4CDEC

Human dpp1 in complex with 4-amino-n-((1s)-1-cyano-2-(4-(4- cyanophenyl)phenyl)ethyl)tetrahydropyran-4-carboxamide
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
68
structure length
68
Chain Sequence
PFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAATPIPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords DIPEPTIDYL PEPTIDASE 1 EXCLUSION DOMAIN CHAIN
publication title Cathepsin C Inhibitors: Property Optimization and Identification of a Clinical Candidate.
pubmed doi rcsb
source organism Homo sapiens
total genus 7
structure length 68
sequence length 68
chains with identical sequence F
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2013-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.170 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Cysteine proteinases. Chain C 4cdeC00
4OELB 1ICFB 4CDEC 2DJFC 1MHWC 4CDFC 2DJGC 4CDDC 4OEMB 4CDCC 1K3BC
chains in the Genus database with same CATH superfamily
4R8IA 2Y0SE 3S17B 4A3EB 2IL8A 2WAQE 4K5XA 4JI0Q 1VQ4A 4X3KA 3HP3A 3QOJA 5F2DA 3G4SA 3RZDH 2F3WA 3DEPA 4UP8A 3ER0A 2ZJPA 2CHBD 1VQJA 4KKSA 4I7AA 5E1FA 3SVMA 1HR0Q 2QDBA 2DUDA 2QW7A 4X64Q 3DXJC 4PZ8A 3D0FA 3OIQA 3OTOQ 2N88A 1DOLA 1IYUA 4K14A 2VQFQ 1TKWB 4HSVA 2M9VA 3ND9A 1Y1VB 3NTIA 1TS5A 2NYZD 4BBSG 3E5SA 4XDXA 4GKKL 3T16A 2QDLA 4K0KL 1Y1WG 2B2VC 3CCEA 4GN4B 3I72A 2K05A 1FL0A 1GUGA 4TSSA 4N9PA 2KCTA 5J22A 1U9RA 1STGA 2K5HA 2UXDQ 4P74A 4RCOA 1HFNA 4OEMB 1SYBA 1EU3A 1VQOA 2ATWA 4DR3L 4ZUJA 2CWAA 4NXNQ 2Z6KC 2YTXA 1EOTA 3TREA 1L0WA 1DCZA 1RTNA 1V1OA 1KLGD 2R6GA 4JBJA 1SYCA 2F0IA 1XNQL 2YU9H 2RF4A 3I4OA 3A74A 5IYCH 5AJ3L 1B8AA 4DN4M 1C8CA 3AYHB 1WTHA 2ZT9C 5JEAG 3VA7A 1D5ZC 3K81C 1T5XD 4JC0A 5E4WC 3QG1A 5I9OA 2HUGA 2QEJC 2K01A 4QIWB 3VR2A 4A3IB 2KUMA 2B29A 3UE1A 1LTGD 4JI2L 4JI6L 3BDOA 2NTTA 3H91A 1KRSA 4XXEA 1EUJA 1H9SB 3IL8A 1F2LA 2F0WA 2OF1A 2VZAA 1HFGA 1XMQQ 3ITPA 5IGFA 3CU7A 1VQ5A 3V96A 4M1UB 3U9OA 5JPNC 2KHSA 4XT3B 5BN3A 2LKVA 4NDXA 5LMNW 5AFWA 2SEBD 3GTPB 3I3CA 3PO2B 4C3JB 2F0DA 4DV0L 1YI2A 3GTJH 4EQOA 3E0JA 4C56C 3QOLA 3M9BA 4B3TL 1TWFH 1ET9A 3HG9A 1S4ZA 1B3QA 4C2MH 4FDBA 2RDFA 3SR1A 2BH8A 1Q82C 4L5SA 4BXXH 2VQEQ 4UP9A 4CBVA 3CRKC 2R7DA 3UDXA 4X66Q 3F2CA 4BY1B 2NVXH 2EJGC 3NELA 3QIAA 5CMDA 4KK7A 4OX9Q 3L0OA 1DONA 3CW2C 1PTOF 1PV4A 3J80i 5M3FH 4OIJA 4RAUC 2KVMA 2I5HA 4G7HC 3AEVA 3Q8DA 4BWGB 1OXUA 1GXDC 1DYQA 5K36H 3E0EA 2A74C 3KLSA 4J6HA 2HT1A 1O78A 2Q8TA 1EY8A 4HAEA 3CCSA 1IBKL 3HOXH 1JR0D 1VQLA 4DV3Q 3J80L 4JPBW 2KHIA 4XYOA 3EN2A 3NBHB 2AUKA 1FNWA 4A3MG 4B3RL 1I4XA 2F0MA 2O5IC 1CK1A 5GAEC 1QILA 1WCMH 3L3OC 1C4QA 4GS3A 1EQQA 2R7ZG 4UAIA 4WJ4A 3DM1A 3HKZB 4K0KQ 2CKZB 1UWVA 2K03A 2PMZB 5FK9C 2RCFA 1H9SA 1KAAA 3P75A 3NWTA 3PUZA 5FLXE 3W1BA 3NHHA 3GTMH 5JEAJ 1Q1BA 2E5LL 4IFDG 2F0JA 4DV7L 3HOVG 1HNZQ 4C3HB 1W6KA 2KECA 3I4NH 2MHVA 4GN5A 4CDDC 4JI4Q 5KIXA 2NWGA 3S1RH 5I6WA 1N33L 1JOKA 2IHEA 1XNQQ 4A3JG 5K36G 2NVTH 2K6AA 1MHWC 2NVQH 1VS0A 3GTGH 3PSIA 4YCVA 2R61A 3GTLH 3EQLC 4X62L 1LTID 2JA8H 4DR6Q 1PZKD 1NR2A 1E2ZA 3TZDA 4DV6Q 1BDOA 5JAVA 2VL6A 4GOPC 4KLKA 3PIOA 2JA9A 2NZOA 2WIIB 3K5NA 4FO2A 5IGGA 5A2QL 2A69D 2ZM6L 1IW7C 4GN3B 4K8IA 1YIJA 2KBNA 3CC7A 4JV5L 3DM3A 4G4KA 4HIKA 1EWHA 3FP9A 5IY0A 4NKLA 3CHBD 4DUZL 4YWMA 3SK4A 1U4MA 2JE6I 2I46A 5JPMC 1WTXA 1SYDA 1W6JA 3A5UA 4DUYQ 5C4JH 2AQ1B 4OHJA 5C5MA 4DR5L 2FFKB 1K0SA 3MWYW 4B3TQ 2QCPX 4NMZA 4C2MB 1UUPA 1EIGA 1FGUA 1I4HA 1LO5D 5C44H 1K8OA 3OIPA 5KNCA 4DK1A 2YYZA 1HZCA 3LWUA 3TN2A 2DNCA 1GVPA 4DNTB 5C4XH 4XQQA 2E2JH 4IOCA 3WOEA 4UP7A 3CP0A 1I4RA 2A68C 3VYRA 1E3PA 1STHA 1F9RA 4BY7B 2ZTCA 3BYYB 1LTSD 2EY1A 4H7BA 4ODGA 2R93H 3EIVA 5C3EH 4IJLA 1M90C 4OIKA 1XXGA 5LMNL 4XTCS 2CW0D 2E2HB 1HUNA 4KHPL 1SXTA 2A6EC 4RKBA 4OWWB 3KBGA 4A3DH 1IXRA 2OT2A 3BZDB 1Q86C 2VUMH 1LUZA 4IFDJ 2B39A 1HHVA 3UDFA 1QVFA 5KNBA 4OELB 3GQBA 5HURA 4JI8L 5EBCA 2BA0A 1DM0B 1L1OC 4DV4L 4FVMA 2I07B 2MQHA 4HCEA 4AIMA 4B9WA 4X6AH 1ENAA 1HZ9A 4DNRB 2I0QA 2EXZA 3R3OA 1H9JA 1M8AA 1Q8IA 2SOBA 1D8LA 4MIUA 2R3ZA 5COYA 1EYAA 3EVQA 3MXPA 1GUOA 4JI1L 4CDFC 4LF4Q 4M8AA 4OL7A 1CZGA 2NB0A 2EIFA 2XWJB 3S1MH 5M5YB 3U50C 1ZXTA 2IY5B 2MPMA 4L6TB 1FVIA 1BR9A 1BCPF 3ICEA 1TT2A 5M5XB 1TWCB 3HOZG 2F0PA 4HCSA 1N8RC 4ZKBB 4ZQ3A 1P8LA 2UXCL 2MJ8A 1YNJD 1TS3A 5ELFA 3UDGA 3L2PA 5DLQE 1HNWL 1R9TH 1O7LA 4PZ7A 3GTGB 3CCQA 1U4RA 2E2IB 1CTMA 1YNNC 1G2SA 1Z9FA 1STAA 5M3MB 4LFBL 2EPBA 2L5TA 2Q8IB 3K59A 1HA5A 1RHPA 2F4VQ 4LF5Q 1N32L 2VNUD 1CSQA 1D1KA 3M4YA 4AQYQ 2D0PA 1XPUA 1B9MA 1BCPC 1LT4D 1P16A 4WFN3 1G291 5KRUA 1TWAB 4JYAQ 1D6EC 3SE0A 4A93B 5CV4A 1I3QB 1GOZA 3V05A 3BG3A 1SYGA 1WTOA 4JCVE 4FXGC 1YNXA 1L2FA 2RSNA 1WCMG 5C4ZA 3I70A 1NUCA 4A3FH 4BBRG 3MEFA 2B2WC 1MJCA 1VF7A 3WWVA 4OO1G 1XTDA 1NMGA 4B9XA 1KNEA 2Z1CA 4OO1I 4J1MA 4EGVA 1K8AC 4E6IA 4I65A 2ALYB 1J5EL 1D5XC 2XRSD 4EVOA 2XIWA 1G91A 1CSPA 3SK6A 1ICWA 3T51B 4OXPA 1TWHB 2FINB 3PO3G 2EYFA 3S17H 4LF9Q 1A2UA 2EYLA 4A3EH 4LF8L 1DXMA 3IRBA 4LNQA 1AEXA 4KD3A 4JOIC 1HRJA 1LTAD 1X9NA 4DAVA 3AU7A 3CCUA 3MXGA 2IW3A 1VMCA 1X54A 1NCVA 4IO9A 2WV6D 1WD0A 2XWBB 2KCCA 1N36Q 2R93B 1E1TA 2KA7A 2RA4A 5EKLA 2JEAI 5FLXL 4OONA 2G9DA 1BBWA 1Y1VH 3NTKA 1V1PB 1WOCA 4AYBG 2Z4HA 2JA5B 4HJAA 4DV4Q 1EIHA 5LL6X 1A62A 3RMHA 1IL2A 3TS0A 2OTJA 2GN5A 3VYTA 2XRQD 1H9RA 4FP5D 3OW7A 5L37A 4C1NK 2KCMA 2IWHA 2XTIA 2L55A 3T53B 1VQEA 1PH2A 3TMEA 3S2DB 4RWSC 1FD7D 4KI0A 1KIXA 2A6HD 5IT9E 3K5MA 3DLLA 3BU2A 1Y14B 3BVGA 3ERSX 1N34L 3GTOB 4KHVA 4TQUS 2WFWA 3T4AC 4IUPA 2AKWB 1B2TA 1D5MC 3CCRA 1GHJA 4R4TA 1PRTB 1G2TA 1FJGQ 1ILQA 2OCEA 1HH2P 1PFNA 3J7AV 1RTOA 1UE6A 4A3BB 5DM73 3I73A 3W1GA 4DV5Q 3DWQA 5C4HA 1HNWQ 4ZCKA 1FNUA 5M5WB 1T5EA 3HKZE 1JB3A 4A3IH 2NZHA 5IGCA 2PMZE 4ZAIA 1U4PA 4JI5Q 3HOYB 4DR1L 1VCIA 5C3EG 5LMUQ 1VF5C 1G6PA 1V8QA 2JA6G 1KNAA 2E75C 4KJNA 3H15A 5IWAQ 1N32Q 2Z9HA 4A3LH 3S9WA 4IOAA 1IBLL 1WYDA 2E8GA 3M7NA 3CCVA 2WB1B 4AH6A 3RNUA 1XMOQ 2N55A 5CV9A 1PTOH 1SE4A 4LF7L 5CV6A 4WORA 2CQAA 3PO2H 4C3JH 4JBWA 3OYYA 4OGQC 1I4QA 1BQQT 3P20A 4LFAL 2K75A 1QZHA 1SE3A 4DR7L 4RGOS 1V1PA 1EYCA 2X6LA 1VQIA 1ZYRD 1PH4A 1F9PA 5G3LF 4BBSB 2NVYB 3K8AA 2BE5C 3ERQA 1LT6D 3QWNA 3IFTA 1S72A 2L9HA 2F0UA 4BY1H 1DOMA 3KLRA 3CPFA 2QGQA 3TBIB 1RJTA 2TMPA 1HJPA 1NAPA 3OSOA 2B2YC 3NXWA 3GV3A 4IURA 2UUAQ 4HJ8A 1TU2B 2DGYA 4NPSA 1EY0A 1KABA 4NP5A 4A3GG 4H44C 3STBD 5FLMG 1JT8A 2ASBA 1LM0A 3NQIA 1TY2A 3B6YA 3HOWB 2NUCA 3D3RA 4LF6Q 2HCIA 4KD4A 3GTKB 1IYVA 3D4DA 2MO1A 1D1IA 3C46A 3W5OA 2HHHL 1Z47A 1PZJD 4RG1A 2KCNA 1CUKA 1QZGA 1SJHD 4IUVA 4B3ML 3QO2A 5CV5A 2LSSA 5CORA 3P1HA 3D6WA 3NQTA 4B08A 4EQPA 5IP9H 5KYIA 1AH9A 2B63G 1PYBA 2PW5A 1EIYB 3BJUA 4RA8A 3K7AB 5JVH3 1L0XB 4C3HH 2UU9Q 3U9SA 1N34Q 1SMXA 4KY5A 1TIID 5C3XA 4K2LA 1JOOA 2B2VA 1HQRD 2EJMA 3D31A 1S5BD 4CKBA 4A3EG 3QR8A 3A0JA 4RCNA 4KN4C 3NWSA 1I6VC 3PF4A 4DR4Q 4IUQA 3K5LA 3E6ZX 1AW7A 1STNA 4CGYB 1PA6A 1F9SA 2FXQA 1VQPA 1H95A 2Z6KA 2E74C 1VQDA 2DY8A 1U0LA 1UE7A 5C0XH 4A3KG 1CKOA 3T1HL 4QUFA 4ALPA 1PTOD 1Y1VG 4NXMQ 4F7XA 1UE5A 1EYGA 5BN5A 2WINB 2Z8LA 2MUYA 1PTOB 2Q2UA 4HIDA 2PPBC 3S2HH 4RKLA 1C9OA 5BR8L 2BOSA 5NUCA 5CC4A 2A19A 3I2ZA 3X3MA 3ZYYX 3Q0AA 1I4PA 3NPPA 3CAMA 3P7JA 3HOUG 5FO7B 4RFBA 2JYOA 3UE0A 2JK8A 4A3MB 4P2CB 3J7A5 2F0EA 3ULPA 1SMYD 5GAHC 4JI7L 1KAWA 2RSOA 5CYUA 2R7ZB 4QUCA 2YV5A 3G6JB 1SFOB 5CR3A 4K8JA 3H0GG 3Q24A 5EKIA 3GDEA 5IGDA 1STEA 4O0AA 4BY7H 2QF7A 3A8JE 4IPDA 4IPGA 4YWLA 2PQEA 3OWFA 5H1SE 2PZUA 4DR2L 1AE2A 1YHQA 1IBML 2R92G 3PUXA 1PH6A 4IJHA 2E2HH 4TKOB 4Q5VA 1K3BC 2B2UC 1ESFA 4YHHL 2G9HD 1KRTA 2EYHA 4QJFA 4HIOA 3KJOA 2CCZA 3MZ5A 4JG2A 1X56A 5CV7A 2J0TD 2GVBA 4YY3L 4A3JB 3K80C 2DJFC 5EPJA 3T56B 4DV2L 3C2PA 4L5RC 4GOPB 3H3VH 1QJOA 1IW7D 1OO9B 2IHFA 3KBXA 4X3UA 5DM63 5IE8A 4F87A 1UAPA 4GKKQ 2EVBA 3CF5A 2JA7G 5IT9c 1KC8C 5FO9B 1C48A 2P5ZX 2A8VA 1YITA 1BF4A 2D9UA 2AQ2B 3PO2G 1S5FD 4JI3L 1A63A 4P71A 3W2DA 5GAGC 1B9NA 1W2BA 1SAPA 2KEEA 1HCZA 2A73B 1XWEA 5M5YH 2M00A 4IALA 4IFDI 2WKCA 4DR3Q 1EQRA 1WI5A 4KMUC 3TSSA 2NN6G 2RHQB 3CPWA 2MGSA 5M5XH 1TWCH 4BY1G 2LXKA 2NN6I 1XX8A 1X55A 1Z7TA 3EJIA 3H94A 2RVLA 1B3AA 2ICEC 4A3CG 2F0KA 5GROA 5AJ3Q 1B4OA 1R4QB 2EZVA 1A2TA 4MZ9A 1S40A 5EQ0A 2JSOA 2E2IH 1VQMA 3J7YW 3D6CA 3OPOA 2F0LA 4BA1I 1F2MA 4IN3A 1JJCB 5M3MH 3K5OA 4DGZA 2Z6BA 3RN5A 1SNMA 3RUZA 2PZWA 1PYWD 4ILWA 1VQNA 4JI2Q 4JI6Q 2WKDA 4XT1B 3M4OB 5I4DA 2F0TA 1WTRA 1TWAH 4F8MA 4HJ9A 4CJ0B 2DNEA 1FGBD 4FF2A 4A93H 1I3QH 3NP8A 3JAMc 1GUWA 4TVAB 1I50B 1QB5D 1V43A 1CM9A 5IYDH 3S1NB 2KEDA 4KTAA 3H09A 1CZWA 4IQZA 4LJZC 4R8NA 2KOLA 2PNHA 2XGTA 1Y8PB 1SEBD 1L1OB 1RKNA 4J15A 1IKLA 4L5TA 5CBAE 3FMCA 3S2HB 3DWAA 4FF3A 2AWOA 3MC0B 1JJ2A 1ET6A 2RHSB 4DV0Q 2IJ0A 4GOPA 4KY7A 1LACA 4DK6C 2NTSA 4G57A 1GUNA 4O1NA 1CA6A 1TWHH 4PV1C 4JI7Q 1Q3LA 2A1AA 1HR0W 1K83B 1A3UA 1Y69U 1NSNS 2J4XA 2N8NA 1M4VA 1WJJA 4DA2A 3U58A 4I7ZC 2WB1E 1WFQA 2IX3A 4POGA 3CXCA 2ZTEA 5IYCG 2JN4A 3PV0A 1TR5A 1EWCA 1YNND 2K14A 2GA4B 4DV1L 1PFBA 2PO4A 4MHEA 1ASZA 2BDNA 4IUUA 1NTGA 5JJKA 4IUTA 2C5CA 3SGIA 3E9IA 4HIMA 3HOZB 3FPPA 1UEAB 1PDQA 4KKUA 1IBKQ 1RIPA 2K4KA 1S5CD 2O4XA 2X6GA 3RR5A 2M2LA 2Y0SG 2JP1A 2WAQG 2JA5H 3F2DA 4R4OA 1BCPB 3PUYA 3VR5A 3BZKA 4DAPA 1UNSA 4B3RQ 1K8MA 2ZXRA 3M4PA 5CV8A 4FXDA 2YTVA 2K5NA 1KHIA 3PCOB 1BBXC 3I4MB 4ULLA 1X3GA 5EBDA 1F2ZA 3S2DH 1QWYA 5C5LA 5I9PA 2E5LQ 4OWTB 2A69C 3GTOH 1MIUA 3M85A 4DV7Q 1WTWA 3WOFA 1I5FA 2PI2A 3J81i 4EQ5A 1L1OA 1TQOA 5KGUA 4HJ5A 1CKNB 4BXXG 1IZ6A 5T1GA 5FJ8H 4BBRB 1GKHA 1J8IA 2IX1A 4A3BH 3HS0C 1N33Q 1Q46A 1K28A 2BH2A 1YEZA 5IP7H 4BY7G 4FF4A 5M5WH 1OXSC 3HOYH 2Q2TA 5M3FG 4X62Q 5ELNA 2J7ZA 1PZID 4CKEA 1Q90A 5JJLA 2F4IA 2WACA 1SBBB 1VQ9A 1SR3A 3J81c 3JC66 3HRZC 4LWCA 3HOXG 3KOJA 1QUQB 1R4PB 2KJXA 3MAQA 1I6HB 1Q81C 3RLOA 2ZM6Q 1VQ7A 4L5QA 1KL9A 4U68A 4FNFA 3FKIB 5D65A 4JV5Q 3H3VI 2TSSA 2HD3A 2N78A 3KF6B 1M1KC 2SDFA 2CW0C 3NEMA 1YBYA 1SYEA 1V9PA 3FVQA 4DUZQ 1JMCA 1VQ6A 4H02A 1T9HA 2LS01 3S15B 1H9KA 3GO5A 1EY9A 3MXNB 3RLFA 4BBSH 2NVYH 3KYHC 3VDYA 4DR5Q 4AYBB 4UY8C 3IAYA 2RKSA 4XIGS 5C6AA 4QIWE 5ISRA 2OXPA 1QE6A 1A15A 2UUCL 1IHZA 2ZXPA 2QILA 3D4RA 2D0OA 3CCMA 3NUCA 3I4NG 1CQFA 1LYLA 1SE2A 1EEFD 2B2WA 3I56A 5D14A 1EY7A 1SJED 4HJ7A 3KJPA 1RCVD 3RZOB 3OW2A 4HSPA 4V0BA 1HUMA 1GJXA 3SK5A 2F3VA 5EPKA 3HOWH 1CKNA 3EBEA 3GTKH 4DV1Q 2K5VA 1G8ZD 5LMNQ 3M7GA 1W3SA 2ICIA 3CC2A 2JA8G 3CD6A 4KHPQ 1AN8A 4JI0L 2EY6A 2F3IA 4Q0FA 1YHBA 1SDFA 3H6MA 3C3LA 1YNJC 4JOIA 1MSHA 1EY5A 2K32A 4X3SA 4A93G 1STYA 4DU9A 1HR0L 4JI8Q 1NJIC 4LFCL 3EFXD 2E76C 1K0RA 4X64L 2G5DA 3T1YL 2GVAA 3KUPA 1K9MC 2JA6B 3OTOL 1QNKA 2VQFL 4XQJA 3K7AH 4QQBX 1NMFA 1QUQA 2K52A 1STBA 2IT1A 1ICFB 1TS4A 1E22A 4HMIA 4WJ3M 2ZTDA 1J6QA 3FPUB 3K0XA 4JI1Q 1EYDA 1U4LA 1DJRD 3KF6A 3TEHB 3KLSX 1PFSA 1PRTD 1BKBA 2EY2A 2AMCB 1HXYD 4CJ2C 4ZYSA 3ONAB 4V190 2BCOA 3HFZB 5C44G 2HQEA 2VW9A 1KXLA 3MXNA 1ASYA 5ELOA 2K5DA 2EY5A 2UXDL 4NW2A 3N52A 4EX5A 2L0CA 1YZ6A 5C4XG 2UXCQ 4O42A 3F8TA 4Z9CB 2ZJRA 3J81j 1FYCA 3HEJA 4NXNL 5GADC 2PYKA 2EQSA 2K5WA 1A8VA 2UUBL 2R93G 3NENA 1LLRD 1VDZA 4C3IB 2AWNA 1RF2D 4LFBQ 1S3OA 1S5ED 3EROA 2K28A 4CHTB 3U4VA 4A3DG 1I4GA 3M3YB 3I8ZA 1WTQA 2VUMG 3DMUA 4A3GB 1CT1D 1JWSD 3PIO3 4ID6A 1GUSA 2JJQA 2ZXOA 1XJVA 4QB4A 3KFUA 1VQ8A 3OMGA 3NBIA 2Q2HA 2K04A 3JAME 2UXBL 1V1QA 4GNXC 2IPKD 1IYJB 4A3MH 1F9QA 3T13A 1S5DD 4B3SL 4X65L 1Z6HA 1XMQL 2R7ZH 1MGSA 2HIXA 1SFOH 1J5EQ 3R2TA 5I2XA 1Y1WB 1LTRD 2RDHA 3KK7A 2BDOA 2EE1A 1VQKA 2FMMA 1GM5A 4LF8Q 1EQVA 1YJ9A 2QA4A 2B63B 3SXHA 1XPOA 3ZJYC 1JE5A 4PZ6A 3HOVH 1K8GA 3CMAA 4Y7NB 4R9WA 2A6HC 5IP7G 3G6EA 1EQTA 2VQEL 2L11A 1L0YB 1XNRL 4KN7C 3FDTA 2ES2A 3URYA 2D2CC 1SYFA 1WVLA 3HOYG 1RL2A 1X3EA 4HN7A 1EY4A 3LGJA 4X66L 1LTLA 4A3JH 3ULLA 4U673 1EZ8A 4G7ZC 1VQCA 4OX9L 1JE4A 3HGBA 3S16H 1BXTA 4CDEC 1EU4A 2B2YA 2B2TC 2L12A 2WB1G 1N9WA 2EYOA 4G7OC 5I2YA 3MXUA 3BVZA 4HEDA 1GO3E 2EYPA 2PW7A 5EGTA 4LFCQ 1E2VA 1LT5D 4A76A 4KV6A 3T1YQ 1EIFA 2H4OA 2CQOA 4DV3L 3AFPA 1PH1A 2WP8J 4A3KB 3S1QB 4QMGA 1FR3A 4A3FG 3G71A 1J9OA 2QEXA 4PNYA 1B7YB 4PG3A 1GHKA 1VQHA 2HQLA 2B2TA 1OTCA 1JWUD 1UE1A 1Q7YC 4MTKA 2O5JC 5K5PA 5FOBB 2H5XA 5JJIA 2V1CC 3BDLA 1VQAA 1C0AA 1NE3A 5KYLA 3HOUB 3VA5A 1MSGA 4KY6A 4L63B 1QNUA 1ZYRC 4XYQA 1CKMA 2XNAC 1BBUA 1BNZA 1HNZL 4DF7A 1CHQD 2XN9C 2ENBA 2HCCA 1G51A 1TWGB 3CQZH 4DAYB 4JI4L 2DJGC 3TS2A 4FYDA 2UUBQ 4DR1Q 3H0GB 4R4IA 3AMUA 5J1ZA 4JBKA 3HOWG 2V4DA 3M4OH 2SNMA 3RLNA 4QCLA 5GQOA 1Q12A 1PHJA 4N8X1 3HZXA 1A6XA 1KDAA 4DAMA 4ZK9B 3D8GA 1K73C 1I50H 3S1NH 1IL8A 1IBLQ 3OOCA 1MD2D 2R92B 4RHRA 4N8FA 1F77A 4DR6L 3STBC 4LF7Q 3J81E 3Q23A 4DV6L 2NBFA 3MTSA 3MHBA 2K1BA 4DPGA 2F0OA 3MFYA 3J7ZC 1PH9A 3SHLA 4LW1A 4WRDA 4LFAQ 2UXBQ 3TDQA 4DR7Q 5KEEA 4YCWA 4PQXA 4B3SQ 4X65Q 1E24A 1ZEQX 1NY4A 2LXJA 4KHZA 3QJYA 2JA7B 4K6DA 4UHVA 1K83H 4IPCA 1O80A 4H0LC 1D2BA 3AFQA 3GTQB 2E2DC 1ML0D 4DUYL 3VYSA 4FXKC 1HZBA 1QCBD 2XVSA 4QF4A 1F2YA 3HOVB 2KQ3A 1KLUD 2N49A 1YVCA 4UDUC 1XNRQ 3CMEA 3DWPA 2CH4A 3HOZH 4A3IG 2FMCA 4MN3A 3A8IE 1CQVA 3KDFB 1HTLD 4AYBE 4CJ1B 2HHHQ 5IT9L 4X3TA 2OEOA 3E9HA 3TP7A 2VY3A 1EY6A 3RZDB 3S16B 4A3LG 1CHPD 4DKAC 1O7YA 5M9OA 3SEBA 2Q8RE 4DAYA 3DHQA 3G48A 3R2IA 1TXYA 1C7YA 3I4MH 1MI2A 4CDCC 4CKCA 4B3MQ 1HNXL 3AQQA 2B2UA 1OXXK 5D3IB 4C3JG 4K5VA 1SSOA 1ZKOA 5A35A 2RDGA 1TVXA 4TRDA 1PTOC 2KHJA 2K50A 5I6YA 1DGSA 4JBMA 3J80c 1ENCA 1Q1EA 5JJZA 4BBRH 2PZTA 3UDIA 1X6OA 4OO1H 4C3IG 1A3TA 1EFWA 4ZRZA 3JAMi 3A7LA 1GUTA 1YHAA 2RBMA 2A68D 4LF4L 1I94L 2MNAA 2ZJQA 3BDCA 3GD7A 1SMYC 2F0QA 2B3GA 3A54A 3PO3H 4DNIA 1XTCD 4IZ8A 5FO8B 2EDGA 1SNPA 3KLWA 1SNOA 2A6ED 3JAML 1ONLA 3CQZB 3NTHA 4POFA 2JEBI 3V2TA 1XYIA 3PUWA 2F0GA 2F0NA 4XQNA 3IKJA 1SE8A 2OTLA 1WTPA 1I6HH 3F2BA 2L15A 4KJOA 2YU9B 1SNCA 1SNDA 5E4XA 2Q2IA 2BA1A 3FKIH 3T1HQ 4F88A 1EFID 1QVGA 4LUVA 2X69A 4ME5A 5JOBA 2I5MX 5ELDA 3U4ZA 3O13A 3D4WA 5LL6S 3OWEB 2F4VL 3HKZG 4LF5L 4RMFA 3KDFA 3QB3A 5BR8Q 3S15H 1KTKA 3CRLC 4AQYL 4LK1C 1Q8KA 1TS2A 3NE5B 3A55A 3I55A 1ENFA 2B8FA 2Y0SB 4ABNA 2WAQB 5IP9G 1B1ZA 1LABA 2SNSA 4JYAL 1PH5A 4OWXB 5ELCA 3PIP3 3RN2A 1X3QA 4C3HG 1EEID 1Y8OB 2EYJA 4APVA 3PQIA 2OQ0A 1RODA 4S3SA 1E0BA 3TP5A 3WDNA 3NBHA 3RZOH 4QL5A 1FNVA 4ME3A 3GTJB 1LTTD 1A0IA 1HTPA 1KDBA 1JOQA 4DR2Q 2OWOA 1EL0A 3S14H 3J7AF 2MP1A 2D62A 1TWFB 1JJGA 2LMCB 1K3RA 1IBMQ 4UPAA 5C3WA 3NK9A 3VR6A 5IGBA 2PCFB 2JQOA 3BS1A 4LF9L 3BVMA 4WJWA 4DK0A 3Q22A 4DXFA 4YHHQ 5ELBA 1LTBD 3TRZA 2EYMA 1BVSA 1NR4A 3I4LA 3FHWA 2MO0A 1BCPD 2AQ3B 4YY3Q 2NVXB 3I7FA 1JB7A 4DV2Q 1PYSB 1II3A 1HA6A 3C1EA 5C0XG 2K5QA 5HGTA 5M3FB 2AUJD 5C0XI 3A5ZB 4QGUA 1N36L 1LV9A 3LWEA 2JA6H 4RGTA 4YCUA 1HNXQ 3PGZA 1PLFA 2R7FA 2HIVA 3A7AB 3K57A 3MFGA 4H13C 4JI3Q 1DD2A 2DY7A 3HOXB 2JXMB 3L7ZC 3X3NA 4FF1A 1PXUA 2EXDA 3S24A 1ILPA 3R93A 3BZCA 5EJWA 2O2LD 3RD4A 5LHY1 2F0HA 1MBYA 1CFMA 2I5LX 1WCMB 4JVZA 1MKHA 5JVG3 1X32A 1WD1A 5TSSA 3TP6A 2B8GA 1SROA 1AE3A 4R4QA 2F03A 3GV6A 4RGNA 5ELEA 1JQYD 3G7LA 4MTNA 2C35B 3GTMB 1I94Q 2ID0A 2QKIC 3KF8B 5EKKA 3MEHA 4JW0A 3J81L 4LUOA 5E7NA 2CFMA 4GLXA 4IUNA 5IYBH 4C3IH 1YJNA 3PO3B 2D5DA 2VS1A 3I4NB 3HKSA 1B44D 1FJGL 4GKJL 1H9MA 4K2KA 3F2UA 1XPRA 1EZ6A 3M3YH 4K5WA 2FJ2A 3BYTB 3S1RB 4MNOA 4A3GH 5D3DA 4DV5L 3PMFA 2PQAB 5FLMH 2NVTB 4BA2I 1VMPA 4RGMA 2NVQB 4YIJA 4JI5L 3GTLB 4HTHA 4YWKA 1O7IA 5LMUL 4A75A 1AP0A 4DXGA 2JA8B 1SRUA 1PH8A 5IWAL 3I4MG 3H3VC 2RQXA 2OQKA 1VQFA 3LNNA 4O2DA 3TZUA 4DFAA 1XMOL 3I91A 5IOCA 1Y1WH 2CWPA 2VXWA 3OHXC 4P72A 5J39A 1CA5A 5FKAC 1PH7A 3Q6SA 4PMCA 1PMRA 3CCLA 1B70B 3M4QA 2B63H 3EA6A 4HR7B 4RH6A 4P73A 3K7UC 3LX0A 4EQNA 4Y7NH 3CCJA 2PNRC 1MJEA 5C0XJ 1KQSA 1JICA 1UEBA 3NSWA 5DAUA 5KNDA 1NNXA 5C4JB 1KDCA 4ZLTF 1G6ZA 5J3BA 1HQMC 3I90A 2F52A 5E3FA 3VR4A 3S14B 5EPLA 1EWIA 5M3MG 5C44B 4GLAC 5JEAH 3VYUA 4C1NI 5C4XB 3L9AX 2UUAL 2E2JB 3KF8A 1BO0A 2F0FA 2VB2X 3UI2A 2VB3X 3FKIG 5IIFA 2LY7A 2HDLA 5IYDG 3F1ZA 5C3EB 2CH4W 2FHTA 4LF6L 1RDPD 1E1OA 4A3KH 3S1QH 3FRPB 5T1IA 3N6RA 1OXVA 3FEWX 3E3XA 1JORA 4KKTA 4A3DB 2LFNA 2PQAA 1NBWA 2VUMB 4NB3A 2EJFC 2F0SA 4GNXB 1LT3D 2F0VA 5FLXc 1KD1C 2BE5D 1BUVT 1X3PA 3K6OA 3OMCA 4LMQD 3PF5A 1AZPA 3TP8A 4GLVB 2Z4IA 1SN8A 4K6LA 3HOUH 1EOVA 1JWMD 1O7ZA 3MA2B 1PVOA 5CBEE 2AHOB 5BN4A 2HDMA 3C1FA 3ULJA 3J80E 1SNQA 1WTVA 1QVCA 3MVVA 1QG7A 4LUZA 2UU9L 2XSCA 2N3SA 4PMBA 1TWGH 3DUZA 3H0GH 5G3LD 1ESRA 2K33A 3S1MB 3SDZA 4N9TA 4PMWA 2L1BA 4R4CA 1GD7A 1VQBA 4J8QA 4GKJQ 1VQGA 2IX0A 3SK8A 5IGEA 4DR4L 2R92H 4A4IA 1X65A 1TY0A 4JK1C 1JC7A 1E2WA 2F1MA 5DEHA 2JA5G 2Z0SA 4DK3C 1R9TB 4L8JA 2CVRA 3ND8A 1PH3A 3W3AA 4QY7A 4RHSA 1IKMA 2KENA 1OXTA 4ZUIA 5CGKA 4GZYC 1JCKB 1Y8NB 1U5KA 2DN8A 3A56A 4HMJA 5HY6A 3K58A 2L4NA 1PRTF 4NXML 1PFMA 3AB9A 1HPCA 1AFPA 2EOTA 1BOSA 2JA7H 3DEOA 2RCNA 3CKIB 5EAYA 2NZ1D 3GTQH 3GTPH 3K0YA 2UUCQ 1CI3M 1AZQA 4ZKCB 1X3FA 4IPHA 1QOHA 3GP7A 1HZAA 1A3VA 3VR3A 2MFIA 2C9OA 4R1JA 3PIPA 1YJWA 4IFDH 4P75A 5FJ8G 3CC4A 4A3FB 1DOKA 3PUVA 1B53A 2A5HA 1E7ZA 3R8BA 4GNXA 5IODA 3IFDA 4A3BG 4LAAA 5HGQA 1D7QA 1DZ1A 5A2QE 5DNFA 2H1EA 2NN6H 1SLJA 3TQYA 2PI2E 2YTYA 1PRTC 1B50A 1RD9D 2K7VA 4Y52H 4A3CH 5IYBG 3A8KE 4BS9A
chains in the Genus database with same CATH topology
4OELB 1ICFB 4CDEC 2DJFC 1MHWC 4CDFC 2DJGC 4CDDC 4OEMB 4CDCC 1K3BC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OEL B;  1ICF B;  4CDE C;  2DJF C;  1MHW C;  4CDF C;  2DJG C;  4CDD C;  4OEM B;  4CDC C;  1K3B C; 
#chains in the Genus database with same CATH topology
 4R8I A;  2Y0S E;  3S17 B;  4A3E B;  2IL8 A;  2WAQ E;  4K5X A;  4JI0 Q;  1VQ4 A;  4X3K A;  3HP3 A;  3QOJ A;  5F2D A;  3G4S A;  3RZD H;  2F3W A;  3DEP A;  4UP8 A;  3ER0 A;  2ZJP A;  2CHB D;  1VQJ A;  4KKS A;  4I7A A;  5E1F A;  3SVM A;  1HR0 Q;  2QDB A;  2DUD A;  2QW7 A;  4X64 Q;  3DXJ C;  4PZ8 A;  3D0F A;  3OIQ A;  3OTO Q;  2N88 A;  1DOL A;  1IYU A;  4K14 A;  2VQF Q;  1TKW B;  4HSV A;  2M9V A;  3ND9 A;  1Y1V B;  3NTI A;  1TS5 A;  2NYZ D;  4BBS G;  3E5S A;  4XDX A;  4GKK L;  3T16 A;  2QDL A;  4K0K L;  1Y1W G;  2B2V C;  3CCE A;  4GN4 B;  3I72 A;  2K05 A;  1FL0 A;  1GUG A;  4TSS A;  4N9P A;  2KCT A;  5J22 A;  1U9R A;  1STG A;  2K5H A;  2UXD Q;  4P74 A;  4RCO A;  1HFN A;  4OEM B;  1SYB A;  1EU3 A;  1VQO A;  2ATW A;  4DR3 L;  4ZUJ A;  2CWA A;  4NXN Q;  2Z6K C;  2YTX A;  1EOT A;  3TRE A;  1L0W A;  1DCZ A;  1RTN A;  1V1O A;  1KLG D;  2R6G A;  4JBJ A;  1SYC A;  2F0I A;  1XNQ L;  2YU9 H;  2RF4 A;  3I4O A;  3A74 A;  5IYC H;  5AJ3 L;  1B8A A;  4DN4 M;  1C8C A;  3AYH B;  1WTH A;  2ZT9 C;  5JEA G;  3VA7 A;  1D5Z C;  3K81 C;  1T5X D;  4JC0 A;  5E4W C;  3QG1 A;  5I9O A;  2HUG A;  2QEJ C;  2K01 A;  4QIW B;  3VR2 A;  4A3I B;  2KUM A;  2B29 A;  3UE1 A;  1LTG D;  4JI2 L;  4JI6 L;  3BDO A;  2NTT A;  3H91 A;  1KRS A;  4XXE A;  1EUJ A;  1H9S B;  3IL8 A;  1F2L A;  2F0W A;  2OF1 A;  2VZA A;  1HFG A;  1XMQ Q;  3ITP A;  5IGF A;  3CU7 A;  1VQ5 A;  3V96 A;  4M1U B;  3U9O A;  5JPN C;  2KHS A;  4XT3 B;  5BN3 A;  2LKV A;  4NDX A;  5LMN W;  5AFW A;  2SEB D;  3GTP B;  3I3C A;  3PO2 B;  4C3J B;  2F0D A;  4DV0 L;  1YI2 A;  3GTJ H;  4EQO A;  3E0J A;  4C56 C;  3QOL A;  3M9B A;  4B3T L;  1TWF H;  1ET9 A;  3HG9 A;  1S4Z A;  1B3Q A;  4C2M H;  4FDB A;  2RDF A;  3SR1 A;  2BH8 A;  1Q82 C;  4L5S A;  4BXX H;  2VQE Q;  4UP9 A;  4CBV A;  3CRK C;  2R7D A;  3UDX A;  4X66 Q;  3F2C A;  4BY1 B;  2NVX H;  2EJG C;  3NEL A;  3QIA A;  5CMD A;  4KK7 A;  4OX9 Q;  3L0O A;  1DON A;  3CW2 C;  1PTO F;  1PV4 A;  3J80 i;  5M3F H;  4OIJ A;  4RAU C;  2KVM A;  2I5H A;  4G7H C;  3AEV A;  3Q8D A;  4BWG B;  1OXU A;  1GXD C;  1DYQ A;  5K36 H;  3E0E A;  2A74 C;  3KLS A;  4J6H A;  2HT1 A;  1O78 A;  2Q8T A;  1EY8 A;  4HAE A;  3CCS A;  1IBK L;  3HOX H;  1JR0 D;  1VQL A;  4DV3 Q;  3J80 L;  4JPB W;  2KHI A;  4XYO A;  3EN2 A;  3NBH B;  2AUK A;  1FNW A;  4A3M G;  4B3R L;  1I4X A;  2F0M A;  2O5I C;  1CK1 A;  5GAE C;  1QIL A;  1WCM H;  3L3O C;  1C4Q A;  4GS3 A;  1EQQ A;  2R7Z G;  4UAI A;  4WJ4 A;  3DM1 A;  3HKZ B;  4K0K Q;  2CKZ B;  1UWV A;  2K03 A;  2PMZ B;  5FK9 C;  2RCF A;  1H9S A;  1KAA A;  3P75 A;  3NWT A;  3PUZ A;  5FLX E;  3W1B A;  3NHH A;  3GTM H;  5JEA J;  1Q1B A;  2E5L L;  4IFD G;  2F0J A;  4DV7 L;  3HOV G;  1HNZ Q;  4C3H B;  1W6K A;  2KEC A;  3I4N H;  2MHV A;  4GN5 A;  4CDD C;  4JI4 Q;  5KIX A;  2NWG A;  3S1R H;  5I6W A;  1N33 L;  1JOK A;  2IHE A;  1XNQ Q;  4A3J G;  5K36 G;  2NVT H;  2K6A A;  1MHW C;  2NVQ H;  1VS0 A;  3GTG H;  3PSI A;  4YCV A;  2R61 A;  3GTL H;  3EQL C;  4X62 L;  1LTI D;  2JA8 H;  4DR6 Q;  1PZK D;  1NR2 A;  1E2Z A;  3TZD A;  4DV6 Q;  1BDO A;  5JAV A;  2VL6 A;  4GOP C;  4KLK A;  3PIO A;  2JA9 A;  2NZO A;  2WII B;  3K5N A;  4FO2 A;  5IGG A;  5A2Q L;  2A69 D;  2ZM6 L;  1IW7 C;  4GN3 B;  4K8I A;  1YIJ A;  2KBN A;  3CC7 A;  4JV5 L;  3DM3 A;  4G4K A;  4HIK A;  1EWH A;  3FP9 A;  5IY0 A;  4NKL A;  3CHB D;  4DUZ L;  4YWM A;  3SK4 A;  1U4M A;  2JE6 I;  2I46 A;  5JPM C;  1WTX A;  1SYD A;  1W6J A;  3A5U A;  4DUY Q;  5C4J H;  2AQ1 B;  4OHJ A;  5C5M A;  4DR5 L;  2FFK B;  1K0S A;  3MWY W;  4B3T Q;  2QCP X;  4NMZ A;  4C2M B;  1UUP A;  1EIG A;  1FGU A;  1I4H A;  1LO5 D;  5C44 H;  1K8O A;  3OIP A;  5KNC A;  4DK1 A;  2YYZ A;  1HZC A;  3LWU A;  3TN2 A;  2DNC A;  1GVP A;  4DNT B;  5C4X H;  4XQQ A;  2E2J H;  4IOC A;  3WOE A;  4UP7 A;  3CP0 A;  1I4R A;  2A68 C;  3VYR A;  1E3P A;  1STH A;  1F9R A;  4BY7 B;  2ZTC A;  3BYY B;  1LTS D;  2EY1 A;  4H7B A;  4ODG A;  2R93 H;  3EIV A;  5C3E H;  4IJL A;  1M90 C;  4OIK A;  1XXG A;  5LMN L;  4XTC S;  2CW0 D;  2E2H B;  1HUN A;  4KHP L;  1SXT A;  2A6E C;  4RKB A;  4OWW B;  3KBG A;  4A3D H;  1IXR A;  2OT2 A;  3BZD B;  1Q86 C;  2VUM H;  1LUZ A;  4IFD J;  2B39 A;  1HHV A;  3UDF A;  1QVF A;  5KNB A;  4OEL B;  3GQB A;  5HUR A;  4JI8 L;  5EBC A;  2BA0 A;  1DM0 B;  1L1O C;  4DV4 L;  4FVM A;  2I07 B;  2MQH A;  4HCE A;  4AIM A;  4B9W A;  4X6A H;  1ENA A;  1HZ9 A;  4DNR B;  2I0Q A;  2EXZ A;  3R3O A;  1H9J A;  1M8A A;  1Q8I A;  2SOB A;  1D8L A;  4MIU A;  2R3Z A;  5COY A;  1EYA A;  3EVQ A;  3MXP A;  1GUO A;  4JI1 L;  4CDF C;  4LF4 Q;  4M8A A;  4OL7 A;  1CZG A;  2NB0 A;  2EIF A;  2XWJ B;  3S1M H;  5M5Y B;  3U50 C;  1ZXT A;  2IY5 B;  2MPM A;  4L6T B;  1FVI A;  1BR9 A;  1BCP F;  3ICE A;  1TT2 A;  5M5X B;  1TWC B;  3HOZ G;  2F0P A;  4HCS A;  1N8R C;  4ZKB B;  4ZQ3 A;  1P8L A;  2UXC L;  2MJ8 A;  1YNJ D;  1TS3 A;  5ELF A;  3UDG A;  3L2P A;  5DLQ E;  1HNW L;  1R9T H;  1O7L A;  4PZ7 A;  3GTG B;  3CCQ A;  1U4R A;  2E2I B;  1CTM A;  1YNN C;  1G2S A;  1Z9F A;  1STA A;  5M3M B;  4LFB L;  2EPB A;  2L5T A;  2Q8I B;  3K59 A;  1HA5 A;  1RHP A;  2F4V Q;  4LF5 Q;  1N32 L;  2VNU D;  1CSQ A;  1D1K A;  3M4Y A;  4AQY Q;  2D0P A;  1XPU A;  1B9M A;  1BCP C;  1LT4 D;  1P16 A;  4WFN 3;  1G29 1;  5KRU A;  1TWA B;  4JYA Q;  1D6E C;  3SE0 A;  4A93 B;  5CV4 A;  1I3Q B;  1GOZ A;  3V05 A;  3BG3 A;  1SYG A;  1WTO A;  4JCV E;  4FXG C;  1YNX A;  1L2F A;  2RSN A;  1WCM G;  5C4Z A;  3I70 A;  1NUC A;  4A3F H;  4BBR G;  3MEF A;  2B2W C;  1MJC A;  1VF7 A;  3WWV A;  4OO1 G;  1XTD A;  1NMG A;  4B9X A;  1KNE A;  2Z1C A;  4OO1 I;  4J1M A;  4EGV A;  1K8A C;  4E6I A;  4I65 A;  2ALY B;  1J5E L;  1D5X C;  2XRS D;  4EVO A;  2XIW A;  1G91 A;  1CSP A;  3SK6 A;  1ICW A;  3T51 B;  4OXP A;  1TWH B;  2FIN B;  3PO3 G;  2EYF A;  3S17 H;  4LF9 Q;  1A2U A;  2EYL A;  4A3E H;  4LF8 L;  1DXM A;  3IRB A;  4LNQ A;  1AEX A;  4KD3 A;  4JOI C;  1HRJ A;  1LTA D;  1X9N A;  4DAV A;  3AU7 A;  3CCU A;  3MXG A;  2IW3 A;  1VMC A;  1X54 A;  1NCV A;  4IO9 A;  2WV6 D;  1WD0 A;  2XWB B;  2KCC A;  1N36 Q;  2R93 B;  1E1T A;  2KA7 A;  2RA4 A;  5EKL A;  2JEA I;  5FLX L;  4OON A;  2G9D A;  1BBW A;  1Y1V H;  3NTK A;  1V1P B;  1WOC A;  4AYB G;  2Z4H A;  2JA5 B;  4HJA A;  4DV4 Q;  1EIH A;  5LL6 X;  1A62 A;  3RMH A;  1IL2 A;  3TS0 A;  2OTJ A;  2GN5 A;  3VYT A;  2XRQ D;  1H9R A;  4FP5 D;  3OW7 A;  5L37 A;  4C1N K;  2KCM A;  2IWH A;  2XTI A;  2L55 A;  3T53 B;  1VQE A;  1PH2 A;  3TME A;  3S2D B;  4RWS C;  1FD7 D;  4KI0 A;  1KIX A;  2A6H D;  5IT9 E;  3K5M A;  3DLL A;  3BU2 A;  1Y14 B;  3BVG A;  3ERS X;  1N34 L;  3GTO B;  4KHV A;  4TQU S;  2WFW A;  3T4A C;  4IUP A;  2AKW B;  1B2T A;  1D5M C;  3CCR A;  1GHJ A;  4R4T A;  1PRT B;  1G2T A;  1FJG Q;  1ILQ A;  2OCE A;  1HH2 P;  1PFN A;  3J7A V;  1RTO A;  1UE6 A;  4A3B B;  5DM7 3;  3I73 A;  3W1G A;  4DV5 Q;  3DWQ A;  5C4H A;  1HNW Q;  4ZCK A;  1FNU A;  5M5W B;  1T5E A;  3HKZ E;  1JB3 A;  4A3I H;  2NZH A;  5IGC A;  2PMZ E;  4ZAI A;  1U4P A;  4JI5 Q;  3HOY B;  4DR1 L;  1VCI A;  5C3E G;  5LMU Q;  1VF5 C;  1G6P A;  1V8Q A;  2JA6 G;  1KNA A;  2E75 C;  4KJN A;  3H15 A;  5IWA Q;  1N32 Q;  2Z9H A;  4A3L H;  3S9W A;  4IOA A;  1IBL L;  1WYD A;  2E8G A;  3M7N A;  3CCV A;  2WB1 B;  4AH6 A;  3RNU A;  1XMO Q;  2N55 A;  5CV9 A;  1PTO H;  1SE4 A;  4LF7 L;  5CV6 A;  4WOR A;  2CQA A;  3PO2 H;  4C3J H;  4JBW A;  3OYY A;  4OGQ C;  1I4Q A;  1BQQ T;  3P20 A;  4LFA L;  2K75 A;  1QZH A;  1SE3 A;  4DR7 L;  4RGO S;  1V1P A;  1EYC A;  2X6L A;  1VQI A;  1ZYR D;  1PH4 A;  1F9P A;  5G3L F;  4BBS B;  2NVY B;  3K8A A;  2BE5 C;  3ERQ A;  1LT6 D;  3QWN A;  3IFT A;  1S72 A;  2L9H A;  2F0U A;  4BY1 H;  1DOM A;  3KLR A;  3CPF A;  2QGQ A;  3TBI B;  1RJT A;  2TMP A;  1HJP A;  1NAP A;  3OSO A;  2B2Y C;  3NXW A;  3GV3 A;  4IUR A;  2UUA Q;  4HJ8 A;  1TU2 B;  2DGY A;  4NPS A;  1EY0 A;  1KAB A;  4NP5 A;  4A3G G;  4H44 C;  3STB D;  5FLM G;  1JT8 A;  2ASB A;  1LM0 A;  3NQI A;  1TY2 A;  3B6Y A;  3HOW B;  2NUC A;  3D3R A;  4LF6 Q;  2HCI A;  4KD4 A;  3GTK B;  1IYV A;  3D4D A;  2MO1 A;  1D1I A;  3C46 A;  3W5O A;  2HHH L;  1Z47 A;  1PZJ D;  4RG1 A;  2KCN A;  1CUK A;  1QZG A;  1SJH D;  4IUV A;  4B3M L;  3QO2 A;  5CV5 A;  2LSS A;  5COR A;  3P1H A;  3D6W A;  3NQT A;  4B08 A;  4EQP A;  5IP9 H;  5KYI A;  1AH9 A;  2B63 G;  1PYB A;  2PW5 A;  1EIY B;  3BJU A;  4RA8 A;  3K7A B;  5JVH 3;  1L0X B;  4C3H H;  2UU9 Q;  3U9S A;  1N34 Q;  1SMX A;  4KY5 A;  1TII D;  5C3X A;  4K2L A;  1JOO A;  2B2V A;  1HQR D;  2EJM A;  3D31 A;  1S5B D;  4CKB A;  4A3E G;  3QR8 A;  3A0J A;  4RCN A;  4KN4 C;  3NWS A;  1I6V C;  3PF4 A;  4DR4 Q;  4IUQ A;  3K5L A;  3E6Z X;  1AW7 A;  1STN A;  4CGY B;  1PA6 A;  1F9S A;  2FXQ A;  1VQP A;  1H95 A;  2Z6K A;  2E74 C;  1VQD A;  2DY8 A;  1U0L A;  1UE7 A;  5C0X H;  4A3K G;  1CKO A;  3T1H L;  4QUF A;  4ALP A;  1PTO D;  1Y1V G;  4NXM Q;  4F7X A;  1UE5 A;  1EYG A;  5BN5 A;  2WIN B;  2Z8L A;  2MUY A;  1PTO B;  2Q2U A;  4HID A;  2PPB C;  3S2H H;  4RKL A;  1C9O A;  5BR8 L;  2BOS A;  5NUC A;  5CC4 A;  2A19 A;  3I2Z A;  3X3M A;  3ZYY X;  3Q0A A;  1I4P A;  3NPP A;  3CAM A;  3P7J A;  3HOU G;  5FO7 B;  4RFB A;  2JYO A;  3UE0 A;  2JK8 A;  4A3M B;  4P2C B;  3J7A 5;  2F0E A;  3ULP A;  1SMY D;  5GAH C;  4JI7 L;  1KAW A;  2RSO A;  5CYU A;  2R7Z B;  4QUC A;  2YV5 A;  3G6J B;  1SFO B;  5CR3 A;  4K8J A;  3H0G G;  3Q24 A;  5EKI A;  3GDE A;  5IGD A;  1STE A;  4O0A A;  4BY7 H;  2QF7 A;  3A8J E;  4IPD A;  4IPG A;  4YWL A;  2PQE A;  3OWF A;  5H1S E;  2PZU A;  4DR2 L;  1AE2 A;  1YHQ A;  1IBM L;  2R92 G;  3PUX A;  1PH6 A;  4IJH A;  2E2H H;  4TKO B;  4Q5V A;  1K3B C;  2B2U C;  1ESF A;  4YHH L;  2G9H D;  1KRT A;  2EYH A;  4QJF A;  4HIO A;  3KJO A;  2CCZ A;  3MZ5 A;  4JG2 A;  1X56 A;  5CV7 A;  2J0T D;  2GVB A;  4YY3 L;  4A3J B;  3K80 C;  2DJF C;  5EPJ A;  3T56 B;  4DV2 L;  3C2P A;  4L5R C;  4GOP B;  3H3V H;  1QJO A;  1IW7 D;  1OO9 B;  2IHF A;  3KBX A;  4X3U A;  5DM6 3;  5IE8 A;  4F87 A;  1UAP A;  4GKK Q;  2EVB A;  3CF5 A;  2JA7 G;  5IT9 c;  1KC8 C;  5FO9 B;  1C48 A;  2P5Z X;  2A8V A;  1YIT A;  1BF4 A;  2D9U A;  2AQ2 B;  3PO2 G;  1S5F D;  4JI3 L;  1A63 A;  4P71 A;  3W2D A;  5GAG C;  1B9N A;  1W2B A;  1SAP A;  2KEE A;  1HCZ A;  2A73 B;  1XWE A;  5M5Y H;  2M00 A;  4IAL A;  4IFD I;  2WKC A;  4DR3 Q;  1EQR A;  1WI5 A;  4KMU C;  3TSS A;  2NN6 G;  2RHQ B;  3CPW A;  2MGS A;  5M5X H;  1TWC H;  4BY1 G;  2LXK A;  2NN6 I;  1XX8 A;  1X55 A;  1Z7T A;  3EJI A;  3H94 A;  2RVL A;  1B3A A;  2ICE C;  4A3C G;  2F0K A;  5GRO A;  5AJ3 Q;  1B4O A;  1R4Q B;  2EZV A;  1A2T A;  4MZ9 A;  1S40 A;  5EQ0 A;  2JSO A;  2E2I H;  1VQM A;  3J7Y W;  3D6C A;  3OPO A;  2F0L A;  4BA1 I;  1F2M A;  4IN3 A;  1JJC B;  5M3M H;  3K5O A;  4DGZ A;  2Z6B A;  3RN5 A;  1SNM A;  3RUZ A;  2PZW A;  1PYW D;  4ILW A;  1VQN A;  4JI2 Q;  4JI6 Q;  2WKD A;  4XT1 B;  3M4O B;  5I4D A;  2F0T A;  1WTR A;  1TWA H;  4F8M A;  4HJ9 A;  4CJ0 B;  2DNE A;  1FGB D;  4FF2 A;  4A93 H;  1I3Q H;  3NP8 A;  3JAM c;  1GUW A;  4TVA B;  1I50 B;  1QB5 D;  1V43 A;  1CM9 A;  5IYD H;  3S1N B;  2KED A;  4KTA A;  3H09 A;  1CZW A;  4IQZ A;  4LJZ C;  4R8N A;  2KOL A;  2PNH A;  2XGT A;  1Y8P B;  1SEB D;  1L1O B;  1RKN A;  4J15 A;  1IKL A;  4L5T A;  5CBA E;  3FMC A;  3S2H B;  3DWA A;  4FF3 A;  2AWO A;  3MC0 B;  1JJ2 A;  1ET6 A;  2RHS B;  4DV0 Q;  2IJ0 A;  4GOP A;  4KY7 A;  1LAC A;  4DK6 C;  2NTS A;  4G57 A;  1GUN A;  4O1N A;  1CA6 A;  1TWH H;  4PV1 C;  4JI7 Q;  1Q3L A;  2A1A A;  1HR0 W;  1K83 B;  1A3U A;  1Y69 U;  1NSN S;  2J4X A;  2N8N A;  1M4V A;  1WJJ A;  4DA2 A;  3U58 A;  4I7Z C;  2WB1 E;  1WFQ A;  2IX3 A;  4POG A;  3CXC A;  2ZTE A;  5IYC G;  2JN4 A;  3PV0 A;  1TR5 A;  1EWC A;  1YNN D;  2K14 A;  2GA4 B;  4DV1 L;  1PFB A;  2PO4 A;  4MHE A;  1ASZ A;  2BDN A;  4IUU A;  1NTG A;  5JJK A;  4IUT A;  2C5C A;  3SGI A;  3E9I A;  4HIM A;  3HOZ B;  3FPP A;  1UEA B;  1PDQ A;  4KKU A;  1IBK Q;  1RIP A;  2K4K A;  1S5C D;  2O4X A;  2X6G A;  3RR5 A;  2M2L A;  2Y0S G;  2JP1 A;  2WAQ G;  2JA5 H;  3F2D A;  4R4O A;  1BCP B;  3PUY A;  3VR5 A;  3BZK A;  4DAP A;  1UNS A;  4B3R Q;  1K8M A;  2ZXR A;  3M4P A;  5CV8 A;  4FXD A;  2YTV A;  2K5N A;  1KHI A;  3PCO B;  1BBX C;  3I4M B;  4ULL A;  1X3G A;  5EBD A;  1F2Z A;  3S2D H;  1QWY A;  5C5L A;  5I9P A;  2E5L Q;  4OWT B;  2A69 C;  3GTO H;  1MIU A;  3M85 A;  4DV7 Q;  1WTW A;  3WOF A;  1I5F A;  2PI2 A;  3J81 i;  4EQ5 A;  1L1O A;  1TQO A;  5KGU A;  4HJ5 A;  1CKN B;  4BXX G;  1IZ6 A;  5T1G A;  5FJ8 H;  4BBR B;  1GKH A;  1J8I A;  2IX1 A;  4A3B H;  3HS0 C;  1N33 Q;  1Q46 A;  1K28 A;  2BH2 A;  1YEZ A;  5IP7 H;  4BY7 G;  4FF4 A;  5M5W H;  1OXS C;  3HOY H;  2Q2T A;  5M3F G;  4X62 Q;  5ELN A;  2J7Z A;  1PZI D;  4CKE A;  1Q90 A;  5JJL A;  2F4I A;  2WAC A;  1SBB B;  1VQ9 A;  1SR3 A;  3J81 c;  3JC6 6;  3HRZ C;  4LWC A;  3HOX G;  3KOJ A;  1QUQ B;  1R4P B;  2KJX A;  3MAQ A;  1I6H B;  1Q81 C;  3RLO A;  2ZM6 Q;  1VQ7 A;  4L5Q A;  1KL9 A;  4U68 A;  4FNF A;  3FKI B;  5D65 A;  4JV5 Q;  3H3V I;  2TSS A;  2HD3 A;  2N78 A;  3KF6 B;  1M1K C;  2SDF A;  2CW0 C;  3NEM A;  1YBY A;  1SYE A;  1V9P A;  3FVQ A;  4DUZ Q;  1JMC A;  1VQ6 A;  4H02 A;  1T9H A;  2LS0 1;  3S15 B;  1H9K A;  3GO5 A;  1EY9 A;  3MXN B;  3RLF A;  4BBS H;  2NVY H;  3KYH C;  3VDY A;  4DR5 Q;  4AYB B;  4UY8 C;  3IAY A;  2RKS A;  4XIG S;  5C6A A;  4QIW E;  5ISR A;  2OXP A;  1QE6 A;  1A15 A;  2UUC L;  1IHZ A;  2ZXP A;  2QIL A;  3D4R A;  2D0O A;  3CCM A;  3NUC A;  3I4N G;  1CQF A;  1LYL A;  1SE2 A;  1EEF D;  2B2W A;  3I56 A;  5D14 A;  1EY7 A;  1SJE D;  4HJ7 A;  3KJP A;  1RCV D;  3RZO B;  3OW2 A;  4HSP A;  4V0B A;  1HUM A;  1GJX A;  3SK5 A;  2F3V A;  5EPK A;  3HOW H;  1CKN A;  3EBE A;  3GTK H;  4DV1 Q;  2K5V A;  1G8Z D;  5LMN Q;  3M7G A;  1W3S A;  2ICI A;  3CC2 A;  2JA8 G;  3CD6 A;  4KHP Q;  1AN8 A;  4JI0 L;  2EY6 A;  2F3I A;  4Q0F A;  1YHB A;  1SDF A;  3H6M A;  3C3L A;  1YNJ C;  4JOI A;  1MSH A;  1EY5 A;  2K32 A;  4X3S A;  4A93 G;  1STY A;  4DU9 A;  1HR0 L;  4JI8 Q;  1NJI C;  4LFC L;  3EFX D;  2E76 C;  1K0R A;  4X64 L;  2G5D A;  3T1Y L;  2GVA A;  3KUP A;  1K9M C;  2JA6 B;  3OTO L;  1QNK A;  2VQF L;  4XQJ A;  3K7A H;  4QQB X;  1NMF A;  1QUQ A;  2K52 A;  1STB A;  2IT1 A;  1ICF B;  1TS4 A;  1E22 A;  4HMI A;  4WJ3 M;  2ZTD A;  1J6Q A;  3FPU B;  3K0X A;  4JI1 Q;  1EYD A;  1U4L A;  1DJR D;  3KF6 A;  3TEH B;  3KLS X;  1PFS A;  1PRT D;  1BKB A;  2EY2 A;  2AMC B;  1HXY D;  4CJ2 C;  4ZYS A;  3ONA B;  4V19 0;  2BCO A;  3HFZ B;  5C44 G;  2HQE A;  2VW9 A;  1KXL A;  3MXN A;  1ASY A;  5ELO A;  2K5D A;  2EY5 A;  2UXD L;  4NW2 A;  3N52 A;  4EX5 A;  2L0C A;  1YZ6 A;  5C4X G;  2UXC Q;  4O42 A;  3F8T A;  4Z9C B;  2ZJR A;  3J81 j;  1FYC A;  3HEJ A;  4NXN L;  5GAD C;  2PYK A;  2EQS A;  2K5W A;  1A8V A;  2UUB L;  2R93 G;  3NEN A;  1LLR D;  1VDZ A;  4C3I B;  2AWN A;  1RF2 D;  4LFB Q;  1S3O A;  1S5E D;  3ERO A;  2K28 A;  4CHT B;  3U4V A;  4A3D G;  1I4G A;  3M3Y B;  3I8Z A;  1WTQ A;  2VUM G;  3DMU A;  4A3G B;  1CT1 D;  1JWS D;  3PIO 3;  4ID6 A;  1GUS A;  2JJQ A;  2ZXO A;  1XJV A;  4QB4 A;  3KFU A;  1VQ8 A;  3OMG A;  3NBI A;  2Q2H A;  2K04 A;  3JAM E;  2UXB L;  1V1Q A;  4GNX C;  2IPK D;  1IYJ B;  4A3M H;  1F9Q A;  3T13 A;  1S5D D;  4B3S L;  4X65 L;  1Z6H A;  1XMQ L;  2R7Z H;  1MGS A;  2HIX A;  1SFO H;  1J5E Q;  3R2T A;  5I2X A;  1Y1W B;  1LTR D;  2RDH A;  3KK7 A;  2BDO A;  2EE1 A;  1VQK A;  2FMM A;  1GM5 A;  4LF8 Q;  1EQV A;  1YJ9 A;  2QA4 A;  2B63 B;  3SXH A;  1XPO A;  3ZJY C;  1JE5 A;  4PZ6 A;  3HOV H;  1K8G A;  3CMA A;  4Y7N B;  4R9W A;  2A6H C;  5IP7 G;  3G6E A;  1EQT A;  2VQE L;  2L11 A;  1L0Y B;  1XNR L;  4KN7 C;  3FDT A;  2ES2 A;  3URY A;  2D2C C;  1SYF A;  1WVL A;  3HOY G;  1RL2 A;  1X3E A;  4HN7 A;  1EY4 A;  3LGJ A;  4X66 L;  1LTL A;  4A3J H;  3ULL A;  4U67 3;  1EZ8 A;  4G7Z C;  1VQC A;  4OX9 L;  1JE4 A;  3HGB A;  3S16 H;  1BXT A;  4CDE C;  1EU4 A;  2B2Y A;  2B2T C;  2L12 A;  2WB1 G;  1N9W A;  2EYO A;  4G7O C;  5I2Y A;  3MXU A;  3BVZ A;  4HED A;  1GO3 E;  2EYP A;  2PW7 A;  5EGT A;  4LFC Q;  1E2V A;  1LT5 D;  4A76 A;  4KV6 A;  3T1Y Q;  1EIF A;  2H4O A;  2CQO A;  4DV3 L;  3AFP A;  1PH1 A;  2WP8 J;  4A3K B;  3S1Q B;  4QMG A;  1FR3 A;  4A3F G;  3G71 A;  1J9O A;  2QEX A;  4PNY A;  1B7Y B;  4PG3 A;  1GHK A;  1VQH A;  2HQL A;  2B2T A;  1OTC A;  1JWU D;  1UE1 A;  1Q7Y C;  4MTK A;  2O5J C;  5K5P A;  5FOB B;  2H5X A;  5JJI A;  2V1C C;  3BDL A;  1VQA A;  1C0A A;  1NE3 A;  5KYL A;  3HOU B;  3VA5 A;  1MSG A;  4KY6 A;  4L63 B;  1QNU A;  1ZYR C;  4XYQ A;  1CKM A;  2XNA C;  1BBU A;  1BNZ A;  1HNZ L;  4DF7 A;  1CHQ D;  2XN9 C;  2ENB A;  2HCC A;  1G51 A;  1TWG B;  3CQZ H;  4DAY B;  4JI4 L;  2DJG C;  3TS2 A;  4FYD A;  2UUB Q;  4DR1 Q;  3H0G B;  4R4I A;  3AMU A;  5J1Z A;  4JBK A;  3HOW G;  2V4D A;  3M4O H;  2SNM A;  3RLN A;  4QCL A;  5GQO A;  1Q12 A;  1PHJ A;  4N8X 1;  3HZX A;  1A6X A;  1KDA A;  4DAM A;  4ZK9 B;  3D8G A;  1K73 C;  1I50 H;  3S1N H;  1IL8 A;  1IBL Q;  3OOC A;  1MD2 D;  2R92 B;  4RHR A;  4N8F A;  1F77 A;  4DR6 L;  3STB C;  4LF7 Q;  3J81 E;  3Q23 A;  4DV6 L;  2NBF A;  3MTS A;  3MHB A;  2K1B A;  4DPG A;  2F0O A;  3MFY A;  3J7Z C;  1PH9 A;  3SHL A;  4LW1 A;  4WRD A;  4LFA Q;  2UXB Q;  3TDQ A;  4DR7 Q;  5KEE A;  4YCW A;  4PQX A;  4B3S Q;  4X65 Q;  1E24 A;  1ZEQ X;  1NY4 A;  2LXJ A;  4KHZ A;  3QJY A;  2JA7 B;  4K6D A;  4UHV A;  1K83 H;  4IPC A;  1O80 A;  4H0L C;  1D2B A;  3AFQ A;  3GTQ B;  2E2D C;  1ML0 D;  4DUY L;  3VYS A;  4FXK C;  1HZB A;  1QCB D;  2XVS A;  4QF4 A;  1F2Y A;  3HOV B;  2KQ3 A;  1KLU D;  2N49 A;  1YVC A;  4UDU C;  1XNR Q;  3CME A;  3DWP A;  2CH4 A;  3HOZ H;  4A3I G;  2FMC A;  4MN3 A;  3A8I E;  1CQV A;  3KDF B;  1HTL D;  4AYB E;  4CJ1 B;  2HHH Q;  5IT9 L;  4X3T A;  2OEO A;  3E9H A;  3TP7 A;  2VY3 A;  1EY6 A;  3RZD B;  3S16 B;  4A3L G;  1CHP D;  4DKA C;  1O7Y A;  5M9O A;  3SEB A;  2Q8R E;  4DAY A;  3DHQ A;  3G48 A;  3R2I A;  1TXY A;  1C7Y A;  3I4M H;  1MI2 A;  4CDC C;  4CKC A;  4B3M Q;  1HNX L;  3AQQ A;  2B2U A;  1OXX K;  5D3I B;  4C3J G;  4K5V A;  1SSO A;  1ZKO A;  5A35 A;  2RDG A;  1TVX A;  4TRD A;  1PTO C;  2KHJ A;  2K50 A;  5I6Y A;  1DGS A;  4JBM A;  3J80 c;  1ENC A;  1Q1E A;  5JJZ A;  4BBR H;  2PZT A;  3UDI A;  1X6O A;  4OO1 H;  4C3I G;  1A3T A;  1EFW A;  4ZRZ A;  3JAM i;  3A7L A;  1GUT A;  1YHA A;  2RBM A;  2A68 D;  4LF4 L;  1I94 L;  2MNA A;  2ZJQ A;  3BDC A;  3GD7 A;  1SMY C;  2F0Q A;  2B3G A;  3A54 A;  3PO3 H;  4DNI A;  1XTC D;  4IZ8 A;  5FO8 B;  2EDG A;  1SNP A;  3KLW A;  1SNO A;  2A6E D;  3JAM L;  1ONL A;  3CQZ B;  3NTH A;  4POF A;  2JEB I;  3V2T A;  1XYI A;  3PUW A;  2F0G A;  2F0N A;  4XQN A;  3IKJ A;  1SE8 A;  2OTL A;  1WTP A;  1I6H H;  3F2B A;  2L15 A;  4KJO A;  2YU9 B;  1SNC A;  1SND A;  5E4X A;  2Q2I A;  2BA1 A;  3FKI H;  3T1H Q;  4F88 A;  1EFI D;  1QVG A;  4LUV A;  2X69 A;  4ME5 A;  5JOB A;  2I5M X;  5ELD A;  3U4Z A;  3O13 A;  3D4W A;  5LL6 S;  3OWE B;  2F4V L;  3HKZ G;  4LF5 L;  4RMF A;  3KDF A;  3QB3 A;  5BR8 Q;  3S15 H;  1KTK A;  3CRL C;  4AQY L;  4LK1 C;  1Q8K A;  1TS2 A;  3NE5 B;  3A55 A;  3I55 A;  1ENF A;  2B8F A;  2Y0S B;  4ABN A;  2WAQ B;  5IP9 G;  1B1Z A;  1LAB A;  2SNS A;  4JYA L;  1PH5 A;  4OWX B;  5ELC A;  3PIP 3;  3RN2 A;  1X3Q A;  4C3H G;  1EEI D;  1Y8O B;  2EYJ A;  4APV A;  3PQI A;  2OQ0 A;  1ROD A;  4S3S A;  1E0B A;  3TP5 A;  3WDN A;  3NBH A;  3RZO H;  4QL5 A;  1FNV A;  4ME3 A;  3GTJ B;  1LTT D;  1A0I A;  1HTP A;  1KDB A;  1JOQ A;  4DR2 Q;  2OWO A;  1EL0 A;  3S14 H;  3J7A F;  2MP1 A;  2D62 A;  1TWF B;  1JJG A;  2LMC B;  1K3R A;  1IBM Q;  4UPA A;  5C3W A;  3NK9 A;  3VR6 A;  5IGB A;  2PCF B;  2JQO A;  3BS1 A;  4LF9 L;  3BVM A;  4WJW A;  4DK0 A;  3Q22 A;  4DXF A;  4YHH Q;  5ELB A;  1LTB D;  3TRZ A;  2EYM A;  1BVS A;  1NR4 A;  3I4L A;  3FHW A;  2MO0 A;  1BCP D;  2AQ3 B;  4YY3 Q;  2NVX B;  3I7F A;  1JB7 A;  4DV2 Q;  1PYS B;  1II3 A;  1HA6 A;  3C1E A;  5C0X G;  2K5Q A;  5HGT A;  5M3F B;  2AUJ D;  5C0X I;  3A5Z B;  4QGU A;  1N36 L;  1LV9 A;  3LWE A;  2JA6 H;  4RGT A;  4YCU A;  1HNX Q;  3PGZ A;  1PLF A;  2R7F A;  2HIV A;  3A7A B;  3K57 A;  3MFG A;  4H13 C;  4JI3 Q;  1DD2 A;  2DY7 A;  3HOX B;  2JXM B;  3L7Z C;  3X3N A;  4FF1 A;  1PXU A;  2EXD A;  3S24 A;  1ILP A;  3R93 A;  3BZC A;  5EJW A;  2O2L D;  3RD4 A;  5LHY 1;  2F0H A;  1MBY A;  1CFM A;  2I5L X;  1WCM B;  4JVZ A;  1MKH A;  5JVG 3;  1X32 A;  1WD1 A;  5TSS A;  3TP6 A;  2B8G A;  1SRO A;  1AE3 A;  4R4Q A;  2F03 A;  3GV6 A;  4RGN A;  5ELE A;  1JQY D;  3G7L A;  4MTN A;  2C35 B;  3GTM B;  1I94 Q;  2ID0 A;  2QKI C;  3KF8 B;  5EKK A;  3MEH A;  4JW0 A;  3J81 L;  4LUO A;  5E7N A;  2CFM A;  4GLX A;  4IUN A;  5IYB H;  4C3I H;  1YJN A;  3PO3 B;  2D5D A;  2VS1 A;  3I4N B;  3HKS A;  1B44 D;  1FJG L;  4GKJ L;  1H9M A;  4K2K A;  3F2U A;  1XPR A;  1EZ6 A;  3M3Y H;  4K5W A;  2FJ2 A;  3BYT B;  3S1R B;  4MNO A;  4A3G H;  5D3D A;  4DV5 L;  3PMF A;  2PQA B;  5FLM H;  2NVT B;  4BA2 I;  1VMP A;  4RGM A;  2NVQ B;  4YIJ A;  4JI5 L;  3GTL B;  4HTH A;  4YWK A;  1O7I A;  5LMU L;  4A75 A;  1AP0 A;  4DXG A;  2JA8 B;  1SRU A;  1PH8 A;  5IWA L;  3I4M G;  3H3V C;  2RQX A;  2OQK A;  1VQF A;  3LNN A;  4O2D A;  3TZU A;  4DFA A;  1XMO L;  3I91 A;  5IOC A;  1Y1W H;  2CWP A;  2VXW A;  3OHX C;  4P72 A;  5J39 A;  1CA5 A;  5FKA C;  1PH7 A;  3Q6S A;  4PMC A;  1PMR A;  3CCL A;  1B70 B;  3M4Q A;  2B63 H;  3EA6 A;  4HR7 B;  4RH6 A;  4P73 A;  3K7U C;  3LX0 A;  4EQN A;  4Y7N H;  3CCJ A;  2PNR C;  1MJE A;  5C0X J;  1KQS A;  1JIC A;  1UEB A;  3NSW A;  5DAU A;  5KND A;  1NNX A;  5C4J B;  1KDC A;  4ZLT F;  1G6Z A;  5J3B A;  1HQM C;  3I90 A;  2F52 A;  5E3F A;  3VR4 A;  3S14 B;  5EPL A;  1EWI A;  5M3M G;  5C44 B;  4GLA C;  5JEA H;  3VYU A;  4C1N I;  5C4X B;  3L9A X;  2UUA L;  2E2J B;  3KF8 A;  1BO0 A;  2F0F A;  2VB2 X;  3UI2 A;  2VB3 X;  3FKI G;  5IIF A;  2LY7 A;  2HDL A;  5IYD G;  3F1Z A;  5C3E B;  2CH4 W;  2FHT A;  4LF6 L;  1RDP D;  1E1O A;  4A3K H;  3S1Q H;  3FRP B;  5T1I A;  3N6R A;  1OXV A;  3FEW X;  3E3X A;  1JOR A;  4KKT A;  4A3D B;  2LFN A;  2PQA A;  1NBW A;  2VUM B;  4NB3 A;  2EJF C;  2F0S A;  4GNX B;  1LT3 D;  2F0V A;  5FLX c;  1KD1 C;  2BE5 D;  1BUV T;  1X3P A;  3K6O A;  3OMC A;  4LMQ D;  3PF5 A;  1AZP A;  3TP8 A;  4GLV B;  2Z4I A;  1SN8 A;  4K6L A;  3HOU H;  1EOV A;  1JWM D;  1O7Z A;  3MA2 B;  1PVO A;  5CBE E;  2AHO B;  5BN4 A;  2HDM A;  3C1F A;  3ULJ A;  3J80 E;  1SNQ A;  1WTV A;  1QVC A;  3MVV A;  1QG7 A;  4LUZ A;  2UU9 L;  2XSC A;  2N3S A;  4PMB A;  1TWG H;  3DUZ A;  3H0G H;  5G3L D;  1ESR A;  2K33 A;  3S1M B;  3SDZ A;  4N9T A;  4PMW A;  2L1B A;  4R4C A;  1GD7 A;  1VQB A;  4J8Q A;  4GKJ Q;  1VQG A;  2IX0 A;  3SK8 A;  5IGE A;  4DR4 L;  2R92 H;  4A4I A;  1X65 A;  1TY0 A;  4JK1 C;  1JC7 A;  1E2W A;  2F1M A;  5DEH A;  2JA5 G;  2Z0S A;  4DK3 C;  1R9T B;  4L8J A;  2CVR A;  3ND8 A;  1PH3 A;  3W3A A;  4QY7 A;  4RHS A;  1IKM A;  2KEN A;  1OXT A;  4ZUI A;  5CGK A;  4GZY C;  1JCK B;  1Y8N B;  1U5K A;  2DN8 A;  3A56 A;  4HMJ A;  5HY6 A;  3K58 A;  2L4N A;  1PRT F;  4NXM L;  1PFM A;  3AB9 A;  1HPC A;  1AFP A;  2EOT A;  1BOS A;  2JA7 H;  3DEO A;  2RCN A;  3CKI B;  5EAY A;  2NZ1 D;  3GTQ H;  3GTP H;  3K0Y A;  2UUC Q;  1CI3 M;  1AZQ A;  4ZKC B;  1X3F A;  4IPH A;  1QOH A;  3GP7 A;  1HZA A;  1A3V A;  3VR3 A;  2MFI A;  2C9O A;  4R1J A;  3PIP A;  1YJW A;  4IFD H;  4P75 A;  5FJ8 G;  3CC4 A;  4A3F B;  1DOK A;  3PUV A;  1B53 A;  2A5H A;  1E7Z A;  3R8B A;  4GNX A;  5IOD A;  3IFD A;  4A3B G;  4LAA A;  5HGQ A;  1D7Q A;  1DZ1 A;  5A2Q E;  5DNF A;  2H1E A;  2NN6 H;  1SLJ A;  3TQY A;  2PI2 E;  2YTY A;  1PRT C;  1B50 A;  1RD9 D;  2K7V A;  4Y52 H;  4A3C H;  5IYB G;  3A8K E;  4BS9 A; 
#chains in the Genus database with same CATH homology
 4OEL B;  1ICF B;  4CDE C;  2DJF C;  1MHW C;  4CDF C;  2DJG C;  4CDD C;  4OEM B;  4CDC C;  1K3B C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...