1BDOA

Structure of the biotinyl domain of acetyl-coenzyme a carboxylase determined by mad phasing
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
80
structure length
80
Chain Sequence
EISGHIVRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEAMKMMNQIEADKSGTVKAILVESGQPVEFDEPLVVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords ACETYL-COA CARBOXYLASE
publication title Structure of the biotinyl domain of acetyl-coenzyme A carboxylase determined by MAD phasing.
pubmed doi rcsb
source organism Escherichia coli
total genus 14
structure length 80
sequence length 80
ec nomenclature ec 6.4.1.2: Acetyl-CoA carboxylase.
pdb deposition date 1995-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1bdoA00
2L5TA 1FR3A 3TZUA 1Q1BA 2ZT9C 1PMRA 3ND9A 2LMCB 1CTMA 3VR3A 2JE6I 4KKSA 1SMYC 3GD7A 4I7ZC 1GUNA 5A35A 3A8JE 1IYVA 1HTPA 3BG3A 5C0XH 4H0LC 3PUVA 3W3AA 2A6EC 1CI3M 2K7VA 3OOCA 2KCCA 2A69D 2D5DA 4LJZC 2EJFC 1K8OA 3I73A 2A6ED 4RCNA 1FYCA 2Q8IB 3M85A 2PPBC 2EDGA 4KN4C 2EJMA 2K33A 2DN8A 1Y69U 1O78A 1LACA 2D2CC 2PNRC 2E75C 4DK1A 1GUOA 1VF5C 1IYUA 1YNJC 4OO1H 4G7OC 2D62A 1HCZA 1ZKOA 3H94A 2NN6G 1DXMA 3VR5A 4H44C 1GUTA 5KNDA 1VDZA 1A6XA 3CRKC 2QF7A 3M4YA 4HR7B 4XIGS 2A68C 2EVBA 2DNEA 3PUYA 3RLFA 2JXMB 4IFDG 1OXSC 1Q12A 1E2VA 1HQMC 2V4DA 1ZYRC 1H9JA 3PUWA 4KHZA 1QJOA 4XTCS 3VA7A 2JEAI 5BN4A 1EWHA 3HGBA 3A7LA 3LWUA 4OGQC 3M7NA 1V43A 4TQUS 3MFYA 4KKTA 4GZYC 3CRLC 2KA7A 1OXTA 1GUGA 1H9SA 4H13C 1DCZA 5C0XG 3T56B 2B8FA 5JEAH 1I6VC 3P20A 3VR6A 1E2ZA 3QIAA 4G7ZC 3A8IE 3NE5B 3A7AB 4TKOB 1VF7A 1Q90A 2A6HC 3PUZA 1LABA 3PV0A 2BDOA 4BA2I 3QJYA 3D31A 4DK0A 1H9MA 3EQLC 1Q1EA 1H9SB 4OO1G 1H9KA 3MXUA 1OXVA 3ND8A 3WDNA 2A68D 4PV1C 3T53B 2BE5C 1GHJA 3LNNA 1GJXA 4KMUC 4DNTB 2IT1A 3VR2A 5K36H 1IW7C 2PCFB 3IKJA 2AUJD 2EJGC 1G291 1VCIA 2DNCA 1DD2A 2AWOA 4KKUA 1HPCA 2E74C 4JK1C 4KN7C 2O5JC 2F1MA 1H9RA 4JBWA 5BN5A 1Z7TA 1YNNC 1B9NA 1B9MA 1Y8NB 1K8MA 2NN6I 3VR4A 2O5IC 3D4RA 2BA0A 3DXJC 3QG1A 3SE0A 1TU2B 3BDOA 3T51B 1GUSA 3L7ZC 2B8GA 5BN3A 2BA1A 3FPPA 3IFTA 5KNBA 1E2WA 5JEAG 1ONLA 4G7HC 2A6HD 3GQBA 2A69C 4L8JA 4LK1C 1Z6HA 5KNCA 2YYZA 3I72A 2JEBI 3AB9A 3U9SA 3OPOA 4KI0A 2K32A 3A8KE 2BE5D 1BDOA 1OXXK 1TKWB 1V8QA 2AUKA 2NN6H 4IQZA 1T5EA 2CW0C 1O7LA 1Y8PB 1CFMA 1IW7D 2R6GA 3OW7A 5K36G 3FMCA 3PUXA 2E76C 3KLRA 3SDZA 4DNRB 4IFDH 3I4LA 3N6RA 1OXUA 4BA1I 1Y8OB 1GHKA
chains in the Genus database with same CATH superfamily
2EYMA 2F0PA 4CDFC 4A3DH 2UU9Q 1SMXA 1Y1VH 2E8GA 1SE3A 4F7XA 4DV4Q 1MSHA 1J6QA 5JOBA 2F0LA 1JJCB 3J80i 5JJLA 2KCCA 4YY3L 1LTBD 2MO1A 1C4QA 2DN8A 2Z6BA 3TMEA 2RHSB 1SFOB 3S17B 1RDPD 1XXGA 4OO1H 5M5YH 1PRTC 1M8AA 1VQAA 2PI2A 4HSVA 5KNDA 1KABA 3LGJA 3GTKH 4XIGS 1FJGL 2A68C 2EYPA 2HD3A 4R1JA 5GAGC 1IKLA 3M3YH 3I4MB 1SXTA 3RZOH 3M4OH 2V4DA 4L5RC 3PUWA 1Q7YC 2JEAI 1I4GA 4GKKL 1G51A 3S1QB 3JAME 1SNDA 5FO8B 4GZYC 4A3GH 3HOXB 1GUGA 3KYHC 4DV1Q 1ICWA 5DEHA 1NAPA 4CKCA 4C3HH 1DYQA 5DM63 2XWJB 3CP0A 1SBBB 3NP8A 3ITPA 3QJYA 4C1NK 3N52A 2KCTA 5CBEE 2JA6B 1WCMB 2A68D 3U4ZA 3T1YL 3G6JB 1K0RA 4JG2A 4GNXC 4DK3C 2R7ZG 1A2UA 4NXMQ 2JA5G 5K5PA 1AW7A 3FKIG 1EEID 4X3UA 2RSNA 1M90C 1B9NA 4CBVA 1YNND 2ZM6Q 3ULJA 1O7ZA 1EIHA 1DOMA 5IP9G 4CJ0B 2N49A 3TN2A 3QG1A 3C2PA 4DR5L 1XMOL 2A69C 1I4PA 1X3FA 1B50A 1CZGA 1XNRQ 4DUYL 2CQOA 2QGQA 2TMPA 2F4VL 2K32A 2RHQB 4RGMA 4PZ6A 4IQZA 1PTOC 1R4QB 4IUUA 4KTAA 4DV7L 1LT6D 4AIMA 5FJ8H 4V190 4DK6C 1OXUA 1IL2A 3HOVG 1UAPA 2Z8LA 3F2CA 1BBWA 3V96A 4B3TL 4QUFA 5CC4A 4C3IH 4I7ZC 2OTLA 1EY6A 1AE2A 1TS5A 3A8JE 1IYVA 1EU3A 1IBKL 2F3VA 1AEXA 4GKJL 1CI3M 4A3MH 3OOCA 2A69D 3CCVA 3CD6A 4JBMA 4GS3A 3DLLA 2UUCQ 5I9PA 2GN5A 1HR0W 2PNRC 1STNA 5E7NA 4LF8L 4QGUA 4C3JG 1PTOD 1TIID 1WD1A 4G7OC 5IP7G 3I70A 1CSPA 2M9VA 1GD7A 3EIVA 5ISRA 2B2TA 3I8ZA 1KHIA 2JA9A 3R93A 5IT9E 4YCWA 5FLXL 5C4JH 2B2YA 4X6AH 3BVGA 5IT9L 1BO0A 2JXMB 4DN4M 2KQ3A 1AP0A 2VZAA 1N32L 4DAYB 1V1QA 1S5CD 4UDUC 5IGDA 1TWFH 2F0FA 2KCNA 2ZXPA 1BOSA 2B8FA 4ZAIA 4A3EG 2CQAA 3EFXD 3KBXA 1WI5A 3G71A 1PXUA 1HNXQ 4B3MQ 2NVYH 2Z6KC 5FK9C 2JA8H 4HIMA 4HCEA 1YITA 3MC0B 1FNWA 2IW3A 1LABA 3CC2A 1MHWC 4B3RQ 1WTOA 1AH9A 4L5QA 4BBRG 1GUWA 3TDQA 1SYGA 1QVCA 3EN2A 1XNQL 1GJXA 4FNFA 2VQEQ 1G291 3RLNA 1SRUA 1IKMA 2SEBD 1H95A 1HHVA 3GTGH 2EYHA 1EYDA 1SJED 4ODGA 4QF4A 3TP5A 1A8VA 1PH9A 2PQEA 2OXPA 2R7ZB 2D9UA 2N88A 4LF6Q 2JA5B 1HZCA 3FKIB 1Z9FA 3VYTA 1VQMA 1PZJD 3J7AF 1G91A 3ICEA 3TZUA 3R8BA 3HOUG 5I6WA 3WOEA 4LFBL 4IFDJ 5GAHC 3UDXA 1CA6A 1N36Q 3J80c 3FP9A 4RGOS 4HAEA 1PH1A 1K83B 2A6EC 4HMJA 3MTSA 1BCPF 4IUVA 5CORA 4XQQA 2FHTA 1FYCA 2PPBC 1HZAA 4KY6A 1HNZQ 4L5SA 4DPGA 3KF6B 1SR3A 1EQRA 1C8CA 3SK4A 2E2IH 2EXZA 2D62A 1KDBA 1NCVA 4DR2Q 3HOVB 4DR6L 3KLSA 2KCMA 2PNHA 5JJZA 5DLQE 4FF1A 2LXKA 4LF4L 3S1MB 4QUCA 5DM73 5FO7B 2ES2A 4GNXA 3S1RB 3G48A 2OT2A 4FXGC 1KRSA 4A3DG 1JWMD 1Y1VG 5IYBH 3OWFA 2E2HB 5AJ3Q 1BNZA 1HZBA 4KHPQ 3M9BA 4UP9A 1O7IA 4A3JH 3VR6A 1E2ZA 4C3JB 4O1NA 4PZ7A 4DF7A 5ELEA 3Q22A 2EYFA 3F2BA 4DAMA 2BDOA 1H9MA 3E3XA 3JAMc 4NKLA 1Q1EA 3F2UA 4QIWE 4OO1G 4POGA 4IN3A 4GOPB 3AYHB 2F0EA 2VB3X 4LF5Q 4EQNA 2UUAL 4GN5A 1BBUA 2K14A 3UE0A 1GXDC 1Q82C 4DV5L 2OWOA 4DV6L 5C6AA 4A3EB 4BS9A 4IUNA 4WRDA 1LTSD 4A3GG 1M4VA 4NXNL 4HJ5A 5KNBA 1D1KA 4C3HG 4BBRB 4F88A 1G6ZA 2B2UC 3DM1A 4K8IA 3DHQA 5EPJA 3KJOA 1EY7A 1EFWA 2K6AA 3UDIA 4DV0Q 1WTQA 3HKSA 1S5DD 4CDDC 2FMMA 3BDCA 1I6HB 1PYWD 4X62Q 4OL7A 4XT3B 1LUZA 1Y8OB 4LWCA 3V05A 1HR0L 5IE8A 2CWPA 2ZTDA 3M4QA 3J7ZC 4DV2Q 5EJWA 4JOIC 4JI7Q 1PDQA 1SYFA 3TREA 4QJFA 1PRTF 2EJFC 4PMBA 1TS4A 4LFCQ 3SK8A 1PH7A 5I9OA 1TWAB 4NMZA 5IOCA 1O78A 3FPUB 1T5XD 3V2TA 2E75C 2WB1G 2Z6KA 1IYUA 4JI2Q 1S40A 1PFMA 1ESFA 1YJWA 4JI4Q 4WJWA 3HOUB 1SEBD 4LUVA 3U58A 5FJ8G 2DNEA 1Q12A 3PIO3 1ZYRC 2NZOA 1G2TA 4OGQC 2VQFQ 3M7NA 4C3IG 1C9OA 2DJFC 4MIUA 1NMFA 2M2LA 3T56B 1KD1C 4A3MG 1F9QA 1AZPA 4G7ZC 5IWAQ 3K58A 4EX5A 3CPWA 2K5WA 3Q23A 5LMUL 1X55A 4DU9A 4A3CH 4JYAL 4R9WA 1H9KA 3S15B 3D8GA 3T16A 3MVVA 1MIUA 1NY4A 4PV1C 1GHJA 4RWSC 4L63B 1CHPD 4A3DB 1Y1VB 2F0SA 4UP8A 4KN7C 2O5JC 2OEOA 4N9TA 3K6OA 1HJPA 2WAQG 4A76A 1EY0A 1B9MA 2L55A 2PW5A 3VR4A 1KRTA 1CT1D 2NBFA 3E0EA 1DOKA 1VQKA 1K83H 1QE6A 4J15A 3RD4A 1SE8A 3BDOA 3T51B 5TSSA 3HKZG 2BA1A 2L15A 2GVBA 1WFQA 3GQBA 4KK7A 5M5YB 2JA8G 3ONAB 1X65A 4JI3L 4JI0Q 1RHPA 1FGUA 3GTKB 2EQSA 2K05A 4P74A 1ASYA 3M3YB 3M4OB 3RZOB 1HUMA 3S1MH 1R9TH 5KRUA 4HJ9A 1FR3A 4XQNA 2F3IA 3A54A 1HZ9A 4A3GB 2AQ1B 4IJLA 4DR7Q 1SDFA 3MEHA 4C3HB 1SMYD 3CU7A 4H0LC 4IPHA 2GVAA 2PQAA 1B2TA 3SHLA 3GP7A 3KF8B 1Y1WH 3UDFA 1Y69U 1ENAA 3T13A 1TT2A 4PQXA 1JC7A 1YJNA 5G3LD 5CV8A 1WOCA 1F9SA 1GUTA 1WJJA 3M4YA 1EY9A 4QB4A 1K3RA 5AFWA 3K5MA 4DR3Q 5JAVA 3KBGA 4ILWA 2WKDA 1T9HA 4A3EH 1EYGA 2UXDL 5M3FH 1B3QA 1HNWQ 3BYTB 2ATWA 5KGUA 3C3LA 4A93H 2WB1B 3P20A 1TWGH 1ZXTA 1HFGA 4Y7NH 1STBA 2A6HC 3EQLC 2C35B 1H9SB 2B2UA 4HJ8A 2WACA 4JBJA 2D0PA 1VQDA 4JC0A 1VS0A 2K28A 2HT1A 2PMZB 1BR9A 5J3BA 1BVSA 2IT1A 1FNVA 2AUJD 3H0GG 4C3IB 4KJOA 3J81j 4JK1C 1LTAD 2K52A 5BN5A 2UXCL 3SXHA 4I65A 4A3MB 2NN6I 2UU9L 5IYBG 4IURA 3S9WA 4DV4L 2FJ2A 3CCUA 3BZKA 3QB3A 2BA0A 4X65L 2F0WA 3SE0A 3U50C 5JJIA 1WD0A 4G7HC 2A6HD 3GTMH 3GTQB 2CHBD 4A3JG 1PRTB 2RA4A 4J1MA 2YYZA 1WTRA 1RTOA 3LX0A 4YHHQ 3RZDH 2QEJC 3U9SA 5DAUA 3A8KE 3NENA 3NPPA 5C0XI 3SGIA 3B6YA 3KUPA 4KY7A 5GAEC 2NVXB 1Y8PB 2XGTA 5IODA 1WYDA 4EQPA 3FMCA 2WAQB 4DXFA 4DR4Q 3GV3A 5CR3A 3J81c 2YU9H 3P75A 3TQYA 3C1EA 1CSQA 1N33Q 4EQOA 1TWFB 2IPKD 2NVQH 4MTKA 1AFPA 1A3VA 3A0JA 1LTGD 3DM3A 1J9OA 2JE6I 3HKZB 5C44H 1TS3A 1IBLQ 2O2LD 1SAPA 1HTPA 4DXGA 4K0KQ 2NVYB 2JA8B 2VUMH 1XX8A 4MNOA 4PZ8A 1F2LA 3J80E 3R2IA 3CC7A 1X54A 4P72A 4DV1L 3J80L 4KJNA 4LF7Q 4MTNA 4IJHA 1X3EA 4XYOA 4ZUIA 2QCPX 3RUZA 1PVOA 1PYSB 1E1TA 3H94A 4OXPA 4DUZQ 4LFAQ 4UPAA 3OTOL 4C1NI 1VMPA 4R4TA 3E9IA 1HQRD 1X56A 1EIGA 1L1OA 1VQOA 1H9JA 1XPRA 2CWAA 4RA8A 1AN8A 1W6KA 2RVLA 4O0AA 3GTGB 3FVQA 3CRLC 2WIIB 4KHVA 3SEBA 2ZM6L 5JEAH 2RCFA 5DNFA 3VYSA 1DM0B 1A3UA 1R4PB 2N3SA 2G9HD 2KJXA 1HRJA 3BJUA 2B2WC 4A3KH 1XNRL 3KLSX 3CKIB 1OXVA 1NMGA 5EGTA 1PHJA 4FVMA 1MSGA 1SE2A 4XDXA 2HDMA 1UUPA 4TSSA 1EY8A 2R7DA 1CZWA 2K50A 4RMFA 1LLRD 3JAML 1S5BD 4JBWA 1SJHD 3OHXC 1MJCA 1YNNC 1RJTA 2NB0A 3AQQA 1VQHA 5M5XH 2M00A 1UNSA 4S3SA 2WP8J 2Z9HA 3RN2A 2EY5A 2OQ0A 2QW7A 1EIYB 5JJKA 2E2IB 1CHQD 5D65A 1I4RA 5E3FA 1N34Q 4DR1L 1YJ9A 3CCJA 3PO2H 4WORA 2IWHA 1BDOA 1E0BA 2NN6H 4A3CG 3EA6A 3H0GB 4JV5L 2B2VA 2N78A 3M7GA 2CW0D 2E76C 3KLRA 3SDZA 3T1HL 1PV4A 2I0QA 4AH6A 1STAA 4JI8L 4BA1I 4X64Q 1ENFA 3BU2A 4XT1B 5J39A 4BY7G 1SNOA 2OF1A 4A3JB 5C0XH 4K2KA 2Z1CA 2HIXA 2K7VA 3NTIA 4UAIA 4OWXB 2CFMA 5F2DA 4YY3Q 3ZYYX 1E24A 2IHEA 4K5XA 1UE7A 1HNXL 5EBDA 4B3ML 2KHIA 1S5ED 5LHY1 5ELBA 3U4VA 2CH4A 2MUYA 2I5MX 1L0XB 4B08A 2NVTH 1HA6A 2VQEL 1S3OA 1XPUA 3C1FA 1STYA 4GKKQ 2FMCA 1JB3A 1XTCD 4JCVE 1BXTA 5GROA 3GTQH 4TKOB 5C3XA 4EVOA 1Y1WG 1NBWA 2F0KA 2IX1A 4Y52H 3D31A 4K2LA 1VQBA 1E22A 2C9OA 3A55A 3K7AH 2NVXH 2ZTCA 2R92H 3VYUA 5T1IA 3F2DA 4RGNA 3WWVA 1VQJA 1J8IA 2DGYA 3T1YQ 2XN9C 1IW7C 3UI2A 1UEBA 1KNEA 1DD2A 2AWOA 5C3WA 2F1MA 1LT3D 1X3QA 2A1AA 3NXWA 4A3BH 1TY2A 1N36L 3DEPA 5M3FG 2YTYA 2KBNA 5C4XH 4A93G 4A3FH 1XMOQ 2UUBQ 1O7YA 2K1BA 2K5VA 4KI0A 1EY4A 3K57A 1PH3A 4OX9Q 4DUYQ 3S16H 2DJGC 1T5EA 1SE4A 4FO2A 3OW2A 2F4VQ 1IW7D 1EEFD 2R6GA 2IL8A 4YCVA 4HIDA 4DR2L 1II3A 4QY7A 4DNRB 5IGFA 3MA2B 3AMUA 2F0VA 4Q5VA 4JI6Q 3N6RA 5EKKA 4PMWA 3K80C 2PQAB 2LXJA 2FFKB 5J22A 3ND9A 4RHSA 4R4IA 1YBYA 3VR3A 3GTOH 4NW2A 1GUNA 5IGGA 1ML0D 5IYDH 1B53A 1IBKQ 1PZKD 2E5LL 5LL6S 5AJ3L 4GKJQ 3PSIA 5CV5A 2QDBA 3CCMA 2EDGA 4J8QA 1PTOH 5JPNC 4EQ5A 1W2BA 1P8LA 4MHEA 3K8AA 5JEAJ 2XRSD 3D6CA 4K6DA 1U0LA 1VDZA 1A6XA 1JE4A 2ICIA 4P71A 4BXXH 3GTJH 1U9RA 4LF5L 1OXSC 4BY7B 3CW2C 4A4IA 2KEEA 1GO3E 2RKSA 4YWMA 3NK9A 1Q81C 1EZ6A 2ZJRA 4POFA 5C44G 2O4XA 3W5OA 1TQOA 1EQVA 4IALA 3DMUA 1NE3A 3KK7A 2MJ8A 4FYDA 1MKHA 2VUMG 2AQ3B 1J5EL 4RKBA 3PUZA 4DA2A 1MI2A 2VW9A 4DK0A 4DAPA 4IUTA 3H0GH 3Q24A 1R9TB 1LTRD 3LNNA 3TSSA 2Y0SG 1U5KA 3IKJA 3EROA 3TP8A 3S2HH 4H7BA 3DUZA 5FKAC 3CC4A 3S24A 4X62L 1VMCA 5J1ZA 3AFPA 2ASBA 3GTPB 4FDBA 4XYQA 4RGTA 3HEJA 3I4OA 3IAYA 2QDLA 1Y1WB 2UXBQ 5BN3A 3FPPA 3IFTA 5JEAG 2PI2E 4LK1C 3I3CA 1S4ZA 1GM5A 1EU4A 1HXYD 3DWQA 3AB9A 5T1GA 2EPBA 5I2YA 3C46A 5C3EH 4A3KG 4CJ1B 1V8QA 2AUKA 3I91A 2BOSA 4R8IA 2QEXA 4JI2L 4UY8C 1K9MC 5M9OA 3K7UC 4IUPA 4AQYQ 1YI2A 5M3FB 1PMRA 1NNXA 4AYBG 3DWPA 4OIKA 3H3VC 4LFBQ 2TSSA 3J81E 2F0JA 2MQHA 1M1KC 4A93B 2VQFL 3S1NB 3L9AX 5ELCA 4JI1Q 3J81L 1TWGB 4X66L 3KDFA 4Y7NB 4YWKA 3PF5A 3NWTA 3A74A 4OWTB 5M3MH 2I5HA 1STEA 5EQ0A 1ASZA 4RHRA 1L1OB 4DK1A 1K3BC 1YNJC 1LO5D 3PO2G 5IWAL 4C56C 2NN6G 1JE5A 4APVA 3MHBA 4DR6Q 1KLUD 4WJ4A 4LAAA 3P7JA 3L0OA 4LF4Q 1RF2D 2EYOA 1QJOA 5BN4A 3VA5A 3I90A 2C5CA 5D3IB 4CGYB 3MFYA 4A3IH 2KHSA 4P73A 3GTMB 5C0XG 5D3DA 2F0QA 2Q8RE 1K8GA 3G4SA 2YTXA 3D4DA 3RZDB 2WV6D 1KNAA 1X9NA 2MFIA 1YNJD 3L3OC 3PV0A 2G5DA 4BA2I 2PO4A 1I94Q 1QCBD 2F4IA 1PA6A 2H5XA 1EIFA 2YU9B 4X3KA 5IYCH 2X6GA 4R8NA 2NVQB 1PH2A 4P75A 1W3SA 1XJVA 3FDTA 5C44B 3I56A 2DNCA 4KKUA 2AHOB 4DV5Q 4OWWB 3NBHA 4HEDA 5L37A 3PIP3 2VUMB 2J4XA 4GOPC 3FEWX 1PFBA 4QL5A 1CKMA 3NTKA 3MEFA 1CUKA 1RKNA 1GUSA 3L7ZC 4LF9L 1UWVA 1Q8KA 4NXNQ 2BDNA 2F0TA 4L8JA 5KNCA 3K0XA 3CPFA 4HIKA 1EL0A 5H1SE 4BWGB 5FLXc 1AE3A 2Y0SB 1TKWB 5HY6A 1O7LA 2R92G 1SN8A 2BH8A 3R2TA 5LMNQ 2R3ZA 1XMQQ 3OW7A 3W2DA 2LKVA 2K03A 3HRZC 4BY7H 1QNKA 3TS0A 2J0TD 3TRZA 3CMAA 4RG1A 2I46A 5CMDA 2WINB 4DR3L 1A2TA 1EWCA 1SMYC 3HG9A 3BZDB 1PTOF 1UE1A 4LW1A 3MXPA 5IY0A 4A3BG 1PH5A 4N8X1 4HTHA 1BCPB 5LL6X 1E1OA 2EZVA 5C4XG 4P2CB 2N8NA 1TY0A 2L11A 2WB1E 4A3KB 4WFN3 4A3FG 1F9PA 1FD7D 1LACA 5A2QE 1HUNA 1JT8A 1GUOA 1ZKOA 1I3QH 5A2QL 4DAYA 3CF5A 3KLWA 3DEOA 1P16A 4HN7A 4AYBB 2PMZE 1PFSA 1YIJA 3CCRA 4ZRZA 1C7YA 1JB7A 4WJ3M 3ULLA 4KHZA 1LTID 5M5XB 4HJAA 3GTPH 2G9DA 3A7LA 3ULPA 4IOAA 4F87A 5EBCA 1AZQA 4CKEA 4IUQA 2JA7H 4TRDA 1SYCA 1D5ZC 5M5WH 2NZ1D 1OXTA 5IIFA 1JOOA 5IYDG 4RKLA 4XXEA 4C2MH 1QILA 1WTWA 3PO2B 3QIAA 1RL2A 3P1HA 1QOHA 1VF7A 2VB2X 2Q2HA 3HS0C 1JOQA 3PO3H 1YHBA 2RF4A 1ET9A 5LMUQ 2MP1A 2AMCB 4YHHL 4NB3A 4JYAQ 4RAUC 3T53B 3GV6A 1WVLA 4DNTB 3J7A5 1KIXA 2SNMA 3TS2A 2WAQE 4BXXG 2A74C 2EJGC 1VCIA 2CCZA 1H9RA 3F8TA 3CQZB 3S1NH 1QWYA 3EJIA 3HKZE 3PMFA 4K6LA 3KJPA 2XTIA 3TEHB 1KLGD 4OHJA 5FOBB 2JYOA 1K73C 2SNSA 2MPMA 3CCSA 4JI5Q 5KIXA 1YNXA 2SOBA 4XQJA 1FGBD 1F2YA 4JI3Q 2F03A 2EY1A 4ZYSA 5C4HA 1EUJA 3M4PA 2IHFA 2PYKA 2NVTB 2L0CA 4KV6A 4GLVB 1ICFB 2VS1A 3CAMA 1I4HA 2B63H 1KDAA 3BVMA 4B3SQ 4RCOA 3QWNA 1GHKA 2LMCB 5CYUA 1XTDA 4JOIA 1JWSD 1VQEA 2MNAA 3I73A 3PGZA 2FXQA 4OEMB 1U4RA 4RCNA 3RR5A 1Z47A 3IL8A 2HCIA 2MGSA 4YCUA 3K7AB 1X3GA 1A15A 2R92B 1STGA 4ULLA 3NUCA 1VF5C 3S2DH 4H02A 4PMCA 4IO9A 1OTCA 1SYBA 5C3EG 2YTVA 2EYLA 1BCPD 4YIJA 2QF7A 1CQFA 2HCCA 3NELA 3WOFA 4R4QA 1KAWA 3QOLA 4A3BB 2H4OA 2NTTA 3HGBA 4K8JA 3MXNA 3U9OA 5C4XB 3OIQA 1BBXC 1QZHA 3CCQA 2RQXA 4FXKC 1LTLA 3L2PA 3HP3A 3H91A 2UXDQ 1A63A 1DCZA 4A3FB 4GOPA 4GNXB 1IBMQ 5ELNA 1O80A 1JCKB 1K8AC 3NSWA 5M3MG 3NE5B 1TS2A 3S16B 1Q90A 3OMGA 1ILPA 4R4OA 2Z0SA 2KVMA 3MXUA 4NXML 4KY5A 3PIOA 5C5MA 4X3TA 3GTOB 1CQVA 4DGZA 1ENCA 4FF4A 2MO0A 4LMQD 2UXCQ 2PZTA 1UE5A 3PIPA 1G6PA 3K59A 4A3IG 5KYIA 2K04A 1PTOB 3SK6A 4X65Q 1FL0A 2R61A 2XNAC 1VQGA 1PH8A 5BR8Q 4CHTB 2JEBI 1WTPA 2R93H 1Q3LA 3NBIA 5JVG3 1MBYA 1KXLA 3QR8A 2X6LA 1L0WA 2KECA 3GTJB 2CW0C 4DV3Q 5IYCG 4IFDH 1A0IA 4ID6A 3GTLH 3KDFB 1NR4A 2EIFA 2L5TA 2EYJA 1D5XC 3NTHA 4UHVA 1N8RC 1Q1BA 1CTMA 4BY1H 2WFWA 5HURA 1FNUA 1CKNA 1I50H 2IJ0A 4JVZA 3PUVA 1KTKA 4K14A 3W3AA 2HHHQ 3GO5A 1F2ZA 2UUCL 1V1PA 2NYZD 4BBSH 3HOWH 1Y14B 2EJMA 3S14H 2VY3A 2P5ZX 3K5NA 4QMGA 1EQTA 2EXDA 3BS1A 3W1BA 3BVZA 4A3LH 4LUOA 1LT5D 1BQQT 3BYYB 3S2HB 1PRTD 4H44C 3D6WA 3STBC 3CRKC 1QZGA 2F0HA 3E0JA 2KUMA 1SLJA 3OTOQ 1STHA 3JAMi 2B3GA 3CQZH 3KFUA 1EY5A 2K5QA 1KDCA 2Z4HA 5GADC 3I4NH 3FHWA 3D0FA 1SROA 1TWCH 5E4WC 1CA5A 5I6YA 3RMHA 1VQNA 4B3RL 5C3EB 5EPLA 2F0IA 2KOLA 4Q0FA 1GOZA 2DY8A 3RNUA 5FLMH 3NBHB 2UUBL 3STBD 4PG3A 1VQ6A 2LY7A 1FJGQ 4K5VA 1TR5A 4OX9L 4GLXA 3AU7A 1SNPA 2XIWA 3VR2A 2PCFB 5CGKA 1DONA 2L1BA 1SSOA 2PW7A 1VQ8A 3K5LA 4HSPA 1D5MC 4JI6L 4E6IA 1QVGA 5COYA 1X3PA 2JA7G 1QB5D 3T4AC 1SNCA 5M3MB 2QA4A 1QUQA 4MZ9A 1IYJB 1B44D 2H1EA 2B8GA 2XRQD 2XSCA 1ONLA 1PYBA 3E9HA 5LMNW 1KC8C 2NWGA 1TVXA 1EYCA 2F0UA 1WTVA 4L5TA 4LF6L 4ZKBB 4DR1Q 2L4NA 3PO3G 2ID0A 2RCNA 4GN3B 2K01A 5IGBA 2PZWA 1K28A 1S5FD 3BZCA 3PUXA 4JV5Q 4JPBW 5FLXE 2EY2A 1DGSA 4X3SA 2ENBA 3T1HQ 1PH6A 4NDXA 4JI8Q 4A3IB 3KF8A 3K0YA 3SR1A 3GD7A 2CH4W 5A35A 3IRBA 5I2XA 4ZLTF 5G3LF 2B29A 3HOYH 3GDEA 3HOZH 4DR5Q 4LJZC 3I55A 5C5LA 4HJ7A 4KD3A 1HNZL 5E1FA 1ZEQX 2VXWA 2PZUA 1QNUA 1YZ6A 2D2CC 5KYLA 3W1GA 1LYLA 2FINB 5ELFA 1NJIC 1HCZA 4DV7Q 1CK1A 3VR5A 1X6OA 4LUZA 3RLFA 4B3TQ 4N8FA 1HH2P 3TP6A 2B63G 2Q2TA 4TQUS 4Z9CB 4KHPL 2KHJA 1I4QA 1H9SA 3I7FA 2ZTEA 1DZ1A 1I6VC 1WTXA 2UXBL 1FVIA 3G7LA 4LF8Q 3A7AB 3J7YW 1XPOA 2B2WA 5JVH3 5I4DA 3SVMA 1SFOH 3S17H 2IX3A 3CCEA 4G57A 1VQCA 2ICEC 2Q2UA 2BE5C 1VQ4A 1GVPA 1E3PA 1N32Q 3TP7A 3NWSA 4IZ8A 4AQYL 3I4MH 3H09A 2HQEA 1IZ6A 2DUDA 3OWEB 4RFBA 1RTNA 3D4RA 3S1QH 2AQ2B 4JI1L 4ZUJA 4B9XA 1LTTD 3HOXH 1CM9A 4R4CA 1N9WA 1I3QB 1Z6HA 2JQOA 1JWUD 3Q0AA 4IPDA 1XNQQ 4DV0L 2BE5D 4CDCC 2HUGA 1KQSA 2JSOA 3TZDA 2NZHA 2F0NA 3QO2A 2ALYB 2JA6H 1VQ7A 2Q2IA 1WCMH 1XWEA 3MZ5A 1BF4A 2JA7B 3PCOB 1X32A 2KENA 4GN4B 5M5WB 3EBEA 3H6MA 5CBAE 2YV5A 4DV2L 4JI7L 3O13A 1RIPA 4C2MB 4FP5D 2B39A 1EZ8A 2AWNA 3H3VI 2CKZB 4LFCL 1K8OA 3OMCA 3CXCA 2A6ED 5C0XJ 2E5LQ 2JK8A 1V1OA 2QILA 3M85A 4UP7A 3PO3B 2E2JB 2A19A 4FF3A 1TWHB 4HCSA 2R93G 3DWAA 1HFNA 4JI4L 2RDFA 5EKLA 5JPMC 3MXNB 1JJ2A 2A8VA 1EWIA 1I94L 5D14A 4IPGA 2QKIC 3E6ZX 1E7ZA 4IFDG 1CKOA 2LS01 1U4PA 1A3TA 1F9RA 4ME5A 3UDGA 4TVAB 4BY1G 3PF4A 1G2SA 1L0YB 2KA7A 1EOTA 3A5ZB 1B3AA 3VYRA 4NP5A 4M1UB 3K81C 1PFNA 1LV9A 1F2MA 4BBSG 3HOWG 2F0GA 5EPKA 1J5EQ 1U4LA 2KEDA 1KAAA 3Q8DA 4A3LG 3AEVA 2Y0SE 2F0OA 3ND8A 4F8MA 1G8ZD 2B63B 1PZID 1EOVA 3BDLA 2AKWB 1L2FA 5K36H 5LMNL 1S72A 1XMQL 3ERSX 4IOCA 1SYDA 3I2ZA 4O42A 1B70B 4JBKA 1Y8NB 5ELDA 4ZQ3A 3J81i 3K5OA 1YHAA 3DXJC 3I4NG 1ET6A 3R3OA 2EE1A 5FO9B 2ZXRA 1VQPA 2K4KA 5NUCA 2NUCA 2OTJA 3URYA 4JI0L 3S2DB 1D6EC 1W6JA 4O2DA 4QIWB 1D8LA 1U4MA 1K0SA 5FLMG 1OO9B 1OXXK 2UUAQ 1B7YB 3NQIA 2EOTA 1CKNB 2E2DC 2V1CC 4DAVA 2A5HA 1B1ZA 4OELB 4AYBE 4DV6Q 1JQYD 4I7AA 4DR7L 1MGSA 1V1PB 2ZT9C 4MN3A 4KKSA 2EY6A 3JC66 3KOJA 2IY5B 2OCEA 5IGCA 1PH4A 3FRPB 2D5DA 4RH6A 4X66Q 3NQTA 2Q8IB 3HFZB 1C48A 3CCLA 5IT9c 1VQLA 4NPSA 2Q8TA 3UE1A 3A5UA 5EKIA 3ZJYC 2R7ZH 1DXMA 2HIVA 1EYAA 3H3VH 1HR0Q 2JA5H 4HR7B 1ILQA 3FKIH 2HQLA 1WTHA 3VA7A 1UEAB 4XTCS 3CMEA 1L1OC 3LWUA 1IXRA 1JORA 1ZYRD 4CKBA 1JOKA 1V43A 4QQBX 1EFID 1NR2A 1HNWL 4KKTA 5IP9H 2N55A 4DNIA 2OQKA 1F77A 3HOYG 4U68A 3X3MA 3HOZG 1BUVT 2R93B 3OYYA 2ZJPA 3A8IE 2VNUD 4JI5L 2HDLA 4QCLA 2F3WA 3RLOA 4DFAA 3WDNA 3GTLB 1EQQA 2RBMA 4CDEC 1DOLA 3TBIB 4KMUC 1RODA 1QUQB 3MFGA 3HOVH 4BY1B 2MHVA 1D1IA 4ALPA 1HPCA 2E74C 1I50B 1UE6A 4B3SL 3E5SA 3S1RH 3OSOA 1JMCA 1D2BA 2Z4IA 1DJRD 3OIPA 3J7AV 4B9WA 4HMIA 4BBSB 3HOWB 4FXDA 1TU2B 3D4WA 3EVQA 3S14B 3X3NA 4ME3A 5ELOA 2E2HH 1E2WA 2E2JH 3QOJA 2LFNA 4LF9Q 4FF2A 1TWHH 1HA5A 1V9PA 1JICA 3VDYA 3I72A 4C3JH 3H15A 5IP7H 3OPOA 4CJ2C 3IFDA 1MJEA 2GA4B 1VQFA 4DR4L 1TXYA 3NHHA 5CV9A 1LT4D 1SNQA 2B2VC 2X69A 3NEMA 3I4LA 1N33L 1KL9A 1I5FA 4GLAC 4N9PA 2I07B 2VL6A 1IHZA 4IPCA 1Q86C 3G6EA 3I4NB 1IBLL 4OO1I 4IFDI 3I4MG 4K0KL 1TWCB 1MD2D 4EGVA 4K5WA 2R7FA 3BG3A 3CHBD 2ZXOA 4JW0A 1GKHA 1NUCA 4V0BA 2SDFA 4ZKCB 2XWBB 2NTSA 4KN4C 3HOXG 4LF7L 1B8AA 2K33A 5HGTA 4ABNA 1IBML 4J6HA 2F0DA 4BBRH 4OONA 5CV4A 4DUZL 4LFAL 4ZCKA 1BCPC 4KLKA 3D3RA 5CV6A 1I4XA 3LWEA 3KF6A 3MAQA 2EVBA 2K75A 3PUYA 1VQ5A 1JJGA 2JA6G 1A62A 1E2VA 1HQMC 1WCMG 2I5LX 2LSSA 3MXGA 1I6HH 3Q6SA 1EWHA 1JR0D 3HZXA 3F1ZA 2RSOA 2JN4A 2F52A 1IL8A 3A56A 4H13C 2J7ZA 4G4KA 1RD9D 3ERQA 5CV7A 4HIOA 3AFQA 4L6TB 1SYEA 2D0OA 2DY7A 1YVCA 2CVRA 4LNQA 2B2TC 5IGEA 5BR8L 5EAYA 5HGQA 5KEEA 1TWAH 2B2YC 1ESRA 5E4XA 1BKBA 2RDGA 2ZJQA 2XVSA 4KD4A 5C4JB 5C4ZA 1QG7A 4DV3L 1XYIA 1Q8IA 4OIJA 3HOUH 1SNMA 4YWLA 2F0MA 3HOYB 1Z7TA 3HOZB 2L9HA 1K8MA 2BH2A 2K5NA 2O5IC 2K5DA 5GQOA 1C0AA 3MWYW 1Q46A 2JJQA 4ZK9B 1B4OA 1PLFA 2HHHL 3ER0A 1N34L 1NSNS 1QVFA 3PQIA 1LM0A 2WKCA 4U673 4PNYA 2IX0A 1D7QA 1VQ9A 2L12A 4M8AA 1HTLD 4DKAC 4A75A 1RCVD 1CFMA 2A73B 3SK5A 2K5HA 3RN5A 1YEZA 2BCOA 1VQIA 2JP1A 4X64L 3S15H 1YHQA 2RDHA 5K36G 1NTGA
chains in the Genus database with same CATH topology
2EYMA 2F0PA 4F7XA 1SE3A 1MSHA 5JOBA 2F0LA 2KCCA 1LTBD 1C4QA 2DN8A 3TMEA 1SFOB 3S17B 1RDPD 1XXGA 4OO1H 1PRTC 1M8AA 4HSVA 5KNDA 1KABA 4XIGS 2A68C 2EYPA 1IKLA 3I4MB 1SXTA 2V4DA 3PUWA 2JEAI 1I4GA 3S1QB 3JAME 1SNDA 5FO8B 4GZYC 3HOXB 1GUGA 1ICWA 5DEHA 1NAPA 4CKCA 1DYQA 5DM63 2XWJB 1SBBB 3NP8A 3ITPA 3QJYA 4C1NK 3N52A 5CBEE 2JA6B 1WCMB 2A68D 3G6JB 1A2UA 5K5PA 1AW7A 1EEID 4X3UA 2RSNA 1B9NA 4CBVA 1YNND 1O7ZA 1EIHA 1DOMA 4CJ0B 3TN2A 3QG1A 3C2PA 2A69C 1I4PA 1B50A 1CZGA 2TMPA 2K32A 4RGMA 4IQZA 1PTOC 1R4QB 4IUUA 4KTAA 1LT6D 4V190 1OXUA 1UAPA 2Z8LA 3V96A 4QUFA 5CC4A 4I7ZC 1EY6A 1TS5A 3A8JE 1IYVA 1EU3A 2F3VA 1AEXA 1CI3M 3OOCA 2A69D 5I9PA 2PNRC 1STNA 4C3JG 1PTOD 1TIID 1WD1A 4G7OC 3I70A 2M9VA 5ISRA 2B2TA 3I8ZA 3R93A 5IT9E 5FLXL 2B2YA 3BVGA 5IT9L 1BO0A 2JXMB 4DN4M 2KQ3A 1AP0A 4UDUC 1S5CD 5IGDA 2F0FA 2KCNA 2ZXPA 1BOSA 2B8FA 4ZAIA 2CQAA 3EFXD 3KBXA 1PXUA 5FK9C 4HCEA 3MC0B 1FNWA 2IW3A 1LABA 1WTOA 1GUWA 3TDQA 1SYGA 1GJXA 4FNFA 1G291 1IKMA 2SEBD 1HHVA 2EYHA 1EYDA 1SJED 4ODGA 4QF4A 3TP5A 2PQEA 2OXPA 2R7ZB 2D9UA 2N88A 2JA5B 3FKIB 3VYTA 1PZJD 3J7AF 1G91A 3TZUA 3R8BA 5I6WA 3WOEA 4IFDJ 1CA6A 4RGOS 4HAEA 1K83B 2A6EC 4HMJA 3MTSA 1BCPF 4IUVA 5CORA 4XQQA 2FHTA 1FYCA 2PPBC 4KY6A 1C8CA 3SK4A 2EXZA 2D62A 1KDBA 1NCVA 3HOVB 3KLSA 5JJZA 4FF1A 3S1MB 4QUCA 5DM73 5FO7B 3S1RB 2OT2A 4FXGC 1JWMD 3OWFA 2E2HB 1BNZA 3VR6A 1E2ZA 4C3JB 4O1NA 4DF7A 5ELEA 3Q22A 2EYFA 2BDOA 1H9MA 4NKLA 1Q1EA 3F2UA 4OO1G 4IN3A 2F0EA 2VB3X 4EQNA 1GXDC 5C6AA 4A3EB 4BS9A 4IUNA 4WRDA 1LTSD 1M4VA 5KNBA 1D1KA 4C3HG 4BBRB 4F88A 1G6ZA 2B2UC 3DM1A 4K8IA 3DHQA 5EPJA 1EY7A 2K6AA 1WTQA 1S5DD 2FMMA 3BDCA 1I6HB 1PYWD 4OL7A 4XT3B 1Y8OB 3V05A 5EJWA 1PDQA 1SYFA 1PRTF 2EJFC 4PMBA 1TS4A 3SK8A 5I9OA 1TWAB 4NMZA 5IOCA 1O78A 3FPUB 1T5XD 3V2TA 2E75C 1IYUA 1PFMA 1ESFA 4WJWA 3HOUB 1SEBD 2DNEA 1Q12A 3PIO3 1ZYRC 1G2TA 4OGQC 3M7NA 4C3IG 4MIUA 2M2LA 3T56B 1F9QA 1AZPA 4G7ZC 3K58A 2K5WA 3Q23A 4DU9A 4R9WA 1H9KA 3S15B 3D8GA 3T16A 3MVVA 4PV1C 1GHJA 4RWSC 4L63B 1CHPD 4A3DB 1Y1VB 2F0SA 4KN7C 2O5JC 2OEOA 4N9TA 3K6OA 1EY0A 1B9MA 2L55A 2PW5A 3VR4A 1CT1D 2NBFA 1DOKA 1QE6A 3RD4A 3BDOA 3T51B 5TSSA 2BA1A 3GQBA 4KK7A 5M5YB 3ONAB 1RHPA 3GTKB 2K05A 3M3YB 3M4OB 3RZOB 1HUMA 5KRUA 1FR3A 4XQNA 3A54A 4A3GB 2AQ1B 1SDFA 3MEHA 4C3HB 1SMYD 3CU7A 4H0LC 1B2TA 3SHLA 3GP7A 1Y69U 1ENAA 3T13A 1TT2A 4PQXA 1JC7A 5G3LD 5CV8A 1F9SA 1GUTA 3M4YA 1EY9A 4QB4A 5AFWA 3K5MA 5JAVA 3KBGA 4ILWA 2WKDA 3BYTB 5KGUA 3C3LA 2WB1B 3P20A 1ZXTA 1HFGA 1STBA 2A6HC 3EQLC 1H9SB 2B2UA 2WACA 2K28A 2PMZB 1BR9A 2IT1A 1FNVA 2AUJD 4C3IB 4KJOA 4JK1C 1LTAD 5BN5A 3SXHA 4I65A 4A3MB 2NN6I 4IURA 3S9WA 2FJ2A 3QB3A 2BA0A 2F0WA 3SE0A 1WD0A 4G7HC 2A6HD 3GTQB 2CHBD 1PRTB 2RA4A 4J1MA 2YYZA 1WTRA 1RTOA 3LX0A 2QEJC 3U9SA 5DAUA 3A8KE 3NPPA 5C0XI 3KUPA 4KY7A 2NVXB 1Y8PB 5IODA 4EQPA 3FMCA 2WAQB 4DXFA 3GV3A 5CR3A 3P75A 3C1EA 4EQOA 1TWFB 2IPKD 1AFPA 1A3VA 1LTGD 1J9OA 2JE6I 3HKZB 1TS3A 2O2LD 1SAPA 1HTPA 4DXGA 2NVYB 2JA8B 1XX8A 1F2LA 3J80E 3R2IA 3J80L 4KJNA 4XYOA 4ZUIA 2QCPX 3RUZA 3H94A 4C1NI 1VMPA 1HQRD 1EIGA 1H9JA 4RA8A 1AN8A 1W6KA 2RVLA 3GTGB 3FVQA 3CRLC 2WIIB 4KHVA 3SEBA 5JEAH 5DNFA 3VYSA 1DM0B 1A3UA 1R4PB 2G9HD 2KJXA 1HRJA 2B2WC 3KLSX 3CKIB 1OXVA 5EGTA 4FVMA 1MSGA 1SE2A 4XDXA 2HDMA 1UUPA 4TSSA 1EY8A 1CZWA 1LLRD 3JAML 1S5BD 4JBWA 1SJHD 3OHXC 1YNNC 1RJTA 2NB0A 2M00A 1UNSA 4S3SA 2WP8J 2EY5A 2E2IB 1CHQD 5D65A 1I4RA 5E3FA 4WORA 2IWHA 1BDOA 1E0BA 2NN6H 3EA6A 3H0GB 2B2VA 3M7GA 2CW0D 2E76C 3KLRA 3SDZA 1STAA 4BA1I 1ENFA 4XT1B 5J39A 1SNOA 2OF1A 4A3JB 5C0XH 4K2KA 2Z1CA 2K7VA 3NTIA 4UAIA 5F2DA 3ZYYX 4K5XA 5EBDA 1S5ED 5LHY1 5ELBA 2MUYA 1L0XB 4B08A 1HA6A 3C1FA 1STYA 2FMCA 1JB3A 1XTCD 1BXTA 4TKOB 5C3XA 4EVOA 2F0KA 2IX1A 3D31A 4K2LA 2C9OA 3A55A 3VYUA 5T1IA 4RGNA 1J8IA 2XN9C 1IW7C 3UI2A 1KNEA 1DD2A 2AWOA 5C3WA 2F1MA 1LT3D 1X3QA 3NXWA 1TY2A 3DEPA 1O7YA 2K1BA 4KI0A 3K57A 1EY4A 1T5EA 1SE4A 4FO2A 1IW7D 1EEFD 2R6GA 2IL8A 3AMUA 5IGFA 1II3A 4DNRB 3MA2B 2F0VA 4Q5VA 3N6RA 5EKKA 4PMWA 5J22A 2FFKB 3ND9A 4RHSA 3VR3A 4NW2A 1GUNA 5IGGA 1ML0D 1B53A 1PZKD 5LL6S 5CV5A 2QDBA 2EDGA 4J8QA 1PTOH 5JPNC 4MHEA 5JEAJ 2XRSD 3D6CA 4K6DA 1VDZA 1A6XA 1JE4A 2ICIA 1U9RA 1OXSC 4BY7B 2KEEA 2RKSA 3NK9A 1EZ6A 2O4XA 1TQOA 1EQVA 4IALA 3DMUA 3KK7A 2MJ8A 4FYDA 2AQ3B 4RKBA 3PUZA 4DA2A 1MI2A 4DK0A 4DAPA 4IUTA 3Q24A 1R9TB 1LTRD 3LNNA 3TSSA 3TP8A 3IKJA 3EROA 4H7BA 3DUZA 5FKAC 1VMCA 5J1ZA 3GTPB 4XYQA 4RGTA 3HEJA 3IAYA 1Y1WB 5BN3A 3FPPA 3IFTA 5JEAG 4LK1C 3I3CA 1S4ZA 1EU4A 1HXYD 3DWQA 3AB9A 5T1GA 2EPBA 5I2YA 3C46A 4CJ1B 1V8QA 2AUKA 3I91A 2BOSA 4R8IA 5M9OA 4IUPA 5M3FB 1PMRA 3DWPA 4OIKA 3H3VC 2TSSA 3J81E 2F0JA 4A93B 3S1NB 3L9AX 5ELCA 3J81L 1TWGB 4Y7NB 3NWTA 1STEA 5EQ0A 4RHRA 4DK1A 1YNJC 1LO5D 4C56C 2NN6G 3MHBA 1KLUD 4LAAA 3P7JA 1RF2D 2EYOA 1QJOA 5BN4A 3VA5A 3I90A 2C5CA 5D3IB 4CGYB 3MFYA 2KHSA 3GTMB 5C0XG 5D3DA 2F0QA 2Q8RE 3D4DA 3RZDB 2WV6D 1KNAA 1YNJD 3L3OC 3PV0A 4BA2I 2PO4A 1QCBD 2F4IA 2YU9B 4X3KA 2X6GA 4R8NA 2NVQB 3FDTA 5C44B 2DNCA 4KKUA 3NBHA 4HEDA 3PIP3 2VUMB 2J4XA 3FEWX 1PFBA 3NTKA 1RKNA 1GUSA 3L7ZC 2BDNA 2F0TA 4L8JA 5KNCA 1EL0A 4BWGB 2Y0SB 1TKWB 1O7LA 3R2TA 2R3ZA 3OW7A 3W2DA 2LKVA 2K03A 3HRZC 1QNKA 2J0TD 2I46A 5CMDA 2WINB 1A2TA 1EWCA 1SMYC 3HG9A 3BZDB 1PTOF 3MXPA 4HTHA 1BCPB 5LL6X 2EZVA 4P2CB 1TY0A 2L11A 4A3KB 4WFN3 1F9PA 1FD7D 1LACA 5A2QE 1HUNA 1GUOA 1ZKOA 5A2QL 4DAYA 3DEOA 4HN7A 4AYBB 4ZRZA 4KHZA 1LTID 5M5XB 2G9DA 3A7LA 4F87A 5EBCA 1AZQA 4CKEA 4IUQA 4TRDA 1SYCA 1D5ZC 2NZ1D 1OXTA 5IIFA 1JOOA 4RKLA 4XXEA 1QILA 1WTWA 3PO2B 3QIAA 3P1HA 1QOHA 1VF7A 2VB2X 3HS0C 1JOQA 1ET9A 2MP1A 4RAUC 3T53B 3GV6A 1WVLA 4DNTB 2SNMA 2A74C 2EJGC 1VCIA 1H9RA 3CQZB 1QWYA 3EJIA 3PMFA 4K6LA 1KLGD 4OHJA 5FOBB 2JYOA 2SNSA 2MPMA 5KIXA 2SOBA 4XQJA 1FGBD 1F2YA 2F03A 2EY1A 4ZYSA 5C4HA 2PYKA 2NVTB 2L0CA 4KV6A 1I4HA 1GHKA 1KDAA 3BVMA 4RCOA 3QWNA 2LMCB 5CYUA 1JWSD 3I73A 1U4RA 4RCNA 1Z47A 3IL8A 2HCIA 2MGSA 3K7AB 1A15A 2R92B 1STGA 4ULLA 3NUCA 1VF5C 4PMCA 1SYBA 2EYLA 1BCPD 4YIJA 2QF7A 1CQFA 2HCCA 3WOFA 3QOLA 4A3BB 2H4OA 2NTTA 3HGBA 4K8JA 3MXNA 3U9OA 5C4XB 3OIQA 1BBXC 2RQXA 4FXKC 3HP3A 3H91A 1DCZA 4A3FB 1O80A 1JCKB 3NSWA 3NE5B 1TS2A 3S16B 1Q90A 3OMGA 1ILPA 2KVMA 3MXUA 4KY5A 5C5MA 4X3TA 3GTOB 1CQVA 4DGZA 1ENCA 4FF4A 4LMQD 2PZTA 3K59A 5KYIA 2K04A 1PTOB 3SK6A 2R61A 2XNAC 4CHTB 2JEBI 1WTPA 1Q3LA 3NBIA 5JVG3 1MBYA 2X6LA 2KECA 3GTJB 2CW0C 4IFDH 4ID6A 1NR4A 2L5TA 2EYJA 1D5XC 3NTHA 1Q1BA 1CTMA 5HURA 1FNUA 2IJ0A 3PUVA 1KTKA 4K14A 3W3AA 3GO5A 1F2ZA 1V1PA 2NYZD 2EJMA 3K5NA 4QMGA 1EQTA 3BS1A 3BVZA 1LT5D 1BQQT 3BYYB 3S2HB 1PRTD 4H44C 3D6WA 3CRKC 2F0HA 3E0JA 2KUMA 1STHA 1EY5A 2K5QA 1KDCA 2Z4HA 5E4WC 1CA5A 5I6YA 3RMHA 5C3EB 5EPLA 2F0IA 2KOLA 4Q0FA 1GOZA 2DY8A 2LY7A 4K5VA 1TR5A 3AU7A 1SNPA 2XIWA 3VR2A 5CGKA 2PCFB 1DONA 2L1BA 1SSOA 2PW7A 3K5LA 4HSPA 1D5MC 4E6IA 5COYA 1X3PA 1QB5D 3T4AC 1SNCA 5M3MB 1B44D 2H1EA 2B8GA 2XRQD 2XSCA 1ONLA 2NWGA 1TVXA 1EYCA 2F0UA 1WTVA 4ZKBB 2L4NA 2ID0A 2K01A 5IGBA 2PZWA 1S5FD 3PUXA 5FLXE 2EY2A 4X3SA 2ENBA 4NDXA 4A3IB 3KF8A 3K0YA 3SR1A 3GD7A 5A35A 5I2XA 4ZLTF 5G3LF 4LJZC 5C5LA 4KD3A 5E1FA 1ZEQX 2VXWA 2PZUA 1QNUA 2D2CC 5KYLA 2FINB 5ELFA 1HCZA 1CK1A 3VR5A 3RLFA 3TP6A 4TQUS 4Z9CB 1I4QA 1H9SA 1DZ1A 1I6VC 1WTXA 3G7LA 3A7AB 3J7YW 2B2WA 5JVH3 5I4DA 3SVMA 2IX3A 4G57A 2ICEC 2BE5C 3TP7A 3NWSA 4IZ8A 3H09A 2HQEA 3OWEB 4RFBA 1RTNA 3D4RA 2AQ2B 4ZUJA 4B9XA 1LTTD 1CM9A 1I3QB 1Z6HA 1JWUD 3Q0AA 2BE5D 2HUGA 2JSOA 3TZDA 2F0NA 3QO2A 1XWEA 3MZ5A 1BF4A 2JA7B 1X32A 5M5WB 3H6MA 5CBAE 3O13A 4C2MB 4FP5D 2B39A 1EZ8A 2AWNA 1K8OA 3OMCA 2A6ED 5C0XJ 2QILA 1V1OA 3M85A 3PO3B 2E2JB 4FF3A 1TWHB 4HCSA 3DWAA 1HFNA 2RDFA 5EKLA 5JPMC 5D14A 2QKIC 3E6ZX 4IFDG 2LS01 1U4PA 1A3TA 1F9RA 4ME5A 1G2SA 1L0YB 2KA7A 1EOTA 1B3AA 3VYRA 4NP5A 4M1UB 1PFNA 1LV9A 1F2MA 2F0GA 5EPKA 1U4LA 2KEDA 1KAAA 2F0OA 3ND8A 4F8MA 1G8ZD 2B63B 1PZID 3BDLA 5K36H 1SYDA 4O42A 1Y8NB 5ELDA 4ZQ3A 3K5OA 3DXJC 1ET6A 3R3OA 2EE1A 5FO9B 2ZXRA 5NUCA 2NUCA 3URYA 3S2DB 1D6EC 1W6JA 4QIWB 1U4MA 1OO9B 1OXXK 3NQIA 2EOTA 2E2DC 4DAVA 2A5HA 1B1ZA 1JQYD 1MGSA 1V1PB 2ZT9C 4MN3A 4KKSA 2EY6A 5IGCA 3FRPB 2D5DA 4RH6A 3NQTA 2Q8IB 1C48A 2Q8TA 5EKIA 1DXMA 1EYAA 4HR7B 1ILQA 3VA7A 1UEAB 4XTCS 3LWUA 1JORA 1ZYRD 4CKBA 1JOKA 1V43A 1EFID 1NR2A 4KKTA 2N55A 1F77A 4U68A 3X3MA 1BUVT 2R93B 3A8IE 2VNUD 2HDLA 4QCLA 2F3WA 4DFAA 3WDNA 3GTLB 2RBMA 1DOLA 3TBIB 4KMUC 1RODA 3MFGA 4BY1B 2MHVA 1D1IA 1HPCA 2E74C 1I50B 3E5SA 3OSOA 1D2BA 2Z4IA 1DJRD 3OIPA 3J7AV 4B9WA 4HMIA 4BBSB 3HOWB 4FXDA 1TU2B 3D4WA 3EVQA 3S14B 3X3NA 1E2WA 3QOJA 2LFNA 4FF2A 1HA5A 1JICA 3I72A 3OPOA 4CJ2C 3IFDA 2GA4B 3NHHA 5CV9A 1LT4D 1SNQA 2B2VC 2X69A 3I4LA 4N9PA 2I07B 1IHZA 3I4NB 4OO1I 4IFDI 1TWCB 1MD2D 4EGVA 4K5WA 3BG3A 3CHBD 2ZXOA 1NUCA 4V0BA 2SDFA 4ZKCB 2XWBB 2NTSA 4KN4C 2K33A 5HGTA 4ABNA 4J6HA 2F0DA 5CV4A 1BCPC 3D3RA 5CV6A 1I4XA 3LWEA 3MAQA 2EVBA 3PUYA 1E2VA 1HQMC 3MXGA 3Q6SA 1EWHA 1JR0D 3HZXA 2RSOA 1IL8A 3A56A 4H13C 2J7ZA 4G4KA 1RD9D 3ERQA 5CV7A 4L6TB 1SYEA 2DY7A 2CVRA 2B2TC 5IGEA 5KEEA 2B2YC 1ESRA 5E4XA 2RDGA 2XVSA 4KD4A 5C4JB 5C4ZA 1QG7A 1XYIA 1Q8IA 4OIJA 1SNMA 2F0MA 3HOYB 1Z7TA 3HOZB 2L9HA 1K8MA 2O5IC 2K5DA 3MWYW 4ZK9B 1B4OA 1PLFA 1NSNS 2WKCA 4U673 4PNYA 2IX0A 2L12A 4M8AA 1HTLD 1RCVD 1CFMA 2A73B 3SK5A 2BCOA 2JP1A 2RDHA 5K36G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L5T A;  1FR3 A;  3TZU A;  1Q1B A;  2ZT9 C;  1PMR A;  3ND9 A;  2LMC B;  1CTM A;  3VR3 A;  2JE6 I;  4KKS A;  1SMY C;  3GD7 A;  4I7Z C;  1GUN A;  5A35 A;  3A8J E;  1IYV A;  1HTP A;  3BG3 A;  5C0X H;  4H0L C;  3PUV A;  3W3A A;  2A6E C;  1CI3 M;  2K7V A;  3OOC A;  2KCC A;  2A69 D;  2D5D A;  4LJZ C;  2EJF C;  1K8O A;  3I73 A;  2A6E D;  4RCN A;  1FYC A;  2Q8I B;  3M85 A;  2PPB C;  2EDG A;  4KN4 C;  2EJM A;  2K33 A;  2DN8 A;  1Y69 U;  1O78 A;  1LAC A;  2D2C C;  2PNR C;  2E75 C;  4DK1 A;  1GUO A;  1VF5 C;  1IYU A;  1YNJ C;  4OO1 H;  4G7O C;  2D62 A;  1HCZ A;  1ZKO A;  3H94 A;  2NN6 G;  1DXM A;  3VR5 A;  4H44 C;  1GUT A;  5KND A;  1VDZ A;  1A6X A;  3CRK C;  2QF7 A;  3M4Y A;  4HR7 B;  4XIG S;  2A68 C;  2EVB A;  2DNE A;  3PUY A;  3RLF A;  2JXM B;  4IFD G;  1OXS C;  1Q12 A;  1E2V A;  1HQM C;  2V4D A;  1ZYR C;  1H9J A;  3PUW A;  4KHZ A;  1QJO A;  4XTC S;  3VA7 A;  2JEA I;  5BN4 A;  1EWH A;  3HGB A;  3A7L A;  3LWU A;  4OGQ C;  3M7N A;  1V43 A;  4TQU S;  3MFY A;  4KKT A;  4GZY C;  3CRL C;  2KA7 A;  1OXT A;  1GUG A;  1H9S A;  4H13 C;  1DCZ A;  5C0X G;  3T56 B;  2B8F A;  5JEA H;  1I6V C;  3P20 A;  3VR6 A;  1E2Z A;  3QIA A;  4G7Z C;  3A8I E;  3NE5 B;  3A7A B;  4TKO B;  1VF7 A;  1Q90 A;  2A6H C;  3PUZ A;  1LAB A;  3PV0 A;  2BDO A;  4BA2 I;  3QJY A;  3D31 A;  4DK0 A;  1H9M A;  3EQL C;  1Q1E A;  1H9S B;  4OO1 G;  1H9K A;  3MXU A;  1OXV A;  3ND8 A;  3WDN A;  2A68 D;  4PV1 C;  3T53 B;  2BE5 C;  1GHJ A;  3LNN A;  1GJX A;  4KMU C;  4DNT B;  2IT1 A;  3VR2 A;  5K36 H;  1IW7 C;  2PCF B;  3IKJ A;  2AUJ D;  2EJG C;  1G29 1;  1VCI A;  2DNC A;  1DD2 A;  2AWO A;  4KKU A;  1HPC A;  2E74 C;  4JK1 C;  4KN7 C;  2O5J C;  2F1M A;  1H9R A;  4JBW A;  5BN5 A;  1Z7T A;  1YNN C;  1B9N A;  1B9M A;  1Y8N B;  1K8M A;  2NN6 I;  3VR4 A;  2O5I C;  3D4R A;  2BA0 A;  3DXJ C;  3QG1 A;  3SE0 A;  1TU2 B;  3BDO A;  3T51 B;  1GUS A;  3L7Z C;  2B8G A;  5BN3 A;  2BA1 A;  3FPP A;  3IFT A;  5KNB A;  1E2W A;  5JEA G;  1ONL A;  4G7H C;  2A6H D;  3GQB A;  2A69 C;  4L8J A;  4LK1 C;  1Z6H A;  5KNC A;  2YYZ A;  3I72 A;  2JEB I;  3AB9 A;  3U9S A;  3OPO A;  4KI0 A;  2K32 A;  3A8K E;  2BE5 D;  1BDO A;  1OXX K;  1TKW B;  1V8Q A;  2AUK A;  2NN6 H;  4IQZ A;  1T5E A;  2CW0 C;  1O7L A;  1Y8P B;  1CFM A;  1IW7 D;  2R6G A;  3OW7 A;  5K36 G;  3FMC A;  3PUX A;  2E76 C;  3KLR A;  3SDZ A;  4DNR B;  4IFD H;  3I4L A;  3N6R A;  1OXU A;  4BA1 I;  1Y8O B;  1GHK A; 
#chains in the Genus database with same CATH topology
 2EYM A;  2F0P A;  4CDF C;  4A3D H;  2UU9 Q;  1SMX A;  1Y1V H;  2E8G A;  1SE3 A;  4F7X A;  4DV4 Q;  1MSH A;  1J6Q A;  5JOB A;  2F0L A;  1JJC B;  3J80 i;  5JJL A;  2KCC A;  4YY3 L;  1LTB D;  2MO1 A;  1C4Q A;  2DN8 A;  2Z6B A;  3TME A;  2RHS B;  1SFO B;  3S17 B;  1RDP D;  1XXG A;  4OO1 H;  5M5Y H;  1PRT C;  1M8A A;  1VQA A;  2PI2 A;  4HSV A;  5KND A;  1KAB A;  3LGJ A;  3GTK H;  4XIG S;  1FJG L;  2A68 C;  2EYP A;  2HD3 A;  4R1J A;  5GAG C;  1IKL A;  3M3Y H;  3I4M B;  1SXT A;  3RZO H;  3M4O H;  2V4D A;  4L5R C;  3PUW A;  1Q7Y C;  2JEA I;  1I4G A;  4GKK L;  1G51 A;  3S1Q B;  3JAM E;  1SND A;  5FO8 B;  4GZY C;  4A3G H;  3HOX B;  1GUG A;  3KYH C;  4DV1 Q;  1ICW A;  5DEH A;  1NAP A;  4CKC A;  4C3H H;  1DYQ A;  5DM6 3;  2XWJ B;  3CP0 A;  1SBB B;  3NP8 A;  3ITP A;  3QJY A;  4C1N K;  3N52 A;  2KCT A;  5CBE E;  2JA6 B;  1WCM B;  2A68 D;  3U4Z A;  3T1Y L;  3G6J B;  1K0R A;  4JG2 A;  4GNX C;  4DK3 C;  2R7Z G;  1A2U A;  4NXM Q;  2JA5 G;  5K5P A;  1AW7 A;  3FKI G;  1EEI D;  4X3U A;  2RSN A;  1M90 C;  1B9N A;  4CBV A;  1YNN D;  2ZM6 Q;  3ULJ A;  1O7Z A;  1EIH A;  1DOM A;  5IP9 G;  4CJ0 B;  2N49 A;  3TN2 A;  3QG1 A;  3C2P A;  4DR5 L;  1XMO L;  2A69 C;  1I4P A;  1X3F A;  1B50 A;  1CZG A;  1XNR Q;  4DUY L;  2CQO A;  2QGQ A;  2TMP A;  2F4V L;  2K32 A;  2RHQ B;  4RGM A;  4PZ6 A;  4IQZ A;  1PTO C;  1R4Q B;  4IUU A;  4KTA A;  4DV7 L;  1LT6 D;  4AIM A;  5FJ8 H;  4V19 0;  4DK6 C;  1OXU A;  1IL2 A;  3HOV G;  1UAP A;  2Z8L A;  3F2C A;  1BBW A;  3V96 A;  4B3T L;  4QUF A;  5CC4 A;  4C3I H;  4I7Z C;  2OTL A;  1EY6 A;  1AE2 A;  1TS5 A;  3A8J E;  1IYV A;  1EU3 A;  1IBK L;  2F3V A;  1AEX A;  4GKJ L;  1CI3 M;  4A3M H;  3OOC A;  2A69 D;  3CCV A;  3CD6 A;  4JBM A;  4GS3 A;  3DLL A;  2UUC Q;  5I9P A;  2GN5 A;  1HR0 W;  2PNR C;  1STN A;  5E7N A;  4LF8 L;  4QGU A;  4C3J G;  1PTO D;  1TII D;  1WD1 A;  4G7O C;  5IP7 G;  3I70 A;  1CSP A;  2M9V A;  1GD7 A;  3EIV A;  5ISR A;  2B2T A;  3I8Z A;  1KHI A;  2JA9 A;  3R93 A;  5IT9 E;  4YCW A;  5FLX L;  5C4J H;  2B2Y A;  4X6A H;  3BVG A;  5IT9 L;  1BO0 A;  2JXM B;  4DN4 M;  2KQ3 A;  1AP0 A;  2VZA A;  1N32 L;  4DAY B;  1V1Q A;  1S5C D;  4UDU C;  5IGD A;  1TWF H;  2F0F A;  2KCN A;  2ZXP A;  1BOS A;  2B8F A;  4ZAI A;  4A3E G;  2CQA A;  3EFX D;  3KBX A;  1WI5 A;  3G71 A;  1PXU A;  1HNX Q;  4B3M Q;  2NVY H;  2Z6K C;  5FK9 C;  2JA8 H;  4HIM A;  4HCE A;  1YIT A;  3MC0 B;  1FNW A;  2IW3 A;  1LAB A;  3CC2 A;  1MHW C;  4B3R Q;  1WTO A;  1AH9 A;  4L5Q A;  4BBR G;  1GUW A;  3TDQ A;  1SYG A;  1QVC A;  3EN2 A;  1XNQ L;  1GJX A;  4FNF A;  2VQE Q;  1G29 1;  3RLN A;  1SRU A;  1IKM A;  2SEB D;  1H95 A;  1HHV A;  3GTG H;  2EYH A;  1EYD A;  1SJE D;  4ODG A;  4QF4 A;  3TP5 A;  1A8V A;  1PH9 A;  2PQE A;  2OXP A;  2R7Z B;  2D9U A;  2N88 A;  4LF6 Q;  2JA5 B;  1HZC A;  3FKI B;  1Z9F A;  3VYT A;  1VQM A;  1PZJ D;  3J7A F;  1G91 A;  3ICE A;  3TZU A;  3R8B A;  3HOU G;  5I6W A;  3WOE A;  4LFB L;  4IFD J;  5GAH C;  3UDX A;  1CA6 A;  1N36 Q;  3J80 c;  3FP9 A;  4RGO S;  4HAE A;  1PH1 A;  1K83 B;  2A6E C;  4HMJ A;  3MTS A;  1BCP F;  4IUV A;  5COR A;  4XQQ A;  2FHT A;  1FYC A;  2PPB C;  1HZA A;  4KY6 A;  1HNZ Q;  4L5S A;  4DPG A;  3KF6 B;  1SR3 A;  1EQR A;  1C8C A;  3SK4 A;  2E2I H;  2EXZ A;  2D62 A;  1KDB A;  1NCV A;  4DR2 Q;  3HOV B;  4DR6 L;  3KLS A;  2KCM A;  2PNH A;  5JJZ A;  5DLQ E;  4FF1 A;  2LXK A;  4LF4 L;  3S1M B;  4QUC A;  5DM7 3;  5FO7 B;  2ES2 A;  4GNX A;  3S1R B;  3G48 A;  2OT2 A;  4FXG C;  1KRS A;  4A3D G;  1JWM D;  1Y1V G;  5IYB H;  3OWF A;  2E2H B;  5AJ3 Q;  1BNZ A;  1HZB A;  4KHP Q;  3M9B A;  4UP9 A;  1O7I A;  4A3J H;  3VR6 A;  1E2Z A;  4C3J B;  4O1N A;  4PZ7 A;  4DF7 A;  5ELE A;  3Q22 A;  2EYF A;  3F2B A;  4DAM A;  2BDO A;  1H9M A;  3E3X A;  3JAM c;  4NKL A;  1Q1E A;  3F2U A;  4QIW E;  4OO1 G;  4POG A;  4IN3 A;  4GOP B;  3AYH B;  2F0E A;  2VB3 X;  4LF5 Q;  4EQN A;  2UUA L;  4GN5 A;  1BBU A;  2K14 A;  3UE0 A;  1GXD C;  1Q82 C;  4DV5 L;  2OWO A;  4DV6 L;  5C6A A;  4A3E B;  4BS9 A;  4IUN A;  4WRD A;  1LTS D;  4A3G G;  1M4V A;  4NXN L;  4HJ5 A;  5KNB A;  1D1K A;  4C3H G;  4BBR B;  4F88 A;  1G6Z A;  2B2U C;  3DM1 A;  4K8I A;  3DHQ A;  5EPJ A;  3KJO A;  1EY7 A;  1EFW A;  2K6A A;  3UDI A;  4DV0 Q;  1WTQ A;  3HKS A;  1S5D D;  4CDD C;  2FMM A;  3BDC A;  1I6H B;  1PYW D;  4X62 Q;  4OL7 A;  4XT3 B;  1LUZ A;  1Y8O B;  4LWC A;  3V05 A;  1HR0 L;  5IE8 A;  2CWP A;  2ZTD A;  3M4Q A;  3J7Z C;  4DV2 Q;  5EJW A;  4JOI C;  4JI7 Q;  1PDQ A;  1SYF A;  3TRE A;  4QJF A;  1PRT F;  2EJF C;  4PMB A;  1TS4 A;  4LFC Q;  3SK8 A;  1PH7 A;  5I9O A;  1TWA B;  4NMZ A;  5IOC A;  1O78 A;  3FPU B;  1T5X D;  3V2T A;  2E75 C;  2WB1 G;  2Z6K A;  1IYU A;  4JI2 Q;  1S40 A;  1PFM A;  1ESF A;  1YJW A;  4JI4 Q;  4WJW A;  3HOU B;  1SEB D;  4LUV A;  3U58 A;  5FJ8 G;  2DNE A;  1Q12 A;  3PIO 3;  1ZYR C;  2NZO A;  1G2T A;  4OGQ C;  2VQF Q;  3M7N A;  4C3I G;  1C9O A;  2DJF C;  4MIU A;  1NMF A;  2M2L A;  3T56 B;  1KD1 C;  4A3M G;  1F9Q A;  1AZP A;  4G7Z C;  5IWA Q;  3K58 A;  4EX5 A;  3CPW A;  2K5W A;  3Q23 A;  5LMU L;  1X55 A;  4DU9 A;  4A3C H;  4JYA L;  4R9W A;  1H9K A;  3S15 B;  3D8G A;  3T16 A;  3MVV A;  1MIU A;  1NY4 A;  4PV1 C;  1GHJ A;  4RWS C;  4L63 B;  1CHP D;  4A3D B;  1Y1V B;  2F0S A;  4UP8 A;  4KN7 C;  2O5J C;  2OEO A;  4N9T A;  3K6O A;  1HJP A;  2WAQ G;  4A76 A;  1EY0 A;  1B9M A;  2L55 A;  2PW5 A;  3VR4 A;  1KRT A;  1CT1 D;  2NBF A;  3E0E A;  1DOK A;  1VQK A;  1K83 H;  1QE6 A;  4J15 A;  3RD4 A;  1SE8 A;  3BDO A;  3T51 B;  5TSS A;  3HKZ G;  2BA1 A;  2L15 A;  2GVB A;  1WFQ A;  3GQB A;  4KK7 A;  5M5Y B;  2JA8 G;  3ONA B;  1X65 A;  4JI3 L;  4JI0 Q;  1RHP A;  1FGU A;  3GTK B;  2EQS A;  2K05 A;  4P74 A;  1ASY A;  3M3Y B;  3M4O B;  3RZO B;  1HUM A;  3S1M H;  1R9T H;  5KRU A;  4HJ9 A;  1FR3 A;  4XQN A;  2F3I A;  3A54 A;  1HZ9 A;  4A3G B;  2AQ1 B;  4IJL A;  4DR7 Q;  1SDF A;  3MEH A;  4C3H B;  1SMY D;  3CU7 A;  4H0L C;  4IPH A;  2GVA A;  2PQA A;  1B2T A;  3SHL A;  3GP7 A;  3KF8 B;  1Y1W H;  3UDF A;  1Y69 U;  1ENA A;  3T13 A;  1TT2 A;  4PQX A;  1JC7 A;  1YJN A;  5G3L D;  5CV8 A;  1WOC A;  1F9S A;  1GUT A;  1WJJ A;  3M4Y A;  1EY9 A;  4QB4 A;  1K3R A;  5AFW A;  3K5M A;  4DR3 Q;  5JAV A;  3KBG A;  4ILW A;  2WKD A;  1T9H A;  4A3E H;  1EYG A;  2UXD L;  5M3F H;  1B3Q A;  1HNW Q;  3BYT B;  2ATW A;  5KGU A;  3C3L A;  4A93 H;  2WB1 B;  3P20 A;  1TWG H;  1ZXT A;  1HFG A;  4Y7N H;  1STB A;  2A6H C;  3EQL C;  2C35 B;  1H9S B;  2B2U A;  4HJ8 A;  2WAC A;  4JBJ A;  2D0P A;  1VQD A;  4JC0 A;  1VS0 A;  2K28 A;  2HT1 A;  2PMZ B;  1BR9 A;  5J3B A;  1BVS A;  2IT1 A;  1FNV A;  2AUJ D;  3H0G G;  4C3I B;  4KJO A;  3J81 j;  4JK1 C;  1LTA D;  2K52 A;  5BN5 A;  2UXC L;  3SXH A;  4I65 A;  4A3M B;  2NN6 I;  2UU9 L;  5IYB G;  4IUR A;  3S9W A;  4DV4 L;  2FJ2 A;  3CCU A;  3BZK A;  3QB3 A;  2BA0 A;  4X65 L;  2F0W A;  3SE0 A;  3U50 C;  5JJI A;  1WD0 A;  4G7H C;  2A6H D;  3GTM H;  3GTQ B;  2CHB D;  4A3J G;  1PRT B;  2RA4 A;  4J1M A;  2YYZ A;  1WTR A;  1RTO A;  3LX0 A;  4YHH Q;  3RZD H;  2QEJ C;  3U9S A;  5DAU A;  3A8K E;  3NEN A;  3NPP A;  5C0X I;  3SGI A;  3B6Y A;  3KUP A;  4KY7 A;  5GAE C;  2NVX B;  1Y8P B;  2XGT A;  5IOD A;  1WYD A;  4EQP A;  3FMC A;  2WAQ B;  4DXF A;  4DR4 Q;  3GV3 A;  5CR3 A;  3J81 c;  2YU9 H;  3P75 A;  3TQY A;  3C1E A;  1CSQ A;  1N33 Q;  4EQO A;  1TWF B;  2IPK D;  2NVQ H;  4MTK A;  1AFP A;  1A3V A;  3A0J A;  1LTG D;  3DM3 A;  1J9O A;  2JE6 I;  3HKZ B;  5C44 H;  1TS3 A;  1IBL Q;  2O2L D;  1SAP A;  1HTP A;  4DXG A;  4K0K Q;  2NVY B;  2JA8 B;  2VUM H;  1XX8 A;  4MNO A;  4PZ8 A;  1F2L A;  3J80 E;  3R2I A;  3CC7 A;  1X54 A;  4P72 A;  4DV1 L;  3J80 L;  4KJN A;  4LF7 Q;  4MTN A;  4IJH A;  1X3E A;  4XYO A;  4ZUI A;  2QCP X;  3RUZ A;  1PVO A;  1PYS B;  1E1T A;  3H94 A;  4OXP A;  4DUZ Q;  4LFA Q;  4UPA A;  3OTO L;  4C1N I;  1VMP A;  4R4T A;  3E9I A;  1HQR D;  1X56 A;  1EIG A;  1L1O A;  1VQO A;  1H9J A;  1XPR A;  2CWA A;  4RA8 A;  1AN8 A;  1W6K A;  2RVL A;  4O0A A;  3GTG B;  3FVQ A;  3CRL C;  2WII B;  4KHV A;  3SEB A;  2ZM6 L;  5JEA H;  2RCF A;  5DNF A;  3VYS A;  1DM0 B;  1A3U A;  1R4P B;  2N3S A;  2G9H D;  2KJX A;  1HRJ A;  3BJU A;  2B2W C;  4A3K H;  1XNR L;  3KLS X;  3CKI B;  1OXV A;  1NMG A;  5EGT A;  1PHJ A;  4FVM A;  1MSG A;  1SE2 A;  4XDX A;  2HDM A;  1UUP A;  4TSS A;  1EY8 A;  2R7D A;  1CZW A;  2K50 A;  4RMF A;  1LLR D;  3JAM L;  1S5B D;  4JBW A;  1SJH D;  3OHX C;  1MJC A;  1YNN C;  1RJT A;  2NB0 A;  3AQQ A;  1VQH A;  5M5X H;  2M00 A;  1UNS A;  4S3S A;  2WP8 J;  2Z9H A;  3RN2 A;  2EY5 A;  2OQ0 A;  2QW7 A;  1EIY B;  5JJK A;  2E2I B;  1CHQ D;  5D65 A;  1I4R A;  5E3F A;  1N34 Q;  4DR1 L;  1YJ9 A;  3CCJ A;  3PO2 H;  4WOR A;  2IWH A;  1BDO A;  1E0B A;  2NN6 H;  4A3C G;  3EA6 A;  3H0G B;  4JV5 L;  2B2V A;  2N78 A;  3M7G A;  2CW0 D;  2E76 C;  3KLR A;  3SDZ A;  3T1H L;  1PV4 A;  2I0Q A;  4AH6 A;  1STA A;  4JI8 L;  4BA1 I;  4X64 Q;  1ENF A;  3BU2 A;  4XT1 B;  5J39 A;  4BY7 G;  1SNO A;  2OF1 A;  4A3J B;  5C0X H;  4K2K A;  2Z1C A;  2HIX A;  2K7V A;  3NTI A;  4UAI A;  4OWX B;  2CFM A;  5F2D A;  4YY3 Q;  3ZYY X;  1E24 A;  2IHE A;  4K5X A;  1UE7 A;  1HNX L;  5EBD A;  4B3M L;  2KHI A;  1S5E D;  5LHY 1;  5ELB A;  3U4V A;  2CH4 A;  2MUY A;  2I5M X;  1L0X B;  4B08 A;  2NVT H;  1HA6 A;  2VQE L;  1S3O A;  1XPU A;  3C1F A;  1STY A;  4GKK Q;  2FMC A;  1JB3 A;  1XTC D;  4JCV E;  1BXT A;  5GRO A;  3GTQ H;  4TKO B;  5C3X A;  4EVO A;  1Y1W G;  1NBW A;  2F0K A;  2IX1 A;  4Y52 H;  3D31 A;  4K2L A;  1VQB A;  1E22 A;  2C9O A;  3A55 A;  3K7A H;  2NVX H;  2ZTC A;  2R92 H;  3VYU A;  5T1I A;  3F2D A;  4RGN A;  3WWV A;  1VQJ A;  1J8I A;  2DGY A;  3T1Y Q;  2XN9 C;  1IW7 C;  3UI2 A;  1UEB A;  1KNE A;  1DD2 A;  2AWO A;  5C3W A;  2F1M A;  1LT3 D;  1X3Q A;  2A1A A;  3NXW A;  4A3B H;  1TY2 A;  1N36 L;  3DEP A;  5M3F G;  2YTY A;  2KBN A;  5C4X H;  4A93 G;  4A3F H;  1XMO Q;  2UUB Q;  1O7Y A;  2K1B A;  2K5V A;  4KI0 A;  1EY4 A;  3K57 A;  1PH3 A;  4OX9 Q;  4DUY Q;  3S16 H;  2DJG C;  1T5E A;  1SE4 A;  4FO2 A;  3OW2 A;  2F4V Q;  1IW7 D;  1EEF D;  2R6G A;  2IL8 A;  4YCV A;  4HID A;  4DR2 L;  1II3 A;  4QY7 A;  4DNR B;  5IGF A;  3MA2 B;  3AMU A;  2F0V A;  4Q5V A;  4JI6 Q;  3N6R A;  5EKK A;  4PMW A;  3K80 C;  2PQA B;  2LXJ A;  2FFK B;  5J22 A;  3ND9 A;  4RHS A;  4R4I A;  1YBY A;  3VR3 A;  3GTO H;  4NW2 A;  1GUN A;  5IGG A;  1ML0 D;  5IYD H;  1B53 A;  1IBK Q;  1PZK D;  2E5L L;  5LL6 S;  5AJ3 L;  4GKJ Q;  3PSI A;  5CV5 A;  2QDB A;  3CCM A;  2EDG A;  4J8Q A;  1PTO H;  5JPN C;  4EQ5 A;  1W2B A;  1P8L A;  4MHE A;  3K8A A;  5JEA J;  2XRS D;  3D6C A;  4K6D A;  1U0L A;  1VDZ A;  1A6X A;  1JE4 A;  2ICI A;  4P71 A;  4BXX H;  3GTJ H;  1U9R A;  4LF5 L;  1OXS C;  4BY7 B;  3CW2 C;  4A4I A;  2KEE A;  1GO3 E;  2RKS A;  4YWM A;  3NK9 A;  1Q81 C;  1EZ6 A;  2ZJR A;  4POF A;  5C44 G;  2O4X A;  3W5O A;  1TQO A;  1EQV A;  4IAL A;  3DMU A;  1NE3 A;  3KK7 A;  2MJ8 A;  4FYD A;  1MKH A;  2VUM G;  2AQ3 B;  1J5E L;  4RKB A;  3PUZ A;  4DA2 A;  1MI2 A;  2VW9 A;  4DK0 A;  4DAP A;  4IUT A;  3H0G H;  3Q24 A;  1R9T B;  1LTR D;  3LNN A;  3TSS A;  2Y0S G;  1U5K A;  3IKJ A;  3ERO A;  3TP8 A;  3S2H H;  4H7B A;  3DUZ A;  5FKA C;  3CC4 A;  3S24 A;  4X62 L;  1VMC A;  5J1Z A;  3AFP A;  2ASB A;  3GTP B;  4FDB A;  4XYQ A;  4RGT A;  3HEJ A;  3I4O A;  3IAY A;  2QDL A;  1Y1W B;  2UXB Q;  5BN3 A;  3FPP A;  3IFT A;  5JEA G;  2PI2 E;  4LK1 C;  3I3C A;  1S4Z A;  1GM5 A;  1EU4 A;  1HXY D;  3DWQ A;  3AB9 A;  5T1G A;  2EPB A;  5I2Y A;  3C46 A;  5C3E H;  4A3K G;  4CJ1 B;  1V8Q A;  2AUK A;  3I91 A;  2BOS A;  4R8I A;  2QEX A;  4JI2 L;  4UY8 C;  1K9M C;  5M9O A;  3K7U C;  4IUP A;  4AQY Q;  1YI2 A;  5M3F B;  1PMR A;  1NNX A;  4AYB G;  3DWP A;  4OIK A;  3H3V C;  4LFB Q;  2TSS A;  3J81 E;  2F0J A;  2MQH A;  1M1K C;  4A93 B;  2VQF L;  3S1N B;  3L9A X;  5ELC A;  4JI1 Q;  3J81 L;  1TWG B;  4X66 L;  3KDF A;  4Y7N B;  4YWK A;  3PF5 A;  3NWT A;  3A74 A;  4OWT B;  5M3M H;  2I5H A;  1STE A;  5EQ0 A;  1ASZ A;  4RHR A;  1L1O B;  4DK1 A;  1K3B C;  1YNJ C;  1LO5 D;  3PO2 G;  5IWA L;  4C56 C;  2NN6 G;  1JE5 A;  4APV A;  3MHB A;  4DR6 Q;  1KLU D;  4WJ4 A;  4LAA A;  3P7J A;  3L0O A;  4LF4 Q;  1RF2 D;  2EYO A;  1QJO A;  5BN4 A;  3VA5 A;  3I90 A;  2C5C A;  5D3I B;  4CGY B;  3MFY A;  4A3I H;  2KHS A;  4P73 A;  3GTM B;  5C0X G;  5D3D A;  2F0Q A;  2Q8R E;  1K8G A;  3G4S A;  2YTX A;  3D4D A;  3RZD B;  2WV6 D;  1KNA A;  1X9N A;  2MFI A;  1YNJ D;  3L3O C;  3PV0 A;  2G5D A;  4BA2 I;  2PO4 A;  1I94 Q;  1QCB D;  2F4I A;  1PA6 A;  2H5X A;  1EIF A;  2YU9 B;  4X3K A;  5IYC H;  2X6G A;  4R8N A;  2NVQ B;  1PH2 A;  4P75 A;  1W3S A;  1XJV A;  3FDT A;  5C44 B;  3I56 A;  2DNC A;  4KKU A;  2AHO B;  4DV5 Q;  4OWW B;  3NBH A;  4HED A;  5L37 A;  3PIP 3;  2VUM B;  2J4X A;  4GOP C;  3FEW X;  1PFB A;  4QL5 A;  1CKM A;  3NTK A;  3MEF A;  1CUK A;  1RKN A;  1GUS A;  3L7Z C;  4LF9 L;  1UWV A;  1Q8K A;  4NXN Q;  2BDN A;  2F0T A;  4L8J A;  5KNC A;  3K0X A;  3CPF A;  4HIK A;  1EL0 A;  5H1S E;  4BWG B;  5FLX c;  1AE3 A;  2Y0S B;  1TKW B;  5HY6 A;  1O7L A;  2R92 G;  1SN8 A;  2BH8 A;  3R2T A;  5LMN Q;  2R3Z A;  1XMQ Q;  3OW7 A;  3W2D A;  2LKV A;  2K03 A;  3HRZ C;  4BY7 H;  1QNK A;  3TS0 A;  2J0T D;  3TRZ A;  3CMA A;  4RG1 A;  2I46 A;  5CMD A;  2WIN B;  4DR3 L;  1A2T A;  1EWC A;  1SMY C;  3HG9 A;  3BZD B;  1PTO F;  1UE1 A;  4LW1 A;  3MXP A;  5IY0 A;  4A3B G;  1PH5 A;  4N8X 1;  4HTH A;  1BCP B;  5LL6 X;  1E1O A;  2EZV A;  5C4X G;  4P2C B;  2N8N A;  1TY0 A;  2L11 A;  2WB1 E;  4A3K B;  4WFN 3;  4A3F G;  1F9P A;  1FD7 D;  1LAC A;  5A2Q E;  1HUN A;  1JT8 A;  1GUO A;  1ZKO A;  1I3Q H;  5A2Q L;  4DAY A;  3CF5 A;  3KLW A;  3DEO A;  1P16 A;  4HN7 A;  4AYB B;  2PMZ E;  1PFS A;  1YIJ A;  3CCR A;  4ZRZ A;  1C7Y A;  1JB7 A;  4WJ3 M;  3ULL A;  4KHZ A;  1LTI D;  5M5X B;  4HJA A;  3GTP H;  2G9D A;  3A7L A;  3ULP A;  4IOA A;  4F87 A;  5EBC A;  1AZQ A;  4CKE A;  4IUQ A;  2JA7 H;  4TRD A;  1SYC A;  1D5Z C;  5M5W H;  2NZ1 D;  1OXT A;  5IIF A;  1JOO A;  5IYD G;  4RKL A;  4XXE A;  4C2M H;  1QIL A;  1WTW A;  3PO2 B;  3QIA A;  1RL2 A;  3P1H A;  1QOH A;  1VF7 A;  2VB2 X;  2Q2H A;  3HS0 C;  1JOQ A;  3PO3 H;  1YHB A;  2RF4 A;  1ET9 A;  5LMU Q;  2MP1 A;  2AMC B;  4YHH L;  4NB3 A;  4JYA Q;  4RAU C;  3T53 B;  3GV6 A;  1WVL A;  4DNT B;  3J7A 5;  1KIX A;  2SNM A;  3TS2 A;  2WAQ E;  4BXX G;  2A74 C;  2EJG C;  1VCI A;  2CCZ A;  1H9R A;  3F8T A;  3CQZ B;  3S1N H;  1QWY A;  3EJI A;  3HKZ E;  3PMF A;  4K6L A;  3KJP A;  2XTI A;  3TEH B;  1KLG D;  4OHJ A;  5FOB B;  2JYO A;  1K73 C;  2SNS A;  2MPM A;  3CCS A;  4JI5 Q;  5KIX A;  1YNX A;  2SOB A;  4XQJ A;  1FGB D;  1F2Y A;  4JI3 Q;  2F03 A;  2EY1 A;  4ZYS A;  5C4H A;  1EUJ A;  3M4P A;  2IHF A;  2PYK A;  2NVT B;  2L0C A;  4KV6 A;  4GLV B;  1ICF B;  2VS1 A;  3CAM A;  1I4H A;  2B63 H;  1KDA A;  3BVM A;  4B3S Q;  4RCO A;  3QWN A;  1GHK A;  2LMC B;  5CYU A;  1XTD A;  4JOI A;  1JWS D;  1VQE A;  2MNA A;  3I73 A;  3PGZ A;  2FXQ A;  4OEM B;  1U4R A;  4RCN A;  3RR5 A;  1Z47 A;  3IL8 A;  2HCI A;  2MGS A;  4YCU A;  3K7A B;  1X3G A;  1A15 A;  2R92 B;  1STG A;  4ULL A;  3NUC A;  1VF5 C;  3S2D H;  4H02 A;  4PMC A;  4IO9 A;  1OTC A;  1SYB A;  5C3E G;  2YTV A;  2EYL A;  1BCP D;  4YIJ A;  2QF7 A;  1CQF A;  2HCC A;  3NEL A;  3WOF A;  4R4Q A;  1KAW A;  3QOL A;  4A3B B;  2H4O A;  2NTT A;  3HGB A;  4K8J A;  3MXN A;  3U9O A;  5C4X B;  3OIQ A;  1BBX C;  1QZH A;  3CCQ A;  2RQX A;  4FXK C;  1LTL A;  3L2P A;  3HP3 A;  3H91 A;  2UXD Q;  1A63 A;  1DCZ A;  4A3F B;  4GOP A;  4GNX B;  1IBM Q;  5ELN A;  1O80 A;  1JCK B;  1K8A C;  3NSW A;  5M3M G;  3NE5 B;  1TS2 A;  3S16 B;  1Q90 A;  3OMG A;  1ILP A;  4R4O A;  2Z0S A;  2KVM A;  3MXU A;  4NXM L;  4KY5 A;  3PIO A;  5C5M A;  4X3T A;  3GTO B;  1CQV A;  4DGZ A;  1ENC A;  4FF4 A;  2MO0 A;  4LMQ D;  2UXC Q;  2PZT A;  1UE5 A;  3PIP A;  1G6P A;  3K59 A;  4A3I G;  5KYI A;  2K04 A;  1PTO B;  3SK6 A;  4X65 Q;  1FL0 A;  2R61 A;  2XNA C;  1VQG A;  1PH8 A;  5BR8 Q;  4CHT B;  2JEB I;  1WTP A;  2R93 H;  1Q3L A;  3NBI A;  5JVG 3;  1MBY A;  1KXL A;  3QR8 A;  2X6L A;  1L0W A;  2KEC A;  3GTJ B;  2CW0 C;  4DV3 Q;  5IYC G;  4IFD H;  1A0I A;  4ID6 A;  3GTL H;  3KDF B;  1NR4 A;  2EIF A;  2L5T A;  2EYJ A;  1D5X C;  3NTH A;  4UHV A;  1N8R C;  1Q1B A;  1CTM A;  4BY1 H;  2WFW A;  5HUR A;  1FNU A;  1CKN A;  1I50 H;  2IJ0 A;  4JVZ A;  3PUV A;  1KTK A;  4K14 A;  3W3A A;  2HHH Q;  3GO5 A;  1F2Z A;  2UUC L;  1V1P A;  2NYZ D;  4BBS H;  3HOW H;  1Y14 B;  2EJM A;  3S14 H;  2VY3 A;  2P5Z X;  3K5N A;  4QMG A;  1EQT A;  2EXD A;  3BS1 A;  3W1B A;  3BVZ A;  4A3L H;  4LUO A;  1LT5 D;  1BQQ T;  3BYY B;  3S2H B;  1PRT D;  4H44 C;  3D6W A;  3STB C;  3CRK C;  1QZG A;  2F0H A;  3E0J A;  2KUM A;  1SLJ A;  3OTO Q;  1STH A;  3JAM i;  2B3G A;  3CQZ H;  3KFU A;  1EY5 A;  2K5Q A;  1KDC A;  2Z4H A;  5GAD C;  3I4N H;  3FHW A;  3D0F A;  1SRO A;  1TWC H;  5E4W C;  1CA5 A;  5I6Y A;  3RMH A;  1VQN A;  4B3R L;  5C3E B;  5EPL A;  2F0I A;  2KOL A;  4Q0F A;  1GOZ A;  2DY8 A;  3RNU A;  5FLM H;  3NBH B;  2UUB L;  3STB D;  4PG3 A;  1VQ6 A;  2LY7 A;  1FJG Q;  4K5V A;  1TR5 A;  4OX9 L;  4GLX A;  3AU7 A;  1SNP A;  2XIW A;  3VR2 A;  2PCF B;  5CGK A;  1DON A;  2L1B A;  1SSO A;  2PW7 A;  1VQ8 A;  3K5L A;  4HSP A;  1D5M C;  4JI6 L;  4E6I A;  1QVG A;  5COY A;  1X3P A;  2JA7 G;  1QB5 D;  3T4A C;  1SNC A;  5M3M B;  2QA4 A;  1QUQ A;  4MZ9 A;  1IYJ B;  1B44 D;  2H1E A;  2B8G A;  2XRQ D;  2XSC A;  1ONL A;  1PYB A;  3E9H A;  5LMN W;  1KC8 C;  2NWG A;  1TVX A;  1EYC A;  2F0U A;  1WTV A;  4L5T A;  4LF6 L;  4ZKB B;  4DR1 Q;  2L4N A;  3PO3 G;  2ID0 A;  2RCN A;  4GN3 B;  2K01 A;  5IGB A;  2PZW A;  1K28 A;  1S5F D;  3BZC A;  3PUX A;  4JV5 Q;  4JPB W;  5FLX E;  2EY2 A;  1DGS A;  4X3S A;  2ENB A;  3T1H Q;  1PH6 A;  4NDX A;  4JI8 Q;  4A3I B;  3KF8 A;  3K0Y A;  3SR1 A;  3GD7 A;  2CH4 W;  5A35 A;  3IRB A;  5I2X A;  4ZLT F;  5G3L F;  2B29 A;  3HOY H;  3GDE A;  3HOZ H;  4DR5 Q;  4LJZ C;  3I55 A;  5C5L A;  4HJ7 A;  4KD3 A;  1HNZ L;  5E1F A;  1ZEQ X;  2VXW A;  2PZU A;  1QNU A;  1YZ6 A;  2D2C C;  5KYL A;  3W1G A;  1LYL A;  2FIN B;  5ELF A;  1NJI C;  1HCZ A;  4DV7 Q;  1CK1 A;  3VR5 A;  1X6O A;  4LUZ A;  3RLF A;  4B3T Q;  4N8F A;  1HH2 P;  3TP6 A;  2B63 G;  2Q2T A;  4TQU S;  4Z9C B;  4KHP L;  2KHJ A;  1I4Q A;  1H9S A;  3I7F A;  2ZTE A;  1DZ1 A;  1I6V C;  1WTX A;  2UXB L;  1FVI A;  3G7L A;  4LF8 Q;  3A7A B;  3J7Y W;  1XPO A;  2B2W A;  5JVH 3;  5I4D A;  3SVM A;  1SFO H;  3S17 H;  2IX3 A;  3CCE A;  4G57 A;  1VQC A;  2ICE C;  2Q2U A;  2BE5 C;  1VQ4 A;  1GVP A;  1E3P A;  1N32 Q;  3TP7 A;  3NWS A;  4IZ8 A;  4AQY L;  3I4M H;  3H09 A;  2HQE A;  1IZ6 A;  2DUD A;  3OWE B;  4RFB A;  1RTN A;  3D4R A;  3S1Q H;  2AQ2 B;  4JI1 L;  4ZUJ A;  4B9X A;  1LTT D;  3HOX H;  1CM9 A;  4R4C A;  1N9W A;  1I3Q B;  1Z6H A;  2JQO A;  1JWU D;  3Q0A A;  4IPD A;  1XNQ Q;  4DV0 L;  2BE5 D;  4CDC C;  2HUG A;  1KQS A;  2JSO A;  3TZD A;  2NZH A;  2F0N A;  3QO2 A;  2ALY B;  2JA6 H;  1VQ7 A;  2Q2I A;  1WCM H;  1XWE A;  3MZ5 A;  1BF4 A;  2JA7 B;  3PCO B;  1X32 A;  2KEN A;  4GN4 B;  5M5W B;  3EBE A;  3H6M A;  5CBA E;  2YV5 A;  4DV2 L;  4JI7 L;  3O13 A;  1RIP A;  4C2M B;  4FP5 D;  2B39 A;  1EZ8 A;  2AWN A;  3H3V I;  2CKZ B;  4LFC L;  1K8O A;  3OMC A;  3CXC A;  2A6E D;  5C0X J;  2E5L Q;  2JK8 A;  1V1O A;  2QIL A;  3M85 A;  4UP7 A;  3PO3 B;  2E2J B;  2A19 A;  4FF3 A;  1TWH B;  4HCS A;  2R93 G;  3DWA A;  1HFN A;  4JI4 L;  2RDF A;  5EKL A;  5JPM C;  3MXN B;  1JJ2 A;  2A8V A;  1EWI A;  1I94 L;  5D14 A;  4IPG A;  2QKI C;  3E6Z X;  1E7Z A;  4IFD G;  1CKO A;  2LS0 1;  1U4P A;  1A3T A;  1F9R A;  4ME5 A;  3UDG A;  4TVA B;  4BY1 G;  3PF4 A;  1G2S A;  1L0Y B;  2KA7 A;  1EOT A;  3A5Z B;  1B3A A;  3VYR A;  4NP5 A;  4M1U B;  3K81 C;  1PFN A;  1LV9 A;  1F2M A;  4BBS G;  3HOW G;  2F0G A;  5EPK A;  1J5E Q;  1U4L A;  2KED A;  1KAA A;  3Q8D A;  4A3L G;  3AEV A;  2Y0S E;  2F0O A;  3ND8 A;  4F8M A;  1G8Z D;  2B63 B;  1PZI D;  1EOV A;  3BDL A;  2AKW B;  1L2F A;  5K36 H;  5LMN L;  1S72 A;  1XMQ L;  3ERS X;  4IOC A;  1SYD A;  3I2Z A;  4O42 A;  1B70 B;  4JBK A;  1Y8N B;  5ELD A;  4ZQ3 A;  3J81 i;  3K5O A;  1YHA A;  3DXJ C;  3I4N G;  1ET6 A;  3R3O A;  2EE1 A;  5FO9 B;  2ZXR A;  1VQP A;  2K4K A;  5NUC A;  2NUC A;  2OTJ A;  3URY A;  4JI0 L;  3S2D B;  1D6E C;  1W6J A;  4O2D A;  4QIW B;  1D8L A;  1U4M A;  1K0S A;  5FLM G;  1OO9 B;  1OXX K;  2UUA Q;  1B7Y B;  3NQI A;  2EOT A;  1CKN B;  2E2D C;  2V1C C;  4DAV A;  2A5H A;  1B1Z A;  4OEL B;  4AYB E;  4DV6 Q;  1JQY D;  4I7A A;  4DR7 L;  1MGS A;  1V1P B;  2ZT9 C;  4MN3 A;  4KKS A;  2EY6 A;  3JC6 6;  3KOJ A;  2IY5 B;  2OCE A;  5IGC A;  1PH4 A;  3FRP B;  2D5D A;  4RH6 A;  4X66 Q;  3NQT A;  2Q8I B;  3HFZ B;  1C48 A;  3CCL A;  5IT9 c;  1VQL A;  4NPS A;  2Q8T A;  3UE1 A;  3A5U A;  5EKI A;  3ZJY C;  2R7Z H;  1DXM A;  2HIV A;  1EYA A;  3H3V H;  1HR0 Q;  2JA5 H;  4HR7 B;  1ILQ A;  3FKI H;  2HQL A;  1WTH A;  3VA7 A;  1UEA B;  4XTC S;  3CME A;  1L1O C;  3LWU A;  1IXR A;  1JOR A;  1ZYR D;  4CKB A;  1JOK A;  1V43 A;  4QQB X;  1EFI D;  1NR2 A;  1HNW L;  4KKT A;  5IP9 H;  2N55 A;  4DNI A;  2OQK A;  1F77 A;  3HOY G;  4U68 A;  3X3M A;  3HOZ G;  1BUV T;  2R93 B;  3OYY A;  2ZJP A;  3A8I E;  2VNU D;  4JI5 L;  2HDL A;  4QCL A;  2F3W A;  3RLO A;  4DFA A;  3WDN A;  3GTL B;  1EQQ A;  2RBM A;  4CDE C;  1DOL A;  3TBI B;  4KMU C;  1ROD A;  1QUQ B;  3MFG A;  3HOV H;  4BY1 B;  2MHV A;  1D1I A;  4ALP A;  1HPC A;  2E74 C;  1I50 B;  1UE6 A;  4B3S L;  3E5S A;  3S1R H;  3OSO A;  1JMC A;  1D2B A;  2Z4I A;  1DJR D;  3OIP A;  3J7A V;  4B9W A;  4HMI A;  4BBS B;  3HOW B;  4FXD A;  1TU2 B;  3D4W A;  3EVQ A;  3S14 B;  3X3N A;  4ME3 A;  5ELO A;  2E2H H;  1E2W A;  2E2J H;  3QOJ A;  2LFN A;  4LF9 Q;  4FF2 A;  1TWH H;  1HA5 A;  1V9P A;  1JIC A;  3VDY A;  3I72 A;  4C3J H;  3H15 A;  5IP7 H;  3OPO A;  4CJ2 C;  3IFD A;  1MJE A;  2GA4 B;  1VQF A;  4DR4 L;  1TXY A;  3NHH A;  5CV9 A;  1LT4 D;  1SNQ A;  2B2V C;  2X69 A;  3NEM A;  3I4L A;  1N33 L;  1KL9 A;  1I5F A;  4GLA C;  4N9P A;  2I07 B;  2VL6 A;  1IHZ A;  4IPC A;  1Q86 C;  3G6E A;  3I4N B;  1IBL L;  4OO1 I;  4IFD I;  3I4M G;  4K0K L;  1TWC B;  1MD2 D;  4EGV A;  4K5W A;  2R7F A;  3BG3 A;  3CHB D;  2ZXO A;  4JW0 A;  1GKH A;  1NUC A;  4V0B A;  2SDF A;  4ZKC B;  2XWB B;  2NTS A;  4KN4 C;  3HOX G;  4LF7 L;  1B8A A;  2K33 A;  5HGT A;  4ABN A;  1IBM L;  4J6H A;  2F0D A;  4BBR H;  4OON A;  5CV4 A;  4DUZ L;  4LFA L;  4ZCK A;  1BCP C;  4KLK A;  3D3R A;  5CV6 A;  1I4X A;  3LWE A;  3KF6 A;  3MAQ A;  2EVB A;  2K75 A;  3PUY A;  1VQ5 A;  1JJG A;  2JA6 G;  1A62 A;  1E2V A;  1HQM C;  1WCM G;  2I5L X;  2LSS A;  3MXG A;  1I6H H;  3Q6S A;  1EWH A;  1JR0 D;  3HZX A;  3F1Z A;  2RSO A;  2JN4 A;  2F52 A;  1IL8 A;  3A56 A;  4H13 C;  2J7Z A;  4G4K A;  1RD9 D;  3ERQ A;  5CV7 A;  4HIO A;  3AFQ A;  4L6T B;  1SYE A;  2D0O A;  2DY7 A;  1YVC A;  2CVR A;  4LNQ A;  2B2T C;  5IGE A;  5BR8 L;  5EAY A;  5HGQ A;  5KEE A;  1TWA H;  2B2Y C;  1ESR A;  5E4X A;  1BKB A;  2RDG A;  2ZJQ A;  2XVS A;  4KD4 A;  5C4J B;  5C4Z A;  1QG7 A;  4DV3 L;  1XYI A;  1Q8I A;  4OIJ A;  3HOU H;  1SNM A;  4YWL A;  2F0M A;  3HOY B;  1Z7T A;  3HOZ B;  2L9H A;  1K8M A;  2BH2 A;  2K5N A;  2O5I C;  2K5D A;  5GQO A;  1C0A A;  3MWY W;  1Q46 A;  2JJQ A;  4ZK9 B;  1B4O A;  1PLF A;  2HHH L;  3ER0 A;  1N34 L;  1NSN S;  1QVF A;  3PQI A;  1LM0 A;  2WKC A;  4U67 3;  4PNY A;  2IX0 A;  1D7Q A;  1VQ9 A;  2L12 A;  4M8A A;  1HTL D;  4DKA C;  4A75 A;  1RCV D;  1CFM A;  2A73 B;  3SK5 A;  2K5H A;  3RN5 A;  1YEZ A;  2BCO A;  1VQI A;  2JP1 A;  4X64 L;  3S15 H;  1YHQ A;  2RDH A;  5K36 G;  1NTG A; 
#chains in the Genus database with same CATH homology
 2EYM A;  2F0P A;  4F7X A;  1SE3 A;  1MSH A;  5JOB A;  2F0L A;  2KCC A;  1LTB D;  1C4Q A;  2DN8 A;  3TME A;  1SFO B;  3S17 B;  1RDP D;  1XXG A;  4OO1 H;  1PRT C;  1M8A A;  4HSV A;  5KND A;  1KAB A;  4XIG S;  2A68 C;  2EYP A;  1IKL A;  3I4M B;  1SXT A;  2V4D A;  3PUW A;  2JEA I;  1I4G A;  3S1Q B;  3JAM E;  1SND A;  5FO8 B;  4GZY C;  3HOX B;  1GUG A;  1ICW A;  5DEH A;  1NAP A;  4CKC A;  1DYQ A;  5DM6 3;  2XWJ B;  1SBB B;  3NP8 A;  3ITP A;  3QJY A;  4C1N K;  3N52 A;  5CBE E;  2JA6 B;  1WCM B;  2A68 D;  3G6J B;  1A2U A;  5K5P A;  1AW7 A;  1EEI D;  4X3U A;  2RSN A;  1B9N A;  4CBV A;  1YNN D;  1O7Z A;  1EIH A;  1DOM A;  4CJ0 B;  3TN2 A;  3QG1 A;  3C2P A;  2A69 C;  1I4P A;  1B50 A;  1CZG A;  2TMP A;  2K32 A;  4RGM A;  4IQZ A;  1PTO C;  1R4Q B;  4IUU A;  4KTA A;  1LT6 D;  4V19 0;  1OXU A;  1UAP A;  2Z8L A;  3V96 A;  4QUF A;  5CC4 A;  4I7Z C;  1EY6 A;  1TS5 A;  3A8J E;  1IYV A;  1EU3 A;  2F3V A;  1AEX A;  1CI3 M;  3OOC A;  2A69 D;  5I9P A;  2PNR C;  1STN A;  4C3J G;  1PTO D;  1TII D;  1WD1 A;  4G7O C;  3I70 A;  2M9V A;  5ISR A;  2B2T A;  3I8Z A;  3R93 A;  5IT9 E;  5FLX L;  2B2Y A;  3BVG A;  5IT9 L;  1BO0 A;  2JXM B;  4DN4 M;  2KQ3 A;  1AP0 A;  4UDU C;  1S5C D;  5IGD A;  2F0F A;  2KCN A;  2ZXP A;  1BOS A;  2B8F A;  4ZAI A;  2CQA A;  3EFX D;  3KBX A;  1PXU A;  5FK9 C;  4HCE A;  3MC0 B;  1FNW A;  2IW3 A;  1LAB A;  1WTO A;  1GUW A;  3TDQ A;  1SYG A;  1GJX A;  4FNF A;  1G29 1;  1IKM A;  2SEB D;  1HHV A;  2EYH A;  1EYD A;  1SJE D;  4ODG A;  4QF4 A;  3TP5 A;  2PQE A;  2OXP A;  2R7Z B;  2D9U A;  2N88 A;  2JA5 B;  3FKI B;  3VYT A;  1PZJ D;  3J7A F;  1G91 A;  3TZU A;  3R8B A;  5I6W A;  3WOE A;  4IFD J;  1CA6 A;  4RGO S;  4HAE A;  1K83 B;  2A6E C;  4HMJ A;  3MTS A;  1BCP F;  4IUV A;  5COR A;  4XQQ A;  2FHT A;  1FYC A;  2PPB C;  4KY6 A;  1C8C A;  3SK4 A;  2EXZ A;  2D62 A;  1KDB A;  1NCV A;  3HOV B;  3KLS A;  5JJZ A;  4FF1 A;  3S1M B;  4QUC A;  5DM7 3;  5FO7 B;  3S1R B;  2OT2 A;  4FXG C;  1JWM D;  3OWF A;  2E2H B;  1BNZ A;  3VR6 A;  1E2Z A;  4C3J B;  4O1N A;  4DF7 A;  5ELE A;  3Q22 A;  2EYF A;  2BDO A;  1H9M A;  4NKL A;  1Q1E A;  3F2U A;  4OO1 G;  4IN3 A;  2F0E A;  2VB3 X;  4EQN A;  1GXD C;  5C6A A;  4A3E B;  4BS9 A;  4IUN A;  4WRD A;  1LTS D;  1M4V A;  5KNB A;  1D1K A;  4C3H G;  4BBR B;  4F88 A;  1G6Z A;  2B2U C;  3DM1 A;  4K8I A;  3DHQ A;  5EPJ A;  1EY7 A;  2K6A A;  1WTQ A;  1S5D D;  2FMM A;  3BDC A;  1I6H B;  1PYW D;  4OL7 A;  4XT3 B;  1Y8O B;  3V05 A;  5EJW A;  1PDQ A;  1SYF A;  1PRT F;  2EJF C;  4PMB A;  1TS4 A;  3SK8 A;  5I9O A;  1TWA B;  4NMZ A;  5IOC A;  1O78 A;  3FPU B;  1T5X D;  3V2T A;  2E75 C;  1IYU A;  1PFM A;  1ESF A;  4WJW A;  3HOU B;  1SEB D;  2DNE A;  1Q12 A;  3PIO 3;  1ZYR C;  1G2T A;  4OGQ C;  3M7N A;  4C3I G;  4MIU A;  2M2L A;  3T56 B;  1F9Q A;  1AZP A;  4G7Z C;  3K58 A;  2K5W A;  3Q23 A;  4DU9 A;  4R9W A;  1H9K A;  3S15 B;  3D8G A;  3T16 A;  3MVV A;  4PV1 C;  1GHJ A;  4RWS C;  4L63 B;  1CHP D;  4A3D B;  1Y1V B;  2F0S A;  4KN7 C;  2O5J C;  2OEO A;  4N9T A;  3K6O A;  1EY0 A;  1B9M A;  2L55 A;  2PW5 A;  3VR4 A;  1CT1 D;  2NBF A;  1DOK A;  1QE6 A;  3RD4 A;  3BDO A;  3T51 B;  5TSS A;  2BA1 A;  3GQB A;  4KK7 A;  5M5Y B;  3ONA B;  1RHP A;  3GTK B;  2K05 A;  3M3Y B;  3M4O B;  3RZO B;  1HUM A;  5KRU A;  1FR3 A;  4XQN A;  3A54 A;  4A3G B;  2AQ1 B;  1SDF A;  3MEH A;  4C3H B;  1SMY D;  3CU7 A;  4H0L C;  1B2T A;  3SHL A;  3GP7 A;  1Y69 U;  1ENA A;  3T13 A;  1TT2 A;  4PQX A;  1JC7 A;  5G3L D;  5CV8 A;  1F9S A;  1GUT A;  3M4Y A;  1EY9 A;  4QB4 A;  5AFW A;  3K5M A;  5JAV A;  3KBG A;  4ILW A;  2WKD A;  3BYT B;  5KGU A;  3C3L A;  2WB1 B;  3P20 A;  1ZXT A;  1HFG A;  1STB A;  2A6H C;  3EQL C;  1H9S B;  2B2U A;  2WAC A;  2K28 A;  2PMZ B;  1BR9 A;  2IT1 A;  1FNV A;  2AUJ D;  4C3I B;  4KJO A;  4JK1 C;  1LTA D;  5BN5 A;  3SXH A;  4I65 A;  4A3M B;  2NN6 I;  4IUR A;  3S9W A;  2FJ2 A;  3QB3 A;  2BA0 A;  2F0W A;  3SE0 A;  1WD0 A;  4G7H C;  2A6H D;  3GTQ B;  2CHB D;  1PRT B;  2RA4 A;  4J1M A;  2YYZ A;  1WTR A;  1RTO A;  3LX0 A;  2QEJ C;  3U9S A;  5DAU A;  3A8K E;  3NPP A;  5C0X I;  3KUP A;  4KY7 A;  2NVX B;  1Y8P B;  5IOD A;  4EQP A;  3FMC A;  2WAQ B;  4DXF A;  3GV3 A;  5CR3 A;  3P75 A;  3C1E A;  4EQO A;  1TWF B;  2IPK D;  1AFP A;  1A3V A;  1LTG D;  1J9O A;  2JE6 I;  3HKZ B;  1TS3 A;  2O2L D;  1SAP A;  1HTP A;  4DXG A;  2NVY B;  2JA8 B;  1XX8 A;  1F2L A;  3J80 E;  3R2I A;  3J80 L;  4KJN A;  4XYO A;  4ZUI A;  2QCP X;  3RUZ A;  3H94 A;  4C1N I;  1VMP A;  1HQR D;  1EIG A;  1H9J A;  4RA8 A;  1AN8 A;  1W6K A;  2RVL A;  3GTG B;  3FVQ A;  3CRL C;  2WII B;  4KHV A;  3SEB A;  5JEA H;  5DNF A;  3VYS A;  1DM0 B;  1A3U A;  1R4P B;  2G9H D;  2KJX A;  1HRJ A;  2B2W C;  3KLS X;  3CKI B;  1OXV A;  5EGT A;  4FVM A;  1MSG A;  1SE2 A;  4XDX A;  2HDM A;  1UUP A;  4TSS A;  1EY8 A;  1CZW A;  1LLR D;  3JAM L;  1S5B D;  4JBW A;  1SJH D;  3OHX C;  1YNN C;  1RJT A;  2NB0 A;  2M00 A;  1UNS A;  4S3S A;  2WP8 J;  2EY5 A;  2E2I B;  1CHQ D;  5D65 A;  1I4R A;  5E3F A;  4WOR A;  2IWH A;  1BDO A;  1E0B A;  2NN6 H;  3EA6 A;  3H0G B;  2B2V A;  3M7G A;  2CW0 D;  2E76 C;  3KLR A;  3SDZ A;  1STA A;  4BA1 I;  1ENF A;  4XT1 B;  5J39 A;  1SNO A;  2OF1 A;  4A3J B;  5C0X H;  4K2K A;  2Z1C A;  2K7V A;  3NTI A;  4UAI A;  5F2D A;  3ZYY X;  4K5X A;  5EBD A;  1S5E D;  5LHY 1;  5ELB A;  2MUY A;  1L0X B;  4B08 A;  1HA6 A;  3C1F A;  1STY A;  2FMC A;  1JB3 A;  1XTC D;  1BXT A;  4TKO B;  5C3X A;  4EVO A;  2F0K A;  2IX1 A;  3D31 A;  4K2L A;  2C9O A;  3A55 A;  3VYU A;  5T1I A;  4RGN A;  1J8I A;  2XN9 C;  1IW7 C;  3UI2 A;  1KNE A;  1DD2 A;  2AWO A;  5C3W A;  2F1M A;  1LT3 D;  1X3Q A;  3NXW A;  1TY2 A;  3DEP A;  1O7Y A;  2K1B A;  4KI0 A;  3K57 A;  1EY4 A;  1T5E A;  1SE4 A;  4FO2 A;  1IW7 D;  1EEF D;  2R6G A;  2IL8 A;  3AMU A;  5IGF A;  1II3 A;  4DNR B;  3MA2 B;  2F0V A;  4Q5V A;  3N6R A;  5EKK A;  4PMW A;  5J22 A;  2FFK B;  3ND9 A;  4RHS A;  3VR3 A;  4NW2 A;  1GUN A;  5IGG A;  1ML0 D;  1B53 A;  1PZK D;  5LL6 S;  5CV5 A;  2QDB A;  2EDG A;  4J8Q A;  1PTO H;  5JPN C;  4MHE A;  5JEA J;  2XRS D;  3D6C A;  4K6D A;  1VDZ A;  1A6X A;  1JE4 A;  2ICI A;  1U9R A;  1OXS C;  4BY7 B;  2KEE A;  2RKS A;  3NK9 A;  1EZ6 A;  2O4X A;  1TQO A;  1EQV A;  4IAL A;  3DMU A;  3KK7 A;  2MJ8 A;  4FYD A;  2AQ3 B;  4RKB A;  3PUZ A;  4DA2 A;  1MI2 A;  4DK0 A;  4DAP A;  4IUT A;  3Q24 A;  1R9T B;  1LTR D;  3LNN A;  3TSS A;  3TP8 A;  3IKJ A;  3ERO A;  4H7B A;  3DUZ A;  5FKA C;  1VMC A;  5J1Z A;  3GTP B;  4XYQ A;  4RGT A;  3HEJ A;  3IAY A;  1Y1W B;  5BN3 A;  3FPP A;  3IFT A;  5JEA G;  4LK1 C;  3I3C A;  1S4Z A;  1EU4 A;  1HXY D;  3DWQ A;  3AB9 A;  5T1G A;  2EPB A;  5I2Y A;  3C46 A;  4CJ1 B;  1V8Q A;  2AUK A;  3I91 A;  2BOS A;  4R8I A;  5M9O A;  4IUP A;  5M3F B;  1PMR A;  3DWP A;  4OIK A;  3H3V C;  2TSS A;  3J81 E;  2F0J A;  4A93 B;  3S1N B;  3L9A X;  5ELC A;  3J81 L;  1TWG B;  4Y7N B;  3NWT A;  1STE A;  5EQ0 A;  4RHR A;  4DK1 A;  1YNJ C;  1LO5 D;  4C56 C;  2NN6 G;  3MHB A;  1KLU D;  4LAA A;  3P7J A;  1RF2 D;  2EYO A;  1QJO A;  5BN4 A;  3VA5 A;  3I90 A;  2C5C A;  5D3I B;  4CGY B;  3MFY A;  2KHS A;  3GTM B;  5C0X G;  5D3D A;  2F0Q A;  2Q8R E;  3D4D A;  3RZD B;  2WV6 D;  1KNA A;  1YNJ D;  3L3O C;  3PV0 A;  4BA2 I;  2PO4 A;  1QCB D;  2F4I A;  2YU9 B;  4X3K A;  2X6G A;  4R8N A;  2NVQ B;  3FDT A;  5C44 B;  2DNC A;  4KKU A;  3NBH A;  4HED A;  3PIP 3;  2VUM B;  2J4X A;  3FEW X;  1PFB A;  3NTK A;  1RKN A;  1GUS A;  3L7Z C;  2BDN A;  2F0T A;  4L8J A;  5KNC A;  1EL0 A;  4BWG B;  2Y0S B;  1TKW B;  1O7L A;  3R2T A;  2R3Z A;  3OW7 A;  3W2D A;  2LKV A;  2K03 A;  3HRZ C;  1QNK A;  2J0T D;  2I46 A;  5CMD A;  2WIN B;  1A2T A;  1EWC A;  1SMY C;  3HG9 A;  3BZD B;  1PTO F;  3MXP A;  4HTH A;  1BCP B;  5LL6 X;  2EZV A;  4P2C B;  1TY0 A;  2L11 A;  4A3K B;  4WFN 3;  1F9P A;  1FD7 D;  1LAC A;  5A2Q E;  1HUN A;  1GUO A;  1ZKO A;  5A2Q L;  4DAY A;  3DEO A;  4HN7 A;  4AYB B;  4ZRZ A;  4KHZ A;  1LTI D;  5M5X B;  2G9D A;  3A7L A;  4F87 A;  5EBC A;  1AZQ A;  4CKE A;  4IUQ A;  4TRD A;  1SYC A;  1D5Z C;  2NZ1 D;  1OXT A;  5IIF A;  1JOO A;  4RKL A;  4XXE A;  1QIL A;  1WTW A;  3PO2 B;  3QIA A;  3P1H A;  1QOH A;  1VF7 A;  2VB2 X;  3HS0 C;  1JOQ A;  1ET9 A;  2MP1 A;  4RAU C;  3T53 B;  3GV6 A;  1WVL A;  4DNT B;  2SNM A;  2A74 C;  2EJG C;  1VCI A;  1H9R A;  3CQZ B;  1QWY A;  3EJI A;  3PMF A;  4K6L A;  1KLG D;  4OHJ A;  5FOB B;  2JYO A;  2SNS A;  2MPM A;  5KIX A;  2SOB A;  4XQJ A;  1FGB D;  1F2Y A;  2F03 A;  2EY1 A;  4ZYS A;  5C4H A;  2PYK A;  2NVT B;  2L0C A;  4KV6 A;  1I4H A;  1GHK A;  1KDA A;  3BVM A;  4RCO A;  3QWN A;  2LMC B;  5CYU A;  1JWS D;  3I73 A;  1U4R A;  4RCN A;  1Z47 A;  3IL8 A;  2HCI A;  2MGS A;  3K7A B;  1A15 A;  2R92 B;  1STG A;  4ULL A;  3NUC A;  1VF5 C;  4PMC A;  1SYB A;  2EYL A;  1BCP D;  4YIJ A;  2QF7 A;  1CQF A;  2HCC A;  3WOF A;  3QOL A;  4A3B B;  2H4O A;  2NTT A;  3HGB A;  4K8J A;  3MXN A;  3U9O A;  5C4X B;  3OIQ A;  1BBX C;  2RQX A;  4FXK C;  3HP3 A;  3H91 A;  1DCZ A;  4A3F B;  1O80 A;  1JCK B;  3NSW A;  3NE5 B;  1TS2 A;  3S16 B;  1Q90 A;  3OMG A;  1ILP A;  2KVM A;  3MXU A;  4KY5 A;  5C5M A;  4X3T A;  3GTO B;  1CQV A;  4DGZ A;  1ENC A;  4FF4 A;  4LMQ D;  2PZT A;  3K59 A;  5KYI A;  2K04 A;  1PTO B;  3SK6 A;  2R61 A;  2XNA C;  4CHT B;  2JEB I;  1WTP A;  1Q3L A;  3NBI A;  5JVG 3;  1MBY A;  2X6L A;  2KEC A;  3GTJ B;  2CW0 C;  4IFD H;  4ID6 A;  1NR4 A;  2L5T A;  2EYJ A;  1D5X C;  3NTH A;  1Q1B A;  1CTM A;  5HUR A;  1FNU A;  2IJ0 A;  3PUV A;  1KTK A;  4K14 A;  3W3A A;  3GO5 A;  1F2Z A;  1V1P A;  2NYZ D;  2EJM A;  3K5N A;  4QMG A;  1EQT A;  3BS1 A;  3BVZ A;  1LT5 D;  1BQQ T;  3BYY B;  3S2H B;  1PRT D;  4H44 C;  3D6W A;  3CRK C;  2F0H A;  3E0J A;  2KUM A;  1STH A;  1EY5 A;  2K5Q A;  1KDC A;  2Z4H A;  5E4W C;  1CA5 A;  5I6Y A;  3RMH A;  5C3E B;  5EPL A;  2F0I A;  2KOL A;  4Q0F A;  1GOZ A;  2DY8 A;  2LY7 A;  4K5V A;  1TR5 A;  3AU7 A;  1SNP A;  2XIW A;  3VR2 A;  5CGK A;  2PCF B;  1DON A;  2L1B A;  1SSO A;  2PW7 A;  3K5L A;  4HSP A;  1D5M C;  4E6I A;  5COY A;  1X3P A;  1QB5 D;  3T4A C;  1SNC A;  5M3M B;  1B44 D;  2H1E A;  2B8G A;  2XRQ D;  2XSC A;  1ONL A;  2NWG A;  1TVX A;  1EYC A;  2F0U A;  1WTV A;  4ZKB B;  2L4N A;  2ID0 A;  2K01 A;  5IGB A;  2PZW A;  1S5F D;  3PUX A;  5FLX E;  2EY2 A;  4X3S A;  2ENB A;  4NDX A;  4A3I B;  3KF8 A;  3K0Y A;  3SR1 A;  3GD7 A;  5A35 A;  5I2X A;  4ZLT F;  5G3L F;  4LJZ C;  5C5L A;  4KD3 A;  5E1F A;  1ZEQ X;  2VXW A;  2PZU A;  1QNU A;  2D2C C;  5KYL A;  2FIN B;  5ELF A;  1HCZ A;  1CK1 A;  3VR5 A;  3RLF A;  3TP6 A;  4TQU S;  4Z9C B;  1I4Q A;  1H9S A;  1DZ1 A;  1I6V C;  1WTX A;  3G7L A;  3A7A B;  3J7Y W;  2B2W A;  5JVH 3;  5I4D A;  3SVM A;  2IX3 A;  4G57 A;  2ICE C;  2BE5 C;  3TP7 A;  3NWS A;  4IZ8 A;  3H09 A;  2HQE A;  3OWE B;  4RFB A;  1RTN A;  3D4R A;  2AQ2 B;  4ZUJ A;  4B9X A;  1LTT D;  1CM9 A;  1I3Q B;  1Z6H A;  1JWU D;  3Q0A A;  2BE5 D;  2HUG A;  2JSO A;  3TZD A;  2F0N A;  3QO2 A;  1XWE A;  3MZ5 A;  1BF4 A;  2JA7 B;  1X32 A;  5M5W B;  3H6M A;  5CBA E;  3O13 A;  4C2M B;  4FP5 D;  2B39 A;  1EZ8 A;  2AWN A;  1K8O A;  3OMC A;  2A6E D;  5C0X J;  2QIL A;  1V1O A;  3M85 A;  3PO3 B;  2E2J B;  4FF3 A;  1TWH B;  4HCS A;  3DWA A;  1HFN A;  2RDF A;  5EKL A;  5JPM C;  5D14 A;  2QKI C;  3E6Z X;  4IFD G;  2LS0 1;  1U4P A;  1A3T A;  1F9R A;  4ME5 A;  1G2S A;  1L0Y B;  2KA7 A;  1EOT A;  1B3A A;  3VYR A;  4NP5 A;  4M1U B;  1PFN A;  1LV9 A;  1F2M A;  2F0G A;  5EPK A;  1U4L A;  2KED A;  1KAA A;  2F0O A;  3ND8 A;  4F8M A;  1G8Z D;  2B63 B;  1PZI D;  3BDL A;  5K36 H;  1SYD A;  4O42 A;  1Y8N B;  5ELD A;  4ZQ3 A;  3K5O A;  3DXJ C;  1ET6 A;  3R3O A;  2EE1 A;  5FO9 B;  2ZXR A;  5NUC A;  2NUC A;  3URY A;  3S2D B;  1D6E C;  1W6J A;  4QIW B;  1U4M A;  1OO9 B;  1OXX K;  3NQI A;  2EOT A;  2E2D C;  4DAV A;  2A5H A;  1B1Z A;  1JQY D;  1MGS A;  1V1P B;  2ZT9 C;  4MN3 A;  4KKS A;  2EY6 A;  5IGC A;  3FRP B;  2D5D A;  4RH6 A;  3NQT A;  2Q8I B;  1C48 A;  2Q8T A;  5EKI A;  1DXM A;  1EYA A;  4HR7 B;  1ILQ A;  3VA7 A;  1UEA B;  4XTC S;  3LWU A;  1JOR A;  1ZYR D;  4CKB A;  1JOK A;  1V43 A;  1EFI D;  1NR2 A;  4KKT A;  2N55 A;  1F77 A;  4U68 A;  3X3M A;  1BUV T;  2R93 B;  3A8I E;  2VNU D;  2HDL A;  4QCL A;  2F3W A;  4DFA A;  3WDN A;  3GTL B;  2RBM A;  1DOL A;  3TBI B;  4KMU C;  1ROD A;  3MFG A;  4BY1 B;  2MHV A;  1D1I A;  1HPC A;  2E74 C;  1I50 B;  3E5S A;  3OSO A;  1D2B A;  2Z4I A;  1DJR D;  3OIP A;  3J7A V;  4B9W A;  4HMI A;  4BBS B;  3HOW B;  4FXD A;  1TU2 B;  3D4W A;  3EVQ A;  3S14 B;  3X3N A;  1E2W A;  3QOJ A;  2LFN A;  4FF2 A;  1HA5 A;  1JIC A;  3I72 A;  3OPO A;  4CJ2 C;  3IFD A;  2GA4 B;  3NHH A;  5CV9 A;  1LT4 D;  1SNQ A;  2B2V C;  2X69 A;  3I4L A;  4N9P A;  2I07 B;  1IHZ A;  3I4N B;  4OO1 I;  4IFD I;  1TWC B;  1MD2 D;  4EGV A;  4K5W A;  3BG3 A;  3CHB D;  2ZXO A;  1NUC A;  4V0B A;  2SDF A;  4ZKC B;  2XWB B;  2NTS A;  4KN4 C;  2K33 A;  5HGT A;  4ABN A;  4J6H A;  2F0D A;  5CV4 A;  1BCP C;  3D3R A;  5CV6 A;  1I4X A;  3LWE A;  3MAQ A;  2EVB A;  3PUY A;  1E2V A;  1HQM C;  3MXG A;  3Q6S A;  1EWH A;  1JR0 D;  3HZX A;  2RSO A;  1IL8 A;  3A56 A;  4H13 C;  2J7Z A;  4G4K A;  1RD9 D;  3ERQ A;  5CV7 A;  4L6T B;  1SYE A;  2DY7 A;  2CVR A;  2B2T C;  5IGE A;  5KEE A;  2B2Y C;  1ESR A;  5E4X A;  2RDG A;  2XVS A;  4KD4 A;  5C4J B;  5C4Z A;  1QG7 A;  1XYI A;  1Q8I A;  4OIJ A;  1SNM A;  2F0M A;  3HOY B;  1Z7T A;  3HOZ B;  2L9H A;  1K8M A;  2O5I C;  2K5D A;  3MWY W;  4ZK9 B;  1B4O A;  1PLF A;  1NSN S;  2WKC A;  4U67 3;  4PNY A;  2IX0 A;  2L12 A;  4M8A A;  1HTL D;  1RCV D;  1CFM A;  2A73 B;  3SK5 A;  2BCO A;  2JP1 A;  2RDH A;  5K36 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...