3D4DA

Crystal structure of staphylococcal nuclease variant delta+phs y91e at cryogenic temperature
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAEIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS Y91E at cryogenic temperature.
rcsb
source organism Staphylococcus aureus
total genus 32
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2008-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3d4dA00
1JOKA 4RKLA 3SR1A 4F8MA 5KEEA 5C5LA 3T13A 2EYJA 5KGUA 2F0QA 1SNPA 1NUCA 1EY5A 3QOLA 5J22A 3SHLA 4WRDA 5C5MA 4QF4A 5KYLA 3MZ5A 2EY1A 4IZ8A 1TT2A 4KJOA 4N9PA 2F0NA 5CV9A 1SNDA 2EYMA 4KY7A 4I65A 4ZUJA 3TP6A 3SK5A 2PZUA 5CV8A 4PMBA 2QDBA 2RDFA 4MIUA 1SYBA 2F0PA 3MEHA 2EYPA 2F0DA 2F3WA 2KQ3A 3QB3A 1A3TA 4DGZA 2SOBA 5C3WA 5C4HA 5IIFA 5JAVA 4K5WA 2F0JA 2PW5A 3BDLA 2WACA 3D4WA 4HMIA 5EGTA 5E3FA 5CC4A 1KDCA 5IGGA 2EY5A 5HGTA 2PW7A 3NHHA 4DU9A 5IGEA 5CR3A 5C3XA 1STHA 5C6AA 5J1ZA 4ME5A 5C4ZA 3TP5A 3MHBA 5CV4A 4J1MA 2SNSA 3QOJA 5DEHA 4LAAA 1SNOA 1EY9A 2PYKA 2F0EA 3P75A 1TR5A 4E6IA 4ODGA 1STGA 5F2DA 1A3VA 5IODA 3HEJA 4K6DA 4NKLA 4PNYA 4S3SA 1SYCA 1STYA 4NDXA 2EYFA 2PZTA 5HURA 2F0OA 3EVQA 4K5VA 3T16A 5I6WA 5I9OA 1F2ZA 4QMGA 1KDAA 5M9OA 1EYCA 1EY6A 1II3A 4K14A 3SK4A 4NMZA 1SYFA 3HZXA 3P1HA 3TMEA 5EKKA 1RKNA 3MVVA 1EY4A 3EJIA 3VA5A 3V2TA 4R8NA 4WORA 1IHZA 5DAUA 4ID6A 4EQPA 3R3OA 3D6CA 3OSOA 5CV5A 2EYLA 2PZWA 3MXPA 3NXWA 3SK8A 1A2TA 2F0HA 2PQEA 2SNMA 1TQOA 1A2UA 2EY2A 1SYEA 2F0SA 4K5XA 1U9RA 4KJNA 3NP8A 4K2KA 4KY5A 1EY7A 4YIJA 3NUCA 5I9PA 1JOQA 4QB4A 2OEOA 4G57A 3SXHA 3D8GA 2F0MA 1EQVA 3TP7A 3ITPA 3NK9A 4OL7A 5IOCA 2NUCA 1STAA 2F0UA 3D4DA 4ZQ3A 4EQOA 3S9WA 3NQTA 2M00A 3EROA 4KHVA 5NUCA 2OXPA 4IALA 3C1FA 4KV6A 1NSNS 2F0GA 1KDBA 3SK6A 3C1EA 1F2MA 5KIXA 4J6HA 1STBA 3DHQA 2F0WA 3E5SA 4DFAA 4NP5A 1JOOA 1SNCA 3OMGA 1KAAA 1KABA 4RKBA 5E1FA 3TP8A 5J39A 1ENAA 5CGKA 5ISRA 1AEXA 1EZ8A 1EY0A 4EVOA 1JORA 2KHSA 1EY8A 4K8IA 2O4XA 1EZ6A 1STNA 4N9TA 2F0FA 1ENCA 5CV7A 2EXZA 4K8JA 2ENBA 3H6MA 2EYHA 4KD3A 4H7BA 4EQNA 3OWFA 4HMJA 5KRUA 2LKVA 3OMCA 4B9XA 1A3UA 2F0VA 5IGCA 4KTAA 5IGFA 2F0KA 2F3VA 1SNQA 5IGBA 1F2YA 1SNMA 5IGDA 5K5PA 1EYDA 3ERQA 3DMUA 5CV6A 2F0IA 5JOBA 2EYOA 2EY6A 2F0LA 2RKSA 2OF1A 3LX0A 3PMFA 1SYDA 4HTHA 4KY6A 4ZUIA 2RBMA 3BDCA 4KD4A 3RUZA 4F7XA 2F0TA 1EYAA 4PMCA 4TRDA 5KYIA 5EKLA 4B9WA 4DF7A 4IUNA 4K2LA 5I6YA 1SYGA 2HQEA 3U9OA
chains in the Genus database with same CATH superfamily
2MPMA 1BXTA 5KEEA 4DR3L 1V1PB 3BZCA 2A6EC 3GP7A 1XPOA 3QO2A 1FJGQ 1X6OA 1ZKOA 2A69D 2JQOA 3F2CA 5JVH3 1S5DD 3K0YA 2WAQE 1PH8A 1E1TA 1LLRD 5CV8A 2QGQA 5JJIA 1D1IA 1Z9FA 3B6YA 2P5ZX 1SMXA 2A5HA 2WINB 2OTLA 2A68C 4DV3L 2R7ZB 3GTQH 1XJVA 2E2HH 2UXBQ 2AKWB 3UDFA 5M3FB 1QB5D 5F2DA 1A3VA 5H1SE 1OXTA 1GUOA 2Q8IB 2NZ1D 5FO8B 4DR7Q 1JCKB 4K14A 4YCUA 2EE1A 3WWVA 1JE5A 3HOYB 1VQCA 3RD4A 4ZCKA 2JA6H 1N34Q 3RR5A 3OSOA 1K8GA 1L0YB 5GAEC 4KHPQ 1P8LA 1T9HA 2EY2A 2DNEA 1ESFA 5BR8L 3R2IA 2EQSA 1K9MC 1KD1C 4JI6L 4EQOA 2A73B 4P74A 2MFIA 4IALA 1KXLA 2EZVA 2XSCA 2Z9HA 3CCRA 4R4IA 3RZDH 3OMGA 2E5LQ 1KABA 1QG7A 3PUZA 3GTKH 1X3PA 2IT1A 4LF4L 2UU9Q 1MD2D 1GD7A 3V96A 1PZID 4RFBA 1I94L 1ZXTA 2F0FA 5ELCA 3PCOB 4A3JG 4IPCA 1PFMA 1B3AA 3OMCA 5FKAC 1CA6A 1MHWC 2UUBL 1B44D 1VQIA 1Q8KA 2KCNA 2F4VQ 3ERQA 2K1BA 2MQHA 4HTHA 5JOBA 2PQAA 4BWGB 5DM73 2R6GA 2K33A 2I07B 2F0TA 1VQNA 4TRDA 1U4LA 3PO3B 2NVQB 3F2DA 3RLNA 4A3CG 2HCIA 1IZ6A 4BS9A 4RGOS 4R1JA 1KNEA 2JP1A 4WRDA 1HUMA 1M4VA 4X6AH 1VQOA 4G7OC 4DV1Q 2B8GA 2XVSA 2AQ2B 4AH6A 2F0PA 2EYPA 1BCPC 3STBD 2SOBA 3BDLA 3D4WA 4HMIA 1UE7A 4GKKL 4LF9L 2EOTA 1STHA 1RF2D 4DR4Q 4POFA 2B2TA 5C4ZA 3KLSA 1IBML 3BVZA 4OWXB 2JA8H 4A3MG 3P75A 4C3JG 3S2HB 1V1QA 2JEBI 4GNXA 1G51A 1N32Q 3EVQA 1B70B 4CDDC 2K6AA 1S72A 3VA5A 4X62L 1Y8NB 1HQMC 1RJTA 3T56B 3AFQA 1CTMA 2L9HA 3S2DB 1D7QA 1HNZL 3E9HA 3KF8A 3SK8A 1TQOA 2VZAA 1J5EQ 1B2TA 2ID0A 4DPGA 3H09A 4QUCA 3IFTA 1EQVA 1CA5A 2A6ED 2WKCA 3S1NH 3ITPA 1D5ZC 4IUTA 1Y8PB 4KI0A 1L0XB 1JMCA 1SJED 2FJ2A 4DNIA 1BKBA 3C1EA 1F2MA 4Q0FA 1TY0A 4C2MB 1VF7A 5GAGC 4RMFA 1ASZA 4DV5L 4RGNA 4IUUA 1Q7YC 5FJ8H 1NY4A 2A68D 1SRUA 1TS2A 1IW7C 2Y0SG 3PO2G 2EPBA 4ULLA 1H9JA 1HCZA 1KRTA 4JI5Q 2V1CC 5JJKA 1TS4A 2D0PA 1WJJA 2J0TD 4J15A 2E8GA 5IGBA 1HA6A 1VDZA 3I3CA 4ZAIA 1PFNA 2F0IA 3F8TA 1JB7A 2ATWA 2NVYH 3N52A 4FVMA 4QUFA 1X56A 4QQBX 4QGUA 2BH8A 2R3ZA 3A55A 3G4SA 4A93H 2OWOA 2ZJRA 1A6XA 3GTPB 4OGQC 1CSPA 3BDOA 3Q24A 3KUPA 2HIVA 4JI4Q 2K32A 2H5XA 4DR7L 1GHKA 2WB1B 3CAMA 3HOWB 3HOUB 2MP1A 3LWEA 3MFYA 2K4KA 1PRTB 5IYDH 1ZYRC 4N9PA 4P2CB 1LT4D 3IL8A 5E7NA 1WYDA 4BBRB 1I3QB 3MXNA 1N34L 4BY1H 2QDBA 3H0GB 3QWNA 4R4TA 5JAVA 3S17H 3Q8DA 2MO1A 2F0JA 3KLSX 5E3FA 3NBHB 2Z6KA 4LF6Q 2E75C 3W1BA 5FLMH 1A63A 3GTJH 2JA6G 4AYBB 3RLOA 1QUQB 1BUVT 3UI2A 1X32A 1SFOH 1EYGA 2EIFA 4ABNA 1Q82C 2UU9L 2VQEL 1V9PA 5CORA 4LF5Q 1EU3A 4R8NA 4BBRG 1MGSA 2AQ1B 5IWAL 3TBIB 4RCOA 1WI5A 1IBLL 4OX9L 4Y52H 4CJ2C 1CI3M 1JOQA 1EIFA 1W6JA 1VQ7A 4MHEA 3GO5A 1P16A 1TWHB 5COYA 1YEZA 3FP9A 2WKDA 5CBEE 1B53A 5ELBA 3D4DA 2CCZA 4BXXH 2NZOA 3OWEB 1NSNS 3AU7A 2UUAQ 3GTGH 3E0JA 5IYCH 3L9AX 2XIWA 1KTKA 4P73A 1UE5A 1GKHA 4DUZQ 4WJ3M 1VQGA 2IPKD 3S14H 4DV1L 3J80L 4Y7NH 4A3FH 1QVFA 4O42A 2F0KA 3IAYA 1EWHA 2ZTCA 2N3SA 3DMUA 5CV6A 2RSOA 4KY6A 1YNND 2LY7A 1RL2A 4DUYL 3BYYB 2AUKA 5EPLA 3S1RB 4GKJL 4A3BH 4DR5Q 3SR1A 2JEAI 5C3EH 3GQBA 3KLWA 3CP0A 2RDGA 2B2TC 5FOBB 4LFBQ 3PIO3 2K5DA 1PH4A 4DR2L 1CSQA 4IUPA 2YTVA 2B2UC 1ZEQX 3U50C 2JA8G 4GNXC 1HR0W 3A74A 4EQ5A 1TWAB 1CZGA 3NWSA 1BDOA 2XGTA 3TP5A 4LF7Q 1SE4A 1IW7D 2NB0A 4H0LC 1STGA 3GD7A 3R8BA 2HDMA 4JBJA 3J7ZC 4RHSA 4C3HH 1SYCA 1Y1VH 1Q12A 2PZTA 4KLKA 4CKCA 5I9OA 3GV3A 3OW7A 1II3A 2JYOA 3ICEA 1MSGA 2CW0C 1H9KA 1Z47A 1LTID 3CC4A 3D6CA 3NE5B 1Z7TA 4GN5A 1A2TA 1IYUA 4KY5A 4JI5L 3HOZH 4DXGA 3CC7A 1HZAA 1I50B 4GN4B 2I0QA 1LTRD 3MXUA 4OL7A 1RDPD 2J4XA 4RG1A 3PQIA 3NQTA 3ONAB 4BBSB 2K5HA 2N55A 1ZYRD 3J80c 3SK6A 3MXNB 4JBKA 2MUYA 3D31A 3P7JA 1AH9A 4QJFA 2I46A 4R9WA 3FPPA 1EZ8A 4R8IA 1EY0A 3E9IA 4HJ5A 3J7AF 2Z4HA 4BY1B 2KHSA 4JI2Q 3H6MA 4EQNA 2L5TA 2LKVA 1GXDC 1E24A 1O78A 1I6HH 2F0VA 4RA8A 3U4ZA 5IGCA 1VQKA 4X65Q 3AFPA 1EWCA 4A93G 2DN8A 3CCJA 4NXMQ 4RCNA 1CHQD 4B3SL 2JA5B 4GLAC 2RKSA 3DUZA 1WD0A 4IUVA 3J81L 3GTMB 3BDCA 2R7ZH 3VYSA 1JQYD 1RODA 4LF6L 4LUZA 1VQMA 1T5XD 1VQLA 3BZKA 5IYDG 5M3FH 4V0BA 3CCUA 3G7LA 1SXTA 3CD6A 4BY1G 4HJ8A 2O5IC 4UP8A 1NUCA 1XTDA 3KYHC 5E4WC 5D3IB 1HNXL 5KYLA 1ASYA 1JB3A 2TSSA 3KDFA 4LF5L 3HOYH 4I7ZC 1X3QA 1XTCD 3ND9A 5LMUQ 4JOIA 2ZJQA 1N9WA 2CWPA 1XWEA 2XRQD 4IN3A 4XYOA 5C4HA 1EQTA 4K5WA 5EGTA 4DR1L 1KDCA 5FLMG 5M5XB 3PIP3 4LF8L 3D0FA 5AJ3Q 2DNCA 4JBWA 4YWLA 1S4ZA 3CCLA 1BBUA 5C4JB 1LT5D 4A4IA 1NR4A 2HT1A 4EX5A 3K6OA 2ZM6Q 3U58A 1KQSA 4NDXA 2UXDQ 1RHPA 1YNXA 1J9OA 1PYBA 4AQYL 4XIGS 2A19A 1EY6A 2F03A 5FLXL 3C3LA 1IHZA 1MJEA 3KBXA 2AWNA 1O7IA 1TWCB 4BXXG 2IWHA 2BE5C 5CYUA 3MXPA 3MTSA 1SYEA 3OTOQ 1X55A 2IW3A 4QB4A 2OEOA 5IYCG 4HAEA 4A3BB 3K7AB 4JC0A 3HGBA 4FP5D 1UAPA 1AP0A 2QKIC 2YTXA 4L5RC 1KDBA 1FYCA 3PO3H 2NVQH 4J6HA 1STBA 1JJCB 2HHHQ 3S15B 4DR5L 4GLXA 5M5WB 1HXYD 4A3FG 4EVOA 3K5NA 1OXXK 4DR6Q 1XYIA 1EY8A 1V43A 1EZ6A 3K81C 4N9TA 5KRUA 1Q3LA 3S16B 4HMJA 4DV6Q 4IJHA 3CQZB 2L4NA 4R4QA 1A3UA 4PZ7A 1SE3A 1SNQA 4RHRA 3JAME 1N33Q 1K73C 5IGDA 1C7YA 4A3BG 1ICFB 4NPSA 1PZKD 3I7FA 3HRZC 3STBC 4KD4A 4C3HB 5C3EG 1C9OA 4FNFA 4B08A 1EQQA 2CW0D 4LK1C 1F9RA 4K2LA 1QJOA 3S2HH 1I4GA 2OT2A 3E5SA 1JOKA 3PUWA 3KF6B 4JPBW 3T13A 3VYRA 1EY5A 2E2DC 2K5QA 1U0LA 2KEEA 3HOXB 1PV4A 2I5MX 1WCMB 1IKMA 1S5CD 2KCCA 4MTKA 3S2DH 4MIUA 3FKIB 4XDXA 3F2BA 1AN8A 3T4AC 4C3HG 5FLXc 3SE0A 3EQLC 1LTLA 1LTGD 2EJGC 1SNOA 1I6VC 3TZDA 1B3QA 2B2VA 1CHPD 5I2YA 4QIWB 3W3AA 3CF5A 1OO9B 4C2MH 4PNYA 3H15A 2WFWA 4MTNA 1PH6A 1XNRQ 4C1NK 2JE6I 4DK0A 2RSNA 1K83B 1KRSA 4JI0L 1VQDA 4JI3Q 2KHIA 1KDAA 1K3RA 1I6HB 3K80C 2WAQG 3HOZG 2C35B 2MNAA 3H94A 5C44B 1CKNB 4X64L 1GJXA 5JPMC 4K0KQ 4CDCC 4L5SA 1MI2A 3F1ZA 2X6GA 1L1OA 3EIVA 2M2LA 3M4OB 4HJ7A 3I4MB 4KV6A 4KN4C 4FDBA 3DLLA 3Q23A 3RZOB 1CQFA 1U4MA 4X65L 3MXGA 3HKZB 2F0MA 1STAA 3EBEA 1QILA 3KDFB 4QIWE 1NAPA 3C1FA 3ULJA 2SEBD 5CBAE 3CPFA 3CCVA 2VUMB 1D5MC 3GTPH 4Z9CB 2L55A 1Y8OB 4IPHA 4DK6C 1VQPA 1XMOL 5ELNA 4M1UB 3HOWH 3HOUH 3CW2C 4PV1C 2UUCL 2ZJPA 5IT9L 4H7BA 2CQOA 2R7ZG 4B9XA 4BBRH 1I3QH 3HKZE 2AWOA 3H0GH 5M3FG 2AQ3B 4H02A 4B3TQ 2EYOA 5JPNC 1QVCA 1YJ9A 1SYDA 3L3OC 5C4XG 5BN5A 1FNWA 5EKLA 4RAUC 1YNJD 3NBHA 1PH7A 1KC8C 1ICWA 2O2LD 1E0BA 4JOIC 1BR9A 2BE5D 1B50A 1S5ED 3HOYG 4YHHQ 1HHVA 3DXJC 4CKBA 2DJGC 5CV9A 1QUQA 2KCMA 2OCEA 4ZUJA 3OPOA 1K8MA 1G8ZD 3HKSA 1FNUA 3DWQA 4XQQA 4BY7B 1WTPA 4JI7L 4HSPA 3OTOL 1WD1A 5AFWA 3K58A 2PW7A 1TWHH 4DV0Q 5CR3A 2TMPA 3I4NB 4FF1A 5CV4A 5DEHA 3QOJA 4PQXA 3I4LA 1EY9A 1NMGA 4GOPA 1UEAB 2F0EA 2LFNA 3TN2A 1GVPA 1C4QA 4K6DA 5EKIA 2F52A 5LMNQ 4O0AA 3UE1A 1YBYA 2HHHL 1STYA 5I6WA 1K0SA 3LNNA 2A8VA 5FLXE 1ENFA 4NMZA 4DR6L 3A8IE 4TVAB 3CMAA 3D6WA 3BJUA 5J3BA 1H9SA 2N78A 2B39A 1YZ6A 1VQ9A 3PO3G 3T1HQ 2MGSA 2VY3A 4JYAL 1XPUA 1N33L 1I4QA 1K8OA 4TKOB 3PSIA 5IT9c 3CC2A 3VR5A 2RF4A 4L6TB 3SGIA 3S1RH 4A3DB 3DHQA 1YNNC 3Q22A 2CWAA 4IJLA 1JOOA 1SNCA 2B8FA 4HCSA 1VCIA 2K7VA 2M9VA 3PIOA 1BBXC 5GQOA 1UE6A 1HFGA 4NXNL 2Q8RE 1NJIC 4LFAL 2K03A 4MN3A 4DV2Q 2B63B 4HCEA 1TIID 1UWVA 2VS1A 1HR0Q 5EAYA 1V8QA 2WP8J 3PUVA 2Z1CA 3V05A 3A7LA 1MIUA 2IJ0A 3VR4A 1F2YA 4H13C 3SDZA 1OXVA 4IFDJ 2BA0A 1TWAH 2OF1A 4G4KA 4DN4M 5ISRA 4M8AA 4A3EB 3AYHB 1PHJA 1CFMA 4C56C 1L1OB 1RCVD 3GTOB 2H1EA 5L37A 1PYSB 3U9OA 1X9NA 1FJGL 1PXUA 3ER0A 2K50A 4POGA 3I72A 2PI2E 5C5MA 4QF4A 3I56A 1KLGD 3J7YW 2EYMA 2RCFA 1SN8A 2F0DA 5IIFA 3Q0AA 1VQAA 1TKWB 4PZ6A 2XRSD 3K57A 1HNWQ 1VQ8A 2Y0SE 1I50H 3WOFA 1IKLA 3NHHA 4DAMA 2UXBL 5M5YB 4RGTA 3NTHA 4ZKBB 2L11A 4JVZA 4A3GB 4BBSH 4A3IB 5LHY1 4JI8Q 1GUTA 1PZJD 1CQVA 4OWTB 4A76A 3X3MA 3CMEA 3HZXA 1TVXA 2KOLA 4R4CA 5EBDA 4UY8C 5JJLA 1E1OA 5GADC 4KHPL 3CCEA 2DY7A 4DAYB 1VMCA 1I4XA 4IPDA 2PZWA 3WDNA 2PQEA 1B4OA 2CFMA 4DV4Q 4YIJA 1U9RA 3NWTA 3NP8A 5I9PA 4JI1Q 2G5DA 2JA5H 1I4HA 3NEMA 2HIXA 3GTMH 4JK1C 5LL6S 3E3XA 2RHSB 5JVG3 2E5LL 2WB1G 3HOWG 2NWGA 3HOUG 1FVIA 3BS1A 2NVTB 3MAQA 1YVCA 1KAAA 1GOZA 1SROA 2FINB 5E1FA 3TP8A 3I91A 2J7ZA 2D0OA 1LYLA 1PRTC 2ALYB 2LMCB 1PMRA 4TQUS 3H0GG 3SEBA 2WIIB 4DK3C 5M3MB 5IT9E 1DONA 2ENBA 4XT1B 2CHBD 1QZHA 3PIPA 1VQFA 4CJ0B 4GOPB 2Z0SA 2F4VL 3L7ZC 1ET6A 2JA7B 4RH6A 3TS2A 2EY6A 3LX0A 5M5XH 3DEOA 4AYBG 3NELA 4OELB 5LL6X 5C4JH 1XNQQ 3H3VI 1H9SB 2XNAC 1GUNA 3CU7A 3HP3A 5LMNW 1OTCA 1E3PA 4CDEC 4F8MA 1HTPA 2A1AA 1SSOA 1N36Q 1VMPA 2PCFB 1TY2A 4X3UA 3EA6A 4DV7Q 4X66Q 3OOCA 1G6ZA 4V190 2F0NA 3QG1A 3TP6A 1F2LA 3SK5A 1LO5D 1X3GA 2RDFA 4CJ1B 1TWCH 3MEHA 3QB3A 2YYZA 4LUOA 1T5EA 3VYUA 2E74C 4DR4L 2YU9B 1I5FA 5ELFA 3T1HL 3NPPA 4UP7A 2A6HD 3K7AH 2K75A 1LT6D 4NW2A 4J1MA 1LM0A 4A3KB 1N32L 1PFSA 1QNUA 5IODA 2A74C 2CH4A 4FXGC 4DXFA 1Q8IA 1QOHA 1XPRA 4LW1A 3S15H 5M5WH 1L0WA 1GO3E 1SYFA 2H4OA 3MVVA 1X3FA 2NTSA 2EVBA 3T53B 1RTNA 1J5EL 3S16H 1SAPA 1HR0L 3CQZH 3TQYA 4C1NI 3O13A 2WV6D 3S17B 4IFDH 2F0SA 1R9TB 2KJXA 4K5XA 3NUCA 2R92H 4G57A 4APVA 1JT8A 1MSHA 3JAMi 4G7HC 2NUCA 2MHVA 3S9WA 2ZT9C 3HOVB 1CT1D 2BCOA 2HD3A 3PUYA 1B9MA 4HIKA 3EFXD 3TS0A 1SMYD 1U4RA 3MC0B 1G2TA 1WTQA 4A75A 1JORA 3VR6A 2QILA 3D3RA 1PVOA 1WOCA 3KF6A 1PH1A 3I70A 3HOXH 1UUPA 1K28A 1WCMH 2F3VA 3S1QB 3M7GA 1MJCA 2I5HA 2B2YA 1JWMD 3FKIH 4JCVE 1FD7D 1BF4A 1NR2A 4F7XA 2UXCQ 1EYAA 4X3KA 2YTYA 4PMCA 1HA5A 1PTOB 4B9WA 2JA9A 1E2WA 4L5TA 3GTLB 1F9PA 1A0IA 2PNHA 2E2JB 1HJPA 3KJPA 4JI4L 1S5FD 4HIOA 1UE1A 1BNZA 4OONA 1K83H 4DR3Q 2KBNA 3OHXC 1N8RC 1G2SA 5IP9H 5C44H 4PG3A 1UNSA 1G291 4YWMA 1JC7A 2N88A 1U5KA 3BG3A 3M4OH 2RDHA 3H3VH 3VYTA 3UDIA 2F3WA 1CKNA 3I4MH 1H9RA 4BBSG 4DV4L 4JBMA 3RZOH 1PRTD 5C6AA 1XX8A 4DV3Q 4XXEA 3CKIB 4HIDA 2ICEC 5DLQE 3G6JB 4E6IA 2K04A 2XWJB 2VUMH 4KK7A 5FO9B 2Z6KC 4IO9A 1M90C 1LT3D 3CRLC 4K5VA 5EPKA 1O7YA 3L2PA 1EYCA 1S5BD 1RKNA 4HJ9A 1PFBA 1QCBD 2JA5G 3M7NA 1SBBB 3A8KE 2F0HA 5C0XJ 1SEBD 4O1NA 2LS01 4Q5VA 3NK9A 2B2WA 2KECA 1DOLA 2UUAL 1TU2B 4FF4A 3CPWA 1NE3A 4IQZA 4JI6Q 1Y69U 1DM0B 2CVRA 2F0GA 4YY3Q 2NVXB 4DFAA 1LTBD 4NP5A 1RIPA 1YNJC 5DNFA 1IBKQ 2NBFA 1LTSD 4DUZL 2NTTA 4LF4Q 3S24A 1AE3A 1PDQA 2RQXA 2L15A 4F88A 1F9QA 4DKAC 4JV5Q 1Y1WB 2QEJC 5TSSA 1CUKA 1DJRD 2FHTA 2MJ8A 1VQ4A 4CDFC 3UDGA 1YHBA 1SNMA 4LJZC 2UUBQ 3C46A 4BY7H 1JWUD 3S1MB 1R4QB 3NTIA 2HDLA 3RUZA 3EN2A 3FVQA 3I4NH 3M85A 1HH2P 4HJAA 1BVSA 1AZPA 4OIJA 4DK1A 4CBVA 1NBWA 3J81c 1FGUA 2D5DA 5EJWA 4P72A 5KGUA 3J80E 1SNPA 4YCWA 3RLFA 1HRJA 3QOLA 2OQ0A 2IHFA 4LFBL 2N8NA 1A8VA 1ILPA 1TT2A 2R92B 2QDLA 4IOAA 2Q2HA 3W5OA 3KOJA 1NCVA 2EY5A 4LF7L 1U4PA 4GKKQ 4XQNA 2LXKA 3P20A 1PH5A 1TWFB 2SNSA 4U68A 5T1GA 2R93B 5IE8A 1CK1A 1TR5A 1IBMQ 2G9HD 4HSVA 4A3DH 5FK9C 3AEVA 4IFDG 3IFDA 4QMGA 3SK4A 4IUQA 2R92G 5C4XB 3I4OA 4C3IB 5GAHC 1EY4A 1GUGA 4WORA 4IOCA 2D62A 4ID6A 2I5LX 2B63H 4A3LH 3FPUB 1JJGA 3HG9A 1EY7A 2PI2A 1AW7A 4H44C 1KAWA 1PH2A 3T51B 3QR8A 1E22A 3TP7A 3IRBA 4ZQ3A 4EGVA 2GA4B 4A3EH 3M3YB 3GTOH 4O2DA 2VQFQ 1KIXA 3MA2B 1YJWA 4MZ9A 5J39A 3I90A 2R7FA 2EXDA 3A8JE 4L8JA 4UP9A 3HOXG 1VQJA 1M8AA 1WCMG 4DV5Q 4JI2L 1FL0A 3FKIG 2EXZA 3G71A 4KKSA 4KD3A 2Q2IA 2BDOA 4CHTB 1WVLA 5K36H 1QWYA 1KLUD 1BO0A 1IXRA 1PTOD 2DJFC 3PV0A 5ELEA 3TDQA 4ZLTF 4NXML 1IYJB 3K8AA 1TWGB 5M5YH 2FFKB 1XXGA 3NBIA 1UEBA 4IUNA 1K0RA 1ESRA 2K5NA 5IP9G 5I6YA 5C44G 4HIMA 4A3GH 1C0AA 3E6ZX 4A3IH 2HCCA 3FDTA 4RKLA 1ILQA 2EYJA 5G3LF 1DCZA 3U4VA 1JWSD 3I4MG 1JJ2A 3H3VC 5LMUL 3FEWX 5C0XH 1VF5C 3HKZG 1MKHA 1MBYA 3CHBD 2Z4IA 1QZGA 1SYBA 3J81E 1NTGA 4WFN3 4B3MQ 1I4RA 1VQHA 2D2CC 4A3JB 5AJ3L 3ERSX 2KVMA 2KHJA 4DAYA 2VUMG 3A0JA 4DAVA 1C8CA 1GUWA 4DNTB 5J1ZA 3I2ZA 1NNXA 4KHZA 2SDFA 2ZM6L 2ZTEA 1A62A 2GN5A 2PPBC 2UXDL 4YY3L 4S3SA 2NVTH 4FO2A 2JJQA 1M1KC 3OIPA 1IBKL 2RHQB 4FF3A 1EUJA 2R61A 2RCNA 1YI2A 2B2WC 3EJIA 1PRTF 2L0CA 5M3MH 2XWBB 2VQEQ 2VB2X 2BA1A 3G48A 5CV5A 5T1IA 4JV5L 1JR0D 3U9SA 5IWAQ 4KJNA 4K2KA 2JA7H 3J7AV 1OXUA 1SLJA 1Q81C 4B3RQ 1IBLQ 1BCPB 4OX9Q 4YCVA 2Q2UA 4ILWA 2MO0A 4KHVA 5NUCA 2OXPA 1KL9A 3LWUA 3CCSA 3J7A5 1AE2A 4PMWA 4UHVA 2D9UA 2QA4A 4FXKC 1DD2A 4OIKA 1YHQA 4ZYSA 2BOSA 1FR3A 4IPGA 4X3TA 4A3MB 4C3JB 2KUMA 4DV6L 3D4RA 5CV7A 1F77A 4BY7G 2EYHA 3AQQA 4CGYB 5IGFA 2F3IA 3I4NG 3CRKC 1SR3A 2B3GA 5JEAG 1EIHA 1S3OA 2QCPX 2OQKA 2YU9H 3UDXA 2NN6H 2C9OA 5A35A 3ZJYC 2K5VA 1BOSA 4A3KH 4DUYQ 4MNOA 2A6HC 4IURA 3J81j 3URYA 3FHWA 4GKJQ 1EWIA 2B2UA 1HQRD 2K01A 2IX0A 2DY8A 3CXCA 3MFGA 4RWSC 1SNDA 2E2IB 3BVGA 1ML0D 2KA7A 2CKZB 4KKTA 4KN7C 2X6LA 3GV6A 1EU4A 1A3TA 1E2ZA 5GROA 1JICA 3TSSA 2QF7A 1LACA 2JK8A 4DR2Q 2Y0SB 1R9TH 3PO2B 2FMMA 5HGTA 4A3DG 3K5LA 5C3XA 4FYDA 3I55A 4LAAA 3JC66 2ES2A 2ZXRA 3FRPB 3HOVH 1XNRL 4ODGA 3HEJA 1W3SA 4JI3L 3F2UA 2B63G 2VQFL 1YIJA 4FF2A 3DWPA 3AB9A 5EQ0A 1WTWA 3NQIA 1E7ZA 2IX3A 4A3LG 4K0KL 5M9OA 3P1HA 1SMYC 1PA6A 2B2VC 3K5OA 5ELDA 3FMCA 4LFCQ 2EYLA 5HY6A 1CZWA 1G91A 1A2UA 1HPCA 4A3EG 3M9BA 4XQJA 1VQ6A 4OO1I 3S1QH 1HTLD 3SXHA 1GHJA 2L12A 2XN9C 4GZYC 3T1YQ 3GTQB 2KCTA 5IOCA 1L1OC 4IFDI 2E2HB 4R4OA 2F0UA 4QCLA 2EJFC 2Q2TA 2FMCA 3IKJA 1PTOH 3GTLH 3A5UA 1DYQA 5K36G 3DM3A 2E2JH 1LTAD 2VL6A 5A2QL 1D1KA 2X69A 5D65A 1ENCA 2JA6B 3KJOA 3RNUA 3OWFA 4LWCA 2K28A 2VB3X 5IY0A 2ZTDA 3LGJA 3K7UC 1B8AA 1LABA 4OXPA 3E0EA 1Q86C 4B3TL 3A5ZB 1BBWA 1HZCA 1H95A 2HUGA 4A3GG 4B3ML 4BA1I 4A3IG 1Q1BA 2AMCB 2Z6BA 4B3SQ 1WTVA 5IP7H 5KYIA 4LNQA 4YHHL 2N49A 4RGMA 1GUSA 3RZDB 5C0XG 3GTKB 5BN4A 1K8AC 4CKEA 1PTOF 4F87A 2F0QA 1AFPA 3Q6SA 3MEFA 4LUVA 3SHLA 5J22A 2IY5B 3MZ5A 2WB1E 1VQBA 3BZDB 1HNXQ 4I65A 3RN2A 2PZUA 2PQAB 4PMBA 2K5WA 4JG2A 5C3WA 4DV0L 2WACA 1D6EC 1K3BC 5CC4A 1VS0A 4B3RL 1IL2A 1S40A 4DR1Q 1PYWD 4ME5A 4L63B 3MHBA 4DNRB 4LF8Q 5LMNL 2PYKA 1KHIA 3MWYW 5M3MG 2NVXH 3BVMA 2EYFA 4AYBE 1B1ZA 3T16A 1Q1EA 3TEHB 1YJNA 2JA7G 1L2FA 4GOPC 4AIMA 1BCPD 4XTCS 1IL8A 4AQYQ 4ZKCB 5DAUA 1YITA 1VQ5A 5KNCA 3R3OA 3VR3A 2QEXA 3M4PA 2NYZD 1RTOA 3NXWA 1Y1WH 2JN4A 2R7DA 2AUJD 4UDUC 1D5XC 3C2PA 1QE6A 2PNRC 4K6LA 2F1MA 4GNXB 4UAIA 2CH4W 2GVAA 3S1MH 5I4DA 1DOKA 1SDFA 2JA8B 3JAML 1CKOA 1EIGA 3EROA 3CCMA 2JSOA 1V1OA 2DGYA 5JEAJ 2VXWA 4OHJA 4P75A 2KEDA 1B9NA 2F0WA 4OWWB 1B7YB 1NMFA 4L5QA 4OO1H 3GDEA 2QW7A 1D8LA 4DV2L 3KF8B 2PMZB 1EQRA 1X54A 3J80i 2BH2A 4GLVB 3K0XA 4N8X1 1EOVA 2NZHA 1XMQQ 4KKUA 4P71A 3WOEA 2AHOB 2NN6G 4N8FA 1HFNA 4A3KG 1FGBD 2JXMB 3S1NB 3G6EA 1HUNA 1DZ1A 5CMDA 4ALPA 4ZUIA 4X3SA 2K52A 1ET9A 4QY7A 4OEMB 1TWFH 2R93H 2O5JC 3CCQA 1FNVA 1E2VA 1EOTA 2PMZE 5IYBH 5ELOA 4WJWA 2EDGA 5G3LD 5C4XH 4C3IH 4ME3A 1VQEA 1GM5A 2KQ3A 1HNWL 4DGZA 3ND8A 4LFCL 2PW5A 5KNBA 3HOVG 1O7LA 2DUDA 2NVYB 1DXMA 4DU9A 2E76C 3ZYYX 3T1YL 1AZQA 1SE2A 3I8ZA 1SE8A 4JI8L 1EL0A 4A93B 2Z8LA 3M3YH 1Z6HA 1QVGA 4NKLA 5FJ8G 3TZUA 5D14A 4G7ZC 2F0OA 1F9SA 2KENA 4ZK9B 1W2BA 1BQQT 3N6RA 3PUXA 5EKKA 4JI0Q 3JAMc 3V2TA 4QL5A 1PLFA 4EQPA 4X64Q 1J8IA 3BYTB 1QNKA 4JI1L 2SNMA 4KMUC 1V1PA 2IX1A 1EEFD 1PTOC 2A69C 4J8QA 4FXDA 1DGSA 3DWAA 1IYVA 2M00A 1A15A 1TWGH 2YV5A 4GS3A 3GTJB 5KIXA 5EPJA 3AMUA 4HEDA 3OIQA 4RKBA 4JW0A 5CGKA 4PZ8A 1AEXA 1HZBA 2VNUD 5A2QE 1SFOB 2V4DA 4WJ4A 2ZXOA 4HN7A 1CM9A 3DM1A 1XMOQ 4GN3B 3BU2A 2ASBA 2PO4A 2UUCQ 4KTAA 3DEPA 3ULLA 3ULPA 5IP7G 1STEA 3NSWA 3A7AB 5BR8Q 3W2DA 4DAPA 2Q8TA 5K5PA 5JJZA 3J81i 4A3JH 4YWKA 3K5MA 1CKMA 2F0LA 2LXJA 2RBMA 1WTOA 1XNQL 4U673 3GTGB 5BN3A 3PF5A 3VDYA 3K59A 1Q46A 1J6QA 1WTHA 1N36L 1SYGA 1O80A 2HQEA 3UE0A 3KFUA 3OW2A 1X65A 5C5LA 4DV7L 3W1GA 4X66L 1I94Q 3HFZB 3VR2A 4A3CH 2EY1A 4IZ8A 4KJOA 3S14B 1TS5A 3H91A 4Y7NB 4KY7A 2OTJA 1EEID 4A3FB 1R4PB 4NB3A 5HGQA 5C0XI 2IL8A 2VW9A 5IGGA 3OYYA 3SVMA 3KLRA 5IGEA 1Q90A 5JEAH 2ZXPA 4TSSA 4JI7Q 1H9MA 2IHEA 5FO7B 2XTIA 1ONLA 1I4PA 4LMQD 2ICIA 3TRZA 3PGZA 3L0OA 3R2TA 1LUZA 1RD9D 5C3EB 5HURA 2K14A 3VA7A 3RN5A 1Y1WG 1F2ZA 1JE4A 4HR7B 4A3MH 3KK7A 2L1BA 4C3JH 1WFQA 4I7AA 4ZRZA 1LV9A 2LSSA 3NTKA 1XMQL 1WTXA 3QJYA 1C48A 2RVLA 3TMEA 2FXQA 4LF9Q 1WTRA 3M4YA 1X3EA 4XYQA 3D8GA 3NENA 3A56A 1DOMA 1PH9A 4JYAQ 4OO1G 1HZ9A 3TREA 5KNDA 2K05A 2EJMA 1TS3A 1G6PA 3PF4A 2G9DA 1BCPF 3RMHA 1PH3A 4UPAA 1LTTD 1O7ZA 4XT3B 1Y1VB 1ENAA 4DA2A 3R93A 1SJHD 1W6KA 5E4XA 2BDNA 4K8IA 2O4XA 4X62Q 5D3DA 1STNA 1KNAA 4K8JA 4NXNQ 1HNZQ 2F4IA 4BA2I 4LFAQ 3KBGA 3A54A 5EBCA 2E2IH 2CQAA 3I73A 1YHAA 2GVBA 2WAQB 3QIAA 3HOZB 1TXYA 3HS0C 1EFWA 2R93G 5DM63 1D2BA 1EYDA 1OXSC 3PO2H 1Y14B 2UXCL 3X3NA 2C5CA 2B29A 3PMFA 5I2XA 5IYBG 1EIYB 3M4QA 4DF7A 2B2YC 1Y1VG 2RA4A 1EFID 2HQLA 4C3IG 2NN6I
chains in the Genus database with same CATH topology
2MPMA 1BXTA 5KEEA 1V1PB 2A6EC 3GP7A 3QO2A 1ZKOA 2A69D 5JVH3 1S5DD 3K0YA 1LLRD 5CV8A 1D1IA 2A5HA 2WINB 2A68C 2R7ZB 5M3FB 1QB5D 5F2DA 1A3VA 1OXTA 1GUOA 2Q8IB 2NZ1D 5FO8B 1JCKB 4K14A 2EE1A 3HOYB 3RD4A 3OSOA 1L0YB 2EY2A 2DNEA 1ESFA 3R2IA 4EQOA 2A73B 4IALA 2EZVA 2XSCA 3OMGA 1KABA 1QG7A 3PUZA 1X3PA 2IT1A 1MD2D 3V96A 1PZID 4RFBA 1ZXTA 2F0FA 5ELCA 1PFMA 1B3AA 3OMCA 5FKAC 1CA6A 1B44D 2KCNA 3ERQA 2K1BA 5JOBA 4HTHA 4BWGB 5DM73 2R6GA 2K33A 2I07B 2F0TA 4TRDA 1U4LA 3PO3B 2NVQB 2HCIA 4RGOS 1KNEA 2JP1A 4WRDA 1HUMA 1M4VA 4G7OC 2B8GA 2XVSA 2AQ2B 2F0PA 2EYPA 1BCPC 2SOBA 3BDLA 3D4WA 4HMIA 2EOTA 1STHA 1RF2D 2B2TA 5C4ZA 3KLSA 3BVZA 3P75A 4C3JG 3S2HB 2JEBI 3EVQA 2K6AA 3VA5A 1Y8NB 1HQMC 1RJTA 3T56B 1CTMA 2L9HA 3S2DB 3KF8A 3SK8A 1TQOA 1B2TA 2ID0A 3H09A 4QUCA 3IFTA 1EQVA 1CA5A 2A6ED 2WKCA 3ITPA 1D5ZC 4KI0A 1Y8PB 4IUTA 1L0XB 1SJED 2FJ2A 3C1EA 4Q0FA 1F2MA 4C2MB 1TY0A 1VF7A 4RGNA 4IUUA 2A68D 1TS2A 1IW7C 2EPBA 4ULLA 1H9JA 1HCZA 1TS4A 2J0TD 5IGBA 1HA6A 1VDZA 3I3CA 4ZAIA 1PFNA 2F0IA 3N52A 4FVMA 4QUFA 2R3ZA 3A55A 1A6XA 3GTPB 4OGQC 3BDOA 3Q24A 3KUPA 2K32A 1GHKA 2WB1B 3HOWB 3HOUB 2MP1A 3LWEA 3MFYA 1PRTB 1ZYRC 4N9PA 4P2CB 1LT4D 3IL8A 4BBRB 1I3QB 3MXNA 2QDBA 3H0GB 3QWNA 5JAVA 2F0JA 3KLSX 5E3FA 2E75C 4AYBB 1BUVT 3UI2A 1X32A 4ABNA 5CORA 1EU3A 4R8NA 1MGSA 2AQ1B 3TBIB 4RCOA 2NN6I 4CJ2C 1CI3M 1JOQA 1W6JA 4MHEA 3GO5A 1TWHB 5CBEE 5COYA 2WKDA 1B53A 5ELBA 3D4DA 3OWEB 1NSNS 3AU7A 3E0JA 3L9AX 2XIWA 1KTKA 2IPKD 3J80L 4O42A 2F0KA 3IAYA 1EWHA 3DMUA 5CV6A 2RSOA 4KY6A 1YNND 2LY7A 3BYYB 2AUKA 5EPLA 3S1RB 3SR1A 2JEAI 3GQBA 2RDGA 2B2TC 5FOBB 3PIO3 2K5DA 4IUPA 2B2UC 1ZEQX 1TWAB 1CZGA 3NWSA 1BDOA 3TP5A 1SE4A 1IW7D 2NB0A 4H0LC 1STGA 3GD7A 3R8BA 2HDMA 4RHSA 1SYCA 1Q12A 2PZTA 4CKCA 5I9OA 3GV3A 3OW7A 1II3A 2JYOA 1MSGA 2CW0C 1H9KA 1Z47A 1LTID 3D6CA 3NE5B 1Z7TA 1A2TA 1IYUA 4KY5A 4DXGA 1I50B 1LTRD 3MXUA 4OL7A 1RDPD 2J4XA 3NQTA 3ONAB 4BBSB 2N55A 1ZYRD 3SK6A 2MUYA 3D31A 3P7JA 4R9WA 2I46A 3FPPA 1EZ8A 4R8IA 1EY0A 3J7AF 2Z4HA 4BY1B 2KHSA 3H6MA 4EQNA 2L5TA 2LKVA 1GXDC 1O78A 2F0VA 4RA8A 5IGCA 1EWCA 2DN8A 4RCNA 1CHQD 2JA5B 2RKSA 3DUZA 1WD0A 4IUVA 3J81L 3GTMB 3BDCA 3VYSA 1JQYD 1RODA 1T5XD 4V0BA 3G7LA 1SXTA 2O5IC 1NUCA 5E4WC 5D3IB 5KYLA 1JB3A 2TSSA 4I7ZC 1X3QA 1XTCD 3ND9A 1XWEA 2XRQD 4IN3A 5C4HA 4XYOA 1EQTA 4K5WA 5EGTA 1KDCA 5M5XB 3PIP3 2DNCA 4JBWA 1S4ZA 5C4JB 1LT5D 1NR4A 3K6OA 4NDXA 1RHPA 1J9OA 4XIGS 1EY6A 2F03A 5FLXL 3C3LA 1IHZA 3KBXA 2AWNA 1TWCB 2IWHA 2BE5C 5CYUA 3MXPA 3MTSA 1SYEA 2IW3A 4QB4A 2OEOA 4HAEA 4A3BB 3K7AB 3HGBA 4FP5D 1UAPA 1AP0A 2QKIC 1KDBA 1FYCA 4J6HA 1STBA 3S15B 5M5WB 1HXYD 4EVOA 3K5NA 1OXXK 1XYIA 1EY8A 1V43A 1EZ6A 4N9TA 5KRUA 1Q3LA 3S16B 4HMJA 3CQZB 2L4NA 1A3UA 1SE3A 1SNQA 4RHRA 3JAME 5IGDA 1PZKD 3HRZC 4KD4A 4C3HB 4FNFA 4B08A 2CW0D 4LK1C 1F9RA 4K2LA 1QJOA 1I4GA 2OT2A 3E5SA 1JOKA 3PUWA 3T13A 3VYRA 1EY5A 2E2DC 2K5QA 2KEEA 3HOXB 1WCMB 1IKMA 1S5CD 2KCCA 4MIUA 3FKIB 4XDXA 1AN8A 3T4AC 4C3HG 3SE0A 3EQLC 1LTGD 2EJGC 1SNOA 1I6VC 3TZDA 2B2VA 1CHPD 5I2YA 4QIWB 3W3AA 1OO9B 4PNYA 4C1NK 2JE6I 4DK0A 2RSNA 1K83B 1KDAA 1I6HB 5C44B 3H94A 1GJXA 5JPMC 1MI2A 2X6GA 3M4OB 2M2LA 3I4MB 4KV6A 4KN4C 3Q23A 3RZOB 1CQFA 1U4MA 3MXGA 3HKZB 2F0MA 1STAA 1QILA 1NAPA 3C1FA 2SEBD 5CBAE 2VUMB 1D5MC 4Z9CB 2L55A 1Y8OB 4M1UB 4PV1C 5IT9L 4H7BA 4B9XA 2AWOA 2AQ3B 2EYOA 5JPNC 1SYDA 3L3OC 5BN5A 1FNWA 5EKLA 4RAUC 1YNJD 3NBHA 1ICWA 2O2LD 1E0BA 1BR9A 2BE5D 1B50A 1S5ED 1HHVA 3DXJC 4CKBA 5CV9A 4ZUJA 3OPOA 1K8MA 1G8ZD 1FNUA 3DWQA 4XQQA 4BY7B 1WTPA 4HSPA 1WD1A 5AFWA 3K58A 2PW7A 5CR3A 2TMPA 3I4NB 4FF1A 5CV4A 5DEHA 3QOJA 4PQXA 3I4LA 1EY9A 1UEAB 2F0EA 2LFNA 3TN2A 1C4QA 4K6DA 5EKIA 1STYA 5I6WA 3LNNA 5FLXE 1ENFA 4NMZA 3A8IE 3D6WA 1H9SA 2B39A 2MGSA 1I4QA 1K8OA 4TKOB 3VR5A 4L6TB 4A3DB 3DHQA 1YNNC 3Q22A 1JOOA 1SNCA 2B8FA 4HCSA 1VCIA 2K7VA 2M9VA 1BBXC 1HFGA 2Q8RE 2K03A 4MN3A 2B63B 4HCEA 1TIID 1V8QA 2WP8J 3PUVA 2Z1CA 3V05A 3A7LA 2IJ0A 3VR4A 1F2YA 4H13C 3SDZA 1OXVA 4IFDJ 2BA0A 4G4KA 2OF1A 5ISRA 4DN4M 4M8AA 4A3EB 1CFMA 4C56C 1RCVD 3GTOB 2H1EA 3U9OA 1PXUA 3I72A 5C5MA 4QF4A 1KLGD 3J7YW 2EYMA 2F0DA 5IIFA 3Q0AA 1TKWB 2XRSD 3K57A 3WOFA 1IKLA 3NHHA 5M5YB 4RGTA 3NTHA 4ZKBB 2L11A 4A3GB 4A3IB 5LHY1 1GUTA 1PZJD 1CQVA 3X3MA 3HZXA 1TVXA 2KOLA 5EBDA 2DY7A 1VMCA 1I4XA 2PZWA 3WDNA 2PQEA 1B4OA 4YIJA 1U9RA 3NWTA 3NP8A 5I9PA 1I4HA 4JK1C 5LL6S 5JVG3 2NWGA 3BS1A 2NVTB 3MAQA 1KAAA 1GOZA 5E1FA 2FINB 3TP8A 3I91A 2J7ZA 1PRTC 2LMCB 1PMRA 4TQUS 3SEBA 2WIIB 1DONA 5M3MB 5IT9E 2ENBA 4XT1B 2CHBD 4CJ0B 3L7ZC 1ET6A 2JA7B 4RH6A 2EY6A 3LX0A 3DEOA 5LL6X 1H9SB 2XNAC 1GUNA 3CU7A 3HP3A 4F8MA 1HTPA 1SSOA 1VMPA 2PCFB 1TY2A 4X3UA 3EA6A 3OOCA 1G6ZA 4V190 2F0NA 3QG1A 3TP6A 1F2LA 3SK5A 1LO5D 2RDFA 4CJ1B 3MEHA 3QB3A 2YYZA 1T5EA 3VYUA 2E74C 2YU9B 5ELFA 3NPPA 2A6HD 1LT6D 4NW2A 4J1MA 4A3KB 1QNUA 5IODA 2A74C 4FXGC 4DXFA 1Q8IA 1QOHA 1SYFA 2H4OA 3MVVA 2NTSA 2EVBA 3T53B 1RTNA 1SAPA 4C1NI 3S17B 3O13A 2WV6D 4IFDH 2F0SA 1R9TB 2KJXA 4K5XA 3NUCA 4G57A 1MSHA 4G7HC 2NUCA 2MHVA 3S9WA 2ZT9C 3HOVB 1CT1D 2BCOA 3PUYA 1B9MA 3EFXD 1SMYD 1U4RA 3MC0B 1G2TA 1WTQA 1JORA 3VR6A 2QILA 3D3RA 3I70A 1UUPA 2F3VA 3S1QB 3M7GA 2B2YA 1JWMD 1FD7D 1BF4A 1NR2A 4F7XA 1EYAA 4X3KA 4PMCA 1HA5A 1PTOB 4B9WA 1E2WA 3GTLB 1F9PA 2E2JB 1S5FD 1BNZA 3OHXC 1G2SA 1UNSA 1G291 1JC7A 2N88A 3BG3A 2RDHA 3VYTA 2F3WA 1H9RA 1PRTD 5C6AA 1XX8A 4XXEA 3CKIB 2ICEC 3G6JB 4E6IA 2K04A 2XWJB 4KK7A 5FO9B 1LT3D 3CRLC 4K5VA 5EPKA 1O7YA 1EYCA 1S5BD 1RKNA 1PFBA 1QCBD 3M7NA 1SBBB 3A8KE 2F0HA 5C0XJ 1SEBD 4O1NA 2LS01 4Q5VA 3NK9A 2B2WA 2KECA 1DOLA 1TU2B 4FF4A 4IQZA 1Y69U 1DM0B 2CVRA 2F0GA 2NVXB 4DFAA 1LTBD 4NP5A 1YNJC 5DNFA 2NBFA 1LTSD 2NTTA 1PDQA 2RQXA 4F88A 1F9QA 1Y1WB 2QEJC 5TSSA 1DJRD 2FHTA 2MJ8A 1SNMA 4LJZC 3C46A 1JWUD 3S1MB 1R4QB 3NTIA 2HDLA 3RUZA 3FVQA 3M85A 1AZPA 4OIJA 4DK1A 4CBVA 2D5DA 5EJWA 5KGUA 3J80E 1SNPA 3RLFA 1HRJA 3QOLA 1ILPA 1TT2A 2R92B 1NCVA 2EY5A 1U4PA 4XQNA 3P20A 1TWFB 2SNSA 4U68A 5T1GA 2R93B 1CK1A 1TR5A 2G9HD 4HSVA 5FK9C 4IFDG 3IFDA 4QMGA 3SK4A 4IUQA 5C4XB 4C3IB 1EY4A 1GUGA 4WORA 2D62A 4ID6A 3FPUB 3HG9A 1EY7A 1AW7A 4H44C 3T51B 3TP7A 4ZQ3A 4EGVA 2GA4B 3M3YB 3MA2B 5J39A 3I90A 4L8JA 3A8JE 1M8AA 2EXZA 4KKSA 4KD3A 2BDOA 4CHTB 1WVLA 5K36H 1QWYA 1KLUD 1BO0A 3TDQA 4ZLTF 1PTOD 5ELEA 3PV0A 1TWGB 2FFKB 1XXGA 3NBIA 4IUNA 1ESRA 5I6YA 3E6ZX 2HCCA 3FDTA 4RKLA 1ILQA 2EYJA 5G3LF 1DCZA 1JWSD 3H3VC 3FEWX 5C0XH 1VF5C 3CHBD 1MBYA 2Z4IA 1SYBA 3J81E 4WFN3 1I4RA 2D2CC 4A3JB 2KVMA 4DAYA 4DAVA 1C8CA 1GUWA 4DNTB 5J1ZA 4KHZA 2SDFA 2PPBC 4S3SA 4FO2A 3OIPA 4FF3A 2R61A 2B2WC 3EJIA 1PRTF 2L0CA 2XWBB 2VB2X 2BA1A 5CV5A 5T1IA 1JR0D 3U9SA 4KJNA 4K2KA 3J7AV 1OXUA 1BCPB 4ILWA 4KHVA 5NUCA 2OXPA 3LWUA 4PMWA 2D9UA 4FXKC 1DD2A 4OIKA 4ZYSA 2BOSA 1FR3A 4X3TA 4A3MB 4C3JB 2KUMA 3D4RA 5CV7A 1F77A 2EYHA 4CGYB 5IGFA 3CRKC 5JEAG 1EIHA 2QCPX 2NN6H 2C9OA 5A35A 1BOSA 2A6HC 4IURA 3URYA 2B2UA 1HQRD 2K01A 2IX0A 2DY8A 3MFGA 4RWSC 1SNDA 2E2IB 3BVGA 1ML0D 2KA7A 4KKTA 4KN7C 2X6LA 3GV6A 1EU4A 1A3TA 1E2ZA 3TSSA 1JICA 2QF7A 1LACA 2Y0SB 3PO2B 2FMMA 5HGTA 3K5LA 5C3XA 4FYDA 4LAAA 2ZXRA 3FRPB 4ODGA 3HEJA 3F2UA 4FF2A 3DWPA 3AB9A 5EQ0A 1WTWA 3NQIA 2IX3A 5M9OA 3P1HA 1SMYC 2B2VC 3K5OA 5ELDA 3FMCA 2EYLA 1G91A 1CZWA 1A2UA 1HPCA 4XQJA 4OO1I 1HTLD 3SXHA 1GHJA 2L12A 2XN9C 4GZYC 3GTQB 5IOCA 4IFDI 2E2HB 2F0UA 4QCLA 2EJFC 2FMCA 3IKJA 1PTOH 1DYQA 5K36G 1LTAD 5A2QL 1D1KA 2X69A 5D65A 1ENCA 2JA6B 3OWFA 2K28A 2VB3X 1LABA 2HUGA 4BA1I 1Q1BA 1WTVA 5KYIA 4RGMA 1GUSA 3RZDB 5C0XG 3GTKB 5BN4A 4CKEA 1PTOF 4F87A 2F0QA 1AFPA 3Q6SA 5J22A 3SHLA 3MZ5A 3BZDB 4I65A 2PZUA 4PMBA 2K5WA 5C3WA 2WACA 1D6EC 5CC4A 1PYWD 4ME5A 4L63B 3MHBA 4DNRB 2PYKA 3MWYW 3BVMA 2EYFA 1B1ZA 3T16A 1Q1EA 1BCPD 4XTCS 1IL8A 4ZKCB 5DAUA 5KNCA 3R3OA 3VR3A 2NYZD 1RTOA 3NXWA 2AUJD 4UDUC 1D5XC 3C2PA 1QE6A 2PNRC 4K6LA 2F1MA 4UAIA 5I4DA 1DOKA 1SDFA 2JA8B 3JAML 3EROA 1EIGA 2JSOA 1V1OA 5JEAJ 2VXWA 4OHJA 2KEDA 1B9NA 2F0WA 4OO1H 2PMZB 4KKUA 3WOEA 2NN6G 1HFNA 1FGBD 2JXMB 3S1NB 1HUNA 1DZ1A 5CMDA 4ZUIA 4X3SA 1ET9A 2O5JC 1FNVA 1E2VA 1EOTA 4WJWA 2EDGA 5G3LD 2KQ3A 4DGZA 3ND8A 2PW5A 5KNBA 1O7LA 2NVYB 1DXMA 4DU9A 2E76C 3ZYYX 1AZQA 1SE2A 3I8ZA 1EL0A 4A93B 2Z8LA 1Z6HA 4NKLA 3TZUA 5D14A 4G7ZC 2F0OA 1F9SA 4ZK9B 1BQQT 3N6RA 3PUXA 5EKKA 3V2TA 1PLFA 4EQPA 1J8IA 3BYTB 1QNKA 2SNMA 4KMUC 1V1PA 2IX1A 1EEFD 1PTOC 2A69C 4J8QA 4FXDA 3DWAA 1IYVA 2M00A 1A15A 3GTJB 5KIXA 5EPJA 3AMUA 4HEDA 3OIQA 4RKBA 5CGKA 2VNUD 1AEXA 5A2QE 1SFOB 2V4DA 2ZXOA 4HN7A 1CM9A 3DM1A 2PO4A 4KTAA 3DEPA 1STEA 3NSWA 3A7AB 3W2DA 4DAPA 2Q8TA 5K5PA 5JJZA 3K5MA 2F0LA 2RBMA 1WTOA 4U673 3GTGB 5BN3A 3K59A 1SYGA 1O80A 2HQEA 5C5LA 3VR2A 2EY1A 4IZ8A 4KJOA 3S14B 1TS5A 3H91A 4Y7NB 4KY7A 1EEID 4A3FB 1R4PB 5C0XI 2IL8A 5IGGA 3SVMA 3KLRA 5IGEA 1Q90A 5JEAH 2ZXPA 4TSSA 1H9MA 5FO7B 1ONLA 1I4PA 4LMQD 2ICIA 3R2TA 1RD9D 5C3EB 5HURA 3VA7A 1F2ZA 1JE4A 4HR7B 3KK7A 2L1BA 4ZRZA 1LV9A 3NTKA 1WTXA 3QJYA 1C48A 2RVLA 3TMEA 1WTRA 3M4YA 4XYQA 3D8GA 3A56A 1DOMA 4OO1G 5KNDA 2K05A 2EJMA 1TS3A 2G9DA 1BCPF 3RMHA 1LTTD 1O7ZA 4XT3B 1Y1VB 1ENAA 4DA2A 3R93A 1SJHD 1W6KA 5E4XA 2BDNA 4K8IA 2O4XA 5D3DA 1STNA 1KNAA 4K8JA 2F4IA 4BA2I 3KBGA 3A54A 5EBCA 2CQAA 3I73A 2WAQB 3HOZB 3QIAA 3HS0C 5DM63 1D2BA 1EYDA 1OXSC 3X3NA 2C5CA 3PMFA 5I2XA 4DF7A 2B2YC 2RA4A 1EFID 4C3IG 4BS9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JOK A;  4RKL A;  3SR1 A;  4F8M A;  5KEE A;  5C5L A;  3T13 A;  2EYJ A;  5KGU A;  2F0Q A;  1SNP A;  1NUC A;  1EY5 A;  3QOL A;  5J22 A;  3SHL A;  4WRD A;  5C5M A;  4QF4 A;  5KYL A;  3MZ5 A;  2EY1 A;  4IZ8 A;  1TT2 A;  4KJO A;  4N9P A;  2F0N A;  5CV9 A;  1SND A;  2EYM A;  4KY7 A;  4I65 A;  4ZUJ A;  3TP6 A;  3SK5 A;  2PZU A;  5CV8 A;  4PMB A;  2QDB A;  2RDF A;  4MIU A;  1SYB A;  2F0P A;  3MEH A;  2EYP A;  2F0D A;  2F3W A;  2KQ3 A;  3QB3 A;  1A3T A;  4DGZ A;  2SOB A;  5C3W A;  5C4H A;  5IIF A;  5JAV A;  4K5W A;  2F0J A;  2PW5 A;  3BDL A;  2WAC A;  3D4W A;  4HMI A;  5EGT A;  5E3F A;  5CC4 A;  1KDC A;  5IGG A;  2EY5 A;  5HGT A;  2PW7 A;  3NHH A;  4DU9 A;  5IGE A;  5CR3 A;  5C3X A;  1STH A;  5C6A A;  5J1Z A;  4ME5 A;  5C4Z A;  3TP5 A;  3MHB A;  5CV4 A;  4J1M A;  2SNS A;  3QOJ A;  5DEH A;  4LAA A;  1SNO A;  1EY9 A;  2PYK A;  2F0E A;  3P75 A;  1TR5 A;  4E6I A;  4ODG A;  1STG A;  5F2D A;  1A3V A;  5IOD A;  3HEJ A;  4K6D A;  4NKL A;  4PNY A;  4S3S A;  1SYC A;  1STY A;  4NDX A;  2EYF A;  2PZT A;  5HUR A;  2F0O A;  3EVQ A;  4K5V A;  3T16 A;  5I6W A;  5I9O A;  1F2Z A;  4QMG A;  1KDA A;  5M9O A;  1EYC A;  1EY6 A;  1II3 A;  4K14 A;  3SK4 A;  4NMZ A;  1SYF A;  3HZX A;  3P1H A;  3TME A;  5EKK A;  1RKN A;  3MVV A;  1EY4 A;  3EJI A;  3VA5 A;  3V2T A;  4R8N A;  4WOR A;  1IHZ A;  5DAU A;  4ID6 A;  4EQP A;  3R3O A;  3D6C A;  3OSO A;  5CV5 A;  2EYL A;  2PZW A;  3MXP A;  3NXW A;  3SK8 A;  1A2T A;  2F0H A;  2PQE A;  2SNM A;  1TQO A;  1A2U A;  2EY2 A;  1SYE A;  2F0S A;  4K5X A;  1U9R A;  4KJN A;  3NP8 A;  4K2K A;  4KY5 A;  1EY7 A;  4YIJ A;  3NUC A;  5I9P A;  1JOQ A;  4QB4 A;  2OEO A;  4G57 A;  3SXH A;  3D8G A;  2F0M A;  1EQV A;  3TP7 A;  3ITP A;  3NK9 A;  4OL7 A;  5IOC A;  2NUC A;  1STA A;  2F0U A;  3D4D A;  4ZQ3 A;  4EQO A;  3S9W A;  3NQT A;  2M00 A;  3ERO A;  4KHV A;  5NUC A;  2OXP A;  4IAL A;  3C1F A;  4KV6 A;  1NSN S;  2F0G A;  1KDB A;  3SK6 A;  3C1E A;  1F2M A;  5KIX A;  4J6H A;  1STB A;  3DHQ A;  2F0W A;  3E5S A;  4DFA A;  4NP5 A;  1JOO A;  1SNC A;  3OMG A;  1KAA A;  1KAB A;  4RKB A;  5E1F A;  3TP8 A;  5J39 A;  1ENA A;  5CGK A;  5ISR A;  1AEX A;  1EZ8 A;  1EY0 A;  4EVO A;  1JOR A;  2KHS A;  1EY8 A;  4K8I A;  2O4X A;  1EZ6 A;  1STN A;  4N9T A;  2F0F A;  1ENC A;  5CV7 A;  2EXZ A;  4K8J A;  2ENB A;  3H6M A;  2EYH A;  4KD3 A;  4H7B A;  4EQN A;  3OWF A;  4HMJ A;  5KRU A;  2LKV A;  3OMC A;  4B9X A;  1A3U A;  2F0V A;  5IGC A;  4KTA A;  5IGF A;  2F0K A;  2F3V A;  1SNQ A;  5IGB A;  1F2Y A;  1SNM A;  5IGD A;  5K5P A;  1EYD A;  3ERQ A;  3DMU A;  5CV6 A;  2F0I A;  5JOB A;  2EYO A;  2EY6 A;  2F0L A;  2RKS A;  2OF1 A;  3LX0 A;  3PMF A;  1SYD A;  4HTH A;  4KY6 A;  4ZUI A;  2RBM A;  3BDC A;  4KD4 A;  3RUZ A;  4F7X A;  2F0T A;  1EYA A;  4PMC A;  4TRD A;  5KYI A;  5EKL A;  4B9W A;  4DF7 A;  4IUN A;  4K2L A;  5I6Y A;  1SYG A;  2HQE A;  3U9O A; 
#chains in the Genus database with same CATH topology
 2MPM A;  1BXT A;  5KEE A;  4DR3 L;  1V1P B;  3BZC A;  2A6E C;  3GP7 A;  1XPO A;  3QO2 A;  1FJG Q;  1X6O A;  1ZKO A;  2A69 D;  2JQO A;  3F2C A;  5JVH 3;  1S5D D;  3K0Y A;  2WAQ E;  1PH8 A;  1E1T A;  1LLR D;  5CV8 A;  2QGQ A;  5JJI A;  1D1I A;  1Z9F A;  3B6Y A;  2P5Z X;  1SMX A;  2A5H A;  2WIN B;  2OTL A;  2A68 C;  4DV3 L;  2R7Z B;  3GTQ H;  1XJV A;  2E2H H;  2UXB Q;  2AKW B;  3UDF A;  5M3F B;  1QB5 D;  5F2D A;  1A3V A;  5H1S E;  1OXT A;  1GUO A;  2Q8I B;  2NZ1 D;  5FO8 B;  4DR7 Q;  1JCK B;  4K14 A;  4YCU A;  2EE1 A;  3WWV A;  1JE5 A;  3HOY B;  1VQC A;  3RD4 A;  4ZCK A;  2JA6 H;  1N34 Q;  3RR5 A;  3OSO A;  1K8G A;  1L0Y B;  5GAE C;  4KHP Q;  1P8L A;  1T9H A;  2EY2 A;  2DNE A;  1ESF A;  5BR8 L;  3R2I A;  2EQS A;  1K9M C;  1KD1 C;  4JI6 L;  4EQO A;  2A73 B;  4P74 A;  2MFI A;  4IAL A;  1KXL A;  2EZV A;  2XSC A;  2Z9H A;  3CCR A;  4R4I A;  3RZD H;  3OMG A;  2E5L Q;  1KAB A;  1QG7 A;  3PUZ A;  3GTK H;  1X3P A;  2IT1 A;  4LF4 L;  2UU9 Q;  1MD2 D;  1GD7 A;  3V96 A;  1PZI D;  4RFB A;  1I94 L;  1ZXT A;  2F0F A;  5ELC A;  3PCO B;  4A3J G;  4IPC A;  1PFM A;  1B3A A;  3OMC A;  5FKA C;  1CA6 A;  1MHW C;  2UUB L;  1B44 D;  1VQI A;  1Q8K A;  2KCN A;  2F4V Q;  3ERQ A;  2K1B A;  2MQH A;  4HTH A;  5JOB A;  2PQA A;  4BWG B;  5DM7 3;  2R6G A;  2K33 A;  2I07 B;  2F0T A;  1VQN A;  4TRD A;  1U4L A;  3PO3 B;  2NVQ B;  3F2D A;  3RLN A;  4A3C G;  2HCI A;  1IZ6 A;  4BS9 A;  4RGO S;  4R1J A;  1KNE A;  2JP1 A;  4WRD A;  1HUM A;  1M4V A;  4X6A H;  1VQO A;  4G7O C;  4DV1 Q;  2B8G A;  2XVS A;  2AQ2 B;  4AH6 A;  2F0P A;  2EYP A;  1BCP C;  3STB D;  2SOB A;  3BDL A;  3D4W A;  4HMI A;  1UE7 A;  4GKK L;  4LF9 L;  2EOT A;  1STH A;  1RF2 D;  4DR4 Q;  4POF A;  2B2T A;  5C4Z A;  3KLS A;  1IBM L;  3BVZ A;  4OWX B;  2JA8 H;  4A3M G;  3P75 A;  4C3J G;  3S2H B;  1V1Q A;  2JEB I;  4GNX A;  1G51 A;  1N32 Q;  3EVQ A;  1B70 B;  4CDD C;  2K6A A;  1S72 A;  3VA5 A;  4X62 L;  1Y8N B;  1HQM C;  1RJT A;  3T56 B;  3AFQ A;  1CTM A;  2L9H A;  3S2D B;  1D7Q A;  1HNZ L;  3E9H A;  3KF8 A;  3SK8 A;  1TQO A;  2VZA A;  1J5E Q;  1B2T A;  2ID0 A;  4DPG A;  3H09 A;  4QUC A;  3IFT A;  1EQV A;  1CA5 A;  2A6E D;  2WKC A;  3S1N H;  3ITP A;  1D5Z C;  4IUT A;  1Y8P B;  4KI0 A;  1L0X B;  1JMC A;  1SJE D;  2FJ2 A;  4DNI A;  1BKB A;  3C1E A;  1F2M A;  4Q0F A;  1TY0 A;  4C2M B;  1VF7 A;  5GAG C;  4RMF A;  1ASZ A;  4DV5 L;  4RGN A;  4IUU A;  1Q7Y C;  5FJ8 H;  1NY4 A;  2A68 D;  1SRU A;  1TS2 A;  1IW7 C;  2Y0S G;  3PO2 G;  2EPB A;  4ULL A;  1H9J A;  1HCZ A;  1KRT A;  4JI5 Q;  2V1C C;  5JJK A;  1TS4 A;  2D0P A;  1WJJ A;  2J0T D;  4J15 A;  2E8G A;  5IGB A;  1HA6 A;  1VDZ A;  3I3C A;  4ZAI A;  1PFN A;  2F0I A;  3F8T A;  1JB7 A;  2ATW A;  2NVY H;  3N52 A;  4FVM A;  4QUF A;  1X56 A;  4QQB X;  4QGU A;  2BH8 A;  2R3Z A;  3A55 A;  3G4S A;  4A93 H;  2OWO A;  2ZJR A;  1A6X A;  3GTP B;  4OGQ C;  1CSP A;  3BDO A;  3Q24 A;  3KUP A;  2HIV A;  4JI4 Q;  2K32 A;  2H5X A;  4DR7 L;  1GHK A;  2WB1 B;  3CAM A;  3HOW B;  3HOU B;  2MP1 A;  3LWE A;  3MFY A;  2K4K A;  1PRT B;  5IYD H;  1ZYR C;  4N9P A;  4P2C B;  1LT4 D;  3IL8 A;  5E7N A;  1WYD A;  4BBR B;  1I3Q B;  3MXN A;  1N34 L;  4BY1 H;  2QDB A;  3H0G B;  3QWN A;  4R4T A;  5JAV A;  3S17 H;  3Q8D A;  2MO1 A;  2F0J A;  3KLS X;  5E3F A;  3NBH B;  2Z6K A;  4LF6 Q;  2E75 C;  3W1B A;  5FLM H;  1A63 A;  3GTJ H;  2JA6 G;  4AYB B;  3RLO A;  1QUQ B;  1BUV T;  3UI2 A;  1X32 A;  1SFO H;  1EYG A;  2EIF A;  4ABN A;  1Q82 C;  2UU9 L;  2VQE L;  1V9P A;  5COR A;  4LF5 Q;  1EU3 A;  4R8N A;  4BBR G;  1MGS A;  2AQ1 B;  5IWA L;  3TBI B;  4RCO A;  1WI5 A;  1IBL L;  4OX9 L;  4Y52 H;  4CJ2 C;  1CI3 M;  1JOQ A;  1EIF A;  1W6J A;  1VQ7 A;  4MHE A;  3GO5 A;  1P16 A;  1TWH B;  5COY A;  1YEZ A;  3FP9 A;  2WKD A;  5CBE E;  1B53 A;  5ELB A;  3D4D A;  2CCZ A;  4BXX H;  2NZO A;  3OWE B;  1NSN S;  3AU7 A;  2UUA Q;  3GTG H;  3E0J A;  5IYC H;  3L9A X;  2XIW A;  1KTK A;  4P73 A;  1UE5 A;  1GKH A;  4DUZ Q;  4WJ3 M;  1VQG A;  2IPK D;  3S14 H;  4DV1 L;  3J80 L;  4Y7N H;  4A3F H;  1QVF A;  4O42 A;  2F0K A;  3IAY A;  1EWH A;  2ZTC A;  2N3S A;  3DMU A;  5CV6 A;  2RSO A;  4KY6 A;  1YNN D;  2LY7 A;  1RL2 A;  4DUY L;  3BYY B;  2AUK A;  5EPL A;  3S1R B;  4GKJ L;  4A3B H;  4DR5 Q;  3SR1 A;  2JEA I;  5C3E H;  3GQB A;  3KLW A;  3CP0 A;  2RDG A;  2B2T C;  5FOB B;  4LFB Q;  3PIO 3;  2K5D A;  1PH4 A;  4DR2 L;  1CSQ A;  4IUP A;  2YTV A;  2B2U C;  1ZEQ X;  3U50 C;  2JA8 G;  4GNX C;  1HR0 W;  3A74 A;  4EQ5 A;  1TWA B;  1CZG A;  3NWS A;  1BDO A;  2XGT A;  3TP5 A;  4LF7 Q;  1SE4 A;  1IW7 D;  2NB0 A;  4H0L C;  1STG A;  3GD7 A;  3R8B A;  2HDM A;  4JBJ A;  3J7Z C;  4RHS A;  4C3H H;  1SYC A;  1Y1V H;  1Q12 A;  2PZT A;  4KLK A;  4CKC A;  5I9O A;  3GV3 A;  3OW7 A;  1II3 A;  2JYO A;  3ICE A;  1MSG A;  2CW0 C;  1H9K A;  1Z47 A;  1LTI D;  3CC4 A;  3D6C A;  3NE5 B;  1Z7T A;  4GN5 A;  1A2T A;  1IYU A;  4KY5 A;  4JI5 L;  3HOZ H;  4DXG A;  3CC7 A;  1HZA A;  1I50 B;  4GN4 B;  2I0Q A;  1LTR D;  3MXU A;  4OL7 A;  1RDP D;  2J4X A;  4RG1 A;  3PQI A;  3NQT A;  3ONA B;  4BBS B;  2K5H A;  2N55 A;  1ZYR D;  3J80 c;  3SK6 A;  3MXN B;  4JBK A;  2MUY A;  3D31 A;  3P7J A;  1AH9 A;  4QJF A;  2I46 A;  4R9W A;  3FPP A;  1EZ8 A;  4R8I A;  1EY0 A;  3E9I A;  4HJ5 A;  3J7A F;  2Z4H A;  4BY1 B;  2KHS A;  4JI2 Q;  3H6M A;  4EQN A;  2L5T A;  2LKV A;  1GXD C;  1E24 A;  1O78 A;  1I6H H;  2F0V A;  4RA8 A;  3U4Z A;  5IGC A;  1VQK A;  4X65 Q;  3AFP A;  1EWC A;  4A93 G;  2DN8 A;  3CCJ A;  4NXM Q;  4RCN A;  1CHQ D;  4B3S L;  2JA5 B;  4GLA C;  2RKS A;  3DUZ A;  1WD0 A;  4IUV A;  3J81 L;  3GTM B;  3BDC A;  2R7Z H;  3VYS A;  1JQY D;  1ROD A;  4LF6 L;  4LUZ A;  1VQM A;  1T5X D;  1VQL A;  3BZK A;  5IYD G;  5M3F H;  4V0B A;  3CCU A;  3G7L A;  1SXT A;  3CD6 A;  4BY1 G;  4HJ8 A;  2O5I C;  4UP8 A;  1NUC A;  1XTD A;  3KYH C;  5E4W C;  5D3I B;  1HNX L;  5KYL A;  1ASY A;  1JB3 A;  2TSS A;  3KDF A;  4LF5 L;  3HOY H;  4I7Z C;  1X3Q A;  1XTC D;  3ND9 A;  5LMU Q;  4JOI A;  2ZJQ A;  1N9W A;  2CWP A;  1XWE A;  2XRQ D;  4IN3 A;  4XYO A;  5C4H A;  1EQT A;  4K5W A;  5EGT A;  4DR1 L;  1KDC A;  5FLM G;  5M5X B;  3PIP 3;  4LF8 L;  3D0F A;  5AJ3 Q;  2DNC A;  4JBW A;  4YWL A;  1S4Z A;  3CCL A;  1BBU A;  5C4J B;  1LT5 D;  4A4I A;  1NR4 A;  2HT1 A;  4EX5 A;  3K6O A;  2ZM6 Q;  3U58 A;  1KQS A;  4NDX A;  2UXD Q;  1RHP A;  1YNX A;  1J9O A;  1PYB A;  4AQY L;  4XIG S;  2A19 A;  1EY6 A;  2F03 A;  5FLX L;  3C3L A;  1IHZ A;  1MJE A;  3KBX A;  2AWN A;  1O7I A;  1TWC B;  4BXX G;  2IWH A;  2BE5 C;  5CYU A;  3MXP A;  3MTS A;  1SYE A;  3OTO Q;  1X55 A;  2IW3 A;  4QB4 A;  2OEO A;  5IYC G;  4HAE A;  4A3B B;  3K7A B;  4JC0 A;  3HGB A;  4FP5 D;  1UAP A;  1AP0 A;  2QKI C;  2YTX A;  4L5R C;  1KDB A;  1FYC A;  3PO3 H;  2NVQ H;  4J6H A;  1STB A;  1JJC B;  2HHH Q;  3S15 B;  4DR5 L;  4GLX A;  5M5W B;  1HXY D;  4A3F G;  4EVO A;  3K5N A;  1OXX K;  4DR6 Q;  1XYI A;  1EY8 A;  1V43 A;  1EZ6 A;  3K81 C;  4N9T A;  5KRU A;  1Q3L A;  3S16 B;  4HMJ A;  4DV6 Q;  4IJH A;  3CQZ B;  2L4N A;  4R4Q A;  1A3U A;  4PZ7 A;  1SE3 A;  1SNQ A;  4RHR A;  3JAM E;  1N33 Q;  1K73 C;  5IGD A;  1C7Y A;  4A3B G;  1ICF B;  4NPS A;  1PZK D;  3I7F A;  3HRZ C;  3STB C;  4KD4 A;  4C3H B;  5C3E G;  1C9O A;  4FNF A;  4B08 A;  1EQQ A;  2CW0 D;  4LK1 C;  1F9R A;  4K2L A;  1QJO A;  3S2H H;  1I4G A;  2OT2 A;  3E5S A;  1JOK A;  3PUW A;  3KF6 B;  4JPB W;  3T13 A;  3VYR A;  1EY5 A;  2E2D C;  2K5Q A;  1U0L A;  2KEE A;  3HOX B;  1PV4 A;  2I5M X;  1WCM B;  1IKM A;  1S5C D;  2KCC A;  4MTK A;  3S2D H;  4MIU A;  3FKI B;  4XDX A;  3F2B A;  1AN8 A;  3T4A C;  4C3H G;  5FLX c;  3SE0 A;  3EQL C;  1LTL A;  1LTG D;  2EJG C;  1SNO A;  1I6V C;  3TZD A;  1B3Q A;  2B2V A;  1CHP D;  5I2Y A;  4QIW B;  3W3A A;  3CF5 A;  1OO9 B;  4C2M H;  4PNY A;  3H15 A;  2WFW A;  4MTN A;  1PH6 A;  1XNR Q;  4C1N K;  2JE6 I;  4DK0 A;  2RSN A;  1K83 B;  1KRS A;  4JI0 L;  1VQD A;  4JI3 Q;  2KHI A;  1KDA A;  1K3R A;  1I6H B;  3K80 C;  2WAQ G;  3HOZ G;  2C35 B;  2MNA A;  3H94 A;  5C44 B;  1CKN B;  4X64 L;  1GJX A;  5JPM C;  4K0K Q;  4CDC C;  4L5S A;  1MI2 A;  3F1Z A;  2X6G A;  1L1O A;  3EIV A;  2M2L A;  3M4O B;  4HJ7 A;  3I4M B;  4KV6 A;  4KN4 C;  4FDB A;  3DLL A;  3Q23 A;  3RZO B;  1CQF A;  1U4M A;  4X65 L;  3MXG A;  3HKZ B;  2F0M A;  1STA A;  3EBE A;  1QIL A;  3KDF B;  4QIW E;  1NAP A;  3C1F A;  3ULJ A;  2SEB D;  5CBA E;  3CPF A;  3CCV A;  2VUM B;  1D5M C;  3GTP H;  4Z9C B;  2L55 A;  1Y8O B;  4IPH A;  4DK6 C;  1VQP A;  1XMO L;  5ELN A;  4M1U B;  3HOW H;  3HOU H;  3CW2 C;  4PV1 C;  2UUC L;  2ZJP A;  5IT9 L;  4H7B A;  2CQO A;  2R7Z G;  4B9X A;  4BBR H;  1I3Q H;  3HKZ E;  2AWO A;  3H0G H;  5M3F G;  2AQ3 B;  4H02 A;  4B3T Q;  2EYO A;  5JPN C;  1QVC A;  1YJ9 A;  1SYD A;  3L3O C;  5C4X G;  5BN5 A;  1FNW A;  5EKL A;  4RAU C;  1YNJ D;  3NBH A;  1PH7 A;  1KC8 C;  1ICW A;  2O2L D;  1E0B A;  4JOI C;  1BR9 A;  2BE5 D;  1B50 A;  1S5E D;  3HOY G;  4YHH Q;  1HHV A;  3DXJ C;  4CKB A;  2DJG C;  5CV9 A;  1QUQ A;  2KCM A;  2OCE A;  4ZUJ A;  3OPO A;  1K8M A;  1G8Z D;  3HKS A;  1FNU A;  3DWQ A;  4XQQ A;  4BY7 B;  1WTP A;  4JI7 L;  4HSP A;  3OTO L;  1WD1 A;  5AFW A;  3K58 A;  2PW7 A;  1TWH H;  4DV0 Q;  5CR3 A;  2TMP A;  3I4N B;  4FF1 A;  5CV4 A;  5DEH A;  3QOJ A;  4PQX A;  3I4L A;  1EY9 A;  1NMG A;  4GOP A;  1UEA B;  2F0E A;  2LFN A;  3TN2 A;  1GVP A;  1C4Q A;  4K6D A;  5EKI A;  2F52 A;  5LMN Q;  4O0A A;  3UE1 A;  1YBY A;  2HHH L;  1STY A;  5I6W A;  1K0S A;  3LNN A;  2A8V A;  5FLX E;  1ENF A;  4NMZ A;  4DR6 L;  3A8I E;  4TVA B;  3CMA A;  3D6W A;  3BJU A;  5J3B A;  1H9S A;  2N78 A;  2B39 A;  1YZ6 A;  1VQ9 A;  3PO3 G;  3T1H Q;  2MGS A;  2VY3 A;  4JYA L;  1XPU A;  1N33 L;  1I4Q A;  1K8O A;  4TKO B;  3PSI A;  5IT9 c;  3CC2 A;  3VR5 A;  2RF4 A;  4L6T B;  3SGI A;  3S1R H;  4A3D B;  3DHQ A;  1YNN C;  3Q22 A;  2CWA A;  4IJL A;  1JOO A;  1SNC A;  2B8F A;  4HCS A;  1VCI A;  2K7V A;  2M9V A;  3PIO A;  1BBX C;  5GQO A;  1UE6 A;  1HFG A;  4NXN L;  2Q8R E;  1NJI C;  4LFA L;  2K03 A;  4MN3 A;  4DV2 Q;  2B63 B;  4HCE A;  1TII D;  1UWV A;  2VS1 A;  1HR0 Q;  5EAY A;  1V8Q A;  2WP8 J;  3PUV A;  2Z1C A;  3V05 A;  3A7L A;  1MIU A;  2IJ0 A;  3VR4 A;  1F2Y A;  4H13 C;  3SDZ A;  1OXV A;  4IFD J;  2BA0 A;  1TWA H;  2OF1 A;  4G4K A;  4DN4 M;  5ISR A;  4M8A A;  4A3E B;  3AYH B;  1PHJ A;  1CFM A;  4C56 C;  1L1O B;  1RCV D;  3GTO B;  2H1E A;  5L37 A;  1PYS B;  3U9O A;  1X9N A;  1FJG L;  1PXU A;  3ER0 A;  2K50 A;  4POG A;  3I72 A;  2PI2 E;  5C5M A;  4QF4 A;  3I56 A;  1KLG D;  3J7Y W;  2EYM A;  2RCF A;  1SN8 A;  2F0D A;  5IIF A;  3Q0A A;  1VQA A;  1TKW B;  4PZ6 A;  2XRS D;  3K57 A;  1HNW Q;  1VQ8 A;  2Y0S E;  1I50 H;  3WOF A;  1IKL A;  3NHH A;  4DAM A;  2UXB L;  5M5Y B;  4RGT A;  3NTH A;  4ZKB B;  2L11 A;  4JVZ A;  4A3G B;  4BBS H;  4A3I B;  5LHY 1;  4JI8 Q;  1GUT A;  1PZJ D;  1CQV A;  4OWT B;  4A76 A;  3X3M A;  3CME A;  3HZX A;  1TVX A;  2KOL A;  4R4C A;  5EBD A;  4UY8 C;  5JJL A;  1E1O A;  5GAD C;  4KHP L;  3CCE A;  2DY7 A;  4DAY B;  1VMC A;  1I4X A;  4IPD A;  2PZW A;  3WDN A;  2PQE A;  1B4O A;  2CFM A;  4DV4 Q;  4YIJ A;  1U9R A;  3NWT A;  3NP8 A;  5I9P A;  4JI1 Q;  2G5D A;  2JA5 H;  1I4H A;  3NEM A;  2HIX A;  3GTM H;  4JK1 C;  5LL6 S;  3E3X A;  2RHS B;  5JVG 3;  2E5L L;  2WB1 G;  3HOW G;  2NWG A;  3HOU G;  1FVI A;  3BS1 A;  2NVT B;  3MAQ A;  1YVC A;  1KAA A;  1GOZ A;  1SRO A;  2FIN B;  5E1F A;  3TP8 A;  3I91 A;  2J7Z A;  2D0O A;  1LYL A;  1PRT C;  2ALY B;  2LMC B;  1PMR A;  4TQU S;  3H0G G;  3SEB A;  2WII B;  4DK3 C;  5M3M B;  5IT9 E;  1DON A;  2ENB A;  4XT1 B;  2CHB D;  1QZH A;  3PIP A;  1VQF A;  4CJ0 B;  4GOP B;  2Z0S A;  2F4V L;  3L7Z C;  1ET6 A;  2JA7 B;  4RH6 A;  3TS2 A;  2EY6 A;  3LX0 A;  5M5X H;  3DEO A;  4AYB G;  3NEL A;  4OEL B;  5LL6 X;  5C4J H;  1XNQ Q;  3H3V I;  1H9S B;  2XNA C;  1GUN A;  3CU7 A;  3HP3 A;  5LMN W;  1OTC A;  1E3P A;  4CDE C;  4F8M A;  1HTP A;  2A1A A;  1SSO A;  1N36 Q;  1VMP A;  2PCF B;  1TY2 A;  4X3U A;  3EA6 A;  4DV7 Q;  4X66 Q;  3OOC A;  1G6Z A;  4V19 0;  2F0N A;  3QG1 A;  3TP6 A;  1F2L A;  3SK5 A;  1LO5 D;  1X3G A;  2RDF A;  4CJ1 B;  1TWC H;  3MEH A;  3QB3 A;  2YYZ A;  4LUO A;  1T5E A;  3VYU A;  2E74 C;  4DR4 L;  2YU9 B;  1I5F A;  5ELF A;  3T1H L;  3NPP A;  4UP7 A;  2A6H D;  3K7A H;  2K75 A;  1LT6 D;  4NW2 A;  4J1M A;  1LM0 A;  4A3K B;  1N32 L;  1PFS A;  1QNU A;  5IOD A;  2A74 C;  2CH4 A;  4FXG C;  4DXF A;  1Q8I A;  1QOH A;  1XPR A;  4LW1 A;  3S15 H;  5M5W H;  1L0W A;  1GO3 E;  1SYF A;  2H4O A;  3MVV A;  1X3F A;  2NTS A;  2EVB A;  3T53 B;  1RTN A;  1J5E L;  3S16 H;  1SAP A;  1HR0 L;  3CQZ H;  3TQY A;  4C1N I;  3O13 A;  2WV6 D;  3S17 B;  4IFD H;  2F0S A;  1R9T B;  2KJX A;  4K5X A;  3NUC A;  2R92 H;  4G57 A;  4APV A;  1JT8 A;  1MSH A;  3JAM i;  4G7H C;  2NUC A;  2MHV A;  3S9W A;  2ZT9 C;  3HOV B;  1CT1 D;  2BCO A;  2HD3 A;  3PUY A;  1B9M A;  4HIK A;  3EFX D;  3TS0 A;  1SMY D;  1U4R A;  3MC0 B;  1G2T A;  1WTQ A;  4A75 A;  1JOR A;  3VR6 A;  2QIL A;  3D3R A;  1PVO A;  1WOC A;  3KF6 A;  1PH1 A;  3I70 A;  3HOX H;  1UUP A;  1K28 A;  1WCM H;  2F3V A;  3S1Q B;  3M7G A;  1MJC A;  2I5H A;  2B2Y A;  1JWM D;  3FKI H;  4JCV E;  1FD7 D;  1BF4 A;  1NR2 A;  4F7X A;  2UXC Q;  1EYA A;  4X3K A;  2YTY A;  4PMC A;  1HA5 A;  1PTO B;  4B9W A;  2JA9 A;  1E2W A;  4L5T A;  3GTL B;  1F9P A;  1A0I A;  2PNH A;  2E2J B;  1HJP A;  3KJP A;  4JI4 L;  1S5F D;  4HIO A;  1UE1 A;  1BNZ A;  4OON A;  1K83 H;  4DR3 Q;  2KBN A;  3OHX C;  1N8R C;  1G2S A;  5IP9 H;  5C44 H;  4PG3 A;  1UNS A;  1G29 1;  4YWM A;  1JC7 A;  2N88 A;  1U5K A;  3BG3 A;  3M4O H;  2RDH A;  3H3V H;  3VYT A;  3UDI A;  2F3W A;  1CKN A;  3I4M H;  1H9R A;  4BBS G;  4DV4 L;  4JBM A;  3RZO H;  1PRT D;  5C6A A;  1XX8 A;  4DV3 Q;  4XXE A;  3CKI B;  4HID A;  2ICE C;  5DLQ E;  3G6J B;  4E6I A;  2K04 A;  2XWJ B;  2VUM H;  4KK7 A;  5FO9 B;  2Z6K C;  4IO9 A;  1M90 C;  1LT3 D;  3CRL C;  4K5V A;  5EPK A;  1O7Y A;  3L2P A;  1EYC A;  1S5B D;  1RKN A;  4HJ9 A;  1PFB A;  1QCB D;  2JA5 G;  3M7N A;  1SBB B;  3A8K E;  2F0H A;  5C0X J;  1SEB D;  4O1N A;  2LS0 1;  4Q5V A;  3NK9 A;  2B2W A;  2KEC A;  1DOL A;  2UUA L;  1TU2 B;  4FF4 A;  3CPW A;  1NE3 A;  4IQZ A;  4JI6 Q;  1Y69 U;  1DM0 B;  2CVR A;  2F0G A;  4YY3 Q;  2NVX B;  4DFA A;  1LTB D;  4NP5 A;  1RIP A;  1YNJ C;  5DNF A;  1IBK Q;  2NBF A;  1LTS D;  4DUZ L;  2NTT A;  4LF4 Q;  3S24 A;  1AE3 A;  1PDQ A;  2RQX A;  2L15 A;  4F88 A;  1F9Q A;  4DKA C;  4JV5 Q;  1Y1W B;  2QEJ C;  5TSS A;  1CUK A;  1DJR D;  2FHT A;  2MJ8 A;  1VQ4 A;  4CDF C;  3UDG A;  1YHB A;  1SNM A;  4LJZ C;  2UUB Q;  3C46 A;  4BY7 H;  1JWU D;  3S1M B;  1R4Q B;  3NTI A;  2HDL A;  3RUZ A;  3EN2 A;  3FVQ A;  3I4N H;  3M85 A;  1HH2 P;  4HJA A;  1BVS A;  1AZP A;  4OIJ A;  4DK1 A;  4CBV A;  1NBW A;  3J81 c;  1FGU A;  2D5D A;  5EJW A;  4P72 A;  5KGU A;  3J80 E;  1SNP A;  4YCW A;  3RLF A;  1HRJ A;  3QOL A;  2OQ0 A;  2IHF A;  4LFB L;  2N8N A;  1A8V A;  1ILP A;  1TT2 A;  2R92 B;  2QDL A;  4IOA A;  2Q2H A;  3W5O A;  3KOJ A;  1NCV A;  2EY5 A;  4LF7 L;  1U4P A;  4GKK Q;  4XQN A;  2LXK A;  3P20 A;  1PH5 A;  1TWF B;  2SNS A;  4U68 A;  5T1G A;  2R93 B;  5IE8 A;  1CK1 A;  1TR5 A;  1IBM Q;  2G9H D;  4HSV A;  4A3D H;  5FK9 C;  3AEV A;  4IFD G;  3IFD A;  4QMG A;  3SK4 A;  4IUQ A;  2R92 G;  5C4X B;  3I4O A;  4C3I B;  5GAH C;  1EY4 A;  1GUG A;  4WOR A;  4IOC A;  2D62 A;  4ID6 A;  2I5L X;  2B63 H;  4A3L H;  3FPU B;  1JJG A;  3HG9 A;  1EY7 A;  2PI2 A;  1AW7 A;  4H44 C;  1KAW A;  1PH2 A;  3T51 B;  3QR8 A;  1E22 A;  3TP7 A;  3IRB A;  4ZQ3 A;  4EGV A;  2GA4 B;  4A3E H;  3M3Y B;  3GTO H;  4O2D A;  2VQF Q;  1KIX A;  3MA2 B;  1YJW A;  4MZ9 A;  5J39 A;  3I90 A;  2R7F A;  2EXD A;  3A8J E;  4L8J A;  4UP9 A;  3HOX G;  1VQJ A;  1M8A A;  1WCM G;  4DV5 Q;  4JI2 L;  1FL0 A;  3FKI G;  2EXZ A;  3G71 A;  4KKS A;  4KD3 A;  2Q2I A;  2BDO A;  4CHT B;  1WVL A;  5K36 H;  1QWY A;  1KLU D;  1BO0 A;  1IXR A;  1PTO D;  2DJF C;  3PV0 A;  5ELE A;  3TDQ A;  4ZLT F;  4NXM L;  1IYJ B;  3K8A A;  1TWG B;  5M5Y H;  2FFK B;  1XXG A;  3NBI A;  1UEB A;  4IUN A;  1K0R A;  1ESR A;  2K5N A;  5IP9 G;  5I6Y A;  5C44 G;  4HIM A;  4A3G H;  1C0A A;  3E6Z X;  4A3I H;  2HCC A;  3FDT A;  4RKL A;  1ILQ A;  2EYJ A;  5G3L F;  1DCZ A;  3U4V A;  1JWS D;  3I4M G;  1JJ2 A;  3H3V C;  5LMU L;  3FEW X;  5C0X H;  1VF5 C;  3HKZ G;  1MKH A;  1MBY A;  3CHB D;  2Z4I A;  1QZG A;  1SYB A;  3J81 E;  1NTG A;  4WFN 3;  4B3M Q;  1I4R A;  1VQH A;  2D2C C;  4A3J B;  5AJ3 L;  3ERS X;  2KVM A;  2KHJ A;  4DAY A;  2VUM G;  3A0J A;  4DAV A;  1C8C A;  1GUW A;  4DNT B;  5J1Z A;  3I2Z A;  1NNX A;  4KHZ A;  2SDF A;  2ZM6 L;  2ZTE A;  1A62 A;  2GN5 A;  2PPB C;  2UXD L;  4YY3 L;  4S3S A;  2NVT H;  4FO2 A;  2JJQ A;  1M1K C;  3OIP A;  1IBK L;  2RHQ B;  4FF3 A;  1EUJ A;  2R61 A;  2RCN A;  1YI2 A;  2B2W C;  3EJI A;  1PRT F;  2L0C A;  5M3M H;  2XWB B;  2VQE Q;  2VB2 X;  2BA1 A;  3G48 A;  5CV5 A;  5T1I A;  4JV5 L;  1JR0 D;  3U9S A;  5IWA Q;  4KJN A;  4K2K A;  2JA7 H;  3J7A V;  1OXU A;  1SLJ A;  1Q81 C;  4B3R Q;  1IBL Q;  1BCP B;  4OX9 Q;  4YCV A;  2Q2U A;  4ILW A;  2MO0 A;  4KHV A;  5NUC A;  2OXP A;  1KL9 A;  3LWU A;  3CCS A;  3J7A 5;  1AE2 A;  4PMW A;  4UHV A;  2D9U A;  2QA4 A;  4FXK C;  1DD2 A;  4OIK A;  1YHQ A;  4ZYS A;  2BOS A;  1FR3 A;  4IPG A;  4X3T A;  4A3M B;  4C3J B;  2KUM A;  4DV6 L;  3D4R A;  5CV7 A;  1F77 A;  4BY7 G;  2EYH A;  3AQQ A;  4CGY B;  5IGF A;  2F3I A;  3I4N G;  3CRK C;  1SR3 A;  2B3G A;  5JEA G;  1EIH A;  1S3O A;  2QCP X;  2OQK A;  2YU9 H;  3UDX A;  2NN6 H;  2C9O A;  5A35 A;  3ZJY C;  2K5V A;  1BOS A;  4A3K H;  4DUY Q;  4MNO A;  2A6H C;  4IUR A;  3J81 j;  3URY A;  3FHW A;  4GKJ Q;  1EWI A;  2B2U A;  1HQR D;  2K01 A;  2IX0 A;  2DY8 A;  3CXC A;  3MFG A;  4RWS C;  1SND A;  2E2I B;  3BVG A;  1ML0 D;  2KA7 A;  2CKZ B;  4KKT A;  4KN7 C;  2X6L A;  3GV6 A;  1EU4 A;  1A3T A;  1E2Z A;  5GRO A;  1JIC A;  3TSS A;  2QF7 A;  1LAC A;  2JK8 A;  4DR2 Q;  2Y0S B;  1R9T H;  3PO2 B;  2FMM A;  5HGT A;  4A3D G;  3K5L A;  5C3X A;  4FYD A;  3I55 A;  4LAA A;  3JC6 6;  2ES2 A;  2ZXR A;  3FRP B;  3HOV H;  1XNR L;  4ODG A;  3HEJ A;  1W3S A;  4JI3 L;  3F2U A;  2B63 G;  2VQF L;  1YIJ A;  4FF2 A;  3DWP A;  3AB9 A;  5EQ0 A;  1WTW A;  3NQI A;  1E7Z A;  2IX3 A;  4A3L G;  4K0K L;  5M9O A;  3P1H A;  1SMY C;  1PA6 A;  2B2V C;  3K5O A;  5ELD A;  3FMC A;  4LFC Q;  2EYL A;  5HY6 A;  1CZW A;  1G91 A;  1A2U A;  1HPC A;  4A3E G;  3M9B A;  4XQJ A;  1VQ6 A;  4OO1 I;  3S1Q H;  1HTL D;  3SXH A;  1GHJ A;  2L12 A;  2XN9 C;  4GZY C;  3T1Y Q;  3GTQ B;  2KCT A;  5IOC A;  1L1O C;  4IFD I;  2E2H B;  4R4O A;  2F0U A;  4QCL A;  2EJF C;  2Q2T A;  2FMC A;  3IKJ A;  1PTO H;  3GTL H;  3A5U A;  1DYQ A;  5K36 G;  3DM3 A;  2E2J H;  1LTA D;  2VL6 A;  5A2Q L;  1D1K A;  2X69 A;  5D65 A;  1ENC A;  2JA6 B;  3KJO A;  3RNU A;  3OWF A;  4LWC A;  2K28 A;  2VB3 X;  5IY0 A;  2ZTD A;  3LGJ A;  3K7U C;  1B8A A;  1LAB A;  4OXP A;  3E0E A;  1Q86 C;  4B3T L;  3A5Z B;  1BBW A;  1HZC A;  1H95 A;  2HUG A;  4A3G G;  4B3M L;  4BA1 I;  4A3I G;  1Q1B A;  2AMC B;  2Z6B A;  4B3S Q;  1WTV A;  5IP7 H;  5KYI A;  4LNQ A;  4YHH L;  2N49 A;  4RGM A;  1GUS A;  3RZD B;  5C0X G;  3GTK B;  5BN4 A;  1K8A C;  4CKE A;  1PTO F;  4F87 A;  2F0Q A;  1AFP A;  3Q6S A;  3MEF A;  4LUV A;  3SHL A;  5J22 A;  2IY5 B;  3MZ5 A;  2WB1 E;  1VQB A;  3BZD B;  1HNX Q;  4I65 A;  3RN2 A;  2PZU A;  2PQA B;  4PMB A;  2K5W A;  4JG2 A;  5C3W A;  4DV0 L;  2WAC A;  1D6E C;  1K3B C;  5CC4 A;  1VS0 A;  4B3R L;  1IL2 A;  1S40 A;  4DR1 Q;  1PYW D;  4ME5 A;  4L63 B;  3MHB A;  4DNR B;  4LF8 Q;  5LMN L;  2PYK A;  1KHI A;  3MWY W;  5M3M G;  2NVX H;  3BVM A;  2EYF A;  4AYB E;  1B1Z A;  3T16 A;  1Q1E A;  3TEH B;  1YJN A;  2JA7 G;  1L2F A;  4GOP C;  4AIM A;  1BCP D;  4XTC S;  1IL8 A;  4AQY Q;  4ZKC B;  5DAU A;  1YIT A;  1VQ5 A;  5KNC A;  3R3O A;  3VR3 A;  2QEX A;  3M4P A;  2NYZ D;  1RTO A;  3NXW A;  1Y1W H;  2JN4 A;  2R7D A;  2AUJ D;  4UDU C;  1D5X C;  3C2P A;  1QE6 A;  2PNR C;  4K6L A;  2F1M A;  4GNX B;  4UAI A;  2CH4 W;  2GVA A;  3S1M H;  5I4D A;  1DOK A;  1SDF A;  2JA8 B;  3JAM L;  1CKO A;  1EIG A;  3ERO A;  3CCM A;  2JSO A;  1V1O A;  2DGY A;  5JEA J;  2VXW A;  4OHJ A;  4P75 A;  2KED A;  1B9N A;  2F0W A;  4OWW B;  1B7Y B;  1NMF A;  4L5Q A;  4OO1 H;  3GDE A;  2QW7 A;  1D8L A;  4DV2 L;  3KF8 B;  2PMZ B;  1EQR A;  1X54 A;  3J80 i;  2BH2 A;  4GLV B;  3K0X A;  4N8X 1;  1EOV A;  2NZH A;  1XMQ Q;  4KKU A;  4P71 A;  3WOE A;  2AHO B;  2NN6 G;  4N8F A;  1HFN A;  4A3K G;  1FGB D;  2JXM B;  3S1N B;  3G6E A;  1HUN A;  1DZ1 A;  5CMD A;  4ALP A;  4ZUI A;  4X3S A;  2K52 A;  1ET9 A;  4QY7 A;  4OEM B;  1TWF H;  2R93 H;  2O5J C;  3CCQ A;  1FNV A;  1E2V A;  1EOT A;  2PMZ E;  5IYB H;  5ELO A;  4WJW A;  2EDG A;  5G3L D;  5C4X H;  4C3I H;  4ME3 A;  1VQE A;  1GM5 A;  2KQ3 A;  1HNW L;  4DGZ A;  3ND8 A;  4LFC L;  2PW5 A;  5KNB A;  3HOV G;  1O7L A;  2DUD A;  2NVY B;  1DXM A;  4DU9 A;  2E76 C;  3ZYY X;  3T1Y L;  1AZQ A;  1SE2 A;  3I8Z A;  1SE8 A;  4JI8 L;  1EL0 A;  4A93 B;  2Z8L A;  3M3Y H;  1Z6H A;  1QVG A;  4NKL A;  5FJ8 G;  3TZU A;  5D14 A;  4G7Z C;  2F0O A;  1F9S A;  2KEN A;  4ZK9 B;  1W2B A;  1BQQ T;  3N6R A;  3PUX A;  5EKK A;  4JI0 Q;  3JAM c;  3V2T A;  4QL5 A;  1PLF A;  4EQP A;  4X64 Q;  1J8I A;  3BYT B;  1QNK A;  4JI1 L;  2SNM A;  4KMU C;  1V1P A;  2IX1 A;  1EEF D;  1PTO C;  2A69 C;  4J8Q A;  4FXD A;  1DGS A;  3DWA A;  1IYV A;  2M00 A;  1A15 A;  1TWG H;  2YV5 A;  4GS3 A;  3GTJ B;  5KIX A;  5EPJ A;  3AMU A;  4HED A;  3OIQ A;  4RKB A;  4JW0 A;  5CGK A;  4PZ8 A;  1AEX A;  1HZB A;  2VNU D;  5A2Q E;  1SFO B;  2V4D A;  4WJ4 A;  2ZXO A;  4HN7 A;  1CM9 A;  3DM1 A;  1XMO Q;  4GN3 B;  3BU2 A;  2ASB A;  2PO4 A;  2UUC Q;  4KTA A;  3DEP A;  3ULL A;  3ULP A;  5IP7 G;  1STE A;  3NSW A;  3A7A B;  5BR8 Q;  3W2D A;  4DAP A;  2Q8T A;  5K5P A;  5JJZ A;  3J81 i;  4A3J H;  4YWK A;  3K5M A;  1CKM A;  2F0L A;  2LXJ A;  2RBM A;  1WTO A;  1XNQ L;  4U67 3;  3GTG B;  5BN3 A;  3PF5 A;  3VDY A;  3K59 A;  1Q46 A;  1J6Q A;  1WTH A;  1N36 L;  1SYG A;  1O80 A;  2HQE A;  3UE0 A;  3KFU A;  3OW2 A;  1X65 A;  5C5L A;  4DV7 L;  3W1G A;  4X66 L;  1I94 Q;  3HFZ B;  3VR2 A;  4A3C H;  2EY1 A;  4IZ8 A;  4KJO A;  3S14 B;  1TS5 A;  3H91 A;  4Y7N B;  4KY7 A;  2OTJ A;  1EEI D;  4A3F B;  1R4P B;  4NB3 A;  5HGQ A;  5C0X I;  2IL8 A;  2VW9 A;  5IGG A;  3OYY A;  3SVM A;  3KLR A;  5IGE A;  1Q90 A;  5JEA H;  2ZXP A;  4TSS A;  4JI7 Q;  1H9M A;  2IHE A;  5FO7 B;  2XTI A;  1ONL A;  1I4P A;  4LMQ D;  2ICI A;  3TRZ A;  3PGZ A;  3L0O A;  3R2T A;  1LUZ A;  1RD9 D;  5C3E B;  5HUR A;  2K14 A;  3VA7 A;  3RN5 A;  1Y1W G;  1F2Z A;  1JE4 A;  4HR7 B;  4A3M H;  3KK7 A;  2L1B A;  4C3J H;  1WFQ A;  4I7A A;  4ZRZ A;  1LV9 A;  2LSS A;  3NTK A;  1XMQ L;  1WTX A;  3QJY A;  1C48 A;  2RVL A;  3TME A;  2FXQ A;  4LF9 Q;  1WTR A;  3M4Y A;  1X3E A;  4XYQ A;  3D8G A;  3NEN A;  3A56 A;  1DOM A;  1PH9 A;  4JYA Q;  4OO1 G;  1HZ9 A;  3TRE A;  5KND A;  2K05 A;  2EJM A;  1TS3 A;  1G6P A;  3PF4 A;  2G9D A;  1BCP F;  3RMH A;  1PH3 A;  4UPA A;  1LTT D;  1O7Z A;  4XT3 B;  1Y1V B;  1ENA A;  4DA2 A;  3R93 A;  1SJH D;  1W6K A;  5E4X A;  2BDN A;  4K8I A;  2O4X A;  4X62 Q;  5D3D A;  1STN A;  1KNA A;  4K8J A;  4NXN Q;  1HNZ Q;  2F4I A;  4BA2 I;  4LFA Q;  3KBG A;  3A54 A;  5EBC A;  2E2I H;  2CQA A;  3I73 A;  1YHA A;  2GVB A;  2WAQ B;  3QIA A;  3HOZ B;  1TXY A;  3HS0 C;  1EFW A;  2R93 G;  5DM6 3;  1D2B A;  1EYD A;  1OXS C;  3PO2 H;  1Y14 B;  2UXC L;  3X3N A;  2C5C A;  2B29 A;  3PMF A;  5I2X A;  5IYB G;  1EIY B;  3M4Q A;  4DF7 A;  2B2Y C;  1Y1V G;  2RA4 A;  1EFI D;  2HQL A;  4C3I G;  2NN6 I; 
#chains in the Genus database with same CATH homology
 2MPM A;  1BXT A;  5KEE A;  1V1P B;  2A6E C;  3GP7 A;  3QO2 A;  1ZKO A;  2A69 D;  5JVH 3;  1S5D D;  3K0Y A;  1LLR D;  5CV8 A;  1D1I A;  2A5H A;  2WIN B;  2A68 C;  2R7Z B;  5M3F B;  1QB5 D;  5F2D A;  1A3V A;  1OXT A;  1GUO A;  2Q8I B;  2NZ1 D;  5FO8 B;  1JCK B;  4K14 A;  2EE1 A;  3HOY B;  3RD4 A;  3OSO A;  1L0Y B;  2EY2 A;  2DNE A;  1ESF A;  3R2I A;  4EQO A;  2A73 B;  4IAL A;  2EZV A;  2XSC A;  3OMG A;  1KAB A;  1QG7 A;  3PUZ A;  1X3P A;  2IT1 A;  1MD2 D;  3V96 A;  1PZI D;  4RFB A;  1ZXT A;  2F0F A;  5ELC A;  1PFM A;  1B3A A;  3OMC A;  5FKA C;  1CA6 A;  1B44 D;  2KCN A;  3ERQ A;  2K1B A;  5JOB A;  4HTH A;  4BWG B;  5DM7 3;  2R6G A;  2K33 A;  2I07 B;  2F0T A;  4TRD A;  1U4L A;  3PO3 B;  2NVQ B;  2HCI A;  4RGO S;  1KNE A;  2JP1 A;  4WRD A;  1HUM A;  1M4V A;  4G7O C;  2B8G A;  2XVS A;  2AQ2 B;  2F0P A;  2EYP A;  1BCP C;  2SOB A;  3BDL A;  3D4W A;  4HMI A;  2EOT A;  1STH A;  1RF2 D;  2B2T A;  5C4Z A;  3KLS A;  3BVZ A;  3P75 A;  4C3J G;  3S2H B;  2JEB I;  3EVQ A;  2K6A A;  3VA5 A;  1Y8N B;  1HQM C;  1RJT A;  3T56 B;  1CTM A;  2L9H A;  3S2D B;  3KF8 A;  3SK8 A;  1TQO A;  1B2T A;  2ID0 A;  3H09 A;  4QUC A;  3IFT A;  1EQV A;  1CA5 A;  2A6E D;  2WKC A;  3ITP A;  1D5Z C;  4KI0 A;  1Y8P B;  4IUT A;  1L0X B;  1SJE D;  2FJ2 A;  3C1E A;  4Q0F A;  1F2M A;  4C2M B;  1TY0 A;  1VF7 A;  4RGN A;  4IUU A;  2A68 D;  1TS2 A;  1IW7 C;  2EPB A;  4ULL A;  1H9J A;  1HCZ A;  1TS4 A;  2J0T D;  5IGB A;  1HA6 A;  1VDZ A;  3I3C A;  4ZAI A;  1PFN A;  2F0I A;  3N52 A;  4FVM A;  4QUF A;  2R3Z A;  3A55 A;  1A6X A;  3GTP B;  4OGQ C;  3BDO A;  3Q24 A;  3KUP A;  2K32 A;  1GHK A;  2WB1 B;  3HOW B;  3HOU B;  2MP1 A;  3LWE A;  3MFY A;  1PRT B;  1ZYR C;  4N9P A;  4P2C B;  1LT4 D;  3IL8 A;  4BBR B;  1I3Q B;  3MXN A;  2QDB A;  3H0G B;  3QWN A;  5JAV A;  2F0J A;  3KLS X;  5E3F A;  2E75 C;  4AYB B;  1BUV T;  3UI2 A;  1X32 A;  4ABN A;  5COR A;  1EU3 A;  4R8N A;  1MGS A;  2AQ1 B;  3TBI B;  4RCO A;  2NN6 I;  4CJ2 C;  1CI3 M;  1JOQ A;  1W6J A;  4MHE A;  3GO5 A;  1TWH B;  5CBE E;  5COY A;  2WKD A;  1B53 A;  5ELB A;  3D4D A;  3OWE B;  1NSN S;  3AU7 A;  3E0J A;  3L9A X;  2XIW A;  1KTK A;  2IPK D;  3J80 L;  4O42 A;  2F0K A;  3IAY A;  1EWH A;  3DMU A;  5CV6 A;  2RSO A;  4KY6 A;  1YNN D;  2LY7 A;  3BYY B;  2AUK A;  5EPL A;  3S1R B;  3SR1 A;  2JEA I;  3GQB A;  2RDG A;  2B2T C;  5FOB B;  3PIO 3;  2K5D A;  4IUP A;  2B2U C;  1ZEQ X;  1TWA B;  1CZG A;  3NWS A;  1BDO A;  3TP5 A;  1SE4 A;  1IW7 D;  2NB0 A;  4H0L C;  1STG A;  3GD7 A;  3R8B A;  2HDM A;  4RHS A;  1SYC A;  1Q12 A;  2PZT A;  4CKC A;  5I9O A;  3GV3 A;  3OW7 A;  1II3 A;  2JYO A;  1MSG A;  2CW0 C;  1H9K A;  1Z47 A;  1LTI D;  3D6C A;  3NE5 B;  1Z7T A;  1A2T A;  1IYU A;  4KY5 A;  4DXG A;  1I50 B;  1LTR D;  3MXU A;  4OL7 A;  1RDP D;  2J4X A;  3NQT A;  3ONA B;  4BBS B;  2N55 A;  1ZYR D;  3SK6 A;  2MUY A;  3D31 A;  3P7J A;  4R9W A;  2I46 A;  3FPP A;  1EZ8 A;  4R8I A;  1EY0 A;  3J7A F;  2Z4H A;  4BY1 B;  2KHS A;  3H6M A;  4EQN A;  2L5T A;  2LKV A;  1GXD C;  1O78 A;  2F0V A;  4RA8 A;  5IGC A;  1EWC A;  2DN8 A;  4RCN A;  1CHQ D;  2JA5 B;  2RKS A;  3DUZ A;  1WD0 A;  4IUV A;  3J81 L;  3GTM B;  3BDC A;  3VYS A;  1JQY D;  1ROD A;  1T5X D;  4V0B A;  3G7L A;  1SXT A;  2O5I C;  1NUC A;  5E4W C;  5D3I B;  5KYL A;  1JB3 A;  2TSS A;  4I7Z C;  1X3Q A;  1XTC D;  3ND9 A;  1XWE A;  2XRQ D;  4IN3 A;  5C4H A;  4XYO A;  1EQT A;  4K5W A;  5EGT A;  1KDC A;  5M5X B;  3PIP 3;  2DNC A;  4JBW A;  1S4Z A;  5C4J B;  1LT5 D;  1NR4 A;  3K6O A;  4NDX A;  1RHP A;  1J9O A;  4XIG S;  1EY6 A;  2F03 A;  5FLX L;  3C3L A;  1IHZ A;  3KBX A;  2AWN A;  1TWC B;  2IWH A;  2BE5 C;  5CYU A;  3MXP A;  3MTS A;  1SYE A;  2IW3 A;  4QB4 A;  2OEO A;  4HAE A;  4A3B B;  3K7A B;  3HGB A;  4FP5 D;  1UAP A;  1AP0 A;  2QKI C;  1KDB A;  1FYC A;  4J6H A;  1STB A;  3S15 B;  5M5W B;  1HXY D;  4EVO A;  3K5N A;  1OXX K;  1XYI A;  1EY8 A;  1V43 A;  1EZ6 A;  4N9T A;  5KRU A;  1Q3L A;  3S16 B;  4HMJ A;  3CQZ B;  2L4N A;  1A3U A;  1SE3 A;  1SNQ A;  4RHR A;  3JAM E;  5IGD A;  1PZK D;  3HRZ C;  4KD4 A;  4C3H B;  4FNF A;  4B08 A;  2CW0 D;  4LK1 C;  1F9R A;  4K2L A;  1QJO A;  1I4G A;  2OT2 A;  3E5S A;  1JOK A;  3PUW A;  3T13 A;  3VYR A;  1EY5 A;  2E2D C;  2K5Q A;  2KEE A;  3HOX B;  1WCM B;  1IKM A;  1S5C D;  2KCC A;  4MIU A;  3FKI B;  4XDX A;  1AN8 A;  3T4A C;  4C3H G;  3SE0 A;  3EQL C;  1LTG D;  2EJG C;  1SNO A;  1I6V C;  3TZD A;  2B2V A;  1CHP D;  5I2Y A;  4QIW B;  3W3A A;  1OO9 B;  4PNY A;  4C1N K;  2JE6 I;  4DK0 A;  2RSN A;  1K83 B;  1KDA A;  1I6H B;  5C44 B;  3H94 A;  1GJX A;  5JPM C;  1MI2 A;  2X6G A;  3M4O B;  2M2L A;  3I4M B;  4KV6 A;  4KN4 C;  3Q23 A;  3RZO B;  1CQF A;  1U4M A;  3MXG A;  3HKZ B;  2F0M A;  1STA A;  1QIL A;  1NAP A;  3C1F A;  2SEB D;  5CBA E;  2VUM B;  1D5M C;  4Z9C B;  2L55 A;  1Y8O B;  4M1U B;  4PV1 C;  5IT9 L;  4H7B A;  4B9X A;  2AWO A;  2AQ3 B;  2EYO A;  5JPN C;  1SYD A;  3L3O C;  5BN5 A;  1FNW A;  5EKL A;  4RAU C;  1YNJ D;  3NBH A;  1ICW A;  2O2L D;  1E0B A;  1BR9 A;  2BE5 D;  1B50 A;  1S5E D;  1HHV A;  3DXJ C;  4CKB A;  5CV9 A;  4ZUJ A;  3OPO A;  1K8M A;  1G8Z D;  1FNU A;  3DWQ A;  4XQQ A;  4BY7 B;  1WTP A;  4HSP A;  1WD1 A;  5AFW A;  3K58 A;  2PW7 A;  5CR3 A;  2TMP A;  3I4N B;  4FF1 A;  5CV4 A;  5DEH A;  3QOJ A;  4PQX A;  3I4L A;  1EY9 A;  1UEA B;  2F0E A;  2LFN A;  3TN2 A;  1C4Q A;  4K6D A;  5EKI A;  1STY A;  5I6W A;  3LNN A;  5FLX E;  1ENF A;  4NMZ A;  3A8I E;  3D6W A;  1H9S A;  2B39 A;  2MGS A;  1I4Q A;  1K8O A;  4TKO B;  3VR5 A;  4L6T B;  4A3D B;  3DHQ A;  1YNN C;  3Q22 A;  1JOO A;  1SNC A;  2B8F A;  4HCS A;  1VCI A;  2K7V A;  2M9V A;  1BBX C;  1HFG A;  2Q8R E;  2K03 A;  4MN3 A;  2B63 B;  4HCE A;  1TII D;  1V8Q A;  2WP8 J;  3PUV A;  2Z1C A;  3V05 A;  3A7L A;  2IJ0 A;  3VR4 A;  1F2Y A;  4H13 C;  3SDZ A;  1OXV A;  4IFD J;  2BA0 A;  4G4K A;  2OF1 A;  5ISR A;  4DN4 M;  4M8A A;  4A3E B;  1CFM A;  4C56 C;  1RCV D;  3GTO B;  2H1E A;  3U9O A;  1PXU A;  3I72 A;  5C5M A;  4QF4 A;  1KLG D;  3J7Y W;  2EYM A;  2F0D A;  5IIF A;  3Q0A A;  1TKW B;  2XRS D;  3K57 A;  3WOF A;  1IKL A;  3NHH A;  5M5Y B;  4RGT A;  3NTH A;  4ZKB B;  2L11 A;  4A3G B;  4A3I B;  5LHY 1;  1GUT A;  1PZJ D;  1CQV A;  3X3M A;  3HZX A;  1TVX A;  2KOL A;  5EBD A;  2DY7 A;  1VMC A;  1I4X A;  2PZW A;  3WDN A;  2PQE A;  1B4O A;  4YIJ A;  1U9R A;  3NWT A;  3NP8 A;  5I9P A;  1I4H A;  4JK1 C;  5LL6 S;  5JVG 3;  2NWG A;  3BS1 A;  2NVT B;  3MAQ A;  1KAA A;  1GOZ A;  5E1F A;  2FIN B;  3TP8 A;  3I91 A;  2J7Z A;  1PRT C;  2LMC B;  1PMR A;  4TQU S;  3SEB A;  2WII B;  1DON A;  5M3M B;  5IT9 E;  2ENB A;  4XT1 B;  2CHB D;  4CJ0 B;  3L7Z C;  1ET6 A;  2JA7 B;  4RH6 A;  2EY6 A;  3LX0 A;  3DEO A;  5LL6 X;  1H9S B;  2XNA C;  1GUN A;  3CU7 A;  3HP3 A;  4F8M A;  1HTP A;  1SSO A;  1VMP A;  2PCF B;  1TY2 A;  4X3U A;  3EA6 A;  3OOC A;  1G6Z A;  4V19 0;  2F0N A;  3QG1 A;  3TP6 A;  1F2L A;  3SK5 A;  1LO5 D;  2RDF A;  4CJ1 B;  3MEH A;  3QB3 A;  2YYZ A;  1T5E A;  3VYU A;  2E74 C;  2YU9 B;  5ELF A;  3NPP A;  2A6H D;  1LT6 D;  4NW2 A;  4J1M A;  4A3K B;  1QNU A;  5IOD A;  2A74 C;  4FXG C;  4DXF A;  1Q8I A;  1QOH A;  1SYF A;  2H4O A;  3MVV A;  2NTS A;  2EVB A;  3T53 B;  1RTN A;  1SAP A;  4C1N I;  3S17 B;  3O13 A;  2WV6 D;  4IFD H;  2F0S A;  1R9T B;  2KJX A;  4K5X A;  3NUC A;  4G57 A;  1MSH A;  4G7H C;  2NUC A;  2MHV A;  3S9W A;  2ZT9 C;  3HOV B;  1CT1 D;  2BCO A;  3PUY A;  1B9M A;  3EFX D;  1SMY D;  1U4R A;  3MC0 B;  1G2T A;  1WTQ A;  1JOR A;  3VR6 A;  2QIL A;  3D3R A;  3I70 A;  1UUP A;  2F3V A;  3S1Q B;  3M7G A;  2B2Y A;  1JWM D;  1FD7 D;  1BF4 A;  1NR2 A;  4F7X A;  1EYA A;  4X3K A;  4PMC A;  1HA5 A;  1PTO B;  4B9W A;  1E2W A;  3GTL B;  1F9P A;  2E2J B;  1S5F D;  1BNZ A;  3OHX C;  1G2S A;  1UNS A;  1G29 1;  1JC7 A;  2N88 A;  3BG3 A;  2RDH A;  3VYT A;  2F3W A;  1H9R A;  1PRT D;  5C6A A;  1XX8 A;  4XXE A;  3CKI B;  2ICE C;  3G6J B;  4E6I A;  2K04 A;  2XWJ B;  4KK7 A;  5FO9 B;  1LT3 D;  3CRL C;  4K5V A;  5EPK A;  1O7Y A;  1EYC A;  1S5B D;  1RKN A;  1PFB A;  1QCB D;  3M7N A;  1SBB B;  3A8K E;  2F0H A;  5C0X J;  1SEB D;  4O1N A;  2LS0 1;  4Q5V A;  3NK9 A;  2B2W A;  2KEC A;  1DOL A;  1TU2 B;  4FF4 A;  4IQZ A;  1Y69 U;  1DM0 B;  2CVR A;  2F0G A;  2NVX B;  4DFA A;  1LTB D;  4NP5 A;  1YNJ C;  5DNF A;  2NBF A;  1LTS D;  2NTT A;  1PDQ A;  2RQX A;  4F88 A;  1F9Q A;  1Y1W B;  2QEJ C;  5TSS A;  1DJR D;  2FHT A;  2MJ8 A;  1SNM A;  4LJZ C;  3C46 A;  1JWU D;  3S1M B;  1R4Q B;  3NTI A;  2HDL A;  3RUZ A;  3FVQ A;  3M85 A;  1AZP A;  4OIJ A;  4DK1 A;  4CBV A;  2D5D A;  5EJW A;  5KGU A;  3J80 E;  1SNP A;  3RLF A;  1HRJ A;  3QOL A;  1ILP A;  1TT2 A;  2R92 B;  1NCV A;  2EY5 A;  1U4P A;  4XQN A;  3P20 A;  1TWF B;  2SNS A;  4U68 A;  5T1G A;  2R93 B;  1CK1 A;  1TR5 A;  2G9H D;  4HSV A;  5FK9 C;  4IFD G;  3IFD A;  4QMG A;  3SK4 A;  4IUQ A;  5C4X B;  4C3I B;  1EY4 A;  1GUG A;  4WOR A;  2D62 A;  4ID6 A;  3FPU B;  3HG9 A;  1EY7 A;  1AW7 A;  4H44 C;  3T51 B;  3TP7 A;  4ZQ3 A;  4EGV A;  2GA4 B;  3M3Y B;  3MA2 B;  5J39 A;  3I90 A;  4L8J A;  3A8J E;  1M8A A;  2EXZ A;  4KKS A;  4KD3 A;  2BDO A;  4CHT B;  1WVL A;  5K36 H;  1QWY A;  1KLU D;  1BO0 A;  3TDQ A;  4ZLT F;  1PTO D;  5ELE A;  3PV0 A;  1TWG B;  2FFK B;  1XXG A;  3NBI A;  4IUN A;  1ESR A;  5I6Y A;  3E6Z X;  2HCC A;  3FDT A;  4RKL A;  1ILQ A;  2EYJ A;  5G3L F;  1DCZ A;  1JWS D;  3H3V C;  3FEW X;  5C0X H;  1VF5 C;  3CHB D;  1MBY A;  2Z4I A;  1SYB A;  3J81 E;  4WFN 3;  1I4R A;  2D2C C;  4A3J B;  2KVM A;  4DAY A;  4DAV A;  1C8C A;  1GUW A;  4DNT B;  5J1Z A;  4KHZ A;  2SDF A;  2PPB C;  4S3S A;  4FO2 A;  3OIP A;  4FF3 A;  2R61 A;  2B2W C;  3EJI A;  1PRT F;  2L0C A;  2XWB B;  2VB2 X;  2BA1 A;  5CV5 A;  5T1I A;  1JR0 D;  3U9S A;  4KJN A;  4K2K A;  3J7A V;  1OXU A;  1BCP B;  4ILW A;  4KHV A;  5NUC A;  2OXP A;  3LWU A;  4PMW A;  2D9U A;  4FXK C;  1DD2 A;  4OIK A;  4ZYS A;  2BOS A;  1FR3 A;  4X3T A;  4A3M B;  4C3J B;  2KUM A;  3D4R A;  5CV7 A;  1F77 A;  2EYH A;  4CGY B;  5IGF A;  3CRK C;  5JEA G;  1EIH A;  2QCP X;  2NN6 H;  2C9O A;  5A35 A;  1BOS A;  2A6H C;  4IUR A;  3URY A;  2B2U A;  1HQR D;  2K01 A;  2IX0 A;  2DY8 A;  3MFG A;  4RWS C;  1SND A;  2E2I B;  3BVG A;  1ML0 D;  2KA7 A;  4KKT A;  4KN7 C;  2X6L A;  3GV6 A;  1EU4 A;  1A3T A;  1E2Z A;  3TSS A;  1JIC A;  2QF7 A;  1LAC A;  2Y0S B;  3PO2 B;  2FMM A;  5HGT A;  3K5L A;  5C3X A;  4FYD A;  4LAA A;  2ZXR A;  3FRP B;  4ODG A;  3HEJ A;  3F2U A;  4FF2 A;  3DWP A;  3AB9 A;  5EQ0 A;  1WTW A;  3NQI A;  2IX3 A;  5M9O A;  3P1H A;  1SMY C;  2B2V C;  3K5O A;  5ELD A;  3FMC A;  2EYL A;  1G91 A;  1CZW A;  1A2U A;  1HPC A;  4XQJ A;  4OO1 I;  1HTL D;  3SXH A;  1GHJ A;  2L12 A;  2XN9 C;  4GZY C;  3GTQ B;  5IOC A;  4IFD I;  2E2H B;  2F0U A;  4QCL A;  2EJF C;  2FMC A;  3IKJ A;  1PTO H;  1DYQ A;  5K36 G;  1LTA D;  5A2Q L;  1D1K A;  2X69 A;  5D65 A;  1ENC A;  2JA6 B;  3OWF A;  2K28 A;  2VB3 X;  1LAB A;  2HUG A;  4BA1 I;  1Q1B A;  1WTV A;  5KYI A;  4RGM A;  1GUS A;  3RZD B;  5C0X G;  3GTK B;  5BN4 A;  4CKE A;  1PTO F;  4F87 A;  2F0Q A;  1AFP A;  3Q6S A;  5J22 A;  3SHL A;  3MZ5 A;  3BZD B;  4I65 A;  2PZU A;  4PMB A;  2K5W A;  5C3W A;  2WAC A;  1D6E C;  5CC4 A;  1PYW D;  4ME5 A;  4L63 B;  3MHB A;  4DNR B;  2PYK A;  3MWY W;  3BVM A;  2EYF A;  1B1Z A;  3T16 A;  1Q1E A;  1BCP D;  4XTC S;  1IL8 A;  4ZKC B;  5DAU A;  5KNC A;  3R3O A;  3VR3 A;  2NYZ D;  1RTO A;  3NXW A;  2AUJ D;  4UDU C;  1D5X C;  3C2P A;  1QE6 A;  2PNR C;  4K6L A;  2F1M A;  4UAI A;  5I4D A;  1DOK A;  1SDF A;  2JA8 B;  3JAM L;  3ERO A;  1EIG A;  2JSO A;  1V1O A;  5JEA J;  2VXW A;  4OHJ A;  2KED A;  1B9N A;  2F0W A;  4OO1 H;  2PMZ B;  4KKU A;  3WOE A;  2NN6 G;  1HFN A;  1FGB D;  2JXM B;  3S1N B;  1HUN A;  1DZ1 A;  5CMD A;  4ZUI A;  4X3S A;  1ET9 A;  2O5J C;  1FNV A;  1E2V A;  1EOT A;  4WJW A;  2EDG A;  5G3L D;  2KQ3 A;  4DGZ A;  3ND8 A;  2PW5 A;  5KNB A;  1O7L A;  2NVY B;  1DXM A;  4DU9 A;  2E76 C;  3ZYY X;  1AZQ A;  1SE2 A;  3I8Z A;  1EL0 A;  4A93 B;  2Z8L A;  1Z6H A;  4NKL A;  3TZU A;  5D14 A;  4G7Z C;  2F0O A;  1F9S A;  4ZK9 B;  1BQQ T;  3N6R A;  3PUX A;  5EKK A;  3V2T A;  1PLF A;  4EQP A;  1J8I A;  3BYT B;  1QNK A;  2SNM A;  4KMU C;  1V1P A;  2IX1 A;  1EEF D;  1PTO C;  2A69 C;  4J8Q A;  4FXD A;  3DWA A;  1IYV A;  2M00 A;  1A15 A;  3GTJ B;  5KIX A;  5EPJ A;  3AMU A;  4HED A;  3OIQ A;  4RKB A;  5CGK A;  2VNU D;  1AEX A;  5A2Q E;  1SFO B;  2V4D A;  2ZXO A;  4HN7 A;  1CM9 A;  3DM1 A;  2PO4 A;  4KTA A;  3DEP A;  1STE A;  3NSW A;  3A7A B;  3W2D A;  4DAP A;  2Q8T A;  5K5P A;  5JJZ A;  3K5M A;  2F0L A;  2RBM A;  1WTO A;  4U67 3;  3GTG B;  5BN3 A;  3K59 A;  1SYG A;  1O80 A;  2HQE A;  5C5L A;  3VR2 A;  2EY1 A;  4IZ8 A;  4KJO A;  3S14 B;  1TS5 A;  3H91 A;  4Y7N B;  4KY7 A;  1EEI D;  4A3F B;  1R4P B;  5C0X I;  2IL8 A;  5IGG A;  3SVM A;  3KLR A;  5IGE A;  1Q90 A;  5JEA H;  2ZXP A;  4TSS A;  1H9M A;  5FO7 B;  1ONL A;  1I4P A;  4LMQ D;  2ICI A;  3R2T A;  1RD9 D;  5C3E B;  5HUR A;  3VA7 A;  1F2Z A;  1JE4 A;  4HR7 B;  3KK7 A;  2L1B A;  4ZRZ A;  1LV9 A;  3NTK A;  1WTX A;  3QJY A;  1C48 A;  2RVL A;  3TME A;  1WTR A;  3M4Y A;  4XYQ A;  3D8G A;  3A56 A;  1DOM A;  4OO1 G;  5KND A;  2K05 A;  2EJM A;  1TS3 A;  2G9D A;  1BCP F;  3RMH A;  1LTT D;  1O7Z A;  4XT3 B;  1Y1V B;  1ENA A;  4DA2 A;  3R93 A;  1SJH D;  1W6K A;  5E4X A;  2BDN A;  4K8I A;  2O4X A;  5D3D A;  1STN A;  1KNA A;  4K8J A;  2F4I A;  4BA2 I;  3KBG A;  3A54 A;  5EBC A;  2CQA A;  3I73 A;  2WAQ B;  3HOZ B;  3QIA A;  3HS0 C;  5DM6 3;  1D2B A;  1EYD A;  1OXS C;  3X3N A;  2C5C A;  3PMF A;  5I2X A;  4DF7 A;  2B2Y C;  2RA4 A;  1EFI D;  4C3I G;  4BS9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...