1BDOA

Structure of the biotinyl domain of acetyl-coenzyme a carboxylase determined by mad phasing
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
80
structure length
80
Chain Sequence
b'EISGHIVRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEAMKMMNQIEADKSGTVKAILVESGQPVEFDEPLVVIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ACETYL-COA CARBOXYLASE
molecule tags Transferase
source organism Escherichia coli
publication title Structure of the biotinyl domain of acetyl-coenzyme A carboxylase determined by MAD phasing.
pubmed doi rcsb
total genus 14
structure length 80
sequence length 80
ec nomenclature ec 6.4.1.2: Acetyl-CoA carboxylase.
pdb deposition date 1995-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1bdoA00
3PUVA 3VR2A 1E2WA 4DK0A 1CTMA 1FR3A 1HQMC 2E74C 1OXUA 2DNCA 3IFTA 4JK1C 2PPBC 4HR7B 2BDOA 2YYZA 2A6HD 1B9MA 3FPPA 3KLRA 3GD7A 4OO1G 3VR6A 1GUNA 1Q90A 4KKUA 1IW7D 3VR4A 2EVBA 3A7LA 1GJXA 3M7NA 3VR3A 1GHKA 5JEAH 2D2CC 3PV0A 1GUOA 2A68C 4KKSA 4LJZC 2PCFB 1V8QA 1VDZA 4KKTA 1B9NA 2A6ED 4L8JA 4DK1A 4BA2I 3A7AB 2O5JC 2A6HC 4KI0A 1CI3M 3CRKC 3QG1A 2K33A 4IFDG 1HPCA 3GQBA 3BG3A 1VCIA 1Y8PB 1TKWB 4JBWA 5JEAG 1Y8OB 2L5TA 4G7OC 1K8MA 2A69D 2K7VA 1Q1EA 3P20A 2D62A 3PUXA 3SDZA 3I4LA 4I7ZC 3A8KE 4G7HC 5BN3A 3VR5A 3WDNA 2D5DA 1O7LA 1LABA 5C0XH 4KMUC 2DNEA 4TQUS 3T53B 5KNBA 3QJYA 3FMCA 3PUZA 3A8JE 2F1MA 1ZYRC 3T51B 4LK1C 3U9SA 3PUWA 2R6GA 1CFMA 4KN7C 2A6EC 1HCZA 4KN4C 3W3AA 3M85A 2AUKA 3ND8A 3H94A 2EDGA 4KHZA 1O78A 1ONLA 2JEBI 4IQZA 4H13C 2CW0C 2A69C 1ZKOA 1Z7TA 3OPOA 4BA1I 2JEAI 2E76C 4DNTB 2NN6H 2AUJD 1T5EA 1H9SA 3M4YA 4TKOB 5K36H 3I73A 2KCCA 1Q12A 3L7ZC 3NE5B 3N6RA 3SE0A 3MFYA 2Q8IB 2ZT9C 1E2VA 2DN8A 1FYCA 3TZUA 4H44C 3LWUA 1GUSA 2BE5C 1GUGA 1A6XA 3I72A 1Y8NB 1DCZA 1OXSC 3D31A 1DD2A 1I6VC 1VF5C 2AWOA 3IKJA 1H9MA 5BN5A 3ND9A 3OW7A 2QF7A 1PMRA 2BA0A 2KA7A 5A35A 1VF7A 2NN6G 1EWHA 2B8GA 3MXUA 4IFDH 3VA7A 1BDOA 1E2ZA 2IT1A 1LACA 5KNDA 1G291 1OXTA 2JE6I 2EJGC 2K32A 1QJOA 3T56B 3BDOA 4GZYC 1IW7C 2NN6I 4H0LC 1DXMA 1H9JA 2EJFC 3CRLC 3EQLC 1V43A 3A8IE 4XTCS 3D4RA 1IYVA 2LMCB 3AB9A 1OXVA 1IYUA 3OOCA 1H9RA 1OXXK 2B8FA 1YNNC 4DNRB 2E75C 4PV1C 1TU2B 1SMYC 2BE5D 2EJMA 2BA1A 5C0XG 2O5IC 1YNJC 4XIGS 4OO1H 2PNRC 3LNNA 3PUYA 4OGQC 1Y69U 5KNCA 1Q1BA 1Z6HA 5BN4A 1GUTA 4G7ZC 3DXJC 1H9SB 1HTPA 5K36G 2A68D 3HGBA 3RLFA 1H9KA 2JXMB 2V4DA 3QIAA 1K8OA 4RCNA 1GHJA
chains in the Genus database with same CATH superfamily
5JEAJ 2PZUA 4QL5A 4YHHQ 3J80E 1FNWA 2UXDL 4CDDC 5E4XA 3NBHA 1AP0A 3M4PA 1SNQA 1T9HA 3KLRA 3GD7A 4UP7A 2JN4A 1NAPA 4IN3A 3VR4A 1EQQA 2OWOA 4C3JH 1AEXA 1Z9FA 2PCFB 5JJZA 4J6HA 3I2ZA 3GTOB 3A54A 4A3FB 5HGTA 5COYA 4DV5L 4DAMA 4B9XA 2PNHA 3I4LA 2NVTH 1XX8A 1VQKA 1U9RA 3J81E 2E2HB 4DAYB 1S5ED 1VQFA 2ZTEA 4AQYL 1D5XC 5LMUQ 4FXKC 1DZ1A 3J7AV 4JI0Q 3PUWA 1RTOA 2F03A 3E5SA 1TT2A 1BKBA 1JWUD 4K0KL 3M85A 3S2HB 4DV5Q 4OX9Q 4P2CB 2KHSA 4KK7A 4HIKA 4K5VA 4KLKA 1ENFA 5FO9B 5HGQA 1ZEQX 4OWTB 5CYUA 5CV7A 2UXBQ 2AUJD 1T5EA 3MVVA 4BBRH 2Q2HA 3PMFA 2OTJA 1C48A 1G2SA 1YHBA 3FP9A 1UAPA 1YHAA 1E2VA 1WCMH 1A62A 4H44C 1R9TH 1A63A 2CKZB 4JBJA 5GROA 3SEBA 5DM63 1Y8NB 4JI0L 2F4VQ 1VQGA 1TXYA 2BA0A 5FLXL 4S3SA 4IALA 3C46A 2ENBA 2KEEA 2UXBL 1S5DD 4NXMQ 1WTRA 3S14H 1JE4A 5HURA 2A1AA 1STHA 3TMEA 1Q3LA 4HN7A 3HEJA 4KY5A 3GTKB 2PI2A 1Q8KA 1H9RA 1LTRD 1XMQQ 4K0KQ 3WWVA 3M3YH 1YEZA 4A3DG 1HA5A 1WCMG 3SGIA 2C9OA 1JCKB 2CQAA 3E0JA 1SNPA 3QOLA 5DM73 3EFXD 1V1PA 1RL2A 2AQ1B 2K14A 3SHLA 1Y1VB 4RCNA 2JA7H 3MXPA 2N3SA 1MSHA 1SYFA 5T1GA 4BBSG 1FR3A 3IFTA 4LFAL 4HEDA 4GN4B 2PMZE 3MEHA 1KABA 1PA6A 3PQIA 4L63B 1C8CA 2RA4A 2SNSA 4A3GB 2PI2E 2DJGC 5FLXE 1SYGA 1GUNA 2Q2UA 1EU3A 4FXGC 3M7NA 4A75A 1GHKA 1HFNA 3VA5A 1VDZA 4IZ8A 4HCEA 2M00A 1DGSA 4GLVB 2E2IH 5E1FA 2VL6A 4DUYL 2R7ZH 4WFN3 1PH2A 4EGVA 3HOZG 2D5DA 3NTHA 4RG1A 3HOXH 4UPAA 1B53A 4HCSA 4C3HG 1N33Q 3TQYA 1YNXA 4FNFA 1IYJB 2GA4B 5ELEA 3T13A 4JI1L 4BXXH 3C3LA 1JB7A 4JI6Q 3DHQA 4C1NK 4FF4A 2A6EC 2BCOA 5ELOA 2ES2A 4A3BG 4K6DA 2JA8H 3TEHB 3TS0A 2H1EA 1PFMA 2CW0C 2X6LA 3OWFA 1EU4A 1ET6A 3EN2A 1H95A 2WP8J 4F87A 1X65A 2AWNA 3BU2A 4NB3A 3SE0A 1E1TA 3R8BA 3N52A 4JC0A 5EBDA 5LL6X 2RDGA 5IP7H 1VF5C 4A93H 3F2CA 1BVSA 4KD4A 2B2UC 4IUPA 3I4MH 1HJPA 2A19A 3HKZB 2B2WC 1I4GA 2HDMA 1VQPA 3HOYB 2JA5B 1EL0A 3OMCA 3GP7A 2JE6I 4GOPB 1DXMA 4RKBA 2E8GA 2O4XA 2VB2X 1ICWA 2L55A 4CJ0B 4X3KA 3A5UA 1FVIA 1EY6A 2VQFL 1MJEA 2MO1A 2MHVA 1FJGL 2EXZA 3J81i 4FP5D 1PH6A 4BBSH 1TWAB 1SDFA 2OCEA 5AJ3Q 5C3WA 4IOCA 3T1YQ 4LW1A 3BZKA 4HJ8A 4J1MA 4EQNA 1U4LA 5IYCH 1Q82C 2RCNA 4K2KA 3I4OA 1D1KA 2KQ3A 3UI2A 3AEVA 2OXPA 5CV5A 1PH3A 4DR3Q 4JI8L 1EZ8A 1J8IA 3NBHB 4FXDA 4PMBA 2B2VA 2K52A 1JOQA 1CKMA 2NTTA 1JJCB 3A7LA 1QZHA 3MXGA 4KKSA 4LJZC 4NW2A 3A7AB 4R8IA 1EIFA 4OWXB 2ZXOA 3E0EA 1STNA 1TWHB 1QB5D 2F0MA 1DOMA 3I7FA 1JT8A 1X54A 4DV1Q 3K8AA 2SOBA 1ESFA 1F2LA 3PF5A 2QDBA 1C9OA 1FGUA 3MWYW 3A74A 3H0GH 1KDBA 4YCUA 5KNBA 3FMCA 1XNQQ 1EY8A 5M9OA 4C3IB 2QDLA 3EIVA 2GVAA 2L4NA 3PO2B 2N78A 3M7GA 3P1HA 2OT2A 5C3EG 2L15A 1SE8A 2EXDA 5JAVA 2Q2IA 1CA6A 1PZKD 5M3FH 2JEAI 3DWAA 3I73A 2J4XA 4IUQA 1HZBA 3N6RA 3BVGA 4JI7Q 2JSOA 2UXCL 3I72A 1HNXL 1DD2A 2F0PA 2R92G 3ND9A 3GDEA 1V9PA 2UUCL 2LY7A 5C4XH 4PMCA 4JI3Q 1Y1WH 1MJCA 5EAYA 4ZLTF 1BCPB 1QOHA 4GZYC 3NK9A 1TR5A 2R93B 4JCVE 1XJVA 3CU7A 4EVOA 5IODA 5IOCA 3BZDB 2PQAA 2JA6G 2KCNA 1XWEA 3Q6SA 4CJ1B 4XT3B 1ASZA 2IHEA 4C3HH 4DAYA 3IAYA 3PO2H 1A8VA 4HIMA 4A3IG 2HHHQ 3GTLH 3RR5A 4ZKBB 1I4RA 1K3BC 1HTPA 3SK4A 4CKEA 4DR3L 3KK7A 4CGYB 4B3MQ 1PRTD 3CPFA 4GOPA 4DR1Q 4NXNQ 4ZQ3A 4RHSA 1EIHA 1Q46A 3I8ZA 5CV6A 1CQVA 4A3DH 2E74C 2E2JB 3K0YA 4EQOA 3TDQA 5IGDA 1I50H 4DR4Q 1G91A 3I90A 4IJLA 4DV4L 4G4KA 1O80A 1MI2A 4AQYQ 3K58A 5J39A 2EVBA 2D2CC 1KXLA 3CMEA 4KKTA 1V8QA 3LX0A 1AN8A 3EJIA 1X3GA 5IY0A 2Z9HA 2L5TA 2FINB 3BYTB 3SDZA 1K83B 2M2LA 2VZAA 4CBVA 3HOVH 1O7YA 2RCFA 2IX3A 3H3VI 3VYTA 1SXTA 2VUMG 1TS4A 4BBSB 2CH4A 3FEWX 2VXWA 5C4HA 2B39A 4QJFA 4KN7C 1S40A 4B3RQ 4YHHL 1TWFH 2KECA 1SMXA 4X66L 2JEBI 1CHQD 4BA1I 2E76C 1RHPA 4TKOB 5C44B 3M4YA 4X65Q 1EQRA 4IOAA 1S72A 5FLXc 1SMYD 3M4OH 3GTPH 3I4MB 4DR7L 1K28A 5CC4A 2XWJB 4GNXC 3E9HA 4IFDH 3DEOA 1VF7A 2IX0A 2L11A 2UU9Q 1BDOA 2F0IA 3CXCA 5KNDA 1IW7C 3ERQA 4Y7NH 1TY0A 4PZ7A 1E7ZA 1GD7A 2IY5B 2F0VA 3A8IE 3AB9A 3D4DA 5M5XB 2H4OA 2GVBA 3CAMA 1AH9A 1D2BA 4DNRB 4YY3L 2K4KA 4R1JA 3LNNA 4K2LA 3NBIA 4K5WA 4JV5Q 1I5FA 2GN5A 3HGBA 2SDFA 4IPGA 2XWBB 1A2TA 5KEEA 4PNYA 1ZYRD 3HKZE 1GHJA 1L1OC 2B63B 4ULLA 1FJGQ 1CUKA 4ZAIA 3Q22A 1LT6D 2MJ8A 5JVG3 3U4VA 2E2IB 5C4JH 1EY9A 4X64Q 1HR0W 1E0BA 4PQXA 2SEBD 1VQEA 4X62L 1L1OB 4DK1A 4UAIA 1VQLA 1AFPA 4LMQD 2IX1A 1X3QA 4HTHA 2XTIA 1HPCA 3FRPB 2MFIA 1Y8PB 4YY3Q 1Y8OB 4DFAA 1VQ7A 1X6OA 3QOJA 4FDBA 5BN3A 1WTQA 2JA7B 3DM1A 3VR5A 2JA5G 3OMGA 4N9TA 4X3SA 1TS3A 5ELFA 4B9WA 4IPHA 1FNVA 3STBC 1TQOA 1ILQA 5IWAQ 3SK8A 3MTSA 5LL6S 2WAQG 1TWGB 3NQTA 1LLRD 2RVLA 1QCBD 2F0LA 2NZOA 1HNWL 4YWLA 5KRUA 1IBLQ 3M3YB 3ULJA 2RHSB 4GN5A 3PF4A 2EDGA 3GTKH 3J81L 5EPKA 3RNUA 1B3QA 2NZ1D 3S14B 1H9SA 5K36H 2KJXA 2KCCA 5C4ZA 5I2XA 1N33L 4KHPQ 3RZDH 2DN8A 4KY7A 1TS5A 2EYPA 2OEOA 2PMZB 3CMAA 4UP8A 4L5TA 1QG7A 1R9TB 1PFSA 2JA7G 1QJOA 2NN6I 4BBRB 2DY7A 1JJ2A 1H9JA 3OHXC 3EQLC 2K1BA 3UDIA 2DJFC 3TP8A 1HZCA 1CSQA 1IYUA 4JI6L 2K5DA 4QF4A 1STGA 2B29A 2BE5D 5IGBA 1IBLL 2BA1A 3S2HH 4O2DA 2A8VA 2Y0SE 4RHRA 1JICA 4IO9A 2K5HA 1Z6HA 1GUTA 2CHBD 3F2DA 2QGQA 4DR6Q 1U4PA 3S16H 4NPSA 1L0YB 2C35B 4KJOA 1B50A 2EYHA 4DV3L 4TVAB 3PIO3 1CM9A 2RKSA 3GTGB 2PPBC 1S5FD 1X56A 2WINB 3UE0A 1WVLA 3L3OC 3KJPA 3OYYA 1IKMA 4A3FH 1B9MA 4OO1G 1MHWC 3J80L 1WI5A 4DAPA 2B2UA 1AZQA 1DM0B 2XRQD 2J7ZA 5FLMH 3VR3A 4A3JB 5ELNA 4QMGA 2Z0SA 4BA2I 1K3RA 5GAGC 3U50C 1KLGD 1PH9A 1LT5D 5IWAL 5C4JB 3V05A 1XMOQ 4CHTB 1F9PA 1HR0L 2YU9B 3HFZB 3W2DA 3VYUA 5LMNW 1Y1VG 4CKCA 4DUZL 4X3TA 3Q24A 1EWIA 1FGBD 1C0AA 3C1EA 1IKLA 4LK1C 3W1GA 1S5CD 1NJIC 1I6HH 3A5ZB 3VYSA 1BCPC 2WACA 5IGGA 2N8NA 2VQEL 2CWPA 1JWMD 4NDXA 1U5KA 3FPUB 3OPOA 4YCWA 2J0TD 1WD1A 1K8AC 1LT4D 5C3EB 4HJ7A 1STAA 2Q8IB 2HD3A 4OELB 4DK6C 2B63G 1CT1D 1SRUA 2WAQE 1I6VC 2F3WA 2NBFA 1KDAA 3TN2A 3M4OB 5EGTA 1X55A 4JG2A 1JJGA 2A5HA 4H0LC 1SE2A 2F3VA 5I9OA 1XPOA 2E5LQ 3MZ5A 2ZXPA 2KVMA 1IYVA 1LTID 4B08A 5EBCA 3TREA 1WJJA 4UHVA 2ZJQA 4QY7A 4JBKA 2K5VA 5IGFA 3JAME 4LUOA 4R4IA 1SSOA 3NP8A 3K7UC 1SNMA 1HNZL 4A3KB 3HZXA 1IHZA 2RSOA 1H9SB 1PTOD 4A76A 2A68D 2K6AA 4MIUA 5M3MH 1RIPA 5E4WC 1H9KA 2E5LL 4DKAC 1G6PA 1CZWA 1E2WA 1EUJA 2L1BA 1OXUA 2DNCA 3HKSA 1PH4A 1BXTA 5K5PA 2WAQB 3HOWH 4A3FG 1T5XD 2LXKA 3DLLA 1VQMA 3H09A 1I94Q 5F2DA 1BBUA 5I2YA 2HHHL 2F0WA 5IP9H 3S1NH 4DUZQ 2AKWB 1PTOB 5EKKA 4HIDA 4A3KH 4K14A 1B7YB 4JI4L 3RN2A 3QB3A 2QKIC 3GV6A 2CFMA 1B44D 1I50B 3BG3A 3D6WA 3KUPA 1K8MA 1SNDA 4QIWE 2EYLA 2Z6KA 1RODA 1AE3A 1EEFD 1SEBD 2KOLA 2AQ2B 1BUVT 1I94L 3CD6A 2AQ3B 4GKJL 2EY2A 1ILPA 1CHPD 2ZJPA 2CW0D 3U9SA 2A73B 2EYOA 3AFQA 3GTLB 3C2PA 4RMFA 2NWGA 4JI7L 4HMIA 1QILA 2ZTDA 3W3AA 1IXRA 1YITA 3S15H 1BQQT 2D9UA 4IUTA 5I9PA 2EYFA 5D3DA 2R61A 3PCOB 2RSNA 1ICFB 2R93H 3E9IA 3O13A 2B2YA 2HQLA 1B3AA 2KHIA 1HH2P 3CCUA 3TZUA 1SE3A 2LXJA 4K6LA 1CKNB 3CW2C 4KJNA 5ELDA 2QF7A 4QB4A 4DXGA 1HZ9A 2UUCQ 3TP5A 1L0XB 3CC7A 5ELBA 4IFDI 1G2TA 4DV0Q 1L1OA 4R4OA 4JOIA 5I6YA 5KGUA 3HKZG 4N8FA 4H02A 5M3FB 3OW2A 4R4CA 2YU9H 2LMCB 2Y0SB 3T1HL 4GS3A 4B3RL 4HIOA 1YNNC 1TU2B 3CHBD 4N9PA 4HJAA 3Q8DA 3KF8A 1Y69U 1Q1BA 3KFUA 4C3IH 2RBMA 4A3GG 1HZAA 1CK1A 3BVZA 3PSIA 2KEDA 3A0JA 4X62Q 4J15A 5C4XG 2R92B 4LFAQ 3PUVA 1GO3E 2HIXA 3KYHC 1HQMC 1VQ8A 1SJED 1UEBA 2VUMH 1CQFA 3TS2A 1EEID 1TWHH 4ZUIA 3UE1A 3BZCA 5KYLA 2LS01 2UU9L 5IGCA 5M3FG 1K9MC 4DV4Q 3PIOA 3NUCA 1SFOH 3CQZB 4OHJA 3HOZB 1PYWD 3MHBA 1NCVA 3KLSA 4YWMA 1QUQA 1PH1A 1QZGA 1ZXTA 5JOBA 1A2UA 2K33A 1G51A 2F0JA 1XMQL 2F3IA 1P8LA 2G5DA 3BVMA 3G71A 4V190 4X6AH 4L5QA 4KMUC 3T53B 2WKCA 5C44G 2F0QA 2PZTA 3MEFA 1CFMA 1PXUA 1X32A 5HY6A 1NNXA 1S5BD 4A3JG 5D3IB 1KL9A 4F7XA 1VS0A 1MIUA 1YVCA 4C1NI 1Q12A 5EJWA 3IRBA 1VQ9A 3MFYA 4X65L 2JA5H 1J6QA 5DNFA 3D31A 4C2MB 2XGTA 3NTKA 1ET9A 4ZUJA 4KD3A 1HNWQ 1SE4A 1QE6A 1TWGH 4A3LH 2BDNA 4A3BH 2EPBA 2Y0SG 3U58A 1B8AA 1PH8A 3DWPA 4APVA 5EPLA 2EJFC 3S9WA 5EKLA 1JC7A 4KHPL 3RZOH 1EIGA 2JA8B 3BJUA 1EY7A 2E75C 5C6AA 2O5IC 2CH4W 3CCQA 4OO1H 2ZXRA 2F0OA 4KTAA 5KNCA 3TBIB 4KY6A 4XXEA 4MZ9A 3UDXA 1EY4A 4DK3C 2NVXB 2RHQB 1BOSA 3MFGA 5CBAE 4A3LG 5I6WA 4LUVA 3J7AF 4DV2Q 3VR2A 3S2DB 1LTTD 2F0NA 4HMJA 2YYZA 3S2DH 3DMUA 3ONAB 1NUCA 3NELA 1JOOA 3VR6A 1N32Q 5IYDG 1XPUA 1XPRA 1NMFA 3H3VC 1ASYA 2YTYA 3EBEA 1BNZA 3CCVA 3T16A 5H1SE 3H6MA 4JW0A 4DV1L 2A69D 2K7VA 2HQEA 2WKDA 3P20A 4OL7A 1PTOF 5M5XH 3KJOA 3A55A 4RGOS 4DUYQ 3GV3A 3G6EA 1PYBA 1IBKQ 4ZRZA 1SNCA 2F0HA 3A8JE 3JAMc 1YJNA 3K57A 1A3VA 1EZ6A 1RTNA 1VQAA 4JBMA 4C2MH 4AH6A 3GTPB 3ICEA 1K73C 1HTLD 2X6GA 3KF6A 5FJ8H 1BBXC 1JMCA 4DNTB 1DJRD 5AJ3L 3T1YL 1GUWA 3NE5B 1WTWA 1K0SA 1N9WA 1A6XA 3WOFA 4BBRG 3SK6A 4K8JA 4QQBX 2I0QA 1EY5A 1DYQA 3I4NG 1HRJA 5IYBH 4HSPA 4Q0FA 1N8RC 1W3SA 3DWQA 2F0EA 3WOEA 1X3FA 2K5WA 4ZCKA 4LFBL 1E2ZA 1NE3A 4RGMA 3K5NA 1KD1C 3T56B 3I4MG 4LFCQ 2F0FA 3NPPA 2TSSA 4ZK9B 2ICIA 4A3IH 2M9VA 1PDQA 1YNJC 4AYBE 5IT9c 5IGEA 1M90C 3PUYA 4P73A 3ZYYX 1NSNS 3CQZH 3HOZH 3CCMA 3S1RB 4LFBQ 2EIFA 3FKIG 2ICEC 4P75A 3CCEA 2L0CA 4DR6L 4RGTA 4DF7A 2JXMB 1N36Q 4BY7G 3QIAA 2JYOA 1UNSA 1EYCA 2FMMA 5IYBG 2UXDQ 2NVTB 3GO5A 1B2TA 2VUMB 3R3OA 2E2JH 4I65A 4A3DB 1JORA 2K5QA 2EZVA 2BDOA 3HOUG 2JA6H 1II3A 2R92H 3HOXG 5C0XI 4BS9A 4JI3L 4ZKCB 4KKUA 2IW3A 2PQAB 4RFBA 4GKJQ 1GJXA 1EYDA 1F77A 4RKLA 2OF1A 4LF9Q 4JI5Q 3KLWA 3BYYB 5FKAC 1N34L 5D65A 3BS1A 1D1IA 4LWCA 1WOCA 1O7ZA 4JBWA 2DGYA 3TRZA 1KHIA 4NP5A 1SYEA 1XMOL 2KCTA 5CORA 1HR0Q 3KBGA 3U4ZA 3S1MH 3Q0AA 1D5ZC 2R7FA 4B3SL 2F1MA 2HIVA 1VQOA 1Y1WB 3ZJYC 4X3UA 4DR1L 1EIYB 2R6GA 1QNUA 4ID6A 1PZID 2OQKA 3IL8A 5DEHA 2UXCQ 2O2LD 2BH2A 3OSOA 1X9NA 3ND8A 3H94A 5FOBB 1QUQB 1ONLA 2A69C 2F52A 4H7BA 4GNXB 3X3MA 3NENA 3K5LA 3PO3G 5IP7G 2NTSA 4U673 4IPCA 3I4NH 5GAHC 1VQCA 3VYRA 1PYSB 1GKHA 1GUSA 3S1QH 3S15B 5C0XJ 1TIID 3TSSA 1V1OA 4GLAC 1GXDC 5BR8Q 2LFNA 2F0SA 4LF5L 4PG3A 4P72A 1STEA 2OQ0A 3H0GB 2IWHA 1ENCA 3F1ZA 4I7AA 3ULLA 4BXXG 3F8TA 1RD9D 5JPNC 5I4DA 2RDHA 2EY1A 2I07B 5JJIA 3KOJA 1DOKA 4DXFA 1RCVD 1R4PB 1KRSA 2B8FA 1Q8IA 1J5EL 4Z9CB 1LTLA 2F0TA 2PNRC 1PZJD 2ZJRA 3HOUH 1PTOH 1HFGA 1JOKA 4DR4L 2MNAA 1LUZA 3EVQA 4DA2A 3RLFA 2QEXA 2HCCA 3CCSA 2EYMA 1AE2A 4KV6A 3L2PA 1EYAA 3OTOL 1LTBD 1PTOC 3OIPA 5AFWA 4LF6Q 4JK1C 4A3EB 3I70A 2L9HA 1BF4A 1FD7D 4LF4Q 4RGNA 3R2IA 4DPGA 1CZGA 1U4MA 4WORA 1R4QB 1UE6A 2YTVA 1VQBA 3RLOA 1I4PA 3SXHA 3NEMA 2A6ED 4KI0A 4DV6Q 3KDFA 3FKIH 1MD2D 3A56A 2QW7A 5JEAG 5C3XA 1RDPD 1EQTA 1B4OA 3WDNA 1O7LA 2I5MX 3J81j 2PYKA 5LHY1 1KQSA 1F9SA 1PRTB 2XVSA 1YI2A 3JAML 1ZYRC 3HOYH 1LT3D 3T51B 2N49A 1SJHD 1E22A 3ITPA 2XRSD 4POFA 2OTLA 2KUMA 1D8LA 4A93B 3NXWA 4L5RC 1B70B 4KHZA 3J7ZC 1VQIA 5G3LD 3KDFB 2MUYA 5GAEC 5C3EH 2F4IA 2WB1G 1UE7A 2RQXA 4A93G 3PGZA 5CBEE 4PZ8A 4JYAL 5L37A 1DCZA 3IKJA 2IJ0A 3H15A 4AYBG 4DV7Q 2CVRA 4AIMA 1I6HB 1YZ6A 1CKOA 4EX5A 1EFID 1U0LA 1A15A 3VA7A 2G9DA 4GN3B 3KF6B 1G291 4FF1A 5CV4A 3HOXB 1EOVA 5IIFA 3PIP3 4XTCS 2R7ZB 3D4RA 4NMZA 4JI2Q 1OXVA 3J81c 1E3PA 1I4HA 5IYDH 2F4VL 1SLJA 1WTPA 3TP6A 1S3OA 5LMNQ 4HJ5A 2UUAQ 1DOLA 4UDUC 2B2TC 2XNAC 2PW5A 1KTKA 4LF4L 4BY1G 2EY5A 1EYGA 5ELCA 2B3GA 4A3JH 1F2ZA 3MA2B 4L6TB 3D0FA 1IZ6A 5IYCG 4JI1Q 4NXML 4A3GH 4MHEA 1VQ4A 1F2YA 4OWWB 1Y1WG 1V1PB 3U9OA 3S17H 1CTMA 3RUZA 3GTGH 3V96A 1SROA 3VDYA 5LMNL 2UUAL 1QVCA 1Y1VH 2JQOA 1Q90A 3S16B 5JJKA 1PH5A 2R93G 1CSPA 1X3PA 2K03A 4Q5VA 2Z1CA 3K5MA 2O5JC 3GTJH 1J9OA 3H91A 5FJ8G 4OIKA 4R4QA 4J8QA 5CGKA 4DN4M 1E24A 2VQEQ 1D7QA 3GTQH 4A3EH 1IBML 5FO7B 3HP3A 3KF8B 4JOIC 4C56C 3NTIA 3QWNA 1IL8A 4PMWA 3I55A 3J80i 2XN9C 1RF2D 1N32L 3G48A 3PUZA 4LUZA 4DU9A 4RAUC 4DR2Q 1QWYA 1GVPA 1P16A 1D6EC 2RF4A 3G4SA 1F9QA 1Z47A 2K04A 4RH6A 1KNEA 1KAWA 4A3KG 3RZDB 4JI8Q 3ULPA 4H13C 1MSGA 1PRTF 1ZKOA 1PFNA 1I4QA 5JVH3 2NN6H 5DLQE 2Z4HA 3SK5A 1FL0A 4QCLA 3W1BA 1WTOA 3PIPA 1HNXQ 4XT1B 2NVYB 3K5OA 1OXSC 1SYDA 2BOSA 3D4WA 4FYDA 2AWOA 4FO2A 3MC0B 1F9RA 1QVGA 1W2BA 1PMRA 1HNZQ 2AHOB 5A35A 3S1QB 3AMUA 1KAAA 3I4NB 2CWAA 3CC4A 1IBKL 1S4ZA 3P7JA 1KIXA 1A3TA 3CRLC 3Q23A 3BDCA 4DR2L 1EFWA 1KC8C 3OOCA 1U4RA 1Y14B 1YHQA 3FVQA 2NZHA 4YCVA 2F0GA 5C0XG 3K7AH 4WJWA 2LKVA 3GTOH 2DUDA 1AW7A 3AU7A 2TMPA 1PFBA 1D5MC 5BN4A 4G7ZC 3DXJC 1JB3A 3EA6A 4C3JB 1OTCA 4A3CH 2EYJA 4PZ6A 1UEAB 3URYA 5C5MA 4LF8Q 4IFDJ 4BY7H 3S1MB 1VQ6A 2BH8A 3CP0A 4CDFC 1VQHA 2UUBQ 2B63H 1UE1A 2VQFQ 1EY0A 1TWCH 4MN3A 1IW7D 4LF9L 3I56A 1CA5A 5FK9C 5IT9L 2A68C 1JE5A 3OTOQ 4L8JA 1MGSA 3X3NA 5E3FA 1SN8A 2JA6B 1G6ZA 1EWCA 4ILWA 3PUXA 2IPKD 4I7ZC 3A8KE 3NWTA 2HUGA 4G7HC 1I3QH 4Y7NB 1BO0A 5LMUL 2NYZD 4ME3A 4M8AA 1STBA 5IE8A 4DV6L 2XIWA 3S24A 1KNAA 3S1RH 3CCRA 1WD0A 1O7IA 2ASBA 3DUZA 4JI5L 5M5WH 3R93A 1YJWA 2HCIA 3HG9A 3MXNB 4QUCA 4A3MH 1N34Q 2VY3A 1TVXA 3FHWA 1A3UA 3J7YW 3M9BA 3PO3B 1M4VA 4RWSC 4A3IB 1O78A 1IL2A 1ENAA 4ZYSA 2JK8A 1Z7TA 5J3BA 1LM0A 1LO5D 5C44H 4WJ3M 3GTMB 3K6OA 2ZT9C 4B3SQ 2BE5C 1GUGA 4L5SA 1XXGA 3MAQA 1TWFB 3E6ZX 5EPJA 1HXYD 4DR5L 4FVMA 2MO0A 1F2MA 2PQEA 2QCPX 1OXTA 4A3MG 1WYDA 1ML0D 5CV9A 4U68A 5D14A 3HOVB 2KCMA 4F8MA 1V43A 1K83H 5CMDA 4AYBB 4C3JG 1OXXK 4OO1I 2CCZA 5G3LF 3W5OA 5KIXA 1HUNA 3I3CA 4A3MB 3LGJA 1NR4A 5K36G 1UUPA 3FDTA 2WB1B 3HRZC 1I4XA 4NKLA 4C3IG 3KLSX 4B3TL 1WTHA 3V2TA 5M3MG 1KLUD 3TZDA 4JPBW 4HR7B 1E1OA 1C4QA 4JV5L 2A6HD 2VS1A 1NY4A 3FPPA 5C5LA 1AZPA 1QVFA 2HT1A 2K05A 4CDEC 1Q7YC 2X69A 2MGSA 2R3ZA 2Z8LA 3I91A 2ZTCA 2ALYB 4C3HB 4YIJA 1CI3M 3DM3A 3CRKC 1VQJA 3QG1A 1GOZA 4JI4Q 4F88A 4B3TQ 1VCIA 1LV9A 2F0UA 1SYBA 3J7A5 4K8IA 1JWSD 2I46A 4G57A 2EOTA 3H3VH 3F2BA 4WJ4A 5C0XH 4BY7B 4DV0L 2VB3X 2K50A 1ESRA 1XTCD 3LWEA 2NVXH 3TP7A 4FF3A 1JQYD 3CCJA 3HOWG 5C4XB 3B6YA 3KBXA 4KN4C 5EKIA 2NVQB 4LF6L 3K7AB 4P71A 4Y52H 4A4IA 1PHJA 2EQSA 2Q2TA 2AUKA 5BR8L 4X64L 3RZOB 5ISRA 5M5YB 3J80c 4R4TA 4A3CG 2MQHA 3T4AC 4HSVA 3UDGA 5KYIA 1XNRQ 1FYCA 3ER0A 3SVMA 1WTVA 4A3BB 1NBWA 3JC66 5BN5A 1PV4A 3CCLA 3RD4A 4XQNA 1PH7A 3MXUA 2NVYH 4XYQA 2RDFA 3BDLA 1HQRD 4YWKA 2I5HA 1Q86C 2AMCB 4UY8C 3K0XA 5IP9G 3D6CA 4JVZA 3D3RA 2JA9A 4HJ9A 1V1QA 4JYAQ 3NHHA 1BCPD 1YJ9A 4BY1B 4TRDA 4OXPA 1PRTC 1SMYC 1LYLA 2MP1A 3T1HQ 4ME5A 3G6JB 4XIGS 4FF2A 2EE1A 2N88A 2KHJA 1NR2A 1J5EQ 1RJTA 4IPDA 2B2VC 4DNIA 2MPMA 3AFPA 4UP9A 2D0PA 1X3EA 3L0OA 5DAUA 2L12A 1HUMA 1LTAD 1YIJA 1LTGD 5CR3A 2WV6D 4DK0A 4ODGA 1IBMQ 3GTQB 4DV7L 4O1NA 2YV5A 2YTXA 2B2YC 1CKNA 1M1KC 3GTJB 5J1ZA 4XQJA 4IUVA 3L9AX 1HA6A 1TWAH 2K75A 1SFOB 1PLFA 2F0DA 2ATWA 5JEAH 3PV0A 1GUOA 2JA8G 2PZWA 3HS0C 2A6HC 2UUBL 4V0BA 4XQQA 4POGA 4IFDG 1W6KA 3GQBA 3CPWA 4BY1H 4R9WA 2F0KA 4G7OC 1KRTA 3F2UA 2D62A 3S17B 3DEPA 4IUNA 2KENA 3RMHA 3AQQA 2DNEA 4TQUS 1XNQL 3NSWA 3QJYA 4DGZA 4BWGB 4MTKA 5NUCA 2V1CC 5IT9E 1SAPA 3ERSX 1EOTA 1WFQA 1SYCA 1W6JA 1VQ5A 2WFWA 4GOPC 5FO8B 1GM5A 3MXNA 3NQIA 4IQZA 2CQOA 4IURA 1NMGA 4MNOA 5M5YH 4LF7L 3PO2G 2P5ZX 4KHVA 1YNND 3UDFA 3LWUA 1LTSD 1DONA 1BR9A 2K01A 2G9HD 2VW9A 2QA4A 2NVQH 3K81C 5JPMC 3OW7A 1OO9B 2KA7A 2NN6G 1EWHA 2B8GA 3IFDA 1C7YA 2FJ2A 4ABNA 1LACA 2K32A 2EJGC 2WB1E 2Z6KC 1NTGA 1N36L 2D0OA 4R8NA 2DY8A 3C1FA 5TSSA 4IUUA 4DR5Q 3P75A 1VMPA 2K28A 2WIIB 4K5XA 4GLXA 4JI2L 4PV1C 4OONA 2EJMA 4DV2L 3EROA 1TS2A 2SNMA 2JP1A 2NB0A 4P74A 1L2FA 1YBYA 3RLNA 4GKKL 2Q8TA 4QUFA 5EQ0A 4B3ML 2K5NA 4DAVA 4A3EG 1XYIA 4TSSA 4O0AA 1VQDA 1SNOA 4EQPA 5GQOA 4DV3Q 5A2QL 5FLMG 1JR0D 3RN5A 3FKIB 2ZM6L 2Z4IA 1YNJD 2FFKB 4MTNA 1BCPF 4E6IA 3M4QA 2NUCA 4EQ5A 5J22A 2FMCA 2R7ZG 3OIQA 3NWSA 3S1NB 1WTXA 1PVOA 1B9NA 4LF8L 2XSCA 3D8GA 4HAEA 1EQVA 3OWEB 2H5XA 1TY2A 3HOWB 1TKWB 3STBD 2LSSA 1Q1EA 2JJQA 2QILA 2FXQA 4XDXA 1LABA 5CV8A 4GKKQ 1RKNA 4CKBA 3AYHB 1VQNA 2Z6BA 3K80C 5M3MB 4N8X1 1BBWA 2EY6A 4WRDA 4OEMB 3HOUB 4LF7Q 1HHVA 1M8AA 4QIWB 2R7DA 1HCZA 3G7LA 3SR1A 1G8ZD 3JAMi 4CJ2C 1WCMB 2ZM6Q 4CDCC 1XTDA 1MBYA 4RCOA 3GTMH 4OIJA 2VNUD 4LAAA 3R2TA 1QNKA 4ALPA 3H0GG 4NXNL 3L7ZC 1K8GA 4O42A 1Q81C 3QR8A 3PO3H 2ID0A 4OX9L 4LFCL 4LF5Q 1H9MA 4IJHA 4X66Q 1A0IA 1SR3A 3QO2A 5M5WB 5GADC 3CF5A 2E2DC 2B2WA 1UWVA 2IT1A 3E3XA 1VMCA 2E2HH 3BDOA 1XNRL 5T1IA 3K59A 1I3QB 5A2QE 4DR7Q 2N55A 2HDLA 2C5CA 2IHFA 5E7NA 4XYOA 1STYA 1UE5A 3HOYG 2IL8A 2Q8RE 1K0RA 1KDCA 2B2TA 3CKIB 1L0WA 3HOVG 1SBBB 2KBNA 4OGQC 4GNXA 1B1ZA 2QEJC 2FHTA 3CC2A 1FNUA 4RA8A 4QGUA 1MKHA 4M1UB 4LNQA 2V4DA 2PW7A 5JJLA 1TWCB 2PO4A 2I5LX 2A74C 1K8OA
chains in the Genus database with same CATH topology
5JEAJ 2PZUA 3J80E 1FNWA 5E4XA 3NBHA 1AP0A 1SNQA 3KLRA 3GD7A 1NAPA 4IN3A 3VR4A 1AEXA 2PCFB 5JJZA 4J6HA 3GTOB 3A54A 4A3FB 5HGTA 5COYA 4B9XA 3I4LA 1XX8A 1U9RA 3J81E 2E2HB 1S5ED 1D5XC 4FXKC 1DZ1A 3J7AV 3PUWA 1RTOA 2F03A 3E5SA 1TT2A 1JWUD 3M85A 3S2HB 2KHSA 4KK7A 4P2CB 4K5VA 1ENFA 5FO9B 1ZEQX 5CYUA 5CV7A 2AUJD 1T5EA 3MVVA 3PMFA 1C48A 1G2SA 1UAPA 1E2VA 4H44C 3SEBA 5DM63 1Y8NB 2BA0A 5FLXL 4S3SA 4IALA 3C46A 2ENBA 2KEEA 1S5DD 1WTRA 1JE4A 5HURA 1STHA 3TMEA 1Q3LA 4HN7A 3HEJA 4KY5A 3GTKB 1H9RA 1LTRD 1HA5A 2C9OA 1JCKB 2CQAA 3E0JA 1SNPA 3QOLA 5DM73 3EFXD 1V1PA 2AQ1B 3SHLA 1Y1VB 4RCNA 3MXPA 1MSHA 1SYFA 5T1GA 1FR3A 3IFTA 4HEDA 3MEHA 1KABA 4L63B 1C8CA 2RA4A 2SNSA 4A3GB 5FLXE 1SYGA 1GUNA 1EU3A 4FXGC 3M7NA 1GHKA 1HFNA 3VA5A 1VDZA 4IZ8A 4HCEA 2M00A 5E1FA 4WFN3 4EGVA 2D5DA 3NTHA 1B53A 4HCSA 4C3HG 4FNFA 2GA4B 5ELEA 3T13A 3C3LA 4FF4A 4C1NK 3DHQA 2A6EC 2BCOA 4K6DA 2H1EA 1PFMA 2CW0C 2X6LA 3OWFA 1EU4A 1ET6A 2WP8J 4F87A 2AWNA 3SE0A 3R8BA 3N52A 5EBDA 5LL6X 2RDGA 1VF5C 4KD4A 2B2UC 4IUPA 3HKZB 2B2WC 1I4GA 2HDMA 3HOYB 2JA5B 1EL0A 3OMCA 3GP7A 2JE6I 1DXMA 4RKBA 2O4XA 2VB2X 1ICWA 2L55A 4CJ0B 4X3KA 1EY6A 2MHVA 2EXZA 4FP5D 1TWAB 1SDFA 5C3WA 4J1MA 4EQNA 1U4LA 4K2KA 1D1KA 2KQ3A 3UI2A 2OXPA 5CV5A 1EZ8A 1J8IA 4FXDA 4PMBA 2B2VA 1JOQA 2NTTA 3A7LA 3MXGA 4KKSA 4LJZC 4NW2A 3A7AB 4R8IA 2ZXOA 1STNA 1TWHB 1QB5D 2F0MA 1DOMA 2SOBA 1ESFA 1F2LA 2QDBA 3MWYW 1KDBA 5KNBA 3FMCA 1EY8A 5M9OA 4C3IB 2L4NA 3PO2B 3M7GA 3P1HA 2OT2A 5JAVA 1CA6A 1PZKD 2JEAI 3DWAA 3I73A 2J4XA 4IUQA 3N6RA 3BVGA 2JSOA 3I72A 1DD2A 2F0PA 3ND9A 2LY7A 4PMCA 4ZLTF 1BCPB 1QOHA 4GZYC 3NK9A 1TR5A 2R93B 3CU7A 4EVOA 5IODA 5IOCA 3BZDB 2KCNA 1XWEA 3Q6SA 4CJ1B 4XT3B 4DAYA 3IAYA 4ZKBB 1I4RA 1HTPA 4CKEA 3SK4A 3KK7A 4CGYB 1PRTD 4ZQ3A 4RHSA 1EIHA 3I8ZA 5CV6A 1CQVA 2E74C 2E2JB 3K0YA 4EQOA 3TDQA 5IGDA 1G91A 3I90A 4G4KA 1O80A 1MI2A 3K58A 5J39A 2EVBA 2D2CC 4KKTA 1V8QA 3LX0A 1AN8A 3EJIA 2L5TA 2FINB 3BYTB 3SDZA 1K83B 2M2LA 4CBVA 1O7YA 2IX3A 3VYTA 1SXTA 1TS4A 4BBSB 3FEWX 2VXWA 5C4HA 2B39A 4KN7C 2KECA 2JEBI 1CHQD 4BA1I 2E76C 1RHPA 4TKOB 5C44B 3M4YA 1SMYD 3I4MB 5CC4A 2XWJB 4IFDH 3DEOA 1VF7A 2IX0A 2L11A 1BDOA 2F0IA 5KNDA 1IW7C 3ERQA 1TY0A 2F0VA 3A8IE 3AB9A 3D4DA 5M5XB 2H4OA 1D2BA 4DNRB 3LNNA 4K2LA 3NBIA 4K5WA 3HGBA 2SDFA 2XWBB 5KEEA 4PNYA 1ZYRD 1GHJA 2B63B 4ULLA 4ZAIA 3Q22A 1LT6D 2MJ8A 5JVG3 2E2IB 1EY9A 1E0BA 4PQXA 2SEBD 4DK1A 4UAIA 1AFPA 4LMQD 2IX1A 1X3QA 4HTHA 1HPCA 3FRPB 1Y8PB 1Y8OB 4DFAA 3QOJA 1WTQA 5BN3A 2JA7B 3DM1A 3VR5A 3OMGA 4N9TA 4X3SA 1TS3A 5ELFA 4B9WA 1FNVA 1TQOA 1ILQA 3SK8A 3MTSA 5LL6S 1TWGB 3NQTA 1LLRD 2RVLA 1QCBD 2F0LA 5KRUA 3M3YB 2EDGA 3J81L 5EPKA 3S14B 2NZ1D 1H9SA 5K36H 2KJXA 2KCCA 5C4ZA 5I2XA 2DN8A 4KY7A 1TS5A 2EYPA 2OEOA 2PMZB 1QG7A 1R9TB 1QJOA 2NN6I 4BBRB 2DY7A 1H9JA 3OHXC 3EQLC 2K1BA 3TP8A 1IYUA 2K5DA 4QF4A 1STGA 5IGBA 2BE5D 2BA1A 4RHRA 1JICA 1Z6HA 1GUTA 2CHBD 1U4PA 1L0YB 4KJOA 1B50A 2EYHA 3PIO3 1CM9A 2RKSA 3GTGB 2PPBC 1S5FD 2WINB 1WVLA 3L3OC 1IKMA 1B9MA 4OO1G 3J80L 4DAPA 2B2UA 1AZQA 1DM0B 2XRQD 2J7ZA 4A3JB 3VR3A 4QMGA 4BA2I 1KLGD 1LT5D 5C4JB 3V05A 4CHTB 1F9PA 2YU9B 3W2DA 3VYUA 4CKCA 4X3TA 3Q24A 1FGBD 3C1EA 1IKLA 4LK1C 1S5CD 3VYSA 1BCPC 2WACA 5IGGA 1JWMD 4NDXA 3FPUB 3OPOA 2J0TD 1WD1A 1LT4D 5C3EB 1STAA 2Q8IB 1CT1D 1I6VC 2F3WA 2NBFA 1KDAA 3TN2A 3M4OB 5EGTA 2A5HA 4H0LC 1SE2A 2F3VA 5I9OA 3MZ5A 2ZXPA 2KVMA 1IYVA 1LTID 4B08A 5EBCA 3JAME 5IGFA 1SSOA 3NP8A 1SNMA 4A3KB 3HZXA 1IHZA 2RSOA 1H9SB 1PTOD 2A68D 2K6AA 4MIUA 5E4WC 1H9KA 1CZWA 1E2WA 2L1BA 1OXUA 2DNCA 1BXTA 5K5PA 2WAQB 1T5XD 3H09A 5F2DA 5I2YA 2F0WA 1PTOB 5EKKA 4K14A 3QB3A 2QKIC 3GV6A 1B44D 1I50B 3BG3A 3D6WA 3KUPA 1K8MA 1SNDA 2EYLA 1RODA 1EEFD 1SEBD 2KOLA 2AQ2B 1BUVT 2AQ3B 2EY2A 1ILPA 1CHPD 2CW0D 3U9SA 2A73B 2EYOA 3GTLB 3C2PA 2NWGA 4HMIA 1QILA 3W3AA 1BQQT 2D9UA 4IUTA 5I9PA 2EYFA 5D3DA 2R61A 2RSNA 3O13A 2B2YA 1B3AA 3TZUA 1SE3A 4K6LA 4KJNA 5ELDA 2QF7A 4QB4A 4DXGA 3TP5A 1L0XB 5ELBA 4IFDI 1G2TA 5I6YA 5KGUA 5M3FB 2LMCB 2Y0SB 1YNNC 1TU2B 3CHBD 4N9PA 3KF8A 1Y69U 1Q1BA 2RBMA 1CK1A 3BVZA 2KEDA 2R92B 3PUVA 1HQMC 1SJED 1CQFA 1EEID 4ZUIA 5KYLA 2LS01 5IGCA 3NUCA 3HOZB 3CQZB 4OHJA 1PYWD 3MHBA 1NCVA 3KLSA 1ZXTA 5JOBA 1A2UA 2K33A 2F0JA 4V190 3BVMA 4KMUC 3T53B 2WKCA 2F0QA 2PZTA 1CFMA 1PXUA 1X32A 1S5BD 5D3IB 4F7XA 4C1NI 1Q12A 5EJWA 3MFYA 5DNFA 3D31A 4C2MB 3NTKA 1ET9A 4ZUJA 4KD3A 1SE4A 1QE6A 2BDNA 2EPBA 3DWPA 5EPLA 2EJFC 3S9WA 5EKLA 1JC7A 1EIGA 2JA8B 1EY7A 2E75C 5C6AA 2O5IC 4OO1H 2ZXRA 2F0OA 4KTAA 5KNCA 3TBIB 4KY6A 4XXEA 1EY4A 2NVXB 5CBAE 1BOSA 3MFGA 5I6WA 3J7AF 3VR2A 3S2DB 1LTTD 2F0NA 4HMJA 2YYZA 3DMUA 3ONAB 1NUCA 1JOOA 3VR6A 3H3VC 1BNZA 3T16A 3H6MA 2A69D 2K7VA 2HQEA 2WKDA 3P20A 4OL7A 1PTOF 3A55A 4RGOS 3GV3A 4ZRZA 1SNCA 2F0HA 3A8JE 3K57A 1A3VA 1EZ6A 1RTNA 3GTPB 1HTLD 2X6GA 1BBXC 4DNTB 1DJRD 1GUWA 3NE5B 1WTWA 1A6XA 3WOFA 3SK6A 4K8JA 1EY5A 1DYQA 1HRJA 4HSPA 4Q0FA 3DWQA 2F0EA 3WOEA 2K5WA 1E2ZA 4RGMA 3K5NA 3T56B 2F0FA 3NPPA 2TSSA 4ZK9B 2ICIA 2M9VA 1PDQA 1YNJC 5IGEA 3PUYA 3ZYYX 1NSNS 3S1RB 2ICEC 2L0CA 4RGTA 4DF7A 2JXMB 3QIAA 2JYOA 1UNSA 1EYCA 2FMMA 2NVTB 3GO5A 1B2TA 2VUMB 3R3OA 4I65A 4A3DB 1JORA 2K5QA 2EZVA 2BDOA 1II3A 5C0XI 4BS9A 4ZKCB 4KKUA 2IW3A 4RFBA 1GJXA 1EYDA 1F77A 4RKLA 2OF1A 3BYYB 5FKAC 5D65A 3BS1A 1D1IA 1O7ZA 4JBWA 4NP5A 1SYEA 5CORA 3KBGA 3Q0AA 1D5ZC 2F1MA 1Y1WB 4X3UA 2R6GA 1QNUA 4ID6A 1PZID 3IL8A 5DEHA 2O2LD 3OSOA 3ND8A 3H94A 5FOBB 1ONLA 2A69C 4H7BA 3X3MA 3K5LA 2NTSA 4U673 3VYRA 1GUSA 3S15B 5C0XJ 1TIID 3TSSA 1V1OA 1GXDC 2LFNA 2F0SA 1STEA 3H0GB 2IWHA 1ENCA 1RD9D 5JPNC 5I4DA 2RDHA 2EY1A 2I07B 1DOKA 4DXFA 1RCVD 1R4PB 2B8FA 1Q8IA 4Z9CB 2F0TA 2PNRC 1PZJD 1PTOH 1HFGA 1JOKA 3EVQA 4DA2A 3RLFA 2HCCA 2EYMA 4KV6A 1EYAA 1LTBD 1PTOC 3OIPA 5AFWA 4JK1C 4A3EB 3I70A 2L9HA 1BF4A 1FD7D 4RGNA 3R2IA 1CZGA 1U4MA 4WORA 1R4QB 1I4PA 3SXHA 2A6ED 4KI0A 1MD2D 3A56A 5JEAG 5C3XA 1RDPD 1EQTA 3WDNA 1B4OA 1O7LA 2PYKA 5LHY1 1F9SA 1PRTB 2XVSA 3JAML 1ZYRC 1LT3D 3T51B 1SJHD 3ITPA 2XRSD 2KUMA 4A93B 3NXWA 4KHZA 5G3LD 2MUYA 2F4IA 2RQXA 5CBEE 1DCZA 3IKJA 2IJ0A 2CVRA 1I6HB 1EFID 1A15A 3VA7A 2G9DA 1G291 4FF1A 5CV4A 3HOXB 5IIFA 3PIP3 4XTCS 2R7ZB 3D4RA 4NMZA 1OXVA 1I4HA 1WTPA 3TP6A 1DOLA 4UDUC 2B2TC 2XNAC 2PW5A 1KTKA 2EY5A 5ELCA 1F2ZA 3MA2B 4L6TB 4MHEA 1F2YA 1V1PB 3U9OA 1CTMA 3RUZA 3V96A 1Q90A 3S16B 1X3PA 2K03A 4Q5VA 2Z1CA 3K5MA 2O5JC 1J9OA 3H91A 4OIKA 4J8QA 5CGKA 4DN4M 5FO7B 3HP3A 4C56C 3NTIA 3QWNA 1IL8A 4PMWA 2XN9C 1RF2D 3PUZA 4DU9A 4RAUC 1QWYA 1D6EC 1F9QA 1Z47A 2K04A 4RH6A 1KNEA 3RZDB 4H13C 1MSGA 1PRTF 1ZKOA 1PFNA 5JVH3 1I4QA 2NN6H 3SK5A 2Z4HA 4QCLA 1WTOA 4XT1B 2NVYB 3K5OA 1OXSC 1SYDA 2BOSA 3D4WA 4FYDA 2AWOA 4FO2A 3MC0B 1F9RA 1PMRA 5A35A 3S1QB 3AMUA 1KAAA 3I4NB 1S4ZA 3P7JA 1A3TA 3CRLC 3Q23A 3BDCA 1U4RA 3OOCA 3FVQA 2F0GA 5C0XG 4WJWA 2LKVA 1AW7A 3AU7A 2TMPA 1PFBA 1D5MC 5BN4A 4G7ZC 3DXJC 1JB3A 3EA6A 4C3JB 2EYJA 1UEAB 3URYA 5C5MA 4IFDJ 3S1MB 1EY0A 4MN3A 1IW7D 1CA5A 5FK9C 5IT9L 2A68C 4L8JA 1MGSA 3X3NA 5E3FA 2JA6B 1G6ZA 1EWCA 4ILWA 3PUXA 2IPKD 4I7ZC 3A8KE 3NWTA 2HUGA 4G7HC 4Y7NB 1BO0A 2NYZD 1STBA 4M8AA 2XIWA 1KNAA 1WD0A 3DUZA 3R93A 2HCIA 3HG9A 4QUCA 1TVXA 3J7YW 1A3UA 3PO3B 1M4VA 4RWSC 4A3IB 1O78A 1ENAA 4ZYSA 1Z7TA 1LO5D 3GTMB 3K6OA 2ZT9C 2BE5C 1GUGA 1XXGA 3MAQA 1TWFB 3E6ZX 5EPJA 1HXYD 4FVMA 1F2MA 2PQEA 2QCPX 1OXTA 1ML0D 5CV9A 4U68A 5D14A 3HOVB 4F8MA 1V43A 5CMDA 4AYBB 4C3JG 1OXXK 4OO1I 5G3LF 5KIXA 1HUNA 3I3CA 4A3MB 1NR4A 5K36G 1UUPA 3FDTA 2WB1B 3HRZC 1I4XA 4NKLA 4C3IG 3KLSX 3V2TA 1KLUD 3TZDA 4HR7B 1C4QA 2A6HD 3FPPA 5C5LA 1AZPA 2K05A 2X69A 2MGSA 2R3ZA 2Z8LA 3I91A 4C3HB 4YIJA 1CI3M 3CRKC 3QG1A 1GOZA 4F88A 1VCIA 1LV9A 2F0UA 1SYBA 4K8IA 1JWSD 2I46A 4G57A 2EOTA 5C0XH 4BY7B 2VB3X 1ESRA 1XTCD 3LWEA 3TP7A 4FF3A 1JQYD 5C4XB 3KBXA 4KN4C 5EKIA 2NVQB 3K7AB 2AUKA 3RZOB 5ISRA 5M5YB 3T4AC 4HSVA 5KYIA 1FYCA 3SVMA 1WTVA 4A3BB 5BN5A 3RD4A 4XQNA 3MXUA 4XYQA 2RDFA 3BDLA 1HQRD 3D6CA 3D3RA 3NHHA 1BCPD 4BY1B 4TRDA 1PRTC 1SMYC 2MP1A 4ME5A 3G6JB 4XIGS 4FF2A 2EE1A 2N88A 1NR2A 1RJTA 2B2VC 2MPMA 5DAUA 2L12A 1HUMA 1LTAD 1LTGD 5CR3A 2WV6D 4DK0A 4ODGA 3GTQB 4O1NA 2B2YC 3GTJB 5J1ZA 4XQJA 4IUVA 3L9AX 1HA6A 1SFOB 1PLFA 2F0DA 5JEAH 3PV0A 1GUOA 2PZWA 3HS0C 2A6HC 4V0BA 4XQQA 4IFDG 1W6KA 3GQBA 4R9WA 2F0KA 4G7OC 3F2UA 2D62A 3S17B 3DEPA 4IUNA 3RMHA 2DNEA 4TQUS 3NSWA 3QJYA 4DGZA 4BWGB 5NUCA 5IT9E 1SAPA 1EOTA 1SYCA 1W6JA 5FO8B 3MXNA 3NQIA 4IQZA 4IURA 4KHVA 1YNND 3LWUA 1LTSD 1DONA 1BR9A 2K01A 2G9HD 5JPMC 3OW7A 1OO9B 2KA7A 2NN6G 1EWHA 2B8GA 3IFDA 2FJ2A 4ABNA 1LACA 2K32A 2EJGC 4R8NA 2DY8A 3C1FA 5TSSA 4IUUA 3P75A 1VMPA 2K28A 2WIIB 4K5XA 4PV1C 2EJMA 3EROA 1TS2A 2SNMA 2JP1A 2NB0A 2Q8TA 4QUFA 5EQ0A 4DAVA 1XYIA 4TSSA 1SNOA 4EQPA 5A2QL 1JR0D 3FKIB 2Z4IA 1YNJD 2FFKB 4E6IA 1BCPF 2NUCA 5J22A 2FMCA 3OIQA 3NWSA 3S1NB 1WTXA 1B9NA 2XSCA 3D8GA 4HAEA 1EQVA 3OWEB 1TY2A 3HOWB 1TKWB 1Q1EA 2QILA 4XDXA 1LABA 5CV8A 1RKNA 4CKBA 5M3MB 2EY6A 4WRDA 3HOUB 1HHVA 1M8AA 4QIWB 1HCZA 3G7LA 3SR1A 1G8ZD 4CJ2C 1WCMB 1MBYA 4RCOA 4OIJA 2VNUD 4LAAA 3R2TA 1QNKA 3L7ZC 4O42A 2ID0A 1H9MA 3QO2A 5M5WB 2E2DC 2B2WA 2IT1A 1VMCA 3BDOA 5T1IA 3K59A 1I3QB 5A2QE 2N55A 2HDLA 2C5CA 4XYOA 1STYA 2IL8A 2Q8RE 1KDCA 2B2TA 3CKIB 1SBBB 4OGQC 1B1ZA 2QEJC 2FHTA 1FNUA 4RA8A 4M1UB 2V4DA 2PW7A 1TWCB 2PO4A 1A2TA 2A74C 1K8OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PUV A;  3VR2 A;  1E2W A;  4DK0 A;  1CTM A;  1FR3 A;  1HQM C;  2E74 C;  1OXU A;  2DNC A;  3IFT A;  4JK1 C;  2PPB C;  4HR7 B;  2BDO A;  2YYZ A;  2A6H D;  1B9M A;  3FPP A;  3KLR A;  3GD7 A;  4OO1 G;  3VR6 A;  1GUN A;  1Q90 A;  4KKU A;  1IW7 D;  3VR4 A;  2EVB A;  3A7L A;  1GJX A;  3M7N A;  3VR3 A;  1GHK A;  5JEA H;  2D2C C;  3PV0 A;  1GUO A;  2A68 C;  4KKS A;  4LJZ C;  2PCF B;  1V8Q A;  1VDZ A;  4KKT A;  1B9N A;  2A6E D;  4L8J A;  4DK1 A;  4BA2 I;  3A7A B;  2O5J C;  2A6H C;  4KI0 A;  1CI3 M;  3CRK C;  3QG1 A;  2K33 A;  4IFD G;  1HPC A;  3GQB A;  3BG3 A;  1VCI A;  1Y8P B;  1TKW B;  4JBW A;  5JEA G;  1Y8O B;  2L5T A;  4G7O C;  1K8M A;  2A69 D;  2K7V A;  1Q1E A;  3P20 A;  2D62 A;  3PUX A;  3SDZ A;  3I4L A;  4I7Z C;  3A8K E;  4G7H C;  5BN3 A;  3VR5 A;  3WDN A;  2D5D A;  1O7L A;  1LAB A;  5C0X H;  4KMU C;  2DNE A;  4TQU S;  3T53 B;  5KNB A;  3QJY A;  3FMC A;  3PUZ A;  3A8J E;  2F1M A;  1ZYR C;  3T51 B;  4LK1 C;  3U9S A;  3PUW A;  2R6G A;  1CFM A;  4KN7 C;  2A6E C;  1HCZ A;  4KN4 C;  3W3A A;  3M85 A;  2AUK A;  3ND8 A;  3H94 A;  2EDG A;  4KHZ A;  1O78 A;  1ONL A;  2JEB I;  4IQZ A;  4H13 C;  2CW0 C;  2A69 C;  1ZKO A;  1Z7T A;  3OPO A;  4BA1 I;  2JEA I;  2E76 C;  4DNT B;  2NN6 H;  2AUJ D;  1T5E A;  1H9S A;  3M4Y A;  4TKO B;  5K36 H;  3I73 A;  2KCC A;  1Q12 A;  3L7Z C;  3NE5 B;  3N6R A;  3SE0 A;  3MFY A;  2Q8I B;  2ZT9 C;  1E2V A;  2DN8 A;  1FYC A;  3TZU A;  4H44 C;  3LWU A;  1GUS A;  2BE5 C;  1GUG A;  1A6X A;  3I72 A;  1Y8N B;  1DCZ A;  1OXS C;  3D31 A;  1DD2 A;  1I6V C;  1VF5 C;  2AWO A;  3IKJ A;  1H9M A;  5BN5 A;  3ND9 A;  3OW7 A;  2QF7 A;  1PMR A;  2BA0 A;  2KA7 A;  5A35 A;  1VF7 A;  2NN6 G;  1EWH A;  2B8G A;  3MXU A;  4IFD H;  3VA7 A;  1BDO A;  1E2Z A;  2IT1 A;  1LAC A;  5KND A;  1G29 1;  1OXT A;  2JE6 I;  2EJG C;  2K32 A;  1QJO A;  3T56 B;  3BDO A;  4GZY C;  1IW7 C;  2NN6 I;  4H0L C;  1DXM A;  1H9J A;  2EJF C;  3CRL C;  3EQL C;  1V43 A;  3A8I E;  4XTC S;  3D4R A;  1IYV A;  2LMC B;  3AB9 A;  1OXV A;  1IYU A;  3OOC A;  1H9R A;  1OXX K;  2B8F A;  1YNN C;  4DNR B;  2E75 C;  4PV1 C;  1TU2 B;  1SMY C;  2BE5 D;  2EJM A;  2BA1 A;  5C0X G;  2O5I C;  1YNJ C;  4XIG S;  4OO1 H;  2PNR C;  3LNN A;  3PUY A;  4OGQ C;  1Y69 U;  5KNC A;  1Q1B A;  1Z6H A;  5BN4 A;  1GUT A;  4G7Z C;  3DXJ C;  1H9S B;  1HTP A;  5K36 G;  2A68 D;  3HGB A;  3RLF A;  1H9K A;  2JXM B;  2V4D A;  3QIA A;  1K8O A;  4RCN A;  1GHJ A; 
#chains in the Genus database with same CATH topology
 5JEA J;  2PZU A;  4QL5 A;  4YHH Q;  3J80 E;  1FNW A;  2UXD L;  4CDD C;  5E4X A;  3NBH A;  1AP0 A;  3M4P A;  1SNQ A;  1T9H A;  3KLR A;  3GD7 A;  4UP7 A;  2JN4 A;  1NAP A;  4IN3 A;  3VR4 A;  1EQQ A;  2OWO A;  4C3J H;  1AEX A;  1Z9F A;  2PCF B;  5JJZ A;  4J6H A;  3I2Z A;  3GTO B;  3A54 A;  4A3F B;  5HGT A;  5COY A;  4DV5 L;  4DAM A;  4B9X A;  2PNH A;  3I4L A;  2NVT H;  1XX8 A;  1VQK A;  1U9R A;  3J81 E;  2E2H B;  4DAY B;  1S5E D;  1VQF A;  2ZTE A;  4AQY L;  1D5X C;  5LMU Q;  4FXK C;  1DZ1 A;  3J7A V;  4JI0 Q;  3PUW A;  1RTO A;  2F03 A;  3E5S A;  1TT2 A;  1BKB A;  1JWU D;  4K0K L;  3M85 A;  3S2H B;  4DV5 Q;  4OX9 Q;  4P2C B;  2KHS A;  4KK7 A;  4HIK A;  4K5V A;  4KLK A;  1ENF A;  5FO9 B;  5HGQ A;  1ZEQ X;  4OWT B;  5CYU A;  5CV7 A;  2UXB Q;  2AUJ D;  1T5E A;  3MVV A;  4BBR H;  2Q2H A;  3PMF A;  2OTJ A;  1C48 A;  1G2S A;  1YHB A;  3FP9 A;  1UAP A;  1YHA A;  1E2V A;  1WCM H;  1A62 A;  4H44 C;  1R9T H;  1A63 A;  2CKZ B;  4JBJ A;  5GRO A;  3SEB A;  5DM6 3;  1Y8N B;  4JI0 L;  2F4V Q;  1VQG A;  1TXY A;  2BA0 A;  5FLX L;  4S3S A;  4IAL A;  3C46 A;  2ENB A;  2KEE A;  2UXB L;  1S5D D;  4NXM Q;  1WTR A;  3S14 H;  1JE4 A;  5HUR A;  2A1A A;  1STH A;  3TME A;  1Q3L A;  4HN7 A;  3HEJ A;  4KY5 A;  3GTK B;  2PI2 A;  1Q8K A;  1H9R A;  1LTR D;  1XMQ Q;  4K0K Q;  3WWV A;  3M3Y H;  1YEZ A;  4A3D G;  1HA5 A;  1WCM G;  3SGI A;  2C9O A;  1JCK B;  2CQA A;  3E0J A;  1SNP A;  3QOL A;  5DM7 3;  3EFX D;  1V1P A;  1RL2 A;  2AQ1 B;  2K14 A;  3SHL A;  1Y1V B;  4RCN A;  2JA7 H;  3MXP A;  2N3S A;  1MSH A;  1SYF A;  5T1G A;  4BBS G;  1FR3 A;  3IFT A;  4LFA L;  4HED A;  4GN4 B;  2PMZ E;  3MEH A;  1KAB A;  1PA6 A;  3PQI A;  4L63 B;  1C8C A;  2RA4 A;  2SNS A;  4A3G B;  2PI2 E;  2DJG C;  5FLX E;  1SYG A;  1GUN A;  2Q2U A;  1EU3 A;  4FXG C;  3M7N A;  4A75 A;  1GHK A;  1HFN A;  3VA5 A;  1VDZ A;  4IZ8 A;  4HCE A;  2M00 A;  1DGS A;  4GLV B;  2E2I H;  5E1F A;  2VL6 A;  4DUY L;  2R7Z H;  4WFN 3;  1PH2 A;  4EGV A;  3HOZ G;  2D5D A;  3NTH A;  4RG1 A;  3HOX H;  4UPA A;  1B53 A;  4HCS A;  4C3H G;  1N33 Q;  3TQY A;  1YNX A;  4FNF A;  1IYJ B;  2GA4 B;  5ELE A;  3T13 A;  4JI1 L;  4BXX H;  3C3L A;  1JB7 A;  4JI6 Q;  3DHQ A;  4C1N K;  4FF4 A;  2A6E C;  2BCO A;  5ELO A;  2ES2 A;  4A3B G;  4K6D A;  2JA8 H;  3TEH B;  3TS0 A;  2H1E A;  1PFM A;  2CW0 C;  2X6L A;  3OWF A;  1EU4 A;  1ET6 A;  3EN2 A;  1H95 A;  2WP8 J;  4F87 A;  1X65 A;  2AWN A;  3BU2 A;  4NB3 A;  3SE0 A;  1E1T A;  3R8B A;  3N52 A;  4JC0 A;  5EBD A;  5LL6 X;  2RDG A;  5IP7 H;  1VF5 C;  4A93 H;  3F2C A;  1BVS A;  4KD4 A;  2B2U C;  4IUP A;  3I4M H;  1HJP A;  2A19 A;  3HKZ B;  2B2W C;  1I4G A;  2HDM A;  1VQP A;  3HOY B;  2JA5 B;  1EL0 A;  3OMC A;  3GP7 A;  2JE6 I;  4GOP B;  1DXM A;  4RKB A;  2E8G A;  2O4X A;  2VB2 X;  1ICW A;  2L55 A;  4CJ0 B;  4X3K A;  3A5U A;  1FVI A;  1EY6 A;  2VQF L;  1MJE A;  2MO1 A;  2MHV A;  1FJG L;  2EXZ A;  3J81 i;  4FP5 D;  1PH6 A;  4BBS H;  1TWA B;  1SDF A;  2OCE A;  5AJ3 Q;  5C3W A;  4IOC A;  3T1Y Q;  4LW1 A;  3BZK A;  4HJ8 A;  4J1M A;  4EQN A;  1U4L A;  5IYC H;  1Q82 C;  2RCN A;  4K2K A;  3I4O A;  1D1K A;  2KQ3 A;  3UI2 A;  3AEV A;  2OXP A;  5CV5 A;  1PH3 A;  4DR3 Q;  4JI8 L;  1EZ8 A;  1J8I A;  3NBH B;  4FXD A;  4PMB A;  2B2V A;  2K52 A;  1JOQ A;  1CKM A;  2NTT A;  1JJC B;  3A7L A;  1QZH A;  3MXG A;  4KKS A;  4LJZ C;  4NW2 A;  3A7A B;  4R8I A;  1EIF A;  4OWX B;  2ZXO A;  3E0E A;  1STN A;  1TWH B;  1QB5 D;  2F0M A;  1DOM A;  3I7F A;  1JT8 A;  1X54 A;  4DV1 Q;  3K8A A;  2SOB A;  1ESF A;  1F2L A;  3PF5 A;  2QDB A;  1C9O A;  1FGU A;  3MWY W;  3A74 A;  3H0G H;  1KDB A;  4YCU A;  5KNB A;  3FMC A;  1XNQ Q;  1EY8 A;  5M9O A;  4C3I B;  2QDL A;  3EIV A;  2GVA A;  2L4N A;  3PO2 B;  2N78 A;  3M7G A;  3P1H A;  2OT2 A;  5C3E G;  2L15 A;  1SE8 A;  2EXD A;  5JAV A;  2Q2I A;  1CA6 A;  1PZK D;  5M3F H;  2JEA I;  3DWA A;  3I73 A;  2J4X A;  4IUQ A;  1HZB A;  3N6R A;  3BVG A;  4JI7 Q;  2JSO A;  2UXC L;  3I72 A;  1HNX L;  1DD2 A;  2F0P A;  2R92 G;  3ND9 A;  3GDE A;  1V9P A;  2UUC L;  2LY7 A;  5C4X H;  4PMC A;  4JI3 Q;  1Y1W H;  1MJC A;  5EAY A;  4ZLT F;  1BCP B;  1QOH A;  4GZY C;  3NK9 A;  1TR5 A;  2R93 B;  4JCV E;  1XJV A;  3CU7 A;  4EVO A;  5IOD A;  5IOC A;  3BZD B;  2PQA A;  2JA6 G;  2KCN A;  1XWE A;  3Q6S A;  4CJ1 B;  4XT3 B;  1ASZ A;  2IHE A;  4C3H H;  4DAY A;  3IAY A;  3PO2 H;  1A8V A;  4HIM A;  4A3I G;  2HHH Q;  3GTL H;  3RR5 A;  4ZKB B;  1I4R A;  1K3B C;  1HTP A;  3SK4 A;  4CKE A;  4DR3 L;  3KK7 A;  4CGY B;  4B3M Q;  1PRT D;  3CPF A;  4GOP A;  4DR1 Q;  4NXN Q;  4ZQ3 A;  4RHS A;  1EIH A;  1Q46 A;  3I8Z A;  5CV6 A;  1CQV A;  4A3D H;  2E74 C;  2E2J B;  3K0Y A;  4EQO A;  3TDQ A;  5IGD A;  1I50 H;  4DR4 Q;  1G91 A;  3I90 A;  4IJL A;  4DV4 L;  4G4K A;  1O80 A;  1MI2 A;  4AQY Q;  3K58 A;  5J39 A;  2EVB A;  2D2C C;  1KXL A;  3CME A;  4KKT A;  1V8Q A;  3LX0 A;  1AN8 A;  3EJI A;  1X3G A;  5IY0 A;  2Z9H A;  2L5T A;  2FIN B;  3BYT B;  3SDZ A;  1K83 B;  2M2L A;  2VZA A;  4CBV A;  3HOV H;  1O7Y A;  2RCF A;  2IX3 A;  3H3V I;  3VYT A;  1SXT A;  2VUM G;  1TS4 A;  4BBS B;  2CH4 A;  3FEW X;  2VXW A;  5C4H A;  2B39 A;  4QJF A;  4KN7 C;  1S40 A;  4B3R Q;  4YHH L;  1TWF H;  2KEC A;  1SMX A;  4X66 L;  2JEB I;  1CHQ D;  4BA1 I;  2E76 C;  1RHP A;  4TKO B;  5C44 B;  3M4Y A;  4X65 Q;  1EQR A;  4IOA A;  1S72 A;  5FLX c;  1SMY D;  3M4O H;  3GTP H;  3I4M B;  4DR7 L;  1K28 A;  5CC4 A;  2XWJ B;  4GNX C;  3E9H A;  4IFD H;  3DEO A;  1VF7 A;  2IX0 A;  2L11 A;  2UU9 Q;  1BDO A;  2F0I A;  3CXC A;  5KND A;  1IW7 C;  3ERQ A;  4Y7N H;  1TY0 A;  4PZ7 A;  1E7Z A;  1GD7 A;  2IY5 B;  2F0V A;  3A8I E;  3AB9 A;  3D4D A;  5M5X B;  2H4O A;  2GVB A;  3CAM A;  1AH9 A;  1D2B A;  4DNR B;  4YY3 L;  2K4K A;  4R1J A;  3LNN A;  4K2L A;  3NBI A;  4K5W A;  4JV5 Q;  1I5F A;  2GN5 A;  3HGB A;  2SDF A;  4IPG A;  2XWB B;  1A2T A;  5KEE A;  4PNY A;  1ZYR D;  3HKZ E;  1GHJ A;  1L1O C;  2B63 B;  4ULL A;  1FJG Q;  1CUK A;  4ZAI A;  3Q22 A;  1LT6 D;  2MJ8 A;  5JVG 3;  3U4V A;  2E2I B;  5C4J H;  1EY9 A;  4X64 Q;  1HR0 W;  1E0B A;  4PQX A;  2SEB D;  1VQE A;  4X62 L;  1L1O B;  4DK1 A;  4UAI A;  1VQL A;  1AFP A;  4LMQ D;  2IX1 A;  1X3Q A;  4HTH A;  2XTI A;  1HPC A;  3FRP B;  2MFI A;  1Y8P B;  4YY3 Q;  1Y8O B;  4DFA A;  1VQ7 A;  1X6O A;  3QOJ A;  4FDB A;  5BN3 A;  1WTQ A;  2JA7 B;  3DM1 A;  3VR5 A;  2JA5 G;  3OMG A;  4N9T A;  4X3S A;  1TS3 A;  5ELF A;  4B9W A;  4IPH A;  1FNV A;  3STB C;  1TQO A;  1ILQ A;  5IWA Q;  3SK8 A;  3MTS A;  5LL6 S;  2WAQ G;  1TWG B;  3NQT A;  1LLR D;  2RVL A;  1QCB D;  2F0L A;  2NZO A;  1HNW L;  4YWL A;  5KRU A;  1IBL Q;  3M3Y B;  3ULJ A;  2RHS B;  4GN5 A;  3PF4 A;  2EDG A;  3GTK H;  3J81 L;  5EPK A;  3RNU A;  1B3Q A;  2NZ1 D;  3S14 B;  1H9S A;  5K36 H;  2KJX A;  2KCC A;  5C4Z A;  5I2X A;  1N33 L;  4KHP Q;  3RZD H;  2DN8 A;  4KY7 A;  1TS5 A;  2EYP A;  2OEO A;  2PMZ B;  3CMA A;  4UP8 A;  4L5T A;  1QG7 A;  1R9T B;  1PFS A;  2JA7 G;  1QJO A;  2NN6 I;  4BBR B;  2DY7 A;  1JJ2 A;  1H9J A;  3OHX C;  3EQL C;  2K1B A;  3UDI A;  2DJF C;  3TP8 A;  1HZC A;  1CSQ A;  1IYU A;  4JI6 L;  2K5D A;  4QF4 A;  1STG A;  2B29 A;  2BE5 D;  5IGB A;  1IBL L;  2BA1 A;  3S2H H;  4O2D A;  2A8V A;  2Y0S E;  4RHR A;  1JIC A;  4IO9 A;  2K5H A;  1Z6H A;  1GUT A;  2CHB D;  3F2D A;  2QGQ A;  4DR6 Q;  1U4P A;  3S16 H;  4NPS A;  1L0Y B;  2C35 B;  4KJO A;  1B50 A;  2EYH A;  4DV3 L;  4TVA B;  3PIO 3;  1CM9 A;  2RKS A;  3GTG B;  2PPB C;  1S5F D;  1X56 A;  2WIN B;  3UE0 A;  1WVL A;  3L3O C;  3KJP A;  3OYY A;  1IKM A;  4A3F H;  1B9M A;  4OO1 G;  1MHW C;  3J80 L;  1WI5 A;  4DAP A;  2B2U A;  1AZQ A;  1DM0 B;  2XRQ D;  2J7Z A;  5FLM H;  3VR3 A;  4A3J B;  5ELN A;  4QMG A;  2Z0S A;  4BA2 I;  1K3R A;  5GAG C;  3U50 C;  1KLG D;  1PH9 A;  1LT5 D;  5IWA L;  5C4J B;  3V05 A;  1XMO Q;  4CHT B;  1F9P A;  1HR0 L;  2YU9 B;  3HFZ B;  3W2D A;  3VYU A;  5LMN W;  1Y1V G;  4CKC A;  4DUZ L;  4X3T A;  3Q24 A;  1EWI A;  1FGB D;  1C0A A;  3C1E A;  1IKL A;  4LK1 C;  3W1G A;  1S5C D;  1NJI C;  1I6H H;  3A5Z B;  3VYS A;  1BCP C;  2WAC A;  5IGG A;  2N8N A;  2VQE L;  2CWP A;  1JWM D;  4NDX A;  1U5K A;  3FPU B;  3OPO A;  4YCW A;  2J0T D;  1WD1 A;  1K8A C;  1LT4 D;  5C3E B;  4HJ7 A;  1STA A;  2Q8I B;  2HD3 A;  4OEL B;  4DK6 C;  2B63 G;  1CT1 D;  1SRU A;  2WAQ E;  1I6V C;  2F3W A;  2NBF A;  1KDA A;  3TN2 A;  3M4O B;  5EGT A;  1X55 A;  4JG2 A;  1JJG A;  2A5H A;  4H0L C;  1SE2 A;  2F3V A;  5I9O A;  1XPO A;  2E5L Q;  3MZ5 A;  2ZXP A;  2KVM A;  1IYV A;  1LTI D;  4B08 A;  5EBC A;  3TRE A;  1WJJ A;  4UHV A;  2ZJQ A;  4QY7 A;  4JBK A;  2K5V A;  5IGF A;  3JAM E;  4LUO A;  4R4I A;  1SSO A;  3NP8 A;  3K7U C;  1SNM A;  1HNZ L;  4A3K B;  3HZX A;  1IHZ A;  2RSO A;  1H9S B;  1PTO D;  4A76 A;  2A68 D;  2K6A A;  4MIU A;  5M3M H;  1RIP A;  5E4W C;  1H9K A;  2E5L L;  4DKA C;  1G6P A;  1CZW A;  1E2W A;  1EUJ A;  2L1B A;  1OXU A;  2DNC A;  3HKS A;  1PH4 A;  1BXT A;  5K5P A;  2WAQ B;  3HOW H;  4A3F G;  1T5X D;  2LXK A;  3DLL A;  1VQM A;  3H09 A;  1I94 Q;  5F2D A;  1BBU A;  5I2Y A;  2HHH L;  2F0W A;  5IP9 H;  3S1N H;  4DUZ Q;  2AKW B;  1PTO B;  5EKK A;  4HID A;  4A3K H;  4K14 A;  1B7Y B;  4JI4 L;  3RN2 A;  3QB3 A;  2QKI C;  3GV6 A;  2CFM A;  1B44 D;  1I50 B;  3BG3 A;  3D6W A;  3KUP A;  1K8M A;  1SND A;  4QIW E;  2EYL A;  2Z6K A;  1ROD A;  1AE3 A;  1EEF D;  1SEB D;  2KOL A;  2AQ2 B;  1BUV T;  1I94 L;  3CD6 A;  2AQ3 B;  4GKJ L;  2EY2 A;  1ILP A;  1CHP D;  2ZJP A;  2CW0 D;  3U9S A;  2A73 B;  2EYO A;  3AFQ A;  3GTL B;  3C2P A;  4RMF A;  2NWG A;  4JI7 L;  4HMI A;  1QIL A;  2ZTD A;  3W3A A;  1IXR A;  1YIT A;  3S15 H;  1BQQ T;  2D9U A;  4IUT A;  5I9P A;  2EYF A;  5D3D A;  2R61 A;  3PCO B;  2RSN A;  1ICF B;  2R93 H;  3E9I A;  3O13 A;  2B2Y A;  2HQL A;  1B3A A;  2KHI A;  1HH2 P;  3CCU A;  3TZU A;  1SE3 A;  2LXJ A;  4K6L A;  1CKN B;  3CW2 C;  4KJN A;  5ELD A;  2QF7 A;  4QB4 A;  4DXG A;  1HZ9 A;  2UUC Q;  3TP5 A;  1L0X B;  3CC7 A;  5ELB A;  4IFD I;  1G2T A;  4DV0 Q;  1L1O A;  4R4O A;  4JOI A;  5I6Y A;  5KGU A;  3HKZ G;  4N8F A;  4H02 A;  5M3F B;  3OW2 A;  4R4C A;  2YU9 H;  2LMC B;  2Y0S B;  3T1H L;  4GS3 A;  4B3R L;  4HIO A;  1YNN C;  1TU2 B;  3CHB D;  4N9P A;  4HJA A;  3Q8D A;  3KF8 A;  1Y69 U;  1Q1B A;  3KFU A;  4C3I H;  2RBM A;  4A3G G;  1HZA A;  1CK1 A;  3BVZ A;  3PSI A;  2KED A;  3A0J A;  4X62 Q;  4J15 A;  5C4X G;  2R92 B;  4LFA Q;  3PUV A;  1GO3 E;  2HIX A;  3KYH C;  1HQM C;  1VQ8 A;  1SJE D;  1UEB A;  2VUM H;  1CQF A;  3TS2 A;  1EEI D;  1TWH H;  4ZUI A;  3UE1 A;  3BZC A;  5KYL A;  2LS0 1;  2UU9 L;  5IGC A;  5M3F G;  1K9M C;  4DV4 Q;  3PIO A;  3NUC A;  1SFO H;  3CQZ B;  4OHJ A;  3HOZ B;  1PYW D;  3MHB A;  1NCV A;  3KLS A;  4YWM A;  1QUQ A;  1PH1 A;  1QZG A;  1ZXT A;  5JOB A;  1A2U A;  2K33 A;  1G51 A;  2F0J A;  1XMQ L;  2F3I A;  1P8L A;  2G5D A;  3BVM A;  3G71 A;  4V19 0;  4X6A H;  4L5Q A;  4KMU C;  3T53 B;  2WKC A;  5C44 G;  2F0Q A;  2PZT A;  3MEF A;  1CFM A;  1PXU A;  1X32 A;  5HY6 A;  1NNX A;  1S5B D;  4A3J G;  5D3I B;  1KL9 A;  4F7X A;  1VS0 A;  1MIU A;  1YVC A;  4C1N I;  1Q12 A;  5EJW A;  3IRB A;  1VQ9 A;  3MFY A;  4X65 L;  2JA5 H;  1J6Q A;  5DNF A;  3D31 A;  4C2M B;  2XGT A;  3NTK A;  1ET9 A;  4ZUJ A;  4KD3 A;  1HNW Q;  1SE4 A;  1QE6 A;  1TWG H;  4A3L H;  2BDN A;  4A3B H;  2EPB A;  2Y0S G;  3U58 A;  1B8A A;  1PH8 A;  3DWP A;  4APV A;  5EPL A;  2EJF C;  3S9W A;  5EKL A;  1JC7 A;  4KHP L;  3RZO H;  1EIG A;  2JA8 B;  3BJU A;  1EY7 A;  2E75 C;  5C6A A;  2O5I C;  2CH4 W;  3CCQ A;  4OO1 H;  2ZXR A;  2F0O A;  4KTA A;  5KNC A;  3TBI B;  4KY6 A;  4XXE A;  4MZ9 A;  3UDX A;  1EY4 A;  4DK3 C;  2NVX B;  2RHQ B;  1BOS A;  3MFG A;  5CBA E;  4A3L G;  5I6W A;  4LUV A;  3J7A F;  4DV2 Q;  3VR2 A;  3S2D B;  1LTT D;  2F0N A;  4HMJ A;  2YYZ A;  3S2D H;  3DMU A;  3ONA B;  1NUC A;  3NEL A;  1JOO A;  3VR6 A;  1N32 Q;  5IYD G;  1XPU A;  1XPR A;  1NMF A;  3H3V C;  1ASY A;  2YTY A;  3EBE A;  1BNZ A;  3CCV A;  3T16 A;  5H1S E;  3H6M A;  4JW0 A;  4DV1 L;  2A69 D;  2K7V A;  2HQE A;  2WKD A;  3P20 A;  4OL7 A;  1PTO F;  5M5X H;  3KJO A;  3A55 A;  4RGO S;  4DUY Q;  3GV3 A;  3G6E A;  1PYB A;  1IBK Q;  4ZRZ A;  1SNC A;  2F0H A;  3A8J E;  3JAM c;  1YJN A;  3K57 A;  1A3V A;  1EZ6 A;  1RTN A;  1VQA A;  4JBM A;  4C2M H;  4AH6 A;  3GTP B;  3ICE A;  1K73 C;  1HTL D;  2X6G A;  3KF6 A;  5FJ8 H;  1BBX C;  1JMC A;  4DNT B;  1DJR D;  5AJ3 L;  3T1Y L;  1GUW A;  3NE5 B;  1WTW A;  1K0S A;  1N9W A;  1A6X A;  3WOF A;  4BBR G;  3SK6 A;  4K8J A;  4QQB X;  2I0Q A;  1EY5 A;  1DYQ A;  3I4N G;  1HRJ A;  5IYB H;  4HSP A;  4Q0F A;  1N8R C;  1W3S A;  3DWQ A;  2F0E A;  3WOE A;  1X3F A;  2K5W A;  4ZCK A;  4LFB L;  1E2Z A;  1NE3 A;  4RGM A;  3K5N A;  1KD1 C;  3T56 B;  3I4M G;  4LFC Q;  2F0F A;  3NPP A;  2TSS A;  4ZK9 B;  2ICI A;  4A3I H;  2M9V A;  1PDQ A;  1YNJ C;  4AYB E;  5IT9 c;  5IGE A;  1M90 C;  3PUY A;  4P73 A;  3ZYY X;  1NSN S;  3CQZ H;  3HOZ H;  3CCM A;  3S1R B;  4LFB Q;  2EIF A;  3FKI G;  2ICE C;  4P75 A;  3CCE A;  2L0C A;  4DR6 L;  4RGT A;  4DF7 A;  2JXM B;  1N36 Q;  4BY7 G;  3QIA A;  2JYO A;  1UNS A;  1EYC A;  2FMM A;  5IYB G;  2UXD Q;  2NVT B;  3GO5 A;  1B2T A;  2VUM B;  3R3O A;  2E2J H;  4I65 A;  4A3D B;  1JOR A;  2K5Q A;  2EZV A;  2BDO A;  3HOU G;  2JA6 H;  1II3 A;  2R92 H;  3HOX G;  5C0X I;  4BS9 A;  4JI3 L;  4ZKC B;  4KKU A;  2IW3 A;  2PQA B;  4RFB A;  4GKJ Q;  1GJX A;  1EYD A;  1F77 A;  4RKL A;  2OF1 A;  4LF9 Q;  4JI5 Q;  3KLW A;  3BYY B;  5FKA C;  1N34 L;  5D65 A;  3BS1 A;  1D1I A;  4LWC A;  1WOC A;  1O7Z A;  4JBW A;  2DGY A;  3TRZ A;  1KHI A;  4NP5 A;  1SYE A;  1XMO L;  2KCT A;  5COR A;  1HR0 Q;  3KBG A;  3U4Z A;  3S1M H;  3Q0A A;  1D5Z C;  2R7F A;  4B3S L;  2F1M A;  2HIV A;  1VQO A;  1Y1W B;  3ZJY C;  4X3U A;  4DR1 L;  1EIY B;  2R6G A;  1QNU A;  4ID6 A;  1PZI D;  2OQK A;  3IL8 A;  5DEH A;  2UXC Q;  2O2L D;  2BH2 A;  3OSO A;  1X9N A;  3ND8 A;  3H94 A;  5FOB B;  1QUQ B;  1ONL A;  2A69 C;  2F52 A;  4H7B A;  4GNX B;  3X3M A;  3NEN A;  3K5L A;  3PO3 G;  5IP7 G;  2NTS A;  4U67 3;  4IPC A;  3I4N H;  5GAH C;  1VQC A;  3VYR A;  1PYS B;  1GKH A;  1GUS A;  3S1Q H;  3S15 B;  5C0X J;  1TII D;  3TSS A;  1V1O A;  4GLA C;  1GXD C;  5BR8 Q;  2LFN A;  2F0S A;  4LF5 L;  4PG3 A;  4P72 A;  1STE A;  2OQ0 A;  3H0G B;  2IWH A;  1ENC A;  3F1Z A;  4I7A A;  3ULL A;  4BXX G;  3F8T A;  1RD9 D;  5JPN C;  5I4D A;  2RDH A;  2EY1 A;  2I07 B;  5JJI A;  3KOJ A;  1DOK A;  4DXF A;  1RCV D;  1R4P B;  1KRS A;  2B8F A;  1Q8I A;  1J5E L;  4Z9C B;  1LTL A;  2F0T A;  2PNR C;  1PZJ D;  2ZJR A;  3HOU H;  1PTO H;  1HFG A;  1JOK A;  4DR4 L;  2MNA A;  1LUZ A;  3EVQ A;  4DA2 A;  3RLF A;  2QEX A;  2HCC A;  3CCS A;  2EYM A;  1AE2 A;  4KV6 A;  3L2P A;  1EYA A;  3OTO L;  1LTB D;  1PTO C;  3OIP A;  5AFW A;  4LF6 Q;  4JK1 C;  4A3E B;  3I70 A;  2L9H A;  1BF4 A;  1FD7 D;  4LF4 Q;  4RGN A;  3R2I A;  4DPG A;  1CZG A;  1U4M A;  4WOR A;  1R4Q B;  1UE6 A;  2YTV A;  1VQB A;  3RLO A;  1I4P A;  3SXH A;  3NEM A;  2A6E D;  4KI0 A;  4DV6 Q;  3KDF A;  3FKI H;  1MD2 D;  3A56 A;  2QW7 A;  5JEA G;  5C3X A;  1RDP D;  1EQT A;  1B4O A;  3WDN A;  1O7L A;  2I5M X;  3J81 j;  2PYK A;  5LHY 1;  1KQS A;  1F9S A;  1PRT B;  2XVS A;  1YI2 A;  3JAM L;  1ZYR C;  3HOY H;  1LT3 D;  3T51 B;  2N49 A;  1SJH D;  1E22 A;  3ITP A;  2XRS D;  4POF A;  2OTL A;  2KUM A;  1D8L A;  4A93 B;  3NXW A;  4L5R C;  1B70 B;  4KHZ A;  3J7Z C;  1VQI A;  5G3L D;  3KDF B;  2MUY A;  5GAE C;  5C3E H;  2F4I A;  2WB1 G;  1UE7 A;  2RQX A;  4A93 G;  3PGZ A;  5CBE E;  4PZ8 A;  4JYA L;  5L37 A;  1DCZ A;  3IKJ A;  2IJ0 A;  3H15 A;  4AYB G;  4DV7 Q;  2CVR A;  4AIM A;  1I6H B;  1YZ6 A;  1CKO A;  4EX5 A;  1EFI D;  1U0L A;  1A15 A;  3VA7 A;  2G9D A;  4GN3 B;  3KF6 B;  1G29 1;  4FF1 A;  5CV4 A;  3HOX B;  1EOV A;  5IIF A;  3PIP 3;  4XTC S;  2R7Z B;  3D4R A;  4NMZ A;  4JI2 Q;  1OXV A;  3J81 c;  1E3P A;  1I4H A;  5IYD H;  2F4V L;  1SLJ A;  1WTP A;  3TP6 A;  1S3O A;  5LMN Q;  4HJ5 A;  2UUA Q;  1DOL A;  4UDU C;  2B2T C;  2XNA C;  2PW5 A;  1KTK A;  4LF4 L;  4BY1 G;  2EY5 A;  1EYG A;  5ELC A;  2B3G A;  4A3J H;  1F2Z A;  3MA2 B;  4L6T B;  3D0F A;  1IZ6 A;  5IYC G;  4JI1 Q;  4NXM L;  4A3G H;  4MHE A;  1VQ4 A;  1F2Y A;  4OWW B;  1Y1W G;  1V1P B;  3U9O A;  3S17 H;  1CTM A;  3RUZ A;  3GTG H;  3V96 A;  1SRO A;  3VDY A;  5LMN L;  2UUA L;  1QVC A;  1Y1V H;  2JQO A;  1Q90 A;  3S16 B;  5JJK A;  1PH5 A;  2R93 G;  1CSP A;  1X3P A;  2K03 A;  4Q5V A;  2Z1C A;  3K5M A;  2O5J C;  3GTJ H;  1J9O A;  3H91 A;  5FJ8 G;  4OIK A;  4R4Q A;  4J8Q A;  5CGK A;  4DN4 M;  1E24 A;  2VQE Q;  1D7Q A;  3GTQ H;  4A3E H;  1IBM L;  5FO7 B;  3HP3 A;  3KF8 B;  4JOI C;  4C56 C;  3NTI A;  3QWN A;  1IL8 A;  4PMW A;  3I55 A;  3J80 i;  2XN9 C;  1RF2 D;  1N32 L;  3G48 A;  3PUZ A;  4LUZ A;  4DU9 A;  4RAU C;  4DR2 Q;  1QWY A;  1GVP A;  1P16 A;  1D6E C;  2RF4 A;  3G4S A;  1F9Q A;  1Z47 A;  2K04 A;  4RH6 A;  1KNE A;  1KAW A;  4A3K G;  3RZD B;  4JI8 Q;  3ULP A;  4H13 C;  1MSG A;  1PRT F;  1ZKO A;  1PFN A;  1I4Q A;  5JVH 3;  2NN6 H;  5DLQ E;  2Z4H A;  3SK5 A;  1FL0 A;  4QCL A;  3W1B A;  1WTO A;  3PIP A;  1HNX Q;  4XT1 B;  2NVY B;  3K5O A;  1OXS C;  1SYD A;  2BOS A;  3D4W A;  4FYD A;  2AWO A;  4FO2 A;  3MC0 B;  1F9R A;  1QVG A;  1W2B A;  1PMR A;  1HNZ Q;  2AHO B;  5A35 A;  3S1Q B;  3AMU A;  1KAA A;  3I4N B;  2CWA A;  3CC4 A;  1IBK L;  1S4Z A;  3P7J A;  1KIX A;  1A3T A;  3CRL C;  3Q23 A;  3BDC A;  4DR2 L;  1EFW A;  1KC8 C;  3OOC A;  1U4R A;  1Y14 B;  1YHQ A;  3FVQ A;  2NZH A;  4YCV A;  2F0G A;  5C0X G;  3K7A H;  4WJW A;  2LKV A;  3GTO H;  2DUD A;  1AW7 A;  3AU7 A;  2TMP A;  1PFB A;  1D5M C;  5BN4 A;  4G7Z C;  3DXJ C;  1JB3 A;  3EA6 A;  4C3J B;  1OTC A;  4A3C H;  2EYJ A;  4PZ6 A;  1UEA B;  3URY A;  5C5M A;  4LF8 Q;  4IFD J;  4BY7 H;  3S1M B;  1VQ6 A;  2BH8 A;  3CP0 A;  4CDF C;  1VQH A;  2UUB Q;  2B63 H;  1UE1 A;  2VQF Q;  1EY0 A;  1TWC H;  4MN3 A;  1IW7 D;  4LF9 L;  3I56 A;  1CA5 A;  5FK9 C;  5IT9 L;  2A68 C;  1JE5 A;  3OTO Q;  4L8J A;  1MGS A;  3X3N A;  5E3F A;  1SN8 A;  2JA6 B;  1G6Z A;  1EWC A;  4ILW A;  3PUX A;  2IPK D;  4I7Z C;  3A8K E;  3NWT A;  2HUG A;  4G7H C;  1I3Q H;  4Y7N B;  1BO0 A;  5LMU L;  2NYZ D;  4ME3 A;  4M8A A;  1STB A;  5IE8 A;  4DV6 L;  2XIW A;  3S24 A;  1KNA A;  3S1R H;  3CCR A;  1WD0 A;  1O7I A;  2ASB A;  3DUZ A;  4JI5 L;  5M5W H;  3R93 A;  1YJW A;  2HCI A;  3HG9 A;  3MXN B;  4QUC A;  4A3M H;  1N34 Q;  2VY3 A;  1TVX A;  3FHW A;  1A3U A;  3J7Y W;  3M9B A;  3PO3 B;  1M4V A;  4RWS C;  4A3I B;  1O78 A;  1IL2 A;  1ENA A;  4ZYS A;  2JK8 A;  1Z7T A;  5J3B A;  1LM0 A;  1LO5 D;  5C44 H;  4WJ3 M;  3GTM B;  3K6O A;  2ZT9 C;  4B3S Q;  2BE5 C;  1GUG A;  4L5S A;  1XXG A;  3MAQ A;  1TWF B;  3E6Z X;  5EPJ A;  1HXY D;  4DR5 L;  4FVM A;  2MO0 A;  1F2M A;  2PQE A;  2QCP X;  1OXT A;  4A3M G;  1WYD A;  1ML0 D;  5CV9 A;  4U68 A;  5D14 A;  3HOV B;  2KCM A;  4F8M A;  1V43 A;  1K83 H;  5CMD A;  4AYB B;  4C3J G;  1OXX K;  4OO1 I;  2CCZ A;  5G3L F;  3W5O A;  5KIX A;  1HUN A;  3I3C A;  4A3M B;  3LGJ A;  1NR4 A;  5K36 G;  1UUP A;  3FDT A;  2WB1 B;  3HRZ C;  1I4X A;  4NKL A;  4C3I G;  3KLS X;  4B3T L;  1WTH A;  3V2T A;  5M3M G;  1KLU D;  3TZD A;  4JPB W;  4HR7 B;  1E1O A;  1C4Q A;  4JV5 L;  2A6H D;  2VS1 A;  1NY4 A;  3FPP A;  5C5L A;  1AZP A;  1QVF A;  2HT1 A;  2K05 A;  4CDE C;  1Q7Y C;  2X69 A;  2MGS A;  2R3Z A;  2Z8L A;  3I91 A;  2ZTC A;  2ALY B;  4C3H B;  4YIJ A;  1CI3 M;  3DM3 A;  3CRK C;  1VQJ A;  3QG1 A;  1GOZ A;  4JI4 Q;  4F88 A;  4B3T Q;  1VCI A;  1LV9 A;  2F0U A;  1SYB A;  3J7A 5;  4K8I A;  1JWS D;  2I46 A;  4G57 A;  2EOT A;  3H3V H;  3F2B A;  4WJ4 A;  5C0X H;  4BY7 B;  4DV0 L;  2VB3 X;  2K50 A;  1ESR A;  1XTC D;  3LWE A;  2NVX H;  3TP7 A;  4FF3 A;  1JQY D;  3CCJ A;  3HOW G;  5C4X B;  3B6Y A;  3KBX A;  4KN4 C;  5EKI A;  2NVQ B;  4LF6 L;  3K7A B;  4P71 A;  4Y52 H;  4A4I A;  1PHJ A;  2EQS A;  2Q2T A;  2AUK A;  5BR8 L;  4X64 L;  3RZO B;  5ISR A;  5M5Y B;  3J80 c;  4R4T A;  4A3C G;  2MQH A;  3T4A C;  4HSV A;  3UDG A;  5KYI A;  1XNR Q;  1FYC A;  3ER0 A;  3SVM A;  1WTV A;  4A3B B;  1NBW A;  3JC6 6;  5BN5 A;  1PV4 A;  3CCL A;  3RD4 A;  4XQN A;  1PH7 A;  3MXU A;  2NVY H;  4XYQ A;  2RDF A;  3BDL A;  1HQR D;  4YWK A;  2I5H A;  1Q86 C;  2AMC B;  4UY8 C;  3K0X A;  5IP9 G;  3D6C A;  4JVZ A;  3D3R A;  2JA9 A;  4HJ9 A;  1V1Q A;  4JYA Q;  3NHH A;  1BCP D;  1YJ9 A;  4BY1 B;  4TRD A;  4OXP A;  1PRT C;  1SMY C;  1LYL A;  2MP1 A;  3T1H Q;  4ME5 A;  3G6J B;  4XIG S;  4FF2 A;  2EE1 A;  2N88 A;  2KHJ A;  1NR2 A;  1J5E Q;  1RJT A;  4IPD A;  2B2V C;  4DNI A;  2MPM A;  3AFP A;  4UP9 A;  2D0P A;  1X3E A;  3L0O A;  5DAU A;  2L12 A;  1HUM A;  1LTA D;  1YIJ A;  1LTG D;  5CR3 A;  2WV6 D;  4DK0 A;  4ODG A;  1IBM Q;  3GTQ B;  4DV7 L;  4O1N A;  2YV5 A;  2YTX A;  2B2Y C;  1CKN A;  1M1K C;  3GTJ B;  5J1Z A;  4XQJ A;  4IUV A;  3L9A X;  1HA6 A;  1TWA H;  2K75 A;  1SFO B;  1PLF A;  2F0D A;  2ATW A;  5JEA H;  3PV0 A;  1GUO A;  2JA8 G;  2PZW A;  3HS0 C;  2A6H C;  2UUB L;  4V0B A;  4XQQ A;  4POG A;  4IFD G;  1W6K A;  3GQB A;  3CPW A;  4BY1 H;  4R9W A;  2F0K A;  4G7O C;  1KRT A;  3F2U A;  2D62 A;  3S17 B;  3DEP A;  4IUN A;  2KEN A;  3RMH A;  3AQQ A;  2DNE A;  4TQU S;  1XNQ L;  3NSW A;  3QJY A;  4DGZ A;  4BWG B;  4MTK A;  5NUC A;  2V1C C;  5IT9 E;  1SAP A;  3ERS X;  1EOT A;  1WFQ A;  1SYC A;  1W6J A;  1VQ5 A;  2WFW A;  4GOP C;  5FO8 B;  1GM5 A;  3MXN A;  3NQI A;  4IQZ A;  2CQO A;  4IUR A;  1NMG A;  4MNO A;  5M5Y H;  4LF7 L;  3PO2 G;  2P5Z X;  4KHV A;  1YNN D;  3UDF A;  3LWU A;  1LTS D;  1DON A;  1BR9 A;  2K01 A;  2G9H D;  2VW9 A;  2QA4 A;  2NVQ H;  3K81 C;  5JPM C;  3OW7 A;  1OO9 B;  2KA7 A;  2NN6 G;  1EWH A;  2B8G A;  3IFD A;  1C7Y A;  2FJ2 A;  4ABN A;  1LAC A;  2K32 A;  2EJG C;  2WB1 E;  2Z6K C;  1NTG A;  1N36 L;  2D0O A;  4R8N A;  2DY8 A;  3C1F A;  5TSS A;  4IUU A;  4DR5 Q;  3P75 A;  1VMP A;  2K28 A;  2WII B;  4K5X A;  4GLX A;  4JI2 L;  4PV1 C;  4OON A;  2EJM A;  4DV2 L;  3ERO A;  1TS2 A;  2SNM A;  2JP1 A;  2NB0 A;  4P74 A;  1L2F A;  1YBY A;  3RLN A;  4GKK L;  2Q8T A;  4QUF A;  5EQ0 A;  4B3M L;  2K5N A;  4DAV A;  4A3E G;  1XYI A;  4TSS A;  4O0A A;  1VQD A;  1SNO A;  4EQP A;  5GQO A;  4DV3 Q;  5A2Q L;  5FLM G;  1JR0 D;  3RN5 A;  3FKI B;  2ZM6 L;  2Z4I A;  1YNJ D;  2FFK B;  4MTN A;  1BCP F;  4E6I A;  3M4Q A;  2NUC A;  4EQ5 A;  5J22 A;  2FMC A;  2R7Z G;  3OIQ A;  3NWS A;  3S1N B;  1WTX A;  1PVO A;  1B9N A;  4LF8 L;  2XSC A;  3D8G A;  4HAE A;  1EQV A;  3OWE B;  2H5X A;  1TY2 A;  3HOW B;  1TKW B;  3STB D;  2LSS A;  1Q1E A;  2JJQ A;  2QIL A;  2FXQ A;  4XDX A;  1LAB A;  5CV8 A;  4GKK Q;  1RKN A;  4CKB A;  3AYH B;  1VQN A;  2Z6B A;  3K80 C;  5M3M B;  4N8X 1;  1BBW A;  2EY6 A;  4WRD A;  4OEM B;  3HOU B;  4LF7 Q;  1HHV A;  1M8A A;  4QIW B;  2R7D A;  1HCZ A;  3G7L A;  3SR1 A;  1G8Z D;  3JAM i;  4CJ2 C;  1WCM B;  2ZM6 Q;  4CDC C;  1XTD A;  1MBY A;  4RCO A;  3GTM H;  4OIJ A;  2VNU D;  4LAA A;  3R2T A;  1QNK A;  4ALP A;  3H0G G;  4NXN L;  3L7Z C;  1K8G A;  4O42 A;  1Q81 C;  3QR8 A;  3PO3 H;  2ID0 A;  4OX9 L;  4LFC L;  4LF5 Q;  1H9M A;  4IJH A;  4X66 Q;  1A0I A;  1SR3 A;  3QO2 A;  5M5W B;  5GAD C;  3CF5 A;  2E2D C;  2B2W A;  1UWV A;  2IT1 A;  3E3X A;  1VMC A;  2E2H H;  3BDO A;  1XNR L;  5T1I A;  3K59 A;  1I3Q B;  5A2Q E;  4DR7 Q;  2N55 A;  2HDL A;  2C5C A;  2IHF A;  5E7N A;  4XYO A;  1STY A;  1UE5 A;  3HOY G;  2IL8 A;  2Q8R E;  1K0R A;  1KDC A;  2B2T A;  3CKI B;  1L0W A;  3HOV G;  1SBB B;  2KBN A;  4OGQ C;  4GNX A;  1B1Z A;  2QEJ C;  2FHT A;  3CC2 A;  1FNU A;  4RA8 A;  4QGU A;  1MKH A;  4M1U B;  4LNQ A;  2V4D A;  2PW7 A;  5JJL A;  1TWC B;  2PO4 A;  2I5L X;  2A74 C;  1K8O A; 
#chains in the Genus database with same CATH homology
 5JEA J;  2PZU A;  3J80 E;  1FNW A;  5E4X A;  3NBH A;  1AP0 A;  1SNQ A;  3KLR A;  3GD7 A;  1NAP A;  4IN3 A;  3VR4 A;  1AEX A;  2PCF B;  5JJZ A;  4J6H A;  3GTO B;  3A54 A;  4A3F B;  5HGT A;  5COY A;  4B9X A;  3I4L A;  1XX8 A;  1U9R A;  3J81 E;  2E2H B;  1S5E D;  1D5X C;  4FXK C;  1DZ1 A;  3J7A V;  3PUW A;  1RTO A;  2F03 A;  3E5S A;  1TT2 A;  1JWU D;  3M85 A;  3S2H B;  2KHS A;  4KK7 A;  4P2C B;  4K5V A;  1ENF A;  5FO9 B;  1ZEQ X;  5CYU A;  5CV7 A;  2AUJ D;  1T5E A;  3MVV A;  3PMF A;  1C48 A;  1G2S A;  1UAP A;  1E2V A;  4H44 C;  3SEB A;  5DM6 3;  1Y8N B;  2BA0 A;  5FLX L;  4S3S A;  4IAL A;  3C46 A;  2ENB A;  2KEE A;  1S5D D;  1WTR A;  1JE4 A;  5HUR A;  1STH A;  3TME A;  1Q3L A;  4HN7 A;  3HEJ A;  4KY5 A;  3GTK B;  1H9R A;  1LTR D;  1HA5 A;  2C9O A;  1JCK B;  2CQA A;  3E0J A;  1SNP A;  3QOL A;  5DM7 3;  3EFX D;  1V1P A;  2AQ1 B;  3SHL A;  1Y1V B;  4RCN A;  3MXP A;  1MSH A;  1SYF A;  5T1G A;  1FR3 A;  3IFT A;  4HED A;  3MEH A;  1KAB A;  4L63 B;  1C8C A;  2RA4 A;  2SNS A;  4A3G B;  5FLX E;  1SYG A;  1GUN A;  1EU3 A;  4FXG C;  3M7N A;  1GHK A;  1HFN A;  3VA5 A;  1VDZ A;  4IZ8 A;  4HCE A;  2M00 A;  5E1F A;  4WFN 3;  4EGV A;  2D5D A;  3NTH A;  1B53 A;  4HCS A;  4C3H G;  4FNF A;  2GA4 B;  5ELE A;  3T13 A;  3C3L A;  4FF4 A;  4C1N K;  3DHQ A;  2A6E C;  2BCO A;  4K6D A;  2H1E A;  1PFM A;  2CW0 C;  2X6L A;  3OWF A;  1EU4 A;  1ET6 A;  2WP8 J;  4F87 A;  2AWN A;  3SE0 A;  3R8B A;  3N52 A;  5EBD A;  5LL6 X;  2RDG A;  1VF5 C;  4KD4 A;  2B2U C;  4IUP A;  3HKZ B;  2B2W C;  1I4G A;  2HDM A;  3HOY B;  2JA5 B;  1EL0 A;  3OMC A;  3GP7 A;  2JE6 I;  1DXM A;  4RKB A;  2O4X A;  2VB2 X;  1ICW A;  2L55 A;  4CJ0 B;  4X3K A;  1EY6 A;  2MHV A;  2EXZ A;  4FP5 D;  1TWA B;  1SDF A;  5C3W A;  4J1M A;  4EQN A;  1U4L A;  4K2K A;  1D1K A;  2KQ3 A;  3UI2 A;  2OXP A;  5CV5 A;  1EZ8 A;  1J8I A;  4FXD A;  4PMB A;  2B2V A;  1JOQ A;  2NTT A;  3A7L A;  3MXG A;  4KKS A;  4LJZ C;  4NW2 A;  3A7A B;  4R8I A;  2ZXO A;  1STN A;  1TWH B;  1QB5 D;  2F0M A;  1DOM A;  2SOB A;  1ESF A;  1F2L A;  2QDB A;  3MWY W;  1KDB A;  5KNB A;  3FMC A;  1EY8 A;  5M9O A;  4C3I B;  2L4N A;  3PO2 B;  3M7G A;  3P1H A;  2OT2 A;  5JAV A;  1CA6 A;  1PZK D;  2JEA I;  3DWA A;  3I73 A;  2J4X A;  4IUQ A;  3N6R A;  3BVG A;  2JSO A;  3I72 A;  1DD2 A;  2F0P A;  3ND9 A;  2LY7 A;  4PMC A;  4ZLT F;  1BCP B;  1QOH A;  4GZY C;  3NK9 A;  1TR5 A;  2R93 B;  3CU7 A;  4EVO A;  5IOD A;  5IOC A;  3BZD B;  2KCN A;  1XWE A;  3Q6S A;  4CJ1 B;  4XT3 B;  4DAY A;  3IAY A;  4ZKB B;  1I4R A;  1HTP A;  4CKE A;  3SK4 A;  3KK7 A;  4CGY B;  1PRT D;  4ZQ3 A;  4RHS A;  1EIH A;  3I8Z A;  5CV6 A;  1CQV A;  2E74 C;  2E2J B;  3K0Y A;  4EQO A;  3TDQ A;  5IGD A;  1G91 A;  3I90 A;  4G4K A;  1O80 A;  1MI2 A;  3K58 A;  5J39 A;  2EVB A;  2D2C C;  4KKT A;  1V8Q A;  3LX0 A;  1AN8 A;  3EJI A;  2L5T A;  2FIN B;  3BYT B;  3SDZ A;  1K83 B;  2M2L A;  4CBV A;  1O7Y A;  2IX3 A;  3VYT A;  1SXT A;  1TS4 A;  4BBS B;  3FEW X;  2VXW A;  5C4H A;  2B39 A;  4KN7 C;  2KEC A;  2JEB I;  1CHQ D;  4BA1 I;  2E76 C;  1RHP A;  4TKO B;  5C44 B;  3M4Y A;  1SMY D;  3I4M B;  5CC4 A;  2XWJ B;  4IFD H;  3DEO A;  1VF7 A;  2IX0 A;  2L11 A;  1BDO A;  2F0I A;  5KND A;  1IW7 C;  3ERQ A;  1TY0 A;  2F0V A;  3A8I E;  3AB9 A;  3D4D A;  5M5X B;  2H4O A;  1D2B A;  4DNR B;  3LNN A;  4K2L A;  3NBI A;  4K5W A;  3HGB A;  2SDF A;  2XWB B;  5KEE A;  4PNY A;  1ZYR D;  1GHJ A;  2B63 B;  4ULL A;  4ZAI A;  3Q22 A;  1LT6 D;  2MJ8 A;  5JVG 3;  2E2I B;  1EY9 A;  1E0B A;  4PQX A;  2SEB D;  4DK1 A;  4UAI A;  1AFP A;  4LMQ D;  2IX1 A;  1X3Q A;  4HTH A;  1HPC A;  3FRP B;  1Y8P B;  1Y8O B;  4DFA A;  3QOJ A;  1WTQ A;  5BN3 A;  2JA7 B;  3DM1 A;  3VR5 A;  3OMG A;  4N9T A;  4X3S A;  1TS3 A;  5ELF A;  4B9W A;  1FNV A;  1TQO A;  1ILQ A;  3SK8 A;  3MTS A;  5LL6 S;  1TWG B;  3NQT A;  1LLR D;  2RVL A;  1QCB D;  2F0L A;  5KRU A;  3M3Y B;  2EDG A;  3J81 L;  5EPK A;  3S14 B;  2NZ1 D;  1H9S A;  5K36 H;  2KJX A;  2KCC A;  5C4Z A;  5I2X A;  2DN8 A;  4KY7 A;  1TS5 A;  2EYP A;  2OEO A;  2PMZ B;  1QG7 A;  1R9T B;  1QJO A;  2NN6 I;  4BBR B;  2DY7 A;  1H9J A;  3OHX C;  3EQL C;  2K1B A;  3TP8 A;  1IYU A;  2K5D A;  4QF4 A;  1STG A;  5IGB A;  2BE5 D;  2BA1 A;  4RHR A;  1JIC A;  1Z6H A;  1GUT A;  2CHB D;  1U4P A;  1L0Y B;  4KJO A;  1B50 A;  2EYH A;  3PIO 3;  1CM9 A;  2RKS A;  3GTG B;  2PPB C;  1S5F D;  2WIN B;  1WVL A;  3L3O C;  1IKM A;  1B9M A;  4OO1 G;  3J80 L;  4DAP A;  2B2U A;  1AZQ A;  1DM0 B;  2XRQ D;  2J7Z A;  4A3J B;  3VR3 A;  4QMG A;  4BA2 I;  1KLG D;  1LT5 D;  5C4J B;  3V05 A;  4CHT B;  1F9P A;  2YU9 B;  3W2D A;  3VYU A;  4CKC A;  4X3T A;  3Q24 A;  1FGB D;  3C1E A;  1IKL A;  4LK1 C;  1S5C D;  3VYS A;  1BCP C;  2WAC A;  5IGG A;  1JWM D;  4NDX A;  3FPU B;  3OPO A;  2J0T D;  1WD1 A;  1LT4 D;  5C3E B;  1STA A;  2Q8I B;  1CT1 D;  1I6V C;  2F3W A;  2NBF A;  1KDA A;  3TN2 A;  3M4O B;  5EGT A;  2A5H A;  4H0L C;  1SE2 A;  2F3V A;  5I9O A;  3MZ5 A;  2ZXP A;  2KVM A;  1IYV A;  1LTI D;  4B08 A;  5EBC A;  3JAM E;  5IGF A;  1SSO A;  3NP8 A;  1SNM A;  4A3K B;  3HZX A;  1IHZ A;  2RSO A;  1H9S B;  1PTO D;  2A68 D;  2K6A A;  4MIU A;  5E4W C;  1H9K A;  1CZW A;  1E2W A;  2L1B A;  1OXU A;  2DNC A;  1BXT A;  5K5P A;  2WAQ B;  1T5X D;  3H09 A;  5F2D A;  5I2Y A;  2F0W A;  1PTO B;  5EKK A;  4K14 A;  3QB3 A;  2QKI C;  3GV6 A;  1B44 D;  1I50 B;  3BG3 A;  3D6W A;  3KUP A;  1K8M A;  1SND A;  2EYL A;  1ROD A;  1EEF D;  1SEB D;  2KOL A;  2AQ2 B;  1BUV T;  2AQ3 B;  2EY2 A;  1ILP A;  1CHP D;  2CW0 D;  3U9S A;  2A73 B;  2EYO A;  3GTL B;  3C2P A;  2NWG A;  4HMI A;  1QIL A;  3W3A A;  1BQQ T;  2D9U A;  4IUT A;  5I9P A;  2EYF A;  5D3D A;  2R61 A;  2RSN A;  3O13 A;  2B2Y A;  1B3A A;  3TZU A;  1SE3 A;  4K6L A;  4KJN A;  5ELD A;  2QF7 A;  4QB4 A;  4DXG A;  3TP5 A;  1L0X B;  5ELB A;  4IFD I;  1G2T A;  5I6Y A;  5KGU A;  5M3F B;  2LMC B;  2Y0S B;  1YNN C;  1TU2 B;  3CHB D;  4N9P A;  3KF8 A;  1Y69 U;  1Q1B A;  2RBM A;  1CK1 A;  3BVZ A;  2KED A;  2R92 B;  3PUV A;  1HQM C;  1SJE D;  1CQF A;  1EEI D;  4ZUI A;  5KYL A;  2LS0 1;  5IGC A;  3NUC A;  3HOZ B;  3CQZ B;  4OHJ A;  1PYW D;  3MHB A;  1NCV A;  3KLS A;  1ZXT A;  5JOB A;  1A2U A;  2K33 A;  2F0J A;  4V19 0;  3BVM A;  4KMU C;  3T53 B;  2WKC A;  2F0Q A;  2PZT A;  1CFM A;  1PXU A;  1X32 A;  1S5B D;  5D3I B;  4F7X A;  4C1N I;  1Q12 A;  5EJW A;  3MFY A;  5DNF A;  3D31 A;  4C2M B;  3NTK A;  1ET9 A;  4ZUJ A;  4KD3 A;  1SE4 A;  1QE6 A;  2BDN A;  2EPB A;  3DWP A;  5EPL A;  2EJF C;  3S9W A;  5EKL A;  1JC7 A;  1EIG A;  2JA8 B;  1EY7 A;  2E75 C;  5C6A A;  2O5I C;  4OO1 H;  2ZXR A;  2F0O A;  4KTA A;  5KNC A;  3TBI B;  4KY6 A;  4XXE A;  1EY4 A;  2NVX B;  5CBA E;  1BOS A;  3MFG A;  5I6W A;  3J7A F;  3VR2 A;  3S2D B;  1LTT D;  2F0N A;  4HMJ A;  2YYZ A;  3DMU A;  3ONA B;  1NUC A;  1JOO A;  3VR6 A;  3H3V C;  1BNZ A;  3T16 A;  3H6M A;  2A69 D;  2K7V A;  2HQE A;  2WKD A;  3P20 A;  4OL7 A;  1PTO F;  3A55 A;  4RGO S;  3GV3 A;  4ZRZ A;  1SNC A;  2F0H A;  3A8J E;  3K57 A;  1A3V A;  1EZ6 A;  1RTN A;  3GTP B;  1HTL D;  2X6G A;  1BBX C;  4DNT B;  1DJR D;  1GUW A;  3NE5 B;  1WTW A;  1A6X A;  3WOF A;  3SK6 A;  4K8J A;  1EY5 A;  1DYQ A;  1HRJ A;  4HSP A;  4Q0F A;  3DWQ A;  2F0E A;  3WOE A;  2K5W A;  1E2Z A;  4RGM A;  3K5N A;  3T56 B;  2F0F A;  3NPP A;  2TSS A;  4ZK9 B;  2ICI A;  2M9V A;  1PDQ A;  1YNJ C;  5IGE A;  3PUY A;  3ZYY X;  1NSN S;  3S1R B;  2ICE C;  2L0C A;  4RGT A;  4DF7 A;  2JXM B;  3QIA A;  2JYO A;  1UNS A;  1EYC A;  2FMM A;  2NVT B;  3GO5 A;  1B2T A;  2VUM B;  3R3O A;  4I65 A;  4A3D B;  1JOR A;  2K5Q A;  2EZV A;  2BDO A;  1II3 A;  5C0X I;  4BS9 A;  4ZKC B;  4KKU A;  2IW3 A;  4RFB A;  1GJX A;  1EYD A;  1F77 A;  4RKL A;  2OF1 A;  3BYY B;  5FKA C;  5D65 A;  3BS1 A;  1D1I A;  1O7Z A;  4JBW A;  4NP5 A;  1SYE A;  5COR A;  3KBG A;  3Q0A A;  1D5Z C;  2F1M A;  1Y1W B;  4X3U A;  2R6G A;  1QNU A;  4ID6 A;  1PZI D;  3IL8 A;  5DEH A;  2O2L D;  3OSO A;  3ND8 A;  3H94 A;  5FOB B;  1ONL A;  2A69 C;  4H7B A;  3X3M A;  3K5L A;  2NTS A;  4U67 3;  3VYR A;  1GUS A;  3S15 B;  5C0X J;  1TII D;  3TSS A;  1V1O A;  1GXD C;  2LFN A;  2F0S A;  1STE A;  3H0G B;  2IWH A;  1ENC A;  1RD9 D;  5JPN C;  5I4D A;  2RDH A;  2EY1 A;  2I07 B;  1DOK A;  4DXF A;  1RCV D;  1R4P B;  2B8F A;  1Q8I A;  4Z9C B;  2F0T A;  2PNR C;  1PZJ D;  1PTO H;  1HFG A;  1JOK A;  3EVQ A;  4DA2 A;  3RLF A;  2HCC A;  2EYM A;  4KV6 A;  1EYA A;  1LTB D;  1PTO C;  3OIP A;  5AFW A;  4JK1 C;  4A3E B;  3I70 A;  2L9H A;  1BF4 A;  1FD7 D;  4RGN A;  3R2I A;  1CZG A;  1U4M A;  4WOR A;  1R4Q B;  1I4P A;  3SXH A;  2A6E D;  4KI0 A;  1MD2 D;  3A56 A;  5JEA G;  5C3X A;  1RDP D;  1EQT A;  3WDN A;  1B4O A;  1O7L A;  2PYK A;  5LHY 1;  1F9S A;  1PRT B;  2XVS A;  3JAM L;  1ZYR C;  1LT3 D;  3T51 B;  1SJH D;  3ITP A;  2XRS D;  2KUM A;  4A93 B;  3NXW A;  4KHZ A;  5G3L D;  2MUY A;  2F4I A;  2RQX A;  5CBE E;  1DCZ A;  3IKJ A;  2IJ0 A;  2CVR A;  1I6H B;  1EFI D;  1A15 A;  3VA7 A;  2G9D A;  1G29 1;  4FF1 A;  5CV4 A;  3HOX B;  5IIF A;  3PIP 3;  4XTC S;  2R7Z B;  3D4R A;  4NMZ A;  1OXV A;  1I4H A;  1WTP A;  3TP6 A;  1DOL A;  4UDU C;  2B2T C;  2XNA C;  2PW5 A;  1KTK A;  2EY5 A;  5ELC A;  1F2Z A;  3MA2 B;  4L6T B;  4MHE A;  1F2Y A;  1V1P B;  3U9O A;  1CTM A;  3RUZ A;  3V96 A;  1Q90 A;  3S16 B;  1X3P A;  2K03 A;  4Q5V A;  2Z1C A;  3K5M A;  2O5J C;  1J9O A;  3H91 A;  4OIK A;  4J8Q A;  5CGK A;  4DN4 M;  5FO7 B;  3HP3 A;  4C56 C;  3NTI A;  3QWN A;  1IL8 A;  4PMW A;  2XN9 C;  1RF2 D;  3PUZ A;  4DU9 A;  4RAU C;  1QWY A;  1D6E C;  1F9Q A;  1Z47 A;  2K04 A;  4RH6 A;  1KNE A;  3RZD B;  4H13 C;  1MSG A;  1PRT F;  1ZKO A;  1PFN A;  5JVH 3;  1I4Q A;  2NN6 H;  3SK5 A;  2Z4H A;  4QCL A;  1WTO A;  4XT1 B;  2NVY B;  3K5O A;  1OXS C;  1SYD A;  2BOS A;  3D4W A;  4FYD A;  2AWO A;  4FO2 A;  3MC0 B;  1F9R A;  1PMR A;  5A35 A;  3S1Q B;  3AMU A;  1KAA A;  3I4N B;  1S4Z A;  3P7J A;  1A3T A;  3CRL C;  3Q23 A;  3BDC A;  1U4R A;  3OOC A;  3FVQ A;  2F0G A;  5C0X G;  4WJW A;  2LKV A;  1AW7 A;  3AU7 A;  2TMP A;  1PFB A;  1D5M C;  5BN4 A;  4G7Z C;  3DXJ C;  1JB3 A;  3EA6 A;  4C3J B;  2EYJ A;  1UEA B;  3URY A;  5C5M A;  4IFD J;  3S1M B;  1EY0 A;  4MN3 A;  1IW7 D;  1CA5 A;  5FK9 C;  5IT9 L;  2A68 C;  4L8J A;  1MGS A;  3X3N A;  5E3F A;  2JA6 B;  1G6Z A;  1EWC A;  4ILW A;  3PUX A;  2IPK D;  4I7Z C;  3A8K E;  3NWT A;  2HUG A;  4G7H C;  4Y7N B;  1BO0 A;  2NYZ D;  1STB A;  4M8A A;  2XIW A;  1KNA A;  1WD0 A;  3DUZ A;  3R93 A;  2HCI A;  3HG9 A;  4QUC A;  1TVX A;  3J7Y W;  1A3U A;  3PO3 B;  1M4V A;  4RWS C;  4A3I B;  1O78 A;  1ENA A;  4ZYS A;  1Z7T A;  1LO5 D;  3GTM B;  3K6O A;  2ZT9 C;  2BE5 C;  1GUG A;  1XXG A;  3MAQ A;  1TWF B;  3E6Z X;  5EPJ A;  1HXY D;  4FVM A;  1F2M A;  2PQE A;  2QCP X;  1OXT A;  1ML0 D;  5CV9 A;  4U68 A;  5D14 A;  3HOV B;  4F8M A;  1V43 A;  5CMD A;  4AYB B;  4C3J G;  1OXX K;  4OO1 I;  5G3L F;  5KIX A;  1HUN A;  3I3C A;  4A3M B;  1NR4 A;  5K36 G;  1UUP A;  3FDT A;  2WB1 B;  3HRZ C;  1I4X A;  4NKL A;  4C3I G;  3KLS X;  3V2T A;  1KLU D;  3TZD A;  4HR7 B;  1C4Q A;  2A6H D;  3FPP A;  5C5L A;  1AZP A;  2K05 A;  2X69 A;  2MGS A;  2R3Z A;  2Z8L A;  3I91 A;  4C3H B;  4YIJ A;  1CI3 M;  3CRK C;  3QG1 A;  1GOZ A;  4F88 A;  1VCI A;  1LV9 A;  2F0U A;  1SYB A;  4K8I A;  1JWS D;  2I46 A;  4G57 A;  2EOT A;  5C0X H;  4BY7 B;  2VB3 X;  1ESR A;  1XTC D;  3LWE A;  3TP7 A;  4FF3 A;  1JQY D;  5C4X B;  3KBX A;  4KN4 C;  5EKI A;  2NVQ B;  3K7A B;  2AUK A;  3RZO B;  5ISR A;  5M5Y B;  3T4A C;  4HSV A;  5KYI A;  1FYC A;  3SVM A;  1WTV A;  4A3B B;  5BN5 A;  3RD4 A;  4XQN A;  3MXU A;  4XYQ A;  2RDF A;  3BDL A;  1HQR D;  3D6C A;  3D3R A;  3NHH A;  1BCP D;  4BY1 B;  4TRD A;  1PRT C;  1SMY C;  2MP1 A;  4ME5 A;  3G6J B;  4XIG S;  4FF2 A;  2EE1 A;  2N88 A;  1NR2 A;  1RJT A;  2B2V C;  2MPM A;  5DAU A;  2L12 A;  1HUM A;  1LTA D;  1LTG D;  5CR3 A;  2WV6 D;  4DK0 A;  4ODG A;  3GTQ B;  4O1N A;  2B2Y C;  3GTJ B;  5J1Z A;  4XQJ A;  4IUV A;  3L9A X;  1HA6 A;  1SFO B;  1PLF A;  2F0D A;  5JEA H;  3PV0 A;  1GUO A;  2PZW A;  3HS0 C;  2A6H C;  4V0B A;  4XQQ A;  4IFD G;  1W6K A;  3GQB A;  4R9W A;  2F0K A;  4G7O C;  3F2U A;  2D62 A;  3S17 B;  3DEP A;  4IUN A;  3RMH A;  2DNE A;  4TQU S;  3NSW A;  3QJY A;  4DGZ A;  4BWG B;  5NUC A;  5IT9 E;  1SAP A;  1EOT A;  1SYC A;  1W6J A;  5FO8 B;  3MXN A;  3NQI A;  4IQZ A;  4IUR A;  4KHV A;  1YNN D;  3LWU A;  1LTS D;  1DON A;  1BR9 A;  2K01 A;  2G9H D;  5JPM C;  3OW7 A;  1OO9 B;  2KA7 A;  2NN6 G;  1EWH A;  2B8G A;  3IFD A;  2FJ2 A;  4ABN A;  1LAC A;  2K32 A;  2EJG C;  4R8N A;  2DY8 A;  3C1F A;  5TSS A;  4IUU A;  3P75 A;  1VMP A;  2K28 A;  2WII B;  4K5X A;  4PV1 C;  2EJM A;  3ERO A;  1TS2 A;  2SNM A;  2JP1 A;  2NB0 A;  2Q8T A;  4QUF A;  5EQ0 A;  4DAV A;  1XYI A;  4TSS A;  1SNO A;  4EQP A;  5A2Q L;  1JR0 D;  3FKI B;  2Z4I A;  1YNJ D;  2FFK B;  4E6I A;  1BCP F;  2NUC A;  5J22 A;  2FMC A;  3OIQ A;  3NWS A;  3S1N B;  1WTX A;  1B9N A;  2XSC A;  3D8G A;  4HAE A;  1EQV A;  3OWE B;  1TY2 A;  3HOW B;  1TKW B;  1Q1E A;  2QIL A;  4XDX A;  1LAB A;  5CV8 A;  1RKN A;  4CKB A;  5M3M B;  2EY6 A;  4WRD A;  3HOU B;  1HHV A;  1M8A A;  4QIW B;  1HCZ A;  3G7L A;  3SR1 A;  1G8Z D;  4CJ2 C;  1WCM B;  1MBY A;  4RCO A;  4OIJ A;  2VNU D;  4LAA A;  3R2T A;  1QNK A;  3L7Z C;  4O42 A;  2ID0 A;  1H9M A;  3QO2 A;  5M5W B;  2E2D C;  2B2W A;  2IT1 A;  1VMC A;  3BDO A;  5T1I A;  3K59 A;  1I3Q B;  5A2Q E;  2N55 A;  2HDL A;  2C5C A;  4XYO A;  1STY A;  2IL8 A;  2Q8R E;  1KDC A;  2B2T A;  3CKI B;  1SBB B;  4OGQ C;  1B1Z A;  2QEJ C;  2FHT A;  1FNU A;  4RA8 A;  4M1U B;  2V4D A;  2PW7 A;  1TWC B;  2PO4 A;  1A2T A;  2A74 C;  1K8O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...