1BDOA

Structure of the biotinyl domain of acetyl-coenzyme a carboxylase determined by mad phasing
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
80
structure length
80
Chain Sequence
EISGHIVRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEAMKMMNQIEADKSGTVKAILVESGQPVEFDEPLVVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ACETYL-COA CARBOXYLASE
publication title Structure of the biotinyl domain of acetyl-coenzyme A carboxylase determined by MAD phasing.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 14
structure length 80
sequence length 80
ec nomenclature ec 6.4.1.2: Acetyl-CoA carboxylase.
pdb deposition date 1995-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1bdoA00
4KKUA 2JE6I 4JK1C 3RLFA 1O7LA 3VR4A 2D5DA 3AB9A 2BE5C 2AUJD 2A69C 2A6ED 2K7VA 3M4YA 2JEAI 4H13C 3P20A 2E76C 5K36G 3I73A 4BA1I 1H9KA 1E2ZA 1ZYRC 2LMCB 1A6XA 3FMCA 2DNCA 2D2CC 3A7LA 4IFDG 3A8KE 1Y8OB 1OXTA 2QF7A 5K36H 3M85A 1DD2A 1Q90A 5A35A 4GZYC 1Q12A 1SMYC 2DNEA 4I7ZC 2A6HC 3H94A 2B8FA 3PUWA 2AUKA 1CTMA 1G291 2AWOA 3HGBA 4IQZA 1V43A 3A8JE 3PUXA 2EJGC 1H9SB 3KLRA 3L7ZC 1K8MA 1YNJC 1BDOA 1DXMA 2BA0A 3SDZA 5JEAH 4G7ZC 4LJZC 2F1MA 1LABA 2A68C 4DNRB 1OXSC 5BN4A 1HTPA 3BDOA 1K8OA 4RCNA 4XTCS 4KKSA 3GD7A 1VF7A 2L5TA 1GHKA 1GUSA 3ND9A 4PV1C 4DNTB 1LACA 2O5IC 3CRLC 2ZT9C 3SE0A 2CW0C 3TZUA 4G7HC 1GUGA 3IFTA 4BA2I 3MFYA 1OXVA 4KI0A 1GJXA 2K32A 3BG3A 2JEBI 1HCZA 3PUVA 1OXXK 3MXUA 4KN4C 2KCCA 5JEAG 1GUOA 1QJOA 4DK0A 3QJYA 1Z6HA 1H9JA 1CFMA 4G7OC 2A6HD 1Y8PB 2R6GA 3CRKC 3QIAA 1IW7C 1B9NA 4OGQC 2PCFB 5BN5A 1VCIA 2NN6I 1DCZA 3FPPA 3A7AB 4DK1A 2BA1A 1V8QA 3QG1A 2EDGA 4XIGS 3VR5A 5C0XG 2EJMA 2E75C 1CI3M 1O78A 2KA7A 4KKTA 4KN7C 2A68D 2BE5D 1Q1BA 2A69D 2K33A 1H9SA 3T53B 1IYUA 1B9MA 1FYCA 3U9SA 1FR3A 1T5EA 1TKWB 3ND8A 5BN3A 4KMUC 3PV0A 5KNCA 5C0XH 2O5JC 3PUYA 1Q1EA 3T51B 1PMRA 3N6RA 1E2WA 1I6VC 2Q8IB 4JBWA 1GUTA 1Y8NB 2A6EC 5KNDA 5KNBA 4TQUS 3OW7A 2V4DA 1TU2B 1VF5C 4KHZA 2YYZA 2JXMB 3VR6A 2NN6H 4OO1H 4HR7B 1ZKOA 1YNNC 3I4LA 3IKJA 1ONLA 3GQBA 3I72A 3VR3A 1IYVA 1IW7D 3OPOA 1Y69U 3VR2A 1EWHA 1Z7TA 2EVBA 4LK1C 2PPBC 3M7NA 1OXUA 2D62A 1GUNA 2EJFC 4TKOB 2DN8A 3T56B 3EQLC 3NE5B 3VA7A 3DXJC 2IT1A 3D4RA 1H9RA 1HQMC 1VDZA 4IFDH 2B8GA 2BDOA 4H0LC 3WDNA 3PUZA 1GHJA 1HPCA 3LNNA 3LWUA 4L8JA 2PNRC 1H9MA 1E2VA 2NN6G 3A8IE 3D31A 3W3AA 4H44C 4OO1G 3OOCA 2E74C
chains in the Genus database with same CATH superfamily
2UUBL 3OHXC 1A62A 1A3UA 1A2UA 1AEXA 1JE4A 1VQ8A 3O13A 4JBJA 4AYBE 5EBDA 5ELEA 4NXMQ 3E6ZX 1Y1WH 1ESFA 1E0BA 5LMNQ 3BVZA 2P5ZX 3BDLA 3M4QA 1DD2A 4A3JH 5M5XB 1GO3E 4Y52H 2MGSA 3AEVA 1RKNA 1X56A 2UU9L 4HSVA 1G291 4J15A 4KJNA 1BCPB 3CW2C 3RUZA 1NMFA 2A1AA 3PO2H 1VQDA 2IHEA 3A56A 1JWSD 3F8TA 4OWTB 1LABA 4Z9CB 4JI5L 2CWPA 4XQJA 3GTGB 3NBHB 4GKJQ 1GHKA 1HH2P 5EPLA 4OX9L 4HJAA 4DGZA 5M3MG 5EKLA 3J80E 3V96A 2K1BA 1OXVA 4KV6A 1VQ9A 1JB3A 2F0SA 3CCMA 1Y14B 3RZOH 2VUMB 4KN4C 2KCCA 2Q2TA 1D5MC 1VMPA 4LNQA 2JQOA 2E2HB 1NY4A 1HA6A 1I5FA 5JJIA 1VCIA 4X3KA 5ELFA 1V8QA 4F7XA 3GP7A 4DKAC 1KDCA 1JC7A 4LF4L 2Z6BA 1T5EA 4LF5Q 3ND8A 3S2DB 1VQHA 3AYHB 2F0DA 4HMJA 4GOPC 2D9UA 2GN5A 1EZ8A 4YCUA 5C4ZA 2ENBA 3M4OH 1IBKQ 1KAAA 1FGBD 3AFPA 1PH2A 4DR4L 1VQMA 1BBUA 2F0MA 3TSSA 1DM0B 2V1CC 5EGTA 1F9RA 3WOEA 1U0LA 2PNHA 2K01A 3MXPA 1MD2D 1TY2A 1E3PA 1XTCD 3TP8A 2EJFC 1A8VA 3G7LA 3LWEA 1LTRD 2YU9B 5L37A 5IWAQ 3K57A 1PDQA 4IFDH 4DV1L 3LNNA 1G2TA 1XNRQ 3A8IE 4OHJA 2CQAA 5DEHA 3V05A 3I56A 5COYA 2F4IA 3S9WA 1IKLA 2AUJD 2K7VA 3CQZH 1NBWA 2PZTA 1FJGL 1H9KA 4P2CB 1TWFH 3CF5A 1VMCA 5GQOA 3S1QH 4P74A 2NVTH 5JPMC 4GN5A 5EKIA 1XNQQ 1X65A 1Y1VG 3DWAA 3GV6A 4FVMA 2G5DA 3KFUA 4GZYC 1I4XA 1TXYA 4WJWA 1X6OA 3GTOH 4JI4Q 2KEDA 1XJVA 1EUJA 5I2YA 1YNJC 5JEAH 4OELB 2MUYA 1VQ7A 5IYCH 1ENFA 2NYZD 3L9AX 1JOKA 3C1EA 1TY0A 5HGQA 3RN2A 2Z6KA 4G57A 4LUVA 3LX0A 1A15A 2PYKA 3AFQA 4QGUA 1LT4D 4WORA 2L4NA 2FMCA 4X62L 3MFGA 5C3EH 3CCQA 4YWLA 3W5OA 3VYTA 1G8ZD 4DV2L 1SYCA 3K81C 3K59A 5J1ZA 4A3BH 1C7YA 5C4XB 1SNOA 1G2SA 2BA1A 4I65A 4L5TA 1PXUA 3H0GG 4CBVA 4FXDA 1S3OA 1VQEA 2ZM6L 4X66Q 1WD0A 4KK7A 5DM63 2JA5B 1PMRA 2B2TA 2JA8G 3GTMB 4JI3L 2JN4A 5IP9G 3T1HQ 4ZKBB 4NXNQ 1NAPA 3FKIG 4FXGC 1FNVA 4LF7Q 4OO1H 2Y0SE 2DJFC 3CMEA 3FPUB 1SNMA 1EOVA 1VQOA 2E5LQ 3EJIA 4JI2L 3G71A 3W1BA 2SEBD 4LF8Q 4C3JG 2OCEA 1I94Q 3NE5B 1HNWQ 2N8NA 4AQYL 3GTGH 2WACA 1LO5D 1B3AA 4DK6C 4X3SA 1PFSA 2J4XA 2E74C 1K28A 2VB3X 1QWYA 1JR0D 4PZ8A 5EAYA 2F4VL 2F0NA 3FRPB 2JEAI 4JOIA 4MTKA 4GNXC 2VUMH 3S2HB 4IO9A 2KEEA 3SK4A 5K36G 2EY2A 4RKLA 2KBNA 1HUMA 4RHRA 2JA6G 3DM1A 3FP9A 3W2DA 5HY6A 4YHHQ 3K0XA 4CHTB 2B8FA 1XX8A 1EZ6A 3TMEA 1T5XD 2ZJQA 4DR7Q 1CQVA 2EJGC 1YIJA 3G48A 1SRUA 1Z9FA 1RODA 1C8CA 1IKMA 3PF4A 2JA9A 2JK8A 4PZ6A 3DWPA 4J6HA 4K2LA 3BDOA 5FLXE 1SE3A 1PFMA 4JYAL 1J8IA 2DJGC 3MVVA 2JA7B 2B2YA 2H5XA 3S1MB 4QUFA 1HTLD 3QOJA 4A3LH 1W6KA 5FLMG 2Y0SB 3J80i 1LLRD 4UP9A 4CGYB 2JEBI 1X9NA 4IPGA 4RGOS 1M4VA 1A63A 1TWHB 1VQBA 3BZCA 5G3LD 3OWFA 5BN5A 2YU9H 1UE6A 3RZDB 4BXXG 2H4OA 3GO5A 1K73C 2WB1B 3I3CA 2OEOA 1S5DD 2B2UC 3E5SA 2I5HA 3J81i 2Q8RE 3D4DA 3OYYA 1TS2A 1I6VC 1S5BD 2ZTCA 2UUAQ 4TQUS 1F2YA 3TEHB 4C1NI 4HR7B 3B6YA 2I0QA 1I6HH 3OPOA 2VQEL 3GTQB 4BBRG 1Z7TA 1U5KA 4TKOB 4Q0FA 1CT1D 3HOYB 3MHBA 5J22A 1SBBB 1SNDA 4UY8C 3NK9A 4L63B 4A3KG 2RHQB 3FEWX 5LMNL 2WKCA 5CMDA 2HCCA 1EYAA 1ICFB 2WP8J 3P20A 2E76C 2HUGA 1O7YA 3GTLH 3Q0AA 4IPHA 4ZCKA 3A7LA 4JCVE 4HJ9A 4DV4L 3HOZB 5I6YA 4DAPA 2G9DA 2MFIA 4NB3A 1B1ZA 3HP3A 4NKLA 4C3IG 3HGBA 4GOPB 4K0KL 2K5QA 5EBCA 3EIVA 5CV6A 1ML0D 4C2MB 4EGVA 4CKEA 3CC7A 4DNRB 1AZPA 4MZ9A 3OMGA 2JA5H 1C48A 3PQIA 4HIDA 4RCNA 4ZLTF 1YHBA 1B7YB 1VF7A 2WFWA 1HNXL 1U4PA 5JAVA 1Q46A 1X55A 3PIOA 5FLXc 1GKHA 2LY7A 1PHJA 5JOBA 1QJOA 2C5CA 4A3IG 4RWSC 2AQ1B 4A3GB 1STAA 4FF3A 2BOSA 2Z0SA 2UXCQ 5IT9c 2OQ0A 3EN2A 1JJ2A 2F0LA 1JJGA 1DCZA 4JI0Q 4ILWA 2WAQB 2ICIA 4OIKA 4A3CG 4L6TB 2BE5D 2JSOA 5H1SE 1VQKA 1IBKL 3H15A 1B9MA 3S24A 4C56C 1TKWB 4RGTA 4GKKQ 5C0XH 1S72A 2Z1CA 3NXWA 2KCTA 1HR0L 2QCPX 1SE2A 2A8VA 1E2WA 5FO8B 2KHIA 3J81L 1LT3D 3R3OA 2R7DA 2YYZA 1B2TA 1KRSA 2K5VA 1ZKOA 3J7ZC 1J5EL 1RTOA 1UWVA 4POGA 4ZAIA 4QUCA 3D8GA 2EPBA 2RSNA 1B50A 1TS5A 3M7NA 1OXUA 1SMXA 3J7YW 3PO2B 1F2MA 4BY1G 2R93G 1J9OA 4CDEC 1PH8A 3W3AA 1A2TA 4JI7Q 3S1MH 3W1GA 2K4KA 2L1BA 4X3TA 2D5DA 4X64L 1K83H 2LSSA 4P72A 3ONAB 4IOCA 3A0JA 5CV8A 4A3FG 1JICA 1UNSA 2D2CC 4LF6Q 3HZXA 4JI1Q 2QW7A 1Q12A 4A3KB 2B3GA 2AUKA 1EYDA 5IE8A 2E8GA 3HFZB 1P16A 3KLRA 1VQAA 3K6OA 2NTTA 1STBA 1HZAA 3DHQA 3OWEB 3PO3G 1E7ZA 3R2TA 1JORA 4A3MG 3C1FA 1GUSA 1NR4A 5LHY1 3MA2B 3M4OB 2Z8LA 1PZKD 2L15A 3CRLC 1PH4A 5E3FA 1GXDC 1GUGA 3DWQA 1SDFA 3H0GH 3E0EA 4HCEA 1LTTD 3T1YQ 4IOAA 3UDIA 2OWOA 2IL8A 1SROA 3RLOA 4U673 1CFMA 3CHBD 3MXNA 1Y8PB 3STBD 3OMCA 2JA8H 1MSGA 5IP9H 1X3PA 2MP1A 1O7IA 4X65Q 1IL2A 1EYCA 2RDGA 3FKIH 1TWGB 4DR6L 2TSSA 2KA7A 4KKTA 3TP6A 3GDEA 5D3DA 4B3RL 4S3SA 4GNXB 3T1HL 2O4XA 1XMQQ 3OW2A 4DR2L 2KHSA 1YZ6A 1G6ZA 2O5JC 1Q1EA 3J7A5 4UP8A 1KNAA 3JAML 3SVMA 4C3JH 2NBFA 3CQZB 3S15B 2E5LL 5IY0A 3HOZH 3HOVG 1D1IA 3U9OA 3I55A 4LF8L 3K80C 2EXZA 5DAUA 1R9TB 3UDGA 4A3EB 3OTOQ 1HNWL 1IYVA 2KUMA 3FVQA 1EOTA 2DY7A 3K5OA 1MJEA 3NUCA 2RSOA 2NVXH 1EWHA 1CKNA 1GM5A 3GTOB 4A93G 1G6PA 4C2MH 2WINB 5F2DA 3M9BA 2R7ZG 4B3TQ 1LV9A 1SLJA 2UXBQ 3S1NH 2VXWA 4HJ8A 2RQXA 4RKBA 2Q2IA 3OOCA 5EQ0A 4B9WA 2PMZE 5AFWA 3VA5A 2BE5C 5JEAJ 1M90C 5NUCA 2HQEA 4IURA 5J39A 2IPKD 2ZXRA 4A3GH 1E2ZA 1YNND 3FMCA 3MEFA 2R93B 1LTSD 4DR7L 1EU3A 1UEAB 5IGDA 1EY9A 4I7ZC 3H94A 4YCWA 3PUWA 4A3BB 4DV5L 5FLMH 2F0HA 1VQFA 2PW7A 2F0GA 4A3FB 5C3WA 2F1MA 3S17B 2WV6D 1W3SA 1IL8A 2SNSA 3J7AF 4IUNA 1GVPA 4IUTA 3GD7A 4V0BA 2QDLA 2C35B 2MO0A 4BXXH 1X3GA 1O7ZA 5M9OA 4TRDA 4JV5Q 5FK9C 3R2IA 1GJXA 2HT1A 4IFDI 4L5SA 2OTLA 1N34Q 5BR8Q 2N78A 4PNYA 1XMOL 1X3FA 2AQ3B 1JMCA 4LFAL 2VW9A 3I4MG 3PO3B 2LKVA 3A7AB 2R7FA 4EQNA 4U68A 3BZKA 5G3LF 4B08A 3HOUG 1ENAA 2EJMA 3SK6A 2A68D 3H09A 4B3SQ 4H02A 2K33A 2PMZB 4DV6Q 5M5WH 1SNPA 1BR9A 4LFCL 4RCOA 1K0SA 1A3TA 1GUTA 2A6EC 2ID0A 1WTQA 2F03A 1AE3A 5IOCA 2F0IA 1QCBD 1CHQD 4A3KH 1WYDA 3VR3A 1DOMA 2GA4B 1KL9A 5HGTA 3RD4A 2ATWA 1PYBA 1XPUA 1V1OA 3CPFA 1CUKA 2XWBB 3J81E 1HHVA 4DUYL 1WCMG 2I07B 1FNUA 1SNCA 3STBC 4AYBB 3KF8B 1DZ1A 5C44G 4L8JA 1DONA 2XRSD 4GNXA 3Q8DA 2RKSA 3G4SA 1Q8IA 3T16A 3CCJA 4C3IH 3C46A 3KJOA 1A6XA 1PTOF 1EWIA 5CBEE 3KBXA 2QF7A 1RD9D 2VQFQ 3CCEA 5E1FA 1TWGH 1AH9A 1JQYD 4L5QA 2EYMA 3HS0C 1QZGA 2CFMA 3KF6B 2BA0A 4OO1I 1PVOA 3E9IA 2N49A 4A3IH 2XSCA 1TIID 5IYDG 4O1NA 1FGUA 1UUPA 5BN4A 4BBSG 1K8OA 3S15H 4FP5D 1SE4A 1N33L 3KUPA 1E22A 1LACA 2TMPA 1R4PB 1T9HA 4R1JA 1C9OA 3SE0A 5IP7H 1IBMQ 1STEA 1R9TH 2X6LA 4A3EH 3KK7A 4JI0L 1I6HB 2Q8TA 4HTHA 1VQJA 2A6HD 3QIAA 4UHVA 2X6GA 4OIJA 4CDFC 2B2UA 3H6MA 4JBKA 4DFAA 2BDNA 1RCVD 4JI8L 4KN7C 2B2WC 2B63G 1Q1BA 5D65A 1FYCA 2KCMA 1FR3A 4FF4A 3V2TA 3BYTB 1BXTA 1ZYRD 3EROA 3F1ZA 1XWEA 1PH9A 4BY1H 3HOWG 4RHSA 5KNBA 3GTLB 2R93H 3J80c 1B44D 3I4NG 3HOUB 1KIXA 4G4KA 3KLSA 4NPSA 5I6WA 3Q24A 4NW2A 2K05A 3TREA 1MI2A 3S1RB 2LXKA 5M3MB 4C1NK 1VQGA 4LK1C 1IZ6A 3JAME 2A5HA 3BZDB 1N32Q 3K58A 1VQ5A 4A3FH 3EQLC 3SK5A 5LMUL 2UXDQ 3S17H 2IT1A 4DUZL 1H9RA 1LT6D 3M3YB 3GTPH 3NBHA 2B2VC 1M1KC 2KENA 1EWCA 4C3HG 4JK1C 3RLFA 1M8AA 3VR4A 5CR3A 1NCVA 4DR1Q 4DV7Q 1EQVA 3M4YA 4JI1L 4H13C 5CGKA 1TS4A 4BA1I 4K6LA 3PO3H 2UUCQ 3BYYB 4DPGA 4A3MH 4EX5A 2ZXOA 5C44B 3M85A 4LF9L 1SJHD 4M8AA 5JVH3 2FINB 3K0YA 1K8GA 3F2DA 1L0YB 2FHTA 5KGUA 1PRTD 1K8MA 4HIMA 4IPDA 1IBLL 2MPMA 4IUUA 4DK3C 3EFXD 1HTPA 4IPCA 5T1GA 1EQQA 2IX1A 4QQBX 2JP1A 4KKSA 2KJXA 3T1YL 4IJLA 4BWGB 4YY3Q 4QF4A 2NVYH 3SR1A 2MHVA 4B3MQ 3NTIA 2RBMA 4QCLA 5DNFA 2G9HD 5C0XJ 1K9MC 1N36Q 1V1QA 1NTGA 1U9RA 2EYHA 1H9JA 1VQCA 1SMYD 1B9NA 1XMQL 2CQOA 2NN6I 2VZAA 4KD4A 2HIVA 2VNUD 2QKIC 2QA4A 3IAYA 3HOVH 2CKZB 1B70B 4F88A 1CZWA 2AQ2B 3DM3A 3ULPA 1NJIC 3PCOB 2RVLA 2A69D 1V9PA 1Y1VB 4N9TA 2PI2E 5BN3A 1OO9B 3PUYA 1KHIA 3T51B 2F0TA 1K83B 2YTYA 4A93H 1RHPA 3ZJYC 4DAVA 2R7ZH 4GLAC 3HOXG 4ULLA 1VQIA 3S16B 1EY6A 2VL6A 4RAUC 3QR8A 3IKJA 2F0OA 2B63B 4P71A 4ZYSA 1N8RC 1PH5A 1IW7D 3CCUA 4K8IA 4CKCA 1KLUD 5GAHC 3I8ZA 3P1HA 3NTHA 4PMCA 4CJ1B 1GHJA 5JJLA 4DV0Q 5AJ3Q 2AMCB 2HD3A 1L1OB 2JE6I 1ENCA 2R61A 4ZQ3A 3G6JB 2K04A 3H0GB 4DXGA 2IWHA 3ERQA 5HURA 3PIP3 1CSQA 1EQTA 4A3JG 1II3A 1ZYRC 3NWTA 1IXRA 2DNCA 4F8MA 4JI5Q 2HDMA 2SNMA 1OXTA 5GAEC 5C0XI 1I3QB 5ELCA 1E1TA 3BVMA 2JA8B 1SE8A 5A35A 1Q81C 4JW0A 2Z6KC 2R92G 4OX9Q 1HZCA 3PGZA 3FKIB 2L12A 2HDLA 1SYGA 3HG9A 5FO9B 4LUZA 4RA8A 1H9SB 4H7BA 4NXML 4GLXA 1BDOA 1DXMA 1L2FA 3CCRA 4JV5L 4Y7NB 1I4GA 3MWYW 4HIOA 1ET9A 2I5LX 3I4MH 1PTOD 4O42A 1N34L 4C3JB 3GTJB 1ZXTA 4MNOA 2M2LA 2KOLA 1D8LA 3KLWA 3HOUH 1IYJB 4G7HC 3KJPA 4PQXA 1XTDA 3DEPA 3CC2A 5IGGA 3S1RH 1NR2A 5KRUA 1SXTA 3PUVA 4LF4Q 5M3MH 3H3VI 4A3DG 1EY8A 1Z6HA 2NVXB 3D0FA 2R6GA 4DF7A 4GKJL 2DUDA 1EFID 2KECA 1SYEA 2B2TC 4DV6L 3F2CA 2I46A 3M3YH 3FHWA 4K14A 3G6EA 4RGNA 4GN3B 2JA6B 3S1NB 2JYOA 2N3SA 3U9SA 3BS1A 4QMGA 1PTOH 1BKBA 1BBXC 1PRTC 5IYBG 2OXPA 1BQQT 3URYA 5KYLA 2NZOA 4LUOA 4JBWA 1WCMH 4HAEA 3A54A 1MGSA 1YBYA 1TU2B 3CU7A 1XPOA 4HEDA 3VR6A 5C44H 3CCVA 1OTCA 1FL0A 4QIWE 4LF5L 1ONLA 4R4OA 3GTKH 3LGJA 4MIUA 3VYRA 2PQAB 5D3IB 3HRZC 1B4OA 3T56B 3JAMi 4ID6A 2K5DA 3S14B 5C3XA 2F3VA 1LTBD 2ZTDA 1H9MA 1E2VA 1XXGA 4ALPA 2BH2A 5I2XA 1K3RA 3FDTA 1AP0A 1WTHA 2A69C 4IUVA 4QB4A 2XRQD 1DOLA 1F2LA 4BY7G 1PYWD 5IWAL 4CKBA 4QL5A 1V1PB 2YTVA 2HHHQ 1XNRL 3A8KE 4BBSH 3NELA 1K8AC 4ZK9B 5CORA 2OF1A 4XDXA 2AKWB 2ALYB 3NBIA 3UE0A 4DR5Q 5IYCG 1IHZA 3I2ZA 4TSSA 1Y1VH 5JJKA 2CWAA 3NTKA 4X62Q 5M5WB 3D6CA 1QUQB 4BBRB 4MTNA 3TS0A 2K14A 5M3FG 1XNQL 4XTCS 5IODA 3Q22A 2L5TA 1ILQA 1P8LA 3ND9A 4DV2Q 4DN4M 3S16H 1HR0W 4JI4L 1PYSB 3HEJA 1STGA 2B63H 4QIWB 4OXPA 1W2BA 3EBEA 1EEFD 4DR3Q 4R8IA 2MQHA 4JI3Q 1U4RA 3QG1A 3I4NH 3CMAA 3K8AA 1VQLA 1CI3M 1SNQA 4ABNA 1H9SA 1JT8A 5FJ8G 1NNXA 2DGYA 3NQTA 4UDUC 3TDQA 4C3IB 4JI2Q 4DA2A 4ZRZA 2XGTA 1YITA 5KNDA 3OW7A 1F9PA 1PTOC 1I3QH 3A74A 4AQYQ 3J81j 1LUZA 1X3EA 4PMWA 4C3HH 4X66L 2UXDL 3EVQA 4A4IA 4RFBA 2J0TD 4ZUIA 4GOPA 2F4VQ 2PPBC 5CBAE 2D62A 2PZUA 2NZHA 3VA7A 4HIKA 3ZYYX 4Y7NH 2M9VA 4NXNL 4A3IB 4LF7L 4DV7L 1JOQA 1KABA 4LAAA 1YJNA 3LWUA 3GTJH 1NE3A 1BBWA 1QB5D 2K03A 4IFDJ 4IQZA 3D6WA 2VUMG 3TP7A 3IL8A 2E2JH 1KDAA 1KDBA 1L0WA 4K5VA 2ZJRA 2EE1A 5DM73 1I94L 1B3QA 5C4HA 1STHA 1EFWA 3A5ZB 1EQRA 1GUWA 5EPKA 4ODGA 5K36H 2EYPA 3K5MA 2DNEA 4N9PA 4JYAQ 4KHVA 4PG3A 1F9QA 2JA6H 2PQAA 2AWOA 5D14A 1RDPD 4K5WA 1EIHA 4FO2A 1WJJA 4RMFA 2K52A 1HA5A 2N55A 2RCNA 3F2BA 4BY7B 4YY3L 1YVCA 5GAGC 4LJZC 3U58A 5EPJA 5M5YH 3SEBA 1PRTF 5EKKA 2ES2A 4A3LG 5C5MA 4YHHL 5GADC 3K7AH 4KY5A 3NP8A 1CZGA 1X54A 4KY6A 4BY1B 3K7UC 3KOJA 4XQNA 1AFPA 2K32A 4WRDA 1WTRA 2K50A 4AH6A 1TWCH 1V1PA 3QJYA 2C9OA 4QY7A 4OWWB 2B2WA 2GVBA 2EIFA 5ELDA 2F0EA 5FKAC 4IN3A 3HOXH 3FPPA 3S14H 1A3VA 2EDGA 5CV4A 1AE2A 3GTPB 2L11A 1SFOH 3SGIA 3ICEA 1QUQA 4I7AA 1KC8C 4PZ7A 1NSNS 2FJ2A 1AN8A 1L1OC 2EOTA 2FMMA 1JOOA 1Y8NB 2EYJA 2F0KA 5IIFA 3RLNA 4FXKC 5E7NA 4OEMB 2K75A 4A3MB 3CPWA 3I4LA 1KD1C 1KQSA 4DU9A 1D5ZC 1FVIA 2BCOA 2CH4W 4APVA 4DV0L 5AJ3L 3KDFB 2B2VA 1WD1A 5FLXL 3AMUA 2H1EA 2UUAL 5CV5A 2GVAA 4BBRH 2FFKB 2BDOA 2XVSA 3WDNA 2CW0D 4P73A 2E2IB 2PNRC 1FD7D 1D6EC 1HFGA 1I50H 2NN6G 3MTSA 3NSWA 5IT9L 4DV4Q 4KKUA 2R92H 3P7JA 2CVRA 3VYUA 2EYLA 2NVYB 2EYFA 4ME3A 1D2BA 5CV7A 4K0KQ 3DLLA 5C4XG 5IGFA 1SJED 4DAYB 5JPNC 2Q2UA 3UE1A 2EZVA 3CC4A 4YIJA 2NVQB 5A2QL 1CTMA 1HNXQ 1BUVT 3HOVB 1PRTB 3HKZG 1K0RA 2JA5G 2EQSA 2MNAA 1LTLA 1SYBA 2X69A 4G7ZC 4A3DH 3MEHA 3J7AV 3AQQA 3UDXA 4POFA 4L5RC 4A93B 2RA4A 3DUZA 5DLQE 4RG1A 3NENA 3VYSA 1S40A 2R7ZB 3TZUA 1HQRD 3IFTA 4XT1B 1HCZA 3P75A 3MXUA 2QDBA 4AIMA 1Q3LA 1X32A 3D3RA 5IYBH 1Q82C 2RDHA 4P75A 2F0WA 4OGQC 1HR0Q 5CYUA 2EYOA 2J7ZA 4EQ5A 5KIXA 4KHPQ 1YEZA 1NUCA 2N88A 4XIGS 3T13A 5C0XG 5ELOA 4CJ0B 2K28A 4DV3Q 2VB2X 4R4QA 1WTVA 3U4ZA 3M4PA 4NDXA 4A3CH 4R4IA 1J5EQ 3I4OA 4WJ4A 1HNZQ 2UXCL 4XXEA 1WTOA 2PO4A 3NEMA 4NMZA 1SR3A 2F0UA 1VS0A 4K2KA 1LM0A 5FO7B 1G91A 1G51A 2RHSB 4JG2A 5IGEA 1LT5D 3WOFA 1TR5A 1YNNC 1KXLA 3HKZE 4GKKL 2XN9C 3I72A 4JBMA 3T4AC 1CM9A 1ET6A 4X64Q 4BY7H 2F0JA 3E9HA 1N9WA 4ZKCB 2JA7G 3D4RA 3ITPA 1HQMC 1QG7A 4H0LC 2Y0SG 2XIWA 3R8BA 2B29A 3I4MB 1TT2A 1WI5A 3PIO3 4KJOA 1O7LA 4HN7A 1S5FD 1YJ9A 2HHHL 1D1KA 1CKOA 3CKIB 2IX3A 4J8QA 4V190 3TP5A 2D0PA 1TVXA 2WB1G 4DR5L 3QWNA 3SK8A 4K8JA 3A5UA 2F3IA 2QILA 3TZDA 5M3FH 1Y8OB 1ILPA 2SOBA 3L3OC 4JI7L 4CDCC 4WJ3M 3K5LA 5I9PA 3KYHC 4O0AA 3NWSA 1S4ZA 3I7FA 5J3BA 1JJCB 2DY8A 3KDFA 1PA6A 3PUXA 1ICWA 1BCPD 3I70A 3L7ZC 4LFBQ 1YJWA 1U4LA 1Z47A 3J81c 4JPBW 1QNKA 2A68C 4LF6L 2E2DC 2NZ1D 1DOKA 1PTOB 2L9HA 2SDFA 3ULLA 1BOSA 3C2PA 4HMIA 4OWXB 3M7GA 2BH8A 3X3NA 4JI6Q 2OTJA 1WCMB 1YI2A 2ZT9C 1WTXA 2CW0C 4UPAA 3RNUA 4DR6Q 3R93A 4DR3L 2YTXA 3HKZB 3CXCA 5FJ8H 3OIPA 2FXQA 4B3RQ 3HOYG 4IUPA 1DJRD 4DR2Q 3GTKB 4DAYA 5M5XH 1NMGA 4TVAB 4MHEA 5CV9A 2CCZA 3KF8A 2E2IH 5GROA 1RTNA 4GS3A 4E6IA 4K5XA 1YHQA 1QOHA 4DNIA 1BNZA 5KNCA 2KHJA 4LMQD 4YWKA 2WB1E 3HOZG 3L2PA 4X65L 1QZHA 3N6RA 1YNXA 3SHLA 1EIFA 1J6QA 2AWNA 1CHPD 2XWJB 1ASYA 2V4DA 4BBSB 1EL0A 1VQ6A 2NVQH 3Q6SA 2LXJA 4EQPA 1QVCA 1VQ4A 1Y69U 1SAPA 2E2HH 2CHBD 1WOCA 1RF2D 4BS9A 3KF6A 2IW3A 2Z4IA 1WTWA 3OSOA 2IY5B 2QGQA 1DGSA 1KLGD 1RL2A 1STNA 1EYGA 3KBGA 3OTOL 4A76A 2JJQA 3S2DH 1EY4A 5KYIA 3DEOA 2IX0A 4A3GG 2B39A 4DV5Q 4RH6A 3NPPA 3QB3A 3TN2A 1EIGA 1E1OA 3TBIB 2L55A 2Z9HA 4B3TL 2WAQG 4RGMA 2UUBQ 2UXBL 5IT9E 1YHAA 3RN5A 1HUNA 1C4QA 3KLSX 2OT2A 1L0XB 1JE5A 2XTIA 2A6HC 4J1MA 3HOWB 1GOZA 1UAPA 2L0CA 3I4NB 3BJUA 3JAMc 2K5HA 1I4RA 1JB7A 4FNFA 1QVFA 1D7QA 1Y1WG 2QEJC 2UU9Q 1HZ9A 1OXSC 1XMOQ 1SEBD 3TS2A 4LFAQ 1E24A 5ELNA 1KRTA 1KTKA 1KNEA 1U4MA 4PV1C 2O5IC 5A2QE 2M00A 4KY7A 1VQPA 3MFYA 1EU4A 1SSOA 5CC4A 3Q23A 2A19A 4LWCA 3PO2G 2RDFA 4C3HB 1PZID 2K5NA 3C3LA 4LW1A 4LFCQ 1Q8KA 4UP7A 1PV4A 1UE1A 2HQLA 1QNUA 4DK1A 4YWMA 4HJ7A 2F0QA 1O78A 3A55A 4XQQA 5BR8L 3T53B 1TQOA 1UEBA 5C4JB 3TRZA 3E3XA 1CSPA 2E2JB 1H95A 2WAQE 2AHOB 1BCPC 4JVZA 1JWMD 4FYDA 2Q8IB 3UDFA 1GD7A 1AW7A 1PH7A 4DUYQ 1VF5C 1CA6A 4B3SL 1VQNA 4KHZA 2NN6H 4N8FA 3ERSX 1RJTA 4XYQA 1PFNA 2A73B 1X3QA 4Q5VA 4B9XA 1K3BC 3WWVA 5LL6S 4DR4Q 3MXNB 3EA6A 4JC0A 1WVLA 1GUNA 1I4QA 4GLVB 5ISRA 2KCNA 5C4XH 5M5YB 2F0FA 3H91A 4X3UA 3D31A 5LMNW 5LL6X 5JVG3 2NB0A 3K7AB 1CK1A 3E0JA 2EY5A 5E4XA 4IJHA 4DV1Q 2D0OA 1XPRA 3GTMH 1QE6A 3NHHA 4PMBA 2F52A 2QEXA 1QILA 3I73A 3CD6A 4CDDC 1TWAB 3BVGA 1TWCB 2MO1A 4IFDG 3U4VA 1EY0A 4JOIC 3HKSA 5ELBA 1Q7YC 3CCSA 4IUQA 2HCIA 1FJGQ 1SMYC 2OQKA 1N33Q 3MZ5A 3HOXB 1D5XC 1RIPA 1PLFA 1WTPA 3J80L 4DXFA 1V43A 1EIYB 1CKNB 4EVOA 1O80A 1SYFA 3A8JE 4O2DA 1SFOB 4CJ2C 1I4PA 5IP7G 4R9WA 2VQFL 4IALA 1BO0A 2KVMA 2ZXPA 4XYOA 3GV3A 3VDYA 3IRBA 1DYQA 2HIXA 4DNTB 4A3EG 3N52A 1CKMA 1B8AA 5IYDH 2Q2HA 2F3WA 1EY5A 1ZEQX 4KI0A 2ZTEA 3MC0B 4JI8Q 3S2HH 3U50C 4YCVA 1OXXK 2B2YC 2LS01 5JEAG 1GUOA 4GN4B 4KHPL 1TS3A 3UI2A 3CAMA 1Y1WB 4DV3L 1IW7C 1JCKB 3BU2A 1IBML 3PMFA 3AU7A 4A3JB 1HNZL 3VR5A 2CH4A 1S5ED 1MKHA 1MBYA 1L1OA 1I50B 1IYUA 1MIUA 3ULJA 2WIIB 4KMUC 2R92B 5C3EG 4X6AH 4R4TA 4HSPA 3X3MA 3H3VH 1C0AA 2JA7H 3MAQA 2PW5A 3QOLA 2ZM6Q 5LMUQ 4A3BG 3PSIA 4DUZQ 4EQOA 1F9SA 2PZWA 2RCFA 4FF1A 3GQBA 3HOWH 4KTAA 4ZUJA 1PZJD 3RZOB 1MJCA 1TWHH 2F0VA 2IJ0A 5EJWA 1XYIA 2NTSA 2PI2A 1R4QB 2MJ8A 4IZ8A 3RZDH 1B53A 3DXJC 4A3DB 1ESRA 5C6AA 1HXYD 3IFDA 3TQYA 1PH6A 3PUZA 1HPCA 4UAIA 4OO1G 1PH1A 4A75A 5I9OA 1LTID 3I91A 5C5LA 4LF9Q 3AB9A 1I4HA 1PH3A 2A6ED 3RMHA 1N32L 1F77A 1UE5A 2A74C 2LFNA 1LYLA 3F2UA 5K5PA 2O2LD 2NUCA 2LMCB 5FOBB 5T1IA 3I90A 1IBLQ 4FF2A 2YV5A 4FDBA 4LFBL 2R3ZA 1PFBA 1Q90A 3GTQH 2RF4A 4OONA 4DR1L 1EY7A 3OIQA 2KQ3A 5C4JH 1HFNA 1LTGD 2K5WA 1HZBA 2EXDA 4JI6L 4MN3A 3SDZA 1QVGA 3HOYH 2WKDA 2UUCL 1BCPF 1UE7A 2ASBA 3JC66 1JWUD 3ER0A 5IGBA 4HJ5A 5I4DA 1HJPA 1KAWA 2I5MX 4KD3A 3K5NA 2IHFA 2XNAC 4N8X1 4BA2I 3BDCA 2F0PA 4R8NA 1MHWC 3BG3A 3L0OA 1SYDA 3CP0A 2EY1A 4DK0A 1Q86C 4AYBG 1TWFB 4G7OC 3S1QB 3CRKC 2NVTB 4OL7A 3PIPA 1A0IA 1SN8A 2PCFB 1F2ZA 4HCSA 1CA5A 1CQFA 1WFQA 2VY3A 4K6DA 4DAMA 4WFN3 4B3ML 2K6AA 1BF4A 5E4WC 4XT3B 2E75C 1N36L 3QO2A 1BVSA 5KEEA 4R4CA 3PV0A 4QJFA 2PQEA 3RR5A 1STYA 4NP5A 1TWAH 4F87A 1W6JA 2VS1A 4KLKA 1EEID 3D4WA 5IGCA 2EY6A 5M3FB 2JXMB 3CCLA 3H3VC 2Z4HA 3PF5A 5TSSA 1YNJD 3VR2A 5C3EB 2EVBA 3MXGA 5JJZA 1AZQA 2NWGA 2DN8A 1ASZA 3SXHA 1VDZA 2VQEQ 2B8GA 1MSHA 3DMUA 1LTAD 1HRJA 3NQIA 1FNWA 2ZJPA 4H44C 4M1UB 1S5CD 2ICEC 4ME5A
chains in the Genus database with same CATH topology
3OHXC 1A3UA 1A2UA 1AEXA 1JE4A 3O13A 5EBDA 5ELEA 3E6ZX 1ESFA 1E0BA 3BVZA 3BDLA 1DD2A 5M5XB 2MGSA 1RKNA 4HSVA 1G291 4KJNA 1BCPB 3RUZA 3A56A 1JWSD 1LABA 4Z9CB 4XQJA 3GTGB 1GHKA 5EPLA 4DGZA 5EKLA 3J80E 3V96A 2K1BA 1OXVA 4KV6A 1JB3A 2F0SA 2VUMB 4KN4C 2KCCA 1D5MC 1VMPA 2E2HB 1HA6A 1VCIA 4X3KA 5ELFA 1V8QA 4F7XA 3GP7A 1KDCA 1JC7A 1T5EA 3ND8A 3S2DB 2F0DA 4HMJA 2D9UA 1EZ8A 5C4ZA 2ENBA 1KAAA 1FGBD 2F0MA 3TSSA 1DM0B 5EGTA 1F9RA 3WOEA 2K01A 3MXPA 1MD2D 1TY2A 1XTCD 3TP8A 2EJFC 3G7LA 3LWEA 1LTRD 2YU9B 3K57A 4IFDH 1PDQA 3LNNA 1G2TA 3A8IE 4OHJA 2CQAA 5DEHA 3V05A 5COYA 2F4IA 3S9WA 1IKLA 2AUJD 2K7VA 2PZTA 1H9KA 4P2CB 1VMCA 5JPMC 5EKIA 3DWAA 3GV6A 4FVMA 4GZYC 1I4XA 4WJWA 2KEDA 5I2YA 1YNJC 5JEAH 2MUYA 1ENFA 2NYZD 3L9AX 1JOKA 3C1EA 1TY0A 4G57A 3LX0A 1A15A 2PYKA 1LT4D 4WORA 2L4NA 2FMCA 3MFGA 3VYTA 1G8ZD 1SYCA 3K59A 5J1ZA 5C4XB 1SNOA 1G2SA 2BA1A 4I65A 1PXUA 4CBVA 4FXDA 1WD0A 4KK7A 5DM63 2JA5B 1PMRA 2B2TA 3GTMB 4ZKBB 1NAPA 4FXGC 1FNVA 4OO1H 3FPUB 1SNMA 3EJIA 2SEBD 4C3JG 3NE5B 2WACA 1LO5D 1B3AA 4X3SA 2J4XA 2E74C 2VB3X 1QWYA 1JR0D 2F0NA 3FRPB 2JEAI 3S2HB 2KEEA 3SK4A 5K36G 2EY2A 4RKLA 4RHRA 1HUMA 3DM1A 3W2DA 4CHTB 2B8FA 1XX8A 1EZ6A 3TMEA 1T5XD 1CQVA 2EJGC 1RODA 1C8CA 1IKMA 3DWPA 4J6HA 4K2LA 3BDOA 5FLXE 1SE3A 1PFMA 1J8IA 3MVVA 2JA7B 2B2YA 3S1MB 4QUFA 1HTLD 3QOJA 1W6KA 2Y0SB 1LLRD 4CGYB 2JEBI 4RGOS 1M4VA 1TWHB 5G3LD 3OWFA 5BN5A 3RZDB 2H4OA 3GO5A 2WB1B 3I3CA 2OEOA 1S5DD 2B2UC 3E5SA 2Q8RE 3D4DA 1TS2A 1I6VC 1S5BD 4TQUS 1F2YA 4C1NI 4HR7B 3OPOA 3GTQB 1Z7TA 4TKOB 4Q0FA 1CT1D 3HOYB 3MHBA 5J22A 1SBBB 1SNDA 3NK9A 4L63B 3FEWX 2WKCA 5CMDA 2HCCA 1EYAA 2WP8J 3P20A 2E76C 2HUGA 1O7YA 3Q0AA 3A7LA 3HOZB 5I6YA 4DAPA 2G9DA 1B1ZA 3HP3A 4NKLA 4C3IG 3HGBA 2K5QA 5EBCA 5CV6A 1ML0D 4C2MB 4EGVA 4CKEA 4DNRB 1AZPA 3OMGA 1C48A 4RCNA 4ZLTF 1VF7A 1U4PA 5JAVA 2LY7A 5JOBA 1QJOA 2C5CA 4RWSC 2AQ1B 4A3GB 1STAA 4FF3A 2BOSA 2F0LA 1DCZA 4ILWA 2WAQB 2ICIA 4OIKA 4L6TB 2BE5D 2JSOA 1B9MA 4C56C 1TKWB 4RGTA 5C0XH 2Z1CA 3NXWA 2QCPX 1SE2A 1E2WA 5FO8B 3J81L 1LT3D 3R3OA 2YYZA 1B2TA 1ZKOA 1RTOA 4ZAIA 4QUCA 3D8GA 2EPBA 2RSNA 1B50A 1TS5A 3M7NA 1OXUA 3J7YW 3PO2B 1F2MA 1J9OA 3W3AA 1A2TA 2L1BA 4X3TA 2D5DA 3ONAB 5CV8A 1JICA 1UNSA 2D2CC 3HZXA 1Q12A 4A3KB 2AUKA 1EYDA 3KLRA 3K6OA 2NTTA 1STBA 3DHQA 3OWEB 3R2TA 1JORA 3C1FA 1GUSA 1NR4A 5LHY1 3MA2B 3M4OB 2Z8LA 1PZKD 3CRLC 5E3FA 1GXDC 1GUGA 3DWQA 1SDFA 4HCEA 1LTTD 2IL8A 4U673 1CFMA 3CHBD 3MXNA 1Y8PB 3OMCA 1MSGA 1X3PA 2MP1A 1EYCA 2RDGA 1TWGB 2TSSA 2KA7A 4KKTA 3TP6A 5D3DA 4S3SA 2O4XA 2KHSA 1G6ZA 2O5JC 1Q1EA 1KNAA 3JAML 3SVMA 2NBFA 3CQZB 3S15B 1D1IA 3U9OA 2EXZA 5DAUA 1R9TB 4A3EB 1IYVA 2KUMA 3FVQA 1EOTA 2DY7A 3K5OA 3NUCA 2RSOA 1EWHA 3GTOB 2WINB 5F2DA 1LV9A 2VXWA 2RQXA 4RKBA 3OOCA 5EQ0A 4B9WA 5AFWA 3VA5A 2BE5C 5JEAJ 5NUCA 2HQEA 4IURA 5J39A 2IPKD 2ZXRA 1E2ZA 1YNND 3FMCA 2R93B 1LTSD 1EU3A 1UEAB 5IGDA 1EY9A 4I7ZC 3H94A 3PUWA 4A3BB 2F0HA 2PW7A 2F0GA 4A3FB 5C3WA 2F1MA 3S17B 2WV6D 2SNSA 1IL8A 3J7AF 4IUNA 4IUTA 3GD7A 4V0BA 1O7ZA 5M9OA 4TRDA 5FK9C 3R2IA 1GJXA 4IFDI 4PNYA 2AQ3B 3PO3B 2LKVA 3A7AB 4EQNA 4U68A 4B08A 5G3LF 1ENAA 2EJMA 3SK6A 2A68D 3H09A 2K33A 2PMZB 1SNPA 1BR9A 4RCOA 1A3TA 1GUTA 2A6EC 2ID0A 1WTQA 2F03A 5IOCA 2F0IA 1QCBD 1CHQD 3VR3A 1DOMA 2GA4B 5HGTA 3RD4A 1V1OA 2XWBB 3J81E 1HHVA 2I07B 1FNUA 1SNCA 4AYBB 1DZ1A 4L8JA 1DONA 2XRSD 2RKSA 1Q8IA 3T16A 3C46A 1A6XA 1PTOF 5CBEE 3KBXA 2QF7A 1RD9D 5E1FA 1JQYD 2EYMA 3HS0C 2BA0A 4OO1I 2XSCA 1TIID 4O1NA 1UUPA 5BN4A 1K8OA 4FP5D 1SE4A 3KUPA 1LACA 1R4PB 2TMPA 3SE0A 1STEA 2X6LA 3KK7A 1I6HB 2Q8TA 4HTHA 2A6HD 3QIAA 2X6GA 4OIJA 2B2UA 3H6MA 4DFAA 2BDNA 1RCVD 4KN7C 2B2WC 1Q1BA 5D65A 1FYCA 1FR3A 4FF4A 3V2TA 3BYTB 1BXTA 1ZYRD 3EROA 1XWEA 4RHSA 5KNBA 3GTLB 1B44D 3HOUB 4G4KA 3KLSA 5I6WA 3Q24A 4NW2A 2K05A 1MI2A 3S1RB 5M3MB 4C1NK 4LK1C 3JAME 2A5HA 3BZDB 3K58A 3EQLC 3SK5A 2IT1A 1H9RA 1LT6D 3M3YB 3NBHA 2B2VC 1EWCA 4C3HG 4JK1C 3RLFA 1M8AA 3VR4A 5CR3A 1NCVA 1EQVA 3M4YA 4H13C 5CGKA 1TS4A 4BA1I 4K6LA 3BYYB 2ZXOA 5C44B 3M85A 1SJHD 4M8AA 5JVH3 2FINB 3K0YA 1L0YB 2FHTA 5KGUA 1PRTD 1K8MA 2MPMA 4IUUA 3EFXD 1HTPA 5T1GA 2IX1A 2JP1A 4KKSA 2KJXA 4BWGB 4QF4A 3SR1A 2MHVA 3NTIA 2RBMA 4QCLA 5DNFA 2G9HD 5C0XJ 1U9RA 2EYHA 1H9JA 1SMYD 1B9NA 2NN6I 4KD4A 2VNUD 2QKIC 3IAYA 4F88A 1CZWA 2AQ2B 2RVLA 2A69D 1Y1VB 4N9TA 5BN3A 1OO9B 3PUYA 3T51B 2F0TA 1K83B 1RHPA 4DAVA 4ULLA 3S16B 1EY6A 4RAUC 3IKJA 2F0OA 2B63B 4ZYSA 1IW7D 4K8IA 4CKCA 1KLUD 3I8ZA 3P1HA 3NTHA 4PMCA 4CJ1B 1GHJA 2JE6I 1ENCA 2R61A 4ZQ3A 3G6JB 2K04A 3H0GB 4DXGA 2IWHA 3ERQA 5HURA 3PIP3 1EQTA 1II3A 1ZYRC 3NWTA 2DNCA 4F8MA 2HDMA 2SNMA 1OXTA 5C0XI 1I3QB 5ELCA 2JA8B 3BVMA 5A35A 3FKIB 2L12A 2HDLA 1SYGA 3HG9A 5FO9B 4RA8A 1H9SB 4H7BA 1BDOA 1DXMA 4Y7NB 1I4GA 3MWYW 1ET9A 1PTOD 4O42A 4C3JB 3GTJB 1ZXTA 2M2LA 2KOLA 4G7HC 4PQXA 3DEPA 5IGGA 1NR2A 5KRUA 1SXTA 3PUVA 1EY8A 1Z6HA 2NVXB 2R6GA 4DF7A 2KECA 1EFID 1SYEA 2B2TC 2I46A 4K14A 4RGNA 2JA6B 3S1NB 2JYOA 3U9SA 3BS1A 4QMGA 1PTOH 1BBXC 1PRTC 2OXPA 1BQQT 3URYA 5KYLA 4JBWA 4HAEA 3A54A 1MGSA 1TU2B 3CU7A 4HEDA 3VR6A 1ONLA 4MIUA 3VYRA 5D3IB 3HRZC 1B4OA 3T56B 4ID6A 2K5DA 3S14B 5C3XA 2F3VA 1LTBD 1H9MA 1E2VA 1XXGA 5I2XA 3FDTA 1AP0A 2A69C 4IUVA 4QB4A 2XRQD 1DOLA 1F2LA 1PYWD 4CKBA 1V1PB 3A8KE 4ZK9B 5CORA 2OF1A 4XDXA 3NBIA 1IHZA 4TSSA 3NTKA 5M5WB 3D6CA 4BBRB 4XTCS 5IODA 3Q22A 2L5TA 1ILQA 3ND9A 4DN4M 3HEJA 1STGA 4QIWB 1EEFD 4R8IA 1U4RA 3QG1A 1CI3M 1SNQA 4ABNA 1H9SA 3NQTA 4UDUC 3TDQA 4C3IB 4DA2A 4ZRZA 5KNDA 3OW7A 1F9PA 1PTOC 4PMWA 3EVQA 4RFBA 2J0TD 4ZUIA 2PPBC 5CBAE 2D62A 2PZUA 3VA7A 3ZYYX 2M9VA 4A3IB 1JOQA 1KABA 4LAAA 3LWUA 2K03A 1QB5D 4IFDJ 4IQZA 3D6WA 3TP7A 3IL8A 1KDAA 1KDBA 4K5VA 2EE1A 5DM73 5C4HA 1STHA 1GUWA 5EPKA 4ODGA 5K36H 2EYPA 3K5MA 2DNEA 4N9PA 4KHVA 1F9QA 2AWOA 5D14A 1RDPD 4K5WA 1EIHA 4FO2A 1HA5A 2N55A 4BY7B 4LJZC 5EPJA 3SEBA 1PRTF 5EKKA 5C5MA 4KY5A 3NP8A 1CZGA 4KY6A 4BY1B 4XQNA 1AFPA 2K32A 4WRDA 1WTRA 1V1PA 3QJYA 2C9OA 2B2WA 5ELDA 2F0EA 5FKAC 4IN3A 3FPPA 1A3VA 2EDGA 5CV4A 3GTPB 2L11A 1NSNS 2FJ2A 1AN8A 2EOTA 2FMMA 1JOOA 1Y8NB 2EYJA 2F0KA 5IIFA 4FXKC 4A3MB 3I4LA 4DU9A 1D5ZC 2BCOA 2B2VA 1WD1A 5FLXL 3AMUA 2H1EA 5CV5A 2FFKB 2BDOA 2XVSA 3WDNA 2CW0D 2E2IB 2PNRC 1FD7D 1D6EC 1HFGA 2NN6G 3MTSA 3NSWA 5IT9L 4KKUA 3P7JA 2CVRA 3VYUA 2EYLA 2NVYB 2EYFA 1D2BA 5CV7A 5IGFA 1SJED 5JPNC 2EZVA 4YIJA 2NVQB 5A2QL 1CTMA 3HOVB 1BUVT 1PRTB 1SYBA 2X69A 4G7ZC 3MEHA 3J7AV 4A93B 2RA4A 3DUZA 3VYSA 2R7ZB 3TZUA 1HQRD 3IFTA 4XT1B 1HCZA 3P75A 3MXUA 2QDBA 1Q3LA 1X32A 3D3RA 2RDHA 2F0WA 4OGQC 5CYUA 2EYOA 2J7ZA 5KIXA 2N88A 1NUCA 4XIGS 3T13A 5C0XG 4CJ0B 2K28A 2VB2X 1WTVA 4NDXA 4XXEA 1WTOA 2PO4A 4NMZA 2F0UA 4K2KA 5FO7B 1G91A 5IGEA 1LT5D 3WOFA 1TR5A 1YNNC 2XN9C 3I72A 3T4AC 1CM9A 1ET6A 2F0JA 4ZKCB 3D4RA 3ITPA 1HQMC 1QG7A 4H0LC 2XIWA 3R8BA 3I4MB 1TT2A 3PIO3 4KJOA 1O7LA 4HN7A 1S5FD 1D1KA 3CKIB 2IX3A 4J8QA 4V190 3TP5A 1TVXA 3QWNA 3SK8A 4K8JA 2QILA 3TZDA 1ILPA 1Y8OB 2SOBA 3L3OC 3K5LA 5I9PA 3NWSA 1S4ZA 2DY8A 3PUXA 1ICWA 1BCPD 3I70A 3L7ZC 1U4LA 1Z47A 1QNKA 2A68C 2E2DC 2NZ1D 1DOKA 1PTOB 2L9HA 2SDFA 1BOSA 3C2PA 4HMIA 3M7GA 3X3NA 1WCMB 2ZT9C 1WTXA 2CW0C 3R93A 3HKZB 3OIPA 4IUPA 1DJRD 3GTKB 4DAYA 4MHEA 5CV9A 3KF8A 1RTNA 4E6IA 4K5XA 1QOHA 1BNZA 5KNCA 4LMQD 3N6RA 3SHLA 2AWNA 1CHPD 2XWJB 2V4DA 4BBSB 1EL0A 3Q6SA 4EQPA 1Y69U 1SAPA 2CHBD 1RF2D 4BS9A 2IW3A 2Z4IA 1WTWA 3OSOA 1KLGD 1STNA 3KBGA 1EY4A 5KYIA 3DEOA 2IX0A 2B39A 4RH6A 3NPPA 3QB3A 3TN2A 1EIGA 3TBIB 2L55A 4RGMA 5IT9E 1HUNA 1C4QA 3KLSX 2OT2A 1L0XB 2A6HC 4J1MA 3HOWB 1GOZA 1UAPA 2L0CA 3I4NB 1I4RA 4FNFA 2QEJC 1OXSC 1SEBD 1KTKA 1KNEA 1U4MA 4PV1C 2O5IC 5A2QE 2M00A 4KY7A 3MFYA 1EU4A 1SSOA 5CC4A 3Q23A 2RDFA 4C3HB 1PZID 3C3LA 1QNUA 4DK1A 2F0QA 1O78A 3A55A 4XQQA 3T53B 1TQOA 5C4JB 2E2JB 1BCPC 1JWMD 4FYDA 2Q8IB 1AW7A 1VF5C 1CA6A 4KHZA 2NN6H 4XYQA 1RJTA 1PFNA 2A73B 1X3QA 4Q5VA 4B9XA 5LL6S 3EA6A 1WVLA 1GUNA 1I4QA 5ISRA 2KCNA 5M5YB 2F0FA 3H91A 4X3UA 3D31A 5LL6X 5JVG3 2NB0A 3K7AB 1CK1A 3E0JA 2EY5A 5E4XA 1QE6A 3NHHA 4PMBA 1QILA 3I73A 1TWAB 3BVGA 1TWCB 4IFDG 1EY0A 5ELBA 4IUQA 2HCIA 1SMYC 3MZ5A 3HOXB 1D5XC 1PLFA 1WTPA 3J80L 4DXFA 1V43A 4EVOA 1O80A 1SYFA 3A8JE 1SFOB 4CJ2C 1I4PA 4R9WA 4IALA 1BO0A 2KVMA 2ZXPA 4XYOA 3GV3A 1DYQA 4DNTB 3N52A 2F3WA 1EY5A 1ZEQX 4KI0A 3MC0B 1OXXK 2B2YC 2LS01 5JEAG 1GUOA 1TS3A 3UI2A 1Y1WB 1IW7C 1JCKB 3PMFA 3AU7A 4A3JB 3VR5A 1S5ED 1MBYA 1I50B 1IYUA 2WIIB 4KMUC 2R92B 4HSPA 3X3MA 3MAQA 2PW5A 3QOLA 4EQOA 1F9SA 2PZWA 4FF1A 3GQBA 4KTAA 4ZUJA 1PZJD 3RZOB 5EJWA 2IJ0A 2F0VA 1XYIA 2NTSA 1R4QB 2MJ8A 4IZ8A 1B53A 3DXJC 4A3DB 1ESRA 5C6AA 1HXYD 3IFDA 3PUZA 1HPCA 4UAIA 4OO1G 5I9OA 1LTID 3I91A 5C5LA 3AB9A 1I4HA 2A6ED 3RMHA 1F77A 2A74C 2LFNA 5K5PA 3F2UA 2O2LD 2NUCA 2LMCB 5FOBB 5T1IA 3I90A 4FF2A 2R3ZA 1PFBA 1Q90A 1EY7A 3OIQA 2KQ3A 1HFNA 1LTGD 2K5WA 4MN3A 3SDZA 2WKDA 1BCPF 1JWUD 5IGBA 5I4DA 4KD3A 3K5NA 2XNAC 4BA2I 3BDCA 2F0PA 4R8NA 3BG3A 1SYDA 2EY1A 4DK0A 1TWFB 4G7OC 3S1QB 3CRKC 2NVTB 4OL7A 2PCFB 1F2ZA 4HCSA 1CA5A 1CQFA 4K6DA 4WFN3 2K6AA 1BF4A 5E4WC 4XT3B 2E75C 3QO2A 5KEEA 3PV0A 2PQEA 1STYA 4NP5A 4F87A 1W6JA 1EEID 3D4WA 5IGCA 2EY6A 5M3FB 2JXMB 3H3VC 2Z4HA 5TSSA 1YNJD 3VR2A 5C3EB 2EVBA 3MXGA 5JJZA 1AZQA 2NWGA 2DN8A 3SXHA 1VDZA 2B8GA 1MSHA 3DMUA 1LTAD 1HRJA 3NQIA 1FNWA 4H44C 4M1UB 1S5CD 2ICEC 4ME5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KKU A;  2JE6 I;  4JK1 C;  3RLF A;  1O7L A;  3VR4 A;  2D5D A;  3AB9 A;  2BE5 C;  2AUJ D;  2A69 C;  2A6E D;  2K7V A;  3M4Y A;  2JEA I;  4H13 C;  3P20 A;  2E76 C;  5K36 G;  3I73 A;  4BA1 I;  1H9K A;  1E2Z A;  1ZYR C;  2LMC B;  1A6X A;  3FMC A;  2DNC A;  2D2C C;  3A7L A;  4IFD G;  3A8K E;  1Y8O B;  1OXT A;  2QF7 A;  5K36 H;  3M85 A;  1DD2 A;  1Q90 A;  5A35 A;  4GZY C;  1Q12 A;  1SMY C;  2DNE A;  4I7Z C;  2A6H C;  3H94 A;  2B8F A;  3PUW A;  2AUK A;  1CTM A;  1G29 1;  2AWO A;  3HGB A;  4IQZ A;  1V43 A;  3A8J E;  3PUX A;  2EJG C;  1H9S B;  3KLR A;  3L7Z C;  1K8M A;  1YNJ C;  1BDO A;  1DXM A;  2BA0 A;  3SDZ A;  5JEA H;  4G7Z C;  4LJZ C;  2F1M A;  1LAB A;  2A68 C;  4DNR B;  1OXS C;  5BN4 A;  1HTP A;  3BDO A;  1K8O A;  4RCN A;  4XTC S;  4KKS A;  3GD7 A;  1VF7 A;  2L5T A;  1GHK A;  1GUS A;  3ND9 A;  4PV1 C;  4DNT B;  1LAC A;  2O5I C;  3CRL C;  2ZT9 C;  3SE0 A;  2CW0 C;  3TZU A;  4G7H C;  1GUG A;  3IFT A;  4BA2 I;  3MFY A;  1OXV A;  4KI0 A;  1GJX A;  2K32 A;  3BG3 A;  2JEB I;  1HCZ A;  3PUV A;  1OXX K;  3MXU A;  4KN4 C;  2KCC A;  5JEA G;  1GUO A;  1QJO A;  4DK0 A;  3QJY A;  1Z6H A;  1H9J A;  1CFM A;  4G7O C;  2A6H D;  1Y8P B;  2R6G A;  3CRK C;  3QIA A;  1IW7 C;  1B9N A;  4OGQ C;  2PCF B;  5BN5 A;  1VCI A;  2NN6 I;  1DCZ A;  3FPP A;  3A7A B;  4DK1 A;  2BA1 A;  1V8Q A;  3QG1 A;  2EDG A;  4XIG S;  3VR5 A;  5C0X G;  2EJM A;  2E75 C;  1CI3 M;  1O78 A;  2KA7 A;  4KKT A;  4KN7 C;  2A68 D;  2BE5 D;  1Q1B A;  2A69 D;  2K33 A;  1H9S A;  3T53 B;  1IYU A;  1B9M A;  1FYC A;  3U9S A;  1FR3 A;  1T5E A;  1TKW B;  3ND8 A;  5BN3 A;  4KMU C;  3PV0 A;  5KNC A;  5C0X H;  2O5J C;  3PUY A;  1Q1E A;  3T51 B;  1PMR A;  3N6R A;  1E2W A;  1I6V C;  2Q8I B;  4JBW A;  1GUT A;  1Y8N B;  2A6E C;  5KND A;  5KNB A;  4TQU S;  3OW7 A;  2V4D A;  1TU2 B;  1VF5 C;  4KHZ A;  2YYZ A;  2JXM B;  3VR6 A;  2NN6 H;  4OO1 H;  4HR7 B;  1ZKO A;  1YNN C;  3I4L A;  3IKJ A;  1ONL A;  3GQB A;  3I72 A;  3VR3 A;  1IYV A;  1IW7 D;  3OPO A;  1Y69 U;  3VR2 A;  1EWH A;  1Z7T A;  2EVB A;  4LK1 C;  2PPB C;  3M7N A;  1OXU A;  2D62 A;  1GUN A;  2EJF C;  4TKO B;  2DN8 A;  3T56 B;  3EQL C;  3NE5 B;  3VA7 A;  3DXJ C;  2IT1 A;  3D4R A;  1H9R A;  1HQM C;  1VDZ A;  4IFD H;  2B8G A;  2BDO A;  4H0L C;  3WDN A;  3PUZ A;  1GHJ A;  1HPC A;  3LNN A;  3LWU A;  4L8J A;  2PNR C;  1H9M A;  1E2V A;  2NN6 G;  3A8I E;  3D31 A;  3W3A A;  4H44 C;  4OO1 G;  3OOC A;  2E74 C; 
#chains in the Genus database with same CATH topology
 2UUB L;  3OHX C;  1A62 A;  1A3U A;  1A2U A;  1AEX A;  1JE4 A;  1VQ8 A;  3O13 A;  4JBJ A;  4AYB E;  5EBD A;  5ELE A;  4NXM Q;  3E6Z X;  1Y1W H;  1ESF A;  1E0B A;  5LMN Q;  3BVZ A;  2P5Z X;  3BDL A;  3M4Q A;  1DD2 A;  4A3J H;  5M5X B;  1GO3 E;  4Y52 H;  2MGS A;  3AEV A;  1RKN A;  1X56 A;  2UU9 L;  4HSV A;  1G29 1;  4J15 A;  4KJN A;  1BCP B;  3CW2 C;  3RUZ A;  1NMF A;  2A1A A;  3PO2 H;  1VQD A;  2IHE A;  3A56 A;  1JWS D;  3F8T A;  4OWT B;  1LAB A;  4Z9C B;  4JI5 L;  2CWP A;  4XQJ A;  3GTG B;  3NBH B;  4GKJ Q;  1GHK A;  1HH2 P;  5EPL A;  4OX9 L;  4HJA A;  4DGZ A;  5M3M G;  5EKL A;  3J80 E;  3V96 A;  2K1B A;  1OXV A;  4KV6 A;  1VQ9 A;  1JB3 A;  2F0S A;  3CCM A;  1Y14 B;  3RZO H;  2VUM B;  4KN4 C;  2KCC A;  2Q2T A;  1D5M C;  1VMP A;  4LNQ A;  2JQO A;  2E2H B;  1NY4 A;  1HA6 A;  1I5F A;  5JJI A;  1VCI A;  4X3K A;  5ELF A;  1V8Q A;  4F7X A;  3GP7 A;  4DKA C;  1KDC A;  1JC7 A;  4LF4 L;  2Z6B A;  1T5E A;  4LF5 Q;  3ND8 A;  3S2D B;  1VQH A;  3AYH B;  2F0D A;  4HMJ A;  4GOP C;  2D9U A;  2GN5 A;  1EZ8 A;  4YCU A;  5C4Z A;  2ENB A;  3M4O H;  1IBK Q;  1KAA A;  1FGB D;  3AFP A;  1PH2 A;  4DR4 L;  1VQM A;  1BBU A;  2F0M A;  3TSS A;  1DM0 B;  2V1C C;  5EGT A;  1F9R A;  3WOE A;  1U0L A;  2PNH A;  2K01 A;  3MXP A;  1MD2 D;  1TY2 A;  1E3P A;  1XTC D;  3TP8 A;  2EJF C;  1A8V A;  3G7L A;  3LWE A;  1LTR D;  2YU9 B;  5L37 A;  5IWA Q;  3K57 A;  1PDQ A;  4IFD H;  4DV1 L;  3LNN A;  1G2T A;  1XNR Q;  3A8I E;  4OHJ A;  2CQA A;  5DEH A;  3V05 A;  3I56 A;  5COY A;  2F4I A;  3S9W A;  1IKL A;  2AUJ D;  2K7V A;  3CQZ H;  1NBW A;  2PZT A;  1FJG L;  1H9K A;  4P2C B;  1TWF H;  3CF5 A;  1VMC A;  5GQO A;  3S1Q H;  4P74 A;  2NVT H;  5JPM C;  4GN5 A;  5EKI A;  1XNQ Q;  1X65 A;  1Y1V G;  3DWA A;  3GV6 A;  4FVM A;  2G5D A;  3KFU A;  4GZY C;  1I4X A;  1TXY A;  4WJW A;  1X6O A;  3GTO H;  4JI4 Q;  2KED A;  1XJV A;  1EUJ A;  5I2Y A;  1YNJ C;  5JEA H;  4OEL B;  2MUY A;  1VQ7 A;  5IYC H;  1ENF A;  2NYZ D;  3L9A X;  1JOK A;  3C1E A;  1TY0 A;  5HGQ A;  3RN2 A;  2Z6K A;  4G57 A;  4LUV A;  3LX0 A;  1A15 A;  2PYK A;  3AFQ A;  4QGU A;  1LT4 D;  4WOR A;  2L4N A;  2FMC A;  4X62 L;  3MFG A;  5C3E H;  3CCQ A;  4YWL A;  3W5O A;  3VYT A;  1G8Z D;  4DV2 L;  1SYC A;  3K81 C;  3K59 A;  5J1Z A;  4A3B H;  1C7Y A;  5C4X B;  1SNO A;  1G2S A;  2BA1 A;  4I65 A;  4L5T A;  1PXU A;  3H0G G;  4CBV A;  4FXD A;  1S3O A;  1VQE A;  2ZM6 L;  4X66 Q;  1WD0 A;  4KK7 A;  5DM6 3;  2JA5 B;  1PMR A;  2B2T A;  2JA8 G;  3GTM B;  4JI3 L;  2JN4 A;  5IP9 G;  3T1H Q;  4ZKB B;  4NXN Q;  1NAP A;  3FKI G;  4FXG C;  1FNV A;  4LF7 Q;  4OO1 H;  2Y0S E;  2DJF C;  3CME A;  3FPU B;  1SNM A;  1EOV A;  1VQO A;  2E5L Q;  3EJI A;  4JI2 L;  3G71 A;  3W1B A;  2SEB D;  4LF8 Q;  4C3J G;  2OCE A;  1I94 Q;  3NE5 B;  1HNW Q;  2N8N A;  4AQY L;  3GTG H;  2WAC A;  1LO5 D;  1B3A A;  4DK6 C;  4X3S A;  1PFS A;  2J4X A;  2E74 C;  1K28 A;  2VB3 X;  1QWY A;  1JR0 D;  4PZ8 A;  5EAY A;  2F4V L;  2F0N A;  3FRP B;  2JEA I;  4JOI A;  4MTK A;  4GNX C;  2VUM H;  3S2H B;  4IO9 A;  2KEE A;  3SK4 A;  5K36 G;  2EY2 A;  4RKL A;  2KBN A;  1HUM A;  4RHR A;  2JA6 G;  3DM1 A;  3FP9 A;  3W2D A;  5HY6 A;  4YHH Q;  3K0X A;  4CHT B;  2B8F A;  1XX8 A;  1EZ6 A;  3TME A;  1T5X D;  2ZJQ A;  4DR7 Q;  1CQV A;  2EJG C;  1YIJ A;  3G48 A;  1SRU A;  1Z9F A;  1ROD A;  1C8C A;  1IKM A;  3PF4 A;  2JA9 A;  2JK8 A;  4PZ6 A;  3DWP A;  4J6H A;  4K2L A;  3BDO A;  5FLX E;  1SE3 A;  1PFM A;  4JYA L;  1J8I A;  2DJG C;  3MVV A;  2JA7 B;  2B2Y A;  2H5X A;  3S1M B;  4QUF A;  1HTL D;  3QOJ A;  4A3L H;  1W6K A;  5FLM G;  2Y0S B;  3J80 i;  1LLR D;  4UP9 A;  4CGY B;  2JEB I;  1X9N A;  4IPG A;  4RGO S;  1M4V A;  1A63 A;  1TWH B;  1VQB A;  3BZC A;  5G3L D;  3OWF A;  5BN5 A;  2YU9 H;  1UE6 A;  3RZD B;  4BXX G;  2H4O A;  3GO5 A;  1K73 C;  2WB1 B;  3I3C A;  2OEO A;  1S5D D;  2B2U C;  3E5S A;  2I5H A;  3J81 i;  2Q8R E;  3D4D A;  3OYY A;  1TS2 A;  1I6V C;  1S5B D;  2ZTC A;  2UUA Q;  4TQU S;  1F2Y A;  3TEH B;  4C1N I;  4HR7 B;  3B6Y A;  2I0Q A;  1I6H H;  3OPO A;  2VQE L;  3GTQ B;  4BBR G;  1Z7T A;  1U5K A;  4TKO B;  4Q0F A;  1CT1 D;  3HOY B;  3MHB A;  5J22 A;  1SBB B;  1SND A;  4UY8 C;  3NK9 A;  4L63 B;  4A3K G;  2RHQ B;  3FEW X;  5LMN L;  2WKC A;  5CMD A;  2HCC A;  1EYA A;  1ICF B;  2WP8 J;  3P20 A;  2E76 C;  2HUG A;  1O7Y A;  3GTL H;  3Q0A A;  4IPH A;  4ZCK A;  3A7L A;  4JCV E;  4HJ9 A;  4DV4 L;  3HOZ B;  5I6Y A;  4DAP A;  2G9D A;  2MFI A;  4NB3 A;  1B1Z A;  3HP3 A;  4NKL A;  4C3I G;  3HGB A;  4GOP B;  4K0K L;  2K5Q A;  5EBC A;  3EIV A;  5CV6 A;  1ML0 D;  4C2M B;  4EGV A;  4CKE A;  3CC7 A;  4DNR B;  1AZP A;  4MZ9 A;  3OMG A;  2JA5 H;  1C48 A;  3PQI A;  4HID A;  4RCN A;  4ZLT F;  1YHB A;  1B7Y B;  1VF7 A;  2WFW A;  1HNX L;  1U4P A;  5JAV A;  1Q46 A;  1X55 A;  3PIO A;  5FLX c;  1GKH A;  2LY7 A;  1PHJ A;  5JOB A;  1QJO A;  2C5C A;  4A3I G;  4RWS C;  2AQ1 B;  4A3G B;  1STA A;  4FF3 A;  2BOS A;  2Z0S A;  2UXC Q;  5IT9 c;  2OQ0 A;  3EN2 A;  1JJ2 A;  2F0L A;  1JJG A;  1DCZ A;  4JI0 Q;  4ILW A;  2WAQ B;  2ICI A;  4OIK A;  4A3C G;  4L6T B;  2BE5 D;  2JSO A;  5H1S E;  1VQK A;  1IBK L;  3H15 A;  1B9M A;  3S24 A;  4C56 C;  1TKW B;  4RGT A;  4GKK Q;  5C0X H;  1S72 A;  2Z1C A;  3NXW A;  2KCT A;  1HR0 L;  2QCP X;  1SE2 A;  2A8V A;  1E2W A;  5FO8 B;  2KHI A;  3J81 L;  1LT3 D;  3R3O A;  2R7D A;  2YYZ A;  1B2T A;  1KRS A;  2K5V A;  1ZKO A;  3J7Z C;  1J5E L;  1RTO A;  1UWV A;  4POG A;  4ZAI A;  4QUC A;  3D8G A;  2EPB A;  2RSN A;  1B50 A;  1TS5 A;  3M7N A;  1OXU A;  1SMX A;  3J7Y W;  3PO2 B;  1F2M A;  4BY1 G;  2R93 G;  1J9O A;  4CDE C;  1PH8 A;  3W3A A;  1A2T A;  4JI7 Q;  3S1M H;  3W1G A;  2K4K A;  2L1B A;  4X3T A;  2D5D A;  4X64 L;  1K83 H;  2LSS A;  4P72 A;  3ONA B;  4IOC A;  3A0J A;  5CV8 A;  4A3F G;  1JIC A;  1UNS A;  2D2C C;  4LF6 Q;  3HZX A;  4JI1 Q;  2QW7 A;  1Q12 A;  4A3K B;  2B3G A;  2AUK A;  1EYD A;  5IE8 A;  2E8G A;  3HFZ B;  1P16 A;  3KLR A;  1VQA A;  3K6O A;  2NTT A;  1STB A;  1HZA A;  3DHQ A;  3OWE B;  3PO3 G;  1E7Z A;  3R2T A;  1JOR A;  4A3M G;  3C1F A;  1GUS A;  1NR4 A;  5LHY 1;  3MA2 B;  3M4O B;  2Z8L A;  1PZK D;  2L15 A;  3CRL C;  1PH4 A;  5E3F A;  1GXD C;  1GUG A;  3DWQ A;  1SDF A;  3H0G H;  3E0E A;  4HCE A;  1LTT D;  3T1Y Q;  4IOA A;  3UDI A;  2OWO A;  2IL8 A;  1SRO A;  3RLO A;  4U67 3;  1CFM A;  3CHB D;  3MXN A;  1Y8P B;  3STB D;  3OMC A;  2JA8 H;  1MSG A;  5IP9 H;  1X3P A;  2MP1 A;  1O7I A;  4X65 Q;  1IL2 A;  1EYC A;  2RDG A;  3FKI H;  1TWG B;  4DR6 L;  2TSS A;  2KA7 A;  4KKT A;  3TP6 A;  3GDE A;  5D3D A;  4B3R L;  4S3S A;  4GNX B;  3T1H L;  2O4X A;  1XMQ Q;  3OW2 A;  4DR2 L;  2KHS A;  1YZ6 A;  1G6Z A;  2O5J C;  1Q1E A;  3J7A 5;  4UP8 A;  1KNA A;  3JAM L;  3SVM A;  4C3J H;  2NBF A;  3CQZ B;  3S15 B;  2E5L L;  5IY0 A;  3HOZ H;  3HOV G;  1D1I A;  3U9O A;  3I55 A;  4LF8 L;  3K80 C;  2EXZ A;  5DAU A;  1R9T B;  3UDG A;  4A3E B;  3OTO Q;  1HNW L;  1IYV A;  2KUM A;  3FVQ A;  1EOT A;  2DY7 A;  3K5O A;  1MJE A;  3NUC A;  2RSO A;  2NVX H;  1EWH A;  1CKN A;  1GM5 A;  3GTO B;  4A93 G;  1G6P A;  4C2M H;  2WIN B;  5F2D A;  3M9B A;  2R7Z G;  4B3T Q;  1LV9 A;  1SLJ A;  2UXB Q;  3S1N H;  2VXW A;  4HJ8 A;  2RQX A;  4RKB A;  2Q2I A;  3OOC A;  5EQ0 A;  4B9W A;  2PMZ E;  5AFW A;  3VA5 A;  2BE5 C;  5JEA J;  1M90 C;  5NUC A;  2HQE A;  4IUR A;  5J39 A;  2IPK D;  2ZXR A;  4A3G H;  1E2Z A;  1YNN D;  3FMC A;  3MEF A;  2R93 B;  1LTS D;  4DR7 L;  1EU3 A;  1UEA B;  5IGD A;  1EY9 A;  4I7Z C;  3H94 A;  4YCW A;  3PUW A;  4A3B B;  4DV5 L;  5FLM H;  2F0H A;  1VQF A;  2PW7 A;  2F0G A;  4A3F B;  5C3W A;  2F1M A;  3S17 B;  2WV6 D;  1W3S A;  1IL8 A;  2SNS A;  3J7A F;  4IUN A;  1GVP A;  4IUT A;  3GD7 A;  4V0B A;  2QDL A;  2C35 B;  2MO0 A;  4BXX H;  1X3G A;  1O7Z A;  5M9O A;  4TRD A;  4JV5 Q;  5FK9 C;  3R2I A;  1GJX A;  2HT1 A;  4IFD I;  4L5S A;  2OTL A;  1N34 Q;  5BR8 Q;  2N78 A;  4PNY A;  1XMO L;  1X3F A;  2AQ3 B;  1JMC A;  4LFA L;  2VW9 A;  3I4M G;  3PO3 B;  2LKV A;  3A7A B;  2R7F A;  4EQN A;  4U68 A;  3BZK A;  5G3L F;  4B08 A;  3HOU G;  1ENA A;  2EJM A;  3SK6 A;  2A68 D;  3H09 A;  4B3S Q;  4H02 A;  2K33 A;  2PMZ B;  4DV6 Q;  5M5W H;  1SNP A;  1BR9 A;  4LFC L;  4RCO A;  1K0S A;  1A3T A;  1GUT A;  2A6E C;  2ID0 A;  1WTQ A;  2F03 A;  1AE3 A;  5IOC A;  2F0I A;  1QCB D;  1CHQ D;  4A3K H;  1WYD A;  3VR3 A;  1DOM A;  2GA4 B;  1KL9 A;  5HGT A;  3RD4 A;  2ATW A;  1PYB A;  1XPU A;  1V1O A;  3CPF A;  1CUK A;  2XWB B;  3J81 E;  1HHV A;  4DUY L;  1WCM G;  2I07 B;  1FNU A;  1SNC A;  3STB C;  4AYB B;  3KF8 B;  1DZ1 A;  5C44 G;  4L8J A;  1DON A;  2XRS D;  4GNX A;  3Q8D A;  2RKS A;  3G4S A;  1Q8I A;  3T16 A;  3CCJ A;  4C3I H;  3C46 A;  3KJO A;  1A6X A;  1PTO F;  1EWI A;  5CBE E;  3KBX A;  2QF7 A;  1RD9 D;  2VQF Q;  3CCE A;  5E1F A;  1TWG H;  1AH9 A;  1JQY D;  4L5Q A;  2EYM A;  3HS0 C;  1QZG A;  2CFM A;  3KF6 B;  2BA0 A;  4OO1 I;  1PVO A;  3E9I A;  2N49 A;  4A3I H;  2XSC A;  1TII D;  5IYD G;  4O1N A;  1FGU A;  1UUP A;  5BN4 A;  4BBS G;  1K8O A;  3S15 H;  4FP5 D;  1SE4 A;  1N33 L;  3KUP A;  1E22 A;  1LAC A;  2TMP A;  1R4P B;  1T9H A;  4R1J A;  1C9O A;  3SE0 A;  5IP7 H;  1IBM Q;  1STE A;  1R9T H;  2X6L A;  4A3E H;  3KK7 A;  4JI0 L;  1I6H B;  2Q8T A;  4HTH A;  1VQJ A;  2A6H D;  3QIA A;  4UHV A;  2X6G A;  4OIJ A;  4CDF C;  2B2U A;  3H6M A;  4JBK A;  4DFA A;  2BDN A;  1RCV D;  4JI8 L;  4KN7 C;  2B2W C;  2B63 G;  1Q1B A;  5D65 A;  1FYC A;  2KCM A;  1FR3 A;  4FF4 A;  3V2T A;  3BYT B;  1BXT A;  1ZYR D;  3ERO A;  3F1Z A;  1XWE A;  1PH9 A;  4BY1 H;  3HOW G;  4RHS A;  5KNB A;  3GTL B;  2R93 H;  3J80 c;  1B44 D;  3I4N G;  3HOU B;  1KIX A;  4G4K A;  3KLS A;  4NPS A;  5I6W A;  3Q24 A;  4NW2 A;  2K05 A;  3TRE A;  1MI2 A;  3S1R B;  2LXK A;  5M3M B;  4C1N K;  1VQG A;  4LK1 C;  1IZ6 A;  3JAM E;  2A5H A;  3BZD B;  1N32 Q;  3K58 A;  1VQ5 A;  4A3F H;  3EQL C;  3SK5 A;  5LMU L;  2UXD Q;  3S17 H;  2IT1 A;  4DUZ L;  1H9R A;  1LT6 D;  3M3Y B;  3GTP H;  3NBH A;  2B2V C;  1M1K C;  2KEN A;  1EWC A;  4C3H G;  4JK1 C;  3RLF A;  1M8A A;  3VR4 A;  5CR3 A;  1NCV A;  4DR1 Q;  4DV7 Q;  1EQV A;  3M4Y A;  4JI1 L;  4H13 C;  5CGK A;  1TS4 A;  4BA1 I;  4K6L A;  3PO3 H;  2UUC Q;  3BYY B;  4DPG A;  4A3M H;  4EX5 A;  2ZXO A;  5C44 B;  3M85 A;  4LF9 L;  1SJH D;  4M8A A;  5JVH 3;  2FIN B;  3K0Y A;  1K8G A;  3F2D A;  1L0Y B;  2FHT A;  5KGU A;  1PRT D;  1K8M A;  4HIM A;  4IPD A;  1IBL L;  2MPM A;  4IUU A;  4DK3 C;  3EFX D;  1HTP A;  4IPC A;  5T1G A;  1EQQ A;  2IX1 A;  4QQB X;  2JP1 A;  4KKS A;  2KJX A;  3T1Y L;  4IJL A;  4BWG B;  4YY3 Q;  4QF4 A;  2NVY H;  3SR1 A;  2MHV A;  4B3M Q;  3NTI A;  2RBM A;  4QCL A;  5DNF A;  2G9H D;  5C0X J;  1K9M C;  1N36 Q;  1V1Q A;  1NTG A;  1U9R A;  2EYH A;  1H9J A;  1VQC A;  1SMY D;  1B9N A;  1XMQ L;  2CQO A;  2NN6 I;  2VZA A;  4KD4 A;  2HIV A;  2VNU D;  2QKI C;  2QA4 A;  3IAY A;  3HOV H;  2CKZ B;  1B70 B;  4F88 A;  1CZW A;  2AQ2 B;  3DM3 A;  3ULP A;  1NJI C;  3PCO B;  2RVL A;  2A69 D;  1V9P A;  1Y1V B;  4N9T A;  2PI2 E;  5BN3 A;  1OO9 B;  3PUY A;  1KHI A;  3T51 B;  2F0T A;  1K83 B;  2YTY A;  4A93 H;  1RHP A;  3ZJY C;  4DAV A;  2R7Z H;  4GLA C;  3HOX G;  4ULL A;  1VQI A;  3S16 B;  1EY6 A;  2VL6 A;  4RAU C;  3QR8 A;  3IKJ A;  2F0O A;  2B63 B;  4P71 A;  4ZYS A;  1N8R C;  1PH5 A;  1IW7 D;  3CCU A;  4K8I A;  4CKC A;  1KLU D;  5GAH C;  3I8Z A;  3P1H A;  3NTH A;  4PMC A;  4CJ1 B;  1GHJ A;  5JJL A;  4DV0 Q;  5AJ3 Q;  2AMC B;  2HD3 A;  1L1O B;  2JE6 I;  1ENC A;  2R61 A;  4ZQ3 A;  3G6J B;  2K04 A;  3H0G B;  4DXG A;  2IWH A;  3ERQ A;  5HUR A;  3PIP 3;  1CSQ A;  1EQT A;  4A3J G;  1II3 A;  1ZYR C;  3NWT A;  1IXR A;  2DNC A;  4F8M A;  4JI5 Q;  2HDM A;  2SNM A;  1OXT A;  5GAE C;  5C0X I;  1I3Q B;  5ELC A;  1E1T A;  3BVM A;  2JA8 B;  1SE8 A;  5A35 A;  1Q81 C;  4JW0 A;  2Z6K C;  2R92 G;  4OX9 Q;  1HZC A;  3PGZ A;  3FKI B;  2L12 A;  2HDL A;  1SYG A;  3HG9 A;  5FO9 B;  4LUZ A;  4RA8 A;  1H9S B;  4H7B A;  4NXM L;  4GLX A;  1BDO A;  1DXM A;  1L2F A;  3CCR A;  4JV5 L;  4Y7N B;  1I4G A;  3MWY W;  4HIO A;  1ET9 A;  2I5L X;  3I4M H;  1PTO D;  4O42 A;  1N34 L;  4C3J B;  3GTJ B;  1ZXT A;  4MNO A;  2M2L A;  2KOL A;  1D8L A;  3KLW A;  3HOU H;  1IYJ B;  4G7H C;  3KJP A;  4PQX A;  1XTD A;  3DEP A;  3CC2 A;  5IGG A;  3S1R H;  1NR2 A;  5KRU A;  1SXT A;  3PUV A;  4LF4 Q;  5M3M H;  3H3V I;  4A3D G;  1EY8 A;  1Z6H A;  2NVX B;  3D0F A;  2R6G A;  4DF7 A;  4GKJ L;  2DUD A;  1EFI D;  2KEC A;  1SYE A;  2B2T C;  4DV6 L;  3F2C A;  2I46 A;  3M3Y H;  3FHW A;  4K14 A;  3G6E A;  4RGN A;  4GN3 B;  2JA6 B;  3S1N B;  2JYO A;  2N3S A;  3U9S A;  3BS1 A;  4QMG A;  1PTO H;  1BKB A;  1BBX C;  1PRT C;  5IYB G;  2OXP A;  1BQQ T;  3URY A;  5KYL A;  2NZO A;  4LUO A;  4JBW A;  1WCM H;  4HAE A;  3A54 A;  1MGS A;  1YBY A;  1TU2 B;  3CU7 A;  1XPO A;  4HED A;  3VR6 A;  5C44 H;  3CCV A;  1OTC A;  1FL0 A;  4QIW E;  4LF5 L;  1ONL A;  4R4O A;  3GTK H;  3LGJ A;  4MIU A;  3VYR A;  2PQA B;  5D3I B;  3HRZ C;  1B4O A;  3T56 B;  3JAM i;  4ID6 A;  2K5D A;  3S14 B;  5C3X A;  2F3V A;  1LTB D;  2ZTD A;  1H9M A;  1E2V A;  1XXG A;  4ALP A;  2BH2 A;  5I2X A;  1K3R A;  3FDT A;  1AP0 A;  1WTH A;  2A69 C;  4IUV A;  4QB4 A;  2XRQ D;  1DOL A;  1F2L A;  4BY7 G;  1PYW D;  5IWA L;  4CKB A;  4QL5 A;  1V1P B;  2YTV A;  2HHH Q;  1XNR L;  3A8K E;  4BBS H;  3NEL A;  1K8A C;  4ZK9 B;  5COR A;  2OF1 A;  4XDX A;  2AKW B;  2ALY B;  3NBI A;  3UE0 A;  4DR5 Q;  5IYC G;  1IHZ A;  3I2Z A;  4TSS A;  1Y1V H;  5JJK A;  2CWA A;  3NTK A;  4X62 Q;  5M5W B;  3D6C A;  1QUQ B;  4BBR B;  4MTN A;  3TS0 A;  2K14 A;  5M3F G;  1XNQ L;  4XTC S;  5IOD A;  3Q22 A;  2L5T A;  1ILQ A;  1P8L A;  3ND9 A;  4DV2 Q;  4DN4 M;  3S16 H;  1HR0 W;  4JI4 L;  1PYS B;  3HEJ A;  1STG A;  2B63 H;  4QIW B;  4OXP A;  1W2B A;  3EBE A;  1EEF D;  4DR3 Q;  4R8I A;  2MQH A;  4JI3 Q;  1U4R A;  3QG1 A;  3I4N H;  3CMA A;  3K8A A;  1VQL A;  1CI3 M;  1SNQ A;  4ABN A;  1H9S A;  1JT8 A;  5FJ8 G;  1NNX A;  2DGY A;  3NQT A;  4UDU C;  3TDQ A;  4C3I B;  4JI2 Q;  4DA2 A;  4ZRZ A;  2XGT A;  1YIT A;  5KND A;  3OW7 A;  1F9P A;  1PTO C;  1I3Q H;  3A74 A;  4AQY Q;  3J81 j;  1LUZ A;  1X3E A;  4PMW A;  4C3H H;  4X66 L;  2UXD L;  3EVQ A;  4A4I A;  4RFB A;  2J0T D;  4ZUI A;  4GOP A;  2F4V Q;  2PPB C;  5CBA E;  2D62 A;  2PZU A;  2NZH A;  3VA7 A;  4HIK A;  3ZYY X;  4Y7N H;  2M9V A;  4NXN L;  4A3I B;  4LF7 L;  4DV7 L;  1JOQ A;  1KAB A;  4LAA A;  1YJN A;  3LWU A;  3GTJ H;  1NE3 A;  1BBW A;  1QB5 D;  2K03 A;  4IFD J;  4IQZ A;  3D6W A;  2VUM G;  3TP7 A;  3IL8 A;  2E2J H;  1KDA A;  1KDB A;  1L0W A;  4K5V A;  2ZJR A;  2EE1 A;  5DM7 3;  1I94 L;  1B3Q A;  5C4H A;  1STH A;  1EFW A;  3A5Z B;  1EQR A;  1GUW A;  5EPK A;  4ODG A;  5K36 H;  2EYP A;  3K5M A;  2DNE A;  4N9P A;  4JYA Q;  4KHV A;  4PG3 A;  1F9Q A;  2JA6 H;  2PQA A;  2AWO A;  5D14 A;  1RDP D;  4K5W A;  1EIH A;  4FO2 A;  1WJJ A;  4RMF A;  2K52 A;  1HA5 A;  2N55 A;  2RCN A;  3F2B A;  4BY7 B;  4YY3 L;  1YVC A;  5GAG C;  4LJZ C;  3U58 A;  5EPJ A;  5M5Y H;  3SEB A;  1PRT F;  5EKK A;  2ES2 A;  4A3L G;  5C5M A;  4YHH L;  5GAD C;  3K7A H;  4KY5 A;  3NP8 A;  1CZG A;  1X54 A;  4KY6 A;  4BY1 B;  3K7U C;  3KOJ A;  4XQN A;  1AFP A;  2K32 A;  4WRD A;  1WTR A;  2K50 A;  4AH6 A;  1TWC H;  1V1P A;  3QJY A;  2C9O A;  4QY7 A;  4OWW B;  2B2W A;  2GVB A;  2EIF A;  5ELD A;  2F0E A;  5FKA C;  4IN3 A;  3HOX H;  3FPP A;  3S14 H;  1A3V A;  2EDG A;  5CV4 A;  1AE2 A;  3GTP B;  2L11 A;  1SFO H;  3SGI A;  3ICE A;  1QUQ A;  4I7A A;  1KC8 C;  4PZ7 A;  1NSN S;  2FJ2 A;  1AN8 A;  1L1O C;  2EOT A;  2FMM A;  1JOO A;  1Y8N B;  2EYJ A;  2F0K A;  5IIF A;  3RLN A;  4FXK C;  5E7N A;  4OEM B;  2K75 A;  4A3M B;  3CPW A;  3I4L A;  1KD1 C;  1KQS A;  4DU9 A;  1D5Z C;  1FVI A;  2BCO A;  2CH4 W;  4APV A;  4DV0 L;  5AJ3 L;  3KDF B;  2B2V A;  1WD1 A;  5FLX L;  3AMU A;  2H1E A;  2UUA L;  5CV5 A;  2GVA A;  4BBR H;  2FFK B;  2BDO A;  2XVS A;  3WDN A;  2CW0 D;  4P73 A;  2E2I B;  2PNR C;  1FD7 D;  1D6E C;  1HFG A;  1I50 H;  2NN6 G;  3MTS A;  3NSW A;  5IT9 L;  4DV4 Q;  4KKU A;  2R92 H;  3P7J A;  2CVR A;  3VYU A;  2EYL A;  2NVY B;  2EYF A;  4ME3 A;  1D2B A;  5CV7 A;  4K0K Q;  3DLL A;  5C4X G;  5IGF A;  1SJE D;  4DAY B;  5JPN C;  2Q2U A;  3UE1 A;  2EZV A;  3CC4 A;  4YIJ A;  2NVQ B;  5A2Q L;  1CTM A;  1HNX Q;  1BUV T;  3HOV B;  1PRT B;  3HKZ G;  1K0R A;  2JA5 G;  2EQS A;  2MNA A;  1LTL A;  1SYB A;  2X69 A;  4G7Z C;  4A3D H;  3MEH A;  3J7A V;  3AQQ A;  3UDX A;  4POF A;  4L5R C;  4A93 B;  2RA4 A;  3DUZ A;  5DLQ E;  4RG1 A;  3NEN A;  3VYS A;  1S40 A;  2R7Z B;  3TZU A;  1HQR D;  3IFT A;  4XT1 B;  1HCZ A;  3P75 A;  3MXU A;  2QDB A;  4AIM A;  1Q3L A;  1X32 A;  3D3R A;  5IYB H;  1Q82 C;  2RDH A;  4P75 A;  2F0W A;  4OGQ C;  1HR0 Q;  5CYU A;  2EYO A;  2J7Z A;  4EQ5 A;  5KIX A;  4KHP Q;  1YEZ A;  1NUC A;  2N88 A;  4XIG S;  3T13 A;  5C0X G;  5ELO A;  4CJ0 B;  2K28 A;  4DV3 Q;  2VB2 X;  4R4Q A;  1WTV A;  3U4Z A;  3M4P A;  4NDX A;  4A3C H;  4R4I A;  1J5E Q;  3I4O A;  4WJ4 A;  1HNZ Q;  2UXC L;  4XXE A;  1WTO A;  2PO4 A;  3NEM A;  4NMZ A;  1SR3 A;  2F0U A;  1VS0 A;  4K2K A;  1LM0 A;  5FO7 B;  1G91 A;  1G51 A;  2RHS B;  4JG2 A;  5IGE A;  1LT5 D;  3WOF A;  1TR5 A;  1YNN C;  1KXL A;  3HKZ E;  4GKK L;  2XN9 C;  3I72 A;  4JBM A;  3T4A C;  1CM9 A;  1ET6 A;  4X64 Q;  4BY7 H;  2F0J A;  3E9H A;  1N9W A;  4ZKC B;  2JA7 G;  3D4R A;  3ITP A;  1HQM C;  1QG7 A;  4H0L C;  2Y0S G;  2XIW A;  3R8B A;  2B29 A;  3I4M B;  1TT2 A;  1WI5 A;  3PIO 3;  4KJO A;  1O7L A;  4HN7 A;  1S5F D;  1YJ9 A;  2HHH L;  1D1K A;  1CKO A;  3CKI B;  2IX3 A;  4J8Q A;  4V19 0;  3TP5 A;  2D0P A;  1TVX A;  2WB1 G;  4DR5 L;  3QWN A;  3SK8 A;  4K8J A;  3A5U A;  2F3I A;  2QIL A;  3TZD A;  5M3F H;  1Y8O B;  1ILP A;  2SOB A;  3L3O C;  4JI7 L;  4CDC C;  4WJ3 M;  3K5L A;  5I9P A;  3KYH C;  4O0A A;  3NWS A;  1S4Z A;  3I7F A;  5J3B A;  1JJC B;  2DY8 A;  3KDF A;  1PA6 A;  3PUX A;  1ICW A;  1BCP D;  3I70 A;  3L7Z C;  4LFB Q;  1YJW A;  1U4L A;  1Z47 A;  3J81 c;  4JPB W;  1QNK A;  2A68 C;  4LF6 L;  2E2D C;  2NZ1 D;  1DOK A;  1PTO B;  2L9H A;  2SDF A;  3ULL A;  1BOS A;  3C2P A;  4HMI A;  4OWX B;  3M7G A;  2BH8 A;  3X3N A;  4JI6 Q;  2OTJ A;  1WCM B;  1YI2 A;  2ZT9 C;  1WTX A;  2CW0 C;  4UPA A;  3RNU A;  4DR6 Q;  3R93 A;  4DR3 L;  2YTX A;  3HKZ B;  3CXC A;  5FJ8 H;  3OIP A;  2FXQ A;  4B3R Q;  3HOY G;  4IUP A;  1DJR D;  4DR2 Q;  3GTK B;  4DAY A;  5M5X H;  1NMG A;  4TVA B;  4MHE A;  5CV9 A;  2CCZ A;  3KF8 A;  2E2I H;  5GRO A;  1RTN A;  4GS3 A;  4E6I A;  4K5X A;  1YHQ A;  1QOH A;  4DNI A;  1BNZ A;  5KNC A;  2KHJ A;  4LMQ D;  4YWK A;  2WB1 E;  3HOZ G;  3L2P A;  4X65 L;  1QZH A;  3N6R A;  1YNX A;  3SHL A;  1EIF A;  1J6Q A;  2AWN A;  1CHP D;  2XWJ B;  1ASY A;  2V4D A;  4BBS B;  1EL0 A;  1VQ6 A;  2NVQ H;  3Q6S A;  2LXJ A;  4EQP A;  1QVC A;  1VQ4 A;  1Y69 U;  1SAP A;  2E2H H;  2CHB D;  1WOC A;  1RF2 D;  4BS9 A;  3KF6 A;  2IW3 A;  2Z4I A;  1WTW A;  3OSO A;  2IY5 B;  2QGQ A;  1DGS A;  1KLG D;  1RL2 A;  1STN A;  1EYG A;  3KBG A;  3OTO L;  4A76 A;  2JJQ A;  3S2D H;  1EY4 A;  5KYI A;  3DEO A;  2IX0 A;  4A3G G;  2B39 A;  4DV5 Q;  4RH6 A;  3NPP A;  3QB3 A;  3TN2 A;  1EIG A;  1E1O A;  3TBI B;  2L55 A;  2Z9H A;  4B3T L;  2WAQ G;  4RGM A;  2UUB Q;  2UXB L;  5IT9 E;  1YHA A;  3RN5 A;  1HUN A;  1C4Q A;  3KLS X;  2OT2 A;  1L0X B;  1JE5 A;  2XTI A;  2A6H C;  4J1M A;  3HOW B;  1GOZ A;  1UAP A;  2L0C A;  3I4N B;  3BJU A;  3JAM c;  2K5H A;  1I4R A;  1JB7 A;  4FNF A;  1QVF A;  1D7Q A;  1Y1W G;  2QEJ C;  2UU9 Q;  1HZ9 A;  1OXS C;  1XMO Q;  1SEB D;  3TS2 A;  4LFA Q;  1E24 A;  5ELN A;  1KRT A;  1KTK A;  1KNE A;  1U4M A;  4PV1 C;  2O5I C;  5A2Q E;  2M00 A;  4KY7 A;  1VQP A;  3MFY A;  1EU4 A;  1SSO A;  5CC4 A;  3Q23 A;  2A19 A;  4LWC A;  3PO2 G;  2RDF A;  4C3H B;  1PZI D;  2K5N A;  3C3L A;  4LW1 A;  4LFC Q;  1Q8K A;  4UP7 A;  1PV4 A;  1UE1 A;  2HQL A;  1QNU A;  4DK1 A;  4YWM A;  4HJ7 A;  2F0Q A;  1O78 A;  3A55 A;  4XQQ A;  5BR8 L;  3T53 B;  1TQO A;  1UEB A;  5C4J B;  3TRZ A;  3E3X A;  1CSP A;  2E2J B;  1H95 A;  2WAQ E;  2AHO B;  1BCP C;  4JVZ A;  1JWM D;  4FYD A;  2Q8I B;  3UDF A;  1GD7 A;  1AW7 A;  1PH7 A;  4DUY Q;  1VF5 C;  1CA6 A;  4B3S L;  1VQN A;  4KHZ A;  2NN6 H;  4N8F A;  3ERS X;  1RJT A;  4XYQ A;  1PFN A;  2A73 B;  1X3Q A;  4Q5V A;  4B9X A;  1K3B C;  3WWV A;  5LL6 S;  4DR4 Q;  3MXN B;  3EA6 A;  4JC0 A;  1WVL A;  1GUN A;  1I4Q A;  4GLV B;  5ISR A;  2KCN A;  5C4X H;  5M5Y B;  2F0F A;  3H91 A;  4X3U A;  3D31 A;  5LMN W;  5LL6 X;  5JVG 3;  2NB0 A;  3K7A B;  1CK1 A;  3E0J A;  2EY5 A;  5E4X A;  4IJH A;  4DV1 Q;  2D0O A;  1XPR A;  3GTM H;  1QE6 A;  3NHH A;  4PMB A;  2F52 A;  2QEX A;  1QIL A;  3I73 A;  3CD6 A;  4CDD C;  1TWA B;  3BVG A;  1TWC B;  2MO1 A;  4IFD G;  3U4V A;  1EY0 A;  4JOI C;  3HKS A;  5ELB A;  1Q7Y C;  3CCS A;  4IUQ A;  2HCI A;  1FJG Q;  1SMY C;  2OQK A;  1N33 Q;  3MZ5 A;  3HOX B;  1D5X C;  1RIP A;  1PLF A;  1WTP A;  3J80 L;  4DXF A;  1V43 A;  1EIY B;  1CKN B;  4EVO A;  1O80 A;  1SYF A;  3A8J E;  4O2D A;  1SFO B;  4CJ2 C;  1I4P A;  5IP7 G;  4R9W A;  2VQF L;  4IAL A;  1BO0 A;  2KVM A;  2ZXP A;  4XYO A;  3GV3 A;  3VDY A;  3IRB A;  1DYQ A;  2HIX A;  4DNT B;  4A3E G;  3N52 A;  1CKM A;  1B8A A;  5IYD H;  2Q2H A;  2F3W A;  1EY5 A;  1ZEQ X;  4KI0 A;  2ZTE A;  3MC0 B;  4JI8 Q;  3S2H H;  3U50 C;  4YCV A;  1OXX K;  2B2Y C;  2LS0 1;  5JEA G;  1GUO A;  4GN4 B;  4KHP L;  1TS3 A;  3UI2 A;  3CAM A;  1Y1W B;  4DV3 L;  1IW7 C;  1JCK B;  3BU2 A;  1IBM L;  3PMF A;  3AU7 A;  4A3J B;  1HNZ L;  3VR5 A;  2CH4 A;  1S5E D;  1MKH A;  1MBY A;  1L1O A;  1I50 B;  1IYU A;  1MIU A;  3ULJ A;  2WII B;  4KMU C;  2R92 B;  5C3E G;  4X6A H;  4R4T A;  4HSP A;  3X3M A;  3H3V H;  1C0A A;  2JA7 H;  3MAQ A;  2PW5 A;  3QOL A;  2ZM6 Q;  5LMU Q;  4A3B G;  3PSI A;  4DUZ Q;  4EQO A;  1F9S A;  2PZW A;  2RCF A;  4FF1 A;  3GQB A;  3HOW H;  4KTA A;  4ZUJ A;  1PZJ D;  3RZO B;  1MJC A;  1TWH H;  2F0V A;  2IJ0 A;  5EJW A;  1XYI A;  2NTS A;  2PI2 A;  1R4Q B;  2MJ8 A;  4IZ8 A;  3RZD H;  1B53 A;  3DXJ C;  4A3D B;  1ESR A;  5C6A A;  1HXY D;  3IFD A;  3TQY A;  1PH6 A;  3PUZ A;  1HPC A;  4UAI A;  4OO1 G;  1PH1 A;  4A75 A;  5I9O A;  1LTI D;  3I91 A;  5C5L A;  4LF9 Q;  3AB9 A;  1I4H A;  1PH3 A;  2A6E D;  3RMH A;  1N32 L;  1F77 A;  1UE5 A;  2A74 C;  2LFN A;  1LYL A;  3F2U A;  5K5P A;  2O2L D;  2NUC A;  2LMC B;  5FOB B;  5T1I A;  3I90 A;  1IBL Q;  4FF2 A;  2YV5 A;  4FDB A;  4LFB L;  2R3Z A;  1PFB A;  1Q90 A;  3GTQ H;  2RF4 A;  4OON A;  4DR1 L;  1EY7 A;  3OIQ A;  2KQ3 A;  5C4J H;  1HFN A;  1LTG D;  2K5W A;  1HZB A;  2EXD A;  4JI6 L;  4MN3 A;  3SDZ A;  1QVG A;  3HOY H;  2WKD A;  2UUC L;  1BCP F;  1UE7 A;  2ASB A;  3JC6 6;  1JWU D;  3ER0 A;  5IGB A;  4HJ5 A;  5I4D A;  1HJP A;  1KAW A;  2I5M X;  4KD3 A;  3K5N A;  2IHF A;  2XNA C;  4N8X 1;  4BA2 I;  3BDC A;  2F0P A;  4R8N A;  1MHW C;  3BG3 A;  3L0O A;  1SYD A;  3CP0 A;  2EY1 A;  4DK0 A;  1Q86 C;  4AYB G;  1TWF B;  4G7O C;  3S1Q B;  3CRK C;  2NVT B;  4OL7 A;  3PIP A;  1A0I A;  1SN8 A;  2PCF B;  1F2Z A;  4HCS A;  1CA5 A;  1CQF A;  1WFQ A;  2VY3 A;  4K6D A;  4DAM A;  4WFN 3;  4B3M L;  2K6A A;  1BF4 A;  5E4W C;  4XT3 B;  2E75 C;  1N36 L;  3QO2 A;  1BVS A;  5KEE A;  4R4C A;  3PV0 A;  4QJF A;  2PQE A;  3RR5 A;  1STY A;  4NP5 A;  1TWA H;  4F87 A;  1W6J A;  2VS1 A;  4KLK A;  1EEI D;  3D4W A;  5IGC A;  2EY6 A;  5M3F B;  2JXM B;  3CCL A;  3H3V C;  2Z4H A;  3PF5 A;  5TSS A;  1YNJ D;  3VR2 A;  5C3E B;  2EVB A;  3MXG A;  5JJZ A;  1AZQ A;  2NWG A;  2DN8 A;  1ASZ A;  3SXH A;  1VDZ A;  2VQE Q;  2B8G A;  1MSH A;  3DMU A;  1LTA D;  1HRJ A;  3NQI A;  1FNW A;  2ZJP A;  4H44 C;  4M1U B;  1S5C D;  2ICE C;  4ME5 A; 
#chains in the Genus database with same CATH homology
 3OHX C;  1A3U A;  1A2U A;  1AEX A;  1JE4 A;  3O13 A;  5EBD A;  5ELE A;  3E6Z X;  1ESF A;  1E0B A;  3BVZ A;  3BDL A;  1DD2 A;  5M5X B;  2MGS A;  1RKN A;  4HSV A;  1G29 1;  4KJN A;  1BCP B;  3RUZ A;  3A56 A;  1JWS D;  1LAB A;  4Z9C B;  4XQJ A;  3GTG B;  1GHK A;  5EPL A;  4DGZ A;  5EKL A;  3J80 E;  3V96 A;  2K1B A;  1OXV A;  4KV6 A;  1JB3 A;  2F0S A;  2VUM B;  4KN4 C;  2KCC A;  1D5M C;  1VMP A;  2E2H B;  1HA6 A;  1VCI A;  4X3K A;  5ELF A;  1V8Q A;  4F7X A;  3GP7 A;  1KDC A;  1JC7 A;  1T5E A;  3ND8 A;  3S2D B;  2F0D A;  4HMJ A;  2D9U A;  1EZ8 A;  5C4Z A;  2ENB A;  1KAA A;  1FGB D;  2F0M A;  3TSS A;  1DM0 B;  5EGT A;  1F9R A;  3WOE A;  2K01 A;  3MXP A;  1MD2 D;  1TY2 A;  1XTC D;  3TP8 A;  2EJF C;  3G7L A;  3LWE A;  1LTR D;  2YU9 B;  3K57 A;  4IFD H;  1PDQ A;  3LNN A;  1G2T A;  3A8I E;  4OHJ A;  2CQA A;  5DEH A;  3V05 A;  5COY A;  2F4I A;  3S9W A;  1IKL A;  2AUJ D;  2K7V A;  2PZT A;  1H9K A;  4P2C B;  1VMC A;  5JPM C;  5EKI A;  3DWA A;  3GV6 A;  4FVM A;  4GZY C;  1I4X A;  4WJW A;  2KED A;  5I2Y A;  1YNJ C;  5JEA H;  2MUY A;  1ENF A;  2NYZ D;  3L9A X;  1JOK A;  3C1E A;  1TY0 A;  4G57 A;  3LX0 A;  1A15 A;  2PYK A;  1LT4 D;  4WOR A;  2L4N A;  2FMC A;  3MFG A;  3VYT A;  1G8Z D;  1SYC A;  3K59 A;  5J1Z A;  5C4X B;  1SNO A;  1G2S A;  2BA1 A;  4I65 A;  1PXU A;  4CBV A;  4FXD A;  1WD0 A;  4KK7 A;  5DM6 3;  2JA5 B;  1PMR A;  2B2T A;  3GTM B;  4ZKB B;  1NAP A;  4FXG C;  1FNV A;  4OO1 H;  3FPU B;  1SNM A;  3EJI A;  2SEB D;  4C3J G;  3NE5 B;  2WAC A;  1LO5 D;  1B3A A;  4X3S A;  2J4X A;  2E74 C;  2VB3 X;  1QWY A;  1JR0 D;  2F0N A;  3FRP B;  2JEA I;  3S2H B;  2KEE A;  3SK4 A;  5K36 G;  2EY2 A;  4RKL A;  4RHR A;  1HUM A;  3DM1 A;  3W2D A;  4CHT B;  2B8F A;  1XX8 A;  1EZ6 A;  3TME A;  1T5X D;  1CQV A;  2EJG C;  1ROD A;  1C8C A;  1IKM A;  3DWP A;  4J6H A;  4K2L A;  3BDO A;  5FLX E;  1SE3 A;  1PFM A;  1J8I A;  3MVV A;  2JA7 B;  2B2Y A;  3S1M B;  4QUF A;  1HTL D;  3QOJ A;  1W6K A;  2Y0S B;  1LLR D;  4CGY B;  2JEB I;  4RGO S;  1M4V A;  1TWH B;  5G3L D;  3OWF A;  5BN5 A;  3RZD B;  2H4O A;  3GO5 A;  2WB1 B;  3I3C A;  2OEO A;  1S5D D;  2B2U C;  3E5S A;  2Q8R E;  3D4D A;  1TS2 A;  1I6V C;  1S5B D;  4TQU S;  1F2Y A;  4C1N I;  4HR7 B;  3OPO A;  3GTQ B;  1Z7T A;  4TKO B;  4Q0F A;  1CT1 D;  3HOY B;  3MHB A;  5J22 A;  1SBB B;  1SND A;  3NK9 A;  4L63 B;  3FEW X;  2WKC A;  5CMD A;  2HCC A;  1EYA A;  2WP8 J;  3P20 A;  2E76 C;  2HUG A;  1O7Y A;  3Q0A A;  3A7L A;  3HOZ B;  5I6Y A;  4DAP A;  2G9D A;  1B1Z A;  3HP3 A;  4NKL A;  4C3I G;  3HGB A;  2K5Q A;  5EBC A;  5CV6 A;  1ML0 D;  4C2M B;  4EGV A;  4CKE A;  4DNR B;  1AZP A;  3OMG A;  1C48 A;  4RCN A;  4ZLT F;  1VF7 A;  1U4P A;  5JAV A;  2LY7 A;  5JOB A;  1QJO A;  2C5C A;  4RWS C;  2AQ1 B;  4A3G B;  1STA A;  4FF3 A;  2BOS A;  2F0L A;  1DCZ A;  4ILW A;  2WAQ B;  2ICI A;  4OIK A;  4L6T B;  2BE5 D;  2JSO A;  1B9M A;  4C56 C;  1TKW B;  4RGT A;  5C0X H;  2Z1C A;  3NXW A;  2QCP X;  1SE2 A;  1E2W A;  5FO8 B;  3J81 L;  1LT3 D;  3R3O A;  2YYZ A;  1B2T A;  1ZKO A;  1RTO A;  4ZAI A;  4QUC A;  3D8G A;  2EPB A;  2RSN A;  1B50 A;  1TS5 A;  3M7N A;  1OXU A;  3J7Y W;  3PO2 B;  1F2M A;  1J9O A;  3W3A A;  1A2T A;  2L1B A;  4X3T A;  2D5D A;  3ONA B;  5CV8 A;  1JIC A;  1UNS A;  2D2C C;  3HZX A;  1Q12 A;  4A3K B;  2AUK A;  1EYD A;  3KLR A;  3K6O A;  2NTT A;  1STB A;  3DHQ A;  3OWE B;  3R2T A;  1JOR A;  3C1F A;  1GUS A;  1NR4 A;  5LHY 1;  3MA2 B;  3M4O B;  2Z8L A;  1PZK D;  3CRL C;  5E3F A;  1GXD C;  1GUG A;  3DWQ A;  1SDF A;  4HCE A;  1LTT D;  2IL8 A;  4U67 3;  1CFM A;  3CHB D;  3MXN A;  1Y8P B;  3OMC A;  1MSG A;  1X3P A;  2MP1 A;  1EYC A;  2RDG A;  1TWG B;  2TSS A;  2KA7 A;  4KKT A;  3TP6 A;  5D3D A;  4S3S A;  2O4X A;  2KHS A;  1G6Z A;  2O5J C;  1Q1E A;  1KNA A;  3JAM L;  3SVM A;  2NBF A;  3CQZ B;  3S15 B;  1D1I A;  3U9O A;  2EXZ A;  5DAU A;  1R9T B;  4A3E B;  1IYV A;  2KUM A;  3FVQ A;  1EOT A;  2DY7 A;  3K5O A;  3NUC A;  2RSO A;  1EWH A;  3GTO B;  2WIN B;  5F2D A;  1LV9 A;  2VXW A;  2RQX A;  4RKB A;  3OOC A;  5EQ0 A;  4B9W A;  5AFW A;  3VA5 A;  2BE5 C;  5JEA J;  5NUC A;  2HQE A;  4IUR A;  5J39 A;  2IPK D;  2ZXR A;  1E2Z A;  1YNN D;  3FMC A;  2R93 B;  1LTS D;  1EU3 A;  1UEA B;  5IGD A;  1EY9 A;  4I7Z C;  3H94 A;  3PUW A;  4A3B B;  2F0H A;  2PW7 A;  2F0G A;  4A3F B;  5C3W A;  2F1M A;  3S17 B;  2WV6 D;  2SNS A;  1IL8 A;  3J7A F;  4IUN A;  4IUT A;  3GD7 A;  4V0B A;  1O7Z A;  5M9O A;  4TRD A;  5FK9 C;  3R2I A;  1GJX A;  4IFD I;  4PNY A;  2AQ3 B;  3PO3 B;  2LKV A;  3A7A B;  4EQN A;  4U68 A;  4B08 A;  5G3L F;  1ENA A;  2EJM A;  3SK6 A;  2A68 D;  3H09 A;  2K33 A;  2PMZ B;  1SNP A;  1BR9 A;  4RCO A;  1A3T A;  1GUT A;  2A6E C;  2ID0 A;  1WTQ A;  2F03 A;  5IOC A;  2F0I A;  1QCB D;  1CHQ D;  3VR3 A;  1DOM A;  2GA4 B;  5HGT A;  3RD4 A;  1V1O A;  2XWB B;  3J81 E;  1HHV A;  2I07 B;  1FNU A;  1SNC A;  4AYB B;  1DZ1 A;  4L8J A;  1DON A;  2XRS D;  2RKS A;  1Q8I A;  3T16 A;  3C46 A;  1A6X A;  1PTO F;  5CBE E;  3KBX A;  2QF7 A;  1RD9 D;  5E1F A;  1JQY D;  2EYM A;  3HS0 C;  2BA0 A;  4OO1 I;  2XSC A;  1TII D;  4O1N A;  1UUP A;  5BN4 A;  1K8O A;  4FP5 D;  1SE4 A;  3KUP A;  1LAC A;  1R4P B;  2TMP A;  3SE0 A;  1STE A;  2X6L A;  3KK7 A;  1I6H B;  2Q8T A;  4HTH A;  2A6H D;  3QIA A;  2X6G A;  4OIJ A;  2B2U A;  3H6M A;  4DFA A;  2BDN A;  1RCV D;  4KN7 C;  2B2W C;  1Q1B A;  5D65 A;  1FYC A;  1FR3 A;  4FF4 A;  3V2T A;  3BYT B;  1BXT A;  1ZYR D;  3ERO A;  1XWE A;  4RHS A;  5KNB A;  3GTL B;  1B44 D;  3HOU B;  4G4K A;  3KLS A;  5I6W A;  3Q24 A;  4NW2 A;  2K05 A;  1MI2 A;  3S1R B;  5M3M B;  4C1N K;  4LK1 C;  3JAM E;  2A5H A;  3BZD B;  3K58 A;  3EQL C;  3SK5 A;  2IT1 A;  1H9R A;  1LT6 D;  3M3Y B;  3NBH A;  2B2V C;  1EWC A;  4C3H G;  4JK1 C;  3RLF A;  1M8A A;  3VR4 A;  5CR3 A;  1NCV A;  1EQV A;  3M4Y A;  4H13 C;  5CGK A;  1TS4 A;  4BA1 I;  4K6L A;  3BYY B;  2ZXO A;  5C44 B;  3M85 A;  1SJH D;  4M8A A;  5JVH 3;  2FIN B;  3K0Y A;  1L0Y B;  2FHT A;  5KGU A;  1PRT D;  1K8M A;  2MPM A;  4IUU A;  3EFX D;  1HTP A;  5T1G A;  2IX1 A;  2JP1 A;  4KKS A;  2KJX A;  4BWG B;  4QF4 A;  3SR1 A;  2MHV A;  3NTI A;  2RBM A;  4QCL A;  5DNF A;  2G9H D;  5C0X J;  1U9R A;  2EYH A;  1H9J A;  1SMY D;  1B9N A;  2NN6 I;  4KD4 A;  2VNU D;  2QKI C;  3IAY A;  4F88 A;  1CZW A;  2AQ2 B;  2RVL A;  2A69 D;  1Y1V B;  4N9T A;  5BN3 A;  1OO9 B;  3PUY A;  3T51 B;  2F0T A;  1K83 B;  1RHP A;  4DAV A;  4ULL A;  3S16 B;  1EY6 A;  4RAU C;  3IKJ A;  2F0O A;  2B63 B;  4ZYS A;  1IW7 D;  4K8I A;  4CKC A;  1KLU D;  3I8Z A;  3P1H A;  3NTH A;  4PMC A;  4CJ1 B;  1GHJ A;  2JE6 I;  1ENC A;  2R61 A;  4ZQ3 A;  3G6J B;  2K04 A;  3H0G B;  4DXG A;  2IWH A;  3ERQ A;  5HUR A;  3PIP 3;  1EQT A;  1II3 A;  1ZYR C;  3NWT A;  2DNC A;  4F8M A;  2HDM A;  2SNM A;  1OXT A;  5C0X I;  1I3Q B;  5ELC A;  2JA8 B;  3BVM A;  5A35 A;  3FKI B;  2L12 A;  2HDL A;  1SYG A;  3HG9 A;  5FO9 B;  4RA8 A;  1H9S B;  4H7B A;  1BDO A;  1DXM A;  4Y7N B;  1I4G A;  3MWY W;  1ET9 A;  1PTO D;  4O42 A;  4C3J B;  3GTJ B;  1ZXT A;  2M2L A;  2KOL A;  4G7H C;  4PQX A;  3DEP A;  5IGG A;  1NR2 A;  5KRU A;  1SXT A;  3PUV A;  1EY8 A;  1Z6H A;  2NVX B;  2R6G A;  4DF7 A;  2KEC A;  1EFI D;  1SYE A;  2B2T C;  2I46 A;  4K14 A;  4RGN A;  2JA6 B;  3S1N B;  2JYO A;  3U9S A;  3BS1 A;  4QMG A;  1PTO H;  1BBX C;  1PRT C;  2OXP A;  1BQQ T;  3URY A;  5KYL A;  4JBW A;  4HAE A;  3A54 A;  1MGS A;  1TU2 B;  3CU7 A;  4HED A;  3VR6 A;  1ONL A;  4MIU A;  3VYR A;  5D3I B;  3HRZ C;  1B4O A;  3T56 B;  4ID6 A;  2K5D A;  3S14 B;  5C3X A;  2F3V A;  1LTB D;  1H9M A;  1E2V A;  1XXG A;  5I2X A;  3FDT A;  1AP0 A;  2A69 C;  4IUV A;  4QB4 A;  2XRQ D;  1DOL A;  1F2L A;  1PYW D;  4CKB A;  1V1P B;  3A8K E;  4ZK9 B;  5COR A;  2OF1 A;  4XDX A;  3NBI A;  1IHZ A;  4TSS A;  3NTK A;  5M5W B;  3D6C A;  4BBR B;  4XTC S;  5IOD A;  3Q22 A;  2L5T A;  1ILQ A;  3ND9 A;  4DN4 M;  3HEJ A;  1STG A;  4QIW B;  1EEF D;  4R8I A;  1U4R A;  3QG1 A;  1CI3 M;  1SNQ A;  4ABN A;  1H9S A;  3NQT A;  4UDU C;  3TDQ A;  4C3I B;  4DA2 A;  4ZRZ A;  5KND A;  3OW7 A;  1F9P A;  1PTO C;  4PMW A;  3EVQ A;  4RFB A;  2J0T D;  4ZUI A;  2PPB C;  5CBA E;  2D62 A;  2PZU A;  3VA7 A;  3ZYY X;  2M9V A;  4A3I B;  1JOQ A;  1KAB A;  4LAA A;  3LWU A;  2K03 A;  1QB5 D;  4IFD J;  4IQZ A;  3D6W A;  3TP7 A;  3IL8 A;  1KDA A;  1KDB A;  4K5V A;  2EE1 A;  5DM7 3;  5C4H A;  1STH A;  1GUW A;  5EPK A;  4ODG A;  5K36 H;  2EYP A;  3K5M A;  2DNE A;  4N9P A;  4KHV A;  1F9Q A;  2AWO A;  5D14 A;  1RDP D;  4K5W A;  1EIH A;  4FO2 A;  1HA5 A;  2N55 A;  4BY7 B;  4LJZ C;  5EPJ A;  3SEB A;  1PRT F;  5EKK A;  5C5M A;  4KY5 A;  3NP8 A;  1CZG A;  4KY6 A;  4BY1 B;  4XQN A;  1AFP A;  2K32 A;  4WRD A;  1WTR A;  1V1P A;  3QJY A;  2C9O A;  2B2W A;  5ELD A;  2F0E A;  5FKA C;  4IN3 A;  3FPP A;  1A3V A;  2EDG A;  5CV4 A;  3GTP B;  2L11 A;  1NSN S;  2FJ2 A;  1AN8 A;  2EOT A;  2FMM A;  1JOO A;  1Y8N B;  2EYJ A;  2F0K A;  5IIF A;  4FXK C;  4A3M B;  3I4L A;  4DU9 A;  1D5Z C;  2BCO A;  2B2V A;  1WD1 A;  5FLX L;  3AMU A;  2H1E A;  5CV5 A;  2FFK B;  2BDO A;  2XVS A;  3WDN A;  2CW0 D;  2E2I B;  2PNR C;  1FD7 D;  1D6E C;  1HFG A;  2NN6 G;  3MTS A;  3NSW A;  5IT9 L;  4KKU A;  3P7J A;  2CVR A;  3VYU A;  2EYL A;  2NVY B;  2EYF A;  1D2B A;  5CV7 A;  5IGF A;  1SJE D;  5JPN C;  2EZV A;  4YIJ A;  2NVQ B;  5A2Q L;  1CTM A;  3HOV B;  1BUV T;  1PRT B;  1SYB A;  2X69 A;  4G7Z C;  3MEH A;  3J7A V;  4A93 B;  2RA4 A;  3DUZ A;  3VYS A;  2R7Z B;  3TZU A;  1HQR D;  3IFT A;  4XT1 B;  1HCZ A;  3P75 A;  3MXU A;  2QDB A;  1Q3L A;  1X32 A;  3D3R A;  2RDH A;  2F0W A;  4OGQ C;  5CYU A;  2EYO A;  2J7Z A;  5KIX A;  2N88 A;  1NUC A;  4XIG S;  3T13 A;  5C0X G;  4CJ0 B;  2K28 A;  2VB2 X;  1WTV A;  4NDX A;  4XXE A;  1WTO A;  2PO4 A;  4NMZ A;  2F0U A;  4K2K A;  5FO7 B;  1G91 A;  5IGE A;  1LT5 D;  3WOF A;  1TR5 A;  1YNN C;  2XN9 C;  3I72 A;  3T4A C;  1CM9 A;  1ET6 A;  2F0J A;  4ZKC B;  3D4R A;  3ITP A;  1HQM C;  1QG7 A;  4H0L C;  2XIW A;  3R8B A;  3I4M B;  1TT2 A;  3PIO 3;  4KJO A;  1O7L A;  4HN7 A;  1S5F D;  1D1K A;  3CKI B;  2IX3 A;  4J8Q A;  4V19 0;  3TP5 A;  1TVX A;  3QWN A;  3SK8 A;  4K8J A;  2QIL A;  3TZD A;  1ILP A;  1Y8O B;  2SOB A;  3L3O C;  3K5L A;  5I9P A;  3NWS A;  1S4Z A;  2DY8 A;  3PUX A;  1ICW A;  1BCP D;  3I70 A;  3L7Z C;  1U4L A;  1Z47 A;  1QNK A;  2A68 C;  2E2D C;  2NZ1 D;  1DOK A;  1PTO B;  2L9H A;  2SDF A;  1BOS A;  3C2P A;  4HMI A;  3M7G A;  3X3N A;  1WCM B;  2ZT9 C;  1WTX A;  2CW0 C;  3R93 A;  3HKZ B;  3OIP A;  4IUP A;  1DJR D;  3GTK B;  4DAY A;  4MHE A;  5CV9 A;  3KF8 A;  1RTN A;  4E6I A;  4K5X A;  1QOH A;  1BNZ A;  5KNC A;  4LMQ D;  3N6R A;  3SHL A;  2AWN A;  1CHP D;  2XWJ B;  2V4D A;  4BBS B;  1EL0 A;  3Q6S A;  4EQP A;  1Y69 U;  1SAP A;  2CHB D;  1RF2 D;  4BS9 A;  2IW3 A;  2Z4I A;  1WTW A;  3OSO A;  1KLG D;  1STN A;  3KBG A;  1EY4 A;  5KYI A;  3DEO A;  2IX0 A;  2B39 A;  4RH6 A;  3NPP A;  3QB3 A;  3TN2 A;  1EIG A;  3TBI B;  2L55 A;  4RGM A;  5IT9 E;  1HUN A;  1C4Q A;  3KLS X;  2OT2 A;  1L0X B;  2A6H C;  4J1M A;  3HOW B;  1GOZ A;  1UAP A;  2L0C A;  3I4N B;  1I4R A;  4FNF A;  2QEJ C;  1OXS C;  1SEB D;  1KTK A;  1KNE A;  1U4M A;  4PV1 C;  2O5I C;  5A2Q E;  2M00 A;  4KY7 A;  3MFY A;  1EU4 A;  1SSO A;  5CC4 A;  3Q23 A;  2RDF A;  4C3H B;  1PZI D;  3C3L A;  1QNU A;  4DK1 A;  2F0Q A;  1O78 A;  3A55 A;  4XQQ A;  3T53 B;  1TQO A;  5C4J B;  2E2J B;  1BCP C;  1JWM D;  4FYD A;  2Q8I B;  1AW7 A;  1VF5 C;  1CA6 A;  4KHZ A;  2NN6 H;  4XYQ A;  1RJT A;  1PFN A;  2A73 B;  1X3Q A;  4Q5V A;  4B9X A;  5LL6 S;  3EA6 A;  1WVL A;  1GUN A;  1I4Q A;  5ISR A;  2KCN A;  5M5Y B;  2F0F A;  3H91 A;  4X3U A;  3D31 A;  5LL6 X;  5JVG 3;  2NB0 A;  3K7A B;  1CK1 A;  3E0J A;  2EY5 A;  5E4X A;  1QE6 A;  3NHH A;  4PMB A;  1QIL A;  3I73 A;  1TWA B;  3BVG A;  1TWC B;  4IFD G;  1EY0 A;  5ELB A;  4IUQ A;  2HCI A;  1SMY C;  3MZ5 A;  3HOX B;  1D5X C;  1PLF A;  1WTP A;  3J80 L;  4DXF A;  1V43 A;  4EVO A;  1O80 A;  1SYF A;  3A8J E;  1SFO B;  4CJ2 C;  1I4P A;  4R9W A;  4IAL A;  1BO0 A;  2KVM A;  2ZXP A;  4XYO A;  3GV3 A;  1DYQ A;  4DNT B;  3N52 A;  2F3W A;  1EY5 A;  1ZEQ X;  4KI0 A;  3MC0 B;  1OXX K;  2B2Y C;  2LS0 1;  5JEA G;  1GUO A;  1TS3 A;  3UI2 A;  1Y1W B;  1IW7 C;  1JCK B;  3PMF A;  3AU7 A;  4A3J B;  3VR5 A;  1S5E D;  1MBY A;  1I50 B;  1IYU A;  2WII B;  4KMU C;  2R92 B;  4HSP A;  3X3M A;  3MAQ A;  2PW5 A;  3QOL A;  4EQO A;  1F9S A;  2PZW A;  4FF1 A;  3GQB A;  4KTA A;  4ZUJ A;  1PZJ D;  3RZO B;  5EJW A;  2IJ0 A;  2F0V A;  1XYI A;  2NTS A;  1R4Q B;  2MJ8 A;  4IZ8 A;  1B53 A;  3DXJ C;  4A3D B;  1ESR A;  5C6A A;  1HXY D;  3IFD A;  3PUZ A;  1HPC A;  4UAI A;  4OO1 G;  5I9O A;  1LTI D;  3I91 A;  5C5L A;  3AB9 A;  1I4H A;  2A6E D;  3RMH A;  1F77 A;  2A74 C;  2LFN A;  5K5P A;  3F2U A;  2O2L D;  2NUC A;  2LMC B;  5FOB B;  5T1I A;  3I90 A;  4FF2 A;  2R3Z A;  1PFB A;  1Q90 A;  1EY7 A;  3OIQ A;  2KQ3 A;  1HFN A;  1LTG D;  2K5W A;  4MN3 A;  3SDZ A;  2WKD A;  1BCP F;  1JWU D;  5IGB A;  5I4D A;  4KD3 A;  3K5N A;  2XNA C;  4BA2 I;  3BDC A;  2F0P A;  4R8N A;  3BG3 A;  1SYD A;  2EY1 A;  4DK0 A;  1TWF B;  4G7O C;  3S1Q B;  3CRK C;  2NVT B;  4OL7 A;  2PCF B;  1F2Z A;  4HCS A;  1CA5 A;  1CQF A;  4K6D A;  4WFN 3;  2K6A A;  1BF4 A;  5E4W C;  4XT3 B;  2E75 C;  3QO2 A;  5KEE A;  3PV0 A;  2PQE A;  1STY A;  4NP5 A;  4F87 A;  1W6J A;  1EEI D;  3D4W A;  5IGC A;  2EY6 A;  5M3F B;  2JXM B;  3H3V C;  2Z4H A;  5TSS A;  1YNJ D;  3VR2 A;  5C3E B;  2EVB A;  3MXG A;  5JJZ A;  1AZQ A;  2NWG A;  2DN8 A;  3SXH A;  1VDZ A;  2B8G A;  1MSH A;  3DMU A;  1LTA D;  1HRJ A;  3NQI A;  1FNW A;  4H44 C;  4M1U B;  1S5C D;  2ICE C;  4ME5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...