3M3YH

Rna polymerase ii elongation complex c
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title X-ray structure and mechanism of RNA polymerase II stalled at an antineoplastic monofunctional platinum-DNA adduct.
pubmed doi rcsb
total genus 18
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2010-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3m3yH00
1M90C 2JEBI 1WCMG 1X3GA 2QGQA 3FP9A 5BR8L 1CUKA 2L15A 1EOVA 1X56A 4L5RC 1HR0W 1CKOA 3PUXA 1BVSA 2YTYA 3E0EA 4R4TA 3HKSA 3CPFA 3BJUA 3GO5A 2K50A 1VQOA 2YU9H 3CAMA 4GKKL 1TXYA 2NVQH 4AH6A 2ZJPA 3M4PA 1MJEA 3GTLH 4HJ7A 4OX9Q 1X55A 2LSSA 3KF6B 4P75A 2AWNA 2PI2A 4A3IG 4LF9Q 1PHJA 1AE2A 4Y7NH 2WB1G 2ZTDA 1U0LA 4DR1Q 1VQDA 1Y1WH 2Q2UA 2UXBL 3U58A 2ALYB 2HQLA 3I4MH 2NVYH 4A4IA 4JC0A 1EFWA 4JI0Q 1FGUA 3OYYA 2JA9A 1VQMA 1IBML 3H3VH 1L0WA 2WAQE 2OTLA 3S16H 4YWLA 1IBLQ 1KXLA 1QZGA 1Y1VG 4LF7L 2VL6A 1Q81C 1KIXA 4BA1I 3HKZE 4QIWE 4POGA 1KL9A 4P72A 2N3SA 4GKJL 4IFDI 2F3IA 5E7NA 2CWAA 4JCVE 1XMQQ 5LMUQ 3H15A 4DKAC 5C44H 1K9MC 4NB3A 4A3BH 3CCUA 2E8GA 4LF6L 4DAMA 1YHQA 1L2FA 2UUCL 3J80c 5M3FG 4DPGA 1HZBA 3AFQA 3JAMc 5FLMH 1K83H 3KDFB 1VQLA 2VY3A 4HJAA 4RMFA 1HH2P 3OTOQ 3KF6A 2JA8G 1VQ6A 3GTPH 3TS2A 2IY5B 3W1BA 2YTXA 4X62L 1Q8KA 4A76A 4OWXB 3TQYA 3J7A5 2Q2HA 5K36G 5ELNA 1U5KA 2BA1A 4DUYL 1J5EL 1IBKQ 3NBHB 4AQYL 1W3SA 3H0GG 3VDYA 5JJIA 3RZOH 1MJCA 4DR4L 3J81c 1O7IA 3S1QH 4P74A 3FKIG 2R93G 3EBEA 4DR5L 5HGQA 2MFIA 1EYGA 2NVXH 2JA7H 1QZHA 1JE5A 2Y0SG 1YEZA 2R7ZH 3D31A 4B3RQ 3GDEA 4JYAQ 4YWKA 2VQFL 3G48A 2ZTEA 4OXPA 4R4QA 5IWAL 4LF8L 3PF4A 5FJ8H 1EQQA 3PO2G 4JV5Q 4BA2I 4QL5A 4HIMA 2EXDA 5JEAG 2JA5G 4DK6C 3KDFA 1CKNB 4JBWA 3D0FA 1HJPA 3HOZG 2R6GA 2WFWA 4NXML 1D7QA 1S40A 1JJ2A 2MO1A 1HR0Q 1LUZA 2ZM6L 1P8LA 3STBD 1XPUA 5DLQE 4JOIA 1PH5A 2CCZA 5C4XH 2DUDA 4A3JH 3AQQA 2JE6I 1X9NA 4L5QA 4A3MH 3H3VI 1GO3E 1QVFA 2UXBQ 1PH9A 1VQ8A 1UE1A 4GOPA 3M4OH 1IBMQ 4IPDA 1E3PA 5C3EG 5IE8A 2GVAA 4LW1A 3PO3H 2IHEA 4A3KH 4A3GH 2UXDL 2B3GA 2CQOA 3GTQH 2N8NA 4DR1L 5LMNL 3M9BA 4JI6L 4LUZA 3CC4A 4C3JH 4JI0L 1CKNA 3PF5A 1C7YA 4LF6Q 4L5TA 4DV0L 1I3QH 2CFMA 1A0IA 2I5HA 2K14A 5M5XH 2K4KA 1Q86C 2NZOA 4HIDA 2Y0SE 2AKWB 1FJGL 3PIOA 2AHOB 4BBRG 3F2BA 2YTVA 4JG2A 1N33L 1XJVA 2R7FA 4B3TL 4L5SA 1J5EQ 4DUYQ 3K0XA 1N32Q 4GNXB 3U50C 2OWOA 4A3BG 2Q2IA 3DM3A 4DR4Q 2E2IH 4A3EH 1XNRQ 1SROA 5M5WH 3OTOL 1YNXA 5C0XJ 3HKZG 2AMCB 5FLMG 4DR5Q 5H1SE 1VQBA 1Y14B 2IX0A 2RCNA 4QJFA 3F2DA 1I5FA 4R1JA 2IT1A 4GN5A 3J80i 1IL2A 4PG3A 2V1CC 4PZ8A 1L1OB 3ULLA 4YHHL 3JAMi 2VQFQ 1BBUA 4APVA 1IBKL 4JI4Q 4DV1Q 1ASZA 4HJ8A 2B63G 2KCMA 1G51A 4DV7L 1C0AA 2ZTCA 3UE1A 4JOIC 3DLLA 1BBWA 3KOJA 4ME3A 3CMEA 1XMOL 5HY6A 1IXRA 1MIUA 2GVBA 4POFA 5AJ3L 4BY7H 2YV5A 1TWGH 1G6PA 2K5NA 2HIXA 2ID0A 4TVAB 2R7ZG 2ZM6Q 3J81i 1QUQB 3ICEA 4JV5L 2R7DA 4GNXA 3S15H 2JQOA 4X65L 4MTNA 2OCEA 4A3LH 3HOXH 1MKHA 1VCIA 5M3MH 3I56A 4AIMA 4IPHA 4O0AA 1SLJA 4DV2Q 1KRSA 1E7ZA 1EIYB 5GADC 1HR0L 2VNUD 4DK3C 1HNZL 1L1OA 4DR2Q 2JEAI 3HOUH 1HNXL 4BXXH 4IPGA 5C4JH 4LFCL 5C4XG 5LMNQ 3OW2A 4A3JG 1E22A 4JI6Q 4A3MG 1VQAA 4IJHA 1OXSC 4ALPA 2R92G 1UWVA 1PH8A 4DV0Q 2KHJA 3E9HA 5IYCH 1K0RA 2OQKA 4WJ4A 1QUQA 3HFZB 3PUZA 1OXUA 2N78A 4GS3A 1SFOH 2UUBQ 5IYDG 5IP7H 1FJGQ 3PO3G 4A3KG 4A93H 5IYBH 2K75A 3CP0A 2E2JH 2VW9A 1N33Q 3RR5A 4B3TQ 5C0XI 1T9HA 4J15A 2MQHA 3BU2A 3LGJA 4GLXA 1RL2A 3PCOB 3CPWA 3TRZA 2AWOA 4KLKA 3KF8B 5GAGC 2BH2A 3S17H 4IPCA 1VQHA 2D0PA 2UXDQ 1B7YB 3AEVA 3F1ZA 3I7FA 2KCTA 3ULPA 3CCJA 2EIFA 2PNHA 2D0OA 2H5XA 3ER0A 4LUOA 2K5HA 3UDXA 2HT1A 2E2HH 3PV0A 1X3EA 4YHHQ 3I4OA 3UDGA 2JA6H 1GM5A 4NXNQ 1X3FA 1TWFH 1PYSB 4IFDG 1S3OA 4DV7Q 1HZAA 1XNRL 3CQZH 3IRBA 4GNXC 2NZHA 1XMOQ 4A3EG 1N34L 3HOYH 3UE0A 5AJ3Q 3Q8DA 4YCUA 2F4VL 5JJKA 2A19A 2PQAB 1V1QA 4JI4L 1YHAA 4NPSA 2OTJA 4UPAA 4OWTB 4DV1L 4A3DG 1OXVA 4BBSG 1L1OC 4X65Q 1CSQA 3T1YL 5IY0A 1X54A 1TWCH 4A3CH 1N36L 3F2CA 1KC8C 4QY7A 5ELOA 1VQFA 3CCVA 1EQRA 3S1NH 4BY7G 4HJ9A 1HNZQ 1CSPA 4YCWA 4JBKA 1PFSA 2UU9L 1K8AC 3CD6A 3A5ZB 1PH4A 1UE6A 2OQ0A 4X66Q 1HNXQ 4PZ6A 2I5MX 2N49A 3PUYA 4LFCQ 1VQEA 1SE8A 3RN2A 1YITA 4A3LG 1WCMH 4DV2L 1VQ9A 2FXQA 3HOVH 3TEHB 4DR2L 2PQAA 1KRTA 3UDFA 1YJNA 4JI5Q 2MNAA 3T1HL 3S24A 1JMCA 4YY3Q 3HOUG 2NN6I 4BXXG 2KENA 4JI7L 3KFUA 1Y1WG 1EUJA 3AFPA 4EQ5A 4JBJA 3I4MG 3TS0A 1I50H 1NE3A 4C3HH 2A1AA 3CC7A 1NJIC 4DR6Q 3GTJH 4AYBE 2UUBL 2RF4A 1XNQL 2UXCL 4X6AH 2E5LL 1KHIA 1SN8A 2LXKA 4KHZA 5IP7G 4DR3Q 3PGZA 5IYBG 1FVIA 3FHWA 2HIVA 1RIPA 1DGSA 3KJOA 5IP9H 2Z0SA 5C44G 4R4OA 2HHHL 4JI3Q 4MZ9A 4DAYB 3CF5A 2NN6G 1YJ9A 1A63A 1UEBA 2VZAA 3PUVA 1XPRA 3M7NA 1N34Q 5JJLA 1G291 1Q46A 4YCVA 5M3FH 4DR6L 3PIPA 1PA6A 3EIVA 1J6QA 3I55A 4OONA 5IT9c 3K7UC 2Q2TA 4NXNL 3CCSA 3M85A 1XPOA 3CXCA 1VQ7A 3CW2C 4LFBL 2JA6G 3T1YQ 1JB7A 3GD7A 4DUZQ 1N36Q 2D62A 3NENA 4O2DA 3L7ZC 1HNWQ 2ZJRA 3HOYG 2PI2E 2JA7G 4KI0A 1OTCA 4LNQA 3FKIH 2DGYA 2Z6KC 2UU9Q 2IX1A 1OXXK 5FJ8G 2VUMH 4FDBA 1HZCA 1NY4A 1QVCA 5GAHC 4LF5Q 3G4SA 4LF4Q 3PO2H 4PMWA 4JI1Q 1NBWA 4B3ML 1A8VA 1IZ6A 3BZKA 3E9IA 3PUWA 4EX5A 2VQEL 3HOZH 4X66L 5GROA 3T1HQ 4JI7Q 1NMFA 2GN5A 4XTCS 2KHIA 4TQUS 5M5YH 3L2PA 3CC2A 3B6YA 1B70B 1YIJA 3CCRA 3J81j 3HOVG 1LM0A 4JI5L 3UDIA 2A8VA 3K8AA 1XNQQ 1K3RA 2UXCQ 2I0QA 4A3GG 5C3EH 2E5LQ 2KBNA 4YY3L 4P73A 1PH1A 1YHBA 1YZ6A 4A3FH 1ASYA 3RLNA 3F8TA 3RN5A 1JJGA 2IHFA 4DV3L 4QGUA 4DNIA 5J3BA 4X64L 1WI5A 2F4VQ 2YYZA 3KLWA 2HHHQ 3MEFA 2EQSA 1K73C 1YI2A 1XTDA 1VQJA 3G71A 1NMGA 1WJJA 3KJPA 3K7AH 3S1RH 1YJWA 1I94L 4DR3L 4K0KL 2PMZE 1A62A 2LXJA 1VQGA 3M4QA 1PV4A 1PYBA 4RG1A 1PH7A 3EN2A 5GAEC 4DV6Q 3J7ZC 1VQKA 4BY1H 3M3YH 1VS0A 1UE5A 4BBRH 1SMXA 4A75A 4JI3L 1TWAH 4LFBQ 1GKHA 1TWHH 5IP9G 5FLXc 1Q1EA 1LYLA 1EWIA 1VQCA 4DV4L 3HOWH 5C0XG 3CCMA 4KHPQ 4AYBG 1AH9A 3SGIA 1E24A 2XGTA 1UE7A 3ERSX 1GD7A 2QA4A 3GTKH 3S1MH 4YWMA 2CKZB 2QEXA 2WP8J 1HZ9A 1C9OA 2ES2A 3A5UA 1GVPA 4JI8L 3GTGH 4B3SL 1VQ5A 4R4IA 4WJ3M 4UP7A 4DUZL 3JC66 1B8AA 4DV5Q 2B63H 1KAWA 1EIFA 2B29A 3A74A 3KYHC 1HNWL 1PH6A 1PH3A 4B3MQ 1NTGA 3CMAA 1N9WA 2I5LX 1FL0A 2VQEQ 4PZ7A 3RZDH 1AE3A 1VQ4A 1VQPA 4LFAQ 3A0JA 4GOPB 2ASBA 4JI2L 3I4NH 3GTMH 4LF5L 4UP9A 4LF4L 2VUMG 4GN4B 4QQBX 3K81C 4JI1L 3CCLA 3HOXG 1E1OA 2Z6KA 5M3MG 1PVOA 2WB1E 2MO0A 4DR7L 1KD1C 1Q1BA 5BR8Q 1JJCB 1WYDA 3RLFA 4XIGS 4MNOA 1X65A 4GKKQ 4Y52H 4OWWB 2UUAL 1E1TA 4DV3Q 4A3IH 1Q7YC 3I2ZA 4X64Q 2NVTH 1CKMA 1OXTA 3RNUA 1N8RC 3GTOH 1SRUA 4P71A 1VQIA 3BZCA 4UP8A 1V43A 4GN3B 5IYCG 3CCEA 2R92H 3W5OA 1KQSA 4LWCA 1I94Q 2ATWA 4K0KQ 1P16A 1Y1VH 4A93G 4C3IH 4GLVB 3U4ZA 2C35B 4LF7Q 4OX9L 5LMNW 4A3FG 4HIKA 3S2DH 5IYDH 2ZJQA 4LF9L 4OO1G 4GKJQ 4DV4Q 1I6HH 2JK8A 3NEMA 3S14H 4IJLA 4HIOA 1WFQA 1JT8A 2BA0A 1SR3A 3CCQA 1Q12A 1IBLL 4C2MH 2UUCQ 4OO1I 4DV6L 2JA8H 1WOCA 3ZJYC 3MXNB 4BY1G 1YBYA 1IYJB 1Z47A 4JI8Q 4B3SQ 1S72A 4IOAA 1N32L 4X62Q 4KHPL 2JJQA 3G6EA 1XMQL 5LMUL 2BH8A 3H0GH 1VQNA 2K5VA 3HOWG 1X6OA 3ULJA 4HJ5A 3WWVA 1K8GA 4JBMA 4R4CA 4AQYQ 1R9TH 4UY8C 1YVCA 2WAQG 2R93H 2VS1A 4IFDJ 1D8LA 2RHSB 1LTLA 4IOCA 1BKBA 3K80C 4LUVA 3W1GA 3PSIA 3TREA 1PH2A 4JI2Q 5EAYA 4DV5L 4H02A 4IO9A 4A3DH 3AYHB 4GLAC 5GQOA 4BBSH 4A3CG 1Q82C 1Z9FA 3L0OA 3U4VA 5IWAQ 4LF8Q 2JA5H 4DR7Q 2RHQB 3NELA 5JEAJ 2CWPA 4LFAL 3S2HH 1W2BA 2K52A 2XTIA 4NXMQ 1QVGA 1M1KC 4B3RL 1H95A 4JYAL 3RLOA 3I4NG 1V9PA 2UUAQ 2F52A 4GOPC 3STBC
chains in the Genus database with same CATH superfamily
1ICWA 2JEBI 5CBEE 2B8FA 2QGQA 3K5NA 5BR8L 1IL8A 3I73A 1X56A 2KA7A 2YTYA 3ONAB 2EYPA 3E0EA 3HKSA 3I8ZA 3GP7A 2G9DA 4OX9Q 2UXDQ 2AWNA 4JVZA 5LL6S 4KD3A 2K6AA 2UXBL 2ALYB 3OHXC 2NVYH 1CQFA 1EU3A 1EFWA 1IBML 2G9HD 3EFXD 3S16H 1KXLA 4YWLA 1X32A 2VL6A 1Q81C 2CH4W 4BY1B 4QIWE 1S5FD 1TWFB 2N3SA 1IW7D 4FXDA 2F3IA 5E7NA 1XMQQ 1K9MC 2E8GA 2EDGA 1L2FA 5E1FA 2UUCL 5M3FG 4RGMA 1CFMA 4DPGA 1T5XD 1VQLA 2VY3A 4RMFA 1HH2P 2IY5B 1RCVD 2HDMA 3SR1A 3AB9A 4OWXB 5K36G 1F9QA 2F0PA 5ELNA 1U5KA 2K01A 1IBKQ 3H0GG 3TZUA 3S1NB 3VDYA 1B53A 5JJIA 3T13A 1I4GA 3P1HA 3S1QH 1MI2A 2MGSA 4UDUC 5E4WC 2R93G 5D65A 1B9NA 1JE5A 3A56A 3D31A 3I90A 1A3UA 4B3RQ 3N52A 4R4QA 3NP8A 3NK9A 2EXDA 4L63B 5JEAG 5BN4A 1CKNB 1LABA 5KGUA 1EYDA 2R6GA 4NXML 1D7QA 1S40A 2MO1A 2X6GA 3M4YA 1DCZA 5EBDA 2NVTB 2DUDA 1EYAA 2F3WA 2CVRA 4L5QA 1X9NA 2F03A 1GO3E 3L3OC 3A8IE 2PZTA 4IPDA 1E3PA 1YNJC 1S5BD 5C3EG 4C3IB 1IKMA 4CJ1B 1II3A 3DWPA 4A3GH 4B9WA 5DM73 1LV9A 5LMNL 3M9BA 4JI6L 1CKNA 4ZQ3A 3VA5A 1KLGD 3W2DA 4QF4A 4L5TA 1BOSA 2JA8B 2E2DC 1A0IA 2K14A 5M5XH 2K4KA 5CYUA 3VYTA 1QCBD 2YTVA 3IFTA 2KVMA 4GNXB 2KCNA 4A3BG 1IYVA 2RVLA 3FKIB 4DR4Q 3LWEA 3OTOL 1YNXA 1JC7A 1Y14B 2IX0A 2XNAC 4R1JA 3BG3A 1C48A 2V1CC 3ULLA 1SNQA 1ASZA 2A69C 1RD9D 2ZTCA 3HOZB 1Y69U 2C9OA 3OIPA 1G91A 1IXRA 4POFA 1Q90A 1JOQA 1H9RA 2YV5A 2XSCA 2HIXA 2R7ZG 5M5YB 4LJZC 1DONA 4GNXA 2JQOA 4FNFA 2F0WA 3HOXH 1MKHA 1I4RA 2EY5A 1MBYA 4ABNA 4O0AA 1SLJA 4R9WA 1HNZL 4DR2Q 2JEAI 1GUWA 1WD1A 4BXXH 1AEXA 4LFCL 3VYUA 5C4XG 1NR2A 1OO9B 4IJHA 2R92G 1UWVA 1YNJD 4IUNA 1PH8A 3M3YB 2EYMA 1OXUA 1FJGQ 3T51B 4A3KG 4RGNA 2VW9A 1N33Q 1G6ZA 3S1MB 2DNEA 1L0XB 2MQHA 4C3JG 2WAQB 2AWOA 3NQIA 5GAGC 1ESRA 3HKZB 3ERQA 1WVLA 1LT6D 1GHKA 2EIFA 2B63B 2G5DA 4YHHQ 3ND8A 4G7OC 1F9PA 3HG9A 5C5LA 1EZ6A 4IZ8A 4NXNQ 4IFDG 1S3OA 1HZAA 5CC4A 4GNXC 4UHVA 1W6JA 3UE0A 2RDFA 4YCUA 1BUVT 3DHQA 2OTJA 4OWTB 2A69D 5K5PA 4X65Q 3C1EA 4ZYSA 1TWCH 3F2CA 3I72A 1KC8C 3OOCA 1EQRA 2KEEA 1CSPA 3NBHA 4X66Q 5FLXL 3IKJA 3RN2A 4K8IA 4A3LG 4JW0A 1CM9A 2A68C 4DV2L 2FXQA 1VQ9A 3TEHB 1MSHA 2B2WA 2IJ0A 5IGFA 3UDFA 1EL0A 2K05A 1D6EC 2MNAA 1E2ZA 1JMCA 4KKSA 3S24A 1RTNA 3HOUG 2F0TA 2KENA 4EQ5A 4JBJA 1EWCA 2O4XA 1GUGA 1NJIC 1I50H 2RDGA 5COYA 1A15A 3R8BA 3LNNA 4J6HA 4X6AH 5CV7A 1KHIA 2E5LL 2LXKA 2EPBA 3PGZA 5IYBG 2F0FA 3FHWA 4WORA 2PYKA 4K5XA 2N88A 4MZ9A 3CF5A 1A3TA 2NN6G 1HQMC 1N34Q 1G291 4PMBA 1J6QA 2JXMB 4QUFA 4A3DB 5IT9c 2Q2TA 3MFYA 2AQ3B 5CBAE 3CCSA 3M85A 3CW2C 2JA6G 5EKIA 2RCFA 3K0YA 1VF5C 1N36Q 3QWNA 1HNWQ 1VF7A 3HOYG 1OTCA 4LNQA 4GZYC 1LT5D 2B2WC 3TP8A 2MJ8A 3G4SA 1EY9A 3PO2H 2EY2A 2F0HA 3FMCA 1A8VA 4EX5A 3PUWA 1S5ED 2VQEL 4X3TA 3VYRA 5GROA 1Y1WB 3H94A 2M00A 3RMHA 4JI7Q 3QOJA 3L2PA 2A68D 2NTTA 3E5SA 3CCRA 2KECA 3HOVG 3QOLA 1FNWA 1U4PA 3UDIA 4FXGC 1WTOA 2UXCQ 2I0QA 4A3GG 2KUMA 3OWEB 4KJNA 4P73A 1PH1A 1YHBA 1YZ6A 3T56B 4JPBW 3F8TA 4DNIA 2DNCA 4CDEC 4RKBA 2HHHQ 2A74C 2EQSA 1NMGA 1WJJA 1A2TA 3K7AH 1YJWA 4K0KL 2LXJA 3K59A 2X6LA 1PYBA 4RG1A 1F2LA 4DV6Q 3IFDA 2RKSA 3OWFA 1FNUA 4NW2A 5IP9G 1LYLA 3CCMA 3KUPA 1SMYC 2QA4A 1ONLA 4O1NA 1S4ZA 1ZYRD 1C9OA 4DXFA 3DXJC 2DJGC 4JI8L 3GTGH 4WJ3M 1IKLA 1O7ZA 1SSOA 1TWCB 2RQXA 4UP7A 4DV5Q 1ILPA 1KAWA 3KYHC 3A74A 1FL0A 4YIJA 4LFAQ 1JR0D 1JB3A 1SNPA 2O2LD 4LF5L 4LF4L 2VUMG 3HOXG 2K03A 2Z6KA 2I46A 3PO3B 5BR8Q 4FXKC 3RLFA 4MNOA 4OWWB 5KNCA 2UUAL 5JVH3 1E1TA 1G2SA 3GTOH 4X64Q 1CKMA 1A3VA 4C1NK 1V1PB 4UP8A 2O5JC 1WTXA 4RCNA 2ATWA 1K8MA 1HPCA 4GLVB 1SAPA 3A8JE 5IYDH 1HFNA 1IYUA 3NBIA 4N8X1 5C4ZA 1B50A 4AYBB 3PIP3 4DV4Q 1X3QA 2NBFA 4HIOA 4KN7C 2K28A 1SR3A 1IBLL 4C2MH 2UUCQ 1TVXA 1Y8NB 2A5HA 3MXNB 1G8ZD 5K36H 1S72A 1V1PA 5LMUL 3H0GH 1SBBB 1STAA 3RD4A 4ZUJA 3QR8A 3MC0B 2R93H 2RHSB 3W1GA 1PH2A 5KYIA 4R8IA 2NYZD 4BBSH 4NP5A 2PZWA 2RHQB 3NELA 1T5EA 3C1FA 5C4JB 4NXMQ 1M1KC 1V9PA 4RAUC 2F52A 4IUPA 1M90C 1ENCA 1X3GA 4DXGA 4L5RC 1BVSA 5FOBB 1QE6A 1B2TA 2E2JB 3NQTA 3CAMA 2NVQH 4AH6A 1X55A 2LSSA 1DM0B 3S17B 2ZTDA 1VQDA 2Q2UA 1SYFA 3U58A 2HQLA 3WOEA 2XRQD 2PQEA 4A4IA 3K7AB 3H3VH 5F2DA 2LS01 2WAQE 2OTLA 2E2HB 1QZGA 1Y1VG 3VA7A 3HKZE 2SEBD 2JP1A 2AUJD 4IFDI 4DKAC 5C44H 4A3BH 1W6KA 4RGOS 2AUKA 1ICFB 3AFQA 1LTSD 1K83H 4OO1G 5IT9E 1VQ6A 3OTOQ 2J0TD 3W1BA 3J7YW 3J7A5 2Q2HA 4OGQC 1J5EL 2BA1A 4DUYL 1MJCA 4P74A 5CV8A 5HGQA 2JA7H 1QZHA 4FF3A 2R7ZH 1YEZA 3MAQA 4JYAQ 4YWKA 2VQFL 4OXPA 4CHTB 3PO2G 2Z6BA 1FR3A 1EQQA 4KJOA 4KKUA 4V0BA 4DK6C 3FVQA 2JA5G 4N8FA 2PNRC 1F77A 3VYSA 1H9SA 3V96A 4ILWA 5IGCA 1JJ2A 2ZM6L 1P8LA 3GTOB 2E75C 2H1EA 4JOIA 5DLQE 5C4XH 4IN3A 1C8CA 1PTOB 1SNOA 1UEAB 3HRZC 3C3LA 2K1BA 1LTGD 3BVMA 1DOMA 5E3FA 2IHEA 4A3KH 3C2PA 1XYIA 2B3GA 2CQOA 1R4QB 1YNND 2K5DA 3CC4A 4C3JH 1J8IA 2EYJA 5KIXA 3PF5A 5M3FB 2GA4B 4XXEA 4LF6Q 1KNAA 1I3QH 1TR5A 4IUUA 1Q86C 2AHOB 3MXUA 4JG2A 4L5SA 1WTWA 3H0GB 1XXGA 5I9OA 3U50C 1EY7A 2K7VA 2Q2IA 2E2IH 2R93B 3HEJA 1SROA 5M5WH 4WFN3 1D1IA 5C0XJ 2AMCB 4DR5Q 2M9VA 1BO0A 4P2CB 2EJFC 4N9TA 1IL2A 3EROA 5EQ0A 4PG3A 1KDCA 4APVA 2KCMA 1EU4A 4PQXA 1SEBD 3UE1A 1EFID 1ENAA 3ZYYX 4JOIC 5IOCA 4B08A 3KOJA 3CMEA 4ME3A 1XMOL 5JJZA 1MIUA 5AJ3L 1HRJA 1HTPA 3OPOA 3RUZA 4EQOA 1TWGH 1BCPB 2ID0A 2L0CA 3TMEA 3ICEA 4JV5L 3S15H 3D4RA 4F88A 4MTNA 4RFBA 2ZXPA 4A3LH 3DMUA 3K5OA 5C3EB 4RCOA 3I56A 2VNUD 4DV2Q 4A3FB 3D4WA 5C5MA 3L9AX 5IT9L 2NVQB 4KHVA 2F3VA 4R8NA 5ELBA 3HOUH 4C56C 1E22A 1VQAA 3FEWX 4X3KA 4CDFC 4M1UB 4CKEA 1OXSC 1PFMA 1PTOC 2KEDA 4DV0Q 2R3ZA 3E9HA 1J9OA 3HFZB 3PUZA 2WKDA 5IYDG 4ID6A 4A93H 4H0LC 5IYBH 4B3TQ 3K5MA 1TY2A 4J15A 4A3BB 3CPWA 2L1BA 2EY6A 2NN6H 3H09A 3KF8B 4IQZA 5C3WA 2BH2A 3NTKA 1EQVA 2L11A 3CCJA 2PNHA 3MEHA 4LUOA 2HT1A 2K5HA 3CKIB 1RJTA 3UDGA 2JA6H 5ELCA 4DV7Q 1CTMA 3SE0A 4HMIA 3HOYH 2R7ZB 3E3XA 2F4VL 5JJKA 1BR9A 5FK9C 4UPAA 4BBSG 1BXTA 5C6AA 1O7LA 3KF8A 4ZK9B 3MXGA 1CSQA 4K6LA 1A6XA 1X54A 1AZPA 4A3CH 4IUQA 1M8AA 4QY7A 1GUTA 2NZ1D 4JBKA 1PFSA 3VR2A 2UU9L 2XVSA 3A5ZB 1PH4A 1UE6A 5C4XB 1HNXQ 1BCPC 2I5MX 3PUYA 4XYOA 2R92B 1CZWA 4EVOA 5JPMC 1WCMH 2TSSA 3HOVH 4K2LA 1WTHA 4EQPA 1KRTA 4RHSA 4A3KB 1YJNA 4MN3A 1HFGA 1X3PA 3KFUA 1PTOD 4DA2A 4C3HH 2A1AA 4AYBE 4BS9A 2UUBL 3H3VC 4KHZA 2RSNA 3OW7A 1PFBA 1SYCA 1PTOF 2E74C 1DGSA 5IP9H 5C44G 1R9TB 5FO8B 4DAYB 4XQQA 1A63A 2Y0SB 2VZAA 3PUVA 2F0QA 2EY1A 1Q46A 4YCVA 4DR6L 1PA6A 3EIVA 2D5DA 1XPOA 5I6WA 1CK1A 3T1YQ 4KV6A 3NENA 3TDQA 2JA7G 1ILQA 2A6EC 1WTVA 1U4LA 2Q8TA 2NTSA 2VUMH 4FDBA 1KLUD 1C4QA 4DAYA 4LF5Q 2BE5C 4LF4Q 2SOBA 3X3MA 4BWGB 1VMPA 2RBMA 5I6YA 4B3ML 5IGGA 3E9IA 3A55A 1AFPA 2NB0A 3HOUB 2RA4A 4MIUA 3T1HQ 1PZJD 3QIAA 2NVYB 1NMFA 2QDBA 3S16B 3CC2A 1LM0A 2A8VA 2KJXA 1XNQQ 3BZDB 2KBNA 4YY3L 4H44C 1JJGA 2PZUA 3CHBD 2HQEA 4DU9A 1AZQA 4FVMA 2YYZA 3KLWA 3MEFA 3O13A 1H9JA 1JQYD 3VR4A 3G6JB 1VQJA 3G71A 2LFNA 3EA6A 1I94L 2HD3A 2XN9C 4DR3L 1EY0A 1VQGA 4I7ZC 3NE5B 5BN3A 5GAEC 2AQ1B 1VQKA 2JA6B 4BBRH 1SMXA 4A75A 1TWAH 4EQNA 1TWHH 4FO2A 4LFBQ 2HCIA 1EWIA 3WOFA 3S1QB 4LAAA 3SGIA 1E24A 1ET6A 1QB5D 3BYYB 3MFGA 3NTIA 3NHHA 3K57A 3C46A 4B3SL 4OO1H 3GV6A 1EIHA 1B8AA 4RWSC 4MHEA 5EKKA 4CJ0B 2L12A 1CT1D 3CMAA 1EY5A 2A6ED 1VQPA 2SNMA 1JWMD 3DEOA 3A0JA 4GOPB 1PFNA 4JI2L 3D4DA 1SE3A 4OELB 3GTMH 4UP9A 2BE5D 4QQBX 4DN4M 5D3DA 3HOVB 1PVOA 1S5CD 4DR7L 4XQNA 1KD1C 4A3GB 5D14A 4IUVA 4QUCA 3E6ZX 4DV3Q 1Q7YC 1N8RC 4P71A 4LMQD 3BZCA 4GN3B 5M5XB 4WJWA 5DM63 1Y1VH 4A93G 4OIKA 2NWGA 4OX9L 3S2DH 4HIKA 3U9SA 2ZJQA 2XWJB 5KNBA 3OMGA 1V8QA 2F0EA 1I6HH 3BVZA 2JK8A 3S14H 3DWAA 2BA0A 1Q12A 3K58A 3FPUB 1WTQA 3EVQA 1AN8A 1WOCA 1D1KA 3D6WA 1YBYA 1RODA 2XIWA 1ESFA 3BDLA 2JJQA 3G6EA 1XMQL 3SDZA 1VQNA 3HOWG 2IW3A 4R4CA 2WAQG 4L6TB 1WD0A 3QO2A 3K80C 4LUVA 2VUMB 3PSIA 3TREA 2BDNA 2A6HC 3HOXB 4DAPA 1KDBA 4GLAC 4A3CG 1Z9FA 3L0OA 3U4VA 2JA5H 3I70A 2Q8RE 4DF7A 3S2HH 5ISRA 3MZ5A 4XT3B 1QVGA 4B3RL 2IPKD 1H95A 3MTSA 3I4NG 4HSPA 3STBC 4GOPC 2F0KA 2SDFA 1WCMG 1B4OA 1EZ8A 1CUKA 2F0UA 1EOVA 4Q5VA 1HR0W 3PUXA 1GHJA 4HMJA 5DEHA 1HUMA 2FMMA 3CPFA 4GKKL 2K50A 4ULLA 2YU9H 5KYLA 2EJMA 1TXYA 1E2WA 3M4PA 4HJ7A 1LLRD 1VMCA 2PI2A 5I2XA 4A3IG 4LF9Q 4C3HG 2WB1G 1U0LA 2B2VA 3I4MH 4JC0A 2Z8LA 2QCPX 3S9WA 4ZAIA 4LF7L 2F1MA 1KIXA 4BA1I 4POGA 1HCZA 4P72A 4GKJL 1TWHB 2ICEC 2CWAA 1EQTA 4JCVE 3H15A 2PMZB 3CCUA 2Z4HA 4EGVA 1STBA 4HSVA 3J80c 1B1ZA 1JCKB 3GTPH 1FYCA 3TS2A 2YTXA 4XQJA 4PV1C 4QCLA 1EYCA 2B2UA 4AQYL 1W3SA 2WINB 1D5MC 2XWBB 3RZOH 4DR4L 1O7IA 1E2VA 3R3OA 5FO9B 2MFIA 1EYGA 2NVXH 3F2UA 3TN2A 2A6HD 2ZTEA 4KN4C 1EIGA 5IWAL 1MHWC 4JV5Q 1HA5A 1QILA 1DZ1A 4KY5A 4S3SA 2D2CC 3A7AB 1HJPA 2MPMA 3NUCA 2B2VC 4RH6A 4FYDA 4RA8A 3STBD 5EPJA 1Q8IA 1I50B 4F87A 1PH5A 5A2QE 2CCZA 4ZRZA 3AQQA 3I91A 3H3VI 2MUYA 1QVFA 2UXBQ 1PH9A 1UE1A 2I07B 2HCCA 3M4OH 1IBMQ 5IE8A 4LW1A 1CI3M 3S2DB 4IURA 1BBXC 4G4KA 3GTQH 4DR1L 1F2YA 2EVBA 1V1OA 2BDOA 5TSSA 4JI0L 1GXDC 1TT2A 1KABA 3NWSA 1HHVA 2B2UC 2X69A 1I4PA 2I5HA 1RTOA 1FJGL 2EYHA 2NZOA 3G7LA 2Y0SE 2AKWB 3PIOA 3F2BA 4BBRG 1LTRD 1N33L 1XJVA 2R7FA 1SMYD 3K0XA 3SXHA 5M9OA 2IL8A 5C0XH 3DM3A 3JAME 4FF4A 3K5LA 5FLMG 1K3BC 4QJFA 3F2DA 1I5FA 3V2TA 2IT1A 2QEJC 1PDQA 4GN5A 3J80i 3U9OA 4PZ8A 1L1OB 5CGKA 4YHHL 2F4VQ 3PO2B 1BBUA 1SYDA 4KMUC 3Q0AA 1DYQA 4HJ8A 1G51A 1NAPA 1C0AA 3Q24A 1BBWA 3S2HB 1K0SA 1PLFA 3MXNA 5C4HA 4OHJA 2GVBA 2K5NA 4TVAB 1G2TA 5E4XA 1QOHA 1H9MA 1QUQB 3SEBA 1B3QA 1SE4A 4X65L 3PQIA 3SK8A 1VCIA 5M3MH 1HTLD 3PMFA 2YU9B 1HR0L 4NKLA 1L1OA 5LMNQ 4A3JG 1SNCA 4JI6Q 4A3MG 2EYOA 2FINB 2KHJA 4WJ4A 1QUQA 2UUBQ 2JSOA 3PO3G 1EY4A 1O7YA 1MD2D 1DXMA 3RR5A 5T1IA 1LTAD 5ELDA 1T9HA 3BU2A 2JYOA 1RL2A 3PCOB 3TRZA 1LTTD 1H9KA 1VQHA 1F2MA 1O80A 3GTGB 1B7YB 3AEVA 2EJGC 4DR6Q 5FKAC 3URYA 2H5XA 3ER0A 3UDXA 2PO4A 1SDFA 3PV0A 5IODA 5A2QL 1GM5A 1TWFH 1XNRL 3IRBA 1SYBA 4K5WA 2NZHA 2F0IA 4A3EG 5KEEA 1N34L 3Q8DA 2A19A 1NR4A 1V1QA 4JI4L 4NPSA 2Z9HA 3V05A 4DV1L 5CV5A 4CDDC 1L1OC 5IY0A 1N36L 3R2TA 3S1NH 4BY7G 1HNZQ 4YCWA 3CD6A 1STGA 1R4PB 4PZ6A 4LFCQ 1SE8A 2K5QA 3OSOA 2F0DA 5BN5A 4QB4A 1JOKA 1XX8A 1LTBD 3A8KE 4KTAA 1JORA 3D6CA 5EJWA 3KK7A 5JPNC 2WKCA 4O42A 4YY3Q 2NN6I 3QB3A 4JI7L 1GUNA 3GV3A 2K5WA 4G7HC 3I4MG 1VDZA 1CQVA 4C2MB 3MXPA 2UXCL 3A54A 1SN8A 4DR3Q 1STEA 5IP7G 4TSSA 1FVIA 1DOKA 2Z4IA 4U673 1RIPA 2Z0SA 5C3XA 2HHHL 1K28A 3J80E 1YJ9A 5AFWA 1UEBA 1XPRA 1FD7D 3I55A 4OONA 4BBSB 3K7UC 3CXCA 2F0JA 5JOBA 3TP5A 3Q6SA 1GUOA 2D62A 4O2DA 2L9HA 2KOLA 3ND9A 5T1GA 2PI2E 2ZJRA 3AMUA 3FKIH 2DGYA 2MHVA 2IX1A 1HZCA 1ML0D 1NY4A 3J7AV 2PW7A 4KY7A 3SK6A 1DJRD 1NBWA 2F0SA 3BZKA 5HGTA 4G7ZC 1PMRA 3P75A 3HOZH 3TSSA 3SK4A 1LT3D 4DNTB 1PRTB 4XTCS 2LY7A 2A73B 4TQUS 4ZUIA 5M5YH 5DAUA 1LT4D 3B6YA 4JK1C 2FMCA 5KRUA 3J81j 1YIJA 1FNVA 4JI5L 3KLSX 1KTKA 3K8AA 3KBGA 1K3RA 2SNSA 2B39A 5NUCA 1U4RA 2E5LQ 1LTID 1ASYA 3RLNA 3RN5A 5J22A 1QWYA 2IHFA 5C44B 4X64L 1WI5A 5A35A 1GUSA 3OMCA 4CDCC 1K83B 1YI2A 1XTDA 4H7BA 3KJPA 3S1RH 2PMZE 1JWSD 1A62A 5I9PA 3M4QA 1PV4A 4J8QA 3EN2A 3LX0A 4K6DA 3M3YH 1VS0A 1UE5A 4JI3L 4DV4L 1VQCA 3HOWH 4K5VA 1EEFD 5C0XG 1AH9A 3FPPA 3P20A 2XGTA 1UE7A 3ERSX 3GTKH 3S1MH 2JA7B 4YWMA 1UUPA 1HZ9A 5I2YA 2ES2A 1GVPA 4DUZL 3JC66 2ENBA 3W3AA 2B63H 1EIFA 3IL8A 5JAVA 1NTGA 3BDCA 1KAAA 1BNZA 4X3UA 3RZDH 2VQEQ 4PZ7A 1AE3A 2CW0C 2ASBA 2F0GA 2F0MA 3I4NH 4OL7A 3MWYW 4JI1L 3CCLA 1E1OA 2LMCB 2K33A 5M3MG 3J80L 1Q1BA 1DD2A 1JJCB 5L37A 1WYDA 4XIGS 3E0JA 4ZCKA 4GKKQ 4C3JB 3H91A 4A3IH 5CMDA 1TS3A 1SRUA 1WTPA 1I3QB 1JWUD 1PRTC 1VQIA 1IHZA 1V43A 1RDPD 1EWHA 3CCEA 3BVGA 3Q23A 5IGBA 3IAYA 4RGTA 2QF7A 4K0KQ 1GOZA 2ZXRA 1AW7A 2B8GA 3U4ZA 2DY7A 2C35B 4LF7Q 3SHLA 4A3FG 1B3AA 3OIQA 2N55A 3P7JA 4GKJQ 2E2IB 5M5WB 1EY8A 4K14A 3NEMA 4XT1B 1WFQA 2F0OA 1EY6A 1JT8A 3CCQA 2PPBC 2RSOA 1EEID 4OO1I 3HS0C 1SE2A 4BY1G 4KY6A 1IYJB 1SJED 4JI8Q 1E0BA 1PZKD 4IOAA 1N32L 2K32A 1TS5A 4KHPL 5FLXE 1I4HA 2F0NA 2BH8A 4KK7A 1X6OA 2F0VA 3ULJA 4HJ5A 4JBMA 4AQYQ 1TWGB 2HDLA 1Y8OB 1YVCA 4UY8C 2VS1A 4IFDJ 1D8LA 1LTLA 4CGYB 1BKBA 4IOCA 3S15B 2IWHA 2PCFB 4IO9A 3KLSA 2O5IC 4A3DH 5ELFA 5IWAQ 1K8OA 5J39A 1LACA 4Q0FA 3CRKC 2CW0D 1BCPD 2EXZA 2XTIA 2K04A 4JYAL 3RLOA 2UUAQ 4HTHA 3FP9A 1MSGA 2L15A 1CKOA 4A93B 1BCPF 4R4TA 3DEPA 1VQOA 3GO5A 3BJUA 3DWQA 1QG7A 1SNMA 2ZJPA 1MJEA 4PMCA 3GTLH 4KD4A 1Y8PB 3KF6B 2OXPA 4H13C 4P75A 1U9RA 2J4XA 1PRTD 1AE2A 4Y7NH 1PHJA 3VR5A 1ZEQX 4DR1Q 1Y1WH 1BF4A 2J7ZA 1SXTA 4JI0Q 1FGUA 3OYYA 2JA9A 3S1RB 1VQMA 1Q3LA 1L0WA 1IBLQ 4C3IG 1KL9A 1TU2B 1PRTF 2VXWA 4Z9CB 3HOWB 1FGBD 5LMUQ 4UAIA 4DGZA 3HOYB 3GTKB 4NB3A 4LF6L 4DAMA 1YHQA 5IIFA 1HZBA 3JAMc 5FLMH 3KDFB 4HJAA 1ZKOA 3KF6A 2JA8G 1F9RA 3T4AC 1CHPD 2Z1CA 1DOLA 4X62L 1Q8KA 3CU7A 5FO7B 3TQYA 4A76A 5LHY1 1CHQD 5CV9A 3NBHB 4CKCA 3J81c 3RZDB 2B2TA 3FKIG 3EBEA 4DR5L 1I4XA 2KQ3A 3I4NB 2Y0SG 3GDEA 3G48A 3PF4A 1WCMB 4LF8L 5FJ8H 4BA2I 4QL5A 4HIMA 5JVG3 2QKIC 3KBXA 3KDFA 5ELEA 1CA5A 4JBWA 3D0FA 3HOZG 1UAPA 2WFWA 3J7AF 4DNRB 4U68A 2V4DA 1HR0Q 1LUZA 4A3IB 3BS1A 1XPUA 4C3HB 2WB1B 2EYFA 4A3JH 2JE6I 5EGTA 4A3MH 3MVVA 1VQ8A 4CJ2C 4OEMB 4GOPA 3GQBA 3NSWA 5CR3A 2FFKB 1PXUA 2ZT9C 2GVAA 2IX3A 3PO3H 2CQAA 1HQRD 2TMPA 2UXDL 3DUZA 1F2ZA 2N8NA 1M4VA 5D3IB 4LUZA 1O78A 5EPKA 1C7YA 3X3NA 4DFAA 4DV0L 1A2UA 3D8GA 3CRLC 2CFMA 4HIDA 1TS4A 2NUCA 5CV6A 4B3TL 2B2TC 4ZKBB 2QDLA 1J5EQ 4DUYQ 3FRPB 1LO5D 2OWOA 1I6VC 1U4MA 4A3EH 1XNRQ 3HKZG 5H1SE 1VQBA 2RCNA 4DK1A 1Z7TA 4K2KA 1B9MA 1ZYRC 3JAMi 2VQFQ 1IBKL 4JI4Q 4DV1Q 2P5ZX 2B63G 4DV7L 5KNDA 4ZLTF 4DAVA 3DLLA 1SNDA 1Z6HA 5HY6A 4BY7H 4XYQA 1UNSA 1G6PA 3SVMA 3J81i 2ZM6Q 2BCOA 1S5DD 2R7DA 2AQ2B 4I65A 2OCEA 4DK0A 1QJOA 4AIMA 1BQQT 4IPHA 1EIYB 1KRSA 1E7ZA 2KCCA 5GADC 4DK3C 4F8MA 3GTLB 1I4QA 1TIID 1HNXL 4Y7NB 4IPGA 5C4JH 3OW2A 4RKLA 5HURA 4ALPA 4ODGA 3T16A 3NPPA 5IYCH 1K0RA 2LKVA 2OQKA 1SFOH 2ZXOA 4GS3A 2N78A 5EKLA 3SK5A 4IALA 1CZGA 1TKWB 3MA2B 4BBRB 1TWAB 5IP7H 1CA6A 2E76C 2K75A 3CP0A 2E2JH 5C0XI 4WRDA 3LGJA 4GLXA 2F0LA 2XRSD 4KLKA 4HN7A 3S17H 3HP3A 3NWTA 2R61A 4IPCA 4QIWB 2D0PA 3QG1A 3F1ZA 1TY0A 2KCTA 3I7FA 3ULPA 2D0OA 2E2HH 4PNYA 1X3EA 5CORA 3I4OA 2EOTA 1MGSA 1X3FA 1PYSB 2WIIB 1NNXA 3CQZH 2OF1A 1XMOQ 1EOTA 3BDOA 4KKTA 5AJ3Q 4MTKA 3GTMB 2VB3X 2DY8A 4RHRA 4F7XA 2ICIA 2PQAB 3EJIA 1YHAA 5EPLA 1BDOA 4A3DG 1OXVA 2PW5A 2B2YA 4ME5A 3T1YL 1HUNA 3N6RA 4QMGA 3VR6A 5ELOA 1STNA 1VQFA 4TRDA 5CV4A 2FJ2A 3CCVA 4HJ9A 1K8AC 2OQ0A 1XTCD 4A3JB 4A3MB 2N49A 1VQEA 1YITA 3KLRA 3QJYA 1Y1VB 4OIJA 4DR2L 2PQAA 2EZVA 4JI5Q 1PYWD 3T1HL 2QILA 1I6HB 3TBIB 4X3SA 4BXXG 1D5ZC 1JICA 2WACA 1Y1WG 1EUJA 3AFPA 3S14B 2CHBD 3WDNA 4E6IA 3TS0A 3CC7A 1NE3A 3LWUA 3PIO3 3EQLC 4B9XA 2CH4A 3GTJH 1PTOH 4IUTA 2F4IA 2RF4A 1PZID 1XNQL 1TS2A 2DN8A 2HIVA 3KJOA 1HA6A 4R4OA 1RKNA 4JI3Q 2WV6D 4A3EB 2B2YC 5JJLA 3M7NA 5M3FH 1D5XC 3PIPA 4M8AA 5LL6X 1JE4A 4NXNL 1VQ7A 2JA5B 4LFBL 1JB7A 3GD7A 3J81E 4DUZQ 3I3CA 3L7ZC 4BY7B 1ENFA 4KI0A 2Z6KC 3R93A 2UU9Q 1F9SA 1OXXK 5FJ8G 1QVCA 4LK1C 5GAHC 3Q22A 4PMWA 4JI1Q 1IZ6A 1L0YB 5G3LD 5JEAH 2RDHA 3DM1A 1GJXA 3TP6A 4X66L 4CBVA 3FDTA 3I4MB 2GN5A 2KHIA 4K8JA 5G3LF 3R2IA 1B70B 3A7LA 4V190 1SFOB 1D2BA 1SYGA 3TZDA 5C3EH 5IGDA 2OEOA 4A3FH 3K6OA 4DV3L 4QGUA 5J3BA 1WTRA 4NMZA 2FHTA 1KNEA 2MP1A 3HZXA 1K73C 1YNNC 3GTPB 1KDAA 1RHPA 5EBCA 4HR7B 1PH7A 4BY1H 3J7ZC 2HUGA 2VB2X 3T53B 1RF2D 2Q8IB 3RZOB 1GKHA 1N32Q 5FLXc 1Q1EA 3CQZB 4KHPQ 4AYBG 3HGBA 1GD7A 2NVXB 4J1MA 2CKZB 2QEXA 2H4OA 2WP8J 1QNUA 3A5UA 1VQ5A 1XWEA 3BYTB 1H9SB 4R4IA 1HXYD 2B29A 3I4LA 1HNWL 1PH6A 1PH3A 4B3MQ 1N9WA 1TQOA 2I5LX 1VQ4A 5J1ZA 3NTHA 1NUCA 4GN4B 1NSNS 2L55A 3K81C 4I7AA 3M4OB 1AP0A 2WB1E 2MO0A 3JAML 4N9PA 3TP7A 1SJHD 1ET9A 3GTQB 2DJFC 4Y52H 1X65A 2EYLA 4HEDA 4FP5D 1JOOA 4L8JA 3I2ZA 2NVTH 4C1NI 1OXTA 3RNUA 3M7GA 4CKBA 3GTJB 3D3RA 3J81L 4NDXA 5IYCG 2R92H 3W5OA 1KQSA 4HCEA 4LWCA 1I94Q 1P16A 1STHA 3NXWA 4C3IH 4HCSA 5LMNW 1QNKA 4FF1A 2OT2A 4HAEA 4LF9L 1IW7C 4ZKCB 2M2LA 4IJLA 2BOSA 4G57A 1STYA 5DNFA 5IGEA 2D9UA 4DV6L 4XDXA 2JA8H 2L4NA 3ZJYC 3AU7A 1Z47A 4B3SQ 1ZXTA 4X62Q 3VR3A 5I4DA 2K5VA 1K8GA 4IFDH 2EE1A 3MHBA 3WWVA 2JN4A 1R9TH 1SYEA 4TKOB 2QW7A 3ITPA 4JI2Q 5EAYA 4DV5L 4H02A 2L5TA 5M3MB 3AYHB 5GQOA 1Q82C 4LF8Q 2C5CA 4FF2A 4DR7Q 3UI2A 3H6MA 5JEAJ 1B44D 2CWPA 4LFAL 1W2BA 1NCVA 2K52A 2KHSA
chains in the Genus database with same CATH topology
1M90C 2JEBI 1WCMG 1X3GA 2QGQA 3FP9A 5BR8L 1CUKA 2L15A 1EOVA 1X56A 4L5RC 1HR0W 1CKOA 3PUXA 1BVSA 2YTYA 3E0EA 4R4TA 3HKSA 3CPFA 3BJUA 3GO5A 2K50A 1VQOA 2YU9H 3CAMA 4GKKL 1TXYA 2NVQH 4AH6A 2ZJPA 3M4PA 1MJEA 3GTLH 4HJ7A 4OX9Q 1X55A 2LSSA 3KF6B 4P75A 2AWNA 2PI2A 4A3IG 4LF9Q 1PHJA 1AE2A 4Y7NH 2WB1G 2ZTDA 1U0LA 4DR1Q 1VQDA 1Y1WH 2Q2UA 2UXBL 3U58A 2ALYB 2HQLA 3I4MH 2NVYH 4A4IA 4JC0A 1EFWA 4JI0Q 1FGUA 3OYYA 2JA9A 1VQMA 1IBML 3H3VH 1L0WA 2WAQE 2OTLA 3S16H 4YWLA 1IBLQ 1KXLA 1QZGA 1Y1VG 4LF7L 2VL6A 1Q81C 1KIXA 4BA1I 3HKZE 4QIWE 4POGA 1KL9A 4P72A 2N3SA 4GKJL 4IFDI 2F3IA 5E7NA 2CWAA 4JCVE 1XMQQ 5LMUQ 3H15A 4DKAC 5C44H 1K9MC 4NB3A 4A3BH 3CCUA 2E8GA 4LF6L 4DAMA 1YHQA 1L2FA 2UUCL 3J80c 5M3FG 4DPGA 1HZBA 3AFQA 3JAMc 5FLMH 1K83H 3KDFB 1VQLA 2VY3A 4HJAA 4RMFA 1HH2P 3OTOQ 3KF6A 2JA8G 1VQ6A 3GTPH 3TS2A 2IY5B 3W1BA 2YTXA 4X62L 1Q8KA 4A76A 4OWXB 3TQYA 3J7A5 2Q2HA 5K36G 5ELNA 1U5KA 2BA1A 4DUYL 1J5EL 1IBKQ 3NBHB 4AQYL 1W3SA 3H0GG 3VDYA 5JJIA 3RZOH 1MJCA 4DR4L 3J81c 1O7IA 3S1QH 4P74A 3FKIG 2R93G 3EBEA 4DR5L 5HGQA 2MFIA 1EYGA 2NVXH 2JA7H 1QZHA 1JE5A 2Y0SG 1YEZA 2R7ZH 3D31A 4B3RQ 3GDEA 4JYAQ 4YWKA 2VQFL 3G48A 2ZTEA 4OXPA 4R4QA 5IWAL 4LF8L 3PF4A 5FJ8H 1EQQA 3PO2G 4JV5Q 4BA2I 4QL5A 4HIMA 2EXDA 5JEAG 2JA5G 4DK6C 3KDFA 1CKNB 4JBWA 3D0FA 1HJPA 3HOZG 2R6GA 2WFWA 4NXML 1D7QA 1S40A 1JJ2A 2MO1A 1HR0Q 1LUZA 2ZM6L 1P8LA 3STBD 1XPUA 5DLQE 4JOIA 1PH5A 2CCZA 5C4XH 2DUDA 4A3JH 3AQQA 2JE6I 1X9NA 4L5QA 4A3MH 3H3VI 1GO3E 1QVFA 2UXBQ 1PH9A 1VQ8A 1UE1A 4GOPA 3M4OH 1IBMQ 4IPDA 1E3PA 5C3EG 5IE8A 2GVAA 4LW1A 3PO3H 2IHEA 4A3KH 4A3GH 2UXDL 2B3GA 2CQOA 3GTQH 2N8NA 4DR1L 5LMNL 3M9BA 4JI6L 4LUZA 3CC4A 4C3JH 4JI0L 1CKNA 3PF5A 1C7YA 4LF6Q 4L5TA 4DV0L 1I3QH 2CFMA 1A0IA 2I5HA 2K14A 5M5XH 2K4KA 1Q86C 2NZOA 4HIDA 2Y0SE 2AKWB 1FJGL 3PIOA 2AHOB 4BBRG 3F2BA 2YTVA 4JG2A 1N33L 1XJVA 2R7FA 4B3TL 4L5SA 1J5EQ 4DUYQ 3K0XA 1N32Q 4GNXB 3U50C 2OWOA 4A3BG 2Q2IA 3DM3A 4DR4Q 2E2IH 4A3EH 1XNRQ 1SROA 5M5WH 3OTOL 1YNXA 5C0XJ 3HKZG 2AMCB 5FLMG 4DR5Q 5H1SE 1VQBA 1Y14B 2IX0A 2RCNA 4QJFA 3F2DA 1I5FA 4R1JA 2IT1A 4GN5A 3J80i 1IL2A 4PG3A 2V1CC 4PZ8A 1L1OB 3ULLA 4YHHL 3JAMi 2VQFQ 1BBUA 4APVA 1IBKL 4JI4Q 4DV1Q 1ASZA 4HJ8A 2B63G 2KCMA 1G51A 4DV7L 1C0AA 2ZTCA 3UE1A 4JOIC 3DLLA 1BBWA 3KOJA 4ME3A 3CMEA 1XMOL 5HY6A 1IXRA 1MIUA 2GVBA 4POFA 5AJ3L 4BY7H 2YV5A 1TWGH 1G6PA 2K5NA 2HIXA 2ID0A 4TVAB 2R7ZG 2ZM6Q 3J81i 1QUQB 3ICEA 4JV5L 2R7DA 4GNXA 3S15H 2JQOA 4X65L 4MTNA 2OCEA 4A3LH 3HOXH 1MKHA 1VCIA 5M3MH 3I56A 4AIMA 4IPHA 4O0AA 1SLJA 4DV2Q 1KRSA 1E7ZA 1EIYB 5GADC 1HR0L 2VNUD 4DK3C 1HNZL 1L1OA 4DR2Q 2JEAI 3HOUH 1HNXL 4BXXH 4IPGA 5C4JH 4LFCL 5C4XG 5LMNQ 3OW2A 4A3JG 1E22A 4JI6Q 4A3MG 1VQAA 4IJHA 1OXSC 4ALPA 2R92G 1UWVA 1PH8A 4DV0Q 2KHJA 3E9HA 5IYCH 1K0RA 2OQKA 4WJ4A 1QUQA 3HFZB 3PUZA 1OXUA 2N78A 4GS3A 1SFOH 2UUBQ 5IYDG 5IP7H 1FJGQ 3PO3G 4A3KG 4A93H 5IYBH 2K75A 3CP0A 2E2JH 2VW9A 1N33Q 3RR5A 4B3TQ 5C0XI 1T9HA 4J15A 2MQHA 3BU2A 3LGJA 4GLXA 1RL2A 3PCOB 3CPWA 3TRZA 2AWOA 4KLKA 3KF8B 5GAGC 2BH2A 3S17H 4IPCA 1VQHA 2D0PA 2UXDQ 1B7YB 3AEVA 3F1ZA 3I7FA 2KCTA 3ULPA 3CCJA 2EIFA 2PNHA 2D0OA 2H5XA 3ER0A 4LUOA 2K5HA 3UDXA 2HT1A 2E2HH 3PV0A 1X3EA 4YHHQ 3I4OA 3UDGA 2JA6H 1GM5A 4NXNQ 1X3FA 1TWFH 1PYSB 4IFDG 1S3OA 4DV7Q 1HZAA 1XNRL 3CQZH 3IRBA 4GNXC 2NZHA 1XMOQ 4A3EG 1N34L 3HOYH 3UE0A 5AJ3Q 3Q8DA 4YCUA 2F4VL 5JJKA 2A19A 2PQAB 1V1QA 4JI4L 1YHAA 4NPSA 2OTJA 4UPAA 4OWTB 4DV1L 4A3DG 1OXVA 4BBSG 1L1OC 4X65Q 1CSQA 3T1YL 5IY0A 1X54A 1TWCH 4A3CH 1N36L 3F2CA 1KC8C 4QY7A 5ELOA 1VQFA 3CCVA 1EQRA 3S1NH 4BY7G 4HJ9A 1HNZQ 1CSPA 4YCWA 4JBKA 1PFSA 2UU9L 1K8AC 3CD6A 3A5ZB 1PH4A 1UE6A 2OQ0A 4X66Q 1HNXQ 4PZ6A 2I5MX 2N49A 3PUYA 4LFCQ 1VQEA 1SE8A 3RN2A 1YITA 4A3LG 1WCMH 4DV2L 1VQ9A 2FXQA 3HOVH 3TEHB 4DR2L 2PQAA 1KRTA 3UDFA 1YJNA 4JI5Q 2MNAA 3T1HL 3S24A 1JMCA 4YY3Q 3HOUG 2NN6I 4BXXG 2KENA 4JI7L 3KFUA 1Y1WG 1EUJA 3AFPA 4EQ5A 4JBJA 3I4MG 3TS0A 1I50H 1NE3A 4C3HH 2A1AA 3CC7A 1NJIC 4DR6Q 3GTJH 4AYBE 2UUBL 2RF4A 1XNQL 2UXCL 4X6AH 2E5LL 1KHIA 1SN8A 2LXKA 4KHZA 5IP7G 4DR3Q 3PGZA 5IYBG 1FVIA 3FHWA 2HIVA 1RIPA 1DGSA 3KJOA 5IP9H 2Z0SA 5C44G 4R4OA 2HHHL 4JI3Q 4MZ9A 4DAYB 3CF5A 2NN6G 1YJ9A 1A63A 1UEBA 2VZAA 3PUVA 1XPRA 3M7NA 1N34Q 5JJLA 1G291 1Q46A 4YCVA 5M3FH 4DR6L 3PIPA 1PA6A 3EIVA 1J6QA 3I55A 4OONA 5IT9c 3K7UC 2Q2TA 4NXNL 3CCSA 3M85A 1XPOA 3CXCA 1VQ7A 3CW2C 4LFBL 2JA6G 3T1YQ 1JB7A 3GD7A 4DUZQ 1N36Q 2D62A 3NENA 4O2DA 3L7ZC 1HNWQ 2ZJRA 3HOYG 2PI2E 2JA7G 4KI0A 1OTCA 4LNQA 3FKIH 2DGYA 2Z6KC 2UU9Q 2IX1A 1OXXK 5FJ8G 2VUMH 4FDBA 1HZCA 1NY4A 1QVCA 5GAHC 4LF5Q 3G4SA 4LF4Q 3PO2H 4PMWA 4JI1Q 1NBWA 4B3ML 1A8VA 1IZ6A 3BZKA 3E9IA 3PUWA 4EX5A 2VQEL 3HOZH 4X66L 5GROA 3T1HQ 4JI7Q 1NMFA 2GN5A 4XTCS 2KHIA 4TQUS 5M5YH 3L2PA 3CC2A 3B6YA 1B70B 1YIJA 3CCRA 3J81j 3HOVG 1LM0A 4JI5L 3UDIA 2A8VA 3K8AA 1XNQQ 1K3RA 2UXCQ 2I0QA 4A3GG 5C3EH 2E5LQ 2KBNA 4YY3L 4P73A 1PH1A 1YHBA 1YZ6A 4A3FH 1ASYA 3RLNA 3F8TA 3RN5A 1JJGA 2IHFA 4DV3L 4QGUA 4DNIA 5J3BA 4X64L 1WI5A 2F4VQ 2YYZA 3KLWA 2HHHQ 3MEFA 2EQSA 1K73C 1YI2A 1XTDA 1VQJA 3G71A 1NMGA 1WJJA 3KJPA 3K7AH 3S1RH 1YJWA 1I94L 4DR3L 4K0KL 2PMZE 1A62A 2LXJA 1VQGA 3M4QA 1PV4A 1PYBA 4RG1A 1PH7A 3EN2A 5GAEC 4DV6Q 3J7ZC 1VQKA 4BY1H 3M3YH 1VS0A 1UE5A 4BBRH 1SMXA 4A75A 4JI3L 1TWAH 4LFBQ 1GKHA 1TWHH 5IP9G 5FLXc 1Q1EA 1LYLA 1EWIA 1VQCA 4DV4L 3HOWH 5C0XG 3CCMA 4KHPQ 4AYBG 1AH9A 3SGIA 1E24A 2XGTA 1UE7A 3ERSX 1GD7A 2QA4A 3GTKH 3S1MH 4YWMA 2CKZB 2QEXA 2WP8J 1HZ9A 1C9OA 2ES2A 3A5UA 1GVPA 4JI8L 3GTGH 4B3SL 1VQ5A 4R4IA 4WJ3M 4UP7A 4DUZL 3JC66 1B8AA 4DV5Q 2B63H 1KAWA 1EIFA 2B29A 3A74A 3KYHC 1HNWL 1PH6A 1PH3A 4B3MQ 1NTGA 3CMAA 1N9WA 2I5LX 1FL0A 2VQEQ 4PZ7A 3RZDH 1AE3A 1VQ4A 1VQPA 4LFAQ 3A0JA 4GOPB 2ASBA 4JI2L 3I4NH 3GTMH 4LF5L 4UP9A 4LF4L 2VUMG 4GN4B 4QQBX 3K81C 4JI1L 3CCLA 3HOXG 1E1OA 2Z6KA 5M3MG 1PVOA 2WB1E 2MO0A 4DR7L 1KD1C 1Q1BA 5BR8Q 1JJCB 1WYDA 3RLFA 4XIGS 4MNOA 1X65A 4GKKQ 4Y52H 4OWWB 2UUAL 1E1TA 4DV3Q 4A3IH 1Q7YC 3I2ZA 4X64Q 2NVTH 1CKMA 1OXTA 3RNUA 1N8RC 3GTOH 1SRUA 4P71A 1VQIA 3BZCA 4UP8A 1V43A 4GN3B 5IYCG 3CCEA 2R92H 3W5OA 1KQSA 4LWCA 1I94Q 2ATWA 4K0KQ 1P16A 1Y1VH 4A93G 4C3IH 4GLVB 3U4ZA 2C35B 4LF7Q 4OX9L 5LMNW 4A3FG 4HIKA 3S2DH 5IYDH 2ZJQA 4LF9L 4OO1G 4GKJQ 4DV4Q 1I6HH 2JK8A 3NEMA 3S14H 4IJLA 4HIOA 1WFQA 1JT8A 2BA0A 1SR3A 3CCQA 1Q12A 1IBLL 4C2MH 2UUCQ 4OO1I 4DV6L 2JA8H 1WOCA 3ZJYC 3MXNB 4BY1G 1YBYA 1IYJB 1Z47A 4JI8Q 4B3SQ 1S72A 4IOAA 1N32L 4X62Q 4KHPL 2JJQA 3G6EA 1XMQL 5LMUL 2BH8A 3H0GH 1VQNA 2K5VA 3HOWG 1X6OA 3ULJA 4HJ5A 3WWVA 1K8GA 4JBMA 4R4CA 4AQYQ 1R9TH 4UY8C 1YVCA 2WAQG 2R93H 2VS1A 4IFDJ 1D8LA 2RHSB 1LTLA 4IOCA 1BKBA 3K80C 4LUVA 3W1GA 3PSIA 3TREA 1PH2A 4JI2Q 5EAYA 4DV5L 4H02A 4IO9A 4A3DH 3AYHB 4GLAC 5GQOA 4BBSH 4A3CG 1Q82C 1Z9FA 3L0OA 3U4VA 5IWAQ 4LF8Q 2JA5H 4DR7Q 2RHQB 3NELA 5JEAJ 2CWPA 4LFAL 3S2HH 1W2BA 2K52A 2XTIA 4NXMQ 1QVGA 1M1KC 4B3RL 1H95A 4JYAL 3RLOA 3I4NG 1V9PA 2UUAQ 2F52A 4GOPC 3STBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M90 C;  2JEB I;  1WCM G;  1X3G A;  2QGQ A;  3FP9 A;  5BR8 L;  1CUK A;  2L15 A;  1EOV A;  1X56 A;  4L5R C;  1HR0 W;  1CKO A;  3PUX A;  1BVS A;  2YTY A;  3E0E A;  4R4T A;  3HKS A;  3CPF A;  3BJU A;  3GO5 A;  2K50 A;  1VQO A;  2YU9 H;  3CAM A;  4GKK L;  1TXY A;  2NVQ H;  4AH6 A;  2ZJP A;  3M4P A;  1MJE A;  3GTL H;  4HJ7 A;  4OX9 Q;  1X55 A;  2LSS A;  3KF6 B;  4P75 A;  2AWN A;  2PI2 A;  4A3I G;  4LF9 Q;  1PHJ A;  1AE2 A;  4Y7N H;  2WB1 G;  2ZTD A;  1U0L A;  4DR1 Q;  1VQD A;  1Y1W H;  2Q2U A;  2UXB L;  3U58 A;  2ALY B;  2HQL A;  3I4M H;  2NVY H;  4A4I A;  4JC0 A;  1EFW A;  4JI0 Q;  1FGU A;  3OYY A;  2JA9 A;  1VQM A;  1IBM L;  3H3V H;  1L0W A;  2WAQ E;  2OTL A;  3S16 H;  4YWL A;  1IBL Q;  1KXL A;  1QZG A;  1Y1V G;  4LF7 L;  2VL6 A;  1Q81 C;  1KIX A;  4BA1 I;  3HKZ E;  4QIW E;  4POG A;  1KL9 A;  4P72 A;  2N3S A;  4GKJ L;  4IFD I;  2F3I A;  5E7N A;  2CWA A;  4JCV E;  1XMQ Q;  5LMU Q;  3H15 A;  4DKA C;  5C44 H;  1K9M C;  4NB3 A;  4A3B H;  3CCU A;  2E8G A;  4LF6 L;  4DAM A;  1YHQ A;  1L2F A;  2UUC L;  3J80 c;  5M3F G;  4DPG A;  1HZB A;  3AFQ A;  3JAM c;  5FLM H;  1K83 H;  3KDF B;  1VQL A;  2VY3 A;  4HJA A;  4RMF A;  1HH2 P;  3OTO Q;  3KF6 A;  2JA8 G;  1VQ6 A;  3GTP H;  3TS2 A;  2IY5 B;  3W1B A;  2YTX A;  4X62 L;  1Q8K A;  4A76 A;  4OWX B;  3TQY A;  3J7A 5;  2Q2H A;  5K36 G;  5ELN A;  1U5K A;  2BA1 A;  4DUY L;  1J5E L;  1IBK Q;  3NBH B;  4AQY L;  1W3S A;  3H0G G;  3VDY A;  5JJI A;  3RZO H;  1MJC A;  4DR4 L;  3J81 c;  1O7I A;  3S1Q H;  4P74 A;  3FKI G;  2R93 G;  3EBE A;  4DR5 L;  5HGQ A;  2MFI A;  1EYG A;  2NVX H;  2JA7 H;  1QZH A;  1JE5 A;  2Y0S G;  1YEZ A;  2R7Z H;  3D31 A;  4B3R Q;  3GDE A;  4JYA Q;  4YWK A;  2VQF L;  3G48 A;  2ZTE A;  4OXP A;  4R4Q A;  5IWA L;  4LF8 L;  3PF4 A;  5FJ8 H;  1EQQ A;  3PO2 G;  4JV5 Q;  4BA2 I;  4QL5 A;  4HIM A;  2EXD A;  5JEA G;  2JA5 G;  4DK6 C;  3KDF A;  1CKN B;  4JBW A;  3D0F A;  1HJP A;  3HOZ G;  2R6G A;  2WFW A;  4NXM L;  1D7Q A;  1S40 A;  1JJ2 A;  2MO1 A;  1HR0 Q;  1LUZ A;  2ZM6 L;  1P8L A;  3STB D;  1XPU A;  5DLQ E;  4JOI A;  1PH5 A;  2CCZ A;  5C4X H;  2DUD A;  4A3J H;  3AQQ A;  2JE6 I;  1X9N A;  4L5Q A;  4A3M H;  3H3V I;  1GO3 E;  1QVF A;  2UXB Q;  1PH9 A;  1VQ8 A;  1UE1 A;  4GOP A;  3M4O H;  1IBM Q;  4IPD A;  1E3P A;  5C3E G;  5IE8 A;  2GVA A;  4LW1 A;  3PO3 H;  2IHE A;  4A3K H;  4A3G H;  2UXD L;  2B3G A;  2CQO A;  3GTQ H;  2N8N A;  4DR1 L;  5LMN L;  3M9B A;  4JI6 L;  4LUZ A;  3CC4 A;  4C3J H;  4JI0 L;  1CKN A;  3PF5 A;  1C7Y A;  4LF6 Q;  4L5T A;  4DV0 L;  1I3Q H;  2CFM A;  1A0I A;  2I5H A;  2K14 A;  5M5X H;  2K4K A;  1Q86 C;  2NZO A;  4HID A;  2Y0S E;  2AKW B;  1FJG L;  3PIO A;  2AHO B;  4BBR G;  3F2B A;  2YTV A;  4JG2 A;  1N33 L;  1XJV A;  2R7F A;  4B3T L;  4L5S A;  1J5E Q;  4DUY Q;  3K0X A;  1N32 Q;  4GNX B;  3U50 C;  2OWO A;  4A3B G;  2Q2I A;  3DM3 A;  4DR4 Q;  2E2I H;  4A3E H;  1XNR Q;  1SRO A;  5M5W H;  3OTO L;  1YNX A;  5C0X J;  3HKZ G;  2AMC B;  5FLM G;  4DR5 Q;  5H1S E;  1VQB A;  1Y14 B;  2IX0 A;  2RCN A;  4QJF A;  3F2D A;  1I5F A;  4R1J A;  2IT1 A;  4GN5 A;  3J80 i;  1IL2 A;  4PG3 A;  2V1C C;  4PZ8 A;  1L1O B;  3ULL A;  4YHH L;  3JAM i;  2VQF Q;  1BBU A;  4APV A;  1IBK L;  4JI4 Q;  4DV1 Q;  1ASZ A;  4HJ8 A;  2B63 G;  2KCM A;  1G51 A;  4DV7 L;  1C0A A;  2ZTC A;  3UE1 A;  4JOI C;  3DLL A;  1BBW A;  3KOJ A;  4ME3 A;  3CME A;  1XMO L;  5HY6 A;  1IXR A;  1MIU A;  2GVB A;  4POF A;  5AJ3 L;  4BY7 H;  2YV5 A;  1TWG H;  1G6P A;  2K5N A;  2HIX A;  2ID0 A;  4TVA B;  2R7Z G;  2ZM6 Q;  3J81 i;  1QUQ B;  3ICE A;  4JV5 L;  2R7D A;  4GNX A;  3S15 H;  2JQO A;  4X65 L;  4MTN A;  2OCE A;  4A3L H;  3HOX H;  1MKH A;  1VCI A;  5M3M H;  3I56 A;  4AIM A;  4IPH A;  4O0A A;  1SLJ A;  4DV2 Q;  1KRS A;  1E7Z A;  1EIY B;  5GAD C;  1HR0 L;  2VNU D;  4DK3 C;  1HNZ L;  1L1O A;  4DR2 Q;  2JEA I;  3HOU H;  1HNX L;  4BXX H;  4IPG A;  5C4J H;  4LFC L;  5C4X G;  5LMN Q;  3OW2 A;  4A3J G;  1E22 A;  4JI6 Q;  4A3M G;  1VQA A;  4IJH A;  1OXS C;  4ALP A;  2R92 G;  1UWV A;  1PH8 A;  4DV0 Q;  2KHJ A;  3E9H A;  5IYC H;  1K0R A;  2OQK A;  4WJ4 A;  1QUQ A;  3HFZ B;  3PUZ A;  1OXU A;  2N78 A;  4GS3 A;  1SFO H;  2UUB Q;  5IYD G;  5IP7 H;  1FJG Q;  3PO3 G;  4A3K G;  4A93 H;  5IYB H;  2K75 A;  3CP0 A;  2E2J H;  2VW9 A;  1N33 Q;  3RR5 A;  4B3T Q;  5C0X I;  1T9H A;  4J15 A;  2MQH A;  3BU2 A;  3LGJ A;  4GLX A;  1RL2 A;  3PCO B;  3CPW A;  3TRZ A;  2AWO A;  4KLK A;  3KF8 B;  5GAG C;  2BH2 A;  3S17 H;  4IPC A;  1VQH A;  2D0P A;  2UXD Q;  1B7Y B;  3AEV A;  3F1Z A;  3I7F A;  2KCT A;  3ULP A;  3CCJ A;  2EIF A;  2PNH A;  2D0O A;  2H5X A;  3ER0 A;  4LUO A;  2K5H A;  3UDX A;  2HT1 A;  2E2H H;  3PV0 A;  1X3E A;  4YHH Q;  3I4O A;  3UDG A;  2JA6 H;  1GM5 A;  4NXN Q;  1X3F A;  1TWF H;  1PYS B;  4IFD G;  1S3O A;  4DV7 Q;  1HZA A;  1XNR L;  3CQZ H;  3IRB A;  4GNX C;  2NZH A;  1XMO Q;  4A3E G;  1N34 L;  3HOY H;  3UE0 A;  5AJ3 Q;  3Q8D A;  4YCU A;  2F4V L;  5JJK A;  2A19 A;  2PQA B;  1V1Q A;  4JI4 L;  1YHA A;  4NPS A;  2OTJ A;  4UPA A;  4OWT B;  4DV1 L;  4A3D G;  1OXV A;  4BBS G;  1L1O C;  4X65 Q;  1CSQ A;  3T1Y L;  5IY0 A;  1X54 A;  1TWC H;  4A3C H;  1N36 L;  3F2C A;  1KC8 C;  4QY7 A;  5ELO A;  1VQF A;  3CCV A;  1EQR A;  3S1N H;  4BY7 G;  4HJ9 A;  1HNZ Q;  1CSP A;  4YCW A;  4JBK A;  1PFS A;  2UU9 L;  1K8A C;  3CD6 A;  3A5Z B;  1PH4 A;  1UE6 A;  2OQ0 A;  4X66 Q;  1HNX Q;  4PZ6 A;  2I5M X;  2N49 A;  3PUY A;  4LFC Q;  1VQE A;  1SE8 A;  3RN2 A;  1YIT A;  4A3L G;  1WCM H;  4DV2 L;  1VQ9 A;  2FXQ A;  3HOV H;  3TEH B;  4DR2 L;  2PQA A;  1KRT A;  3UDF A;  1YJN A;  4JI5 Q;  2MNA A;  3T1H L;  3S24 A;  1JMC A;  4YY3 Q;  3HOU G;  2NN6 I;  4BXX G;  2KEN A;  4JI7 L;  3KFU A;  1Y1W G;  1EUJ A;  3AFP A;  4EQ5 A;  4JBJ A;  3I4M G;  3TS0 A;  1I50 H;  1NE3 A;  4C3H H;  2A1A A;  3CC7 A;  1NJI C;  4DR6 Q;  3GTJ H;  4AYB E;  2UUB L;  2RF4 A;  1XNQ L;  2UXC L;  4X6A H;  2E5L L;  1KHI A;  1SN8 A;  2LXK A;  4KHZ A;  5IP7 G;  4DR3 Q;  3PGZ A;  5IYB G;  1FVI A;  3FHW A;  2HIV A;  1RIP A;  1DGS A;  3KJO A;  5IP9 H;  2Z0S A;  5C44 G;  4R4O A;  2HHH L;  4JI3 Q;  4MZ9 A;  4DAY B;  3CF5 A;  2NN6 G;  1YJ9 A;  1A63 A;  1UEB A;  2VZA A;  3PUV A;  1XPR A;  3M7N A;  1N34 Q;  5JJL A;  1G29 1;  1Q46 A;  4YCV A;  5M3F H;  4DR6 L;  3PIP A;  1PA6 A;  3EIV A;  1J6Q A;  3I55 A;  4OON A;  5IT9 c;  3K7U C;  2Q2T A;  4NXN L;  3CCS A;  3M85 A;  1XPO A;  3CXC A;  1VQ7 A;  3CW2 C;  4LFB L;  2JA6 G;  3T1Y Q;  1JB7 A;  3GD7 A;  4DUZ Q;  1N36 Q;  2D62 A;  3NEN A;  4O2D A;  3L7Z C;  1HNW Q;  2ZJR A;  3HOY G;  2PI2 E;  2JA7 G;  4KI0 A;  1OTC A;  4LNQ A;  3FKI H;  2DGY A;  2Z6K C;  2UU9 Q;  2IX1 A;  1OXX K;  5FJ8 G;  2VUM H;  4FDB A;  1HZC A;  1NY4 A;  1QVC A;  5GAH C;  4LF5 Q;  3G4S A;  4LF4 Q;  3PO2 H;  4PMW A;  4JI1 Q;  1NBW A;  4B3M L;  1A8V A;  1IZ6 A;  3BZK A;  3E9I A;  3PUW A;  4EX5 A;  2VQE L;  3HOZ H;  4X66 L;  5GRO A;  3T1H Q;  4JI7 Q;  1NMF A;  2GN5 A;  4XTC S;  2KHI A;  4TQU S;  5M5Y H;  3L2P A;  3CC2 A;  3B6Y A;  1B70 B;  1YIJ A;  3CCR A;  3J81 j;  3HOV G;  1LM0 A;  4JI5 L;  3UDI A;  2A8V A;  3K8A A;  1XNQ Q;  1K3R A;  2UXC Q;  2I0Q A;  4A3G G;  5C3E H;  2E5L Q;  2KBN A;  4YY3 L;  4P73 A;  1PH1 A;  1YHB A;  1YZ6 A;  4A3F H;  1ASY A;  3RLN A;  3F8T A;  3RN5 A;  1JJG A;  2IHF A;  4DV3 L;  4QGU A;  4DNI A;  5J3B A;  4X64 L;  1WI5 A;  2F4V Q;  2YYZ A;  3KLW A;  2HHH Q;  3MEF A;  2EQS A;  1K73 C;  1YI2 A;  1XTD A;  1VQJ A;  3G71 A;  1NMG A;  1WJJ A;  3KJP A;  3K7A H;  3S1R H;  1YJW A;  1I94 L;  4DR3 L;  4K0K L;  2PMZ E;  1A62 A;  2LXJ A;  1VQG A;  3M4Q A;  1PV4 A;  1PYB A;  4RG1 A;  1PH7 A;  3EN2 A;  5GAE C;  4DV6 Q;  3J7Z C;  1VQK A;  4BY1 H;  3M3Y H;  1VS0 A;  1UE5 A;  4BBR H;  1SMX A;  4A75 A;  4JI3 L;  1TWA H;  4LFB Q;  1GKH A;  1TWH H;  5IP9 G;  5FLX c;  1Q1E A;  1LYL A;  1EWI A;  1VQC A;  4DV4 L;  3HOW H;  5C0X G;  3CCM A;  4KHP Q;  4AYB G;  1AH9 A;  3SGI A;  1E24 A;  2XGT A;  1UE7 A;  3ERS X;  1GD7 A;  2QA4 A;  3GTK H;  3S1M H;  4YWM A;  2CKZ B;  2QEX A;  2WP8 J;  1HZ9 A;  1C9O A;  2ES2 A;  3A5U A;  1GVP A;  4JI8 L;  3GTG H;  4B3S L;  1VQ5 A;  4R4I A;  4WJ3 M;  4UP7 A;  4DUZ L;  3JC6 6;  1B8A A;  4DV5 Q;  2B63 H;  1KAW A;  1EIF A;  2B29 A;  3A74 A;  3KYH C;  1HNW L;  1PH6 A;  1PH3 A;  4B3M Q;  1NTG A;  3CMA A;  1N9W A;  2I5L X;  1FL0 A;  2VQE Q;  4PZ7 A;  3RZD H;  1AE3 A;  1VQ4 A;  1VQP A;  4LFA Q;  3A0J A;  4GOP B;  2ASB A;  4JI2 L;  3I4N H;  3GTM H;  4LF5 L;  4UP9 A;  4LF4 L;  2VUM G;  4GN4 B;  4QQB X;  3K81 C;  4JI1 L;  3CCL A;  3HOX G;  1E1O A;  2Z6K A;  5M3M G;  1PVO A;  2WB1 E;  2MO0 A;  4DR7 L;  1KD1 C;  1Q1B A;  5BR8 Q;  1JJC B;  1WYD A;  3RLF A;  4XIG S;  4MNO A;  1X65 A;  4GKK Q;  4Y52 H;  4OWW B;  2UUA L;  1E1T A;  4DV3 Q;  4A3I H;  1Q7Y C;  3I2Z A;  4X64 Q;  2NVT H;  1CKM A;  1OXT A;  3RNU A;  1N8R C;  3GTO H;  1SRU A;  4P71 A;  1VQI A;  3BZC A;  4UP8 A;  1V43 A;  4GN3 B;  5IYC G;  3CCE A;  2R92 H;  3W5O A;  1KQS A;  4LWC A;  1I94 Q;  2ATW A;  4K0K Q;  1P16 A;  1Y1V H;  4A93 G;  4C3I H;  4GLV B;  3U4Z A;  2C35 B;  4LF7 Q;  4OX9 L;  5LMN W;  4A3F G;  4HIK A;  3S2D H;  5IYD H;  2ZJQ A;  4LF9 L;  4OO1 G;  4GKJ Q;  4DV4 Q;  1I6H H;  2JK8 A;  3NEM A;  3S14 H;  4IJL A;  4HIO A;  1WFQ A;  1JT8 A;  2BA0 A;  1SR3 A;  3CCQ A;  1Q12 A;  1IBL L;  4C2M H;  2UUC Q;  4OO1 I;  4DV6 L;  2JA8 H;  1WOC A;  3ZJY C;  3MXN B;  4BY1 G;  1YBY A;  1IYJ B;  1Z47 A;  4JI8 Q;  4B3S Q;  1S72 A;  4IOA A;  1N32 L;  4X62 Q;  4KHP L;  2JJQ A;  3G6E A;  1XMQ L;  5LMU L;  2BH8 A;  3H0G H;  1VQN A;  2K5V A;  3HOW G;  1X6O A;  3ULJ A;  4HJ5 A;  3WWV A;  1K8G A;  4JBM A;  4R4C A;  4AQY Q;  1R9T H;  4UY8 C;  1YVC A;  2WAQ G;  2R93 H;  2VS1 A;  4IFD J;  1D8L A;  2RHS B;  1LTL A;  4IOC A;  1BKB A;  3K80 C;  4LUV A;  3W1G A;  3PSI A;  3TRE A;  1PH2 A;  4JI2 Q;  5EAY A;  4DV5 L;  4H02 A;  4IO9 A;  4A3D H;  3AYH B;  4GLA C;  5GQO A;  4BBS H;  4A3C G;  1Q82 C;  1Z9F A;  3L0O A;  3U4V A;  5IWA Q;  4LF8 Q;  2JA5 H;  4DR7 Q;  2RHQ B;  3NEL A;  5JEA J;  2CWP A;  4LFA L;  3S2H H;  1W2B A;  2K52 A;  2XTI A;  4NXM Q;  1QVG A;  1M1K C;  4B3R L;  1H95 A;  4JYA L;  3RLO A;  3I4N G;  1V9P A;  2UUA Q;  2F52 A;  4GOP C;  3STB C; 
#chains in the Genus database with same CATH topology
 1ICW A;  2JEB I;  5CBE E;  2B8F A;  2QGQ A;  3K5N A;  5BR8 L;  1IL8 A;  3I73 A;  1X56 A;  2KA7 A;  2YTY A;  3ONA B;  2EYP A;  3E0E A;  3HKS A;  3I8Z A;  3GP7 A;  2G9D A;  4OX9 Q;  2UXD Q;  2AWN A;  4JVZ A;  5LL6 S;  4KD3 A;  2K6A A;  2UXB L;  2ALY B;  3OHX C;  2NVY H;  1CQF A;  1EU3 A;  1EFW A;  1IBM L;  2G9H D;  3EFX D;  3S16 H;  1KXL A;  4YWL A;  1X32 A;  2VL6 A;  1Q81 C;  2CH4 W;  4BY1 B;  4QIW E;  1S5F D;  1TWF B;  2N3S A;  1IW7 D;  4FXD A;  2F3I A;  5E7N A;  1XMQ Q;  1K9M C;  2E8G A;  2EDG A;  1L2F A;  5E1F A;  2UUC L;  5M3F G;  4RGM A;  1CFM A;  4DPG A;  1T5X D;  1VQL A;  2VY3 A;  4RMF A;  1HH2 P;  2IY5 B;  1RCV D;  2HDM A;  3SR1 A;  3AB9 A;  4OWX B;  5K36 G;  1F9Q A;  2F0P A;  5ELN A;  1U5K A;  2K01 A;  1IBK Q;  3H0G G;  3TZU A;  3S1N B;  3VDY A;  1B53 A;  5JJI A;  3T13 A;  1I4G A;  3P1H A;  3S1Q H;  1MI2 A;  2MGS A;  4UDU C;  5E4W C;  2R93 G;  5D65 A;  1B9N A;  1JE5 A;  3A56 A;  3D31 A;  3I90 A;  1A3U A;  4B3R Q;  3N52 A;  4R4Q A;  3NP8 A;  3NK9 A;  2EXD A;  4L63 B;  5JEA G;  5BN4 A;  1CKN B;  1LAB A;  5KGU A;  1EYD A;  2R6G A;  4NXM L;  1D7Q A;  1S40 A;  2MO1 A;  2X6G A;  3M4Y A;  1DCZ A;  5EBD A;  2NVT B;  2DUD A;  1EYA A;  2F3W A;  2CVR A;  4L5Q A;  1X9N A;  2F03 A;  1GO3 E;  3L3O C;  3A8I E;  2PZT A;  4IPD A;  1E3P A;  1YNJ C;  1S5B D;  5C3E G;  4C3I B;  1IKM A;  4CJ1 B;  1II3 A;  3DWP A;  4A3G H;  4B9W A;  5DM7 3;  1LV9 A;  5LMN L;  3M9B A;  4JI6 L;  1CKN A;  4ZQ3 A;  3VA5 A;  1KLG D;  3W2D A;  4QF4 A;  4L5T A;  1BOS A;  2JA8 B;  2E2D C;  1A0I A;  2K14 A;  5M5X H;  2K4K A;  5CYU A;  3VYT A;  1QCB D;  2YTV A;  3IFT A;  2KVM A;  4GNX B;  2KCN A;  4A3B G;  1IYV A;  2RVL A;  3FKI B;  4DR4 Q;  3LWE A;  3OTO L;  1YNX A;  1JC7 A;  1Y14 B;  2IX0 A;  2XNA C;  4R1J A;  3BG3 A;  1C48 A;  2V1C C;  3ULL A;  1SNQ A;  1ASZ A;  2A69 C;  1RD9 D;  2ZTC A;  3HOZ B;  1Y69 U;  2C9O A;  3OIP A;  1G91 A;  1IXR A;  4POF A;  1Q90 A;  1JOQ A;  1H9R A;  2YV5 A;  2XSC A;  2HIX A;  2R7Z G;  5M5Y B;  4LJZ C;  1DON A;  4GNX A;  2JQO A;  4FNF A;  2F0W A;  3HOX H;  1MKH A;  1I4R A;  2EY5 A;  1MBY A;  4ABN A;  4O0A A;  1SLJ A;  4R9W A;  1HNZ L;  4DR2 Q;  2JEA I;  1GUW A;  1WD1 A;  4BXX H;  1AEX A;  4LFC L;  3VYU A;  5C4X G;  1NR2 A;  1OO9 B;  4IJH A;  2R92 G;  1UWV A;  1YNJ D;  4IUN A;  1PH8 A;  3M3Y B;  2EYM A;  1OXU A;  1FJG Q;  3T51 B;  4A3K G;  4RGN A;  2VW9 A;  1N33 Q;  1G6Z A;  3S1M B;  2DNE A;  1L0X B;  2MQH A;  4C3J G;  2WAQ B;  2AWO A;  3NQI A;  5GAG C;  1ESR A;  3HKZ B;  3ERQ A;  1WVL A;  1LT6 D;  1GHK A;  2EIF A;  2B63 B;  2G5D A;  4YHH Q;  3ND8 A;  4G7O C;  1F9P A;  3HG9 A;  5C5L A;  1EZ6 A;  4IZ8 A;  4NXN Q;  4IFD G;  1S3O A;  1HZA A;  5CC4 A;  4GNX C;  4UHV A;  1W6J A;  3UE0 A;  2RDF A;  4YCU A;  1BUV T;  3DHQ A;  2OTJ A;  4OWT B;  2A69 D;  5K5P A;  4X65 Q;  3C1E A;  4ZYS A;  1TWC H;  3F2C A;  3I72 A;  1KC8 C;  3OOC A;  1EQR A;  2KEE A;  1CSP A;  3NBH A;  4X66 Q;  5FLX L;  3IKJ A;  3RN2 A;  4K8I A;  4A3L G;  4JW0 A;  1CM9 A;  2A68 C;  4DV2 L;  2FXQ A;  1VQ9 A;  3TEH B;  1MSH A;  2B2W A;  2IJ0 A;  5IGF A;  3UDF A;  1EL0 A;  2K05 A;  1D6E C;  2MNA A;  1E2Z A;  1JMC A;  4KKS A;  3S24 A;  1RTN A;  3HOU G;  2F0T A;  2KEN A;  4EQ5 A;  4JBJ A;  1EWC A;  2O4X A;  1GUG A;  1NJI C;  1I50 H;  2RDG A;  5COY A;  1A15 A;  3R8B A;  3LNN A;  4J6H A;  4X6A H;  5CV7 A;  1KHI A;  2E5L L;  2LXK A;  2EPB A;  3PGZ A;  5IYB G;  2F0F A;  3FHW A;  4WOR A;  2PYK A;  4K5X A;  2N88 A;  4MZ9 A;  3CF5 A;  1A3T A;  2NN6 G;  1HQM C;  1N34 Q;  1G29 1;  4PMB A;  1J6Q A;  2JXM B;  4QUF A;  4A3D B;  5IT9 c;  2Q2T A;  3MFY A;  2AQ3 B;  5CBA E;  3CCS A;  3M85 A;  3CW2 C;  2JA6 G;  5EKI A;  2RCF A;  3K0Y A;  1VF5 C;  1N36 Q;  3QWN A;  1HNW Q;  1VF7 A;  3HOY G;  1OTC A;  4LNQ A;  4GZY C;  1LT5 D;  2B2W C;  3TP8 A;  2MJ8 A;  3G4S A;  1EY9 A;  3PO2 H;  2EY2 A;  2F0H A;  3FMC A;  1A8V A;  4EX5 A;  3PUW A;  1S5E D;  2VQE L;  4X3T A;  3VYR A;  5GRO A;  1Y1W B;  3H94 A;  2M00 A;  3RMH A;  4JI7 Q;  3QOJ A;  3L2P A;  2A68 D;  2NTT A;  3E5S A;  3CCR A;  2KEC A;  3HOV G;  3QOL A;  1FNW A;  1U4P A;  3UDI A;  4FXG C;  1WTO A;  2UXC Q;  2I0Q A;  4A3G G;  2KUM A;  3OWE B;  4KJN A;  4P73 A;  1PH1 A;  1YHB A;  1YZ6 A;  3T56 B;  4JPB W;  3F8T A;  4DNI A;  2DNC A;  4CDE C;  4RKB A;  2HHH Q;  2A74 C;  2EQS A;  1NMG A;  1WJJ A;  1A2T A;  3K7A H;  1YJW A;  4K0K L;  2LXJ A;  3K59 A;  2X6L A;  1PYB A;  4RG1 A;  1F2L A;  4DV6 Q;  3IFD A;  2RKS A;  3OWF A;  1FNU A;  4NW2 A;  5IP9 G;  1LYL A;  3CCM A;  3KUP A;  1SMY C;  2QA4 A;  1ONL A;  4O1N A;  1S4Z A;  1ZYR D;  1C9O A;  4DXF A;  3DXJ C;  2DJG C;  4JI8 L;  3GTG H;  4WJ3 M;  1IKL A;  1O7Z A;  1SSO A;  1TWC B;  2RQX A;  4UP7 A;  4DV5 Q;  1ILP A;  1KAW A;  3KYH C;  3A74 A;  1FL0 A;  4YIJ A;  4LFA Q;  1JR0 D;  1JB3 A;  1SNP A;  2O2L D;  4LF5 L;  4LF4 L;  2VUM G;  3HOX G;  2K03 A;  2Z6K A;  2I46 A;  3PO3 B;  5BR8 Q;  4FXK C;  3RLF A;  4MNO A;  4OWW B;  5KNC A;  2UUA L;  5JVH 3;  1E1T A;  1G2S A;  3GTO H;  4X64 Q;  1CKM A;  1A3V A;  4C1N K;  1V1P B;  4UP8 A;  2O5J C;  1WTX A;  4RCN A;  2ATW A;  1K8M A;  1HPC A;  4GLV B;  1SAP A;  3A8J E;  5IYD H;  1HFN A;  1IYU A;  3NBI A;  4N8X 1;  5C4Z A;  1B50 A;  4AYB B;  3PIP 3;  4DV4 Q;  1X3Q A;  2NBF A;  4HIO A;  4KN7 C;  2K28 A;  1SR3 A;  1IBL L;  4C2M H;  2UUC Q;  1TVX A;  1Y8N B;  2A5H A;  3MXN B;  1G8Z D;  5K36 H;  1S72 A;  1V1P A;  5LMU L;  3H0G H;  1SBB B;  1STA A;  3RD4 A;  4ZUJ A;  3QR8 A;  3MC0 B;  2R93 H;  2RHS B;  3W1G A;  1PH2 A;  5KYI A;  4R8I A;  2NYZ D;  4BBS H;  4NP5 A;  2PZW A;  2RHQ B;  3NEL A;  1T5E A;  3C1F A;  5C4J B;  4NXM Q;  1M1K C;  1V9P A;  4RAU C;  2F52 A;  4IUP A;  1M90 C;  1ENC A;  1X3G A;  4DXG A;  4L5R C;  1BVS A;  5FOB B;  1QE6 A;  1B2T A;  2E2J B;  3NQT A;  3CAM A;  2NVQ H;  4AH6 A;  1X55 A;  2LSS A;  1DM0 B;  3S17 B;  2ZTD A;  1VQD A;  2Q2U A;  1SYF A;  3U58 A;  2HQL A;  3WOE A;  2XRQ D;  2PQE A;  4A4I A;  3K7A B;  3H3V H;  5F2D A;  2LS0 1;  2WAQ E;  2OTL A;  2E2H B;  1QZG A;  1Y1V G;  3VA7 A;  3HKZ E;  2SEB D;  2JP1 A;  2AUJ D;  4IFD I;  4DKA C;  5C44 H;  4A3B H;  1W6K A;  4RGO S;  2AUK A;  1ICF B;  3AFQ A;  1LTS D;  1K83 H;  4OO1 G;  5IT9 E;  1VQ6 A;  3OTO Q;  2J0T D;  3W1B A;  3J7Y W;  3J7A 5;  2Q2H A;  4OGQ C;  1J5E L;  2BA1 A;  4DUY L;  1MJC A;  4P74 A;  5CV8 A;  5HGQ A;  2JA7 H;  1QZH A;  4FF3 A;  2R7Z H;  1YEZ A;  3MAQ A;  4JYA Q;  4YWK A;  2VQF L;  4OXP A;  4CHT B;  3PO2 G;  2Z6B A;  1FR3 A;  1EQQ A;  4KJO A;  4KKU A;  4V0B A;  4DK6 C;  3FVQ A;  2JA5 G;  4N8F A;  2PNR C;  1F77 A;  3VYS A;  1H9S A;  3V96 A;  4ILW A;  5IGC A;  1JJ2 A;  2ZM6 L;  1P8L A;  3GTO B;  2E75 C;  2H1E A;  4JOI A;  5DLQ E;  5C4X H;  4IN3 A;  1C8C A;  1PTO B;  1SNO A;  1UEA B;  3HRZ C;  3C3L A;  2K1B A;  1LTG D;  3BVM A;  1DOM A;  5E3F A;  2IHE A;  4A3K H;  3C2P A;  1XYI A;  2B3G A;  2CQO A;  1R4Q B;  1YNN D;  2K5D A;  3CC4 A;  4C3J H;  1J8I A;  2EYJ A;  5KIX A;  3PF5 A;  5M3F B;  2GA4 B;  4XXE A;  4LF6 Q;  1KNA A;  1I3Q H;  1TR5 A;  4IUU A;  1Q86 C;  2AHO B;  3MXU A;  4JG2 A;  4L5S A;  1WTW A;  3H0G B;  1XXG A;  5I9O A;  3U50 C;  1EY7 A;  2K7V A;  2Q2I A;  2E2I H;  2R93 B;  3HEJ A;  1SRO A;  5M5W H;  4WFN 3;  1D1I A;  5C0X J;  2AMC B;  4DR5 Q;  2M9V A;  1BO0 A;  4P2C B;  2EJF C;  4N9T A;  1IL2 A;  3ERO A;  5EQ0 A;  4PG3 A;  1KDC A;  4APV A;  2KCM A;  1EU4 A;  4PQX A;  1SEB D;  3UE1 A;  1EFI D;  1ENA A;  3ZYY X;  4JOI C;  5IOC A;  4B08 A;  3KOJ A;  3CME A;  4ME3 A;  1XMO L;  5JJZ A;  1MIU A;  5AJ3 L;  1HRJ A;  1HTP A;  3OPO A;  3RUZ A;  4EQO A;  1TWG H;  1BCP B;  2ID0 A;  2L0C A;  3TME A;  3ICE A;  4JV5 L;  3S15 H;  3D4R A;  4F88 A;  4MTN A;  4RFB A;  2ZXP A;  4A3L H;  3DMU A;  3K5O A;  5C3E B;  4RCO A;  3I56 A;  2VNU D;  4DV2 Q;  4A3F B;  3D4W A;  5C5M A;  3L9A X;  5IT9 L;  2NVQ B;  4KHV A;  2F3V A;  4R8N A;  5ELB A;  3HOU H;  4C56 C;  1E22 A;  1VQA A;  3FEW X;  4X3K A;  4CDF C;  4M1U B;  4CKE A;  1OXS C;  1PFM A;  1PTO C;  2KED A;  4DV0 Q;  2R3Z A;  3E9H A;  1J9O A;  3HFZ B;  3PUZ A;  2WKD A;  5IYD G;  4ID6 A;  4A93 H;  4H0L C;  5IYB H;  4B3T Q;  3K5M A;  1TY2 A;  4J15 A;  4A3B B;  3CPW A;  2L1B A;  2EY6 A;  2NN6 H;  3H09 A;  3KF8 B;  4IQZ A;  5C3W A;  2BH2 A;  3NTK A;  1EQV A;  2L11 A;  3CCJ A;  2PNH A;  3MEH A;  4LUO A;  2HT1 A;  2K5H A;  3CKI B;  1RJT A;  3UDG A;  2JA6 H;  5ELC A;  4DV7 Q;  1CTM A;  3SE0 A;  4HMI A;  3HOY H;  2R7Z B;  3E3X A;  2F4V L;  5JJK A;  1BR9 A;  5FK9 C;  4UPA A;  4BBS G;  1BXT A;  5C6A A;  1O7L A;  3KF8 A;  4ZK9 B;  3MXG A;  1CSQ A;  4K6L A;  1A6X A;  1X54 A;  1AZP A;  4A3C H;  4IUQ A;  1M8A A;  4QY7 A;  1GUT A;  2NZ1 D;  4JBK A;  1PFS A;  3VR2 A;  2UU9 L;  2XVS A;  3A5Z B;  1PH4 A;  1UE6 A;  5C4X B;  1HNX Q;  1BCP C;  2I5M X;  3PUY A;  4XYO A;  2R92 B;  1CZW A;  4EVO A;  5JPM C;  1WCM H;  2TSS A;  3HOV H;  4K2L A;  1WTH A;  4EQP A;  1KRT A;  4RHS A;  4A3K B;  1YJN A;  4MN3 A;  1HFG A;  1X3P A;  3KFU A;  1PTO D;  4DA2 A;  4C3H H;  2A1A A;  4AYB E;  4BS9 A;  2UUB L;  3H3V C;  4KHZ A;  2RSN A;  3OW7 A;  1PFB A;  1SYC A;  1PTO F;  2E74 C;  1DGS A;  5IP9 H;  5C44 G;  1R9T B;  5FO8 B;  4DAY B;  4XQQ A;  1A63 A;  2Y0S B;  2VZA A;  3PUV A;  2F0Q A;  2EY1 A;  1Q46 A;  4YCV A;  4DR6 L;  1PA6 A;  3EIV A;  2D5D A;  1XPO A;  5I6W A;  1CK1 A;  3T1Y Q;  4KV6 A;  3NEN A;  3TDQ A;  2JA7 G;  1ILQ A;  2A6E C;  1WTV A;  1U4L A;  2Q8T A;  2NTS A;  2VUM H;  4FDB A;  1KLU D;  1C4Q A;  4DAY A;  4LF5 Q;  2BE5 C;  4LF4 Q;  2SOB A;  3X3M A;  4BWG B;  1VMP A;  2RBM A;  5I6Y A;  4B3M L;  5IGG A;  3E9I A;  3A55 A;  1AFP A;  2NB0 A;  3HOU B;  2RA4 A;  4MIU A;  3T1H Q;  1PZJ D;  3QIA A;  2NVY B;  1NMF A;  2QDB A;  3S16 B;  3CC2 A;  1LM0 A;  2A8V A;  2KJX A;  1XNQ Q;  3BZD B;  2KBN A;  4YY3 L;  4H44 C;  1JJG A;  2PZU A;  3CHB D;  2HQE A;  4DU9 A;  1AZQ A;  4FVM A;  2YYZ A;  3KLW A;  3MEF A;  3O13 A;  1H9J A;  1JQY D;  3VR4 A;  3G6J B;  1VQJ A;  3G71 A;  2LFN A;  3EA6 A;  1I94 L;  2HD3 A;  2XN9 C;  4DR3 L;  1EY0 A;  1VQG A;  4I7Z C;  3NE5 B;  5BN3 A;  5GAE C;  2AQ1 B;  1VQK A;  2JA6 B;  4BBR H;  1SMX A;  4A75 A;  1TWA H;  4EQN A;  1TWH H;  4FO2 A;  4LFB Q;  2HCI A;  1EWI A;  3WOF A;  3S1Q B;  4LAA A;  3SGI A;  1E24 A;  1ET6 A;  1QB5 D;  3BYY B;  3MFG A;  3NTI A;  3NHH A;  3K57 A;  3C46 A;  4B3S L;  4OO1 H;  3GV6 A;  1EIH A;  1B8A A;  4RWS C;  4MHE A;  5EKK A;  4CJ0 B;  2L12 A;  1CT1 D;  3CMA A;  1EY5 A;  2A6E D;  1VQP A;  2SNM A;  1JWM D;  3DEO A;  3A0J A;  4GOP B;  1PFN A;  4JI2 L;  3D4D A;  1SE3 A;  4OEL B;  3GTM H;  4UP9 A;  2BE5 D;  4QQB X;  4DN4 M;  5D3D A;  3HOV B;  1PVO A;  1S5C D;  4DR7 L;  4XQN A;  1KD1 C;  4A3G B;  5D14 A;  4IUV A;  4QUC A;  3E6Z X;  4DV3 Q;  1Q7Y C;  1N8R C;  4P71 A;  4LMQ D;  3BZC A;  4GN3 B;  5M5X B;  4WJW A;  5DM6 3;  1Y1V H;  4A93 G;  4OIK A;  2NWG A;  4OX9 L;  3S2D H;  4HIK A;  3U9S A;  2ZJQ A;  2XWJ B;  5KNB A;  3OMG A;  1V8Q A;  2F0E A;  1I6H H;  3BVZ A;  2JK8 A;  3S14 H;  3DWA A;  2BA0 A;  1Q12 A;  3K58 A;  3FPU B;  1WTQ A;  3EVQ A;  1AN8 A;  1WOC A;  1D1K A;  3D6W A;  1YBY A;  1ROD A;  2XIW A;  1ESF A;  3BDL A;  2JJQ A;  3G6E A;  1XMQ L;  3SDZ A;  1VQN A;  3HOW G;  2IW3 A;  4R4C A;  2WAQ G;  4L6T B;  1WD0 A;  3QO2 A;  3K80 C;  4LUV A;  2VUM B;  3PSI A;  3TRE A;  2BDN A;  2A6H C;  3HOX B;  4DAP A;  1KDB A;  4GLA C;  4A3C G;  1Z9F A;  3L0O A;  3U4V A;  2JA5 H;  3I70 A;  2Q8R E;  4DF7 A;  3S2H H;  5ISR A;  3MZ5 A;  4XT3 B;  1QVG A;  4B3R L;  2IPK D;  1H95 A;  3MTS A;  3I4N G;  4HSP A;  3STB C;  4GOP C;  2F0K A;  2SDF A;  1WCM G;  1B4O A;  1EZ8 A;  1CUK A;  2F0U A;  1EOV A;  4Q5V A;  1HR0 W;  3PUX A;  1GHJ A;  4HMJ A;  5DEH A;  1HUM A;  2FMM A;  3CPF A;  4GKK L;  2K50 A;  4ULL A;  2YU9 H;  5KYL A;  2EJM A;  1TXY A;  1E2W A;  3M4P A;  4HJ7 A;  1LLR D;  1VMC A;  2PI2 A;  5I2X A;  4A3I G;  4LF9 Q;  4C3H G;  2WB1 G;  1U0L A;  2B2V A;  3I4M H;  4JC0 A;  2Z8L A;  2QCP X;  3S9W A;  4ZAI A;  4LF7 L;  2F1M A;  1KIX A;  4BA1 I;  4POG A;  1HCZ A;  4P72 A;  4GKJ L;  1TWH B;  2ICE C;  2CWA A;  1EQT A;  4JCV E;  3H15 A;  2PMZ B;  3CCU A;  2Z4H A;  4EGV A;  1STB A;  4HSV A;  3J80 c;  1B1Z A;  1JCK B;  3GTP H;  1FYC A;  3TS2 A;  2YTX A;  4XQJ A;  4PV1 C;  4QCL A;  1EYC A;  2B2U A;  4AQY L;  1W3S A;  2WIN B;  1D5M C;  2XWB B;  3RZO H;  4DR4 L;  1O7I A;  1E2V A;  3R3O A;  5FO9 B;  2MFI A;  1EYG A;  2NVX H;  3F2U A;  3TN2 A;  2A6H D;  2ZTE A;  4KN4 C;  1EIG A;  5IWA L;  1MHW C;  4JV5 Q;  1HA5 A;  1QIL A;  1DZ1 A;  4KY5 A;  4S3S A;  2D2C C;  3A7A B;  1HJP A;  2MPM A;  3NUC A;  2B2V C;  4RH6 A;  4FYD A;  4RA8 A;  3STB D;  5EPJ A;  1Q8I A;  1I50 B;  4F87 A;  1PH5 A;  5A2Q E;  2CCZ A;  4ZRZ A;  3AQQ A;  3I91 A;  3H3V I;  2MUY A;  1QVF A;  2UXB Q;  1PH9 A;  1UE1 A;  2I07 B;  2HCC A;  3M4O H;  1IBM Q;  5IE8 A;  4LW1 A;  1CI3 M;  3S2D B;  4IUR A;  1BBX C;  4G4K A;  3GTQ H;  4DR1 L;  1F2Y A;  2EVB A;  1V1O A;  2BDO A;  5TSS A;  4JI0 L;  1GXD C;  1TT2 A;  1KAB A;  3NWS A;  1HHV A;  2B2U C;  2X69 A;  1I4P A;  2I5H A;  1RTO A;  1FJG L;  2EYH A;  2NZO A;  3G7L A;  2Y0S E;  2AKW B;  3PIO A;  3F2B A;  4BBR G;  1LTR D;  1N33 L;  1XJV A;  2R7F A;  1SMY D;  3K0X A;  3SXH A;  5M9O A;  2IL8 A;  5C0X H;  3DM3 A;  3JAM E;  4FF4 A;  3K5L A;  5FLM G;  1K3B C;  4QJF A;  3F2D A;  1I5F A;  3V2T A;  2IT1 A;  2QEJ C;  1PDQ A;  4GN5 A;  3J80 i;  3U9O A;  4PZ8 A;  1L1O B;  5CGK A;  4YHH L;  2F4V Q;  3PO2 B;  1BBU A;  1SYD A;  4KMU C;  3Q0A A;  1DYQ A;  4HJ8 A;  1G51 A;  1NAP A;  1C0A A;  3Q24 A;  1BBW A;  3S2H B;  1K0S A;  1PLF A;  3MXN A;  5C4H A;  4OHJ A;  2GVB A;  2K5N A;  4TVA B;  1G2T A;  5E4X A;  1QOH A;  1H9M A;  1QUQ B;  3SEB A;  1B3Q A;  1SE4 A;  4X65 L;  3PQI A;  3SK8 A;  1VCI A;  5M3M H;  1HTL D;  3PMF A;  2YU9 B;  1HR0 L;  4NKL A;  1L1O A;  5LMN Q;  4A3J G;  1SNC A;  4JI6 Q;  4A3M G;  2EYO A;  2FIN B;  2KHJ A;  4WJ4 A;  1QUQ A;  2UUB Q;  2JSO A;  3PO3 G;  1EY4 A;  1O7Y A;  1MD2 D;  1DXM A;  3RR5 A;  5T1I A;  1LTA D;  5ELD A;  1T9H A;  3BU2 A;  2JYO A;  1RL2 A;  3PCO B;  3TRZ A;  1LTT D;  1H9K A;  1VQH A;  1F2M A;  1O80 A;  3GTG B;  1B7Y B;  3AEV A;  2EJG C;  4DR6 Q;  5FKA C;  3URY A;  2H5X A;  3ER0 A;  3UDX A;  2PO4 A;  1SDF A;  3PV0 A;  5IOD A;  5A2Q L;  1GM5 A;  1TWF H;  1XNR L;  3IRB A;  1SYB A;  4K5W A;  2NZH A;  2F0I A;  4A3E G;  5KEE A;  1N34 L;  3Q8D A;  2A19 A;  1NR4 A;  1V1Q A;  4JI4 L;  4NPS A;  2Z9H A;  3V05 A;  4DV1 L;  5CV5 A;  4CDD C;  1L1O C;  5IY0 A;  1N36 L;  3R2T A;  3S1N H;  4BY7 G;  1HNZ Q;  4YCW A;  3CD6 A;  1STG A;  1R4P B;  4PZ6 A;  4LFC Q;  1SE8 A;  2K5Q A;  3OSO A;  2F0D A;  5BN5 A;  4QB4 A;  1JOK A;  1XX8 A;  1LTB D;  3A8K E;  4KTA A;  1JOR A;  3D6C A;  5EJW A;  3KK7 A;  5JPN C;  2WKC A;  4O42 A;  4YY3 Q;  2NN6 I;  3QB3 A;  4JI7 L;  1GUN A;  3GV3 A;  2K5W A;  4G7H C;  3I4M G;  1VDZ A;  1CQV A;  4C2M B;  3MXP A;  2UXC L;  3A54 A;  1SN8 A;  4DR3 Q;  1STE A;  5IP7 G;  4TSS A;  1FVI A;  1DOK A;  2Z4I A;  4U67 3;  1RIP A;  2Z0S A;  5C3X A;  2HHH L;  1K28 A;  3J80 E;  1YJ9 A;  5AFW A;  1UEB A;  1XPR A;  1FD7 D;  3I55 A;  4OON A;  4BBS B;  3K7U C;  3CXC A;  2F0J A;  5JOB A;  3TP5 A;  3Q6S A;  1GUO A;  2D62 A;  4O2D A;  2L9H A;  2KOL A;  3ND9 A;  5T1G A;  2PI2 E;  2ZJR A;  3AMU A;  3FKI H;  2DGY A;  2MHV A;  2IX1 A;  1HZC A;  1ML0 D;  1NY4 A;  3J7A V;  2PW7 A;  4KY7 A;  3SK6 A;  1DJR D;  1NBW A;  2F0S A;  3BZK A;  5HGT A;  4G7Z C;  1PMR A;  3P75 A;  3HOZ H;  3TSS A;  3SK4 A;  1LT3 D;  4DNT B;  1PRT B;  4XTC S;  2LY7 A;  2A73 B;  4TQU S;  4ZUI A;  5M5Y H;  5DAU A;  1LT4 D;  3B6Y A;  4JK1 C;  2FMC A;  5KRU A;  3J81 j;  1YIJ A;  1FNV A;  4JI5 L;  3KLS X;  1KTK A;  3K8A A;  3KBG A;  1K3R A;  2SNS A;  2B39 A;  5NUC A;  1U4R A;  2E5L Q;  1LTI D;  1ASY A;  3RLN A;  3RN5 A;  5J22 A;  1QWY A;  2IHF A;  5C44 B;  4X64 L;  1WI5 A;  5A35 A;  1GUS A;  3OMC A;  4CDC C;  1K83 B;  1YI2 A;  1XTD A;  4H7B A;  3KJP A;  3S1R H;  2PMZ E;  1JWS D;  1A62 A;  5I9P A;  3M4Q A;  1PV4 A;  4J8Q A;  3EN2 A;  3LX0 A;  4K6D A;  3M3Y H;  1VS0 A;  1UE5 A;  4JI3 L;  4DV4 L;  1VQC A;  3HOW H;  4K5V A;  1EEF D;  5C0X G;  1AH9 A;  3FPP A;  3P20 A;  2XGT A;  1UE7 A;  3ERS X;  3GTK H;  3S1M H;  2JA7 B;  4YWM A;  1UUP A;  1HZ9 A;  5I2Y A;  2ES2 A;  1GVP A;  4DUZ L;  3JC6 6;  2ENB A;  3W3A A;  2B63 H;  1EIF A;  3IL8 A;  5JAV A;  1NTG A;  3BDC A;  1KAA A;  1BNZ A;  4X3U A;  3RZD H;  2VQE Q;  4PZ7 A;  1AE3 A;  2CW0 C;  2ASB A;  2F0G A;  2F0M A;  3I4N H;  4OL7 A;  3MWY W;  4JI1 L;  3CCL A;  1E1O A;  2LMC B;  2K33 A;  5M3M G;  3J80 L;  1Q1B A;  1DD2 A;  1JJC B;  5L37 A;  1WYD A;  4XIG S;  3E0J A;  4ZCK A;  4GKK Q;  4C3J B;  3H91 A;  4A3I H;  5CMD A;  1TS3 A;  1SRU A;  1WTP A;  1I3Q B;  1JWU D;  1PRT C;  1VQI A;  1IHZ A;  1V43 A;  1RDP D;  1EWH A;  3CCE A;  3BVG A;  3Q23 A;  5IGB A;  3IAY A;  4RGT A;  2QF7 A;  4K0K Q;  1GOZ A;  2ZXR A;  1AW7 A;  2B8G A;  3U4Z A;  2DY7 A;  2C35 B;  4LF7 Q;  3SHL A;  4A3F G;  1B3A A;  3OIQ A;  2N55 A;  3P7J A;  4GKJ Q;  2E2I B;  5M5W B;  1EY8 A;  4K14 A;  3NEM A;  4XT1 B;  1WFQ A;  2F0O A;  1EY6 A;  1JT8 A;  3CCQ A;  2PPB C;  2RSO A;  1EEI D;  4OO1 I;  3HS0 C;  1SE2 A;  4BY1 G;  4KY6 A;  1IYJ B;  1SJE D;  4JI8 Q;  1E0B A;  1PZK D;  4IOA A;  1N32 L;  2K32 A;  1TS5 A;  4KHP L;  5FLX E;  1I4H A;  2F0N A;  2BH8 A;  4KK7 A;  1X6O A;  2F0V A;  3ULJ A;  4HJ5 A;  4JBM A;  4AQY Q;  1TWG B;  2HDL A;  1Y8O B;  1YVC A;  4UY8 C;  2VS1 A;  4IFD J;  1D8L A;  1LTL A;  4CGY B;  1BKB A;  4IOC A;  3S15 B;  2IWH A;  2PCF B;  4IO9 A;  3KLS A;  2O5I C;  4A3D H;  5ELF A;  5IWA Q;  1K8O A;  5J39 A;  1LAC A;  4Q0F A;  3CRK C;  2CW0 D;  1BCP D;  2EXZ A;  2XTI A;  2K04 A;  4JYA L;  3RLO A;  2UUA Q;  4HTH A;  3FP9 A;  1MSG A;  2L15 A;  1CKO A;  4A93 B;  1BCP F;  4R4T A;  3DEP A;  1VQO A;  3GO5 A;  3BJU A;  3DWQ A;  1QG7 A;  1SNM A;  2ZJP A;  1MJE A;  4PMC A;  3GTL H;  4KD4 A;  1Y8P B;  3KF6 B;  2OXP A;  4H13 C;  4P75 A;  1U9R A;  2J4X A;  1PRT D;  1AE2 A;  4Y7N H;  1PHJ A;  3VR5 A;  1ZEQ X;  4DR1 Q;  1Y1W H;  1BF4 A;  2J7Z A;  1SXT A;  4JI0 Q;  1FGU A;  3OYY A;  2JA9 A;  3S1R B;  1VQM A;  1Q3L A;  1L0W A;  1IBL Q;  4C3I G;  1KL9 A;  1TU2 B;  1PRT F;  2VXW A;  4Z9C B;  3HOW B;  1FGB D;  5LMU Q;  4UAI A;  4DGZ A;  3HOY B;  3GTK B;  4NB3 A;  4LF6 L;  4DAM A;  1YHQ A;  5IIF A;  1HZB A;  3JAM c;  5FLM H;  3KDF B;  4HJA A;  1ZKO A;  3KF6 A;  2JA8 G;  1F9R A;  3T4A C;  1CHP D;  2Z1C A;  1DOL A;  4X62 L;  1Q8K A;  3CU7 A;  5FO7 B;  3TQY A;  4A76 A;  5LHY 1;  1CHQ D;  5CV9 A;  3NBH B;  4CKC A;  3J81 c;  3RZD B;  2B2T A;  3FKI G;  3EBE A;  4DR5 L;  1I4X A;  2KQ3 A;  3I4N B;  2Y0S G;  3GDE A;  3G48 A;  3PF4 A;  1WCM B;  4LF8 L;  5FJ8 H;  4BA2 I;  4QL5 A;  4HIM A;  5JVG 3;  2QKI C;  3KBX A;  3KDF A;  5ELE A;  1CA5 A;  4JBW A;  3D0F A;  3HOZ G;  1UAP A;  2WFW A;  3J7A F;  4DNR B;  4U68 A;  2V4D A;  1HR0 Q;  1LUZ A;  4A3I B;  3BS1 A;  1XPU A;  4C3H B;  2WB1 B;  2EYF A;  4A3J H;  2JE6 I;  5EGT A;  4A3M H;  3MVV A;  1VQ8 A;  4CJ2 C;  4OEM B;  4GOP A;  3GQB A;  3NSW A;  5CR3 A;  2FFK B;  1PXU A;  2ZT9 C;  2GVA A;  2IX3 A;  3PO3 H;  2CQA A;  1HQR D;  2TMP A;  2UXD L;  3DUZ A;  1F2Z A;  2N8N A;  1M4V A;  5D3I B;  4LUZ A;  1O78 A;  5EPK A;  1C7Y A;  3X3N A;  4DFA A;  4DV0 L;  1A2U A;  3D8G A;  3CRL C;  2CFM A;  4HID A;  1TS4 A;  2NUC A;  5CV6 A;  4B3T L;  2B2T C;  4ZKB B;  2QDL A;  1J5E Q;  4DUY Q;  3FRP B;  1LO5 D;  2OWO A;  1I6V C;  1U4M A;  4A3E H;  1XNR Q;  3HKZ G;  5H1S E;  1VQB A;  2RCN A;  4DK1 A;  1Z7T A;  4K2K A;  1B9M A;  1ZYR C;  3JAM i;  2VQF Q;  1IBK L;  4JI4 Q;  4DV1 Q;  2P5Z X;  2B63 G;  4DV7 L;  5KND A;  4ZLT F;  4DAV A;  3DLL A;  1SND A;  1Z6H A;  5HY6 A;  4BY7 H;  4XYQ A;  1UNS A;  1G6P A;  3SVM A;  3J81 i;  2ZM6 Q;  2BCO A;  1S5D D;  2R7D A;  2AQ2 B;  4I65 A;  2OCE A;  4DK0 A;  1QJO A;  4AIM A;  1BQQ T;  4IPH A;  1EIY B;  1KRS A;  1E7Z A;  2KCC A;  5GAD C;  4DK3 C;  4F8M A;  3GTL B;  1I4Q A;  1TII D;  1HNX L;  4Y7N B;  4IPG A;  5C4J H;  3OW2 A;  4RKL A;  5HUR A;  4ALP A;  4ODG A;  3T16 A;  3NPP A;  5IYC H;  1K0R A;  2LKV A;  2OQK A;  1SFO H;  2ZXO A;  4GS3 A;  2N78 A;  5EKL A;  3SK5 A;  4IAL A;  1CZG A;  1TKW B;  3MA2 B;  4BBR B;  1TWA B;  5IP7 H;  1CA6 A;  2E76 C;  2K75 A;  3CP0 A;  2E2J H;  5C0X I;  4WRD A;  3LGJ A;  4GLX A;  2F0L A;  2XRS D;  4KLK A;  4HN7 A;  3S17 H;  3HP3 A;  3NWT A;  2R61 A;  4IPC A;  4QIW B;  2D0P A;  3QG1 A;  3F1Z A;  1TY0 A;  2KCT A;  3I7F A;  3ULP A;  2D0O A;  2E2H H;  4PNY A;  1X3E A;  5COR A;  3I4O A;  2EOT A;  1MGS A;  1X3F A;  1PYS B;  2WII B;  1NNX A;  3CQZ H;  2OF1 A;  1XMO Q;  1EOT A;  3BDO A;  4KKT A;  5AJ3 Q;  4MTK A;  3GTM B;  2VB3 X;  2DY8 A;  4RHR A;  4F7X A;  2ICI A;  2PQA B;  3EJI A;  1YHA A;  5EPL A;  1BDO A;  4A3D G;  1OXV A;  2PW5 A;  2B2Y A;  4ME5 A;  3T1Y L;  1HUN A;  3N6R A;  4QMG A;  3VR6 A;  5ELO A;  1STN A;  1VQF A;  4TRD A;  5CV4 A;  2FJ2 A;  3CCV A;  4HJ9 A;  1K8A C;  2OQ0 A;  1XTC D;  4A3J B;  4A3M B;  2N49 A;  1VQE A;  1YIT A;  3KLR A;  3QJY A;  1Y1V B;  4OIJ A;  4DR2 L;  2PQA A;  2EZV A;  4JI5 Q;  1PYW D;  3T1H L;  2QIL A;  1I6H B;  3TBI B;  4X3S A;  4BXX G;  1D5Z C;  1JIC A;  2WAC A;  1Y1W G;  1EUJ A;  3AFP A;  3S14 B;  2CHB D;  3WDN A;  4E6I A;  3TS0 A;  3CC7 A;  1NE3 A;  3LWU A;  3PIO 3;  3EQL C;  4B9X A;  2CH4 A;  3GTJ H;  1PTO H;  4IUT A;  2F4I A;  2RF4 A;  1PZI D;  1XNQ L;  1TS2 A;  2DN8 A;  2HIV A;  3KJO A;  1HA6 A;  4R4O A;  1RKN A;  4JI3 Q;  2WV6 D;  4A3E B;  2B2Y C;  5JJL A;  3M7N A;  5M3F H;  1D5X C;  3PIP A;  4M8A A;  5LL6 X;  1JE4 A;  4NXN L;  1VQ7 A;  2JA5 B;  4LFB L;  1JB7 A;  3GD7 A;  3J81 E;  4DUZ Q;  3I3C A;  3L7Z C;  4BY7 B;  1ENF A;  4KI0 A;  2Z6K C;  3R93 A;  2UU9 Q;  1F9S A;  1OXX K;  5FJ8 G;  1QVC A;  4LK1 C;  5GAH C;  3Q22 A;  4PMW A;  4JI1 Q;  1IZ6 A;  1L0Y B;  5G3L D;  5JEA H;  2RDH A;  3DM1 A;  1GJX A;  3TP6 A;  4X66 L;  4CBV A;  3FDT A;  3I4M B;  2GN5 A;  2KHI A;  4K8J A;  5G3L F;  3R2I A;  1B70 B;  3A7L A;  4V19 0;  1SFO B;  1D2B A;  1SYG A;  3TZD A;  5C3E H;  5IGD A;  2OEO A;  4A3F H;  3K6O A;  4DV3 L;  4QGU A;  5J3B A;  1WTR A;  4NMZ A;  2FHT A;  1KNE A;  2MP1 A;  3HZX A;  1K73 C;  1YNN C;  3GTP B;  1KDA A;  1RHP A;  5EBC A;  4HR7 B;  1PH7 A;  4BY1 H;  3J7Z C;  2HUG A;  2VB2 X;  3T53 B;  1RF2 D;  2Q8I B;  3RZO B;  1GKH A;  1N32 Q;  5FLX c;  1Q1E A;  3CQZ B;  4KHP Q;  4AYB G;  3HGB A;  1GD7 A;  2NVX B;  4J1M A;  2CKZ B;  2QEX A;  2H4O A;  2WP8 J;  1QNU A;  3A5U A;  1VQ5 A;  1XWE A;  3BYT B;  1H9S B;  4R4I A;  1HXY D;  2B29 A;  3I4L A;  1HNW L;  1PH6 A;  1PH3 A;  4B3M Q;  1N9W A;  1TQO A;  2I5L X;  1VQ4 A;  5J1Z A;  3NTH A;  1NUC A;  4GN4 B;  1NSN S;  2L55 A;  3K81 C;  4I7A A;  3M4O B;  1AP0 A;  2WB1 E;  2MO0 A;  3JAM L;  4N9P A;  3TP7 A;  1SJH D;  1ET9 A;  3GTQ B;  2DJF C;  4Y52 H;  1X65 A;  2EYL A;  4HED A;  4FP5 D;  1JOO A;  4L8J A;  3I2Z A;  2NVT H;  4C1N I;  1OXT A;  3RNU A;  3M7G A;  4CKB A;  3GTJ B;  3D3R A;  3J81 L;  4NDX A;  5IYC G;  2R92 H;  3W5O A;  1KQS A;  4HCE A;  4LWC A;  1I94 Q;  1P16 A;  1STH A;  3NXW A;  4C3I H;  4HCS A;  5LMN W;  1QNK A;  4FF1 A;  2OT2 A;  4HAE A;  4LF9 L;  1IW7 C;  4ZKC B;  2M2L A;  4IJL A;  2BOS A;  4G57 A;  1STY A;  5DNF A;  5IGE A;  2D9U A;  4DV6 L;  4XDX A;  2JA8 H;  2L4N A;  3ZJY C;  3AU7 A;  1Z47 A;  4B3S Q;  1ZXT A;  4X62 Q;  3VR3 A;  5I4D A;  2K5V A;  1K8G A;  4IFD H;  2EE1 A;  3MHB A;  3WWV A;  2JN4 A;  1R9T H;  1SYE A;  4TKO B;  2QW7 A;  3ITP A;  4JI2 Q;  5EAY A;  4DV5 L;  4H02 A;  2L5T A;  5M3M B;  3AYH B;  5GQO A;  1Q82 C;  4LF8 Q;  2C5C A;  4FF2 A;  4DR7 Q;  3UI2 A;  3H6M A;  5JEA J;  1B44 D;  2CWP A;  4LFA L;  1W2B A;  1NCV A;  2K52 A;  2KHS A; 
#chains in the Genus database with same CATH homology
 1M90 C;  2JEB I;  1WCM G;  1X3G A;  2QGQ A;  3FP9 A;  5BR8 L;  1CUK A;  2L15 A;  1EOV A;  1X56 A;  4L5R C;  1HR0 W;  1CKO A;  3PUX A;  1BVS A;  2YTY A;  3E0E A;  4R4T A;  3HKS A;  3CPF A;  3BJU A;  3GO5 A;  2K50 A;  1VQO A;  2YU9 H;  3CAM A;  4GKK L;  1TXY A;  2NVQ H;  4AH6 A;  2ZJP A;  3M4P A;  1MJE A;  3GTL H;  4HJ7 A;  4OX9 Q;  1X55 A;  2LSS A;  3KF6 B;  4P75 A;  2AWN A;  2PI2 A;  4A3I G;  4LF9 Q;  1PHJ A;  1AE2 A;  4Y7N H;  2WB1 G;  2ZTD A;  1U0L A;  4DR1 Q;  1VQD A;  1Y1W H;  2Q2U A;  2UXB L;  3U58 A;  2ALY B;  2HQL A;  3I4M H;  2NVY H;  4A4I A;  4JC0 A;  1EFW A;  4JI0 Q;  1FGU A;  3OYY A;  2JA9 A;  1VQM A;  1IBM L;  3H3V H;  1L0W A;  2WAQ E;  2OTL A;  3S16 H;  4YWL A;  1IBL Q;  1KXL A;  1QZG A;  1Y1V G;  4LF7 L;  2VL6 A;  1Q81 C;  1KIX A;  4BA1 I;  3HKZ E;  4QIW E;  4POG A;  1KL9 A;  4P72 A;  2N3S A;  4GKJ L;  4IFD I;  2F3I A;  5E7N A;  2CWA A;  4JCV E;  1XMQ Q;  5LMU Q;  3H15 A;  4DKA C;  5C44 H;  1K9M C;  4NB3 A;  4A3B H;  3CCU A;  2E8G A;  4LF6 L;  4DAM A;  1YHQ A;  1L2F A;  2UUC L;  3J80 c;  5M3F G;  4DPG A;  1HZB A;  3AFQ A;  3JAM c;  5FLM H;  1K83 H;  3KDF B;  1VQL A;  2VY3 A;  4HJA A;  4RMF A;  1HH2 P;  3OTO Q;  3KF6 A;  2JA8 G;  1VQ6 A;  3GTP H;  3TS2 A;  2IY5 B;  3W1B A;  2YTX A;  4X62 L;  1Q8K A;  4A76 A;  4OWX B;  3TQY A;  3J7A 5;  2Q2H A;  5K36 G;  5ELN A;  1U5K A;  2BA1 A;  4DUY L;  1J5E L;  1IBK Q;  3NBH B;  4AQY L;  1W3S A;  3H0G G;  3VDY A;  5JJI A;  3RZO H;  1MJC A;  4DR4 L;  3J81 c;  1O7I A;  3S1Q H;  4P74 A;  3FKI G;  2R93 G;  3EBE A;  4DR5 L;  5HGQ A;  2MFI A;  1EYG A;  2NVX H;  2JA7 H;  1QZH A;  1JE5 A;  2Y0S G;  1YEZ A;  2R7Z H;  3D31 A;  4B3R Q;  3GDE A;  4JYA Q;  4YWK A;  2VQF L;  3G48 A;  2ZTE A;  4OXP A;  4R4Q A;  5IWA L;  4LF8 L;  3PF4 A;  5FJ8 H;  1EQQ A;  3PO2 G;  4JV5 Q;  4BA2 I;  4QL5 A;  4HIM A;  2EXD A;  5JEA G;  2JA5 G;  4DK6 C;  3KDF A;  1CKN B;  4JBW A;  3D0F A;  1HJP A;  3HOZ G;  2R6G A;  2WFW A;  4NXM L;  1D7Q A;  1S40 A;  1JJ2 A;  2MO1 A;  1HR0 Q;  1LUZ A;  2ZM6 L;  1P8L A;  3STB D;  1XPU A;  5DLQ E;  4JOI A;  1PH5 A;  2CCZ A;  5C4X H;  2DUD A;  4A3J H;  3AQQ A;  2JE6 I;  1X9N A;  4L5Q A;  4A3M H;  3H3V I;  1GO3 E;  1QVF A;  2UXB Q;  1PH9 A;  1VQ8 A;  1UE1 A;  4GOP A;  3M4O H;  1IBM Q;  4IPD A;  1E3P A;  5C3E G;  5IE8 A;  2GVA A;  4LW1 A;  3PO3 H;  2IHE A;  4A3K H;  4A3G H;  2UXD L;  2B3G A;  2CQO A;  3GTQ H;  2N8N A;  4DR1 L;  5LMN L;  3M9B A;  4JI6 L;  4LUZ A;  3CC4 A;  4C3J H;  4JI0 L;  1CKN A;  3PF5 A;  1C7Y A;  4LF6 Q;  4L5T A;  4DV0 L;  1I3Q H;  2CFM A;  1A0I A;  2I5H A;  2K14 A;  5M5X H;  2K4K A;  1Q86 C;  2NZO A;  4HID A;  2Y0S E;  2AKW B;  1FJG L;  3PIO A;  2AHO B;  4BBR G;  3F2B A;  2YTV A;  4JG2 A;  1N33 L;  1XJV A;  2R7F A;  4B3T L;  4L5S A;  1J5E Q;  4DUY Q;  3K0X A;  1N32 Q;  4GNX B;  3U50 C;  2OWO A;  4A3B G;  2Q2I A;  3DM3 A;  4DR4 Q;  2E2I H;  4A3E H;  1XNR Q;  1SRO A;  5M5W H;  3OTO L;  1YNX A;  5C0X J;  3HKZ G;  2AMC B;  5FLM G;  4DR5 Q;  5H1S E;  1VQB A;  1Y14 B;  2IX0 A;  2RCN A;  4QJF A;  3F2D A;  1I5F A;  4R1J A;  2IT1 A;  4GN5 A;  3J80 i;  1IL2 A;  4PG3 A;  2V1C C;  4PZ8 A;  1L1O B;  3ULL A;  4YHH L;  3JAM i;  2VQF Q;  1BBU A;  4APV A;  1IBK L;  4JI4 Q;  4DV1 Q;  1ASZ A;  4HJ8 A;  2B63 G;  2KCM A;  1G51 A;  4DV7 L;  1C0A A;  2ZTC A;  3UE1 A;  4JOI C;  3DLL A;  1BBW A;  3KOJ A;  4ME3 A;  3CME A;  1XMO L;  5HY6 A;  1IXR A;  1MIU A;  2GVB A;  4POF A;  5AJ3 L;  4BY7 H;  2YV5 A;  1TWG H;  1G6P A;  2K5N A;  2HIX A;  2ID0 A;  4TVA B;  2R7Z G;  2ZM6 Q;  3J81 i;  1QUQ B;  3ICE A;  4JV5 L;  2R7D A;  4GNX A;  3S15 H;  2JQO A;  4X65 L;  4MTN A;  2OCE A;  4A3L H;  3HOX H;  1MKH A;  1VCI A;  5M3M H;  3I56 A;  4AIM A;  4IPH A;  4O0A A;  1SLJ A;  4DV2 Q;  1KRS A;  1E7Z A;  1EIY B;  5GAD C;  1HR0 L;  2VNU D;  4DK3 C;  1HNZ L;  1L1O A;  4DR2 Q;  2JEA I;  3HOU H;  1HNX L;  4BXX H;  4IPG A;  5C4J H;  4LFC L;  5C4X G;  5LMN Q;  3OW2 A;  4A3J G;  1E22 A;  4JI6 Q;  4A3M G;  1VQA A;  4IJH A;  1OXS C;  4ALP A;  2R92 G;  1UWV A;  1PH8 A;  4DV0 Q;  2KHJ A;  3E9H A;  5IYC H;  1K0R A;  2OQK A;  4WJ4 A;  1QUQ A;  3HFZ B;  3PUZ A;  1OXU A;  2N78 A;  4GS3 A;  1SFO H;  2UUB Q;  5IYD G;  5IP7 H;  1FJG Q;  3PO3 G;  4A3K G;  4A93 H;  5IYB H;  2K75 A;  3CP0 A;  2E2J H;  2VW9 A;  1N33 Q;  3RR5 A;  4B3T Q;  5C0X I;  1T9H A;  4J15 A;  2MQH A;  3BU2 A;  3LGJ A;  4GLX A;  1RL2 A;  3PCO B;  3CPW A;  3TRZ A;  2AWO A;  4KLK A;  3KF8 B;  5GAG C;  2BH2 A;  3S17 H;  4IPC A;  1VQH A;  2D0P A;  2UXD Q;  1B7Y B;  3AEV A;  3F1Z A;  3I7F A;  2KCT A;  3ULP A;  3CCJ A;  2EIF A;  2PNH A;  2D0O A;  2H5X A;  3ER0 A;  4LUO A;  2K5H A;  3UDX A;  2HT1 A;  2E2H H;  3PV0 A;  1X3E A;  4YHH Q;  3I4O A;  3UDG A;  2JA6 H;  1GM5 A;  4NXN Q;  1X3F A;  1TWF H;  1PYS B;  4IFD G;  1S3O A;  4DV7 Q;  1HZA A;  1XNR L;  3CQZ H;  3IRB A;  4GNX C;  2NZH A;  1XMO Q;  4A3E G;  1N34 L;  3HOY H;  3UE0 A;  5AJ3 Q;  3Q8D A;  4YCU A;  2F4V L;  5JJK A;  2A19 A;  2PQA B;  1V1Q A;  4JI4 L;  1YHA A;  4NPS A;  2OTJ A;  4UPA A;  4OWT B;  4DV1 L;  4A3D G;  1OXV A;  4BBS G;  1L1O C;  4X65 Q;  1CSQ A;  3T1Y L;  5IY0 A;  1X54 A;  1TWC H;  4A3C H;  1N36 L;  3F2C A;  1KC8 C;  4QY7 A;  5ELO A;  1VQF A;  3CCV A;  1EQR A;  3S1N H;  4BY7 G;  4HJ9 A;  1HNZ Q;  1CSP A;  4YCW A;  4JBK A;  1PFS A;  2UU9 L;  1K8A C;  3CD6 A;  3A5Z B;  1PH4 A;  1UE6 A;  2OQ0 A;  4X66 Q;  1HNX Q;  4PZ6 A;  2I5M X;  2N49 A;  3PUY A;  4LFC Q;  1VQE A;  1SE8 A;  3RN2 A;  1YIT A;  4A3L G;  1WCM H;  4DV2 L;  1VQ9 A;  2FXQ A;  3HOV H;  3TEH B;  4DR2 L;  2PQA A;  1KRT A;  3UDF A;  1YJN A;  4JI5 Q;  2MNA A;  3T1H L;  3S24 A;  1JMC A;  4YY3 Q;  3HOU G;  2NN6 I;  4BXX G;  2KEN A;  4JI7 L;  3KFU A;  1Y1W G;  1EUJ A;  3AFP A;  4EQ5 A;  4JBJ A;  3I4M G;  3TS0 A;  1I50 H;  1NE3 A;  4C3H H;  2A1A A;  3CC7 A;  1NJI C;  4DR6 Q;  3GTJ H;  4AYB E;  2UUB L;  2RF4 A;  1XNQ L;  2UXC L;  4X6A H;  2E5L L;  1KHI A;  1SN8 A;  2LXK A;  4KHZ A;  5IP7 G;  4DR3 Q;  3PGZ A;  5IYB G;  1FVI A;  3FHW A;  2HIV A;  1RIP A;  1DGS A;  3KJO A;  5IP9 H;  2Z0S A;  5C44 G;  4R4O A;  2HHH L;  4JI3 Q;  4MZ9 A;  4DAY B;  3CF5 A;  2NN6 G;  1YJ9 A;  1A63 A;  1UEB A;  2VZA A;  3PUV A;  1XPR A;  3M7N A;  1N34 Q;  5JJL A;  1G29 1;  1Q46 A;  4YCV A;  5M3F H;  4DR6 L;  3PIP A;  1PA6 A;  3EIV A;  1J6Q A;  3I55 A;  4OON A;  5IT9 c;  3K7U C;  2Q2T A;  4NXN L;  3CCS A;  3M85 A;  1XPO A;  3CXC A;  1VQ7 A;  3CW2 C;  4LFB L;  2JA6 G;  3T1Y Q;  1JB7 A;  3GD7 A;  4DUZ Q;  1N36 Q;  2D62 A;  3NEN A;  4O2D A;  3L7Z C;  1HNW Q;  2ZJR A;  3HOY G;  2PI2 E;  2JA7 G;  4KI0 A;  1OTC A;  4LNQ A;  3FKI H;  2DGY A;  2Z6K C;  2UU9 Q;  2IX1 A;  1OXX K;  5FJ8 G;  2VUM H;  4FDB A;  1HZC A;  1NY4 A;  1QVC A;  5GAH C;  4LF5 Q;  3G4S A;  4LF4 Q;  3PO2 H;  4PMW A;  4JI1 Q;  1NBW A;  4B3M L;  1A8V A;  1IZ6 A;  3BZK A;  3E9I A;  3PUW A;  4EX5 A;  2VQE L;  3HOZ H;  4X66 L;  5GRO A;  3T1H Q;  4JI7 Q;  1NMF A;  2GN5 A;  4XTC S;  2KHI A;  4TQU S;  5M5Y H;  3L2P A;  3CC2 A;  3B6Y A;  1B70 B;  1YIJ A;  3CCR A;  3J81 j;  3HOV G;  1LM0 A;  4JI5 L;  3UDI A;  2A8V A;  3K8A A;  1XNQ Q;  1K3R A;  2UXC Q;  2I0Q A;  4A3G G;  5C3E H;  2E5L Q;  2KBN A;  4YY3 L;  4P73 A;  1PH1 A;  1YHB A;  1YZ6 A;  4A3F H;  1ASY A;  3RLN A;  3F8T A;  3RN5 A;  1JJG A;  2IHF A;  4DV3 L;  4QGU A;  4DNI A;  5J3B A;  4X64 L;  1WI5 A;  2F4V Q;  2YYZ A;  3KLW A;  2HHH Q;  3MEF A;  2EQS A;  1K73 C;  1YI2 A;  1XTD A;  1VQJ A;  3G71 A;  1NMG A;  1WJJ A;  3KJP A;  3K7A H;  3S1R H;  1YJW A;  1I94 L;  4DR3 L;  4K0K L;  2PMZ E;  1A62 A;  2LXJ A;  1VQG A;  3M4Q A;  1PV4 A;  1PYB A;  4RG1 A;  1PH7 A;  3EN2 A;  5GAE C;  4DV6 Q;  3J7Z C;  1VQK A;  4BY1 H;  3M3Y H;  1VS0 A;  1UE5 A;  4BBR H;  1SMX A;  4A75 A;  4JI3 L;  1TWA H;  4LFB Q;  1GKH A;  1TWH H;  5IP9 G;  5FLX c;  1Q1E A;  1LYL A;  1EWI A;  1VQC A;  4DV4 L;  3HOW H;  5C0X G;  3CCM A;  4KHP Q;  4AYB G;  1AH9 A;  3SGI A;  1E24 A;  2XGT A;  1UE7 A;  3ERS X;  1GD7 A;  2QA4 A;  3GTK H;  3S1M H;  4YWM A;  2CKZ B;  2QEX A;  2WP8 J;  1HZ9 A;  1C9O A;  2ES2 A;  3A5U A;  1GVP A;  4JI8 L;  3GTG H;  4B3S L;  1VQ5 A;  4R4I A;  4WJ3 M;  4UP7 A;  4DUZ L;  3JC6 6;  1B8A A;  4DV5 Q;  2B63 H;  1KAW A;  1EIF A;  2B29 A;  3A74 A;  3KYH C;  1HNW L;  1PH6 A;  1PH3 A;  4B3M Q;  1NTG A;  3CMA A;  1N9W A;  2I5L X;  1FL0 A;  2VQE Q;  4PZ7 A;  3RZD H;  1AE3 A;  1VQ4 A;  1VQP A;  4LFA Q;  3A0J A;  4GOP B;  2ASB A;  4JI2 L;  3I4N H;  3GTM H;  4LF5 L;  4UP9 A;  4LF4 L;  2VUM G;  4GN4 B;  4QQB X;  3K81 C;  4JI1 L;  3CCL A;  3HOX G;  1E1O A;  2Z6K A;  5M3M G;  1PVO A;  2WB1 E;  2MO0 A;  4DR7 L;  1KD1 C;  1Q1B A;  5BR8 Q;  1JJC B;  1WYD A;  3RLF A;  4XIG S;  4MNO A;  1X65 A;  4GKK Q;  4Y52 H;  4OWW B;  2UUA L;  1E1T A;  4DV3 Q;  4A3I H;  1Q7Y C;  3I2Z A;  4X64 Q;  2NVT H;  1CKM A;  1OXT A;  3RNU A;  1N8R C;  3GTO H;  1SRU A;  4P71 A;  1VQI A;  3BZC A;  4UP8 A;  1V43 A;  4GN3 B;  5IYC G;  3CCE A;  2R92 H;  3W5O A;  1KQS A;  4LWC A;  1I94 Q;  2ATW A;  4K0K Q;  1P16 A;  1Y1V H;  4A93 G;  4C3I H;  4GLV B;  3U4Z A;  2C35 B;  4LF7 Q;  4OX9 L;  5LMN W;  4A3F G;  4HIK A;  3S2D H;  5IYD H;  2ZJQ A;  4LF9 L;  4OO1 G;  4GKJ Q;  4DV4 Q;  1I6H H;  2JK8 A;  3NEM A;  3S14 H;  4IJL A;  4HIO A;  1WFQ A;  1JT8 A;  2BA0 A;  1SR3 A;  3CCQ A;  1Q12 A;  1IBL L;  4C2M H;  2UUC Q;  4OO1 I;  4DV6 L;  2JA8 H;  1WOC A;  3ZJY C;  3MXN B;  4BY1 G;  1YBY A;  1IYJ B;  1Z47 A;  4JI8 Q;  4B3S Q;  1S72 A;  4IOA A;  1N32 L;  4X62 Q;  4KHP L;  2JJQ A;  3G6E A;  1XMQ L;  5LMU L;  2BH8 A;  3H0G H;  1VQN A;  2K5V A;  3HOW G;  1X6O A;  3ULJ A;  4HJ5 A;  3WWV A;  1K8G A;  4JBM A;  4R4C A;  4AQY Q;  1R9T H;  4UY8 C;  1YVC A;  2WAQ G;  2R93 H;  2VS1 A;  4IFD J;  1D8L A;  2RHS B;  1LTL A;  4IOC A;  1BKB A;  3K80 C;  4LUV A;  3W1G A;  3PSI A;  3TRE A;  1PH2 A;  4JI2 Q;  5EAY A;  4DV5 L;  4H02 A;  4IO9 A;  4A3D H;  3AYH B;  4GLA C;  5GQO A;  4BBS H;  4A3C G;  1Q82 C;  1Z9F A;  3L0O A;  3U4V A;  5IWA Q;  4LF8 Q;  2JA5 H;  4DR7 Q;  2RHQ B;  3NEL A;  5JEA J;  2CWP A;  4LFA L;  3S2H H;  1W2B A;  2K52 A;  2XTI A;  4NXM Q;  1QVG A;  1M1K C;  4B3R L;  1H95 A;  4JYA L;  3RLO A;  3I4N G;  1V9P A;  2UUA Q;  2F52 A;  4GOP C;  3STB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...