4CDEC

Human dpp1 in complex with 4-amino-n-((1s)-1-cyano-2-(4-(4- cyanophenyl)phenyl)ethyl)tetrahydropyran-4-carboxamide
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
68
structure length
68
Chain Sequence
PFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAATPIPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DIPEPTIDYL PEPTIDASE 1 EXCLUSION DOMAIN CHAIN
publication title Cathepsin C Inhibitors: Property Optimization and Identification of a Clinical Candidate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 7
structure length 68
sequence length 68
chains with identical sequence F
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2013-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.170 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Cysteine proteinases. Chain C 4cdeC00
2DJGC 1MHWC 4OELB 2DJFC 4OEMB 4CDEC 4CDFC 4CDCC 1K3BC 1ICFB 4CDDC
chains in the Genus database with same CATH superfamily
3L2PA 4KY7A 2GN5A 3WOFA 3I4MG 4B3SQ 1EIFA 1F9PA 4BBRG 3IL8A 3HKSA 2CCZA 4HJ5A 5JAVA 3HOVH 4KHZA 5JEAJ 1MD2D 4LF4L 1XNQQ 2QCPX 5C0XH 1EFWA 4A93H 2YV5A 1PVOA 1IYVA 1I6HH 4G57A 1V9PA 5C4XH 4C3IG 5E4XA 1LTLA 4X66L 2RHSB 4HCSA 4DFAA 2JA9A 4MN3A 3NQIA 2K5WA 1NR2A 2ICIA 4C3HB 3SGIA 2C9OA 2IHEA 3ULLA 1J5EL 5EPLA 1HNWL 1T5XD 4BXXH 4NXNL 4PMBA 4C3JG 2JE6I 1QNKA 1KRTA 1RDPD 1YBYA 3H6MA 3TP5A 2F0SA 3KLRA 3G71A 1DOLA 1SLJA 1KLUD 2ATWA 4IZ8A 1HQMC 1E2VA 4RH6A 2KA7A 1W2BA 1SYFA 3S1QB 4A3MH 1HA5A 5FJ8G 5C0XJ 1L1OB 1SFOB 4UPAA 1SN8A 1QUQA 3H09A 1DOMA 1HTPA 4GLAC 2KCTA 3K7UC 1XWEA 4JI7L 3SK8A 1OXXK 3RN2A 2JA6G 1U4RA 5M3MB 1TU2B 1YNJC 1QWYA 1H9RA 4FF1A 2KHJA 3VR4A 2OTLA 5J3BA 2R93H 2B63G 1CSQA 5IWAL 5K36H 5CMDA 3I72A 5I2YA 4DK3C 4DUZL 4F87A 1CKNB 2WIIB 2RDFA 2A5HA 4UDUC 2MPMA 3LX0A 1SE2A 1TWCH 3I4MH 1EU4A 4HR7B 5KYIA 1K0SA 4RA8A 4A3DB 1YVCA 2A6HD 4BBRH 1QOHA 1GM5A 1E2ZA 2DY7A 3B6YA 3PIPA 2OTJA 3HKZG 3PUYA 5JJLA 2EY6A 4B3RL 2EYOA 4LUOA 3GTLH 1X55A 1JQYD 2I5HA 3Q0AA 3CP0A 4C3IH 2PCFB 2ZXPA 1CA6A 2D2CC 4B3SL 2F3WA 1VQFA 1MBYA 1JOKA 4JOIA 3WOEA 2OF1A 3JAME 1XNQL 4UP8A 1JORA 4OX9Q 3OHXC 2DN8A 1ASYA 2IHFA 1YEZA 1YHAA 3GTOH 1TWFB 4ZLTF 4C3JH 1B4OA 1LABA 2N3SA 1HZ9A 1FYCA 4EGVA 3HOXG 1XX8A 4J1MA 1Q1BA 4JI0L 1TWHH 3CCSA 4ID6A 5M3FG 3K57A 1PYSB 3I7FA 4ZK9B 3QIAA 3CCUA 1JWSD 5FKAC 5IGGA 3I91A 1PZJD 5M5WH 1JWMD 1ESFA 2Z4IA 3LWEA 4CDDC 5FJ8H 1GHJA 4IUNA 4ZUJA 4X3TA 3GTKH 4DR5Q 1WTXA 4JI5Q 5JJIA 1UE5A 1ZYRD 3IFDA 4IUPA 1O78A 2P5ZX 4DN4M 1ILPA 3FKIG 5E4WC 1MSHA 2JA6H 1LT6D 3M4YA 1G291 5IT9L 4IUTA 2EE1A 5IGDA 4PZ8A 1HPCA 3W1GA 2NVTB 2IX1A 3I4NB 4QCLA 3I70A 3NTKA 1WTWA 4HAEA 2B63H 5FO8B 3A8KE 1EY4A 3C1FA 1M90C 4KHPL 4XTCS 2K7VA 3Q24A 3DUZA 4YWKA 4UAIA 2VW9A 2OEOA 1HNZQ 5J1ZA 1VQKA 4A3BB 4KJOA 3OW2A 1PMRA 1T9HA 4XQQA 1H9SA 4DK0A 1PHJA 1VQ6A 3DEOA 1FGUA 1GUWA 3QR8A 1MI2A 5LL6S 1LT5D 3BZCA 3S17H 4CBVA 3NK9A 4HJ9A 3V05A 3HZXA 3RLOA 1FNWA 4JBJA 2G9HD 3ULPA 1GKHA 4IFDH 5GADC 3D6CA 3KF6A 4IOAA 1F9QA 4CKEA 3J81j 4ME3A 1VF5C 3GV6A 4DR7Q 1LTGD 1WTRA 1FGBD 1QNUA 3DM3A 4RWSC 4DA2A 4LUZA 2VXWA 3CQZH 2OXPA 1PTOF 3HOXH 3TZUA 4BY1B 3BDLA 1E7ZA 2B2TC 3A8IE 5M3FH 2ZJQA 4DR1Q 1K0RA 4BY7H 2NVXB 1H95A 4GN5A 4OX9L 4IUVA 1BCPD 1WJJA 4JI1Q 3G6EA 4A3KG 5E7NA 1D1IA 2Q8IB 3CCMA 2MGSA 3EFXD 5M5YH 2RQXA 1J9OA 1WVLA 1B44D 2E2HB 3SEBA 1ET6A 2MO1A 3GTMH 3S1MB 3VYRA 3A7AB 4IFDJ 3FKIH 4NP5A 2H4OA 1B70B 3I73A 1HNXQ 1K28A 5M5XB 1IKMA 1AZPA 5J22A 4FF2A 2Q8RE 2BDOA 4YIJA 4LFCQ 2ZTDA 1LTTD 1V8QA 3NE5B 4KD4A 3MAQA 4FYDA 1RJTA 4HIOA 1C7YA 4PV1C 1PH8A 4JI5L 1MHWC 5BN5A 1K8GA 4NDXA 5FOBB 4RCNA 1TWGB 4ZAIA 2QDBA 3ER0A 2KVMA 3M7GA 5IGEA 5HGTA 4JV5Q 1MSGA 4KKUA 5IODA 1D5ZC 4N8FA 3KFUA 4DK6C 1IBMQ 4M8AA 2Q2TA 1U4LA 4KY6A 3K58A 1ILQA 4A3JB 1JCKB 2EYJA 1HNZL 1TQOA 4BS9A 3OPOA 2EJMA 2F0DA 3GTGH 3BYYB 2CFMA 1XJVA 2PMZB 3JAMc 4K2KA 1F2ZA 2A68C 4GOPC 3UDFA 3T56B 4B3TQ 4DXFA 2MFIA 2EYHA 4DAYB 3PF4A 1ICFB 2FMCA 4APVA 3NXWA 4R8NA 1G6ZA 1Q1EA 1PRTC 2R61A 3STBC 1S5ED 1VQMA 1NCVA 4K5XA 5IE8A 4LF7L 1DZ1A 1JE5A 5LMNW 5EQ0A 1JOOA 3GTQB 4LFBQ 1RTOA 2VQEQ 3PIP3 4DR7L 1NMGA 5D14A 2SOBA 4A3KH 5CBEE 1OO9B 3Q23A 4LFAL 2LFNA 3D8GA 2BCOA 4LF8Q 1D1KA 1IBKQ 4HEDA 5FLMG 1UAPA 3SK4A 5C3EB 3BDCA 4DR1L 1F9RA 2N78A 3D4RA 4PNYA 2A6EC 1ESRA 4EQNA 4JI1L 4ALPA 1N36L 3DMUA 1YNND 4DR6Q 3S2DB 2XRSD 4QIWB 2RDGA 1TXYA 2F3IA 4TRDA 4K0KL 1I6VC 2K75A 1OTCA 5JJKA 2VUMG 2F0LA 1HNXL 4FNFA 4ZKCB 1WTVA 1XPOA 2KQ3A 2QF7A 3CD6A 2N8NA 4LFCL 2Y0SB 4E6IA 5KEEA 1CSPA 1HZBA 1WTQA 1LYLA 2CW0D 1EY0A 5KRUA 3KDFB 1ZEQX 3VA5A 3BZDB 3HOZH 3HOWB 4JV5L 1B3QA 2K05A 2Z6KC 4N8X1 1AE2A 3DEPA 4MNOA 4DR4Q 1IBML 2NZHA 3DM1A 3IKJA 5JJZA 1SE3A 1QVFA 1IBLQ 2PNRC 1A3UA 3QG1A 5KIXA 4LF6Q 4Y7NB 1GJXA 1QZHA 3H0GG 3I4OA 2ZM6Q 2EYFA 3UDGA 2MO0A 3OWFA 1FD7D 4A3EG 1NSNS 2I5MX 2LS01 4A75A 2QKIC 3GTPH 3W1BA 1HZCA 2FHTA 2K6AA 2VZAA 2IPKD 3SXHA 2YTVA 5AFWA 5LHY1 1LM0A 2X6GA 1X6OA 5IP9G 3S24A 1DM0B 3S15B 1PH9A 2IL8A 4LFBL 5CV6A 3CU7A 4R9WA 2VQEL 1KLGD 1CQFA 1X3FA 5EPKA 2XGTA 2RF4A 3FHWA 1IL8A 5EKIA 2RCFA 5IY0A 1A3TA 4LF8L 2FFKB 4BBSG 2NVQB 1IBKL 3KF8B 1KNAA 3VR6A 4KI0A 1U0LA 2VUMH 1PRTB 2XN9C 3NENA 3RZOH 4L5RC 1NE3A 3S14H 3EIVA 1Y1VG 4DR6L 2MHVA 1SXTA 2QEJC 2EJGC 2A73B 4X3KA 2M00A 4XT3B 1YITA 5AJ3L 4POFA 1UE1A 2RKSA 2A6HC 2ES2A 3E9IA 3HKZE 2E75C 5CORA 5IYBG 3OSOA 3PO3B 1N32Q 2BH2A 1IZ6A 1W3SA 2PW5A 3ND8A 5DM73 4DAPA 4R4QA 5C44H 2E2DC 5IP7H 4FO2A 1PFNA 1R9TB 3CCLA 4I7ZC 1I3QH 1Q90A 2JA8G 1LO5D 1VQNA 4JI2Q 3H0GH 4UP9A 5I6YA 1X32A 2G5DA 4H44C 2DJFC 1YJNA 2XWBB 1IBLL 1CK1A 2KUMA 2H1EA 2O2LD 4LF6L 1X3PA 2AWOA 2UXBL 3TEHB 1F2LA 5IP9H 1STGA 4MTKA 4LK1C 2PZWA 2R7ZB 4C3HG 2MQHA 1KDAA 2E2JB 4K5VA 4FDBA 4RGNA 1O7YA 4KV6A 1ZYRC 1YNXA 4KKSA 2R3ZA 4DV0Q 1V1PA 1VQ4A 2CQOA 2L12A 2HDMA 1CZGA 2Q8TA 1LT4D 1SE8A 4LNQA 1Y1VH 4YY3Q 1C0AA 1A8VA 1ML0D 1NUCA 1GOZA 5ELBA 1SDFA 4BBSB 1DD2A 1JC7A 1PDQA 2KCCA 4X3SA 1PTOB 4IJLA 2ID0A 1CFMA 3Q8DA 2PMZE 3S2HH 1NBWA 1KABA 1Q82C 2D9UA 3NTHA 5IYBH 2NN6I 3A74A 1KDCA 1A6XA 3F2BA 1EQRA 4UHVA 1HHVA 4YWMA 4DR2Q 2RDHA 4RFBA 2FMMA 4WJWA 2TSSA 1CKOA 4RKLA 4OO1I 1H9KA 3CC2A 3VYTA 2B2YC 3W3AA 1C8CA 3J80E 2JA8H 4YCWA 1HR0Q 3T1HQ 3QOJA 5ELOA 1Q3LA 2B2UC 5EJWA 3KLSA 3PUVA 5EKLA 3M4OB 4A3DG 1N32L 3UE1A 1TWAB 1GUSA 4JI4L 2E8GA 2PQAB 3NHHA 1ET9A 2F0JA 3D4DA 3ERSX 3F2UA 3F8TA 3FP9A 4ZKBB 5I6WA 1SNMA 2B8FA 4XQNA 4JI2L 3ERQA 4RGMA 2L1BA 4CGYB 3ONAB 5IT9E 1VQPA 4V190 3SR1A 3PGZA 4FXGC 3KBGA 1BCPC 5T1IA 5K5PA 4OL7A 2B2VC 4C3HH 2R92G 4YHHQ 1KAAA 2FXQA 1SEBD 4JC0A 5JVG3 3GV3A 5EPJA 2PQEA 4AIMA 1KNEA 4I7AA 3QWNA 3CPWA 4IPDA 4C1NK 5M9OA 3MXGA 1X54A 2OWOA 1DGSA 3S1QH 4IN3A 4KTAA 2OQKA 1SFOH 4JYAQ 4V0BA 1RCVD 3BZKA 1MJCA 1PFSA 3R93A 2O5JC 1M1KC 2ZJRA 1QZGA 4C2MB 4A3FB 5M3MH 1ONLA 2NVYH 3NEMA 1O80A 4JVZA 1JB7A 2Z0SA 4A3IB 3I4NG 3P1HA 2PZTA 3ND9A 1EOVA 4DV1L 2F0VA 5E3FA 4CJ0B 3VDYA 4A3GG 1AN8A 4X3UA 2H5XA 4EQOA 1M4VA 4KN7C 1U4MA 2HQLA 3CAMA 3W2DA 4WJ4A 1K73C 4A3BG 3U4VA 1FJGL 5LMUQ 2RSOA 1NNXA 1EIGA 4DR2L 2AKWB 1IYUA 2F1MA 5IOCA 4KJNA 4DV2Q 1XMQL 1NJIC 2UUCQ 2BH8A 4B9WA 3TRZA 3RLFA 1D7QA 2QILA 3DWQA 1HR0L 3T1HL 3G6JB 3G48A 1II3A 2HDLA 1TT2A 2OCEA 3CCEA 4LAAA 4DAMA 4HJAA 3J81c 5CV8A 1KIXA 3J7AV 1TWFH 3KJOA 4QMGA 2I07B 4GNXA 5KNBA 3J7YW 1HJPA 4BY1G 1LT3D 1S3OA 3A5UA 2F0QA 1STNA 1KAWA 1PRTF 3RUZA 3E0EA 1EY8A 3TZDA 2R92B 1YNNC 4YHHL 1YHQA 1VQIA 4K8JA 3F2CA 1LTSD 1P8LA 1VMPA 1STHA 1WFQA 4XT1B 3LNNA 4GLVB 2D0OA 4O1NA 5ELDA 1E22A 4DUYQ 2PZUA 3HOUG 4KMUC 2B2WA 2VS1A 1SROA 5G3LF 1AP0A 3TBIB 2CHBD 2A69D 1CHPD 1YZ6A 4ME5A 1IYJB 1STYA 1O7LA 2MP1A 4FF4A 1SJED 1BXTA 2CW0C 1VQGA 2A8VA 2NVTH 3I4NH 4G7OC 3H3VH 4JYAL 3EROA 5A35A 1E1OA 3J80c 2UXDQ 2V1CC 1GUNA 3OWEB 1IXRA 1S4ZA 1SYDA 1GO3E 1IHZA 4A3BH 3P20A 1EEID 5HGQA 1J8IA 5GAGC 1LTRD 3T16A 1QILA 1ENFA 3NBIA 4A3GB 3GP7A 4MZ9A 4GKKQ 1GXDC 3X3NA 3D6WA 4A3JG 3RR5A 2LY7A 5DLQE 3J7ZC 1ASZA 1S5FD 5LMUL 3KUPA 1NMFA 3EA6A 2UUCL 4QGUA 3RN5A 1Z9FA 4KKTA 2HIXA 4R4IA 2B39A 3K5MA 2PQAA 1QJOA 3C3LA 2WAQB 4FP5D 1MIUA 1A3VA 2HD3A 1C48A 3TDQA 4BY1H 1GUGA 4JI6Q 1R4QB 2LKVA 4ILWA 3UDXA 3W5OA 2DNCA 3CRKC 3ICEA 2XNAC 2NVXH 3TP8A 1SRUA 1H9MA 4AYBG 1B9NA 3T53B 1OXVA 3GTJB 5ISRA 1I4XA 4NW2A 1B7YB 2F52A 4OXPA 2YU9B 1A62A 1BUVT 3PO2B 3I4LA 1SNOA 2K01A 5FK9C 5C3EG 4NPSA 3S1MH 1EUJA 3T51B 4C1NI 1PFBA 2QA4A 3H91A 2WKDA 4Z9CB 1XYIA 1DONA 4GZYC 1SNPA 2ZXRA 4P75A 4N9PA 5M5XH 3BVZA 1GVPA 5C4HA 1V1QA 2WB1B 3E3XA 3HEJA 3CHBD 4DUYL 3HOUB 2HCIA 2NTTA 1TWGH 4HTHA 1J6QA 4L5QA 1LV9A 3MA2B 4R8IA 5C0XI 3CF5A 3SK5A 5CV4A 1EIYB 4HMJA 1KQSA 2Y0SG 1L2FA 2N55A 4POGA 4DR5L 2JN4A 3CQZB 3K0XA 2V4DA 5I9PA 3T4AC 3DXJC 5IGCA 4P73A 2UXDL 1L1OA 2L4NA 1LTAD 4JBWA 2AWNA 3RZDB 4ZUIA 2JYOA 2UU9Q 4LUVA 3HOWG 2R7DA 1DOKA 2UUAQ 4J8QA 3JC66 1XTCD 4HMIA 3NBHB 5T1GA 4TVAB 2ZJPA 3Q22A 3PV0A 4B3MQ 3KK7A 1EFID 5DNFA 4TKOB 1I94Q 2D5DA 2GVAA 2DJGC 3RLNA 1CKNA 2L11A 3K5OA 4H0LC 4KK7A 1WCMB 3GTQH 1PH5A 5JPNC 4F7XA 5FO7B 1V43A 1UNSA 3GDEA 4X62Q 2F0EA 4QUFA 1NY4A 1LTBD 1D5XC 1B2TA 3TMEA 5D3DA 1EY5A 3R3OA 3K7AB 4JI6L 5C3EH 4IQZA 4B9XA 1N9WA 1LUZA 2ASBA 2QEXA 1YNJD 3E5SA 4AYBB 3MXPA 3J7A5 2AHOB 1XMOQ 4JI8Q 3ZJYC 2F0IA 1EY6A 2QGQA 3K6OA 1XPRA 3S2DH 5C3WA 3SDZA 2HCCA 1KL9A 1O7ZA 1ENCA 3TQYA 1AZQA 3PUWA 4WFN3 2XRQD 2OT2A 1Y8OB 3MFYA 5CR3A 4DV7Q 1U5KA 4K6LA 4IOCA 4OWWB 2SEBD 1BBUA 1Q8IA 4JCVE 3TS2A 2F0KA 3PIOA 5DAUA 3AU7A 4DV4Q 4LMQD 2HUGA 1VQAA 4JK1C 3MXUA 3BS1A 2UUBQ 3E0JA 2EPBA 1SNDA 3HOWH 3PO3G 1L0WA 4K2LA 2SNSA 3OMGA 4C56C 2EY5A 1XNRQ 2ICEC 4ULLA 2K5QA 4M1UB 4L63B 1STAA 3QJYA 3KOJA 4IO9A 2Q2IA 3D4WA 2SDFA 4PG3A 1SE4A 4UY8C 4HJ7A 4XYQA 2K5VA 2IY5B 2UU9L 1H9JA 1SNQA 2K14A 2L55A 2UUAL 3CCQA 2DNEA 4JBKA 1EWIA 1K83B 3HG9A 2F03A 4B3ML 4JOIC 3GQBA 4PZ6A 5C6AA 3OIPA 1B8AA 3HOYB 5ELNA 2D62A 4R1JA 2GA4B 5C4JH 1LLRD 1MKHA 4YCUA 4RGTA 3VR5A 1Y8PB 1I4RA 4ZQ3A 1SYGA 2K28A 1PH3A 4B3TL 2R7ZG 4X62L 2VB2X 4O2DA 1BCPF 3BG3A 3K59A 2PYKA 2M9VA 4IALA 3OTOQ 3AYHB 1HQRD 2NVQH 3A0JA 3M4QA 1PZKD 5FLMH 2F0HA 1EZ8A 2JSOA 3E9HA 4K14A 4LJZC 1I4QA 1AFPA 1CM9A 1NTGA 1CHQD 4A3LG 4HN7A 1VQ8A 4U68A 4JI8L 1XMOL 2HIVA 4DV3Q 1OXUA 3F2DA 4GOPB 4IFDI 2NWGA 2KENA 4CJ1B 1G2SA 4FF3A 2JA7G 1I50B 1E2WA 2VB3X 3HRZC 1F2YA 3CCRA 1HFGA 2UXCQ 5HY6A 1EYGA 4FVMA 4DV7L 3PO3H 2ZXOA 3Q6SA 1WD1A 1JJGA 3GTPB 2EYMA 4H7BA 2R6GA 1HXYD 2KECA 3A54A 3BDOA 1RD9D 4YWLA 2NTSA 4WRDA 2BA0A 4GS3A 3H15A 3MXNB 3OOCA 1PXUA 3NSWA 3CMEA 1HFNA 1GUOA 1X3QA 2WFWA 1D2BA 1PA6A 5KNDA 3OW7A 1EZ6A 5EAYA 1B3AA 3V96A 1A2TA 1KHIA 5COYA 2AQ2B 2PNHA 1TY0A 2AQ1B 5FLXL 4JBMA 2LXKA 3ULJA 3BU2A 2JEBI 1SMYD 2N88A 1Y1WB 4DR4L 3FDTA 3V2TA 3CC4A 2E2IB 2R7ZH 1BO0A 4A3EH 4BA1I 2FINB 1AEXA 3EVQA 1N8RC 1PFMA 2E2JH 2K50A 1Q81C 1K9MC 1CT1D 5NUCA 2EY2A 4DAYA 1FNVA 1SBBB 2ZM6L 3PMFA 2A69C 4DNIA 4J6HA 3SHLA 1JB3A 5C5LA 2CQAA 3R2TA 3U58A 4CJ2C 4L5TA 2NUCA 1Q46A 4A3LH 3S16H 2F0OA 5D3IB 4DGZA 2Q2UA 1P16A 2F4VQ 1Y69U 2XTIA 1VQOA 2I0QA 5A2QL 2K04A 2L9HA 4BBSH 1BDOA 4DPGA 4RGOS 4NXMQ 5C5MA 1UEAB 1PTOH 3VR2A 1UE7A 2EJFC 1MJEA 1D5MC 4A3FG 2L5TA 2O4XA 2J4XA 2R7FA 3CW2C 3J7AF 1B53A 4DV3L 2RA4A 4A3IG 3KLSX 4N9TA 4XDXA 5IGFA 3O13A 4J15A 3S1NH 2Z4HA 2JA7B 5GAHC 3A55A 5LL6X 3M4PA 1BNZA 2JA5B 1MGSA 3OYYA 2UXCL 1SYBA 4OWXB 4DAVA 4DNRB 1HR0W 4FXDA 3M4OH 2OQ0A 1TWAH 2EY1A 5BR8Q 4BXXG 3UDIA 3I55A 3C46A 4H02A 2B2TA 2CVRA 1U4PA 4CDCC 3PIO3 1Q7YC 4DNTB 2K5DA 5ELEA 3P75A 1Y14B 3EQLC 3U50C 4KY5A 4DKAC 1EY9A 3KDFA 3AFPA 3BVGA 3PF5A 1F77A 2K32A 1D8LA 4AYBE 1XPUA 1VQDA 1JOQA 4K5WA 3AMUA 2A6ED 1EL0A 1HH2P 1RHPA 2JJQA 2KOLA 3U9OA 3CRLC 2BE5D 3HP3A 1AE3A 4AQYQ 2RVLA 1Q12A 3T1YQ 2RSNA 1H9SB 3S2HB 2DGYA 5BN4A 3CPFA 4O0AA 4K6DA 2G9DA 4IJHA 1R4PB 2RCNA 1NR4A 3M3YB 2XSCA 3LGJA 3D3RA 3PQIA 1IKLA 3MVVA 2CH4W 4HJ8A 1M8AA 1EWHA 4QIWE 5EBDA 2AMCB 2RBMA 3QOLA 4QL5A 5F2DA 1PZID 1VF7A 1TS5A 3RD4A 3M7NA 4L6TB 2JP1A 2VY3A 1VCIA 4JI3Q 1WI5A 3KJPA 4C2MH 4A3FH 2NZ1D 5JVH3 1PH7A 2Y0SE 3VYSA 1I4PA 3AB9A 2F4VL 1EQTA 2KHIA 3IFTA 4TQUS 3GO5A 5FO9B 4DV0L 3S1RB 1VQLA 2EDGA 4A3IH 3MWYW 1FR3A 4A76A 1SJHD 4NXML 1G8ZD 2YTYA 5BN3A 4JI0Q 5C4ZA 2CWAA 5EKKA 4GOPA 4HIKA 1EQVA 3H3VC 3HOVB 3KF8A 3K5LA 5EGTA 1JR0D 1YIJA 3L3OC 4YY3L 4A93B 2EYPA 1I6HB 3F1ZA 1B50A 5C4XB 2NZOA 3FMCA 5GQOA 1PTOD 5CC4A 3NTIA 3K8AA 1K8AC 2YYZA 4GKJQ 2IW3A 2C35B 2K5HA 2LMCB 4PMWA 1FL0A 3MXNA 4HCEA 4A3DH 5BR8L 2HHHQ 4L5SA 3PUXA 4IPCA 3WDNA 3DWPA 2IWHA 1JICA 1JWUD 2WAQG 3RMHA 4KHPQ 1S5CD 4RHSA 4X65Q 2X69A 4DK1A 4K8IA 1S72A 2EQSA 4CDFC 2NVYB 3A8JE 4OIKA 1X56A 1RF2D 4A3MB 2R92H 1EYAA 2F0GA 2E74C 4BWGB 4OONA 2EOTA 4L8JA 1VQBA 4AQYL 3J81L 1SYEA 3T1YL 2L15A 3I90A 3PO2G 3KYHC 4PMCA 1XXGA 4HIDA 2K4KA 4UP7A 2JXMB 1W6JA 2WV6D 2YTXA 2R93B 2K33A 4P2CB 4ZRZA 2WB1G 1G2TA 1DJRD 4MIUA 5JOBA 3NP8A 1TWCB 5JPMC 3I4MB 2Z6KA 2IJ0A 4IFDG 4JI3L 1Z6HA 4BBRB 3ZYYX 2Q2HA 1AH9A 1L0YB 2F0PA 1VS0A 2F0NA 1VQ9A 1Q86C 3CXCA 3GTLB 3J81i 3MHBA 2LXJA 4JPBW 1TY2A 2L0CA 3NELA 4IUUA 1BCPB 4C3IB 4A3GH 1PLFA 1V1OA 1F2MA 2WKCA 1UEBA 4YCVA 3J80L 2VNUD 1CTMA 4NMZA 2IX3A 4BY7G 3PSIA 3A5ZB 3KBXA 5L37A 1KTKA 1FNUA 2KEEA 3MFGA 3CCJA 3GTOB 3NWSA 2MUYA 4C3JB 4KD3A 1LTID 3QO2A 1IW7D 3LWUA 4GN3B 3U4ZA 1BF4A 3TS0A 1TWHB 1KDBA 1SAPA 4PQXA 4GKJL 5IT9c 5HURA 5E1FA 3HS0C 1D6EC 2EVBA 1NAPA 4F88A 1WCMG 2IT1A 5M5WB 4DV2L 2HHHL 4MTNA 3GTKB 1RKNA 1EOTA 3QB3A 3GTJH 4F8MA 1RL2A 2F0UA 4QJFA 3J80i 3GD7A 2E5LQ 2YU9H 1QE6A 3PO2H 4Y52H 4X65L 2JA6B 1VDZA 2CWPA 2VL6A 1EYDA 1EYCA 3HFZB 4DR3Q 1E1TA 4EQPA 2CKZB 2EXDA 2B63B 1TIID 1WYDA 4G4KA 4CDEC 3U9SA 1GD7A 5IYDG 1E3PA 2EXZA 1BBWA 4WORA 3CC7A 3HOUH 2E2HH 4HSVA 1KC8C 5IGBA 3IAYA 4HIMA 1A2UA 4FXKC 4LF7Q 3HKZB 3EBEA 1F9SA 1I5FA 2AUKA 1G91A 3M9BA 4P72A 2TMPA 3S17B 3N52A 4G7ZC 1EIHA 4LWCA 4LF5Q 1UE6A 2DUDA 1TVXA 4LFAQ 1IL2A 1TKWB 1CZWA 1SMXA 2M2LA 2JEAI 3BYTB 4MHEA 4XIGS 2KCNA 3CCVA 3RZDH 1EY7A 2B3GA 3URYA 4P74A 2EYLA 3MEHA 1DCZA 3OIQA 2NN6G 1BVSA 2I5LX 2PI2A 2ZTEA 1N36Q 1VMCA 1Y8NB 3I56A 1E0BA 2B8GA 4XYOA 3HOXB 3K0YA 4X6AH 1QB5D 1SMYC 4OO1G 5M3FB 4A3JH 4AH6A 4K0KQ 1WTOA 4BY7B 4GLXA 1WCMH 2ENBA 2MNAA 5I9OA 1ENAA 4GKKL 1YJWA 5M5YB 4QUCA 4OWTB 1HA6A 3ITPA 3I2ZA 2O5IC 4DF7A 3GTMB 2X6LA 4JW0A 4RHRA 3HOYG 1WD0A 3FKIB 1X3EA 4LW1A 1EEFD 1E24A 1CI3M 2KCMA 3K7AH 1DXMA 1C4QA 1BOSA 1TS2A 2F4IA 1Z47A 3JAML 3MZ5A 1T5EA 1B9MA 1CA5A 1YHBA 2J0TD 2E5LL 4QF4A 5IYDH 1HUMA 4NB3A 1VQCA 4DV6Q 3VR3A 1N33Q 3MEFA 3HOZG 1KXLA 2PI2E 1KRSA 5C3XA 2D0PA 1N34Q 4IUQA 4DR3L 4R4OA 2B2YA 4A4IA 4DXGA 1K3RA 2A19A 4XXEA 4DU9A 2B2UA 1VQHA 5FLXE 4BA2I 1KD1C 4JG2A 1S5DD 5IYCG 3GTGB 3DWAA 2E76C 2ALYB 3DHQA 3JAMi 4DV5Q 4QQBX 2PO4A 4IPGA 2A1AA 1V1PB 2C5CA 2NN6H 3NQTA 1TS4A 4RG1A 3WWVA 4LF5L 1X65A 2I46A 4IURA 5LMNQ 2DY8A 5CV5A 2F0FA 3I8ZA 4OO1H 2B2VA 1PV4A 2WINB 1YJ9A 1SSOA 5CGKA 2F3VA 1BR9A 5DM63 3R8BA 1ICWA 5A2QE 1TS3A 2XVSA 2BE5C 4EQ5A 4A3KB 3FPPA 3FRPB 1BKBA 1K83H 1UUPA 3G4SA 1JJCB 4Y7NH 2KHSA 5CV7A 5AJ3Q 1S40A 3D31A 3HOYH 4P71A 1PYBA 3K80C 4R4TA 1PH6A 3A7LA 3MC0B 4GNXC 3M85A 2EZVA 1SYCA 4IPHA 1Y1WG 3H3VI 3L9AX 1SNCA 4EX5A 1G6PA 1CQVA 3FEWX 2RHQB 1I4GA 3TN2A 3EN2A 1I94L 4QB4A 4GN4B 3SK6A 5I2XA 5EBCA 1EU3A 4R4CA 2KEDA 2K1BA 3BVMA 4U673 1FVIA 3G7LA 4LF9Q 2K5NA 3C1EA 1QVCA 2HT1A 3S15H 4QY7A 1PH1A 3EJIA 2B2WC 1HRJA 1C9OA 1BBXC 5C44G 4ZCKA 5IP7G 1XTDA 3TREA 2SNMA 1JT8A 3TSSA 3NPPA 1PYWD 1OXSC 4B08A 4Q5VA 2UXBQ 1A15A 2F0TA 3UE0A 4DV6L 5IYCH 1N33L 3HOZB 4OHJA 1I50H 1A63A 4TSSA 3C2PA 1VQEA 1TR5A 1N34L 1ZXTA 5KGUA 2A74C 1PTOC 2AQ3B 4OEMB 3SVMA 4CKBA 1HUNA 3HGBA 5C4JB 1RTNA 3L0OA 1VQ7A 2JA5G 4DV5L 2BOSA 5I4DA 1UWVA 2VQFQ 3RNUA 3KLWA 1EWCA 2WP8J 1OXTA 1K3BC 2NB0A 3NUCA 1RODA 4I65A 1GHKA 1ZKOA 1A0IA 4RCOA 2EIFA 2WAQE 1R9TH 5LMNL 4DV4L 1RIPA 4PZ7A 3I3CA 5CYUA 2UUBL 5ELCA 5D65A 3L7ZC 3N6RA 1B1ZA 5KNCA 3S9WA 2QW7A 1Y1WH 1XNRL 2E2IH 1QUQB 3FVQA 3TP7A 2KBNA 3VYUA 4RAUC 1K8OA 2LSSA 4KLKA 2PW7A 2N49A 4NKLA 3PCOB 3IRBA 4OGQC 1QG7A 3NBHA 2HQEA 1SR3A 3K5NA 2K52A 2Z8LA 2IX0A 2XWJB 2VUMB 2KJXA 3R2IA 5CBAE 1HCZA 2K03A 1L0XB 3RZOB 3S14B 4ODGA 5JEAG 4A3CG 4JI4Q 1LACA 4KHVA 2WB1E 3TP6A 4XQJA 3T13A 5FLXc 4X64Q 1BQQT 5IIFA 1JMCA 4LF9L 4OIJA 1AW7A 2Z1CA 4O42A 1X3GA 3MTSA 3UI2A 2F0MA 5KYLA 5GROA 3X3MA 3OMCA 2CH4A 5CV9A 4S3SA 3AEVA 5C44B 1GUTA 1JJ2A 4LF4Q 5J39A 1PH2A 2ZT9C 3P7JA 2NBFA 1I3QB 1JE4A 3OTOL 1CUKA 4GNXB 1G51A 3NWTA 4HSPA 3H0GB 2FJ2A 3CMAA 4WJ3M 2JA7H 4X66Q 4KN4C 4CKCA 2J7ZA 2ZTCA 1HZAA 2Z6BA 3K81C 1L1OC 2JA5H 1CKMA 3HOVG 3AQQA 3BJUA 1VQ5A 1QVGA 4A3EB 3E6ZX 4EVOA 2PPBC 1YI2A 1IW7C 3CKIB 5C0XG 4A93G 3J81E 1J5EQ 2A68D 1HNWQ 5C4XG 3VA7A 4NXNQ 4RKBA 4G7HC 1PH4A 4OELB 1PRTD 2F0WA 2QDLA 3STBD 2VQFL 1I4HA 1S5BD 3S16B 2JQOA 2BDNA 3H94A 3AFQA 5DEHA 1HTLD 1U9RA 1K8MA 4DV1Q 1W6KA 3PUZA 4CHTB 1O7IA 5G3LD 5TSSA 4JI7Q 4H13C 1WTPA 4Q0FA 5M3MG 1WTHA 1QCBD 1FJGQ 1DYQA 2GVBA 3D0FA 5JEAH 1Q8KA 4A3MG 3M3YH 4A3CH 1Y1VB 2JK8A 3A56A 4ZYSA 1XMQQ 3SE0A 5IWAQ 3S1NB 5GAEC 4RMFA 4DUZQ 3FPUB 1VQJA 1X9NA 4ABNA 1Z7TA 2AUJD 1STBA 3DLLA 2B29A 2Z9HA 2WACA 1STEA 2BA1A 2XIWA 2MJ8A 5H1SE 2R93G 5ELFA 4B3RQ 2NYZD 5K36G 1EQQA 4X64L 3S1RH 1WOCA 2JA8B 3KF6B
chains in the Genus database with same CATH topology
2DJGC 1MHWC 4OELB 2DJFC 4OEMB 4CDEC 4CDFC 4CDCC 1K3BC 1ICFB 4CDDC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DJG C;  1MHW C;  4OEL B;  2DJF C;  4OEM B;  4CDE C;  4CDF C;  4CDC C;  1K3B C;  1ICF B;  4CDD C; 
#chains in the Genus database with same CATH topology
 3L2P A;  4KY7 A;  2GN5 A;  3WOF A;  3I4M G;  4B3S Q;  1EIF A;  1F9P A;  4BBR G;  3IL8 A;  3HKS A;  2CCZ A;  4HJ5 A;  5JAV A;  3HOV H;  4KHZ A;  5JEA J;  1MD2 D;  4LF4 L;  1XNQ Q;  2QCP X;  5C0X H;  1EFW A;  4A93 H;  2YV5 A;  1PVO A;  1IYV A;  1I6H H;  4G57 A;  1V9P A;  5C4X H;  4C3I G;  5E4X A;  1LTL A;  4X66 L;  2RHS B;  4HCS A;  4DFA A;  2JA9 A;  4MN3 A;  3NQI A;  2K5W A;  1NR2 A;  2ICI A;  4C3H B;  3SGI A;  2C9O A;  2IHE A;  3ULL A;  1J5E L;  5EPL A;  1HNW L;  1T5X D;  4BXX H;  4NXN L;  4PMB A;  4C3J G;  2JE6 I;  1QNK A;  1KRT A;  1RDP D;  1YBY A;  3H6M A;  3TP5 A;  2F0S A;  3KLR A;  3G71 A;  1DOL A;  1SLJ A;  1KLU D;  2ATW A;  4IZ8 A;  1HQM C;  1E2V A;  4RH6 A;  2KA7 A;  1W2B A;  1SYF A;  3S1Q B;  4A3M H;  1HA5 A;  5FJ8 G;  5C0X J;  1L1O B;  1SFO B;  4UPA A;  1SN8 A;  1QUQ A;  3H09 A;  1DOM A;  1HTP A;  4GLA C;  2KCT A;  3K7U C;  1XWE A;  4JI7 L;  3SK8 A;  1OXX K;  3RN2 A;  2JA6 G;  1U4R A;  5M3M B;  1TU2 B;  1YNJ C;  1QWY A;  1H9R A;  4FF1 A;  2KHJ A;  3VR4 A;  2OTL A;  5J3B A;  2R93 H;  2B63 G;  1CSQ A;  5IWA L;  5K36 H;  5CMD A;  3I72 A;  5I2Y A;  4DK3 C;  4DUZ L;  4F87 A;  1CKN B;  2WII B;  2RDF A;  2A5H A;  4UDU C;  2MPM A;  3LX0 A;  1SE2 A;  1TWC H;  3I4M H;  1EU4 A;  4HR7 B;  5KYI A;  1K0S A;  4RA8 A;  4A3D B;  1YVC A;  2A6H D;  4BBR H;  1QOH A;  1GM5 A;  1E2Z A;  2DY7 A;  3B6Y A;  3PIP A;  2OTJ A;  3HKZ G;  3PUY A;  5JJL A;  2EY6 A;  4B3R L;  2EYO A;  4LUO A;  3GTL H;  1X55 A;  1JQY D;  2I5H A;  3Q0A A;  3CP0 A;  4C3I H;  2PCF B;  2ZXP A;  1CA6 A;  2D2C C;  4B3S L;  2F3W A;  1VQF A;  1MBY A;  1JOK A;  4JOI A;  3WOE A;  2OF1 A;  3JAM E;  1XNQ L;  4UP8 A;  1JOR A;  4OX9 Q;  3OHX C;  2DN8 A;  1ASY A;  2IHF A;  1YEZ A;  1YHA A;  3GTO H;  1TWF B;  4ZLT F;  4C3J H;  1B4O A;  1LAB A;  2N3S A;  1HZ9 A;  1FYC A;  4EGV A;  3HOX G;  1XX8 A;  4J1M A;  1Q1B A;  4JI0 L;  1TWH H;  3CCS A;  4ID6 A;  5M3F G;  3K57 A;  1PYS B;  3I7F A;  4ZK9 B;  3QIA A;  3CCU A;  1JWS D;  5FKA C;  5IGG A;  3I91 A;  1PZJ D;  5M5W H;  1JWM D;  1ESF A;  2Z4I A;  3LWE A;  4CDD C;  5FJ8 H;  1GHJ A;  4IUN A;  4ZUJ A;  4X3T A;  3GTK H;  4DR5 Q;  1WTX A;  4JI5 Q;  5JJI A;  1UE5 A;  1ZYR D;  3IFD A;  4IUP A;  1O78 A;  2P5Z X;  4DN4 M;  1ILP A;  3FKI G;  5E4W C;  1MSH A;  2JA6 H;  1LT6 D;  3M4Y A;  1G29 1;  5IT9 L;  4IUT A;  2EE1 A;  5IGD A;  4PZ8 A;  1HPC A;  3W1G A;  2NVT B;  2IX1 A;  3I4N B;  4QCL A;  3I70 A;  3NTK A;  1WTW A;  4HAE A;  2B63 H;  5FO8 B;  3A8K E;  1EY4 A;  3C1F A;  1M90 C;  4KHP L;  4XTC S;  2K7V A;  3Q24 A;  3DUZ A;  4YWK A;  4UAI A;  2VW9 A;  2OEO A;  1HNZ Q;  5J1Z A;  1VQK A;  4A3B B;  4KJO A;  3OW2 A;  1PMR A;  1T9H A;  4XQQ A;  1H9S A;  4DK0 A;  1PHJ A;  1VQ6 A;  3DEO A;  1FGU A;  1GUW A;  3QR8 A;  1MI2 A;  5LL6 S;  1LT5 D;  3BZC A;  3S17 H;  4CBV A;  3NK9 A;  4HJ9 A;  3V05 A;  3HZX A;  3RLO A;  1FNW A;  4JBJ A;  2G9H D;  3ULP A;  1GKH A;  4IFD H;  5GAD C;  3D6C A;  3KF6 A;  4IOA A;  1F9Q A;  4CKE A;  3J81 j;  4ME3 A;  1VF5 C;  3GV6 A;  4DR7 Q;  1LTG D;  1WTR A;  1FGB D;  1QNU A;  3DM3 A;  4RWS C;  4DA2 A;  4LUZ A;  2VXW A;  3CQZ H;  2OXP A;  1PTO F;  3HOX H;  3TZU A;  4BY1 B;  3BDL A;  1E7Z A;  2B2T C;  3A8I E;  5M3F H;  2ZJQ A;  4DR1 Q;  1K0R A;  4BY7 H;  2NVX B;  1H95 A;  4GN5 A;  4OX9 L;  4IUV A;  1BCP D;  1WJJ A;  4JI1 Q;  3G6E A;  4A3K G;  5E7N A;  1D1I A;  2Q8I B;  3CCM A;  2MGS A;  3EFX D;  5M5Y H;  2RQX A;  1J9O A;  1WVL A;  1B44 D;  2E2H B;  3SEB A;  1ET6 A;  2MO1 A;  3GTM H;  3S1M B;  3VYR A;  3A7A B;  4IFD J;  3FKI H;  4NP5 A;  2H4O A;  1B70 B;  3I73 A;  1HNX Q;  1K28 A;  5M5X B;  1IKM A;  1AZP A;  5J22 A;  4FF2 A;  2Q8R E;  2BDO A;  4YIJ A;  4LFC Q;  2ZTD A;  1LTT D;  1V8Q A;  3NE5 B;  4KD4 A;  3MAQ A;  4FYD A;  1RJT A;  4HIO A;  1C7Y A;  4PV1 C;  1PH8 A;  4JI5 L;  1MHW C;  5BN5 A;  1K8G A;  4NDX A;  5FOB B;  4RCN A;  1TWG B;  4ZAI A;  2QDB A;  3ER0 A;  2KVM A;  3M7G A;  5IGE A;  5HGT A;  4JV5 Q;  1MSG A;  4KKU A;  5IOD A;  1D5Z C;  4N8F A;  3KFU A;  4DK6 C;  1IBM Q;  4M8A A;  2Q2T A;  1U4L A;  4KY6 A;  3K58 A;  1ILQ A;  4A3J B;  1JCK B;  2EYJ A;  1HNZ L;  1TQO A;  4BS9 A;  3OPO A;  2EJM A;  2F0D A;  3GTG H;  3BYY B;  2CFM A;  1XJV A;  2PMZ B;  3JAM c;  4K2K A;  1F2Z A;  2A68 C;  4GOP C;  3UDF A;  3T56 B;  4B3T Q;  4DXF A;  2MFI A;  2EYH A;  4DAY B;  3PF4 A;  1ICF B;  2FMC A;  4APV A;  3NXW A;  4R8N A;  1G6Z A;  1Q1E A;  1PRT C;  2R61 A;  3STB C;  1S5E D;  1VQM A;  1NCV A;  4K5X A;  5IE8 A;  4LF7 L;  1DZ1 A;  1JE5 A;  5LMN W;  5EQ0 A;  1JOO A;  3GTQ B;  4LFB Q;  1RTO A;  2VQE Q;  3PIP 3;  4DR7 L;  1NMG A;  5D14 A;  2SOB A;  4A3K H;  5CBE E;  1OO9 B;  3Q23 A;  4LFA L;  2LFN A;  3D8G A;  2BCO A;  4LF8 Q;  1D1K A;  1IBK Q;  4HED A;  5FLM G;  1UAP A;  3SK4 A;  5C3E B;  3BDC A;  4DR1 L;  1F9R A;  2N78 A;  3D4R A;  4PNY A;  2A6E C;  1ESR A;  4EQN A;  4JI1 L;  4ALP A;  1N36 L;  3DMU A;  1YNN D;  4DR6 Q;  3S2D B;  2XRS D;  4QIW B;  2RDG A;  1TXY A;  2F3I A;  4TRD A;  4K0K L;  1I6V C;  2K75 A;  1OTC A;  5JJK A;  2VUM G;  2F0L A;  1HNX L;  4FNF A;  4ZKC B;  1WTV A;  1XPO A;  2KQ3 A;  2QF7 A;  3CD6 A;  2N8N A;  4LFC L;  2Y0S B;  4E6I A;  5KEE A;  1CSP A;  1HZB A;  1WTQ A;  1LYL A;  2CW0 D;  1EY0 A;  5KRU A;  3KDF B;  1ZEQ X;  3VA5 A;  3BZD B;  3HOZ H;  3HOW B;  4JV5 L;  1B3Q A;  2K05 A;  2Z6K C;  4N8X 1;  1AE2 A;  3DEP A;  4MNO A;  4DR4 Q;  1IBM L;  2NZH A;  3DM1 A;  3IKJ A;  5JJZ A;  1SE3 A;  1QVF A;  1IBL Q;  2PNR C;  1A3U A;  3QG1 A;  5KIX A;  4LF6 Q;  4Y7N B;  1GJX A;  1QZH A;  3H0G G;  3I4O A;  2ZM6 Q;  2EYF A;  3UDG A;  2MO0 A;  3OWF A;  1FD7 D;  4A3E G;  1NSN S;  2I5M X;  2LS0 1;  4A75 A;  2QKI C;  3GTP H;  3W1B A;  1HZC A;  2FHT A;  2K6A A;  2VZA A;  2IPK D;  3SXH A;  2YTV A;  5AFW A;  5LHY 1;  1LM0 A;  2X6G A;  1X6O A;  5IP9 G;  3S24 A;  1DM0 B;  3S15 B;  1PH9 A;  2IL8 A;  4LFB L;  5CV6 A;  3CU7 A;  4R9W A;  2VQE L;  1KLG D;  1CQF A;  1X3F A;  5EPK A;  2XGT A;  2RF4 A;  3FHW A;  1IL8 A;  5EKI A;  2RCF A;  5IY0 A;  1A3T A;  4LF8 L;  2FFK B;  4BBS G;  2NVQ B;  1IBK L;  3KF8 B;  1KNA A;  3VR6 A;  4KI0 A;  1U0L A;  2VUM H;  1PRT B;  2XN9 C;  3NEN A;  3RZO H;  4L5R C;  1NE3 A;  3S14 H;  3EIV A;  1Y1V G;  4DR6 L;  2MHV A;  1SXT A;  2QEJ C;  2EJG C;  2A73 B;  4X3K A;  2M00 A;  4XT3 B;  1YIT A;  5AJ3 L;  4POF A;  1UE1 A;  2RKS A;  2A6H C;  2ES2 A;  3E9I A;  3HKZ E;  2E75 C;  5COR A;  5IYB G;  3OSO A;  3PO3 B;  1N32 Q;  2BH2 A;  1IZ6 A;  1W3S A;  2PW5 A;  3ND8 A;  5DM7 3;  4DAP A;  4R4Q A;  5C44 H;  2E2D C;  5IP7 H;  4FO2 A;  1PFN A;  1R9T B;  3CCL A;  4I7Z C;  1I3Q H;  1Q90 A;  2JA8 G;  1LO5 D;  1VQN A;  4JI2 Q;  3H0G H;  4UP9 A;  5I6Y A;  1X32 A;  2G5D A;  4H44 C;  2DJF C;  1YJN A;  2XWB B;  1IBL L;  1CK1 A;  2KUM A;  2H1E A;  2O2L D;  4LF6 L;  1X3P A;  2AWO A;  2UXB L;  3TEH B;  1F2L A;  5IP9 H;  1STG A;  4MTK A;  4LK1 C;  2PZW A;  2R7Z B;  4C3H G;  2MQH A;  1KDA A;  2E2J B;  4K5V A;  4FDB A;  4RGN A;  1O7Y A;  4KV6 A;  1ZYR C;  1YNX A;  4KKS A;  2R3Z A;  4DV0 Q;  1V1P A;  1VQ4 A;  2CQO A;  2L12 A;  2HDM A;  1CZG A;  2Q8T A;  1LT4 D;  1SE8 A;  4LNQ A;  1Y1V H;  4YY3 Q;  1C0A A;  1A8V A;  1ML0 D;  1NUC A;  1GOZ A;  5ELB A;  1SDF A;  4BBS B;  1DD2 A;  1JC7 A;  1PDQ A;  2KCC A;  4X3S A;  1PTO B;  4IJL A;  2ID0 A;  1CFM A;  3Q8D A;  2PMZ E;  3S2H H;  1NBW A;  1KAB A;  1Q82 C;  2D9U A;  3NTH A;  5IYB H;  2NN6 I;  3A74 A;  1KDC A;  1A6X A;  3F2B A;  1EQR A;  4UHV A;  1HHV A;  4YWM A;  4DR2 Q;  2RDH A;  4RFB A;  2FMM A;  4WJW A;  2TSS A;  1CKO A;  4RKL A;  4OO1 I;  1H9K A;  3CC2 A;  3VYT A;  2B2Y C;  3W3A A;  1C8C A;  3J80 E;  2JA8 H;  4YCW A;  1HR0 Q;  3T1H Q;  3QOJ A;  5ELO A;  1Q3L A;  2B2U C;  5EJW A;  3KLS A;  3PUV A;  5EKL A;  3M4O B;  4A3D G;  1N32 L;  3UE1 A;  1TWA B;  1GUS A;  4JI4 L;  2E8G A;  2PQA B;  3NHH A;  1ET9 A;  2F0J A;  3D4D A;  3ERS X;  3F2U A;  3F8T A;  3FP9 A;  4ZKB B;  5I6W A;  1SNM A;  2B8F A;  4XQN A;  4JI2 L;  3ERQ A;  4RGM A;  2L1B A;  4CGY B;  3ONA B;  5IT9 E;  1VQP A;  4V19 0;  3SR1 A;  3PGZ A;  4FXG C;  3KBG A;  1BCP C;  5T1I A;  5K5P A;  4OL7 A;  2B2V C;  4C3H H;  2R92 G;  4YHH Q;  1KAA A;  2FXQ A;  1SEB D;  4JC0 A;  5JVG 3;  3GV3 A;  5EPJ A;  2PQE A;  4AIM A;  1KNE A;  4I7A A;  3QWN A;  3CPW A;  4IPD A;  4C1N K;  5M9O A;  3MXG A;  1X54 A;  2OWO A;  1DGS A;  3S1Q H;  4IN3 A;  4KTA A;  2OQK A;  1SFO H;  4JYA Q;  4V0B A;  1RCV D;  3BZK A;  1MJC A;  1PFS A;  3R93 A;  2O5J C;  1M1K C;  2ZJR A;  1QZG A;  4C2M B;  4A3F B;  5M3M H;  1ONL A;  2NVY H;  3NEM A;  1O80 A;  4JVZ A;  1JB7 A;  2Z0S A;  4A3I B;  3I4N G;  3P1H A;  2PZT A;  3ND9 A;  1EOV A;  4DV1 L;  2F0V A;  5E3F A;  4CJ0 B;  3VDY A;  4A3G G;  1AN8 A;  4X3U A;  2H5X A;  4EQO A;  1M4V A;  4KN7 C;  1U4M A;  2HQL A;  3CAM A;  3W2D A;  4WJ4 A;  1K73 C;  4A3B G;  3U4V A;  1FJG L;  5LMU Q;  2RSO A;  1NNX A;  1EIG A;  4DR2 L;  2AKW B;  1IYU A;  2F1M A;  5IOC A;  4KJN A;  4DV2 Q;  1XMQ L;  1NJI C;  2UUC Q;  2BH8 A;  4B9W A;  3TRZ A;  3RLF A;  1D7Q A;  2QIL A;  3DWQ A;  1HR0 L;  3T1H L;  3G6J B;  3G48 A;  1II3 A;  2HDL A;  1TT2 A;  2OCE A;  3CCE A;  4LAA A;  4DAM A;  4HJA A;  3J81 c;  5CV8 A;  1KIX A;  3J7A V;  1TWF H;  3KJO A;  4QMG A;  2I07 B;  4GNX A;  5KNB A;  3J7Y W;  1HJP A;  4BY1 G;  1LT3 D;  1S3O A;  3A5U A;  2F0Q A;  1STN A;  1KAW A;  1PRT F;  3RUZ A;  3E0E A;  1EY8 A;  3TZD A;  2R92 B;  1YNN C;  4YHH L;  1YHQ A;  1VQI A;  4K8J A;  3F2C A;  1LTS D;  1P8L A;  1VMP A;  1STH A;  1WFQ A;  4XT1 B;  3LNN A;  4GLV B;  2D0O A;  4O1N A;  5ELD A;  1E22 A;  4DUY Q;  2PZU A;  3HOU G;  4KMU C;  2B2W A;  2VS1 A;  1SRO A;  5G3L F;  1AP0 A;  3TBI B;  2CHB D;  2A69 D;  1CHP D;  1YZ6 A;  4ME5 A;  1IYJ B;  1STY A;  1O7L A;  2MP1 A;  4FF4 A;  1SJE D;  1BXT A;  2CW0 C;  1VQG A;  2A8V A;  2NVT H;  3I4N H;  4G7O C;  3H3V H;  4JYA L;  3ERO A;  5A35 A;  1E1O A;  3J80 c;  2UXD Q;  2V1C C;  1GUN A;  3OWE B;  1IXR A;  1S4Z A;  1SYD A;  1GO3 E;  1IHZ A;  4A3B H;  3P20 A;  1EEI D;  5HGQ A;  1J8I A;  5GAG C;  1LTR D;  3T16 A;  1QIL A;  1ENF A;  3NBI A;  4A3G B;  3GP7 A;  4MZ9 A;  4GKK Q;  1GXD C;  3X3N A;  3D6W A;  4A3J G;  3RR5 A;  2LY7 A;  5DLQ E;  3J7Z C;  1ASZ A;  1S5F D;  5LMU L;  3KUP A;  1NMF A;  3EA6 A;  2UUC L;  4QGU A;  3RN5 A;  1Z9F A;  4KKT A;  2HIX A;  4R4I A;  2B39 A;  3K5M A;  2PQA A;  1QJO A;  3C3L A;  2WAQ B;  4FP5 D;  1MIU A;  1A3V A;  2HD3 A;  1C48 A;  3TDQ A;  4BY1 H;  1GUG A;  4JI6 Q;  1R4Q B;  2LKV A;  4ILW A;  3UDX A;  3W5O A;  2DNC A;  3CRK C;  3ICE A;  2XNA C;  2NVX H;  3TP8 A;  1SRU A;  1H9M A;  4AYB G;  1B9N A;  3T53 B;  1OXV A;  3GTJ B;  5ISR A;  1I4X A;  4NW2 A;  1B7Y B;  2F52 A;  4OXP A;  2YU9 B;  1A62 A;  1BUV T;  3PO2 B;  3I4L A;  1SNO A;  2K01 A;  5FK9 C;  5C3E G;  4NPS A;  3S1M H;  1EUJ A;  3T51 B;  4C1N I;  1PFB A;  2QA4 A;  3H91 A;  2WKD A;  4Z9C B;  1XYI A;  1DON A;  4GZY C;  1SNP A;  2ZXR A;  4P75 A;  4N9P A;  5M5X H;  3BVZ A;  1GVP A;  5C4H A;  1V1Q A;  2WB1 B;  3E3X A;  3HEJ A;  3CHB D;  4DUY L;  3HOU B;  2HCI A;  2NTT A;  1TWG H;  4HTH A;  1J6Q A;  4L5Q A;  1LV9 A;  3MA2 B;  4R8I A;  5C0X I;  3CF5 A;  3SK5 A;  5CV4 A;  1EIY B;  4HMJ A;  1KQS A;  2Y0S G;  1L2F A;  2N55 A;  4POG A;  4DR5 L;  2JN4 A;  3CQZ B;  3K0X A;  2V4D A;  5I9P A;  3T4A C;  3DXJ C;  5IGC A;  4P73 A;  2UXD L;  1L1O A;  2L4N A;  1LTA D;  4JBW A;  2AWN A;  3RZD B;  4ZUI A;  2JYO A;  2UU9 Q;  4LUV A;  3HOW G;  2R7D A;  1DOK A;  2UUA Q;  4J8Q A;  3JC6 6;  1XTC D;  4HMI A;  3NBH B;  5T1G A;  4TVA B;  2ZJP A;  3Q22 A;  3PV0 A;  4B3M Q;  3KK7 A;  1EFI D;  5DNF A;  4TKO B;  1I94 Q;  2D5D A;  2GVA A;  2DJG C;  3RLN A;  1CKN A;  2L11 A;  3K5O A;  4H0L C;  4KK7 A;  1WCM B;  3GTQ H;  1PH5 A;  5JPN C;  4F7X A;  5FO7 B;  1V43 A;  1UNS A;  3GDE A;  4X62 Q;  2F0E A;  4QUF A;  1NY4 A;  1LTB D;  1D5X C;  1B2T A;  3TME A;  5D3D A;  1EY5 A;  3R3O A;  3K7A B;  4JI6 L;  5C3E H;  4IQZ A;  4B9X A;  1N9W A;  1LUZ A;  2ASB A;  2QEX A;  1YNJ D;  3E5S A;  4AYB B;  3MXP A;  3J7A 5;  2AHO B;  1XMO Q;  4JI8 Q;  3ZJY C;  2F0I A;  1EY6 A;  2QGQ A;  3K6O A;  1XPR A;  3S2D H;  5C3W A;  3SDZ A;  2HCC A;  1KL9 A;  1O7Z A;  1ENC A;  3TQY A;  1AZQ A;  3PUW A;  4WFN 3;  2XRQ D;  2OT2 A;  1Y8O B;  3MFY A;  5CR3 A;  4DV7 Q;  1U5K A;  4K6L A;  4IOC A;  4OWW B;  2SEB D;  1BBU A;  1Q8I A;  4JCV E;  3TS2 A;  2F0K A;  3PIO A;  5DAU A;  3AU7 A;  4DV4 Q;  4LMQ D;  2HUG A;  1VQA A;  4JK1 C;  3MXU A;  3BS1 A;  2UUB Q;  3E0J A;  2EPB A;  1SND A;  3HOW H;  3PO3 G;  1L0W A;  4K2L A;  2SNS A;  3OMG A;  4C56 C;  2EY5 A;  1XNR Q;  2ICE C;  4ULL A;  2K5Q A;  4M1U B;  4L63 B;  1STA A;  3QJY A;  3KOJ A;  4IO9 A;  2Q2I A;  3D4W A;  2SDF A;  4PG3 A;  1SE4 A;  4UY8 C;  4HJ7 A;  4XYQ A;  2K5V A;  2IY5 B;  2UU9 L;  1H9J A;  1SNQ A;  2K14 A;  2L55 A;  2UUA L;  3CCQ A;  2DNE A;  4JBK A;  1EWI A;  1K83 B;  3HG9 A;  2F03 A;  4B3M L;  4JOI C;  3GQB A;  4PZ6 A;  5C6A A;  3OIP A;  1B8A A;  3HOY B;  5ELN A;  2D62 A;  4R1J A;  2GA4 B;  5C4J H;  1LLR D;  1MKH A;  4YCU A;  4RGT A;  3VR5 A;  1Y8P B;  1I4R A;  4ZQ3 A;  1SYG A;  2K28 A;  1PH3 A;  4B3T L;  2R7Z G;  4X62 L;  2VB2 X;  4O2D A;  1BCP F;  3BG3 A;  3K59 A;  2PYK A;  2M9V A;  4IAL A;  3OTO Q;  3AYH B;  1HQR D;  2NVQ H;  3A0J A;  3M4Q A;  1PZK D;  5FLM H;  2F0H A;  1EZ8 A;  2JSO A;  3E9H A;  4K14 A;  4LJZ C;  1I4Q A;  1AFP A;  1CM9 A;  1NTG A;  1CHQ D;  4A3L G;  4HN7 A;  1VQ8 A;  4U68 A;  4JI8 L;  1XMO L;  2HIV A;  4DV3 Q;  1OXU A;  3F2D A;  4GOP B;  4IFD I;  2NWG A;  2KEN A;  4CJ1 B;  1G2S A;  4FF3 A;  2JA7 G;  1I50 B;  1E2W A;  2VB3 X;  3HRZ C;  1F2Y A;  3CCR A;  1HFG A;  2UXC Q;  5HY6 A;  1EYG A;  4FVM A;  4DV7 L;  3PO3 H;  2ZXO A;  3Q6S A;  1WD1 A;  1JJG A;  3GTP B;  2EYM A;  4H7B A;  2R6G A;  1HXY D;  2KEC A;  3A54 A;  3BDO A;  1RD9 D;  4YWL A;  2NTS A;  4WRD A;  2BA0 A;  4GS3 A;  3H15 A;  3MXN B;  3OOC A;  1PXU A;  3NSW A;  3CME A;  1HFN A;  1GUO A;  1X3Q A;  2WFW A;  1D2B A;  1PA6 A;  5KND A;  3OW7 A;  1EZ6 A;  5EAY A;  1B3A A;  3V96 A;  1A2T A;  1KHI A;  5COY A;  2AQ2 B;  2PNH A;  1TY0 A;  2AQ1 B;  5FLX L;  4JBM A;  2LXK A;  3ULJ A;  3BU2 A;  2JEB I;  1SMY D;  2N88 A;  1Y1W B;  4DR4 L;  3FDT A;  3V2T A;  3CC4 A;  2E2I B;  2R7Z H;  1BO0 A;  4A3E H;  4BA1 I;  2FIN B;  1AEX A;  3EVQ A;  1N8R C;  1PFM A;  2E2J H;  2K50 A;  1Q81 C;  1K9M C;  1CT1 D;  5NUC A;  2EY2 A;  4DAY A;  1FNV A;  1SBB B;  2ZM6 L;  3PMF A;  2A69 C;  4DNI A;  4J6H A;  3SHL A;  1JB3 A;  5C5L A;  2CQA A;  3R2T A;  3U58 A;  4CJ2 C;  4L5T A;  2NUC A;  1Q46 A;  4A3L H;  3S16 H;  2F0O A;  5D3I B;  4DGZ A;  2Q2U A;  1P16 A;  2F4V Q;  1Y69 U;  2XTI A;  1VQO A;  2I0Q A;  5A2Q L;  2K04 A;  2L9H A;  4BBS H;  1BDO A;  4DPG A;  4RGO S;  4NXM Q;  5C5M A;  1UEA B;  1PTO H;  3VR2 A;  1UE7 A;  2EJF C;  1MJE A;  1D5M C;  4A3F G;  2L5T A;  2O4X A;  2J4X A;  2R7F A;  3CW2 C;  3J7A F;  1B53 A;  4DV3 L;  2RA4 A;  4A3I G;  3KLS X;  4N9T A;  4XDX A;  5IGF A;  3O13 A;  4J15 A;  3S1N H;  2Z4H A;  2JA7 B;  5GAH C;  3A55 A;  5LL6 X;  3M4P A;  1BNZ A;  2JA5 B;  1MGS A;  3OYY A;  2UXC L;  1SYB A;  4OWX B;  4DAV A;  4DNR B;  1HR0 W;  4FXD A;  3M4O H;  2OQ0 A;  1TWA H;  2EY1 A;  5BR8 Q;  4BXX G;  3UDI A;  3I55 A;  3C46 A;  4H02 A;  2B2T A;  2CVR A;  1U4P A;  4CDC C;  3PIO 3;  1Q7Y C;  4DNT B;  2K5D A;  5ELE A;  3P75 A;  1Y14 B;  3EQL C;  3U50 C;  4KY5 A;  4DKA C;  1EY9 A;  3KDF A;  3AFP A;  3BVG A;  3PF5 A;  1F77 A;  2K32 A;  1D8L A;  4AYB E;  1XPU A;  1VQD A;  1JOQ A;  4K5W A;  3AMU A;  2A6E D;  1EL0 A;  1HH2 P;  1RHP A;  2JJQ A;  2KOL A;  3U9O A;  3CRL C;  2BE5 D;  3HP3 A;  1AE3 A;  4AQY Q;  2RVL A;  1Q12 A;  3T1Y Q;  2RSN A;  1H9S B;  3S2H B;  2DGY A;  5BN4 A;  3CPF A;  4O0A A;  4K6D A;  2G9D A;  4IJH A;  1R4P B;  2RCN A;  1NR4 A;  3M3Y B;  2XSC A;  3LGJ A;  3D3R A;  3PQI A;  1IKL A;  3MVV A;  2CH4 W;  4HJ8 A;  1M8A A;  1EWH A;  4QIW E;  5EBD A;  2AMC B;  2RBM A;  3QOL A;  4QL5 A;  5F2D A;  1PZI D;  1VF7 A;  1TS5 A;  3RD4 A;  3M7N A;  4L6T B;  2JP1 A;  2VY3 A;  1VCI A;  4JI3 Q;  1WI5 A;  3KJP A;  4C2M H;  4A3F H;  2NZ1 D;  5JVH 3;  1PH7 A;  2Y0S E;  3VYS A;  1I4P A;  3AB9 A;  2F4V L;  1EQT A;  2KHI A;  3IFT A;  4TQU S;  3GO5 A;  5FO9 B;  4DV0 L;  3S1R B;  1VQL A;  2EDG A;  4A3I H;  3MWY W;  1FR3 A;  4A76 A;  1SJH D;  4NXM L;  1G8Z D;  2YTY A;  5BN3 A;  4JI0 Q;  5C4Z A;  2CWA A;  5EKK A;  4GOP A;  4HIK A;  1EQV A;  3H3V C;  3HOV B;  3KF8 A;  3K5L A;  5EGT A;  1JR0 D;  1YIJ A;  3L3O C;  4YY3 L;  4A93 B;  2EYP A;  1I6H B;  3F1Z A;  1B50 A;  5C4X B;  2NZO A;  3FMC A;  5GQO A;  1PTO D;  5CC4 A;  3NTI A;  3K8A A;  1K8A C;  2YYZ A;  4GKJ Q;  2IW3 A;  2C35 B;  2K5H A;  2LMC B;  4PMW A;  1FL0 A;  3MXN A;  4HCE A;  4A3D H;  5BR8 L;  2HHH Q;  4L5S A;  3PUX A;  4IPC A;  3WDN A;  3DWP A;  2IWH A;  1JIC A;  1JWU D;  2WAQ G;  3RMH A;  4KHP Q;  1S5C D;  4RHS A;  4X65 Q;  2X69 A;  4DK1 A;  4K8I A;  1S72 A;  2EQS A;  4CDF C;  2NVY B;  3A8J E;  4OIK A;  1X56 A;  1RF2 D;  4A3M B;  2R92 H;  1EYA A;  2F0G A;  2E74 C;  4BWG B;  4OON A;  2EOT A;  4L8J A;  1VQB A;  4AQY L;  3J81 L;  1SYE A;  3T1Y L;  2L15 A;  3I90 A;  3PO2 G;  3KYH C;  4PMC A;  1XXG A;  4HID A;  2K4K A;  4UP7 A;  2JXM B;  1W6J A;  2WV6 D;  2YTX A;  2R93 B;  2K33 A;  4P2C B;  4ZRZ A;  2WB1 G;  1G2T A;  1DJR D;  4MIU A;  5JOB A;  3NP8 A;  1TWC B;  5JPM C;  3I4M B;  2Z6K A;  2IJ0 A;  4IFD G;  4JI3 L;  1Z6H A;  4BBR B;  3ZYY X;  2Q2H A;  1AH9 A;  1L0Y B;  2F0P A;  1VS0 A;  2F0N A;  1VQ9 A;  1Q86 C;  3CXC A;  3GTL B;  3J81 i;  3MHB A;  2LXJ A;  4JPB W;  1TY2 A;  2L0C A;  3NEL A;  4IUU A;  1BCP B;  4C3I B;  4A3G H;  1PLF A;  1V1O A;  1F2M A;  2WKC A;  1UEB A;  4YCV A;  3J80 L;  2VNU D;  1CTM A;  4NMZ A;  2IX3 A;  4BY7 G;  3PSI A;  3A5Z B;  3KBX A;  5L37 A;  1KTK A;  1FNU A;  2KEE A;  3MFG A;  3CCJ A;  3GTO B;  3NWS A;  2MUY A;  4C3J B;  4KD3 A;  1LTI D;  3QO2 A;  1IW7 D;  3LWU A;  4GN3 B;  3U4Z A;  1BF4 A;  3TS0 A;  1TWH B;  1KDB A;  1SAP A;  4PQX A;  4GKJ L;  5IT9 c;  5HUR A;  5E1F A;  3HS0 C;  1D6E C;  2EVB A;  1NAP A;  4F88 A;  1WCM G;  2IT1 A;  5M5W B;  4DV2 L;  2HHH L;  4MTN A;  3GTK B;  1RKN A;  1EOT A;  3QB3 A;  3GTJ H;  4F8M A;  1RL2 A;  2F0U A;  4QJF A;  3J80 i;  3GD7 A;  2E5L Q;  2YU9 H;  1QE6 A;  3PO2 H;  4Y52 H;  4X65 L;  2JA6 B;  1VDZ A;  2CWP A;  2VL6 A;  1EYD A;  1EYC A;  3HFZ B;  4DR3 Q;  1E1T A;  4EQP A;  2CKZ B;  2EXD A;  2B63 B;  1TII D;  1WYD A;  4G4K A;  4CDE C;  3U9S A;  1GD7 A;  5IYD G;  1E3P A;  2EXZ A;  1BBW A;  4WOR A;  3CC7 A;  3HOU H;  2E2H H;  4HSV A;  1KC8 C;  5IGB A;  3IAY A;  4HIM A;  1A2U A;  4FXK C;  4LF7 Q;  3HKZ B;  3EBE A;  1F9S A;  1I5F A;  2AUK A;  1G91 A;  3M9B A;  4P72 A;  2TMP A;  3S17 B;  3N52 A;  4G7Z C;  1EIH A;  4LWC A;  4LF5 Q;  1UE6 A;  2DUD A;  1TVX A;  4LFA Q;  1IL2 A;  1TKW B;  1CZW A;  1SMX A;  2M2L A;  2JEA I;  3BYT B;  4MHE A;  4XIG S;  2KCN A;  3CCV A;  3RZD H;  1EY7 A;  2B3G A;  3URY A;  4P74 A;  2EYL A;  3MEH A;  1DCZ A;  3OIQ A;  2NN6 G;  1BVS A;  2I5L X;  2PI2 A;  2ZTE A;  1N36 Q;  1VMC A;  1Y8N B;  3I56 A;  1E0B A;  2B8G A;  4XYO A;  3HOX B;  3K0Y A;  4X6A H;  1QB5 D;  1SMY C;  4OO1 G;  5M3F B;  4A3J H;  4AH6 A;  4K0K Q;  1WTO A;  4BY7 B;  4GLX A;  1WCM H;  2ENB A;  2MNA A;  5I9O A;  1ENA A;  4GKK L;  1YJW A;  5M5Y B;  4QUC A;  4OWT B;  1HA6 A;  3ITP A;  3I2Z A;  2O5I C;  4DF7 A;  3GTM B;  2X6L A;  4JW0 A;  4RHR A;  3HOY G;  1WD0 A;  3FKI B;  1X3E A;  4LW1 A;  1EEF D;  1E24 A;  1CI3 M;  2KCM A;  3K7A H;  1DXM A;  1C4Q A;  1BOS A;  1TS2 A;  2F4I A;  1Z47 A;  3JAM L;  3MZ5 A;  1T5E A;  1B9M A;  1CA5 A;  1YHB A;  2J0T D;  2E5L L;  4QF4 A;  5IYD H;  1HUM A;  4NB3 A;  1VQC A;  4DV6 Q;  3VR3 A;  1N33 Q;  3MEF A;  3HOZ G;  1KXL A;  2PI2 E;  1KRS A;  5C3X A;  2D0P A;  1N34 Q;  4IUQ A;  4DR3 L;  4R4O A;  2B2Y A;  4A4I A;  4DXG A;  1K3R A;  2A19 A;  4XXE A;  4DU9 A;  2B2U A;  1VQH A;  5FLX E;  4BA2 I;  1KD1 C;  4JG2 A;  1S5D D;  5IYC G;  3GTG B;  3DWA A;  2E76 C;  2ALY B;  3DHQ A;  3JAM i;  4DV5 Q;  4QQB X;  2PO4 A;  4IPG A;  2A1A A;  1V1P B;  2C5C A;  2NN6 H;  3NQT A;  1TS4 A;  4RG1 A;  3WWV A;  4LF5 L;  1X65 A;  2I46 A;  4IUR A;  5LMN Q;  2DY8 A;  5CV5 A;  2F0F A;  3I8Z A;  4OO1 H;  2B2V A;  1PV4 A;  2WIN B;  1YJ9 A;  1SSO A;  5CGK A;  2F3V A;  1BR9 A;  5DM6 3;  3R8B A;  1ICW A;  5A2Q E;  1TS3 A;  2XVS A;  2BE5 C;  4EQ5 A;  4A3K B;  3FPP A;  3FRP B;  1BKB A;  1K83 H;  1UUP A;  3G4S A;  1JJC B;  4Y7N H;  2KHS A;  5CV7 A;  5AJ3 Q;  1S40 A;  3D31 A;  3HOY H;  4P71 A;  1PYB A;  3K80 C;  4R4T A;  1PH6 A;  3A7L A;  3MC0 B;  4GNX C;  3M85 A;  2EZV A;  1SYC A;  4IPH A;  1Y1W G;  3H3V I;  3L9A X;  1SNC A;  4EX5 A;  1G6P A;  1CQV A;  3FEW X;  2RHQ B;  1I4G A;  3TN2 A;  3EN2 A;  1I94 L;  4QB4 A;  4GN4 B;  3SK6 A;  5I2X A;  5EBC A;  1EU3 A;  4R4C A;  2KED A;  2K1B A;  3BVM A;  4U67 3;  1FVI A;  3G7L A;  4LF9 Q;  2K5N A;  3C1E A;  1QVC A;  2HT1 A;  3S15 H;  4QY7 A;  1PH1 A;  3EJI A;  2B2W C;  1HRJ A;  1C9O A;  1BBX C;  5C44 G;  4ZCK A;  5IP7 G;  1XTD A;  3TRE A;  2SNM A;  1JT8 A;  3TSS A;  3NPP A;  1PYW D;  1OXS C;  4B08 A;  4Q5V A;  2UXB Q;  1A15 A;  2F0T A;  3UE0 A;  4DV6 L;  5IYC H;  1N33 L;  3HOZ B;  4OHJ A;  1I50 H;  1A63 A;  4TSS A;  3C2P A;  1VQE A;  1TR5 A;  1N34 L;  1ZXT A;  5KGU A;  2A74 C;  1PTO C;  2AQ3 B;  4OEM B;  3SVM A;  4CKB A;  1HUN A;  3HGB A;  5C4J B;  1RTN A;  3L0O A;  1VQ7 A;  2JA5 G;  4DV5 L;  2BOS A;  5I4D A;  1UWV A;  2VQF Q;  3RNU A;  3KLW A;  1EWC A;  2WP8 J;  1OXT A;  1K3B C;  2NB0 A;  3NUC A;  1ROD A;  4I65 A;  1GHK A;  1ZKO A;  1A0I A;  4RCO A;  2EIF A;  2WAQ E;  1R9T H;  5LMN L;  4DV4 L;  1RIP A;  4PZ7 A;  3I3C A;  5CYU A;  2UUB L;  5ELC A;  5D65 A;  3L7Z C;  3N6R A;  1B1Z A;  5KNC A;  3S9W A;  2QW7 A;  1Y1W H;  1XNR L;  2E2I H;  1QUQ B;  3FVQ A;  3TP7 A;  2KBN A;  3VYU A;  4RAU C;  1K8O A;  2LSS A;  4KLK A;  2PW7 A;  2N49 A;  4NKL A;  3PCO B;  3IRB A;  4OGQ C;  1QG7 A;  3NBH A;  2HQE A;  1SR3 A;  3K5N A;  2K52 A;  2Z8L A;  2IX0 A;  2XWJ B;  2VUM B;  2KJX A;  3R2I A;  5CBA E;  1HCZ A;  2K03 A;  1L0X B;  3RZO B;  3S14 B;  4ODG A;  5JEA G;  4A3C G;  4JI4 Q;  1LAC A;  4KHV A;  2WB1 E;  3TP6 A;  4XQJ A;  3T13 A;  5FLX c;  4X64 Q;  1BQQ T;  5IIF A;  1JMC A;  4LF9 L;  4OIJ A;  1AW7 A;  2Z1C A;  4O42 A;  1X3G A;  3MTS A;  3UI2 A;  2F0M A;  5KYL A;  5GRO A;  3X3M A;  3OMC A;  2CH4 A;  5CV9 A;  4S3S A;  3AEV A;  5C44 B;  1GUT A;  1JJ2 A;  4LF4 Q;  5J39 A;  1PH2 A;  2ZT9 C;  3P7J A;  2NBF A;  1I3Q B;  1JE4 A;  3OTO L;  1CUK A;  4GNX B;  1G51 A;  3NWT A;  4HSP A;  3H0G B;  2FJ2 A;  3CMA A;  4WJ3 M;  2JA7 H;  4X66 Q;  4KN4 C;  4CKC A;  2J7Z A;  2ZTC A;  1HZA A;  2Z6B A;  3K81 C;  1L1O C;  2JA5 H;  1CKM A;  3HOV G;  3AQQ A;  3BJU A;  1VQ5 A;  1QVG A;  4A3E B;  3E6Z X;  4EVO A;  2PPB C;  1YI2 A;  1IW7 C;  3CKI B;  5C0X G;  4A93 G;  3J81 E;  1J5E Q;  2A68 D;  1HNW Q;  5C4X G;  3VA7 A;  4NXN Q;  4RKB A;  4G7H C;  1PH4 A;  4OEL B;  1PRT D;  2F0W A;  2QDL A;  3STB D;  2VQF L;  1I4H A;  1S5B D;  3S16 B;  2JQO A;  2BDN A;  3H94 A;  3AFQ A;  5DEH A;  1HTL D;  1U9R A;  1K8M A;  4DV1 Q;  1W6K A;  3PUZ A;  4CHT B;  1O7I A;  5G3L D;  5TSS A;  4JI7 Q;  4H13 C;  1WTP A;  4Q0F A;  5M3M G;  1WTH A;  1QCB D;  1FJG Q;  1DYQ A;  2GVB A;  3D0F A;  5JEA H;  1Q8K A;  4A3M G;  3M3Y H;  4A3C H;  1Y1V B;  2JK8 A;  3A56 A;  4ZYS A;  1XMQ Q;  3SE0 A;  5IWA Q;  3S1N B;  5GAE C;  4RMF A;  4DUZ Q;  3FPU B;  1VQJ A;  1X9N A;  4ABN A;  1Z7T A;  2AUJ D;  1STB A;  3DLL A;  2B29 A;  2Z9H A;  2WAC A;  1STE A;  2BA1 A;  2XIW A;  2MJ8 A;  5H1S E;  2R93 G;  5ELF A;  4B3R Q;  2NYZ D;  5K36 G;  1EQQ A;  4X64 L;  3S1R H;  1WOC A;  2JA8 B;  3KF6 B; 
#chains in the Genus database with same CATH homology
 2DJG C;  1MHW C;  4OEL B;  2DJF C;  4OEM B;  4CDE C;  4CDF C;  4CDC C;  1K3B C;  1ICF B;  4CDD C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...