1BDOA

Structure of the biotinyl domain of acetyl-coenzyme a carboxylase determined by mad phasing
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
80
structure length
80
Chain Sequence
EISGHIVRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEAMKMMNQIEADKSGTVKAILVESGQPVEFDEPLVVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the biotinyl domain of acetyl-coenzyme A carboxylase determined by MAD phasing.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords ACETYL-COA CARBOXYLASE
total genus 14
structure length 80
sequence length 80
ec nomenclature ec 6.4.1.2: Acetyl-CoA carboxylase.
pdb deposition date 1995-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1bdoA00
2EJMA 4DNTB 5K36G 2A69C 1T5EA 3WDNA 4BA2I 3MXUA 4IQZA 4RCNA 2A68C 4KKSA 4XTCS 2E76C 1H9RA 1H9SB 3I73A 2EDGA 1OXVA 5JEAH 1LABA 1ONLA 1IYVA 2NN6I 3CRKC 3VR6A 1YNJC 2EVBA 3TZUA 3OOCA 3P20A 4G7HC 3I72A 2KA7A 3PUVA 5A35A 4G7OC 4H44C 1CI3M 1GUGA 1HPCA 2D2CC 4DK0A 1E2ZA 2A68D 2CW0C 3OW7A 1FYCA 1OXTA 1H9JA 5KNBA 3M7NA 1VDZA 3A8KE 2PCFB 3AB9A 1G291 1I6VC 1GHKA 1SMYC 1HTPA 3NE5B 3EQLC 1ZKOA 1IW7C 1BDOA 1H9MA 1VCIA 3QJYA 2PPBC 4H0LC 1GUSA 2BE5C 3H94A 2PNRC 4I7ZC 3IKJA 1OXSC 4JBWA 4KHZA 1Y69U 4KN4C 1PMRA 3KLRA 3T51B 2ZT9C 1OXUA 3U9SA 3BG3A 1V43A 2BE5D 3HGBA 4PV1C 5BN3A 1VF5C 5KNCA 3PUXA 2BDOA 3N6RA 1YNNC 3W3AA 1DD2A 2BA1A 3QIAA 1Q90A 1O78A 2LMCB 3L7ZC 1HCZA 2IT1A 1CTMA 4OGQC 1K8MA 1HQMC 2A6HC 2A69D 5KNDA 2F1MA 3GD7A 2KCCA 2JXMB 4KI0A 1CFMA 3A7LA 3ND8A 3T56B 3MFYA 3SDZA 1TKWB 1Y8PB 3PUYA 1OXXK 2EJGC 5BN5A 3PUWA 4KN7C 4TQUS 2B8FA 3A8IE 3M85A 2O5IC 4LJZC 2R6GA 2E74C 4JK1C 1O7LA 1GUNA 2K32A 1B9MA 2YYZA 5C0XH 1Q1EA 2O5JC 1E2VA 2DN8A 5BN4A 1FR3A 2B8GA 4G7ZC 1DCZA 4BA1I 1QJOA 2DNCA 3DXJC 3LNNA 3VR3A 2AWOA 1Q1BA 1VF7A 2QF7A 4DNRB 5K36H 2EJFC 2K7VA 1H9SA 4KMUC 2K33A 1B9NA 2AUJD 1IW7D 1Y8OB 2JEBI 3FPPA 2JE6I 1GJXA 3D4RA 4TKOB 1V8QA 3SE0A 2D5DA 2V4DA 2A6HD 1H9KA 3GQBA 4KKTA 4KKUA 4IFDG 1Z7TA 5JEAG 2BA0A 2DNEA 3I4LA 3OPOA 1K8OA 2E75C 3IFTA 3PV0A 3FMCA 3VR2A 4GZYC 1IYUA 3QG1A 3ND9A 5C0XG 4IFDH 4H13C 4XIGS 1GUOA 2NN6G 3A7AB 2AUKA 3PUZA 2Q8IB 3RLFA 3A8JE 4LK1C 4OO1G 1ZYRC 4HR7B 1Y8NB 3VR4A 1DXMA 1GUTA 3BDOA 2A6ED 1E2WA 3D31A 2A6EC 1TU2B 1Z6HA 1A6XA 2L5TA 4L8JA 3LWUA 3VA7A 2D62A 2JEAI 1EWHA 1Q12A 3CRLC 3T53B 1GHJA 3M4YA 1LACA 3VR5A 4OO1H 2NN6H 4DK1A
chains in the Genus database with same CATH superfamily
3F2BA 2C35B 2JA9A 5A2QE 3J81E 2AHOB 1G8ZD 2UUBL 1L1OC 1NR4A 3MXUA 3F2CA 4AYBG 4R8IA 4Y7NB 4DV2L 2EPBA 3PIPA 1ONLA 1EY6A 1SROA 4EQPA 4ZKBB 2WB1B 3PO3H 5JPMC 3TREA 3J80E 2SDFA 5FO7B 4XQJA 2Z6KA 5DEHA 1PH6A 1D1KA 2D2CC 3I4NG 1VQEA 4CJ2C 5HY6A 1N34Q 3HEJA 4A3EG 4UHVA 4P2CB 1PZKD 1U4MA 1H9MA 1VCIA 1IHZA 5FOBB 4DUYL 1SSOA 2KJXA 4DR1Q 1JR0D 2MUYA 1CKNA 3EROA 4QIWB 3SEBA 1BVSA 3KDFB 1FNUA 4JI3Q 1R4QB 2K28A 4XT1B 4TRDA 1K8MA 1EWIA 5KNDA 3RN2A 3W1GA 3MAQA 2WAQE 5C0XI 2HT1A 4PMCA 1QZHA 1Y1WG 2EIFA 1D8LA 2KECA 4JCVE 4C3JH 1FGUA 2EY1A 3PO3G 3M85A 4KV6A 1NE3A 3ZJYC 2RSOA 3NQIA 4C3HG 1EIYB 2K50A 4K0KQ 1QNKA 1TWGB 2GVAA 1IBKL 3NP8A 3HOYH 3S24A 5C4HA 1IZ6A 4B3RL 4A3EB 4LUZA 4S3SA 5C4XB 3PO2B 3X3MA 3HOWG 4UP8A 1Q82C 5JAVA 1IW7D 4HIDA 5IODA 1C0AA 1B3QA 3Q8DA 2R7DA 5M5YH 1N36L 2VY3A 2K52A 2V4DA 3S15B 3E5SA 2HHHQ 2QGQA 4NXML 4GKKQ 3FMCA 1YZ6A 4DF7A 2UU9L 3HOVH 3OYYA 5IGEA 1GUOA 3PUZA 1DJRD 2Q8IB 1IBLL 2KEDA 3PQIA 2QCPX 1M8AA 4BBRH 3FVQA 5CGKA 3T53B 3J81L 3SDZA 3CC2A 4LF9L 1QOHA 3K7UC 1T5EA 4JI8Q 4IQZA 3I4MH 2F3VA 2G9DA 2B63B 2KVMA 2PNHA 1LABA 2AQ2B 2F03A 1PRTC 2B2VC 2Z0SA 3KLWA 1EOVA 4H44C 2F0EA 3G48A 5LL6X 1CI3M 3K8AA 1PTOF 4A3GB 1PH7A 4A3BH 2CWPA 5ELDA 2MGSA 1ENAA 4LF8Q 2F0WA 3EIVA 4H0LC 1O7IA 3KLSX 1F2YA 1A3VA 1Y1WB 1U5KA 2GA4B 3NBHA 5LMUQ 4IPCA 4DK3C 4LF5Q 4APVA 4A3DH 2R93B 1JJCB 3E0EA 4A3GH 3LGJA 4V190 3MTSA 5ELFA 2F0SA 4IUQA 4OWXB 5C3WA 4F8MA 2LMCB 1UE5A 4JI5L 1G2SA 5ISRA 3QB3A 1FJGQ 2JXMB 2ZXRA 5KYLA 3A55A 1SRUA 2KHSA 4JI7Q 1DGSA 1EIFA 3S1RB 3URYA 2KEEA 3MXGA 3CCQA 1N32Q 5LL6S 1EQQA 3E9HA 2E2HH 5EKLA 2CQAA 1DCZA 3QR8A 1CSQA 2ATWA 1QUQB 2AWOA 4K8IA 1R9TH 2UXBL 3NXWA 4MIUA 1CKMA 2WIIB 3HOVB 3TDQA 2B63H 2FHTA 1PRTD 1Y8OB 2MQHA 3TP5A 1WCMH 2ZM6L 3OHXC 2LS01 5IE8A 4FXKC 3MEFA 4A3MH 2R92G 1EZ6A 5LHY1 3NTIA 1KQSA 1G51A 1ZEQX 3NQTA 1N36Q 3B6YA 1WCMG 1VQHA 1IKLA 3A56A 3DLLA 4AYBE 2JA6G 4A76A 1B44D 2RBMA 2YTXA 5I4DA 2UXBQ 1GKHA 3WDNA 4MTNA 1DOLA 2K01A 2B2YC 5AJ3Q 3GTJH 4X6AH 4X65Q 2D0OA 1ASZA 1BUVT 2ICIA 4Q0FA 1X9NA 4JI6L 3OMGA 3A74A 3H3VC 1XTDA 2A19A 3OWFA 5HGTA 3L3OC 2Z4HA 1NCVA 2CW0D 4DV6Q 1OXTA 1RTOA 3EJIA 2L0CA 3MEHA 2MO1A 3D3RA 2RDGA 1HTLD 4PZ7A 1GUSA 2HCIA 4LF6Q 1KLGD 3U4VA 4O1NA 1BXTA 5JJZA 4YCVA 3J81c 1HR0Q 2H1EA 4DNIA 3T16A 1JCKB 1S40A 1VF5C 1HNWQ 1LTBD 4XDXA 1DONA 2BA1A 4DR2L 3I7FA 4UPAA 3I4OA 1O78A 2L15A 1HZAA 1HCZA 4A4IA 5KIXA 3CCVA 1II3A 1Y8PB 1UAPA 4JI2L 2Q2TA 2X6LA 1TQOA 3DEPA 3J80i 4DV2Q 1GVPA 4YY3Q 1SLJA 1YJWA 3GTKH 4JW0A 4LF4Q 1RKNA 5IP9H 2JA8B 4IURA 1JWUD 3FEWX 1SNQA 2RHQB 2F0FA 3VYRA 4GLAC 1N34L 1SN8A 3LWEA 3FP9A 2WP8J 4R4TA 1K8GA 1AFPA 3X3NA 1WI5A 5IGGA 1WTRA 5EGTA 3CCRA 2OCEA 2F0JA 4OXPA 1DOMA 5L37A 4ME5A 2ZJRA 4K14A 3DWPA 3IFTA 2ASBA 5M5XB 3CCMA 1JOOA 3PIP3 2SOBA 1HZBA 3AMUA 1A2TA 1ENCA 1SBBB 1EQTA 4IPHA 4ME3A 3BDOA 2B63G 4HTHA 1FNWA 3M4YA 2VW9A 4K2LA 2ICEC 1EU4A 4F88A 3ONAB 3NTHA 4GOPA 2F0KA 1GO3E 3TZDA 4XTCS 1H9SB 4BY1G 3BDCA 3EA6A 2F4VL 2M2LA 3NPPA 4LFAL 4NMZA 2NVQH 1WVLA 4JYAQ 1S5BD 1SE3A 1JT8A 3QOJA 4LWCA 3CU7A 1S3OA 1ILPA 5F2DA 1MBYA 2CW0C 2AQ1B 2TMPA 3PSIA 1G291 1PZID 3I3CA 1B53A 1VQOA 4A3GG 3KLRA 1MJEA 1YEZA 4QL5A 1D2BA 2CHBD 3J7ZC 1J8IA 3CF5A 1JOKA 4B3SL 4XT3B 1V1QA 3JAME 3S17H 1WYDA 2WKDA 1X3EA 4WRDA 1CFMA 3UDXA 4U673 2DGYA 2CKZB 4YHHL 2QEJC 2JJQA 3RZDH 3PUWA 1KHIA 3D8GA 4OELB 4YCWA 4C1NK 1LTSD 1WTXA 3KJPA 1HR0W 3RLNA 1SYEA 4YWKA 2IL8A 2K32A 1UUPA 1EY8A 4L5RC 2F0GA 1EY5A 5C4ZA 3T13A 3H3VH 4XYOA 2ZTDA 5ELCA 1A3TA 2VUMB 2RVLA 4IPGA 1NR2A 3VDYA 1KDBA 3FDTA 4ALPA 4DAVA 3FKIG 3BU2A 3GTMH 4FYDA 4ZK9B 3HOWB 1T9HA 4C3IH 4JYAL 4IUNA 4WFN3 1L1OB 5C44B 3HOVG 3AU7A 4GLXA 4HN7A 5T1GA 2LKVA 3CMEA 1TR5A 4GZYC 2H5XA 2AUKA 4A3JB 4KHVA 2Z1CA 2R7FA 1DXMA 3C3LA 1B8AA 2HDLA 2MJ8A 3HOWH 1CK1A 3VA7A 3S2DH 1HFGA 1UEAB 4POGA 2E2IB 3SXHA 1N33L 5GAHC 4YCUA 3HOUB 3Q23A 3SK6A 1B3AA 2ENBA 2HDMA 4ZKCB 1TIID 1JMCA 3HOYG 1B50A 1C8CA 4LAAA 2UUCL 2NZ1D 1STNA 2IHEA 4FDBA 4UP9A 4C3HH 1EYAA 2E76C 5JEAH 1KRTA 4OHJA 3AEVA 2UXCQ 1YNJC 4KTAA 4CDEC 1XXGA 3S1MB 3I55A 3J7A5 4ILWA 2R93G 4A3IG 4E6IA 3BDLA 3S16B 1E2ZA 1SNMA 1YITA 4DXGA 4AQYQ 1J5EL 3M7NA 4BY7B 3AB9A 1JORA 1XNQL 1S5FD 3MXPA 3OIPA 2ID0A 4IFDJ 5EQ0A 4I65A 3STBC 4JI5Q 1NMFA 2BH2A 3SK5A 1PMRA 3DHQA 2EYLA 3RLOA 5D65A 3MC0B 2F0DA 4DR7Q 2Y0SE 2XWJB 3HG9A 4PNYA 4JI7L 5I6YA 4J1MA 1PFBA 4M8AA 3NENA 4RGOS 3J7YW 4JI2Q 1VQGA 1YNNC 3VYSA 1U9RA 3OIQA 2KHJA 2PMZE 2KUMA 3K7AH 4R4OA 4EQNA 1D6EC 1Q90A 1G2TA 2YU9B 2HIXA 1SYBA 1RCVD 2FXQA 4A3LG 4IJHA 1V9PA 2A6HC 4OX9L 1STGA 3GD7A 4IALA 1AE3A 2P5ZX 4KI0A 3I4NH 2Q8TA 5IT9E 5FKAC 3M3YB 3U4ZA 1Q3LA 2N3SA 3TSSA 2EJGC 4DV4Q 2LXJA 1IBML 5IOCA 2B8FA 2O5IC 5E4XA 2L1BA 5C0XH 1CA5A 1E2VA 2DN8A 3KF6A 4X3TA 3KOJA 2FJ2A 4BY1H 4X3SA 5GAEC 2CQOA 4HJ9A 1HRJA 3TEHB 4LF9Q 5IYCG 1JC7A 4A93H 2AKWB 1HNXQ 1B9NA 1J6QA 4CHTB 2A5HA 1V8QA 5IGCA 5CBEE 1LT4D 2QW7A 4FNFA 1I4PA 1NJIC 4A3FB 3I4LA 3OPOA 2NUCA 5M5XH 3S2HH 5J3BA 4FVMA 2XNAC 1D5XC 2EYMA 2K5WA 2K5NA 1IL8A 2ZXOA 4P72A 2I5MX 1Z6HA 2KCNA 5LMNW 2ZTCA 3RZOB 1EWHA 1NTGA 2F3IA 3CMAA 1KC8C 3UDFA 4JI4L 4YWMA 2A73B 4LW1A 4DK1A 4HEDA 2FINB 1XWEA 3TBIB 2JA8H 3TS2A 3T1HQ 3GTKB 4V0BA 2BCOA 3NBIA 3K81C 5M3MB 3WWVA 4CJ1B 2K05A 4CKCA 5GADC 2TSSA 4HAEA 5FLMG 1YJNA 2E2JH 3K57A 1TWCB 4KHPL 1ET9A 5CV4A 1IBMQ 3BVGA 1PTOB 2IPKD 3F1ZA 3OW7A 2EYPA 5DM73 4A3BB 2PCFB 1SFOB 1X54A 4K5XA 5DNFA 3H94A 5J22A 1Y69U 2VQEL 2NB0A 3HS0C 4CGYB 5IP7H 4PV1C 2B2YA 4RGMA 4ZQ3A 1MSHA 1I4GA 5IT9L 2B2WC 1B70B 2F0HA 1OO9B 4EQ5A 2ZJPA 3HKZG 1K0SA 1O80A 5ELEA 5G3LF 1SR3A 1VQ4A 2XIWA 3K5LA 2IX1A 4JV5Q 2HCCA 2PQAA 4R8NA 4X64Q 4DV0Q 4X3UA 1PRTB 3ERQA 1BF4A 4O0AA 2QEXA 1I6HH 1LT6D 5C44G 2F4VQ 2J4XA 2NTSA 3GTQH 1HNZQ 1O7LA 3KYHC 3CCEA 1Q8IA 3MZ5A 3KK7A 3KLSA 5BN4A 3MXNA 2YU9H 3I70A 3GTJB 3S1QB 4LNQA 2Z4IA 5EJWA 5M5YB 3BYYB 3GTGB 3DXJC 4DNRB 1AE2A 4WJ4A 4RKBA 4Q5VA 3RR5A 4J6HA 1H9SA 1X3FA 5FK9C 1GJXA 3WOFA 5M5WB 2XGTA 3I8ZA 4OWTB 4RKLA 1H9KA 2LXKA 3H91A 5H1SE 2E5LL 5E1FA 2I0QA 2D9UA 4KD4A 5IWAQ 1QNUA 4A3MB 1K83H 2WB1G 3HOUG 3CP0A 2VNUD 1FL0A 2VXWA 2UUCQ 3EVQA 1HNZL 1X55A 1RODA 4OO1G 1XTCD 4DAMA 3CQZB 1A6XA 2L5TA 1I5FA 1YHAA 3T1YL 2JEAI 3IL8A 4AH6A 2NN6H 4FXGC 2K6AA 4DV5L 2N8NA 2NVYH 3PF5A 1X6OA 2B3GA 1HUNA 2EDGA 1JE4A 3TQYA 4NXNL 3JAMi 1N9WA 2Z6KC 1UE7A 1L0XB 4L63B 2EYFA 1S4ZA 4A93G 1TWCH 2G5DA 4GNXC 2E2JB 1L0YB 4JI0L 1FYCA 2YTVA 3DM3A 4B08A 1DZ1A 3CC4A 2GN5A 3NEMA 1F2LA 3ERSX 1HA6A 2E2DC 1WD1A 1R4PB 2DUDA 4H7BA 1SJED 1VS0A 3T51B 1I94L 4G57A 4OL7A 3HOZB 4RGTA 3U9SA 4A3DB 2R93H 3HGBA 3KBGA 1PTOC 3TP8A 4BXXH 4C3JG 1TS4A 2VUMH 1Y1WH 2JQOA 1UWVA 3N6RA 2AQ3B 2F0OA 4B3ML 3H0GB 4XQQA 1HUMA 1UE6A 3N52A 1HQMC 2A69D 5EBDA 2JN4A 3S2HB 1LTGD 3RMHA 1BCPF 2FFKB 3F8TA 2OQKA 2LSSA 4P73A 4A3FG 5GAGC 3F2UA 1JICA 2N78A 5E7NA 3J81i 4QY7A 2F4IA 3FHWA 2JA7B 5JVH3 4LF7Q 2DNCA 4LFCQ 1PV4A 1KNEA 3ER0A 1VF7A 3R93A 5FLXE 3NHHA 2KCTA 1PDQA 2N49A 4NW2A 2B2WA 1CZGA 2JYOA 2AUJD 2X69A 3RNUA 3S14H 4KHPQ 2C9OA 2JEBI 1NMGA 4BBRB 5E4WC 4BBRG 4TSSA 2F0MA 1TWFB 3GTOB 3HOXH 2D5DA 2A6HD 5JEAG 4IOCA 3M3YH 3H15A 1PFMA 2E75C 3HRZC 4QGUA 2PI2E 1W6KA 1JWMD 2UUBQ 2K14A 2NWGA 1C9OA 3PCOB 3S14B 1I50H 1QG7A 3OWEB 1Q12A 4HCSA 5C5MA 2Q2HA 2EJMA 4JBJA 3AFQA 1BCPC 3GTLH 2NVXB 4B3TQ 1KAWA 1KNAA 4HJ8A 2NN6I 1CT1D 2K5QA 2SNMA 4GN5A 1STHA 1L1OA 5C4JB 3S9WA 2VQEQ 3FKIH 4JI1Q 2MHVA 4DK0A 1VDZA 1IL2A 1I4QA 1HTPA 1XNQQ 4C3HB 1BDOA 4PZ6A 1G6ZA 2N55A 1OXUA 4A3IH 4JI6Q 2NVTB 1Q8KA 5BN3A 1XMOQ 4K2KA 3PUXA 1XYIA 4DV7Q 1S5DD 2JK8A 1DD2A 3BZKA 3HP3A 4B3TL 3QIAA 5M3FH 1LM0A 4K6LA 1PVOA 2F1MA 2IX3A 3I90A 3R2TA 1S5CD 3GP7A 5FO9B 1HJPA 5LMUL 1HR0L 4C3IB 4KLKA 2O5JC 4X65L 3MHBA 1VQJA 3CKIB 2I07B 1EYDA 5CBAE 2DJGC 1EIHA 1ICFB 1X32A 1VQPA 1GM5A 2EJFC 1I3QB 2K33A 2DY8A 3CQZH 3DWQA 3Q6SA 3BS1A 2OWOA 2B2VA 4B9XA 4R4IA 3FKIB 2UXCL 2HQEA 4LFCL 4P71A 2ALYB 5IP9G 1L0WA 4NDXA 4DXFA 3A5UA 2OTLA 3ND9A 4HMJA 2OT2A 1XPRA 2NN6G 5M5WH 3GTLB 2Y0SB 4HR7B 2O2LD 2K03A 3KF6B 4TVAB 1LACA 2LY7A 4OO1H 1EEID 1IBKQ 3TN2A 3BYTB 4BA2I 4BWGB 3J81j 3DM1A 4JI3L 1OXVA 1VMCA 3IRBA 4QUCA 1A63A 2L9HA 1U4LA 5JJKA 3OOCA 2PYKA 1EY9A 3V2TA 3E9IA 1Y1VB 1PZJD 3I72A 2WINB 1JJ2A 1H9JA 4ZCKA 4OIJA 3TP6A 3CW2C 1AZQA 1GD7A 1QVFA 1Q46A 2BE5C 1YIJA 4CBVA 1BR9A 2MP1A 3E6ZX 4LFAQ 1AN8A 4DGZA 3J80c 1ESFA 1TWHB 1V1PB 1PFSA 3G6JB 1PH4A 2QDBA 3CCJA 2E2HB 4HCEA 4RG1A 1B1ZA 4DAYA 4OX9Q 4X3KA 1PH8A 5CV9A 1OTCA 4F7XA 1J9OA 2IJ0A 3A7LA 3C1EA 1RL2A 3MFYA 5J1ZA 1K3RA 1X56A 4AIMA 4AQYL 4N8X1 1J5EQ 1STEA 1CKOA 1LV9A 2VS1A 4LMQD 1K8AC 4TQUS 1EUJA 2R6GA 5CMDA 4DR7L 1PYSB 1BBXC 2F3WA 1B9MA 4ODGA 1Q1EA 5IYDG 4DV1Q 4N8FA 4XYQA 4A3MG 2N88A 2PO4A 3EBEA 1SYFA 4R1JA 5D3DA 4QJFA 4MNOA 1Q81C 1SXTA 1D7QA 1WD0A 1LTRD 3RZOH 2Q8RE 2K7VA 4RWSC 3J7AF 1GOZA 4ID6A 2QILA 2PZWA 2F0NA 2KCMA 1PH9A 1SJHD 2PI2A 5FJ8H 3QWNA 2VQFL 4KY7A 5E3FA 4LF4L 3NUCA 4MZ9A 2V1CC 2JA8G 2R7ZH 1K3BC 4IN3A 1VQFA 3RLFA 1WTQA 3IAYA 3VR4A 4GN4B 2A6EC 1F77A 3DUZA 2JA5B 4X62Q 2CVRA 3KJOA 5I2XA 2PZUA 1F9QA 2L12A 1TWAH 5K36G 4OWWB 2I5LX 3Q0AA 4K5VA 4JBKA 4KKSA 1U0LA 1VQ8A 5NUCA 1MIUA 3CPWA 1XPOA 4OO1I 3GTPB 1K83B 1CQVA 3TZUA 1Y14B 5HURA 1CHPD 4PMWA 2NTTA 2VZAA 4NPSA 5IP7G 3I4NB 3ULPA 4PMBA 1HZ9A 2WAQB 4JV5L 5KNBA 3JAML 1MKHA 1X3QA 1ESRA 2XWBB 5G3LD 1V1OA 1SMYC 3M7GA 4DR2Q 3S15H 3K7AB 4A3BG 2F0IA 4JI0Q 2PNRC 3IKJA 1RIPA 4JBWA 4B3SQ 2B2UC 4C2MH 1ASYA 4LUOA 2B39A 3BG3A 2IWHA 5C4XH 1I94Q 5JEAJ 3KF8B 2ZXPA 5IYBH 1E0BA 1YHQA 3HOYB 4M1UB 5M3MG 1SYCA 5IY0A 1I6HB 5IGDA 1NBWA 1X3GA 2BDNA 1FNVA 1N8RC 2IT1A 5CV5A 1Q86C 2RDFA 4LUVA 5CV7A 4BY7H 2IX0A 4C2MB 1TT2A 3HKZB 4DR3L 2UUAQ 4MHEA 4C3JB 1PRTF 5DM63 4A3DG 3HZXA 3R3OA 1EY0A 1WCMB 4YWLA 2PZTA 1M1KC 1GUNA 3HFZB 2EYHA 4IUTA 3K6OA 4A3JG 1LTAD 1BKBA 1FR3A 3IFDA 1LUZA 1QJOA 4JI4Q 1HXYD 1Q1BA 4JG2A 2EOTA 2DJFC 1G91A 2ES2A 4EVOA 4DR4L 3C1FA 2KQ3A 1SFOH 3CC7A 1HQRD 2VB3X 5M9OA 3S1RH 2EY2A 1CQFA 1AH9A 3SE0A 2Z8LA 2MNAA 1TS3A 2Q2UA 5I9PA 2KOLA 4IZ8A 5FLXc 2DNEA 3BJUA 2H4OA 4FXDA 2F0QA 3UDGA 4PG3A 1VQMA 5IWAL 5C0XG 3L2PA 1K73C 4H13C 3PIO3 4IFDH 3A7AB 4QUFA 1ZYRC 1HNXL 1BO0A 1W2BA 2F0PA 2PW7A 2XTIA 3CHBD 2LFNA 2M00A 1SDFA 1E1OA 1E22A 2A68C 4H02A 2RCNA 4J15A 1QWYA 1IYVA 3FPUB 2L55A 2Y0SG 1PH3A 1P8LA 2K5HA 4A3FH 5C5LA 3M4OH 3RN5A 2BH8A 1W6JA 5C3XA 1YBYA 5I6WA 1PA6A 2QDLA 5LMNQ 3V96A 1SEBD 1MGSA 3S17B 5CC4A 5KGUA 4ULLA 1GHKA 3EQLC 1KL9A 4DV3Q 1L2FA 3QJYA 3R2IA 4I7ZC 4YY3L 1OXSC 5JJLA 1I4XA 2B29A 2ZT9C 4I7AA 1EU3A 2WAQG 4BY1B 1V43A 1NNXA 4XQNA 1EFID 3NBHB 5IIFA 3NELA 2RCFA 1B2TA 1TWHH 1VQCA 2FMCA 3KUPA 4ZYSA 4DV0L 4GN3B 4JBMA 1IKMA 4L5TA 4IUPA 3L7ZC 1Y1VH 1EEFD 3NK9A 4QCLA 1WFQA 2PMZB 3G4SA 5EPJA 1UE1A 2KCCA 1NY4A 1BCPB 2M9VA 1LT3D 2ZJQA 3CCLA 2KHIA 2L4NA 3KDFA 4DV6L 2HIVA 1A62A 4JOIA 3W5OA 3NTKA 3U9OA 3M9BA 4RGNA 4JK1C 5EKKA 4P74A 4X66Q 4KJNA 2HQLA 4JI8L 4J8QA 2R92B 3PO2H 3STBD 1TVXA 4GKKL 2HHHL 1V1PA 2B2UA 5BR8L 3CXCA 5K36H 4DAYB 3K0XA 5ELBA 1TWGH 3M4PA 4L5QA 2K1BA 3NWTA 4R4QA 1EWCA 4X62L 4RCOA 3K80C 4B3RQ 2EQSA 3D6WA 4IFDG 2RHSB 4KKUA 5C3EB 3L0OA 4HJ5A 1QVGA 4NKLA 4ZLTF 1H95A 1NAPA 3VYTA 2EXDA 1TXYA 4DR6L 1N32L 3HOXG 5FJ8G 3A0JA 4KK7A 1Z9FA 4LK1C 4P75A 4XXEA 1Y8NB 2WV6D 1FD7D 3D31A 3JAMc 1TU2B 4K6DA 4YHHQ 4B9WA 3SGIA 4L8JA 2I46A 5KYIA 1GHJA 2E2IH 4CJ0B 1LT5D 3C2PA 2HD3A 1ICWA 1CHQD 4IO9A 5BR8Q 4A3JH 2CWAA 3I73A 4CKEA 3TMEA 4HIMA 1WOCA 3CRKC 3PGZA 5D14A 1XMOL 3S1NB 4GS3A 3GDEA 2F0LA 5M3FB 2KA7A 1RD9D 4G7OC 5C44H 3BVMA 4KY5A 2OTJA 3K0YA 3SK8A 1WTPA 3W1BA 4RFBA 3RD4A 4BY7G 1VQKA 2CH4W 1D5ZC 4DN4M 3GTMB 2CH4A 1VQ5A 4WJ3M 3NE5B 2NBFA 1ZKOA 3EFXD 5I9OA 4A3IB 2K5VA 2EYOA 2IHFA 4KN4C 1HZCA 2Z9HA 3S1NH 5C4XG 1E24A 5IYBG 5C0XJ 2ZTEA 2BE5D 5A2QL 2PQAB 2RQXA 3OTOQ 4DR1L 2UXDQ 2XN9C 1VQAA 4A75A 1CTMA 2NVTH 1ZYRD 4JI1L 1CUKA 1PXUA 1BBUA 1I4HA 4RHSA 3G71A 4PQXA 1XNRL 1AZPA 4LJZC 1DYQA 3LX0A 4BBSG 1LYLA 5C3EH 2UU9Q 4DKAC 4A3CH 2RDHA 3OW2A 1I50B 2VB2X 5C4JH 3VR3A 1SYDA 1SMXA 1E1TA 1VQIA 3M4QA 1DM0B 1B7YB 4QF4A 1SNDA 1RHPA 1HA5A 3DEOA 2NZOA 4QQBX 1VQ7A 2NVXH 3VYUA 5IGBA 1ENFA 4KKTA 1BQQT 2R7ZG 1TWFH 2R92H 3GTOH 4BBSB 4DK6C 3AQQA 1PH1A 2NVQB 5TSSA 1PH2A 4IUUA 3UE0A 1BNZA 1EIGA 4BS9A 2J0TD 4NXMQ 4BBSH 3A8JE 1QILA 1WTWA 4QMGA 1GUTA 3NSWA 1TY0A 5DAUA 2X6GA 4CDCC 5AFWA 3I2ZA 1QCBD 1R9TB 1RJTA 1K28A 5IYCH 3Q22A 5IT9c 4DNTB 3HOXB 1KXLA 4OONA 5GROA 2A69C 1F9PA 4R9WA 3BZCA 1GXDC 1H9RA 5D3IB 1F2MA 5C3EG 5CV8A 5EPKA 3VR6A 1LLRD 4EQOA 4F87A 1KDAA 1HH2P 1LTTD 4R4CA 4LFBQ 1HPCA 2EY5A 4NB3A 1EYCA 3U58A 5CV6A 4DR3Q 1STAA 2IW3A 4Y52H 1FGBD 4A3LH 4RMFA 5M3FG 3HOZH 2CFMA 1KABA 3TS0A 2NZHA 4K5WA 1IYJB 1HFNA 5I2YA 4B3MQ 2Z6BA 1TY2A 1SE4A 1WTVA 1XPUA 1YNXA 5KNCA 4LF6L 3H0GH 4KY6A 1E3PA 4UP7A 3WOEA 5JVG3 4Z9CB 2F0TA 1MHWC 4OIKA 4ABNA 1S5ED 5HGQA 2XVSA 1LO5D 3ZYYX 3P7JA 2NVYB 4KN7C 5T1IA 4HSVA 1YHBA 5EPLA 4RAUC 2RF4A 1PYBA 2PQEA 2YV5A 3CD6A 1A8VA 2A1AA 4FP5D 3H09A 3D4WA 1A3UA 4G7ZC 1C48A 1SAPA 1JB3A 3O13A 3MA2B 1TS2A 1MSGA 1SE8A 5DLQE 1JJGA 3J80L 3D4RA 4TKOB 2AWNA 1JQYD 1RF2D 4RHRA 4EX5A 1EQVA 2RKSA 3ULLA 2BOSA 2A74C 1X65A 5CORA 2VQFQ 1U4PA 4HSPA 3AYHB 1SNOA 4DV1L 1VQNA 4C3IG 3FRPB 2O4XA 1X3PA 1PHJA 1E2WA 1EY4A 2XSCA 3S1QH 3D4DA 2MO0A 4O2DA 2D62A 1SNCA 1KLUD 4KJOA 1PH5A 2OXPA 1W3SA 3HKZE 3D0FA 2JA5G 3AFPA 3A5ZB 1P16A 3P1HA 1HHVA 4RCNA 2XRQD 3UE1A 4LF7L 3SHLA 1MI2A 1SYGA 2OEOA 4LF5L 1XNRQ 2EVBA 2F52A 1JWSD 3PUVA 2JSOA 4QIWE 4UAIA 3GTGH 4X64L 4DFAA 3Q24A 1PLFA 1FJGL 1GUGA 2L11A 2A68D 1Q7YC 4DA2A 2SEBD 1DOKA 1K0RA 2B2TC 5EKIA 4N9TA 3GTQB 1C4QA 3K5MA 1SE2A 1Y1VG 2EYJA 2EE1A 4MN3A 5GQOA 2EY6A 4K8JA 4HIOA 3GTPH 2MFIA 1YI2A 1B4OA 1EL0A 3MXNB 4NP5A 5JJIA 5AJ3L 3T1HL 3BVZA 1EQRA 1NUCA 3CPFA 5ELNA 4JPBW 2DY7A 2JA5H 1TS5A 4HIKA 4DPGA 3KF8A 5M3MH 3DWAA 1VQBA 4L6TB 1TKWB 4N9PA 1XMQL 2WACA 1CZWA 4GLVB 5CYUA 2R7ZB 3A8IE 3SR1A 2VL6A 3TRZA 2E74C 3U50C 4C1NI 3OSOA 1O7YA 2KBNA 3H6MA 4OEMB 4Y7NH 1PTOH 2C5CA 2B8GA 1WJJA 4DR5L 1KDCA 1CKNB 1UEBA 3GV3A 2QF7A 3MVVA 1QE6A 4CDDC 4KMUC 2F0VA 3KBXA 2EZVA 5K5PA 3GQBA 4GKJL 1IXRA 1Z7TA 3PF4A 1LTID 2RSNA 1F2ZA 1U4RA 2D0PA 5EAYA 4A93B 2JA7G 3G7LA 2G9HD 1ML0D 3SK4A 3P75A 4XIGS 3I4MB 5FO8B 2A6ED 4GOPC 1EYGA 3BZDB 2NYZD 2OQ0A 2XRSD 3NWSA 4C56C 2JA6B 2J7ZA 4DR5Q 1YNJD 2PW5A 1D5MC 4HJ7A 3D6CA 4IOAA 1A0IA 1T5XD 3SVMA 1EFWA 4GKJQ 3OTOL 2UXDL 3P20A 4G7HC 3K5OA 1I4RA 4ZAIA 4YIJA 4FF3A 3PMFA 1ILQA 2CCZA 4GNXA 4LF8L 2KENA 1KTKA 4DV3L 3OMCA 1BBWA 4A3EH 4A3CG 2E8GA 5ELOA 4DUZQ 1VMPA 4BXXG 1JE5A 1QB5D 3I56A 2VUMG 3PIOA 1F9RA 1KD1C 4DV4L 2A8VA 1XMQQ 1KIXA 1CSPA 1MD2D 4L5SA 3R8BA 1RDPD 4OGQC 3A54A 1AEXA 4O42A 5LMNL 3GO5A 3PUYA 3K59A 4DV7L 5KEEA 1CA6A 3CAMA 5FLMH 4CKBA 3GV6A 4A3KB 2YYZA 4DUZL 3K58A 4DV5Q 3S16H 4BA1I 3LNNA 4IUVA 3S1MH 1TWAB 3KFUA 3E0JA 1AP0A 2WFWA 1I3QH 5JPNC 1BCPD 4WJWA 1N33Q 3FPPA 1SMYD 1RTNA 2R3ZA 3HOUH 4DU9A 2BA0A 4A3KG 1K9MC 1IBLQ 1K8OA 1M90C 3S2DB 4DR6Q 3PO3B 3VR2A 1G6PA 1ET6A 4UY8C 3I91A 3QG1A 5IYDH 4X66L 1VQ9A 4GOPB 3QO2A 1UNSA 5FLXL 3C46A 2WKCA 5C6AA 1BOSA 2ZM6Q 3V05A 3LWUA 3RUZA 4FF1A 1ZXTA 1WTHA 3MWYW 4HJAA 3DMUA 1QUQA 2WB1E 4WORA 2R61A 3ICEA 4RH6A 4FO2A 1VQLA 4A3KH 1JB7A 1KAAA 3L9AX 4K0KL 3H0GG 3TP7A 3G6EA 2AMCB 4EGVA 4ZRZA 2MPMA 1JOQA 4DAPA 5A35A 1YJ9A 1MJCA 4GNXB 4UDUC 2K4KA 3ULJA 4DR4Q 1EOTA 1PFNA 3EN2A 3A8KE 3ITPA 1CM9A 3HOZG 3MFGA 1KRSA 1I6VC 2B2TA 1IW7C 2PPBC 2JP1A 3RZDB 3PO2G 5CR3A 4ZUJA 1QVCA 2FMMA 4KHZA 4POFA 1HNWL 1AW7A 1FVIA 3UI2A 2QA4A 1A2UA 4KD3A 3J7AV 3W2DA 1S72A 2RA4A 3JC66 2BDOA 3UDIA 4FF2A 3W3AA 4U68A 1PTOD 4PZ8A 3F2DA 1EZ8A 5JOBA 4DUYQ 3T4AC 1WTOA 2Q2IA 3VA5A 1STBA 4LFBL 3ND8A 2I5HA 3T56B 1O7ZA 1SNPA 2K04A 1OXXK 1LTLA 5BN5A 3H3VI 5IGFA 1YVCA 1QZGA 2K75A 2F0UA 4HMIA 4MTKA 4IFDI 1NSNS 3HKSA 1YNND 1EY7A 2HUGA 3I4MG 1VQDA 4NXNQ 4RA8A 2EXZA 4JOIC 3CCUA 5J39A 1PYWD 2OF1A 2IY5B 2JA6H 4QB4A 1VQ6A 2YTYA 2QKIC 1XX8A 1A15A 1C7YA 2GVBA 2JE6I 3T1YQ 4IJLA 1XJVA 1STYA 2JA7H 4JVZA 1M4VA 3E3XA 3PV0A 3CCSA 4JC0A 4ZUIA 1IYUA 1E7ZA 1Z47A 4CDFC 3M4OB 2K5DA 4AYBB 2E5LQ 2SNSA 1D1IA 5COYA 3K5NA 3QOLA 1GUWA 4FF4A 5EBCA 4G4KA 4IPDA 3CRLC 2UUAL 1F9SA 3VR5A 5KRUA
chains in the Genus database with same CATH topology
5A2QE 3J81E 1G8ZD 1NR4A 3MXUA 4R8IA 4Y7NB 2EPBA 1ONLA 1EY6A 4ZKBB 4EQPA 2WB1B 5JPMC 3J80E 2SDFA 5FO7B 4XQJA 5DEHA 1D1KA 2D2CC 4CJ2C 3HEJA 4P2CB 1PZKD 1U4MA 1H9MA 1VCIA 1IHZA 5FOBB 1SSOA 2KJXA 1JR0D 2MUYA 3EROA 4QIWB 3SEBA 1FNUA 1R4QB 2K28A 4XT1B 4TRDA 1K8MA 5KNDA 3MAQA 5C0XI 4PMCA 2KECA 2EY1A 3M85A 4KV6A 2RSOA 3NQIA 4C3HG 1QNKA 1TWGB 3NP8A 5C4HA 4A3EB 4S3SA 5C4XB 3PO2B 3X3MA 5JAVA 1IW7D 5IODA 2V4DA 3S15B 3E5SA 3FMCA 4DF7A 5IGEA 1GUOA 3PUZA 1DJRD 2Q8IB 2KEDA 2QCPX 1M8AA 5CGKA 3FVQA 3T53B 3J81L 3SDZA 1QOHA 1T5EA 4IQZA 2F3VA 2G9DA 2B63B 2KVMA 1LABA 2AQ2B 2F03A 1PRTC 2B2VC 4H44C 2F0EA 5LL6X 1CI3M 1PTOF 4A3GB 5ELDA 2MGSA 1ENAA 2F0WA 4H0LC 3KLSX 1F2YA 1A3VA 1Y1WB 2GA4B 3NBHA 2R93B 4V190 3MTSA 5ELFA 2F0SA 4IUQA 5C3WA 4F8MA 2LMCB 1G2SA 5ISRA 3QB3A 2JXMB 2ZXRA 5KYLA 3A55A 2KHSA 3S1RB 3URYA 2KEEA 3MXGA 5LL6S 5EKLA 2CQAA 1DCZA 2AWOA 4K8IA 3NXWA 4MIUA 2WIIB 3HOVB 3TDQA 2FHTA 1PRTD 1Y8OB 3TP5A 3OHXC 2LS01 4FXKC 1EZ6A 5LHY1 3NTIA 1ZEQX 3NQTA 1IKLA 3A56A 1B44D 2RBMA 5I4DA 3WDNA 1DOLA 2K01A 2B2YC 1BUVT 2ICIA 4Q0FA 3OMGA 3H3VC 3OWFA 5HGTA 3L3OC 2Z4HA 1NCVA 2CW0D 1OXTA 1RTOA 3EJIA 2L0CA 3MEHA 3D3RA 2RDGA 1HTLD 1GUSA 2HCIA 1KLGD 4O1NA 1BXTA 5JJZA 2H1EA 3T16A 1JCKB 1VF5C 1LTBD 4XDXA 1DONA 2BA1A 1O78A 1HCZA 5KIXA 1II3A 1Y8PB 1UAPA 2X6LA 1TQOA 3DEPA 1RKNA 2JA8B 4IURA 1JWUD 3FEWX 1SNQA 3VYRA 2F0FA 3LWEA 2WP8J 1AFPA 3X3NA 5IGGA 1WTRA 5EGTA 2F0JA 1DOMA 4ME5A 4K14A 3DWPA 3IFTA 5M5XB 1JOOA 3PIP3 2SOBA 3AMUA 1A2TA 1ENCA 1SBBB 1EQTA 3BDOA 4HTHA 1FNWA 3M4YA 4K2LA 2ICEC 1EU4A 4F88A 3ONAB 3NTHA 2F0KA 3TZDA 4XTCS 1H9SB 3BDCA 3EA6A 2M2LA 3NPPA 4NMZA 1WVLA 1S5BD 1SE3A 3QOJA 3CU7A 1ILPA 5F2DA 1MBYA 2CW0C 2AQ1B 2TMPA 1G291 1PZID 3I3CA 1B53A 3KLRA 1D2BA 2CHBD 1J8IA 1JOKA 4XT3B 3JAME 2WKDA 4WRDA 1CFMA 4U673 2QEJC 3PUWA 1WTXA 3D8GA 4C1NK 1LTSD 1SYEA 2IL8A 2K32A 1UUPA 1EY8A 2F0GA 1EY5A 5C4ZA 3T13A 4XYOA 5ELCA 1A3TA 2VUMB 2RVLA 1NR2A 1KDBA 3FDTA 4DAVA 4FYDA 4ZK9B 3HOWB 4IUNA 4WFN3 5C44B 3AU7A 4HN7A 5T1GA 2LKVA 1TR5A 4GZYC 2AUKA 4A3JB 4KHVA 2Z1CA 1DXMA 3C3LA 2HDLA 2MJ8A 1CK1A 3VA7A 1HFGA 1UEAB 2E2IB 3SXHA 3HOUB 3Q23A 3SK6A 1B3AA 2ENBA 2HDMA 4ZKCB 1TIID 1B50A 1C8CA 4LAAA 2NZ1D 1STNA 1EYAA 2E76C 5JEAH 4OHJA 1YNJC 4KTAA 1XXGA 3S1MB 4ILWA 3S16B 4E6IA 3BDLA 1E2ZA 1SNMA 4DXGA 3M7NA 4BY7B 3AB9A 1JORA 1S5FD 3MXPA 3OIPA 2ID0A 4IFDJ 5EQ0A 4I65A 3SK5A 1PMRA 3DHQA 2EYLA 5D65A 3MC0B 2F0DA 2XWJB 3HG9A 4PNYA 5I6YA 4J1MA 1PFBA 4M8AA 4RGOS 3J7YW 1YNNC 3VYSA 1U9RA 3OIQA 2KUMA 4EQNA 1D6EC 1Q90A 1G2TA 2YU9B 1SYBA 1RCVD 2A6HC 1STGA 3GD7A 4IALA 4KI0A 2Q8TA 5IT9E 5FKAC 3M3YB 1Q3LA 3TSSA 2EJGC 5IOCA 2B8FA 2O5IC 5E4XA 2L1BA 5C0XH 1CA5A 1E2VA 2DN8A 4X3TA 2FJ2A 4X3SA 1HRJA 1JC7A 1B9NA 4CHTB 2A5HA 1V8QA 5IGCA 5CBEE 1LT4D 4FNFA 1I4PA 4A3FB 3I4LA 3OPOA 2NUCA 4FVMA 2XNAC 1D5XC 2EYMA 2K5WA 1IL8A 2ZXOA 1Z6HA 2KCNA 3RZOB 1EWHA 2A73B 4DK1A 4HEDA 2FINB 1XWEA 3TBIB 3GTKB 4V0BA 2BCOA 3NBIA 5M3MB 4CJ1B 2K05A 4CKCA 2TSSA 4HAEA 3K57A 1TWCB 1ET9A 5CV4A 3BVGA 1PTOB 2IPKD 3OW7A 2EYPA 5DM73 4A3BB 2PCFB 1SFOB 4K5XA 5DNFA 3H94A 5J22A 1Y69U 2NB0A 3HS0C 4CGYB 4PV1C 2B2YA 4RGMA 4ZQ3A 1MSHA 1I4GA 5IT9L 2B2WC 2F0HA 1OO9B 1O80A 5ELEA 5G3LF 2XIWA 3K5LA 2IX1A 2HCCA 4R8NA 4X3UA 1PRTB 3ERQA 1BF4A 1LT6D 2J4XA 2NTSA 1O7LA 1Q8IA 3MZ5A 3KK7A 3KLSA 5BN4A 3MXNA 3GTJB 3I70A 3S1QB 2Z4IA 5EJWA 5M5YB 3BYYB 3GTGB 3DXJC 4DNRB 4RKBA 4Q5VA 4J6HA 1H9SA 5FK9C 1GJXA 3WOFA 5M5WB 3I8ZA 4RKLA 1H9KA 3H91A 5E1FA 2D9UA 4KD4A 1QNUA 4A3MB 2VNUD 2VXWA 3EVQA 1RODA 4OO1G 1XTCD 3CQZB 1A6XA 2L5TA 2JEAI 3IL8A 2NN6H 4FXGC 2K6AA 1HUNA 2EDGA 1JE4A 1L0XB 4L63B 2EYFA 1S4ZA 2E2JB 1L0YB 1FYCA 4B08A 1DZ1A 1F2LA 1HA6A 2E2DC 1WD1A 1R4PB 4H7BA 1SJED 3T51B 3HOZB 4G57A 4OL7A 4RGTA 3U9SA 4A3DB 3HGBA 3KBGA 1PTOC 3TP8A 4C3JG 1TS4A 3N6RA 2AQ3B 2F0OA 3H0GB 4XQQA 1HUMA 3N52A 1HQMC 2A69D 5EBDA 3S2HB 1LTGD 3RMHA 1BCPF 2FFKB 3F2UA 1JICA 2F4IA 2JA7B 5JVH3 2DNCA 1KNEA 1VF7A 3R93A 5FLXE 3NHHA 1PDQA 4NW2A 2B2WA 1CZGA 2JYOA 2AUJD 2X69A 2C9OA 2JEBI 4BBRB 5E4WC 4TSSA 2F0MA 1TWFB 3GTOB 2D5DA 2A6HD 5JEAG 1PFMA 2E75C 3HRZC 1W6KA 1JWMD 2NWGA 3S14B 1QG7A 3OWEB 1Q12A 4HCSA 5C5MA 2EJMA 1BCPC 2NVXB 1KNAA 2NN6I 1CT1D 2K5QA 2SNMA 1STHA 5C4JB 3S9WA 4DK0A 2MHVA 1VDZA 1I4QA 1HTPA 4C3HB 1BDOA 1G6ZA 2N55A 1OXUA 2NVTB 5BN3A 4K2KA 3PUXA 1XYIA 1S5DD 1DD2A 3HP3A 3QIAA 4K6LA 2F1MA 2IX3A 3I90A 3R2TA 1S5CD 3GP7A 5FO9B 4C3IB 2O5JC 3MHBA 3CKIB 2I07B 1EYDA 5CBAE 1EIHA 1X32A 2EJFC 1I3QB 2K33A 2DY8A 3DWQA 3Q6SA 3BS1A 2B2VA 4B9XA 3FKIB 2HQEA 4NDXA 4DXFA 3ND9A 4HMJA 2OT2A 2NN6G 3GTLB 2Y0SB 4HR7B 2O2LD 2K03A 1LACA 2LY7A 4OO1H 1EEID 3TN2A 3BYTB 4BA2I 4BWGB 3DM1A 1OXVA 1VMCA 4QUCA 2L9HA 1U4LA 3OOCA 2PYKA 1EY9A 3V2TA 1Y1VB 1PZJD 3I72A 2WINB 1H9JA 4OIJA 3TP6A 1AZQA 2BE5C 4CBVA 1BR9A 2MP1A 3E6ZX 1AN8A 4DGZA 1ESFA 1TWHB 1V1PB 3G6JB 2QDBA 2E2HB 4HCEA 4DAYA 1B1ZA 4X3KA 5CV9A 4F7XA 1J9OA 2IJ0A 3A7LA 3C1EA 3MFYA 5J1ZA 1STEA 1LV9A 4LMQD 4TQUS 2R6GA 5CMDA 1BBXC 2F3WA 1B9MA 4ODGA 1Q1EA 4XYQA 2N88A 2PO4A 1SYFA 5D3DA 1SXTA 1WD0A 1LTRD 2Q8RE 2K7VA 4RWSC 3J7AF 1GOZA 4ID6A 2QILA 2PZWA 2F0NA 1SJHD 3QWNA 4KY7A 5E3FA 3NUCA 4IN3A 3RLFA 1WTQA 3IAYA 3VR4A 2A6EC 1F77A 3DUZA 2JA5B 2CVRA 5I2XA 2PZUA 1F9QA 2L12A 5K36G 3Q0AA 4K5VA 4KKSA 5NUCA 4OO1I 3GTPB 1K83B 1CQVA 3TZUA 5HURA 1CHPD 4PMWA 2NTTA 3I4NB 4PMBA 2WAQB 5KNBA 3JAML 1X3QA 1ESRA 2XWBB 5G3LD 1V1OA 1SMYC 3M7GA 3K7AB 2F0IA 2PNRC 3IKJA 4JBWA 2B2UC 2B39A 3BG3A 2IWHA 5JEAJ 2ZXPA 1E0BA 3HOYB 4M1UB 1SYCA 1I6HB 5IGDA 2BDNA 1FNVA 2IT1A 5CV5A 2RDFA 5CV7A 2IX0A 4C2MB 1TT2A 3HKZB 4MHEA 4C3JB 1PRTF 5DM63 3HZXA 3R3OA 1EY0A 1WCMB 2PZTA 1GUNA 2EYHA 4IUTA 3K6OA 1LTAD 1FR3A 3IFDA 1QJOA 1HXYD 1Q1BA 2EOTA 1G91A 4EVOA 3C1FA 2KQ3A 1HQRD 2VB3X 5M9OA 2EY2A 1CQFA 3SE0A 2Z8LA 1TS3A 5I9PA 2KOLA 4IZ8A 2DNEA 2H4OA 4FXDA 2F0QA 5C0XG 4IFDH 4H13C 3PIO3 3A7AB 4QUFA 1ZYRC 1BO0A 2F0PA 2PW7A 3CHBD 2LFNA 2M00A 1SDFA 2A68C 1QWYA 1IYVA 3FPUB 2L55A 5C5LA 1W6JA 5C3XA 5I6WA 3V96A 1SEBD 1MGSA 3S17B 5CC4A 5KGUA 4ULLA 1GHKA 3EQLC 3QJYA 3R2IA 4I7ZC 1OXSC 1I4XA 2ZT9C 1EU3A 4BY1B 1V43A 4XQNA 1EFID 5IIFA 1B2TA 2FMCA 3KUPA 4ZYSA 1IKMA 4IUPA 3L7ZC 3NK9A 1EEFD 4QCLA 2PMZB 5EPJA 2KCCA 1BCPB 2M9VA 1LT3D 2L4NA 3NTKA 3U9OA 5EKKA 4RGNA 4JK1C 4KJNA 4J8QA 2R92B 1TVXA 1V1PA 2B2UA 5K36H 5ELBA 2K1BA 3NWTA 1EWCA 4RCOA 3D6WA 4IFDG 4KKUA 5C3EB 4NKLA 4ZLTF 1NAPA 3VYTA 4KK7A 4LK1C 4XXEA 1Y8NB 2WV6D 1FD7D 3D31A 1TU2B 4K6DA 4B9WA 4L8JA 2I46A 5KYIA 1GHJA 4CJ0B 1LT5D 3C2PA 1ICWA 1CHQD 3I73A 4CKEA 3TMEA 3CRKC 5D14A 3S1NB 2F0LA 5M3FB 2KA7A 1RD9D 4G7OC 3BVMA 4KY5A 3K0YA 3SK8A 1WTPA 4RFBA 3RD4A 1D5ZC 4DN4M 3GTMB 3NE5B 2NBFA 1ZKOA 3EFXD 5I9OA 4A3IB 2EYOA 4KN4C 5C0XJ 2BE5D 5A2QL 2RQXA 2XN9C 1CTMA 1ZYRD 1PXUA 4RHSA 1I4HA 4PQXA 1AZPA 4LJZC 1DYQA 3LX0A 2RDHA 1I50B 2VB2X 3VR3A 1SYDA 1DM0B 4QF4A 1SNDA 1RHPA 1HA5A 3DEOA 3VYUA 5IGBA 1ENFA 4KKTA 1BQQT 4BBSB 2NVQB 5TSSA 4IUUA 1BNZA 1EIGA 4BS9A 2J0TD 3A8JE 1QILA 1WTWA 4QMGA 1GUTA 3NSWA 1TY0A 5DAUA 2X6GA 5AFWA 1QCBD 1R9TB 3Q22A 1RJTA 4DNTB 3HOXB 2A69C 1F9PA 4R9WA 1GXDC 1H9RA 5D3IB 1F2MA 5CV8A 5EPKA 3VR6A 1LLRD 4EQOA 4F87A 1KDAA 1LTTD 1HPCA 2EY5A 1EYCA 5CV6A 1STAA 2IW3A 1FGBD 1KABA 4K5WA 1HFNA 5I2YA 1TY2A 1SE4A 1WTVA 5KNCA 4KY6A 3WOEA 5JVG3 4Z9CB 2F0TA 4ABNA 4OIKA 1S5ED 2XVSA 1LO5D 3ZYYX 3P7JA 2NVYB 4KN7C 5T1IA 4HSVA 5EPLA 4RAUC 2PQEA 4FP5D 3H09A 3D4WA 1A3UA 4G7ZC 1C48A 1SAPA 1JB3A 3O13A 3MA2B 1TS2A 1MSGA 3J80L 3D4RA 4TKOB 2AWNA 1JQYD 1RF2D 4RHRA 1EQVA 2RKSA 2BOSA 2A74C 5CORA 1U4PA 4HSPA 1SNOA 4C3IG 3FRPB 2O4XA 1X3PA 1E2WA 1EY4A 2XSCA 3D4DA 2D62A 1SNCA 1KLUD 4KJOA 2OXPA 3P1HA 1HHVA 4RCNA 2XRQD 3SHLA 1MI2A 1SYGA 2OEOA 2EVBA 1JWSD 3PUVA 2JSOA 4UAIA 4DFAA 3Q24A 1PLFA 1GUGA 2L11A 2A68D 4DA2A 2SEBD 1DOKA 2B2TC 5EKIA 4N9TA 3GTQB 1C4QA 3K5MA 1SE2A 2EYJA 2EE1A 4MN3A 2EY6A 4K8JA 1B4OA 1EL0A 4NP5A 3BVZA 1NUCA 2DY7A 1TS5A 3KF8A 3DWAA 4L6TB 1TKWB 4N9PA 2WACA 1CZWA 5CYUA 2R7ZB 3A8IE 3SR1A 2E74C 4C1NI 3OSOA 1O7YA 3H6MA 1PTOH 2C5CA 2B8GA 1KDCA 3GV3A 2QF7A 3MVVA 1QE6A 4KMUC 2F0VA 3KBXA 2EZVA 5K5PA 3GQBA 1Z7TA 1LTID 2RSNA 1F2ZA 1U4RA 4A93B 3G7LA 2G9HD 1ML0D 3SK4A 3P75A 4XIGS 3I4MB 5FO8B 2A6ED 3BZDB 2NYZD 2XRSD 3NWSA 4C56C 2JA6B 2J7ZA 1YNJD 2PW5A 1D5MC 3D6CA 1T5XD 3SVMA 3P20A 4G7HC 3K5OA 1I4RA 4ZAIA 4YIJA 4FF3A 3PMFA 1ILQA 1KTKA 3OMCA 1VMPA 1QB5D 1F9RA 1MD2D 3R8BA 1RDPD 4OGQC 3A54A 1AEXA 4O42A 3GO5A 3PUYA 3K59A 5KEEA 1CA6A 4CKBA 3GV6A 4A3KB 2YYZA 3K58A 4BA1I 3LNNA 4IUVA 1TWAB 3E0JA 1AP0A 5JPNC 1BCPD 4WJWA 3FPPA 1SMYD 1RTNA 2R3ZA 4DU9A 2BA0A 1K8OA 3S2DB 3PO3B 3VR2A 1ET6A 3I91A 3QG1A 3QO2A 1UNSA 5FLXL 3C46A 2WKCA 5C6AA 1BOSA 3V05A 3LWUA 3RUZA 4FF1A 1ZXTA 3MWYW 3DMUA 4WORA 2R61A 4RH6A 4FO2A 1KAAA 3L9AX 3TP7A 4EGVA 4ZRZA 2MPMA 1JOQA 4DAPA 5A35A 4UDUC 1EOTA 1PFNA 3A8KE 3ITPA 1CM9A 3MFGA 1I6VC 2B2TA 1IW7C 2PPBC 2JP1A 3RZDB 5CR3A 4ZUJA 2FMMA 4KHZA 1AW7A 3UI2A 1A2UA 4KD3A 3J7AV 3W2DA 2RA4A 2BDOA 4FF2A 3W3AA 4U68A 1PTOD 1EZ8A 5JOBA 3T4AC 1WTOA 3VA5A 1STBA 3ND8A 3T56B 1O7ZA 1SNPA 2K04A 1OXXK 5BN5A 5IGFA 2F0UA 4HMIA 4IFDI 1NSNS 1YNND 1EY7A 2HUGA 4RA8A 2EXZA 5J39A 1PYWD 2OF1A 4QB4A 2QKIC 1XX8A 1A15A 2JE6I 1STYA 1M4VA 3PV0A 4ZUIA 1IYUA 1Z47A 3M4OB 2K5DA 4AYBB 2SNSA 1D1IA 5COYA 3K5NA 3QOLA 1GUWA 4FF4A 5EBCA 4G4KA 3CRLC 1F9SA 3VR5A 5KRUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EJM A;  4DNT B;  5K36 G;  2A69 C;  1T5E A;  3WDN A;  4BA2 I;  3MXU A;  4IQZ A;  4RCN A;  2A68 C;  4KKS A;  4XTC S;  2E76 C;  1H9R A;  1H9S B;  3I73 A;  2EDG A;  1OXV A;  5JEA H;  1LAB A;  1ONL A;  1IYV A;  2NN6 I;  3CRK C;  3VR6 A;  1YNJ C;  2EVB A;  3TZU A;  3OOC A;  3P20 A;  4G7H C;  3I72 A;  2KA7 A;  3PUV A;  5A35 A;  4G7O C;  4H44 C;  1CI3 M;  1GUG A;  1HPC A;  2D2C C;  4DK0 A;  1E2Z A;  2A68 D;  2CW0 C;  3OW7 A;  1FYC A;  1OXT A;  1H9J A;  5KNB A;  3M7N A;  1VDZ A;  3A8K E;  2PCF B;  3AB9 A;  1G29 1;  1I6V C;  1GHK A;  1SMY C;  1HTP A;  3NE5 B;  3EQL C;  1ZKO A;  1IW7 C;  1BDO A;  1H9M A;  1VCI A;  3QJY A;  2PPB C;  4H0L C;  1GUS A;  2BE5 C;  3H94 A;  2PNR C;  4I7Z C;  3IKJ A;  1OXS C;  4JBW A;  4KHZ A;  1Y69 U;  4KN4 C;  1PMR A;  3KLR A;  3T51 B;  2ZT9 C;  1OXU A;  3U9S A;  3BG3 A;  1V43 A;  2BE5 D;  3HGB A;  4PV1 C;  5BN3 A;  1VF5 C;  5KNC A;  3PUX A;  2BDO A;  3N6R A;  1YNN C;  3W3A A;  1DD2 A;  2BA1 A;  3QIA A;  1Q90 A;  1O78 A;  2LMC B;  3L7Z C;  1HCZ A;  2IT1 A;  1CTM A;  4OGQ C;  1K8M A;  1HQM C;  2A6H C;  2A69 D;  5KND A;  2F1M A;  3GD7 A;  2KCC A;  2JXM B;  4KI0 A;  1CFM A;  3A7L A;  3ND8 A;  3T56 B;  3MFY A;  3SDZ A;  1TKW B;  1Y8P B;  3PUY A;  1OXX K;  2EJG C;  5BN5 A;  3PUW A;  4KN7 C;  4TQU S;  2B8F A;  3A8I E;  3M85 A;  2O5I C;  4LJZ C;  2R6G A;  2E74 C;  4JK1 C;  1O7L A;  1GUN A;  2K32 A;  1B9M A;  2YYZ A;  5C0X H;  1Q1E A;  2O5J C;  1E2V A;  2DN8 A;  5BN4 A;  1FR3 A;  2B8G A;  4G7Z C;  1DCZ A;  4BA1 I;  1QJO A;  2DNC A;  3DXJ C;  3LNN A;  3VR3 A;  2AWO A;  1Q1B A;  1VF7 A;  2QF7 A;  4DNR B;  5K36 H;  2EJF C;  2K7V A;  1H9S A;  4KMU C;  2K33 A;  1B9N A;  2AUJ D;  1IW7 D;  1Y8O B;  2JEB I;  3FPP A;  2JE6 I;  1GJX A;  3D4R A;  4TKO B;  1V8Q A;  3SE0 A;  2D5D A;  2V4D A;  2A6H D;  1H9K A;  3GQB A;  4KKT A;  4KKU A;  4IFD G;  1Z7T A;  5JEA G;  2BA0 A;  2DNE A;  3I4L A;  3OPO A;  1K8O A;  2E75 C;  3IFT A;  3PV0 A;  3FMC A;  3VR2 A;  4GZY C;  1IYU A;  3QG1 A;  3ND9 A;  5C0X G;  4IFD H;  4H13 C;  4XIG S;  1GUO A;  2NN6 G;  3A7A B;  2AUK A;  3PUZ A;  2Q8I B;  3RLF A;  3A8J E;  4LK1 C;  4OO1 G;  1ZYR C;  4HR7 B;  1Y8N B;  3VR4 A;  1DXM A;  1GUT A;  3BDO A;  2A6E D;  1E2W A;  3D31 A;  2A6E C;  1TU2 B;  1Z6H A;  1A6X A;  2L5T A;  4L8J A;  3LWU A;  3VA7 A;  2D62 A;  2JEA I;  1EWH A;  1Q12 A;  3CRL C;  3T53 B;  1GHJ A;  3M4Y A;  1LAC A;  3VR5 A;  4OO1 H;  2NN6 H;  4DK1 A; 
#chains in the Genus database with same CATH topology
 3F2B A;  2C35 B;  2JA9 A;  5A2Q E;  3J81 E;  2AHO B;  1G8Z D;  2UUB L;  1L1O C;  1NR4 A;  3MXU A;  3F2C A;  4AYB G;  4R8I A;  4Y7N B;  4DV2 L;  2EPB A;  3PIP A;  1ONL A;  1EY6 A;  1SRO A;  4EQP A;  4ZKB B;  2WB1 B;  3PO3 H;  5JPM C;  3TRE A;  3J80 E;  2SDF A;  5FO7 B;  4XQJ A;  2Z6K A;  5DEH A;  1PH6 A;  1D1K A;  2D2C C;  3I4N G;  1VQE A;  4CJ2 C;  5HY6 A;  1N34 Q;  3HEJ A;  4A3E G;  4UHV A;  4P2C B;  1PZK D;  1U4M A;  1H9M A;  1VCI A;  1IHZ A;  5FOB B;  4DUY L;  1SSO A;  2KJX A;  4DR1 Q;  1JR0 D;  2MUY A;  1CKN A;  3ERO A;  4QIW B;  3SEB A;  1BVS A;  3KDF B;  1FNU A;  4JI3 Q;  1R4Q B;  2K28 A;  4XT1 B;  4TRD A;  1K8M A;  1EWI A;  5KND A;  3RN2 A;  3W1G A;  3MAQ A;  2WAQ E;  5C0X I;  2HT1 A;  4PMC A;  1QZH A;  1Y1W G;  2EIF A;  1D8L A;  2KEC A;  4JCV E;  4C3J H;  1FGU A;  2EY1 A;  3PO3 G;  3M85 A;  4KV6 A;  1NE3 A;  3ZJY C;  2RSO A;  3NQI A;  4C3H G;  1EIY B;  2K50 A;  4K0K Q;  1QNK A;  1TWG B;  2GVA A;  1IBK L;  3NP8 A;  3HOY H;  3S24 A;  5C4H A;  1IZ6 A;  4B3R L;  4A3E B;  4LUZ A;  4S3S A;  5C4X B;  3PO2 B;  3X3M A;  3HOW G;  4UP8 A;  1Q82 C;  5JAV A;  1IW7 D;  4HID A;  5IOD A;  1C0A A;  1B3Q A;  3Q8D A;  2R7D A;  5M5Y H;  1N36 L;  2VY3 A;  2K52 A;  2V4D A;  3S15 B;  3E5S A;  2HHH Q;  2QGQ A;  4NXM L;  4GKK Q;  3FMC A;  1YZ6 A;  4DF7 A;  2UU9 L;  3HOV H;  3OYY A;  5IGE A;  1GUO A;  3PUZ A;  1DJR D;  2Q8I B;  1IBL L;  2KED A;  3PQI A;  2QCP X;  1M8A A;  4BBR H;  3FVQ A;  5CGK A;  3T53 B;  3J81 L;  3SDZ A;  3CC2 A;  4LF9 L;  1QOH A;  3K7U C;  1T5E A;  4JI8 Q;  4IQZ A;  3I4M H;  2F3V A;  2G9D A;  2B63 B;  2KVM A;  2PNH A;  1LAB A;  2AQ2 B;  2F03 A;  1PRT C;  2B2V C;  2Z0S A;  3KLW A;  1EOV A;  4H44 C;  2F0E A;  3G48 A;  5LL6 X;  1CI3 M;  3K8A A;  1PTO F;  4A3G B;  1PH7 A;  4A3B H;  2CWP A;  5ELD A;  2MGS A;  1ENA A;  4LF8 Q;  2F0W A;  3EIV A;  4H0L C;  1O7I A;  3KLS X;  1F2Y A;  1A3V A;  1Y1W B;  1U5K A;  2GA4 B;  3NBH A;  5LMU Q;  4IPC A;  4DK3 C;  4LF5 Q;  4APV A;  4A3D H;  2R93 B;  1JJC B;  3E0E A;  4A3G H;  3LGJ A;  4V19 0;  3MTS A;  5ELF A;  2F0S A;  4IUQ A;  4OWX B;  5C3W A;  4F8M A;  2LMC B;  1UE5 A;  4JI5 L;  1G2S A;  5ISR A;  3QB3 A;  1FJG Q;  2JXM B;  2ZXR A;  5KYL A;  3A55 A;  1SRU A;  2KHS A;  4JI7 Q;  1DGS A;  1EIF A;  3S1R B;  3URY A;  2KEE A;  3MXG A;  3CCQ A;  1N32 Q;  5LL6 S;  1EQQ A;  3E9H A;  2E2H H;  5EKL A;  2CQA A;  1DCZ A;  3QR8 A;  1CSQ A;  2ATW A;  1QUQ B;  2AWO A;  4K8I A;  1R9T H;  2UXB L;  3NXW A;  4MIU A;  1CKM A;  2WII B;  3HOV B;  3TDQ A;  2B63 H;  2FHT A;  1PRT D;  1Y8O B;  2MQH A;  3TP5 A;  1WCM H;  2ZM6 L;  3OHX C;  2LS0 1;  5IE8 A;  4FXK C;  3MEF A;  4A3M H;  2R92 G;  1EZ6 A;  5LHY 1;  3NTI A;  1KQS A;  1G51 A;  1ZEQ X;  3NQT A;  1N36 Q;  3B6Y A;  1WCM G;  1VQH A;  1IKL A;  3A56 A;  3DLL A;  4AYB E;  2JA6 G;  4A76 A;  1B44 D;  2RBM A;  2YTX A;  5I4D A;  2UXB Q;  1GKH A;  3WDN A;  4MTN A;  1DOL A;  2K01 A;  2B2Y C;  5AJ3 Q;  3GTJ H;  4X6A H;  4X65 Q;  2D0O A;  1ASZ A;  1BUV T;  2ICI A;  4Q0F A;  1X9N A;  4JI6 L;  3OMG A;  3A74 A;  3H3V C;  1XTD A;  2A19 A;  3OWF A;  5HGT A;  3L3O C;  2Z4H A;  1NCV A;  2CW0 D;  4DV6 Q;  1OXT A;  1RTO A;  3EJI A;  2L0C A;  3MEH A;  2MO1 A;  3D3R A;  2RDG A;  1HTL D;  4PZ7 A;  1GUS A;  2HCI A;  4LF6 Q;  1KLG D;  3U4V A;  4O1N A;  1BXT A;  5JJZ A;  4YCV A;  3J81 c;  1HR0 Q;  2H1E A;  4DNI A;  3T16 A;  1JCK B;  1S40 A;  1VF5 C;  1HNW Q;  1LTB D;  4XDX A;  1DON A;  2BA1 A;  4DR2 L;  3I7F A;  4UPA A;  3I4O A;  1O78 A;  2L15 A;  1HZA A;  1HCZ A;  4A4I A;  5KIX A;  3CCV A;  1II3 A;  1Y8P B;  1UAP A;  4JI2 L;  2Q2T A;  2X6L A;  1TQO A;  3DEP A;  3J80 i;  4DV2 Q;  1GVP A;  4YY3 Q;  1SLJ A;  1YJW A;  3GTK H;  4JW0 A;  4LF4 Q;  1RKN A;  5IP9 H;  2JA8 B;  4IUR A;  1JWU D;  3FEW X;  1SNQ A;  2RHQ B;  2F0F A;  3VYR A;  4GLA C;  1N34 L;  1SN8 A;  3LWE A;  3FP9 A;  2WP8 J;  4R4T A;  1K8G A;  1AFP A;  3X3N A;  1WI5 A;  5IGG A;  1WTR A;  5EGT A;  3CCR A;  2OCE A;  2F0J A;  4OXP A;  1DOM A;  5L37 A;  4ME5 A;  2ZJR A;  4K14 A;  3DWP A;  3IFT A;  2ASB A;  5M5X B;  3CCM A;  1JOO A;  3PIP 3;  2SOB A;  1HZB A;  3AMU A;  1A2T A;  1ENC A;  1SBB B;  1EQT A;  4IPH A;  4ME3 A;  3BDO A;  2B63 G;  4HTH A;  1FNW A;  3M4Y A;  2VW9 A;  4K2L A;  2ICE C;  1EU4 A;  4F88 A;  3ONA B;  3NTH A;  4GOP A;  2F0K A;  1GO3 E;  3TZD A;  4XTC S;  1H9S B;  4BY1 G;  3BDC A;  3EA6 A;  2F4V L;  2M2L A;  3NPP A;  4LFA L;  4NMZ A;  2NVQ H;  1WVL A;  4JYA Q;  1S5B D;  1SE3 A;  1JT8 A;  3QOJ A;  4LWC A;  3CU7 A;  1S3O A;  1ILP A;  5F2D A;  1MBY A;  2CW0 C;  2AQ1 B;  2TMP A;  3PSI A;  1G29 1;  1PZI D;  3I3C A;  1B53 A;  1VQO A;  4A3G G;  3KLR A;  1MJE A;  1YEZ A;  4QL5 A;  1D2B A;  2CHB D;  3J7Z C;  1J8I A;  3CF5 A;  1JOK A;  4B3S L;  4XT3 B;  1V1Q A;  3JAM E;  3S17 H;  1WYD A;  2WKD A;  1X3E A;  4WRD A;  1CFM A;  3UDX A;  4U67 3;  2DGY A;  2CKZ B;  4YHH L;  2QEJ C;  2JJQ A;  3RZD H;  3PUW A;  1KHI A;  3D8G A;  4OEL B;  4YCW A;  4C1N K;  1LTS D;  1WTX A;  3KJP A;  1HR0 W;  3RLN A;  1SYE A;  4YWK A;  2IL8 A;  2K32 A;  1UUP A;  1EY8 A;  4L5R C;  2F0G A;  1EY5 A;  5C4Z A;  3T13 A;  3H3V H;  4XYO A;  2ZTD A;  5ELC A;  1A3T A;  2VUM B;  2RVL A;  4IPG A;  1NR2 A;  3VDY A;  1KDB A;  3FDT A;  4ALP A;  4DAV A;  3FKI G;  3BU2 A;  3GTM H;  4FYD A;  4ZK9 B;  3HOW B;  1T9H A;  4C3I H;  4JYA L;  4IUN A;  4WFN 3;  1L1O B;  5C44 B;  3HOV G;  3AU7 A;  4GLX A;  4HN7 A;  5T1G A;  2LKV A;  3CME A;  1TR5 A;  4GZY C;  2H5X A;  2AUK A;  4A3J B;  4KHV A;  2Z1C A;  2R7F A;  1DXM A;  3C3L A;  1B8A A;  2HDL A;  2MJ8 A;  3HOW H;  1CK1 A;  3VA7 A;  3S2D H;  1HFG A;  1UEA B;  4POG A;  2E2I B;  3SXH A;  1N33 L;  5GAH C;  4YCU A;  3HOU B;  3Q23 A;  3SK6 A;  1B3A A;  2ENB A;  2HDM A;  4ZKC B;  1TII D;  1JMC A;  3HOY G;  1B50 A;  1C8C A;  4LAA A;  2UUC L;  2NZ1 D;  1STN A;  2IHE A;  4FDB A;  4UP9 A;  4C3H H;  1EYA A;  2E76 C;  5JEA H;  1KRT A;  4OHJ A;  3AEV A;  2UXC Q;  1YNJ C;  4KTA A;  4CDE C;  1XXG A;  3S1M B;  3I55 A;  3J7A 5;  4ILW A;  2R93 G;  4A3I G;  4E6I A;  3BDL A;  3S16 B;  1E2Z A;  1SNM A;  1YIT A;  4DXG A;  4AQY Q;  1J5E L;  3M7N A;  4BY7 B;  3AB9 A;  1JOR A;  1XNQ L;  1S5F D;  3MXP A;  3OIP A;  2ID0 A;  4IFD J;  5EQ0 A;  4I65 A;  3STB C;  4JI5 Q;  1NMF A;  2BH2 A;  3SK5 A;  1PMR A;  3DHQ A;  2EYL A;  3RLO A;  5D65 A;  3MC0 B;  2F0D A;  4DR7 Q;  2Y0S E;  2XWJ B;  3HG9 A;  4PNY A;  4JI7 L;  5I6Y A;  4J1M A;  1PFB A;  4M8A A;  3NEN A;  4RGO S;  3J7Y W;  4JI2 Q;  1VQG A;  1YNN C;  3VYS A;  1U9R A;  3OIQ A;  2KHJ A;  2PMZ E;  2KUM A;  3K7A H;  4R4O A;  4EQN A;  1D6E C;  1Q90 A;  1G2T A;  2YU9 B;  2HIX A;  1SYB A;  1RCV D;  2FXQ A;  4A3L G;  4IJH A;  1V9P A;  2A6H C;  4OX9 L;  1STG A;  3GD7 A;  4IAL A;  1AE3 A;  2P5Z X;  4KI0 A;  3I4N H;  2Q8T A;  5IT9 E;  5FKA C;  3M3Y B;  3U4Z A;  1Q3L A;  2N3S A;  3TSS A;  2EJG C;  4DV4 Q;  2LXJ A;  1IBM L;  5IOC A;  2B8F A;  2O5I C;  5E4X A;  2L1B A;  5C0X H;  1CA5 A;  1E2V A;  2DN8 A;  3KF6 A;  4X3T A;  3KOJ A;  2FJ2 A;  4BY1 H;  4X3S A;  5GAE C;  2CQO A;  4HJ9 A;  1HRJ A;  3TEH B;  4LF9 Q;  5IYC G;  1JC7 A;  4A93 H;  2AKW B;  1HNX Q;  1B9N A;  1J6Q A;  4CHT B;  2A5H A;  1V8Q A;  5IGC A;  5CBE E;  1LT4 D;  2QW7 A;  4FNF A;  1I4P A;  1NJI C;  4A3F B;  3I4L A;  3OPO A;  2NUC A;  5M5X H;  3S2H H;  5J3B A;  4FVM A;  2XNA C;  1D5X C;  2EYM A;  2K5W A;  2K5N A;  1IL8 A;  2ZXO A;  4P72 A;  2I5M X;  1Z6H A;  2KCN A;  5LMN W;  2ZTC A;  3RZO B;  1EWH A;  1NTG A;  2F3I A;  3CMA A;  1KC8 C;  3UDF A;  4JI4 L;  4YWM A;  2A73 B;  4LW1 A;  4DK1 A;  4HED A;  2FIN B;  1XWE A;  3TBI B;  2JA8 H;  3TS2 A;  3T1H Q;  3GTK B;  4V0B A;  2BCO A;  3NBI A;  3K81 C;  5M3M B;  3WWV A;  4CJ1 B;  2K05 A;  4CKC A;  5GAD C;  2TSS A;  4HAE A;  5FLM G;  1YJN A;  2E2J H;  3K57 A;  1TWC B;  4KHP L;  1ET9 A;  5CV4 A;  1IBM Q;  3BVG A;  1PTO B;  2IPK D;  3F1Z A;  3OW7 A;  2EYP A;  5DM7 3;  4A3B B;  2PCF B;  1SFO B;  1X54 A;  4K5X A;  5DNF A;  3H94 A;  5J22 A;  1Y69 U;  2VQE L;  2NB0 A;  3HS0 C;  4CGY B;  5IP7 H;  4PV1 C;  2B2Y A;  4RGM A;  4ZQ3 A;  1MSH A;  1I4G A;  5IT9 L;  2B2W C;  1B70 B;  2F0H A;  1OO9 B;  4EQ5 A;  2ZJP A;  3HKZ G;  1K0S A;  1O80 A;  5ELE A;  5G3L F;  1SR3 A;  1VQ4 A;  2XIW A;  3K5L A;  2IX1 A;  4JV5 Q;  2HCC A;  2PQA A;  4R8N A;  4X64 Q;  4DV0 Q;  4X3U A;  1PRT B;  3ERQ A;  1BF4 A;  4O0A A;  2QEX A;  1I6H H;  1LT6 D;  5C44 G;  2F4V Q;  2J4X A;  2NTS A;  3GTQ H;  1HNZ Q;  1O7L A;  3KYH C;  3CCE A;  1Q8I A;  3MZ5 A;  3KK7 A;  3KLS A;  5BN4 A;  3MXN A;  2YU9 H;  3I70 A;  3GTJ B;  3S1Q B;  4LNQ A;  2Z4I A;  5EJW A;  5M5Y B;  3BYY B;  3GTG B;  3DXJ C;  4DNR B;  1AE2 A;  4WJ4 A;  4RKB A;  4Q5V A;  3RR5 A;  4J6H A;  1H9S A;  1X3F A;  5FK9 C;  1GJX A;  3WOF A;  5M5W B;  2XGT A;  3I8Z A;  4OWT B;  4RKL A;  1H9K A;  2LXK A;  3H91 A;  5H1S E;  2E5L L;  5E1F A;  2I0Q A;  2D9U A;  4KD4 A;  5IWA Q;  1QNU A;  4A3M B;  1K83 H;  2WB1 G;  3HOU G;  3CP0 A;  2VNU D;  1FL0 A;  2VXW A;  2UUC Q;  3EVQ A;  1HNZ L;  1X55 A;  1ROD A;  4OO1 G;  1XTC D;  4DAM A;  3CQZ B;  1A6X A;  2L5T A;  1I5F A;  1YHA A;  3T1Y L;  2JEA I;  3IL8 A;  4AH6 A;  2NN6 H;  4FXG C;  2K6A A;  4DV5 L;  2N8N A;  2NVY H;  3PF5 A;  1X6O A;  2B3G A;  1HUN A;  2EDG A;  1JE4 A;  3TQY A;  4NXN L;  3JAM i;  1N9W A;  2Z6K C;  1UE7 A;  1L0X B;  4L63 B;  2EYF A;  1S4Z A;  4A93 G;  1TWC H;  2G5D A;  4GNX C;  2E2J B;  1L0Y B;  4JI0 L;  1FYC A;  2YTV A;  3DM3 A;  4B08 A;  1DZ1 A;  3CC4 A;  2GN5 A;  3NEM A;  1F2L A;  3ERS X;  1HA6 A;  2E2D C;  1WD1 A;  1R4P B;  2DUD A;  4H7B A;  1SJE D;  1VS0 A;  3T51 B;  1I94 L;  4G57 A;  4OL7 A;  3HOZ B;  4RGT A;  3U9S A;  4A3D B;  2R93 H;  3HGB A;  3KBG A;  1PTO C;  3TP8 A;  4BXX H;  4C3J G;  1TS4 A;  2VUM H;  1Y1W H;  2JQO A;  1UWV A;  3N6R A;  2AQ3 B;  2F0O A;  4B3M L;  3H0G B;  4XQQ A;  1HUM A;  1UE6 A;  3N52 A;  1HQM C;  2A69 D;  5EBD A;  2JN4 A;  3S2H B;  1LTG D;  3RMH A;  1BCP F;  2FFK B;  3F8T A;  2OQK A;  2LSS A;  4P73 A;  4A3F G;  5GAG C;  3F2U A;  1JIC A;  2N78 A;  5E7N A;  3J81 i;  4QY7 A;  2F4I A;  3FHW A;  2JA7 B;  5JVH 3;  4LF7 Q;  2DNC A;  4LFC Q;  1PV4 A;  1KNE A;  3ER0 A;  1VF7 A;  3R93 A;  5FLX E;  3NHH A;  2KCT A;  1PDQ A;  2N49 A;  4NW2 A;  2B2W A;  1CZG A;  2JYO A;  2AUJ D;  2X69 A;  3RNU A;  3S14 H;  4KHP Q;  2C9O A;  2JEB I;  1NMG A;  4BBR B;  5E4W C;  4BBR G;  4TSS A;  2F0M A;  1TWF B;  3GTO B;  3HOX H;  2D5D A;  2A6H D;  5JEA G;  4IOC A;  3M3Y H;  3H15 A;  1PFM A;  2E75 C;  3HRZ C;  4QGU A;  2PI2 E;  1W6K A;  1JWM D;  2UUB Q;  2K14 A;  2NWG A;  1C9O A;  3PCO B;  3S14 B;  1I50 H;  1QG7 A;  3OWE B;  1Q12 A;  4HCS A;  5C5M A;  2Q2H A;  2EJM A;  4JBJ A;  3AFQ A;  1BCP C;  3GTL H;  2NVX B;  4B3T Q;  1KAW A;  1KNA A;  4HJ8 A;  2NN6 I;  1CT1 D;  2K5Q A;  2SNM A;  4GN5 A;  1STH A;  1L1O A;  5C4J B;  3S9W A;  2VQE Q;  3FKI H;  4JI1 Q;  2MHV A;  4DK0 A;  1VDZ A;  1IL2 A;  1I4Q A;  1HTP A;  1XNQ Q;  4C3H B;  1BDO A;  4PZ6 A;  1G6Z A;  2N55 A;  1OXU A;  4A3I H;  4JI6 Q;  2NVT B;  1Q8K A;  5BN3 A;  1XMO Q;  4K2K A;  3PUX A;  1XYI A;  4DV7 Q;  1S5D D;  2JK8 A;  1DD2 A;  3BZK A;  3HP3 A;  4B3T L;  3QIA A;  5M3F H;  1LM0 A;  4K6L A;  1PVO A;  2F1M A;  2IX3 A;  3I90 A;  3R2T A;  1S5C D;  3GP7 A;  5FO9 B;  1HJP A;  5LMU L;  1HR0 L;  4C3I B;  4KLK A;  2O5J C;  4X65 L;  3MHB A;  1VQJ A;  3CKI B;  2I07 B;  1EYD A;  5CBA E;  2DJG C;  1EIH A;  1ICF B;  1X32 A;  1VQP A;  1GM5 A;  2EJF C;  1I3Q B;  2K33 A;  2DY8 A;  3CQZ H;  3DWQ A;  3Q6S A;  3BS1 A;  2OWO A;  2B2V A;  4B9X A;  4R4I A;  3FKI B;  2UXC L;  2HQE A;  4LFC L;  4P71 A;  2ALY B;  5IP9 G;  1L0W A;  4NDX A;  4DXF A;  3A5U A;  2OTL A;  3ND9 A;  4HMJ A;  2OT2 A;  1XPR A;  2NN6 G;  5M5W H;  3GTL B;  2Y0S B;  4HR7 B;  2O2L D;  2K03 A;  3KF6 B;  4TVA B;  1LAC A;  2LY7 A;  4OO1 H;  1EEI D;  1IBK Q;  3TN2 A;  3BYT B;  4BA2 I;  4BWG B;  3J81 j;  3DM1 A;  4JI3 L;  1OXV A;  1VMC A;  3IRB A;  4QUC A;  1A63 A;  2L9H A;  1U4L A;  5JJK A;  3OOC A;  2PYK A;  1EY9 A;  3V2T A;  3E9I A;  1Y1V B;  1PZJ D;  3I72 A;  2WIN B;  1JJ2 A;  1H9J A;  4ZCK A;  4OIJ A;  3TP6 A;  3CW2 C;  1AZQ A;  1GD7 A;  1QVF A;  1Q46 A;  2BE5 C;  1YIJ A;  4CBV A;  1BR9 A;  2MP1 A;  3E6Z X;  4LFA Q;  1AN8 A;  4DGZ A;  3J80 c;  1ESF A;  1TWH B;  1V1P B;  1PFS A;  3G6J B;  1PH4 A;  2QDB A;  3CCJ A;  2E2H B;  4HCE A;  4RG1 A;  1B1Z A;  4DAY A;  4OX9 Q;  4X3K A;  1PH8 A;  5CV9 A;  1OTC A;  4F7X A;  1J9O A;  2IJ0 A;  3A7L A;  3C1E A;  1RL2 A;  3MFY A;  5J1Z A;  1K3R A;  1X56 A;  4AIM A;  4AQY L;  4N8X 1;  1J5E Q;  1STE A;  1CKO A;  1LV9 A;  2VS1 A;  4LMQ D;  1K8A C;  4TQU S;  1EUJ A;  2R6G A;  5CMD A;  4DR7 L;  1PYS B;  1BBX C;  2F3W A;  1B9M A;  4ODG A;  1Q1E A;  5IYD G;  4DV1 Q;  4N8F A;  4XYQ A;  4A3M G;  2N88 A;  2PO4 A;  3EBE A;  1SYF A;  4R1J A;  5D3D A;  4QJF A;  4MNO A;  1Q81 C;  1SXT A;  1D7Q A;  1WD0 A;  1LTR D;  3RZO H;  2Q8R E;  2K7V A;  4RWS C;  3J7A F;  1GOZ A;  4ID6 A;  2QIL A;  2PZW A;  2F0N A;  2KCM A;  1PH9 A;  1SJH D;  2PI2 A;  5FJ8 H;  3QWN A;  2VQF L;  4KY7 A;  5E3F A;  4LF4 L;  3NUC A;  4MZ9 A;  2V1C C;  2JA8 G;  2R7Z H;  1K3B C;  4IN3 A;  1VQF A;  3RLF A;  1WTQ A;  3IAY A;  3VR4 A;  4GN4 B;  2A6E C;  1F77 A;  3DUZ A;  2JA5 B;  4X62 Q;  2CVR A;  3KJO A;  5I2X A;  2PZU A;  1F9Q A;  2L12 A;  1TWA H;  5K36 G;  4OWW B;  2I5L X;  3Q0A A;  4K5V A;  4JBK A;  4KKS A;  1U0L A;  1VQ8 A;  5NUC A;  1MIU A;  3CPW A;  1XPO A;  4OO1 I;  3GTP B;  1K83 B;  1CQV A;  3TZU A;  1Y14 B;  5HUR A;  1CHP D;  4PMW A;  2NTT A;  2VZA A;  4NPS A;  5IP7 G;  3I4N B;  3ULP A;  4PMB A;  1HZ9 A;  2WAQ B;  4JV5 L;  5KNB A;  3JAM L;  1MKH A;  1X3Q A;  1ESR A;  2XWB B;  5G3L D;  1V1O A;  1SMY C;  3M7G A;  4DR2 Q;  3S15 H;  3K7A B;  4A3B G;  2F0I A;  4JI0 Q;  2PNR C;  3IKJ A;  1RIP A;  4JBW A;  4B3S Q;  2B2U C;  4C2M H;  1ASY A;  4LUO A;  2B39 A;  3BG3 A;  2IWH A;  5C4X H;  1I94 Q;  5JEA J;  3KF8 B;  2ZXP A;  5IYB H;  1E0B A;  1YHQ A;  3HOY B;  4M1U B;  5M3M G;  1SYC A;  5IY0 A;  1I6H B;  5IGD A;  1NBW A;  1X3G A;  2BDN A;  1FNV A;  1N8R C;  2IT1 A;  5CV5 A;  1Q86 C;  2RDF A;  4LUV A;  5CV7 A;  4BY7 H;  2IX0 A;  4C2M B;  1TT2 A;  3HKZ B;  4DR3 L;  2UUA Q;  4MHE A;  4C3J B;  1PRT F;  5DM6 3;  4A3D G;  3HZX A;  3R3O A;  1EY0 A;  1WCM B;  4YWL A;  2PZT A;  1M1K C;  1GUN A;  3HFZ B;  2EYH A;  4IUT A;  3K6O A;  4A3J G;  1LTA D;  1BKB A;  1FR3 A;  3IFD A;  1LUZ A;  1QJO A;  4JI4 Q;  1HXY D;  1Q1B A;  4JG2 A;  2EOT A;  2DJF C;  1G91 A;  2ES2 A;  4EVO A;  4DR4 L;  3C1F A;  2KQ3 A;  1SFO H;  3CC7 A;  1HQR D;  2VB3 X;  5M9O A;  3S1R H;  2EY2 A;  1CQF A;  1AH9 A;  3SE0 A;  2Z8L A;  2MNA A;  1TS3 A;  2Q2U A;  5I9P A;  2KOL A;  4IZ8 A;  5FLX c;  2DNE A;  3BJU A;  2H4O A;  4FXD A;  2F0Q A;  3UDG A;  4PG3 A;  1VQM A;  5IWA L;  5C0X G;  3L2P A;  1K73 C;  4H13 C;  3PIO 3;  4IFD H;  3A7A B;  4QUF A;  1ZYR C;  1HNX L;  1BO0 A;  1W2B A;  2F0P A;  2PW7 A;  2XTI A;  3CHB D;  2LFN A;  2M00 A;  1SDF A;  1E1O A;  1E22 A;  2A68 C;  4H02 A;  2RCN A;  4J15 A;  1QWY A;  1IYV A;  3FPU B;  2L55 A;  2Y0S G;  1PH3 A;  1P8L A;  2K5H A;  4A3F H;  5C5L A;  3M4O H;  3RN5 A;  2BH8 A;  1W6J A;  5C3X A;  1YBY A;  5I6W A;  1PA6 A;  2QDL A;  5LMN Q;  3V96 A;  1SEB D;  1MGS A;  3S17 B;  5CC4 A;  5KGU A;  4ULL A;  1GHK A;  3EQL C;  1KL9 A;  4DV3 Q;  1L2F A;  3QJY A;  3R2I A;  4I7Z C;  4YY3 L;  1OXS C;  5JJL A;  1I4X A;  2B29 A;  2ZT9 C;  4I7A A;  1EU3 A;  2WAQ G;  4BY1 B;  1V43 A;  1NNX A;  4XQN A;  1EFI D;  3NBH B;  5IIF A;  3NEL A;  2RCF A;  1B2T A;  1TWH H;  1VQC A;  2FMC A;  3KUP A;  4ZYS A;  4DV0 L;  4GN3 B;  4JBM A;  1IKM A;  4L5T A;  4IUP A;  3L7Z C;  1Y1V H;  1EEF D;  3NK9 A;  4QCL A;  1WFQ A;  2PMZ B;  3G4S A;  5EPJ A;  1UE1 A;  2KCC A;  1NY4 A;  1BCP B;  2M9V A;  1LT3 D;  2ZJQ A;  3CCL A;  2KHI A;  2L4N A;  3KDF A;  4DV6 L;  2HIV A;  1A62 A;  4JOI A;  3W5O A;  3NTK A;  3U9O A;  3M9B A;  4RGN A;  4JK1 C;  5EKK A;  4P74 A;  4X66 Q;  4KJN A;  2HQL A;  4JI8 L;  4J8Q A;  2R92 B;  3PO2 H;  3STB D;  1TVX A;  4GKK L;  2HHH L;  1V1P A;  2B2U A;  5BR8 L;  3CXC A;  5K36 H;  4DAY B;  3K0X A;  5ELB A;  1TWG H;  3M4P A;  4L5Q A;  2K1B A;  3NWT A;  4R4Q A;  1EWC A;  4X62 L;  4RCO A;  3K80 C;  4B3R Q;  2EQS A;  3D6W A;  4IFD G;  2RHS B;  4KKU A;  5C3E B;  3L0O A;  4HJ5 A;  1QVG A;  4NKL A;  4ZLT F;  1H95 A;  1NAP A;  3VYT A;  2EXD A;  1TXY A;  4DR6 L;  1N32 L;  3HOX G;  5FJ8 G;  3A0J A;  4KK7 A;  1Z9F A;  4LK1 C;  4P75 A;  4XXE A;  1Y8N B;  2WV6 D;  1FD7 D;  3D31 A;  3JAM c;  1TU2 B;  4K6D A;  4YHH Q;  4B9W A;  3SGI A;  4L8J A;  2I46 A;  5KYI A;  1GHJ A;  2E2I H;  4CJ0 B;  1LT5 D;  3C2P A;  2HD3 A;  1ICW A;  1CHQ D;  4IO9 A;  5BR8 Q;  4A3J H;  2CWA A;  3I73 A;  4CKE A;  3TME A;  4HIM A;  1WOC A;  3CRK C;  3PGZ A;  5D14 A;  1XMO L;  3S1N B;  4GS3 A;  3GDE A;  2F0L A;  5M3F B;  2KA7 A;  1RD9 D;  4G7O C;  5C44 H;  3BVM A;  4KY5 A;  2OTJ A;  3K0Y A;  3SK8 A;  1WTP A;  3W1B A;  4RFB A;  3RD4 A;  4BY7 G;  1VQK A;  2CH4 W;  1D5Z C;  4DN4 M;  3GTM B;  2CH4 A;  1VQ5 A;  4WJ3 M;  3NE5 B;  2NBF A;  1ZKO A;  3EFX D;  5I9O A;  4A3I B;  2K5V A;  2EYO A;  2IHF A;  4KN4 C;  1HZC A;  2Z9H A;  3S1N H;  5C4X G;  1E24 A;  5IYB G;  5C0X J;  2ZTE A;  2BE5 D;  5A2Q L;  2PQA B;  2RQX A;  3OTO Q;  4DR1 L;  2UXD Q;  2XN9 C;  1VQA A;  4A75 A;  1CTM A;  2NVT H;  1ZYR D;  4JI1 L;  1CUK A;  1PXU A;  1BBU A;  1I4H A;  4RHS A;  3G71 A;  4PQX A;  1XNR L;  1AZP A;  4LJZ C;  1DYQ A;  3LX0 A;  4BBS G;  1LYL A;  5C3E H;  2UU9 Q;  4DKA C;  4A3C H;  2RDH A;  3OW2 A;  1I50 B;  2VB2 X;  5C4J H;  3VR3 A;  1SYD A;  1SMX A;  1E1T A;  1VQI A;  3M4Q A;  1DM0 B;  1B7Y B;  4QF4 A;  1SND A;  1RHP A;  1HA5 A;  3DEO A;  2NZO A;  4QQB X;  1VQ7 A;  2NVX H;  3VYU A;  5IGB A;  1ENF A;  4KKT A;  1BQQ T;  2R7Z G;  1TWF H;  2R92 H;  3GTO H;  4BBS B;  4DK6 C;  3AQQ A;  1PH1 A;  2NVQ B;  5TSS A;  1PH2 A;  4IUU A;  3UE0 A;  1BNZ A;  1EIG A;  4BS9 A;  2J0T D;  4NXM Q;  4BBS H;  3A8J E;  1QIL A;  1WTW A;  4QMG A;  1GUT A;  3NSW A;  1TY0 A;  5DAU A;  2X6G A;  4CDC C;  5AFW A;  3I2Z A;  1QCB D;  1R9T B;  1RJT A;  1K28 A;  5IYC H;  3Q22 A;  5IT9 c;  4DNT B;  3HOX B;  1KXL A;  4OON A;  5GRO A;  2A69 C;  1F9P A;  4R9W A;  3BZC A;  1GXD C;  1H9R A;  5D3I B;  1F2M A;  5C3E G;  5CV8 A;  5EPK A;  3VR6 A;  1LLR D;  4EQO A;  4F87 A;  1KDA A;  1HH2 P;  1LTT D;  4R4C A;  4LFB Q;  1HPC A;  2EY5 A;  4NB3 A;  1EYC A;  3U58 A;  5CV6 A;  4DR3 Q;  1STA A;  2IW3 A;  4Y52 H;  1FGB D;  4A3L H;  4RMF A;  5M3F G;  3HOZ H;  2CFM A;  1KAB A;  3TS0 A;  2NZH A;  4K5W A;  1IYJ B;  1HFN A;  5I2Y A;  4B3M Q;  2Z6B A;  1TY2 A;  1SE4 A;  1WTV A;  1XPU A;  1YNX A;  5KNC A;  4LF6 L;  3H0G H;  4KY6 A;  1E3P A;  4UP7 A;  3WOE A;  5JVG 3;  4Z9C B;  2F0T A;  1MHW C;  4OIK A;  4ABN A;  1S5E D;  5HGQ A;  2XVS A;  1LO5 D;  3ZYY X;  3P7J A;  2NVY B;  4KN7 C;  5T1I A;  4HSV A;  1YHB A;  5EPL A;  4RAU C;  2RF4 A;  1PYB A;  2PQE A;  2YV5 A;  3CD6 A;  1A8V A;  2A1A A;  4FP5 D;  3H09 A;  3D4W A;  1A3U A;  4G7Z C;  1C48 A;  1SAP A;  1JB3 A;  3O13 A;  3MA2 B;  1TS2 A;  1MSG A;  1SE8 A;  5DLQ E;  1JJG A;  3J80 L;  3D4R A;  4TKO B;  2AWN A;  1JQY D;  1RF2 D;  4RHR A;  4EX5 A;  1EQV A;  2RKS A;  3ULL A;  2BOS A;  2A74 C;  1X65 A;  5COR A;  2VQF Q;  1U4P A;  4HSP A;  3AYH B;  1SNO A;  4DV1 L;  1VQN A;  4C3I G;  3FRP B;  2O4X A;  1X3P A;  1PHJ A;  1E2W A;  1EY4 A;  2XSC A;  3S1Q H;  3D4D A;  2MO0 A;  4O2D A;  2D62 A;  1SNC A;  1KLU D;  4KJO A;  1PH5 A;  2OXP A;  1W3S A;  3HKZ E;  3D0F A;  2JA5 G;  3AFP A;  3A5Z B;  1P16 A;  3P1H A;  1HHV A;  4RCN A;  2XRQ D;  3UE1 A;  4LF7 L;  3SHL A;  1MI2 A;  1SYG A;  2OEO A;  4LF5 L;  1XNR Q;  2EVB A;  2F52 A;  1JWS D;  3PUV A;  2JSO A;  4QIW E;  4UAI A;  3GTG H;  4X64 L;  4DFA A;  3Q24 A;  1PLF A;  1FJG L;  1GUG A;  2L11 A;  2A68 D;  1Q7Y C;  4DA2 A;  2SEB D;  1DOK A;  1K0R A;  2B2T C;  5EKI A;  4N9T A;  3GTQ B;  1C4Q A;  3K5M A;  1SE2 A;  1Y1V G;  2EYJ A;  2EE1 A;  4MN3 A;  5GQO A;  2EY6 A;  4K8J A;  4HIO A;  3GTP H;  2MFI A;  1YI2 A;  1B4O A;  1EL0 A;  3MXN B;  4NP5 A;  5JJI A;  5AJ3 L;  3T1H L;  3BVZ A;  1EQR A;  1NUC A;  3CPF A;  5ELN A;  4JPB W;  2DY7 A;  2JA5 H;  1TS5 A;  4HIK A;  4DPG A;  3KF8 A;  5M3M H;  3DWA A;  1VQB A;  4L6T B;  1TKW B;  4N9P A;  1XMQ L;  2WAC A;  1CZW A;  4GLV B;  5CYU A;  2R7Z B;  3A8I E;  3SR1 A;  2VL6 A;  3TRZ A;  2E74 C;  3U50 C;  4C1N I;  3OSO A;  1O7Y A;  2KBN A;  3H6M A;  4OEM B;  4Y7N H;  1PTO H;  2C5C A;  2B8G A;  1WJJ A;  4DR5 L;  1KDC A;  1CKN B;  1UEB A;  3GV3 A;  2QF7 A;  3MVV A;  1QE6 A;  4CDD C;  4KMU C;  2F0V A;  3KBX A;  2EZV A;  5K5P A;  3GQB A;  4GKJ L;  1IXR A;  1Z7T A;  3PF4 A;  1LTI D;  2RSN A;  1F2Z A;  1U4R A;  2D0P A;  5EAY A;  4A93 B;  2JA7 G;  3G7L A;  2G9H D;  1ML0 D;  3SK4 A;  3P75 A;  4XIG S;  3I4M B;  5FO8 B;  2A6E D;  4GOP C;  1EYG A;  3BZD B;  2NYZ D;  2OQ0 A;  2XRS D;  3NWS A;  4C56 C;  2JA6 B;  2J7Z A;  4DR5 Q;  1YNJ D;  2PW5 A;  1D5M C;  4HJ7 A;  3D6C A;  4IOA A;  1A0I A;  1T5X D;  3SVM A;  1EFW A;  4GKJ Q;  3OTO L;  2UXD L;  3P20 A;  4G7H C;  3K5O A;  1I4R A;  4ZAI A;  4YIJ A;  4FF3 A;  3PMF A;  1ILQ A;  2CCZ A;  4GNX A;  4LF8 L;  2KEN A;  1KTK A;  4DV3 L;  3OMC A;  1BBW A;  4A3E H;  4A3C G;  2E8G A;  5ELO A;  4DUZ Q;  1VMP A;  4BXX G;  1JE5 A;  1QB5 D;  3I56 A;  2VUM G;  3PIO A;  1F9R A;  1KD1 C;  4DV4 L;  2A8V A;  1XMQ Q;  1KIX A;  1CSP A;  1MD2 D;  4L5S A;  3R8B A;  1RDP D;  4OGQ C;  3A54 A;  1AEX A;  4O42 A;  5LMN L;  3GO5 A;  3PUY A;  3K59 A;  4DV7 L;  5KEE A;  1CA6 A;  3CAM A;  5FLM H;  4CKB A;  3GV6 A;  4A3K B;  2YYZ A;  4DUZ L;  3K58 A;  4DV5 Q;  3S16 H;  4BA1 I;  3LNN A;  4IUV A;  3S1M H;  1TWA B;  3KFU A;  3E0J A;  1AP0 A;  2WFW A;  1I3Q H;  5JPN C;  1BCP D;  4WJW A;  1N33 Q;  3FPP A;  1SMY D;  1RTN A;  2R3Z A;  3HOU H;  4DU9 A;  2BA0 A;  4A3K G;  1K9M C;  1IBL Q;  1K8O A;  1M90 C;  3S2D B;  4DR6 Q;  3PO3 B;  3VR2 A;  1G6P A;  1ET6 A;  4UY8 C;  3I91 A;  3QG1 A;  5IYD H;  4X66 L;  1VQ9 A;  4GOP B;  3QO2 A;  1UNS A;  5FLX L;  3C46 A;  2WKC A;  5C6A A;  1BOS A;  2ZM6 Q;  3V05 A;  3LWU A;  3RUZ A;  4FF1 A;  1ZXT A;  1WTH A;  3MWY W;  4HJA A;  3DMU A;  1QUQ A;  2WB1 E;  4WOR A;  2R61 A;  3ICE A;  4RH6 A;  4FO2 A;  1VQL A;  4A3K H;  1JB7 A;  1KAA A;  3L9A X;  4K0K L;  3H0G G;  3TP7 A;  3G6E A;  2AMC B;  4EGV A;  4ZRZ A;  2MPM A;  1JOQ A;  4DAP A;  5A35 A;  1YJ9 A;  1MJC A;  4GNX B;  4UDU C;  2K4K A;  3ULJ A;  4DR4 Q;  1EOT A;  1PFN A;  3EN2 A;  3A8K E;  3ITP A;  1CM9 A;  3HOZ G;  3MFG A;  1KRS A;  1I6V C;  2B2T A;  1IW7 C;  2PPB C;  2JP1 A;  3RZD B;  3PO2 G;  5CR3 A;  4ZUJ A;  1QVC A;  2FMM A;  4KHZ A;  4POF A;  1HNW L;  1AW7 A;  1FVI A;  3UI2 A;  2QA4 A;  1A2U A;  4KD3 A;  3J7A V;  3W2D A;  1S72 A;  2RA4 A;  3JC6 6;  2BDO A;  3UDI A;  4FF2 A;  3W3A A;  4U68 A;  1PTO D;  4PZ8 A;  3F2D A;  1EZ8 A;  5JOB A;  4DUY Q;  3T4A C;  1WTO A;  2Q2I A;  3VA5 A;  1STB A;  4LFB L;  3ND8 A;  2I5H A;  3T56 B;  1O7Z A;  1SNP A;  2K04 A;  1OXX K;  1LTL A;  5BN5 A;  3H3V I;  5IGF A;  1YVC A;  1QZG A;  2K75 A;  2F0U A;  4HMI A;  4MTK A;  4IFD I;  1NSN S;  3HKS A;  1YNN D;  1EY7 A;  2HUG A;  3I4M G;  1VQD A;  4NXN Q;  4RA8 A;  2EXZ A;  4JOI C;  3CCU A;  5J39 A;  1PYW D;  2OF1 A;  2IY5 B;  2JA6 H;  4QB4 A;  1VQ6 A;  2YTY A;  2QKI C;  1XX8 A;  1A15 A;  1C7Y A;  2GVB A;  2JE6 I;  3T1Y Q;  4IJL A;  1XJV A;  1STY A;  2JA7 H;  4JVZ A;  1M4V A;  3E3X A;  3PV0 A;  3CCS A;  4JC0 A;  4ZUI A;  1IYU A;  1E7Z A;  1Z47 A;  4CDF C;  3M4O B;  2K5D A;  4AYB B;  2E5L Q;  2SNS A;  1D1I A;  5COY A;  3K5N A;  3QOL A;  1GUW A;  4FF4 A;  5EBC A;  4G4K A;  4IPD A;  3CRL C;  2UUA L;  1F9S A;  3VR5 A;  5KRU A; 
#chains in the Genus database with same CATH homology
 5A2Q E;  3J81 E;  1G8Z D;  1NR4 A;  3MXU A;  4R8I A;  4Y7N B;  2EPB A;  1ONL A;  1EY6 A;  4ZKB B;  4EQP A;  2WB1 B;  5JPM C;  3J80 E;  2SDF A;  5FO7 B;  4XQJ A;  5DEH A;  1D1K A;  2D2C C;  4CJ2 C;  3HEJ A;  4P2C B;  1PZK D;  1U4M A;  1H9M A;  1VCI A;  1IHZ A;  5FOB B;  1SSO A;  2KJX A;  1JR0 D;  2MUY A;  3ERO A;  4QIW B;  3SEB A;  1FNU A;  1R4Q B;  2K28 A;  4XT1 B;  4TRD A;  1K8M A;  5KND A;  3MAQ A;  5C0X I;  4PMC A;  2KEC A;  2EY1 A;  3M85 A;  4KV6 A;  2RSO A;  3NQI A;  4C3H G;  1QNK A;  1TWG B;  3NP8 A;  5C4H A;  4A3E B;  4S3S A;  5C4X B;  3PO2 B;  3X3M A;  5JAV A;  1IW7 D;  5IOD A;  2V4D A;  3S15 B;  3E5S A;  3FMC A;  4DF7 A;  5IGE A;  1GUO A;  3PUZ A;  1DJR D;  2Q8I B;  2KED A;  2QCP X;  1M8A A;  5CGK A;  3FVQ A;  3T53 B;  3J81 L;  3SDZ A;  1QOH A;  1T5E A;  4IQZ A;  2F3V A;  2G9D A;  2B63 B;  2KVM A;  1LAB A;  2AQ2 B;  2F03 A;  1PRT C;  2B2V C;  4H44 C;  2F0E A;  5LL6 X;  1CI3 M;  1PTO F;  4A3G B;  5ELD A;  2MGS A;  1ENA A;  2F0W A;  4H0L C;  3KLS X;  1F2Y A;  1A3V A;  1Y1W B;  2GA4 B;  3NBH A;  2R93 B;  4V19 0;  3MTS A;  5ELF A;  2F0S A;  4IUQ A;  5C3W A;  4F8M A;  2LMC B;  1G2S A;  5ISR A;  3QB3 A;  2JXM B;  2ZXR A;  5KYL A;  3A55 A;  2KHS A;  3S1R B;  3URY A;  2KEE A;  3MXG A;  5LL6 S;  5EKL A;  2CQA A;  1DCZ A;  2AWO A;  4K8I A;  3NXW A;  4MIU A;  2WII B;  3HOV B;  3TDQ A;  2FHT A;  1PRT D;  1Y8O B;  3TP5 A;  3OHX C;  2LS0 1;  4FXK C;  1EZ6 A;  5LHY 1;  3NTI A;  1ZEQ X;  3NQT A;  1IKL A;  3A56 A;  1B44 D;  2RBM A;  5I4D A;  3WDN A;  1DOL A;  2K01 A;  2B2Y C;  1BUV T;  2ICI A;  4Q0F A;  3OMG A;  3H3V C;  3OWF A;  5HGT A;  3L3O C;  2Z4H A;  1NCV A;  2CW0 D;  1OXT A;  1RTO A;  3EJI A;  2L0C A;  3MEH A;  3D3R A;  2RDG A;  1HTL D;  1GUS A;  2HCI A;  1KLG D;  4O1N A;  1BXT A;  5JJZ A;  2H1E A;  3T16 A;  1JCK B;  1VF5 C;  1LTB D;  4XDX A;  1DON A;  2BA1 A;  1O78 A;  1HCZ A;  5KIX A;  1II3 A;  1Y8P B;  1UAP A;  2X6L A;  1TQO A;  3DEP A;  1RKN A;  2JA8 B;  4IUR A;  1JWU D;  3FEW X;  1SNQ A;  3VYR A;  2F0F A;  3LWE A;  2WP8 J;  1AFP A;  3X3N A;  5IGG A;  1WTR A;  5EGT A;  2F0J A;  1DOM A;  4ME5 A;  4K14 A;  3DWP A;  3IFT A;  5M5X B;  1JOO A;  3PIP 3;  2SOB A;  3AMU A;  1A2T A;  1ENC A;  1SBB B;  1EQT A;  3BDO A;  4HTH A;  1FNW A;  3M4Y A;  4K2L A;  2ICE C;  1EU4 A;  4F88 A;  3ONA B;  3NTH A;  2F0K A;  3TZD A;  4XTC S;  1H9S B;  3BDC A;  3EA6 A;  2M2L A;  3NPP A;  4NMZ A;  1WVL A;  1S5B D;  1SE3 A;  3QOJ A;  3CU7 A;  1ILP A;  5F2D A;  1MBY A;  2CW0 C;  2AQ1 B;  2TMP A;  1G29 1;  1PZI D;  3I3C A;  1B53 A;  3KLR A;  1D2B A;  2CHB D;  1J8I A;  1JOK A;  4XT3 B;  3JAM E;  2WKD A;  4WRD A;  1CFM A;  4U67 3;  2QEJ C;  3PUW A;  1WTX A;  3D8G A;  4C1N K;  1LTS D;  1SYE A;  2IL8 A;  2K32 A;  1UUP A;  1EY8 A;  2F0G A;  1EY5 A;  5C4Z A;  3T13 A;  4XYO A;  5ELC A;  1A3T A;  2VUM B;  2RVL A;  1NR2 A;  1KDB A;  3FDT A;  4DAV A;  4FYD A;  4ZK9 B;  3HOW B;  4IUN A;  4WFN 3;  5C44 B;  3AU7 A;  4HN7 A;  5T1G A;  2LKV A;  1TR5 A;  4GZY C;  2AUK A;  4A3J B;  4KHV A;  2Z1C A;  1DXM A;  3C3L A;  2HDL A;  2MJ8 A;  1CK1 A;  3VA7 A;  1HFG A;  1UEA B;  2E2I B;  3SXH A;  3HOU B;  3Q23 A;  3SK6 A;  1B3A A;  2ENB A;  2HDM A;  4ZKC B;  1TII D;  1B50 A;  1C8C A;  4LAA A;  2NZ1 D;  1STN A;  1EYA A;  2E76 C;  5JEA H;  4OHJ A;  1YNJ C;  4KTA A;  1XXG A;  3S1M B;  4ILW A;  3S16 B;  4E6I A;  3BDL A;  1E2Z A;  1SNM A;  4DXG A;  3M7N A;  4BY7 B;  3AB9 A;  1JOR A;  1S5F D;  3MXP A;  3OIP A;  2ID0 A;  4IFD J;  5EQ0 A;  4I65 A;  3SK5 A;  1PMR A;  3DHQ A;  2EYL A;  5D65 A;  3MC0 B;  2F0D A;  2XWJ B;  3HG9 A;  4PNY A;  5I6Y A;  4J1M A;  1PFB A;  4M8A A;  4RGO S;  3J7Y W;  1YNN C;  3VYS A;  1U9R A;  3OIQ A;  2KUM A;  4EQN A;  1D6E C;  1Q90 A;  1G2T A;  2YU9 B;  1SYB A;  1RCV D;  2A6H C;  1STG A;  3GD7 A;  4IAL A;  4KI0 A;  2Q8T A;  5IT9 E;  5FKA C;  3M3Y B;  1Q3L A;  3TSS A;  2EJG C;  5IOC A;  2B8F A;  2O5I C;  5E4X A;  2L1B A;  5C0X H;  1CA5 A;  1E2V A;  2DN8 A;  4X3T A;  2FJ2 A;  4X3S A;  1HRJ A;  1JC7 A;  1B9N A;  4CHT B;  2A5H A;  1V8Q A;  5IGC A;  5CBE E;  1LT4 D;  4FNF A;  1I4P A;  4A3F B;  3I4L A;  3OPO A;  2NUC A;  4FVM A;  2XNA C;  1D5X C;  2EYM A;  2K5W A;  1IL8 A;  2ZXO A;  1Z6H A;  2KCN A;  3RZO B;  1EWH A;  2A73 B;  4DK1 A;  4HED A;  2FIN B;  1XWE A;  3TBI B;  3GTK B;  4V0B A;  2BCO A;  3NBI A;  5M3M B;  4CJ1 B;  2K05 A;  4CKC A;  2TSS A;  4HAE A;  3K57 A;  1TWC B;  1ET9 A;  5CV4 A;  3BVG A;  1PTO B;  2IPK D;  3OW7 A;  2EYP A;  5DM7 3;  4A3B B;  2PCF B;  1SFO B;  4K5X A;  5DNF A;  3H94 A;  5J22 A;  1Y69 U;  2NB0 A;  3HS0 C;  4CGY B;  4PV1 C;  2B2Y A;  4RGM A;  4ZQ3 A;  1MSH A;  1I4G A;  5IT9 L;  2B2W C;  2F0H A;  1OO9 B;  1O80 A;  5ELE A;  5G3L F;  2XIW A;  3K5L A;  2IX1 A;  2HCC A;  4R8N A;  4X3U A;  1PRT B;  3ERQ A;  1BF4 A;  1LT6 D;  2J4X A;  2NTS A;  1O7L A;  1Q8I A;  3MZ5 A;  3KK7 A;  3KLS A;  5BN4 A;  3MXN A;  3GTJ B;  3I70 A;  3S1Q B;  2Z4I A;  5EJW A;  5M5Y B;  3BYY B;  3GTG B;  3DXJ C;  4DNR B;  4RKB A;  4Q5V A;  4J6H A;  1H9S A;  5FK9 C;  1GJX A;  3WOF A;  5M5W B;  3I8Z A;  4RKL A;  1H9K A;  3H91 A;  5E1F A;  2D9U A;  4KD4 A;  1QNU A;  4A3M B;  2VNU D;  2VXW A;  3EVQ A;  1ROD A;  4OO1 G;  1XTC D;  3CQZ B;  1A6X A;  2L5T A;  2JEA I;  3IL8 A;  2NN6 H;  4FXG C;  2K6A A;  1HUN A;  2EDG A;  1JE4 A;  1L0X B;  4L63 B;  2EYF A;  1S4Z A;  2E2J B;  1L0Y B;  1FYC A;  4B08 A;  1DZ1 A;  1F2L A;  1HA6 A;  2E2D C;  1WD1 A;  1R4P B;  4H7B A;  1SJE D;  3T51 B;  3HOZ B;  4G57 A;  4OL7 A;  4RGT A;  3U9S A;  4A3D B;  3HGB A;  3KBG A;  1PTO C;  3TP8 A;  4C3J G;  1TS4 A;  3N6R A;  2AQ3 B;  2F0O A;  3H0G B;  4XQQ A;  1HUM A;  3N52 A;  1HQM C;  2A69 D;  5EBD A;  3S2H B;  1LTG D;  3RMH A;  1BCP F;  2FFK B;  3F2U A;  1JIC A;  2F4I A;  2JA7 B;  5JVH 3;  2DNC A;  1KNE A;  1VF7 A;  3R93 A;  5FLX E;  3NHH A;  1PDQ A;  4NW2 A;  2B2W A;  1CZG A;  2JYO A;  2AUJ D;  2X69 A;  2C9O A;  2JEB I;  4BBR B;  5E4W C;  4TSS A;  2F0M A;  1TWF B;  3GTO B;  2D5D A;  2A6H D;  5JEA G;  1PFM A;  2E75 C;  3HRZ C;  1W6K A;  1JWM D;  2NWG A;  3S14 B;  1QG7 A;  3OWE B;  1Q12 A;  4HCS A;  5C5M A;  2EJM A;  1BCP C;  2NVX B;  1KNA A;  2NN6 I;  1CT1 D;  2K5Q A;  2SNM A;  1STH A;  5C4J B;  3S9W A;  4DK0 A;  2MHV A;  1VDZ A;  1I4Q A;  1HTP A;  4C3H B;  1BDO A;  1G6Z A;  2N55 A;  1OXU A;  2NVT B;  5BN3 A;  4K2K A;  3PUX A;  1XYI A;  1S5D D;  1DD2 A;  3HP3 A;  3QIA A;  4K6L A;  2F1M A;  2IX3 A;  3I90 A;  3R2T A;  1S5C D;  3GP7 A;  5FO9 B;  4C3I B;  2O5J C;  3MHB A;  3CKI B;  2I07 B;  1EYD A;  5CBA E;  1EIH A;  1X32 A;  2EJF C;  1I3Q B;  2K33 A;  2DY8 A;  3DWQ A;  3Q6S A;  3BS1 A;  2B2V A;  4B9X A;  3FKI B;  2HQE A;  4NDX A;  4DXF A;  3ND9 A;  4HMJ A;  2OT2 A;  2NN6 G;  3GTL B;  2Y0S B;  4HR7 B;  2O2L D;  2K03 A;  1LAC A;  2LY7 A;  4OO1 H;  1EEI D;  3TN2 A;  3BYT B;  4BA2 I;  4BWG B;  3DM1 A;  1OXV A;  1VMC A;  4QUC A;  2L9H A;  1U4L A;  3OOC A;  2PYK A;  1EY9 A;  3V2T A;  1Y1V B;  1PZJ D;  3I72 A;  2WIN B;  1H9J A;  4OIJ A;  3TP6 A;  1AZQ A;  2BE5 C;  4CBV A;  1BR9 A;  2MP1 A;  3E6Z X;  1AN8 A;  4DGZ A;  1ESF A;  1TWH B;  1V1P B;  3G6J B;  2QDB A;  2E2H B;  4HCE A;  4DAY A;  1B1Z A;  4X3K A;  5CV9 A;  4F7X A;  1J9O A;  2IJ0 A;  3A7L A;  3C1E A;  3MFY A;  5J1Z A;  1STE A;  1LV9 A;  4LMQ D;  4TQU S;  2R6G A;  5CMD A;  1BBX C;  2F3W A;  1B9M A;  4ODG A;  1Q1E A;  4XYQ A;  2N88 A;  2PO4 A;  1SYF A;  5D3D A;  1SXT A;  1WD0 A;  1LTR D;  2Q8R E;  2K7V A;  4RWS C;  3J7A F;  1GOZ A;  4ID6 A;  2QIL A;  2PZW A;  2F0N A;  1SJH D;  3QWN A;  4KY7 A;  5E3F A;  3NUC A;  4IN3 A;  3RLF A;  1WTQ A;  3IAY A;  3VR4 A;  2A6E C;  1F77 A;  3DUZ A;  2JA5 B;  2CVR A;  5I2X A;  2PZU A;  1F9Q A;  2L12 A;  5K36 G;  3Q0A A;  4K5V A;  4KKS A;  5NUC A;  4OO1 I;  3GTP B;  1K83 B;  1CQV A;  3TZU A;  5HUR A;  1CHP D;  4PMW A;  2NTT A;  3I4N B;  4PMB A;  2WAQ B;  5KNB A;  3JAM L;  1X3Q A;  1ESR A;  2XWB B;  5G3L D;  1V1O A;  1SMY C;  3M7G A;  3K7A B;  2F0I A;  2PNR C;  3IKJ A;  4JBW A;  2B2U C;  2B39 A;  3BG3 A;  2IWH A;  5JEA J;  2ZXP A;  1E0B A;  3HOY B;  4M1U B;  1SYC A;  1I6H B;  5IGD A;  2BDN A;  1FNV A;  2IT1 A;  5CV5 A;  2RDF A;  5CV7 A;  2IX0 A;  4C2M B;  1TT2 A;  3HKZ B;  4MHE A;  4C3J B;  1PRT F;  5DM6 3;  3HZX A;  3R3O A;  1EY0 A;  1WCM B;  2PZT A;  1GUN A;  2EYH A;  4IUT A;  3K6O A;  1LTA D;  1FR3 A;  3IFD A;  1QJO A;  1HXY D;  1Q1B A;  2EOT A;  1G91 A;  4EVO A;  3C1F A;  2KQ3 A;  1HQR D;  2VB3 X;  5M9O A;  2EY2 A;  1CQF A;  3SE0 A;  2Z8L A;  1TS3 A;  5I9P A;  2KOL A;  4IZ8 A;  2DNE A;  2H4O A;  4FXD A;  2F0Q A;  5C0X G;  4IFD H;  4H13 C;  3PIO 3;  3A7A B;  4QUF A;  1ZYR C;  1BO0 A;  2F0P A;  2PW7 A;  3CHB D;  2LFN A;  2M00 A;  1SDF A;  2A68 C;  1QWY A;  1IYV A;  3FPU B;  2L55 A;  5C5L A;  1W6J A;  5C3X A;  5I6W A;  3V96 A;  1SEB D;  1MGS A;  3S17 B;  5CC4 A;  5KGU A;  4ULL A;  1GHK A;  3EQL C;  3QJY A;  3R2I A;  4I7Z C;  1OXS C;  1I4X A;  2ZT9 C;  1EU3 A;  4BY1 B;  1V43 A;  4XQN A;  1EFI D;  5IIF A;  1B2T A;  2FMC A;  3KUP A;  4ZYS A;  1IKM A;  4IUP A;  3L7Z C;  3NK9 A;  1EEF D;  4QCL A;  2PMZ B;  5EPJ A;  2KCC A;  1BCP B;  2M9V A;  1LT3 D;  2L4N A;  3NTK A;  3U9O A;  5EKK A;  4RGN A;  4JK1 C;  4KJN A;  4J8Q A;  2R92 B;  1TVX A;  1V1P A;  2B2U A;  5K36 H;  5ELB A;  2K1B A;  3NWT A;  1EWC A;  4RCO A;  3D6W A;  4IFD G;  4KKU A;  5C3E B;  4NKL A;  4ZLT F;  1NAP A;  3VYT A;  4KK7 A;  4LK1 C;  4XXE A;  1Y8N B;  2WV6 D;  1FD7 D;  3D31 A;  1TU2 B;  4K6D A;  4B9W A;  4L8J A;  2I46 A;  5KYI A;  1GHJ A;  4CJ0 B;  1LT5 D;  3C2P A;  1ICW A;  1CHQ D;  3I73 A;  4CKE A;  3TME A;  3CRK C;  5D14 A;  3S1N B;  2F0L A;  5M3F B;  2KA7 A;  1RD9 D;  4G7O C;  3BVM A;  4KY5 A;  3K0Y A;  3SK8 A;  1WTP A;  4RFB A;  3RD4 A;  1D5Z C;  4DN4 M;  3GTM B;  3NE5 B;  2NBF A;  1ZKO A;  3EFX D;  5I9O A;  4A3I B;  2EYO A;  4KN4 C;  5C0X J;  2BE5 D;  5A2Q L;  2RQX A;  2XN9 C;  1CTM A;  1ZYR D;  1PXU A;  4RHS A;  1I4H A;  4PQX A;  1AZP A;  4LJZ C;  1DYQ A;  3LX0 A;  2RDH A;  1I50 B;  2VB2 X;  3VR3 A;  1SYD A;  1DM0 B;  4QF4 A;  1SND A;  1RHP A;  1HA5 A;  3DEO A;  3VYU A;  5IGB A;  1ENF A;  4KKT A;  1BQQ T;  4BBS B;  2NVQ B;  5TSS A;  4IUU A;  1BNZ A;  1EIG A;  4BS9 A;  2J0T D;  3A8J E;  1QIL A;  1WTW A;  4QMG A;  1GUT A;  3NSW A;  1TY0 A;  5DAU A;  2X6G A;  5AFW A;  1QCB D;  1R9T B;  3Q22 A;  1RJT A;  4DNT B;  3HOX B;  2A69 C;  1F9P A;  4R9W A;  1GXD C;  1H9R A;  5D3I B;  1F2M A;  5CV8 A;  5EPK A;  3VR6 A;  1LLR D;  4EQO A;  4F87 A;  1KDA A;  1LTT D;  1HPC A;  2EY5 A;  1EYC A;  5CV6 A;  1STA A;  2IW3 A;  1FGB D;  1KAB A;  4K5W A;  1HFN A;  5I2Y A;  1TY2 A;  1SE4 A;  1WTV A;  5KNC A;  4KY6 A;  3WOE A;  5JVG 3;  4Z9C B;  2F0T A;  4ABN A;  4OIK A;  1S5E D;  2XVS A;  1LO5 D;  3ZYY X;  3P7J A;  2NVY B;  4KN7 C;  5T1I A;  4HSV A;  5EPL A;  4RAU C;  2PQE A;  4FP5 D;  3H09 A;  3D4W A;  1A3U A;  4G7Z C;  1C48 A;  1SAP A;  1JB3 A;  3O13 A;  3MA2 B;  1TS2 A;  1MSG A;  3J80 L;  3D4R A;  4TKO B;  2AWN A;  1JQY D;  1RF2 D;  4RHR A;  1EQV A;  2RKS A;  2BOS A;  2A74 C;  5COR A;  1U4P A;  4HSP A;  1SNO A;  4C3I G;  3FRP B;  2O4X A;  1X3P A;  1E2W A;  1EY4 A;  2XSC A;  3D4D A;  2D62 A;  1SNC A;  1KLU D;  4KJO A;  2OXP A;  3P1H A;  1HHV A;  4RCN A;  2XRQ D;  3SHL A;  1MI2 A;  1SYG A;  2OEO A;  2EVB A;  1JWS D;  3PUV A;  2JSO A;  4UAI A;  4DFA A;  3Q24 A;  1PLF A;  1GUG A;  2L11 A;  2A68 D;  4DA2 A;  2SEB D;  1DOK A;  2B2T C;  5EKI A;  4N9T A;  3GTQ B;  1C4Q A;  3K5M A;  1SE2 A;  2EYJ A;  2EE1 A;  4MN3 A;  2EY6 A;  4K8J A;  1B4O A;  1EL0 A;  4NP5 A;  3BVZ A;  1NUC A;  2DY7 A;  1TS5 A;  3KF8 A;  3DWA A;  4L6T B;  1TKW B;  4N9P A;  2WAC A;  1CZW A;  5CYU A;  2R7Z B;  3A8I E;  3SR1 A;  2E74 C;  4C1N I;  3OSO A;  1O7Y A;  3H6M A;  1PTO H;  2C5C A;  2B8G A;  1KDC A;  3GV3 A;  2QF7 A;  3MVV A;  1QE6 A;  4KMU C;  2F0V A;  3KBX A;  2EZV A;  5K5P A;  3GQB A;  1Z7T A;  1LTI D;  2RSN A;  1F2Z A;  1U4R A;  4A93 B;  3G7L A;  2G9H D;  1ML0 D;  3SK4 A;  3P75 A;  4XIG S;  3I4M B;  5FO8 B;  2A6E D;  3BZD B;  2NYZ D;  2XRS D;  3NWS A;  4C56 C;  2JA6 B;  2J7Z A;  1YNJ D;  2PW5 A;  1D5M C;  3D6C A;  1T5X D;  3SVM A;  3P20 A;  4G7H C;  3K5O A;  1I4R A;  4ZAI A;  4YIJ A;  4FF3 A;  3PMF A;  1ILQ A;  1KTK A;  3OMC A;  1VMP A;  1QB5 D;  1F9R A;  1MD2 D;  3R8B A;  1RDP D;  4OGQ C;  3A54 A;  1AEX A;  4O42 A;  3GO5 A;  3PUY A;  3K59 A;  5KEE A;  1CA6 A;  4CKB A;  3GV6 A;  4A3K B;  2YYZ A;  3K58 A;  4BA1 I;  3LNN A;  4IUV A;  1TWA B;  3E0J A;  1AP0 A;  5JPN C;  1BCP D;  4WJW A;  3FPP A;  1SMY D;  1RTN A;  2R3Z A;  4DU9 A;  2BA0 A;  1K8O A;  3S2D B;  3PO3 B;  3VR2 A;  1ET6 A;  3I91 A;  3QG1 A;  3QO2 A;  1UNS A;  5FLX L;  3C46 A;  2WKC A;  5C6A A;  1BOS A;  3V05 A;  3LWU A;  3RUZ A;  4FF1 A;  1ZXT A;  3MWY W;  3DMU A;  4WOR A;  2R61 A;  4RH6 A;  4FO2 A;  1KAA A;  3L9A X;  3TP7 A;  4EGV A;  4ZRZ A;  2MPM A;  1JOQ A;  4DAP A;  5A35 A;  4UDU C;  1EOT A;  1PFN A;  3A8K E;  3ITP A;  1CM9 A;  3MFG A;  1I6V C;  2B2T A;  1IW7 C;  2PPB C;  2JP1 A;  3RZD B;  5CR3 A;  4ZUJ A;  2FMM A;  4KHZ A;  1AW7 A;  3UI2 A;  1A2U A;  4KD3 A;  3J7A V;  3W2D A;  2RA4 A;  2BDO A;  4FF2 A;  3W3A A;  4U68 A;  1PTO D;  1EZ8 A;  5JOB A;  3T4A C;  1WTO A;  3VA5 A;  1STB A;  3ND8 A;  3T56 B;  1O7Z A;  1SNP A;  2K04 A;  1OXX K;  5BN5 A;  5IGF A;  2F0U A;  4HMI A;  4IFD I;  1NSN S;  1YNN D;  1EY7 A;  2HUG A;  4RA8 A;  2EXZ A;  5J39 A;  1PYW D;  2OF1 A;  4QB4 A;  2QKI C;  1XX8 A;  1A15 A;  2JE6 I;  1STY A;  1M4V A;  3PV0 A;  4ZUI A;  1IYU A;  1Z47 A;  3M4O B;  2K5D A;  4AYB B;  2SNS A;  1D1I A;  5COY A;  3K5N A;  3QOL A;  1GUW A;  4FF4 A;  5EBC A;  4G4K A;  3CRL C;  1F9S A;  3VR5 A;  5KRU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...