1BDOA

Structure of the biotinyl domain of acetyl-coenzyme a carboxylase determined by mad phasing
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
80
structure length
80
Chain Sequence
EISGHIVRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEAMKMMNQIEADKSGTVKAILVESGQPVEFDEPLVVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ACETYL-COA CARBOXYLASE
publication title Structure of the biotinyl domain of acetyl-coenzyme A carboxylase determined by MAD phasing.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 14
structure length 80
sequence length 80
ec nomenclature ec 6.4.1.2: Acetyl-CoA carboxylase.
pdb deposition date 1995-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1bdoA00
3VR3A 2BE5C 2EDGA 4KHZA 2BA0A 2B8GA 1ONLA 5JEAG 4XIGS 1EWHA 4TQUS 4RCNA 1LABA 4H13C 2A6ED 5K36H 4OGQC 1OXTA 3IFTA 2E75C 1GUGA 1HCZA 2D2CC 3A8JE 2DNEA 1H9MA 3D31A 5C0XG 3EQLC 1A6XA 3PUYA 2O5IC 4IFDH 1BDOA 3M4YA 2NN6G 3P20A 1YNJC 4L8JA 3QIAA 4DK0A 2JEBI 4LJZC 3N6RA 4JK1C 2A69C 1Y69U 1E2VA 3WDNA 2PNRC 4IQZA 2D5DA 1VCIA 1IW7D 1OXUA 2YYZA 2PPBC 1CI3M 3A7LA 3D4RA 5JEAH 2IT1A 2EVBA 1OXVA 2BA1A 3OOCA 4KKTA 3T53B 5A35A 1VF5C 2O5JC 3A8KE 1DD2A 4KI0A 2A6EC 4KMUC 1VDZA 3GQBA 4HR7B 1LACA 2K32A 5C0XH 3L7ZC 1ZYRC 1B9MA 4H44C 3I73A 1GUSA 1IYVA 2NN6H 2E74C 2R6GA 2A6HD 1VF7A 1GUOA 2QF7A 3VR6A 2K7VA 3VR5A 2JEAI 2B8FA 2F1MA 2NN6I 1GJXA 1H9JA 1O7LA 1I6VC 1E2WA 4DNTB 3A8IE 1Q1EA 3T56B 3CRLC 1FR3A 1GHJA 1IW7C 4H0LC 3SE0A 3FPPA 1H9SB 3TZUA 4BA2I 4GZYC 2K33A 2EJFC 2DNCA 3U9SA 3BG3A 1V8QA 3MFYA 4I7ZC 1Q90A 3CRKC 3RLFA 4G7ZC 1Y8NB 3H94A 3OW7A 1OXXK 3PUWA 4XTCS 3PUXA 1IYUA 1H9RA 2L5TA 3PUVA 3VA7A 1Q12A 2A6HC 1DXMA 2Q8IB 1GUNA 3LNNA 3M85A 2KA7A 2V4DA 3PUZA 1ZKOA 3LWUA 2D62A 1OXSC 2E76C 3I72A 1HQMC 1TU2B 4DNRB 1Z6HA 4TKOB 5KNBA 3KLRA 4LK1C 3ND8A 1HPCA 4KN7C 2DN8A 3FMCA 5BN4A 1T5EA 4G7HC 3I4LA 2JXMB 1K8MA 1H9SA 3VR4A 2AWOA 4BA1I 1G291 1O78A 1E2ZA 5K36G 4OO1G 4G7OC 4JBWA 3PV0A 2LMCB 1FYCA 3QJYA 1TKWB 1Z7TA 5BN3A 2A68D 1Y8OB 1H9KA 2BDOA 3BDOA 5KNDA 4PV1C 3VR2A 2BE5D 2AUKA 2JE6I 4KN4C 1V43A 3OPOA 1HTPA 4KKUA 1DCZA 3MXUA 1YNNC 1PMRA 1Y8PB 3GD7A 1K8OA 3QG1A 1Q1BA 1CTMA 1GUTA 1CFMA 2CW0C 2EJGC 2ZT9C 2PCFB 3DXJC 2KCCA 2AUJD 3HGBA 4KKSA 4OO1H 5BN5A 1GHKA 1QJOA 3NE5B 4IFDG 3A7AB 1SMYC 3AB9A 3W3AA 4DK1A 3IKJA 3M7NA 2A69D 2A68C 3T51B 2EJMA 3SDZA 1B9NA 5KNCA 3ND9A
chains in the Genus database with same CATH superfamily
2NVTH 1S5CD 4YHHL 4GNXA 5J1ZA 4PQXA 1PH3A 3H3VH 4XT1B 3GV3A 1E7ZA 4BXXH 1D5ZC 1HR0L 4R1JA 2R93G 2B2TA 3PUYA 1EQRA 4CKCA 2JA5H 1RJTA 2JK8A 1LLRD 1D5XC 1VCIA 1SNOA 1EU4A 3HOVH 3CCRA 3KDFA 2PQAB 3F1ZA 4RA8A 1SNDA 5I9PA 3H91A 4NP5A 1IYVA 2NVYH 3GTLB 2WV6D 2RCNA 4ZQ3A 1E24A 2WKDA 5ELDA 3S2HB 1S72A 1HR0Q 3D8GA 4X3SA 3TZUA 2OCEA 4L5SA 1P8LA 4A76A 1J9OA 2D0OA 3H94A 2N8NA 4RKBA 2BOSA 1KRSA 4LF5L 3AU7A 3BVGA 2TMPA 4IFDJ 1TWHB 3CCMA 1VQFA 1TU2B 2XGTA 4GNXC 3CC4A 5JOBA 4IUQA 2J4XA 1ET9A 2B63G 4DGZA 5M5WH 2CW0D 1ENAA 4IJHA 2NVQB 1JJCB 1PA6A 5M5XB 2B2TC 4A93B 3S1RH 1PH2A 3ITPA 3R8BA 5C4XH 5IYBH 4FYDA 4MZ9A 4B3TL 4P2CB 4FF4A 3S1QH 4PV1C 1AZPA 2DGYA 3PIPA 5IGBA 2EZVA 2CHBD 2E2HH 1YEZA 3I90A 3K80C 1HRJA 4V190 4F7XA 4RFBA 1YNNC 2EYJA 4R8IA 2WAQE 3GD7A 2EYMA 2XWJB 1GUTA 1PLFA 1PFBA 1EY9A 3GTMH 2K52A 3HG9A 4N8X1 3W1BA 5M5YH 2EYPA 1TWFB 3J80c 4A3KB 2N78A 1TVXA 2QILA 2K5WA 3TEHB 4B3TQ 2N55A 4E6IA 4FF1A 3ERQA 1O7ZA 2K6AA 1IL8A 4C2MB 2NZ1D 3A74A 2O5IC 3F2UA 3P20A 1SE2A 4L8JA 2N49A 2E2DC 3T1HL 5FLXL 2A69C 4IFDI 3GDEA 4I7AA 3I3CA 1VQ8A 4EQ5A 2LY7A 2F0QA 2R92G 3HOWH 3K5MA 2HIXA 4DAYA 2F4VL 2O5JC 2PQAA 3GQBA 3R93A 2K5HA 2R93H 1L0YB 1IBLQ 5T1GA 3BZKA 1G2SA 4GN4B 4Q0FA 2LFNA 4A75A 1PZJD 4K8JA 1TY0A 1EEFD 1WFQA 3W1GA 2NN6I 3K5NA 5G3LD 5IP9G 5ELEA 3SK5A 2KHJA 3HZXA 3H15A 1ASZA 2DNCA 2XTIA 5FJ8G 4DV4L 3T1HQ 4B3SL 1VQDA 2KEDA 3CAMA 3U9SA 3HOXG 3I4MB 2XWBB 3NQTA 5C44G 2ZXPA 2F0TA 1BQQT 2R7FA 1FNVA 1EU3A 4XTCS 4BWGB 2KUMA 2OT2A 3L0OA 4ZAIA 2OF1A 1Y1WG 4ULLA 2K05A 1AP0A 5IODA 1YITA 5FLXE 1BBWA 5IGEA 3KLRA 4LK1C 4LFCL 1VQ7A 2HQLA 3AFQA 2P5ZX 5K36G 4B3SQ 1BCPD 4G57A 1QVCA 4RAUC 1G8ZD 2BDOA 1X32A 4MTNA 5LL6X 4DV2L 2B2UC 1I50H 4C1NI 1KQSA 1XWEA 4K2KA 4J15A 1JWUD 2F0KA 5IP7G 1JWSD 3GTPH 1TWAB 3OMGA 2ZJPA 1WTPA 1VQPA 1N32L 1GKHA 1LTID 3T51B 4GKJL 1B9NA 2SEBD 1Y1VG 2XVSA 5BR8L 5C5MA 1PTOD 3VR3A 1TS2A 2B8GA 1LTLA 3C3LA 4F87A 4IOAA 1LYLA 1EWHA 1VMPA 3SHLA 4TQUS 1NBWA 2Q2TA 5TSSA 3I4NG 3RZOB 4DV2Q 1GOZA 3PQIA 4A3DB 2EY6A 4H7BA 5EBCA 1S5FD 4P74A 5IGGA 4AYBB 2RSOA 3IFDA 3GTJB 1HNZL 1G2TA 4UY8C 2YTXA 2YU9B 1TWCH 1WTOA 4GKJQ 5BR8Q 3U58A 3S14H 2K03A 5IYCG 3ICEA 3E5SA 3GV6A 4CKEA 3HS0C 2R92B 5M3MH 4OEMB 3VR6A 2N3SA 3D3RA 1O7LA 1JOKA 5KEEA 3C1FA 1Q1EA 4ABNA 3CKIB 3P75A 4LAAA 1MD2D 2EQSA 4JBKA 3KJOA 1Q90A 4GLVB 1HNZQ 1W6JA 4A3JG 1MHWC 4IOCA 1EOTA 4QGUA 5C3WA 2L4NA 2N88A 3DLLA 5LMNQ 1LV9A 3PUVA 3HRZC 1QNUA 1CUKA 3VA7A 5T1IA 1DXMA 1U4LA 2Q8IB 5CBEE 3CCJA 4N9TA 3OTOL 2D62A 2IX0A 5IP9H 4DNRB 1Z6HA 4JVZA 1PH9A 4X64Q 5FJ8H 1HUNA 3HOXH 2UUAL 1I4RA 3OWFA 5C44H 3I55A 1LTAD 1K8MA 4KK7A 3UDGA 2F0PA 4IPCA 3S2DH 1Q86C 1N9WA 3PO2G 3OW2A 4A3GB 5GQOA 2VB3X 1Y1WH 4GN3B 2F0JA 2IWHA 1Y8OB 2RHSB 1EY7A 1LTSD 2X6GA 2Z6BA 4EQOA 3CD6A 3S1NH 5HURA 1HA5A 4AYBE 2CH4A 3DM3A 1K8OA 3K8AA 3PO3B 2FHTA 2EJGC 5DAUA 2ZT9C 5K36H 1EIYB 2R7ZG 1SXTA 2F0NA 1B3AA 3G7LA 3NE5B 4DK1A 5IWAQ 2UUAQ 2K4KA 1PFSA 2SNMA 4NW2A 3E9IA 2EYOA 3OSOA 3C46A 5LMNW 3OHXC 3J80i 4RH6A 4R8NA 2BA0A 1K28A 3EROA 3TS0A 1F2LA 1UE5A 1FJGL 3UDFA 3RD4A 2CQAA 5IP7H 3IFTA 5EQ0A 4WFN3 1YJWA 5C4HA 2A8VA 3J7YW 1VQ5A 4LF4L 4PZ7A 4RWSC 4A3MG 3JC66 1W2BA 3AMUA 2F3VA 4M1UB 3FKIG 4B9XA 2E5LQ 2VQEL 4TVAB 2MPMA 1VQBA 2ZXRA 3OWEB 1SR3A 2OEOA 3I4NH 1EUJA 1B7YB 1Q46A 2WFWA 1I6HH 1ZYRC 2E2JH 4DR7L 1KHIA 2A6HD 1FJGQ 3RLOA 2WKCA 5IT9c 2F1MA 1H9JA 4H02A 2L55A 3A8IE 3WOFA 2IX3A 2LSSA 4LF4Q 1N33L 2EJFC 4RG1A 2JP1A 4LUZA 1TS4A 3D0FA 2VQEQ 2F0MA 1SROA 2G9DA 2Y0SB 3PUWA 3PUXA 5IYCH 1XPUA 2XRSD 4UP7A 2MP1A 4HSVA 4EVOA 2AKWB 5I2YA 3A56A 4X6AH 5E3FA 1NR2A 4BA1I 4A3JH 3CU7A 1PXUA 2L12A 3I56A 3H0GB 3I8ZA 3BDLA 4HJ9A 3ULJA 3STBC 4RKLA 1STGA 4QUCA 3QJYA 1WTXA 5CV9A 5EPKA 2HHHL 1E3PA 5ELFA 4TSSA 1TWGH 2B2YA 3PF4A 2VB2X 3SVMA 4HJAA 3E6ZX 1F9SA 4UPAA 1PH5A 1QOHA 3QG1A 4DAPA 1L2FA 2RDFA 3HGBA 2EY2A 4RHRA 4O0AA 3DMUA 4V0BA 2PMZE 2ZTCA 2NYZD 4LF9L 1WI5A 2A68C 2EJMA 3K57A 4A3BB 3PSIA 1Q81C 4A3IG 4RGMA 3K58A 3T1YL 1PDQA 1B53A 1R9TH 2EDGA 4NXML 1UEBA 2HHHQ 4XIGS 1B44D 1O80A 4H13C 2JYOA 4B3RL 4JI4L 2E75C 3D31A 3RUZA 3WWVA 2IW3A 2F0SA 1QILA 1SNCA 1SYDA 2Z6KC 4DPGA 4BY1G 1GXDC 1I4QA 3PIOA 4NKLA 4A3CH 1EWCA 4LF9Q 3K59A 4FF2A 4PZ6A 2L0CA 1JMCA 2L9HA 2HIVA 3T1YQ 1HNXL 4NXMQ 3MVVA 1SJED 5AFWA 4NMZA 4O42A 4A3MH 1PHJA 4B3RQ 2EXDA 3GP7A 4JI4Q 1GJXA 2B2YC 3FKIH 1KD1C 1H9SB 1CZGA 4X3KA 3RZDH 1E0BA 1MSHA 2C5CA 1N8RC 1SE8A 3FRPB 4LF7Q 3CQZB 1RODA 2DY7A 1X3FA 1IYUA 2ICEC 1AW7A 1M4VA 3AYHB 1EYDA 2AQ2B 3TDQA 3RN2A 3MXPA 1NAPA 1HQMC 1HJPA 1PTOB 4IO9A 5KNBA 1C0AA 2GVBA 5NUCA 5BN4A 4RHSA 1ENCA 2KCNA 1P16A 4MHEA 1X3PA 4CJ0B 2NZHA 5ISRA 3TRZA 3W5OA 1DM0B 3FVQA 1Z7TA 1KAWA 4B9WA 4QIWB 4NXNL 3G48A 2QEJC 2JE6I 4BBRB 1YJNA 3KLWA 4B3ML 1NTGA 2Z4IA 2NVXB 1EY5A 2JA6B 5ELCA 4OWXB 4IZ8A 4A93G 1CKNB 3V2TA 3DWQA 1FNUA 2PI2E 1D5MC 2PNHA 2K75A 4JV5L 2CW0C 2PCFB 3VYRA 3K5LA 2AUJD 3NWTA 2ATWA 3A7AB 4OO1I 4RCOA 4C1NK 1JICA 5GROA 3G71A 3F2BA 4K5VA 5EPJA 1J6QA 1ILQA 2JSOA 5JEAG 2KHIA 1B50A 1W6KA 2JA7B 4NXNQ 3MXNA 2A6ED 5JPNC 3CCEA 4B3MQ 4B08A 4A3KG 5G3LF 5CORA 1NR4A 3EQLC 3S17H 4JV5Q 4ODGA 4A3IH 3S15H 1HZAA 3IAYA 1R4PB 4DR6L 2MO0A 2G5DA 4F88A 2L1BA 2UUCQ 2F0FA 1SYFA 1X3QA 3CCQA 1JR0D 3HOYB 1XPOA 3S16B 4L6TB 3P1HA 5EPLA 3E0EA 1YJ9A 1IKLA 4CKBA 1EYAA 4H44C 1FVIA 4BY1B 1KLGD 2AQ1B 4BY7B 3NHHA 3VYSA 1OO9B 1VQ9A 4FF3A 4Y7NB 5KRUA 3N52A 2JN4A 2NVTB 2ALYB 1MJEA 4R4OA 4U673 4QCLA 1BCPF 4C3JH 3RLFA 2K50A 4QIWE 4DR6Q 3VDYA 3GTQB 2A1AA 1STEA 3K7AB 1Q12A 2X69A 3TP7A 4K5WA 4Q5VA 5DLQE 3GTKB 3PGZA 3I4MG 4MN3A 4PMBA 3JAML 4TKOB 2VQFL 1B2TA 2YV5A 1MIUA 2NTSA 1DJRD 3BJUA 1EQTA 1EWIA 3A54A 4ZKBB 1HUMA 3LX0A 4FP5D 1VMCA 3GTLH 2NBFA 1VQGA 5IY0A 4C3HB 1J5EQ 1PTOF 3S2HH 2FMCA 4J1MA 5JAVA 3I91A 1ENFA 1X3EA 1H9KA 1FGBD 3FEWX 3KOJA 3NTIA 2M00A 2BE5D 4NB3A 2PO4A 1WVLA 3MWYW 3OPOA 1HHVA 4ZLTF 2RF4A 5C4JH 1DCZA 3G4SA 1CSQA 1SYCA 3QR8A 3U4ZA 2VQFQ 4KKSA 2Z1CA 3NUCA 2XSCA 4LUOA 5E7NA 3M4OB 1TWHH 1YNJD 5I9OA 2A74C 1BCPC 1DOLA 5KNCA 3T4AC 4DV6L 3K6OA 3UI2A 2I5MX 3L2PA 1BUVT 2ZTEA 4P73A 5M5XH 3S1MB 3JAME 1JCKB 1FD7D 3KLSX 1JJGA 5M5WB 3F2CA 5JJZA 3TQYA 5C0XG 1VQOA 2HUGA 1BDOA 1UE6A 2QEXA 4R4IA 4DKAC 3P7JA 1PTOC 4ID6A 1IW7D 5FLXc 4NDXA 2EIFA 5JEAH 3TS2A 4A3DG 1YBYA 1BF4A 4DV6Q 4ZUJA 1K9MC 2HT1A 1EY0A 1KRTA 4ZUIA 1LUZA 1VQNA 4AYBG 4A3KH 1A15A 1E1TA 1IBLL 2DJFC 3ERSX 2E74C 2QW7A 3CXCA 3NBHB 3I70A 1IBKQ 5M5YB 1GUOA 2QF7A 5A2QL 2M9VA 5HGTA 1BO0A 4GOPB 3T56B 1WD0A 2F0VA 4GZYC 4C2MH 3NWSA 1NE3A 3QOLA 5AJ3Q 5CV7A 1DOMA 4CDDC 4QL5A 4DAVA 4WORA 1K83H 1S4ZA 2L5TA 3Q22A 1XTCD 2O4XA 3ZJYC 3NK9A 4JPBW 3J7ZC 5IE8A 1BXTA 5M9OA 1I4PA 1WTQA 5I6YA 1EEID 3MHBA 2C9OA 1C4QA 4CGYB 4HJ8A 3HOWB 3ND8A 4KN7C 4IPGA 4DF7A 3DM1A 2UXBL 2IHEA 1WCMB 3K5OA 3ER0A 3DEOA 3CCVA 3QB3A 1YNXA 5I6WA 1SMYD 1ET6A 1FYCA 1K8AC 1LT6D 5IGFA 1SN8A 4IALA 1EIHA 1F77A 3HKZG 3CPFA 1G6PA 1EY4A 1V1OA 3OIQA 3VR2A 3I4MH 4FDBA 1JT8A 2UUBL 2Q2HA 2FJ2A 2XN9C 5FO8B 4A3GG 1PRTB 1LM0A 1CFMA 2EPBA 2GA4B 4OL7A 2MHVA 1HA6A 4F8MA 4X65L 1NY4A 3E9HA 1I4HA 2UXBQ 4DR2Q 2CWPA 4LW1A 2GVAA 2NB0A 2B39A 2RSNA 4XYOA 3RR5A 3DHQA 3EJIA 4EGVA 3TSSA 5ELBA 4Z9CB 3PO3G 3HOUB 3PIP3 2EYLA 2VUMB 1M90C 1KNAA 2KECA 1UNSA 3T13A 3H3VI 2JA8B 3PF5A 1CKMA 1HCZA 4XQJA 1D6EC 2UUBQ 4HCEA 3GTGB 2B63H 3QIAA 1Q7YC 2K5NA 1RF2D 4DNIA 4KD4A 3VYUA 1LT4D 3M7GA 2HCIA 1OXUA 4X65Q 2PPBC 4DR4L 1IYJB 4KV6A 5COYA 2K14A 1TWAH 2LXJA 3A8KE 4CDCC 4ALPA 1TT2A 3TP6A 3AFPA 4BBSB 5C0XH 2I46A 4CDFC 2F0DA 4L5TA 3K7UC 2JEAI 3BVMA 4DNTB 4GOPA 1FR3A 3RZOH 3HOZB 3NTKA 5CYUA 4A3DH 3HKSA 3R2TA 4KJOA 2ZJRA 2WP8J 1OXXK 5LMNL 5IOCA 1SFOB 4DR4Q 3NBIA 1EY8A 2A6HC 4G4KA 3RNUA 5J39A 1XYIA 1QUQB 3NEMA 2YU9H 1ESFA 1XPRA 1VQKA 3OIPA 1E1OA 2QDLA 3I2ZA 5F2DA 4AIMA 2MQHA 3C1EA 4X64L 2Y0SG 3FHWA 3RMHA 3MFGA 4HCSA 1QNKA 2R92H 1KABA 3J7AF 4U68A 2VZAA 4DK6C 3PV0A 1S5DD 2MGSA 1NMGA 4I65A 2F03A 3SXHA 3NELA 5C3EB 2OQ0A 1K3RA 1BBUA 3H0GG 4DV0L 3UDXA 2K5QA 3FDTA 1N34Q 1SE4A 3HKZB 2KCCA 2F0IA 1RKNA 1JJ2A 3J81L 5IWAL 2R61A 2RDHA 4L63B 4LFAL 1UWVA 2E2IB 5CR3A 1TQOA 2QGQA 3MAQA 1WTVA 2K01A 4RCNA 1A3UA 4A3GH 4LF8L 2R7DA 1EZ6A 2KOLA 2LS01 2Z0SA 1EFWA 4A3BG 4DV0Q 3S2DB 2I0QA 2AHOB 1O7IA 4X3TA 3SR1A 2F0LA 3PMFA 1E2VA 2E5LL 2DUDA 4RGTA 3U9OA 5GADC 3GTOB 1U4MA 3PO3H 3MZ5A 1AH9A 4LFAQ 1PYSB 4HIDA 2L15A 5A35A 1SSOA 1VF5C 1CT1D 1TR5A 3G6JB 1C8CA 2QCPX 2WB1G 4KMUC 1XMOL 5D3DA 1OTCA 1AN8A 2KEEA 2OTLA 1V1PB 1L0WA 4WJ3M 3J81E 4LF8Q 2CH4W 1PVOA 4P72A 4JI2Q 2UU9Q 1B70B 3EA6A 1T5XD 2CFMA 1VQLA 2PZUA 2SOBA 5J22A 3O13A 1Y1VH 1XX8A 5CGKA 5L37A 1HXYD 3CRKC 3OW7A 2BH2A 3NQIA 1FGUA 1XMOQ 1B4OA 3BZCA 1A3VA 1ZKOA 3K0YA 5EBDA 1Q82C 3I72A 3HKZE 3IRBA 4J6HA 1XJVA 1STAA 1HPCA 2K04A 3OYYA 3TZDA 1D2BA 1T5EA 4QUFA 1ZXTA 2BH8A 1STBA 3EFXD 2KJXA 3TBIB 2A5HA 3TP8A 4HIKA 1PV4A 4KN4C 2A73B 1N36L 4NPSA 1TIID 2MO1A 4IJLA 2WIIB 1KLUD 1BNZA 5EAYA 5CBAE 1Q1BA 2PYKA 1CM9A 4L5QA 1JC7A 1GHKA 1F2ZA 1NCVA 2ID0A 4BBRG 4IFDG 3A55A 3W3AA 5GAGC 3EIVA 1I3QB 2JA6G 4OIKA 1MI2A 3J7A5 1U4RA 2HDLA 3L3OC 2EXZA 3BS1A 3QO2A 1MSGA 5IT9L 2WINB 2FMMA 1N36Q 4DR3L 3BU2A 4QB4A 2F0HA 1H9MA 3CW2C 2NN6G 1X55A 5E1FA 3CMAA 3L9AX 4A3FB 1KXLA 4N8FA 2JA7G 4JI6L 1HZBA 3E0JA 1WTHA 3PO2H 2YYZA 4IUNA 1ICWA 4JC0A 2NWGA 4R9WA 4UDUC 2A6EC 1QB5D 1WD1A 1STHA 4A3BH 4OHJA 4R4QA 3ZYYX 4HMIA 1EIFA 3U4VA 4GN5A 4DR3Q 3TN2A 2R7ZH 3D4DA 1EL0A 4K8IA 3HOYG 2WB1B 4FVMA 2HDMA 4BA2I 1GHJA 1LTTD 2BDNA 2F0WA 4IUVA 4DR1L 2D0PA 3X3NA 5IGDA 2ZJQA 4BY7G 4I7ZC 2RVLA 2Y0SE 4JI6Q 4LF7L 4HSPA 4DXFA 1QE6A 4DN4M 5IT9E 4OELB 2NUCA 1XMQL 2Z9HA 1PRTD 3Q6SA 3U50C 3M85A 1OXSC 1EQVA 2PW5A 3NPPA 1AFPA 2NZOA 4CBVA 3C2PA 2AWOA 4DR1Q 4JI7L 4PZ8A 4HTHA 1A63A 3BYYB 1W3SA 3SK4A 1BR9A 1NJIC 2XRQD 4HIOA 1DOKA 5JJKA 3BDOA 4C3IB 4AH6A 3G6EA 1XMQQ 3DEPA 1I94L 1MJCA 2RCFA 3CQZH 2F52A 2ZXOA 4KKUA 4C3HG 2I5LX 2B3GA 3E3XA 3CCUA 2QA4A 1PMRA 4J8QA 5CV5A 5D14A 1CTMA 2EYHA 4YIJA 5ELOA 1I4GA 1PTOH 1SNMA 3AB9A 4LUVA 4JYAQ 4JI0L 3IKJA 1RL2A 4EQNA 1HFGA 4JI7Q 3ND9A 5LMUL 3CP0A 2BE5C 1A8VA 2Z4HA 3KDFB 3UE0A 3S9WA 2PW7A 1C9OA 1F9QA 4XQQA 4A3EB 1I94Q 4KHPQ 4FXDA 2WB1E 5JJLA 4BBRH 4IFDH 4EX5A 3M4YA 1NNXA 1YNJC 3HFZB 2KHSA 1TS5A 2NVXH 1F2YA 4IUUA 2I5HA 2VS1A 2FFKB 2UUCL 4JI0Q 1UEAB 2KBNA 3F8TA 1XNRL 3A7LA 4YCWA 2IT1A 3D6WA 1G91A 3Q8DA 5LMUQ 4N9PA 4RGNA 5IYBG 2K32A 4JI5L 2PQEA 2NN6H 1HH2P 4WJ4A 3CCLA 1RDPD 5ELNA 5M3FB 2JA7H 1RCVD 1IW7C 5E4XA 1YIJA 3FPPA 3PIO3 2MFIA 2C35B 2PI2A 1T9HA 3M3YB 4GLAC 4DAMA 1Y8NB 2YTYA 4K0KQ 2ZM6L 4PMWA 1XNRQ 1A62A 4KTAA 1K3BC 1XNQQ 3KF6B 3DWAA 3AEVA 1LO5D 4UAIA 4PG3A 2OXPA 4JI5Q 1VS0A 1XXGA 3HOYH 1PZKD 3S16H 1EY6A 3KF8B 3UDIA 4IN3A 1B1ZA 4BY1H 2HD3A 4BY7H 5CMDA 1J5EL 3VR4A 1H9SA 4Y7NH 5C4ZA 1G291 1U5KA 1E2ZA 4G7OC 4JBWA 2OWOA 1SNPA 3NP8A 1PH6A 2UXDL 4KY7A 3HOWG 2ZM6Q 5FLMG 5EKKA 5DNFA 2AUKA 4OWTB 2JA5B 1WCMG 5CV6A 3GTQH 3RN5A 1SNQA 3K7AH 4C3JB 1JWMD 3LGJA 1A2UA 1SAPA 4UP9A 3HOVB 4K2LA 3GTKH 2WAQB 2Q8TA 3KUPA 1JORA 1SMYC 4MNOA 2RQXA 5FK9C 3BZDB 2H5XA 4DAYB 4JI3Q 2NVYB 2K28A 4ZYSA 2UXDQ 3EVQA 4C3HH 4YHHQ 5LHY1 4ME5A 1V9PA 4POGA 2ASBA 2E8GA 1OXTA 2Q8RE 1PYBA 3CMEA 4YCUA 4BS9A 1CKNA 2QKIC 3I4OA 5HGQA 3HOUG 1F9RA 1SMXA 2JEBI 4LJZC 4JK1C 2VUMG 2KENA 3K81C 1DYQA 2EY5A 2VW9A 1O7YA 1U9RA 3KBXA 2RBMA 2JA8G 1S5ED 4POFA 2B2WA 5C4JB 3M4OH 1OXVA 4DV5L 2MJ8A 5C5LA 4L5RC 1DONA 4KI0A 2NVQH 4HR7B 1JB3A 1B9MA 1D7QA 4A93H 1GUSA 2K1BA 1IBKL 1F2MA 2F0EA 1M1KC 2CCZA 4HAEA 3S1MH 3CPWA 1NMFA 1KTKA 3CRLC 3S1RB 5C4XB 1IKMA 5AJ3L 4BBSG 3S1QB 1IXRA 4CHTB 1KL9A 2E2HB 3FPUB 3RLNA 4CDEC 2M2LA 1H9RA 1I4XA 2I07B 4PNYA 4DV5Q 3X3MA 4LF5Q 3HOZG 1TWFH 3KF6A 5IYDG 1ICFB 4KLKA 3LWUA 3GTMB 2E76C 1NSNS 1GUWA 4O2DA 1HR0W 3KF8A 5KYIA 4FO2A 4FXGC 3J81j 4X62L 1SE3A 1J8IA 1FL0A 1RTNA 5JPMC 1IL2A 1PZID 3J7AV 2L11A 4R4CA 1X65A 3H09A 4FXKC 1SBBB 2B2WC 4MTKA 4K14A 1IBML 1KDAA 5M3MG 2F3IA 2AMCB 3NTHA 4YCVA 4Y52H 1HFNA 5BN5A 1SYGA 3J80L 5C3EG 1K83B 3BYTB 4DR2L 4X62Q 2H4OA 1Q3LA 3M9BA 2B2UA 4A3LG 5FLMH 3CF5A 5EJWA 2R93B 4IPDA 1K8GA 4UHVA 1WCMH 2B2VA 4X3UA 2QDBA 4JI1L 3MA2B 5A2QE 5EKIA 2RDGA 1AE2A 1GUGA 3A8JE 4DXGA 2F0UA 5EGTA 3FP9A 1II3A 1IBMQ 3GO5A 3F2DA 3WDNA 2PNRC 3QWNA 5I4DA 4IQZA 3UE1A 1VQMA 4HEDA 3MTSA 3D4RA 4JBMA 2F4VQ 1JE4A 1VDZA 1YHAA 1LTRD 2EYFA 2JA9A 3H3VC 4AQYL 1KNEA 4JI1Q 5K5PA 2R6GA 1NUCA 3LWEA 5H1SE 1F9PA 3HOUH 1BBXC 2J7ZA 3EN2A 2K7VA 1GO3E 3J80E 4DUZL 2OQKA 2VUMH 3KFUA 2RKSA 1KDCA 2J0TD 4OX9L 1UAPA 1A3TA 2JA8H 1A0IA 1U4PA 3GTGH 4DV4Q 3SK8A 4RGOS 3KLSA 4HMJA 4UP8A 5CV8A 1I50B 1MKHA 4ZKCB 3K0XA 1Q8KA 2B63B 3LNNA 1SYEA 3PUZA 4K5XA 3GTPB 4AQYQ 4DUYL 1LTGD 1VQ4A 4QY7A 3NBHA 2IPKD 4GLXA 2B2VC 1VQJA 3NSWA 4BBSH 4LFCQ 4DUZQ 1YNND 3BDCA 4DR5L 5I2XA 1S3OA 1U0LA 3I4LA 4OX9Q 3JAMi 2JXMB 5JEAJ 4YWLA 4EQPA 1JB7A 1M8AA 4OO1G 3MEHA 4XDXA 1HQRD 1VQHA 3HOZH 1VQIA 1TKWB 4PMCA 5BN3A 5DEHA 5IYDH 1LT3D 2K5VA 2YTVA 1C48A 3GTJH 2WACA 2R3ZA 3HEJA 3W2DA 1TY2A 1ILPA 1YVCA 1SFOH 1ESRA 1N34L 4DUYQ 1Y8PB 1IZ6A 2Q2IA 4LFBL 2F3WA 2ZTDA 4TRDA 3A5UA 1TWCB 4IUTA 3CC7A 1QJOA 4DR5Q 3R3OA 1XTDA 2HCCA 1STNA 3J81c 1WTRA 3S14B 2A69D 1CA6A 1N32Q 3M4PA 1K0SA 4KHZA 5M3MB 4ME3A 4LNQA 4K6DA 3EBEA 2FXQA 1E22A 3KJPA 4OWWB 5JJIA 1LABA 1BOSA 1BKBA 1LT5D 4QMGA 5EKLA 3Q0AA 4KHVA 1KC8C 4DA2A 4OXPA 2CKZB 2MUYA 2DJGC 5C3EH 4DK0A 1TS3A 4LFBQ 4A3LH 4QJFA 3OMCA 1Y69U 2Z8LA 2D5DA 3TP5A 2F0GA 1FNWA 2IJ0A 1PRTF 2IL8A 3SK6A 1K0RA 1WOCA 4GOPC 1MGSA 4A3FG 4LF6L 4JW0A 2E2IH 3HOXB 2F0OA 3I73A 2BCOA 2XNAC 5C44B 4A4IA 4DV1L 4K6LA 3VR5A 2MNAA 4JI2L 1AEXA 2UU9L 2A19A 1WTWA 2EE1A 1Y1WB 2K33A 2K5DA 3MC0B 1YHQA 1STYA 1VQEA 4YY3L 1EYGA 4YWKA 5IGCA 3S1NB 4DFAA 2IX1A 3V05A 3GTOH 1HNWL 1VQCA 1GUNA 3KK7A 4LF6Q 3OTOQ 4DV7L 1CSPA 1RTOA 2IY5B 2IHFA 1KIXA 1CA5A 1PH1A 1G6ZA 1L0XB 4DV1Q 3WOEA 2JQOA 2DN8A 4G7HC 1QZHA 4KD3A 4WRDA 3Q24A 1AZQA 2GN5A 4QF4A 2LMCB 4YWMA 1PRTC 4JCVE 1IHZA 1YHBA 4YY3Q 5C0XJ 4A3CG 1SYBA 1EZ8A 4FNFA 2KCMA 1RD9D 2VY3A 4XT3B 3KYHC 3DUZA 1HNWQ 3SEBA 1QUQA 3D4WA 1Y1VB 2PZWA 3MXUA 4DV7Q 1JOOA 1B3QA 4QQBX 2VXWA 3TMEA 5C3XA 4OO1H 1PFNA 4S3SA 4HJ5A 4C3IG 1S5BD 1UUPA 1X54A 4JG2A 4ZCKA 3I4NB 1LTBD 3BVZA 1D1IA 4KY5A 2PMZB 1I6HB 1X6OA 3CC2A 2E2JB 1CK1A 1X56A 4GKKL 5KYLA 2KVMA 3TREA 1ONLA 1EIGA 2NTTA 4JBJA 4M8AA 2UXCL 4OGQC 1GM5A 1JE5A 2PZTA 1X9NA 1KDBA 3URYA 2RHQB 2CQOA 1A6XA 1HZ9A 5FO9B 2H1EA 4A3EG 4ILWA 1KAAA 2HQEA 1QVFA 1CI3M 1G51A 4IPHA 3T16A 2EVBA 2BA1A 1DD2A 3OOCA 1I3QH 4GKKQ 3H0GH 2Z6KA 1EFID 4P75A 3IL8A 3L7ZC 1L1OB 2AQ3B 1CZWA 4DR7Q 1VF7A 2UXCQ 1K73C 4A3JB 5C0XI 5D65A 5D3IB 2B8FA 1A2TA 4APVA 1E2WA 1WJJA 1RIPA 3MEFA 1PFMA 2O2LD 1N33Q 1Q8IA 3BG3A 1TWGB 1DGSA 2G9HD 1Z9FA 1C7YA 1HTLD 1MBYA 4A3FH 1TXYA 1SRUA 4ZRZA 5M3FG 1R4QB 2RA4A 3PCOB 3S24A 1JOQA 1YI2A 2KA7A 2F4IA 1CHQD 1V1PA 3PO2B 4JI8L 5HY6A 2LKVA 4DV3L 1B8AA 3FMCA 3NXWA 4CJ2C 1SLJA 1R9TB 3ULPA 2Q2UA 1O78A 1QG7A 4KY6A 2ENBA 1QZGA 2V1CC 5KNDA 4XXEA 1HZCA 2ES2A 2R7ZB 3AQQA 3MXNB 4O1NA 3SGIA 5JVG3 1EQQA 1DZ1A 2SNSA 1GD7A 2JJQA 2B29A 4GS3A 4BXXG 4JI8Q 5JVH3 1I5FA 1X3GA 4RMFA 4DV3Q 4JYAL 3NENA 1PH8A 4LMQD 2JA5G 1VQ6A 2CVRA 4IURA 5GAEC 3SDZA 2LXKA 1CKOA 1CQVA 3A0JA 3J81i 4C3JG 5J3BA 4MIUA 4HJ7A 4GNXB 1UE1A 2EY1A 4A3MB 2OTJA 3HOVG 2WAQG 2X6LA 3FKIB 4P71A 4KHPL 1EYCA 1BCPB 2D9UA 3RZDB 1ZYRD 2D2CC 3Q23A 2DNEA 4C3IH 5CC4A 3V96A 1SJHD 2KQ3A 4OIJA 4LWCA 3N6RA 3D6CA 3VYTA 1QWYA 1WYDA 3T53B 4KKTA 3CCSA 4X66L 5KIXA 4JOIA 1EOVA 1ZEQX 3M4QA 1LACA 1HNXQ 4HN7A 1BVSA 1L1OA 3H6MA 2KCTA 3QOJA 4KJNA 3R2IA 5FO7B 5FKAC 1PH4A 1I6VC 3MXGA 4A3EH 4H0LC 5E4WC 3SE0A 1D1KA 2JA6H 1D8LA 1V8QA 1YZ6A 3MFYA 4G7ZC 4XYQA 5FOBB 1RHPA 4K0KL 1Y14B 2EOTA 2AWNA 3STBD 3VA5A 1XNQL 3B6YA 4X66Q 5KGUA 1CHPD 3A5ZB 1QVGA 5IIFA 1SDFA 3KBGA 5C4XG 2TSSA 2V4DA 4R4TA 2FINB 1JQYD 5DM73 5C6AA 3CHBD 4OONA 1ML0D 5LL6S 1PYWD 1CQFA 3I7FA 3DWPA 4C56C 5M3FH 5GAHC 1AE3A 1ASYA 1UE7A 2A68D 2VL6A 1V1QA 4CJ1B 4DK3C 2XIWA 2CWAA 2SDFA 2ICIA 3ONAB 5CV4A 3M3YH 3S17B 1S40A 1H95A 1V43A 1HTPA 1VQAA 3HP3A 1SEBD 4DU9A 1Z47A 1GVPA 4JOIC 4A3IB 4HIMA 1PH7A 3S15B 3ULLA 3DXJC 1QCBD 4WJWA 4XQNA 3JAMc 1L1OC 4IUPA 2VNUD 4ZK9B 3M7NA 5DM63 4JI3L 2DY8A
chains in the Genus database with same CATH topology
1S5CD 5J1ZA 4PQXA 4XT1B 3GV3A 1D5ZC 2B2TA 3PUYA 4CKCA 1RJTA 1LLRD 1D5XC 1VCIA 1SNOA 1EU4A 4RA8A 1SNDA 5I9PA 3H91A 4NP5A 1IYVA 3GTLB 2WV6D 4ZQ3A 5ELDA 2WKDA 3S2HB 3D8GA 4X3SA 3TZUA 1J9OA 3H94A 4RKBA 2BOSA 3AU7A 3BVGA 2TMPA 4IFDJ 1TWHB 1TU2B 5JOBA 4IUQA 2J4XA 1ET9A 4DGZA 2CW0D 1ENAA 2NVQB 5M5XB 2B2TC 4A93B 3ITPA 3R8BA 4FYDA 4P2CB 4FF4A 4PV1C 1AZPA 5IGBA 2EZVA 2CHBD 1HRJA 3I90A 4V190 4F7XA 4RFBA 1YNNC 2EYJA 4R8IA 3GD7A 2EYMA 2XWJB 1GUTA 1PLFA 1PFBA 1EY9A 3HG9A 2EYPA 1TWFB 4A3KB 1TVXA 2QILA 2K5WA 2N55A 4E6IA 4FF1A 3ERQA 1O7ZA 2K6AA 1IL8A 4C2MB 2NZ1D 2O5IC 3F2UA 3P20A 1SE2A 4L8JA 2E2DC 5FLXL 2A69C 4IFDI 3I3CA 2LY7A 2F0QA 3K5MA 4DAYA 2O5JC 3GQBA 3R93A 1L0YB 5T1GA 1G2SA 4Q0FA 2LFNA 1PZJD 4K8JA 1TY0A 1EEFD 2NN6I 3K5NA 5G3LD 5ELEA 3SK5A 3HZXA 2DNCA 2KEDA 3U9SA 3I4MB 2XWBB 3NQTA 2ZXPA 2F0TA 1BQQT 1FNVA 1EU3A 4XTCS 4BWGB 2KUMA 2OT2A 4ZAIA 2OF1A 4ULLA 2K05A 1AP0A 5IODA 5FLXE 5IGEA 3KLRA 4LK1C 5K36G 1BCPD 4G57A 4RAUC 1G8ZD 2BDOA 1X32A 5LL6X 2B2UC 4C1NI 1XWEA 4K2KA 1JWUD 2F0KA 1JWSD 1TWAB 3OMGA 1WTPA 1LTID 3T51B 1B9NA 2SEBD 2XVSA 5C5MA 1PTOD 3VR3A 1TS2A 2B8GA 3C3LA 4F87A 3SHLA 1EWHA 1VMPA 4TQUS 5TSSA 3RZOB 1GOZA 4A3DB 2EY6A 4H7BA 5EBCA 1S5FD 5IGGA 4AYBB 2RSOA 3IFDA 3GTJB 1G2TA 2YU9B 1WTOA 2K03A 3E5SA 3GV6A 4CKEA 3HS0C 2R92B 3VR6A 3D3RA 1O7LA 1JOKA 5KEEA 3C1FA 1Q1EA 4ABNA 3CKIB 3P75A 4LAAA 1MD2D 1Q90A 1W6JA 1EOTA 5C3WA 2L4NA 2N88A 1LV9A 3PUVA 3HRZC 1QNUA 3VA7A 5T1IA 1DXMA 1U4LA 2Q8IB 5CBEE 4N9TA 2D62A 2IX0A 4DNRB 1Z6HA 1HUNA 1I4RA 3OWFA 1LTAD 1K8MA 4KK7A 2F0PA 4A3GB 2VB3X 2F0JA 2IWHA 1Y8OB 1EY7A 1LTSD 2X6GA 4EQOA 5HURA 1HA5A 1K8OA 3PO3B 2FHTA 2EJGC 5DAUA 2ZT9C 5K36H 1SXTA 2F0NA 1B3AA 3G7LA 3NE5B 4DK1A 2SNMA 4NW2A 2EYOA 3OSOA 3C46A 3OHXC 4RH6A 4R8NA 2BA0A 3EROA 1F2LA 3RD4A 2CQAA 3IFTA 5EQ0A 4WFN3 5C4HA 3J7YW 4RWSC 3AMUA 2F3VA 4M1UB 4B9XA 2MPMA 2ZXRA 3OWEB 2OEOA 1ZYRC 2A6HD 2WKCA 2F1MA 1H9JA 2L55A 3A8IE 3WOFA 2IX3A 2EJFC 2JP1A 2DY8A 1TS4A 2F0MA 2G9DA 2Y0SB 3PUWA 3PUXA 2XRSD 2MP1A 4HSVA 4EVOA 5I2YA 3A56A 5E3FA 1NR2A 4BA1I 3CU7A 1PXUA 2L12A 3H0GB 3I8ZA 3BDLA 4RKLA 1STGA 4QUCA 3QJYA 1WTXA 5CV9A 5EPKA 5ELFA 4TSSA 2B2YA 2VB2X 3SVMA 3E6ZX 1F9SA 1QOHA 3QG1A 4DAPA 2RDFA 3HGBA 2EY2A 4RHRA 3DMUA 4V0BA 2NYZD 2A68C 2EJMA 3K57A 4A3BB 4RGMA 3K58A 1PDQA 1B53A 2EDGA 4XIGS 1B44D 1O80A 4H13C 2JYOA 2E75C 3D31A 3RUZA 2IW3A 2F0SA 1QILA 1SNCA 1SYDA 1GXDC 1I4QA 4NKLA 1EWCA 3K59A 4FF2A 2L0CA 2L9HA 3MVVA 1SJED 5AFWA 4NMZA 4O42A 3GP7A 1GJXA 2B2YC 1H9SB 1CZGA 4X3KA 1E0BA 1MSHA 2C5CA 3FRPB 3CQZB 1RODA 2DY7A 1IYUA 2ICEC 1AW7A 1M4VA 1EYDA 2AQ2B 3TDQA 3MXPA 1NAPA 1HQMC 1PTOB 5KNBA 5NUCA 5BN4A 4RHSA 1ENCA 2KCNA 4MHEA 1X3PA 4CJ0B 5ISRA 1DM0B 3FVQA 1Z7TA 4B9WA 4QIWB 2QEJC 2JE6I 4BBRB 2Z4IA 2NVXB 1EY5A 2JA6B 5ELCA 4IZ8A 3V2TA 3DWQA 1FNUA 1D5MC 2CW0C 2PCFB 3VYRA 3K5LA 2AUJD 3NWTA 3A7AB 4OO1I 4RCOA 4C1NK 1JICA 4K5VA 5EPJA 1ILQA 2JSOA 5JEAG 1B50A 1W6KA 2JA7B 3MXNA 2A6ED 5JPNC 4B08A 5G3LF 5CORA 1NR4A 3EQLC 4ODGA 3IAYA 1R4PB 4F88A 2L1BA 2F0FA 1SYFA 1X3QA 1JR0D 3HOYB 3S16B 4L6TB 3P1HA 5EPLA 1IKLA 4CKBA 1EYAA 4H44C 4BY1B 1KLGD 2AQ1B 4BY7B 3NHHA 3VYSA 1OO9B 4FF3A 4Y7NB 5KRUA 3N52A 2NVTB 4U673 4QCLA 1BCPF 3RLFA 3GTQB 1STEA 3K7AB 1Q12A 2X69A 3TP7A 4K5WA 4Q5VA 3GTKB 4MN3A 4PMBA 3JAML 4TKOB 1B2TA 2NTSA 1DJRD 1EQTA 4ZKBB 3A54A 1HUMA 3LX0A 4FP5D 1VMCA 2NBFA 4C3HB 1PTOF 2FMCA 4J1MA 5JAVA 3I91A 1ENFA 1H9KA 1FGBD 3FEWX 3NTIA 2M00A 2BE5D 2PO4A 1WVLA 3MWYW 3OPOA 1HHVA 4ZLTF 1DCZA 1SYCA 4KKSA 2Z1CA 3NUCA 2XSCA 3M4OB 1YNJD 5I9OA 2A74C 1BCPC 1DOLA 3T4AC 3K6OA 3UI2A 1BUVT 3S1MB 3JAME 1JCKB 1FD7D 3KLSX 5M5WB 5JJZA 5C0XG 2HUGA 1BDOA 3P7JA 1PTOC 4ID6A 1IW7D 4NDXA 5JEAH 1BF4A 4ZUJA 1EY0A 4ZUIA 1A15A 2E74C 3I70A 5M5YB 1GUOA 2QF7A 5A2QL 2M9VA 5HGTA 1BO0A 3T56B 1WD0A 2F0VA 4GZYC 3NWSA 3QOLA 5CV7A 1DOMA 4DAVA 4WORA 1S4ZA 2L5TA 3Q22A 1XTCD 2O4XA 3NK9A 1BXTA 5M9OA 1I4PA 1WTQA 5I6YA 1EEID 3MHBA 2C9OA 1C4QA 4CGYB 3HOWB 3ND8A 4KN7C 4DF7A 3DM1A 1WCMB 3K5OA 3DEOA 3QB3A 5I6WA 1SMYD 1ET6A 1FYCA 1LT6D 5IGFA 4IALA 1EIHA 1F77A 1EY4A 1V1OA 3OIQA 3VR2A 2FJ2A 2XN9C 5FO8B 1PRTB 1CFMA 2EPBA 2GA4B 4OL7A 2MHVA 1HA6A 4F8MA 1I4HA 2NB0A 2B39A 2RSNA 4XYOA 3DHQA 3EJIA 4EGVA 3TSSA 5ELBA 4Z9CB 3HOUB 3PIP3 2EYLA 2VUMB 1KNAA 2KECA 1UNSA 3T13A 2JA8B 1HCZA 4XQJA 1D6EC 4HCEA 3GTGB 3QIAA 1RF2D 4KD4A 3VYUA 1LT4D 3M7GA 2HCIA 1OXUA 2PPBC 4KV6A 5COYA 3A8KE 1TT2A 3TP6A 4BBSB 5C0XH 2I46A 2F0DA 2JEAI 3BVMA 4DNTB 1FR3A 3HOZB 3NTKA 5CYUA 3R2TA 4KJOA 2WP8J 1OXXK 5IOCA 1SFOB 3NBIA 1EY8A 2A6HC 4G4KA 5J39A 1XYIA 1ESFA 3OIPA 5F2DA 3C1EA 3RMHA 3MFGA 4HCSA 1QNKA 1KABA 3J7AF 4U68A 3PV0A 1S5DD 2MGSA 4I65A 2F03A 3SXHA 5C3EB 2K5QA 3FDTA 1SE4A 3HKZB 2KCCA 2F0IA 1RKNA 3J81L 2R61A 2RDHA 4L63B 2E2IB 5CR3A 1TQOA 3MAQA 1WTVA 2K01A 4RCNA 1A3UA 1EZ6A 2KOLA 2LS01 3S2DB 4X3TA 3SR1A 2F0LA 3PMFA 1E2VA 4RGTA 3U9OA 3GTOB 1U4MA 3MZ5A 5A35A 1SSOA 1VF5C 1CT1D 1TR5A 3G6JB 1C8CA 2QCPX 4KMUC 5D3DA 1AN8A 2KEEA 1V1PB 3J81E 3EA6A 1T5XD 2PZUA 2SOBA 5J22A 3O13A 1XX8A 5CGKA 1HXYD 3CRKC 3OW7A 3NQIA 1B4OA 1A3VA 1ZKOA 3K0YA 5EBDA 3I72A 4J6HA 1STAA 1HPCA 2K04A 3TZDA 1D2BA 1T5EA 4QUFA 1ZXTA 1STBA 3EFXD 2KJXA 3TBIB 2A5HA 3TP8A 4KN4C 2A73B 1TIID 2WIIB 1KLUD 1BNZA 5CBAE 1Q1BA 1CM9A 2PYKA 1JC7A 1GHKA 1F2ZA 1NCVA 2ID0A 4IFDG 3A55A 3W3AA 1I3QB 4OIKA 1MI2A 1U4RA 2HDLA 3L3OC 2EXZA 3BS1A 3QO2A 1MSGA 5IT9L 2WINB 2FMMA 4QB4A 2F0HA 1H9MA 2NN6G 5E1FA 3L9AX 4A3FB 3E0JA 2YYZA 4IUNA 1ICWA 2NWGA 4R9WA 4UDUC 2A6EC 1QB5D 1WD1A 1STHA 4OHJA 3ZYYX 4HMIA 3TN2A 3D4DA 1EL0A 4K8IA 2WB1B 4FVMA 2HDMA 4BA2I 1GHJA 1LTTD 2BDNA 2F0WA 4IUVA 3X3NA 5IGDA 4I7ZC 2RVLA 4HSPA 4DXFA 1QE6A 4DN4M 5IT9E 2NUCA 1PRTD 3Q6SA 3M85A 1OXSC 1EQVA 2PW5A 3NPPA 1AFPA 4CBVA 3C2PA 2AWOA 4HTHA 3BYYB 3SK4A 1BR9A 2XRQD 1DOKA 3BDOA 4C3IB 3DEPA 2ZXOA 4KKUA 4C3HG 1PMRA 4J8QA 5CV5A 5D14A 1CTMA 2EYHA 4YIJA 1I4GA 1PTOH 1SNMA 3AB9A 3IKJA 4EQNA 1HFGA 3ND9A 2BE5C 2Z4HA 3S9WA 2PW7A 1F9QA 4XQQA 4A3EB 4FXDA 4IFDH 3M4YA 1YNJC 2KHSA 1TS5A 1F2YA 4IUUA 2FFKB 1UEAB 3A7LA 2IT1A 3D6WA 1G91A 4N9PA 4RGNA 2K32A 2PQEA 2NN6H 1RDPD 5M3FB 1RCVD 1IW7C 5E4XA 3FPPA 3PIO3 3M3YB 1Y8NB 4PMWA 4KTAA 3DWAA 1LO5D 4UAIA 2OXPA 1XXGA 1PZKD 1EY6A 4IN3A 1B1ZA 5CMDA 3VR4A 1H9SA 5C4ZA 1G291 1E2ZA 4G7OC 4JBWA 1SNPA 3NP8A 4KY7A 5EKKA 5DNFA 2AUKA 2JA5B 5CV6A 1SNQA 4C3JB 1JWMD 1SAPA 1A2UA 3HOVB 4K2LA 2WAQB 2Q8TA 3KUPA 1JORA 1SMYC 2RQXA 5FK9C 3BZDB 2NVYB 2K28A 4ZYSA 3EVQA 5LHY1 4ME5A 1OXTA 2Q8RE 4BS9A 2QKIC 1F9RA 2JEBI 4LJZC 4JK1C 1DYQA 2EY5A 1O7YA 1U9RA 3KBXA 2RBMA 1S5ED 2B2WA 5C4JB 1OXVA 2MJ8A 5C5LA 1DONA 4KI0A 4HR7B 1JB3A 1B9MA 1GUSA 2K1BA 1F2MA 2F0EA 4HAEA 3CRLC 1KTKA 3S1RB 5C4XB 1IKMA 3S1QB 4CHTB 2E2HB 3FPUB 2M2LA 1H9RA 1I4XA 2I07B 4PNYA 3X3MA 3LWUA 3GTMB 2E76C 1NSNS 1GUWA 3KF8A 5KYIA 4FO2A 4FXGC 1SE3A 1J8IA 1RTNA 5JPMC 1PZID 3J7AV 2L11A 3H09A 4FXKC 1SBBB 2B2WC 4K14A 1KDAA 3NTHA 1HFNA 5BN5A 1SYGA 3J80L 1K83B 3BYTB 2H4OA 1Q3LA 2B2UA 5EJWA 2R93B 2B2VA 4X3UA 2QDBA 3MA2B 5A2QE 5EKIA 2RDGA 1GUGA 3A8JE 4DXGA 2F0UA 5EGTA 1II3A 3GO5A 3WDNA 2PNRC 3QWNA 5I4DA 4IQZA 4HEDA 3MTSA 3D4RA 1JE4A 1VDZA 2EYFA 1LTRD 3H3VC 1KNEA 5K5PA 2R6GA 1NUCA 3LWEA 1F9PA 1BBXC 2J7ZA 2K7VA 3J80E 2RKSA 1KDCA 2J0TD 1UAPA 1A3TA 1U4PA 3SK8A 4RGOS 3KLSA 4HMJA 5CV8A 1I50B 4ZKCB 2B63B 3LNNA 1SYEA 3PUZA 4K5XA 3GTPB 1LTGD 3NBHA 2IPKD 2B2VC 3NSWA 1YNND 3BDCA 5I2XA 3I4LA 2JXMB 5JEAJ 4EQPA 1M8AA 4OO1G 3MEHA 4XDXA 1HQRD 1TKWB 4PMCA 5BN3A 5DEHA 1LT3D 1C48A 2WACA 2R3ZA 3HEJA 3W2DA 1TY2A 1ILPA 1ESRA 1Y8PB 2F3WA 4TRDA 1TWCB 4IUTA 1QJOA 3R3OA 2HCCA 1STNA 1WTRA 3S14B 2A69D 1CA6A 4KHZA 5M3MB 4K6DA 1LABA 1BOSA 1LT5D 5EKLA 4QMGA 3Q0AA 4KHVA 4DA2A 2MUYA 4DK0A 1TS3A 1Y69U 3OMCA 2Z8LA 2D5DA 3TP5A 2F0GA 1FNWA 2IJ0A 1PRTF 2IL8A 3SK6A 1MGSA 3HOXB 2F0OA 3I73A 2BCOA 2XNAC 5C44B 4K6LA 3VR5A 1AEXA 1WTWA 2EE1A 1Y1WB 2K33A 2K5DA 3MC0B 1STYA 5IGCA 3S1NB 4DFAA 2IX1A 3V05A 1GUNA 3KK7A 1RTOA 1CA5A 1G6ZA 1L0XB 3WOEA 2DN8A 4G7HC 4KD3A 4WRDA 3Q24A 1AZQA 4QF4A 2LMCB 1PRTC 5C0XJ 1IHZA 1SYBA 1EZ8A 4FNFA 1RD9D 4XT3B 3DUZA 3SEBA 3D4WA 1Y1VB 2PZWA 3MXUA 1JOOA 2VXWA 3TMEA 5C3XA 4OO1H 1PFNA 4S3SA 4C3IG 1S5BD 1UUPA 3I4NB 1LTBD 3BVZA 1D1IA 4KY5A 2PMZB 1I6HB 2E2JB 1CK1A 5KYLA 2KVMA 1ONLA 1EIGA 2NTTA 4M8AA 4OGQC 2PZTA 1KDBA 3URYA 1A6XA 5FO9B 2H1EA 4ILWA 1KAAA 2HQEA 1CI3M 3T16A 2EVBA 2BA1A 1DD2A 3OOCA 1EFID 3IL8A 3L7ZC 2AQ3B 1CZWA 1VF7A 4A3JB 5C0XI 5D65A 5D3IB 2B8FA 1A2TA 1E2WA 1PFMA 2O2LD 1Q8IA 3BG3A 1TWGB 2G9HD 1HTLD 1MBYA 4ZRZA 1R4QB 2RA4A 1JOQA 2KA7A 2F4IA 1CHQD 1V1PA 3PO2B 2LKVA 3FMCA 3NXWA 4CJ2C 1R9TB 1O78A 1QG7A 4KY6A 2ENBA 5KNDA 4XXEA 2R7ZB 4O1NA 5JVG3 1DZ1A 2SNSA 5JVH3 4LMQD 2CVRA 4IURA 3SDZA 1CQVA 4C3JG 4MIUA 2EY1A 4A3MB 2X6LA 3FKIB 1EYCA 1BCPB 2D9UA 3RZDB 1ZYRD 2D2CC 3Q23A 2DNEA 5CC4A 3V96A 1SJHD 2KQ3A 4OIJA 3N6RA 3D6CA 3VYTA 1QWYA 3T53B 4KKTA 5KIXA 1ZEQX 1LACA 4HN7A 3H6MA 3QOJA 4KJNA 3R2IA 5FO7B 5FKAC 1I6VC 3MXGA 4H0LC 5E4WC 3SE0A 1D1KA 1V8QA 3MFYA 4G7ZC 4XYQA 5FOBB 1RHPA 2EOTA 2AWNA 3VA5A 5KGUA 1CHPD 5IIFA 1SDFA 3KBGA 2TSSA 2V4DA 2FINB 1JQYD 5DM73 5C6AA 3CHBD 5LL6S 1ML0D 1PYWD 1CQFA 3DWPA 4C56C 2A68D 4CJ1B 2XIWA 2SDFA 2ICIA 3ONAB 5CV4A 3S17B 1V43A 1HTPA 3HP3A 1SEBD 4DU9A 1Z47A 4A3IB 3S15B 3DXJC 1QCBD 4WJWA 4XQNA 4IUPA 2VNUD 4ZK9B 3M7NA 5DM63 5KNCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VR3 A;  2BE5 C;  2EDG A;  4KHZ A;  2BA0 A;  2B8G A;  1ONL A;  5JEA G;  4XIG S;  1EWH A;  4TQU S;  4RCN A;  1LAB A;  4H13 C;  2A6E D;  5K36 H;  4OGQ C;  1OXT A;  3IFT A;  2E75 C;  1GUG A;  1HCZ A;  2D2C C;  3A8J E;  2DNE A;  1H9M A;  3D31 A;  5C0X G;  3EQL C;  1A6X A;  3PUY A;  2O5I C;  4IFD H;  1BDO A;  3M4Y A;  2NN6 G;  3P20 A;  1YNJ C;  4L8J A;  3QIA A;  4DK0 A;  2JEB I;  4LJZ C;  3N6R A;  4JK1 C;  2A69 C;  1Y69 U;  1E2V A;  3WDN A;  2PNR C;  4IQZ A;  2D5D A;  1VCI A;  1IW7 D;  1OXU A;  2YYZ A;  2PPB C;  1CI3 M;  3A7L A;  3D4R A;  5JEA H;  2IT1 A;  2EVB A;  1OXV A;  2BA1 A;  3OOC A;  4KKT A;  3T53 B;  5A35 A;  1VF5 C;  2O5J C;  3A8K E;  1DD2 A;  4KI0 A;  2A6E C;  4KMU C;  1VDZ A;  3GQB A;  4HR7 B;  1LAC A;  2K32 A;  5C0X H;  3L7Z C;  1ZYR C;  1B9M A;  4H44 C;  3I73 A;  1GUS A;  1IYV A;  2NN6 H;  2E74 C;  2R6G A;  2A6H D;  1VF7 A;  1GUO A;  2QF7 A;  3VR6 A;  2K7V A;  3VR5 A;  2JEA I;  2B8F A;  2F1M A;  2NN6 I;  1GJX A;  1H9J A;  1O7L A;  1I6V C;  1E2W A;  4DNT B;  3A8I E;  1Q1E A;  3T56 B;  3CRL C;  1FR3 A;  1GHJ A;  1IW7 C;  4H0L C;  3SE0 A;  3FPP A;  1H9S B;  3TZU A;  4BA2 I;  4GZY C;  2K33 A;  2EJF C;  2DNC A;  3U9S A;  3BG3 A;  1V8Q A;  3MFY A;  4I7Z C;  1Q90 A;  3CRK C;  3RLF A;  4G7Z C;  1Y8N B;  3H94 A;  3OW7 A;  1OXX K;  3PUW A;  4XTC S;  3PUX A;  1IYU A;  1H9R A;  2L5T A;  3PUV A;  3VA7 A;  1Q12 A;  2A6H C;  1DXM A;  2Q8I B;  1GUN A;  3LNN A;  3M85 A;  2KA7 A;  2V4D A;  3PUZ A;  1ZKO A;  3LWU A;  2D62 A;  1OXS C;  2E76 C;  3I72 A;  1HQM C;  1TU2 B;  4DNR B;  1Z6H A;  4TKO B;  5KNB A;  3KLR A;  4LK1 C;  3ND8 A;  1HPC A;  4KN7 C;  2DN8 A;  3FMC A;  5BN4 A;  1T5E A;  4G7H C;  3I4L A;  2JXM B;  1K8M A;  1H9S A;  3VR4 A;  2AWO A;  4BA1 I;  1G29 1;  1O78 A;  1E2Z A;  5K36 G;  4OO1 G;  4G7O C;  4JBW A;  3PV0 A;  2LMC B;  1FYC A;  3QJY A;  1TKW B;  1Z7T A;  5BN3 A;  2A68 D;  1Y8O B;  1H9K A;  2BDO A;  3BDO A;  5KND A;  4PV1 C;  3VR2 A;  2BE5 D;  2AUK A;  2JE6 I;  4KN4 C;  1V43 A;  3OPO A;  1HTP A;  4KKU A;  1DCZ A;  3MXU A;  1YNN C;  1PMR A;  1Y8P B;  3GD7 A;  1K8O A;  3QG1 A;  1Q1B A;  1CTM A;  1GUT A;  1CFM A;  2CW0 C;  2EJG C;  2ZT9 C;  2PCF B;  3DXJ C;  2KCC A;  2AUJ D;  3HGB A;  4KKS A;  4OO1 H;  5BN5 A;  1GHK A;  1QJO A;  3NE5 B;  4IFD G;  3A7A B;  1SMY C;  3AB9 A;  3W3A A;  4DK1 A;  3IKJ A;  3M7N A;  2A69 D;  2A68 C;  3T51 B;  2EJM A;  3SDZ A;  1B9N A;  5KNC A;  3ND9 A; 
#chains in the Genus database with same CATH topology
 2NVT H;  1S5C D;  4YHH L;  4GNX A;  5J1Z A;  4PQX A;  1PH3 A;  3H3V H;  4XT1 B;  3GV3 A;  1E7Z A;  4BXX H;  1D5Z C;  1HR0 L;  4R1J A;  2R93 G;  2B2T A;  3PUY A;  1EQR A;  4CKC A;  2JA5 H;  1RJT A;  2JK8 A;  1LLR D;  1D5X C;  1VCI A;  1SNO A;  1EU4 A;  3HOV H;  3CCR A;  3KDF A;  2PQA B;  3F1Z A;  4RA8 A;  1SND A;  5I9P A;  3H91 A;  4NP5 A;  1IYV A;  2NVY H;  3GTL B;  2WV6 D;  2RCN A;  4ZQ3 A;  1E24 A;  2WKD A;  5ELD A;  3S2H B;  1S72 A;  1HR0 Q;  3D8G A;  4X3S A;  3TZU A;  2OCE A;  4L5S A;  1P8L A;  4A76 A;  1J9O A;  2D0O A;  3H94 A;  2N8N A;  4RKB A;  2BOS A;  1KRS A;  4LF5 L;  3AU7 A;  3BVG A;  2TMP A;  4IFD J;  1TWH B;  3CCM A;  1VQF A;  1TU2 B;  2XGT A;  4GNX C;  3CC4 A;  5JOB A;  4IUQ A;  2J4X A;  1ET9 A;  2B63 G;  4DGZ A;  5M5W H;  2CW0 D;  1ENA A;  4IJH A;  2NVQ B;  1JJC B;  1PA6 A;  5M5X B;  2B2T C;  4A93 B;  3S1R H;  1PH2 A;  3ITP A;  3R8B A;  5C4X H;  5IYB H;  4FYD A;  4MZ9 A;  4B3T L;  4P2C B;  4FF4 A;  3S1Q H;  4PV1 C;  1AZP A;  2DGY A;  3PIP A;  5IGB A;  2EZV A;  2CHB D;  2E2H H;  1YEZ A;  3I90 A;  3K80 C;  1HRJ A;  4V19 0;  4F7X A;  4RFB A;  1YNN C;  2EYJ A;  4R8I A;  2WAQ E;  3GD7 A;  2EYM A;  2XWJ B;  1GUT A;  1PLF A;  1PFB A;  1EY9 A;  3GTM H;  2K52 A;  3HG9 A;  4N8X 1;  3W1B A;  5M5Y H;  2EYP A;  1TWF B;  3J80 c;  4A3K B;  2N78 A;  1TVX A;  2QIL A;  2K5W A;  3TEH B;  4B3T Q;  2N55 A;  4E6I A;  4FF1 A;  3ERQ A;  1O7Z A;  2K6A A;  1IL8 A;  4C2M B;  2NZ1 D;  3A74 A;  2O5I C;  3F2U A;  3P20 A;  1SE2 A;  4L8J A;  2N49 A;  2E2D C;  3T1H L;  5FLX L;  2A69 C;  4IFD I;  3GDE A;  4I7A A;  3I3C A;  1VQ8 A;  4EQ5 A;  2LY7 A;  2F0Q A;  2R92 G;  3HOW H;  3K5M A;  2HIX A;  4DAY A;  2F4V L;  2O5J C;  2PQA A;  3GQB A;  3R93 A;  2K5H A;  2R93 H;  1L0Y B;  1IBL Q;  5T1G A;  3BZK A;  1G2S A;  4GN4 B;  4Q0F A;  2LFN A;  4A75 A;  1PZJ D;  4K8J A;  1TY0 A;  1EEF D;  1WFQ A;  3W1G A;  2NN6 I;  3K5N A;  5G3L D;  5IP9 G;  5ELE A;  3SK5 A;  2KHJ A;  3HZX A;  3H15 A;  1ASZ A;  2DNC A;  2XTI A;  5FJ8 G;  4DV4 L;  3T1H Q;  4B3S L;  1VQD A;  2KED A;  3CAM A;  3U9S A;  3HOX G;  3I4M B;  2XWB B;  3NQT A;  5C44 G;  2ZXP A;  2F0T A;  1BQQ T;  2R7F A;  1FNV A;  1EU3 A;  4XTC S;  4BWG B;  2KUM A;  2OT2 A;  3L0O A;  4ZAI A;  2OF1 A;  1Y1W G;  4ULL A;  2K05 A;  1AP0 A;  5IOD A;  1YIT A;  5FLX E;  1BBW A;  5IGE A;  3KLR A;  4LK1 C;  4LFC L;  1VQ7 A;  2HQL A;  3AFQ A;  2P5Z X;  5K36 G;  4B3S Q;  1BCP D;  4G57 A;  1QVC A;  4RAU C;  1G8Z D;  2BDO A;  1X32 A;  4MTN A;  5LL6 X;  4DV2 L;  2B2U C;  1I50 H;  4C1N I;  1KQS A;  1XWE A;  4K2K A;  4J15 A;  1JWU D;  2F0K A;  5IP7 G;  1JWS D;  3GTP H;  1TWA B;  3OMG A;  2ZJP A;  1WTP A;  1VQP A;  1N32 L;  1GKH A;  1LTI D;  3T51 B;  4GKJ L;  1B9N A;  2SEB D;  1Y1V G;  2XVS A;  5BR8 L;  5C5M A;  1PTO D;  3VR3 A;  1TS2 A;  2B8G A;  1LTL A;  3C3L A;  4F87 A;  4IOA A;  1LYL A;  1EWH A;  1VMP A;  3SHL A;  4TQU S;  1NBW A;  2Q2T A;  5TSS A;  3I4N G;  3RZO B;  4DV2 Q;  1GOZ A;  3PQI A;  4A3D B;  2EY6 A;  4H7B A;  5EBC A;  1S5F D;  4P74 A;  5IGG A;  4AYB B;  2RSO A;  3IFD A;  3GTJ B;  1HNZ L;  1G2T A;  4UY8 C;  2YTX A;  2YU9 B;  1TWC H;  1WTO A;  4GKJ Q;  5BR8 Q;  3U58 A;  3S14 H;  2K03 A;  5IYC G;  3ICE A;  3E5S A;  3GV6 A;  4CKE A;  3HS0 C;  2R92 B;  5M3M H;  4OEM B;  3VR6 A;  2N3S A;  3D3R A;  1O7L A;  1JOK A;  5KEE A;  3C1F A;  1Q1E A;  4ABN A;  3CKI B;  3P75 A;  4LAA A;  1MD2 D;  2EQS A;  4JBK A;  3KJO A;  1Q90 A;  4GLV B;  1HNZ Q;  1W6J A;  4A3J G;  1MHW C;  4IOC A;  1EOT A;  4QGU A;  5C3W A;  2L4N A;  2N88 A;  3DLL A;  5LMN Q;  1LV9 A;  3PUV A;  3HRZ C;  1QNU A;  1CUK A;  3VA7 A;  5T1I A;  1DXM A;  1U4L A;  2Q8I B;  5CBE E;  3CCJ A;  4N9T A;  3OTO L;  2D62 A;  2IX0 A;  5IP9 H;  4DNR B;  1Z6H A;  4JVZ A;  1PH9 A;  4X64 Q;  5FJ8 H;  1HUN A;  3HOX H;  2UUA L;  1I4R A;  3OWF A;  5C44 H;  3I55 A;  1LTA D;  1K8M A;  4KK7 A;  3UDG A;  2F0P A;  4IPC A;  3S2D H;  1Q86 C;  1N9W A;  3PO2 G;  3OW2 A;  4A3G B;  5GQO A;  2VB3 X;  1Y1W H;  4GN3 B;  2F0J A;  2IWH A;  1Y8O B;  2RHS B;  1EY7 A;  1LTS D;  2X6G A;  2Z6B A;  4EQO A;  3CD6 A;  3S1N H;  5HUR A;  1HA5 A;  4AYB E;  2CH4 A;  3DM3 A;  1K8O A;  3K8A A;  3PO3 B;  2FHT A;  2EJG C;  5DAU A;  2ZT9 C;  5K36 H;  1EIY B;  2R7Z G;  1SXT A;  2F0N A;  1B3A A;  3G7L A;  3NE5 B;  4DK1 A;  5IWA Q;  2UUA Q;  2K4K A;  1PFS A;  2SNM A;  4NW2 A;  3E9I A;  2EYO A;  3OSO A;  3C46 A;  5LMN W;  3OHX C;  3J80 i;  4RH6 A;  4R8N A;  2BA0 A;  1K28 A;  3ERO A;  3TS0 A;  1F2L A;  1UE5 A;  1FJG L;  3UDF A;  3RD4 A;  2CQA A;  5IP7 H;  3IFT A;  5EQ0 A;  4WFN 3;  1YJW A;  5C4H A;  2A8V A;  3J7Y W;  1VQ5 A;  4LF4 L;  4PZ7 A;  4RWS C;  4A3M G;  3JC6 6;  1W2B A;  3AMU A;  2F3V A;  4M1U B;  3FKI G;  4B9X A;  2E5L Q;  2VQE L;  4TVA B;  2MPM A;  1VQB A;  2ZXR A;  3OWE B;  1SR3 A;  2OEO A;  3I4N H;  1EUJ A;  1B7Y B;  1Q46 A;  2WFW A;  1I6H H;  1ZYR C;  2E2J H;  4DR7 L;  1KHI A;  2A6H D;  1FJG Q;  3RLO A;  2WKC A;  5IT9 c;  2F1M A;  1H9J A;  4H02 A;  2L55 A;  3A8I E;  3WOF A;  2IX3 A;  2LSS A;  4LF4 Q;  1N33 L;  2EJF C;  4RG1 A;  2JP1 A;  4LUZ A;  1TS4 A;  3D0F A;  2VQE Q;  2F0M A;  1SRO A;  2G9D A;  2Y0S B;  3PUW A;  3PUX A;  5IYC H;  1XPU A;  2XRS D;  4UP7 A;  2MP1 A;  4HSV A;  4EVO A;  2AKW B;  5I2Y A;  3A56 A;  4X6A H;  5E3F A;  1NR2 A;  4BA1 I;  4A3J H;  3CU7 A;  1PXU A;  2L12 A;  3I56 A;  3H0G B;  3I8Z A;  3BDL A;  4HJ9 A;  3ULJ A;  3STB C;  4RKL A;  1STG A;  4QUC A;  3QJY A;  1WTX A;  5CV9 A;  5EPK A;  2HHH L;  1E3P A;  5ELF A;  4TSS A;  1TWG H;  2B2Y A;  3PF4 A;  2VB2 X;  3SVM A;  4HJA A;  3E6Z X;  1F9S A;  4UPA A;  1PH5 A;  1QOH A;  3QG1 A;  4DAP A;  1L2F A;  2RDF A;  3HGB A;  2EY2 A;  4RHR A;  4O0A A;  3DMU A;  4V0B A;  2PMZ E;  2ZTC A;  2NYZ D;  4LF9 L;  1WI5 A;  2A68 C;  2EJM A;  3K57 A;  4A3B B;  3PSI A;  1Q81 C;  4A3I G;  4RGM A;  3K58 A;  3T1Y L;  1PDQ A;  1B53 A;  1R9T H;  2EDG A;  4NXM L;  1UEB A;  2HHH Q;  4XIG S;  1B44 D;  1O80 A;  4H13 C;  2JYO A;  4B3R L;  4JI4 L;  2E75 C;  3D31 A;  3RUZ A;  3WWV A;  2IW3 A;  2F0S A;  1QIL A;  1SNC A;  1SYD A;  2Z6K C;  4DPG A;  4BY1 G;  1GXD C;  1I4Q A;  3PIO A;  4NKL A;  4A3C H;  1EWC A;  4LF9 Q;  3K59 A;  4FF2 A;  4PZ6 A;  2L0C A;  1JMC A;  2L9H A;  2HIV A;  3T1Y Q;  1HNX L;  4NXM Q;  3MVV A;  1SJE D;  5AFW A;  4NMZ A;  4O42 A;  4A3M H;  1PHJ A;  4B3R Q;  2EXD A;  3GP7 A;  4JI4 Q;  1GJX A;  2B2Y C;  3FKI H;  1KD1 C;  1H9S B;  1CZG A;  4X3K A;  3RZD H;  1E0B A;  1MSH A;  2C5C A;  1N8R C;  1SE8 A;  3FRP B;  4LF7 Q;  3CQZ B;  1ROD A;  2DY7 A;  1X3F A;  1IYU A;  2ICE C;  1AW7 A;  1M4V A;  3AYH B;  1EYD A;  2AQ2 B;  3TDQ A;  3RN2 A;  3MXP A;  1NAP A;  1HQM C;  1HJP A;  1PTO B;  4IO9 A;  5KNB A;  1C0A A;  2GVB A;  5NUC A;  5BN4 A;  4RHS A;  1ENC A;  2KCN A;  1P16 A;  4MHE A;  1X3P A;  4CJ0 B;  2NZH A;  5ISR A;  3TRZ A;  3W5O A;  1DM0 B;  3FVQ A;  1Z7T A;  1KAW A;  4B9W A;  4QIW B;  4NXN L;  3G48 A;  2QEJ C;  2JE6 I;  4BBR B;  1YJN A;  3KLW A;  4B3M L;  1NTG A;  2Z4I A;  2NVX B;  1EY5 A;  2JA6 B;  5ELC A;  4OWX B;  4IZ8 A;  4A93 G;  1CKN B;  3V2T A;  3DWQ A;  1FNU A;  2PI2 E;  1D5M C;  2PNH A;  2K75 A;  4JV5 L;  2CW0 C;  2PCF B;  3VYR A;  3K5L A;  2AUJ D;  3NWT A;  2ATW A;  3A7A B;  4OO1 I;  4RCO A;  4C1N K;  1JIC A;  5GRO A;  3G71 A;  3F2B A;  4K5V A;  5EPJ A;  1J6Q A;  1ILQ A;  2JSO A;  5JEA G;  2KHI A;  1B50 A;  1W6K A;  2JA7 B;  4NXN Q;  3MXN A;  2A6E D;  5JPN C;  3CCE A;  4B3M Q;  4B08 A;  4A3K G;  5G3L F;  5COR A;  1NR4 A;  3EQL C;  3S17 H;  4JV5 Q;  4ODG A;  4A3I H;  3S15 H;  1HZA A;  3IAY A;  1R4P B;  4DR6 L;  2MO0 A;  2G5D A;  4F88 A;  2L1B A;  2UUC Q;  2F0F A;  1SYF A;  1X3Q A;  3CCQ A;  1JR0 D;  3HOY B;  1XPO A;  3S16 B;  4L6T B;  3P1H A;  5EPL A;  3E0E A;  1YJ9 A;  1IKL A;  4CKB A;  1EYA A;  4H44 C;  1FVI A;  4BY1 B;  1KLG D;  2AQ1 B;  4BY7 B;  3NHH A;  3VYS A;  1OO9 B;  1VQ9 A;  4FF3 A;  4Y7N B;  5KRU A;  3N52 A;  2JN4 A;  2NVT B;  2ALY B;  1MJE A;  4R4O A;  4U67 3;  4QCL A;  1BCP F;  4C3J H;  3RLF A;  2K50 A;  4QIW E;  4DR6 Q;  3VDY A;  3GTQ B;  2A1A A;  1STE A;  3K7A B;  1Q12 A;  2X69 A;  3TP7 A;  4K5W A;  4Q5V A;  5DLQ E;  3GTK B;  3PGZ A;  3I4M G;  4MN3 A;  4PMB A;  3JAM L;  4TKO B;  2VQF L;  1B2T A;  2YV5 A;  1MIU A;  2NTS A;  1DJR D;  3BJU A;  1EQT A;  1EWI A;  3A54 A;  4ZKB B;  1HUM A;  3LX0 A;  4FP5 D;  1VMC A;  3GTL H;  2NBF A;  1VQG A;  5IY0 A;  4C3H B;  1J5E Q;  1PTO F;  3S2H H;  2FMC A;  4J1M A;  5JAV A;  3I91 A;  1ENF A;  1X3E A;  1H9K A;  1FGB D;  3FEW X;  3KOJ A;  3NTI A;  2M00 A;  2BE5 D;  4NB3 A;  2PO4 A;  1WVL A;  3MWY W;  3OPO A;  1HHV A;  4ZLT F;  2RF4 A;  5C4J H;  1DCZ A;  3G4S A;  1CSQ A;  1SYC A;  3QR8 A;  3U4Z A;  2VQF Q;  4KKS A;  2Z1C A;  3NUC A;  2XSC A;  4LUO A;  5E7N A;  3M4O B;  1TWH H;  1YNJ D;  5I9O A;  2A74 C;  1BCP C;  1DOL A;  5KNC A;  3T4A C;  4DV6 L;  3K6O A;  3UI2 A;  2I5M X;  3L2P A;  1BUV T;  2ZTE A;  4P73 A;  5M5X H;  3S1M B;  3JAM E;  1JCK B;  1FD7 D;  3KLS X;  1JJG A;  5M5W B;  3F2C A;  5JJZ A;  3TQY A;  5C0X G;  1VQO A;  2HUG A;  1BDO A;  1UE6 A;  2QEX A;  4R4I A;  4DKA C;  3P7J A;  1PTO C;  4ID6 A;  1IW7 D;  5FLX c;  4NDX A;  2EIF A;  5JEA H;  3TS2 A;  4A3D G;  1YBY A;  1BF4 A;  4DV6 Q;  4ZUJ A;  1K9M C;  2HT1 A;  1EY0 A;  1KRT A;  4ZUI A;  1LUZ A;  1VQN A;  4AYB G;  4A3K H;  1A15 A;  1E1T A;  1IBL L;  2DJF C;  3ERS X;  2E74 C;  2QW7 A;  3CXC A;  3NBH B;  3I70 A;  1IBK Q;  5M5Y B;  1GUO A;  2QF7 A;  5A2Q L;  2M9V A;  5HGT A;  1BO0 A;  4GOP B;  3T56 B;  1WD0 A;  2F0V A;  4GZY C;  4C2M H;  3NWS A;  1NE3 A;  3QOL A;  5AJ3 Q;  5CV7 A;  1DOM A;  4CDD C;  4QL5 A;  4DAV A;  4WOR A;  1K83 H;  1S4Z A;  2L5T A;  3Q22 A;  1XTC D;  2O4X A;  3ZJY C;  3NK9 A;  4JPB W;  3J7Z C;  5IE8 A;  1BXT A;  5M9O A;  1I4P A;  1WTQ A;  5I6Y A;  1EEI D;  3MHB A;  2C9O A;  1C4Q A;  4CGY B;  4HJ8 A;  3HOW B;  3ND8 A;  4KN7 C;  4IPG A;  4DF7 A;  3DM1 A;  2UXB L;  2IHE A;  1WCM B;  3K5O A;  3ER0 A;  3DEO A;  3CCV A;  3QB3 A;  1YNX A;  5I6W A;  1SMY D;  1ET6 A;  1FYC A;  1K8A C;  1LT6 D;  5IGF A;  1SN8 A;  4IAL A;  1EIH A;  1F77 A;  3HKZ G;  3CPF A;  1G6P A;  1EY4 A;  1V1O A;  3OIQ A;  3VR2 A;  3I4M H;  4FDB A;  1JT8 A;  2UUB L;  2Q2H A;  2FJ2 A;  2XN9 C;  5FO8 B;  4A3G G;  1PRT B;  1LM0 A;  1CFM A;  2EPB A;  2GA4 B;  4OL7 A;  2MHV A;  1HA6 A;  4F8M A;  4X65 L;  1NY4 A;  3E9H A;  1I4H A;  2UXB Q;  4DR2 Q;  2CWP A;  4LW1 A;  2GVA A;  2NB0 A;  2B39 A;  2RSN A;  4XYO A;  3RR5 A;  3DHQ A;  3EJI A;  4EGV A;  3TSS A;  5ELB A;  4Z9C B;  3PO3 G;  3HOU B;  3PIP 3;  2EYL A;  2VUM B;  1M90 C;  1KNA A;  2KEC A;  1UNS A;  3T13 A;  3H3V I;  2JA8 B;  3PF5 A;  1CKM A;  1HCZ A;  4XQJ A;  1D6E C;  2UUB Q;  4HCE A;  3GTG B;  2B63 H;  3QIA A;  1Q7Y C;  2K5N A;  1RF2 D;  4DNI A;  4KD4 A;  3VYU A;  1LT4 D;  3M7G A;  2HCI A;  1OXU A;  4X65 Q;  2PPB C;  4DR4 L;  1IYJ B;  4KV6 A;  5COY A;  2K14 A;  1TWA H;  2LXJ A;  3A8K E;  4CDC C;  4ALP A;  1TT2 A;  3TP6 A;  3AFP A;  4BBS B;  5C0X H;  2I46 A;  4CDF C;  2F0D A;  4L5T A;  3K7U C;  2JEA I;  3BVM A;  4DNT B;  4GOP A;  1FR3 A;  3RZO H;  3HOZ B;  3NTK A;  5CYU A;  4A3D H;  3HKS A;  3R2T A;  4KJO A;  2ZJR A;  2WP8 J;  1OXX K;  5LMN L;  5IOC A;  1SFO B;  4DR4 Q;  3NBI A;  1EY8 A;  2A6H C;  4G4K A;  3RNU A;  5J39 A;  1XYI A;  1QUQ B;  3NEM A;  2YU9 H;  1ESF A;  1XPR A;  1VQK A;  3OIP A;  1E1O A;  2QDL A;  3I2Z A;  5F2D A;  4AIM A;  2MQH A;  3C1E A;  4X64 L;  2Y0S G;  3FHW A;  3RMH A;  3MFG A;  4HCS A;  1QNK A;  2R92 H;  1KAB A;  3J7A F;  4U68 A;  2VZA A;  4DK6 C;  3PV0 A;  1S5D D;  2MGS A;  1NMG A;  4I65 A;  2F03 A;  3SXH A;  3NEL A;  5C3E B;  2OQ0 A;  1K3R A;  1BBU A;  3H0G G;  4DV0 L;  3UDX A;  2K5Q A;  3FDT A;  1N34 Q;  1SE4 A;  3HKZ B;  2KCC A;  2F0I A;  1RKN A;  1JJ2 A;  3J81 L;  5IWA L;  2R61 A;  2RDH A;  4L63 B;  4LFA L;  1UWV A;  2E2I B;  5CR3 A;  1TQO A;  2QGQ A;  3MAQ A;  1WTV A;  2K01 A;  4RCN A;  1A3U A;  4A3G H;  4LF8 L;  2R7D A;  1EZ6 A;  2KOL A;  2LS0 1;  2Z0S A;  1EFW A;  4A3B G;  4DV0 Q;  3S2D B;  2I0Q A;  2AHO B;  1O7I A;  4X3T A;  3SR1 A;  2F0L A;  3PMF A;  1E2V A;  2E5L L;  2DUD A;  4RGT A;  3U9O A;  5GAD C;  3GTO B;  1U4M A;  3PO3 H;  3MZ5 A;  1AH9 A;  4LFA Q;  1PYS B;  4HID A;  2L15 A;  5A35 A;  1SSO A;  1VF5 C;  1CT1 D;  1TR5 A;  3G6J B;  1C8C A;  2QCP X;  2WB1 G;  4KMU C;  1XMO L;  5D3D A;  1OTC A;  1AN8 A;  2KEE A;  2OTL A;  1V1P B;  1L0W A;  4WJ3 M;  3J81 E;  4LF8 Q;  2CH4 W;  1PVO A;  4P72 A;  4JI2 Q;  2UU9 Q;  1B70 B;  3EA6 A;  1T5X D;  2CFM A;  1VQL A;  2PZU A;  2SOB A;  5J22 A;  3O13 A;  1Y1V H;  1XX8 A;  5CGK A;  5L37 A;  1HXY D;  3CRK C;  3OW7 A;  2BH2 A;  3NQI A;  1FGU A;  1XMO Q;  1B4O A;  3BZC A;  1A3V A;  1ZKO A;  3K0Y A;  5EBD A;  1Q82 C;  3I72 A;  3HKZ E;  3IRB A;  4J6H A;  1XJV A;  1STA A;  1HPC A;  2K04 A;  3OYY A;  3TZD A;  1D2B A;  1T5E A;  4QUF A;  1ZXT A;  2BH8 A;  1STB A;  3EFX D;  2KJX A;  3TBI B;  2A5H A;  3TP8 A;  4HIK A;  1PV4 A;  4KN4 C;  2A73 B;  1N36 L;  4NPS A;  1TII D;  2MO1 A;  4IJL A;  2WII B;  1KLU D;  1BNZ A;  5EAY A;  5CBA E;  1Q1B A;  2PYK A;  1CM9 A;  4L5Q A;  1JC7 A;  1GHK A;  1F2Z A;  1NCV A;  2ID0 A;  4BBR G;  4IFD G;  3A55 A;  3W3A A;  5GAG C;  3EIV A;  1I3Q B;  2JA6 G;  4OIK A;  1MI2 A;  3J7A 5;  1U4R A;  2HDL A;  3L3O C;  2EXZ A;  3BS1 A;  3QO2 A;  1MSG A;  5IT9 L;  2WIN B;  2FMM A;  1N36 Q;  4DR3 L;  3BU2 A;  4QB4 A;  2F0H A;  1H9M A;  3CW2 C;  2NN6 G;  1X55 A;  5E1F A;  3CMA A;  3L9A X;  4A3F B;  1KXL A;  4N8F A;  2JA7 G;  4JI6 L;  1HZB A;  3E0J A;  1WTH A;  3PO2 H;  2YYZ A;  4IUN A;  1ICW A;  4JC0 A;  2NWG A;  4R9W A;  4UDU C;  2A6E C;  1QB5 D;  1WD1 A;  1STH A;  4A3B H;  4OHJ A;  4R4Q A;  3ZYY X;  4HMI A;  1EIF A;  3U4V A;  4GN5 A;  4DR3 Q;  3TN2 A;  2R7Z H;  3D4D A;  1EL0 A;  4K8I A;  3HOY G;  2WB1 B;  4FVM A;  2HDM A;  4BA2 I;  1GHJ A;  1LTT D;  2BDN A;  2F0W A;  4IUV A;  4DR1 L;  2D0P A;  3X3N A;  5IGD A;  2ZJQ A;  4BY7 G;  4I7Z C;  2RVL A;  2Y0S E;  4JI6 Q;  4LF7 L;  4HSP A;  4DXF A;  1QE6 A;  4DN4 M;  5IT9 E;  4OEL B;  2NUC A;  1XMQ L;  2Z9H A;  1PRT D;  3Q6S A;  3U50 C;  3M85 A;  1OXS C;  1EQV A;  2PW5 A;  3NPP A;  1AFP A;  2NZO A;  4CBV A;  3C2P A;  2AWO A;  4DR1 Q;  4JI7 L;  4PZ8 A;  4HTH A;  1A63 A;  3BYY B;  1W3S A;  3SK4 A;  1BR9 A;  1NJI C;  2XRQ D;  4HIO A;  1DOK A;  5JJK A;  3BDO A;  4C3I B;  4AH6 A;  3G6E A;  1XMQ Q;  3DEP A;  1I94 L;  1MJC A;  2RCF A;  3CQZ H;  2F52 A;  2ZXO A;  4KKU A;  4C3H G;  2I5L X;  2B3G A;  3E3X A;  3CCU A;  2QA4 A;  1PMR A;  4J8Q A;  5CV5 A;  5D14 A;  1CTM A;  2EYH A;  4YIJ A;  5ELO A;  1I4G A;  1PTO H;  1SNM A;  3AB9 A;  4LUV A;  4JYA Q;  4JI0 L;  3IKJ A;  1RL2 A;  4EQN A;  1HFG A;  4JI7 Q;  3ND9 A;  5LMU L;  3CP0 A;  2BE5 C;  1A8V A;  2Z4H A;  3KDF B;  3UE0 A;  3S9W A;  2PW7 A;  1C9O A;  1F9Q A;  4XQQ A;  4A3E B;  1I94 Q;  4KHP Q;  4FXD A;  2WB1 E;  5JJL A;  4BBR H;  4IFD H;  4EX5 A;  3M4Y A;  1NNX A;  1YNJ C;  3HFZ B;  2KHS A;  1TS5 A;  2NVX H;  1F2Y A;  4IUU A;  2I5H A;  2VS1 A;  2FFK B;  2UUC L;  4JI0 Q;  1UEA B;  2KBN A;  3F8T A;  1XNR L;  3A7L A;  4YCW A;  2IT1 A;  3D6W A;  1G91 A;  3Q8D A;  5LMU Q;  4N9P A;  4RGN A;  5IYB G;  2K32 A;  4JI5 L;  2PQE A;  2NN6 H;  1HH2 P;  4WJ4 A;  3CCL A;  1RDP D;  5ELN A;  5M3F B;  2JA7 H;  1RCV D;  1IW7 C;  5E4X A;  1YIJ A;  3FPP A;  3PIO 3;  2MFI A;  2C35 B;  2PI2 A;  1T9H A;  3M3Y B;  4GLA C;  4DAM A;  1Y8N B;  2YTY A;  4K0K Q;  2ZM6 L;  4PMW A;  1XNR Q;  1A62 A;  4KTA A;  1K3B C;  1XNQ Q;  3KF6 B;  3DWA A;  3AEV A;  1LO5 D;  4UAI A;  4PG3 A;  2OXP A;  4JI5 Q;  1VS0 A;  1XXG A;  3HOY H;  1PZK D;  3S16 H;  1EY6 A;  3KF8 B;  3UDI A;  4IN3 A;  1B1Z A;  4BY1 H;  2HD3 A;  4BY7 H;  5CMD A;  1J5E L;  3VR4 A;  1H9S A;  4Y7N H;  5C4Z A;  1G29 1;  1U5K A;  1E2Z A;  4G7O C;  4JBW A;  2OWO A;  1SNP A;  3NP8 A;  1PH6 A;  2UXD L;  4KY7 A;  3HOW G;  2ZM6 Q;  5FLM G;  5EKK A;  5DNF A;  2AUK A;  4OWT B;  2JA5 B;  1WCM G;  5CV6 A;  3GTQ H;  3RN5 A;  1SNQ A;  3K7A H;  4C3J B;  1JWM D;  3LGJ A;  1A2U A;  1SAP A;  4UP9 A;  3HOV B;  4K2L A;  3GTK H;  2WAQ B;  2Q8T A;  3KUP A;  1JOR A;  1SMY C;  4MNO A;  2RQX A;  5FK9 C;  3BZD B;  2H5X A;  4DAY B;  4JI3 Q;  2NVY B;  2K28 A;  4ZYS A;  2UXD Q;  3EVQ A;  4C3H H;  4YHH Q;  5LHY 1;  4ME5 A;  1V9P A;  4POG A;  2ASB A;  2E8G A;  1OXT A;  2Q8R E;  1PYB A;  3CME A;  4YCU A;  4BS9 A;  1CKN A;  2QKI C;  3I4O A;  5HGQ A;  3HOU G;  1F9R A;  1SMX A;  2JEB I;  4LJZ C;  4JK1 C;  2VUM G;  2KEN A;  3K81 C;  1DYQ A;  2EY5 A;  2VW9 A;  1O7Y A;  1U9R A;  3KBX A;  2RBM A;  2JA8 G;  1S5E D;  4POF A;  2B2W A;  5C4J B;  3M4O H;  1OXV A;  4DV5 L;  2MJ8 A;  5C5L A;  4L5R C;  1DON A;  4KI0 A;  2NVQ H;  4HR7 B;  1JB3 A;  1B9M A;  1D7Q A;  4A93 H;  1GUS A;  2K1B A;  1IBK L;  1F2M A;  2F0E A;  1M1K C;  2CCZ A;  4HAE A;  3S1M H;  3CPW A;  1NMF A;  1KTK A;  3CRL C;  3S1R B;  5C4X B;  1IKM A;  5AJ3 L;  4BBS G;  3S1Q B;  1IXR A;  4CHT B;  1KL9 A;  2E2H B;  3FPU B;  3RLN A;  4CDE C;  2M2L A;  1H9R A;  1I4X A;  2I07 B;  4PNY A;  4DV5 Q;  3X3M A;  4LF5 Q;  3HOZ G;  1TWF H;  3KF6 A;  5IYD G;  1ICF B;  4KLK A;  3LWU A;  3GTM B;  2E76 C;  1NSN S;  1GUW A;  4O2D A;  1HR0 W;  3KF8 A;  5KYI A;  4FO2 A;  4FXG C;  3J81 j;  4X62 L;  1SE3 A;  1J8I A;  1FL0 A;  1RTN A;  5JPM C;  1IL2 A;  1PZI D;  3J7A V;  2L11 A;  4R4C A;  1X65 A;  3H09 A;  4FXK C;  1SBB B;  2B2W C;  4MTK A;  4K14 A;  1IBM L;  1KDA A;  5M3M G;  2F3I A;  2AMC B;  3NTH A;  4YCV A;  4Y52 H;  1HFN A;  5BN5 A;  1SYG A;  3J80 L;  5C3E G;  1K83 B;  3BYT B;  4DR2 L;  4X62 Q;  2H4O A;  1Q3L A;  3M9B A;  2B2U A;  4A3L G;  5FLM H;  3CF5 A;  5EJW A;  2R93 B;  4IPD A;  1K8G A;  4UHV A;  1WCM H;  2B2V A;  4X3U A;  2QDB A;  4JI1 L;  3MA2 B;  5A2Q E;  5EKI A;  2RDG A;  1AE2 A;  1GUG A;  3A8J E;  4DXG A;  2F0U A;  5EGT A;  3FP9 A;  1II3 A;  1IBM Q;  3GO5 A;  3F2D A;  3WDN A;  2PNR C;  3QWN A;  5I4D A;  4IQZ A;  3UE1 A;  1VQM A;  4HED A;  3MTS A;  3D4R A;  4JBM A;  2F4V Q;  1JE4 A;  1VDZ A;  1YHA A;  1LTR D;  2EYF A;  2JA9 A;  3H3V C;  4AQY L;  1KNE A;  4JI1 Q;  5K5P A;  2R6G A;  1NUC A;  3LWE A;  5H1S E;  1F9P A;  3HOU H;  1BBX C;  2J7Z A;  3EN2 A;  2K7V A;  1GO3 E;  3J80 E;  4DUZ L;  2OQK A;  2VUM H;  3KFU A;  2RKS A;  1KDC A;  2J0T D;  4OX9 L;  1UAP A;  1A3T A;  2JA8 H;  1A0I A;  1U4P A;  3GTG H;  4DV4 Q;  3SK8 A;  4RGO S;  3KLS A;  4HMJ A;  4UP8 A;  5CV8 A;  1I50 B;  1MKH A;  4ZKC B;  3K0X A;  1Q8K A;  2B63 B;  3LNN A;  1SYE A;  3PUZ A;  4K5X A;  3GTP B;  4AQY Q;  4DUY L;  1LTG D;  1VQ4 A;  4QY7 A;  3NBH A;  2IPK D;  4GLX A;  2B2V C;  1VQJ A;  3NSW A;  4BBS H;  4LFC Q;  4DUZ Q;  1YNN D;  3BDC A;  4DR5 L;  5I2X A;  1S3O A;  1U0L A;  3I4L A;  4OX9 Q;  3JAM i;  2JXM B;  5JEA J;  4YWL A;  4EQP A;  1JB7 A;  1M8A A;  4OO1 G;  3MEH A;  4XDX A;  1HQR D;  1VQH A;  3HOZ H;  1VQI A;  1TKW B;  4PMC A;  5BN3 A;  5DEH A;  5IYD H;  1LT3 D;  2K5V A;  2YTV A;  1C48 A;  3GTJ H;  2WAC A;  2R3Z A;  3HEJ A;  3W2D A;  1TY2 A;  1ILP A;  1YVC A;  1SFO H;  1ESR A;  1N34 L;  4DUY Q;  1Y8P B;  1IZ6 A;  2Q2I A;  4LFB L;  2F3W A;  2ZTD A;  4TRD A;  3A5U A;  1TWC B;  4IUT A;  3CC7 A;  1QJO A;  4DR5 Q;  3R3O A;  1XTD A;  2HCC A;  1STN A;  3J81 c;  1WTR A;  3S14 B;  2A69 D;  1CA6 A;  1N32 Q;  3M4P A;  1K0S A;  4KHZ A;  5M3M B;  4ME3 A;  4LNQ A;  4K6D A;  3EBE A;  2FXQ A;  1E22 A;  3KJP A;  4OWW B;  5JJI A;  1LAB A;  1BOS A;  1BKB A;  1LT5 D;  4QMG A;  5EKL A;  3Q0A A;  4KHV A;  1KC8 C;  4DA2 A;  4OXP A;  2CKZ B;  2MUY A;  2DJG C;  5C3E H;  4DK0 A;  1TS3 A;  4LFB Q;  4A3L H;  4QJF A;  3OMC A;  1Y69 U;  2Z8L A;  2D5D A;  3TP5 A;  2F0G A;  1FNW A;  2IJ0 A;  1PRT F;  2IL8 A;  3SK6 A;  1K0R A;  1WOC A;  4GOP C;  1MGS A;  4A3F G;  4LF6 L;  4JW0 A;  2E2I H;  3HOX B;  2F0O A;  3I73 A;  2BCO A;  2XNA C;  5C44 B;  4A4I A;  4DV1 L;  4K6L A;  3VR5 A;  2MNA A;  4JI2 L;  1AEX A;  2UU9 L;  2A19 A;  1WTW A;  2EE1 A;  1Y1W B;  2K33 A;  2K5D A;  3MC0 B;  1YHQ A;  1STY A;  1VQE A;  4YY3 L;  1EYG A;  4YWK A;  5IGC A;  3S1N B;  4DFA A;  2IX1 A;  3V05 A;  3GTO H;  1HNW L;  1VQC A;  1GUN A;  3KK7 A;  4LF6 Q;  3OTO Q;  4DV7 L;  1CSP A;  1RTO A;  2IY5 B;  2IHF A;  1KIX A;  1CA5 A;  1PH1 A;  1G6Z A;  1L0X B;  4DV1 Q;  3WOE A;  2JQO A;  2DN8 A;  4G7H C;  1QZH A;  4KD3 A;  4WRD A;  3Q24 A;  1AZQ A;  2GN5 A;  4QF4 A;  2LMC B;  4YWM A;  1PRT C;  4JCV E;  1IHZ A;  1YHB A;  4YY3 Q;  5C0X J;  4A3C G;  1SYB A;  1EZ8 A;  4FNF A;  2KCM A;  1RD9 D;  2VY3 A;  4XT3 B;  3KYH C;  3DUZ A;  1HNW Q;  3SEB A;  1QUQ A;  3D4W A;  1Y1V B;  2PZW A;  3MXU A;  4DV7 Q;  1JOO A;  1B3Q A;  4QQB X;  2VXW A;  3TME A;  5C3X A;  4OO1 H;  1PFN A;  4S3S A;  4HJ5 A;  4C3I G;  1S5B D;  1UUP A;  1X54 A;  4JG2 A;  4ZCK A;  3I4N B;  1LTB D;  3BVZ A;  1D1I A;  4KY5 A;  2PMZ B;  1I6H B;  1X6O A;  3CC2 A;  2E2J B;  1CK1 A;  1X56 A;  4GKK L;  5KYL A;  2KVM A;  3TRE A;  1ONL A;  1EIG A;  2NTT A;  4JBJ A;  4M8A A;  2UXC L;  4OGQ C;  1GM5 A;  1JE5 A;  2PZT A;  1X9N A;  1KDB A;  3URY A;  2RHQ B;  2CQO A;  1A6X A;  1HZ9 A;  5FO9 B;  2H1E A;  4A3E G;  4ILW A;  1KAA A;  2HQE A;  1QVF A;  1CI3 M;  1G51 A;  4IPH A;  3T16 A;  2EVB A;  2BA1 A;  1DD2 A;  3OOC A;  1I3Q H;  4GKK Q;  3H0G H;  2Z6K A;  1EFI D;  4P75 A;  3IL8 A;  3L7Z C;  1L1O B;  2AQ3 B;  1CZW A;  4DR7 Q;  1VF7 A;  2UXC Q;  1K73 C;  4A3J B;  5C0X I;  5D65 A;  5D3I B;  2B8F A;  1A2T A;  4APV A;  1E2W A;  1WJJ A;  1RIP A;  3MEF A;  1PFM A;  2O2L D;  1N33 Q;  1Q8I A;  3BG3 A;  1TWG B;  1DGS A;  2G9H D;  1Z9F A;  1C7Y A;  1HTL D;  1MBY A;  4A3F H;  1TXY A;  1SRU A;  4ZRZ A;  5M3F G;  1R4Q B;  2RA4 A;  3PCO B;  3S24 A;  1JOQ A;  1YI2 A;  2KA7 A;  2F4I A;  1CHQ D;  1V1P A;  3PO2 B;  4JI8 L;  5HY6 A;  2LKV A;  4DV3 L;  1B8A A;  3FMC A;  3NXW A;  4CJ2 C;  1SLJ A;  1R9T B;  3ULP A;  2Q2U A;  1O78 A;  1QG7 A;  4KY6 A;  2ENB A;  1QZG A;  2V1C C;  5KND A;  4XXE A;  1HZC A;  2ES2 A;  2R7Z B;  3AQQ A;  3MXN B;  4O1N A;  3SGI A;  5JVG 3;  1EQQ A;  1DZ1 A;  2SNS A;  1GD7 A;  2JJQ A;  2B29 A;  4GS3 A;  4BXX G;  4JI8 Q;  5JVH 3;  1I5F A;  1X3G A;  4RMF A;  4DV3 Q;  4JYA L;  3NEN A;  1PH8 A;  4LMQ D;  2JA5 G;  1VQ6 A;  2CVR A;  4IUR A;  5GAE C;  3SDZ A;  2LXK A;  1CKO A;  1CQV A;  3A0J A;  3J81 i;  4C3J G;  5J3B A;  4MIU A;  4HJ7 A;  4GNX B;  1UE1 A;  2EY1 A;  4A3M B;  2OTJ A;  3HOV G;  2WAQ G;  2X6L A;  3FKI B;  4P71 A;  4KHP L;  1EYC A;  1BCP B;  2D9U A;  3RZD B;  1ZYR D;  2D2C C;  3Q23 A;  2DNE A;  4C3I H;  5CC4 A;  3V96 A;  1SJH D;  2KQ3 A;  4OIJ A;  4LWC A;  3N6R A;  3D6C A;  3VYT A;  1QWY A;  1WYD A;  3T53 B;  4KKT A;  3CCS A;  4X66 L;  5KIX A;  4JOI A;  1EOV A;  1ZEQ X;  3M4Q A;  1LAC A;  1HNX Q;  4HN7 A;  1BVS A;  1L1O A;  3H6M A;  2KCT A;  3QOJ A;  4KJN A;  3R2I A;  5FO7 B;  5FKA C;  1PH4 A;  1I6V C;  3MXG A;  4A3E H;  4H0L C;  5E4W C;  3SE0 A;  1D1K A;  2JA6 H;  1D8L A;  1V8Q A;  1YZ6 A;  3MFY A;  4G7Z C;  4XYQ A;  5FOB B;  1RHP A;  4K0K L;  1Y14 B;  2EOT A;  2AWN A;  3STB D;  3VA5 A;  1XNQ L;  3B6Y A;  4X66 Q;  5KGU A;  1CHP D;  3A5Z B;  1QVG A;  5IIF A;  1SDF A;  3KBG A;  5C4X G;  2TSS A;  2V4D A;  4R4T A;  2FIN B;  1JQY D;  5DM7 3;  5C6A A;  3CHB D;  4OON A;  1ML0 D;  5LL6 S;  1PYW D;  1CQF A;  3I7F A;  3DWP A;  4C56 C;  5M3F H;  5GAH C;  1AE3 A;  1ASY A;  1UE7 A;  2A68 D;  2VL6 A;  1V1Q A;  4CJ1 B;  4DK3 C;  2XIW A;  2CWA A;  2SDF A;  2ICI A;  3ONA B;  5CV4 A;  3M3Y H;  3S17 B;  1S40 A;  1H95 A;  1V43 A;  1HTP A;  1VQA A;  3HP3 A;  1SEB D;  4DU9 A;  1Z47 A;  1GVP A;  4JOI C;  4A3I B;  4HIM A;  1PH7 A;  3S15 B;  3ULL A;  3DXJ C;  1QCB D;  4WJW A;  4XQN A;  3JAM c;  1L1O C;  4IUP A;  2VNU D;  4ZK9 B;  3M7N A;  5DM6 3;  4JI3 L;  2DY8 A; 
#chains in the Genus database with same CATH homology
 1S5C D;  5J1Z A;  4PQX A;  4XT1 B;  3GV3 A;  1D5Z C;  2B2T A;  3PUY A;  4CKC A;  1RJT A;  1LLR D;  1D5X C;  1VCI A;  1SNO A;  1EU4 A;  4RA8 A;  1SND A;  5I9P A;  3H91 A;  4NP5 A;  1IYV A;  3GTL B;  2WV6 D;  4ZQ3 A;  5ELD A;  2WKD A;  3S2H B;  3D8G A;  4X3S A;  3TZU A;  1J9O A;  3H94 A;  4RKB A;  2BOS A;  3AU7 A;  3BVG A;  2TMP A;  4IFD J;  1TWH B;  1TU2 B;  5JOB A;  4IUQ A;  2J4X A;  1ET9 A;  4DGZ A;  2CW0 D;  1ENA A;  2NVQ B;  5M5X B;  2B2T C;  4A93 B;  3ITP A;  3R8B A;  4FYD A;  4P2C B;  4FF4 A;  4PV1 C;  1AZP A;  5IGB A;  2EZV A;  2CHB D;  1HRJ A;  3I90 A;  4V19 0;  4F7X A;  4RFB A;  1YNN C;  2EYJ A;  4R8I A;  3GD7 A;  2EYM A;  2XWJ B;  1GUT A;  1PLF A;  1PFB A;  1EY9 A;  3HG9 A;  2EYP A;  1TWF B;  4A3K B;  1TVX A;  2QIL A;  2K5W A;  2N55 A;  4E6I A;  4FF1 A;  3ERQ A;  1O7Z A;  2K6A A;  1IL8 A;  4C2M B;  2NZ1 D;  2O5I C;  3F2U A;  3P20 A;  1SE2 A;  4L8J A;  2E2D C;  5FLX L;  2A69 C;  4IFD I;  3I3C A;  2LY7 A;  2F0Q A;  3K5M A;  4DAY A;  2O5J C;  3GQB A;  3R93 A;  1L0Y B;  5T1G A;  1G2S A;  4Q0F A;  2LFN A;  1PZJ D;  4K8J A;  1TY0 A;  1EEF D;  2NN6 I;  3K5N A;  5G3L D;  5ELE A;  3SK5 A;  3HZX A;  2DNC A;  2KED A;  3U9S A;  3I4M B;  2XWB B;  3NQT A;  2ZXP A;  2F0T A;  1BQQ T;  1FNV A;  1EU3 A;  4XTC S;  4BWG B;  2KUM A;  2OT2 A;  4ZAI A;  2OF1 A;  4ULL A;  2K05 A;  1AP0 A;  5IOD A;  5FLX E;  5IGE A;  3KLR A;  4LK1 C;  5K36 G;  1BCP D;  4G57 A;  4RAU C;  1G8Z D;  2BDO A;  1X32 A;  5LL6 X;  2B2U C;  4C1N I;  1XWE A;  4K2K A;  1JWU D;  2F0K A;  1JWS D;  1TWA B;  3OMG A;  1WTP A;  1LTI D;  3T51 B;  1B9N A;  2SEB D;  2XVS A;  5C5M A;  1PTO D;  3VR3 A;  1TS2 A;  2B8G A;  3C3L A;  4F87 A;  3SHL A;  1EWH A;  1VMP A;  4TQU S;  5TSS A;  3RZO B;  1GOZ A;  4A3D B;  2EY6 A;  4H7B A;  5EBC A;  1S5F D;  5IGG A;  4AYB B;  2RSO A;  3IFD A;  3GTJ B;  1G2T A;  2YU9 B;  1WTO A;  2K03 A;  3E5S A;  3GV6 A;  4CKE A;  3HS0 C;  2R92 B;  3VR6 A;  3D3R A;  1O7L A;  1JOK A;  5KEE A;  3C1F A;  1Q1E A;  4ABN A;  3CKI B;  3P75 A;  4LAA A;  1MD2 D;  1Q90 A;  1W6J A;  1EOT A;  5C3W A;  2L4N A;  2N88 A;  1LV9 A;  3PUV A;  3HRZ C;  1QNU A;  3VA7 A;  5T1I A;  1DXM A;  1U4L A;  2Q8I B;  5CBE E;  4N9T A;  2D62 A;  2IX0 A;  4DNR B;  1Z6H A;  1HUN A;  1I4R A;  3OWF A;  1LTA D;  1K8M A;  4KK7 A;  2F0P A;  4A3G B;  2VB3 X;  2F0J A;  2IWH A;  1Y8O B;  1EY7 A;  1LTS D;  2X6G A;  4EQO A;  5HUR A;  1HA5 A;  1K8O A;  3PO3 B;  2FHT A;  2EJG C;  5DAU A;  2ZT9 C;  5K36 H;  1SXT A;  2F0N A;  1B3A A;  3G7L A;  3NE5 B;  4DK1 A;  2SNM A;  4NW2 A;  2EYO A;  3OSO A;  3C46 A;  3OHX C;  4RH6 A;  4R8N A;  2BA0 A;  3ERO A;  1F2L A;  3RD4 A;  2CQA A;  3IFT A;  5EQ0 A;  4WFN 3;  5C4H A;  3J7Y W;  4RWS C;  3AMU A;  2F3V A;  4M1U B;  4B9X A;  2MPM A;  2ZXR A;  3OWE B;  2OEO A;  1ZYR C;  2A6H D;  2WKC A;  2F1M A;  1H9J A;  2L55 A;  3A8I E;  3WOF A;  2IX3 A;  2EJF C;  2JP1 A;  2DY8 A;  1TS4 A;  2F0M A;  2G9D A;  2Y0S B;  3PUW A;  3PUX A;  2XRS D;  2MP1 A;  4HSV A;  4EVO A;  5I2Y A;  3A56 A;  5E3F A;  1NR2 A;  4BA1 I;  3CU7 A;  1PXU A;  2L12 A;  3H0G B;  3I8Z A;  3BDL A;  4RKL A;  1STG A;  4QUC A;  3QJY A;  1WTX A;  5CV9 A;  5EPK A;  5ELF A;  4TSS A;  2B2Y A;  2VB2 X;  3SVM A;  3E6Z X;  1F9S A;  1QOH A;  3QG1 A;  4DAP A;  2RDF A;  3HGB A;  2EY2 A;  4RHR A;  3DMU A;  4V0B A;  2NYZ D;  2A68 C;  2EJM A;  3K57 A;  4A3B B;  4RGM A;  3K58 A;  1PDQ A;  1B53 A;  2EDG A;  4XIG S;  1B44 D;  1O80 A;  4H13 C;  2JYO A;  2E75 C;  3D31 A;  3RUZ A;  2IW3 A;  2F0S A;  1QIL A;  1SNC A;  1SYD A;  1GXD C;  1I4Q A;  4NKL A;  1EWC A;  3K59 A;  4FF2 A;  2L0C A;  2L9H A;  3MVV A;  1SJE D;  5AFW A;  4NMZ A;  4O42 A;  3GP7 A;  1GJX A;  2B2Y C;  1H9S B;  1CZG A;  4X3K A;  1E0B A;  1MSH A;  2C5C A;  3FRP B;  3CQZ B;  1ROD A;  2DY7 A;  1IYU A;  2ICE C;  1AW7 A;  1M4V A;  1EYD A;  2AQ2 B;  3TDQ A;  3MXP A;  1NAP A;  1HQM C;  1PTO B;  5KNB A;  5NUC A;  5BN4 A;  4RHS A;  1ENC A;  2KCN A;  4MHE A;  1X3P A;  4CJ0 B;  5ISR A;  1DM0 B;  3FVQ A;  1Z7T A;  4B9W A;  4QIW B;  2QEJ C;  2JE6 I;  4BBR B;  2Z4I A;  2NVX B;  1EY5 A;  2JA6 B;  5ELC A;  4IZ8 A;  3V2T A;  3DWQ A;  1FNU A;  1D5M C;  2CW0 C;  2PCF B;  3VYR A;  3K5L A;  2AUJ D;  3NWT A;  3A7A B;  4OO1 I;  4RCO A;  4C1N K;  1JIC A;  4K5V A;  5EPJ A;  1ILQ A;  2JSO A;  5JEA G;  1B50 A;  1W6K A;  2JA7 B;  3MXN A;  2A6E D;  5JPN C;  4B08 A;  5G3L F;  5COR A;  1NR4 A;  3EQL C;  4ODG A;  3IAY A;  1R4P B;  4F88 A;  2L1B A;  2F0F A;  1SYF A;  1X3Q A;  1JR0 D;  3HOY B;  3S16 B;  4L6T B;  3P1H A;  5EPL A;  1IKL A;  4CKB A;  1EYA A;  4H44 C;  4BY1 B;  1KLG D;  2AQ1 B;  4BY7 B;  3NHH A;  3VYS A;  1OO9 B;  4FF3 A;  4Y7N B;  5KRU A;  3N52 A;  2NVT B;  4U67 3;  4QCL A;  1BCP F;  3RLF A;  3GTQ B;  1STE A;  3K7A B;  1Q12 A;  2X69 A;  3TP7 A;  4K5W A;  4Q5V A;  3GTK B;  4MN3 A;  4PMB A;  3JAM L;  4TKO B;  1B2T A;  2NTS A;  1DJR D;  1EQT A;  4ZKB B;  3A54 A;  1HUM A;  3LX0 A;  4FP5 D;  1VMC A;  2NBF A;  4C3H B;  1PTO F;  2FMC A;  4J1M A;  5JAV A;  3I91 A;  1ENF A;  1H9K A;  1FGB D;  3FEW X;  3NTI A;  2M00 A;  2BE5 D;  2PO4 A;  1WVL A;  3MWY W;  3OPO A;  1HHV A;  4ZLT F;  1DCZ A;  1SYC A;  4KKS A;  2Z1C A;  3NUC A;  2XSC A;  3M4O B;  1YNJ D;  5I9O A;  2A74 C;  1BCP C;  1DOL A;  3T4A C;  3K6O A;  3UI2 A;  1BUV T;  3S1M B;  3JAM E;  1JCK B;  1FD7 D;  3KLS X;  5M5W B;  5JJZ A;  5C0X G;  2HUG A;  1BDO A;  3P7J A;  1PTO C;  4ID6 A;  1IW7 D;  4NDX A;  5JEA H;  1BF4 A;  4ZUJ A;  1EY0 A;  4ZUI A;  1A15 A;  2E74 C;  3I70 A;  5M5Y B;  1GUO A;  2QF7 A;  5A2Q L;  2M9V A;  5HGT A;  1BO0 A;  3T56 B;  1WD0 A;  2F0V A;  4GZY C;  3NWS A;  3QOL A;  5CV7 A;  1DOM A;  4DAV A;  4WOR A;  1S4Z A;  2L5T A;  3Q22 A;  1XTC D;  2O4X A;  3NK9 A;  1BXT A;  5M9O A;  1I4P A;  1WTQ A;  5I6Y A;  1EEI D;  3MHB A;  2C9O A;  1C4Q A;  4CGY B;  3HOW B;  3ND8 A;  4KN7 C;  4DF7 A;  3DM1 A;  1WCM B;  3K5O A;  3DEO A;  3QB3 A;  5I6W A;  1SMY D;  1ET6 A;  1FYC A;  1LT6 D;  5IGF A;  4IAL A;  1EIH A;  1F77 A;  1EY4 A;  1V1O A;  3OIQ A;  3VR2 A;  2FJ2 A;  2XN9 C;  5FO8 B;  1PRT B;  1CFM A;  2EPB A;  2GA4 B;  4OL7 A;  2MHV A;  1HA6 A;  4F8M A;  1I4H A;  2NB0 A;  2B39 A;  2RSN A;  4XYO A;  3DHQ A;  3EJI A;  4EGV A;  3TSS A;  5ELB A;  4Z9C B;  3HOU B;  3PIP 3;  2EYL A;  2VUM B;  1KNA A;  2KEC A;  1UNS A;  3T13 A;  2JA8 B;  1HCZ A;  4XQJ A;  1D6E C;  4HCE A;  3GTG B;  3QIA A;  1RF2 D;  4KD4 A;  3VYU A;  1LT4 D;  3M7G A;  2HCI A;  1OXU A;  2PPB C;  4KV6 A;  5COY A;  3A8K E;  1TT2 A;  3TP6 A;  4BBS B;  5C0X H;  2I46 A;  2F0D A;  2JEA I;  3BVM A;  4DNT B;  1FR3 A;  3HOZ B;  3NTK A;  5CYU A;  3R2T A;  4KJO A;  2WP8 J;  1OXX K;  5IOC A;  1SFO B;  3NBI A;  1EY8 A;  2A6H C;  4G4K A;  5J39 A;  1XYI A;  1ESF A;  3OIP A;  5F2D A;  3C1E A;  3RMH A;  3MFG A;  4HCS A;  1QNK A;  1KAB A;  3J7A F;  4U68 A;  3PV0 A;  1S5D D;  2MGS A;  4I65 A;  2F03 A;  3SXH A;  5C3E B;  2K5Q A;  3FDT A;  1SE4 A;  3HKZ B;  2KCC A;  2F0I A;  1RKN A;  3J81 L;  2R61 A;  2RDH A;  4L63 B;  2E2I B;  5CR3 A;  1TQO A;  3MAQ A;  1WTV A;  2K01 A;  4RCN A;  1A3U A;  1EZ6 A;  2KOL A;  2LS0 1;  3S2D B;  4X3T A;  3SR1 A;  2F0L A;  3PMF A;  1E2V A;  4RGT A;  3U9O A;  3GTO B;  1U4M A;  3MZ5 A;  5A35 A;  1SSO A;  1VF5 C;  1CT1 D;  1TR5 A;  3G6J B;  1C8C A;  2QCP X;  4KMU C;  5D3D A;  1AN8 A;  2KEE A;  1V1P B;  3J81 E;  3EA6 A;  1T5X D;  2PZU A;  2SOB A;  5J22 A;  3O13 A;  1XX8 A;  5CGK A;  1HXY D;  3CRK C;  3OW7 A;  3NQI A;  1B4O A;  1A3V A;  1ZKO A;  3K0Y A;  5EBD A;  3I72 A;  4J6H A;  1STA A;  1HPC A;  2K04 A;  3TZD A;  1D2B A;  1T5E A;  4QUF A;  1ZXT A;  1STB A;  3EFX D;  2KJX A;  3TBI B;  2A5H A;  3TP8 A;  4KN4 C;  2A73 B;  1TII D;  2WII B;  1KLU D;  1BNZ A;  5CBA E;  1Q1B A;  1CM9 A;  2PYK A;  1JC7 A;  1GHK A;  1F2Z A;  1NCV A;  2ID0 A;  4IFD G;  3A55 A;  3W3A A;  1I3Q B;  4OIK A;  1MI2 A;  1U4R A;  2HDL A;  3L3O C;  2EXZ A;  3BS1 A;  3QO2 A;  1MSG A;  5IT9 L;  2WIN B;  2FMM A;  4QB4 A;  2F0H A;  1H9M A;  2NN6 G;  5E1F A;  3L9A X;  4A3F B;  3E0J A;  2YYZ A;  4IUN A;  1ICW A;  2NWG A;  4R9W A;  4UDU C;  2A6E C;  1QB5 D;  1WD1 A;  1STH A;  4OHJ A;  3ZYY X;  4HMI A;  3TN2 A;  3D4D A;  1EL0 A;  4K8I A;  2WB1 B;  4FVM A;  2HDM A;  4BA2 I;  1GHJ A;  1LTT D;  2BDN A;  2F0W A;  4IUV A;  3X3N A;  5IGD A;  4I7Z C;  2RVL A;  4HSP A;  4DXF A;  1QE6 A;  4DN4 M;  5IT9 E;  2NUC A;  1PRT D;  3Q6S A;  3M85 A;  1OXS C;  1EQV A;  2PW5 A;  3NPP A;  1AFP A;  4CBV A;  3C2P A;  2AWO A;  4HTH A;  3BYY B;  3SK4 A;  1BR9 A;  2XRQ D;  1DOK A;  3BDO A;  4C3I B;  3DEP A;  2ZXO A;  4KKU A;  4C3H G;  1PMR A;  4J8Q A;  5CV5 A;  5D14 A;  1CTM A;  2EYH A;  4YIJ A;  1I4G A;  1PTO H;  1SNM A;  3AB9 A;  3IKJ A;  4EQN A;  1HFG A;  3ND9 A;  2BE5 C;  2Z4H A;  3S9W A;  2PW7 A;  1F9Q A;  4XQQ A;  4A3E B;  4FXD A;  4IFD H;  3M4Y A;  1YNJ C;  2KHS A;  1TS5 A;  1F2Y A;  4IUU A;  2FFK B;  1UEA B;  3A7L A;  2IT1 A;  3D6W A;  1G91 A;  4N9P A;  4RGN A;  2K32 A;  2PQE A;  2NN6 H;  1RDP D;  5M3F B;  1RCV D;  1IW7 C;  5E4X A;  3FPP A;  3PIO 3;  3M3Y B;  1Y8N B;  4PMW A;  4KTA A;  3DWA A;  1LO5 D;  4UAI A;  2OXP A;  1XXG A;  1PZK D;  1EY6 A;  4IN3 A;  1B1Z A;  5CMD A;  3VR4 A;  1H9S A;  5C4Z A;  1G29 1;  1E2Z A;  4G7O C;  4JBW A;  1SNP A;  3NP8 A;  4KY7 A;  5EKK A;  5DNF A;  2AUK A;  2JA5 B;  5CV6 A;  1SNQ A;  4C3J B;  1JWM D;  1SAP A;  1A2U A;  3HOV B;  4K2L A;  2WAQ B;  2Q8T A;  3KUP A;  1JOR A;  1SMY C;  2RQX A;  5FK9 C;  3BZD B;  2NVY B;  2K28 A;  4ZYS A;  3EVQ A;  5LHY 1;  4ME5 A;  1OXT A;  2Q8R E;  4BS9 A;  2QKI C;  1F9R A;  2JEB I;  4LJZ C;  4JK1 C;  1DYQ A;  2EY5 A;  1O7Y A;  1U9R A;  3KBX A;  2RBM A;  1S5E D;  2B2W A;  5C4J B;  1OXV A;  2MJ8 A;  5C5L A;  1DON A;  4KI0 A;  4HR7 B;  1JB3 A;  1B9M A;  1GUS A;  2K1B A;  1F2M A;  2F0E A;  4HAE A;  3CRL C;  1KTK A;  3S1R B;  5C4X B;  1IKM A;  3S1Q B;  4CHT B;  2E2H B;  3FPU B;  2M2L A;  1H9R A;  1I4X A;  2I07 B;  4PNY A;  3X3M A;  3LWU A;  3GTM B;  2E76 C;  1NSN S;  1GUW A;  3KF8 A;  5KYI A;  4FO2 A;  4FXG C;  1SE3 A;  1J8I A;  1RTN A;  5JPM C;  1PZI D;  3J7A V;  2L11 A;  3H09 A;  4FXK C;  1SBB B;  2B2W C;  4K14 A;  1KDA A;  3NTH A;  1HFN A;  5BN5 A;  1SYG A;  3J80 L;  1K83 B;  3BYT B;  2H4O A;  1Q3L A;  2B2U A;  5EJW A;  2R93 B;  2B2V A;  4X3U A;  2QDB A;  3MA2 B;  5A2Q E;  5EKI A;  2RDG A;  1GUG A;  3A8J E;  4DXG A;  2F0U A;  5EGT A;  1II3 A;  3GO5 A;  3WDN A;  2PNR C;  3QWN A;  5I4D A;  4IQZ A;  4HED A;  3MTS A;  3D4R A;  1JE4 A;  1VDZ A;  2EYF A;  1LTR D;  3H3V C;  1KNE A;  5K5P A;  2R6G A;  1NUC A;  3LWE A;  1F9P A;  1BBX C;  2J7Z A;  2K7V A;  3J80 E;  2RKS A;  1KDC A;  2J0T D;  1UAP A;  1A3T A;  1U4P A;  3SK8 A;  4RGO S;  3KLS A;  4HMJ A;  5CV8 A;  1I50 B;  4ZKC B;  2B63 B;  3LNN A;  1SYE A;  3PUZ A;  4K5X A;  3GTP B;  1LTG D;  3NBH A;  2IPK D;  2B2V C;  3NSW A;  1YNN D;  3BDC A;  5I2X A;  3I4L A;  2JXM B;  5JEA J;  4EQP A;  1M8A A;  4OO1 G;  3MEH A;  4XDX A;  1HQR D;  1TKW B;  4PMC A;  5BN3 A;  5DEH A;  1LT3 D;  1C48 A;  2WAC A;  2R3Z A;  3HEJ A;  3W2D A;  1TY2 A;  1ILP A;  1ESR A;  1Y8P B;  2F3W A;  4TRD A;  1TWC B;  4IUT A;  1QJO A;  3R3O A;  2HCC A;  1STN A;  1WTR A;  3S14 B;  2A69 D;  1CA6 A;  4KHZ A;  5M3M B;  4K6D A;  1LAB A;  1BOS A;  1LT5 D;  5EKL A;  4QMG A;  3Q0A A;  4KHV A;  4DA2 A;  2MUY A;  4DK0 A;  1TS3 A;  1Y69 U;  3OMC A;  2Z8L A;  2D5D A;  3TP5 A;  2F0G A;  1FNW A;  2IJ0 A;  1PRT F;  2IL8 A;  3SK6 A;  1MGS A;  3HOX B;  2F0O A;  3I73 A;  2BCO A;  2XNA C;  5C44 B;  4K6L A;  3VR5 A;  1AEX A;  1WTW A;  2EE1 A;  1Y1W B;  2K33 A;  2K5D A;  3MC0 B;  1STY A;  5IGC A;  3S1N B;  4DFA A;  2IX1 A;  3V05 A;  1GUN A;  3KK7 A;  1RTO A;  1CA5 A;  1G6Z A;  1L0X B;  3WOE A;  2DN8 A;  4G7H C;  4KD3 A;  4WRD A;  3Q24 A;  1AZQ A;  4QF4 A;  2LMC B;  1PRT C;  5C0X J;  1IHZ A;  1SYB A;  1EZ8 A;  4FNF A;  1RD9 D;  4XT3 B;  3DUZ A;  3SEB A;  3D4W A;  1Y1V B;  2PZW A;  3MXU A;  1JOO A;  2VXW A;  3TME A;  5C3X A;  4OO1 H;  1PFN A;  4S3S A;  4C3I G;  1S5B D;  1UUP A;  3I4N B;  1LTB D;  3BVZ A;  1D1I A;  4KY5 A;  2PMZ B;  1I6H B;  2E2J B;  1CK1 A;  5KYL A;  2KVM A;  1ONL A;  1EIG A;  2NTT A;  4M8A A;  4OGQ C;  2PZT A;  1KDB A;  3URY A;  1A6X A;  5FO9 B;  2H1E A;  4ILW A;  1KAA A;  2HQE A;  1CI3 M;  3T16 A;  2EVB A;  2BA1 A;  1DD2 A;  3OOC A;  1EFI D;  3IL8 A;  3L7Z C;  2AQ3 B;  1CZW A;  1VF7 A;  4A3J B;  5C0X I;  5D65 A;  5D3I B;  2B8F A;  1A2T A;  1E2W A;  1PFM A;  2O2L D;  1Q8I A;  3BG3 A;  1TWG B;  2G9H D;  1HTL D;  1MBY A;  4ZRZ A;  1R4Q B;  2RA4 A;  1JOQ A;  2KA7 A;  2F4I A;  1CHQ D;  1V1P A;  3PO2 B;  2LKV A;  3FMC A;  3NXW A;  4CJ2 C;  1R9T B;  1O78 A;  1QG7 A;  4KY6 A;  2ENB A;  5KND A;  4XXE A;  2R7Z B;  4O1N A;  5JVG 3;  1DZ1 A;  2SNS A;  5JVH 3;  4LMQ D;  2CVR A;  4IUR A;  3SDZ A;  1CQV A;  4C3J G;  4MIU A;  2EY1 A;  4A3M B;  2X6L A;  3FKI B;  1EYC A;  1BCP B;  2D9U A;  3RZD B;  1ZYR D;  2D2C C;  3Q23 A;  2DNE A;  5CC4 A;  3V96 A;  1SJH D;  2KQ3 A;  4OIJ A;  3N6R A;  3D6C A;  3VYT A;  1QWY A;  3T53 B;  4KKT A;  5KIX A;  1ZEQ X;  1LAC A;  4HN7 A;  3H6M A;  3QOJ A;  4KJN A;  3R2I A;  5FO7 B;  5FKA C;  1I6V C;  3MXG A;  4H0L C;  5E4W C;  3SE0 A;  1D1K A;  1V8Q A;  3MFY A;  4G7Z C;  4XYQ A;  5FOB B;  1RHP A;  2EOT A;  2AWN A;  3VA5 A;  5KGU A;  1CHP D;  5IIF A;  1SDF A;  3KBG A;  2TSS A;  2V4D A;  2FIN B;  1JQY D;  5DM7 3;  5C6A A;  3CHB D;  5LL6 S;  1ML0 D;  1PYW D;  1CQF A;  3DWP A;  4C56 C;  2A68 D;  4CJ1 B;  2XIW A;  2SDF A;  2ICI A;  3ONA B;  5CV4 A;  3S17 B;  1V43 A;  1HTP A;  3HP3 A;  1SEB D;  4DU9 A;  1Z47 A;  4A3I B;  3S15 B;  3DXJ C;  1QCB D;  4WJW A;  4XQN A;  4IUP A;  2VNU D;  4ZK9 B;  3M7N A;  5DM6 3;  5KNC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...