1BDOA

Structure of the biotinyl domain of acetyl-coenzyme a carboxylase determined by mad phasing
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
80
structure length
80
Chain Sequence
EISGHIVRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEAMKMMNQIEADKSGTVKAILVESGQPVEFDEPLVVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the biotinyl domain of acetyl-coenzyme A carboxylase determined by MAD phasing.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords ACETYL-COA CARBOXYLASE
total genus 14
structure length 80
sequence length 80
ec nomenclature ec 6.4.1.2: Acetyl-CoA carboxylase.
pdb deposition date 1995-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1bdoA00
3AB9A 1VF7A 1H9SB 2B8GA 1CFMA 2E76C 3PUVA 3A7AB 5K36G 2EJMA 2IT1A 3VR6A 2BA1A 1Q1EA 3PUWA 3IFTA 3M7NA 1SMYC 3M85A 4IFDH 2K7VA 4LJZC 1HTPA 1CI3M 3EQLC 4IFDG 2BA0A 1BDOA 3I72A 3WDNA 1HCZA 3QIAA 1ZYRC 2A68C 3I4LA 1H9JA 2E74C 1H9SA 2D62A 3FMCA 1EWHA 4G7HC 1GUSA 3PUXA 1A6XA 2D2CC 2NN6G 4G7OC 3DXJC 1ONLA 2YYZA 1PMRA 1E2ZA 4I7ZC 4JBWA 5C0XH 1GUTA 2BDOA 2BE5D 4IQZA 3HGBA 4OGQC 1Q90A 3QJYA 4OO1G 3NE5B 1Y8OB 3ND8A 1H9KA 3A8KE 1HPCA 2F1MA 2JE6I 2KCCA 1B9NA 3I73A 4KKTA 3OW7A 1TKWB 4KN4C 5K36H 4H13C 4XIGS 3VR4A 1VF5C 3P20A 5KNBA 2KA7A 3FPPA 4KMUC 4XTCS 2O5IC 2O5JC 2A6ED 4LK1C 1IYVA 1B9MA 3VA7A 3CRKC 3RLFA 3W3AA 1Y69U 1Q12A 1IYUA 1G291 1GUOA 1Y8PB 2QF7A 3MXUA 2AUJD 3VR3A 2E75C 1V43A 1VDZA 1IW7D 1O78A 2EJFC 3BDOA 1I6VC 4JK1C 4OO1H 3D4RA 3ND9A 1H9MA 1OXVA 2PPBC 3PV0A 5BN4A 3QG1A 4TQUS 2EDGA 3GQBA 3VR2A 1YNNC 1OXSC 2K32A 4L8JA 3H94A 4H0LC 2EJGC 4RCNA 3N6RA 2NN6H 3SDZA 1CTMA 5BN5A 4KHZA 2JEAI 1OXTA 1FR3A 1GHKA 4KKUA 4GZYC 2A68D 1Y8NB 2A69D 3D31A 5BN3A 1GUGA 5A35A 3OPOA 1T5EA 2A69C 4BA1I 1O7LA 2V4DA 3KLRA 2DN8A 3T53B 2Q8IB 3CRLC 4DK1A 1K8OA 1E2WA 1LABA 4BA2I 3PUYA 1H9RA 1Z7TA 5JEAH 5KNCA 1E2VA 1GJXA 2DNEA 3PUZA 3A8JE 2K33A 1K8MA 3U9SA 2PCFB 1HQMC 4DK0A 1OXXK 2AUKA 2CW0C 3L7ZC 5KNDA 2DNCA 4DNTB 2A6EC 3TZUA 1DD2A 3A8IE 3SE0A 1OXUA 3LNNA 1GUNA 3GD7A 1YNJC 2A6HC 2EVBA 2R6GA 3OOCA 4KN7C 3VR5A 2LMCB 1Z6HA 2NN6I 3M4YA 4KKSA 4DNRB 3MFYA 1TU2B 4TKOB 1VCIA 1LACA 1GHJA 2BE5C 2D5DA 2PNRC 2JEBI 2ZT9C 4HR7B 5C0XG 2A6HD 2AWOA 3LWUA 5JEAG 1QJOA 1DCZA 1Q1BA 2L5TA 3T56B 4G7ZC 1ZKOA 2JXMB 4H44C 4KI0A 4PV1C 1IW7C 3IKJA 1FYCA 3BG3A 2B8FA 3T51B 1V8QA 3A7LA 1DXMA
chains in the Genus database with same CATH superfamily
4QIWB 1ET6A 2B2WA 2NZOA 3OWFA 1I50H 4GN4B 2UXDL 1XNRQ 2N3SA 2WB1G 2F0MA 3IL8A 4MIUA 1B50A 5C6AA 3A55A 1NE3A 2A68C 1BCPD 2M9VA 5HGTA 2F3IA 1SE2A 2DY7A 3PUXA 4A93B 4N8FA 1E24A 4XT3B 4ZK9B 2BDOA 2E8GA 1Y14B 3I4NH 3NE5B 4J15A 3S2HH 4JV5L 4JPBW 2K14A 1SNOA 4A93G 5IT9E 3GTKB 3OW7A 1DOLA 5K36H 1KQSA 4Y52H 3VR4A 4RKBA 2B63H 3HOZG 3BU2A 4MTKA 2QF7A 3NELA 1MGSA 1SE3A 2H5XA 3PIOA 5GROA 1AN8A 1IYJB 4IUTA 2NUCA 1OXVA 4QB4A 2PPBC 2F0LA 3S1RB 3I55A 1SYCA 4JI5Q 2N8NA 2EIFA 4IN3A 4QF4A 1Q7YC 3EVQA 1ML0D 3HOXG 4JI7L 3GTOB 1JWMD 2VW9A 1R9TB 4K5WA 3GP7A 4HN7A 5IT9c 4R1JA 4C2MH 5T1GA 1P8LA 4HJ5A 5BR8Q 4HJ9A 3S16B 2A68D 2A69D 1BCPC 3NPPA 1D8LA 1EZ8A 3J80i 4GLAC 5A35A 2VB3X 1YIJA 4OWXB 4DKAC 2EYJA 2IX0A 2SOBA 1C7YA 3PQIA 4BBSB 1P16A 4LWCA 1WTRA 4IALA 3PIO3 4FP5D 3S15H 1I6HH 1V1OA 3HFZB 3Q8DA 4LFAL 3M4OH 1V9PA 4I7AA 3A8JE 2K33A 2PCFB 1OXXK 2CW0C 2B2UC 1SNMA 3MC0B 5M3MG 1GUNA 3GD7A 5JPNC 4FXKC 2RSNA 3P1HA 2YTYA 3T16A 4HJAA 4KKSA 4KK7A 4DV2L 1IBKQ 1TS5A 1EU3A 4R4CA 3HKZG 2RDFA 4JOIC 3GV6A 5EKKA 1FGUA 1KABA 1OTCA 3ICEA 3KLWA 3CF5A 1TQOA 2PQAB 1S5BD 2HUGA 2OTLA 1AH9A 2CH4W 2JA8H 4CJ1B 1V8QA 2CFMA 2CWPA 1PA6A 1WJJA 5JPMC 3FKIG 3FHWA 1RKNA 1PH3A 1YZ6A 3HKZE 5C44B 2RVLA 3J81E 4CDDC 4IFDG 2A19A 4G4KA 4R4QA 1RTOA 4DV4L 1VQLA 1ZXTA 1UE5A 2K03A 2NVYB 1MSGA 1EWHA 4G7HC 1QB5D 2LY7A 1TS3A 1MD2D 3QJYA 4L6TB 4IURA 2N88A 3A0JA 3TP7A 2PW5A 4XIGS 1VF5C 3P20A 3OMCA 3CMAA 4A3GG 2O5IC 2ZTDA 1NUCA 2Y0SE 4RGNA 3J81c 4YHHQ 4TVAB 5LMUL 3PCOB 5EPJA 3EIVA 2C9OA 2F0OA 1RTNA 2UXBL 3ERQA 3BJUA 1I4XA 4JI0L 2HCIA 3HOYH 2F0KA 2RHQB 4QQBX 1HXYD 4H0LC 1PH1A 4RCNA 4K5XA 2NVXH 3VDYA 4A3MH 4LF4Q 2PNHA 4KHZA 1GHKA 1C9OA 2OCEA 4IFDJ 5C3EH 1IXRA 2K5QA 4A3JB 4FF1A 5C0XJ 2PMZE 4K6DA 2JA6G 2EYLA 2Y0SB 3MVVA 2Q8IB 4JBKA 2Q2UA 2HIVA 3R2TA 5A2QE 1H9RA 5JEAH 3AU7A 3LWEA 4A3GB 1HZCA 3X3MA 2JP1A 3HOVG 5EKIA 2O2LD 3H09A 3T1HQ 1W6KA 3J80E 4RG1A 2F0QA 1MBYA 3LNNA 5E4WC 5CC4A 1UE1A 4DAYB 2L1BA 1Q8KA 2GN5A 1UAPA 1CKNB 4QY7A 3AQQA 3GTGB 2EY5A 2BE5C 2A6HD 4A3GH 4A3KG 1PZID 1DCZA 3JC66 2KHIA 1RODA 2JXMB 4ZKCB 3DM3A 1WTVA 1F2ZA 2B8FA 3EBEA 4XQQA 2B2VA 1AEXA 1PRTC 3UDXA 1QVFA 4OEMB 2EJMA 5IP7H 2ZM6L 3M7NA 1JJ2A 1RL2A 4AYBE 3U9OA 3KF6B 3NK9A 3TS0A 3QIAA 4JI5L 3S14B 1CKOA 4YCUA 3CU7A 4QMGA 1SLJA 1H9SA 2L15A 5M3MB 2BE5D 4OGQC 1BXTA 2IPKD 3GTQB 4L63B 1VQ5A 2F1MA 2JN4A 1FVIA 3KF6A 1S40A 3RR5A 1HHVA 1SRUA 4HMJA 4DV2Q 4KMUC 3BZKA 2VB2X 4O42A 2MUYA 2NVTH 5EBCA 1EYGA 5IGCA 1VS0A 2B2YA 4PMBA 4DK6C 1PTOH 1V43A 1Y1VB 1ET9A 1VQBA 1DOMA 3ND9A 3AMUA 1RHPA 1QOHA 2NVQH 2VUMG 4R8NA 3NUCA 2DJGC 4BY1B 3A5ZB 5D65A 2JYOA 3KBXA 2UUAQ 1Y1WB 3K5MA 2NVTB 3I4OA 4TSSA 1VQOA 3U58A 2VUMB 3C3LA 2HQLA 1TS4A 4O2DA 4X65Q 5M9OA 3OPOA 3J7YW 1T5EA 4DAPA 4DV6Q 2RA4A 1QCBD 3UDGA 1GOZA 1IHZA 3RZOB 1STYA 3MXNA 1KD1C 1A3UA 2DY8A 4OWTB 3UE1A 1LABA 4N9TA 2ZXPA 4L5SA 1EY8A 5FJ8H 1PH4A 1GJXA 2PO4A 4DR4L 2Z1CA 5EBDA 3NSWA 3A8IE 1GO3E 3SE0A 5DM73 1CA5A 5C4JH 5M5XB 5M3FH 1R4PB 4B3TL 1R4QB 4HR7B 3RD4A 5DAUA 3PO2G 3HS0C 4BBRB 1QJOA 3H3VH 3F2BA 3SHLA 3OTOQ 5GAHC 2MFIA 4P71A 1TWHH 4A3LH 1FGBD 3S1QH 1LTID 4ME5A 1VQ6A 3WOEA 4C56C 2XRSD 2V1CC 2F0GA 3HOUH 2KBNA 5IYCH 3T1HL 1SJHD 3NBHB 4DV7Q 3HOVB 1I3QB 5FLXL 3I4MB 1SNQA 1NAPA 2KJXA 3RLOA 1JMCA 1MKHA 4A3IG 1AFPA 1LM0A 5ELOA 4DUZQ 4FF3A 2NYZD 2YYZA 4RH6A 2KCTA 1C0AA 4QCLA 3HOUB 4DA2A 3CW2C 4DR1Q 5FK9C 2X6GA 3MA2B 4IUNA 4XTCS 5CR3A 3CCEA 1B53A 2MNAA 1EZ6A 2SNSA 1Y69U 1Q12A 2BH8A 2RDGA 4IJHA 4CDEC 2JA6B 4LUVA 5FO8B 3CCJA 2R92H 1M4VA 4OX9L 3KLSA 4B9XA 3GQBA 1DOKA 3MAQA 4FXDA 2FMMA 4OWWB 4IOCA 3I4MG 1TWCB 5BN5A 3TEHB 3CMEA 3CP0A 3NWTA 1NNXA 1CZWA 1EQVA 4BY7B 1MSHA 4C3JH 4Y7NB 1UEAB 2L4NA 4RA8A 2FXQA 4NXMQ 3UI2A 3I4NB 4X3TA 1EEFD 3ZJYC 5JJLA 3DHQA 1X3GA 2JK8A 3FKIH 3L3OC 1Y1VH 2JA9A 1X3QA 1E2VA 3HEJA 4A3MG 4IPGA 1PLFA 5CV4A 1VQDA 4B3SQ 4Y7NH 5A2QL 2HT1A 1S5CD 1E1OA 2A6HC 3NHHA 4EQOA 5IGBA 5IOCA 3M4YA 4O1NA 2PQEA 2ZT9C 4RMFA 3NTKA 3M4QA 3D3RA 3T56B 3RMHA 4LNQA 3CCLA 3S24A 4QUCA 3E3XA 2Q2TA 3A74A 3HOWH 3M4PA 2H4OA 1LYLA 4L5RC 4DR7Q 5COYA 1DXMA 4JI2L 1LV9A 3S1RH 1JOKA 1IKMA 4XQNA 4JOIA 1ZEQX 3PUWA 4R9WA 5FJ8G 4GOPA 1U0LA 3VA5A 2Q8TA 1ZYRC 5C3WA 2GA4B 3I4LA 4X66Q 3I8ZA 2RCNA 4BY1G 2JJQA 1JWUD 3F2DA 1T9HA 2MGSA 4IQZA 3QOJA 3RNUA 2B2UA 2RQXA 4H7BA 3PO3G 1HPCA 4A3BH 4IOAA 3FVQA 5FLMH 2KECA 1YITA 3ULJA 3JAME 1JE5A 2UUBL 4K2LA 3HOXB 2HD3A 5C4HA 3Q22A 4BBSG 4IJLA 3QO2A 2WIIB 4X3KA 3D6CA 2KOLA 2RKSA 2HIXA 1H9MA 3ONAB 1Y1VG 3PF5A 2YTVA 2EDGA 4XXEA 2MQHA 1SFOB 1LT3D 1PFSA 1N34L 4EQNA 2J4XA 4PZ6A 2E2HB 4DXGA 1KTKA 4X62L 2IY5B 4JI1Q 1A2TA 2SNMA 4BWGB 2B2VC 1WCMG 2BOSA 2IHFA 1XYIA 1E22A 3AEVA 1STHA 3HZXA 4K14A 4JI8L 1N34Q 4MHEA 2VQEQ 5I9PA 4WJWA 4AQYQ 1WTOA 2DNEA 2HHHL 1HFNA 3L9AX 3W1BA 1VQEA 4A3JH 1NMGA 4KY6A 3FEWX 2CVRA 1A0IA 2K75A 2EVBA 3F2CA 3GTPB 4PNYA 1LTBD 1VCIA 4K2KA 2D5DA 5LMNL 1B3AA 3D6WA 3I7FA 1G6ZA 3RN2A 2F0VA 2EXDA 4A3MB 1UEBA 2ES2A 1X54A 4H44C 3K81C 1YI2A 2C35B 4DV4Q 4ZCKA 1EQTA 2B2WC 2ZTCA 1PYBA 1SN8A 4DN4M 3J81L 4WORA 4GKKL 3I4NG 1ESRA 2UXCL 1EY7A 5FO9B 1TWFB 5IWAL 5AJ3L 1S72A 5K36G 3EN2A 4KJNA 2EY1A 2R92B 4ZRZA 3PF4A 5M5YB 1XMOL 4DR5Q 2BA0A 4DAVA 4CKCA 3J80c 4OX9Q 1WYDA 2EYFA 1TS2A 5C3EB 1BF4A 2VY3A 1WTWA 4I7ZC 3S9WA 2C5CA 5FKAC 1ENCA 1NY4A 2RCFA 5G3LF 3TDQA 3S2DB 1G2TA 5IT9L 5C3EG 5IYCG 4JI1L 1TKWB 1SXTA 1XNQQ 4DR5L 5IGEA 5C4XH 1C4QA 3CCMA 1IBLL 3W3AA 2UU9L 3GTOH 3OW2A 1KDAA 2EPBA 2OWOA 4YIJA 1O78A 5GAEC 5ISRA 5M3FG 4LFAQ 4J6HA 3D4RA 1LTSD 1EOTA 1EFWA 2Z9HA 2WKDA 2CQAA 3S16H 1XMQL 3G7LA 2VNUD 3PO3H 1EYDA 3HRZC 3N52A 4IUVA 1E7ZA 3H94A 4GOPC 4BXXG 3N6RA 5IP9G 3V05A 2F03A 3LGJA 2CWAA 1G91A 1KNEA 3PO2B 1X65A 4KHVA 1ENAA 4LF8L 1DM0B 2JA8G 4KD4A 1VMPA 1F9RA 2WFWA 5DLQE 2ATWA 2RF4A 1NCVA 2F0IA 4K6LA 1EY6A 1QZGA 1U4MA 1G2SA 4B3RQ 3U9SA 3J81i 2F0PA 2Q2IA 3TMEA 3E5SA 4WRDA 3VYUA 4ME3A 2Z6BA 5IIFA 2Q2HA 3CD6A 3DEOA 3OOCA 1MHWC 2K50A 3VR5A 1TT2A 4K5VA 5DEHA 4DNRB 5IGFA 3QWNA 1PTOC 1GHJA 3FPUB 3MHBA 4DR2Q 2KQ3A 1I3QH 1EIGA 3CC7A 4CJ0B 2YU9H 2MPMA 3HKZB 5I2YA 1Y1WG 2R7ZH 4LFCQ 1W2BA 1YBYA 4ALPA 4X6AH 4UP7A 4ILWA 1I4HA 5CGKA 3CCRA 2WKCA 4X64L 1KC8C 1H9SB 2B8GA 4DUYQ 5IP7G 1G51A 1B3QA 1D5XC 3VYRA 1PTOF 3I72A 4LFCL 1PH6A 4HIMA 1JICA 3F8TA 5ELNA 1VQGA 1XMQQ 1SFOH 1GUSA 2D2CC 4EX5A 1SNPA 1VQCA 4DXFA 1LT6D 3A8KE 2XSCA 1UE6A 4KN4C 1X3PA 3EROA 2F0TA 4C3HG 1IYVA 3U4ZA 3G4SA 1PFBA 2X69A 2B2TA 3AYHB 4NB3A 1WTHA 1EFID 1CK1A 1K83H 4KY5A 2E2IB 2IHEA 1ESFA 3NBIA 2F3WA 2J0TD 3VR3A 2G9HD 3W5OA 2Z6KC 4IFDI 1I6VC 4QL5A 3H3VC 1G6PA 1LT4D 3QG1A 5ELDA 1RJTA 4GOPB 1O7ZA 3KBGA 3VR2A 5EAYA 5KIXA 1QVGA 1OXSC 3VYTA 2DGYA 1KXLA 5EJWA 3RZDH 3G6JB 3I70A 4C3HB 4YY3Q 1CTMA 3GTPH 3OYYA 1EQRA 2UUCL 5IYBH 1BVSA 2TSSA 4A93H 5BN3A 4HSVA 3T13A 4K0KQ 1SSOA 1B1ZA 1L0WA 2JA7G 4LFBL 3ZYYX 5J22A 4IPDA 1X9NA 4UP8A 2QKIC 2KUMA 4LMQD 1K8OA 3CKIB 3PUYA 4ZAIA 4P75A 4EQ5A 3I4MH 2B63B 1HNWL 4IUPA 1B4OA 5FLXc 2RDHA 3HG9A 5GAGC 2M2LA 5AJ3Q 1PH7A 1K8AC 2DNCA 3GTJB 3PO3B 1OXUA 1M90C 1Q82C 1BOSA 1EIHA 3GO5A 2N49A 2R6GA 3KJPA 1EOVA 2JA5G 1Z6HA 3U50C 1TU2B 2IL8A 2KEDA 4X3SA 5CYUA 1GXDC 1HFGA 5C0XG 1I4QA 2OT2A 1TY2A 4DR4Q 3M4OB 1J8IA 3H6MA 3HP3A 4G7ZC 4JBMA 4KI0A 1IBMQ 2Z4IA 4LF6L 4QIWE 4NW2A 5D3DA 5C5LA 3MXGA 3I91A 5IYDG 4YWKA 4HTHA 1J5EQ 1ASYA 3AB9A 1VF7A 1CFMA 1LUZA 1XX8A 1PRTD 2HDLA 4FO2A 1WTQA 2BA1A 5ELEA 3BS1A 1PTOB 2F0NA 3IFTA 2F0JA 1K73C 2MJ8A 4GKKQ 2QCPX 2ZTEA 1HCZA 1HA6A 2I5MX 5I2XA 3SR1A 5EPLA 1PXUA 1WCMH 4PQXA 1GUTA 2BDNA 3J81j 1BR9A 4DR6Q 2KCCA 2B2YC 3JAMi 1KRTA 1PH2A 1BBXC 5D14A 1N36L 3R93A 3A54A 3RZOH 4E6IA 1Y8PB 1U5KA 1STEA 4R4OA 2JA8B 3H0GB 1VDZA 1L1OB 1KDBA 1BBWA 4A3DG 4X66L 1HR0W 1HZAA 2BCOA 4DV5Q 4RKLA 3CPWA 4KLKA 4DNIA 2VQFQ 4FYDA 2WB1E 3NENA 4B3ML 3EFXD 2VZAA 2QEXA 3GTMB 4YWMA 1FR3A 1L1OA 3K58A 4GZYC 4NP5A 1L0XB 3K57A 4BY1H 1Y8NB 1HH2P 1K0SA 1XNQL 5JVH3 1SYGA 1PTOD 2MO0A 4JI2Q 2QEJC 5IYDH 3W2DA 1B70B 3I2ZA 5DNFA 2KENA 1K83B 2PW7A 3CRLC 3PIP3 4DR3L 1NJIC 3JAMc 2FINB 2L9HA 1BNZA 4HAEA 5I6WA 3W1GA 5K5PA 1EIYB 2AHOB 1HQMC 4A4IA 2QILA 4GN5A 3KF8B 4M8AA 4GKJQ 3TZUA 1DD2A 1CKNA 3IRBA 2WAQE 1I4GA 2PMZB 2F0EA 2O4XA 1J5EL 3CHBD 2I5HA 2LFNA 5J39A 2PI2A 2EYOA 4YCVA 4MZ9A 1J9OA 4HJ8A 1BCPB 2JQOA 3OIQA 4NMZA 3Q0AA 4OONA 3GTKH 1SEBD 1FYCA 2R7DA 3VYSA 1HUNA 3KDFB 2F4IA 3KLSX 1GUWA 3P7JA 1STNA 3PUVA 2IX3A 4HCSA 3KK7A 1XTDA 1DJRD 4HJ7A 2JA6H 1Q1EA 2PI2E 2R3ZA 4DV1L 2EYHA 2K7VA 3EQLC 1VQNA 3HOYG 3S2HB 2R93H 3GV3A 1TY0A 3OWEB 5L37A 2LS01 3K80C 1ASZA 2WP8J 4CDCC 1W3SA 1WFQA 5EPKA 5T1IA 3DXJC 3T1YQ 3HGBA 1HUMA 4TRDA 1HZBA 1Q81C 3EA6A 4YHHL 5LMUQ 4BY7H 2VQFL 1C8CA 3D8GA 2AKWB 3RLFA 4BBSH 4DR1L 1IYUA 3BDLA 1KDCA 5DM63 5CMDA 2K1BA 3DUZA 4GNXA 3KJOA 1X3EA 2KCMA 3SGIA 3R8BA 2X6LA 2EXZA 2G5DA 5GQOA 5CV9A 1V1QA 2AQ2B 4EGVA 1D6EC 1SDFA 1KAWA 4LAAA 3GTJH 4OIKA 4L8JA 5C5MA 3H15A 4B3SL 4A3CH 2D0PA 2NN6H 3F1ZA 3PGZA 1CKMA 1QZHA 5EKLA 1UUPA 3BDCA 1CA6A 4JC0A 1VQFA 1STGA 1CSQA 4P74A 4Z9CB 1PFNA 1HZ9A 3C46A 4JI4L 1E2WA 5CBEE 4A3IH 2B29A 1RF2D 1NR4A 1WTXA 3HOWG 3OIPA 4YWLA 4AIMA 1U4LA 4DNTB 2A6EC 4DV3Q 1E3PA 5M5WH 1QNKA 3ER0A 5M3MH 3E6ZX 1YNJC 5KRUA 5LL6X 4HIKA 1E0BA 1SNDA 3MFYA 2F0HA 2RHSB 1F2YA 1SNCA 4GS3A 3MZ5A 2E5LL 1BQQT 2QDBA 1D7QA 2A73B 4EQPA 2B3GA 4RFBA 4QJFA 1YJ9A 2L55A 4HCEA 1JJCB 1JJGA 2NVYH 1JORA 1CM9A 1YNJD 3H0GG 4LUZA 1RD9D 3TP8A 2GVAA 5C4ZA 4LJZC 2E2JH 3S1NB 4L5TA 1S5ED 1X3FA 5LMNW 4U68A 2R7ZB 1IKLA 2OQKA 1ILPA 1TWGB 3IAYA 1H9JA 2ZJQA 4DR6L 4A3DB 1A6XA 5CORA 3TP6A 5C0XH 4OO1G 2HCCA 1Y8OB 3HOXH 3QB3A 1AZQA 2JE6I 2JA5H 5C4XG 2D0OA 2OTJA 4DAYA 4KV6A 4NDXA 4A3EB 5J1ZA 1JCKB 1GUOA 1U9RA 3MXUA 1S5DD 3NBHA 4JV5Q 1S3OA 3R2IA 5M3FB 4FF4A 2WACA 1X55A 2ENBA 4DR2L 1B7YB 2ID0A 4P2CB 4LF7L 2G9DA 1PH8A 2EZVA 3SK5A 3J7A5 2YU9B 1Q3LA 1SYFA 4J1MA 3GTGH 2EY6A 2K5DA 1PHJA 4FDBA 3ULLA 4RGOS 4BA1I 5ELBA 2NVXB 4HIOA 1PFMA 4UAIA 5NUCA 1TIID 2LXKA 1SMXA 1N32L 4FXGC 2CHBD 4A3EG 4YCWA 3J7ZC 4C1NI 1ICFB 2A8VA 1K3BC 4ZUIA 2HQEA 1L0YB 1XNRL 5IYBG 4C3IH 2I5LX 1LTAD 3GTLB 4X65L 1T5XD 3L0OA 2K5VA 2UXCQ 1F9SA 2JA7B 2YV5A 3STBD 2UUCQ 4CKEA 2OXPA 2N55A 1CZGA 1VQIA 2IWHA 2KHSA 2PZTA 5TSSA 2B63G 4A3KH 4UY8C 1TWCH 1PRTB 3FDTA 5G3LD 1PZJD 2I07B 4C3IB 1WCMB 1SJED 4JG2A 1JOQA 4XDXA 4DV3L 2BH2A 3KF8A 4DPGA 2B39A 1D1IA 4NXNL 1BKBA 5CV8A 1CI3M 2F0UA 2ZJPA 3OHXC 4X3UA 1F2LA 2WAQG 3FMCA 1PDQA 4FVMA 1NSNS 1HNZQ 4RGTA 1XPRA 1GKHA 4IO9A 2CCZA 1Q90A 4LF9L 2K4KA 1LTGD 2CH4A 5D3IB 3NWSA 4XYOA 4H13C 1R9TH 1FL0A 3BYYB 3KDFA 4JBJA 3G71A 3CC2A 4I65A 5C3XA 2K01A 2UXDQ 5HURA 1C48A 2L0CA 4A3LG 1EWCA 3FRPB 3Q24A 2K5NA 3BDOA 4JK1C 1F77A 4F88A 1I5FA 4DAMA 3J7AF 1IZ6A 1TWAB 3M7GA 3DLLA 3CCQA 1Q8IA 3D0FA 1GM5A 1ZYRD 1PYWD 2AQ1B 3MEFA 1L2FA 2UUBQ 1EUJA 1GD7A 1OXTA 1YNND 4UHVA 2GVBA 1A63A 1RIPA 2SDFA 1V1PB 1NBWA 3KLRA 2D9UA 3F2UA 4AQYL 2PQAA 2WAQB 3HOZB 1N33Q 1HNXQ 3E0EA 1VQPA 4BA2I 5KNCA 3K0YA 3B6YA 2E2HH 4AH6A 1NTGA 5CV7A 1K8MA 2Z8LA 4PMWA 2N78A 2AUKA 3HKSA 1E1TA 4DV1Q 1YHBA 4LF8Q 4K8JA 4JI0Q 4H02A 1SYBA 2XN9C 3TZDA 2M00A 5KYLA 4LF4L 1TWHB 1Q46A 4TKOB 4A3BB 3CCUA 3HOYB 4JCVE 1N9WA 2WB1B 3BZCA 3KOJA 2AQ3B 3SEBA 2R93B 5JAVA 3QOLA 4OELB 4WJ3M 4JI4Q 3BG3A 3HOVH 4IUUA 2F3VA 1JT8A 4RHRA 3S1MH 1A2UA 5JOBA 3VA7A 1MJEA 3UDFA 3DM1A 1UWVA 2E76C 3BVGA 2K52A 2XWJB 2XNAC 2EE1A 1HTPA 1F2MA 3NQIA 5HGQA 4JI7Q 4ZYSA 1KL9A 2ASBA 3QR8A 1SAPA 2LSSA 2K6AA 2QDLA 1PMRA 1E2ZA 4RWSC 2MP1A 3A5UA 4UDUC 3KFUA 2F0WA 1IBLQ 2E2DC 3I73A 3K0XA 1VQ4A 2FHTA 2DUDA 3FPPA 2O5JC 4N8X1 1X6OA 1QWYA 5EQ0A 2Y0SG 3TREA 3PIPA 1N32Q 1J6QA 2ICEC 2EJFC 1WOCA 1H95A 2F0SA 4A3JG 5LHY1 1PH5A 5BN4A 4JI3L 4C1NK 1N33L 4FF2A 4ID6A 4C3JB 3K6OA 1WTPA 2K32A 1MJCA 1VQHA 3WOFA 3ERSX 1PVOA 2PZWA 4NXNQ 3SK4A 5C4XB 1EL0A 4LW1A 5I6YA 4WFN3 2JEAI 2FFKB 5LMNQ 2R61A 5C0XI 1VQMA 2IX1A 1HQRD 4PG3A 5M5WB 1STAA 5FLXE 2A69C 1O7LA 5ELFA 1QNUA 3T53B 1TXYA 3TSSA 2ICIA 2B2TC 4K0KL 3UDIA 1Z7TA 1XJVA 2R93G 1FJGL 1OO9B 1X32A 2NTTA 1N36Q 2Z4HA 1SROA 4A3FB 4JW0A 3WWVA 2EYPA 1PRTF 2KCNA 4LFBQ 4DFAA 3AFQA 2Z0SA 2P5ZX 4RAUC 4DR7L 2EQSA 4Q0FA 5BR8L 2LMCB 1PZKD 2PNRC 3OSOA 4LF5Q 2F52A 5E4XA 2I46A 4LUOA 3M9BA 1B8AA 2L5TA 1Q1BA 3S14H 2QW7A 1EY9A 4A3BG 1X56A 2ZJRA 3FKIB 3BVZA 1IW7C 1EIFA 4PMCA 3T51B 4CJ2C 4JYAL 1LTRD 3CC4A 1CSPA 4RHSA 3TP5A 3S17B 3RN5A 5IODA 1CHPD 1F9QA 1EEID 1O80A 2IT1A 4M1UB 3TRZA 3M3YB 1EWIA 3MEHA 3WDNA 2XVSA 4J8QA 1O7IA 1AE2A 1FD7D 3SXHA 2NN6G 5C4JB 4JBWA 5CV5A 1I94Q 1CUKA 1VQJA 1SE8A 4IPHA 1H9KA 3HOWB 3DWAA 4P72A 1S4ZA 1D5MC 2CQOA 1KLGD 3CQZH 4QUFA 3D4WA 1NMFA 1PH9A 5KYIA 3HOZH 4DUYL 2XGTA 1MIUA 5JJZA 3CPFA 2E75C 1IW7D 1K28A 3PMFA 3I56A 1QUQA 3JAML 5JVG3 3PV0A 5F2DA 2L11A 5FLMG 1YNNC 2AMCB 1U4PA 4A75A 2CW0D 1PV4A 4B3TQ 4R8IA 4PZ8A 2NTSA 1TWGH 4KKUA 3D4DA 2OQ0A 4CKBA 4F7XA 3GTLH 2PZUA 1XTCD 2NWGA 1DGSA 1WD1A 4LF6Q 1YEZA 2KEEA 3K5OA 3K5LA 5IGGA 2E5LQ 4A3KB 3TQYA 1HRJA 5IP9H 3S1NH 3DWQA 4F8MA 3L7ZC 1QE6A 4OXPA 2ZM6Q 1B44D 3BYTB 1PYSB 3CCVA 5J3BA 3MTSA 1EYAA 4F87A 1U4RA 4C3IG 1LT5D 2NN6I 3SVMA 1M1KC 3C1FA 2JEBI 1DYQA 1XPOA 3RLNA 2AWNA 1QVCA 2CKZB 4C3HH 5JEAG 5FOBB 3RUZA 1FNUA 2UU9Q 2EY2A 4KTAA 3E9HA 4CDFC 1I4PA 3K7AB 1VQAA 3E0JA 3K5NA 2TMPA 1CHQD 2F4VL 2ZXOA 2Z6KA 4POFA 3A7AB 4BY7G 2VXWA 3E9IA 3VR6A 4GKJL 1EY4A 1SMYC 5JEAJ 3FP9A 1LO5D 4DV0Q 2NBFA 3RZDB 4ULLA 4AYBG 1B2TA 2NZ1D 3S2DH 4C3JG 2Q8RE 5FO7B 4JYAQ 1SE4A 1UNSA 1SR3A 4DV6L 3Q23A 2JA7H 4KY7A 4V190 5IWAQ 1FNVA 2A1AA 3ND8A 1EY5A 1QG7A 1B9NA 4KKTA 4QGUA 1HR0Q 5CV6A 1RDPD 5KNBA 2KA7A 4LK1C 4B3MQ 4B3RL 2K04A 1LTLA 3CRKC 1TWFH 1JR0D 2R92G 1SYDA 3K8AA 2RSOA 1JWSD 4DR3Q 3H91A 2AUJD 4ODGA 2IJ0A 4UP9A 4OO1H 5ELCA 2H1EA 1AW7A 4RGMA 4JI6L 4NPSA 5KEEA 2LXJA 4DK3C 1L1OC 4R4IA 2PYKA 4KHPL 1KHIA 2F0FA 4BBRG 5C44G 2NVQB 1DONA 3AFPA 5JJIA 4GLVB 1ENFA 2ZXRA 3MFGA 1YHAA 1JB3A 3C1EA 2VS1A 5IGDA 4U673 1I94L 3G48A 4IUQA 5I4DA 1XWEA 1QILA 3OTOL 2HDMA 4IZ8A 4DK1A 2VUMH 3URYA 4CBVA 4BXXH 1GVPA 4X62Q 3J7AV 1A8VA 4DK0A 4UPAA 4POGA 3DEPA 2XWBB 4XQJA 4P73A 4Q5VA 3PO2H 1YHQA 1O7YA 4O0AA 2VQEL 1KRSA 3K59A 4A3DH 3A56A 4AYBB 4FNFA 2XRQD 1AP0A 1IBKL 3IKJA 3TN2A 3TBIB 2KVMA 1XPUA 2WINB 1UE7A 1A3VA 3A7LA 5KGUA 3NEMA 4ZLTF 1AE3A 1AZPA 4BS9A 3PSIA 4APVA 4CGYB 4NKLA 2QA4A 3MXPA 2ALYB 1VQKA 1V1PA 2L12A 1TVXA 1YNXA 3UE0A 2HHHQ 1W6JA 4DV5L 4K8IA 3GTMH 2E74C 1BO0A 2JA5B 2D62A 4MN3A 4XT1B 1F9PA 1Z47A 1WVLA 3S1MB 4ZKBB 1CQVA 4GNXC 1RCVD 3K7UC 1S5FD 4R4TA 1YVCA 1TR5A 3K7AH 5C44H 1BUVT 3KYHC 1Z9FA 2K05A 1HNWQ 3TS2A 2OF1A 4YY3L 1B9MA 3MWYW 1I50B 4L5QA 3DWPA 5I9OA 4G57A 3O13A 1HNZL 3EJIA 1LTTD 5H1SE 4HMIA 3T1YL 2A74C 3T4AC 2RBMA 4A3EH 1KNAA 3DMUA 1A62A 4TQUS 3GDEA 3G6EA 3ULPA 2E2IH 2I0QA 3NP8A 5E3FA 2K5WA 2LKVA 4S3SA 4OO1I 4ZQ3A 2EJGC 3SDZA 4CHTB 4LF5L 4A3FH 3S15B 2QGQA 1I6HB 3D31A 1GUGA 5LL6S 4OIJA 3U4VA 5IE8A 4MTNA 1WD0A 2V4DA 1MI2A 5CBAE 2DN8A 3OMGA 1XXGA 4A3FG 2K5HA 1KAAA 4JI6Q 4GNXB 1IL8A 1HTLD 1EU4A 1M8AA 1QUQB 3PUZA 1DZ1A 3V2TA 1LLRD 5KNDA 2VL6A 3IFDA 3J80L 3NTIA 3MXNB 4IPCA 4X64Q 2OEOA 4KN7C 1D1KA 4C2MB 3GTQH 3SK8A 4OL7A 1JC7A 2K28A 4DU9A 4PZ7A 5M5YH 1YJWA 2AWOA 4WJ4A 3LWUA 1SBBB 1ZKOA 2JSOA 4PV1C 1K8GA 3C2PA 4JI8Q 3LX0A 1SMYD 2YTXA 2EOTA 1JOOA 1VMCA 4B9WA 4MNOA 2XIWA 1BCPF 2XTIA 3L2PA 1NR2A 3M85A 2NB0A 4IFDH 1K9MC 1G8ZD 4HEDA 1BDOA 1WI5A 3I3CA 3CXCA 2UXBQ 4DF7A 4EVOA 3BVMA 4V0BA 1STBA 3HOUG 1VQ8A 2FMCA 4G7OC 1HJPA 1D5ZC 1ONLA 2KHJA 2MHVA 3Q6SA 2DJFC 2IW3A 2MO1A 3H3VI 3ITPA 2EYMA 1EQQA 2SEBD 3CAMA 4XYQA 4A3IB 1SYEA 5E1FA 2R7ZG 2A6ED 1Y1WH 5GADC 4GLXA 3NTHA 1G291 1JB7A 5IY0A 4KHPQ 4LF9Q 3S17H 1A3TA 1KIXA 4NXML 1N8RC 4N9PA 3P75A 2E2JB 3M3YH 2WV6D 4HSPA 3X3NA 1VQ9A 4KD3A 1IL2A 3CCSA 5JJKA 1D2BA 4B08A 1TWAH 1JE4A 3R3OA 1BBUA 1II3A 1HR0L 2R7FA 4JI3Q 1ICWA 3STBC 1K0RA 5E7NA 5EGTA 1IBML 2A5HA 2FJ2A 4GN3B 4A76A 3H0GH 3NXWA 4LF7Q 3CQZB 3V96A 4HIDA 1A15A 4A3CG 4BBRH 1EYCA 1VQ7A 1HA5A 1HNXL 4JVZA 4OHJA 4DV0L 4ZUJA 2J7ZA 4DV7L 2F0DA 1Q86C 3SK6A 2UUAL 1ILQA 3S1QB 4ABNA 1YJNA 1EY0A 3I90A 2F4VQ 2NZHA 1LACA 1FNWA 1CT1D 1FJGQ 5AFWA 5HY6A 1XMOQ 1JQYD 1CQFA 1K3RA 4KJOA 3KUPA 3BZDB 4DUZL 1KLUD 1I4RA 5M5XH 3NQTA 4RCOA 4DGZA
chains in the Genus database with same CATH topology
4QIWB 1ET6A 2B2WA 3OWFA 2F0MA 3IL8A 4MIUA 1B50A 5C6AA 3A55A 2A68C 1BCPD 2M9VA 5HGTA 1SE2A 2DY7A 3PUXA 4A93B 4XT3B 4ZK9B 2BDOA 3NE5B 1SNOA 5IT9E 3GTKB 3OW7A 1DOLA 5K36H 3VR4A 4RKBA 2QF7A 1MGSA 1SE3A 1AN8A 4IUTA 2NUCA 1OXVA 4QB4A 2PPBC 2F0LA 3S1RB 1SYCA 4IN3A 4QF4A 3EVQA 1ML0D 3GTOB 1JWMD 1R9TB 4K5WA 3GP7A 4HN7A 5T1GA 3S16B 2A68D 2A69D 1BCPC 3NPPA 1EZ8A 5A35A 2VB3X 2EYJA 2IX0A 2SOBA 4BBSB 1WTRA 4IALA 3PIO3 4FP5D 1V1OA 3A8JE 2K33A 2PCFB 1OXXK 2CW0C 2B2UC 1SNMA 3MC0B 1GUNA 3GD7A 5JPNC 4FXKC 2RSNA 3P1HA 3T16A 4KK7A 4KKSA 1TS5A 1EU3A 2RDFA 3GV6A 5EKKA 1KABA 1TQOA 1S5BD 2HUGA 4CJ1B 1V8QA 5JPMC 1RKNA 5C44B 2RVLA 3J81E 4IFDG 4G4KA 1RTOA 1ZXTA 2NVYB 2K03A 1MSGA 1EWHA 4G7HC 1QB5D 2LY7A 1TS3A 1MD2D 3QJYA 4L6TB 4IURA 2N88A 3TP7A 2PW5A 4XIGS 1VF5C 3P20A 3OMCA 2O5IC 1NUCA 4RGNA 5EPJA 2C9OA 2F0OA 1RTNA 3ERQA 1I4XA 2HCIA 2F0KA 1HXYD 4H0LC 4RCNA 4K5XA 4KHZA 1GHKA 4IFDJ 2K5QA 4A3JB 4FF1A 5C0XJ 4K6DA 2EYLA 2Y0SB 3MVVA 2Q8IB 3R2TA 5A2QE 1H9RA 5JEAH 3AU7A 3LWEA 4A3GB 3X3MA 2JP1A 5EKIA 2O2LD 3H09A 1W6KA 3J80E 2F0QA 1MBYA 3LNNA 5E4WC 5CC4A 2L1BA 1UAPA 3GTGB 2EY5A 2BE5C 2A6HD 1PZID 1DCZA 1RODA 2JXMB 4ZKCB 1WTVA 1F2ZA 2B8FA 4XQQA 2B2VA 1AEXA 1PRTC 2EJMA 3M7NA 3U9OA 3NK9A 3QIAA 3S14B 3CU7A 4QMGA 1H9SA 5M3MB 2BE5D 4OGQC 1BXTA 2IPKD 3GTQB 4L63B 2F1MA 1HHVA 4HMJA 4KMUC 2VB2X 4O42A 2MUYA 5EBCA 5IGCA 2B2YA 4PMBA 1PTOH 1V43A 1Y1VB 1ET9A 1DOMA 3ND9A 3AMUA 1RHPA 1QOHA 4R8NA 3NUCA 4BY1B 5D65A 2JYOA 3KBXA 1Y1WB 3K5MA 2NVTB 4TSSA 2VUMB 3C3LA 1TS4A 5M9OA 3OPOA 3J7YW 1T5EA 4DAPA 2RA4A 1QCBD 1GOZA 1IHZA 3RZOB 1STYA 3MXNA 1A3UA 2DY8A 1LABA 4N9TA 2ZXPA 1EY8A 1GJXA 2PO4A 2Z1CA 5EBDA 3NSWA 3A8IE 3SE0A 5DM73 1CA5A 5M5XB 1R4PB 1R4QB 4HR7B 3RD4A 5DAUA 3HS0C 4BBRB 1QJOA 3SHLA 1FGBD 1LTID 4ME5A 3WOEA 4C56C 2XRSD 2F0GA 1SJHD 3HOVB 1I3QB 5FLXL 3I4MB 1SNQA 1NAPA 2KJXA 1AFPA 4FF3A 2NYZD 2YYZA 4RH6A 4QCLA 3HOUB 4DA2A 5FK9C 2X6GA 3MA2B 4IUNA 4XTCS 5CR3A 1B53A 1EZ6A 2SNSA 1Y69U 1Q12A 2RDGA 2JA6B 5FO8B 1M4VA 3KLSA 4B9XA 3GQBA 1DOKA 3MAQA 4FXDA 2FMMA 1TWCB 5BN5A 3NWTA 1CZWA 1EQVA 4BY7B 1MSHA 4Y7NB 1UEAB 2L4NA 4RA8A 3UI2A 3I4NB 4X3TA 1EEFD 3DHQA 3L3OC 1X3QA 1E2VA 3HEJA 1PLFA 5CV4A 5A2QL 1S5CD 2A6HC 3NHHA 4EQOA 5IGBA 5IOCA 3M4YA 4O1NA 2PQEA 2ZT9C 3NTKA 3D3RA 3T56B 3RMHA 4QUCA 2H4OA 5COYA 1DXMA 1LV9A 1JOKA 1IKMA 4XQNA 1ZEQX 3PUWA 4R9WA 3VA5A 2Q8TA 1ZYRC 5C3WA 2GA4B 3I4LA 3I8ZA 1JWUD 2MGSA 3QOJA 4IQZA 2B2UA 2RQXA 4H7BA 1HPCA 3FVQA 2KECA 3JAME 4K2LA 3HOXB 5C4HA 3Q22A 3QO2A 4X3KA 2WIIB 3D6CA 2KOLA 2RKSA 1H9MA 3ONAB 2EDGA 4XXEA 1SFOB 1LT3D 4EQNA 2J4XA 2E2HB 4DXGA 1KTKA 1A2TA 2SNMA 4BWGB 2B2VC 2BOSA 1XYIA 1STHA 3HZXA 4K14A 4MHEA 5I9PA 4WJWA 1WTOA 2DNEA 1HFNA 3L9AX 4KY6A 3FEWX 2CVRA 2EVBA 3GTPB 4PNYA 1LTBD 1VCIA 4K2KA 2D5DA 1B3AA 3D6WA 1G6ZA 2F0VA 4A3MB 4H44C 1EQTA 2B2WC 4DN4M 3J81L 4WORA 1ESRA 1EY7A 5FO9B 1TWFB 5K36G 4KJNA 2EY1A 2R92B 4ZRZA 5M5YB 2BA0A 4DAVA 4CKCA 2EYFA 1TS2A 5C3EB 1BF4A 1WTWA 4I7ZC 3S9WA 2C5CA 5FKAC 1ENCA 5G3LF 3TDQA 3S2DB 1G2TA 5IT9L 1TKWB 1SXTA 5IGEA 1C4QA 3W3AA 1KDAA 2EPBA 4YIJA 1O78A 5ISRA 4J6HA 3D4RA 1LTSD 1EOTA 2WKDA 2CQAA 3G7LA 2VNUD 1EYDA 3HRZC 3N52A 4IUVA 3H94A 3N6RA 3V05A 2F03A 1G91A 1KNEA 3PO2B 4KHVA 1ENAA 1DM0B 4KD4A 1VMPA 1F9RA 1NCVA 2F0IA 4K6LA 1EY6A 1U4MA 1G2SA 3U9SA 2F0PA 3TMEA 3E5SA 4WRDA 3VYUA 5IIFA 3DEOA 3OOCA 3VR5A 1TT2A 4K5VA 5DEHA 4DNRB 5IGFA 1PTOC 3FPUB 1GHJA 3QWNA 3MHBA 2KQ3A 1EIGA 4CJ0B 2MPMA 3HKZB 5I2YA 4ILWA 1I4HA 5CGKA 2WKCA 1H9SB 2B8GA 1D5XC 3VYRA 1PTOF 3I72A 1JICA 1GUSA 2D2CC 1SNPA 4DXFA 1LT6D 3A8KE 2XSCA 4KN4C 1X3PA 3EROA 2F0TA 4C3HG 1IYVA 1PFBA 2X69A 2B2TA 1EFID 1CK1A 4KY5A 2E2IB 2J0TD 1ESFA 3NBIA 2F3WA 3VR3A 4IFDI 2G9HD 1I6VC 3H3VC 1LT4D 3QG1A 5ELDA 1RJTA 1O7ZA 3KBGA 3VR2A 5KIXA 1OXSC 3VYTA 5EJWA 3G6JB 3I70A 4C3HB 1CTMA 2TSSA 5BN3A 4HSVA 3T13A 1SSOA 1B1ZA 3ZYYX 5J22A 2QKIC 2KUMA 4LMQD 1K8OA 3CKIB 3PUYA 4ZAIA 2B63B 4IUPA 1B4OA 2RDHA 3HG9A 2M2LA 3PO3B 2DNCA 3GTJB 1OXUA 1BOSA 1EIHA 3GO5A 2R6GA 1Z6HA 1TU2B 2IL8A 2KEDA 4X3SA 5CYUA 1GXDC 1HFGA 5C0XG 1I4QA 2OT2A 1TY2A 3M4OB 1J8IA 3H6MA 3HP3A 4G7ZC 4KI0A 2Z4IA 4NW2A 5D3DA 5C5LA 3MXGA 3I91A 4HTHA 3AB9A 1VF7A 1CFMA 1XX8A 1PRTD 2HDLA 1WTQA 4FO2A 3BS1A 5ELEA 2BA1A 1PTOB 2F0NA 3IFTA 2F0JA 2MJ8A 2QCPX 1HCZA 1HA6A 5I2XA 3SR1A 5EPLA 1PXUA 4PQXA 1GUTA 2BDNA 1BR9A 2KCCA 2B2YC 1BBXC 5D14A 3R93A 3A54A 4E6IA 1Y8PB 1STEA 2JA8B 3H0GB 1VDZA 1KDBA 2BCOA 4RKLA 4FYDA 3EFXD 3GTMB 1FR3A 3K58A 4GZYC 4NP5A 1L0XB 3K57A 1Y8NB 5JVH3 1SYGA 1PTOD 2QEJC 3W2DA 5DNFA 1K83B 2PW7A 3CRLC 3PIP3 2FINB 2L9HA 1BNZA 4HAEA 5I6WA 5K5PA 1HQMC 2QILA 4M8AA 3TZUA 1DD2A 1I4GA 2PMZB 2F0EA 2O4XA 3CHBD 2LFNA 5J39A 2EYOA 1J9OA 1BCPB 3OIQA 4NMZA 3Q0AA 1SEBD 1FYCA 3VYSA 1HUNA 2F4IA 3KLSX 1GUWA 3P7JA 1STNA 3PUVA 2IX3A 4HCSA 3KK7A 1DJRD 1Q1EA 2R3ZA 2EYHA 2K7VA 3EQLC 3S2HB 3GV3A 1TY0A 3OWEB 2LS01 2WP8J 5EPKA 5T1IA 3DXJC 3HGBA 1HUMA 4TRDA 3EA6A 1C8CA 3D8GA 3RLFA 1IYUA 3BDLA 1KDCA 5DM63 5CMDA 2K1BA 3DUZA 3R8BA 2X6LA 2EXZA 5CV9A 2AQ2B 4EGVA 1D6EC 1SDFA 4LAAA 4OIKA 4L8JA 5C5MA 2NN6H 5EKLA 1UUPA 3BDCA 1CA6A 1STGA 4Z9CB 1PFNA 3C46A 1E2WA 5CBEE 1RF2D 1NR4A 1WTXA 3OIPA 1U4LA 4DNTB 2A6EC 1QNKA 3E6ZX 1YNJC 5KRUA 5LL6X 1E0BA 1SNDA 3MFYA 2F0HA 1F2YA 1SNCA 3MZ5A 1BQQT 2QDBA 2A73B 4EQPA 4RFBA 2L55A 4HCEA 1JORA 1CM9A 1YNJD 1RD9D 3TP8A 5C4ZA 4LJZC 3S1NB 1S5ED 4U68A 2R7ZB 1IKLA 1ILPA 1TWGB 3IAYA 1H9JA 4A3DB 1A6XA 5CORA 3TP6A 5C0XH 4OO1G 2HCCA 1Y8OB 3QB3A 1AZQA 2JE6I 4DAYA 4KV6A 4NDXA 4A3EB 5J1ZA 1JCKB 1GUOA 1U9RA 3MXUA 1S5DD 3NBHA 3R2IA 5M3FB 4FF4A 2WACA 2ENBA 2ID0A 4P2CB 2G9DA 2EZVA 3SK5A 2YU9B 1Q3LA 1SYFA 4J1MA 2EY6A 2K5DA 4BA1I 4RGOS 5ELBA 2NVXB 1PFMA 4UAIA 5NUCA 1TIID 4FXGC 2CHBD 4C1NI 4ZUIA 2HQEA 1L0YB 1LTAD 3GTLB 1T5XD 1F9SA 2JA7B 4CKEA 2OXPA 2N55A 1CZGA 2IWHA 2KHSA 2PZTA 5TSSA 1PRTB 3FDTA 5G3LD 1PZJD 2I07B 4C3IB 1WCMB 1SJED 1JOQA 4XDXA 3KF8A 2B39A 1D1IA 5CV8A 1CI3M 2F0UA 3OHXC 4X3UA 1F2LA 3FMCA 1PDQA 4FVMA 1NSNS 4RGTA 1Q90A 1LTGD 5D3IB 3NWSA 4XYOA 4H13C 3BYYB 4I65A 5C3XA 2K01A 5HURA 1C48A 2L0CA 1EWCA 3FRPB 3Q24A 3BDOA 4JK1C 1F77A 4F88A 3J7AF 1TWAB 3M7GA 1Q8IA 1ZYRD 1PYWD 2AQ1B 1OXTA 1YNND 2SDFA 1V1PB 3KLRA 2D9UA 3F2UA 2WAQB 3HOZB 4BA2I 5KNCA 3K0YA 4PMWA 5CV7A 1K8MA 2Z8LA 2AUKA 4K8JA 1SYBA 2XN9C 3TZDA 2M00A 5KYLA 1TWHB 4TKOB 4A3BB 3HOYB 2WB1B 3SEBA 2R93B 2AQ3B 5JAVA 3QOLA 3BG3A 4IUUA 2F3VA 4RHRA 1A2UA 5JOBA 3VA7A 3DM1A 2E76C 3BVGA 2XWJB 2XNAC 2EE1A 1HTPA 1F2MA 3NQIA 4ZYSA 1SAPA 2K6AA 1PMRA 1E2ZA 4RWSC 2MP1A 4UDUC 2F0WA 2E2DC 3I73A 2FHTA 3FPPA 2O5JC 1QWYA 5EQ0A 2ICEC 2EJFC 2F0SA 5LHY1 5BN4A 4C1NK 4FF2A 4ID6A 4C3JB 3K6OA 1WTPA 2K32A 3WOFA 2PZWA 3SK4A 5C4XB 1EL0A 4WFN3 5I6YA 2JEAI 2FFKB 2R61A 5C0XI 2IX1A 1HQRD 5M5WB 1STAA 5FLXE 2A69C 1O7LA 5ELFA 1QNUA 3T53B 3TSSA 2ICIA 2B2TC 1Z7TA 1OO9B 1X32A 2NTTA 2Z4HA 4A3FB 2EYPA 1PRTF 2KCNA 4DFAA 4RAUC 4Q0FA 2LMCB 1PZKD 2PNRC 3OSOA 5E4XA 2I46A 2L5TA 1Q1BA 1EY9A 3FKIB 3BVZA 1IW7C 4PMCA 3T51B 4CJ2C 1LTRD 4RHSA 3TP5A 3S17B 5IODA 1CHPD 1F9QA 1EEID 1O80A 2IT1A 4M1UB 3M3YB 3MEHA 3WDNA 2XVSA 4J8QA 1FD7D 3SXHA 2NN6G 5C4JB 4JBWA 5CV5A 1H9KA 3HOWB 3DWAA 1S4ZA 1D5MC 1KLGD 4QUFA 3D4WA 5KYIA 5JJZA 2E75C 1IW7D 3PMFA 3JAML 5JVG3 3PV0A 5F2DA 2L11A 1YNNC 1U4PA 2CW0D 4R8IA 2NTSA 4KKUA 3D4DA 4CKBA 4F7XA 2PZUA 1XTCD 2NWGA 1WD1A 2KEEA 3K5OA 3K5LA 5IGGA 4A3KB 1HRJA 3DWQA 4F8MA 3L7ZC 1QE6A 1B44D 3BYTB 3MTSA 1EYAA 4F87A 1U4RA 4C3IG 1LT5D 2NN6I 3SVMA 3C1FA 2JEBI 1DYQA 2AWNA 5JEAG 5FOBB 3RUZA 1FNUA 2EY2A 4KTAA 1I4PA 3K7AB 3E0JA 3K5NA 2TMPA 1CHQD 2ZXOA 3A7AB 2VXWA 3VR6A 1EY4A 1SMYC 5JEAJ 1LO5D 2NBFA 3RZDB 4ULLA 1B2TA 2NZ1D 4C3JG 2Q8RE 5FO7B 1SE4A 1UNSA 3Q23A 4KY7A 4V190 1FNVA 3ND8A 1EY5A 1QG7A 1B9NA 4KKTA 5CV6A 1RDPD 5KNBA 2KA7A 4LK1C 2K04A 3CRKC 1JR0D 1SYDA 2RSOA 1JWSD 3H91A 2AUJD 4ODGA 2IJ0A 4OO1H 5ELCA 2H1EA 1AW7A 4RGMA 5KEEA 2PYKA 2F0FA 2NVQB 1DONA 1ENFA 2ZXRA 3MFGA 1JB3A 3C1EA 5IGDA 4U673 4IUQA 5I4DA 1XWEA 1QILA 2HDMA 4IZ8A 4DK1A 3URYA 4CBVA 3J7AV 4DK0A 3DEPA 2XWBB 4XQJA 4Q5VA 1O7YA 3K59A 3A56A 4AYBB 4FNFA 2XRQD 1AP0A 3IKJA 3TN2A 3TBIB 2KVMA 2WINB 1A3VA 3A7LA 5KGUA 4ZLTF 1AZPA 4BS9A 4CGYB 4NKLA 3MXPA 1V1PA 2L12A 1TVXA 1W6JA 4K8IA 2E74C 1BO0A 2JA5B 2D62A 4MN3A 4XT1B 1F9PA 1Z47A 1WVLA 3S1MB 4ZKBB 1CQVA 1RCVD 1S5FD 1TR5A 1BUVT 2K05A 2OF1A 1B9MA 3MWYW 1I50B 3DWPA 5I9OA 4G57A 3O13A 3EJIA 1LTTD 4HMIA 2A74C 3T4AC 2RBMA 1KNAA 3DMUA 4TQUS 3NP8A 5E3FA 2K5WA 2LKVA 4S3SA 4OO1I 4ZQ3A 2EJGC 3SDZA 4CHTB 3S15B 1I6HB 3D31A 1GUGA 5LL6S 4OIJA 1WD0A 2V4DA 1MI2A 5CBAE 2DN8A 3OMGA 1XXGA 1KAAA 1IL8A 1HTLD 1EU4A 1M8AA 1DZ1A 3PUZA 3V2TA 1LLRD 5KNDA 3IFDA 3J80L 3NTIA 2OEOA 4KN7C 1D1KA 4C2MB 3SK8A 4OL7A 1JC7A 2K28A 4DU9A 2AWOA 3LWUA 1SBBB 1ZKOA 2JSOA 4PV1C 3C2PA 3LX0A 1SMYD 2EOTA 1JOOA 1VMCA 4B9WA 2XIWA 1BCPF 1NR2A 3M85A 2NB0A 4IFDH 1G8ZD 4HEDA 1BDOA 3I3CA 4DF7A 4EVOA 3BVMA 4V0BA 1STBA 2FMCA 4G7OC 1D5ZC 1ONLA 3Q6SA 2MHVA 2IW3A 3ITPA 2EYMA 2SEBD 4XYQA 4A3IB 1SYEA 5E1FA 2A6ED 3NTHA 1G291 1A3TA 4N9PA 3P75A 2E2JB 2WV6D 4HSPA 3X3NA 4KD3A 1D2BA 4B08A 1JE4A 3R3OA 1II3A 1ICWA 5EGTA 2A5HA 2FJ2A 3NXWA 3CQZB 3V96A 1A15A 1EYCA 1HA5A 4OHJA 4ZUJA 2J7ZA 2F0DA 3SK6A 1ILQA 3S1QB 4ABNA 1EY0A 3I90A 1LACA 1FNWA 1CT1D 5AFWA 1JQYD 1CQFA 4KJOA 3KUPA 3BZDB 1KLUD 1I4RA 3NQTA 4RCOA 4DGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AB9 A;  1VF7 A;  1H9S B;  2B8G A;  1CFM A;  2E76 C;  3PUV A;  3A7A B;  5K36 G;  2EJM A;  2IT1 A;  3VR6 A;  2BA1 A;  1Q1E A;  3PUW A;  3IFT A;  3M7N A;  1SMY C;  3M85 A;  4IFD H;  2K7V A;  4LJZ C;  1HTP A;  1CI3 M;  3EQL C;  4IFD G;  2BA0 A;  1BDO A;  3I72 A;  3WDN A;  1HCZ A;  3QIA A;  1ZYR C;  2A68 C;  3I4L A;  1H9J A;  2E74 C;  1H9S A;  2D62 A;  3FMC A;  1EWH A;  4G7H C;  1GUS A;  3PUX A;  1A6X A;  2D2C C;  2NN6 G;  4G7O C;  3DXJ C;  1ONL A;  2YYZ A;  1PMR A;  1E2Z A;  4I7Z C;  4JBW A;  5C0X H;  1GUT A;  2BDO A;  2BE5 D;  4IQZ A;  3HGB A;  4OGQ C;  1Q90 A;  3QJY A;  4OO1 G;  3NE5 B;  1Y8O B;  3ND8 A;  1H9K A;  3A8K E;  1HPC A;  2F1M A;  2JE6 I;  2KCC A;  1B9N A;  3I73 A;  4KKT A;  3OW7 A;  1TKW B;  4KN4 C;  5K36 H;  4H13 C;  4XIG S;  3VR4 A;  1VF5 C;  3P20 A;  5KNB A;  2KA7 A;  3FPP A;  4KMU C;  4XTC S;  2O5I C;  2O5J C;  2A6E D;  4LK1 C;  1IYV A;  1B9M A;  3VA7 A;  3CRK C;  3RLF A;  3W3A A;  1Y69 U;  1Q12 A;  1IYU A;  1G29 1;  1GUO A;  1Y8P B;  2QF7 A;  3MXU A;  2AUJ D;  3VR3 A;  2E75 C;  1V43 A;  1VDZ A;  1IW7 D;  1O78 A;  2EJF C;  3BDO A;  1I6V C;  4JK1 C;  4OO1 H;  3D4R A;  3ND9 A;  1H9M A;  1OXV A;  2PPB C;  3PV0 A;  5BN4 A;  3QG1 A;  4TQU S;  2EDG A;  3GQB A;  3VR2 A;  1YNN C;  1OXS C;  2K32 A;  4L8J A;  3H94 A;  4H0L C;  2EJG C;  4RCN A;  3N6R A;  2NN6 H;  3SDZ A;  1CTM A;  5BN5 A;  4KHZ A;  2JEA I;  1OXT A;  1FR3 A;  1GHK A;  4KKU A;  4GZY C;  2A68 D;  1Y8N B;  2A69 D;  3D31 A;  5BN3 A;  1GUG A;  5A35 A;  3OPO A;  1T5E A;  2A69 C;  4BA1 I;  1O7L A;  2V4D A;  3KLR A;  2DN8 A;  3T53 B;  2Q8I B;  3CRL C;  4DK1 A;  1K8O A;  1E2W A;  1LAB A;  4BA2 I;  3PUY A;  1H9R A;  1Z7T A;  5JEA H;  5KNC A;  1E2V A;  1GJX A;  2DNE A;  3PUZ A;  3A8J E;  2K33 A;  1K8M A;  3U9S A;  2PCF B;  1HQM C;  4DK0 A;  1OXX K;  2AUK A;  2CW0 C;  3L7Z C;  5KND A;  2DNC A;  4DNT B;  2A6E C;  3TZU A;  1DD2 A;  3A8I E;  3SE0 A;  1OXU A;  3LNN A;  1GUN A;  3GD7 A;  1YNJ C;  2A6H C;  2EVB A;  2R6G A;  3OOC A;  4KN7 C;  3VR5 A;  2LMC B;  1Z6H A;  2NN6 I;  3M4Y A;  4KKS A;  4DNR B;  3MFY A;  1TU2 B;  4TKO B;  1VCI A;  1LAC A;  1GHJ A;  2BE5 C;  2D5D A;  2PNR C;  2JEB I;  2ZT9 C;  4HR7 B;  5C0X G;  2A6H D;  2AWO A;  3LWU A;  5JEA G;  1QJO A;  1DCZ A;  1Q1B A;  2L5T A;  3T56 B;  4G7Z C;  1ZKO A;  2JXM B;  4H44 C;  4KI0 A;  4PV1 C;  1IW7 C;  3IKJ A;  1FYC A;  3BG3 A;  2B8F A;  3T51 B;  1V8Q A;  3A7L A;  1DXM A; 
#chains in the Genus database with same CATH topology
 4QIW B;  1ET6 A;  2B2W A;  2NZO A;  3OWF A;  1I50 H;  4GN4 B;  2UXD L;  1XNR Q;  2N3S A;  2WB1 G;  2F0M A;  3IL8 A;  4MIU A;  1B50 A;  5C6A A;  3A55 A;  1NE3 A;  2A68 C;  1BCP D;  2M9V A;  5HGT A;  2F3I A;  1SE2 A;  2DY7 A;  3PUX A;  4A93 B;  4N8F A;  1E24 A;  4XT3 B;  4ZK9 B;  2BDO A;  2E8G A;  1Y14 B;  3I4N H;  3NE5 B;  4J15 A;  3S2H H;  4JV5 L;  4JPB W;  2K14 A;  1SNO A;  4A93 G;  5IT9 E;  3GTK B;  3OW7 A;  1DOL A;  5K36 H;  1KQS A;  4Y52 H;  3VR4 A;  4RKB A;  2B63 H;  3HOZ G;  3BU2 A;  4MTK A;  2QF7 A;  3NEL A;  1MGS A;  1SE3 A;  2H5X A;  3PIO A;  5GRO A;  1AN8 A;  1IYJ B;  4IUT A;  2NUC A;  1OXV A;  4QB4 A;  2PPB C;  2F0L A;  3S1R B;  3I55 A;  1SYC A;  4JI5 Q;  2N8N A;  2EIF A;  4IN3 A;  4QF4 A;  1Q7Y C;  3EVQ A;  1ML0 D;  3HOX G;  4JI7 L;  3GTO B;  1JWM D;  2VW9 A;  1R9T B;  4K5W A;  3GP7 A;  4HN7 A;  5IT9 c;  4R1J A;  4C2M H;  5T1G A;  1P8L A;  4HJ5 A;  5BR8 Q;  4HJ9 A;  3S16 B;  2A68 D;  2A69 D;  1BCP C;  3NPP A;  1D8L A;  1EZ8 A;  3J80 i;  4GLA C;  5A35 A;  2VB3 X;  1YIJ A;  4OWX B;  4DKA C;  2EYJ A;  2IX0 A;  2SOB A;  1C7Y A;  3PQI A;  4BBS B;  1P16 A;  4LWC A;  1WTR A;  4IAL A;  3PIO 3;  4FP5 D;  3S15 H;  1I6H H;  1V1O A;  3HFZ B;  3Q8D A;  4LFA L;  3M4O H;  1V9P A;  4I7A A;  3A8J E;  2K33 A;  2PCF B;  1OXX K;  2CW0 C;  2B2U C;  1SNM A;  3MC0 B;  5M3M G;  1GUN A;  3GD7 A;  5JPN C;  4FXK C;  2RSN A;  3P1H A;  2YTY A;  3T16 A;  4HJA A;  4KKS A;  4KK7 A;  4DV2 L;  1IBK Q;  1TS5 A;  1EU3 A;  4R4C A;  3HKZ G;  2RDF A;  4JOI C;  3GV6 A;  5EKK A;  1FGU A;  1KAB A;  1OTC A;  3ICE A;  3KLW A;  3CF5 A;  1TQO A;  2PQA B;  1S5B D;  2HUG A;  2OTL A;  1AH9 A;  2CH4 W;  2JA8 H;  4CJ1 B;  1V8Q A;  2CFM A;  2CWP A;  1PA6 A;  1WJJ A;  5JPM C;  3FKI G;  3FHW A;  1RKN A;  1PH3 A;  1YZ6 A;  3HKZ E;  5C44 B;  2RVL A;  3J81 E;  4CDD C;  4IFD G;  2A19 A;  4G4K A;  4R4Q A;  1RTO A;  4DV4 L;  1VQL A;  1ZXT A;  1UE5 A;  2K03 A;  2NVY B;  1MSG A;  1EWH A;  4G7H C;  1QB5 D;  2LY7 A;  1TS3 A;  1MD2 D;  3QJY A;  4L6T B;  4IUR A;  2N88 A;  3A0J A;  3TP7 A;  2PW5 A;  4XIG S;  1VF5 C;  3P20 A;  3OMC A;  3CMA A;  4A3G G;  2O5I C;  2ZTD A;  1NUC A;  2Y0S E;  4RGN A;  3J81 c;  4YHH Q;  4TVA B;  5LMU L;  3PCO B;  5EPJ A;  3EIV A;  2C9O A;  2F0O A;  1RTN A;  2UXB L;  3ERQ A;  3BJU A;  1I4X A;  4JI0 L;  2HCI A;  3HOY H;  2F0K A;  2RHQ B;  4QQB X;  1HXY D;  4H0L C;  1PH1 A;  4RCN A;  4K5X A;  2NVX H;  3VDY A;  4A3M H;  4LF4 Q;  2PNH A;  4KHZ A;  1GHK A;  1C9O A;  2OCE A;  4IFD J;  5C3E H;  1IXR A;  2K5Q A;  4A3J B;  4FF1 A;  5C0X J;  2PMZ E;  4K6D A;  2JA6 G;  2EYL A;  2Y0S B;  3MVV A;  2Q8I B;  4JBK A;  2Q2U A;  2HIV A;  3R2T A;  5A2Q E;  1H9R A;  5JEA H;  3AU7 A;  3LWE A;  4A3G B;  1HZC A;  3X3M A;  2JP1 A;  3HOV G;  5EKI A;  2O2L D;  3H09 A;  3T1H Q;  1W6K A;  3J80 E;  4RG1 A;  2F0Q A;  1MBY A;  3LNN A;  5E4W C;  5CC4 A;  1UE1 A;  4DAY B;  2L1B A;  1Q8K A;  2GN5 A;  1UAP A;  1CKN B;  4QY7 A;  3AQQ A;  3GTG B;  2EY5 A;  2BE5 C;  2A6H D;  4A3G H;  4A3K G;  1PZI D;  1DCZ A;  3JC6 6;  2KHI A;  1ROD A;  2JXM B;  4ZKC B;  3DM3 A;  1WTV A;  1F2Z A;  2B8F A;  3EBE A;  4XQQ A;  2B2V A;  1AEX A;  1PRT C;  3UDX A;  1QVF A;  4OEM B;  2EJM A;  5IP7 H;  2ZM6 L;  3M7N A;  1JJ2 A;  1RL2 A;  4AYB E;  3U9O A;  3KF6 B;  3NK9 A;  3TS0 A;  3QIA A;  4JI5 L;  3S14 B;  1CKO A;  4YCU A;  3CU7 A;  4QMG A;  1SLJ A;  1H9S A;  2L15 A;  5M3M B;  2BE5 D;  4OGQ C;  1BXT A;  2IPK D;  3GTQ B;  4L63 B;  1VQ5 A;  2F1M A;  2JN4 A;  1FVI A;  3KF6 A;  1S40 A;  3RR5 A;  1HHV A;  1SRU A;  4HMJ A;  4DV2 Q;  4KMU C;  3BZK A;  2VB2 X;  4O42 A;  2MUY A;  2NVT H;  5EBC A;  1EYG A;  5IGC A;  1VS0 A;  2B2Y A;  4PMB A;  4DK6 C;  1PTO H;  1V43 A;  1Y1V B;  1ET9 A;  1VQB A;  1DOM A;  3ND9 A;  3AMU A;  1RHP A;  1QOH A;  2NVQ H;  2VUM G;  4R8N A;  3NUC A;  2DJG C;  4BY1 B;  3A5Z B;  5D65 A;  2JYO A;  3KBX A;  2UUA Q;  1Y1W B;  3K5M A;  2NVT B;  3I4O A;  4TSS A;  1VQO A;  3U58 A;  2VUM B;  3C3L A;  2HQL A;  1TS4 A;  4O2D A;  4X65 Q;  5M9O A;  3OPO A;  3J7Y W;  1T5E A;  4DAP A;  4DV6 Q;  2RA4 A;  1QCB D;  3UDG A;  1GOZ A;  1IHZ A;  3RZO B;  1STY A;  3MXN A;  1KD1 C;  1A3U A;  2DY8 A;  4OWT B;  3UE1 A;  1LAB A;  4N9T A;  2ZXP A;  4L5S A;  1EY8 A;  5FJ8 H;  1PH4 A;  1GJX A;  2PO4 A;  4DR4 L;  2Z1C A;  5EBD A;  3NSW A;  3A8I E;  1GO3 E;  3SE0 A;  5DM7 3;  1CA5 A;  5C4J H;  5M5X B;  5M3F H;  1R4P B;  4B3T L;  1R4Q B;  4HR7 B;  3RD4 A;  5DAU A;  3PO2 G;  3HS0 C;  4BBR B;  1QJO A;  3H3V H;  3F2B A;  3SHL A;  3OTO Q;  5GAH C;  2MFI A;  4P71 A;  1TWH H;  4A3L H;  1FGB D;  3S1Q H;  1LTI D;  4ME5 A;  1VQ6 A;  3WOE A;  4C56 C;  2XRS D;  2V1C C;  2F0G A;  3HOU H;  2KBN A;  5IYC H;  3T1H L;  1SJH D;  3NBH B;  4DV7 Q;  3HOV B;  1I3Q B;  5FLX L;  3I4M B;  1SNQ A;  1NAP A;  2KJX A;  3RLO A;  1JMC A;  1MKH A;  4A3I G;  1AFP A;  1LM0 A;  5ELO A;  4DUZ Q;  4FF3 A;  2NYZ D;  2YYZ A;  4RH6 A;  2KCT A;  1C0A A;  4QCL A;  3HOU B;  4DA2 A;  3CW2 C;  4DR1 Q;  5FK9 C;  2X6G A;  3MA2 B;  4IUN A;  4XTC S;  5CR3 A;  3CCE A;  1B53 A;  2MNA A;  1EZ6 A;  2SNS A;  1Y69 U;  1Q12 A;  2BH8 A;  2RDG A;  4IJH A;  4CDE C;  2JA6 B;  4LUV A;  5FO8 B;  3CCJ A;  2R92 H;  1M4V A;  4OX9 L;  3KLS A;  4B9X A;  3GQB A;  1DOK A;  3MAQ A;  4FXD A;  2FMM A;  4OWW B;  4IOC A;  3I4M G;  1TWC B;  5BN5 A;  3TEH B;  3CME A;  3CP0 A;  3NWT A;  1NNX A;  1CZW A;  1EQV A;  4BY7 B;  1MSH A;  4C3J H;  4Y7N B;  1UEA B;  2L4N A;  4RA8 A;  2FXQ A;  4NXM Q;  3UI2 A;  3I4N B;  4X3T A;  1EEF D;  3ZJY C;  5JJL A;  3DHQ A;  1X3G A;  2JK8 A;  3FKI H;  3L3O C;  1Y1V H;  2JA9 A;  1X3Q A;  1E2V A;  3HEJ A;  4A3M G;  4IPG A;  1PLF A;  5CV4 A;  1VQD A;  4B3S Q;  4Y7N H;  5A2Q L;  2HT1 A;  1S5C D;  1E1O A;  2A6H C;  3NHH A;  4EQO A;  5IGB A;  5IOC A;  3M4Y A;  4O1N A;  2PQE A;  2ZT9 C;  4RMF A;  3NTK A;  3M4Q A;  3D3R A;  3T56 B;  3RMH A;  4LNQ A;  3CCL A;  3S24 A;  4QUC A;  3E3X A;  2Q2T A;  3A74 A;  3HOW H;  3M4P A;  2H4O A;  1LYL A;  4L5R C;  4DR7 Q;  5COY A;  1DXM A;  4JI2 L;  1LV9 A;  3S1R H;  1JOK A;  1IKM A;  4XQN A;  4JOI A;  1ZEQ X;  3PUW A;  4R9W A;  5FJ8 G;  4GOP A;  1U0L A;  3VA5 A;  2Q8T A;  1ZYR C;  5C3W A;  2GA4 B;  3I4L A;  4X66 Q;  3I8Z A;  2RCN A;  4BY1 G;  2JJQ A;  1JWU D;  3F2D A;  1T9H A;  2MGS A;  4IQZ A;  3QOJ A;  3RNU A;  2B2U A;  2RQX A;  4H7B A;  3PO3 G;  1HPC A;  4A3B H;  4IOA A;  3FVQ A;  5FLM H;  2KEC A;  1YIT A;  3ULJ A;  3JAM E;  1JE5 A;  2UUB L;  4K2L A;  3HOX B;  2HD3 A;  5C4H A;  3Q22 A;  4BBS G;  4IJL A;  3QO2 A;  2WII B;  4X3K A;  3D6C A;  2KOL A;  2RKS A;  2HIX A;  1H9M A;  3ONA B;  1Y1V G;  3PF5 A;  2YTV A;  2EDG A;  4XXE A;  2MQH A;  1SFO B;  1LT3 D;  1PFS A;  1N34 L;  4EQN A;  2J4X A;  4PZ6 A;  2E2H B;  4DXG A;  1KTK A;  4X62 L;  2IY5 B;  4JI1 Q;  1A2T A;  2SNM A;  4BWG B;  2B2V C;  1WCM G;  2BOS A;  2IHF A;  1XYI A;  1E22 A;  3AEV A;  1STH A;  3HZX A;  4K14 A;  4JI8 L;  1N34 Q;  4MHE A;  2VQE Q;  5I9P A;  4WJW A;  4AQY Q;  1WTO A;  2DNE A;  2HHH L;  1HFN A;  3L9A X;  3W1B A;  1VQE A;  4A3J H;  1NMG A;  4KY6 A;  3FEW X;  2CVR A;  1A0I A;  2K75 A;  2EVB A;  3F2C A;  3GTP B;  4PNY A;  1LTB D;  1VCI A;  4K2K A;  2D5D A;  5LMN L;  1B3A A;  3D6W A;  3I7F A;  1G6Z A;  3RN2 A;  2F0V A;  2EXD A;  4A3M B;  1UEB A;  2ES2 A;  1X54 A;  4H44 C;  3K81 C;  1YI2 A;  2C35 B;  4DV4 Q;  4ZCK A;  1EQT A;  2B2W C;  2ZTC A;  1PYB A;  1SN8 A;  4DN4 M;  3J81 L;  4WOR A;  4GKK L;  3I4N G;  1ESR A;  2UXC L;  1EY7 A;  5FO9 B;  1TWF B;  5IWA L;  5AJ3 L;  1S72 A;  5K36 G;  3EN2 A;  4KJN A;  2EY1 A;  2R92 B;  4ZRZ A;  3PF4 A;  5M5Y B;  1XMO L;  4DR5 Q;  2BA0 A;  4DAV A;  4CKC A;  3J80 c;  4OX9 Q;  1WYD A;  2EYF A;  1TS2 A;  5C3E B;  1BF4 A;  2VY3 A;  1WTW A;  4I7Z C;  3S9W A;  2C5C A;  5FKA C;  1ENC A;  1NY4 A;  2RCF A;  5G3L F;  3TDQ A;  3S2D B;  1G2T A;  5IT9 L;  5C3E G;  5IYC G;  4JI1 L;  1TKW B;  1SXT A;  1XNQ Q;  4DR5 L;  5IGE A;  5C4X H;  1C4Q A;  3CCM A;  1IBL L;  3W3A A;  2UU9 L;  3GTO H;  3OW2 A;  1KDA A;  2EPB A;  2OWO A;  4YIJ A;  1O78 A;  5GAE C;  5ISR A;  5M3F G;  4LFA Q;  4J6H A;  3D4R A;  1LTS D;  1EOT A;  1EFW A;  2Z9H A;  2WKD A;  2CQA A;  3S16 H;  1XMQ L;  3G7L A;  2VNU D;  3PO3 H;  1EYD A;  3HRZ C;  3N52 A;  4IUV A;  1E7Z A;  3H94 A;  4GOP C;  4BXX G;  3N6R A;  5IP9 G;  3V05 A;  2F03 A;  3LGJ A;  2CWA A;  1G91 A;  1KNE A;  3PO2 B;  1X65 A;  4KHV A;  1ENA A;  4LF8 L;  1DM0 B;  2JA8 G;  4KD4 A;  1VMP A;  1F9R A;  2WFW A;  5DLQ E;  2ATW A;  2RF4 A;  1NCV A;  2F0I A;  4K6L A;  1EY6 A;  1QZG A;  1U4M A;  1G2S A;  4B3R Q;  3U9S A;  3J81 i;  2F0P A;  2Q2I A;  3TME A;  3E5S A;  4WRD A;  3VYU A;  4ME3 A;  2Z6B A;  5IIF A;  2Q2H A;  3CD6 A;  3DEO A;  3OOC A;  1MHW C;  2K50 A;  3VR5 A;  1TT2 A;  4K5V A;  5DEH A;  4DNR B;  5IGF A;  3QWN A;  1PTO C;  1GHJ A;  3FPU B;  3MHB A;  4DR2 Q;  2KQ3 A;  1I3Q H;  1EIG A;  3CC7 A;  4CJ0 B;  2YU9 H;  2MPM A;  3HKZ B;  5I2Y A;  1Y1W G;  2R7Z H;  4LFC Q;  1W2B A;  1YBY A;  4ALP A;  4X6A H;  4UP7 A;  4ILW A;  1I4H A;  5CGK A;  3CCR A;  2WKC A;  4X64 L;  1KC8 C;  1H9S B;  2B8G A;  4DUY Q;  5IP7 G;  1G51 A;  1B3Q A;  1D5X C;  3VYR A;  1PTO F;  3I72 A;  4LFC L;  1PH6 A;  4HIM A;  1JIC A;  3F8T A;  5ELN A;  1VQG A;  1XMQ Q;  1SFO H;  1GUS A;  2D2C C;  4EX5 A;  1SNP A;  1VQC A;  4DXF A;  1LT6 D;  3A8K E;  2XSC A;  1UE6 A;  4KN4 C;  1X3P A;  3ERO A;  2F0T A;  4C3H G;  1IYV A;  3U4Z A;  3G4S A;  1PFB A;  2X69 A;  2B2T A;  3AYH B;  4NB3 A;  1WTH A;  1EFI D;  1CK1 A;  1K83 H;  4KY5 A;  2E2I B;  2IHE A;  1ESF A;  3NBI A;  2F3W A;  2J0T D;  3VR3 A;  2G9H D;  3W5O A;  2Z6K C;  4IFD I;  1I6V C;  4QL5 A;  3H3V C;  1G6P A;  1LT4 D;  3QG1 A;  5ELD A;  1RJT A;  4GOP B;  1O7Z A;  3KBG A;  3VR2 A;  5EAY A;  5KIX A;  1QVG A;  1OXS C;  3VYT A;  2DGY A;  1KXL A;  5EJW A;  3RZD H;  3G6J B;  3I70 A;  4C3H B;  4YY3 Q;  1CTM A;  3GTP H;  3OYY A;  1EQR A;  2UUC L;  5IYB H;  1BVS A;  2TSS A;  4A93 H;  5BN3 A;  4HSV A;  3T13 A;  4K0K Q;  1SSO A;  1B1Z A;  1L0W A;  2JA7 G;  4LFB L;  3ZYY X;  5J22 A;  4IPD A;  1X9N A;  4UP8 A;  2QKI C;  2KUM A;  4LMQ D;  1K8O A;  3CKI B;  3PUY A;  4ZAI A;  4P75 A;  4EQ5 A;  3I4M H;  2B63 B;  1HNW L;  4IUP A;  1B4O A;  5FLX c;  2RDH A;  3HG9 A;  5GAG C;  2M2L A;  5AJ3 Q;  1PH7 A;  1K8A C;  2DNC A;  3GTJ B;  3PO3 B;  1OXU A;  1M90 C;  1Q82 C;  1BOS A;  1EIH A;  3GO5 A;  2N49 A;  2R6G A;  3KJP A;  1EOV A;  2JA5 G;  1Z6H A;  3U50 C;  1TU2 B;  2IL8 A;  2KED A;  4X3S A;  5CYU A;  1GXD C;  1HFG A;  5C0X G;  1I4Q A;  2OT2 A;  1TY2 A;  4DR4 Q;  3M4O B;  1J8I A;  3H6M A;  3HP3 A;  4G7Z C;  4JBM A;  4KI0 A;  1IBM Q;  2Z4I A;  4LF6 L;  4QIW E;  4NW2 A;  5D3D A;  5C5L A;  3MXG A;  3I91 A;  5IYD G;  4YWK A;  4HTH A;  1J5E Q;  1ASY A;  3AB9 A;  1VF7 A;  1CFM A;  1LUZ A;  1XX8 A;  1PRT D;  2HDL A;  4FO2 A;  1WTQ A;  2BA1 A;  5ELE A;  3BS1 A;  1PTO B;  2F0N A;  3IFT A;  2F0J A;  1K73 C;  2MJ8 A;  4GKK Q;  2QCP X;  2ZTE A;  1HCZ A;  1HA6 A;  2I5M X;  5I2X A;  3SR1 A;  5EPL A;  1PXU A;  1WCM H;  4PQX A;  1GUT A;  2BDN A;  3J81 j;  1BR9 A;  4DR6 Q;  2KCC A;  2B2Y C;  3JAM i;  1KRT A;  1PH2 A;  1BBX C;  5D14 A;  1N36 L;  3R93 A;  3A54 A;  3RZO H;  4E6I A;  1Y8P B;  1U5K A;  1STE A;  4R4O A;  2JA8 B;  3H0G B;  1VDZ A;  1L1O B;  1KDB A;  1BBW A;  4A3D G;  4X66 L;  1HR0 W;  1HZA A;  2BCO A;  4DV5 Q;  4RKL A;  3CPW A;  4KLK A;  4DNI A;  2VQF Q;  4FYD A;  2WB1 E;  3NEN A;  4B3M L;  3EFX D;  2VZA A;  2QEX A;  3GTM B;  4YWM A;  1FR3 A;  1L1O A;  3K58 A;  4GZY C;  4NP5 A;  1L0X B;  3K57 A;  4BY1 H;  1Y8N B;  1HH2 P;  1K0S A;  1XNQ L;  5JVH 3;  1SYG A;  1PTO D;  2MO0 A;  4JI2 Q;  2QEJ C;  5IYD H;  3W2D A;  1B70 B;  3I2Z A;  5DNF A;  2KEN A;  1K83 B;  2PW7 A;  3CRL C;  3PIP 3;  4DR3 L;  1NJI C;  3JAM c;  2FIN B;  2L9H A;  1BNZ A;  4HAE A;  5I6W A;  3W1G A;  5K5P A;  1EIY B;  2AHO B;  1HQM C;  4A4I A;  2QIL A;  4GN5 A;  3KF8 B;  4M8A A;  4GKJ Q;  3TZU A;  1DD2 A;  1CKN A;  3IRB A;  2WAQ E;  1I4G A;  2PMZ B;  2F0E A;  2O4X A;  1J5E L;  3CHB D;  2I5H A;  2LFN A;  5J39 A;  2PI2 A;  2EYO A;  4YCV A;  4MZ9 A;  1J9O A;  4HJ8 A;  1BCP B;  2JQO A;  3OIQ A;  4NMZ A;  3Q0A A;  4OON A;  3GTK H;  1SEB D;  1FYC A;  2R7D A;  3VYS A;  1HUN A;  3KDF B;  2F4I A;  3KLS X;  1GUW A;  3P7J A;  1STN A;  3PUV A;  2IX3 A;  4HCS A;  3KK7 A;  1XTD A;  1DJR D;  4HJ7 A;  2JA6 H;  1Q1E A;  2PI2 E;  2R3Z A;  4DV1 L;  2EYH A;  2K7V A;  3EQL C;  1VQN A;  3HOY G;  3S2H B;  2R93 H;  3GV3 A;  1TY0 A;  3OWE B;  5L37 A;  2LS0 1;  3K80 C;  1ASZ A;  2WP8 J;  4CDC C;  1W3S A;  1WFQ A;  5EPK A;  5T1I A;  3DXJ C;  3T1Y Q;  3HGB A;  1HUM A;  4TRD A;  1HZB A;  1Q81 C;  3EA6 A;  4YHH L;  5LMU Q;  4BY7 H;  2VQF L;  1C8C A;  3D8G A;  2AKW B;  3RLF A;  4BBS H;  4DR1 L;  1IYU A;  3BDL A;  1KDC A;  5DM6 3;  5CMD A;  2K1B A;  3DUZ A;  4GNX A;  3KJO A;  1X3E A;  2KCM A;  3SGI A;  3R8B A;  2X6L A;  2EXZ A;  2G5D A;  5GQO A;  5CV9 A;  1V1Q A;  2AQ2 B;  4EGV A;  1D6E C;  1SDF A;  1KAW A;  4LAA A;  3GTJ H;  4OIK A;  4L8J A;  5C5M A;  3H15 A;  4B3S L;  4A3C H;  2D0P A;  2NN6 H;  3F1Z A;  3PGZ A;  1CKM A;  1QZH A;  5EKL A;  1UUP A;  3BDC A;  1CA6 A;  4JC0 A;  1VQF A;  1STG A;  1CSQ A;  4P74 A;  4Z9C B;  1PFN A;  1HZ9 A;  3C46 A;  4JI4 L;  1E2W A;  5CBE E;  4A3I H;  2B29 A;  1RF2 D;  1NR4 A;  1WTX A;  3HOW G;  3OIP A;  4YWL A;  4AIM A;  1U4L A;  4DNT B;  2A6E C;  4DV3 Q;  1E3P A;  5M5W H;  1QNK A;  3ER0 A;  5M3M H;  3E6Z X;  1YNJ C;  5KRU A;  5LL6 X;  4HIK A;  1E0B A;  1SND A;  3MFY A;  2F0H A;  2RHS B;  1F2Y A;  1SNC A;  4GS3 A;  3MZ5 A;  2E5L L;  1BQQ T;  2QDB A;  1D7Q A;  2A73 B;  4EQP A;  2B3G A;  4RFB A;  4QJF A;  1YJ9 A;  2L55 A;  4HCE A;  1JJC B;  1JJG A;  2NVY H;  1JOR A;  1CM9 A;  1YNJ D;  3H0G G;  4LUZ A;  1RD9 D;  3TP8 A;  2GVA A;  5C4Z A;  4LJZ C;  2E2J H;  3S1N B;  4L5T A;  1S5E D;  1X3F A;  5LMN W;  4U68 A;  2R7Z B;  1IKL A;  2OQK A;  1ILP A;  1TWG B;  3IAY A;  1H9J A;  2ZJQ A;  4DR6 L;  4A3D B;  1A6X A;  5COR A;  3TP6 A;  5C0X H;  4OO1 G;  2HCC A;  1Y8O B;  3HOX H;  3QB3 A;  1AZQ A;  2JE6 I;  2JA5 H;  5C4X G;  2D0O A;  2OTJ A;  4DAY A;  4KV6 A;  4NDX A;  4A3E B;  5J1Z A;  1JCK B;  1GUO A;  1U9R A;  3MXU A;  1S5D D;  3NBH A;  4JV5 Q;  1S3O A;  3R2I A;  5M3F B;  4FF4 A;  2WAC A;  1X55 A;  2ENB A;  4DR2 L;  1B7Y B;  2ID0 A;  4P2C B;  4LF7 L;  2G9D A;  1PH8 A;  2EZV A;  3SK5 A;  3J7A 5;  2YU9 B;  1Q3L A;  1SYF A;  4J1M A;  3GTG H;  2EY6 A;  2K5D A;  1PHJ A;  4FDB A;  3ULL A;  4RGO S;  4BA1 I;  5ELB A;  2NVX B;  4HIO A;  1PFM A;  4UAI A;  5NUC A;  1TII D;  2LXK A;  1SMX A;  1N32 L;  4FXG C;  2CHB D;  4A3E G;  4YCW A;  3J7Z C;  4C1N I;  1ICF B;  2A8V A;  1K3B C;  4ZUI A;  2HQE A;  1L0Y B;  1XNR L;  5IYB G;  4C3I H;  2I5L X;  1LTA D;  3GTL B;  4X65 L;  1T5X D;  3L0O A;  2K5V A;  2UXC Q;  1F9S A;  2JA7 B;  2YV5 A;  3STB D;  2UUC Q;  4CKE A;  2OXP A;  2N55 A;  1CZG A;  1VQI A;  2IWH A;  2KHS A;  2PZT A;  5TSS A;  2B63 G;  4A3K H;  4UY8 C;  1TWC H;  1PRT B;  3FDT A;  5G3L D;  1PZJ D;  2I07 B;  4C3I B;  1WCM B;  1SJE D;  4JG2 A;  1JOQ A;  4XDX A;  4DV3 L;  2BH2 A;  3KF8 A;  4DPG A;  2B39 A;  1D1I A;  4NXN L;  1BKB A;  5CV8 A;  1CI3 M;  2F0U A;  2ZJP A;  3OHX C;  4X3U A;  1F2L A;  2WAQ G;  3FMC A;  1PDQ A;  4FVM A;  1NSN S;  1HNZ Q;  4RGT A;  1XPR A;  1GKH A;  4IO9 A;  2CCZ A;  1Q90 A;  4LF9 L;  2K4K A;  1LTG D;  2CH4 A;  5D3I B;  3NWS A;  4XYO A;  4H13 C;  1R9T H;  1FL0 A;  3BYY B;  3KDF A;  4JBJ A;  3G71 A;  3CC2 A;  4I65 A;  5C3X A;  2K01 A;  2UXD Q;  5HUR A;  1C48 A;  2L0C A;  4A3L G;  1EWC A;  3FRP B;  3Q24 A;  2K5N A;  3BDO A;  4JK1 C;  1F77 A;  4F88 A;  1I5F A;  4DAM A;  3J7A F;  1IZ6 A;  1TWA B;  3M7G A;  3DLL A;  3CCQ A;  1Q8I A;  3D0F A;  1GM5 A;  1ZYR D;  1PYW D;  2AQ1 B;  3MEF A;  1L2F A;  2UUB Q;  1EUJ A;  1GD7 A;  1OXT A;  1YNN D;  4UHV A;  2GVB A;  1A63 A;  1RIP A;  2SDF A;  1V1P B;  1NBW A;  3KLR A;  2D9U A;  3F2U A;  4AQY L;  2PQA A;  2WAQ B;  3HOZ B;  1N33 Q;  1HNX Q;  3E0E A;  1VQP A;  4BA2 I;  5KNC A;  3K0Y A;  3B6Y A;  2E2H H;  4AH6 A;  1NTG A;  5CV7 A;  1K8M A;  2Z8L A;  4PMW A;  2N78 A;  2AUK A;  3HKS A;  1E1T A;  4DV1 Q;  1YHB A;  4LF8 Q;  4K8J A;  4JI0 Q;  4H02 A;  1SYB A;  2XN9 C;  3TZD A;  2M00 A;  5KYL A;  4LF4 L;  1TWH B;  1Q46 A;  4TKO B;  4A3B B;  3CCU A;  3HOY B;  4JCV E;  1N9W A;  2WB1 B;  3BZC A;  3KOJ A;  2AQ3 B;  3SEB A;  2R93 B;  5JAV A;  3QOL A;  4OEL B;  4WJ3 M;  4JI4 Q;  3BG3 A;  3HOV H;  4IUU A;  2F3V A;  1JT8 A;  4RHR A;  3S1M H;  1A2U A;  5JOB A;  3VA7 A;  1MJE A;  3UDF A;  3DM1 A;  1UWV A;  2E76 C;  3BVG A;  2K52 A;  2XWJ B;  2XNA C;  2EE1 A;  1HTP A;  1F2M A;  3NQI A;  5HGQ A;  4JI7 Q;  4ZYS A;  1KL9 A;  2ASB A;  3QR8 A;  1SAP A;  2LSS A;  2K6A A;  2QDL A;  1PMR A;  1E2Z A;  4RWS C;  2MP1 A;  3A5U A;  4UDU C;  3KFU A;  2F0W A;  1IBL Q;  2E2D C;  3I73 A;  3K0X A;  1VQ4 A;  2FHT A;  2DUD A;  3FPP A;  2O5J C;  4N8X 1;  1X6O A;  1QWY A;  5EQ0 A;  2Y0S G;  3TRE A;  3PIP A;  1N32 Q;  1J6Q A;  2ICE C;  2EJF C;  1WOC A;  1H95 A;  2F0S A;  4A3J G;  5LHY 1;  1PH5 A;  5BN4 A;  4JI3 L;  4C1N K;  1N33 L;  4FF2 A;  4ID6 A;  4C3J B;  3K6O A;  1WTP A;  2K32 A;  1MJC A;  1VQH A;  3WOF A;  3ERS X;  1PVO A;  2PZW A;  4NXN Q;  3SK4 A;  5C4X B;  1EL0 A;  4LW1 A;  5I6Y A;  4WFN 3;  2JEA I;  2FFK B;  5LMN Q;  2R61 A;  5C0X I;  1VQM A;  2IX1 A;  1HQR D;  4PG3 A;  5M5W B;  1STA A;  5FLX E;  2A69 C;  1O7L A;  5ELF A;  1QNU A;  3T53 B;  1TXY A;  3TSS A;  2ICI A;  2B2T C;  4K0K L;  3UDI A;  1Z7T A;  1XJV A;  2R93 G;  1FJG L;  1OO9 B;  1X32 A;  2NTT A;  1N36 Q;  2Z4H A;  1SRO A;  4A3F B;  4JW0 A;  3WWV A;  2EYP A;  1PRT F;  2KCN A;  4LFB Q;  4DFA A;  3AFQ A;  2Z0S A;  2P5Z X;  4RAU C;  4DR7 L;  2EQS A;  4Q0F A;  5BR8 L;  2LMC B;  1PZK D;  2PNR C;  3OSO A;  4LF5 Q;  2F52 A;  5E4X A;  2I46 A;  4LUO A;  3M9B A;  1B8A A;  2L5T A;  1Q1B A;  3S14 H;  2QW7 A;  1EY9 A;  4A3B G;  1X56 A;  2ZJR A;  3FKI B;  3BVZ A;  1IW7 C;  1EIF A;  4PMC A;  3T51 B;  4CJ2 C;  4JYA L;  1LTR D;  3CC4 A;  1CSP A;  4RHS A;  3TP5 A;  3S17 B;  3RN5 A;  5IOD A;  1CHP D;  1F9Q A;  1EEI D;  1O80 A;  2IT1 A;  4M1U B;  3TRZ A;  3M3Y B;  1EWI A;  3MEH A;  3WDN A;  2XVS A;  4J8Q A;  1O7I A;  1AE2 A;  1FD7 D;  3SXH A;  2NN6 G;  5C4J B;  4JBW A;  5CV5 A;  1I94 Q;  1CUK A;  1VQJ A;  1SE8 A;  4IPH A;  1H9K A;  3HOW B;  3DWA A;  4P72 A;  1S4Z A;  1D5M C;  2CQO A;  1KLG D;  3CQZ H;  4QUF A;  3D4W A;  1NMF A;  1PH9 A;  5KYI A;  3HOZ H;  4DUY L;  2XGT A;  1MIU A;  5JJZ A;  3CPF A;  2E75 C;  1IW7 D;  1K28 A;  3PMF A;  3I56 A;  1QUQ A;  3JAM L;  5JVG 3;  3PV0 A;  5F2D A;  2L11 A;  5FLM G;  1YNN C;  2AMC B;  1U4P A;  4A75 A;  2CW0 D;  1PV4 A;  4B3T Q;  4R8I A;  4PZ8 A;  2NTS A;  1TWG H;  4KKU A;  3D4D A;  2OQ0 A;  4CKB A;  4F7X A;  3GTL H;  2PZU A;  1XTC D;  2NWG A;  1DGS A;  1WD1 A;  4LF6 Q;  1YEZ A;  2KEE A;  3K5O A;  3K5L A;  5IGG A;  2E5L Q;  4A3K B;  3TQY A;  1HRJ A;  5IP9 H;  3S1N H;  3DWQ A;  4F8M A;  3L7Z C;  1QE6 A;  4OXP A;  2ZM6 Q;  1B44 D;  3BYT B;  1PYS B;  3CCV A;  5J3B A;  3MTS A;  1EYA A;  4F87 A;  1U4R A;  4C3I G;  1LT5 D;  2NN6 I;  3SVM A;  1M1K C;  3C1F A;  2JEB I;  1DYQ A;  1XPO A;  3RLN A;  2AWN A;  1QVC A;  2CKZ B;  4C3H H;  5JEA G;  5FOB B;  3RUZ A;  1FNU A;  2UU9 Q;  2EY2 A;  4KTA A;  3E9H A;  4CDF C;  1I4P A;  3K7A B;  1VQA A;  3E0J A;  3K5N A;  2TMP A;  1CHQ D;  2F4V L;  2ZXO A;  2Z6K A;  4POF A;  3A7A B;  4BY7 G;  2VXW A;  3E9I A;  3VR6 A;  4GKJ L;  1EY4 A;  1SMY C;  5JEA J;  3FP9 A;  1LO5 D;  4DV0 Q;  2NBF A;  3RZD B;  4ULL A;  4AYB G;  1B2T A;  2NZ1 D;  3S2D H;  4C3J G;  2Q8R E;  5FO7 B;  4JYA Q;  1SE4 A;  1UNS A;  1SR3 A;  4DV6 L;  3Q23 A;  2JA7 H;  4KY7 A;  4V19 0;  5IWA Q;  1FNV A;  2A1A A;  3ND8 A;  1EY5 A;  1QG7 A;  1B9N A;  4KKT A;  4QGU A;  1HR0 Q;  5CV6 A;  1RDP D;  5KNB A;  2KA7 A;  4LK1 C;  4B3M Q;  4B3R L;  2K04 A;  1LTL A;  3CRK C;  1TWF H;  1JR0 D;  2R92 G;  1SYD A;  3K8A A;  2RSO A;  1JWS D;  4DR3 Q;  3H91 A;  2AUJ D;  4ODG A;  2IJ0 A;  4UP9 A;  4OO1 H;  5ELC A;  2H1E A;  1AW7 A;  4RGM A;  4JI6 L;  4NPS A;  5KEE A;  2LXJ A;  4DK3 C;  1L1O C;  4R4I A;  2PYK A;  4KHP L;  1KHI A;  2F0F A;  4BBR G;  5C44 G;  2NVQ B;  1DON A;  3AFP A;  5JJI A;  4GLV B;  1ENF A;  2ZXR A;  3MFG A;  1YHA A;  1JB3 A;  3C1E A;  2VS1 A;  5IGD A;  4U67 3;  1I94 L;  3G48 A;  4IUQ A;  5I4D A;  1XWE A;  1QIL A;  3OTO L;  2HDM A;  4IZ8 A;  4DK1 A;  2VUM H;  3URY A;  4CBV A;  4BXX H;  1GVP A;  4X62 Q;  3J7A V;  1A8V A;  4DK0 A;  4UPA A;  4POG A;  3DEP A;  2XWB B;  4XQJ A;  4P73 A;  4Q5V A;  3PO2 H;  1YHQ A;  1O7Y A;  4O0A A;  2VQE L;  1KRS A;  3K59 A;  4A3D H;  3A56 A;  4AYB B;  4FNF A;  2XRQ D;  1AP0 A;  1IBK L;  3IKJ A;  3TN2 A;  3TBI B;  2KVM A;  1XPU A;  2WIN B;  1UE7 A;  1A3V A;  3A7L A;  5KGU A;  3NEM A;  4ZLT F;  1AE3 A;  1AZP A;  4BS9 A;  3PSI A;  4APV A;  4CGY B;  4NKL A;  2QA4 A;  3MXP A;  2ALY B;  1VQK A;  1V1P A;  2L12 A;  1TVX A;  1YNX A;  3UE0 A;  2HHH Q;  1W6J A;  4DV5 L;  4K8I A;  3GTM H;  2E74 C;  1BO0 A;  2JA5 B;  2D62 A;  4MN3 A;  4XT1 B;  1F9P A;  1Z47 A;  1WVL A;  3S1M B;  4ZKB B;  1CQV A;  4GNX C;  1RCV D;  3K7U C;  1S5F D;  4R4T A;  1YVC A;  1TR5 A;  3K7A H;  5C44 H;  1BUV T;  3KYH C;  1Z9F A;  2K05 A;  1HNW Q;  3TS2 A;  2OF1 A;  4YY3 L;  1B9M A;  3MWY W;  1I50 B;  4L5Q A;  3DWP A;  5I9O A;  4G57 A;  3O13 A;  1HNZ L;  3EJI A;  1LTT D;  5H1S E;  4HMI A;  3T1Y L;  2A74 C;  3T4A C;  2RBM A;  4A3E H;  1KNA A;  3DMU A;  1A62 A;  4TQU S;  3GDE A;  3G6E A;  3ULP A;  2E2I H;  2I0Q A;  3NP8 A;  5E3F A;  2K5W A;  2LKV A;  4S3S A;  4OO1 I;  4ZQ3 A;  2EJG C;  3SDZ A;  4CHT B;  4LF5 L;  4A3F H;  3S15 B;  2QGQ A;  1I6H B;  3D31 A;  1GUG A;  5LL6 S;  4OIJ A;  3U4V A;  5IE8 A;  4MTN A;  1WD0 A;  2V4D A;  1MI2 A;  5CBA E;  2DN8 A;  3OMG A;  1XXG A;  4A3F G;  2K5H A;  1KAA A;  4JI6 Q;  4GNX B;  1IL8 A;  1HTL D;  1EU4 A;  1M8A A;  1QUQ B;  3PUZ A;  1DZ1 A;  3V2T A;  1LLR D;  5KND A;  2VL6 A;  3IFD A;  3J80 L;  3NTI A;  3MXN B;  4IPC A;  4X64 Q;  2OEO A;  4KN7 C;  1D1K A;  4C2M B;  3GTQ H;  3SK8 A;  4OL7 A;  1JC7 A;  2K28 A;  4DU9 A;  4PZ7 A;  5M5Y H;  1YJW A;  2AWO A;  4WJ4 A;  3LWU A;  1SBB B;  1ZKO A;  2JSO A;  4PV1 C;  1K8G A;  3C2P A;  4JI8 Q;  3LX0 A;  1SMY D;  2YTX A;  2EOT A;  1JOO A;  1VMC A;  4B9W A;  4MNO A;  2XIW A;  1BCP F;  2XTI A;  3L2P A;  1NR2 A;  3M85 A;  2NB0 A;  4IFD H;  1K9M C;  1G8Z D;  4HED A;  1BDO A;  1WI5 A;  3I3C A;  3CXC A;  2UXB Q;  4DF7 A;  4EVO A;  3BVM A;  4V0B A;  1STB A;  3HOU G;  1VQ8 A;  2FMC A;  4G7O C;  1HJP A;  1D5Z C;  1ONL A;  2KHJ A;  2MHV A;  3Q6S A;  2DJF C;  2IW3 A;  2MO1 A;  3H3V I;  3ITP A;  2EYM A;  1EQQ A;  2SEB D;  3CAM A;  4XYQ A;  4A3I B;  1SYE A;  5E1F A;  2R7Z G;  2A6E D;  1Y1W H;  5GAD C;  4GLX A;  3NTH A;  1G29 1;  1JB7 A;  5IY0 A;  4KHP Q;  4LF9 Q;  3S17 H;  1A3T A;  1KIX A;  4NXM L;  1N8R C;  4N9P A;  3P75 A;  2E2J B;  3M3Y H;  2WV6 D;  4HSP A;  3X3N A;  1VQ9 A;  4KD3 A;  1IL2 A;  3CCS A;  5JJK A;  1D2B A;  4B08 A;  1TWA H;  1JE4 A;  3R3O A;  1BBU A;  1II3 A;  1HR0 L;  2R7F A;  4JI3 Q;  1ICW A;  3STB C;  1K0R A;  5E7N A;  5EGT A;  1IBM L;  2A5H A;  2FJ2 A;  4GN3 B;  4A76 A;  3H0G H;  3NXW A;  4LF7 Q;  3CQZ B;  3V96 A;  4HID A;  1A15 A;  4A3C G;  4BBR H;  1EYC A;  1VQ7 A;  1HA5 A;  1HNX L;  4JVZ A;  4OHJ A;  4DV0 L;  4ZUJ A;  2J7Z A;  4DV7 L;  2F0D A;  1Q86 C;  3SK6 A;  2UUA L;  1ILQ A;  3S1Q B;  4ABN A;  1YJN A;  1EY0 A;  3I90 A;  2F4V Q;  2NZH A;  1LAC A;  1FNW A;  1CT1 D;  1FJG Q;  5AFW A;  5HY6 A;  1XMO Q;  1JQY D;  1CQF A;  1K3R A;  4KJO A;  3KUP A;  3BZD B;  4DUZ L;  1KLU D;  1I4R A;  5M5X H;  3NQT A;  4RCO A;  4DGZ A; 
#chains in the Genus database with same CATH homology
 4QIW B;  1ET6 A;  2B2W A;  3OWF A;  2F0M A;  3IL8 A;  4MIU A;  1B50 A;  5C6A A;  3A55 A;  2A68 C;  1BCP D;  2M9V A;  5HGT A;  1SE2 A;  2DY7 A;  3PUX A;  4A93 B;  4XT3 B;  4ZK9 B;  2BDO A;  3NE5 B;  1SNO A;  5IT9 E;  3GTK B;  3OW7 A;  1DOL A;  5K36 H;  3VR4 A;  4RKB A;  2QF7 A;  1MGS A;  1SE3 A;  1AN8 A;  4IUT A;  2NUC A;  1OXV A;  4QB4 A;  2PPB C;  2F0L A;  3S1R B;  1SYC A;  4IN3 A;  4QF4 A;  3EVQ A;  1ML0 D;  3GTO B;  1JWM D;  1R9T B;  4K5W A;  3GP7 A;  4HN7 A;  5T1G A;  3S16 B;  2A68 D;  2A69 D;  1BCP C;  3NPP A;  1EZ8 A;  5A35 A;  2VB3 X;  2EYJ A;  2IX0 A;  2SOB A;  4BBS B;  1WTR A;  4IAL A;  3PIO 3;  4FP5 D;  1V1O A;  3A8J E;  2K33 A;  2PCF B;  1OXX K;  2CW0 C;  2B2U C;  1SNM A;  3MC0 B;  1GUN A;  3GD7 A;  5JPN C;  4FXK C;  2RSN A;  3P1H A;  3T16 A;  4KK7 A;  4KKS A;  1TS5 A;  1EU3 A;  2RDF A;  3GV6 A;  5EKK A;  1KAB A;  1TQO A;  1S5B D;  2HUG A;  4CJ1 B;  1V8Q A;  5JPM C;  1RKN A;  5C44 B;  2RVL A;  3J81 E;  4IFD G;  4G4K A;  1RTO A;  1ZXT A;  2NVY B;  2K03 A;  1MSG A;  1EWH A;  4G7H C;  1QB5 D;  2LY7 A;  1TS3 A;  1MD2 D;  3QJY A;  4L6T B;  4IUR A;  2N88 A;  3TP7 A;  2PW5 A;  4XIG S;  1VF5 C;  3P20 A;  3OMC A;  2O5I C;  1NUC A;  4RGN A;  5EPJ A;  2C9O A;  2F0O A;  1RTN A;  3ERQ A;  1I4X A;  2HCI A;  2F0K A;  1HXY D;  4H0L C;  4RCN A;  4K5X A;  4KHZ A;  1GHK A;  4IFD J;  2K5Q A;  4A3J B;  4FF1 A;  5C0X J;  4K6D A;  2EYL A;  2Y0S B;  3MVV A;  2Q8I B;  3R2T A;  5A2Q E;  1H9R A;  5JEA H;  3AU7 A;  3LWE A;  4A3G B;  3X3M A;  2JP1 A;  5EKI A;  2O2L D;  3H09 A;  1W6K A;  3J80 E;  2F0Q A;  1MBY A;  3LNN A;  5E4W C;  5CC4 A;  2L1B A;  1UAP A;  3GTG B;  2EY5 A;  2BE5 C;  2A6H D;  1PZI D;  1DCZ A;  1ROD A;  2JXM B;  4ZKC B;  1WTV A;  1F2Z A;  2B8F A;  4XQQ A;  2B2V A;  1AEX A;  1PRT C;  2EJM A;  3M7N A;  3U9O A;  3NK9 A;  3QIA A;  3S14 B;  3CU7 A;  4QMG A;  1H9S A;  5M3M B;  2BE5 D;  4OGQ C;  1BXT A;  2IPK D;  3GTQ B;  4L63 B;  2F1M A;  1HHV A;  4HMJ A;  4KMU C;  2VB2 X;  4O42 A;  2MUY A;  5EBC A;  5IGC A;  2B2Y A;  4PMB A;  1PTO H;  1V43 A;  1Y1V B;  1ET9 A;  1DOM A;  3ND9 A;  3AMU A;  1RHP A;  1QOH A;  4R8N A;  3NUC A;  4BY1 B;  5D65 A;  2JYO A;  3KBX A;  1Y1W B;  3K5M A;  2NVT B;  4TSS A;  2VUM B;  3C3L A;  1TS4 A;  5M9O A;  3OPO A;  3J7Y W;  1T5E A;  4DAP A;  2RA4 A;  1QCB D;  1GOZ A;  1IHZ A;  3RZO B;  1STY A;  3MXN A;  1A3U A;  2DY8 A;  1LAB A;  4N9T A;  2ZXP A;  1EY8 A;  1GJX A;  2PO4 A;  2Z1C A;  5EBD A;  3NSW A;  3A8I E;  3SE0 A;  5DM7 3;  1CA5 A;  5M5X B;  1R4P B;  1R4Q B;  4HR7 B;  3RD4 A;  5DAU A;  3HS0 C;  4BBR B;  1QJO A;  3SHL A;  1FGB D;  1LTI D;  4ME5 A;  3WOE A;  4C56 C;  2XRS D;  2F0G A;  1SJH D;  3HOV B;  1I3Q B;  5FLX L;  3I4M B;  1SNQ A;  1NAP A;  2KJX A;  1AFP A;  4FF3 A;  2NYZ D;  2YYZ A;  4RH6 A;  4QCL A;  3HOU B;  4DA2 A;  5FK9 C;  2X6G A;  3MA2 B;  4IUN A;  4XTC S;  5CR3 A;  1B53 A;  1EZ6 A;  2SNS A;  1Y69 U;  1Q12 A;  2RDG A;  2JA6 B;  5FO8 B;  1M4V A;  3KLS A;  4B9X A;  3GQB A;  1DOK A;  3MAQ A;  4FXD A;  2FMM A;  1TWC B;  5BN5 A;  3NWT A;  1CZW A;  1EQV A;  4BY7 B;  1MSH A;  4Y7N B;  1UEA B;  2L4N A;  4RA8 A;  3UI2 A;  3I4N B;  4X3T A;  1EEF D;  3DHQ A;  3L3O C;  1X3Q A;  1E2V A;  3HEJ A;  1PLF A;  5CV4 A;  5A2Q L;  1S5C D;  2A6H C;  3NHH A;  4EQO A;  5IGB A;  5IOC A;  3M4Y A;  4O1N A;  2PQE A;  2ZT9 C;  3NTK A;  3D3R A;  3T56 B;  3RMH A;  4QUC A;  2H4O A;  5COY A;  1DXM A;  1LV9 A;  1JOK A;  1IKM A;  4XQN A;  1ZEQ X;  3PUW A;  4R9W A;  3VA5 A;  2Q8T A;  1ZYR C;  5C3W A;  2GA4 B;  3I4L A;  3I8Z A;  1JWU D;  2MGS A;  3QOJ A;  4IQZ A;  2B2U A;  2RQX A;  4H7B A;  1HPC A;  3FVQ A;  2KEC A;  3JAM E;  4K2L A;  3HOX B;  5C4H A;  3Q22 A;  3QO2 A;  4X3K A;  2WII B;  3D6C A;  2KOL A;  2RKS A;  1H9M A;  3ONA B;  2EDG A;  4XXE A;  1SFO B;  1LT3 D;  4EQN A;  2J4X A;  2E2H B;  4DXG A;  1KTK A;  1A2T A;  2SNM A;  4BWG B;  2B2V C;  2BOS A;  1XYI A;  1STH A;  3HZX A;  4K14 A;  4MHE A;  5I9P A;  4WJW A;  1WTO A;  2DNE A;  1HFN A;  3L9A X;  4KY6 A;  3FEW X;  2CVR A;  2EVB A;  3GTP B;  4PNY A;  1LTB D;  1VCI A;  4K2K A;  2D5D A;  1B3A A;  3D6W A;  1G6Z A;  2F0V A;  4A3M B;  4H44 C;  1EQT A;  2B2W C;  4DN4 M;  3J81 L;  4WOR A;  1ESR A;  1EY7 A;  5FO9 B;  1TWF B;  5K36 G;  4KJN A;  2EY1 A;  2R92 B;  4ZRZ A;  5M5Y B;  2BA0 A;  4DAV A;  4CKC A;  2EYF A;  1TS2 A;  5C3E B;  1BF4 A;  1WTW A;  4I7Z C;  3S9W A;  2C5C A;  5FKA C;  1ENC A;  5G3L F;  3TDQ A;  3S2D B;  1G2T A;  5IT9 L;  1TKW B;  1SXT A;  5IGE A;  1C4Q A;  3W3A A;  1KDA A;  2EPB A;  4YIJ A;  1O78 A;  5ISR A;  4J6H A;  3D4R A;  1LTS D;  1EOT A;  2WKD A;  2CQA A;  3G7L A;  2VNU D;  1EYD A;  3HRZ C;  3N52 A;  4IUV A;  3H94 A;  3N6R A;  3V05 A;  2F03 A;  1G91 A;  1KNE A;  3PO2 B;  4KHV A;  1ENA A;  1DM0 B;  4KD4 A;  1VMP A;  1F9R A;  1NCV A;  2F0I A;  4K6L A;  1EY6 A;  1U4M A;  1G2S A;  3U9S A;  2F0P A;  3TME A;  3E5S A;  4WRD A;  3VYU A;  5IIF A;  3DEO A;  3OOC A;  3VR5 A;  1TT2 A;  4K5V A;  5DEH A;  4DNR B;  5IGF A;  1PTO C;  3FPU B;  1GHJ A;  3QWN A;  3MHB A;  2KQ3 A;  1EIG A;  4CJ0 B;  2MPM A;  3HKZ B;  5I2Y A;  4ILW A;  1I4H A;  5CGK A;  2WKC A;  1H9S B;  2B8G A;  1D5X C;  3VYR A;  1PTO F;  3I72 A;  1JIC A;  1GUS A;  2D2C C;  1SNP A;  4DXF A;  1LT6 D;  3A8K E;  2XSC A;  4KN4 C;  1X3P A;  3ERO A;  2F0T A;  4C3H G;  1IYV A;  1PFB A;  2X69 A;  2B2T A;  1EFI D;  1CK1 A;  4KY5 A;  2E2I B;  2J0T D;  1ESF A;  3NBI A;  2F3W A;  3VR3 A;  4IFD I;  2G9H D;  1I6V C;  3H3V C;  1LT4 D;  3QG1 A;  5ELD A;  1RJT A;  1O7Z A;  3KBG A;  3VR2 A;  5KIX A;  1OXS C;  3VYT A;  5EJW A;  3G6J B;  3I70 A;  4C3H B;  1CTM A;  2TSS A;  5BN3 A;  4HSV A;  3T13 A;  1SSO A;  1B1Z A;  3ZYY X;  5J22 A;  2QKI C;  2KUM A;  4LMQ D;  1K8O A;  3CKI B;  3PUY A;  4ZAI A;  2B63 B;  4IUP A;  1B4O A;  2RDH A;  3HG9 A;  2M2L A;  3PO3 B;  2DNC A;  3GTJ B;  1OXU A;  1BOS A;  1EIH A;  3GO5 A;  2R6G A;  1Z6H A;  1TU2 B;  2IL8 A;  2KED A;  4X3S A;  5CYU A;  1GXD C;  1HFG A;  5C0X G;  1I4Q A;  2OT2 A;  1TY2 A;  3M4O B;  1J8I A;  3H6M A;  3HP3 A;  4G7Z C;  4KI0 A;  2Z4I A;  4NW2 A;  5D3D A;  5C5L A;  3MXG A;  3I91 A;  4HTH A;  3AB9 A;  1VF7 A;  1CFM A;  1XX8 A;  1PRT D;  2HDL A;  1WTQ A;  4FO2 A;  3BS1 A;  5ELE A;  2BA1 A;  1PTO B;  2F0N A;  3IFT A;  2F0J A;  2MJ8 A;  2QCP X;  1HCZ A;  1HA6 A;  5I2X A;  3SR1 A;  5EPL A;  1PXU A;  4PQX A;  1GUT A;  2BDN A;  1BR9 A;  2KCC A;  2B2Y C;  1BBX C;  5D14 A;  3R93 A;  3A54 A;  4E6I A;  1Y8P B;  1STE A;  2JA8 B;  3H0G B;  1VDZ A;  1KDB A;  2BCO A;  4RKL A;  4FYD A;  3EFX D;  3GTM B;  1FR3 A;  3K58 A;  4GZY C;  4NP5 A;  1L0X B;  3K57 A;  1Y8N B;  5JVH 3;  1SYG A;  1PTO D;  2QEJ C;  3W2D A;  5DNF A;  1K83 B;  2PW7 A;  3CRL C;  3PIP 3;  2FIN B;  2L9H A;  1BNZ A;  4HAE A;  5I6W A;  5K5P A;  1HQM C;  2QIL A;  4M8A A;  3TZU A;  1DD2 A;  1I4G A;  2PMZ B;  2F0E A;  2O4X A;  3CHB D;  2LFN A;  5J39 A;  2EYO A;  1J9O A;  1BCP B;  3OIQ A;  4NMZ A;  3Q0A A;  1SEB D;  1FYC A;  3VYS A;  1HUN A;  2F4I A;  3KLS X;  1GUW A;  3P7J A;  1STN A;  3PUV A;  2IX3 A;  4HCS A;  3KK7 A;  1DJR D;  1Q1E A;  2R3Z A;  2EYH A;  2K7V A;  3EQL C;  3S2H B;  3GV3 A;  1TY0 A;  3OWE B;  2LS0 1;  2WP8 J;  5EPK A;  5T1I A;  3DXJ C;  3HGB A;  1HUM A;  4TRD A;  3EA6 A;  1C8C A;  3D8G A;  3RLF A;  1IYU A;  3BDL A;  1KDC A;  5DM6 3;  5CMD A;  2K1B A;  3DUZ A;  3R8B A;  2X6L A;  2EXZ A;  5CV9 A;  2AQ2 B;  4EGV A;  1D6E C;  1SDF A;  4LAA A;  4OIK A;  4L8J A;  5C5M A;  2NN6 H;  5EKL A;  1UUP A;  3BDC A;  1CA6 A;  1STG A;  4Z9C B;  1PFN A;  3C46 A;  1E2W A;  5CBE E;  1RF2 D;  1NR4 A;  1WTX A;  3OIP A;  1U4L A;  4DNT B;  2A6E C;  1QNK A;  3E6Z X;  1YNJ C;  5KRU A;  5LL6 X;  1E0B A;  1SND A;  3MFY A;  2F0H A;  1F2Y A;  1SNC A;  3MZ5 A;  1BQQ T;  2QDB A;  2A73 B;  4EQP A;  4RFB A;  2L55 A;  4HCE A;  1JOR A;  1CM9 A;  1YNJ D;  1RD9 D;  3TP8 A;  5C4Z A;  4LJZ C;  3S1N B;  1S5E D;  4U68 A;  2R7Z B;  1IKL A;  1ILP A;  1TWG B;  3IAY A;  1H9J A;  4A3D B;  1A6X A;  5COR A;  3TP6 A;  5C0X H;  4OO1 G;  2HCC A;  1Y8O B;  3QB3 A;  1AZQ A;  2JE6 I;  4DAY A;  4KV6 A;  4NDX A;  4A3E B;  5J1Z A;  1JCK B;  1GUO A;  1U9R A;  3MXU A;  1S5D D;  3NBH A;  3R2I A;  5M3F B;  4FF4 A;  2WAC A;  2ENB A;  2ID0 A;  4P2C B;  2G9D A;  2EZV A;  3SK5 A;  2YU9 B;  1Q3L A;  1SYF A;  4J1M A;  2EY6 A;  2K5D A;  4BA1 I;  4RGO S;  5ELB A;  2NVX B;  1PFM A;  4UAI A;  5NUC A;  1TII D;  4FXG C;  2CHB D;  4C1N I;  4ZUI A;  2HQE A;  1L0Y B;  1LTA D;  3GTL B;  1T5X D;  1F9S A;  2JA7 B;  4CKE A;  2OXP A;  2N55 A;  1CZG A;  2IWH A;  2KHS A;  2PZT A;  5TSS A;  1PRT B;  3FDT A;  5G3L D;  1PZJ D;  2I07 B;  4C3I B;  1WCM B;  1SJE D;  1JOQ A;  4XDX A;  3KF8 A;  2B39 A;  1D1I A;  5CV8 A;  1CI3 M;  2F0U A;  3OHX C;  4X3U A;  1F2L A;  3FMC A;  1PDQ A;  4FVM A;  1NSN S;  4RGT A;  1Q90 A;  1LTG D;  5D3I B;  3NWS A;  4XYO A;  4H13 C;  3BYY B;  4I65 A;  5C3X A;  2K01 A;  5HUR A;  1C48 A;  2L0C A;  1EWC A;  3FRP B;  3Q24 A;  3BDO A;  4JK1 C;  1F77 A;  4F88 A;  3J7A F;  1TWA B;  3M7G A;  1Q8I A;  1ZYR D;  1PYW D;  2AQ1 B;  1OXT A;  1YNN D;  2SDF A;  1V1P B;  3KLR A;  2D9U A;  3F2U A;  2WAQ B;  3HOZ B;  4BA2 I;  5KNC A;  3K0Y A;  4PMW A;  5CV7 A;  1K8M A;  2Z8L A;  2AUK A;  4K8J A;  1SYB A;  2XN9 C;  3TZD A;  2M00 A;  5KYL A;  1TWH B;  4TKO B;  4A3B B;  3HOY B;  2WB1 B;  3SEB A;  2R93 B;  2AQ3 B;  5JAV A;  3QOL A;  3BG3 A;  4IUU A;  2F3V A;  4RHR A;  1A2U A;  5JOB A;  3VA7 A;  3DM1 A;  2E76 C;  3BVG A;  2XWJ B;  2XNA C;  2EE1 A;  1HTP A;  1F2M A;  3NQI A;  4ZYS A;  1SAP A;  2K6A A;  1PMR A;  1E2Z A;  4RWS C;  2MP1 A;  4UDU C;  2F0W A;  2E2D C;  3I73 A;  2FHT A;  3FPP A;  2O5J C;  1QWY A;  5EQ0 A;  2ICE C;  2EJF C;  2F0S A;  5LHY 1;  5BN4 A;  4C1N K;  4FF2 A;  4ID6 A;  4C3J B;  3K6O A;  1WTP A;  2K32 A;  3WOF A;  2PZW A;  3SK4 A;  5C4X B;  1EL0 A;  4WFN 3;  5I6Y A;  2JEA I;  2FFK B;  2R61 A;  5C0X I;  2IX1 A;  1HQR D;  5M5W B;  1STA A;  5FLX E;  2A69 C;  1O7L A;  5ELF A;  1QNU A;  3T53 B;  3TSS A;  2ICI A;  2B2T C;  1Z7T A;  1OO9 B;  1X32 A;  2NTT A;  2Z4H A;  4A3F B;  2EYP A;  1PRT F;  2KCN A;  4DFA A;  4RAU C;  4Q0F A;  2LMC B;  1PZK D;  2PNR C;  3OSO A;  5E4X A;  2I46 A;  2L5T A;  1Q1B A;  1EY9 A;  3FKI B;  3BVZ A;  1IW7 C;  4PMC A;  3T51 B;  4CJ2 C;  1LTR D;  4RHS A;  3TP5 A;  3S17 B;  5IOD A;  1CHP D;  1F9Q A;  1EEI D;  1O80 A;  2IT1 A;  4M1U B;  3M3Y B;  3MEH A;  3WDN A;  2XVS A;  4J8Q A;  1FD7 D;  3SXH A;  2NN6 G;  5C4J B;  4JBW A;  5CV5 A;  1H9K A;  3HOW B;  3DWA A;  1S4Z A;  1D5M C;  1KLG D;  4QUF A;  3D4W A;  5KYI A;  5JJZ A;  2E75 C;  1IW7 D;  3PMF A;  3JAM L;  5JVG 3;  3PV0 A;  5F2D A;  2L11 A;  1YNN C;  1U4P A;  2CW0 D;  4R8I A;  2NTS A;  4KKU A;  3D4D A;  4CKB A;  4F7X A;  2PZU A;  1XTC D;  2NWG A;  1WD1 A;  2KEE A;  3K5O A;  3K5L A;  5IGG A;  4A3K B;  1HRJ A;  3DWQ A;  4F8M A;  3L7Z C;  1QE6 A;  1B44 D;  3BYT B;  3MTS A;  1EYA A;  4F87 A;  1U4R A;  4C3I G;  1LT5 D;  2NN6 I;  3SVM A;  3C1F A;  2JEB I;  1DYQ A;  2AWN A;  5JEA G;  5FOB B;  3RUZ A;  1FNU A;  2EY2 A;  4KTA A;  1I4P A;  3K7A B;  3E0J A;  3K5N A;  2TMP A;  1CHQ D;  2ZXO A;  3A7A B;  2VXW A;  3VR6 A;  1EY4 A;  1SMY C;  5JEA J;  1LO5 D;  2NBF A;  3RZD B;  4ULL A;  1B2T A;  2NZ1 D;  4C3J G;  2Q8R E;  5FO7 B;  1SE4 A;  1UNS A;  3Q23 A;  4KY7 A;  4V19 0;  1FNV A;  3ND8 A;  1EY5 A;  1QG7 A;  1B9N A;  4KKT A;  5CV6 A;  1RDP D;  5KNB A;  2KA7 A;  4LK1 C;  2K04 A;  3CRK C;  1JR0 D;  1SYD A;  2RSO A;  1JWS D;  3H91 A;  2AUJ D;  4ODG A;  2IJ0 A;  4OO1 H;  5ELC A;  2H1E A;  1AW7 A;  4RGM A;  5KEE A;  2PYK A;  2F0F A;  2NVQ B;  1DON A;  1ENF A;  2ZXR A;  3MFG A;  1JB3 A;  3C1E A;  5IGD A;  4U67 3;  4IUQ A;  5I4D A;  1XWE A;  1QIL A;  2HDM A;  4IZ8 A;  4DK1 A;  3URY A;  4CBV A;  3J7A V;  4DK0 A;  3DEP A;  2XWB B;  4XQJ A;  4Q5V A;  1O7Y A;  3K59 A;  3A56 A;  4AYB B;  4FNF A;  2XRQ D;  1AP0 A;  3IKJ A;  3TN2 A;  3TBI B;  2KVM A;  2WIN B;  1A3V A;  3A7L A;  5KGU A;  4ZLT F;  1AZP A;  4BS9 A;  4CGY B;  4NKL A;  3MXP A;  1V1P A;  2L12 A;  1TVX A;  1W6J A;  4K8I A;  2E74 C;  1BO0 A;  2JA5 B;  2D62 A;  4MN3 A;  4XT1 B;  1F9P A;  1Z47 A;  1WVL A;  3S1M B;  4ZKB B;  1CQV A;  1RCV D;  1S5F D;  1TR5 A;  1BUV T;  2K05 A;  2OF1 A;  1B9M A;  3MWY W;  1I50 B;  3DWP A;  5I9O A;  4G57 A;  3O13 A;  3EJI A;  1LTT D;  4HMI A;  2A74 C;  3T4A C;  2RBM A;  1KNA A;  3DMU A;  4TQU S;  3NP8 A;  5E3F A;  2K5W A;  2LKV A;  4S3S A;  4OO1 I;  4ZQ3 A;  2EJG C;  3SDZ A;  4CHT B;  3S15 B;  1I6H B;  3D31 A;  1GUG A;  5LL6 S;  4OIJ A;  1WD0 A;  2V4D A;  1MI2 A;  5CBA E;  2DN8 A;  3OMG A;  1XXG A;  1KAA A;  1IL8 A;  1HTL D;  1EU4 A;  1M8A A;  1DZ1 A;  3PUZ A;  3V2T A;  1LLR D;  5KND A;  3IFD A;  3J80 L;  3NTI A;  2OEO A;  4KN7 C;  1D1K A;  4C2M B;  3SK8 A;  4OL7 A;  1JC7 A;  2K28 A;  4DU9 A;  2AWO A;  3LWU A;  1SBB B;  1ZKO A;  2JSO A;  4PV1 C;  3C2P A;  3LX0 A;  1SMY D;  2EOT A;  1JOO A;  1VMC A;  4B9W A;  2XIW A;  1BCP F;  1NR2 A;  3M85 A;  2NB0 A;  4IFD H;  1G8Z D;  4HED A;  1BDO A;  3I3C A;  4DF7 A;  4EVO A;  3BVM A;  4V0B A;  1STB A;  2FMC A;  4G7O C;  1D5Z C;  1ONL A;  3Q6S A;  2MHV A;  2IW3 A;  3ITP A;  2EYM A;  2SEB D;  4XYQ A;  4A3I B;  1SYE A;  5E1F A;  2A6E D;  3NTH A;  1G29 1;  1A3T A;  4N9P A;  3P75 A;  2E2J B;  2WV6 D;  4HSP A;  3X3N A;  4KD3 A;  1D2B A;  4B08 A;  1JE4 A;  3R3O A;  1II3 A;  1ICW A;  5EGT A;  2A5H A;  2FJ2 A;  3NXW A;  3CQZ B;  3V96 A;  1A15 A;  1EYC A;  1HA5 A;  4OHJ A;  4ZUJ A;  2J7Z A;  2F0D A;  3SK6 A;  1ILQ A;  3S1Q B;  4ABN A;  1EY0 A;  3I90 A;  1LAC A;  1FNW A;  1CT1 D;  5AFW A;  1JQY D;  1CQF A;  4KJO A;  3KUP A;  3BZD B;  1KLU D;  1I4R A;  3NQT A;  4RCO A;  4DGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...