3D4DA

Crystal structure of staphylococcal nuclease variant delta+phs y91e at cryogenic temperature
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAEIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS Y91E at cryogenic temperature.
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 32
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2008-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3d4dA00
2PW5A 4E6IA 1SNQA 2F0HA 3NHHA 4EQOA 2EY2A 1JOKA 4KY6A 2SNMA 5C5MA 1TR5A 4ZUJA 3SK8A 5IOCA 3VA5A 5CC4A 2PW7A 5J22A 3MZ5A 1F2YA 1SYDA 1TQOA 2RDFA 3E5SA 1F2MA 5I9PA 5DAUA 5EKLA 3BDLA 3C1EA 2EYPA 2RBMA 2F0UA 4ME5A 4KTAA 3NP8A 5CV5A 5IGDA 2PZWA 1EY6A 4B9XA 2LKVA 4G57A 2F0FA 1EY0A 5E1FA 5J1ZA 4S3SA 3PMFA 1EYDA 4J6HA 4KY7A 3D4WA 3HZXA 4F7XA 4B9WA 5CV8A 5KIXA 1A3VA 2SOBA 5JAVA 1SNMA 1II3A 1KDCA 2F0PA 2F0QA 3BDCA 4NMZA 4WRDA 2EYFA 2ENBA 5IIFA 1SNDA 3OSOA 3OMCA 4KD3A 5I6YA 1SNPA 4HMIA 3MHBA 4HTHA 5EGTA 4MIUA 3NQTA 1SNOA 2M00A 5EKKA 3R3OA 1EY4A 4TRDA 4ZUIA 3SK5A 3TP8A 3DHQA 4EVOA 1EYAA 1EQVA 3V2TA 2OXPA 4K8JA 4HMJA 1KDAA 5IGCA 1AEXA 4J1MA 5DEHA 4PMBA 2WACA 1NSNS 2KQ3A 2RKSA 2F0TA 2F0IA 4DF7A 5KEEA 3TP5A 2EXZA 4OL7A 4ZQ3A 1JOQA 2F0OA 4KHVA 2F0SA 3QOLA 2OEOA 1KDBA 2PZTA 2HQEA 1SYBA 1F2ZA 2O4XA 3OWFA 4IUNA 1A3TA 3MEHA 4K14A 1NUCA 4LAAA 5CV7A 3ERQA 5CV6A 5C5LA 3T13A 1EY5A 3TP7A 3SK4A 5HGTA 5J39A 4KD4A 4K2KA 3MXPA 4N9TA 4RKBA 2QDBA 1STBA 1STAA 4PNYA 4QF4A 3T16A 5F2DA 5CR3A 1A2UA 2PQEA 2F0EA 3D6CA 3RUZA 3ITPA 4DU9A 3S9WA 2OF1A 5IGBA 4K2LA 5KGUA 2EY5A 2F0GA 2NUCA 1IHZA 4WORA 3NXWA 3NUCA 4K6DA 3EVQA 1A3UA 1U9RA 1ENCA 4R8NA 1A2TA 2F0KA 1JOOA 4PMCA 5CV9A 1EY8A 1SYEA 1RKNA 1SYFA 4KY5A 5ISRA 4KV6A 5IGGA 2F0DA 3TP6A 4EQPA 1EYCA 3SK6A 2EY6A 5C6AA 5JOBA 5E3FA 1EZ6A 1SNCA 2EYOA 4ID6A 3QOJA 4KJNA 4EQNA 5I6WA 3MVVA 4NDXA 4QB4A 1SYCA 4K5WA 1STYA 3SR1A 4NP5A 4RKLA 5IGEA 3SXHA 4K5VA 2F0VA 3SHLA 4IZ8A 1STGA 1JORA 2F0LA 4K5XA 2EYJA 1KABA 1STNA 3EJIA 2EYMA 3EROA 5KYIA 2F0NA 4ODGA 3P1HA 3HEJA 3TMEA 2PZUA 4KJOA 2SNSA 4DGZA 5HURA 4NKLA 5KYLA 4H7BA 4YIJA 5CV4A 3D8GA 1EY9A 2EYHA 5NUCA 5CGKA 4F8MA 4N9PA 2F3WA 5K5PA 1ENAA 3C1FA 5C4HA 3P75A 3D4DA 4K8IA 5C4ZA 1TT2A 2F0WA 2KHSA 2F0MA 3DMUA 1KAAA 2EYLA 1EZ8A 3OMGA 3U9OA 5C3XA 5I9OA 2F0JA 3H6MA 1EY7A 2EY1A 4IALA 4I65A 4QMGA 3QB3A 4DFAA 5C3WA 5KRUA 5M9OA 2PYKA 2F3VA 1STHA 3LX0A 5IGFA 1SYGA 5IODA 3NK9A
chains in the Genus database with same CATH superfamily
3AQQA 4OO1I 4Y7NB 3L2PA 1LYLA 4B3RQ 2LXKA 5I2YA 1H9SB 1SSOA 5CV5A 3QIAA 4HEDA 1RCVD 4B9XA 5IYDG 1F9RA 4S3SA 4B9WA 4H0LC 5JAVA 2E5LQ 2MPMA 5IY0A 3OTOQ 4NXMQ 5IWAQ 4K0KL 4O2DA 2EYFA 1X3FA 1X3PA 3TN2A 1X9NA 4RGNA 3MXNA 1JQYD 1SMYD 3A55A 1A15A 3S15H 1SE2A 3NBIA 4EVOA 3HOWG 2Z0SA 1V1OA 4A3JB 2EVBA 1KXLA 1K83B 1XNQL 1G6ZA 3TBIB 3BDOA 1K9MC 1FNWA 1VQJA 4GZYC 1TVXA 3Q24A 3OTOL 4DXFA 1GUTA 4UHVA 3PIP3 3JAME 1SJHD 3T13A 3ERQA 1B2TA 2PI2A 1A62A 1I4XA 1KRTA 2QDBA 1KAWA 1Q1BA 3O13A 1I3QB 4QUFA 4JYAL 2Q8TA 1L1OA 1LT4D 4DV0Q 3T1HL 4L5TA 2PPBC 2A6EC 3CC2A 1RL2A 4A3BH 4IOAA 3GTQB 2J0TD 1O78A 5G3LD 3VDYA 3HKZB 4JV5Q 1HQRD 4EX5A 1SMXA 2V1CC 2XWBB 1SJED 3TRZA 4DV1L 1V1QA 3EJIA 4GOPA 1WTWA 1VQLA 5C4JH 2JJQA 5HURA 3L9AX 3JC66 2MUYA 5NUCA 1EIYB 1TWHB 1WVLA 1LACA 1HR0W 3MXNB 3S1NH 1KAAA 2EJMA 2MGSA 4KMUC 3U9OA 3H6MA 3PUZA 1XYIA 3QB3A 3R93A 4KI0A 2F3VA 1GM5A 4RMFA 2GVAA 1L0WA 1SNQA 2A73B 4GKKL 5C5MA 4IJLA 1XX8A 3G6EA 5C4XH 4KHPQ 1E2VA 3ZJYC 1YNNC 2EYPA 3KLSX 3QR8A 4R4OA 4A3FB 4LF9Q 2BDOA 1UWVA 2ID0A 4IFDG 4J6HA 3KF6A 1II3A 1KDCA 1HA6A 2EDGA 1N36Q 3BDCA 1L1OB 1ZXTA 3RZDH 2ENBA 3PO2B 1H95A 2DY8A 3MHBA 1BQQT 1ICFB 4LFCQ 4B3SL 1PH2A 1G91A 5I2XA 1EQVA 1TWGH 3GTKH 4OGQC 1AEXA 2NTSA 5DEHA 4LF9L 1EOTA 3K5NA 1LTTD 1NY4A 2DNCA 4R1JA 2HD3A 1PYSB 4B08A 3J7AF 4DR6Q 1E1TA 4JI7Q 4KHVA 4GOPB 2WB1B 3W2DA 3S2DH 4DV5L 1TWAH 2CVRA 2ICEC 2RF4A 2IX3A 3J7YW 4K2KA 4LFCL 1D2BA 3MXPA 4RKBA 1VF7A 1PFMA 5IYCH 2YU9H 2SDFA 3CC4A 2OF1A 2WB1G 3ULPA 4DR3Q 4A3CH 5C3EG 1I94Q 2VQFL 1LTLA 3HS0C 4DR6L 4JI7L 1XPUA 3K80C 1S3OA 3A8JE 3S15B 2K1BA 4C3HH 3CC7A 4FYDA 1Z9FA 1STYA 1QVCA 1H9RA 1JMCA 4DUYL 4M1UB 2Z6BA 4IZ8A 2M2LA 4K5XA 3UDGA 3KOJA 1YNND 4XYOA 2N55A 2TSSA 3TS2A 1CFMA 4O1NA 1X55A 5JJKA 3KF6B 4GNXA 3HOUH 2E76C 3U50C 5JPMC 3J81j 3PIO3 4AIMA 4DNIA 4X64L 5IE8A 1XJVA 1MKHA 4OIJA 1JE5A 4DV4Q 1EZ8A 5M5XH 1FJGQ 2BA1A 5EPJA 2PYKA 2ZTDA 1Z47A 1XPRA 1STHA 4X62L 4EQOA 4DK3C 4A3BB 1NNXA 5IOCA 2K75A 2K5QA 4I7AA 1Q1EA 2JA8G 1RJTA 1J8IA 4JK1C 1FJGL 5KIXA 5D3DA 5C4JB 4LK1C 3K8AA 4X6AH 1HCZA 2HIXA 3GO5A 2X6LA 1SNDA 3UDIA 5JVH3 1CM9A 2PNRC 4GOPC 1ESRA 2AHOB 3D4RA 1WD0A 4TRDA 3IL8A 1QNKA 1AZQA 1KQSA 4EQ5A 4HMJA 5CBAE 4DK0A 3CU7A 2B2WA 2RKSA 4DF7A 1EWCA 4CDEC 5D65A 2AWOA 3HG9A 2IT1A 1HNWL 4C3JH 2PMZB 5C4XB 5FLMG 4GNXB 1HH2P 4KD4A 4P72A 1G8ZD 5IT9L 3OPOA 1XMOQ 4PNYA 1A2UA 4K2LA 5C4XG 3NE5B 1YEZA 1PTOF 1CQVA 3RZDB 2KOLA 1A3UA 1YBYA 2F0KA 1JOOA 1RD9D 3FHWA 3GV6A 4P71A 3A7LA 1I6VC 5CMDA 4LUOA 1TWGB 2E2HH 4EQNA 1EWIA 3GTKB 1LM0A 1ASYA 3L7ZC 4JCVE 3R8BA 1Y8OB 4FF2A 1KABA 1STNA 1WD1A 2UXCQ 3S2DB 2XWJB 4MZ9A 1TWAB 1VQBA 5KYLA 1EY9A 2EYHA 2WINB 2YU9B 4FNFA 1RF2D 1IYVA 3DMUA 2I5LX 4PV1C 1EWHA 2NVQH 2BE5C 2EQSA 3D31A 2KEDA 1K0RA 4DR1Q 4WJ3M 2NVXH 2A68C 1OXVA 5IYCG 1BNZA 2F0HA 5D3IB 1HTPA 3OW7A 1VQ5A 4QL5A 3VA5A 1BCPC 5CC4A 1KRSA 2B8GA 4BA2I 5L37A 4C3HB 2DNEA 2DGYA 4C3IH 1JWMD 2J4XA 5HY6A 1EY0A 1KL9A 4L5RC 1TU2B 1PH7A 3S14H 3U58A 2L1BA 4X3TA 3HOUB 5AJ3Q 3GDEA 1O7IA 3A56A 1VQIA 5IIFA 2Z6KA 2F52A 4BBRH 2B63H 3S17H 4OO1H 2O5JC 5EKKA 4JPBW 2BH8A 2KCMA 4U68A 4BXXH 5M5XB 3UE1A 4WFN3 1CHQD 2DJGC 3Q23A 1EU4A 4DV3L 1BR9A 4A3EH 4GN3B 2RSOA 2QCPX 3K6OA 4GLVB 1VQGA 2HCIA 1NTGA 4JI8L 2F0SA 1KDBA 4GN5A 4LAAA 2WAQE 4QY7A 2QILA 5E7NA 1X65A 1UAPA 3BU2A 2X69A 3RUZA 5DNFA 1MIUA 2F0EA 3H0GH 4V190 1YHBA 1D5MC 3F2UA 4RG1A 1RKNA 2JK8A 4JG2A 4X3UA 2O2LD 1GUNA 3C46A 5ELDA 5DM73 1HR0Q 3RMHA 1TS3A 4NDXA 4QB4A 4PQXA 1B1ZA 3IRBA 1P8LA 2L4NA 2XGTA 4RKLA 3UI2A 1BCPD 1SXTA 3NPPA 1V43A 1C9OA 1VQ4A 2NVYH 4C3JB 3W5OA 4JBWA 2E2IH 4LF4L 2P5ZX 4KJOA 2Y0SB 1Q86C 2B2WC 4A76A 4DV7Q 2A8VA 2E2JH 4JI0Q 1OO9B 1MJEA 1R4QB 4C3JG 5KNCA 4GKJL 3MXGA 3H91A 4NXNQ 2R92H 4LFBL 4I65A 1QVFA 1QWYA 3URYA 4FXDA 1SYGA 3CQZH 2A69C 1EIGA 2A6HC 2EY2A 3K81C 4KY6A 1WI5A 3ICEA 1K8MA 5J22A 2E2HB 3MZ5A 1BXTA 3MEFA 4XQJA 2ZM6L 3C2PA 1OTCA 4DV7L 1N8RC 2RHQB 3RZOH 4JI2L 4IUVA 2PZWA 1AE3A 5J1ZA 1PH3A 3D4WA 3R2IA 4DR2Q 2JA5G 1YI2A 2L0CA 2KCTA 1MSHA 2NN6H 4M8AA 1PRTF 2LY7A 3N52A 3M3YH 2B3GA 4A3JH 3CW2C 4HMIA 4DAPA 2RCNA 2M00A 2CKZB 1I4GA 4DNTB 2NVQB 4LF6L 1N34Q 4DR5Q 1VQHA 2FHTA 5IGCA 1ONLA 4J1MA 3EQLC 3FRPB 1TS4A 2NVXB 4ZAIA 4DR2L 1HZAA 4NB3A 3CAMA 3FPUB 1ZYRD 1K3RA 5JJZA 1B9MA 1GUOA 2IHFA 5LMUL 3V05A 5HGTA 1CKOA 3FP9A 4A3DH 4C3IB 3NTIA 4RHRA 2BH2A 2R6GA 3PV0A 4KLKA 1JORA 4RGMA 3S14B 2NYZD 4YCWA 1WTOA 4IURA 3GTQH 4WORA 1AZPA 3MA2B 1JJ2A 2JA6G 3WOFA 4BBRB 2B63B 4QIWE 3S17B 2HDMA 1NCVA 5IP9H 4CKBA 2Z8LA 4IPGA 1SNCA 2Z6KC 2A6HD 3MVVA 4A3EB 4C2MH 2F1MA 3N6RA 1U4MA 2CQAA 4C1NI 4AQYQ 3VA7A 3LWEA 4X3KA 1XMQL 5BR8L 4NPSA 1SMYC 2B2YC 2DN8A 5K36H 3J7ZC 4UPAA 3C1FA 2JN4A 3D4DA 3NTKA 3T1YQ 1TT2A 3H0GB 5M3MH 2ATWA 2F0JA 2KHJA 1PHJA 3OYYA 2RA4A 5IGFA 2N8NA 2VUMG 4OHJA 3VYUA 3D0FA 4A93B 4AQYL 4E6IA 4LF5L 1WTVA 1JOKA 2ZJRA 1TR5A 1NE3A 1HTLD 3PQIA 2MJ8A 4X66L 1QILA 2Z4IA 3T1YL 2MP1A 1JICA 4R8IA 3HGBA 3AU7A 2NVYB 3D3RA 1EYDA 1NAPA 4ABNA 2E2IB 1VQ6A 3S24A 2F0QA 3FEWX 3HOVB 3KF8A 3OSOA 3OMCA 4JI1L 2E2JB 2D0OA 4K0KQ 3K0XA 4CJ1B 1SNOA 1QNUA 2LS01 3A8KE 2R92B 2LSSA 3A5ZB 1B70B 1YNJD 4TKOB 4K8JA 4OWWB 1KDAA 3GTOH 3DM3A 2LMCB 3CQZB 5IP7H 2JQOA 3MWYW 2R61A 2NBFA 3VR3A 5LHY1 2IX1A 4I7ZC 3F1ZA 4BBSB 1XNQQ 1VQ8A 1SAPA 4HIOA 1A0IA 2F0OA 4CJ0B 2LXJA 1DJRD 1NUCA 3QO2A 3ND8A 5JEAH 2N78A 4JBMA 3RZOB 4X65L 1WYDA 1U4LA 2N88A 4N9TA 2QKIC 1JWUD 3MXUA 5F2DA 1UUPA 2VQEL 1V1PA 3M3YB 3NUCA 1VQ7A 1PXUA 1U9RA 3IAYA 4JI6L 4JYAQ 1EFWA 2CQOA 1GJXA 1SYFA 5DM63 2ZXOA 2JEBI 3T1HQ 2B2UA 2AQ3B 5COYA 4EQPA 3G4SA 3I7FA 4LWCA 3NSWA 1PH8A 1O7LA 4A3JG 4A3KH 1M4VA 5EBCA 1QZHA 5FJ8H 1WJJA 2OQKA 1CK1A 4JVZA 3T56B 4BWGB 3CCLA 4DV1Q 2BCOA 1I50H 2SNSA 4CDFC 4A3DB 2R7ZH 4R4IA 3KF8B 3P75A 4DKAC 3BS1A 1J9OA 3CMAA 1FD7D 2XNAC 4HCSA 4DFAA 3CD6A 4BY1H 1U0LA 3K57A 4AYBE 1E0BA 4QCLA 1Q82C 3QG1A 4GKKQ 1B53A 1JB3A 4C2MB 3NP8A 3HKZG 3PIPA 4XT1B 2VS1A 5GAGC 1VQNA 4LF7L 1HZCA 5FLXE 3I90A 4F7XA 1PFNA 1ESFA 1JB7A 2XRSD 2VXWA 2F0PA 4WJWA 4IPCA 1M90C 4NMZA 4ZCKA 3PF5A 2NN6I 4C56C 3G48A 3GTMH 3CXCA 4A3LH 5M3MB 1S72A 4LUVA 2AQ1B 1STEA 4B3SQ 2TMPA 2OXPA 3E0JA 4YCVA 2EOTA 2KQ3A 2F0TA 1MI2A 2MFIA 4OL7A 2AMCB 2H5XA 4R9WA 4JI4L 1ET6A 4IPDA 1LV9A 1YZ6A 1Z7TA 2F03A 2K32A 3PO3H 5FO8B 4DV5Q 2XVSA 1GD7A 3KLWA 4A3FG 2JEAI 3MTSA 2IL8A 2UU9L 3ITPA 1FNUA 1C0AA 3M4OH 5KGUA 2EY5A 4RCNA 1JT8A 4K6DA 1F9SA 2KVMA 5KNDA 1D5XC 3PO2G 4CKCA 1CZWA 2CWAA 2VQFQ 2XRQD 2F0DA 4OEMB 1EYCA 3G71A 5JOBA 4F87A 3DUZA 3ER0A 5FO9B 3FMCA 3QOJA 3GTOB 3E9HA 4ZK9B 5IYBH 3F2CA 4DUYQ 5GQOA 1O7YA 4DGZA 4HCEA 2QDLA 4RGTA 4IQZA 3J80i 2N3SA 4JI5L 1VMCA 4X64Q 2WP8J 1C7YA 3JAML 4IUUA 3FPPA 2ES2A 1M8AA 1HPCA 4X62Q 1F77A 1VQAA 4XQNA 3KBGA 3K0YA 2C9OA 1WCMH 5JJLA 4POFA 1TQOA 2CWPA 2K5VA 4JOIA 4FF4A 2VW9A 1KNAA 5EKLA 3J80c 4PMWA 4CGYB 4A3KB 1IBKQ 4ZLTF 1QCBD 2B2UC 5GAEC 1EQRA 5GADC 3HOZH 4IFDI 4HN7A 5CV8A 4JBKA 1I50B 3NENA 2Z4HA 1QOHA 2R7ZB 3VYTA 1Z6HA 1S5FD 3CCRA 1WTXA 3GQBA 1S5BD 2A74C 4MIUA 2FMCA 3NQTA 3CMEA 2L5TA 3HOYH 4KKSA 1IW7C 4F88A 3Q6SA 5M5YH 1IBKL 4BY1B 4ALPA 2JP1A 3L0OA 4ZQ3A 4A3BG 3T51B 1EIHA 1SYBA 4IUNA 1HNWQ 5E4WC 3EFXD 1BCPB 2RSNA 1TWCH 1ILQA 2C35B 4NW2A 3PIOA 1UEBA 1D7QA 3E3XA 1O80A 3RLNA 3HOXH 3J80E 3GTJH 3X3NA 1EQTA 4ZRZA 1IKMA 4G4KA 4BY7B 2ICIA 1EU3A 3EVQA 2ALYB 1EY8A 3GTMB 3A0JA 1SE4A 2H1EA 1N33L 3SK6A 5C6AA 4GLAC 2CH4A 1HFGA 3SR1A 4DR4Q 2Z1CA 3SXHA 2QGQA 1RTOA 3SGIA 2CW0D 3LNNA 2EYMA 2RCFA 1X3GA 1XWEA 1AP0A 3ONAB 3PO3B 3MFYA 4DNRB 2PQAA 2B2VA 2VL6A 3OMGA 3M4OB 1PH9A 1HNXQ 2NZOA 2XTIA 3GTLH 4DR4L 1JR0D 4A4IA 1Y8NB 1LTID 1IW7D 4APVA 2I07B 3H3VI 3A74A 3TREA 1XTCD 1F2YA 3QJYA 1SYDA 2NB0A 3E5SA 4YHHQ 1F2MA 5EAYA 3BG3A 4RA8A 1Y14B 3S2HH 1DD2A 2VB3X 2NWGA 1MD2D 2F0UA 1WTRA 1Q90A 2R93H 2LKVA 2ZJQA 4UP9A 3PUXA 1SDFA 1HNXL 3S1QH 1VQFA 1MHWC 5E4XA 1MSGA 2KCCA 3H3VC 3J81i 5ELFA 1GHKA 3G7LA 2I5MX 5ELEA 2JA7H 5LL6X 4U673 5IYBG 1QJOA 3SK5A 4YHHL 4P74A 1J5EL 1EEID 1E2ZA 5ELCA 1C8CA 2NZ1D 1U5KA 2NTTA 1LUZA 4QUCA 3RN2A 4A3CG 1PLFA 3QWNA 1EYGA 1TY0A 4DV3Q 1A8VA 2A19A 2HIVA 3K5MA 4DPGA 2OT2A 1WCMB 3QOLA 1D1IA 4DR7L 1F2ZA 2L55A 1A3TA 1Q46A 4R4QA 1HZ9A 4JI8Q 2AUJD 4C3HG 2MQHA 3GTGH 1N9WA 1YHQA 1KC8C 5BN4A 2UUBQ 2EZVA 3HOZB 2PQAB 2PQEA 1L2FA 4DU9A 3I70A 5FO7B 4JOIC 1DM0B 1VQPA 4QQBX 1NMFA 3HOUG 1VS0A 3I3CA 2NZHA 3PGZA 3SVMA 4IOCA 1G291 3M7GA 2B2YA 3HOYB 1HFNA 3U4ZA 2EY6A 1EZ6A 1KTKA 5M5YB 2EYOA 4WJ4A 1FR3A 2CFMA 1XTDA 4L6TB 2M9VA 4LW1A 2UUBL 1IBLQ 3A54A 3I4NB 3W1BA 1STGA 1WTQA 1HUNA 2NVTH 1AH9A 1EUJA 4P73A 3P1HA 1OXXK 1V8QA 2D2CC 3OHXC 2ZJPA 1HHVA 3AFQA 3D8GA 4LF4Q 1PYWD 3ND9A 2I46A 1E1OA 1TWCB 2F3WA 1ENAA 1AN8A 4UP7A 4K8IA 1PZJD 3J81E 4A93H 1Y1WH 3HOXB 3GTJB 3VYSA 5LL6S 1YITA 5KRUA 4IUPA 1IBLL 4GKJQ 1I4PA 4LFBQ 3I73A 4J8QA 1ZYRC 2JE6I 2RQXA 4CDCC 2FINB 3I72A 2EXDA 5DLQE 2I0QA 1PTOC 1EQQA 1PH4A 2N49A 3HOXG 1WTPA 3CRKC 2ZM6Q 1I6HH 1LABA 3CPWA 3HOVH 1EY6A 3IKJA 2XN9C 4JI2Q 5M3FH 4A3GH 2R7FA 1B4OA 4CJ2C 1OXSC 5C44H 1KLUD 1QVGA 1DZ1A 4TSSA 2UXBL 2K05A 1F9QA 2Y0SG 4WRDA 2LFNA 2Q8IB 2OTLA 4ZUIA 4BBSH 3TP8A 4G7HC 1BBWA 3P20A 3GTLB 2B39A 2AUKA 3SDZA 5CBEE 5A2QL 4A3MB 4LF6Q 1E3PA 2F0IA 4N8FA 5KEEA 2K33A 3TP5A 1HA5A 3AEVA 1CSQA 3A7AB 2B2VC 4X3SA 2IY5B 1JJCB 1WFQA 3A5UA 3K7AH 3S2HB 1T9HA 3MEHA 5EQ0A 3UDFA 3CCVA 1GHJA 3TP7A 1AW7A 3M9BA 3K5OA 1PVOA 2R93B 2K50A 5LMUQ 2GVBA 1BO0A 4JBJA 3S1QB 3OOCA 3M85A 2VZAA 3E0EA 1UNSA 3HOWH 1IHZA 4JI3Q 4R8NA 4L5SA 3CHBD 2JA7B 1HZBA 3NEMA 3KDFA 1DCZA 1SYEA 5ISRA 3HKZE 3WOEA 1KD1C 3PUVA 3TP6A 1DONA 1Y1VH 2SEBD 2QF7A 2D9UA 4TQUS 1SYCA 4K5WA 1N32L 1PTOD 2JA7G 1BBUA 1GUGA 5CORA 2F0VA 1VQCA 4YY3Q 4PG3A 2HUGA 4AH6A 3CP0A 2A5HA 2G9HD 2EJGC 3DWAA 4DV6L 4ODGA 4JI3L 3TMEA 3CKIB 4YIJA 3GTGB 3TDQA 1XMQQ 5C0XI 1DGSA 1YNJC 5BR8Q 4C3IG 2DJFC 3I55A 2F0MA 4RCOA 2KA7A 1BUVT 4HJ7A 5JEAJ 1FYCA 2HQLA 3M4PA 3H15A 3MFGA 1K28A 4YY3L 4BBRG 1QUQA 2B63G 2O5IC 2C5CA 4OO1G 1F2LA 1HJPA 4N8X1 4BXXG 2PW7A 1LT3D 3SEBA 2UUCQ 2KJXA 4LF5Q 5DAUA 4JW0A 1DOKA 1IZ6A 5KNBA 1FVIA 4KTAA 5D14A 4YWKA 4A3EG 4X66Q 4LMQD 3DLLA 5JJIA 2NVTB 1IKLA 3RD4A 1OXUA 1YVCA 1Q7YC 1B3AA 1H9KA 2FXQA 2K04A 2AWNA 2ASBA 2K7VA 3PUYA 5TSSA 4POGA 3KDFB 3I4LA 4GS3A 1A6XA 1QE6A 4LUZA 4JI1Q 1Y1WB 2UUCL 4IJHA 1XNRL 4RAUC 3H0GG 5EKIA 2UXDL 3AFPA 1LT5D 2WB1E 2ZTCA 2K03A 3DEOA 4IFDH 4A93G 1CI3M 1EL0A 1Y1WG 2OEOA 2L12A 4RHSA 5J39A 4B3ML 1I6HB 1K3BC 2IW3A 4LF8Q 4FF1A 3CCUA 1BF4A 4X65Q 2WAQB 4KHZA 5M3FB 1SFOH 2E74C 1M1KC 1NMGA 4H44C 4A3GB 5IGBA 5C44B 1XPOA 4O42A 3C3LA 4GLXA 3NXWA 1HXYD 1A2TA 4H02A 3HOVG 3HFZB 2VQEQ 2Q2TA 2EE1A 1EEFD 1QUQB 2WAQG 4JI6Q 1PRTC 2KENA 2R92G 4LF8L 4P75A 1S40A 1SE8A 2FFKB 2CHBD 4BBSG 4CKEA 1UE1A 3K7AB 3P7JA 2K01A 1LTAD 2D5DA 3HEJA 5C3EH 5CV4A 4N9PA 4BA1I 5K5PA 4MNOA 4KN7C 3CCJA 4ZKBB 2KEEA 2WFWA 3HOWB 3BVZA 1EY7A 2EY1A 5EJWA 5FLXc 1IL2A 1JE4A 2NN6G 1NR2A 1C4QA 2E8GA 3S16H 2PW5A 3UDXA 4B3RL 4YCUA 1Y1VB 1B8AA 1IL8A 1UE6A 4ME5A 4GN4B 5IGDA 1E7ZA 4OWXB 3TSSA 2E5LL 2BDNA 1SEBD 4NXML 5IWAL 1Y1VG 1SN8A 5T1IA 1LT6D 4LF7Q 2FJ2A 2CCZA 4ILWA 3PF4A 2DY7A 1GXDC 4A3DG 5HGQA 1ZEQX 3AYHB 4HTHA 5EGTA 3EBEA 1TS5A 3H3VH 3L3OC 2B2TA 4DAYA 3GTPH 1A63A 4K6LA 3H94A 3IFDA 3I56A 3V2TA 2JA8H 3S1MH 1GKHA 3HRZC 4IN3A 1PRTD 2PMZE 2RVLA 4LNQA 4QGUA 3KLRA 3NWSA 5IP9G 4HJ9A 4K14A 2O4XA 2DUDA 4L63B 4JI4Q 1JC7A 1V1PB 1WTHA 1UE7A 4BY7H 3M4QA 4QF4A 5CR3A 4IUTA 3S9WA 5IT9c 4DV0L 4G7ZC 2F0GA 4KK7A 2UU9Q 1VQOA 5K36G 1PH1A 5ELNA 2FMMA 1E22A 1K73C 5M3MG 4QIWB 5FLMH 4LFAQ 3PCOB 2EJFC 4JV5L 2OQ0A 4Q0FA 3STBC 1CTMA 4J15A 3I2ZA 1LLRD 4NP5A 2K14A 2MO1A 2F4IA 2Z9HA 4XTCS 1CT1D 2EYJA 3DM1A 3RR5A 1I4HA 1PH5A 4O0AA 1SROA 3HKSA 2PZUA 2YTYA 4ULLA 4UY8C 3GP7A 5EBDA 4F8MA 1NJIC 5C4HA 3UE0A 3I4OA 1SFOB 4LFAL 3CRLC 4DAYB 3WWVA 5C3XA 1WOCA 4JI5Q 4IALA 4QMGA 2K5HA 4OWTB 3KFUA 1LO5D 4XYQA 1VQ9A 3NK9A 2Q8RE 4XQQA 2HDLA 3I8ZA 5IT9E 1GOZA 4BS9A 2SNMA 4IUQA 4KHPL 3TQYA 1JJGA 3BVMA 2KHIA 1VCIA 1VQEA 5I9PA 3RLFA 2A6ED 4RWSC 1PTOH 5IP7G 1CUKA 5H1SE 3CF5A 1PFBA 3FKIH 2F4VQ 1CKNA 2PNHA 1N36L 1SNMA 2D62A 1ET9A 4UAIA 5EPKA 5C3EB 4LJZC 5JEAG 2OWOA 1DOMA 2JYOA 1VDZA 4KD3A 1EFID 2K6AA 2XIWA 3OIPA 2HCCA 2ZXRA 1DOLA 1EYAA 3EA6A 2ZXPA 2CW0C 3M4YA 1J6QA 5C0XJ 2WACA 2F4VL 2YV5A 1JWSD 3S16B 3LWUA 1V9PA 1Q81C 3KYHC 3STBD 1PDQA 1B7YB 2PZTA 4P2CB 5CV7A 5CYUA 5CV6A 3CCSA 1UEAB 2E75C 1EY5A 1X56A 3SK4A 1L0XB 3OWEB 1ML0D 2YTXA 4A3KG 1STBA 1G2TA 1SR3A 1B50A 5FJ8G 3T16A 1HRJA 4DR3L 1GO3E 2WKCA 3NELA 1S5DD 5ELOA 1YJNA 1KIXA 2VY3A 1I94L 3BVGA 1BCPF 1AFPA 1F9PA 1BDOA 2R7ZG 3NBHA 5I4DA 2PO4A 1LTGD 4KY5A 1NR4A 3DWPA 1E24A 5FLXL 3I4NH 5IGGA 3GTPB 4DV2Q 1H9JA 2K4KA 1PYBA 1R4PB 3K58A 1X6OA 1MGSA 4YWMA 4HJ5A 3BZDB 2JA8B 1K8AC 4UP8A 3S1MB 1N33Q 2G5DA 3GV3A 3E6ZX 1HUMA 4FO2A 4BY1G 2B2TC 4K5VA 3SHLA 3U4VA 2Y0SE 1OXTA 1CKNB 4MTNA 1Y8PB 3EROA 1L1OC 3Q22A 4FF3A 4XIGS 1O7ZA 1E2WA 2KCNA 1U4PA 2G9DA 2XSCA 1D8LA 1X3QA 2MNAA 4MHEA 4DV2L 4DV4L 2WV6D 5C4ZA 1JCKB 2F0WA 3K59A 4L8JA 3BJUA 1G2SA 2EYLA 2IWHA 3KJPA 4HSVA 5LMNQ 3OW2A 4R4CA 5M9OA 4IO9A 2A1AA 3MC0B 3LX0A 4EGVA 4BY7G 3SE0A 2ZTEA 3S1NB 3RNUA 2K5DA 2WKDA 4A3LG 1R9TH 3V96A 1ASZA 4RGOS 1I4QA 3I91A 1PV4A 4AYBB 3CCEA 1YIJA 1BVSA 3ZYYX 1YJWA 3BDLA 3RLOA 5C0XH 3AMUA 2R3ZA 1TIID 5BN5A 1I5FA 1TY2A 4DK6C 3K5LA 5LMNL 3E9IA 2AKWB 4A3IH 3BYTB 4AYBG 2RDHA 1QB5D 4A3MH 3PO3G 3KLSA 1IXRA 1CKMA 1KHIA 4HIMA 3NBHB 1G6PA 3KBXA 4ME3A 5FKAC 1LTRD 3B6YA 3R3OA 1SE3A 4MN3A 1UE5A 1FL0A 2EIFA 4HIDA 2KBNA 1HNZQ 3FDTA 1RHPA 4KKUA 1J5EQ 2GN5A 2K52A 3M7NA 1IBMQ 4ZKCB 1SLJA 3EIVA 1X32A 2JA5H 1LTSD 4L5QA 2PCFB 4R4TA 1PTOB 1TKWB 2MO0A 4DR7Q 1XMOL 1BOSA 1T5XD 2IPKD 3FKIB 1HNZL 3F8TA 1PZKD 5GAHC 1IYUA 5A2QE 1PH6A 1TS2A 3ULLA 1IBML 4ZYSA 1PFSA 4PMCA 5JPNC 5CV9A 3FKIG 5GROA 3I4MH 1RDPD 2L15A 3J81c 1QZGA 3G6JB 5IGEA 3F2BA 4XT3B 2UXCL 1K0SA 1W6KA 4PZ6A 2HHHQ 1FGBD 1GUWA 1B3QA 3T53B 1DXMA 2F0NA 2H4OA 3S1RH 2OCEA 1WCMG 4OIKA 5M5WH 2HT1A 2JA6H 5CGKA 1EIFA 1MJCA 4MTKA 2X6GA 2KHSA 3HOZG 4DR1L 2IX0A 2JSOA 1CQFA 4HSPA 3OIQA 3TZDA 2D0PA 5IODA 2HHHL 4DAMA 3J7A5 4GNXC 3ULJA 1H9MA 3J80L 3HOYG 2RDFA 2WIIB 3ERSX 1Q8IA 1FGUA 4XDXA 4CDDC 1KLGD 1YHAA 1U4RA 1LTBD 4G57A 3I4NG 5AJ3L 1X54A 4OONA 2SOBA 3KJOA 1RTNA 3K7UC 3NTHA 2VUMH 4OXPA 4HJ8A 2UXBQ 2B8FA 4Q5VA 1C48A 4PZ8A 3PSIA 3VR2A 3MAQA 1ILPA 2QEXA 1VQKA 1GVPA 1NSNS 2BE5D 4DUZQ 2EXZA 1TWFH 2KUMA 1R9TB 2A68D 5BN3A 3CCMA 1CHPD 2F3IA 1YJ9A 3OWFA 2QW7A 3R2TA 5C5LA 3EN2A 4QJFA 3AB9A 3W3AA 5JVG3 1P16A 1HQMC 5FK9C 1ZKOA 1STAA 2JA9A 2I5HA 1D6EC 1CA6A 3D6CA 3NQIA 4A3IB 2BOSA 2ZT9C 2QA4A 2NUCA 5J3BA 1ENCA 5C0XG 4DUZL 4TVAB 5IYDH 1BKBA 4OX9Q 1RIPA 4OELB 1HR0L 4Y7NH 4A3IG 5I6WA 4KJNA 1B44D 4A3MG 4PZ7A 3W1GA 3BZCA 5ELBA 3TZUA 1W2BA 1N32Q 1Q12A 2F0LA 4DN4M 3BZKA 2JA5B 1S5ED 1X3EA 5KYIA 1TXYA 5G3LF 1CA5A 1QG7A 3TS0A 4JI0L 4DXGA 1K8GA 4DV6Q 4JC0A 4OX9L 3FVQA 3DEPA 1PA6A 2R93G 1PMRA 3D6WA 2L11A 4NXNL 4IFDJ 4IPHA 1SRUA 2L9HA 1G51A 5A35A 1VMPA 5C3WA 2KECA 2Q2UA 1K8OA 2RHSB 2YTVA 2OTJA 1K83H 4H13C 5AFWA 3I4MB 3NHHA 1I4RA 3SK8A 4ZUJA 1Q3LA 1ENFA 4A75A 3Q0AA 1GUSA 2EPBA 1PRTB 4HAEA 3C1EA 1SBBB 2RBMA 4RFBA 3TEHB 4KKTA 2UUAQ 4DK1A 2K5WA 2F0FA 5E1FA 3I4MG 5T1GA 3PMFA 4KY7A 2GA4B 3HZXA 3S1RB 3WDNA 1A3VA 5EPLA 5M5WB 1I3QH 3CCQA 4C1NK 4DAVA 4B3TQ 2JA6B 3J7AV 1D1KA 3KK7A 2J7ZA 1BBXC 5I6YA 1KNEA 1SNPA 3X3MA 1N34L 1W3SA 1T5EA 2BA0A 4CBVA 1EY4A 3VR5A 4DR5L 2CH4W 1S4ZA 1IYJB 3DHQA 1AE2A 2PI2E 2IJ0A 2Q2IA 3GD7A 4FP5D 1S5CD 3RN5A 2UUAL 1Q8KA 1XNRQ 4XXEA 1Y69U 2UXDQ 4PMBA 1YNXA 1L0YB 2JXMB 1FNVA 3VR4A 3J81L 4G7OC 3Q8DA 1D5ZC 1JOQA 5LMNW 2A69D 2V4DA 4B3TL 2HQEA 1H9SA 2QEJC 4FVMA 4Z9CB 3PUWA 3DWQA 4FDBA 1TWHH 2RDGA 4B3MQ 3T4AC 4FXGC 2MHVA 3A8IE 5FOBB 2K5NA 4UDUC 1W6JA 2IHEA 2VUMB 3U9SA 3IFTA 4FXKC 2AQ2B 1EOVA 4HR7B 4KV6A 4RH6A 4V0BA 1VF5C 4Y52H 5E3FA 3NWTA 1CZGA 4DA2A 4ID6A 3H09A 4YWLA 2VNUD 2VB2X 3DXJC 3HP3A 4A3FH 2YYZA 1ICWA 1TWFB 1CSPA 1NBWA 2E2DC 3JAMi 3VR6A 2Q2HA 4HIKA 3KUPA 4HJAA 3BYYB 2B29A 1VQDA 3CPFA 3F2DA 2R7DA 4NKLA 4H7BA 3LGJA 3PO2H 1PZID 1DYQA 1B9NA 4KN4C 5I9OA 2K28A 1MBYA 5M3FG 4A3GG 1RODA 1VQMA 5C44G 3JAMc 3VYRA 1XXGA 4CHTB
chains in the Genus database with same CATH topology
4OO1I 4Y7NB 5I2YA 1H9SB 1SSOA 5CV5A 3QIAA 4HEDA 1RCVD 4B9XA 1F9RA 4S3SA 4B9WA 4H0LC 5JAVA 2MPMA 2EYFA 1X3PA 3TN2A 4RGNA 3MXNA 1JQYD 1SMYD 3A55A 1A15A 1SE2A 3NBIA 4EVOA 1V1OA 4A3JB 2EVBA 1K83B 1G6ZA 3TBIB 3BDOA 1FNWA 4GZYC 1TVXA 3Q24A 4DXFA 1GUTA 3PIP3 3JAME 1SJHD 3T13A 3ERQA 1B2TA 1I4XA 2QDBA 1Q1BA 3O13A 1I3QB 4QUFA 2Q8TA 1LT4D 2PPBC 2A6EC 3GTQB 2J0TD 1O78A 5G3LD 3HKZB 1HQRD 2XWBB 1SJED 3EJIA 1WTWA 5HURA 3L9AX 2MUYA 5NUCA 1TWHB 1WVLA 1LACA 1KAAA 2EJMA 2MGSA 4KMUC 3U9OA 3H6MA 3PUZA 1XYIA 3QB3A 3R93A 4KI0A 2F3VA 1SNQA 2A73B 5C5MA 1XX8A 1E2VA 1YNNC 2EYPA 3KLSX 4A3FB 2BDOA 2ID0A 4IFDG 4J6HA 1II3A 1KDCA 1HA6A 2EDGA 3BDCA 1ZXTA 2ENBA 3PO2B 2DY8A 3MHBA 1BQQT 1G91A 5I2XA 1EQVA 4OGQC 1AEXA 2NTSA 5DEHA 1EOTA 3K5NA 1LTTD 2DNCA 4B08A 3J7AF 4KHVA 2WB1B 3W2DA 2CVRA 2ICEC 2IX3A 3J7YW 4K2KA 1D2BA 3MXPA 4RKBA 1VF7A 1PFMA 2SDFA 2OF1A 3HS0C 3A8JE 3S15B 2K1BA 4FYDA 1STYA 1H9RA 4M1UB 4IZ8A 2M2LA 4K5XA 1YNND 4XYOA 2N55A 2TSSA 1CFMA 4O1NA 2E76C 5JPMC 3PIO3 4OIJA 1EZ8A 2BA1A 5EPJA 2PYKA 1Z47A 1STHA 4EQOA 4A3BB 5IOCA 2K5QA 1Q1EA 1RJTA 1J8IA 4JK1C 5KIXA 5D3DA 5C4JB 4LK1C 1HCZA 3GO5A 2X6LA 1SNDA 5JVH3 1CM9A 2PNRC 1ESRA 3D4RA 1WD0A 4TRDA 3IL8A 1QNKA 1AZQA 4HMJA 5CBAE 4DK0A 3CU7A 2B2WA 2RKSA 4DF7A 1EWCA 5D65A 2AWOA 3HG9A 2IT1A 2PMZB 5C4XB 4KD4A 1G8ZD 5IT9L 3OPOA 4PNYA 1A2UA 4K2LA 3NE5B 1PTOF 1CQVA 3RZDB 2KOLA 1A3UA 3GV6A 2F0KA 1JOOA 1RD9D 3A7LA 1I6VC 5CMDA 1TWGB 4EQNA 3GTKB 3L7ZC 3R8BA 1Y8OB 4FF2A 1KABA 1STNA 1WD1A 3S2DB 2XWJB 1TWAB 5KYLA 1EY9A 2EYHA 2WINB 2YU9B 4FNFA 1RF2D 1IYVA 3DMUA 4PV1C 1EWHA 2BE5C 3D31A 2KEDA 2A68C 1OXVA 1BNZA 2F0HA 5D3IB 1HTPA 3OW7A 3VA5A 1BCPC 5CC4A 2B8GA 4BA2I 4C3HB 2DNEA 1JWMD 2J4XA 1EY0A 1TU2B 2L1BA 4X3TA 3HOUB 3A56A 5IIFA 4OO1H 2O5JC 5EKKA 4U68A 5M5XB 4WFN3 1CHQD 3Q23A 1EU4A 1BR9A 2RSOA 2QCPX 3K6OA 2HCIA 2F0SA 1KDBA 4LAAA 2QILA 1UAPA 2X69A 3RUZA 5DNFA 2F0EA 4V190 1D5MC 3F2UA 1RKNA 4X3UA 2O2LD 1GUNA 3C46A 5ELDA 5DM73 3RMHA 1TS3A 4NDXA 4QB4A 4PQXA 1B1ZA 2L4NA 4RKLA 3UI2A 1BCPD 1SXTA 3NPPA 1V43A 4C3JB 4JBWA 4KJOA 2Y0SB 2B2WC 1OO9B 1R4QB 4C3JG 5KNCA 3MXGA 3H91A 4I65A 1QWYA 3URYA 4FXDA 1SYGA 2A69C 1EIGA 2A6HC 2EY2A 4KY6A 1K8MA 5J22A 2E2HB 3MZ5A 1BXTA 4XQJA 3C2PA 4IUVA 2PZWA 5J1ZA 3D4WA 3R2IA 2L0CA 1MSHA 2NN6H 4M8AA 1PRTF 2LY7A 3N52A 4HMIA 4DAPA 2M00A 1I4GA 4DNTB 2NVQB 2FHTA 5IGCA 1ONLA 4J1MA 3EQLC 3FRPB 1TS4A 2NVXB 4ZAIA 3FPUB 1ZYRD 5JJZA 1B9MA 1GUOA 3V05A 5HGTA 4C3IB 3NTIA 4RHRA 2R6GA 3PV0A 1JORA 4RGMA 3S14B 2NYZD 1WTOA 4IURA 4WORA 1AZPA 3MA2B 3WOFA 4BBRB 2B63B 3S17B 2HDMA 1NCVA 4CKBA 2Z8LA 1SNCA 2A6HD 3MVVA 4A3EB 2F1MA 3N6RA 1U4MA 2CQAA 4C1NI 3VA7A 3LWEA 4X3KA 1SMYC 2B2YC 2DN8A 5K36H 3C1FA 3D4DA 3NTKA 1TT2A 3H0GB 2F0JA 2RA4A 5IGFA 4OHJA 3VYUA 4A93B 4E6IA 1WTVA 1JOKA 1TR5A 1HTLD 2MJ8A 1QILA 2Z4IA 2MP1A 1JICA 4R8IA 3HGBA 3AU7A 2NVYB 3D3RA 1EYDA 1NAPA 4ABNA 2E2IB 2F0QA 3FEWX 3HOVB 3KF8A 3OSOA 3OMCA 2E2JB 4CJ1B 1SNOA 1QNUA 2LS01 3A8KE 2R92B 1YNJD 4TKOB 4K8JA 1KDAA 2LMCB 3CQZB 3MWYW 2R61A 2NBFA 3VR3A 5LHY1 2IX1A 4I7ZC 4BBSB 1SAPA 2F0OA 4CJ0B 1DJRD 1NUCA 3QO2A 3ND8A 5JEAH 3RZOB 1U4LA 2N88A 4N9TA 2QKIC 1JWUD 3MXUA 5F2DA 1UUPA 1V1PA 3M3YB 3NUCA 1PXUA 1U9RA 3IAYA 1GJXA 1SYFA 5DM63 2ZXOA 2JEBI 2B2UA 2AQ3B 5COYA 4EQPA 3NSWA 1O7LA 1M4VA 5EBCA 4BWGB 1CK1A 3T56B 2BCOA 2SNSA 4A3DB 3P75A 3BS1A 1J9OA 1FD7D 2XNAC 4HCSA 4DFAA 3K57A 1E0BA 4QCLA 3QG1A 1B53A 1JB3A 4C2MB 3NP8A 4XT1B 5FLXE 3I90A 4F7XA 1PFNA 1ESFA 2XRSD 2VXWA 2F0PA 4WJWA 4NMZA 2NN6I 4C56C 5M3MB 2AQ1B 1STEA 2TMPA 2OXPA 3E0JA 2EOTA 2KQ3A 2F0TA 1MI2A 4OL7A 4R9WA 1ET6A 1LV9A 1Z7TA 2F03A 2K32A 5FO8B 2XVSA 2JEAI 3MTSA 2IL8A 3ITPA 1FNUA 5KGUA 2EY5A 4RCNA 4K6DA 1F9SA 2KVMA 5KNDA 1D5XC 4CKCA 1CZWA 2XRQD 2F0DA 1EYCA 5JOBA 4F87A 3DUZA 5FO9B 3FMCA 3QOJA 3GTOB 4ZK9B 1O7YA 4DGZA 4HCEA 4RGTA 4IQZA 1VMCA 2WP8J 3JAML 4IUUA 3FPPA 1M8AA 1HPCA 1F77A 4XQNA 3KBGA 3K0YA 2C9OA 1TQOA 4FF4A 1KNAA 5EKLA 4PMWA 4CGYB 4A3KB 4ZLTF 1QCBD 2B2UC 4IFDI 4HN7A 5CV8A 1I50B 2Z4HA 1QOHA 2R7ZB 3VYTA 1Z6HA 1S5FD 1WTXA 3GQBA 1S5BD 2A74C 4MIUA 2FMCA 3NQTA 2L5TA 4KKSA 1IW7C 4F88A 3Q6SA 4BY1B 2JP1A 4ZQ3A 3T51B 1EIHA 1SYBA 4IUNA 5E4WC 3EFXD 1BCPB 2RSNA 1ILQA 4NW2A 1O80A 3J80E 3X3NA 1EQTA 4ZRZA 1IKMA 4G4KA 4BY7B 2ICIA 1EU3A 3EVQA 1EY8A 3GTMB 1SE4A 2H1EA 3SK6A 5C6AA 1HFGA 3SR1A 2Z1CA 3SXHA 1RTOA 2CW0D 3LNNA 2EYMA 1XWEA 1AP0A 3ONAB 3PO3B 3MFYA 4DNRB 2B2VA 3OMGA 3M4OB 1JR0D 1Y8NB 1LTID 1IW7D 2I07B 1XTCD 1F2YA 1SYDA 2NB0A 3E5SA 3QJYA 1F2MA 1DD2A 3BG3A 4RA8A 2VB3X 2NWGA 1MD2D 2F0UA 1WTRA 1Q90A 2LKVA 3PUXA 1SDFA 5E4XA 1MSGA 2KCCA 3H3VC 5ELFA 1GHKA 3G7LA 5ELEA 5LL6X 4U673 1QJOA 3SK5A 1EEID 1E2ZA 5ELCA 1C8CA 2NZ1D 2NTTA 4QUCA 1PLFA 3QWNA 1TY0A 3K5MA 2OT2A 1WCMB 3QOLA 1D1IA 1F2ZA 2L55A 1A3TA 2AUJD 4C3HG 5BN4A 2EZVA 3HOZB 2PQEA 4DU9A 3I70A 5FO7B 1DM0B 3I3CA 3SVMA 1G291 3M7GA 2B2YA 3HOYB 1HFNA 2EY6A 1EZ6A 1KTKA 5M5YB 2EYOA 1FR3A 4L6TB 2M9VA 3A54A 3I4NB 1STGA 1WTQA 1HUNA 3P1HA 1OXXK 1V8QA 2D2CC 3OHXC 1HHVA 3D8GA 1PYWD 3ND9A 2I46A 1TWCB 2F3WA 1ENAA 1AN8A 4K8IA 1PZJD 3J81E 3HOXB 3GTJB 3VYSA 5LL6S 5KRUA 4IUPA 1I4PA 3I73A 4J8QA 1ZYRC 2JE6I 2RQXA 2FINB 3I72A 1PTOC 1WTPA 3CRKC 1LABA 1EY6A 3IKJA 2XN9C 1B4OA 4CJ2C 1OXSC 1KLUD 1DZ1A 4TSSA 2K05A 1F9QA 4WRDA 2LFNA 2Q8IB 4ZUIA 3TP8A 4G7HC 3P20A 3GTLB 2B39A 2AUKA 3SDZA 5CBEE 5A2QL 4A3MB 2F0IA 5KEEA 2K33A 3TP5A 1HA5A 3A7AB 2B2VC 4X3SA 3S2HB 3MEHA 5EQ0A 1GHJA 3TP7A 1AW7A 3K5OA 2R93B 1BO0A 3S1QB 3OOCA 3M85A 1UNSA 1IHZA 4R8NA 3CHBD 2JA7B 1DCZA 1SYEA 5ISRA 3WOEA 3PUVA 3TP6A 1DONA 2SEBD 2QF7A 2D9UA 4TQUS 1SYCA 4K5WA 1PTOD 1GUGA 5CORA 2F0VA 2HUGA 2A5HA 2G9HD 2EJGC 3DWAA 4ODGA 3TMEA 3CKIB 4YIJA 3GTGB 3TDQA 5C0XI 1YNJC 4C3IG 2F0MA 4RCOA 2KA7A 1BUVT 5JEAJ 1FYCA 3MFGA 2O5IC 2C5CA 4OO1G 1F2LA 2PW7A 1LT3D 3SEBA 2KJXA 5DAUA 1DOKA 5KNBA 4KTAA 5D14A 4LMQD 2NVTB 1IKLA 3RD4A 1OXUA 1B3AA 1H9KA 2K04A 2AWNA 2K7VA 3PUYA 5TSSA 3I4LA 1A6XA 1QE6A 1Y1WB 4RAUC 5EKIA 1LT5D 2K03A 3DEOA 4IFDH 1CI3M 1EL0A 2OEOA 2L12A 4RHSA 5J39A 1I6HB 2IW3A 4FF1A 1BF4A 2WAQB 4KHZA 5M3FB 4A3GB 2E74C 4H44C 5IGBA 5C44B 4O42A 3C3LA 3NXWA 1HXYD 1A2TA 2EE1A 1EEFD 1PRTC 2FFKB 2CHBD 4CKEA 3K7AB 3P7JA 2K01A 1LTAD 2D5DA 3HEJA 5CV4A 4N9PA 4BA1I 5K5PA 4KN7C 4ZKBB 2KEEA 3HOWB 3BVZA 1EY7A 2EY1A 5EJWA 1JE4A 2NN6G 1NR2A 1C4QA 2PW5A 1Y1VB 1IL8A 4ME5A 5IGDA 3TSSA 2BDNA 1SEBD 5T1IA 1LT6D 2FJ2A 4ILWA 2DY7A 1GXDC 1ZEQX 4HTHA 5EGTA 1TS5A 3L3OC 2B2TA 4DAYA 4K6LA 3H94A 3IFDA 3V2TA 3HRZC 4IN3A 1PRTD 2RVLA 3KLRA 3NWSA 4K14A 2O4XA 4L63B 1JC7A 1V1PB 4QF4A 5CR3A 4IUTA 3S9WA 4G7ZC 2F0GA 4KK7A 5K36G 2FMMA 4QIWB 2EJFC 4Q0FA 1CTMA 1LLRD 4NP5A 4XTCS 2F4IA 1CT1D 2EYJA 3DM1A 1I4HA 2PZUA 4ULLA 3GP7A 5EBDA 4F8MA 5C4HA 1SFOB 3CRLC 5C3XA 4IALA 4QMGA 1LO5D 4XYQA 3NK9A 2Q8RE 4XQQA 2HDLA 3I8ZA 5IT9E 1GOZA 4BS9A 2SNMA 4IUQA 3BVMA 1VCIA 5I9PA 3RLFA 2A6ED 4RWSC 1PTOH 1PFBA 1SNMA 2D62A 1ET9A 4UAIA 5EPKA 5C3EB 4LJZC 5JEAG 1DOMA 2JYOA 1VDZA 4KD3A 1EFID 2K6AA 2XIWA 3OIPA 2HCCA 2ZXRA 1DOLA 1EYAA 3EA6A 2ZXPA 2CW0C 3M4YA 5C0XJ 2WACA 1JWSD 3S16B 3LWUA 1PDQA 2PZTA 4P2CB 5CV7A 5CYUA 5CV6A 1UEAB 2E75C 1EY5A 3SK4A 1L0XB 3OWEB 1ML0D 1STBA 1G2TA 1B50A 3T16A 1HRJA 2WKCA 1S5DD 3BVGA 1BCPF 1AFPA 1F9PA 1BDOA 3NBHA 5I4DA 2PO4A 1LTGD 4KY5A 1NR4A 3DWPA 5FLXL 5IGGA 3GTPB 1H9JA 1R4PB 3K58A 1MGSA 3BZDB 2JA8B 3S1MB 3GV3A 3E6ZX 1HUMA 4FO2A 2B2TC 4K5VA 3SHLA 1OXTA 1Y8PB 3EROA 3Q22A 4FF3A 4XIGS 1O7ZA 1E2WA 2KCNA 1U4PA 2G9DA 2XSCA 1X3QA 4MHEA 2WV6D 5C4ZA 1JCKB 2F0WA 3K59A 4L8JA 1G2SA 2EYLA 2IWHA 4HSVA 5M9OA 3MC0B 3LX0A 4EGVA 3SE0A 3S1NB 2K5DA 2WKDA 3V96A 4RGOS 1I4QA 3I91A 4AYBB 3ZYYX 3BDLA 5C0XH 3AMUA 2R3ZA 1TIID 5BN5A 1TY2A 3K5LA 3BYTB 2RDHA 1QB5D 3KLSA 3KBXA 5FKAC 1LTRD 3R3OA 1SE3A 4MN3A 3FDTA 1RHPA 4KKUA 3M7NA 4ZKCB 1X32A 1LTSD 2PCFB 1PTOB 1TKWB 1BOSA 1T5XD 2IPKD 3FKIB 1PZKD 1IYUA 5A2QE 1TS2A 4ZYSA 4PMCA 5JPNC 5CV9A 1RDPD 3G6JB 5IGEA 4XT3B 1W6KA 1FGBD 1GUWA 3T53B 1DXMA 2F0NA 2H4OA 4OIKA 5CGKA 2X6GA 2KHSA 2IX0A 2JSOA 1CQFA 4HSPA 3OIQA 3TZDA 5IODA 1H9MA 3J80L 2RDFA 2WIIB 1Q8IA 4XDXA 1KLGD 1U4RA 1LTBD 4G57A 2SOBA 1RTNA 3NTHA 2B8FA 4Q5VA 1C48A 3VR2A 3MAQA 1ILPA 1NSNS 2BE5D 2EXZA 2KUMA 1R9TB 2A68D 5BN3A 1CHPD 3OWFA 3R2TA 5C5LA 3AB9A 3W3AA 5JVG3 1HQMC 5FK9C 1ZKOA 1STAA 1D6EC 1CA6A 3D6CA 3NQIA 4A3IB 2BOSA 2ZT9C 2NUCA 1ENCA 5C0XG 5I6WA 4KJNA 1B44D 5ELBA 3TZUA 1Q12A 2F0LA 4DN4M 2JA5B 1S5ED 5KYIA 5G3LF 1CA5A 1QG7A 4DXGA 3FVQA 3DEPA 1PMRA 3D6WA 2L11A 4IFDJ 2L9HA 5A35A 1VMPA 5C3WA 2KECA 1K8OA 4H13C 5AFWA 3I4MB 3NHHA 1I4RA 3SK8A 4ZUJA 1Q3LA 1ENFA 3Q0AA 1GUSA 2EPBA 1PRTB 4HAEA 3C1EA 1SBBB 2RBMA 4RFBA 4KKTA 4DK1A 2K5WA 2F0FA 5E1FA 5T1GA 3PMFA 4KY7A 2GA4B 3HZXA 3S1RB 3WDNA 1A3VA 5EPLA 5M5WB 4C1NK 4DAVA 3J7AV 2JA6B 1D1KA 3KK7A 2J7ZA 1BBXC 5I6YA 3X3MA 1KNEA 1SNPA 1T5EA 2BA0A 4CBVA 1EY4A 3VR5A 1S4ZA 3GD7A 3DHQA 2IJ0A 4FP5D 1S5CD 4XXEA 1Y69U 4PMBA 1L0YB 2JXMB 1FNVA 3VR4A 3J81L 4G7OC 1D5ZC 1JOQA 2A69D 2V4DA 2HQEA 1H9SA 2QEJC 4FVMA 4Z9CB 3PUWA 3DWQA 2RDGA 3T4AC 4FXGC 2MHVA 3A8IE 5FOBB 4UDUC 1W6JA 2VUMB 3U9SA 3IFTA 4FXKC 2AQ2B 4HR7B 4KV6A 4RH6A 4V0BA 1VF5C 5E3FA 3NWTA 1CZGA 4DA2A 4ID6A 3H09A 2VNUD 2VB2X 3DXJC 3HP3A 1ICWA 2YYZA 1TWFB 2E2DC 3VR6A 3KUPA 3BYYB 4NKLA 4H7BA 1PZID 1DYQA 1B9NA 4KN4C 5I9OA 2K28A 1MBYA 1RODA 3VYRA 1XXGA 4CHTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PW5 A;  4E6I A;  1SNQ A;  2F0H A;  3NHH A;  4EQO A;  2EY2 A;  1JOK A;  4KY6 A;  2SNM A;  5C5M A;  1TR5 A;  4ZUJ A;  3SK8 A;  5IOC A;  3VA5 A;  5CC4 A;  2PW7 A;  5J22 A;  3MZ5 A;  1F2Y A;  1SYD A;  1TQO A;  2RDF A;  3E5S A;  1F2M A;  5I9P A;  5DAU A;  5EKL A;  3BDL A;  3C1E A;  2EYP A;  2RBM A;  2F0U A;  4ME5 A;  4KTA A;  3NP8 A;  5CV5 A;  5IGD A;  2PZW A;  1EY6 A;  4B9X A;  2LKV A;  4G57 A;  2F0F A;  1EY0 A;  5E1F A;  5J1Z A;  4S3S A;  3PMF A;  1EYD A;  4J6H A;  4KY7 A;  3D4W A;  3HZX A;  4F7X A;  4B9W A;  5CV8 A;  5KIX A;  1A3V A;  2SOB A;  5JAV A;  1SNM A;  1II3 A;  1KDC A;  2F0P A;  2F0Q A;  3BDC A;  4NMZ A;  4WRD A;  2EYF A;  2ENB A;  5IIF A;  1SND A;  3OSO A;  3OMC A;  4KD3 A;  5I6Y A;  1SNP A;  4HMI A;  3MHB A;  4HTH A;  5EGT A;  4MIU A;  3NQT A;  1SNO A;  2M00 A;  5EKK A;  3R3O A;  1EY4 A;  4TRD A;  4ZUI A;  3SK5 A;  3TP8 A;  3DHQ A;  4EVO A;  1EYA A;  1EQV A;  3V2T A;  2OXP A;  4K8J A;  4HMJ A;  1KDA A;  5IGC A;  1AEX A;  4J1M A;  5DEH A;  4PMB A;  2WAC A;  1NSN S;  2KQ3 A;  2RKS A;  2F0T A;  2F0I A;  4DF7 A;  5KEE A;  3TP5 A;  2EXZ A;  4OL7 A;  4ZQ3 A;  1JOQ A;  2F0O A;  4KHV A;  2F0S A;  3QOL A;  2OEO A;  1KDB A;  2PZT A;  2HQE A;  1SYB A;  1F2Z A;  2O4X A;  3OWF A;  4IUN A;  1A3T A;  3MEH A;  4K14 A;  1NUC A;  4LAA A;  5CV7 A;  3ERQ A;  5CV6 A;  5C5L A;  3T13 A;  1EY5 A;  3TP7 A;  3SK4 A;  5HGT A;  5J39 A;  4KD4 A;  4K2K A;  3MXP A;  4N9T A;  4RKB A;  2QDB A;  1STB A;  1STA A;  4PNY A;  4QF4 A;  3T16 A;  5F2D A;  5CR3 A;  1A2U A;  2PQE A;  2F0E A;  3D6C A;  3RUZ A;  3ITP A;  4DU9 A;  3S9W A;  2OF1 A;  5IGB A;  4K2L A;  5KGU A;  2EY5 A;  2F0G A;  2NUC A;  1IHZ A;  4WOR A;  3NXW A;  3NUC A;  4K6D A;  3EVQ A;  1A3U A;  1U9R A;  1ENC A;  4R8N A;  1A2T A;  2F0K A;  1JOO A;  4PMC A;  5CV9 A;  1EY8 A;  1SYE A;  1RKN A;  1SYF A;  4KY5 A;  5ISR A;  4KV6 A;  5IGG A;  2F0D A;  3TP6 A;  4EQP A;  1EYC A;  3SK6 A;  2EY6 A;  5C6A A;  5JOB A;  5E3F A;  1EZ6 A;  1SNC A;  2EYO A;  4ID6 A;  3QOJ A;  4KJN A;  4EQN A;  5I6W A;  3MVV A;  4NDX A;  4QB4 A;  1SYC A;  4K5W A;  1STY A;  3SR1 A;  4NP5 A;  4RKL A;  5IGE A;  3SXH A;  4K5V A;  2F0V A;  3SHL A;  4IZ8 A;  1STG A;  1JOR A;  2F0L A;  4K5X A;  2EYJ A;  1KAB A;  1STN A;  3EJI A;  2EYM A;  3ERO A;  5KYI A;  2F0N A;  4ODG A;  3P1H A;  3HEJ A;  3TME A;  2PZU A;  4KJO A;  2SNS A;  4DGZ A;  5HUR A;  4NKL A;  5KYL A;  4H7B A;  4YIJ A;  5CV4 A;  3D8G A;  1EY9 A;  2EYH A;  5NUC A;  5CGK A;  4F8M A;  4N9P A;  2F3W A;  5K5P A;  1ENA A;  3C1F A;  5C4H A;  3P75 A;  3D4D A;  4K8I A;  5C4Z A;  1TT2 A;  2F0W A;  2KHS A;  2F0M A;  3DMU A;  1KAA A;  2EYL A;  1EZ8 A;  3OMG A;  3U9O A;  5C3X A;  5I9O A;  2F0J A;  3H6M A;  1EY7 A;  2EY1 A;  4IAL A;  4I65 A;  4QMG A;  3QB3 A;  4DFA A;  5C3W A;  5KRU A;  5M9O A;  2PYK A;  2F3V A;  1STH A;  3LX0 A;  5IGF A;  1SYG A;  5IOD A;  3NK9 A; 
#chains in the Genus database with same CATH topology
 3AQQ A;  4OO1 I;  4Y7N B;  3L2P A;  1LYL A;  4B3R Q;  2LXK A;  5I2Y A;  1H9S B;  1SSO A;  5CV5 A;  3QIA A;  4HED A;  1RCV D;  4B9X A;  5IYD G;  1F9R A;  4S3S A;  4B9W A;  4H0L C;  5JAV A;  2E5L Q;  2MPM A;  5IY0 A;  3OTO Q;  4NXM Q;  5IWA Q;  4K0K L;  4O2D A;  2EYF A;  1X3F A;  1X3P A;  3TN2 A;  1X9N A;  4RGN A;  3MXN A;  1JQY D;  1SMY D;  3A55 A;  1A15 A;  3S15 H;  1SE2 A;  3NBI A;  4EVO A;  3HOW G;  2Z0S A;  1V1O A;  4A3J B;  2EVB A;  1KXL A;  1K83 B;  1XNQ L;  1G6Z A;  3TBI B;  3BDO A;  1K9M C;  1FNW A;  1VQJ A;  4GZY C;  1TVX A;  3Q24 A;  3OTO L;  4DXF A;  1GUT A;  4UHV A;  3PIP 3;  3JAM E;  1SJH D;  3T13 A;  3ERQ A;  1B2T A;  2PI2 A;  1A62 A;  1I4X A;  1KRT A;  2QDB A;  1KAW A;  1Q1B A;  3O13 A;  1I3Q B;  4QUF A;  4JYA L;  2Q8T A;  1L1O A;  1LT4 D;  4DV0 Q;  3T1H L;  4L5T A;  2PPB C;  2A6E C;  3CC2 A;  1RL2 A;  4A3B H;  4IOA A;  3GTQ B;  2J0T D;  1O78 A;  5G3L D;  3VDY A;  3HKZ B;  4JV5 Q;  1HQR D;  4EX5 A;  1SMX A;  2V1C C;  2XWB B;  1SJE D;  3TRZ A;  4DV1 L;  1V1Q A;  3EJI A;  4GOP A;  1WTW A;  1VQL A;  5C4J H;  2JJQ A;  5HUR A;  3L9A X;  3JC6 6;  2MUY A;  5NUC A;  1EIY B;  1TWH B;  1WVL A;  1LAC A;  1HR0 W;  3MXN B;  3S1N H;  1KAA A;  2EJM A;  2MGS A;  4KMU C;  3U9O A;  3H6M A;  3PUZ A;  1XYI A;  3QB3 A;  3R93 A;  4KI0 A;  2F3V A;  1GM5 A;  4RMF A;  2GVA A;  1L0W A;  1SNQ A;  2A73 B;  4GKK L;  5C5M A;  4IJL A;  1XX8 A;  3G6E A;  5C4X H;  4KHP Q;  1E2V A;  3ZJY C;  1YNN C;  2EYP A;  3KLS X;  3QR8 A;  4R4O A;  4A3F B;  4LF9 Q;  2BDO A;  1UWV A;  2ID0 A;  4IFD G;  4J6H A;  3KF6 A;  1II3 A;  1KDC A;  1HA6 A;  2EDG A;  1N36 Q;  3BDC A;  1L1O B;  1ZXT A;  3RZD H;  2ENB A;  3PO2 B;  1H95 A;  2DY8 A;  3MHB A;  1BQQ T;  1ICF B;  4LFC Q;  4B3S L;  1PH2 A;  1G91 A;  5I2X A;  1EQV A;  1TWG H;  3GTK H;  4OGQ C;  1AEX A;  2NTS A;  5DEH A;  4LF9 L;  1EOT A;  3K5N A;  1LTT D;  1NY4 A;  2DNC A;  4R1J A;  2HD3 A;  1PYS B;  4B08 A;  3J7A F;  4DR6 Q;  1E1T A;  4JI7 Q;  4KHV A;  4GOP B;  2WB1 B;  3W2D A;  3S2D H;  4DV5 L;  1TWA H;  2CVR A;  2ICE C;  2RF4 A;  2IX3 A;  3J7Y W;  4K2K A;  4LFC L;  1D2B A;  3MXP A;  4RKB A;  1VF7 A;  1PFM A;  5IYC H;  2YU9 H;  2SDF A;  3CC4 A;  2OF1 A;  2WB1 G;  3ULP A;  4DR3 Q;  4A3C H;  5C3E G;  1I94 Q;  2VQF L;  1LTL A;  3HS0 C;  4DR6 L;  4JI7 L;  1XPU A;  3K80 C;  1S3O A;  3A8J E;  3S15 B;  2K1B A;  4C3H H;  3CC7 A;  4FYD A;  1Z9F A;  1STY A;  1QVC A;  1H9R A;  1JMC A;  4DUY L;  4M1U B;  2Z6B A;  4IZ8 A;  2M2L A;  4K5X A;  3UDG A;  3KOJ A;  1YNN D;  4XYO A;  2N55 A;  2TSS A;  3TS2 A;  1CFM A;  4O1N A;  1X55 A;  5JJK A;  3KF6 B;  4GNX A;  3HOU H;  2E76 C;  3U50 C;  5JPM C;  3J81 j;  3PIO 3;  4AIM A;  4DNI A;  4X64 L;  5IE8 A;  1XJV A;  1MKH A;  4OIJ A;  1JE5 A;  4DV4 Q;  1EZ8 A;  5M5X H;  1FJG Q;  2BA1 A;  5EPJ A;  2PYK A;  2ZTD A;  1Z47 A;  1XPR A;  1STH A;  4X62 L;  4EQO A;  4DK3 C;  4A3B B;  1NNX A;  5IOC A;  2K75 A;  2K5Q A;  4I7A A;  1Q1E A;  2JA8 G;  1RJT A;  1J8I A;  4JK1 C;  1FJG L;  5KIX A;  5D3D A;  5C4J B;  4LK1 C;  3K8A A;  4X6A H;  1HCZ A;  2HIX A;  3GO5 A;  2X6L A;  1SND A;  3UDI A;  5JVH 3;  1CM9 A;  2PNR C;  4GOP C;  1ESR A;  2AHO B;  3D4R A;  1WD0 A;  4TRD A;  3IL8 A;  1QNK A;  1AZQ A;  1KQS A;  4EQ5 A;  4HMJ A;  5CBA E;  4DK0 A;  3CU7 A;  2B2W A;  2RKS A;  4DF7 A;  1EWC A;  4CDE C;  5D65 A;  2AWO A;  3HG9 A;  2IT1 A;  1HNW L;  4C3J H;  2PMZ B;  5C4X B;  5FLM G;  4GNX B;  1HH2 P;  4KD4 A;  4P72 A;  1G8Z D;  5IT9 L;  3OPO A;  1XMO Q;  4PNY A;  1A2U A;  4K2L A;  5C4X G;  3NE5 B;  1YEZ A;  1PTO F;  1CQV A;  3RZD B;  2KOL A;  1A3U A;  1YBY A;  2F0K A;  1JOO A;  1RD9 D;  3FHW A;  3GV6 A;  4P71 A;  3A7L A;  1I6V C;  5CMD A;  4LUO A;  1TWG B;  2E2H H;  4EQN A;  1EWI A;  3GTK B;  1LM0 A;  1ASY A;  3L7Z C;  4JCV E;  3R8B A;  1Y8O B;  4FF2 A;  1KAB A;  1STN A;  1WD1 A;  2UXC Q;  3S2D B;  2XWJ B;  4MZ9 A;  1TWA B;  1VQB A;  5KYL A;  1EY9 A;  2EYH A;  2WIN B;  2YU9 B;  4FNF A;  1RF2 D;  1IYV A;  3DMU A;  2I5L X;  4PV1 C;  1EWH A;  2NVQ H;  2BE5 C;  2EQS A;  3D31 A;  2KED A;  1K0R A;  4DR1 Q;  4WJ3 M;  2NVX H;  2A68 C;  1OXV A;  5IYC G;  1BNZ A;  2F0H A;  5D3I B;  1HTP A;  3OW7 A;  1VQ5 A;  4QL5 A;  3VA5 A;  1BCP C;  5CC4 A;  1KRS A;  2B8G A;  4BA2 I;  5L37 A;  4C3H B;  2DNE A;  2DGY A;  4C3I H;  1JWM D;  2J4X A;  5HY6 A;  1EY0 A;  1KL9 A;  4L5R C;  1TU2 B;  1PH7 A;  3S14 H;  3U58 A;  2L1B A;  4X3T A;  3HOU B;  5AJ3 Q;  3GDE A;  1O7I A;  3A56 A;  1VQI A;  5IIF A;  2Z6K A;  2F52 A;  4BBR H;  2B63 H;  3S17 H;  4OO1 H;  2O5J C;  5EKK A;  4JPB W;  2BH8 A;  2KCM A;  4U68 A;  4BXX H;  5M5X B;  3UE1 A;  4WFN 3;  1CHQ D;  2DJG C;  3Q23 A;  1EU4 A;  4DV3 L;  1BR9 A;  4A3E H;  4GN3 B;  2RSO A;  2QCP X;  3K6O A;  4GLV B;  1VQG A;  2HCI A;  1NTG A;  4JI8 L;  2F0S A;  1KDB A;  4GN5 A;  4LAA A;  2WAQ E;  4QY7 A;  2QIL A;  5E7N A;  1X65 A;  1UAP A;  3BU2 A;  2X69 A;  3RUZ A;  5DNF A;  1MIU A;  2F0E A;  3H0G H;  4V19 0;  1YHB A;  1D5M C;  3F2U A;  4RG1 A;  1RKN A;  2JK8 A;  4JG2 A;  4X3U A;  2O2L D;  1GUN A;  3C46 A;  5ELD A;  5DM7 3;  1HR0 Q;  3RMH A;  1TS3 A;  4NDX A;  4QB4 A;  4PQX A;  1B1Z A;  3IRB A;  1P8L A;  2L4N A;  2XGT A;  4RKL A;  3UI2 A;  1BCP D;  1SXT A;  3NPP A;  1V43 A;  1C9O A;  1VQ4 A;  2NVY H;  4C3J B;  3W5O A;  4JBW A;  2E2I H;  4LF4 L;  2P5Z X;  4KJO A;  2Y0S B;  1Q86 C;  2B2W C;  4A76 A;  4DV7 Q;  2A8V A;  2E2J H;  4JI0 Q;  1OO9 B;  1MJE A;  1R4Q B;  4C3J G;  5KNC A;  4GKJ L;  3MXG A;  3H91 A;  4NXN Q;  2R92 H;  4LFB L;  4I65 A;  1QVF A;  1QWY A;  3URY A;  4FXD A;  1SYG A;  3CQZ H;  2A69 C;  1EIG A;  2A6H C;  2EY2 A;  3K81 C;  4KY6 A;  1WI5 A;  3ICE A;  1K8M A;  5J22 A;  2E2H B;  3MZ5 A;  1BXT A;  3MEF A;  4XQJ A;  2ZM6 L;  3C2P A;  1OTC A;  4DV7 L;  1N8R C;  2RHQ B;  3RZO H;  4JI2 L;  4IUV A;  2PZW A;  1AE3 A;  5J1Z A;  1PH3 A;  3D4W A;  3R2I A;  4DR2 Q;  2JA5 G;  1YI2 A;  2L0C A;  2KCT A;  1MSH A;  2NN6 H;  4M8A A;  1PRT F;  2LY7 A;  3N52 A;  3M3Y H;  2B3G A;  4A3J H;  3CW2 C;  4HMI A;  4DAP A;  2RCN A;  2M00 A;  2CKZ B;  1I4G A;  4DNT B;  2NVQ B;  4LF6 L;  1N34 Q;  4DR5 Q;  1VQH A;  2FHT A;  5IGC A;  1ONL A;  4J1M A;  3EQL C;  3FRP B;  1TS4 A;  2NVX B;  4ZAI A;  4DR2 L;  1HZA A;  4NB3 A;  3CAM A;  3FPU B;  1ZYR D;  1K3R A;  5JJZ A;  1B9M A;  1GUO A;  2IHF A;  5LMU L;  3V05 A;  5HGT A;  1CKO A;  3FP9 A;  4A3D H;  4C3I B;  3NTI A;  4RHR A;  2BH2 A;  2R6G A;  3PV0 A;  4KLK A;  1JOR A;  4RGM A;  3S14 B;  2NYZ D;  4YCW A;  1WTO A;  4IUR A;  3GTQ H;  4WOR A;  1AZP A;  3MA2 B;  1JJ2 A;  2JA6 G;  3WOF A;  4BBR B;  2B63 B;  4QIW E;  3S17 B;  2HDM A;  1NCV A;  5IP9 H;  4CKB A;  2Z8L A;  4IPG A;  1SNC A;  2Z6K C;  2A6H D;  3MVV A;  4A3E B;  4C2M H;  2F1M A;  3N6R A;  1U4M A;  2CQA A;  4C1N I;  4AQY Q;  3VA7 A;  3LWE A;  4X3K A;  1XMQ L;  5BR8 L;  4NPS A;  1SMY C;  2B2Y C;  2DN8 A;  5K36 H;  3J7Z C;  4UPA A;  3C1F A;  2JN4 A;  3D4D A;  3NTK A;  3T1Y Q;  1TT2 A;  3H0G B;  5M3M H;  2ATW A;  2F0J A;  2KHJ A;  1PHJ A;  3OYY A;  2RA4 A;  5IGF A;  2N8N A;  2VUM G;  4OHJ A;  3VYU A;  3D0F A;  4A93 B;  4AQY L;  4E6I A;  4LF5 L;  1WTV A;  1JOK A;  2ZJR A;  1TR5 A;  1NE3 A;  1HTL D;  3PQI A;  2MJ8 A;  4X66 L;  1QIL A;  2Z4I A;  3T1Y L;  2MP1 A;  1JIC A;  4R8I A;  3HGB A;  3AU7 A;  2NVY B;  3D3R A;  1EYD A;  1NAP A;  4ABN A;  2E2I B;  1VQ6 A;  3S24 A;  2F0Q A;  3FEW X;  3HOV B;  3KF8 A;  3OSO A;  3OMC A;  4JI1 L;  2E2J B;  2D0O A;  4K0K Q;  3K0X A;  4CJ1 B;  1SNO A;  1QNU A;  2LS0 1;  3A8K E;  2R92 B;  2LSS A;  3A5Z B;  1B70 B;  1YNJ D;  4TKO B;  4K8J A;  4OWW B;  1KDA A;  3GTO H;  3DM3 A;  2LMC B;  3CQZ B;  5IP7 H;  2JQO A;  3MWY W;  2R61 A;  2NBF A;  3VR3 A;  5LHY 1;  2IX1 A;  4I7Z C;  3F1Z A;  4BBS B;  1XNQ Q;  1VQ8 A;  1SAP A;  4HIO A;  1A0I A;  2F0O A;  4CJ0 B;  2LXJ A;  1DJR D;  1NUC A;  3QO2 A;  3ND8 A;  5JEA H;  2N78 A;  4JBM A;  3RZO B;  4X65 L;  1WYD A;  1U4L A;  2N88 A;  4N9T A;  2QKI C;  1JWU D;  3MXU A;  5F2D A;  1UUP A;  2VQE L;  1V1P A;  3M3Y B;  3NUC A;  1VQ7 A;  1PXU A;  1U9R A;  3IAY A;  4JI6 L;  4JYA Q;  1EFW A;  2CQO A;  1GJX A;  1SYF A;  5DM6 3;  2ZXO A;  2JEB I;  3T1H Q;  2B2U A;  2AQ3 B;  5COY A;  4EQP A;  3G4S A;  3I7F A;  4LWC A;  3NSW A;  1PH8 A;  1O7L A;  4A3J G;  4A3K H;  1M4V A;  5EBC A;  1QZH A;  5FJ8 H;  1WJJ A;  2OQK A;  1CK1 A;  4JVZ A;  3T56 B;  4BWG B;  3CCL A;  4DV1 Q;  2BCO A;  1I50 H;  2SNS A;  4CDF C;  4A3D B;  2R7Z H;  4R4I A;  3KF8 B;  3P75 A;  4DKA C;  3BS1 A;  1J9O A;  3CMA A;  1FD7 D;  2XNA C;  4HCS A;  4DFA A;  3CD6 A;  4BY1 H;  1U0L A;  3K57 A;  4AYB E;  1E0B A;  4QCL A;  1Q82 C;  3QG1 A;  4GKK Q;  1B53 A;  1JB3 A;  4C2M B;  3NP8 A;  3HKZ G;  3PIP A;  4XT1 B;  2VS1 A;  5GAG C;  1VQN A;  4LF7 L;  1HZC A;  5FLX E;  3I90 A;  4F7X A;  1PFN A;  1ESF A;  1JB7 A;  2XRS D;  2VXW A;  2F0P A;  4WJW A;  4IPC A;  1M90 C;  4NMZ A;  4ZCK A;  3PF5 A;  2NN6 I;  4C56 C;  3G48 A;  3GTM H;  3CXC A;  4A3L H;  5M3M B;  1S72 A;  4LUV A;  2AQ1 B;  1STE A;  4B3S Q;  2TMP A;  2OXP A;  3E0J A;  4YCV A;  2EOT A;  2KQ3 A;  2F0T A;  1MI2 A;  2MFI A;  4OL7 A;  2AMC B;  2H5X A;  4R9W A;  4JI4 L;  1ET6 A;  4IPD A;  1LV9 A;  1YZ6 A;  1Z7T A;  2F03 A;  2K32 A;  3PO3 H;  5FO8 B;  4DV5 Q;  2XVS A;  1GD7 A;  3KLW A;  4A3F G;  2JEA I;  3MTS A;  2IL8 A;  2UU9 L;  3ITP A;  1FNU A;  1C0A A;  3M4O H;  5KGU A;  2EY5 A;  4RCN A;  1JT8 A;  4K6D A;  1F9S A;  2KVM A;  5KND A;  1D5X C;  3PO2 G;  4CKC A;  1CZW A;  2CWA A;  2VQF Q;  2XRQ D;  2F0D A;  4OEM B;  1EYC A;  3G71 A;  5JOB A;  4F87 A;  3DUZ A;  3ER0 A;  5FO9 B;  3FMC A;  3QOJ A;  3GTO B;  3E9H A;  4ZK9 B;  5IYB H;  3F2C A;  4DUY Q;  5GQO A;  1O7Y A;  4DGZ A;  4HCE A;  2QDL A;  4RGT A;  4IQZ A;  3J80 i;  2N3S A;  4JI5 L;  1VMC A;  4X64 Q;  2WP8 J;  1C7Y A;  3JAM L;  4IUU A;  3FPP A;  2ES2 A;  1M8A A;  1HPC A;  4X62 Q;  1F77 A;  1VQA A;  4XQN A;  3KBG A;  3K0Y A;  2C9O A;  1WCM H;  5JJL A;  4POF A;  1TQO A;  2CWP A;  2K5V A;  4JOI A;  4FF4 A;  2VW9 A;  1KNA A;  5EKL A;  3J80 c;  4PMW A;  4CGY B;  4A3K B;  1IBK Q;  4ZLT F;  1QCB D;  2B2U C;  5GAE C;  1EQR A;  5GAD C;  3HOZ H;  4IFD I;  4HN7 A;  5CV8 A;  4JBK A;  1I50 B;  3NEN A;  2Z4H A;  1QOH A;  2R7Z B;  3VYT A;  1Z6H A;  1S5F D;  3CCR A;  1WTX A;  3GQB A;  1S5B D;  2A74 C;  4MIU A;  2FMC A;  3NQT A;  3CME A;  2L5T A;  3HOY H;  4KKS A;  1IW7 C;  4F88 A;  3Q6S A;  5M5Y H;  1IBK L;  4BY1 B;  4ALP A;  2JP1 A;  3L0O A;  4ZQ3 A;  4A3B G;  3T51 B;  1EIH A;  1SYB A;  4IUN A;  1HNW Q;  5E4W C;  3EFX D;  1BCP B;  2RSN A;  1TWC H;  1ILQ A;  2C35 B;  4NW2 A;  3PIO A;  1UEB A;  1D7Q A;  3E3X A;  1O80 A;  3RLN A;  3HOX H;  3J80 E;  3GTJ H;  3X3N A;  1EQT A;  4ZRZ A;  1IKM A;  4G4K A;  4BY7 B;  2ICI A;  1EU3 A;  3EVQ A;  2ALY B;  1EY8 A;  3GTM B;  3A0J A;  1SE4 A;  2H1E A;  1N33 L;  3SK6 A;  5C6A A;  4GLA C;  2CH4 A;  1HFG A;  3SR1 A;  4DR4 Q;  2Z1C A;  3SXH A;  2QGQ A;  1RTO A;  3SGI A;  2CW0 D;  3LNN A;  2EYM A;  2RCF A;  1X3G A;  1XWE A;  1AP0 A;  3ONA B;  3PO3 B;  3MFY A;  4DNR B;  2PQA A;  2B2V A;  2VL6 A;  3OMG A;  3M4O B;  1PH9 A;  1HNX Q;  2NZO A;  2XTI A;  3GTL H;  4DR4 L;  1JR0 D;  4A4I A;  1Y8N B;  1LTI D;  1IW7 D;  4APV A;  2I07 B;  3H3V I;  3A74 A;  3TRE A;  1XTC D;  1F2Y A;  3QJY A;  1SYD A;  2NB0 A;  3E5S A;  4YHH Q;  1F2M A;  5EAY A;  3BG3 A;  4RA8 A;  1Y14 B;  3S2H H;  1DD2 A;  2VB3 X;  2NWG A;  1MD2 D;  2F0U A;  1WTR A;  1Q90 A;  2R93 H;  2LKV A;  2ZJQ A;  4UP9 A;  3PUX A;  1SDF A;  1HNX L;  3S1Q H;  1VQF A;  1MHW C;  5E4X A;  1MSG A;  2KCC A;  3H3V C;  3J81 i;  5ELF A;  1GHK A;  3G7L A;  2I5M X;  5ELE A;  2JA7 H;  5LL6 X;  4U67 3;  5IYB G;  1QJO A;  3SK5 A;  4YHH L;  4P74 A;  1J5E L;  1EEI D;  1E2Z A;  5ELC A;  1C8C A;  2NZ1 D;  1U5K A;  2NTT A;  1LUZ A;  4QUC A;  3RN2 A;  4A3C G;  1PLF A;  3QWN A;  1EYG A;  1TY0 A;  4DV3 Q;  1A8V A;  2A19 A;  2HIV A;  3K5M A;  4DPG A;  2OT2 A;  1WCM B;  3QOL A;  1D1I A;  4DR7 L;  1F2Z A;  2L55 A;  1A3T A;  1Q46 A;  4R4Q A;  1HZ9 A;  4JI8 Q;  2AUJ D;  4C3H G;  2MQH A;  3GTG H;  1N9W A;  1YHQ A;  1KC8 C;  5BN4 A;  2UUB Q;  2EZV A;  3HOZ B;  2PQA B;  2PQE A;  1L2F A;  4DU9 A;  3I70 A;  5FO7 B;  4JOI C;  1DM0 B;  1VQP A;  4QQB X;  1NMF A;  3HOU G;  1VS0 A;  3I3C A;  2NZH A;  3PGZ A;  3SVM A;  4IOC A;  1G29 1;  3M7G A;  2B2Y A;  3HOY B;  1HFN A;  3U4Z A;  2EY6 A;  1EZ6 A;  1KTK A;  5M5Y B;  2EYO A;  4WJ4 A;  1FR3 A;  2CFM A;  1XTD A;  4L6T B;  2M9V A;  4LW1 A;  2UUB L;  1IBL Q;  3A54 A;  3I4N B;  3W1B A;  1STG A;  1WTQ A;  1HUN A;  2NVT H;  1AH9 A;  1EUJ A;  4P73 A;  3P1H A;  1OXX K;  1V8Q A;  2D2C C;  3OHX C;  2ZJP A;  1HHV A;  3AFQ A;  3D8G A;  4LF4 Q;  1PYW D;  3ND9 A;  2I46 A;  1E1O A;  1TWC B;  2F3W A;  1ENA A;  1AN8 A;  4UP7 A;  4K8I A;  1PZJ D;  3J81 E;  4A93 H;  1Y1W H;  3HOX B;  3GTJ B;  3VYS A;  5LL6 S;  1YIT A;  5KRU A;  4IUP A;  1IBL L;  4GKJ Q;  1I4P A;  4LFB Q;  3I73 A;  4J8Q A;  1ZYR C;  2JE6 I;  2RQX A;  4CDC C;  2FIN B;  3I72 A;  2EXD A;  5DLQ E;  2I0Q A;  1PTO C;  1EQQ A;  1PH4 A;  2N49 A;  3HOX G;  1WTP A;  3CRK C;  2ZM6 Q;  1I6H H;  1LAB A;  3CPW A;  3HOV H;  1EY6 A;  3IKJ A;  2XN9 C;  4JI2 Q;  5M3F H;  4A3G H;  2R7F A;  1B4O A;  4CJ2 C;  1OXS C;  5C44 H;  1KLU D;  1QVG A;  1DZ1 A;  4TSS A;  2UXB L;  2K05 A;  1F9Q A;  2Y0S G;  4WRD A;  2LFN A;  2Q8I B;  2OTL A;  4ZUI A;  4BBS H;  3TP8 A;  4G7H C;  1BBW A;  3P20 A;  3GTL B;  2B39 A;  2AUK A;  3SDZ A;  5CBE E;  5A2Q L;  4A3M B;  4LF6 Q;  1E3P A;  2F0I A;  4N8F A;  5KEE A;  2K33 A;  3TP5 A;  1HA5 A;  3AEV A;  1CSQ A;  3A7A B;  2B2V C;  4X3S A;  2IY5 B;  1JJC B;  1WFQ A;  3A5U A;  3K7A H;  3S2H B;  1T9H A;  3MEH A;  5EQ0 A;  3UDF A;  3CCV A;  1GHJ A;  3TP7 A;  1AW7 A;  3M9B A;  3K5O A;  1PVO A;  2R93 B;  2K50 A;  5LMU Q;  2GVB A;  1BO0 A;  4JBJ A;  3S1Q B;  3OOC A;  3M85 A;  2VZA A;  3E0E A;  1UNS A;  3HOW H;  1IHZ A;  4JI3 Q;  4R8N A;  4L5S A;  3CHB D;  2JA7 B;  1HZB A;  3NEM A;  3KDF A;  1DCZ A;  1SYE A;  5ISR A;  3HKZ E;  3WOE A;  1KD1 C;  3PUV A;  3TP6 A;  1DON A;  1Y1V H;  2SEB D;  2QF7 A;  2D9U A;  4TQU S;  1SYC A;  4K5W A;  1N32 L;  1PTO D;  2JA7 G;  1BBU A;  1GUG A;  5COR A;  2F0V A;  1VQC A;  4YY3 Q;  4PG3 A;  2HUG A;  4AH6 A;  3CP0 A;  2A5H A;  2G9H D;  2EJG C;  3DWA A;  4DV6 L;  4ODG A;  4JI3 L;  3TME A;  3CKI B;  4YIJ A;  3GTG B;  3TDQ A;  1XMQ Q;  5C0X I;  1DGS A;  1YNJ C;  5BR8 Q;  4C3I G;  2DJF C;  3I55 A;  2F0M A;  4RCO A;  2KA7 A;  1BUV T;  4HJ7 A;  5JEA J;  1FYC A;  2HQL A;  3M4P A;  3H15 A;  3MFG A;  1K28 A;  4YY3 L;  4BBR G;  1QUQ A;  2B63 G;  2O5I C;  2C5C A;  4OO1 G;  1F2L A;  1HJP A;  4N8X 1;  4BXX G;  2PW7 A;  1LT3 D;  3SEB A;  2UUC Q;  2KJX A;  4LF5 Q;  5DAU A;  4JW0 A;  1DOK A;  1IZ6 A;  5KNB A;  1FVI A;  4KTA A;  5D14 A;  4YWK A;  4A3E G;  4X66 Q;  4LMQ D;  3DLL A;  5JJI A;  2NVT B;  1IKL A;  3RD4 A;  1OXU A;  1YVC A;  1Q7Y C;  1B3A A;  1H9K A;  2FXQ A;  2K04 A;  2AWN A;  2ASB A;  2K7V A;  3PUY A;  5TSS A;  4POG A;  3KDF B;  3I4L A;  4GS3 A;  1A6X A;  1QE6 A;  4LUZ A;  4JI1 Q;  1Y1W B;  2UUC L;  4IJH A;  1XNR L;  4RAU C;  3H0G G;  5EKI A;  2UXD L;  3AFP A;  1LT5 D;  2WB1 E;  2ZTC A;  2K03 A;  3DEO A;  4IFD H;  4A93 G;  1CI3 M;  1EL0 A;  1Y1W G;  2OEO A;  2L12 A;  4RHS A;  5J39 A;  4B3M L;  1I6H B;  1K3B C;  2IW3 A;  4LF8 Q;  4FF1 A;  3CCU A;  1BF4 A;  4X65 Q;  2WAQ B;  4KHZ A;  5M3F B;  1SFO H;  2E74 C;  1M1K C;  1NMG A;  4H44 C;  4A3G B;  5IGB A;  5C44 B;  1XPO A;  4O42 A;  3C3L A;  4GLX A;  3NXW A;  1HXY D;  1A2T A;  4H02 A;  3HOV G;  3HFZ B;  2VQE Q;  2Q2T A;  2EE1 A;  1EEF D;  1QUQ B;  2WAQ G;  4JI6 Q;  1PRT C;  2KEN A;  2R92 G;  4LF8 L;  4P75 A;  1S40 A;  1SE8 A;  2FFK B;  2CHB D;  4BBS G;  4CKE A;  1UE1 A;  3K7A B;  3P7J A;  2K01 A;  1LTA D;  2D5D A;  3HEJ A;  5C3E H;  5CV4 A;  4N9P A;  4BA1 I;  5K5P A;  4MNO A;  4KN7 C;  3CCJ A;  4ZKB B;  2KEE A;  2WFW A;  3HOW B;  3BVZ A;  1EY7 A;  2EY1 A;  5EJW A;  5FLX c;  1IL2 A;  1JE4 A;  2NN6 G;  1NR2 A;  1C4Q A;  2E8G A;  3S16 H;  2PW5 A;  3UDX A;  4B3R L;  4YCU A;  1Y1V B;  1B8A A;  1IL8 A;  1UE6 A;  4ME5 A;  4GN4 B;  5IGD A;  1E7Z A;  4OWX B;  3TSS A;  2E5L L;  2BDN A;  1SEB D;  4NXM L;  5IWA L;  1Y1V G;  1SN8 A;  5T1I A;  1LT6 D;  4LF7 Q;  2FJ2 A;  2CCZ A;  4ILW A;  3PF4 A;  2DY7 A;  1GXD C;  4A3D G;  5HGQ A;  1ZEQ X;  3AYH B;  4HTH A;  5EGT A;  3EBE A;  1TS5 A;  3H3V H;  3L3O C;  2B2T A;  4DAY A;  3GTP H;  1A63 A;  4K6L A;  3H94 A;  3IFD A;  3I56 A;  3V2T A;  2JA8 H;  3S1M H;  1GKH A;  3HRZ C;  4IN3 A;  1PRT D;  2PMZ E;  2RVL A;  4LNQ A;  4QGU A;  3KLR A;  3NWS A;  5IP9 G;  4HJ9 A;  4K14 A;  2O4X A;  2DUD A;  4L63 B;  4JI4 Q;  1JC7 A;  1V1P B;  1WTH A;  1UE7 A;  4BY7 H;  3M4Q A;  4QF4 A;  5CR3 A;  4IUT A;  3S9W A;  5IT9 c;  4DV0 L;  4G7Z C;  2F0G A;  4KK7 A;  2UU9 Q;  1VQO A;  5K36 G;  1PH1 A;  5ELN A;  2FMM A;  1E22 A;  1K73 C;  5M3M G;  4QIW B;  5FLM H;  4LFA Q;  3PCO B;  2EJF C;  4JV5 L;  2OQ0 A;  4Q0F A;  3STB C;  1CTM A;  4J15 A;  3I2Z A;  1LLR D;  4NP5 A;  2K14 A;  2MO1 A;  2F4I A;  2Z9H A;  4XTC S;  1CT1 D;  2EYJ A;  3DM1 A;  3RR5 A;  1I4H A;  1PH5 A;  4O0A A;  1SRO A;  3HKS A;  2PZU A;  2YTY A;  4ULL A;  4UY8 C;  3GP7 A;  5EBD A;  4F8M A;  1NJI C;  5C4H A;  3UE0 A;  3I4O A;  1SFO B;  4LFA L;  3CRL C;  4DAY B;  3WWV A;  5C3X A;  1WOC A;  4JI5 Q;  4IAL A;  4QMG A;  2K5H A;  4OWT B;  3KFU A;  1LO5 D;  4XYQ A;  1VQ9 A;  3NK9 A;  2Q8R E;  4XQQ A;  2HDL A;  3I8Z A;  5IT9 E;  1GOZ A;  4BS9 A;  2SNM A;  4IUQ A;  4KHP L;  3TQY A;  1JJG A;  3BVM A;  2KHI A;  1VCI A;  1VQE A;  5I9P A;  3RLF A;  2A6E D;  4RWS C;  1PTO H;  5IP7 G;  1CUK A;  5H1S E;  3CF5 A;  1PFB A;  3FKI H;  2F4V Q;  1CKN A;  2PNH A;  1N36 L;  1SNM A;  2D62 A;  1ET9 A;  4UAI A;  5EPK A;  5C3E B;  4LJZ C;  5JEA G;  2OWO A;  1DOM A;  2JYO A;  1VDZ A;  4KD3 A;  1EFI D;  2K6A A;  2XIW A;  3OIP A;  2HCC A;  2ZXR A;  1DOL A;  1EYA A;  3EA6 A;  2ZXP A;  2CW0 C;  3M4Y A;  1J6Q A;  5C0X J;  2WAC A;  2F4V L;  2YV5 A;  1JWS D;  3S16 B;  3LWU A;  1V9P A;  1Q81 C;  3KYH C;  3STB D;  1PDQ A;  1B7Y B;  2PZT A;  4P2C B;  5CV7 A;  5CYU A;  5CV6 A;  3CCS A;  1UEA B;  2E75 C;  1EY5 A;  1X56 A;  3SK4 A;  1L0X B;  3OWE B;  1ML0 D;  2YTX A;  4A3K G;  1STB A;  1G2T A;  1SR3 A;  1B50 A;  5FJ8 G;  3T16 A;  1HRJ A;  4DR3 L;  1GO3 E;  2WKC A;  3NEL A;  1S5D D;  5ELO A;  1YJN A;  1KIX A;  2VY3 A;  1I94 L;  3BVG A;  1BCP F;  1AFP A;  1F9P A;  1BDO A;  2R7Z G;  3NBH A;  5I4D A;  2PO4 A;  1LTG D;  4KY5 A;  1NR4 A;  3DWP A;  1E24 A;  5FLX L;  3I4N H;  5IGG A;  3GTP B;  4DV2 Q;  1H9J A;  2K4K A;  1PYB A;  1R4P B;  3K58 A;  1X6O A;  1MGS A;  4YWM A;  4HJ5 A;  3BZD B;  2JA8 B;  1K8A C;  4UP8 A;  3S1M B;  1N33 Q;  2G5D A;  3GV3 A;  3E6Z X;  1HUM A;  4FO2 A;  4BY1 G;  2B2T C;  4K5V A;  3SHL A;  3U4V A;  2Y0S E;  1OXT A;  1CKN B;  4MTN A;  1Y8P B;  3ERO A;  1L1O C;  3Q22 A;  4FF3 A;  4XIG S;  1O7Z A;  1E2W A;  2KCN A;  1U4P A;  2G9D A;  2XSC A;  1D8L A;  1X3Q A;  2MNA A;  4MHE A;  4DV2 L;  4DV4 L;  2WV6 D;  5C4Z A;  1JCK B;  2F0W A;  3K59 A;  4L8J A;  3BJU A;  1G2S A;  2EYL A;  2IWH A;  3KJP A;  4HSV A;  5LMN Q;  3OW2 A;  4R4C A;  5M9O A;  4IO9 A;  2A1A A;  3MC0 B;  3LX0 A;  4EGV A;  4BY7 G;  3SE0 A;  2ZTE A;  3S1N B;  3RNU A;  2K5D A;  2WKD A;  4A3L G;  1R9T H;  3V96 A;  1ASZ A;  4RGO S;  1I4Q A;  3I91 A;  1PV4 A;  4AYB B;  3CCE A;  1YIJ A;  1BVS A;  3ZYY X;  1YJW A;  3BDL A;  3RLO A;  5C0X H;  3AMU A;  2R3Z A;  1TII D;  5BN5 A;  1I5F A;  1TY2 A;  4DK6 C;  3K5L A;  5LMN L;  3E9I A;  2AKW B;  4A3I H;  3BYT B;  4AYB G;  2RDH A;  1QB5 D;  4A3M H;  3PO3 G;  3KLS A;  1IXR A;  1CKM A;  1KHI A;  4HIM A;  3NBH B;  1G6P A;  3KBX A;  4ME3 A;  5FKA C;  1LTR D;  3B6Y A;  3R3O A;  1SE3 A;  4MN3 A;  1UE5 A;  1FL0 A;  2EIF A;  4HID A;  2KBN A;  1HNZ Q;  3FDT A;  1RHP A;  4KKU A;  1J5E Q;  2GN5 A;  2K52 A;  3M7N A;  1IBM Q;  4ZKC B;  1SLJ A;  3EIV A;  1X32 A;  2JA5 H;  1LTS D;  4L5Q A;  2PCF B;  4R4T A;  1PTO B;  1TKW B;  2MO0 A;  4DR7 Q;  1XMO L;  1BOS A;  1T5X D;  2IPK D;  3FKI B;  1HNZ L;  3F8T A;  1PZK D;  5GAH C;  1IYU A;  5A2Q E;  1PH6 A;  1TS2 A;  3ULL A;  1IBM L;  4ZYS A;  1PFS A;  4PMC A;  5JPN C;  5CV9 A;  3FKI G;  5GRO A;  3I4M H;  1RDP D;  2L15 A;  3J81 c;  1QZG A;  3G6J B;  5IGE A;  3F2B A;  4XT3 B;  2UXC L;  1K0S A;  1W6K A;  4PZ6 A;  2HHH Q;  1FGB D;  1GUW A;  1B3Q A;  3T53 B;  1DXM A;  2F0N A;  2H4O A;  3S1R H;  2OCE A;  1WCM G;  4OIK A;  5M5W H;  2HT1 A;  2JA6 H;  5CGK A;  1EIF A;  1MJC A;  4MTK A;  2X6G A;  2KHS A;  3HOZ G;  4DR1 L;  2IX0 A;  2JSO A;  1CQF A;  4HSP A;  3OIQ A;  3TZD A;  2D0P A;  5IOD A;  2HHH L;  4DAM A;  3J7A 5;  4GNX C;  3ULJ A;  1H9M A;  3J80 L;  3HOY G;  2RDF A;  2WII B;  3ERS X;  1Q8I A;  1FGU A;  4XDX A;  4CDD C;  1KLG D;  1YHA A;  1U4R A;  1LTB D;  4G57 A;  3I4N G;  5AJ3 L;  1X54 A;  4OON A;  2SOB A;  3KJO A;  1RTN A;  3K7U C;  3NTH A;  2VUM H;  4OXP A;  4HJ8 A;  2UXB Q;  2B8F A;  4Q5V A;  1C48 A;  4PZ8 A;  3PSI A;  3VR2 A;  3MAQ A;  1ILP A;  2QEX A;  1VQK A;  1GVP A;  1NSN S;  2BE5 D;  4DUZ Q;  2EXZ A;  1TWF H;  2KUM A;  1R9T B;  2A68 D;  5BN3 A;  3CCM A;  1CHP D;  2F3I A;  1YJ9 A;  3OWF A;  2QW7 A;  3R2T A;  5C5L A;  3EN2 A;  4QJF A;  3AB9 A;  3W3A A;  5JVG 3;  1P16 A;  1HQM C;  5FK9 C;  1ZKO A;  1STA A;  2JA9 A;  2I5H A;  1D6E C;  1CA6 A;  3D6C A;  3NQI A;  4A3I B;  2BOS A;  2ZT9 C;  2QA4 A;  2NUC A;  5J3B A;  1ENC A;  5C0X G;  4DUZ L;  4TVA B;  5IYD H;  1BKB A;  4OX9 Q;  1RIP A;  4OEL B;  1HR0 L;  4Y7N H;  4A3I G;  5I6W A;  4KJN A;  1B44 D;  4A3M G;  4PZ7 A;  3W1G A;  3BZC A;  5ELB A;  3TZU A;  1W2B A;  1N32 Q;  1Q12 A;  2F0L A;  4DN4 M;  3BZK A;  2JA5 B;  1S5E D;  1X3E A;  5KYI A;  1TXY A;  5G3L F;  1CA5 A;  1QG7 A;  3TS0 A;  4JI0 L;  4DXG A;  1K8G A;  4DV6 Q;  4JC0 A;  4OX9 L;  3FVQ A;  3DEP A;  1PA6 A;  2R93 G;  1PMR A;  3D6W A;  2L11 A;  4NXN L;  4IFD J;  4IPH A;  1SRU A;  2L9H A;  1G51 A;  5A35 A;  1VMP A;  5C3W A;  2KEC A;  2Q2U A;  1K8O A;  2RHS B;  2YTV A;  2OTJ A;  1K83 H;  4H13 C;  5AFW A;  3I4M B;  3NHH A;  1I4R A;  3SK8 A;  4ZUJ A;  1Q3L A;  1ENF A;  4A75 A;  3Q0A A;  1GUS A;  2EPB A;  1PRT B;  4HAE A;  3C1E A;  1SBB B;  2RBM A;  4RFB A;  3TEH B;  4KKT A;  2UUA Q;  4DK1 A;  2K5W A;  2F0F A;  5E1F A;  3I4M G;  5T1G A;  3PMF A;  4KY7 A;  2GA4 B;  3HZX A;  3S1R B;  3WDN A;  1A3V A;  5EPL A;  5M5W B;  1I3Q H;  3CCQ A;  4C1N K;  4DAV A;  4B3T Q;  2JA6 B;  3J7A V;  1D1K A;  3KK7 A;  2J7Z A;  1BBX C;  5I6Y A;  1KNE A;  1SNP A;  3X3M A;  1N34 L;  1W3S A;  1T5E A;  2BA0 A;  4CBV A;  1EY4 A;  3VR5 A;  4DR5 L;  2CH4 W;  1S4Z A;  1IYJ B;  3DHQ A;  1AE2 A;  2PI2 E;  2IJ0 A;  2Q2I A;  3GD7 A;  4FP5 D;  1S5C D;  3RN5 A;  2UUA L;  1Q8K A;  1XNR Q;  4XXE A;  1Y69 U;  2UXD Q;  4PMB A;  1YNX A;  1L0Y B;  2JXM B;  1FNV A;  3VR4 A;  3J81 L;  4G7O C;  3Q8D A;  1D5Z C;  1JOQ A;  5LMN W;  2A69 D;  2V4D A;  4B3T L;  2HQE A;  1H9S A;  2QEJ C;  4FVM A;  4Z9C B;  3PUW A;  3DWQ A;  4FDB A;  1TWH H;  2RDG A;  4B3M Q;  3T4A C;  4FXG C;  2MHV A;  3A8I E;  5FOB B;  2K5N A;  4UDU C;  1W6J A;  2IHE A;  2VUM B;  3U9S A;  3IFT A;  4FXK C;  2AQ2 B;  1EOV A;  4HR7 B;  4KV6 A;  4RH6 A;  4V0B A;  1VF5 C;  4Y52 H;  5E3F A;  3NWT A;  1CZG A;  4DA2 A;  4ID6 A;  3H09 A;  4YWL A;  2VNU D;  2VB2 X;  3DXJ C;  3HP3 A;  4A3F H;  2YYZ A;  1ICW A;  1TWF B;  1CSP A;  1NBW A;  2E2D C;  3JAM i;  3VR6 A;  2Q2H A;  4HIK A;  3KUP A;  4HJA A;  3BYY B;  2B29 A;  1VQD A;  3CPF A;  3F2D A;  2R7D A;  4NKL A;  4H7B A;  3LGJ A;  3PO2 H;  1PZI D;  1DYQ A;  1B9N A;  4KN4 C;  5I9O A;  2K28 A;  1MBY A;  5M3F G;  4A3G G;  1ROD A;  1VQM A;  5C44 G;  3JAM c;  3VYR A;  1XXG A;  4CHT B; 
#chains in the Genus database with same CATH homology
 4OO1 I;  4Y7N B;  5I2Y A;  1H9S B;  1SSO A;  5CV5 A;  3QIA A;  4HED A;  1RCV D;  4B9X A;  1F9R A;  4S3S A;  4B9W A;  4H0L C;  5JAV A;  2MPM A;  2EYF A;  1X3P A;  3TN2 A;  4RGN A;  3MXN A;  1JQY D;  1SMY D;  3A55 A;  1A15 A;  1SE2 A;  3NBI A;  4EVO A;  1V1O A;  4A3J B;  2EVB A;  1K83 B;  1G6Z A;  3TBI B;  3BDO A;  1FNW A;  4GZY C;  1TVX A;  3Q24 A;  4DXF A;  1GUT A;  3PIP 3;  3JAM E;  1SJH D;  3T13 A;  3ERQ A;  1B2T A;  1I4X A;  2QDB A;  1Q1B A;  3O13 A;  1I3Q B;  4QUF A;  2Q8T A;  1LT4 D;  2PPB C;  2A6E C;  3GTQ B;  2J0T D;  1O78 A;  5G3L D;  3HKZ B;  1HQR D;  2XWB B;  1SJE D;  3EJI A;  1WTW A;  5HUR A;  3L9A X;  2MUY A;  5NUC A;  1TWH B;  1WVL A;  1LAC A;  1KAA A;  2EJM A;  2MGS A;  4KMU C;  3U9O A;  3H6M A;  3PUZ A;  1XYI A;  3QB3 A;  3R93 A;  4KI0 A;  2F3V A;  1SNQ A;  2A73 B;  5C5M A;  1XX8 A;  1E2V A;  1YNN C;  2EYP A;  3KLS X;  4A3F B;  2BDO A;  2ID0 A;  4IFD G;  4J6H A;  1II3 A;  1KDC A;  1HA6 A;  2EDG A;  3BDC A;  1ZXT A;  2ENB A;  3PO2 B;  2DY8 A;  3MHB A;  1BQQ T;  1G91 A;  5I2X A;  1EQV A;  4OGQ C;  1AEX A;  2NTS A;  5DEH A;  1EOT A;  3K5N A;  1LTT D;  2DNC A;  4B08 A;  3J7A F;  4KHV A;  2WB1 B;  3W2D A;  2CVR A;  2ICE C;  2IX3 A;  3J7Y W;  4K2K A;  1D2B A;  3MXP A;  4RKB A;  1VF7 A;  1PFM A;  2SDF A;  2OF1 A;  3HS0 C;  3A8J E;  3S15 B;  2K1B A;  4FYD A;  1STY A;  1H9R A;  4M1U B;  4IZ8 A;  2M2L A;  4K5X A;  1YNN D;  4XYO A;  2N55 A;  2TSS A;  1CFM A;  4O1N A;  2E76 C;  5JPM C;  3PIO 3;  4OIJ A;  1EZ8 A;  2BA1 A;  5EPJ A;  2PYK A;  1Z47 A;  1STH A;  4EQO A;  4A3B B;  5IOC A;  2K5Q A;  1Q1E A;  1RJT A;  1J8I A;  4JK1 C;  5KIX A;  5D3D A;  5C4J B;  4LK1 C;  1HCZ A;  3GO5 A;  2X6L A;  1SND A;  5JVH 3;  1CM9 A;  2PNR C;  1ESR A;  3D4R A;  1WD0 A;  4TRD A;  3IL8 A;  1QNK A;  1AZQ A;  4HMJ A;  5CBA E;  4DK0 A;  3CU7 A;  2B2W A;  2RKS A;  4DF7 A;  1EWC A;  5D65 A;  2AWO A;  3HG9 A;  2IT1 A;  2PMZ B;  5C4X B;  4KD4 A;  1G8Z D;  5IT9 L;  3OPO A;  4PNY A;  1A2U A;  4K2L A;  3NE5 B;  1PTO F;  1CQV A;  3RZD B;  2KOL A;  1A3U A;  3GV6 A;  2F0K A;  1JOO A;  1RD9 D;  3A7L A;  1I6V C;  5CMD A;  1TWG B;  4EQN A;  3GTK B;  3L7Z C;  3R8B A;  1Y8O B;  4FF2 A;  1KAB A;  1STN A;  1WD1 A;  3S2D B;  2XWJ B;  1TWA B;  5KYL A;  1EY9 A;  2EYH A;  2WIN B;  2YU9 B;  4FNF A;  1RF2 D;  1IYV A;  3DMU A;  4PV1 C;  1EWH A;  2BE5 C;  3D31 A;  2KED A;  2A68 C;  1OXV A;  1BNZ A;  2F0H A;  5D3I B;  1HTP A;  3OW7 A;  3VA5 A;  1BCP C;  5CC4 A;  2B8G A;  4BA2 I;  4C3H B;  2DNE A;  1JWM D;  2J4X A;  1EY0 A;  1TU2 B;  2L1B A;  4X3T A;  3HOU B;  3A56 A;  5IIF A;  4OO1 H;  2O5J C;  5EKK A;  4U68 A;  5M5X B;  4WFN 3;  1CHQ D;  3Q23 A;  1EU4 A;  1BR9 A;  2RSO A;  2QCP X;  3K6O A;  2HCI A;  2F0S A;  1KDB A;  4LAA A;  2QIL A;  1UAP A;  2X69 A;  3RUZ A;  5DNF A;  2F0E A;  4V19 0;  1D5M C;  3F2U A;  1RKN A;  4X3U A;  2O2L D;  1GUN A;  3C46 A;  5ELD A;  5DM7 3;  3RMH A;  1TS3 A;  4NDX A;  4QB4 A;  4PQX A;  1B1Z A;  2L4N A;  4RKL A;  3UI2 A;  1BCP D;  1SXT A;  3NPP A;  1V43 A;  4C3J B;  4JBW A;  4KJO A;  2Y0S B;  2B2W C;  1OO9 B;  1R4Q B;  4C3J G;  5KNC A;  3MXG A;  3H91 A;  4I65 A;  1QWY A;  3URY A;  4FXD A;  1SYG A;  2A69 C;  1EIG A;  2A6H C;  2EY2 A;  4KY6 A;  1K8M A;  5J22 A;  2E2H B;  3MZ5 A;  1BXT A;  4XQJ A;  3C2P A;  4IUV A;  2PZW A;  5J1Z A;  3D4W A;  3R2I A;  2L0C A;  1MSH A;  2NN6 H;  4M8A A;  1PRT F;  2LY7 A;  3N52 A;  4HMI A;  4DAP A;  2M00 A;  1I4G A;  4DNT B;  2NVQ B;  2FHT A;  5IGC A;  1ONL A;  4J1M A;  3EQL C;  3FRP B;  1TS4 A;  2NVX B;  4ZAI A;  3FPU B;  1ZYR D;  5JJZ A;  1B9M A;  1GUO A;  3V05 A;  5HGT A;  4C3I B;  3NTI A;  4RHR A;  2R6G A;  3PV0 A;  1JOR A;  4RGM A;  3S14 B;  2NYZ D;  1WTO A;  4IUR A;  4WOR A;  1AZP A;  3MA2 B;  3WOF A;  4BBR B;  2B63 B;  3S17 B;  2HDM A;  1NCV A;  4CKB A;  2Z8L A;  1SNC A;  2A6H D;  3MVV A;  4A3E B;  2F1M A;  3N6R A;  1U4M A;  2CQA A;  4C1N I;  3VA7 A;  3LWE A;  4X3K A;  1SMY C;  2B2Y C;  2DN8 A;  5K36 H;  3C1F A;  3D4D A;  3NTK A;  1TT2 A;  3H0G B;  2F0J A;  2RA4 A;  5IGF A;  4OHJ A;  3VYU A;  4A93 B;  4E6I A;  1WTV A;  1JOK A;  1TR5 A;  1HTL D;  2MJ8 A;  1QIL A;  2Z4I A;  2MP1 A;  1JIC A;  4R8I A;  3HGB A;  3AU7 A;  2NVY B;  3D3R A;  1EYD A;  1NAP A;  4ABN A;  2E2I B;  2F0Q A;  3FEW X;  3HOV B;  3KF8 A;  3OSO A;  3OMC A;  2E2J B;  4CJ1 B;  1SNO A;  1QNU A;  2LS0 1;  3A8K E;  2R92 B;  1YNJ D;  4TKO B;  4K8J A;  1KDA A;  2LMC B;  3CQZ B;  3MWY W;  2R61 A;  2NBF A;  3VR3 A;  5LHY 1;  2IX1 A;  4I7Z C;  4BBS B;  1SAP A;  2F0O A;  4CJ0 B;  1DJR D;  1NUC A;  3QO2 A;  3ND8 A;  5JEA H;  3RZO B;  1U4L A;  2N88 A;  4N9T A;  2QKI C;  1JWU D;  3MXU A;  5F2D A;  1UUP A;  1V1P A;  3M3Y B;  3NUC A;  1PXU A;  1U9R A;  3IAY A;  1GJX A;  1SYF A;  5DM6 3;  2ZXO A;  2JEB I;  2B2U A;  2AQ3 B;  5COY A;  4EQP A;  3NSW A;  1O7L A;  1M4V A;  5EBC A;  4BWG B;  1CK1 A;  3T56 B;  2BCO A;  2SNS A;  4A3D B;  3P75 A;  3BS1 A;  1J9O A;  1FD7 D;  2XNA C;  4HCS A;  4DFA A;  3K57 A;  1E0B A;  4QCL A;  3QG1 A;  1B53 A;  1JB3 A;  4C2M B;  3NP8 A;  4XT1 B;  5FLX E;  3I90 A;  4F7X A;  1PFN A;  1ESF A;  2XRS D;  2VXW A;  2F0P A;  4WJW A;  4NMZ A;  2NN6 I;  4C56 C;  5M3M B;  2AQ1 B;  1STE A;  2TMP A;  2OXP A;  3E0J A;  2EOT A;  2KQ3 A;  2F0T A;  1MI2 A;  4OL7 A;  4R9W A;  1ET6 A;  1LV9 A;  1Z7T A;  2F03 A;  2K32 A;  5FO8 B;  2XVS A;  2JEA I;  3MTS A;  2IL8 A;  3ITP A;  1FNU A;  5KGU A;  2EY5 A;  4RCN A;  4K6D A;  1F9S A;  2KVM A;  5KND A;  1D5X C;  4CKC A;  1CZW A;  2XRQ D;  2F0D A;  1EYC A;  5JOB A;  4F87 A;  3DUZ A;  5FO9 B;  3FMC A;  3QOJ A;  3GTO B;  4ZK9 B;  1O7Y A;  4DGZ A;  4HCE A;  4RGT A;  4IQZ A;  1VMC A;  2WP8 J;  3JAM L;  4IUU A;  3FPP A;  1M8A A;  1HPC A;  1F77 A;  4XQN A;  3KBG A;  3K0Y A;  2C9O A;  1TQO A;  4FF4 A;  1KNA A;  5EKL A;  4PMW A;  4CGY B;  4A3K B;  4ZLT F;  1QCB D;  2B2U C;  4IFD I;  4HN7 A;  5CV8 A;  1I50 B;  2Z4H A;  1QOH A;  2R7Z B;  3VYT A;  1Z6H A;  1S5F D;  1WTX A;  3GQB A;  1S5B D;  2A74 C;  4MIU A;  2FMC A;  3NQT A;  2L5T A;  4KKS A;  1IW7 C;  4F88 A;  3Q6S A;  4BY1 B;  2JP1 A;  4ZQ3 A;  3T51 B;  1EIH A;  1SYB A;  4IUN A;  5E4W C;  3EFX D;  1BCP B;  2RSN A;  1ILQ A;  4NW2 A;  1O80 A;  3J80 E;  3X3N A;  1EQT A;  4ZRZ A;  1IKM A;  4G4K A;  4BY7 B;  2ICI A;  1EU3 A;  3EVQ A;  1EY8 A;  3GTM B;  1SE4 A;  2H1E A;  3SK6 A;  5C6A A;  1HFG A;  3SR1 A;  2Z1C A;  3SXH A;  1RTO A;  2CW0 D;  3LNN A;  2EYM A;  1XWE A;  1AP0 A;  3ONA B;  3PO3 B;  3MFY A;  4DNR B;  2B2V A;  3OMG A;  3M4O B;  1JR0 D;  1Y8N B;  1LTI D;  1IW7 D;  2I07 B;  1XTC D;  1F2Y A;  1SYD A;  2NB0 A;  3E5S A;  3QJY A;  1F2M A;  1DD2 A;  3BG3 A;  4RA8 A;  2VB3 X;  2NWG A;  1MD2 D;  2F0U A;  1WTR A;  1Q90 A;  2LKV A;  3PUX A;  1SDF A;  5E4X A;  1MSG A;  2KCC A;  3H3V C;  5ELF A;  1GHK A;  3G7L A;  5ELE A;  5LL6 X;  4U67 3;  1QJO A;  3SK5 A;  1EEI D;  1E2Z A;  5ELC A;  1C8C A;  2NZ1 D;  2NTT A;  4QUC A;  1PLF A;  3QWN A;  1TY0 A;  3K5M A;  2OT2 A;  1WCM B;  3QOL A;  1D1I A;  1F2Z A;  2L55 A;  1A3T A;  2AUJ D;  4C3H G;  5BN4 A;  2EZV A;  3HOZ B;  2PQE A;  4DU9 A;  3I70 A;  5FO7 B;  1DM0 B;  3I3C A;  3SVM A;  1G29 1;  3M7G A;  2B2Y A;  3HOY B;  1HFN A;  2EY6 A;  1EZ6 A;  1KTK A;  5M5Y B;  2EYO A;  1FR3 A;  4L6T B;  2M9V A;  3A54 A;  3I4N B;  1STG A;  1WTQ A;  1HUN A;  3P1H A;  1OXX K;  1V8Q A;  2D2C C;  3OHX C;  1HHV A;  3D8G A;  1PYW D;  3ND9 A;  2I46 A;  1TWC B;  2F3W A;  1ENA A;  1AN8 A;  4K8I A;  1PZJ D;  3J81 E;  3HOX B;  3GTJ B;  3VYS A;  5LL6 S;  5KRU A;  4IUP A;  1I4P A;  3I73 A;  4J8Q A;  1ZYR C;  2JE6 I;  2RQX A;  2FIN B;  3I72 A;  1PTO C;  1WTP A;  3CRK C;  1LAB A;  1EY6 A;  3IKJ A;  2XN9 C;  1B4O A;  4CJ2 C;  1OXS C;  1KLU D;  1DZ1 A;  4TSS A;  2K05 A;  1F9Q A;  4WRD A;  2LFN A;  2Q8I B;  4ZUI A;  3TP8 A;  4G7H C;  3P20 A;  3GTL B;  2B39 A;  2AUK A;  3SDZ A;  5CBE E;  5A2Q L;  4A3M B;  2F0I A;  5KEE A;  2K33 A;  3TP5 A;  1HA5 A;  3A7A B;  2B2V C;  4X3S A;  3S2H B;  3MEH A;  5EQ0 A;  1GHJ A;  3TP7 A;  1AW7 A;  3K5O A;  2R93 B;  1BO0 A;  3S1Q B;  3OOC A;  3M85 A;  1UNS A;  1IHZ A;  4R8N A;  3CHB D;  2JA7 B;  1DCZ A;  1SYE A;  5ISR A;  3WOE A;  3PUV A;  3TP6 A;  1DON A;  2SEB D;  2QF7 A;  2D9U A;  4TQU S;  1SYC A;  4K5W A;  1PTO D;  1GUG A;  5COR A;  2F0V A;  2HUG A;  2A5H A;  2G9H D;  2EJG C;  3DWA A;  4ODG A;  3TME A;  3CKI B;  4YIJ A;  3GTG B;  3TDQ A;  5C0X I;  1YNJ C;  4C3I G;  2F0M A;  4RCO A;  2KA7 A;  1BUV T;  5JEA J;  1FYC A;  3MFG A;  2O5I C;  2C5C A;  4OO1 G;  1F2L A;  2PW7 A;  1LT3 D;  3SEB A;  2KJX A;  5DAU A;  1DOK A;  5KNB A;  4KTA A;  5D14 A;  4LMQ D;  2NVT B;  1IKL A;  3RD4 A;  1OXU A;  1B3A A;  1H9K A;  2K04 A;  2AWN A;  2K7V A;  3PUY A;  5TSS A;  3I4L A;  1A6X A;  1QE6 A;  1Y1W B;  4RAU C;  5EKI A;  1LT5 D;  2K03 A;  3DEO A;  4IFD H;  1CI3 M;  1EL0 A;  2OEO A;  2L12 A;  4RHS A;  5J39 A;  1I6H B;  2IW3 A;  4FF1 A;  1BF4 A;  2WAQ B;  4KHZ A;  5M3F B;  4A3G B;  2E74 C;  4H44 C;  5IGB A;  5C44 B;  4O42 A;  3C3L A;  3NXW A;  1HXY D;  1A2T A;  2EE1 A;  1EEF D;  1PRT C;  2FFK B;  2CHB D;  4CKE A;  3K7A B;  3P7J A;  2K01 A;  1LTA D;  2D5D A;  3HEJ A;  5CV4 A;  4N9P A;  4BA1 I;  5K5P A;  4KN7 C;  4ZKB B;  2KEE A;  3HOW B;  3BVZ A;  1EY7 A;  2EY1 A;  5EJW A;  1JE4 A;  2NN6 G;  1NR2 A;  1C4Q A;  2PW5 A;  1Y1V B;  1IL8 A;  4ME5 A;  5IGD A;  3TSS A;  2BDN A;  1SEB D;  5T1I A;  1LT6 D;  2FJ2 A;  4ILW A;  2DY7 A;  1GXD C;  1ZEQ X;  4HTH A;  5EGT A;  1TS5 A;  3L3O C;  2B2T A;  4DAY A;  4K6L A;  3H94 A;  3IFD A;  3V2T A;  3HRZ C;  4IN3 A;  1PRT D;  2RVL A;  3KLR A;  3NWS A;  4K14 A;  2O4X A;  4L63 B;  1JC7 A;  1V1P B;  4QF4 A;  5CR3 A;  4IUT A;  3S9W A;  4G7Z C;  2F0G A;  4KK7 A;  5K36 G;  2FMM A;  4QIW B;  2EJF C;  4Q0F A;  1CTM A;  1LLR D;  4NP5 A;  4XTC S;  2F4I A;  1CT1 D;  2EYJ A;  3DM1 A;  1I4H A;  2PZU A;  4ULL A;  3GP7 A;  5EBD A;  4F8M A;  5C4H A;  1SFO B;  3CRL C;  5C3X A;  4IAL A;  4QMG A;  1LO5 D;  4XYQ A;  3NK9 A;  2Q8R E;  4XQQ A;  2HDL A;  3I8Z A;  5IT9 E;  1GOZ A;  4BS9 A;  2SNM A;  4IUQ A;  3BVM A;  1VCI A;  5I9P A;  3RLF A;  2A6E D;  4RWS C;  1PTO H;  1PFB A;  1SNM A;  2D62 A;  1ET9 A;  4UAI A;  5EPK A;  5C3E B;  4LJZ C;  5JEA G;  1DOM A;  2JYO A;  1VDZ A;  4KD3 A;  1EFI D;  2K6A A;  2XIW A;  3OIP A;  2HCC A;  2ZXR A;  1DOL A;  1EYA A;  3EA6 A;  2ZXP A;  2CW0 C;  3M4Y A;  5C0X J;  2WAC A;  1JWS D;  3S16 B;  3LWU A;  1PDQ A;  2PZT A;  4P2C B;  5CV7 A;  5CYU A;  5CV6 A;  1UEA B;  2E75 C;  1EY5 A;  3SK4 A;  1L0X B;  3OWE B;  1ML0 D;  1STB A;  1G2T A;  1B50 A;  3T16 A;  1HRJ A;  2WKC A;  1S5D D;  3BVG A;  1BCP F;  1AFP A;  1F9P A;  1BDO A;  3NBH A;  5I4D A;  2PO4 A;  1LTG D;  4KY5 A;  1NR4 A;  3DWP A;  5FLX L;  5IGG A;  3GTP B;  1H9J A;  1R4P B;  3K58 A;  1MGS A;  3BZD B;  2JA8 B;  3S1M B;  3GV3 A;  3E6Z X;  1HUM A;  4FO2 A;  2B2T C;  4K5V A;  3SHL A;  1OXT A;  1Y8P B;  3ERO A;  3Q22 A;  4FF3 A;  4XIG S;  1O7Z A;  1E2W A;  2KCN A;  1U4P A;  2G9D A;  2XSC A;  1X3Q A;  4MHE A;  2WV6 D;  5C4Z A;  1JCK B;  2F0W A;  3K59 A;  4L8J A;  1G2S A;  2EYL A;  2IWH A;  4HSV A;  5M9O A;  3MC0 B;  3LX0 A;  4EGV A;  3SE0 A;  3S1N B;  2K5D A;  2WKD A;  3V96 A;  4RGO S;  1I4Q A;  3I91 A;  4AYB B;  3ZYY X;  3BDL A;  5C0X H;  3AMU A;  2R3Z A;  1TII D;  5BN5 A;  1TY2 A;  3K5L A;  3BYT B;  2RDH A;  1QB5 D;  3KLS A;  3KBX A;  5FKA C;  1LTR D;  3R3O A;  1SE3 A;  4MN3 A;  3FDT A;  1RHP A;  4KKU A;  3M7N A;  4ZKC B;  1X32 A;  1LTS D;  2PCF B;  1PTO B;  1TKW B;  1BOS A;  1T5X D;  2IPK D;  3FKI B;  1PZK D;  1IYU A;  5A2Q E;  1TS2 A;  4ZYS A;  4PMC A;  5JPN C;  5CV9 A;  1RDP D;  3G6J B;  5IGE A;  4XT3 B;  1W6K A;  1FGB D;  1GUW A;  3T53 B;  1DXM A;  2F0N A;  2H4O A;  4OIK A;  5CGK A;  2X6G A;  2KHS A;  2IX0 A;  2JSO A;  1CQF A;  4HSP A;  3OIQ A;  3TZD A;  5IOD A;  1H9M A;  3J80 L;  2RDF A;  2WII B;  1Q8I A;  4XDX A;  1KLG D;  1U4R A;  1LTB D;  4G57 A;  2SOB A;  1RTN A;  3NTH A;  2B8F A;  4Q5V A;  1C48 A;  3VR2 A;  3MAQ A;  1ILP A;  1NSN S;  2BE5 D;  2EXZ A;  2KUM A;  1R9T B;  2A68 D;  5BN3 A;  1CHP D;  3OWF A;  3R2T A;  5C5L A;  3AB9 A;  3W3A A;  5JVG 3;  1HQM C;  5FK9 C;  1ZKO A;  1STA A;  1D6E C;  1CA6 A;  3D6C A;  3NQI A;  4A3I B;  2BOS A;  2ZT9 C;  2NUC A;  1ENC A;  5C0X G;  5I6W A;  4KJN A;  1B44 D;  5ELB A;  3TZU A;  1Q12 A;  2F0L A;  4DN4 M;  2JA5 B;  1S5E D;  5KYI A;  5G3L F;  1CA5 A;  1QG7 A;  4DXG A;  3FVQ A;  3DEP A;  1PMR A;  3D6W A;  2L11 A;  4IFD J;  2L9H A;  5A35 A;  1VMP A;  5C3W A;  2KEC A;  1K8O A;  4H13 C;  5AFW A;  3I4M B;  3NHH A;  1I4R A;  3SK8 A;  4ZUJ A;  1Q3L A;  1ENF A;  3Q0A A;  1GUS A;  2EPB A;  1PRT B;  4HAE A;  3C1E A;  1SBB B;  2RBM A;  4RFB A;  4KKT A;  4DK1 A;  2K5W A;  2F0F A;  5E1F A;  5T1G A;  3PMF A;  4KY7 A;  2GA4 B;  3HZX A;  3S1R B;  3WDN A;  1A3V A;  5EPL A;  5M5W B;  4C1N K;  4DAV A;  3J7A V;  2JA6 B;  1D1K A;  3KK7 A;  2J7Z A;  1BBX C;  5I6Y A;  3X3M A;  1KNE A;  1SNP A;  1T5E A;  2BA0 A;  4CBV A;  1EY4 A;  3VR5 A;  1S4Z A;  3GD7 A;  3DHQ A;  2IJ0 A;  4FP5 D;  1S5C D;  4XXE A;  1Y69 U;  4PMB A;  1L0Y B;  2JXM B;  1FNV A;  3VR4 A;  3J81 L;  4G7O C;  1D5Z C;  1JOQ A;  2A69 D;  2V4D A;  2HQE A;  1H9S A;  2QEJ C;  4FVM A;  4Z9C B;  3PUW A;  3DWQ A;  2RDG A;  3T4A C;  4FXG C;  2MHV A;  3A8I E;  5FOB B;  4UDU C;  1W6J A;  2VUM B;  3U9S A;  3IFT A;  4FXK C;  2AQ2 B;  4HR7 B;  4KV6 A;  4RH6 A;  4V0B A;  1VF5 C;  5E3F A;  3NWT A;  1CZG A;  4DA2 A;  4ID6 A;  3H09 A;  2VNU D;  2VB2 X;  3DXJ C;  3HP3 A;  1ICW A;  2YYZ A;  1TWF B;  2E2D C;  3VR6 A;  3KUP A;  3BYY B;  4NKL A;  4H7B A;  1PZI D;  1DYQ A;  1B9N A;  4KN4 C;  5I9O A;  2K28 A;  1MBY A;  1ROD A;  3VYR A;  1XXG A;  4CHT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...