1KRSA

Solution structure of the anticodon binding domain of escherichia coli lysyl-trna synthetase and studies of its interactions with trna-lys
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
110
structure length
110
Chain Sequence
FRRDHTSDQLHAEFDGKENEELEALNIEVAVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDDLPEGVYNEQFKKWDLGDILGAKGKLFKTKTGELSIHCTELRLLTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the anticodon-binding domain of Escherichia coli lysyl-tRNA synthetase and studies of its interaction with tRNA(Lys).
pubmed doi rcsb
source organism Escherichia coli
molecule tags Aminoacyl-trna synthetase
molecule keywords LYSYL-TRNA SYNTHETASE (PRODUCT OF LYSS GENE)
total genus 14
structure length 110
sequence length 110
ec nomenclature ec 6.1.1.6: Lysine--tRNA ligase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1krsA00
5FJ8G 2UUBQ 2KBNA 1N33L 2I5HA 4UY8C 1PHJA 2E2IH 4OWTB 1TWGH 3PV0A 4X65L 2UUCL 4PG3A 1WCMG 3STBC 1XMQQ 3B6YA 2ZTDA 4R4CA 2UXBQ 4IPGA 2UXBL 4DK3C 4DV3Q 3JC66 2JA7G 2UUAQ 2UUCQ 2UU9Q 4JI2L 1N33Q 1XPUA 3MEFA 3DLLA 3CMEA 1PA6A 1N32Q 4DV2L 3BJUA 3HKZG 3F2DA 3FP9A 1E1OA 3I55A 5C3EH 3PO2H 5C4XH 2KENA 2R7ZH 4A93H 1U0LA 4DV7Q 4DV4L 1K8AC 1L1OC 3KDFB 2UXDL 4XIGS 4B3RL 3RLFA 1Q86C 1E7ZA 1FJGL 4DUZQ 4QL5A 1NBWA 4GOPC 1KAWA 2Z0SA 3UE1A 3GDEA 3I56A 4A3KH 1PH9A 4YCVA 4GKKQ 2ZJQA 2QEXA 5FJ8H 2JA8G 4KI0A 4P73A 3S24A 5LMNL 3UDIA 2JEBI 1HNZQ 5IYCG 4B3TL 2AKWB 3CC4A 1JJCB 2JQOA 3VDYA 4A4IA 2LSSA 4Y52H 4A3EG 4NXNL 1XNQL 4OO1I 4DV1Q 2NVXH 1X54A 5JEAG 3RN2A 3A74A 4A3BG 5JJKA 2UUBL 1LUZA 3J80i 3M7NA 4LWCA 1X65A 1Y1VG 2Q2HA 3EBEA 4R4IA 2VQEL 3J81c 1KHIA 3CF5A 3TS2A 2R93G 4JI0L 2KCTA 2WB1G 4YY3L 1VQOA 2ZJPA 2MFIA 3ULJA 1HNXL 2KCMA 2BH2A 1GVPA 4P74A 4LF7L 4RG1A 3HOZH 2WFWA 4DPGA 4A3EH 1V1QA 4LFBL 2VW9A 3J81i 4UP7A 4C3IH 3PUXA 1K83H 2JA9A 3K80C 5M5YH 4APVA 4LUZA 4A3BH 5M5WH 3OTOQ 3E9IA 4LF6Q 4L5SA 1YHBA 1K8GA 3G6EA 1PH7A 1CKOA 2D0OA 4BY1G 1JE5A 2ALYB 5IYCH 1RL2A 1VQ9A 1XNRL 3J80c 4DV7L 2JK8A 4HIOA 3PF4A 3IRBA 4A3KG 3HOXG 4NPSA 1U5KA 1WJJA 3Q8DA 4X66L 2B3GA 5C0XJ 3CMAA 3TS0A 1IBLL 3AQQA 3DM3A 3UE0A 1PH1A 1HZCA 2F4VQ 1N9WA 1GKHA 4KLKA 3I4NH 5AJ3L 4X66Q 1QZHA 3KFUA 1VS0A 3S15H 2PMZE 3RLOA 2D0PA 2HIXA 3KYHC 3UDXA 5IYBG 3CXCA 1E24A 1OXUA 2MO1A 2IY5B 5M3MH 3FKIH 5C4JH 4DV0L 1JMCA 1HR0L 1S3OA 2BA0A 1Q1EA 1VQEA 2AHOB 3S2HH 3PUYA 3H15A 2UXCL 2F3IA 2N49A 2PI2E 1QZGA 1JJGA 1FJGQ 1UE7A 4IFDJ 2CFMA 3KF8B 2NVYH 4NXMQ 1OXSC 2PQAB 3J7ZC 3K81C 2HT1A 4DR7Q 2I5MX 1XMOL 4YWLA 1VQ5A 1LYLA 1PH2A 5JEAJ 5M3FH 3CCUA 4IJHA 3K8AA 2EIFA 4LF9Q 1FVIA 3KLWA 4JI5L 2JA8H 4P72A 1PH3A 1L0WA 3GTKH 4L5QA 4A3DG 2N3SA 4JBMA 2K52A 1HZ9A 4JBWA 4OX9L 1KL9A 3F1ZA 3S1RH 3D0FA 3K7UC 4B3ML 4ME3A 1V9PA 1Q8KA 2JE6I 4HJ8A 1XNQQ 4JI8Q 3I4MH 1X55A 3PSIA 1P16A 2I0QA 1PYSB 1SN8A 2H5XA 5M3MG 4BXXG 1AH9A 1VQPA 3F2BA 1VQ6A 3A5UA 1N8RC 4POGA 4PZ6A 2PNHA 1HR0W 4LNQA 2AWNA 1W2BA 3L7ZC 2ID0A 1I94Q 1NMGA 2YTXA 3M9BA 1HR0Q 2ATWA 2JA7H 1UE6A 4LFAQ 4BY7H 1SRUA 2GVAA 3W1GA 4GNXB 4Y7NH 3CP0A 3KDFA 3CCLA 3S1QH 1X6OA 4EX5A 1B70B 1CUKA 4DR7L 3ERSX 1M90C 2N78A 2NVQH 1H95A 2K4KA 4P75A 2R92H 4DK6C 1TWFH 4A3MH 4JI6L 1K0RA 5JJIA 4GN4B 3AFPA 2RF4A 2VQFQ 1CKMA 4AH6A 3CC2A 2OTJA 1WOCA 2R7ZG 5C4XG 2YTYA 3I4OA 5J3BA 4IPHA 5HGQA 2AWOA 3GO5A 5C44H 1ASYA 4JBKA 4GN3B 1HNWL 2D62A 2FXQA 4JBJA 2CCZA 4X65Q 1N34Q 4DV6Q 2VNUD 3BZKA 1VQ4A 1PH6A 1YJNA 3H3VI 2Y0SE 1Q12A 2A19A 2F4VL 2MNAA 3U58A 1L1OB 1WYDA 4GOPA 2JA6G 1LTLA 1C9OA 3FHWA 1R9TH 2V1CC 4X62Q 1QVGA 4X6AH 4X62L 4LF5Q 2PI2A 1E22A 2EXDA 5GAHC 1A8VA 3L0OA 4QY7A 1J6QA 2DUDA 2NN6G 4MTNA 2ZJRA 1EFWA 1P8LA 4FDBA 2NN6I 1PH4A 3T1YL 5FLMH 5FLXc 1JB7A 2ZM6Q 5C44G 2QGQA 3D31A 3HOVH 3F8TA 4DR3Q 4BY1H 4IOCA 3OYYA 4UP8A 1N36L 1GM5A 4GLAC 4IFDI 5IWAL 1QVFA 1ASZA 2YV5A 3CPFA 5IWAQ 1GO3E 1QUQB 2E8GA 2MQHA 1G291 3PCOB 2R7FA 2NVTH 3H3VH 4QQBX 1MIUA 2CWAA 2R92G 2IX1A 4A3CG 2K75A 4DR4Q 1C0AA 2MO0A 1IBML 4DR1L 4IOAA 3T1HQ 1VQKA 1Q1BA 4LF9L 4POFA 3NEMA 2HHHL 2B63G 4IJLA 3HOVG 1VQ7A 1Y14B 1EOVA 4B3MQ 3TRZA 1WI5A 2BH8A 3E0EA 3RNUA 3G71A 2CWPA 4YWKA 2A1AA 4X64L 4DV2Q 1D7QA 3M85A 4L5RC 3KJOA 1NJIC 3A0JA 3W5OA 1D8LA 1BKBA 2UXCQ 1J5EQ 4B3RQ 4DV5Q 4HIKA 2UU9L 4LF8Q 2L15A 5H1SE 2K5HA 1EQQA 2R6GA 3HOXH 1G51A 2Q2IA 4LF4Q 3GTQH 2GVBA 1PH5A 3FKIG 4JI1Q 4JI3Q 1YHAA 5LMNQ 3K0XA 1IL2A 3W1BA 2VQFL 4DNIA 4GKKL 5IYDH 1XPRA 3CW2C 3BU2A 1SROA 3KF6B 1OTCA 2JA6H 3H0GG 3CCSA 4IFDG 1A62A 2EQSA 4LFCL 4HJ5A 1A63A 4KHPQ 5JJLA 3HKSA 4B3SL 3PO3H 4C2MH 4YHHQ 4JI7Q 3NELA 2A8VA 1TWHH 4JI3L 5C3EG 3PO2G 4A93G 1EUJA 1UEBA 3MXNB 1YITA 4GOPB 3HFZB 1X56A 4DR2Q 5M5XH 4J15A 2XGTA 3OW2A 4NXML 1DGSA 1I3QH 4PMWA 2KHJA 1IYJB 1WCMH 3GD7A 3CCVA 1PH8A 1IBKL 1EIYB 2RHSB 4IPCA 1IBLQ 4R4OA 1UE5A 1Z47A 1YVCA 1Q46A 3CAMA 1VQDA 2WAQG 4JI1L 1VQNA 4GS3A 1X3EA 2IT1A 4JOIC 5GAEC 1L2FA 4DR5Q 4UPAA 4LF7Q 4JYAL 1BVSA 3GTOH 2VUMG 4OWXB 1I6HH 4DAMA 1E3PA 2R7DA 5IY0A 1E1TA 4A3LG 3CCEA 3ZJYC 4A3FH 2QA4A 4HJAA 4BY7G 3JAMc 3AFQA 3CCRA 4X64Q 2R93H 4DR1Q 5IP7H 1EYGA 1YEZA 2VS1A 3I4MG 1NE3A 3GTPH 4BBSG 4TVAB 2E2JH 4IO9A 2VZAA 1YJ9A 2RHQB 1CKNA 2YTVA 4QIWE 4NXNQ 1MJEA 2IX0A 2PQAA 1YHQA 3CCQA 3M3YH 1XTDA 4EQ5A 5C0XI 2NZOA 3G4SA 4YWMA 3CD6A 4A3MG 3I2ZA 5C0XG 3PIOA 3S16H 4P71A 3E9HA 5BR8L 3L2PA 3T1HL 4AIMA 3S17H 1LM0A 4GNXC 2JA5H 4DR4L 1B8AA 3ULPA 3H0GH 4H02A 1MJCA 1C7YA 2K50A 3SGIA 1T9HA 4JCVE 5ELOA 2ASBA 4JV5L 1HZAA 1CSPA 5DLQE 1Q7YC 4YY3Q 4GLXA 1A0IA 4QJFA 3RN5A 1I50H 1S72A 1VQ8A 2ZM6L 4AQYL 5HY6A 1XPOA 1MKHA 1VQFA 4LUVA 4R4QA 4A3FG 4JI5Q 3PO3G 1IBKQ 3I4NG 4OONA 1YI2A 1VQHA 5M3FG 2Q2TA 4OWWB 1VQIA 1YBYA 3HOZG 1W3SA 4RMFA 3TQYA 4LF5L 1K3RA 3BZCA 3S1NH 3PIPA 1XNRQ 4C3JH 1FGUA 1PFSA 4DKAC 1XMOQ 4DR5L 4A3GG 1TXYA 1VCIA 3CQZH 3UDFA 2B29A 2WP8J 3U50C 4BBRH 3ER0A 4A3IH 3GTGH 3WWVA 1JJ2A 1GD7A 1YIJA 5E7NA 4BBSH 1NTGA 3OTOL 4OO1G 4HJ9A 2OQ0A 1HZBA 1SR3A 2HQLA 4TQUS 5GQOA 4C3HH 1KRSA 2UXDQ 2ZTCA 3F2CA 1KD1C 3U4VA 1TWAH 3AYHB 4GLVB 4DV3L 3GTLH 1PVOA 1QVCA 4DR2L 4A3CH 1SMXA 1VQBA 3RLNA 4A3LH 1XMQL 3EN2A 2LXJA 3K7AH 3NBHB 2E5LL 4R4TA 4JG2A 5AJ3Q 4A3JG 4JI0Q 4GKJQ 1N32L 1O7IA 3J81j 4DUYQ 2KHIA 1M1KC 1KXLA 5GADC 1FL0A 2CKZB 3KOJA 4HIMA 3HOWG 3TREA 1UWVA 3PGZA 4A3DH 4AQYQ 4GKJL 2XTIA 1OXTA 1CSQA 4A3GH 1X3FA 1KIXA 3J7A5 2GN5A 2ZTEA 3A5ZB 1IZ6A 1VQCA 1CKNB 2CQOA 3NENA 1K73C 4DR3L 1B7YB 2JA5G 4AYBG 1XJVA 1SLJA 4KHZA 1YJWA 2F52A 4JI4Q 2BA1A 1VQGA 1G6PA 4DUZL 3HOWH 1EQRA 5GAGC 3ICEA 4LW1A 4GN5A 3HKZE 2OQKA 3RR5A 4JI8L 1KQSA 4DR6L 3G48A 1N36Q 1AE2A 1HH2P 5IP9G 2IHFA 2K14A 3PUVA 4MZ9A 4BA1I 2VY3A 1BBWA 4LUOA 4R1JA 4HIDA 3RZDH 4OX9Q 1EIFA 2VQEQ 4B3SQ 2IHEA 1QUQA 3S14H 2VL6A 3GTMH 2OTLA 5IT9c 3M4PA 2WB1E 1X9NA 3PUZA 4IPDA 4K0KQ 5EAYA 4PZ8A 1Y1WH 2E5LQ 2C35B 4DV6L 4DV0Q 4MNOA 1S40A 3CPWA 4L5TA 1PYBA 4BBRG 4A3IG 4AYBE 3JAMi 3CCJA 4ALPA 4JV5Q 2Z6KC 1YNXA 5IP7G 5GROA 4LF8L 2JEAI 3S2DH 1RIPA 3EIVA 3HOUG 3TEHB 1J5EL 4QGUA 4JI6Q 1TWCH 1X3GA 2I5LX 3PUWA 4A3JH 2DGYA 3PF5A 4O0AA 2YU9H 1N34L 2K5NA 2WAQE 4JC0A 1KRTA 2RCNA 5IYBH 2ES2A 1HNWQ 4DV4Q 5LMUL 5ELNA 5LMUQ 2NZHA 1VQJA 4NB3A 3HOYG 2VUMH 4YHHL 4JI7L 4JOIA 4O2DA 1JT8A 5IP9H 4HJ7A 3GTJH 4WJ4A 2AMCB 3U4ZA 3I7FA 1Q81C 1BBUA 3HOUH 1I94L 2YYZA 5FLMG 4UP9A 4JI2Q 1IBMQ 3STBD 1OXXK 2Q2UA 4YCWA 5BR8Q 1Y1VH 4OXPA 2N8NA 2UUAL 2E2HH 2OCEA 1K9MC 1YZ6A 2Y0SG 4LFBQ 2Z6KA 1AE3A 4LF4L 2JJQA 1Z9FA 4XTCS 1EWIA 5LMNW 1HNXQ 4LFAL 2LXKA 3HOYH 4JYAQ 1V43A 4DAYB 4DV5L 1VQMA 3CC7A 3M4OH 4LF6L 4K0KL 1VQLA 1OXVA 3T1YQ 1IXRA 4PZ7A 3M4QA 1KC8C 1PV4A 4A75A 1UE1A 4JI4L 4BXXH 3AEVA 3KJPA 4DUYL 1WFQA 4WJ3M 4BA2I 1HJPA 1I5FA 1NY4A 2K5VA 5IYDG 5IE8A 1NMFA 3ULLA 4GNXA 3UDGA 1SFOH 1Q82C 4DV1L 2B63H 3RZOH 4DR6Q 2HIVA 1VQAA 5K36G 3KF6A 3S1MH 3LGJA 2HHHQ 1HNZL 2OWOA 1SE8A 4B3TQ 4KHPL 1L1OA 4YCUA 4A76A 4LFCQ 1Y1WG 3CCMA
chains in the Genus database with same CATH superfamily
2CH4W 1N33L 2I5HA 2JXMB 2F0TA 1TWGH 3PV0A 4OWTB 4ILWA 5EKIA 2UUCL 2E2HB 2IW3A 2RKSA 5IGFA 4IPGA 2UXBL 4N8FA 4JW0A 4IURA 3TBIB 1HTLD 3IAYA 5IGCA 1TS4A 1XPUA 2SNSA 2A73B 4AYBB 4IUVA 3DLLA 2CW0D 2A68C 3CMEA 1HFGA 3FP9A 1E1OA 2AUJD 5CV7A 4UDUC 3PO2H 4KKSA 5FLXE 4HR7B 4B9WA 3RLFA 1Q86C 4DUZQ 1G8ZD 1KAWA 2Z0SA 3GDEA 5CR3A 5FJ8H 5LMNL 4LK1C 5DEHA 3CC4A 2LSSA 4Y52H 4OO1I 4XDXA 2NVXH 1LT4D 1X54A 1SNMA 3J80i 2D5DA 5ELEA 4LWCA 2Q2HA 3CF5A 3TS2A 2R93G 4J1MA 3A55A 3QR8A 5JAVA 4YY3L 1LT3D 1VQOA 2ZJPA 3ULJA 2E75C 2KCMA 4LF7L 1PTOC 5JJZA 2VW9A 4A3BH 2F3VA 3LWEA 4LUZA 4ME5A 3QIAA 5M5WH 3E9IA 4L5SA 1YHBA 2RSOA 1ML0D 2ALYB 4DNRB 3GTOB 1RL2A 3PF4A 3J80c 2EYJA 3I8ZA 5C0XJ 1WJJA 3CRLC 2B3GA 3UE0A 5AJ3L 3S15H 4CDFC 1DONA 1JWUD 3KYHC 3HZXA 4G4KA 3OOCA 3CXCA 5M3MH 1D2BA 2M2LA 3H15A 2PI2E 4CGYB 1QZGA 1Q8IA 2CFMA 1SNQA 3KF8B 1RJTA 5C4HA 4NXMQ 1OXSC 2PQAB 1PZJD 3K81C 5IT9L 1QOHA 1ICFB 1EOTA 5D65A 5M5YB 4A3DB 3CCUA 4IJHA 3K8AA 2EIFA 1QB5D 4JI5L 4X3TA 5CC4A 2JSOA 4A3JB 1TIID 1II3A 4K8IA 1V9PA 4JI8Q 1CQVA 2DNEA 3A5UA 1E0BA 4POGA 3NBHA 1HR0W 4LNQA 2AWNA 1W2BA 3L7ZC 2ID0A 1WTHA 2RSNA 5KGUA 2ATWA 2JA7H 1UE6A 3S1NB 1TS2A 3N6RA 1SXTA 2GVAA 4GNXB 1LTGD 4PQXA 2BDNA 3S14B 3HKZB 1K8MA 4ULLA 4EX5A 1LTSD 1MBYA 3FPUB 2N78A 2R92H 3NPPA 4A3MH 1K0RA 1LTAD 3AFPA 5IGBA 5K36H 2JA5B 4AH6A 3Q0AA 1WOCA 2YTYA 3I4OA 5J3BA 4IPHA 3GO5A 4JK1C 2A74C 3VR5A 2FXQA 1I4RA 1N34Q 3BZKA 2RDFA 3A8KE 2Y0SE 4L8JA 2NUCA 4H0LC 1WYDA 2F0SA 3MTSA 5EKLA 3GTJB 1DOMA 3V96A 1JCKB 3E5SA 1R9TH 4X62Q 1QVGA 3HGBA 4X62L 4LF5Q 1EEFD 2EXDA 4S3SA 1J6QA 2DUDA 2BE5D 1EIHA 5FLXc 2EJMA 3D31A 3TP6A 3HOVH 4DR3Q 2EJFC 5L37A 3OYYA 4IOCA 1N36L 4GLAC 2R7ZB 3DM1A 1ASZA 2YV5A 1QUQB 2E8GA 1LTRD 1G291 3PCOB 2R92G 1LT5D 2CWAA 1C0AA 4QB4A 5M3FB 3IL8A 4DR1L 4IOAA 2OXPA 3U9SA 3T1HQ 3NEMA 1PTOB 1SYGA 1BBXC 4KMUC 1GHJA 4IJLA 1VQ7A 2F03A 4RHRA 2G5DA 1L0YB 1XTCD 4YWKA 4L5RC 4CBVA 3A0JA 1D1IA 1D8LA 1BKBA 3EVQA 4B3RQ 5H1SE 3MFGA 4LF4Q 4MN3A 1T5XD 4HMIA 1PH5A 4JI1Q 2B39A 2FJ2A 2HQEA 1DZ1A 3KF6B 5CORA 2JA6H 4IFDG 2R93B 2EYLA 2RDHA 4HJ5A 2KOLA 5M5XB 3T4AC 3PO3H 4C2MH 1FNVA 5C3EG 4ZUJA 1EUJA 2EXZA 1YITA 5CV8A 4GOPB 3C46A 5I9PA 3OW2A 4PMWA 3GD7A 3CHBD 4IPCA 5CV5A 1DM0B 2KHSA 1PMRA 3CAMA 1VQDA 4CDEC 4NMZA 2B2WA 1X3EA 4JYAL 5GAEC 4LF7Q 3GTOH 1Q90A 1I6HH 1DD2A 1E3PA 3QOLA 1R9TB 4A3LG 5D3IB 2RVLA 4DAPA 4A3FH 5EQ0A 4HJAA 1RD9D 2ZXPA 1HA6A 4X64Q 4RFBA 4DR1Q 2VS1A 3I4MG 2E2JH 4C3JG 3MAQA 5D14A 5EKKA 1XTDA 3G4SA 1TR5A 4YWMA 5E4WC 3E9HA 1C8CA 4AIMA 4GNXC 1F2LA 4C3HG 3ULPA 3H0GH 1MJCA 5M9OA 2A5HA 4JV5L 4JCVE 1Q7YC 4RA8A 5D3DA 1A0IA 4QJFA 3RN5A 3BVZA 1I50H 2ZM6L 4UAIA 1BXTA 4JI5Q 3AU7A 3I4NG 1YBYA 3PQIA 3GTPB 1W3SA 3D6WA 2Z9HA 2K33A 2R61A 1ESFA 4DR5L 1CA6A 1VCIA 3CQZH 3UDFA 2D9UA 1EZ6A 1GD7A 5E7NA 2B2UA 2F1MA 2OQ0A 1SR3A 2HQLA 3MHBA 4TQUS 3HOWB 1TWAH 3GTLH 4DV3L 4Q0FA 4DR2L 1ZEQX 1VQBA 2LXJA 4XXEA 5CGKA 3DXJC 3U9OA 4OGQC 4FNFA 3A8JE 2E2DC 5AJ3Q 4A3JG 1O7IA 3A54A 1FL0A 2IPKD 3C2PA 3TREA 1LTTD 1HRJA 1SYFA 3H09A 1B50A 3TZUA 3OWEB 1FR3A 3J7AF 3A56A 1D5ZC 1VQCA 4A3GB 1XJVA 4KHZA 3P75A 2F0KA 3A7LA 1GUWA 3I72A 2EY1A 4GN5A 2EYHA 2D2CC 1VF5C 5FLXL 1LO5D 1TS5A 3CQZB 5IP9G 3W3AA 2IHFA 2K14A 4MZ9A 5BN4A 4B3SQ 2VL6A 3BS1A 5EAYA 1Y1WH 3WDNA 1KNEA 2EZVA 1S40A 4J6HA 2MHVA 1G2TA 3J80L 3CCJA 1SYEA 1EYAA 2Z6KC 5IP7G 1SJED 3EIVA 3MFYA 4H13C 3IKJA 3PUWA 1AP0A 1CZWA 4O0AA 4JC0A 4DAVA 2RCNA 3E3XA 2ES2A 1HNWQ 4DV4Q 5LMUQ 1C4QA 1U4LA 1JT8A 4O2DA 2GA4B 3U4ZA 4EQOA 1TU2B 4UP9A 2EYFA 3STBD 3QO2A 4OXPA 1EU4A 2OCEA 3NWTA 1YZ6A 4NKLA 3KLSX 2WIIB 3E0JA 5LMNW 4LFAL 1K3BC 3CC7A 4BY1B 4HN7A 4LF6L 2N55A 1VQLA 3T1YQ 1IXRA 1KDBA 1A3VA 2F0FA 1UE1A 4BXXH 4DUYL 4GNXA 1PZID 3X3NA 3ULLA 2B63H 2EE1A 1FGBD 1JE4A 2K01A 2OWOA 4NDXA 1SE8A 1M4VA 2KCCA 4G57A 4A76A 1A3TA 3DEPA 2UUBQ 4UY8C 1PHJA 2E2IH 1F9PA 3OSOA 3STBC 2SNMA 4UHVA 3VR4A 1STGA 2UUAQ 1RKNA 5LL6X 1RDPD 4DN4M 3J7AV 4XT1B 1K0SA 1BCPC 3P1HA 5LHY1 5J22A 2KENA 2QEJC 2WKCA 1I3QB 4DV7Q 1IYVA 4DV4L 3P7JA 1TY2A 2J0TD 1A15A 3T16A 2UXDL 4XIGS 3HS0C 4QL5A 1NBWA 4A3KH 2WACA 3UE1A 4K2LA 3I56A 2K5QA 4YCVA 4GKKQ 3S24A 2JEBI 3VYUA 5JEAG 3RN2A 5A2QE 4A3BG 2UUBL 3M7NA 1Y1VG 1D5MC 4R4IA 3R93A 3MEHA 2KCTA 4H7BA 4EQNA 5T1GA 1EU3A 1U4RA 3SDZA 2MFIA 4P74A 2X6GA 4X3SA 1VDZA 4RG1A 5FKAC 1V1QA 3PUXA 2JA9A 3MA2B 4K5XA 4RGNA 1K8GA 4BY1G 5IYCH 2XWJB 3I4LA 3NTKA 4HIOA 1RTNA 1G6ZA 1PLFA 1SAPA 4A3KG 4NPSA 3Q8DA 4X66L 1GXDC 2RCFA 3AQQA 4RKLA 2E76C 3KUPA 1GKHA 1WTXA 1H9SB 1U4PA 4RHSA 2D0PA 3H91A 2HIXA 1E24A 1OXUA 2MO1A 3PIP3 3DHQA 3J80E 2K05A 4FF3A 1JMCA 2BA0A 3SR1A 1JJGA 2N49A 2PZWA 5C6AA 1UE7A 3P20A 3J7ZC 2HT1A 4DR7Q 2I5MX 2LFNA 1X3PA 3IFTA 3UI2A 5EBCA 2NVYB 5JEAJ 4FF2A 3M7GA 5M3FH 1HPCA 3ITPA 2Q8TA 5J39A 3QB3A 1FD7D 4LF9Q 2R3ZA 1K28A 1QWYA 3K7AB 2JA8H 1TWFB 1AFPA 1PH3A 4CKBA 4A3DG 1H9RA 4L5QA 2N3SA 1TWCB 4KD4A 1SNPA 4JBWA 2ZT9C 4OX9L 1ESRA 1IW7C 2L12A 3F1ZA 4K5WA 5BN5A 1XNQQ 4HJ8A 2L55A 1STBA 2F4IA 1P16A 1UAPA 2I0QA 1AH9A 1N8RC 4BY7B 1SYBA 3M9BA 4X3UA 4G7OC 4DA2A 5CBAE 3KDFA 2K1BA 1X6OA 4I65A 3GTMB 4KY7A 2JA6B 5KRUA 3HG9A 3ERSX 4IN3A 4DXGA 2NVQH 1NR2A 2K4KA 4C3HB 4JVZA 5JJIA 3BG3A 4GN4B 2PPBC 1O7LA 2RF4A 1CKMA 1S5BD 5C4XG 5C3WA 1NNXA 2AWOA 2A69D 3DUZA 3BVGA 3M4OB 4X65Q 4X3KA 4DV6Q 3H3VI 2MNAA 1I4PA 3H3VC 3U58A 4RCOA 2JA6G 4IFDH 4GOPA 1C9OA 1ENFA 1H9SA 1EFID 1VMCA 4RH6A 1RTOA 4QY7A 1O78A 2NN6G 4MTNA 5I2XA 2QW7A 2DJGC 4FDBA 2NN6I 1HHVA 1JOOA 4A3MB 5FLMH 2ZM6Q 4RGMA 4BY1H 1HQMC 1NUCA 2XN9C 2PQEA 1GO3E 2MQHA 4YIJA 2NVQB 3C1FA 2IX1A 2K75A 2A68D 2A6HC 1S4ZA 1IBML 2QDLA 3MZ5A 2HHHL 1KLGD 1I50B 2FMMA 1UUPA 1B9MA 2XRSD 1Y14B 3TP7A 3TRZA 3NQIA 4L6TB 3FVQA 4X64L 3FDTA 4DV2Q 5JVG3 3RZOB 3ND9A 1D7QA 4XQJA 1NJIC 3W5OA 2UXCQ 2L9HA 2XWBB 2DY7A 3FKIB 3HOVB 2L15A 1ILPA 2K5HA 2R6GA 2Q2IA 2PW5A 3GV3A 2GVBA 3FKIG 2H1EA 4JI3Q 1D1KA 5LMNQ 1LABA 1AEXA 1Q3LA 4DNIA 2ICIA 3CW2C 1XPRA 3BU2A 1OTCA 1EY9A 4I7AA 4OIKA 2EQSA 4LFCL 3AMUA 1BQQT 1PFNA 5JJLA 4YHHQ 2M9VA 4JI7Q 3NELA 2A8VA 4A93G 1EYDA 3MXNB 1UEBA 2ICEC 1X56A 5M5XH 4A3EB 1VMPA 5C3EB 2JP1A 2KHJA 1IBKL 1WCMH 1AW7A 1U9RA 3S1RB 1B2TA 3OPOA 1Q46A 2WAQG 3I73A 1TKWB 4JI1L 5A2QL 4K5VA 4DR5Q 1L2FA 3D6CA 4U68A 4UPAA 4RCNA 2CVRA 3SK6A 4DAMA 4QCLA 5IY0A 2BDOA 3CCEA 2QA4A 2B2VC 2WKDA 2RA4A 4BY7G 3JAMc 3AFQA 2RDGA 2R93H 5IP7H 1TWGB 2TMPA 4OIJA 4NXNQ 1KLUD 1YHQA 4H44C 3CCQA 2NZOA 1CHQD 1BF4A 3CD6A 3I2ZA 3PIOA 3S16H 2F0JA 5IOCA 3EQLC 3L2PA 1B8AA 1C7YA 1F2YA 1HTPA 2HCIA 3TZDA 2ASBA 1CSPA 1RF2D 5I9OA 1S72A 1KAAA 4AQYL 5HY6A 4ZKCB 1XPOA 1MKHA 3DMUA 3T53B 2QILA 4R4QA 2L4NA 4IQZA 1STNA 1VQHA 1YI2A 3HOZG 2DY8A 1K3RA 3VR2A 1CZGA 1XNRQ 5EJWA 2MUYA 4M8AA 3ER0A 4HSVA 3WWVA 4OL7A 5CV9A 1JJ2A 1EL0A 1KNAA 1NTGA 4HJ9A 3C1EA 2R92B 1KRSA 1KD1C 3AYHB 4GLVB 5ELFA 4A3CH 1SMXA 1MGSA 2I46A 3EN2A 3NBHB 3TP8A 3S16B 4K2KA 1YNND 4KK7A 2E5LL 4R4TA 4JG2A 4JI0Q 4GKJQ 1M1KC 4QIWB 5GADC 2HDLA 2F0PA 1UWVA 3PGZA 2XTIA 2B8GA 1CSQA 4HCSA 3FEWX 3I90A 4XYQA 1KIXA 2GN5A 4EQPA 2BOSA 2CQOA 3NENA 1K73C 2AQ1B 4DR3L 4KJOA 1J9OA 5EPLA 4AYBG 1SLJA 1EQTA 1V1PB 1BCPD 2K5DA 2ZXRA 4DUZL 3C3LA 3HOWH 1EQRA 4LW1A 3HKZE 3NE5B 4I7ZC 1CQFA 3VYTA 1GJXA 1HH2P 1B3QA 2EYPA 4BA1I 4R1JA 2LMCB 4OX9Q 5DM63 2VQEQ 2OTLA 1I4HA 2NZ1D 3PUZA 4IPDA 2B2YA 1Y1VB 2K6AA 2VB3X 2C35B 4DV6L 3SXHA 5FO7B 2EY2A 4BBRG 4A3IG 2F0UA 4AYBE 3JAMi 4LF8L 5GROA 4TSSA 5I2YA 1TY0A 1WTRA 1G2SA 1X3GA 2I5LX 4A3JH 2DGYA 3VYRA 1V1OA 4Q5VA 2TSSA 2EVBA 4F88A 4CDCC 3OIQA 1EQVA 1HUMA 1PDQA 2NZHA 4KN4C 3FMCA 4WJWA 4C3JB 5EGTA 1DCZA 1Q81C 2F0GA 1JWMD 4YCWA 4DU9A 2E2HH 2Y0SG 2Z6KA 4TRDA 5NUCA 2JJQA 4XTCS 1EWIA 3HEJA 2JN4A 3HOYH 4DAYB 4DV5L 3M4OH 4OEMB 1OXVA 4KTAA 4CDDC 2J4XA 1CFMA 2NTTA 4PZ7A 1SFOB 2VB2X 1M8AA 3J81L 1NY4A 1SNCA 1Q82C 4DV1L 2HIVA 3D3RA 3KF6A 3LGJA 3LWUA 1ENCA 4KHPL 1DOLA 2K7VA 3ND8A 5FJ8G 2KBNA 1GUGA 1GUNA 4G7HC 1U4MA 2HCCA 4X65L 4PG3A 3R3OA 5EPKA 4JPBW 3B6YA 2ZTDA 4R4CA 2UXBQ 3K6OA 4DV3Q 2JA7G 2UU9Q 2V4DA 4CJ0B 1N33Q 2EYMA 3MEFA 4C3IB 4MHEA 3MVVA 1PA6A 1N32Q 3TDQA 3HKZG 2XRQD 3F2DA 3I55A 2LS01 5C3EH 5C4XH 1CM9A 5T1IA 1ET6A 3KDFB 1SBBB 1PFBA 3K57A 1TWHB 2MGSA 1WTVA 1PH9A 1HA5A 4KY6A 1PYWD 2QEXA 2ZJQA 4KI0A 4P73A 1F2ZA 4B3TL 1HNZQ 2EDGA 3Q23A 3V05A 2AKWB 1JJCB 2J7ZA 3G7LA 3VDYA 2SOBA 3I91A 1K8OA 5CV4A 3A74A 2KEDA 1AZQA 3J81c 3HOXB 1IW7D 1UEAB 2AQ2B 3X3MA 1HNXL 2BH2A 3AB9A 4N9TA 4LFBL 2WFWA 4A3EH 2PMZB 4RWSC 1JR0D 3R2IA 4HCEA 1K83H 1F9SA 4LF6Q 2K5WA 4DXFA 5KEEA 3G6EA 3R8BA 2D0OA 4A3BB 1Y8OB 3GQBA 5CV6A 1PTOH 1VQ9A 4DV7L 2JK8A 2M00A 4IZ8A 1ZXTA 3I4MB 3EA6A 2PO4A 5J1ZA 3HOXG 3CMAA 3DM3A 3TN2A 2N88A 4CHTB 4X66Q 5I6YA 1VS0A 2PMZE 1ZYRD 3UDXA 5IYBG 2I07B 1JORA 3K59A 2IY5B 2WB1B 1G91A 2NB0A 3FKIH 1B1ZA 4DV0L 2F0WA 1HR0L 4WFN3 1VQEA 3S2HH 2UXCL 2F3IA 2K03A 2XSCA 1NR4A 2DNCA 2RQXA 4J8QA 3K5LA 1CTMA 3SVMA 4PMCA 1LACA 1Y8PB 4O42A 1EY7A 2CHBD 4KJNA 4B9XA 3J7YW 1FVIA 3G6JB 3KLWA 2F0EA 3GTKH 2B2WC 1EYCA 1I4GA 4JBMA 1ZKOA 1HZ9A 1QILA 5FO9B 1KL9A 4NW2A 3BYTB 3D0FA 4B3ML 4ME3A 1MHWC 2JE6I 4ZKBB 3PSIA 1EY6A 5M3MG 1SN8A 2H5XA 1A2UA 5I4DA 4BXXG 2O2LD 3F2BA 3PMFA 2F0NA 5ELDA 4PZ6A 2PNHA 1KDCA 4FYDA 2O5JC 1BR9A 1SRUA 2C9OA 3W1GA 3CCLA 2L5TA 3CP0A 1STYA 2A6EC 2SDFA 2K32A 2JA7B 1LLRD 3BDLA 3S2HB 1CUKA 4DR7L 1BCPF 4RKBA 4O1NA 1H95A 4DK6C 1TWFH 2LKVA 3NWSA 3CC2A 4V0BA 2R7ZG 1E2VA 1H9MA 5C44H 1HNWL 3MXPA 3MXUA 2D62A 3K5MA 3HOYB 4IUNA 4JBJA 1CK1A 2VNUD 1VQ4A 1YJNA 2SEBD 4F87A 4CKEA 1E2ZA 4FF1A 1LTLA 2IL8A 2E2IB 3FHWA 2V1CC 3I70A 4X6AH 1KABA 3GTQB 1J8IA 1E22A 1TT2A 1EY5A 3L0OA 4FVMA 4IUQA 4BWGB 4DFAA 1NAPA 5ISRA 2ZJRA 3TP5A 2B8FA 1PH4A 5F2DA 3T1YL 3KK7A 1JB7A 2PZTA 3NUCA 2QGQA 4N8X1 1HCZA 4IFDI 5JEAH 5IWAL 4LMQD 5IWAQ 3CPFA 1TWAB 3GTLB 4ID6A 1XWEA 4ZUIA 2R7FA 2O5IC 3H3VH 1MIUA 5IT9E 4DR4Q 4C3IG 1TVXA 3SK8A 1PTOF 4RAUC 1Q1BA 2Z8LA 4A3KB 4LF9L 2OEOA 2B63G 1MD2D 2O4XA 3DEOA 1I6VC 2PW7A 1VF7A 2QF7A 1EOVA 2PNRC 2BH8A 3H6MA 5BN3A 3J81E 3G71A 2A1AA 2G9DA 3S15B 3M85A 4PMBA 2YU9B 3KJOA 2XNAC 2EY5A 1SYDA 5M3MB 4DV5Q 2UU9L 2DN8A 4LF8Q 3OIPA 2KVMA 2A6ED 3GTGB 5HURA 1XXGA 4QF4A 3K0XA 3CKIB 3NXWA 3W1BA 2VQFL 5IYDH 4C56C 1SROA 2NN6H 3CRKC 1PRTF 1BDOA 1A62A 1B9NA 5DAUA 5M5WB 4B3SL 1TWHH 3PO2G 3NHHA 1SJHD 1JC7A 1SMYD 3HFZB 4DR2Q 2RBMA 4A93B 2XGTA 1DGSA 2L1BA 2RHSB 1IBLQ 1UE5A 2F0VA 4HSPA 3Q24A 1VQNA 4GS3A 2LY7A 3DWAA 1BVSA 1BOSA 1X32A 4ZQ3A 3ZJYC 3NSWA 3D4WA 1HQRD 2EY6A 3OMGA 3CCRA 1Y69U 1YEZA 4ZRZA 4Y7NB 1NE3A 3GTPH 4BBSG 4TVAB 4IO9A 2IX3A 1YJ9A 2RHQB 5CBEE 1CKNA 2MPMA 1SSOA 1GUOA 1K83B 4LJZC 4EQ5A 5C0XI 4A3MG 5C0XG 1V1PA 4P71A 3T1HL 3S17H 1DJRD 4H02A 2G9HD 2F0OA 3T51B 4OO1H 1GUSA 1EZ8A 3SGIA 3Q6SA 4K6LA 2Y0SB 1IL8A 4FP5D 1WCMB 5DNFA 3SK5A 2QDBA 3WOEA 1VQFA 4A3FG 2XVSA 1IBKQ 1EWCA 5M3FG 1VQIA 1BO0A 2HD3A 4LF5L 3TQYA 3BZCA 4R8NA 2EOTA 3S1NH 3PIPA 4C3JH 1R4QB 3NTIA 1FGUA 1PFSA 4DKAC 1XMOQ 5FK9C 4A3GG 1TXYA 1JOQA 2WP8J 4BBRH 4A3IH 3GTGH 1QG7A 3NP8A 4BBSH 3OTOL 5C4JB 1EY4A 1HZBA 5GQOA 4C3HH 4LAAA 1O7ZA 4MIUA 5A35A 3F2CA 4IUUA 3U4VA 2F0IA 1QVCA 2FINB 3M4YA 2NYZD 3RLNA 5C0XH 1XMQL 3K7AH 2JA8B 4TKOB 1TS3A 1SDFA 1N32L 4PNYA 3J81j 2KHIA 1KXLA 2BE5C 3KOJA 2IWHA 4HIMA 3HOWG 2HDMA 1F77A 1UNSA 4AQYQ 4GKJL 3FPPA 4OHJA 3E6ZX 1CA5A 2ZTEA 1RODA 1BNZA 1WTQA 4CJ1B 3HP3A 5TSSA 1HFNA 2JA5G 3L3OC 1AN8A 3MC0B 4ABNA 2CH4A 1YJWA 4JI4Q 3K5OA 1VQGA 5KNBA 2KA7A 3ICEA 5GAGC 1O7YA 4JI8L 2F0DA 2DJFC 1RHPA 2A69C 3G48A 1AE2A 2PZUA 2AQ3B 4U673 4G7ZC 4ZYSA 1BBWA 4LUOA 4BBSB 3QG1A 3S1QB 1X9NA 2B2TA 3SEBA 2E5LQ 1WD0A 1SE4A 4DV0Q 4MNOA 3CPWA 4L5TA 4WRDA 5EPJA 1ILQA 4ALPA 1WVLA 3SE0A 1YNXA 3S2DH 1RIPA 5IODA 4DGZA 4QGUA 1TWCH 2MP1A 3LNNA 4KV6A 1XYIA 2K5NA 1KRTA 3TSSA 5IYBH 5LMUL 5ELNA 3HOYG 1VQJA 4HTHA 2VUMH 4YHHL 4JI7L 1ICWA 5IP9H 4HJ7A 3FRPB 3GTJH 2AMCB 3I7FA 1BBUA 3HOUH 1HXYD 5AFWA 4XQQA 5FLMG 4JI2Q 1IBMQ 2L11A 1OXXK 2Q2UA 5BR8Q 1Y1VH 1QCBD 3RUZA 2JYOA 4K8JA 4LFBQ 1EEID 4LF4L 1STAA 1Z9FA 5C44B 4HAEA 5ELBA 2LXKA 1V43A 1X3QA 3H0GB 1T5EA 1PV4A 3M4QA 3VA5A 4JI4L 3EFXD 2NVTB 1A2TA 1LV9A 5G3LD 1B3AA 3KJPA 1WFQA 3AEVA 1SE3A 4BA2I 1HJPA 1I5FA 2Q2TA 2K5VA 5IE8A 1NMFA 1B44D 3RZOH 2Q8IB 3QJYA 3S1MH 2HHHQ 5HGTA 1HNZL 1LT6D 4B3TQ 3JAME 2NVXB 1S5CD 1NCVA 3CCMA 3ONAB 2HUGA 1ONLA 1WCMG 1AZPA 2E2JB 1XMQQ 4EVOA 3SHLA 2VUMB 1JICA 4DK3C 3JC66 1GOZA 2UUCQ 4QUCA 3VA7A 1F9QA 3HOZB 4JI2L 3VR6A 1LTID 1JWSD 3BYYB 3OWFA 1TQOA 2VXWA 4K14A 4DV2L 3BJUA 5K5PA 1PRTC 4K6DA 1MI2A 2P5ZX 4A93H 2R7ZH 1U0LA 2B63B 5C4ZA 2NWGA 3PIO3 2K04A 4OELB 3M3YB 2F0HA 1K8AC 1L1OC 1ET9A 1I4QA 2FMCA 4B3RL 1E7ZA 1FJGL 2WAQB 4GOPC 4ZAIA 2L0CA 2JA8G 3UDIA 5IYCG 4N9PA 2JQOA 4A4IA 1Z6HA 4A3EG 4NXNL 1XNQL 4DV1Q 4F8MA 1PFMA 5JJKA 3ZYYX 1LUZA 1L0XB 1X65A 1I6HB 3EBEA 2VQEL 1D5XC 1KHIA 4QUFA 3N52A 4JI0L 2WB1G 3KBGA 2WV6D 1GVPA 1STEA 3HOZH 4DPGA 5KIXA 3J81i 3SK4A 4UP7A 4B08A 4C3IH 5M5YH 3K80C 4APVA 3OTOQ 3PO3B 1JOKA 4MTKA 4KHVA 2KCNA 1PH7A 1CKOA 1KDAA 1JE5A 1XNRL 3Q22A 3CU7A 3IRBA 3LX0A 2X6LA 1U5KA 1MSGA 3RD4A 1RCVD 3TS0A 1IBLL 1PH1A 1HZCA 4ZLTF 2F4VQ 1N9WA 5IGGA 5JPMC 4KLKA 3I4NH 2MJ8A 1QZHA 3KFUA 3RLOA 5C5MA 4R9WA 5C4JH 1GHKA 1XX8A 1S3OA 1Q1EA 2AHOB 2ZXOA 3PUYA 2Z6BA 4XT3B 1FJGQ 4IFDJ 2NVYH 1H9JA 1O80A 4IALA 1XMOL 5ELCA 4YWLA 1VQ5A 1LYLA 2Z1CA 1PH2A 1LTBD 2CQAA 1EY0A 2F0LA 1QJOA 4XQNA 5JOBA 4P72A 3D4DA 1L0WA 2K52A 3KLRA 5EBDA 3S1RH 3K7UC 3NTHA 1Q8KA 1SMYC 3I4MH 1X55A 4KKTA 1PYSB 1VQPA 1HUNA 1VQ6A 4DAYA 3F2UA 2E74C 2AUKA 1I94Q 1NMGA 2YTXA 1HR0Q 1WTWA 4LFAQ 4BY7H 5COYA 4Y7NH 3S1QH 5IGEA 1F2MA 1B70B 1M90C 4XYOA 4DF7A 4E6IA 4P75A 4JI6L 2C5CA 2EYOA 2VQFQ 1YNJD 2OTJA 4HMJA 5HGQA 1ASYA 1H9KA 1B4OA 3MXGA 4JBKA 4GN3B 2CCZA 1PRTB 1PH6A 1PXUA 1NSNS 3KLSA 1Q12A 1S5ED 2A19A 3A7AB 2F4VL 2X69A 1IYUA 2EPBA 1W6JA 1L1OB 3HRZC 3R2TA 2KQ3A 2PI2A 3URYA 5GAHC 1A8VA 4QMGA 1EFWA 1P8LA 3W2DA 1CI3M 1BUVT 4R8IA 1B53A 5C44G 3F8TA 1A63A 1GM5A 4FO2A 4UP8A 1QVFA 5C4XB 1R4PB 2KECA 2F3WA 2NVTH 4V190 4QQBX 4A3CG 3RMHA 3BDCA 2MO0A 3T13A 4BS9A 1VQKA 1Y1WB 1DOKA 4POFA 3I3CA 3OW7A 1QNKA 3HOVG 3KBXA 4B3MQ 4ZK9B 1WI5A 3E0EA 2KUMA 3RNUA 1YNNC 2CWPA 5LL6S 3K5NA 4A3FB 1JB3A 1I4XA 1C48A 1J5EQ 2NTSA 4HIKA 1IKMA 1EQQA 3HOXH 4KY5A 1G51A 3OHXC 4HEDA 2BCOA 3MWYW 3GTQH 2ENBA 1FNUA 1YHAA 1IL2A 3QOJA 4GKKL 2B2YC 3ERQA 4C2MB 4CJ2C 3H0GG 3CCSA 3NQTA 3T56B 5KNCA 4KHPQ 3HKSA 3MXNA 4ODGA 4IUTA 3H94A 1BCPB 4WORA 4JI3L 1SYCA 4J15A 3PO2B 1GUTA 4NXML 1I3QH 1PH8A 3CCVA 1IYJB 1EIYB 1WTOA 4R4OA 1Z47A 3IFDA 3V2TA 1YVCA 3KF8A 5G3LF 1SEBD 1Z7TA 4JOIC 2IT1A 2PCFB 5C3XA 1EY8A 4M1UB 2VUMG 4OWXB 2FHTA 2KJXA 2R7DA 4DNTB 1W6KA 1E1TA 5CYUA 4DK0A 3EROA 1S5DD 2OT2A 1EYGA 5I6WA 2VZAA 1FYCA 2H4OA 3NK9A 3L9AX 2YTVA 1JQYD 4QIWE 3RZDB 1MJEA 2IX0A 2PQAA 3M3YH 1F9RA 2K28A 1DYQA 5BR8L 2XIWA 1LM0A 4FXGC 2JA5H 5JPNC 4DR4L 1KTKA 2B2UC 5IGDA 3S17B 2K50A 2IJ0A 1T9HA 5ELOA 1HZAA 1EWHA 5DLQE 3S2DB 4YY3Q 4GLXA 3K0YA 1VQ8A 1E2WA 4NP5A 3I4NB 4FXKC 5KNDA 4LUVA 3VYSA 3PO3G 4OONA 1A3UA 2A6HD 4OWWB 4P2CB 4RMFA 1QE6A 3JAML 4GZYC 4DK1A 3VR3A 2QKIC 2WINB 1OO9B 4ZCKA 3DWQA 5FO8B 2B29A 3NBIA 3U50C 5FOBB 1IHZA 5E3FA 2NBFA 4C1NK 1YIJA 4OO1G 1CHPD 3GP7A 2UXDQ 5CMDA 2ZTCA 1A6XA 1ENAA 1PVOA 1STHA 3OMCA 1WD1A 4A3LH 4F7XA 4IUPA 4DUYQ 4KD3A 2CKZB 3TMEA 4A3DH 2F0MA 3A8IE 1OXTA 4A3GH 1S5FD 4KN7C 1X3FA 4EGVA 3S1MB 1MSHA 3J7A5 3A5ZB 1IZ6A 1QNUA 1CKNB 4RGOS 1B7YB 2F52A 1V8QA 2BA1A 2CW0C 1G6PA 1Y8NB 4CKCA 1IKLA 1WTPA 2OQKA 3RR5A 3S9WA 1KQSA 4DR6L 5DM73 1N36Q 4C1NI 4BBRB 4A3IB 1YNJC 3PUVA 3WOFA 2VY3A 4HIDA 3RZDH 2QCPX 1EIFA 3EJIA 2IHEA 1QUQA 3S14H 3GTMH 1CT1D 1SE2A 5IT9c 3M4PA 2WB1E 4K0KQ 3BVMA 4PZ8A 5IIFA 5E1FA 1PYBA 1PZKD 5C5LA 4JV5Q 2JEAI 4RGTA 3HOUG 3TEHB 1J5EL 2F0QA 4JI6Q 3PF5A 4L63B 4PV1C 2YU9H 1N34L 2WAQE 1ZYRC 1PRTD 4FXDA 4KKUA 3DWPA 1SNOA 4NB3A 4JOIA 1SNDA 1EIGA 2Z4HA 4WJ4A 2B2TC 5KYLA 3GV6A 1I94L 2YYZA 1DXMA 2B2VA 2EJGC 3BDOA 2N8NA 2UUAL 1K9MC 3HOUB 5E4XA 1AE3A 3D4RA 1D6EC 1HNXQ 4FF4A 4JYAQ 1VQMA 2Z4IA 3BZDB 1PTOD 4K0KL 1KC8C 2OF1A 4A75A 4Z9CB 2PYKA 4WJ3M 5IYDG 3UDGA 3GTKB 5KYIA 2FFKB 3O13A 1SFOH 2Q8RE 4DR6Q 1VQAA 5K36G 3QWNA 3K58A 5JVH3 3D8GA 1FNWA 1L1OA 4YCUA 4LFCQ 2KEEA 1Y1WG
chains in the Genus database with same CATH topology
5FJ8G 2UUBQ 2KBNA 1N33L 2I5HA 4UY8C 1PHJA 2E2IH 4OWTB 1TWGH 3PV0A 4X65L 2UUCL 4PG3A 1WCMG 3STBC 1XMQQ 3B6YA 2ZTDA 4R4CA 2UXBQ 4IPGA 2UXBL 4DK3C 4DV3Q 3JC66 2JA7G 2UUAQ 2UUCQ 2UU9Q 4JI2L 1N33Q 1XPUA 3MEFA 3DLLA 3CMEA 1PA6A 1N32Q 4DV2L 3BJUA 3HKZG 3F2DA 3FP9A 1E1OA 3I55A 5C3EH 3PO2H 5C4XH 2KENA 2R7ZH 4A93H 1U0LA 4DV7Q 4DV4L 1K8AC 1L1OC 3KDFB 2UXDL 4XIGS 4B3RL 3RLFA 1Q86C 1E7ZA 1FJGL 4DUZQ 4QL5A 1NBWA 4GOPC 1KAWA 2Z0SA 3UE1A 3GDEA 3I56A 4A3KH 1PH9A 4YCVA 4GKKQ 2ZJQA 2QEXA 5FJ8H 2JA8G 4KI0A 4P73A 3S24A 5LMNL 3UDIA 2JEBI 1HNZQ 5IYCG 4B3TL 2AKWB 3CC4A 1JJCB 2JQOA 3VDYA 4A4IA 2LSSA 4Y52H 4A3EG 4NXNL 1XNQL 4OO1I 4DV1Q 2NVXH 1X54A 5JEAG 3RN2A 3A74A 4A3BG 5JJKA 2UUBL 1LUZA 3J80i 3M7NA 4LWCA 1X65A 1Y1VG 2Q2HA 3EBEA 4R4IA 2VQEL 3J81c 1KHIA 3CF5A 3TS2A 2R93G 4JI0L 2KCTA 2WB1G 4YY3L 1VQOA 2ZJPA 2MFIA 3ULJA 1HNXL 2KCMA 2BH2A 1GVPA 4P74A 4LF7L 4RG1A 3HOZH 2WFWA 4DPGA 4A3EH 1V1QA 4LFBL 2VW9A 3J81i 4UP7A 4C3IH 3PUXA 1K83H 2JA9A 3K80C 5M5YH 4APVA 4LUZA 4A3BH 5M5WH 3OTOQ 3E9IA 4LF6Q 4L5SA 1YHBA 1K8GA 3G6EA 1PH7A 1CKOA 2D0OA 4BY1G 1JE5A 2ALYB 5IYCH 1RL2A 1VQ9A 1XNRL 3J80c 4DV7L 2JK8A 4HIOA 3PF4A 3IRBA 4A3KG 3HOXG 4NPSA 1U5KA 1WJJA 3Q8DA 4X66L 2B3GA 5C0XJ 3CMAA 3TS0A 1IBLL 3AQQA 3DM3A 3UE0A 1PH1A 1HZCA 2F4VQ 1N9WA 1GKHA 4KLKA 3I4NH 5AJ3L 4X66Q 1QZHA 3KFUA 1VS0A 3S15H 2PMZE 3RLOA 2D0PA 2HIXA 3KYHC 3UDXA 5IYBG 3CXCA 1E24A 1OXUA 2MO1A 2IY5B 5M3MH 3FKIH 5C4JH 4DV0L 1JMCA 1HR0L 1S3OA 2BA0A 1Q1EA 1VQEA 2AHOB 3S2HH 3PUYA 3H15A 2UXCL 2F3IA 2N49A 2PI2E 1QZGA 1JJGA 1FJGQ 1UE7A 4IFDJ 2CFMA 3KF8B 2NVYH 4NXMQ 1OXSC 2PQAB 3J7ZC 3K81C 2HT1A 4DR7Q 2I5MX 1XMOL 4YWLA 1VQ5A 1LYLA 1PH2A 5JEAJ 5M3FH 3CCUA 4IJHA 3K8AA 2EIFA 4LF9Q 1FVIA 3KLWA 4JI5L 2JA8H 4P72A 1PH3A 1L0WA 3GTKH 4L5QA 4A3DG 2N3SA 4JBMA 2K52A 1HZ9A 4JBWA 4OX9L 1KL9A 3F1ZA 3S1RH 3D0FA 3K7UC 4B3ML 4ME3A 1V9PA 1Q8KA 2JE6I 4HJ8A 1XNQQ 4JI8Q 3I4MH 1X55A 3PSIA 1P16A 2I0QA 1PYSB 1SN8A 2H5XA 5M3MG 4BXXG 1AH9A 1VQPA 3F2BA 1VQ6A 3A5UA 1N8RC 4POGA 4PZ6A 2PNHA 1HR0W 4LNQA 2AWNA 1W2BA 3L7ZC 2ID0A 1I94Q 1NMGA 2YTXA 3M9BA 1HR0Q 2ATWA 2JA7H 1UE6A 4LFAQ 4BY7H 1SRUA 2GVAA 3W1GA 4GNXB 4Y7NH 3CP0A 3KDFA 3CCLA 3S1QH 1X6OA 4EX5A 1B70B 1CUKA 4DR7L 3ERSX 1M90C 2N78A 2NVQH 1H95A 2K4KA 4P75A 2R92H 4DK6C 1TWFH 4A3MH 4JI6L 1K0RA 5JJIA 4GN4B 3AFPA 2RF4A 2VQFQ 1CKMA 4AH6A 3CC2A 2OTJA 1WOCA 2R7ZG 5C4XG 2YTYA 3I4OA 5J3BA 4IPHA 5HGQA 2AWOA 3GO5A 5C44H 1ASYA 4JBKA 4GN3B 1HNWL 2D62A 2FXQA 4JBJA 2CCZA 4X65Q 1N34Q 4DV6Q 2VNUD 3BZKA 1VQ4A 1PH6A 1YJNA 3H3VI 2Y0SE 1Q12A 2A19A 2F4VL 2MNAA 3U58A 1L1OB 1WYDA 4GOPA 2JA6G 1LTLA 1C9OA 3FHWA 1R9TH 2V1CC 4X62Q 1QVGA 4X6AH 4X62L 4LF5Q 2PI2A 1E22A 2EXDA 5GAHC 1A8VA 3L0OA 4QY7A 1J6QA 2DUDA 2NN6G 4MTNA 2ZJRA 1EFWA 1P8LA 4FDBA 2NN6I 1PH4A 3T1YL 5FLMH 5FLXc 1JB7A 2ZM6Q 5C44G 2QGQA 3D31A 3HOVH 3F8TA 4DR3Q 4BY1H 4IOCA 3OYYA 4UP8A 1N36L 1GM5A 4GLAC 4IFDI 5IWAL 1QVFA 1ASZA 2YV5A 3CPFA 5IWAQ 1GO3E 1QUQB 2E8GA 2MQHA 1G291 3PCOB 2R7FA 2NVTH 3H3VH 4QQBX 1MIUA 2CWAA 2R92G 2IX1A 4A3CG 2K75A 4DR4Q 1C0AA 2MO0A 1IBML 4DR1L 4IOAA 3T1HQ 1VQKA 1Q1BA 4LF9L 4POFA 3NEMA 2HHHL 2B63G 4IJLA 3HOVG 1VQ7A 1Y14B 1EOVA 4B3MQ 3TRZA 1WI5A 2BH8A 3E0EA 3RNUA 3G71A 2CWPA 4YWKA 2A1AA 4X64L 4DV2Q 1D7QA 3M85A 4L5RC 3KJOA 1NJIC 3A0JA 3W5OA 1D8LA 1BKBA 2UXCQ 1J5EQ 4B3RQ 4DV5Q 4HIKA 2UU9L 4LF8Q 2L15A 5H1SE 2K5HA 1EQQA 2R6GA 3HOXH 1G51A 2Q2IA 4LF4Q 3GTQH 2GVBA 1PH5A 3FKIG 4JI1Q 4JI3Q 1YHAA 5LMNQ 3K0XA 1IL2A 3W1BA 2VQFL 4DNIA 4GKKL 5IYDH 1XPRA 3CW2C 3BU2A 1SROA 3KF6B 1OTCA 2JA6H 3H0GG 3CCSA 4IFDG 1A62A 2EQSA 4LFCL 4HJ5A 1A63A 4KHPQ 5JJLA 3HKSA 4B3SL 3PO3H 4C2MH 4YHHQ 4JI7Q 3NELA 2A8VA 1TWHH 4JI3L 5C3EG 3PO2G 4A93G 1EUJA 1UEBA 3MXNB 1YITA 4GOPB 3HFZB 1X56A 4DR2Q 5M5XH 4J15A 2XGTA 3OW2A 4NXML 1DGSA 1I3QH 4PMWA 2KHJA 1IYJB 1WCMH 3GD7A 3CCVA 1PH8A 1IBKL 1EIYB 2RHSB 4IPCA 1IBLQ 4R4OA 1UE5A 1Z47A 1YVCA 1Q46A 3CAMA 1VQDA 2WAQG 4JI1L 1VQNA 4GS3A 1X3EA 2IT1A 4JOIC 5GAEC 1L2FA 4DR5Q 4UPAA 4LF7Q 4JYAL 1BVSA 3GTOH 2VUMG 4OWXB 1I6HH 4DAMA 1E3PA 2R7DA 5IY0A 1E1TA 4A3LG 3CCEA 3ZJYC 4A3FH 2QA4A 4HJAA 4BY7G 3JAMc 3AFQA 3CCRA 4X64Q 2R93H 4DR1Q 5IP7H 1EYGA 1YEZA 2VS1A 3I4MG 1NE3A 3GTPH 4BBSG 4TVAB 2E2JH 4IO9A 2VZAA 1YJ9A 2RHQB 1CKNA 2YTVA 4QIWE 4NXNQ 1MJEA 2IX0A 2PQAA 1YHQA 3CCQA 3M3YH 1XTDA 4EQ5A 5C0XI 2NZOA 3G4SA 4YWMA 3CD6A 4A3MG 3I2ZA 5C0XG 3PIOA 3S16H 4P71A 3E9HA 5BR8L 3L2PA 3T1HL 4AIMA 3S17H 1LM0A 4GNXC 2JA5H 4DR4L 1B8AA 3ULPA 3H0GH 4H02A 1MJCA 1C7YA 2K50A 3SGIA 1T9HA 4JCVE 5ELOA 2ASBA 4JV5L 1HZAA 1CSPA 5DLQE 1Q7YC 4YY3Q 4GLXA 1A0IA 4QJFA 3RN5A 1I50H 1S72A 1VQ8A 2ZM6L 4AQYL 5HY6A 1XPOA 1MKHA 1VQFA 4LUVA 4R4QA 4A3FG 4JI5Q 3PO3G 1IBKQ 3I4NG 4OONA 1YI2A 1VQHA 5M3FG 2Q2TA 4OWWB 1VQIA 1YBYA 3HOZG 1W3SA 4RMFA 3TQYA 4LF5L 1K3RA 3BZCA 3S1NH 3PIPA 1XNRQ 4C3JH 1FGUA 1PFSA 4DKAC 1XMOQ 4DR5L 4A3GG 1TXYA 1VCIA 3CQZH 3UDFA 2B29A 2WP8J 3U50C 4BBRH 3ER0A 4A3IH 3GTGH 3WWVA 1JJ2A 1GD7A 1YIJA 5E7NA 4BBSH 1NTGA 3OTOL 4OO1G 4HJ9A 2OQ0A 1HZBA 1SR3A 2HQLA 4TQUS 5GQOA 4C3HH 1KRSA 2UXDQ 2ZTCA 3F2CA 1KD1C 3U4VA 1TWAH 3AYHB 4GLVB 4DV3L 3GTLH 1PVOA 1QVCA 4DR2L 4A3CH 1SMXA 1VQBA 3RLNA 4A3LH 1XMQL 3EN2A 2LXJA 3K7AH 3NBHB 2E5LL 4R4TA 4JG2A 5AJ3Q 4A3JG 4JI0Q 4GKJQ 1N32L 1O7IA 3J81j 4DUYQ 2KHIA 1M1KC 1KXLA 5GADC 1FL0A 2CKZB 3KOJA 4HIMA 3HOWG 3TREA 1UWVA 3PGZA 4A3DH 4AQYQ 4GKJL 2XTIA 1OXTA 1CSQA 4A3GH 1X3FA 1KIXA 3J7A5 2GN5A 2ZTEA 3A5ZB 1IZ6A 1VQCA 1CKNB 2CQOA 3NENA 1K73C 4DR3L 1B7YB 2JA5G 4AYBG 1XJVA 1SLJA 4KHZA 1YJWA 2F52A 4JI4Q 2BA1A 1VQGA 1G6PA 4DUZL 3HOWH 1EQRA 5GAGC 3ICEA 4LW1A 4GN5A 3HKZE 2OQKA 3RR5A 4JI8L 1KQSA 4DR6L 3G48A 1N36Q 1AE2A 1HH2P 5IP9G 2IHFA 2K14A 3PUVA 4MZ9A 4BA1I 2VY3A 1BBWA 4LUOA 4R1JA 4HIDA 3RZDH 4OX9Q 1EIFA 2VQEQ 4B3SQ 2IHEA 1QUQA 3S14H 2VL6A 3GTMH 2OTLA 5IT9c 3M4PA 2WB1E 1X9NA 3PUZA 4IPDA 4K0KQ 5EAYA 4PZ8A 1Y1WH 2E5LQ 2C35B 4DV6L 4DV0Q 4MNOA 1S40A 3CPWA 4L5TA 1PYBA 4BBRG 4A3IG 4AYBE 3JAMi 3CCJA 4ALPA 4JV5Q 2Z6KC 1YNXA 5IP7G 5GROA 4LF8L 2JEAI 3S2DH 1RIPA 3EIVA 3HOUG 3TEHB 1J5EL 4QGUA 4JI6Q 1TWCH 1X3GA 2I5LX 3PUWA 4A3JH 2DGYA 3PF5A 4O0AA 2YU9H 1N34L 2K5NA 2WAQE 4JC0A 1KRTA 2RCNA 5IYBH 2ES2A 1HNWQ 4DV4Q 5LMUL 5ELNA 5LMUQ 2NZHA 1VQJA 4NB3A 3HOYG 2VUMH 4YHHL 4JI7L 4JOIA 4O2DA 1JT8A 5IP9H 4HJ7A 3GTJH 4WJ4A 2AMCB 3U4ZA 3I7FA 1Q81C 1BBUA 3HOUH 1I94L 2YYZA 5FLMG 4UP9A 4JI2Q 1IBMQ 3STBD 1OXXK 2Q2UA 4YCWA 5BR8Q 1Y1VH 4OXPA 2N8NA 2UUAL 2E2HH 2OCEA 1K9MC 1YZ6A 2Y0SG 4LFBQ 2Z6KA 1AE3A 4LF4L 2JJQA 1Z9FA 4XTCS 1EWIA 5LMNW 1HNXQ 4LFAL 2LXKA 3HOYH 4JYAQ 1V43A 4DAYB 4DV5L 1VQMA 3CC7A 3M4OH 4LF6L 4K0KL 1VQLA 1OXVA 3T1YQ 1IXRA 4PZ7A 3M4QA 1KC8C 1PV4A 4A75A 1UE1A 4JI4L 4BXXH 3AEVA 3KJPA 4DUYL 1WFQA 4WJ3M 4BA2I 1HJPA 1I5FA 1NY4A 2K5VA 5IYDG 5IE8A 1NMFA 3ULLA 4GNXA 3UDGA 1SFOH 1Q82C 4DV1L 2B63H 3RZOH 4DR6Q 2HIVA 1VQAA 5K36G 3KF6A 3S1MH 3LGJA 2HHHQ 1HNZL 2OWOA 1SE8A 4B3TQ 4KHPL 1L1OA 4YCUA 4A76A 4LFCQ 1Y1WG 3CCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FJ8 G;  2UUB Q;  2KBN A;  1N33 L;  2I5H A;  4UY8 C;  1PHJ A;  2E2I H;  4OWT B;  1TWG H;  3PV0 A;  4X65 L;  2UUC L;  4PG3 A;  1WCM G;  3STB C;  1XMQ Q;  3B6Y A;  2ZTD A;  4R4C A;  2UXB Q;  4IPG A;  2UXB L;  4DK3 C;  4DV3 Q;  3JC6 6;  2JA7 G;  2UUA Q;  2UUC Q;  2UU9 Q;  4JI2 L;  1N33 Q;  1XPU A;  3MEF A;  3DLL A;  3CME A;  1PA6 A;  1N32 Q;  4DV2 L;  3BJU A;  3HKZ G;  3F2D A;  3FP9 A;  1E1O A;  3I55 A;  5C3E H;  3PO2 H;  5C4X H;  2KEN A;  2R7Z H;  4A93 H;  1U0L A;  4DV7 Q;  4DV4 L;  1K8A C;  1L1O C;  3KDF B;  2UXD L;  4XIG S;  4B3R L;  3RLF A;  1Q86 C;  1E7Z A;  1FJG L;  4DUZ Q;  4QL5 A;  1NBW A;  4GOP C;  1KAW A;  2Z0S A;  3UE1 A;  3GDE A;  3I56 A;  4A3K H;  1PH9 A;  4YCV A;  4GKK Q;  2ZJQ A;  2QEX A;  5FJ8 H;  2JA8 G;  4KI0 A;  4P73 A;  3S24 A;  5LMN L;  3UDI A;  2JEB I;  1HNZ Q;  5IYC G;  4B3T L;  2AKW B;  3CC4 A;  1JJC B;  2JQO A;  3VDY A;  4A4I A;  2LSS A;  4Y52 H;  4A3E G;  4NXN L;  1XNQ L;  4OO1 I;  4DV1 Q;  2NVX H;  1X54 A;  5JEA G;  3RN2 A;  3A74 A;  4A3B G;  5JJK A;  2UUB L;  1LUZ A;  3J80 i;  3M7N A;  4LWC A;  1X65 A;  1Y1V G;  2Q2H A;  3EBE A;  4R4I A;  2VQE L;  3J81 c;  1KHI A;  3CF5 A;  3TS2 A;  2R93 G;  4JI0 L;  2KCT A;  2WB1 G;  4YY3 L;  1VQO A;  2ZJP A;  2MFI A;  3ULJ A;  1HNX L;  2KCM A;  2BH2 A;  1GVP A;  4P74 A;  4LF7 L;  4RG1 A;  3HOZ H;  2WFW A;  4DPG A;  4A3E H;  1V1Q A;  4LFB L;  2VW9 A;  3J81 i;  4UP7 A;  4C3I H;  3PUX A;  1K83 H;  2JA9 A;  3K80 C;  5M5Y H;  4APV A;  4LUZ A;  4A3B H;  5M5W H;  3OTO Q;  3E9I A;  4LF6 Q;  4L5S A;  1YHB A;  1K8G A;  3G6E A;  1PH7 A;  1CKO A;  2D0O A;  4BY1 G;  1JE5 A;  2ALY B;  5IYC H;  1RL2 A;  1VQ9 A;  1XNR L;  3J80 c;  4DV7 L;  2JK8 A;  4HIO A;  3PF4 A;  3IRB A;  4A3K G;  3HOX G;  4NPS A;  1U5K A;  1WJJ A;  3Q8D A;  4X66 L;  2B3G A;  5C0X J;  3CMA A;  3TS0 A;  1IBL L;  3AQQ A;  3DM3 A;  3UE0 A;  1PH1 A;  1HZC A;  2F4V Q;  1N9W A;  1GKH A;  4KLK A;  3I4N H;  5AJ3 L;  4X66 Q;  1QZH A;  3KFU A;  1VS0 A;  3S15 H;  2PMZ E;  3RLO A;  2D0P A;  2HIX A;  3KYH C;  3UDX A;  5IYB G;  3CXC A;  1E24 A;  1OXU A;  2MO1 A;  2IY5 B;  5M3M H;  3FKI H;  5C4J H;  4DV0 L;  1JMC A;  1HR0 L;  1S3O A;  2BA0 A;  1Q1E A;  1VQE A;  2AHO B;  3S2H H;  3PUY A;  3H15 A;  2UXC L;  2F3I A;  2N49 A;  2PI2 E;  1QZG A;  1JJG A;  1FJG Q;  1UE7 A;  4IFD J;  2CFM A;  3KF8 B;  2NVY H;  4NXM Q;  1OXS C;  2PQA B;  3J7Z C;  3K81 C;  2HT1 A;  4DR7 Q;  2I5M X;  1XMO L;  4YWL A;  1VQ5 A;  1LYL A;  1PH2 A;  5JEA J;  5M3F H;  3CCU A;  4IJH A;  3K8A A;  2EIF A;  4LF9 Q;  1FVI A;  3KLW A;  4JI5 L;  2JA8 H;  4P72 A;  1PH3 A;  1L0W A;  3GTK H;  4L5Q A;  4A3D G;  2N3S A;  4JBM A;  2K52 A;  1HZ9 A;  4JBW A;  4OX9 L;  1KL9 A;  3F1Z A;  3S1R H;  3D0F A;  3K7U C;  4B3M L;  4ME3 A;  1V9P A;  1Q8K A;  2JE6 I;  4HJ8 A;  1XNQ Q;  4JI8 Q;  3I4M H;  1X55 A;  3PSI A;  1P16 A;  2I0Q A;  1PYS B;  1SN8 A;  2H5X A;  5M3M G;  4BXX G;  1AH9 A;  1VQP A;  3F2B A;  1VQ6 A;  3A5U A;  1N8R C;  4POG A;  4PZ6 A;  2PNH A;  1HR0 W;  4LNQ A;  2AWN A;  1W2B A;  3L7Z C;  2ID0 A;  1I94 Q;  1NMG A;  2YTX A;  3M9B A;  1HR0 Q;  2ATW A;  2JA7 H;  1UE6 A;  4LFA Q;  4BY7 H;  1SRU A;  2GVA A;  3W1G A;  4GNX B;  4Y7N H;  3CP0 A;  3KDF A;  3CCL A;  3S1Q H;  1X6O A;  4EX5 A;  1B70 B;  1CUK A;  4DR7 L;  3ERS X;  1M90 C;  2N78 A;  2NVQ H;  1H95 A;  2K4K A;  4P75 A;  2R92 H;  4DK6 C;  1TWF H;  4A3M H;  4JI6 L;  1K0R A;  5JJI A;  4GN4 B;  3AFP A;  2RF4 A;  2VQF Q;  1CKM A;  4AH6 A;  3CC2 A;  2OTJ A;  1WOC A;  2R7Z G;  5C4X G;  2YTY A;  3I4O A;  5J3B A;  4IPH A;  5HGQ A;  2AWO A;  3GO5 A;  5C44 H;  1ASY A;  4JBK A;  4GN3 B;  1HNW L;  2D62 A;  2FXQ A;  4JBJ A;  2CCZ A;  4X65 Q;  1N34 Q;  4DV6 Q;  2VNU D;  3BZK A;  1VQ4 A;  1PH6 A;  1YJN A;  3H3V I;  2Y0S E;  1Q12 A;  2A19 A;  2F4V L;  2MNA A;  3U58 A;  1L1O B;  1WYD A;  4GOP A;  2JA6 G;  1LTL A;  1C9O A;  3FHW A;  1R9T H;  2V1C C;  4X62 Q;  1QVG A;  4X6A H;  4X62 L;  4LF5 Q;  2PI2 A;  1E22 A;  2EXD A;  5GAH C;  1A8V A;  3L0O A;  4QY7 A;  1J6Q A;  2DUD A;  2NN6 G;  4MTN A;  2ZJR A;  1EFW A;  1P8L A;  4FDB A;  2NN6 I;  1PH4 A;  3T1Y L;  5FLM H;  5FLX c;  1JB7 A;  2ZM6 Q;  5C44 G;  2QGQ A;  3D31 A;  3HOV H;  3F8T A;  4DR3 Q;  4BY1 H;  4IOC A;  3OYY A;  4UP8 A;  1N36 L;  1GM5 A;  4GLA C;  4IFD I;  5IWA L;  1QVF A;  1ASZ A;  2YV5 A;  3CPF A;  5IWA Q;  1GO3 E;  1QUQ B;  2E8G A;  2MQH A;  1G29 1;  3PCO B;  2R7F A;  2NVT H;  3H3V H;  4QQB X;  1MIU A;  2CWA A;  2R92 G;  2IX1 A;  4A3C G;  2K75 A;  4DR4 Q;  1C0A A;  2MO0 A;  1IBM L;  4DR1 L;  4IOA A;  3T1H Q;  1VQK A;  1Q1B A;  4LF9 L;  4POF A;  3NEM A;  2HHH L;  2B63 G;  4IJL A;  3HOV G;  1VQ7 A;  1Y14 B;  1EOV A;  4B3M Q;  3TRZ A;  1WI5 A;  2BH8 A;  3E0E A;  3RNU A;  3G71 A;  2CWP A;  4YWK A;  2A1A A;  4X64 L;  4DV2 Q;  1D7Q A;  3M85 A;  4L5R C;  3KJO A;  1NJI C;  3A0J A;  3W5O A;  1D8L A;  1BKB A;  2UXC Q;  1J5E Q;  4B3R Q;  4DV5 Q;  4HIK A;  2UU9 L;  4LF8 Q;  2L15 A;  5H1S E;  2K5H A;  1EQQ A;  2R6G A;  3HOX H;  1G51 A;  2Q2I A;  4LF4 Q;  3GTQ H;  2GVB A;  1PH5 A;  3FKI G;  4JI1 Q;  4JI3 Q;  1YHA A;  5LMN Q;  3K0X A;  1IL2 A;  3W1B A;  2VQF L;  4DNI A;  4GKK L;  5IYD H;  1XPR A;  3CW2 C;  3BU2 A;  1SRO A;  3KF6 B;  1OTC A;  2JA6 H;  3H0G G;  3CCS A;  4IFD G;  1A62 A;  2EQS A;  4LFC L;  4HJ5 A;  1A63 A;  4KHP Q;  5JJL A;  3HKS A;  4B3S L;  3PO3 H;  4C2M H;  4YHH Q;  4JI7 Q;  3NEL A;  2A8V A;  1TWH H;  4JI3 L;  5C3E G;  3PO2 G;  4A93 G;  1EUJ A;  1UEB A;  3MXN B;  1YIT A;  4GOP B;  3HFZ B;  1X56 A;  4DR2 Q;  5M5X H;  4J15 A;  2XGT A;  3OW2 A;  4NXM L;  1DGS A;  1I3Q H;  4PMW A;  2KHJ A;  1IYJ B;  1WCM H;  3GD7 A;  3CCV A;  1PH8 A;  1IBK L;  1EIY B;  2RHS B;  4IPC A;  1IBL Q;  4R4O A;  1UE5 A;  1Z47 A;  1YVC A;  1Q46 A;  3CAM A;  1VQD A;  2WAQ G;  4JI1 L;  1VQN A;  4GS3 A;  1X3E A;  2IT1 A;  4JOI C;  5GAE C;  1L2F A;  4DR5 Q;  4UPA A;  4LF7 Q;  4JYA L;  1BVS A;  3GTO H;  2VUM G;  4OWX B;  1I6H H;  4DAM A;  1E3P A;  2R7D A;  5IY0 A;  1E1T A;  4A3L G;  3CCE A;  3ZJY C;  4A3F H;  2QA4 A;  4HJA A;  4BY7 G;  3JAM c;  3AFQ A;  3CCR A;  4X64 Q;  2R93 H;  4DR1 Q;  5IP7 H;  1EYG A;  1YEZ A;  2VS1 A;  3I4M G;  1NE3 A;  3GTP H;  4BBS G;  4TVA B;  2E2J H;  4IO9 A;  2VZA A;  1YJ9 A;  2RHQ B;  1CKN A;  2YTV A;  4QIW E;  4NXN Q;  1MJE A;  2IX0 A;  2PQA A;  1YHQ A;  3CCQ A;  3M3Y H;  1XTD A;  4EQ5 A;  5C0X I;  2NZO A;  3G4S A;  4YWM A;  3CD6 A;  4A3M G;  3I2Z A;  5C0X G;  3PIO A;  3S16 H;  4P71 A;  3E9H A;  5BR8 L;  3L2P A;  3T1H L;  4AIM A;  3S17 H;  1LM0 A;  4GNX C;  2JA5 H;  4DR4 L;  1B8A A;  3ULP A;  3H0G H;  4H02 A;  1MJC A;  1C7Y A;  2K50 A;  3SGI A;  1T9H A;  4JCV E;  5ELO A;  2ASB A;  4JV5 L;  1HZA A;  1CSP A;  5DLQ E;  1Q7Y C;  4YY3 Q;  4GLX A;  1A0I A;  4QJF A;  3RN5 A;  1I50 H;  1S72 A;  1VQ8 A;  2ZM6 L;  4AQY L;  5HY6 A;  1XPO A;  1MKH A;  1VQF A;  4LUV A;  4R4Q A;  4A3F G;  4JI5 Q;  3PO3 G;  1IBK Q;  3I4N G;  4OON A;  1YI2 A;  1VQH A;  5M3F G;  2Q2T A;  4OWW B;  1VQI A;  1YBY A;  3HOZ G;  1W3S A;  4RMF A;  3TQY A;  4LF5 L;  1K3R A;  3BZC A;  3S1N H;  3PIP A;  1XNR Q;  4C3J H;  1FGU A;  1PFS A;  4DKA C;  1XMO Q;  4DR5 L;  4A3G G;  1TXY A;  1VCI A;  3CQZ H;  3UDF A;  2B29 A;  2WP8 J;  3U50 C;  4BBR H;  3ER0 A;  4A3I H;  3GTG H;  3WWV A;  1JJ2 A;  1GD7 A;  1YIJ A;  5E7N A;  4BBS H;  1NTG A;  3OTO L;  4OO1 G;  4HJ9 A;  2OQ0 A;  1HZB A;  1SR3 A;  2HQL A;  4TQU S;  5GQO A;  4C3H H;  1KRS A;  2UXD Q;  2ZTC A;  3F2C A;  1KD1 C;  3U4V A;  1TWA H;  3AYH B;  4GLV B;  4DV3 L;  3GTL H;  1PVO A;  1QVC A;  4DR2 L;  4A3C H;  1SMX A;  1VQB A;  3RLN A;  4A3L H;  1XMQ L;  3EN2 A;  2LXJ A;  3K7A H;  3NBH B;  2E5L L;  4R4T A;  4JG2 A;  5AJ3 Q;  4A3J G;  4JI0 Q;  4GKJ Q;  1N32 L;  1O7I A;  3J81 j;  4DUY Q;  2KHI A;  1M1K C;  1KXL A;  5GAD C;  1FL0 A;  2CKZ B;  3KOJ A;  4HIM A;  3HOW G;  3TRE A;  1UWV A;  3PGZ A;  4A3D H;  4AQY Q;  4GKJ L;  2XTI A;  1OXT A;  1CSQ A;  4A3G H;  1X3F A;  1KIX A;  3J7A 5;  2GN5 A;  2ZTE A;  3A5Z B;  1IZ6 A;  1VQC A;  1CKN B;  2CQO A;  3NEN A;  1K73 C;  4DR3 L;  1B7Y B;  2JA5 G;  4AYB G;  1XJV A;  1SLJ A;  4KHZ A;  1YJW A;  2F52 A;  4JI4 Q;  2BA1 A;  1VQG A;  1G6P A;  4DUZ L;  3HOW H;  1EQR A;  5GAG C;  3ICE A;  4LW1 A;  4GN5 A;  3HKZ E;  2OQK A;  3RR5 A;  4JI8 L;  1KQS A;  4DR6 L;  3G48 A;  1N36 Q;  1AE2 A;  1HH2 P;  5IP9 G;  2IHF A;  2K14 A;  3PUV A;  4MZ9 A;  4BA1 I;  2VY3 A;  1BBW A;  4LUO A;  4R1J A;  4HID A;  3RZD H;  4OX9 Q;  1EIF A;  2VQE Q;  4B3S Q;  2IHE A;  1QUQ A;  3S14 H;  2VL6 A;  3GTM H;  2OTL A;  5IT9 c;  3M4P A;  2WB1 E;  1X9N A;  3PUZ A;  4IPD A;  4K0K Q;  5EAY A;  4PZ8 A;  1Y1W H;  2E5L Q;  2C35 B;  4DV6 L;  4DV0 Q;  4MNO A;  1S40 A;  3CPW A;  4L5T A;  1PYB A;  4BBR G;  4A3I G;  4AYB E;  3JAM i;  3CCJ A;  4ALP A;  4JV5 Q;  2Z6K C;  1YNX A;  5IP7 G;  5GRO A;  4LF8 L;  2JEA I;  3S2D H;  1RIP A;  3EIV A;  3HOU G;  3TEH B;  1J5E L;  4QGU A;  4JI6 Q;  1TWC H;  1X3G A;  2I5L X;  3PUW A;  4A3J H;  2DGY A;  3PF5 A;  4O0A A;  2YU9 H;  1N34 L;  2K5N A;  2WAQ E;  4JC0 A;  1KRT A;  2RCN A;  5IYB H;  2ES2 A;  1HNW Q;  4DV4 Q;  5LMU L;  5ELN A;  5LMU Q;  2NZH A;  1VQJ A;  4NB3 A;  3HOY G;  2VUM H;  4YHH L;  4JI7 L;  4JOI A;  4O2D A;  1JT8 A;  5IP9 H;  4HJ7 A;  3GTJ H;  4WJ4 A;  2AMC B;  3U4Z A;  3I7F A;  1Q81 C;  1BBU A;  3HOU H;  1I94 L;  2YYZ A;  5FLM G;  4UP9 A;  4JI2 Q;  1IBM Q;  3STB D;  1OXX K;  2Q2U A;  4YCW A;  5BR8 Q;  1Y1V H;  4OXP A;  2N8N A;  2UUA L;  2E2H H;  2OCE A;  1K9M C;  1YZ6 A;  2Y0S G;  4LFB Q;  2Z6K A;  1AE3 A;  4LF4 L;  2JJQ A;  1Z9F A;  4XTC S;  1EWI A;  5LMN W;  1HNX Q;  4LFA L;  2LXK A;  3HOY H;  4JYA Q;  1V43 A;  4DAY B;  4DV5 L;  1VQM A;  3CC7 A;  3M4O H;  4LF6 L;  4K0K L;  1VQL A;  1OXV A;  3T1Y Q;  1IXR A;  4PZ7 A;  3M4Q A;  1KC8 C;  1PV4 A;  4A75 A;  1UE1 A;  4JI4 L;  4BXX H;  3AEV A;  3KJP A;  4DUY L;  1WFQ A;  4WJ3 M;  4BA2 I;  1HJP A;  1I5F A;  1NY4 A;  2K5V A;  5IYD G;  5IE8 A;  1NMF A;  3ULL A;  4GNX A;  3UDG A;  1SFO H;  1Q82 C;  4DV1 L;  2B63 H;  3RZO H;  4DR6 Q;  2HIV A;  1VQA A;  5K36 G;  3KF6 A;  3S1M H;  3LGJ A;  2HHH Q;  1HNZ L;  2OWO A;  1SE8 A;  4B3T Q;  4KHP L;  1L1O A;  4YCU A;  4A76 A;  4LFC Q;  1Y1W G;  3CCM A; 
#chains in the Genus database with same CATH topology
 2CH4 W;  1N33 L;  2I5H A;  2JXM B;  2F0T A;  1TWG H;  3PV0 A;  4OWT B;  4ILW A;  5EKI A;  2UUC L;  2E2H B;  2IW3 A;  2RKS A;  5IGF A;  4IPG A;  2UXB L;  4N8F A;  4JW0 A;  4IUR A;  3TBI B;  1HTL D;  3IAY A;  5IGC A;  1TS4 A;  1XPU A;  2SNS A;  2A73 B;  4AYB B;  4IUV A;  3DLL A;  2CW0 D;  2A68 C;  3CME A;  1HFG A;  3FP9 A;  1E1O A;  2AUJ D;  5CV7 A;  4UDU C;  3PO2 H;  4KKS A;  5FLX E;  4HR7 B;  4B9W A;  3RLF A;  1Q86 C;  4DUZ Q;  1G8Z D;  1KAW A;  2Z0S A;  3GDE A;  5CR3 A;  5FJ8 H;  5LMN L;  4LK1 C;  5DEH A;  3CC4 A;  2LSS A;  4Y52 H;  4OO1 I;  4XDX A;  2NVX H;  1LT4 D;  1X54 A;  1SNM A;  3J80 i;  2D5D A;  5ELE A;  4LWC A;  2Q2H A;  3CF5 A;  3TS2 A;  2R93 G;  4J1M A;  3A55 A;  3QR8 A;  5JAV A;  4YY3 L;  1LT3 D;  1VQO A;  2ZJP A;  3ULJ A;  2E75 C;  2KCM A;  4LF7 L;  1PTO C;  5JJZ A;  2VW9 A;  4A3B H;  2F3V A;  3LWE A;  4LUZ A;  4ME5 A;  3QIA A;  5M5W H;  3E9I A;  4L5S A;  1YHB A;  2RSO A;  1ML0 D;  2ALY B;  4DNR B;  3GTO B;  1RL2 A;  3PF4 A;  3J80 c;  2EYJ A;  3I8Z A;  5C0X J;  1WJJ A;  3CRL C;  2B3G A;  3UE0 A;  5AJ3 L;  3S15 H;  4CDF C;  1DON A;  1JWU D;  3KYH C;  3HZX A;  4G4K A;  3OOC A;  3CXC A;  5M3M H;  1D2B A;  2M2L A;  3H15 A;  2PI2 E;  4CGY B;  1QZG A;  1Q8I A;  2CFM A;  1SNQ A;  3KF8 B;  1RJT A;  5C4H A;  4NXM Q;  1OXS C;  2PQA B;  1PZJ D;  3K81 C;  5IT9 L;  1QOH A;  1ICF B;  1EOT A;  5D65 A;  5M5Y B;  4A3D B;  3CCU A;  4IJH A;  3K8A A;  2EIF A;  1QB5 D;  4JI5 L;  4X3T A;  5CC4 A;  2JSO A;  4A3J B;  1TII D;  1II3 A;  4K8I A;  1V9P A;  4JI8 Q;  1CQV A;  2DNE A;  3A5U A;  1E0B A;  4POG A;  3NBH A;  1HR0 W;  4LNQ A;  2AWN A;  1W2B A;  3L7Z C;  2ID0 A;  1WTH A;  2RSN A;  5KGU A;  2ATW A;  2JA7 H;  1UE6 A;  3S1N B;  1TS2 A;  3N6R A;  1SXT A;  2GVA A;  4GNX B;  1LTG D;  4PQX A;  2BDN A;  3S14 B;  3HKZ B;  1K8M A;  4ULL A;  4EX5 A;  1LTS D;  1MBY A;  3FPU B;  2N78 A;  2R92 H;  3NPP A;  4A3M H;  1K0R A;  1LTA D;  3AFP A;  5IGB A;  5K36 H;  2JA5 B;  4AH6 A;  3Q0A A;  1WOC A;  2YTY A;  3I4O A;  5J3B A;  4IPH A;  3GO5 A;  4JK1 C;  2A74 C;  3VR5 A;  2FXQ A;  1I4R A;  1N34 Q;  3BZK A;  2RDF A;  3A8K E;  2Y0S E;  4L8J A;  2NUC A;  4H0L C;  1WYD A;  2F0S A;  3MTS A;  5EKL A;  3GTJ B;  1DOM A;  3V96 A;  1JCK B;  3E5S A;  1R9T H;  4X62 Q;  1QVG A;  3HGB A;  4X62 L;  4LF5 Q;  1EEF D;  2EXD A;  4S3S A;  1J6Q A;  2DUD A;  2BE5 D;  1EIH A;  5FLX c;  2EJM A;  3D31 A;  3TP6 A;  3HOV H;  4DR3 Q;  2EJF C;  5L37 A;  3OYY A;  4IOC A;  1N36 L;  4GLA C;  2R7Z B;  3DM1 A;  1ASZ A;  2YV5 A;  1QUQ B;  2E8G A;  1LTR D;  1G29 1;  3PCO B;  2R92 G;  1LT5 D;  2CWA A;  1C0A A;  4QB4 A;  5M3F B;  3IL8 A;  4DR1 L;  4IOA A;  2OXP A;  3U9S A;  3T1H Q;  3NEM A;  1PTO B;  1SYG A;  1BBX C;  4KMU C;  1GHJ A;  4IJL A;  1VQ7 A;  2F03 A;  4RHR A;  2G5D A;  1L0Y B;  1XTC D;  4YWK A;  4L5R C;  4CBV A;  3A0J A;  1D1I A;  1D8L A;  1BKB A;  3EVQ A;  4B3R Q;  5H1S E;  3MFG A;  4LF4 Q;  4MN3 A;  1T5X D;  4HMI A;  1PH5 A;  4JI1 Q;  2B39 A;  2FJ2 A;  2HQE A;  1DZ1 A;  3KF6 B;  5COR A;  2JA6 H;  4IFD G;  2R93 B;  2EYL A;  2RDH A;  4HJ5 A;  2KOL A;  5M5X B;  3T4A C;  3PO3 H;  4C2M H;  1FNV A;  5C3E G;  4ZUJ A;  1EUJ A;  2EXZ A;  1YIT A;  5CV8 A;  4GOP B;  3C46 A;  5I9P A;  3OW2 A;  4PMW A;  3GD7 A;  3CHB D;  4IPC A;  5CV5 A;  1DM0 B;  2KHS A;  1PMR A;  3CAM A;  1VQD A;  4CDE C;  4NMZ A;  2B2W A;  1X3E A;  4JYA L;  5GAE C;  4LF7 Q;  3GTO H;  1Q90 A;  1I6H H;  1DD2 A;  1E3P A;  3QOL A;  1R9T B;  4A3L G;  5D3I B;  2RVL A;  4DAP A;  4A3F H;  5EQ0 A;  4HJA A;  1RD9 D;  2ZXP A;  1HA6 A;  4X64 Q;  4RFB A;  4DR1 Q;  2VS1 A;  3I4M G;  2E2J H;  4C3J G;  3MAQ A;  5D14 A;  5EKK A;  1XTD A;  3G4S A;  1TR5 A;  4YWM A;  5E4W C;  3E9H A;  1C8C A;  4AIM A;  4GNX C;  1F2L A;  4C3H G;  3ULP A;  3H0G H;  1MJC A;  5M9O A;  2A5H A;  4JV5 L;  4JCV E;  1Q7Y C;  4RA8 A;  5D3D A;  1A0I A;  4QJF A;  3RN5 A;  3BVZ A;  1I50 H;  2ZM6 L;  4UAI A;  1BXT A;  4JI5 Q;  3AU7 A;  3I4N G;  1YBY A;  3PQI A;  3GTP B;  1W3S A;  3D6W A;  2Z9H A;  2K33 A;  2R61 A;  1ESF A;  4DR5 L;  1CA6 A;  1VCI A;  3CQZ H;  3UDF A;  2D9U A;  1EZ6 A;  1GD7 A;  5E7N A;  2B2U A;  2F1M A;  2OQ0 A;  1SR3 A;  2HQL A;  3MHB A;  4TQU S;  3HOW B;  1TWA H;  3GTL H;  4DV3 L;  4Q0F A;  4DR2 L;  1ZEQ X;  1VQB A;  2LXJ A;  4XXE A;  5CGK A;  3DXJ C;  3U9O A;  4OGQ C;  4FNF A;  3A8J E;  2E2D C;  5AJ3 Q;  4A3J G;  1O7I A;  3A54 A;  1FL0 A;  2IPK D;  3C2P A;  3TRE A;  1LTT D;  1HRJ A;  1SYF A;  3H09 A;  1B50 A;  3TZU A;  3OWE B;  1FR3 A;  3J7A F;  3A56 A;  1D5Z C;  1VQC A;  4A3G B;  1XJV A;  4KHZ A;  3P75 A;  2F0K A;  3A7L A;  1GUW A;  3I72 A;  2EY1 A;  4GN5 A;  2EYH A;  2D2C C;  1VF5 C;  5FLX L;  1LO5 D;  1TS5 A;  3CQZ B;  5IP9 G;  3W3A A;  2IHF A;  2K14 A;  4MZ9 A;  5BN4 A;  4B3S Q;  2VL6 A;  3BS1 A;  5EAY A;  1Y1W H;  3WDN A;  1KNE A;  2EZV A;  1S40 A;  4J6H A;  2MHV A;  1G2T A;  3J80 L;  3CCJ A;  1SYE A;  1EYA A;  2Z6K C;  5IP7 G;  1SJE D;  3EIV A;  3MFY A;  4H13 C;  3IKJ A;  3PUW A;  1AP0 A;  1CZW A;  4O0A A;  4JC0 A;  4DAV A;  2RCN A;  3E3X A;  2ES2 A;  1HNW Q;  4DV4 Q;  5LMU Q;  1C4Q A;  1U4L A;  1JT8 A;  4O2D A;  2GA4 B;  3U4Z A;  4EQO A;  1TU2 B;  4UP9 A;  2EYF A;  3STB D;  3QO2 A;  4OXP A;  1EU4 A;  2OCE A;  3NWT A;  1YZ6 A;  4NKL A;  3KLS X;  2WII B;  3E0J A;  5LMN W;  4LFA L;  1K3B C;  3CC7 A;  4BY1 B;  4HN7 A;  4LF6 L;  2N55 A;  1VQL A;  3T1Y Q;  1IXR A;  1KDB A;  1A3V A;  2F0F A;  1UE1 A;  4BXX H;  4DUY L;  4GNX A;  1PZI D;  3X3N A;  3ULL A;  2B63 H;  2EE1 A;  1FGB D;  1JE4 A;  2K01 A;  2OWO A;  4NDX A;  1SE8 A;  1M4V A;  2KCC A;  4G57 A;  4A76 A;  1A3T A;  3DEP A;  2UUB Q;  4UY8 C;  1PHJ A;  2E2I H;  1F9P A;  3OSO A;  3STB C;  2SNM A;  4UHV A;  3VR4 A;  1STG A;  2UUA Q;  1RKN A;  5LL6 X;  1RDP D;  4DN4 M;  3J7A V;  4XT1 B;  1K0S A;  1BCP C;  3P1H A;  5LHY 1;  5J22 A;  2KEN A;  2QEJ C;  2WKC A;  1I3Q B;  4DV7 Q;  1IYV A;  4DV4 L;  3P7J A;  1TY2 A;  2J0T D;  1A15 A;  3T16 A;  2UXD L;  4XIG S;  3HS0 C;  4QL5 A;  1NBW A;  4A3K H;  2WAC A;  3UE1 A;  4K2L A;  3I56 A;  2K5Q A;  4YCV A;  4GKK Q;  3S24 A;  2JEB I;  3VYU A;  5JEA G;  3RN2 A;  5A2Q E;  4A3B G;  2UUB L;  3M7N A;  1Y1V G;  1D5M C;  4R4I A;  3R93 A;  3MEH A;  2KCT A;  4H7B A;  4EQN A;  5T1G A;  1EU3 A;  1U4R A;  3SDZ A;  2MFI A;  4P74 A;  2X6G A;  4X3S A;  1VDZ A;  4RG1 A;  5FKA C;  1V1Q A;  3PUX A;  2JA9 A;  3MA2 B;  4K5X A;  4RGN A;  1K8G A;  4BY1 G;  5IYC H;  2XWJ B;  3I4L A;  3NTK A;  4HIO A;  1RTN A;  1G6Z A;  1PLF A;  1SAP A;  4A3K G;  4NPS A;  3Q8D A;  4X66 L;  1GXD C;  2RCF A;  3AQQ A;  4RKL A;  2E76 C;  3KUP A;  1GKH A;  1WTX A;  1H9S B;  1U4P A;  4RHS A;  2D0P A;  3H91 A;  2HIX A;  1E24 A;  1OXU A;  2MO1 A;  3PIP 3;  3DHQ A;  3J80 E;  2K05 A;  4FF3 A;  1JMC A;  2BA0 A;  3SR1 A;  1JJG A;  2N49 A;  2PZW A;  5C6A A;  1UE7 A;  3P20 A;  3J7Z C;  2HT1 A;  4DR7 Q;  2I5M X;  2LFN A;  1X3P A;  3IFT A;  3UI2 A;  5EBC A;  2NVY B;  5JEA J;  4FF2 A;  3M7G A;  5M3F H;  1HPC A;  3ITP A;  2Q8T A;  5J39 A;  3QB3 A;  1FD7 D;  4LF9 Q;  2R3Z A;  1K28 A;  1QWY A;  3K7A B;  2JA8 H;  1TWF B;  1AFP A;  1PH3 A;  4CKB A;  4A3D G;  1H9R A;  4L5Q A;  2N3S A;  1TWC B;  4KD4 A;  1SNP A;  4JBW A;  2ZT9 C;  4OX9 L;  1ESR A;  1IW7 C;  2L12 A;  3F1Z A;  4K5W A;  5BN5 A;  1XNQ Q;  4HJ8 A;  2L55 A;  1STB A;  2F4I A;  1P16 A;  1UAP A;  2I0Q A;  1AH9 A;  1N8R C;  4BY7 B;  1SYB A;  3M9B A;  4X3U A;  4G7O C;  4DA2 A;  5CBA E;  3KDF A;  2K1B A;  1X6O A;  4I65 A;  3GTM B;  4KY7 A;  2JA6 B;  5KRU A;  3HG9 A;  3ERS X;  4IN3 A;  4DXG A;  2NVQ H;  1NR2 A;  2K4K A;  4C3H B;  4JVZ A;  5JJI A;  3BG3 A;  4GN4 B;  2PPB C;  1O7L A;  2RF4 A;  1CKM A;  1S5B D;  5C4X G;  5C3W A;  1NNX A;  2AWO A;  2A69 D;  3DUZ A;  3BVG A;  3M4O B;  4X65 Q;  4X3K A;  4DV6 Q;  3H3V I;  2MNA A;  1I4P A;  3H3V C;  3U58 A;  4RCO A;  2JA6 G;  4IFD H;  4GOP A;  1C9O A;  1ENF A;  1H9S A;  1EFI D;  1VMC A;  4RH6 A;  1RTO A;  4QY7 A;  1O78 A;  2NN6 G;  4MTN A;  5I2X A;  2QW7 A;  2DJG C;  4FDB A;  2NN6 I;  1HHV A;  1JOO A;  4A3M B;  5FLM H;  2ZM6 Q;  4RGM A;  4BY1 H;  1HQM C;  1NUC A;  2XN9 C;  2PQE A;  1GO3 E;  2MQH A;  4YIJ A;  2NVQ B;  3C1F A;  2IX1 A;  2K75 A;  2A68 D;  2A6H C;  1S4Z A;  1IBM L;  2QDL A;  3MZ5 A;  2HHH L;  1KLG D;  1I50 B;  2FMM A;  1UUP A;  1B9M A;  2XRS D;  1Y14 B;  3TP7 A;  3TRZ A;  3NQI A;  4L6T B;  3FVQ A;  4X64 L;  3FDT A;  4DV2 Q;  5JVG 3;  3RZO B;  3ND9 A;  1D7Q A;  4XQJ A;  1NJI C;  3W5O A;  2UXC Q;  2L9H A;  2XWB B;  2DY7 A;  3FKI B;  3HOV B;  2L15 A;  1ILP A;  2K5H A;  2R6G A;  2Q2I A;  2PW5 A;  3GV3 A;  2GVB A;  3FKI G;  2H1E A;  4JI3 Q;  1D1K A;  5LMN Q;  1LAB A;  1AEX A;  1Q3L A;  4DNI A;  2ICI A;  3CW2 C;  1XPR A;  3BU2 A;  1OTC A;  1EY9 A;  4I7A A;  4OIK A;  2EQS A;  4LFC L;  3AMU A;  1BQQ T;  1PFN A;  5JJL A;  4YHH Q;  2M9V A;  4JI7 Q;  3NEL A;  2A8V A;  4A93 G;  1EYD A;  3MXN B;  1UEB A;  2ICE C;  1X56 A;  5M5X H;  4A3E B;  1VMP A;  5C3E B;  2JP1 A;  2KHJ A;  1IBK L;  1WCM H;  1AW7 A;  1U9R A;  3S1R B;  1B2T A;  3OPO A;  1Q46 A;  2WAQ G;  3I73 A;  1TKW B;  4JI1 L;  5A2Q L;  4K5V A;  4DR5 Q;  1L2F A;  3D6C A;  4U68 A;  4UPA A;  4RCN A;  2CVR A;  3SK6 A;  4DAM A;  4QCL A;  5IY0 A;  2BDO A;  3CCE A;  2QA4 A;  2B2V C;  2WKD A;  2RA4 A;  4BY7 G;  3JAM c;  3AFQ A;  2RDG A;  2R93 H;  5IP7 H;  1TWG B;  2TMP A;  4OIJ A;  4NXN Q;  1KLU D;  1YHQ A;  4H44 C;  3CCQ A;  2NZO A;  1CHQ D;  1BF4 A;  3CD6 A;  3I2Z A;  3PIO A;  3S16 H;  2F0J A;  5IOC A;  3EQL C;  3L2P A;  1B8A A;  1C7Y A;  1F2Y A;  1HTP A;  2HCI A;  3TZD A;  2ASB A;  1CSP A;  1RF2 D;  5I9O A;  1S72 A;  1KAA A;  4AQY L;  5HY6 A;  4ZKC B;  1XPO A;  1MKH A;  3DMU A;  3T53 B;  2QIL A;  4R4Q A;  2L4N A;  4IQZ A;  1STN A;  1VQH A;  1YI2 A;  3HOZ G;  2DY8 A;  1K3R A;  3VR2 A;  1CZG A;  1XNR Q;  5EJW A;  2MUY A;  4M8A A;  3ER0 A;  4HSV A;  3WWV A;  4OL7 A;  5CV9 A;  1JJ2 A;  1EL0 A;  1KNA A;  1NTG A;  4HJ9 A;  3C1E A;  2R92 B;  1KRS A;  1KD1 C;  3AYH B;  4GLV B;  5ELF A;  4A3C H;  1SMX A;  1MGS A;  2I46 A;  3EN2 A;  3NBH B;  3TP8 A;  3S16 B;  4K2K A;  1YNN D;  4KK7 A;  2E5L L;  4R4T A;  4JG2 A;  4JI0 Q;  4GKJ Q;  1M1K C;  4QIW B;  5GAD C;  2HDL A;  2F0P A;  1UWV A;  3PGZ A;  2XTI A;  2B8G A;  1CSQ A;  4HCS A;  3FEW X;  3I90 A;  4XYQ A;  1KIX A;  2GN5 A;  4EQP A;  2BOS A;  2CQO A;  3NEN A;  1K73 C;  2AQ1 B;  4DR3 L;  4KJO A;  1J9O A;  5EPL A;  4AYB G;  1SLJ A;  1EQT A;  1V1P B;  1BCP D;  2K5D A;  2ZXR A;  4DUZ L;  3C3L A;  3HOW H;  1EQR A;  4LW1 A;  3HKZ E;  3NE5 B;  4I7Z C;  1CQF A;  3VYT A;  1GJX A;  1HH2 P;  1B3Q A;  2EYP A;  4BA1 I;  4R1J A;  2LMC B;  4OX9 Q;  5DM6 3;  2VQE Q;  2OTL A;  1I4H A;  2NZ1 D;  3PUZ A;  4IPD A;  2B2Y A;  1Y1V B;  2K6A A;  2VB3 X;  2C35 B;  4DV6 L;  3SXH A;  5FO7 B;  2EY2 A;  4BBR G;  4A3I G;  2F0U A;  4AYB E;  3JAM i;  4LF8 L;  5GRO A;  4TSS A;  5I2Y A;  1TY0 A;  1WTR A;  1G2S A;  1X3G A;  2I5L X;  4A3J H;  2DGY A;  3VYR A;  1V1O A;  4Q5V A;  2TSS A;  2EVB A;  4F88 A;  4CDC C;  3OIQ A;  1EQV A;  1HUM A;  1PDQ A;  2NZH A;  4KN4 C;  3FMC A;  4WJW A;  4C3J B;  5EGT A;  1DCZ A;  1Q81 C;  2F0G A;  1JWM D;  4YCW A;  4DU9 A;  2E2H H;  2Y0S G;  2Z6K A;  4TRD A;  5NUC A;  2JJQ A;  4XTC S;  1EWI A;  3HEJ A;  2JN4 A;  3HOY H;  4DAY B;  4DV5 L;  3M4O H;  4OEM B;  1OXV A;  4KTA A;  4CDD C;  2J4X A;  1CFM A;  2NTT A;  4PZ7 A;  1SFO B;  2VB2 X;  1M8A A;  3J81 L;  1NY4 A;  1SNC A;  1Q82 C;  4DV1 L;  2HIV A;  3D3R A;  3KF6 A;  3LGJ A;  3LWU A;  1ENC A;  4KHP L;  1DOL A;  2K7V A;  3ND8 A;  5FJ8 G;  2KBN A;  1GUG A;  1GUN A;  4G7H C;  1U4M A;  2HCC A;  4X65 L;  4PG3 A;  3R3O A;  5EPK A;  4JPB W;  3B6Y A;  2ZTD A;  4R4C A;  2UXB Q;  3K6O A;  4DV3 Q;  2JA7 G;  2UU9 Q;  2V4D A;  4CJ0 B;  1N33 Q;  2EYM A;  3MEF A;  4C3I B;  4MHE A;  3MVV A;  1PA6 A;  1N32 Q;  3TDQ A;  3HKZ G;  2XRQ D;  3F2D A;  3I55 A;  2LS0 1;  5C3E H;  5C4X H;  1CM9 A;  5T1I A;  1ET6 A;  3KDF B;  1SBB B;  1PFB A;  3K57 A;  1TWH B;  2MGS A;  1WTV A;  1PH9 A;  1HA5 A;  4KY6 A;  1PYW D;  2QEX A;  2ZJQ A;  4KI0 A;  4P73 A;  1F2Z A;  4B3T L;  1HNZ Q;  2EDG A;  3Q23 A;  3V05 A;  2AKW B;  1JJC B;  2J7Z A;  3G7L A;  3VDY A;  2SOB A;  3I91 A;  1K8O A;  5CV4 A;  3A74 A;  2KED A;  1AZQ A;  3J81 c;  3HOX B;  1IW7 D;  1UEA B;  2AQ2 B;  3X3M A;  1HNX L;  2BH2 A;  3AB9 A;  4N9T A;  4LFB L;  2WFW A;  4A3E H;  2PMZ B;  4RWS C;  1JR0 D;  3R2I A;  4HCE A;  1K83 H;  1F9S A;  4LF6 Q;  2K5W A;  4DXF A;  5KEE A;  3G6E A;  3R8B A;  2D0O A;  4A3B B;  1Y8O B;  3GQB A;  5CV6 A;  1PTO H;  1VQ9 A;  4DV7 L;  2JK8 A;  2M00 A;  4IZ8 A;  1ZXT A;  3I4M B;  3EA6 A;  2PO4 A;  5J1Z A;  3HOX G;  3CMA A;  3DM3 A;  3TN2 A;  2N88 A;  4CHT B;  4X66 Q;  5I6Y A;  1VS0 A;  2PMZ E;  1ZYR D;  3UDX A;  5IYB G;  2I07 B;  1JOR A;  3K59 A;  2IY5 B;  2WB1 B;  1G91 A;  2NB0 A;  3FKI H;  1B1Z A;  4DV0 L;  2F0W A;  1HR0 L;  4WFN 3;  1VQE A;  3S2H H;  2UXC L;  2F3I A;  2K03 A;  2XSC A;  1NR4 A;  2DNC A;  2RQX A;  4J8Q A;  3K5L A;  1CTM A;  3SVM A;  4PMC A;  1LAC A;  1Y8P B;  4O42 A;  1EY7 A;  2CHB D;  4KJN A;  4B9X A;  3J7Y W;  1FVI A;  3G6J B;  3KLW A;  2F0E A;  3GTK H;  2B2W C;  1EYC A;  1I4G A;  4JBM A;  1ZKO A;  1HZ9 A;  1QIL A;  5FO9 B;  1KL9 A;  4NW2 A;  3BYT B;  3D0F A;  4B3M L;  4ME3 A;  1MHW C;  2JE6 I;  4ZKB B;  3PSI A;  1EY6 A;  5M3M G;  1SN8 A;  2H5X A;  1A2U A;  5I4D A;  4BXX G;  2O2L D;  3F2B A;  3PMF A;  2F0N A;  5ELD A;  4PZ6 A;  2PNH A;  1KDC A;  4FYD A;  2O5J C;  1BR9 A;  1SRU A;  2C9O A;  3W1G A;  3CCL A;  2L5T A;  3CP0 A;  1STY A;  2A6E C;  2SDF A;  2K32 A;  2JA7 B;  1LLR D;  3BDL A;  3S2H B;  1CUK A;  4DR7 L;  1BCP F;  4RKB A;  4O1N A;  1H95 A;  4DK6 C;  1TWF H;  2LKV A;  3NWS A;  3CC2 A;  4V0B A;  2R7Z G;  1E2V A;  1H9M A;  5C44 H;  1HNW L;  3MXP A;  3MXU A;  2D62 A;  3K5M A;  3HOY B;  4IUN A;  4JBJ A;  1CK1 A;  2VNU D;  1VQ4 A;  1YJN A;  2SEB D;  4F87 A;  4CKE A;  1E2Z A;  4FF1 A;  1LTL A;  2IL8 A;  2E2I B;  3FHW A;  2V1C C;  3I70 A;  4X6A H;  1KAB A;  3GTQ B;  1J8I A;  1E22 A;  1TT2 A;  1EY5 A;  3L0O A;  4FVM A;  4IUQ A;  4BWG B;  4DFA A;  1NAP A;  5ISR A;  2ZJR A;  3TP5 A;  2B8F A;  1PH4 A;  5F2D A;  3T1Y L;  3KK7 A;  1JB7 A;  2PZT A;  3NUC A;  2QGQ A;  4N8X 1;  1HCZ A;  4IFD I;  5JEA H;  5IWA L;  4LMQ D;  5IWA Q;  3CPF A;  1TWA B;  3GTL B;  4ID6 A;  1XWE A;  4ZUI A;  2R7F A;  2O5I C;  3H3V H;  1MIU A;  5IT9 E;  4DR4 Q;  4C3I G;  1TVX A;  3SK8 A;  1PTO F;  4RAU C;  1Q1B A;  2Z8L A;  4A3K B;  4LF9 L;  2OEO A;  2B63 G;  1MD2 D;  2O4X A;  3DEO A;  1I6V C;  2PW7 A;  1VF7 A;  2QF7 A;  1EOV A;  2PNR C;  2BH8 A;  3H6M A;  5BN3 A;  3J81 E;  3G71 A;  2A1A A;  2G9D A;  3S15 B;  3M85 A;  4PMB A;  2YU9 B;  3KJO A;  2XNA C;  2EY5 A;  1SYD A;  5M3M B;  4DV5 Q;  2UU9 L;  2DN8 A;  4LF8 Q;  3OIP A;  2KVM A;  2A6E D;  3GTG B;  5HUR A;  1XXG A;  4QF4 A;  3K0X A;  3CKI B;  3NXW A;  3W1B A;  2VQF L;  5IYD H;  4C56 C;  1SRO A;  2NN6 H;  3CRK C;  1PRT F;  1BDO A;  1A62 A;  1B9N A;  5DAU A;  5M5W B;  4B3S L;  1TWH H;  3PO2 G;  3NHH A;  1SJH D;  1JC7 A;  1SMY D;  3HFZ B;  4DR2 Q;  2RBM A;  4A93 B;  2XGT A;  1DGS A;  2L1B A;  2RHS B;  1IBL Q;  1UE5 A;  2F0V A;  4HSP A;  3Q24 A;  1VQN A;  4GS3 A;  2LY7 A;  3DWA A;  1BVS A;  1BOS A;  1X32 A;  4ZQ3 A;  3ZJY C;  3NSW A;  3D4W A;  1HQR D;  2EY6 A;  3OMG A;  3CCR A;  1Y69 U;  1YEZ A;  4ZRZ A;  4Y7N B;  1NE3 A;  3GTP H;  4BBS G;  4TVA B;  4IO9 A;  2IX3 A;  1YJ9 A;  2RHQ B;  5CBE E;  1CKN A;  2MPM A;  1SSO A;  1GUO A;  1K83 B;  4LJZ C;  4EQ5 A;  5C0X I;  4A3M G;  5C0X G;  1V1P A;  4P71 A;  3T1H L;  3S17 H;  1DJR D;  4H02 A;  2G9H D;  2F0O A;  3T51 B;  4OO1 H;  1GUS A;  1EZ8 A;  3SGI A;  3Q6S A;  4K6L A;  2Y0S B;  1IL8 A;  4FP5 D;  1WCM B;  5DNF A;  3SK5 A;  2QDB A;  3WOE A;  1VQF A;  4A3F G;  2XVS A;  1IBK Q;  1EWC A;  5M3F G;  1VQI A;  1BO0 A;  2HD3 A;  4LF5 L;  3TQY A;  3BZC A;  4R8N A;  2EOT A;  3S1N H;  3PIP A;  4C3J H;  1R4Q B;  3NTI A;  1FGU A;  1PFS A;  4DKA C;  1XMO Q;  5FK9 C;  4A3G G;  1TXY A;  1JOQ A;  2WP8 J;  4BBR H;  4A3I H;  3GTG H;  1QG7 A;  3NP8 A;  4BBS H;  3OTO L;  5C4J B;  1EY4 A;  1HZB A;  5GQO A;  4C3H H;  4LAA A;  1O7Z A;  4MIU A;  5A35 A;  3F2C A;  4IUU A;  3U4V A;  2F0I A;  1QVC A;  2FIN B;  3M4Y A;  2NYZ D;  3RLN A;  5C0X H;  1XMQ L;  3K7A H;  2JA8 B;  4TKO B;  1TS3 A;  1SDF A;  1N32 L;  4PNY A;  3J81 j;  2KHI A;  1KXL A;  2BE5 C;  3KOJ A;  2IWH A;  4HIM A;  3HOW G;  2HDM A;  1F77 A;  1UNS A;  4AQY Q;  4GKJ L;  3FPP A;  4OHJ A;  3E6Z X;  1CA5 A;  2ZTE A;  1ROD A;  1BNZ A;  1WTQ A;  4CJ1 B;  3HP3 A;  5TSS A;  1HFN A;  2JA5 G;  3L3O C;  1AN8 A;  3MC0 B;  4ABN A;  2CH4 A;  1YJW A;  4JI4 Q;  3K5O A;  1VQG A;  5KNB A;  2KA7 A;  3ICE A;  5GAG C;  1O7Y A;  4JI8 L;  2F0D A;  2DJF C;  1RHP A;  2A69 C;  3G48 A;  1AE2 A;  2PZU A;  2AQ3 B;  4U67 3;  4G7Z C;  4ZYS A;  1BBW A;  4LUO A;  4BBS B;  3QG1 A;  3S1Q B;  1X9N A;  2B2T A;  3SEB A;  2E5L Q;  1WD0 A;  1SE4 A;  4DV0 Q;  4MNO A;  3CPW A;  4L5T A;  4WRD A;  5EPJ A;  1ILQ A;  4ALP A;  1WVL A;  3SE0 A;  1YNX A;  3S2D H;  1RIP A;  5IOD A;  4DGZ A;  4QGU A;  1TWC H;  2MP1 A;  3LNN A;  4KV6 A;  1XYI A;  2K5N A;  1KRT A;  3TSS A;  5IYB H;  5LMU L;  5ELN A;  3HOY G;  1VQJ A;  4HTH A;  2VUM H;  4YHH L;  4JI7 L;  1ICW A;  5IP9 H;  4HJ7 A;  3FRP B;  3GTJ H;  2AMC B;  3I7F A;  1BBU A;  3HOU H;  1HXY D;  5AFW A;  4XQQ A;  5FLM G;  4JI2 Q;  1IBM Q;  2L11 A;  1OXX K;  2Q2U A;  5BR8 Q;  1Y1V H;  1QCB D;  3RUZ A;  2JYO A;  4K8J A;  4LFB Q;  1EEI D;  4LF4 L;  1STA A;  1Z9F A;  5C44 B;  4HAE A;  5ELB A;  2LXK A;  1V43 A;  1X3Q A;  3H0G B;  1T5E A;  1PV4 A;  3M4Q A;  3VA5 A;  4JI4 L;  3EFX D;  2NVT B;  1A2T A;  1LV9 A;  5G3L D;  1B3A A;  3KJP A;  1WFQ A;  3AEV A;  1SE3 A;  4BA2 I;  1HJP A;  1I5F A;  2Q2T A;  2K5V A;  5IE8 A;  1NMF A;  1B44 D;  3RZO H;  2Q8I B;  3QJY A;  3S1M H;  2HHH Q;  5HGT A;  1HNZ L;  1LT6 D;  4B3T Q;  3JAM E;  2NVX B;  1S5C D;  1NCV A;  3CCM A;  3ONA B;  2HUG A;  1ONL A;  1WCM G;  1AZP A;  2E2J B;  1XMQ Q;  4EVO A;  3SHL A;  2VUM B;  1JIC A;  4DK3 C;  3JC6 6;  1GOZ A;  2UUC Q;  4QUC A;  3VA7 A;  1F9Q A;  3HOZ B;  4JI2 L;  3VR6 A;  1LTI D;  1JWS D;  3BYY B;  3OWF A;  1TQO A;  2VXW A;  4K14 A;  4DV2 L;  3BJU A;  5K5P A;  1PRT C;  4K6D A;  1MI2 A;  2P5Z X;  4A93 H;  2R7Z H;  1U0L A;  2B63 B;  5C4Z A;  2NWG A;  3PIO 3;  2K04 A;  4OEL B;  3M3Y B;  2F0H A;  1K8A C;  1L1O C;  1ET9 A;  1I4Q A;  2FMC A;  4B3R L;  1E7Z A;  1FJG L;  2WAQ B;  4GOP C;  4ZAI A;  2L0C A;  2JA8 G;  3UDI A;  5IYC G;  4N9P A;  2JQO A;  4A4I A;  1Z6H A;  4A3E G;  4NXN L;  1XNQ L;  4DV1 Q;  4F8M A;  1PFM A;  5JJK A;  3ZYY X;  1LUZ A;  1L0X B;  1X65 A;  1I6H B;  3EBE A;  2VQE L;  1D5X C;  1KHI A;  4QUF A;  3N52 A;  4JI0 L;  2WB1 G;  3KBG A;  2WV6 D;  1GVP A;  1STE A;  3HOZ H;  4DPG A;  5KIX A;  3J81 i;  3SK4 A;  4UP7 A;  4B08 A;  4C3I H;  5M5Y H;  3K80 C;  4APV A;  3OTO Q;  3PO3 B;  1JOK A;  4MTK A;  4KHV A;  2KCN A;  1PH7 A;  1CKO A;  1KDA A;  1JE5 A;  1XNR L;  3Q22 A;  3CU7 A;  3IRB A;  3LX0 A;  2X6L A;  1U5K A;  1MSG A;  3RD4 A;  1RCV D;  3TS0 A;  1IBL L;  1PH1 A;  1HZC A;  4ZLT F;  2F4V Q;  1N9W A;  5IGG A;  5JPM C;  4KLK A;  3I4N H;  2MJ8 A;  1QZH A;  3KFU A;  3RLO A;  5C5M A;  4R9W A;  5C4J H;  1GHK A;  1XX8 A;  1S3O A;  1Q1E A;  2AHO B;  2ZXO A;  3PUY A;  2Z6B A;  4XT3 B;  1FJG Q;  4IFD J;  2NVY H;  1H9J A;  1O80 A;  4IAL A;  1XMO L;  5ELC A;  4YWL A;  1VQ5 A;  1LYL A;  2Z1C A;  1PH2 A;  1LTB D;  2CQA A;  1EY0 A;  2F0L A;  1QJO A;  4XQN A;  5JOB A;  4P72 A;  3D4D A;  1L0W A;  2K52 A;  3KLR A;  5EBD A;  3S1R H;  3K7U C;  3NTH A;  1Q8K A;  1SMY C;  3I4M H;  1X55 A;  4KKT A;  1PYS B;  1VQP A;  1HUN A;  1VQ6 A;  4DAY A;  3F2U A;  2E74 C;  2AUK A;  1I94 Q;  1NMG A;  2YTX A;  1HR0 Q;  1WTW A;  4LFA Q;  4BY7 H;  5COY A;  4Y7N H;  3S1Q H;  5IGE A;  1F2M A;  1B70 B;  1M90 C;  4XYO A;  4DF7 A;  4E6I A;  4P75 A;  4JI6 L;  2C5C A;  2EYO A;  2VQF Q;  1YNJ D;  2OTJ A;  4HMJ A;  5HGQ A;  1ASY A;  1H9K A;  1B4O A;  3MXG A;  4JBK A;  4GN3 B;  2CCZ A;  1PRT B;  1PH6 A;  1PXU A;  1NSN S;  3KLS A;  1Q12 A;  1S5E D;  2A19 A;  3A7A B;  2F4V L;  2X69 A;  1IYU A;  2EPB A;  1W6J A;  1L1O B;  3HRZ C;  3R2T A;  2KQ3 A;  2PI2 A;  3URY A;  5GAH C;  1A8V A;  4QMG A;  1EFW A;  1P8L A;  3W2D A;  1CI3 M;  1BUV T;  4R8I A;  1B53 A;  5C44 G;  3F8T A;  1A63 A;  1GM5 A;  4FO2 A;  4UP8 A;  1QVF A;  5C4X B;  1R4P B;  2KEC A;  2F3W A;  2NVT H;  4V19 0;  4QQB X;  4A3C G;  3RMH A;  3BDC A;  2MO0 A;  3T13 A;  4BS9 A;  1VQK A;  1Y1W B;  1DOK A;  4POF A;  3I3C A;  3OW7 A;  1QNK A;  3HOV G;  3KBX A;  4B3M Q;  4ZK9 B;  1WI5 A;  3E0E A;  2KUM A;  3RNU A;  1YNN C;  2CWP A;  5LL6 S;  3K5N A;  4A3F B;  1JB3 A;  1I4X A;  1C48 A;  1J5E Q;  2NTS A;  4HIK A;  1IKM A;  1EQQ A;  3HOX H;  4KY5 A;  1G51 A;  3OHX C;  4HED A;  2BCO A;  3MWY W;  3GTQ H;  2ENB A;  1FNU A;  1YHA A;  1IL2 A;  3QOJ A;  4GKK L;  2B2Y C;  3ERQ A;  4C2M B;  4CJ2 C;  3H0G G;  3CCS A;  3NQT A;  3T56 B;  5KNC A;  4KHP Q;  3HKS A;  3MXN A;  4ODG A;  4IUT A;  3H94 A;  1BCP B;  4WOR A;  4JI3 L;  1SYC A;  4J15 A;  3PO2 B;  1GUT A;  4NXM L;  1I3Q H;  1PH8 A;  3CCV A;  1IYJ B;  1EIY B;  1WTO A;  4R4O A;  1Z47 A;  3IFD A;  3V2T A;  1YVC A;  3KF8 A;  5G3L F;  1SEB D;  1Z7T A;  4JOI C;  2IT1 A;  2PCF B;  5C3X A;  1EY8 A;  4M1U B;  2VUM G;  4OWX B;  2FHT A;  2KJX A;  2R7D A;  4DNT B;  1W6K A;  1E1T A;  5CYU A;  4DK0 A;  3ERO A;  1S5D D;  2OT2 A;  1EYG A;  5I6W A;  2VZA A;  1FYC A;  2H4O A;  3NK9 A;  3L9A X;  2YTV A;  1JQY D;  4QIW E;  3RZD B;  1MJE A;  2IX0 A;  2PQA A;  3M3Y H;  1F9R A;  2K28 A;  1DYQ A;  5BR8 L;  2XIW A;  1LM0 A;  4FXG C;  2JA5 H;  5JPN C;  4DR4 L;  1KTK A;  2B2U C;  5IGD A;  3S17 B;  2K50 A;  2IJ0 A;  1T9H A;  5ELO A;  1HZA A;  1EWH A;  5DLQ E;  3S2D B;  4YY3 Q;  4GLX A;  3K0Y A;  1VQ8 A;  1E2W A;  4NP5 A;  3I4N B;  4FXK C;  5KND A;  4LUV A;  3VYS A;  3PO3 G;  4OON A;  1A3U A;  2A6H D;  4OWW B;  4P2C B;  4RMF A;  1QE6 A;  3JAM L;  4GZY C;  4DK1 A;  3VR3 A;  2QKI C;  2WIN B;  1OO9 B;  4ZCK A;  3DWQ A;  5FO8 B;  2B29 A;  3NBI A;  3U50 C;  5FOB B;  1IHZ A;  5E3F A;  2NBF A;  4C1N K;  1YIJ A;  4OO1 G;  1CHP D;  3GP7 A;  2UXD Q;  5CMD A;  2ZTC A;  1A6X A;  1ENA A;  1PVO A;  1STH A;  3OMC A;  1WD1 A;  4A3L H;  4F7X A;  4IUP A;  4DUY Q;  4KD3 A;  2CKZ B;  3TME A;  4A3D H;  2F0M A;  3A8I E;  1OXT A;  4A3G H;  1S5F D;  4KN7 C;  1X3F A;  4EGV A;  3S1M B;  1MSH A;  3J7A 5;  3A5Z B;  1IZ6 A;  1QNU A;  1CKN B;  4RGO S;  1B7Y B;  2F52 A;  1V8Q A;  2BA1 A;  2CW0 C;  1G6P A;  1Y8N B;  4CKC A;  1IKL A;  1WTP A;  2OQK A;  3RR5 A;  3S9W A;  1KQS A;  4DR6 L;  5DM7 3;  1N36 Q;  4C1N I;  4BBR B;  4A3I B;  1YNJ C;  3PUV A;  3WOF A;  2VY3 A;  4HID A;  3RZD H;  2QCP X;  1EIF A;  3EJI A;  2IHE A;  1QUQ A;  3S14 H;  3GTM H;  1CT1 D;  1SE2 A;  5IT9 c;  3M4P A;  2WB1 E;  4K0K Q;  3BVM A;  4PZ8 A;  5IIF A;  5E1F A;  1PYB A;  1PZK D;  5C5L A;  4JV5 Q;  2JEA I;  4RGT A;  3HOU G;  3TEH B;  1J5E L;  2F0Q A;  4JI6 Q;  3PF5 A;  4L63 B;  4PV1 C;  2YU9 H;  1N34 L;  2WAQ E;  1ZYR C;  1PRT D;  4FXD A;  4KKU A;  3DWP A;  1SNO A;  4NB3 A;  4JOI A;  1SND A;  1EIG A;  2Z4H A;  4WJ4 A;  2B2T C;  5KYL A;  3GV6 A;  1I94 L;  2YYZ A;  1DXM A;  2B2V A;  2EJG C;  3BDO A;  2N8N A;  2UUA L;  1K9M C;  3HOU B;  5E4X A;  1AE3 A;  3D4R A;  1D6E C;  1HNX Q;  4FF4 A;  4JYA Q;  1VQM A;  2Z4I A;  3BZD B;  1PTO D;  4K0K L;  1KC8 C;  2OF1 A;  4A75 A;  4Z9C B;  2PYK A;  4WJ3 M;  5IYD G;  3UDG A;  3GTK B;  5KYI A;  2FFK B;  3O13 A;  1SFO H;  2Q8R E;  4DR6 Q;  1VQA A;  5K36 G;  3QWN A;  3K58 A;  5JVH 3;  3D8G A;  1FNW A;  1L1O A;  4YCU A;  4LFC Q;  2KEE A;  1Y1W G; 
#chains in the Genus database with same CATH homology
 5FJ8 G;  2UUB Q;  2KBN A;  1N33 L;  2I5H A;  4UY8 C;  1PHJ A;  2E2I H;  4OWT B;  1TWG H;  3PV0 A;  4X65 L;  2UUC L;  4PG3 A;  1WCM G;  3STB C;  1XMQ Q;  3B6Y A;  2ZTD A;  4R4C A;  2UXB Q;  4IPG A;  2UXB L;  4DK3 C;  4DV3 Q;  3JC6 6;  2JA7 G;  2UUA Q;  2UUC Q;  2UU9 Q;  4JI2 L;  1N33 Q;  1XPU A;  3MEF A;  3DLL A;  3CME A;  1PA6 A;  1N32 Q;  4DV2 L;  3BJU A;  3HKZ G;  3F2D A;  3FP9 A;  1E1O A;  3I55 A;  5C3E H;  3PO2 H;  5C4X H;  2KEN A;  2R7Z H;  4A93 H;  1U0L A;  4DV7 Q;  4DV4 L;  1K8A C;  1L1O C;  3KDF B;  2UXD L;  4XIG S;  4B3R L;  3RLF A;  1Q86 C;  1E7Z A;  1FJG L;  4DUZ Q;  4QL5 A;  1NBW A;  4GOP C;  1KAW A;  2Z0S A;  3UE1 A;  3GDE A;  3I56 A;  4A3K H;  1PH9 A;  4YCV A;  4GKK Q;  2ZJQ A;  2QEX A;  5FJ8 H;  2JA8 G;  4KI0 A;  4P73 A;  3S24 A;  5LMN L;  3UDI A;  2JEB I;  1HNZ Q;  5IYC G;  4B3T L;  2AKW B;  3CC4 A;  1JJC B;  2JQO A;  3VDY A;  4A4I A;  2LSS A;  4Y52 H;  4A3E G;  4NXN L;  1XNQ L;  4OO1 I;  4DV1 Q;  2NVX H;  1X54 A;  5JEA G;  3RN2 A;  3A74 A;  4A3B G;  5JJK A;  2UUB L;  1LUZ A;  3J80 i;  3M7N A;  4LWC A;  1X65 A;  1Y1V G;  2Q2H A;  3EBE A;  4R4I A;  2VQE L;  3J81 c;  1KHI A;  3CF5 A;  3TS2 A;  2R93 G;  4JI0 L;  2KCT A;  2WB1 G;  4YY3 L;  1VQO A;  2ZJP A;  2MFI A;  3ULJ A;  1HNX L;  2KCM A;  2BH2 A;  1GVP A;  4P74 A;  4LF7 L;  4RG1 A;  3HOZ H;  2WFW A;  4DPG A;  4A3E H;  1V1Q A;  4LFB L;  2VW9 A;  3J81 i;  4UP7 A;  4C3I H;  3PUX A;  1K83 H;  2JA9 A;  3K80 C;  5M5Y H;  4APV A;  4LUZ A;  4A3B H;  5M5W H;  3OTO Q;  3E9I A;  4LF6 Q;  4L5S A;  1YHB A;  1K8G A;  3G6E A;  1PH7 A;  1CKO A;  2D0O A;  4BY1 G;  1JE5 A;  2ALY B;  5IYC H;  1RL2 A;  1VQ9 A;  1XNR L;  3J80 c;  4DV7 L;  2JK8 A;  4HIO A;  3PF4 A;  3IRB A;  4A3K G;  3HOX G;  4NPS A;  1U5K A;  1WJJ A;  3Q8D A;  4X66 L;  2B3G A;  5C0X J;  3CMA A;  3TS0 A;  1IBL L;  3AQQ A;  3DM3 A;  3UE0 A;  1PH1 A;  1HZC A;  2F4V Q;  1N9W A;  1GKH A;  4KLK A;  3I4N H;  5AJ3 L;  4X66 Q;  1QZH A;  3KFU A;  1VS0 A;  3S15 H;  2PMZ E;  3RLO A;  2D0P A;  2HIX A;  3KYH C;  3UDX A;  5IYB G;  3CXC A;  1E24 A;  1OXU A;  2MO1 A;  2IY5 B;  5M3M H;  3FKI H;  5C4J H;  4DV0 L;  1JMC A;  1HR0 L;  1S3O A;  2BA0 A;  1Q1E A;  1VQE A;  2AHO B;  3S2H H;  3PUY A;  3H15 A;  2UXC L;  2F3I A;  2N49 A;  2PI2 E;  1QZG A;  1JJG A;  1FJG Q;  1UE7 A;  4IFD J;  2CFM A;  3KF8 B;  2NVY H;  4NXM Q;  1OXS C;  2PQA B;  3J7Z C;  3K81 C;  2HT1 A;  4DR7 Q;  2I5M X;  1XMO L;  4YWL A;  1VQ5 A;  1LYL A;  1PH2 A;  5JEA J;  5M3F H;  3CCU A;  4IJH A;  3K8A A;  2EIF A;  4LF9 Q;  1FVI A;  3KLW A;  4JI5 L;  2JA8 H;  4P72 A;  1PH3 A;  1L0W A;  3GTK H;  4L5Q A;  4A3D G;  2N3S A;  4JBM A;  2K52 A;  1HZ9 A;  4JBW A;  4OX9 L;  1KL9 A;  3F1Z A;  3S1R H;  3D0F A;  3K7U C;  4B3M L;  4ME3 A;  1V9P A;  1Q8K A;  2JE6 I;  4HJ8 A;  1XNQ Q;  4JI8 Q;  3I4M H;  1X55 A;  3PSI A;  1P16 A;  2I0Q A;  1PYS B;  1SN8 A;  2H5X A;  5M3M G;  4BXX G;  1AH9 A;  1VQP A;  3F2B A;  1VQ6 A;  3A5U A;  1N8R C;  4POG A;  4PZ6 A;  2PNH A;  1HR0 W;  4LNQ A;  2AWN A;  1W2B A;  3L7Z C;  2ID0 A;  1I94 Q;  1NMG A;  2YTX A;  3M9B A;  1HR0 Q;  2ATW A;  2JA7 H;  1UE6 A;  4LFA Q;  4BY7 H;  1SRU A;  2GVA A;  3W1G A;  4GNX B;  4Y7N H;  3CP0 A;  3KDF A;  3CCL A;  3S1Q H;  1X6O A;  4EX5 A;  1B70 B;  1CUK A;  4DR7 L;  3ERS X;  1M90 C;  2N78 A;  2NVQ H;  1H95 A;  2K4K A;  4P75 A;  2R92 H;  4DK6 C;  1TWF H;  4A3M H;  4JI6 L;  1K0R A;  5JJI A;  4GN4 B;  3AFP A;  2RF4 A;  2VQF Q;  1CKM A;  4AH6 A;  3CC2 A;  2OTJ A;  1WOC A;  2R7Z G;  5C4X G;  2YTY A;  3I4O A;  5J3B A;  4IPH A;  5HGQ A;  2AWO A;  3GO5 A;  5C44 H;  1ASY A;  4JBK A;  4GN3 B;  1HNW L;  2D62 A;  2FXQ A;  4JBJ A;  2CCZ A;  4X65 Q;  1N34 Q;  4DV6 Q;  2VNU D;  3BZK A;  1VQ4 A;  1PH6 A;  1YJN A;  3H3V I;  2Y0S E;  1Q12 A;  2A19 A;  2F4V L;  2MNA A;  3U58 A;  1L1O B;  1WYD A;  4GOP A;  2JA6 G;  1LTL A;  1C9O A;  3FHW A;  1R9T H;  2V1C C;  4X62 Q;  1QVG A;  4X6A H;  4X62 L;  4LF5 Q;  2PI2 A;  1E22 A;  2EXD A;  5GAH C;  1A8V A;  3L0O A;  4QY7 A;  1J6Q A;  2DUD A;  2NN6 G;  4MTN A;  2ZJR A;  1EFW A;  1P8L A;  4FDB A;  2NN6 I;  1PH4 A;  3T1Y L;  5FLM H;  5FLX c;  1JB7 A;  2ZM6 Q;  5C44 G;  2QGQ A;  3D31 A;  3HOV H;  3F8T A;  4DR3 Q;  4BY1 H;  4IOC A;  3OYY A;  4UP8 A;  1N36 L;  1GM5 A;  4GLA C;  4IFD I;  5IWA L;  1QVF A;  1ASZ A;  2YV5 A;  3CPF A;  5IWA Q;  1GO3 E;  1QUQ B;  2E8G A;  2MQH A;  1G29 1;  3PCO B;  2R7F A;  2NVT H;  3H3V H;  4QQB X;  1MIU A;  2CWA A;  2R92 G;  2IX1 A;  4A3C G;  2K75 A;  4DR4 Q;  1C0A A;  2MO0 A;  1IBM L;  4DR1 L;  4IOA A;  3T1H Q;  1VQK A;  1Q1B A;  4LF9 L;  4POF A;  3NEM A;  2HHH L;  2B63 G;  4IJL A;  3HOV G;  1VQ7 A;  1Y14 B;  1EOV A;  4B3M Q;  3TRZ A;  1WI5 A;  2BH8 A;  3E0E A;  3RNU A;  3G71 A;  2CWP A;  4YWK A;  2A1A A;  4X64 L;  4DV2 Q;  1D7Q A;  3M85 A;  4L5R C;  3KJO A;  1NJI C;  3A0J A;  3W5O A;  1D8L A;  1BKB A;  2UXC Q;  1J5E Q;  4B3R Q;  4DV5 Q;  4HIK A;  2UU9 L;  4LF8 Q;  2L15 A;  5H1S E;  2K5H A;  1EQQ A;  2R6G A;  3HOX H;  1G51 A;  2Q2I A;  4LF4 Q;  3GTQ H;  2GVB A;  1PH5 A;  3FKI G;  4JI1 Q;  4JI3 Q;  1YHA A;  5LMN Q;  3K0X A;  1IL2 A;  3W1B A;  2VQF L;  4DNI A;  4GKK L;  5IYD H;  1XPR A;  3CW2 C;  3BU2 A;  1SRO A;  3KF6 B;  1OTC A;  2JA6 H;  3H0G G;  3CCS A;  4IFD G;  1A62 A;  2EQS A;  4LFC L;  4HJ5 A;  1A63 A;  4KHP Q;  5JJL A;  3HKS A;  4B3S L;  3PO3 H;  4C2M H;  4YHH Q;  4JI7 Q;  3NEL A;  2A8V A;  1TWH H;  4JI3 L;  5C3E G;  3PO2 G;  4A93 G;  1EUJ A;  1UEB A;  3MXN B;  1YIT A;  4GOP B;  3HFZ B;  1X56 A;  4DR2 Q;  5M5X H;  4J15 A;  2XGT A;  3OW2 A;  4NXM L;  1DGS A;  1I3Q H;  4PMW A;  2KHJ A;  1IYJ B;  1WCM H;  3GD7 A;  3CCV A;  1PH8 A;  1IBK L;  1EIY B;  2RHS B;  4IPC A;  1IBL Q;  4R4O A;  1UE5 A;  1Z47 A;  1YVC A;  1Q46 A;  3CAM A;  1VQD A;  2WAQ G;  4JI1 L;  1VQN A;  4GS3 A;  1X3E A;  2IT1 A;  4JOI C;  5GAE C;  1L2F A;  4DR5 Q;  4UPA A;  4LF7 Q;  4JYA L;  1BVS A;  3GTO H;  2VUM G;  4OWX B;  1I6H H;  4DAM A;  1E3P A;  2R7D A;  5IY0 A;  1E1T A;  4A3L G;  3CCE A;  3ZJY C;  4A3F H;  2QA4 A;  4HJA A;  4BY7 G;  3JAM c;  3AFQ A;  3CCR A;  4X64 Q;  2R93 H;  4DR1 Q;  5IP7 H;  1EYG A;  1YEZ A;  2VS1 A;  3I4M G;  1NE3 A;  3GTP H;  4BBS G;  4TVA B;  2E2J H;  4IO9 A;  2VZA A;  1YJ9 A;  2RHQ B;  1CKN A;  2YTV A;  4QIW E;  4NXN Q;  1MJE A;  2IX0 A;  2PQA A;  1YHQ A;  3CCQ A;  3M3Y H;  1XTD A;  4EQ5 A;  5C0X I;  2NZO A;  3G4S A;  4YWM A;  3CD6 A;  4A3M G;  3I2Z A;  5C0X G;  3PIO A;  3S16 H;  4P71 A;  3E9H A;  5BR8 L;  3L2P A;  3T1H L;  4AIM A;  3S17 H;  1LM0 A;  4GNX C;  2JA5 H;  4DR4 L;  1B8A A;  3ULP A;  3H0G H;  4H02 A;  1MJC A;  1C7Y A;  2K50 A;  3SGI A;  1T9H A;  4JCV E;  5ELO A;  2ASB A;  4JV5 L;  1HZA A;  1CSP A;  5DLQ E;  1Q7Y C;  4YY3 Q;  4GLX A;  1A0I A;  4QJF A;  3RN5 A;  1I50 H;  1S72 A;  1VQ8 A;  2ZM6 L;  4AQY L;  5HY6 A;  1XPO A;  1MKH A;  1VQF A;  4LUV A;  4R4Q A;  4A3F G;  4JI5 Q;  3PO3 G;  1IBK Q;  3I4N G;  4OON A;  1YI2 A;  1VQH A;  5M3F G;  2Q2T A;  4OWW B;  1VQI A;  1YBY A;  3HOZ G;  1W3S A;  4RMF A;  3TQY A;  4LF5 L;  1K3R A;  3BZC A;  3S1N H;  3PIP A;  1XNR Q;  4C3J H;  1FGU A;  1PFS A;  4DKA C;  1XMO Q;  4DR5 L;  4A3G G;  1TXY A;  1VCI A;  3CQZ H;  3UDF A;  2B29 A;  2WP8 J;  3U50 C;  4BBR H;  3ER0 A;  4A3I H;  3GTG H;  3WWV A;  1JJ2 A;  1GD7 A;  1YIJ A;  5E7N A;  4BBS H;  1NTG A;  3OTO L;  4OO1 G;  4HJ9 A;  2OQ0 A;  1HZB A;  1SR3 A;  2HQL A;  4TQU S;  5GQO A;  4C3H H;  1KRS A;  2UXD Q;  2ZTC A;  3F2C A;  1KD1 C;  3U4V A;  1TWA H;  3AYH B;  4GLV B;  4DV3 L;  3GTL H;  1PVO A;  1QVC A;  4DR2 L;  4A3C H;  1SMX A;  1VQB A;  3RLN A;  4A3L H;  1XMQ L;  3EN2 A;  2LXJ A;  3K7A H;  3NBH B;  2E5L L;  4R4T A;  4JG2 A;  5AJ3 Q;  4A3J G;  4JI0 Q;  4GKJ Q;  1N32 L;  1O7I A;  3J81 j;  4DUY Q;  2KHI A;  1M1K C;  1KXL A;  5GAD C;  1FL0 A;  2CKZ B;  3KOJ A;  4HIM A;  3HOW G;  3TRE A;  1UWV A;  3PGZ A;  4A3D H;  4AQY Q;  4GKJ L;  2XTI A;  1OXT A;  1CSQ A;  4A3G H;  1X3F A;  1KIX A;  3J7A 5;  2GN5 A;  2ZTE A;  3A5Z B;  1IZ6 A;  1VQC A;  1CKN B;  2CQO A;  3NEN A;  1K73 C;  4DR3 L;  1B7Y B;  2JA5 G;  4AYB G;  1XJV A;  1SLJ A;  4KHZ A;  1YJW A;  2F52 A;  4JI4 Q;  2BA1 A;  1VQG A;  1G6P A;  4DUZ L;  3HOW H;  1EQR A;  5GAG C;  3ICE A;  4LW1 A;  4GN5 A;  3HKZ E;  2OQK A;  3RR5 A;  4JI8 L;  1KQS A;  4DR6 L;  3G48 A;  1N36 Q;  1AE2 A;  1HH2 P;  5IP9 G;  2IHF A;  2K14 A;  3PUV A;  4MZ9 A;  4BA1 I;  2VY3 A;  1BBW A;  4LUO A;  4R1J A;  4HID A;  3RZD H;  4OX9 Q;  1EIF A;  2VQE Q;  4B3S Q;  2IHE A;  1QUQ A;  3S14 H;  2VL6 A;  3GTM H;  2OTL A;  5IT9 c;  3M4P A;  2WB1 E;  1X9N A;  3PUZ A;  4IPD A;  4K0K Q;  5EAY A;  4PZ8 A;  1Y1W H;  2E5L Q;  2C35 B;  4DV6 L;  4DV0 Q;  4MNO A;  1S40 A;  3CPW A;  4L5T A;  1PYB A;  4BBR G;  4A3I G;  4AYB E;  3JAM i;  3CCJ A;  4ALP A;  4JV5 Q;  2Z6K C;  1YNX A;  5IP7 G;  5GRO A;  4LF8 L;  2JEA I;  3S2D H;  1RIP A;  3EIV A;  3HOU G;  3TEH B;  1J5E L;  4QGU A;  4JI6 Q;  1TWC H;  1X3G A;  2I5L X;  3PUW A;  4A3J H;  2DGY A;  3PF5 A;  4O0A A;  2YU9 H;  1N34 L;  2K5N A;  2WAQ E;  4JC0 A;  1KRT A;  2RCN A;  5IYB H;  2ES2 A;  1HNW Q;  4DV4 Q;  5LMU L;  5ELN A;  5LMU Q;  2NZH A;  1VQJ A;  4NB3 A;  3HOY G;  2VUM H;  4YHH L;  4JI7 L;  4JOI A;  4O2D A;  1JT8 A;  5IP9 H;  4HJ7 A;  3GTJ H;  4WJ4 A;  2AMC B;  3U4Z A;  3I7F A;  1Q81 C;  1BBU A;  3HOU H;  1I94 L;  2YYZ A;  5FLM G;  4UP9 A;  4JI2 Q;  1IBM Q;  3STB D;  1OXX K;  2Q2U A;  4YCW A;  5BR8 Q;  1Y1V H;  4OXP A;  2N8N A;  2UUA L;  2E2H H;  2OCE A;  1K9M C;  1YZ6 A;  2Y0S G;  4LFB Q;  2Z6K A;  1AE3 A;  4LF4 L;  2JJQ A;  1Z9F A;  4XTC S;  1EWI A;  5LMN W;  1HNX Q;  4LFA L;  2LXK A;  3HOY H;  4JYA Q;  1V43 A;  4DAY B;  4DV5 L;  1VQM A;  3CC7 A;  3M4O H;  4LF6 L;  4K0K L;  1VQL A;  1OXV A;  3T1Y Q;  1IXR A;  4PZ7 A;  3M4Q A;  1KC8 C;  1PV4 A;  4A75 A;  1UE1 A;  4JI4 L;  4BXX H;  3AEV A;  3KJP A;  4DUY L;  1WFQ A;  4WJ3 M;  4BA2 I;  1HJP A;  1I5F A;  1NY4 A;  2K5V A;  5IYD G;  5IE8 A;  1NMF A;  3ULL A;  4GNX A;  3UDG A;  1SFO H;  1Q82 C;  4DV1 L;  2B63 H;  3RZO H;  4DR6 Q;  2HIV A;  1VQA A;  5K36 G;  3KF6 A;  3S1M H;  3LGJ A;  2HHH Q;  1HNZ L;  2OWO A;  1SE8 A;  4B3T Q;  4KHP L;  1L1O A;  4YCU A;  4A76 A;  4LFC Q;  1Y1W G;  3CCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...