1HRJA

Human rantes, nmr, 13 structures
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
68
structure length
68
Chain Sequence
SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN REGULATED UPON ACTIVATION NORMAL T-CELL EXPRESSED AND
publication title The three-dimensional solution structure of RANTES.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine (chemotactic)
total genus 5
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1hrjA00
1X3QA 4R9WA 1KNEA 1QNKA 2EE1A 2FHTA 1O80A 4UAIA 1WD0A 1TVXA 2NZ1D 3H91A 1WTXA 5EJWA 2K01A 2KOLA 2X6LA 3G7LA 2L4NA 3GV3A 3KBXA 4HEDA 5COYA 4U68A 4CJ2C 1HUNA 1MSGA 3DEPA 1U4PA 1WD1A 2K1BA 4CJ1B 3N52A 1XYIA 1SSOA 4MN3A 2N55A 1F9QA 2HDLA 4XDXA 1HHVA 2L9HA 4CJ0B 1WTWA 2FINB 2K05A 3P7JA 5EPJA 2DY8A 2HUGA 4XT3B 2EPBA 5CBEE 1CA5A 2KECA 4RAUC 3IFDA 3LWEA 1QE6A 1JICA 3MWYW 4HSVA 2FFKB 4O42A 1DOMA 2HCCA 1B53A 4QUCA 1ILPA 1E0BA 1SDFA 1G6ZA 1F2LA 1C8CA 1WTPA 1EL0A 1ILQA 1G2SA 4X3KA 1HA6A 1ESRA 1F9SA 1MGSA 1LV9A 1EQTA 1NR2A 4HCSA 1CA6A 2DY7A 1CM9A 1MI2A 1RTOA 2B2TA 4RA8A 1ZXTA 1HFNA 1MSHA 1PLFA 3F2UA 2IL8A 2BDNA 3I91A 1O7ZA 3GV6A 1NR4A 4ZLTF 4R8IA 1IKMA 1IKLA 1SAPA 2J7ZA 1HUMA 1M8AA 2K03A 2D9UA 1RHPA 2EOTA 1PFMA 5EPKA 2N88A 1JE4A 1AP0A 1HRJA 1WVLA 2B2YA 3ONAB 2B2VA 1RJTA 5D14A 2MPMA 2RSNA 5T1GA 4ZAIA 1NCVA 2B2UC 4XT1B 3KUPA 3MTSA 3TN2A 5JJZA 1U4MA 1J8IA 2NWGA 3DEOA 2MP1A 4X3UA 3TZDA 5D65A 2JP1A 2X69A 2H1EA 4IUPA 4IUQA 2R3ZA 5EKIA 2FJ2A 4OIJA 3SVMA 2KUMA 1B4OA 2M2LA 4DN4M 3R93A 1G2TA 2B2WA 1HFGA 3IL8A 4LMQD 1VMPA 1IL8A 2RA4A 1ICWA 5CORA 3DM1A 4IUUA 1PDQA 1S4ZA 2L11A 1KNAA 3HP3A 2HCIA 4X3TA 2X6GA 4ZKCB 1F9RA 2KEDA 2MGSA 3FDTA 2HDMA 4IUTA 3I90A 2CVRA 4RWSC 5DNFA 5T1IA 4IUVA 1WTRA 1AZPA 1DONA 2K04A 1BBXC 2L12A 3D6WA 1VMCA 2VXWA 3I3CA 1EOTA 2MJ8A 1QG7A 5AFWA 4X3SA 1RODA 2L1BA 3FPUB 2SDFA 3QO2A 4MHEA 5E4WC 1BF4A 1ML0D 1J9OA 1EIGA 4QUFA 5CMDA 1B3AA 5EPLA 1WTQA 1B50A 2FMMA 1B2TA 2KEEA 1Q3LA 1G91A 1NAPA 2K28A 2Q8TA 2B2TC 1U4LA 1DOLA 3I8ZA 4OIKA 2RVLA 4IURA 1F9PA 1WTOA 1O7YA 3Q6SA 4HAEA 1X3PA 3UI2A 2B2WC 1EIHA 1RTNA 1X32A 2KVMA 2B2UA 1AZQA 4ZK9B 2JYOA 1WTVA 1A15A 1U4RA 1DOKA 2NYZD 2RSOA 4ZKBB 1PFNA 1PFBA 4NW2A 1BNZA 1DZ1A 2XIWA 5E4XA 1XX8A 5CBAE 1GUWA 2Q8RE 2B2YC 5EQ0A 1BO0A 2B2VC
chains in the Genus database with same CATH superfamily
4MTKA 4LF6L 2F0QA 5K36G 3ND9A 2B29A 3J81i 1PZID 3CQZH 2EYMA 2FXQA 3M9BA 2JA6G 1VQ5A 3JAMc 1K8AC 1D7QA 1FJGQ 2GVBA 3NP8A 3IAYA 1QWYA 2ZTCA 1XTCD 4J6HA 4KI0A 1FYCA 4F7XA 2E75C 1BR9A 1GKHA 3I4MG 3FRPB 4DV3L 2VY3A 4JI3L 3H6MA 1A2TA 2NTSA 1PH4A 1ET6A 4DA2A 4CKBA 2C5CA 4WJWA 1A62A 2M00A 3F1ZA 3PSIA 3TREA 5C4XB 1SAPA 4JPBW 2F0DA 4LWCA 3Q22A 5BN3A 3HOVG 5AJ3L 4C3IH 4FDBA 3VYUA 4ZYSA 4K8IA 4QGUA 1E24A 5FOBB 2JEBI 4H0LC 3A0JA 1PYBA 1BCPF 2VB3X 1D5ZC 3I2ZA 2AKWB 2ZXPA 4K5WA 4C3IG 1XNRL 5C4JH 1SXTA 1D5XC 1EEID 2NN6I 1QVGA 4F88A 2FJ2A 2KUMA 1B4OA 2TMPA 4YWKA 3GD7A 4UP8A 1XPOA 1G2TA 4A3KG 3HKSA 1VMPA 2RA4A 4DUZL 4A3CH 1Y14B 3H3VC 2CFMA 4X65L 3I90A 1BKBA 4FXDA 4G7OC 3W2DA 2F3VA 2E2HH 2R93H 1XNQL 4GKKL 1EOTA 4DK3C 1MBYA 1SR3A 4A3CG 4EQOA 2PW7A 2L1BA 4MHEA 4NXML 2MFIA 2EVBA 4TVAB 1ML0D 2J0TD 2RDFA 3A5UA 2R7ZH 2IHFA 2I5LX 4LUOA 1HZCA 2FMMA 2JEAI 3PO3H 2D5DA 2K28A 2F0PA 1JWSD 4FNFA 4JI4Q 1VQIA 4DR5L 4R4IA 1A3TA 2A8VA 3K58A 4B9XA 4C3JH 1PZKD 4XIGS 4NW2A 3PO3G 2EY5A 3P1HA 1HTPA 3H09A 2IPKD 2XIWA 1CZGA 2LMCB 1WTXA 2PYKA 1KDAA 4C3JG 3CPFA 1CQFA 5LMUQ 1N34L 3HKZB 1PTOF 1SFOB 2KHJA 2N55A 5FO7B 1F77A 1Q82C 2F0FA 1KLGD 5C44B 2QEXA 3M4OB 3OTOQ 2WP8J 1Q81C 1CA5A 2JK8A 1B9NA 1SNPA 4JI5Q 3IFDA 1JOOA 4LF7L 3EN2A 4YY3Q 1SROA 5CGKA 1B53A 1MHWC 1SYDA 5BR8Q 1SBBB 2XTIA 4KD4A 3A8JE 4XXEA 2EYFA 1QZHA 2B3GA 2CKZB 1HZBA 2UUAQ 2IL8A 4B3RL 1L0XB 3C3LA 1DYQA 2QGQA 4IALA 4HIDA 1UWVA 2K75A 2XWBB 5CV7A 3ONAB 1II3A 4LF6Q 2B2VA 2XNAC 2CH4A 3J81L 2EQSA 2Z9HA 1Y8PB 3KDFB 3MTSA 1U4MA 3GTKB 3L7ZC 5J39A 1ASZA 4IJLA 4B3TL 2E74C 2MP1A 5M3FH 1EY6A 4MIUA 1S5ED 2H1EA 1SNQA 2AUKA 4KD3A 3TDQA 1YEZA 3TQYA 2IX0A 4GN5A 3K7AB 3RLOA 3W1GA 1NMFA 3PMFA 3J7YW 1HFGA 4DV0L 3NBHA 2QKIC 3NEMA 4LF5L 1PYSB 2HCIA 5M3FG 1DM0B 4JI3Q 1S40A 1PVOA 1STAA 3H3VI 4A3FB 3AYHB 4C1NI 5E1FA 4PG3A 1I3QB 1Y1WG 2Y0SB 5KYLA 3HOYB 1W3SA 2PI2A 5M5XB 2JA7B 4KHVA 1R4PB 5J22A 2ASBA 5AJ3Q 3QIAA 4R4QA 4JBJA 1PXUA 3DMUA 5IIFA 3BDCA 1IYUA 5BN5A 3HS0C 4C3HH 3S16H 1XNRQ 4AYBG 3IFTA 3SR1A 2QW7A 2ZXOA 4HJ7A 1B7YB 1N8RC 4A93H 1C9OA 4DAYA 4BS9A 1GO3E 2FHTA 3T53B 4JI7L 4C3HG 2DJGC 3T1YL 1Q90A 2K01A 2KOLA 3KBXA 2F52A 4KN7C 4CJ1B 4GS3A 1IL2A 3HOXB 4R4CA 1V1PB 1F9QA 3F8TA 5CV5A 4A3MH 2L9HA 2UUBL 4C2MB 3J7AF 4O1NA 5CBEE 5LL6X 1DGSA 4Y52H 2SNMA 1SDFA 1YNXA 4JG2A 4IZ8A 5LHY1 4X62L 2SEBD 5FJ8H 1PFSA 4A3MG 3T56B 2Z4HA 1LV9A 2VUMH 3PIOA 1Z6HA 5M3MH 3I72A 1E1TA 1EU4A 1PLFA 1RF2D 2EY2A 3MXUA 4MTNA 1LUZA 4LNQA 2HQEA 4R8IA 2NVYB 1CI3M 1VQGA 3PQIA 3S1RH 4WFN3 1YIJA 5FJ8G 4JBKA 2VUMG 4J15A 3KJPA 3HOUH 5M3MG 3PIPA 3CC4A 5IOCA 1LT4D 3CAMA 3HFZB 1F2ZA 5IGGA 1GHJA 2B2UC 4JI8Q 4E6IA 3MZ5A 2VQFL 4OWWB 4YHHL 1JWUD 4BBSH 3DEOA 2KA7A 2F0SA 1UE5A 5C5LA 3HOUG 1G6PA 4IPHA 1GJXA 3T51B 1BOSA 4DR7Q 3M7GA 3J80E 2R3ZA 1D2BA 3SVMA 2IT1A 1QVFA 1VCIA 4B3MQ 1K83B 3D4RA 2WFWA 1ZEQX 2PQAA 1WTHA 1HNXQ 4IQZA 5CORA 3OWFA 4RGNA 2QDLA 1A8VA 2MNAA 3FDTA 4LJZC 3ND8A 1BVSA 2PQEA 4IUVA 2BOSA 2Z6KA 2K04A 1BBXC 5HY6A 1JE5A 4BXXH 2VXWA 2K33A 4Q0FA 1AEXA 1E2VA 1GXDC 2D0OA 3FMCA 4A4IA 5IGCA 2D2CC 3MEFA 1IHZA 1QNUA 4OONA 2OTJA 2RF4A 1VQKA 1EY4A 4OO1I 4K0KQ 4OIKA 1WTOA 3G6EA 2LS01 4HAEA 1EIHA 4QF4A 1KTKA 1YNND 2JYOA 5A35A 2XVSA 4P74A 1DOKA 2D0PA 4NMZA 4G7ZC 2Q8RE 1U5KA 1EYCA 3KFUA 1EIFA 4JW0A 3F2DA 1O80A 3RNUA 2NZ1D 4DV0Q 2XWJB 2IHEA 1SN8A 1B70B 1JOQA 2NVTB 2XSCA 5IY0A 4JVZA 2QDBA 3KOJA 2HDLA 4O0AA 3S1QH 1VDZA 4ZQ3A 1NUCA 3CCQA 2PO4A 1HZAA 1IBLL 4DAVA 4A3BH 2FFKB 4O42A 1DOMA 4HIKA 4QUCA 4LFAL 4I7ZC 4OHJA 2B63B 2FMCA 4OWTB 3BVGA 3D8GA 4CDFC 4EGVA 4DFAA 2AWOA 2F3IA 4A3BG 1TS5A 1RKNA 4AYBE 1IXRA 1B44D 2EOTA 1XMQL 2BCOA 2ZTDA 3OIPA 1AP0A 3GTPB 1CZWA 3T1YQ 4C1NK 4IO9A 1I50B 3RN5A 3H0GB 2NZHA 1PHJA 1EY8A 4GKJL 2A74C 3EVQA 5D65A 2K5QA 3R3OA 1YITA 4A75A 3OSOA 1KDBA 2EXZA 4OIJA 4DR6L 2YTXA 3AEVA 2OXPA 4JI0Q 5HURA 2F0IA 3TSSA 1KAAA 2K5VA 3CRLC 2A6ED 2G5DA 2X6GA 1F9RA 2L5TA 3L2PA 5ELDA 5I4DA 3KYHC 1DONA 1FGUA 2EYPA 4ODGA 3NSWA 1SMXA 3BZKA 3GTQB 4V0BA 1RODA 2SDFA 3BJUA 1SEBD 1T5EA 3DLLA 3GTLB 1V9PA 5GROA 3GTJH 3Q8DA 1Q3LA 1QUQA 2V1CC 1DOLA 5CC4A 2PMZE 2I07B 4UDUC 5C4HA 5ELNA 2VQFQ 4OL7A 1WFQA 1VQAA 4BBRB 4ID6A 1Q46A 1FJGL 1PFBA 2A73B 1TS4A 1MJEA 5FKAC 1TWAB 3MXNB 3K57A 2UXCQ 1GD7A 4A3EB 4A3GH 3I4MB 1B9MA 3WWVA 3TRZA 4XDXA 1JCKB 4DR1L 1TY2A 3M3YH 4A3GG 3HOVB 1TWCB 1SE4A 4DKAC 5DLQE 1HPCA 2QILA 4HCEA 3KDFA 4LFBL 5JJIA 1CA6A 4B08A 1RTOA 3BU2A 2B2TA 4NKLA 4GLAC 1T9HA 2R92H 3I91A 2Q2HA 1PH8A 2EYJA 1K28A 3BYTB 3NWTA 3R8BA 1CKMA 2MHVA 4A3KB 1BCPB 5C3EH 3MFGA 1S5FD 2BDOA 5IT9E 2E2JB 1O7IA 3S1NH 2R92G 4EQPA 3KUPA 5KNCA 1NNXA 3HGBA 5ISRA 1XWEA 2A69D 2NVQB 5FO9B 3D3RA 3RR5A 4XYQA 2R7FA 2VL6A 1EY7A 3RN2A 2LXKA 5GQOA 3KJOA 4B9WA 5C0XI 1K73C 1YBYA 1YNNC 3NPPA 1X3EA 4LFAQ 1SMYD 3S2HB 4TRDA 1ENFA 5ELCA 4G57A 3DXJC 1LTRD 2ZTEA 1IYVA 1LTGD 4JCVE 1NBWA 1O78A 1Z9FA 1QG7A 1LACA 1EYGA 1UE6A 4M8AA 2CW0D 1C48A 3UDFA 1XMQQ 5EPLA 3CRKC 2Z8LA 1CUKA 3IRBA 2JA5H 3TP6A 4BY1H 4EQ5A 4IFDI 2M9VA 4A3JH 1LLRD 1V1PA 1QZGA 2ATWA 1KLUD 4V190 4GKJQ 1C4QA 2MQHA 2YYZA 3FKIG 1N36L 3RMHA 5E7NA 1JJ2A 4FYDA 2JA5G 4CBVA 4U673 4BY1G 3J80i 4BA1I 5GAHC 2IX3A 4DK1A 4QCLA 3OTOL 5IGBA 1TQOA 4A3JG 4JI5L 5A2QE 4TSSA 3GV3A 4YY3L 3E5SA 1L1OA 2K6AA 5BR8L 4K8JA 2WV6D 2UXBQ 3A7AB 1ZKOA 1EQQA 3L0OA 1EYAA 1DCZA 3CF5A 2J4XA 3PUYA 4JOIA 3CW2C 2MO1A 2WAQE 1QOHA 1CFMA 1ILPA 1VQ4A 3Q23A 4LFCQ 1EL0A 1ILQA 1MJCA 3CCVA 2UXDL 4AQYQ 1EU3A 1LT6D 1ZXTA 3K0YA 2QEJC 2PNHA 1S5BD 2YTVA 2AQ2B 4KN4C 1EY5A 3S1MB 2IY5B 5I2XA 2A6EC 3W1BA 1BBWA 1WVLA 5IYCH 1SYFA 4CDEC 4KY5A 3OIQA 2NUCA 2EXDA 3J81c 2DN8A 3TN2A 4X64Q 2CQAA 4FXKC 3P75A 4X3UA 3S2DH 1CKOA 4L63B 3CC2A 3K5NA 1Y1WB 3SEBA 1Q86C 5IYCG 5LL6S 5EKIA 4DR1Q 3RLFA 4CHTB 1LTLA 2KCNA 2KQ3A 3PUXA 3MVVA 1IL8A 2ID0A 2OF1A 3GTMB 3HG9A 4X3TA 1HJPA 5M5YB 1B3QA 5T1IA 4LFBQ 2WIIB 2JA8H 4QQBX 1Q8IA 1RL2A 3WOFA 1ICFB 4RKLA 2H4OA 3URYA 3NBIA 4DR4Q 3U4ZA 3BVZA 1KQSA 1J9OA 1STEA 1SLJA 2N49A 1B3AA 2JA8G 1NAPA 4QY7A 1ET9A 1PH5A 5L37A 1E2WA 3NTHA 4IURA 1TWGB 1GUSA 4Y7NB 4RCOA 4OEMB 3VYRA 4C56C 4GNXC 4ZKBB 1DZ1A 1R4QB 1BNZA 1N9WA 1GUWA 1H9KA 5IYDH 4PMWA 2RCFA 2HDMA 5CR3A 3C46A 3MHBA 3PO2H 3DHQA 1G51A 1D6EC 3GTOH 4A3DH 4H13C 2X6LA 3G7LA 5COYA 2ZM6Q 1STGA 5ELOA 3I4NB 5IYDG 2R93G 1I4GA 2WINB 3X3MA 4OX9L 1FNWA 3E6ZX 1E2ZA 3PO2G 1K8GA 3HEJA 2HUGA 2VZAA 1UEAB 2R7ZG 3S14H 5KGUA 1LTID 1OXXK 3AMUA 1JB7A 2BA1A 1HCZA 1JWMD 1STNA 1K0RA 2A69C 2PMZB 3C1FA 2UU9L 4UP9A 4RA8A 3T13A 5I9PA 4L8JA 1QUQB 4BWGB 1IZ6A 5CV8A 1S5CD 4JI8L 4L5SA 4ZLTF 2BH8A 1HQRD 5IP7H 4QMGA 1N36Q 2K14A 3W3AA 1D5MC 2N88A 3DWQA 4DR7L 1SMYC 1WCMH 2F4IA 2EY1A 4B3ML 2PPBC 1D1KA 4IJHA 1HNXL 1H9MA 5IP7G 3KF8B 4YCVA 1EWHA 1B8AA 5ELFA 3DUZA 1WCMG 5CYUA 2CW0C 2ENBA 4BY7H 3NQIA 4YIJA 3SK6A 3F2BA 4KY7A 1PTOH 1EWIA 4HSPA 2G9HD 4HJ5A 2RHSB 5KYIA 1VQBA 1STBA 3S15B 1Y1VH 1S4ZA 2L11A 2E8GA 5JPMC 5FO8B 4NB3A 4KK7A 4RWSC 4BY7G 1X55A 4LUVA 3PUWA 2UXDQ 4LAAA 4K0KL 4FF3A 3M4YA 3ZYYX 4K2KA 3EIVA 3RZDH 2YU9B 2DJFC 1Y1VG 1STHA 1YHAA 3MXNA 2K50A 4OWXB 1O7LA 4DR2L 2CWAA 4LW1A 2AQ3B 5JJKA 2K5DA 3MAQA 2LSSA 4RMFA 2K5HA 3T1HL 1X54A 2IJ0A 4RGOS 3PCOB 2VNUD 2B8GA 2F3WA 3MA2B 1XX8A 1AE3A 5FLXc 2Q2UA 3ZJYC 1J5EQ 1KNEA 1QNKA 1VQJA 3I4LA 4I7AA 1VQOA 1D8LA 5EBCA 4U68A 1HQMC 2NVXB 3K80C 1XYIA 1FVIA 1I6VC 2ALYB 1JMCA 2ZJQA 3OOCA 2K05A 5C4XH 1A0IA 3GTGB 1I4PA 2EJMA 5CV9A 3HOWB 4QJFA 2WB1G 1A3VA 4CDDC 4KTAA 5BN4A 1WTPA 1K0SA 1ESFA 3K0XA 3AFQA 3V2TA 1KHIA 4GOPC 4JBWA 4FF1A 1TR5A 4A3LH 3GV6A 1U9RA 2P5ZX 5IYBH 1LTTD 1Y8NB 4A93G 4KHZA 1E3PA 1IBML 4KJOA 3L3OC 1PRTD 3HOZB 3CKIB 3X3NA 5D14A 1I94Q 2AWNA 1RIPA 4JI0L 4A3LG 2GVAA 3RZOB 5IYBG 5G3LD 4Z9CB 3Q24A 3HRZC 1KD1C 1NTGA 4R4TA 4OX9Q 1L1OB 4KV6A 4DPGA 2EIFA 2WAQB 1PH9A 3S17B 3UE1A 1K8MA 3BVMA 1PH2A 3HP3A 4ZKCB 2KEDA 2CVRA 3PF4A 2UU9Q 4RCNA 2LFNA 1A6XA 4P73A 1TKWB 1TWHB 3V96A 2KHIA 5AFWA 1A3UA 3GQBA 2R61A 1EQVA 1PH6A 3OWEB 4TQUS 2R7DA 3WDNA 1BQQT 1ENAA 1U0LA 2KENA 2UXCL 2ZXRA 3TP5A 1SFOH 4BBSG 1FD7D 4HJAA 2JXMB 1NJIC 5C44H 2AHOB 3M4OH 5E4XA 5DNFA 2RHQB 3K81C 4XQJA 2XRSD 3HKZG 2EE1A 1WD0A 4UPAA 1VS0A 1TVXA 3PUZA 4J1MA 4ABNA 4X6AH 1KL9A 2RDHA 1S3OA 3DEPA 1V8QA 3WOEA 3CMEA 4DK6C 4DAMA 2EY6A 4BXXG 3QR8A 4HIOA 1RDPD 2LKVA 1GHKA 1JB3A 1KABA 1JJGA 1BUVT 3CP0A 4KKUA 3E3XA 4QL5A 1C0AA 3MEHA 5FLXL 2C9OA 3ERSX 3D4WA 3JAME 1G6ZA 4DR2Q 1EZ6A 1C8CA 1G2SA 1ESRA 4A3IB 1MGSA 4HCSA 3CCLA 3T1HQ 5NUCA 3GTKH 1SYBA 3CU7A 1ENCA 4H02A 2BDNA 1TWFB 3J81E 2I5HA 1IKLA 2J7ZA 3K7AH 2K03A 1Y69U 2LXJA 2AMCB 1AN8A 3AU7A 2EJGC 5ELEA 2JSOA 2F0WA 3UDGA 3NXWA 1J6QA 3T16A 3U9OA 4LF4Q 4A3FH 1VQ6A 1I3QH 3TZDA 3HOYH 2X69A 5M5XH 2JA7H 4IUQA 2JN4A 2KCTA 2B2WA 4HTHA 3EROA 4A3FG 3FVQA 1OO9B 1WJJA 3HZXA 1N33Q 2E2IB 2WB1E 3EA6A 2JJQA 2Y0SG 3HOYG 1AZPA 1XJVA 2JA7G 3GO5A 3CCRA 1LYLA 4DGZA 2A68D 1E22A 1P8LA 4N9PA 4RFBA 3CCUA 2MJ8A 5JVG3 1I6HB 4DR3L 3FKIB 2O5JC 3PGZA 5KRUA 3R2IA 3LGJA 4QB4A 1F2MA 1OXVA 2A6HD 1WTQA 1IBMQ 1B50A 1QILA 1G91A 4NDXA 1D1IA 2N8NA 2Q8IB 4DU9A 4APVA 3HOXH 2EYHA 1GVPA 1EFID 1VQPA 5FK9C 2B2UA 2PZUA 4ZK9B 1EOVA 4QIWE 1U4RA 1CTMA 2UUCQ 2UXBL 2OQKA 4C2MH 4CGYB 5GAGC 2A1AA 5IWAL 4KHPL 2B2YC 1PH3A 5IP9H 1UUPA 3HOXG 1N32L 3OPOA 1CHQD 4P71A 3TMEA 3TEHB 2F0KA 1IBKL 1PH7A 3U4VA 3E0JA 1R9TB 2F03A 5M5WB 4IN3A 4LFCL 1XMOL 3MXGA 1L0YB 1FR3A 5FLMH 5IP9G 4AQYL 4P2CB 4CJ0B 3P7JA 2NVYH 1EFWA 4I65A 1CT1D 1PRTC 1X65A 2JA6B 1FNUA 1HA5A 1TIID 1UE1A 3DWAA 3KK7A 2EDGA 4HSVA 3VR5A 4ME5A 3SGIA 3O13A 5FLMG 4TKOB 1EQTA 1VF5C 1OXTA 3CQZB 3KF8A 4RG1A 3M4QA 2EYLA 3ULJA 3I7FA 1PH1A 1MKHA 1Z47A 4X64L 1E7ZA 4L5RC 2XRQD 4GZYC 4PNYA 1K83H 4JK1C 1X3GA 3HKZE 4J8QA 4DV4Q 2I46A 5T1GA 2B39A 3G48A 1SRUA 1NCVA 2F0EA 3DM3A 2JQOA 3AQQA 3EFXD 2XGTA 2K32A 4XTCS 2BE5D 1AE2A 3OMCA 1M1KC 4GNXB 4C3IB 4DR4L 3CXCA 4IUUA 2MGSA 2A5HA 4IUTA 2I0QA 4POFA 5C4JB 5D3DA 3B6YA 1HZ9A 5D3IB 5E4WC 4GN4B 3PUVA 1BCPD 4HR7B 5C3XA 5CMDA 5C3EG 1WOCA 1UNSA 2V4DA 1V1OA 2SOBA 3BS1A 1YNJD 2Q8TA 1PYWD 1VQFA 2NVTH 1MD2D 5HGTA 3PIP3 1X3PA 1STYA 4MZ9A 2ZM6L 1VQMA 4XYOA 2R93B 2E2HB 1XTDA 1Z7TA 2NN6H 3Q0AA 2VQEL 1PZJD 1YJ9A 3A8IE 1BO0A 1YZ6A 2LY7A 5I2YA 2R7ZB 3H91A 3PO3B 2KHSA 2B63H 1TS3A 2NN6G 1TS2A 4PMBA 1S72A 1MSGA 2K1BA 4XQQA 2Y0SE 3M85A 3C2PA 4X66Q 4C3JB 3FHWA 5H1SE 1F2YA 1M4VA 1SJED 1NSNS 2F4VQ 5JPNC 1GOZA 4DR3Q 2CH4W 2B63G 4OGQC 3GTPH 1JICA 4P75A 2HCCA 3A8KE 1E0BA 2HIVA 4KJNA 1KXLA 1I50H 3H0GH 4JC0A 1A2UA 4LF9Q 3TP7A 3TS0A 2DNCA 4RGMA 4JYAQ 4LF8Q 3NUCA 2ZT9C 2G9DA 4DV7L 5IGFA 5KNDA 2PCFB 5IWAQ 4KHPQ 2KBNA 1HRJA 1PTOD 2F0UA 3BZDB 1DJRD 3J80c 2A68C 1HR0W 4YCUA 1N32Q 4ZAIA 1EY9A 1Q1BA 3DWPA 4DV6Q 1IBKQ 1DD2A 4IOAA 1QJOA 4IUNA 1XMOQ 3RD4A 5JOBA 3L9AX 1Q1EA 2HHHL 3GTQH 2A6HC 3GTLH 4BA2I 3MC0B 1NY4A 3UE0A 2QF7A 1KNAA 2DUDA 4RHRA 1XPUA 3TZUA 3VR2A 3JAMi 1Q7YC 3J7ZC 1MIUA 3OYYA 5IE8A 1EYDA 5IODA 4BBRH 2HIXA 5M3FB 1EQRA 1P16A 1TWAH 3K59A 1BF4A 3TS2A 5LMNL 1V1QA 4A3EH 4L5QA 4CKCA 1JOKA 1KDCA 3K5MA 3ICEA 4DF7A 2O2LD 2VB2X 4BBRG 3I4MH 1J5EL 2O4XA 1U4LA 5CV4A 3I8ZA 2HD3A 4HMJA 1HR0L 1AZQA 2KCCA 2KVMA 4NXNL 3PF5A 4PV1C 1JC7A 4A3EG 4GOPB 3KLSA 2PNRC 2B8FA 1CHPD 3D0FA 1TWCH 4DV5Q 4ME3A 3HOVH 1I4RA 2B2VC 3OHXC 4N8X1 4AYBB 2CCZA 3D4DA 3K5OA 1QB5D 2WB1B 4K14A 2K4KA 4CDCC 1HUNA 3H3VH 1UAPA 3STBD 5KIXA 1VQHA 4MN3A 4C3HB 3S16B 2DNEA 4LK1C 1WTWA 4NPSA 5C4ZA 3NK9A 5EPJA 3KF6A 2DY8A 2R6GA 4RH6A 4KKSA 4RAUC 4A93B 3LWEA 1QE6A 4A3KH 2NZOA 2KCMA 3I55A 2E2JH 1YJNA 1SNDA 2BE5C 1CM9A 1I94L 1HTLD 1MSHA 4ALPA 5C6AA 4QIWB 2NVQH 4A3MB 5EKLA 2VQEQ 1HUMA 3QB3A 1QVCA 5EPKA 3QG1A 5EGTA 4A3DG 2BH2A 1H9SB 1GUTA 1HXYD 2AQ1B 3S2HH 3G6JB 2VUMB 1IW7D 5JJZA 5M3MB 3A74A 2NWGA 5GADC 1BCPC 5ELBA 2K7VA 4IUPA 1LABA 1Q8KA 1TU2B 3S1RB 3GDEA 1YNJC 4DAPA 4WJ4A 1PA6A 1PV4A 3IL8A 4FP5D 4LMQD 3HOUB 3DM1A 4S3SA 1VQLA 2A19A 2GA4B 1H9RA 3J80L 3GP7A 4JI2L 1KC8C 4BBSB 2OQ0A 3BG3A 1OXSC 4IPCA 2VW9A 4DV7Q 1ONLA 4JI1L 4DK0A 1CKNA 3RUZA 3PV0A 2CWPA 3E9IA 2OCEA 5EAYA 4ULLA 3TP8A 1F9PA 1FGBD 1RTNA 1X32A 1OTCA 4WRDA 4DV2L 1LTAD 2HHHQ 4ZCKA 2H5XA 1Y8OB 2F0GA 1SYEA 2MUYA 4IPGA 4PMCA 4DV1L 3MFYA 4RKBA 3KLRA 3E9HA 1LTSD 3A55A 3JAML 1JQYD 4DUYL 4JV5L 5J1ZA 2L0CA 3N52A 1VQNA 3JC66 4JBMA 5EBDA 3BDLA 4B3SL 4R8NA 2FINB 1PTOC 3S1MH 1CQVA 1YJWA 1SE8A 5F2DA 2L55A 2KECA 5LMNQ 5GAEC 3BZCA 1E1OA 4OO1H 2ZJRA 1F9SA 3K8AA 2Z6KC 2F0TA 2RKSA 2DY7A 2PZTA 1IYJB 5IT9c 1SNMA 3NTIA 1SNCA 1HR0Q 3I70A 1G8ZD 4LF4L 4NXNQ 1Y1WH 3S1QB 1XPRA 3VR4A 4AIMA 2F1MA 3I73A 1M8AA 4G7HC 4OO1G 4GNXA 1RHPA 4H44C 4EVOA 4DV3Q 2K5NA 4F87A 4A3BB 1W2BA 3GTMH 1VQDA 1SNOA 5C0XJ 5M5YH 3I4OA 2RQXA 3NELA 1TY0A 1N33L 2OEOA 2C35B 2IWHA 3H94A 4F8MA 3MXPA 5C4XG 1LT3D 4KMUC 5C3WA 4K6DA 2PI2E 3SHLA 4DN4M 2O5IC 3VYSA 1PDQA 4HJ8A 1X56A 3A5ZB 1X9NA 4K5VA 1WTRA 3AB9A 1TWGH 5J3BA 3QWNA 3TBIB 4Y7NH 4PZ8A 4IFDJ 3I3CA 4FO2A 1X6OA 3EQLC 2EYOA 1HNWL 4X3SA 4DUZQ 1GM5A 2UUCL 1VQCA 4P72A 4K5XA 1HNZL 1PRTB 4NP5A 2NB0A 1B2TA 2KEEA 4X65Q 1B1ZA 1VQEA 3STBC 3VA7A 3OW7A 1XNQQ 4GKKQ 3I4NH 2B2WC 3U9SA 3CCJA 4NXMQ 2NYZD 3UDXA 1PFNA 2SNSA 4N9TA 5CBAE 4JI6L 1X3QA 3R2TA 4H7BA 1CK1A 3I4NG 3GTJB 4DR5Q 4OELB 5EJWA 1SE2A 1ASYA 1V43A 3RLNA 4CJ2C 1H9JA 3QOLA 3H15A 1WD1A 5C5MA 4JI2Q 2Z0SA 1BDOA 2JE6I 3D6CA 4CKEA 2RBMA 1X3FA 1SYCA 2EPBA 1GUNA 2F0HA 4JI1Q 2PW5A 1SJHD 1IW7C 2F0MA 1N34Q 2GN5A 4A3GB 2NTTA 4PZ6A 3VYTA 3T4AC 1NR2A 1JORA 1MI2A 1W6KA 2D62A 4DV4L 3FPPA 3SXHA 5JVH3 1K3BC 5DM73 3ER0A 5C44G 1A63A 1T5XD 1O7ZA 4LF7Q 4DV2Q 4DXFA 4N8FA 2WKCA 3I56A 3M3YB 1AH9A 2D9UA 1ZYRD 1YI2A 4O2DA 4YWMA 1KAWA 3S15H 4HN7A 2E76C 3C1EA 2MPMA 2RSNA 4ZUJA 3S9WA 4DV1Q 3LX0A 4B3RQ 1CSQA 5JEAJ 4DUYQ 4JV5Q 1J8IA 1EY0A 3FEWX 4DNRB 2YU9H 2R92B 5IT9L 3SK8A 4B3SQ 4DXGA 4HIMA 3NTKA 2IW3A 3KF6B 5I6YA 5C3EB 3S1NB 1I4QA 4B3TQ 2DGYA 5CV6A 1K8OA 4PZ7A 4ZUIA 1Q12A 3S24A 1JJCB 3NQTA 2IX1A 2N3SA 3G4SA 1I4HA 2CHBD 5DAUA 4GOPA 3U50C 1FNVA 4LF5Q 1EIGA 2TSSA 3NWSA 2RCNA 1XXGA 1BBUA 4HJ9A 2B2TC 3QOJA 3BYYB 3CC7A 1VQ9A 2RVLA 1AFPA 1L0WA 2NVXH 1WTVA 2BA0A 2RSOA 3A56A 3V05A 3GTGH 1HH2P 5M9OA 4X66L 3ULPA 1RD9D 2KJXA 2ICIA 5IGEA 1H95A 1GUOA 3HOWH 1AW7A 5KNBA 2F4VL 4UAIA 5C0XH 1C7YA 2ZJPA 4WJ3M 4HEDA 2L4NA 4Q5VA 2JA5B 1EZ8A 4MNOA 4BY1B 3CPWA 1SSOA 4A3JB 1PRTF 2F0OA 4LF9L 1HHVA 3HOWG 1WYDA 1DXMA 2F0LA 2OTLA 4K2LA 5A2QL 5C0XG 1BXTA 4DNIA 4JYAL 5E3FA 4LF8L 1HNWQ 4JI7Q 5G3LF 1K3RA 2Z1CA 3MWYW 3HOZH 1EWCA 1H9SA 1HNZQ 2Q2TA 4OXPA 2WACA 4GLVB 3NE5B 4L6TB 4UP7A 1KIXA 1W6JA 1M90C 2E5LL 5I9OA 3RZOH 1HA6A 4FF4A 4IFDH 1KRTA 1CKNB 2UUBQ 3VDYA 3M7NA 4DV6L 1S5DD 1IKMA 1NR4A 3HOZG 3J7A5 3D31A 3S17H 2YTYA 1PFMA 4GN3B 3CCEA 3OW2A 4JI6Q 1JE4A 4X62Q 4IFDG 3KLSX 4RGTA 4WORA 1UEBA 1RJTA 2HQLA 1JT8A 5IGDA 2VS1A 1TT2A 2CQOA 3OMGA 3A7LA 1L2FA 3QJYA 4XT1B 4M1UB 2WAQG 5TSSA 2Q2IA 1TWHH 3CMAA 3AFPA 2QA4A 4UY8C 1WI5A 3SDZA 2JP1A 3ERQA 1VQ8A 1FL0A 2XN9C 4HMIA 2OT2A 3SK4A 4FXGC 4L5TA 2K5WA 4YWLA 3SK5A 1ICWA 1EIYB 3J81j 1L1OC 4FVMA 4YHHQ 2I5MX 2E2DC 1SYGA 3E0EA 4DNTB 5K5PA 1VQ7A 4KLKA 3BDOA 4PQXA 2N78A 4UHVA 2L12A 2Z6BA 3W5OA 3S2DB 3ULLA 2WKDA 3ITPA 4JOIC 4K6LA 2EZVA 1PMRA 3QO2A 3FPUB 2OWOA 1TXYA 4QUFA 4DV5L 3U58A 3NBHB 5KEEA 3K6OA 3CCSA 1I4XA 3KBGA 3NHHA 2K52A 3Q6SA 4FF2A 2JA8B 1LM0A 2QCPX 3CHBD 3K5LA 1A15A 1YHQA 1OXUA 4R4OA 3LNNA 4R9WA 3PIO3 1RCVD 2MO0A 3M4PA 4IPDA 4A3IH 3J7AV 5JEAH 5JJLA 3VR6A 1U4PA 5FLXE 1ZYRC 1TWFH 1NE3A 4XT3B 3EJIA 4A3IG 3P20A 5JEAG 3G71A 4A76A 2NBFA 3KLWA 2AUJD 4DAYB 3PO2B 1F2LA 3GTOB 4A3DB 4X3KA 3VR3A 1HFNA 3F2CA 2ES2A 3F2UA 4XQNA 1IBLQ 1I5FA 3K7UC 4ZRZA 3S14B 2B2YA 1KRSA 5EKKA 3EBEA 4YCWA 2E2IH 1LT5D 4JI4L 4KKTA 4RHSA 2F0JA 5DM63 3SE0A 1K9MC 1CSPA 1YHBA 1LTBD 1NMGA 1QCBD 1LO5D 1I6HH 2ICEC 3FKIH 2JA9A 1UE7A 2M2LA 3R93A 4LUZA 5LMNW 3A54A 4AH6A 4IOCA 5HGQA 1WCMB 1EUJA 4GLXA 1EEFD 1G291 3CCMA 4KY6A 2RDGA 2Z4IA 5LMUL 3H0GG 2E5LQ 1GUGA 4POGA 4EX5A 1SE3A 3CD6A 3D6WA 4DR6Q 1JR0D 1VMCA 5JAVA 2EJFC 4BY7B 1YVCA 4R1JA 3IKJA 3N6RA 1PTOB 5I6WA 2PQAB 3FP9A 2HT1A 1VF7A 5DEHA 2F0NA 4ILWA 1Y1VB 3UDIA 4EQNA 1R9TH 5M5WH 3VA5A 2PZWA 2F0VA 1O7YA 3LWUA 3UI2A 5K36H 2UUAL 4G4KA 2L15A 3RZDB 2JA6H 2YV5A 3NENA 5EQ0A
chains in the Genus database with same CATH topology
2F0QA 5K36G 3ND9A 1PZID 2EYMA 3NP8A 3IAYA 1QWYA 1XTCD 4J6HA 4KI0A 1FYCA 4F7XA 2E75C 1BR9A 3FRPB 3H6MA 1A2TA 2NTSA 1ET6A 4DA2A 4CKBA 2C5CA 4WJWA 2M00A 5C4XB 1SAPA 2F0DA 3Q22A 5BN3A 3VYUA 4ZYSA 4K8IA 5FOBB 2JEBI 4H0LC 1BCPF 2VB3X 1D5ZC 2ZXPA 4K5WA 4C3IG 1SXTA 1D5XC 1EEID 2NN6I 4F88A 2FJ2A 2KUMA 1B4OA 2TMPA 3GD7A 1G2TA 1VMPA 2RA4A 3H3VC 3I90A 4FXDA 4G7OC 3W2DA 2F3VA 1EOTA 1MBYA 4EQOA 2PW7A 2L1BA 4MHEA 2EVBA 1ML0D 2J0TD 2RDFA 2FMMA 2JEAI 2D5DA 2K28A 2F0PA 1JWSD 4FNFA 1A3TA 3K58A 4B9XA 1PZKD 4XIGS 4NW2A 2EY5A 3P1HA 1HTPA 3H09A 2IPKD 2XIWA 1CZGA 2LMCB 1WTXA 2PYKA 1KDAA 4C3JG 1CQFA 3HKZB 1PTOF 1SFOB 2N55A 5FO7B 1F77A 2F0FA 1KLGD 5C44B 3M4OB 2WP8J 1CA5A 1B9NA 1SNPA 1JOOA 3IFDA 5CGKA 1B53A 1SYDA 1SBBB 4KD4A 3A8JE 4XXEA 2EYFA 2IL8A 1L0XB 3C3LA 1DYQA 4IALA 2XWBB 5CV7A 3ONAB 1II3A 2B2VA 2XNAC 3J81L 1Y8PB 3MTSA 1U4MA 3GTKB 3L7ZC 5J39A 2E74C 2MP1A 1EY6A 4MIUA 1S5ED 2H1EA 1SNQA 2AUKA 4KD3A 3TDQA 2IX0A 3K7AB 3PMFA 3J7YW 1HFGA 3NBHA 2QKIC 2HCIA 1DM0B 1STAA 4A3FB 4C1NI 5E1FA 1I3QB 2Y0SB 5KYLA 3HOYB 5M5XB 2JA7B 4KHVA 1R4PB 5J22A 3QIAA 1PXUA 3DMUA 5IIFA 3BDCA 1IYUA 5BN5A 3HS0C 3IFTA 3SR1A 2ZXOA 4DAYA 4BS9A 2FHTA 3T53B 4C3HG 1Q90A 2K01A 2KOLA 3KBXA 4KN7C 4CJ1B 3HOXB 1V1PB 1F9QA 5CV5A 2L9HA 4C2MB 3J7AF 4O1NA 5CBEE 5LL6X 2SNMA 1SDFA 4IZ8A 5LHY1 2SEBD 3T56B 2Z4HA 1LV9A 1Z6HA 3I72A 1EU4A 1PLFA 1RF2D 2EY2A 3MXUA 2HQEA 4R8IA 2NVYB 1CI3M 4WFN3 5IOCA 1LT4D 5IGGA 1F2ZA 1GHJA 2B2UC 4E6IA 3MZ5A 1JWUD 3DEOA 2KA7A 2F0SA 5C5LA 1GJXA 3T51B 1BOSA 3M7GA 3J80E 2R3ZA 1D2BA 3SVMA 2IT1A 1VCIA 1K83B 3D4RA 1ZEQX 4IQZA 5CORA 3OWFA 4RGNA 3FDTA 4LJZC 3ND8A 2PQEA 4IUVA 2BOSA 2K04A 1BBXC 2VXWA 2K33A 4Q0FA 1AEXA 1E2VA 1GXDC 3FMCA 5IGCA 2D2CC 1IHZA 1QNUA 1EY4A 4OO1I 4OIKA 1WTOA 2LS01 4HAEA 1EIHA 4QF4A 1KTKA 1YNND 2JYOA 5A35A 2XVSA 1DOKA 4NMZA 4G7ZC 2Q8RE 1EYCA 1O80A 2NZ1D 2XWJB 1JOQA 2NVTB 2XSCA 2QDBA 2HDLA 1VDZA 4ZQ3A 1NUCA 2PO4A 4DAVA 2FFKB 4O42A 1DOMA 4QUCA 4I7ZC 4OHJA 2B63B 2FMCA 3BVGA 3D8GA 4EGVA 4DFAA 2AWOA 1TS5A 1RKNA 1B44D 2EOTA 2BCOA 3OIPA 1AP0A 3GTPB 1CZWA 4C1NK 1I50B 3H0GB 1EY8A 2A74C 3EVQA 5D65A 2K5QA 3R3OA 2EXZA 1KDBA 3OSOA 4OIJA 2OXPA 5HURA 2F0IA 3TSSA 1KAAA 3CRLC 2A6ED 2X6GA 1F9RA 2L5TA 5ELDA 5I4DA 1DONA 2EYPA 4ODGA 3NSWA 3GTQB 4V0BA 1RODA 2SDFA 1SEBD 1T5EA 3GTLB 1Q3LA 1DOLA 5CC4A 2I07B 4UDUC 5C4HA 4OL7A 4BBRB 4ID6A 1PFBA 2A73B 1TS4A 5FKAC 1TWAB 3K57A 4A3EB 3I4MB 1B9MA 4XDXA 1JCKB 1TY2A 3HOVB 1TWCB 1SE4A 1HPCA 2QILA 4HCEA 1CA6A 4B08A 1RTOA 2B2TA 4NKLA 3I91A 2EYJA 3BYTB 3NWTA 3R8BA 2MHVA 4A3KB 1BCPB 3MFGA 1S5FD 2BDOA 5IT9E 2E2JB 4EQPA 3KUPA 5KNCA 3HGBA 5ISRA 1XWEA 2A69D 2NVQB 5FO9B 3D3RA 4XYQA 1EY7A 4B9WA 5C0XI 1YNNC 3NPPA 3S2HB 1SMYD 4TRDA 1ENFA 5ELCA 4G57A 3DXJC 1LTRD 1IYVA 1LTGD 1O78A 1QG7A 1LACA 4M8AA 2CW0D 1C48A 5EPLA 3CRKC 2Z8LA 3TP6A 4IFDI 2M9VA 1LLRD 1V1PA 1KLUD 4V190 1C4QA 2YYZA 3RMHA 4FYDA 4CBVA 4U673 4BA1I 2IX3A 4DK1A 4QCLA 5IGBA 1TQOA 5A2QE 4TSSA 3GV3A 3E5SA 2K6AA 4K8JA 2WV6D 3A7AB 1ZKOA 1EYAA 1DCZA 2J4XA 3PUYA 1QOHA 1CFMA 1ILPA 3Q23A 1EL0A 1ILQA 1EU3A 1LT6D 1ZXTA 3K0YA 2QEJC 1S5BD 2AQ2B 4KN4C 1EY5A 3S1MB 5I2XA 2A6EC 1WVLA 1SYFA 4KY5A 3OIQA 2NUCA 2DN8A 3TN2A 2CQAA 4FXKC 3P75A 4X3UA 4L63B 3K5NA 1Y1WB 3SEBA 5LL6S 5EKIA 3RLFA 4CHTB 2KCNA 2KQ3A 3PUXA 3MVVA 1IL8A 2ID0A 2OF1A 3GTMB 3HG9A 4X3TA 5M5YB 5T1IA 2WIIB 1Q8IA 3WOFA 4RKLA 2H4OA 3URYA 3NBIA 3BVZA 1J9OA 1STEA 1B3AA 1NAPA 1ET9A 1E2WA 3NTHA 4IURA 1TWGB 1GUSA 4Y7NB 4RCOA 3VYRA 4C56C 4ZKBB 1DZ1A 1R4QB 1BNZA 1GUWA 1H9KA 4PMWA 2HDMA 5CR3A 3C46A 3MHBA 3DHQA 1D6EC 4H13C 2X6LA 3G7LA 5COYA 1STGA 3I4NB 1I4GA 2WINB 3X3MA 1FNWA 3E6ZX 1E2ZA 3HEJA 2HUGA 1UEAB 5KGUA 1LTID 1OXXK 3AMUA 2BA1A 1HCZA 1JWMD 1STNA 2A69C 2PMZB 3C1FA 4RA8A 3T13A 5I9PA 4L8JA 4BWGB 5CV8A 1S5CD 4ZLTF 1HQRD 4QMGA 3W3AA 1D5MC 2N88A 3DWQA 1SMYC 2F4IA 2EY1A 2PPBC 1D1KA 1H9MA 1EWHA 5ELFA 3DUZA 5CYUA 2CW0C 2ENBA 3NQIA 4YIJA 3SK6A 4KY7A 1PTOH 4HSPA 2G9HD 5KYIA 1STBA 3S15B 1S4ZA 2L11A 5JPMC 5FO8B 4KK7A 4RWSC 3PUWA 4LAAA 4FF3A 3M4YA 3ZYYX 4K2KA 2YU9B 1STHA 3MXNA 1O7LA 2AQ3B 2K5DA 3MAQA 2IJ0A 4RGOS 2VNUD 2B8GA 2F3WA 3MA2B 1XX8A 1KNEA 1QNKA 3I4LA 5EBCA 4U68A 1HQMC 2NVXB 1XYIA 1I6VC 3OOCA 2K05A 3GTGB 1I4PA 2EJMA 5CV9A 3HOWB 1A3VA 4KTAA 5BN4A 1WTPA 1ESFA 3V2TA 4JBWA 4FF1A 1TR5A 3GV6A 1U9RA 1LTTD 1Y8NB 4KHZA 4KJOA 3L3OC 1PRTD 3HOZB 3CKIB 3X3NA 5D14A 2AWNA 3RZOB 5G3LD 4Z9CB 3Q24A 3HRZC 4KV6A 2WAQB 3S17B 1K8MA 3BVMA 3HP3A 4ZKCB 2KEDA 2CVRA 4RCNA 2LFNA 1A6XA 1TKWB 1TWHB 3V96A 5AFWA 1A3UA 3GQBA 2R61A 1EQVA 3OWEB 4TQUS 3WDNA 1BQQT 1ENAA 2ZXRA 3TP5A 1FD7D 2JXMB 5E4XA 5DNFA 4XQJA 2XRSD 2EE1A 1WD0A 1TVXA 3PUZA 4J1MA 4ABNA 3DEPA 2RDHA 3WOEA 1V8QA 2EY6A 1RDPD 2LKVA 1GHKA 1JB3A 1KABA 1BUVT 4KKUA 3MEHA 5FLXL 2C9OA 3JAME 3D4WA 1G6ZA 1EZ6A 1C8CA 1G2SA 1ESRA 4A3IB 1MGSA 4HCSA 5NUCA 1SYBA 3CU7A 1ENCA 2BDNA 1TWFB 3J81E 1IKLA 2J7ZA 2K03A 1Y69U 1AN8A 3AU7A 2EJGC 5ELEA 2JSOA 2F0WA 3NXWA 3T16A 3U9OA 3TZDA 2X69A 4IUQA 2B2WA 4HTHA 3EROA 3FVQA 1OO9B 3HZXA 2E2IB 3EA6A 1AZPA 3GO5A 4DGZA 2A68D 4N9PA 4RFBA 2MJ8A 5JVG3 1I6HB 2O5JC 3FKIB 5KRUA 3R2IA 4QB4A 1F2MA 1OXVA 2A6HD 1WTQA 1B50A 1G91A 1QILA 4NDXA 1D1IA 2Q8IB 4DU9A 2EYHA 1EFID 5FK9C 2B2UA 2PZUA 4ZK9B 1U4RA 1CTMA 4CGYB 2B2YC 1UUPA 3OPOA 1CHQD 3TMEA 2F0KA 2F03A 3E0JA 1R9TB 5M5WB 4IN3A 3MXGA 1L0YB 1FR3A 4P2CB 4CJ0B 3P7JA 4I65A 1CT1D 1PRTC 2JA6B 1FNUA 1HA5A 1TIID 3DWAA 3KK7A 2EDGA 4HSVA 3VR5A 4ME5A 3O13A 4TKOB 1EQTA 1VF5C 1OXTA 3CQZB 3KF8A 2EYLA 1Z47A 2XRQD 4GZYC 4PNYA 4JK1C 4J8QA 2I46A 5T1GA 2B39A 1NCVA 2F0EA 3EFXD 2K32A 4XTCS 2BE5D 3OMCA 4C3IB 4IUUA 2MGSA 2A5HA 4IUTA 5C4JB 5D3DA 5D3IB 5E4WC 3PUVA 1BCPD 4HR7B 5C3XA 5CMDA 1UNSA 2V4DA 1V1OA 2SOBA 3BS1A 1YNJD 2Q8TA 1PYWD 1MD2D 5HGTA 3PIP3 1X3PA 1STYA 4XYOA 2R93B 2E2HB 1Z7TA 2NN6H 3Q0AA 1PZJD 3A8IE 1BO0A 2LY7A 5I2YA 2R7ZB 3H91A 3PO3B 2KHSA 1TS3A 2NN6G 1TS2A 4PMBA 1MSGA 2K1BA 4XQQA 3M85A 3C2PA 4C3JB 1F2YA 1M4VA 1SJED 1NSNS 5JPNC 1GOZA 4OGQC 1JICA 2HCCA 3A8KE 1E0BA 4KJNA 1A2UA 3TP7A 2DNCA 4RGMA 3NUCA 2ZT9C 2G9DA 5IGFA 5KNDA 2PCFB 1HRJA 1PTOD 2F0UA 3BZDB 1DJRD 2A68C 4ZAIA 1EY9A 1Q1BA 3DWPA 1DD2A 1QJOA 4IUNA 3RD4A 5JOBA 3L9AX 1Q1EA 2A6HC 4BA2I 3MC0B 2QF7A 1KNAA 4RHRA 3TZUA 3VR2A 1EYDA 5IODA 5M3FB 3K59A 1BF4A 4CKCA 1JOKA 1KDCA 3K5MA 4DF7A 2O2LD 2VB2X 2O4XA 1U4LA 5CV4A 3I8ZA 4HMJA 1AZQA 2KCCA 2KVMA 4PV1C 1JC7A 3KLSA 2PNRC 2B8FA 1CHPD 1I4RA 2B2VC 3OHXC 4AYBB 3D4DA 3K5OA 1QB5D 2WB1B 4K14A 1HUNA 1UAPA 5KIXA 4MN3A 4C3HB 3S16B 2DNEA 4LK1C 1WTWA 5C4ZA 3NK9A 5EPJA 2DY8A 2R6GA 4RH6A 4KKSA 4RAUC 4A93B 3LWEA 1QE6A 1SNDA 2BE5C 1CM9A 1HTLD 1MSHA 5C6AA 4QIWB 4A3MB 5EKLA 1HUMA 3QB3A 5EPKA 3QG1A 5EGTA 1H9SB 1GUTA 1HXYD 2AQ1B 3G6JB 2VUMB 1IW7D 5JJZA 5M3MB 2NWGA 1BCPC 5ELBA 2K7VA 4IUPA 1LABA 1TU2B 3S1RB 1YNJC 4DAPA 3IL8A 4FP5D 4LMQD 3HOUB 3DM1A 4S3SA 2GA4B 1H9RA 3J80L 3GP7A 4BBSB 3BG3A 1OXSC 1ONLA 4DK0A 3RUZA 3PV0A 4ULLA 3TP8A 1F9PA 1FGBD 1RTNA 1X32A 4WRDA 1LTAD 1Y8OB 2F0GA 1SYEA 2MUYA 4PMCA 3MFYA 4RKBA 3KLRA 1LTSD 3A55A 3JAML 1JQYD 5J1ZA 2L0CA 3N52A 5EBDA 3BDLA 4R8NA 2FINB 1PTOC 1CQVA 5F2DA 2L55A 2KECA 4OO1H 1F9SA 2F0TA 2RKSA 2DY7A 2PZTA 1SNMA 3NTIA 1SNCA 3I70A 1G8ZD 3S1QB 3VR4A 2F1MA 3I73A 1M8AA 4G7HC 4OO1G 1RHPA 4H44C 4EVOA 4F87A 4A3BB 1SNOA 5C0XJ 2RQXA 1TY0A 2OEOA 2IWHA 3H94A 4F8MA 3MXPA 1LT3D 4KMUC 5C3WA 4K6DA 3SHLA 4DN4M 2O5IC 3VYSA 1PDQA 4K5VA 1WTRA 3AB9A 3QWNA 3TBIB 4IFDJ 3I3CA 4FO2A 3EQLC 2EYOA 4X3SA 4K5XA 1PRTB 4NP5A 2NB0A 1B2TA 2KEEA 1B1ZA 3VA7A 3OW7A 2B2WC 3U9SA 2NYZD 1PFNA 2SNSA 4N9TA 5CBAE 1X3QA 3R2TA 4H7BA 1CK1A 3GTJB 5EJWA 1SE2A 1V43A 4CJ2C 1H9JA 3QOLA 1WD1A 5C5MA 1BDOA 2JE6I 3D6CA 4CKEA 2RBMA 1SYCA 2EPBA 1GUNA 2F0HA 2PW5A 1SJHD 1IW7C 2F0MA 4A3GB 2NTTA 3VYTA 3T4AC 1NR2A 1JORA 1MI2A 1W6KA 2D62A 3FPPA 3SXHA 5JVH3 5DM73 1T5XD 1O7ZA 4DXFA 2WKCA 3M3YB 2D9UA 1ZYRD 4HN7A 2E76C 3C1EA 2MPMA 2RSNA 4ZUJA 3S9WA 3LX0A 5JEAJ 1J8IA 1EY0A 3FEWX 4DNRB 2R92B 5IT9L 3SK8A 4DXGA 3NTKA 2IW3A 5C3EB 5I6YA 3S1NB 1I4QA 5CV6A 1K8OA 4ZUIA 1Q12A 3NQTA 2IX1A 1I4HA 2CHBD 5DAUA 1FNVA 1EIGA 2TSSA 3NWSA 1XXGA 2B2TC 3QOJA 3BYYB 2RVLA 1AFPA 1WTVA 2BA0A 2RSOA 3A56A 3V05A 5M9OA 1RD9D 2KJXA 2ICIA 5IGEA 1GUOA 1AW7A 5KNBA 4UAIA 5C0XH 4HEDA 2L4NA 4Q5VA 2JA5B 1EZ8A 4BY1B 1SSOA 4A3JB 1PRTF 2F0OA 1HHVA 2F0LA 1DXMA 4K2LA 5A2QL 5C0XG 1BXTA 5E3FA 5G3LF 2Z1CA 3MWYW 1EWCA 1H9SA 2WACA 4L6TB 3NE5B 1W6JA 5I9OA 1HA6A 4FF4A 4IFDH 3M7NA 1S5DD 1IKMA 1NR4A 3D31A 1PFMA 1JE4A 4IFDG 3KLSX 4RGTA 4WORA 1RJTA 5IGDA 1TT2A 3OMGA 3A7LA 3QJYA 4XT1B 4M1UB 5TSSA 3SDZA 2JP1A 3ERQA 2XN9C 4HMIA 2OT2A 3SK4A 4FXGC 2K5WA 3SK5A 1ICWA 4FVMA 2E2DC 1SYGA 4DNTB 5K5PA 3BDOA 4PQXA 2L12A 3S2DB 2WKDA 3ITPA 4K6LA 2EZVA 1PMRA 3QO2A 3FPUB 4QUFA 5KEEA 3K6OA 1I4XA 3KBGA 3NHHA 3Q6SA 4FF2A 2JA8B 2QCPX 3CHBD 3K5LA 1A15A 1OXUA 3LNNA 4R9WA 3PIO3 1RCVD 3J7AV 5JEAH 3VR6A 1U4PA 5FLXE 1ZYRC 4XT3B 3EJIA 3P20A 5JEAG 2NBFA 2AUJD 3PO2B 1F2LA 3GTOB 4A3DB 4X3KA 3VR3A 1HFNA 3F2UA 4XQNA 4ZRZA 3S14B 2B2YA 5EKKA 1LT5D 4KKTA 4RHSA 2F0JA 5DM63 3SE0A 1LTBD 1QCBD 1LO5D 2ICEC 2M2LA 3R93A 3A54A 1WCMB 1EEFD 1G291 4KY6A 2RDGA 2Z4IA 1GUGA 1SE3A 3D6WA 1JR0D 1VMCA 5JAVA 2EJFC 4BY7B 3IKJA 3N6RA 1PTOB 5I6WA 1VF7A 5DEHA 2F0NA 4ILWA 1Y1VB 4EQNA 3VA5A 2PZWA 2F0VA 1O7YA 3LWUA 3UI2A 5K36H 4G4KA 3RZDB 5EQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X3Q A;  4R9W A;  1KNE A;  1QNK A;  2EE1 A;  2FHT A;  1O80 A;  4UAI A;  1WD0 A;  1TVX A;  2NZ1 D;  3H91 A;  1WTX A;  5EJW A;  2K01 A;  2KOL A;  2X6L A;  3G7L A;  2L4N A;  3GV3 A;  3KBX A;  4HED A;  5COY A;  4U68 A;  4CJ2 C;  1HUN A;  1MSG A;  3DEP A;  1U4P A;  1WD1 A;  2K1B A;  4CJ1 B;  3N52 A;  1XYI A;  1SSO A;  4MN3 A;  2N55 A;  1F9Q A;  2HDL A;  4XDX A;  1HHV A;  2L9H A;  4CJ0 B;  1WTW A;  2FIN B;  2K05 A;  3P7J A;  5EPJ A;  2DY8 A;  2HUG A;  4XT3 B;  2EPB A;  5CBE E;  1CA5 A;  2KEC A;  4RAU C;  3IFD A;  3LWE A;  1QE6 A;  1JIC A;  3MWY W;  4HSV A;  2FFK B;  4O42 A;  1DOM A;  2HCC A;  1B53 A;  4QUC A;  1ILP A;  1E0B A;  1SDF A;  1G6Z A;  1F2L A;  1C8C A;  1WTP A;  1EL0 A;  1ILQ A;  1G2S A;  4X3K A;  1HA6 A;  1ESR A;  1F9S A;  1MGS A;  1LV9 A;  1EQT A;  1NR2 A;  4HCS A;  1CA6 A;  2DY7 A;  1CM9 A;  1MI2 A;  1RTO A;  2B2T A;  4RA8 A;  1ZXT A;  1HFN A;  1MSH A;  1PLF A;  3F2U A;  2IL8 A;  2BDN A;  3I91 A;  1O7Z A;  3GV6 A;  1NR4 A;  4ZLT F;  4R8I A;  1IKM A;  1IKL A;  1SAP A;  2J7Z A;  1HUM A;  1M8A A;  2K03 A;  2D9U A;  1RHP A;  2EOT A;  1PFM A;  5EPK A;  2N88 A;  1JE4 A;  1AP0 A;  1HRJ A;  1WVL A;  2B2Y A;  3ONA B;  2B2V A;  1RJT A;  5D14 A;  2MPM A;  2RSN A;  5T1G A;  4ZAI A;  1NCV A;  2B2U C;  4XT1 B;  3KUP A;  3MTS A;  3TN2 A;  5JJZ A;  1U4M A;  1J8I A;  2NWG A;  3DEO A;  2MP1 A;  4X3U A;  3TZD A;  5D65 A;  2JP1 A;  2X69 A;  2H1E A;  4IUP A;  4IUQ A;  2R3Z A;  5EKI A;  2FJ2 A;  4OIJ A;  3SVM A;  2KUM A;  1B4O A;  2M2L A;  4DN4 M;  3R93 A;  1G2T A;  2B2W A;  1HFG A;  3IL8 A;  4LMQ D;  1VMP A;  1IL8 A;  2RA4 A;  1ICW A;  5COR A;  3DM1 A;  4IUU A;  1PDQ A;  1S4Z A;  2L11 A;  1KNA A;  3HP3 A;  2HCI A;  4X3T A;  2X6G A;  4ZKC B;  1F9R A;  2KED A;  2MGS A;  3FDT A;  2HDM A;  4IUT A;  3I90 A;  2CVR A;  4RWS C;  5DNF A;  5T1I A;  4IUV A;  1WTR A;  1AZP A;  1DON A;  2K04 A;  1BBX C;  2L12 A;  3D6W A;  1VMC A;  2VXW A;  3I3C A;  1EOT A;  2MJ8 A;  1QG7 A;  5AFW A;  4X3S A;  1ROD A;  2L1B A;  3FPU B;  2SDF A;  3QO2 A;  4MHE A;  5E4W C;  1BF4 A;  1ML0 D;  1J9O A;  1EIG A;  4QUF A;  5CMD A;  1B3A A;  5EPL A;  1WTQ A;  1B50 A;  2FMM A;  1B2T A;  2KEE A;  1Q3L A;  1G91 A;  1NAP A;  2K28 A;  2Q8T A;  2B2T C;  1U4L A;  1DOL A;  3I8Z A;  4OIK A;  2RVL A;  4IUR A;  1F9P A;  1WTO A;  1O7Y A;  3Q6S A;  4HAE A;  1X3P A;  3UI2 A;  2B2W C;  1EIH A;  1RTN A;  1X32 A;  2KVM A;  2B2U A;  1AZQ A;  4ZK9 B;  2JYO A;  1WTV A;  1A15 A;  1U4R A;  1DOK A;  2NYZ D;  2RSO A;  4ZKB B;  1PFN A;  1PFB A;  4NW2 A;  1BNZ A;  1DZ1 A;  2XIW A;  5E4X A;  1XX8 A;  5CBA E;  1GUW A;  2Q8R E;  2B2Y C;  5EQ0 A;  1BO0 A;  2B2V C; 
#chains in the Genus database with same CATH topology
 4MTK A;  4LF6 L;  2F0Q A;  5K36 G;  3ND9 A;  2B29 A;  3J81 i;  1PZI D;  3CQZ H;  2EYM A;  2FXQ A;  3M9B A;  2JA6 G;  1VQ5 A;  3JAM c;  1K8A C;  1D7Q A;  1FJG Q;  2GVB A;  3NP8 A;  3IAY A;  1QWY A;  2ZTC A;  1XTC D;  4J6H A;  4KI0 A;  1FYC A;  4F7X A;  2E75 C;  1BR9 A;  1GKH A;  3I4M G;  3FRP B;  4DV3 L;  2VY3 A;  4JI3 L;  3H6M A;  1A2T A;  2NTS A;  1PH4 A;  1ET6 A;  4DA2 A;  4CKB A;  2C5C A;  4WJW A;  1A62 A;  2M00 A;  3F1Z A;  3PSI A;  3TRE A;  5C4X B;  1SAP A;  4JPB W;  2F0D A;  4LWC A;  3Q22 A;  5BN3 A;  3HOV G;  5AJ3 L;  4C3I H;  4FDB A;  3VYU A;  4ZYS A;  4K8I A;  4QGU A;  1E24 A;  5FOB B;  2JEB I;  4H0L C;  3A0J A;  1PYB A;  1BCP F;  2VB3 X;  1D5Z C;  3I2Z A;  2AKW B;  2ZXP A;  4K5W A;  4C3I G;  1XNR L;  5C4J H;  1SXT A;  1D5X C;  1EEI D;  2NN6 I;  1QVG A;  4F88 A;  2FJ2 A;  2KUM A;  1B4O A;  2TMP A;  4YWK A;  3GD7 A;  4UP8 A;  1XPO A;  1G2T A;  4A3K G;  3HKS A;  1VMP A;  2RA4 A;  4DUZ L;  4A3C H;  1Y14 B;  3H3V C;  2CFM A;  4X65 L;  3I90 A;  1BKB A;  4FXD A;  4G7O C;  3W2D A;  2F3V A;  2E2H H;  2R93 H;  1XNQ L;  4GKK L;  1EOT A;  4DK3 C;  1MBY A;  1SR3 A;  4A3C G;  4EQO A;  2PW7 A;  2L1B A;  4MHE A;  4NXM L;  2MFI A;  2EVB A;  4TVA B;  1ML0 D;  2J0T D;  2RDF A;  3A5U A;  2R7Z H;  2IHF A;  2I5L X;  4LUO A;  1HZC A;  2FMM A;  2JEA I;  3PO3 H;  2D5D A;  2K28 A;  2F0P A;  1JWS D;  4FNF A;  4JI4 Q;  1VQI A;  4DR5 L;  4R4I A;  1A3T A;  2A8V A;  3K58 A;  4B9X A;  4C3J H;  1PZK D;  4XIG S;  4NW2 A;  3PO3 G;  2EY5 A;  3P1H A;  1HTP A;  3H09 A;  2IPK D;  2XIW A;  1CZG A;  2LMC B;  1WTX A;  2PYK A;  1KDA A;  4C3J G;  3CPF A;  1CQF A;  5LMU Q;  1N34 L;  3HKZ B;  1PTO F;  1SFO B;  2KHJ A;  2N55 A;  5FO7 B;  1F77 A;  1Q82 C;  2F0F A;  1KLG D;  5C44 B;  2QEX A;  3M4O B;  3OTO Q;  2WP8 J;  1Q81 C;  1CA5 A;  2JK8 A;  1B9N A;  1SNP A;  4JI5 Q;  3IFD A;  1JOO A;  4LF7 L;  3EN2 A;  4YY3 Q;  1SRO A;  5CGK A;  1B53 A;  1MHW C;  1SYD A;  5BR8 Q;  1SBB B;  2XTI A;  4KD4 A;  3A8J E;  4XXE A;  2EYF A;  1QZH A;  2B3G A;  2CKZ B;  1HZB A;  2UUA Q;  2IL8 A;  4B3R L;  1L0X B;  3C3L A;  1DYQ A;  2QGQ A;  4IAL A;  4HID A;  1UWV A;  2K75 A;  2XWB B;  5CV7 A;  3ONA B;  1II3 A;  4LF6 Q;  2B2V A;  2XNA C;  2CH4 A;  3J81 L;  2EQS A;  2Z9H A;  1Y8P B;  3KDF B;  3MTS A;  1U4M A;  3GTK B;  3L7Z C;  5J39 A;  1ASZ A;  4IJL A;  4B3T L;  2E74 C;  2MP1 A;  5M3F H;  1EY6 A;  4MIU A;  1S5E D;  2H1E A;  1SNQ A;  2AUK A;  4KD3 A;  3TDQ A;  1YEZ A;  3TQY A;  2IX0 A;  4GN5 A;  3K7A B;  3RLO A;  3W1G A;  1NMF A;  3PMF A;  3J7Y W;  1HFG A;  4DV0 L;  3NBH A;  2QKI C;  3NEM A;  4LF5 L;  1PYS B;  2HCI A;  5M3F G;  1DM0 B;  4JI3 Q;  1S40 A;  1PVO A;  1STA A;  3H3V I;  4A3F B;  3AYH B;  4C1N I;  5E1F A;  4PG3 A;  1I3Q B;  1Y1W G;  2Y0S B;  5KYL A;  3HOY B;  1W3S A;  2PI2 A;  5M5X B;  2JA7 B;  4KHV A;  1R4P B;  5J22 A;  2ASB A;  5AJ3 Q;  3QIA A;  4R4Q A;  4JBJ A;  1PXU A;  3DMU A;  5IIF A;  3BDC A;  1IYU A;  5BN5 A;  3HS0 C;  4C3H H;  3S16 H;  1XNR Q;  4AYB G;  3IFT A;  3SR1 A;  2QW7 A;  2ZXO A;  4HJ7 A;  1B7Y B;  1N8R C;  4A93 H;  1C9O A;  4DAY A;  4BS9 A;  1GO3 E;  2FHT A;  3T53 B;  4JI7 L;  4C3H G;  2DJG C;  3T1Y L;  1Q90 A;  2K01 A;  2KOL A;  3KBX A;  2F52 A;  4KN7 C;  4CJ1 B;  4GS3 A;  1IL2 A;  3HOX B;  4R4C A;  1V1P B;  1F9Q A;  3F8T A;  5CV5 A;  4A3M H;  2L9H A;  2UUB L;  4C2M B;  3J7A F;  4O1N A;  5CBE E;  5LL6 X;  1DGS A;  4Y52 H;  2SNM A;  1SDF A;  1YNX A;  4JG2 A;  4IZ8 A;  5LHY 1;  4X62 L;  2SEB D;  5FJ8 H;  1PFS A;  4A3M G;  3T56 B;  2Z4H A;  1LV9 A;  2VUM H;  3PIO A;  1Z6H A;  5M3M H;  3I72 A;  1E1T A;  1EU4 A;  1PLF A;  1RF2 D;  2EY2 A;  3MXU A;  4MTN A;  1LUZ A;  4LNQ A;  2HQE A;  4R8I A;  2NVY B;  1CI3 M;  1VQG A;  3PQI A;  3S1R H;  4WFN 3;  1YIJ A;  5FJ8 G;  4JBK A;  2VUM G;  4J15 A;  3KJP A;  3HOU H;  5M3M G;  3PIP A;  3CC4 A;  5IOC A;  1LT4 D;  3CAM A;  3HFZ B;  1F2Z A;  5IGG A;  1GHJ A;  2B2U C;  4JI8 Q;  4E6I A;  3MZ5 A;  2VQF L;  4OWW B;  4YHH L;  1JWU D;  4BBS H;  3DEO A;  2KA7 A;  2F0S A;  1UE5 A;  5C5L A;  3HOU G;  1G6P A;  4IPH A;  1GJX A;  3T51 B;  1BOS A;  4DR7 Q;  3M7G A;  3J80 E;  2R3Z A;  1D2B A;  3SVM A;  2IT1 A;  1QVF A;  1VCI A;  4B3M Q;  1K83 B;  3D4R A;  2WFW A;  1ZEQ X;  2PQA A;  1WTH A;  1HNX Q;  4IQZ A;  5COR A;  3OWF A;  4RGN A;  2QDL A;  1A8V A;  2MNA A;  3FDT A;  4LJZ C;  3ND8 A;  1BVS A;  2PQE A;  4IUV A;  2BOS A;  2Z6K A;  2K04 A;  1BBX C;  5HY6 A;  1JE5 A;  4BXX H;  2VXW A;  2K33 A;  4Q0F A;  1AEX A;  1E2V A;  1GXD C;  2D0O A;  3FMC A;  4A4I A;  5IGC A;  2D2C C;  3MEF A;  1IHZ A;  1QNU A;  4OON A;  2OTJ A;  2RF4 A;  1VQK A;  1EY4 A;  4OO1 I;  4K0K Q;  4OIK A;  1WTO A;  3G6E A;  2LS0 1;  4HAE A;  1EIH A;  4QF4 A;  1KTK A;  1YNN D;  2JYO A;  5A35 A;  2XVS A;  4P74 A;  1DOK A;  2D0P A;  4NMZ A;  4G7Z C;  2Q8R E;  1U5K A;  1EYC A;  3KFU A;  1EIF A;  4JW0 A;  3F2D A;  1O80 A;  3RNU A;  2NZ1 D;  4DV0 Q;  2XWJ B;  2IHE A;  1SN8 A;  1B70 B;  1JOQ A;  2NVT B;  2XSC A;  5IY0 A;  4JVZ A;  2QDB A;  3KOJ A;  2HDL A;  4O0A A;  3S1Q H;  1VDZ A;  4ZQ3 A;  1NUC A;  3CCQ A;  2PO4 A;  1HZA A;  1IBL L;  4DAV A;  4A3B H;  2FFK B;  4O42 A;  1DOM A;  4HIK A;  4QUC A;  4LFA L;  4I7Z C;  4OHJ A;  2B63 B;  2FMC A;  4OWT B;  3BVG A;  3D8G A;  4CDF C;  4EGV A;  4DFA A;  2AWO A;  2F3I A;  4A3B G;  1TS5 A;  1RKN A;  4AYB E;  1IXR A;  1B44 D;  2EOT A;  1XMQ L;  2BCO A;  2ZTD A;  3OIP A;  1AP0 A;  3GTP B;  1CZW A;  3T1Y Q;  4C1N K;  4IO9 A;  1I50 B;  3RN5 A;  3H0G B;  2NZH A;  1PHJ A;  1EY8 A;  4GKJ L;  2A74 C;  3EVQ A;  5D65 A;  2K5Q A;  3R3O A;  1YIT A;  4A75 A;  3OSO A;  1KDB A;  2EXZ A;  4OIJ A;  4DR6 L;  2YTX A;  3AEV A;  2OXP A;  4JI0 Q;  5HUR A;  2F0I A;  3TSS A;  1KAA A;  2K5V A;  3CRL C;  2A6E D;  2G5D A;  2X6G A;  1F9R A;  2L5T A;  3L2P A;  5ELD A;  5I4D A;  3KYH C;  1DON A;  1FGU A;  2EYP A;  4ODG A;  3NSW A;  1SMX A;  3BZK A;  3GTQ B;  4V0B A;  1ROD A;  2SDF A;  3BJU A;  1SEB D;  1T5E A;  3DLL A;  3GTL B;  1V9P A;  5GRO A;  3GTJ H;  3Q8D A;  1Q3L A;  1QUQ A;  2V1C C;  1DOL A;  5CC4 A;  2PMZ E;  2I07 B;  4UDU C;  5C4H A;  5ELN A;  2VQF Q;  4OL7 A;  1WFQ A;  1VQA A;  4BBR B;  4ID6 A;  1Q46 A;  1FJG L;  1PFB A;  2A73 B;  1TS4 A;  1MJE A;  5FKA C;  1TWA B;  3MXN B;  3K57 A;  2UXC Q;  1GD7 A;  4A3E B;  4A3G H;  3I4M B;  1B9M A;  3WWV A;  3TRZ A;  4XDX A;  1JCK B;  4DR1 L;  1TY2 A;  3M3Y H;  4A3G G;  3HOV B;  1TWC B;  1SE4 A;  4DKA C;  5DLQ E;  1HPC A;  2QIL A;  4HCE A;  3KDF A;  4LFB L;  5JJI A;  1CA6 A;  4B08 A;  1RTO A;  3BU2 A;  2B2T A;  4NKL A;  4GLA C;  1T9H A;  2R92 H;  3I91 A;  2Q2H A;  1PH8 A;  2EYJ A;  1K28 A;  3BYT B;  3NWT A;  3R8B A;  1CKM A;  2MHV A;  4A3K B;  1BCP B;  5C3E H;  3MFG A;  1S5F D;  2BDO A;  5IT9 E;  2E2J B;  1O7I A;  3S1N H;  2R92 G;  4EQP A;  3KUP A;  5KNC A;  1NNX A;  3HGB A;  5ISR A;  1XWE A;  2A69 D;  2NVQ B;  5FO9 B;  3D3R A;  3RR5 A;  4XYQ A;  2R7F A;  2VL6 A;  1EY7 A;  3RN2 A;  2LXK A;  5GQO A;  3KJO A;  4B9W A;  5C0X I;  1K73 C;  1YBY A;  1YNN C;  3NPP A;  1X3E A;  4LFA Q;  1SMY D;  3S2H B;  4TRD A;  1ENF A;  5ELC A;  4G57 A;  3DXJ C;  1LTR D;  2ZTE A;  1IYV A;  1LTG D;  4JCV E;  1NBW A;  1O78 A;  1Z9F A;  1QG7 A;  1LAC A;  1EYG A;  1UE6 A;  4M8A A;  2CW0 D;  1C48 A;  3UDF A;  1XMQ Q;  5EPL A;  3CRK C;  2Z8L A;  1CUK A;  3IRB A;  2JA5 H;  3TP6 A;  4BY1 H;  4EQ5 A;  4IFD I;  2M9V A;  4A3J H;  1LLR D;  1V1P A;  1QZG A;  2ATW A;  1KLU D;  4V19 0;  4GKJ Q;  1C4Q A;  2MQH A;  2YYZ A;  3FKI G;  1N36 L;  3RMH A;  5E7N A;  1JJ2 A;  4FYD A;  2JA5 G;  4CBV A;  4U67 3;  4BY1 G;  3J80 i;  4BA1 I;  5GAH C;  2IX3 A;  4DK1 A;  4QCL A;  3OTO L;  5IGB A;  1TQO A;  4A3J G;  4JI5 L;  5A2Q E;  4TSS A;  3GV3 A;  4YY3 L;  3E5S A;  1L1O A;  2K6A A;  5BR8 L;  4K8J A;  2WV6 D;  2UXB Q;  3A7A B;  1ZKO A;  1EQQ A;  3L0O A;  1EYA A;  1DCZ A;  3CF5 A;  2J4X A;  3PUY A;  4JOI A;  3CW2 C;  2MO1 A;  2WAQ E;  1QOH A;  1CFM A;  1ILP A;  1VQ4 A;  3Q23 A;  4LFC Q;  1EL0 A;  1ILQ A;  1MJC A;  3CCV A;  2UXD L;  4AQY Q;  1EU3 A;  1LT6 D;  1ZXT A;  3K0Y A;  2QEJ C;  2PNH A;  1S5B D;  2YTV A;  2AQ2 B;  4KN4 C;  1EY5 A;  3S1M B;  2IY5 B;  5I2X A;  2A6E C;  3W1B A;  1BBW A;  1WVL A;  5IYC H;  1SYF A;  4CDE C;  4KY5 A;  3OIQ A;  2NUC A;  2EXD A;  3J81 c;  2DN8 A;  3TN2 A;  4X64 Q;  2CQA A;  4FXK C;  3P75 A;  4X3U A;  3S2D H;  1CKO A;  4L63 B;  3CC2 A;  3K5N A;  1Y1W B;  3SEB A;  1Q86 C;  5IYC G;  5LL6 S;  5EKI A;  4DR1 Q;  3RLF A;  4CHT B;  1LTL A;  2KCN A;  2KQ3 A;  3PUX A;  3MVV A;  1IL8 A;  2ID0 A;  2OF1 A;  3GTM B;  3HG9 A;  4X3T A;  1HJP A;  5M5Y B;  1B3Q A;  5T1I A;  4LFB Q;  2WII B;  2JA8 H;  4QQB X;  1Q8I A;  1RL2 A;  3WOF A;  1ICF B;  4RKL A;  2H4O A;  3URY A;  3NBI A;  4DR4 Q;  3U4Z A;  3BVZ A;  1KQS A;  1J9O A;  1STE A;  1SLJ A;  2N49 A;  1B3A A;  2JA8 G;  1NAP A;  4QY7 A;  1ET9 A;  1PH5 A;  5L37 A;  1E2W A;  3NTH A;  4IUR A;  1TWG B;  1GUS A;  4Y7N B;  4RCO A;  4OEM B;  3VYR A;  4C56 C;  4GNX C;  4ZKB B;  1DZ1 A;  1R4Q B;  1BNZ A;  1N9W A;  1GUW A;  1H9K A;  5IYD H;  4PMW A;  2RCF A;  2HDM A;  5CR3 A;  3C46 A;  3MHB A;  3PO2 H;  3DHQ A;  1G51 A;  1D6E C;  3GTO H;  4A3D H;  4H13 C;  2X6L A;  3G7L A;  5COY A;  2ZM6 Q;  1STG A;  5ELO A;  3I4N B;  5IYD G;  2R93 G;  1I4G A;  2WIN B;  3X3M A;  4OX9 L;  1FNW A;  3E6Z X;  1E2Z A;  3PO2 G;  1K8G A;  3HEJ A;  2HUG A;  2VZA A;  1UEA B;  2R7Z G;  3S14 H;  5KGU A;  1LTI D;  1OXX K;  3AMU A;  1JB7 A;  2BA1 A;  1HCZ A;  1JWM D;  1STN A;  1K0R A;  2A69 C;  2PMZ B;  3C1F A;  2UU9 L;  4UP9 A;  4RA8 A;  3T13 A;  5I9P A;  4L8J A;  1QUQ B;  4BWG B;  1IZ6 A;  5CV8 A;  1S5C D;  4JI8 L;  4L5S A;  4ZLT F;  2BH8 A;  1HQR D;  5IP7 H;  4QMG A;  1N36 Q;  2K14 A;  3W3A A;  1D5M C;  2N88 A;  3DWQ A;  4DR7 L;  1SMY C;  1WCM H;  2F4I A;  2EY1 A;  4B3M L;  2PPB C;  1D1K A;  4IJH A;  1HNX L;  1H9M A;  5IP7 G;  3KF8 B;  4YCV A;  1EWH A;  1B8A A;  5ELF A;  3DUZ A;  1WCM G;  5CYU A;  2CW0 C;  2ENB A;  4BY7 H;  3NQI A;  4YIJ A;  3SK6 A;  3F2B A;  4KY7 A;  1PTO H;  1EWI A;  4HSP A;  2G9H D;  4HJ5 A;  2RHS B;  5KYI A;  1VQB A;  1STB A;  3S15 B;  1Y1V H;  1S4Z A;  2L11 A;  2E8G A;  5JPM C;  5FO8 B;  4NB3 A;  4KK7 A;  4RWS C;  4BY7 G;  1X55 A;  4LUV A;  3PUW A;  2UXD Q;  4LAA A;  4K0K L;  4FF3 A;  3M4Y A;  3ZYY X;  4K2K A;  3EIV A;  3RZD H;  2YU9 B;  2DJF C;  1Y1V G;  1STH A;  1YHA A;  3MXN A;  2K50 A;  4OWX B;  1O7L A;  4DR2 L;  2CWA A;  4LW1 A;  2AQ3 B;  5JJK A;  2K5D A;  3MAQ A;  2LSS A;  4RMF A;  2K5H A;  3T1H L;  1X54 A;  2IJ0 A;  4RGO S;  3PCO B;  2VNU D;  2B8G A;  2F3W A;  3MA2 B;  1XX8 A;  1AE3 A;  5FLX c;  2Q2U A;  3ZJY C;  1J5E Q;  1KNE A;  1QNK A;  1VQJ A;  3I4L A;  4I7A A;  1VQO A;  1D8L A;  5EBC A;  4U68 A;  1HQM C;  2NVX B;  3K80 C;  1XYI A;  1FVI A;  1I6V C;  2ALY B;  1JMC A;  2ZJQ A;  3OOC A;  2K05 A;  5C4X H;  1A0I A;  3GTG B;  1I4P A;  2EJM A;  5CV9 A;  3HOW B;  4QJF A;  2WB1 G;  1A3V A;  4CDD C;  4KTA A;  5BN4 A;  1WTP A;  1K0S A;  1ESF A;  3K0X A;  3AFQ A;  3V2T A;  1KHI A;  4GOP C;  4JBW A;  4FF1 A;  1TR5 A;  4A3L H;  3GV6 A;  1U9R A;  2P5Z X;  5IYB H;  1LTT D;  1Y8N B;  4A93 G;  4KHZ A;  1E3P A;  1IBM L;  4KJO A;  3L3O C;  1PRT D;  3HOZ B;  3CKI B;  3X3N A;  5D14 A;  1I94 Q;  2AWN A;  1RIP A;  4JI0 L;  4A3L G;  2GVA A;  3RZO B;  5IYB G;  5G3L D;  4Z9C B;  3Q24 A;  3HRZ C;  1KD1 C;  1NTG A;  4R4T A;  4OX9 Q;  1L1O B;  4KV6 A;  4DPG A;  2EIF A;  2WAQ B;  1PH9 A;  3S17 B;  3UE1 A;  1K8M A;  3BVM A;  1PH2 A;  3HP3 A;  4ZKC B;  2KED A;  2CVR A;  3PF4 A;  2UU9 Q;  4RCN A;  2LFN A;  1A6X A;  4P73 A;  1TKW B;  1TWH B;  3V96 A;  2KHI A;  5AFW A;  1A3U A;  3GQB A;  2R61 A;  1EQV A;  1PH6 A;  3OWE B;  4TQU S;  2R7D A;  3WDN A;  1BQQ T;  1ENA A;  1U0L A;  2KEN A;  2UXC L;  2ZXR A;  3TP5 A;  1SFO H;  4BBS G;  1FD7 D;  4HJA A;  2JXM B;  1NJI C;  5C44 H;  2AHO B;  3M4O H;  5E4X A;  5DNF A;  2RHQ B;  3K81 C;  4XQJ A;  2XRS D;  3HKZ G;  2EE1 A;  1WD0 A;  4UPA A;  1VS0 A;  1TVX A;  3PUZ A;  4J1M A;  4ABN A;  4X6A H;  1KL9 A;  2RDH A;  1S3O A;  3DEP A;  1V8Q A;  3WOE A;  3CME A;  4DK6 C;  4DAM A;  2EY6 A;  4BXX G;  3QR8 A;  4HIO A;  1RDP D;  2LKV A;  1GHK A;  1JB3 A;  1KAB A;  1JJG A;  1BUV T;  3CP0 A;  4KKU A;  3E3X A;  4QL5 A;  1C0A A;  3MEH A;  5FLX L;  2C9O A;  3ERS X;  3D4W A;  3JAM E;  1G6Z A;  4DR2 Q;  1EZ6 A;  1C8C A;  1G2S A;  1ESR A;  4A3I B;  1MGS A;  4HCS A;  3CCL A;  3T1H Q;  5NUC A;  3GTK H;  1SYB A;  3CU7 A;  1ENC A;  4H02 A;  2BDN A;  1TWF B;  3J81 E;  2I5H A;  1IKL A;  2J7Z A;  3K7A H;  2K03 A;  1Y69 U;  2LXJ A;  2AMC B;  1AN8 A;  3AU7 A;  2EJG C;  5ELE A;  2JSO A;  2F0W A;  3UDG A;  3NXW A;  1J6Q A;  3T16 A;  3U9O A;  4LF4 Q;  4A3F H;  1VQ6 A;  1I3Q H;  3TZD A;  3HOY H;  2X69 A;  5M5X H;  2JA7 H;  4IUQ A;  2JN4 A;  2KCT A;  2B2W A;  4HTH A;  3ERO A;  4A3F G;  3FVQ A;  1OO9 B;  1WJJ A;  3HZX A;  1N33 Q;  2E2I B;  2WB1 E;  3EA6 A;  2JJQ A;  2Y0S G;  3HOY G;  1AZP A;  1XJV A;  2JA7 G;  3GO5 A;  3CCR A;  1LYL A;  4DGZ A;  2A68 D;  1E22 A;  1P8L A;  4N9P A;  4RFB A;  3CCU A;  2MJ8 A;  5JVG 3;  1I6H B;  4DR3 L;  3FKI B;  2O5J C;  3PGZ A;  5KRU A;  3R2I A;  3LGJ A;  4QB4 A;  1F2M A;  1OXV A;  2A6H D;  1WTQ A;  1IBM Q;  1B50 A;  1QIL A;  1G91 A;  4NDX A;  1D1I A;  2N8N A;  2Q8I B;  4DU9 A;  4APV A;  3HOX H;  2EYH A;  1GVP A;  1EFI D;  1VQP A;  5FK9 C;  2B2U A;  2PZU A;  4ZK9 B;  1EOV A;  4QIW E;  1U4R A;  1CTM A;  2UUC Q;  2UXB L;  2OQK A;  4C2M H;  4CGY B;  5GAG C;  2A1A A;  5IWA L;  4KHP L;  2B2Y C;  1PH3 A;  5IP9 H;  1UUP A;  3HOX G;  1N32 L;  3OPO A;  1CHQ D;  4P71 A;  3TME A;  3TEH B;  2F0K A;  1IBK L;  1PH7 A;  3U4V A;  3E0J A;  1R9T B;  2F03 A;  5M5W B;  4IN3 A;  4LFC L;  1XMO L;  3MXG A;  1L0Y B;  1FR3 A;  5FLM H;  5IP9 G;  4AQY L;  4P2C B;  4CJ0 B;  3P7J A;  2NVY H;  1EFW A;  4I65 A;  1CT1 D;  1PRT C;  1X65 A;  2JA6 B;  1FNU A;  1HA5 A;  1TII D;  1UE1 A;  3DWA A;  3KK7 A;  2EDG A;  4HSV A;  3VR5 A;  4ME5 A;  3SGI A;  3O13 A;  5FLM G;  4TKO B;  1EQT A;  1VF5 C;  1OXT A;  3CQZ B;  3KF8 A;  4RG1 A;  3M4Q A;  2EYL A;  3ULJ A;  3I7F A;  1PH1 A;  1MKH A;  1Z47 A;  4X64 L;  1E7Z A;  4L5R C;  2XRQ D;  4GZY C;  4PNY A;  1K83 H;  4JK1 C;  1X3G A;  3HKZ E;  4J8Q A;  4DV4 Q;  2I46 A;  5T1G A;  2B39 A;  3G48 A;  1SRU A;  1NCV A;  2F0E A;  3DM3 A;  2JQO A;  3AQQ A;  3EFX D;  2XGT A;  2K32 A;  4XTC S;  2BE5 D;  1AE2 A;  3OMC A;  1M1K C;  4GNX B;  4C3I B;  4DR4 L;  3CXC A;  4IUU A;  2MGS A;  2A5H A;  4IUT A;  2I0Q A;  4POF A;  5C4J B;  5D3D A;  3B6Y A;  1HZ9 A;  5D3I B;  5E4W C;  4GN4 B;  3PUV A;  1BCP D;  4HR7 B;  5C3X A;  5CMD A;  5C3E G;  1WOC A;  1UNS A;  2V4D A;  1V1O A;  2SOB A;  3BS1 A;  1YNJ D;  2Q8T A;  1PYW D;  1VQF A;  2NVT H;  1MD2 D;  5HGT A;  3PIP 3;  1X3P A;  1STY A;  4MZ9 A;  2ZM6 L;  1VQM A;  4XYO A;  2R93 B;  2E2H B;  1XTD A;  1Z7T A;  2NN6 H;  3Q0A A;  2VQE L;  1PZJ D;  1YJ9 A;  3A8I E;  1BO0 A;  1YZ6 A;  2LY7 A;  5I2Y A;  2R7Z B;  3H91 A;  3PO3 B;  2KHS A;  2B63 H;  1TS3 A;  2NN6 G;  1TS2 A;  4PMB A;  1S72 A;  1MSG A;  2K1B A;  4XQQ A;  2Y0S E;  3M85 A;  3C2P A;  4X66 Q;  4C3J B;  3FHW A;  5H1S E;  1F2Y A;  1M4V A;  1SJE D;  1NSN S;  2F4V Q;  5JPN C;  1GOZ A;  4DR3 Q;  2CH4 W;  2B63 G;  4OGQ C;  3GTP H;  1JIC A;  4P75 A;  2HCC A;  3A8K E;  1E0B A;  2HIV A;  4KJN A;  1KXL A;  1I50 H;  3H0G H;  4JC0 A;  1A2U A;  4LF9 Q;  3TP7 A;  3TS0 A;  2DNC A;  4RGM A;  4JYA Q;  4LF8 Q;  3NUC A;  2ZT9 C;  2G9D A;  4DV7 L;  5IGF A;  5KND A;  2PCF B;  5IWA Q;  4KHP Q;  2KBN A;  1HRJ A;  1PTO D;  2F0U A;  3BZD B;  1DJR D;  3J80 c;  2A68 C;  1HR0 W;  4YCU A;  1N32 Q;  4ZAI A;  1EY9 A;  1Q1B A;  3DWP A;  4DV6 Q;  1IBK Q;  1DD2 A;  4IOA A;  1QJO A;  4IUN A;  1XMO Q;  3RD4 A;  5JOB A;  3L9A X;  1Q1E A;  2HHH L;  3GTQ H;  2A6H C;  3GTL H;  4BA2 I;  3MC0 B;  1NY4 A;  3UE0 A;  2QF7 A;  1KNA A;  2DUD A;  4RHR A;  1XPU A;  3TZU A;  3VR2 A;  3JAM i;  1Q7Y C;  3J7Z C;  1MIU A;  3OYY A;  5IE8 A;  1EYD A;  5IOD A;  4BBR H;  2HIX A;  5M3F B;  1EQR A;  1P16 A;  1TWA H;  3K59 A;  1BF4 A;  3TS2 A;  5LMN L;  1V1Q A;  4A3E H;  4L5Q A;  4CKC A;  1JOK A;  1KDC A;  3K5M A;  3ICE A;  4DF7 A;  2O2L D;  2VB2 X;  4BBR G;  3I4M H;  1J5E L;  2O4X A;  1U4L A;  5CV4 A;  3I8Z A;  2HD3 A;  4HMJ A;  1HR0 L;  1AZQ A;  2KCC A;  2KVM A;  4NXN L;  3PF5 A;  4PV1 C;  1JC7 A;  4A3E G;  4GOP B;  3KLS A;  2PNR C;  2B8F A;  1CHP D;  3D0F A;  1TWC H;  4DV5 Q;  4ME3 A;  3HOV H;  1I4R A;  2B2V C;  3OHX C;  4N8X 1;  4AYB B;  2CCZ A;  3D4D A;  3K5O A;  1QB5 D;  2WB1 B;  4K14 A;  2K4K A;  4CDC C;  1HUN A;  3H3V H;  1UAP A;  3STB D;  5KIX A;  1VQH A;  4MN3 A;  4C3H B;  3S16 B;  2DNE A;  4LK1 C;  1WTW A;  4NPS A;  5C4Z A;  3NK9 A;  5EPJ A;  3KF6 A;  2DY8 A;  2R6G A;  4RH6 A;  4KKS A;  4RAU C;  4A93 B;  3LWE A;  1QE6 A;  4A3K H;  2NZO A;  2KCM A;  3I55 A;  2E2J H;  1YJN A;  1SND A;  2BE5 C;  1CM9 A;  1I94 L;  1HTL D;  1MSH A;  4ALP A;  5C6A A;  4QIW B;  2NVQ H;  4A3M B;  5EKL A;  2VQE Q;  1HUM A;  3QB3 A;  1QVC A;  5EPK A;  3QG1 A;  5EGT A;  4A3D G;  2BH2 A;  1H9S B;  1GUT A;  1HXY D;  2AQ1 B;  3S2H H;  3G6J B;  2VUM B;  1IW7 D;  5JJZ A;  5M3M B;  3A74 A;  2NWG A;  5GAD C;  1BCP C;  5ELB A;  2K7V A;  4IUP A;  1LAB A;  1Q8K A;  1TU2 B;  3S1R B;  3GDE A;  1YNJ C;  4DAP A;  4WJ4 A;  1PA6 A;  1PV4 A;  3IL8 A;  4FP5 D;  4LMQ D;  3HOU B;  3DM1 A;  4S3S A;  1VQL A;  2A19 A;  2GA4 B;  1H9R A;  3J80 L;  3GP7 A;  4JI2 L;  1KC8 C;  4BBS B;  2OQ0 A;  3BG3 A;  1OXS C;  4IPC A;  2VW9 A;  4DV7 Q;  1ONL A;  4JI1 L;  4DK0 A;  1CKN A;  3RUZ A;  3PV0 A;  2CWP A;  3E9I A;  2OCE A;  5EAY A;  4ULL A;  3TP8 A;  1F9P A;  1FGB D;  1RTN A;  1X32 A;  1OTC A;  4WRD A;  4DV2 L;  1LTA D;  2HHH Q;  4ZCK A;  2H5X A;  1Y8O B;  2F0G A;  1SYE A;  2MUY A;  4IPG A;  4PMC A;  4DV1 L;  3MFY A;  4RKB A;  3KLR A;  3E9H A;  1LTS D;  3A55 A;  3JAM L;  1JQY D;  4DUY L;  4JV5 L;  5J1Z A;  2L0C A;  3N52 A;  1VQN A;  3JC6 6;  4JBM A;  5EBD A;  3BDL A;  4B3S L;  4R8N A;  2FIN B;  1PTO C;  3S1M H;  1CQV A;  1YJW A;  1SE8 A;  5F2D A;  2L55 A;  2KEC A;  5LMN Q;  5GAE C;  3BZC A;  1E1O A;  4OO1 H;  2ZJR A;  1F9S A;  3K8A A;  2Z6K C;  2F0T A;  2RKS A;  2DY7 A;  2PZT A;  1IYJ B;  5IT9 c;  1SNM A;  3NTI A;  1SNC A;  1HR0 Q;  3I70 A;  1G8Z D;  4LF4 L;  4NXN Q;  1Y1W H;  3S1Q B;  1XPR A;  3VR4 A;  4AIM A;  2F1M A;  3I73 A;  1M8A A;  4G7H C;  4OO1 G;  4GNX A;  1RHP A;  4H44 C;  4EVO A;  4DV3 Q;  2K5N A;  4F87 A;  4A3B B;  1W2B A;  3GTM H;  1VQD A;  1SNO A;  5C0X J;  5M5Y H;  3I4O A;  2RQX A;  3NEL A;  1TY0 A;  1N33 L;  2OEO A;  2C35 B;  2IWH A;  3H94 A;  4F8M A;  3MXP A;  5C4X G;  1LT3 D;  4KMU C;  5C3W A;  4K6D A;  2PI2 E;  3SHL A;  4DN4 M;  2O5I C;  3VYS A;  1PDQ A;  4HJ8 A;  1X56 A;  3A5Z B;  1X9N A;  4K5V A;  1WTR A;  3AB9 A;  1TWG H;  5J3B A;  3QWN A;  3TBI B;  4Y7N H;  4PZ8 A;  4IFD J;  3I3C A;  4FO2 A;  1X6O A;  3EQL C;  2EYO A;  1HNW L;  4X3S A;  4DUZ Q;  1GM5 A;  2UUC L;  1VQC A;  4P72 A;  4K5X A;  1HNZ L;  1PRT B;  4NP5 A;  2NB0 A;  1B2T A;  2KEE A;  4X65 Q;  1B1Z A;  1VQE A;  3STB C;  3VA7 A;  3OW7 A;  1XNQ Q;  4GKK Q;  3I4N H;  2B2W C;  3U9S A;  3CCJ A;  4NXM Q;  2NYZ D;  3UDX A;  1PFN A;  2SNS A;  4N9T A;  5CBA E;  4JI6 L;  1X3Q A;  3R2T A;  4H7B A;  1CK1 A;  3I4N G;  3GTJ B;  4DR5 Q;  4OEL B;  5EJW A;  1SE2 A;  1ASY A;  1V43 A;  3RLN A;  4CJ2 C;  1H9J A;  3QOL A;  3H15 A;  1WD1 A;  5C5M A;  4JI2 Q;  2Z0S A;  1BDO A;  2JE6 I;  3D6C A;  4CKE A;  2RBM A;  1X3F A;  1SYC A;  2EPB A;  1GUN A;  2F0H A;  4JI1 Q;  2PW5 A;  1SJH D;  1IW7 C;  2F0M A;  1N34 Q;  2GN5 A;  4A3G B;  2NTT A;  4PZ6 A;  3VYT A;  3T4A C;  1NR2 A;  1JOR A;  1MI2 A;  1W6K A;  2D62 A;  4DV4 L;  3FPP A;  3SXH A;  5JVH 3;  1K3B C;  5DM7 3;  3ER0 A;  5C44 G;  1A63 A;  1T5X D;  1O7Z A;  4LF7 Q;  4DV2 Q;  4DXF A;  4N8F A;  2WKC A;  3I56 A;  3M3Y B;  1AH9 A;  2D9U A;  1ZYR D;  1YI2 A;  4O2D A;  4YWM A;  1KAW A;  3S15 H;  4HN7 A;  2E76 C;  3C1E A;  2MPM A;  2RSN A;  4ZUJ A;  3S9W A;  4DV1 Q;  3LX0 A;  4B3R Q;  1CSQ A;  5JEA J;  4DUY Q;  4JV5 Q;  1J8I A;  1EY0 A;  3FEW X;  4DNR B;  2YU9 H;  2R92 B;  5IT9 L;  3SK8 A;  4B3S Q;  4DXG A;  4HIM A;  3NTK A;  2IW3 A;  3KF6 B;  5I6Y A;  5C3E B;  3S1N B;  1I4Q A;  4B3T Q;  2DGY A;  5CV6 A;  1K8O A;  4PZ7 A;  4ZUI A;  1Q12 A;  3S24 A;  1JJC B;  3NQT A;  2IX1 A;  2N3S A;  3G4S A;  1I4H A;  2CHB D;  5DAU A;  4GOP A;  3U50 C;  1FNV A;  4LF5 Q;  1EIG A;  2TSS A;  3NWS A;  2RCN A;  1XXG A;  1BBU A;  4HJ9 A;  2B2T C;  3QOJ A;  3BYY B;  3CC7 A;  1VQ9 A;  2RVL A;  1AFP A;  1L0W A;  2NVX H;  1WTV A;  2BA0 A;  2RSO A;  3A56 A;  3V05 A;  3GTG H;  1HH2 P;  5M9O A;  4X66 L;  3ULP A;  1RD9 D;  2KJX A;  2ICI A;  5IGE A;  1H95 A;  1GUO A;  3HOW H;  1AW7 A;  5KNB A;  2F4V L;  4UAI A;  5C0X H;  1C7Y A;  2ZJP A;  4WJ3 M;  4HED A;  2L4N A;  4Q5V A;  2JA5 B;  1EZ8 A;  4MNO A;  4BY1 B;  3CPW A;  1SSO A;  4A3J B;  1PRT F;  2F0O A;  4LF9 L;  1HHV A;  3HOW G;  1WYD A;  1DXM A;  2F0L A;  2OTL A;  4K2L A;  5A2Q L;  5C0X G;  1BXT A;  4DNI A;  4JYA L;  5E3F A;  4LF8 L;  1HNW Q;  4JI7 Q;  5G3L F;  1K3R A;  2Z1C A;  3MWY W;  3HOZ H;  1EWC A;  1H9S A;  1HNZ Q;  2Q2T A;  4OXP A;  2WAC A;  4GLV B;  3NE5 B;  4L6T B;  4UP7 A;  1KIX A;  1W6J A;  1M90 C;  2E5L L;  5I9O A;  3RZO H;  1HA6 A;  4FF4 A;  4IFD H;  1KRT A;  1CKN B;  2UUB Q;  3VDY A;  3M7N A;  4DV6 L;  1S5D D;  1IKM A;  1NR4 A;  3HOZ G;  3J7A 5;  3D31 A;  3S17 H;  2YTY A;  1PFM A;  4GN3 B;  3CCE A;  3OW2 A;  4JI6 Q;  1JE4 A;  4X62 Q;  4IFD G;  3KLS X;  4RGT A;  4WOR A;  1UEB A;  1RJT A;  2HQL A;  1JT8 A;  5IGD A;  2VS1 A;  1TT2 A;  2CQO A;  3OMG A;  3A7L A;  1L2F A;  3QJY A;  4XT1 B;  4M1U B;  2WAQ G;  5TSS A;  2Q2I A;  1TWH H;  3CMA A;  3AFP A;  2QA4 A;  4UY8 C;  1WI5 A;  3SDZ A;  2JP1 A;  3ERQ A;  1VQ8 A;  1FL0 A;  2XN9 C;  4HMI A;  2OT2 A;  3SK4 A;  4FXG C;  4L5T A;  2K5W A;  4YWL A;  3SK5 A;  1ICW A;  1EIY B;  3J81 j;  1L1O C;  4FVM A;  4YHH Q;  2I5M X;  2E2D C;  1SYG A;  3E0E A;  4DNT B;  5K5P A;  1VQ7 A;  4KLK A;  3BDO A;  4PQX A;  2N78 A;  4UHV A;  2L12 A;  2Z6B A;  3W5O A;  3S2D B;  3ULL A;  2WKD A;  3ITP A;  4JOI C;  4K6L A;  2EZV A;  1PMR A;  3QO2 A;  3FPU B;  2OWO A;  1TXY A;  4QUF A;  4DV5 L;  3U58 A;  3NBH B;  5KEE A;  3K6O A;  3CCS A;  1I4X A;  3KBG A;  3NHH A;  2K52 A;  3Q6S A;  4FF2 A;  2JA8 B;  1LM0 A;  2QCP X;  3CHB D;  3K5L A;  1A15 A;  1YHQ A;  1OXU A;  4R4O A;  3LNN A;  4R9W A;  3PIO 3;  1RCV D;  2MO0 A;  3M4P A;  4IPD A;  4A3I H;  3J7A V;  5JEA H;  5JJL A;  3VR6 A;  1U4P A;  5FLX E;  1ZYR C;  1TWF H;  1NE3 A;  4XT3 B;  3EJI A;  4A3I G;  3P20 A;  5JEA G;  3G71 A;  4A76 A;  2NBF A;  3KLW A;  2AUJ D;  4DAY B;  3PO2 B;  1F2L A;  3GTO B;  4A3D B;  4X3K A;  3VR3 A;  1HFN A;  3F2C A;  2ES2 A;  3F2U A;  4XQN A;  1IBL Q;  1I5F A;  3K7U C;  4ZRZ A;  3S14 B;  2B2Y A;  1KRS A;  5EKK A;  3EBE A;  4YCW A;  2E2I H;  1LT5 D;  4JI4 L;  4KKT A;  4RHS A;  2F0J A;  5DM6 3;  3SE0 A;  1K9M C;  1CSP A;  1YHB A;  1LTB D;  1NMG A;  1QCB D;  1LO5 D;  1I6H H;  2ICE C;  3FKI H;  2JA9 A;  1UE7 A;  2M2L A;  3R93 A;  4LUZ A;  5LMN W;  3A54 A;  4AH6 A;  4IOC A;  5HGQ A;  1WCM B;  1EUJ A;  4GLX A;  1EEF D;  1G29 1;  3CCM A;  4KY6 A;  2RDG A;  2Z4I A;  5LMU L;  3H0G G;  2E5L Q;  1GUG A;  4POG A;  4EX5 A;  1SE3 A;  3CD6 A;  3D6W A;  4DR6 Q;  1JR0 D;  1VMC A;  5JAV A;  2EJF C;  4BY7 B;  1YVC A;  4R1J A;  3IKJ A;  3N6R A;  1PTO B;  5I6W A;  2PQA B;  3FP9 A;  2HT1 A;  1VF7 A;  5DEH A;  2F0N A;  4ILW A;  1Y1V B;  3UDI A;  4EQN A;  1R9T H;  5M5W H;  3VA5 A;  2PZW A;  2F0V A;  1O7Y A;  3LWU A;  3UI2 A;  5K36 H;  2UUA L;  4G4K A;  2L15 A;  3RZD B;  2JA6 H;  2YV5 A;  3NEN A;  5EQ0 A; 
#chains in the Genus database with same CATH homology
 2F0Q A;  5K36 G;  3ND9 A;  1PZI D;  2EYM A;  3NP8 A;  3IAY A;  1QWY A;  1XTC D;  4J6H A;  4KI0 A;  1FYC A;  4F7X A;  2E75 C;  1BR9 A;  3FRP B;  3H6M A;  1A2T A;  2NTS A;  1ET6 A;  4DA2 A;  4CKB A;  2C5C A;  4WJW A;  2M00 A;  5C4X B;  1SAP A;  2F0D A;  3Q22 A;  5BN3 A;  3VYU A;  4ZYS A;  4K8I A;  5FOB B;  2JEB I;  4H0L C;  1BCP F;  2VB3 X;  1D5Z C;  2ZXP A;  4K5W A;  4C3I G;  1SXT A;  1D5X C;  1EEI D;  2NN6 I;  4F88 A;  2FJ2 A;  2KUM A;  1B4O A;  2TMP A;  3GD7 A;  1G2T A;  1VMP A;  2RA4 A;  3H3V C;  3I90 A;  4FXD A;  4G7O C;  3W2D A;  2F3V A;  1EOT A;  1MBY A;  4EQO A;  2PW7 A;  2L1B A;  4MHE A;  2EVB A;  1ML0 D;  2J0T D;  2RDF A;  2FMM A;  2JEA I;  2D5D A;  2K28 A;  2F0P A;  1JWS D;  4FNF A;  1A3T A;  3K58 A;  4B9X A;  1PZK D;  4XIG S;  4NW2 A;  2EY5 A;  3P1H A;  1HTP A;  3H09 A;  2IPK D;  2XIW A;  1CZG A;  2LMC B;  1WTX A;  2PYK A;  1KDA A;  4C3J G;  1CQF A;  3HKZ B;  1PTO F;  1SFO B;  2N55 A;  5FO7 B;  1F77 A;  2F0F A;  1KLG D;  5C44 B;  3M4O B;  2WP8 J;  1CA5 A;  1B9N A;  1SNP A;  1JOO A;  3IFD A;  5CGK A;  1B53 A;  1SYD A;  1SBB B;  4KD4 A;  3A8J E;  4XXE A;  2EYF A;  2IL8 A;  1L0X B;  3C3L A;  1DYQ A;  4IAL A;  2XWB B;  5CV7 A;  3ONA B;  1II3 A;  2B2V A;  2XNA C;  3J81 L;  1Y8P B;  3MTS A;  1U4M A;  3GTK B;  3L7Z C;  5J39 A;  2E74 C;  2MP1 A;  1EY6 A;  4MIU A;  1S5E D;  2H1E A;  1SNQ A;  2AUK A;  4KD3 A;  3TDQ A;  2IX0 A;  3K7A B;  3PMF A;  3J7Y W;  1HFG A;  3NBH A;  2QKI C;  2HCI A;  1DM0 B;  1STA A;  4A3F B;  4C1N I;  5E1F A;  1I3Q B;  2Y0S B;  5KYL A;  3HOY B;  5M5X B;  2JA7 B;  4KHV A;  1R4P B;  5J22 A;  3QIA A;  1PXU A;  3DMU A;  5IIF A;  3BDC A;  1IYU A;  5BN5 A;  3HS0 C;  3IFT A;  3SR1 A;  2ZXO A;  4DAY A;  4BS9 A;  2FHT A;  3T53 B;  4C3H G;  1Q90 A;  2K01 A;  2KOL A;  3KBX A;  4KN7 C;  4CJ1 B;  3HOX B;  1V1P B;  1F9Q A;  5CV5 A;  2L9H A;  4C2M B;  3J7A F;  4O1N A;  5CBE E;  5LL6 X;  2SNM A;  1SDF A;  4IZ8 A;  5LHY 1;  2SEB D;  3T56 B;  2Z4H A;  1LV9 A;  1Z6H A;  3I72 A;  1EU4 A;  1PLF A;  1RF2 D;  2EY2 A;  3MXU A;  2HQE A;  4R8I A;  2NVY B;  1CI3 M;  4WFN 3;  5IOC A;  1LT4 D;  5IGG A;  1F2Z A;  1GHJ A;  2B2U C;  4E6I A;  3MZ5 A;  1JWU D;  3DEO A;  2KA7 A;  2F0S A;  5C5L A;  1GJX A;  3T51 B;  1BOS A;  3M7G A;  3J80 E;  2R3Z A;  1D2B A;  3SVM A;  2IT1 A;  1VCI A;  1K83 B;  3D4R A;  1ZEQ X;  4IQZ A;  5COR A;  3OWF A;  4RGN A;  3FDT A;  4LJZ C;  3ND8 A;  2PQE A;  4IUV A;  2BOS A;  2K04 A;  1BBX C;  2VXW A;  2K33 A;  4Q0F A;  1AEX A;  1E2V A;  1GXD C;  3FMC A;  5IGC A;  2D2C C;  1IHZ A;  1QNU A;  1EY4 A;  4OO1 I;  4OIK A;  1WTO A;  2LS0 1;  4HAE A;  1EIH A;  4QF4 A;  1KTK A;  1YNN D;  2JYO A;  5A35 A;  2XVS A;  1DOK A;  4NMZ A;  4G7Z C;  2Q8R E;  1EYC A;  1O80 A;  2NZ1 D;  2XWJ B;  1JOQ A;  2NVT B;  2XSC A;  2QDB A;  2HDL A;  1VDZ A;  4ZQ3 A;  1NUC A;  2PO4 A;  4DAV A;  2FFK B;  4O42 A;  1DOM A;  4QUC A;  4I7Z C;  4OHJ A;  2B63 B;  2FMC A;  3BVG A;  3D8G A;  4EGV A;  4DFA A;  2AWO A;  1TS5 A;  1RKN A;  1B44 D;  2EOT A;  2BCO A;  3OIP A;  1AP0 A;  3GTP B;  1CZW A;  4C1N K;  1I50 B;  3H0G B;  1EY8 A;  2A74 C;  3EVQ A;  5D65 A;  2K5Q A;  3R3O A;  2EXZ A;  1KDB A;  3OSO A;  4OIJ A;  2OXP A;  5HUR A;  2F0I A;  3TSS A;  1KAA A;  3CRL C;  2A6E D;  2X6G A;  1F9R A;  2L5T A;  5ELD A;  5I4D A;  1DON A;  2EYP A;  4ODG A;  3NSW A;  3GTQ B;  4V0B A;  1ROD A;  2SDF A;  1SEB D;  1T5E A;  3GTL B;  1Q3L A;  1DOL A;  5CC4 A;  2I07 B;  4UDU C;  5C4H A;  4OL7 A;  4BBR B;  4ID6 A;  1PFB A;  2A73 B;  1TS4 A;  5FKA C;  1TWA B;  3K57 A;  4A3E B;  3I4M B;  1B9M A;  4XDX A;  1JCK B;  1TY2 A;  3HOV B;  1TWC B;  1SE4 A;  1HPC A;  2QIL A;  4HCE A;  1CA6 A;  4B08 A;  1RTO A;  2B2T A;  4NKL A;  3I91 A;  2EYJ A;  3BYT B;  3NWT A;  3R8B A;  2MHV A;  4A3K B;  1BCP B;  3MFG A;  1S5F D;  2BDO A;  5IT9 E;  2E2J B;  4EQP A;  3KUP A;  5KNC A;  3HGB A;  5ISR A;  1XWE A;  2A69 D;  2NVQ B;  5FO9 B;  3D3R A;  4XYQ A;  1EY7 A;  4B9W A;  5C0X I;  1YNN C;  3NPP A;  3S2H B;  1SMY D;  4TRD A;  1ENF A;  5ELC A;  4G57 A;  3DXJ C;  1LTR D;  1IYV A;  1LTG D;  1O78 A;  1QG7 A;  1LAC A;  4M8A A;  2CW0 D;  1C48 A;  5EPL A;  3CRK C;  2Z8L A;  3TP6 A;  4IFD I;  2M9V A;  1LLR D;  1V1P A;  1KLU D;  4V19 0;  1C4Q A;  2YYZ A;  3RMH A;  4FYD A;  4CBV A;  4U67 3;  4BA1 I;  2IX3 A;  4DK1 A;  4QCL A;  5IGB A;  1TQO A;  5A2Q E;  4TSS A;  3GV3 A;  3E5S A;  2K6A A;  4K8J A;  2WV6 D;  3A7A B;  1ZKO A;  1EYA A;  1DCZ A;  2J4X A;  3PUY A;  1QOH A;  1CFM A;  1ILP A;  3Q23 A;  1EL0 A;  1ILQ A;  1EU3 A;  1LT6 D;  1ZXT A;  3K0Y A;  2QEJ C;  1S5B D;  2AQ2 B;  4KN4 C;  1EY5 A;  3S1M B;  5I2X A;  2A6E C;  1WVL A;  1SYF A;  4KY5 A;  3OIQ A;  2NUC A;  2DN8 A;  3TN2 A;  2CQA A;  4FXK C;  3P75 A;  4X3U A;  4L63 B;  3K5N A;  1Y1W B;  3SEB A;  5LL6 S;  5EKI A;  3RLF A;  4CHT B;  2KCN A;  2KQ3 A;  3PUX A;  3MVV A;  1IL8 A;  2ID0 A;  2OF1 A;  3GTM B;  3HG9 A;  4X3T A;  5M5Y B;  5T1I A;  2WII B;  1Q8I A;  3WOF A;  4RKL A;  2H4O A;  3URY A;  3NBI A;  3BVZ A;  1J9O A;  1STE A;  1B3A A;  1NAP A;  1ET9 A;  1E2W A;  3NTH A;  4IUR A;  1TWG B;  1GUS A;  4Y7N B;  4RCO A;  3VYR A;  4C56 C;  4ZKB B;  1DZ1 A;  1R4Q B;  1BNZ A;  1GUW A;  1H9K A;  4PMW A;  2HDM A;  5CR3 A;  3C46 A;  3MHB A;  3DHQ A;  1D6E C;  4H13 C;  2X6L A;  3G7L A;  5COY A;  1STG A;  3I4N B;  1I4G A;  2WIN B;  3X3M A;  1FNW A;  3E6Z X;  1E2Z A;  3HEJ A;  2HUG A;  1UEA B;  5KGU A;  1LTI D;  1OXX K;  3AMU A;  2BA1 A;  1HCZ A;  1JWM D;  1STN A;  2A69 C;  2PMZ B;  3C1F A;  4RA8 A;  3T13 A;  5I9P A;  4L8J A;  4BWG B;  5CV8 A;  1S5C D;  4ZLT F;  1HQR D;  4QMG A;  3W3A A;  1D5M C;  2N88 A;  3DWQ A;  1SMY C;  2F4I A;  2EY1 A;  2PPB C;  1D1K A;  1H9M A;  1EWH A;  5ELF A;  3DUZ A;  5CYU A;  2CW0 C;  2ENB A;  3NQI A;  4YIJ A;  3SK6 A;  4KY7 A;  1PTO H;  4HSP A;  2G9H D;  5KYI A;  1STB A;  3S15 B;  1S4Z A;  2L11 A;  5JPM C;  5FO8 B;  4KK7 A;  4RWS C;  3PUW A;  4LAA A;  4FF3 A;  3M4Y A;  3ZYY X;  4K2K A;  2YU9 B;  1STH A;  3MXN A;  1O7L A;  2AQ3 B;  2K5D A;  3MAQ A;  2IJ0 A;  4RGO S;  2VNU D;  2B8G A;  2F3W A;  3MA2 B;  1XX8 A;  1KNE A;  1QNK A;  3I4L A;  5EBC A;  4U68 A;  1HQM C;  2NVX B;  1XYI A;  1I6V C;  3OOC A;  2K05 A;  3GTG B;  1I4P A;  2EJM A;  5CV9 A;  3HOW B;  1A3V A;  4KTA A;  5BN4 A;  1WTP A;  1ESF A;  3V2T A;  4JBW A;  4FF1 A;  1TR5 A;  3GV6 A;  1U9R A;  1LTT D;  1Y8N B;  4KHZ A;  4KJO A;  3L3O C;  1PRT D;  3HOZ B;  3CKI B;  3X3N A;  5D14 A;  2AWN A;  3RZO B;  5G3L D;  4Z9C B;  3Q24 A;  3HRZ C;  4KV6 A;  2WAQ B;  3S17 B;  1K8M A;  3BVM A;  3HP3 A;  4ZKC B;  2KED A;  2CVR A;  4RCN A;  2LFN A;  1A6X A;  1TKW B;  1TWH B;  3V96 A;  5AFW A;  1A3U A;  3GQB A;  2R61 A;  1EQV A;  3OWE B;  4TQU S;  3WDN A;  1BQQ T;  1ENA A;  2ZXR A;  3TP5 A;  1FD7 D;  2JXM B;  5E4X A;  5DNF A;  4XQJ A;  2XRS D;  2EE1 A;  1WD0 A;  1TVX A;  3PUZ A;  4J1M A;  4ABN A;  3DEP A;  2RDH A;  3WOE A;  1V8Q A;  2EY6 A;  1RDP D;  2LKV A;  1GHK A;  1JB3 A;  1KAB A;  1BUV T;  4KKU A;  3MEH A;  5FLX L;  2C9O A;  3JAM E;  3D4W A;  1G6Z A;  1EZ6 A;  1C8C A;  1G2S A;  1ESR A;  4A3I B;  1MGS A;  4HCS A;  5NUC A;  1SYB A;  3CU7 A;  1ENC A;  2BDN A;  1TWF B;  3J81 E;  1IKL A;  2J7Z A;  2K03 A;  1Y69 U;  1AN8 A;  3AU7 A;  2EJG C;  5ELE A;  2JSO A;  2F0W A;  3NXW A;  3T16 A;  3U9O A;  3TZD A;  2X69 A;  4IUQ A;  2B2W A;  4HTH A;  3ERO A;  3FVQ A;  1OO9 B;  3HZX A;  2E2I B;  3EA6 A;  1AZP A;  3GO5 A;  4DGZ A;  2A68 D;  4N9P A;  4RFB A;  2MJ8 A;  5JVG 3;  1I6H B;  2O5J C;  3FKI B;  5KRU A;  3R2I A;  4QB4 A;  1F2M A;  1OXV A;  2A6H D;  1WTQ A;  1B50 A;  1G91 A;  1QIL A;  4NDX A;  1D1I A;  2Q8I B;  4DU9 A;  2EYH A;  1EFI D;  5FK9 C;  2B2U A;  2PZU A;  4ZK9 B;  1U4R A;  1CTM A;  4CGY B;  2B2Y C;  1UUP A;  3OPO A;  1CHQ D;  3TME A;  2F0K A;  2F03 A;  3E0J A;  1R9T B;  5M5W B;  4IN3 A;  3MXG A;  1L0Y B;  1FR3 A;  4P2C B;  4CJ0 B;  3P7J A;  4I65 A;  1CT1 D;  1PRT C;  2JA6 B;  1FNU A;  1HA5 A;  1TII D;  3DWA A;  3KK7 A;  2EDG A;  4HSV A;  3VR5 A;  4ME5 A;  3O13 A;  4TKO B;  1EQT A;  1VF5 C;  1OXT A;  3CQZ B;  3KF8 A;  2EYL A;  1Z47 A;  2XRQ D;  4GZY C;  4PNY A;  4JK1 C;  4J8Q A;  2I46 A;  5T1G A;  2B39 A;  1NCV A;  2F0E A;  3EFX D;  2K32 A;  4XTC S;  2BE5 D;  3OMC A;  4C3I B;  4IUU A;  2MGS A;  2A5H A;  4IUT A;  5C4J B;  5D3D A;  5D3I B;  5E4W C;  3PUV A;  1BCP D;  4HR7 B;  5C3X A;  5CMD A;  1UNS A;  2V4D A;  1V1O A;  2SOB A;  3BS1 A;  1YNJ D;  2Q8T A;  1PYW D;  1MD2 D;  5HGT A;  3PIP 3;  1X3P A;  1STY A;  4XYO A;  2R93 B;  2E2H B;  1Z7T A;  2NN6 H;  3Q0A A;  1PZJ D;  3A8I E;  1BO0 A;  2LY7 A;  5I2Y A;  2R7Z B;  3H91 A;  3PO3 B;  2KHS A;  1TS3 A;  2NN6 G;  1TS2 A;  4PMB A;  1MSG A;  2K1B A;  4XQQ A;  3M85 A;  3C2P A;  4C3J B;  1F2Y A;  1M4V A;  1SJE D;  1NSN S;  5JPN C;  1GOZ A;  4OGQ C;  1JIC A;  2HCC A;  3A8K E;  1E0B A;  4KJN A;  1A2U A;  3TP7 A;  2DNC A;  4RGM A;  3NUC A;  2ZT9 C;  2G9D A;  5IGF A;  5KND A;  2PCF B;  1HRJ A;  1PTO D;  2F0U A;  3BZD B;  1DJR D;  2A68 C;  4ZAI A;  1EY9 A;  1Q1B A;  3DWP A;  1DD2 A;  1QJO A;  4IUN A;  3RD4 A;  5JOB A;  3L9A X;  1Q1E A;  2A6H C;  4BA2 I;  3MC0 B;  2QF7 A;  1KNA A;  4RHR A;  3TZU A;  3VR2 A;  1EYD A;  5IOD A;  5M3F B;  3K59 A;  1BF4 A;  4CKC A;  1JOK A;  1KDC A;  3K5M A;  4DF7 A;  2O2L D;  2VB2 X;  2O4X A;  1U4L A;  5CV4 A;  3I8Z A;  4HMJ A;  1AZQ A;  2KCC A;  2KVM A;  4PV1 C;  1JC7 A;  3KLS A;  2PNR C;  2B8F A;  1CHP D;  1I4R A;  2B2V C;  3OHX C;  4AYB B;  3D4D A;  3K5O A;  1QB5 D;  2WB1 B;  4K14 A;  1HUN A;  1UAP A;  5KIX A;  4MN3 A;  4C3H B;  3S16 B;  2DNE A;  4LK1 C;  1WTW A;  5C4Z A;  3NK9 A;  5EPJ A;  2DY8 A;  2R6G A;  4RH6 A;  4KKS A;  4RAU C;  4A93 B;  3LWE A;  1QE6 A;  1SND A;  2BE5 C;  1CM9 A;  1HTL D;  1MSH A;  5C6A A;  4QIW B;  4A3M B;  5EKL A;  1HUM A;  3QB3 A;  5EPK A;  3QG1 A;  5EGT A;  1H9S B;  1GUT A;  1HXY D;  2AQ1 B;  3G6J B;  2VUM B;  1IW7 D;  5JJZ A;  5M3M B;  2NWG A;  1BCP C;  5ELB A;  2K7V A;  4IUP A;  1LAB A;  1TU2 B;  3S1R B;  1YNJ C;  4DAP A;  3IL8 A;  4FP5 D;  4LMQ D;  3HOU B;  3DM1 A;  4S3S A;  2GA4 B;  1H9R A;  3J80 L;  3GP7 A;  4BBS B;  3BG3 A;  1OXS C;  1ONL A;  4DK0 A;  3RUZ A;  3PV0 A;  4ULL A;  3TP8 A;  1F9P A;  1FGB D;  1RTN A;  1X32 A;  4WRD A;  1LTA D;  1Y8O B;  2F0G A;  1SYE A;  2MUY A;  4PMC A;  3MFY A;  4RKB A;  3KLR A;  1LTS D;  3A55 A;  3JAM L;  1JQY D;  5J1Z A;  2L0C A;  3N52 A;  5EBD A;  3BDL A;  4R8N A;  2FIN B;  1PTO C;  1CQV A;  5F2D A;  2L55 A;  2KEC A;  4OO1 H;  1F9S A;  2F0T A;  2RKS A;  2DY7 A;  2PZT A;  1SNM A;  3NTI A;  1SNC A;  3I70 A;  1G8Z D;  3S1Q B;  3VR4 A;  2F1M A;  3I73 A;  1M8A A;  4G7H C;  4OO1 G;  1RHP A;  4H44 C;  4EVO A;  4F87 A;  4A3B B;  1SNO A;  5C0X J;  2RQX A;  1TY0 A;  2OEO A;  2IWH A;  3H94 A;  4F8M A;  3MXP A;  1LT3 D;  4KMU C;  5C3W A;  4K6D A;  3SHL A;  4DN4 M;  2O5I C;  3VYS A;  1PDQ A;  4K5V A;  1WTR A;  3AB9 A;  3QWN A;  3TBI B;  4IFD J;  3I3C A;  4FO2 A;  3EQL C;  2EYO A;  4X3S A;  4K5X A;  1PRT B;  4NP5 A;  2NB0 A;  1B2T A;  2KEE A;  1B1Z A;  3VA7 A;  3OW7 A;  2B2W C;  3U9S A;  2NYZ D;  1PFN A;  2SNS A;  4N9T A;  5CBA E;  1X3Q A;  3R2T A;  4H7B A;  1CK1 A;  3GTJ B;  5EJW A;  1SE2 A;  1V43 A;  4CJ2 C;  1H9J A;  3QOL A;  1WD1 A;  5C5M A;  1BDO A;  2JE6 I;  3D6C A;  4CKE A;  2RBM A;  1SYC A;  2EPB A;  1GUN A;  2F0H A;  2PW5 A;  1SJH D;  1IW7 C;  2F0M A;  4A3G B;  2NTT A;  3VYT A;  3T4A C;  1NR2 A;  1JOR A;  1MI2 A;  1W6K A;  2D62 A;  3FPP A;  3SXH A;  5JVH 3;  5DM7 3;  1T5X D;  1O7Z A;  4DXF A;  2WKC A;  3M3Y B;  2D9U A;  1ZYR D;  4HN7 A;  2E76 C;  3C1E A;  2MPM A;  2RSN A;  4ZUJ A;  3S9W A;  3LX0 A;  5JEA J;  1J8I A;  1EY0 A;  3FEW X;  4DNR B;  2R92 B;  5IT9 L;  3SK8 A;  4DXG A;  3NTK A;  2IW3 A;  5C3E B;  5I6Y A;  3S1N B;  1I4Q A;  5CV6 A;  1K8O A;  4ZUI A;  1Q12 A;  3NQT A;  2IX1 A;  1I4H A;  2CHB D;  5DAU A;  1FNV A;  1EIG A;  2TSS A;  3NWS A;  1XXG A;  2B2T C;  3QOJ A;  3BYY B;  2RVL A;  1AFP A;  1WTV A;  2BA0 A;  2RSO A;  3A56 A;  3V05 A;  5M9O A;  1RD9 D;  2KJX A;  2ICI A;  5IGE A;  1GUO A;  1AW7 A;  5KNB A;  4UAI A;  5C0X H;  4HED A;  2L4N A;  4Q5V A;  2JA5 B;  1EZ8 A;  4BY1 B;  1SSO A;  4A3J B;  1PRT F;  2F0O A;  1HHV A;  2F0L A;  1DXM A;  4K2L A;  5A2Q L;  5C0X G;  1BXT A;  5E3F A;  5G3L F;  2Z1C A;  3MWY W;  1EWC A;  1H9S A;  2WAC A;  4L6T B;  3NE5 B;  1W6J A;  5I9O A;  1HA6 A;  4FF4 A;  4IFD H;  3M7N A;  1S5D D;  1IKM A;  1NR4 A;  3D31 A;  1PFM A;  1JE4 A;  4IFD G;  3KLS X;  4RGT A;  4WOR A;  1RJT A;  5IGD A;  1TT2 A;  3OMG A;  3A7L A;  3QJY A;  4XT1 B;  4M1U B;  5TSS A;  3SDZ A;  2JP1 A;  3ERQ A;  2XN9 C;  4HMI A;  2OT2 A;  3SK4 A;  4FXG C;  2K5W A;  3SK5 A;  1ICW A;  4FVM A;  2E2D C;  1SYG A;  4DNT B;  5K5P A;  3BDO A;  4PQX A;  2L12 A;  3S2D B;  2WKD A;  3ITP A;  4K6L A;  2EZV A;  1PMR A;  3QO2 A;  3FPU B;  4QUF A;  5KEE A;  3K6O A;  1I4X A;  3KBG A;  3NHH A;  3Q6S A;  4FF2 A;  2JA8 B;  2QCP X;  3CHB D;  3K5L A;  1A15 A;  1OXU A;  3LNN A;  4R9W A;  3PIO 3;  1RCV D;  3J7A V;  5JEA H;  3VR6 A;  1U4P A;  5FLX E;  1ZYR C;  4XT3 B;  3EJI A;  3P20 A;  5JEA G;  2NBF A;  2AUJ D;  3PO2 B;  1F2L A;  3GTO B;  4A3D B;  4X3K A;  3VR3 A;  1HFN A;  3F2U A;  4XQN A;  4ZRZ A;  3S14 B;  2B2Y A;  5EKK A;  1LT5 D;  4KKT A;  4RHS A;  2F0J A;  5DM6 3;  3SE0 A;  1LTB D;  1QCB D;  1LO5 D;  2ICE C;  2M2L A;  3R93 A;  3A54 A;  1WCM B;  1EEF D;  1G29 1;  4KY6 A;  2RDG A;  2Z4I A;  1GUG A;  1SE3 A;  3D6W A;  1JR0 D;  1VMC A;  5JAV A;  2EJF C;  4BY7 B;  3IKJ A;  3N6R A;  1PTO B;  5I6W A;  1VF7 A;  5DEH A;  2F0N A;  4ILW A;  1Y1V B;  4EQN A;  3VA5 A;  2PZW A;  2F0V A;  1O7Y A;  3LWU A;  3UI2 A;  5K36 H;  4G4K A;  3RZD B;  5EQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...