1KRSA

Solution structure of the anticodon binding domain of escherichia coli lysyl-trna synthetase and studies of its interactions with trna-lys
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
110
structure length
110
Chain Sequence
b'FRRDHTSDQLHAEFDGKENEELEALNIEVAVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDDLPEGVYNEQFKKWDLGDILGAKGKLFKTKTGELSIHCTELRLLTKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSYL-TRNA SYNTHETASE (PRODUCT OF LYSS GENE)
molecule tags Aminoacyl-trna synthetase
source organism Escherichia coli
publication title Solution structure of the anticodon-binding domain of Escherichia coli lysyl-tRNA synthetase and studies of its interaction with tRNA(Lys).
pubmed doi rcsb
total genus 14
structure length 110
sequence length 110
ec nomenclature ec 6.1.1.6: Lysine--tRNA ligase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1krsA00
4B3SL 4BA1I 4WJ4A 1YHBA 2BA1A 3L0OA 1SR3A 4PMWA 5IYCH 1V1QA 1EWIA 2K52A 1VQ8A 4L5SA 1GD7A 4DR6L 1GM5A 2A1AA 4YWLA 1Y1WG 1SLJA 2B63H 2PI2A 1P16A 2UUCQ 3T1HL 3Q8DA 3DLLA 2UU9L 3BU2A 4LF5L 1KXLA 4DUYQ 1E7ZA 3S2DH 4P75A 2HQLA 1G291 4IJLA 1VQMA 5C3EH 4JI5Q 4MTNA 4WJ3M 1VQLA 4JBWA 3KJOA 2K5NA 2NVTH 5IP7G 2ZM6L 3CMAA 4LUZA 5C4XG 1V9PA 1CSPA 3GDEA 5M3MH 1K8AC 3I56A 4GLVB 1K73C 3KFUA 4A3GH 4OX9Q 4HIDA 3GD7A 4A3DG 2D0PA 3CPWA 4A4IA 3PIPA 2MO1A 2VNUD 3WWVA 1I50H 1LTLA 2UUCL 2CQOA 1WCMG 2L15A 5GQOA 3A0JA 2ZTEA 3U4VA 4IJHA 3GTKH 4X65L 1JJCB 1M90C 3RN5A 2WAQE 4R4QA 1PA6A 3ULLA 4JI4L 3FKIG 4C3IH 4PZ6A 2IHFA 1S40A 1E1TA 4HIOA 1VQ5A 4GOPB 4A3CH 1EYGA 1E1OA 3HOZG 2LXKA 4DPGA 4J15A 1N34L 3S1MH 1QVCA 1X3EA 1HZAA 5IE8A 1Y1WH 4LW1A 3RLNA 2Q2TA 4JI0L 3K8AA 4BY1G 1IBLQ 4DAMA 4A3IG 3E0EA 4P71A 4DK6C 5C0XI 1T9HA 2AKWB 3M4PA 4BA2I 3PO3H 2RCNA 2C35B 5C0XJ 2JK8A 1MKHA 4KI0A 1Z47A 5FLXc 2BH2A 2UXDQ 3D31A 1VQDA 2CWPA 1BBUA 1Q86C 1CKMA 4A3MH 4C3JH 1D7QA 4YY3Q 3UE0A 3UE1A 1P8LA 2F52A 4Y7NH 3L2PA 3I55A 1N34Q 2VY3A 1WI5A 4A3LG 2IHEA 2R92G 4A75A 1FJGQ 3KF8B 5J3BA 5BR8L 1KQSA 3F2DA 1XNRL 3TREA 2RHQB 1IXRA 2AWOA 2E2HH 4NPSA 2I5LX 4LFCQ 2KCMA 4B3ML 1X3FA 2MNAA 1U5KA 4K0KQ 3DM3A 4AIMA 5IYBG 2WB1E 3GTQH 3M9BA 5M5WH 4IFDJ 2UXDL 2ZJQA 1I94L 1B70B 4A3BG 1GVPA 2NN6I 1N8RC 4YWMA 2GN5A 1HZBA 2NZOA 1FJGL 3GTLH 2OWOA 1PH7A 1SE8A 4GOPC 1NJIC 2PQAB 2UXCQ 4AH6A 2KHJA 4JBJA 4JOIA 1FL0A 2JA9A 5FLMG 4DR2Q 1N33L 2WB1G 1Q1EA 4OONA 3UDFA 2YU9H 5JJIA 2BH8A 2CFMA 2VQFL 4DV1Q 1C7YA 2KHIA 4PZ8A 2JA6G 1I3QH 1K0RA 4LF6Q 4GN4B 3S17H 2PQAA 2YTVA 4IPCA 4LF7Q 3STBD 1JB7A 1EFWA 3TRZA 1YZ6A 1Z9FA 4X6AH 4JI3L 3CCUA 4A3JH 5IYDG 1LUZA 4JI5L 4A3KH 1VQKA 1KRTA 2NZHA 4LF6L 4DR4L 4GN3B 5ELNA 4L5RC 1CSQA 3HOUG 4DNIA 4BY7H 1A62A 3I4MH 2R7ZH 2VQFQ 3EBEA 4JI3Q 3S2HH 4DR1Q 4DR5L 3U50C 1YJ9A 5FJ8G 3BJUA 3W1GA 1S72A 4DV3L 1J6QA 5HGQA 3AYHB 2OQ0A 1AE3A 5C4XH 4R4TA 3F8TA 4A3FG 1VCIA 4RMFA 4IPDA 1YJNA 1XNQL 4BBSH 5IY0A 4KHPL 4A3DH 2EXDA 4LF9Q 5LMNW 4GNXC 2PNHA 1Q81C 3MEFA 1L1OC 4KLKA 3ULJA 3T1HQ 1YHQA 2UU9Q 2N49A 3AQQA 2D62A 4X62Q 1VQBA 4OWTB 2UUBQ 1VQNA 4P74A 4JI8Q 1VQ7A 4JBMA 4LFAL 4DV4Q 2KENA 1PH4A 5GADC 2WAQG 4KHPQ 4BBRG 2A19A 1R9TH 4A3LH 3PF5A 2KBNA 1DGSA 1Q12A 3OW2A 1HJPA 3PUZA 4MNOA 1IBLL 5AJ3Q 2UUBL 5C44H 4JI8L 4IOAA 2HHHL 1KAWA 5IWAQ 3TS2A 2I5MX 3RR5A 1FVIA 4GOPA 3F2CA 1ASYA 4LF9L 1HZ9A 3J80i 1VQOA 1OXXK 2HIVA 4A3EG 4AQYL 1TWAH 1C9OA 4GS3A 2GVAA 1XTDA 3UDGA 1X54A 3S24A 4UPAA 4A3IH 1H95A 2R6GA 4LFAQ 3M3YH 1L0WA 4APVA 1N9WA 1GKHA 3GTJH 4HJ8A 4QQBX 4QJFA 1A0IA 1SRUA 1WFQA 3I7FA 1A8VA 4ME3A 5AJ3L 1YITA 4LF8L 3CF5A 2ATWA 1TWFH 1TWHH 4X66Q 3RZOH 3CC7A 2JA6H 2R92H 2N8NA 1EIYB 4LFBQ 5M5YH 2Y0SE 3CW2C 4GN5A 1NMGA 4A3KG 1VQAA 4ALPA 1Q7YC 2JA8H 2H5XA 1OXSC 4B3TL 4OWXB 1HZCA 2K5HA 1VQ6A 3G6EA 2D0OA 4DV6Q 4GLXA 3UDIA 4JI1Q 5LMUQ 2HIXA 1PH2A 1AE2A 1IL2A 3CXCA 1Y1VG 4NXNQ 3SGIA 4B3RL 3MXNB 5IP9G 3AFQA 4R4CA 1XMQQ 4IPGA 3PO2G 4DV1L 5JEAG 4X65Q 1SN8A 2PI2E 3H15A 3PCOB 1OTCA 3H3VI 2BA0A 1HNWQ 2NVYH 2OCEA 3A74A 3CCEA 1HR0Q 2UUAQ 3FP9A 1D8LA 1XNRQ 4TQUS 3J81j 2MFIA 4QL5A 1YEZA 1J5EQ 1C0AA 1PFSA 4DUYL 3HOYH 4A3FH 3T1YL 1SROA 1TWCH 1SMXA 2R7FA 4DV6L 3PUVA 1ASZA 4BBSG 1HNWL 5LMUL 4DR4Q 3JC66 1N36L 2EIFA 4JI0Q 2E2IH 1EQRA 1X56A 3CQZH 1PYSB 1XMQL 4H02A 4UP8A 2A8VA 4A93H 2E5LL 2VS1A 3M7NA 3PSIA 3S15H 2R7ZG 2Z0SA 1HR0L 1W3SA 2IT1A 4X62L 3I4MG 3L7ZC 3FHWA 2LXJA 5HY6A 2GVBA 1W2BA 4L5TA 4LF7L 5C3EG 4JI6Q 4DV5L 4GNXB 4JCVE 2NVXH 3STBC 1L2FA 5JJKA 4HIMA 1NY4A 2K75A 4DV2L 4BY1H 4DV4L 5H1SE 3NBHB 3LGJA 2CKZB 1Q8KA 3PIOA 1PH9A 3I4NH 2JEBI 1JJ2A 3S14H 5JJLA 3KJPA 4LWCA 1VQIA 3HOYG 3CCMA 1A63A 2JA5G 5C4JH 4R4OA 3K80C 4EX5A 1IBKQ 4GKKQ 4DKAC 1BVSA 3CAMA 3RLOA 1N33Q 3HKZG 1X55A 1XPOA 3H0GG 2ASBA 4GLAC 1LM0A 4AYBE 4UP7A 4DR3L 3S16H 1LYLA 3VDYA 2YTYA 4LFBL 4OO1G 2HT1A 1E3PA 3I4OA 3M4OH 2KCTA 2V1CC 1PH8A 1V43A 4C2MH 3CPFA 2UXBL 2VUMG 5M3MG 4JBKA 4DR3Q 4DV7L 4QY7A 5C0XG 2CCZA 3KF6B 4JI7L 4A3GG 4LUVA 3HOWH 3PF4A 2UXBQ 4B3RQ 3K81C 1VQ9A 5GAEC 1PH3A 4DV0L 1KIXA 3F1ZA 2QEXA 5LMNQ 3HKZE 1PYBA 1MIUA 4DR5Q 1YHAA 2ID0A 2IX0A 1QUQB 3NENA 2Z6KA 1SFOH 1Q82C 2UUAL 2ZM6Q 3CCJA 2I5HA 3K0XA 2F4VL 2K4KA 4NB3A 3EIVA 3J80c 4POFA 1XJVA 4RG1A 4DR7Q 2R93G 5EAYA 4HJ9A 2N3SA 4L5QA 2YV5A 4IFDG 3ER0A 1Y14B 3AFPA 1OXTA 4GKJQ 2QGQA 3J81c 1QVGA 2XGTA 2RF4A 4X64Q 3H3VH 1VQGA 1KC8C 4A3MG 2ZTCA 1NTGA 4NXML 3W5OA 4A3BH 1IZ6A 3HKSA 2Q2IA 1K83H 3PGZA 4DR1L 4JYAL 3IRBA 4O2DA 3HOXH 4YHHQ 2ES2A 4O0AA 3PV0A 3CCQA 3HOVH 3M4QA 4YCUA 4DK3C 4OXPA 3B6YA 4DV5Q 2OTJA 2JA7H 2DUDA 3E9IA 4PG3A 4YCVA 3GTGH 4JYAQ 2Q2UA 4IOCA 3RLFA 4A3JG 2EQSA 3U58A 3GTPH 3K7AH 4HJAA 3K7UC 1O7IA 4LF4L 4POGA 3I2ZA 4DV2Q 5IYBH 1OXUA 1TWGH 4X66L 3F2BA 5IYDH 3NELA 1FGUA 3TQYA 5M3FG 4OO1I 1Q46A 1UE1A 1VQJA 1VQFA 3A5ZB 3A5UA 3BZKA 2NN6G 4OWWB 1PH6A 3PO3G 1VQ4A 1I5FA 4YY3L 2DGYA 3CC2A 4A3EH 1HNZL 2I0QA 5GROA 5ELOA 1IBML 4TVAB 4LFCL 4DUZQ 1NE3A 1X65A 5FJ8H 3CCVA 1MJCA 4IO9A 1IBKL 2OTLA 3I4NG 2RHSB 2JA5H 1UWVA 4MZ9A 1PHJA 1WJJA 2QA4A 1MJEA 1UE7A 1HNZQ 4YCWA 2ALYB 2MO0A 3UDXA 3PUXA 3HFZB 3TEHB 1B8AA 2Y0SG 4BXXH 3HOXG 4K0KL 1PV4A 3CCLA 1UEBA 4JI2Q 2R93H 1XPRA 3HOUH 4BBRH 3H0GH 1HNXL 4BY7G 1YJWA 5DLQE 1VQHA 4JC0A 2JQOA 5E7NA 1EOVA 1PH5A 3S1NH 1KD1C 1G51A 2E2JH 2XTIA 4OX9L 1EIFA 1Q1BA 1VQPA 4B3SQ 4JI7Q 3M85A 2IX1A 1XMOQ 2NVQH 1AH9A 1U0LA 1PVOA 4DR2L 4IFDI 4A3CG 1X6OA 2VUMH 1KHIA 1OXVA 1YBYA 3PUYA 1UE5A 4HIKA 2B63G 1JE5A 4QGUA 2B3GA 1WYDA 5FLMH 1QZHA 3HOWG 2R7DA 5LMNL 5K36G 1JJGA 1GO3E 4GKKL 1K8GA 5M3FH 3PO2H 2F3IA 1QZGA 1TXYA 4NXNL 1QUQA 4EQ5A 1HNXQ 1CKNA 2VQEL 2IY5B 5GAGC 2F4VQ 1WOCA 4FDBA 3KYHC 5IP7H 2AMCB 2JJQA 4DR6Q 1B7YB 3J7ZC 4B3MQ 2AWNA 2ZJPA 1NBWA 1XMOL 4AYBG 2JEAI 4X64L 2YYZA 4P73A 3J81i 3KF6A 3CCSA 1J5EL 1I94Q 5IYCG 4LF5Q 2JA7G 3CCRA 3D0FA 1IYJB 3AEVA 3CD6A 4GKJL 1BKBA 1E24A 2AHOB 3ZJYC 1JT8A 1EUJA 1X3GA 1K3RA 4BXXG 3FKIH 5C44G 3GO5A 3KLWA 3BZCA 4DV3Q 1N36Q 2UXCL 3RZDH 1BBWA 2VQEQ 2VW9A 2K5VA 4DV0Q 4NXMQ 5JEAJ 4XTCS 1E22A 1Y1VH 2Q2HA 2K14A 1YNXA 4YWKA 2ZJRA 3T1YQ 3S1QH 1XNQQ 2E5LQ 1XPUA 4PZ7A 2VZAA 2CWAA 3CMEA 4JI4Q 3ULPA 3RN2A 2OQKA 1RL2A 3J7A5 3G71A 2E8GA 2N78A 4KHZA 4R1JA 3GTOH 4A76A 2VL6A 1HH2P 3PUWA 4DAYB 4HJ5A 1QVFA 2B29A 4AQYQ 5IT9c 4JI6L 3HOVG 1CKNB 2JA8G 4UP9A 1PH1A 3S1RH 4IPHA 1UE6A 4LF4Q 1IBMQ 5IWAL 2WP8J 4GNXA 1VQCA 1YVCA 4P72A 4DV7Q 4C3HH 1EQQA 1L1OA 1S3OA 3NEMA 1N32Q 4LNQA 4HJ7A 1YIJA 3CP0A 3KDFA 3ERSX 4JV5L 3W1BA 3GTMH 2FXQA 2PMZE 1K9MC 3OYYA 1JMCA 4LF8Q 3HOZH 3RNUA 3CC4A 3ICEA 2WFWA 5IP9H 1N32L 4DUZL 3OTOL 4JOIC 2MQHA 5M5XH 4YHHL 1M1KC 1CKOA 1VS0A 4JI2L 1VQEA 5GAHC 3TS0A 3KDFB 3G4SA 3U4ZA 2YTXA 3JAMc 1YI2A 2ZTDA 1L1OB 4DR7L 4UY8C 3G48A 1I6HH 4JI1L 1CUKA 3KOJA 5BR8Q 2JE6I 4XIGS 4R4IA 4JV5Q 1KL9A 1WCMH 2Z6KC 4JG2A 3JAMi 3EN2A 1G6PA 1NMFA 4QIWE 2HHHQ 4B3TQ 4Y52H 1KRSA 4LUOA 2LSSA 4A93G 1RIPA 3E9HA 1HR0W 2K50A 1X9NA 3OTOQ
chains in the Genus database with same CATH superfamily
4B3SL 1E2VA 3HKZB 2Z1CA 4KMUC 2K52A 1NNXA 4DR6L 2X69A 2PI2A 2UU9L 3DLLA 2SDFA 2LFNA 3V2TA 4LF5L 1KXLA 1U4MA 4IJLA 4RCNA 1D5MC 2RBMA 4WJ3M 2K5NA 5IP7G 4LUZA 1IW7D 5C4XG 5M3MH 3GDEA 1K8AC 2WINB 3KFUA 4OX9Q 4HIDA 1ET9A 2D0PA 5IGFA 3VR4A 2VNUD 3FDTA 3WWVA 3GQBA 2CQOA 2NVXB 1WCMG 3U4VA 4X65L 1M90C 1EY4A 3A8KE 2WAQE 4R4QA 4HSVA 4CGYB 5KNDA 4JI4L 3A56A 1STNA 1E1OA 5C4HA 3S1MH 1QVCA 1Y1WH 4LW1A 4BY1G 1XTCD 4F8MA 3GTQB 2MJ8A 3E0EA 4DK6C 3V96A 3ND9A 4BA2I 1CQFA 3DUZA 1R4PB 4IUQA 2CWPA 4A3MH 1EU3A 4ZQ3A 3TP5A 4YY3Q 1I6HB 4BBRB 3I55A 4A3LG 5BR8L 1QWYA 3NTIA 3TREA 2P5ZX 2SOBA 1XNRL 2AWOA 4NPSA 2MHVA 1EY9A 4XQJA 1U5KA 1CI3M 2DNEA 3E6ZX 5IYBG 2ZJQA 1B70B 1F2LA 1HZBA 3GTLH 5E1FA 5D65A 1SE8A 2PQAB 5FLMG 5KIXA 1FL0A 2H1EA 4OONA 1Q1EA 5JJIA 2BH8A 2CFMA 2EYHA 2EYMA 1K0RA 2HD3A 4LF6Q 4GN4B 4IPCA 4LF7Q 1JB7A 2F0EA 5IT9L 3FRPB 1U4RA 1YZ6A 5C4ZA 1DXMA 4BY7B 3CCUA 4A3JH 5IYDG 1LUZA 1HCZA 2B2UC 2NZHA 4LF6L 3I72A 5ELNA 2IW3A 2NTSA 4BY7H 4DNIA 1A62A 3I4MH 1O7LA 4JI3Q 1V8QA 4HTHA 4KD3A 1WTOA 3HOZB 4DU9A 3U50C 1PTOB 1S72A 3VYTA 1J6QA 3AYHB 2OQ0A 2PNRC 1BO0A 5K36H 4DGZA 1KNEA 3VR3A 4IUUA 4RMFA 2X6GA 1YJNA 1XNQL 4BBSH 4KHPL 2V4DA 4LF9Q 4GNXC 1L1OC 2A69D 2UU9Q 2K05A 5FLXE 4X62Q 4OWTB 4NMZA 4A3LH 2A19A 1Q12A 1JB3A 3FVQA 2RA4A 3OW2A 3PUZA 1KLGD 2F0TA 2UUBL 2QEJC 5CV5A 3GTLB 4A3IB 3RR5A 4GOPA 1B3QA 1ASYA 2R93B 2HIVA 4KY5A 4IALA 4GS3A 2GVAA 2MP1A 1X54A 1W6KA 4RGTA 2A6HD 1L0WA 5A35A 4RH6A 4JW0A 1IYVA 1F9SA 3T13A 3I7FA 4ME3A 3IKJA 4LF8L 2ATWA 1TWFH 4K8IA 1TWHH 4X66Q 3CC7A 1OO9B 2G5DA 3RMHA 1S5ED 3CW2C 4GN5A 1EU4A 1NMGA 1VQAA 3T4AC 1Q7YC 5JPNC 2JA8H 4B3TL 1BR9A 3G6EA 2D0OA 4DV6Q 4GLXA 3UDIA 1IL2A 3TDQA 4B3RL 1YNND 1ESFA 1SN8A 2PI2E 2BA0A 2NVYH 1D8LA 4TQUS 5A2QL 1YEZA 1YNJD 2HQEA 1SROA 1SMXA 3K0YA 4XYOA 4BBSG 1RF2D 1ASZA 1HNWL 3JC66 2EIFA 1PZKD 3CQZH 2E74C 4UP8A 1EEID 2BE5D 4OGQC 3NWSA 3M7NA 3PSIA 1A2UA 1JORA 4PMCA 1F2ZA 1W3SA 2E76C 3FHWA 1LT5D 2LXJA 1SNPA 1W2BA 2WB1B 1C8CA 4GNXB 1WTWA 1L2FA 4DV2L 4DV4L 3PMFA 5H1SE 2JA7B 3LGJA 1Q8KA 1ZYRC 4RKLA 5ELEA 3S14H 2WKCA 3HOYG 3SEBA 1A63A 2JA5G 1BBXC 4R4OA 4L6TB 3BVMA 2J7ZA 1X55A 1XPOA 3S2DB 2ASBA 4GLAC 2DN8A 4UP7A 4AYBE 1LYLA 2YTYA 4I7AA 4OO1G 3M4OH 5CMDA 1V43A 1CK1A 2A69C 2F0MA 1LT6D 4DV7L 4QY7A 1SDFA 3KF6B 1O7YA 3AMUA 4QMGA 4A3GG 3MWYW 3HOWH 5C3WA 3BYTB 1CHPD 1VQ9A 5GAEC 4K5VA 4X3UA 1NR2A 1PXUA 2QEXA 3S15B 3HKZE 1PYBA 1QUQB 3R8BA 3A8IE 2ZM6Q 4LAAA 2I46A 3K0XA 5M5WB 4NB3A 2N3SA 4HAEA 4K8JA 4L5QA 3LNNA 4XT3B 2QDBA 1TVXA 1CTMA 1OXTA 3PO3B 4GKJQ 1TU2B 3J81c 5FK9C 5T1IA 4F87A 5TSSA 1SYCA 2RF4A 4X64Q 4XYQA 3H3VH 1VMCA 4CHTB 4A3MG 4NXML 1NTGA 2I07B 3OW7A 1IZ6A 3TSSA 1K83H 1IW7C 3IRBA 4B9XA 2F0DA 4O0AA 1RJTA 1SJHD 1B9NA 3PV0A 1D2BA 4DK3C 3B6YA 5IGEA 2OTJA 2O5IC 5EGTA 3E9IA 1STHA 3HP3A 4YCVA 5C44B 1SNOA 2KEDA 3P75A 1GUNA 4HR7B 4DV2Q 1JE4A 3F2BA 1B4OA 2OXPA 1MSHA 5M3FG 4IFDH 1VQJA 4X3SA 1TWGB 4H44C 4YY3L 3CC2A 4A3EH 1HNZL 1DYQA 4LFCL 3HEJA 4DUZQ 1NE3A 1X65A 2L5TA 2ZT9C 1MJCA 3CCVA 5IT9E 4K14A 1UWVA 3OWFA 3R2TA 4IZ8A 1O80A 1MJEA 2ALYB 3EA6A 3QO2A 4R9WA 3PUXA 1RD9D 3CCLA 3D8GA 3A8JE 1UEBA 4JI2Q 3SDZA 3HOUH 4BBRH 1X3QA 3BDCA 4NDXA 5DLQE 1VQHA 1D1IA 1G8ZD 2JQOA 5KYLA 2VUMB 5I9PA 1G51A 2XTIA 2SNMA 1EIFA 1AH9A 1SMYD 1WTXA 4IFDI 2KECA 4KD4A 3PUYA 2B63G 2B3GA 2F0NA 1K8GA 2F3IA 1QZGA 4EQ5A 4WRDA 3E0JA 5M5XB 1HNXQ 3AB9A 2F03A 5GAGC 1WOCA 2NYZD 2AMCB 2F0IA 3CRLC 3SXHA 3MEHA 4FF2A 1DOMA 1XMOL 4PNYA 3K5NA 3KF6A 2B63B 1I94Q 3RZDB 2JA7G 4KN4C 1BKBA 3ZJYC 1EUJA 4C3IG 1I6VC 1PFNA 2K5VA 4A3JB 4XTCS 3T1YQ 4YWKA 1YNXA 2JA8B 4FYDA 3EJIA 1F9QA 4KKUA 1HA5A 1VMPA 4UAIA 4C2MB 3J7A5 1FNUA 4WFN3 4KHZA 1Y8PB 4AQYQ 5IT9c 1CKNB 4XXEA 5L37A 5HURA 3S1RH 2FHTA 2NVQB 2WP8J 4KKTA 1VQCA 4GNXA 2XIWA 1L1OA 1S3OA 3NEMA 2PW5A 4DK1A 5BN5A 4HJ7A 2XNAC 2B2WA 4PV1C 1JCKB 3A55A 5D3IB 3W1BA 3GTMH 2FXQA 1JMCA 1LTSD 2B2TA 5CC4A 3K57A 2WFWA 5JOBA 5IP9H 4H0LC 1PRTF 2MQHA 4K2LA 5M5XH 2M2LA 1M1KC 4A93B 5GAHC 1WTHA 1LTAD 4DN4M 3U4ZA 2YTXA 2ZXPA 3G48A 1I6HH 4RKBA 2BCOA 1GUGA 3K5MA 3P20A 1NUCA 4R4IA 2NVTB 1WCMH 3W3AA 1SSOA 4A93G 2KHSA 1UEAB 3E9HA 4HSPA 2Q8RE 3OHXC 1HR0W 3HOUG 1V1OA 4ABNA 1YHBA 2BA1A 3N6RA 1ZEQX 4PMWA 5J39A 3TZDA 1VQ8A 1GD7A 1GM5A 4YWLA 1Y1WG 2Z6BA 2EJGC 1P16A 3Q8DA 1H9KA 3TZUA 2F0PA 4IUPA 1JICA 5C3EH 4JI5Q 4MTNA 3D4RA 2NVTH 3KJOA 2ZM6L 3MXUA 3T56B 5C0XH 1CSPA 1SYDA 2XN9C 4L63B 1K73C 2NVYB 1F2MA 1F9PA 4A3DG 1YNJC 2MO1A 3T16A 3VR6A 2UUCL 2MUYA 2L15A 4FXKC 5GQOA 3A0JA 2ZTEA 1SJED 1T5XD 1PA6A 1AFPA 3ULLA 2M00A 1CZWA 3CQZB 2OT2A 1E1TA 3OSOA 4HIOA 1VQ5A 2K03A 2BE5C 1A3VA 4GOPB 4A3CH 2NWGA 1EYGA 3HOZG 3P7JA 1ESRA 1B44D 2B2UA 3DWQA 2Q2TA 4JI0L 3T51B 4P71A 2RSOA 5C0XI 1T9HA 5IGDA 3M4PA 1EY7A 4O1NA 3PO3H 2RCNA 2XSCA 1MD2D 2JK8A 1RHPA 1VQDA 1BBUA 4C3JH 4K2KA 3UE0A 2OEOA 1P8LA 3L2PA 3VA5A 1WI5A 2JSOA 2R92G 1FJGQ 3S14B 1CM9A 3KF8B 1HUNA 1A2TA 1IXRA 2E2HH 5C3EB 3A7AB 4LFCQ 4B3ML 1GUSA 2MNAA 4PQXA 5CV6A 3GTQH 2UXDL 1I94L 1K8MA 3I91A 3K7AB 2GN5A 2B2TC 2NZOA 1I50B 3J81L 2OWOA 4GOPC 3BDLA 1NJIC 3HOVB 2UXCQ 2KHJA 4JBJA 2SEBD 5C4XB 1C7YA 2KHIA 2VB2X 4ID6A 3SVMA 1I3QH 3S17H 2PQAA 4ZUJA 3S9WA 4JPBW 2E2HB 4EQOA 1EFWA 3TRZA 1Z9FA 1V1PA 4JI5L 4A3KH 1TWHB 2NBFA 2K5WA 4DAVA 2J0TD 1ONLA 2RDFA 4DR1Q 4DR5L 2LKVA 3W1GA 1HTPA 3HGBA 3X3NA 4X3KA 3M4YA 4R4TA 3F8TA 1DOLA 1RDPD 2ZXOA 4A3DH 2EXDA 1Q81C 4MIUA 3ULJA 3T1HQ 1YHQA 3AQQA 2D62A 1G6ZA 1VQBA 1VQNA 1VQ7A 2XRQD 1PH4A 2WAQG 1QNKA 4BBRG 1QNUA 4QUFA 1HJPA 1IBLL 3MXNA 5C44H 4JI8L 2HHHL 1KAWA 4HMIA 4KN7C 1FVIA 3F2UA 2F0WA 4BS9A 3J80i 5EBDA 1OXXK 4A3EG 4AQYL 1TWAH 1C9OA 1CA6A 1IYUA 1H95A 3S24A 4UPAA 2K01A 4A3IH 2R6GA 3S17B 1N9WA 3C2PA 4KTAA 4HJ8A 4QQBX 1A0IA 1SRUA 1CHQD 4J1MA 1DJRD 4LFBQ 3NWTA 1BQQT 2HUGA 2K28A 3NXWA 4OWXB 5DAUA 1VQ6A 1IHZA 5FLXL 2E75C 4RWSC 3MXNB 2GA4B 1BCPF 3PO2G 4IPGA 4DV1L 1STBA 3G7LA 1G2SA 1XX8A 3CCEA 1XNRQ 3J81j 2MFIA 4G7HC 4DUYL 1IKMA 3JAML 4C3HG 5LMUL 1DOKA 3C1EA 4IUVA 2HDLA 3WOFA 2MGSA 3VR2A 3IAYA 3QOLA 3S15H 2R7ZG 1LTBD 4G7OC 2IT1A 4X62L 3I4MG 2EDGA 1H9RA 1W6JA 1V1PB 2C9OA 3NPPA 4JI6Q 4B9WA 5FO9B 2CKZB 2WKDA 1PH9A 2JEBI 1JJ2A 2KA7A 1HPCA 1DZ1A 5M3MB 3OIQA 3K80C 1K0SA 4EX5A 1IBKQ 5KNCA 3HKZG 4ULLA 3N52A 2KVMA 3PQIA 3KLSX 3QOJA 3J80L 3RZOB 3HRZC 3S16H 4LFBL 4ZK9B 1PH8A 1SXTA 1WD0A 3CPFA 3Q6SA 3IFTA 2D5DA 5KEEA 3BZDB 3VYUA 3PF4A 4DAPA 4B3RQ 3AU7A 1BCPB 4DF7A 4DV0L 1QG7A 1PTOC 4A3BB 5LMNQ 2OF1A 4DR5Q 2IX0A 3KK7A 3HOYB 4A3FB 3CCJA 3J80c 4POFA 4RG1A 4DR7Q 4HJ9A 1HFGA 1M4VA 1GJXA 1ZXTA 2PZUA 5M3FB 1RTOA 5T1GA 3K6OA 3ZYYX 3S1NB 3MC0B 1QVGA 3KUPA 1WCMB 3KLSA 3R2IA 1KC8C 4A3BH 3HKSA 4DR1L 1VF7A 4IURA 4O2DA 2A5HA 4QUCA 2A68C 5NUCA 3P1HA 4DV5Q 1K83B 1LTID 3KBXA 5DEHA 2AQ2B 4PG3A 1NSNS 4JYAQ 1MHWC 1SYBA 2FJ2A 4IOCA 1MBYA 2FMCA 1B1ZA 1R4QB 4LF4L 4ZCKA 1KDCA 1OXUA 1TS4A 5CORA 5IYDH 3NELA 4CKCA 3A5UA 2XWJB 3BZKA 2NN6G 1PH6A 1MI2A 2F0QA 1JWSD 5ELOA 1X32A 4RA8A 3R3OA 3S1QB 1IBKL 2OTLA 3I4NG 2TSSA 1PYWD 4P2CB 1LLRD 1DM0B 4IQZA 4RCOA 4MZ9A 4A3EB 1HNZQ 5BN4A 2MO0A 3UDXA 1LV9A 4K0KL 1PV4A 1XPRA 4ME5A 4BY7G 3TP8A 2Z9HA 1YJWA 3S1NH 2E2JH 3WOEA 2EY2A 1Q1BA 5HGTA 4B3SQ 2NVQH 3M85A 3DEOA 1TT2A 4OEMB 2VUMH 4IUTA 1KHIA 2E2JB 1UE5A 1Y8NB 5FLMH 3HOWG 1ICWA 5LMNL 5K36G 2L11A 3PO2H 3I4MB 2IY5B 3KYHC 4FO2A 1BNZA 3PO2B 1B7YB 5CV9A 2AWNA 3J7AV 1PTOF 3LWEA 2JEAI 2HCCA 4X64L 4P73A 2RDGA 3J81i 3CCRA 4GKJL 4MTKA 1X3GA 3FKIH 5C44G 3GO5A 3BZCA 2UXCL 3V05A 3Q24A 3RZDH 1BBWA 2O2LD 1GHJA 4A3CG 5I6YA 3S1QH 2IX3A 1XNQQ 2VZAA 2CWAA 3MFYA 4JI4Q 3H09A 3NTKA 3I4LA 2OQKA 3NP8A 3G71A 2E8GA 2N78A 2L9HA 4Q0FA 4A76A 3TN2A 1HH2P 4HJ5A 1QVFA 4JI6L 3NBHA 4UP9A 3M3YB 1UE6A 5I6WA 4RGOS 1XWEA 1SAPA 4P72A 3FPUB 1EQQA 4MN3A 3CP0A 1T5EA 4N8FA 1K9MC 3OYYA 3HOZH 3RNUA 3ITPA 3ICEA 4DUZL 3OTOL 4JOIC 3U9OA 4YHHL 5JEAH 1CKOA 1VQEA 4DFAA 3KDFB 2F3WA 2ZTDA 3DMUA 2L12A 1B50A 3KOJA 5BR8Q 4XIGS 4CJ2C 4JV5Q 2Z6KC 1ILPA 4JG2A 1Q8IA 3JAMi 3S1RB 1G6PA 2CHBD 4QIWE 4B3TQ 1SYGA 2HHHQ 1HFNA 1KRSA 1FYCA 2EYJA 3OTOQ 2ES2A 1KLUD 3MZ5A 2ICIA 2Z4IA 1SR3A 5IYCH 3CHBD 4V190 1STEA 1TIID 2A1AA 1PZID 4XT1B 4C3IB 3K5OA 2L1BA 3S2DH 4DK0A 2HQLA 1G291 1VQMA 2EXZA 3IL8A 3J80E 4OO1H 3H91A 2RCFA 4U673 3M4OB 1ET6A 4CDFC 3I56A 4GLVB 4A3GH 2PW7A 1H9MA 3PIPA 3CPWA 1I50H 1LTLA 4TKOB 1IL8A 3QWNA 2JA5B 4BY1B 3GTKH 1UUPA 1JJCB 3MVVA 2K5QA 4R8IA 3RN5A 3FKIG 2EYFA 4M1UB 4CBVA 2PYKA 2LXKA 2G9HD 1WD1A 3UI2A 4FXDA 1X3EA 5IE8A 1S5DD 2L4NA 2F0FA 3A7LA 4BBSB 1WTRA 2R3ZA 1DONA 2K6AA 2AKWB 2C35B 1MKHA 4KI0A 1Z47A 3R93A 5FLXc 2BH2A 2IWHA 2F0VA 1Q86C 1CKMA 1D7QA 2F52A 1LTGD 5CV4A 2LY7A 2VY3A 1B2TA 2F0OA 1GUTA 5J3BA 2K04A 2RHQB 4FF3A 3J7YW 3H3VC 1GUWA 2J4XA 4DNRB 1L0XB 2B2WC 1FD7D 1JWMD 4K0KQ 3DM3A 3M9BA 2NN6I 1Q3LA 3NK9A 4YWMA 4EQNA 1FJGL 3C3LA 1N33L 4JOIA 2JA9A 1KDBA 3UDFA 5AFWA 2VQFL 3I90A 4OELB 4H7BA 5EQ0A 3URYA 1EQVA 1EIGA 4ZKCB 4X6AH 4JI3L 4Q5VA 1Y1VB 1F9RA 1VQKA 1KRTA 2KJXA 1SE4A 2NTTA 1TS5A 5M5YB 2BDOA 3ERQA 4QB4A 5CYUA 3BJUA 2IJ0A 4DV3L 2EZVA 5HGQA 5EKKA 2L55A 1Q90A 1EYCA 1AE3A 5C4XH 3GV3A 1VCIA 5FO8B 1DD2A 4RGNA 4TRDA 2NZ1D 2PNHA 5LHY1 1ZYRD 2N49A 5ELCA 2UUBQ 4JBMA 4LFAL 4DV4Q 2F0UA 1EY8A 3PF5A 1TKWB 4JK1C 1S4ZA 1Z7TA 4MNOA 3TS2A 1NR4A 3F2CA 2D9UA 4LF9L 1HZ9A 4PMBA 1QB5D 1C48A 1ZKOA 2K7VA 4CJ1B 4EGVA 4APVA 4KJOA 4U68A 3SK4A 3GTJH 1TWAB 5G3LD 4K6LA 4QJFA 4FF1A 1WFQA 3D6WA 1U9RA 5IGBA 2DNCA 3TMEA 1GHKA 4LK1C 1EYDA 2N8NA 1EIYB 2CVRA 5M5YH 2Y0SE 5EJWA 2R7ZB 3PIP3 2K33A 4A3KG 1HA6A 4ALPA 2H5XA 1OXSC 1HZCA 1K3BC 4G4KA 3I73A 2F0GA 1LABA 4JI1Q 1PH2A 1AE2A 1LACA 4K5WA 4KV6A 4NXNQ 3SGIA 4NW2A 5M9OA 5IP9G 2CH4A 3AFQA 4QF4A 4R4CA 1XMQQ 4X65Q 3GTMB 2KUMA 3H15A 3H3VI 2B2VA 1WTVA 1OTCA 1HNWQ 3FP9A 2CW0D 4QL5A 3DHQA 1J5EQ 1PFSA 1MSGA 3HOYH 1PTOH 3H6MA 3I3CA 2B39A 2N88A 4TSSA 1X56A 1GUOA 1SBBB 1XMQL 4H02A 2A8VA 5IGGA 2E5LL 4WORA 1PTOD 2TMPA 1HR0L 3QG1A 4Z9CB 2O5JC 5IIFA 1UAPA 4DA2A 4K6DA 1FR3A 1SNMA 3VYSA 5EKLA 2MPMA 4FP5D 2O4XA 2GVBA 4L5TA 5J1ZA 4DV5L 4JCVE 1SE3A 2NVXH 5LL6X 2AUKA 2RQXA 1NY4A 2K75A 2JA6B 3NBHB 2Q8IB 1K28A 3PIOA 3I4NH 2DY8A 4G7ZC 1VQIA 3CCMA 5EPKA 3I4NB 1FNWA 1KAAA 1S5BD 3RLOA 3JAME 1N33Q 1TWFB 2JYOA 2PQEA 1EL0A 4OL7A 3NTHA 3I4OA 3GV6A 2V1CC 4C2MH 4KKSA 4EQPA 2UXBL 1SMYC 4ZAIA 2XWBB 4DR3Q 4JBKA 3D3RA 2QKIC 2Z4HA 5C0XG 4NP5A 3K81C 1LT4D 3K59A 3F1ZA 4UHVA 1MIUA 2ID0A 1AN8A 3NENA 2Z6KA 1QCBD 2F4VL 1A15A 2K4KA 1XJVA 1HUMA 1PFBA 4ODGA 3EROA 2YV5A 4IFDG 2H4OA 1CT1D 3ER0A 3AFPA 4GZYC 5ELDA 1LO5D 2FFKB 1B9MA 1STYA 3S1MB 1TY0A 1PDQA 2Q2IA 5JPMC 1RTNA 3PGZA 1PLFA 4DAYA 3HOXH 4YHHQ 1WTQA 2B2VC 3HOVH 3M4QA 4YCUA 5IODA 4OXPA 1A3UA 1EY0A 2N55A 3GTGH 2QDLA 1WVLA 5CBEE 1JC7A 3RLFA 3NSWA 1O7ZA 2EJMA 3NQTA 4HJAA 3K7UC 1O7IA 3H0GB 1ENAA 4POGA 2K32A 4ZKBB 3TQYA 4OO1I 1UE1A 4OHJA 4A3DB 1VQFA 3KF8A 2E2DC 2I0QA 5GROA 4C1NI 4TVAB 1KTKA 5FJ8H 4IO9A 4BWGB 2JA5H 4FXGC 2B8FA 3NHHA 1UE7A 1LTRD 2B8GA 2ZXRA 3I8ZA 1E0BA 3SK8A 3X3MA 2QILA 3HOXG 3MTSA 1BCPC 1AZPA 1D5ZC 2R93H 4OIKA 3H0GH 1HNXL 1I4RA 4JC0A 1I4XA 1SFOB 5JJZA 1VQPA 1JR0D 1CZGA 4JI7Q 2IX1A 1TR5A 1PVOA 4DR2L 1J9OA 1OXVA 1YBYA 2EY1A 4QGUA 1QZHA 3HOXB 2R7DA 1GO3E 4KY6A 4NXNL 4M8AA 5JVG3 4C3JB 1ICFB 1CKNA 4CDDC 2VQEL 1B53A 4FDBA 2JJQA 1NBWA 4J6HA 1SYEA 4N9PA 3GP7A 2XVSA 3CCSA 4LF5Q 2RVLA 4CDEC 5IYCG 3QR8A 3D0FA 1IYJB 3AEVA 2AHOB 1TS3A 2B2YA 1K3RA 3HG9A 3KLWA 3J7AF 1JQYD 4NXMQ 4DV0Q 1E22A 1Y1VH 3J81E 4G57A 2F0SA 2ZJRA 3FKIB 1XPUA 2E5LQ 2WIIB 3CMEA 3ULPA 3RN2A 4RAUC 4R1JA 5JAVA 2VL6A 4DAYB 3SR1A 1S5FD 2JA8G 1PH1A 3CKIB 3FEWX 2EYLA 1NAPA 4LF4Q 5IWAL 4A3GB 1N32Q 4LNQA 3KDFA 3ERSX 2BDNA 3ND8A 1BF4A 2KCCA 4HMJA 2PMZE 4I7ZC 5CBAE 3NUCA 4WJWA 5E3FA 4JI2L 4KY7A 2FINB 4ZRZA 1BUVT 1L1OB 5DM63 4JI1L 2WAQB 2VXWA 2JE6I 1ML0D 4HCSA 5DNFA 3PIO3 4Y52H 2LSSA 1KABA 4WJ4A 4BA1I 3LWUA 3L0OA 1V1QA 4RHSA 1EWIA 1QOHA 4L5SA 1TY2A 1SLJA 5LL6S 2B63H 1PRTB 2UUCQ 1SNDA 1LT3D 3EFXD 3T1HL 3BU2A 4DUYQ 1E7ZA 3WDNA 1CFMA 4P75A 3MXGA 1VQLA 4JBWA 3CMAA 1BCPD 1V9PA 4I65A 2Z8LA 3GD7A 5CV8A 4A4IA 1Y8OB 3SE0A 4UDUC 2NB0A 3L9AX 3SK5A 1GOZA 2JN4A 4IJHA 1BXTA 1I4HA 1SNCA 4C3IH 4PZ6A 2IHFA 1S40A 2EY5A 2HCIA 1RODA 4QIWB 5ELFA 2PCFB 3I70A 4DPGA 4J15A 3VYRA 1N34L 1D6EC 3BVGA 1HZAA 4H13C 5F2DA 3RLNA 2B2YC 3K8AA 1IBLQ 4DAMA 4A3IG 1I4QA 3FMCA 4A3MB 1U4PA 2PZTA 5EPJA 5C0XJ 2UXDQ 3D31A 5J22A 3EQLC 3UE1A 4Y7NH 1PFMA 1U4LA 1N34Q 2YU9B 2IHEA 1JOKA 4A75A 2KEEA 3VA7A 1KQSA 3F2DA 4HCEA 4L8JA 3NQIA 3NBIA 5BN3A 5CGKA 3BVZA 4E6IA 2I5LX 1AEXA 2KCMA 1X3FA 4J8QA 1BOSA 1SEBD 2AUJD 4NKLA 4AIMA 2WB1E 4IFDJ 4KJNA 4ZUIA 5M5WH 4A3BG 3OPOA 1GVPA 1N8RC 4K5XA 1HTLD 4F88A 1PH7A 3SHLA 4AH6A 4DR2Q 1L0YB 1JOQA 3VR5A 2L0CA 2WB1G 3BG3A 2YU9H 4DV1Q 1D1KA 4PZ8A 2Q8TA 3RD4A 2JA6G 3QB3A 2LMCB 3K58A 2RSNA 2YTVA 3STBD 1F77A 2NUCA 3D6CA 4FF4A 1PRTC 2K5DA 4DR4L 1A3TA 2F0JA 1E2ZA 4GN3B 2EVBA 2G9DA 4L5RC 4FNFA 1CSQA 3OMGA 2R7ZH 4CKEA 2VQFQ 3EBEA 3S2HH 5KRUA 1FNVA 3ONAB 1YJ9A 5FJ8G 3OMCA 1AZQA 5I2YA 4A3FG 4IPDA 3DWAA 5IY0A 1EWCA 1NCVA 4F7XA 5LMNW 3MEFA 1B3AA 3SK6A 4KLKA 1EEFD 2CH4W 2HDMA 3MFGA 3U9SA 2F0KA 1VDZA 4P74A 4JI8Q 5CV7A 2CW0C 2KENA 4DXFA 5GADC 4KHPQ 1R9TH 2DJGC 2KBNA 1DGSA 2A6ED 4CJ0B 5AJ3Q 3S2HB 3GTGB 4IOAA 1SE2A 1R9TB 1EZ8A 5IWAQ 2I5MX 3HZXA 3O13A 4RHRA 4C56C 1VQOA 4X3TA 1XTDA 3UDGA 4LFAQ 1SYFA 3OOCA 3M3YH 1GKHA 2IL8A 2PPBC 1UNSA 1A8VA 5AJ3L 1YITA 1TS2A 3BDOA 3CF5A 3GTJB 3RZOH 2KOLA 2JA6H 2R92H 4LJZC 5EPLA 1ENFA 2ENBA 2F0LA 1HQMC 4RFBA 3DWPA 2K5HA 3MA2B 3Q23A 5LMUQ 1DCZA 2HIXA 2JP1A 3CXCA 1Y1VG 5KGUA 3KLRA 4ZLTF 2FMMA 4IN3A 5JEAG 4FVMA 5I9OA 1EYAA 3PCOB 2OCEA 3A74A 2UUAQ 1JOOA 1HR0Q 1C0AA 5C3XA 4A3FH 3T1YL 4IUNA 1TWCH 2AQ3B 2R7FA 4DV6L 3PUVA 4DR4Q 4ILWA 5D3DA 1N36L 4JI0Q 2E2IH 1EQRA 1TWCB 1PYSB 2EY6A 2QF7A 3K5LA 2XRSD 3D4WA 4A93H 2VS1A 4XQQA 2E2IB 2Z0SA 1II3A 1Y1WB 4QCLA 1H9SA 1VF5C 3QIAA 3CU7A 2R61A 3L7ZC 5I2XA 5HY6A 1O78A 4LF7L 2RDHA 3OIPA 3HS0C 5C5MA 3E5SA 4AYBB 5C3EG 1QE6A 5ISRA 3STBC 5JJKA 4HIMA 4BY1H 3GTKB 2EOTA 2EYOA 4LMQD 4S3SA 1EIHA 1KDAA 4N9TA 5C4JB 2AQ1B 3MXPA 4C1NK 5JJLA 1PZJD 5DM73 3KJPA 4LWCA 5EKIA 5C4JH 4N8X1 1IKLA 1YNNC 4GKKQ 4DKAC 1BVSA 2CQAA 3CAMA 3D4DA 2C5CA 1EWHA 4HEDA 3H0GG 1LM0A 2F1MA 4HN7A 3MAQA 4DR3L 3VDYA 1H9JA 1HXYD 1E3PA 2HT1A 2KCTA 1F2YA 2EJFC 4CKBA 1D5XC 2EPBA 1SNQA 2VUMG 5M3MG 3FPPA 2WACA 1AW7A 2CCZA 5CR3A 4JVZA 4JI7L 4LUVA 1EOTA 2UXBQ 2A6EC 1PH3A 1WTPA 3C46A 1KIXA 2X6LA 5FOBB 5C6AA 5G3LF 1SFOH 1YHAA 2UUAL 1Q82C 1CA5A 1QJOA 2I5HA 1FGBD 3EIVA 1ENCA 1MGSA 2R93G 3Q0AA 5EAYA 5D14A 3C1FA 3BYYB 3TP7A 1Y14B 5JVH3 2PMZB 4XQNA 2QGQA 3G6JB 5E4XA 4ZYSA 3TP6A 1AP0A 3MHBA 5EBCA 2VB3X 2XGTA 1K8OA 1VQGA 5E4WC 2ZTCA 3DEPA 3W5OA 3OWEB 5KNBA 3A54A 4JYAL 2A73B 4A3KB 2KQ3A 3CCQA 1BDOA 2K1BA 4KK7A 2JXMB 2JA7H 1QILA 2DUDA 4XDXA 1E2WA 2Q2UA 3H94A 1LTTD 4A3JG 2EQSA 3U58A 3GTPH 3K7AH 1G2TA 2F4IA 3I2ZA 5IOCA 5IYBH 1TWGH 4X66L 2DJFC 5FO7B 1STGA 1FGUA 2A6HC 4DXGA 3GTPB 1GXDC 1G91A 1Q46A 3A5ZB 4OWWB 2Y0SB 3PO3G 3TBIB 1CQVA 1VQ4A 1I5FA 2DGYA 1I3QB 1IBML 2PZWA 1M8AA 2RHSB 1I4PA 3EVQA 1PHJA 1WJJA 1S5CD 2QA4A 4R8NA 2ICEC 3QJYA 4YCWA 3HFZB 3TEHB 1B8AA 2F0HA 2Y0SG 3HOWB 4OIJA 4BXXH 2KCNA 3DM1A 1HRJA 4Y7NB 3CRKC 3E3XA 4V0BA 4YIJA 1PH5A 5E7NA 1EOVA 1J8IA 1KD1C 4OX9L 5K5PA 2M9VA 4CDCC 2LS01 4DNTB 1XMOQ 1U0LA 2BOSA 1EQTA 1X6OA 3L3OC 4KHVA 2DY7A 4HIKA 1JE5A 1JJGA 1WYDA 4GKKL 5COYA 5M3FH 1ILQA 1TXYA 2D2CC 1QUQA 5FKAC 5I4DA 1XXGA 3RUZA 2F4VQ 4MHEA 5IP7H 4DR6Q 4B3MQ 3J7ZC 2ZJPA 2QCPX 4AYBG 2YYZA 4RGMA 3KBGA 1J5EL 1X3PA 5KYIA 3CD6A 1RCVD 5IGCA 1E24A 1JT8A 1Y69U 4BXXG 3M7GA 1HQRD 1N36Q 4DV3Q 1PRTD 2R92B 1PMRA 5C5LA 2VQEQ 2VW9A 2EYPA 3T53B 5JEAJ 2Q2HA 2K14A 4PZ7A 1A6XA 2EE1A 2RKSA 3LX0A 1JWUD 1RL2A 1Z6HA 3W2DA 3DXJC 2A68D 1I4GA 3HOUB 3GTOH 3PUWA 1XYIA 1EY6A 4C3HB 2B29A 3HOVG 2SNSA 4IPHA 1KNAA 1IBMQ 3GTOB 4DV7Q 1YVCA 4C3HH 3S16B 3NE5B 1HHVA 1YIJA 2F3VA 3IFDA 4JV5L 4EVOA 2WV6D 4LF8Q 3CC4A 4O42A 1EY5A 1H9SB 5A2QE 1N32L 1VS0A 2NN6H 1TQOA 3G4SA 3TS0A 1C4QA 3JAMc 1YI2A 1EFID 4DR7L 4UY8C 2A74C 5ELBA 1STAA 1CUKA 1EZ6A 2PO4A 1KL9A 1RKNA 2IPKD 3EN2A 4C3JG 1NMFA 4B08A 4LUOA 3Q22A 1RIPA 3BS1A 2K50A 1X9NA 2QW7A
chains in the Genus database with same CATH topology
4B3SL 4BA1I 4WJ4A 1YHBA 2BA1A 3L0OA 1SR3A 4PMWA 5IYCH 1V1QA 1EWIA 2K52A 1VQ8A 4L5SA 1GD7A 4DR6L 1GM5A 2A1AA 4YWLA 1Y1WG 1SLJA 2B63H 2PI2A 1P16A 2UUCQ 3T1HL 3Q8DA 3DLLA 2UU9L 3BU2A 4LF5L 1KXLA 4DUYQ 1E7ZA 3S2DH 4P75A 2HQLA 1G291 4IJLA 1VQMA 5C3EH 4JI5Q 4MTNA 4WJ3M 1VQLA 4JBWA 3KJOA 2K5NA 2NVTH 5IP7G 2ZM6L 3CMAA 4LUZA 5C4XG 1V9PA 1CSPA 3GDEA 5M3MH 1K8AC 3I56A 4GLVB 1K73C 3KFUA 4A3GH 4OX9Q 4HIDA 3GD7A 4A3DG 2D0PA 3CPWA 4A4IA 3PIPA 2MO1A 2VNUD 3WWVA 1I50H 1LTLA 2UUCL 2CQOA 1WCMG 2L15A 5GQOA 3A0JA 2ZTEA 3U4VA 4IJHA 3GTKH 4X65L 1JJCB 1M90C 3RN5A 2WAQE 4R4QA 1PA6A 3ULLA 4JI4L 3FKIG 4C3IH 4PZ6A 2IHFA 1S40A 1E1TA 4HIOA 1VQ5A 4GOPB 4A3CH 1EYGA 1E1OA 3HOZG 2LXKA 4DPGA 4J15A 1N34L 3S1MH 1QVCA 1X3EA 1HZAA 5IE8A 1Y1WH 4LW1A 3RLNA 2Q2TA 4JI0L 3K8AA 4BY1G 1IBLQ 4DAMA 4A3IG 3E0EA 4P71A 4DK6C 5C0XI 1T9HA 2AKWB 3M4PA 4BA2I 3PO3H 2RCNA 2C35B 5C0XJ 2JK8A 1MKHA 4KI0A 1Z47A 5FLXc 2BH2A 2UXDQ 3D31A 1VQDA 2CWPA 1BBUA 1Q86C 1CKMA 4A3MH 4C3JH 1D7QA 4YY3Q 3UE0A 3UE1A 1P8LA 2F52A 4Y7NH 3L2PA 3I55A 1N34Q 2VY3A 1WI5A 4A3LG 2IHEA 2R92G 4A75A 1FJGQ 3KF8B 5J3BA 5BR8L 1KQSA 3F2DA 1XNRL 3TREA 2RHQB 1IXRA 2AWOA 2E2HH 4NPSA 2I5LX 4LFCQ 2KCMA 4B3ML 1X3FA 2MNAA 1U5KA 4K0KQ 3DM3A 4AIMA 5IYBG 2WB1E 3GTQH 3M9BA 5M5WH 4IFDJ 2UXDL 2ZJQA 1I94L 1B70B 4A3BG 1GVPA 2NN6I 1N8RC 4YWMA 2GN5A 1HZBA 2NZOA 1FJGL 3GTLH 2OWOA 1PH7A 1SE8A 4GOPC 1NJIC 2PQAB 2UXCQ 4AH6A 2KHJA 4JBJA 4JOIA 1FL0A 2JA9A 5FLMG 4DR2Q 1N33L 2WB1G 1Q1EA 4OONA 3UDFA 2YU9H 5JJIA 2BH8A 2CFMA 2VQFL 4DV1Q 1C7YA 2KHIA 4PZ8A 2JA6G 1I3QH 1K0RA 4LF6Q 4GN4B 3S17H 2PQAA 2YTVA 4IPCA 4LF7Q 3STBD 1JB7A 1EFWA 3TRZA 1YZ6A 1Z9FA 4X6AH 4JI3L 3CCUA 4A3JH 5IYDG 1LUZA 4JI5L 4A3KH 1VQKA 1KRTA 2NZHA 4LF6L 4DR4L 4GN3B 5ELNA 4L5RC 1CSQA 3HOUG 4DNIA 4BY7H 1A62A 3I4MH 2R7ZH 2VQFQ 3EBEA 4JI3Q 3S2HH 4DR1Q 4DR5L 3U50C 1YJ9A 5FJ8G 3BJUA 3W1GA 1S72A 4DV3L 1J6QA 5HGQA 3AYHB 2OQ0A 1AE3A 5C4XH 4R4TA 3F8TA 4A3FG 1VCIA 4RMFA 4IPDA 1YJNA 1XNQL 4BBSH 5IY0A 4KHPL 4A3DH 2EXDA 4LF9Q 5LMNW 4GNXC 2PNHA 1Q81C 3MEFA 1L1OC 4KLKA 3ULJA 3T1HQ 1YHQA 2UU9Q 2N49A 3AQQA 2D62A 4X62Q 1VQBA 4OWTB 2UUBQ 1VQNA 4P74A 4JI8Q 1VQ7A 4JBMA 4LFAL 4DV4Q 2KENA 1PH4A 5GADC 2WAQG 4KHPQ 4BBRG 2A19A 1R9TH 4A3LH 3PF5A 2KBNA 1DGSA 1Q12A 3OW2A 1HJPA 3PUZA 4MNOA 1IBLL 5AJ3Q 2UUBL 5C44H 4JI8L 4IOAA 2HHHL 1KAWA 5IWAQ 3TS2A 2I5MX 3RR5A 1FVIA 4GOPA 3F2CA 1ASYA 4LF9L 1HZ9A 3J80i 1VQOA 1OXXK 2HIVA 4A3EG 4AQYL 1TWAH 1C9OA 4GS3A 2GVAA 1XTDA 3UDGA 1X54A 3S24A 4UPAA 4A3IH 1H95A 2R6GA 4LFAQ 3M3YH 1L0WA 4APVA 1N9WA 1GKHA 3GTJH 4HJ8A 4QQBX 4QJFA 1A0IA 1SRUA 1WFQA 3I7FA 1A8VA 4ME3A 5AJ3L 1YITA 4LF8L 3CF5A 2ATWA 1TWFH 1TWHH 4X66Q 3RZOH 3CC7A 2JA6H 2R92H 2N8NA 1EIYB 4LFBQ 5M5YH 2Y0SE 3CW2C 4GN5A 1NMGA 4A3KG 1VQAA 4ALPA 1Q7YC 2JA8H 2H5XA 1OXSC 4B3TL 4OWXB 1HZCA 2K5HA 1VQ6A 3G6EA 2D0OA 4DV6Q 4GLXA 3UDIA 4JI1Q 5LMUQ 2HIXA 1PH2A 1AE2A 1IL2A 3CXCA 1Y1VG 4NXNQ 3SGIA 4B3RL 3MXNB 5IP9G 3AFQA 4R4CA 1XMQQ 4IPGA 3PO2G 4DV1L 5JEAG 4X65Q 1SN8A 2PI2E 3H15A 3PCOB 1OTCA 3H3VI 2BA0A 1HNWQ 2NVYH 2OCEA 3A74A 3CCEA 1HR0Q 2UUAQ 3FP9A 1D8LA 1XNRQ 4TQUS 3J81j 2MFIA 4QL5A 1YEZA 1J5EQ 1C0AA 1PFSA 4DUYL 3HOYH 4A3FH 3T1YL 1SROA 1TWCH 1SMXA 2R7FA 4DV6L 3PUVA 1ASZA 4BBSG 1HNWL 5LMUL 4DR4Q 3JC66 1N36L 2EIFA 4JI0Q 2E2IH 1EQRA 1X56A 3CQZH 1PYSB 1XMQL 4H02A 4UP8A 2A8VA 4A93H 2E5LL 2VS1A 3M7NA 3PSIA 3S15H 2R7ZG 2Z0SA 1HR0L 1W3SA 2IT1A 4X62L 3I4MG 3L7ZC 3FHWA 2LXJA 5HY6A 2GVBA 1W2BA 4L5TA 4LF7L 5C3EG 4JI6Q 4DV5L 4GNXB 4JCVE 2NVXH 3STBC 1L2FA 5JJKA 4HIMA 1NY4A 2K75A 4DV2L 4BY1H 4DV4L 5H1SE 3NBHB 3LGJA 2CKZB 1Q8KA 3PIOA 1PH9A 3I4NH 2JEBI 1JJ2A 3S14H 5JJLA 3KJPA 4LWCA 1VQIA 3HOYG 3CCMA 1A63A 2JA5G 5C4JH 4R4OA 3K80C 4EX5A 1IBKQ 4GKKQ 4DKAC 1BVSA 3CAMA 3RLOA 1N33Q 3HKZG 1X55A 1XPOA 3H0GG 2ASBA 4GLAC 1LM0A 4AYBE 4UP7A 4DR3L 3S16H 1LYLA 3VDYA 2YTYA 4LFBL 4OO1G 2HT1A 1E3PA 3I4OA 3M4OH 2KCTA 2V1CC 1PH8A 1V43A 4C2MH 3CPFA 2UXBL 2VUMG 5M3MG 4JBKA 4DR3Q 4DV7L 4QY7A 5C0XG 2CCZA 3KF6B 4JI7L 4A3GG 4LUVA 3HOWH 3PF4A 2UXBQ 4B3RQ 3K81C 1VQ9A 5GAEC 1PH3A 4DV0L 1KIXA 3F1ZA 2QEXA 5LMNQ 3HKZE 1PYBA 1MIUA 4DR5Q 1YHAA 2ID0A 2IX0A 1QUQB 3NENA 2Z6KA 1SFOH 1Q82C 2UUAL 2ZM6Q 3CCJA 2I5HA 3K0XA 2F4VL 2K4KA 4NB3A 3EIVA 3J80c 4POFA 1XJVA 4RG1A 4DR7Q 2R93G 5EAYA 4HJ9A 2N3SA 4L5QA 2YV5A 4IFDG 3ER0A 1Y14B 3AFPA 1OXTA 4GKJQ 2QGQA 3J81c 1QVGA 2XGTA 2RF4A 4X64Q 3H3VH 1VQGA 1KC8C 4A3MG 2ZTCA 1NTGA 4NXML 3W5OA 4A3BH 1IZ6A 3HKSA 2Q2IA 1K83H 3PGZA 4DR1L 4JYAL 3IRBA 4O2DA 3HOXH 4YHHQ 2ES2A 4O0AA 3PV0A 3CCQA 3HOVH 3M4QA 4YCUA 4DK3C 4OXPA 3B6YA 4DV5Q 2OTJA 2JA7H 2DUDA 3E9IA 4PG3A 4YCVA 3GTGH 4JYAQ 2Q2UA 4IOCA 3RLFA 4A3JG 2EQSA 3U58A 3GTPH 3K7AH 4HJAA 3K7UC 1O7IA 4LF4L 4POGA 3I2ZA 4DV2Q 5IYBH 1OXUA 1TWGH 4X66L 3F2BA 5IYDH 3NELA 1FGUA 3TQYA 5M3FG 4OO1I 1Q46A 1UE1A 1VQJA 1VQFA 3A5ZB 3A5UA 3BZKA 2NN6G 4OWWB 1PH6A 3PO3G 1VQ4A 1I5FA 4YY3L 2DGYA 3CC2A 4A3EH 1HNZL 2I0QA 5GROA 5ELOA 1IBML 4TVAB 4LFCL 4DUZQ 1NE3A 1X65A 5FJ8H 3CCVA 1MJCA 4IO9A 1IBKL 2OTLA 3I4NG 2RHSB 2JA5H 1UWVA 4MZ9A 1PHJA 1WJJA 2QA4A 1MJEA 1UE7A 1HNZQ 4YCWA 2ALYB 2MO0A 3UDXA 3PUXA 3HFZB 3TEHB 1B8AA 2Y0SG 4BXXH 3HOXG 4K0KL 1PV4A 3CCLA 1UEBA 4JI2Q 2R93H 1XPRA 3HOUH 4BBRH 3H0GH 1HNXL 4BY7G 1YJWA 5DLQE 1VQHA 4JC0A 2JQOA 5E7NA 1EOVA 1PH5A 3S1NH 1KD1C 1G51A 2E2JH 2XTIA 4OX9L 1EIFA 1Q1BA 1VQPA 4B3SQ 4JI7Q 3M85A 2IX1A 1XMOQ 2NVQH 1AH9A 1U0LA 1PVOA 4DR2L 4IFDI 4A3CG 1X6OA 2VUMH 1KHIA 1OXVA 1YBYA 3PUYA 1UE5A 4HIKA 2B63G 1JE5A 4QGUA 2B3GA 1WYDA 5FLMH 1QZHA 3HOWG 2R7DA 5LMNL 5K36G 1JJGA 1GO3E 4GKKL 1K8GA 5M3FH 3PO2H 2F3IA 1QZGA 1TXYA 4NXNL 1QUQA 4EQ5A 1HNXQ 1CKNA 2VQEL 2IY5B 5GAGC 2F4VQ 1WOCA 4FDBA 3KYHC 5IP7H 2AMCB 2JJQA 4DR6Q 1B7YB 3J7ZC 4B3MQ 2AWNA 2ZJPA 1NBWA 1XMOL 4AYBG 2JEAI 4X64L 2YYZA 4P73A 3J81i 3KF6A 3CCSA 1J5EL 1I94Q 5IYCG 4LF5Q 2JA7G 3CCRA 3D0FA 1IYJB 3AEVA 3CD6A 4GKJL 1BKBA 1E24A 2AHOB 3ZJYC 1JT8A 1EUJA 1X3GA 1K3RA 4BXXG 3FKIH 5C44G 3GO5A 3KLWA 3BZCA 4DV3Q 1N36Q 2UXCL 3RZDH 1BBWA 2VQEQ 2VW9A 2K5VA 4DV0Q 4NXMQ 5JEAJ 4XTCS 1E22A 1Y1VH 2Q2HA 2K14A 1YNXA 4YWKA 2ZJRA 3T1YQ 3S1QH 1XNQQ 2E5LQ 1XPUA 4PZ7A 2VZAA 2CWAA 3CMEA 4JI4Q 3ULPA 3RN2A 2OQKA 1RL2A 3J7A5 3G71A 2E8GA 2N78A 4KHZA 4R1JA 3GTOH 4A76A 2VL6A 1HH2P 3PUWA 4DAYB 4HJ5A 1QVFA 2B29A 4AQYQ 5IT9c 4JI6L 3HOVG 1CKNB 2JA8G 4UP9A 1PH1A 3S1RH 4IPHA 1UE6A 4LF4Q 1IBMQ 5IWAL 2WP8J 4GNXA 1VQCA 1YVCA 4P72A 4DV7Q 4C3HH 1EQQA 1L1OA 1S3OA 3NEMA 1N32Q 4LNQA 4HJ7A 1YIJA 3CP0A 3KDFA 3ERSX 4JV5L 3W1BA 3GTMH 2FXQA 2PMZE 1K9MC 3OYYA 1JMCA 4LF8Q 3HOZH 3RNUA 3CC4A 3ICEA 2WFWA 5IP9H 1N32L 4DUZL 3OTOL 4JOIC 2MQHA 5M5XH 4YHHL 1M1KC 1CKOA 1VS0A 4JI2L 1VQEA 5GAHC 3TS0A 3KDFB 3G4SA 3U4ZA 2YTXA 3JAMc 1YI2A 2ZTDA 1L1OB 4DR7L 4UY8C 3G48A 1I6HH 4JI1L 1CUKA 3KOJA 5BR8Q 2JE6I 4XIGS 4R4IA 4JV5Q 1KL9A 1WCMH 2Z6KC 4JG2A 3JAMi 3EN2A 1G6PA 1NMFA 4QIWE 2HHHQ 4B3TQ 4Y52H 1KRSA 4LUOA 2LSSA 4A93G 1RIPA 3E9HA 1HR0W 2K50A 1X9NA 3OTOQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3S L;  4BA1 I;  4WJ4 A;  1YHB A;  2BA1 A;  3L0O A;  1SR3 A;  4PMW A;  5IYC H;  1V1Q A;  1EWI A;  2K52 A;  1VQ8 A;  4L5S A;  1GD7 A;  4DR6 L;  1GM5 A;  2A1A A;  4YWL A;  1Y1W G;  1SLJ A;  2B63 H;  2PI2 A;  1P16 A;  2UUC Q;  3T1H L;  3Q8D A;  3DLL A;  2UU9 L;  3BU2 A;  4LF5 L;  1KXL A;  4DUY Q;  1E7Z A;  3S2D H;  4P75 A;  2HQL A;  1G29 1;  4IJL A;  1VQM A;  5C3E H;  4JI5 Q;  4MTN A;  4WJ3 M;  1VQL A;  4JBW A;  3KJO A;  2K5N A;  2NVT H;  5IP7 G;  2ZM6 L;  3CMA A;  4LUZ A;  5C4X G;  1V9P A;  1CSP A;  3GDE A;  5M3M H;  1K8A C;  3I56 A;  4GLV B;  1K73 C;  3KFU A;  4A3G H;  4OX9 Q;  4HID A;  3GD7 A;  4A3D G;  2D0P A;  3CPW A;  4A4I A;  3PIP A;  2MO1 A;  2VNU D;  3WWV A;  1I50 H;  1LTL A;  2UUC L;  2CQO A;  1WCM G;  2L15 A;  5GQO A;  3A0J A;  2ZTE A;  3U4V A;  4IJH A;  3GTK H;  4X65 L;  1JJC B;  1M90 C;  3RN5 A;  2WAQ E;  4R4Q A;  1PA6 A;  3ULL A;  4JI4 L;  3FKI G;  4C3I H;  4PZ6 A;  2IHF A;  1S40 A;  1E1T A;  4HIO A;  1VQ5 A;  4GOP B;  4A3C H;  1EYG A;  1E1O A;  3HOZ G;  2LXK A;  4DPG A;  4J15 A;  1N34 L;  3S1M H;  1QVC A;  1X3E A;  1HZA A;  5IE8 A;  1Y1W H;  4LW1 A;  3RLN A;  2Q2T A;  4JI0 L;  3K8A A;  4BY1 G;  1IBL Q;  4DAM A;  4A3I G;  3E0E A;  4P71 A;  4DK6 C;  5C0X I;  1T9H A;  2AKW B;  3M4P A;  4BA2 I;  3PO3 H;  2RCN A;  2C35 B;  5C0X J;  2JK8 A;  1MKH A;  4KI0 A;  1Z47 A;  5FLX c;  2BH2 A;  2UXD Q;  3D31 A;  1VQD A;  2CWP A;  1BBU A;  1Q86 C;  1CKM A;  4A3M H;  4C3J H;  1D7Q A;  4YY3 Q;  3UE0 A;  3UE1 A;  1P8L A;  2F52 A;  4Y7N H;  3L2P A;  3I55 A;  1N34 Q;  2VY3 A;  1WI5 A;  4A3L G;  2IHE A;  2R92 G;  4A75 A;  1FJG Q;  3KF8 B;  5J3B A;  5BR8 L;  1KQS A;  3F2D A;  1XNR L;  3TRE A;  2RHQ B;  1IXR A;  2AWO A;  2E2H H;  4NPS A;  2I5L X;  4LFC Q;  2KCM A;  4B3M L;  1X3F A;  2MNA A;  1U5K A;  4K0K Q;  3DM3 A;  4AIM A;  5IYB G;  2WB1 E;  3GTQ H;  3M9B A;  5M5W H;  4IFD J;  2UXD L;  2ZJQ A;  1I94 L;  1B70 B;  4A3B G;  1GVP A;  2NN6 I;  1N8R C;  4YWM A;  2GN5 A;  1HZB A;  2NZO A;  1FJG L;  3GTL H;  2OWO A;  1PH7 A;  1SE8 A;  4GOP C;  1NJI C;  2PQA B;  2UXC Q;  4AH6 A;  2KHJ A;  4JBJ A;  4JOI A;  1FL0 A;  2JA9 A;  5FLM G;  4DR2 Q;  1N33 L;  2WB1 G;  1Q1E A;  4OON A;  3UDF A;  2YU9 H;  5JJI A;  2BH8 A;  2CFM A;  2VQF L;  4DV1 Q;  1C7Y A;  2KHI A;  4PZ8 A;  2JA6 G;  1I3Q H;  1K0R A;  4LF6 Q;  4GN4 B;  3S17 H;  2PQA A;  2YTV A;  4IPC A;  4LF7 Q;  3STB D;  1JB7 A;  1EFW A;  3TRZ A;  1YZ6 A;  1Z9F A;  4X6A H;  4JI3 L;  3CCU A;  4A3J H;  5IYD G;  1LUZ A;  4JI5 L;  4A3K H;  1VQK A;  1KRT A;  2NZH A;  4LF6 L;  4DR4 L;  4GN3 B;  5ELN A;  4L5R C;  1CSQ A;  3HOU G;  4DNI A;  4BY7 H;  1A62 A;  3I4M H;  2R7Z H;  2VQF Q;  3EBE A;  4JI3 Q;  3S2H H;  4DR1 Q;  4DR5 L;  3U50 C;  1YJ9 A;  5FJ8 G;  3BJU A;  3W1G A;  1S72 A;  4DV3 L;  1J6Q A;  5HGQ A;  3AYH B;  2OQ0 A;  1AE3 A;  5C4X H;  4R4T A;  3F8T A;  4A3F G;  1VCI A;  4RMF A;  4IPD A;  1YJN A;  1XNQ L;  4BBS H;  5IY0 A;  4KHP L;  4A3D H;  2EXD A;  4LF9 Q;  5LMN W;  4GNX C;  2PNH A;  1Q81 C;  3MEF A;  1L1O C;  4KLK A;  3ULJ A;  3T1H Q;  1YHQ A;  2UU9 Q;  2N49 A;  3AQQ A;  2D62 A;  4X62 Q;  1VQB A;  4OWT B;  2UUB Q;  1VQN A;  4P74 A;  4JI8 Q;  1VQ7 A;  4JBM A;  4LFA L;  4DV4 Q;  2KEN A;  1PH4 A;  5GAD C;  2WAQ G;  4KHP Q;  4BBR G;  2A19 A;  1R9T H;  4A3L H;  3PF5 A;  2KBN A;  1DGS A;  1Q12 A;  3OW2 A;  1HJP A;  3PUZ A;  4MNO A;  1IBL L;  5AJ3 Q;  2UUB L;  5C44 H;  4JI8 L;  4IOA A;  2HHH L;  1KAW A;  5IWA Q;  3TS2 A;  2I5M X;  3RR5 A;  1FVI A;  4GOP A;  3F2C A;  1ASY A;  4LF9 L;  1HZ9 A;  3J80 i;  1VQO A;  1OXX K;  2HIV A;  4A3E G;  4AQY L;  1TWA H;  1C9O A;  4GS3 A;  2GVA A;  1XTD A;  3UDG A;  1X54 A;  3S24 A;  4UPA A;  4A3I H;  1H95 A;  2R6G A;  4LFA Q;  3M3Y H;  1L0W A;  4APV A;  1N9W A;  1GKH A;  3GTJ H;  4HJ8 A;  4QQB X;  4QJF A;  1A0I A;  1SRU A;  1WFQ A;  3I7F A;  1A8V A;  4ME3 A;  5AJ3 L;  1YIT A;  4LF8 L;  3CF5 A;  2ATW A;  1TWF H;  1TWH H;  4X66 Q;  3RZO H;  3CC7 A;  2JA6 H;  2R92 H;  2N8N A;  1EIY B;  4LFB Q;  5M5Y H;  2Y0S E;  3CW2 C;  4GN5 A;  1NMG A;  4A3K G;  1VQA A;  4ALP A;  1Q7Y C;  2JA8 H;  2H5X A;  1OXS C;  4B3T L;  4OWX B;  1HZC A;  2K5H A;  1VQ6 A;  3G6E A;  2D0O A;  4DV6 Q;  4GLX A;  3UDI A;  4JI1 Q;  5LMU Q;  2HIX A;  1PH2 A;  1AE2 A;  1IL2 A;  3CXC A;  1Y1V G;  4NXN Q;  3SGI A;  4B3R L;  3MXN B;  5IP9 G;  3AFQ A;  4R4C A;  1XMQ Q;  4IPG A;  3PO2 G;  4DV1 L;  5JEA G;  4X65 Q;  1SN8 A;  2PI2 E;  3H15 A;  3PCO B;  1OTC A;  3H3V I;  2BA0 A;  1HNW Q;  2NVY H;  2OCE A;  3A74 A;  3CCE A;  1HR0 Q;  2UUA Q;  3FP9 A;  1D8L A;  1XNR Q;  4TQU S;  3J81 j;  2MFI A;  4QL5 A;  1YEZ A;  1J5E Q;  1C0A A;  1PFS A;  4DUY L;  3HOY H;  4A3F H;  3T1Y L;  1SRO A;  1TWC H;  1SMX A;  2R7F A;  4DV6 L;  3PUV A;  1ASZ A;  4BBS G;  1HNW L;  5LMU L;  4DR4 Q;  3JC6 6;  1N36 L;  2EIF A;  4JI0 Q;  2E2I H;  1EQR A;  1X56 A;  3CQZ H;  1PYS B;  1XMQ L;  4H02 A;  4UP8 A;  2A8V A;  4A93 H;  2E5L L;  2VS1 A;  3M7N A;  3PSI A;  3S15 H;  2R7Z G;  2Z0S A;  1HR0 L;  1W3S A;  2IT1 A;  4X62 L;  3I4M G;  3L7Z C;  3FHW A;  2LXJ A;  5HY6 A;  2GVB A;  1W2B A;  4L5T A;  4LF7 L;  5C3E G;  4JI6 Q;  4DV5 L;  4GNX B;  4JCV E;  2NVX H;  3STB C;  1L2F A;  5JJK A;  4HIM A;  1NY4 A;  2K75 A;  4DV2 L;  4BY1 H;  4DV4 L;  5H1S E;  3NBH B;  3LGJ A;  2CKZ B;  1Q8K A;  3PIO A;  1PH9 A;  3I4N H;  2JEB I;  1JJ2 A;  3S14 H;  5JJL A;  3KJP A;  4LWC A;  1VQI A;  3HOY G;  3CCM A;  1A63 A;  2JA5 G;  5C4J H;  4R4O A;  3K80 C;  4EX5 A;  1IBK Q;  4GKK Q;  4DKA C;  1BVS A;  3CAM A;  3RLO A;  1N33 Q;  3HKZ G;  1X55 A;  1XPO A;  3H0G G;  2ASB A;  4GLA C;  1LM0 A;  4AYB E;  4UP7 A;  4DR3 L;  3S16 H;  1LYL A;  3VDY A;  2YTY A;  4LFB L;  4OO1 G;  2HT1 A;  1E3P A;  3I4O A;  3M4O H;  2KCT A;  2V1C C;  1PH8 A;  1V43 A;  4C2M H;  3CPF A;  2UXB L;  2VUM G;  5M3M G;  4JBK A;  4DR3 Q;  4DV7 L;  4QY7 A;  5C0X G;  2CCZ A;  3KF6 B;  4JI7 L;  4A3G G;  4LUV A;  3HOW H;  3PF4 A;  2UXB Q;  4B3R Q;  3K81 C;  1VQ9 A;  5GAE C;  1PH3 A;  4DV0 L;  1KIX A;  3F1Z A;  2QEX A;  5LMN Q;  3HKZ E;  1PYB A;  1MIU A;  4DR5 Q;  1YHA A;  2ID0 A;  2IX0 A;  1QUQ B;  3NEN A;  2Z6K A;  1SFO H;  1Q82 C;  2UUA L;  2ZM6 Q;  3CCJ A;  2I5H A;  3K0X A;  2F4V L;  2K4K A;  4NB3 A;  3EIV A;  3J80 c;  4POF A;  1XJV A;  4RG1 A;  4DR7 Q;  2R93 G;  5EAY A;  4HJ9 A;  2N3S A;  4L5Q A;  2YV5 A;  4IFD G;  3ER0 A;  1Y14 B;  3AFP A;  1OXT A;  4GKJ Q;  2QGQ A;  3J81 c;  1QVG A;  2XGT A;  2RF4 A;  4X64 Q;  3H3V H;  1VQG A;  1KC8 C;  4A3M G;  2ZTC A;  1NTG A;  4NXM L;  3W5O A;  4A3B H;  1IZ6 A;  3HKS A;  2Q2I A;  1K83 H;  3PGZ A;  4DR1 L;  4JYA L;  3IRB A;  4O2D A;  3HOX H;  4YHH Q;  2ES2 A;  4O0A A;  3PV0 A;  3CCQ A;  3HOV H;  3M4Q A;  4YCU A;  4DK3 C;  4OXP A;  3B6Y A;  4DV5 Q;  2OTJ A;  2JA7 H;  2DUD A;  3E9I A;  4PG3 A;  4YCV A;  3GTG H;  4JYA Q;  2Q2U A;  4IOC A;  3RLF A;  4A3J G;  2EQS A;  3U58 A;  3GTP H;  3K7A H;  4HJA A;  3K7U C;  1O7I A;  4LF4 L;  4POG A;  3I2Z A;  4DV2 Q;  5IYB H;  1OXU A;  1TWG H;  4X66 L;  3F2B A;  5IYD H;  3NEL A;  1FGU A;  3TQY A;  5M3F G;  4OO1 I;  1Q46 A;  1UE1 A;  1VQJ A;  1VQF A;  3A5Z B;  3A5U A;  3BZK A;  2NN6 G;  4OWW B;  1PH6 A;  3PO3 G;  1VQ4 A;  1I5F A;  4YY3 L;  2DGY A;  3CC2 A;  4A3E H;  1HNZ L;  2I0Q A;  5GRO A;  5ELO A;  1IBM L;  4TVA B;  4LFC L;  4DUZ Q;  1NE3 A;  1X65 A;  5FJ8 H;  3CCV A;  1MJC A;  4IO9 A;  1IBK L;  2OTL A;  3I4N G;  2RHS B;  2JA5 H;  1UWV A;  4MZ9 A;  1PHJ A;  1WJJ A;  2QA4 A;  1MJE A;  1UE7 A;  1HNZ Q;  4YCW A;  2ALY B;  2MO0 A;  3UDX A;  3PUX A;  3HFZ B;  3TEH B;  1B8A A;  2Y0S G;  4BXX H;  3HOX G;  4K0K L;  1PV4 A;  3CCL A;  1UEB A;  4JI2 Q;  2R93 H;  1XPR A;  3HOU H;  4BBR H;  3H0G H;  1HNX L;  4BY7 G;  1YJW A;  5DLQ E;  1VQH A;  4JC0 A;  2JQO A;  5E7N A;  1EOV A;  1PH5 A;  3S1N H;  1KD1 C;  1G51 A;  2E2J H;  2XTI A;  4OX9 L;  1EIF A;  1Q1B A;  1VQP A;  4B3S Q;  4JI7 Q;  3M85 A;  2IX1 A;  1XMO Q;  2NVQ H;  1AH9 A;  1U0L A;  1PVO A;  4DR2 L;  4IFD I;  4A3C G;  1X6O A;  2VUM H;  1KHI A;  1OXV A;  1YBY A;  3PUY A;  1UE5 A;  4HIK A;  2B63 G;  1JE5 A;  4QGU A;  2B3G A;  1WYD A;  5FLM H;  1QZH A;  3HOW G;  2R7D A;  5LMN L;  5K36 G;  1JJG A;  1GO3 E;  4GKK L;  1K8G A;  5M3F H;  3PO2 H;  2F3I A;  1QZG A;  1TXY A;  4NXN L;  1QUQ A;  4EQ5 A;  1HNX Q;  1CKN A;  2VQE L;  2IY5 B;  5GAG C;  2F4V Q;  1WOC A;  4FDB A;  3KYH C;  5IP7 H;  2AMC B;  2JJQ A;  4DR6 Q;  1B7Y B;  3J7Z C;  4B3M Q;  2AWN A;  2ZJP A;  1NBW A;  1XMO L;  4AYB G;  2JEA I;  4X64 L;  2YYZ A;  4P73 A;  3J81 i;  3KF6 A;  3CCS A;  1J5E L;  1I94 Q;  5IYC G;  4LF5 Q;  2JA7 G;  3CCR A;  3D0F A;  1IYJ B;  3AEV A;  3CD6 A;  4GKJ L;  1BKB A;  1E24 A;  2AHO B;  3ZJY C;  1JT8 A;  1EUJ A;  1X3G A;  1K3R A;  4BXX G;  3FKI H;  5C44 G;  3GO5 A;  3KLW A;  3BZC A;  4DV3 Q;  1N36 Q;  2UXC L;  3RZD H;  1BBW A;  2VQE Q;  2VW9 A;  2K5V A;  4DV0 Q;  4NXM Q;  5JEA J;  4XTC S;  1E22 A;  1Y1V H;  2Q2H A;  2K14 A;  1YNX A;  4YWK A;  2ZJR A;  3T1Y Q;  3S1Q H;  1XNQ Q;  2E5L Q;  1XPU A;  4PZ7 A;  2VZA A;  2CWA A;  3CME A;  4JI4 Q;  3ULP A;  3RN2 A;  2OQK A;  1RL2 A;  3J7A 5;  3G71 A;  2E8G A;  2N78 A;  4KHZ A;  4R1J A;  3GTO H;  4A76 A;  2VL6 A;  1HH2 P;  3PUW A;  4DAY B;  4HJ5 A;  1QVF A;  2B29 A;  4AQY Q;  5IT9 c;  4JI6 L;  3HOV G;  1CKN B;  2JA8 G;  4UP9 A;  1PH1 A;  3S1R H;  4IPH A;  1UE6 A;  4LF4 Q;  1IBM Q;  5IWA L;  2WP8 J;  4GNX A;  1VQC A;  1YVC A;  4P72 A;  4DV7 Q;  4C3H H;  1EQQ A;  1L1O A;  1S3O A;  3NEM A;  1N32 Q;  4LNQ A;  4HJ7 A;  1YIJ A;  3CP0 A;  3KDF A;  3ERS X;  4JV5 L;  3W1B A;  3GTM H;  2FXQ A;  2PMZ E;  1K9M C;  3OYY A;  1JMC A;  4LF8 Q;  3HOZ H;  3RNU A;  3CC4 A;  3ICE A;  2WFW A;  5IP9 H;  1N32 L;  4DUZ L;  3OTO L;  4JOI C;  2MQH A;  5M5X H;  4YHH L;  1M1K C;  1CKO A;  1VS0 A;  4JI2 L;  1VQE A;  5GAH C;  3TS0 A;  3KDF B;  3G4S A;  3U4Z A;  2YTX A;  3JAM c;  1YI2 A;  2ZTD A;  1L1O B;  4DR7 L;  4UY8 C;  3G48 A;  1I6H H;  4JI1 L;  1CUK A;  3KOJ A;  5BR8 Q;  2JE6 I;  4XIG S;  4R4I A;  4JV5 Q;  1KL9 A;  1WCM H;  2Z6K C;  4JG2 A;  3JAM i;  3EN2 A;  1G6P A;  1NMF A;  4QIW E;  2HHH Q;  4B3T Q;  4Y52 H;  1KRS A;  4LUO A;  2LSS A;  4A93 G;  1RIP A;  3E9H A;  1HR0 W;  2K50 A;  1X9N A;  3OTO Q; 
#chains in the Genus database with same CATH topology
 4B3S L;  1E2V A;  3HKZ B;  2Z1C A;  4KMU C;  2K52 A;  1NNX A;  4DR6 L;  2X69 A;  2PI2 A;  2UU9 L;  3DLL A;  2SDF A;  2LFN A;  3V2T A;  4LF5 L;  1KXL A;  1U4M A;  4IJL A;  4RCN A;  1D5M C;  2RBM A;  4WJ3 M;  2K5N A;  5IP7 G;  4LUZ A;  1IW7 D;  5C4X G;  5M3M H;  3GDE A;  1K8A C;  2WIN B;  3KFU A;  4OX9 Q;  4HID A;  1ET9 A;  2D0P A;  5IGF A;  3VR4 A;  2VNU D;  3FDT A;  3WWV A;  3GQB A;  2CQO A;  2NVX B;  1WCM G;  3U4V A;  4X65 L;  1M90 C;  1EY4 A;  3A8K E;  2WAQ E;  4R4Q A;  4HSV A;  4CGY B;  5KND A;  4JI4 L;  3A56 A;  1STN A;  1E1O A;  5C4H A;  3S1M H;  1QVC A;  1Y1W H;  4LW1 A;  4BY1 G;  1XTC D;  4F8M A;  3GTQ B;  2MJ8 A;  3E0E A;  4DK6 C;  3V96 A;  3ND9 A;  4BA2 I;  1CQF A;  3DUZ A;  1R4P B;  4IUQ A;  2CWP A;  4A3M H;  1EU3 A;  4ZQ3 A;  3TP5 A;  4YY3 Q;  1I6H B;  4BBR B;  3I55 A;  4A3L G;  5BR8 L;  1QWY A;  3NTI A;  3TRE A;  2P5Z X;  2SOB A;  1XNR L;  2AWO A;  4NPS A;  2MHV A;  1EY9 A;  4XQJ A;  1U5K A;  1CI3 M;  2DNE A;  3E6Z X;  5IYB G;  2ZJQ A;  1B70 B;  1F2L A;  1HZB A;  3GTL H;  5E1F A;  5D65 A;  1SE8 A;  2PQA B;  5FLM G;  5KIX A;  1FL0 A;  2H1E A;  4OON A;  1Q1E A;  5JJI A;  2BH8 A;  2CFM A;  2EYH A;  2EYM A;  1K0R A;  2HD3 A;  4LF6 Q;  4GN4 B;  4IPC A;  4LF7 Q;  1JB7 A;  2F0E A;  5IT9 L;  3FRP B;  1U4R A;  1YZ6 A;  5C4Z A;  1DXM A;  4BY7 B;  3CCU A;  4A3J H;  5IYD G;  1LUZ A;  1HCZ A;  2B2U C;  2NZH A;  4LF6 L;  3I72 A;  5ELN A;  2IW3 A;  2NTS A;  4BY7 H;  4DNI A;  1A62 A;  3I4M H;  1O7L A;  4JI3 Q;  1V8Q A;  4HTH A;  4KD3 A;  1WTO A;  3HOZ B;  4DU9 A;  3U50 C;  1PTO B;  1S72 A;  3VYT A;  1J6Q A;  3AYH B;  2OQ0 A;  2PNR C;  1BO0 A;  5K36 H;  4DGZ A;  1KNE A;  3VR3 A;  4IUU A;  4RMF A;  2X6G A;  1YJN A;  1XNQ L;  4BBS H;  4KHP L;  2V4D A;  4LF9 Q;  4GNX C;  1L1O C;  2A69 D;  2UU9 Q;  2K05 A;  5FLX E;  4X62 Q;  4OWT B;  4NMZ A;  4A3L H;  2A19 A;  1Q12 A;  1JB3 A;  3FVQ A;  2RA4 A;  3OW2 A;  3PUZ A;  1KLG D;  2F0T A;  2UUB L;  2QEJ C;  5CV5 A;  3GTL B;  4A3I B;  3RR5 A;  4GOP A;  1B3Q A;  1ASY A;  2R93 B;  2HIV A;  4KY5 A;  4IAL A;  4GS3 A;  2GVA A;  2MP1 A;  1X54 A;  1W6K A;  4RGT A;  2A6H D;  1L0W A;  5A35 A;  4RH6 A;  4JW0 A;  1IYV A;  1F9S A;  3T13 A;  3I7F A;  4ME3 A;  3IKJ A;  4LF8 L;  2ATW A;  1TWF H;  4K8I A;  1TWH H;  4X66 Q;  3CC7 A;  1OO9 B;  2G5D A;  3RMH A;  1S5E D;  3CW2 C;  4GN5 A;  1EU4 A;  1NMG A;  1VQA A;  3T4A C;  1Q7Y C;  5JPN C;  2JA8 H;  4B3T L;  1BR9 A;  3G6E A;  2D0O A;  4DV6 Q;  4GLX A;  3UDI A;  1IL2 A;  3TDQ A;  4B3R L;  1YNN D;  1ESF A;  1SN8 A;  2PI2 E;  2BA0 A;  2NVY H;  1D8L A;  4TQU S;  5A2Q L;  1YEZ A;  1YNJ D;  2HQE A;  1SRO A;  1SMX A;  3K0Y A;  4XYO A;  4BBS G;  1RF2 D;  1ASZ A;  1HNW L;  3JC6 6;  2EIF A;  1PZK D;  3CQZ H;  2E74 C;  4UP8 A;  1EEI D;  2BE5 D;  4OGQ C;  3NWS A;  3M7N A;  3PSI A;  1A2U A;  1JOR A;  4PMC A;  1F2Z A;  1W3S A;  2E76 C;  3FHW A;  1LT5 D;  2LXJ A;  1SNP A;  1W2B A;  2WB1 B;  1C8C A;  4GNX B;  1WTW A;  1L2F A;  4DV2 L;  4DV4 L;  3PMF A;  5H1S E;  2JA7 B;  3LGJ A;  1Q8K A;  1ZYR C;  4RKL A;  5ELE A;  3S14 H;  2WKC A;  3HOY G;  3SEB A;  1A63 A;  2JA5 G;  1BBX C;  4R4O A;  4L6T B;  3BVM A;  2J7Z A;  1X55 A;  1XPO A;  3S2D B;  2ASB A;  4GLA C;  2DN8 A;  4UP7 A;  4AYB E;  1LYL A;  2YTY A;  4I7A A;  4OO1 G;  3M4O H;  5CMD A;  1V43 A;  1CK1 A;  2A69 C;  2F0M A;  1LT6 D;  4DV7 L;  4QY7 A;  1SDF A;  3KF6 B;  1O7Y A;  3AMU A;  4QMG A;  4A3G G;  3MWY W;  3HOW H;  5C3W A;  3BYT B;  1CHP D;  1VQ9 A;  5GAE C;  4K5V A;  4X3U A;  1NR2 A;  1PXU A;  2QEX A;  3S15 B;  3HKZ E;  1PYB A;  1QUQ B;  3R8B A;  3A8I E;  2ZM6 Q;  4LAA A;  2I46 A;  3K0X A;  5M5W B;  4NB3 A;  2N3S A;  4HAE A;  4K8J A;  4L5Q A;  3LNN A;  4XT3 B;  2QDB A;  1TVX A;  1CTM A;  1OXT A;  3PO3 B;  4GKJ Q;  1TU2 B;  3J81 c;  5FK9 C;  5T1I A;  4F87 A;  5TSS A;  1SYC A;  2RF4 A;  4X64 Q;  4XYQ A;  3H3V H;  1VMC A;  4CHT B;  4A3M G;  4NXM L;  1NTG A;  2I07 B;  3OW7 A;  1IZ6 A;  3TSS A;  1K83 H;  1IW7 C;  3IRB A;  4B9X A;  2F0D A;  4O0A A;  1RJT A;  1SJH D;  1B9N A;  3PV0 A;  1D2B A;  4DK3 C;  3B6Y A;  5IGE A;  2OTJ A;  2O5I C;  5EGT A;  3E9I A;  1STH A;  3HP3 A;  4YCV A;  5C44 B;  1SNO A;  2KED A;  3P75 A;  1GUN A;  4HR7 B;  4DV2 Q;  1JE4 A;  3F2B A;  1B4O A;  2OXP A;  1MSH A;  5M3F G;  4IFD H;  1VQJ A;  4X3S A;  1TWG B;  4H44 C;  4YY3 L;  3CC2 A;  4A3E H;  1HNZ L;  1DYQ A;  4LFC L;  3HEJ A;  4DUZ Q;  1NE3 A;  1X65 A;  2L5T A;  2ZT9 C;  1MJC A;  3CCV A;  5IT9 E;  4K14 A;  1UWV A;  3OWF A;  3R2T A;  4IZ8 A;  1O80 A;  1MJE A;  2ALY B;  3EA6 A;  3QO2 A;  4R9W A;  3PUX A;  1RD9 D;  3CCL A;  3D8G A;  3A8J E;  1UEB A;  4JI2 Q;  3SDZ A;  3HOU H;  4BBR H;  1X3Q A;  3BDC A;  4NDX A;  5DLQ E;  1VQH A;  1D1I A;  1G8Z D;  2JQO A;  5KYL A;  2VUM B;  5I9P A;  1G51 A;  2XTI A;  2SNM A;  1EIF A;  1AH9 A;  1SMY D;  1WTX A;  4IFD I;  2KEC A;  4KD4 A;  3PUY A;  2B63 G;  2B3G A;  2F0N A;  1K8G A;  2F3I A;  1QZG A;  4EQ5 A;  4WRD A;  3E0J A;  5M5X B;  1HNX Q;  3AB9 A;  2F03 A;  5GAG C;  1WOC A;  2NYZ D;  2AMC B;  2F0I A;  3CRL C;  3SXH A;  3MEH A;  4FF2 A;  1DOM A;  1XMO L;  4PNY A;  3K5N A;  3KF6 A;  2B63 B;  1I94 Q;  3RZD B;  2JA7 G;  4KN4 C;  1BKB A;  3ZJY C;  1EUJ A;  4C3I G;  1I6V C;  1PFN A;  2K5V A;  4A3J B;  4XTC S;  3T1Y Q;  4YWK A;  1YNX A;  2JA8 B;  4FYD A;  3EJI A;  1F9Q A;  4KKU A;  1HA5 A;  1VMP A;  4UAI A;  4C2M B;  3J7A 5;  1FNU A;  4WFN 3;  4KHZ A;  1Y8P B;  4AQY Q;  5IT9 c;  1CKN B;  4XXE A;  5L37 A;  5HUR A;  3S1R H;  2FHT A;  2NVQ B;  2WP8 J;  4KKT A;  1VQC A;  4GNX A;  2XIW A;  1L1O A;  1S3O A;  3NEM A;  2PW5 A;  4DK1 A;  5BN5 A;  4HJ7 A;  2XNA C;  2B2W A;  4PV1 C;  1JCK B;  3A55 A;  5D3I B;  3W1B A;  3GTM H;  2FXQ A;  1JMC A;  1LTS D;  2B2T A;  5CC4 A;  3K57 A;  2WFW A;  5JOB A;  5IP9 H;  4H0L C;  1PRT F;  2MQH A;  4K2L A;  5M5X H;  2M2L A;  1M1K C;  4A93 B;  5GAH C;  1WTH A;  1LTA D;  4DN4 M;  3U4Z A;  2YTX A;  2ZXP A;  3G48 A;  1I6H H;  4RKB A;  2BCO A;  1GUG A;  3K5M A;  3P20 A;  1NUC A;  4R4I A;  2NVT B;  1WCM H;  3W3A A;  1SSO A;  4A93 G;  2KHS A;  1UEA B;  3E9H A;  4HSP A;  2Q8R E;  3OHX C;  1HR0 W;  3HOU G;  1V1O A;  4ABN A;  1YHB A;  2BA1 A;  3N6R A;  1ZEQ X;  4PMW A;  5J39 A;  3TZD A;  1VQ8 A;  1GD7 A;  1GM5 A;  4YWL A;  1Y1W G;  2Z6B A;  2EJG C;  1P16 A;  3Q8D A;  1H9K A;  3TZU A;  2F0P A;  4IUP A;  1JIC A;  5C3E H;  4JI5 Q;  4MTN A;  3D4R A;  2NVT H;  3KJO A;  2ZM6 L;  3MXU A;  3T56 B;  5C0X H;  1CSP A;  1SYD A;  2XN9 C;  4L63 B;  1K73 C;  2NVY B;  1F2M A;  1F9P A;  4A3D G;  1YNJ C;  2MO1 A;  3T16 A;  3VR6 A;  2UUC L;  2MUY A;  2L15 A;  4FXK C;  5GQO A;  3A0J A;  2ZTE A;  1SJE D;  1T5X D;  1PA6 A;  1AFP A;  3ULL A;  2M00 A;  1CZW A;  3CQZ B;  2OT2 A;  1E1T A;  3OSO A;  4HIO A;  1VQ5 A;  2K03 A;  2BE5 C;  1A3V A;  4GOP B;  4A3C H;  2NWG A;  1EYG A;  3HOZ G;  3P7J A;  1ESR A;  1B44 D;  2B2U A;  3DWQ A;  2Q2T A;  4JI0 L;  3T51 B;  4P71 A;  2RSO A;  5C0X I;  1T9H A;  5IGD A;  3M4P A;  1EY7 A;  4O1N A;  3PO3 H;  2RCN A;  2XSC A;  1MD2 D;  2JK8 A;  1RHP A;  1VQD A;  1BBU A;  4C3J H;  4K2K A;  3UE0 A;  2OEO A;  1P8L A;  3L2P A;  3VA5 A;  1WI5 A;  2JSO A;  2R92 G;  1FJG Q;  3S14 B;  1CM9 A;  3KF8 B;  1HUN A;  1A2T A;  1IXR A;  2E2H H;  5C3E B;  3A7A B;  4LFC Q;  4B3M L;  1GUS A;  2MNA A;  4PQX A;  5CV6 A;  3GTQ H;  2UXD L;  1I94 L;  1K8M A;  3I91 A;  3K7A B;  2GN5 A;  2B2T C;  2NZO A;  1I50 B;  3J81 L;  2OWO A;  4GOP C;  3BDL A;  1NJI C;  3HOV B;  2UXC Q;  2KHJ A;  4JBJ A;  2SEB D;  5C4X B;  1C7Y A;  2KHI A;  2VB2 X;  4ID6 A;  3SVM A;  1I3Q H;  3S17 H;  2PQA A;  4ZUJ A;  3S9W A;  4JPB W;  2E2H B;  4EQO A;  1EFW A;  3TRZ A;  1Z9F A;  1V1P A;  4JI5 L;  4A3K H;  1TWH B;  2NBF A;  2K5W A;  4DAV A;  2J0T D;  1ONL A;  2RDF A;  4DR1 Q;  4DR5 L;  2LKV A;  3W1G A;  1HTP A;  3HGB A;  3X3N A;  4X3K A;  3M4Y A;  4R4T A;  3F8T A;  1DOL A;  1RDP D;  2ZXO A;  4A3D H;  2EXD A;  1Q81 C;  4MIU A;  3ULJ A;  3T1H Q;  1YHQ A;  3AQQ A;  2D62 A;  1G6Z A;  1VQB A;  1VQN A;  1VQ7 A;  2XRQ D;  1PH4 A;  2WAQ G;  1QNK A;  4BBR G;  1QNU A;  4QUF A;  1HJP A;  1IBL L;  3MXN A;  5C44 H;  4JI8 L;  2HHH L;  1KAW A;  4HMI A;  4KN7 C;  1FVI A;  3F2U A;  2F0W A;  4BS9 A;  3J80 i;  5EBD A;  1OXX K;  4A3E G;  4AQY L;  1TWA H;  1C9O A;  1CA6 A;  1IYU A;  1H95 A;  3S24 A;  4UPA A;  2K01 A;  4A3I H;  2R6G A;  3S17 B;  1N9W A;  3C2P A;  4KTA A;  4HJ8 A;  4QQB X;  1A0I A;  1SRU A;  1CHQ D;  4J1M A;  1DJR D;  4LFB Q;  3NWT A;  1BQQ T;  2HUG A;  2K28 A;  3NXW A;  4OWX B;  5DAU A;  1VQ6 A;  1IHZ A;  5FLX L;  2E75 C;  4RWS C;  3MXN B;  2GA4 B;  1BCP F;  3PO2 G;  4IPG A;  4DV1 L;  1STB A;  3G7L A;  1G2S A;  1XX8 A;  3CCE A;  1XNR Q;  3J81 j;  2MFI A;  4G7H C;  4DUY L;  1IKM A;  3JAM L;  4C3H G;  5LMU L;  1DOK A;  3C1E A;  4IUV A;  2HDL A;  3WOF A;  2MGS A;  3VR2 A;  3IAY A;  3QOL A;  3S15 H;  2R7Z G;  1LTB D;  4G7O C;  2IT1 A;  4X62 L;  3I4M G;  2EDG A;  1H9R A;  1W6J A;  1V1P B;  2C9O A;  3NPP A;  4JI6 Q;  4B9W A;  5FO9 B;  2CKZ B;  2WKD A;  1PH9 A;  2JEB I;  1JJ2 A;  2KA7 A;  1HPC A;  1DZ1 A;  5M3M B;  3OIQ A;  3K80 C;  1K0S A;  4EX5 A;  1IBK Q;  5KNC A;  3HKZ G;  4ULL A;  3N52 A;  2KVM A;  3PQI A;  3KLS X;  3QOJ A;  3J80 L;  3RZO B;  3HRZ C;  3S16 H;  4LFB L;  4ZK9 B;  1PH8 A;  1SXT A;  1WD0 A;  3CPF A;  3Q6S A;  3IFT A;  2D5D A;  5KEE A;  3BZD B;  3VYU A;  3PF4 A;  4DAP A;  4B3R Q;  3AU7 A;  1BCP B;  4DF7 A;  4DV0 L;  1QG7 A;  1PTO C;  4A3B B;  5LMN Q;  2OF1 A;  4DR5 Q;  2IX0 A;  3KK7 A;  3HOY B;  4A3F B;  3CCJ A;  3J80 c;  4POF A;  4RG1 A;  4DR7 Q;  4HJ9 A;  1HFG A;  1M4V A;  1GJX A;  1ZXT A;  2PZU A;  5M3F B;  1RTO A;  5T1G A;  3K6O A;  3ZYY X;  3S1N B;  3MC0 B;  1QVG A;  3KUP A;  1WCM B;  3KLS A;  3R2I A;  1KC8 C;  4A3B H;  3HKS A;  4DR1 L;  1VF7 A;  4IUR A;  4O2D A;  2A5H A;  4QUC A;  2A68 C;  5NUC A;  3P1H A;  4DV5 Q;  1K83 B;  1LTI D;  3KBX A;  5DEH A;  2AQ2 B;  4PG3 A;  1NSN S;  4JYA Q;  1MHW C;  1SYB A;  2FJ2 A;  4IOC A;  1MBY A;  2FMC A;  1B1Z A;  1R4Q B;  4LF4 L;  4ZCK A;  1KDC A;  1OXU A;  1TS4 A;  5COR A;  5IYD H;  3NEL A;  4CKC A;  3A5U A;  2XWJ B;  3BZK A;  2NN6 G;  1PH6 A;  1MI2 A;  2F0Q A;  1JWS D;  5ELO A;  1X32 A;  4RA8 A;  3R3O A;  3S1Q B;  1IBK L;  2OTL A;  3I4N G;  2TSS A;  1PYW D;  4P2C B;  1LLR D;  1DM0 B;  4IQZ A;  4RCO A;  4MZ9 A;  4A3E B;  1HNZ Q;  5BN4 A;  2MO0 A;  3UDX A;  1LV9 A;  4K0K L;  1PV4 A;  1XPR A;  4ME5 A;  4BY7 G;  3TP8 A;  2Z9H A;  1YJW A;  3S1N H;  2E2J H;  3WOE A;  2EY2 A;  1Q1B A;  5HGT A;  4B3S Q;  2NVQ H;  3M85 A;  3DEO A;  1TT2 A;  4OEM B;  2VUM H;  4IUT A;  1KHI A;  2E2J B;  1UE5 A;  1Y8N B;  5FLM H;  3HOW G;  1ICW A;  5LMN L;  5K36 G;  2L11 A;  3PO2 H;  3I4M B;  2IY5 B;  3KYH C;  4FO2 A;  1BNZ A;  3PO2 B;  1B7Y B;  5CV9 A;  2AWN A;  3J7A V;  1PTO F;  3LWE A;  2JEA I;  2HCC A;  4X64 L;  4P73 A;  2RDG A;  3J81 i;  3CCR A;  4GKJ L;  4MTK A;  1X3G A;  3FKI H;  5C44 G;  3GO5 A;  3BZC A;  2UXC L;  3V05 A;  3Q24 A;  3RZD H;  1BBW A;  2O2L D;  1GHJ A;  4A3C G;  5I6Y A;  3S1Q H;  2IX3 A;  1XNQ Q;  2VZA A;  2CWA A;  3MFY A;  4JI4 Q;  3H09 A;  3NTK A;  3I4L A;  2OQK A;  3NP8 A;  3G71 A;  2E8G A;  2N78 A;  2L9H A;  4Q0F A;  4A76 A;  3TN2 A;  1HH2 P;  4HJ5 A;  1QVF A;  4JI6 L;  3NBH A;  4UP9 A;  3M3Y B;  1UE6 A;  5I6W A;  4RGO S;  1XWE A;  1SAP A;  4P72 A;  3FPU B;  1EQQ A;  4MN3 A;  3CP0 A;  1T5E A;  4N8F A;  1K9M C;  3OYY A;  3HOZ H;  3RNU A;  3ITP A;  3ICE A;  4DUZ L;  3OTO L;  4JOI C;  3U9O A;  4YHH L;  5JEA H;  1CKO A;  1VQE A;  4DFA A;  3KDF B;  2F3W A;  2ZTD A;  3DMU A;  2L12 A;  1B50 A;  3KOJ A;  5BR8 Q;  4XIG S;  4CJ2 C;  4JV5 Q;  2Z6K C;  1ILP A;  4JG2 A;  1Q8I A;  3JAM i;  3S1R B;  1G6P A;  2CHB D;  4QIW E;  4B3T Q;  1SYG A;  2HHH Q;  1HFN A;  1KRS A;  1FYC A;  2EYJ A;  3OTO Q;  2ES2 A;  1KLU D;  3MZ5 A;  2ICI A;  2Z4I A;  1SR3 A;  5IYC H;  3CHB D;  4V19 0;  1STE A;  1TII D;  2A1A A;  1PZI D;  4XT1 B;  4C3I B;  3K5O A;  2L1B A;  3S2D H;  4DK0 A;  2HQL A;  1G29 1;  1VQM A;  2EXZ A;  3IL8 A;  3J80 E;  4OO1 H;  3H91 A;  2RCF A;  4U67 3;  3M4O B;  1ET6 A;  4CDF C;  3I56 A;  4GLV B;  4A3G H;  2PW7 A;  1H9M A;  3PIP A;  3CPW A;  1I50 H;  1LTL A;  4TKO B;  1IL8 A;  3QWN A;  2JA5 B;  4BY1 B;  3GTK H;  1UUP A;  1JJC B;  3MVV A;  2K5Q A;  4R8I A;  3RN5 A;  3FKI G;  2EYF A;  4M1U B;  4CBV A;  2PYK A;  2LXK A;  2G9H D;  1WD1 A;  3UI2 A;  4FXD A;  1X3E A;  5IE8 A;  1S5D D;  2L4N A;  2F0F A;  3A7L A;  4BBS B;  1WTR A;  2R3Z A;  1DON A;  2K6A A;  2AKW B;  2C35 B;  1MKH A;  4KI0 A;  1Z47 A;  3R93 A;  5FLX c;  2BH2 A;  2IWH A;  2F0V A;  1Q86 C;  1CKM A;  1D7Q A;  2F52 A;  1LTG D;  5CV4 A;  2LY7 A;  2VY3 A;  1B2T A;  2F0O A;  1GUT A;  5J3B A;  2K04 A;  2RHQ B;  4FF3 A;  3J7Y W;  3H3V C;  1GUW A;  2J4X A;  4DNR B;  1L0X B;  2B2W C;  1FD7 D;  1JWM D;  4K0K Q;  3DM3 A;  3M9B A;  2NN6 I;  1Q3L A;  3NK9 A;  4YWM A;  4EQN A;  1FJG L;  3C3L A;  1N33 L;  4JOI A;  2JA9 A;  1KDB A;  3UDF A;  5AFW A;  2VQF L;  3I90 A;  4OEL B;  4H7B A;  5EQ0 A;  3URY A;  1EQV A;  1EIG A;  4ZKC B;  4X6A H;  4JI3 L;  4Q5V A;  1Y1V B;  1F9R A;  1VQK A;  1KRT A;  2KJX A;  1SE4 A;  2NTT A;  1TS5 A;  5M5Y B;  2BDO A;  3ERQ A;  4QB4 A;  5CYU A;  3BJU A;  2IJ0 A;  4DV3 L;  2EZV A;  5HGQ A;  5EKK A;  2L55 A;  1Q90 A;  1EYC A;  1AE3 A;  5C4X H;  3GV3 A;  1VCI A;  5FO8 B;  1DD2 A;  4RGN A;  4TRD A;  2NZ1 D;  2PNH A;  5LHY 1;  1ZYR D;  2N49 A;  5ELC A;  2UUB Q;  4JBM A;  4LFA L;  4DV4 Q;  2F0U A;  1EY8 A;  3PF5 A;  1TKW B;  4JK1 C;  1S4Z A;  1Z7T A;  4MNO A;  3TS2 A;  1NR4 A;  3F2C A;  2D9U A;  4LF9 L;  1HZ9 A;  4PMB A;  1QB5 D;  1C48 A;  1ZKO A;  2K7V A;  4CJ1 B;  4EGV A;  4APV A;  4KJO A;  4U68 A;  3SK4 A;  3GTJ H;  1TWA B;  5G3L D;  4K6L A;  4QJF A;  4FF1 A;  1WFQ A;  3D6W A;  1U9R A;  5IGB A;  2DNC A;  3TME A;  1GHK A;  4LK1 C;  1EYD A;  2N8N A;  1EIY B;  2CVR A;  5M5Y H;  2Y0S E;  5EJW A;  2R7Z B;  3PIP 3;  2K33 A;  4A3K G;  1HA6 A;  4ALP A;  2H5X A;  1OXS C;  1HZC A;  1K3B C;  4G4K A;  3I73 A;  2F0G A;  1LAB A;  4JI1 Q;  1PH2 A;  1AE2 A;  1LAC A;  4K5W A;  4KV6 A;  4NXN Q;  3SGI A;  4NW2 A;  5M9O A;  5IP9 G;  2CH4 A;  3AFQ A;  4QF4 A;  4R4C A;  1XMQ Q;  4X65 Q;  3GTM B;  2KUM A;  3H15 A;  3H3V I;  2B2V A;  1WTV A;  1OTC A;  1HNW Q;  3FP9 A;  2CW0 D;  4QL5 A;  3DHQ A;  1J5E Q;  1PFS A;  1MSG A;  3HOY H;  1PTO H;  3H6M A;  3I3C A;  2B39 A;  2N88 A;  4TSS A;  1X56 A;  1GUO A;  1SBB B;  1XMQ L;  4H02 A;  2A8V A;  5IGG A;  2E5L L;  4WOR A;  1PTO D;  2TMP A;  1HR0 L;  3QG1 A;  4Z9C B;  2O5J C;  5IIF A;  1UAP A;  4DA2 A;  4K6D A;  1FR3 A;  1SNM A;  3VYS A;  5EKL A;  2MPM A;  4FP5 D;  2O4X A;  2GVB A;  4L5T A;  5J1Z A;  4DV5 L;  4JCV E;  1SE3 A;  2NVX H;  5LL6 X;  2AUK A;  2RQX A;  1NY4 A;  2K75 A;  2JA6 B;  3NBH B;  2Q8I B;  1K28 A;  3PIO A;  3I4N H;  2DY8 A;  4G7Z C;  1VQI A;  3CCM A;  5EPK A;  3I4N B;  1FNW A;  1KAA A;  1S5B D;  3RLO A;  3JAM E;  1N33 Q;  1TWF B;  2JYO A;  2PQE A;  1EL0 A;  4OL7 A;  3NTH A;  3I4O A;  3GV6 A;  2V1C C;  4C2M H;  4KKS A;  4EQP A;  2UXB L;  1SMY C;  4ZAI A;  2XWB B;  4DR3 Q;  4JBK A;  3D3R A;  2QKI C;  2Z4H A;  5C0X G;  4NP5 A;  3K81 C;  1LT4 D;  3K59 A;  3F1Z A;  4UHV A;  1MIU A;  2ID0 A;  1AN8 A;  3NEN A;  2Z6K A;  1QCB D;  2F4V L;  1A15 A;  2K4K A;  1XJV A;  1HUM A;  1PFB A;  4ODG A;  3ERO A;  2YV5 A;  4IFD G;  2H4O A;  1CT1 D;  3ER0 A;  3AFP A;  4GZY C;  5ELD A;  1LO5 D;  2FFK B;  1B9M A;  1STY A;  3S1M B;  1TY0 A;  1PDQ A;  2Q2I A;  5JPM C;  1RTN A;  3PGZ A;  1PLF A;  4DAY A;  3HOX H;  4YHH Q;  1WTQ A;  2B2V C;  3HOV H;  3M4Q A;  4YCU A;  5IOD A;  4OXP A;  1A3U A;  1EY0 A;  2N55 A;  3GTG H;  2QDL A;  1WVL A;  5CBE E;  1JC7 A;  3RLF A;  3NSW A;  1O7Z A;  2EJM A;  3NQT A;  4HJA A;  3K7U C;  1O7I A;  3H0G B;  1ENA A;  4POG A;  2K32 A;  4ZKB B;  3TQY A;  4OO1 I;  1UE1 A;  4OHJ A;  4A3D B;  1VQF A;  3KF8 A;  2E2D C;  2I0Q A;  5GRO A;  4C1N I;  4TVA B;  1KTK A;  5FJ8 H;  4IO9 A;  4BWG B;  2JA5 H;  4FXG C;  2B8F A;  3NHH A;  1UE7 A;  1LTR D;  2B8G A;  2ZXR A;  3I8Z A;  1E0B A;  3SK8 A;  3X3M A;  2QIL A;  3HOX G;  3MTS A;  1BCP C;  1AZP A;  1D5Z C;  2R93 H;  4OIK A;  3H0G H;  1HNX L;  1I4R A;  4JC0 A;  1I4X A;  1SFO B;  5JJZ A;  1VQP A;  1JR0 D;  1CZG A;  4JI7 Q;  2IX1 A;  1TR5 A;  1PVO A;  4DR2 L;  1J9O A;  1OXV A;  1YBY A;  2EY1 A;  4QGU A;  1QZH A;  3HOX B;  2R7D A;  1GO3 E;  4KY6 A;  4NXN L;  4M8A A;  5JVG 3;  4C3J B;  1ICF B;  1CKN A;  4CDD C;  2VQE L;  1B53 A;  4FDB A;  2JJQ A;  1NBW A;  4J6H A;  1SYE A;  4N9P A;  3GP7 A;  2XVS A;  3CCS A;  4LF5 Q;  2RVL A;  4CDE C;  5IYC G;  3QR8 A;  3D0F A;  1IYJ B;  3AEV A;  2AHO B;  1TS3 A;  2B2Y A;  1K3R A;  3HG9 A;  3KLW A;  3J7A F;  1JQY D;  4NXM Q;  4DV0 Q;  1E22 A;  1Y1V H;  3J81 E;  4G57 A;  2F0S A;  2ZJR A;  3FKI B;  1XPU A;  2E5L Q;  2WII B;  3CME A;  3ULP A;  3RN2 A;  4RAU C;  4R1J A;  5JAV A;  2VL6 A;  4DAY B;  3SR1 A;  1S5F D;  2JA8 G;  1PH1 A;  3CKI B;  3FEW X;  2EYL A;  1NAP A;  4LF4 Q;  5IWA L;  4A3G B;  1N32 Q;  4LNQ A;  3KDF A;  3ERS X;  2BDN A;  3ND8 A;  1BF4 A;  2KCC A;  4HMJ A;  2PMZ E;  4I7Z C;  5CBA E;  3NUC A;  4WJW A;  5E3F A;  4JI2 L;  4KY7 A;  2FIN B;  4ZRZ A;  1BUV T;  1L1O B;  5DM6 3;  4JI1 L;  2WAQ B;  2VXW A;  2JE6 I;  1ML0 D;  4HCS A;  5DNF A;  3PIO 3;  4Y52 H;  2LSS A;  1KAB A;  4WJ4 A;  4BA1 I;  3LWU A;  3L0O A;  1V1Q A;  4RHS A;  1EWI A;  1QOH A;  4L5S A;  1TY2 A;  1SLJ A;  5LL6 S;  2B63 H;  1PRT B;  2UUC Q;  1SND A;  1LT3 D;  3EFX D;  3T1H L;  3BU2 A;  4DUY Q;  1E7Z A;  3WDN A;  1CFM A;  4P75 A;  3MXG A;  1VQL A;  4JBW A;  3CMA A;  1BCP D;  1V9P A;  4I65 A;  2Z8L A;  3GD7 A;  5CV8 A;  4A4I A;  1Y8O B;  3SE0 A;  4UDU C;  2NB0 A;  3L9A X;  3SK5 A;  1GOZ A;  2JN4 A;  4IJH A;  1BXT A;  1I4H A;  1SNC A;  4C3I H;  4PZ6 A;  2IHF A;  1S40 A;  2EY5 A;  2HCI A;  1ROD A;  4QIW B;  5ELF A;  2PCF B;  3I70 A;  4DPG A;  4J15 A;  3VYR A;  1N34 L;  1D6E C;  3BVG A;  1HZA A;  4H13 C;  5F2D A;  3RLN A;  2B2Y C;  3K8A A;  1IBL Q;  4DAM A;  4A3I G;  1I4Q A;  3FMC A;  4A3M B;  1U4P A;  2PZT A;  5EPJ A;  5C0X J;  2UXD Q;  3D31 A;  5J22 A;  3EQL C;  3UE1 A;  4Y7N H;  1PFM A;  1U4L A;  1N34 Q;  2YU9 B;  2IHE A;  1JOK A;  4A75 A;  2KEE A;  3VA7 A;  1KQS A;  3F2D A;  4HCE A;  4L8J A;  3NQI A;  3NBI A;  5BN3 A;  5CGK A;  3BVZ A;  4E6I A;  2I5L X;  1AEX A;  2KCM A;  1X3F A;  4J8Q A;  1BOS A;  1SEB D;  2AUJ D;  4NKL A;  4AIM A;  2WB1 E;  4IFD J;  4KJN A;  4ZUI A;  5M5W H;  4A3B G;  3OPO A;  1GVP A;  1N8R C;  4K5X A;  1HTL D;  4F88 A;  1PH7 A;  3SHL A;  4AH6 A;  4DR2 Q;  1L0Y B;  1JOQ A;  3VR5 A;  2L0C A;  2WB1 G;  3BG3 A;  2YU9 H;  4DV1 Q;  1D1K A;  4PZ8 A;  2Q8T A;  3RD4 A;  2JA6 G;  3QB3 A;  2LMC B;  3K58 A;  2RSN A;  2YTV A;  3STB D;  1F77 A;  2NUC A;  3D6C A;  4FF4 A;  1PRT C;  2K5D A;  4DR4 L;  1A3T A;  2F0J A;  1E2Z A;  4GN3 B;  2EVB A;  2G9D A;  4L5R C;  4FNF A;  1CSQ A;  3OMG A;  2R7Z H;  4CKE A;  2VQF Q;  3EBE A;  3S2H H;  5KRU A;  1FNV A;  3ONA B;  1YJ9 A;  5FJ8 G;  3OMC A;  1AZQ A;  5I2Y A;  4A3F G;  4IPD A;  3DWA A;  5IY0 A;  1EWC A;  1NCV A;  4F7X A;  5LMN W;  3MEF A;  1B3A A;  3SK6 A;  4KLK A;  1EEF D;  2CH4 W;  2HDM A;  3MFG A;  3U9S A;  2F0K A;  1VDZ A;  4P74 A;  4JI8 Q;  5CV7 A;  2CW0 C;  2KEN A;  4DXF A;  5GAD C;  4KHP Q;  1R9T H;  2DJG C;  2KBN A;  1DGS A;  2A6E D;  4CJ0 B;  5AJ3 Q;  3S2H B;  3GTG B;  4IOA A;  1SE2 A;  1R9T B;  1EZ8 A;  5IWA Q;  2I5M X;  3HZX A;  3O13 A;  4RHR A;  4C56 C;  1VQO A;  4X3T A;  1XTD A;  3UDG A;  4LFA Q;  1SYF A;  3OOC A;  3M3Y H;  1GKH A;  2IL8 A;  2PPB C;  1UNS A;  1A8V A;  5AJ3 L;  1YIT A;  1TS2 A;  3BDO A;  3CF5 A;  3GTJ B;  3RZO H;  2KOL A;  2JA6 H;  2R92 H;  4LJZ C;  5EPL A;  1ENF A;  2ENB A;  2F0L A;  1HQM C;  4RFB A;  3DWP A;  2K5H A;  3MA2 B;  3Q23 A;  5LMU Q;  1DCZ A;  2HIX A;  2JP1 A;  3CXC A;  1Y1V G;  5KGU A;  3KLR A;  4ZLT F;  2FMM A;  4IN3 A;  5JEA G;  4FVM A;  5I9O A;  1EYA A;  3PCO B;  2OCE A;  3A74 A;  2UUA Q;  1JOO A;  1HR0 Q;  1C0A A;  5C3X A;  4A3F H;  3T1Y L;  4IUN A;  1TWC H;  2AQ3 B;  2R7F A;  4DV6 L;  3PUV A;  4DR4 Q;  4ILW A;  5D3D A;  1N36 L;  4JI0 Q;  2E2I H;  1EQR A;  1TWC B;  1PYS B;  2EY6 A;  2QF7 A;  3K5L A;  2XRS D;  3D4W A;  4A93 H;  2VS1 A;  4XQQ A;  2E2I B;  2Z0S A;  1II3 A;  1Y1W B;  4QCL A;  1H9S A;  1VF5 C;  3QIA A;  3CU7 A;  2R61 A;  3L7Z C;  5I2X A;  5HY6 A;  1O78 A;  4LF7 L;  2RDH A;  3OIP A;  3HS0 C;  5C5M A;  3E5S A;  4AYB B;  5C3E G;  1QE6 A;  5ISR A;  3STB C;  5JJK A;  4HIM A;  4BY1 H;  3GTK B;  2EOT A;  2EYO A;  4LMQ D;  4S3S A;  1EIH A;  1KDA A;  4N9T A;  5C4J B;  2AQ1 B;  3MXP A;  4C1N K;  5JJL A;  1PZJ D;  5DM7 3;  3KJP A;  4LWC A;  5EKI A;  5C4J H;  4N8X 1;  1IKL A;  1YNN C;  4GKK Q;  4DKA C;  1BVS A;  2CQA A;  3CAM A;  3D4D A;  2C5C A;  1EWH A;  4HED A;  3H0G G;  1LM0 A;  2F1M A;  4HN7 A;  3MAQ A;  4DR3 L;  3VDY A;  1H9J A;  1HXY D;  1E3P A;  2HT1 A;  2KCT A;  1F2Y A;  2EJF C;  4CKB A;  1D5X C;  2EPB A;  1SNQ A;  2VUM G;  5M3M G;  3FPP A;  2WAC A;  1AW7 A;  2CCZ A;  5CR3 A;  4JVZ A;  4JI7 L;  4LUV A;  1EOT A;  2UXB Q;  2A6E C;  1PH3 A;  1WTP A;  3C46 A;  1KIX A;  2X6L A;  5FOB B;  5C6A A;  5G3L F;  1SFO H;  1YHA A;  2UUA L;  1Q82 C;  1CA5 A;  1QJO A;  2I5H A;  1FGB D;  3EIV A;  1ENC A;  1MGS A;  2R93 G;  3Q0A A;  5EAY A;  5D14 A;  3C1F A;  3BYY B;  3TP7 A;  1Y14 B;  5JVH 3;  2PMZ B;  4XQN A;  2QGQ A;  3G6J B;  5E4X A;  4ZYS A;  3TP6 A;  1AP0 A;  3MHB A;  5EBC A;  2VB3 X;  2XGT A;  1K8O A;  1VQG A;  5E4W C;  2ZTC A;  3DEP A;  3W5O A;  3OWE B;  5KNB A;  3A54 A;  4JYA L;  2A73 B;  4A3K B;  2KQ3 A;  3CCQ A;  1BDO A;  2K1B A;  4KK7 A;  2JXM B;  2JA7 H;  1QIL A;  2DUD A;  4XDX A;  1E2W A;  2Q2U A;  3H94 A;  1LTT D;  4A3J G;  2EQS A;  3U58 A;  3GTP H;  3K7A H;  1G2T A;  2F4I A;  3I2Z A;  5IOC A;  5IYB H;  1TWG H;  4X66 L;  2DJF C;  5FO7 B;  1STG A;  1FGU A;  2A6H C;  4DXG A;  3GTP B;  1GXD C;  1G91 A;  1Q46 A;  3A5Z B;  4OWW B;  2Y0S B;  3PO3 G;  3TBI B;  1CQV A;  1VQ4 A;  1I5F A;  2DGY A;  1I3Q B;  1IBM L;  2PZW A;  1M8A A;  2RHS B;  1I4P A;  3EVQ A;  1PHJ A;  1WJJ A;  1S5C D;  2QA4 A;  4R8N A;  2ICE C;  3QJY A;  4YCW A;  3HFZ B;  3TEH B;  1B8A A;  2F0H A;  2Y0S G;  3HOW B;  4OIJ A;  4BXX H;  2KCN A;  3DM1 A;  1HRJ A;  4Y7N B;  3CRK C;  3E3X A;  4V0B A;  4YIJ A;  1PH5 A;  5E7N A;  1EOV A;  1J8I A;  1KD1 C;  4OX9 L;  5K5P A;  2M9V A;  4CDC C;  2LS0 1;  4DNT B;  1XMO Q;  1U0L A;  2BOS A;  1EQT A;  1X6O A;  3L3O C;  4KHV A;  2DY7 A;  4HIK A;  1JE5 A;  1JJG A;  1WYD A;  4GKK L;  5COY A;  5M3F H;  1ILQ A;  1TXY A;  2D2C C;  1QUQ A;  5FKA C;  5I4D A;  1XXG A;  3RUZ A;  2F4V Q;  4MHE A;  5IP7 H;  4DR6 Q;  4B3M Q;  3J7Z C;  2ZJP A;  2QCP X;  4AYB G;  2YYZ A;  4RGM A;  3KBG A;  1J5E L;  1X3P A;  5KYI A;  3CD6 A;  1RCV D;  5IGC A;  1E24 A;  1JT8 A;  1Y69 U;  4BXX G;  3M7G A;  1HQR D;  1N36 Q;  4DV3 Q;  1PRT D;  2R92 B;  1PMR A;  5C5L A;  2VQE Q;  2VW9 A;  2EYP A;  3T53 B;  5JEA J;  2Q2H A;  2K14 A;  4PZ7 A;  1A6X A;  2EE1 A;  2RKS A;  3LX0 A;  1JWU D;  1RL2 A;  1Z6H A;  3W2D A;  3DXJ C;  2A68 D;  1I4G A;  3HOU B;  3GTO H;  3PUW A;  1XYI A;  1EY6 A;  4C3H B;  2B29 A;  3HOV G;  2SNS A;  4IPH A;  1KNA A;  1IBM Q;  3GTO B;  4DV7 Q;  1YVC A;  4C3H H;  3S16 B;  3NE5 B;  1HHV A;  1YIJ A;  2F3V A;  3IFD A;  4JV5 L;  4EVO A;  2WV6 D;  4LF8 Q;  3CC4 A;  4O42 A;  1EY5 A;  1H9S B;  5A2Q E;  1N32 L;  1VS0 A;  2NN6 H;  1TQO A;  3G4S A;  3TS0 A;  1C4Q A;  3JAM c;  1YI2 A;  1EFI D;  4DR7 L;  4UY8 C;  2A74 C;  5ELB A;  1STA A;  1CUK A;  1EZ6 A;  2PO4 A;  1KL9 A;  1RKN A;  2IPK D;  3EN2 A;  4C3J G;  1NMF A;  4B08 A;  4LUO A;  3Q22 A;  1RIP A;  3BS1 A;  2K50 A;  1X9N A;  2QW7 A; 
#chains in the Genus database with same CATH homology
 4B3S L;  4BA1 I;  4WJ4 A;  1YHB A;  2BA1 A;  3L0O A;  1SR3 A;  4PMW A;  5IYC H;  1V1Q A;  1EWI A;  2K52 A;  1VQ8 A;  4L5S A;  1GD7 A;  4DR6 L;  1GM5 A;  2A1A A;  4YWL A;  1Y1W G;  1SLJ A;  2B63 H;  2PI2 A;  1P16 A;  2UUC Q;  3T1H L;  3Q8D A;  3DLL A;  2UU9 L;  3BU2 A;  4LF5 L;  1KXL A;  4DUY Q;  1E7Z A;  3S2D H;  4P75 A;  2HQL A;  1G29 1;  4IJL A;  1VQM A;  5C3E H;  4JI5 Q;  4MTN A;  4WJ3 M;  1VQL A;  4JBW A;  3KJO A;  2K5N A;  2NVT H;  5IP7 G;  2ZM6 L;  3CMA A;  4LUZ A;  5C4X G;  1V9P A;  1CSP A;  3GDE A;  5M3M H;  1K8A C;  3I56 A;  4GLV B;  1K73 C;  3KFU A;  4A3G H;  4OX9 Q;  4HID A;  3GD7 A;  4A3D G;  2D0P A;  3CPW A;  4A4I A;  3PIP A;  2MO1 A;  2VNU D;  3WWV A;  1I50 H;  1LTL A;  2UUC L;  2CQO A;  1WCM G;  2L15 A;  5GQO A;  3A0J A;  2ZTE A;  3U4V A;  4IJH A;  3GTK H;  4X65 L;  1JJC B;  1M90 C;  3RN5 A;  2WAQ E;  4R4Q A;  1PA6 A;  3ULL A;  4JI4 L;  3FKI G;  4C3I H;  4PZ6 A;  2IHF A;  1S40 A;  1E1T A;  4HIO A;  1VQ5 A;  4GOP B;  4A3C H;  1EYG A;  1E1O A;  3HOZ G;  2LXK A;  4DPG A;  4J15 A;  1N34 L;  3S1M H;  1QVC A;  1X3E A;  1HZA A;  5IE8 A;  1Y1W H;  4LW1 A;  3RLN A;  2Q2T A;  4JI0 L;  3K8A A;  4BY1 G;  1IBL Q;  4DAM A;  4A3I G;  3E0E A;  4P71 A;  4DK6 C;  5C0X I;  1T9H A;  2AKW B;  3M4P A;  4BA2 I;  3PO3 H;  2RCN A;  2C35 B;  5C0X J;  2JK8 A;  1MKH A;  4KI0 A;  1Z47 A;  5FLX c;  2BH2 A;  2UXD Q;  3D31 A;  1VQD A;  2CWP A;  1BBU A;  1Q86 C;  1CKM A;  4A3M H;  4C3J H;  1D7Q A;  4YY3 Q;  3UE0 A;  3UE1 A;  1P8L A;  2F52 A;  4Y7N H;  3L2P A;  3I55 A;  1N34 Q;  2VY3 A;  1WI5 A;  4A3L G;  2IHE A;  2R92 G;  4A75 A;  1FJG Q;  3KF8 B;  5J3B A;  5BR8 L;  1KQS A;  3F2D A;  1XNR L;  3TRE A;  2RHQ B;  1IXR A;  2AWO A;  2E2H H;  4NPS A;  2I5L X;  4LFC Q;  2KCM A;  4B3M L;  1X3F A;  2MNA A;  1U5K A;  4K0K Q;  3DM3 A;  4AIM A;  5IYB G;  2WB1 E;  3GTQ H;  3M9B A;  5M5W H;  4IFD J;  2UXD L;  2ZJQ A;  1I94 L;  1B70 B;  4A3B G;  1GVP A;  2NN6 I;  1N8R C;  4YWM A;  2GN5 A;  1HZB A;  2NZO A;  1FJG L;  3GTL H;  2OWO A;  1PH7 A;  1SE8 A;  4GOP C;  1NJI C;  2PQA B;  2UXC Q;  4AH6 A;  2KHJ A;  4JBJ A;  4JOI A;  1FL0 A;  2JA9 A;  5FLM G;  4DR2 Q;  1N33 L;  2WB1 G;  1Q1E A;  4OON A;  3UDF A;  2YU9 H;  5JJI A;  2BH8 A;  2CFM A;  2VQF L;  4DV1 Q;  1C7Y A;  2KHI A;  4PZ8 A;  2JA6 G;  1I3Q H;  1K0R A;  4LF6 Q;  4GN4 B;  3S17 H;  2PQA A;  2YTV A;  4IPC A;  4LF7 Q;  3STB D;  1JB7 A;  1EFW A;  3TRZ A;  1YZ6 A;  1Z9F A;  4X6A H;  4JI3 L;  3CCU A;  4A3J H;  5IYD G;  1LUZ A;  4JI5 L;  4A3K H;  1VQK A;  1KRT A;  2NZH A;  4LF6 L;  4DR4 L;  4GN3 B;  5ELN A;  4L5R C;  1CSQ A;  3HOU G;  4DNI A;  4BY7 H;  1A62 A;  3I4M H;  2R7Z H;  2VQF Q;  3EBE A;  4JI3 Q;  3S2H H;  4DR1 Q;  4DR5 L;  3U50 C;  1YJ9 A;  5FJ8 G;  3BJU A;  3W1G A;  1S72 A;  4DV3 L;  1J6Q A;  5HGQ A;  3AYH B;  2OQ0 A;  1AE3 A;  5C4X H;  4R4T A;  3F8T A;  4A3F G;  1VCI A;  4RMF A;  4IPD A;  1YJN A;  1XNQ L;  4BBS H;  5IY0 A;  4KHP L;  4A3D H;  2EXD A;  4LF9 Q;  5LMN W;  4GNX C;  2PNH A;  1Q81 C;  3MEF A;  1L1O C;  4KLK A;  3ULJ A;  3T1H Q;  1YHQ A;  2UU9 Q;  2N49 A;  3AQQ A;  2D62 A;  4X62 Q;  1VQB A;  4OWT B;  2UUB Q;  1VQN A;  4P74 A;  4JI8 Q;  1VQ7 A;  4JBM A;  4LFA L;  4DV4 Q;  2KEN A;  1PH4 A;  5GAD C;  2WAQ G;  4KHP Q;  4BBR G;  2A19 A;  1R9T H;  4A3L H;  3PF5 A;  2KBN A;  1DGS A;  1Q12 A;  3OW2 A;  1HJP A;  3PUZ A;  4MNO A;  1IBL L;  5AJ3 Q;  2UUB L;  5C44 H;  4JI8 L;  4IOA A;  2HHH L;  1KAW A;  5IWA Q;  3TS2 A;  2I5M X;  3RR5 A;  1FVI A;  4GOP A;  3F2C A;  1ASY A;  4LF9 L;  1HZ9 A;  3J80 i;  1VQO A;  1OXX K;  2HIV A;  4A3E G;  4AQY L;  1TWA H;  1C9O A;  4GS3 A;  2GVA A;  1XTD A;  3UDG A;  1X54 A;  3S24 A;  4UPA A;  4A3I H;  1H95 A;  2R6G A;  4LFA Q;  3M3Y H;  1L0W A;  4APV A;  1N9W A;  1GKH A;  3GTJ H;  4HJ8 A;  4QQB X;  4QJF A;  1A0I A;  1SRU A;  1WFQ A;  3I7F A;  1A8V A;  4ME3 A;  5AJ3 L;  1YIT A;  4LF8 L;  3CF5 A;  2ATW A;  1TWF H;  1TWH H;  4X66 Q;  3RZO H;  3CC7 A;  2JA6 H;  2R92 H;  2N8N A;  1EIY B;  4LFB Q;  5M5Y H;  2Y0S E;  3CW2 C;  4GN5 A;  1NMG A;  4A3K G;  1VQA A;  4ALP A;  1Q7Y C;  2JA8 H;  2H5X A;  1OXS C;  4B3T L;  4OWX B;  1HZC A;  2K5H A;  1VQ6 A;  3G6E A;  2D0O A;  4DV6 Q;  4GLX A;  3UDI A;  4JI1 Q;  5LMU Q;  2HIX A;  1PH2 A;  1AE2 A;  1IL2 A;  3CXC A;  1Y1V G;  4NXN Q;  3SGI A;  4B3R L;  3MXN B;  5IP9 G;  3AFQ A;  4R4C A;  1XMQ Q;  4IPG A;  3PO2 G;  4DV1 L;  5JEA G;  4X65 Q;  1SN8 A;  2PI2 E;  3H15 A;  3PCO B;  1OTC A;  3H3V I;  2BA0 A;  1HNW Q;  2NVY H;  2OCE A;  3A74 A;  3CCE A;  1HR0 Q;  2UUA Q;  3FP9 A;  1D8L A;  1XNR Q;  4TQU S;  3J81 j;  2MFI A;  4QL5 A;  1YEZ A;  1J5E Q;  1C0A A;  1PFS A;  4DUY L;  3HOY H;  4A3F H;  3T1Y L;  1SRO A;  1TWC H;  1SMX A;  2R7F A;  4DV6 L;  3PUV A;  1ASZ A;  4BBS G;  1HNW L;  5LMU L;  4DR4 Q;  3JC6 6;  1N36 L;  2EIF A;  4JI0 Q;  2E2I H;  1EQR A;  1X56 A;  3CQZ H;  1PYS B;  1XMQ L;  4H02 A;  4UP8 A;  2A8V A;  4A93 H;  2E5L L;  2VS1 A;  3M7N A;  3PSI A;  3S15 H;  2R7Z G;  2Z0S A;  1HR0 L;  1W3S A;  2IT1 A;  4X62 L;  3I4M G;  3L7Z C;  3FHW A;  2LXJ A;  5HY6 A;  2GVB A;  1W2B A;  4L5T A;  4LF7 L;  5C3E G;  4JI6 Q;  4DV5 L;  4GNX B;  4JCV E;  2NVX H;  3STB C;  1L2F A;  5JJK A;  4HIM A;  1NY4 A;  2K75 A;  4DV2 L;  4BY1 H;  4DV4 L;  5H1S E;  3NBH B;  3LGJ A;  2CKZ B;  1Q8K A;  3PIO A;  1PH9 A;  3I4N H;  2JEB I;  1JJ2 A;  3S14 H;  5JJL A;  3KJP A;  4LWC A;  1VQI A;  3HOY G;  3CCM A;  1A63 A;  2JA5 G;  5C4J H;  4R4O A;  3K80 C;  4EX5 A;  1IBK Q;  4GKK Q;  4DKA C;  1BVS A;  3CAM A;  3RLO A;  1N33 Q;  3HKZ G;  1X55 A;  1XPO A;  3H0G G;  2ASB A;  4GLA C;  1LM0 A;  4AYB E;  4UP7 A;  4DR3 L;  3S16 H;  1LYL A;  3VDY A;  2YTY A;  4LFB L;  4OO1 G;  2HT1 A;  1E3P A;  3I4O A;  3M4O H;  2KCT A;  2V1C C;  1PH8 A;  1V43 A;  4C2M H;  3CPF A;  2UXB L;  2VUM G;  5M3M G;  4JBK A;  4DR3 Q;  4DV7 L;  4QY7 A;  5C0X G;  2CCZ A;  3KF6 B;  4JI7 L;  4A3G G;  4LUV A;  3HOW H;  3PF4 A;  2UXB Q;  4B3R Q;  3K81 C;  1VQ9 A;  5GAE C;  1PH3 A;  4DV0 L;  1KIX A;  3F1Z A;  2QEX A;  5LMN Q;  3HKZ E;  1PYB A;  1MIU A;  4DR5 Q;  1YHA A;  2ID0 A;  2IX0 A;  1QUQ B;  3NEN A;  2Z6K A;  1SFO H;  1Q82 C;  2UUA L;  2ZM6 Q;  3CCJ A;  2I5H A;  3K0X A;  2F4V L;  2K4K A;  4NB3 A;  3EIV A;  3J80 c;  4POF A;  1XJV A;  4RG1 A;  4DR7 Q;  2R93 G;  5EAY A;  4HJ9 A;  2N3S A;  4L5Q A;  2YV5 A;  4IFD G;  3ER0 A;  1Y14 B;  3AFP A;  1OXT A;  4GKJ Q;  2QGQ A;  3J81 c;  1QVG A;  2XGT A;  2RF4 A;  4X64 Q;  3H3V H;  1VQG A;  1KC8 C;  4A3M G;  2ZTC A;  1NTG A;  4NXM L;  3W5O A;  4A3B H;  1IZ6 A;  3HKS A;  2Q2I A;  1K83 H;  3PGZ A;  4DR1 L;  4JYA L;  3IRB A;  4O2D A;  3HOX H;  4YHH Q;  2ES2 A;  4O0A A;  3PV0 A;  3CCQ A;  3HOV H;  3M4Q A;  4YCU A;  4DK3 C;  4OXP A;  3B6Y A;  4DV5 Q;  2OTJ A;  2JA7 H;  2DUD A;  3E9I A;  4PG3 A;  4YCV A;  3GTG H;  4JYA Q;  2Q2U A;  4IOC A;  3RLF A;  4A3J G;  2EQS A;  3U58 A;  3GTP H;  3K7A H;  4HJA A;  3K7U C;  1O7I A;  4LF4 L;  4POG A;  3I2Z A;  4DV2 Q;  5IYB H;  1OXU A;  1TWG H;  4X66 L;  3F2B A;  5IYD H;  3NEL A;  1FGU A;  3TQY A;  5M3F G;  4OO1 I;  1Q46 A;  1UE1 A;  1VQJ A;  1VQF A;  3A5Z B;  3A5U A;  3BZK A;  2NN6 G;  4OWW B;  1PH6 A;  3PO3 G;  1VQ4 A;  1I5F A;  4YY3 L;  2DGY A;  3CC2 A;  4A3E H;  1HNZ L;  2I0Q A;  5GRO A;  5ELO A;  1IBM L;  4TVA B;  4LFC L;  4DUZ Q;  1NE3 A;  1X65 A;  5FJ8 H;  3CCV A;  1MJC A;  4IO9 A;  1IBK L;  2OTL A;  3I4N G;  2RHS B;  2JA5 H;  1UWV A;  4MZ9 A;  1PHJ A;  1WJJ A;  2QA4 A;  1MJE A;  1UE7 A;  1HNZ Q;  4YCW A;  2ALY B;  2MO0 A;  3UDX A;  3PUX A;  3HFZ B;  3TEH B;  1B8A A;  2Y0S G;  4BXX H;  3HOX G;  4K0K L;  1PV4 A;  3CCL A;  1UEB A;  4JI2 Q;  2R93 H;  1XPR A;  3HOU H;  4BBR H;  3H0G H;  1HNX L;  4BY7 G;  1YJW A;  5DLQ E;  1VQH A;  4JC0 A;  2JQO A;  5E7N A;  1EOV A;  1PH5 A;  3S1N H;  1KD1 C;  1G51 A;  2E2J H;  2XTI A;  4OX9 L;  1EIF A;  1Q1B A;  1VQP A;  4B3S Q;  4JI7 Q;  3M85 A;  2IX1 A;  1XMO Q;  2NVQ H;  1AH9 A;  1U0L A;  1PVO A;  4DR2 L;  4IFD I;  4A3C G;  1X6O A;  2VUM H;  1KHI A;  1OXV A;  1YBY A;  3PUY A;  1UE5 A;  4HIK A;  2B63 G;  1JE5 A;  4QGU A;  2B3G A;  1WYD A;  5FLM H;  1QZH A;  3HOW G;  2R7D A;  5LMN L;  5K36 G;  1JJG A;  1GO3 E;  4GKK L;  1K8G A;  5M3F H;  3PO2 H;  2F3I A;  1QZG A;  1TXY A;  4NXN L;  1QUQ A;  4EQ5 A;  1HNX Q;  1CKN A;  2VQE L;  2IY5 B;  5GAG C;  2F4V Q;  1WOC A;  4FDB A;  3KYH C;  5IP7 H;  2AMC B;  2JJQ A;  4DR6 Q;  1B7Y B;  3J7Z C;  4B3M Q;  2AWN A;  2ZJP A;  1NBW A;  1XMO L;  4AYB G;  2JEA I;  4X64 L;  2YYZ A;  4P73 A;  3J81 i;  3KF6 A;  3CCS A;  1J5E L;  1I94 Q;  5IYC G;  4LF5 Q;  2JA7 G;  3CCR A;  3D0F A;  1IYJ B;  3AEV A;  3CD6 A;  4GKJ L;  1BKB A;  1E24 A;  2AHO B;  3ZJY C;  1JT8 A;  1EUJ A;  1X3G A;  1K3R A;  4BXX G;  3FKI H;  5C44 G;  3GO5 A;  3KLW A;  3BZC A;  4DV3 Q;  1N36 Q;  2UXC L;  3RZD H;  1BBW A;  2VQE Q;  2VW9 A;  2K5V A;  4DV0 Q;  4NXM Q;  5JEA J;  4XTC S;  1E22 A;  1Y1V H;  2Q2H A;  2K14 A;  1YNX A;  4YWK A;  2ZJR A;  3T1Y Q;  3S1Q H;  1XNQ Q;  2E5L Q;  1XPU A;  4PZ7 A;  2VZA A;  2CWA A;  3CME A;  4JI4 Q;  3ULP A;  3RN2 A;  2OQK A;  1RL2 A;  3J7A 5;  3G71 A;  2E8G A;  2N78 A;  4KHZ A;  4R1J A;  3GTO H;  4A76 A;  2VL6 A;  1HH2 P;  3PUW A;  4DAY B;  4HJ5 A;  1QVF A;  2B29 A;  4AQY Q;  5IT9 c;  4JI6 L;  3HOV G;  1CKN B;  2JA8 G;  4UP9 A;  1PH1 A;  3S1R H;  4IPH A;  1UE6 A;  4LF4 Q;  1IBM Q;  5IWA L;  2WP8 J;  4GNX A;  1VQC A;  1YVC A;  4P72 A;  4DV7 Q;  4C3H H;  1EQQ A;  1L1O A;  1S3O A;  3NEM A;  1N32 Q;  4LNQ A;  4HJ7 A;  1YIJ A;  3CP0 A;  3KDF A;  3ERS X;  4JV5 L;  3W1B A;  3GTM H;  2FXQ A;  2PMZ E;  1K9M C;  3OYY A;  1JMC A;  4LF8 Q;  3HOZ H;  3RNU A;  3CC4 A;  3ICE A;  2WFW A;  5IP9 H;  1N32 L;  4DUZ L;  3OTO L;  4JOI C;  2MQH A;  5M5X H;  4YHH L;  1M1K C;  1CKO A;  1VS0 A;  4JI2 L;  1VQE A;  5GAH C;  3TS0 A;  3KDF B;  3G4S A;  3U4Z A;  2YTX A;  3JAM c;  1YI2 A;  2ZTD A;  1L1O B;  4DR7 L;  4UY8 C;  3G48 A;  1I6H H;  4JI1 L;  1CUK A;  3KOJ A;  5BR8 Q;  2JE6 I;  4XIG S;  4R4I A;  4JV5 Q;  1KL9 A;  1WCM H;  2Z6K C;  4JG2 A;  3JAM i;  3EN2 A;  1G6P A;  1NMF A;  4QIW E;  2HHH Q;  4B3T Q;  4Y52 H;  1KRS A;  4LUO A;  2LSS A;  4A93 G;  1RIP A;  3E9H A;  1HR0 W;  2K50 A;  1X9N A;  3OTO Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...