1HRJA

Human rantes, nmr, 13 structures
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
68
structure length
68
Chain Sequence
SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine (chemotactic)
molecule keywords HUMAN REGULATED UPON ACTIVATION NORMAL T-CELL EXPRESSED AND
publication title The three-dimensional solution structure of RANTES.
pubmed doi rcsb
source organism Homo sapiens
total genus 5
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1hrjA00
1RTNA 1F9QA 2L1BA 3GV3A 2B2TC 5D14A 2HDLA 2R3ZA 2MPMA 3KBXA 3I90A 2L9HA 2NWGA 1EIGA 1RHPA 1IL8A 1X3QA 2DY7A 1ML0D 2RSOA 2DY8A 2XIWA 3N52A 2HDMA 2B2UA 1G2TA 2MP1A 4OIJA 3ONAB 3HP3A 2KOLA 1DOLA 2L11A 1WD1A 2RA4A 2CVRA 2KEEA 5EQ0A 1J9OA 2J7ZA 2NYZD 1TVXA 1PFNA 1X3PA 5E4XA 2L12A 5CBEE 1DOMA 5CMDA 2FHTA 4IURA 2IL8A 3MTSA 1F2LA 2B2YC 1DOKA 2KEDA 5AFWA 1CM9A 5E4WC 1NR4A 2K05A 1EIHA 1PDQA 2BDNA 2EE1A 2M2LA 5CBAE 2H1EA 1WTVA 1NR2A 1WTRA 2K01A 2K1BA 1B50A 1WTOA 2K28A 3KUPA 1Q3LA 1JICA 2Q8RE 1ICWA 3I3CA 3I8ZA 5T1GA 1QG7A 4HAEA 1JE4A 5D65A 3I91A 1O7ZA 1S4ZA 3QO2A 5EPLA 5T1IA 4HCSA 1HHVA 4UAIA 1GUWA 2NZ1D 2X6LA 4CJ2C 2L4NA 1MI2A 1AZQA 2B2YA 1ESRA 1RODA 4HEDA 1DONA 1XX8A 2KVMA 1MSHA 1WTQA 4RA8A 2B2WA 1O80A 1PFMA 5JJZA 3MWYW 4CJ1B 4IUTA 3SVMA 1F9RA 2B2VC 4XDXA 2N55A 1G2SA 3DEOA 3UI2A 1EQTA 1SSOA 2B2TA 1DZ1A 2HCCA 3TZDA 1C8CA 3GV6A 1U4LA 2HCIA 5EJWA 2RVLA 2X6GA 1QE6A 4OIKA 1BNZA 4R9WA 4ZAIA 1WTWA 4RAUC 2EOTA 2FFKB 1XYIA 1LV9A 1HRJA 4X3UA 4CJ0B 4DN4M 2SDFA 1B53A 4O42A 1SAPA 5CORA 4LMQD 2X69A 4IUQA 4QUCA 1WVLA 4X3SA 2VXWA 4QUFA 1SDFA 2FINB 3DEPA 1CA5A 4NW2A 1U4RA 1M8AA 1U4MA 1NAPA 4MHEA 1EOTA 1ILPA 2MGSA 5COYA 1RTOA 2B2UC 1O7YA 4X3KA 4R8IA 1MGSA 2HUGA 1IKLA 1ILQA 2Q8TA 2EPBA 2FMMA 4IUUA 3H91A 1NCVA 5EKIA 3R93A 1WTPA 1HFGA 5EPJA 3D6WA 4XT3B 1E0BA 3TN2A 4ZKBB 1B4OA 1X32A 1BBXC 3G7LA 4ZLTF 1MSGA 5EPKA 3IFDA 1WTXA 1HUMA 2JP1A 1WD0A 1AP0A 3F2UA 1EL0A 1KNEA 1G6ZA 4U68A 1HUNA 1IKMA 1PLFA 3P7JA 1B2TA 2B2VA 2KECA 4RWSC 1CA6A 1G91A 1HA6A 3LWEA 2D9UA 1BO0A 2MJ8A 2RSNA 3Q6SA 4X3TA 1B3AA 1U4PA 1KNAA 3FPUB 1A15A 1VMCA 4IUVA 4XT1B 4ZKCB 4MN3A 1RJTA 3FDTA 2FJ2A 5DNFA 4IUPA 1F9SA 3DM1A 3IL8A 1VMPA 1F9PA 2B2WC 4HSVA 1J8IA 1AZPA 2K04A 2KUMA 2K03A 2JYOA 1BF4A 2N88A 1PFBA 1ZXTA 1HFNA 1QNKA 4ZK9B
chains in the Genus database with same CATH superfamily
1F9QA 1I6HB 3NP8A 3CCMA 4JI3Q 1PYSB 3HOVH 2L0CA 3ER0A 1X3QA 5KNDA 2F0WA 4UPAA 5FKAC 3K0XA 3CCSA 3TQYA 4IFDG 3MTSA 4IO9A 5AFWA 4DNIA 4LUVA 5IP7H 2NUCA 5D65A 1PZID 1VQOA 2HIVA 1S4ZA 3OOCA 1EQQA 4UAIA 2B2YA 1YHQA 4A3KB 2R7ZB 4OONA 1C9OA 2KVMA 4UP9A 3TP7A 5C4JH 1WTQA 4RHRA 1U9RA 4B3MQ 3UI2A 3VA5A 2UUCQ 2HT1A 4KHPL 2PO4A 1BNZA 1CI3M 4R9WA 3PIPA 2NZOA 2EOTA 1EYGA 4EVOA 1EY8A 3KF8A 3E0EA 4X3UA 1D1IA 3OSOA 4L8JA 4R4IA 5EKKA 4LMQD 4C1NK 4L5TA 4F87A 1SEBD 1XNRQ 1VQAA 3T1YQ 2E74C 4KMUC 3OIPA 4OX9Q 4FP5D 1DYQA 2DGYA 1KTKA 4JI3L 4A3EB 2F0OA 1JC7A 3CU7A 3M3YH 4GOPB 4HIMA 3TS0A 2FMMA 1SMYC 3R93A 1TR5A 4X64Q 1E1TA 1A8VA 4IJLA 3IRBA 1V1OA 2LFNA 3G71A 1VCIA 4JG2A 1X56A 1R9TH 4A3GB 2CWAA 1L0YB 4KI0A 2BE5D 3T1HQ 3CRLC 2M9VA 5LL6S 1FNWA 1BO0A 1MIUA 3F8TA 3OTOQ 4RMFA 2Z6BA 3CRKC 1NUCA 1BDOA 1KQSA 2F3VA 1G291 1Z47A 3GTGB 2EIFA 2KBNA 4DXGA 3TREA 1E22A 4C3IH 1PYWD 1B44D 1EIYB 1BF4A 1EYCA 4GS3A 4NMZA 5DM63 5ELNA 3RMHA 1L0WA 2NWGA 1A3TA 4R4QA 2ZT9C 4B3ML 1DM0B 2B2UA 3NENA 2UUCL 1FNVA 2OTLA 1TY2A 1VQ8A 1HXYD 2ICEC 3GTKH 1YIJA 3C46A 1PRTD 3ITPA 2B63G 1EZ8A 1HJPA 4DAYA 2K05A 3BVMA 2JA6B 1ET6A 1EWCA 4PQXA 4DR4L 1Q3LA 2NVTH 1XNRL 3HOVB 3T1YL 3H09A 2F4VQ 3HOUH 1XPUA 2F0PA 2L4NA 2EDGA 4JI6Q 1Z7TA 3S1NB 3RR5A 3HOYB 1I4HA 5C5MA 4RGMA 3EBEA 4A3MB 3MFYA 3S9WA 3DEOA 3M85A 2K52A 4YCWA 2PCFB 4PMBA 1HNZL 1NJIC 1PTOB 1N36Q 4CDCC 1F2MA 1A2UA 2K50A 4H0LC 3I4MG 4A3LG 3NBIA 4FNFA 4GN4B 1MJCA 4QUCA 3UDGA 4R8NA 1DCZA 1U4RA 1O7IA 4P73A 1NAPA 1ILPA 3L2PA 5JEAJ 2B2UC 2VS1A 1GUOA 4R8IA 1K8AC 3NQTA 1PH4A 5FLMG 4K6DA 4DR3L 3H91A 1HFGA 3D3RA 4ZKBB 1D1KA 2K5QA 2O4XA 1A62A 1QZHA 1GO3E 3HGBA 3PO3B 1EIFA 3IFDA 1HUMA 5I4DA 2XRQD 3M4PA 3VYTA 5IGDA 1AE3A 1VQPA 4HTHA 1CA6A 4OHJA 1X9NA 4PV1C 4QY7A 2SEBD 1JJ2A 4BBRG 4BXXH 1SYFA 2IX0A 1SE2A 2JA7H 3M3YB 1F9SA 3IL8A 2F4VL 5D3IB 5KEEA 2WKDA 1UE6A 2K04A 4N8FA 2K03A 1KDBA 2O5JC 2Y0SB 3S15H 2MPMA 4RCNA 3CCVA 4M1UB 4ULLA 4B3SQ 5J3BA 4KD4A 1GVPA 4LJZC 3K5MA 2F0QA 1ZEQX 4J1MA 2KEEA 4LW1A 4TSSA 1TVXA 4GKJL 4IALA 3RUZA 3EJIA 3I4OA 3CAMA 3HOXH 3CCQA 1EU4A 2EYJA 5M5WH 1K73C 1K3RA 3KUPA 1SE3A 1HR0Q 3L9AX 3I91A 5T1IA 1S3OA 1T5XD 3W5OA 2M00A 3FRPB 4RKLA 1PZKD 4AQYQ 1TXYA 2RDHA 3GTKB 1CZGA 1IHZA 2VUMB 4A3BB 5JJLA 2XRSD 5J1ZA 1LT6D 2BH8A 1K83H 2RVLA 2NVTB 1UEAB 4G57A 4ZCKA 4JI0L 1TS3A 2CH4A 1A0IA 1I5FA 4IFDH 5J39A 5JVH3 2ATWA 2EJGC 1K8MA 3TBIB 4A93H 4KN4C 2IX3A 4YY3Q 1YBYA 4G7ZC 5CORA 1PTOD 2FINB 1EY0A 2XSCA 3A8KE 4B3RQ 3P1HA 2JA5G 3S2DH 1GUTA 3K7UC 1CHPD 2TSSA 4DPGA 4BWGB 4HJAA 1WTPA 2E2HH 4B3SL 3KLSX 3RLOA 3UDFA 1KDAA 4DV7Q 3A74A 1AFPA 5M3MB 1XTCD 4DNRB 3QOLA 3VR4A 2YYZA 3A54A 4GKKL 3JAME 3ERSX 2B2VA 4RWSC 1G91A 3KYHC 3ULLA 2JK8A 4ZQ3A 5IT9c 1QZGA 4ZKCB 3K5OA 4H02A 3NHHA 1CKMA 3HKSA 4JCVE 1C7YA 3OWFA 4PNYA 5GADC 5G3LD 5IE8A 5GAHC 3NBHA 4L5QA 3TP8A 5D14A 2VZAA 2CKZB 1BCPC 4IFDI 2PQAA 4A3IG 2K6AA 2L9HA 3H15A 2K5WA 3EVQA 1EY5A 3RN2A 4WORA 1Y1VG 4NXNL 4V190 2ES2A 5HY6A 1XXGA 2L12A 2JA7B 1F2LA 4K2KA 1CFMA 1QWYA 3EROA 2F03A 1VQGA 1EIHA 4YY3L 1IYJB 4P71A 2K28A 3SGIA 5CC4A 1L0XB 3S15B 4OO1G 2EY1A 5BR8Q 1YNXA 2C9OA 1SNQA 2DNEA 3S17B 3KDFA 2MHVA 5JOBA 2DNCA 5CV9A 5JEAG 5C0XG 4ALPA 1PFMA 1YEZA 2B2VC 3A8IE 2UU9L 2B2TA 1C0AA 3MXNB 1C8CA 1X55A 4NPSA 1STBA 2F0FA 2F0UA 2EYHA 3J80c 4C3JG 3WOFA 2FFKB 4IPGA 3QWNA 5K5PA 4BBSG 4KD3A 3GTPH 2QGQA 4FF4A 2ZJQA 2OCEA 4G7OC 2A6ED 4B08A 4NW2A 1M8AA 1SNDA 4RH6A 3NWSA 3URYA 1G8ZD 4FO2A 1P8LA 5IWAQ 5JVG3 4Q0FA 1HNXQ 1D6EC 4DV4Q 5EKIA 3PIOA 5CR3A 1RD9D 3NUCA 3S1RB 3KK7A 3NEMA 4ZLTF 1KAWA 2DJGC 2Z8LA 4GLXA 1EL0A 4UHVA 1C48A 1I50H 1VQEA 5LMUL 2XGTA 1ESFA 1FVIA 3RN5A 2XWBB 3ND9A 2CCZA 3S2DB 1A15A 1B70B 3K59A 2K5DA 3I4MH 4L5SA 4A3LH 4ZUIA 1JOKA 3HOWG 4DR1L 4O1NA 1UAPA 5C4XG 2A8VA 3CD6A 1QNKA 3R2IA 4BA2I 2B2TC 1SMXA 4XTCS 5I2YA 1JMCA 1I6HH 5FLMH 2D0OA 4OL7A 1IL8A 1QJOA 3OWEB 2ZM6Q 1J5EQ 3MZ5A 1XMOQ 2Q2HA 4LF8Q 1DOLA 3A8JE 3A5ZB 3M9BA 2A6HD 4F88A 3CF5A 3SEBA 1CM9A 1GOZA 2R6GA 3H3VC 5CBAE 1JJCB 4V0BA 4F8MA 1UE7A 3J7AV 4BBRH 2WKCA 3Q24A 1O78A 2F0VA 2LXJA 3AYHB 3W3AA 2AHOB 5IWAL 5DLQE 3ND8A 1HNXL 2PZTA 4RFBA 2PI2E 1MSHA 5BN3A 5IGCA 4DV4L 4GLAC 4A3KH 2R7ZH 1VQMA 3E9HA 5IIFA 2F0IA 3MEFA 3HOZG 4NXMQ 4DNTB 1PH9A 4JI5Q 2FXQA 3BU2A 5HGTA 2SNSA 4ID6A 5FO7B 3GD7A 2AWOA 4RAUC 3PSIA 2QDLA 3KJOA 1XYIA 4M8AA 1OTCA 4ODGA 2SDFA 5KGUA 1Q81C 5IYDH 1O7LA 2UUAQ 1SAPA 5C5LA 5AJ3Q 1YNJC 4IPCA 4X3SA 4HCEA 2C35B 3DEPA 3UE0A 1QVCA 3AMUA 1JCKB 4LF4Q 2VQEL 2ZXOA 5IYCH 4J8QA 1B9MA 1SN8A 1IBML 5FJ8G 4QF4A 4YWKA 1LTRD 2D62A 2HUGA 1IKLA 1ILQA 4A3EH 3X3NA 2QKIC 1B1ZA 3M7NA 3MAQA 3D6WA 2ZM6L 2E5LL 1ET9A 4IPHA 4KY7A 1XMOL 4LF8L 2K5HA 3J7AF 2B63B 3VR2A 1G6ZA 5FO8B 2NB0A 4JI1Q 1V9PA 4IOAA 1IZ6A 4HMJA 4A3GH 3SE0A 2N78A 4ME5A 3GTJH 4LWCA 1RJTA 4DV2L 2EVBA 2BH2A 3GDEA 4AIMA 2PPBC 1UE1A 2NN6G 2R61A 3DM1A 4K5VA 3QB3A 1GUSA 2Z4IA 4HIOA 4N9TA 4GOPA 4KK7A 3GV3A 2RQXA 1I50B 4R4TA 4I7ZC 2A74C 1T9HA 2DY8A 3K7AH 1GHKA 4B9XA 1NSNS 4JBMA 2PNRC 3K57A 3I4MB 1PFNA 2VL6A 3PUXA 3G6EA 3RD4A 1N34L 3IKJA 2EJFC 3P75A 4LK1C 4C3HG 3FKIG 1CQVA 3CCUA 1W6KA 4DR7L 3I73A 2JA6H 1L1OB 3SK4A 1EEFD 2GN5A 4LF4L 4CBVA 3TP5A 4KJOA 2QCPX 1NBWA 2B8GA 4CJ2C 4LFCQ 3GQBA 1PRTB 2RDGA 3M4YA 1J6QA 2XVSA 4CGYB 3S1NH 3HOYH 2IX1A 1LM0A 4HR7B 3TZUA 4A3MH 4LFBQ 4JI1L 4N8X1 4QGUA 2HCIA 3MFGA 1H9SB 2KHJA 1TQOA 3QJYA 4BBRB 1Y1WH 1WCMG 2JA9A 1MKHA 4PG3A 1EU3A 4KY6A 1PTOH 1CZWA 5K36G 2NVXB 1WVLA 4K0KQ 4OO1H 1SXTA 3I4NG 1VQJA 1LYLA 3A7LA 4A3JG 2RCNA 1EFID 1MJEA 3H94A 4DV0L 1XPRA 2PMZB 1HZ9A 1TS5A 4OWTB 3HKZG 2RF4A 3ULPA 3GTQH 2EPBA 1Q86C 5C0XH 1G51A 2H5XA 1CKNB 2F4IA 3FVQA 5IGFA 1STYA 3D0FA 1LABA 2B39A 1STHA 3F2UA 3PO3H 4IPDA 1QUQA 1X3EA 3OW7A 2KECA 3GP7A 4TKOB 4DR4Q 2GVBA 2IW3A 3A0JA 1KNAA 2LXKA 3S2HH 3J7A5 3CCEA 3H0GG 5A2QL 4LFCL 2KUMA 4POFA 2JYOA 1S40A 2ZXRA 5FLXc 1E24A 2LY7A 2G9DA 2LKVA 3TSSA 1HA5A 1N33L 3S1QH 2MO0A 2WINB 1C4QA 1VQ7A 1RHPA 1KL9A 3DWQA 2A73B 3R3OA 1DGSA 2MP1A 2J4XA 3GTJB 3ONAB 4LFBL 3J7YW 4E6IA 1HNZQ 1PVOA 4OO1I 1VQIA 2WV6D 5IGBA 2NYZD 2QEJC 4IQZA 1X3PA 1QCBD 1TU2B 2B2YC 4LF5L 5A35A 3TP6A 4KJNA 2EE1A 3PUWA 4DUZQ 3STBD 5C0XI 3KF6B 1N8RC 2JA5B 4K0KL 2CW0C 2JSOA 5D3DA 3HOWH 3K7AB 4DR3Q 1NMGA 3OHXC 3MHBA 4CJ1B 2PQEA 3DWAA 3EQLC 5C44G 2HCCA 3TZDA 4QL5A 3GO5A 2VUMH 4A3BH 1V1QA 1TT2A 3HFZB 1LV9A 1V1PA 5KRUA 2EYLA 4PMWA 3KJPA 3NQIA 3T4AC 2F0TA 3J81c 2R7DA 2K5NA 3K6OA 2VXWA 2WFWA 1YJ9A 4CKEA 4A3IB 2EYMA 1K8OA 4IJHA 1EZ6A 1M1KC 5COYA 1CUKA 3NE5B 2F3IA 4J6HA 1AW7A 4I7AA 3G48A 1AH9A 5E3FA 2I5HA 1B8AA 2UXDQ 5LMNW 1WI5A 1LTAD 5EPJA 2F0NA 1E0BA 1Y1WB 4A3FG 4FDBA 2BOSA 4GKJQ 2OWOA 2F0SA 1Z6HA 3PMFA 5M3MH 1IYVA 1QOHA 2EXDA 4A3DG 3AFPA 4UDUC 2RKSA 1PH8A 4DUZL 1BCPF 1U4PA 1EWHA 4Q5VA 3IAYA 4B9WA 3PCOB 5DNFA 4DV3Q 2JXMB 1EYDA 2WAQG 2F52A 4C56C 3GTQB 4JW0A 3BDOA 5IYBG 2K4KA 1HQRD 3KF8B 3MVVA 4ILWA 2NBFA 3KBXA 5ELBA 3HRZC 2DY7A 1STAA 2HQLA 1YI2A 1JOQA 4P74A 4JI0Q 4C3JB 4LNQA 2F1MA 4BBSB 2KJXA 3S2HB 2IL8A 3PO2G 3EA6A 1B9NA 1T5EA 3L0OA 3K5NA 4WJWA 1LACA 4KN7C 3K0YA 4QIWB 5M3FH 4H44C 1TWAB 1VQKA 1JORA 2WAQE 3S1QB 2NN6H 4HIDA 1GUWA 1ESRA 4HEDA 3S16B 4IOCA 1I94Q 3LNNA 2UXDL 3S17H 1W6JA 5I9OA 5J22A 1S72A 1QNUA 5ISRA 1JWUD 4WJ3M 1Q8KA 4LF7L 4GKKQ 4BS9A 3TRZA 1SJED 1DJRD 2K7VA 1HNWQ 3MC0B 1SNPA 1U4LA 3LWUA 2D2CC 4JI4L 1IW7C 2ENBA 2A68C 3HOWB 5JPMC 2Q2IA 4H7BA 4MNOA 4DV3L 5C4XB 1RKNA 3U4VA 1RIPA 4K8JA 1TWGH 4DK6C 3BDLA 2HD3A 1VQ9A 3VYRA 2BA0A 2CFMA 1XTDA 2KA7A 3VR5A 4DAYB 2PMZE 1BBWA 1FGUA 1I4PA 1SMYD 4LAAA 3GTLH 1Y8OB 3E3XA 4DR5Q 4NXNQ 3TN2A 5JPNC 4A3CG 1GUGA 3MXNA 3PIO3 3S24A 3CXCA 2AUJD 3G6JB 1R4QB 3S1RH 4YWLA 4JI7Q 4L63B 2NN6I 3ZJYC 1Q82C 5L37A 5ELOA 4MTNA 2WB1G 2YTVA 2B8FA 2C5CA 4JYAL 1E2VA 4XT1B 2K32A 3CMEA 1EUJA 4MZ9A 5K36H 3R8BA 5C6AA 1F9PA 3VYUA 3I4NH 4RGOS 2WP8J 2HHHQ 3HOZB 1I94L 2JEBI 3F2DA 3V2TA 2UU9Q 4KKUA 4GNXB 4OIJA 2I5LX 1ENCA 5IODA 1HNWL 3DWPA 5IY0A 4TVAB 3UDIA 3AB9A 4DV5Q 1EYAA 5CBEE 2FHTA 4IURA 5IT9E 2YU9B 4R4OA 5E4WC 5KNBA 3V05A 1Y8PB 5KYLA 1EWIA 1IBLL 1K8GA 4BY7G 4PMCA 2GVAA 3P20A 1KAAA 1PH3A 3JAMc 2JEAI 2SOBA 3BVGA 2DN8A 5DEHA 3PQIA 4KHVA 4UY8C 3AQQA 3SHLA 4ABNA 1PH7A 1RODA 4HSPA 1NE3A 2G5DA 1HPCA 3FMCA 1GM5A 1O80A 4DR5L 3RZOB 4GN5A 2L55A 4YHHL 4JI7L 1EY6A 1PV4A 5LMUQ 1SSOA 5M3FB 2EZVA 2YTXA 1WYDA 1H9KA 3G4SA 3BZCA 4DK0A 3DUZA 3GV6A 3CCJA 2K14A 2V4DA 5LHY1 5CYUA 2O5IC 1TWFB 4DN4M 4Y52H 4DR1Q 4O42A 3SK6A 5IP7G 3FEWX 1EOVA 3EFXD 1EY7A 1SDFA 3O13A 3VDYA 1LTLA 2HHHL 1EQVA 2D5DA 2AWNA 2EQSA 2F0JA 4JI2L 3KLSA 1FJGQ 2KCMA 2Q8TA 1LTID 2NZHA 2ZTEA 3HS0C 4EQPA 1X32A 2NVQH 5JJKA 1CSPA 4ZRZA 1MSGA 5EPKA 3GTOB 3H6MA 4AH6A 2A1AA 4C3HB 3FKIB 5C44H 1NNXA 2XNAC 4DV5L 3I56A 1SYEA 2B63H 4C2MH 1TWGB 1E1OA 2JE6I 1SR3A 5ELEA 1JE5A 5LMNL 4IUVA 4MTKA 3GTMB 1D7QA 3FDTA 1CSQA 4IUPA 1CQFA 2ZTCA 3GTLB 1ASZA 4PZ6A 3PV0A 4K5XA 5C3XA 1EFWA 1PFBA 4C1NI 5C3EG 4L5RC 4LUOA 2K1BA 3MXPA 4ZK9B 2VNUD 1HFNA 2EYFA 1MD2D 5IT9L 2PW7A 2R3ZA 5IP9G 3LX0A 1EIGA 4U673 1XNQQ 3S1MH 3N52A 3D6CA 1GHJA 1WCMB 4A3FH 1J9OA 2IT1A 3Q23A 1KRTA 5IGEA 1DOMA 1PH6A 4B3TL 3I4LA 1NR4A 3OMGA 4QIWE 4ZYSA 2BDNA 3I4NB 4IFDJ 1HQMC 2H1EA 2VQFL 2K01A 4A3JB 3T16A 3KBGA 2VQEQ 1QG7A 1IBMQ 3HKZB 1KHIA 4K6LA 5LL6X 2NZ1D 1KDCA 3I72A 1MI2A 1AN8A 1STEA 4C3IG 4DV6Q 1FJGL 4X66Q 3K58A 1SE4A 3ERQA 2E5LQ 3MWYW 1UNSA 2IY5B 4JK1C 1G2SA 1DZ1A 3J81i 4DR6L 3J81j 1IBKL 4X6AH 2ASBA 5EJWA 2XN9C 1E2ZA 2DJFC 2LSSA 4A4IA 1I4XA 3TMEA 1ZYRC 1L1OA 4DV2Q 1AEXA 1HRJA 3NXWA 1CT1D 3H0GB 1D5XC 4GN3B 1I4GA 1SROA 4JOIA 1M90C 2NVXH 4DA2A 4LF9L 5E1FA 1RF2D 1UUPA 2F0EA 2CH4W 4MHEA 3J80L 4GLVB 2J0TD 5NUCA 1PYBA 3HOUG 1XNQL 2VB2X 4OGQC 4X62Q 4EX5A 4RCOA 1H9SA 1N34Q 4KHZA 1D8LA 3KFUA 3KDFB 1VS0A 2CQOA 3PIP3 1YNNC 2QW7A 1B2TA 2K75A 1ZKOA 4DR7Q 2VB3X 1A2TA 2BE5C 3E9IA 3Q6SA 4HJ9A 2IHEA 1VMCA 4XYQA 1JWSD 1DXMA 3N6RA 4RGNA 1FL0A 3D4DA 2N49A 1VQBA 3CKIB 4JVZA 2NVQB 4OELB 4DV6L 4X66L 1EQRA 3T56B 1BCPD 1CKNA 1FNUA 3SR1A 3HEJA 5C44B 4O2DA 1TWCB 2I0QA 4C2MB 1WJJA 4KY5A 3E0JA 3PUYA 5EBDA 4A3CH 5C4HA 5BN4A 1Z9FA 1KLUD 2KOLA 1KXLA 1WD1A 5IOCA 5EQ0A 2J7ZA 5I6YA 5E4XA 1OO9B 4XXEA 3K81C 4CDDC 4JOIC 1PXUA 3BZDB 1TS4A 2EXZA 1K9MC 1I4QA 4PZ7A 1FD7D 1WTVA 1PTOF 4I65A 1WTOA 3KLRA 5T1GA 1ICWA 2JA5H 4HAEA 4DV0Q 1HHVA 4P2CB 2Z9HA 1BR9A 4BXXG 3S1MB 2KHIA 1CKOA 1KIXA 3M4QA 1PMRA 3F2CA 4A3FB 2KHSA 2E8GA 1HCZA 5A2QE 1S5FD 4X62L 4DR2Q 2EYPA 3W2DA 2ZXPA 4A3DB 4H13C 1EY9A 3S14B 2E2JH 3KF6A 1WTWA 2WAQB 1E2WA 3OIQA 3TEHB 4FF2A 1CK1A 2Q2TA 2QA4A 1LT4D 4KTAA 4R1JA 5G3LF 3UE1A 3HOXG 4BY7H 1LTBD 1D2BA 4QUFA 4CKBA 1TWHH 1SNOA 1BVSA 1PZJD 1N33Q 3W1GA 2MGSA 4A3IH 4MIUA 1AE2A 2EY2A 5HGQA 2OT2A 1Y1VH 4JBKA 3OW2A 1CTMA 1Q46A 3G7LA 3PO2B 4LF5Q 3EIVA 2BA1A 4U68A 1IKMA 4GOPC 1TIID 4YWMA 3W1BA 5M5XB 2UXCQ 1I6VC 1OXTA 2F0DA 4NB3A 4KKSA 2FJ2A 2RDFA 3OPOA 1HZCA 4A93G 3WOEA 2JQOA 1VMPA 3SK5A 4Y7NB 1Q1BA 5JEAH 3PGZA 4XIGS 4A75A 2HDLA 1X6OA 3C3LA 1BBUA 4DR2L 2GA4B 1XMQQ 3Q0AA 1D5ZC 5CV8A 2HDMA 5CGKA 1YHAA 1GXDC 2RA4A 1JJGA 2MUYA 4CHTB 4C3JH 3JAMi 2OF1A 4BBSH 2UXBL 5E7NA 2KEDA 1N32Q 1S5ED 1BXTA 3F1ZA 4FXKC 1ZYRD 1VF5C 1B50A 1Q8IA 1TWAH 2Q8RE 3ZYYX 4JBWA 1SYGA 4HN7A 3HKZE 5FLXE 4DV1Q 3QO2A 2VY3A 3D4WA 1HH2P 2N8NA 2EY5A 5DM73 4HJ8A 4QCLA 4UP7A 3KLWA 3FHWA 5C3EH 4TRDA 3S16H 4IUTA 5IP9H 2QILA 3SVMA 2AQ1B 4A76A 4CDFC 2WB1B 4K5WA 1RCVD 4BY1G 5I6WA 1HR0W 3DM3A 2X6GA 3X3MA 1PHJA 4IN3A 2UXCL 1SFOB 1YNND 4FVMA 5FOBB 4KV6A 1ONLA 1K28A 3PF4A 1NMFA 2H4OA 1YNJD 1LTSD 4DKAC 4YCVA 5C4XH 4CKCA 5KYIA 2O2LD 2JA8G 3T51B 1F2ZA 1PTOC 1R4PB 1U4MA 3J80i 2Q8IB 4AYBG 2E75C 1B3QA 4Z9CB 3CHBD 3NTIA 1YZ6A 2KENA 2Z4HA 1NCVA 1XMQL 1KC8C 2E2IH 2E2JB 2OXPA 4O0AA 3Q22A 1B4OA 2OQ0A 1RDPD 5CV6A 1OXVA 3MEHA 3MXGA 1I3QB 1VQ6A 1WD0A 3L7ZC 1VQFA 3QOJA 3CCRA 2R93G 1YITA 5M5YB 1HUNA 1PLFA 3P7JA 1UWVA 3TS2A 4BY7B 2R92G 5GROA 4OXPA 3RZDB 1N32L 1TWHB 2D9UA 4EGVA 3J81E 4X3TA 3FPUB 2L15A 2PI2A 3I2ZA 1LLRD 4DV1L 4HSVA 3K8AA 1B7YB 4X65Q 1J8IA 1Y1VB 1AZPA 3L3OC 1OXUA 5CV7A 4AYBE 2EYOA 1JB7A 3DMUA 1PH2A 5ELFA 1PFSA 2MFIA 1WTHA 3E6ZX 3VA7A 3IFTA 3HOZH 4OX9L 5IGGA 3I90A 4IZ8A 4LF7Q 1F77A 1ML0D 2RSOA 3CC2A 1G2TA 4JPBW 2B3GA 2A5HA 2L11A 4X64L 5FLXL 4JI4Q 2ICIA 1TY0A 2HQEA 4JI8Q 1GJXA 1DOKA 5CV4A 1H95A 2UUBQ 1PDQA 3NPPA 1SJHD 2YU9H 1SLJA 2F0HA 4DF7A 3T1HL 2ALYB 2NTSA 1JICA 2PNHA 3OTOL 5GAEC 1OXSC 1Q90A 1QUQB 3E5SA 3CPFA 3OYYA 5FJ8H 1GKHA 1VQLA 5H1SE 2D0PA 1V8QA 5C4JB 1W3SA 1X65A 1V43A 4EQOA 3K5LA 1U0LA 4GNXA 4K8IA 5JJZA 1Q7YC 1K0RA 5C0XJ 3RZOH 2AUKA 2A19A 1OXXK 3DHQA 2A69C 4FF3A 4JYAQ 1JB3A 1JT8A 1II3A 2Z1CA 2NVYH 4DXFA 3DXJC 4NKLA 4CJ0B 1TWFH 4HJ5A 5C3EB 2IJ0A 4KKTA 5BN5A 4X65L 2X69A 5KIXA 2BCOA 2A6EC 1HTLD 3VR3A 4POGA 1RTOA 1O7YA 1MGSA 1H9JA 1X54A 5FK9C 3J81L 4JI6L 4A3KG 2R7ZG 1R9TB 3BVZA 4YIJA 3VYSA 4WJ4A 4OEMB 1ENAA 1TS2A 3GTOH 1YVCA 4C3HH 3FKIH 1IBLQ 4JI8L 3CQZH 4JV5Q 2UUBL 1LT3D 2K33A 2RSNA 1STNA 3R2TA 3NSWA 3PUZA 4HJ7A 1N36L 4C3IB 3GTMH 3BDCA 1RL2A 4GNXC 1HZBA 5IYDG 1MBYA 2E2IB 4DU9A 4DAPA 3CCLA 3TDQA 1ZXTA 3NK9A 1V1PB 3LGJA 5EAYA 4DUYQ 2R7FA 3PF5A 1F2YA 5IYCG 4YHHQ 4RGTA 1K0SA 2XIWA 1BOSA 3CP0A 5F2DA 5ELDA 4A3EG 2FMCA 4FXGC 2CWPA 4KLKA 2Q2UA 1WCMH 3M7GA 2HIXA 3QR8A 4UP8A 1IXRA 2Z6KA 2A6HC 2AKWB 4A3GG 1WTRA 3U4ZA 4FF1A 2CW0D 1Q12A 3I3CA 3I8ZA 1ASYA 4A3JH 3HOUB 4JI2Q 1SYBA 4HCSA 2ID0A 4APVA 1AZQA 1Y14B 1YJWA 4DK1A 3AU7A 3J7ZC 1S5DD 3WWVA 3KOJA 1TKWB 3K80C 1KLGD 3C2PA 1F9RA 1SYCA 2N55A 2ZJPA 3HG9A 3RLFA 2PZWA 2PYKA 2WB1E 5C4ZA 1G6PA 4LF6Q 2RHQB 1XWEA 4WRDA 1SNCA 1H9RA 4XQNA 4OIKA 1XPOA 1VQCA 5LMNQ 4JV5L 3ICEA 1X3FA 3BYTB 2OQKA 4NDXA 2MQHA 3QG1A 3RLNA 3H0GH 1A3VA 2JA6G 4P72A 3A55A 1HR0L 4K14A 4DUYL 3HOVG 3CPWA 3CC4A 4TQUS 3WDNA 1IYUA 4IUUA 4AQYL 1BBXC 1A63A 3C1FA 2G9HD 3T13A 2Z0SA 2Z6KC 2NVYB 4HIKA 3HOYG 1AP0A 1STGA 2SNMA 4B3TQ 1CHQD 1KNEA 1EEID 3ULJA 4RG1A 3U50C 4A3MG 2I07B 1GUNA 2PZUA 4BY1H 2VQFQ 2OEOA 2RBMA 3LWEA 1PH5A 1Y1WG 1B3AA 3MA2B 1PH1A 2V1CC 1LT5D 3U9OA 2EY6A 3SDZA 2RCFA 3QIAA 3CC7A 2JA8H 2KQ3A 4NP5A 4G4KA 2N88A 2QF7A 4B3RL 4FYDA 2L1BA 3U9SA 1PRTF 4DR6Q 3BG3A 3J80E 1IBKQ 1TWCH 5JJIA 3CQZB 4G7HC 4OWXB 3JC66 3BZKA 1NY4A 5TSSA 4LF6L 3H3VH 5GQOA 2CVRA 2QDBA 4DV7L 1VDZA 2R93H 4CDEC 5HURA 3PO3G 1BCPB 3NELA 4HMIA 3HOXB 1VQDA 3Q8DA 5M5WB 2A69D 3D4RA 2R92H 5I2XA 2PW5A 2L5TA 1X3GA 1NR2A 4LF9Q 2WACA 4ME3A 1JE4A 1O7ZA 4ZUJA 5EPLA 2BDOA 4OWWB 1WFQA 4BA1I 2JJQA 4QJFA 1DONA 1UEBA 1XX8A 1HZAA 5EKLA 2B2WA 2KCCA 4XYOA 1SNMA 3M4OH 2KCTA 1XJVA 2MNAA 2IWHA 2Y0SG 2KCNA 3FP9A 4XDXA 3JAML 2CHBD 2OTJA 2F0GA 1U5KA 2F0LA 2NTTA 1BKBA 1EQTA 4A3DH 4L6TB 1WOCA 1K83B 2MO1A 4DFAA 1SE8A 1FYCA 3S14H 1QE6A 1IW7D 4ZAIA 1Q1EA 2A68D 1VQHA 1YJNA 4A93B 1ICFB 1K3BC 1ENFA 3I7FA 1A3UA 5IYBH 2E2DC 1CA5A 3H3VI 4DAVA 1Y69U 1EOTA 4IUNA 4X3KA 5BR8L 3F2BA 2E2HB 3NBHB 4XT3B 2Y0SE 4JBJA 5ELCA 2LS01 4QB4A 3DLLA 2PQAB 3CW2C 3SK8A 3UDXA 3EN2A 4LUZA 2E76C 2JP1A 5EBCA 3SXHA 4K2LA 4R4CA 3PO2H 3NWTA 3BS1A 2TMPA 1JR0D 4DGZA 2VUMG 1BUVT 4A3BG 1LTTD 5M5XH 4N9PA 4P75A 4MN3A 1NTGA 4J15A 3BJUA 2EJMA 1P16A 4JC0A 5I9PA 2B2WC 2B29A 1JQYD 3PUVA 1E7ZA 1IL2A 3I70A 4Y7NH 1L2FA 1GD7A 1RTNA 3AFQA 3NTKA 1H9MA 2I46A 3V96A 5CV5A 1Y8NB 4BY1B 3U58A 3HP3A 1SBBB 1JOOA 2RHSB 2IHFA 1SRUA 2AQ2B 2YV5A 4PZ8A 5EGTA 4WFN3 2ZJRA 2DUDA 1M4VA 5CMDA 4DK3C 4QMGA 3C1EA 5M3MG 2CQAA 1HTPA 2JA8B 1EY4A 4DAMA 2M2LA 2ZTDA 1E3PA 1LUZA 4AYBB 3D31A 1N9WA 4XQJA 1W2BA 3STBC 2LMCB 3CMAA 3FPPA 4LFAQ 2AQ3B 2X6LA 4YCUA 3T53B 4RKBA 1FGBD 1L1OC 1S5BD 3RNUA 3BYYB 4RA8A 4S3SA 4EQNA 2R93B 3NTHA 1VF7A 2R92B 4RHSA 1UE5A 1SYDA 1PRTC 3I55A 3B6YA 1MHWC 5KNCA 1J5EL 2QEXA 2F3WA 3A7AB 2K5VA 1I4RA 2F0KA 1JWMD 1SFOH 3GTPB 1QVGA 2JA7G 1B53A 1YHBA 1VQ5A 5M3FG 2JN4A 5M9OA 4IUQA 5DAUA 1LTGD 1QB5D 3M4OB 1KABA 2IPKD 1KD1C 4EQ5A 4FXDA 3MXUA 3GTGH 2XWJB 3VR6A 5FO9B 3AEVA 2AMCB 5GAGC 1BQQT 2XTIA 1A6XA 2UXBQ 3A5UA 1WTXA 1LO5D 2VW9A 4GZYC 4NXML 2YTYA 1I3QH 5M5YH 3OMCA 4QQBX 2F0MA 2P5ZX 4JI5L 1KRSA 4KHPQ 1DD2A 5JAVA 1HA6A 3A56A 2I5MX 1S5CD 2MJ8A 2WIIB 3D8GA 1VQNA 3RZDH 1FR3A 1QILA 1D5MC 1VQ4A 1QVFA 1PA6A 4F7XA 4LFAL 2UUAL 5C3WA 2N3SA 4XQQA 5AJ3L 3HZXA
chains in the Genus database with same CATH topology
1F9QA 1I6HB 3NP8A 2L0CA 1X3QA 5KNDA 2F0WA 5FKAC 4IFDG 3MTSA 5AFWA 2NUCA 5D65A 1PZID 1S4ZA 3OOCA 4UAIA 2B2YA 4A3KB 2R7ZB 2KVMA 3TP7A 1WTQA 4RHRA 1U9RA 3UI2A 3VA5A 2PO4A 1BNZA 1CI3M 4R9WA 2EOTA 4EVOA 1EY8A 3KF8A 4X3UA 1D1IA 3OSOA 4L8JA 5EKKA 4LMQD 4C1NK 4F87A 1SEBD 2E74C 4KMUC 3OIPA 4FP5D 1DYQA 4A3EB 1KTKA 2F0OA 1JC7A 3CU7A 2FMMA 1SMYC 3R93A 1TR5A 1V1OA 2LFNA 1VCIA 4A3GB 1L0YB 4KI0A 2BE5D 3CRLC 2M9VA 5LL6S 1FNWA 1BO0A 3CRKC 1NUCA 1BDOA 2F3VA 1G291 1Z47A 3GTGB 4DXGA 1PYWD 1B44D 1BF4A 1EYCA 4NMZA 5DM63 3RMHA 2NWGA 1A3TA 2ZT9C 1DM0B 2B2UA 1FNVA 1TY2A 1HXYD 2ICEC 3C46A 1PRTD 3ITPA 1EZ8A 4DAYA 2K05A 3BVMA 2JA6B 1ET6A 1EWCA 4PQXA 1Q3LA 3HOVB 3H09A 2F0PA 2L4NA 2EDGA 1Z7TA 3S1NB 3HOYB 1I4HA 5C5MA 4RGMA 4A3MB 3MFYA 3S9WA 3DEOA 3M85A 2PCFB 4PMBA 1PTOB 1F2MA 1A2UA 4H0LC 3NBIA 4FNFA 4QUCA 4R8NA 1DCZA 1U4RA 1NAPA 1ILPA 5JEAJ 2B2UC 1GUOA 4R8IA 3NQTA 4K6DA 3H91A 1HFGA 3D3RA 4ZKBB 1D1KA 2K5QA 2O4XA 3HGBA 3PO3B 3IFDA 1HUMA 5I4DA 2XRQD 3VYTA 5IGDA 4HTHA 1CA6A 4OHJA 4PV1C 2SEBD 1SYFA 2IX0A 1SE2A 3M3YB 1F9SA 3IL8A 5D3IB 5KEEA 2WKDA 2K04A 2K03A 1KDBA 2O5JC 2Y0SB 2MPMA 4RCNA 4M1UB 4ULLA 4KD4A 3K5MA 4LJZC 2F0QA 1ZEQX 4J1MA 2KEEA 4TSSA 1TVXA 4IALA 3RUZA 3EJIA 1EU4A 2EYJA 3KUPA 1SE3A 3L9AX 3I91A 5T1IA 1T5XD 2M00A 3FRPB 4RKLA 1PZKD 2RDHA 3GTKB 1CZGA 1IHZA 2VUMB 4A3BB 2XRSD 5J1ZA 1LT6D 2RVLA 2NVTB 1UEAB 4G57A 1TS3A 4IFDH 5J39A 5JVH3 2EJGC 1K8MA 3TBIB 4KN4C 2IX3A 4G7ZC 5CORA 1PTOD 2FINB 1EY0A 2XSCA 3A8KE 3P1HA 1GUTA 1CHPD 2TSSA 4BWGB 1WTPA 3KLSX 1KDAA 1AFPA 5M3MB 1XTCD 4DNRB 3QOLA 3VR4A 2YYZA 3A54A 3JAME 2B2VA 4RWSC 1G91A 4ZQ3A 4ZKCB 3K5OA 3NHHA 3OWFA 4PNYA 5G3LD 3NBHA 3TP8A 5D14A 1BCPC 4IFDI 2K6AA 2L9HA 2K5WA 3EVQA 1EY5A 4WORA 4V190 1XXGA 2L12A 2JA7B 1F2LA 4K2KA 1CFMA 1QWYA 3EROA 2F03A 1EIHA 2K28A 3S15B 5CC4A 1L0XB 4OO1G 2EY1A 2C9OA 1SNQA 2DNEA 3S17B 2MHVA 5JOBA 2DNCA 5CV9A 5JEAG 5C0XG 1PFMA 2B2VC 3A8IE 2B2TA 1C8CA 1STBA 2F0FA 2F0UA 2EYHA 4C3JG 3WOFA 2FFKB 3QWNA 5K5PA 4KD3A 4FF4A 4G7OC 4B08A 2A6ED 4NW2A 1M8AA 1SNDA 4RH6A 3URYA 3NWSA 1G8ZD 4FO2A 5JVG3 4Q0FA 1D6EC 5EKIA 5CR3A 1RD9D 3NUCA 3S1RB 3KK7A 4ZLTF 2Z8LA 1EL0A 1C48A 1ESFA 2XWBB 3ND9A 3S2DB 1A15A 3K59A 2K5DA 4ZUIA 1JOKA 4O1NA 1UAPA 1QNKA 3R2IA 4BA2I 2B2TC 4XTCS 5I2YA 4OL7A 1IL8A 1QJOA 3OWEB 3MZ5A 1DOLA 3A8JE 2A6HD 4F88A 3SEBA 1CM9A 1GOZA 2R6GA 3H3VC 5CBAE 4V0BA 4F8MA 3J7AV 2WKCA 3Q24A 1O78A 2F0VA 3W3AA 3ND8A 2PZTA 4RFBA 5IGCA 1MSHA 5BN3A 5IIFA 2F0IA 4DNTB 5HGTA 2SNSA 4ID6A 5FO7B 3GD7A 2AWOA 4RAUC 1XYIA 4M8AA 4ODGA 2SDFA 5KGUA 1O7LA 1SAPA 5C5LA 1YNJC 4X3SA 4HCEA 3DEPA 3AMUA 1JCKB 2ZXOA 4J8QA 1B9MA 4QF4A 1LTRD 2D62A 2HUGA 1IKLA 1ILQA 3X3NA 2QKIC 1B1ZA 3M7NA 3MAQA 3D6WA 1ET9A 4KY7A 3J7AF 2B63B 3VR2A 1G6ZA 5FO8B 2NB0A 4HMJA 3SE0A 4ME5A 1RJTA 2EVBA 2PPBC 2R61A 2NN6G 3DM1A 4K5VA 3QB3A 1GUSA 2Z4IA 4N9TA 4KK7A 3GV3A 2RQXA 1I50B 4I7ZC 2A74C 2DY8A 1GHKA 4B9XA 1NSNS 2PNRC 3K57A 3I4MB 1PFNA 3PUXA 3RD4A 3IKJA 2EJFC 3P75A 4LK1C 4C3HG 1CQVA 1W6KA 3I73A 3SK4A 1EEFD 4CBVA 3TP5A 4KJOA 2QCPX 4CJ2C 2B8GA 3GQBA 1PRTB 2RDGA 3M4YA 4CGYB 2XVSA 2IX1A 4HR7B 3TZUA 2HCIA 3MFGA 1H9SB 1TQOA 3QJYA 4BBRB 1EU3A 4KY6A 1PTOH 1CZWA 5K36G 2NVXB 1WVLA 4OO1H 1SXTA 3A7LA 1EFID 3H94A 2PMZB 1TS5A 2EPBA 5C0XH 2F4IA 3FVQA 5IGFA 1STYA 1LABA 2B39A 1STHA 3F2UA 3OW7A 2KECA 3GP7A 4TKOB 2IW3A 1KNAA 5A2QL 2KUMA 2JYOA 2ZXRA 2LY7A 2G9DA 2LKVA 3TSSA 1HA5A 2WINB 1C4QA 1RHPA 3DWQA 2A73B 3R3OA 2MP1A 2J4XA 3GTJB 3ONAB 3J7YW 4E6IA 4OO1I 2WV6D 5IGBA 2NYZD 2QEJC 4IQZA 1X3PA 1QCBD 1TU2B 2B2YC 5A35A 3TP6A 4KJNA 2EE1A 3PUWA 5C0XI 2JA5B 2CW0C 2JSOA 5D3DA 3K7AB 3OHXC 3MHBA 4CJ1B 2PQEA 3DWAA 3EQLC 2HCCA 3TZDA 3GO5A 1TT2A 1LV9A 1V1PA 5KRUA 2EYLA 4PMWA 3NQIA 3T4AC 2F0TA 3K6OA 2VXWA 4CKEA 4A3IB 2EYMA 1K8OA 1EZ6A 5COYA 3NE5B 4J6HA 1AW7A 5E3FA 1LTAD 5EPJA 2F0NA 1E0BA 1Y1WB 2BOSA 2F0SA 1Z6HA 3PMFA 1IYVA 1QOHA 4UDUC 2RKSA 1BCPF 1U4PA 1EWHA 4Q5VA 3IAYA 4B9WA 5DNFA 2JXMB 1EYDA 4C56C 3GTQB 3BDOA 1HQRD 3MVVA 4ILWA 2NBFA 3KBXA 5ELBA 3HRZC 2DY7A 1STAA 1JOQA 4C3JB 2F1MA 4BBSB 2KJXA 3S2HB 2IL8A 3EA6A 1B9NA 1T5EA 3K5NA 4WJWA 1LACA 4KN7C 3K0YA 4QIWB 4H44C 1TWAB 1JORA 3S1QB 2NN6H 1GUWA 1ESRA 4HEDA 3S16B 3LNNA 1W6JA 5I9OA 5J22A 1QNUA 5ISRA 1JWUD 4BS9A 1SJED 1DJRD 2K7VA 3MC0B 1SNPA 1U4LA 3LWUA 2D2CC 1IW7C 2ENBA 2A68C 3HOWB 5JPMC 4H7BA 5C4XB 1RKNA 4K8JA 3BDLA 3VYRA 2BA0A 2KA7A 3VR5A 1I4PA 1SMYD 4LAAA 1Y8OB 3TN2A 5JPNC 1GUGA 3MXNA 3PIO3 2AUJD 3G6JB 1R4QB 4L63B 2NN6I 2B8FA 2C5CA 1E2VA 4XT1B 2K32A 5K36H 3R8BA 5C6AA 1F9PA 3VYUA 4RGOS 2WP8J 3HOZB 2JEBI 3V2TA 4KKUA 4OIJA 5IODA 1ENCA 3DWPA 3AB9A 1EYAA 5CBEE 2FHTA 4IURA 5IT9E 2YU9B 5E4WC 5KNBA 3V05A 1Y8PB 5KYLA 4PMCA 3P20A 1KAAA 2JEAI 2SOBA 3BVGA 2DN8A 5DEHA 4KHVA 3SHLA 4ABNA 1RODA 4HSPA 1HPCA 3FMCA 1O80A 3RZOB 2L55A 1EY6A 1SSOA 5M3FB 2EZVA 1H9KA 4DK0A 3DUZA 3GV6A 2V4DA 5LHY1 5CYUA 2O5IC 1TWFB 4DN4M 4O42A 3SK6A 3FEWX 3EFXD 1EY7A 1SDFA 3O13A 1EQVA 2D5DA 2AWNA 2F0JA 3KLSA 2Q8TA 1LTID 3HS0C 4EQPA 1X32A 4ZRZA 1MSGA 5EPKA 3GTOB 3H6MA 4C3HB 3FKIB 2XNAC 1SYEA 1TWGB 2JE6I 5ELEA 4IUVA 3GTMB 3FDTA 4IUPA 1CQFA 3GTLB 3PV0A 4K5XA 5C3XA 1PFBA 4C1NI 1HFNA 2K1BA 3MXPA 4ZK9B 2VNUD 2EYFA 1MD2D 5IT9L 2PW7A 2R3ZA 3LX0A 1EIGA 4U673 3N52A 3D6CA 1GHJA 1WCMB 1J9OA 2IT1A 3Q23A 5IGEA 1DOMA 3I4LA 1NR4A 3OMGA 4ZYSA 2BDNA 3I4NB 4IFDJ 1HQMC 2H1EA 2K01A 4A3JB 3T16A 3KBGA 1QG7A 3HKZB 4K6LA 5LL6X 2NZ1D 1KDCA 3I72A 1MI2A 1AN8A 1STEA 4C3IG 3K58A 1SE4A 3ERQA 3MWYW 1UNSA 4JK1C 1G2SA 1DZ1A 5EJWA 2XN9C 1E2ZA 1I4XA 3TMEA 1ZYRC 1AEXA 1HRJA 3NXWA 1CT1D 3H0GB 1D5XC 1I4GA 4DA2A 5E1FA 1RF2D 1UUPA 2F0EA 4MHEA 3J80L 2J0TD 5NUCA 2VB2X 4OGQC 4RCOA 1H9SA 4KHZA 3PIP3 1YNNC 1B2TA 1ZKOA 2VB3X 1A2TA 2BE5C 3Q6SA 1VMCA 4XYQA 1JWSD 1DXMA 3N6RA 4RGNA 3CKIB 3D4DA 2NVQB 3T56B 1BCPD 3SR1A 1FNUA 5C44B 3HEJA 1TWCB 4C2MB 4KY5A 3E0JA 3PUYA 5EBDA 5C4HA 5BN4A 1KLUD 2KOLA 1WD1A 5IOCA 5EQ0A 2J7ZA 5I6YA 5E4XA 1OO9B 4XXEA 1PXUA 3BZDB 1TS4A 2EXZA 1I4QA 1FD7D 1WTVA 1PTOF 4I65A 1WTOA 3KLRA 5T1GA 1ICWA 4HAEA 1HHVA 4P2CB 1BR9A 3S1MB 4A3FB 1PMRA 2KHSA 5A2QE 1HCZA 1S5FD 2EYPA 3W2DA 2ZXPA 4A3DB 4H13C 1EY9A 3S14B 1WTWA 2WAQB 1E2WA 3OIQA 4FF2A 1CK1A 1LT4D 4KTAA 5G3LF 1LTBD 1D2BA 4QUFA 4CKBA 1SNOA 1PZJD 2MGSA 4MIUA 2EY2A 2OT2A 1CTMA 3G7LA 3PO2B 2BA1A 4U68A 1IKMA 1TIID 5M5XB 1I6VC 1OXTA 2F0DA 4KKSA 2FJ2A 2RDFA 3OPOA 3WOEA 1VMPA 3SK5A 4Y7NB 1Q1BA 5JEAH 4XIGS 2HDLA 3C3LA 2GA4B 3Q0AA 1D5ZC 5CV8A 2HDMA 5CGKA 1GXDC 2RA4A 2MUYA 4CHTB 2OF1A 2KEDA 1S5ED 1BXTA 4FXKC 1ZYRD 1VF5C 1B50A 1Q8IA 2Q8RE 3ZYYX 4JBWA 1SYGA 4HN7A 5FLXE 3QO2A 3D4WA 2EY5A 5DM73 4QCLA 4TRDA 4IUTA 2QILA 3SVMA 2AQ1B 2WB1B 4K5WA 1RCVD 5I6WA 2X6GA 3X3MA 4IN3A 1SFOB 1YNND 4FVMA 5FOBB 4KV6A 1ONLA 2H4OA 1YNJD 1LTSD 4CKCA 5KYIA 2O2LD 3T51B 1R4PB 1F2ZA 1PTOC 1U4MA 2Q8IB 2E75C 4Z9CB 3CHBD 3NTIA 2Z4HA 1NCVA 2E2JB 2OXPA 3Q22A 1B4OA 1RDPD 5CV6A 1OXVA 3MEHA 3MXGA 1I3QB 5M5YB 1WD0A 3L7ZC 3QOJA 1HUNA 1PLFA 3P7JA 4BY7B 3RZDB 1TWHB 2D9UA 4EGVA 3J81E 4X3TA 3FPUB 1LLRD 4HSVA 1J8IA 1Y1VB 1AZPA 3L3OC 1OXUA 5CV7A 2EYOA 3DMUA 5ELFA 3E6ZX 3VA7A 3IFTA 5IGGA 3I90A 4IZ8A 1F77A 1ML0D 2RSOA 1G2TA 2A5HA 2L11A 5FLXL 2ICIA 1TY0A 2HQEA 1GJXA 1DOKA 5CV4A 1PDQA 3NPPA 1SJHD 2F0HA 4DF7A 2NTSA 1JICA 1OXSC 1Q90A 3E5SA 1V8QA 5C4JB 1V43A 4EQOA 3K5LA 4K8IA 5JJZA 5C0XJ 2AUKA 1OXXK 3DHQA 2A69C 4FF3A 1JB3A 1II3A 2Z1CA 4DXFA 3DXJC 4NKLA 4CJ0B 5C3EB 2IJ0A 4KKTA 5BN5A 2X69A 5KIXA 2BCOA 2A6EC 1HTLD 3VR3A 1RTOA 1O7YA 1MGSA 1H9JA 5FK9C 3J81L 1R9TB 3BVZA 4YIJA 3VYSA 1ENAA 1TS2A 1LT3D 2K33A 2RSNA 1STNA 3R2TA 3NSWA 3PUZA 4C3IB 3BDCA 1MBYA 2E2IB 4DU9A 4DAPA 3TDQA 1ZXTA 3NK9A 1V1PB 1F2YA 4RGTA 2XIWA 1BOSA 5F2DA 5ELDA 2FMCA 4FXGC 3M7GA 2A6HC 1WTRA 4FF1A 2CW0D 1Q12A 3I3CA 3I8ZA 3HOUB 1SYBA 4HCSA 2ID0A 1AZQA 4DK1A 3AU7A 1S5DD 1TKWB 1KLGD 3C2PA 1F9RA 1SYCA 2N55A 3HG9A 3RLFA 2PZWA 2PYKA 5C4ZA 1XWEA 4WRDA 1SNCA 1H9RA 4XQNA 4OIKA 3BYTB 4NDXA 3QG1A 1A3VA 3A55A 4K14A 4TQUS 3WDNA 1IYUA 4IUUA 1BBXC 3C1FA 2G9HD 3T13A 2NVYB 1AP0A 1STGA 2SNMA 1CHQD 1KNEA 1EEID 2I07B 1GUNA 2PZUA 2OEOA 2RBMA 3LWEA 1B3AA 3MA2B 1LT5D 3U9OA 2EY6A 3SDZA 3QIAA 2KQ3A 4NP5A 4G4KA 2N88A 2QF7A 4FYDA 2L1BA 3U9SA 1PRTF 3BG3A 3J80E 3CQZB 4G7HC 5TSSA 2CVRA 2QDBA 1VDZA 5HURA 1BCPB 4HMIA 3HOXB 5M5WB 2A69D 3D4RA 5I2XA 2PW5A 2L5TA 1NR2A 2WACA 1JE4A 1O7ZA 4ZUJA 5EPLA 2BDOA 4BA1I 1DONA 1XX8A 5EKLA 2B2WA 2KCCA 4XYOA 1SNMA 2IWHA 4XDXA 2KCNA 3JAML 2CHBD 2F0GA 2F0LA 2NTTA 1EQTA 4L6TB 1K83B 4DFAA 1FYCA 1QE6A 1IW7D 4ZAIA 1Q1EA 2A68D 4A93B 1ENFA 1A3UA 2E2DC 1CA5A 4DAVA 1Y69U 1EOTA 4IUNA 4X3KA 2E2HB 4XT3B 5ELCA 2LS01 4QB4A 3SK8A 2E76C 2JP1A 5EBCA 3SXHA 4K2LA 3NWTA 3BS1A 2TMPA 1JR0D 4DGZA 1BUVT 1LTTD 4N9PA 4MN3A 2EJMA 5I9PA 2B2WC 1JQYD 3PUVA 3I70A 1RTNA 1H9MA 3NTKA 2I46A 3V96A 5CV5A 1Y8NB 4BY1B 3HP3A 1SBBB 1JOOA 2AQ2B 5EGTA 4WFN3 1M4VA 5CMDA 4QMGA 3C1EA 2CQAA 1HTPA 2JA8B 1EY4A 2M2LA 4AYBB 3D31A 4XQJA 2LMCB 3FPPA 2AQ3B 2X6LA 3T53B 4RKBA 1FGBD 1S5BD 3BYYB 4RA8A 4S3SA 4EQNA 2R93B 3NTHA 1VF7A 2R92B 4RHSA 1SYDA 1PRTC 5KNCA 2F3WA 3A7AB 1I4RA 2F0KA 1JWMD 3GTPB 1B53A 5M9OA 4IUQA 5DAUA 1LTGD 1QB5D 3M4OB 1KABA 2IPKD 4FXDA 3MXUA 2XWJB 3VR6A 5FO9B 1BQQT 1A6XA 1WTXA 1LO5D 4GZYC 3OMCA 2F0MA 1DD2A 5JAVA 1HA6A 3A56A 1S5CD 2MJ8A 2WIIB 3D8GA 1FR3A 1QILA 1D5MC 4F7XA 5C3WA 4XQQA 3HZXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RTN A;  1F9Q A;  2L1B A;  3GV3 A;  2B2T C;  5D14 A;  2HDL A;  2R3Z A;  2MPM A;  3KBX A;  3I90 A;  2L9H A;  2NWG A;  1EIG A;  1RHP A;  1IL8 A;  1X3Q A;  2DY7 A;  1ML0 D;  2RSO A;  2DY8 A;  2XIW A;  3N52 A;  2HDM A;  2B2U A;  1G2T A;  2MP1 A;  4OIJ A;  3ONA B;  3HP3 A;  2KOL A;  1DOL A;  2L11 A;  1WD1 A;  2RA4 A;  2CVR A;  2KEE A;  5EQ0 A;  1J9O A;  2J7Z A;  2NYZ D;  1TVX A;  1PFN A;  1X3P A;  5E4X A;  2L12 A;  5CBE E;  1DOM A;  5CMD A;  2FHT A;  4IUR A;  2IL8 A;  3MTS A;  1F2L A;  2B2Y C;  1DOK A;  2KED A;  5AFW A;  1CM9 A;  5E4W C;  1NR4 A;  2K05 A;  1EIH A;  1PDQ A;  2BDN A;  2EE1 A;  2M2L A;  5CBA E;  2H1E A;  1WTV A;  1NR2 A;  1WTR A;  2K01 A;  2K1B A;  1B50 A;  1WTO A;  2K28 A;  3KUP A;  1Q3L A;  1JIC A;  2Q8R E;  1ICW A;  3I3C A;  3I8Z A;  5T1G A;  1QG7 A;  4HAE A;  1JE4 A;  5D65 A;  3I91 A;  1O7Z A;  1S4Z A;  3QO2 A;  5EPL A;  5T1I A;  4HCS A;  1HHV A;  4UAI A;  1GUW A;  2NZ1 D;  2X6L A;  4CJ2 C;  2L4N A;  1MI2 A;  1AZQ A;  2B2Y A;  1ESR A;  1ROD A;  4HED A;  1DON A;  1XX8 A;  2KVM A;  1MSH A;  1WTQ A;  4RA8 A;  2B2W A;  1O80 A;  1PFM A;  5JJZ A;  3MWY W;  4CJ1 B;  4IUT A;  3SVM A;  1F9R A;  2B2V C;  4XDX A;  2N55 A;  1G2S A;  3DEO A;  3UI2 A;  1EQT A;  1SSO A;  2B2T A;  1DZ1 A;  2HCC A;  3TZD A;  1C8C A;  3GV6 A;  1U4L A;  2HCI A;  5EJW A;  2RVL A;  2X6G A;  1QE6 A;  4OIK A;  1BNZ A;  4R9W A;  4ZAI A;  1WTW A;  4RAU C;  2EOT A;  2FFK B;  1XYI A;  1LV9 A;  1HRJ A;  4X3U A;  4CJ0 B;  4DN4 M;  2SDF A;  1B53 A;  4O42 A;  1SAP A;  5COR A;  4LMQ D;  2X69 A;  4IUQ A;  4QUC A;  1WVL A;  4X3S A;  2VXW A;  4QUF A;  1SDF A;  2FIN B;  3DEP A;  1CA5 A;  4NW2 A;  1U4R A;  1M8A A;  1U4M A;  1NAP A;  4MHE A;  1EOT A;  1ILP A;  2MGS A;  5COY A;  1RTO A;  2B2U C;  1O7Y A;  4X3K A;  4R8I A;  1MGS A;  2HUG A;  1IKL A;  1ILQ A;  2Q8T A;  2EPB A;  2FMM A;  4IUU A;  3H91 A;  1NCV A;  5EKI A;  3R93 A;  1WTP A;  1HFG A;  5EPJ A;  3D6W A;  4XT3 B;  1E0B A;  3TN2 A;  4ZKB B;  1B4O A;  1X32 A;  1BBX C;  3G7L A;  4ZLT F;  1MSG A;  5EPK A;  3IFD A;  1WTX A;  1HUM A;  2JP1 A;  1WD0 A;  1AP0 A;  3F2U A;  1EL0 A;  1KNE A;  1G6Z A;  4U68 A;  1HUN A;  1IKM A;  1PLF A;  3P7J A;  1B2T A;  2B2V A;  2KEC A;  4RWS C;  1CA6 A;  1G91 A;  1HA6 A;  3LWE A;  2D9U A;  1BO0 A;  2MJ8 A;  2RSN A;  3Q6S A;  4X3T A;  1B3A A;  1U4P A;  1KNA A;  3FPU B;  1A15 A;  1VMC A;  4IUV A;  4XT1 B;  4ZKC B;  4MN3 A;  1RJT A;  3FDT A;  2FJ2 A;  5DNF A;  4IUP A;  1F9S A;  3DM1 A;  3IL8 A;  1VMP A;  1F9P A;  2B2W C;  4HSV A;  1J8I A;  1AZP A;  2K04 A;  2KUM A;  2K03 A;  2JYO A;  1BF4 A;  2N88 A;  1PFB A;  1ZXT A;  1HFN A;  1QNK A;  4ZK9 B; 
#chains in the Genus database with same CATH topology
 1F9Q A;  1I6H B;  3NP8 A;  3CCM A;  4JI3 Q;  1PYS B;  3HOV H;  2L0C A;  3ER0 A;  1X3Q A;  5KND A;  2F0W A;  4UPA A;  5FKA C;  3K0X A;  3CCS A;  3TQY A;  4IFD G;  3MTS A;  4IO9 A;  5AFW A;  4DNI A;  4LUV A;  5IP7 H;  2NUC A;  5D65 A;  1PZI D;  1VQO A;  2HIV A;  1S4Z A;  3OOC A;  1EQQ A;  4UAI A;  2B2Y A;  1YHQ A;  4A3K B;  2R7Z B;  4OON A;  1C9O A;  2KVM A;  4UP9 A;  3TP7 A;  5C4J H;  1WTQ A;  4RHR A;  1U9R A;  4B3M Q;  3UI2 A;  3VA5 A;  2UUC Q;  2HT1 A;  4KHP L;  2PO4 A;  1BNZ A;  1CI3 M;  4R9W A;  3PIP A;  2NZO A;  2EOT A;  1EYG A;  4EVO A;  1EY8 A;  3KF8 A;  3E0E A;  4X3U A;  1D1I A;  3OSO A;  4L8J A;  4R4I A;  5EKK A;  4LMQ D;  4C1N K;  4L5T A;  4F87 A;  1SEB D;  1XNR Q;  1VQA A;  3T1Y Q;  2E74 C;  4KMU C;  3OIP A;  4OX9 Q;  4FP5 D;  1DYQ A;  2DGY A;  1KTK A;  4JI3 L;  4A3E B;  2F0O A;  1JC7 A;  3CU7 A;  3M3Y H;  4GOP B;  4HIM A;  3TS0 A;  2FMM A;  1SMY C;  3R93 A;  1TR5 A;  4X64 Q;  1E1T A;  1A8V A;  4IJL A;  3IRB A;  1V1O A;  2LFN A;  3G71 A;  1VCI A;  4JG2 A;  1X56 A;  1R9T H;  4A3G B;  2CWA A;  1L0Y B;  4KI0 A;  2BE5 D;  3T1H Q;  3CRL C;  2M9V A;  5LL6 S;  1FNW A;  1BO0 A;  1MIU A;  3F8T A;  3OTO Q;  4RMF A;  2Z6B A;  3CRK C;  1NUC A;  1BDO A;  1KQS A;  2F3V A;  1G29 1;  1Z47 A;  3GTG B;  2EIF A;  2KBN A;  4DXG A;  3TRE A;  1E22 A;  4C3I H;  1PYW D;  1B44 D;  1EIY B;  1BF4 A;  1EYC A;  4GS3 A;  4NMZ A;  5DM6 3;  5ELN A;  3RMH A;  1L0W A;  2NWG A;  1A3T A;  4R4Q A;  2ZT9 C;  4B3M L;  1DM0 B;  2B2U A;  3NEN A;  2UUC L;  1FNV A;  2OTL A;  1TY2 A;  1VQ8 A;  1HXY D;  2ICE C;  3GTK H;  1YIJ A;  3C46 A;  1PRT D;  3ITP A;  2B63 G;  1EZ8 A;  1HJP A;  4DAY A;  2K05 A;  3BVM A;  2JA6 B;  1ET6 A;  1EWC A;  4PQX A;  4DR4 L;  1Q3L A;  2NVT H;  1XNR L;  3HOV B;  3T1Y L;  3H09 A;  2F4V Q;  3HOU H;  1XPU A;  2F0P A;  2L4N A;  2EDG A;  4JI6 Q;  1Z7T A;  3S1N B;  3RR5 A;  3HOY B;  1I4H A;  5C5M A;  4RGM A;  3EBE A;  4A3M B;  3MFY A;  3S9W A;  3DEO A;  3M85 A;  2K52 A;  4YCW A;  2PCF B;  4PMB A;  1HNZ L;  1NJI C;  1PTO B;  1N36 Q;  4CDC C;  1F2M A;  1A2U A;  2K50 A;  4H0L C;  3I4M G;  4A3L G;  3NBI A;  4FNF A;  4GN4 B;  1MJC A;  4QUC A;  3UDG A;  4R8N A;  1DCZ A;  1U4R A;  1O7I A;  4P73 A;  1NAP A;  1ILP A;  3L2P A;  5JEA J;  2B2U C;  2VS1 A;  1GUO A;  4R8I A;  1K8A C;  3NQT A;  1PH4 A;  5FLM G;  4K6D A;  4DR3 L;  3H91 A;  1HFG A;  3D3R A;  4ZKB B;  1D1K A;  2K5Q A;  2O4X A;  1A62 A;  1QZH A;  1GO3 E;  3HGB A;  3PO3 B;  1EIF A;  3IFD A;  1HUM A;  5I4D A;  2XRQ D;  3M4P A;  3VYT A;  5IGD A;  1AE3 A;  1VQP A;  4HTH A;  1CA6 A;  4OHJ A;  1X9N A;  4PV1 C;  4QY7 A;  2SEB D;  1JJ2 A;  4BBR G;  4BXX H;  1SYF A;  2IX0 A;  1SE2 A;  2JA7 H;  3M3Y B;  1F9S A;  3IL8 A;  2F4V L;  5D3I B;  5KEE A;  2WKD A;  1UE6 A;  2K04 A;  4N8F A;  2K03 A;  1KDB A;  2O5J C;  2Y0S B;  3S15 H;  2MPM A;  4RCN A;  3CCV A;  4M1U B;  4ULL A;  4B3S Q;  5J3B A;  4KD4 A;  1GVP A;  4LJZ C;  3K5M A;  2F0Q A;  1ZEQ X;  4J1M A;  2KEE A;  4LW1 A;  4TSS A;  1TVX A;  4GKJ L;  4IAL A;  3RUZ A;  3EJI A;  3I4O A;  3CAM A;  3HOX H;  3CCQ A;  1EU4 A;  2EYJ A;  5M5W H;  1K73 C;  1K3R A;  3KUP A;  1SE3 A;  1HR0 Q;  3L9A X;  3I91 A;  5T1I A;  1S3O A;  1T5X D;  3W5O A;  2M00 A;  3FRP B;  4RKL A;  1PZK D;  4AQY Q;  1TXY A;  2RDH A;  3GTK B;  1CZG A;  1IHZ A;  2VUM B;  4A3B B;  5JJL A;  2XRS D;  5J1Z A;  1LT6 D;  2BH8 A;  1K83 H;  2RVL A;  2NVT B;  1UEA B;  4G57 A;  4ZCK A;  4JI0 L;  1TS3 A;  2CH4 A;  1A0I A;  1I5F A;  4IFD H;  5J39 A;  5JVH 3;  2ATW A;  2EJG C;  1K8M A;  3TBI B;  4A93 H;  4KN4 C;  2IX3 A;  4YY3 Q;  1YBY A;  4G7Z C;  5COR A;  1PTO D;  2FIN B;  1EY0 A;  2XSC A;  3A8K E;  4B3R Q;  3P1H A;  2JA5 G;  3S2D H;  1GUT A;  3K7U C;  1CHP D;  2TSS A;  4DPG A;  4BWG B;  4HJA A;  1WTP A;  2E2H H;  4B3S L;  3KLS X;  3RLO A;  3UDF A;  1KDA A;  4DV7 Q;  3A74 A;  1AFP A;  5M3M B;  1XTC D;  4DNR B;  3QOL A;  3VR4 A;  2YYZ A;  3A54 A;  4GKK L;  3JAM E;  3ERS X;  2B2V A;  4RWS C;  1G91 A;  3KYH C;  3ULL A;  2JK8 A;  4ZQ3 A;  5IT9 c;  1QZG A;  4ZKC B;  3K5O A;  4H02 A;  3NHH A;  1CKM A;  3HKS A;  4JCV E;  1C7Y A;  3OWF A;  4PNY A;  5GAD C;  5G3L D;  5IE8 A;  5GAH C;  3NBH A;  4L5Q A;  3TP8 A;  5D14 A;  2VZA A;  2CKZ B;  1BCP C;  4IFD I;  2PQA A;  4A3I G;  2K6A A;  2L9H A;  3H15 A;  2K5W A;  3EVQ A;  1EY5 A;  3RN2 A;  4WOR A;  1Y1V G;  4NXN L;  4V19 0;  2ES2 A;  5HY6 A;  1XXG A;  2L12 A;  2JA7 B;  1F2L A;  4K2K A;  1CFM A;  1QWY A;  3ERO A;  2F03 A;  1VQG A;  1EIH A;  4YY3 L;  1IYJ B;  4P71 A;  2K28 A;  3SGI A;  5CC4 A;  1L0X B;  3S15 B;  4OO1 G;  2EY1 A;  5BR8 Q;  1YNX A;  2C9O A;  1SNQ A;  2DNE A;  3S17 B;  3KDF A;  2MHV A;  5JOB A;  2DNC A;  5CV9 A;  5JEA G;  5C0X G;  4ALP A;  1PFM A;  1YEZ A;  2B2V C;  3A8I E;  2UU9 L;  2B2T A;  1C0A A;  3MXN B;  1C8C A;  1X55 A;  4NPS A;  1STB A;  2F0F A;  2F0U A;  2EYH A;  3J80 c;  4C3J G;  3WOF A;  2FFK B;  4IPG A;  3QWN A;  5K5P A;  4BBS G;  4KD3 A;  3GTP H;  2QGQ A;  4FF4 A;  2ZJQ A;  2OCE A;  4G7O C;  2A6E D;  4B08 A;  4NW2 A;  1M8A A;  1SND A;  4RH6 A;  3NWS A;  3URY A;  1G8Z D;  4FO2 A;  1P8L A;  5IWA Q;  5JVG 3;  4Q0F A;  1HNX Q;  1D6E C;  4DV4 Q;  5EKI A;  3PIO A;  5CR3 A;  1RD9 D;  3NUC A;  3S1R B;  3KK7 A;  3NEM A;  4ZLT F;  1KAW A;  2DJG C;  2Z8L A;  4GLX A;  1EL0 A;  4UHV A;  1C48 A;  1I50 H;  1VQE A;  5LMU L;  2XGT A;  1ESF A;  1FVI A;  3RN5 A;  2XWB B;  3ND9 A;  2CCZ A;  3S2D B;  1A15 A;  1B70 B;  3K59 A;  2K5D A;  3I4M H;  4L5S A;  4A3L H;  4ZUI A;  1JOK A;  3HOW G;  4DR1 L;  4O1N A;  1UAP A;  5C4X G;  2A8V A;  3CD6 A;  1QNK A;  3R2I A;  4BA2 I;  2B2T C;  1SMX A;  4XTC S;  5I2Y A;  1JMC A;  1I6H H;  5FLM H;  2D0O A;  4OL7 A;  1IL8 A;  1QJO A;  3OWE B;  2ZM6 Q;  1J5E Q;  3MZ5 A;  1XMO Q;  2Q2H A;  4LF8 Q;  1DOL A;  3A8J E;  3A5Z B;  3M9B A;  2A6H D;  4F88 A;  3CF5 A;  3SEB A;  1CM9 A;  1GOZ A;  2R6G A;  3H3V C;  5CBA E;  1JJC B;  4V0B A;  4F8M A;  1UE7 A;  3J7A V;  4BBR H;  2WKC A;  3Q24 A;  1O78 A;  2F0V A;  2LXJ A;  3AYH B;  3W3A A;  2AHO B;  5IWA L;  5DLQ E;  3ND8 A;  1HNX L;  2PZT A;  4RFB A;  2PI2 E;  1MSH A;  5BN3 A;  5IGC A;  4DV4 L;  4GLA C;  4A3K H;  2R7Z H;  1VQM A;  3E9H A;  5IIF A;  2F0I A;  3MEF A;  3HOZ G;  4NXM Q;  4DNT B;  1PH9 A;  4JI5 Q;  2FXQ A;  3BU2 A;  5HGT A;  2SNS A;  4ID6 A;  5FO7 B;  3GD7 A;  2AWO A;  4RAU C;  3PSI A;  2QDL A;  3KJO A;  1XYI A;  4M8A A;  1OTC A;  4ODG A;  2SDF A;  5KGU A;  1Q81 C;  5IYD H;  1O7L A;  2UUA Q;  1SAP A;  5C5L A;  5AJ3 Q;  1YNJ C;  4IPC A;  4X3S A;  4HCE A;  2C35 B;  3DEP A;  3UE0 A;  1QVC A;  3AMU A;  1JCK B;  4LF4 Q;  2VQE L;  2ZXO A;  5IYC H;  4J8Q A;  1B9M A;  1SN8 A;  1IBM L;  5FJ8 G;  4QF4 A;  4YWK A;  1LTR D;  2D62 A;  2HUG A;  1IKL A;  1ILQ A;  4A3E H;  3X3N A;  2QKI C;  1B1Z A;  3M7N A;  3MAQ A;  3D6W A;  2ZM6 L;  2E5L L;  1ET9 A;  4IPH A;  4KY7 A;  1XMO L;  4LF8 L;  2K5H A;  3J7A F;  2B63 B;  3VR2 A;  1G6Z A;  5FO8 B;  2NB0 A;  4JI1 Q;  1V9P A;  4IOA A;  1IZ6 A;  4HMJ A;  4A3G H;  3SE0 A;  2N78 A;  4ME5 A;  3GTJ H;  4LWC A;  1RJT A;  4DV2 L;  2EVB A;  2BH2 A;  3GDE A;  4AIM A;  2PPB C;  1UE1 A;  2NN6 G;  2R61 A;  3DM1 A;  4K5V A;  3QB3 A;  1GUS A;  2Z4I A;  4HIO A;  4N9T A;  4GOP A;  4KK7 A;  3GV3 A;  2RQX A;  1I50 B;  4R4T A;  4I7Z C;  2A74 C;  1T9H A;  2DY8 A;  3K7A H;  1GHK A;  4B9X A;  1NSN S;  4JBM A;  2PNR C;  3K57 A;  3I4M B;  1PFN A;  2VL6 A;  3PUX A;  3G6E A;  3RD4 A;  1N34 L;  3IKJ A;  2EJF C;  3P75 A;  4LK1 C;  4C3H G;  3FKI G;  1CQV A;  3CCU A;  1W6K A;  4DR7 L;  3I73 A;  2JA6 H;  1L1O B;  3SK4 A;  1EEF D;  2GN5 A;  4LF4 L;  4CBV A;  3TP5 A;  4KJO A;  2QCP X;  1NBW A;  2B8G A;  4CJ2 C;  4LFC Q;  3GQB A;  1PRT B;  2RDG A;  3M4Y A;  1J6Q A;  2XVS A;  4CGY B;  3S1N H;  3HOY H;  2IX1 A;  1LM0 A;  4HR7 B;  3TZU A;  4A3M H;  4LFB Q;  4JI1 L;  4N8X 1;  4QGU A;  2HCI A;  3MFG A;  1H9S B;  2KHJ A;  1TQO A;  3QJY A;  4BBR B;  1Y1W H;  1WCM G;  2JA9 A;  1MKH A;  4PG3 A;  1EU3 A;  4KY6 A;  1PTO H;  1CZW A;  5K36 G;  2NVX B;  1WVL A;  4K0K Q;  4OO1 H;  1SXT A;  3I4N G;  1VQJ A;  1LYL A;  3A7L A;  4A3J G;  2RCN A;  1EFI D;  1MJE A;  3H94 A;  4DV0 L;  1XPR A;  2PMZ B;  1HZ9 A;  1TS5 A;  4OWT B;  3HKZ G;  2RF4 A;  3ULP A;  3GTQ H;  2EPB A;  1Q86 C;  5C0X H;  1G51 A;  2H5X A;  1CKN B;  2F4I A;  3FVQ A;  5IGF A;  1STY A;  3D0F A;  1LAB A;  2B39 A;  1STH A;  3F2U A;  3PO3 H;  4IPD A;  1QUQ A;  1X3E A;  3OW7 A;  2KEC A;  3GP7 A;  4TKO B;  4DR4 Q;  2GVB A;  2IW3 A;  3A0J A;  1KNA A;  2LXK A;  3S2H H;  3J7A 5;  3CCE A;  3H0G G;  5A2Q L;  4LFC L;  2KUM A;  4POF A;  2JYO A;  1S40 A;  2ZXR A;  5FLX c;  1E24 A;  2LY7 A;  2G9D A;  2LKV A;  3TSS A;  1HA5 A;  1N33 L;  3S1Q H;  2MO0 A;  2WIN B;  1C4Q A;  1VQ7 A;  1RHP A;  1KL9 A;  3DWQ A;  2A73 B;  3R3O A;  1DGS A;  2MP1 A;  2J4X A;  3GTJ B;  3ONA B;  4LFB L;  3J7Y W;  4E6I A;  1HNZ Q;  1PVO A;  4OO1 I;  1VQI A;  2WV6 D;  5IGB A;  2NYZ D;  2QEJ C;  4IQZ A;  1X3P A;  1QCB D;  1TU2 B;  2B2Y C;  4LF5 L;  5A35 A;  3TP6 A;  4KJN A;  2EE1 A;  3PUW A;  4DUZ Q;  3STB D;  5C0X I;  3KF6 B;  1N8R C;  2JA5 B;  4K0K L;  2CW0 C;  2JSO A;  5D3D A;  3HOW H;  3K7A B;  4DR3 Q;  1NMG A;  3OHX C;  3MHB A;  4CJ1 B;  2PQE A;  3DWA A;  3EQL C;  5C44 G;  2HCC A;  3TZD A;  4QL5 A;  3GO5 A;  2VUM H;  4A3B H;  1V1Q A;  1TT2 A;  3HFZ B;  1LV9 A;  1V1P A;  5KRU A;  2EYL A;  4PMW A;  3KJP A;  3NQI A;  3T4A C;  2F0T A;  3J81 c;  2R7D A;  2K5N A;  3K6O A;  2VXW A;  2WFW A;  1YJ9 A;  4CKE A;  4A3I B;  2EYM A;  1K8O A;  4IJH A;  1EZ6 A;  1M1K C;  5COY A;  1CUK A;  3NE5 B;  2F3I A;  4J6H A;  1AW7 A;  4I7A A;  3G48 A;  1AH9 A;  5E3F A;  2I5H A;  1B8A A;  2UXD Q;  5LMN W;  1WI5 A;  1LTA D;  5EPJ A;  2F0N A;  1E0B A;  1Y1W B;  4A3F G;  4FDB A;  2BOS A;  4GKJ Q;  2OWO A;  2F0S A;  1Z6H A;  3PMF A;  5M3M H;  1IYV A;  1QOH A;  2EXD A;  4A3D G;  3AFP A;  4UDU C;  2RKS A;  1PH8 A;  4DUZ L;  1BCP F;  1U4P A;  1EWH A;  4Q5V A;  3IAY A;  4B9W A;  3PCO B;  5DNF A;  4DV3 Q;  2JXM B;  1EYD A;  2WAQ G;  2F52 A;  4C56 C;  3GTQ B;  4JW0 A;  3BDO A;  5IYB G;  2K4K A;  1HQR D;  3KF8 B;  3MVV A;  4ILW A;  2NBF A;  3KBX A;  5ELB A;  3HRZ C;  2DY7 A;  1STA A;  2HQL A;  1YI2 A;  1JOQ A;  4P74 A;  4JI0 Q;  4C3J B;  4LNQ A;  2F1M A;  4BBS B;  2KJX A;  3S2H B;  2IL8 A;  3PO2 G;  3EA6 A;  1B9N A;  1T5E A;  3L0O A;  3K5N A;  4WJW A;  1LAC A;  4KN7 C;  3K0Y A;  4QIW B;  5M3F H;  4H44 C;  1TWA B;  1VQK A;  1JOR A;  2WAQ E;  3S1Q B;  2NN6 H;  4HID A;  1GUW A;  1ESR A;  4HED A;  3S16 B;  4IOC A;  1I94 Q;  3LNN A;  2UXD L;  3S17 H;  1W6J A;  5I9O A;  5J22 A;  1S72 A;  1QNU A;  5ISR A;  1JWU D;  4WJ3 M;  1Q8K A;  4LF7 L;  4GKK Q;  4BS9 A;  3TRZ A;  1SJE D;  1DJR D;  2K7V A;  1HNW Q;  3MC0 B;  1SNP A;  1U4L A;  3LWU A;  2D2C C;  4JI4 L;  1IW7 C;  2ENB A;  2A68 C;  3HOW B;  5JPM C;  2Q2I A;  4H7B A;  4MNO A;  4DV3 L;  5C4X B;  1RKN A;  3U4V A;  1RIP A;  4K8J A;  1TWG H;  4DK6 C;  3BDL A;  2HD3 A;  1VQ9 A;  3VYR A;  2BA0 A;  2CFM A;  1XTD A;  2KA7 A;  3VR5 A;  4DAY B;  2PMZ E;  1BBW A;  1FGU A;  1I4P A;  1SMY D;  4LAA A;  3GTL H;  1Y8O B;  3E3X A;  4DR5 Q;  4NXN Q;  3TN2 A;  5JPN C;  4A3C G;  1GUG A;  3MXN A;  3PIO 3;  3S24 A;  3CXC A;  2AUJ D;  3G6J B;  1R4Q B;  3S1R H;  4YWL A;  4JI7 Q;  4L63 B;  2NN6 I;  3ZJY C;  1Q82 C;  5L37 A;  5ELO A;  4MTN A;  2WB1 G;  2YTV A;  2B8F A;  2C5C A;  4JYA L;  1E2V A;  4XT1 B;  2K32 A;  3CME A;  1EUJ A;  4MZ9 A;  5K36 H;  3R8B A;  5C6A A;  1F9P A;  3VYU A;  3I4N H;  4RGO S;  2WP8 J;  2HHH Q;  3HOZ B;  1I94 L;  2JEB I;  3F2D A;  3V2T A;  2UU9 Q;  4KKU A;  4GNX B;  4OIJ A;  2I5L X;  1ENC A;  5IOD A;  1HNW L;  3DWP A;  5IY0 A;  4TVA B;  3UDI A;  3AB9 A;  4DV5 Q;  1EYA A;  5CBE E;  2FHT A;  4IUR A;  5IT9 E;  2YU9 B;  4R4O A;  5E4W C;  5KNB A;  3V05 A;  1Y8P B;  5KYL A;  1EWI A;  1IBL L;  1K8G A;  4BY7 G;  4PMC A;  2GVA A;  3P20 A;  1KAA A;  1PH3 A;  3JAM c;  2JEA I;  2SOB A;  3BVG A;  2DN8 A;  5DEH A;  3PQI A;  4KHV A;  4UY8 C;  3AQQ A;  3SHL A;  4ABN A;  1PH7 A;  1ROD A;  4HSP A;  1NE3 A;  2G5D A;  1HPC A;  3FMC A;  1GM5 A;  1O80 A;  4DR5 L;  3RZO B;  4GN5 A;  2L55 A;  4YHH L;  4JI7 L;  1EY6 A;  1PV4 A;  5LMU Q;  1SSO A;  5M3F B;  2EZV A;  2YTX A;  1WYD A;  1H9K A;  3G4S A;  3BZC A;  4DK0 A;  3DUZ A;  3GV6 A;  3CCJ A;  2K14 A;  2V4D A;  5LHY 1;  5CYU A;  2O5I C;  1TWF B;  4DN4 M;  4Y52 H;  4DR1 Q;  4O42 A;  3SK6 A;  5IP7 G;  3FEW X;  1EOV A;  3EFX D;  1EY7 A;  1SDF A;  3O13 A;  3VDY A;  1LTL A;  2HHH L;  1EQV A;  2D5D A;  2AWN A;  2EQS A;  2F0J A;  4JI2 L;  3KLS A;  1FJG Q;  2KCM A;  2Q8T A;  1LTI D;  2NZH A;  2ZTE A;  3HS0 C;  4EQP A;  1X32 A;  2NVQ H;  5JJK A;  1CSP A;  4ZRZ A;  1MSG A;  5EPK A;  3GTO B;  3H6M A;  4AH6 A;  2A1A A;  4C3H B;  3FKI B;  5C44 H;  1NNX A;  2XNA C;  4DV5 L;  3I56 A;  1SYE A;  2B63 H;  4C2M H;  1TWG B;  1E1O A;  2JE6 I;  1SR3 A;  5ELE A;  1JE5 A;  5LMN L;  4IUV A;  4MTK A;  3GTM B;  1D7Q A;  3FDT A;  1CSQ A;  4IUP A;  1CQF A;  2ZTC A;  3GTL B;  1ASZ A;  4PZ6 A;  3PV0 A;  4K5X A;  5C3X A;  1EFW A;  1PFB A;  4C1N I;  5C3E G;  4L5R C;  4LUO A;  2K1B A;  3MXP A;  4ZK9 B;  2VNU D;  1HFN A;  2EYF A;  1MD2 D;  5IT9 L;  2PW7 A;  2R3Z A;  5IP9 G;  3LX0 A;  1EIG A;  4U67 3;  1XNQ Q;  3S1M H;  3N52 A;  3D6C A;  1GHJ A;  1WCM B;  4A3F H;  1J9O A;  2IT1 A;  3Q23 A;  1KRT A;  5IGE A;  1DOM A;  1PH6 A;  4B3T L;  3I4L A;  1NR4 A;  3OMG A;  4QIW E;  4ZYS A;  2BDN A;  3I4N B;  4IFD J;  1HQM C;  2H1E A;  2VQF L;  2K01 A;  4A3J B;  3T16 A;  3KBG A;  2VQE Q;  1QG7 A;  1IBM Q;  3HKZ B;  1KHI A;  4K6L A;  5LL6 X;  2NZ1 D;  1KDC A;  3I72 A;  1MI2 A;  1AN8 A;  1STE A;  4C3I G;  4DV6 Q;  1FJG L;  4X66 Q;  3K58 A;  1SE4 A;  3ERQ A;  2E5L Q;  3MWY W;  1UNS A;  2IY5 B;  4JK1 C;  1G2S A;  1DZ1 A;  3J81 i;  4DR6 L;  3J81 j;  1IBK L;  4X6A H;  2ASB A;  5EJW A;  2XN9 C;  1E2Z A;  2DJF C;  2LSS A;  4A4I A;  1I4X A;  3TME A;  1ZYR C;  1L1O A;  4DV2 Q;  1AEX A;  1HRJ A;  3NXW A;  1CT1 D;  3H0G B;  1D5X C;  4GN3 B;  1I4G A;  1SRO A;  4JOI A;  1M90 C;  2NVX H;  4DA2 A;  4LF9 L;  5E1F A;  1RF2 D;  1UUP A;  2F0E A;  2CH4 W;  4MHE A;  3J80 L;  4GLV B;  2J0T D;  5NUC A;  1PYB A;  3HOU G;  1XNQ L;  2VB2 X;  4OGQ C;  4X62 Q;  4EX5 A;  4RCO A;  1H9S A;  1N34 Q;  4KHZ A;  1D8L A;  3KFU A;  3KDF B;  1VS0 A;  2CQO A;  3PIP 3;  1YNN C;  2QW7 A;  1B2T A;  2K75 A;  1ZKO A;  4DR7 Q;  2VB3 X;  1A2T A;  2BE5 C;  3E9I A;  3Q6S A;  4HJ9 A;  2IHE A;  1VMC A;  4XYQ A;  1JWS D;  1DXM A;  3N6R A;  4RGN A;  1FL0 A;  3D4D A;  2N49 A;  1VQB A;  3CKI B;  4JVZ A;  2NVQ B;  4OEL B;  4DV6 L;  4X66 L;  1EQR A;  3T56 B;  1BCP D;  1CKN A;  1FNU A;  3SR1 A;  3HEJ A;  5C44 B;  4O2D A;  1TWC B;  2I0Q A;  4C2M B;  1WJJ A;  4KY5 A;  3E0J A;  3PUY A;  5EBD A;  4A3C H;  5C4H A;  5BN4 A;  1Z9F A;  1KLU D;  2KOL A;  1KXL A;  1WD1 A;  5IOC A;  5EQ0 A;  2J7Z A;  5I6Y A;  5E4X A;  1OO9 B;  4XXE A;  3K81 C;  4CDD C;  4JOI C;  1PXU A;  3BZD B;  1TS4 A;  2EXZ A;  1K9M C;  1I4Q A;  4PZ7 A;  1FD7 D;  1WTV A;  1PTO F;  4I65 A;  1WTO A;  3KLR A;  5T1G A;  1ICW A;  2JA5 H;  4HAE A;  4DV0 Q;  1HHV A;  4P2C B;  2Z9H A;  1BR9 A;  4BXX G;  3S1M B;  2KHI A;  1CKO A;  1KIX A;  3M4Q A;  1PMR A;  3F2C A;  4A3F B;  2KHS A;  2E8G A;  1HCZ A;  5A2Q E;  1S5F D;  4X62 L;  4DR2 Q;  2EYP A;  3W2D A;  2ZXP A;  4A3D B;  4H13 C;  1EY9 A;  3S14 B;  2E2J H;  3KF6 A;  1WTW A;  2WAQ B;  1E2W A;  3OIQ A;  3TEH B;  4FF2 A;  1CK1 A;  2Q2T A;  2QA4 A;  1LT4 D;  4KTA A;  4R1J A;  5G3L F;  3UE1 A;  3HOX G;  4BY7 H;  1LTB D;  1D2B A;  4QUF A;  4CKB A;  1TWH H;  1SNO A;  1BVS A;  1PZJ D;  1N33 Q;  3W1G A;  2MGS A;  4A3I H;  4MIU A;  1AE2 A;  2EY2 A;  5HGQ A;  2OT2 A;  1Y1V H;  4JBK A;  3OW2 A;  1CTM A;  1Q46 A;  3G7L A;  3PO2 B;  4LF5 Q;  3EIV A;  2BA1 A;  4U68 A;  1IKM A;  4GOP C;  1TII D;  4YWM A;  3W1B A;  5M5X B;  2UXC Q;  1I6V C;  1OXT A;  2F0D A;  4NB3 A;  4KKS A;  2FJ2 A;  2RDF A;  3OPO A;  1HZC A;  4A93 G;  3WOE A;  2JQO A;  1VMP A;  3SK5 A;  4Y7N B;  1Q1B A;  5JEA H;  3PGZ A;  4XIG S;  4A75 A;  2HDL A;  1X6O A;  3C3L A;  1BBU A;  4DR2 L;  2GA4 B;  1XMQ Q;  3Q0A A;  1D5Z C;  5CV8 A;  2HDM A;  5CGK A;  1YHA A;  1GXD C;  2RA4 A;  1JJG A;  2MUY A;  4CHT B;  4C3J H;  3JAM i;  2OF1 A;  4BBS H;  2UXB L;  5E7N A;  2KED A;  1N32 Q;  1S5E D;  1BXT A;  3F1Z A;  4FXK C;  1ZYR D;  1VF5 C;  1B50 A;  1Q8I A;  1TWA H;  2Q8R E;  3ZYY X;  4JBW A;  1SYG A;  4HN7 A;  3HKZ E;  5FLX E;  4DV1 Q;  3QO2 A;  2VY3 A;  3D4W A;  1HH2 P;  2N8N A;  2EY5 A;  5DM7 3;  4HJ8 A;  4QCL A;  4UP7 A;  3KLW A;  3FHW A;  5C3E H;  4TRD A;  3S16 H;  4IUT A;  5IP9 H;  2QIL A;  3SVM A;  2AQ1 B;  4A76 A;  4CDF C;  2WB1 B;  4K5W A;  1RCV D;  4BY1 G;  5I6W A;  1HR0 W;  3DM3 A;  2X6G A;  3X3M A;  1PHJ A;  4IN3 A;  2UXC L;  1SFO B;  1YNN D;  4FVM A;  5FOB B;  4KV6 A;  1ONL A;  1K28 A;  3PF4 A;  1NMF A;  2H4O A;  1YNJ D;  1LTS D;  4DKA C;  4YCV A;  5C4X H;  4CKC A;  5KYI A;  2O2L D;  2JA8 G;  3T51 B;  1F2Z A;  1PTO C;  1R4P B;  1U4M A;  3J80 i;  2Q8I B;  4AYB G;  2E75 C;  1B3Q A;  4Z9C B;  3CHB D;  3NTI A;  1YZ6 A;  2KEN A;  2Z4H A;  1NCV A;  1XMQ L;  1KC8 C;  2E2I H;  2E2J B;  2OXP A;  4O0A A;  3Q22 A;  1B4O A;  2OQ0 A;  1RDP D;  5CV6 A;  1OXV A;  3MEH A;  3MXG A;  1I3Q B;  1VQ6 A;  1WD0 A;  3L7Z C;  1VQF A;  3QOJ A;  3CCR A;  2R93 G;  1YIT A;  5M5Y B;  1HUN A;  1PLF A;  3P7J A;  1UWV A;  3TS2 A;  4BY7 B;  2R92 G;  5GRO A;  4OXP A;  3RZD B;  1N32 L;  1TWH B;  2D9U A;  4EGV A;  3J81 E;  4X3T A;  3FPU B;  2L15 A;  2PI2 A;  3I2Z A;  1LLR D;  4DV1 L;  4HSV A;  3K8A A;  1B7Y B;  4X65 Q;  1J8I A;  1Y1V B;  1AZP A;  3L3O C;  1OXU A;  5CV7 A;  4AYB E;  2EYO A;  1JB7 A;  3DMU A;  1PH2 A;  5ELF A;  1PFS A;  2MFI A;  1WTH A;  3E6Z X;  3VA7 A;  3IFT A;  3HOZ H;  4OX9 L;  5IGG A;  3I90 A;  4IZ8 A;  4LF7 Q;  1F77 A;  1ML0 D;  2RSO A;  3CC2 A;  1G2T A;  4JPB W;  2B3G A;  2A5H A;  2L11 A;  4X64 L;  5FLX L;  4JI4 Q;  2ICI A;  1TY0 A;  2HQE A;  4JI8 Q;  1GJX A;  1DOK A;  5CV4 A;  1H95 A;  2UUB Q;  1PDQ A;  3NPP A;  1SJH D;  2YU9 H;  1SLJ A;  2F0H A;  4DF7 A;  3T1H L;  2ALY B;  2NTS A;  1JIC A;  2PNH A;  3OTO L;  5GAE C;  1OXS C;  1Q90 A;  1QUQ B;  3E5S A;  3CPF A;  3OYY A;  5FJ8 H;  1GKH A;  1VQL A;  5H1S E;  2D0P A;  1V8Q A;  5C4J B;  1W3S A;  1X65 A;  1V43 A;  4EQO A;  3K5L A;  1U0L A;  4GNX A;  4K8I A;  5JJZ A;  1Q7Y C;  1K0R A;  5C0X J;  3RZO H;  2AUK A;  2A19 A;  1OXX K;  3DHQ A;  2A69 C;  4FF3 A;  4JYA Q;  1JB3 A;  1JT8 A;  1II3 A;  2Z1C A;  2NVY H;  4DXF A;  3DXJ C;  4NKL A;  4CJ0 B;  1TWF H;  4HJ5 A;  5C3E B;  2IJ0 A;  4KKT A;  5BN5 A;  4X65 L;  2X69 A;  5KIX A;  2BCO A;  2A6E C;  1HTL D;  3VR3 A;  4POG A;  1RTO A;  1O7Y A;  1MGS A;  1H9J A;  1X54 A;  5FK9 C;  3J81 L;  4JI6 L;  4A3K G;  2R7Z G;  1R9T B;  3BVZ A;  4YIJ A;  3VYS A;  4WJ4 A;  4OEM B;  1ENA A;  1TS2 A;  3GTO H;  1YVC A;  4C3H H;  3FKI H;  1IBL Q;  4JI8 L;  3CQZ H;  4JV5 Q;  2UUB L;  1LT3 D;  2K33 A;  2RSN A;  1STN A;  3R2T A;  3NSW A;  3PUZ A;  4HJ7 A;  1N36 L;  4C3I B;  3GTM H;  3BDC A;  1RL2 A;  4GNX C;  1HZB A;  5IYD G;  1MBY A;  2E2I B;  4DU9 A;  4DAP A;  3CCL A;  3TDQ A;  1ZXT A;  3NK9 A;  1V1P B;  3LGJ A;  5EAY A;  4DUY Q;  2R7F A;  3PF5 A;  1F2Y A;  5IYC G;  4YHH Q;  4RGT A;  1K0S A;  2XIW A;  1BOS A;  3CP0 A;  5F2D A;  5ELD A;  4A3E G;  2FMC A;  4FXG C;  2CWP A;  4KLK A;  2Q2U A;  1WCM H;  3M7G A;  2HIX A;  3QR8 A;  4UP8 A;  1IXR A;  2Z6K A;  2A6H C;  2AKW B;  4A3G G;  1WTR A;  3U4Z A;  4FF1 A;  2CW0 D;  1Q12 A;  3I3C A;  3I8Z A;  1ASY A;  4A3J H;  3HOU B;  4JI2 Q;  1SYB A;  4HCS A;  2ID0 A;  4APV A;  1AZQ A;  1Y14 B;  1YJW A;  4DK1 A;  3AU7 A;  3J7Z C;  1S5D D;  3WWV A;  3KOJ A;  1TKW B;  3K80 C;  1KLG D;  3C2P A;  1F9R A;  1SYC A;  2N55 A;  2ZJP A;  3HG9 A;  3RLF A;  2PZW A;  2PYK A;  2WB1 E;  5C4Z A;  1G6P A;  4LF6 Q;  2RHQ B;  1XWE A;  4WRD A;  1SNC A;  1H9R A;  4XQN A;  4OIK A;  1XPO A;  1VQC A;  5LMN Q;  4JV5 L;  3ICE A;  1X3F A;  3BYT B;  2OQK A;  4NDX A;  2MQH A;  3QG1 A;  3RLN A;  3H0G H;  1A3V A;  2JA6 G;  4P72 A;  3A55 A;  1HR0 L;  4K14 A;  4DUY L;  3HOV G;  3CPW A;  3CC4 A;  4TQU S;  3WDN A;  1IYU A;  4IUU A;  4AQY L;  1BBX C;  1A63 A;  3C1F A;  2G9H D;  3T13 A;  2Z0S A;  2Z6K C;  2NVY B;  4HIK A;  3HOY G;  1AP0 A;  1STG A;  2SNM A;  4B3T Q;  1CHQ D;  1KNE A;  1EEI D;  3ULJ A;  4RG1 A;  3U50 C;  4A3M G;  2I07 B;  1GUN A;  2PZU A;  4BY1 H;  2VQF Q;  2OEO A;  2RBM A;  3LWE A;  1PH5 A;  1Y1W G;  1B3A A;  3MA2 B;  1PH1 A;  2V1C C;  1LT5 D;  3U9O A;  2EY6 A;  3SDZ A;  2RCF A;  3QIA A;  3CC7 A;  2JA8 H;  2KQ3 A;  4NP5 A;  4G4K A;  2N88 A;  2QF7 A;  4B3R L;  4FYD A;  2L1B A;  3U9S A;  1PRT F;  4DR6 Q;  3BG3 A;  3J80 E;  1IBK Q;  1TWC H;  5JJI A;  3CQZ B;  4G7H C;  4OWX B;  3JC6 6;  3BZK A;  1NY4 A;  5TSS A;  4LF6 L;  3H3V H;  5GQO A;  2CVR A;  2QDB A;  4DV7 L;  1VDZ A;  2R93 H;  4CDE C;  5HUR A;  3PO3 G;  1BCP B;  3NEL A;  4HMI A;  3HOX B;  1VQD A;  3Q8D A;  5M5W B;  2A69 D;  3D4R A;  2R92 H;  5I2X A;  2PW5 A;  2L5T A;  1X3G A;  1NR2 A;  4LF9 Q;  2WAC A;  4ME3 A;  1JE4 A;  1O7Z A;  4ZUJ A;  5EPL A;  2BDO A;  4OWW B;  1WFQ A;  4BA1 I;  2JJQ A;  4QJF A;  1DON A;  1UEB A;  1XX8 A;  1HZA A;  5EKL A;  2B2W A;  2KCC A;  4XYO A;  1SNM A;  3M4O H;  2KCT A;  1XJV A;  2MNA A;  2IWH A;  2Y0S G;  2KCN A;  3FP9 A;  4XDX A;  3JAM L;  2CHB D;  2OTJ A;  2F0G A;  1U5K A;  2F0L A;  2NTT A;  1BKB A;  1EQT A;  4A3D H;  4L6T B;  1WOC A;  1K83 B;  2MO1 A;  4DFA A;  1SE8 A;  1FYC A;  3S14 H;  1QE6 A;  1IW7 D;  4ZAI A;  1Q1E A;  2A68 D;  1VQH A;  1YJN A;  4A93 B;  1ICF B;  1K3B C;  1ENF A;  3I7F A;  1A3U A;  5IYB H;  2E2D C;  1CA5 A;  3H3V I;  4DAV A;  1Y69 U;  1EOT A;  4IUN A;  4X3K A;  5BR8 L;  3F2B A;  2E2H B;  3NBH B;  4XT3 B;  2Y0S E;  4JBJ A;  5ELC A;  2LS0 1;  4QB4 A;  3DLL A;  2PQA B;  3CW2 C;  3SK8 A;  3UDX A;  3EN2 A;  4LUZ A;  2E76 C;  2JP1 A;  5EBC A;  3SXH A;  4K2L A;  4R4C A;  3PO2 H;  3NWT A;  3BS1 A;  2TMP A;  1JR0 D;  4DGZ A;  2VUM G;  1BUV T;  4A3B G;  1LTT D;  5M5X H;  4N9P A;  4P75 A;  4MN3 A;  1NTG A;  4J15 A;  3BJU A;  2EJM A;  1P16 A;  4JC0 A;  5I9P A;  2B2W C;  2B29 A;  1JQY D;  3PUV A;  1E7Z A;  1IL2 A;  3I70 A;  4Y7N H;  1L2F A;  1GD7 A;  1RTN A;  3AFQ A;  3NTK A;  1H9M A;  2I46 A;  3V96 A;  5CV5 A;  1Y8N B;  4BY1 B;  3U58 A;  3HP3 A;  1SBB B;  1JOO A;  2RHS B;  2IHF A;  1SRU A;  2AQ2 B;  2YV5 A;  4PZ8 A;  5EGT A;  4WFN 3;  2ZJR A;  2DUD A;  1M4V A;  5CMD A;  4DK3 C;  4QMG A;  3C1E A;  5M3M G;  2CQA A;  1HTP A;  2JA8 B;  1EY4 A;  4DAM A;  2M2L A;  2ZTD A;  1E3P A;  1LUZ A;  4AYB B;  3D31 A;  1N9W A;  4XQJ A;  1W2B A;  3STB C;  2LMC B;  3CMA A;  3FPP A;  4LFA Q;  2AQ3 B;  2X6L A;  4YCU A;  3T53 B;  4RKB A;  1FGB D;  1L1O C;  1S5B D;  3RNU A;  3BYY B;  4RA8 A;  4S3S A;  4EQN A;  2R93 B;  3NTH A;  1VF7 A;  2R92 B;  4RHS A;  1UE5 A;  1SYD A;  1PRT C;  3I55 A;  3B6Y A;  1MHW C;  5KNC A;  1J5E L;  2QEX A;  2F3W A;  3A7A B;  2K5V A;  1I4R A;  2F0K A;  1JWM D;  1SFO H;  3GTP B;  1QVG A;  2JA7 G;  1B53 A;  1YHB A;  1VQ5 A;  5M3F G;  2JN4 A;  5M9O A;  4IUQ A;  5DAU A;  1LTG D;  1QB5 D;  3M4O B;  1KAB A;  2IPK D;  1KD1 C;  4EQ5 A;  4FXD A;  3MXU A;  3GTG H;  2XWJ B;  3VR6 A;  5FO9 B;  3AEV A;  2AMC B;  5GAG C;  1BQQ T;  2XTI A;  1A6X A;  2UXB Q;  3A5U A;  1WTX A;  1LO5 D;  2VW9 A;  4GZY C;  4NXM L;  2YTY A;  1I3Q H;  5M5Y H;  3OMC A;  4QQB X;  2F0M A;  2P5Z X;  4JI5 L;  1KRS A;  4KHP Q;  1DD2 A;  5JAV A;  1HA6 A;  3A56 A;  2I5M X;  1S5C D;  2MJ8 A;  2WII B;  3D8G A;  1VQN A;  3RZD H;  1FR3 A;  1QIL A;  1D5M C;  1VQ4 A;  1QVF A;  1PA6 A;  4F7X A;  4LFA L;  2UUA L;  5C3W A;  2N3S A;  4XQQ A;  5AJ3 L;  3HZX A; 
#chains in the Genus database with same CATH homology
 1F9Q A;  1I6H B;  3NP8 A;  2L0C A;  1X3Q A;  5KND A;  2F0W A;  5FKA C;  4IFD G;  3MTS A;  5AFW A;  2NUC A;  5D65 A;  1PZI D;  1S4Z A;  3OOC A;  4UAI A;  2B2Y A;  4A3K B;  2R7Z B;  2KVM A;  3TP7 A;  1WTQ A;  4RHR A;  1U9R A;  3UI2 A;  3VA5 A;  2PO4 A;  1BNZ A;  1CI3 M;  4R9W A;  2EOT A;  4EVO A;  1EY8 A;  3KF8 A;  4X3U A;  1D1I A;  3OSO A;  4L8J A;  5EKK A;  4LMQ D;  4C1N K;  4F87 A;  1SEB D;  2E74 C;  4KMU C;  3OIP A;  4FP5 D;  1DYQ A;  4A3E B;  1KTK A;  2F0O A;  1JC7 A;  3CU7 A;  2FMM A;  1SMY C;  3R93 A;  1TR5 A;  1V1O A;  2LFN A;  1VCI A;  4A3G B;  1L0Y B;  4KI0 A;  2BE5 D;  3CRL C;  2M9V A;  5LL6 S;  1FNW A;  1BO0 A;  3CRK C;  1NUC A;  1BDO A;  2F3V A;  1G29 1;  1Z47 A;  3GTG B;  4DXG A;  1PYW D;  1B44 D;  1BF4 A;  1EYC A;  4NMZ A;  5DM6 3;  3RMH A;  2NWG A;  1A3T A;  2ZT9 C;  1DM0 B;  2B2U A;  1FNV A;  1TY2 A;  1HXY D;  2ICE C;  3C46 A;  1PRT D;  3ITP A;  1EZ8 A;  4DAY A;  2K05 A;  3BVM A;  2JA6 B;  1ET6 A;  1EWC A;  4PQX A;  1Q3L A;  3HOV B;  3H09 A;  2F0P A;  2L4N A;  2EDG A;  1Z7T A;  3S1N B;  3HOY B;  1I4H A;  5C5M A;  4RGM A;  4A3M B;  3MFY A;  3S9W A;  3DEO A;  3M85 A;  2PCF B;  4PMB A;  1PTO B;  1F2M A;  1A2U A;  4H0L C;  3NBI A;  4FNF A;  4QUC A;  4R8N A;  1DCZ A;  1U4R A;  1NAP A;  1ILP A;  5JEA J;  2B2U C;  1GUO A;  4R8I A;  3NQT A;  4K6D A;  3H91 A;  1HFG A;  3D3R A;  4ZKB B;  1D1K A;  2K5Q A;  2O4X A;  3HGB A;  3PO3 B;  3IFD A;  1HUM A;  5I4D A;  2XRQ D;  3VYT A;  5IGD A;  4HTH A;  1CA6 A;  4OHJ A;  4PV1 C;  2SEB D;  1SYF A;  2IX0 A;  1SE2 A;  3M3Y B;  1F9S A;  3IL8 A;  5D3I B;  5KEE A;  2WKD A;  2K04 A;  2K03 A;  1KDB A;  2O5J C;  2Y0S B;  2MPM A;  4RCN A;  4M1U B;  4ULL A;  4KD4 A;  3K5M A;  4LJZ C;  2F0Q A;  1ZEQ X;  4J1M A;  2KEE A;  4TSS A;  1TVX A;  4IAL A;  3RUZ A;  3EJI A;  1EU4 A;  2EYJ A;  3KUP A;  1SE3 A;  3L9A X;  3I91 A;  5T1I A;  1T5X D;  2M00 A;  3FRP B;  4RKL A;  1PZK D;  2RDH A;  3GTK B;  1CZG A;  1IHZ A;  2VUM B;  4A3B B;  2XRS D;  5J1Z A;  1LT6 D;  2RVL A;  2NVT B;  1UEA B;  4G57 A;  1TS3 A;  4IFD H;  5J39 A;  5JVH 3;  2EJG C;  1K8M A;  3TBI B;  4KN4 C;  2IX3 A;  4G7Z C;  5COR A;  1PTO D;  2FIN B;  1EY0 A;  2XSC A;  3A8K E;  3P1H A;  1GUT A;  1CHP D;  2TSS A;  4BWG B;  1WTP A;  3KLS X;  1KDA A;  1AFP A;  5M3M B;  1XTC D;  4DNR B;  3QOL A;  3VR4 A;  2YYZ A;  3A54 A;  3JAM E;  2B2V A;  4RWS C;  1G91 A;  4ZQ3 A;  4ZKC B;  3K5O A;  3NHH A;  3OWF A;  4PNY A;  5G3L D;  3NBH A;  3TP8 A;  5D14 A;  1BCP C;  4IFD I;  2K6A A;  2L9H A;  2K5W A;  3EVQ A;  1EY5 A;  4WOR A;  4V19 0;  1XXG A;  2L12 A;  2JA7 B;  1F2L A;  4K2K A;  1CFM A;  1QWY A;  3ERO A;  2F03 A;  1EIH A;  2K28 A;  3S15 B;  5CC4 A;  1L0X B;  4OO1 G;  2EY1 A;  2C9O A;  1SNQ A;  2DNE A;  3S17 B;  2MHV A;  5JOB A;  2DNC A;  5CV9 A;  5JEA G;  5C0X G;  1PFM A;  2B2V C;  3A8I E;  2B2T A;  1C8C A;  1STB A;  2F0F A;  2F0U A;  2EYH A;  4C3J G;  3WOF A;  2FFK B;  3QWN A;  5K5P A;  4KD3 A;  4FF4 A;  4G7O C;  4B08 A;  2A6E D;  4NW2 A;  1M8A A;  1SND A;  4RH6 A;  3URY A;  3NWS A;  1G8Z D;  4FO2 A;  5JVG 3;  4Q0F A;  1D6E C;  5EKI A;  5CR3 A;  1RD9 D;  3NUC A;  3S1R B;  3KK7 A;  4ZLT F;  2Z8L A;  1EL0 A;  1C48 A;  1ESF A;  2XWB B;  3ND9 A;  3S2D B;  1A15 A;  3K59 A;  2K5D A;  4ZUI A;  1JOK A;  4O1N A;  1UAP A;  1QNK A;  3R2I A;  4BA2 I;  2B2T C;  4XTC S;  5I2Y A;  4OL7 A;  1IL8 A;  1QJO A;  3OWE B;  3MZ5 A;  1DOL A;  3A8J E;  2A6H D;  4F88 A;  3SEB A;  1CM9 A;  1GOZ A;  2R6G A;  3H3V C;  5CBA E;  4V0B A;  4F8M A;  3J7A V;  2WKC A;  3Q24 A;  1O78 A;  2F0V A;  3W3A A;  3ND8 A;  2PZT A;  4RFB A;  5IGC A;  1MSH A;  5BN3 A;  5IIF A;  2F0I A;  4DNT B;  5HGT A;  2SNS A;  4ID6 A;  5FO7 B;  3GD7 A;  2AWO A;  4RAU C;  1XYI A;  4M8A A;  4ODG A;  2SDF A;  5KGU A;  1O7L A;  1SAP A;  5C5L A;  1YNJ C;  4X3S A;  4HCE A;  3DEP A;  3AMU A;  1JCK B;  2ZXO A;  4J8Q A;  1B9M A;  4QF4 A;  1LTR D;  2D62 A;  2HUG A;  1IKL A;  1ILQ A;  3X3N A;  2QKI C;  1B1Z A;  3M7N A;  3MAQ A;  3D6W A;  1ET9 A;  4KY7 A;  3J7A F;  2B63 B;  3VR2 A;  1G6Z A;  5FO8 B;  2NB0 A;  4HMJ A;  3SE0 A;  4ME5 A;  1RJT A;  2EVB A;  2PPB C;  2R61 A;  2NN6 G;  3DM1 A;  4K5V A;  3QB3 A;  1GUS A;  2Z4I A;  4N9T A;  4KK7 A;  3GV3 A;  2RQX A;  1I50 B;  4I7Z C;  2A74 C;  2DY8 A;  1GHK A;  4B9X A;  1NSN S;  2PNR C;  3K57 A;  3I4M B;  1PFN A;  3PUX A;  3RD4 A;  3IKJ A;  2EJF C;  3P75 A;  4LK1 C;  4C3H G;  1CQV A;  1W6K A;  3I73 A;  3SK4 A;  1EEF D;  4CBV A;  3TP5 A;  4KJO A;  2QCP X;  4CJ2 C;  2B8G A;  3GQB A;  1PRT B;  2RDG A;  3M4Y A;  4CGY B;  2XVS A;  2IX1 A;  4HR7 B;  3TZU A;  2HCI A;  3MFG A;  1H9S B;  1TQO A;  3QJY A;  4BBR B;  1EU3 A;  4KY6 A;  1PTO H;  1CZW A;  5K36 G;  2NVX B;  1WVL A;  4OO1 H;  1SXT A;  3A7L A;  1EFI D;  3H94 A;  2PMZ B;  1TS5 A;  2EPB A;  5C0X H;  2F4I A;  3FVQ A;  5IGF A;  1STY A;  1LAB A;  2B39 A;  1STH A;  3F2U A;  3OW7 A;  2KEC A;  3GP7 A;  4TKO B;  2IW3 A;  1KNA A;  5A2Q L;  2KUM A;  2JYO A;  2ZXR A;  2LY7 A;  2G9D A;  2LKV A;  3TSS A;  1HA5 A;  2WIN B;  1C4Q A;  1RHP A;  3DWQ A;  2A73 B;  3R3O A;  2MP1 A;  2J4X A;  3GTJ B;  3ONA B;  3J7Y W;  4E6I A;  4OO1 I;  2WV6 D;  5IGB A;  2NYZ D;  2QEJ C;  4IQZ A;  1X3P A;  1QCB D;  1TU2 B;  2B2Y C;  5A35 A;  3TP6 A;  4KJN A;  2EE1 A;  3PUW A;  5C0X I;  2JA5 B;  2CW0 C;  2JSO A;  5D3D A;  3K7A B;  3OHX C;  3MHB A;  4CJ1 B;  2PQE A;  3DWA A;  3EQL C;  2HCC A;  3TZD A;  3GO5 A;  1TT2 A;  1LV9 A;  1V1P A;  5KRU A;  2EYL A;  4PMW A;  3NQI A;  3T4A C;  2F0T A;  3K6O A;  2VXW A;  4CKE A;  4A3I B;  2EYM A;  1K8O A;  1EZ6 A;  5COY A;  3NE5 B;  4J6H A;  1AW7 A;  5E3F A;  1LTA D;  5EPJ A;  2F0N A;  1E0B A;  1Y1W B;  2BOS A;  2F0S A;  1Z6H A;  3PMF A;  1IYV A;  1QOH A;  4UDU C;  2RKS A;  1BCP F;  1U4P A;  1EWH A;  4Q5V A;  3IAY A;  4B9W A;  5DNF A;  2JXM B;  1EYD A;  4C56 C;  3GTQ B;  3BDO A;  1HQR D;  3MVV A;  4ILW A;  2NBF A;  3KBX A;  5ELB A;  3HRZ C;  2DY7 A;  1STA A;  1JOQ A;  4C3J B;  2F1M A;  4BBS B;  2KJX A;  3S2H B;  2IL8 A;  3EA6 A;  1B9N A;  1T5E A;  3K5N A;  4WJW A;  1LAC A;  4KN7 C;  3K0Y A;  4QIW B;  4H44 C;  1TWA B;  1JOR A;  3S1Q B;  2NN6 H;  1GUW A;  1ESR A;  4HED A;  3S16 B;  3LNN A;  1W6J A;  5I9O A;  5J22 A;  1QNU A;  5ISR A;  1JWU D;  4BS9 A;  1SJE D;  1DJR D;  2K7V A;  3MC0 B;  1SNP A;  1U4L A;  3LWU A;  2D2C C;  1IW7 C;  2ENB A;  2A68 C;  3HOW B;  5JPM C;  4H7B A;  5C4X B;  1RKN A;  4K8J A;  3BDL A;  3VYR A;  2BA0 A;  2KA7 A;  3VR5 A;  1I4P A;  1SMY D;  4LAA A;  1Y8O B;  3TN2 A;  5JPN C;  1GUG A;  3MXN A;  3PIO 3;  2AUJ D;  3G6J B;  1R4Q B;  4L63 B;  2NN6 I;  2B8F A;  2C5C A;  1E2V A;  4XT1 B;  2K32 A;  5K36 H;  3R8B A;  5C6A A;  1F9P A;  3VYU A;  4RGO S;  2WP8 J;  3HOZ B;  2JEB I;  3V2T A;  4KKU A;  4OIJ A;  5IOD A;  1ENC A;  3DWP A;  3AB9 A;  1EYA A;  5CBE E;  2FHT A;  4IUR A;  5IT9 E;  2YU9 B;  5E4W C;  5KNB A;  3V05 A;  1Y8P B;  5KYL A;  4PMC A;  3P20 A;  1KAA A;  2JEA I;  2SOB A;  3BVG A;  2DN8 A;  5DEH A;  4KHV A;  3SHL A;  4ABN A;  1ROD A;  4HSP A;  1HPC A;  3FMC A;  1O80 A;  3RZO B;  2L55 A;  1EY6 A;  1SSO A;  5M3F B;  2EZV A;  1H9K A;  4DK0 A;  3DUZ A;  3GV6 A;  2V4D A;  5LHY 1;  5CYU A;  2O5I C;  1TWF B;  4DN4 M;  4O42 A;  3SK6 A;  3FEW X;  3EFX D;  1EY7 A;  1SDF A;  3O13 A;  1EQV A;  2D5D A;  2AWN A;  2F0J A;  3KLS A;  2Q8T A;  1LTI D;  3HS0 C;  4EQP A;  1X32 A;  4ZRZ A;  1MSG A;  5EPK A;  3GTO B;  3H6M A;  4C3H B;  3FKI B;  2XNA C;  1SYE A;  1TWG B;  2JE6 I;  5ELE A;  4IUV A;  3GTM B;  3FDT A;  4IUP A;  1CQF A;  3GTL B;  3PV0 A;  4K5X A;  5C3X A;  1PFB A;  4C1N I;  1HFN A;  2K1B A;  3MXP A;  4ZK9 B;  2VNU D;  2EYF A;  1MD2 D;  5IT9 L;  2PW7 A;  2R3Z A;  3LX0 A;  1EIG A;  4U67 3;  3N52 A;  3D6C A;  1GHJ A;  1WCM B;  1J9O A;  2IT1 A;  3Q23 A;  5IGE A;  1DOM A;  3I4L A;  1NR4 A;  3OMG A;  4ZYS A;  2BDN A;  3I4N B;  4IFD J;  1HQM C;  2H1E A;  2K01 A;  4A3J B;  3T16 A;  3KBG A;  1QG7 A;  3HKZ B;  4K6L A;  5LL6 X;  2NZ1 D;  1KDC A;  3I72 A;  1MI2 A;  1AN8 A;  1STE A;  4C3I G;  3K58 A;  1SE4 A;  3ERQ A;  3MWY W;  1UNS A;  4JK1 C;  1G2S A;  1DZ1 A;  5EJW A;  2XN9 C;  1E2Z A;  1I4X A;  3TME A;  1ZYR C;  1AEX A;  1HRJ A;  3NXW A;  1CT1 D;  3H0G B;  1D5X C;  1I4G A;  4DA2 A;  5E1F A;  1RF2 D;  1UUP A;  2F0E A;  4MHE A;  3J80 L;  2J0T D;  5NUC A;  2VB2 X;  4OGQ C;  4RCO A;  1H9S A;  4KHZ A;  3PIP 3;  1YNN C;  1B2T A;  1ZKO A;  2VB3 X;  1A2T A;  2BE5 C;  3Q6S A;  1VMC A;  4XYQ A;  1JWS D;  1DXM A;  3N6R A;  4RGN A;  3CKI B;  3D4D A;  2NVQ B;  3T56 B;  1BCP D;  3SR1 A;  1FNU A;  5C44 B;  3HEJ A;  1TWC B;  4C2M B;  4KY5 A;  3E0J A;  3PUY A;  5EBD A;  5C4H A;  5BN4 A;  1KLU D;  2KOL A;  1WD1 A;  5IOC A;  5EQ0 A;  2J7Z A;  5I6Y A;  5E4X A;  1OO9 B;  4XXE A;  1PXU A;  3BZD B;  1TS4 A;  2EXZ A;  1I4Q A;  1FD7 D;  1WTV A;  1PTO F;  4I65 A;  1WTO A;  3KLR A;  5T1G A;  1ICW A;  4HAE A;  1HHV A;  4P2C B;  1BR9 A;  3S1M B;  4A3F B;  1PMR A;  2KHS A;  5A2Q E;  1HCZ A;  1S5F D;  2EYP A;  3W2D A;  2ZXP A;  4A3D B;  4H13 C;  1EY9 A;  3S14 B;  1WTW A;  2WAQ B;  1E2W A;  3OIQ A;  4FF2 A;  1CK1 A;  1LT4 D;  4KTA A;  5G3L F;  1LTB D;  1D2B A;  4QUF A;  4CKB A;  1SNO A;  1PZJ D;  2MGS A;  4MIU A;  2EY2 A;  2OT2 A;  1CTM A;  3G7L A;  3PO2 B;  2BA1 A;  4U68 A;  1IKM A;  1TII D;  5M5X B;  1I6V C;  1OXT A;  2F0D A;  4KKS A;  2FJ2 A;  2RDF A;  3OPO A;  3WOE A;  1VMP A;  3SK5 A;  4Y7N B;  1Q1B A;  5JEA H;  4XIG S;  2HDL A;  3C3L A;  2GA4 B;  3Q0A A;  1D5Z C;  5CV8 A;  2HDM A;  5CGK A;  1GXD C;  2RA4 A;  2MUY A;  4CHT B;  2OF1 A;  2KED A;  1S5E D;  1BXT A;  4FXK C;  1ZYR D;  1VF5 C;  1B50 A;  1Q8I A;  2Q8R E;  3ZYY X;  4JBW A;  1SYG A;  4HN7 A;  5FLX E;  3QO2 A;  3D4W A;  2EY5 A;  5DM7 3;  4QCL A;  4TRD A;  4IUT A;  2QIL A;  3SVM A;  2AQ1 B;  2WB1 B;  4K5W A;  1RCV D;  5I6W A;  2X6G A;  3X3M A;  4IN3 A;  1SFO B;  1YNN D;  4FVM A;  5FOB B;  4KV6 A;  1ONL A;  2H4O A;  1YNJ D;  1LTS D;  4CKC A;  5KYI A;  2O2L D;  3T51 B;  1R4P B;  1F2Z A;  1PTO C;  1U4M A;  2Q8I B;  2E75 C;  4Z9C B;  3CHB D;  3NTI A;  2Z4H A;  1NCV A;  2E2J B;  2OXP A;  3Q22 A;  1B4O A;  1RDP D;  5CV6 A;  1OXV A;  3MEH A;  3MXG A;  1I3Q B;  5M5Y B;  1WD0 A;  3L7Z C;  3QOJ A;  1HUN A;  1PLF A;  3P7J A;  4BY7 B;  3RZD B;  1TWH B;  2D9U A;  4EGV A;  3J81 E;  4X3T A;  3FPU B;  1LLR D;  4HSV A;  1J8I A;  1Y1V B;  1AZP A;  3L3O C;  1OXU A;  5CV7 A;  2EYO A;  3DMU A;  5ELF A;  3E6Z X;  3VA7 A;  3IFT A;  5IGG A;  3I90 A;  4IZ8 A;  1F77 A;  1ML0 D;  2RSO A;  1G2T A;  2A5H A;  2L11 A;  5FLX L;  2ICI A;  1TY0 A;  2HQE A;  1GJX A;  1DOK A;  5CV4 A;  1PDQ A;  3NPP A;  1SJH D;  2F0H A;  4DF7 A;  2NTS A;  1JIC A;  1OXS C;  1Q90 A;  3E5S A;  1V8Q A;  5C4J B;  1V43 A;  4EQO A;  3K5L A;  4K8I A;  5JJZ A;  5C0X J;  2AUK A;  1OXX K;  3DHQ A;  2A69 C;  4FF3 A;  1JB3 A;  1II3 A;  2Z1C A;  4DXF A;  3DXJ C;  4NKL A;  4CJ0 B;  5C3E B;  2IJ0 A;  4KKT A;  5BN5 A;  2X69 A;  5KIX A;  2BCO A;  2A6E C;  1HTL D;  3VR3 A;  1RTO A;  1O7Y A;  1MGS A;  1H9J A;  5FK9 C;  3J81 L;  1R9T B;  3BVZ A;  4YIJ A;  3VYS A;  1ENA A;  1TS2 A;  1LT3 D;  2K33 A;  2RSN A;  1STN A;  3R2T A;  3NSW A;  3PUZ A;  4C3I B;  3BDC A;  1MBY A;  2E2I B;  4DU9 A;  4DAP A;  3TDQ A;  1ZXT A;  3NK9 A;  1V1P B;  1F2Y A;  4RGT A;  2XIW A;  1BOS A;  5F2D A;  5ELD A;  2FMC A;  4FXG C;  3M7G A;  2A6H C;  1WTR A;  4FF1 A;  2CW0 D;  1Q12 A;  3I3C A;  3I8Z A;  3HOU B;  1SYB A;  4HCS A;  2ID0 A;  1AZQ A;  4DK1 A;  3AU7 A;  1S5D D;  1TKW B;  1KLG D;  3C2P A;  1F9R A;  1SYC A;  2N55 A;  3HG9 A;  3RLF A;  2PZW A;  2PYK A;  5C4Z A;  1XWE A;  4WRD A;  1SNC A;  1H9R A;  4XQN A;  4OIK A;  3BYT B;  4NDX A;  3QG1 A;  1A3V A;  3A55 A;  4K14 A;  4TQU S;  3WDN A;  1IYU A;  4IUU A;  1BBX C;  3C1F A;  2G9H D;  3T13 A;  2NVY B;  1AP0 A;  1STG A;  2SNM A;  1CHQ D;  1KNE A;  1EEI D;  2I07 B;  1GUN A;  2PZU A;  2OEO A;  2RBM A;  3LWE A;  1B3A A;  3MA2 B;  1LT5 D;  3U9O A;  2EY6 A;  3SDZ A;  3QIA A;  2KQ3 A;  4NP5 A;  4G4K A;  2N88 A;  2QF7 A;  4FYD A;  2L1B A;  3U9S A;  1PRT F;  3BG3 A;  3J80 E;  3CQZ B;  4G7H C;  5TSS A;  2CVR A;  2QDB A;  1VDZ A;  5HUR A;  1BCP B;  4HMI A;  3HOX B;  5M5W B;  2A69 D;  3D4R A;  5I2X A;  2PW5 A;  2L5T A;  1NR2 A;  2WAC A;  1JE4 A;  1O7Z A;  4ZUJ A;  5EPL A;  2BDO A;  4BA1 I;  1DON A;  1XX8 A;  5EKL A;  2B2W A;  2KCC A;  4XYO A;  1SNM A;  2IWH A;  4XDX A;  2KCN A;  3JAM L;  2CHB D;  2F0G A;  2F0L A;  2NTT A;  1EQT A;  4L6T B;  1K83 B;  4DFA A;  1FYC A;  1QE6 A;  1IW7 D;  4ZAI A;  1Q1E A;  2A68 D;  4A93 B;  1ENF A;  1A3U A;  2E2D C;  1CA5 A;  4DAV A;  1Y69 U;  1EOT A;  4IUN A;  4X3K A;  2E2H B;  4XT3 B;  5ELC A;  2LS0 1;  4QB4 A;  3SK8 A;  2E76 C;  2JP1 A;  5EBC A;  3SXH A;  4K2L A;  3NWT A;  3BS1 A;  2TMP A;  1JR0 D;  4DGZ A;  1BUV T;  1LTT D;  4N9P A;  4MN3 A;  2EJM A;  5I9P A;  2B2W C;  1JQY D;  3PUV A;  3I70 A;  1RTN A;  1H9M A;  3NTK A;  2I46 A;  3V96 A;  5CV5 A;  1Y8N B;  4BY1 B;  3HP3 A;  1SBB B;  1JOO A;  2AQ2 B;  5EGT A;  4WFN 3;  1M4V A;  5CMD A;  4QMG A;  3C1E A;  2CQA A;  1HTP A;  2JA8 B;  1EY4 A;  2M2L A;  4AYB B;  3D31 A;  4XQJ A;  2LMC B;  3FPP A;  2AQ3 B;  2X6L A;  3T53 B;  4RKB A;  1FGB D;  1S5B D;  3BYY B;  4RA8 A;  4S3S A;  4EQN A;  2R93 B;  3NTH A;  1VF7 A;  2R92 B;  4RHS A;  1SYD A;  1PRT C;  5KNC A;  2F3W A;  3A7A B;  1I4R A;  2F0K A;  1JWM D;  3GTP B;  1B53 A;  5M9O A;  4IUQ A;  5DAU A;  1LTG D;  1QB5 D;  3M4O B;  1KAB A;  2IPK D;  4FXD A;  3MXU A;  2XWJ B;  3VR6 A;  5FO9 B;  1BQQ T;  1A6X A;  1WTX A;  1LO5 D;  4GZY C;  3OMC A;  2F0M A;  1DD2 A;  5JAV A;  1HA6 A;  3A56 A;  1S5C D;  2MJ8 A;  2WII B;  3D8G A;  1FR3 A;  1QIL A;  1D5M C;  4F7X A;  5C3W A;  4XQQ A;  3HZX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...