3D4DA

Crystal structure of staphylococcal nuclease variant delta+phs y91e at cryogenic temperature
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAEIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS Y91E at cryogenic temperature.
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 32
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2008-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3d4dA00
4KD4A 4KJNA 5JOBA 3SK6A 3EROA 5C4ZA 4TRDA 2F0DA 1STBA 2PZTA 1IHZA 2PW7A 4QMGA 5F2DA 2PQEA 5C3XA 3H6MA 4EQOA 1A3TA 1SYDA 2EYLA 3HZXA 3D4DA 2F0QA 5CV7A 3R3OA 1KDBA 4RKLA 2SNSA 2F0MA 2F0LA 1NUCA 2HQEA 4ID6A 2F0PA 1SNMA 2O4XA 4KY7A 3SK4A 2WACA 3PMFA 4KJOA 5CC4A 1STNA 3QOLA 5IGBA 2EXZA 1EY6A 3BDLA 4WORA 3DMUA 5CV4A 4S3SA 5CV5A 5EKKA 5M9OA 3BDCA 2PW5A 3MHBA 3OMGA 2F0GA 2F0JA 2EYHA 4IALA 4K2KA 4ZQ3A 1EY4A 5KRUA 5E1FA 2KHSA 3P1HA 4EVOA 5IGGA 2F0FA 3OSOA 2EY6A 5HURA 4HTHA 5C3WA 2EYFA 1SYCA 2OEOA 1SYBA 4QF4A 2F0HA 2OXPA 5IGDA 2F0OA 1TT2A 1F2MA 3C1FA 3TMEA 3EVQA 2RDFA 4YIJA 4MIUA 5EGTA 5IOCA 3EJIA 1ENAA 4H7BA 1ENCA 1EYDA 1RKNA 3QB3A 4K8JA 5DEHA 1EY7A 4LAAA 4E6IA 4IUNA 1A3VA 3NK9A 5EKLA 4K5WA 5CGKA 1SNOA 1F2ZA 2EY2A 4ME5A 3TP8A 3NXWA 3NHHA 4ZUIA 4DU9A 2F0IA 4R8NA 2F0UA 1U9RA 2PYKA 1II3A 4K5VA 4KTAA 5KGUA 4KHVA 3MXPA 1SYEA 1SNPA 4K14A 4KY6A 1AEXA 2QDBA 3E5SA 5NUCA 3RUZA 4ZUJA 3D4WA 4B9XA 5I6YA 5IGCA 5E3FA 3OMCA 5I9PA 1SNCA 2M00A 4N9TA 5I6WA 5C6AA 3SK8A 2F0TA 1JORA 3VA5A 3SK5A 2F0VA 3DHQA 3V2TA 4DF7A 5IGEA 2F3WA 1SNDA 1A2TA 1STHA 3C1EA 5IIFA 2F3VA 5DAUA 1EYCA 3SHLA 5C5MA 3OWFA 1STGA 2LKVA 1EY5A 4RKBA 4NP5A 2NUCA 3NUCA 5C5LA 3TP6A 1EY8A 4EQNA 1SYGA 4HMIA 5C4HA 5KYLA 3SR1A 3S9WA 5J39A 2EYMA 3U9OA 4QB4A 4N9PA 3D8GA 4IZ8A 1EZ6A 3HEJA 4NDXA 2ENBA 3ITPA 3SXHA 1EZ8A 2OF1A 5KYIA 4DGZA 2RKSA 4F7XA 3MEHA 4PMBA 1TQOA 2F0WA 3NP8A 1EY0A 3TP7A 5K5PA 1NSNS 1JOKA 2PZWA 1STYA 5IODA 3P75A 3MVVA 3T13A 1KDCA 1JOOA 4NMZA 4K8IA 1A3UA 4K5XA 1KABA 1SNQA 1TR5A 2EYPA 3MZ5A 4DFAA 1JOQA 4G57A 5KIXA 2EY1A 4OL7A 5I9OA 5ISRA 1KDAA 3QOJA 5IGFA 2PZUA 2EYJA 3ERQA 2F0EA 4B9WA 4WRDA 3TP5A 4HMJA 2F0KA 4K6DA 4K2LA 4PMCA 4F8MA 5HGTA 5CR3A 3LX0A 4KY5A 1EY9A 4I65A 2EY5A 2SNMA 2SOBA 4J1MA 5CV8A 5J22A 2EYOA 2KQ3A 4NKLA 4PNYA 2F0NA 4KV6A 5KEEA 1SYFA 1EQVA 5JAVA 3NQTA 4KD3A 1F2YA 5CV6A 1EYAA 4ODGA 3T16A 5CV9A 4EQPA 3D6CA 4J6HA 1STAA 5J1ZA 1KAAA 2F0SA 2RBMA 1A2UA
chains in the Genus database with same CATH superfamily
5IY0A 2MFIA 4JPBW 1N34L 5F2DA 1VQLA 2E75C 5M5YB 4GKJL 1SYDA 1C0AA 1KLUD 2SNSA 4X66L 4ID6A 4LF6Q 3PO3B 1B4OA 4XQJA 1D5XC 5LMNW 3H94A 4WORA 5CV5A 2AUKA 2C35B 5JEAH 2J4XA 4C3IB 5M3FG 4G7ZC 2KHSA 1HUNA 1SSOA 4V0BA 4O1NA 1JJCB 4EGVA 2F0HA 3NQIA 2R93G 2HCIA 3WOFA 1OXSC 1PZID 2Q2IA 3EJIA 4LF6L 4LNQA 1EYDA 1CM9A 1J5EQ 1LTGD 3NBIA 1Q86C 2KCNA 4DNTB 4OIKA 2Q8TA 2NTTA 4A3FB 3Q22A 1NR2A 1ET6A 5KGUA 4KHVA 2FMMA 1XNQQ 3BYYB 4JI0Q 2Z9HA 2HIXA 1PZJD 1G6PA 3S2DH 5IGCA 1G291 5JJZA 3TS0A 3NPPA 3VA5A 1EU4A 2F0VA 4JCVE 2I07B 4TVAB 1ILPA 5C5LA 3QO2A 4GN5A 4EQNA 1KAWA 3R2IA 2CWPA 1JJGA 1I6HH 2I5HA 1Z6HA 4JW0A 4BS9A 3HEJA 5IWAQ 1SE4A 3WWVA 1KNEA 1VQMA 1O7IA 3S14H 4JVZA 4QY7A 2CW0C 3F2DA 3KLRA 1GUTA 2VS1A 3MVVA 4JI1L 2R92H 1DCZA 3PUXA 5M3MB 1JOQA 1Z7TA 2UXCL 2XRSD 5C4XH 3G6EA 2F4IA 5C0XI 2UXDL 1GOZA 3HP3A 2F0KA 4DR7L 4F8MA 1FGUA 3EA6A 3LX0A 3BYTB 4J1MA 3GTGB 4NW2A 1N33L 5IYCH 1PYWD 3L9AX 3TZDA 3CAMA 4OHJA 1SLJA 1YHBA 3VYTA 2EPBA 1M1KC 5J1ZA 1S5FD 1HTLD 4WFN3 1K8MA 1D5MC 1ESRA 3RLOA 1EWIA 1CUKA 2O4XA 1RHPA 3S1QB 1NMGA 5M9OA 2UUAL 4OO1G 2LSSA 2A6ED 4CKCA 1TWAH 2B63H 3QJYA 4JBKA 4JV5Q 4A3IB 3NTHA 5IGDA 4XQNA 1TY0A 2DNCA 1C4QA 3CCQA 3OTOQ 2R7ZH 4OWXB 1X55A 3S17B 1F2ZA 4C1NI 1HJPA 4ZUIA 3R93A 2Z8LA 3TEHB 4B08A 4Y7NB 2MNAA 4A3IG 1LTBD 1VF7A 1K28A 4DV6Q 3JAME 4XT1B 4A3GG 2QEXA 3PO3H 3ONAB 4JI7L 4Q0FA 3PIOA 2E2JB 5EBDA 1BBUA 4DR5L 3UDXA 1B7YB 1LT6D 2K52A 4C56C 4GZYC 4GLAC 4DAVA 3PO2G 1TWFB 2LFNA 2LKVA 4RKBA 1HNZQ 4A3GH 5BN5A 2RSNA 3J81j 5G3LD 2B2VA 1B44D 3RD4A 1EZ6A 3GTLB 1XJVA 3ITPA 4A93H 5IP9G 2QF7A 3U58A 2BH8A 1TQOA 1JC7A 5IODA 2PZWA 1L2FA 2UUCL 3L7ZC 3PO2B 4HCEA 3GTQB 4DFAA 2DGYA 4RMFA 3G71A 3CCUA 5KIXA 3PO3G 4DXGA 4A3EB 2JJQA 4HJ8A 4JI2L 3M3YH 4UPAA 1CKMA 4OELB 2KUMA 3GDEA 1KQSA 2SOBA 2PQAA 5D3DA 2JA5B 1YHAA 4KN4C 1MHWC 1N36Q 4KKSA 4CGYB 1EOVA 1VMPA 2GVBA 1TWCH 3J81E 5ELDA 3VYRA 4A75A 4KD4A 4KJNA 1LM0A 1PMRA 3IRBA 1V9PA 1HPCA 1XYIA 5C44H 1XNRQ 1B2TA 3AQQA 4A3JB 4HSVA 1SE8A 2EYLA 1DYQA 1PZKD 1G2TA 1TU2B 2KHIA 1UEAB 5CV7A 4YCWA 1OXVA 2YYZA 4NPSA 4OONA 2JA5G 4X6AH 2F0LA 1CT1D 2HQEA 3HOYB 3BVGA 1FNVA 5IYCG 4HIDA 4Q5VA 4S3SA 5ELCA 3H0GH 2DUDA 4NB3A 2ICEC 2OXPA 2EJFC 3S24A 1E22A 5E4WC 5T1GA 4X64Q 4B3MQ 3AEVA 1Y1VB 2A6HD 2R92G 4H7BA 5D14A 2L11A 2X69A 4IUNA 1L0XB 5E7NA 2F1MA 3E0JA 2EIFA 2ZM6L 4DU9A 3MXNB 4LF9Q 2ZM6Q 1W6KA 3ZYYX 4YCUA 2ICIA 2MUYA 1YNND 1IYJB 1O7YA 4KY6A 2K7VA 4R4QA 1EOTA 4ZUJA 3EFXD 5M5WH 4JBMA 1R9TH 2R7FA 1BKBA 4RWSC 1R4PB 1C9OA 1VQFA 1PV4A 3H0GB 1JE4A 2E2IB 1I3QH 1YVCA 2UU9Q 1STHA 1JQYD 1EYCA 2ZTEA 1L1OB 5A2QL 1Y1WG 3PIP3 5KYLA 3A5UA 5J39A 3GTOB 4AYBG 3AU7A 1HNXL 3OW2A 2F4VL 2UXBQ 1FR3A 4HJ7A 3KF6A 4DGZA 2JA5H 1JWMD 1EWCA 4PMBA 1PXUA 1LABA 1TY2A 3FVQA 1STYA 3BG3A 3M3YB 1TWGH 4A3KG 1KNAA 3PIO3 2EYPA 3NTIA 5D65A 2V4DA 2K5HA 3DM3A 5GAHC 4B9WA 3TP5A 3J80c 1RTNA 2J7ZA 3MTSA 1JE5A 3CQZB 1IBLL 1EIYB 3HOXG 3VR4A 3O13A 3I4OA 4LF5Q 2F0NA 4OXPA 1VQDA 3H91A 1GUGA 2JA7B 1NY4A 3GTQH 4IUPA 2ASBA 3F2BA 2UUAQ 3SK6A 1RIPA 4X65L 4DV2L 2Z6KA 3S14B 2PI2E 5LL6S 5KNDA 2PQEA 1VQOA 2F0QA 3M4OB 2I46A 3R3OA 2PPBC 2LXKA 1CKNA 5CC4A 1NMFA 4LFBQ 1HNZL 4A3GB 2K5NA 3VYSA 1GO3E 3NE5B 2EXDA 3F2CA 1TWAB 2R3ZA 5A2QE 3HOXH 1JJ2A 4I7AA 5E1FA 1BCPF 2LS01 2EYFA 4JYAQ 4AQYQ 2D62A 5M5XB 3NEMA 1PLFA 4DV3Q 3I4NB 1MSGA 1RKNA 1I4XA 4XTCS 3TDQA 4K5WA 4B3TL 2RF4A 2E2DC 2QKIC 2WKDA 1XPOA 4H44C 3EN2A 4L5QA 5BN3A 1I4RA 1B70B 3X3NA 4DR2L 1ASYA 5C4XG 3CCMA 4JI7Q 2C5CA 4Y52H 2XSCA 1V43A 1GJXA 4H02A 1LV9A 3OW7A 4DV6L 3MXGA 3HFZB 3SK5A 4DK1A 4JV5L 3S1MH 2G9HD 1PRTF 2F52A 5AJ3L 4DR4L 2O5IC 4XYQA 4DV2Q 1SAPA 3VDYA 4CJ1B 3C3LA 1Z47A 1LTAD 2A69C 3Q23A 3S2HB 4C3JH 3SR1A 5FLXL 1GKHA 4Z9CB 5LMNQ 1MD2D 3S1NB 1Q3LA 4QB4A 3SXHA 1C8CA 2IX0A 2IT1A 5JEAJ 5KYIA 1X9NA 1Q8IA 2FHTA 4KKUA 4CDEC 1YJNA 3GTGH 4X3UA 2IHFA 3E0EA 1EEFD 4A3JG 2XTIA 1PH9A 1KDCA 1QZGA 3S2HH 3M7GA 2RCFA 1KABA 2RQXA 2KJXA 5I9OA 4R9WA 2XIWA 4DR2Q 5IP7H 4XYOA 1N33Q 5M3MH 3S1MB 2F3IA 1Q46A 1I50H 1Y69U 3K7AH 2UXDQ 5C0XJ 2KOLA 4HJAA 1TVXA 1F2YA 1SFOB 2JA9A 3CC4A 1BUVT 1HNXQ 1VDZA 2CKZB 2N49A 4DNRB 2Z6KC 2R92B 2PCFB 5M3FH 4G7OC 3DXJC 2PZTA 3NTKA 1V1QA 3SGIA 3K5NA 4KHPQ 1V8QA 4DR7Q 4JI4L 4DV3L 4JK1C 5CORA 1K0SA 3S1NH 2F0PA 2LY7A 1M8AA 2WACA 1F77A 4ZRZA 1BCPB 4A3DB 3GTJB 1PH4A 3UE1A 1LTTD 5FLMH 4LF9L 3C46A 4QF4A 1QE6A 1F9SA 1X54A 2HHHQ 1FJGQ 3DWQA 1V1OA 2NN6G 2Z6BA 4H13C 4HAEA 3WOEA 3J80E 4XXEA 4UP8A 2KCMA 1BOSA 2BDNA 1TXYA 3W2DA 3K0YA 3I90A 5GAGC 2DJFC 2KVMA 3GO5A 2LXJA 1SYEA 1D2BA 2DN8A 4GS3A 4LF5L 1S5BD 4C3HB 5JPNC 2PNHA 3OHXC 2NZ1D 4OO1H 3D3RA 1DOKA 4CBVA 2VB3X 3HOXB 2EOTA 1ZYRC 1EQTA 2VUMG 2E2HH 4HN7A 3A54A 4CJ0B 2A74C 1AH9A 2JA6G 4AYBE 3RZDH 1S4ZA 2ES2A 1KRSA 3FRPB 4DPGA 4AQYL 4O0AA 4OWWB 2QCPX 4DV1L 2F4VQ 3BDOA 4N8X1 1JOOA 2IJ0A 4IUQA 1PH3A 2EY1A 4FF4A 3QOJA 1I4GA 2CHBD 3G4SA 2OCEA 3M4PA 3BVMA 5C0XG 3D6WA 1BQQT 3KDFA 4ZAIA 4GKJQ 3L2PA 5CR3A 3CXCA 4B3RQ 4IJHA 1A8VA 4A3CH 4EQPA 3GTMB 5JJLA 2RDGA 4QJFA 4A3LG 1H9SB 1ZKOA 3I55A 3UI2A 3I70A 2EVBA 2JSOA 4ZK9B 3HZXA 1CK1A 4UP9A 4U673 5JVH3 3RNUA 1ML0D 4FVMA 3ULLA 3MXNA 2A6HC 2BCOA 1O78A 5IGBA 3BDLA 1TS2A 2IX1A 3AB9A 4FYDA 2L15A 1STEA 2EYHA 4ZQ3A 4L8JA 5JVG3 1SBBB 2PMZB 3Q24A 3PCOB 3HOWG 2NWGA 2OWOA 1QVGA 2JA8B 2NZOA 4JI5Q 3I8ZA 2EJMA 1RCVD 5DEHA 3J81i 1EIHA 2R93B 4ME5A 3W5OA 5JJIA 1KRTA 2Z1CA 4ALPA 1GD7A 4K5VA 1WTOA 1JR0D 1VMCA 1Z9FA 2VL6A 5EAYA 2I5MX 2PQAB 2JA8G 2M2LA 4OIJA 1YNXA 3M4QA 3JAMc 5IP9H 2F0TA 4K0KL 2A1AA 3FDTA 4RGMA 1D1KA 1NR4A 1SMXA 4KLKA 1PH8A 4DK3C 5DAUA 5IT9L 3SHLA 1VQKA 3HOVG 1YJ9A 4NP5A 3HRZC 3HOVH 2RHSB 3CRLC 1HFGA 4YWMA 4R8IA 4BY1B 2K28A 4FF2A 2YTVA 3J80i 1YITA 3LWEA 3MEHA 4LF8L 2XVSA 1HA5A 4NXML 3T53B 1WCMH 2CCZA 2ZTCA 3A5ZB 4ZLTF 3HOVB 2PNRC 1AN8A 3VR2A 4DV5Q 4IJLA 4G57A 1SEBD 2B2UA 2JEAI 1I3QB 4YY3L 3GTJH 3CCJA 1CA6A 1E2ZA 5M3MG 5A35A 4R4CA 4NKLA 4K6LA 4AIMA 4GKKQ 1SMYC 3J81c 5EPLA 4BBRH 1I94L 1U0LA 5C4JH 3D6CA 3CCVA 1KAAA 2AUJD 2RBMA 1V1PA 4XIGS 2AWNA 3E9IA 1HZBA 1CZGA 5JJKA 3W3AA 3K59A 1TS5A 2JE6I 4ZYSA 1ZXTA 4DR3L 4HIKA 1QVFA 2IWHA 2B2YC 2IY5B 1H9KA 4LJZC 1KHIA 4G4KA 4GN3B 5KRUA 5IGGA 5CMDA 1Y8PB 2OTJA 4HTHA 3S1QH 2NYZD 3A7AB 1J5EL 1E1OA 4LWCA 5KNBA 2K6AA 4ULLA 1GHJA 1XPUA 4P2CB 3FKIH 3VR6A 1ENAA 3PIPA 4CJ2C 2JA6B 3RZOB 3J7AV 4UDUC 4JI4Q 3TP8A 3NXWA 1TWHB 2F0IA 1M4VA 3KJOA 4BY7B 3I3CA 5K36H 2A8VA 1L1OA 1NNXA 2NVYB 4DV0Q 2PI2A 5NUCA 1A63A 2HIVA 1BCPC 2H5XA 3H3VC 2K01A 4N9TA 3T51B 5I6WA 1JORA 2MO0A 1TS4A 3V96A 4A3MB 1SNDA 1MI2A 2AHOB 5FO9B 3S1RB 3HOZH 1VQGA 2UXCQ 1B9NA 3KJPA 1EY8A 1SYGA 4DUZL 1K3BC 1PHJA 2CWAA 3MFGA 2WFWA 2ENBA 2L9HA 2AMCB 1XTCD 1YEZA 5T1IA 1J8IA 5IWAL 1EY0A 1JOKA 3CCEA 1M90C 1CI3M 4RAUC 4YWKA 1BXTA 4XQQA 3AYHB 1JWUD 3T1HQ 3IFDA 3K81C 5GROA 1JMCA 1DJRD 1BR9A 2A19A 2GA4B 3I4MG 2NTSA 2SNMA 4FDBA 3NBHB 3I4MH 1W3SA 3S2DB 2K5VA 2K5WA 1MSHA 4X3TA 4LF7Q 2RCNA 1EL0A 4J6HA 4A3FG 3ER0A 2CVRA 2KCTA 3OPOA 3U9SA 4RA8A 1QG7A 2JYOA 3S17H 2EQSA 3DEOA 5E4XA 3R8BA 3H6MA 1A3TA 3URYA 1LTLA 3CC7A 4DUYL 3UE0A 4ZKBB 3A55A 1QCBD 3KF8B 2FJ2A 3LWUA 1I6HB 3QR8A 2IHEA 1QNUA 4KJOA 1GM5A 1EY6A 1IW7C 1DD2A 3B6YA 3BDCA 1E2WA 1I4QA 1SROA 3BS1A 1D7QA 1VS0A 3HKZE 4KMUC 2IX3A 4PMWA 4M8AA 1SYCA 3K6OA 2ZTDA 3OYYA 3ULPA 1XPRA 4RGOS 1MBYA 4JBJA 4MIUA 4JI8Q 5IOCA 4LF4Q 1ENCA 2V1CC 1A0IA 1BBWA 1QUQA 2Q2TA 4OX9L 1T9HA 1L1OC 4R8NA 1S5DD 1RTOA 3E3XA 2D0PA 3CRKC 2BE5D 1SNPA 1LT4D 4JI3Q 5I6YA 5LL6X 1O7LA 5FKAC 3A8KE 2E76C 3OMCA 1SNCA 1S5ED 4RGTA 3T1YL 4QIWB 1HCZA 1VQBA 1X65A 2NVTH 1N32Q 3TSSA 1RF2D 4C3IH 1Y8NB 2NBFA 3OWFA 4QUFA 2WINB 3CCSA 4N8FA 1OXUA 1H9SA 3S9WA 4NXMQ 4DUYQ 1K3RA 3FKIB 2B2TA 1J6QA 1K8GA 1ZEQX 5I2XA 4L5TA 1Y1WB 2JK8A 4YWLA 2VZAA 1W2BA 1GUWA 4QUCA 1N8RC 2HDLA 3LGJA 1KXLA 2QW7A 1EFWA 1TR5A 3IFTA 3MC0B 3GV6A 3KLWA 4HSPA 2F0EA 4CHTB 2AKWB 2YTXA 5D3IB 4A3KB 4K6DA 1VF5C 1WTRA 1EU3A 2IW3A 2L55A 3D0FA 4WJ3M 1NBWA 4DR1Q 4A3JH 2MJ8A 3P20A 4FF3A 1FVIA 5C44B 5JAVA 1EQVA 1K83H 5CV6A 3GTPH 2L0CA 3T1HL 5CV9A 1LUZA 3I72A 4FNFA 1SN8A 1I6VC 3K5OA 4IPCA 4JC0A 3GTMH 1F2LA 4A3BB 1Y14B 2G9DA 2JA7G 3GV3A 2ZXOA 1F9PA 3OWEB 1VQCA 1XWEA 4JI5L 1NUCA 2R6GA 1C48A 3H09A 4IFDG 1U4LA 2HT1A 1N9WA 4NXNQ 4TQUS 1TIID 2F0FA 5IYDH 2EY6A 3J7A5 1PH6A 2OTLA 1JWSD 1OO9B 2EDGA 4KI0A 1BO0A 2A68D 3NWTA 3EVQA 3CCRA 3M4OH 2KCCA 4MHEA 5EGTA 4MN3A 1MJCA 5I2YA 3OIQA 4LAAA 5CGKA 2GN5A 4DV5L 2JQOA 2YV5A 4X62L 1U9RA 3OOCA 4OGQC 1PTOH 2A68C 1CKOA 2ZJRA 1B9MA 5E3FA 1ENFA 1LT5D 3I91A 1IZ6A 1JICA 3BZKA 1AP0A 4L6TB 3M7NA 1GUNA 1VQEA 3HKZB 2B8FA 4P71A 3NUCA 4HCSA 2Z0SA 1P16A 4O2DA 1CSPA 2MHVA 3QIAA 4N9PA 2K14A 2RDHA 1BF4A 1BDOA 4F7XA 3W1BA 2WAQB 4DR1L 3HOYG 2JA8H 1F9QA 3HKZG 3A56A 5IYBH 3A8IE 1D6EC 1X3PA 4PZ8A 1FD7D 1EFID 4LFAQ 1UAPA 2EE1A 2K5DA 4QL5A 2NVQH 3ERQA 4JOIC 3TN2A 4WRDA 2MQHA 4V190 1ET9A 3CW2C 2JN4A 1Y1VG 4KY5A 1PH5A 2EY5A 1NTGA 1XNRL 2BOSA 3KK7A 2KQ3A 1EIGA 1UEBA 5KEEA 3HG9A 4FXGC 2WB1E 4RCOA 1GVPA 4QQBX 4IPHA 1ESFA 5ELBA 5FOBB 1WI5A 4NXNL 5EKIA 3T13A 1A2UA 3C1FA 5C4ZA 2VQEL 1X56A 2O2LD 4LMQD 2X6GA 2RVLA 4MTNA 2AQ1B 1Y1WH 2K33A 4C2MB 4GLVB 1JT8A 2D5DA 1RJTA 2K32A 2KECA 1U5KA 3JC66 2A69D 1FJGL 4C1NK 3S15B 4KY7A 3KFUA 4FXDA 2EXZA 1OXXK 3DMUA 4JI3L 2PW5A 1FNWA 4A3LH 4JI6L 1EY4A 3KLSA 3RLNA 1UUPA 4J8QA 1QWYA 4XT3B 5C3WA 2CFMA 2Z4IA 2Q8RE 2WB1B 5H1SE 4DV1Q 3E6ZX 1S72A 4MZ9A 3T4AC 2XGTA 4I7ZC 4K8JA 1KLGD 3IL8A 4KHPL 4BXXG 5COYA 2XN9C 3NHHA 2E2HB 4DK0A 1PFBA 2DY7A 1B3AA 1II3A 1G2SA 1WTXA 4ME3A 4AH6A 1PH7A 1A15A 1S40A 4B3SL 1PFSA 3D4WA 1EQRA 2A5HA 5EPJA 4CDFC 4LF7L 1C7YA 2Y0SB 1SR3A 2R7DA 3L3OC 4QCLA 4HIOA 3K5MA 1K73C 1TKWB 2ATWA 2F3WA 4H0LC 5C3EG 2F3VA 4A3BH 4LFCL 2PMZE 4O42A 1STGA 1HA6A 5M3FB 3BZDB 3V05A 5EPKA 2ID0A 1K8AC 3GP7A 5C44G 3PO2H 2IL8A 4POGA 3PQIA 1P8LA 1N32L 1SFOH 3SDZA 2E5LL 2Q2HA 1EZ8A 2OF1A 2Y0SG 2O5JC 1IL8A 1R4QB 2RKSA 4A3CG 5C3EH 2Q8IB 3GTLH 4A3BG 5EJWA 4U68A 1O7ZA 4OWTB 1GHKA 3P75A 1A62A 1E3PA 1SE2A 2B8GA 3CMAA 4RHRA 3BZCA 5IGFA 2PZUA 1MJEA 1E2VA 1PTOF 2NVXH 3AFPA 3K57A 3I4NG 2R7ZG 5J3BA 2JXMB 1WCMG 2ZJQA 3EIVA 5DNFA 5ELOA 1RL2A 4C3JB 3J7AF 4IUVA 1XNQL 3HOZG 1UNSA 4Y7NH 1EEID 4YHHQ 4DV0L 2B63G 4ILWA 4KKTA 1VQ8A 4POFA 1QNKA 2K05A 1DXMA 1G51A 3UDFA 4EQOA 5IYDG 4MTKA 2Z4HA 2R7ZB 2ZXRA 3MXUA 5FO8B 3CF5A 2AQ3B 4HJ5A 3S1RH 3HOZB 2B63B 2L12A 1IBKQ 4FF1A 3U4ZA 2L5TA 1KTKA 1PTOC 2QGQA 1IBMQ 3OSOA 4BY7H 2ZT9C 3QG1A 5CBAE 3KBGA 1TT2A 3A74A 4IURA 4DV4Q 2KA7A 1QOHA 1D1IA 3GTKB 1QJOA 2D9UA 4FXKC 3GTOH 2DJGC 3SEBA 4HIMA 3TQYA 1IYVA 1TWHH 1X32A 4RG1A 1BNZA 2HD3A 2E2IH 2I0QA 1L0YB 5FO7B 2VUMH 4JI0L 1LYLA 1DOLA 2A73B 2VQFL 5IGEA 3I2ZA 1B8AA 1U4MA 3GQBA 1ZYRD 4DAYB 4DA2A 4YY3Q 1KIXA 4KHZA 3RZOH 1G6ZA 3U9OA 1YJWA 1I94Q 4P72A 4NDXA 1DM0B 2B29A 3T56B 4IN3A 3TP7A 3NBHA 1DOMA 5L37A 1IBKL 4FP5D 2NN6H 3CU7A 4HEDA 5CYUA 1RDPD 4XDXA 2L1BA 3EQLC 1YZ6A 1NAPA 2YU9B 1HH2P 3S16B 3D4RA 1F9RA 4K2LA 3A8JE 4PMCA 5HGQA 5HGTA 2Y0SE 2EJGC 1EY9A 1QUQB 3IAYA 1HRJA 1IXRA 1S5CD 4MNOA 3NELA 1XTDA 4KV6A 2NVQB 5EQ0A 2WB1G 1AE3A 4KD3A 2BH2A 2KHJA 3PUWA 4IPDA 3T16A 4JI6Q 4X3KA 1TWCB 3EBEA 2F0DA 1VQ5A 1IHZA 1CHQD 1UWVA 2DY8A 1SXTA 5FLXE 1PRTD 1HNWQ 2BDOA 1L0WA 3FMCA 1YI2A 1VQIA 2VY3A 4LUZA 3PGZA 4KK7A 3J80L 3ICEA 1HQRD 3MFYA 1PRTC 2J0TD 2A6EC 1U4PA 2VQEQ 4DXFA 4DR4Q 5TSSA 3K7UC 2NVYH 3J7ZC 1YBYA 3TZUA 1VQAA 2IPKD 3J81L 3PV0A 1HFNA 1IL2A 2N88A 1VCIA 4IPGA 3Q0AA 1EWHA 5GAEC 1K9MC 1LACA 1SYBA 2QDLA 3S15H 4B3SQ 3SVMA 1IBLQ 3I56A 1Y1VH 3K0XA 5M5YH 4GOPA 4TSSA 1A3VA 3NK9A 5EKLA 2Q2UA 5FLXc 2FINB 3G7LA 4R4IA 2F0UA 3HOUG 4A4IA 1Q12A 3MXPA 3ND9A 5LHY1 1UE6A 3KF6B 4OO1I 3E5SA 4JBWA 3I7FA 3RMHA 4DNIA 5I9PA 4KN7C 2HDMA 2L4NA 2NN6I 4DF7A 4C2MH 2K1BA 3R2TA 1Q90A 3HOUB 1B53A 2NB0A 3TP6A 4A3MG 4F88A 2E74C 1A6XA 4C3JG 2DNEA 1UE1A 3CPFA 1HZ9A 2KEDA 3DLLA 3FPUB 1Q81C 4K8IA 4DAPA 1VQ6A 1IKMA 3CCLA 3M4YA 3MZ5A 1E0BA 4HR7B 2B2WC 1KDAA 5IYBG 1J9OA 2EYJA 4PZ6A 4HMJA 3NENA 5IP7G 4DKAC 5DM73 2BA1A 1VQ7A 4IQZA 1G8ZD 1SYFA 1Y8OB 3ERSX 1SMYD 4ODGA 4LW1A 1FYCA 2M9VA 1PTOD 1Q7YC 3G6JB 3K58A 1HZCA 2VNUD 4APVA 1QVCA 4IFDH 1N36L 3STBC 2D0OA 3FP9A 5C3XA 1XMOQ 1B3QA 4J15A 3ULJA 3SK4A 1PYBA 3ND8A 2K04A 2P5ZX 2TMPA 1D5ZC 1HNWL 2YTYA 3OMGA 3HOUH 3FEWX 2F0JA 5BR8Q 4K2KA 4LUVA 2XRQD 4ZKCB 4ZCKA 3VYUA 1GUSA 4L5SA 2N78A 2CQOA 5HURA 2MGSA 2OEOA 1UE5A 1X3GA 2C9OA 4P73A 3D31A 1PRTB 1F2MA 1WD1A 3KUPA 4GOPC 4JI2Q 1VQJA 1WYDA 2FXQA 1ASZA 4DV4L 3G48A 2H1EA 3QWNA 4X62Q 3A0JA 1E24A 3MWYW 3DEPA 1TWFH 1QILA 3H3VI 4P75A 2VW9A 1SRUA 1H9RA 4IUTA 1LTRD 3M85A 3F1ZA 1TS3A 3PSIA 3SK8A 3J7YW 1SE3A 3V2TA 4ABNA 2SDFA 2N3SA 3C1EA 4F87A 4GN4B 1BVSA 2QA4A 2NUCA 2K03A 3PUYA 5FJ8H 1D8LA 1JB7A 2QILA 2EYMA 1NE3A 2BA0A 2CH4W 2JEBI 3D8GA 3F2UA 2X6LA 3K80C 1E1TA 3Q6SA 3OTOL 1CQFA 1EYGA 2F0WA 4BXXH 4A3EG 2WIIB 2ZJPA 4IFDJ 4BBRG 4R4OA 3FKIG 2OT2A 4NMZA 4A3IH 4K5XA 4X3SA 1O80A 5C4XB 5ISRA 4OX9Q 2GVAA 1SJED 2VQFQ 3K8AA 4JI8L 4LF4L 3PF4A 4QGUA 3U4VA 5AJ3Q 4I65A 1CZWA 2B2TC 5J22A 4A3KH 4RCNA 2XWBB 3KYHC 2K5QA 3RLFA 4GNXC 2YU9H 2E5LQ 1EYAA 2OQKA 4L5RC 2CQAA 2OQ0A 5G3LF 4C3IG 4BY7G 5IT9E 2F0SA 2K75A 2PYKA 3STBD 5JOBA 1HR0L 1AE2A 1VQNA 4TRDA 4DAMA 1STBA 1AW7A 1ICWA 4QMGA 3VA7A 2NVTB 3TREA 3GTKH 3D4DA 1QB5D 3C2PA 1LO5D 1X6OA 4RKLA 1V1PB 1I50B 1PFMA 1SNMA 3VR5A 4IOCA 1STNA 3QOLA 4P74A 3RN5A 1KL9A 3E9HA 1NCVA 3P7JA 4HJ9A 3KOJA 1IBML 2F0GA 1IW7D 4CKEA 4RH6A 4YHHL 1X3EA 4DR5Q 5DM63 1ICFB 1WJJA 3JAML 3T1YQ 3KLSX 1WTHA 4RGNA 4BWGB 4B3TQ 2G5DA 1H9JA 3TMEA 5IE8A 3CKIB 3H15A 3HS0C 3I4NH 5IT9c 3CP0A 4E6IA 2TSSA 2WV6D 1PYSB 3OIPA 1AFPA 1DZ1A 2B3GA 5CBEE 3KBXA 1HR0W 2HUGA 4K14A 1AEXA 1X3FA 3H0GG 2FFKB 2CW0D 4GNXA 3I4MB 2M00A 5ELFA 1JCKB 4DUZQ 1KD1C 3MEFA 4AYBB 3DWPA 5LMNL 1H95A 4A76A 4A3DG 2EZVA 1B50A 5C5MA 5I4DA 4A3FH 4X65Q 5AFWA 5C4HA 2QEJC 1CSQA 5EBCA 1I4HA 2RHQB 1YHQA 1SDFA 4IZ8A 4EQ5A 4G7HC 4IFDI 4GOPB 2LMCB 2WKCA 1CQVA 4IOAA 2PO4A 5M5XH 1HZAA 2CH4A 4DN4M 1G91A 3K7AB 3I73A 5K5PA 1NSNS 4UP7A 2UXBL 1WFQA 4IO9A 1FGBD 5K36G 5GQOA 1HHVA 4M1UB 3N52A 2UU9L 5FLMG 3L0OA 2HQLA 4UAIA 4C3HG 1WD0A 1RODA 1YNNC 5ELNA 3N6RA 1I4PA 1PFNA 3UDIA 1HR0Q 2K50A 4JYAL 2R61A 5LMUQ 3M9BA 4PZ7A 3F8TA 5JEAG 5CV8A 1TWGB 1DONA 4DK6C 3SE0A 3EROA 4CDDC 2JA7H 4BBSB 3UDGA 2PW7A 2JA6H 1EQQA 4X66Q 4LFBL 1NJIC 4A3MH 2K4KA 1K8OA 3CC2A 1CA5A 3BJUA 1CTMA 3CQZH 2WAQE 3PMFA 4DAYA 3HGBA 5EKKA 1VQ9A 1IKLA 2N55A 4FO2A 1VQPA 2I5LX 3P1HA 4BBSG 1EIFA 1LTID 4LUOA 4WJWA 5BR8L 2H4OA 1LLRD 1WTVA 4GNXB 2F0OA 3RR5A 5M5WB 4DR6L 2RDFA 3CPWA 2HCCA 3QB3A 4X64L 4B3ML 3PUZA 1SNOA 1FNUA 1XMOL 1YNJC 1CFMA 3DUZA 4LFCQ 1EUJA 5C4JB 4DV7Q 4KTAA 4YCVA 4BBRB 2QDBA 3RUZA 4B9XA 4RHSA 1ONLA 3FHWA 1MGSA 1R9TB 2N8NA 2NVXB 5C6AA 4IUUA 3DHQA 4PG3A 1KC8C 5IIFA 3CMEA 4LFAL 1EY5A 1FL0A 1YNJD 1SJHD 5C3EB 1MIUA 3HOWB 1B1ZA 1GUOA 2SEBD 4JG2A 1T5XD 2F03A 5FK9C 1U4RA 3FPPA 1XX8A 4R4TA 1N34Q 3KF8A 4CDCC 2BE5C 1SNQA 5DLQE 4PV1C 3PUVA 4DR3Q 1PH1A 4GLXA 1X3QA 5ELEA 1XXGA 3CD6A 2AQ2B 1LTSD 3KDFB 4BA1I 3HOYH 1HTPA 1JB3A 1XMQL 1UE7A 2EYOA 2UUBL 4A93G 4WJ4A 4RFBA 4PNYA 2XNAC 4A3EH 1OXTA 1GXDC 3HOWH 4L63B 1PDQA 3NQTA 1PA6A 4DV7L 5KNCA 2VB2X 2VXWA 3AMUA 3U50C 1MKHA 2ALYB 1WTWA 1WCMB 4GKKL 2R93H 1E7ZA 3RN2A 1HQMC 4LF8Q 5FJ8G 4UY8C 1QZHA 4BY1G 1WTPA 1W6JA 1XMQQ 2B2UC 1Q82C 4A93B 4R1JA 4BY1H 4DR6Q 1KDBA 3TRZA 3AFQA 2F0MA 4LK1C 1YIJA 3VR3A 3S16H 5CV4A 1Q1EA 2AWOA 2B2VC 2E8GA 3CHBD 3MHBA 2XWJB 3IKJA 1AZQA 4IALA 1PVOA 4BA2I 3LNNA 4EVOA 2RSOA 2KEEA 3A7LA 2E2JH 3DM1A 4K0KQ 1ILQA 4PQXA 3H3VH 2KBNA 4C3HH 2WAQG 4QIWE 4YIJA 2JP1A 1EY7A 5HY6A 1AZPA 3PF5A 3WDNA 4JOIA 2EY2A 2WP8J 3X3MA 3NWSA 1BBXC 1CKNB 2B39A 1BCPD 1RD9D 4CKBA 2MPMA 3K5LA 5LMUL 3MA2B 3Q8DA 1VQ4A 2UUCQ 1DGSA 2VUMB 1WVLA 2B2WA 4TKOB 3BVZA 1A2TA 1T5EA 3BU2A 1I5FA 3TBIB 4BBSH 1Q8KA 1Q1BA 1WOCA 4A3DH 3JAMi 2B2YA 3NSWA 3TS2A 4HMIA 1PH2A 1VQHA 1OTCA 4JI1Q 1LT3D 2KENA 3ZJYC 4EX5A 3RZDB 1WTQA 3NP8A 5BN4A 1K0RA 3I4LA 4UHVA 2NZHA 1A3UA 1IYUA 5GADC 1K83B 4OL7A 3GTPB 2MP1A 2RA4A 4B3RL 2D2CC 3DWAA 1S3OA 2UUBQ 2HHHL 2MO1A 1HXYD 3GD7A 3HKSA 3MAQA 4OEMB 5JPMC 5C0XH 1HUMA 2ZXPA 1PTOB 1CHPD 1H9MA 3W1GA 1STAA 2FMCA
chains in the Genus database with same CATH topology
5F2DA 2E75C 5M5YB 1SYDA 1KLUD 2SNSA 4ID6A 3PO3B 1B4OA 4XQJA 1D5XC 3H94A 4WORA 5CV5A 2AUKA 5JEAH 2J4XA 4C3IB 4G7ZC 2KHSA 1HUNA 1SSOA 4V0BA 4O1NA 4EGVA 2F0HA 3NQIA 2HCIA 3WOFA 1OXSC 1PZID 3EJIA 1EYDA 1CM9A 1LTGD 3NBIA 2KCNA 4DNTB 4OIKA 2Q8TA 2NTTA 4A3FB 3Q22A 1NR2A 1ET6A 5KGUA 4KHVA 2FMMA 3BYYB 1PZJD 5IGCA 1G291 5JJZA 3NPPA 3VA5A 1EU4A 2F0VA 2I07B 1ILPA 5C5LA 3QO2A 4EQNA 3R2IA 1Z6HA 4BS9A 3HEJA 1SE4A 1KNEA 2CW0C 3KLRA 1GUTA 3MVVA 1DCZA 3PUXA 5M3MB 1JOQA 1Z7TA 2XRSD 2F4IA 5C0XI 1GOZA 3HP3A 2F0KA 4F8MA 3EA6A 3LX0A 3BYTB 4J1MA 3GTGB 4NW2A 1PYWD 3L9AX 3TZDA 4OHJA 3VYTA 2EPBA 5J1ZA 1S5FD 1HTLD 4WFN3 1K8MA 1D5MC 1ESRA 2O4XA 1RHPA 3S1QB 5M9OA 4OO1G 2A6ED 4CKCA 3QJYA 4A3IB 3NTHA 5IGDA 4XQNA 1TY0A 2DNCA 1C4QA 3S17B 1F2ZA 4C1NI 4ZUIA 3R93A 2Z8LA 4B08A 4Y7NB 1LTBD 1VF7A 3JAME 4XT1B 3ONAB 4Q0FA 2E2JB 5EBDA 1LT6D 4GZYC 4C56C 4DAVA 1TWFB 2LFNA 2LKVA 4RKBA 5BN5A 2RSNA 5G3LD 2B2VA 1B44D 3RD4A 1EZ6A 3GTLB 3ITPA 2QF7A 1TQOA 1JC7A 5IODA 2PZWA 3L7ZC 3PO2B 4HCEA 3GTQB 4DFAA 5KIXA 4DXGA 4A3EB 2KUMA 2SOBA 5D3DA 2JA5B 4KN4C 4KKSA 4CGYB 1VMPA 3J81E 3VYRA 5ELDA 4KD4A 4KJNA 1PMRA 1HPCA 1XYIA 1B2TA 4A3JB 4HSVA 2EYLA 1DYQA 1PZKD 1G2TA 1TU2B 1UEAB 5CV7A 1OXVA 2YYZA 2F0LA 1CT1D 2HQEA 3HOYB 3BVGA 1FNVA 4Q5VA 4S3SA 5ELCA 2ICEC 2OXPA 2EJFC 5E4WC 5T1GA 1Y1VB 2A6HD 4H7BA 5D14A 2L11A 2X69A 4IUNA 1L0XB 2F1MA 3E0JA 4DU9A 1W6KA 3ZYYX 2ICIA 2MUYA 1YNND 1O7YA 4KY6A 2K7VA 1EOTA 4ZUJA 3EFXD 4RWSC 1R4PB 3H0GB 1JE4A 2E2IB 1STHA 1JQYD 1EYCA 5A2QL 3PIP3 5KYLA 5J39A 3GTOB 3AU7A 1FR3A 4DGZA 1JWMD 1EWCA 4PMBA 1PXUA 1LABA 1TY2A 3FVQA 1STYA 3BG3A 3M3YB 1KNAA 3PIO3 2EYPA 3NTIA 5D65A 2V4DA 4B9WA 3TP5A 1RTNA 2J7ZA 3MTSA 3CQZB 3VR4A 3O13A 2F0NA 3H91A 1GUGA 2JA7B 4IUPA 3SK6A 3S14B 5LL6S 5KNDA 2PQEA 2F0QA 3M4OB 2I46A 3R3OA 2PPBC 5CC4A 4A3GB 3VYSA 3NE5B 1TWAB 2R3ZA 5A2QE 5E1FA 1BCPF 2LS01 2EYFA 2D62A 5M5XB 1PLFA 3I4NB 1MSGA 1RKNA 1I4XA 4XTCS 3TDQA 4K5WA 2E2DC 2QKIC 2WKDA 4H44C 5BN3A 1I4RA 3X3NA 2C5CA 2XSCA 1V43A 1GJXA 1LV9A 3OW7A 3MXGA 3SK5A 4DK1A 2G9HD 1PRTF 2O5IC 4XYQA 1SAPA 4CJ1B 3C3LA 1Z47A 1LTAD 2A69C 3Q23A 3S2HB 3SR1A 5FLXL 4Z9CB 3S1NB 1MD2D 1Q3LA 4QB4A 3SXHA 1C8CA 2IX0A 2IT1A 5JEAJ 5KYIA 1Q8IA 2FHTA 4KKUA 4X3UA 1EEFD 1KDCA 3M7GA 1KABA 2RQXA 2KJXA 5I9OA 4R9WA 2XIWA 4XYOA 3S1MB 1Y69U 5C0XJ 2KOLA 1TVXA 1F2YA 1SFOB 1BUVT 1VDZA 4DNRB 2R92B 2PCFB 4G7OC 3DXJC 2PZTA 3NTKA 3K5NA 1V8QA 4JK1C 5CORA 2F0PA 2LY7A 1M8AA 2WACA 1F77A 4ZRZA 1BCPB 4A3DB 3GTJB 1LTTD 3C46A 4QF4A 1QE6A 1F9SA 3DWQA 1V1OA 2NN6G 4H13C 4HAEA 3WOEA 3J80E 4XXEA 1BOSA 2BDNA 3W2DA 3K0YA 3I90A 2KVMA 3GO5A 1SYEA 1D2BA 2DN8A 1S5BD 4C3HB 5JPNC 3OHXC 2NZ1D 4OO1H 3D3RA 1DOKA 4CBVA 2VB3X 3HOXB 2EOTA 1ZYRC 1EQTA 4HN7A 3A54A 4CJ0B 2A74C 1S4ZA 3FRPB 2QCPX 3BDOA 1JOOA 2IJ0A 4IUQA 2EY1A 4FF4A 3QOJA 1I4GA 2CHBD 3BVMA 5C0XG 3D6WA 1BQQT 4ZAIA 5CR3A 4EQPA 3GTMB 2RDGA 1H9SB 1ZKOA 3UI2A 3I70A 2EVBA 2JSOA 4ZK9B 3HZXA 1CK1A 4U673 5JVH3 1ML0D 4FVMA 3MXNA 2A6HC 2BCOA 1O78A 5IGBA 3BDLA 1TS2A 2IX1A 3AB9A 4FYDA 1STEA 2EYHA 4ZQ3A 4L8JA 5JVG3 1SBBB 2PMZB 3Q24A 2NWGA 2JA8B 3I8ZA 2EJMA 1RCVD 5DEHA 1EIHA 2R93B 4ME5A 2Z1CA 4K5VA 1WTOA 1JR0D 1VMCA 2M2LA 4OIJA 2F0TA 3FDTA 4RGMA 1D1KA 1NR4A 5DAUA 5IT9L 3SHLA 4NP5A 3HRZC 3CRLC 4R8IA 1HFGA 4BY1B 2K28A 4FF2A 3LWEA 3MEHA 2XVSA 1HA5A 3T53B 4ZLTF 3HOVB 2PNRC 1AN8A 3VR2A 4G57A 1SEBD 2B2UA 2JEAI 1I3QB 1CA6A 1E2ZA 5A35A 4NKLA 4K6LA 1SMYC 5EPLA 3D6CA 1KAAA 2AUJD 2RBMA 1V1PA 4XIGS 2AWNA 1CZGA 3W3AA 3K59A 1TS5A 2JE6I 4ZYSA 1ZXTA 2IWHA 2B2YC 1H9KA 4LJZC 4G4KA 5KRUA 5IGGA 5CMDA 1Y8PB 4HTHA 2NYZD 3A7AB 5KNBA 4ULLA 2K6AA 1GHJA 4P2CB 3VR6A 1ENAA 4CJ2C 2JA6B 3RZOB 3J7AV 4UDUC 3TP8A 3NXWA 1TWHB 2F0IA 1M4VA 4BY7B 3I3CA 5K36H 2NVYB 5NUCA 1BCPC 3H3VC 2K01A 4N9TA 3T51B 5I6WA 1JORA 1TS4A 3V96A 4A3MB 1SNDA 1MI2A 5FO9B 3S1RB 1B9NA 1EY8A 1SYGA 3MFGA 2ENBA 2L9HA 1XTCD 5T1IA 1J8IA 1EY0A 1JOKA 1CI3M 4RAUC 1BXTA 4XQQA 1JWUD 3IFDA 1DJRD 1BR9A 2GA4B 2NTSA 2SNMA 3S2DB 2K5WA 1MSHA 4X3TA 1EL0A 4J6HA 2FMCA 2CVRA 3OPOA 3U9SA 4RA8A 1QG7A 2JYOA 3DEOA 5E4XA 3R8BA 3H6MA 1A3TA 3URYA 4ZKBB 3A55A 1QCBD 2FJ2A 3LWUA 1I6HB 1QNUA 4KJOA 1EY6A 1IW7C 1DD2A 1E2WA 1I4QA 3BDCA 3BS1A 4KMUC 2IX3A 4PMWA 4M8AA 1SYCA 3K6OA 4RGOS 1MBYA 4MIUA 5IOCA 1ENCA 4R8NA 1S5DD 1RTOA 3CRKC 2BE5D 1SNPA 1LT4D 5I6YA 5LL6X 1O7LA 5FKAC 3A8KE 2E76C 3OMCA 1SNCA 1S5ED 4RGTA 4QIWB 1HCZA 3TSSA 1RF2D 1Y8NB 2NBFA 3OWFA 4QUFA 2WINB 1OXUA 1H9SA 3S9WA 2B2TA 3FKIB 1ZEQX 5I2XA 1Y1WB 1GUWA 4QUCA 2HDLA 1TR5A 3IFTA 3MC0B 3GV6A 4HSPA 2F0EA 4CHTB 5D3IB 4A3KB 4K6DA 1VF5C 1WTRA 1EU3A 2IW3A 2L55A 2MJ8A 3P20A 4FF3A 5C44B 5JAVA 1EQVA 5CV6A 2L0CA 5CV9A 3I72A 4FNFA 1I6VC 3K5OA 1F2LA 4A3BB 2G9DA 3GV3A 2ZXOA 1F9PA 3OWEB 1XWEA 1NUCA 2R6GA 1C48A 3H09A 4IFDG 1U4LA 4TQUS 1TIID 2F0FA 2EY6A 1JWSD 1OO9B 2EDGA 4KI0A 1BO0A 2A68D 3NWTA 3EVQA 2KCCA 4MHEA 5EGTA 4MN3A 5I2YA 3OIQA 4LAAA 5CGKA 1U9RA 3OOCA 4OGQC 1PTOH 2A68C 1B9MA 5E3FA 1ENFA 1LT5D 3I91A 1JICA 1AP0A 4L6TB 3M7NA 1GUNA 3HKZB 2B8FA 3NUCA 4HCSA 2MHVA 3QIAA 4N9PA 2RDHA 1BF4A 1BDOA 4F7XA 2WAQB 1F9QA 3A56A 3A8IE 1D6EC 1X3PA 1FD7D 1EFID 1UAPA 2EE1A 2K5DA 3ERQA 3TN2A 4WRDA 4V190 1ET9A 4KY5A 2EY5A 2BOSA 3KK7A 2KQ3A 1EIGA 5KEEA 3HG9A 4FXGC 4RCOA 1ESFA 5ELBA 5FOBB 5EKIA 3T13A 1A2UA 3C1FA 5C4ZA 2O2LD 4LMQD 2X6GA 2RVLA 2AQ1B 2K33A 4C2MB 2D5DA 1RJTA 2K32A 2KECA 2A69D 4C1NK 3S15B 4KY7A 4FXDA 2EXZA 1OXXK 3DMUA 2PW5A 1FNWA 1EY4A 3KLSA 1UUPA 4J8QA 1QWYA 4XT3B 5C3WA 2Z4IA 2Q8RE 2WB1B 3E6ZX 3T4AC 4I7ZC 4K8JA 1KLGD 3IL8A 5COYA 2XN9C 3NHHA 2E2HB 4DK0A 1PFBA 2DY7A 1B3AA 1II3A 1G2SA 1WTXA 1A15A 3D4WA 2A5HA 5EPJA 2Y0SB 3L3OC 4QCLA 3K5MA 1TKWB 2F3WA 4H0LC 2F3VA 4O42A 1STGA 1HA6A 5M3FB 3BZDB 3V05A 5EPKA 2ID0A 3GP7A 2IL8A 3SDZA 1EZ8A 2OF1A 2O5JC 1IL8A 1R4QB 2RKSA 2Q8IB 5EJWA 4U68A 1O7ZA 1GHKA 3P75A 1SE2A 2B8GA 4RHRA 5IGFA 2PZUA 1E2VA 1PTOF 3K57A 2JXMB 5DNFA 4C3JB 3J7AF 4IUVA 1UNSA 1EEID 4ILWA 4KKTA 1QNKA 2K05A 1DXMA 4EQOA 2Z4HA 2R7ZB 2ZXRA 3MXUA 5FO8B 2AQ3B 3HOZB 2B63B 2L12A 4FF1A 2L5TA 1KTKA 1PTOC 3OSOA 2ZT9C 3QG1A 5CBAE 3KBGA 1TT2A 4IURA 2KA7A 1QOHA 1D1IA 3GTKB 1QJOA 2D9UA 4FXKC 3SEBA 1IYVA 1X32A 1BNZA 1L0YB 5FO7B 1DOLA 2A73B 5IGEA 1U4MA 3GQBA 1ZYRD 4DA2A 4KHZA 1G6ZA 3U9OA 4NDXA 1DM0B 3T56B 4IN3A 3TP7A 3NBHA 1DOMA 4FP5D 2NN6H 3CU7A 4HEDA 5CYUA 1RDPD 4XDXA 2L1BA 3EQLC 1NAPA 2YU9B 3S16B 3D4RA 1F9RA 4K2LA 3A8JE 4PMCA 5HGTA 2EJGC 1EY9A 3IAYA 1HRJA 1S5CD 4KV6A 2NVQB 5EQ0A 4KD3A 3PUWA 3T16A 4X3KA 1TWCB 2F0DA 1IHZA 1CHQD 2DY8A 5FLXE 1SXTA 1PRTD 2BDOA 3FMCA 4KK7A 3J80L 1HQRD 3MFYA 1PRTC 2J0TD 2A6EC 1U4PA 4DXFA 5TSSA 3TZUA 2IPKD 3J81L 3PV0A 1HFNA 2N88A 1VCIA 3Q0AA 1EWHA 1LACA 1SYBA 3SVMA 4TSSA 1A3VA 3NK9A 5EKLA 2FINB 3G7LA 2F0UA 1Q12A 3MXPA 3ND9A 5LHY1 4OO1I 3E5SA 4JBWA 3RMHA 5I9PA 4KN7C 2HDMA 2L4NA 2NN6I 4DF7A 2K1BA 3R2TA 1Q90A 3HOUB 1B53A 2NB0A 3TP6A 4F88A 2E74C 1A6XA 4C3JG 2DNEA 2KEDA 3FPUB 4K8IA 4DAPA 1IKMA 3M4YA 3MZ5A 1E0BA 4HR7B 2B2WC 1KDAA 1J9OA 2EYJA 4HMJA 5DM73 2BA1A 4IQZA 1G8ZD 1SYFA 1Y8OB 1SMYD 4ODGA 1FYCA 2M9VA 1PTOD 3G6JB 3K58A 2VNUD 4IFDH 5C3XA 3SK4A 3ND8A 2K04A 2TMPA 1D5ZC 3OMGA 3FEWX 2F0JA 4K2KA 2XRQD 4ZKCB 3VYUA 1GUSA 5HURA 2MGSA 2OEOA 2C9OA 3D31A 1PRTB 1F2MA 1WD1A 3KUPA 2H1EA 3QWNA 3MWYW 3DEPA 1QILA 1H9RA 4IUTA 1LTRD 3M85A 1TS3A 3SK8A 3J7YW 1SE3A 3V2TA 4ABNA 2SDFA 3C1EA 4F87A 2NUCA 2K03A 3PUYA 2QILA 2EYMA 2BA0A 2JEBI 3D8GA 3F2UA 2X6LA 3Q6SA 1CQFA 2F0WA 2WIIB 4IFDJ 2OT2A 4NMZA 4K5XA 4X3SA 1O80A 5C4XB 5ISRA 1SJED 4I65A 1CZWA 2B2TC 5J22A 4RCNA 2XWBB 2K5QA 3RLFA 1EYAA 2CQAA 5G3LF 5IT9E 2F0SA 2PYKA 5JOBA 4TRDA 1STBA 1AW7A 1ICWA 4QMGA 3VA7A 2NVTB 3D4DA 1QB5D 3C2PA 1LO5D 4RKLA 1V1PB 1I50B 1PFMA 1SNMA 3VR5A 1STNA 3QOLA 1NCVA 3P7JA 2F0GA 1IW7D 4CKEA 4RH6A 5DM63 3JAML 3KLSX 4RGNA 4BWGB 1H9JA 3TMEA 3CKIB 3HS0C 4E6IA 2TSSA 2WV6D 3OIPA 1AFPA 1DZ1A 5CBEE 3KBXA 2HUGA 4K14A 1AEXA 2FFKB 2CW0D 3I4MB 2M00A 5ELFA 1JCKB 4AYBB 3DWPA 2EZVA 1B50A 5I4DA 5C5MA 5AFWA 5C4HA 2QEJC 5EBCA 1I4HA 1SDFA 4IZ8A 4G7HC 4IFDI 2LMCB 2WKCA 1CQVA 2PO4A 4DN4M 1G91A 3K7AB 3I73A 5K5PA 1NSNS 1FGBD 5K36G 1HHVA 4M1UB 3N52A 4UAIA 4C3HG 1WD0A 1RODA 1YNNC 3N6RA 1I4PA 1PFNA 2R61A 5JEAG 5CV8A 1TWGB 1DONA 3SE0A 3EROA 4BBSB 2PW7A 1K8OA 1CA5A 1CTMA 3PMFA 4DAYA 3HGBA 5EKKA 1IKLA 2N55A 4FO2A 3P1HA 1LTID 4WJWA 2H4OA 1LLRD 1WTVA 2F0OA 5M5WB 2RDFA 2HCCA 3QB3A 3PUZA 1SNOA 1FNUA 1YNJC 1CFMA 3DUZA 5C4JB 4KTAA 4BBRB 2QDBA 3RUZA 4B9XA 4RHSA 1ONLA 1MGSA 1R9TB 2NVXB 5C6AA 4IUUA 3DHQA 5IIFA 1EY5A 1YNJD 1SJHD 5C3EB 3HOWB 1B1ZA 1GUOA 2SEBD 1T5XD 2F03A 5FK9C 1U4RA 3FPPA 1XX8A 3KF8A 2BE5C 1SNQA 4PV1C 3PUVA 1X3QA 5ELEA 1XXGA 2AQ2B 1LTSD 4BA1I 1HTPA 1JB3A 2EYOA 4RFBA 4PNYA 2XNAC 1OXTA 1GXDC 1PDQA 3NQTA 4L63B 5KNCA 2VB2X 2VXWA 3AMUA 1WTWA 1WCMB 1HQMC 1WTPA 1W6JA 2B2UC 4A93B 1KDBA 2F0MA 4LK1C 3VR3A 5CV4A 1Q1EA 2AWOA 2B2VC 3MHBA 3CHBD 2XWJB 3IKJA 1AZQA 4IALA 4BA2I 3LNNA 4EVOA 2RSOA 2KEEA 3A7LA 3DM1A 1ILQA 4PQXA 4YIJA 2JP1A 1EY7A 1AZPA 3WDNA 2EY2A 2WP8J 3X3MA 3NWSA 1BBXC 2B39A 1BCPD 1RD9D 4CKBA 2MPMA 3K5LA 3MA2B 2VUMB 1WVLA 2B2WA 4TKOB 3BVZA 1A2TA 1T5EA 3TBIB 1Q1BA 2B2YA 3NSWA 4HMIA 1LT3D 1WTQA 3RZDB 3NP8A 5BN4A 3I4LA 1A3UA 1IYUA 3GTPB 1K83B 4OL7A 2MP1A 2RA4A 2D2CC 3DWAA 1HXYD 3GD7A 3MAQA 5JPMC 5C0XH 1HUMA 2ZXPA 1PTOB 1CHPD 1H9MA 1STAA 4C3IG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KD4 A;  4KJN A;  5JOB A;  3SK6 A;  3ERO A;  5C4Z A;  4TRD A;  2F0D A;  1STB A;  2PZT A;  1IHZ A;  2PW7 A;  4QMG A;  5F2D A;  2PQE A;  5C3X A;  3H6M A;  4EQO A;  1A3T A;  1SYD A;  2EYL A;  3HZX A;  3D4D A;  2F0Q A;  5CV7 A;  3R3O A;  1KDB A;  4RKL A;  2SNS A;  2F0M A;  2F0L A;  1NUC A;  2HQE A;  4ID6 A;  2F0P A;  1SNM A;  2O4X A;  4KY7 A;  3SK4 A;  2WAC A;  3PMF A;  4KJO A;  5CC4 A;  1STN A;  3QOL A;  5IGB A;  2EXZ A;  1EY6 A;  3BDL A;  4WOR A;  3DMU A;  5CV4 A;  4S3S A;  5CV5 A;  5EKK A;  5M9O A;  3BDC A;  2PW5 A;  3MHB A;  3OMG A;  2F0G A;  2F0J A;  2EYH A;  4IAL A;  4K2K A;  4ZQ3 A;  1EY4 A;  5KRU A;  5E1F A;  2KHS A;  3P1H A;  4EVO A;  5IGG A;  2F0F A;  3OSO A;  2EY6 A;  5HUR A;  4HTH A;  5C3W A;  2EYF A;  1SYC A;  2OEO A;  1SYB A;  4QF4 A;  2F0H A;  2OXP A;  5IGD A;  2F0O A;  1TT2 A;  1F2M A;  3C1F A;  3TME A;  3EVQ A;  2RDF A;  4YIJ A;  4MIU A;  5EGT A;  5IOC A;  3EJI A;  1ENA A;  4H7B A;  1ENC A;  1EYD A;  1RKN A;  3QB3 A;  4K8J A;  5DEH A;  1EY7 A;  4LAA A;  4E6I A;  4IUN A;  1A3V A;  3NK9 A;  5EKL A;  4K5W A;  5CGK A;  1SNO A;  1F2Z A;  2EY2 A;  4ME5 A;  3TP8 A;  3NXW A;  3NHH A;  4ZUI A;  4DU9 A;  2F0I A;  4R8N A;  2F0U A;  1U9R A;  2PYK A;  1II3 A;  4K5V A;  4KTA A;  5KGU A;  4KHV A;  3MXP A;  1SYE A;  1SNP A;  4K14 A;  4KY6 A;  1AEX A;  2QDB A;  3E5S A;  5NUC A;  3RUZ A;  4ZUJ A;  3D4W A;  4B9X A;  5I6Y A;  5IGC A;  5E3F A;  3OMC A;  5I9P A;  1SNC A;  2M00 A;  4N9T A;  5I6W A;  5C6A A;  3SK8 A;  2F0T A;  1JOR A;  3VA5 A;  3SK5 A;  2F0V A;  3DHQ A;  3V2T A;  4DF7 A;  5IGE A;  2F3W A;  1SND A;  1A2T A;  1STH A;  3C1E A;  5IIF A;  2F3V A;  5DAU A;  1EYC A;  3SHL A;  5C5M A;  3OWF A;  1STG A;  2LKV A;  1EY5 A;  4RKB A;  4NP5 A;  2NUC A;  3NUC A;  5C5L A;  3TP6 A;  1EY8 A;  4EQN A;  1SYG A;  4HMI A;  5C4H A;  5KYL A;  3SR1 A;  3S9W A;  5J39 A;  2EYM A;  3U9O A;  4QB4 A;  4N9P A;  3D8G A;  4IZ8 A;  1EZ6 A;  3HEJ A;  4NDX A;  2ENB A;  3ITP A;  3SXH A;  1EZ8 A;  2OF1 A;  5KYI A;  4DGZ A;  2RKS A;  4F7X A;  3MEH A;  4PMB A;  1TQO A;  2F0W A;  3NP8 A;  1EY0 A;  3TP7 A;  5K5P A;  1NSN S;  1JOK A;  2PZW A;  1STY A;  5IOD A;  3P75 A;  3MVV A;  3T13 A;  1KDC A;  1JOO A;  4NMZ A;  4K8I A;  1A3U A;  4K5X A;  1KAB A;  1SNQ A;  1TR5 A;  2EYP A;  3MZ5 A;  4DFA A;  1JOQ A;  4G57 A;  5KIX A;  2EY1 A;  4OL7 A;  5I9O A;  5ISR A;  1KDA A;  3QOJ A;  5IGF A;  2PZU A;  2EYJ A;  3ERQ A;  2F0E A;  4B9W A;  4WRD A;  3TP5 A;  4HMJ A;  2F0K A;  4K6D A;  4K2L A;  4PMC A;  4F8M A;  5HGT A;  5CR3 A;  3LX0 A;  4KY5 A;  1EY9 A;  4I65 A;  2EY5 A;  2SNM A;  2SOB A;  4J1M A;  5CV8 A;  5J22 A;  2EYO A;  2KQ3 A;  4NKL A;  4PNY A;  2F0N A;  4KV6 A;  5KEE A;  1SYF A;  1EQV A;  5JAV A;  3NQT A;  4KD3 A;  1F2Y A;  5CV6 A;  1EYA A;  4ODG A;  3T16 A;  5CV9 A;  4EQP A;  3D6C A;  4J6H A;  1STA A;  5J1Z A;  1KAA A;  2F0S A;  2RBM A;  1A2U A; 
#chains in the Genus database with same CATH topology
 5IY0 A;  2MFI A;  4JPB W;  1N34 L;  5F2D A;  1VQL A;  2E75 C;  5M5Y B;  4GKJ L;  1SYD A;  1C0A A;  1KLU D;  2SNS A;  4X66 L;  4ID6 A;  4LF6 Q;  3PO3 B;  1B4O A;  4XQJ A;  1D5X C;  5LMN W;  3H94 A;  4WOR A;  5CV5 A;  2AUK A;  2C35 B;  5JEA H;  2J4X A;  4C3I B;  5M3F G;  4G7Z C;  2KHS A;  1HUN A;  1SSO A;  4V0B A;  4O1N A;  1JJC B;  4EGV A;  2F0H A;  3NQI A;  2R93 G;  2HCI A;  3WOF A;  1OXS C;  1PZI D;  2Q2I A;  3EJI A;  4LF6 L;  4LNQ A;  1EYD A;  1CM9 A;  1J5E Q;  1LTG D;  3NBI A;  1Q86 C;  2KCN A;  4DNT B;  4OIK A;  2Q8T A;  2NTT A;  4A3F B;  3Q22 A;  1NR2 A;  1ET6 A;  5KGU A;  4KHV A;  2FMM A;  1XNQ Q;  3BYY B;  4JI0 Q;  2Z9H A;  2HIX A;  1PZJ D;  1G6P A;  3S2D H;  5IGC A;  1G29 1;  5JJZ A;  3TS0 A;  3NPP A;  3VA5 A;  1EU4 A;  2F0V A;  4JCV E;  2I07 B;  4TVA B;  1ILP A;  5C5L A;  3QO2 A;  4GN5 A;  4EQN A;  1KAW A;  3R2I A;  2CWP A;  1JJG A;  1I6H H;  2I5H A;  1Z6H A;  4JW0 A;  4BS9 A;  3HEJ A;  5IWA Q;  1SE4 A;  3WWV A;  1KNE A;  1VQM A;  1O7I A;  3S14 H;  4JVZ A;  4QY7 A;  2CW0 C;  3F2D A;  3KLR A;  1GUT A;  2VS1 A;  3MVV A;  4JI1 L;  2R92 H;  1DCZ A;  3PUX A;  5M3M B;  1JOQ A;  1Z7T A;  2UXC L;  2XRS D;  5C4X H;  3G6E A;  2F4I A;  5C0X I;  2UXD L;  1GOZ A;  3HP3 A;  2F0K A;  4DR7 L;  4F8M A;  1FGU A;  3EA6 A;  3LX0 A;  3BYT B;  4J1M A;  3GTG B;  4NW2 A;  1N33 L;  5IYC H;  1PYW D;  3L9A X;  3TZD A;  3CAM A;  4OHJ A;  1SLJ A;  1YHB A;  3VYT A;  2EPB A;  1M1K C;  5J1Z A;  1S5F D;  1HTL D;  4WFN 3;  1K8M A;  1D5M C;  1ESR A;  3RLO A;  1EWI A;  1CUK A;  2O4X A;  1RHP A;  3S1Q B;  1NMG A;  5M9O A;  2UUA L;  4OO1 G;  2LSS A;  2A6E D;  4CKC A;  1TWA H;  2B63 H;  3QJY A;  4JBK A;  4JV5 Q;  4A3I B;  3NTH A;  5IGD A;  4XQN A;  1TY0 A;  2DNC A;  1C4Q A;  3CCQ A;  3OTO Q;  2R7Z H;  4OWX B;  1X55 A;  3S17 B;  1F2Z A;  4C1N I;  1HJP A;  4ZUI A;  3R93 A;  2Z8L A;  3TEH B;  4B08 A;  4Y7N B;  2MNA A;  4A3I G;  1LTB D;  1VF7 A;  1K28 A;  4DV6 Q;  3JAM E;  4XT1 B;  4A3G G;  2QEX A;  3PO3 H;  3ONA B;  4JI7 L;  4Q0F A;  3PIO A;  2E2J B;  5EBD A;  1BBU A;  4DR5 L;  3UDX A;  1B7Y B;  1LT6 D;  2K52 A;  4C56 C;  4GZY C;  4GLA C;  4DAV A;  3PO2 G;  1TWF B;  2LFN A;  2LKV A;  4RKB A;  1HNZ Q;  4A3G H;  5BN5 A;  2RSN A;  3J81 j;  5G3L D;  2B2V A;  1B44 D;  3RD4 A;  1EZ6 A;  3GTL B;  1XJV A;  3ITP A;  4A93 H;  5IP9 G;  2QF7 A;  3U58 A;  2BH8 A;  1TQO A;  1JC7 A;  5IOD A;  2PZW A;  1L2F A;  2UUC L;  3L7Z C;  3PO2 B;  4HCE A;  3GTQ B;  4DFA A;  2DGY A;  4RMF A;  3G71 A;  3CCU A;  5KIX A;  3PO3 G;  4DXG A;  4A3E B;  2JJQ A;  4HJ8 A;  4JI2 L;  3M3Y H;  4UPA A;  1CKM A;  4OEL B;  2KUM A;  3GDE A;  1KQS A;  2SOB A;  2PQA A;  5D3D A;  2JA5 B;  1YHA A;  4KN4 C;  1MHW C;  1N36 Q;  4KKS A;  4CGY B;  1EOV A;  1VMP A;  2GVB A;  1TWC H;  3J81 E;  5ELD A;  3VYR A;  4A75 A;  4KD4 A;  4KJN A;  1LM0 A;  1PMR A;  3IRB A;  1V9P A;  1HPC A;  1XYI A;  5C44 H;  1XNR Q;  1B2T A;  3AQQ A;  4A3J B;  4HSV A;  1SE8 A;  2EYL A;  1DYQ A;  1PZK D;  1G2T A;  1TU2 B;  2KHI A;  1UEA B;  5CV7 A;  4YCW A;  1OXV A;  2YYZ A;  4NPS A;  4OON A;  2JA5 G;  4X6A H;  2F0L A;  1CT1 D;  2HQE A;  3HOY B;  3BVG A;  1FNV A;  5IYC G;  4HID A;  4Q5V A;  4S3S A;  5ELC A;  3H0G H;  2DUD A;  4NB3 A;  2ICE C;  2OXP A;  2EJF C;  3S24 A;  1E22 A;  5E4W C;  5T1G A;  4X64 Q;  4B3M Q;  3AEV A;  1Y1V B;  2A6H D;  2R92 G;  4H7B A;  5D14 A;  2L11 A;  2X69 A;  4IUN A;  1L0X B;  5E7N A;  2F1M A;  3E0J A;  2EIF A;  2ZM6 L;  4DU9 A;  3MXN B;  4LF9 Q;  2ZM6 Q;  1W6K A;  3ZYY X;  4YCU A;  2ICI A;  2MUY A;  1YNN D;  1IYJ B;  1O7Y A;  4KY6 A;  2K7V A;  4R4Q A;  1EOT A;  4ZUJ A;  3EFX D;  5M5W H;  4JBM A;  1R9T H;  2R7F A;  1BKB A;  4RWS C;  1R4P B;  1C9O A;  1VQF A;  1PV4 A;  3H0G B;  1JE4 A;  2E2I B;  1I3Q H;  1YVC A;  2UU9 Q;  1STH A;  1JQY D;  1EYC A;  2ZTE A;  1L1O B;  5A2Q L;  1Y1W G;  3PIP 3;  5KYL A;  3A5U A;  5J39 A;  3GTO B;  4AYB G;  3AU7 A;  1HNX L;  3OW2 A;  2F4V L;  2UXB Q;  1FR3 A;  4HJ7 A;  3KF6 A;  4DGZ A;  2JA5 H;  1JWM D;  1EWC A;  4PMB A;  1PXU A;  1LAB A;  1TY2 A;  3FVQ A;  1STY A;  3BG3 A;  3M3Y B;  1TWG H;  4A3K G;  1KNA A;  3PIO 3;  2EYP A;  3NTI A;  5D65 A;  2V4D A;  2K5H A;  3DM3 A;  5GAH C;  4B9W A;  3TP5 A;  3J80 c;  1RTN A;  2J7Z A;  3MTS A;  1JE5 A;  3CQZ B;  1IBL L;  1EIY B;  3HOX G;  3VR4 A;  3O13 A;  3I4O A;  4LF5 Q;  2F0N A;  4OXP A;  1VQD A;  3H91 A;  1GUG A;  2JA7 B;  1NY4 A;  3GTQ H;  4IUP A;  2ASB A;  3F2B A;  2UUA Q;  3SK6 A;  1RIP A;  4X65 L;  4DV2 L;  2Z6K A;  3S14 B;  2PI2 E;  5LL6 S;  5KND A;  2PQE A;  1VQO A;  2F0Q A;  3M4O B;  2I46 A;  3R3O A;  2PPB C;  2LXK A;  1CKN A;  5CC4 A;  1NMF A;  4LFB Q;  1HNZ L;  4A3G B;  2K5N A;  3VYS A;  1GO3 E;  3NE5 B;  2EXD A;  3F2C A;  1TWA B;  2R3Z A;  5A2Q E;  3HOX H;  1JJ2 A;  4I7A A;  5E1F A;  1BCP F;  2LS0 1;  2EYF A;  4JYA Q;  4AQY Q;  2D62 A;  5M5X B;  3NEM A;  1PLF A;  4DV3 Q;  3I4N B;  1MSG A;  1RKN A;  1I4X A;  4XTC S;  3TDQ A;  4K5W A;  4B3T L;  2RF4 A;  2E2D C;  2QKI C;  2WKD A;  1XPO A;  4H44 C;  3EN2 A;  4L5Q A;  5BN3 A;  1I4R A;  1B70 B;  3X3N A;  4DR2 L;  1ASY A;  5C4X G;  3CCM A;  4JI7 Q;  2C5C A;  4Y52 H;  2XSC A;  1V43 A;  1GJX A;  4H02 A;  1LV9 A;  3OW7 A;  4DV6 L;  3MXG A;  3HFZ B;  3SK5 A;  4DK1 A;  4JV5 L;  3S1M H;  2G9H D;  1PRT F;  2F52 A;  5AJ3 L;  4DR4 L;  2O5I C;  4XYQ A;  4DV2 Q;  1SAP A;  3VDY A;  4CJ1 B;  3C3L A;  1Z47 A;  1LTA D;  2A69 C;  3Q23 A;  3S2H B;  4C3J H;  3SR1 A;  5FLX L;  1GKH A;  4Z9C B;  5LMN Q;  1MD2 D;  3S1N B;  1Q3L A;  4QB4 A;  3SXH A;  1C8C A;  2IX0 A;  2IT1 A;  5JEA J;  5KYI A;  1X9N A;  1Q8I A;  2FHT A;  4KKU A;  4CDE C;  1YJN A;  3GTG H;  4X3U A;  2IHF A;  3E0E A;  1EEF D;  4A3J G;  2XTI A;  1PH9 A;  1KDC A;  1QZG A;  3S2H H;  3M7G A;  2RCF A;  1KAB A;  2RQX A;  2KJX A;  5I9O A;  4R9W A;  2XIW A;  4DR2 Q;  5IP7 H;  4XYO A;  1N33 Q;  5M3M H;  3S1M B;  2F3I A;  1Q46 A;  1I50 H;  1Y69 U;  3K7A H;  2UXD Q;  5C0X J;  2KOL A;  4HJA A;  1TVX A;  1F2Y A;  1SFO B;  2JA9 A;  3CC4 A;  1BUV T;  1HNX Q;  1VDZ A;  2CKZ B;  2N49 A;  4DNR B;  2Z6K C;  2R92 B;  2PCF B;  5M3F H;  4G7O C;  3DXJ C;  2PZT A;  3NTK A;  1V1Q A;  3SGI A;  3K5N A;  4KHP Q;  1V8Q A;  4DR7 Q;  4JI4 L;  4DV3 L;  4JK1 C;  5COR A;  1K0S A;  3S1N H;  2F0P A;  2LY7 A;  1M8A A;  2WAC A;  1F77 A;  4ZRZ A;  1BCP B;  4A3D B;  3GTJ B;  1PH4 A;  3UE1 A;  1LTT D;  5FLM H;  4LF9 L;  3C46 A;  4QF4 A;  1QE6 A;  1F9S A;  1X54 A;  2HHH Q;  1FJG Q;  3DWQ A;  1V1O A;  2NN6 G;  2Z6B A;  4H13 C;  4HAE A;  3WOE A;  3J80 E;  4XXE A;  4UP8 A;  2KCM A;  1BOS A;  2BDN A;  1TXY A;  3W2D A;  3K0Y A;  3I90 A;  5GAG C;  2DJF C;  2KVM A;  3GO5 A;  2LXJ A;  1SYE A;  1D2B A;  2DN8 A;  4GS3 A;  4LF5 L;  1S5B D;  4C3H B;  5JPN C;  2PNH A;  3OHX C;  2NZ1 D;  4OO1 H;  3D3R A;  1DOK A;  4CBV A;  2VB3 X;  3HOX B;  2EOT A;  1ZYR C;  1EQT A;  2VUM G;  2E2H H;  4HN7 A;  3A54 A;  4CJ0 B;  2A74 C;  1AH9 A;  2JA6 G;  4AYB E;  3RZD H;  1S4Z A;  2ES2 A;  1KRS A;  3FRP B;  4DPG A;  4AQY L;  4O0A A;  4OWW B;  2QCP X;  4DV1 L;  2F4V Q;  3BDO A;  4N8X 1;  1JOO A;  2IJ0 A;  4IUQ A;  1PH3 A;  2EY1 A;  4FF4 A;  3QOJ A;  1I4G A;  2CHB D;  3G4S A;  2OCE A;  3M4P A;  3BVM A;  5C0X G;  3D6W A;  1BQQ T;  3KDF A;  4ZAI A;  4GKJ Q;  3L2P A;  5CR3 A;  3CXC A;  4B3R Q;  4IJH A;  1A8V A;  4A3C H;  4EQP A;  3GTM B;  5JJL A;  2RDG A;  4QJF A;  4A3L G;  1H9S B;  1ZKO A;  3I55 A;  3UI2 A;  3I70 A;  2EVB A;  2JSO A;  4ZK9 B;  3HZX A;  1CK1 A;  4UP9 A;  4U67 3;  5JVH 3;  3RNU A;  1ML0 D;  4FVM A;  3ULL A;  3MXN A;  2A6H C;  2BCO A;  1O78 A;  5IGB A;  3BDL A;  1TS2 A;  2IX1 A;  3AB9 A;  4FYD A;  2L15 A;  1STE A;  2EYH A;  4ZQ3 A;  4L8J A;  5JVG 3;  1SBB B;  2PMZ B;  3Q24 A;  3PCO B;  3HOW G;  2NWG A;  2OWO A;  1QVG A;  2JA8 B;  2NZO A;  4JI5 Q;  3I8Z A;  2EJM A;  1RCV D;  5DEH A;  3J81 i;  1EIH A;  2R93 B;  4ME5 A;  3W5O A;  5JJI A;  1KRT A;  2Z1C A;  4ALP A;  1GD7 A;  4K5V A;  1WTO A;  1JR0 D;  1VMC A;  1Z9F A;  2VL6 A;  5EAY A;  2I5M X;  2PQA B;  2JA8 G;  2M2L A;  4OIJ A;  1YNX A;  3M4Q A;  3JAM c;  5IP9 H;  2F0T A;  4K0K L;  2A1A A;  3FDT A;  4RGM A;  1D1K A;  1NR4 A;  1SMX A;  4KLK A;  1PH8 A;  4DK3 C;  5DAU A;  5IT9 L;  3SHL A;  1VQK A;  3HOV G;  1YJ9 A;  4NP5 A;  3HRZ C;  3HOV H;  2RHS B;  3CRL C;  1HFG A;  4YWM A;  4R8I A;  4BY1 B;  2K28 A;  4FF2 A;  2YTV A;  3J80 i;  1YIT A;  3LWE A;  3MEH A;  4LF8 L;  2XVS A;  1HA5 A;  4NXM L;  3T53 B;  1WCM H;  2CCZ A;  2ZTC A;  3A5Z B;  4ZLT F;  3HOV B;  2PNR C;  1AN8 A;  3VR2 A;  4DV5 Q;  4IJL A;  4G57 A;  1SEB D;  2B2U A;  2JEA I;  1I3Q B;  4YY3 L;  3GTJ H;  3CCJ A;  1CA6 A;  1E2Z A;  5M3M G;  5A35 A;  4R4C A;  4NKL A;  4K6L A;  4AIM A;  4GKK Q;  1SMY C;  3J81 c;  5EPL A;  4BBR H;  1I94 L;  1U0L A;  5C4J H;  3D6C A;  3CCV A;  1KAA A;  2AUJ D;  2RBM A;  1V1P A;  4XIG S;  2AWN A;  3E9I A;  1HZB A;  1CZG A;  5JJK A;  3W3A A;  3K59 A;  1TS5 A;  2JE6 I;  4ZYS A;  1ZXT A;  4DR3 L;  4HIK A;  1QVF A;  2IWH A;  2B2Y C;  2IY5 B;  1H9K A;  4LJZ C;  1KHI A;  4G4K A;  4GN3 B;  5KRU A;  5IGG A;  5CMD A;  1Y8P B;  2OTJ A;  4HTH A;  3S1Q H;  2NYZ D;  3A7A B;  1J5E L;  1E1O A;  4LWC A;  5KNB A;  2K6A A;  4ULL A;  1GHJ A;  1XPU A;  4P2C B;  3FKI H;  3VR6 A;  1ENA A;  3PIP A;  4CJ2 C;  2JA6 B;  3RZO B;  3J7A V;  4UDU C;  4JI4 Q;  3TP8 A;  3NXW A;  1TWH B;  2F0I A;  1M4V A;  3KJO A;  4BY7 B;  3I3C A;  5K36 H;  2A8V A;  1L1O A;  1NNX A;  2NVY B;  4DV0 Q;  2PI2 A;  5NUC A;  1A63 A;  2HIV A;  1BCP C;  2H5X A;  3H3V C;  2K01 A;  4N9T A;  3T51 B;  5I6W A;  1JOR A;  2MO0 A;  1TS4 A;  3V96 A;  4A3M B;  1SND A;  1MI2 A;  2AHO B;  5FO9 B;  3S1R B;  3HOZ H;  1VQG A;  2UXC Q;  1B9N A;  3KJP A;  1EY8 A;  1SYG A;  4DUZ L;  1K3B C;  1PHJ A;  2CWA A;  3MFG A;  2WFW A;  2ENB A;  2L9H A;  2AMC B;  1XTC D;  1YEZ A;  5T1I A;  1J8I A;  5IWA L;  1EY0 A;  1JOK A;  3CCE A;  1M90 C;  1CI3 M;  4RAU C;  4YWK A;  1BXT A;  4XQQ A;  3AYH B;  1JWU D;  3T1H Q;  3IFD A;  3K81 C;  5GRO A;  1JMC A;  1DJR D;  1BR9 A;  2A19 A;  2GA4 B;  3I4M G;  2NTS A;  2SNM A;  4FDB A;  3NBH B;  3I4M H;  1W3S A;  3S2D B;  2K5V A;  2K5W A;  1MSH A;  4X3T A;  4LF7 Q;  2RCN A;  1EL0 A;  4J6H A;  4A3F G;  3ER0 A;  2CVR A;  2KCT A;  3OPO A;  3U9S A;  4RA8 A;  1QG7 A;  2JYO A;  3S17 H;  2EQS A;  3DEO A;  5E4X A;  3R8B A;  3H6M A;  1A3T A;  3URY A;  1LTL A;  3CC7 A;  4DUY L;  3UE0 A;  4ZKB B;  3A55 A;  1QCB D;  3KF8 B;  2FJ2 A;  3LWU A;  1I6H B;  3QR8 A;  2IHE A;  1QNU A;  4KJO A;  1GM5 A;  1EY6 A;  1IW7 C;  1DD2 A;  3B6Y A;  3BDC A;  1E2W A;  1I4Q A;  1SRO A;  3BS1 A;  1D7Q A;  1VS0 A;  3HKZ E;  4KMU C;  2IX3 A;  4PMW A;  4M8A A;  1SYC A;  3K6O A;  2ZTD A;  3OYY A;  3ULP A;  1XPR A;  4RGO S;  1MBY A;  4JBJ A;  4MIU A;  4JI8 Q;  5IOC A;  4LF4 Q;  1ENC A;  2V1C C;  1A0I A;  1BBW A;  1QUQ A;  2Q2T A;  4OX9 L;  1T9H A;  1L1O C;  4R8N A;  1S5D D;  1RTO A;  3E3X A;  2D0P A;  3CRK C;  2BE5 D;  1SNP A;  1LT4 D;  4JI3 Q;  5I6Y A;  5LL6 X;  1O7L A;  5FKA C;  3A8K E;  2E76 C;  3OMC A;  1SNC A;  1S5E D;  4RGT A;  3T1Y L;  4QIW B;  1HCZ A;  1VQB A;  1X65 A;  2NVT H;  1N32 Q;  3TSS A;  1RF2 D;  4C3I H;  1Y8N B;  2NBF A;  3OWF A;  4QUF A;  2WIN B;  3CCS A;  4N8F A;  1OXU A;  1H9S A;  3S9W A;  4NXM Q;  4DUY Q;  1K3R A;  3FKI B;  2B2T A;  1J6Q A;  1K8G A;  1ZEQ X;  5I2X A;  4L5T A;  1Y1W B;  2JK8 A;  4YWL A;  2VZA A;  1W2B A;  1GUW A;  4QUC A;  1N8R C;  2HDL A;  3LGJ A;  1KXL A;  2QW7 A;  1EFW A;  1TR5 A;  3IFT A;  3MC0 B;  3GV6 A;  3KLW A;  4HSP A;  2F0E A;  4CHT B;  2AKW B;  2YTX A;  5D3I B;  4A3K B;  4K6D A;  1VF5 C;  1WTR A;  1EU3 A;  2IW3 A;  2L55 A;  3D0F A;  4WJ3 M;  1NBW A;  4DR1 Q;  4A3J H;  2MJ8 A;  3P20 A;  4FF3 A;  1FVI A;  5C44 B;  5JAV A;  1EQV A;  1K83 H;  5CV6 A;  3GTP H;  2L0C A;  3T1H L;  5CV9 A;  1LUZ A;  3I72 A;  4FNF A;  1SN8 A;  1I6V C;  3K5O A;  4IPC A;  4JC0 A;  3GTM H;  1F2L A;  4A3B B;  1Y14 B;  2G9D A;  2JA7 G;  3GV3 A;  2ZXO A;  1F9P A;  3OWE B;  1VQC A;  1XWE A;  4JI5 L;  1NUC A;  2R6G A;  1C48 A;  3H09 A;  4IFD G;  1U4L A;  2HT1 A;  1N9W A;  4NXN Q;  4TQU S;  1TII D;  2F0F A;  5IYD H;  2EY6 A;  3J7A 5;  1PH6 A;  2OTL A;  1JWS D;  1OO9 B;  2EDG A;  4KI0 A;  1BO0 A;  2A68 D;  3NWT A;  3EVQ A;  3CCR A;  3M4O H;  2KCC A;  4MHE A;  5EGT A;  4MN3 A;  1MJC A;  5I2Y A;  3OIQ A;  4LAA A;  5CGK A;  2GN5 A;  4DV5 L;  2JQO A;  2YV5 A;  4X62 L;  1U9R A;  3OOC A;  4OGQ C;  1PTO H;  2A68 C;  1CKO A;  2ZJR A;  1B9M A;  5E3F A;  1ENF A;  1LT5 D;  3I91 A;  1IZ6 A;  1JIC A;  3BZK A;  1AP0 A;  4L6T B;  3M7N A;  1GUN A;  1VQE A;  3HKZ B;  2B8F A;  4P71 A;  3NUC A;  4HCS A;  2Z0S A;  1P16 A;  4O2D A;  1CSP A;  2MHV A;  3QIA A;  4N9P A;  2K14 A;  2RDH A;  1BF4 A;  1BDO A;  4F7X A;  3W1B A;  2WAQ B;  4DR1 L;  3HOY G;  2JA8 H;  1F9Q A;  3HKZ G;  3A56 A;  5IYB H;  3A8I E;  1D6E C;  1X3P A;  4PZ8 A;  1FD7 D;  1EFI D;  4LFA Q;  1UAP A;  2EE1 A;  2K5D A;  4QL5 A;  2NVQ H;  3ERQ A;  4JOI C;  3TN2 A;  4WRD A;  2MQH A;  4V19 0;  1ET9 A;  3CW2 C;  2JN4 A;  1Y1V G;  4KY5 A;  1PH5 A;  2EY5 A;  1NTG A;  1XNR L;  2BOS A;  3KK7 A;  2KQ3 A;  1EIG A;  1UEB A;  5KEE A;  3HG9 A;  4FXG C;  2WB1 E;  4RCO A;  1GVP A;  4QQB X;  4IPH A;  1ESF A;  5ELB A;  5FOB B;  1WI5 A;  4NXN L;  5EKI A;  3T13 A;  1A2U A;  3C1F A;  5C4Z A;  2VQE L;  1X56 A;  2O2L D;  4LMQ D;  2X6G A;  2RVL A;  4MTN A;  2AQ1 B;  1Y1W H;  2K33 A;  4C2M B;  4GLV B;  1JT8 A;  2D5D A;  1RJT A;  2K32 A;  2KEC A;  1U5K A;  3JC6 6;  2A69 D;  1FJG L;  4C1N K;  3S15 B;  4KY7 A;  3KFU A;  4FXD A;  2EXZ A;  1OXX K;  3DMU A;  4JI3 L;  2PW5 A;  1FNW A;  4A3L H;  4JI6 L;  1EY4 A;  3KLS A;  3RLN A;  1UUP A;  4J8Q A;  1QWY A;  4XT3 B;  5C3W A;  2CFM A;  2Z4I A;  2Q8R E;  2WB1 B;  5H1S E;  4DV1 Q;  3E6Z X;  1S72 A;  4MZ9 A;  3T4A C;  2XGT A;  4I7Z C;  4K8J A;  1KLG D;  3IL8 A;  4KHP L;  4BXX G;  5COY A;  2XN9 C;  3NHH A;  2E2H B;  4DK0 A;  1PFB A;  2DY7 A;  1B3A A;  1II3 A;  1G2S A;  1WTX A;  4ME3 A;  4AH6 A;  1PH7 A;  1A15 A;  1S40 A;  4B3S L;  1PFS A;  3D4W A;  1EQR A;  2A5H A;  5EPJ A;  4CDF C;  4LF7 L;  1C7Y A;  2Y0S B;  1SR3 A;  2R7D A;  3L3O C;  4QCL A;  4HIO A;  3K5M A;  1K73 C;  1TKW B;  2ATW A;  2F3W A;  4H0L C;  5C3E G;  2F3V A;  4A3B H;  4LFC L;  2PMZ E;  4O42 A;  1STG A;  1HA6 A;  5M3F B;  3BZD B;  3V05 A;  5EPK A;  2ID0 A;  1K8A C;  3GP7 A;  5C44 G;  3PO2 H;  2IL8 A;  4POG A;  3PQI A;  1P8L A;  1N32 L;  1SFO H;  3SDZ A;  2E5L L;  2Q2H A;  1EZ8 A;  2OF1 A;  2Y0S G;  2O5J C;  1IL8 A;  1R4Q B;  2RKS A;  4A3C G;  5C3E H;  2Q8I B;  3GTL H;  4A3B G;  5EJW A;  4U68 A;  1O7Z A;  4OWT B;  1GHK A;  3P75 A;  1A62 A;  1E3P A;  1SE2 A;  2B8G A;  3CMA A;  4RHR A;  3BZC A;  5IGF A;  2PZU A;  1MJE A;  1E2V A;  1PTO F;  2NVX H;  3AFP A;  3K57 A;  3I4N G;  2R7Z G;  5J3B A;  2JXM B;  1WCM G;  2ZJQ A;  3EIV A;  5DNF A;  5ELO A;  1RL2 A;  4C3J B;  3J7A F;  4IUV A;  1XNQ L;  3HOZ G;  1UNS A;  4Y7N H;  1EEI D;  4YHH Q;  4DV0 L;  2B63 G;  4ILW A;  4KKT A;  1VQ8 A;  4POF A;  1QNK A;  2K05 A;  1DXM A;  1G51 A;  3UDF A;  4EQO A;  5IYD G;  4MTK A;  2Z4H A;  2R7Z B;  2ZXR A;  3MXU A;  5FO8 B;  3CF5 A;  2AQ3 B;  4HJ5 A;  3S1R H;  3HOZ B;  2B63 B;  2L12 A;  1IBK Q;  4FF1 A;  3U4Z A;  2L5T A;  1KTK A;  1PTO C;  2QGQ A;  1IBM Q;  3OSO A;  4BY7 H;  2ZT9 C;  3QG1 A;  5CBA E;  3KBG A;  1TT2 A;  3A74 A;  4IUR A;  4DV4 Q;  2KA7 A;  1QOH A;  1D1I A;  3GTK B;  1QJO A;  2D9U A;  4FXK C;  3GTO H;  2DJG C;  3SEB A;  4HIM A;  3TQY A;  1IYV A;  1TWH H;  1X32 A;  4RG1 A;  1BNZ A;  2HD3 A;  2E2I H;  2I0Q A;  1L0Y B;  5FO7 B;  2VUM H;  4JI0 L;  1LYL A;  1DOL A;  2A73 B;  2VQF L;  5IGE A;  3I2Z A;  1B8A A;  1U4M A;  3GQB A;  1ZYR D;  4DAY B;  4DA2 A;  4YY3 Q;  1KIX A;  4KHZ A;  3RZO H;  1G6Z A;  3U9O A;  1YJW A;  1I94 Q;  4P72 A;  4NDX A;  1DM0 B;  2B29 A;  3T56 B;  4IN3 A;  3TP7 A;  3NBH A;  1DOM A;  5L37 A;  1IBK L;  4FP5 D;  2NN6 H;  3CU7 A;  4HED A;  5CYU A;  1RDP D;  4XDX A;  2L1B A;  3EQL C;  1YZ6 A;  1NAP A;  2YU9 B;  1HH2 P;  3S16 B;  3D4R A;  1F9R A;  4K2L A;  3A8J E;  4PMC A;  5HGQ A;  5HGT A;  2Y0S E;  2EJG C;  1EY9 A;  1QUQ B;  3IAY A;  1HRJ A;  1IXR A;  1S5C D;  4MNO A;  3NEL A;  1XTD A;  4KV6 A;  2NVQ B;  5EQ0 A;  2WB1 G;  1AE3 A;  4KD3 A;  2BH2 A;  2KHJ A;  3PUW A;  4IPD A;  3T16 A;  4JI6 Q;  4X3K A;  1TWC B;  3EBE A;  2F0D A;  1VQ5 A;  1IHZ A;  1CHQ D;  1UWV A;  2DY8 A;  1SXT A;  5FLX E;  1PRT D;  1HNW Q;  2BDO A;  1L0W A;  3FMC A;  1YI2 A;  1VQI A;  2VY3 A;  4LUZ A;  3PGZ A;  4KK7 A;  3J80 L;  3ICE A;  1HQR D;  3MFY A;  1PRT C;  2J0T D;  2A6E C;  1U4P A;  2VQE Q;  4DXF A;  4DR4 Q;  5TSS A;  3K7U C;  2NVY H;  3J7Z C;  1YBY A;  3TZU A;  1VQA A;  2IPK D;  3J81 L;  3PV0 A;  1HFN A;  1IL2 A;  2N88 A;  1VCI A;  4IPG A;  3Q0A A;  1EWH A;  5GAE C;  1K9M C;  1LAC A;  1SYB A;  2QDL A;  3S15 H;  4B3S Q;  3SVM A;  1IBL Q;  3I56 A;  1Y1V H;  3K0X A;  5M5Y H;  4GOP A;  4TSS A;  1A3V A;  3NK9 A;  5EKL A;  2Q2U A;  5FLX c;  2FIN B;  3G7L A;  4R4I A;  2F0U A;  3HOU G;  4A4I A;  1Q12 A;  3MXP A;  3ND9 A;  5LHY 1;  1UE6 A;  3KF6 B;  4OO1 I;  3E5S A;  4JBW A;  3I7F A;  3RMH A;  4DNI A;  5I9P A;  4KN7 C;  2HDM A;  2L4N A;  2NN6 I;  4DF7 A;  4C2M H;  2K1B A;  3R2T A;  1Q90 A;  3HOU B;  1B53 A;  2NB0 A;  3TP6 A;  4A3M G;  4F88 A;  2E74 C;  1A6X A;  4C3J G;  2DNE A;  1UE1 A;  3CPF A;  1HZ9 A;  2KED A;  3DLL A;  3FPU B;  1Q81 C;  4K8I A;  4DAP A;  1VQ6 A;  1IKM A;  3CCL A;  3M4Y A;  3MZ5 A;  1E0B A;  4HR7 B;  2B2W C;  1KDA A;  5IYB G;  1J9O A;  2EYJ A;  4PZ6 A;  4HMJ A;  3NEN A;  5IP7 G;  4DKA C;  5DM7 3;  2BA1 A;  1VQ7 A;  4IQZ A;  1G8Z D;  1SYF A;  1Y8O B;  3ERS X;  1SMY D;  4ODG A;  4LW1 A;  1FYC A;  2M9V A;  1PTO D;  1Q7Y C;  3G6J B;  3K58 A;  1HZC A;  2VNU D;  4APV A;  1QVC A;  4IFD H;  1N36 L;  3STB C;  2D0O A;  3FP9 A;  5C3X A;  1XMO Q;  1B3Q A;  4J15 A;  3ULJ A;  3SK4 A;  1PYB A;  3ND8 A;  2K04 A;  2P5Z X;  2TMP A;  1D5Z C;  1HNW L;  2YTY A;  3OMG A;  3HOU H;  3FEW X;  2F0J A;  5BR8 Q;  4K2K A;  4LUV A;  2XRQ D;  4ZKC B;  4ZCK A;  3VYU A;  1GUS A;  4L5S A;  2N78 A;  2CQO A;  5HUR A;  2MGS A;  2OEO A;  1UE5 A;  1X3G A;  2C9O A;  4P73 A;  3D31 A;  1PRT B;  1F2M A;  1WD1 A;  3KUP A;  4GOP C;  4JI2 Q;  1VQJ A;  1WYD A;  2FXQ A;  1ASZ A;  4DV4 L;  3G48 A;  2H1E A;  3QWN A;  4X62 Q;  3A0J A;  1E24 A;  3MWY W;  3DEP A;  1TWF H;  1QIL A;  3H3V I;  4P75 A;  2VW9 A;  1SRU A;  1H9R A;  4IUT A;  1LTR D;  3M85 A;  3F1Z A;  1TS3 A;  3PSI A;  3SK8 A;  3J7Y W;  1SE3 A;  3V2T A;  4ABN A;  2SDF A;  2N3S A;  3C1E A;  4F87 A;  4GN4 B;  1BVS A;  2QA4 A;  2NUC A;  2K03 A;  3PUY A;  5FJ8 H;  1D8L A;  1JB7 A;  2QIL A;  2EYM A;  1NE3 A;  2BA0 A;  2CH4 W;  2JEB I;  3D8G A;  3F2U A;  2X6L A;  3K80 C;  1E1T A;  3Q6S A;  3OTO L;  1CQF A;  1EYG A;  2F0W A;  4BXX H;  4A3E G;  2WII B;  2ZJP A;  4IFD J;  4BBR G;  4R4O A;  3FKI G;  2OT2 A;  4NMZ A;  4A3I H;  4K5X A;  4X3S A;  1O80 A;  5C4X B;  5ISR A;  4OX9 Q;  2GVA A;  1SJE D;  2VQF Q;  3K8A A;  4JI8 L;  4LF4 L;  3PF4 A;  4QGU A;  3U4V A;  5AJ3 Q;  4I65 A;  1CZW A;  2B2T C;  5J22 A;  4A3K H;  4RCN A;  2XWB B;  3KYH C;  2K5Q A;  3RLF A;  4GNX C;  2YU9 H;  2E5L Q;  1EYA A;  2OQK A;  4L5R C;  2CQA A;  2OQ0 A;  5G3L F;  4C3I G;  4BY7 G;  5IT9 E;  2F0S A;  2K75 A;  2PYK A;  3STB D;  5JOB A;  1HR0 L;  1AE2 A;  1VQN A;  4TRD A;  4DAM A;  1STB A;  1AW7 A;  1ICW A;  4QMG A;  3VA7 A;  2NVT B;  3TRE A;  3GTK H;  3D4D A;  1QB5 D;  3C2P A;  1LO5 D;  1X6O A;  4RKL A;  1V1P B;  1I50 B;  1PFM A;  1SNM A;  3VR5 A;  4IOC A;  1STN A;  3QOL A;  4P74 A;  3RN5 A;  1KL9 A;  3E9H A;  1NCV A;  3P7J A;  4HJ9 A;  3KOJ A;  1IBM L;  2F0G A;  1IW7 D;  4CKE A;  4RH6 A;  4YHH L;  1X3E A;  4DR5 Q;  5DM6 3;  1ICF B;  1WJJ A;  3JAM L;  3T1Y Q;  3KLS X;  1WTH A;  4RGN A;  4BWG B;  4B3T Q;  2G5D A;  1H9J A;  3TME A;  5IE8 A;  3CKI B;  3H15 A;  3HS0 C;  3I4N H;  5IT9 c;  3CP0 A;  4E6I A;  2TSS A;  2WV6 D;  1PYS B;  3OIP A;  1AFP A;  1DZ1 A;  2B3G A;  5CBE E;  3KBX A;  1HR0 W;  2HUG A;  4K14 A;  1AEX A;  1X3F A;  3H0G G;  2FFK B;  2CW0 D;  4GNX A;  3I4M B;  2M00 A;  5ELF A;  1JCK B;  4DUZ Q;  1KD1 C;  3MEF A;  4AYB B;  3DWP A;  5LMN L;  1H95 A;  4A76 A;  4A3D G;  2EZV A;  1B50 A;  5C5M A;  5I4D A;  4A3F H;  4X65 Q;  5AFW A;  5C4H A;  2QEJ C;  1CSQ A;  5EBC A;  1I4H A;  2RHQ B;  1YHQ A;  1SDF A;  4IZ8 A;  4EQ5 A;  4G7H C;  4IFD I;  4GOP B;  2LMC B;  2WKC A;  1CQV A;  4IOA A;  2PO4 A;  5M5X H;  1HZA A;  2CH4 A;  4DN4 M;  1G91 A;  3K7A B;  3I73 A;  5K5P A;  1NSN S;  4UP7 A;  2UXB L;  1WFQ A;  4IO9 A;  1FGB D;  5K36 G;  5GQO A;  1HHV A;  4M1U B;  3N52 A;  2UU9 L;  5FLM G;  3L0O A;  2HQL A;  4UAI A;  4C3H G;  1WD0 A;  1ROD A;  1YNN C;  5ELN A;  3N6R A;  1I4P A;  1PFN A;  3UDI A;  1HR0 Q;  2K50 A;  4JYA L;  2R61 A;  5LMU Q;  3M9B A;  4PZ7 A;  3F8T A;  5JEA G;  5CV8 A;  1TWG B;  1DON A;  4DK6 C;  3SE0 A;  3ERO A;  4CDD C;  2JA7 H;  4BBS B;  3UDG A;  2PW7 A;  2JA6 H;  1EQQ A;  4X66 Q;  4LFB L;  1NJI C;  4A3M H;  2K4K A;  1K8O A;  3CC2 A;  1CA5 A;  3BJU A;  1CTM A;  3CQZ H;  2WAQ E;  3PMF A;  4DAY A;  3HGB A;  5EKK A;  1VQ9 A;  1IKL A;  2N55 A;  4FO2 A;  1VQP A;  2I5L X;  3P1H A;  4BBS G;  1EIF A;  1LTI D;  4LUO A;  4WJW A;  5BR8 L;  2H4O A;  1LLR D;  1WTV A;  4GNX B;  2F0O A;  3RR5 A;  5M5W B;  4DR6 L;  2RDF A;  3CPW A;  2HCC A;  3QB3 A;  4X64 L;  4B3M L;  3PUZ A;  1SNO A;  1FNU A;  1XMO L;  1YNJ C;  1CFM A;  3DUZ A;  4LFC Q;  1EUJ A;  5C4J B;  4DV7 Q;  4KTA A;  4YCV A;  4BBR B;  2QDB A;  3RUZ A;  4B9X A;  4RHS A;  1ONL A;  3FHW A;  1MGS A;  1R9T B;  2N8N A;  2NVX B;  5C6A A;  4IUU A;  3DHQ A;  4PG3 A;  1KC8 C;  5IIF A;  3CME A;  4LFA L;  1EY5 A;  1FL0 A;  1YNJ D;  1SJH D;  5C3E B;  1MIU A;  3HOW B;  1B1Z A;  1GUO A;  2SEB D;  4JG2 A;  1T5X D;  2F03 A;  5FK9 C;  1U4R A;  3FPP A;  1XX8 A;  4R4T A;  1N34 Q;  3KF8 A;  4CDC C;  2BE5 C;  1SNQ A;  5DLQ E;  4PV1 C;  3PUV A;  4DR3 Q;  1PH1 A;  4GLX A;  1X3Q A;  5ELE A;  1XXG A;  3CD6 A;  2AQ2 B;  1LTS D;  3KDF B;  4BA1 I;  3HOY H;  1HTP A;  1JB3 A;  1XMQ L;  1UE7 A;  2EYO A;  2UUB L;  4A93 G;  4WJ4 A;  4RFB A;  4PNY A;  2XNA C;  4A3E H;  1OXT A;  1GXD C;  3HOW H;  4L63 B;  1PDQ A;  3NQT A;  1PA6 A;  4DV7 L;  5KNC A;  2VB2 X;  2VXW A;  3AMU A;  3U50 C;  1MKH A;  2ALY B;  1WTW A;  1WCM B;  4GKK L;  2R93 H;  1E7Z A;  3RN2 A;  1HQM C;  4LF8 Q;  5FJ8 G;  4UY8 C;  1QZH A;  4BY1 G;  1WTP A;  1W6J A;  1XMQ Q;  2B2U C;  1Q82 C;  4A93 B;  4R1J A;  4BY1 H;  4DR6 Q;  1KDB A;  3TRZ A;  3AFQ A;  2F0M A;  4LK1 C;  1YIJ A;  3VR3 A;  3S16 H;  5CV4 A;  1Q1E A;  2AWO A;  2B2V C;  2E8G A;  3CHB D;  3MHB A;  2XWJ B;  3IKJ A;  1AZQ A;  4IAL A;  1PVO A;  4BA2 I;  3LNN A;  4EVO A;  2RSO A;  2KEE A;  3A7L A;  2E2J H;  3DM1 A;  4K0K Q;  1ILQ A;  4PQX A;  3H3V H;  2KBN A;  4C3H H;  2WAQ G;  4QIW E;  4YIJ A;  2JP1 A;  1EY7 A;  5HY6 A;  1AZP A;  3PF5 A;  3WDN A;  4JOI A;  2EY2 A;  2WP8 J;  3X3M A;  3NWS A;  1BBX C;  1CKN B;  2B39 A;  1BCP D;  1RD9 D;  4CKB A;  2MPM A;  3K5L A;  5LMU L;  3MA2 B;  3Q8D A;  1VQ4 A;  2UUC Q;  1DGS A;  2VUM B;  1WVL A;  2B2W A;  4TKO B;  3BVZ A;  1A2T A;  1T5E A;  3BU2 A;  1I5F A;  3TBI B;  4BBS H;  1Q8K A;  1Q1B A;  1WOC A;  4A3D H;  3JAM i;  2B2Y A;  3NSW A;  3TS2 A;  4HMI A;  1PH2 A;  1VQH A;  1OTC A;  4JI1 Q;  1LT3 D;  2KEN A;  3ZJY C;  4EX5 A;  3RZD B;  1WTQ A;  3NP8 A;  5BN4 A;  1K0R A;  3I4L A;  4UHV A;  2NZH A;  1A3U A;  1IYU A;  5GAD C;  1K83 B;  4OL7 A;  3GTP B;  2MP1 A;  2RA4 A;  4B3R L;  2D2C C;  3DWA A;  1S3O A;  2UUB Q;  2HHH L;  2MO1 A;  1HXY D;  3GD7 A;  3HKS A;  3MAQ A;  4OEM B;  5JPM C;  5C0X H;  1HUM A;  2ZXP A;  1PTO B;  1CHP D;  1H9M A;  3W1G A;  1STA A;  2FMC A; 
#chains in the Genus database with same CATH homology
 5F2D A;  2E75 C;  5M5Y B;  1SYD A;  1KLU D;  2SNS A;  4ID6 A;  3PO3 B;  1B4O A;  4XQJ A;  1D5X C;  3H94 A;  4WOR A;  5CV5 A;  2AUK A;  5JEA H;  2J4X A;  4C3I B;  4G7Z C;  2KHS A;  1HUN A;  1SSO A;  4V0B A;  4O1N A;  4EGV A;  2F0H A;  3NQI A;  2HCI A;  3WOF A;  1OXS C;  1PZI D;  3EJI A;  1EYD A;  1CM9 A;  1LTG D;  3NBI A;  2KCN A;  4DNT B;  4OIK A;  2Q8T A;  2NTT A;  4A3F B;  3Q22 A;  1NR2 A;  1ET6 A;  5KGU A;  4KHV A;  2FMM A;  3BYY B;  1PZJ D;  5IGC A;  1G29 1;  5JJZ A;  3NPP A;  3VA5 A;  1EU4 A;  2F0V A;  2I07 B;  1ILP A;  5C5L A;  3QO2 A;  4EQN A;  3R2I A;  1Z6H A;  4BS9 A;  3HEJ A;  1SE4 A;  1KNE A;  2CW0 C;  3KLR A;  1GUT A;  3MVV A;  1DCZ A;  3PUX A;  5M3M B;  1JOQ A;  1Z7T A;  2XRS D;  2F4I A;  5C0X I;  1GOZ A;  3HP3 A;  2F0K A;  4F8M A;  3EA6 A;  3LX0 A;  3BYT B;  4J1M A;  3GTG B;  4NW2 A;  1PYW D;  3L9A X;  3TZD A;  4OHJ A;  3VYT A;  2EPB A;  5J1Z A;  1S5F D;  1HTL D;  4WFN 3;  1K8M A;  1D5M C;  1ESR A;  2O4X A;  1RHP A;  3S1Q B;  5M9O A;  4OO1 G;  2A6E D;  4CKC A;  3QJY A;  4A3I B;  3NTH A;  5IGD A;  4XQN A;  1TY0 A;  2DNC A;  1C4Q A;  3S17 B;  1F2Z A;  4C1N I;  4ZUI A;  3R93 A;  2Z8L A;  4B08 A;  4Y7N B;  1LTB D;  1VF7 A;  3JAM E;  4XT1 B;  3ONA B;  4Q0F A;  2E2J B;  5EBD A;  1LT6 D;  4GZY C;  4C56 C;  4DAV A;  1TWF B;  2LFN A;  2LKV A;  4RKB A;  5BN5 A;  2RSN A;  5G3L D;  2B2V A;  1B44 D;  3RD4 A;  1EZ6 A;  3GTL B;  3ITP A;  2QF7 A;  1TQO A;  1JC7 A;  5IOD A;  2PZW A;  3L7Z C;  3PO2 B;  4HCE A;  3GTQ B;  4DFA A;  5KIX A;  4DXG A;  4A3E B;  2KUM A;  2SOB A;  5D3D A;  2JA5 B;  4KN4 C;  4KKS A;  4CGY B;  1VMP A;  3J81 E;  3VYR A;  5ELD A;  4KD4 A;  4KJN A;  1PMR A;  1HPC A;  1XYI A;  1B2T A;  4A3J B;  4HSV A;  2EYL A;  1DYQ A;  1PZK D;  1G2T A;  1TU2 B;  1UEA B;  5CV7 A;  1OXV A;  2YYZ A;  2F0L A;  1CT1 D;  2HQE A;  3HOY B;  3BVG A;  1FNV A;  4Q5V A;  4S3S A;  5ELC A;  2ICE C;  2OXP A;  2EJF C;  5E4W C;  5T1G A;  1Y1V B;  2A6H D;  4H7B A;  5D14 A;  2L11 A;  2X69 A;  4IUN A;  1L0X B;  2F1M A;  3E0J A;  4DU9 A;  1W6K A;  3ZYY X;  2ICI A;  2MUY A;  1YNN D;  1O7Y A;  4KY6 A;  2K7V A;  1EOT A;  4ZUJ A;  3EFX D;  4RWS C;  1R4P B;  3H0G B;  1JE4 A;  2E2I B;  1STH A;  1JQY D;  1EYC A;  5A2Q L;  3PIP 3;  5KYL A;  5J39 A;  3GTO B;  3AU7 A;  1FR3 A;  4DGZ A;  1JWM D;  1EWC A;  4PMB A;  1PXU A;  1LAB A;  1TY2 A;  3FVQ A;  1STY A;  3BG3 A;  3M3Y B;  1KNA A;  3PIO 3;  2EYP A;  3NTI A;  5D65 A;  2V4D A;  4B9W A;  3TP5 A;  1RTN A;  2J7Z A;  3MTS A;  3CQZ B;  3VR4 A;  3O13 A;  2F0N A;  3H91 A;  1GUG A;  2JA7 B;  4IUP A;  3SK6 A;  3S14 B;  5LL6 S;  5KND A;  2PQE A;  2F0Q A;  3M4O B;  2I46 A;  3R3O A;  2PPB C;  5CC4 A;  4A3G B;  3VYS A;  3NE5 B;  1TWA B;  2R3Z A;  5A2Q E;  5E1F A;  1BCP F;  2LS0 1;  2EYF A;  2D62 A;  5M5X B;  1PLF A;  3I4N B;  1MSG A;  1RKN A;  1I4X A;  4XTC S;  3TDQ A;  4K5W A;  2E2D C;  2QKI C;  2WKD A;  4H44 C;  5BN3 A;  1I4R A;  3X3N A;  2C5C A;  2XSC A;  1V43 A;  1GJX A;  1LV9 A;  3OW7 A;  3MXG A;  3SK5 A;  4DK1 A;  2G9H D;  1PRT F;  2O5I C;  4XYQ A;  1SAP A;  4CJ1 B;  3C3L A;  1Z47 A;  1LTA D;  2A69 C;  3Q23 A;  3S2H B;  3SR1 A;  5FLX L;  4Z9C B;  3S1N B;  1MD2 D;  1Q3L A;  4QB4 A;  3SXH A;  1C8C A;  2IX0 A;  2IT1 A;  5JEA J;  5KYI A;  1Q8I A;  2FHT A;  4KKU A;  4X3U A;  1EEF D;  1KDC A;  3M7G A;  1KAB A;  2RQX A;  2KJX A;  5I9O A;  4R9W A;  2XIW A;  4XYO A;  3S1M B;  1Y69 U;  5C0X J;  2KOL A;  1TVX A;  1F2Y A;  1SFO B;  1BUV T;  1VDZ A;  4DNR B;  2R92 B;  2PCF B;  4G7O C;  3DXJ C;  2PZT A;  3NTK A;  3K5N A;  1V8Q A;  4JK1 C;  5COR A;  2F0P A;  2LY7 A;  1M8A A;  2WAC A;  1F77 A;  4ZRZ A;  1BCP B;  4A3D B;  3GTJ B;  1LTT D;  3C46 A;  4QF4 A;  1QE6 A;  1F9S A;  3DWQ A;  1V1O A;  2NN6 G;  4H13 C;  4HAE A;  3WOE A;  3J80 E;  4XXE A;  1BOS A;  2BDN A;  3W2D A;  3K0Y A;  3I90 A;  2KVM A;  3GO5 A;  1SYE A;  1D2B A;  2DN8 A;  1S5B D;  4C3H B;  5JPN C;  3OHX C;  2NZ1 D;  4OO1 H;  3D3R A;  1DOK A;  4CBV A;  2VB3 X;  3HOX B;  2EOT A;  1ZYR C;  1EQT A;  4HN7 A;  3A54 A;  4CJ0 B;  2A74 C;  1S4Z A;  3FRP B;  2QCP X;  3BDO A;  1JOO A;  2IJ0 A;  4IUQ A;  2EY1 A;  4FF4 A;  3QOJ A;  1I4G A;  2CHB D;  3BVM A;  5C0X G;  3D6W A;  1BQQ T;  4ZAI A;  5CR3 A;  4EQP A;  3GTM B;  2RDG A;  1H9S B;  1ZKO A;  3UI2 A;  3I70 A;  2EVB A;  2JSO A;  4ZK9 B;  3HZX A;  1CK1 A;  4U67 3;  5JVH 3;  1ML0 D;  4FVM A;  3MXN A;  2A6H C;  2BCO A;  1O78 A;  5IGB A;  3BDL A;  1TS2 A;  2IX1 A;  3AB9 A;  4FYD A;  1STE A;  2EYH A;  4ZQ3 A;  4L8J A;  5JVG 3;  1SBB B;  2PMZ B;  3Q24 A;  2NWG A;  2JA8 B;  3I8Z A;  2EJM A;  1RCV D;  5DEH A;  1EIH A;  2R93 B;  4ME5 A;  2Z1C A;  4K5V A;  1WTO A;  1JR0 D;  1VMC A;  2M2L A;  4OIJ A;  2F0T A;  3FDT A;  4RGM A;  1D1K A;  1NR4 A;  5DAU A;  5IT9 L;  3SHL A;  4NP5 A;  3HRZ C;  3CRL C;  4R8I A;  1HFG A;  4BY1 B;  2K28 A;  4FF2 A;  3LWE A;  3MEH A;  2XVS A;  1HA5 A;  3T53 B;  4ZLT F;  3HOV B;  2PNR C;  1AN8 A;  3VR2 A;  4G57 A;  1SEB D;  2B2U A;  2JEA I;  1I3Q B;  1CA6 A;  1E2Z A;  5A35 A;  4NKL A;  4K6L A;  1SMY C;  5EPL A;  3D6C A;  1KAA A;  2AUJ D;  2RBM A;  1V1P A;  4XIG S;  2AWN A;  1CZG A;  3W3A A;  3K59 A;  1TS5 A;  2JE6 I;  4ZYS A;  1ZXT A;  2IWH A;  2B2Y C;  1H9K A;  4LJZ C;  4G4K A;  5KRU A;  5IGG A;  5CMD A;  1Y8P B;  4HTH A;  2NYZ D;  3A7A B;  5KNB A;  4ULL A;  2K6A A;  1GHJ A;  4P2C B;  3VR6 A;  1ENA A;  4CJ2 C;  2JA6 B;  3RZO B;  3J7A V;  4UDU C;  3TP8 A;  3NXW A;  1TWH B;  2F0I A;  1M4V A;  4BY7 B;  3I3C A;  5K36 H;  2NVY B;  5NUC A;  1BCP C;  3H3V C;  2K01 A;  4N9T A;  3T51 B;  5I6W A;  1JOR A;  1TS4 A;  3V96 A;  4A3M B;  1SND A;  1MI2 A;  5FO9 B;  3S1R B;  1B9N A;  1EY8 A;  1SYG A;  3MFG A;  2ENB A;  2L9H A;  1XTC D;  5T1I A;  1J8I A;  1EY0 A;  1JOK A;  1CI3 M;  4RAU C;  1BXT A;  4XQQ A;  1JWU D;  3IFD A;  1DJR D;  1BR9 A;  2GA4 B;  2NTS A;  2SNM A;  3S2D B;  2K5W A;  1MSH A;  4X3T A;  1EL0 A;  4J6H A;  2FMC A;  2CVR A;  3OPO A;  3U9S A;  4RA8 A;  1QG7 A;  2JYO A;  3DEO A;  5E4X A;  3R8B A;  3H6M A;  1A3T A;  3URY A;  4ZKB B;  3A55 A;  1QCB D;  2FJ2 A;  3LWU A;  1I6H B;  1QNU A;  4KJO A;  1EY6 A;  1IW7 C;  1DD2 A;  1E2W A;  1I4Q A;  3BDC A;  3BS1 A;  4KMU C;  2IX3 A;  4PMW A;  4M8A A;  1SYC A;  3K6O A;  4RGO S;  1MBY A;  4MIU A;  5IOC A;  1ENC A;  4R8N A;  1S5D D;  1RTO A;  3CRK C;  2BE5 D;  1SNP A;  1LT4 D;  5I6Y A;  5LL6 X;  1O7L A;  5FKA C;  3A8K E;  2E76 C;  3OMC A;  1SNC A;  1S5E D;  4RGT A;  4QIW B;  1HCZ A;  3TSS A;  1RF2 D;  1Y8N B;  2NBF A;  3OWF A;  4QUF A;  2WIN B;  1OXU A;  1H9S A;  3S9W A;  2B2T A;  3FKI B;  1ZEQ X;  5I2X A;  1Y1W B;  1GUW A;  4QUC A;  2HDL A;  1TR5 A;  3IFT A;  3MC0 B;  3GV6 A;  4HSP A;  2F0E A;  4CHT B;  5D3I B;  4A3K B;  4K6D A;  1VF5 C;  1WTR A;  1EU3 A;  2IW3 A;  2L55 A;  2MJ8 A;  3P20 A;  4FF3 A;  5C44 B;  5JAV A;  1EQV A;  5CV6 A;  2L0C A;  5CV9 A;  3I72 A;  4FNF A;  1I6V C;  3K5O A;  1F2L A;  4A3B B;  2G9D A;  3GV3 A;  2ZXO A;  1F9P A;  3OWE B;  1XWE A;  1NUC A;  2R6G A;  1C48 A;  3H09 A;  4IFD G;  1U4L A;  4TQU S;  1TII D;  2F0F A;  2EY6 A;  1JWS D;  1OO9 B;  2EDG A;  4KI0 A;  1BO0 A;  2A68 D;  3NWT A;  3EVQ A;  2KCC A;  4MHE A;  5EGT A;  4MN3 A;  5I2Y A;  3OIQ A;  4LAA A;  5CGK A;  1U9R A;  3OOC A;  4OGQ C;  1PTO H;  2A68 C;  1B9M A;  5E3F A;  1ENF A;  1LT5 D;  3I91 A;  1JIC A;  1AP0 A;  4L6T B;  3M7N A;  1GUN A;  3HKZ B;  2B8F A;  3NUC A;  4HCS A;  2MHV A;  3QIA A;  4N9P A;  2RDH A;  1BF4 A;  1BDO A;  4F7X A;  2WAQ B;  1F9Q A;  3A56 A;  3A8I E;  1D6E C;  1X3P A;  1FD7 D;  1EFI D;  1UAP A;  2EE1 A;  2K5D A;  3ERQ A;  3TN2 A;  4WRD A;  4V19 0;  1ET9 A;  4KY5 A;  2EY5 A;  2BOS A;  3KK7 A;  2KQ3 A;  1EIG A;  5KEE A;  3HG9 A;  4FXG C;  4RCO A;  1ESF A;  5ELB A;  5FOB B;  5EKI A;  3T13 A;  1A2U A;  3C1F A;  5C4Z A;  2O2L D;  4LMQ D;  2X6G A;  2RVL A;  2AQ1 B;  2K33 A;  4C2M B;  2D5D A;  1RJT A;  2K32 A;  2KEC A;  2A69 D;  4C1N K;  3S15 B;  4KY7 A;  4FXD A;  2EXZ A;  1OXX K;  3DMU A;  2PW5 A;  1FNW A;  1EY4 A;  3KLS A;  1UUP A;  4J8Q A;  1QWY A;  4XT3 B;  5C3W A;  2Z4I A;  2Q8R E;  2WB1 B;  3E6Z X;  3T4A C;  4I7Z C;  4K8J A;  1KLG D;  3IL8 A;  5COY A;  2XN9 C;  3NHH A;  2E2H B;  4DK0 A;  1PFB A;  2DY7 A;  1B3A A;  1II3 A;  1G2S A;  1WTX A;  1A15 A;  3D4W A;  2A5H A;  5EPJ A;  2Y0S B;  3L3O C;  4QCL A;  3K5M A;  1TKW B;  2F3W A;  4H0L C;  2F3V A;  4O42 A;  1STG A;  1HA6 A;  5M3F B;  3BZD B;  3V05 A;  5EPK A;  2ID0 A;  3GP7 A;  2IL8 A;  3SDZ A;  1EZ8 A;  2OF1 A;  2O5J C;  1IL8 A;  1R4Q B;  2RKS A;  2Q8I B;  5EJW A;  4U68 A;  1O7Z A;  1GHK A;  3P75 A;  1SE2 A;  2B8G A;  4RHR A;  5IGF A;  2PZU A;  1E2V A;  1PTO F;  3K57 A;  2JXM B;  5DNF A;  4C3J B;  3J7A F;  4IUV A;  1UNS A;  1EEI D;  4ILW A;  4KKT A;  1QNK A;  2K05 A;  1DXM A;  4EQO A;  2Z4H A;  2R7Z B;  2ZXR A;  3MXU A;  5FO8 B;  2AQ3 B;  3HOZ B;  2B63 B;  2L12 A;  4FF1 A;  2L5T A;  1KTK A;  1PTO C;  3OSO A;  2ZT9 C;  3QG1 A;  5CBA E;  3KBG A;  1TT2 A;  4IUR A;  2KA7 A;  1QOH A;  1D1I A;  3GTK B;  1QJO A;  2D9U A;  4FXK C;  3SEB A;  1IYV A;  1X32 A;  1BNZ A;  1L0Y B;  5FO7 B;  1DOL A;  2A73 B;  5IGE A;  1U4M A;  3GQB A;  1ZYR D;  4DA2 A;  4KHZ A;  1G6Z A;  3U9O A;  4NDX A;  1DM0 B;  3T56 B;  4IN3 A;  3TP7 A;  3NBH A;  1DOM A;  4FP5 D;  2NN6 H;  3CU7 A;  4HED A;  5CYU A;  1RDP D;  4XDX A;  2L1B A;  3EQL C;  1NAP A;  2YU9 B;  3S16 B;  3D4R A;  1F9R A;  4K2L A;  3A8J E;  4PMC A;  5HGT A;  2EJG C;  1EY9 A;  3IAY A;  1HRJ A;  1S5C D;  4KV6 A;  2NVQ B;  5EQ0 A;  4KD3 A;  3PUW A;  3T16 A;  4X3K A;  1TWC B;  2F0D A;  1IHZ A;  1CHQ D;  2DY8 A;  5FLX E;  1SXT A;  1PRT D;  2BDO A;  3FMC A;  4KK7 A;  3J80 L;  1HQR D;  3MFY A;  1PRT C;  2J0T D;  2A6E C;  1U4P A;  4DXF A;  5TSS A;  3TZU A;  2IPK D;  3J81 L;  3PV0 A;  1HFN A;  2N88 A;  1VCI A;  3Q0A A;  1EWH A;  1LAC A;  1SYB A;  3SVM A;  4TSS A;  1A3V A;  3NK9 A;  5EKL A;  2FIN B;  3G7L A;  2F0U A;  1Q12 A;  3MXP A;  3ND9 A;  5LHY 1;  4OO1 I;  3E5S A;  4JBW A;  3RMH A;  5I9P A;  4KN7 C;  2HDM A;  2L4N A;  2NN6 I;  4DF7 A;  2K1B A;  3R2T A;  1Q90 A;  3HOU B;  1B53 A;  2NB0 A;  3TP6 A;  4F88 A;  2E74 C;  1A6X A;  4C3J G;  2DNE A;  2KED A;  3FPU B;  4K8I A;  4DAP A;  1IKM A;  3M4Y A;  3MZ5 A;  1E0B A;  4HR7 B;  2B2W C;  1KDA A;  1J9O A;  2EYJ A;  4HMJ A;  5DM7 3;  2BA1 A;  4IQZ A;  1G8Z D;  1SYF A;  1Y8O B;  1SMY D;  4ODG A;  1FYC A;  2M9V A;  1PTO D;  3G6J B;  3K58 A;  2VNU D;  4IFD H;  5C3X A;  3SK4 A;  3ND8 A;  2K04 A;  2TMP A;  1D5Z C;  3OMG A;  3FEW X;  2F0J A;  4K2K A;  2XRQ D;  4ZKC B;  3VYU A;  1GUS A;  5HUR A;  2MGS A;  2OEO A;  2C9O A;  3D31 A;  1PRT B;  1F2M A;  1WD1 A;  3KUP A;  2H1E A;  3QWN A;  3MWY W;  3DEP A;  1QIL A;  1H9R A;  4IUT A;  1LTR D;  3M85 A;  1TS3 A;  3SK8 A;  3J7Y W;  1SE3 A;  3V2T A;  4ABN A;  2SDF A;  3C1E A;  4F87 A;  2NUC A;  2K03 A;  3PUY A;  2QIL A;  2EYM A;  2BA0 A;  2JEB I;  3D8G A;  3F2U A;  2X6L A;  3Q6S A;  1CQF A;  2F0W A;  2WII B;  4IFD J;  2OT2 A;  4NMZ A;  4K5X A;  4X3S A;  1O80 A;  5C4X B;  5ISR A;  1SJE D;  4I65 A;  1CZW A;  2B2T C;  5J22 A;  4RCN A;  2XWB B;  2K5Q A;  3RLF A;  1EYA A;  2CQA A;  5G3L F;  5IT9 E;  2F0S A;  2PYK A;  5JOB A;  4TRD A;  1STB A;  1AW7 A;  1ICW A;  4QMG A;  3VA7 A;  2NVT B;  3D4D A;  1QB5 D;  3C2P A;  1LO5 D;  4RKL A;  1V1P B;  1I50 B;  1PFM A;  1SNM A;  3VR5 A;  1STN A;  3QOL A;  1NCV A;  3P7J A;  2F0G A;  1IW7 D;  4CKE A;  4RH6 A;  5DM6 3;  3JAM L;  3KLS X;  4RGN A;  4BWG B;  1H9J A;  3TME A;  3CKI B;  3HS0 C;  4E6I A;  2TSS A;  2WV6 D;  3OIP A;  1AFP A;  1DZ1 A;  5CBE E;  3KBX A;  2HUG A;  4K14 A;  1AEX A;  2FFK B;  2CW0 D;  3I4M B;  2M00 A;  5ELF A;  1JCK B;  4AYB B;  3DWP A;  2EZV A;  1B50 A;  5I4D A;  5C5M A;  5AFW A;  5C4H A;  2QEJ C;  5EBC A;  1I4H A;  1SDF A;  4IZ8 A;  4G7H C;  4IFD I;  2LMC B;  2WKC A;  1CQV A;  2PO4 A;  4DN4 M;  1G91 A;  3K7A B;  3I73 A;  5K5P A;  1NSN S;  1FGB D;  5K36 G;  1HHV A;  4M1U B;  3N52 A;  4UAI A;  4C3H G;  1WD0 A;  1ROD A;  1YNN C;  3N6R A;  1I4P A;  1PFN A;  2R61 A;  5JEA G;  5CV8 A;  1TWG B;  1DON A;  3SE0 A;  3ERO A;  4BBS B;  2PW7 A;  1K8O A;  1CA5 A;  1CTM A;  3PMF A;  4DAY A;  3HGB A;  5EKK A;  1IKL A;  2N55 A;  4FO2 A;  3P1H A;  1LTI D;  4WJW A;  2H4O A;  1LLR D;  1WTV A;  2F0O A;  5M5W B;  2RDF A;  2HCC A;  3QB3 A;  3PUZ A;  1SNO A;  1FNU A;  1YNJ C;  1CFM A;  3DUZ A;  5C4J B;  4KTA A;  4BBR B;  2QDB A;  3RUZ A;  4B9X A;  4RHS A;  1ONL A;  1MGS A;  1R9T B;  2NVX B;  5C6A A;  4IUU A;  3DHQ A;  5IIF A;  1EY5 A;  1YNJ D;  1SJH D;  5C3E B;  3HOW B;  1B1Z A;  1GUO A;  2SEB D;  1T5X D;  2F03 A;  5FK9 C;  1U4R A;  3FPP A;  1XX8 A;  3KF8 A;  2BE5 C;  1SNQ A;  4PV1 C;  3PUV A;  1X3Q A;  5ELE A;  1XXG A;  2AQ2 B;  1LTS D;  4BA1 I;  1HTP A;  1JB3 A;  2EYO A;  4RFB A;  4PNY A;  2XNA C;  1OXT A;  1GXD C;  1PDQ A;  3NQT A;  4L63 B;  5KNC A;  2VB2 X;  2VXW A;  3AMU A;  1WTW A;  1WCM B;  1HQM C;  1WTP A;  1W6J A;  2B2U C;  4A93 B;  1KDB A;  2F0M A;  4LK1 C;  3VR3 A;  5CV4 A;  1Q1E A;  2AWO A;  2B2V C;  3MHB A;  3CHB D;  2XWJ B;  3IKJ A;  1AZQ A;  4IAL A;  4BA2 I;  3LNN A;  4EVO A;  2RSO A;  2KEE A;  3A7L A;  3DM1 A;  1ILQ A;  4PQX A;  4YIJ A;  2JP1 A;  1EY7 A;  1AZP A;  3WDN A;  2EY2 A;  2WP8 J;  3X3M A;  3NWS A;  1BBX C;  2B39 A;  1BCP D;  1RD9 D;  4CKB A;  2MPM A;  3K5L A;  3MA2 B;  2VUM B;  1WVL A;  2B2W A;  4TKO B;  3BVZ A;  1A2T A;  1T5E A;  3TBI B;  1Q1B A;  2B2Y A;  3NSW A;  4HMI A;  1LT3 D;  1WTQ A;  3RZD B;  3NP8 A;  5BN4 A;  3I4L A;  1A3U A;  1IYU A;  3GTP B;  1K83 B;  4OL7 A;  2MP1 A;  2RA4 A;  2D2C C;  3DWA A;  1HXY D;  3GD7 A;  3MAQ A;  5JPM C;  5C0X H;  1HUM A;  2ZXP A;  1PTO B;  1CHP D;  1H9M A;  1STA A;  4C3I G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...