1KRSA

Solution structure of the anticodon binding domain of escherichia coli lysyl-trna synthetase and studies of its interactions with trna-lys
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
110
structure length
110
Chain Sequence
FRRDHTSDQLHAEFDGKENEELEALNIEVAVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDDLPEGVYNEQFKKWDLGDILGAKGKLFKTKTGELSIHCTELRLLTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Aminoacyl-trna synthetase
molecule keywords LYSYL-TRNA SYNTHETASE (PRODUCT OF LYSS GENE)
publication title Solution structure of the anticodon-binding domain of Escherichia coli lysyl-tRNA synthetase and studies of its interaction with tRNA(Lys).
pubmed doi rcsb
source organism Escherichia coli
total genus 14
structure length 110
sequence length 110
ec nomenclature ec 6.1.1.6: Lysine--tRNA ligase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1krsA00
3D0FA 3GTPH 3GO5A 4LF9Q 1SLJA 2WB1E 4JBWA 3CCJA 1Q7YC 4IOAA 4YWMA 4J15A 1QZGA 5JEAJ 5C0XJ 3F2BA 2HQLA 2YTVA 4UP9A 4AYBE 5LMNW 5FLMH 2UUBQ 4HJ8A 2D62A 4X65Q 1I3QH 3PUWA 3OYYA 4DK3C 1HNWQ 4BXXG 1XNRQ 4IFDI 1PFSA 4AQYQ 1MJEA 1IZ6A 1R9TH 4DR6Q 1SROA 4GLAC 2RF4A 1NY4A 4O0AA 4A75A 2UUCL 2NN6G 4OWWB 2YTXA 3PO2H 3W1BA 1HNZL 3FP9A 1HZAA 2XGTA 3EBEA 2E8GA 5ELOA 3I55A 1IBLL 3I4OA 1VQMA 2QEXA 1N34L 1OXTA 1UE6A 1Q82C 5BR8L 2ZM6Q 2WAQE 4A3IG 3DM3A 4GOPA 4PZ7A 4DK6C 1LM0A 5LMUQ 1FJGQ 2PNHA 2XTIA 1N36L 2MO1A 1BBUA 1JB7A 1HR0L 2PI2A 3S2DH 1X3EA 1LUZA 4DR5L 5IWAL 3CXCA 1WCMH 3BZCA 5C44G 1YIJA 1CKNA 1JJ2A 3RZOH 1Q46A 1V43A 2OQKA 3PSIA 3HOVG 4OO1G 3OW2A 5ELNA 1V9PA 1KRSA 3I7FA 1XPOA 3UDXA 4R4TA 2R7FA 4EX5A 4UY8C 4K0KL 2MQHA 4B3MQ 3H0GG 5C4XH 4DV4L 1WOCA 2CKZB 5EAYA 3KFUA 1VQKA 4YY3L 1E1TA 3PUVA 4A76A 4A3MH 4GOPB 3KYHC 3VDYA 3FKIG 3CCVA 1VQLA 2VQFL 2K5VA 2B29A 5DLQE 1OXUA 1Q8KA 4A3JH 1RL2A 4NXNL 4IPGA 4DV2L 1UE7A 2F4VL 4DV7L 2N8NA 2R6GA 3RLOA 1CKNB 1GO3E 3ULPA 2JA5H 1PHJA 5C3EH 1VQ9A 3A5ZB 1XJVA 1GVPA 1C0AA 1X54A 2CQOA 1XNRL 1PYBA 2ZTDA 1S3OA 2ID0A 4YHHQ 4LFCQ 4PG3A 1EFWA 4IPHA 1PH8A 1AE3A 1B7YB 1DGSA 1HZ9A 1EWIA 5IYBH 5J3BA 4DUZQ 4R1JA 4AIMA 3CC2A 4OX9Q 1IBML 1S40A 4L5SA 4LFBL 4YCUA 3BZKA 2PMZE 4JI5L 1A8VA 3S14H 1OXXK 2HHHQ 1SE8A 3AFQA 4JBJA 1YHAA 2DGYA 1SRUA 3OTOQ 3HOYG 2UXBL 4A3FH 5IP9H 1FJGL 1G51A 2NVXH 1QUQA 3T1YL 1S72A 5FJ8H 3M4PA 3PIOA 3GTMH 3K7AH 3F8TA 1LTLA 2AMCB 4OXPA 1TWCH 1PH3A 4X66L 3CCEA 2PQAA 2BA1A 1K3RA 2BH8A 3HOZH 3I4NG 3MXNB 4NPSA 1E22A 1EOVA 3CC7A 4RMFA 3HOXG 4IJLA 5FLMG 4DR2L 4UP8A 2D0OA 4EQ5A 4DV1Q 4X6AH 3F1ZA 3J81c 2UUAL 2IX0A 5GAGC 4JI3Q 1N32Q 2MFIA 1HJPA 1U0LA 4DR1L 4NXML 1X56A 2JEBI 2Z0SA 1FGUA 1EUJA 4DNIA 3ZJYC 4AYBG 5GAHC 4JBKA 1QUQB 1YHQA 1B70B 2ZTCA 2IHEA 1VCIA 2WFWA 4GNXA 4A3CH 1UWVA 3PO3H 3KF8B 3EIVA 3PUXA 4LF5Q 3RNUA 2PQAB 2E5LQ 3KOJA 2UXCL 4LF6L 1WFQA 2HIXA 1KHIA 3HOUH 4DR4Q 1YVCA 1HNXL 1X65A 2CWAA 4XTCS 3CCLA 3PCOB 2KBNA 4KHPQ 1WCMG 4LNQA 4IFDG 1VQJA 1CKMA 3STBD 4JC0A 1Y1WG 4GN3B 4JOIC 2VL6A 2K50A 2K75A 3CQZH 4GNXB 1PV4A 1W2BA 4A93H 4X62Q 1KRTA 1QVGA 2R7ZG 1Q1BA 1L1OC 2K52A 1YI2A 2KCTA 1J5EL 2ASBA 3G71A 2VUMH 1VQDA 2EQSA 5AJ3Q 1KAWA 1OTCA 3TS2A 3CPFA 2A1AA 1IXRA 2ES2A 4JI6Q 4OWTB 4A3JG 1VS0A 4B3RQ 4A3EH 1VQ8A 2JQOA 2VY3A 1VQPA 1VQGA 3Q8DA 1A0IA 2RHQB 1PA6A 4LF7Q 1FVIA 4APVA 1YJNA 4JI3L 2K14A 2Z6KC 1GD7A 3JC66 3M7NA 2KHIA 1Y1VG 1LYLA 1XMOQ 1YHBA 5C0XI 1W3SA 3NEMA 4A3BH 1VQOA 4R4OA 4DPGA 1K8GA 3I2ZA 4DR7Q 4JV5L 2PI2E 2ZJQA 3ER0A 4JG2A 3WWVA 1X3GA 3A0JA 5IT9c 2VQEQ 3GTOH 1I94L 2MNAA 2UU9Q 4JI4Q 3J80c 3T1HL 4H02A 4DV5Q 4BY1H 4PMWA 2LXKA 2I5HA 2QGQA 4LFAQ 3UE1A 2NVYH 4JYAQ 2H5XA 4KHPL 3J7A5 1Y14B 3E0EA 2OTLA 3G4SA 3TREA 2NVTH 4B3SL 4LF4L 2UXDL 4HIMA 3HOZG 3I56A 4HJ5A 3K7UC 1E7ZA 4B3TL 4XIGS 4IFDJ 3H15A 1XPRA 3PIPA 4DV0Q 4R4CA 4GKJL 4BBRG 1T9HA 4JI8Q 4A3LH 3AEVA 4Y7NH 2DUDA 4BBSH 4DUYQ 1YNXA 3HKSA 2KENA 4A3GG 1VQNA 1XNQQ 3STBC 1X55A 4LWCA 4LW1A 3CCUA 4JI6L 3U4VA 1YITA 1M90C 4A3CG 5LMNL 3K0XA 1I50H 1N9WA 3K81C 4PZ8A 1BBWA 4YWLA 1PYSB 2NZOA 3NENA 1IBKQ 1CSPA 2JJQA 3GD7A 3GTLH 1HH2P 4DV3Q 4P72A 2B63H 2Q2IA 4LF9L 2VS1A 1M1KC 3KF6A 5C4JH 4IPCA 1VQ6A 3HOUG 4A3KH 2JA7G 3UDFA 4JI1Q 2UUBL 2WP8J 4X65L 3TS0A 4LF8Q 1HNWL 4AQYL 4DR6L 1SR3A 5GAEC 1VQEA 1ASYA 1UEBA 2CWPA 2Y0SG 3CPWA 1PH6A 1SFOH 3CF5A 2JA6H 2R92H 3NELA 2A19A 5IY0A 4TVAB 5M3FH 3I4MG 1E1OA 2JA8H 1JJCB 3L0OA 2ZM6L 1CKOA 3HOWG 4DV6Q 3KF6B 3D31A 4BY7H 1G291 5IYDG 1TWFH 5FLXc 2E2HH 5LMUL 2EXDA 3JAMc 2A8VA 1K9MC 2OTJA 4JI0Q 1IYJB 4P74A 4GKKQ 4L5RC 1KXLA 1YJWA 3RLFA 3LGJA 3ICEA 1U5KA 4C3HH 1PH1A 4A3DH 3PF4A 3RZDH 3S16H 2VNUD 5M3MH 2ZJPA 5HGQA 4B3ML 3J81j 1N33Q 4JI7Q 4BXXH 1C7YA 1C9OA 2VW9A 5IE8A 2YTYA 4P71A 4P73A 1K8AC 2RCNA 2YV5A 2HIVA 4UPAA 1XMQQ 3PO2G 3PF5A 4GN5A 4KI0A 2KCMA 1N8RC 4ME3A 2BA0A 4BY1G 4BA1I 2OQ0A 5GQOA 2KHJA 4A3IH 3KJOA 1JMCA 3S2HH 1K83H 5M5WH 2IHFA 1XPUA 4HJ9A 4LFCL 4YHHL 1GKHA 3GTKH 3DLLA 4DR3Q 1L0WA 3ULJA 3H3VH 3BJUA 4POFA 2Y0SE 4DUZL 2I5LX 1SN8A 5C0XG 5C44H 3KJPA 4LUVA 3BU2A 3CMEA 1NBWA 4A3LG 2GVBA 3JAMi 3HOVH 4OX9L 3S15H 3CAMA 1VQ7A 4OONA 2E2JH 1EQQA 1KQSA 4YWKA 3H0GH 2HHHL 3RR5A 1G6PA 1JE5A 5C4XG 2LSSA 3OTOL 4GNXC 2JE6I 5K36G 1A63A 1I6HH 1P8LA 1IL2A 2F3IA 4A3MG 4QGUA 2UUCQ 3AFPA 3FKIH 2N3SA 3G6EA 1HNZQ 2K4KA 4JBMA 3J81i 1IBLQ 1P16A 1BKBA 1KD1C 2OWOA 1N34Q 5BR8Q 3CP0A 1AH9A 2JA5G 4DV1L 5C3EG 1X6OA 2Z6KA 5IYCH 1N32L 1MJCA 2N78A 1L2FA 3M9BA 3AQQA 4HIDA 1N36Q 1HR0Q 2CCZA 1OXSC 3GTJH 4DR5Q 5IYBG 3CCQA 5IWAQ 3K8AA 4NB3A 2BH2A 2JA6G 4QQBX 2I5MX 1Q12A 5M3FG 2Q2HA 4ALPA 3G48A 4JCVE 4GLVB 4YCWA 5IP7H 3A5UA 4LF5L 3U4ZA 1E3PA 2YYZA 1VQ5A 3UDGA 2E5LL 4K0KQ 4TQUS 3GDEA 1RIPA 4QY7A 4YCVA 1PH9A 1HR0W 4R4IA 1QVFA 3HOYH 3FHWA 3L7ZC 5JJKA 4A3FG 4DR4L 5IP9G 4YY3Q 3RN2A 1D8LA 4LUOA 5FJ8G 2NZHA 2D0PA 2IX1A 2VQFQ 4NXNQ 4DV2Q 2E2IH 1EIFA 3A74A 3HKZG 1CUKA 3E9HA 1EIYB 3I4NH 4A3DG 2B3GA 2F4VQ 3HOXH 4DV7Q 5M3MG 1KIXA 4GN4B 4DAMA 3U58A 4BA2I 3S1QH 3S1RH 4X62L 5HY6A 4C3IH 4GS3A 1KL9A 4QJFA 1VQCA 1VQBA 1VQFA 3MEFA 4FDBA 4PZ6A 5AJ3L 3M3YH 1E24A 3U50C 1K0RA 4B3RL 3M4OH 1IBMQ 1J6QA 1NMFA 1X3FA 3PO3G 4HJAA 3RN5A 4LFBQ 4JI5Q 1V1QA 2GN5A 4LF7L 4GOPC 3M85A 4HIKA 3S17H 2UXBQ 1CSQA 2R93H 3T1YQ 5M5XH 2C35B 2OCEA 3CCRA 1H95A 1XMOL 3J80i 4OWXB 4X66Q 3CW2C 4DR7L 3ULLA 2EIFA 1Y1WH 2AHOB 3TRZA 1EQRA 2VQEL 4DR2Q 3PGZA 2UU9L 3F2DA 4JI4L 1A62A 4A93G 1JT8A 2R7ZH 4DV5L 2UUAQ 1YEZA 4DR1Q 4NXMQ 4LFAL 2VUMG 3B6YA 3K80C 4JYAL 2NN6I 1ASZA 2YU9H 1GM5A 5GROA 3ERSX 1UE5A 3HKZE 3L2PA 1X9NA 3TEHB 5H1SE 4POGA 1TXYA 1VQ4A 3S24A 2IY5B 1TWHH 4A3EG 4WJ4A 4RG1A 2QA4A 3HFZB 1VQIA 4UP7A 3F2CA 4DV0L 1Q1EA 4P75A 4JI8L 2Q2UA 2UXCQ 2RHSB 5IYCG 4IPDA 4LF6Q 3PV0A 4DUYL 3E9IA 3UDIA 1HNXQ 1EYGA 1MKHA 1NMGA 1Y1VH 4MZ9A 3KDFA 4DKAC 4C3JH 3J7ZC 1YJ9A 1XNQL 1QVCA 3CD6A 3H3VI 1O7IA 4A3BG 1UE1A 4HIOA 2AKWB 4KHZA 4OO1I 3EN2A 2ZTEA 3PUZA 5E7NA 2GVAA 5IP7G 4DV3L 1B8AA 2ZJRA 1IBKL 3SGIA 3UE0A 4QIWE 4X64Q 1WJJA 3TQYA 4JI2Q 1JJGA 2LXJA 4MNOA 1J5EQ 4JI1L 1MIUA 4IO9A 1OXVA 5M5YH 4LF8L 1KC8C 1YZ6A 1VQHA 2AWNA 3KDFB 4QL5A 4A4IA 4IOCA 1Q81C 2JK8A 2VZAA 3RLNA 2FXQA 3W5OA 2K5NA 4BBRH 4HJ7A 5JEAG 2HT1A 3CC4A 1SMXA 3GTQH 3CMAA 2IT1A 2WB1G 4O2DA 2ATWA 1D7QA 4BBSG 2I0QA 2L15A 4L5QA 3W1GA 4JOIA 4DAYB 4DV6L 3KLWA 3IRBA 1VQAA 1PH5A 4C2MH 1XTDA 4JV5Q 1PVOA 4JI0L 1L1OA 1WI5A 2CFMA 4GKKL 4R4QA 2V1CC 1I94Q 5JJIA 3S1NH 1Z47A 3M4QA 1PH2A 2B63G 3T1HQ 4IJHA 1AE2A 1YBYA 2AWOA 3AYHB 2R93G 2JEAI 2JA9A 2JA7H 3GTGH 4A3KG 3CCMA 4LUZA 3CCSA 1N33L 4JI7L 1BVSA 1NTGA 1TWAH 2MO0A 2R7DA 2WAQG 1NJIC 2NVQH 4Y52H 4B3SQ 4LF4Q 2UXDQ 1Z9FA 4B3TQ 1XMQL 1PH7A 3PUYA 1Q86C 4GKJQ 3NBHB 1L1OB 4GLXA 4X64L 2K5HA 1TWGH 2R92G 4JI2L 1NE3A 3I4MH 5JJLA 1HZBA 1WYDA 2Q2TA 3HOWH 3S1MH 2JA8G 1HZCA 4BY7G 1FL0A 4AH6A 5IYDH 5GADC 2F52A 4DV4Q 2ALYB 4KLKA 1QZHA 5LMNQ 4A3GH 4DR3L 4L5TA 4WJ3M 1I5FA 1K73C 2N49A 4MTNA 1PH4A
chains in the Genus database with same CATH superfamily
2KOLA 3SK4A 1G2SA 1F9QA 3V2TA 4C3HG 3CCJA 2JA7B 3GTGB 4YWMA 2HQLA 2BE5C 4UAIA 2H4OA 1HNWQ 3I3CA 2OEOA 2MP1A 3K59A 4A75A 3GTJB 3OWFA 3A8KE 3W1BA 1HNZL 1HZAA 2XGTA 1I4HA 1N34L 3I90A 1OXTA 1UE6A 2KHSA 4LJZC 5CV8A 4PZ7A 1U9RA 4DK6C 4K2LA 1D6EC 2PI2A 3S2DH 1LUZA 1GUSA 2G9DA 3BZCA 1JJ2A 3K5MA 3I4NB 2B2WA 3ND8A 3I7FA 3MWYW 1I3QB 2Q8RE 4DA2A 2MQHA 1FNUA 5C4XH 5K36H 1STGA 1WOCA 2CKZB 2E2DC 5CV7A 1VQKA 4V190 5D14A 4A3MH 4GOPB 3M3YB 3PO2B 4CJ0B 2B29A 1OXUA 1SYEA 5C5LA 4NXNL 4A3JH 4IPGA 1UE7A 4DV7L 2N8NA 3ULPA 1PHJA 3A5ZB 1XJVA 2Q8TA 1C0AA 1HTLD 1X54A 1DCZA 1X32A 4YHHQ 4HEDA 1EFWA 2IL8A 1AE3A 1WTOA 1LTBD 1EWIA 4KJNA 4XXEA 2K03A 2JXMB 4DUZQ 3RZOB 1Y1WB 1L0YB 4YCUA 5JOBA 1A8VA 2HHHQ 1F2MA 3MXPA 3OTOQ 2ICEC 1QUQA 3T1YL 3M4PA 4OXPA 1TWHB 3MXNB 4NPSA 3CC7A 3NWTA 1SE4A 1D2BA 3AB9A 1LLRD 2J7ZA 2IX0A 1AN8A 3TMEA 1QCBD 1U0LA 1ZEQX 1EUJA 1O7LA 3I70A 4JBKA 4AYBG 4KKUA 3J81E 1VCIA 3PO3H 5FKAC 4FXKC 4NW2A 1H9RA 2E5LQ 3KOJA 1WFQA 1KHIA 1X65A 3T4AC 2CWAA 4DK1A 3CCLA 1GJXA 1ILQA 5C5MA 1B3AA 3EFXD 2HDLA 4CBVA 1VQJA 3NTKA 1LTGD 2VL6A 4GNXB 1T5XD 1QVGA 3MEHA 2ASBA 2KCTA 3G71A 1EY7A 2CHBD 2EQSA 3KLRA 5AJ3Q 3R2TA 4JI6Q 4A3JG 4CKBA 1ZXTA 4B3RQ 4A3EH 2PNRC 1PRTF 3Q8DA 2F0QA 4LF7Q 4APVA 3TP5A 1LT5D 1GD7A 5D3DA 3M7NA 2KHIA 5CBEE 1Y1VG 1YHBA 1B50A 3WWVA 1X3GA 3A0JA 2Y0SB 1I94L 3SVMA 3VR4A 5JVG3 3QJYA 5IGBA 1GHJA 1D5MC 2B2YC 2RCFA 4KHVA 4LFAQ 1EU3A 3G4SA 4HIMA 4HJ5A 4FF3A 2RQXA 3PIPA 4DV0Q 2XWJB 5C0XH 3OSOA 4A3LH 4JI8Q 1C8CA 3BDLA 1EOTA 2DUDA 1YNXA 4A3GG 4JI6L 2KECA 4L63B 3K0XA 3K81C 4YWLA 2NZOA 1CT1D 4P72A 2B63H 2VS1A 1WD0A 4IPCA 5E4XA 3UDFA 4JI1Q 4DXFA 5GAEC 1VQEA 4NDXA 4X3KA 1GUOA 2CWPA 2EYHA 3CPWA 3URYA 1SFOH 2EY1A 2R92H 3NELA 1PTOF 2X6GA 1E1OA 2EYFA 3HOWG 1NCVA 3KF6B 3D31A 5C4XB 5IYDG 4NKLA 5FLXc 2MHVA 3JAMc 4A3MB 2OTJA 4JI0Q 1ILPA 3TP7A 3ICEA 1KLUD 3RZDH 2VNUD 4Q5VA 1TR5A 1A3UA 2XRSD 1SYDA 2B8FA 3J81j 4JI7Q 3QOLA 4BXXH 4BWGB 2KEDA 1ESRA 1WTWA 4F8MA 1K8AC 2RCNA 2HIVA 1XMQQ 3NXWA 4HCSA 1O7ZA 1N8RC 4OIKA 1PRTD 2Z8LA 2CW0C 3N52A 4BA1I 5GQOA 2F0JA 1BQQT 2IHFA 4RCNA 4LFCL 1XXGA 1ZYRC 5CYUA 3GTKH 1G8ZD 1A3TA 1L0WA 4OGQC 3H3VH 3BJUA 4POFA 2Y0SE 4PMBA 1SN8A 5C0XG 3L3OC 4A3LG 3HKZB 1NBWA 4OO1H 3HOVH 2L12A 4N8X1 3FDTA 1EQQA 1K28A 2IX3A 2LSSA 4GNXC 1A63A 4IUVA 3T51B 2B2UC 2F3IA 2UUCQ 3G6EA 3FPUB 1BCPF 4H0LC 1KD1C 2I46A 2KCCA 4A3IB 1VMPA 5BR8Q 4DV1L 4FXDA 5J1ZA 2Z6KA 4KD4A 4DNRB 5IYCH 1L2FA 4HIDA 1N36Q 1HR0Q 2CCZA 4RWSC 4DR5Q 3MZ5A 5DAUA 3CCQA 4NB3A 5ELBA 1Q12A 1DYQA 3G48A 4JCVE 1ENCA 3A5UA 1A2TA 1E3PA 2FINB 1RIPA 5EJWA 1I6HB 3FEWX 1VMCA 4V0BA 4DR4L 5IP9G 4YY3Q 2BDOA 3RN2A 2RSNA 1AP0A 1EIYB 4A3EB 3E9HA 1STAA 1PTOD 1KIXA 3S1QH 2A5HA 1ONLA 3S1RH 4X62L 2MUYA 4OL7A 5E3FA 1VQFA 1Y69U 1LT6D 1VF5C 3LWUA 1KTKA 4XQJA 1J6QA 1NMFA 2CVRA 1MSHA 4LFBQ 1JR0D 1L0XB 4JI5Q 1V1QA 3G7LA 3DWQA 3PIP3 4GZYC 1LTRD 1B53A 3S17H 3HEJA 5M5XH 5IT9L 4U68A 4G7ZC 3ITPA 1CA6A 3J80L 4X66Q 4IFDH 3CW2C 1QOHA 3ULLA 5LHY1 2EIFA 2K05A 4KKSA 2A73B 4DR2Q 1EY0A 2B2VA 2UU9L 4EVOA 4JI4L 4C3IB 2R7ZH 4K6LA 1XWEA 4DR1Q 4NXMQ 3K80C 1DJRD 3BG3A 1DXMA 5GROA 3ERSX 1TT2A 3HKZE 2XRQD 3F2CA 2B63B 1Q1EA 4P75A 2Q2UA 2UXCQ 5IYCG 2R93B 3NWSA 4DUYL 3E9IA 4DU9A 5M9OA 2YU9H 1MKHA 4DKAC 1BBXC 3KDFA 1XNQL 2WAQB 5ELEA 5FO9B 5EKIA 1O7IA 4OEMB 2XWBB 2OT2A 5COYA 4DV3L 5L37A 1BCPD 1EY5A 2F0HA 1SFOB 2R92B 5HURA 4DAYA 4X64Q 3NQIA 3HZXA 5I6WA 4MNOA 1J5EQ 1MIUA 4IO9A 4LF8L 1ICWA 2F1MA 1VQHA 2RDGA 1BF4A 2VZAA 1ZKOA 2FXQA 4ZLTF 5JEAG 3GQBA 4KY5A 1H9KA 1SEBD 4HSVA 3RZDB 2JSOA 2L15A 4L5QA 3X3NA 4EQOA 1JE4A 1XTDA 2ENBA 4JV5Q 4LK1C 2DY7A 3T1HQ 3E5SA 1AE2A 3E6ZX 2JA7H 3GTGH 1DD2A 4A3KG 5JPMC 2PMZB 4LUZA 4CDEC 4CKCA 3VR6A 3GTKB 3BYTB 1DZ1A 2NTTA 3NBHB 1L1OB 4X64L 3HOVB 1STNA 4PMCA 4ULLA 4G7OC 2A6HC 3QG1A 4BY7G 4AH6A 5GADC 1QZHA 2ALYB 5LMNQ 2PPBC 4DR3L 4WJ3M 1PH4A 3D0FA 4RKLA 1AZPA 3V96A 1X3PA 1SLJA 2NBFA 4JBWA 1QILA 4LF9Q 4IOAA 1QZGA 3IL8A 5JEAJ 3F2BA 5FLMH 2UUBQ 4X65Q 1TWAB 5D3IB 1I3QH 5IODA 2HUGA 1PFSA 4AQYQ 5C4HA 3LWEA 1EQTA 2RF4A 4CHTB 3WOEA 3PO2H 2A69C 1BXTA 1B4OA 1CI3M 3FP9A 2E8GA 5ELOA 3I55A 3I4OA 1VQMA 1U4MA 3OPOA 2QEXA 1PZID 5G3LF 3J80E 2WAQE 2QKIC 4CJ2C 3IAYA 2F0VA 5CC4A 3K58A 4HTHA 5KYLA 1SE3A 1D5ZC 5IWAL 3RZOH 2HCIA 1V43A 3OMCA 2OQKA 4G7HC 2PZUA 3I72A 5ELNA 1XPOA 2FHTA 3S1QB 5ISRA 3NP8A 3S1RB 2R7FA 4UY8C 1TY0A 3H0GG 1EY6A 1E1TA 4ZUIA 3PUVA 1QE6A 3VDYA 3FKIG 3CCVA 3TDQA 2K5VA 5F2DA 5DLQE 1Q8KA 4DV2L 2NTSA 4NP5A 2Z4IA 2F4VL 1R4PB 2R6GA 2JA5H 1PTOH 1VQ9A 4L8JA 1PYBA 2ZTDA 1S3OA 1BOSA 2ID0A 5M5XB 2OXPA 4IQZA 4PG3A 4KN7C 3A55A 1BDOA 4IPHA 3CU7A 1HZ9A 1E0BA 1I4GA 1KDBA 1TS5A 4LMQD 5DEHA 2A6EC 4KY6A 1S40A 4R8NA 2PMZE 3SR1A 2X6LA 2R7ZB 1SRUA 2JP1A 4A3FH 2UXBL 2NVXH 3PIOA 4QF4A 3F8TA 5CGKA 2WKDA 3KF8A 1JC7A 1HTPA 3I4NG 1E22A 1EOVA 1UUPA 4RMFA 3Q23A 5FLMG 3D8GA 2F0IA 3J81c 5GAGC 1N32Q 2FMMA 2MFIA 2YU9B 3HGBA 5FOBB 1X56A 1FD7D 2JEBI 3EJIA 4YIJA 5C3XA 5TSSA 1EYDA 1QUQB 4ZKBB 2R61A 4A3CH 1UWVA 3PUXA 4LF5Q 3S14B 3RNUA 5KNDA 3M4YA 1YVCA 2EY6A 2NZ1D 4KHPQ 3LX0A 3HOZB 4MN3A 3OMGA 1CKMA 1Y1WG 4GN3B 4I7AA 4JOIC 5FO8B 1PV4A 3H3VC 4A93H 2K01A 5G3LD 1Q1BA 4IURA 1L1OC 2K52A 5C4ZA 2Q8IB 2C9OA 2VUMH 1VQDA 4UHVA 1OTCA 3TS2A 3CPFA 2A1AA 1IXRA 4OWTB 2JQOA 4K6DA 2VY3A 3DWPA 1VQGA 5IOCA 1A0IA 2RHQB 1PA6A 4DAVA 2EYLA 4PQXA 3OOCA 2KEEA 1JOQA 4G57A 1Q90A 1SYGA 5C0XI 4R4OA 1WTPA 2PI2E 3ER0A 4K8JA 1WD1A 3CQZB 2VQEQ 1B3QA 2VB2X 4DV5Q 1PRTB 3KLSA 1ML0D 4K2KA 2I5HA 2QGQA 4QB4A 1CTMA 5I9PA 4KHPL 2H5XA 1LV9A 1Z7TA 2OTLA 1RD9D 3TREA 4B3SL 4LF4L 2DJGC 3BVMA 3I56A 1H9SA 3H15A 1RCVD 2BCOA 1WTVA 1B2TA 4R4CA 2AUJD 4HCEA 4GKJL 1T9HA 1IKMA 1GHKA 3AEVA 4KY7A 4WJWA 1PZJD 1W6KA 3HKSA 1VQNA 4IUNA 5ELDA 4A3BB 1X55A 4LWCA 2L0CA 3U4VA 4A3CG 1I50H 4IUQA 3GTOB 3NENA 3E3XA 4EQPA 3GD7A 2BDNA 2QF7A 1AZQA 2Q2IA 2K5QA 1M1KC 2RBMA 1VQ6A 3Q6SA 3I73A 2WP8J 3TS0A 1HNWL 2XN9C 2IJ0A 2B2WC 3DEOA 1SR3A 1ASYA 1UEBA 2C5CA 2MGSA 2Y0SG 4HR7B 5JJZA 4U673 5IY0A 2JA8H 1JJCB 3L0OA 3SK6A 1CKOA 1LT3D 4DV6Q 2WIIB 1RTNA 1G291 1EYAA 4WFN3 2A8VA 3J7YW 4P74A 1KXLA 4RFBA 1S5BD 1SJHD 5IIFA 1U5KA 1PMRA 3FMCA 3MFGA 4L6TB 2JA5B 2ZJPA 1PTOB 1RDPD 1N33Q 1I6VC 3QO2A 4J6HA 4J1MA 2YTYA 5IGCA 2QCPX 3PIO3 4UPAA 2ICIA 2JA6B 3CHBD 4ME3A 2BA0A 4S3SA 4PNYA 4FF1A 2TSSA 1YNND 2DN8A 2L1BA 4A3IH 5M5WH 3A7AB 4A3FB 2NVXB 4YHHL 1NNXA 1GKHA 3DLLA 3NTIA 4H7BA 3ULJA 5EKLA 1SSOA 4DUZL 4CDFC 2GA4B 4C3HB 5C44H 2PW5A 3BU2A 5KNBA 4A3DB 1HRJA 3JAMi 1QNKA 3F2UA 3I8ZA 4KKTA 5M3MB 2E2JH 4N9TA 4DF7A 2HHHL 1JE5A 5C4XG 3OTOL 5K36G 1I6HH 2WACA 4A3MG 5IGFA 3TBIB 2EJFC 2K4KA 3VYRA 1LTID 1LO5D 3OIQA 4KJOA 1IBLQ 2WKCA 2F0MA 2B2TA 4X3UA 3CP0A 4QUFA 2EDGA 2KA7A 1LTTD 1MJCA 1NSNS 5C3WA 1ICFB 3M9BA 1PFNA 2F03A 1OXSC 3A54A 4RGTA 1CZGA 3K8AA 1CQVA 2I5MX 2XNAC 4ALPA 1G2TA 1VF7A 2YYZA 2PYKA 1BCPB 2E5LL 4A93B 4K0KQ 3SEBA 1HR0W 4QY7A 3HOYH 3FHWA 1U4PA 2F0PA 3L7ZC 5JJKA 3FVQA 5ELCA 2VUMB 1D8LA 1Q8IA 2B2YA 2NZHA 1STHA 2EY5A 2IX1A 4RHSA 2VQFQ 1KDAA 3HKZG 3A74A 2PCFB 2XVSA 3HOXH 4GN4B 1A3VA 4XDXA 4C3IH 1FR3A 4GS3A 1KL9A 4QJFA 4RGOS 1VQCA 3MEFA 5AJ3L 4PZ6A 1E24A 3U50C 1SE2A 1W6JA 2E76C 4B3RL 2K32A 1IBMQ 3PO3G 3EQLC 2GN5A 4LF7L 4GOPC 4ID6A 3GV6A 1M8AA 1CQFA 3M85A 3J7AF 4O42A 1ET9A 2R93H 3CCRA 4RAUC 2ZXPA 3J80i 3H91A 1RKNA 2SNSA 4QCLA 1IHZA 2JYOA 3TRZA 1EQRA 1O7YA 5BN4A 3NSWA 3DMUA 1IL8A 2WB1B 2UUAQ 5EBDA 1FYCA 4LFAL 4AYBB 2AQ1B 2F0LA 1GM5A 3L2PA 1I50B 3TEHB 3M4OB 1TXYA 4A3EG 1S5CD 4WJ4A 5A35A 4UP7A 4DV0L 3TN2A 1M4VA 2OF1A 4JI8L 4LF6Q 4IPDA 2PZTA 4ZKCB 5IGEA 3UDIA 1HNXQ 1WVLA 4MZ9A 3FPPA 3T56B 4TKOB 1HQMC 3T13A 4C3JH 4ME5A 1C4QA 3K5OA 1PTOC 4HIOA 2PW7A 4ZRZA 3BYYB 4C1NI 4RHRA 5E7NA 4CDCC 1B8AA 2A68D 2K04A 3SGIA 4FXGC 1JJGA 2JA8B 4ILWA 2FMCA 4JI1L 1DONA 1OXVA 1YZ6A 3MFYA 2MJ8A 2ZT9C 1SJED 3KDFB 4IOCA 1Q81C 1NAPA 2JK8A 3MC0B 3RLNA 3W5OA 4BBRH 3QOJA 2HT1A 1SMXA 3GTQH 5FLXL 4C3IG 3CMAA 2IT1A 3JAML 3UI2A 2I0QA 5J39A 3W1GA 4DAYB 3KLWA 1JORA 3PMFA 3TP6A 3K57A 4BS9A 4JI0L 1D1KA 1WI5A 2B2UA 2CFMA 4R4QA 4ABNA 2R3ZA 1Z47A 3I4LA 1PH2A 1SAPA 2B63G 2AWOA 4DGZA 2R93G 2JA9A 3E0JA 3CCSA 5M5WB 4JI7L 2WAQG 4KTAA 1TWAH 1JWUD 2L9HA 1NJIC 2UXDQ 1PXUA 1QNUA 5EKKA 1SXTA 4B3TQ 1G91A 1HFGA 2TMPA 1TS2A 1XMQL 5C44B 2K6AA 2K5HA 2R92G 3I4MH 1B9MA 4A3GB 2Q2TA 3S1MH 2E2JB 2F0NA 5ELFA 4C2MB 1MSGA 1HZCA 1FL0A 1K0SA 1BCPC 2F52A 3D4DA 2N49A 2K33A 3NQTA 2Z4HA 2BOSA 3VYTA 2WB1E 1Q7YC 2NUCA 5C0XJ 4UP9A 5LMNW 4AYBE 4HJ8A 2AQ3B 2D62A 4J8QA 2KJXA 3PUWA 4DK3C 4BXXG 2PQEA 1MJEA 1IZ6A 4DR6Q 4QMGA 5KEEA 3C1FA 1NY4A 2UUCL 3T16A 3R2IA 1OO9B 4OWWB 3X3MA 2FFKB 3EBEA 1TWGB 1PLFA 1Q82C 5BR8L 2ZM6Q 3HOYB 2L11A 4TSSA 5LMUQ 2XTIA 1N36L 2MO1A 1EY4A 4C1NK 1JB7A 1HR0L 2EYPA 3R8BA 1ET6A 1X3EA 4DR5L 1YIJA 5KIXA 1GUGA 3WDNA 1CKNA 2F0SA 1Q46A 3PSIA 4OO1G 3HOVG 5JVH3 3HOXB 1KRSA 1GOZA 3UDXA 2QDBA 4EX5A 4B3MQ 3KFUA 5EAYA 4YY3L 2KQ3A 4A76A 1GUWA 3KYHC 1VQLA 1RL2A 1S5FD 1JB3A 1AEXA 2CH4W 5C3EH 1CA5A 2CQOA 2H1EA 4XYOA 1G6ZA 3A8IE 4MIUA 1DGSA 2B2VC 1WCMB 5IYBH 5J3BA 4AIMA 4OX9Q 4L5SA 4LFBL 3BZKA 1CHPD 4JI5L 2LS01 3S14H 3AFQA 4JBJA 1YHAA 4DAPA 2F0KA 5FJ8H 5I2XA 1STEA 1EZ8A 2D9UA 1LTLA 3C46A 3ONAB 2AMCB 1TWCH 3O13A 2X69A 4X66L 5FLXE 1PH3A 3CCEA 2PQAA 3JAME 5A2QL 2BA1A 3BZDB 2BH8A 3MXGA 3HOZH 1SMYD 2O2LD 3OWEB 4B9XA 4DR2L 4IJLA 4UP8A 2D0OA 3MA2B 3F1ZA 3M7GA 4X3TA 4ZAIA 4JI3Q 4DR1L 4NXML 2K5DA 2RKSA 1CZWA 4C3JB 2Z0SA 4DNIA 4F87A 3ZJYC 3MXUA 2I07B 2ZTCA 2WFWA 3KF8B 2F0WA 5T1GA 2EYMA 1ESFA 1KNEA 2UXCL 1JOOA 2P5ZX 4RA8A 1O80A 3GTMB 1F9SA 3K7AB 5CV4A 1EYCA 4IFDG 3STBD 5CV9A 5EGTA 1Q3LA 2K75A 3CQZH 4BBRB 1W2BA 3GTQB 3K0YA 1LTAD 2R7ZG 2N55A 4KV6A 1YI2A 1J5EL 1KAWA 5I4DA 4JK1C 1VS0A 1VQ8A 3LNNA 1VQPA 2LY7A 1FVIA 4IUUA 4JI3L 2K14A 1YJNA 4FF4A 3HOUB 2QILA 1XMOQ 5CV5A 4A3BH 1VQOA 1K8GA 4DR7Q 4JV5L 4Q0FA 3GTOH 2MNAA 3T1HL 2RDHA 3I4MB 3KLSX 3S1MB 2LXKA 1EEFD 5IT9E 3UE1A 4JYAQ 1EIGA 3ZYYX 3J7A5 1Y14B 1R4QB 1DOLA 1ENFA 3HOZG 3VR5A 1E7ZA 3CRKC 4IFDJ 1XPRA 2Z6BA 1HHVA 1SNPA 3MTSA 5FO7B 2QW7A 4Y7NH 4BBSH 1STBA 3HRZC 1TS4A 3SXHA 3CCUA 5LMNL 1N9WA 4PZ8A 4DNTB 5JAVA 2EOTA 2JJQA 1IBKQ 3GTLH 1HFNA 2A74C 4LF9L 4BY1B 1H9SB 5C4JH 5NUCA 2JA7G 5CBAE 4ZQ3A 2UUBL 1D1IA 4X65L 2O5IC 2VXWA 1NR4A 4AQYL 3U9SA 3VYUA 4HAEA 4XQQA 2K28A 3W2DA 1PH6A 1JOKA 3CF5A 2JA6H 3I91A 2A19A 4XT1B 3S9WA 2EYOA 3IFTA 5A2QE 1EL0A 2EXDA 2EXZA 1TQOA 4GKKQ 2ZXOA 4C3HH 1PH1A 3DWAA 4HMJA 1MHWC 2XIWA 3PF4A 4A3DH 5M3MH 5HGQA 5C3EB 4N8FA 5EPKA 1C7YA 1C9OA 1FNWA 2VW9A 3D4RA 2KVMA 2YV5A 4FYDA 3PO2G 3PF5A 4GN5A 4KI0A 5M3FB 2EVBA 1JWSD 4IALA 4FF2A 4E6IA 2OQ0A 2NB0A 3KJOA 3S2HH 1K83H 2E2HB 1XPUA 1EWHA 1H9JA 3H6MA 1IYVA 1TWCB 3V05A 2I5LX 4EQNA 3CMEA 1EU4A 1A6XA 4CDDC 2GVBA 1IW7D 4QUCA 1VQ7A 4OONA 1KQSA 4YWKA 3QIAA 3RR5A 3CRLC 2JE6I 4R9WA 4LAAA 1IL2A 3P75A 1QJOA 4QGUA 4C56C 1HNZQ 3J81L 3Q0AA 1BKBA 3H94A 2OWOA 1N34Q 3ERQA 2EJGC 1QG7A 1AH9A 2JA5G 2PO4A 1X6OA 1N32L 1Z6HA 2F3WA 2F0DA 3Q22A 1GUTA 5EBCA 1IYUA 3OW7A 3TZUA 5K5PA 4N9PA 2BH2A 3A8JE 3DM1A 4F7XA 2JA6G 3S15B 4QQBX 1Y8OB 2Q2HA 1YNJD 2L5TA 4HMIA 4GLVB 4YCWA 4LF5L 3U4ZA 1VQ5A 3UDGA 4P2CB 3GDEA 5DNFA 4FO2A 2WV6D 1F77A 4A3FG 1LTSD 2EZVA 3HG9A 4LUOA 4RGMA 5C6AA 4RCOA 3T53B 2F0OA 1YNNC 4NXNQ 2M2LA 1EIFA 1S5ED 5EPLA 1CUKA 4A3DG 3KBXA 4DV7Q 3D4WA 5M3MG 4I7ZC 3U58A 2A6ED 5HY6A 1KAAA 3A7LA 3DEPA 1LT4D 2Z1CA 4FDBA 5I6YA 3M4OH 4JVZA 3BDOA 3A56A 1EZ6A 4HIKA 1A2UA 1CSQA 3U9OA 3CKIB 1KNAA 3T1YQ 2LFNA 2OCEA 5EQ0A 1PFMA 4EGVA 3H09A 1H95A 4OWXB 2E2IB 1E2VA 2AHOB 2VQEL 1WTRA 1LABA 4IUPA 4A93G 4ZYSA 4Y7NB 1JT8A 4DV5L 4BBSB 1HPCA 2VUMG 1S4ZA 3QB3A 4B9WA 1X9NA 3IKJA 5H1SE 4POGA 2IY5B 1DOKA 4RG1A 2QA4A 3GTLB 1S5DD 1F9RA 5C4JB 5EPJA 3TP8A 3PV0A 3R3OA 3TSSA 1EYGA 1Y1VH 1NMGA 3J7ZC 1YJ9A 3H3VI 1DM0B 1QVCA 2AKWB 4OO1I 4KD3A 2ZTEA 3PUZA 2GVAA 2NN6H 2ZJRA 1MD2D 3C2PA 5LL6X 2F3VA 1MGSA 3RMHA 2DY8A 1TU2B 3TQYA 2CH4A 1UAPA 1SNOA 3NTHA 1PDQA 4H44C 1KC8C 3VR2A 1V1OA 2BE5D 5E4WC 4A4IA 2HCCA 2O5JC 1F2YA 3SK5A 3MVVA 2DNEA 2J4XA 3CC4A 2EJMA 2F4IA 2WB1G 2ATWA 1D7QA 1CK1A 1PZKD 4A3GH 3NHHA 5BN3A 3K5NA 4DV6L 1PH5A 3IRBA 4C2MH 2G5DA 1PVOA 2EYJA 2M00A 2V1CC 1I94Q 1F9PA 3S1NH 3M4QA 4KMUC 4IJHA 4UDUC 1F2ZA 2WINB 5M5YB 1V8QA 1EFID 1K8MA 3S2HB 1K83B 1V1PA 1N33L 2AUKA 4Y52H 2R7DA 1WTXA 1HA5A 1PH7A 3PUYA 2QDLA 1TWGH 5JJLA 1HA6A 1NE3A 1SYCA 3HOWH 2JA8G 1PYWD 1D5XC 3DHQA 3L9AX 3NUCA 5JPNC 3KBGA 5IYDH 4Z9CB 2A68C 4DV4Q 4FVMA 3NBIA 4H13C 2B2TC 1I5FA 1K73C 3D6CA 4MTNA 1PRTC 4WRDA 3GTPH 3GO5A 3QR8A 4J15A 2YTVA 2NVQB 2J0TD 1H9MA 2RVLA 3OYYA 2EPBA 1XNRQ 4IFDI 1I4PA 1R9TH 1SROA 4GLAC 1XX8A 4O0AA 2F0EA 2NN6G 2YTXA 1JICA 1IBLL 4A3IG 2MPMA 3DM3A 4GOPA 1JWMD 1UEAB 1B9NA 1LM0A 2E75C 1FJGQ 2PNHA 3KUPA 1BBUA 2HDMA 1JCKB 1MBYA 2D5DA 1TS3A 3CXCA 1WCMH 1SNMA 5C44G 3OW2A 1V9PA 4R4TA 4K0KL 5DM73 4DV4L 4DN4M 1I4RA 4K5WA 3J7AV 2VQFL 4DXGA 1RTOA 3RLOA 1CKNB 1GO3E 1SYBA 1TY2A 1GVPA 3DXJC 1XNRL 5D65A 4JW0A 4LFCQ 4DFAA 1PH8A 1B7YB 3QWNA 3S2DB 3GP7A 3MXNA 4DK0A 4R1JA 3RUZA 3CC2A 4MTKA 4MHEA 1IBML 1WTQA 1OXXK 3RD4A 1SE8A 2F0UA 2DGYA 2FJ2A 3HOYG 5IP9H 1FJGL 1G51A 1S72A 3GTMH 3K7AH 1JQYD 4A3JB 5HGTA 1K3RA 3HOXG 2IWHA 4EQ5A 4DV1Q 4X6AH 2UUAL 1WTHA 1HJPA 3FRPB 1Y1VB 4F88A 1TIID 1FGUA 5GAHC 1YHQA 5DM63 1B70B 4GNXA 2IHEA 3SK8A 5J22A 3EIVA 1QWYA 2F0FA 2NYZD 2PQAB 4IZ8A 2Z9HA 3HP3A 4LF6L 2HIXA 1EEID 3HOUH 4DR4Q 4FNFA 3P1HA 1HNXL 1SBBB 4XTCS 4WORA 3PCOB 4G4KA 2KBNA 1WCMG 4LNQA 4CGYB 1EQVA 5IGDA 4JC0A 2K50A 5BN5A 2O4XA 4X62Q 1KRTA 1EWCA 2IPKD 4OELB 1I4XA 5E1FA 1KLGD 1KABA 2ES2A 3PO3B 1CFMA 3C1EA 3S1NB 3BVGA 1U4LA 1J9OA 2Z6KC 3JC66 2L55A 1LYLA 4C3JG 1BO0A 1SMYC 2F0TA 1W3SA 3NEMA 5I9OA 1PFBA 4DPGA 3I2ZA 2RSOA 2ZJQA 2HQEA 4JG2A 5IT9c 1I4QA 1E2WA 2UU9Q 3J80c 4JI4Q 4H02A 4BY1H 4PMWA 3HOWB 1HCZA 2NVYH 1A15A 3E0EA 2NVTH 2UXDL 2XSCA 2RA4A 3K7UC 4B3TL 4XIGS 3GTPB 5JEAH 1RF2D 4BBRG 1RJTA 1XTCD 2B39A 3OHXC 5KYIA 4DUYQ 4M8AA 4CKEA 4K5VA 2KENA 1XNQQ 3STBC 4LW1A 2CW0D 1YITA 5AFWA 1M90C 1R9TB 1BBWA 3IFDA 1PYSB 1GUNA 4XQNA 1CSPA 3P7JA 1HH2P 4DV3Q 3VR3A 1ZYRD 1STYA 4B08A 3KF6A 2QEJC 3HOUG 3Q24A 4A3KH 4RKBA 4X3SA 4LF8Q 1C48A 3SDZA 2F0GA 4DR6L 3G6JB 2V4DA 3EA6A 1SNQA 1HXYD 1NUCA 3NE5B 4ZUJA 1CHQD 1O78A 1B1ZA 5M3FH 4TVAB 2RDFA 5FK9C 3I4MG 2K1BA 2SEBD 4I65A 2ZM6L 4BY7H 1CM9A 1TWFH 3MHBA 2E2HH 5LMUL 1K9MC 1IYJB 4L5RC 1YJWA 1B44D 2LKVA 3RLFA 3LGJA 4HN7A 3K5LA 5CV6A 2NWGA 3S16H 4B3ML 3N6RA 1FGBD 1ENAA 5IE8A 1KDCA 4P71A 4P73A 4FP5D 2G9HD 2SOBA 1E2ZA 1TKWB 2KCMA 1Y8PB 5T1IA 4BY1G 5CR3A 4PV1C 2KCNA 2KHJA 1JMCA 5IGGA 4HJ9A 1SNDA 4DR3Q 1IKLA 1K3BC 1AFPA 3SHLA 3KJPA 4LUVA 4RGNA 2M9VA 2PZWA 4OX9L 3S15H 1AW7A 3CAMA 3H0GH 1G6PA 2VB3X 1P8LA 4CJ1B 1XYIA 3AFPA 3FKIH 2N3SA 4RH6A 2DJFC 4JBMA 1DOMA 2K5WA 1VDZA 3J81i 1P16A 2N88A 3BDCA 3HS0C 3KK7A 2IW3A 5C3EG 3PQIA 4QIWB 2N78A 3P20A 2JN4A 3AQQA 3WOFA 3GTJH 5IYBG 5IWAQ 5M3FG 3W3AA 1GXDC 2EE1A 5IP7H 4TQUS 4ODGA 1PH9A 4YCVA 3R93A 4R4IA 4K14A 1QVFA 5CORA 5FJ8G 2D0PA 4IUTA 4JPBW 3EROA 3VA7A 1NR2A 4NMZA 3TZDA 2E74C 4DV2Q 2E2IH 3I4NH 1BUVT 3D3RA 2B3GA 2F4VQ 2B8GA 4DAMA 4BA2I 1II3A 1FNVA 5I2YA 1EY8A 1VQBA 3M3YH 1IW7C 4OHJA 5LL6S 1K0RA 1HUMA 1X3FA 4HJAA 1SNCA 2HD3A 3RN5A 1LACA 4XT3B 2UXBQ 4KN4C 2CQAA 3MAQA 5KRUA 2C35B 2NVYB 1XMOL 2NVTB 1F2LA 1UNSA 4DR7L 1K8OA 1Y1WH 5KNCA 3PGZA 3C3LA 3F2DA 1RODA 1A62A 2DNCA 3VA5A 5CMDA 1YEZA 3B6YA 1TVXA 4JYAL 2AQ2B 2NN6I 1ASZA 1YNJC 1UE5A 4O1NA 1VQ4A 3DUZA 3EVQA 3S24A 1TWHH 1EIHA 3HFZB 2LMCB 1VQIA 3S17B 2RHSB 4A3KB 3BVZA 3OIPA 1EY9A 4KK7A 2EY2A 3AU7A 3CD6A 1HQRD 3NK9A 4A3BG 1UE1A 4OIJA 4KHZA 3EN2A 1BR9A 2A6HD 1IBKL 5IP7G 1QB5D 3UE0A 3ND9A 4K5XA 4QIWE 1WJJA 4JI2Q 2LXJA 5M5YH 4BY7B 2L4NA 1Y8NB 1TWFB 2AWNA 4HSPA 3K6OA 4QL5A 4XYQA 3GV3A 2K5NA 4HJ7A 4ZK9B 1HUNA 1T5EA 1SYFA 1X3QA 1SDFA 4O2DA 1BNZA 3S16B 2A69D 3BS1A 4BBSG 3AMUA 2K7VA 4JOIA 1VQAA 4ZCKA 3NPPA 4K8IA 5KGUA 3NBHA 1L1OA 4GKKL 5JJIA 1YBYA 3AYHB 2D2CC 2JEAI 3CCMA 4M1UB 1MI2A 2NVQH 1BVSA 1NTGA 2MO0A 1J8IA 1U4RA 4B3SQ 4LF4Q 3D6WA 1Z9FA 1Q86C 4GKJQ 2ZXRA 4GLXA 4R8IA 4JI2L 2KUMA 1HZBA 1WYDA 2SNMA 4TRDA 3H0GB 3VYSA 3SE0A 4KLKA 4L5TA 1V1PB 2SDFA 4IN3A 3FKIB 1RHPA
chains in the Genus database with same CATH topology
3D0FA 3GTPH 3GO5A 4LF9Q 1SLJA 2WB1E 4JBWA 3CCJA 1Q7YC 4IOAA 4YWMA 4J15A 1QZGA 5JEAJ 5C0XJ 3F2BA 2HQLA 2YTVA 4UP9A 4AYBE 5LMNW 5FLMH 2UUBQ 4HJ8A 2D62A 4X65Q 1I3QH 3PUWA 3OYYA 4DK3C 1HNWQ 4BXXG 1XNRQ 4IFDI 1PFSA 4AQYQ 1MJEA 1IZ6A 1R9TH 4DR6Q 1SROA 4GLAC 2RF4A 1NY4A 4O0AA 4A75A 2UUCL 2NN6G 4OWWB 2YTXA 3PO2H 3W1BA 1HNZL 3FP9A 1HZAA 2XGTA 3EBEA 2E8GA 5ELOA 3I55A 1IBLL 3I4OA 1VQMA 2QEXA 1N34L 1OXTA 1UE6A 1Q82C 5BR8L 2ZM6Q 2WAQE 4A3IG 3DM3A 4GOPA 4PZ7A 4DK6C 1LM0A 5LMUQ 1FJGQ 2PNHA 2XTIA 1N36L 2MO1A 1BBUA 1JB7A 1HR0L 2PI2A 3S2DH 1X3EA 1LUZA 4DR5L 5IWAL 3CXCA 1WCMH 3BZCA 5C44G 1YIJA 1CKNA 1JJ2A 3RZOH 1Q46A 1V43A 2OQKA 3PSIA 3HOVG 4OO1G 3OW2A 5ELNA 1V9PA 1KRSA 3I7FA 1XPOA 3UDXA 4R4TA 2R7FA 4EX5A 4UY8C 4K0KL 2MQHA 4B3MQ 3H0GG 5C4XH 4DV4L 1WOCA 2CKZB 5EAYA 3KFUA 1VQKA 4YY3L 1E1TA 3PUVA 4A76A 4A3MH 4GOPB 3KYHC 3VDYA 3FKIG 3CCVA 1VQLA 2VQFL 2K5VA 2B29A 5DLQE 1OXUA 1Q8KA 4A3JH 1RL2A 4NXNL 4IPGA 4DV2L 1UE7A 2F4VL 4DV7L 2N8NA 2R6GA 3RLOA 1CKNB 1GO3E 3ULPA 2JA5H 1PHJA 5C3EH 1VQ9A 3A5ZB 1XJVA 1GVPA 1C0AA 1X54A 2CQOA 1XNRL 1PYBA 2ZTDA 1S3OA 2ID0A 4YHHQ 4LFCQ 4PG3A 1EFWA 4IPHA 1PH8A 1AE3A 1B7YB 1DGSA 1HZ9A 1EWIA 5IYBH 5J3BA 4DUZQ 4R1JA 4AIMA 3CC2A 4OX9Q 1IBML 1S40A 4L5SA 4LFBL 4YCUA 3BZKA 2PMZE 4JI5L 1A8VA 3S14H 1OXXK 2HHHQ 1SE8A 3AFQA 4JBJA 1YHAA 2DGYA 1SRUA 3OTOQ 3HOYG 2UXBL 4A3FH 5IP9H 1FJGL 1G51A 2NVXH 1QUQA 3T1YL 1S72A 5FJ8H 3M4PA 3PIOA 3GTMH 3K7AH 3F8TA 1LTLA 2AMCB 4OXPA 1TWCH 1PH3A 4X66L 3CCEA 2PQAA 2BA1A 1K3RA 2BH8A 3HOZH 3I4NG 3MXNB 4NPSA 1E22A 1EOVA 3CC7A 4RMFA 3HOXG 4IJLA 5FLMG 4DR2L 4UP8A 2D0OA 4EQ5A 4DV1Q 4X6AH 3F1ZA 3J81c 2UUAL 2IX0A 5GAGC 4JI3Q 1N32Q 2MFIA 1HJPA 1U0LA 4DR1L 4NXML 1X56A 2JEBI 2Z0SA 1FGUA 1EUJA 4DNIA 3ZJYC 4AYBG 5GAHC 4JBKA 1QUQB 1YHQA 1B70B 2ZTCA 2IHEA 1VCIA 2WFWA 4GNXA 4A3CH 1UWVA 3PO3H 3KF8B 3EIVA 3PUXA 4LF5Q 3RNUA 2PQAB 2E5LQ 3KOJA 2UXCL 4LF6L 1WFQA 2HIXA 1KHIA 3HOUH 4DR4Q 1YVCA 1HNXL 1X65A 2CWAA 4XTCS 3CCLA 3PCOB 2KBNA 4KHPQ 1WCMG 4LNQA 4IFDG 1VQJA 1CKMA 3STBD 4JC0A 1Y1WG 4GN3B 4JOIC 2VL6A 2K50A 2K75A 3CQZH 4GNXB 1PV4A 1W2BA 4A93H 4X62Q 1KRTA 1QVGA 2R7ZG 1Q1BA 1L1OC 2K52A 1YI2A 2KCTA 1J5EL 2ASBA 3G71A 2VUMH 1VQDA 2EQSA 5AJ3Q 1KAWA 1OTCA 3TS2A 3CPFA 2A1AA 1IXRA 2ES2A 4JI6Q 4OWTB 4A3JG 1VS0A 4B3RQ 4A3EH 1VQ8A 2JQOA 2VY3A 1VQPA 1VQGA 3Q8DA 1A0IA 2RHQB 1PA6A 4LF7Q 1FVIA 4APVA 1YJNA 4JI3L 2K14A 2Z6KC 1GD7A 3JC66 3M7NA 2KHIA 1Y1VG 1LYLA 1XMOQ 1YHBA 5C0XI 1W3SA 3NEMA 4A3BH 1VQOA 4R4OA 4DPGA 1K8GA 3I2ZA 4DR7Q 4JV5L 2PI2E 2ZJQA 3ER0A 4JG2A 3WWVA 1X3GA 3A0JA 5IT9c 2VQEQ 3GTOH 1I94L 2MNAA 2UU9Q 4JI4Q 3J80c 3T1HL 4H02A 4DV5Q 4BY1H 4PMWA 2LXKA 2I5HA 2QGQA 4LFAQ 3UE1A 2NVYH 4JYAQ 2H5XA 4KHPL 3J7A5 1Y14B 3E0EA 2OTLA 3G4SA 3TREA 2NVTH 4B3SL 4LF4L 2UXDL 4HIMA 3HOZG 3I56A 4HJ5A 3K7UC 1E7ZA 4B3TL 4XIGS 4IFDJ 3H15A 1XPRA 3PIPA 4DV0Q 4R4CA 4GKJL 4BBRG 1T9HA 4JI8Q 4A3LH 3AEVA 4Y7NH 2DUDA 4BBSH 4DUYQ 1YNXA 3HKSA 2KENA 4A3GG 1VQNA 1XNQQ 3STBC 1X55A 4LWCA 4LW1A 3CCUA 4JI6L 3U4VA 1YITA 1M90C 4A3CG 5LMNL 3K0XA 1I50H 1N9WA 3K81C 4PZ8A 1BBWA 4YWLA 1PYSB 2NZOA 3NENA 1IBKQ 1CSPA 2JJQA 3GD7A 3GTLH 1HH2P 4DV3Q 4P72A 2B63H 2Q2IA 4LF9L 2VS1A 1M1KC 3KF6A 5C4JH 4IPCA 1VQ6A 3HOUG 4A3KH 2JA7G 3UDFA 4JI1Q 2UUBL 2WP8J 4X65L 3TS0A 4LF8Q 1HNWL 4AQYL 4DR6L 1SR3A 5GAEC 1VQEA 1ASYA 1UEBA 2CWPA 2Y0SG 3CPWA 1PH6A 1SFOH 3CF5A 2JA6H 2R92H 3NELA 2A19A 5IY0A 4TVAB 5M3FH 3I4MG 1E1OA 2JA8H 1JJCB 3L0OA 2ZM6L 1CKOA 3HOWG 4DV6Q 3KF6B 3D31A 4BY7H 1G291 5IYDG 1TWFH 5FLXc 2E2HH 5LMUL 2EXDA 3JAMc 2A8VA 1K9MC 2OTJA 4JI0Q 1IYJB 4P74A 4GKKQ 4L5RC 1KXLA 1YJWA 3RLFA 3LGJA 3ICEA 1U5KA 4C3HH 1PH1A 4A3DH 3PF4A 3RZDH 3S16H 2VNUD 5M3MH 2ZJPA 5HGQA 4B3ML 3J81j 1N33Q 4JI7Q 4BXXH 1C7YA 1C9OA 2VW9A 5IE8A 2YTYA 4P71A 4P73A 1K8AC 2RCNA 2YV5A 2HIVA 4UPAA 1XMQQ 3PO2G 3PF5A 4GN5A 4KI0A 2KCMA 1N8RC 4ME3A 2BA0A 4BY1G 4BA1I 2OQ0A 5GQOA 2KHJA 4A3IH 3KJOA 1JMCA 3S2HH 1K83H 5M5WH 2IHFA 1XPUA 4HJ9A 4LFCL 4YHHL 1GKHA 3GTKH 3DLLA 4DR3Q 1L0WA 3ULJA 3H3VH 3BJUA 4POFA 2Y0SE 4DUZL 2I5LX 1SN8A 5C0XG 5C44H 3KJPA 4LUVA 3BU2A 3CMEA 1NBWA 4A3LG 2GVBA 3JAMi 3HOVH 4OX9L 3S15H 3CAMA 1VQ7A 4OONA 2E2JH 1EQQA 1KQSA 4YWKA 3H0GH 2HHHL 3RR5A 1G6PA 1JE5A 5C4XG 2LSSA 3OTOL 4GNXC 2JE6I 5K36G 1A63A 1I6HH 1P8LA 1IL2A 2F3IA 4A3MG 4QGUA 2UUCQ 3AFPA 3FKIH 2N3SA 3G6EA 1HNZQ 2K4KA 4JBMA 3J81i 1IBLQ 1P16A 1BKBA 1KD1C 2OWOA 1N34Q 5BR8Q 3CP0A 1AH9A 2JA5G 4DV1L 5C3EG 1X6OA 2Z6KA 5IYCH 1N32L 1MJCA 2N78A 1L2FA 3M9BA 3AQQA 4HIDA 1N36Q 1HR0Q 2CCZA 1OXSC 3GTJH 4DR5Q 5IYBG 3CCQA 5IWAQ 3K8AA 4NB3A 2BH2A 2JA6G 4QQBX 2I5MX 1Q12A 5M3FG 2Q2HA 4ALPA 3G48A 4JCVE 4GLVB 4YCWA 5IP7H 3A5UA 4LF5L 3U4ZA 1E3PA 2YYZA 1VQ5A 3UDGA 2E5LL 4K0KQ 4TQUS 3GDEA 1RIPA 4QY7A 4YCVA 1PH9A 1HR0W 4R4IA 1QVFA 3HOYH 3FHWA 3L7ZC 5JJKA 4A3FG 4DR4L 5IP9G 4YY3Q 3RN2A 1D8LA 4LUOA 5FJ8G 2NZHA 2D0PA 2IX1A 2VQFQ 4NXNQ 4DV2Q 2E2IH 1EIFA 3A74A 3HKZG 1CUKA 3E9HA 1EIYB 3I4NH 4A3DG 2B3GA 2F4VQ 3HOXH 4DV7Q 5M3MG 1KIXA 4GN4B 4DAMA 3U58A 4BA2I 3S1QH 3S1RH 4X62L 5HY6A 4C3IH 4GS3A 1KL9A 4QJFA 1VQCA 1VQBA 1VQFA 3MEFA 4FDBA 4PZ6A 5AJ3L 3M3YH 1E24A 3U50C 1K0RA 4B3RL 3M4OH 1IBMQ 1J6QA 1NMFA 1X3FA 3PO3G 4HJAA 3RN5A 4LFBQ 4JI5Q 1V1QA 2GN5A 4LF7L 4GOPC 3M85A 4HIKA 3S17H 2UXBQ 1CSQA 2R93H 3T1YQ 5M5XH 2C35B 2OCEA 3CCRA 1H95A 1XMOL 3J80i 4OWXB 4X66Q 3CW2C 4DR7L 3ULLA 2EIFA 1Y1WH 2AHOB 3TRZA 1EQRA 2VQEL 4DR2Q 3PGZA 2UU9L 3F2DA 4JI4L 1A62A 4A93G 1JT8A 2R7ZH 4DV5L 2UUAQ 1YEZA 4DR1Q 4NXMQ 4LFAL 2VUMG 3B6YA 3K80C 4JYAL 2NN6I 1ASZA 2YU9H 1GM5A 5GROA 3ERSX 1UE5A 3HKZE 3L2PA 1X9NA 3TEHB 5H1SE 4POGA 1TXYA 1VQ4A 3S24A 2IY5B 1TWHH 4A3EG 4WJ4A 4RG1A 2QA4A 3HFZB 1VQIA 4UP7A 3F2CA 4DV0L 1Q1EA 4P75A 4JI8L 2Q2UA 2UXCQ 2RHSB 5IYCG 4IPDA 4LF6Q 3PV0A 4DUYL 3E9IA 3UDIA 1HNXQ 1EYGA 1MKHA 1NMGA 1Y1VH 4MZ9A 3KDFA 4DKAC 4C3JH 3J7ZC 1YJ9A 1XNQL 1QVCA 3CD6A 3H3VI 1O7IA 4A3BG 1UE1A 4HIOA 2AKWB 4KHZA 4OO1I 3EN2A 2ZTEA 3PUZA 5E7NA 2GVAA 5IP7G 4DV3L 1B8AA 2ZJRA 1IBKL 3SGIA 3UE0A 4QIWE 4X64Q 1WJJA 3TQYA 4JI2Q 1JJGA 2LXJA 4MNOA 1J5EQ 4JI1L 1MIUA 4IO9A 1OXVA 5M5YH 4LF8L 1KC8C 1YZ6A 1VQHA 2AWNA 3KDFB 4QL5A 4A4IA 4IOCA 1Q81C 2JK8A 2VZAA 3RLNA 2FXQA 3W5OA 2K5NA 4BBRH 4HJ7A 5JEAG 2HT1A 3CC4A 1SMXA 3GTQH 3CMAA 2IT1A 2WB1G 4O2DA 2ATWA 1D7QA 4BBSG 2I0QA 2L15A 4L5QA 3W1GA 4JOIA 4DAYB 4DV6L 3KLWA 3IRBA 1VQAA 1PH5A 4C2MH 1XTDA 4JV5Q 1PVOA 4JI0L 1L1OA 1WI5A 2CFMA 4GKKL 4R4QA 2V1CC 1I94Q 5JJIA 3S1NH 1Z47A 3M4QA 1PH2A 2B63G 3T1HQ 4IJHA 1AE2A 1YBYA 2AWOA 3AYHB 2R93G 2JEAI 2JA9A 2JA7H 3GTGH 4A3KG 3CCMA 4LUZA 3CCSA 1N33L 4JI7L 1BVSA 1NTGA 1TWAH 2MO0A 2R7DA 2WAQG 1NJIC 2NVQH 4Y52H 4B3SQ 4LF4Q 2UXDQ 1Z9FA 4B3TQ 1XMQL 1PH7A 3PUYA 1Q86C 4GKJQ 3NBHB 1L1OB 4GLXA 4X64L 2K5HA 1TWGH 2R92G 4JI2L 1NE3A 3I4MH 5JJLA 1HZBA 1WYDA 2Q2TA 3HOWH 3S1MH 2JA8G 1HZCA 4BY7G 1FL0A 4AH6A 5IYDH 5GADC 2F52A 4DV4Q 2ALYB 4KLKA 1QZHA 5LMNQ 4A3GH 4DR3L 4L5TA 4WJ3M 1I5FA 1K73C 2N49A 4MTNA 1PH4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D0F A;  3GTP H;  3GO5 A;  4LF9 Q;  1SLJ A;  2WB1 E;  4JBW A;  3CCJ A;  1Q7Y C;  4IOA A;  4YWM A;  4J15 A;  1QZG A;  5JEA J;  5C0X J;  3F2B A;  2HQL A;  2YTV A;  4UP9 A;  4AYB E;  5LMN W;  5FLM H;  2UUB Q;  4HJ8 A;  2D62 A;  4X65 Q;  1I3Q H;  3PUW A;  3OYY A;  4DK3 C;  1HNW Q;  4BXX G;  1XNR Q;  4IFD I;  1PFS A;  4AQY Q;  1MJE A;  1IZ6 A;  1R9T H;  4DR6 Q;  1SRO A;  4GLA C;  2RF4 A;  1NY4 A;  4O0A A;  4A75 A;  2UUC L;  2NN6 G;  4OWW B;  2YTX A;  3PO2 H;  3W1B A;  1HNZ L;  3FP9 A;  1HZA A;  2XGT A;  3EBE A;  2E8G A;  5ELO A;  3I55 A;  1IBL L;  3I4O A;  1VQM A;  2QEX A;  1N34 L;  1OXT A;  1UE6 A;  1Q82 C;  5BR8 L;  2ZM6 Q;  2WAQ E;  4A3I G;  3DM3 A;  4GOP A;  4PZ7 A;  4DK6 C;  1LM0 A;  5LMU Q;  1FJG Q;  2PNH A;  2XTI A;  1N36 L;  2MO1 A;  1BBU A;  1JB7 A;  1HR0 L;  2PI2 A;  3S2D H;  1X3E A;  1LUZ A;  4DR5 L;  5IWA L;  3CXC A;  1WCM H;  3BZC A;  5C44 G;  1YIJ A;  1CKN A;  1JJ2 A;  3RZO H;  1Q46 A;  1V43 A;  2OQK A;  3PSI A;  3HOV G;  4OO1 G;  3OW2 A;  5ELN A;  1V9P A;  1KRS A;  3I7F A;  1XPO A;  3UDX A;  4R4T A;  2R7F A;  4EX5 A;  4UY8 C;  4K0K L;  2MQH A;  4B3M Q;  3H0G G;  5C4X H;  4DV4 L;  1WOC A;  2CKZ B;  5EAY A;  3KFU A;  1VQK A;  4YY3 L;  1E1T A;  3PUV A;  4A76 A;  4A3M H;  4GOP B;  3KYH C;  3VDY A;  3FKI G;  3CCV A;  1VQL A;  2VQF L;  2K5V A;  2B29 A;  5DLQ E;  1OXU A;  1Q8K A;  4A3J H;  1RL2 A;  4NXN L;  4IPG A;  4DV2 L;  1UE7 A;  2F4V L;  4DV7 L;  2N8N A;  2R6G A;  3RLO A;  1CKN B;  1GO3 E;  3ULP A;  2JA5 H;  1PHJ A;  5C3E H;  1VQ9 A;  3A5Z B;  1XJV A;  1GVP A;  1C0A A;  1X54 A;  2CQO A;  1XNR L;  1PYB A;  2ZTD A;  1S3O A;  2ID0 A;  4YHH Q;  4LFC Q;  4PG3 A;  1EFW A;  4IPH A;  1PH8 A;  1AE3 A;  1B7Y B;  1DGS A;  1HZ9 A;  1EWI A;  5IYB H;  5J3B A;  4DUZ Q;  4R1J A;  4AIM A;  3CC2 A;  4OX9 Q;  1IBM L;  1S40 A;  4L5S A;  4LFB L;  4YCU A;  3BZK A;  2PMZ E;  4JI5 L;  1A8V A;  3S14 H;  1OXX K;  2HHH Q;  1SE8 A;  3AFQ A;  4JBJ A;  1YHA A;  2DGY A;  1SRU A;  3OTO Q;  3HOY G;  2UXB L;  4A3F H;  5IP9 H;  1FJG L;  1G51 A;  2NVX H;  1QUQ A;  3T1Y L;  1S72 A;  5FJ8 H;  3M4P A;  3PIO A;  3GTM H;  3K7A H;  3F8T A;  1LTL A;  2AMC B;  4OXP A;  1TWC H;  1PH3 A;  4X66 L;  3CCE A;  2PQA A;  2BA1 A;  1K3R A;  2BH8 A;  3HOZ H;  3I4N G;  3MXN B;  4NPS A;  1E22 A;  1EOV A;  3CC7 A;  4RMF A;  3HOX G;  4IJL A;  5FLM G;  4DR2 L;  4UP8 A;  2D0O A;  4EQ5 A;  4DV1 Q;  4X6A H;  3F1Z A;  3J81 c;  2UUA L;  2IX0 A;  5GAG C;  4JI3 Q;  1N32 Q;  2MFI A;  1HJP A;  1U0L A;  4DR1 L;  4NXM L;  1X56 A;  2JEB I;  2Z0S A;  1FGU A;  1EUJ A;  4DNI A;  3ZJY C;  4AYB G;  5GAH C;  4JBK A;  1QUQ B;  1YHQ A;  1B70 B;  2ZTC A;  2IHE A;  1VCI A;  2WFW A;  4GNX A;  4A3C H;  1UWV A;  3PO3 H;  3KF8 B;  3EIV A;  3PUX A;  4LF5 Q;  3RNU A;  2PQA B;  2E5L Q;  3KOJ A;  2UXC L;  4LF6 L;  1WFQ A;  2HIX A;  1KHI A;  3HOU H;  4DR4 Q;  1YVC A;  1HNX L;  1X65 A;  2CWA A;  4XTC S;  3CCL A;  3PCO B;  2KBN A;  4KHP Q;  1WCM G;  4LNQ A;  4IFD G;  1VQJ A;  1CKM A;  3STB D;  4JC0 A;  1Y1W G;  4GN3 B;  4JOI C;  2VL6 A;  2K50 A;  2K75 A;  3CQZ H;  4GNX B;  1PV4 A;  1W2B A;  4A93 H;  4X62 Q;  1KRT A;  1QVG A;  2R7Z G;  1Q1B A;  1L1O C;  2K52 A;  1YI2 A;  2KCT A;  1J5E L;  2ASB A;  3G71 A;  2VUM H;  1VQD A;  2EQS A;  5AJ3 Q;  1KAW A;  1OTC A;  3TS2 A;  3CPF A;  2A1A A;  1IXR A;  2ES2 A;  4JI6 Q;  4OWT B;  4A3J G;  1VS0 A;  4B3R Q;  4A3E H;  1VQ8 A;  2JQO A;  2VY3 A;  1VQP A;  1VQG A;  3Q8D A;  1A0I A;  2RHQ B;  1PA6 A;  4LF7 Q;  1FVI A;  4APV A;  1YJN A;  4JI3 L;  2K14 A;  2Z6K C;  1GD7 A;  3JC6 6;  3M7N A;  2KHI A;  1Y1V G;  1LYL A;  1XMO Q;  1YHB A;  5C0X I;  1W3S A;  3NEM A;  4A3B H;  1VQO A;  4R4O A;  4DPG A;  1K8G A;  3I2Z A;  4DR7 Q;  4JV5 L;  2PI2 E;  2ZJQ A;  3ER0 A;  4JG2 A;  3WWV A;  1X3G A;  3A0J A;  5IT9 c;  2VQE Q;  3GTO H;  1I94 L;  2MNA A;  2UU9 Q;  4JI4 Q;  3J80 c;  3T1H L;  4H02 A;  4DV5 Q;  4BY1 H;  4PMW A;  2LXK A;  2I5H A;  2QGQ A;  4LFA Q;  3UE1 A;  2NVY H;  4JYA Q;  2H5X A;  4KHP L;  3J7A 5;  1Y14 B;  3E0E A;  2OTL A;  3G4S A;  3TRE A;  2NVT H;  4B3S L;  4LF4 L;  2UXD L;  4HIM A;  3HOZ G;  3I56 A;  4HJ5 A;  3K7U C;  1E7Z A;  4B3T L;  4XIG S;  4IFD J;  3H15 A;  1XPR A;  3PIP A;  4DV0 Q;  4R4C A;  4GKJ L;  4BBR G;  1T9H A;  4JI8 Q;  4A3L H;  3AEV A;  4Y7N H;  2DUD A;  4BBS H;  4DUY Q;  1YNX A;  3HKS A;  2KEN A;  4A3G G;  1VQN A;  1XNQ Q;  3STB C;  1X55 A;  4LWC A;  4LW1 A;  3CCU A;  4JI6 L;  3U4V A;  1YIT A;  1M90 C;  4A3C G;  5LMN L;  3K0X A;  1I50 H;  1N9W A;  3K81 C;  4PZ8 A;  1BBW A;  4YWL A;  1PYS B;  2NZO A;  3NEN A;  1IBK Q;  1CSP A;  2JJQ A;  3GD7 A;  3GTL H;  1HH2 P;  4DV3 Q;  4P72 A;  2B63 H;  2Q2I A;  4LF9 L;  2VS1 A;  1M1K C;  3KF6 A;  5C4J H;  4IPC A;  1VQ6 A;  3HOU G;  4A3K H;  2JA7 G;  3UDF A;  4JI1 Q;  2UUB L;  2WP8 J;  4X65 L;  3TS0 A;  4LF8 Q;  1HNW L;  4AQY L;  4DR6 L;  1SR3 A;  5GAE C;  1VQE A;  1ASY A;  1UEB A;  2CWP A;  2Y0S G;  3CPW A;  1PH6 A;  1SFO H;  3CF5 A;  2JA6 H;  2R92 H;  3NEL A;  2A19 A;  5IY0 A;  4TVA B;  5M3F H;  3I4M G;  1E1O A;  2JA8 H;  1JJC B;  3L0O A;  2ZM6 L;  1CKO A;  3HOW G;  4DV6 Q;  3KF6 B;  3D31 A;  4BY7 H;  1G29 1;  5IYD G;  1TWF H;  5FLX c;  2E2H H;  5LMU L;  2EXD A;  3JAM c;  2A8V A;  1K9M C;  2OTJ A;  4JI0 Q;  1IYJ B;  4P74 A;  4GKK Q;  4L5R C;  1KXL A;  1YJW A;  3RLF A;  3LGJ A;  3ICE A;  1U5K A;  4C3H H;  1PH1 A;  4A3D H;  3PF4 A;  3RZD H;  3S16 H;  2VNU D;  5M3M H;  2ZJP A;  5HGQ A;  4B3M L;  3J81 j;  1N33 Q;  4JI7 Q;  4BXX H;  1C7Y A;  1C9O A;  2VW9 A;  5IE8 A;  2YTY A;  4P71 A;  4P73 A;  1K8A C;  2RCN A;  2YV5 A;  2HIV A;  4UPA A;  1XMQ Q;  3PO2 G;  3PF5 A;  4GN5 A;  4KI0 A;  2KCM A;  1N8R C;  4ME3 A;  2BA0 A;  4BY1 G;  4BA1 I;  2OQ0 A;  5GQO A;  2KHJ A;  4A3I H;  3KJO A;  1JMC A;  3S2H H;  1K83 H;  5M5W H;  2IHF A;  1XPU A;  4HJ9 A;  4LFC L;  4YHH L;  1GKH A;  3GTK H;  3DLL A;  4DR3 Q;  1L0W A;  3ULJ A;  3H3V H;  3BJU A;  4POF A;  2Y0S E;  4DUZ L;  2I5L X;  1SN8 A;  5C0X G;  5C44 H;  3KJP A;  4LUV A;  3BU2 A;  3CME A;  1NBW A;  4A3L G;  2GVB A;  3JAM i;  3HOV H;  4OX9 L;  3S15 H;  3CAM A;  1VQ7 A;  4OON A;  2E2J H;  1EQQ A;  1KQS A;  4YWK A;  3H0G H;  2HHH L;  3RR5 A;  1G6P A;  1JE5 A;  5C4X G;  2LSS A;  3OTO L;  4GNX C;  2JE6 I;  5K36 G;  1A63 A;  1I6H H;  1P8L A;  1IL2 A;  2F3I A;  4A3M G;  4QGU A;  2UUC Q;  3AFP A;  3FKI H;  2N3S A;  3G6E A;  1HNZ Q;  2K4K A;  4JBM A;  3J81 i;  1IBL Q;  1P16 A;  1BKB A;  1KD1 C;  2OWO A;  1N34 Q;  5BR8 Q;  3CP0 A;  1AH9 A;  2JA5 G;  4DV1 L;  5C3E G;  1X6O A;  2Z6K A;  5IYC H;  1N32 L;  1MJC A;  2N78 A;  1L2F A;  3M9B A;  3AQQ A;  4HID A;  1N36 Q;  1HR0 Q;  2CCZ A;  1OXS C;  3GTJ H;  4DR5 Q;  5IYB G;  3CCQ A;  5IWA Q;  3K8A A;  4NB3 A;  2BH2 A;  2JA6 G;  4QQB X;  2I5M X;  1Q12 A;  5M3F G;  2Q2H A;  4ALP A;  3G48 A;  4JCV E;  4GLV B;  4YCW A;  5IP7 H;  3A5U A;  4LF5 L;  3U4Z A;  1E3P A;  2YYZ A;  1VQ5 A;  3UDG A;  2E5L L;  4K0K Q;  4TQU S;  3GDE A;  1RIP A;  4QY7 A;  4YCV A;  1PH9 A;  1HR0 W;  4R4I A;  1QVF A;  3HOY H;  3FHW A;  3L7Z C;  5JJK A;  4A3F G;  4DR4 L;  5IP9 G;  4YY3 Q;  3RN2 A;  1D8L A;  4LUO A;  5FJ8 G;  2NZH A;  2D0P A;  2IX1 A;  2VQF Q;  4NXN Q;  4DV2 Q;  2E2I H;  1EIF A;  3A74 A;  3HKZ G;  1CUK A;  3E9H A;  1EIY B;  3I4N H;  4A3D G;  2B3G A;  2F4V Q;  3HOX H;  4DV7 Q;  5M3M G;  1KIX A;  4GN4 B;  4DAM A;  3U58 A;  4BA2 I;  3S1Q H;  3S1R H;  4X62 L;  5HY6 A;  4C3I H;  4GS3 A;  1KL9 A;  4QJF A;  1VQC A;  1VQB A;  1VQF A;  3MEF A;  4FDB A;  4PZ6 A;  5AJ3 L;  3M3Y H;  1E24 A;  3U50 C;  1K0R A;  4B3R L;  3M4O H;  1IBM Q;  1J6Q A;  1NMF A;  1X3F A;  3PO3 G;  4HJA A;  3RN5 A;  4LFB Q;  4JI5 Q;  1V1Q A;  2GN5 A;  4LF7 L;  4GOP C;  3M85 A;  4HIK A;  3S17 H;  2UXB Q;  1CSQ A;  2R93 H;  3T1Y Q;  5M5X H;  2C35 B;  2OCE A;  3CCR A;  1H95 A;  1XMO L;  3J80 i;  4OWX B;  4X66 Q;  3CW2 C;  4DR7 L;  3ULL A;  2EIF A;  1Y1W H;  2AHO B;  3TRZ A;  1EQR A;  2VQE L;  4DR2 Q;  3PGZ A;  2UU9 L;  3F2D A;  4JI4 L;  1A62 A;  4A93 G;  1JT8 A;  2R7Z H;  4DV5 L;  2UUA Q;  1YEZ A;  4DR1 Q;  4NXM Q;  4LFA L;  2VUM G;  3B6Y A;  3K80 C;  4JYA L;  2NN6 I;  1ASZ A;  2YU9 H;  1GM5 A;  5GRO A;  3ERS X;  1UE5 A;  3HKZ E;  3L2P A;  1X9N A;  3TEH B;  5H1S E;  4POG A;  1TXY A;  1VQ4 A;  3S24 A;  2IY5 B;  1TWH H;  4A3E G;  4WJ4 A;  4RG1 A;  2QA4 A;  3HFZ B;  1VQI A;  4UP7 A;  3F2C A;  4DV0 L;  1Q1E A;  4P75 A;  4JI8 L;  2Q2U A;  2UXC Q;  2RHS B;  5IYC G;  4IPD A;  4LF6 Q;  3PV0 A;  4DUY L;  3E9I A;  3UDI A;  1HNX Q;  1EYG A;  1MKH A;  1NMG A;  1Y1V H;  4MZ9 A;  3KDF A;  4DKA C;  4C3J H;  3J7Z C;  1YJ9 A;  1XNQ L;  1QVC A;  3CD6 A;  3H3V I;  1O7I A;  4A3B G;  1UE1 A;  4HIO A;  2AKW B;  4KHZ A;  4OO1 I;  3EN2 A;  2ZTE A;  3PUZ A;  5E7N A;  2GVA A;  5IP7 G;  4DV3 L;  1B8A A;  2ZJR A;  1IBK L;  3SGI A;  3UE0 A;  4QIW E;  4X64 Q;  1WJJ A;  3TQY A;  4JI2 Q;  1JJG A;  2LXJ A;  4MNO A;  1J5E Q;  4JI1 L;  1MIU A;  4IO9 A;  1OXV A;  5M5Y H;  4LF8 L;  1KC8 C;  1YZ6 A;  1VQH A;  2AWN A;  3KDF B;  4QL5 A;  4A4I A;  4IOC A;  1Q81 C;  2JK8 A;  2VZA A;  3RLN A;  2FXQ A;  3W5O A;  2K5N A;  4BBR H;  4HJ7 A;  5JEA G;  2HT1 A;  3CC4 A;  1SMX A;  3GTQ H;  3CMA A;  2IT1 A;  2WB1 G;  4O2D A;  2ATW A;  1D7Q A;  4BBS G;  2I0Q A;  2L15 A;  4L5Q A;  3W1G A;  4JOI A;  4DAY B;  4DV6 L;  3KLW A;  3IRB A;  1VQA A;  1PH5 A;  4C2M H;  1XTD A;  4JV5 Q;  1PVO A;  4JI0 L;  1L1O A;  1WI5 A;  2CFM A;  4GKK L;  4R4Q A;  2V1C C;  1I94 Q;  5JJI A;  3S1N H;  1Z47 A;  3M4Q A;  1PH2 A;  2B63 G;  3T1H Q;  4IJH A;  1AE2 A;  1YBY A;  2AWO A;  3AYH B;  2R93 G;  2JEA I;  2JA9 A;  2JA7 H;  3GTG H;  4A3K G;  3CCM A;  4LUZ A;  3CCS A;  1N33 L;  4JI7 L;  1BVS A;  1NTG A;  1TWA H;  2MO0 A;  2R7D A;  2WAQ G;  1NJI C;  2NVQ H;  4Y52 H;  4B3S Q;  4LF4 Q;  2UXD Q;  1Z9F A;  4B3T Q;  1XMQ L;  1PH7 A;  3PUY A;  1Q86 C;  4GKJ Q;  3NBH B;  1L1O B;  4GLX A;  4X64 L;  2K5H A;  1TWG H;  2R92 G;  4JI2 L;  1NE3 A;  3I4M H;  5JJL A;  1HZB A;  1WYD A;  2Q2T A;  3HOW H;  3S1M H;  2JA8 G;  1HZC A;  4BY7 G;  1FL0 A;  4AH6 A;  5IYD H;  5GAD C;  2F52 A;  4DV4 Q;  2ALY B;  4KLK A;  1QZH A;  5LMN Q;  4A3G H;  4DR3 L;  4L5T A;  4WJ3 M;  1I5F A;  1K73 C;  2N49 A;  4MTN A;  1PH4 A; 
#chains in the Genus database with same CATH topology
 2KOL A;  3SK4 A;  1G2S A;  1F9Q A;  3V2T A;  4C3H G;  3CCJ A;  2JA7 B;  3GTG B;  4YWM A;  2HQL A;  2BE5 C;  4UAI A;  2H4O A;  1HNW Q;  3I3C A;  2OEO A;  2MP1 A;  3K59 A;  4A75 A;  3GTJ B;  3OWF A;  3A8K E;  3W1B A;  1HNZ L;  1HZA A;  2XGT A;  1I4H A;  1N34 L;  3I90 A;  1OXT A;  1UE6 A;  2KHS A;  4LJZ C;  5CV8 A;  4PZ7 A;  1U9R A;  4DK6 C;  4K2L A;  1D6E C;  2PI2 A;  3S2D H;  1LUZ A;  1GUS A;  2G9D A;  3BZC A;  1JJ2 A;  3K5M A;  3I4N B;  2B2W A;  3ND8 A;  3I7F A;  3MWY W;  1I3Q B;  2Q8R E;  4DA2 A;  2MQH A;  1FNU A;  5C4X H;  5K36 H;  1STG A;  1WOC A;  2CKZ B;  2E2D C;  5CV7 A;  1VQK A;  4V19 0;  5D14 A;  4A3M H;  4GOP B;  3M3Y B;  3PO2 B;  4CJ0 B;  2B29 A;  1OXU A;  1SYE A;  5C5L A;  4NXN L;  4A3J H;  4IPG A;  1UE7 A;  4DV7 L;  2N8N A;  3ULP A;  1PHJ A;  3A5Z B;  1XJV A;  2Q8T A;  1C0A A;  1HTL D;  1X54 A;  1DCZ A;  1X32 A;  4YHH Q;  4HED A;  1EFW A;  2IL8 A;  1AE3 A;  1WTO A;  1LTB D;  1EWI A;  4KJN A;  4XXE A;  2K03 A;  2JXM B;  4DUZ Q;  3RZO B;  1Y1W B;  1L0Y B;  4YCU A;  5JOB A;  1A8V A;  2HHH Q;  1F2M A;  3MXP A;  3OTO Q;  2ICE C;  1QUQ A;  3T1Y L;  3M4P A;  4OXP A;  1TWH B;  3MXN B;  4NPS A;  3CC7 A;  3NWT A;  1SE4 A;  1D2B A;  3AB9 A;  1LLR D;  2J7Z A;  2IX0 A;  1AN8 A;  3TME A;  1QCB D;  1U0L A;  1ZEQ X;  1EUJ A;  1O7L A;  3I70 A;  4JBK A;  4AYB G;  4KKU A;  3J81 E;  1VCI A;  3PO3 H;  5FKA C;  4FXK C;  4NW2 A;  1H9R A;  2E5L Q;  3KOJ A;  1WFQ A;  1KHI A;  1X65 A;  3T4A C;  2CWA A;  4DK1 A;  3CCL A;  1GJX A;  1ILQ A;  5C5M A;  1B3A A;  3EFX D;  2HDL A;  4CBV A;  1VQJ A;  3NTK A;  1LTG D;  2VL6 A;  4GNX B;  1T5X D;  1QVG A;  3MEH A;  2ASB A;  2KCT A;  3G71 A;  1EY7 A;  2CHB D;  2EQS A;  3KLR A;  5AJ3 Q;  3R2T A;  4JI6 Q;  4A3J G;  4CKB A;  1ZXT A;  4B3R Q;  4A3E H;  2PNR C;  1PRT F;  3Q8D A;  2F0Q A;  4LF7 Q;  4APV A;  3TP5 A;  1LT5 D;  1GD7 A;  5D3D A;  3M7N A;  2KHI A;  5CBE E;  1Y1V G;  1YHB A;  1B50 A;  3WWV A;  1X3G A;  3A0J A;  2Y0S B;  1I94 L;  3SVM A;  3VR4 A;  5JVG 3;  3QJY A;  5IGB A;  1GHJ A;  1D5M C;  2B2Y C;  2RCF A;  4KHV A;  4LFA Q;  1EU3 A;  3G4S A;  4HIM A;  4HJ5 A;  4FF3 A;  2RQX A;  3PIP A;  4DV0 Q;  2XWJ B;  5C0X H;  3OSO A;  4A3L H;  4JI8 Q;  1C8C A;  3BDL A;  1EOT A;  2DUD A;  1YNX A;  4A3G G;  4JI6 L;  2KEC A;  4L63 B;  3K0X A;  3K81 C;  4YWL A;  2NZO A;  1CT1 D;  4P72 A;  2B63 H;  2VS1 A;  1WD0 A;  4IPC A;  5E4X A;  3UDF A;  4JI1 Q;  4DXF A;  5GAE C;  1VQE A;  4NDX A;  4X3K A;  1GUO A;  2CWP A;  2EYH A;  3CPW A;  3URY A;  1SFO H;  2EY1 A;  2R92 H;  3NEL A;  1PTO F;  2X6G A;  1E1O A;  2EYF A;  3HOW G;  1NCV A;  3KF6 B;  3D31 A;  5C4X B;  5IYD G;  4NKL A;  5FLX c;  2MHV A;  3JAM c;  4A3M B;  2OTJ A;  4JI0 Q;  1ILP A;  3TP7 A;  3ICE A;  1KLU D;  3RZD H;  2VNU D;  4Q5V A;  1TR5 A;  1A3U A;  2XRS D;  1SYD A;  2B8F A;  3J81 j;  4JI7 Q;  3QOL A;  4BXX H;  4BWG B;  2KED A;  1ESR A;  1WTW A;  4F8M A;  1K8A C;  2RCN A;  2HIV A;  1XMQ Q;  3NXW A;  4HCS A;  1O7Z A;  1N8R C;  4OIK A;  1PRT D;  2Z8L A;  2CW0 C;  3N52 A;  4BA1 I;  5GQO A;  2F0J A;  1BQQ T;  2IHF A;  4RCN A;  4LFC L;  1XXG A;  1ZYR C;  5CYU A;  3GTK H;  1G8Z D;  1A3T A;  1L0W A;  4OGQ C;  3H3V H;  3BJU A;  4POF A;  2Y0S E;  4PMB A;  1SN8 A;  5C0X G;  3L3O C;  4A3L G;  3HKZ B;  1NBW A;  4OO1 H;  3HOV H;  2L12 A;  4N8X 1;  3FDT A;  1EQQ A;  1K28 A;  2IX3 A;  2LSS A;  4GNX C;  1A63 A;  4IUV A;  3T51 B;  2B2U C;  2F3I A;  2UUC Q;  3G6E A;  3FPU B;  1BCP F;  4H0L C;  1KD1 C;  2I46 A;  2KCC A;  4A3I B;  1VMP A;  5BR8 Q;  4DV1 L;  4FXD A;  5J1Z A;  2Z6K A;  4KD4 A;  4DNR B;  5IYC H;  1L2F A;  4HID A;  1N36 Q;  1HR0 Q;  2CCZ A;  4RWS C;  4DR5 Q;  3MZ5 A;  5DAU A;  3CCQ A;  4NB3 A;  5ELB A;  1Q12 A;  1DYQ A;  3G48 A;  4JCV E;  1ENC A;  3A5U A;  1A2T A;  1E3P A;  2FIN B;  1RIP A;  5EJW A;  1I6H B;  3FEW X;  1VMC A;  4V0B A;  4DR4 L;  5IP9 G;  4YY3 Q;  2BDO A;  3RN2 A;  2RSN A;  1AP0 A;  1EIY B;  4A3E B;  3E9H A;  1STA A;  1PTO D;  1KIX A;  3S1Q H;  2A5H A;  1ONL A;  3S1R H;  4X62 L;  2MUY A;  4OL7 A;  5E3F A;  1VQF A;  1Y69 U;  1LT6 D;  1VF5 C;  3LWU A;  1KTK A;  4XQJ A;  1J6Q A;  1NMF A;  2CVR A;  1MSH A;  4LFB Q;  1JR0 D;  1L0X B;  4JI5 Q;  1V1Q A;  3G7L A;  3DWQ A;  3PIP 3;  4GZY C;  1LTR D;  1B53 A;  3S17 H;  3HEJ A;  5M5X H;  5IT9 L;  4U68 A;  4G7Z C;  3ITP A;  1CA6 A;  3J80 L;  4X66 Q;  4IFD H;  3CW2 C;  1QOH A;  3ULL A;  5LHY 1;  2EIF A;  2K05 A;  4KKS A;  2A73 B;  4DR2 Q;  1EY0 A;  2B2V A;  2UU9 L;  4EVO A;  4JI4 L;  4C3I B;  2R7Z H;  4K6L A;  1XWE A;  4DR1 Q;  4NXM Q;  3K80 C;  1DJR D;  3BG3 A;  1DXM A;  5GRO A;  3ERS X;  1TT2 A;  3HKZ E;  2XRQ D;  3F2C A;  2B63 B;  1Q1E A;  4P75 A;  2Q2U A;  2UXC Q;  5IYC G;  2R93 B;  3NWS A;  4DUY L;  3E9I A;  4DU9 A;  5M9O A;  2YU9 H;  1MKH A;  4DKA C;  1BBX C;  3KDF A;  1XNQ L;  2WAQ B;  5ELE A;  5FO9 B;  5EKI A;  1O7I A;  4OEM B;  2XWB B;  2OT2 A;  5COY A;  4DV3 L;  5L37 A;  1BCP D;  1EY5 A;  2F0H A;  1SFO B;  2R92 B;  5HUR A;  4DAY A;  4X64 Q;  3NQI A;  3HZX A;  5I6W A;  4MNO A;  1J5E Q;  1MIU A;  4IO9 A;  4LF8 L;  1ICW A;  2F1M A;  1VQH A;  2RDG A;  1BF4 A;  2VZA A;  1ZKO A;  2FXQ A;  4ZLT F;  5JEA G;  3GQB A;  4KY5 A;  1H9K A;  1SEB D;  4HSV A;  3RZD B;  2JSO A;  2L15 A;  4L5Q A;  3X3N A;  4EQO A;  1JE4 A;  1XTD A;  2ENB A;  4JV5 Q;  4LK1 C;  2DY7 A;  3T1H Q;  3E5S A;  1AE2 A;  3E6Z X;  2JA7 H;  3GTG H;  1DD2 A;  4A3K G;  5JPM C;  2PMZ B;  4LUZ A;  4CDE C;  4CKC A;  3VR6 A;  3GTK B;  3BYT B;  1DZ1 A;  2NTT A;  3NBH B;  1L1O B;  4X64 L;  3HOV B;  1STN A;  4PMC A;  4ULL A;  4G7O C;  2A6H C;  3QG1 A;  4BY7 G;  4AH6 A;  5GAD C;  1QZH A;  2ALY B;  5LMN Q;  2PPB C;  4DR3 L;  4WJ3 M;  1PH4 A;  3D0F A;  4RKL A;  1AZP A;  3V96 A;  1X3P A;  1SLJ A;  2NBF A;  4JBW A;  1QIL A;  4LF9 Q;  4IOA A;  1QZG A;  3IL8 A;  5JEA J;  3F2B A;  5FLM H;  2UUB Q;  4X65 Q;  1TWA B;  5D3I B;  1I3Q H;  5IOD A;  2HUG A;  1PFS A;  4AQY Q;  5C4H A;  3LWE A;  1EQT A;  2RF4 A;  4CHT B;  3WOE A;  3PO2 H;  2A69 C;  1BXT A;  1B4O A;  1CI3 M;  3FP9 A;  2E8G A;  5ELO A;  3I55 A;  3I4O A;  1VQM A;  1U4M A;  3OPO A;  2QEX A;  1PZI D;  5G3L F;  3J80 E;  2WAQ E;  2QKI C;  4CJ2 C;  3IAY A;  2F0V A;  5CC4 A;  3K58 A;  4HTH A;  5KYL A;  1SE3 A;  1D5Z C;  5IWA L;  3RZO H;  2HCI A;  1V43 A;  3OMC A;  2OQK A;  4G7H C;  2PZU A;  3I72 A;  5ELN A;  1XPO A;  2FHT A;  3S1Q B;  5ISR A;  3NP8 A;  3S1R B;  2R7F A;  4UY8 C;  1TY0 A;  3H0G G;  1EY6 A;  1E1T A;  4ZUI A;  3PUV A;  1QE6 A;  3VDY A;  3FKI G;  3CCV A;  3TDQ A;  2K5V A;  5F2D A;  5DLQ E;  1Q8K A;  4DV2 L;  2NTS A;  4NP5 A;  2Z4I A;  2F4V L;  1R4P B;  2R6G A;  2JA5 H;  1PTO H;  1VQ9 A;  4L8J A;  1PYB A;  2ZTD A;  1S3O A;  1BOS A;  2ID0 A;  5M5X B;  2OXP A;  4IQZ A;  4PG3 A;  4KN7 C;  3A55 A;  1BDO A;  4IPH A;  3CU7 A;  1HZ9 A;  1E0B A;  1I4G A;  1KDB A;  1TS5 A;  4LMQ D;  5DEH A;  2A6E C;  4KY6 A;  1S40 A;  4R8N A;  2PMZ E;  3SR1 A;  2X6L A;  2R7Z B;  1SRU A;  2JP1 A;  4A3F H;  2UXB L;  2NVX H;  3PIO A;  4QF4 A;  3F8T A;  5CGK A;  2WKD A;  3KF8 A;  1JC7 A;  1HTP A;  3I4N G;  1E22 A;  1EOV A;  1UUP A;  4RMF A;  3Q23 A;  5FLM G;  3D8G A;  2F0I A;  3J81 c;  5GAG C;  1N32 Q;  2FMM A;  2MFI A;  2YU9 B;  3HGB A;  5FOB B;  1X56 A;  1FD7 D;  2JEB I;  3EJI A;  4YIJ A;  5C3X A;  5TSS A;  1EYD A;  1QUQ B;  4ZKB B;  2R61 A;  4A3C H;  1UWV A;  3PUX A;  4LF5 Q;  3S14 B;  3RNU A;  5KND A;  3M4Y A;  1YVC A;  2EY6 A;  2NZ1 D;  4KHP Q;  3LX0 A;  3HOZ B;  4MN3 A;  3OMG A;  1CKM A;  1Y1W G;  4GN3 B;  4I7A A;  4JOI C;  5FO8 B;  1PV4 A;  3H3V C;  4A93 H;  2K01 A;  5G3L D;  1Q1B A;  4IUR A;  1L1O C;  2K52 A;  5C4Z A;  2Q8I B;  2C9O A;  2VUM H;  1VQD A;  4UHV A;  1OTC A;  3TS2 A;  3CPF A;  2A1A A;  1IXR A;  4OWT B;  2JQO A;  4K6D A;  2VY3 A;  3DWP A;  1VQG A;  5IOC A;  1A0I A;  2RHQ B;  1PA6 A;  4DAV A;  2EYL A;  4PQX A;  3OOC A;  2KEE A;  1JOQ A;  4G57 A;  1Q90 A;  1SYG A;  5C0X I;  4R4O A;  1WTP A;  2PI2 E;  3ER0 A;  4K8J A;  1WD1 A;  3CQZ B;  2VQE Q;  1B3Q A;  2VB2 X;  4DV5 Q;  1PRT B;  3KLS A;  1ML0 D;  4K2K A;  2I5H A;  2QGQ A;  4QB4 A;  1CTM A;  5I9P A;  4KHP L;  2H5X A;  1LV9 A;  1Z7T A;  2OTL A;  1RD9 D;  3TRE A;  4B3S L;  4LF4 L;  2DJG C;  3BVM A;  3I56 A;  1H9S A;  3H15 A;  1RCV D;  2BCO A;  1WTV A;  1B2T A;  4R4C A;  2AUJ D;  4HCE A;  4GKJ L;  1T9H A;  1IKM A;  1GHK A;  3AEV A;  4KY7 A;  4WJW A;  1PZJ D;  1W6K A;  3HKS A;  1VQN A;  4IUN A;  5ELD A;  4A3B B;  1X55 A;  4LWC A;  2L0C A;  3U4V A;  4A3C G;  1I50 H;  4IUQ A;  3GTO B;  3NEN A;  3E3X A;  4EQP A;  3GD7 A;  2BDN A;  2QF7 A;  1AZQ A;  2Q2I A;  2K5Q A;  1M1K C;  2RBM A;  1VQ6 A;  3Q6S A;  3I73 A;  2WP8 J;  3TS0 A;  1HNW L;  2XN9 C;  2IJ0 A;  2B2W C;  3DEO A;  1SR3 A;  1ASY A;  1UEB A;  2C5C A;  2MGS A;  2Y0S G;  4HR7 B;  5JJZ A;  4U67 3;  5IY0 A;  2JA8 H;  1JJC B;  3L0O A;  3SK6 A;  1CKO A;  1LT3 D;  4DV6 Q;  2WII B;  1RTN A;  1G29 1;  1EYA A;  4WFN 3;  2A8V A;  3J7Y W;  4P74 A;  1KXL A;  4RFB A;  1S5B D;  1SJH D;  5IIF A;  1U5K A;  1PMR A;  3FMC A;  3MFG A;  4L6T B;  2JA5 B;  2ZJP A;  1PTO B;  1RDP D;  1N33 Q;  1I6V C;  3QO2 A;  4J6H A;  4J1M A;  2YTY A;  5IGC A;  2QCP X;  3PIO 3;  4UPA A;  2ICI A;  2JA6 B;  3CHB D;  4ME3 A;  2BA0 A;  4S3S A;  4PNY A;  4FF1 A;  2TSS A;  1YNN D;  2DN8 A;  2L1B A;  4A3I H;  5M5W H;  3A7A B;  4A3F B;  2NVX B;  4YHH L;  1NNX A;  1GKH A;  3DLL A;  3NTI A;  4H7B A;  3ULJ A;  5EKL A;  1SSO A;  4DUZ L;  4CDF C;  2GA4 B;  4C3H B;  5C44 H;  2PW5 A;  3BU2 A;  5KNB A;  4A3D B;  1HRJ A;  3JAM i;  1QNK A;  3F2U A;  3I8Z A;  4KKT A;  5M3M B;  2E2J H;  4N9T A;  4DF7 A;  2HHH L;  1JE5 A;  5C4X G;  3OTO L;  5K36 G;  1I6H H;  2WAC A;  4A3M G;  5IGF A;  3TBI B;  2EJF C;  2K4K A;  3VYR A;  1LTI D;  1LO5 D;  3OIQ A;  4KJO A;  1IBL Q;  2WKC A;  2F0M A;  2B2T A;  4X3U A;  3CP0 A;  4QUF A;  2EDG A;  2KA7 A;  1LTT D;  1MJC A;  1NSN S;  5C3W A;  1ICF B;  3M9B A;  1PFN A;  2F03 A;  1OXS C;  3A54 A;  4RGT A;  1CZG A;  3K8A A;  1CQV A;  2I5M X;  2XNA C;  4ALP A;  1G2T A;  1VF7 A;  2YYZ A;  2PYK A;  1BCP B;  2E5L L;  4A93 B;  4K0K Q;  3SEB A;  1HR0 W;  4QY7 A;  3HOY H;  3FHW A;  1U4P A;  2F0P A;  3L7Z C;  5JJK A;  3FVQ A;  5ELC A;  2VUM B;  1D8L A;  1Q8I A;  2B2Y A;  2NZH A;  1STH A;  2EY5 A;  2IX1 A;  4RHS A;  2VQF Q;  1KDA A;  3HKZ G;  3A74 A;  2PCF B;  2XVS A;  3HOX H;  4GN4 B;  1A3V A;  4XDX A;  4C3I H;  1FR3 A;  4GS3 A;  1KL9 A;  4QJF A;  4RGO S;  1VQC A;  3MEF A;  5AJ3 L;  4PZ6 A;  1E24 A;  3U50 C;  1SE2 A;  1W6J A;  2E76 C;  4B3R L;  2K32 A;  1IBM Q;  3PO3 G;  3EQL C;  2GN5 A;  4LF7 L;  4GOP C;  4ID6 A;  3GV6 A;  1M8A A;  1CQF A;  3M85 A;  3J7A F;  4O42 A;  1ET9 A;  2R93 H;  3CCR A;  4RAU C;  2ZXP A;  3J80 i;  3H91 A;  1RKN A;  2SNS A;  4QCL A;  1IHZ A;  2JYO A;  3TRZ A;  1EQR A;  1O7Y A;  5BN4 A;  3NSW A;  3DMU A;  1IL8 A;  2WB1 B;  2UUA Q;  5EBD A;  1FYC A;  4LFA L;  4AYB B;  2AQ1 B;  2F0L A;  1GM5 A;  3L2P A;  1I50 B;  3TEH B;  3M4O B;  1TXY A;  4A3E G;  1S5C D;  4WJ4 A;  5A35 A;  4UP7 A;  4DV0 L;  3TN2 A;  1M4V A;  2OF1 A;  4JI8 L;  4LF6 Q;  4IPD A;  2PZT A;  4ZKC B;  5IGE A;  3UDI A;  1HNX Q;  1WVL A;  4MZ9 A;  3FPP A;  3T56 B;  4TKO B;  1HQM C;  3T13 A;  4C3J H;  4ME5 A;  1C4Q A;  3K5O A;  1PTO C;  4HIO A;  2PW7 A;  4ZRZ A;  3BYY B;  4C1N I;  4RHR A;  5E7N A;  4CDC C;  1B8A A;  2A68 D;  2K04 A;  3SGI A;  4FXG C;  1JJG A;  2JA8 B;  4ILW A;  2FMC A;  4JI1 L;  1DON A;  1OXV A;  1YZ6 A;  3MFY A;  2MJ8 A;  2ZT9 C;  1SJE D;  3KDF B;  4IOC A;  1Q81 C;  1NAP A;  2JK8 A;  3MC0 B;  3RLN A;  3W5O A;  4BBR H;  3QOJ A;  2HT1 A;  1SMX A;  3GTQ H;  5FLX L;  4C3I G;  3CMA A;  2IT1 A;  3JAM L;  3UI2 A;  2I0Q A;  5J39 A;  3W1G A;  4DAY B;  3KLW A;  1JOR A;  3PMF A;  3TP6 A;  3K57 A;  4BS9 A;  4JI0 L;  1D1K A;  1WI5 A;  2B2U A;  2CFM A;  4R4Q A;  4ABN A;  2R3Z A;  1Z47 A;  3I4L A;  1PH2 A;  1SAP A;  2B63 G;  2AWO A;  4DGZ A;  2R93 G;  2JA9 A;  3E0J A;  3CCS A;  5M5W B;  4JI7 L;  2WAQ G;  4KTA A;  1TWA H;  1JWU D;  2L9H A;  1NJI C;  2UXD Q;  1PXU A;  1QNU A;  5EKK A;  1SXT A;  4B3T Q;  1G91 A;  1HFG A;  2TMP A;  1TS2 A;  1XMQ L;  5C44 B;  2K6A A;  2K5H A;  2R92 G;  3I4M H;  1B9M A;  4A3G B;  2Q2T A;  3S1M H;  2E2J B;  2F0N A;  5ELF A;  4C2M B;  1MSG A;  1HZC A;  1FL0 A;  1K0S A;  1BCP C;  2F52 A;  3D4D A;  2N49 A;  2K33 A;  3NQT A;  2Z4H A;  2BOS A;  3VYT A;  2WB1 E;  1Q7Y C;  2NUC A;  5C0X J;  4UP9 A;  5LMN W;  4AYB E;  4HJ8 A;  2AQ3 B;  2D62 A;  4J8Q A;  2KJX A;  3PUW A;  4DK3 C;  4BXX G;  2PQE A;  1MJE A;  1IZ6 A;  4DR6 Q;  4QMG A;  5KEE A;  3C1F A;  1NY4 A;  2UUC L;  3T16 A;  3R2I A;  1OO9 B;  4OWW B;  3X3M A;  2FFK B;  3EBE A;  1TWG B;  1PLF A;  1Q82 C;  5BR8 L;  2ZM6 Q;  3HOY B;  2L11 A;  4TSS A;  5LMU Q;  2XTI A;  1N36 L;  2MO1 A;  1EY4 A;  4C1N K;  1JB7 A;  1HR0 L;  2EYP A;  3R8B A;  1ET6 A;  1X3E A;  4DR5 L;  1YIJ A;  5KIX A;  1GUG A;  3WDN A;  1CKN A;  2F0S A;  1Q46 A;  3PSI A;  4OO1 G;  3HOV G;  5JVH 3;  3HOX B;  1KRS A;  1GOZ A;  3UDX A;  2QDB A;  4EX5 A;  4B3M Q;  3KFU A;  5EAY A;  4YY3 L;  2KQ3 A;  4A76 A;  1GUW A;  3KYH C;  1VQL A;  1RL2 A;  1S5F D;  1JB3 A;  1AEX A;  2CH4 W;  5C3E H;  1CA5 A;  2CQO A;  2H1E A;  4XYO A;  1G6Z A;  3A8I E;  4MIU A;  1DGS A;  2B2V C;  1WCM B;  5IYB H;  5J3B A;  4AIM A;  4OX9 Q;  4L5S A;  4LFB L;  3BZK A;  1CHP D;  4JI5 L;  2LS0 1;  3S14 H;  3AFQ A;  4JBJ A;  1YHA A;  4DAP A;  2F0K A;  5FJ8 H;  5I2X A;  1STE A;  1EZ8 A;  2D9U A;  1LTL A;  3C46 A;  3ONA B;  2AMC B;  1TWC H;  3O13 A;  2X69 A;  4X66 L;  5FLX E;  1PH3 A;  3CCE A;  2PQA A;  3JAM E;  5A2Q L;  2BA1 A;  3BZD B;  2BH8 A;  3MXG A;  3HOZ H;  1SMY D;  2O2L D;  3OWE B;  4B9X A;  4DR2 L;  4IJL A;  4UP8 A;  2D0O A;  3MA2 B;  3F1Z A;  3M7G A;  4X3T A;  4ZAI A;  4JI3 Q;  4DR1 L;  4NXM L;  2K5D A;  2RKS A;  1CZW A;  4C3J B;  2Z0S A;  4DNI A;  4F87 A;  3ZJY C;  3MXU A;  2I07 B;  2ZTC A;  2WFW A;  3KF8 B;  2F0W A;  5T1G A;  2EYM A;  1ESF A;  1KNE A;  2UXC L;  1JOO A;  2P5Z X;  4RA8 A;  1O80 A;  3GTM B;  1F9S A;  3K7A B;  5CV4 A;  1EYC A;  4IFD G;  3STB D;  5CV9 A;  5EGT A;  1Q3L A;  2K75 A;  3CQZ H;  4BBR B;  1W2B A;  3GTQ B;  3K0Y A;  1LTA D;  2R7Z G;  2N55 A;  4KV6 A;  1YI2 A;  1J5E L;  1KAW A;  5I4D A;  4JK1 C;  1VS0 A;  1VQ8 A;  3LNN A;  1VQP A;  2LY7 A;  1FVI A;  4IUU A;  4JI3 L;  2K14 A;  1YJN A;  4FF4 A;  3HOU B;  2QIL A;  1XMO Q;  5CV5 A;  4A3B H;  1VQO A;  1K8G A;  4DR7 Q;  4JV5 L;  4Q0F A;  3GTO H;  2MNA A;  3T1H L;  2RDH A;  3I4M B;  3KLS X;  3S1M B;  2LXK A;  1EEF D;  5IT9 E;  3UE1 A;  4JYA Q;  1EIG A;  3ZYY X;  3J7A 5;  1Y14 B;  1R4Q B;  1DOL A;  1ENF A;  3HOZ G;  3VR5 A;  1E7Z A;  3CRK C;  4IFD J;  1XPR A;  2Z6B A;  1HHV A;  1SNP A;  3MTS A;  5FO7 B;  2QW7 A;  4Y7N H;  4BBS H;  1STB A;  3HRZ C;  1TS4 A;  3SXH A;  3CCU A;  5LMN L;  1N9W A;  4PZ8 A;  4DNT B;  5JAV A;  2EOT A;  2JJQ A;  1IBK Q;  3GTL H;  1HFN A;  2A74 C;  4LF9 L;  4BY1 B;  1H9S B;  5C4J H;  5NUC A;  2JA7 G;  5CBA E;  4ZQ3 A;  2UUB L;  1D1I A;  4X65 L;  2O5I C;  2VXW A;  1NR4 A;  4AQY L;  3U9S A;  3VYU A;  4HAE A;  4XQQ A;  2K28 A;  3W2D A;  1PH6 A;  1JOK A;  3CF5 A;  2JA6 H;  3I91 A;  2A19 A;  4XT1 B;  3S9W A;  2EYO A;  3IFT A;  5A2Q E;  1EL0 A;  2EXD A;  2EXZ A;  1TQO A;  4GKK Q;  2ZXO A;  4C3H H;  1PH1 A;  3DWA A;  4HMJ A;  1MHW C;  2XIW A;  3PF4 A;  4A3D H;  5M3M H;  5HGQ A;  5C3E B;  4N8F A;  5EPK A;  1C7Y A;  1C9O A;  1FNW A;  2VW9 A;  3D4R A;  2KVM A;  2YV5 A;  4FYD A;  3PO2 G;  3PF5 A;  4GN5 A;  4KI0 A;  5M3F B;  2EVB A;  1JWS D;  4IAL A;  4FF2 A;  4E6I A;  2OQ0 A;  2NB0 A;  3KJO A;  3S2H H;  1K83 H;  2E2H B;  1XPU A;  1EWH A;  1H9J A;  3H6M A;  1IYV A;  1TWC B;  3V05 A;  2I5L X;  4EQN A;  3CME A;  1EU4 A;  1A6X A;  4CDD C;  2GVB A;  1IW7 D;  4QUC A;  1VQ7 A;  4OON A;  1KQS A;  4YWK A;  3QIA A;  3RR5 A;  3CRL C;  2JE6 I;  4R9W A;  4LAA A;  1IL2 A;  3P75 A;  1QJO A;  4QGU A;  4C56 C;  1HNZ Q;  3J81 L;  3Q0A A;  1BKB A;  3H94 A;  2OWO A;  1N34 Q;  3ERQ A;  2EJG C;  1QG7 A;  1AH9 A;  2JA5 G;  2PO4 A;  1X6O A;  1N32 L;  1Z6H A;  2F3W A;  2F0D A;  3Q22 A;  1GUT A;  5EBC A;  1IYU A;  3OW7 A;  3TZU A;  5K5P A;  4N9P A;  2BH2 A;  3A8J E;  3DM1 A;  4F7X A;  2JA6 G;  3S15 B;  4QQB X;  1Y8O B;  2Q2H A;  1YNJ D;  2L5T A;  4HMI A;  4GLV B;  4YCW A;  4LF5 L;  3U4Z A;  1VQ5 A;  3UDG A;  4P2C B;  3GDE A;  5DNF A;  4FO2 A;  2WV6 D;  1F77 A;  4A3F G;  1LTS D;  2EZV A;  3HG9 A;  4LUO A;  4RGM A;  5C6A A;  4RCO A;  3T53 B;  2F0O A;  1YNN C;  4NXN Q;  2M2L A;  1EIF A;  1S5E D;  5EPL A;  1CUK A;  4A3D G;  3KBX A;  4DV7 Q;  3D4W A;  5M3M G;  4I7Z C;  3U58 A;  2A6E D;  5HY6 A;  1KAA A;  3A7L A;  3DEP A;  1LT4 D;  2Z1C A;  4FDB A;  5I6Y A;  3M4O H;  4JVZ A;  3BDO A;  3A56 A;  1EZ6 A;  4HIK A;  1A2U A;  1CSQ A;  3U9O A;  3CKI B;  1KNA A;  3T1Y Q;  2LFN A;  2OCE A;  5EQ0 A;  1PFM A;  4EGV A;  3H09 A;  1H95 A;  4OWX B;  2E2I B;  1E2V A;  2AHO B;  2VQE L;  1WTR A;  1LAB A;  4IUP A;  4A93 G;  4ZYS A;  4Y7N B;  1JT8 A;  4DV5 L;  4BBS B;  1HPC A;  2VUM G;  1S4Z A;  3QB3 A;  4B9W A;  1X9N A;  3IKJ A;  5H1S E;  4POG A;  2IY5 B;  1DOK A;  4RG1 A;  2QA4 A;  3GTL B;  1S5D D;  1F9R A;  5C4J B;  5EPJ A;  3TP8 A;  3PV0 A;  3R3O A;  3TSS A;  1EYG A;  1Y1V H;  1NMG A;  3J7Z C;  1YJ9 A;  3H3V I;  1DM0 B;  1QVC A;  2AKW B;  4OO1 I;  4KD3 A;  2ZTE A;  3PUZ A;  2GVA A;  2NN6 H;  2ZJR A;  1MD2 D;  3C2P A;  5LL6 X;  2F3V A;  1MGS A;  3RMH A;  2DY8 A;  1TU2 B;  3TQY A;  2CH4 A;  1UAP A;  1SNO A;  3NTH A;  1PDQ A;  4H44 C;  1KC8 C;  3VR2 A;  1V1O A;  2BE5 D;  5E4W C;  4A4I A;  2HCC A;  2O5J C;  1F2Y A;  3SK5 A;  3MVV A;  2DNE A;  2J4X A;  3CC4 A;  2EJM A;  2F4I A;  2WB1 G;  2ATW A;  1D7Q A;  1CK1 A;  1PZK D;  4A3G H;  3NHH A;  5BN3 A;  3K5N A;  4DV6 L;  1PH5 A;  3IRB A;  4C2M H;  2G5D A;  1PVO A;  2EYJ A;  2M00 A;  2V1C C;  1I94 Q;  1F9P A;  3S1N H;  3M4Q A;  4KMU C;  4IJH A;  4UDU C;  1F2Z A;  2WIN B;  5M5Y B;  1V8Q A;  1EFI D;  1K8M A;  3S2H B;  1K83 B;  1V1P A;  1N33 L;  2AUK A;  4Y52 H;  2R7D A;  1WTX A;  1HA5 A;  1PH7 A;  3PUY A;  2QDL A;  1TWG H;  5JJL A;  1HA6 A;  1NE3 A;  1SYC A;  3HOW H;  2JA8 G;  1PYW D;  1D5X C;  3DHQ A;  3L9A X;  3NUC A;  5JPN C;  3KBG A;  5IYD H;  4Z9C B;  2A68 C;  4DV4 Q;  4FVM A;  3NBI A;  4H13 C;  2B2T C;  1I5F A;  1K73 C;  3D6C A;  4MTN A;  1PRT C;  4WRD A;  3GTP H;  3GO5 A;  3QR8 A;  4J15 A;  2YTV A;  2NVQ B;  2J0T D;  1H9M A;  2RVL A;  3OYY A;  2EPB A;  1XNR Q;  4IFD I;  1I4P A;  1R9T H;  1SRO A;  4GLA C;  1XX8 A;  4O0A A;  2F0E A;  2NN6 G;  2YTX A;  1JIC A;  1IBL L;  4A3I G;  2MPM A;  3DM3 A;  4GOP A;  1JWM D;  1UEA B;  1B9N A;  1LM0 A;  2E75 C;  1FJG Q;  2PNH A;  3KUP A;  1BBU A;  2HDM A;  1JCK B;  1MBY A;  2D5D A;  1TS3 A;  3CXC A;  1WCM H;  1SNM A;  5C44 G;  3OW2 A;  1V9P A;  4R4T A;  4K0K L;  5DM7 3;  4DV4 L;  4DN4 M;  1I4R A;  4K5W A;  3J7A V;  2VQF L;  4DXG A;  1RTO A;  3RLO A;  1CKN B;  1GO3 E;  1SYB A;  1TY2 A;  1GVP A;  3DXJ C;  1XNR L;  5D65 A;  4JW0 A;  4LFC Q;  4DFA A;  1PH8 A;  1B7Y B;  3QWN A;  3S2D B;  3GP7 A;  3MXN A;  4DK0 A;  4R1J A;  3RUZ A;  3CC2 A;  4MTK A;  4MHE A;  1IBM L;  1WTQ A;  1OXX K;  3RD4 A;  1SE8 A;  2F0U A;  2DGY A;  2FJ2 A;  3HOY G;  5IP9 H;  1FJG L;  1G51 A;  1S72 A;  3GTM H;  3K7A H;  1JQY D;  4A3J B;  5HGT A;  1K3R A;  3HOX G;  2IWH A;  4EQ5 A;  4DV1 Q;  4X6A H;  2UUA L;  1WTH A;  1HJP A;  3FRP B;  1Y1V B;  4F88 A;  1TII D;  1FGU A;  5GAH C;  1YHQ A;  5DM6 3;  1B70 B;  4GNX A;  2IHE A;  3SK8 A;  5J22 A;  3EIV A;  1QWY A;  2F0F A;  2NYZ D;  2PQA B;  4IZ8 A;  2Z9H A;  3HP3 A;  4LF6 L;  2HIX A;  1EEI D;  3HOU H;  4DR4 Q;  4FNF A;  3P1H A;  1HNX L;  1SBB B;  4XTC S;  4WOR A;  3PCO B;  4G4K A;  2KBN A;  1WCM G;  4LNQ A;  4CGY B;  1EQV A;  5IGD A;  4JC0 A;  2K50 A;  5BN5 A;  2O4X A;  4X62 Q;  1KRT A;  1EWC A;  2IPK D;  4OEL B;  1I4X A;  5E1F A;  1KLG D;  1KAB A;  2ES2 A;  3PO3 B;  1CFM A;  3C1E A;  3S1N B;  3BVG A;  1U4L A;  1J9O A;  2Z6K C;  3JC6 6;  2L55 A;  1LYL A;  4C3J G;  1BO0 A;  1SMY C;  2F0T A;  1W3S A;  3NEM A;  5I9O A;  1PFB A;  4DPG A;  3I2Z A;  2RSO A;  2ZJQ A;  2HQE A;  4JG2 A;  5IT9 c;  1I4Q A;  1E2W A;  2UU9 Q;  3J80 c;  4JI4 Q;  4H02 A;  4BY1 H;  4PMW A;  3HOW B;  1HCZ A;  2NVY H;  1A15 A;  3E0E A;  2NVT H;  2UXD L;  2XSC A;  2RA4 A;  3K7U C;  4B3T L;  4XIG S;  3GTP B;  5JEA H;  1RF2 D;  4BBR G;  1RJT A;  1XTC D;  2B39 A;  3OHX C;  5KYI A;  4DUY Q;  4M8A A;  4CKE A;  4K5V A;  2KEN A;  1XNQ Q;  3STB C;  4LW1 A;  2CW0 D;  1YIT A;  5AFW A;  1M90 C;  1R9T B;  1BBW A;  3IFD A;  1PYS B;  1GUN A;  4XQN A;  1CSP A;  3P7J A;  1HH2 P;  4DV3 Q;  3VR3 A;  1ZYR D;  1STY A;  4B08 A;  3KF6 A;  2QEJ C;  3HOU G;  3Q24 A;  4A3K H;  4RKB A;  4X3S A;  4LF8 Q;  1C48 A;  3SDZ A;  2F0G A;  4DR6 L;  3G6J B;  2V4D A;  3EA6 A;  1SNQ A;  1HXY D;  1NUC A;  3NE5 B;  4ZUJ A;  1CHQ D;  1O78 A;  1B1Z A;  5M3F H;  4TVA B;  2RDF A;  5FK9 C;  3I4M G;  2K1B A;  2SEB D;  4I65 A;  2ZM6 L;  4BY7 H;  1CM9 A;  1TWF H;  3MHB A;  2E2H H;  5LMU L;  1K9M C;  1IYJ B;  4L5R C;  1YJW A;  1B44 D;  2LKV A;  3RLF A;  3LGJ A;  4HN7 A;  3K5L A;  5CV6 A;  2NWG A;  3S16 H;  4B3M L;  3N6R A;  1FGB D;  1ENA A;  5IE8 A;  1KDC A;  4P71 A;  4P73 A;  4FP5 D;  2G9H D;  2SOB A;  1E2Z A;  1TKW B;  2KCM A;  1Y8P B;  5T1I A;  4BY1 G;  5CR3 A;  4PV1 C;  2KCN A;  2KHJ A;  1JMC A;  5IGG A;  4HJ9 A;  1SND A;  4DR3 Q;  1IKL A;  1K3B C;  1AFP A;  3SHL A;  3KJP A;  4LUV A;  4RGN A;  2M9V A;  2PZW A;  4OX9 L;  3S15 H;  1AW7 A;  3CAM A;  3H0G H;  1G6P A;  2VB3 X;  1P8L A;  4CJ1 B;  1XYI A;  3AFP A;  3FKI H;  2N3S A;  4RH6 A;  2DJF C;  4JBM A;  1DOM A;  2K5W A;  1VDZ A;  3J81 i;  1P16 A;  2N88 A;  3BDC A;  3HS0 C;  3KK7 A;  2IW3 A;  5C3E G;  3PQI A;  4QIW B;  2N78 A;  3P20 A;  2JN4 A;  3AQQ A;  3WOF A;  3GTJ H;  5IYB G;  5IWA Q;  5M3F G;  3W3A A;  1GXD C;  2EE1 A;  5IP7 H;  4TQU S;  4ODG A;  1PH9 A;  4YCV A;  3R93 A;  4R4I A;  4K14 A;  1QVF A;  5COR A;  5FJ8 G;  2D0P A;  4IUT A;  4JPB W;  3ERO A;  3VA7 A;  1NR2 A;  4NMZ A;  3TZD A;  2E74 C;  4DV2 Q;  2E2I H;  3I4N H;  1BUV T;  3D3R A;  2B3G A;  2F4V Q;  2B8G A;  4DAM A;  4BA2 I;  1II3 A;  1FNV A;  5I2Y A;  1EY8 A;  1VQB A;  3M3Y H;  1IW7 C;  4OHJ A;  5LL6 S;  1K0R A;  1HUM A;  1X3F A;  4HJA A;  1SNC A;  2HD3 A;  3RN5 A;  1LAC A;  4XT3 B;  2UXB Q;  4KN4 C;  2CQA A;  3MAQ A;  5KRU A;  2C35 B;  2NVY B;  1XMO L;  2NVT B;  1F2L A;  1UNS A;  4DR7 L;  1K8O A;  1Y1W H;  5KNC A;  3PGZ A;  3C3L A;  3F2D A;  1ROD A;  1A62 A;  2DNC A;  3VA5 A;  5CMD A;  1YEZ A;  3B6Y A;  1TVX A;  4JYA L;  2AQ2 B;  2NN6 I;  1ASZ A;  1YNJ C;  1UE5 A;  4O1N A;  1VQ4 A;  3DUZ A;  3EVQ A;  3S24 A;  1TWH H;  1EIH A;  3HFZ B;  2LMC B;  1VQI A;  3S17 B;  2RHS B;  4A3K B;  3BVZ A;  3OIP A;  1EY9 A;  4KK7 A;  2EY2 A;  3AU7 A;  3CD6 A;  1HQR D;  3NK9 A;  4A3B G;  1UE1 A;  4OIJ A;  4KHZ A;  3EN2 A;  1BR9 A;  2A6H D;  1IBK L;  5IP7 G;  1QB5 D;  3UE0 A;  3ND9 A;  4K5X A;  4QIW E;  1WJJ A;  4JI2 Q;  2LXJ A;  5M5Y H;  4BY7 B;  2L4N A;  1Y8N B;  1TWF B;  2AWN A;  4HSP A;  3K6O A;  4QL5 A;  4XYQ A;  3GV3 A;  2K5N A;  4HJ7 A;  4ZK9 B;  1HUN A;  1T5E A;  1SYF A;  1X3Q A;  1SDF A;  4O2D A;  1BNZ A;  3S16 B;  2A69 D;  3BS1 A;  4BBS G;  3AMU A;  2K7V A;  4JOI A;  1VQA A;  4ZCK A;  3NPP A;  4K8I A;  5KGU A;  3NBH A;  1L1O A;  4GKK L;  5JJI A;  1YBY A;  3AYH B;  2D2C C;  2JEA I;  3CCM A;  4M1U B;  1MI2 A;  2NVQ H;  1BVS A;  1NTG A;  2MO0 A;  1J8I A;  1U4R A;  4B3S Q;  4LF4 Q;  3D6W A;  1Z9F A;  1Q86 C;  4GKJ Q;  2ZXR A;  4GLX A;  4R8I A;  4JI2 L;  2KUM A;  1HZB A;  1WYD A;  2SNM A;  4TRD A;  3H0G B;  3VYS A;  3SE0 A;  4KLK A;  4L5T A;  1V1P B;  2SDF A;  4IN3 A;  3FKI B;  1RHP A; 
#chains in the Genus database with same CATH homology
 3D0F A;  3GTP H;  3GO5 A;  4LF9 Q;  1SLJ A;  2WB1 E;  4JBW A;  3CCJ A;  1Q7Y C;  4IOA A;  4YWM A;  4J15 A;  1QZG A;  5JEA J;  5C0X J;  3F2B A;  2HQL A;  2YTV A;  4UP9 A;  4AYB E;  5LMN W;  5FLM H;  2UUB Q;  4HJ8 A;  2D62 A;  4X65 Q;  1I3Q H;  3PUW A;  3OYY A;  4DK3 C;  1HNW Q;  4BXX G;  1XNR Q;  4IFD I;  1PFS A;  4AQY Q;  1MJE A;  1IZ6 A;  1R9T H;  4DR6 Q;  1SRO A;  4GLA C;  2RF4 A;  1NY4 A;  4O0A A;  4A75 A;  2UUC L;  2NN6 G;  4OWW B;  2YTX A;  3PO2 H;  3W1B A;  1HNZ L;  3FP9 A;  1HZA A;  2XGT A;  3EBE A;  2E8G A;  5ELO A;  3I55 A;  1IBL L;  3I4O A;  1VQM A;  2QEX A;  1N34 L;  1OXT A;  1UE6 A;  1Q82 C;  5BR8 L;  2ZM6 Q;  2WAQ E;  4A3I G;  3DM3 A;  4GOP A;  4PZ7 A;  4DK6 C;  1LM0 A;  5LMU Q;  1FJG Q;  2PNH A;  2XTI A;  1N36 L;  2MO1 A;  1BBU A;  1JB7 A;  1HR0 L;  2PI2 A;  3S2D H;  1X3E A;  1LUZ A;  4DR5 L;  5IWA L;  3CXC A;  1WCM H;  3BZC A;  5C44 G;  1YIJ A;  1CKN A;  1JJ2 A;  3RZO H;  1Q46 A;  1V43 A;  2OQK A;  3PSI A;  3HOV G;  4OO1 G;  3OW2 A;  5ELN A;  1V9P A;  1KRS A;  3I7F A;  1XPO A;  3UDX A;  4R4T A;  2R7F A;  4EX5 A;  4UY8 C;  4K0K L;  2MQH A;  4B3M Q;  3H0G G;  5C4X H;  4DV4 L;  1WOC A;  2CKZ B;  5EAY A;  3KFU A;  1VQK A;  4YY3 L;  1E1T A;  3PUV A;  4A76 A;  4A3M H;  4GOP B;  3KYH C;  3VDY A;  3FKI G;  3CCV A;  1VQL A;  2VQF L;  2K5V A;  2B29 A;  5DLQ E;  1OXU A;  1Q8K A;  4A3J H;  1RL2 A;  4NXN L;  4IPG A;  4DV2 L;  1UE7 A;  2F4V L;  4DV7 L;  2N8N A;  2R6G A;  3RLO A;  1CKN B;  1GO3 E;  3ULP A;  2JA5 H;  1PHJ A;  5C3E H;  1VQ9 A;  3A5Z B;  1XJV A;  1GVP A;  1C0A A;  1X54 A;  2CQO A;  1XNR L;  1PYB A;  2ZTD A;  1S3O A;  2ID0 A;  4YHH Q;  4LFC Q;  4PG3 A;  1EFW A;  4IPH A;  1PH8 A;  1AE3 A;  1B7Y B;  1DGS A;  1HZ9 A;  1EWI A;  5IYB H;  5J3B A;  4DUZ Q;  4R1J A;  4AIM A;  3CC2 A;  4OX9 Q;  1IBM L;  1S40 A;  4L5S A;  4LFB L;  4YCU A;  3BZK A;  2PMZ E;  4JI5 L;  1A8V A;  3S14 H;  1OXX K;  2HHH Q;  1SE8 A;  3AFQ A;  4JBJ A;  1YHA A;  2DGY A;  1SRU A;  3OTO Q;  3HOY G;  2UXB L;  4A3F H;  5IP9 H;  1FJG L;  1G51 A;  2NVX H;  1QUQ A;  3T1Y L;  1S72 A;  5FJ8 H;  3M4P A;  3PIO A;  3GTM H;  3K7A H;  3F8T A;  1LTL A;  2AMC B;  4OXP A;  1TWC H;  1PH3 A;  4X66 L;  3CCE A;  2PQA A;  2BA1 A;  1K3R A;  2BH8 A;  3HOZ H;  3I4N G;  3MXN B;  4NPS A;  1E22 A;  1EOV A;  3CC7 A;  4RMF A;  3HOX G;  4IJL A;  5FLM G;  4DR2 L;  4UP8 A;  2D0O A;  4EQ5 A;  4DV1 Q;  4X6A H;  3F1Z A;  3J81 c;  2UUA L;  2IX0 A;  5GAG C;  4JI3 Q;  1N32 Q;  2MFI A;  1HJP A;  1U0L A;  4DR1 L;  4NXM L;  1X56 A;  2JEB I;  2Z0S A;  1FGU A;  1EUJ A;  4DNI A;  3ZJY C;  4AYB G;  5GAH C;  4JBK A;  1QUQ B;  1YHQ A;  1B70 B;  2ZTC A;  2IHE A;  1VCI A;  2WFW A;  4GNX A;  4A3C H;  1UWV A;  3PO3 H;  3KF8 B;  3EIV A;  3PUX A;  4LF5 Q;  3RNU A;  2PQA B;  2E5L Q;  3KOJ A;  2UXC L;  4LF6 L;  1WFQ A;  2HIX A;  1KHI A;  3HOU H;  4DR4 Q;  1YVC A;  1HNX L;  1X65 A;  2CWA A;  4XTC S;  3CCL A;  3PCO B;  2KBN A;  4KHP Q;  1WCM G;  4LNQ A;  4IFD G;  1VQJ A;  1CKM A;  3STB D;  4JC0 A;  1Y1W G;  4GN3 B;  4JOI C;  2VL6 A;  2K50 A;  2K75 A;  3CQZ H;  4GNX B;  1PV4 A;  1W2B A;  4A93 H;  4X62 Q;  1KRT A;  1QVG A;  2R7Z G;  1Q1B A;  1L1O C;  2K52 A;  1YI2 A;  2KCT A;  1J5E L;  2ASB A;  3G71 A;  2VUM H;  1VQD A;  2EQS A;  5AJ3 Q;  1KAW A;  1OTC A;  3TS2 A;  3CPF A;  2A1A A;  1IXR A;  2ES2 A;  4JI6 Q;  4OWT B;  4A3J G;  1VS0 A;  4B3R Q;  4A3E H;  1VQ8 A;  2JQO A;  2VY3 A;  1VQP A;  1VQG A;  3Q8D A;  1A0I A;  2RHQ B;  1PA6 A;  4LF7 Q;  1FVI A;  4APV A;  1YJN A;  4JI3 L;  2K14 A;  2Z6K C;  1GD7 A;  3JC6 6;  3M7N A;  2KHI A;  1Y1V G;  1LYL A;  1XMO Q;  1YHB A;  5C0X I;  1W3S A;  3NEM A;  4A3B H;  1VQO A;  4R4O A;  4DPG A;  1K8G A;  3I2Z A;  4DR7 Q;  4JV5 L;  2PI2 E;  2ZJQ A;  3ER0 A;  4JG2 A;  3WWV A;  1X3G A;  3A0J A;  5IT9 c;  2VQE Q;  3GTO H;  1I94 L;  2MNA A;  2UU9 Q;  4JI4 Q;  3J80 c;  3T1H L;  4H02 A;  4DV5 Q;  4BY1 H;  4PMW A;  2LXK A;  2I5H A;  2QGQ A;  4LFA Q;  3UE1 A;  2NVY H;  4JYA Q;  2H5X A;  4KHP L;  3J7A 5;  1Y14 B;  3E0E A;  2OTL A;  3G4S A;  3TRE A;  2NVT H;  4B3S L;  4LF4 L;  2UXD L;  4HIM A;  3HOZ G;  3I56 A;  4HJ5 A;  3K7U C;  1E7Z A;  4B3T L;  4XIG S;  4IFD J;  3H15 A;  1XPR A;  3PIP A;  4DV0 Q;  4R4C A;  4GKJ L;  4BBR G;  1T9H A;  4JI8 Q;  4A3L H;  3AEV A;  4Y7N H;  2DUD A;  4BBS H;  4DUY Q;  1YNX A;  3HKS A;  2KEN A;  4A3G G;  1VQN A;  1XNQ Q;  3STB C;  1X55 A;  4LWC A;  4LW1 A;  3CCU A;  4JI6 L;  3U4V A;  1YIT A;  1M90 C;  4A3C G;  5LMN L;  3K0X A;  1I50 H;  1N9W A;  3K81 C;  4PZ8 A;  1BBW A;  4YWL A;  1PYS B;  2NZO A;  3NEN A;  1IBK Q;  1CSP A;  2JJQ A;  3GD7 A;  3GTL H;  1HH2 P;  4DV3 Q;  4P72 A;  2B63 H;  2Q2I A;  4LF9 L;  2VS1 A;  1M1K C;  3KF6 A;  5C4J H;  4IPC A;  1VQ6 A;  3HOU G;  4A3K H;  2JA7 G;  3UDF A;  4JI1 Q;  2UUB L;  2WP8 J;  4X65 L;  3TS0 A;  4LF8 Q;  1HNW L;  4AQY L;  4DR6 L;  1SR3 A;  5GAE C;  1VQE A;  1ASY A;  1UEB A;  2CWP A;  2Y0S G;  3CPW A;  1PH6 A;  1SFO H;  3CF5 A;  2JA6 H;  2R92 H;  3NEL A;  2A19 A;  5IY0 A;  4TVA B;  5M3F H;  3I4M G;  1E1O A;  2JA8 H;  1JJC B;  3L0O A;  2ZM6 L;  1CKO A;  3HOW G;  4DV6 Q;  3KF6 B;  3D31 A;  4BY7 H;  1G29 1;  5IYD G;  1TWF H;  5FLX c;  2E2H H;  5LMU L;  2EXD A;  3JAM c;  2A8V A;  1K9M C;  2OTJ A;  4JI0 Q;  1IYJ B;  4P74 A;  4GKK Q;  4L5R C;  1KXL A;  1YJW A;  3RLF A;  3LGJ A;  3ICE A;  1U5K A;  4C3H H;  1PH1 A;  4A3D H;  3PF4 A;  3RZD H;  3S16 H;  2VNU D;  5M3M H;  2ZJP A;  5HGQ A;  4B3M L;  3J81 j;  1N33 Q;  4JI7 Q;  4BXX H;  1C7Y A;  1C9O A;  2VW9 A;  5IE8 A;  2YTY A;  4P71 A;  4P73 A;  1K8A C;  2RCN A;  2YV5 A;  2HIV A;  4UPA A;  1XMQ Q;  3PO2 G;  3PF5 A;  4GN5 A;  4KI0 A;  2KCM A;  1N8R C;  4ME3 A;  2BA0 A;  4BY1 G;  4BA1 I;  2OQ0 A;  5GQO A;  2KHJ A;  4A3I H;  3KJO A;  1JMC A;  3S2H H;  1K83 H;  5M5W H;  2IHF A;  1XPU A;  4HJ9 A;  4LFC L;  4YHH L;  1GKH A;  3GTK H;  3DLL A;  4DR3 Q;  1L0W A;  3ULJ A;  3H3V H;  3BJU A;  4POF A;  2Y0S E;  4DUZ L;  2I5L X;  1SN8 A;  5C0X G;  5C44 H;  3KJP A;  4LUV A;  3BU2 A;  3CME A;  1NBW A;  4A3L G;  2GVB A;  3JAM i;  3HOV H;  4OX9 L;  3S15 H;  3CAM A;  1VQ7 A;  4OON A;  2E2J H;  1EQQ A;  1KQS A;  4YWK A;  3H0G H;  2HHH L;  3RR5 A;  1G6P A;  1JE5 A;  5C4X G;  2LSS A;  3OTO L;  4GNX C;  2JE6 I;  5K36 G;  1A63 A;  1I6H H;  1P8L A;  1IL2 A;  2F3I A;  4A3M G;  4QGU A;  2UUC Q;  3AFP A;  3FKI H;  2N3S A;  3G6E A;  1HNZ Q;  2K4K A;  4JBM A;  3J81 i;  1IBL Q;  1P16 A;  1BKB A;  1KD1 C;  2OWO A;  1N34 Q;  5BR8 Q;  3CP0 A;  1AH9 A;  2JA5 G;  4DV1 L;  5C3E G;  1X6O A;  2Z6K A;  5IYC H;  1N32 L;  1MJC A;  2N78 A;  1L2F A;  3M9B A;  3AQQ A;  4HID A;  1N36 Q;  1HR0 Q;  2CCZ A;  1OXS C;  3GTJ H;  4DR5 Q;  5IYB G;  3CCQ A;  5IWA Q;  3K8A A;  4NB3 A;  2BH2 A;  2JA6 G;  4QQB X;  2I5M X;  1Q12 A;  5M3F G;  2Q2H A;  4ALP A;  3G48 A;  4JCV E;  4GLV B;  4YCW A;  5IP7 H;  3A5U A;  4LF5 L;  3U4Z A;  1E3P A;  2YYZ A;  1VQ5 A;  3UDG A;  2E5L L;  4K0K Q;  4TQU S;  3GDE A;  1RIP A;  4QY7 A;  4YCV A;  1PH9 A;  1HR0 W;  4R4I A;  1QVF A;  3HOY H;  3FHW A;  3L7Z C;  5JJK A;  4A3F G;  4DR4 L;  5IP9 G;  4YY3 Q;  3RN2 A;  1D8L A;  4LUO A;  5FJ8 G;  2NZH A;  2D0P A;  2IX1 A;  2VQF Q;  4NXN Q;  4DV2 Q;  2E2I H;  1EIF A;  3A74 A;  3HKZ G;  1CUK A;  3E9H A;  1EIY B;  3I4N H;  4A3D G;  2B3G A;  2F4V Q;  3HOX H;  4DV7 Q;  5M3M G;  1KIX A;  4GN4 B;  4DAM A;  3U58 A;  4BA2 I;  3S1Q H;  3S1R H;  4X62 L;  5HY6 A;  4C3I H;  4GS3 A;  1KL9 A;  4QJF A;  1VQC A;  1VQB A;  1VQF A;  3MEF A;  4FDB A;  4PZ6 A;  5AJ3 L;  3M3Y H;  1E24 A;  3U50 C;  1K0R A;  4B3R L;  3M4O H;  1IBM Q;  1J6Q A;  1NMF A;  1X3F A;  3PO3 G;  4HJA A;  3RN5 A;  4LFB Q;  4JI5 Q;  1V1Q A;  2GN5 A;  4LF7 L;  4GOP C;  3M85 A;  4HIK A;  3S17 H;  2UXB Q;  1CSQ A;  2R93 H;  3T1Y Q;  5M5X H;  2C35 B;  2OCE A;  3CCR A;  1H95 A;  1XMO L;  3J80 i;  4OWX B;  4X66 Q;  3CW2 C;  4DR7 L;  3ULL A;  2EIF A;  1Y1W H;  2AHO B;  3TRZ A;  1EQR A;  2VQE L;  4DR2 Q;  3PGZ A;  2UU9 L;  3F2D A;  4JI4 L;  1A62 A;  4A93 G;  1JT8 A;  2R7Z H;  4DV5 L;  2UUA Q;  1YEZ A;  4DR1 Q;  4NXM Q;  4LFA L;  2VUM G;  3B6Y A;  3K80 C;  4JYA L;  2NN6 I;  1ASZ A;  2YU9 H;  1GM5 A;  5GRO A;  3ERS X;  1UE5 A;  3HKZ E;  3L2P A;  1X9N A;  3TEH B;  5H1S E;  4POG A;  1TXY A;  1VQ4 A;  3S24 A;  2IY5 B;  1TWH H;  4A3E G;  4WJ4 A;  4RG1 A;  2QA4 A;  3HFZ B;  1VQI A;  4UP7 A;  3F2C A;  4DV0 L;  1Q1E A;  4P75 A;  4JI8 L;  2Q2U A;  2UXC Q;  2RHS B;  5IYC G;  4IPD A;  4LF6 Q;  3PV0 A;  4DUY L;  3E9I A;  3UDI A;  1HNX Q;  1EYG A;  1MKH A;  1NMG A;  1Y1V H;  4MZ9 A;  3KDF A;  4DKA C;  4C3J H;  3J7Z C;  1YJ9 A;  1XNQ L;  1QVC A;  3CD6 A;  3H3V I;  1O7I A;  4A3B G;  1UE1 A;  4HIO A;  2AKW B;  4KHZ A;  4OO1 I;  3EN2 A;  2ZTE A;  3PUZ A;  5E7N A;  2GVA A;  5IP7 G;  4DV3 L;  1B8A A;  2ZJR A;  1IBK L;  3SGI A;  3UE0 A;  4QIW E;  4X64 Q;  1WJJ A;  3TQY A;  4JI2 Q;  1JJG A;  2LXJ A;  4MNO A;  1J5E Q;  4JI1 L;  1MIU A;  4IO9 A;  1OXV A;  5M5Y H;  4LF8 L;  1KC8 C;  1YZ6 A;  1VQH A;  2AWN A;  3KDF B;  4QL5 A;  4A4I A;  4IOC A;  1Q81 C;  2JK8 A;  2VZA A;  3RLN A;  2FXQ A;  3W5O A;  2K5N A;  4BBR H;  4HJ7 A;  5JEA G;  2HT1 A;  3CC4 A;  1SMX A;  3GTQ H;  3CMA A;  2IT1 A;  2WB1 G;  4O2D A;  2ATW A;  1D7Q A;  4BBS G;  2I0Q A;  2L15 A;  4L5Q A;  3W1G A;  4JOI A;  4DAY B;  4DV6 L;  3KLW A;  3IRB A;  1VQA A;  1PH5 A;  4C2M H;  1XTD A;  4JV5 Q;  1PVO A;  4JI0 L;  1L1O A;  1WI5 A;  2CFM A;  4GKK L;  4R4Q A;  2V1C C;  1I94 Q;  5JJI A;  3S1N H;  1Z47 A;  3M4Q A;  1PH2 A;  2B63 G;  3T1H Q;  4IJH A;  1AE2 A;  1YBY A;  2AWO A;  3AYH B;  2R93 G;  2JEA I;  2JA9 A;  2JA7 H;  3GTG H;  4A3K G;  3CCM A;  4LUZ A;  3CCS A;  1N33 L;  4JI7 L;  1BVS A;  1NTG A;  1TWA H;  2MO0 A;  2R7D A;  2WAQ G;  1NJI C;  2NVQ H;  4Y52 H;  4B3S Q;  4LF4 Q;  2UXD Q;  1Z9F A;  4B3T Q;  1XMQ L;  1PH7 A;  3PUY A;  1Q86 C;  4GKJ Q;  3NBH B;  1L1O B;  4GLX A;  4X64 L;  2K5H A;  1TWG H;  2R92 G;  4JI2 L;  1NE3 A;  3I4M H;  5JJL A;  1HZB A;  1WYD A;  2Q2T A;  3HOW H;  3S1M H;  2JA8 G;  1HZC A;  4BY7 G;  1FL0 A;  4AH6 A;  5IYD H;  5GAD C;  2F52 A;  4DV4 Q;  2ALY B;  4KLK A;  1QZH A;  5LMN Q;  4A3G H;  4DR3 L;  4L5T A;  4WJ3 M;  1I5F A;  1K73 C;  2N49 A;  4MTN A;  1PH4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...