3D4DA

Crystal structure of staphylococcal nuclease variant delta+phs y91e at cryogenic temperature
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAEIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS Y91E at cryogenic temperature.
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 32
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2008-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3d4dA00
3NXWA 4KHVA 1AEXA 5IGGA 2EYFA 5CV4A 2HQEA 4NDXA 3P75A 2EYHA 4N9PA 2PQEA 2ENBA 2SNMA 3SK8A 3C1EA 2O4XA 4B9WA 3SK4A 3NK9A 1EY9A 2F0TA 2F3WA 4I65A 4KD3A 3HEJA 3C1FA 4ME5A 2M00A 2OF1A 1ENAA 3NP8A 4KY7A 4R8NA 5J39A 4EQNA 5C3WA 2F0QA 3OSOA 4F8MA 2F0GA 4N9TA 3PMFA 5J22A 5KEEA 3T16A 4H7BA 5IOCA 2F0NA 1ENCA 1EY7A 1A3UA 2F0LA 3MXPA 4QMGA 3DMUA 5CV5A 5C5LA 5NUCA 2PW5A 4PMBA 3D8GA 5C4HA 3D4WA 5C4ZA 5IGEA 4K5WA 2EYOA 3ITPA 4HMIA 4K5XA 5IGDA 2EY1A 2PZTA 4RKBA 3NHHA 4K8IA 4MIUA 4IALA 3D4DA 5K5PA 2F0OA 5HURA 2EYMA 2F0HA 3OMCA 3TP8A 1IHZA 1JORA 4IZ8A 4HMJA 2OEOA 2F0EA 1EYCA 5KGUA 1EQVA 4KTAA 2RKSA 3R3OA 4KJNA 4K14A 3SR1A 2F0DA 3TP7A 2NUCA 1EYAA 1TT2A 3MHBA 1A3VA 1SNMA 5CV9A 3SK5A 5KYIA 3LX0A 5CGKA 1KDCA 3MZ5A 2OXPA 1NUCA 3NUCA 4B9XA 1EY6A 4K2KA 1EY0A 2F0SA 5CR3A 3U9OA 5ISRA 1SYCA 3HZXA 4ZUIA 4ID6A 3QOJA 1KDBA 4IUNA 3ERQA 2RBMA 1EZ8A 3TMEA 3OWFA 5I6WA 5IGBA 4KY5A 4DFAA 2F3VA 1A2UA 1F2MA 3SXHA 1SYGA 1SYFA 4KY6A 5JOBA 5E1FA 3S9WA 3BDLA 3BDCA 1JOKA 1STNA 2EY5A 1SNCA 4J6HA 4KD4A 4K6DA 3TP5A 1EZ6A 1STYA 2KQ3A 1KDAA 1SNOA 4QB4A 3TP6A 5IODA 1SNDA 2F0JA 4WRDA 4YIJA 2F0PA 5KYLA 1II3A 1KABA 1SYEA 2EY2A 2F0FA 4G57A 3RUZA 2WACA 4S3SA 5EKLA 5C5MA 5IIFA 4NMZA 1SYDA 1TQOA 4ODGA 3EVQA 1F2YA 4PNYA 4TRDA 3MVVA 4HTHA 1STGA 3EROA 4QF4A 4OL7A 2QDBA 1STAA 5EGTA 3T13A 2EYPA 4RKLA 4NP5A 5C3XA 5IGFA 3EJIA 5E3FA 2PYKA 3H6MA 1SNQA 2SNSA 4DU9A 1RKNA 2PZWA 3SHLA 4PMCA 5HGTA 1U9RA 5CV8A 1EY4A 1JOQA 3P1HA 1A2TA 5DAUA 1STBA 3MEHA 4ZQ3A 4DF7A 2EY6A 4NKLA 5EKKA 2PW7A 4KV6A 2EYJA 4WORA 5I9OA 2F0KA 5CC4A 1EY8A 4EVOA 4DGZA 3DHQA 3D6CA 3E5SA 5I9PA 3VA5A 4J1MA 1EY5A 1A3TA 2EXZA 5JAVA 1KAAA 2F0MA 2LKVA 3NQTA 5CV7A 5I6YA 2SOBA 1JOOA 4LAAA 5M9OA 4KJOA 1SYBA 1TR5A 2F0UA 3QB3A 2F0VA 5DEHA 3SK6A 4F7XA 4ZUJA 3OMGA 1SNPA 2F0WA 2RDFA 4E6IA 1NSNS 2F0IA 2EYLA 4K5VA 5J1ZA 5KRUA 3QOLA 4K8JA 5KIXA 1EYDA 5CV6A 5F2DA 4EQPA 4EQOA 5C6AA 5IGCA 1STHA 2KHSA 2PZUA 3V2TA 4K2LA 1F2ZA
chains in the Genus database with same CATH superfamily
1H9KA 1XMQL 2ICEC 1IL8A 1N33L 4ZKCB 1XPRA 3ERSX 1B3QA 1EY9A 3SGIA 4CDDC 5KIXA 4G7ZC 4KKUA 1TWHB 2Z4HA 4LFAQ 4DR2L 2D0PA 4DR3Q 1EY7A 1MI2A 5IT9L 4HSPA 5C4HA 4GZYC 2EE1A 5IGDA 2JA8H 1I6HB 1HNXL 1TKWB 5JVH3 3BS1A 2C9OA 1HPCA 4H13C 2KCMA 5IE8A 3KF8A 4JI4L 1DD2A 5T1GA 5IP9G 4A93H 4QUCA 4C2MB 3MZ5A 3VR2A 4K2KA 3G48A 3U9OA 4DV1L 4YCVA 5JEAH 4IUNA 4GKKQ 3L9AX 4DAPA 4GNXA 1D2BA 1XTDA 4HEDA 1LTLA 1PZID 1YHAA 3S9WA 3BDCA 1SNCA 1JCKB 3K5LA 2YU9H 1Q8IA 3KLSA 2JA6H 1PTOF 4UP9A 1KDAA 1BCPC 5IODA 2KVMA 1EFWA 3GO5A 3G6EA 2F3IA 4A93B 5IWAL 4LFCQ 1BDOA 2A19A 1VQ4A 3GTJB 3PO2H 1N34L 4HTHA 3BJUA 4B3RL 1SLJA 1ET6A 3BG3A 5BN4A 5E3FA 2PYKA 3UDFA 1HUMA 1TY2A 2VUMG 2ZM6Q 3EA6A 1N9WA 3NPPA 3T56B 2JA6B 1JC7A 4QIWE 1HTPA 1V8QA 3TDQA 4JI6L 1D5MC 1E22A 2ZTDA 3PO2B 1IL2A 1TR5A 4QY7A 1DYQA 3GD7A 1RDPD 2B2UA 2VQEQ 2JYOA 4JYAL 2CHBD 4TQUS 3QIAA 1DOMA 1HRJA 2E2IH 4GOPC 1OXTA 3GV3A 2AKWB 3NSWA 1QG7A 1BKBA 3RLOA 3M4OH 2AWOA 3HOXG 2GA4B 1Z9FA 1XNQL 3KOJA 1QUQB 4OXPA 4N9TA 4ZK9B 1Y8PB 3NBIA 1K73C 1ASZA 2WAQG 2F0LA 3BDOA 3DMUA 4KHZA 1DOLA 5CV5A 5H1SE 2E2IB 4NXMQ 1CA5A 3D4DA 4OGQC 1BQQT 2MHVA 3GTLH 3OMCA 4IZ8A 3QR8A 4C3JH 4KN4C 4DAYB 4G7HC 4QL5A 4V190 3M4OB 2JQOA 2YTVA 4KTAA 2UUAL 4X6AH 2IW3A 1XWEA 1HCZA 3E3XA 1VMCA 5GAGC 4X62Q 4RCNA 1EQQA 1X3QA 5HY6A 1G6PA 1NTGA 5FJ8G 1R9TH 2XN9C 4ID6A 3TMEA 3CXCA 2WAQE 2EDGA 3K80C 3GTLB 3H91A 2PI2E 5C44H 5I4DA 2ZJRA 2L5TA 1RTNA 4C3JB 4NB3A 1VQ7A 4AQYL 1MKHA 2B2WA 1KLGD 4AYBB 3CHBD 2IHFA 1U4MA 5D14A 1YVCA 2B63H 4R8IA 3Q0AA 4S3SA 4BY1G 4NMZA 4IPHA 1XMOQ 5A2QE 1F2YA 5GADC 4LFAL 1TS4A 2TMPA 1WTRA 2RVLA 4NW2A 5C44B 2FXQA 2GVAA 4HJ8A 3U4ZA 2KCCA 3CMEA 4JCVE 1P8LA 3IFTA 4KV6A 4OHJA 1LTGD 1IXRA 4LF5L 3UI2A 4RGMA 1H9RA 4GS3A 2B63B 1EL0A 3K58A 3PUVA 1F9PA 2A6HC 5K36G 5M3FG 2K04A 2RCNA 4JI8Q 1L0YB 5M9OA 3I8ZA 4KJOA 1Y1WG 4KK7A 4WJ4A 4F7XA 3J81j 4FXGC 3OWEB 5KNDA 2UXDL 1SMYD 4K8JA 3DM1A 1B2TA 4GKKL 1F9QA 1PHJA 4KMUC 3BVMA 1VDZA 1PA6A 1PFBA 4XYOA 5BR8L 3S1QH 4YWKA 2EYHA 4N9PA 3I72A 2PQEA 3KFUA 2CWAA 3SK4A 1K0SA 2F3WA 3VDYA 2M00A 1JE4A 4CJ0B 2OQKA 4LFCL 3H3VI 1Y8NB 1BUVT 4QMGA 4KKTA 1PZJD 5TSSA 3HOYG 3U58A 3V96A 1BBUA 3MFYA 3S1QB 3TP8A 2ZM6L 2JA7G 2BH2A 1I6VC 3CC7A 5C0XI 4KKSA 2KA7A 3K7AH 1EEFD 4TKOB 2XVSA 3T4AC 3FKIH 1RODA 3LX0A 1S5BD 1EY0A 1R4QB 4RHSA 5AJ3Q 1X54A 1O7ZA 1HHVA 4KY6A 3T1HL 1PRTB 1BNZA 1BCPF 2VQEL 1JR0D 1HFNA 4FP5D 1LT4D 1J6QA 4L5TA 3K7AB 1ICWA 3K5OA 1SXTA 2DJGC 4GLVB 2RHSB 3NQIA 1S4ZA 1CKNA 4ODGA 1X3FA 1B3AA 4C1NK 4JBMA 5GQOA 2A74C 2Z9HA 4C3IH 1DCZA 1KD1C 1B44D 3PO3H 4MHEA 4QIWB 3D4RA 5HGTA 1PH2A 4FXDA 4NXML 5DAUA 3STBC 1STBA 4RAUC 3R8BA 2Q8IB 3RLNA 4MN3A 2NZ1D 1X3EA 3W2DA 3AYHB 4L8JA 4A3DG 2CW0C 4AH6A 2CFMA 1B53A 1Q1BA 4RGOS 4P74A 4X62L 3JAME 1E1OA 3G4SA 1UE7A 1H95A 2XNAC 3GDEA 2RDGA 4A3FB 2Y0SE 1YEZA 2EZVA 1CM9A 2D0OA 4EQOA 4JI3L 1C9OA 3R2IA 4R4TA 1QILA 1E2ZA 2K01A 1WVLA 1HTLD 4DV5Q 3SEBA 2IWHA 2CKZB 2XSCA 5ELFA 2JK8A 1PH8A 3LNNA 5EJWA 2B2TA 2PMZE 1Y1VB 3GV6A 1FNUA 2AMCB 3VYUA 2PQAB 1XMOL 4ZAIA 2F0NA 1ENCA 3A54A 2ATWA 1JWMD 4UP8A 1J9OA 5C4XH 1EIFA 2A6EC 4JI2L 2PZTA 1X32A 1K3RA 4JI5Q 1L1OC 3HRZC 1KC8C 4A3CG 4DR1Q 2QEJC 1FGUA 2B3GA 4P71A 4RFBA 2ES2A 1AE3A 1JJCB 3VA7A 1A3VA 2B2VC 2OXPA 1EY6A 1MIUA 4WFN3 4IFDH 2RCFA 5I2XA 1EZ8A 3UDXA 3P7JA 4C3HH 4RCOA 4XTCS 2QGQA 2XGTA 1AE2A 3OIPA 4DK3C 3KF6B 2JA8G 1SE3A 2UUCL 3OPOA 2BE5C 4P2CB 3M3YH 1NJIC 1E24A 3HOVH 1FYCA 5IT9E 4X66Q 2V1CC 3GTQB 3K0XA 1JB3A 4A3LH 4A93G 1GUWA 1C8CA 5FKAC 3MA2B 2MFIA 1FJGL 1STGA 1VQCA 3J80i 3M85A 2ASBA 2Z6KA 1I4QA 2EYPA 3DLLA 3CCEA 1O7IA 1LT6D 2D5DA 1YNJC 3I91A 5JEAG 1ILPA 4DU9A 5ELEA 4O0AA 4Z9CB 2PZWA 1PH1A 1W2BA 2B2YA 1EU3A 1PH6A 3HOUB 4X65L 3M3YB 5IY0A 4EVOA 1SFOH 1Q46A 1KHIA 2LXJA 1A3TA 5E4WC 1TY0A 1HZCA 4NXNL 1JOOA 4HCSA 1XXGA 1I4XA 1E0BA 2F0WA 3J81c 1KL9A 5EPKA 5AJ3L 3QOLA 5F2DA 3CD6A 4A3KG 3CCLA 1YIJA 4IUUA 4FDBA 2WB1B 1LT5D 2R61A 4P72A 1SFOB 1FNWA 4ZLTF 4QJFA 4KI0A 5CBEE 1VQ9A 1N36Q 1UE5A 5M3MH 1LTAD 1NNXA 2L11A 3OSOA 3HOWH 3RN5A 1I50H 5J22A 2NVTH 1Q12A 5FO9B 2K75A 3UE0A 3A55A 2NWGA 3QG1A 2KEEA 2R6GA 3I55A 1MSGA 4GKJL 1EWCA 2BDNA 2HD3A 1VQJA 1VQKA 3CRKC 3CU7A 5GAHC 2JEAI 3I4LA 1WTOA 4WJ3M 3RMHA 4DV2Q 5JJZA 2KOLA 3HOWB 1I50B 1IBLQ 3HP3A 1PYWD 1PLFA 3MTSA 2F03A 1LTBD 1ILQA 5CBAE 1LM0A 2B8GA 2G9DA 1A2UA 3BZDB 3I4MH 4IN3A 1G91A 3IFDA 4LF6Q 1I4HA 2J4XA 4FF4A 1GHJA 4I7AA 1B9MA 4J6HA 1BXTA 3VYSA 4DR6Q 1TWCH 5FLXc 2IT1A 4C3JG 4WRDA 1SYEA 1U4PA 4N8FA 4A3BH 5EKLA 1HR0W 3M4PA 1KTKA 3T53B 4HR7B 2R7ZH 4TRDA 3RZOH 3BZKA 3RZDH 2QDBA 1VF5C 1STAA 4RKLA 1JICA 3E0JA 2MP1A 1SNQA 3I4MB 4IQZA 1B4OA 3E9IA 3PV0A 4JI5L 3SE0A 5C44G 4NPSA 1TWCB 4DR1L 1HNZQ 2I5LX 1L0WA 3ZJYC 1WTWA 4A3BB 2VS1A 3F8TA 4PV1C 3KK7A 2B63G 1TS3A 4JOIC 2RF4A 4AYBE 2R7ZB 4JW0A 3VR6A 3CCUA 3C2PA 1FR3A 3PIOA 3RZDB 4R4IA 2L55A 4LF8L 1XJVA 3L2PA 2GN5A 1HR0Q 3EIVA 2NVQH 1W6JA 1A62A 3KF8B 3TZDA 1S5ED 3SDZA 4DPGA 1VQ6A 2A1AA 1IKLA 2K33A 2KJXA 3W3AA 5A35A 4A3EH 1LTRD 2I5HA 3WOEA 3PF4A 2MO0A 5E4XA 4KY7A 2F0QA 2JA5G 2Z6BA 4ABNA 4GNXB 1GUTA 2C35B 1OXSC 1LACA 1Q3LA 2NVQB 2NB0A 4ILWA 4PG3A 2HUGA 4A3EB 4KJNA 1OXUA 2NUCA 3MXNA 2CH4A 2KHJA 1VQDA 3ULLA 1Q90A 4C2MH 5ISRA 4GN4B 1AZQA 1SYCA 5I2YA 4H0LC 1QCBD 1HQRD 2N88A 3JC66 4X3TA 1QE6A 3MC0B 5JOBA 4L5RC 3I2ZA 4XQJA 2A69D 4IJHA 2BOSA 4YCUA 2MGSA 3DXJC 5LL6S 2IY5B 2RDHA 1EIGA 4YIJA 1XTCD 1II3A 1KABA 1ET9A 3N6RA 1A8VA 4LF9L 1GD7A 1UAPA 3FKIG 1PH7A 2L0CA 3OTOQ 4A76A 1MJCA 4MTKA 1CQFA 4XYQA 1FL0A 3GTJH 4O1NA 5EPLA 1E3PA 4H44C 1WTQA 3D31A 1J5EQ 1V1PA 1K8MA 5EKKA 3X3MA 2LSSA 4WORA 1ZXTA 2F0KA 1GJXA 2OTJA 1CKOA 5JAVA 3RN2A 1QB5D 3NQTA 2SOBA 3QJYA 2AQ3B 1SYBA 1I94Q 1K8GA 3SK6A 1IBLL 3HGBA 3E6ZX 3FHWA 2F0IA 4C3IG 1U4RA 4P75A 3J80L 3PO3G 1SMYC 2WINB 3MAQA 4LF4Q 2X69A 4LF6L 4PZ8A 3CRLC 3CC4A 1D8LA 4A3IH 2ZXOA 4UY8C 3G71A 2K1BA 3J7YW 3U4VA 5EPJA 2F0GA 1TVXA 3K0YA 3WWVA 4TVAB 1F77A 5D3IB 1Z6HA 3MXPA 5C5LA 4OWWB 1E2WA 3ND8A 1SE4A 2L15A 4OELB 3KBGA 3M4YA 2ZJQA 2M9VA 1JORA 4HMJA 4TSSA 1YHBA 1V1OA 1EQVA 4A3IB 1AP0A 4GOPA 1JT8A 1HNZL 4DNTB 4BXXH 1EYAA 3MHBA 4JI1L 1MGSA 5LMNQ 3ICEA 1NUCA 3S15H 1Y8OB 5CR3A 4U673 1PXUA 3IL8A 3ONAB 2Q2HA 2O2LD 1KDBA 3BU2A 2RBMA 3DWPA 4APVA 5C4XG 1BO0A 1UE6A 4LUZA 4DK0A 1B50A 1HR0L 1MJEA 2ZXPA 1F9RA 1STYA 2F0PA 3M4QA 1WD1A 3S1NH 2H4OA 1VS0A 2IX0A 1TWFH 2WACA 3OW7A 5C5MA 3S15B 1SYDA 3UE1A 2K5VA 2YTXA 3TZUA 3EQLC 1M90C 4IFDG 5EBDA 4NP5A 1N32Q 2MQHA 4C3HG 5LL6X 1BBXC 1IYJB 1C4QA 2VZAA 3PIO3 4JI0L 1C7YA 5DM73 4IFDJ 4DF7A 1CT1D 3VYRA 5I9OA 2LY7A 4X3KA 2DNEA 2NN6I 3D6CA 3E5SA 3S1NB 1TWFB 1TWAB 2E5LQ 1VQAA 2VL6A 3HFZB 1UUPA 1KAAA 5CV7A 3HOVG 3FDTA 2AUJD 2LXKA 1KIXA 4A3LG 2CVRA 1LYLA 4UAIA 3S17H 4ALPA 5J1ZA 3PIPA 1BOSA 4DR3L 2VW9A 5CV6A 2QCPX 5E7NA 4PZ7A 4POFA 1STHA 1QZGA 4FF2A 1QOHA 4RH6A 2I46A 5IGGA 3F2DA 1LO5D 4NDXA 1HNWQ 5M5XH 1R4PB 3URYA 2WB1G 1PYSB 4CBVA 1GOZA 4I65A 2IX3A 1YJNA 1ENAA 1CHQD 2KCTA 5ELNA 3C46A 1GHKA 3S17B 5IOCA 1CUKA 3TRZA 5IYBH 4DA2A 3NELA 3ITPA 4QUFA 1WTVA 3H3VH 1YNND 5M5WH 2EYMA 4M1UB 1TS5A 5M5XB 1J5EL 1HA5A 1HJPA 1S72A 2XTIA 4LWCA 5GAEC 3A8IE 1CKNB 4P73A 5KYIA 3SK5A 5C0XH 1Q8KA 2WB1E 4IJLA 4R4CA 1G6ZA 4B3SQ 2DUDA 2A68D 5M3MG 1YZ6A 5M5YH 4R4OA 2RQXA 2KENA 1Y69U 3HOWG 3BVGA 2SDFA 5IGBA 3J81i 1X3GA 2Q2UA 1IKMA 5M5WB 3ND9A 3TEHB 2BDOA 4KD4A 2K5NA 3H09A 1SE8A 3AEVA 4LF4L 1NMGA 1PZKD 1SNDA 3M9BA 4WJWA 3CCQA 3M7GA 4QQBX 3OHXC 1B70B 3AMUA 5M5YB 3A56A 1ENFA 1S3OA 5C3EH 3BYTB 3MVVA 1M1KC 1G8ZD 4HIOA 5C3XA 2NTSA 3EJIA 2X6LA 4EGVA 2XRQD 2C5CA 2OCEA 3I7FA 3I4MG 1D6EC 1T5EA 2EY6A 1I4RA 1TS2A 4FF3A 2E2HH 4F88A 1V9PA 3KLRA 1F2LA 3CQZH 4J1MA 1EY5A 2NVYH 4IUVA 1G2SA 3CMAA 2RHQB 4A3BG 2EXDA 5C3EB 5LMNL 3QB3A 2Y0SG 2R7ZG 1X3PA 1LTSD 3T1YQ 1NBWA 2EYLA 4CKBA 1O78A 5IGCA 1QVGA 5JJLA 4A3FH 1QNUA 1L1OB 4IUPA 1WJJA 4K2LA 4JC0A 2E2HB 3P75A 1GUOA 4A3JG 3W5OA 3I56A 1U5KA 1PYBA 1E2VA 2CH4W 3CQZB 1NMFA 2NVYB 1Q86C 4BWGB 1SE2A 3A5ZB 4YY3Q 3CC2A 2K4KA 1Y1VH 4H7BA 4UP7A 2DN8A 3T16A 3A5UA 5IGEA 4K5WA 2EYOA 3DM3A 2K03A 2VB2X 4ZCKA 4LJZC 2Z8LA 2F0HA 4OX9Q 1IHZA 2Z4IA 2CQAA 1MD2D 4C56C 4L63B 1H9SA 1WTHA 3OYYA 1TT2A 4JBWA 4A3EG 4RA8A 2KCNA 5FOBB 2UU9Q 5CGKA 1KDCA 2E5LL 1PTOH 3KDFB 4JBJA 3I73A 2VUMB 1TIID 2EPBA 3EBEA 1FVIA 3ULPA 1PDQA 2EJGC 1YBYA 1PRTC 3R2TA 4J8QA 4KHPQ 4FO2A 1LT3D 4K6DA 1LLRD 3G7LA 1K9MC 4DKAC 5C4JB 3AFPA 1L1OA 2HCIA 2JXMB 1HZAA 1L2FA 1G291 4PMWA 1STEA 1PTOB 4LK1C 1ZYRD 3AQQA 3PUZA 4DV7Q 4BY7H 3GTQH 2QF7A 4XXEA 4JI8L 4QF4A 3TN2A 2B2VA 3T13A 5IGFA 1Y14B 3GTMH 4L5QA 1D5ZC 5ELCA 1EY4A 4KLKA 4MTNA 3HOXB 1VQIA 3PIP3 3CCMA 2I5MX 3HOUH 2K5HA 1GKHA 4DV4Q 4LNQA 3F1ZA 2F0MA 1T9HA 4BY7B 1ONLA 4DR4Q 4DN4M 4B3SL 1EYGA 5BN5A 4A3GH 4XT1B 1NSNS 1PFSA 3GTMB 3PF5A 3KDFA 5IYDH 4IPGA 2RSNA 1JWSD 2ICIA 3TSSA 2PZUA 1F2ZA 1E1TA 1BR9A 1U4LA 5JEAJ 3CF5A 2QKIC 2IL8A 1YITA 1PH3A 2FFKB 2SNMA 3C1EA 2JA6G 4FVMA 4KD3A 2I0QA 3TS2A 4A3GB 2QILA 5COYA 2D2CC 3PO2G 2FMCA 2PW5A 3F2UA 4PMBA 1XMQQ 1K0RA 1H9JA 3CCSA 1ASYA 1CSPA 1N33Q 1IW7D 2F0OA 1WI5A 3HKZE 2AUKA 4RG1A 1NCVA 1EYCA 2O5JC 4UDUC 2F0DA 3SVMA 1WD0A 1HH2P 1JB7A 4DR2Q 4A3IG 2YV5A 1LUZA 2AQ1B 5EKIA 3T51B 3J80E 4R1JA 4ZUIA 4UHVA 3W1GA 5I6WA 3DUZA 1JE5A 4ULLA 4HJ5A 1A6XA 3BVZA 2A8VA 1K8OA 2J0TD 2J7ZA 3TP5A 4CKEA 3PUYA 2VXWA 2A69C 5FO7B 1GXDC 1ZKOA 3RR5A 4BXXG 3CKIB 3JAMc 3IRBA 3M7NA 4HN7A 1GVPA 4PNYA 1VQMA 2PCFB 1N8RC 2WKDA 2HIVA 1PRTD 4XT3B 4FF1A 1ESRA 2WKCA 4DK6C 4EQ5A 5G3LD 3L0OA 1VQ8A 3O13A 4HJ9A 3P1HA 4C1NI 3J81L 3DEPA 4OX9L 2IHEA 3DHQA 5IWAQ 1XPUA 4EX5A 4DV5L 2WV6D 4AYBG 4B3RQ 5BN3A 2UU9L 1PMRA 5DEHA 1NE3A 2R7DA 4HJ7A 3HOYB 3TS0A 1X6OA 2E8GA 3FPUB 3J7A5 2EJMA 2X6GA 1TXYA 3MXUA 2VY3A 3NXWA 2MO1A 1OXVA 3HS0C 1QNKA 2GVBA 5CV4A 1EQTA 3MXNB 4JI6Q 1SN8A 4Y7NH 2R3ZA 4R8NA 3C1FA 5L37A 5J39A 2RA4A 1Q7YC 1KXLA 3GTOH 4EQNA 4YWMA 1EUJA 2UXBQ 1SROA 4QGUA 4DV7L 2JJQA 4OIJA 2PO4A 3K59A 1A3UA 4JOIA 4DUZQ 2YTYA 1Q82C 5HURA 1X9NA 5J3BA 1CKMA 4DK1A 2F0EA 4ZKBB 5KGUA 2UUBQ 2QA4A 1EOTA 2Z0SA 1S5CD 4GN3B 1IZ6A 1FGBD 4Y7NB 1XNQQ 5IT9c 3GTOB 4LMQD 1A15A 2JN4A 3NUCA 4DV4L 1AZPA 4X66L 4L5SA 4G7OC 1RF2D 2A73B 1PRTF 4M8AA 3PSIA 1RHPA 2AHOB 2H5XA 4B3TQ 5IYBG 1V1PB 4DFAA 3SXHA 1SYGA 5G3LF 4YHHQ 4HIKA 4BBRH 1YJ9A 4LW1A 1GO3E 3H15A 2D9UA 1EZ6A 1TU2B 1K3BC 1PTOD 3TQYA 4O2DA 4CDFC 1BCPB 2G9HD 5KYLA 4G4KA 1B1ZA 3Q22A 2L12A 5C0XG 2BA1A 4HAEA 3KJOA 1WCMH 1X56A 4OL7A 4V0BA 5EGTA 5C0XJ 4Q0FA 3H6MA 3P20A 3RD4A 4BBRB 3LWEA 4AQYQ 1HFGA 1VQOA 3SHLA 3CCJA 4JPBW 4POGA 3K81C 1D1KA 2TSSA 3A74A 3CP0A 3H0GH 3E0EA 4DGZA 3K57A 1PH4A 3NBHA 2HDLA 4DV0Q 1WCMB 1N36L 1EFID 3J80c 1IBMQ 5ELOA 2K52A 3OMGA 4CKCA 5C3EG 1OXXK 2B39A 4K5VA 4I7ZC 2XWJB 2AQ2B 4GN5A 3CAMA 3V2TA 1JQYD 4LF5Q 4GOPB 2K6AA 3RNUA 1W3SA 3H0GB 2MNAA 4K0KQ 2R93H 5JPNC 3WDNA 1I4GA 3NK9A 1VMPA 2L9HA 4DV2L 3S16H 3FPPA 1P16A 1QWYA 4GNXC 1VQBA 1VQHA 2UXDQ 1MBYA 2K50A 1YJWA 1UE1A 2R92H 2JA8B 3HKZB 5ELDA 1DOKA 3NEMA 4JK1C 2QDLA 5BR8Q 1VQFA 3I3CA 3I4NH 2BCOA 4IALA 3KJPA 4A3FG 5LMNW 4X3SA 5AFWA 5HGQA 2OEOA 1YNNC 2R93B 1VQGA 4QCLA 2E74C 4DR6L 3S24A 1IBKQ 1SNMA 3S16B 4R4QA 4DV3Q 2LMCB 1AN8A 3NTKA 1DONA 1VQNA 5EBCA 3HZXA 1SDFA 2R92B 1Y1VG 1EU4A 4A3KH 4IO9A 3OWFA 2A68C 3I4NB 3VR4A 2HT1A 2YU9B 4Y52H 1EIHA 2CWPA 2RSOA 1CFMA 1EOVA 1PFMA 3DEOA 4OO1H 3KLSX 1S40A 1HXYD 1VQLA 1OTCA 2B2UC 5LMUQ 1QJOA 3R93A 1F9SA 2ID0A 1WTXA 4A3KB 2UXBL 3PUWA 1VF7A 3T1HQ 3GTPH 3Q23A 1ESFA 4BBSH 1RKNA 4DUZL 5IP7H 1AW7A 4OO1I 1WTPA 2PW7A 3NENA 3J7ZC 1EY8A 1CI3M 1IYUA 1RD9D 1EEID 2KECA 3QWNA 3A7LA 5I9PA 2ALYB 2UUBL 2VNUD 1GUNA 2JSOA 3AU7A 1TWAH 2HCCA 2NN6H 4PZ6A 3GTKH 3GQBA 3NWTA 4BY7G 4DR7Q 3GTPB 4X64Q 4A3MH 2LS01 2G5DA 2ZTCA 4ZRZA 1V43A 4BBSB 4A75A 2N49A 2DY7A 4B3TL 3ULJA 3LWUA 4YHHL 3D0FA 2HQEA 5EQ0A 2E75C 3N52A 2WP8J 1LTTD 3RLFA 1V1QA 4HSVA 2VQFQ 2OTLA 1SEBD 3HOUG 1WYDA 1VQPA 1VQEA 3GTKB 4GLAC 4F8MA 1J8IA 2ZXRA 5CYUA 3U50C 5KNBA 5KEEA 4A3MB 1G51A 5NUCA 3TREA 3Q6SA 4JI3Q 5C4ZA 1DJRD 4A3GG 3KLWA 2EY1A 2B2WC 3QO2A 4JG2A 5IYDG 5K5PA 4OONA 2MJ8A 3X3NA 2DGYA 1A63A 3CW2C 1O80A 4MNOA 2N3SA 1UEBA 3R3OA 2K5QA 4K14A 1SJHD 4MZ9A 1AH9A 3GTGH 4LFBQ 2KEDA 4B9XA 4IPDA 1CHPD 1R9TB 2F0SA 1RCVD 2XIWA 1RL2A 1AFPA 1K83H 1X55A 4DV0L 1IBML 4LF7Q 3HG9A 4JI2Q 3OTOL 1QUQA 3CPWA 5FLMH 1XNRQ 2F3VA 1WFQA 2FMMA 4IPCA 3VR5A 1XPOA 1BCPD 5E1FA 1C48A 3MEFA 1HA6A 3D6WA 1SSOA 4FNFA 1SNOA 4QB4A 2F0JA 3PGZA 2UXCQ 1KLUD 2JEBI 1DGSA 2WIIB 4K0KL 2H1EA 3GTGB 2JA5H 4DAYA 3UDIA 5DM63 1YNXA 2D62A 4CHTB 2DNCA 5IYCH 1TQOA 1MSHA 3H94A 5CORA 1K83B 4H02A 4JV5Q 3EROA 1CA6A 3CCRA 1YHQA 1ZYRC 1I94L 1QVFA 3HOZH 4HCEA 1I3QH 2MUYA 4YCWA 1B9NA 2UUCQ 3ZYYX 2Q8TA 5DNFA 3PUXA 1U9RA 5D65A 3J7AF 1JOQA 4JBKA 4GLXA 4JI7Q 2EYJA 2MPMA 1O7YA 3AFQA 2EOTA 1PVOA 2EIFA 1NR4A 5FK9C 2JA5B 1LV9A 1FNVA 2WFWA 3NWSA 1IBKL 4LAAA 1YI2A 1FJGQ 4DAMA 4OEMB 4DV3L 2KUMA 3HOZB 1UEAB 2M2LA 1I3QB 2RDFA 5KRUA 3I4OA 1EYDA 2KHSA 4RGTA 2PPBC 4X65Q 4CJ1B 4KHVA 1AEXA 4L6TB 1H9SB 1SAPA 3K5MA 5IP9H 4NXNQ 3DWQA 4DR5Q 4B9WA 1G2TA 4LUOA 1XX8A 2F0TA 4ME5A 4FYDA 3NP8A 5C3WA 4U68A 3PMFA 3JAMi 4XIGS 4KN7C 1KRTA 3K7UC 5LMUL 1K8AC 1KNEA 3MXGA 1I4PA 3J81E 2KHIA 2PNHA 3A7AB 3KUPA 4K5XA 3NHHA 2R7FA 1TWGH 1M8AA 1EWHA 1DM0B 3MWYW 5DLQE 3IAYA 1IW7C 3FKIB 4DNIA 2FINB 2NZOA 1C0AA 5ELBA 1VQ5A 2F1MA 5JJKA 1DXMA 4LUVA 1CK1A 3H3VC 2VUMH 4DR7L 4X64L 4KY5A 5D3DA 3CPFA 1BF4A 2AWNA 4GKJQ 5JPMC 3FVQA 1TWGB 4DXFA 2N55A 3BDLA 1N32L 4RHRA 4X3UA 1ICFB 3A8KE 4CGYB 3TP6A 4CDCC 2OT2A 5C4JH 2F0FA 1SR3A 3C3LA 4DV6Q 1QZHA 4HIDA 3NTHA 3RUZA 1SJED 1HUNA 3AB9A 4XQQA 2VQFL 3UDGA 1PH9A 1D5XC 2N78A 5EAYA 4C3IB 2F4VQ 1GUGA 3PO3B 2F4IA 1CQVA 4Q5VA 1U0LA 5T1IA 4BBRG 1T5XD 3MEHA 4OWXB 1OO9B 4N8X1 4IURA 2A6HD 2B2TC 3HOXH 5CC4A 5FLXE 2E2DC 2JP1A 1HNWL 3VA5A 2IPKD 4IUQA 1X65A 3ER0A 1JMCA 1NY4A 3FP9A 4LFBL 2E76C 3HKSA 1WCMG 2EQSA 1S5DD 1FD7D 1SNPA 3BZCA 5KNCA 4LF7L 2B8FA 4PQXA 5C6AA 1XNRL 2EYFA 2PNRC 1IYVA 2K7VA 1CZGA 2BH8A 1RJTA 2ENBA 4F87A 3H0GG 5CMDA 2HHHQ 2UXCL 3KBXA 4LF8Q 2WAQB 5FJ8H 3S2HH 2FJ2A 2XRSD 4K6LA 2K5DA 1ML0D 1KAWA 2A5HA 4OWTB 4JV5L 5C4XB 5I6YA 3VR3A 2ZJPA 1S5FD 3D8GA 5JVG3 3D4WA 4B3MQ 5A2QL 4RKBA 3U9SA 3HKZG 4K8IA 1HZ9A 3E9HA 1GUSA 3CCVA 3V05A 3S14H 1CTMA 1WOCA 2Q2TA 2CCZA 2NVXH 3S1MH 3EFXD 3PQIA 1DZ1A 3L7ZC 3SR1A 4XQNA 4JI7L 2R93G 1HZBA 3WOFA 4BY1H 2EVBA 4IFDI 2Z6KC 4FXKC 3S2HB 3A8JE 1W6KA 2YYZA 1VCIA 2Q2IA 4C3HB 4DUYQ 3QOJA 2F52A 2B29A 2JE6I 2B2YC 2Q8RE 1B7YB 2R92G 1F2MA 2PQAA 4AIMA 1KNAA 2QW7A 2SEBD 3S14B 1CZWA 3I4NG 1UNSA 1PFNA 1STNA 2EY5A 1KQSA 3FMCA 2KQ3A 1NR2A 3S1MB 2NVXB 3IKJA 1UWVA 3HOVB 2DJFC 1JWUD 4BY1B 2EY2A 2ZTEA 3K6OA 5M3FH 5K36H 2NTTA 4OIKA 1PTOC 3BYYB 4DR5L 1Y1WH 5IIFA 4RWSC 1Q81C 2K5WA 1HNXQ 1SBBB 3STBD 1BBWA 3FEWX 3T1YL 2HDMA 2PI2A 2HIXA 4PMCA 5CV8A 1Q1EA 2I07B 1A2TA 4ZQ3A 3K8AA 5LHY1 3Q24A 1QVCA 4YWLA 2CW0D 2K28A 3KF6A 4JI4Q 2OWOA 1SRUA 4LF9Q 5M3FB 3NTIA 4UPAA 2EXZA 4OO1G 1Y1WB 2LKVA 4HIMA 1Z7TA 3OIQA 1B8AA 1LTID 4CDEC 4DV1Q 2LFNA 2ZT9C 4YY3L 2JA9A 4ZUJA 4E6IA 1Z47A 4CJ2C 4DNRB 3HOYH 3FRPB 4EQPA 1SMXA 5GROA 4BBSG 2XWBB 3VYTA 2NYZD 2JA7H 3S1RH 2NZHA 2E2JH 2L1BA 5IP7G 2QEXA 3SK8A 3I70A 2O4XA 4RGNA 5M3MB 1MHWC 3TBIB 3HEJA 4O42A 1ZEQX 2OF1A 4ME3A 4DV6L 3GP7A 1N34Q 2NVTB 3K5NA 1EWIA 4HJAA 3J7AV 2A6ED 2NN6G 4BA1I 1O7LA 2OQ0A 4A3MG 2F4VL 4HMIA 2JA7B 4MIUA 3S1RB 1PH5A 3NE5B 5FO8B 4IOAA 2E2JB 1EQRA 4RMFA 1RTOA 2K05A 4BA2I 4KHPL 4DXGA 4ZYSA 2RKSA 2P5ZX 3TP7A 1A0IA 3F2BA 2N8NA 3I90A 5CV9A 3F2CA 1LABA 1HQMC 1D1IA 3MFGA 1XYIA 1GM5A 2K14A 3ERQA 4A4IA 4JYAQ 2BE5D 3G6JB 1L0XB 1SYFA 3EN2A 3JAML 1H9MA 4R9WA 1JJ2A 1EIYB 2IX1A 3Q8DA 4A3JH 1JOKA 2L4NA 3S2DH 2KBNA 3NBHB 2O5IC 2FHTA 4JI1Q 4A3DH 2NBFA 4DAVA 2DY8A 4XDXA 4G57A 3LGJA 3DWAA 2CQOA 2Y0SB 2HHHL 3RZOB 3L3OC 3EVQA 1YNJD 1I5FA 4DR4L 4BS9A 1JJGA 5FLXL 2EJFC 3A0JA 2SNSA 3OOCA 5FLMG 2BA0A 3D3RA 5JJIA 1E7ZA 1BVSA 4A3JB 4IOCA 4B3ML 3S2DB 2K32A 2VB3X 1M4VA 1D7QA 4NKLA 2UUAQ 2PMZB 4A3DB 2IJ0A 1CSQA 4IUTA 3OW2A 4B08A 2Z1CA 4JVZA 3PCOB 2V4DA 3B6YA 1K28A 1TWHH 1KRSA 1NAPA 2F0UA 5IYCG 1RIPA 2F0VA 2HQLA 1PV4A 3KYHC 3W1BA 4DUYL 3HOZG 4JI0Q 4J15A 4A3CH 1I6HH
chains in the Genus database with same CATH topology
1H9KA 2ICEC 1IL8A 4ZKCB 1EY9A 5KIXA 4G7ZC 4KKUA 1TWHB 2Z4HA 1EY7A 1MI2A 5IT9L 4HSPA 5C4HA 4GZYC 2EE1A 5IGDA 1I6HB 1TKWB 5JVH3 3BS1A 2C9OA 1HPCA 4H13C 3KF8A 1DD2A 5T1GA 4QUCA 4C2MB 3MZ5A 3VR2A 4K2KA 3U9OA 5JEAH 4IUNA 3L9AX 4DAPA 1D2BA 4HEDA 1PZID 3S9WA 3BDCA 1SNCA 1JCKB 3K5LA 1Q8IA 3KLSA 1PTOF 1KDAA 1BCPC 5IODA 2KVMA 3GO5A 4A93B 1BDOA 3GTJB 4HTHA 1ET6A 3BG3A 5BN4A 5E3FA 2PYKA 1HUMA 1TY2A 3EA6A 3NPPA 3T56B 2JA6B 1JC7A 1HTPA 1V8QA 3TDQA 1D5MC 3PO2B 1TR5A 1DYQA 3GD7A 1RDPD 2B2UA 2JYOA 2CHBD 4TQUS 3QIAA 1DOMA 1HRJA 1OXTA 3GV3A 3NSWA 1QG7A 2AWOA 2GA4B 4N9TA 4ZK9B 1Y8PB 3NBIA 2F0LA 3BDOA 3DMUA 4KHZA 1DOLA 5CV5A 2E2IB 1CA5A 3D4DA 4OGQC 1BQQT 2MHVA 3OMCA 4IZ8A 4KN4C 4G7HC 4V190 3M4OB 4KTAA 2IW3A 1XWEA 1HCZA 1VMCA 4RCNA 1X3QA 2XN9C 4ID6A 3TMEA 2EDGA 3GTLB 3H91A 5I4DA 2L5TA 1RTNA 4C3JB 2B2WA 1KLGD 4AYBB 3CHBD 1U4MA 5D14A 4R8IA 3Q0AA 4S3SA 4NMZA 5A2QE 1F2YA 1TS4A 2TMPA 1WTRA 2RVLA 4NW2A 5C44B 2KCCA 3IFTA 4KV6A 4OHJA 1LTGD 3UI2A 4RGMA 1H9RA 2B63B 1EL0A 3K58A 3PUVA 1F9PA 2A6HC 5K36G 2K04A 1L0YB 5M9OA 3I8ZA 4KJOA 4KK7A 4F7XA 4FXGC 3OWEB 5KNDA 1SMYD 4K8JA 3DM1A 1B2TA 1F9QA 4KMUC 3BVMA 1VDZA 1PFBA 4XYOA 2EYHA 4N9PA 3I72A 2PQEA 3SK4A 2F3WA 2M00A 1JE4A 4CJ0B 1Y8NB 1BUVT 4QMGA 4KKTA 1PZJD 5TSSA 3V96A 3MFYA 3S1QB 3TP8A 1I6VC 5C0XI 4KKSA 2KA7A 1EEFD 4TKOB 2XVSA 3T4AC 1RODA 3LX0A 1S5BD 1EY0A 1R4QB 4RHSA 1O7ZA 1HHVA 4KY6A 1PRTB 1BNZA 1BCPF 1JR0D 1HFNA 4FP5D 1LT4D 3K7AB 1ICWA 3K5OA 1SXTA 3NQIA 1S4ZA 4ODGA 1B3AA 4C1NK 2A74C 1DCZA 1B44D 4MHEA 4QIWB 3D4RA 5HGTA 4FXDA 5DAUA 1STBA 4RAUC 3R8BA 2Q8IB 4MN3A 2NZ1D 3W2DA 4L8JA 2CW0C 1B53A 1Q1BA 4RGOS 3JAME 2XNAC 2RDGA 4A3FB 2EZVA 1CM9A 4EQOA 3R2IA 1QILA 1E2ZA 2K01A 1WVLA 1HTLD 3SEBA 2IWHA 2XSCA 5ELFA 3LNNA 5EJWA 2B2TA 1Y1VB 3GV6A 1FNUA 3VYUA 4ZAIA 2F0NA 1ENCA 3A54A 1JWMD 1J9OA 2A6EC 2PZTA 1X32A 3HRZC 2QEJC 4RFBA 3VA7A 1A3VA 2B2VC 2OXPA 1EY6A 4WFN3 4IFDH 5I2XA 1EZ8A 3P7JA 4RCOA 4XTCS 3OIPA 1SE3A 3OPOA 2BE5C 4P2CB 1FYCA 5IT9E 3GTQB 1JB3A 1GUWA 1C8CA 5FKAC 3MA2B 1STGA 3M85A 1I4QA 2EYPA 2D5DA 1LT6D 3I91A 1YNJC 5JEAG 1ILPA 4DU9A 5ELEA 4Z9CB 2PZWA 2B2YA 1EU3A 3HOUB 3M3YB 4EVOA 1A3TA 5E4WC 1TY0A 1JOOA 4HCSA 1XXGA 1I4XA 1E0BA 2F0WA 5EPKA 3QOLA 5F2DA 4IUUA 2WB1B 1LT5D 2R61A 1SFOB 1FNWA 4ZLTF 4KI0A 5CBEE 1LTAD 2L11A 3OSOA 5J22A 1Q12A 5FO9B 3A55A 2NWGA 3QG1A 2KEEA 2R6GA 1MSGA 1EWCA 2BDNA 3CRKC 3CU7A 2JEAI 3I4LA 1WTOA 3RMHA 5JJZA 2KOLA 3HOWB 1I50B 3HP3A 1PYWD 1PLFA 3MTSA 2F03A 1LTBD 1ILQA 5CBAE 2B8GA 2G9DA 1A2UA 3BZDB 4IN3A 1G91A 3IFDA 1I4HA 2J4XA 4FF4A 1GHJA 1B9MA 4J6HA 1BXTA 3VYSA 2IT1A 4C3JG 4WRDA 1SYEA 1U4PA 5EKLA 1KTKA 3T53B 4HR7B 4TRDA 2QDBA 1VF5C 1STAA 4RKLA 1JICA 3E0JA 2MP1A 1SNQA 3I4MB 4IQZA 1B4OA 3PV0A 3SE0A 1TWCB 1WTWA 4A3BB 4PV1C 3KK7A 1TS3A 2R7ZB 3VR6A 3C2PA 1FR3A 3RZDB 2L55A 1W6JA 3TZDA 1S5ED 3SDZA 1IKLA 2K33A 2KJXA 3W3AA 5A35A 1LTRD 3WOEA 5E4XA 4KY7A 2F0QA 4ABNA 1GUTA 1OXSC 1LACA 1Q3LA 2NVQB 2NB0A 4ILWA 2HUGA 4A3EB 4KJNA 1OXUA 2NUCA 3MXNA 1Q90A 5ISRA 1AZQA 1SYCA 5I2YA 4H0LC 1QCBD 1HQRD 2N88A 4X3TA 1QE6A 3MC0B 5JOBA 4XQJA 2A69D 2BOSA 2MGSA 3DXJC 5LL6S 2RDHA 1EIGA 4YIJA 1XTCD 1II3A 1KABA 1ET9A 3N6RA 1UAPA 2L0CA 1CQFA 4XYQA 4O1NA 5EPLA 4H44C 1WTQA 3D31A 1V1PA 1K8MA 5EKKA 3X3MA 4WORA 1ZXTA 2F0KA 1GJXA 5JAVA 1QB5D 3NQTA 2SOBA 3QJYA 2AQ3B 1SYBA 3SK6A 3HGBA 3E6ZX 2F0IA 4C3IG 1U4RA 3J80L 1SMYC 2WINB 3MAQA 2X69A 3CRLC 2ZXOA 2K1BA 3J7YW 5EPJA 2F0GA 1TVXA 3K0YA 1F77A 5D3IB 1Z6HA 3MXPA 5C5LA 1E2WA 3ND8A 1SE4A 3KBGA 3M4YA 2M9VA 1JORA 4HMJA 4TSSA 1V1OA 1EQVA 4A3IB 1AP0A 4DNTB 1EYAA 3MHBA 1MGSA 1NUCA 1Y8OB 5CR3A 4U673 1PXUA 3IL8A 3ONAB 2O2LD 1KDBA 2RBMA 3DWPA 1BO0A 4DK0A 1B50A 2ZXPA 1F9RA 1STYA 2F0PA 1WD1A 2H4OA 2IX0A 2WACA 3OW7A 5C5MA 3S15B 1SYDA 3TZUA 3EQLC 4IFDG 5EBDA 4NP5A 4C3HG 5LL6X 1BBXC 1C4QA 3PIO3 4IFDJ 5DM73 4DF7A 1CT1D 3VYRA 5I9OA 2LY7A 4X3KA 2DNEA 2NN6I 3D6CA 3E5SA 3S1NB 1TWFB 1TWAB 1UUPA 1KAAA 5CV7A 3FDTA 2AUJD 2CVRA 4UAIA 5J1ZA 1BOSA 5CV6A 2QCPX 1STHA 4FF2A 1QOHA 4RH6A 2I46A 5IGGA 1LO5D 4NDXA 1R4PB 3URYA 4CBVA 1GOZA 4I65A 2IX3A 1ENAA 1CHQD 3C46A 1GHKA 3S17B 5IOCA 4DA2A 3ITPA 4QUFA 1WTVA 1YNND 2EYMA 4M1UB 1TS5A 5M5XB 1HA5A 3A8IE 5KYIA 3SK5A 5C0XH 1G6ZA 2A68D 2RQXA 1Y69U 3BVGA 2SDFA 5IGBA 1IKMA 5M5WB 3ND9A 2BDOA 4KD4A 3H09A 1PZKD 1SNDA 4WJWA 3M7GA 3OHXC 3AMUA 5M5YB 3A56A 1ENFA 3BYTB 3MVVA 1G8ZD 5C3XA 2NTSA 3EJIA 2X6LA 4EGVA 2XRQD 2C5CA 1D6EC 1T5EA 2EY6A 1I4RA 1TS2A 4FF3A 4F88A 3KLRA 1F2LA 4J1MA 1EY5A 4IUVA 1G2SA 5C3EB 3QB3A 1X3PA 1LTSD 2EYLA 4CKBA 1O78A 5IGCA 1QNUA 4IUPA 4K2LA 2E2HB 3P75A 1GUOA 1E2VA 3CQZB 2NVYB 4BWGB 1SE2A 4H7BA 2DN8A 3T16A 5IGEA 4K5WA 2EYOA 2K03A 2VB2X 4LJZC 2Z8LA 2F0HA 1IHZA 2Z4IA 2CQAA 1MD2D 4C56C 4L63B 1H9SA 4JBWA 1TT2A 4RA8A 2KCNA 5FOBB 5CGKA 1KDCA 1PTOH 3I73A 2VUMB 1TIID 2EPBA 1PDQA 2EJGC 1PRTC 3R2TA 4J8QA 4FO2A 1LT3D 4K6DA 1LLRD 3G7LA 5C4JB 2HCIA 2JXMB 1G291 4PMWA 1STEA 1PTOB 4LK1C 1ZYRD 3PUZA 2QF7A 4XXEA 4QF4A 3TN2A 2B2VA 3T13A 5IGFA 1D5ZC 5ELCA 1EY4A 3HOXB 3PIP3 2F0MA 4BY7B 1ONLA 4DN4M 5BN5A 4XT1B 1NSNS 3GTMB 2RSNA 1JWSD 2ICIA 3TSSA 2PZUA 1F2ZA 1BR9A 1U4LA 5JEAJ 2QKIC 2IL8A 2FFKB 2SNMA 3C1EA 4FVMA 4KD3A 4A3GB 2QILA 5COYA 2D2CC 2FMCA 2PW5A 3F2UA 4PMBA 1H9JA 1IW7D 2F0OA 2AUKA 1NCVA 1EYCA 2O5JC 4UDUC 2F0DA 3SVMA 1WD0A 2AQ1B 5EKIA 3T51B 3J80E 4ZUIA 5I6WA 3DUZA 4ULLA 1A6XA 3BVZA 1K8OA 2J0TD 2J7ZA 3TP5A 4CKEA 3PUYA 2VXWA 2A69C 5FO7B 1GXDC 1ZKOA 3CKIB 3M7NA 4HN7A 4PNYA 2PCFB 2WKDA 1PRTD 4XT3B 4FF1A 1ESRA 2WKCA 5G3LD 3O13A 3P1HA 4C1NI 3J81L 3DEPA 3DHQA 2WV6D 5BN3A 1PMRA 5DEHA 3HOYB 3FPUB 2EJMA 2X6GA 3MXUA 3NXWA 1OXVA 3HS0C 1QNKA 5CV4A 1EQTA 2R3ZA 4R8NA 3C1FA 5J39A 2RA4A 4EQNA 4OIJA 3K59A 2PO4A 1A3UA 5HURA 4DK1A 2F0EA 4ZKBB 5KGUA 1EOTA 1S5CD 4Y7NB 1FGBD 3GTOB 4LMQD 1A15A 3NUCA 1AZPA 4G7OC 1RF2D 2A73B 1PRTF 4M8AA 1RHPA 1V1PB 4DFAA 3SXHA 1SYGA 5G3LF 2D9UA 1EZ6A 1TU2B 1PTOD 1BCPB 2G9HD 5KYLA 4G4KA 1B1ZA 3Q22A 2L12A 5C0XG 2BA1A 4HAEA 4OL7A 4V0BA 5EGTA 5C0XJ 4Q0FA 3H6MA 3P20A 3RD4A 4BBRB 3LWEA 1HFGA 3SHLA 1D1KA 2TSSA 4DGZA 3K57A 3NBHA 2HDLA 1WCMB 1EFID 3OMGA 4CKCA 1OXXK 2B39A 4K5VA 4I7ZC 2XWJB 2AQ2B 3V2TA 1JQYD 2K6AA 3H0GB 5JPNC 3WDNA 1I4GA 3NK9A 1VMPA 2L9HA 3FPPA 1QWYA 1MBYA 2JA8B 3HKZB 5ELDA 1DOKA 4JK1C 3I3CA 2BCOA 4IALA 4X3SA 5AFWA 2OEOA 1YNNC 2R93B 4QCLA 2E74C 1SNMA 3S16B 1DONA 2LMCB 1AN8A 3NTKA 5EBCA 3HZXA 1SDFA 2R92B 1EU4A 3OWFA 2A68C 3I4NB 3VR4A 2YU9B 1EIHA 2RSOA 1CFMA 1PFMA 3DEOA 4OO1H 3KLSX 1HXYD 2B2UC 1QJOA 3R93A 1F9SA 2ID0A 1WTXA 4A3KB 3PUWA 1VF7A 3Q23A 1ESFA 1RKNA 1AW7A 4OO1I 1WTPA 2PW7A 1EY8A 1CI3M 1IYUA 1RD9D 1EEID 2KECA 3QWNA 3A7LA 5I9PA 2VNUD 1GUNA 2JSOA 3AU7A 2HCCA 2NN6H 3GQBA 3NWTA 3GTPB 2LS01 4ZRZA 1V43A 4BBSB 2DY7A 3LWUA 2HQEA 5EQ0A 2E75C 3N52A 2WP8J 1LTTD 3RLFA 4HSVA 1SEBD 3GTKB 4F8MA 1J8IA 2ZXRA 5CYUA 5KNBA 5KEEA 4A3MB 5NUCA 3Q6SA 5C4ZA 1DJRD 2EY1A 2B2WC 3QO2A 5K5PA 2MJ8A 3X3NA 1O80A 3R3OA 2K5QA 4K14A 1SJHD 2KEDA 4B9XA 1CHPD 1R9TB 2F0SA 1RCVD 2XIWA 1AFPA 3HG9A 2F3VA 2FMMA 3VR5A 1BCPD 5E1FA 1C48A 1HA6A 3D6WA 1SSOA 4FNFA 1SNOA 4QB4A 2F0JA 1KLUD 2JEBI 2WIIB 2H1EA 3GTGB 4DAYA 5DM63 4CHTB 2D62A 2DNCA 1TQOA 1MSHA 3H94A 5CORA 1K83B 3EROA 1CA6A 1ZYRC 4HCEA 2MUYA 1B9NA 3ZYYX 2Q8TA 5DNFA 3PUXA 1U9RA 5D65A 3J7AF 1JOQA 2EYJA 2MPMA 1O7YA 2EOTA 1NR4A 5FK9C 2JA5B 1LV9A 1FNVA 3NWSA 4LAAA 2KUMA 3HOZB 1UEAB 2M2LA 1I3QB 2RDFA 5KRUA 1EYDA 2KHSA 4RGTA 2PPBC 4CJ1B 4KHVA 1AEXA 4L6TB 1H9SB 1SAPA 3K5MA 1G2TA 3DWQA 4B9WA 1XX8A 2F0TA 4ME5A 4FYDA 3NP8A 5C3WA 4U68A 3PMFA 4XIGS 4KN7C 1KNEA 3MXGA 1I4PA 3J81E 3A7AB 3KUPA 4K5XA 3NHHA 1M8AA 1EWHA 1DM0B 3MWYW 3IAYA 1IW7C 3FKIB 2FINB 5ELBA 2F1MA 1DXMA 1CK1A 3H3VC 4KY5A 5D3DA 1BF4A 2AWNA 5JPMC 3FVQA 1TWGB 4DXFA 2N55A 3BDLA 4RHRA 4X3UA 3A8KE 4CGYB 3TP6A 2OT2A 2F0FA 3C3LA 3NTHA 3RUZA 1SJED 1HUNA 3AB9A 4XQQA 1D5XC 4C3IB 1GUGA 3PO3B 2F4IA 1CQVA 4Q5VA 5T1IA 1T5XD 3MEHA 1OO9B 4IURA 2A6HD 2B2TC 5CC4A 5FLXE 2E2DC 2JP1A 3VA5A 2IPKD 4IUQA 2E76C 5KNCA 1S5DD 1FD7D 1SNPA 2B8FA 4PQXA 5C6AA 2EYFA 2PNRC 1IYVA 2K7VA 1CZGA 1RJTA 2ENBA 4F87A 5CMDA 3KBXA 2WAQB 2FJ2A 2XRSD 4K6LA 2K5DA 1ML0D 2A5HA 5C4XB 5I6YA 3VR3A 1S5FD 3D8GA 5JVG3 3D4WA 5A2QL 4RKBA 3U9SA 4K8IA 1GUSA 3V05A 1CTMA 3EFXD 1DZ1A 3L7ZC 3SR1A 4XQNA 3WOFA 2EVBA 4IFDI 4FXKC 3S2HB 3A8JE 1W6KA 2YYZA 1VCIA 4C3HB 3QOJA 2JE6I 2B2YC 2Q8RE 1F2MA 1KNAA 2SEBD 3S14B 1CZWA 1UNSA 1STNA 1PFNA 2EY5A 3FMCA 2KQ3A 1NR2A 3S1MB 2NVXB 3IKJA 3HOVB 1JWUD 4BY1B 2EY2A 5K36H 3K6OA 2NTTA 4OIKA 1PTOC 3BYYB 5IIFA 4RWSC 2K5WA 1SBBB 3FEWX 2HDMA 4PMCA 5CV8A 1Q1EA 2I07B 1A2TA 4ZQ3A 5LHY1 3Q24A 2CW0D 2K28A 5M3FB 3NTIA 2EXZA 4OO1G 1Y1WB 2LKVA 1Z7TA 3OIQA 1LTID 2LFNA 2ZT9C 4ZUJA 4E6IA 1Z47A 4CJ2C 4DNRB 3FRPB 4EQPA 2XWBB 3VYTA 2NYZD 2L1BA 3SK8A 3I70A 2O4XA 4RGNA 5M3MB 3TBIB 3HEJA 4O42A 1ZEQX 2OF1A 3GP7A 2NVTB 3K5NA 3J7AV 2A6ED 2NN6G 4BA1I 1O7LA 4HMIA 2JA7B 4MIUA 3S1RB 3NE5B 5FO8B 2E2JB 1RTOA 2K05A 4BA2I 4DXGA 4ZYSA 2RKSA 3TP7A 3I90A 5CV9A 1LABA 1HQMC 1D1IA 3MFGA 1XYIA 3ERQA 2BE5D 3G6JB 1L0XB 1SYFA 3JAML 1H9MA 4R9WA 2IX1A 1JOKA 2L4NA 2O5IC 2FHTA 2NBFA 4DAVA 2DY8A 4XDXA 4G57A 3DWAA 2Y0SB 3RZOB 3L3OC 3EVQA 1YNJD 4BS9A 5FLXL 2EJFC 2SNSA 3OOCA 2BA0A 3D3RA 4A3JB 3S2DB 2K32A 2VB3X 1M4VA 4NKLA 2PMZB 4A3DB 2IJ0A 4IUTA 4B08A 2Z1CA 2V4DA 1NAPA 2F0UA 2F0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NXW A;  4KHV A;  1AEX A;  5IGG A;  2EYF A;  5CV4 A;  2HQE A;  4NDX A;  3P75 A;  2EYH A;  4N9P A;  2PQE A;  2ENB A;  2SNM A;  3SK8 A;  3C1E A;  2O4X A;  4B9W A;  3SK4 A;  3NK9 A;  1EY9 A;  2F0T A;  2F3W A;  4I65 A;  4KD3 A;  3HEJ A;  3C1F A;  4ME5 A;  2M00 A;  2OF1 A;  1ENA A;  3NP8 A;  4KY7 A;  4R8N A;  5J39 A;  4EQN A;  5C3W A;  2F0Q A;  3OSO A;  4F8M A;  2F0G A;  4N9T A;  3PMF A;  5J22 A;  5KEE A;  3T16 A;  4H7B A;  5IOC A;  2F0N A;  1ENC A;  1EY7 A;  1A3U A;  2F0L A;  3MXP A;  4QMG A;  3DMU A;  5CV5 A;  5C5L A;  5NUC A;  2PW5 A;  4PMB A;  3D8G A;  5C4H A;  3D4W A;  5C4Z A;  5IGE A;  4K5W A;  2EYO A;  3ITP A;  4HMI A;  4K5X A;  5IGD A;  2EY1 A;  2PZT A;  4RKB A;  3NHH A;  4K8I A;  4MIU A;  4IAL A;  3D4D A;  5K5P A;  2F0O A;  5HUR A;  2EYM A;  2F0H A;  3OMC A;  3TP8 A;  1IHZ A;  1JOR A;  4IZ8 A;  4HMJ A;  2OEO A;  2F0E A;  1EYC A;  5KGU A;  1EQV A;  4KTA A;  2RKS A;  3R3O A;  4KJN A;  4K14 A;  3SR1 A;  2F0D A;  3TP7 A;  2NUC A;  1EYA A;  1TT2 A;  3MHB A;  1A3V A;  1SNM A;  5CV9 A;  3SK5 A;  5KYI A;  3LX0 A;  5CGK A;  1KDC A;  3MZ5 A;  2OXP A;  1NUC A;  3NUC A;  4B9X A;  1EY6 A;  4K2K A;  1EY0 A;  2F0S A;  5CR3 A;  3U9O A;  5ISR A;  1SYC A;  3HZX A;  4ZUI A;  4ID6 A;  3QOJ A;  1KDB A;  4IUN A;  3ERQ A;  2RBM A;  1EZ8 A;  3TME A;  3OWF A;  5I6W A;  5IGB A;  4KY5 A;  4DFA A;  2F3V A;  1A2U A;  1F2M A;  3SXH A;  1SYG A;  1SYF A;  4KY6 A;  5JOB A;  5E1F A;  3S9W A;  3BDL A;  3BDC A;  1JOK A;  1STN A;  2EY5 A;  1SNC A;  4J6H A;  4KD4 A;  4K6D A;  3TP5 A;  1EZ6 A;  1STY A;  2KQ3 A;  1KDA A;  1SNO A;  4QB4 A;  3TP6 A;  5IOD A;  1SND A;  2F0J A;  4WRD A;  4YIJ A;  2F0P A;  5KYL A;  1II3 A;  1KAB A;  1SYE A;  2EY2 A;  2F0F A;  4G57 A;  3RUZ A;  2WAC A;  4S3S A;  5EKL A;  5C5M A;  5IIF A;  4NMZ A;  1SYD A;  1TQO A;  4ODG A;  3EVQ A;  1F2Y A;  4PNY A;  4TRD A;  3MVV A;  4HTH A;  1STG A;  3ERO A;  4QF4 A;  4OL7 A;  2QDB A;  1STA A;  5EGT A;  3T13 A;  2EYP A;  4RKL A;  4NP5 A;  5C3X A;  5IGF A;  3EJI A;  5E3F A;  2PYK A;  3H6M A;  1SNQ A;  2SNS A;  4DU9 A;  1RKN A;  2PZW A;  3SHL A;  4PMC A;  5HGT A;  1U9R A;  5CV8 A;  1EY4 A;  1JOQ A;  3P1H A;  1A2T A;  5DAU A;  1STB A;  3MEH A;  4ZQ3 A;  4DF7 A;  2EY6 A;  4NKL A;  5EKK A;  2PW7 A;  4KV6 A;  2EYJ A;  4WOR A;  5I9O A;  2F0K A;  5CC4 A;  1EY8 A;  4EVO A;  4DGZ A;  3DHQ A;  3D6C A;  3E5S A;  5I9P A;  3VA5 A;  4J1M A;  1EY5 A;  1A3T A;  2EXZ A;  5JAV A;  1KAA A;  2F0M A;  2LKV A;  3NQT A;  5CV7 A;  5I6Y A;  2SOB A;  1JOO A;  4LAA A;  5M9O A;  4KJO A;  1SYB A;  1TR5 A;  2F0U A;  3QB3 A;  2F0V A;  5DEH A;  3SK6 A;  4F7X A;  4ZUJ A;  3OMG A;  1SNP A;  2F0W A;  2RDF A;  4E6I A;  1NSN S;  2F0I A;  2EYL A;  4K5V A;  5J1Z A;  5KRU A;  3QOL A;  4K8J A;  5KIX A;  1EYD A;  5CV6 A;  5F2D A;  4EQP A;  4EQO A;  5C6A A;  5IGC A;  1STH A;  2KHS A;  2PZU A;  3V2T A;  4K2L A;  1F2Z A; 
#chains in the Genus database with same CATH topology
 1H9K A;  1XMQ L;  2ICE C;  1IL8 A;  1N33 L;  4ZKC B;  1XPR A;  3ERS X;  1B3Q A;  1EY9 A;  3SGI A;  4CDD C;  5KIX A;  4G7Z C;  4KKU A;  1TWH B;  2Z4H A;  4LFA Q;  4DR2 L;  2D0P A;  4DR3 Q;  1EY7 A;  1MI2 A;  5IT9 L;  4HSP A;  5C4H A;  4GZY C;  2EE1 A;  5IGD A;  2JA8 H;  1I6H B;  1HNX L;  1TKW B;  5JVH 3;  3BS1 A;  2C9O A;  1HPC A;  4H13 C;  2KCM A;  5IE8 A;  3KF8 A;  4JI4 L;  1DD2 A;  5T1G A;  5IP9 G;  4A93 H;  4QUC A;  4C2M B;  3MZ5 A;  3VR2 A;  4K2K A;  3G48 A;  3U9O A;  4DV1 L;  4YCV A;  5JEA H;  4IUN A;  4GKK Q;  3L9A X;  4DAP A;  4GNX A;  1D2B A;  1XTD A;  4HED A;  1LTL A;  1PZI D;  1YHA A;  3S9W A;  3BDC A;  1SNC A;  1JCK B;  3K5L A;  2YU9 H;  1Q8I A;  3KLS A;  2JA6 H;  1PTO F;  4UP9 A;  1KDA A;  1BCP C;  5IOD A;  2KVM A;  1EFW A;  3GO5 A;  3G6E A;  2F3I A;  4A93 B;  5IWA L;  4LFC Q;  1BDO A;  2A19 A;  1VQ4 A;  3GTJ B;  3PO2 H;  1N34 L;  4HTH A;  3BJU A;  4B3R L;  1SLJ A;  1ET6 A;  3BG3 A;  5BN4 A;  5E3F A;  2PYK A;  3UDF A;  1HUM A;  1TY2 A;  2VUM G;  2ZM6 Q;  3EA6 A;  1N9W A;  3NPP A;  3T56 B;  2JA6 B;  1JC7 A;  4QIW E;  1HTP A;  1V8Q A;  3TDQ A;  4JI6 L;  1D5M C;  1E22 A;  2ZTD A;  3PO2 B;  1IL2 A;  1TR5 A;  4QY7 A;  1DYQ A;  3GD7 A;  1RDP D;  2B2U A;  2VQE Q;  2JYO A;  4JYA L;  2CHB D;  4TQU S;  3QIA A;  1DOM A;  1HRJ A;  2E2I H;  4GOP C;  1OXT A;  3GV3 A;  2AKW B;  3NSW A;  1QG7 A;  1BKB A;  3RLO A;  3M4O H;  2AWO A;  3HOX G;  2GA4 B;  1Z9F A;  1XNQ L;  3KOJ A;  1QUQ B;  4OXP A;  4N9T A;  4ZK9 B;  1Y8P B;  3NBI A;  1K73 C;  1ASZ A;  2WAQ G;  2F0L A;  3BDO A;  3DMU A;  4KHZ A;  1DOL A;  5CV5 A;  5H1S E;  2E2I B;  4NXM Q;  1CA5 A;  3D4D A;  4OGQ C;  1BQQ T;  2MHV A;  3GTL H;  3OMC A;  4IZ8 A;  3QR8 A;  4C3J H;  4KN4 C;  4DAY B;  4G7H C;  4QL5 A;  4V19 0;  3M4O B;  2JQO A;  2YTV A;  4KTA A;  2UUA L;  4X6A H;  2IW3 A;  1XWE A;  1HCZ A;  3E3X A;  1VMC A;  5GAG C;  4X62 Q;  4RCN A;  1EQQ A;  1X3Q A;  5HY6 A;  1G6P A;  1NTG A;  5FJ8 G;  1R9T H;  2XN9 C;  4ID6 A;  3TME A;  3CXC A;  2WAQ E;  2EDG A;  3K80 C;  3GTL B;  3H91 A;  2PI2 E;  5C44 H;  5I4D A;  2ZJR A;  2L5T A;  1RTN A;  4C3J B;  4NB3 A;  1VQ7 A;  4AQY L;  1MKH A;  2B2W A;  1KLG D;  4AYB B;  3CHB D;  2IHF A;  1U4M A;  5D14 A;  1YVC A;  2B63 H;  4R8I A;  3Q0A A;  4S3S A;  4BY1 G;  4NMZ A;  4IPH A;  1XMO Q;  5A2Q E;  1F2Y A;  5GAD C;  4LFA L;  1TS4 A;  2TMP A;  1WTR A;  2RVL A;  4NW2 A;  5C44 B;  2FXQ A;  2GVA A;  4HJ8 A;  3U4Z A;  2KCC A;  3CME A;  4JCV E;  1P8L A;  3IFT A;  4KV6 A;  4OHJ A;  1LTG D;  1IXR A;  4LF5 L;  3UI2 A;  4RGM A;  1H9R A;  4GS3 A;  2B63 B;  1EL0 A;  3K58 A;  3PUV A;  1F9P A;  2A6H C;  5K36 G;  5M3F G;  2K04 A;  2RCN A;  4JI8 Q;  1L0Y B;  5M9O A;  3I8Z A;  4KJO A;  1Y1W G;  4KK7 A;  4WJ4 A;  4F7X A;  3J81 j;  4FXG C;  3OWE B;  5KND A;  2UXD L;  1SMY D;  4K8J A;  3DM1 A;  1B2T A;  4GKK L;  1F9Q A;  1PHJ A;  4KMU C;  3BVM A;  1VDZ A;  1PA6 A;  1PFB A;  4XYO A;  5BR8 L;  3S1Q H;  4YWK A;  2EYH A;  4N9P A;  3I72 A;  2PQE A;  3KFU A;  2CWA A;  3SK4 A;  1K0S A;  2F3W A;  3VDY A;  2M00 A;  1JE4 A;  4CJ0 B;  2OQK A;  4LFC L;  3H3V I;  1Y8N B;  1BUV T;  4QMG A;  4KKT A;  1PZJ D;  5TSS A;  3HOY G;  3U58 A;  3V96 A;  1BBU A;  3MFY A;  3S1Q B;  3TP8 A;  2ZM6 L;  2JA7 G;  2BH2 A;  1I6V C;  3CC7 A;  5C0X I;  4KKS A;  2KA7 A;  3K7A H;  1EEF D;  4TKO B;  2XVS A;  3T4A C;  3FKI H;  1ROD A;  3LX0 A;  1S5B D;  1EY0 A;  1R4Q B;  4RHS A;  5AJ3 Q;  1X54 A;  1O7Z A;  1HHV A;  4KY6 A;  3T1H L;  1PRT B;  1BNZ A;  1BCP F;  2VQE L;  1JR0 D;  1HFN A;  4FP5 D;  1LT4 D;  1J6Q A;  4L5T A;  3K7A B;  1ICW A;  3K5O A;  1SXT A;  2DJG C;  4GLV B;  2RHS B;  3NQI A;  1S4Z A;  1CKN A;  4ODG A;  1X3F A;  1B3A A;  4C1N K;  4JBM A;  5GQO A;  2A74 C;  2Z9H A;  4C3I H;  1DCZ A;  1KD1 C;  1B44 D;  3PO3 H;  4MHE A;  4QIW B;  3D4R A;  5HGT A;  1PH2 A;  4FXD A;  4NXM L;  5DAU A;  3STB C;  1STB A;  4RAU C;  3R8B A;  2Q8I B;  3RLN A;  4MN3 A;  2NZ1 D;  1X3E A;  3W2D A;  3AYH B;  4L8J A;  4A3D G;  2CW0 C;  4AH6 A;  2CFM A;  1B53 A;  1Q1B A;  4RGO S;  4P74 A;  4X62 L;  3JAM E;  1E1O A;  3G4S A;  1UE7 A;  1H95 A;  2XNA C;  3GDE A;  2RDG A;  4A3F B;  2Y0S E;  1YEZ A;  2EZV A;  1CM9 A;  2D0O A;  4EQO A;  4JI3 L;  1C9O A;  3R2I A;  4R4T A;  1QIL A;  1E2Z A;  2K01 A;  1WVL A;  1HTL D;  4DV5 Q;  3SEB A;  2IWH A;  2CKZ B;  2XSC A;  5ELF A;  2JK8 A;  1PH8 A;  3LNN A;  5EJW A;  2B2T A;  2PMZ E;  1Y1V B;  3GV6 A;  1FNU A;  2AMC B;  3VYU A;  2PQA B;  1XMO L;  4ZAI A;  2F0N A;  1ENC A;  3A54 A;  2ATW A;  1JWM D;  4UP8 A;  1J9O A;  5C4X H;  1EIF A;  2A6E C;  4JI2 L;  2PZT A;  1X32 A;  1K3R A;  4JI5 Q;  1L1O C;  3HRZ C;  1KC8 C;  4A3C G;  4DR1 Q;  2QEJ C;  1FGU A;  2B3G A;  4P71 A;  4RFB A;  2ES2 A;  1AE3 A;  1JJC B;  3VA7 A;  1A3V A;  2B2V C;  2OXP A;  1EY6 A;  1MIU A;  4WFN 3;  4IFD H;  2RCF A;  5I2X A;  1EZ8 A;  3UDX A;  3P7J A;  4C3H H;  4RCO A;  4XTC S;  2QGQ A;  2XGT A;  1AE2 A;  3OIP A;  4DK3 C;  3KF6 B;  2JA8 G;  1SE3 A;  2UUC L;  3OPO A;  2BE5 C;  4P2C B;  3M3Y H;  1NJI C;  1E24 A;  3HOV H;  1FYC A;  5IT9 E;  4X66 Q;  2V1C C;  3GTQ B;  3K0X A;  1JB3 A;  4A3L H;  4A93 G;  1GUW A;  1C8C A;  5FKA C;  3MA2 B;  2MFI A;  1FJG L;  1STG A;  1VQC A;  3J80 i;  3M85 A;  2ASB A;  2Z6K A;  1I4Q A;  2EYP A;  3DLL A;  3CCE A;  1O7I A;  1LT6 D;  2D5D A;  1YNJ C;  3I91 A;  5JEA G;  1ILP A;  4DU9 A;  5ELE A;  4O0A A;  4Z9C B;  2PZW A;  1PH1 A;  1W2B A;  2B2Y A;  1EU3 A;  1PH6 A;  3HOU B;  4X65 L;  3M3Y B;  5IY0 A;  4EVO A;  1SFO H;  1Q46 A;  1KHI A;  2LXJ A;  1A3T A;  5E4W C;  1TY0 A;  1HZC A;  4NXN L;  1JOO A;  4HCS A;  1XXG A;  1I4X A;  1E0B A;  2F0W A;  3J81 c;  1KL9 A;  5EPK A;  5AJ3 L;  3QOL A;  5F2D A;  3CD6 A;  4A3K G;  3CCL A;  1YIJ A;  4IUU A;  4FDB A;  2WB1 B;  1LT5 D;  2R61 A;  4P72 A;  1SFO B;  1FNW A;  4ZLT F;  4QJF A;  4KI0 A;  5CBE E;  1VQ9 A;  1N36 Q;  1UE5 A;  5M3M H;  1LTA D;  1NNX A;  2L11 A;  3OSO A;  3HOW H;  3RN5 A;  1I50 H;  5J22 A;  2NVT H;  1Q12 A;  5FO9 B;  2K75 A;  3UE0 A;  3A55 A;  2NWG A;  3QG1 A;  2KEE A;  2R6G A;  3I55 A;  1MSG A;  4GKJ L;  1EWC A;  2BDN A;  2HD3 A;  1VQJ A;  1VQK A;  3CRK C;  3CU7 A;  5GAH C;  2JEA I;  3I4L A;  1WTO A;  4WJ3 M;  3RMH A;  4DV2 Q;  5JJZ A;  2KOL A;  3HOW B;  1I50 B;  1IBL Q;  3HP3 A;  1PYW D;  1PLF A;  3MTS A;  2F03 A;  1LTB D;  1ILQ A;  5CBA E;  1LM0 A;  2B8G A;  2G9D A;  1A2U A;  3BZD B;  3I4M H;  4IN3 A;  1G91 A;  3IFD A;  4LF6 Q;  1I4H A;  2J4X A;  4FF4 A;  1GHJ A;  4I7A A;  1B9M A;  4J6H A;  1BXT A;  3VYS A;  4DR6 Q;  1TWC H;  5FLX c;  2IT1 A;  4C3J G;  4WRD A;  1SYE A;  1U4P A;  4N8F A;  4A3B H;  5EKL A;  1HR0 W;  3M4P A;  1KTK A;  3T53 B;  4HR7 B;  2R7Z H;  4TRD A;  3RZO H;  3BZK A;  3RZD H;  2QDB A;  1VF5 C;  1STA A;  4RKL A;  1JIC A;  3E0J A;  2MP1 A;  1SNQ A;  3I4M B;  4IQZ A;  1B4O A;  3E9I A;  3PV0 A;  4JI5 L;  3SE0 A;  5C44 G;  4NPS A;  1TWC B;  4DR1 L;  1HNZ Q;  2I5L X;  1L0W A;  3ZJY C;  1WTW A;  4A3B B;  2VS1 A;  3F8T A;  4PV1 C;  3KK7 A;  2B63 G;  1TS3 A;  4JOI C;  2RF4 A;  4AYB E;  2R7Z B;  4JW0 A;  3VR6 A;  3CCU A;  3C2P A;  1FR3 A;  3PIO A;  3RZD B;  4R4I A;  2L55 A;  4LF8 L;  1XJV A;  3L2P A;  2GN5 A;  1HR0 Q;  3EIV A;  2NVQ H;  1W6J A;  1A62 A;  3KF8 B;  3TZD A;  1S5E D;  3SDZ A;  4DPG A;  1VQ6 A;  2A1A A;  1IKL A;  2K33 A;  2KJX A;  3W3A A;  5A35 A;  4A3E H;  1LTR D;  2I5H A;  3WOE A;  3PF4 A;  2MO0 A;  5E4X A;  4KY7 A;  2F0Q A;  2JA5 G;  2Z6B A;  4ABN A;  4GNX B;  1GUT A;  2C35 B;  1OXS C;  1LAC A;  1Q3L A;  2NVQ B;  2NB0 A;  4ILW A;  4PG3 A;  2HUG A;  4A3E B;  4KJN A;  1OXU A;  2NUC A;  3MXN A;  2CH4 A;  2KHJ A;  1VQD A;  3ULL A;  1Q90 A;  4C2M H;  5ISR A;  4GN4 B;  1AZQ A;  1SYC A;  5I2Y A;  4H0L C;  1QCB D;  1HQR D;  2N88 A;  3JC6 6;  4X3T A;  1QE6 A;  3MC0 B;  5JOB A;  4L5R C;  3I2Z A;  4XQJ A;  2A69 D;  4IJH A;  2BOS A;  4YCU A;  2MGS A;  3DXJ C;  5LL6 S;  2IY5 B;  2RDH A;  1EIG A;  4YIJ A;  1XTC D;  1II3 A;  1KAB A;  1ET9 A;  3N6R A;  1A8V A;  4LF9 L;  1GD7 A;  1UAP A;  3FKI G;  1PH7 A;  2L0C A;  3OTO Q;  4A76 A;  1MJC A;  4MTK A;  1CQF A;  4XYQ A;  1FL0 A;  3GTJ H;  4O1N A;  5EPL A;  1E3P A;  4H44 C;  1WTQ A;  3D31 A;  1J5E Q;  1V1P A;  1K8M A;  5EKK A;  3X3M A;  2LSS A;  4WOR A;  1ZXT A;  2F0K A;  1GJX A;  2OTJ A;  1CKO A;  5JAV A;  3RN2 A;  1QB5 D;  3NQT A;  2SOB A;  3QJY A;  2AQ3 B;  1SYB A;  1I94 Q;  1K8G A;  3SK6 A;  1IBL L;  3HGB A;  3E6Z X;  3FHW A;  2F0I A;  4C3I G;  1U4R A;  4P75 A;  3J80 L;  3PO3 G;  1SMY C;  2WIN B;  3MAQ A;  4LF4 Q;  2X69 A;  4LF6 L;  4PZ8 A;  3CRL C;  3CC4 A;  1D8L A;  4A3I H;  2ZXO A;  4UY8 C;  3G71 A;  2K1B A;  3J7Y W;  3U4V A;  5EPJ A;  2F0G A;  1TVX A;  3K0Y A;  3WWV A;  4TVA B;  1F77 A;  5D3I B;  1Z6H A;  3MXP A;  5C5L A;  4OWW B;  1E2W A;  3ND8 A;  1SE4 A;  2L15 A;  4OEL B;  3KBG A;  3M4Y A;  2ZJQ A;  2M9V A;  1JOR A;  4HMJ A;  4TSS A;  1YHB A;  1V1O A;  1EQV A;  4A3I B;  1AP0 A;  4GOP A;  1JT8 A;  1HNZ L;  4DNT B;  4BXX H;  1EYA A;  3MHB A;  4JI1 L;  1MGS A;  5LMN Q;  3ICE A;  1NUC A;  3S15 H;  1Y8O B;  5CR3 A;  4U67 3;  1PXU A;  3IL8 A;  3ONA B;  2Q2H A;  2O2L D;  1KDB A;  3BU2 A;  2RBM A;  3DWP A;  4APV A;  5C4X G;  1BO0 A;  1UE6 A;  4LUZ A;  4DK0 A;  1B50 A;  1HR0 L;  1MJE A;  2ZXP A;  1F9R A;  1STY A;  2F0P A;  3M4Q A;  1WD1 A;  3S1N H;  2H4O A;  1VS0 A;  2IX0 A;  1TWF H;  2WAC A;  3OW7 A;  5C5M A;  3S15 B;  1SYD A;  3UE1 A;  2K5V A;  2YTX A;  3TZU A;  3EQL C;  1M90 C;  4IFD G;  5EBD A;  4NP5 A;  1N32 Q;  2MQH A;  4C3H G;  5LL6 X;  1BBX C;  1IYJ B;  1C4Q A;  2VZA A;  3PIO 3;  4JI0 L;  1C7Y A;  5DM7 3;  4IFD J;  4DF7 A;  1CT1 D;  3VYR A;  5I9O A;  2LY7 A;  4X3K A;  2DNE A;  2NN6 I;  3D6C A;  3E5S A;  3S1N B;  1TWF B;  1TWA B;  2E5L Q;  1VQA A;  2VL6 A;  3HFZ B;  1UUP A;  1KAA A;  5CV7 A;  3HOV G;  3FDT A;  2AUJ D;  2LXK A;  1KIX A;  4A3L G;  2CVR A;  1LYL A;  4UAI A;  3S17 H;  4ALP A;  5J1Z A;  3PIP A;  1BOS A;  4DR3 L;  2VW9 A;  5CV6 A;  2QCP X;  5E7N A;  4PZ7 A;  4POF A;  1STH A;  1QZG A;  4FF2 A;  1QOH A;  4RH6 A;  2I46 A;  5IGG A;  3F2D A;  1LO5 D;  4NDX A;  1HNW Q;  5M5X H;  1R4P B;  3URY A;  2WB1 G;  1PYS B;  4CBV A;  1GOZ A;  4I65 A;  2IX3 A;  1YJN A;  1ENA A;  1CHQ D;  2KCT A;  5ELN A;  3C46 A;  1GHK A;  3S17 B;  5IOC A;  1CUK A;  3TRZ A;  5IYB H;  4DA2 A;  3NEL A;  3ITP A;  4QUF A;  1WTV A;  3H3V H;  1YNN D;  5M5W H;  2EYM A;  4M1U B;  1TS5 A;  5M5X B;  1J5E L;  1HA5 A;  1HJP A;  1S72 A;  2XTI A;  4LWC A;  5GAE C;  3A8I E;  1CKN B;  4P73 A;  5KYI A;  3SK5 A;  5C0X H;  1Q8K A;  2WB1 E;  4IJL A;  4R4C A;  1G6Z A;  4B3S Q;  2DUD A;  2A68 D;  5M3M G;  1YZ6 A;  5M5Y H;  4R4O A;  2RQX A;  2KEN A;  1Y69 U;  3HOW G;  3BVG A;  2SDF A;  5IGB A;  3J81 i;  1X3G A;  2Q2U A;  1IKM A;  5M5W B;  3ND9 A;  3TEH B;  2BDO A;  4KD4 A;  2K5N A;  3H09 A;  1SE8 A;  3AEV A;  4LF4 L;  1NMG A;  1PZK D;  1SND A;  3M9B A;  4WJW A;  3CCQ A;  3M7G A;  4QQB X;  3OHX C;  1B70 B;  3AMU A;  5M5Y B;  3A56 A;  1ENF A;  1S3O A;  5C3E H;  3BYT B;  3MVV A;  1M1K C;  1G8Z D;  4HIO A;  5C3X A;  2NTS A;  3EJI A;  2X6L A;  4EGV A;  2XRQ D;  2C5C A;  2OCE A;  3I7F A;  3I4M G;  1D6E C;  1T5E A;  2EY6 A;  1I4R A;  1TS2 A;  4FF3 A;  2E2H H;  4F88 A;  1V9P A;  3KLR A;  1F2L A;  3CQZ H;  4J1M A;  1EY5 A;  2NVY H;  4IUV A;  1G2S A;  3CMA A;  2RHQ B;  4A3B G;  2EXD A;  5C3E B;  5LMN L;  3QB3 A;  2Y0S G;  2R7Z G;  1X3P A;  1LTS D;  3T1Y Q;  1NBW A;  2EYL A;  4CKB A;  1O78 A;  5IGC A;  1QVG A;  5JJL A;  4A3F H;  1QNU A;  1L1O B;  4IUP A;  1WJJ A;  4K2L A;  4JC0 A;  2E2H B;  3P75 A;  1GUO A;  4A3J G;  3W5O A;  3I56 A;  1U5K A;  1PYB A;  1E2V A;  2CH4 W;  3CQZ B;  1NMF A;  2NVY B;  1Q86 C;  4BWG B;  1SE2 A;  3A5Z B;  4YY3 Q;  3CC2 A;  2K4K A;  1Y1V H;  4H7B A;  4UP7 A;  2DN8 A;  3T16 A;  3A5U A;  5IGE A;  4K5W A;  2EYO A;  3DM3 A;  2K03 A;  2VB2 X;  4ZCK A;  4LJZ C;  2Z8L A;  2F0H A;  4OX9 Q;  1IHZ A;  2Z4I A;  2CQA A;  1MD2 D;  4C56 C;  4L63 B;  1H9S A;  1WTH A;  3OYY A;  1TT2 A;  4JBW A;  4A3E G;  4RA8 A;  2KCN A;  5FOB B;  2UU9 Q;  5CGK A;  1KDC A;  2E5L L;  1PTO H;  3KDF B;  4JBJ A;  3I73 A;  2VUM B;  1TII D;  2EPB A;  3EBE A;  1FVI A;  3ULP A;  1PDQ A;  2EJG C;  1YBY A;  1PRT C;  3R2T A;  4J8Q A;  4KHP Q;  4FO2 A;  1LT3 D;  4K6D A;  1LLR D;  3G7L A;  1K9M C;  4DKA C;  5C4J B;  3AFP A;  1L1O A;  2HCI A;  2JXM B;  1HZA A;  1L2F A;  1G29 1;  4PMW A;  1STE A;  1PTO B;  4LK1 C;  1ZYR D;  3AQQ A;  3PUZ A;  4DV7 Q;  4BY7 H;  3GTQ H;  2QF7 A;  4XXE A;  4JI8 L;  4QF4 A;  3TN2 A;  2B2V A;  3T13 A;  5IGF A;  1Y14 B;  3GTM H;  4L5Q A;  1D5Z C;  5ELC A;  1EY4 A;  4KLK A;  4MTN A;  3HOX B;  1VQI A;  3PIP 3;  3CCM A;  2I5M X;  3HOU H;  2K5H A;  1GKH A;  4DV4 Q;  4LNQ A;  3F1Z A;  2F0M A;  1T9H A;  4BY7 B;  1ONL A;  4DR4 Q;  4DN4 M;  4B3S L;  1EYG A;  5BN5 A;  4A3G H;  4XT1 B;  1NSN S;  1PFS A;  3GTM B;  3PF5 A;  3KDF A;  5IYD H;  4IPG A;  2RSN A;  1JWS D;  2ICI A;  3TSS A;  2PZU A;  1F2Z A;  1E1T A;  1BR9 A;  1U4L A;  5JEA J;  3CF5 A;  2QKI C;  2IL8 A;  1YIT A;  1PH3 A;  2FFK B;  2SNM A;  3C1E A;  2JA6 G;  4FVM A;  4KD3 A;  2I0Q A;  3TS2 A;  4A3G B;  2QIL A;  5COY A;  2D2C C;  3PO2 G;  2FMC A;  2PW5 A;  3F2U A;  4PMB A;  1XMQ Q;  1K0R A;  1H9J A;  3CCS A;  1ASY A;  1CSP A;  1N33 Q;  1IW7 D;  2F0O A;  1WI5 A;  3HKZ E;  2AUK A;  4RG1 A;  1NCV A;  1EYC A;  2O5J C;  4UDU C;  2F0D A;  3SVM A;  1WD0 A;  1HH2 P;  1JB7 A;  4DR2 Q;  4A3I G;  2YV5 A;  1LUZ A;  2AQ1 B;  5EKI A;  3T51 B;  3J80 E;  4R1J A;  4ZUI A;  4UHV A;  3W1G A;  5I6W A;  3DUZ A;  1JE5 A;  4ULL A;  4HJ5 A;  1A6X A;  3BVZ A;  2A8V A;  1K8O A;  2J0T D;  2J7Z A;  3TP5 A;  4CKE A;  3PUY A;  2VXW A;  2A69 C;  5FO7 B;  1GXD C;  1ZKO A;  3RR5 A;  4BXX G;  3CKI B;  3JAM c;  3IRB A;  3M7N A;  4HN7 A;  1GVP A;  4PNY A;  1VQM A;  2PCF B;  1N8R C;  2WKD A;  2HIV A;  1PRT D;  4XT3 B;  4FF1 A;  1ESR A;  2WKC A;  4DK6 C;  4EQ5 A;  5G3L D;  3L0O A;  1VQ8 A;  3O13 A;  4HJ9 A;  3P1H A;  4C1N I;  3J81 L;  3DEP A;  4OX9 L;  2IHE A;  3DHQ A;  5IWA Q;  1XPU A;  4EX5 A;  4DV5 L;  2WV6 D;  4AYB G;  4B3R Q;  5BN3 A;  2UU9 L;  1PMR A;  5DEH A;  1NE3 A;  2R7D A;  4HJ7 A;  3HOY B;  3TS0 A;  1X6O A;  2E8G A;  3FPU B;  3J7A 5;  2EJM A;  2X6G A;  1TXY A;  3MXU A;  2VY3 A;  3NXW A;  2MO1 A;  1OXV A;  3HS0 C;  1QNK A;  2GVB A;  5CV4 A;  1EQT A;  3MXN B;  4JI6 Q;  1SN8 A;  4Y7N H;  2R3Z A;  4R8N A;  3C1F A;  5L37 A;  5J39 A;  2RA4 A;  1Q7Y C;  1KXL A;  3GTO H;  4EQN A;  4YWM A;  1EUJ A;  2UXB Q;  1SRO A;  4QGU A;  4DV7 L;  2JJQ A;  4OIJ A;  2PO4 A;  3K59 A;  1A3U A;  4JOI A;  4DUZ Q;  2YTY A;  1Q82 C;  5HUR A;  1X9N A;  5J3B A;  1CKM A;  4DK1 A;  2F0E A;  4ZKB B;  5KGU A;  2UUB Q;  2QA4 A;  1EOT A;  2Z0S A;  1S5C D;  4GN3 B;  1IZ6 A;  1FGB D;  4Y7N B;  1XNQ Q;  5IT9 c;  3GTO B;  4LMQ D;  1A15 A;  2JN4 A;  3NUC A;  4DV4 L;  1AZP A;  4X66 L;  4L5S A;  4G7O C;  1RF2 D;  2A73 B;  1PRT F;  4M8A A;  3PSI A;  1RHP A;  2AHO B;  2H5X A;  4B3T Q;  5IYB G;  1V1P B;  4DFA A;  3SXH A;  1SYG A;  5G3L F;  4YHH Q;  4HIK A;  4BBR H;  1YJ9 A;  4LW1 A;  1GO3 E;  3H15 A;  2D9U A;  1EZ6 A;  1TU2 B;  1K3B C;  1PTO D;  3TQY A;  4O2D A;  4CDF C;  1BCP B;  2G9H D;  5KYL A;  4G4K A;  1B1Z A;  3Q22 A;  2L12 A;  5C0X G;  2BA1 A;  4HAE A;  3KJO A;  1WCM H;  1X56 A;  4OL7 A;  4V0B A;  5EGT A;  5C0X J;  4Q0F A;  3H6M A;  3P20 A;  3RD4 A;  4BBR B;  3LWE A;  4AQY Q;  1HFG A;  1VQO A;  3SHL A;  3CCJ A;  4JPB W;  4POG A;  3K81 C;  1D1K A;  2TSS A;  3A74 A;  3CP0 A;  3H0G H;  3E0E A;  4DGZ A;  3K57 A;  1PH4 A;  3NBH A;  2HDL A;  4DV0 Q;  1WCM B;  1N36 L;  1EFI D;  3J80 c;  1IBM Q;  5ELO A;  2K52 A;  3OMG A;  4CKC A;  5C3E G;  1OXX K;  2B39 A;  4K5V A;  4I7Z C;  2XWJ B;  2AQ2 B;  4GN5 A;  3CAM A;  3V2T A;  1JQY D;  4LF5 Q;  4GOP B;  2K6A A;  3RNU A;  1W3S A;  3H0G B;  2MNA A;  4K0K Q;  2R93 H;  5JPN C;  3WDN A;  1I4G A;  3NK9 A;  1VMP A;  2L9H A;  4DV2 L;  3S16 H;  3FPP A;  1P16 A;  1QWY A;  4GNX C;  1VQB A;  1VQH A;  2UXD Q;  1MBY A;  2K50 A;  1YJW A;  1UE1 A;  2R92 H;  2JA8 B;  3HKZ B;  5ELD A;  1DOK A;  3NEM A;  4JK1 C;  2QDL A;  5BR8 Q;  1VQF A;  3I3C A;  3I4N H;  2BCO A;  4IAL A;  3KJP A;  4A3F G;  5LMN W;  4X3S A;  5AFW A;  5HGQ A;  2OEO A;  1YNN C;  2R93 B;  1VQG A;  4QCL A;  2E74 C;  4DR6 L;  3S24 A;  1IBK Q;  1SNM A;  3S16 B;  4R4Q A;  4DV3 Q;  2LMC B;  1AN8 A;  3NTK A;  1DON A;  1VQN A;  5EBC A;  3HZX A;  1SDF A;  2R92 B;  1Y1V G;  1EU4 A;  4A3K H;  4IO9 A;  3OWF A;  2A68 C;  3I4N B;  3VR4 A;  2HT1 A;  2YU9 B;  4Y52 H;  1EIH A;  2CWP A;  2RSO A;  1CFM A;  1EOV A;  1PFM A;  3DEO A;  4OO1 H;  3KLS X;  1S40 A;  1HXY D;  1VQL A;  1OTC A;  2B2U C;  5LMU Q;  1QJO A;  3R93 A;  1F9S A;  2ID0 A;  1WTX A;  4A3K B;  2UXB L;  3PUW A;  1VF7 A;  3T1H Q;  3GTP H;  3Q23 A;  1ESF A;  4BBS H;  1RKN A;  4DUZ L;  5IP7 H;  1AW7 A;  4OO1 I;  1WTP A;  2PW7 A;  3NEN A;  3J7Z C;  1EY8 A;  1CI3 M;  1IYU A;  1RD9 D;  1EEI D;  2KEC A;  3QWN A;  3A7L A;  5I9P A;  2ALY B;  2UUB L;  2VNU D;  1GUN A;  2JSO A;  3AU7 A;  1TWA H;  2HCC A;  2NN6 H;  4PZ6 A;  3GTK H;  3GQB A;  3NWT A;  4BY7 G;  4DR7 Q;  3GTP B;  4X64 Q;  4A3M H;  2LS0 1;  2G5D A;  2ZTC A;  4ZRZ A;  1V43 A;  4BBS B;  4A75 A;  2N49 A;  2DY7 A;  4B3T L;  3ULJ A;  3LWU A;  4YHH L;  3D0F A;  2HQE A;  5EQ0 A;  2E75 C;  3N52 A;  2WP8 J;  1LTT D;  3RLF A;  1V1Q A;  4HSV A;  2VQF Q;  2OTL A;  1SEB D;  3HOU G;  1WYD A;  1VQP A;  1VQE A;  3GTK B;  4GLA C;  4F8M A;  1J8I A;  2ZXR A;  5CYU A;  3U50 C;  5KNB A;  5KEE A;  4A3M B;  1G51 A;  5NUC A;  3TRE A;  3Q6S A;  4JI3 Q;  5C4Z A;  1DJR D;  4A3G G;  3KLW A;  2EY1 A;  2B2W C;  3QO2 A;  4JG2 A;  5IYD G;  5K5P A;  4OON A;  2MJ8 A;  3X3N A;  2DGY A;  1A63 A;  3CW2 C;  1O80 A;  4MNO A;  2N3S A;  1UEB A;  3R3O A;  2K5Q A;  4K14 A;  1SJH D;  4MZ9 A;  1AH9 A;  3GTG H;  4LFB Q;  2KED A;  4B9X A;  4IPD A;  1CHP D;  1R9T B;  2F0S A;  1RCV D;  2XIW A;  1RL2 A;  1AFP A;  1K83 H;  1X55 A;  4DV0 L;  1IBM L;  4LF7 Q;  3HG9 A;  4JI2 Q;  3OTO L;  1QUQ A;  3CPW A;  5FLM H;  1XNR Q;  2F3V A;  1WFQ A;  2FMM A;  4IPC A;  3VR5 A;  1XPO A;  1BCP D;  5E1F A;  1C48 A;  3MEF A;  1HA6 A;  3D6W A;  1SSO A;  4FNF A;  1SNO A;  4QB4 A;  2F0J A;  3PGZ A;  2UXC Q;  1KLU D;  2JEB I;  1DGS A;  2WII B;  4K0K L;  2H1E A;  3GTG B;  2JA5 H;  4DAY A;  3UDI A;  5DM6 3;  1YNX A;  2D62 A;  4CHT B;  2DNC A;  5IYC H;  1TQO A;  1MSH A;  3H94 A;  5COR A;  1K83 B;  4H02 A;  4JV5 Q;  3ERO A;  1CA6 A;  3CCR A;  1YHQ A;  1ZYR C;  1I94 L;  1QVF A;  3HOZ H;  4HCE A;  1I3Q H;  2MUY A;  4YCW A;  1B9N A;  2UUC Q;  3ZYY X;  2Q8T A;  5DNF A;  3PUX A;  1U9R A;  5D65 A;  3J7A F;  1JOQ A;  4JBK A;  4GLX A;  4JI7 Q;  2EYJ A;  2MPM A;  1O7Y A;  3AFQ A;  2EOT A;  1PVO A;  2EIF A;  1NR4 A;  5FK9 C;  2JA5 B;  1LV9 A;  1FNV A;  2WFW A;  3NWS A;  1IBK L;  4LAA A;  1YI2 A;  1FJG Q;  4DAM A;  4OEM B;  4DV3 L;  2KUM A;  3HOZ B;  1UEA B;  2M2L A;  1I3Q B;  2RDF A;  5KRU A;  3I4O A;  1EYD A;  2KHS A;  4RGT A;  2PPB C;  4X65 Q;  4CJ1 B;  4KHV A;  1AEX A;  4L6T B;  1H9S B;  1SAP A;  3K5M A;  5IP9 H;  4NXN Q;  3DWQ A;  4DR5 Q;  4B9W A;  1G2T A;  4LUO A;  1XX8 A;  2F0T A;  4ME5 A;  4FYD A;  3NP8 A;  5C3W A;  4U68 A;  3PMF A;  3JAM i;  4XIG S;  4KN7 C;  1KRT A;  3K7U C;  5LMU L;  1K8A C;  1KNE A;  3MXG A;  1I4P A;  3J81 E;  2KHI A;  2PNH A;  3A7A B;  3KUP A;  4K5X A;  3NHH A;  2R7F A;  1TWG H;  1M8A A;  1EWH A;  1DM0 B;  3MWY W;  5DLQ E;  3IAY A;  1IW7 C;  3FKI B;  4DNI A;  2FIN B;  2NZO A;  1C0A A;  5ELB A;  1VQ5 A;  2F1M A;  5JJK A;  1DXM A;  4LUV A;  1CK1 A;  3H3V C;  2VUM H;  4DR7 L;  4X64 L;  4KY5 A;  5D3D A;  3CPF A;  1BF4 A;  2AWN A;  4GKJ Q;  5JPM C;  3FVQ A;  1TWG B;  4DXF A;  2N55 A;  3BDL A;  1N32 L;  4RHR A;  4X3U A;  1ICF B;  3A8K E;  4CGY B;  3TP6 A;  4CDC C;  2OT2 A;  5C4J H;  2F0F A;  1SR3 A;  3C3L A;  4DV6 Q;  1QZH A;  4HID A;  3NTH A;  3RUZ A;  1SJE D;  1HUN A;  3AB9 A;  4XQQ A;  2VQF L;  3UDG A;  1PH9 A;  1D5X C;  2N78 A;  5EAY A;  4C3I B;  2F4V Q;  1GUG A;  3PO3 B;  2F4I A;  1CQV A;  4Q5V A;  1U0L A;  5T1I A;  4BBR G;  1T5X D;  3MEH A;  4OWX B;  1OO9 B;  4N8X 1;  4IUR A;  2A6H D;  2B2T C;  3HOX H;  5CC4 A;  5FLX E;  2E2D C;  2JP1 A;  1HNW L;  3VA5 A;  2IPK D;  4IUQ A;  1X65 A;  3ER0 A;  1JMC A;  1NY4 A;  3FP9 A;  4LFB L;  2E76 C;  3HKS A;  1WCM G;  2EQS A;  1S5D D;  1FD7 D;  1SNP A;  3BZC A;  5KNC A;  4LF7 L;  2B8F A;  4PQX A;  5C6A A;  1XNR L;  2EYF A;  2PNR C;  1IYV A;  2K7V A;  1CZG A;  2BH8 A;  1RJT A;  2ENB A;  4F87 A;  3H0G G;  5CMD A;  2HHH Q;  2UXC L;  3KBX A;  4LF8 Q;  2WAQ B;  5FJ8 H;  3S2H H;  2FJ2 A;  2XRS D;  4K6L A;  2K5D A;  1ML0 D;  1KAW A;  2A5H A;  4OWT B;  4JV5 L;  5C4X B;  5I6Y A;  3VR3 A;  2ZJP A;  1S5F D;  3D8G A;  5JVG 3;  3D4W A;  4B3M Q;  5A2Q L;  4RKB A;  3U9S A;  3HKZ G;  4K8I A;  1HZ9 A;  3E9H A;  1GUS A;  3CCV A;  3V05 A;  3S14 H;  1CTM A;  1WOC A;  2Q2T A;  2CCZ A;  2NVX H;  3S1M H;  3EFX D;  3PQI A;  1DZ1 A;  3L7Z C;  3SR1 A;  4XQN A;  4JI7 L;  2R93 G;  1HZB A;  3WOF A;  4BY1 H;  2EVB A;  4IFD I;  2Z6K C;  4FXK C;  3S2H B;  3A8J E;  1W6K A;  2YYZ A;  1VCI A;  2Q2I A;  4C3H B;  4DUY Q;  3QOJ A;  2F52 A;  2B29 A;  2JE6 I;  2B2Y C;  2Q8R E;  1B7Y B;  2R92 G;  1F2M A;  2PQA A;  4AIM A;  1KNA A;  2QW7 A;  2SEB D;  3S14 B;  1CZW A;  3I4N G;  1UNS A;  1PFN A;  1STN A;  2EY5 A;  1KQS A;  3FMC A;  2KQ3 A;  1NR2 A;  3S1M B;  2NVX B;  3IKJ A;  1UWV A;  3HOV B;  2DJF C;  1JWU D;  4BY1 B;  2EY2 A;  2ZTE A;  3K6O A;  5M3F H;  5K36 H;  2NTT A;  4OIK A;  1PTO C;  3BYY B;  4DR5 L;  1Y1W H;  5IIF A;  4RWS C;  1Q81 C;  2K5W A;  1HNX Q;  1SBB B;  3STB D;  1BBW A;  3FEW X;  3T1Y L;  2HDM A;  2PI2 A;  2HIX A;  4PMC A;  5CV8 A;  1Q1E A;  2I07 B;  1A2T A;  4ZQ3 A;  3K8A A;  5LHY 1;  3Q24 A;  1QVC A;  4YWL A;  2CW0 D;  2K28 A;  3KF6 A;  4JI4 Q;  2OWO A;  1SRU A;  4LF9 Q;  5M3F B;  3NTI A;  4UPA A;  2EXZ A;  4OO1 G;  1Y1W B;  2LKV A;  4HIM A;  1Z7T A;  3OIQ A;  1B8A A;  1LTI D;  4CDE C;  4DV1 Q;  2LFN A;  2ZT9 C;  4YY3 L;  2JA9 A;  4ZUJ A;  4E6I A;  1Z47 A;  4CJ2 C;  4DNR B;  3HOY H;  3FRP B;  4EQP A;  1SMX A;  5GRO A;  4BBS G;  2XWB B;  3VYT A;  2NYZ D;  2JA7 H;  3S1R H;  2NZH A;  2E2J H;  2L1B A;  5IP7 G;  2QEX A;  3SK8 A;  3I70 A;  2O4X A;  4RGN A;  5M3M B;  1MHW C;  3TBI B;  3HEJ A;  4O42 A;  1ZEQ X;  2OF1 A;  4ME3 A;  4DV6 L;  3GP7 A;  1N34 Q;  2NVT B;  3K5N A;  1EWI A;  4HJA A;  3J7A V;  2A6E D;  2NN6 G;  4BA1 I;  1O7L A;  2OQ0 A;  4A3M G;  2F4V L;  4HMI A;  2JA7 B;  4MIU A;  3S1R B;  1PH5 A;  3NE5 B;  5FO8 B;  4IOA A;  2E2J B;  1EQR A;  4RMF A;  1RTO A;  2K05 A;  4BA2 I;  4KHP L;  4DXG A;  4ZYS A;  2RKS A;  2P5Z X;  3TP7 A;  1A0I A;  3F2B A;  2N8N A;  3I90 A;  5CV9 A;  3F2C A;  1LAB A;  1HQM C;  1D1I A;  3MFG A;  1XYI A;  1GM5 A;  2K14 A;  3ERQ A;  4A4I A;  4JYA Q;  2BE5 D;  3G6J B;  1L0X B;  1SYF A;  3EN2 A;  3JAM L;  1H9M A;  4R9W A;  1JJ2 A;  1EIY B;  2IX1 A;  3Q8D A;  4A3J H;  1JOK A;  2L4N A;  3S2D H;  2KBN A;  3NBH B;  2O5I C;  2FHT A;  4JI1 Q;  4A3D H;  2NBF A;  4DAV A;  2DY8 A;  4XDX A;  4G57 A;  3LGJ A;  3DWA A;  2CQO A;  2Y0S B;  2HHH L;  3RZO B;  3L3O C;  3EVQ A;  1YNJ D;  1I5F A;  4DR4 L;  4BS9 A;  1JJG A;  5FLX L;  2EJF C;  3A0J A;  2SNS A;  3OOC A;  5FLM G;  2BA0 A;  3D3R A;  5JJI A;  1E7Z A;  1BVS A;  4A3J B;  4IOC A;  4B3M L;  3S2D B;  2K32 A;  2VB3 X;  1M4V A;  1D7Q A;  4NKL A;  2UUA Q;  2PMZ B;  4A3D B;  2IJ0 A;  1CSQ A;  4IUT A;  3OW2 A;  4B08 A;  2Z1C A;  4JVZ A;  3PCO B;  2V4D A;  3B6Y A;  1K28 A;  1TWH H;  1KRS A;  1NAP A;  2F0U A;  5IYC G;  1RIP A;  2F0V A;  2HQL A;  1PV4 A;  3KYH C;  3W1B A;  4DUY L;  3HOZ G;  4JI0 Q;  4J15 A;  4A3C H;  1I6H H; 
#chains in the Genus database with same CATH homology
 1H9K A;  2ICE C;  1IL8 A;  4ZKC B;  1EY9 A;  5KIX A;  4G7Z C;  4KKU A;  1TWH B;  2Z4H A;  1EY7 A;  1MI2 A;  5IT9 L;  4HSP A;  5C4H A;  4GZY C;  2EE1 A;  5IGD A;  1I6H B;  1TKW B;  5JVH 3;  3BS1 A;  2C9O A;  1HPC A;  4H13 C;  3KF8 A;  1DD2 A;  5T1G A;  4QUC A;  4C2M B;  3MZ5 A;  3VR2 A;  4K2K A;  3U9O A;  5JEA H;  4IUN A;  3L9A X;  4DAP A;  1D2B A;  4HED A;  1PZI D;  3S9W A;  3BDC A;  1SNC A;  1JCK B;  3K5L A;  1Q8I A;  3KLS A;  1PTO F;  1KDA A;  1BCP C;  5IOD A;  2KVM A;  3GO5 A;  4A93 B;  1BDO A;  3GTJ B;  4HTH A;  1ET6 A;  3BG3 A;  5BN4 A;  5E3F A;  2PYK A;  1HUM A;  1TY2 A;  3EA6 A;  3NPP A;  3T56 B;  2JA6 B;  1JC7 A;  1HTP A;  1V8Q A;  3TDQ A;  1D5M C;  3PO2 B;  1TR5 A;  1DYQ A;  3GD7 A;  1RDP D;  2B2U A;  2JYO A;  2CHB D;  4TQU S;  3QIA A;  1DOM A;  1HRJ A;  1OXT A;  3GV3 A;  3NSW A;  1QG7 A;  2AWO A;  2GA4 B;  4N9T A;  4ZK9 B;  1Y8P B;  3NBI A;  2F0L A;  3BDO A;  3DMU A;  4KHZ A;  1DOL A;  5CV5 A;  2E2I B;  1CA5 A;  3D4D A;  4OGQ C;  1BQQ T;  2MHV A;  3OMC A;  4IZ8 A;  4KN4 C;  4G7H C;  4V19 0;  3M4O B;  4KTA A;  2IW3 A;  1XWE A;  1HCZ A;  1VMC A;  4RCN A;  1X3Q A;  2XN9 C;  4ID6 A;  3TME A;  2EDG A;  3GTL B;  3H91 A;  5I4D A;  2L5T A;  1RTN A;  4C3J B;  2B2W A;  1KLG D;  4AYB B;  3CHB D;  1U4M A;  5D14 A;  4R8I A;  3Q0A A;  4S3S A;  4NMZ A;  5A2Q E;  1F2Y A;  1TS4 A;  2TMP A;  1WTR A;  2RVL A;  4NW2 A;  5C44 B;  2KCC A;  3IFT A;  4KV6 A;  4OHJ A;  1LTG D;  3UI2 A;  4RGM A;  1H9R A;  2B63 B;  1EL0 A;  3K58 A;  3PUV A;  1F9P A;  2A6H C;  5K36 G;  2K04 A;  1L0Y B;  5M9O A;  3I8Z A;  4KJO A;  4KK7 A;  4F7X A;  4FXG C;  3OWE B;  5KND A;  1SMY D;  4K8J A;  3DM1 A;  1B2T A;  1F9Q A;  4KMU C;  3BVM A;  1VDZ A;  1PFB A;  4XYO A;  2EYH A;  4N9P A;  3I72 A;  2PQE A;  3SK4 A;  2F3W A;  2M00 A;  1JE4 A;  4CJ0 B;  1Y8N B;  1BUV T;  4QMG A;  4KKT A;  1PZJ D;  5TSS A;  3V96 A;  3MFY A;  3S1Q B;  3TP8 A;  1I6V C;  5C0X I;  4KKS A;  2KA7 A;  1EEF D;  4TKO B;  2XVS A;  3T4A C;  1ROD A;  3LX0 A;  1S5B D;  1EY0 A;  1R4Q B;  4RHS A;  1O7Z A;  1HHV A;  4KY6 A;  1PRT B;  1BNZ A;  1BCP F;  1JR0 D;  1HFN A;  4FP5 D;  1LT4 D;  3K7A B;  1ICW A;  3K5O A;  1SXT A;  3NQI A;  1S4Z A;  4ODG A;  1B3A A;  4C1N K;  2A74 C;  1DCZ A;  1B44 D;  4MHE A;  4QIW B;  3D4R A;  5HGT A;  4FXD A;  5DAU A;  1STB A;  4RAU C;  3R8B A;  2Q8I B;  4MN3 A;  2NZ1 D;  3W2D A;  4L8J A;  2CW0 C;  1B53 A;  1Q1B A;  4RGO S;  3JAM E;  2XNA C;  2RDG A;  4A3F B;  2EZV A;  1CM9 A;  4EQO A;  3R2I A;  1QIL A;  1E2Z A;  2K01 A;  1WVL A;  1HTL D;  3SEB A;  2IWH A;  2XSC A;  5ELF A;  3LNN A;  5EJW A;  2B2T A;  1Y1V B;  3GV6 A;  1FNU A;  3VYU A;  4ZAI A;  2F0N A;  1ENC A;  3A54 A;  1JWM D;  1J9O A;  2A6E C;  2PZT A;  1X32 A;  3HRZ C;  2QEJ C;  4RFB A;  3VA7 A;  1A3V A;  2B2V C;  2OXP A;  1EY6 A;  4WFN 3;  4IFD H;  5I2X A;  1EZ8 A;  3P7J A;  4RCO A;  4XTC S;  3OIP A;  1SE3 A;  3OPO A;  2BE5 C;  4P2C B;  1FYC A;  5IT9 E;  3GTQ B;  1JB3 A;  1GUW A;  1C8C A;  5FKA C;  3MA2 B;  1STG A;  3M85 A;  1I4Q A;  2EYP A;  2D5D A;  1LT6 D;  3I91 A;  1YNJ C;  5JEA G;  1ILP A;  4DU9 A;  5ELE A;  4Z9C B;  2PZW A;  2B2Y A;  1EU3 A;  3HOU B;  3M3Y B;  4EVO A;  1A3T A;  5E4W C;  1TY0 A;  1JOO A;  4HCS A;  1XXG A;  1I4X A;  1E0B A;  2F0W A;  5EPK A;  3QOL A;  5F2D A;  4IUU A;  2WB1 B;  1LT5 D;  2R61 A;  1SFO B;  1FNW A;  4ZLT F;  4KI0 A;  5CBE E;  1LTA D;  2L11 A;  3OSO A;  5J22 A;  1Q12 A;  5FO9 B;  3A55 A;  2NWG A;  3QG1 A;  2KEE A;  2R6G A;  1MSG A;  1EWC A;  2BDN A;  3CRK C;  3CU7 A;  2JEA I;  3I4L A;  1WTO A;  3RMH A;  5JJZ A;  2KOL A;  3HOW B;  1I50 B;  3HP3 A;  1PYW D;  1PLF A;  3MTS A;  2F03 A;  1LTB D;  1ILQ A;  5CBA E;  2B8G A;  2G9D A;  1A2U A;  3BZD B;  4IN3 A;  1G91 A;  3IFD A;  1I4H A;  2J4X A;  4FF4 A;  1GHJ A;  1B9M A;  4J6H A;  1BXT A;  3VYS A;  2IT1 A;  4C3J G;  4WRD A;  1SYE A;  1U4P A;  5EKL A;  1KTK A;  3T53 B;  4HR7 B;  4TRD A;  2QDB A;  1VF5 C;  1STA A;  4RKL A;  1JIC A;  3E0J A;  2MP1 A;  1SNQ A;  3I4M B;  4IQZ A;  1B4O A;  3PV0 A;  3SE0 A;  1TWC B;  1WTW A;  4A3B B;  4PV1 C;  3KK7 A;  1TS3 A;  2R7Z B;  3VR6 A;  3C2P A;  1FR3 A;  3RZD B;  2L55 A;  1W6J A;  3TZD A;  1S5E D;  3SDZ A;  1IKL A;  2K33 A;  2KJX A;  3W3A A;  5A35 A;  1LTR D;  3WOE A;  5E4X A;  4KY7 A;  2F0Q A;  4ABN A;  1GUT A;  1OXS C;  1LAC A;  1Q3L A;  2NVQ B;  2NB0 A;  4ILW A;  2HUG A;  4A3E B;  4KJN A;  1OXU A;  2NUC A;  3MXN A;  1Q90 A;  5ISR A;  1AZQ A;  1SYC A;  5I2Y A;  4H0L C;  1QCB D;  1HQR D;  2N88 A;  4X3T A;  1QE6 A;  3MC0 B;  5JOB A;  4XQJ A;  2A69 D;  2BOS A;  2MGS A;  3DXJ C;  5LL6 S;  2RDH A;  1EIG A;  4YIJ A;  1XTC D;  1II3 A;  1KAB A;  1ET9 A;  3N6R A;  1UAP A;  2L0C A;  1CQF A;  4XYQ A;  4O1N A;  5EPL A;  4H44 C;  1WTQ A;  3D31 A;  1V1P A;  1K8M A;  5EKK A;  3X3M A;  4WOR A;  1ZXT A;  2F0K A;  1GJX A;  5JAV A;  1QB5 D;  3NQT A;  2SOB A;  3QJY A;  2AQ3 B;  1SYB A;  3SK6 A;  3HGB A;  3E6Z X;  2F0I A;  4C3I G;  1U4R A;  3J80 L;  1SMY C;  2WIN B;  3MAQ A;  2X69 A;  3CRL C;  2ZXO A;  2K1B A;  3J7Y W;  5EPJ A;  2F0G A;  1TVX A;  3K0Y A;  1F77 A;  5D3I B;  1Z6H A;  3MXP A;  5C5L A;  1E2W A;  3ND8 A;  1SE4 A;  3KBG A;  3M4Y A;  2M9V A;  1JOR A;  4HMJ A;  4TSS A;  1V1O A;  1EQV A;  4A3I B;  1AP0 A;  4DNT B;  1EYA A;  3MHB A;  1MGS A;  1NUC A;  1Y8O B;  5CR3 A;  4U67 3;  1PXU A;  3IL8 A;  3ONA B;  2O2L D;  1KDB A;  2RBM A;  3DWP A;  1BO0 A;  4DK0 A;  1B50 A;  2ZXP A;  1F9R A;  1STY A;  2F0P A;  1WD1 A;  2H4O A;  2IX0 A;  2WAC A;  3OW7 A;  5C5M A;  3S15 B;  1SYD A;  3TZU A;  3EQL C;  4IFD G;  5EBD A;  4NP5 A;  4C3H G;  5LL6 X;  1BBX C;  1C4Q A;  3PIO 3;  4IFD J;  5DM7 3;  4DF7 A;  1CT1 D;  3VYR A;  5I9O A;  2LY7 A;  4X3K A;  2DNE A;  2NN6 I;  3D6C A;  3E5S A;  3S1N B;  1TWF B;  1TWA B;  1UUP A;  1KAA A;  5CV7 A;  3FDT A;  2AUJ D;  2CVR A;  4UAI A;  5J1Z A;  1BOS A;  5CV6 A;  2QCP X;  1STH A;  4FF2 A;  1QOH A;  4RH6 A;  2I46 A;  5IGG A;  1LO5 D;  4NDX A;  1R4P B;  3URY A;  4CBV A;  1GOZ A;  4I65 A;  2IX3 A;  1ENA A;  1CHQ D;  3C46 A;  1GHK A;  3S17 B;  5IOC A;  4DA2 A;  3ITP A;  4QUF A;  1WTV A;  1YNN D;  2EYM A;  4M1U B;  1TS5 A;  5M5X B;  1HA5 A;  3A8I E;  5KYI A;  3SK5 A;  5C0X H;  1G6Z A;  2A68 D;  2RQX A;  1Y69 U;  3BVG A;  2SDF A;  5IGB A;  1IKM A;  5M5W B;  3ND9 A;  2BDO A;  4KD4 A;  3H09 A;  1PZK D;  1SND A;  4WJW A;  3M7G A;  3OHX C;  3AMU A;  5M5Y B;  3A56 A;  1ENF A;  3BYT B;  3MVV A;  1G8Z D;  5C3X A;  2NTS A;  3EJI A;  2X6L A;  4EGV A;  2XRQ D;  2C5C A;  1D6E C;  1T5E A;  2EY6 A;  1I4R A;  1TS2 A;  4FF3 A;  4F88 A;  3KLR A;  1F2L A;  4J1M A;  1EY5 A;  4IUV A;  1G2S A;  5C3E B;  3QB3 A;  1X3P A;  1LTS D;  2EYL A;  4CKB A;  1O78 A;  5IGC A;  1QNU A;  4IUP A;  4K2L A;  2E2H B;  3P75 A;  1GUO A;  1E2V A;  3CQZ B;  2NVY B;  4BWG B;  1SE2 A;  4H7B A;  2DN8 A;  3T16 A;  5IGE A;  4K5W A;  2EYO A;  2K03 A;  2VB2 X;  4LJZ C;  2Z8L A;  2F0H A;  1IHZ A;  2Z4I A;  2CQA A;  1MD2 D;  4C56 C;  4L63 B;  1H9S A;  4JBW A;  1TT2 A;  4RA8 A;  2KCN A;  5FOB B;  5CGK A;  1KDC A;  1PTO H;  3I73 A;  2VUM B;  1TII D;  2EPB A;  1PDQ A;  2EJG C;  1PRT C;  3R2T A;  4J8Q A;  4FO2 A;  1LT3 D;  4K6D A;  1LLR D;  3G7L A;  5C4J B;  2HCI A;  2JXM B;  1G29 1;  4PMW A;  1STE A;  1PTO B;  4LK1 C;  1ZYR D;  3PUZ A;  2QF7 A;  4XXE A;  4QF4 A;  3TN2 A;  2B2V A;  3T13 A;  5IGF A;  1D5Z C;  5ELC A;  1EY4 A;  3HOX B;  3PIP 3;  2F0M A;  4BY7 B;  1ONL A;  4DN4 M;  5BN5 A;  4XT1 B;  1NSN S;  3GTM B;  2RSN A;  1JWS D;  2ICI A;  3TSS A;  2PZU A;  1F2Z A;  1BR9 A;  1U4L A;  5JEA J;  2QKI C;  2IL8 A;  2FFK B;  2SNM A;  3C1E A;  4FVM A;  4KD3 A;  4A3G B;  2QIL A;  5COY A;  2D2C C;  2FMC A;  2PW5 A;  3F2U A;  4PMB A;  1H9J A;  1IW7 D;  2F0O A;  2AUK A;  1NCV A;  1EYC A;  2O5J C;  4UDU C;  2F0D A;  3SVM A;  1WD0 A;  2AQ1 B;  5EKI A;  3T51 B;  3J80 E;  4ZUI A;  5I6W A;  3DUZ A;  4ULL A;  1A6X A;  3BVZ A;  1K8O A;  2J0T D;  2J7Z A;  3TP5 A;  4CKE A;  3PUY A;  2VXW A;  2A69 C;  5FO7 B;  1GXD C;  1ZKO A;  3CKI B;  3M7N A;  4HN7 A;  4PNY A;  2PCF B;  2WKD A;  1PRT D;  4XT3 B;  4FF1 A;  1ESR A;  2WKC A;  5G3L D;  3O13 A;  3P1H A;  4C1N I;  3J81 L;  3DEP A;  3DHQ A;  2WV6 D;  5BN3 A;  1PMR A;  5DEH A;  3HOY B;  3FPU B;  2EJM A;  2X6G A;  3MXU A;  3NXW A;  1OXV A;  3HS0 C;  1QNK A;  5CV4 A;  1EQT A;  2R3Z A;  4R8N A;  3C1F A;  5J39 A;  2RA4 A;  4EQN A;  4OIJ A;  3K59 A;  2PO4 A;  1A3U A;  5HUR A;  4DK1 A;  2F0E A;  4ZKB B;  5KGU A;  1EOT A;  1S5C D;  4Y7N B;  1FGB D;  3GTO B;  4LMQ D;  1A15 A;  3NUC A;  1AZP A;  4G7O C;  1RF2 D;  2A73 B;  1PRT F;  4M8A A;  1RHP A;  1V1P B;  4DFA A;  3SXH A;  1SYG A;  5G3L F;  2D9U A;  1EZ6 A;  1TU2 B;  1PTO D;  1BCP B;  2G9H D;  5KYL A;  4G4K A;  1B1Z A;  3Q22 A;  2L12 A;  5C0X G;  2BA1 A;  4HAE A;  4OL7 A;  4V0B A;  5EGT A;  5C0X J;  4Q0F A;  3H6M A;  3P20 A;  3RD4 A;  4BBR B;  3LWE A;  1HFG A;  3SHL A;  1D1K A;  2TSS A;  4DGZ A;  3K57 A;  3NBH A;  2HDL A;  1WCM B;  1EFI D;  3OMG A;  4CKC A;  1OXX K;  2B39 A;  4K5V A;  4I7Z C;  2XWJ B;  2AQ2 B;  3V2T A;  1JQY D;  2K6A A;  3H0G B;  5JPN C;  3WDN A;  1I4G A;  3NK9 A;  1VMP A;  2L9H A;  3FPP A;  1QWY A;  1MBY A;  2JA8 B;  3HKZ B;  5ELD A;  1DOK A;  4JK1 C;  3I3C A;  2BCO A;  4IAL A;  4X3S A;  5AFW A;  2OEO A;  1YNN C;  2R93 B;  4QCL A;  2E74 C;  1SNM A;  3S16 B;  1DON A;  2LMC B;  1AN8 A;  3NTK A;  5EBC A;  3HZX A;  1SDF A;  2R92 B;  1EU4 A;  3OWF A;  2A68 C;  3I4N B;  3VR4 A;  2YU9 B;  1EIH A;  2RSO A;  1CFM A;  1PFM A;  3DEO A;  4OO1 H;  3KLS X;  1HXY D;  2B2U C;  1QJO A;  3R93 A;  1F9S A;  2ID0 A;  1WTX A;  4A3K B;  3PUW A;  1VF7 A;  3Q23 A;  1ESF A;  1RKN A;  1AW7 A;  4OO1 I;  1WTP A;  2PW7 A;  1EY8 A;  1CI3 M;  1IYU A;  1RD9 D;  1EEI D;  2KEC A;  3QWN A;  3A7L A;  5I9P A;  2VNU D;  1GUN A;  2JSO A;  3AU7 A;  2HCC A;  2NN6 H;  3GQB A;  3NWT A;  3GTP B;  2LS0 1;  4ZRZ A;  1V43 A;  4BBS B;  2DY7 A;  3LWU A;  2HQE A;  5EQ0 A;  2E75 C;  3N52 A;  2WP8 J;  1LTT D;  3RLF A;  4HSV A;  1SEB D;  3GTK B;  4F8M A;  1J8I A;  2ZXR A;  5CYU A;  5KNB A;  5KEE A;  4A3M B;  5NUC A;  3Q6S A;  5C4Z A;  1DJR D;  2EY1 A;  2B2W C;  3QO2 A;  5K5P A;  2MJ8 A;  3X3N A;  1O80 A;  3R3O A;  2K5Q A;  4K14 A;  1SJH D;  2KED A;  4B9X A;  1CHP D;  1R9T B;  2F0S A;  1RCV D;  2XIW A;  1AFP A;  3HG9 A;  2F3V A;  2FMM A;  3VR5 A;  1BCP D;  5E1F A;  1C48 A;  1HA6 A;  3D6W A;  1SSO A;  4FNF A;  1SNO A;  4QB4 A;  2F0J A;  1KLU D;  2JEB I;  2WII B;  2H1E A;  3GTG B;  4DAY A;  5DM6 3;  4CHT B;  2D62 A;  2DNC A;  1TQO A;  1MSH A;  3H94 A;  5COR A;  1K83 B;  3ERO A;  1CA6 A;  1ZYR C;  4HCE A;  2MUY A;  1B9N A;  3ZYY X;  2Q8T A;  5DNF A;  3PUX A;  1U9R A;  5D65 A;  3J7A F;  1JOQ A;  2EYJ A;  2MPM A;  1O7Y A;  2EOT A;  1NR4 A;  5FK9 C;  2JA5 B;  1LV9 A;  1FNV A;  3NWS A;  4LAA A;  2KUM A;  3HOZ B;  1UEA B;  2M2L A;  1I3Q B;  2RDF A;  5KRU A;  1EYD A;  2KHS A;  4RGT A;  2PPB C;  4CJ1 B;  4KHV A;  1AEX A;  4L6T B;  1H9S B;  1SAP A;  3K5M A;  1G2T A;  3DWQ A;  4B9W A;  1XX8 A;  2F0T A;  4ME5 A;  4FYD A;  3NP8 A;  5C3W A;  4U68 A;  3PMF A;  4XIG S;  4KN7 C;  1KNE A;  3MXG A;  1I4P A;  3J81 E;  3A7A B;  3KUP A;  4K5X A;  3NHH A;  1M8A A;  1EWH A;  1DM0 B;  3MWY W;  3IAY A;  1IW7 C;  3FKI B;  2FIN B;  5ELB A;  2F1M A;  1DXM A;  1CK1 A;  3H3V C;  4KY5 A;  5D3D A;  1BF4 A;  2AWN A;  5JPM C;  3FVQ A;  1TWG B;  4DXF A;  2N55 A;  3BDL A;  4RHR A;  4X3U A;  3A8K E;  4CGY B;  3TP6 A;  2OT2 A;  2F0F A;  3C3L A;  3NTH A;  3RUZ A;  1SJE D;  1HUN A;  3AB9 A;  4XQQ A;  1D5X C;  4C3I B;  1GUG A;  3PO3 B;  2F4I A;  1CQV A;  4Q5V A;  5T1I A;  1T5X D;  3MEH A;  1OO9 B;  4IUR A;  2A6H D;  2B2T C;  5CC4 A;  5FLX E;  2E2D C;  2JP1 A;  3VA5 A;  2IPK D;  4IUQ A;  2E76 C;  5KNC A;  1S5D D;  1FD7 D;  1SNP A;  2B8F A;  4PQX A;  5C6A A;  2EYF A;  2PNR C;  1IYV A;  2K7V A;  1CZG A;  1RJT A;  2ENB A;  4F87 A;  5CMD A;  3KBX A;  2WAQ B;  2FJ2 A;  2XRS D;  4K6L A;  2K5D A;  1ML0 D;  2A5H A;  5C4X B;  5I6Y A;  3VR3 A;  1S5F D;  3D8G A;  5JVG 3;  3D4W A;  5A2Q L;  4RKB A;  3U9S A;  4K8I A;  1GUS A;  3V05 A;  1CTM A;  3EFX D;  1DZ1 A;  3L7Z C;  3SR1 A;  4XQN A;  3WOF A;  2EVB A;  4IFD I;  4FXK C;  3S2H B;  3A8J E;  1W6K A;  2YYZ A;  1VCI A;  4C3H B;  3QOJ A;  2JE6 I;  2B2Y C;  2Q8R E;  1F2M A;  1KNA A;  2SEB D;  3S14 B;  1CZW A;  1UNS A;  1STN A;  1PFN A;  2EY5 A;  3FMC A;  2KQ3 A;  1NR2 A;  3S1M B;  2NVX B;  3IKJ A;  3HOV B;  1JWU D;  4BY1 B;  2EY2 A;  5K36 H;  3K6O A;  2NTT A;  4OIK A;  1PTO C;  3BYY B;  5IIF A;  4RWS C;  2K5W A;  1SBB B;  3FEW X;  2HDM A;  4PMC A;  5CV8 A;  1Q1E A;  2I07 B;  1A2T A;  4ZQ3 A;  5LHY 1;  3Q24 A;  2CW0 D;  2K28 A;  5M3F B;  3NTI A;  2EXZ A;  4OO1 G;  1Y1W B;  2LKV A;  1Z7T A;  3OIQ A;  1LTI D;  2LFN A;  2ZT9 C;  4ZUJ A;  4E6I A;  1Z47 A;  4CJ2 C;  4DNR B;  3FRP B;  4EQP A;  2XWB B;  3VYT A;  2NYZ D;  2L1B A;  3SK8 A;  3I70 A;  2O4X A;  4RGN A;  5M3M B;  3TBI B;  3HEJ A;  4O42 A;  1ZEQ X;  2OF1 A;  3GP7 A;  2NVT B;  3K5N A;  3J7A V;  2A6E D;  2NN6 G;  4BA1 I;  1O7L A;  4HMI A;  2JA7 B;  4MIU A;  3S1R B;  3NE5 B;  5FO8 B;  2E2J B;  1RTO A;  2K05 A;  4BA2 I;  4DXG A;  4ZYS A;  2RKS A;  3TP7 A;  3I90 A;  5CV9 A;  1LAB A;  1HQM C;  1D1I A;  3MFG A;  1XYI A;  3ERQ A;  2BE5 D;  3G6J B;  1L0X B;  1SYF A;  3JAM L;  1H9M A;  4R9W A;  2IX1 A;  1JOK A;  2L4N A;  2O5I C;  2FHT A;  2NBF A;  4DAV A;  2DY8 A;  4XDX A;  4G57 A;  3DWA A;  2Y0S B;  3RZO B;  3L3O C;  3EVQ A;  1YNJ D;  4BS9 A;  5FLX L;  2EJF C;  2SNS A;  3OOC A;  2BA0 A;  3D3R A;  4A3J B;  3S2D B;  2K32 A;  2VB3 X;  1M4V A;  4NKL A;  2PMZ B;  4A3D B;  2IJ0 A;  4IUT A;  4B08 A;  2Z1C A;  2V4D A;  1NAP A;  2F0U A;  2F0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...