4BBSG 4LF4Q 5H1SE 5C44H 1SRUA 2UU9L 4BBSH 1XMQL 4HIOA 3UDXA 4X62Q 1PVOA 1YI2A 4JV5L 2PNHA 4DAMA 2OTLA 3CCLA 2V1CC 4DNIA 2PI2E 1JE5A 4DV2L 1AE3A 2VQEL 4DR5Q 1N36L 4DV1Q 2E5LQ 4JI6Q 1K83H 3I4MG 1P16A 3DM3A 2I5MX 5ELOA 3HOWG 1VQIA 3RN5A 3M3YH 2MNAA 4AQYQ 2UXCL 1YITA 1OTCA 3J81j 4JI3L 4LFCL 4X66L 3CC4A 3RZOH 1YHBA 1E24A 2UUAQ 1L1OC 4JBMA 2N3SA 4DV6Q 1U5KA 1PH6A 4KHPQ 4A3FG 1TWHH 5IP9H 3CD6A 4A3FH 2BA0A 3STBD 4APVA 1HZCA 4DUYQ 2AHOB 2VY3A 4R4QA 1Q7YC 3F1ZA 4LF6Q 3HOZG 1A63A 2VZAA 4IOCA 2JA9A 2LXJA 4TQUS 4BA1I 2KCTA 4X65Q 4BA2I 3HOZH 3E0EA 5M3MG 4OO1G 4WJ3M 1N33L 2Y0SG 2NVQH 3NELA 5HY6A 2CCZA 2JA7G 3S2DH 3UDGA 1S40A 4A3GG 1X3FA 1FJGQ 4YCWA 3M4QA 4B3TL 1QVFA 2JA7H 1EOVA 1OXVA 1YJ9A 3I4NG 2PMZE 1BKBA 1SLJA 4ME3A 1Y14B 2ZJQA 1CSPA 2YV5A 1V1QA 2L15A 1MIUA 5GADC 4LUOA 3D0FA 3HOUG 1B8AA 1KQSA 3HOUH 3T1YL 1PHJA 1OXTA 4XTCS 3U50C 2D62A 1KD1C 4L5SA 3GTLH 3UDFA 3H0GG 5M5XH 1M90C 4UY8C 4QQBX 3CQZH 4XIGS 4A3IG 1JJGA 1J6QA 1VCIA 4GN3B 1FL0A 3F2DA 1YHAA 3CPWA 2QA4A 5LMUL 2K5NA 4A3IH 1SN8A 1Q81C 4L5RC 4QGUA 4GKKL 4K0KQ 3CCSA 1CKNA 4POGA 3AEVA 1SR3A 1SMXA 4DR4Q 4C3IH 1HNWQ 4DUZL 1WOCA 1IYJB 3WWVA 4TVAB 4B3SL 1YBYA 4PZ6A 2YU9H 3OW2A 1EWIA 1XJVA 3ZJYC 2KENA 2Z6KA 3MXNB 2F4VL 3TEHB 1PH2A 2VUMG 1G51A 4A93G 4A76A 5IWAQ 1XNQQ 4UPAA 1UWVA 4NXML 3TREA 2VUMH 3S1NH 4A93H 2N8NA 3FKIG 4NPSA 2ES2A 3GTOH 4GLVB 4P75A 1E1TA 3FKIH 1JJCB 3KDFA 1HNZQ 4QIWE 3KLWA 4OONA 5C4XH 4DR7L 4DKAC 5GROA 1I94Q 4IPDA 4DAYB 4A3DG 4IFDJ 1X3GA 1EYGA 3J7A5 5JEAG 5C0XG 4L5QA 1VQHA 5FJ8G 3EBEA 2ZM6Q 2DGYA 3RNUA 1PH9A 1A0IA 5FJ8H 3J81i 3G71A 3T1HL 5GQOA 1LM0A 4BY1G 1AE2A 3A0JA 1Q86C 4GOPB 1W2BA 1M1KC 1HZAA 2IX1A 4WJ4A 4BY1H 4DV3L 4UP9A 4JYAL 3RN2A 4OX9Q 1X9NA 4X64L 2Y0SE 4YHHQ 4IJLA 3L0OA 4KHZA 4LF8Q 4GNXC 1VQBA 2NZHA 2WFWA 3CCRA 4JI8L 5LMNW 1X55A 2NVXH 3KFUA 1EQRA 1GO3E 1QZGA 2PI2A 4LF4L 2EXDA 5GAHC 2HQLA 1DGSA 1IBKQ 2CWPA 3K0XA 2ATWA 4OWXB 2AWOA 3ERSX 4X62L 2ASBA 4R1JA 4A3KG 3BZKA 2Q2HA 4OWTB 3ULLA 1JJ2A 4JI7Q 1VQAA 2E5LL 5JJIA 4JI6L 4DR5L 4A3KH 4DV1L 3PGZA 2UUCQ 1L1OA 4P74A 2MFIA 1RL2A 2C35B 3UE0A 1JB7A 4R4CA 4YY3Q 3S1QH 4B3RQ 1TXYA 1VQ6A 3PO2G 3KF8B 1EIFA 4AQYL 1GD7A 2JA5H 4BXXG 1WJJA 2KHIA 2BH8A 3PO2H 1QUQA 3AQQA 3EIVA 4BXXH 2UUAL 4DV6L 1YHQA 1CKNB 1E7ZA 5AJ3Q 3PV0A 4KHPL 4QY7A 1I50H 1TWFH 3CP0A 2AMCB 4BY7G 1NTGA 3W1GA 4R4TA 5C4JH 3CCEA 3RLOA 3H3VH 4DUYL 2OQKA 1T9HA 4BY7H 3FHWA 1KIXA 2OQ0A 3G4SA 1V43A 4R4IA 4LF6L 1D8LA 4X65L 2N49A 3I4MH 2F52A 1I5FA 4GS3A 1Q1BA 3HOWH 2OCEA 4NXNQ 3UE1A 3KJPA 1FJGL 2YTXA 4BBRG 5IT9c 3CMEA 3KDFB 3HKZG 3J81c 1JT8A 2IT1A 1J5EQ 4BBRH 5K36G 5FLMG 1L2FA 4DV7Q 4P73A 2NN6I 5LMNQ 1IBLL 4GKJQ 1WCMG 1CUKA 3PUWA 3CCMA 4A4IA 4IFDI 2E2HH 4A75A 4GN5A 4LUVA 1EQQA 3F2CA 5C3EG 3CC7A 4RMFA 2KHJA 4DV5Q 4DR1Q 2Q2UA 2RF4A 1KL9A 4LF9Q 3ULPA 3K81C 3SGIA 2HHHQ 1QVCA 2R6GA 2JEBI 5M3MH 1YVCA 4UP7A 2I0QA 1Z9FA 2ALYB 2N78A 1LYLA 1QZHA 1PFSA 4K0KL 2BH2A 1N9WA 1NMGA 4A3GH 1Q46A 5IYCG 1MJCA 2B63G 4DR4L 1HNWL 4X6AH 3I4NH 4LFAQ 1E1OA 3PUXA 1IBLQ 3HFZB 4P72A 1PV4A 1WYDA 2GVAA 4IPGA 1YZ6A 4DR2Q 5IWAL 2H5XA 1PH3A 1XNQL 1CSQA 1KRSA 1OXSC 2IY5B 2CWAA 3A5UA 3GTMH 1UE5A 4HIKA 2DUDA 2UUBQ 3ICEA 1AH9A 4O2DA 2LXKA 4HJ9A 4JBJA 3H0GH 1UE6A 2R92G 3M4OH 1KXLA 4DR3Q 5M5YH 1HR0W 2R92H 1HNZL 1FGUA 4Y52H 4H02A 1L1OB 1U0LA 2AKWB 3KJOA 2CFMA 1HZ9A 2QGQA 1YJWA 3PO3G 1I94L 4KI0A 1IBML 2JEAI 1GKHA 3PO3H 4DV0Q 3KF6A 1QUQB 1SFOH 2Z0SA 2Q2IA 2B3GA 2ZM6L 1KC8C 2CKZB 1B7YB 1MJEA 4YWMA 4JBKA 2LSSA 2IHEA 3PSIA 1I3QH 2IX0A 4PZ8A 3CF5A 4A3EG 2VNUD 2JA8G 4GNXA 3GTGH 1KAWA 2KCMA 4A3EH 3GDEA 1PH5A 3H3VI 1BBWA 1C9OA 2VL6A 2JA8H 3S17H 4A3BG 2JA6G 1ASYA 3Q8DA 4DK6C 2EIFA 4OX9L 1IZ6A 4A3BH 4YHHL 2JA6H 5GAGC 1SE8A 1Y1WG 1PH4A 4JI4L 3L2PA 4LF8L 1Q12A 1Y1WH 1IBMQ 3PUVA 1N32Q 2GN5A 1R9TH 2R7ZG 5JEAJ 5C0XJ 4A3DH 3I4OA 3I2ZA 2R7ZH 1IBKL 4B3MQ 4DR6Q 3DLLA 1Y1VG 1VQNA 2R93G 1OXXK 4JOIC 4DK3C 4JBWA 2A1AA 4PZ7A 4LUZA 2R93H 1VQ8A 4JI7L 4X66Q 2VQFQ 2E2IH 2VS1A 3PF4A 3AYHB 4JI1Q 2UUCL 2K5VA 3J7ZC 1KHIA 3PUZA 3OTOQ 4JI4Q 4YY3L 1PH8A 4B3RL 1HH2P 4R4OA 1A62A 4LNQA 1PYBA 4OO1I 3HOVG 1HR0Q 1YIJA 4JI2Q 1NBWA 2K14A 2UXDQ 5M3FG 1VQLA 1QVGA 5AJ3L 5M3FH 1WFQA 3JAMi 4Y7NH 1XNRQ 3RR5A 4HIMA 1TWAH 4KLKA 1PH7A 3E9IA 3AFPA 3I56A 4A3LG 2A8VA 2YYZA 4A3LH 5ELNA 4JI0Q 2JK8A 4HJ5A 1K9MC 3AFQA 3S2HH 3CCVA 3L7ZC 3PUYA 1TWGH 4YWLA 4NXNL 2A19A 3HOXG 3TS2A 2Q2TA 3HOXH 3HKSA 4RG1A 4JC0A 3GO5A 4GN4B 3CC2A 2B29A 1FVIA 1J5EL 1VQOA 5GAEC 4DV7L 3ER0A 4O0AA 1E22A 1XTDA 1C7YA 1XPUA 3PCOB 5LMNL 2K75A 2K52A 4GKJL 4AYBG 3H15A 4JG2A 4LF5Q 2VW9A 2AWNA 2E8GA 3S24A 4A3CG 3KF6B 4DV4Q 3RLFA 1HZBA 4A3CH 1VS0A 1XMOQ 4LF7Q 1YEZA 3LGJA 4DV5L 4DR1L 3JC66 5JJKA 4ALPA 4GNXB 1N8RC 4LF9L 1VQDA 1XPOA 3S1RH 2HHHL 4IJHA 3I55A 1HNXQ 5FLXc 1K0RA 1VQGA 1VQ4A 1YJNA 2XGTA 3B6YA 5C44G 1KRTA 4JCVE 1VQFA 4A3MG 4LFAL 3GTPH 5BR8Q 1V9PA 1PH1A 1W3SA 1X65A 5FLMH 4A3MH 4YCVA 4LFBQ 1PYSB 4MZ9A 2HIVA 4P71A 1WCMH 3F2BA 2UXBQ 4DR2L 3I7FA 2IHFA 5C0XI 3U4ZA 4FDBA 2UUBL 1X3EA 5C3EH 1ASZA 3M4PA 3F8TA 2MO1A 4POFA 5IYDG 4C3HH 4GLXA 1X56A 3U4VA 3CMAA 4DR3L 3VDYA 1XPRA 1N34Q 4JI5Q 5IP7G 5IYDH 2EQSA 3BU2A 2RHQB 3MEFA 3JAMc 4IPCA 3TQYA 5IP7H 2UU9Q 1B70B 4EX5A 5IP9G 1XMQQ 1VQPA 2PQAA 5IYCH 4IPHA 2B63H 5IE8A 4GOPA 4JV5Q 3K7UC 3CCQA 3GTKH 4NB3A 4DV0L 3BJUA 1NY4A 4DV2Q 1VQJA 2VQEQ 1N36Q 2WB1G 4UP8A 2ID0A 2NZOA 3CW2C 2YTVA 2JQOA 2ZTCA 4GLAC 2D0OA 2JE6I 5M5WH 1C0AA 2UXCQ 1RIPA 1K8GA 3S14H 4JI3Q 2YTYA 4LFCQ 1SROA 1UE1A 4PMWA 1BBUA 1VQCA 1VQEA 3D31A 3GD7A 3K7AH 3UDIA 1JMCA 1EIYB 1VQMA 1GVPA 1CKMA 3CPFA 4JOIA 4IO9A 3STBC 1N32L 4HJAA 1A8VA 2ZTDA 3EN2A 3PIOA 2RHSB 1K8AC 3GTQH 1E3PA 4B3ML 4DR6L 1Q1EA 4PG3A 2ZTEA 3KOJA 4AYBE 5HGQA 5IYBG 2WAQG 3CCJA 4C2MH 4GOPC 2FXQA 3A74A 5IYBH 2HIXA 1N33Q 1I6HH 3NENA 3M7NA 3A5ZB 2VQFL 5EAYA
chains in the Genus database with same CATH superfamily
4U68A 4JI1L 1EWCA 4G7OC 2K5HA 1VQ9A 5CBAE 1S3OA 2EYHA 2KBNA 2X6LA 4F88A 2HT1A 3QIAA 3OSOA 5IGCA 2QEJC 1V1PA 4HJ7A 2EJMA 2BA1A 4YCUA 2MO0A 2JN4A 2EJFC 3V05A 1QB5D 1CKOA 4JI0L 1EL0A 1F2YA 3VYSA 3KBGA 1TS5A 4DUZQ 1D5XC 3K8AA 5IT9L 5DLQE 4KV6A 3RD4A 1RD9D 2J4XA 2NN6H 5DNFA 3GTJH 2CQAA 1I50B 4CDCC 5C4JB 3OIPA 1HRJA 4NXMQ 1GXDC 4OIKA 2F0MA 3H91A 2ZJRA 3U58A 3I4MB 1NMFA 1LTGD 1QG7A 2GVBA 4DAVA 1GM5A 1G291 1NCVA 2R7DA 1X32A 4DV4L 3IRBA 2PQEA 1XWEA 4KN4C 2K03A 1LUZA 1HNXL 3RZDH 1VQKA 4FF2A 4QL5A 1YNJC 4OXPA 1ML0D 1MGSA 1SYBA 2E2HB 2RSOA 3RLNA 2HUGA 4L5TA 5D14A 4LFBL 1UEBA 4K2LA 1Q8KA 2WAQE 4CJ0B 4C3JH 3FP9A 1L0YB 3FEWX 5M3MB 1II3A 1WTWA 4LK1C 3K57A 1VQ7A 4A3JG 2Z6BA 4HSPA 4JI5L 4BBSG 5C44H 2KEEA 4KJOA 1EEFD 1MD2D 3UDXA 4JV5L 4B9WA 2V1CC 3CC4A 1AE3A 4DR5Q 1N36L 2NBFA 4JI6Q 1AEXA 2I5MX 3HOWG 1EIGA 1SAPA 3RN5A 2UXCL 1V1PB 2MNAA 2V4DA 1LTBD 1OTCA 2CHBD 4X66L 3J7AF 4CGYB 1F9QA 4DV6Q 1SFOB 5IP9H 3CD6A 2BA0A 3GTGB 2AHOB 1CHPD 4A3EB 2FHTA 2VY3A 4KY5A 2KEDA 1A63A 1UNSA 2LXJA 4BA1I 4U673 4A3BB 3UI2A 3HOZH 2AQ3B 1F9PA 1WTOA 2NVQH 2CCZA 2O5IC 2N88A 4Q0FA 3UDGA 4OO1H 2CW0D 4YCWA 3M4QA 4B3TL 1QVFA 3I4NG 1YNNC 1CSPA 1DM0B 4CBVA 1BO0A 1MIUA 5GADC 3TMEA 3R3OA 3HOUH 3T1YL 1OXTA 4XTCS 2D62A 3UDFA 4K5WA 4QQBX 4A3IG 3PQIA 4GKKL 4QGUA 1PTOH 1QJOA 2FMCA 4CDFC 3CCSA 1CKNA 1WOCA 2L1BA 5K5PA 4PZ6A 1EWIA 2Z6KA 1L0XB 1TVXA 1VF7A 3TEHB 1PH2A 1XNQQ 1UWVA 2K7VA 4A93H 3I4LA 2ES2A 1GUOA 4GLVB 3FKIH 3CU7A 1EOTA 3TDQA 4N9TA 3HOXB 1UUPA 1BUVT 1PXUA 2HCCA 5J39A 3J7A5 5JEAG 4L8JA 5C0XG 5FJ8G 2RQXA 2DGYA 2ZM6Q 1PMRA 2K33A 1AE2A 4GOPB 1EEID 2M2LA 4TSSA 4WJ4A 4BY1H 1S5DD 4X64L 1KNEA 4IJLA 3L0OA 3HG9A 3MXUA 4JI8L 2NVXH 1K28A 1EQRA 2EXDA 3C1FA 1DGSA 1K8OA 4UAIA 2R3ZA 3S9WA 5IIFA 1A2TA 4X62L 2EZVA 1F2LA 2RVLA 3ULLA 1VQAA 1PRTC 1ZEQX 5A2QL 5KRUA 1RL2A 5LL6S 3LNNA 4R4CA 1TXYA 1VQ6A 1EIFA 1JWUD 1GD7A 2JA5H 2BH8A 2F3VA 3EIVA 4BXXH 2UUAL 4DXFA 1YHQA 1CKNB 4IN3A 3W1GA 3E0JA 3CCEA 3LWEA 3RLOA 2HQEA 3VYTA 2BOSA 1B9MA 2OQKA 4RKLA 1T9HA 2B2YA 4BY7H 1KIXA 5JVG3 4LF6L 5ELDA 1BBXC 1GUTA 5E1FA 4N8X1 3I3CA 3UE1A 4BBRG 5IT9c 4ZAIA 1G2TA 5IGFA 1GUGA 3HKZG 1JT8A 1WTQA 2NN6I 5LMNQ 1WCMG 3CCMA 2HDLA 4XYQA 1JOOA 4LUVA 1I6HB 1EQQA 2A73B 2K1BA 2CVRA 3TP8A 4DV5Q 4DR1Q 1BQQT 4RA8A 4C3HG 2Q2UA 2E76C 3ULPA 3SGIA 2R6GA 1DCZA 2I0QA 1Z9FA 2A69D 2N78A 4LJZC 3NBIA 4X6AH 4DR4L 4ZQ3A 1HNWL 1SEBD 1AFPA 1QCBD 2MJ8A 2MPMA 1SMYC 1WYDA 2GVAA 4FO2A 2E74C 1YZ6A 1SNOA 2IY5B 1UE5A 4HIKA 2WKCA 4HJ9A 3H0GH 1UE6A 2R92G 3M4OH 1KXLA 2PZTA 3X3MA 1HR0W 3GTJB 1CHQD 2CFMA 2O2LD 4WORA 3PO3G 1DJRD 3KLSA 1KDCA 2Q2IA 2B3GA 2CKZB 4DNTB 1MJEA 1B4OA 1I3QH 2JA8G 3H3VI 1C9OA 3S17H 3Q8DA 2EIFA 5GAGC 1SE8A 2PMZB 2Q8TA 1Y1WH 3PUVA 4I7ZC 3FMCA 4A3DH 1EQTA 4H7BA 3C1EA 1IBKL 4DR6Q 3DWPA 4C3JB 3KUPA 3L9AX 4JBWA 4PZ7A 2R93H 3W3AA 3BYYB 1VQ8A 4KTAA 4JI7L 3PF4A 2E2IH 3DWQA 2UUCL 1KHIA 3PUZA 3OTOQ 2K5DA 1PTOD 4IURA 5C5MA 1A62A 5C44B 4OO1I 1YIJA 2A6EC 3TBIB 2K14A 2UXDQ 1VQLA 4Y7NH 1XNRQ 3RR5A 4HIMA 1TWAH 3KBXA 1PH7A 1XTCD 2B39A 4A3LH 3MTSA 1F9SA 1HA6A 3SXHA 1TU2B 3CCVA 3L7ZC 1S5CD 1TWGH 4YWLA 3CC2A 3GTKB 2XIWA 3R2TA 3MVVA 4O1NA 1J5EL 5GAEC 2K5WA 3V2TA 5IGGA 3EQLC 4DV7L 3PCOB 4GKJL 1Z7TA 1WTPA 5HGTA 3HOZB 1WTVA 4RFBA 2NVQB 4A3CH 1VS0A 1CA5A 1YEZA 2Y0SB 3K6OA 5JJKA 1W6KA 3TZDA 4IJHA 1H9MA 1K0RA 2L5TA 1F2ZA 1FD7D 2A68C 3R2IA 3GTPH 4LFAL 5BR8Q 3BDOA 1RDPD 3HOUB 1W3SA 4YCVA 3I70A 1VF5C 2HIVA 4P71A 1EQVA 3BYTB 3F2BA 1SNCA 2UXBQ 3NWTA 3TP5A 1X3EA 1PTOB 5FO7B 4DXGA 2BE5C 3U4VA 1EY5A 4DR3L 4CKEA 1CA6A 1M4VA 2PZUA 2UU9Q 1VQPA 2PQAA 5KEEA 3Q0AA 4A93B 2B8GA 1NNXA 1NY4A 4DV2Q 1VQJA 4G7ZC 1H9RA 3F2UA 2ID0A 3FKIB 2NZOA 3HEJA 2JQOA 2ZTCA 2JE6I 4CKBA 3N6RA 1K8GA 3S14H 1BBUA 1VQEA 3K7AH 3GP7A 1JMCA 1VQMA 1IKMA 5JAVA 4Q5VA 2JXMB 4IO9A 1N32L 2R61A 1A8VA 3EN2A 5EKKA 1Q1EA 4AYBE 2ZTEA 3KOJA 4BY1B 4FF1A 3QOJA 2WAQG 1D5ZC 2X6GA 1CQVA 5IYBH 2I07B 3NENA 2L9HA 3ZYYX 3DXJC 1IL2A 4NW2A 1JOKA 2NVXB 3TSSA 2N55A 1RTOA 2F0PA 1SXTA 3HKZE 4PQXA 3T16A 3TP7A 5E7NA 3G6JB 3M9BA 4JI2L 3TRZA 5JJLA 3BVMA 1JOQA 3QWNA 1PA6A 2XTIA 1ENAA 1Y1VH 1EY9A 3D6CA 3VYRA 1D7QA 4RCOA 2F4IA 4IOAA 5LMUQ 2F0NA 5C4XG 2JA5B 1PYWD 1S72A 2B2TC 2EYLA 1O7IA 3OYYA 4KD3A 3J81E 4B3SQ 4IFDG 3QO2A 1FYCA 3H6MA 1GJXA 1EU4A 4XT1B 1G6PA 3MFGA 2NWGA 3HOYG 1YNJD 5C6AA 2PQAB 3CAMA 1LTSD 1Y8OB 3T13A 4LF5L 4J15A 4QJFA 5C4HA 1EFWA 2MQHA 4G7HC 3DWAA 1XMOL 1BNZA 2F0UA 5I4DA 4LF7L 4EQ5A 3MC0B 1L0WA 3E3XA 4IUQA 3IL8A 4HJ8A 2B2VA 5JVH3 4MTNA 4XT3B 2I5LX 3O13A 4A3FB 1CZGA 1I4HA 2XWJB 1LTLA 3I72A 4XQQA 4JK1C 3S15H 3T1HQ 1F77A 2WP8J 3CXCA 2Z1CA 1T5EA 1O78A 1B44D 2RBMA 1NE3A 3BZCA 4XYOA 1HJPA 1HQRD 4IUUA 3ULJA 4F7XA 4HIDA 2XVSA 1BCPB 5IGEA 2B2WC 1N34L 4A3JH 3E9HA 2TSSA 2C9OA 3MXNA 4AIMA 4RHSA 4H13C 4LF4Q 5DEHA 4B08A 2KUMA 1I4QA 4BBSH 3U9SA 1GHJA 3IKJA 1YI2A 1RODA 2PNHA 3HZXA 3CCLA 3MWYW 2PI2E 2E5LQ 2VQEL 2VB3X 4DV1Q 3I4MG 3H0GB 3M4OB 4C56C 1STNA 1UAPA 1EZ6A 1YITA 3K59A 2SEBD 4JI3L 4HAEA 4LFCL 1L1OC 4IZ8A 1V1OA 1U5KA 5LL6X 3HGBA 1I4GA 4QB4A 1YNND 1JORA 1TWHH 1D2BA 1I3QB 4APVA 2XRSD 3BZDB 2QF7A 1CFMA 4R4QA 2OF1A 3F1ZA 3S17B 4X65Q 1RHPA 4BA2I 3MXGA 3E0EA 5M3MG 3C3LA 4WJ3M 3BDLA 3I8ZA 2F03A 1X3FA 1FJGQ 1Y1WB 1CTMA 4IUTA 2F0QA 1BKBA 4A3DB 1SLJA 4ME3A 1Y14B 5IGBA 1V1QA 2L15A 1K8MA 1IL8A 1VMPA 1KQSA 2R93B 4KD4A 4IUNA 2L0CA 4KKUA 3U50C 1PHJA 2EY1A 1KD1C 4L5SA 3GTLH 1M90C 2E2IB 3KF8A 3CQZH 4L6TB 1FL0A 3F2DA 1Q81C 4A3IH 2K5NA 1PRTF 4C3IG 1VDZA 4M8AA 3T56B 3AEVA 1DXMA 4DUZL 3WWVA 4TVAB 1PZID 1YBYA 4Y7NB 1C48A 1ESRA 3OW2A 1XJVA 2KENA 1TWAB 3MXNB 1QILA 4ZUJA 4A76A 5IWAQ 4NXML 1LV9A 3TREA 2PCFB 5T1GA 5EKLA 2EY6A 2ZXPA 5T1IA 1Q90A 1O7ZA 2K6AA 1TWGB 3KDFA 3PO2B 2DJFC 4QIWE 5FLXE 5GROA 4IPDA 1ZXTA 5CGKA 4L5QA 2EYMA 1VQHA 4L63B 3EBEA 1PFNA 1PH9A 1A0IA 3H09A 5FJ8H 1Q86C 3A0JA 4MIUA 1W2BA 1ZYRC 3NP8A 4UP9A 3RN2A 5EKIA 1J8IA 4RHRA 4YHHQ 4KHZA 4CJ2C 1EY0A 4GNXC 4KJNA 2IW3A 3JAME 2NZHA 1SNDA 3GTPB 4KMUC 1W6JA 1QZGA 3FDTA 1S5BD 3ERSX 4FXKC 3P7JA 2F0VA 2QCPX 2ASBA 2O4XA 4A3KG 4OWTB 4DGZA 1ZKOA 1JJ2A 4JI6L 4DR5L 1RCVD 3LWUA 3VA5A 4XDXA 1JB7A 2MFIA 2C35B 4YY3Q 4B3RQ 3KF8B 5M9OA 4S3SA 1STHA 2KCNA 1HPCA 2KHIA 4C1NI 4DV6L 1O80A 4QY7A 1TWFH 5KNDA 3H3VH 2WB1B 4OIJA 3FHWA 3S14B 1I5FA 1Q1BA 1HQMC 3K7AB 5CV4A 1JWSD 1DOMA 2YTXA 1X3QA 3KDFB 4BBRH 5FLMG 4P73A 1STEA 1CUKA 3I90A 4MN3A 1C8CA 4A4IA 5LHY1 2RA4A 2B2UA 4GN5A 3F2CA 2IPKD 2K28A 1KAAA 1KL9A 4LF9Q 2Z8LA 1GUNA 4FNFA 4KY7A 4UP7A 2ALYB 4QCLA 3NPPA 3M4YA 1NMGA 2J0TD 2BH2A 4A3GH 2BCOA 1TS4A 1G8ZD 1PV4A 1Y1VB 4IPGA 1KLUD 1XNQL 4TRDA 1OXSC 2Z4HA 5EPLA 3A55A 3GTMH 3ICEA 2UUBQ 1EZ8A 1I4XA 5CV6A 2R92H 3HS0C 1FGUA 1U0LA 2AKWB 1YJWA 3NTKA 4DFAA 1IBML 1Q8IA 2QW7A 3PO3H 3KF6A 4EGVA 1KDBA 2Z0SA 2ZM6L 2IJ0A 4C1NK 4PZ8A 2IX0A 3J80E 4FF3A 4K2KA 1LLRD 2F0HA 1PH5A 1QOHA 1ICFB 2JA8H 2JA6G 1IZ6A 4WFN3 4ZUIA 2L55A 3EA6A 4K14A 1KNAA 1PH4A 4RKBA 2WV6D 1Q12A 1IBMQ 2GN5A 2H4OA 1R9TH 2R7ZG 3OOCA 3D4WA 3I4OA 1I4PA 4B3MQ 4MTKA 3GV6A 3SK5A 3MHBA 4JOIC 3R93A 3U9OA 4LUZA 4HCEA 2VQFQ 2VS1A 1SYFA 3AYHB 4A3JB 3E5SA 1R4QB 1STGA 4R4OA 3C46A 4BBSB 4LNQA 1PYBA 1LT6D 1HR0Q 4ID6A 5M3FG 4HSVA 3L3OC 1QVGA 1U4PA 3E9IA 3AFPA 2VB2X 2YYZA 4WRDA 2K01A 4DK1A 1Q3LA 2JK8A 2KVMA 3AFQA 3S2HH 1X3PA 4NDXA 1PFMA 3TS2A 3PUYA 1LT4D 2PPBC 2Q2TA 2F0EA 1LO5D 2K05A 2EYOA 2B29A 2DN8A 5C3XA 3ER0A 4O0AA 1XTDA 5LMNL 2G9DA 4AYBG 3H15A 3BS1A 1D6EC 4J1MA 4OELB 3KF6B 5IGDA 1BDOA 1CK1A 2F0KA 3LX0A 2WINB 2EVBA 4DV5L 4DR1L 2XN9C 4LAAA 4ALPA 1KABA 1VQDA 3CKIB 3I55A 1MHWC 1VQ4A 2HD3A 3B6YA 5C44G 3NQTA 1VQFA 4A3MG 1PH1A 1X65A 1MSGA 2KA7A 1AZQA 1PYSB 3GTLB 3CQZB 3I7FA 5C0XI 4A3IB 3MA2B 2SOBA 2ZXRA 5C3EH 2F0IA 3M4PA 5CR3A 1XX8A 1S5ED 1XXGA 2MO1A 1PDQA 3AB9A 2EJGC 2EY2A 2EQSA 3BU2A 3MEFA 4GZYC 4I7AA 5D65A 5IP9G 1XMQQ 1ILPA 4N8FA 4F8MA 5IYCH 2B63H 5IE8A 3I91A 1EY7A 3NBHA 1XYIA 1EY6A 2SNSA 4GLAC 5KIXA 2D9UA 4ZYSA 3QJYA 5JOBA 2RDGA 2YTYA 1UE1A 4H44C 1JQYD 3UDIA 1GVPA 1CKMA 4R8IA 2CH4A 4HJAA 1SJHD 3GTQH 1E3PA 4DR6L 5KYLA 3CCJA 4GOPC 1Z6HA 1EY4A 2FXQA 3A74A 5IODA 1N33Q 3OWFA 5I2YA 2CW0C 1JE4A 3RZDB 1MKHA 4ZRZA 3OTOL 1IXRA 3OWEB 2NTTA 4MNOA 3K80C 5IY0A 1TIID 2UXDL 3OMCA 1BF4A 2M9VA 5A35A 1X54A 1OXUA 4AH6A 3ITPA 1XNRL 2F0SA 1WI5A 2EDGA 2R7FA 3A54A 3CCUA 1K3RA 1EU3A 1O7LA 1SYDA 2NVYH 5ELCA 3SHLA 1EWHA 1EYAA 2F4VQ 4CHTB 1TWFB 4IFDH 3A7AB 3SK4A 4QF4A 3HOVH 3Q6SA 2XNAC 3W1BA 2K4KA 5EJWA 2EYFA 3HOYH 4LW1A 2Z6KC 3TS0A 3NBHB 1EIHA 1FNUA 1G6ZA 1Y8PB 4DR7Q 4HN7A 4YWKA 4BBRB 1NUCA 1RKNA 3S1MH 1DOKA 3TP6A 3MFYA 2F0TA 1K73C 5KYIA 3PIPA 4X3UA 5FO9B 2OTJA 5EBCA 5BR8L 1LTAD 2RCNA 5KNCA 2KECA 1UEAB 3R8BA 2NZ1D 4NKLA 4DPGA 5A2QE 4DV3Q 4JYAQ 2UXBL 4LWCA 2EXZA 1Z47A 5L37A 2JA5G 4A3GB 1H95A 2PZWA 2B8FA 3M85A 2NVTH 4I65A 2L12A 5H1SE 1SRUA 2UU9L 4HIOA 2M00A 1PVOA 1SNQA 2OTLA 1FNWA 3GTMB 4DK0A 2NTSA 3TN2A 4DNIA 2F0DA 4DV2L 1P16A 3DM3A 5ELOA 1IYUA 2R92B 3IFDA 1VQIA 4DAYA 4AQYQ 3J81j 4P2CB 1E24A 5JJZA 2N3SA 3EVQA 3PO3B 2J7ZA 1PH6A 4KHPQ 4A3FG 1EY8A 3OPOA 1TS3A 5NUCA 4PV1C 3STBD 1HZCA 4DUYQ 1WD1A 3K5LA 3HRZC 2JA8B 2VZAA 1LT3D 4IOCA 1SJED 2JA9A 4TQUS 1D5MC 3S2DH 2ZXOA 2JA7G 2G5DA 1S40A 4DN4M 1EOVA 1LT5D 1YJ9A 3DHQA 2PMZE 1R9TB 5I2XA 3DEPA 1SYCA 2ZJQA 1EFID 3BVGA 3D0FA 1B8AA 3KLRA 3QB3A 5ELBA 1STYA 3H0GG 5M5XH 1H9SA 4UY8C 4GN3B 4BWGB 5LMUL 2QA4A 1WTRA 4L5RC 1SN8A 4FYDA 3FPPA 4K0KQ 4C3IH 2Q8RE 1IYJB 3NXWA 4B3SL 2YU9H 3ZJYC 2CH4W 2VUMG 1QNKA 1JCKB 3BG3A 2EY5A 4FP5D 3SEBA 4UPAA 5ELEA 1SBBB 3VR3A 3T51B 4OEMB 3A7LA 3S2HB 1B9NA 1D1IA 4RGNA 1JJCB 1ZYRD 4B9XA 1J9OA 1HNZQ 5FLXL 3KLWA 4DKAC 1I94Q 3FPUB 4DAYB 4A3DG 1X3GA 3AU7A 4IUPA 3SK6A 1NR2A 4BY7B 3J81i 3T1HL 5GQOA 3MZ5A 1B3AA 1HZAA 2O5JC 4OX9Q 3TZUA 2FMMA 2Y0SE 4FXGC 4RGTA 4LF8Q 4UDUC 2WFWA 3JAML 2LMCB 1X55A 1HUNA 1ET6A 1U4LA 1GO3E 4LF4L 4CKCA 2HQLA 3K0XA 4OWXB 1HCZA 2AWOA 2EPBA 1HFNA 2SDFA 4OGQC 5C3EB 2E5LL 4A3KH 1AZPA 4DV1L 3PGZA 2OXPA 3D3RA 4P74A 3UE0A 5ELFA 1PTOC 3S1QH 3PO2G 1H9SB 1IHZA 1CZWA 1DD2A 2B63B 1QUQA 1I4RA 2JSOA 1E7ZA 5AJ3Q 4ME5A 3RMHA 5C4ZA 2QKIC 3CP0A 5I6WA 1NTGA 5D3DA 1C4QA 4R4TA 5I9OA 3EROA 3NHHA 4X65L 4GS3A 2Z9HA 3HOWH 2OCEA 4NXNQ 2L4NA 3K5NA 1LTTD 1FJGL 3J81c 2IT1A 5K36G 3GTQB 1IBLL 4QUFA 4XQNA 3PUWA 1LTID 4IFDI 1PZKD 2WAQB 4A75A 3D4RA 2RKSA 3CC7A 2KHJA 3Q23A 3K81C 2HHHQ 2AQ1B 4JW0A 3SR1A 2E75C 1N9WA 4Z9CB 5KGUA 1A6XA 3I4NH 5E3FA 4N9PA 1IBLQ 1SSOA 1ILQA 1QE6A 3HFZB 1SE3A 2F0JA 2AUJD 4DR2Q 5IWAL 2H5XA 1KRSA 1LTRD 3VR6A 4HR7B 1AH9A 4O2DA 2LXKA 1H9JA 5M5YH 3A8IE 2NVYB 2L11A 5EPKA 1HHVA 3CRKC 1AP0A 4H02A 3KJOA 3EJIA 3HOVB 4XQJA 2JEAI 1RF2D 4DV0Q 3HOYB 1QUQB 2Z4IA 1KC8C 1B53A 4YWMA 2IHEA 3PSIA 3CF5A 4TKOB 4A3EG 1SDFA 2C5CA 5J1ZA 3GQBA 4A3BG 1BBWA 2VL6A 5CV7A 4DK6C 2A6HC 1AW7A 4YHHL 2JA6H 3S1MB 2EYPA 3HP3A 4JI4L 1QNUA 3L2PA 2WACA 1TKWB 4PMBA 1LABA 5JEAJ 5C0XJ 3I2ZA 2R7ZH 5JEAH 5C0XH 3DLLA 3QR8A 1Y1VG 2JYOA 1A15A 1VQNA 3DUZA 1OXXK 1CQFA 4DK3C 2A1AA 5CBEE 4YIJA 1F2MA 1PRTD 3MEHA 4JI1Q 2K5VA 3T53B 2NVTB 4JI4Q 4YY3L 4B3RL 2EE1A 1WVLA 1BCPC 3DEOA 5JPNC 2WKDA 1NBWA 2PW5A 2KOLA 5M3FH 1WFQA 3JAMi 2F0OA 4QMGA 3I56A 5CYUA 3NSWA 2DJGC 1B2TA 1HA5A 2F1MA 5ELNA 4JI0Q 5I9PA 1K9MC 2FINB 3HOXG 5C3WA 3GO5A 4GN4B 2OEOA 2AQ2B 1VQOA 4KN7C 1C7YA 3J7AV 1MBYA 1A3UA 2E8GA 1U4RA 1LACA 3S2DB 4DV4Q 2SNMA 4CJ1B 3LGJA 3JC66 4LF9L 1PZJD 3S1RH 1HNXQ 5FLXc 1VQGA 1YJNA 2IX3A 3QOLA 4NP5A 3DMUA 4A3MH 5E4XA 2B2VC 4LFBQ 4MZ9A 5M5XB 1R4PB 1SMYD 1WCMH 1PRTB 1DZ1A 2IHFA 3VR5A 4DF7A 3NE5B 2D5DA 1SE4A 2ZT9C 4KK7A 2AUKA 2UUBL 4X3TA 4KHVA 5IYDG 4C3HH 4C3IB 1X56A 4GLXA 3I73A 1XPRA 4JI5Q 1HFGA 4KY6A 5IP7G 3SVMA 3ONAB 2I46A 2RHQB 2YU9B 3JAMc 3TQYA 4ZKBB 1WTHA 1B70B 1FR3A 4GOPA 4JV5Q 1CM9A 3DM1A 3K7UC 4FVMA 3GTKH 3BJUA 4EQPA 5CMDA 1N36Q 2NUCA 4UP8A 1VMCA 3CW2C 5M5WH 3W2DA 2UXCQ 3NUCA 1SYGA 1CT1D 2F0WA 2KQ3A 4R8NA 3K5MA 2K32A 1SROA 4PMWA 4X66Q 1K0SA 1EIYB 4JVZA 3CPFA 2D2CC 3PIOA 2LS01 4B3ML 4PG3A 5HGQA 3A8JE 4C2MH 4XXEA 2HIXA 2XSCA 1WTXA 3M7NA 3IFTA 2VQFL 1MI2A 1BXTA 5J3BA 3J80i 4B3TQ 4G57A 2F3IA 1EUJA 3PIO3 1IW7C 5EBDA 3S15B 2ZJPA 1HR0L 1UE7A 2CQOA 1VQ5A 3SK8A 4HEDA 4OWWB 2A6ED 1Q82C 2I5HA 1TWCH 2H1EA 3C2PA 2NB0A 1E0BA 3WOFA 3T1YQ 4A3KB 1I6VC 4IQZA 3KYHC 3S1QB 1FNVA 4GKKQ 3P75A 2IL8A 1T5XD 2BDOA 4X3SA 4WJWA 2NN6G 5IT9E 2E2JH 1ENFA 4QUCA 2EOTA 1D1KA 1P8LA 1STAA 1X6OA 1BVSA 1NAPA 3NEMA 3S16H 2RDFA 2WB1E 5FOBB 3G48A 3HOWB 2FFKB 3K0YA 4RAUC 2PW7A 3A56A 3OMGA 5DM73 2JJQA 3W5OA 1GUSA 3BDCA 2K50A 1TWHB 2A68D 1F9RA 1KDAA 3PF5A 1YNXA 4C3JG 1OO9B 3CHBD 1S4ZA 2PO4A 3J80c 2TMPA 3G6EA 1B3QA 3RUZA 4X64Q 2RDHA 1IKLA 2QEXA 1TR5A 1PFBA 5CV9A 2D0PA 4JI8Q 3I4NB 2OWOA 2BE5D 1NJIC 1HXYD 4HCSA 2DY8A 5IOCA 1XMQL 1HUMA 4X62Q 4DAMA 5FO8B 3WDNA 1JE5A 1JICA 1K83H 4ZLTF 5M5YB 3NTHA 5CC4A 2LY7A 5CV8A 3M3YH 4ZKCB 3FRPB 4K6DA 3RZOH 1YHBA 1HTLD 2UUAQ 4JBMA 2XRQD 1HTPA 1A3TA 2MGSA 1KTKA 4A3FH 1TY0A 1Q7YC 2IWHA 1ET9A 4LF6Q 1JWMD 3HOZG 1NSNS 2KCTA 4OO1G 3WOEA 2JA6B 1N33L 2Y0SG 2F3WA 3NELA 1EYCA 5HY6A 3A8KE 4A3GG 1TT2A 5BN5A 2JA7H 1OXVA 3VR2A 2R7ZB 1JC7A 2YV5A 1ICWA 1O7YA 4LUOA 4ODGA 4CDEC 3HOUG 1DONA 2B2TA 4RGMA 4K5VA 4XIGS 1JJGA 1J6QA 1VCIA 1YHAA 2B2UC 3CPWA 4V190 1E2VA 4POGA 4DR4Q 1SR3A 1SMXA 3ND8A 1HNWQ 1PTOF 5KNBA 5E4WC 5M3FB 3OW7A 1S5FD 2F4VL 1G51A 3E6ZX 5AFWA 4A93G 2VUMH 1TQOA 3S1NH 2PNRC 2N8NA 3P1HA 2RCFA 3FKIG 4NPSA 3GTOH 5DAUA 4P75A 1E1TA 2Q8IB 5EGTA 1TS2A 3EFXD 3NK9A 4HMIA 4OONA 5C4XH 4BS9A 1MSHA 4DR7L 5CORA 5G3LF 4IFDJ 3J81L 1EYGA 4K6LA 1U9RA 1SNPA 3RNUA 3NTIA 4RCNA 4AYBB 3G71A 1LM0A 4BY1G 4ABNA 1NR4A 1M1KC 2B2WA 2LKVA 2IX1A 4DV3L 4JYAL 1M8AA 3SDZA 3S1RB 4ZK9B 1X9NA 4OL7A 1VQBA 5I6YA 2P5ZX 3CCRA 5LMNW 3HKZB 2MP1A 3KFUA 4A3MB 2PI2A 3GV3A 5GAHC 1IBKQ 2ATWA 2CWPA 1GUWA 1WCMB 2HCIA 4FF4A 4R1JA 3BZKA 1BOSA 2Q2HA 4ULLA 4J6HA 4JI7Q 5JJIA 1JB3A 2ENBA 4C3HB 2F0FA 2UUCQ 1L1OA 2EYJA 3PIP3 4AQYL 5G3LD 3MAQA 4BXXG 1WJJA 3PO2H 1AN8A 3AQQA 2VXWA 4DAPA 2ICIA 4NMZA 3VR4A 3PV0A 3AMUA 4KHPL 1I50H 4IALA 2AMCB 3VYUA 3K5OA 2ICEC 2KCCA 3N52A 4BY7G 5C4JH 4DUYL 5M5WB 1IYVA 2KJXA 2OQ0A 1V43A 4R4IA 3G4SA 1D8LA 2F0LA 2N49A 3I4MH 3D8GA 2F52A 4KKTA 4UHVA 3D6WA 1ENCA 1H9KA 3KJPA 3CMEA 1J5EQ 4RWSC 1L2FA 4DV7Q 5K36H 4GKJQ 3ND9A 4C2MB 5EQ0A 2E2HH 2A5HA 5C3EG 4RMFA 5FK9C 2F0GA 1JR0D 4DNRB 2RF4A 4HTHA 2E2DC 1QVCA 4HMJA 1STBA 2JEBI 1RTNA 1YVCA 2B2YC 3OIQA 5M3MH 4FXDA 1SYEA 1LYLA 1QZHA 1PFSA 4K0KL 1Q46A 5IYCG 1MJCA 2B63G 1Y8NB 2MHVA 4LFAQ 1TWCB 1E1OA 3PUXA 1BCPF 4P72A 5BN3A 1PH3A 1CSQA 3MXPA 1B1ZA 1PLFA 2CWAA 3A5UA 1G2SA 2DUDA 1G91A 1CI3M 2QDLA 4JBJA 2A69C 2E2JB 4DR3Q 2GA4B 5CV5A 2K5QA 1HNZL 4Y52H 4EQNA 1L1OB 2A6HD 3G7LA 1HZ9A 2QGQA 4DA2A 3J7YW 1I94L 4KI0A 4RGOS 1GKHA 1ESFA 3S16B 1SFOH 2DNEA 4CDDC 3H3VC 1B7YB 4JBKA 2LSSA 2VNUD 4DU9A 4GNXA 3GTGH 1KAWA 2KCMA 4A3EH 3GDEA 1K3BC 5COYA 1ASYA 4K5XA 4OX9L 4A3BH 3SE0A 4M1UB 1QWYA 1Y1WG 4LF8L 3T4AC 3D4DA 3BVZA 4EVOA 1BCPD 1N32Q 3QG1A 3V96A 4V0BA 5F2DA 2R93G 5J22A 4E6IA 1E2ZA 3KK7A 4JPBW 3J7ZC 1BR9A 4F87A 1PH8A 3Q22A 1HH2P 2HDMA 5EPJA 5JPMC 3NWSA 3HOVG 4JI2Q 5HURA 2XWBB 4IUVA 5AJ3L 2NYZD 1U4MA 4KKSA 4MHEA 1K83B 4KLKA 1RJTA 4A3LG 2DY7A 2A8VA 3NQIA 4G4KA 3M3YB 3IAYA 2OT2A 4HJ5A 3VA7A 4QIWB 3RZOB 1KLGD 4NXNL 2A19A 3K58A 3X3NA 4OHJA 3HOXH 3HKSA 4RG1A 4JC0A 2K04A 1FVIA 1GHKA 3PMFA 1E22A 1XPUA 4R9WA 2PYKA 2K75A 2K52A 3URYA 4ZCKA 4JG2A 4LF5Q 2JP1A 2AWNA 3S24A 2VW9A 4A3CG 4O42A 1ONLA 3RLFA 1HZBA 2A74C 4LF7Q 1XMOQ 4H0LC 1E2WA 3H94A 2JA7B 1N8RC 4GNXB 2HHHL 1XPOA 3FVQA 4PNYA 2MUYA 2XGTA 2QILA 2RSNA 1KRTA 4JCVE 1V9PA 1WD0A 2BDNA 5FLMH 4PMCA 5DM63 1TY2A 4EQOA 1SE2A 4X3KA 4DR2L 3U4ZA 4FDBA 1ASZA 3F8TA 4POFA 1N34Q 3CMAA 3VDYA 1B50A 1EYDA 1SNMA 5C5LA 5IYDH 2KHSA 2QDBA 4IPCA 5IP7H 1DYQA 4EX5A 1GOZA 4K8JA 4IPHA 2VUMB 3S1NB 3CCQA 4ILWA 4NB3A 1Y69U 4DV0L 1A2UA 2VQEQ 5D3IB 5TSSA 2G9HD 3GTOB 2WB1G 2YTVA 3P20A 2D0OA 2LFNA 4LMQD 1DOLA 1C0AA 3OHXC 5C4XB 2X69A 1RIPA 4JI3Q 4LFCQ 3M7GA 1FGBD 1VQCA 3D31A 3GD7A 3Q24A 2DNCA 1IW7D 4JOIA 4K8IA 3STBC 3KLSX 5BN4A 2ZTDA 1K8AC 2RHSB 1V8QA 5ISRA 2FJ2A 1A3VA 5IYBG 3J80L 4J8QA 3ERQA 1I6HH 2WIIB 3A5ZB 4RH6A 5EAYA 5FKAC 3CRLC
chains in the Genus database with same CATH topology
5J3BA 4JI1L 3J80i 4B3TQ 1IL2A 2F3IA 1EUJA 1MKHA 3OTOL 2K5HA 1IXRA 1VQ9A 4MNOA 3K80C 5IY0A 3HKZE 5E7NA 2ZJPA 1HR0L 1S3OA 1UE7A 2CQOA 3M9BA 1VQ5A 4JI2L 3TRZA 2UXDL 5JJLA 4OWWB 1Q82C 2I5HA 1TWCH 1X54A 2KBNA 1OXUA 4AH6A 1PA6A 3T1YQ 2XTIA 1XNRL 2HT1A 1Y1VH 1D7QA 4HJ7A 1WI5A 4YCUA 2BA1A 3KYHC 2MO0A 4IOAA 5LMUQ 4GKKQ 5C4XG 1S72A 2R7FA 1CKOA 4JI0L 2E2JH 2NN6G 3CCUA 1K3RA 3K8AA 4DUZQ 5DLQE 2NVYH 1O7IA 3OYYA 4B3SQ 4IFDG 3GTJH 2F4VQ 3HOVH 1P8LA 1G6PA 4NXMQ 3W1BA 1X6OA 2K4KA 1BVSA 3HOYG 2PQAB 3NEMA 3CAMA 2ZJRA 3U58A 3HOYH 3S16H 2WB1E 4LW1A 1NMFA 2Z6KC 3TS0A 2GVBA 4LF5L 3G48A 1GM5A 4J15A 4QJFA 3NBHB 1G291 2R7DA 4DV4L 1EFWA 2MQHA 4LF7L 1XMOL 3IRBA 4EQ5A 2JJQA 1L0WA 3W5OA 4DR7Q 4YWKA 4HJ8A 1LUZA 1HNXL 3RZDH 4MTNA 1VQKA 3S1MH 2K50A 2I5LX 4QL5A 4OXPA 1K73C 3PIPA 1LTLA 2OTJA 3PF5A 5BR8L 3S15H 3T1HQ 2RCNA 3RLNA 4L5TA 4LFBL 2WP8J 1UEBA 1YNXA 3CXCA 1Q8KA 2WAQE 4DPGA 3J80c 4DV3Q 2UXBL 4JYAQ 3G6EA 4LWCA 3FP9A 4C3JH 4X64Q 1NE3A 3BZCA 3ULJA 1HJPA 4HIDA 1VQ7A 1Z47A 4A3JG 2JA5G 2QEXA 1H95A 1N34L 4A3JH 2D0PA 3E9HA 4JI5L 4JI8Q 2OWOA 4AIMA 3M85A 2NVTH 1NJIC 4BBSG 4LF4Q 5H1SE 5C44H 1SRUA 2UU9L 4BBSH 1XMQL 4HIOA 3UDXA 4X62Q 1PVOA 1YI2A 4JV5L 2PNHA 4DAMA 2OTLA 3CCLA 2V1CC 4DNIA 2PI2E 1JE5A 4DV2L 1AE3A 2VQEL 4DR5Q 1N36L 4DV1Q 2E5LQ 4JI6Q 1K83H 3I4MG 1P16A 3DM3A 2I5MX 5ELOA 3HOWG 1VQIA 3RN5A 3M3YH 2MNAA 4AQYQ 2UXCL 1YITA 1OTCA 3J81j 4JI3L 4LFCL 4X66L 3CC4A 3RZOH 1YHBA 1E24A 2UUAQ 1L1OC 4JBMA 2N3SA 4DV6Q 1U5KA 1PH6A 4KHPQ 4A3FG 1TWHH 5IP9H 3CD6A 4A3FH 2BA0A 3STBD 4APVA 1HZCA 4DUYQ 2AHOB 2VY3A 4R4QA 1Q7YC 3F1ZA 4LF6Q 3HOZG 1A63A 2VZAA 4IOCA 2JA9A 2LXJA 4TQUS 4BA1I 2KCTA 4X65Q 4BA2I 3HOZH 3E0EA 5M3MG 4OO1G 4WJ3M 1N33L 2Y0SG 2NVQH 3NELA 5HY6A 2CCZA 2JA7G 3S2DH 3UDGA 1S40A 4A3GG 1X3FA 1FJGQ 4YCWA 3M4QA 4B3TL 1QVFA 2JA7H 1EOVA 1OXVA 1YJ9A 3I4NG 2PMZE 1BKBA 1SLJA 4ME3A 1Y14B 2ZJQA 1CSPA 2YV5A 1V1QA 2L15A 1MIUA 5GADC 4LUOA 3D0FA 3HOUG 1B8AA 1KQSA 3HOUH 3T1YL 1PHJA 1OXTA 4XTCS 3U50C 2D62A 1KD1C 4L5SA 3GTLH 3UDFA 3H0GG 5M5XH 1M90C 4UY8C 4QQBX 3CQZH 4XIGS 4A3IG 1JJGA 1J6QA 1VCIA 4GN3B 1FL0A 3F2DA 1YHAA 3CPWA 2QA4A 5LMUL 2K5NA 4A3IH 1SN8A 1Q81C 4L5RC 4QGUA 4GKKL 4K0KQ 3CCSA 1CKNA 4POGA 3AEVA 1SR3A 1SMXA 4DR4Q 4C3IH 1HNWQ 4DUZL 1WOCA 1IYJB 3WWVA 4TVAB 4B3SL 1YBYA 4PZ6A 2YU9H 3OW2A 1EWIA 1XJVA 3ZJYC 2KENA 2Z6KA 3MXNB 2F4VL 3TEHB 1PH2A 2VUMG 1G51A 4A93G 4A76A 5IWAQ 1XNQQ 4UPAA 1UWVA 4NXML 3TREA 2VUMH 3S1NH 4A93H 2N8NA 3FKIG 4NPSA 2ES2A 3GTOH 4GLVB 4P75A 1E1TA 3FKIH 1JJCB 3KDFA 1HNZQ 4QIWE 3KLWA 4OONA 5C4XH 4DR7L 4DKAC 5GROA 1I94Q 4IPDA 4DAYB 4A3DG 4IFDJ 1X3GA 1EYGA 3J7A5 5JEAG 5C0XG 4L5QA 1VQHA 5FJ8G 3EBEA 2ZM6Q 2DGYA 3RNUA 1PH9A 1A0IA 5FJ8H 3J81i 3G71A 3T1HL 5GQOA 1LM0A 4BY1G 1AE2A 3A0JA 1Q86C 4GOPB 1W2BA 1M1KC 1HZAA 2IX1A 4WJ4A 4BY1H 4DV3L 4UP9A 4JYAL 3RN2A 4OX9Q 1X9NA 4X64L 2Y0SE 4YHHQ 4IJLA 3L0OA 4KHZA 4LF8Q 4GNXC 1VQBA 2NZHA 2WFWA 3CCRA 4JI8L 5LMNW 1X55A 2NVXH 3KFUA 1EQRA 1GO3E 1QZGA 2PI2A 4LF4L 2EXDA 5GAHC 2HQLA 1DGSA 1IBKQ 2CWPA 3K0XA 2ATWA 4OWXB 2AWOA 3ERSX 4X62L 2ASBA 4R1JA 4A3KG 3BZKA 2Q2HA 4OWTB 3ULLA 1JJ2A 4JI7Q 1VQAA 2E5LL 5JJIA 4JI6L 4DR5L 4A3KH 4DV1L 3PGZA 2UUCQ 1L1OA 4P74A 2MFIA 1RL2A 2C35B 3UE0A 1JB7A 4R4CA 4YY3Q 3S1QH 4B3RQ 1TXYA 1VQ6A 3PO2G 3KF8B 1EIFA 4AQYL 1GD7A 2JA5H 4BXXG 1WJJA 2KHIA 2BH8A 3PO2H 1QUQA 3AQQA 3EIVA 4BXXH 2UUAL 4DV6L 1YHQA 1CKNB 1E7ZA 5AJ3Q 3PV0A 4KHPL 4QY7A 1I50H 1TWFH 3CP0A 2AMCB 4BY7G 1NTGA 3W1GA 4R4TA 5C4JH 3CCEA 3RLOA 3H3VH 4DUYL 2OQKA 1T9HA 4BY7H 3FHWA 1KIXA 2OQ0A 3G4SA 1V43A 4R4IA 4LF6L 1D8LA 4X65L 2N49A 3I4MH 2F52A 1I5FA 4GS3A 1Q1BA 3HOWH 2OCEA 4NXNQ 3UE1A 3KJPA 1FJGL 2YTXA 4BBRG 5IT9c 3CMEA 3KDFB 3HKZG 3J81c 1JT8A 2IT1A 1J5EQ 4BBRH 5K36G 5FLMG 1L2FA 4DV7Q 4P73A 2NN6I 5LMNQ 1IBLL 4GKJQ 1WCMG 1CUKA 3PUWA 3CCMA 4A4IA 4IFDI 2E2HH 4A75A 4GN5A 4LUVA 1EQQA 3F2CA 5C3EG 3CC7A 4RMFA 2KHJA 4DV5Q 4DR1Q 2Q2UA 2RF4A 1KL9A 4LF9Q 3ULPA 3K81C 3SGIA 2HHHQ 1QVCA 2R6GA 2JEBI 5M3MH 1YVCA 4UP7A 2I0QA 1Z9FA 2ALYB 2N78A 1LYLA 1QZHA 1PFSA 4K0KL 2BH2A 1N9WA 1NMGA 4A3GH 1Q46A 5IYCG 1MJCA 2B63G 4DR4L 1HNWL 4X6AH 3I4NH 4LFAQ 1E1OA 3PUXA 1IBLQ 3HFZB 4P72A 1PV4A 1WYDA 2GVAA 4IPGA 1YZ6A 4DR2Q 5IWAL 2H5XA 1PH3A 1XNQL 1CSQA 1KRSA 1OXSC 2IY5B 2CWAA 3A5UA 3GTMH 1UE5A 4HIKA 2DUDA 2UUBQ 3ICEA 1AH9A 4O2DA 2LXKA 4HJ9A 4JBJA 3H0GH 1UE6A 2R92G 3M4OH 1KXLA 4DR3Q 5M5YH 1HR0W 2R92H 1HNZL 1FGUA 4Y52H 4H02A 1L1OB 1U0LA 2AKWB 3KJOA 2CFMA 1HZ9A 2QGQA 1YJWA 3PO3G 1I94L 4KI0A 1IBML 2JEAI 1GKHA 3PO3H 4DV0Q 3KF6A 1QUQB 1SFOH 2Z0SA 2Q2IA 2B3GA 2ZM6L 1KC8C 2CKZB 1B7YB 1MJEA 4YWMA 4JBKA 2LSSA 2IHEA 3PSIA 1I3QH 2IX0A 4PZ8A 3CF5A 4A3EG 2VNUD 2JA8G 4GNXA 3GTGH 1KAWA 2KCMA 4A3EH 3GDEA 1PH5A 3H3VI 1BBWA 1C9OA 2VL6A 2JA8H 3S17H 4A3BG 2JA6G 1ASYA 3Q8DA 4DK6C 2EIFA 4OX9L 1IZ6A 4A3BH 4YHHL 2JA6H 5GAGC 1SE8A 1Y1WG 1PH4A 4JI4L 3L2PA 4LF8L 1Q12A 1Y1WH 1IBMQ 3PUVA 1N32Q 2GN5A 1R9TH 2R7ZG 5JEAJ 5C0XJ 4A3DH 3I4OA 3I2ZA 2R7ZH 1IBKL 4B3MQ 4DR6Q 3DLLA 1Y1VG 1VQNA 2R93G 1OXXK 4JOIC 4DK3C 4JBWA 2A1AA 4PZ7A 4LUZA 2R93H 1VQ8A 4JI7L 4X66Q 2VQFQ 2E2IH 2VS1A 3PF4A 3AYHB 4JI1Q 2UUCL 2K5VA 3J7ZC 1KHIA 3PUZA 3OTOQ 4JI4Q 4YY3L 1PH8A 4B3RL 1HH2P 4R4OA 1A62A 4LNQA 1PYBA 4OO1I 3HOVG 1HR0Q 1YIJA 4JI2Q 1NBWA 2K14A 2UXDQ 5M3FG 1VQLA 1QVGA 5AJ3L 5M3FH 1WFQA 3JAMi 4Y7NH 1XNRQ 3RR5A 4HIMA 1TWAH 4KLKA 1PH7A 3E9IA 3AFPA 3I56A 4A3LG 2A8VA 2YYZA 4A3LH 5ELNA 4JI0Q 2JK8A 4HJ5A 1K9MC 3AFQA 3S2HH 3CCVA 3L7ZC 3PUYA 1TWGH 4YWLA 4NXNL 2A19A 3HOXG 3TS2A 2Q2TA 3HOXH 3HKSA 4RG1A 4JC0A 3GO5A 4GN4B 3CC2A 2B29A 1FVIA 1J5EL 1VQOA 5GAEC 4DV7L 3ER0A 4O0AA 1E22A 1XTDA 1C7YA 1XPUA 3PCOB 5LMNL 2K75A 2K52A 4GKJL 4AYBG 3H15A 4JG2A 4LF5Q 2VW9A 2AWNA 2E8GA 3S24A 4A3CG 3KF6B 4DV4Q 3RLFA 1HZBA 4A3CH 1VS0A 1XMOQ 4LF7Q 1YEZA 3LGJA 4DV5L 4DR1L 3JC66 5JJKA 4ALPA 4GNXB 1N8RC 4LF9L 1VQDA 1XPOA 3S1RH 2HHHL 4IJHA 3I55A 1HNXQ 5FLXc 1K0RA 1VQGA 1VQ4A 1YJNA 2XGTA 3B6YA 5C44G 1KRTA 4JCVE 1VQFA 4A3MG 4LFAL 3GTPH 5BR8Q 1V9PA 1PH1A 1W3SA 1X65A 5FLMH 4A3MH 4YCVA 4LFBQ 1PYSB 4MZ9A 2HIVA 4P71A 1WCMH 3F2BA 2UXBQ 4DR2L 3I7FA 2IHFA 5C0XI 3U4ZA 4FDBA 2UUBL 1X3EA 5C3EH 1ASZA 3M4PA 3F8TA 2MO1A 4POFA 5IYDG 4C3HH 4GLXA 1X56A 3U4VA 3CMAA 4DR3L 3VDYA 1XPRA 1N34Q 4JI5Q 5IP7G 5IYDH 2EQSA 3BU2A 2RHQB 3MEFA 3JAMc 4IPCA 3TQYA 5IP7H 2UU9Q 1B70B 4EX5A 5IP9G 1XMQQ 1VQPA 2PQAA 5IYCH 4IPHA 2B63H 5IE8A 4GOPA 4JV5Q 3K7UC 3CCQA 3GTKH 4NB3A 4DV0L 3BJUA 1NY4A 4DV2Q 1VQJA 2VQEQ 1N36Q 2WB1G 4UP8A 2ID0A 2NZOA 3CW2C 2YTVA 2JQOA 2ZTCA 4GLAC 2D0OA 2JE6I 5M5WH 1C0AA 2UXCQ 1RIPA 1K8GA 3S14H 4JI3Q 2YTYA 4LFCQ 1SROA 1UE1A 4PMWA 1BBUA 1VQCA 1VQEA 3D31A 3GD7A 3K7AH 3UDIA 1JMCA 1EIYB 1VQMA 1GVPA 1CKMA 3CPFA 4JOIA 4IO9A 3STBC 1N32L 4HJAA 1A8VA 2ZTDA 3EN2A 3PIOA 2RHSB 1K8AC 3GTQH 1E3PA 4B3ML 4DR6L 1Q1EA 4PG3A 2ZTEA 3KOJA 4AYBE 5HGQA 5IYBG 2WAQG 3CCJA 4C2MH 4GOPC 2FXQA 3A74A 5IYBH 2HIXA 1N33Q 1I6HH 3NENA 3M7NA 3A5ZB 2VQFL 5EAYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J3B A;  4JI1 L;  3J80 i;  4B3T Q;  1IL2 A;  2F3I A;  1EUJ A;  1MKH A;  3OTO L;  2K5H A;  1IXR A;  1VQ9 A;  4MNO A;  3K80 C;  5IY0 A;  3HKZ E;  5E7N A;  2ZJP A;  1HR0 L;  1S3O A;  1UE7 A;  2CQO A;  3M9B A;  1VQ5 A;  4JI2 L;  3TRZ A;  2UXD L;  5JJL A;  4OWW B;  1Q82 C;  2I5H A;  1TWC H;  1X54 A;  2KBN A;  1OXU A;  4AH6 A;  1PA6 A;  3T1Y Q;  2XTI A;  1XNR L;  2HT1 A;  1Y1V H;  1D7Q A;  4HJ7 A;  1WI5 A;  4YCU A;  2BA1 A;  3KYH C;  2MO0 A;  4IOA A;  5LMU Q;  4GKK Q;  5C4X G;  1S72 A;  2R7F A;  1CKO A;  4JI0 L;  2E2J H;  2NN6 G;  3CCU A;  1K3R A;  3K8A A;  4DUZ Q;  5DLQ E;  2NVY H;  1O7I A;  3OYY A;  4B3S Q;  4IFD G;  3GTJ H;  2F4V Q;  3HOV H;  1P8L A;  1G6P A;  4NXM Q;  3W1B A;  1X6O A;  2K4K A;  1BVS A;  3HOY G;  2PQA B;  3NEM A;  3CAM A;  2ZJR A;  3U58 A;  3HOY H;  3S16 H;  2WB1 E;  4LW1 A;  1NMF A;  2Z6K C;  3TS0 A;  2GVB A;  4LF5 L;  3G48 A;  1GM5 A;  4J15 A;  4QJF A;  3NBH B;  1G29 1;  2R7D A;  4DV4 L;  1EFW A;  2MQH A;  4LF7 L;  1XMO L;  3IRB A;  4EQ5 A;  2JJQ A;  1L0W A;  3W5O A;  4DR7 Q;  4YWK A;  4HJ8 A;  1LUZ A;  1HNX L;  3RZD H;  4MTN A;  1VQK A;  3S1M H;  2K50 A;  2I5L X;  4QL5 A;  4OXP A;  1K73 C;  3PIP A;  1LTL A;  2OTJ A;  3PF5 A;  5BR8 L;  3S15 H;  3T1H Q;  2RCN A;  3RLN A;  4L5T A;  4LFB L;  2WP8 J;  1UEB A;  1YNX A;  3CXC A;  1Q8K A;  2WAQ E;  4DPG A;  3J80 c;  4DV3 Q;  2UXB L;  4JYA Q;  3G6E A;  4LWC A;  3FP9 A;  4C3J H;  4X64 Q;  1NE3 A;  3BZC A;  3ULJ A;  1HJP A;  4HID A;  1VQ7 A;  1Z47 A;  4A3J G;  2JA5 G;  2QEX A;  1H95 A;  1N34 L;  4A3J H;  2D0P A;  3E9H A;  4JI5 L;  4JI8 Q;  2OWO A;  4AIM A;  3M85 A;  2NVT H;  1NJI C;  4BBS G;  4LF4 Q;  5H1S E;  5C44 H;  1SRU A;  2UU9 L;  4BBS H;  1XMQ L;  4HIO A;  3UDX A;  4X62 Q;  1PVO A;  1YI2 A;  4JV5 L;  2PNH A;  4DAM A;  2OTL A;  3CCL A;  2V1C C;  4DNI A;  2PI2 E;  1JE5 A;  4DV2 L;  1AE3 A;  2VQE L;  4DR5 Q;  1N36 L;  4DV1 Q;  2E5L Q;  4JI6 Q;  1K83 H;  3I4M G;  1P16 A;  3DM3 A;  2I5M X;  5ELO A;  3HOW G;  1VQI A;  3RN5 A;  3M3Y H;  2MNA A;  4AQY Q;  2UXC L;  1YIT A;  1OTC A;  3J81 j;  4JI3 L;  4LFC L;  4X66 L;  3CC4 A;  3RZO H;  1YHB A;  1E24 A;  2UUA Q;  1L1O C;  4JBM A;  2N3S A;  4DV6 Q;  1U5K A;  1PH6 A;  4KHP Q;  4A3F G;  1TWH H;  5IP9 H;  3CD6 A;  4A3F H;  2BA0 A;  3STB D;  4APV A;  1HZC A;  4DUY Q;  2AHO B;  2VY3 A;  4R4Q A;  1Q7Y C;  3F1Z A;  4LF6 Q;  3HOZ G;  1A63 A;  2VZA A;  4IOC A;  2JA9 A;  2LXJ A;  4TQU S;  4BA1 I;  2KCT A;  4X65 Q;  4BA2 I;  3HOZ H;  3E0E A;  5M3M G;  4OO1 G;  4WJ3 M;  1N33 L;  2Y0S G;  2NVQ H;  3NEL A;  5HY6 A;  2CCZ A;  2JA7 G;  3S2D H;  3UDG A;  1S40 A;  4A3G G;  1X3F A;  1FJG Q;  4YCW A;  3M4Q A;  4B3T L;  1QVF A;  2JA7 H;  1EOV A;  1OXV A;  1YJ9 A;  3I4N G;  2PMZ E;  1BKB A;  1SLJ A;  4ME3 A;  1Y14 B;  2ZJQ A;  1CSP A;  2YV5 A;  1V1Q A;  2L15 A;  1MIU A;  5GAD C;  4LUO A;  3D0F A;  3HOU G;  1B8A A;  1KQS A;  3HOU H;  3T1Y L;  1PHJ A;  1OXT A;  4XTC S;  3U50 C;  2D62 A;  1KD1 C;  4L5S A;  3GTL H;  3UDF A;  3H0G G;  5M5X H;  1M90 C;  4UY8 C;  4QQB X;  3CQZ H;  4XIG S;  4A3I G;  1JJG A;  1J6Q A;  1VCI A;  4GN3 B;  1FL0 A;  3F2D A;  1YHA A;  3CPW A;  2QA4 A;  5LMU L;  2K5N A;  4A3I H;  1SN8 A;  1Q81 C;  4L5R C;  4QGU A;  4GKK L;  4K0K Q;  3CCS A;  1CKN A;  4POG A;  3AEV A;  1SR3 A;  1SMX A;  4DR4 Q;  4C3I H;  1HNW Q;  4DUZ L;  1WOC A;  1IYJ B;  3WWV A;  4TVA B;  4B3S L;  1YBY A;  4PZ6 A;  2YU9 H;  3OW2 A;  1EWI A;  1XJV A;  3ZJY C;  2KEN A;  2Z6K A;  3MXN B;  2F4V L;  3TEH B;  1PH2 A;  2VUM G;  1G51 A;  4A93 G;  4A76 A;  5IWA Q;  1XNQ Q;  4UPA A;  1UWV A;  4NXM L;  3TRE A;  2VUM H;  3S1N H;  4A93 H;  2N8N A;  3FKI G;  4NPS A;  2ES2 A;  3GTO H;  4GLV B;  4P75 A;  1E1T A;  3FKI H;  1JJC B;  3KDF A;  1HNZ Q;  4QIW E;  3KLW A;  4OON A;  5C4X H;  4DR7 L;  4DKA C;  5GRO A;  1I94 Q;  4IPD A;  4DAY B;  4A3D G;  4IFD J;  1X3G A;  1EYG A;  3J7A 5;  5JEA G;  5C0X G;  4L5Q A;  1VQH A;  5FJ8 G;  3EBE A;  2ZM6 Q;  2DGY A;  3RNU A;  1PH9 A;  1A0I A;  5FJ8 H;  3J81 i;  3G71 A;  3T1H L;  5GQO A;  1LM0 A;  4BY1 G;  1AE2 A;  3A0J A;  1Q86 C;  4GOP B;  1W2B A;  1M1K C;  1HZA A;  2IX1 A;  4WJ4 A;  4BY1 H;  4DV3 L;  4UP9 A;  4JYA L;  3RN2 A;  4OX9 Q;  1X9N A;  4X64 L;  2Y0S E;  4YHH Q;  4IJL A;  3L0O A;  4KHZ A;  4LF8 Q;  4GNX C;  1VQB A;  2NZH A;  2WFW A;  3CCR A;  4JI8 L;  5LMN W;  1X55 A;  2NVX H;  3KFU A;  1EQR A;  1GO3 E;  1QZG A;  2PI2 A;  4LF4 L;  2EXD A;  5GAH C;  2HQL A;  1DGS A;  1IBK Q;  2CWP A;  3K0X A;  2ATW A;  4OWX B;  2AWO A;  3ERS X;  4X62 L;  2ASB A;  4R1J A;  4A3K G;  3BZK A;  2Q2H A;  4OWT B;  3ULL A;  1JJ2 A;  4JI7 Q;  1VQA A;  2E5L L;  5JJI A;  4JI6 L;  4DR5 L;  4A3K H;  4DV1 L;  3PGZ A;  2UUC Q;  1L1O A;  4P74 A;  2MFI A;  1RL2 A;  2C35 B;  3UE0 A;  1JB7 A;  4R4C A;  4YY3 Q;  3S1Q H;  4B3R Q;  1TXY A;  1VQ6 A;  3PO2 G;  3KF8 B;  1EIF A;  4AQY L;  1GD7 A;  2JA5 H;  4BXX G;  1WJJ A;  2KHI A;  2BH8 A;  3PO2 H;  1QUQ A;  3AQQ A;  3EIV A;  4BXX H;  2UUA L;  4DV6 L;  1YHQ A;  1CKN B;  1E7Z A;  5AJ3 Q;  3PV0 A;  4KHP L;  4QY7 A;  1I50 H;  1TWF H;  3CP0 A;  2AMC B;  4BY7 G;  1NTG A;  3W1G A;  4R4T A;  5C4J H;  3CCE A;  3RLO A;  3H3V H;  4DUY L;  2OQK A;  1T9H A;  4BY7 H;  3FHW A;  1KIX A;  2OQ0 A;  3G4S A;  1V43 A;  4R4I A;  4LF6 L;  1D8L A;  4X65 L;  2N49 A;  3I4M H;  2F52 A;  1I5F A;  4GS3 A;  1Q1B A;  3HOW H;  2OCE A;  4NXN Q;  3UE1 A;  3KJP A;  1FJG L;  2YTX A;  4BBR G;  5IT9 c;  3CME A;  3KDF B;  3HKZ G;  3J81 c;  1JT8 A;  2IT1 A;  1J5E Q;  4BBR H;  5K36 G;  5FLM G;  1L2F A;  4DV7 Q;  4P73 A;  2NN6 I;  5LMN Q;  1IBL L;  4GKJ Q;  1WCM G;  1CUK A;  3PUW A;  3CCM A;  4A4I A;  4IFD I;  2E2H H;  4A75 A;  4GN5 A;  4LUV A;  1EQQ A;  3F2C A;  5C3E G;  3CC7 A;  4RMF A;  2KHJ A;  4DV5 Q;  4DR1 Q;  2Q2U A;  2RF4 A;  1KL9 A;  4LF9 Q;  3ULP A;  3K81 C;  3SGI A;  2HHH Q;  1QVC A;  2R6G A;  2JEB I;  5M3M H;  1YVC A;  4UP7 A;  2I0Q A;  1Z9F A;  2ALY B;  2N78 A;  1LYL A;  1QZH A;  1PFS A;  4K0K L;  2BH2 A;  1N9W A;  1NMG A;  4A3G H;  1Q46 A;  5IYC G;  1MJC A;  2B63 G;  4DR4 L;  1HNW L;  4X6A H;  3I4N H;  4LFA Q;  1E1O A;  3PUX A;  1IBL Q;  3HFZ B;  4P72 A;  1PV4 A;  1WYD A;  2GVA A;  4IPG A;  1YZ6 A;  4DR2 Q;  5IWA L;  2H5X A;  1PH3 A;  1XNQ L;  1CSQ A;  1KRS A;  1OXS C;  2IY5 B;  2CWA A;  3A5U A;  3GTM H;  1UE5 A;  4HIK A;  2DUD A;  2UUB Q;  3ICE A;  1AH9 A;  4O2D A;  2LXK A;  4HJ9 A;  4JBJ A;  3H0G H;  1UE6 A;  2R92 G;  3M4O H;  1KXL A;  4DR3 Q;  5M5Y H;  1HR0 W;  2R92 H;  1HNZ L;  1FGU A;  4Y52 H;  4H02 A;  1L1O B;  1U0L A;  2AKW B;  3KJO A;  2CFM A;  1HZ9 A;  2QGQ A;  1YJW A;  3PO3 G;  1I94 L;  4KI0 A;  1IBM L;  2JEA I;  1GKH A;  3PO3 H;  4DV0 Q;  3KF6 A;  1QUQ B;  1SFO H;  2Z0S A;  2Q2I A;  2B3G A;  2ZM6 L;  1KC8 C;  2CKZ B;  1B7Y B;  1MJE A;  4YWM A;  4JBK A;  2LSS A;  2IHE A;  3PSI A;  1I3Q H;  2IX0 A;  4PZ8 A;  3CF5 A;  4A3E G;  2VNU D;  2JA8 G;  4GNX A;  3GTG H;  1KAW A;  2KCM A;  4A3E H;  3GDE A;  1PH5 A;  3H3V I;  1BBW A;  1C9O A;  2VL6 A;  2JA8 H;  3S17 H;  4A3B G;  2JA6 G;  1ASY A;  3Q8D A;  4DK6 C;  2EIF A;  4OX9 L;  1IZ6 A;  4A3B H;  4YHH L;  2JA6 H;  5GAG C;  1SE8 A;  1Y1W G;  1PH4 A;  4JI4 L;  3L2P A;  4LF8 L;  1Q12 A;  1Y1W H;  1IBM Q;  3PUV A;  1N32 Q;  2GN5 A;  1R9T H;  2R7Z G;  5JEA J;  5C0X J;  4A3D H;  3I4O A;  3I2Z A;  2R7Z H;  1IBK L;  4B3M Q;  4DR6 Q;  3DLL A;  1Y1V G;  1VQN A;  2R93 G;  1OXX K;  4JOI C;  4DK3 C;  4JBW A;  2A1A A;  4PZ7 A;  4LUZ A;  2R93 H;  1VQ8 A;  4JI7 L;  4X66 Q;  2VQF Q;  2E2I H;  2VS1 A;  3PF4 A;  3AYH B;  4JI1 Q;  2UUC L;  2K5V A;  3J7Z C;  1KHI A;  3PUZ A;  3OTO Q;  4JI4 Q;  4YY3 L;  1PH8 A;  4B3R L;  1HH2 P;  4R4O A;  1A62 A;  4LNQ A;  1PYB A;  4OO1 I;  3HOV G;  1HR0 Q;  1YIJ A;  4JI2 Q;  1NBW A;  2K14 A;  2UXD Q;  5M3F G;  1VQL A;  1QVG A;  5AJ3 L;  5M3F H;  1WFQ A;  3JAM i;  4Y7N H;  1XNR Q;  3RR5 A;  4HIM A;  1TWA H;  4KLK A;  1PH7 A;  3E9I A;  3AFP A;  3I56 A;  4A3L G;  2A8V A;  2YYZ A;  4A3L H;  5ELN A;  4JI0 Q;  2JK8 A;  4HJ5 A;  1K9M C;  3AFQ A;  3S2H H;  3CCV A;  3L7Z C;  3PUY A;  1TWG H;  4YWL A;  4NXN L;  2A19 A;  3HOX G;  3TS2 A;  2Q2T A;  3HOX H;  3HKS A;  4RG1 A;  4JC0 A;  3GO5 A;  4GN4 B;  3CC2 A;  2B29 A;  1FVI A;  1J5E L;  1VQO A;  5GAE C;  4DV7 L;  3ER0 A;  4O0A A;  1E22 A;  1XTD A;  1C7Y A;  1XPU A;  3PCO B;  5LMN L;  2K75 A;  2K52 A;  4GKJ L;  4AYB G;  3H15 A;  4JG2 A;  4LF5 Q;  2VW9 A;  2AWN A;  2E8G A;  3S24 A;  4A3C G;  3KF6 B;  4DV4 Q;  3RLF A;  1HZB A;  4A3C H;  1VS0 A;  1XMO Q;  4LF7 Q;  1YEZ A;  3LGJ A;  4DV5 L;  4DR1 L;  3JC6 6;  5JJK A;  4ALP A;  4GNX B;  1N8R C;  4LF9 L;  1VQD A;  1XPO A;  3S1R H;  2HHH L;  4IJH A;  3I55 A;  1HNX Q;  5FLX c;  1K0R A;  1VQG A;  1VQ4 A;  1YJN A;  2XGT A;  3B6Y A;  5C44 G;  1KRT A;  4JCV E;  1VQF A;  4A3M G;  4LFA L;  3GTP H;  5BR8 Q;  1V9P A;  1PH1 A;  1W3S A;  1X65 A;  5FLM H;  4A3M H;  4YCV A;  4LFB Q;  1PYS B;  4MZ9 A;  2HIV A;  4P71 A;  1WCM H;  3F2B A;  2UXB Q;  4DR2 L;  3I7F A;  2IHF A;  5C0X I;  3U4Z A;  4FDB A;  2UUB L;  1X3E A;  5C3E H;  1ASZ A;  3M4P A;  3F8T A;  2MO1 A;  4POF A;  5IYD G;  4C3H H;  4GLX A;  1X56 A;  3U4V A;  3CMA A;  4DR3 L;  3VDY A;  1XPR A;  1N34 Q;  4JI5 Q;  5IP7 G;  5IYD H;  2EQS A;  3BU2 A;  2RHQ B;  3MEF A;  3JAM c;  4IPC A;  3TQY A;  5IP7 H;  2UU9 Q;  1B70 B;  4EX5 A;  5IP9 G;  1XMQ Q;  1VQP A;  2PQA A;  5IYC H;  4IPH A;  2B63 H;  5IE8 A;  4GOP A;  4JV5 Q;  3K7U C;  3CCQ A;  3GTK H;  4NB3 A;  4DV0 L;  3BJU A;  1NY4 A;  4DV2 Q;  1VQJ A;  2VQE Q;  1N36 Q;  2WB1 G;  4UP8 A;  2ID0 A;  2NZO A;  3CW2 C;  2YTV A;  2JQO A;  2ZTC A;  4GLA C;  2D0O A;  2JE6 I;  5M5W H;  1C0A A;  2UXC Q;  1RIP A;  1K8G A;  3S14 H;  4JI3 Q;  2YTY A;  4LFC Q;  1SRO A;  1UE1 A;  4PMW A;  1BBU A;  1VQC A;  1VQE A;  3D31 A;  3GD7 A;  3K7A H;  3UDI A;  1JMC A;  1EIY B;  1VQM A;  1GVP A;  1CKM A;  3CPF A;  4JOI A;  4IO9 A;  3STB C;  1N32 L;  4HJA A;  1A8V A;  2ZTD A;  3EN2 A;  3PIO A;  2RHS B;  1K8A C;  3GTQ H;  1E3P A;  4B3M L;  4DR6 L;  1Q1E A;  4PG3 A;  2ZTE A;  3KOJ A;  4AYB E;  5HGQ A;  5IYB G;  2WAQ G;  3CCJ A;  4C2M H;  4GOP C;  2FXQ A;  3A74 A;  5IYB H;  2HIX A;  1N33 Q;  1I6H H;  3NEN A;  3M7N A;  3A5Z B;  2VQF L;  5EAY A; 
#chains in the Genus database with same CATH topology
 4U68 A;  4JI1 L;  1EWC A;  4G7O C;  2K5H A;  1VQ9 A;  5CBA E;  1S3O A;  2EYH A;  2KBN A;  2X6L A;  4F88 A;  2HT1 A;  3QIA A;  3OSO A;  5IGC A;  2QEJ C;  1V1P A;  4HJ7 A;  2EJM A;  2BA1 A;  4YCU A;  2MO0 A;  2JN4 A;  2EJF C;  3V05 A;  1QB5 D;  1CKO A;  4JI0 L;  1EL0 A;  1F2Y A;  3VYS A;  3KBG A;  1TS5 A;  4DUZ Q;  1D5X C;  3K8A A;  5IT9 L;  5DLQ E;  4KV6 A;  3RD4 A;  1RD9 D;  2J4X A;  2NN6 H;  5DNF A;  3GTJ H;  2CQA A;  1I50 B;  4CDC C;  5C4J B;  3OIP A;  1HRJ A;  4NXM Q;  1GXD C;  4OIK A;  2F0M A;  3H91 A;  2ZJR A;  3U58 A;  3I4M B;  1NMF A;  1LTG D;  1QG7 A;  2GVB A;  4DAV A;  1GM5 A;  1G29 1;  1NCV A;  2R7D A;  1X32 A;  4DV4 L;  3IRB A;  2PQE A;  1XWE A;  4KN4 C;  2K03 A;  1LUZ A;  1HNX L;  3RZD H;  1VQK A;  4FF2 A;  4QL5 A;  1YNJ C;  4OXP A;  1ML0 D;  1MGS A;  1SYB A;  2E2H B;  2RSO A;  3RLN A;  2HUG A;  4L5T A;  5D14 A;  4LFB L;  1UEB A;  4K2L A;  1Q8K A;  2WAQ E;  4CJ0 B;  4C3J H;  3FP9 A;  1L0Y B;  3FEW X;  5M3M B;  1II3 A;  1WTW A;  4LK1 C;  3K57 A;  1VQ7 A;  4A3J G;  2Z6B A;  4HSP A;  4JI5 L;  4BBS G;  5C44 H;  2KEE A;  4KJO A;  1EEF D;  1MD2 D;  3UDX A;  4JV5 L;  4B9W A;  2V1C C;  3CC4 A;  1AE3 A;  4DR5 Q;  1N36 L;  2NBF A;  4JI6 Q;  1AEX A;  2I5M X;  3HOW G;  1EIG A;  1SAP A;  3RN5 A;  2UXC L;  1V1P B;  2MNA A;  2V4D A;  1LTB D;  1OTC A;  2CHB D;  4X66 L;  3J7A F;  4CGY B;  1F9Q A;  4DV6 Q;  1SFO B;  5IP9 H;  3CD6 A;  2BA0 A;  3GTG B;  2AHO B;  1CHP D;  4A3E B;  2FHT A;  2VY3 A;  4KY5 A;  2KED A;  1A63 A;  1UNS A;  2LXJ A;  4BA1 I;  4U67 3;  4A3B B;  3UI2 A;  3HOZ H;  2AQ3 B;  1F9P A;  1WTO A;  2NVQ H;  2CCZ A;  2O5I C;  2N88 A;  4Q0F A;  3UDG A;  4OO1 H;  2CW0 D;  4YCW A;  3M4Q A;  4B3T L;  1QVF A;  3I4N G;  1YNN C;  1CSP A;  1DM0 B;  4CBV A;  1BO0 A;  1MIU A;  5GAD C;  3TME A;  3R3O A;  3HOU H;  3T1Y L;  1OXT A;  4XTC S;  2D62 A;  3UDF A;  4K5W A;  4QQB X;  4A3I G;  3PQI A;  4GKK L;  4QGU A;  1PTO H;  1QJO A;  2FMC A;  4CDF C;  3CCS A;  1CKN A;  1WOC A;  2L1B A;  5K5P A;  4PZ6 A;  1EWI A;  2Z6K A;  1L0X B;  1TVX A;  1VF7 A;  3TEH B;  1PH2 A;  1XNQ Q;  1UWV A;  2K7V A;  4A93 H;  3I4L A;  2ES2 A;  1GUO A;  4GLV B;  3FKI H;  3CU7 A;  1EOT A;  3TDQ A;  4N9T A;  3HOX B;  1UUP A;  1BUV T;  1PXU A;  2HCC A;  5J39 A;  3J7A 5;  5JEA G;  4L8J A;  5C0X G;  5FJ8 G;  2RQX A;  2DGY A;  2ZM6 Q;  1PMR A;  2K33 A;  1AE2 A;  4GOP B;  1EEI D;  2M2L A;  4TSS A;  4WJ4 A;  4BY1 H;  1S5D D;  4X64 L;  1KNE A;  4IJL A;  3L0O A;  3HG9 A;  3MXU A;  4JI8 L;  2NVX H;  1K28 A;  1EQR A;  2EXD A;  3C1F A;  1DGS A;  1K8O A;  4UAI A;  2R3Z A;  3S9W A;  5IIF A;  1A2T A;  4X62 L;  2EZV A;  1F2L A;  2RVL A;  3ULL A;  1VQA A;  1PRT C;  1ZEQ X;  5A2Q L;  5KRU A;  1RL2 A;  5LL6 S;  3LNN A;  4R4C A;  1TXY A;  1VQ6 A;  1EIF A;  1JWU D;  1GD7 A;  2JA5 H;  2BH8 A;  2F3V A;  3EIV A;  4BXX H;  2UUA L;  4DXF A;  1YHQ A;  1CKN B;  4IN3 A;  3W1G A;  3E0J A;  3CCE A;  3LWE A;  3RLO A;  2HQE A;  3VYT A;  2BOS A;  1B9M A;  2OQK A;  4RKL A;  1T9H A;  2B2Y A;  4BY7 H;  1KIX A;  5JVG 3;  4LF6 L;  5ELD A;  1BBX C;  1GUT A;  5E1F A;  4N8X 1;  3I3C A;  3UE1 A;  4BBR G;  5IT9 c;  4ZAI A;  1G2T A;  5IGF A;  1GUG A;  3HKZ G;  1JT8 A;  1WTQ A;  2NN6 I;  5LMN Q;  1WCM G;  3CCM A;  2HDL A;  4XYQ A;  1JOO A;  4LUV A;  1I6H B;  1EQQ A;  2A73 B;  2K1B A;  2CVR A;  3TP8 A;  4DV5 Q;  4DR1 Q;  1BQQ T;  4RA8 A;  4C3H G;  2Q2U A;  2E76 C;  3ULP A;  3SGI A;  2R6G A;  1DCZ A;  2I0Q A;  1Z9F A;  2A69 D;  2N78 A;  4LJZ C;  3NBI A;  4X6A H;  4DR4 L;  4ZQ3 A;  1HNW L;  1SEB D;  1AFP A;  1QCB D;  2MJ8 A;  2MPM A;  1SMY C;  1WYD A;  2GVA A;  4FO2 A;  2E74 C;  1YZ6 A;  1SNO A;  2IY5 B;  1UE5 A;  4HIK A;  2WKC A;  4HJ9 A;  3H0G H;  1UE6 A;  2R92 G;  3M4O H;  1KXL A;  2PZT A;  3X3M A;  1HR0 W;  3GTJ B;  1CHQ D;  2CFM A;  2O2L D;  4WOR A;  3PO3 G;  1DJR D;  3KLS A;  1KDC A;  2Q2I A;  2B3G A;  2CKZ B;  4DNT B;  1MJE A;  1B4O A;  1I3Q H;  2JA8 G;  3H3V I;  1C9O A;  3S17 H;  3Q8D A;  2EIF A;  5GAG C;  1SE8 A;  2PMZ B;  2Q8T A;  1Y1W H;  3PUV A;  4I7Z C;  3FMC A;  4A3D H;  1EQT A;  4H7B A;  3C1E A;  1IBK L;  4DR6 Q;  3DWP A;  4C3J B;  3KUP A;  3L9A X;  4JBW A;  4PZ7 A;  2R93 H;  3W3A A;  3BYY B;  1VQ8 A;  4KTA A;  4JI7 L;  3PF4 A;  2E2I H;  3DWQ A;  2UUC L;  1KHI A;  3PUZ A;  3OTO Q;  2K5D A;  1PTO D;  4IUR A;  5C5M A;  1A62 A;  5C44 B;  4OO1 I;  1YIJ A;  2A6E C;  3TBI B;  2K14 A;  2UXD Q;  1VQL A;  4Y7N H;  1XNR Q;  3RR5 A;  4HIM A;  1TWA H;  3KBX A;  1PH7 A;  1XTC D;  2B39 A;  4A3L H;  3MTS A;  1F9S A;  1HA6 A;  3SXH A;  1TU2 B;  3CCV A;  3L7Z C;  1S5C D;  1TWG H;  4YWL A;  3CC2 A;  3GTK B;  2XIW A;  3R2T A;  3MVV A;  4O1N A;  1J5E L;  5GAE C;  2K5W A;  3V2T A;  5IGG A;  3EQL C;  4DV7 L;  3PCO B;  4GKJ L;  1Z7T A;  1WTP A;  5HGT A;  3HOZ B;  1WTV A;  4RFB A;  2NVQ B;  4A3C H;  1VS0 A;  1CA5 A;  1YEZ A;  2Y0S B;  3K6O A;  5JJK A;  1W6K A;  3TZD A;  4IJH A;  1H9M A;  1K0R A;  2L5T A;  1F2Z A;  1FD7 D;  2A68 C;  3R2I A;  3GTP H;  4LFA L;  5BR8 Q;  3BDO A;  1RDP D;  3HOU B;  1W3S A;  4YCV A;  3I70 A;  1VF5 C;  2HIV A;  4P71 A;  1EQV A;  3BYT B;  3F2B A;  1SNC A;  2UXB Q;  3NWT A;  3TP5 A;  1X3E A;  1PTO B;  5FO7 B;  4DXG A;  2BE5 C;  3U4V A;  1EY5 A;  4DR3 L;  4CKE A;  1CA6 A;  1M4V A;  2PZU A;  2UU9 Q;  1VQP A;  2PQA A;  5KEE A;  3Q0A A;  4A93 B;  2B8G A;  1NNX A;  1NY4 A;  4DV2 Q;  1VQJ A;  4G7Z C;  1H9R A;  3F2U A;  2ID0 A;  3FKI B;  2NZO A;  3HEJ A;  2JQO A;  2ZTC A;  2JE6 I;  4CKB A;  3N6R A;  1K8G A;  3S14 H;  1BBU A;  1VQE A;  3K7A H;  3GP7 A;  1JMC A;  1VQM A;  1IKM A;  5JAV A;  4Q5V A;  2JXM B;  4IO9 A;  1N32 L;  2R61 A;  1A8V A;  3EN2 A;  5EKK A;  1Q1E A;  4AYB E;  2ZTE A;  3KOJ A;  4BY1 B;  4FF1 A;  3QOJ A;  2WAQ G;  1D5Z C;  2X6G A;  1CQV A;  5IYB H;  2I07 B;  3NEN A;  2L9H A;  3ZYY X;  3DXJ C;  1IL2 A;  4NW2 A;  1JOK A;  2NVX B;  3TSS A;  2N55 A;  1RTO A;  2F0P A;  1SXT A;  3HKZ E;  4PQX A;  3T16 A;  3TP7 A;  5E7N A;  3G6J B;  3M9B A;  4JI2 L;  3TRZ A;  5JJL A;  3BVM A;  1JOQ A;  3QWN A;  1PA6 A;  2XTI A;  1ENA A;  1Y1V H;  1EY9 A;  3D6C A;  3VYR A;  1D7Q A;  4RCO A;  2F4I A;  4IOA A;  5LMU Q;  2F0N A;  5C4X G;  2JA5 B;  1PYW D;  1S72 A;  2B2T C;  2EYL A;  1O7I A;  3OYY A;  4KD3 A;  3J81 E;  4B3S Q;  4IFD G;  3QO2 A;  1FYC A;  3H6M A;  1GJX A;  1EU4 A;  4XT1 B;  1G6P A;  3MFG A;  2NWG A;  3HOY G;  1YNJ D;  5C6A A;  2PQA B;  3CAM A;  1LTS D;  1Y8O B;  3T13 A;  4LF5 L;  4J15 A;  4QJF A;  5C4H A;  1EFW A;  2MQH A;  4G7H C;  3DWA A;  1XMO L;  1BNZ A;  2F0U A;  5I4D A;  4LF7 L;  4EQ5 A;  3MC0 B;  1L0W A;  3E3X A;  4IUQ A;  3IL8 A;  4HJ8 A;  2B2V A;  5JVH 3;  4MTN A;  4XT3 B;  2I5L X;  3O13 A;  4A3F B;  1CZG A;  1I4H A;  2XWJ B;  1LTL A;  3I72 A;  4XQQ A;  4JK1 C;  3S15 H;  3T1H Q;  1F77 A;  2WP8 J;  3CXC A;  2Z1C A;  1T5E A;  1O78 A;  1B44 D;  2RBM A;  1NE3 A;  3BZC A;  4XYO A;  1HJP A;  1HQR D;  4IUU A;  3ULJ A;  4F7X A;  4HID A;  2XVS A;  1BCP B;  5IGE A;  2B2W C;  1N34 L;  4A3J H;  3E9H A;  2TSS A;  2C9O A;  3MXN A;  4AIM A;  4RHS A;  4H13 C;  4LF4 Q;  5DEH A;  4B08 A;  2KUM A;  1I4Q A;  4BBS H;  3U9S A;  1GHJ A;  3IKJ A;  1YI2 A;  1ROD A;  2PNH A;  3HZX A;  3CCL A;  3MWY W;  2PI2 E;  2E5L Q;  2VQE L;  2VB3 X;  4DV1 Q;  3I4M G;  3H0G B;  3M4O B;  4C56 C;  1STN A;  1UAP A;  1EZ6 A;  1YIT A;  3K59 A;  2SEB D;  4JI3 L;  4HAE A;  4LFC L;  1L1O C;  4IZ8 A;  1V1O A;  1U5K A;  5LL6 X;  3HGB A;  1I4G A;  4QB4 A;  1YNN D;  1JOR A;  1TWH H;  1D2B A;  1I3Q B;  4APV A;  2XRS D;  3BZD B;  2QF7 A;  1CFM A;  4R4Q A;  2OF1 A;  3F1Z A;  3S17 B;  4X65 Q;  1RHP A;  4BA2 I;  3MXG A;  3E0E A;  5M3M G;  3C3L A;  4WJ3 M;  3BDL A;  3I8Z A;  2F03 A;  1X3F A;  1FJG Q;  1Y1W B;  1CTM A;  4IUT A;  2F0Q A;  1BKB A;  4A3D B;  1SLJ A;  4ME3 A;  1Y14 B;  5IGB A;  1V1Q A;  2L15 A;  1K8M A;  1IL8 A;  1VMP A;  1KQS A;  2R93 B;  4KD4 A;  4IUN A;  2L0C A;  4KKU A;  3U50 C;  1PHJ A;  2EY1 A;  1KD1 C;  4L5S A;  3GTL H;  1M90 C;  2E2I B;  3KF8 A;  3CQZ H;  4L6T B;  1FL0 A;  3F2D A;  1Q81 C;  4A3I H;  2K5N A;  1PRT F;  4C3I G;  1VDZ A;  4M8A A;  3T56 B;  3AEV A;  1DXM A;  4DUZ L;  3WWV A;  4TVA B;  1PZI D;  1YBY A;  4Y7N B;  1C48 A;  1ESR A;  3OW2 A;  1XJV A;  2KEN A;  1TWA B;  3MXN B;  1QIL A;  4ZUJ A;  4A76 A;  5IWA Q;  4NXM L;  1LV9 A;  3TRE A;  2PCF B;  5T1G A;  5EKL A;  2EY6 A;  2ZXP A;  5T1I A;  1Q90 A;  1O7Z A;  2K6A A;  1TWG B;  3KDF A;  3PO2 B;  2DJF C;  4QIW E;  5FLX E;  5GRO A;  4IPD A;  1ZXT A;  5CGK A;  4L5Q A;  2EYM A;  1VQH A;  4L63 B;  3EBE A;  1PFN A;  1PH9 A;  1A0I A;  3H09 A;  5FJ8 H;  1Q86 C;  3A0J A;  4MIU A;  1W2B A;  1ZYR C;  3NP8 A;  4UP9 A;  3RN2 A;  5EKI A;  1J8I A;  4RHR A;  4YHH Q;  4KHZ A;  4CJ2 C;  1EY0 A;  4GNX C;  4KJN A;  2IW3 A;  3JAM E;  2NZH A;  1SND A;  3GTP B;  4KMU C;  1W6J A;  1QZG A;  3FDT A;  1S5B D;  3ERS X;  4FXK C;  3P7J A;  2F0V A;  2QCP X;  2ASB A;  2O4X A;  4A3K G;  4OWT B;  4DGZ A;  1ZKO A;  1JJ2 A;  4JI6 L;  4DR5 L;  1RCV D;  3LWU A;  3VA5 A;  4XDX A;  1JB7 A;  2MFI A;  2C35 B;  4YY3 Q;  4B3R Q;  3KF8 B;  5M9O A;  4S3S A;  1STH A;  2KCN A;  1HPC A;  2KHI A;  4C1N I;  4DV6 L;  1O80 A;  4QY7 A;  1TWF H;  5KND A;  3H3V H;  2WB1 B;  4OIJ A;  3FHW A;  3S14 B;  1I5F A;  1Q1B A;  1HQM C;  3K7A B;  5CV4 A;  1JWS D;  1DOM A;  2YTX A;  1X3Q A;  3KDF B;  4BBR H;  5FLM G;  4P73 A;  1STE A;  1CUK A;  3I90 A;  4MN3 A;  1C8C A;  4A4I A;  5LHY 1;  2RA4 A;  2B2U A;  4GN5 A;  3F2C A;  2IPK D;  2K28 A;  1KAA A;  1KL9 A;  4LF9 Q;  2Z8L A;  1GUN A;  4FNF A;  4KY7 A;  4UP7 A;  2ALY B;  4QCL A;  3NPP A;  3M4Y A;  1NMG A;  2J0T D;  2BH2 A;  4A3G H;  2BCO A;  1TS4 A;  1G8Z D;  1PV4 A;  1Y1V B;  4IPG A;  1KLU D;  1XNQ L;  4TRD A;  1OXS C;  2Z4H A;  5EPL A;  3A55 A;  3GTM H;  3ICE A;  2UUB Q;  1EZ8 A;  1I4X A;  5CV6 A;  2R92 H;  3HS0 C;  1FGU A;  1U0L A;  2AKW B;  1YJW A;  3NTK A;  4DFA A;  1IBM L;  1Q8I A;  2QW7 A;  3PO3 H;  3KF6 A;  4EGV A;  1KDB A;  2Z0S A;  2ZM6 L;  2IJ0 A;  4C1N K;  4PZ8 A;  2IX0 A;  3J80 E;  4FF3 A;  4K2K A;  1LLR D;  2F0H A;  1PH5 A;  1QOH A;  1ICF B;  2JA8 H;  2JA6 G;  1IZ6 A;  4WFN 3;  4ZUI A;  2L55 A;  3EA6 A;  4K14 A;  1KNA A;  1PH4 A;  4RKB A;  2WV6 D;  1Q12 A;  1IBM Q;  2GN5 A;  2H4O A;  1R9T H;  2R7Z G;  3OOC A;  3D4W A;  3I4O A;  1I4P A;  4B3M Q;  4MTK A;  3GV6 A;  3SK5 A;  3MHB A;  4JOI C;  3R93 A;  3U9O A;  4LUZ A;  4HCE A;  2VQF Q;  2VS1 A;  1SYF A;  3AYH B;  4A3J B;  3E5S A;  1R4Q B;  1STG A;  4R4O A;  3C46 A;  4BBS B;  4LNQ A;  1PYB A;  1LT6 D;  1HR0 Q;  4ID6 A;  5M3F G;  4HSV A;  3L3O C;  1QVG A;  1U4P A;  3E9I A;  3AFP A;  2VB2 X;  2YYZ A;  4WRD A;  2K01 A;  4DK1 A;  1Q3L A;  2JK8 A;  2KVM A;  3AFQ A;  3S2H H;  1X3P A;  4NDX A;  1PFM A;  3TS2 A;  3PUY A;  1LT4 D;  2PPB C;  2Q2T A;  2F0E A;  1LO5 D;  2K05 A;  2EYO A;  2B29 A;  2DN8 A;  5C3X A;  3ER0 A;  4O0A A;  1XTD A;  5LMN L;  2G9D A;  4AYB G;  3H15 A;  3BS1 A;  1D6E C;  4J1M A;  4OEL B;  3KF6 B;  5IGD A;  1BDO A;  1CK1 A;  2F0K A;  3LX0 A;  2WIN B;  2EVB A;  4DV5 L;  4DR1 L;  2XN9 C;  4LAA A;  4ALP A;  1KAB A;  1VQD A;  3CKI B;  3I55 A;  1MHW C;  1VQ4 A;  2HD3 A;  3B6Y A;  5C44 G;  3NQT A;  1VQF A;  4A3M G;  1PH1 A;  1X65 A;  1MSG A;  2KA7 A;  1AZQ A;  1PYS B;  3GTL B;  3CQZ B;  3I7F A;  5C0X I;  4A3I B;  3MA2 B;  2SOB A;  2ZXR A;  5C3E H;  2F0I A;  3M4P A;  5CR3 A;  1XX8 A;  1S5E D;  1XXG A;  2MO1 A;  1PDQ A;  3AB9 A;  2EJG C;  2EY2 A;  2EQS A;  3BU2 A;  3MEF A;  4GZY C;  4I7A A;  5D65 A;  5IP9 G;  1XMQ Q;  1ILP A;  4N8F A;  4F8M A;  5IYC H;  2B63 H;  5IE8 A;  3I91 A;  1EY7 A;  3NBH A;  1XYI A;  1EY6 A;  2SNS A;  4GLA C;  5KIX A;  2D9U A;  4ZYS A;  3QJY A;  5JOB A;  2RDG A;  2YTY A;  1UE1 A;  4H44 C;  1JQY D;  3UDI A;  1GVP A;  1CKM A;  4R8I A;  2CH4 A;  4HJA A;  1SJH D;  3GTQ H;  1E3P A;  4DR6 L;  5KYL A;  3CCJ A;  4GOP C;  1Z6H A;  1EY4 A;  2FXQ A;  3A74 A;  5IOD A;  1N33 Q;  3OWF A;  5I2Y A;  2CW0 C;  1JE4 A;  3RZD B;  1MKH A;  4ZRZ A;  3OTO L;  1IXR A;  3OWE B;  2NTT A;  4MNO A;  3K80 C;  5IY0 A;  1TII D;  2UXD L;  3OMC A;  1BF4 A;  2M9V A;  5A35 A;  1X54 A;  1OXU A;  4AH6 A;  3ITP A;  1XNR L;  2F0S A;  1WI5 A;  2EDG A;  2R7F A;  3A54 A;  3CCU A;  1K3R A;  1EU3 A;  1O7L A;  1SYD A;  2NVY H;  5ELC A;  3SHL A;  1EWH A;  1EYA A;  2F4V Q;  4CHT B;  1TWF B;  4IFD H;  3A7A B;  3SK4 A;  4QF4 A;  3HOV H;  3Q6S A;  2XNA C;  3W1B A;  2K4K A;  5EJW A;  2EYF A;  3HOY H;  4LW1 A;  2Z6K C;  3TS0 A;  3NBH B;  1EIH A;  1FNU A;  1G6Z A;  1Y8P B;  4DR7 Q;  4HN7 A;  4YWK A;  4BBR B;  1NUC A;  1RKN A;  3S1M H;  1DOK A;  3TP6 A;  3MFY A;  2F0T A;  1K73 C;  5KYI A;  3PIP A;  4X3U A;  5FO9 B;  2OTJ A;  5EBC A;  5BR8 L;  1LTA D;  2RCN A;  5KNC A;  2KEC A;  1UEA B;  3R8B A;  2NZ1 D;  4NKL A;  4DPG A;  5A2Q E;  4DV3 Q;  4JYA Q;  2UXB L;  4LWC A;  2EXZ A;  1Z47 A;  5L37 A;  2JA5 G;  4A3G B;  1H95 A;  2PZW A;  2B8F A;  3M85 A;  2NVT H;  4I65 A;  2L12 A;  5H1S E;  1SRU A;  2UU9 L;  4HIO A;  2M00 A;  1PVO A;  1SNQ A;  2OTL A;  1FNW A;  3GTM B;  4DK0 A;  2NTS A;  3TN2 A;  4DNI A;  2F0D A;  4DV2 L;  1P16 A;  3DM3 A;  5ELO A;  1IYU A;  2R92 B;  3IFD A;  1VQI A;  4DAY A;  4AQY Q;  3J81 j;  4P2C B;  1E24 A;  5JJZ A;  2N3S A;  3EVQ A;  3PO3 B;  2J7Z A;  1PH6 A;  4KHP Q;  4A3F G;  1EY8 A;  3OPO A;  1TS3 A;  5NUC A;  4PV1 C;  3STB D;  1HZC A;  4DUY Q;  1WD1 A;  3K5L A;  3HRZ C;  2JA8 B;  2VZA A;  1LT3 D;  4IOC A;  1SJE D;  2JA9 A;  4TQU S;  1D5M C;  3S2D H;  2ZXO A;  2JA7 G;  2G5D A;  1S40 A;  4DN4 M;  1EOV A;  1LT5 D;  1YJ9 A;  3DHQ A;  2PMZ E;  1R9T B;  5I2X A;  3DEP A;  1SYC A;  2ZJQ A;  1EFI D;  3BVG A;  3D0F A;  1B8A A;  3KLR A;  3QB3 A;  5ELB A;  1STY A;  3H0G G;  5M5X H;  1H9S A;  4UY8 C;  4GN3 B;  4BWG B;  5LMU L;  2QA4 A;  1WTR A;  4L5R C;  1SN8 A;  4FYD A;  3FPP A;  4K0K Q;  4C3I H;  2Q8R E;  1IYJ B;  3NXW A;  4B3S L;  2YU9 H;  3ZJY C;  2CH4 W;  2VUM G;  1QNK A;  1JCK B;  3BG3 A;  2EY5 A;  4FP5 D;  3SEB A;  4UPA A;  5ELE A;  1SBB B;  3VR3 A;  3T51 B;  4OEM B;  3A7L A;  3S2H B;  1B9N A;  1D1I A;  4RGN A;  1JJC B;  1ZYR D;  4B9X A;  1J9O A;  1HNZ Q;  5FLX L;  3KLW A;  4DKA C;  1I94 Q;  3FPU B;  4DAY B;  4A3D G;  1X3G A;  3AU7 A;  4IUP A;  3SK6 A;  1NR2 A;  4BY7 B;  3J81 i;  3T1H L;  5GQO A;  3MZ5 A;  1B3A A;  1HZA A;  2O5J C;  4OX9 Q;  3TZU A;  2FMM A;  2Y0S E;  4FXG C;  4RGT A;  4LF8 Q;  4UDU C;  2WFW A;  3JAM L;  2LMC B;  1X55 A;  1HUN A;  1ET6 A;  1U4L A;  1GO3 E;  4LF4 L;  4CKC A;  2HQL A;  3K0X A;  4OWX B;  1HCZ A;  2AWO A;  2EPB A;  1HFN A;  2SDF A;  4OGQ C;  5C3E B;  2E5L L;  4A3K H;  1AZP A;  4DV1 L;  3PGZ A;  2OXP A;  3D3R A;  4P74 A;  3UE0 A;  5ELF A;  1PTO C;  3S1Q H;  3PO2 G;  1H9S B;  1IHZ A;  1CZW A;  1DD2 A;  2B63 B;  1QUQ A;  1I4R A;  2JSO A;  1E7Z A;  5AJ3 Q;  4ME5 A;  3RMH A;  5C4Z A;  2QKI C;  3CP0 A;  5I6W A;  1NTG A;  5D3D A;  1C4Q A;  4R4T A;  5I9O A;  3ERO A;  3NHH A;  4X65 L;  4GS3 A;  2Z9H A;  3HOW H;  2OCE A;  4NXN Q;  2L4N A;  3K5N A;  1LTT D;  1FJG L;  3J81 c;  2IT1 A;  5K36 G;  3GTQ B;  1IBL L;  4QUF A;  4XQN A;  3PUW A;  1LTI D;  4IFD I;  1PZK D;  2WAQ B;  4A75 A;  3D4R A;  2RKS A;  3CC7 A;  2KHJ A;  3Q23 A;  3K81 C;  2HHH Q;  2AQ1 B;  4JW0 A;  3SR1 A;  2E75 C;  1N9W A;  4Z9C B;  5KGU A;  1A6X A;  3I4N H;  5E3F A;  4N9P A;  1IBL Q;  1SSO A;  1ILQ A;  1QE6 A;  3HFZ B;  1SE3 A;  2F0J A;  2AUJ D;  4DR2 Q;  5IWA L;  2H5X A;  1KRS A;  1LTR D;  3VR6 A;  4HR7 B;  1AH9 A;  4O2D A;  2LXK A;  1H9J A;  5M5Y H;  3A8I E;  2NVY B;  2L11 A;  5EPK A;  1HHV A;  3CRK C;  1AP0 A;  4H02 A;  3KJO A;  3EJI A;  3HOV B;  4XQJ A;  2JEA I;  1RF2 D;  4DV0 Q;  3HOY B;  1QUQ B;  2Z4I A;  1KC8 C;  1B53 A;  4YWM A;  2IHE A;  3PSI A;  3CF5 A;  4TKO B;  4A3E G;  1SDF A;  2C5C A;  5J1Z A;  3GQB A;  4A3B G;  1BBW A;  2VL6 A;  5CV7 A;  4DK6 C;  2A6H C;  1AW7 A;  4YHH L;  2JA6 H;  3S1M B;  2EYP A;  3HP3 A;  4JI4 L;  1QNU A;  3L2P A;  2WAC A;  1TKW B;  4PMB A;  1LAB A;  5JEA J;  5C0X J;  3I2Z A;  2R7Z H;  5JEA H;  5C0X H;  3DLL A;  3QR8 A;  1Y1V G;  2JYO A;  1A15 A;  1VQN A;  3DUZ A;  1OXX K;  1CQF A;  4DK3 C;  2A1A A;  5CBE E;  4YIJ A;  1F2M A;  1PRT D;  3MEH A;  4JI1 Q;  2K5V A;  3T53 B;  2NVT B;  4JI4 Q;  4YY3 L;  4B3R L;  2EE1 A;  1WVL A;  1BCP C;  3DEO A;  5JPN C;  2WKD A;  1NBW A;  2PW5 A;  2KOL A;  5M3F H;  1WFQ A;  3JAM i;  2F0O A;  4QMG A;  3I56 A;  5CYU A;  3NSW A;  2DJG C;  1B2T A;  1HA5 A;  2F1M A;  5ELN A;  4JI0 Q;  5I9P A;  1K9M C;  2FIN B;  3HOX G;  5C3W A;  3GO5 A;  4GN4 B;  2OEO A;  2AQ2 B;  1VQO A;  4KN7 C;  1C7Y A;  3J7A V;  1MBY A;  1A3U A;  2E8G A;  1U4R A;  1LAC A;  3S2D B;  4DV4 Q;  2SNM A;  4CJ1 B;  3LGJ A;  3JC6 6;  4LF9 L;  1PZJ D;  3S1R H;  1HNX Q;  5FLX c;  1VQG A;  1YJN A;  2IX3 A;  3QOL A;  4NP5 A;  3DMU A;  4A3M H;  5E4X A;  2B2V C;  4LFB Q;  4MZ9 A;  5M5X B;  1R4P B;  1SMY D;  1WCM H;  1PRT B;  1DZ1 A;  2IHF A;  3VR5 A;  4DF7 A;  3NE5 B;  2D5D A;  1SE4 A;  2ZT9 C;  4KK7 A;  2AUK A;  2UUB L;  4X3T A;  4KHV A;  5IYD G;  4C3H H;  4C3I B;  1X56 A;  4GLX A;  3I73 A;  1XPR A;  4JI5 Q;  1HFG A;  4KY6 A;  5IP7 G;  3SVM A;  3ONA B;  2I46 A;  2RHQ B;  2YU9 B;  3JAM c;  3TQY A;  4ZKB B;  1WTH A;  1B70 B;  1FR3 A;  4GOP A;  4JV5 Q;  1CM9 A;  3DM1 A;  3K7U C;  4FVM A;  3GTK H;  3BJU A;  4EQP A;  5CMD A;  1N36 Q;  2NUC A;  4UP8 A;  1VMC A;  3CW2 C;  5M5W H;  3W2D A;  2UXC Q;  3NUC A;  1SYG A;  1CT1 D;  2F0W A;  2KQ3 A;  4R8N A;  3K5M A;  2K32 A;  1SRO A;  4PMW A;  4X66 Q;  1K0S A;  1EIY B;  4JVZ A;  3CPF A;  2D2C C;  3PIO A;  2LS0 1;  4B3M L;  4PG3 A;  5HGQ A;  3A8J E;  4C2M H;  4XXE A;  2HIX A;  2XSC A;  1WTX A;  3M7N A;  3IFT A;  2VQF L;  1MI2 A;  1BXT A;  5J3B A;  3J80 i;  4B3T Q;  4G57 A;  2F3I A;  1EUJ A;  3PIO 3;  1IW7 C;  5EBD A;  3S15 B;  2ZJP A;  1HR0 L;  1UE7 A;  2CQO A;  1VQ5 A;  3SK8 A;  4HED A;  4OWW B;  2A6E D;  1Q82 C;  2I5H A;  1TWC H;  2H1E A;  3C2P A;  2NB0 A;  1E0B A;  3WOF A;  3T1Y Q;  4A3K B;  1I6V C;  4IQZ A;  3KYH C;  3S1Q B;  1FNV A;  4GKK Q;  3P75 A;  2IL8 A;  1T5X D;  2BDO A;  4X3S A;  4WJW A;  2NN6 G;  5IT9 E;  2E2J H;  1ENF A;  4QUC A;  2EOT A;  1D1K A;  1P8L A;  1STA A;  1X6O A;  1BVS A;  1NAP A;  3NEM A;  3S16 H;  2RDF A;  2WB1 E;  5FOB B;  3G48 A;  3HOW B;  2FFK B;  3K0Y A;  4RAU C;  2PW7 A;  3A56 A;  3OMG A;  5DM7 3;  2JJQ A;  3W5O A;  1GUS A;  3BDC A;  2K50 A;  1TWH B;  2A68 D;  1F9R A;  1KDA A;  3PF5 A;  1YNX A;  4C3J G;  1OO9 B;  3CHB D;  1S4Z A;  2PO4 A;  3J80 c;  2TMP A;  3G6E A;  1B3Q A;  3RUZ A;  4X64 Q;  2RDH A;  1IKL A;  2QEX A;  1TR5 A;  1PFB A;  5CV9 A;  2D0P A;  4JI8 Q;  3I4N B;  2OWO A;  2BE5 D;  1NJI C;  1HXY D;  4HCS A;  2DY8 A;  5IOC A;  1XMQ L;  1HUM A;  4X62 Q;  4DAM A;  5FO8 B;  3WDN A;  1JE5 A;  1JIC A;  1K83 H;  4ZLT F;  5M5Y B;  3NTH A;  5CC4 A;  2LY7 A;  5CV8 A;  3M3Y H;  4ZKC B;  3FRP B;  4K6D A;  3RZO H;  1YHB A;  1HTL D;  2UUA Q;  4JBM A;  2XRQ D;  1HTP A;  1A3T A;  2MGS A;  1KTK A;  4A3F H;  1TY0 A;  1Q7Y C;  2IWH A;  1ET9 A;  4LF6 Q;  1JWM D;  3HOZ G;  1NSN S;  2KCT A;  4OO1 G;  3WOE A;  2JA6 B;  1N33 L;  2Y0S G;  2F3W A;  3NEL A;  1EYC A;  5HY6 A;  3A8K E;  4A3G G;  1TT2 A;  5BN5 A;  2JA7 H;  1OXV A;  3VR2 A;  2R7Z B;  1JC7 A;  2YV5 A;  1ICW A;  1O7Y A;  4LUO A;  4ODG A;  4CDE C;  3HOU G;  1DON A;  2B2T A;  4RGM A;  4K5V A;  4XIG S;  1JJG A;  1J6Q A;  1VCI A;  1YHA A;  2B2U C;  3CPW A;  4V19 0;  1E2V A;  4POG A;  4DR4 Q;  1SR3 A;  1SMX A;  3ND8 A;  1HNW Q;  1PTO F;  5KNB A;  5E4W C;  5M3F B;  3OW7 A;  1S5F D;  2F4V L;  1G51 A;  3E6Z X;  5AFW A;  4A93 G;  2VUM H;  1TQO A;  3S1N H;  2PNR C;  2N8N A;  3P1H A;  2RCF A;  3FKI G;  4NPS A;  3GTO H;  5DAU A;  4P75 A;  1E1T A;  2Q8I B;  5EGT A;  1TS2 A;  3EFX D;  3NK9 A;  4HMI A;  4OON A;  5C4X H;  4BS9 A;  1MSH A;  4DR7 L;  5COR A;  5G3L F;  4IFD J;  3J81 L;  1EYG A;  4K6L A;  1U9R A;  1SNP A;  3RNU A;  3NTI A;  4RCN A;  4AYB B;  3G71 A;  1LM0 A;  4BY1 G;  4ABN A;  1NR4 A;  1M1K C;  2B2W A;  2LKV A;  2IX1 A;  4DV3 L;  4JYA L;  1M8A A;  3SDZ A;  3S1R B;  4ZK9 B;  1X9N A;  4OL7 A;  1VQB A;  5I6Y A;  2P5Z X;  3CCR A;  5LMN W;  3HKZ B;  2MP1 A;  3KFU A;  4A3M B;  2PI2 A;  3GV3 A;  5GAH C;  1IBK Q;  2ATW A;  2CWP A;  1GUW A;  1WCM B;  2HCI A;  4FF4 A;  4R1J A;  3BZK A;  1BOS A;  2Q2H A;  4ULL A;  4J6H A;  4JI7 Q;  5JJI A;  1JB3 A;  2ENB A;  4C3H B;  2F0F A;  2UUC Q;  1L1O A;  2EYJ A;  3PIP 3;  4AQY L;  5G3L D;  3MAQ A;  4BXX G;  1WJJ A;  3PO2 H;  1AN8 A;  3AQQ A;  2VXW A;  4DAP A;  2ICI A;  4NMZ A;  3VR4 A;  3PV0 A;  3AMU A;  4KHP L;  1I50 H;  4IAL A;  2AMC B;  3VYU A;  3K5O A;  2ICE C;  2KCC A;  3N52 A;  4BY7 G;  5C4J H;  4DUY L;  5M5W B;  1IYV A;  2KJX A;  2OQ0 A;  1V43 A;  4R4I A;  3G4S A;  1D8L A;  2F0L A;  2N49 A;  3I4M H;  3D8G A;  2F52 A;  4KKT A;  4UHV A;  3D6W A;  1ENC A;  1H9K A;  3KJP A;  3CME A;  1J5E Q;  4RWS C;  1L2F A;  4DV7 Q;  5K36 H;  4GKJ Q;  3ND9 A;  4C2M B;  5EQ0 A;  2E2H H;  2A5H A;  5C3E G;  4RMF A;  5FK9 C;  2F0G A;  1JR0 D;  4DNR B;  2RF4 A;  4HTH A;  2E2D C;  1QVC A;  4HMJ A;  1STB A;  2JEB I;  1RTN A;  1YVC A;  2B2Y C;  3OIQ A;  5M3M H;  4FXD A;  1SYE A;  1LYL A;  1QZH A;  1PFS A;  4K0K L;  1Q46 A;  5IYC G;  1MJC A;  2B63 G;  1Y8N B;  2MHV A;  4LFA Q;  1TWC B;  1E1O A;  3PUX A;  1BCP F;  4P72 A;  5BN3 A;  1PH3 A;  1CSQ A;  3MXP A;  1B1Z A;  1PLF A;  2CWA A;  3A5U A;  1G2S A;  2DUD A;  1G91 A;  1CI3 M;  2QDL A;  4JBJ A;  2A69 C;  2E2J B;  4DR3 Q;  2GA4 B;  5CV5 A;  2K5Q A;  1HNZ L;  4Y52 H;  4EQN A;  1L1O B;  2A6H D;  3G7L A;  1HZ9 A;  2QGQ A;  4DA2 A;  3J7Y W;  1I94 L;  4KI0 A;  4RGO S;  1GKH A;  1ESF A;  3S16 B;  1SFO H;  2DNE A;  4CDD C;  3H3V C;  1B7Y B;  4JBK A;  2LSS A;  2VNU D;  4DU9 A;  4GNX A;  3GTG H;  1KAW A;  2KCM A;  4A3E H;  3GDE A;  1K3B C;  5COY A;  1ASY A;  4K5X A;  4OX9 L;  4A3B H;  3SE0 A;  4M1U B;  1QWY A;  1Y1W G;  4LF8 L;  3T4A C;  3D4D A;  3BVZ A;  4EVO A;  1BCP D;  1N32 Q;  3QG1 A;  3V96 A;  4V0B A;  5F2D A;  2R93 G;  5J22 A;  4E6I A;  1E2Z A;  3KK7 A;  4JPB W;  3J7Z C;  1BR9 A;  4F87 A;  1PH8 A;  3Q22 A;  1HH2 P;  2HDM A;  5EPJ A;  5JPM C;  3NWS A;  3HOV G;  4JI2 Q;  5HUR A;  2XWB B;  4IUV A;  5AJ3 L;  2NYZ D;  1U4M A;  4KKS A;  4MHE A;  1K83 B;  4KLK A;  1RJT A;  4A3L G;  2DY7 A;  2A8V A;  3NQI A;  4G4K A;  3M3Y B;  3IAY A;  2OT2 A;  4HJ5 A;  3VA7 A;  4QIW B;  3RZO B;  1KLG D;  4NXN L;  2A19 A;  3K58 A;  3X3N A;  4OHJ A;  3HOX H;  3HKS A;  4RG1 A;  4JC0 A;  2K04 A;  1FVI A;  1GHK A;  3PMF A;  1E22 A;  1XPU A;  4R9W A;  2PYK A;  2K75 A;  2K52 A;  3URY A;  4ZCK A;  4JG2 A;  4LF5 Q;  2JP1 A;  2AWN A;  3S24 A;  2VW9 A;  4A3C G;  4O42 A;  1ONL A;  3RLF A;  1HZB A;  2A74 C;  4LF7 Q;  1XMO Q;  4H0L C;  1E2W A;  3H94 A;  2JA7 B;  1N8R C;  4GNX B;  2HHH L;  1XPO A;  3FVQ A;  4PNY A;  2MUY A;  2XGT A;  2QIL A;  2RSN A;  1KRT A;  4JCV E;  1V9P A;  1WD0 A;  2BDN A;  5FLM H;  4PMC A;  5DM6 3;  1TY2 A;  4EQO A;  1SE2 A;  4X3K A;  4DR2 L;  3U4Z A;  4FDB A;  1ASZ A;  3F8T A;  4POF A;  1N34 Q;  3CMA A;  3VDY A;  1B50 A;  1EYD A;  1SNM A;  5C5L A;  5IYD H;  2KHS A;  2QDB A;  4IPC A;  5IP7 H;  1DYQ A;  4EX5 A;  1GOZ A;  4K8J A;  4IPH A;  2VUM B;  3S1N B;  3CCQ A;  4ILW A;  4NB3 A;  1Y69 U;  4DV0 L;  1A2U A;  2VQE Q;  5D3I B;  5TSS A;  2G9H D;  3GTO B;  2WB1 G;  2YTV A;  3P20 A;  2D0O A;  2LFN A;  4LMQ D;  1DOL A;  1C0A A;  3OHX C;  5C4X B;  2X69 A;  1RIP A;  4JI3 Q;  4LFC Q;  3M7G A;  1FGB D;  1VQC A;  3D31 A;  3GD7 A;  3Q24 A;  2DNC A;  1IW7 D;  4JOI A;  4K8I A;  3STB C;  3KLS X;  5BN4 A;  2ZTD A;  1K8A C;  2RHS B;  1V8Q A;  5ISR A;  2FJ2 A;  1A3V A;  5IYB G;  3J80 L;  4J8Q A;  3ERQ A;  1I6H H;  2WII B;  3A5Z B;  4RH6 A;  5EAY A;  5FKA C;  3CRL C; 
#chains in the Genus database with same CATH homology
 5J3B A;  4JI1 L;  3J80 i;  4B3T Q;  1IL2 A;  2F3I A;  1EUJ A;  1MKH A;  3OTO L;  2K5H A;  1IXR A;  1VQ9 A;  4MNO A;  3K80 C;  5IY0 A;  3HKZ E;  5E7N A;  2ZJP A;  1HR0 L;  1S3O A;  1UE7 A;  2CQO A;  3M9B A;  1VQ5 A;  4JI2 L;  3TRZ A;  2UXD L;  5JJL A;  4OWW B;  1Q82 C;  2I5H A;  1TWC H;  1X54 A;  2KBN A;  1OXU A;  4AH6 A;  1PA6 A;  3T1Y Q;  2XTI A;  1XNR L;  2HT1 A;  1Y1V H;  1D7Q A;  4HJ7 A;  1WI5 A;  4YCU A;  2BA1 A;  3KYH C;  2MO0 A;  4IOA A;  5LMU Q;  4GKK Q;  5C4X G;  1S72 A;  2R7F A;  1CKO A;  4JI0 L;  2E2J H;  2NN6 G;  3CCU A;  1K3R A;  3K8A A;  4DUZ Q;  5DLQ E;  2NVY H;  1O7I A;  3OYY A;  4B3S Q;  4IFD G;  3GTJ H;  2F4V Q;  3HOV H;  1P8L A;  1G6P A;  4NXM Q;  3W1B A;  1X6O A;  2K4K A;  1BVS A;  3HOY G;  2PQA B;  3NEM A;  3CAM A;  2ZJR A;  3U58 A;  3HOY H;  3S16 H;  2WB1 E;  4LW1 A;  1NMF A;  2Z6K C;  3TS0 A;  2GVB A;  4LF5 L;  3G48 A;  1GM5 A;  4J15 A;  4QJF A;  3NBH B;  1G29 1;  2R7D A;  4DV4 L;  1EFW A;  2MQH A;  4LF7 L;  1XMO L;  3IRB A;  4EQ5 A;  2JJQ A;  1L0W A;  3W5O A;  4DR7 Q;  4YWK A;  4HJ8 A;  1LUZ A;  1HNX L;  3RZD H;  4MTN A;  1VQK A;  3S1M H;  2K50 A;  2I5L X;  4QL5 A;  4OXP A;  1K73 C;  3PIP A;  1LTL A;  2OTJ A;  3PF5 A;  5BR8 L;  3S15 H;  3T1H Q;  2RCN A;  3RLN A;  4L5T A;  4LFB L;  2WP8 J;  1UEB A;  1YNX A;  3CXC A;  1Q8K A;  2WAQ E;  4DPG A;  3J80 c;  4DV3 Q;  2UXB L;  4JYA Q;  3G6E A;  4LWC A;  3FP9 A;  4C3J H;  4X64 Q;  1NE3 A;  3BZC A;  3ULJ A;  1HJP A;  4HID A;  1VQ7 A;  1Z47 A;  4A3J G;  2JA5 G;  2QEX A;  1H95 A;  1N34 L;  4A3J H;  2D0P A;  3E9H A;  4JI5 L;  4JI8 Q;  2OWO A;  4AIM A;  3M85 A;  2NVT H;  1NJI C;  4BBS G;  4LF4 Q;  5H1S E;  5C44 H;  1SRU A;  2UU9 L;  4BBS H;  1XMQ L;  4HIO A;  3UDX A;  4X62 Q;  1PVO A;  1YI2 A;  4JV5 L;  2PNH A;  4DAM A;  2OTL A;  3CCL A;  2V1C C;  4DNI A;  2PI2 E;  1JE5 A;  4DV2 L;  1AE3 A;  2VQE L;  4DR5 Q;  1N36 L;  4DV1 Q;  2E5L Q;  4JI6 Q;  1K83 H;  3I4M G;  1P16 A;  3DM3 A;  2I5M X;  5ELO A;  3HOW G;  1VQI A;  3RN5 A;  3M3Y H;  2MNA A;  4AQY Q;  2UXC L;  1YIT A;  1OTC A;  3J81 j;  4JI3 L;  4LFC L;  4X66 L;  3CC4 A;  3RZO H;  1YHB A;  1E24 A;  2UUA Q;  1L1O C;  4JBM A;  2N3S A;  4DV6 Q;  1U5K A;  1PH6 A;  4KHP Q;  4A3F G;  1TWH H;  5IP9 H;  3CD6 A;  4A3F H;  2BA0 A;  3STB D;  4APV A;  1HZC A;  4DUY Q;  2AHO B;  2VY3 A;  4R4Q A;  1Q7Y C;  3F1Z A;  4LF6 Q;  3HOZ G;  1A63 A;  2VZA A;  4IOC A;  2JA9 A;  2LXJ A;  4TQU S;  4BA1 I;  2KCT A;  4X65 Q;  4BA2 I;  3HOZ H;  3E0E A;  5M3M G;  4OO1 G;  4WJ3 M;  1N33 L;  2Y0S G;  2NVQ H;  3NEL A;  5HY6 A;  2CCZ A;  2JA7 G;  3S2D H;  3UDG A;  1S40 A;  4A3G G;  1X3F A;  1FJG Q;  4YCW A;  3M4Q A;  4B3T L;  1QVF A;  2JA7 H;  1EOV A;  1OXV A;  1YJ9 A;  3I4N G;  2PMZ E;  1BKB A;  1SLJ A;  4ME3 A;  1Y14 B;  2ZJQ A;  1CSP A;  2YV5 A;  1V1Q A;  2L15 A;  1MIU A;  5GAD C;  4LUO A;  3D0F A;  3HOU G;  1B8A A;  1KQS A;  3HOU H;  3T1Y L;  1PHJ A;  1OXT A;  4XTC S;  3U50 C;  2D62 A;  1KD1 C;  4L5S A;  3GTL H;  3UDF A;  3H0G G;  5M5X H;  1M90 C;  4UY8 C;  4QQB X;  3CQZ H;  4XIG S;  4A3I G;  1JJG A;  1J6Q A;  1VCI A;  4GN3 B;  1FL0 A;  3F2D A;  1YHA A;  3CPW A;  2QA4 A;  5LMU L;  2K5N A;  4A3I H;  1SN8 A;  1Q81 C;  4L5R C;  4QGU A;  4GKK L;  4K0K Q;  3CCS A;  1CKN A;  4POG A;  3AEV A;  1SR3 A;  1SMX A;  4DR4 Q;  4C3I H;  1HNW Q;  4DUZ L;  1WOC A;  1IYJ B;  3WWV A;  4TVA B;  4B3S L;  1YBY A;  4PZ6 A;  2YU9 H;  3OW2 A;  1EWI A;  1XJV A;  3ZJY C;  2KEN A;  2Z6K A;  3MXN B;  2F4V L;  3TEH B;  1PH2 A;  2VUM G;  1G51 A;  4A93 G;  4A76 A;  5IWA Q;  1XNQ Q;  4UPA A;  1UWV A;  4NXM L;  3TRE A;  2VUM H;  3S1N H;  4A93 H;  2N8N A;  3FKI G;  4NPS A;  2ES2 A;  3GTO H;  4GLV B;  4P75 A;  1E1T A;  3FKI H;  1JJC B;  3KDF A;  1HNZ Q;  4QIW E;  3KLW A;  4OON A;  5C4X H;  4DR7 L;  4DKA C;  5GRO A;  1I94 Q;  4IPD A;  4DAY B;  4A3D G;  4IFD J;  1X3G A;  1EYG A;  3J7A 5;  5JEA G;  5C0X G;  4L5Q A;  1VQH A;  5FJ8 G;  3EBE A;  2ZM6 Q;  2DGY A;  3RNU A;  1PH9 A;  1A0I A;  5FJ8 H;  3J81 i;  3G71 A;  3T1H L;  5GQO A;  1LM0 A;  4BY1 G;  1AE2 A;  3A0J A;  1Q86 C;  4GOP B;  1W2B A;  1M1K C;  1HZA A;  2IX1 A;  4WJ4 A;  4BY1 H;  4DV3 L;  4UP9 A;  4JYA L;  3RN2 A;  4OX9 Q;  1X9N A;  4X64 L;  2Y0S E;  4YHH Q;  4IJL A;  3L0O A;  4KHZ A;  4LF8 Q;  4GNX C;  1VQB A;  2NZH A;  2WFW A;  3CCR A;  4JI8 L;  5LMN W;  1X55 A;  2NVX H;  3KFU A;  1EQR A;  1GO3 E;  1QZG A;  2PI2 A;  4LF4 L;  2EXD A;  5GAH C;  2HQL A;  1DGS A;  1IBK Q;  2CWP A;  3K0X A;  2ATW A;  4OWX B;  2AWO A;  3ERS X;  4X62 L;  2ASB A;  4R1J A;  4A3K G;  3BZK A;  2Q2H A;  4OWT B;  3ULL A;  1JJ2 A;  4JI7 Q;  1VQA A;  2E5L L;  5JJI A;  4JI6 L;  4DR5 L;  4A3K H;  4DV1 L;  3PGZ A;  2UUC Q;  1L1O A;  4P74 A;  2MFI A;  1RL2 A;  2C35 B;  3UE0 A;  1JB7 A;  4R4C A;  4YY3 Q;  3S1Q H;  4B3R Q;  1TXY A;  1VQ6 A;  3PO2 G;  3KF8 B;  1EIF A;  4AQY L;  1GD7 A;  2JA5 H;  4BXX G;  1WJJ A;  2KHI A;  2BH8 A;  3PO2 H;  1QUQ A;  3AQQ A;  3EIV A;  4BXX H;  2UUA L;  4DV6 L;  1YHQ A;  1CKN B;  1E7Z A;  5AJ3 Q;  3PV0 A;  4KHP L;  4QY7 A;  1I50 H;  1TWF H;  3CP0 A;  2AMC B;  4BY7 G;  1NTG A;  3W1G A;  4R4T A;  5C4J H;  3CCE A;  3RLO A;  3H3V H;  4DUY L;  2OQK A;  1T9H A;  4BY7 H;  3FHW A;  1KIX A;  2OQ0 A;  3G4S A;  1V43 A;  4R4I A;  4LF6 L;  1D8L A;  4X65 L;  2N49 A;  3I4M H;  2F52 A;  1I5F A;  4GS3 A;  1Q1B A;  3HOW H;  2OCE A;  4NXN Q;  3UE1 A;  3KJP A;  1FJG L;  2YTX A;  4BBR G;  5IT9 c;  3CME A;  3KDF B;  3HKZ G;  3J81 c;  1JT8 A;  2IT1 A;  1J5E Q;  4BBR H;  5K36 G;  5FLM G;  1L2F A;  4DV7 Q;  4P73 A;  2NN6 I;  5LMN Q;  1IBL L;  4GKJ Q;  1WCM G;  1CUK A;  3PUW A;  3CCM A;  4A4I A;  4IFD I;  2E2H H;  4A75 A;  4GN5 A;  4LUV A;  1EQQ A;  3F2C A;  5C3E G;  3CC7 A;  4RMF A;  2KHJ A;  4DV5 Q;  4DR1 Q;  2Q2U A;  2RF4 A;  1KL9 A;  4LF9 Q;  3ULP A;  3K81 C;  3SGI A;  2HHH Q;  1QVC A;  2R6G A;  2JEB I;  5M3M H;  1YVC A;  4UP7 A;  2I0Q A;  1Z9F A;  2ALY B;  2N78 A;  1LYL A;  1QZH A;  1PFS A;  4K0K L;  2BH2 A;  1N9W A;  1NMG A;  4A3G H;  1Q46 A;  5IYC G;  1MJC A;  2B63 G;  4DR4 L;  1HNW L;  4X6A H;  3I4N H;  4LFA Q;  1E1O A;  3PUX A;  1IBL Q;  3HFZ B;  4P72 A;  1PV4 A;  1WYD A;  2GVA A;  4IPG A;  1YZ6 A;  4DR2 Q;  5IWA L;  2H5X A;  1PH3 A;  1XNQ L;  1CSQ A;  1KRS A;  1OXS C;  2IY5 B;  2CWA A;  3A5U A;  3GTM H;  1UE5 A;  4HIK A;  2DUD A;  2UUB Q;  3ICE A;  1AH9 A;  4O2D A;  2LXK A;  4HJ9 A;  4JBJ A;  3H0G H;  1UE6 A;  2R92 G;  3M4O H;  1KXL A;  4DR3 Q;  5M5Y H;  1HR0 W;  2R92 H;  1HNZ L;  1FGU A;  4Y52 H;  4H02 A;  1L1O B;  1U0L A;  2AKW B;  3KJO A;  2CFM A;  1HZ9 A;  2QGQ A;  1YJW A;  3PO3 G;  1I94 L;  4KI0 A;  1IBM L;  2JEA I;  1GKH A;  3PO3 H;  4DV0 Q;  3KF6 A;  1QUQ B;  1SFO H;  2Z0S A;  2Q2I A;  2B3G A;  2ZM6 L;  1KC8 C;  2CKZ B;  1B7Y B;  1MJE A;  4YWM A;  4JBK A;  2LSS A;  2IHE A;  3PSI A;  1I3Q H;  2IX0 A;  4PZ8 A;  3CF5 A;  4A3E G;  2VNU D;  2JA8 G;  4GNX A;  3GTG H;  1KAW A;  2KCM A;  4A3E H;  3GDE A;  1PH5 A;  3H3V I;  1BBW A;  1C9O A;  2VL6 A;  2JA8 H;  3S17 H;  4A3B G;  2JA6 G;  1ASY A;  3Q8D A;  4DK6 C;  2EIF A;  4OX9 L;  1IZ6 A;  4A3B H;  4YHH L;  2JA6 H;  5GAG C;  1SE8 A;  1Y1W G;  1PH4 A;  4JI4 L;  3L2P A;  4LF8 L;  1Q12 A;  1Y1W H;  1IBM Q;  3PUV A;  1N32 Q;  2GN5 A;  1R9T H;  2R7Z G;  5JEA J;  5C0X J;  4A3D H;  3I4O A;  3I2Z A;  2R7Z H;  1IBK L;  4B3M Q;  4DR6 Q;  3DLL A;  1Y1V G;  1VQN A;  2R93 G;  1OXX K;  4JOI C;  4DK3 C;  4JBW A;  2A1A A;  4PZ7 A;  4LUZ A;  2R93 H;  1VQ8 A;  4JI7 L;  4X66 Q;  2VQF Q;  2E2I H;  2VS1 A;  3PF4 A;  3AYH B;  4JI1 Q;  2UUC L;  2K5V A;  3J7Z C;  1KHI A;  3PUZ A;  3OTO Q;  4JI4 Q;  4YY3 L;  1PH8 A;  4B3R L;  1HH2 P;  4R4O A;  1A62 A;  4LNQ A;  1PYB A;  4OO1 I;  3HOV G;  1HR0 Q;  1YIJ A;  4JI2 Q;  1NBW A;  2K14 A;  2UXD Q;  5M3F G;  1VQL A;  1QVG A;  5AJ3 L;  5M3F H;  1WFQ A;  3JAM i;  4Y7N H;  1XNR Q;  3RR5 A;  4HIM A;  1TWA H;  4KLK A;  1PH7 A;  3E9I A;  3AFP A;  3I56 A;  4A3L G;  2A8V A;  2YYZ A;  4A3L H;  5ELN A;  4JI0 Q;  2JK8 A;  4HJ5 A;  1K9M C;  3AFQ A;  3S2H H;  3CCV A;  3L7Z C;  3PUY A;  1TWG H;  4YWL A;  4NXN L;  2A19 A;  3HOX G;  3TS2 A;  2Q2T A;  3HOX H;  3HKS A;  4RG1 A;  4JC0 A;  3GO5 A;  4GN4 B;  3CC2 A;  2B29 A;  1FVI A;  1J5E L;  1VQO A;  5GAE C;  4DV7 L;  3ER0 A;  4O0A A;  1E22 A;  1XTD A;  1C7Y A;  1XPU A;  3PCO B;  5LMN L;  2K75 A;  2K52 A;  4GKJ L;  4AYB G;  3H15 A;  4JG2 A;  4LF5 Q;  2VW9 A;  2AWN A;  2E8G A;  3S24 A;  4A3C G;  3KF6 B;  4DV4 Q;  3RLF A;  1HZB A;  4A3C H;  1VS0 A;  1XMO Q;  4LF7 Q;  1YEZ A;  3LGJ A;  4DV5 L;  4DR1 L;  3JC6 6;  5JJK A;  4ALP A;  4GNX B;  1N8R C;  4LF9 L;  1VQD A;  1XPO A;  3S1R H;  2HHH L;  4IJH A;  3I55 A;  1HNX Q;  5FLX c;  1K0R A;  1VQG A;  1VQ4 A;  1YJN A;  2XGT A;  3B6Y A;  5C44 G;  1KRT A;  4JCV E;  1VQF A;  4A3M G;  4LFA L;  3GTP H;  5BR8 Q;  1V9P A;  1PH1 A;  1W3S A;  1X65 A;  5FLM H;  4A3M H;  4YCV A;  4LFB Q;  1PYS B;  4MZ9 A;  2HIV A;  4P71 A;  1WCM H;  3F2B A;  2UXB Q;  4DR2 L;  3I7F A;  2IHF A;  5C0X I;  3U4Z A;  4FDB A;  2UUB L;  1X3E A;  5C3E H;  1ASZ A;  3M4P A;  3F8T A;  2MO1 A;  4POF A;  5IYD G;  4C3H H;  4GLX A;  1X56 A;  3U4V A;  3CMA A;  4DR3 L;  3VDY A;  1XPR A;  1N34 Q;  4JI5 Q;  5IP7 G;  5IYD H;  2EQS A;  3BU2 A;  2RHQ B;  3MEF A;  3JAM c;  4IPC A;  3TQY A;  5IP7 H;  2UU9 Q;  1B70 B;  4EX5 A;  5IP9 G;  1XMQ Q;  1VQP A;  2PQA A;  5IYC H;  4IPH A;  2B63 H;  5IE8 A;  4GOP A;  4JV5 Q;  3K7U C;  3CCQ A;  3GTK H;  4NB3 A;  4DV0 L;  3BJU A;  1NY4 A;  4DV2 Q;  1VQJ A;  2VQE Q;  1N36 Q;  2WB1 G;  4UP8 A;  2ID0 A;  2NZO A;  3CW2 C;  2YTV A;  2JQO A;  2ZTC A;  4GLA C;  2D0O A;  2JE6 I;  5M5W H;  1C0A A;  2UXC Q;  1RIP A;  1K8G A;  3S14 H;  4JI3 Q;  2YTY A;  4LFC Q;  1SRO A;  1UE1 A;  4PMW A;  1BBU A;  1VQC A;  1VQE A;  3D31 A;  3GD7 A;  3K7A H;  3UDI A;  1JMC A;  1EIY B;  1VQM A;  1GVP A;  1CKM A;  3CPF A;  4JOI A;  4IO9 A;  3STB C;  1N32 L;  4HJA A;  1A8V A;  2ZTD A;  3EN2 A;  3PIO A;  2RHS B;  1K8A C;  3GTQ H;  1E3P A;  4B3M L;  4DR6 L;  1Q1E A;  4PG3 A;  2ZTE A;  3KOJ A;  4AYB E;  5HGQ A;  5IYB G;  2WAQ G;  3CCJ A;  4C2M H;  4GOP C;  2FXQ A;  3A74 A;  5IYB H;  2HIX A;  1N33 Q;  1I6H H;  3NEN A;  3M7N A;  3A5Z B;  2VQF L;  5EAY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...