4CDEC

Human dpp1 in complex with 4-amino-n-((1s)-1-cyano-2-(4-(4- cyanophenyl)phenyl)ethyl)tetrahydropyran-4-carboxamide
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
68
structure length
68
Chain Sequence
PFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAATPIPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cathepsin C Inhibitors: Property Optimization and Identification of a Clinical Candidate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords DIPEPTIDYL PEPTIDASE 1 EXCLUSION DOMAIN CHAIN
total genus 7
structure length 68
sequence length 68
chains with identical sequence F
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2013-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.170 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Cysteine proteinases. Chain C 4cdeC00
4OEMB 2DJFC 1MHWC 4OELB 4CDCC 4CDEC 1K3BC 1ICFB 4CDDC 4CDFC 2DJGC
chains in the Genus database with same CATH superfamily
1HRJA 4LW1A 4B3ML 1QB5D 3FPUB 1HFNA 2B3GA 2BCOA 5CV6A 3MAQA 2E76C 5A2QE 5EJWA 4YWKA 5GQOA 3V96A 4DR4Q 3A74A 4M8AA 3I4LA 2A5HA 3CCJA 1Y8OB 2AHOB 1G51A 2QILA 2N55A 1SSOA 1YNJC 4A75A 5C3XA 1WTRA 1EFID 1O7LA 2DY7A 4FVMA 4H02A 4WJ3M 1JR0D 5IYBH 2ID0A 1ET9A 3RN2A 4DK3C 2BH2A 1UUPA 5I4DA 2E5LL 1N9WA 2YTXA 3BDCA 3S2DB 2OXPA 1HNWL 5GAEC 4OWTB 1EQQA 2XTIA 3M3YH 2EXZA 1X9NA 2YYZA 3SXHA 1OXTA 3G6EA 1SLJA 4N8X1 1VQ7A 2KENA 3JAMi 2NUCA 5I6YA 1GUOA 2NZOA 5DM63 1VQGA 3J7A5 4P71A 1EIHA 2IL8A 1A62A 3AFQA 2HD3A 5LMNW 3BVMA 5H1SE 2Z1CA 1BO0A 4L63B 3MFYA 1EY0A 3CCLA 3M9BA 1OXUA 1SYBA 3K5LA 1QUQA 1L1OC 3STBC 3NK9A 1ET6A 4AQYQ 5CGKA 2B2WA 3CW2C 2A6ED 3OW7A 5EBCA 5DNFA 1X3PA 3H3VC 3L3OC 5BN5A 2PZWA 2F0IA 4TSSA 3UDGA 1XPRA 2KJXA 1BBWA 1RTOA 4JYAL 2LXJA 2JA6H 3S9WA 5C44B 5IYCG 1CK1A 3OOCA 5M5XB 3PO3H 4IN3A 1D6EC 1KNAA 1N32L 2R61A 1HCZA 3I56A 2JA8G 2M9VA 5CMDA 1H9MA 1LTTD 1OXXK 1NR2A 4N9TA 4K5XA 2D0PA 2A6EC 1B9NA 3D3RA 5JEAJ 3S1RH 4B3RQ 2A6HD 4FNFA 4A3GG 1JJGA 2LMCB 2PQAA 2NVQH 5JOBA 2I0QA 2DJGC 4L5TA 3X3NA 3PO2B 3STBD 4A3JB 2B2TC 2Z0SA 3Q6SA 2PI2E 2L9HA 3NENA 3HOYH 1QVCA 1SXTA 3SGIA 3MXUA 3NE5B 3S1QH 1PRTC 1STYA 4IFDJ 4NXNQ 2VUMH 5HGQA 1X3GA 4PG3A 1L0XB 3GTPB 1DZ1A 5I6WA 4XXEA 3J80i 1SE2A 2UU9Q 3PIO3 2Y0SB 3EN2A 4KJNA 3I73A 5CV7A 4DV0Q 1S40A 1EQTA 4L5QA 5IOCA 1VQJA 3Q22A 1HZBA 2B8FA 4DR2Q 2UUBQ 1BNZA 1B53A 1E3PA 1B70B 4POFA 3MWYW 1XPOA 1EFWA 4U673 1WTHA 5IP9G 2E75C 2A74C 1QNUA 2UXDQ 1YBYA 2B2YC 1D5ZC 4HR7B 5EQ0A 3AQQA 4K5VA 3VA7A 4A3KB 3M7NA 1CT1D 3RMHA 3RD4A 4X64Q 1XNQL 2E5LQ 1GUSA 2F0GA 4LF9L 1VQEA 1VF5C 1SE4A 5C44G 1ENCA 3GV3A 4U68A 4X66Q 1XX8A 1NSNS 1VQDA 2F3IA 1K0SA 3NWSA 3H3VI 1EEFD 4X62L 4XQNA 4DAMA 3TQYA 4ME3A 3CHBD 1EU4A 2WFWA 2VB3X 4Q5VA 2AUKA 3M85A 1MBYA 2HIVA 1HQMC 1YJWA 1Q8KA 4R4CA 5CR3A 3RZOB 3K7AH 1F9RA 2AUJD 3SK6A 4XYOA 4X65Q 2ZM6Q 2PQAB 1FGUA 3L7ZC 3TDQA 1YIJA 1FJGL 1DM0B 3TREA 2D0OA 2QDBA 3G48A 1L0YB 4JI1Q 2Q2IA 4E6IA 2Z4IA 4I65A 2MGSA 4R4OA 4XYQA 4ZKCB 4QIWE 1E22A 4DR4L 5K36G 1GM5A 2F0HA 5E3FA 4UY8C 3I3CA 4ZKBB 3ICEA 5EPJA 4JOIC 4RGNA 4WRDA 2XIWA 5CV8A 4B9WA 4KMUC 1EY4A 1AEXA 4I7AA 2B63B 1GD7A 1I3QH 3HOWB 1JOQA 1KLGD 3T1YQ 1NCVA 1CFMA 1U0LA 4X62Q 4KHPQ 1QWYA 3S17B 2B2VA 1C4QA 1VQ6A 1XNRQ 2IX3A 3VYRA 4XDXA 2E2IH 3IL8A 3D4DA 2K50A 1OXSC 2QEJC 2N3SA 4JOIA 4K2KA 4B3RL 3K8AA 2J4XA 4EQ5A 3KF8A 3OWEB 4OHJA 3JAME 1SFOB 1I4RA 3T51B 2R3ZA 1HZCA 2K5HA 3CKIB 1G291 4O1NA 1WI5A 3I4MH 1HTLD 1ZYRD 1NR4A 1NBWA 4R1JA 1GHJA 4ME5A 4PMBA 1ESFA 3KLRA 2BOSA 2PW5A 2SOBA 4KV6A 3TSSA 3DEPA 4FF3A 1NAPA 3HOVG 2RHSB 4K8JA 4RCOA 3SK4A 4DV4Q 2R6GA 1VQOA 2C9OA 2BA0A 4X3UA 2AWOA 1NNXA 4EQOA 1I4PA 4A3DB 1CTMA 1FL0A 5ELNA 4DV5Q 1II3A 4A3MH 3MXGA 5C0XI 4IO9A 1HTPA 2D9UA 1Z7TA 3FP9A 1STAA 5DEHA 3VYTA 1PMRA 5HURA 1YJ9A 2JA8B 1BOSA 2UXCL 2FINB 3HOZB 1SN8A 2WKDA 3PO2G 3DMUA 3VYSA 2K33A 1IBLL 1RF2D 1N33Q 2KOLA 2WB1B 4RHRA 1HNXL 1STEA 4QCLA 4JI5L 1H9SA 1HA5A 2JEAI 1NUCA 1PZID 5LMUL 1A8VA 4Y7NH 3EVQA 4GNXC 1K8MA 3GTMH 2F0VA 2EY5A 4XT1B 1PTOF 1HUMA 2WAQB 1CA5A 3K6OA 1PFBA 1Y8PB 2EDGA 4F88A 2QEXA 3CAMA 2OQ0A 1EIGA 5JEAG 3M3YB 4OIKA 1H9SB 3FKIB 2Q8IB 2UXBL 1TVXA 1X32A 3HOUG 2I46A 2KEEA 3AFPA 4OELB 1X3EA 1E0BA 4DUZL 1CA6A 2XNAC 2Z6KA 1F2MA 3I91A 2PCFB 4RKLA 5JAVA 1TS3A 4NB3A 3U9SA 2RSNA 4OWXB 4C3HB 5FO8B 4CJ0B 3D6CA 3QWNA 4GKJL 4J15A 4DAPA 2VS1A 4NPSA 1D1IA 3K0XA 3QOJA 1SROA 2CKZB 3T56B 4JYAQ 4DR6Q 4IOAA 4KN4C 5M9OA 4A3EG 2L55A 4HMJA 4P2CB 1NTGA 4JI2Q 3AMUA 4DUYL 1R4QB 2KA7A 3FDTA 2KCTA 4DNTB 3SDZA 2DY8A 1GOZA 5BN3A 1CKNB 4DPGA 1PH2A 2F4VQ 4G4KA 1MGSA 1DOKA 2KEDA 4WJWA 2HCIA 3S1RB 4JI4Q 4GOPA 1HR0L 4DR7Q 2B2UA 3CP0A 2NB0A 2OWOA 1I3QB 1KC8C 5JEAH 1EOTA 5IT9E 1ONLA 3OIQA 1LT5D 5A2QL 3CCVA 3E0EA 2C5CA 3K0YA 4OL7A 1C7YA 3MHBA 3W5OA 1JE5A 5F2DA 5IT9L 3QJYA 1G91A 2R7ZB 3F2UA 4DN4M 5C5MA 3OIPA 5AJ3L 1IYVA 3ULJA 4UDUC 3FKIH 5IGCA 1E1TA 4RAUC 2F0FA 4GS3A 4A93H 3JC66 3RZDH 4A3MG 2EQSA 4C3HG 1KD1C 4C3JG 5C0XH 1A63A 2OEOA 3J80c 2HHHL 2VQEL 4WJ4A 4LF6L 2IW3A 2UXCQ 5IGBA 2MPMA 3FMCA 3ERSX 3FEWX 2N88A 1MHWC 2PPBC 4V190 3HOVH 5K36H 2ZXPA 2ZTEA 1LTID 3WWVA 5JJLA 1Y1WG 4FF1A 2F4IA 4BBSG 4PQXA 3CCSA 4IALA 1G6ZA 2HHHQ 1EY8A 4HJ7A 3DWQA 4G7HC 1VQ9A 2Y0SG 1IBKL 3MA2B 5HGTA 4NKLA 1N34L 2BE5C 1LTAD 1C0AA 4A3CG 4A3FB 1J6QA 4OX9L 3CMAA 2DNCA 1VQNA 1FVIA 5M5YH 4IUVA 2WAQE 4C1NK 2EJFC 5IODA 1UE1A 4FO2A 2A6HC 3F2DA 5KYIA 4BY7G 2PZTA 1CKMA 3GTKH 4QF4A 4G57A 3HKZE 4V0BA 4IFDI 3F2BA 3KBGA 3HOZG 3NQIA 1YHAA 1S5DD 3D4RA 3BZDB 3K7AB 1SFOH 2DGYA 2FMCA 1XXGA 4IFDG 1LTLA 4TKOB 4A4IA 4CBVA 4AH6A 4DXGA 2ZJPA 3NELA 1QVGA 3PIP3 1V8QA 1X55A 5KRUA 1Q8IA 2NN6H 3T53B 3S16B 4A93G 2SNMA 3MXNB 2PNHA 5EBDA 4X3TA 1SAPA 1YITA 2UUAL 4LF8L 2EYPA 1VQ5A 2NVTH 1R9TH 3BDOA 4DKAC 1K83B 1HXYD 2M00A 2RHQB 5E1FA 4AQYL 5M5YB 3CXCA 3GQBA 4GN5A 3CC2A 1EQRA 3A7AB 1VF7A 1K9MC 1XNRL 3OW2A 4ZRZA 1O80A 1KRTA 4BWGB 2NVXH 4CHTB 1EYDA 4JPBW 2MO0A 3UI2A 3EROA 2AQ1B 4GLXA 3TZUA 3S2HB 1RL2A 4DV3Q 2HT1A 4CJ1B 2ENBA 4A3EH 1IL2A 2Y0SE 2XRQD 5GROA 3I4NG 2MQHA 3ONAB 3I90A 1TWGH 3UE0A 3AEVA 3KJOA 3TS2A 2RDFA 2NYZD 3HP3A 1JJCB 2RKSA 4A3FG 1VQBA 2XWJB 1V1PB 1H95A 2CH4W 3OMGA 4KLKA 2I5MX 1PH8A 2YTYA 2NN6G 1I6VC 5FOBB 1DONA 1EY9A 2F0DA 5C3EH 1JQYD 2R7ZH 2QGQA 2G9HD 4PNYA 2G5DA 3BYYB 2JA9A 5M3FH 2B8GA 1FD7D 4IFDH 4JV5Q 3LWUA 2IPKD 1DGSA 1RCVD 2FMMA 3TS0A 3KDFA 2JA5B 1LTSD 4C56C 5LMNL 4GOPC 1VQLA 5C3WA 1GKHA 2OT2A 1ICWA 2JXMB 1HNZQ 1LO5D 2HCCA 4X66L 3PIOA 3E3XA 3WOEA 3J81L 4LUZA 4MIUA 3NHHA 1K3BC 2F4VL 2CH4A 1TR5A 3I4NB 4ODGA 1WCMB 4C3IG 3ULLA 5IYDG 1TXYA 3D8GA 4Y7NB 2F0KA 1N36Q 4OWWB 3BVGA 1XMQQ 2NWGA 1M90C 4YCWA 1PTOD 1IZ6A 4RG1A 1YNND 2F0EA 1AN8A 3SHLA 2PI2A 3ZYYX 4M1UB 1GUWA 1H9RA 3K58A 2VY3A 4YWMA 1KRSA 4TVAB 3ZJYC 2KCNA 4Y52H 4DV4L 2VUMG 4EGVA 5G3LF 1BVSA 2PNRC 4IUUA 3NWTA 1WJJA 3S15H 1H9JA 1F77A 3QO2A 1PRTD 1J5EL 3J81c 4DR3L 3N52A 1AZQA 2EOTA 3PCOB 4DV6L 3RLFA 5ELFA 4N8FA 2R7DA 2EYHA 1RIPA 4CDFC 2UUCL 2HDMA 3U58A 1P16A 5M5WH 2EE1A 5CV4A 1TWFH 3CCQA 4LFAL 1SMYD 1O7YA 3P1HA 3GTGH 3KJPA 2JK8A 4DR1Q 4X3SA 3TN2A 3H0GH 2B39A 1HUNA 3PQIA 1I94L 3VR4A 1F2LA 1GVPA 2EPBA 2HUGA 3S15B 2RVLA 1NY4A 4JI5Q 2OCEA 4BBSB 3TP6A 5IYCH 2EYLA 3SVMA 1Q1BA 4RWSC 3W1GA 1FNWA 1VQKA 4KKUA 4MTKA 5KNDA 4ZUIA 5I9OA 2EJMA 5C4ZA 4GNXB 1EYCA 4QL5A 3I7FA 5FLXL 1HHVA 3T13A 4A3GB 2A8VA 2VQFQ 1SEBD 4QUCA 1A3UA 2A68D 3S14B 4B3SL 1GO3E 3GTPH 5G3LD 3GP7A 4RFBA 5DLQE 5IGDA 2JA5H 2R93B 4BBRG 1WTPA 4K14A 4WFN3 1X3FA 4TQUS 4X6AH 1WTWA 1LLRD 3PUXA 2V1CC 4A3BB 3H91A 1KAWA 2J7ZA 3ND9A 1KDCA 2ZT9C 2K03A 1SNPA 2B2YA 3NTIA 3A54A 4DV7L 2KUMA 5A35A 1PH6A 1LUZA 3U4VA 4KKTA 4JI7Q 4HIOA 3PV0A 1UEAB 2UUAQ 1JWMD 2A69C 1Q90A 3D0FA 4IJLA 1Y14B 1UEBA 2RDHA 1B4OA 4UHVA 1SRUA 1UE6A 1KNEA 1I4XA 4F87A 1AW7A 1U4LA 1EUJA 2YU9H 1LT6D 4A3JH 3CRLC 5C44H 5KGUA 1DYQA 2ICIA 2Z9HA 1A15A 3HEJA 1R4PB 2JYOA 1FYCA 2EY1A 1JICA 2BH8A 5M3MH 1HNWQ 2TMPA 4DR6L 3NBHA 1TY0A 5K5PA 1YNJD 2A1AA 2LFNA 4GZYC 3PUYA 4GKKQ 1MJEA 2DN8A 1ZYRC 1PHJA 4LF5Q 4YHHQ 2F0SA 1Q46A 1Q82C 4BS9A 3HOWH 3F8TA 4B9XA 1KDAA 2G9DA 5CORA 4FF2A 4RCNA 1JWUD 1XMQL 2LKVA 3R2IA 1HA6A 2ZTCA 2KBNA 3W1BA 5GAHC 1HZAA 4YY3L 3GTJH 3CD6A 1WTXA 3X3MA 4LF5L 1PTOB 1VMPA 1PXUA 1RHPA 1HNZL 3MEHA 1I6HH 2IY5B 4PMCA 3IKJA 4X65L 1QZHA 3ITPA 4KD4A 3TZDA 4JC0A 2E8GA 3U4ZA 3Q23A 4BY7B 4P75A 1CZGA 2R93G 3KLWA 1BDOA 2WB1G 3B6YA 2B63H 2B2TA 1PH3A 2UUCQ 5T1GA 4IUQA 1SYFA 1CSQA 3O13A 4LF8Q 3U50C 4MHEA 1V1QA 2AQ2B 4O2DA 1EY7A 1AH9A 4GLAC 3FVQA 3S24A 1W2BA 3ND8A 2WIIB 3PO2H 4OEMB 1L1OA 1LYLA 1WTOA 1QUQB 1TWFB 2K5NA 3MVVA 4RHSA 5ELCA 4B3TL 3E9IA 4KI0A 1T5XD 3GTMB 4X64L 4BA1I 4HCEA 2L11A 5ELDA 4A3BH 3MFGA 1MSHA 3PF5A 2AKWB 4A76A 3RN5A 1P8LA 4GN3B 3R3OA 4BY1G 2L4NA 2X69A 3PO3G 1OXVA 2Z6BA 3L2PA 5C4XH 2UUBL 4LNQA 3M4QA 1PFNA 1BQQT 3GD7A 1EQVA 4R4QA 5JVG3 3EIVA 4OXPA 1FR3A 3BVZA 4UAIA 1SE3A 1SNOA 3J7YW 1PTOC 2HQLA 4A3GH 3QIAA 3H94A 2AQ3B 4B3SQ 1G2SA 2K05A 2EYFA 2K6AA 2ZXOA 3HG9A 4QUFA 5BN4A 2MUYA 1VQMA 3W2DA 3D6WA 3M4OB 4ABNA 2F0TA 4YCUA 4CKEA 3TMEA 1Q86C 2H5XA 2R93H 1ESRA 1V1OA 2VQEQ 1JE4A 5E7NA 4IQZA 2HIXA 1D5XC 3KF6A 2Z4HA 2O5JC 2RQXA 1BUVT 3H6MA 2Q2TA 3C3LA 4GKKL 1I94Q 4DV1L 5M5WB 1E7ZA 5C0XJ 1O78A 1Q3LA 5NUCA 2A73B 2EYOA 3PUZA 2KHIA 1PH7A 1J8IA 2Q8RE 2NVYB 1A3TA 3LX0A 3MEFA 3RR5A 1NJIC 1C9OA 1PYBA 1ZKOA 4DV1Q 4QGUA 4DV6Q 1F9PA 3Q8DA 3C46A 1WFQA 2O2LD 2KHJA 2QA4A 2NVXB 1ILQA 4DFAA 1TKWB 4GN4B 5IY0A 4QQBX 3HFZB 1L1OB 5AFWA 5IYBG 4FXDA 1YVCA 4K8IA 1ILPA 5CV9A 4JI7L 3FKIG 2AWNA 5M5XH 1V1PA 3DXJC 1TQOA 3OYYA 5JPMC 4O0AA 1RD9D 2JA6G 4DK6C 4QMGA 1X6OA 2K5WA 3I2ZA 3K5NA 1K8OA 2ZM6L 3UE1A 3M7GA 4A3KG 2JSOA 4P72A 1N36L 1I4HA 1HNXQ 1UE5A 1K8AC 2YV5A 1EU3A 4JBJA 3MXNA 3NSWA 4POGA 4HSVA 5KNBA 4F7XA 4FDBA 1C8CA 3BZCA 5EKKA 1ZXTA 3DEOA 4LK1C 1S3OA 3CPWA 1Y1WB 4GKJQ 4OIJA 5D3IB 3KOJA 1UAPA 3AU7A 2NZHA 5D65A 2Z8LA 1STHA 2MNAA 3HOUB 3R2TA 5IGGA 1B7YB 2D5DA 2HDLA 4LUOA 2GA4B 3NBIA 3OWFA 1GXDC 2CWPA 4N9PA 2L12A 3U9OA 5J22A 2CW0D 1VQ4A 4BA2I 2Z6KC 3P20A 1Y8NB 5D14A 4EX5A 4DV3L 2P5ZX 1JWSD 3F1ZA 1PH4A 1DCZA 2B63G 3HOYB 1QNKA 1IKLA 4DF7A 4DR1L 3K7UC 2UXBQ 1O7IA 1WTVA 4DNRB 4CJ2C 1JC7A 2GVBA 2CQOA 1FNUA 3EFXD 3RLOA 2D62A 2F0WA 2XGTA 4DU9A 3UDIA 1Y1WH 5GAGC 3NUCA 2K4KA 2K75A 4DA2A 2EYJA 5CC4A 2F0NA 1EL0A 2H1EA 4A3JG 2IHFA 4A3IG 3HOWG 3ER0A 4ZAIA 3RLNA 2NTTA 1HQRD 3A8JE 4C3HH 1AE3A 3QB3A 4C3JH 5C0XG 3TP5A 1RJTA 4YHHL 2F0QA 1STNA 5CYUA 2F0MA 1BBUA 1Q12A 5AJ3Q 3CF5A 2NTSA 1SYDA 3BG3A 2K5VA 3TP7A 4EVOA 1MSGA 5ELOA 3K57A 5GADC 1U5KA 2B2UC 5JJZA 4B3TQ 4GOPB 2J0TD 5FLMH 1IL8A 3I55A 2IT1A 1CSPA 2SEBD 1B3QA 4BBRB 4C2MB 1PYSB 4BY1B 3OPOA 1V9PA 5BR8Q 1YNNC 5IIFA 4G7OC 1S5BD 3E0JA 3NQTA 3HOVB 1E2VA 2OTJA 2E2IB 2K52A 2FXQA 4AIMA 3MC0B 2PYKA 1K83H 2WACA 1T9HA 1SMYC 1JCKB 3GV6A 4OGQC 2E2JB 1W3SA 3OTOL 3E5SA 3OMCA 1CQVA 1SJED 1LM0A 4A3BG 2I5LX 2QKIC 1Q1EA 1HZ9A 4OX9Q 4JBMA 1D2BA 1TIID 4UP7A 4LF7Q 5J3BA 4LF6Q 5C4JB 1TWAH 3T1HL 4HIKA 1PZKD 1EWHA 1SBBB 3QR8A 2VL6A 4LF4L 3S1QB 1G6PA 1QVFA 5JVH3 5IP7G 2PO4A 1MD2D 3P7JA 3C2PA 3VR6A 3WDNA 1LV9A 1HPCA 2K5QA 3DM3A 2RA4A 4DAYA 5IYDH 5JPNC 2MO1A 4JCVE 5CBAE 4IPDA 3HKZB 4K2LA 3EQLC 3PF4A 3I4MB 1CHPD 1JOKA 5C4XG 2ZXRA 1N34Q 1GHKA 2K32A 1U4PA 2I5HA 4RMFA 2CFMA 2L0CA 4JI1L 3Q24A 4GNXA 3J7AF 1Y1VB 1Y69U 3L9AX 1E2WA 1KAAA 3GTKB 4R8NA 4A3EB 1PH1A 1JORA 1ML0D 2WKCA 1QG7A 2PW7A 1LTRD 4HAEA 4CGYB 1HFGA 1KQSA 4P74A 1YEZA 2R7FA 1K8GA 4A3LG 1BCPF 1C48A 4NDXA 3VYUA 2VXWA 3EBEA 1PRTB 1Z6HA 3QG1A 1TWHB 4H44C 4H7BA 2Q2HA 3A0JA 2IX0A 1Y1VH 2GVAA 2XSCA 3H0GG 4LFCQ 3VR5A 4ALPA 1VDZA 1XMOQ 3BU2A 1BF4A 2CHBD 2CW0C 3G4SA 1U4MA 4ULLA 1IKMA 4FXKC 2JA6B 5L37A 3EJIA 3OSOA 2IJ0A 1EY6A 2O5IC 1N32Q 1KL9A 1TU2B 4KKSA 4EQPA 2LS01 5M3FG 3TBIB 5I2YA 1EIFA 4A3DG 2Q8TA 2AMCB 4MN3A 1CKOA 1MJCA 2E74C 3SK5A 4K6LA 4IURA 4KTAA 5KYLA 3JAML 5C3EG 2BDNA 3G7LA 1D8LA 3NP8A 4DR2L 4JI2L 4KD3A 4DAVA 3JAMc 1F9SA 3CC7A 3GTQB 1VS0A 1YZ6A 4Z9CB 2WB1E 5CBEE 1M1KC 2EIFA 1B2TA 2D2CC 2JA5G 2DJFC 1HH2P 3PMFA 1B3AA 4DXFA 5JJKA 4HJ9A 3I4MG 4LJZC 4NXNL 1KLUD 1E24A 5M3MB 1EWCA 4HJAA 2FFKB 2DNEA 5FLXE 3RUZA 4LWCA 4YWLA 4C3IH 1WCMH 3CMEA 2L1BA 4NP5A 1S72A 2CQAA 3M4PA 4R4TA 2PQEA 2GN5A 3SK8A 3GTQH 4ZYSA 5LMUQ 1NMGA 4DAYB 1IXRA 2Q2UA 1B1ZA 4LUVA 1SNMA 4A3MB 1I50H 2EJGC 1TS5A 2DUDA 1B8AA 3HRZC 4IOCA 1BBXC 2IWHA 2F0UA 2NVTB 1VQHA 4AYBE 1N8RC 2IHEA 1F2YA 1IW7D 1S5CD 2MP1A 1I6HB 3E6ZX 4PZ8A 4C1NI 4FYDA 5BR8L 3MXPA 3NPPA 2K28A 3CU7A 3HS0C 1IYUA 2EVBA 1JOOA 2SDFA 3DWPA 1WOCA 1TWCH 2XRSD 3KDFB 5FKAC 1HR0W 1ENAA 3A56A 1A2TA 1L0WA 2ASBA 4DR5L 1WTQA 1TWAB 1TWHH 4LMQD 2F1MA 2F3VA 3PGZA 1PA6A 4PZ7A 3GTGB 5JJIA 3S14H 3LGJA 3K81C 3I72A 4NW2A 1TS4A 4JK1C 1QJOA 5IWAL 1E2ZA 3S1NB 3A8KE 1Z47A 2BE5D 1STBA 2KECA 3DLLA 1PFSA 5IP7H 1AFPA 1A6XA 3KF8B 4IZ8A 2VW9A 3C1EA 4LF4Q 2O4XA 3GTLB 4DUYQ 1EOVA 3J80L 2E2HB 1IYJB 4CDDC 1XTCD 1JMCA 4Q0FA 1GJXA 4HSPA 2QDLA 4KN7C 1XTDA 1YI2A 2EY6A 5IWAQ 4NXMQ 2R92G 4LFBQ 3FRPB 3HZXA 1I4GA 5M3MG 4QB4A 1RODA 4JV5L 5FO9B 1LTGD 2KVMA 3HOYG 4FP5D 4HIDA 2B29A 1G8ZD 5C5LA 2OTLA 2LXKA 3F2CA 1GUTA 1QOHA 2I07B 2JA7B 1EZ8A 4FXGC 3H3VH 3J81E 1SDFA 1J5EQ 4XT3B 2BDOA 1DOLA 3I4NH 5IGFA 4XIGS 1WD0A 1CQFA 3GO5A 2VZAA 1S5ED 1PFMA 1S5FD 4KHZA 4DV0L 4DGZA 4R8IA 2B2WC 4DV2Q 1EYAA 3A7LA 3PUVA 1UWVA 2NZ1D 1YHQA 1ASZA 1Y1VG 1IW7C 1KDBA 5EGTA 4TRDA 3N6RA 5D3DA 5EPKA 2KCCA 2EXDA 4RGTA 5E4XA 4B3MQ 1GUNA 1EIYB 1BCPC 3MZ5A 2F3WA 1E1OA 2E2DC 5EAYA 4J6HA 4BXXG 1VQFA 5I9PA 2K5DA 3UDXA 3T1YL 2K04A 3URYA 3I70A 1SNQA 4RKBA 2ICEC 4BY1H 3QOLA 2RSOA 4HJ5A 3TRZA 3BYTB 1SE8A 2VB2X 3KUPA 2K01A 3T4AC 1TWCB 4A3KH 3H0GB 2K14A 4CDCC 1NMFA 4B08A 1VQIA 2LSSA 3BDLA 3H09A 3AB9A 1M4VA 1U4RA 5EKIA 3WOFA 3C1FA 2XVSA 1LACA 2QW7A 4JI8Q 4HN7A 3GTOB 2BA1A 1SNDA 1XMOL 3DUZA 4APVA 1U9RA 4PZ6A 1FGBD 2MHVA 2LY7A 4LFCL 2ES2A 2JA8H 1NE3A 1H9KA 2L5TA 1LT4D 1PYWD 1YJNA 1J9OA 1VQ8A 4HTHA 1AZPA 5EKLA 1X65A 4J8QA 4KY5A 4ZQ3A 3L0OA 2K7VA 1TY2A 2JJQA 5IT9c 3KYHC 2NN6I 2N49A 5M3FB 1ASYA 2YTVA 4QIWB 2PMZE 2H4OA 1S4ZA 3GTOH 1EEID 3EA6A 3CCUA 3J80E 1D5MC 2JN4A 4MNOA 1QZGA 1JB3A 3IFTA 3CCMA 4LF9Q 4BXXH 2OQKA 5C4XB 1XJVA 1N33L 1I5FA 4JI0Q 3CQZH 2RF4A 4C2MH 1A0IA 3CRKC 1EYGA 2CVRA 1L2FA 1W6JA 5LHY1 5T1IA 5KEEA 3DM1A 2F0JA 1TWGB 3TP8A 2HQEA 4RH6A 3ULPA 1Q7YC 4DV5L 3HKZG 2F0OA 3DWAA 3S1NH 4DK1A 1STGA 4JI3L 3HKSA 4MZ9A 1BKBA 3RZDB 5C6AA 2JE6I 4KJOA 3J7ZC 4P73A 2F52A 5CV5A 1TT2A 4R4IA 2ZJRA 1LTBD 4F8MA 5COYA 3V2TA 4IPGA 3IAYA 5FLXc 3CCRA 4WORA 2IX1A 1F9QA 1PVOA 2SNSA 3P75A 1SNCA 4QJFA 4DK0A 1CZWA 1XYIA 5FLMG 1KTKA 1OO9B 4KY7A 3K80C 1KABA 2F03A 2WP8J 1JJ2A 1JB7A 4AYBG 2A69D 1UE7A 5KIXA 2JA7H 1CI3M 1LT3D 4NXML 2X6GA 4A3FH 4L8JA 1PTOH 1B50A 3AYHB 3KFUA 4BBSH 4KHPL 2X6LA 2R92H 1V43A 3NTKA 2FHTA 4GLVB 5TSSA 4L5RC 1BCPD 3A55A 4A3CH 1HJPA 3NXWA 4JI4L 4KK7A 2ZJQA 5FJ8G 2PZUA 3UDFA 4KY6A 5LL6S 5LMNQ 4YIJA 3CC4A 4L5SA 2E2JH 1D7QA 1BCPB 4C3IB 1BR9A 3I4OA 2EY2A 1ICFB 4K6DA 4DR5Q 3S1MB 3KLSA 4LAAA 4ILWA 2JEBI 5C3EB 3HOZH 2NBFA 1W6KA 1ZEQX 3W3AA 4JW0A 3VR2A 1UNSA 2R92B 5C4JH 3KBXA 1CM9A 1Z9FA 2VQFL 1YHBA 2RCNA 5HY6A 4JI8L 4HJ8A 1WYDA 4OO1I 4UP9A 3VR3A 3HOUH 1QILA 3D31A 3SEBA 4JI0L 4XTCS 1VQCA 1EY5A 4CKBA 1WVLA 3T1HQ 3S1MH 1VMCA 4ZK9B 5DAUA 1SYCA 1IBML 4KHVA 4JBKA 2ATWA 5J39A 4LF7L 1SMXA 4X3KA 3IFDA 5ISRA 4A93B 1TS2A 4DR3Q 2XN9C 1G2TA 1DXMA 1LABA 2JP1A 3FHWA 1IBMQ 3HOXG 3A5UA 4BBRH 5LL6X 1FNVA 1SJHD 4NMZA 4LFAQ 3S2DH 4DV7Q 1K3RA 4PMWA 3BJUA 3J81j 4I7ZC 1RKNA 3GTLH 2E2HH 1X54A 3D4WA 1VQAA 3R93A 4K0KL 1AP0A 1QCBD 5I2XA 3MTSA 4YY3Q 3J7AV 3CCEA 4DV2L 2MFIA 4IPCA 1A2UA 4K5WA 3NEMA 1X3QA 4YCVA 4C3JB 1VCIA 2CWAA 1Q81C 4L6TB 3G6JB 3G71A 2YU9B 2WV6D 2B2VC 4DNIA 3PO3B 4XQJA 4OO1G 4ZUJA 2TSSA 4R9WA 2F0PA 2L15A 1GUGA 2R7ZG 1R9TB 2RDGA 1PDQA 4A3IH 5KNCA 1SYGA 1CUKA 5FK9C 1D1KA 4IPHA 3PSIA 4LFBL 1B9MA 3VA5A 3A8IE 3R8BA 5IGEA 1EZ6A 2EYMA 4OONA 1VQPA 1SYEA 4JBWA 2ALYB 1K28A 2QF7A 4ZLTF 5C4HA 4JI6L 3KK7A 1KHIA 2KHSA 4XQQA 1KXLA 4J1MA 1WCMG 2EZVA 1PZJD 3BS1A 2PMZB 2VUMB 4HCSA 1F2ZA 1RDPD 3TEHB 1B44D 3M4OH 1A3VA 2XWBB 2UXDL 3KF6B 1K0RA 2F0LA 3NTHA 1JT8A 4DUZQ 3PIPA 4A3IB 1BXTA 3SR1A 1IBLQ 3GTJB 4QY7A 5EPLA 1KIXA 3S2HH 4G7ZC 2C35B 3GDEA 1I50B 2UU9L 2JA7G 4JVZA 2N78A 4JI3Q 3CPFA 4ID6A 1M8AA 3CQZB 1T5EA 5IP9H 3NBHB 2A19A 2ZTDA 4RGOS 4H0LC 3K59A 4AYBB 3VDYA 4OO1H 4IUNA 4BY7H 1DD2A 2QCPX 3RNUA 4UP8A 4FF4A 3M4YA 1XPUA 2K1BA 1PH5A 4O42A 3BZKA 5ELBA 4CKCA 3Q0AA 1CHQD 3A5ZB 2JQOA 3PUWA 3LWEA 3S16H 1XWEA 4EQNA 1DJRD 2M2LA 4UPAA 4CDEC 1OTCA 4MTNA 3ERQA 5FO7B 2KCMA 3OTOQ 4JG2A 4IUPA 2FJ2A 4H13C 4S3SA 5ELEA 1MIUA 2OF1A 1PH9A 4A3DH 4HEDA 4JI6Q 4RA8A 2NVYH 2WINB 3HOXH 1X56A 2A68C 1O7ZA 4A3LH 3K5MA 5E4WC 1PRTF 3SE0A 3I8ZA 2NVQB 3IRBA 3H15A 1PV4A 1PLFA 1XNQQ 1YNXA 3E9HA 1IBKQ 1MKHA 2RBMA 1CKNA 2RCFA 4RGMA 3RZOH 1I4QA 3KLSX 4K0KQ 1RTNA 1QE6A 3HGBA 2CCZA 4IJHA 1EWIA 3K5OA 1WD1A 4HIMA 1HR0Q 4PV1C 4DR7L 4ZCKA 1MI2A 2VNUD 2WAQG 5DM73 3T16A 2KQ3A 5FJ8H 3V05A 3J81i 1SR3A 2V4DA 3HOXB 2MJ8A 3S17H 3LNNA 3FPPA 1IHZA 1AE2A 1FJGQ 1K73C 5J1ZA 2N8NA 4HMIA 1DOMA 1ENFA 4IUTA 5IE8A 3OHXC 3DHQA
chains in the Genus database with same CATH topology
4OEMB 2DJFC 1MHWC 4OELB 4CDCC 4CDEC 1K3BC 1ICFB 4CDDC 4CDFC 2DJGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OEM B;  2DJF C;  1MHW C;  4OEL B;  4CDC C;  4CDE C;  1K3B C;  1ICF B;  4CDD C;  4CDF C;  2DJG C; 
#chains in the Genus database with same CATH topology
 1HRJ A;  4LW1 A;  4B3M L;  1QB5 D;  3FPU B;  1HFN A;  2B3G A;  2BCO A;  5CV6 A;  3MAQ A;  2E76 C;  5A2Q E;  5EJW A;  4YWK A;  5GQO A;  3V96 A;  4DR4 Q;  3A74 A;  4M8A A;  3I4L A;  2A5H A;  3CCJ A;  1Y8O B;  2AHO B;  1G51 A;  2QIL A;  2N55 A;  1SSO A;  1YNJ C;  4A75 A;  5C3X A;  1WTR A;  1EFI D;  1O7L A;  2DY7 A;  4FVM A;  4H02 A;  4WJ3 M;  1JR0 D;  5IYB H;  2ID0 A;  1ET9 A;  3RN2 A;  4DK3 C;  2BH2 A;  1UUP A;  5I4D A;  2E5L L;  1N9W A;  2YTX A;  3BDC A;  3S2D B;  2OXP A;  1HNW L;  5GAE C;  4OWT B;  1EQQ A;  2XTI A;  3M3Y H;  2EXZ A;  1X9N A;  2YYZ A;  3SXH A;  1OXT A;  3G6E A;  1SLJ A;  4N8X 1;  1VQ7 A;  2KEN A;  3JAM i;  2NUC A;  5I6Y A;  1GUO A;  2NZO A;  5DM6 3;  1VQG A;  3J7A 5;  4P71 A;  1EIH A;  2IL8 A;  1A62 A;  3AFQ A;  2HD3 A;  5LMN W;  3BVM A;  5H1S E;  2Z1C A;  1BO0 A;  4L63 B;  3MFY A;  1EY0 A;  3CCL A;  3M9B A;  1OXU A;  1SYB A;  3K5L A;  1QUQ A;  1L1O C;  3STB C;  3NK9 A;  1ET6 A;  4AQY Q;  5CGK A;  2B2W A;  3CW2 C;  2A6E D;  3OW7 A;  5EBC A;  5DNF A;  1X3P A;  3H3V C;  3L3O C;  5BN5 A;  2PZW A;  2F0I A;  4TSS A;  3UDG A;  1XPR A;  2KJX A;  1BBW A;  1RTO A;  4JYA L;  2LXJ A;  2JA6 H;  3S9W A;  5C44 B;  5IYC G;  1CK1 A;  3OOC A;  5M5X B;  3PO3 H;  4IN3 A;  1D6E C;  1KNA A;  1N32 L;  2R61 A;  1HCZ A;  3I56 A;  2JA8 G;  2M9V A;  5CMD A;  1H9M A;  1LTT D;  1OXX K;  1NR2 A;  4N9T A;  4K5X A;  2D0P A;  2A6E C;  1B9N A;  3D3R A;  5JEA J;  3S1R H;  4B3R Q;  2A6H D;  4FNF A;  4A3G G;  1JJG A;  2LMC B;  2PQA A;  2NVQ H;  5JOB A;  2I0Q A;  2DJG C;  4L5T A;  3X3N A;  3PO2 B;  3STB D;  4A3J B;  2B2T C;  2Z0S A;  3Q6S A;  2PI2 E;  2L9H A;  3NEN A;  3HOY H;  1QVC A;  1SXT A;  3SGI A;  3MXU A;  3NE5 B;  3S1Q H;  1PRT C;  1STY A;  4IFD J;  4NXN Q;  2VUM H;  5HGQ A;  1X3G A;  4PG3 A;  1L0X B;  3GTP B;  1DZ1 A;  5I6W A;  4XXE A;  3J80 i;  1SE2 A;  2UU9 Q;  3PIO 3;  2Y0S B;  3EN2 A;  4KJN A;  3I73 A;  5CV7 A;  4DV0 Q;  1S40 A;  1EQT A;  4L5Q A;  5IOC A;  1VQJ A;  3Q22 A;  1HZB A;  2B8F A;  4DR2 Q;  2UUB Q;  1BNZ A;  1B53 A;  1E3P A;  1B70 B;  4POF A;  3MWY W;  1XPO A;  1EFW A;  4U67 3;  1WTH A;  5IP9 G;  2E75 C;  2A74 C;  1QNU A;  2UXD Q;  1YBY A;  2B2Y C;  1D5Z C;  4HR7 B;  5EQ0 A;  3AQQ A;  4K5V A;  3VA7 A;  4A3K B;  3M7N A;  1CT1 D;  3RMH A;  3RD4 A;  4X64 Q;  1XNQ L;  2E5L Q;  1GUS A;  2F0G A;  4LF9 L;  1VQE A;  1VF5 C;  1SE4 A;  5C44 G;  1ENC A;  3GV3 A;  4U68 A;  4X66 Q;  1XX8 A;  1NSN S;  1VQD A;  2F3I A;  1K0S A;  3NWS A;  3H3V I;  1EEF D;  4X62 L;  4XQN A;  4DAM A;  3TQY A;  4ME3 A;  3CHB D;  1EU4 A;  2WFW A;  2VB3 X;  4Q5V A;  2AUK A;  3M85 A;  1MBY A;  2HIV A;  1HQM C;  1YJW A;  1Q8K A;  4R4C A;  5CR3 A;  3RZO B;  3K7A H;  1F9R A;  2AUJ D;  3SK6 A;  4XYO A;  4X65 Q;  2ZM6 Q;  2PQA B;  1FGU A;  3L7Z C;  3TDQ A;  1YIJ A;  1FJG L;  1DM0 B;  3TRE A;  2D0O A;  2QDB A;  3G48 A;  1L0Y B;  4JI1 Q;  2Q2I A;  4E6I A;  2Z4I A;  4I65 A;  2MGS A;  4R4O A;  4XYQ A;  4ZKC B;  4QIW E;  1E22 A;  4DR4 L;  5K36 G;  1GM5 A;  2F0H A;  5E3F A;  4UY8 C;  3I3C A;  4ZKB B;  3ICE A;  5EPJ A;  4JOI C;  4RGN A;  4WRD A;  2XIW A;  5CV8 A;  4B9W A;  4KMU C;  1EY4 A;  1AEX A;  4I7A A;  2B63 B;  1GD7 A;  1I3Q H;  3HOW B;  1JOQ A;  1KLG D;  3T1Y Q;  1NCV A;  1CFM A;  1U0L A;  4X62 Q;  4KHP Q;  1QWY A;  3S17 B;  2B2V A;  1C4Q A;  1VQ6 A;  1XNR Q;  2IX3 A;  3VYR A;  4XDX A;  2E2I H;  3IL8 A;  3D4D A;  2K50 A;  1OXS C;  2QEJ C;  2N3S A;  4JOI A;  4K2K A;  4B3R L;  3K8A A;  2J4X A;  4EQ5 A;  3KF8 A;  3OWE B;  4OHJ A;  3JAM E;  1SFO B;  1I4R A;  3T51 B;  2R3Z A;  1HZC A;  2K5H A;  3CKI B;  1G29 1;  4O1N A;  1WI5 A;  3I4M H;  1HTL D;  1ZYR D;  1NR4 A;  1NBW A;  4R1J A;  1GHJ A;  4ME5 A;  4PMB A;  1ESF A;  3KLR A;  2BOS A;  2PW5 A;  2SOB A;  4KV6 A;  3TSS A;  3DEP A;  4FF3 A;  1NAP A;  3HOV G;  2RHS B;  4K8J A;  4RCO A;  3SK4 A;  4DV4 Q;  2R6G A;  1VQO A;  2C9O A;  2BA0 A;  4X3U A;  2AWO A;  1NNX A;  4EQO A;  1I4P A;  4A3D B;  1CTM A;  1FL0 A;  5ELN A;  4DV5 Q;  1II3 A;  4A3M H;  3MXG A;  5C0X I;  4IO9 A;  1HTP A;  2D9U A;  1Z7T A;  3FP9 A;  1STA A;  5DEH A;  3VYT A;  1PMR A;  5HUR A;  1YJ9 A;  2JA8 B;  1BOS A;  2UXC L;  2FIN B;  3HOZ B;  1SN8 A;  2WKD A;  3PO2 G;  3DMU A;  3VYS A;  2K33 A;  1IBL L;  1RF2 D;  1N33 Q;  2KOL A;  2WB1 B;  4RHR A;  1HNX L;  1STE A;  4QCL A;  4JI5 L;  1H9S A;  1HA5 A;  2JEA I;  1NUC A;  1PZI D;  5LMU L;  1A8V A;  4Y7N H;  3EVQ A;  4GNX C;  1K8M A;  3GTM H;  2F0V A;  2EY5 A;  4XT1 B;  1PTO F;  1HUM A;  2WAQ B;  1CA5 A;  3K6O A;  1PFB A;  1Y8P B;  2EDG A;  4F88 A;  2QEX A;  3CAM A;  2OQ0 A;  1EIG A;  5JEA G;  3M3Y B;  4OIK A;  1H9S B;  3FKI B;  2Q8I B;  2UXB L;  1TVX A;  1X32 A;  3HOU G;  2I46 A;  2KEE A;  3AFP A;  4OEL B;  1X3E A;  1E0B A;  4DUZ L;  1CA6 A;  2XNA C;  2Z6K A;  1F2M A;  3I91 A;  2PCF B;  4RKL A;  5JAV A;  1TS3 A;  4NB3 A;  3U9S A;  2RSN A;  4OWX B;  4C3H B;  5FO8 B;  4CJ0 B;  3D6C A;  3QWN A;  4GKJ L;  4J15 A;  4DAP A;  2VS1 A;  4NPS A;  1D1I A;  3K0X A;  3QOJ A;  1SRO A;  2CKZ B;  3T56 B;  4JYA Q;  4DR6 Q;  4IOA A;  4KN4 C;  5M9O A;  4A3E G;  2L55 A;  4HMJ A;  4P2C B;  1NTG A;  4JI2 Q;  3AMU A;  4DUY L;  1R4Q B;  2KA7 A;  3FDT A;  2KCT A;  4DNT B;  3SDZ A;  2DY8 A;  1GOZ A;  5BN3 A;  1CKN B;  4DPG A;  1PH2 A;  2F4V Q;  4G4K A;  1MGS A;  1DOK A;  2KED A;  4WJW A;  2HCI A;  3S1R B;  4JI4 Q;  4GOP A;  1HR0 L;  4DR7 Q;  2B2U A;  3CP0 A;  2NB0 A;  2OWO A;  1I3Q B;  1KC8 C;  5JEA H;  1EOT A;  5IT9 E;  1ONL A;  3OIQ A;  1LT5 D;  5A2Q L;  3CCV A;  3E0E A;  2C5C A;  3K0Y A;  4OL7 A;  1C7Y A;  3MHB A;  3W5O A;  1JE5 A;  5F2D A;  5IT9 L;  3QJY A;  1G91 A;  2R7Z B;  3F2U A;  4DN4 M;  5C5M A;  3OIP A;  5AJ3 L;  1IYV A;  3ULJ A;  4UDU C;  3FKI H;  5IGC A;  1E1T A;  4RAU C;  2F0F A;  4GS3 A;  4A93 H;  3JC6 6;  3RZD H;  4A3M G;  2EQS A;  4C3H G;  1KD1 C;  4C3J G;  5C0X H;  1A63 A;  2OEO A;  3J80 c;  2HHH L;  2VQE L;  4WJ4 A;  4LF6 L;  2IW3 A;  2UXC Q;  5IGB A;  2MPM A;  3FMC A;  3ERS X;  3FEW X;  2N88 A;  1MHW C;  2PPB C;  4V19 0;  3HOV H;  5K36 H;  2ZXP A;  2ZTE A;  1LTI D;  3WWV A;  5JJL A;  1Y1W G;  4FF1 A;  2F4I A;  4BBS G;  4PQX A;  3CCS A;  4IAL A;  1G6Z A;  2HHH Q;  1EY8 A;  4HJ7 A;  3DWQ A;  4G7H C;  1VQ9 A;  2Y0S G;  1IBK L;  3MA2 B;  5HGT A;  4NKL A;  1N34 L;  2BE5 C;  1LTA D;  1C0A A;  4A3C G;  4A3F B;  1J6Q A;  4OX9 L;  3CMA A;  2DNC A;  1VQN A;  1FVI A;  5M5Y H;  4IUV A;  2WAQ E;  4C1N K;  2EJF C;  5IOD A;  1UE1 A;  4FO2 A;  2A6H C;  3F2D A;  5KYI A;  4BY7 G;  2PZT A;  1CKM A;  3GTK H;  4QF4 A;  4G57 A;  3HKZ E;  4V0B A;  4IFD I;  3F2B A;  3KBG A;  3HOZ G;  3NQI A;  1YHA A;  1S5D D;  3D4R A;  3BZD B;  3K7A B;  1SFO H;  2DGY A;  2FMC A;  1XXG A;  4IFD G;  1LTL A;  4TKO B;  4A4I A;  4CBV A;  4AH6 A;  4DXG A;  2ZJP A;  3NEL A;  1QVG A;  3PIP 3;  1V8Q A;  1X55 A;  5KRU A;  1Q8I A;  2NN6 H;  3T53 B;  3S16 B;  4A93 G;  2SNM A;  3MXN B;  2PNH A;  5EBD A;  4X3T A;  1SAP A;  1YIT A;  2UUA L;  4LF8 L;  2EYP A;  1VQ5 A;  2NVT H;  1R9T H;  3BDO A;  4DKA C;  1K83 B;  1HXY D;  2M00 A;  2RHQ B;  5E1F A;  4AQY L;  5M5Y B;  3CXC A;  3GQB A;  4GN5 A;  3CC2 A;  1EQR A;  3A7A B;  1VF7 A;  1K9M C;  1XNR L;  3OW2 A;  4ZRZ A;  1O80 A;  1KRT A;  4BWG B;  2NVX H;  4CHT B;  1EYD A;  4JPB W;  2MO0 A;  3UI2 A;  3ERO A;  2AQ1 B;  4GLX A;  3TZU A;  3S2H B;  1RL2 A;  4DV3 Q;  2HT1 A;  4CJ1 B;  2ENB A;  4A3E H;  1IL2 A;  2Y0S E;  2XRQ D;  5GRO A;  3I4N G;  2MQH A;  3ONA B;  3I90 A;  1TWG H;  3UE0 A;  3AEV A;  3KJO A;  3TS2 A;  2RDF A;  2NYZ D;  3HP3 A;  1JJC B;  2RKS A;  4A3F G;  1VQB A;  2XWJ B;  1V1P B;  1H95 A;  2CH4 W;  3OMG A;  4KLK A;  2I5M X;  1PH8 A;  2YTY A;  2NN6 G;  1I6V C;  5FOB B;  1DON A;  1EY9 A;  2F0D A;  5C3E H;  1JQY D;  2R7Z H;  2QGQ A;  2G9H D;  4PNY A;  2G5D A;  3BYY B;  2JA9 A;  5M3F H;  2B8G A;  1FD7 D;  4IFD H;  4JV5 Q;  3LWU A;  2IPK D;  1DGS A;  1RCV D;  2FMM A;  3TS0 A;  3KDF A;  2JA5 B;  1LTS D;  4C56 C;  5LMN L;  4GOP C;  1VQL A;  5C3W A;  1GKH A;  2OT2 A;  1ICW A;  2JXM B;  1HNZ Q;  1LO5 D;  2HCC A;  4X66 L;  3PIO A;  3E3X A;  3WOE A;  3J81 L;  4LUZ A;  4MIU A;  3NHH A;  1K3B C;  2F4V L;  2CH4 A;  1TR5 A;  3I4N B;  4ODG A;  1WCM B;  4C3I G;  3ULL A;  5IYD G;  1TXY A;  3D8G A;  4Y7N B;  2F0K A;  1N36 Q;  4OWW B;  3BVG A;  1XMQ Q;  2NWG A;  1M90 C;  4YCW A;  1PTO D;  1IZ6 A;  4RG1 A;  1YNN D;  2F0E A;  1AN8 A;  3SHL A;  2PI2 A;  3ZYY X;  4M1U B;  1GUW A;  1H9R A;  3K58 A;  2VY3 A;  4YWM A;  1KRS A;  4TVA B;  3ZJY C;  2KCN A;  4Y52 H;  4DV4 L;  2VUM G;  4EGV A;  5G3L F;  1BVS A;  2PNR C;  4IUU A;  3NWT A;  1WJJ A;  3S15 H;  1H9J A;  1F77 A;  3QO2 A;  1PRT D;  1J5E L;  3J81 c;  4DR3 L;  3N52 A;  1AZQ A;  2EOT A;  3PCO B;  4DV6 L;  3RLF A;  5ELF A;  4N8F A;  2R7D A;  2EYH A;  1RIP A;  4CDF C;  2UUC L;  2HDM A;  3U58 A;  1P16 A;  5M5W H;  2EE1 A;  5CV4 A;  1TWF H;  3CCQ A;  4LFA L;  1SMY D;  1O7Y A;  3P1H A;  3GTG H;  3KJP A;  2JK8 A;  4DR1 Q;  4X3S A;  3TN2 A;  3H0G H;  2B39 A;  1HUN A;  3PQI A;  1I94 L;  3VR4 A;  1F2L A;  1GVP A;  2EPB A;  2HUG A;  3S15 B;  2RVL A;  1NY4 A;  4JI5 Q;  2OCE A;  4BBS B;  3TP6 A;  5IYC H;  2EYL A;  3SVM A;  1Q1B A;  4RWS C;  3W1G A;  1FNW A;  1VQK A;  4KKU A;  4MTK A;  5KND A;  4ZUI A;  5I9O A;  2EJM A;  5C4Z A;  4GNX B;  1EYC A;  4QL5 A;  3I7F A;  5FLX L;  1HHV A;  3T13 A;  4A3G B;  2A8V A;  2VQF Q;  1SEB D;  4QUC A;  1A3U A;  2A68 D;  3S14 B;  4B3S L;  1GO3 E;  3GTP H;  5G3L D;  3GP7 A;  4RFB A;  5DLQ E;  5IGD A;  2JA5 H;  2R93 B;  4BBR G;  1WTP A;  4K14 A;  4WFN 3;  1X3F A;  4TQU S;  4X6A H;  1WTW A;  1LLR D;  3PUX A;  2V1C C;  4A3B B;  3H91 A;  1KAW A;  2J7Z A;  3ND9 A;  1KDC A;  2ZT9 C;  2K03 A;  1SNP A;  2B2Y A;  3NTI A;  3A54 A;  4DV7 L;  2KUM A;  5A35 A;  1PH6 A;  1LUZ A;  3U4V A;  4KKT A;  4JI7 Q;  4HIO A;  3PV0 A;  1UEA B;  2UUA Q;  1JWM D;  2A69 C;  1Q90 A;  3D0F A;  4IJL A;  1Y14 B;  1UEB A;  2RDH A;  1B4O A;  4UHV A;  1SRU A;  1UE6 A;  1KNE A;  1I4X A;  4F87 A;  1AW7 A;  1U4L A;  1EUJ A;  2YU9 H;  1LT6 D;  4A3J H;  3CRL C;  5C44 H;  5KGU A;  1DYQ A;  2ICI A;  2Z9H A;  1A15 A;  3HEJ A;  1R4P B;  2JYO A;  1FYC A;  2EY1 A;  1JIC A;  2BH8 A;  5M3M H;  1HNW Q;  2TMP A;  4DR6 L;  3NBH A;  1TY0 A;  5K5P A;  1YNJ D;  2A1A A;  2LFN A;  4GZY C;  3PUY A;  4GKK Q;  1MJE A;  2DN8 A;  1ZYR C;  1PHJ A;  4LF5 Q;  4YHH Q;  2F0S A;  1Q46 A;  1Q82 C;  4BS9 A;  3HOW H;  3F8T A;  4B9X A;  1KDA A;  2G9D A;  5COR A;  4FF2 A;  4RCN A;  1JWU D;  1XMQ L;  2LKV A;  3R2I A;  1HA6 A;  2ZTC A;  2KBN A;  3W1B A;  5GAH C;  1HZA A;  4YY3 L;  3GTJ H;  3CD6 A;  1WTX A;  3X3M A;  4LF5 L;  1PTO B;  1VMP A;  1PXU A;  1RHP A;  1HNZ L;  3MEH A;  1I6H H;  2IY5 B;  4PMC A;  3IKJ A;  4X65 L;  1QZH A;  3ITP A;  4KD4 A;  3TZD A;  4JC0 A;  2E8G A;  3U4Z A;  3Q23 A;  4BY7 B;  4P75 A;  1CZG A;  2R93 G;  3KLW A;  1BDO A;  2WB1 G;  3B6Y A;  2B63 H;  2B2T A;  1PH3 A;  2UUC Q;  5T1G A;  4IUQ A;  1SYF A;  1CSQ A;  3O13 A;  4LF8 Q;  3U50 C;  4MHE A;  1V1Q A;  2AQ2 B;  4O2D A;  1EY7 A;  1AH9 A;  4GLA C;  3FVQ A;  3S24 A;  1W2B A;  3ND8 A;  2WII B;  3PO2 H;  4OEM B;  1L1O A;  1LYL A;  1WTO A;  1QUQ B;  1TWF B;  2K5N A;  3MVV A;  4RHS A;  5ELC A;  4B3T L;  3E9I A;  4KI0 A;  1T5X D;  3GTM B;  4X64 L;  4BA1 I;  4HCE A;  2L11 A;  5ELD A;  4A3B H;  3MFG A;  1MSH A;  3PF5 A;  2AKW B;  4A76 A;  3RN5 A;  1P8L A;  4GN3 B;  3R3O A;  4BY1 G;  2L4N A;  2X69 A;  3PO3 G;  1OXV A;  2Z6B A;  3L2P A;  5C4X H;  2UUB L;  4LNQ A;  3M4Q A;  1PFN A;  1BQQ T;  3GD7 A;  1EQV A;  4R4Q A;  5JVG 3;  3EIV A;  4OXP A;  1FR3 A;  3BVZ A;  4UAI A;  1SE3 A;  1SNO A;  3J7Y W;  1PTO C;  2HQL A;  4A3G H;  3QIA A;  3H94 A;  2AQ3 B;  4B3S Q;  1G2S A;  2K05 A;  2EYF A;  2K6A A;  2ZXO A;  3HG9 A;  4QUF A;  5BN4 A;  2MUY A;  1VQM A;  3W2D A;  3D6W A;  3M4O B;  4ABN A;  2F0T A;  4YCU A;  4CKE A;  3TME A;  1Q86 C;  2H5X A;  2R93 H;  1ESR A;  1V1O A;  2VQE Q;  1JE4 A;  5E7N A;  4IQZ A;  2HIX A;  1D5X C;  3KF6 A;  2Z4H A;  2O5J C;  2RQX A;  1BUV T;  3H6M A;  2Q2T A;  3C3L A;  4GKK L;  1I94 Q;  4DV1 L;  5M5W B;  1E7Z A;  5C0X J;  1O78 A;  1Q3L A;  5NUC A;  2A73 B;  2EYO A;  3PUZ A;  2KHI A;  1PH7 A;  1J8I A;  2Q8R E;  2NVY B;  1A3T A;  3LX0 A;  3MEF A;  3RR5 A;  1NJI C;  1C9O A;  1PYB A;  1ZKO A;  4DV1 Q;  4QGU A;  4DV6 Q;  1F9P A;  3Q8D A;  3C46 A;  1WFQ A;  2O2L D;  2KHJ A;  2QA4 A;  2NVX B;  1ILQ A;  4DFA A;  1TKW B;  4GN4 B;  5IY0 A;  4QQB X;  3HFZ B;  1L1O B;  5AFW A;  5IYB G;  4FXD A;  1YVC A;  4K8I A;  1ILP A;  5CV9 A;  4JI7 L;  3FKI G;  2AWN A;  5M5X H;  1V1P A;  3DXJ C;  1TQO A;  3OYY A;  5JPM C;  4O0A A;  1RD9 D;  2JA6 G;  4DK6 C;  4QMG A;  1X6O A;  2K5W A;  3I2Z A;  3K5N A;  1K8O A;  2ZM6 L;  3UE1 A;  3M7G A;  4A3K G;  2JSO A;  4P72 A;  1N36 L;  1I4H A;  1HNX Q;  1UE5 A;  1K8A C;  2YV5 A;  1EU3 A;  4JBJ A;  3MXN A;  3NSW A;  4POG A;  4HSV A;  5KNB A;  4F7X A;  4FDB A;  1C8C A;  3BZC A;  5EKK A;  1ZXT A;  3DEO A;  4LK1 C;  1S3O A;  3CPW A;  1Y1W B;  4GKJ Q;  4OIJ A;  5D3I B;  3KOJ A;  1UAP A;  3AU7 A;  2NZH A;  5D65 A;  2Z8L A;  1STH A;  2MNA A;  3HOU B;  3R2T A;  5IGG A;  1B7Y B;  2D5D A;  2HDL A;  4LUO A;  2GA4 B;  3NBI A;  3OWF A;  1GXD C;  2CWP A;  4N9P A;  2L12 A;  3U9O A;  5J22 A;  2CW0 D;  1VQ4 A;  4BA2 I;  2Z6K C;  3P20 A;  1Y8N B;  5D14 A;  4EX5 A;  4DV3 L;  2P5Z X;  1JWS D;  3F1Z A;  1PH4 A;  1DCZ A;  2B63 G;  3HOY B;  1QNK A;  1IKL A;  4DF7 A;  4DR1 L;  3K7U C;  2UXB Q;  1O7I A;  1WTV A;  4DNR B;  4CJ2 C;  1JC7 A;  2GVB A;  2CQO A;  1FNU A;  3EFX D;  3RLO A;  2D62 A;  2F0W A;  2XGT A;  4DU9 A;  3UDI A;  1Y1W H;  5GAG C;  3NUC A;  2K4K A;  2K75 A;  4DA2 A;  2EYJ A;  5CC4 A;  2F0N A;  1EL0 A;  2H1E A;  4A3J G;  2IHF A;  4A3I G;  3HOW G;  3ER0 A;  4ZAI A;  3RLN A;  2NTT A;  1HQR D;  3A8J E;  4C3H H;  1AE3 A;  3QB3 A;  4C3J H;  5C0X G;  3TP5 A;  1RJT A;  4YHH L;  2F0Q A;  1STN A;  5CYU A;  2F0M A;  1BBU A;  1Q12 A;  5AJ3 Q;  3CF5 A;  2NTS A;  1SYD A;  3BG3 A;  2K5V A;  3TP7 A;  4EVO A;  1MSG A;  5ELO A;  3K57 A;  5GAD C;  1U5K A;  2B2U C;  5JJZ A;  4B3T Q;  4GOP B;  2J0T D;  5FLM H;  1IL8 A;  3I55 A;  2IT1 A;  1CSP A;  2SEB D;  1B3Q A;  4BBR B;  4C2M B;  1PYS B;  4BY1 B;  3OPO A;  1V9P A;  5BR8 Q;  1YNN C;  5IIF A;  4G7O C;  1S5B D;  3E0J A;  3NQT A;  3HOV B;  1E2V A;  2OTJ A;  2E2I B;  2K52 A;  2FXQ A;  4AIM A;  3MC0 B;  2PYK A;  1K83 H;  2WAC A;  1T9H A;  1SMY C;  1JCK B;  3GV6 A;  4OGQ C;  2E2J B;  1W3S A;  3OTO L;  3E5S A;  3OMC A;  1CQV A;  1SJE D;  1LM0 A;  4A3B G;  2I5L X;  2QKI C;  1Q1E A;  1HZ9 A;  4OX9 Q;  4JBM A;  1D2B A;  1TII D;  4UP7 A;  4LF7 Q;  5J3B A;  4LF6 Q;  5C4J B;  1TWA H;  3T1H L;  4HIK A;  1PZK D;  1EWH A;  1SBB B;  3QR8 A;  2VL6 A;  4LF4 L;  3S1Q B;  1G6P A;  1QVF A;  5JVH 3;  5IP7 G;  2PO4 A;  1MD2 D;  3P7J A;  3C2P A;  3VR6 A;  3WDN A;  1LV9 A;  1HPC A;  2K5Q A;  3DM3 A;  2RA4 A;  4DAY A;  5IYD H;  5JPN C;  2MO1 A;  4JCV E;  5CBA E;  4IPD A;  3HKZ B;  4K2L A;  3EQL C;  3PF4 A;  3I4M B;  1CHP D;  1JOK A;  5C4X G;  2ZXR A;  1N34 Q;  1GHK A;  2K32 A;  1U4P A;  2I5H A;  4RMF A;  2CFM A;  2L0C A;  4JI1 L;  3Q24 A;  4GNX A;  3J7A F;  1Y1V B;  1Y69 U;  3L9A X;  1E2W A;  1KAA A;  3GTK B;  4R8N A;  4A3E B;  1PH1 A;  1JOR A;  1ML0 D;  2WKC A;  1QG7 A;  2PW7 A;  1LTR D;  4HAE A;  4CGY B;  1HFG A;  1KQS A;  4P74 A;  1YEZ A;  2R7F A;  1K8G A;  4A3L G;  1BCP F;  1C48 A;  4NDX A;  3VYU A;  2VXW A;  3EBE A;  1PRT B;  1Z6H A;  3QG1 A;  1TWH B;  4H44 C;  4H7B A;  2Q2H A;  3A0J A;  2IX0 A;  1Y1V H;  2GVA A;  2XSC A;  3H0G G;  4LFC Q;  3VR5 A;  4ALP A;  1VDZ A;  1XMO Q;  3BU2 A;  1BF4 A;  2CHB D;  2CW0 C;  3G4S A;  1U4M A;  4ULL A;  1IKM A;  4FXK C;  2JA6 B;  5L37 A;  3EJI A;  3OSO A;  2IJ0 A;  1EY6 A;  2O5I C;  1N32 Q;  1KL9 A;  1TU2 B;  4KKS A;  4EQP A;  2LS0 1;  5M3F G;  3TBI B;  5I2Y A;  1EIF A;  4A3D G;  2Q8T A;  2AMC B;  4MN3 A;  1CKO A;  1MJC A;  2E74 C;  3SK5 A;  4K6L A;  4IUR A;  4KTA A;  5KYL A;  3JAM L;  5C3E G;  2BDN A;  3G7L A;  1D8L A;  3NP8 A;  4DR2 L;  4JI2 L;  4KD3 A;  4DAV A;  3JAM c;  1F9S A;  3CC7 A;  3GTQ B;  1VS0 A;  1YZ6 A;  4Z9C B;  2WB1 E;  5CBE E;  1M1K C;  2EIF A;  1B2T A;  2D2C C;  2JA5 G;  2DJF C;  1HH2 P;  3PMF A;  1B3A A;  4DXF A;  5JJK A;  4HJ9 A;  3I4M G;  4LJZ C;  4NXN L;  1KLU D;  1E24 A;  5M3M B;  1EWC A;  4HJA A;  2FFK B;  2DNE A;  5FLX E;  3RUZ A;  4LWC A;  4YWL A;  4C3I H;  1WCM H;  3CME A;  2L1B A;  4NP5 A;  1S72 A;  2CQA A;  3M4P A;  4R4T A;  2PQE A;  2GN5 A;  3SK8 A;  3GTQ H;  4ZYS A;  5LMU Q;  1NMG A;  4DAY B;  1IXR A;  2Q2U A;  1B1Z A;  4LUV A;  1SNM A;  4A3M B;  1I50 H;  2EJG C;  1TS5 A;  2DUD A;  1B8A A;  3HRZ C;  4IOC A;  1BBX C;  2IWH A;  2F0U A;  2NVT B;  1VQH A;  4AYB E;  1N8R C;  2IHE A;  1F2Y A;  1IW7 D;  1S5C D;  2MP1 A;  1I6H B;  3E6Z X;  4PZ8 A;  4C1N I;  4FYD A;  5BR8 L;  3MXP A;  3NPP A;  2K28 A;  3CU7 A;  3HS0 C;  1IYU A;  2EVB A;  1JOO A;  2SDF A;  3DWP A;  1WOC A;  1TWC H;  2XRS D;  3KDF B;  5FKA C;  1HR0 W;  1ENA A;  3A56 A;  1A2T A;  1L0W A;  2ASB A;  4DR5 L;  1WTQ A;  1TWA B;  1TWH H;  4LMQ D;  2F1M A;  2F3V A;  3PGZ A;  1PA6 A;  4PZ7 A;  3GTG B;  5JJI A;  3S14 H;  3LGJ A;  3K81 C;  3I72 A;  4NW2 A;  1TS4 A;  4JK1 C;  1QJO A;  5IWA L;  1E2Z A;  3S1N B;  3A8K E;  1Z47 A;  2BE5 D;  1STB A;  2KEC A;  3DLL A;  1PFS A;  5IP7 H;  1AFP A;  1A6X A;  3KF8 B;  4IZ8 A;  2VW9 A;  3C1E A;  4LF4 Q;  2O4X A;  3GTL B;  4DUY Q;  1EOV A;  3J80 L;  2E2H B;  1IYJ B;  4CDD C;  1XTC D;  1JMC A;  4Q0F A;  1GJX A;  4HSP A;  2QDL A;  4KN7 C;  1XTD A;  1YI2 A;  2EY6 A;  5IWA Q;  4NXM Q;  2R92 G;  4LFB Q;  3FRP B;  3HZX A;  1I4G A;  5M3M G;  4QB4 A;  1ROD A;  4JV5 L;  5FO9 B;  1LTG D;  2KVM A;  3HOY G;  4FP5 D;  4HID A;  2B29 A;  1G8Z D;  5C5L A;  2OTL A;  2LXK A;  3F2C A;  1GUT A;  1QOH A;  2I07 B;  2JA7 B;  1EZ8 A;  4FXG C;  3H3V H;  3J81 E;  1SDF A;  1J5E Q;  4XT3 B;  2BDO A;  1DOL A;  3I4N H;  5IGF A;  4XIG S;  1WD0 A;  1CQF A;  3GO5 A;  2VZA A;  1S5E D;  1PFM A;  1S5F D;  4KHZ A;  4DV0 L;  4DGZ A;  4R8I A;  2B2W C;  4DV2 Q;  1EYA A;  3A7L A;  3PUV A;  1UWV A;  2NZ1 D;  1YHQ A;  1ASZ A;  1Y1V G;  1IW7 C;  1KDB A;  5EGT A;  4TRD A;  3N6R A;  5D3D A;  5EPK A;  2KCC A;  2EXD A;  4RGT A;  5E4X A;  4B3M Q;  1GUN A;  1EIY B;  1BCP C;  3MZ5 A;  2F3W A;  1E1O A;  2E2D C;  5EAY A;  4J6H A;  4BXX G;  1VQF A;  5I9P A;  2K5D A;  3UDX A;  3T1Y L;  2K04 A;  3URY A;  3I70 A;  1SNQ A;  4RKB A;  2ICE C;  4BY1 H;  3QOL A;  2RSO A;  4HJ5 A;  3TRZ A;  3BYT B;  1SE8 A;  2VB2 X;  3KUP A;  2K01 A;  3T4A C;  1TWC B;  4A3K H;  3H0G B;  2K14 A;  4CDC C;  1NMF A;  4B08 A;  1VQI A;  2LSS A;  3BDL A;  3H09 A;  3AB9 A;  1M4V A;  1U4R A;  5EKI A;  3WOF A;  3C1F A;  2XVS A;  1LAC A;  2QW7 A;  4JI8 Q;  4HN7 A;  3GTO B;  2BA1 A;  1SND A;  1XMO L;  3DUZ A;  4APV A;  1U9R A;  4PZ6 A;  1FGB D;  2MHV A;  2LY7 A;  4LFC L;  2ES2 A;  2JA8 H;  1NE3 A;  1H9K A;  2L5T A;  1LT4 D;  1PYW D;  1YJN A;  1J9O A;  1VQ8 A;  4HTH A;  1AZP A;  5EKL A;  1X65 A;  4J8Q A;  4KY5 A;  4ZQ3 A;  3L0O A;  2K7V A;  1TY2 A;  2JJQ A;  5IT9 c;  3KYH C;  2NN6 I;  2N49 A;  5M3F B;  1ASY A;  2YTV A;  4QIW B;  2PMZ E;  2H4O A;  1S4Z A;  3GTO H;  1EEI D;  3EA6 A;  3CCU A;  3J80 E;  1D5M C;  2JN4 A;  4MNO A;  1QZG A;  1JB3 A;  3IFT A;  3CCM A;  4LF9 Q;  4BXX H;  2OQK A;  5C4X B;  1XJV A;  1N33 L;  1I5F A;  4JI0 Q;  3CQZ H;  2RF4 A;  4C2M H;  1A0I A;  3CRK C;  1EYG A;  2CVR A;  1L2F A;  1W6J A;  5LHY 1;  5T1I A;  5KEE A;  3DM1 A;  2F0J A;  1TWG B;  3TP8 A;  2HQE A;  4RH6 A;  3ULP A;  1Q7Y C;  4DV5 L;  3HKZ G;  2F0O A;  3DWA A;  3S1N H;  4DK1 A;  1STG A;  4JI3 L;  3HKS A;  4MZ9 A;  1BKB A;  3RZD B;  5C6A A;  2JE6 I;  4KJO A;  3J7Z C;  4P73 A;  2F52 A;  5CV5 A;  1TT2 A;  4R4I A;  2ZJR A;  1LTB D;  4F8M A;  5COY A;  3V2T A;  4IPG A;  3IAY A;  5FLX c;  3CCR A;  4WOR A;  2IX1 A;  1F9Q A;  1PVO A;  2SNS A;  3P75 A;  1SNC A;  4QJF A;  4DK0 A;  1CZW A;  1XYI A;  5FLM G;  1KTK A;  1OO9 B;  4KY7 A;  3K80 C;  1KAB A;  2F03 A;  2WP8 J;  1JJ2 A;  1JB7 A;  4AYB G;  2A69 D;  1UE7 A;  5KIX A;  2JA7 H;  1CI3 M;  1LT3 D;  4NXM L;  2X6G A;  4A3F H;  4L8J A;  1PTO H;  1B50 A;  3AYH B;  3KFU A;  4BBS H;  4KHP L;  2X6L A;  2R92 H;  1V43 A;  3NTK A;  2FHT A;  4GLV B;  5TSS A;  4L5R C;  1BCP D;  3A55 A;  4A3C H;  1HJP A;  3NXW A;  4JI4 L;  4KK7 A;  2ZJQ A;  5FJ8 G;  2PZU A;  3UDF A;  4KY6 A;  5LL6 S;  5LMN Q;  4YIJ A;  3CC4 A;  4L5S A;  2E2J H;  1D7Q A;  1BCP B;  4C3I B;  1BR9 A;  3I4O A;  2EY2 A;  1ICF B;  4K6D A;  4DR5 Q;  3S1M B;  3KLS A;  4LAA A;  4ILW A;  2JEB I;  5C3E B;  3HOZ H;  2NBF A;  1W6K A;  1ZEQ X;  3W3A A;  4JW0 A;  3VR2 A;  1UNS A;  2R92 B;  5C4J H;  3KBX A;  1CM9 A;  1Z9F A;  2VQF L;  1YHB A;  2RCN A;  5HY6 A;  4JI8 L;  4HJ8 A;  1WYD A;  4OO1 I;  4UP9 A;  3VR3 A;  3HOU H;  1QIL A;  3D31 A;  3SEB A;  4JI0 L;  4XTC S;  1VQC A;  1EY5 A;  4CKB A;  1WVL A;  3T1H Q;  3S1M H;  1VMC A;  4ZK9 B;  5DAU A;  1SYC A;  1IBM L;  4KHV A;  4JBK A;  2ATW A;  5J39 A;  4LF7 L;  1SMX A;  4X3K A;  3IFD A;  5ISR A;  4A93 B;  1TS2 A;  4DR3 Q;  2XN9 C;  1G2T A;  1DXM A;  1LAB A;  2JP1 A;  3FHW A;  1IBM Q;  3HOX G;  3A5U A;  4BBR H;  5LL6 X;  1FNV A;  1SJH D;  4NMZ A;  4LFA Q;  3S2D H;  4DV7 Q;  1K3R A;  4PMW A;  3BJU A;  3J81 j;  4I7Z C;  1RKN A;  3GTL H;  2E2H H;  1X54 A;  3D4W A;  1VQA A;  3R93 A;  4K0K L;  1AP0 A;  1QCB D;  5I2X A;  3MTS A;  4YY3 Q;  3J7A V;  3CCE A;  4DV2 L;  2MFI A;  4IPC A;  1A2U A;  4K5W A;  3NEM A;  1X3Q A;  4YCV A;  4C3J B;  1VCI A;  2CWA A;  1Q81 C;  4L6T B;  3G6J B;  3G71 A;  2YU9 B;  2WV6 D;  2B2V C;  4DNI A;  3PO3 B;  4XQJ A;  4OO1 G;  4ZUJ A;  2TSS A;  4R9W A;  2F0P A;  2L15 A;  1GUG A;  2R7Z G;  1R9T B;  2RDG A;  1PDQ A;  4A3I H;  5KNC A;  1SYG A;  1CUK A;  5FK9 C;  1D1K A;  4IPH A;  3PSI A;  4LFB L;  1B9M A;  3VA5 A;  3A8I E;  3R8B A;  5IGE A;  1EZ6 A;  2EYM A;  4OON A;  1VQP A;  1SYE A;  4JBW A;  2ALY B;  1K28 A;  2QF7 A;  4ZLT F;  5C4H A;  4JI6 L;  3KK7 A;  1KHI A;  2KHS A;  4XQQ A;  1KXL A;  4J1M A;  1WCM G;  2EZV A;  1PZJ D;  3BS1 A;  2PMZ B;  2VUM B;  4HCS A;  1F2Z A;  1RDP D;  3TEH B;  1B44 D;  3M4O H;  1A3V A;  2XWB B;  2UXD L;  3KF6 B;  1K0R A;  2F0L A;  3NTH A;  1JT8 A;  4DUZ Q;  3PIP A;  4A3I B;  1BXT A;  3SR1 A;  1IBL Q;  3GTJ B;  4QY7 A;  5EPL A;  1KIX A;  3S2H H;  4G7Z C;  2C35 B;  3GDE A;  1I50 B;  2UU9 L;  2JA7 G;  4JVZ A;  2N78 A;  4JI3 Q;  3CPF A;  4ID6 A;  1M8A A;  3CQZ B;  1T5E A;  5IP9 H;  3NBH B;  2A19 A;  2ZTD A;  4RGO S;  4H0L C;  3K59 A;  4AYB B;  3VDY A;  4OO1 H;  4IUN A;  4BY7 H;  1DD2 A;  2QCP X;  3RNU A;  4UP8 A;  4FF4 A;  3M4Y A;  1XPU A;  2K1B A;  1PH5 A;  4O42 A;  3BZK A;  5ELB A;  4CKC A;  3Q0A A;  1CHQ D;  3A5Z B;  2JQO A;  3PUW A;  3LWE A;  3S16 H;  1XWE A;  4EQN A;  1DJR D;  2M2L A;  4UPA A;  4CDE C;  1OTC A;  4MTN A;  3ERQ A;  5FO7 B;  2KCM A;  3OTO Q;  4JG2 A;  4IUP A;  2FJ2 A;  4H13 C;  4S3S A;  5ELE A;  1MIU A;  2OF1 A;  1PH9 A;  4A3D H;  4HED A;  4JI6 Q;  4RA8 A;  2NVY H;  2WIN B;  3HOX H;  1X56 A;  2A68 C;  1O7Z A;  4A3L H;  3K5M A;  5E4W C;  1PRT F;  3SE0 A;  3I8Z A;  2NVQ B;  3IRB A;  3H15 A;  1PV4 A;  1PLF A;  1XNQ Q;  1YNX A;  3E9H A;  1IBK Q;  1MKH A;  2RBM A;  1CKN A;  2RCF A;  4RGM A;  3RZO H;  1I4Q A;  3KLS X;  4K0K Q;  1RTN A;  1QE6 A;  3HGB A;  2CCZ A;  4IJH A;  1EWI A;  3K5O A;  1WD1 A;  4HIM A;  1HR0 Q;  4PV1 C;  4DR7 L;  4ZCK A;  1MI2 A;  2VNU D;  2WAQ G;  5DM7 3;  3T16 A;  2KQ3 A;  5FJ8 H;  3V05 A;  3J81 i;  1SR3 A;  2V4D A;  3HOX B;  2MJ8 A;  3S17 H;  3LNN A;  3FPP A;  1IHZ A;  1AE2 A;  1FJG Q;  1K73 C;  5J1Z A;  2N8N A;  4HMI A;  1DOM A;  1ENF A;  4IUT A;  5IE8 A;  3OHX C;  3DHQ A; 
#chains in the Genus database with same CATH homology
 4OEM B;  2DJF C;  1MHW C;  4OEL B;  4CDC C;  4CDE C;  1K3B C;  1ICF B;  4CDD C;  4CDF C;  2DJG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...