1HRJA

Human rantes, nmr, 13 structures
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
68
structure length
68
Chain Sequence
SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The three-dimensional solution structure of RANTES.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine (chemotactic)
molecule keywords HUMAN REGULATED UPON ACTIVATION NORMAL T-CELL EXPRESSED AND
total genus 5
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1hrjA00
1PLFA 5D14A 1IKMA 1DOKA 1RTOA 2RA4A 1ZXTA 4IUUA 1Q3LA 3P7JA 1NCVA 1U4MA 2X6LA 4ZKBB 2HCIA 3I8ZA 4HEDA 5DNFA 1F9PA 1IKLA 2X69A 1AZQA 4RA8A 3KBXA 2K05A 1AP0A 1BF4A 2B2VC 2B2YC 2KECA 1GUWA 2B2UA 1RHPA 2DY7A 4X3KA 1G2SA 2MPMA 1BNZA 2FMMA 3DEPA 2RSOA 1B3AA 1X32A 2DY8A 1MSHA 1X3PA 1EIGA 2M2LA 3LWEA 3QO2A 1DOMA 1O7YA 1PFMA 4OIKA 4RAUC 4U68A 5AFWA 1WD1A 2NZ1D 2RSNA 5JJZA 2KEDA 2EE1A 2K03A 1B50A 4HCSA 1HRJA 4XDXA 4RWSC 1F9QA 1HFNA 3UI2A 4NW2A 4CJ0B 5EPJA 3KUPA 1WTQA 1RTNA 2KVMA 2L4NA 1EQTA 4DN4M 1ILPA 1WTVA 1HFGA 2Q8TA 1C8CA 2JYOA 1CM9A 3R93A 1WTXA 2B2WC 1WTWA 1CA6A 2EPBA 1MSGA 2L12A 2L1BA 1XX8A 1PFBA 2B2VA 1VMCA 5CBEE 2B2YA 1DOLA 2B2TA 5E4WC 1XYIA 1NR2A 4R9WA 1WTRA 1VMPA 2J7ZA 1RJTA 4X3UA 1BO0A 5EJWA 1WTOA 4XT3B 5EQ0A 1DZ1A 2H1EA 4QUFA 2EOTA 1PFNA 4OIJA 4ZKCB 3MWYW 2VXWA 4LMQD 1CA5A 1SDFA 1KNAA 1A15A 4X3SA 1U4RA 2JP1A 3HP3A 3IL8A 1O80A 3H91A 2K01A 2K28A 2XIWA 3I3CA 4X3TA 1TVXA 4CJ1B 3ONAB 2MJ8A 1B4OA 4ZLTF 2CVRA 3SVMA 1WTPA 1QNKA 2MGSA 1J9OA 1O7ZA 2X6GA 4R8IA 3G7LA 5CBAE 4IUVA 5EPKA 1QE6A 1F9SA 1EIHA 1DONA 1IL8A 1NAPA 2B2WA 1MI2A 5COYA 2Q8RE 1HHVA 1SSOA 1JICA 1WVLA 2K04A 2K1BA 4IUTA 5EKIA 5CMDA 5D65A 1ML0D 1BBXC 2B2TC 2L11A 3TZDA 2NWGA 1QG7A 4ZAIA 1HA6A 1M8AA 1SAPA 3DEOA 3DM1A 1G6ZA 2L9HA 2N88A 4IURA 1B53A 2FFKB 1ICWA 5CORA 4ZK9B 3TN2A 1S4ZA 3N52A 1B2TA 1EL0A 3D6WA 3GV6A 4QUCA 2FHTA 2RVLA 3I90A 1AZPA 5EPLA 1U4LA 1NR4A 4IUQA 1G91A 2HCCA 1WD0A 4HAEA 4O42A 1X3QA 4CJ2C 1J8IA 1MGSA 3F2UA 5E4XA 1EOTA 1KNEA 1HUMA 4HSVA 3Q6SA 1E0BA 2MP1A 5T1IA 2BDNA 1HUNA 2B2UC 2D9UA 2HDMA 2IL8A 2R3ZA 2KUMA 3GV3A 3FPUB 3I91A 2HDLA 2FJ2A 2FINB 3IFDA 1U4PA 4MN3A 2KEEA 1G2TA 4UAIA 5T1GA 2N55A 4MHEA 1F2LA 2NYZD 3FDTA 1ILQA 4XT1B 1PDQA 1JE4A 1ESRA 1F9RA 2HUGA 1RODA 3MTSA 2SDFA 4IUPA 2KOLA 1LV9A
chains in the Genus database with same CATH superfamily
2AQ2B 4Y7NB 5IP7H 2F0EA 4LFCQ 2QKIC 5C3EG 1Q8KA 1I4QA 1YHQA 3MFGA 4LFBQ 3I4OA 1I6HB 4N9TA 5I6YA 1NCVA 2Z4HA 2NN6H 2X6LA 3D31A 3GTLB 2IX0A 3S24A 3OMGA 3LGJA 1F2MA 1YHBA 2B8GA 5M5WB 1EY6A 1TWGB 2B2VC 2EYHA 2TSSA 5E1FA 2A6HD 3HKZB 1RHPA 1GOZA 3SHLA 1X32A 3LWEA 4U68A 5LL6S 1O7YA 2Q2HA 1HR0Q 4OELB 2F0HA 4A4IA 5IYCG 1SYEA 3F1ZA 4FXDA 3PUVA 2WAQE 4DV1L 4IFDJ 3U50C 3KUPA 1LTTD 2IY5B 4K6DA 4DK1A 4YHHQ 5FLXE 1O7IA 3SDZA 1CM9A 1CQFA 4KK7A 2R7ZB 3K5NA 2GN5A 2E5LQ 1D6EC 1NR2A 2OF1A 4QQBX 5JEAG 2E75C 3IKJA 1SJHD 2MFIA 4K0KL 2H5XA 1PTOF 2A1AA 1HQMC 3NK9A 5C3EH 3A5UA 2PO4A 2RDHA 1O80A 1TWAB 2IHEA 4H7BA 4DPGA 4OO1H 5K5PA 3ONAB 4ZLTF 2JA7G 1RDPD 1J9OA 3HOWH 2B8FA 2R93B 5CC4A 2QGQA 1YNJD 4GNXA 2C35B 2O5IC 1NAPA 1EYCA 1C7YA 2YYZA 1ASYA 1F2YA 4OL7A 3J7AV 1GJXA 2KENA 1M8AA 2A6HC 1I3QB 4G4KA 1LTGD 1Y14B 5CORA 1EFID 2ICIA 5JAVA 3TP8A 3V96A 2OQ0A 3AU7A 1SLJA 5M5WH 4BY1B 1SYBA 4NKLA 4GN3B 1BCPF 4RG1A 1FVIA 1EOTA 3HOXH 4B9XA 2JA5B 2VUMB 2JE6I 1K0RA 2AKWB 1JB3A 3LWUA 1K8GA 3S1QH 4G57A 3FKIB 3STBC 4C3HH 4K8JA 4A3JH 2ZM6Q 3KLRA 1FL0A 4BY7H 4V190 4OO1G 1GUGA 1TWCH 5C4XH 4A3DB 2F0LA 1HNZQ 3S2HB 3W1GA 2FMCA 5IIFA 1KDCA 2XRQD 4A93B 1BF4A 5EBDA 2ZXOA 4JI0L 3DWPA 5IT9L 4CDCC 3E5SA 4B3ML 3A8JE 4GKJL 1Z7TA 1B3AA 3I73A 3K7AH 4FF3A 4RHSA 3CMEA 3S1NB 2NZ1D 2WKDA 5CR3A 2EY5A 3EFXD 2PQAA 2F4IA 4UP7A 2HIXA 3BG3A 2F0MA 1F9QA 5C3WA 1MHWC 5EPJA 2L4NA 4QB4A 4DV6L 3QOJA 4IALA 1SNCA 1VF5C 4FNFA 3DMUA 4HSPA 5KEEA 3OTOQ 4IO9A 4B3RQ 1QNUA 4DAMA 3A54A 3HOZH 4GOPA 1SR3A 3VA7A 2R92H 5I9OA 3HOVH 3GDEA 4JBJA 1BBUA 1PZID 1QZHA 2F0PA 2I0QA 3CMAA 2UU9Q 1JJCB 1JWSD 2RKSA 4ODGA 4LW1A 3A74A 5D3IB 3TS0A 1SDFA 1K3BC 1PV4A 2NN6G 3MA2B 4PMWA 3BZDB 5ELOA 2X6GA 4DNTB 4V0BA 3GTLH 4BS9A 1EIHA 4P73A 4JBKA 3TP5A 4XQJA 1WVLA 2K1BA 1PRTF 5LMUQ 4FP5D 2E2HB 4AQYQ 3PGZA 1TWHH 2EDGA 4DR3L 3S15B 3KK7A 1KDAA 1SE8A 3S1MB 4JI4Q 4IOCA 4PMBA 1IYUA 1LTRD 1SNMA 4PNYA 4RMFA 1G91A 1X3QA 3F2CA 4L6TB 5IGGA 3L3OC 1CHQD 1BDOA 1Y8NB 3R2TA 3FPUB 1UE6A 5IP9H 3T53B 3X3NA 1B44D 1SEBD 1G51A 2OCEA 4JPBW 1K3RA 3RLNA 2AQ3B 2QDLA 4DUYQ 3Q22A 4HJ5A 1ONLA 3K58A 3SK6A 3AMUA 2SNSA 3SK8A 1AZQA 3GTPH 3I4NH 1G8ZD 3KF6A 3JC66 3GTJH 2RQXA 3ZYYX 2B2UA 4P71A 4DV0Q 1FGUA 2MPMA 1BNZA 5HY6A 4P72A 4OEMB 4KD4A 1E1OA 1J6QA 5AFWA 5K36H 2ASBA 3T4AC 1E7ZA 1B50A 3E0JA 1SE4A 3I4MB 1A6XA 1NJIC 4JI3L 4PG3A 3UDXA 4RGMA 3KDFB 1UE7A 2ZJPA 3K0XA 4QGUA 1C8CA 3PO2H 4JK1C 1VQGA 3HOVG 3A8IE 5FLMG 3NUCA 1O78A 2F0NA 2NZHA 3S14B 1XNQQ 2NVQB 3BDCA 3CPWA 1YNNC 4GN4B 4QIWB 4DV5Q 3OIQA 1VMPA 4O1NA 2EY2A 2UXCL 4CKBA 3VYUA 1PFNA 2IW3A 3K81C 1CA5A 3HGBA 2IWHA 2ZTCA 4R8NA 4IQZA 1CTMA 3CQZH 3HFZB 3K0YA 3H91A 4X3TA 2PPBC 3H3VC 1EY0A 1U0LA 1EZ8A 3CCEA 1TQOA 1F9SA 2OXPA 1IL8A 2B2WA 3U9OA 4B3TL 3J81c 3NPPA 3H3VI 1FNVA 2DJGC 1Q12A 2NWGA 1H9JA 1KLUD 3LNNA 4DK3C 4C1NI 4C3IH 2F0IA 3SR1A 3CCMA 1YI2A 2R7ZG 1PYSB 2M9VA 3H3VH 4I7AA 2WFWA 3RUZA 3WOEA 1C0AA 1H9MA 3D6WA 4AIMA 3I90A 4DV5L 1AZPA 1T5XD 1PH3A 3KJPA 5CV9A 2JA7B 4A3KB 4A3KH 4IZ8A 5HGQA 3JAMi 4DV2L 5C5LA 5LL6X 2QEXA 1J5EQ 2FJ2A 1IW7C 1LTAD 1UNSA 2NYZD 4XT1B 4LFBL 1LT6D 3PF5A 1ESRA 2RCFA 4X62L 1Q7YC 1STNA 4NPSA 4BBRH 3HOWG 2CH4A 2NVXB 2FXQA 1A63A 3C46A 1IKMA 4DAYA 1OTCA 4B9WA 3AFQA 2XGTA 1IW7D 2VQEL 4RHRA 3J80E 3JAME 1WFQA 2X69A 3SEBA 2F0TA 2F0UA 3MZ5A 3CRKC 4HIDA 2XSCA 1N33Q 1P8LA 2EYPA 1KAAA 3UE0A 3OW2A 4TRDA 1B70B 2EQSA 1A2UA 1SRUA 5FLXc 4I65A 2KCMA 3FPPA 2D0OA 3I70A 1E1TA 5ELCA 3C3LA 2JXMB 5J1ZA 4OX9L 1EQTA 1XWEA 1ILPA 2G9DA 4A75A 4LF7Q 2A69D 1PA6A 1WTXA 2OTLA 3MAQA 4JI2L 3RMHA 4PZ8A 1DGSA 2QEJC 2XWBB 1XYIA 1JOOA 1AE2A 5IGCA 2BA1A 4XT3B 3AEVA 4Y52H 1SNQA 2XRSD 3I7FA 5JVH3 1N34Q 1YHAA 1PH5A 4NP5A 4X66Q 2EYOA 2BDOA 1SE3A 3S9WA 1L0YB 2WB1E 4C3JH 5ISRA 2L55A 1KC8C 4JYAQ 3K57A 3MXUA 5LMUL 1B3QA 1UE5A 3PUXA 1SNOA 1FYCA 1Y1VB 2WAQG 3RZOH 2L11A 3Q0AA 1VQCA 3DEOA 3HOWB 3NWSA 1HNXL 2PCFB 1CSQA 3J7ZC 3RZDH 4YIJA 3GTGH 2E2IB 5FO7B 1QCBD 1Z6HA 1TWHB 1Q90A 1PFSA 4C3HG 4BY1H 3ERQA 1FJGL 5FOBB 4BA2I 1KDBA 1G291 3W5OA 2N49A 2N55A 3T1YQ 2HUGA 2RHSB 1JB7A 5G3LD 1DM0B 2VB3X 1AE3A 2PQEA 2KOLA 2AUKA 4FYDA 2N8NA 1RIPA 2NTTA 4R4OA 4LF5Q 3M3YH 1Q3LA 4HCEA 3Q8DA 2UXDL 5KRUA 2L5TA 4JI0Q 3ER0A 1LLRD 1U4MA 2J0TD 5M3MH 1L1OA 2R6GA 2R7DA 1IBLL 2K05A 1XXGA 3A55A 2N3SA 2CW0D 5A2QE 5J39A 2WV6D 3BYYB 3ZJYC 4C3JB 5M5YH 3NE5B 5BN5A 2DY8A 4FF1A 3DXJC 4C3IB 1XNQL 5I2YA 2VW9A 4UP8A 1EWHA 3A56A 1PZKD 3JAML 1HRJA 4RCOA 2Z8LA 4NW2A 1WTQA 5C44H 4OHJA 2A5HA 1N36Q 4WORA 1I6HH 5C0XI 5JEAH 4JYAL 2B2WC 2L0CA 4A3BB 2EPBA 5CV8A 2SNMA 5FO9B 2HD3A 4DR6L 1EY7A 4F87A 2JA6B 4DV3Q 2AWOA 1EY4A 2EYLA 4OIJA 1HZ9A 1LABA 5E7NA 3NENA 5CV6A 4LFCL 4ZKCB 1SXTA 1A15A 1Y1VG 3HP3A 2K01A 4JBWA 1Z47A 3BVMA 3MC0B 4H02A 1M4VA 1NMGA 4YCVA 3W3AA 3PIO3 5BR8L 4KKUA 4XYOA 5CBAE 3VA5A 4DR3Q 3SXHA 4DXGA 4ILWA 2ZTEA 2O4XA 3NEMA 1VQ6A 4L5RC 1SFOB 2G5DA 1LT3D 4Y7NH 4JV5L 1KHIA 2KCCA 2F1MA 1J5EL 3CPFA 2EXDA 2N88A 4RFBA 2I5HA 1GM5A 5IGFA 3TN2A 5EKLA 1PRTD 5CGKA 4CKCA 4K8IA 1CK1A 3HOUB 2F0VA 3NQIA 2JA6H 4A3FH 2BDNA 1NMFA 4L8JA 2F3VA 4AQYL 2JA6G 3J81E 4NXML 2Z9HA 1RODA 3MTSA 4GKKQ 4JI8L 4LJZC 3G6EA 4EQPA 3TS2A 1DJRD 3HOVB 2JA5G 1EIYB 1QVGA 1JOKA 1VQFA 4RH6A 2HCIA 4B08A 1EWIA 4OWTB 4JC0A 1XNRL 5C0XJ 3J7A5 5JVG3 3UDGA 1ZYRD 2NZOA 3MXNA 1HH2P 1G2SA 4A3GB 3NTIA 1I4HA 3KLSX 1I94Q 1YIJA 4RGOS 3QB3A 2EY6A 3DLLA 3RZOB 1STAA 4DK6C 3RZDB 1ASZA 2JK8A 4K5XA 2Q2TA 3UI2A 3NP8A 3VR3A 1VDZA 5IE8A 1WTVA 2YTXA 4GNXB 3VR2A 3R93A 1SYDA 1SN8A 3A8KE 4A3CH 1HTLD 3TEHB 1KIXA 4YY3Q 5FLMH 1SMYD 1I4XA 4A3MH 1DOLA 1CKOA 3E3XA 5EJWA 1MBYA 1EYGA 4K6LA 4J15A 3CXCA 4JI7Q 2F0WA 1X6OA 5E3FA 5M3FB 2MUYA 5K36G 1TY0A 3PQIA 5C3XA 3AB9A 4B3TQ 1GD7A 3WOFA 4ZYSA 3CC4A 2K5QA 5IOCA 4APVA 5IYBH 1EZ6A 3K5MA 5COYA 1K8OA 2K04A 5EKIA 3I4NG 1BOSA 4DUZQ 4A76A 3KFUA 1M1KC 2HIVA 1FNUA 3EA6A 1UUPA 4HR7B 1Q82C 4KJNA 1ENCA 4JI8Q 1B53A 2MNAA 4JI5Q 1JJGA 1YJWA 3J80L 5HURA 1JCKB 1VQLA 4UPAA 3AFPA 3HKSA 3BJUA 4LUOA 1KNEA 1VQOA 4QMGA 1ICFB 5IP9G 4IPHA 4KI0A 3J80i 4R4TA 4BY1G 2B2UC 4UY8C 2FINB 1V1PA 1LO5D 1R4QB 1YZ6A 3O13A 2LFNA 4DR7Q 3GD7A 4IUPA 1UE1A 1PLFA 3T56B 1D5ZC 4O0AA 2F0KA 2KCNA 2MQHA 5IODA 1MJCA 3P7JA 1XMOL 4QY7A 4ZKBB 3HOXB 3KF6B 1F9PA 4ME5A 3OYYA 5DM63 4J1MA 3PSIA 4C3JG 2AQ1B 4A3IB 4IN3A 1ZEQX 4JI1Q 2ZJRA 1GUOA 3OIPA 2VUMG 3QJYA 3QR8A 3G4SA 2F3IA 1F2ZA 3QWNA 4KKTA 1SROA 2K32A 4RKBA 4EQOA 4JOIA 1YJNA 1GXDC 2KVMA 1EQQA 1D8LA 1SBBB 5F2DA 2TMPA 3CCRA 4DV0L 1TT2A 5C4JB 3OHXC 1HPCA 2F0DA 2Q8TA 4DR1Q 1JR0D 3BDLA 4MZ9A 2BCOA 2I5LX 4OX9Q 2B2VA 1IBML 4GKJQ 3FHWA 1B1ZA 2J7ZA 4X3UA 4HN7A 5BN4A 2VQFL 2EZVA 1WOCA 3I2ZA 1PH7A 3M3YB 2IX3A 3STBD 2JP1A 2V1CC 4XYQA 4KTAA 2QDBA 1YNND 1STGA 4P74A 4N8X1 3D4DA 4DV4L 1JE5A 1VF7A 1KTKA 3UDIA 5IGEA 1DONA 1L0WA 5M5XH 2C5CA 1HHVA 5EKKA 1BCPD 1HZAA 1W6KA 2K5WA 4I7ZC 3R8BA 4FVMA 3NSWA 4BBRB 5LMNW 2DNEA 3ULJA 2YU9H 3U9SA 2DJFC 2L9HA 2PZWA 1FR3A 1ICWA 3QG1A 4ZK9B 1R9TB 2FHTA 2RVLA 3L7ZC 1GHKA 5IGDA 1PHJA 5EBCA 1BCPC 1STYA 2QCPX 1J8IA 3J7AF 2DNCA 2I46A 1A8VA 2A68C 1WCMB 4HSVA 1WYDA 2LS01 2QW7A 4DV7L 1PH9A 2D9UA 3I91A 3TRZA 1L2FA 2KEEA 2D0PA 3HOXG 4RGTA 2CHBD 4P2CB 1PH4A 1IL2A 1AW7A 3T13A 4NDXA 1N32Q 4JOIC 2OWOA 3PO2B 2K5DA 4IOAA 3K80C 3VYTA 4YY3L 1SE2A 3CAMA 2B2YC 4POFA 4DFAA 1H9SB 1LYLA 3ULLA 4C1NK 2YV5A 1T5EA 1A62A 2R92B 1PRTC 1MSHA 4OIKA 4H13C 2Z6KC 4AYBB 5JJZA 1EEFD 1N9WA 1JJ2A 1NBWA 5AJ3L 4GN5A 4KD3A 4RWSC 3KLSA 4LUVA 1JORA 1V8QA 2PI2A 3KF8A 2F4VL 2RDGA 3R3OA 3TREA 1CHPD 1NNXA 3S17H 4DV3L 2XTIA 4LAAA 4KMUC 4C56C 5GAGC 1FGBD 1EUJA 3RLFA 5C0XG 4PQXA 1DZ1A 1C9OA 3T51B 3KJOA 1D5MC 4QUFA 2Y0SG 4F8MA 1CKMA 5M3FG 1XPOA 4XXEA 2XIWA 2A69C 4BBRG 3LX0A 5IY0A 3BVGA 3BVZA 2EIFA 1RF2D 4JI5L 1KAWA 3GTPB 4JCVE 1T9HA 3K5LA 2Q8RE 1SSOA 2DUDA 4IJHA 3T16A 1OXUA 3PUWA 2UXBL 3DM3A 2K4KA 4YWMA 4CDEC 2HQLA 1EL0A 1B2TA 5FLXL 1HNWL 4JV5Q 1WCMH 1PXUA 4DR6Q 3VR6A 1S5BD 1TS3A 3MHBA 4C2MB 4HJAA 1QUQB 4O2DA 5M9OA 4XIGS 1H9KA 2E76C 3MEFA 1W3SA 1NTGA 5D3DA 4UAIA 1XMQQ 1M90C 1IBMQ 3KYHC 1X3GA 5JPNC 1JE4A 5ELBA 5IYBG 2RF4A 3MXNB 2D62A 3D8GA 4HJ7A 1HR0W 2F3WA 2M00A 4JI6Q 4QJFA 4MNOA 2ALYB 4KN7C 3R2IA 1RTOA 2ZT9C 3OWEB 3D6CA 5A2QL 5IT9c 1VQ9A 3U58A 1IKLA 3M4OB 4J8QA 3U4ZA 1AP0A 4UHVA 5L37A 2UUBL 1GUWA 3VYRA 3CHBD 4PV1C 1CT1D 1HZCA 1E2WA 1SNPA 3CP0A 3DHQA 1DOMA 3BZCA 1IYVA 2RSNA 3PUYA 3VDYA 4A3IH 1XPRA 4LF4Q 1OXSC 5TSSA 3TP6A 4M1UB 3HEJA 4KY7A 1TS2A 1ET9A 1C48A 4CBVA 1HJPA 3FMCA 1E2VA 3C2PA 4A3JB 4TQUS 4A93G 2ICEC 1HFGA 4LF8L 4NXNL 2WACA 1PTOC 3GTKH 3BZKA 1X3FA 2E5LL 1HNWQ 1MD2D 4DNIA 2H1EA 3E6ZX 3H0GH 2EY1A 1B8AA 1LTID 4X3SA 1AH9A 4FF4A 1WJJA 4X64Q 1KLGD 2JA5H 3K7AB 1Q1BA 3ITPA 3OPOA 3S1NH 4TSSA 4JG2A 1L0XB 4IUVA 4X65Q 1S5CD 3CD6A 3AYHB 1R9TH 1BVSA 2K5VA 2XNAC 3M85A 1MI2A 3HOUG 1JICA 1LT5D 1CZWA 4YCWA 1VQJA 1S3OA 2BH2A 3TZDA 2PW7A 1SAPA 2CFMA 1RL2A 1V1PB 2MHVA 4KN4C 4N9PA 3BDOA 4A3KG 4GLXA 4ULLA 5EPLA 2CWPA 3H15A 1K8AC 3GTMB 4JBMA 4O42A 1L1OB 1Q86C 4EQNA 2E2JH 2E2JB 1AEXA 1EY8A 4HMJA 3FVQA 1EU4A 1A0IA 4OWXB 2R3ZA 4LF7L 2KUMA 5ELFA 3I72A 5DAUA 2Q2UA 1G2TA 3NWTA 2UUCQ 2SOBA 4DUYL 1BUVT 2EVBA 1S72A 1FNWA 2F03A 3NBHB 1BQQT 1DOKA 4MTKA 4DV6Q 3CC7A 4IUUA 3ICEA 2UUBQ 5FJ8G 5C0XH 5DNFA 1HNXQ 4HIKA 1B9NA 1TS4A 2IPKD 3KBXA 4NXNQ 3HOUH 1TIID 2KECA 2F4VQ 1TY2A 2EXZA 3HOZG 4B3MQ 3PIP3 2JA8H 3TQYA 3N6RA 4PZ7A 2HHHL 4YCUA 1PFMA 1GVPA 3D4WA 4HJ8A 1QZGA 5C4XG 4ZCKA 1EY9A 2R7FA 4PZ6A 4QF4A 2IX1A 1RTNA 1N8RC 5EAYA 1O7LA 4HTHA 2D2CC 4BXXH 3M7GA 2IHFA 3KF8B 4TKOB 4YHHL 1PFBA 5CBEE 1Y69U 4A93H 3URYA 4R9WA 4FXKC 2R92G 1FJGQ 1EWCA 3F2BA 4AYBG 4K2LA 4BY7G 1W2BA 1LT4D 1V1QA 2Z0SA 1KNAA 5M3FH 1KRTA 2Y0SB 3S14H 1K83B 1D5XC 5C5MA 2K5NA 1DCZA 4H44C 5GROA 3M4OH 3TP7A 5CV4A 4C3HB 2VZAA 2PMZE 2WB1G 4IUTA 3RR5A 5CMDA 5IT9E 2K50A 1LTLA 1QG7A 2K6AA 4LFAQ 2OEOA 2JQOA 4A3EB 2PZUA 3HZXA 2CQAA 3T1YL 1WCMG 3L2PA 4XQNA 4KHVA 2HCCA 5CV7A 4CJ2C 1WD0A 5JEAJ 3NQTA 3I4NB 4KLKA 1VQNA 4WJ4A 1LTBD 4IUNA 5LMNQ 3Q6SA 1K8MA 1PH8A 2GVBA 3SGIA 1QWYA 3D4RA 3IFDA 3CF5A 4MHEA 4DUZL 2JA7H 4DV7Q 3GTOH 1SMYC 3VR4A 1PTOD 2K5HA 2SDFA 1KABA 2NB0A 2O5JC 4POGA 2O2LD 3PIPA 1YITA 1VQMA 2Z1CA 1Q8IA 2BOSA 3DWAA 4JI4L 5AJ3Q 4DAYB 3I8ZA 4GOPC 3S1RB 2JA8B 5BR8Q 4UDUC 1Y1WH 1Y1WB 2MO0A 1WI5A 3MXPA 1K9MC 2A19A 5IWAQ 3DEPA 3MEHA 3GTQB 4LUZA 2KEDA 3CW2C 2I5MX 4R4IA 1I4PA 4WJ3M 4BY7B 1B9MA 5IYCH 4BBSB 2NN6I 4ZQ3A 5M5XB 2PQAB 1HFNA 1Y8OB 1K28A 4OONA 4AYBE 1II3A 1OXXK 3RLOA 4DK0A 4ID6A 2I07B 2V4DA 2JYOA 2VS1A 4LF8Q 2HT1A 2PMZB 3S16B 4NB3A 1MSGA 2L12A 5C44B 4DR2L 1LTSD 4BXXG 3S17B 3TSSA 2KHSA 1CFMA 1H9RA 2KHJA 1WTRA 4TVAB 3I56A 1BO0A 3GP7A 2EOTA 5FJ8H 5JJLA 1CKNB 5KYLA 3CCVA 2B63B 1U4RA 3IAYA 1UEAB 3IL8A 3L0OA 4CJ1B 2F0QA 4K5WA 2BE5D 4A3BH 3CC2A 3V2TA 2E2DC 2JA8G 4A3EG 3ND8A 4G7HC 4L5SA 5EPKA 4J6HA 1XPUA 1TKWB 3S1MH 1I5FA 4GKKL 4P75A 2VQFQ 1D2BA 2E8GA 2UXCQ 4QIWE 2L15A 2LMCB 2UXDQ 1BBXC 3J80c 2UUAQ 1P16A 4ZAIA 3TMEA 3DM1A 5KNDA 1G6ZA 4YWKA 4GS3A 5G3LF 3S1QB 3E0EA 1EYAA 4DKAC 1PMRA 1I94L 1A3UA 2VUMH 1EQRA 4CGYB 4YWLA 3G6JB 4IUQA 3VR5A 2EYJA 2H4OA 2ES2A 1X3EA 1EFWA 4XTCS 1SYFA 2CCZA 3MVVA 2AUJD 1OO9B 4KHZA 2MP1A 1TWCB 2HDLA 1TS5A 1I3QH 1IZ6A 4X6AH 2NBFA 5J3BA 5KYIA 1TR5A 1PDQA 2AWNA 4KKSA 4ZRZA 2RHQB 5ELNA 4NMZA 1G6PA 5NUCA 1Z9FA 3K8AA 3DWQA 1NY4A 1LACA 1TWFB 1DYQA 1TWAH 2RA4A 2K33A 2PNHA 2NVTB 3H6MA 1V43A 4DR5Q 2IT1A 2LXJA 5H1SE 2LY7A 3BU2A 2EJFC 3TZUA 4LNQA 2C9OA 5C6AA 4A3DG 4CKEA 3K7UC 2E2IH 4RCNA 3GTGB 2NVYB 3KLWA 1Q81C 2ZTDA 2RSOA 3A5ZB 2RDFA 4FDBA 3Q24A 2WINB 4RAUC 3QO2A 3PO2G 1WD1A 1KD1C 2OQKA 1PH1A 2XVSA 1GUTA 2PZTA 2Q8IB 3BS1A 1ZKOA 2ATWA 1VS0A 4G7ZC 4EX5A 1YVCA 4CJ0B 3BYTB 1CSPA 1I50B 4JI7L 2R93H 2PYKA 1X54A 1CA6A 2DGYA 3SE0A 1A2TA 3NBIA 2CH4W 2A6EC 2F0JA 1Q46A 3K6OA 4XQQA 1NE3A 3FKIH 5JJIA 4IFDH 3PF4A 4AH6A 5KIXA 3GO5A 2NVYH 3UE1A 1V9PA 2B3GA 1KQSA 2MJ8A 4U673 3PO3B 2YTYA 2MGSA 5IP7G 4E6IA 2BH8A 3EQLC 1DD2A 2WKCA 3K5OA 2KQ3A 2UUAL 3H94A 2OT2A 3FRPB 5D65A 1UEBA 1ESFA 2B2TC 5DM73 4CHTB 2EYFA 2LSSA 4IJLA 1GO3E 1XNRQ 2KHIA 4IURA 2FFKB 1YNJC 1S4ZA 3OTOL 3V05A 3NXWA 5C4ZA 3NHHA 1PZJD 5C3EB 2A73B 4A3LG 1JWMD 2ID0A 1MGSA 5E4XA 2B39A 5LMNL 3E9HA 2E2HH 3L9AX 1HUNA 3M4QA 4DR4Q 5DLQE 4WFN3 1BR9A 3S16H 1PTOB 2GA4B 4LWCA 1ILQA 1F9RA 1QB5D 2WP8J 1X9NA 3RD4A 1X55A 1Y1VH 3F2DA 5IYDH 5FO8B 3EVQA 1GUNA 1ZXTA 2EJGC 1SYCA 3ULPA 5GAEC 1EEID 1YEZA 4CDDC 4A3IG 3J81i 2XWJB 3GQBA 1E24A 1VQAA 4RA8A 3FP9A 1SYGA 4GZYC 3PO3H 2HQEA 2WAQB 5GAHC 5I2XA 2DY7A 4X3KA 5IWAL 1PYBA 4LK1C 2PNRC 1X3PA 1HXYD 2M2LA 3RN2A 4DAPA 1IHZA 2HHHQ 5FK9C 3OOCA 3H0GG 4MTNA 2Q2IA 3I4MG 3T1HL 5KGUA 3A7AB 1SFOH 4A3MG 1AFPA 1E2ZA 1PYWD 2A8VA 3AQQA 3ND9A 2ZXRA 5J22A 2L1BA 4IPDA 2Z6BA 4DV4Q 2R93G 2VB2X 2B2TA 2CWAA 4UP9A 5E4WC 2ZXPA 3GTOB 4IFDI 3HOYG 3I55A 1SNDA 1IBKL 4FF2A 3S2HH 5M5YB 4IPCA 1VQ4A 1VQPA 3RN5A 2ZM6L 4DU9A 1CZGA 1FD7D 3I3CA 1X56A 1CKNA 2SEBD 1QUQA 2CVRA 3SVMA 1DXMA 4N8FA 1U5KA 3CCUA 1YJ9A 5A35A 3OW7A 2OTJA 4LF9Q 1QE6A 3OWFA 2Z4IA 4LFAL 4IPGA 2JEBI 1EQVA 1CI3M 4H0LC 4KV6A 2CW0C 5IGBA 4DAVA 4ZUIA 4R4QA 3PV0A 3CKIB 4QUCA 2VL6A 1AN8A 1NR4A 4R1JA 2NVXH 2G9HD 3S2DH 1HTPA 1L1OC 4FXGC 1VQIA 3QIAA 2B29A 2JEAI 5CV5A 4A3GH 1ENFA 5T1IA 1IXRA 4DXFA 3F8TA 5JJKA 3A7LA 4OXPA 4A3FG 5T1GA 3TDQA 5M3MB 1HA5A 1S5FD 3G71A 2JJQA 3T1HQ 1UWVA 1EIFA 5CYUA 2WIIB 3HOZB 1VQHA 3NBHA 1RKNA 1QVCA 3KOJA 2Y0SE 4DR5L 1ENAA 3VYSA 3ERSX 4HEDA 1VQDA 1PH6A 4MIUA 4RKLA 1HR0L 3E9IA 1NSNS 4A3MB 3EJIA 3H0GB 4JW0A 1X65A 4DV1Q 2EJMA 2K7VA 4A3BG 2P5ZX 1EOVA 1NUCA 1JOQA 2NTSA 2K03A 4X62Q 4K0KQ 4DR1L 1RD9D 1QJOA 2LXKA 1E22A 1JC7A 1VQBA 4KHPL 3HOYH 2D5DA 2BE5C 4DN4M 1N33L 2CQOA 4LF6L 3KBGA 1QVFA 3K59A 3P75A 1N36L 4K2KA 2QA4A 1VMCA 2F0GA 2GVAA 2B63G 1QOHA 1I6VC 3B6YA 2WB1B 5EQ0A 1PTOH 1V1OA 2K14A 3I4LA 1STHA 3M9BA 4EVOA 2AHOB 1VQ8A 5LHY1 1TVXA 4QL5A 1QNKA 4K5VA 3J81L 3EIVA 1O7ZA 3PUZA 3G7LA 4DR4L 1LUZA 2A68D 1W6JA 1VCIA 1Y8PB 5I4DA 3W2DA 5M3MG 1ML0D 2ENBA 3CCSA 5C4JH 1IYJB 5ELDA 4A3FB 1HA6A 3SK5A 3JAMc 4JI6L 3J7YW 1B7YB 4Q5VA 3S2DB 4ZUJA 5I9PA 3GV6A 1I4GA 2JN4A 3D0FA 4B3SQ 2XN9C 1D7QA 3M4PA 4PMCA 4JI2Q 1HCZA 4X66L 3IRBA 1BBWA 1RCVD 1E0BA 1YNXA 2HDMA 3C1FA 1CQVA 3P1HA 3GTKB 1VQEA 1U4PA 3QOLA 3FDTA 3UDFA 4A3GG 2JA9A 3GV3A 1K0SA 3CRLC 1GUSA 1I4RA 3NELA 2LKVA 3CCLA 4BBSG 2YU9B 4F7XA 4OWWB 1TU2B 4HIMA 3HKZG 4Z9CB 1H9SA 1K83H 1LM0A 2B63H 4G7OC 1BKBA 4BWGB 2N78A 4HJ9A 5JPMC 2CKZB 4X64L 1WTOA 3PO3G 2J4XA 4K14A 1N34L 3P20A 1UAPA 5C4HA 4DR7L 4HCSA 2R7ZH 1TWGH 4GLAC 1IBKQ 1EU3A 4XDXA 2K75A 1GKHA 4L5TA 1STBA 2R61A 4L5QA 1KXLA 5GADC 5IYDG 5EGTA 4R4CA 3NTKA 3KDFA 1D1IA 3W1BA 4CDFC 1A3VA 3X3MA 1WTWA 1JQYD 1XX8A 2AMCB 3H09A 4BA1I 1Q1EA 4ME3A 3GTJB 2B2YA 4GLVB 4B3SL 3IFTA 2QF7A 1RJTA 1PVOA 1EYDA 1I50H 3CU7A 1S5DD 3MWYW 4Q0FA 2E74C 4JVZA 4WJWA 3M4YA 3EBEA 4S3SA 2F0OA 4ALPA 4R8IA 4KY6A 1WTHA 2ZJQA 3PIOA 4A3DH 5C4XB 2UXBQ 2DN8A 3I4MH 4DA2A 1A3TA 4HMIA 3EROA 3WWVA 4LF5L 1BXTA 1C4QA 2YTVA 3MFYA 2A74C 2KBNA 1TWFH 1XTDA 3N52A 4EQ5A 5KNCA 1KL9A 3CQZB 1U4LA 4DF7A 1SMXA 4HAEA 1S5ED 5BN3A 3S1RH 5ELEA 2F52A 4KHPQ 2NUCA 3F2UA 1CUKA 1F77A 3GTQH 1JMCA 1HUMA 1JT8A 2F0FA 4C3IG 4LF6Q 1IBLQ 3FKIG 2F0SA 4DGZA 3DUZA 3EN2A 3OMCA 1R4PB 3HKZE 2KA7A 4ABNA 4A3CG 3GTMH 1YBYA 4A3LH 5D14A 1PH2A 5JOBA 1U9RA 2A6ED 1E3PA 3PMFA 3C1EA 2QILA 2RCNA 1D1KA 1K73C 4OGQC 4M8AA 1VQ7A 3HRZC 2FMMA 3CCJA 1MKHA 4C2MH 4JI3Q 1EIGA 3MXGA 1HZBA 1VQ5A 3FEWX 2K52A 5I6WA 4EGVA 2EE1A 4RGNA 5HGTA 2KJXA 3M7NA 2KCTA 4NXMQ 3S15H 4KJOA 4GOPB 1OXVA 2PW5A 1N32L 2IJ0A 4HIOA 3G48A 1ZYRC 2RBMA 4GNXC 4IFDG 4OO1I 2NVQH 3Q23A 3WDNA 1STEA 2VY3A 3HOYB 1XJVA 1HNZL 2EYMA 1HQRD 1XMOQ 1EY5A 5C44G 1TXYA 5DEHA 4FO2A 1H95A 4LMQD 2VXWA 4BBSH 3U4VA 4X65L 4LF9L 4B3RL 2PI2E 1MIUA 5FKAC 2K28A 3PCOB 1KRSA 4WRDA 4A3JG 1B4OA 4JI1L 1WTPA 3TBIB 1Y1WG 2VNUD 1SJED 1XTCD 1PRTB 4L63B 1QILA 1JWUD 2JSOA 2VQEQ 4DNRB 3SK4A 4KY5A 4QCLA 1BCPB 2MO1A 2NVTH 1GHJA 3OSOA 4DV2Q 2BA0A 3D3RA 4F88A 3HG9A 1S40A 5KNBA 1VQKA 1MJEA 3A0JA 2IL8A 2UUCL 3HS0C 4MN3A 2UU9L 1XMQL 1ET6A 1OXTA 4A3EH 1F2LA 2Z6KA 4DR2Q 3J81j 5GQOA 4LF4L 3RNUA 3CCQA 3NTHA 1LV9A
chains in the Genus database with same CATH topology
2AQ2B 4Y7NB 2F0EA 2QKIC 1I4QA 1I6HB 3MFGA 4N9TA 5I6YA 1NCVA 2Z4HA 2NN6H 2X6LA 3D31A 3GTLB 2IX0A 3OMGA 1F2MA 2B8GA 5M5WB 1EY6A 1TWGB 2B2VC 2EYHA 2TSSA 5E1FA 2A6HD 3HKZB 1RHPA 1GOZA 3SHLA 1X32A 3LWEA 4U68A 5LL6S 1O7YA 2F0HA 1SYEA 4FXDA 3PUVA 4IFDJ 3KUPA 1LTTD 4K6DA 4DK1A 5FLXE 3SDZA 1CM9A 1CQFA 4KK7A 2R7ZB 3K5NA 1D6EC 1NR2A 2OF1A 5JEAG 2E75C 3IKJA 1SJHD 1PTOF 1HQMC 3NK9A 2PO4A 2RDHA 1O80A 1TWAB 4H7BA 4OO1H 5K5PA 3ONAB 4ZLTF 1RDPD 1J9OA 2B8FA 2R93B 5CC4A 1YNJD 2O5IC 1NAPA 1EYCA 2YYZA 1F2YA 4OL7A 3J7AV 1GJXA 1M8AA 2A6HC 1I3QB 4G4KA 1LTGD 5CORA 1EFID 2ICIA 5JAVA 3TP8A 3V96A 3AU7A 4BY1B 1SYBA 4NKLA 1BCPF 1EOTA 4B9XA 2JA5B 2VUMB 2JE6I 1JB3A 3LWUA 4G57A 3FKIB 4K8JA 3KLRA 4V190 4OO1G 1GUGA 4A3DB 2F0LA 3S2HB 2FMCA 5IIFA 1KDCA 2XRQD 4A93B 1BF4A 5EBDA 2ZXOA 3DWPA 5IT9L 3E5SA 3A8JE 1Z7TA 1B3AA 3I73A 3S1NB 4FF3A 4RHSA 2NZ1D 2WKDA 5CR3A 2EY5A 3EFXD 2F4IA 3BG3A 2F0MA 1F9QA 5C3WA 5EPJA 2L4NA 4QB4A 3QOJA 1SNCA 4FNFA 1VF5C 4HSPA 3DMUA 4IALA 5KEEA 1QNUA 3A54A 3VA7A 5I9OA 1PZID 2F0PA 1JWSD 2RKSA 4ODGA 5D3IB 1SDFA 2NN6G 3MA2B 4PMWA 3BZDB 2X6GA 4DNTB 4V0BA 1EIHA 4BS9A 3TP5A 4XQJA 1WVLA 2K1BA 1PRTF 4FP5D 2E2HB 2EDGA 3S15B 3KK7A 1KDAA 3S1MB 4PMBA 1IYUA 1LTRD 1SNMA 4PNYA 1G91A 1X3QA 4L6TB 5IGGA 3L3OC 1CHQD 1BDOA 1Y8NB 3R2TA 3FPUB 3T53B 3X3NA 1B44D 1SEBD 2AQ3B 3Q22A 1ONLA 3K58A 3SK6A 3AMUA 2SNSA 3SK8A 1AZQA 1G8ZD 2RQXA 3ZYYX 2B2UA 2MPMA 1BNZA 4KD4A 5AFWA 5K36H 3T4AC 1B50A 3E0JA 1SE4A 3I4MB 1A6XA 4RGMA 1C8CA 4JK1C 3A8IE 3NUCA 1O78A 2F0NA 3S14B 2NVQB 3BDCA 1YNNC 4QIWB 3OIQA 1VMPA 4O1NA 2EY2A 4CKBA 3VYUA 1PFNA 1CA5A 2IW3A 3HGBA 2IWHA 4R8NA 4IQZA 1CTMA 3K0YA 3H91A 4X3TA 2PPBC 3H3VC 1EY0A 1EZ8A 1TQOA 1F9SA 2OXPA 1IL8A 2B2WA 3U9OA 3NPPA 1FNVA 1Q12A 2NWGA 1H9JA 1KLUD 3LNNA 4C1NI 2F0IA 3SR1A 2M9VA 3WOEA 3RUZA 1H9MA 3D6WA 3I90A 1AZPA 1T5XD 5CV9A 2JA7B 4A3KB 4IZ8A 5C5LA 5LL6X 2FJ2A 1IW7C 1LTAD 1UNSA 2NYZD 4XT1B 1LT6D 1ESRA 1STNA 2NVXB 3C46A 1IKMA 4DAYA 4B9WA 1IW7D 4RHRA 3J80E 3JAME 2X69A 3SEBA 2F0TA 2F0UA 3MZ5A 3CRKC 2XSCA 2EYPA 1KAAA 4TRDA 1A2UA 4I65A 3FPPA 3I70A 5ELCA 3C3LA 2JXMB 5J1ZA 1EQTA 1XWEA 1ILPA 2G9DA 2A69D 1WTXA 3MAQA 3RMHA 2QEJC 2XWBB 1XYIA 1JOOA 5IGCA 2BA1A 4XT3B 1SNQA 2XRSD 5JVH3 4NP5A 2EYOA 2BDOA 1SE3A 3S9WA 1L0YB 5ISRA 2L55A 3K57A 3MXUA 3PUXA 1SNOA 1FYCA 1Y1VB 2L11A 3Q0AA 3DEOA 3HOWB 3NWSA 2PCFB 4YIJA 2E2IB 5FO7B 1QCBD 1Z6HA 1TWHB 1Q90A 4C3HG 3ERQA 5FOBB 4BA2I 1KDBA 1G291 2N55A 2HUGA 5G3LD 1DM0B 2VB3X 2PQEA 2KOLA 2AUKA 4FYDA 2NTTA 1Q3LA 4HCEA 5KRUA 2L5TA 1LLRD 1U4MA 2J0TD 2R6GA 2K05A 1XXGA 3A55A 2CW0D 5A2QE 5J39A 2WV6D 3BYYB 4C3JB 3NE5B 5BN5A 2DY8A 4FF1A 3DXJC 4C3IB 5I2YA 1EWHA 3A56A 1PZKD 3JAML 1HRJA 4RCOA 2Z8LA 4NW2A 1WTQA 4OHJA 2A5HA 4WORA 5C0XI 5JEAH 2B2WC 2L0CA 4A3BB 2EPBA 5CV8A 2SNMA 5FO9B 1EY7A 4F87A 2JA6B 2AWOA 1EY4A 2EYLA 4OIJA 4ZKCB 1LABA 5CV6A 1SXTA 1A15A 3HP3A 2K01A 4JBWA 1Z47A 3BVMA 3MC0B 1M4VA 3W3AA 3PIO3 4KKUA 4XYOA 5CBAE 3VA5A 3SXHA 4DXGA 4ILWA 2O4XA 1SFOB 1LT3D 2KCCA 2F1MA 2N88A 4RFBA 5IGFA 3TN2A 5EKLA 1PRTD 5CGKA 4CKCA 4K8IA 1CK1A 3HOUB 2F0VA 3NQIA 2BDNA 4L8JA 2F3VA 3J81E 1RODA 3MTSA 4LJZC 4EQPA 1DJRD 3HOVB 1JOKA 4RH6A 2HCIA 4B08A 5C0XJ 5JVG3 1ZYRD 3MXNA 1G2SA 4A3GB 3NTIA 1I4HA 3KLSX 4RGOS 3QB3A 2EY6A 3RZOB 1STAA 3RZDB 4K5XA 3UI2A 3NP8A 3VR3A 1VDZA 1WTVA 3VR2A 3R93A 1SYDA 3A8KE 1HTLD 1SMYD 1I4XA 1DOLA 5EJWA 1MBYA 4K6LA 2F0WA 5E3FA 5M3FB 2MUYA 5K36G 1TY0A 5C3XA 3AB9A 3WOFA 4ZYSA 2K5QA 5IOCA 1EZ6A 3K5MA 5COYA 1K8OA 2K04A 5EKIA 1BOSA 1FNUA 3EA6A 1UUPA 4HR7B 4KJNA 1ENCA 1B53A 3J80L 5HURA 1JCKB 1KNEA 4QMGA 4KI0A 2B2UC 2FINB 1V1PA 1LO5D 1R4QB 3O13A 2LFNA 3GD7A 4IUPA 1PLFA 3T56B 1D5ZC 2F0KA 2KCNA 5IODA 3P7JA 4ZKBB 3HOXB 1F9PA 4ME5A 5DM63 4J1MA 4C3JG 2AQ1B 4A3IB 4IN3A 1ZEQX 1GUOA 3OIPA 3QJYA 1F2ZA 3QWNA 4KKTA 2K32A 4RKBA 4EQOA 1GXDC 2KVMA 1SBBB 5F2DA 2TMPA 1TT2A 5C4JB 3OHXC 1HPCA 2F0DA 2Q8TA 1JR0D 3BDLA 2BCOA 2B2VA 1B1ZA 2J7ZA 4X3UA 4HN7A 5BN4A 2EZVA 3M3YB 2IX3A 2JP1A 4XYQA 4KTAA 2QDBA 1YNND 1STGA 3D4DA 1VF7A 1KTKA 5IGEA 1DONA 1HHVA 2C5CA 5EKKA 1BCPD 1W6KA 2K5WA 4I7ZC 3R8BA 4BBRB 3NSWA 4FVMA 2DNEA 3U9SA 2L9HA 2PZWA 1FR3A 1ICWA 3QG1A 4ZK9B 1R9TB 2FHTA 2RVLA 3L7ZC 1GHKA 5IGDA 5EBCA 1BCPC 1STYA 2QCPX 1J8IA 3J7AF 2DNCA 2I46A 2A68C 1WCMB 4HSVA 2LS01 2D9UA 3I91A 2KEEA 4RGTA 2CHBD 4P2CB 1AW7A 3T13A 4NDXA 3PO2B 2K5DA 3VYTA 1SE2A 2B2YC 4DFAA 1H9SB 4C1NK 1T5EA 2R92B 1PRTC 1MSHA 4OIKA 4H13C 4AYBB 5JJZA 1EEFD 4RWSC 4KD3A 3KLSA 1JORA 1V8QA 3KF8A 2RDGA 3R3OA 1CHPD 4LAAA 4KMUC 4C56C 1FGBD 3RLFA 5C0XG 4PQXA 1DZ1A 3T51B 1D5MC 4QUFA 4F8MA 4XXEA 2XIWA 2A69C 3LX0A 3BVGA 3BVZA 1RF2D 3GTPB 3K5LA 2Q8RE 1SSOA 3T16A 1OXUA 3PUWA 1EL0A 1B2TA 5FLXL 1PXUA 3VR6A 1S5BD 1TS3A 3MHBA 4C2MB 5M9OA 4XIGS 1H9KA 2E76C 5D3DA 4UAIA 5JPNC 1JE4A 5ELBA 2D62A 3D8GA 2F3WA 2M00A 4KN7C 3R2IA 1RTOA 2ZT9C 3OWEB 3D6CA 5A2QL 1IKLA 3M4OB 4J8QA 1AP0A 1GUWA 3VYRA 3CHBD 4PV1C 1CT1D 1E2WA 1SNPA 3DHQA 1DOMA 1IYVA 2RSNA 3PUYA 1OXSC 5TSSA 3TP6A 4M1UB 3HEJA 4KY7A 1TS2A 1ET9A 1C48A 4CBVA 3FMCA 1E2VA 3C2PA 4A3JB 4TQUS 2ICEC 1HFGA 2WACA 1PTOC 1MD2D 2H1EA 3E6ZX 2EY1A 1LTID 4X3SA 4FF4A 1KLGD 3K7AB 1Q1BA 3ITPA 3OPOA 4TSSA 1L0XB 4IUVA 1S5CD 2XNAC 3M85A 1MI2A 1JICA 1LT5D 1CZWA 3TZDA 2PW7A 1SAPA 1V1PB 2MHVA 4KN4C 4N9PA 3BDOA 4ULLA 5EPLA 3GTMB 4O42A 4EQNA 2E2JB 1AEXA 1EY8A 4HMJA 3FVQA 1EU4A 2R3ZA 2KUMA 5ELFA 3I72A 5DAUA 1G2TA 3NWTA 2SOBA 1BUVT 2EVBA 1FNWA 2F03A 1BQQT 1DOKA 4IUUA 5C0XH 5DNFA 1B9NA 1TS4A 2IPKD 3KBXA 1TIID 2KECA 1TY2A 2EXZA 3PIP3 3N6RA 1PFMA 3D4WA 1EY9A 4QF4A 2IX1A 1RTNA 1O7LA 4HTHA 2D2CC 3M7GA 4TKOB 1PFBA 5CBEE 1Y69U 3URYA 4R9WA 4FXKC 1EWCA 4K2LA 1LT4D 1KNAA 2Y0SB 1K83B 1D5XC 5C5MA 1DCZA 4H44C 3TP7A 5CV4A 4C3HB 4IUTA 5CMDA 5IT9E 1QG7A 2K6AA 2OEOA 4A3EB 2PZUA 3HZXA 2CQAA 4XQNA 4KHVA 2HCCA 5CV7A 4CJ2C 1WD0A 5JEAJ 3NQTA 3I4NB 1LTBD 4IUNA 3Q6SA 1K8MA 1QWYA 3D4RA 3IFDA 4MHEA 1SMYC 3VR4A 1PTOD 2SDFA 1KABA 2NB0A 2O5JC 2O2LD 2Z1CA 1Q8IA 2BOSA 3DWAA 3I8ZA 3S1RB 2JA8B 4UDUC 1Y1WB 3MXPA 3DEPA 3MEHA 3GTQB 2KEDA 1I4PA 4BY7B 1B9MA 4BBSB 2NN6I 4ZQ3A 5M5XB 1HFNA 1Y8OB 1II3A 1OXXK 4DK0A 4ID6A 2I07B 2V4DA 2JYOA 2PMZB 3S16B 1MSGA 2L12A 5C44B 1LTSD 3S17B 3TSSA 2KHSA 1CFMA 1H9RA 1WTRA 1BO0A 3GP7A 2EOTA 5KYLA 2B63B 3IAYA 1U4RA 1UEAB 3IL8A 4CJ1B 2F0QA 4K5WA 2BE5D 3V2TA 2E2DC 3ND8A 4G7HC 5EPKA 4J6HA 1TKWB 1D2BA 2LMCB 1BBXC 4ZAIA 3TMEA 5KNDA 3DM1A 1G6ZA 3S1QB 5G3LF 1EYAA 1PMRA 1A3UA 4CGYB 3G6JB 4IUQA 3VR5A 2EYJA 2H4OA 4XTCS 1SYFA 3MVVA 2AUJD 1OO9B 4KHZA 2MP1A 1TWCB 2HDLA 1TS5A 2NBFA 5KYIA 1TR5A 1PDQA 2AWNA 4KKSA 4ZRZA 4NMZA 5NUCA 3DWQA 1LACA 1TWFB 1DYQA 2RA4A 2K33A 2NVTB 3H6MA 1V43A 2IT1A 2LY7A 2EJFC 3TZUA 2C9OA 5C6AA 4CKEA 3GTGB 4RCNA 2NVYB 3Q24A 2RSOA 2RDFA 2WINB 4RAUC 3QO2A 1WD1A 2XVSA 1GUTA 2PZTA 2Q8IB 3BS1A 1ZKOA 4G7ZC 4CJ0B 3BYTB 1I50B 2PYKA 1CA6A 3SE0A 1A2TA 3NBIA 2A6EC 2F0JA 3K6OA 4XQQA 4IFDH 5KIXA 3GO5A 2MJ8A 4U673 3PO3B 2MGSA 4E6IA 3EQLC 1DD2A 2WKCA 3K5OA 2KQ3A 3H94A 2OT2A 3FRPB 5D65A 1ESFA 2B2TC 5DM73 4CHTB 2EYFA 4IURA 2FFKB 1YNJC 1S4ZA 3V05A 3NXWA 5C4ZA 3NHHA 1PZJD 5C3EB 2A73B 1JWMD 2ID0A 1MGSA 5E4XA 2B39A 3L9AX 1HUNA 4WFN3 1BR9A 1PTOB 2GA4B 1ILQA 1F9RA 1QB5D 2WP8J 3RD4A 5FO8B 3EVQA 1GUNA 1ZXTA 2EJGC 1SYCA 1EEID 2XWJB 3GQBA 4RA8A 1SYGA 4GZYC 2HQEA 2WAQB 5I2XA 2DY7A 4X3KA 4LK1C 2PNRC 1X3PA 1HXYD 2M2LA 4DAPA 1IHZA 5FK9C 3OOCA 5KGUA 3A7AB 1AFPA 1E2ZA 1PYWD 3ND9A 2ZXRA 5J22A 2L1BA 2VB2X 2B2TA 5E4WC 3GTOB 2ZXPA 4IFDI 1SNDA 4FF2A 5M5YB 4DU9A 1CZGA 1FD7D 3I3CA 2SEBD 2CVRA 3SVMA 1DXMA 5A35A 3OW7A 1QE6A 3OWFA 2Z4IA 2JEBI 1EQVA 1CI3M 4H0LC 4KV6A 2CW0C 5IGBA 4DAVA 4ZUIA 3PV0A 3CKIB 4QUCA 1AN8A 1NR4A 2G9HD 1HTPA 4FXGC 3QIAA 2JEAI 5CV5A 1ENFA 5T1IA 4DXFA 3A7LA 5T1GA 3TDQA 5M3MB 1HA5A 1S5FD 5CYUA 2WIIB 3HOZB 3NBHA 1RKNA 1ENAA 3VYSA 4HEDA 4MIUA 4RKLA 1NSNS 4A3MB 3EJIA 3H0GB 2EJMA 2K7VA 1NUCA 1JOQA 2NTSA 2K03A 1RD9D 1QJOA 1JC7A 2D5DA 2BE5C 4DN4M 3KBGA 3K59A 3P75A 4K2KA 1VMCA 2F0GA 1QOHA 1I6VC 2WB1B 5EQ0A 1PTOH 1V1OA 3I4LA 1STHA 4EVOA 5LHY1 1TVXA 1QNKA 4K5VA 3J81L 1O7ZA 3PUZA 3G7LA 2A68D 1W6JA 1VCIA 1Y8PB 5I4DA 3W2DA 1ML0D 2ENBA 5ELDA 4A3FB 1HA6A 3SK5A 3J7YW 4Q5VA 3S2DB 4ZUJA 5I9PA 3GV6A 1I4GA 2XN9C 4PMCA 1HCZA 1RCVD 1E0BA 2HDMA 3C1FA 1CQVA 3P1HA 3GTKB 1U4PA 3QOLA 3FDTA 3GV3A 3CRLC 1GUSA 1I4RA 2LKVA 2YU9B 4F7XA 1TU2B 4Z9CB 1H9SA 4G7OC 4BWGB 5JPMC 1WTOA 2J4XA 4K14A 3P20A 1UAPA 5C4HA 4HCSA 1EU3A 4XDXA 1STBA 2R61A 5EGTA 3NTKA 1D1IA 1A3VA 3X3MA 1WTWA 1JQYD 1XX8A 3H09A 4BA1I 1Q1EA 3GTJB 2B2YA 3IFTA 2QF7A 1RJTA 1EYDA 3CU7A 1S5DD 3MWYW 4Q0FA 2E74C 4WJWA 3M4YA 4S3SA 2F0OA 4R8IA 4KY6A 5C4XB 2DN8A 4DA2A 1A3TA 4HMIA 3EROA 1BXTA 1C4QA 3MFYA 2A74C 3N52A 5KNCA 3CQZB 1U4LA 4DF7A 4HAEA 1S5ED 5BN3A 5ELEA 2NUCA 3F2UA 1F77A 1HUMA 2F0FA 4C3IG 2F0SA 4DGZA 3DUZA 3OMCA 1R4PB 2KA7A 4ABNA 5D14A 5JOBA 1U9RA 2A6ED 3PMFA 3C1EA 2QILA 1D1KA 4OGQC 4M8AA 3HRZC 2FMMA 1EIGA 3MXGA 3FEWX 5I6WA 4EGVA 2EE1A 4RGNA 5HGTA 2KJXA 3M7NA 4KJOA 1OXVA 2PW5A 2IJ0A 1ZYRC 2RBMA 4IFDG 4OO1I 3Q23A 3WDNA 1STEA 3HOYB 2EYMA 1HQRD 1EY5A 5DEHA 4FO2A 4LMQD 2VXWA 5FKAC 2K28A 4WRDA 1B4OA 1WTPA 3TBIB 2VNUD 1SJED 1XTCD 1PRTB 4L63B 1QILA 1JWUD 2JSOA 4DNRB 3SK4A 4KY5A 4QCLA 1BCPB 1GHJA 3OSOA 2BA0A 3D3RA 4F88A 3HG9A 5KNBA 2IL8A 3HS0C 4MN3A 1ET6A 1OXTA 1F2LA 3NTHA 1LV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PLF A;  5D14 A;  1IKM A;  1DOK A;  1RTO A;  2RA4 A;  1ZXT A;  4IUU A;  1Q3L A;  3P7J A;  1NCV A;  1U4M A;  2X6L A;  4ZKB B;  2HCI A;  3I8Z A;  4HED A;  5DNF A;  1F9P A;  1IKL A;  2X69 A;  1AZQ A;  4RA8 A;  3KBX A;  2K05 A;  1AP0 A;  1BF4 A;  2B2V C;  2B2Y C;  2KEC A;  1GUW A;  2B2U A;  1RHP A;  2DY7 A;  4X3K A;  1G2S A;  2MPM A;  1BNZ A;  2FMM A;  3DEP A;  2RSO A;  1B3A A;  1X32 A;  2DY8 A;  1MSH A;  1X3P A;  1EIG A;  2M2L A;  3LWE A;  3QO2 A;  1DOM A;  1O7Y A;  1PFM A;  4OIK A;  4RAU C;  4U68 A;  5AFW A;  1WD1 A;  2NZ1 D;  2RSN A;  5JJZ A;  2KED A;  2EE1 A;  2K03 A;  1B50 A;  4HCS A;  1HRJ A;  4XDX A;  4RWS C;  1F9Q A;  1HFN A;  3UI2 A;  4NW2 A;  4CJ0 B;  5EPJ A;  3KUP A;  1WTQ A;  1RTN A;  2KVM A;  2L4N A;  1EQT A;  4DN4 M;  1ILP A;  1WTV A;  1HFG A;  2Q8T A;  1C8C A;  2JYO A;  1CM9 A;  3R93 A;  1WTX A;  2B2W C;  1WTW A;  1CA6 A;  2EPB A;  1MSG A;  2L12 A;  2L1B A;  1XX8 A;  1PFB A;  2B2V A;  1VMC A;  5CBE E;  2B2Y A;  1DOL A;  2B2T A;  5E4W C;  1XYI A;  1NR2 A;  4R9W A;  1WTR A;  1VMP A;  2J7Z A;  1RJT A;  4X3U A;  1BO0 A;  5EJW A;  1WTO A;  4XT3 B;  5EQ0 A;  1DZ1 A;  2H1E A;  4QUF A;  2EOT A;  1PFN A;  4OIJ A;  4ZKC B;  3MWY W;  2VXW A;  4LMQ D;  1CA5 A;  1SDF A;  1KNA A;  1A15 A;  4X3S A;  1U4R A;  2JP1 A;  3HP3 A;  3IL8 A;  1O80 A;  3H91 A;  2K01 A;  2K28 A;  2XIW A;  3I3C A;  4X3T A;  1TVX A;  4CJ1 B;  3ONA B;  2MJ8 A;  1B4O A;  4ZLT F;  2CVR A;  3SVM A;  1WTP A;  1QNK A;  2MGS A;  1J9O A;  1O7Z A;  2X6G A;  4R8I A;  3G7L A;  5CBA E;  4IUV A;  5EPK A;  1QE6 A;  1F9S A;  1EIH A;  1DON A;  1IL8 A;  1NAP A;  2B2W A;  1MI2 A;  5COY A;  2Q8R E;  1HHV A;  1SSO A;  1JIC A;  1WVL A;  2K04 A;  2K1B A;  4IUT A;  5EKI A;  5CMD A;  5D65 A;  1ML0 D;  1BBX C;  2B2T C;  2L11 A;  3TZD A;  2NWG A;  1QG7 A;  4ZAI A;  1HA6 A;  1M8A A;  1SAP A;  3DEO A;  3DM1 A;  1G6Z A;  2L9H A;  2N88 A;  4IUR A;  1B53 A;  2FFK B;  1ICW A;  5COR A;  4ZK9 B;  3TN2 A;  1S4Z A;  3N52 A;  1B2T A;  1EL0 A;  3D6W A;  3GV6 A;  4QUC A;  2FHT A;  2RVL A;  3I90 A;  1AZP A;  5EPL A;  1U4L A;  1NR4 A;  4IUQ A;  1G91 A;  2HCC A;  1WD0 A;  4HAE A;  4O42 A;  1X3Q A;  4CJ2 C;  1J8I A;  1MGS A;  3F2U A;  5E4X A;  1EOT A;  1KNE A;  1HUM A;  4HSV A;  3Q6S A;  1E0B A;  2MP1 A;  5T1I A;  2BDN A;  1HUN A;  2B2U C;  2D9U A;  2HDM A;  2IL8 A;  2R3Z A;  2KUM A;  3GV3 A;  3FPU B;  3I91 A;  2HDL A;  2FJ2 A;  2FIN B;  3IFD A;  1U4P A;  4MN3 A;  2KEE A;  1G2T A;  4UAI A;  5T1G A;  2N55 A;  4MHE A;  1F2L A;  2NYZ D;  3FDT A;  1ILQ A;  4XT1 B;  1PDQ A;  1JE4 A;  1ESR A;  1F9R A;  2HUG A;  1ROD A;  3MTS A;  2SDF A;  4IUP A;  2KOL A;  1LV9 A; 
#chains in the Genus database with same CATH topology
 2AQ2 B;  4Y7N B;  5IP7 H;  2F0E A;  4LFC Q;  2QKI C;  5C3E G;  1Q8K A;  1I4Q A;  1YHQ A;  3MFG A;  4LFB Q;  3I4O A;  1I6H B;  4N9T A;  5I6Y A;  1NCV A;  2Z4H A;  2NN6 H;  2X6L A;  3D31 A;  3GTL B;  2IX0 A;  3S24 A;  3OMG A;  3LGJ A;  1F2M A;  1YHB A;  2B8G A;  5M5W B;  1EY6 A;  1TWG B;  2B2V C;  2EYH A;  2TSS A;  5E1F A;  2A6H D;  3HKZ B;  1RHP A;  1GOZ A;  3SHL A;  1X32 A;  3LWE A;  4U68 A;  5LL6 S;  1O7Y A;  2Q2H A;  1HR0 Q;  4OEL B;  2F0H A;  4A4I A;  5IYC G;  1SYE A;  3F1Z A;  4FXD A;  3PUV A;  2WAQ E;  4DV1 L;  4IFD J;  3U50 C;  3KUP A;  1LTT D;  2IY5 B;  4K6D A;  4DK1 A;  4YHH Q;  5FLX E;  1O7I A;  3SDZ A;  1CM9 A;  1CQF A;  4KK7 A;  2R7Z B;  3K5N A;  2GN5 A;  2E5L Q;  1D6E C;  1NR2 A;  2OF1 A;  4QQB X;  5JEA G;  2E75 C;  3IKJ A;  1SJH D;  2MFI A;  4K0K L;  2H5X A;  1PTO F;  2A1A A;  1HQM C;  3NK9 A;  5C3E H;  3A5U A;  2PO4 A;  2RDH A;  1O80 A;  1TWA B;  2IHE A;  4H7B A;  4DPG A;  4OO1 H;  5K5P A;  3ONA B;  4ZLT F;  2JA7 G;  1RDP D;  1J9O A;  3HOW H;  2B8F A;  2R93 B;  5CC4 A;  2QGQ A;  1YNJ D;  4GNX A;  2C35 B;  2O5I C;  1NAP A;  1EYC A;  1C7Y A;  2YYZ A;  1ASY A;  1F2Y A;  4OL7 A;  3J7A V;  1GJX A;  2KEN A;  1M8A A;  2A6H C;  1I3Q B;  4G4K A;  1LTG D;  1Y14 B;  5COR A;  1EFI D;  2ICI A;  5JAV A;  3TP8 A;  3V96 A;  2OQ0 A;  3AU7 A;  1SLJ A;  5M5W H;  4BY1 B;  1SYB A;  4NKL A;  4GN3 B;  1BCP F;  4RG1 A;  1FVI A;  1EOT A;  3HOX H;  4B9X A;  2JA5 B;  2VUM B;  2JE6 I;  1K0R A;  2AKW B;  1JB3 A;  3LWU A;  1K8G A;  3S1Q H;  4G57 A;  3FKI B;  3STB C;  4C3H H;  4K8J A;  4A3J H;  2ZM6 Q;  3KLR A;  1FL0 A;  4BY7 H;  4V19 0;  4OO1 G;  1GUG A;  1TWC H;  5C4X H;  4A3D B;  2F0L A;  1HNZ Q;  3S2H B;  3W1G A;  2FMC A;  5IIF A;  1KDC A;  2XRQ D;  4A93 B;  1BF4 A;  5EBD A;  2ZXO A;  4JI0 L;  3DWP A;  5IT9 L;  4CDC C;  3E5S A;  4B3M L;  3A8J E;  4GKJ L;  1Z7T A;  1B3A A;  3I73 A;  3K7A H;  4FF3 A;  4RHS A;  3CME A;  3S1N B;  2NZ1 D;  2WKD A;  5CR3 A;  2EY5 A;  3EFX D;  2PQA A;  2F4I A;  4UP7 A;  2HIX A;  3BG3 A;  2F0M A;  1F9Q A;  5C3W A;  1MHW C;  5EPJ A;  2L4N A;  4QB4 A;  4DV6 L;  3QOJ A;  4IAL A;  1SNC A;  1VF5 C;  4FNF A;  3DMU A;  4HSP A;  5KEE A;  3OTO Q;  4IO9 A;  4B3R Q;  1QNU A;  4DAM A;  3A54 A;  3HOZ H;  4GOP A;  1SR3 A;  3VA7 A;  2R92 H;  5I9O A;  3HOV H;  3GDE A;  4JBJ A;  1BBU A;  1PZI D;  1QZH A;  2F0P A;  2I0Q A;  3CMA A;  2UU9 Q;  1JJC B;  1JWS D;  2RKS A;  4ODG A;  4LW1 A;  3A74 A;  5D3I B;  3TS0 A;  1SDF A;  1K3B C;  1PV4 A;  2NN6 G;  3MA2 B;  4PMW A;  3BZD B;  5ELO A;  2X6G A;  4DNT B;  4V0B A;  3GTL H;  4BS9 A;  1EIH A;  4P73 A;  4JBK A;  3TP5 A;  4XQJ A;  1WVL A;  2K1B A;  1PRT F;  5LMU Q;  4FP5 D;  2E2H B;  4AQY Q;  3PGZ A;  1TWH H;  2EDG A;  4DR3 L;  3S15 B;  3KK7 A;  1KDA A;  1SE8 A;  3S1M B;  4JI4 Q;  4IOC A;  4PMB A;  1IYU A;  1LTR D;  1SNM A;  4PNY A;  4RMF A;  1G91 A;  1X3Q A;  3F2C A;  4L6T B;  5IGG A;  3L3O C;  1CHQ D;  1BDO A;  1Y8N B;  3R2T A;  3FPU B;  1UE6 A;  5IP9 H;  3T53 B;  3X3N A;  1B44 D;  1SEB D;  1G51 A;  2OCE A;  4JPB W;  1K3R A;  3RLN A;  2AQ3 B;  2QDL A;  4DUY Q;  3Q22 A;  4HJ5 A;  1ONL A;  3K58 A;  3SK6 A;  3AMU A;  2SNS A;  3SK8 A;  1AZQ A;  3GTP H;  3I4N H;  1G8Z D;  3KF6 A;  3JC6 6;  3GTJ H;  2RQX A;  3ZYY X;  2B2U A;  4P71 A;  4DV0 Q;  1FGU A;  2MPM A;  1BNZ A;  5HY6 A;  4P72 A;  4OEM B;  4KD4 A;  1E1O A;  1J6Q A;  5AFW A;  5K36 H;  2ASB A;  3T4A C;  1E7Z A;  1B50 A;  3E0J A;  1SE4 A;  3I4M B;  1A6X A;  1NJI C;  4JI3 L;  4PG3 A;  3UDX A;  4RGM A;  3KDF B;  1UE7 A;  2ZJP A;  3K0X A;  4QGU A;  1C8C A;  3PO2 H;  4JK1 C;  1VQG A;  3HOV G;  3A8I E;  5FLM G;  3NUC A;  1O78 A;  2F0N A;  2NZH A;  3S14 B;  1XNQ Q;  2NVQ B;  3BDC A;  3CPW A;  1YNN C;  4GN4 B;  4QIW B;  4DV5 Q;  3OIQ A;  1VMP A;  4O1N A;  2EY2 A;  2UXC L;  4CKB A;  3VYU A;  1PFN A;  2IW3 A;  3K81 C;  1CA5 A;  3HGB A;  2IWH A;  2ZTC A;  4R8N A;  4IQZ A;  1CTM A;  3CQZ H;  3HFZ B;  3K0Y A;  3H91 A;  4X3T A;  2PPB C;  3H3V C;  1EY0 A;  1U0L A;  1EZ8 A;  3CCE A;  1TQO A;  1F9S A;  2OXP A;  1IL8 A;  2B2W A;  3U9O A;  4B3T L;  3J81 c;  3NPP A;  3H3V I;  1FNV A;  2DJG C;  1Q12 A;  2NWG A;  1H9J A;  1KLU D;  3LNN A;  4DK3 C;  4C1N I;  4C3I H;  2F0I A;  3SR1 A;  3CCM A;  1YI2 A;  2R7Z G;  1PYS B;  2M9V A;  3H3V H;  4I7A A;  2WFW A;  3RUZ A;  3WOE A;  1C0A A;  1H9M A;  3D6W A;  4AIM A;  3I90 A;  4DV5 L;  1AZP A;  1T5X D;  1PH3 A;  3KJP A;  5CV9 A;  2JA7 B;  4A3K B;  4A3K H;  4IZ8 A;  5HGQ A;  3JAM i;  4DV2 L;  5C5L A;  5LL6 X;  2QEX A;  1J5E Q;  2FJ2 A;  1IW7 C;  1LTA D;  1UNS A;  2NYZ D;  4XT1 B;  4LFB L;  1LT6 D;  3PF5 A;  1ESR A;  2RCF A;  4X62 L;  1Q7Y C;  1STN A;  4NPS A;  4BBR H;  3HOW G;  2CH4 A;  2NVX B;  2FXQ A;  1A63 A;  3C46 A;  1IKM A;  4DAY A;  1OTC A;  4B9W A;  3AFQ A;  2XGT A;  1IW7 D;  2VQE L;  4RHR A;  3J80 E;  3JAM E;  1WFQ A;  2X69 A;  3SEB A;  2F0T A;  2F0U A;  3MZ5 A;  3CRK C;  4HID A;  2XSC A;  1N33 Q;  1P8L A;  2EYP A;  1KAA A;  3UE0 A;  3OW2 A;  4TRD A;  1B70 B;  2EQS A;  1A2U A;  1SRU A;  5FLX c;  4I65 A;  2KCM A;  3FPP A;  2D0O A;  3I70 A;  1E1T A;  5ELC A;  3C3L A;  2JXM B;  5J1Z A;  4OX9 L;  1EQT A;  1XWE A;  1ILP A;  2G9D A;  4A75 A;  4LF7 Q;  2A69 D;  1PA6 A;  1WTX A;  2OTL A;  3MAQ A;  4JI2 L;  3RMH A;  4PZ8 A;  1DGS A;  2QEJ C;  2XWB B;  1XYI A;  1JOO A;  1AE2 A;  5IGC A;  2BA1 A;  4XT3 B;  3AEV A;  4Y52 H;  1SNQ A;  2XRS D;  3I7F A;  5JVH 3;  1N34 Q;  1YHA A;  1PH5 A;  4NP5 A;  4X66 Q;  2EYO A;  2BDO A;  1SE3 A;  3S9W A;  1L0Y B;  2WB1 E;  4C3J H;  5ISR A;  2L55 A;  1KC8 C;  4JYA Q;  3K57 A;  3MXU A;  5LMU L;  1B3Q A;  1UE5 A;  3PUX A;  1SNO A;  1FYC A;  1Y1V B;  2WAQ G;  3RZO H;  2L11 A;  3Q0A A;  1VQC A;  3DEO A;  3HOW B;  3NWS A;  1HNX L;  2PCF B;  1CSQ A;  3J7Z C;  3RZD H;  4YIJ A;  3GTG H;  2E2I B;  5FO7 B;  1QCB D;  1Z6H A;  1TWH B;  1Q90 A;  1PFS A;  4C3H G;  4BY1 H;  3ERQ A;  1FJG L;  5FOB B;  4BA2 I;  1KDB A;  1G29 1;  3W5O A;  2N49 A;  2N55 A;  3T1Y Q;  2HUG A;  2RHS B;  1JB7 A;  5G3L D;  1DM0 B;  2VB3 X;  1AE3 A;  2PQE A;  2KOL A;  2AUK A;  4FYD A;  2N8N A;  1RIP A;  2NTT A;  4R4O A;  4LF5 Q;  3M3Y H;  1Q3L A;  4HCE A;  3Q8D A;  2UXD L;  5KRU A;  2L5T A;  4JI0 Q;  3ER0 A;  1LLR D;  1U4M A;  2J0T D;  5M3M H;  1L1O A;  2R6G A;  2R7D A;  1IBL L;  2K05 A;  1XXG A;  3A55 A;  2N3S A;  2CW0 D;  5A2Q E;  5J39 A;  2WV6 D;  3BYY B;  3ZJY C;  4C3J B;  5M5Y H;  3NE5 B;  5BN5 A;  2DY8 A;  4FF1 A;  3DXJ C;  4C3I B;  1XNQ L;  5I2Y A;  2VW9 A;  4UP8 A;  1EWH A;  3A56 A;  1PZK D;  3JAM L;  1HRJ A;  4RCO A;  2Z8L A;  4NW2 A;  1WTQ A;  5C44 H;  4OHJ A;  2A5H A;  1N36 Q;  4WOR A;  1I6H H;  5C0X I;  5JEA H;  4JYA L;  2B2W C;  2L0C A;  4A3B B;  2EPB A;  5CV8 A;  2SNM A;  5FO9 B;  2HD3 A;  4DR6 L;  1EY7 A;  4F87 A;  2JA6 B;  4DV3 Q;  2AWO A;  1EY4 A;  2EYL A;  4OIJ A;  1HZ9 A;  1LAB A;  5E7N A;  3NEN A;  5CV6 A;  4LFC L;  4ZKC B;  1SXT A;  1A15 A;  1Y1V G;  3HP3 A;  2K01 A;  4JBW A;  1Z47 A;  3BVM A;  3MC0 B;  4H02 A;  1M4V A;  1NMG A;  4YCV A;  3W3A A;  3PIO 3;  5BR8 L;  4KKU A;  4XYO A;  5CBA E;  3VA5 A;  4DR3 Q;  3SXH A;  4DXG A;  4ILW A;  2ZTE A;  2O4X A;  3NEM A;  1VQ6 A;  4L5R C;  1SFO B;  2G5D A;  1LT3 D;  4Y7N H;  4JV5 L;  1KHI A;  2KCC A;  2F1M A;  1J5E L;  3CPF A;  2EXD A;  2N88 A;  4RFB A;  2I5H A;  1GM5 A;  5IGF A;  3TN2 A;  5EKL A;  1PRT D;  5CGK A;  4CKC A;  4K8I A;  1CK1 A;  3HOU B;  2F0V A;  3NQI A;  2JA6 H;  4A3F H;  2BDN A;  1NMF A;  4L8J A;  2F3V A;  4AQY L;  2JA6 G;  3J81 E;  4NXM L;  2Z9H A;  1ROD A;  3MTS A;  4GKK Q;  4JI8 L;  4LJZ C;  3G6E A;  4EQP A;  3TS2 A;  1DJR D;  3HOV B;  2JA5 G;  1EIY B;  1QVG A;  1JOK A;  1VQF A;  4RH6 A;  2HCI A;  4B08 A;  1EWI A;  4OWT B;  4JC0 A;  1XNR L;  5C0X J;  3J7A 5;  5JVG 3;  3UDG A;  1ZYR D;  2NZO A;  3MXN A;  1HH2 P;  1G2S A;  4A3G B;  3NTI A;  1I4H A;  3KLS X;  1I94 Q;  1YIJ A;  4RGO S;  3QB3 A;  2EY6 A;  3DLL A;  3RZO B;  1STA A;  4DK6 C;  3RZD B;  1ASZ A;  2JK8 A;  4K5X A;  2Q2T A;  3UI2 A;  3NP8 A;  3VR3 A;  1VDZ A;  5IE8 A;  1WTV A;  2YTX A;  4GNX B;  3VR2 A;  3R93 A;  1SYD A;  1SN8 A;  3A8K E;  4A3C H;  1HTL D;  3TEH B;  1KIX A;  4YY3 Q;  5FLM H;  1SMY D;  1I4X A;  4A3M H;  1DOL A;  1CKO A;  3E3X A;  5EJW A;  1MBY A;  1EYG A;  4K6L A;  4J15 A;  3CXC A;  4JI7 Q;  2F0W A;  1X6O A;  5E3F A;  5M3F B;  2MUY A;  5K36 G;  1TY0 A;  3PQI A;  5C3X A;  3AB9 A;  4B3T Q;  1GD7 A;  3WOF A;  4ZYS A;  3CC4 A;  2K5Q A;  5IOC A;  4APV A;  5IYB H;  1EZ6 A;  3K5M A;  5COY A;  1K8O A;  2K04 A;  5EKI A;  3I4N G;  1BOS A;  4DUZ Q;  4A76 A;  3KFU A;  1M1K C;  2HIV A;  1FNU A;  3EA6 A;  1UUP A;  4HR7 B;  1Q82 C;  4KJN A;  1ENC A;  4JI8 Q;  1B53 A;  2MNA A;  4JI5 Q;  1JJG A;  1YJW A;  3J80 L;  5HUR A;  1JCK B;  1VQL A;  4UPA A;  3AFP A;  3HKS A;  3BJU A;  4LUO A;  1KNE A;  1VQO A;  4QMG A;  1ICF B;  5IP9 G;  4IPH A;  4KI0 A;  3J80 i;  4R4T A;  4BY1 G;  2B2U C;  4UY8 C;  2FIN B;  1V1P A;  1LO5 D;  1R4Q B;  1YZ6 A;  3O13 A;  2LFN A;  4DR7 Q;  3GD7 A;  4IUP A;  1UE1 A;  1PLF A;  3T56 B;  1D5Z C;  4O0A A;  2F0K A;  2KCN A;  2MQH A;  5IOD A;  1MJC A;  3P7J A;  1XMO L;  4QY7 A;  4ZKB B;  3HOX B;  3KF6 B;  1F9P A;  4ME5 A;  3OYY A;  5DM6 3;  4J1M A;  3PSI A;  4C3J G;  2AQ1 B;  4A3I B;  4IN3 A;  1ZEQ X;  4JI1 Q;  2ZJR A;  1GUO A;  3OIP A;  2VUM G;  3QJY A;  3QR8 A;  3G4S A;  2F3I A;  1F2Z A;  3QWN A;  4KKT A;  1SRO A;  2K32 A;  4RKB A;  4EQO A;  4JOI A;  1YJN A;  1GXD C;  2KVM A;  1EQQ A;  1D8L A;  1SBB B;  5F2D A;  2TMP A;  3CCR A;  4DV0 L;  1TT2 A;  5C4J B;  3OHX C;  1HPC A;  2F0D A;  2Q8T A;  4DR1 Q;  1JR0 D;  3BDL A;  4MZ9 A;  2BCO A;  2I5L X;  4OX9 Q;  2B2V A;  1IBM L;  4GKJ Q;  3FHW A;  1B1Z A;  2J7Z A;  4X3U A;  4HN7 A;  5BN4 A;  2VQF L;  2EZV A;  1WOC A;  3I2Z A;  1PH7 A;  3M3Y B;  2IX3 A;  3STB D;  2JP1 A;  2V1C C;  4XYQ A;  4KTA A;  2QDB A;  1YNN D;  1STG A;  4P74 A;  4N8X 1;  3D4D A;  4DV4 L;  1JE5 A;  1VF7 A;  1KTK A;  3UDI A;  5IGE A;  1DON A;  1L0W A;  5M5X H;  2C5C A;  1HHV A;  5EKK A;  1BCP D;  1HZA A;  1W6K A;  2K5W A;  4I7Z C;  3R8B A;  4FVM A;  3NSW A;  4BBR B;  5LMN W;  2DNE A;  3ULJ A;  2YU9 H;  3U9S A;  2DJF C;  2L9H A;  2PZW A;  1FR3 A;  1ICW A;  3QG1 A;  4ZK9 B;  1R9T B;  2FHT A;  2RVL A;  3L7Z C;  1GHK A;  5IGD A;  1PHJ A;  5EBC A;  1BCP C;  1STY A;  2QCP X;  1J8I A;  3J7A F;  2DNC A;  2I46 A;  1A8V A;  2A68 C;  1WCM B;  4HSV A;  1WYD A;  2LS0 1;  2QW7 A;  4DV7 L;  1PH9 A;  2D9U A;  3I91 A;  3TRZ A;  1L2F A;  2KEE A;  2D0P A;  3HOX G;  4RGT A;  2CHB D;  4P2C B;  1PH4 A;  1IL2 A;  1AW7 A;  3T13 A;  4NDX A;  1N32 Q;  4JOI C;  2OWO A;  3PO2 B;  2K5D A;  4IOA A;  3K80 C;  3VYT A;  4YY3 L;  1SE2 A;  3CAM A;  2B2Y C;  4POF A;  4DFA A;  1H9S B;  1LYL A;  3ULL A;  4C1N K;  2YV5 A;  1T5E A;  1A62 A;  2R92 B;  1PRT C;  1MSH A;  4OIK A;  4H13 C;  2Z6K C;  4AYB B;  5JJZ A;  1EEF D;  1N9W A;  1JJ2 A;  1NBW A;  5AJ3 L;  4GN5 A;  4KD3 A;  4RWS C;  3KLS A;  4LUV A;  1JOR A;  1V8Q A;  2PI2 A;  3KF8 A;  2F4V L;  2RDG A;  3R3O A;  3TRE A;  1CHP D;  1NNX A;  3S17 H;  4DV3 L;  2XTI A;  4LAA A;  4KMU C;  4C56 C;  5GAG C;  1FGB D;  1EUJ A;  3RLF A;  5C0X G;  4PQX A;  1DZ1 A;  1C9O A;  3T51 B;  3KJO A;  1D5M C;  4QUF A;  2Y0S G;  4F8M A;  1CKM A;  5M3F G;  1XPO A;  4XXE A;  2XIW A;  2A69 C;  4BBR G;  3LX0 A;  5IY0 A;  3BVG A;  3BVZ A;  2EIF A;  1RF2 D;  4JI5 L;  1KAW A;  3GTP B;  4JCV E;  1T9H A;  3K5L A;  2Q8R E;  1SSO A;  2DUD A;  4IJH A;  3T16 A;  1OXU A;  3PUW A;  2UXB L;  3DM3 A;  2K4K A;  4YWM A;  4CDE C;  2HQL A;  1EL0 A;  1B2T A;  5FLX L;  1HNW L;  4JV5 Q;  1WCM H;  1PXU A;  4DR6 Q;  3VR6 A;  1S5B D;  1TS3 A;  3MHB A;  4C2M B;  4HJA A;  1QUQ B;  4O2D A;  5M9O A;  4XIG S;  1H9K A;  2E76 C;  3MEF A;  1W3S A;  1NTG A;  5D3D A;  4UAI A;  1XMQ Q;  1M90 C;  1IBM Q;  3KYH C;  1X3G A;  5JPN C;  1JE4 A;  5ELB A;  5IYB G;  2RF4 A;  3MXN B;  2D62 A;  3D8G A;  4HJ7 A;  1HR0 W;  2F3W A;  2M00 A;  4JI6 Q;  4QJF A;  4MNO A;  2ALY B;  4KN7 C;  3R2I A;  1RTO A;  2ZT9 C;  3OWE B;  3D6C A;  5A2Q L;  5IT9 c;  1VQ9 A;  3U58 A;  1IKL A;  3M4O B;  4J8Q A;  3U4Z A;  1AP0 A;  4UHV A;  5L37 A;  2UUB L;  1GUW A;  3VYR A;  3CHB D;  4PV1 C;  1CT1 D;  1HZC A;  1E2W A;  1SNP A;  3CP0 A;  3DHQ A;  1DOM A;  3BZC A;  1IYV A;  2RSN A;  3PUY A;  3VDY A;  4A3I H;  1XPR A;  4LF4 Q;  1OXS C;  5TSS A;  3TP6 A;  4M1U B;  3HEJ A;  4KY7 A;  1TS2 A;  1ET9 A;  1C48 A;  4CBV A;  1HJP A;  3FMC A;  1E2V A;  3C2P A;  4A3J B;  4TQU S;  4A93 G;  2ICE C;  1HFG A;  4LF8 L;  4NXN L;  2WAC A;  1PTO C;  3GTK H;  3BZK A;  1X3F A;  2E5L L;  1HNW Q;  1MD2 D;  4DNI A;  2H1E A;  3E6Z X;  3H0G H;  2EY1 A;  1B8A A;  1LTI D;  4X3S A;  1AH9 A;  4FF4 A;  1WJJ A;  4X64 Q;  1KLG D;  2JA5 H;  3K7A B;  1Q1B A;  3ITP A;  3OPO A;  3S1N H;  4TSS A;  4JG2 A;  1L0X B;  4IUV A;  4X65 Q;  1S5C D;  3CD6 A;  3AYH B;  1R9T H;  1BVS A;  2K5V A;  2XNA C;  3M85 A;  1MI2 A;  3HOU G;  1JIC A;  1LT5 D;  1CZW A;  4YCW A;  1VQJ A;  1S3O A;  2BH2 A;  3TZD A;  2PW7 A;  1SAP A;  2CFM A;  1RL2 A;  1V1P B;  2MHV A;  4KN4 C;  4N9P A;  3BDO A;  4A3K G;  4GLX A;  4ULL A;  5EPL A;  2CWP A;  3H15 A;  1K8A C;  3GTM B;  4JBM A;  4O42 A;  1L1O B;  1Q86 C;  4EQN A;  2E2J H;  2E2J B;  1AEX A;  1EY8 A;  4HMJ A;  3FVQ A;  1EU4 A;  1A0I A;  4OWX B;  2R3Z A;  4LF7 L;  2KUM A;  5ELF A;  3I72 A;  5DAU A;  2Q2U A;  1G2T A;  3NWT A;  2UUC Q;  2SOB A;  4DUY L;  1BUV T;  2EVB A;  1S72 A;  1FNW A;  2F03 A;  3NBH B;  1BQQ T;  1DOK A;  4MTK A;  4DV6 Q;  3CC7 A;  4IUU A;  3ICE A;  2UUB Q;  5FJ8 G;  5C0X H;  5DNF A;  1HNX Q;  4HIK A;  1B9N A;  1TS4 A;  2IPK D;  3KBX A;  4NXN Q;  3HOU H;  1TII D;  2KEC A;  2F4V Q;  1TY2 A;  2EXZ A;  3HOZ G;  4B3M Q;  3PIP 3;  2JA8 H;  3TQY A;  3N6R A;  4PZ7 A;  2HHH L;  4YCU A;  1PFM A;  1GVP A;  3D4W A;  4HJ8 A;  1QZG A;  5C4X G;  4ZCK A;  1EY9 A;  2R7F A;  4PZ6 A;  4QF4 A;  2IX1 A;  1RTN A;  1N8R C;  5EAY A;  1O7L A;  4HTH A;  2D2C C;  4BXX H;  3M7G A;  2IHF A;  3KF8 B;  4TKO B;  4YHH L;  1PFB A;  5CBE E;  1Y69 U;  4A93 H;  3URY A;  4R9W A;  4FXK C;  2R92 G;  1FJG Q;  1EWC A;  3F2B A;  4AYB G;  4K2L A;  4BY7 G;  1W2B A;  1LT4 D;  1V1Q A;  2Z0S A;  1KNA A;  5M3F H;  1KRT A;  2Y0S B;  3S14 H;  1K83 B;  1D5X C;  5C5M A;  2K5N A;  1DCZ A;  4H44 C;  5GRO A;  3M4O H;  3TP7 A;  5CV4 A;  4C3H B;  2VZA A;  2PMZ E;  2WB1 G;  4IUT A;  3RR5 A;  5CMD A;  5IT9 E;  2K50 A;  1LTL A;  1QG7 A;  2K6A A;  4LFA Q;  2OEO A;  2JQO A;  4A3E B;  2PZU A;  3HZX A;  2CQA A;  3T1Y L;  1WCM G;  3L2P A;  4XQN A;  4KHV A;  2HCC A;  5CV7 A;  4CJ2 C;  1WD0 A;  5JEA J;  3NQT A;  3I4N B;  4KLK A;  1VQN A;  4WJ4 A;  1LTB D;  4IUN A;  5LMN Q;  3Q6S A;  1K8M A;  1PH8 A;  2GVB A;  3SGI A;  1QWY A;  3D4R A;  3IFD A;  3CF5 A;  4MHE A;  4DUZ L;  2JA7 H;  4DV7 Q;  3GTO H;  1SMY C;  3VR4 A;  1PTO D;  2K5H A;  2SDF A;  1KAB A;  2NB0 A;  2O5J C;  4POG A;  2O2L D;  3PIP A;  1YIT A;  1VQM A;  2Z1C A;  1Q8I A;  2BOS A;  3DWA A;  4JI4 L;  5AJ3 Q;  4DAY B;  3I8Z A;  4GOP C;  3S1R B;  2JA8 B;  5BR8 Q;  4UDU C;  1Y1W H;  1Y1W B;  2MO0 A;  1WI5 A;  3MXP A;  1K9M C;  2A19 A;  5IWA Q;  3DEP A;  3MEH A;  3GTQ B;  4LUZ A;  2KED A;  3CW2 C;  2I5M X;  4R4I A;  1I4P A;  4WJ3 M;  4BY7 B;  1B9M A;  5IYC H;  4BBS B;  2NN6 I;  4ZQ3 A;  5M5X B;  2PQA B;  1HFN A;  1Y8O B;  1K28 A;  4OON A;  4AYB E;  1II3 A;  1OXX K;  3RLO A;  4DK0 A;  4ID6 A;  2I07 B;  2V4D A;  2JYO A;  2VS1 A;  4LF8 Q;  2HT1 A;  2PMZ B;  3S16 B;  4NB3 A;  1MSG A;  2L12 A;  5C44 B;  4DR2 L;  1LTS D;  4BXX G;  3S17 B;  3TSS A;  2KHS A;  1CFM A;  1H9R A;  2KHJ A;  1WTR A;  4TVA B;  3I56 A;  1BO0 A;  3GP7 A;  2EOT A;  5FJ8 H;  5JJL A;  1CKN B;  5KYL A;  3CCV A;  2B63 B;  1U4R A;  3IAY A;  1UEA B;  3IL8 A;  3L0O A;  4CJ1 B;  2F0Q A;  4K5W A;  2BE5 D;  4A3B H;  3CC2 A;  3V2T A;  2E2D C;  2JA8 G;  4A3E G;  3ND8 A;  4G7H C;  4L5S A;  5EPK A;  4J6H A;  1XPU A;  1TKW B;  3S1M H;  1I5F A;  4GKK L;  4P75 A;  2VQF Q;  1D2B A;  2E8G A;  2UXC Q;  4QIW E;  2L15 A;  2LMC B;  2UXD Q;  1BBX C;  3J80 c;  2UUA Q;  1P16 A;  4ZAI A;  3TME A;  3DM1 A;  5KND A;  1G6Z A;  4YWK A;  4GS3 A;  5G3L F;  3S1Q B;  3E0E A;  1EYA A;  4DKA C;  1PMR A;  1I94 L;  1A3U A;  2VUM H;  1EQR A;  4CGY B;  4YWL A;  3G6J B;  4IUQ A;  3VR5 A;  2EYJ A;  2H4O A;  2ES2 A;  1X3E A;  1EFW A;  4XTC S;  1SYF A;  2CCZ A;  3MVV A;  2AUJ D;  1OO9 B;  4KHZ A;  2MP1 A;  1TWC B;  2HDL A;  1TS5 A;  1I3Q H;  1IZ6 A;  4X6A H;  2NBF A;  5J3B A;  5KYI A;  1TR5 A;  1PDQ A;  2AWN A;  4KKS A;  4ZRZ A;  2RHQ B;  5ELN A;  4NMZ A;  1G6P A;  5NUC A;  1Z9F A;  3K8A A;  3DWQ A;  1NY4 A;  1LAC A;  1TWF B;  1DYQ A;  1TWA H;  2RA4 A;  2K33 A;  2PNH A;  2NVT B;  3H6M A;  1V43 A;  4DR5 Q;  2IT1 A;  2LXJ A;  5H1S E;  2LY7 A;  3BU2 A;  2EJF C;  3TZU A;  4LNQ A;  2C9O A;  5C6A A;  4A3D G;  4CKE A;  3K7U C;  2E2I H;  4RCN A;  3GTG B;  2NVY B;  3KLW A;  1Q81 C;  2ZTD A;  2RSO A;  3A5Z B;  2RDF A;  4FDB A;  3Q24 A;  2WIN B;  4RAU C;  3QO2 A;  3PO2 G;  1WD1 A;  1KD1 C;  2OQK A;  1PH1 A;  2XVS A;  1GUT A;  2PZT A;  2Q8I B;  3BS1 A;  1ZKO A;  2ATW A;  1VS0 A;  4G7Z C;  4EX5 A;  1YVC A;  4CJ0 B;  3BYT B;  1CSP A;  1I50 B;  4JI7 L;  2R93 H;  2PYK A;  1X54 A;  1CA6 A;  2DGY A;  3SE0 A;  1A2T A;  3NBI A;  2CH4 W;  2A6E C;  2F0J A;  1Q46 A;  3K6O A;  4XQQ A;  1NE3 A;  3FKI H;  5JJI A;  4IFD H;  3PF4 A;  4AH6 A;  5KIX A;  3GO5 A;  2NVY H;  3UE1 A;  1V9P A;  2B3G A;  1KQS A;  2MJ8 A;  4U67 3;  3PO3 B;  2YTY A;  2MGS A;  5IP7 G;  4E6I A;  2BH8 A;  3EQL C;  1DD2 A;  2WKC A;  3K5O A;  2KQ3 A;  2UUA L;  3H94 A;  2OT2 A;  3FRP B;  5D65 A;  1UEB A;  1ESF A;  2B2T C;  5DM7 3;  4CHT B;  2EYF A;  2LSS A;  4IJL A;  1GO3 E;  1XNR Q;  2KHI A;  4IUR A;  2FFK B;  1YNJ C;  1S4Z A;  3OTO L;  3V05 A;  3NXW A;  5C4Z A;  3NHH A;  1PZJ D;  5C3E B;  2A73 B;  4A3L G;  1JWM D;  2ID0 A;  1MGS A;  5E4X A;  2B39 A;  5LMN L;  3E9H A;  2E2H H;  3L9A X;  1HUN A;  3M4Q A;  4DR4 Q;  5DLQ E;  4WFN 3;  1BR9 A;  3S16 H;  1PTO B;  2GA4 B;  4LWC A;  1ILQ A;  1F9R A;  1QB5 D;  2WP8 J;  1X9N A;  3RD4 A;  1X55 A;  1Y1V H;  3F2D A;  5IYD H;  5FO8 B;  3EVQ A;  1GUN A;  1ZXT A;  2EJG C;  1SYC A;  3ULP A;  5GAE C;  1EEI D;  1YEZ A;  4CDD C;  4A3I G;  3J81 i;  2XWJ B;  3GQB A;  1E24 A;  1VQA A;  4RA8 A;  3FP9 A;  1SYG A;  4GZY C;  3PO3 H;  2HQE A;  2WAQ B;  5GAH C;  5I2X A;  2DY7 A;  4X3K A;  5IWA L;  1PYB A;  4LK1 C;  2PNR C;  1X3P A;  1HXY D;  2M2L A;  3RN2 A;  4DAP A;  1IHZ A;  2HHH Q;  5FK9 C;  3OOC A;  3H0G G;  4MTN A;  2Q2I A;  3I4M G;  3T1H L;  5KGU A;  3A7A B;  1SFO H;  4A3M G;  1AFP A;  1E2Z A;  1PYW D;  2A8V A;  3AQQ A;  3ND9 A;  2ZXR A;  5J22 A;  2L1B A;  4IPD A;  2Z6B A;  4DV4 Q;  2R93 G;  2VB2 X;  2B2T A;  2CWA A;  4UP9 A;  5E4W C;  2ZXP A;  3GTO B;  4IFD I;  3HOY G;  3I55 A;  1SND A;  1IBK L;  4FF2 A;  3S2H H;  5M5Y B;  4IPC A;  1VQ4 A;  1VQP A;  3RN5 A;  2ZM6 L;  4DU9 A;  1CZG A;  1FD7 D;  3I3C A;  1X56 A;  1CKN A;  2SEB D;  1QUQ A;  2CVR A;  3SVM A;  1DXM A;  4N8F A;  1U5K A;  3CCU A;  1YJ9 A;  5A35 A;  3OW7 A;  2OTJ A;  4LF9 Q;  1QE6 A;  3OWF A;  2Z4I A;  4LFA L;  4IPG A;  2JEB I;  1EQV A;  1CI3 M;  4H0L C;  4KV6 A;  2CW0 C;  5IGB A;  4DAV A;  4ZUI A;  4R4Q A;  3PV0 A;  3CKI B;  4QUC A;  2VL6 A;  1AN8 A;  1NR4 A;  4R1J A;  2NVX H;  2G9H D;  3S2D H;  1HTP A;  1L1O C;  4FXG C;  1VQI A;  3QIA A;  2B29 A;  2JEA I;  5CV5 A;  4A3G H;  1ENF A;  5T1I A;  1IXR A;  4DXF A;  3F8T A;  5JJK A;  3A7L A;  4OXP A;  4A3F G;  5T1G A;  3TDQ A;  5M3M B;  1HA5 A;  1S5F D;  3G71 A;  2JJQ A;  3T1H Q;  1UWV A;  1EIF A;  5CYU A;  2WII B;  3HOZ B;  1VQH A;  3NBH A;  1RKN A;  1QVC A;  3KOJ A;  2Y0S E;  4DR5 L;  1ENA A;  3VYS A;  3ERS X;  4HED A;  1VQD A;  1PH6 A;  4MIU A;  4RKL A;  1HR0 L;  3E9I A;  1NSN S;  4A3M B;  3EJI A;  3H0G B;  4JW0 A;  1X65 A;  4DV1 Q;  2EJM A;  2K7V A;  4A3B G;  2P5Z X;  1EOV A;  1NUC A;  1JOQ A;  2NTS A;  2K03 A;  4X62 Q;  4K0K Q;  4DR1 L;  1RD9 D;  1QJO A;  2LXK A;  1E22 A;  1JC7 A;  1VQB A;  4KHP L;  3HOY H;  2D5D A;  2BE5 C;  4DN4 M;  1N33 L;  2CQO A;  4LF6 L;  3KBG A;  1QVF A;  3K59 A;  3P75 A;  1N36 L;  4K2K A;  2QA4 A;  1VMC A;  2F0G A;  2GVA A;  2B63 G;  1QOH A;  1I6V C;  3B6Y A;  2WB1 B;  5EQ0 A;  1PTO H;  1V1O A;  2K14 A;  3I4L A;  1STH A;  3M9B A;  4EVO A;  2AHO B;  1VQ8 A;  5LHY 1;  1TVX A;  4QL5 A;  1QNK A;  4K5V A;  3J81 L;  3EIV A;  1O7Z A;  3PUZ A;  3G7L A;  4DR4 L;  1LUZ A;  2A68 D;  1W6J A;  1VCI A;  1Y8P B;  5I4D A;  3W2D A;  5M3M G;  1ML0 D;  2ENB A;  3CCS A;  5C4J H;  1IYJ B;  5ELD A;  4A3F B;  1HA6 A;  3SK5 A;  3JAM c;  4JI6 L;  3J7Y W;  1B7Y B;  4Q5V A;  3S2D B;  4ZUJ A;  5I9P A;  3GV6 A;  1I4G A;  2JN4 A;  3D0F A;  4B3S Q;  2XN9 C;  1D7Q A;  3M4P A;  4PMC A;  4JI2 Q;  1HCZ A;  4X66 L;  3IRB A;  1BBW A;  1RCV D;  1E0B A;  1YNX A;  2HDM A;  3C1F A;  1CQV A;  3P1H A;  3GTK B;  1VQE A;  1U4P A;  3QOL A;  3FDT A;  3UDF A;  4A3G G;  2JA9 A;  3GV3 A;  1K0S A;  3CRL C;  1GUS A;  1I4R A;  3NEL A;  2LKV A;  3CCL A;  4BBS G;  2YU9 B;  4F7X A;  4OWW B;  1TU2 B;  4HIM A;  3HKZ G;  4Z9C B;  1H9S A;  1K83 H;  1LM0 A;  2B63 H;  4G7O C;  1BKB A;  4BWG B;  2N78 A;  4HJ9 A;  5JPM C;  2CKZ B;  4X64 L;  1WTO A;  3PO3 G;  2J4X A;  4K14 A;  1N34 L;  3P20 A;  1UAP A;  5C4H A;  4DR7 L;  4HCS A;  2R7Z H;  1TWG H;  4GLA C;  1IBK Q;  1EU3 A;  4XDX A;  2K75 A;  1GKH A;  4L5T A;  1STB A;  2R61 A;  4L5Q A;  1KXL A;  5GAD C;  5IYD G;  5EGT A;  4R4C A;  3NTK A;  3KDF A;  1D1I A;  3W1B A;  4CDF C;  1A3V A;  3X3M A;  1WTW A;  1JQY D;  1XX8 A;  2AMC B;  3H09 A;  4BA1 I;  1Q1E A;  4ME3 A;  3GTJ B;  2B2Y A;  4GLV B;  4B3S L;  3IFT A;  2QF7 A;  1RJT A;  1PVO A;  1EYD A;  1I50 H;  3CU7 A;  1S5D D;  3MWY W;  4Q0F A;  2E74 C;  4JVZ A;  4WJW A;  3M4Y A;  3EBE A;  4S3S A;  2F0O A;  4ALP A;  4R8I A;  4KY6 A;  1WTH A;  2ZJQ A;  3PIO A;  4A3D H;  5C4X B;  2UXB Q;  2DN8 A;  3I4M H;  4DA2 A;  1A3T A;  4HMI A;  3ERO A;  3WWV A;  4LF5 L;  1BXT A;  1C4Q A;  2YTV A;  3MFY A;  2A74 C;  2KBN A;  1TWF H;  1XTD A;  3N52 A;  4EQ5 A;  5KNC A;  1KL9 A;  3CQZ B;  1U4L A;  4DF7 A;  1SMX A;  4HAE A;  1S5E D;  5BN3 A;  3S1R H;  5ELE A;  2F52 A;  4KHP Q;  2NUC A;  3F2U A;  1CUK A;  1F77 A;  3GTQ H;  1JMC A;  1HUM A;  1JT8 A;  2F0F A;  4C3I G;  4LF6 Q;  1IBL Q;  3FKI G;  2F0S A;  4DGZ A;  3DUZ A;  3EN2 A;  3OMC A;  1R4P B;  3HKZ E;  2KA7 A;  4ABN A;  4A3C G;  3GTM H;  1YBY A;  4A3L H;  5D14 A;  1PH2 A;  5JOB A;  1U9R A;  2A6E D;  1E3P A;  3PMF A;  3C1E A;  2QIL A;  2RCN A;  1D1K A;  1K73 C;  4OGQ C;  4M8A A;  1VQ7 A;  3HRZ C;  2FMM A;  3CCJ A;  1MKH A;  4C2M H;  4JI3 Q;  1EIG A;  3MXG A;  1HZB A;  1VQ5 A;  3FEW X;  2K52 A;  5I6W A;  4EGV A;  2EE1 A;  4RGN A;  5HGT A;  2KJX A;  3M7N A;  2KCT A;  4NXM Q;  3S15 H;  4KJO A;  4GOP B;  1OXV A;  2PW5 A;  1N32 L;  2IJ0 A;  4HIO A;  3G48 A;  1ZYR C;  2RBM A;  4GNX C;  4IFD G;  4OO1 I;  2NVQ H;  3Q23 A;  3WDN A;  1STE A;  2VY3 A;  3HOY B;  1XJV A;  1HNZ L;  2EYM A;  1HQR D;  1XMO Q;  1EY5 A;  5C44 G;  1TXY A;  5DEH A;  4FO2 A;  1H95 A;  4LMQ D;  2VXW A;  4BBS H;  3U4V A;  4X65 L;  4LF9 L;  4B3R L;  2PI2 E;  1MIU A;  5FKA C;  2K28 A;  3PCO B;  1KRS A;  4WRD A;  4A3J G;  1B4O A;  4JI1 L;  1WTP A;  3TBI B;  1Y1W G;  2VNU D;  1SJE D;  1XTC D;  1PRT B;  4L63 B;  1QIL A;  1JWU D;  2JSO A;  2VQE Q;  4DNR B;  3SK4 A;  4KY5 A;  4QCL A;  1BCP B;  2MO1 A;  2NVT H;  1GHJ A;  3OSO A;  4DV2 Q;  2BA0 A;  3D3R A;  4F88 A;  3HG9 A;  1S40 A;  5KNB A;  1VQK A;  1MJE A;  3A0J A;  2IL8 A;  2UUC L;  3HS0 C;  4MN3 A;  2UU9 L;  1XMQ L;  1ET6 A;  1OXT A;  4A3E H;  1F2L A;  2Z6K A;  4DR2 Q;  3J81 j;  5GQO A;  4LF4 L;  3RNU A;  3CCQ A;  3NTH A;  1LV9 A; 
#chains in the Genus database with same CATH homology
 2AQ2 B;  4Y7N B;  2F0E A;  2QKI C;  1I4Q A;  1I6H B;  3MFG A;  4N9T A;  5I6Y A;  1NCV A;  2Z4H A;  2NN6 H;  2X6L A;  3D31 A;  3GTL B;  2IX0 A;  3OMG A;  1F2M A;  2B8G A;  5M5W B;  1EY6 A;  1TWG B;  2B2V C;  2EYH A;  2TSS A;  5E1F A;  2A6H D;  3HKZ B;  1RHP A;  1GOZ A;  3SHL A;  1X32 A;  3LWE A;  4U68 A;  5LL6 S;  1O7Y A;  2F0H A;  1SYE A;  4FXD A;  3PUV A;  4IFD J;  3KUP A;  1LTT D;  4K6D A;  4DK1 A;  5FLX E;  3SDZ A;  1CM9 A;  1CQF A;  4KK7 A;  2R7Z B;  3K5N A;  1D6E C;  1NR2 A;  2OF1 A;  5JEA G;  2E75 C;  3IKJ A;  1SJH D;  1PTO F;  1HQM C;  3NK9 A;  2PO4 A;  2RDH A;  1O80 A;  1TWA B;  4H7B A;  4OO1 H;  5K5P A;  3ONA B;  4ZLT F;  1RDP D;  1J9O A;  2B8F A;  2R93 B;  5CC4 A;  1YNJ D;  2O5I C;  1NAP A;  1EYC A;  2YYZ A;  1F2Y A;  4OL7 A;  3J7A V;  1GJX A;  1M8A A;  2A6H C;  1I3Q B;  4G4K A;  1LTG D;  5COR A;  1EFI D;  2ICI A;  5JAV A;  3TP8 A;  3V96 A;  3AU7 A;  4BY1 B;  1SYB A;  4NKL A;  1BCP F;  1EOT A;  4B9X A;  2JA5 B;  2VUM B;  2JE6 I;  1JB3 A;  3LWU A;  4G57 A;  3FKI B;  4K8J A;  3KLR A;  4V19 0;  4OO1 G;  1GUG A;  4A3D B;  2F0L A;  3S2H B;  2FMC A;  5IIF A;  1KDC A;  2XRQ D;  4A93 B;  1BF4 A;  5EBD A;  2ZXO A;  3DWP A;  5IT9 L;  3E5S A;  3A8J E;  1Z7T A;  1B3A A;  3I73 A;  3S1N B;  4FF3 A;  4RHS A;  2NZ1 D;  2WKD A;  5CR3 A;  2EY5 A;  3EFX D;  2F4I A;  3BG3 A;  2F0M A;  1F9Q A;  5C3W A;  5EPJ A;  2L4N A;  4QB4 A;  3QOJ A;  1SNC A;  4FNF A;  1VF5 C;  4HSP A;  3DMU A;  4IAL A;  5KEE A;  1QNU A;  3A54 A;  3VA7 A;  5I9O A;  1PZI D;  2F0P A;  1JWS D;  2RKS A;  4ODG A;  5D3I B;  1SDF A;  2NN6 G;  3MA2 B;  4PMW A;  3BZD B;  2X6G A;  4DNT B;  4V0B A;  1EIH A;  4BS9 A;  3TP5 A;  4XQJ A;  1WVL A;  2K1B A;  1PRT F;  4FP5 D;  2E2H B;  2EDG A;  3S15 B;  3KK7 A;  1KDA A;  3S1M B;  4PMB A;  1IYU A;  1LTR D;  1SNM A;  4PNY A;  1G91 A;  1X3Q A;  4L6T B;  5IGG A;  3L3O C;  1CHQ D;  1BDO A;  1Y8N B;  3R2T A;  3FPU B;  3T53 B;  3X3N A;  1B44 D;  1SEB D;  2AQ3 B;  3Q22 A;  1ONL A;  3K58 A;  3SK6 A;  3AMU A;  2SNS A;  3SK8 A;  1AZQ A;  1G8Z D;  2RQX A;  3ZYY X;  2B2U A;  2MPM A;  1BNZ A;  4KD4 A;  5AFW A;  5K36 H;  3T4A C;  1B50 A;  3E0J A;  1SE4 A;  3I4M B;  1A6X A;  4RGM A;  1C8C A;  4JK1 C;  3A8I E;  3NUC A;  1O78 A;  2F0N A;  3S14 B;  2NVQ B;  3BDC A;  1YNN C;  4QIW B;  3OIQ A;  1VMP A;  4O1N A;  2EY2 A;  4CKB A;  3VYU A;  1PFN A;  1CA5 A;  2IW3 A;  3HGB A;  2IWH A;  4R8N A;  4IQZ A;  1CTM A;  3K0Y A;  3H91 A;  4X3T A;  2PPB C;  3H3V C;  1EY0 A;  1EZ8 A;  1TQO A;  1F9S A;  2OXP A;  1IL8 A;  2B2W A;  3U9O A;  3NPP A;  1FNV A;  1Q12 A;  2NWG A;  1H9J A;  1KLU D;  3LNN A;  4C1N I;  2F0I A;  3SR1 A;  2M9V A;  3WOE A;  3RUZ A;  1H9M A;  3D6W A;  3I90 A;  1AZP A;  1T5X D;  5CV9 A;  2JA7 B;  4A3K B;  4IZ8 A;  5C5L A;  5LL6 X;  2FJ2 A;  1IW7 C;  1LTA D;  1UNS A;  2NYZ D;  4XT1 B;  1LT6 D;  1ESR A;  1STN A;  2NVX B;  3C46 A;  1IKM A;  4DAY A;  4B9W A;  1IW7 D;  4RHR A;  3J80 E;  3JAM E;  2X69 A;  3SEB A;  2F0T A;  2F0U A;  3MZ5 A;  3CRK C;  2XSC A;  2EYP A;  1KAA A;  4TRD A;  1A2U A;  4I65 A;  3FPP A;  3I70 A;  5ELC A;  3C3L A;  2JXM B;  5J1Z A;  1EQT A;  1XWE A;  1ILP A;  2G9D A;  2A69 D;  1WTX A;  3MAQ A;  3RMH A;  2QEJ C;  2XWB B;  1XYI A;  1JOO A;  5IGC A;  2BA1 A;  4XT3 B;  1SNQ A;  2XRS D;  5JVH 3;  4NP5 A;  2EYO A;  2BDO A;  1SE3 A;  3S9W A;  1L0Y B;  5ISR A;  2L55 A;  3K57 A;  3MXU A;  3PUX A;  1SNO A;  1FYC A;  1Y1V B;  2L11 A;  3Q0A A;  3DEO A;  3HOW B;  3NWS A;  2PCF B;  4YIJ A;  2E2I B;  5FO7 B;  1QCB D;  1Z6H A;  1TWH B;  1Q90 A;  4C3H G;  3ERQ A;  5FOB B;  4BA2 I;  1KDB A;  1G29 1;  2N55 A;  2HUG A;  5G3L D;  1DM0 B;  2VB3 X;  2PQE A;  2KOL A;  2AUK A;  4FYD A;  2NTT A;  1Q3L A;  4HCE A;  5KRU A;  2L5T A;  1LLR D;  1U4M A;  2J0T D;  2R6G A;  2K05 A;  1XXG A;  3A55 A;  2CW0 D;  5A2Q E;  5J39 A;  2WV6 D;  3BYY B;  4C3J B;  3NE5 B;  5BN5 A;  2DY8 A;  4FF1 A;  3DXJ C;  4C3I B;  5I2Y A;  1EWH A;  3A56 A;  1PZK D;  3JAM L;  1HRJ A;  4RCO A;  2Z8L A;  4NW2 A;  1WTQ A;  4OHJ A;  2A5H A;  4WOR A;  5C0X I;  5JEA H;  2B2W C;  2L0C A;  4A3B B;  2EPB A;  5CV8 A;  2SNM A;  5FO9 B;  1EY7 A;  4F87 A;  2JA6 B;  2AWO A;  1EY4 A;  2EYL A;  4OIJ A;  4ZKC B;  1LAB A;  5CV6 A;  1SXT A;  1A15 A;  3HP3 A;  2K01 A;  4JBW A;  1Z47 A;  3BVM A;  3MC0 B;  1M4V A;  3W3A A;  3PIO 3;  4KKU A;  4XYO A;  5CBA E;  3VA5 A;  3SXH A;  4DXG A;  4ILW A;  2O4X A;  1SFO B;  1LT3 D;  2KCC A;  2F1M A;  2N88 A;  4RFB A;  5IGF A;  3TN2 A;  5EKL A;  1PRT D;  5CGK A;  4CKC A;  4K8I A;  1CK1 A;  3HOU B;  2F0V A;  3NQI A;  2BDN A;  4L8J A;  2F3V A;  3J81 E;  1ROD A;  3MTS A;  4LJZ C;  4EQP A;  1DJR D;  3HOV B;  1JOK A;  4RH6 A;  2HCI A;  4B08 A;  5C0X J;  5JVG 3;  1ZYR D;  3MXN A;  1G2S A;  4A3G B;  3NTI A;  1I4H A;  3KLS X;  4RGO S;  3QB3 A;  2EY6 A;  3RZO B;  1STA A;  3RZD B;  4K5X A;  3UI2 A;  3NP8 A;  3VR3 A;  1VDZ A;  1WTV A;  3VR2 A;  3R93 A;  1SYD A;  3A8K E;  1HTL D;  1SMY D;  1I4X A;  1DOL A;  5EJW A;  1MBY A;  4K6L A;  2F0W A;  5E3F A;  5M3F B;  2MUY A;  5K36 G;  1TY0 A;  5C3X A;  3AB9 A;  3WOF A;  4ZYS A;  2K5Q A;  5IOC A;  1EZ6 A;  3K5M A;  5COY A;  1K8O A;  2K04 A;  5EKI A;  1BOS A;  1FNU A;  3EA6 A;  1UUP A;  4HR7 B;  4KJN A;  1ENC A;  1B53 A;  3J80 L;  5HUR A;  1JCK B;  1KNE A;  4QMG A;  4KI0 A;  2B2U C;  2FIN B;  1V1P A;  1LO5 D;  1R4Q B;  3O13 A;  2LFN A;  3GD7 A;  4IUP A;  1PLF A;  3T56 B;  1D5Z C;  2F0K A;  2KCN A;  5IOD A;  3P7J A;  4ZKB B;  3HOX B;  1F9P A;  4ME5 A;  5DM6 3;  4J1M A;  4C3J G;  2AQ1 B;  4A3I B;  4IN3 A;  1ZEQ X;  1GUO A;  3OIP A;  3QJY A;  1F2Z A;  3QWN A;  4KKT A;  2K32 A;  4RKB A;  4EQO A;  1GXD C;  2KVM A;  1SBB B;  5F2D A;  2TMP A;  1TT2 A;  5C4J B;  3OHX C;  1HPC A;  2F0D A;  2Q8T A;  1JR0 D;  3BDL A;  2BCO A;  2B2V A;  1B1Z A;  2J7Z A;  4X3U A;  4HN7 A;  5BN4 A;  2EZV A;  3M3Y B;  2IX3 A;  2JP1 A;  4XYQ A;  4KTA A;  2QDB A;  1YNN D;  1STG A;  3D4D A;  1VF7 A;  1KTK A;  5IGE A;  1DON A;  1HHV A;  2C5C A;  5EKK A;  1BCP D;  1W6K A;  2K5W A;  4I7Z C;  3R8B A;  4BBR B;  3NSW A;  4FVM A;  2DNE A;  3U9S A;  2L9H A;  2PZW A;  1FR3 A;  1ICW A;  3QG1 A;  4ZK9 B;  1R9T B;  2FHT A;  2RVL A;  3L7Z C;  1GHK A;  5IGD A;  5EBC A;  1BCP C;  1STY A;  2QCP X;  1J8I A;  3J7A F;  2DNC A;  2I46 A;  2A68 C;  1WCM B;  4HSV A;  2LS0 1;  2D9U A;  3I91 A;  2KEE A;  4RGT A;  2CHB D;  4P2C B;  1AW7 A;  3T13 A;  4NDX A;  3PO2 B;  2K5D A;  3VYT A;  1SE2 A;  2B2Y C;  4DFA A;  1H9S B;  4C1N K;  1T5E A;  2R92 B;  1PRT C;  1MSH A;  4OIK A;  4H13 C;  4AYB B;  5JJZ A;  1EEF D;  4RWS C;  4KD3 A;  3KLS A;  1JOR A;  1V8Q A;  3KF8 A;  2RDG A;  3R3O A;  1CHP D;  4LAA A;  4KMU C;  4C56 C;  1FGB D;  3RLF A;  5C0X G;  4PQX A;  1DZ1 A;  3T51 B;  1D5M C;  4QUF A;  4F8M A;  4XXE A;  2XIW A;  2A69 C;  3LX0 A;  3BVG A;  3BVZ A;  1RF2 D;  3GTP B;  3K5L A;  2Q8R E;  1SSO A;  3T16 A;  1OXU A;  3PUW A;  1EL0 A;  1B2T A;  5FLX L;  1PXU A;  3VR6 A;  1S5B D;  1TS3 A;  3MHB A;  4C2M B;  5M9O A;  4XIG S;  1H9K A;  2E76 C;  5D3D A;  4UAI A;  5JPN C;  1JE4 A;  5ELB A;  2D62 A;  3D8G A;  2F3W A;  2M00 A;  4KN7 C;  3R2I A;  1RTO A;  2ZT9 C;  3OWE B;  3D6C A;  5A2Q L;  1IKL A;  3M4O B;  4J8Q A;  1AP0 A;  1GUW A;  3VYR A;  3CHB D;  4PV1 C;  1CT1 D;  1E2W A;  1SNP A;  3DHQ A;  1DOM A;  1IYV A;  2RSN A;  3PUY A;  1OXS C;  5TSS A;  3TP6 A;  4M1U B;  3HEJ A;  4KY7 A;  1TS2 A;  1ET9 A;  1C48 A;  4CBV A;  3FMC A;  1E2V A;  3C2P A;  4A3J B;  4TQU S;  2ICE C;  1HFG A;  2WAC A;  1PTO C;  1MD2 D;  2H1E A;  3E6Z X;  2EY1 A;  1LTI D;  4X3S A;  4FF4 A;  1KLG D;  3K7A B;  1Q1B A;  3ITP A;  3OPO A;  4TSS A;  1L0X B;  4IUV A;  1S5C D;  2XNA C;  3M85 A;  1MI2 A;  1JIC A;  1LT5 D;  1CZW A;  3TZD A;  2PW7 A;  1SAP A;  1V1P B;  2MHV A;  4KN4 C;  4N9P A;  3BDO A;  4ULL A;  5EPL A;  3GTM B;  4O42 A;  4EQN A;  2E2J B;  1AEX A;  1EY8 A;  4HMJ A;  3FVQ A;  1EU4 A;  2R3Z A;  2KUM A;  5ELF A;  3I72 A;  5DAU A;  1G2T A;  3NWT A;  2SOB A;  1BUV T;  2EVB A;  1FNW A;  2F03 A;  1BQQ T;  1DOK A;  4IUU A;  5C0X H;  5DNF A;  1B9N A;  1TS4 A;  2IPK D;  3KBX A;  1TII D;  2KEC A;  1TY2 A;  2EXZ A;  3PIP 3;  3N6R A;  1PFM A;  3D4W A;  1EY9 A;  4QF4 A;  2IX1 A;  1RTN A;  1O7L A;  4HTH A;  2D2C C;  3M7G A;  4TKO B;  1PFB A;  5CBE E;  1Y69 U;  3URY A;  4R9W A;  4FXK C;  1EWC A;  4K2L A;  1LT4 D;  1KNA A;  2Y0S B;  1K83 B;  1D5X C;  5C5M A;  1DCZ A;  4H44 C;  3TP7 A;  5CV4 A;  4C3H B;  4IUT A;  5CMD A;  5IT9 E;  1QG7 A;  2K6A A;  2OEO A;  4A3E B;  2PZU A;  3HZX A;  2CQA A;  4XQN A;  4KHV A;  2HCC A;  5CV7 A;  4CJ2 C;  1WD0 A;  5JEA J;  3NQT A;  3I4N B;  1LTB D;  4IUN A;  3Q6S A;  1K8M A;  1QWY A;  3D4R A;  3IFD A;  4MHE A;  1SMY C;  3VR4 A;  1PTO D;  2SDF A;  1KAB A;  2NB0 A;  2O5J C;  2O2L D;  2Z1C A;  1Q8I A;  2BOS A;  3DWA A;  3I8Z A;  3S1R B;  2JA8 B;  4UDU C;  1Y1W B;  3MXP A;  3DEP A;  3MEH A;  3GTQ B;  2KED A;  1I4P A;  4BY7 B;  1B9M A;  4BBS B;  2NN6 I;  4ZQ3 A;  5M5X B;  1HFN A;  1Y8O B;  1II3 A;  1OXX K;  4DK0 A;  4ID6 A;  2I07 B;  2V4D A;  2JYO A;  2PMZ B;  3S16 B;  1MSG A;  2L12 A;  5C44 B;  1LTS D;  3S17 B;  3TSS A;  2KHS A;  1CFM A;  1H9R A;  1WTR A;  1BO0 A;  3GP7 A;  2EOT A;  5KYL A;  2B63 B;  3IAY A;  1U4R A;  1UEA B;  3IL8 A;  4CJ1 B;  2F0Q A;  4K5W A;  2BE5 D;  3V2T A;  2E2D C;  3ND8 A;  4G7H C;  5EPK A;  4J6H A;  1TKW B;  1D2B A;  2LMC B;  1BBX C;  4ZAI A;  3TME A;  5KND A;  3DM1 A;  1G6Z A;  3S1Q B;  5G3L F;  1EYA A;  1PMR A;  1A3U A;  4CGY B;  3G6J B;  4IUQ A;  3VR5 A;  2EYJ A;  2H4O A;  4XTC S;  1SYF A;  3MVV A;  2AUJ D;  1OO9 B;  4KHZ A;  2MP1 A;  1TWC B;  2HDL A;  1TS5 A;  2NBF A;  5KYI A;  1TR5 A;  1PDQ A;  2AWN A;  4KKS A;  4ZRZ A;  4NMZ A;  5NUC A;  3DWQ A;  1LAC A;  1TWF B;  1DYQ A;  2RA4 A;  2K33 A;  2NVT B;  3H6M A;  1V43 A;  2IT1 A;  2LY7 A;  2EJF C;  3TZU A;  2C9O A;  5C6A A;  4CKE A;  3GTG B;  4RCN A;  2NVY B;  3Q24 A;  2RSO A;  2RDF A;  2WIN B;  4RAU C;  3QO2 A;  1WD1 A;  2XVS A;  1GUT A;  2PZT A;  2Q8I B;  3BS1 A;  1ZKO A;  4G7Z C;  4CJ0 B;  3BYT B;  1I50 B;  2PYK A;  1CA6 A;  3SE0 A;  1A2T A;  3NBI A;  2A6E C;  2F0J A;  3K6O A;  4XQQ A;  4IFD H;  5KIX A;  3GO5 A;  2MJ8 A;  4U67 3;  3PO3 B;  2MGS A;  4E6I A;  3EQL C;  1DD2 A;  2WKC A;  3K5O A;  2KQ3 A;  3H94 A;  2OT2 A;  3FRP B;  5D65 A;  1ESF A;  2B2T C;  5DM7 3;  4CHT B;  2EYF A;  4IUR A;  2FFK B;  1YNJ C;  1S4Z A;  3V05 A;  3NXW A;  5C4Z A;  3NHH A;  1PZJ D;  5C3E B;  2A73 B;  1JWM D;  2ID0 A;  1MGS A;  5E4X A;  2B39 A;  3L9A X;  1HUN A;  4WFN 3;  1BR9 A;  1PTO B;  2GA4 B;  1ILQ A;  1F9R A;  1QB5 D;  2WP8 J;  3RD4 A;  5FO8 B;  3EVQ A;  1GUN A;  1ZXT A;  2EJG C;  1SYC A;  1EEI D;  2XWJ B;  3GQB A;  4RA8 A;  1SYG A;  4GZY C;  2HQE A;  2WAQ B;  5I2X A;  2DY7 A;  4X3K A;  4LK1 C;  2PNR C;  1X3P A;  1HXY D;  2M2L A;  4DAP A;  1IHZ A;  5FK9 C;  3OOC A;  5KGU A;  3A7A B;  1AFP A;  1E2Z A;  1PYW D;  3ND9 A;  2ZXR A;  5J22 A;  2L1B A;  2VB2 X;  2B2T A;  5E4W C;  3GTO B;  2ZXP A;  4IFD I;  1SND A;  4FF2 A;  5M5Y B;  4DU9 A;  1CZG A;  1FD7 D;  3I3C A;  2SEB D;  2CVR A;  3SVM A;  1DXM A;  5A35 A;  3OW7 A;  1QE6 A;  3OWF A;  2Z4I A;  2JEB I;  1EQV A;  1CI3 M;  4H0L C;  4KV6 A;  2CW0 C;  5IGB A;  4DAV A;  4ZUI A;  3PV0 A;  3CKI B;  4QUC A;  1AN8 A;  1NR4 A;  2G9H D;  1HTP A;  4FXG C;  3QIA A;  2JEA I;  5CV5 A;  1ENF A;  5T1I A;  4DXF A;  3A7L A;  5T1G A;  3TDQ A;  5M3M B;  1HA5 A;  1S5F D;  5CYU A;  2WII B;  3HOZ B;  3NBH A;  1RKN A;  1ENA A;  3VYS A;  4HED A;  4MIU A;  4RKL A;  1NSN S;  4A3M B;  3EJI A;  3H0G B;  2EJM A;  2K7V A;  1NUC A;  1JOQ A;  2NTS A;  2K03 A;  1RD9 D;  1QJO A;  1JC7 A;  2D5D A;  2BE5 C;  4DN4 M;  3KBG A;  3K59 A;  3P75 A;  4K2K A;  1VMC A;  2F0G A;  1QOH A;  1I6V C;  2WB1 B;  5EQ0 A;  1PTO H;  1V1O A;  3I4L A;  1STH A;  4EVO A;  5LHY 1;  1TVX A;  1QNK A;  4K5V A;  3J81 L;  1O7Z A;  3PUZ A;  3G7L A;  2A68 D;  1W6J A;  1VCI A;  1Y8P B;  5I4D A;  3W2D A;  1ML0 D;  2ENB A;  5ELD A;  4A3F B;  1HA6 A;  3SK5 A;  3J7Y W;  4Q5V A;  3S2D B;  4ZUJ A;  5I9P A;  3GV6 A;  1I4G A;  2XN9 C;  4PMC A;  1HCZ A;  1RCV D;  1E0B A;  2HDM A;  3C1F A;  1CQV A;  3P1H A;  3GTK B;  1U4P A;  3QOL A;  3FDT A;  3GV3 A;  3CRL C;  1GUS A;  1I4R A;  2LKV A;  2YU9 B;  4F7X A;  1TU2 B;  4Z9C B;  1H9S A;  4G7O C;  4BWG B;  5JPM C;  1WTO A;  2J4X A;  4K14 A;  3P20 A;  1UAP A;  5C4H A;  4HCS A;  1EU3 A;  4XDX A;  1STB A;  2R61 A;  5EGT A;  3NTK A;  1D1I A;  1A3V A;  3X3M A;  1WTW A;  1JQY D;  1XX8 A;  3H09 A;  4BA1 I;  1Q1E A;  3GTJ B;  2B2Y A;  3IFT A;  2QF7 A;  1RJT A;  1EYD A;  3CU7 A;  1S5D D;  3MWY W;  4Q0F A;  2E74 C;  4WJW A;  3M4Y A;  4S3S A;  2F0O A;  4R8I A;  4KY6 A;  5C4X B;  2DN8 A;  4DA2 A;  1A3T A;  4HMI A;  3ERO A;  1BXT A;  1C4Q A;  3MFY A;  2A74 C;  3N52 A;  5KNC A;  3CQZ B;  1U4L A;  4DF7 A;  4HAE A;  1S5E D;  5BN3 A;  5ELE A;  2NUC A;  3F2U A;  1F77 A;  1HUM A;  2F0F A;  4C3I G;  2F0S A;  4DGZ A;  3DUZ A;  3OMC A;  1R4P B;  2KA7 A;  4ABN A;  5D14 A;  5JOB A;  1U9R A;  2A6E D;  3PMF A;  3C1E A;  2QIL A;  1D1K A;  4OGQ C;  4M8A A;  3HRZ C;  2FMM A;  1EIG A;  3MXG A;  3FEW X;  5I6W A;  4EGV A;  2EE1 A;  4RGN A;  5HGT A;  2KJX A;  3M7N A;  4KJO A;  1OXV A;  2PW5 A;  2IJ0 A;  1ZYR C;  2RBM A;  4IFD G;  4OO1 I;  3Q23 A;  3WDN A;  1STE A;  3HOY B;  2EYM A;  1HQR D;  1EY5 A;  5DEH A;  4FO2 A;  4LMQ D;  2VXW A;  5FKA C;  2K28 A;  4WRD A;  1B4O A;  1WTP A;  3TBI B;  2VNU D;  1SJE D;  1XTC D;  1PRT B;  4L63 B;  1QIL A;  1JWU D;  2JSO A;  4DNR B;  3SK4 A;  4KY5 A;  4QCL A;  1BCP B;  1GHJ A;  3OSO A;  2BA0 A;  3D3R A;  4F88 A;  3HG9 A;  5KNB A;  2IL8 A;  3HS0 C;  4MN3 A;  1ET6 A;  1OXT A;  1F2L A;  3NTH A;  1LV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...