1HRJA

Human rantes, nmr, 13 structures
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
68
structure length
68
Chain Sequence
b'SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN REGULATED UPON ACTIVATION NORMAL T-CELL EXPRESSED AND
publication title The three-dimensional solution structure of RANTES.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine (chemotactic)
total genus 5
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1hrjA00
2L12A 5CBAE 1ILQA 1G2SA 1WTQA 1RODA 3MTSA 1QG7A 4CJ2C 1U4MA 2B2YC 2JP1A 4XT3B 1U4RA 1G91A 2B2UC 2XIWA 2EOTA 1AZQA 1IKLA 1WTRA 3GV6A 4ZLTF 4QUCA 4IUVA 4CJ1B 2M2LA 2RSNA 5D65A 5T1IA 2DY7A 1BNZA 2K1BA 2VXWA 1E0BA 2HCCA 3I91A 4R9WA 3KUPA 1AP0A 3R93A 1IL8A 2FHTA 1RTNA 2MPMA 3N52A 4HCSA 5EPKA 4O42A 2DY8A 5EQ0A 4OIKA 1F9PA 4X3TA 4X3KA 4XDXA 1X3PA 2KECA 2HUGA 1WTPA 2D9UA 3ONAB 3QO2A 4RWSC 1DOMA 5T1GA 1NR4A 1EIHA 1B2TA 1G2TA 4HSVA 4HEDA 4MHEA 4NW2A 1F9QA 2NZ1D 1EOTA 4IURA 1J9OA 1X3QA 4ZK9B 2NYZD 1DOLA 5CBEE 2B2WC 1NCVA 2FINB 1RJTA 3FPUB 4ZAIA 2X6GA 1GUWA 1DOKA 2MJ8A 5DNFA 1TVXA 1B4OA 3DEOA 1SDFA 5CMDA 1SAPA 2IL8A 5JJZA 1HA6A 2X6LA 1IKMA 2B2TA 5E4WC 2KOLA 1WTOA 1WD1A 4UAIA 1MI2A 4XT1B 1C8CA 1QNKA 4RAUC 2Q8TA 3IL8A 1HFNA 4ZKCB 2HDLA 2KUMA 4MN3A 5EPJA 2K04A 1WTWA 1SSOA 3LWEA 3UI2A 3TZDA 1CA6A 2B2VA 5EKIA 1M8AA 1KNEA 1A15A 1S4ZA 2MGSA 4IUQA 3P7JA 5EPLA 1J8IA 1BO0A 4R8IA 1HRJA 1RHPA 1O7YA 1PFMA 1U4PA 1F9SA 5D14A 2SDFA 2FMMA 4DN4M 4X3UA 1VMPA 1JE4A 1PDQA 3I90A 1HFGA 1F2LA 3GV3A 5COYA 4CJ0B 2HCIA 4IUUA 3G7LA 3F2UA 1RTOA 1MSHA 2R3ZA 2B2YA 2RA4A 1WTVA 1HUNA 2H1EA 2B2UA 1EL0A 2L4NA 2KEDA 1CM9A 1ZXTA 2X69A 1PFNA 2N88A 1XX8A 2KEEA 1ICWA 1B53A 2EE1A 3IFDA 1ILPA 1AZPA 1MSGA 2CVRA 2L11A 2L9HA 2KVMA 1B50A 2RSOA 1KNAA 5E4XA 1HUMA 3DM1A 2L1BA 1CA5A 3D6WA 3I8ZA 4RA8A 1DONA 1ML0D 2MP1A 5EJWA 1PLFA 1Q3LA 4LMQD 4U68A 5CORA 1HHVA 1O7ZA 3I3CA 4OIJA 1WVLA 1B3AA 2Q8RE 1EQTA 2B2TC 2K05A 1NAPA 2K28A 4X3SA 3H91A 1DZ1A 1LV9A 1X32A 1U4LA 1PFBA 2FFKB 2FJ2A 4HAEA 2B2WA 1F9RA 1O80A 1XYIA 1G6ZA 1QE6A 1MGSA 2B2VC 1ESRA 4IUTA 3DEPA 1EIGA 2NWGA 2RVLA 4IUPA 2JYOA 2EPBA 3MWYW 1JICA 4QUFA 1WD0A 2BDNA 2HDMA 2K03A 3KBXA 3Q6SA 4ZKBB 3SVMA 2N55A 1BBXC 3TN2A 1VMCA 1WTXA 2K01A 2J7ZA 1BF4A 1NR2A 3FDTA 5AFWA 3HP3A
chains in the Genus database with same CATH superfamily
4LF5L 1VF5C 1ILQA 1GUOA 1SYEA 2EZVA 1WTQA 3PO3G 4LUOA 1G51A 4A3KB 3AEVA 1I4GA 2IJ0A 3E5SA 4LWCA 4KKSA 1II3A 3HOXB 3QOJA 2B63B 4QQBX 1A3UA 1BCPD 2E2HH 3T13A 3MA2B 1LTGD 5IYDH 5FLMG 5HGQA 2LSSA 4LF7Q 3OOCA 5FKAC 1K73C 4IUNA 4K6DA 1AEXA 1F9QA 1SFOH 2Z6KA 1C0AA 1QJOA 3KF8B 1TWGH 3OTOQ 4HJ7A 3EJIA 4EQ5A 5CV5A 2JA6G 4K0KL 4HJ5A 1GUWA 5M3MH 1TWHH 2VW9A 4FO2A 1EY8A 2ICEC 2Z4HA 2CW0C 2EDGA 2B2TA 3CCVA 1QOHA 1U9RA 4YWKA 2A6HC 1IYJB 3OHXC 4M1UB 2EY6A 4PMWA 1RHPA 5ELFA 2F4IA 4OXPA 1MIUA 4RKBA 1EWHA 4LFBQ 5FLXL 3QOLA 1MHWC 2F0GA 2RA4A 3WWVA 4Y52H 3W2DA 4BA1I 4DUYQ 3LGJA 3NE5B 3NWSA 3S17H 2R7DA 1JJGA 4QIWB 3K5LA 4R4QA 3TZUA 3I2ZA 4RA8A 1DONA 4X64L 2E76C 3CCSA 2MP1A 4U68A 4IPCA 1HR0W 2ZTDA 4X62L 5KIXA 1EQTA 2R7ZG 1U4LA 1Y8PB 1VQBA 2EYHA 2FFKB 2B2WA 3RN5A 2VZAA 4LK1C 5IT9c 1XYIA 2A74C 3GTJB 1HTLD 1CI3M 1N32Q 1SNMA 4CKEA 1TXYA 2BDNA 1RIPA 3CAMA 2N55A 5HGTA 1XMQQ 3OWFA 1IBKL 4L5QA 1PH2A 3FDTA 2R92B 3OIQA 4KV6A 4H13C 3FKIB 4HJ8A 5LMNL 3W1GA 5C4XG 2B8GA 1SMYC 4NP5A 3S2HH 3V05A 1IKLA 4B3TQ 4JI7Q 3MEHA 4CDCC 2ZJPA 4QUCA 4R4CA 1TWFH 5D65A 4R8NA 4XQJA 3QWNA 4IZ8A 3NK9A 1YI2A 5EQ0A 1ASYA 4XDXA 3OMGA 2HUGA 1YHBA 4WORA 1VQMA 4RWSC 1LYLA 4M8AA 3A8IE 4HSVA 3R3OA 4LUVA 5CBEE 1Q46A 4X65Q 4KHVA 2IX0A 3VR6A 4DV3Q 4YHHQ 2KJXA 4K5WA 2AQ2B 2KCNA 2AWNA 3NWTA 4N9PA 3BZCA 2N8NA 3I4MH 5C4JB 3I4LA 4LUZA 4XT1B 5LMUQ 3VR5A 1HH2P 2K04A 1BBUA 4PG3A 2AUJD 3J80L 3HOZH 4C3HG 1ZKOA 2BOSA 1XTDA 2PMZE 4A93B 1L1OA 2ZM6Q 1O7YA 4DR5L 3HOWG 4A3BH 4C1NI 4UP9A 4B3SL 1SN8A 1SE3A 1MSHA 2JEAI 2HD3A 1NY4A 4KLKA 3HOYG 2PYKA 1QB5D 4J1MA 1Y8OB 2K7VA 2D0PA 4LAAA 1DXMA 4JOIA 2BCOA 4BS9A 4BY7H 4R4OA 2K5QA 4JK1C 1KNAA 3TBIB 1I3QB 3PF5A 2IY5B 1LTBD 2KA7A 5NUCA 4LFAQ 1TIID 3I3CA 1EEID 1X3EA 2B2TC 3M4PA 3U9OA 3PQIA 1MD2D 4H7BA 4TQUS 1QE6A 2RDFA 1N34Q 1EIGA 1I94L 4DAYA 4H44C 2A69D 4JBKA 1JB3A 1RF2D 1CKOA 3TP8A 1FNWA 5IGCA 3CMEA 1BF4A 4GLVB 4ZRZA 1LO5D 2F3WA 4JI0L 4UY8C 1N36Q 1RODA 5FK9C 2JP1A 1Y1VG 1PH4A 4K14A 1NMFA 4L63B 2M2LA 1HTPA 5C3WA 3A8KE 4HIMA 5C3EG 4P72A 1XWEA 3GTGB 1TS2A 4A3MH 1EZ6A 2OEOA 2MQHA 4IPHA 1L0YB 3ITPA 4HJAA 4IOAA 3ONAB 5T1GA 1SYGA 2I46A 2VB2X 3GQBA 3CCRA 2UUAQ 1LTSD 1TY2A 3D4RA 3CKIB 2F4VQ 2B2WC 2FINB 1RJTA 3HOUH 1IW7D 5DEHA 2BA0A 3TP7A 5I6WA 5GAHC 2ZXOA 5EAYA 4LF7L 1AN8A 3J81L 3HOVB 4P75A 4C56C 3T1YQ 3SR1A 5JJIA 3D0FA 2WB1B 5EPJA 2DUDA 2BH2A 5IYDG 4IFDJ 4RFBA 1GHJA 4N8FA 3H3VC 1OXUA 2L0CA 3K8AA 3R8BA 2BH8A 2ZTEA 1SROA 3GTOB 2HQEA 5JEAG 4IUUA 5M3MG 4KD3A 4YY3L 3D31A 1STHA 2B3GA 1E22A 4P74A 4GOPA 1ZXTA 2X69A 1TKWB 3BG3A 4HMJA 1SNPA 3IFDA 4OEMB 2E5LL 4DR7Q 3DWAA 3TMEA 2F0FA 1BOSA 5K36G 3KLSA 4JI8Q 1QNUA 5EJWA 1PLFA 1K0RA 5CORA 2JA5G 1PXUA 3D8GA 4OIJA 2EJGC 4DUYL 5KEEA 3TS2A 1YVCA 4A3JB 3M4QA 1KIXA 4JI2Q 3CW2C 3E3XA 1XMOQ 4DNRB 3MWYW 3S2DH 5F2DA 3P20A 2VQFQ 4DF7A 3HKZE 2ID0A 2EYPA 1XPUA 1XNQQ 3KLWA 5CBAE 4DFAA 1SE4A 4BBRG 3MXGA 2XSCA 2I5LX 3URYA 2JA8G 2XIWA 4HIDA 2K5NA 3CHBD 1PYSB 3S1QB 4LFCQ 3MFGA 1Q8KA 4LF5Q 2YTXA 3KK7A 3PO3B 4J15A 4HMIA 4XYOA 3R93A 2FHTA 2MPMA 5M5WB 5J3BA 3K80C 1F9PA 1SXTA 2E2IH 2MO0A 3CCUA 5C6AA 4B3TL 4BY1H 1D8LA 1R9TH 2F0PA 3M4OB 3F2BA 1J9OA 4ZK9B 1WCMH 1JORA 1SNOA 3S24A 4KK7A 1AW7A 3FPUB 4UP8A 1EU3A 1FNUA 1VQ9A 1XTCD 1HA6A 1WD1A 3VYUA 1STNA 2Q8TA 3IL8A 2JA6B 4K0KQ 4MN3A 4X65L 2R7FA 3LNNA 1SSOA 2MNAA 3LWEA 1CA6A 5KNDA 4HSPA 1BQQT 4DV3L 2JJQA 3K7AH 1BO0A 1V1PA 1RD9D 2D2CC 2WAQE 2IT1A 1LTID 4X3UA 1CSPA 5C4ZA 2H5XA 1JE5A 3I4OA 1PH5A 1AE2A 2B2YA 5J1ZA 1PH1A 4A3FH 4EQNA 2A5HA 4J6HA 5GAEC 5M3FH 2ZM6L 3MAQA 4DAMA 3ERSX 1TQOA 3D3RA 4JC0A 5IT9E 2KVMA 1P16A 3W5OA 5IOCA 3HOZG 3I73A 1XPOA 3STBD 4C3JH 2PZTA 4A3BG 1FYCA 1RDPD 5IP9H 3HKZG 1LV9A 3RR5A 2UXBL 3KYHC 2Y0SG 2A68D 4NB3A 2R7ZB 3NQIA 4BY7G 1KXLA 1D2BA 4KHPQ 4RCOA 1R4QB 1GO3E 3DWPA 5IODA 4RCNA 2PI2E 2PQAA 1E2VA 1N34L 4IALA 3EIVA 1TWAB 1JWSD 4ZUJA 1IBKQ 5I6YA 1S5ED 2RSNA 5DAUA 1FGUA 2VXWA 1NBWA 5LMNQ 3AFQA 3DM3A 2EVBA 5C4XB 1A0IA 3K7UC 1VQIA 3S15H 1D1IA 5IGBA 1CFMA 1JT8A 3BS1A 2NVQH 4OL7A 2QKIC 2CWAA 4ZQ3A 1K0SA 1WTHA 4NW2A 1EOTA 1X3QA 3VDYA 4JI1L 1ET6A 1CQFA 2DNEA 5KGUA 1YZ6A 4GN5A 2OCEA 5J22A 2F0JA 1Q7YC 1NJIC 1SDFA 1F2MA 2WAQG 1D5MC 3BJUA 1JB7A 1I50H 2XGTA 2KUMA 4JI5Q 2QF7A 3GTKB 2F4VL 2YU9H 3GTPH 3TZDA 2ENBA 1YEZA 2RDGA 4DR1L 2M00A 4F87A 3K0XA 4B08A 2BDOA 2OQKA 1Q82C 1JE4A 2XWJB 3HG9A 1JC7A 3RLFA 1F2LA 3UDGA 4KY5A 3HOUG 3EBEA 4DA2A 2SEBD 2AQ1B 4PNYA 4C3HB 2R3ZA 3GTLH 1HUNA 4DV7Q 1BDOA 3S9WA 1CSQA 5E1FA 3F2CA 1TS4A 1PV4A 3HOWB 2ZTCA 3TRZA 1WYDA 2SOBA 2WFWA 4B3SQ 1X54A 4QMGA 1ILPA 3RZDH 1PH9A 5C3XA 3UE0A 1ZYRC 1YNND 3U50C 3HOYB 5FLXc 5IYBH 2NVTH 5IWAL 1D1KA 3R2TA 2E8GA 5ELEA 3KDFB 4X3SA 3S1MH 3ZJYC 4HAEA 5DM73 1F9RA 1PTOH 2OWOA 5I2YA 4JI8L 4G7ZC 2CQAA 2HDMA 2K32A 5E3FA 3MHBA 3L7ZC 1IBML 1TWCB 1Q1BA 3HP3A 4K6LA 4JI2L 4JYAQ 3NPPA 1E3PA 1I94Q 2B2YC 3CRKC 1XMOL 1G91A 1WTRA 1GHKA 1PH8A 3M3YB 2K1BA 1H9SB 4ABNA 4JI0Q 4RHSA 3TQYA 1IBLL 1XNQL 2BE5D 1Y1VB 1UE5A 2V1CC 4DXFA 1DYQA 2KECA 1BCPC 3QO2A 2RDHA 4DAYB 1E1OA 3I72A 1VQ8A 5C3EB 4MHEA 2NZ1D 1SEBD 2EYLA 3S14B 4ZAIA 3J7ZC 1UEBA 3M7NA 5M5XB 4LJZC 3ULJA 3SK6A 1H9KA 4FDBA 4XXEA 1QVGA 4HR7B 2NTTA 4A3GH 1HFNA 2J4XA 2HDLA 4YWMA 4JVZA 3KOJA 5I2XA 4LF9Q 3I4NH 2MGSA 5EPLA 1DCZA 5JJKA 1LT6D 2K75A 1WCMG 5L37A 4L5TA 4A3DH 1B1ZA 2E2HB 2AWOA 2JN4A 1SLJA 3F2UA 4LF6Q 4EX5A 3ZYYX 2KEDA 1SFOB 2ES2A 4JI3Q 4E6IA 3KJPA 3S1RH 1AZPA 4GLAC 5M3MB 1TWHB 1TS3A 4YY3Q 2EYFA 2FMCA 2EY1A 2NBFA 3BVZA 4POFA 4A76A 5IY0A 3GTQH 3FHWA 1SNDA 2O5IC 4PZ8A 4ZUIA 2E5LQ 1CHQD 2NN6H 1WVLA 3BU2A 4F88A 1NAPA 2GA4B 3MVVA 3EVQA 5E7NA 2ZXPA 5D3IB 1N33Q 4L8JA 2LS01 3PIOA 5C44H 4A3FG 2JA5B 1ASZA 2VL6A 2ICIA 2JYOA 1I4RA 2UUBQ 1S3OA 1JICA 1LTRD 1JMCA 2TMPA 2QA4A 1TR5A 1S40A 1I6HH 1WTXA 5AFWA 2LFNA 4YIJA 2G5DA 1K3RA 1HQMC 3K0YA 4C3JG 1EYDA 1E1TA 3CC2A 2HT1A 5CC4A 1ENFA 5IP9G 2DY7A 2GVAA 5ISRA 4KHPL 2A6HD 3H0GH 4BBRB 5A35A 1EIFA 2JA8B 1RTNA 2DY8A 3VR2A 1X3PA 4MNOA 1JWMD 2Z1CA 3X3NA 1P8LA 1T5XD 2QCPX 3JAML 5GAGC 1SR3A 4BBSH 5IGGA 5ELNA 2K14A 3S1NB 4UHVA 3TDQA 1YIJA 1EY5A 5DNFA 2XN9C 1TVXA 3PUWA 2D0OA 1B4OA 3PV0A 1W2BA 3VA5A 1IKMA 4KI0A 3BYYB 1QWYA 2WIIB 3E0JA 1OXTA 4N8X1 4FXGC 3X3MA 3UDXA 4ZKCB 3S2HB 2I5MX 1TWFB 2JA7H 1PH3A 3GO5A 4AYBE 1QCBD 4J8QA 1BXTA 1SRUA 3ER0A 1LTAD 1VMPA 4A3EH 3J81c 1SJHD 4BWGB 1YHAA 4JI5L 4I7ZC 4WJ4A 2NVXH 3BDOA 2EY5A 1JJCB 2PZWA 4HN7A 1KDBA 4C2MB 3AMUA 4LW1A 1X56A 2C9OA 1Z6HA 2N88A 4DV1L 1ICWA 2AKWB 4YCWA 5IYCH 1LT5D 2L9HA 2L11A 5C4JH 1HZ9A 1Q12A 3SHLA 1VQAA 2F1MA 1SMYD 4DV7L 3NBHA 1ZEQX 5JPMC 1I4QA 1UAPA 1IL2A 2UUCL 1VQEA 2GN5A 3HOZB 1Z7TA 2D62A 4U673 4POGA 5FO9B 1WJJA 4EQOA 4DR3Q 4A3BB 3Q6SA 2E75C 1VS0A 3HKZB 2F0VA 1EYCA 2Z6KC 4TSSA 3RZOH 1SYFA 3RD4A 4PV1C 5I9OA 2UXBQ 4O1NA 2Y0SB 3FRPB 2IPKD 5IYBG 3Q0AA 1U4RA 1H9JA 1X9NA 2BA1A 1HCZA 4DK6C 2Z0SA 4BY7B 5LMNW 2SNMA 3KF6B 3FP9A 1EY6A 4KKUA 2GVBA 4JYAL 5EPKA 1K8GA 1YBYA 4YWLA 4X3KA 1O7LA 3QIAA 3U58A 3RLOA 4GNXA 1NUCA 3MXNA 3DLLA 1JR0D 1ENCA 3O13A 2R61A 3H3VI 4DK1A 4DNIA 1PRTC 5CV7A 5IIFA 1L2FA 3PUYA 1HQRD 2MJ8A 4FXKC 4XTCS 1GUGA 5A2QE 5JJZA 1Y1WH 2ASBA 2N78A 4JI1Q 5JOBA 4GKKQ 4KKTA 1H9RA 1XXGA 4RGTA 5JEAJ 4JV5Q 4A3CG 2RKSA 1B9NA 4QIWE 4GKJL 1LT4D 4UPAA 4IUQA 1HJPA 2WAQB 1U4PA 2KBNA 3HZXA 4GS3A 3BVMA 3ICEA 5EGTA 1YNXA 3BVGA 3CMAA 4RG1A 4XQNA 4ME3A 5FLXE 4DR1Q 1EU4A 1K83H 2XWBB 4LF9L 1BR9A 1QUQB 5CV4A 3C1FA 4A4IA 1A3TA 1VQJA 3MEFA 5C0XH 3CCLA 3HOUB 4A3GG 3BDLA 2RCNA 3OMCA 1MSGA 1FL0A 1QILA 1KRTA 3KF8A 2RSOA 1B50A 3DM1A 3ULPA 1CA5A 5HURA 1H95A 1LLRD 1I5FA 3I4NG 4LF6L 3J81i 1ML0D 2F52A 3M4YA 1HHVA 1EZ8A 1SBBB 1LABA 2AMCB 4JI3L 4A3DG 1Y69U 2EYMA 2V4DA 1WOCA 1PFBA 2N3SA 4IJHA 5FOBB 1G6ZA 4KY7A 5IWAQ 1AH9A 3GTOH 2QDBA 1VQHA 2K03A 3T51B 1K8OA 4RGOS 3FPPA 3ND9A 2CCZA 3JC66 4PMBA 3OIPA 1WTPA 4A3LH 2YYZA 1N33L 2AQ3B 2NVYB 5G3LF 3SEBA 4Q5VA 2KENA 2NN6G 2UUBL 1IBMQ 1YHQA 3F1ZA 4FP5D 3GTMH 5T1IA 2JXMB 1BNZA 2L5TA 1Y8NB 3GDEA 5C44G 2UXDQ 4N9TA 4KJNA 1L1OC 1K8AC 1MKHA 1CQVA 1K3BC 1NMGA 1G2TA 3HGBA 2F0WA 4DU9A 1IBLQ 4RGNA 4IURA 3PO2H 3KLSX 2PO4A 1VQNA 4G57A 3T16A 3G6EA 2KHIA 1TY0A 4EVOA 3C3LA 3S2DB 2EXZA 3AFPA 1L0XB 4WFN3 4ODGA 4JOIC 2X6LA 1Z9FA 2EXDA 4K5XA 1PTOC 2F03A 1KRSA 4FF3A 3H0GG 2EY2A 2IHFA 4R1JA 2VUMH 4PZ6A 3VR4A 3OPOA 4JCVE 1M8AA 1A15A 2KQ3A 5FJ8H 4GLXA 4P73A 4OO1H 1M90C 4I65A 1RKNA 4Y7NH 1CZWA 4BBSG 2EIFA 1EUJA 4HCEA 1KHIA 2F0EA 2B39A 3I90A 1TS5A 2LXJA 3DUZA 3UDFA 5EBCA 1HR0Q 4NDXA 2E2IB 4L6TB 1VQ5A 1JWUD 1G291 1SYBA 1B3QA 1N9WA 2VQEQ 4A3IH 1LT3D 1S5FD 2JA9A 1A63A 4DKAC 1WCMB 1G8ZD 1PFNA 4GNXC 2KEEA 1Q8IA 3A7LA 3DWQA 3H94A 3NXWA 4QB4A 4DAVA 3Q23A 4B9XA 1S5CD 2A19A 4DV0L 1NSNS 2JA7G 3S16B 1GVPA 1Q3LA 5C5LA 4R4IA 1B3AA 4OWWB 2K6AA 3W3AA 4A3EG 1BVSA 2NN6I 3NTIA 1VQPA 4QY7A 1XNRQ 4C3IH 2G9DA 1V1OA 2HIXA 2K50A 2AUKA 4FF2A 4FXDA 3I4MG 3VYTA 1WD0A 2WINB 3TN2A 5IYCG 3MC0B 4DR4Q 2EJFC 4ILWA 2Q2UA 2JEBI 2C35B 4A3FB 3PIPA 1UE1A 1VQ4A 4CJ2C 1NTGA 3CCEA 1O7IA 1DM0B 1DGSA 4WRDA 4KMUC 1AZQA 4DR3L 1RL2A 4ZLTF 2RQXA 3KUPA 2OT2A 3A74A 1PRTB 4C3JB 1PZKD 2Z6BA 4O42A 2WB1E 4RHRA 4TRDA 1Y14B 1VQKA 3OYYA 1IHZA 3PIO3 4HEDA 5LL6S 2R93H 1STEA 4K2KA 1B9MA 1A2TA 1FGBD 4DXGA 4G7HC 1B8AA 4H0LC 5JAVA 5KYIA 4WJ3M 1PYBA 1HA5A 1ENAA 1PHJA 4MTNA 1YNJC 4GOPC 4NXNL 5H1SE 4RMFA 5CMDA 1UE6A 2H4OA 2O4XA 2KOLA 3J81E 3CD6A 4HTHA 3CPWA 1Q81C 2B2VA 1YITA 2DNCA 3F8TA 5EKIA 4FNFA 2C5CA 1VQFA 3SDZA 1CK1A 2HHHQ 3A7AB 1QZGA 1SE8A 5D14A 4JBMA 3H6MA 2WP8J 1HFGA 2WACA 3S15B 3G48A 4GKKL 2ZT9C 3M9BA 1JOQA 4JV5L 1BBWA 1JCKB 2OTLA 2NVQB 1WTVA 1HPCA 4AQYL 1LTLA 1Y1WG 1JJ2A 1CM9A 3L9AX 3A56A 3PMFA 3E9HA 4A3MG 1GD7A 5CV8A 3CCJA 2CVRA 5E4XA 4DNTB 1K9MC 3J7AF 3I8ZA 3PUVA 3CQZH 2A6EC 4DV1Q 4OX9Q 1D6EC 3EN2A 4LF4Q 2YU9B 2F0UA 2K4KA 5EKLA 3GTPB 1EY7A 2I0QA 4QGUA 3KLRA 3RLNA 5ELDA 4GZYC 1C7YA 4IOCA 1VQ7A 2UUCQ 1A8VA 2EYJA 5C0XG 2EQSA 5GQOA 4ZKBB 1PMRA 2DGYA 1PZID 2MUYA 4K8IA 4CHTB 1X3FA 3GTLB 3HOWH 4QCLA 3M85A 1E2ZA 2VNUD 2LMCB 2EOTA 4O0AA 2P5ZX 1L1OB 5DM63 3FMCA 4X6AH 4H02A 3RZDB 4IUVA 3HOYH 3WDNA 1VQCA 1LACA 3GD7A 4HIOA 2RHQB 2VB3X 3EQLC 1E0BA 2A1AA 3E0EA 2F0NA 2HCCA 2F0SA 2QILA 1AP0A 2NVTB 1QVFA 1GUSA 1M4VA 2XNAC 2IWHA 3CC4A 2LKVA 2N49A 3QB3A 3QR8A 1K8MA 1KLGD 2CKZB 4DGZA 3S1MB 3NQTA 4F7XA 4DR2Q 1EYGA 1FNVA 1PTOB 5D3DA 5G3LD 2F3IA 4A3LG 1X6OA 1OXVA 2ZXRA 4MTKA 5KNCA 3E6ZX 5M5YH 4P71A 2UXDL 1DOKA 3L3OC 2F0DA 1KABA 2IL8A 3QG1A 5BN3A 5ELCA 3J7A5 3LWUA 2F0HA 4OELB 1CUKA 3JAMc 2JK8A 3NEMA 4UDUC 5ELOA 1CKMA 2E2JH 1ZYRD 1GJXA 4K8JA 2XVSA 3M3YH 5CV9A 2A73B 1S4ZA 2HIVA 1BUVT 1FJGQ 4AH6A 4GNXB 2FMMA 1ONLA 3J81j 3PO2G 5KYLA 4GKJQ 1YJWA 3T53B 4CJ0B 2OQ0A 1EY0A 2IW3A 3ULLA 5BN5A 1A62A 1PFSA 2Q2HA 2CWPA 3S14H 1XX8A 3TP6A 4A3KH 5C0XI 2PNHA 3A0JA 2VUMG 1YJ9A 4FVMA 1I4PA 4HJ9A 1HR0L 1STAA 2PMZB 3D6WA 3HOXH 5BR8Q 4UP7A 5FJ8G 2CH4W 2B63H 4OO1G 1PRTF 2VQEL 3HRZC 4BY1G 1O7ZA 3L2PA 3N6RA 4A3GB 4P2CB 5LHY1 2K28A 3H91A 5BN4A 1HZAA 1A2UA 3I4NB 3EFXD 3RUZA 1FR3A 2B2VC 4O2DA 4A3IG 3J80c 3D4DA 3Q24A 1TU2B 3UE1A 4A3DB 1TWGB 4TVAB 3DXJC 1SNQA 2QEJC 2J7ZA 3CF5A 1EQRA 4CKCA 1MJEA 1XNRL 2JE6I 4JI4Q 1G2SA 2YTVA 3NBIA 5IE8A 3G6JB 4DPGA 1C9OA 2UXCQ 1H9MA 5JEAH 1Q90A 2XTIA 3S1RB 5A2QL 3GV6A 3U4VA 1EY4A 3U9SA 4C3IG 4DR4L 4EGVA 4B3ML 3A8JE 3GTQB 3D4WA 4APVA 3N52A 5M3FG 3VA7A 3CXCA 1QZHA 4GOPB 5K36H 3DMUA 2F0MA 4G4KA 1VDZA 1S5DD 3RNUA 4I7AA 1KTKA 2JA5H 2EJMA 4ULLA 5C44B 2CHBD 1HNZQ 5K5PA 2UU9L 3S17B 4FF1A 2PW7A 3A5UA 4FF4A 1I6HB 4DUZQ 4IFDH 1SMXA 2CW0D 4G7OC 5KRUA 3RMHA 1EWCA 3NUCA 1V1QA 3FVQA 1WTWA 2K5DA 5CYUA 3H09A 4KD4A 3KBGA 2EYOA 1E2WA 4BBRH 1GUTA 1Q86C 3GTJH 2JA8H 4OO1I 3H0GB 2SDFA 5HY6A 1VQDA 2R93G 3CPFA 4FYDA 3MXPA 4JPBW 1PVOA 2PZUA 4RKLA 4WJWA 3JAMi 2R92H 4B3RQ 3OW7A 2B2UA 3FKIH 2L4NA 2WKCA 4OWTB 4BBSB 5AJ3L 1HNXQ 2HHHL 3S1NH 2NZHA 1B53A 2EE1A 4IPGA 1HUMA 1U0LA 3A55A 4R4TA 1JOKA 4DV4L 3QJYA 4CDFC 1SNCA 1VQLA 1OXXK 5I9PA 2A8VA 4DK3C 1T5EA 1X55A 1MJCA 3RN2A 4DV0Q 4DV2Q 2JA7B 1O80A 5IGFA 4BA2I 1KAAA 1PTOF 1ESRA 4IUTA 1EFID 1E24A 3DEPA 4A3EB 2VS1A 2MO1A 4F8MA 3TS0A 1KDAA 2Q2TA 4OX9L 2B29A 4S3SA 5ELBA 4LF4L 1OXSC 2NVXB 1R4PB 4C2MH 5JVH3 1LM0A 5DLQE 3I4MB 3HEJA 1UUPA 4XT3B 4X66Q 3I70A 1NNXA 1V1PB 3EROA 2F3VA 2SNSA 4CJ1B 1SYCA 3J80i 4A93H 1J5EL 3NSWA 3IFTA 4RH6A 3TREA 2JSOA 1PH7A 2E2DC 2XRQD 3I55A 1CKNA 1WFQA 1EIHA 2A69C 5CR3A 4DV6Q 2RF4A 2ATWA 3KDFA 4QJFA 1I4XA 4V0BA 2PPBC 1BCPB 2RCFA 1I3QH 3DEOA 3RZOB 1SAPA 4DR2L 3T1HQ 5E4WC 3PIP3 1HNWL 2CH4A 2LXKA 4KN7C 1MI2A 1QNKA 2Q2IA 3UDIA 1I4HA 3AQQA 4NXNQ 3CP0A 2F0OA 1RCVD 3U4ZA 1KNEA 5GROA 3P7JA 2OTJA 1AFPA 4R8IA 1LTTD 4QL5A 1ICFB 1PFMA 4NXML 1D5XC 4DN4M 1PDQA 1PA6A 1H9SA 4DV5L 3GV3A 3PCOB 3PUXA 4CGYB 2PQAB 1CZGA 3W1BA 1IW7C 3BDCA 1HZBA 4AYBG 2F0KA 1EL0A 2QGQA 3CU7A 1FJGL 1K28A 2KCMA 2YTYA 5IT9L 1FD7D 1EWIA 1VCIA 2L1BA 4AQYQ 3C2PA 4ME5A 4PQXA 4NPSA 3GTGH 1Y1WB 4K2LA 4JW0A 5J39A 4A3MB 3Q22A 4NMZA 4OGQC 3P1HA 1E7ZA 4IJLA 2ZJQA 2FJ2A 3G4SA 2G9HD 4KN4C 2Z9HA 3OSOA 3HKSA 2YV5A 1M1KC 5I4DA 5BR8L 2KHSA 2PQEA 3E9IA 1V9PA 2KCCA 3EA6A 3FEWX 2PW5A 5JPNC 3AB9A 4A3KG 2B8FA 1VQ6A 2Z4IA 4BXXH 3OWEB 4CBVA 1NR2A 2CFMA 1PRTD 1K83B 3HOVH 2L12A 1PYWD 3HOXG 3MTSA 1U4MA 2B63G 2B2UC 2QW7A 4PZ7A 1EIYB 1STBA 1NE3A 1QVCA 2R6GA 3BYTB 2DJGC 4LF8Q 2MFIA 2DN8A 1F2ZA 1VQOA 3MFYA 4JI4L 4HCSA 4OIKA 5IP7H 3OTOL 1YJNA 1UWVA 3T4AC 2WKDA 4GN3B 2UXCL 4L5SA 2IX3A 2D9UA 4XYQA 3JAME 4K5VA 3NP8A 4JI6Q 2ZJRA 4YCVA 4CDEC 1DOLA 3J7YW 3VYSA 1ESFA 1NCVA 2X6GA 2Z8LA 1PH6A 2F0TA 2Q8IB 4NKLA 2NVYH 4UAIA 1C8CA 1GUNA 1F2YA 2DJFC 4A3JH 1HNZL 4LFBL 1BKBA 5M9OA 5IGEA 1J8IA 1XPRA 3GTMB 2J0TD 4DUZL 3K57A 4OONA 2RBMA 3AYHB 3H15A 4Z9CB 1PZJD 1J6QA 2OXPA 3LX0A 1DD2A 5JVG3 2MHVA 4YCUA 3TP5A 4IFDG 2H1EA 3K59A 4CKBA 3PO2B 3S1QH 3K81C 4QF4A 2AHOB 3SGIA 3J80E 3PO3H 4B3RL 4LMQD 4DR6Q 2Y0SE 4RGMA 3GP7A 4XIGS 5M5WH 5CV6A 3SK4A 1HNXL 1N32L 2VUMB 2K05A 4DAPA 1F77A 3IAYA 1DZ1A 5LL6X 4KY6A 1XMQL 2OF1A 3M4OH 3BZDB 2R92G 1MGSA 1EY9A 1GM5A 3VYRA 4Y7NB 1R9TB 4BY1B 3FKIG 3PF4A 4IUPA 4CDDC 1UNSA 4QUFA 1EQVA 5FLMH 1VMCA 4JI7L 1BCPF 3B6YA 2K01A 3Q8DA 1JQYD 1KQSA 3P75A 4IO9A 3NELA 4DV2L 4A3IB 1QG7A 2JA6H 5C4HA 3ND8A 3STBC 1T9HA 1HZCA 1S72A 1N8RC 1B44D 1Q1EA 1PTOD 2L15A 3S16H 3BZKA 3I91A 3K7AB 2PCFB 4IPDA 2VY3A 1IL8A 4IQZA 4X3TA 2O2LD 4AIMA 4X66L 2A68C 4YHHL 1NR4A 4C3IB 1XJVA 1B2TA 4B3MQ 2IX1A 1KC8C 3C1EA 4ZYSA 2NYZD 1G6PA 5M3FB 3SK5A 5LMUL 5EKKA 5C5MA 1SJED 4LNQA 5CGKA 1OO9B 4ID6A 4IFDI 1EOVA 1WTOA 4A93G 4DV6L 3A5ZB 1OTCA 2UU9Q 5TSSA 1A3VA 4MIUA 4B9WA 3IKJA 3I56A 4TKOB 2QEXA 3CCMA 1D7QA 3VR3A 4HIKA 3UI2A 1HXYD 3L0OA 2HQLA 1B70B 1X3GA 3OW2A 1HRJA 3KF6A 4JBJA 2LY7A 3T1HL 1KDCA 1IYVA 2R7ZH 5COYA 5FO8B 1C48A 3G7LA 4MZ9A 1RTOA 4X64Q 2M9VA 1W6JA 1GXDC 4X62Q 3K6OA 1EFWA 4V190 2K5VA 2R93B 4IN3A 1TWAH 2NUCA 4LFAL 3AU7A 3CCQA 3KFUA 5AJ3Q 1X65A 5C4XH 4L5RC 3C46A 3NENA 5C0XJ 3WOEA 5FO7B 3M7GA 2O5JC 1X32A 1MBYA 4Q0FA 4GN4B 1CT1D 4DV4Q 2I5HA 3J7AV 1VF7A 2RVLA 1N36L 2KHJA 2NTSA 1V43A 1AE3A 1W6KA 1STGA 3SVMA 1ET9A 1BBXC 1A6XA 1I6VC 1KAWA 3PSIA 3H3VH 2F0LA 2K52A 1C4QA 1YNNC 3PGZA 2K5HA 1EQQA 1YNJD 3GTKH 1QUQA 1D5ZC 1I50B 4KTAA 1IXRA 3HFZB 1IZ6A 5IGDA 4EQPA 1LUZA 4XQQA 3MZ5A 3NTHA 4R9WA 3CQZB 3ERQA 2UUAL 3A54A 1FVIA 3IRBA 4C3HH 1DOMA 1J5EQ 3MXUA 4BXXG 1IYUA 1TT2A 3K5OA 4LF8L 3HOVG 1GKHA 1O78A 3T1YL 2QDLA 4JBWA 2KCTA 2WB1G 4JG2A 3KJOA 1KD1C 3NHHA 3NBHB 4ALPA 3SE0A 3K5NA 1UE7A 4C1NK 3CRLC 4KJOA 1KL9A 4DR5Q 3K5MA 4OHJA 1VQGA 3R2IA 4JI6L 2L55A 3WOFA 4RAUC 2WV6D 2BE5C 2PI2A 2K5WA 5IP7G 1SYDA 2XRSD 1DJRD 2NB0A 2A6ED 3DHQA 5JJLA 1W3SA 1KLUD 1B7YB 1EYAA 4ZCKA 1HNWQ 2ALYB 1CKNB 4OWXB 1F9SA 2F0IA 1L0WA 1CTMA 4A75A 3D6CA 2CQOA 2HCIA 2K33A 2F0QA 4DR7L 2PNRC 1TWCH 3TEHB 1JOOA 4KHZA 1EEFD 4NXMQ 1U5KA 3HS0C 2JQOA 1STYA 3K58A 5EBDA 3SK8A 4DV5Q 3SXHA 1Z47A 5M5YB 4A3JG 4AYBB 5KNBA 3TSSA 1Y1VH 3PUZA 2FXQA 1V8QA 3F2DA 3MXNB 2Q8RE 2E2JB 2VQFL 1UEAB 4PMCA 5C3EH 1WI5A 2IHEA 3T56B 2TSSA 1GOZA 2NWGA 1S5BD 1SE2A 2I07B 2RHSB 3V2TA 2EPBA 4A3CH 2E74C 4DR6L 2D5DA 4DK0A 5GADC 3KBXA 5M5XH 3V96A 3I7FA 2NZOA 1CHPD 3NTKA 3CC7A 4LFCL 3G71A
chains in the Genus database with same CATH topology
1VF5C 1ILQA 1GUOA 1SYEA 2EZVA 1WTQA 4A3KB 1I4GA 2IJ0A 3E5SA 4KKSA 1II3A 3HOXB 3QOJA 2B63B 1A3UA 1BCPD 3T13A 3MA2B 1LTGD 3OOCA 5FKAC 4IUNA 4K6DA 1AEXA 1F9QA 1QJOA 3EJIA 5CV5A 1GUWA 4FO2A 1EY8A 2ICEC 2Z4HA 2CW0C 2EDGA 2B2TA 1QOHA 1U9RA 2A6HC 3OHXC 4M1UB 2EY6A 4PMWA 1RHPA 5ELFA 2F4IA 4RKBA 1EWHA 5FLXL 3QOLA 2F0GA 2RA4A 3W2DA 4BA1I 3NE5B 3NWSA 4QIWB 3K5LA 3TZUA 4RA8A 1DONA 2E76C 2MP1A 4U68A 5KIXA 1EQTA 1U4LA 1Y8PB 2EYHA 2FFKB 2B2WA 4LK1C 1XYIA 2A74C 3GTJB 1HTLD 1CI3M 1SNMA 4CKEA 2BDNA 2N55A 5HGTA 3OWFA 3FDTA 2R92B 3OIQA 4KV6A 4H13C 3FKIB 2B8GA 1SMYC 4NP5A 3V05A 1IKLA 3MEHA 4QUCA 5D65A 4R8NA 4XQJA 3QWNA 4IZ8A 3NK9A 5EQ0A 4XDXA 3OMGA 2HUGA 4WORA 4RWSC 4M8AA 3A8IE 4HSVA 3R3OA 5CBEE 4KHVA 2IX0A 3VR6A 2KJXA 4K5WA 2AQ2B 2KCNA 2AWNA 3NWTA 4N9PA 5C4JB 3I4LA 4XT1B 3VR5A 2K04A 2AUJD 3J80L 4C3HG 1ZKOA 2BOSA 4A93B 1O7YA 4C1NI 1SE3A 1MSHA 2JEAI 2PYKA 1QB5D 4J1MA 1Y8OB 2K7VA 4LAAA 1DXMA 2BCOA 4BS9A 2K5QA 4JK1C 1KNAA 3TBIB 1I3QB 1LTBD 2KA7A 5NUCA 1TIID 3I3CA 1EEID 2B2TC 3U9OA 1MD2D 4H7BA 4TQUS 1QE6A 2RDFA 1EIGA 4DAYA 4H44C 2A69D 1JB3A 1RF2D 3TP8A 1FNWA 5IGCA 1BF4A 4ZRZA 1LO5D 2F3WA 1RODA 5FK9C 2JP1A 4K14A 4L63B 2M2LA 1HTPA 5C3WA 3A8KE 1XWEA 3GTGB 1TS2A 1EZ6A 2OEOA 1L0YB 3ITPA 3ONAB 5T1GA 1SYGA 2I46A 2VB2X 3GQBA 1LTSD 1TY2A 3D4RA 3CKIB 2B2WC 2FINB 1RJTA 1IW7D 5DEHA 2BA0A 3TP7A 5I6WA 2ZXOA 1AN8A 3J81L 3HOVB 4C56C 3SR1A 2WB1B 5EPJA 4IFDJ 4RFBA 1GHJA 3H3VC 1OXUA 2L0CA 3R8BA 3GTOB 2HQEA 5JEAG 4IUUA 4KD3A 3D31A 1STHA 1ZXTA 2X69A 1TKWB 3BG3A 4HMJA 1SNPA 3IFDA 3DWAA 3TMEA 2F0FA 1BOSA 5K36G 3KLSA 1QNUA 5EJWA 1PLFA 5CORA 1PXUA 3D8GA 4OIJA 2EJGC 5KEEA 4A3JB 4DNRB 3MWYW 5F2DA 3P20A 4DF7A 2ID0A 2EYPA 5CBAE 4DFAA 1SE4A 3MXGA 2XSCA 3URYA 2XIWA 3CHBD 3S1QB 3MFGA 3KK7A 3PO3B 4HMIA 4XYOA 3R93A 2FHTA 2MPMA 5M5WB 1F9PA 1SXTA 5C6AA 3M4OB 2F0PA 1J9OA 4ZK9B 1JORA 1SNOA 4KK7A 1AW7A 3FPUB 1EU3A 1FNUA 1XTCD 1HA6A 1WD1A 3VYUA 1STNA 2Q8TA 3IL8A 2JA6B 4MN3A 3LNNA 1SSOA 3LWEA 1CA6A 5KNDA 4HSPA 1BQQT 1BO0A 1V1PA 1RD9D 2D2CC 2IT1A 1LTID 4X3UA 5C4ZA 5J1ZA 2B2YA 4EQNA 2A5HA 4J6HA 3MAQA 1TQOA 3D3RA 5IT9E 2KVMA 5IOCA 3I73A 2PZTA 1FYCA 1RDPD 1LV9A 2A68D 2R7ZB 3NQIA 1D2BA 4RCOA 1R4QB 3DWPA 5IODA 4RCNA 1E2VA 4IALA 1TWAB 1JWSD 4ZUJA 5I6YA 1S5ED 2RSNA 5DAUA 2VXWA 2EVBA 5C4XB 1D1IA 5IGBA 1CFMA 3BS1A 4OL7A 2QKIC 4ZQ3A 4NW2A 1EOTA 1X3QA 1ET6A 1CQFA 2DNEA 5KGUA 5J22A 2F0JA 1SDFA 1F2MA 1D5MC 2KUMA 2QF7A 3GTKB 3TZDA 2ENBA 2RDGA 2M00A 4F87A 4B08A 2BDOA 1JE4A 2XWJB 3HG9A 1JC7A 3RLFA 1F2LA 4KY5A 4DA2A 2SEBD 2AQ1B 4PNYA 4C3HB 2R3ZA 1HUNA 1BDOA 3S9WA 5E1FA 1TS4A 3HOWB 2SOBA 4QMGA 1ILPA 5C3XA 1ZYRC 1YNND 3HOYB 1D1KA 3R2TA 5ELEA 4X3SA 4HAEA 5DM73 1F9RA 1PTOH 5I2YA 4G7ZC 2CQAA 2HDMA 2K32A 5E3FA 3MHBA 3L7ZC 1TWCB 1Q1BA 3HP3A 4K6LA 3NPPA 2B2YC 3CRKC 1G91A 1WTRA 1GHKA 3M3YB 2K1BA 1H9SB 4ABNA 4RHSA 2BE5D 1Y1VB 4DXFA 1DYQA 2KECA 1BCPC 3QO2A 2RDHA 3I72A 5C3EB 4MHEA 2NZ1D 1SEBD 2EYLA 3S14B 4ZAIA 3M7NA 5M5XB 4LJZC 3SK6A 1H9KA 4XXEA 4HR7B 2NTTA 1HFNA 2J4XA 2HDLA 5I2XA 2MGSA 5EPLA 1DCZA 1LT6D 1B1ZA 2E2HB 2AWOA 3F2UA 3ZYYX 2KEDA 1SFOB 4E6IA 1AZPA 5M3MB 1TWHB 1TS3A 2EYFA 2FMCA 2EY1A 2NBFA 3BVZA 2O5IC 1SNDA 4ZUIA 1CHQD 2NN6H 1WVLA 4F88A 1NAPA 2GA4B 3MVVA 3EVQA 2ZXPA 5D3IB 4L8JA 2LS01 2JA5B 2ICIA 2JYOA 1I4RA 1JICA 1LTRD 2TMPA 1TR5A 1WTXA 5AFWA 2LFNA 4YIJA 1HQMC 3K0YA 4C3JG 1EYDA 5CC4A 1ENFA 2DY7A 5ISRA 2A6HD 4BBRB 5A35A 2JA8B 1RTNA 2DY8A 3VR2A 1X3PA 1JWMD 2Z1CA 3X3NA 1T5XD 2QCPX 3JAML 5IGGA 3S1NB 3TDQA 1EY5A 5DNFA 2XN9C 1TVXA 3PUWA 1B4OA 3PV0A 3VA5A 1IKMA 4KI0A 3BYYB 1QWYA 2WIIB 3E0JA 1OXTA 4FXGC 3X3MA 4ZKCB 3S2HB 1TWFB 3GO5A 1QCBD 4J8QA 1BXTA 1LTAD 1VMPA 1SJHD 4BWGB 4I7ZC 3BDOA 2EY5A 2PZWA 4HN7A 1KDBA 4C2MB 3AMUA 2C9OA 1Z6HA 2N88A 1ICWA 1LT5D 2L9HA 2L11A 1Q12A 3SHLA 2F1MA 1SMYD 3NBHA 1ZEQX 5JPMC 1I4QA 1UAPA 3HOZB 1Z7TA 2D62A 4U673 5FO9B 4EQOA 4A3BB 3Q6SA 2E75C 3HKZB 2F0VA 1EYCA 4TSSA 1SYFA 3RD4A 4PV1C 5I9OA 4O1NA 2Y0SB 3FRPB 2IPKD 3Q0AA 1U4RA 1H9JA 2BA1A 1HCZA 4BY7B 2SNMA 1EY6A 4KKUA 5EPKA 4X3KA 1O7LA 3QIAA 1NUCA 3MXNA 1JR0D 1ENCA 3O13A 2R61A 4DK1A 1PRTC 5CV7A 5IIFA 3PUYA 1HQRD 2MJ8A 4FXKC 4XTCS 1GUGA 5A2QE 5JJZA 5JOBA 4KKTA 1H9RA 4RGTA 1XXGA 5JEAJ 2RKSA 1B9NA 1LT4D 4IUQA 2WAQB 1U4PA 3HZXA 3BVMA 5EGTA 3BVGA 4XQNA 5FLXE 1EU4A 2XWBB 1BR9A 5CV4A 3C1FA 1A3TA 5C0XH 3HOUB 3BDLA 3OMCA 1MSGA 1QILA 3KF8A 2RSOA 1B50A 3DM1A 1CA5A 5HURA 1LLRD 1ML0D 3M4YA 1HHVA 1EZ8A 1SBBB 1LABA 1Y69U 2EYMA 2V4DA 1PFBA 5FOBB 1G6ZA 4KY7A 2QDBA 2K03A 3T51B 1K8OA 4RGOS 3FPPA 3ND9A 4PMBA 3OIPA 1WTPA 2YYZA 2AQ3B 2NVYB 5G3LF 3SEBA 4Q5VA 2NN6G 4FP5D 5T1IA 2JXMB 1BNZA 2L5TA 1Y8NB 4N9TA 4KJNA 1CQVA 1G2TA 3HGBA 2F0WA 4DU9A 4RGNA 4IURA 3KLSX 2PO4A 4G57A 3T16A 1TY0A 4EVOA 3C3LA 3S2DB 2EXZA 1L0XB 4WFN3 4ODGA 2X6LA 4K5XA 1PTOC 2F03A 4FF3A 2EY2A 3VR4A 3OPOA 1M8AA 1A15A 2KQ3A 4OO1H 4I65A 1RKNA 1CZWA 4HCEA 2F0EA 2B39A 3I90A 1TS5A 3DUZA 5EBCA 4NDXA 2E2IB 4L6TB 1JWUD 1G291 1SYBA 1LT3D 1S5FD 1WCMB 1G8ZD 1PFNA 2KEEA 1Q8IA 3A7LA 3DWQA 3H94A 3NXWA 4QB4A 4DAVA 3Q23A 4B9XA 1S5CD 1NSNS 3S16B 1Q3LA 5C5LA 1B3AA 2K6AA 3W3AA 2NN6I 3NTIA 2G9DA 1V1OA 2AUKA 4FF2A 4FXDA 3VYTA 1WD0A 2WINB 3TN2A 3MC0B 2EJFC 4ILWA 2JEBI 4A3FB 4CJ2C 4WRDA 1DM0B 4KMUC 1AZQA 4ZLTF 2RQXA 3KUPA 2OT2A 1PRTB 4C3JB 1PZKD 4O42A 4RHRA 4TRDA 1IHZA 3PIO3 4HEDA 5LL6S 1STEA 4K2KA 1B9MA 1A2TA 1FGBD 4DXGA 4G7HC 5JAVA 4H0LC 5KYIA 1HA5A 1ENAA 1YNJC 5CMDA 2H4OA 2O4XA 2KOLA 3J81E 4HTHA 2B2VA 2DNCA 5EKIA 4FNFA 2C5CA 3SDZA 1CK1A 3A7AB 5D14A 3H6MA 2WP8J 1HFGA 2WACA 3S15B 2ZT9C 1JOQA 1JCKB 2NVQB 1WTVA 1HPCA 1CM9A 3L9AX 3A56A 3PMFA 5CV8A 2CVRA 5E4XA 4DNTB 3J7AF 3I8ZA 3PUVA 2A6EC 1D6EC 2YU9B 2F0UA 5EKLA 3GTPB 1EY7A 3KLRA 5ELDA 4GZYC 2EYJA 5C0XG 4ZKBB 1PMRA 1PZID 2MUYA 4K8IA 4CHTB 3GTLB 4QCLA 3M85A 1E2ZA 2VNUD 2LMCB 2EOTA 5DM63 3FMCA 3RZDB 4IUVA 3WDNA 3GD7A 1LACA 2VB3X 3EQLC 1E0BA 2F0NA 2HCCA 2QILA 2F0SA 1AP0A 2NVTB 1GUSA 1M4VA 2XNAC 2IWHA 2LKVA 3QB3A 1K8MA 1KLGD 4DGZA 3S1MB 3NQTA 4F7XA 1FNVA 1PTOB 5D3DA 5G3LD 1OXVA 2ZXRA 5KNCA 3E6ZX 1DOKA 3L3OC 2F0DA 1KABA 2IL8A 3QG1A 5BN3A 5ELCA 3LWUA 2F0HA 4UDUC 1ZYRD 1GJXA 4K8JA 2XVSA 5CV9A 2A73B 1S4ZA 1BUVT 2FMMA 1ONLA 5KYLA 3T53B 4CJ0B 1EY0A 2IW3A 5BN5A 1XX8A 3TP6A 5C0XI 4FVMA 1I4PA 1STAA 2PMZB 3D6WA 4OO1G 1PRTF 3HRZC 1O7ZA 3N6RA 4A3GB 4P2CB 5LHY1 2K28A 3H91A 5BN4A 1A2UA 3I4NB 3EFXD 3RUZA 1FR3A 2B2VC 3D4DA 3Q24A 1TU2B 4A3DB 1TWGB 3DXJC 1SNQA 2QEJC 2J7ZA 4CKCA 2JE6I 1G2SA 3NBIA 3G6JB 1H9MA 5JEAH 1Q90A 3S1RB 5A2QL 3GV6A 1EY4A 3U9SA 4C3IG 4EGVA 3A8JE 3GTQB 3D4WA 3N52A 3VA7A 5K36H 3DMUA 2F0MA 4G4KA 1VDZA 1S5DD 1KTKA 2EJMA 4ULLA 5C44B 2CHBD 5K5PA 3S17B 4FF1A 2PW7A 4FF4A 1I6HB 4IFDH 2CW0D 4G7OC 5KRUA 3RMHA 1EWCA 3NUCA 3FVQA 1WTWA 2K5DA 5CYUA 3H09A 4KD4A 3KBGA 2EYOA 1E2WA 1GUTA 4OO1I 3H0GB 2SDFA 4FYDA 3MXPA 2PZUA 4RKLA 4WJWA 3OW7A 2B2UA 4BBSB 2L4NA 2WKCA 1B53A 2EE1A 1HUMA 3A55A 1JOKA 3QJYA 1SNCA 1OXXK 5I9PA 1T5EA 2JA7B 1O80A 5IGFA 4BA2I 1KAAA 1PTOF 1ESRA 4IUTA 1EFID 3DEPA 4A3EB 4F8MA 1KDAA 4S3SA 5ELBA 1OXSC 2NVXB 1R4PB 5JVH3 3I4MB 3HEJA 1UUPA 4XT3B 3I70A 1V1PB 3EROA 2F3VA 2SNSA 4CJ1B 1SYCA 3NSWA 3IFTA 4RH6A 2JSOA 2E2DC 2XRQD 1EIHA 2A69C 5CR3A 1I4XA 4V0BA 2PPBC 1BCPB 3DEOA 3RZOB 1SAPA 5E4WC 3PIP3 4KN7C 1MI2A 1QNKA 1I4HA 2F0OA 1RCVD 1KNEA 3P7JA 1AFPA 4R8IA 1LTTD 1PFMA 1D5XC 4DN4M 1PDQA 1H9SA 3GV3A 3PUXA 4CGYB 1CZGA 1IW7C 3BDCA 2F0KA 1EL0A 3CU7A 5IT9L 1FD7D 1VCIA 2L1BA 3C2PA 4ME5A 4PQXA 1Y1WB 4K2LA 5J39A 4A3MB 3Q22A 4NMZA 4OGQC 3P1HA 2FJ2A 2G9HD 4KN4C 3OSOA 5I4DA 2KHSA 2PQEA 3FEWX 2KCCA 3EA6A 5JPNC 2PW5A 3AB9A 2B8FA 2Z4IA 3OWEB 4CBVA 1NR2A 1PRTD 1K83B 2L12A 1PYWD 3MTSA 1U4MA 2B2UC 1STBA 2R6GA 3BYTB 2DN8A 1F2ZA 3MFYA 4HCSA 4OIKA 3T4AC 2WKDA 2IX3A 2D9UA 4XYQA 3JAME 4K5VA 3NP8A 1DOLA 3J7YW 3VYSA 1ESFA 1NCVA 2X6GA 2Z8LA 2F0TA 2Q8IB 4NKLA 4UAIA 1C8CA 1GUNA 1F2YA 5M9OA 5IGEA 1J8IA 3GTMB 2J0TD 3K57A 2RBMA 4Z9CB 1PZJD 2OXPA 3LX0A 1DD2A 5JVG3 2MHVA 3TP5A 4IFDG 2H1EA 3K59A 4CKBA 3PO2B 4QF4A 3J80E 4LMQD 4RGMA 3GP7A 4XIGS 5CV6A 3SK4A 2VUMB 2K05A 4DAPA 1F77A 3IAYA 1DZ1A 5LL6X 4KY6A 2OF1A 3BZDB 1MGSA 1EY9A 3VYRA 4Y7NB 1R9TB 4BY1B 4IUPA 1UNSA 4QUFA 1EQVA 1VMCA 1BCPF 2K01A 1JQYD 3P75A 4A3IB 1QG7A 5C4HA 3ND8A 1B44D 1Q1EA 1PTOD 3I91A 3K7AB 2PCFB 1IL8A 4IQZA 4X3TA 2O2LD 2A68C 1NR4A 4C3IB 1B2TA 2IX1A 3C1EA 4ZYSA 2NYZD 5M3FB 3SK5A 5EKKA 5C5MA 1SJED 5CGKA 1OO9B 4ID6A 4IFDI 1WTOA 5TSSA 1A3VA 4MIUA 4B9WA 3IKJA 4TKOB 3VR3A 3UI2A 1HXYD 1HRJA 2LY7A 1KDCA 1IYVA 5COYA 5FO8B 1C48A 3G7LA 1RTOA 2M9VA 1W6JA 1GXDC 3K6OA 4V190 2R93B 4IN3A 2NUCA 3AU7A 3C46A 5C0XJ 3WOEA 5FO7B 3M7GA 2O5JC 1X32A 1MBYA 4Q0FA 1CT1D 3J7AV 1VF7A 2RVLA 2NTSA 1V43A 1W6KA 1STGA 3SVMA 1ET9A 1BBXC 1A6XA 1I6VC 2F0LA 1C4QA 1YNNC 1YNJD 1D5ZC 1I50B 4KTAA 5IGDA 4EQPA 4XQQA 3MZ5A 3NTHA 4R9WA 3CQZB 3ERQA 3A54A 1DOMA 3MXUA 1IYUA 1TT2A 3K5OA 1O78A 4JBWA 3NHHA 3SE0A 3K5NA 4C1NK 3CRLC 4KJOA 3K5MA 4OHJA 3R2IA 2L55A 3WOFA 4RAUC 2WV6D 2BE5C 2K5WA 1SYDA 2XRSD 1DJRD 2NB0A 2A6ED 3DHQA 1KLUD 1EYAA 1F9SA 2F0IA 1CTMA 3D6CA 2K33A 2HCIA 2F0QA 2PNRC 1JOOA 4KHZA 1EEFD 3HS0C 3K58A 1STYA 5EBDA 3SK8A 3SXHA 1Z47A 5M5YB 4AYBB 5KNBA 3TSSA 3PUZA 1V8QA 2Q8RE 2E2JB 1UEAB 4PMCA 3T56B 2TSSA 1GOZA 2NWGA 1S5BD 1SE2A 2I07B 3V2TA 2EPBA 2E74C 2D5DA 4DK0A 3KBXA 3V96A 1CHPD 3NTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L12 A;  5CBA E;  1ILQ A;  1G2S A;  1WTQ A;  1ROD A;  3MTS A;  1QG7 A;  4CJ2 C;  1U4M A;  2B2Y C;  2JP1 A;  4XT3 B;  1U4R A;  1G91 A;  2B2U C;  2XIW A;  2EOT A;  1AZQ A;  1IKL A;  1WTR A;  3GV6 A;  4ZLT F;  4QUC A;  4IUV A;  4CJ1 B;  2M2L A;  2RSN A;  5D65 A;  5T1I A;  2DY7 A;  1BNZ A;  2K1B A;  2VXW A;  1E0B A;  2HCC A;  3I91 A;  4R9W A;  3KUP A;  1AP0 A;  3R93 A;  1IL8 A;  2FHT A;  1RTN A;  2MPM A;  3N52 A;  4HCS A;  5EPK A;  4O42 A;  2DY8 A;  5EQ0 A;  4OIK A;  1F9P A;  4X3T A;  4X3K A;  4XDX A;  1X3P A;  2KEC A;  2HUG A;  1WTP A;  2D9U A;  3ONA B;  3QO2 A;  4RWS C;  1DOM A;  5T1G A;  1NR4 A;  1EIH A;  1B2T A;  1G2T A;  4HSV A;  4HED A;  4MHE A;  4NW2 A;  1F9Q A;  2NZ1 D;  1EOT A;  4IUR A;  1J9O A;  1X3Q A;  4ZK9 B;  2NYZ D;  1DOL A;  5CBE E;  2B2W C;  1NCV A;  2FIN B;  1RJT A;  3FPU B;  4ZAI A;  2X6G A;  1GUW A;  1DOK A;  2MJ8 A;  5DNF A;  1TVX A;  1B4O A;  3DEO A;  1SDF A;  5CMD A;  1SAP A;  2IL8 A;  5JJZ A;  1HA6 A;  2X6L A;  1IKM A;  2B2T A;  5E4W C;  2KOL A;  1WTO A;  1WD1 A;  4UAI A;  1MI2 A;  4XT1 B;  1C8C A;  1QNK A;  4RAU C;  2Q8T A;  3IL8 A;  1HFN A;  4ZKC B;  2HDL A;  2KUM A;  4MN3 A;  5EPJ A;  2K04 A;  1WTW A;  1SSO A;  3LWE A;  3UI2 A;  3TZD A;  1CA6 A;  2B2V A;  5EKI A;  1M8A A;  1KNE A;  1A15 A;  1S4Z A;  2MGS A;  4IUQ A;  3P7J A;  5EPL A;  1J8I A;  1BO0 A;  4R8I A;  1HRJ A;  1RHP A;  1O7Y A;  1PFM A;  1U4P A;  1F9S A;  5D14 A;  2SDF A;  2FMM A;  4DN4 M;  4X3U A;  1VMP A;  1JE4 A;  1PDQ A;  3I90 A;  1HFG A;  1F2L A;  3GV3 A;  5COY A;  4CJ0 B;  2HCI A;  4IUU A;  3G7L A;  3F2U A;  1RTO A;  1MSH A;  2R3Z A;  2B2Y A;  2RA4 A;  1WTV A;  1HUN A;  2H1E A;  2B2U A;  1EL0 A;  2L4N A;  2KED A;  1CM9 A;  1ZXT A;  2X69 A;  1PFN A;  2N88 A;  1XX8 A;  2KEE A;  1ICW A;  1B53 A;  2EE1 A;  3IFD A;  1ILP A;  1AZP A;  1MSG A;  2CVR A;  2L11 A;  2L9H A;  2KVM A;  1B50 A;  2RSO A;  1KNA A;  5E4X A;  1HUM A;  3DM1 A;  2L1B A;  1CA5 A;  3D6W A;  3I8Z A;  4RA8 A;  1DON A;  1ML0 D;  2MP1 A;  5EJW A;  1PLF A;  1Q3L A;  4LMQ D;  4U68 A;  5COR A;  1HHV A;  1O7Z A;  3I3C A;  4OIJ A;  1WVL A;  1B3A A;  2Q8R E;  1EQT A;  2B2T C;  2K05 A;  1NAP A;  2K28 A;  4X3S A;  3H91 A;  1DZ1 A;  1LV9 A;  1X32 A;  1U4L A;  1PFB A;  2FFK B;  2FJ2 A;  4HAE A;  2B2W A;  1F9R A;  1O80 A;  1XYI A;  1G6Z A;  1QE6 A;  1MGS A;  2B2V C;  1ESR A;  4IUT A;  3DEP A;  1EIG A;  2NWG A;  2RVL A;  4IUP A;  2JYO A;  2EPB A;  3MWY W;  1JIC A;  4QUF A;  1WD0 A;  2BDN A;  2HDM A;  2K03 A;  3KBX A;  3Q6S A;  4ZKB B;  3SVM A;  2N55 A;  1BBX C;  3TN2 A;  1VMC A;  1WTX A;  2K01 A;  2J7Z A;  1BF4 A;  1NR2 A;  3FDT A;  5AFW A;  3HP3 A; 
#chains in the Genus database with same CATH topology
 4LF5 L;  1VF5 C;  1ILQ A;  1GUO A;  1SYE A;  2EZV A;  1WTQ A;  3PO3 G;  4LUO A;  1G51 A;  4A3K B;  3AEV A;  1I4G A;  2IJ0 A;  3E5S A;  4LWC A;  4KKS A;  1II3 A;  3HOX B;  3QOJ A;  2B63 B;  4QQB X;  1A3U A;  1BCP D;  2E2H H;  3T13 A;  3MA2 B;  1LTG D;  5IYD H;  5FLM G;  5HGQ A;  2LSS A;  4LF7 Q;  3OOC A;  5FKA C;  1K73 C;  4IUN A;  4K6D A;  1AEX A;  1F9Q A;  1SFO H;  2Z6K A;  1C0A A;  1QJO A;  3KF8 B;  1TWG H;  3OTO Q;  4HJ7 A;  3EJI A;  4EQ5 A;  5CV5 A;  2JA6 G;  4K0K L;  4HJ5 A;  1GUW A;  5M3M H;  1TWH H;  2VW9 A;  4FO2 A;  1EY8 A;  2ICE C;  2Z4H A;  2CW0 C;  2EDG A;  2B2T A;  3CCV A;  1QOH A;  1U9R A;  4YWK A;  2A6H C;  1IYJ B;  3OHX C;  4M1U B;  2EY6 A;  4PMW A;  1RHP A;  5ELF A;  2F4I A;  4OXP A;  1MIU A;  4RKB A;  1EWH A;  4LFB Q;  5FLX L;  3QOL A;  1MHW C;  2F0G A;  2RA4 A;  3WWV A;  4Y52 H;  3W2D A;  4BA1 I;  4DUY Q;  3LGJ A;  3NE5 B;  3NWS A;  3S17 H;  2R7D A;  1JJG A;  4QIW B;  3K5L A;  4R4Q A;  3TZU A;  3I2Z A;  4RA8 A;  1DON A;  4X64 L;  2E76 C;  3CCS A;  2MP1 A;  4U68 A;  4IPC A;  1HR0 W;  2ZTD A;  4X62 L;  5KIX A;  1EQT A;  2R7Z G;  1U4L A;  1Y8P B;  1VQB A;  2EYH A;  2FFK B;  2B2W A;  3RN5 A;  2VZA A;  4LK1 C;  5IT9 c;  1XYI A;  2A74 C;  3GTJ B;  1HTL D;  1CI3 M;  1N32 Q;  1SNM A;  4CKE A;  1TXY A;  2BDN A;  1RIP A;  3CAM A;  2N55 A;  5HGT A;  1XMQ Q;  3OWF A;  1IBK L;  4L5Q A;  1PH2 A;  3FDT A;  2R92 B;  3OIQ A;  4KV6 A;  4H13 C;  3FKI B;  4HJ8 A;  5LMN L;  3W1G A;  5C4X G;  2B8G A;  1SMY C;  4NP5 A;  3S2H H;  3V05 A;  1IKL A;  4B3T Q;  4JI7 Q;  3MEH A;  4CDC C;  2ZJP A;  4QUC A;  4R4C A;  1TWF H;  5D65 A;  4R8N A;  4XQJ A;  3QWN A;  4IZ8 A;  3NK9 A;  1YI2 A;  5EQ0 A;  1ASY A;  4XDX A;  3OMG A;  2HUG A;  1YHB A;  4WOR A;  1VQM A;  4RWS C;  1LYL A;  4M8A A;  3A8I E;  4HSV A;  3R3O A;  4LUV A;  5CBE E;  1Q46 A;  4X65 Q;  4KHV A;  2IX0 A;  3VR6 A;  4DV3 Q;  4YHH Q;  2KJX A;  4K5W A;  2AQ2 B;  2KCN A;  2AWN A;  3NWT A;  4N9P A;  3BZC A;  2N8N A;  3I4M H;  5C4J B;  3I4L A;  4LUZ A;  4XT1 B;  5LMU Q;  3VR5 A;  1HH2 P;  2K04 A;  1BBU A;  4PG3 A;  2AUJ D;  3J80 L;  3HOZ H;  4C3H G;  1ZKO A;  2BOS A;  1XTD A;  2PMZ E;  4A93 B;  1L1O A;  2ZM6 Q;  1O7Y A;  4DR5 L;  3HOW G;  4A3B H;  4C1N I;  4UP9 A;  4B3S L;  1SN8 A;  1SE3 A;  1MSH A;  2JEA I;  2HD3 A;  1NY4 A;  4KLK A;  3HOY G;  2PYK A;  1QB5 D;  4J1M A;  1Y8O B;  2K7V A;  2D0P A;  4LAA A;  1DXM A;  4JOI A;  2BCO A;  4BS9 A;  4BY7 H;  4R4O A;  2K5Q A;  4JK1 C;  1KNA A;  3TBI B;  1I3Q B;  3PF5 A;  2IY5 B;  1LTB D;  2KA7 A;  5NUC A;  4LFA Q;  1TII D;  3I3C A;  1EEI D;  1X3E A;  2B2T C;  3M4P A;  3U9O A;  3PQI A;  1MD2 D;  4H7B A;  4TQU S;  1QE6 A;  2RDF A;  1N34 Q;  1EIG A;  1I94 L;  4DAY A;  4H44 C;  2A69 D;  4JBK A;  1JB3 A;  1RF2 D;  1CKO A;  3TP8 A;  1FNW A;  5IGC A;  3CME A;  1BF4 A;  4GLV B;  4ZRZ A;  1LO5 D;  2F3W A;  4JI0 L;  4UY8 C;  1N36 Q;  1ROD A;  5FK9 C;  2JP1 A;  1Y1V G;  1PH4 A;  4K14 A;  1NMF A;  4L63 B;  2M2L A;  1HTP A;  5C3W A;  3A8K E;  4HIM A;  5C3E G;  4P72 A;  1XWE A;  3GTG B;  1TS2 A;  4A3M H;  1EZ6 A;  2OEO A;  2MQH A;  4IPH A;  1L0Y B;  3ITP A;  4HJA A;  4IOA A;  3ONA B;  5T1G A;  1SYG A;  2I46 A;  2VB2 X;  3GQB A;  3CCR A;  2UUA Q;  1LTS D;  1TY2 A;  3D4R A;  3CKI B;  2F4V Q;  2B2W C;  2FIN B;  1RJT A;  3HOU H;  1IW7 D;  5DEH A;  2BA0 A;  3TP7 A;  5I6W A;  5GAH C;  2ZXO A;  5EAY A;  4LF7 L;  1AN8 A;  3J81 L;  3HOV B;  4P75 A;  4C56 C;  3T1Y Q;  3SR1 A;  5JJI A;  3D0F A;  2WB1 B;  5EPJ A;  2DUD A;  2BH2 A;  5IYD G;  4IFD J;  4RFB A;  1GHJ A;  4N8F A;  3H3V C;  1OXU A;  2L0C A;  3K8A A;  3R8B A;  2BH8 A;  2ZTE A;  1SRO A;  3GTO B;  2HQE A;  5JEA G;  4IUU A;  5M3M G;  4KD3 A;  4YY3 L;  3D31 A;  1STH A;  2B3G A;  1E22 A;  4P74 A;  4GOP A;  1ZXT A;  2X69 A;  1TKW B;  3BG3 A;  4HMJ A;  1SNP A;  3IFD A;  4OEM B;  2E5L L;  4DR7 Q;  3DWA A;  3TME A;  2F0F A;  1BOS A;  5K36 G;  3KLS A;  4JI8 Q;  1QNU A;  5EJW A;  1PLF A;  1K0R A;  5COR A;  2JA5 G;  1PXU A;  3D8G A;  4OIJ A;  2EJG C;  4DUY L;  5KEE A;  3TS2 A;  1YVC A;  4A3J B;  3M4Q A;  1KIX A;  4JI2 Q;  3CW2 C;  3E3X A;  1XMO Q;  4DNR B;  3MWY W;  3S2D H;  5F2D A;  3P20 A;  2VQF Q;  4DF7 A;  3HKZ E;  2ID0 A;  2EYP A;  1XPU A;  1XNQ Q;  3KLW A;  5CBA E;  4DFA A;  1SE4 A;  4BBR G;  3MXG A;  2XSC A;  2I5L X;  3URY A;  2JA8 G;  2XIW A;  4HID A;  2K5N A;  3CHB D;  1PYS B;  3S1Q B;  4LFC Q;  3MFG A;  1Q8K A;  4LF5 Q;  2YTX A;  3KK7 A;  3PO3 B;  4J15 A;  4HMI A;  4XYO A;  3R93 A;  2FHT A;  2MPM A;  5M5W B;  5J3B A;  3K80 C;  1F9P A;  1SXT A;  2E2I H;  2MO0 A;  3CCU A;  5C6A A;  4B3T L;  4BY1 H;  1D8L A;  1R9T H;  2F0P A;  3M4O B;  3F2B A;  1J9O A;  4ZK9 B;  1WCM H;  1JOR A;  1SNO A;  3S24 A;  4KK7 A;  1AW7 A;  3FPU B;  4UP8 A;  1EU3 A;  1FNU A;  1VQ9 A;  1XTC D;  1HA6 A;  1WD1 A;  3VYU A;  1STN A;  2Q8T A;  3IL8 A;  2JA6 B;  4K0K Q;  4MN3 A;  4X65 L;  2R7F A;  3LNN A;  1SSO A;  2MNA A;  3LWE A;  1CA6 A;  5KND A;  4HSP A;  1BQQ T;  4DV3 L;  2JJQ A;  3K7A H;  1BO0 A;  1V1P A;  1RD9 D;  2D2C C;  2WAQ E;  2IT1 A;  1LTI D;  4X3U A;  1CSP A;  5C4Z A;  2H5X A;  1JE5 A;  3I4O A;  1PH5 A;  1AE2 A;  2B2Y A;  5J1Z A;  1PH1 A;  4A3F H;  4EQN A;  2A5H A;  4J6H A;  5GAE C;  5M3F H;  2ZM6 L;  3MAQ A;  4DAM A;  3ERS X;  1TQO A;  3D3R A;  4JC0 A;  5IT9 E;  2KVM A;  1P16 A;  3W5O A;  5IOC A;  3HOZ G;  3I73 A;  1XPO A;  3STB D;  4C3J H;  2PZT A;  4A3B G;  1FYC A;  1RDP D;  5IP9 H;  3HKZ G;  1LV9 A;  3RR5 A;  2UXB L;  3KYH C;  2Y0S G;  2A68 D;  4NB3 A;  2R7Z B;  3NQI A;  4BY7 G;  1KXL A;  1D2B A;  4KHP Q;  4RCO A;  1R4Q B;  1GO3 E;  3DWP A;  5IOD A;  4RCN A;  2PI2 E;  2PQA A;  1E2V A;  1N34 L;  4IAL A;  3EIV A;  1TWA B;  1JWS D;  4ZUJ A;  1IBK Q;  5I6Y A;  1S5E D;  2RSN A;  5DAU A;  1FGU A;  2VXW A;  1NBW A;  5LMN Q;  3AFQ A;  3DM3 A;  2EVB A;  5C4X B;  1A0I A;  3K7U C;  1VQI A;  3S15 H;  1D1I A;  5IGB A;  1CFM A;  1JT8 A;  3BS1 A;  2NVQ H;  4OL7 A;  2QKI C;  2CWA A;  4ZQ3 A;  1K0S A;  1WTH A;  4NW2 A;  1EOT A;  1X3Q A;  3VDY A;  4JI1 L;  1ET6 A;  1CQF A;  2DNE A;  5KGU A;  1YZ6 A;  4GN5 A;  2OCE A;  5J22 A;  2F0J A;  1Q7Y C;  1NJI C;  1SDF A;  1F2M A;  2WAQ G;  1D5M C;  3BJU A;  1JB7 A;  1I50 H;  2XGT A;  2KUM A;  4JI5 Q;  2QF7 A;  3GTK B;  2F4V L;  2YU9 H;  3GTP H;  3TZD A;  2ENB A;  1YEZ A;  2RDG A;  4DR1 L;  2M00 A;  4F87 A;  3K0X A;  4B08 A;  2BDO A;  2OQK A;  1Q82 C;  1JE4 A;  2XWJ B;  3HG9 A;  1JC7 A;  3RLF A;  1F2L A;  3UDG A;  4KY5 A;  3HOU G;  3EBE A;  4DA2 A;  2SEB D;  2AQ1 B;  4PNY A;  4C3H B;  2R3Z A;  3GTL H;  1HUN A;  4DV7 Q;  1BDO A;  3S9W A;  1CSQ A;  5E1F A;  3F2C A;  1TS4 A;  1PV4 A;  3HOW B;  2ZTC A;  3TRZ A;  1WYD A;  2SOB A;  2WFW A;  4B3S Q;  1X54 A;  4QMG A;  1ILP A;  3RZD H;  1PH9 A;  5C3X A;  3UE0 A;  1ZYR C;  1YNN D;  3U50 C;  3HOY B;  5FLX c;  5IYB H;  2NVT H;  5IWA L;  1D1K A;  3R2T A;  2E8G A;  5ELE A;  3KDF B;  4X3S A;  3S1M H;  3ZJY C;  4HAE A;  5DM7 3;  1F9R A;  1PTO H;  2OWO A;  5I2Y A;  4JI8 L;  4G7Z C;  2CQA A;  2HDM A;  2K32 A;  5E3F A;  3MHB A;  3L7Z C;  1IBM L;  1TWC B;  1Q1B A;  3HP3 A;  4K6L A;  4JI2 L;  4JYA Q;  3NPP A;  1E3P A;  1I94 Q;  2B2Y C;  3CRK C;  1XMO L;  1G91 A;  1WTR A;  1GHK A;  1PH8 A;  3M3Y B;  2K1B A;  1H9S B;  4ABN A;  4JI0 Q;  4RHS A;  3TQY A;  1IBL L;  1XNQ L;  2BE5 D;  1Y1V B;  1UE5 A;  2V1C C;  4DXF A;  1DYQ A;  2KEC A;  1BCP C;  3QO2 A;  2RDH A;  4DAY B;  1E1O A;  3I72 A;  1VQ8 A;  5C3E B;  4MHE A;  2NZ1 D;  1SEB D;  2EYL A;  3S14 B;  4ZAI A;  3J7Z C;  1UEB A;  3M7N A;  5M5X B;  4LJZ C;  3ULJ A;  3SK6 A;  1H9K A;  4FDB A;  4XXE A;  1QVG A;  4HR7 B;  2NTT A;  4A3G H;  1HFN A;  2J4X A;  2HDL A;  4YWM A;  4JVZ A;  3KOJ A;  5I2X A;  4LF9 Q;  3I4N H;  2MGS A;  5EPL A;  1DCZ A;  5JJK A;  1LT6 D;  2K75 A;  1WCM G;  5L37 A;  4L5T A;  4A3D H;  1B1Z A;  2E2H B;  2AWO A;  2JN4 A;  1SLJ A;  3F2U A;  4LF6 Q;  4EX5 A;  3ZYY X;  2KED A;  1SFO B;  2ES2 A;  4JI3 Q;  4E6I A;  3KJP A;  3S1R H;  1AZP A;  4GLA C;  5M3M B;  1TWH B;  1TS3 A;  4YY3 Q;  2EYF A;  2FMC A;  2EY1 A;  2NBF A;  3BVZ A;  4POF A;  4A76 A;  5IY0 A;  3GTQ H;  3FHW A;  1SND A;  2O5I C;  4PZ8 A;  4ZUI A;  2E5L Q;  1CHQ D;  2NN6 H;  1WVL A;  3BU2 A;  4F88 A;  1NAP A;  2GA4 B;  3MVV A;  3EVQ A;  5E7N A;  2ZXP A;  5D3I B;  1N33 Q;  4L8J A;  2LS0 1;  3PIO A;  5C44 H;  4A3F G;  2JA5 B;  1ASZ A;  2VL6 A;  2ICI A;  2JYO A;  1I4R A;  2UUB Q;  1S3O A;  1JIC A;  1LTR D;  1JMC A;  2TMP A;  2QA4 A;  1TR5 A;  1S40 A;  1I6H H;  1WTX A;  5AFW A;  2LFN A;  4YIJ A;  2G5D A;  1K3R A;  1HQM C;  3K0Y A;  4C3J G;  1EYD A;  1E1T A;  3CC2 A;  2HT1 A;  5CC4 A;  1ENF A;  5IP9 G;  2DY7 A;  2GVA A;  5ISR A;  4KHP L;  2A6H D;  3H0G H;  4BBR B;  5A35 A;  1EIF A;  2JA8 B;  1RTN A;  2DY8 A;  3VR2 A;  1X3P A;  4MNO A;  1JWM D;  2Z1C A;  3X3N A;  1P8L A;  1T5X D;  2QCP X;  3JAM L;  5GAG C;  1SR3 A;  4BBS H;  5IGG A;  5ELN A;  2K14 A;  3S1N B;  4UHV A;  3TDQ A;  1YIJ A;  1EY5 A;  5DNF A;  2XN9 C;  1TVX A;  3PUW A;  2D0O A;  1B4O A;  3PV0 A;  1W2B A;  3VA5 A;  1IKM A;  4KI0 A;  3BYY B;  1QWY A;  2WII B;  3E0J A;  1OXT A;  4N8X 1;  4FXG C;  3X3M A;  3UDX A;  4ZKC B;  3S2H B;  2I5M X;  1TWF B;  2JA7 H;  1PH3 A;  3GO5 A;  4AYB E;  1QCB D;  4J8Q A;  1BXT A;  1SRU A;  3ER0 A;  1LTA D;  1VMP A;  4A3E H;  3J81 c;  1SJH D;  4BWG B;  1YHA A;  4JI5 L;  4I7Z C;  4WJ4 A;  2NVX H;  3BDO A;  2EY5 A;  1JJC B;  2PZW A;  4HN7 A;  1KDB A;  4C2M B;  3AMU A;  4LW1 A;  1X56 A;  2C9O A;  1Z6H A;  2N88 A;  4DV1 L;  1ICW A;  2AKW B;  4YCW A;  5IYC H;  1LT5 D;  2L9H A;  2L11 A;  5C4J H;  1HZ9 A;  1Q12 A;  3SHL A;  1VQA A;  2F1M A;  1SMY D;  4DV7 L;  3NBH A;  1ZEQ X;  5JPM C;  1I4Q A;  1UAP A;  1IL2 A;  2UUC L;  1VQE A;  2GN5 A;  3HOZ B;  1Z7T A;  2D62 A;  4U67 3;  4POG A;  5FO9 B;  1WJJ A;  4EQO A;  4DR3 Q;  4A3B B;  3Q6S A;  2E75 C;  1VS0 A;  3HKZ B;  2F0V A;  1EYC A;  2Z6K C;  4TSS A;  3RZO H;  1SYF A;  3RD4 A;  4PV1 C;  5I9O A;  2UXB Q;  4O1N A;  2Y0S B;  3FRP B;  2IPK D;  5IYB G;  3Q0A A;  1U4R A;  1H9J A;  1X9N A;  2BA1 A;  1HCZ A;  4DK6 C;  2Z0S A;  4BY7 B;  5LMN W;  2SNM A;  3KF6 B;  3FP9 A;  1EY6 A;  4KKU A;  2GVB A;  4JYA L;  5EPK A;  1K8G A;  1YBY A;  4YWL A;  4X3K A;  1O7L A;  3QIA A;  3U58 A;  3RLO A;  4GNX A;  1NUC A;  3MXN A;  3DLL A;  1JR0 D;  1ENC A;  3O13 A;  2R61 A;  3H3V I;  4DK1 A;  4DNI A;  1PRT C;  5CV7 A;  5IIF A;  1L2F A;  3PUY A;  1HQR D;  2MJ8 A;  4FXK C;  4XTC S;  1GUG A;  5A2Q E;  5JJZ A;  1Y1W H;  2ASB A;  2N78 A;  4JI1 Q;  5JOB A;  4GKK Q;  4KKT A;  1H9R A;  1XXG A;  4RGT A;  5JEA J;  4JV5 Q;  4A3C G;  2RKS A;  1B9N A;  4QIW E;  4GKJ L;  1LT4 D;  4UPA A;  4IUQ A;  1HJP A;  2WAQ B;  1U4P A;  2KBN A;  3HZX A;  4GS3 A;  3BVM A;  3ICE A;  5EGT A;  1YNX A;  3BVG A;  3CMA A;  4RG1 A;  4XQN A;  4ME3 A;  5FLX E;  4DR1 Q;  1EU4 A;  1K83 H;  2XWB B;  4LF9 L;  1BR9 A;  1QUQ B;  5CV4 A;  3C1F A;  4A4I A;  1A3T A;  1VQJ A;  3MEF A;  5C0X H;  3CCL A;  3HOU B;  4A3G G;  3BDL A;  2RCN A;  3OMC A;  1MSG A;  1FL0 A;  1QIL A;  1KRT A;  3KF8 A;  2RSO A;  1B50 A;  3DM1 A;  3ULP A;  1CA5 A;  5HUR A;  1H95 A;  1LLR D;  1I5F A;  3I4N G;  4LF6 L;  3J81 i;  1ML0 D;  2F52 A;  3M4Y A;  1HHV A;  1EZ8 A;  1SBB B;  1LAB A;  2AMC B;  4JI3 L;  4A3D G;  1Y69 U;  2EYM A;  2V4D A;  1WOC A;  1PFB A;  2N3S A;  4IJH A;  5FOB B;  1G6Z A;  4KY7 A;  5IWA Q;  1AH9 A;  3GTO H;  2QDB A;  1VQH A;  2K03 A;  3T51 B;  1K8O A;  4RGO S;  3FPP A;  3ND9 A;  2CCZ A;  3JC6 6;  4PMB A;  3OIP A;  1WTP A;  4A3L H;  2YYZ A;  1N33 L;  2AQ3 B;  2NVY B;  5G3L F;  3SEB A;  4Q5V A;  2KEN A;  2NN6 G;  2UUB L;  1IBM Q;  1YHQ A;  3F1Z A;  4FP5 D;  3GTM H;  5T1I A;  2JXM B;  1BNZ A;  2L5T A;  1Y8N B;  3GDE A;  5C44 G;  2UXD Q;  4N9T A;  4KJN A;  1L1O C;  1K8A C;  1MKH A;  1CQV A;  1K3B C;  1NMG A;  1G2T A;  3HGB A;  2F0W A;  4DU9 A;  1IBL Q;  4RGN A;  4IUR A;  3PO2 H;  3KLS X;  2PO4 A;  1VQN A;  4G57 A;  3T16 A;  3G6E A;  2KHI A;  1TY0 A;  4EVO A;  3C3L A;  3S2D B;  2EXZ A;  3AFP A;  1L0X B;  4WFN 3;  4ODG A;  4JOI C;  2X6L A;  1Z9F A;  2EXD A;  4K5X A;  1PTO C;  2F03 A;  1KRS A;  4FF3 A;  3H0G G;  2EY2 A;  2IHF A;  4R1J A;  2VUM H;  4PZ6 A;  3VR4 A;  3OPO A;  4JCV E;  1M8A A;  1A15 A;  2KQ3 A;  5FJ8 H;  4GLX A;  4P73 A;  4OO1 H;  1M90 C;  4I65 A;  1RKN A;  4Y7N H;  1CZW A;  4BBS G;  2EIF A;  1EUJ A;  4HCE A;  1KHI A;  2F0E A;  2B39 A;  3I90 A;  1TS5 A;  2LXJ A;  3DUZ A;  3UDF A;  5EBC A;  1HR0 Q;  4NDX A;  2E2I B;  4L6T B;  1VQ5 A;  1JWU D;  1G29 1;  1SYB A;  1B3Q A;  1N9W A;  2VQE Q;  4A3I H;  1LT3 D;  1S5F D;  2JA9 A;  1A63 A;  4DKA C;  1WCM B;  1G8Z D;  1PFN A;  4GNX C;  2KEE A;  1Q8I A;  3A7L A;  3DWQ A;  3H94 A;  3NXW A;  4QB4 A;  4DAV A;  3Q23 A;  4B9X A;  1S5C D;  2A19 A;  4DV0 L;  1NSN S;  2JA7 G;  3S16 B;  1GVP A;  1Q3L A;  5C5L A;  4R4I A;  1B3A A;  4OWW B;  2K6A A;  3W3A A;  4A3E G;  1BVS A;  2NN6 I;  3NTI A;  1VQP A;  4QY7 A;  1XNR Q;  4C3I H;  2G9D A;  1V1O A;  2HIX A;  2K50 A;  2AUK A;  4FF2 A;  4FXD A;  3I4M G;  3VYT A;  1WD0 A;  2WIN B;  3TN2 A;  5IYC G;  3MC0 B;  4DR4 Q;  2EJF C;  4ILW A;  2Q2U A;  2JEB I;  2C35 B;  4A3F B;  3PIP A;  1UE1 A;  1VQ4 A;  4CJ2 C;  1NTG A;  3CCE A;  1O7I A;  1DM0 B;  1DGS A;  4WRD A;  4KMU C;  1AZQ A;  4DR3 L;  1RL2 A;  4ZLT F;  2RQX A;  3KUP A;  2OT2 A;  3A74 A;  1PRT B;  4C3J B;  1PZK D;  2Z6B A;  4O42 A;  2WB1 E;  4RHR A;  4TRD A;  1Y14 B;  1VQK A;  3OYY A;  1IHZ A;  3PIO 3;  4HED A;  5LL6 S;  2R93 H;  1STE A;  4K2K A;  1B9M A;  1A2T A;  1FGB D;  4DXG A;  4G7H C;  1B8A A;  4H0L C;  5JAV A;  5KYI A;  4WJ3 M;  1PYB A;  1HA5 A;  1ENA A;  1PHJ A;  4MTN A;  1YNJ C;  4GOP C;  4NXN L;  5H1S E;  4RMF A;  5CMD A;  1UE6 A;  2H4O A;  2O4X A;  2KOL A;  3J81 E;  3CD6 A;  4HTH A;  3CPW A;  1Q81 C;  2B2V A;  1YIT A;  2DNC A;  3F8T A;  5EKI A;  4FNF A;  2C5C A;  1VQF A;  3SDZ A;  1CK1 A;  2HHH Q;  3A7A B;  1QZG A;  1SE8 A;  5D14 A;  4JBM A;  3H6M A;  2WP8 J;  1HFG A;  2WAC A;  3S15 B;  3G48 A;  4GKK L;  2ZT9 C;  3M9B A;  1JOQ A;  4JV5 L;  1BBW A;  1JCK B;  2OTL A;  2NVQ B;  1WTV A;  1HPC A;  4AQY L;  1LTL A;  1Y1W G;  1JJ2 A;  1CM9 A;  3L9A X;  3A56 A;  3PMF A;  3E9H A;  4A3M G;  1GD7 A;  5CV8 A;  3CCJ A;  2CVR A;  5E4X A;  4DNT B;  1K9M C;  3J7A F;  3I8Z A;  3PUV A;  3CQZ H;  2A6E C;  4DV1 Q;  4OX9 Q;  1D6E C;  3EN2 A;  4LF4 Q;  2YU9 B;  2F0U A;  2K4K A;  5EKL A;  3GTP B;  1EY7 A;  2I0Q A;  4QGU A;  3KLR A;  3RLN A;  5ELD A;  4GZY C;  1C7Y A;  4IOC A;  1VQ7 A;  2UUC Q;  1A8V A;  2EYJ A;  5C0X G;  2EQS A;  5GQO A;  4ZKB B;  1PMR A;  2DGY A;  1PZI D;  2MUY A;  4K8I A;  4CHT B;  1X3F A;  3GTL B;  3HOW H;  4QCL A;  3M85 A;  1E2Z A;  2VNU D;  2LMC B;  2EOT A;  4O0A A;  2P5Z X;  1L1O B;  5DM6 3;  3FMC A;  4X6A H;  4H02 A;  3RZD B;  4IUV A;  3HOY H;  3WDN A;  1VQC A;  1LAC A;  3GD7 A;  4HIO A;  2RHQ B;  2VB3 X;  3EQL C;  1E0B A;  2A1A A;  3E0E A;  2F0N A;  2HCC A;  2F0S A;  2QIL A;  1AP0 A;  2NVT B;  1QVF A;  1GUS A;  1M4V A;  2XNA C;  2IWH A;  3CC4 A;  2LKV A;  2N49 A;  3QB3 A;  3QR8 A;  1K8M A;  1KLG D;  2CKZ B;  4DGZ A;  3S1M B;  3NQT A;  4F7X A;  4DR2 Q;  1EYG A;  1FNV A;  1PTO B;  5D3D A;  5G3L D;  2F3I A;  4A3L G;  1X6O A;  1OXV A;  2ZXR A;  4MTK A;  5KNC A;  3E6Z X;  5M5Y H;  4P71 A;  2UXD L;  1DOK A;  3L3O C;  2F0D A;  1KAB A;  2IL8 A;  3QG1 A;  5BN3 A;  5ELC A;  3J7A 5;  3LWU A;  2F0H A;  4OEL B;  1CUK A;  3JAM c;  2JK8 A;  3NEM A;  4UDU C;  5ELO A;  1CKM A;  2E2J H;  1ZYR D;  1GJX A;  4K8J A;  2XVS A;  3M3Y H;  5CV9 A;  2A73 B;  1S4Z A;  2HIV A;  1BUV T;  1FJG Q;  4AH6 A;  4GNX B;  2FMM A;  1ONL A;  3J81 j;  3PO2 G;  5KYL A;  4GKJ Q;  1YJW A;  3T53 B;  4CJ0 B;  2OQ0 A;  1EY0 A;  2IW3 A;  3ULL A;  5BN5 A;  1A62 A;  1PFS A;  2Q2H A;  2CWP A;  3S14 H;  1XX8 A;  3TP6 A;  4A3K H;  5C0X I;  2PNH A;  3A0J A;  2VUM G;  1YJ9 A;  4FVM A;  1I4P A;  4HJ9 A;  1HR0 L;  1STA A;  2PMZ B;  3D6W A;  3HOX H;  5BR8 Q;  4UP7 A;  5FJ8 G;  2CH4 W;  2B63 H;  4OO1 G;  1PRT F;  2VQE L;  3HRZ C;  4BY1 G;  1O7Z A;  3L2P A;  3N6R A;  4A3G B;  4P2C B;  5LHY 1;  2K28 A;  3H91 A;  5BN4 A;  1HZA A;  1A2U A;  3I4N B;  3EFX D;  3RUZ A;  1FR3 A;  2B2V C;  4O2D A;  4A3I G;  3J80 c;  3D4D A;  3Q24 A;  1TU2 B;  3UE1 A;  4A3D B;  1TWG B;  4TVA B;  3DXJ C;  1SNQ A;  2QEJ C;  2J7Z A;  3CF5 A;  1EQR A;  4CKC A;  1MJE A;  1XNR L;  2JE6 I;  4JI4 Q;  1G2S A;  2YTV A;  3NBI A;  5IE8 A;  3G6J B;  4DPG A;  1C9O A;  2UXC Q;  1H9M A;  5JEA H;  1Q90 A;  2XTI A;  3S1R B;  5A2Q L;  3GV6 A;  3U4V A;  1EY4 A;  3U9S A;  4C3I G;  4DR4 L;  4EGV A;  4B3M L;  3A8J E;  3GTQ B;  3D4W A;  4APV A;  3N52 A;  5M3F G;  3VA7 A;  3CXC A;  1QZH A;  4GOP B;  5K36 H;  3DMU A;  2F0M A;  4G4K A;  1VDZ A;  1S5D D;  3RNU A;  4I7A A;  1KTK A;  2JA5 H;  2EJM A;  4ULL A;  5C44 B;  2CHB D;  1HNZ Q;  5K5P A;  2UU9 L;  3S17 B;  4FF1 A;  2PW7 A;  3A5U A;  4FF4 A;  1I6H B;  4DUZ Q;  4IFD H;  1SMX A;  2CW0 D;  4G7O C;  5KRU A;  3RMH A;  1EWC A;  3NUC A;  1V1Q A;  3FVQ A;  1WTW A;  2K5D A;  5CYU A;  3H09 A;  4KD4 A;  3KBG A;  2EYO A;  1E2W A;  4BBR H;  1GUT A;  1Q86 C;  3GTJ H;  2JA8 H;  4OO1 I;  3H0G B;  2SDF A;  5HY6 A;  1VQD A;  2R93 G;  3CPF A;  4FYD A;  3MXP A;  4JPB W;  1PVO A;  2PZU A;  4RKL A;  4WJW A;  3JAM i;  2R92 H;  4B3R Q;  3OW7 A;  2B2U A;  3FKI H;  2L4N A;  2WKC A;  4OWT B;  4BBS B;  5AJ3 L;  1HNX Q;  2HHH L;  3S1N H;  2NZH A;  1B53 A;  2EE1 A;  4IPG A;  1HUM A;  1U0L A;  3A55 A;  4R4T A;  1JOK A;  4DV4 L;  3QJY A;  4CDF C;  1SNC A;  1VQL A;  1OXX K;  5I9P A;  2A8V A;  4DK3 C;  1T5E A;  1X55 A;  1MJC A;  3RN2 A;  4DV0 Q;  4DV2 Q;  2JA7 B;  1O80 A;  5IGF A;  4BA2 I;  1KAA A;  1PTO F;  1ESR A;  4IUT A;  1EFI D;  1E24 A;  3DEP A;  4A3E B;  2VS1 A;  2MO1 A;  4F8M A;  3TS0 A;  1KDA A;  2Q2T A;  4OX9 L;  2B29 A;  4S3S A;  5ELB A;  4LF4 L;  1OXS C;  2NVX B;  1R4P B;  4C2M H;  5JVH 3;  1LM0 A;  5DLQ E;  3I4M B;  3HEJ A;  1UUP A;  4XT3 B;  4X66 Q;  3I70 A;  1NNX A;  1V1P B;  3ERO A;  2F3V A;  2SNS A;  4CJ1 B;  1SYC A;  3J80 i;  4A93 H;  1J5E L;  3NSW A;  3IFT A;  4RH6 A;  3TRE A;  2JSO A;  1PH7 A;  2E2D C;  2XRQ D;  3I55 A;  1CKN A;  1WFQ A;  1EIH A;  2A69 C;  5CR3 A;  4DV6 Q;  2RF4 A;  2ATW A;  3KDF A;  4QJF A;  1I4X A;  4V0B A;  2PPB C;  1BCP B;  2RCF A;  1I3Q H;  3DEO A;  3RZO B;  1SAP A;  4DR2 L;  3T1H Q;  5E4W C;  3PIP 3;  1HNW L;  2CH4 A;  2LXK A;  4KN7 C;  1MI2 A;  1QNK A;  2Q2I A;  3UDI A;  1I4H A;  3AQQ A;  4NXN Q;  3CP0 A;  2F0O A;  1RCV D;  3U4Z A;  1KNE A;  5GRO A;  3P7J A;  2OTJ A;  1AFP A;  4R8I A;  1LTT D;  4QL5 A;  1ICF B;  1PFM A;  4NXM L;  1D5X C;  4DN4 M;  1PDQ A;  1PA6 A;  1H9S A;  4DV5 L;  3GV3 A;  3PCO B;  3PUX A;  4CGY B;  2PQA B;  1CZG A;  3W1B A;  1IW7 C;  3BDC A;  1HZB A;  4AYB G;  2F0K A;  1EL0 A;  2QGQ A;  3CU7 A;  1FJG L;  1K28 A;  2KCM A;  2YTY A;  5IT9 L;  1FD7 D;  1EWI A;  1VCI A;  2L1B A;  4AQY Q;  3C2P A;  4ME5 A;  4PQX A;  4NPS A;  3GTG H;  1Y1W B;  4K2L A;  4JW0 A;  5J39 A;  4A3M B;  3Q22 A;  4NMZ A;  4OGQ C;  3P1H A;  1E7Z A;  4IJL A;  2ZJQ A;  2FJ2 A;  3G4S A;  2G9H D;  4KN4 C;  2Z9H A;  3OSO A;  3HKS A;  2YV5 A;  1M1K C;  5I4D A;  5BR8 L;  2KHS A;  2PQE A;  3E9I A;  1V9P A;  2KCC A;  3EA6 A;  3FEW X;  2PW5 A;  5JPN C;  3AB9 A;  4A3K G;  2B8F A;  1VQ6 A;  2Z4I A;  4BXX H;  3OWE B;  4CBV A;  1NR2 A;  2CFM A;  1PRT D;  1K83 B;  3HOV H;  2L12 A;  1PYW D;  3HOX G;  3MTS A;  1U4M A;  2B63 G;  2B2U C;  2QW7 A;  4PZ7 A;  1EIY B;  1STB A;  1NE3 A;  1QVC A;  2R6G A;  3BYT B;  2DJG C;  4LF8 Q;  2MFI A;  2DN8 A;  1F2Z A;  1VQO A;  3MFY A;  4JI4 L;  4HCS A;  4OIK A;  5IP7 H;  3OTO L;  1YJN A;  1UWV A;  3T4A C;  2WKD A;  4GN3 B;  2UXC L;  4L5S A;  2IX3 A;  2D9U A;  4XYQ A;  3JAM E;  4K5V A;  3NP8 A;  4JI6 Q;  2ZJR A;  4YCV A;  4CDE C;  1DOL A;  3J7Y W;  3VYS A;  1ESF A;  1NCV A;  2X6G A;  2Z8L A;  1PH6 A;  2F0T A;  2Q8I B;  4NKL A;  2NVY H;  4UAI A;  1C8C A;  1GUN A;  1F2Y A;  2DJF C;  4A3J H;  1HNZ L;  4LFB L;  1BKB A;  5M9O A;  5IGE A;  1J8I A;  1XPR A;  3GTM B;  2J0T D;  4DUZ L;  3K57 A;  4OON A;  2RBM A;  3AYH B;  3H15 A;  4Z9C B;  1PZJ D;  1J6Q A;  2OXP A;  3LX0 A;  1DD2 A;  5JVG 3;  2MHV A;  4YCU A;  3TP5 A;  4IFD G;  2H1E A;  3K59 A;  4CKB A;  3PO2 B;  3S1Q H;  3K81 C;  4QF4 A;  2AHO B;  3SGI A;  3J80 E;  3PO3 H;  4B3R L;  4LMQ D;  4DR6 Q;  2Y0S E;  4RGM A;  3GP7 A;  4XIG S;  5M5W H;  5CV6 A;  3SK4 A;  1HNX L;  1N32 L;  2VUM B;  2K05 A;  4DAP A;  1F77 A;  3IAY A;  1DZ1 A;  5LL6 X;  4KY6 A;  1XMQ L;  2OF1 A;  3M4O H;  3BZD B;  2R92 G;  1MGS A;  1EY9 A;  1GM5 A;  3VYR A;  4Y7N B;  1R9T B;  4BY1 B;  3FKI G;  3PF4 A;  4IUP A;  4CDD C;  1UNS A;  4QUF A;  1EQV A;  5FLM H;  1VMC A;  4JI7 L;  1BCP F;  3B6Y A;  2K01 A;  3Q8D A;  1JQY D;  1KQS A;  3P75 A;  4IO9 A;  3NEL A;  4DV2 L;  4A3I B;  1QG7 A;  2JA6 H;  5C4H A;  3ND8 A;  3STB C;  1T9H A;  1HZC A;  1S72 A;  1N8R C;  1B44 D;  1Q1E A;  1PTO D;  2L15 A;  3S16 H;  3BZK A;  3I91 A;  3K7A B;  2PCF B;  4IPD A;  2VY3 A;  1IL8 A;  4IQZ A;  4X3T A;  2O2L D;  4AIM A;  4X66 L;  2A68 C;  4YHH L;  1NR4 A;  4C3I B;  1XJV A;  1B2T A;  4B3M Q;  2IX1 A;  1KC8 C;  3C1E A;  4ZYS A;  2NYZ D;  1G6P A;  5M3F B;  3SK5 A;  5LMU L;  5EKK A;  5C5M A;  1SJE D;  4LNQ A;  5CGK A;  1OO9 B;  4ID6 A;  4IFD I;  1EOV A;  1WTO A;  4A93 G;  4DV6 L;  3A5Z B;  1OTC A;  2UU9 Q;  5TSS A;  1A3V A;  4MIU A;  4B9W A;  3IKJ A;  3I56 A;  4TKO B;  2QEX A;  3CCM A;  1D7Q A;  3VR3 A;  4HIK A;  3UI2 A;  1HXY D;  3L0O A;  2HQL A;  1B70 B;  1X3G A;  3OW2 A;  1HRJ A;  3KF6 A;  4JBJ A;  2LY7 A;  3T1H L;  1KDC A;  1IYV A;  2R7Z H;  5COY A;  5FO8 B;  1C48 A;  3G7L A;  4MZ9 A;  1RTO A;  4X64 Q;  2M9V A;  1W6J A;  1GXD C;  4X62 Q;  3K6O A;  1EFW A;  4V19 0;  2K5V A;  2R93 B;  4IN3 A;  1TWA H;  2NUC A;  4LFA L;  3AU7 A;  3CCQ A;  3KFU A;  5AJ3 Q;  1X65 A;  5C4X H;  4L5R C;  3C46 A;  3NEN A;  5C0X J;  3WOE A;  5FO7 B;  3M7G A;  2O5J C;  1X32 A;  1MBY A;  4Q0F A;  4GN4 B;  1CT1 D;  4DV4 Q;  2I5H A;  3J7A V;  1VF7 A;  2RVL A;  1N36 L;  2KHJ A;  2NTS A;  1V43 A;  1AE3 A;  1W6K A;  1STG A;  3SVM A;  1ET9 A;  1BBX C;  1A6X A;  1I6V C;  1KAW A;  3PSI A;  3H3V H;  2F0L A;  2K52 A;  1C4Q A;  1YNN C;  3PGZ A;  2K5H A;  1EQQ A;  1YNJ D;  3GTK H;  1QUQ A;  1D5Z C;  1I50 B;  4KTA A;  1IXR A;  3HFZ B;  1IZ6 A;  5IGD A;  4EQP A;  1LUZ A;  4XQQ A;  3MZ5 A;  3NTH A;  4R9W A;  3CQZ B;  3ERQ A;  2UUA L;  3A54 A;  1FVI A;  3IRB A;  4C3H H;  1DOM A;  1J5E Q;  3MXU A;  4BXX G;  1IYU A;  1TT2 A;  3K5O A;  4LF8 L;  3HOV G;  1GKH A;  1O78 A;  3T1Y L;  2QDL A;  4JBW A;  2KCT A;  2WB1 G;  4JG2 A;  3KJO A;  1KD1 C;  3NHH A;  3NBH B;  4ALP A;  3SE0 A;  3K5N A;  1UE7 A;  4C1N K;  3CRL C;  4KJO A;  1KL9 A;  4DR5 Q;  3K5M A;  4OHJ A;  1VQG A;  3R2I A;  4JI6 L;  2L55 A;  3WOF A;  4RAU C;  2WV6 D;  2BE5 C;  2PI2 A;  2K5W A;  5IP7 G;  1SYD A;  2XRS D;  1DJR D;  2NB0 A;  2A6E D;  3DHQ A;  5JJL A;  1W3S A;  1KLU D;  1B7Y B;  1EYA A;  4ZCK A;  1HNW Q;  2ALY B;  1CKN B;  4OWX B;  1F9S A;  2F0I A;  1L0W A;  1CTM A;  4A75 A;  3D6C A;  2CQO A;  2HCI A;  2K33 A;  2F0Q A;  4DR7 L;  2PNR C;  1TWC H;  3TEH B;  1JOO A;  4KHZ A;  1EEF D;  4NXM Q;  1U5K A;  3HS0 C;  2JQO A;  1STY A;  3K58 A;  5EBD A;  3SK8 A;  4DV5 Q;  3SXH A;  1Z47 A;  5M5Y B;  4A3J G;  4AYB B;  5KNB A;  3TSS A;  1Y1V H;  3PUZ A;  2FXQ A;  1V8Q A;  3F2D A;  3MXN B;  2Q8R E;  2E2J B;  2VQF L;  1UEA B;  4PMC A;  5C3E H;  1WI5 A;  2IHE A;  3T56 B;  2TSS A;  1GOZ A;  2NWG A;  1S5B D;  1SE2 A;  2I07 B;  2RHS B;  3V2T A;  2EPB A;  4A3C H;  2E74 C;  4DR6 L;  2D5D A;  4DK0 A;  5GAD C;  3KBX A;  5M5X H;  3V96 A;  3I7F A;  2NZO A;  1CHP D;  3NTK A;  3CC7 A;  4LFC L;  3G71 A; 
#chains in the Genus database with same CATH homology
 1VF5 C;  1ILQ A;  1GUO A;  1SYE A;  2EZV A;  1WTQ A;  4A3K B;  1I4G A;  2IJ0 A;  3E5S A;  4KKS A;  1II3 A;  3HOX B;  3QOJ A;  2B63 B;  1A3U A;  1BCP D;  3T13 A;  3MA2 B;  1LTG D;  3OOC A;  5FKA C;  4IUN A;  4K6D A;  1AEX A;  1F9Q A;  1QJO A;  3EJI A;  5CV5 A;  1GUW A;  4FO2 A;  1EY8 A;  2ICE C;  2Z4H A;  2CW0 C;  2EDG A;  2B2T A;  1QOH A;  1U9R A;  2A6H C;  3OHX C;  4M1U B;  2EY6 A;  4PMW A;  1RHP A;  5ELF A;  2F4I A;  4RKB A;  1EWH A;  5FLX L;  3QOL A;  2F0G A;  2RA4 A;  3W2D A;  4BA1 I;  3NE5 B;  3NWS A;  4QIW B;  3K5L A;  3TZU A;  4RA8 A;  1DON A;  2E76 C;  2MP1 A;  4U68 A;  5KIX A;  1EQT A;  1U4L A;  1Y8P B;  2EYH A;  2FFK B;  2B2W A;  4LK1 C;  1XYI A;  2A74 C;  3GTJ B;  1HTL D;  1CI3 M;  1SNM A;  4CKE A;  2BDN A;  2N55 A;  5HGT A;  3OWF A;  3FDT A;  2R92 B;  3OIQ A;  4KV6 A;  4H13 C;  3FKI B;  2B8G A;  1SMY C;  4NP5 A;  3V05 A;  1IKL A;  3MEH A;  4QUC A;  5D65 A;  4R8N A;  4XQJ A;  3QWN A;  4IZ8 A;  3NK9 A;  5EQ0 A;  4XDX A;  3OMG A;  2HUG A;  4WOR A;  4RWS C;  4M8A A;  3A8I E;  4HSV A;  3R3O A;  5CBE E;  4KHV A;  2IX0 A;  3VR6 A;  2KJX A;  4K5W A;  2AQ2 B;  2KCN A;  2AWN A;  3NWT A;  4N9P A;  5C4J B;  3I4L A;  4XT1 B;  3VR5 A;  2K04 A;  2AUJ D;  3J80 L;  4C3H G;  1ZKO A;  2BOS A;  4A93 B;  1O7Y A;  4C1N I;  1SE3 A;  1MSH A;  2JEA I;  2PYK A;  1QB5 D;  4J1M A;  1Y8O B;  2K7V A;  4LAA A;  1DXM A;  2BCO A;  4BS9 A;  2K5Q A;  4JK1 C;  1KNA A;  3TBI B;  1I3Q B;  1LTB D;  2KA7 A;  5NUC A;  1TII D;  3I3C A;  1EEI D;  2B2T C;  3U9O A;  1MD2 D;  4H7B A;  4TQU S;  1QE6 A;  2RDF A;  1EIG A;  4DAY A;  4H44 C;  2A69 D;  1JB3 A;  1RF2 D;  3TP8 A;  1FNW A;  5IGC A;  1BF4 A;  4ZRZ A;  1LO5 D;  2F3W A;  1ROD A;  5FK9 C;  2JP1 A;  4K14 A;  4L63 B;  2M2L A;  1HTP A;  5C3W A;  3A8K E;  1XWE A;  3GTG B;  1TS2 A;  1EZ6 A;  2OEO A;  1L0Y B;  3ITP A;  3ONA B;  5T1G A;  1SYG A;  2I46 A;  2VB2 X;  3GQB A;  1LTS D;  1TY2 A;  3D4R A;  3CKI B;  2B2W C;  2FIN B;  1RJT A;  1IW7 D;  5DEH A;  2BA0 A;  3TP7 A;  5I6W A;  2ZXO A;  1AN8 A;  3J81 L;  3HOV B;  4C56 C;  3SR1 A;  2WB1 B;  5EPJ A;  4IFD J;  4RFB A;  1GHJ A;  3H3V C;  1OXU A;  2L0C A;  3R8B A;  3GTO B;  2HQE A;  5JEA G;  4IUU A;  4KD3 A;  3D31 A;  1STH A;  1ZXT A;  2X69 A;  1TKW B;  3BG3 A;  4HMJ A;  1SNP A;  3IFD A;  3DWA A;  3TME A;  2F0F A;  1BOS A;  5K36 G;  3KLS A;  1QNU A;  5EJW A;  1PLF A;  5COR A;  1PXU A;  3D8G A;  4OIJ A;  2EJG C;  5KEE A;  4A3J B;  4DNR B;  3MWY W;  5F2D A;  3P20 A;  4DF7 A;  2ID0 A;  2EYP A;  5CBA E;  4DFA A;  1SE4 A;  3MXG A;  2XSC A;  3URY A;  2XIW A;  3CHB D;  3S1Q B;  3MFG A;  3KK7 A;  3PO3 B;  4HMI A;  4XYO A;  3R93 A;  2FHT A;  2MPM A;  5M5W B;  1F9P A;  1SXT A;  5C6A A;  3M4O B;  2F0P A;  1J9O A;  4ZK9 B;  1JOR A;  1SNO A;  4KK7 A;  1AW7 A;  3FPU B;  1EU3 A;  1FNU A;  1XTC D;  1HA6 A;  1WD1 A;  3VYU A;  1STN A;  2Q8T A;  3IL8 A;  2JA6 B;  4MN3 A;  3LNN A;  1SSO A;  3LWE A;  1CA6 A;  5KND A;  4HSP A;  1BQQ T;  1BO0 A;  1V1P A;  1RD9 D;  2D2C C;  2IT1 A;  1LTI D;  4X3U A;  5C4Z A;  5J1Z A;  2B2Y A;  4EQN A;  2A5H A;  4J6H A;  3MAQ A;  1TQO A;  3D3R A;  5IT9 E;  2KVM A;  5IOC A;  3I73 A;  2PZT A;  1FYC A;  1RDP D;  1LV9 A;  2A68 D;  2R7Z B;  3NQI A;  1D2B A;  4RCO A;  1R4Q B;  3DWP A;  5IOD A;  4RCN A;  1E2V A;  4IAL A;  1TWA B;  1JWS D;  4ZUJ A;  5I6Y A;  1S5E D;  2RSN A;  5DAU A;  2VXW A;  2EVB A;  5C4X B;  1D1I A;  5IGB A;  1CFM A;  3BS1 A;  4OL7 A;  2QKI C;  4ZQ3 A;  4NW2 A;  1EOT A;  1X3Q A;  1ET6 A;  1CQF A;  2DNE A;  5KGU A;  5J22 A;  2F0J A;  1SDF A;  1F2M A;  1D5M C;  2KUM A;  2QF7 A;  3GTK B;  3TZD A;  2ENB A;  2RDG A;  2M00 A;  4F87 A;  4B08 A;  2BDO A;  1JE4 A;  2XWJ B;  3HG9 A;  1JC7 A;  3RLF A;  1F2L A;  4KY5 A;  4DA2 A;  2SEB D;  2AQ1 B;  4PNY A;  4C3H B;  2R3Z A;  1HUN A;  1BDO A;  3S9W A;  5E1F A;  1TS4 A;  3HOW B;  2SOB A;  4QMG A;  1ILP A;  5C3X A;  1ZYR C;  1YNN D;  3HOY B;  1D1K A;  3R2T A;  5ELE A;  4X3S A;  4HAE A;  5DM7 3;  1F9R A;  1PTO H;  5I2Y A;  4G7Z C;  2CQA A;  2HDM A;  2K32 A;  5E3F A;  3MHB A;  3L7Z C;  1TWC B;  1Q1B A;  3HP3 A;  4K6L A;  3NPP A;  2B2Y C;  3CRK C;  1G91 A;  1WTR A;  1GHK A;  3M3Y B;  2K1B A;  1H9S B;  4ABN A;  4RHS A;  2BE5 D;  1Y1V B;  4DXF A;  1DYQ A;  2KEC A;  1BCP C;  3QO2 A;  2RDH A;  3I72 A;  5C3E B;  4MHE A;  2NZ1 D;  1SEB D;  2EYL A;  3S14 B;  4ZAI A;  3M7N A;  5M5X B;  4LJZ C;  3SK6 A;  1H9K A;  4XXE A;  4HR7 B;  2NTT A;  1HFN A;  2J4X A;  2HDL A;  5I2X A;  2MGS A;  5EPL A;  1DCZ A;  1LT6 D;  1B1Z A;  2E2H B;  2AWO A;  3F2U A;  3ZYY X;  2KED A;  1SFO B;  4E6I A;  1AZP A;  5M3M B;  1TWH B;  1TS3 A;  2EYF A;  2FMC A;  2EY1 A;  2NBF A;  3BVZ A;  2O5I C;  1SND A;  4ZUI A;  1CHQ D;  2NN6 H;  1WVL A;  4F88 A;  1NAP A;  2GA4 B;  3MVV A;  3EVQ A;  2ZXP A;  5D3I B;  4L8J A;  2LS0 1;  2JA5 B;  2ICI A;  2JYO A;  1I4R A;  1JIC A;  1LTR D;  2TMP A;  1TR5 A;  1WTX A;  5AFW A;  2LFN A;  4YIJ A;  1HQM C;  3K0Y A;  4C3J G;  1EYD A;  5CC4 A;  1ENF A;  2DY7 A;  5ISR A;  2A6H D;  4BBR B;  5A35 A;  2JA8 B;  1RTN A;  2DY8 A;  3VR2 A;  1X3P A;  1JWM D;  2Z1C A;  3X3N A;  1T5X D;  2QCP X;  3JAM L;  5IGG A;  3S1N B;  3TDQ A;  1EY5 A;  5DNF A;  2XN9 C;  1TVX A;  3PUW A;  1B4O A;  3PV0 A;  3VA5 A;  1IKM A;  4KI0 A;  3BYY B;  1QWY A;  2WII B;  3E0J A;  1OXT A;  4FXG C;  3X3M A;  4ZKC B;  3S2H B;  1TWF B;  3GO5 A;  1QCB D;  4J8Q A;  1BXT A;  1LTA D;  1VMP A;  1SJH D;  4BWG B;  4I7Z C;  3BDO A;  2EY5 A;  2PZW A;  4HN7 A;  1KDB A;  4C2M B;  3AMU A;  2C9O A;  1Z6H A;  2N88 A;  1ICW A;  1LT5 D;  2L9H A;  2L11 A;  1Q12 A;  3SHL A;  2F1M A;  1SMY D;  3NBH A;  1ZEQ X;  5JPM C;  1I4Q A;  1UAP A;  3HOZ B;  1Z7T A;  2D62 A;  4U67 3;  5FO9 B;  4EQO A;  4A3B B;  3Q6S A;  2E75 C;  3HKZ B;  2F0V A;  1EYC A;  4TSS A;  1SYF A;  3RD4 A;  4PV1 C;  5I9O A;  4O1N A;  2Y0S B;  3FRP B;  2IPK D;  3Q0A A;  1U4R A;  1H9J A;  2BA1 A;  1HCZ A;  4BY7 B;  2SNM A;  1EY6 A;  4KKU A;  5EPK A;  4X3K A;  1O7L A;  3QIA A;  1NUC A;  3MXN A;  1JR0 D;  1ENC A;  3O13 A;  2R61 A;  4DK1 A;  1PRT C;  5CV7 A;  5IIF A;  3PUY A;  1HQR D;  2MJ8 A;  4FXK C;  4XTC S;  1GUG A;  5A2Q E;  5JJZ A;  5JOB A;  4KKT A;  1H9R A;  4RGT A;  1XXG A;  5JEA J;  2RKS A;  1B9N A;  1LT4 D;  4IUQ A;  2WAQ B;  1U4P A;  3HZX A;  3BVM A;  5EGT A;  3BVG A;  4XQN A;  5FLX E;  1EU4 A;  2XWB B;  1BR9 A;  5CV4 A;  3C1F A;  1A3T A;  5C0X H;  3HOU B;  3BDL A;  3OMC A;  1MSG A;  1QIL A;  3KF8 A;  2RSO A;  1B50 A;  3DM1 A;  1CA5 A;  5HUR A;  1LLR D;  1ML0 D;  3M4Y A;  1HHV A;  1EZ8 A;  1SBB B;  1LAB A;  1Y69 U;  2EYM A;  2V4D A;  1PFB A;  5FOB B;  1G6Z A;  4KY7 A;  2QDB A;  2K03 A;  3T51 B;  1K8O A;  4RGO S;  3FPP A;  3ND9 A;  4PMB A;  3OIP A;  1WTP A;  2YYZ A;  2AQ3 B;  2NVY B;  5G3L F;  3SEB A;  4Q5V A;  2NN6 G;  4FP5 D;  5T1I A;  2JXM B;  1BNZ A;  2L5T A;  1Y8N B;  4N9T A;  4KJN A;  1CQV A;  1G2T A;  3HGB A;  2F0W A;  4DU9 A;  4RGN A;  4IUR A;  3KLS X;  2PO4 A;  4G57 A;  3T16 A;  1TY0 A;  4EVO A;  3C3L A;  3S2D B;  2EXZ A;  1L0X B;  4WFN 3;  4ODG A;  2X6L A;  4K5X A;  1PTO C;  2F03 A;  4FF3 A;  2EY2 A;  3VR4 A;  3OPO A;  1M8A A;  1A15 A;  2KQ3 A;  4OO1 H;  4I65 A;  1RKN A;  1CZW A;  4HCE A;  2F0E A;  2B39 A;  3I90 A;  1TS5 A;  3DUZ A;  5EBC A;  4NDX A;  2E2I B;  4L6T B;  1JWU D;  1G29 1;  1SYB A;  1LT3 D;  1S5F D;  1WCM B;  1G8Z D;  1PFN A;  2KEE A;  1Q8I A;  3A7L A;  3DWQ A;  3H94 A;  3NXW A;  4QB4 A;  4DAV A;  3Q23 A;  4B9X A;  1S5C D;  1NSN S;  3S16 B;  1Q3L A;  5C5L A;  1B3A A;  2K6A A;  3W3A A;  2NN6 I;  3NTI A;  2G9D A;  1V1O A;  2AUK A;  4FF2 A;  4FXD A;  3VYT A;  1WD0 A;  2WIN B;  3TN2 A;  3MC0 B;  2EJF C;  4ILW A;  2JEB I;  4A3F B;  4CJ2 C;  4WRD A;  1DM0 B;  4KMU C;  1AZQ A;  4ZLT F;  2RQX A;  3KUP A;  2OT2 A;  1PRT B;  4C3J B;  1PZK D;  4O42 A;  4RHR A;  4TRD A;  1IHZ A;  3PIO 3;  4HED A;  5LL6 S;  1STE A;  4K2K A;  1B9M A;  1A2T A;  1FGB D;  4DXG A;  4G7H C;  5JAV A;  4H0L C;  5KYI A;  1HA5 A;  1ENA A;  1YNJ C;  5CMD A;  2H4O A;  2O4X A;  2KOL A;  3J81 E;  4HTH A;  2B2V A;  2DNC A;  5EKI A;  4FNF A;  2C5C A;  3SDZ A;  1CK1 A;  3A7A B;  5D14 A;  3H6M A;  2WP8 J;  1HFG A;  2WAC A;  3S15 B;  2ZT9 C;  1JOQ A;  1JCK B;  2NVQ B;  1WTV A;  1HPC A;  1CM9 A;  3L9A X;  3A56 A;  3PMF A;  5CV8 A;  2CVR A;  5E4X A;  4DNT B;  3J7A F;  3I8Z A;  3PUV A;  2A6E C;  1D6E C;  2YU9 B;  2F0U A;  5EKL A;  3GTP B;  1EY7 A;  3KLR A;  5ELD A;  4GZY C;  2EYJ A;  5C0X G;  4ZKB B;  1PMR A;  1PZI D;  2MUY A;  4K8I A;  4CHT B;  3GTL B;  4QCL A;  3M85 A;  1E2Z A;  2VNU D;  2LMC B;  2EOT A;  5DM6 3;  3FMC A;  3RZD B;  4IUV A;  3WDN A;  3GD7 A;  1LAC A;  2VB3 X;  3EQL C;  1E0B A;  2F0N A;  2HCC A;  2QIL A;  2F0S A;  1AP0 A;  2NVT B;  1GUS A;  1M4V A;  2XNA C;  2IWH A;  2LKV A;  3QB3 A;  1K8M A;  1KLG D;  4DGZ A;  3S1M B;  3NQT A;  4F7X A;  1FNV A;  1PTO B;  5D3D A;  5G3L D;  1OXV A;  2ZXR A;  5KNC A;  3E6Z X;  1DOK A;  3L3O C;  2F0D A;  1KAB A;  2IL8 A;  3QG1 A;  5BN3 A;  5ELC A;  3LWU A;  2F0H A;  4UDU C;  1ZYR D;  1GJX A;  4K8J A;  2XVS A;  5CV9 A;  2A73 B;  1S4Z A;  1BUV T;  2FMM A;  1ONL A;  5KYL A;  3T53 B;  4CJ0 B;  1EY0 A;  2IW3 A;  5BN5 A;  1XX8 A;  3TP6 A;  5C0X I;  4FVM A;  1I4P A;  1STA A;  2PMZ B;  3D6W A;  4OO1 G;  1PRT F;  3HRZ C;  1O7Z A;  3N6R A;  4A3G B;  4P2C B;  5LHY 1;  2K28 A;  3H91 A;  5BN4 A;  1A2U A;  3I4N B;  3EFX D;  3RUZ A;  1FR3 A;  2B2V C;  3D4D A;  3Q24 A;  1TU2 B;  4A3D B;  1TWG B;  3DXJ C;  1SNQ A;  2QEJ C;  2J7Z A;  4CKC A;  2JE6 I;  1G2S A;  3NBI A;  3G6J B;  1H9M A;  5JEA H;  1Q90 A;  3S1R B;  5A2Q L;  3GV6 A;  1EY4 A;  3U9S A;  4C3I G;  4EGV A;  3A8J E;  3GTQ B;  3D4W A;  3N52 A;  3VA7 A;  5K36 H;  3DMU A;  2F0M A;  4G4K A;  1VDZ A;  1S5D D;  1KTK A;  2EJM A;  4ULL A;  5C44 B;  2CHB D;  5K5P A;  3S17 B;  4FF1 A;  2PW7 A;  4FF4 A;  1I6H B;  4IFD H;  2CW0 D;  4G7O C;  5KRU A;  3RMH A;  1EWC A;  3NUC A;  3FVQ A;  1WTW A;  2K5D A;  5CYU A;  3H09 A;  4KD4 A;  3KBG A;  2EYO A;  1E2W A;  1GUT A;  4OO1 I;  3H0G B;  2SDF A;  4FYD A;  3MXP A;  2PZU A;  4RKL A;  4WJW A;  3OW7 A;  2B2U A;  4BBS B;  2L4N A;  2WKC A;  1B53 A;  2EE1 A;  1HUM A;  3A55 A;  1JOK A;  3QJY A;  1SNC A;  1OXX K;  5I9P A;  1T5E A;  2JA7 B;  1O80 A;  5IGF A;  4BA2 I;  1KAA A;  1PTO F;  1ESR A;  4IUT A;  1EFI D;  3DEP A;  4A3E B;  4F8M A;  1KDA A;  4S3S A;  5ELB A;  1OXS C;  2NVX B;  1R4P B;  5JVH 3;  3I4M B;  3HEJ A;  1UUP A;  4XT3 B;  3I70 A;  1V1P B;  3ERO A;  2F3V A;  2SNS A;  4CJ1 B;  1SYC A;  3NSW A;  3IFT A;  4RH6 A;  2JSO A;  2E2D C;  2XRQ D;  1EIH A;  2A69 C;  5CR3 A;  1I4X A;  4V0B A;  2PPB C;  1BCP B;  3DEO A;  3RZO B;  1SAP A;  5E4W C;  3PIP 3;  4KN7 C;  1MI2 A;  1QNK A;  1I4H A;  2F0O A;  1RCV D;  1KNE A;  3P7J A;  1AFP A;  4R8I A;  1LTT D;  1PFM A;  1D5X C;  4DN4 M;  1PDQ A;  1H9S A;  3GV3 A;  3PUX A;  4CGY B;  1CZG A;  1IW7 C;  3BDC A;  2F0K A;  1EL0 A;  3CU7 A;  5IT9 L;  1FD7 D;  1VCI A;  2L1B A;  3C2P A;  4ME5 A;  4PQX A;  1Y1W B;  4K2L A;  5J39 A;  4A3M B;  3Q22 A;  4NMZ A;  4OGQ C;  3P1H A;  2FJ2 A;  2G9H D;  4KN4 C;  3OSO A;  5I4D A;  2KHS A;  2PQE A;  3FEW X;  2KCC A;  3EA6 A;  5JPN C;  2PW5 A;  3AB9 A;  2B8F A;  2Z4I A;  3OWE B;  4CBV A;  1NR2 A;  1PRT D;  1K83 B;  2L12 A;  1PYW D;  3MTS A;  1U4M A;  2B2U C;  1STB A;  2R6G A;  3BYT B;  2DN8 A;  1F2Z A;  3MFY A;  4HCS A;  4OIK A;  3T4A C;  2WKD A;  2IX3 A;  2D9U A;  4XYQ A;  3JAM E;  4K5V A;  3NP8 A;  1DOL A;  3J7Y W;  3VYS A;  1ESF A;  1NCV A;  2X6G A;  2Z8L A;  2F0T A;  2Q8I B;  4NKL A;  4UAI A;  1C8C A;  1GUN A;  1F2Y A;  5M9O A;  5IGE A;  1J8I A;  3GTM B;  2J0T D;  3K57 A;  2RBM A;  4Z9C B;  1PZJ D;  2OXP A;  3LX0 A;  1DD2 A;  5JVG 3;  2MHV A;  3TP5 A;  4IFD G;  2H1E A;  3K59 A;  4CKB A;  3PO2 B;  4QF4 A;  3J80 E;  4LMQ D;  4RGM A;  3GP7 A;  4XIG S;  5CV6 A;  3SK4 A;  2VUM B;  2K05 A;  4DAP A;  1F77 A;  3IAY A;  1DZ1 A;  5LL6 X;  4KY6 A;  2OF1 A;  3BZD B;  1MGS A;  1EY9 A;  3VYR A;  4Y7N B;  1R9T B;  4BY1 B;  4IUP A;  1UNS A;  4QUF A;  1EQV A;  1VMC A;  1BCP F;  2K01 A;  1JQY D;  3P75 A;  4A3I B;  1QG7 A;  5C4H A;  3ND8 A;  1B44 D;  1Q1E A;  1PTO D;  3I91 A;  3K7A B;  2PCF B;  1IL8 A;  4IQZ A;  4X3T A;  2O2L D;  2A68 C;  1NR4 A;  4C3I B;  1B2T A;  2IX1 A;  3C1E A;  4ZYS A;  2NYZ D;  5M3F B;  3SK5 A;  5EKK A;  5C5M A;  1SJE D;  5CGK A;  1OO9 B;  4ID6 A;  4IFD I;  1WTO A;  5TSS A;  1A3V A;  4MIU A;  4B9W A;  3IKJ A;  4TKO B;  3VR3 A;  3UI2 A;  1HXY D;  1HRJ A;  2LY7 A;  1KDC A;  1IYV A;  5COY A;  5FO8 B;  1C48 A;  3G7L A;  1RTO A;  2M9V A;  1W6J A;  1GXD C;  3K6O A;  4V19 0;  2R93 B;  4IN3 A;  2NUC A;  3AU7 A;  3C46 A;  5C0X J;  3WOE A;  5FO7 B;  3M7G A;  2O5J C;  1X32 A;  1MBY A;  4Q0F A;  1CT1 D;  3J7A V;  1VF7 A;  2RVL A;  2NTS A;  1V43 A;  1W6K A;  1STG A;  3SVM A;  1ET9 A;  1BBX C;  1A6X A;  1I6V C;  2F0L A;  1C4Q A;  1YNN C;  1YNJ D;  1D5Z C;  1I50 B;  4KTA A;  5IGD A;  4EQP A;  4XQQ A;  3MZ5 A;  3NTH A;  4R9W A;  3CQZ B;  3ERQ A;  3A54 A;  1DOM A;  3MXU A;  1IYU A;  1TT2 A;  3K5O A;  1O78 A;  4JBW A;  3NHH A;  3SE0 A;  3K5N A;  4C1N K;  3CRL C;  4KJO A;  3K5M A;  4OHJ A;  3R2I A;  2L55 A;  3WOF A;  4RAU C;  2WV6 D;  2BE5 C;  2K5W A;  1SYD A;  2XRS D;  1DJR D;  2NB0 A;  2A6E D;  3DHQ A;  1KLU D;  1EYA A;  1F9S A;  2F0I A;  1CTM A;  3D6C A;  2K33 A;  2HCI A;  2F0Q A;  2PNR C;  1JOO A;  4KHZ A;  1EEF D;  3HS0 C;  3K58 A;  1STY A;  5EBD A;  3SK8 A;  3SXH A;  1Z47 A;  5M5Y B;  4AYB B;  5KNB A;  3TSS A;  3PUZ A;  1V8Q A;  2Q8R E;  2E2J B;  1UEA B;  4PMC A;  3T56 B;  2TSS A;  1GOZ A;  2NWG A;  1S5B D;  1SE2 A;  2I07 B;  3V2T A;  2EPB A;  2E74 C;  2D5D A;  4DK0 A;  3KBX A;  3V96 A;  1CHP D;  3NTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...