1KRSA

Solution structure of the anticodon binding domain of escherichia coli lysyl-trna synthetase and studies of its interactions with trna-lys
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
110
structure length
110
Chain Sequence
FRRDHTSDQLHAEFDGKENEELEALNIEVAVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDDLPEGVYNEQFKKWDLGDILGAKGKLFKTKTGELSIHCTELRLLTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the anticodon-binding domain of Escherichia coli lysyl-tRNA synthetase and studies of its interaction with tRNA(Lys).
pubmed doi rcsb
source organism Escherichia coli
molecule tags Aminoacyl-trna synthetase
molecule keywords LYSYL-TRNA SYNTHETASE (PRODUCT OF LYSS GENE)
total genus 14
structure length 110
sequence length 110
ec nomenclature ec 6.1.1.6: Lysine--tRNA ligase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1krsA00
1VQ5A 2H5XA 4P75A 3DLLA 5FJ8H 3L7ZC 2NVXH 1BBUA 4DUZL 3OTOQ 1VQFA 1WCMG 2E5LL 4IJHA 1U5KA 2YTYA 4DR5L 1HNXL 2F4VQ 1CKNB 1VQBA 1L2FA 3KJOA 2IY5B 1TWAH 1K73C 4IO9A 1KQSA 4TVAB 2UXCQ 1X65A 3PUVA 1FGUA 1QZGA 3OW2A 1GM5A 4LFAL 2Z6KC 1VQHA 4YWMA 2NVTH 2RCNA 1Y1WG 1MJEA 4R4OA 4GN5A 2VW9A 1OXTA 1XNQQ 4DR4Q 5JJLA 1EUJA 1O7IA 1EFWA 3U50C 1E1TA 4DV4Q 3CQZH 3A74A 2KCMA 4JI3Q 4LF9Q 5LMNW 4R4CA 3KLWA 1G6PA 1WOCA 4UPAA 1KRTA 1HNXQ 4C3IH 1K83H 1GVPA 3F1ZA 4YCUA 3D31A 1HR0L 1L1OA 2PI2A 3KF6A 3A0JA 2K5VA 3I4OA 1S3OA 1W3SA 3D0FA 2JA6G 2N49A 4NXNL 2MFIA 2A19A 2F3IA 5K36G 1TWFH 3PSIA 4DR3L 2R92H 1VQDA 1TWGH 2AWOA 1YJNA 4OWXB 4DK6C 3TQYA 1N33Q 1PYSB 2VQEL 4YCVA 2R92G 2EIFA 4LF9L 1A0IA 1I5FA 4EX5A 4QIWE 1YITA 5M3FH 2E5LQ 3LGJA 4DV0Q 1P8LA 1PH4A 5JEAG 4LF6Q 2PI2E 1VQOA 1IBML 4A3FG 3AFPA 3GD7A 2GN5A 4A76A 2UXCL 1GKHA 4JC0A 1PA6A 3CC2A 4R4IA 4K0KL 4JI0Q 4MNOA 4HJ7A 4DR4L 2EQSA 4DV3L 3HOUG 5HY6A 1VQ4A 3TEHB 5HGQA 2ID0A 4A3DG 3PF5A 1V1QA 4DAYB 2DGYA 2WB1E 3KDFA 4IOAA 1JJGA 4A3GH 1YNXA 3G4SA 2K75A 1I6HH 1QUQB 2VNUD 3EBEA 4A3EG 2UXBQ 1I94L 5IP7G 4JI4L 2YTXA 1VQJA 3CXCA 3J81i 1W2BA 5M5YH 3CCMA 4A4IA 4K0KQ 4JBKA 3PF4A 3PO3H 3UDGA 4JI2L 4NXMQ 3GTKH 1SE8A 1VQ7A 4DV5Q 3RN2A 2I0QA 1S72A 2NN6G 1Y1VH 5GAEC 3S1RH 5IY0A 1XJVA 2A1AA 2JA9A 1HNZQ 1M90C 4BBSG 4A3KG 3OYYA 5H1SE 4A75A 2OCEA 3CMAA 2UUAQ 2XGTA 1EIFA 2CFMA 3KF6B 4PZ8A 1U0LA 5ELNA 3KOJA 2N3SA 3S1MH 5C0XG 2Q2IA 4DR2Q 2NVYH 1PH5A 1IYJB 2NN6I 4X64Q 4P74A 1M1KC 1EOVA 3M3YH 4P72A 1PH7A 4DV2L 3RLOA 1L0WA 1MJCA 2NZHA 3KYHC 5FJ8G 2UUBL 4RG1A 4APVA 2ZTDA 3FHWA 1NMFA 5M3FG 1N9WA 2Z0SA 4IFDG 1XMOL 4OXPA 4JYAQ 1Q1BA 4GNXC 1YEZA 3RZDH 4QJFA 1JE5A 5IYCG 1YHAA 2N8NA 1NJIC 4A3BH 2E2IH 2D0OA 4GKKQ 3AYHB 5M5WH 2ZTCA 3S24A 3RR5A 5C3EH 1KC8C 4YY3Q 1XNRQ 3UE0A 3BZKA 4DV4L 1VQKA 1Z47A 4LFCL 3HOYG 3J7A5 2GVBA 1N36Q 2R7DA 2VQFL 4A3LH 1CUKA 1P16A 4GN4B 3I55A 4LUZA 4POFA 1YIJA 4A3LG 2C35B 3HFZB 4X65L 4DR7L 4O0AA 3GO5A 4BA1I 2YU9H 4MZ9A 1DGSA 4A3KH 4YHHQ 4NXNQ 1B7YB 2Q2TA 4L5TA 3TS0A 3M4OH 3GTMH 2VL6A 2R6GA 5IE8A 1J5EQ 4BY7G 4LFBQ 3JC66 3CPWA 4DUZQ 1OTCA 1C0AA 1E3PA 4DK3C 4POGA 4BXXH 3KFUA 4A93H 1E7ZA 3J80i 2OQKA 2KBNA 4LNQA 1G291 4DV7L 1I50H 4JCVE 5IYBG 2ALYB 3NBHB 4LF6L 2UXDL 5IYBH 2UU9Q 3CCLA 5GADC 4HJ5A 1RL2A 3G48A 4KLKA 2YYZA 4DV1Q 1V9PA 1ASYA 2PQAB 2JA8H 3F2CA 4A3GG 1WJJA 5M3MG 1IBKQ 3I4MH 4GKKL 4OO1G 4JI6L 1FJGQ 2JA7G 1XTDA 4L5SA 1BBWA 1VCIA 1PHJA 1RIPA 1MIUA 4PZ6A 4JI1Q 2VUMH 4LWCA 5E7NA 3PUYA 3H0GG 4BA2I 2HIXA 1LUZA 3CPFA 2NVQH 1H95A 2AKWB 4P73A 4QL5A 2RHQB 4JV5Q 3GTGH 4A3CH 2YV5A 1X55A 4QQBX 2K50A 3PUZA 4X64L 1L1OB 4C2MH 1N34Q 1HNWQ 5M5XH 2R93H 1LM0A 1SN8A 1X3FA 2GVAA 2I5MX 4LF4Q 1OXVA 3TS2A 2WAQG 3FKIH 4GLAC 3TRZA 2LSSA 4A3EH 4YWLA 3EIVA 4AQYQ 3CCUA 5C0XJ 3GTOH 2E2HH 2Y0SG 4XIGS 4WJ3M 2PNHA 3TREA 2PQAA 3W1GA 1VQEA 4B3MQ 3AFQA 3J80c 3HOZH 4X6AH 2IHFA 1VQMA 4OX9L 3CCEA 4X62L 1KXLA 4C3HH 1Q1EA 4HIMA 1IBMQ 2IT1A 4O2DA 2FXQA 5IT9c 2K5NA 4JBWA 3STBD 4ALPA 3HOUH 2R93G 4GN3B 1UE7A 4R1JA 1OXXK 2CCZA 1NBWA 4L5QA 2AMCB 2K52A 5IWAL 2JE6I 2YTVA 1I3QH 1EYGA 4JI6Q 4EQ5A 4A3FH 1S40A 4R4TA 3F2DA 4B3RL 1Y1WH 1D7QA 2ZM6Q 2JJQA 3ERSX 4DV0L 4LF8L 1XNQL 3H3VH 4GNXB 3H3VI 4HJ9A 1UE5A 2V1CC 4XTCS 1YVCA 2QA4A 2BA1A 3I4NG 1VQAA 2OQ0A 3I2ZA 3S1NH 4C3JH 1SFOH 1VQPA 1IBLQ 1K8AC 1J6QA 2NZOA 2K14A 1WCMH 5IWAQ 4R4QA 3K80C 4AIMA 1C7YA 3A5UA 2UXDQ 2ATWA 4RMFA 4JG2A 5JJIA 1A63A 1YHQA 4B3RQ 3M4PA 1WFQA 2JEBI 2N78A 1N8RC 2HHHQ 1SRUA 1UE6A 4AYBG 5IP9G 1IBKL 1TWCH 3HKZE 3K7UC 4BY1H 1QVFA 4IPGA 4IPHA 2JEAI 1E22A 5LMUQ 4BBSH 2JA5H 3S16H 1Z9FA 1VQLA 1EQRA 1PFSA 4IPDA 3S15H 5ELOA 1Q12A 3GTPH 4IPCA 1D8LA 3CCJA 1BKBA 3T1YL 2JA8G 1Q7YC 1UE1A 1SROA 3CCSA 2ZJQA 1HZ9A 2OTLA 2KHJA 1TXYA 4AYBE 3F2BA 5BR8Q 4A3IG 1HNZL 1VQ8A 3A5ZB 1A8VA 1ASZA 3J81j 1L1OC 1KL9A 4JI7L 3PO2H 5GROA 5FLXc 4GKJQ 1YJ9A 1K9MC 4A3DH 1XNRL 1VQ9A 1SR3A 1NY4A 4HIDA 4IFDJ 1NE3A 4LUOA 4A3CG 1XPRA 2EXDA 1SLJA 5LMNQ 4GLVB 4A3IH 2BH2A 2A8VA 1VQCA 5IYDG 3JAMi 2Q2UA 3IRBA 4L5RC 2Z6KA 3U4ZA 4DNIA 3I7FA 1I94Q 4JI4Q 4MTNA 1XMQL 4WJ4A 3H15A 1CSQA 4JOIC 1IZ6A 1HNWL 3EN2A 4DKAC 2UUCL 1CKMA 4A3MG 4JI0L 1YHBA 3E9HA 3G71A 4B3TQ 2MO0A 3PIPA 5LMUL 5AJ3Q 1JJCB 4BY1G 4LFBL 4JI3L 3UDXA 4Y52H 1Q46A 2UUAL 3U58A 1N36L 2WFWA 4LF8Q 3M4QA 4OONA 1G51A 4BBRG 1AE3A 4NPSA 2KENA 3Q8DA 4BBRH 1QVCA 3ICEA 3NELA 2IX0A 1UEBA 1KAWA 3I56A 4GS3A 2QEXA 1PYBA 2VZAA 4DUYL 4DR3Q 1MKHA 4JI2Q 3CC7A 2CKZB 3E0EA 3L0OA 3H0GH 2B63G 4KHPL 1PVOA 5AJ3L 2JQOA 2E8GA 1PH3A 4LF5L 1XPOA 4UP9A 1QUQA 4DR1L 3GTLH 4UY8C 2JA7H 2CWAA 1HZAA 1KRSA 2I5LX 3HOVG 5FLMG 3KDFB 4GOPA 2CQOA 1VQGA 2UU9L 1HJPA 4OWWB 2B63H 2K5HA 1A62A 2MQHA 1HH2P 5C44H 2ES2A 1PH9A 4LF4L 3PO3G 2MNAA 3RLNA 1OXSC 4A3JG 4B3SQ 1X3GA 1B70B 1E24A 1FL0A 4B3TL 5GAGC 2AHOB 3BJUA 4LF7Q 5BR8L 2CWPA 3B6YA 4J15A 2XTIA 2Q2HA 3BZCA 4LW1A 4IFDI 3NEMA 3J7ZC 1VQIA 4UP8A 4GOPB 2HHHL 1X3EA 1K0RA 3ZJYC 3CCVA 2QGQA 4KHPQ 3GDEA 3ULJA 3RNUA 2JA6H 5GAHC 4YY3L 3PV0A 5C44G 1CKNA 3OTOL 4DV6L 4A3MH 4H02A 3VDYA 4HIKA 5JJKA 2PMZE 4DR5Q 2F4VL 1N32L 3K81C 2JA5G 3M7NA 1Q86C 4DV3Q 2D0PA 4GNXA 4AQYL 3F8TA 1YI2A 4PMWA 4FDBA 5GQOA 1X54A 1EWIA 4QY7A 4YHHL 4B3ML 4DR6Q 1X6OA 3STBC 1HZBA 2ZTEA 3PGZA 4PZ7A 2UUCQ 4OX9Q 4NB3A 2HIVA 4KHZA 5JEAJ 4DPGA 4X62Q 3L2PA 1GD7A 3CW2C 3M9BA 3JAMc 3HOXH 1PV4A 3S1QH 2BA0A 2ZJPA 3K0XA 3UE1A 5C4JH 3K7AH 1CSPA 4IJLA 3U4VA 2BH8A 1IBLL 3HOYH 4HIOA 5LMNL 1K8GA 3W5OA 4OWTB 2HT1A 2UUBQ 3HOWG 2R7ZG 3CAMA 4JOIA 1V43A 4DV5L 2R7ZH 3HOWH 5J3BA 1JB7A 5DLQE 1T9HA 1HR0W 4DAMA 3RZOH 4DR6L 4DV1L 4JBMA 3G6EA 4DUYQ 1Y14B 2WAQE 3S17H 3S2DH 2L15A 3ULPA 4JI8Q 5C4XG 3CCQA 1FJGL 3GTQH 2VQEQ 3S2HH 1UWVA 4BY7H 3PCOB 3FP9A 3UDFA 2OTJA 2IHEA 4DR1Q 1PH2A 1VQNA 2ZJRA 1EQQA 3T1YQ 2I5HA 4HJ8A 4OO1I 4Y7NH 2VS1A 2WP8J 3PUWA 2UXBL 2R7FA 1XMOQ 1TWHH 1Q8KA 2KHIA 4LFAQ 1PH6A 1N34L 1JT8A 2JK8A 4GKJL 4B3SL 3T1HL 4YWKA 3M85A 4BXXG 1J5EL 1KHIA 2AWNA 1WYDA 4LF7L 1X56A 3WWVA 1R9TH 4GLXA 5C3EG 1YBYA 2B3GA 3KJPA 3AQQA 1KIXA 3PO2G 4GOPC 2ZM6L 1WI5A 3CCRA 2HQLA 3K8AA 1QVGA 3CD6A 4DV7Q 1LYLA 4IOCA 1SMXA 3KF8B 4UP7A 3DM3A 4QGUA 2KCTA 3E9IA 3ER0A 4DR2L 1BVSA 4DV6Q 3UDIA 1NTGA 4YCWA 3HOVH 1GO3E 3CP0A 1JJ2A 1N32Q 3HKSA 4JI8L 2VY3A 2B29A 3PUXA 4JYAL 3SGIA 5C4XH 1AH9A 1HZCA 4JI1L 3S14H 4HJAA 2E2JH 4JI5Q 3PIOA 1Q81C 3ULLA 3HKZG 1Y1VG 1XPUA 1AE2A 4JV5L 2Y0SE 4X66Q 1HR0Q 4ME3A 1XMQQ 3FKIG 4KI0A 3CMEA 4LFCQ 2VQFQ 1PH8A 1QZHA 3BU2A 2D62A 4DV2Q 3I4NH 2MO1A 2WB1G 4A3BG 1VS0A 1EIYB 3GTJH 1N33L 5IYCH 4X65Q 1Q82C 4DR7Q 5EAYA 3RN5A 1IL2A 2RF4A 4A93G 3RLFA 3HOXG 3NENA 4LF5Q 1X9NA 1E1OA 2IX1A 1FVIA 1LTLA 1NMGA 5C0XI 1KD1C 4LUVA 1B8AA 2VUMG 4P71A 1OXUA 2K4KA 2RHSB 4PG3A 4A3JH 2F52A 1YJWA 4X66L 1JMCA 4TQUS 1VQ6A 5M3MH 3I4MG 2DUDA 2ASBA 1CKOA 3MEFA 5FLMH 1K3RA 4NXML 1IXRA 2OWOA 5IYDH 1YZ6A 2LXKA 4JBJA 1C9OA 5IP7H 2LXJA 3W1BA 3CF5A 4AH6A 3J81c 1PH1A 3HOZG 5IP9H 3CC4A 4JI7Q 4JI5L 3AEVA 3MXNB 3T1HQ
chains in the Genus database with same CATH superfamily
3NSWA 4K6LA 1VQ5A 4C3JB 3DLLA 3J7AV 3PO2B 1R9TB 1BBUA 3OTOQ 5EKIA 1WTVA 1HXYD 4DR5L 3S9WA 1HNXL 1B3AA 1CQVA 2F4VQ 1BO0A 4KKTA 1VQBA 5C0XH 5FKAC 3PUVA 1FGUA 1ZXTA 3OW2A 4LFAL 1STHA 4CKCA 2NVTH 2RCNA 1Y1WG 1B53A 1XNQQ 4GN5A 3I91A 3CQZH 4LF9Q 3G6JB 4K2LA 3Q0AA 1NR4A 1QOHA 2K6AA 3GQBA 3JAME 1ZYRC 3PIP3 1G6PA 1K83H 1GVPA 3BDCA 4YCUA 4O42A 3I4OA 4NXNL 4BBRB 1QE6A 1GHJA 1VQDA 2WB1B 1STEA 2R92G 4XQJA 4FO2A 4B08A 4YCVA 1A0IA 1YITA 5M3FH 4J1MA 2BDOA 4RAUC 4DV0Q 5JEAG 4LF6Q 1ENCA 2X6GA 3DWPA 4A3FG 3GD7A 2UXCL 1NUCA 1AN8A 1D5MC 1QCBD 3CKIB 3K6OA 3CC2A 4K0KL 4ZUIA 3VYRA 4E6IA 1PDQA 4DR4L 2KJXA 5LL6S 1SEBD 1U4RA 3HOUG 1LTAD 4DFAA 4A3DG 5FOBB 3ITPA 2NB0A 3OOCA 4A3GH 1YNXA 5FLXL 2DNEA 1F2MA 1TS3A 2K75A 2G5DA 4IALA 4P2CB 1QUQB 3QOJA 2UXBQ 2YTXA 3J81i 2KECA 4UDUC 1XYIA 1RF2D 3PF4A 3GTKH 5C4ZA 2K5DA 2D2CC 1E2ZA 3S1RH 1PRTC 2JA9A 3OYYA 3CMAA 2XGTA 1KABA 4DU9A 2B63B 4KD4A 1CHQD 1IYJB 4P74A 4DK0A 3M3YH 1PH7A 3RLOA 1MJCA 2NZHA 3KYHC 3EROA 2ZTDA 3FHWA 5M3FG 4JYAQ 1N9WA 2Z0SA 4IFDG 4OXPA 2E74C 4QJFA 2OF1A 2J4XA 2D0OA 4KHPL 1KC8C 4I7AA 1D5XC 4DV4L 1VQKA 1Z47A 1K0SA 2AQ3B 1SE2A 2R7DA 2VQFL 4NKLA 4FF2A 4GN4B 4LUZA 2O5IC 3D4WA 4DR7L 3GO5A 4DNRB 2YU9H 4MZ9A 4FYDA 4NXNQ 2Q2TA 3J81E 1EY8A 3TS0A 1J5EQ 4BY7G 3JC66 3CPWA 1OTCA 1VF5C 1UAPA 1RTOA 3P1HA 2OQKA 4I7ZC 1JC7A 3J80i 5G3LD 1MI2A 4ILWA 5IYBG 2A6ED 5GADC 2PMZB 2ZXOA 2E76C 3G48A 1ASYA 1V9PA 3F2CA 3NTKA 3GTKB 1SYEA 4OO1G 3TP5A 2J0TD 1FJGQ 5CGKA 5C5LA 2JA7G 4L5SA 3R2IA 3SK6A 3VR2A 2AKWB 4JK1C 3I73A 4QL5A 2RHQB 4G4KA 4X64L 2R93H 4GLAC 2B2TA 1FNUA 4YWLA 3EIVA 5C0XJ 4DF7A 2E2HH 1W6JA 3I4NB 5K36H 3NPPA 3GTJB 3AFQA 4X6AH 4A3IB 3CCEA 4X62L 1I6VC 4HIMA 4O2DA 5IT9c 4JBWA 1UE7A 1Z7TA 5ELEA 1NBWA 1JCKB 3SXHA 2K52A 2KEDA 2JE6I 5IWAL 1EYGA 1S40A 4R4TA 2WINB 3F2DA 2QKIC 2L11A 3ERSX 3LWEA 5J1ZA 3H3VH 2F0EA 3VR5A 3RUZA 4HJ9A 1UE5A 5FO7B 1YVCA 5C5MA 5DAUA 1EOTA 4B9XA 3I2ZA 3I4NG 2RDGA 3H6MA 1IBLQ 1WCMH 5IWAQ 4R4QA 2UXDQ 2EJMA 3T16A 1YHQA 2N78A 4HN7A 2NBFA 1SRUA 3VYSA 1UE6A 2FHTA 2Z9HA 3HKZE 4IPGA 4IPHA 5M3MB 1QILA 4BBSH 1PRTF 2K32A 1Z9FA 4CDCC 1EQRA 4MTKA 3S15H 4IPCA 4CKEA 3Q22A 2K7VA 1HZ9A 4A3IG 1HNZL 1O80A 4OGQC 3J81j 3PO2H 3W2DA 4HR7B 5T1IA 4A3DH 2EYFA 3AU7A 1DD2A 1B1ZA 1LTSD 1PTOH 2EXZA 1BCPB 1NE3A 3DMUA 2KEEA 5LMNQ 2ICEC 4A3IH 5JPNC 1VQCA 2Q2UA 2WKDA 2CH4A 3IRBA 3U4ZA 3I7FA 4QUFA 2Z1CA 2IX3A 1CSQA 2EVBA 3QIAA 1IZ6A 4JOIC 2NWGA 4HTHA 3KF8A 1CKMA 2F0TA 1SYDA 4A3MG 3E9HA 4B3TQ 4Y52H 1JJCB 4BY1G 3WOEA 4JI3L 1HUMA 3K7AB 1N36L 4LF8Q 3BVGA 1G51A 2F0DA 4BBRH 1SNMA 2XSCA 4CJ2C 1GOZA 1F9RA 1QNKA 2O5JC 5ELFA 2IX0A 4V0BA 3S1NB 2OT2A 1H9MA 4TSSA 5IT9L 1HHVA 4DUYL 1PVOA 4JI2Q 4KJNA 1WCMB 3CC7A 2D9UA 5AJ3L 1KNAA 1PH3A 3OPOA 1IYVA 1EQVA 2JN4A 2I5LX 4ZLTF 1W6KA 4HAEA 3KDFB 1U9RA 4C1NK 3ERQA 3QB3A 4XQNA 3P7JA 1HJPA 2F03A 2QEJC 2MQHA 1A62A 1PH9A 1XXGA 4ODGA 1E24A 1GJXA 4B3TL 3BJUA 4A3GB 2Q2HA 3BZCA 3HS0C 3J7ZC 1VQIA 4UP8A 5EKLA 2HHHL 1X3EA 4QF4A 1QG7A 1VMCA 3NTHA 3CCVA 4KHPQ 2ZXRA 5D3IB 4DAPA 2M2LA 4A3MH 5JJKA 2PMZE 3S1RB 1N32L 2JA5G 3M7NA 3H94A 4GNXA 3C1EA 3DHQA 3T51B 3K59A 4B3ML 4DR6Q 4QQBX 1FNVA 3TRZA 3GTPH 4NB3A 2HIVA 4X62Q 5EJWA 3CRLC 2L9HA 4OHJA 3U9OA 4NW2A 3U4VA 2EE1A 1KLUD 1R4QB 4HIOA 3T53B 5LMNL 4FF1A 3W5OA 5L37A 3NUCA 2UUBQ 2G9DA 3HOWG 2R7ZG 4A93B 4JOIA 1V43A 5J3BA 4DAMA 2FMMA 1BXTA 3T4AC 4DR6L 4JBMA 1Y14B 3S17H 3S2DH 5BN5A 5C4XG 2MPMA 1B9NA 1SSOA 4L8JA 2VQEQ 1UUPA 1DJRD 3J80E 1M8AA 2DJFC 3KLRA 1VQNA 5EQ0A 3WOFA 2VS1A 2WP8J 1O78A 5TSSA 1TY0A 3QOLA 1XMOQ 3H3VC 2PYKA 4QB4A 1M4VA 3V2TA 3KLSX 4XQQA 4GKJL 4B3SL 4RGTA 3D4RA 3I8ZA 2AWNA 1WYDA 1X56A 1KIXA 4IQZA 3CCRA 4C56C 2HQLA 1QVGA 4DV7Q 1L0YB 1RKNA 4QGUA 2KCTA 4FF3A 4DV6Q 1NTGA 4YCWA 5BN3A 3HKSA 2I07B 2R61A 1LACA 3MVVA 1U4MA 5I2XA 3BDOA 1LTBD 1IW7D 1TT2A 2Y0SE 1XMQQ 4KI0A 1LT6D 3CMEA 5CV9A 2E2HB 3I4NH 2MO1A 2R92B 1PTOC 1Q82C 1FR3A 1YNJC 3RLFA 1X9NA 1S5FD 1NMGA 3OWFA 1JOOA 4RH6A 4LUVA 3S17B 3S2DB 4ZQ3A 3NHHA 1SNQA 1V1PB 4X66L 4BY7B 3HGBA 1JMCA 4K5VA 2PZTA 2JA5B 4M1UB 3MEFA 2OWOA 1ENAA 4JBJA 2LXJA 4X3UA 4XXEA 1PTOF 1SBBB 3AMUA 4JI5L 1EIHA 3T1HQ 2A68C 4P75A 3L7ZC 2NVXH 2BCOA 4XYQA 3A8KE 2N88A 4IJHA 1Q3LA 1U5KA 4KHVA 4H0LC 5DM63 1CKNB 1L2FA 3KJOA 2L5TA 1KQSA 2UXCQ 1QZGA 1GM5A 4YWMA 5JJLA 4R4OA 1EZ6A 2OEOA 4FP5D 3U50C 4CDEC 2IPKD 4JI3Q 2A69C 1KRTA 1TY2A 1HNXQ 4AYBB 2PW5A 1BOSA 4C3IH 3F1ZA 4RCOA 1SMYD 1ET9A 3A0JA 1TU2B 2K5VA 1KDAA 3RZDB 2A6HD 2MFIA 4ZK9B 3PSIA 4F87A 2R92H 1TWGH 2CW0D 1IL8A 1YJNA 3TQYA 2JYOA 4EX5A 1GHKA 1WTWA 1PH4A 1HA5A 3TP8A 2A69D 3MA2B 2PI2E 1VQOA 1EYAA 2M9VA 4OEMB 1PZKD 1EL0A 3NBHA 4JI0Q 3DWAA 1PFNA 3TEHB 1ONLA 1V1QA 4DAYB 2DGYA 1FGBD 2WB1E 1JJGA 1MSHA 1ILPA 1EWHA 1I6HH 3EBEA 1KAAA 3MEHA 2PO4A 4JI4L 1VQJA 2B2YA 1W2BA 2A68D 5M5YH 4A4IA 1PYWD 4JBKA 2HDLA 5LL6X 4JI2L 4NXMQ 1A3VA 2L12A 2NTTA 4DV5Q 1S72A 1Y1VH 3T13A 5GAEC 2A1AA 1M90C 1HCZA 3SK8A 4A75A 2OCEA 3SR1A 2EPBA 2F0UA 2CFMA 1U0LA 5ELNA 3KOJA 3S1MH 2BE5C 3IL8A 5J39A 4HMJA 4MIUA 3CQZB 4DR2Q 2NVYH 2NN6I 1M1KC 4PNYA 4DNTB 4DV2L 5I6YA 1LTGD 5FJ8G 1CZGA 1I4RA 1JR0D 3HOYB 1XMOL 3DUZA 3KUPA 2RCFA 1YEZA 1PTOD 1YHAA 1WVLA 2E2IH 4A3MB 2WACA 3RR5A 1BNZA 3VR3A 3VR4A 5M3FB 3J7A5 1N36Q 4ABNA 4A3LH 1YIJA 4X65L 2XNAC 1C8CA 2F0NA 4C3HG 4BA1I 1DGSA 3K57A 1B7YB 3TP6A 4L5TA 3GTMH 1XWEA 2VL6A 1C0AA 4KJOA 4DK3C 3KFUA 5EPJA 3I72A 2RA4A 5ELBA 3QJYA 2RVLA 3GTQB 2F0SA 2JA8H 1DXMA 1WJJA 5M3MG 3I4MH 4GKKL 4JI6L 1VCIA 1PHJA 2GA4B 4PZ6A 3Q6SA 2VUMH 5AFWA 3MZ5A 3VYUA 2F0IA 3H0GG 2HIXA 1LUZA 2NVQH 3S1MB 2E2JB 3BYYB 1FD7D 2NZ1D 4JV5Q 4I65A 4DAYA 2K50A 5J22A 1L1OB 4C2MH 1N34Q 3TS2A 2L4NA 4KD3A 3MHBA 2LSSA 4A3EH 3GTOH 4AQYQ 3CCUA 4EVOA 3TREA 1S5CD 2Z4HA 4OX9L 1KXLA 4C3HH 1HQRD 2IT1A 3HOVB 2R93G 2FXQA 4EGVA 2K5NA 3STBD 4ALPA 2P5ZX 3D4DA 1SYGA 1DYQA 1SNDA 3FPPA 1X32A 5CV6A 1AZPA 1I3QH 4JI6Q 2KVMA 3ZYYX 3PIO3 1SE3A 1RTNA 1CA6A 4B3RL 1Y1WH 1PZID 2JJQA 2ZM6Q 5CV8A 1XNQL 5CR3A 1EFID 3D6CA 3H3VI 1A6XA 1CTMA 2QA4A 4CDDC 5CV7A 4CGYB 1VQAA 2A6HC 3ONAB 1SFOH 2F0QA 1C48A 4C3JG 4Z9CB 3R93A 2ATWA 4RMFA 5JJIA 3J7AF 3WDNA 4ZKCB 3J80L 1WFQA 2JEBI 1TWAB 2HHHQ 3NXWA 2JA7B 1IBKL 1B9MA 3K7UC 4CDFC 3DWQA 2JEAI 1E22A 5LMUQ 2JA8G 4OIKA 1SROA 3CCSA 2KHJA 1TS4A 4ZYSA 3MFYA 2NVXB 2VB3X 4KN7C 3HG9A 2X69A 1XNRL 1WTPA 1SR3A 4HIDA 1SAPA 1Y8PB 5DM73 3K5LA 4IFDJ 4CHTB 1EYDA 3OW7A 4LUOA 1V1PA 1XPRA 4GLVB 2A8VA 3MFGA 3X3NA 4HEDA 2XWJB 4L5RC 1SDFA 3H15A 3MXUA 3H91A 3PMFA 4JI0L 2B39A 3G71A 2MO0A 5LMUL 5AJ3Q 4K14A 3LX0A 2SNSA 3NWTA 1Q46A 4JPBW 3U58A 2UUAL 2WFWA 1G6ZA 3NE5B 1AE3A 4NPSA 3Q8DA 1QVCA 3ICEA 1K28A 3NP8A 1EZ8A 1BQQT 1EQTA 2MGSA 1MKHA 2F3WA 2AUKA 1QJOA 2Z4IA 3S2HB 3BVZA 4LF5L 2XN9C 2KHSA 3GTLH 3DEOA 1F2ZA 1HZAA 1JB3A 2WV6D 4Y7NB 3HOVG 5FLMG 1JWUD 2K05A 2CQOA 4V190 3NK9A 2AQ1B 4OWWB 2K5HA 2ES2A 2OXPA 4LF4L 2MNAA 4A3JG 1X3GA 1B70B 4HCSA 4GZYC 5GAGC 4LF7Q 3B6YA 2XTIA 4LW1A 2CW0C 4GOPB 4X3SA 1GUWA 3GDEA 3ULJA 2JA6H 4YY3L 2ICIA 1SMYC 3SVMA 4N8X1 3TMEA 3VDYA 4DR5Q 2F4VL 2EY6A 3KBGA 2KQ3A 2BOSA 2A5HA 3F8TA 3I90A 2Q8IB 4FDBA 1X54A 1EWIA 1U4PA 5DEHA 4QY7A 1QWYA 3STBC 3PGZA 4OX9Q 5JEAJ 4JW0A 3HOXH 3M3YB 3M9BA 2K28A 2BA0A 1E2VA 3K0XA 3UE1A 3K7AH 1Z6HA 1LTID 4IJLA 1BF4A 1CFMA 2BH8A 1IBLL 3UI2A 3HOYH 2HT1A 1RJTA 4Q0FA 1JB7A 1T9HA 1HR0W 1SJED 4S3SA 4DV1L 2PQEA 1DOKA 3CHBD 1RHPA 2X6LA 3E3XA 4M8AA 3ULPA 1B2TA 3CCQA 2EZVA 1EU4A 1UWVA 2B2UC 4LK1C 2F1MA 2OTJA 2IHEA 4DR1Q 2I5HA 4Y7NH 4FXGC 4TKOB 1DOLA 5FO8B 2UXBL 2R7FA 4RHRA 1TWHH 2KCNA 2Y0SB 2KHIA 4LFAQ 3SK5A 3M85A 4BXXG 1KHIA 2A6EC 3WWVA 5C3EG 4GOPC 3CD6A 1JOQA 1LYLA 4IOCA 2EDGA 3DM3A 3HOZB 4X3TA 3QWNA 3KLSA 3ER0A 1IW7C 1BVSA 1KNEA 3K0YA 3G7LA 1Y8OB 3CP0A 1JJ2A 2F0VA 2FMCA 1N32Q 1L0XB 4IUUA 2VUMB 2Z8LA 5C4XH 3V96A 1A3UA 4JI1L 2HCCA 3HEJA 1WTXA 2E2JH 3PIOA 4JI5Q 3ULLA 3HKZG 4J6HA 3MXNA 2F0JA 2B2WA 2QDLA 4JVZA 3SE0A 4G57A 3L9AX 1CQFA 3FKIG 2SDFA 2VQFQ 1PH8A 3BU2A 1EIGA 4DV2Q 3DEPA 4A3BG 1EIYB 3GTJH 1DZ1A 5IYCH 4X65Q 1F9SA 5A2QL 1IL2A 1Y69U 3NENA 3MXGA 4C3HB 1LTLA 1ZKOA 1KD1C 4K5WA 1OXUA 2BE5D 4PG3A 3KK7A 1PLFA 5IODA 1UNSA 2F52A 5KGUA 2R3ZA 3H09A 1JORA 2RDFA 4TQUS 3ND9A 1VQ6A 1I3QB 1WTQA 1LTTD 2ASBA 1CKOA 5EGTA 1Y1WB 1PRTD 3CF5A 1TWHB 3HOZG 3AEVA 1EY9A 2H5XA 3NBIA 1ET6A 2TSSA 5FJ8H 1STAA 2FFKB 4PQXA 1CM9A 4RGOS 2IY5B 1KDBA 2MJ8A 3GV3A 1K73C 4IO9A 1JE4A 4TVAB 4WFN3 1X65A 1NNXA 4WJWA 4BBSB 2Z6KC 1VQHA 1MJEA 4DR4Q 1OXTA 1EUJA 1O7IA 1EFWA 1E1TA 4DV4Q 4L6TB 3A74A 2KCMA 1SE4A 4R4CA 1SNOA 1WOCA 4KN4C 1O7LA 3R8BA 3D31A 1L1OA 1S3OA 1W3SA 4A3DB 2F3IA 5K36G 4QMGA 3NWSA 4OWXB 2KCCA 1EY5A 1N33Q 4G7OC 2VQEL 2EIFA 4QIWE 1K8MA 5IT9E 3LGJA 3SDZA 1P8LA 3T56B 3K5NA 2HDMA 4UHVA 1TVXA 1ILQA 4A3KB 2F0WA 2DY7A 5CMDA 4N9PA 4MNOA 4HJ7A 4IUPA 2EQSA 2J7ZA 4DV3L 5HY6A 5C44B 1VQ4A 1LTRD 1Q8IA 1ICWA 2ID0A 1EEID 3PF5A 3IAYA 3KDFA 3VR6A 3G4SA 3AB9A 4C1NI 3A54A 2VNUD 1T5XD 2BDNA 5E4WC 1TKWB 4K0KQ 3PO3H 5I4DA 1NCVA 3FMCA 4U68A 3GTLB 4LJZC 1XJVA 1HNZQ 3VA5A 3KBXA 4A3KG 2UUAQ 1EIFA 4PZ8A 4KV6A 2N3SA 2Q2IA 1PH5A 2NUCA 1YNJD 5KNDA 1EEFD 3O13A 1L0WA 4ZKBB 4APVA 4IN3A 1NMFA 5A2QE 5EBCA 3RZDH 2JA6B 1JE5A 5LHY1 5E3FA 1NJIC 4TRDA 3S24A 5C3EH 1XNRQ 3RZOB 1HUNA 2E2DC 1H9RA 1J8IA 2EY2A 5CV4A 4RGMA 3HOYG 2GVBA 4PV1C 1CUKA 1P16A 4ZRZA 5ISRA 1OO9B 4A3KH 4YHHQ 1JQYD 4G7ZC 2EYLA 3TZDA 5IE8A 1TS2A 1AP0A 4BXXH 4A93H 1SYFA 2CH4W 2KBNA 2WIIB 4LNQA 1F9PA 2F3VA 1I50H 1PXUA 5FLXE 3NBHB 4LF6L 5IYBH 1G91A 3CCLA 1AEXA 1WD0A 4KLKA 4DV1Q 2PQAB 1AW7A 4HMIA 4BY1B 2B2VC 3QR8A 1BBWA 1Y1VB 3OWEB 1MIUA 3OMCA 4JI1Q 4EQPA 1GUNA 4LWCA 4YIJA 5E7NA 4KTAA 4IUVA 1LO5D 1WTHA 5KNBA 4EQNA 4A3CH 2MHVA 2NVYB 3PUZA 5EPLA 1HNWQ 1KLGD 4LF4Q 1CI3M 1X3FA 1OXVA 4R8IA 1GUGA 2Y0SG 4O1NA 3W1GA 2PQAA 1MGSA 3IFDA 1VQEA 4B3MQ 3J80c 1PMRA 2IHFA 1VQMA 1AZQA 5JVH3 2E2IB 1IBMQ 3GV6A 3HOUH 4GN3B 4R1JA 4H7BA 2CCZA 5I2YA 2Z6BA 2AMCB 2XWBB 1PFBA 3Q24A 4A3FH 2PZUA 3EJIA 5M9OA 1CZWA 1O7YA 4DV0L 2K5QA 4GNXB 2V1CC 1X3PA 1HA6A 4KKSA 2L0CA 2BA1A 3BZDB 4IUNA 4C3JH 1VQPA 3R2TA 1K8AC 1J6QA 2AUJD 2K14A 1I50B 3D8GA 2ENBA 4AIMA 3A5UA 5A35A 1A63A 2LFNA 1ZYRD 2M00A 4B3RQ 3M4PA 4HSPA 3FPUB 3I4MB 1TWCH 4X3KA 4BY1H 3BYTB 2JA5H 3EFXD 2NVTB 1PFSA 1Q12A 1D8LA 3A8JE 3CCJA 1BKBA 3T1YL 4XT1B 1ICFB 1IKMA 2ZJQA 1ESRA 4AYBE 2N55A 3F2BA 3E6ZX 1D1IA 1VQ8A 3A5ZB 1A8VA 2LMCB 4OL7A 1ASZA 1BDOA 1L1OC 1KL9A 4JI7L 5GROA 3JAML 4IFDH 1JWMD 3BVMA 5D65A 1K9MC 3GTOB 1NR2A 1GUSA 4F8MA 2EYMA 2I46A 2PPBC 1GXDC 1DM0B 3MC0B 1SLJA 2PNRC 3TDQA 3VYTA 5IYDG 3DXJC 2Z6KA 4DNIA 1I94Q 3M4YA 4ZUJA 4WJ4A 1NSNS 2ZT9C 4K2KA 4BS9A 1HNWL 2UUCL 3I3CA 1YHBA 5I9OA 3UDXA 4DGZA 2QW7A 4C3IB 3LNNA 3M4QA 4OONA 4BBRG 1EY6A 3OHXC 3NELA 1BBXC 1EWCA 3I70A 2HD3A 5IGGA 4IUQA 1B4OA 3I56A 5IGFA 1PYBA 1MD2D 2B63G 3L0OA 5CV5A 3FVQA 4L63B 2B2YC 2E8GA 4KMUC 4DXFA 1HFGA 4UY8C 2JA7H 2CWAA 1KRSA 1PRTB 1TWCB 4OO1H 2EJGC 1KTKA 2UU9L 3SHLA 3A55A 2B63H 3PO3G 1HH2P 5C44H 2RBMA 3RLNA 4B3SQ 4G7HC 1FL0A 2AHOB 4N8FA 4IFDI 4XDXA 1LV9A 2VXWA 1K0RA 5M5YB 3OTOL 2WKCA 3N6RA 5M5WB 1F2LA 4HIKA 1K8OA 3A56A 1II3A 2K33A 3K81C 3TN2A 4AQYL 1YNNC 1SYBA 1YI2A 5GQOA 1WD1A 4HSVA 5JEAH 4YHHL 3A8IE 3HKZB 2UUCQ 1HZBA 2ZTEA 1STYA 3J81L 4DPGA 4KHZA 2YU9B 5CC4A 3CW2C 3A7AB 3JAMc 1PV4A 2ZJPA 1CSPA 1HPCA 1SNCA 1BCPD 4FXDA 3GP7A 1IKLA 5DLQE 1V1OA 4KY7A 1J9OA 2L15A 4JI8Q 1FJGL 1B3QA 3NQTA 3S2HH 2F0PA 3PCOB 3FP9A 2B2UA 3T1YQ 4BWGB 4HJ8A 2EY1A 3PUWA 5ELDA 4CKBA 2XVSA 1A2TA 1PH6A 2JK8A 4CBVA 3HZXA 3T1HL 1D6EC 5IOCA 1J5EL 2L1BA 5M5XB 1LABA 2PW7A 4GLXA 1Q90A 1YBYA 2B3GA 3PO2G 2C5CA 4EQOA 2ZM6L 2IW3A 3R3OA 1WI5A 5JJZA 3K8AA 3C46A 1SMXA 3KF8B 4UP7A 2JA8B 3E9IA 2F0GA 1LLRD 3UDIA 1GO3E 1F9QA 3CU7A 1I4GA 1VF7A 2JXMB 3PUXA 2B29A 2NTSA 1AH9A 1HZCA 3E0JA 3S14H 4HJAA 1SJHD 1DONA 1Q81C 2FINB 1RCVD 4RGNA 4C2MB 1Y1VG 4H44C 1AE2A 4X66Q 1HR0Q 5I9PA 1ENFA 4ME3A 4LFCQ 2XRSD 4A3EB 5IGEA 1QZHA 1TWFB 2D62A 2D5DA 2WB1G 1N33L 2MUYA 4DR7Q 3RN5A 2RF4A 3HOXG 4LF5Q 2IX1A 2EYHA 1FVIA 5C0XI 3E5SA 1B8AA 1S5BD 2RHSB 3C2PA 2RKSA 1HRJA 1JICA 2DJGC 1RDPD 3K5MA 4A3FB 3S16B 3QG1A 1K3RA 2LXKA 5IP7H 2DNCA 4AH6A 3J81c 3CC4A 4JI7Q 4CJ0B 3OMGA 2XIWA 3F2UA 3HRZC 1SFOB 1KDCA 4DUZL 2RQXA 1VQFA 1I4XA 1WCMG 4DK1A 2E5LL 2YTYA 5NUCA 3EVQA 1S4ZA 1A2UA 4K5XA 2VB2X 3MTSA 1TWAH 3RMHA 1RD9D 3K5OA 3RD4A 1GUTA 2PCFB 3MWYW 2VW9A 4KY5A 5IGBA 1S5DD 5C4XB 3SK4A 5LMNW 3S14B 3KLWA 3Q23A 4UPAA 1HR0L 5EKKA 2PI2A 3KF6A 2JA6G 1SNPA 3D0FA 2N49A 4DA2A 2A19A 2JSOA 4Q5VA 1TWFH 4DR3L 4A3BB 2AWOA 1AFPA 4DK6C 1PYSB 4LF9L 1I5FA 2B8FA 3H0GB 2E5LQ 1D5ZC 2NYZD 4LMQD 2E75C 1IBML 2LY7A 3IKJA 3AFPA 4A76A 2GN5A 1E0BA 4N9TA 1GKHA 4JC0A 4KY6A 1PA6A 4R4IA 2IJ0A 1UEAB 5IGDA 4FVMA 1HQMC 3M4OB 5HGQA 4IOAA 1E2WA 5KNCA 3LWUA 5ELCA 1STBA 1MSGA 5JVG3 4A3EG 1I94L 5IP7G 4C3IG 1IHZA 3CXCA 5T1GA 3BG3A 5FO9B 1K3BC 3CCMA 2FJ2A 3UDGA 2K03A 1SE8A 5F2DA 1VQ7A 4NDXA 3P75A 3RN2A 2I0QA 2NN6G 1QNUA 5IY0A 1G2TA 3M7GA 4BBSG 5H1SE 4LAAA 3FRPB 1EY4A 3KF6B 5C0XG 2HCIA 4J8QA 3GTGB 2EYJA 4X64Q 1EOVA 3S1QB 4P72A 2F0KA 4RA8A 2A74C 2UUBL 4RG1A 1SYCA 4ID6A 2H4OA 1Q1BA 4IUTA 4GNXC 1VMPA 1ESFA 4OIJA 1RODA 5HGTA 5IYCG 4WORA 2N8NA 4GKKQ 4A3BH 3AYHB 5M5WH 2ZTCA 4IURA 4YY3Q 3UE0A 3BZKA 1DOMA 1O7ZA 4LFCL 2K04A 4RWSC 5IIFA 3I55A 4POFA 4A3LG 2MP1A 2C35B 3HFZB 1R4PB 5JOBA 4O0AA 1GUOA 3HOXB 1ZEQX 1IYUA 4H13C 3M4OH 2F4IA 2R6GA 4LFBQ 1STGA 1C4QA 4DUZQ 4ME5A 1E3PA 2EOTA 4POGA 1E7ZA 1G291 4DV7L 1FNWA 3MXPA 4JCVE 2ALYB 2UXDL 4RKLA 1I4QA 1BUVT 2UU9Q 2RSOA 5JPMC 4HJ5A 1RL2A 3MAQA 2YYZA 3IFTA 4A3GG 3PO3B 1IBKQ 5KYLA 2C9OA 1XTDA 2CVRA 1RIPA 3S15B 3TSSA 1D2BA 4CJ1B 1NAPA 3PUYA 4BA2I 3TBIB 3CPFA 1MHWC 1H95A 4P73A 1XTCD 3GTGH 2YV5A 1X55A 4UAIA 1EY0A 1A3TA 1EYCA 5M5XH 1LM0A 1SN8A 2GVAA 2I5MX 1CT1D 2WAQG 3FKIH 1JWSD 2Q8RE 1F77A 4KK7A 4XIGS 5E4XA 1PTOB 2JP1A 2PNHA 4WJ3M 5KYIA 4K6DA 3HOZH 4U673 4ZCKA 1CA5A 3OIQA 1T5EA 2XRQD 1Q1EA 1QB5D 5D3DA 4A3JB 2CQAA 1OXXK 5BN4A 2B2TC 3QO2A 4L5QA 2YTVA 3D6WA 4EQ5A 1U4LA 3C1FA 1D7QA 1VDZA 4MHEA 4LF8L 1ML0D 2B2WC 1EU3A 2WAQB 4RCNA 1S5ED 2K1BA 2F0FA 2F0OA 4XTCS 2OQ0A 5KRUA 3S1NH 4NP5A 1TQOA 4QCLA 1Y8NB 2NZOA 4K8IA 5C4HA 3K80C 3BS1A 1C7YA 4JG2A 3SEBA 3NTIA 1FYCA 5D14A 4QIWB 1WTRA 1N8RC 3HP3A 4AYBG 5IP9G 5C3XA 1QVFA 4B9WA 3L3OC 5C6AA 3S16H 1VQLA 2TMPA 4IPDA 5ELOA 5EPKA 1UE1A 1Q7YC 3C3LA 2OTLA 3D3RA 1TXYA 5BR8Q 5COYA 1K83B 1B44D 5FLXc 4GKJQ 3FKIB 1YJ9A 4K8JA 1VQ9A 5KEEA 1NY4A 1D1KA 4XYOA 4A3CG 5FK9C 2EXDA 1LT5D 5C3WA 1TS5A 4FF4A 2KOLA 2BH2A 3JAMi 2QILA 3HOUB 1G2SA 4R9WA 4MTNA 5JAVA 1XMQL 4JI4Q 1TIID 3EN2A 4DKAC 1A15A 3GTPB 4HCEA 1H9SB 5EBDA 3PIPA 4LFBL 3DM1A 4ZAIA 5C4JB 2NN6H 1TR5A 4MN3A 5CYUA 2F0LA 2KENA 2RSNA 5KIXA 3P20A 1UEBA 1I6HB 1KAWA 4GS3A 2QEXA 2VZAA 4FNFA 4DR3Q 2CKZB 3E0EA 3N52A 3H0GH 1EY7A 2JQOA 4DN4M 2ZXPA 1I4PA 1XPOA 2HUGA 4UP9A 1QUQA 4DR1L 2PZWA 5CORA 3V05A 2F0MA 2K01A 4GOPA 1VQGA 2LS01 3A7LA 1B50A 2V4DA 4OELB 3URYA 1MBYA 2IWHA 1OXSC 1H9JA 2QCPX 5BR8L 2A73B 2CWPA 4J15A 5G3LF 1H9SA 3NEMA 4KKUA 3FEWX 3ZJYC 2AQ2B 3X3MA 2QGQA 3EA6A 2QDBA 2K5WA 3NQIA 3RNUA 5GAHC 3PV0A 2SOBA 1CKNA 4DXGA 5HURA 5C44G 4DV6L 4H02A 3PQIA 1HTPA 4NMZA 1Q86C 4DV3Q 2D0PA 2EYPA 3CRKC 4PMWA 1PZJD 1HTLD 1STNA 1I4HA 2KA7A 2SNMA 4RHSA 1X6OA 4PZ7A 3L2PA 1GD7A 2EYOA 3S1QH 2EJFC 5C4JH 3GTMB 1K8GA 2RDHA 5K5PA 4OWTB 1BCPF 1BCPC 3FDTA 3W3AA 3CAMA 4DV5L 1CHPD 2R7ZH 3HOWH 2O2LD 3TP7A 1H9KA 2HQEA 5C3EB 3RZOH 3G6EA 3I4LA 4DUYQ 1DCZA 2WAQE 3GTQH 1LT4D 1WTOA 4BY7H 3UDFA 1PH2A 2ZJRA 1EQQA 1YNND 2CHBD 4OO1I 1F2YA 1PFMA 4QUCA 2KUMA 2QF7A 3BDLA 5DNFA 2B8GA 2NVQB 1Q8KA 2EY5A 1N34L 1JT8A 4YWKA 3U9SA 4PMCA 2F0HA 4LF7L 5CBAE 2R93B 1R9TH 3KJPA 3AQQA 4F7XA 3ND8A 3TZUA 2Q8TA 3VA7A 4DR2L 2IL8A 4PMBA 4ULLA 3HOVH 1X3QA 4JI8L 2VY3A 4JYAL 1V8QA 5IGCA 3SGIA 5CBEE 1JOKA 2H1EA 1SXTA 3OIPA 1XX8A 4RKBA 4DAVA 3EQLC 2O4XA 1LT3D 2DY8A 1XPUA 4JV5L 3K58A 2B2VA 5I6WA 2L55A 4RFBA 1TWGB 1VS0A 4R8NA 1G8ZD 5EAYA 3HOWB 4A93G 3J7YW 2R7ZB 2SEBD 1E1OA 1BR9A 2VUMG 4WRDA 4P71A 2K4KA 4A3JH 2DN8A 1YJWA 3OSOA 5M3MH 3I4MG 5E1FA 2DUDA 5FLMH 4NXML 1IXRA 5IYDH 4IZ8A 1HFNA 1YZ6A 1C9OA 2LKVA 3W1BA 1CK1A 2G9HD 1PH1A 5IP9H 4FXKC 4XT3B 3MXNB 4F88A
chains in the Genus database with same CATH topology
1VQ5A 2H5XA 4P75A 3DLLA 5FJ8H 3L7ZC 2NVXH 1BBUA 4DUZL 3OTOQ 1VQFA 1WCMG 2E5LL 4IJHA 1U5KA 2YTYA 4DR5L 1HNXL 2F4VQ 1CKNB 1VQBA 1L2FA 3KJOA 2IY5B 1TWAH 1K73C 4IO9A 1KQSA 4TVAB 2UXCQ 1X65A 3PUVA 1FGUA 1QZGA 3OW2A 1GM5A 4LFAL 2Z6KC 1VQHA 4YWMA 2NVTH 2RCNA 1Y1WG 1MJEA 4R4OA 4GN5A 2VW9A 1OXTA 1XNQQ 4DR4Q 5JJLA 1EUJA 1O7IA 1EFWA 3U50C 1E1TA 4DV4Q 3CQZH 3A74A 2KCMA 4JI3Q 4LF9Q 5LMNW 4R4CA 3KLWA 1G6PA 1WOCA 4UPAA 1KRTA 1HNXQ 4C3IH 1K83H 1GVPA 3F1ZA 4YCUA 3D31A 1HR0L 1L1OA 2PI2A 3KF6A 3A0JA 2K5VA 3I4OA 1S3OA 1W3SA 3D0FA 2JA6G 2N49A 4NXNL 2MFIA 2A19A 2F3IA 5K36G 1TWFH 3PSIA 4DR3L 2R92H 1VQDA 1TWGH 2AWOA 1YJNA 4OWXB 4DK6C 3TQYA 1N33Q 1PYSB 2VQEL 4YCVA 2R92G 2EIFA 4LF9L 1A0IA 1I5FA 4EX5A 4QIWE 1YITA 5M3FH 2E5LQ 3LGJA 4DV0Q 1P8LA 1PH4A 5JEAG 4LF6Q 2PI2E 1VQOA 1IBML 4A3FG 3AFPA 3GD7A 2GN5A 4A76A 2UXCL 1GKHA 4JC0A 1PA6A 3CC2A 4R4IA 4K0KL 4JI0Q 4MNOA 4HJ7A 4DR4L 2EQSA 4DV3L 3HOUG 5HY6A 1VQ4A 3TEHB 5HGQA 2ID0A 4A3DG 3PF5A 1V1QA 4DAYB 2DGYA 2WB1E 3KDFA 4IOAA 1JJGA 4A3GH 1YNXA 3G4SA 2K75A 1I6HH 1QUQB 2VNUD 3EBEA 4A3EG 2UXBQ 1I94L 5IP7G 4JI4L 2YTXA 1VQJA 3CXCA 3J81i 1W2BA 5M5YH 3CCMA 4A4IA 4K0KQ 4JBKA 3PF4A 3PO3H 3UDGA 4JI2L 4NXMQ 3GTKH 1SE8A 1VQ7A 4DV5Q 3RN2A 2I0QA 1S72A 2NN6G 1Y1VH 5GAEC 3S1RH 5IY0A 1XJVA 2A1AA 2JA9A 1HNZQ 1M90C 4BBSG 4A3KG 3OYYA 5H1SE 4A75A 2OCEA 3CMAA 2UUAQ 2XGTA 1EIFA 2CFMA 3KF6B 4PZ8A 1U0LA 5ELNA 3KOJA 2N3SA 3S1MH 5C0XG 2Q2IA 4DR2Q 2NVYH 1PH5A 1IYJB 2NN6I 4X64Q 4P74A 1M1KC 1EOVA 3M3YH 4P72A 1PH7A 4DV2L 3RLOA 1L0WA 1MJCA 2NZHA 3KYHC 5FJ8G 2UUBL 4RG1A 4APVA 2ZTDA 3FHWA 1NMFA 5M3FG 1N9WA 2Z0SA 4IFDG 1XMOL 4OXPA 4JYAQ 1Q1BA 4GNXC 1YEZA 3RZDH 4QJFA 1JE5A 5IYCG 1YHAA 2N8NA 1NJIC 4A3BH 2E2IH 2D0OA 4GKKQ 3AYHB 5M5WH 2ZTCA 3S24A 3RR5A 5C3EH 1KC8C 4YY3Q 1XNRQ 3UE0A 3BZKA 4DV4L 1VQKA 1Z47A 4LFCL 3HOYG 3J7A5 2GVBA 1N36Q 2R7DA 2VQFL 4A3LH 1CUKA 1P16A 4GN4B 3I55A 4LUZA 4POFA 1YIJA 4A3LG 2C35B 3HFZB 4X65L 4DR7L 4O0AA 3GO5A 4BA1I 2YU9H 4MZ9A 1DGSA 4A3KH 4YHHQ 4NXNQ 1B7YB 2Q2TA 4L5TA 3TS0A 3M4OH 3GTMH 2VL6A 2R6GA 5IE8A 1J5EQ 4BY7G 4LFBQ 3JC66 3CPWA 4DUZQ 1OTCA 1C0AA 1E3PA 4DK3C 4POGA 4BXXH 3KFUA 4A93H 1E7ZA 3J80i 2OQKA 2KBNA 4LNQA 1G291 4DV7L 1I50H 4JCVE 5IYBG 2ALYB 3NBHB 4LF6L 2UXDL 5IYBH 2UU9Q 3CCLA 5GADC 4HJ5A 1RL2A 3G48A 4KLKA 2YYZA 4DV1Q 1V9PA 1ASYA 2PQAB 2JA8H 3F2CA 4A3GG 1WJJA 5M3MG 1IBKQ 3I4MH 4GKKL 4OO1G 4JI6L 1FJGQ 2JA7G 1XTDA 4L5SA 1BBWA 1VCIA 1PHJA 1RIPA 1MIUA 4PZ6A 4JI1Q 2VUMH 4LWCA 5E7NA 3PUYA 3H0GG 4BA2I 2HIXA 1LUZA 3CPFA 2NVQH 1H95A 2AKWB 4P73A 4QL5A 2RHQB 4JV5Q 3GTGH 4A3CH 2YV5A 1X55A 4QQBX 2K50A 3PUZA 4X64L 1L1OB 4C2MH 1N34Q 1HNWQ 5M5XH 2R93H 1LM0A 1SN8A 1X3FA 2GVAA 2I5MX 4LF4Q 1OXVA 3TS2A 2WAQG 3FKIH 4GLAC 3TRZA 2LSSA 4A3EH 4YWLA 3EIVA 4AQYQ 3CCUA 5C0XJ 3GTOH 2E2HH 2Y0SG 4XIGS 4WJ3M 2PNHA 3TREA 2PQAA 3W1GA 1VQEA 4B3MQ 3AFQA 3J80c 3HOZH 4X6AH 2IHFA 1VQMA 4OX9L 3CCEA 4X62L 1KXLA 4C3HH 1Q1EA 4HIMA 1IBMQ 2IT1A 4O2DA 2FXQA 5IT9c 2K5NA 4JBWA 3STBD 4ALPA 3HOUH 2R93G 4GN3B 1UE7A 4R1JA 1OXXK 2CCZA 1NBWA 4L5QA 2AMCB 2K52A 5IWAL 2JE6I 2YTVA 1I3QH 1EYGA 4JI6Q 4EQ5A 4A3FH 1S40A 4R4TA 3F2DA 4B3RL 1Y1WH 1D7QA 2ZM6Q 2JJQA 3ERSX 4DV0L 4LF8L 1XNQL 3H3VH 4GNXB 3H3VI 4HJ9A 1UE5A 2V1CC 4XTCS 1YVCA 2QA4A 2BA1A 3I4NG 1VQAA 2OQ0A 3I2ZA 3S1NH 4C3JH 1SFOH 1VQPA 1IBLQ 1K8AC 1J6QA 2NZOA 2K14A 1WCMH 5IWAQ 4R4QA 3K80C 4AIMA 1C7YA 3A5UA 2UXDQ 2ATWA 4RMFA 4JG2A 5JJIA 1A63A 1YHQA 4B3RQ 3M4PA 1WFQA 2JEBI 2N78A 1N8RC 2HHHQ 1SRUA 1UE6A 4AYBG 5IP9G 1IBKL 1TWCH 3HKZE 3K7UC 4BY1H 1QVFA 4IPGA 4IPHA 2JEAI 1E22A 5LMUQ 4BBSH 2JA5H 3S16H 1Z9FA 1VQLA 1EQRA 1PFSA 4IPDA 3S15H 5ELOA 1Q12A 3GTPH 4IPCA 1D8LA 3CCJA 1BKBA 3T1YL 2JA8G 1Q7YC 1UE1A 1SROA 3CCSA 2ZJQA 1HZ9A 2OTLA 2KHJA 1TXYA 4AYBE 3F2BA 5BR8Q 4A3IG 1HNZL 1VQ8A 3A5ZB 1A8VA 1ASZA 3J81j 1L1OC 1KL9A 4JI7L 3PO2H 5GROA 5FLXc 4GKJQ 1YJ9A 1K9MC 4A3DH 1XNRL 1VQ9A 1SR3A 1NY4A 4HIDA 4IFDJ 1NE3A 4LUOA 4A3CG 1XPRA 2EXDA 1SLJA 5LMNQ 4GLVB 4A3IH 2BH2A 2A8VA 1VQCA 5IYDG 3JAMi 2Q2UA 3IRBA 4L5RC 2Z6KA 3U4ZA 4DNIA 3I7FA 1I94Q 4JI4Q 4MTNA 1XMQL 4WJ4A 3H15A 1CSQA 4JOIC 1IZ6A 1HNWL 3EN2A 4DKAC 2UUCL 1CKMA 4A3MG 4JI0L 1YHBA 3E9HA 3G71A 4B3TQ 2MO0A 3PIPA 5LMUL 5AJ3Q 1JJCB 4BY1G 4LFBL 4JI3L 3UDXA 4Y52H 1Q46A 2UUAL 3U58A 1N36L 2WFWA 4LF8Q 3M4QA 4OONA 1G51A 4BBRG 1AE3A 4NPSA 2KENA 3Q8DA 4BBRH 1QVCA 3ICEA 3NELA 2IX0A 1UEBA 1KAWA 3I56A 4GS3A 2QEXA 1PYBA 2VZAA 4DUYL 4DR3Q 1MKHA 4JI2Q 3CC7A 2CKZB 3E0EA 3L0OA 3H0GH 2B63G 4KHPL 1PVOA 5AJ3L 2JQOA 2E8GA 1PH3A 4LF5L 1XPOA 4UP9A 1QUQA 4DR1L 3GTLH 4UY8C 2JA7H 2CWAA 1HZAA 1KRSA 2I5LX 3HOVG 5FLMG 3KDFB 4GOPA 2CQOA 1VQGA 2UU9L 1HJPA 4OWWB 2B63H 2K5HA 1A62A 2MQHA 1HH2P 5C44H 2ES2A 1PH9A 4LF4L 3PO3G 2MNAA 3RLNA 1OXSC 4A3JG 4B3SQ 1X3GA 1B70B 1E24A 1FL0A 4B3TL 5GAGC 2AHOB 3BJUA 4LF7Q 5BR8L 2CWPA 3B6YA 4J15A 2XTIA 2Q2HA 3BZCA 4LW1A 4IFDI 3NEMA 3J7ZC 1VQIA 4UP8A 4GOPB 2HHHL 1X3EA 1K0RA 3ZJYC 3CCVA 2QGQA 4KHPQ 3GDEA 3ULJA 3RNUA 2JA6H 5GAHC 4YY3L 3PV0A 5C44G 1CKNA 3OTOL 4DV6L 4A3MH 4H02A 3VDYA 4HIKA 5JJKA 2PMZE 4DR5Q 2F4VL 1N32L 3K81C 2JA5G 3M7NA 1Q86C 4DV3Q 2D0PA 4GNXA 4AQYL 3F8TA 1YI2A 4PMWA 4FDBA 5GQOA 1X54A 1EWIA 4QY7A 4YHHL 4B3ML 4DR6Q 1X6OA 3STBC 1HZBA 2ZTEA 3PGZA 4PZ7A 2UUCQ 4OX9Q 4NB3A 2HIVA 4KHZA 5JEAJ 4DPGA 4X62Q 3L2PA 1GD7A 3CW2C 3M9BA 3JAMc 3HOXH 1PV4A 3S1QH 2BA0A 2ZJPA 3K0XA 3UE1A 5C4JH 3K7AH 1CSPA 4IJLA 3U4VA 2BH8A 1IBLL 3HOYH 4HIOA 5LMNL 1K8GA 3W5OA 4OWTB 2HT1A 2UUBQ 3HOWG 2R7ZG 3CAMA 4JOIA 1V43A 4DV5L 2R7ZH 3HOWH 5J3BA 1JB7A 5DLQE 1T9HA 1HR0W 4DAMA 3RZOH 4DR6L 4DV1L 4JBMA 3G6EA 4DUYQ 1Y14B 2WAQE 3S17H 3S2DH 2L15A 3ULPA 4JI8Q 5C4XG 3CCQA 1FJGL 3GTQH 2VQEQ 3S2HH 1UWVA 4BY7H 3PCOB 3FP9A 3UDFA 2OTJA 2IHEA 4DR1Q 1PH2A 1VQNA 2ZJRA 1EQQA 3T1YQ 2I5HA 4HJ8A 4OO1I 4Y7NH 2VS1A 2WP8J 3PUWA 2UXBL 2R7FA 1XMOQ 1TWHH 1Q8KA 2KHIA 4LFAQ 1PH6A 1N34L 1JT8A 2JK8A 4GKJL 4B3SL 3T1HL 4YWKA 3M85A 4BXXG 1J5EL 1KHIA 2AWNA 1WYDA 4LF7L 1X56A 3WWVA 1R9TH 4GLXA 5C3EG 1YBYA 2B3GA 3KJPA 3AQQA 1KIXA 3PO2G 4GOPC 2ZM6L 1WI5A 3CCRA 2HQLA 3K8AA 1QVGA 3CD6A 4DV7Q 1LYLA 4IOCA 1SMXA 3KF8B 4UP7A 3DM3A 4QGUA 2KCTA 3E9IA 3ER0A 4DR2L 1BVSA 4DV6Q 3UDIA 1NTGA 4YCWA 3HOVH 1GO3E 3CP0A 1JJ2A 1N32Q 3HKSA 4JI8L 2VY3A 2B29A 3PUXA 4JYAL 3SGIA 5C4XH 1AH9A 1HZCA 4JI1L 3S14H 4HJAA 2E2JH 4JI5Q 3PIOA 1Q81C 3ULLA 3HKZG 1Y1VG 1XPUA 1AE2A 4JV5L 2Y0SE 4X66Q 1HR0Q 4ME3A 1XMQQ 3FKIG 4KI0A 3CMEA 4LFCQ 2VQFQ 1PH8A 1QZHA 3BU2A 2D62A 4DV2Q 3I4NH 2MO1A 2WB1G 4A3BG 1VS0A 1EIYB 3GTJH 1N33L 5IYCH 4X65Q 1Q82C 4DR7Q 5EAYA 3RN5A 1IL2A 2RF4A 4A93G 3RLFA 3HOXG 3NENA 4LF5Q 1X9NA 1E1OA 2IX1A 1FVIA 1LTLA 1NMGA 5C0XI 1KD1C 4LUVA 1B8AA 2VUMG 4P71A 1OXUA 2K4KA 2RHSB 4PG3A 4A3JH 2F52A 1YJWA 4X66L 1JMCA 4TQUS 1VQ6A 5M3MH 3I4MG 2DUDA 2ASBA 1CKOA 3MEFA 5FLMH 1K3RA 4NXML 1IXRA 2OWOA 5IYDH 1YZ6A 2LXKA 4JBJA 1C9OA 5IP7H 2LXJA 3W1BA 3CF5A 4AH6A 3J81c 1PH1A 3HOZG 5IP9H 3CC4A 4JI7Q 4JI5L 3AEVA 3MXNB 3T1HQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ5 A;  2H5X A;  4P75 A;  3DLL A;  5FJ8 H;  3L7Z C;  2NVX H;  1BBU A;  4DUZ L;  3OTO Q;  1VQF A;  1WCM G;  2E5L L;  4IJH A;  1U5K A;  2YTY A;  4DR5 L;  1HNX L;  2F4V Q;  1CKN B;  1VQB A;  1L2F A;  3KJO A;  2IY5 B;  1TWA H;  1K73 C;  4IO9 A;  1KQS A;  4TVA B;  2UXC Q;  1X65 A;  3PUV A;  1FGU A;  1QZG A;  3OW2 A;  1GM5 A;  4LFA L;  2Z6K C;  1VQH A;  4YWM A;  2NVT H;  2RCN A;  1Y1W G;  1MJE A;  4R4O A;  4GN5 A;  2VW9 A;  1OXT A;  1XNQ Q;  4DR4 Q;  5JJL A;  1EUJ A;  1O7I A;  1EFW A;  3U50 C;  1E1T A;  4DV4 Q;  3CQZ H;  3A74 A;  2KCM A;  4JI3 Q;  4LF9 Q;  5LMN W;  4R4C A;  3KLW A;  1G6P A;  1WOC A;  4UPA A;  1KRT A;  1HNX Q;  4C3I H;  1K83 H;  1GVP A;  3F1Z A;  4YCU A;  3D31 A;  1HR0 L;  1L1O A;  2PI2 A;  3KF6 A;  3A0J A;  2K5V A;  3I4O A;  1S3O A;  1W3S A;  3D0F A;  2JA6 G;  2N49 A;  4NXN L;  2MFI A;  2A19 A;  2F3I A;  5K36 G;  1TWF H;  3PSI A;  4DR3 L;  2R92 H;  1VQD A;  1TWG H;  2AWO A;  1YJN A;  4OWX B;  4DK6 C;  3TQY A;  1N33 Q;  1PYS B;  2VQE L;  4YCV A;  2R92 G;  2EIF A;  4LF9 L;  1A0I A;  1I5F A;  4EX5 A;  4QIW E;  1YIT A;  5M3F H;  2E5L Q;  3LGJ A;  4DV0 Q;  1P8L A;  1PH4 A;  5JEA G;  4LF6 Q;  2PI2 E;  1VQO A;  1IBM L;  4A3F G;  3AFP A;  3GD7 A;  2GN5 A;  4A76 A;  2UXC L;  1GKH A;  4JC0 A;  1PA6 A;  3CC2 A;  4R4I A;  4K0K L;  4JI0 Q;  4MNO A;  4HJ7 A;  4DR4 L;  2EQS A;  4DV3 L;  3HOU G;  5HY6 A;  1VQ4 A;  3TEH B;  5HGQ A;  2ID0 A;  4A3D G;  3PF5 A;  1V1Q A;  4DAY B;  2DGY A;  2WB1 E;  3KDF A;  4IOA A;  1JJG A;  4A3G H;  1YNX A;  3G4S A;  2K75 A;  1I6H H;  1QUQ B;  2VNU D;  3EBE A;  4A3E G;  2UXB Q;  1I94 L;  5IP7 G;  4JI4 L;  2YTX A;  1VQJ A;  3CXC A;  3J81 i;  1W2B A;  5M5Y H;  3CCM A;  4A4I A;  4K0K Q;  4JBK A;  3PF4 A;  3PO3 H;  3UDG A;  4JI2 L;  4NXM Q;  3GTK H;  1SE8 A;  1VQ7 A;  4DV5 Q;  3RN2 A;  2I0Q A;  1S72 A;  2NN6 G;  1Y1V H;  5GAE C;  3S1R H;  5IY0 A;  1XJV A;  2A1A A;  2JA9 A;  1HNZ Q;  1M90 C;  4BBS G;  4A3K G;  3OYY A;  5H1S E;  4A75 A;  2OCE A;  3CMA A;  2UUA Q;  2XGT A;  1EIF A;  2CFM A;  3KF6 B;  4PZ8 A;  1U0L A;  5ELN A;  3KOJ A;  2N3S A;  3S1M H;  5C0X G;  2Q2I A;  4DR2 Q;  2NVY H;  1PH5 A;  1IYJ B;  2NN6 I;  4X64 Q;  4P74 A;  1M1K C;  1EOV A;  3M3Y H;  4P72 A;  1PH7 A;  4DV2 L;  3RLO A;  1L0W A;  1MJC A;  2NZH A;  3KYH C;  5FJ8 G;  2UUB L;  4RG1 A;  4APV A;  2ZTD A;  3FHW A;  1NMF A;  5M3F G;  1N9W A;  2Z0S A;  4IFD G;  1XMO L;  4OXP A;  4JYA Q;  1Q1B A;  4GNX C;  1YEZ A;  3RZD H;  4QJF A;  1JE5 A;  5IYC G;  1YHA A;  2N8N A;  1NJI C;  4A3B H;  2E2I H;  2D0O A;  4GKK Q;  3AYH B;  5M5W H;  2ZTC A;  3S24 A;  3RR5 A;  5C3E H;  1KC8 C;  4YY3 Q;  1XNR Q;  3UE0 A;  3BZK A;  4DV4 L;  1VQK A;  1Z47 A;  4LFC L;  3HOY G;  3J7A 5;  2GVB A;  1N36 Q;  2R7D A;  2VQF L;  4A3L H;  1CUK A;  1P16 A;  4GN4 B;  3I55 A;  4LUZ A;  4POF A;  1YIJ A;  4A3L G;  2C35 B;  3HFZ B;  4X65 L;  4DR7 L;  4O0A A;  3GO5 A;  4BA1 I;  2YU9 H;  4MZ9 A;  1DGS A;  4A3K H;  4YHH Q;  4NXN Q;  1B7Y B;  2Q2T A;  4L5T A;  3TS0 A;  3M4O H;  3GTM H;  2VL6 A;  2R6G A;  5IE8 A;  1J5E Q;  4BY7 G;  4LFB Q;  3JC6 6;  3CPW A;  4DUZ Q;  1OTC A;  1C0A A;  1E3P A;  4DK3 C;  4POG A;  4BXX H;  3KFU A;  4A93 H;  1E7Z A;  3J80 i;  2OQK A;  2KBN A;  4LNQ A;  1G29 1;  4DV7 L;  1I50 H;  4JCV E;  5IYB G;  2ALY B;  3NBH B;  4LF6 L;  2UXD L;  5IYB H;  2UU9 Q;  3CCL A;  5GAD C;  4HJ5 A;  1RL2 A;  3G48 A;  4KLK A;  2YYZ A;  4DV1 Q;  1V9P A;  1ASY A;  2PQA B;  2JA8 H;  3F2C A;  4A3G G;  1WJJ A;  5M3M G;  1IBK Q;  3I4M H;  4GKK L;  4OO1 G;  4JI6 L;  1FJG Q;  2JA7 G;  1XTD A;  4L5S A;  1BBW A;  1VCI A;  1PHJ A;  1RIP A;  1MIU A;  4PZ6 A;  4JI1 Q;  2VUM H;  4LWC A;  5E7N A;  3PUY A;  3H0G G;  4BA2 I;  2HIX A;  1LUZ A;  3CPF A;  2NVQ H;  1H95 A;  2AKW B;  4P73 A;  4QL5 A;  2RHQ B;  4JV5 Q;  3GTG H;  4A3C H;  2YV5 A;  1X55 A;  4QQB X;  2K50 A;  3PUZ A;  4X64 L;  1L1O B;  4C2M H;  1N34 Q;  1HNW Q;  5M5X H;  2R93 H;  1LM0 A;  1SN8 A;  1X3F A;  2GVA A;  2I5M X;  4LF4 Q;  1OXV A;  3TS2 A;  2WAQ G;  3FKI H;  4GLA C;  3TRZ A;  2LSS A;  4A3E H;  4YWL A;  3EIV A;  4AQY Q;  3CCU A;  5C0X J;  3GTO H;  2E2H H;  2Y0S G;  4XIG S;  4WJ3 M;  2PNH A;  3TRE A;  2PQA A;  3W1G A;  1VQE A;  4B3M Q;  3AFQ A;  3J80 c;  3HOZ H;  4X6A H;  2IHF A;  1VQM A;  4OX9 L;  3CCE A;  4X62 L;  1KXL A;  4C3H H;  1Q1E A;  4HIM A;  1IBM Q;  2IT1 A;  4O2D A;  2FXQ A;  5IT9 c;  2K5N A;  4JBW A;  3STB D;  4ALP A;  3HOU H;  2R93 G;  4GN3 B;  1UE7 A;  4R1J A;  1OXX K;  2CCZ A;  1NBW A;  4L5Q A;  2AMC B;  2K52 A;  5IWA L;  2JE6 I;  2YTV A;  1I3Q H;  1EYG A;  4JI6 Q;  4EQ5 A;  4A3F H;  1S40 A;  4R4T A;  3F2D A;  4B3R L;  1Y1W H;  1D7Q A;  2ZM6 Q;  2JJQ A;  3ERS X;  4DV0 L;  4LF8 L;  1XNQ L;  3H3V H;  4GNX B;  3H3V I;  4HJ9 A;  1UE5 A;  2V1C C;  4XTC S;  1YVC A;  2QA4 A;  2BA1 A;  3I4N G;  1VQA A;  2OQ0 A;  3I2Z A;  3S1N H;  4C3J H;  1SFO H;  1VQP A;  1IBL Q;  1K8A C;  1J6Q A;  2NZO A;  2K14 A;  1WCM H;  5IWA Q;  4R4Q A;  3K80 C;  4AIM A;  1C7Y A;  3A5U A;  2UXD Q;  2ATW A;  4RMF A;  4JG2 A;  5JJI A;  1A63 A;  1YHQ A;  4B3R Q;  3M4P A;  1WFQ A;  2JEB I;  2N78 A;  1N8R C;  2HHH Q;  1SRU A;  1UE6 A;  4AYB G;  5IP9 G;  1IBK L;  1TWC H;  3HKZ E;  3K7U C;  4BY1 H;  1QVF A;  4IPG A;  4IPH A;  2JEA I;  1E22 A;  5LMU Q;  4BBS H;  2JA5 H;  3S16 H;  1Z9F A;  1VQL A;  1EQR A;  1PFS A;  4IPD A;  3S15 H;  5ELO A;  1Q12 A;  3GTP H;  4IPC A;  1D8L A;  3CCJ A;  1BKB A;  3T1Y L;  2JA8 G;  1Q7Y C;  1UE1 A;  1SRO A;  3CCS A;  2ZJQ A;  1HZ9 A;  2OTL A;  2KHJ A;  1TXY A;  4AYB E;  3F2B A;  5BR8 Q;  4A3I G;  1HNZ L;  1VQ8 A;  3A5Z B;  1A8V A;  1ASZ A;  3J81 j;  1L1O C;  1KL9 A;  4JI7 L;  3PO2 H;  5GRO A;  5FLX c;  4GKJ Q;  1YJ9 A;  1K9M C;  4A3D H;  1XNR L;  1VQ9 A;  1SR3 A;  1NY4 A;  4HID A;  4IFD J;  1NE3 A;  4LUO A;  4A3C G;  1XPR A;  2EXD A;  1SLJ A;  5LMN Q;  4GLV B;  4A3I H;  2BH2 A;  2A8V A;  1VQC A;  5IYD G;  3JAM i;  2Q2U A;  3IRB A;  4L5R C;  2Z6K A;  3U4Z A;  4DNI A;  3I7F A;  1I94 Q;  4JI4 Q;  4MTN A;  1XMQ L;  4WJ4 A;  3H15 A;  1CSQ A;  4JOI C;  1IZ6 A;  1HNW L;  3EN2 A;  4DKA C;  2UUC L;  1CKM A;  4A3M G;  4JI0 L;  1YHB A;  3E9H A;  3G71 A;  4B3T Q;  2MO0 A;  3PIP A;  5LMU L;  5AJ3 Q;  1JJC B;  4BY1 G;  4LFB L;  4JI3 L;  3UDX A;  4Y52 H;  1Q46 A;  2UUA L;  3U58 A;  1N36 L;  2WFW A;  4LF8 Q;  3M4Q A;  4OON A;  1G51 A;  4BBR G;  1AE3 A;  4NPS A;  2KEN A;  3Q8D A;  4BBR H;  1QVC A;  3ICE A;  3NEL A;  2IX0 A;  1UEB A;  1KAW A;  3I56 A;  4GS3 A;  2QEX A;  1PYB A;  2VZA A;  4DUY L;  4DR3 Q;  1MKH A;  4JI2 Q;  3CC7 A;  2CKZ B;  3E0E A;  3L0O A;  3H0G H;  2B63 G;  4KHP L;  1PVO A;  5AJ3 L;  2JQO A;  2E8G A;  1PH3 A;  4LF5 L;  1XPO A;  4UP9 A;  1QUQ A;  4DR1 L;  3GTL H;  4UY8 C;  2JA7 H;  2CWA A;  1HZA A;  1KRS A;  2I5L X;  3HOV G;  5FLM G;  3KDF B;  4GOP A;  2CQO A;  1VQG A;  2UU9 L;  1HJP A;  4OWW B;  2B63 H;  2K5H A;  1A62 A;  2MQH A;  1HH2 P;  5C44 H;  2ES2 A;  1PH9 A;  4LF4 L;  3PO3 G;  2MNA A;  3RLN A;  1OXS C;  4A3J G;  4B3S Q;  1X3G A;  1B70 B;  1E24 A;  1FL0 A;  4B3T L;  5GAG C;  2AHO B;  3BJU A;  4LF7 Q;  5BR8 L;  2CWP A;  3B6Y A;  4J15 A;  2XTI A;  2Q2H A;  3BZC A;  4LW1 A;  4IFD I;  3NEM A;  3J7Z C;  1VQI A;  4UP8 A;  4GOP B;  2HHH L;  1X3E A;  1K0R A;  3ZJY C;  3CCV A;  2QGQ A;  4KHP Q;  3GDE A;  3ULJ A;  3RNU A;  2JA6 H;  5GAH C;  4YY3 L;  3PV0 A;  5C44 G;  1CKN A;  3OTO L;  4DV6 L;  4A3M H;  4H02 A;  3VDY A;  4HIK A;  5JJK A;  2PMZ E;  4DR5 Q;  2F4V L;  1N32 L;  3K81 C;  2JA5 G;  3M7N A;  1Q86 C;  4DV3 Q;  2D0P A;  4GNX A;  4AQY L;  3F8T A;  1YI2 A;  4PMW A;  4FDB A;  5GQO A;  1X54 A;  1EWI A;  4QY7 A;  4YHH L;  4B3M L;  4DR6 Q;  1X6O A;  3STB C;  1HZB A;  2ZTE A;  3PGZ A;  4PZ7 A;  2UUC Q;  4OX9 Q;  4NB3 A;  2HIV A;  4KHZ A;  5JEA J;  4DPG A;  4X62 Q;  3L2P A;  1GD7 A;  3CW2 C;  3M9B A;  3JAM c;  3HOX H;  1PV4 A;  3S1Q H;  2BA0 A;  2ZJP A;  3K0X A;  3UE1 A;  5C4J H;  3K7A H;  1CSP A;  4IJL A;  3U4V A;  2BH8 A;  1IBL L;  3HOY H;  4HIO A;  5LMN L;  1K8G A;  3W5O A;  4OWT B;  2HT1 A;  2UUB Q;  3HOW G;  2R7Z G;  3CAM A;  4JOI A;  1V43 A;  4DV5 L;  2R7Z H;  3HOW H;  5J3B A;  1JB7 A;  5DLQ E;  1T9H A;  1HR0 W;  4DAM A;  3RZO H;  4DR6 L;  4DV1 L;  4JBM A;  3G6E A;  4DUY Q;  1Y14 B;  2WAQ E;  3S17 H;  3S2D H;  2L15 A;  3ULP A;  4JI8 Q;  5C4X G;  3CCQ A;  1FJG L;  3GTQ H;  2VQE Q;  3S2H H;  1UWV A;  4BY7 H;  3PCO B;  3FP9 A;  3UDF A;  2OTJ A;  2IHE A;  4DR1 Q;  1PH2 A;  1VQN A;  2ZJR A;  1EQQ A;  3T1Y Q;  2I5H A;  4HJ8 A;  4OO1 I;  4Y7N H;  2VS1 A;  2WP8 J;  3PUW A;  2UXB L;  2R7F A;  1XMO Q;  1TWH H;  1Q8K A;  2KHI A;  4LFA Q;  1PH6 A;  1N34 L;  1JT8 A;  2JK8 A;  4GKJ L;  4B3S L;  3T1H L;  4YWK A;  3M85 A;  4BXX G;  1J5E L;  1KHI A;  2AWN A;  1WYD A;  4LF7 L;  1X56 A;  3WWV A;  1R9T H;  4GLX A;  5C3E G;  1YBY A;  2B3G A;  3KJP A;  3AQQ A;  1KIX A;  3PO2 G;  4GOP C;  2ZM6 L;  1WI5 A;  3CCR A;  2HQL A;  3K8A A;  1QVG A;  3CD6 A;  4DV7 Q;  1LYL A;  4IOC A;  1SMX A;  3KF8 B;  4UP7 A;  3DM3 A;  4QGU A;  2KCT A;  3E9I A;  3ER0 A;  4DR2 L;  1BVS A;  4DV6 Q;  3UDI A;  1NTG A;  4YCW A;  3HOV H;  1GO3 E;  3CP0 A;  1JJ2 A;  1N32 Q;  3HKS A;  4JI8 L;  2VY3 A;  2B29 A;  3PUX A;  4JYA L;  3SGI A;  5C4X H;  1AH9 A;  1HZC A;  4JI1 L;  3S14 H;  4HJA A;  2E2J H;  4JI5 Q;  3PIO A;  1Q81 C;  3ULL A;  3HKZ G;  1Y1V G;  1XPU A;  1AE2 A;  4JV5 L;  2Y0S E;  4X66 Q;  1HR0 Q;  4ME3 A;  1XMQ Q;  3FKI G;  4KI0 A;  3CME A;  4LFC Q;  2VQF Q;  1PH8 A;  1QZH A;  3BU2 A;  2D62 A;  4DV2 Q;  3I4N H;  2MO1 A;  2WB1 G;  4A3B G;  1VS0 A;  1EIY B;  3GTJ H;  1N33 L;  5IYC H;  4X65 Q;  1Q82 C;  4DR7 Q;  5EAY A;  3RN5 A;  1IL2 A;  2RF4 A;  4A93 G;  3RLF A;  3HOX G;  3NEN A;  4LF5 Q;  1X9N A;  1E1O A;  2IX1 A;  1FVI A;  1LTL A;  1NMG A;  5C0X I;  1KD1 C;  4LUV A;  1B8A A;  2VUM G;  4P71 A;  1OXU A;  2K4K A;  2RHS B;  4PG3 A;  4A3J H;  2F52 A;  1YJW A;  4X66 L;  1JMC A;  4TQU S;  1VQ6 A;  5M3M H;  3I4M G;  2DUD A;  2ASB A;  1CKO A;  3MEF A;  5FLM H;  1K3R A;  4NXM L;  1IXR A;  2OWO A;  5IYD H;  1YZ6 A;  2LXK A;  4JBJ A;  1C9O A;  5IP7 H;  2LXJ A;  3W1B A;  3CF5 A;  4AH6 A;  3J81 c;  1PH1 A;  3HOZ G;  5IP9 H;  3CC4 A;  4JI7 Q;  4JI5 L;  3AEV A;  3MXN B;  3T1H Q; 
#chains in the Genus database with same CATH topology
 3NSW A;  4K6L A;  1VQ5 A;  4C3J B;  3DLL A;  3J7A V;  3PO2 B;  1R9T B;  1BBU A;  3OTO Q;  5EKI A;  1WTV A;  1HXY D;  4DR5 L;  3S9W A;  1HNX L;  1B3A A;  1CQV A;  2F4V Q;  1BO0 A;  4KKT A;  1VQB A;  5C0X H;  5FKA C;  3PUV A;  1FGU A;  1ZXT A;  3OW2 A;  4LFA L;  1STH A;  4CKC A;  2NVT H;  2RCN A;  1Y1W G;  1B53 A;  1XNQ Q;  4GN5 A;  3I91 A;  3CQZ H;  4LF9 Q;  3G6J B;  4K2L A;  3Q0A A;  1NR4 A;  1QOH A;  2K6A A;  3GQB A;  3JAM E;  1ZYR C;  3PIP 3;  1G6P A;  1K83 H;  1GVP A;  3BDC A;  4YCU A;  4O42 A;  3I4O A;  4NXN L;  4BBR B;  1QE6 A;  1GHJ A;  1VQD A;  2WB1 B;  1STE A;  2R92 G;  4XQJ A;  4FO2 A;  4B08 A;  4YCV A;  1A0I A;  1YIT A;  5M3F H;  4J1M A;  2BDO A;  4RAU C;  4DV0 Q;  5JEA G;  4LF6 Q;  1ENC A;  2X6G A;  3DWP A;  4A3F G;  3GD7 A;  2UXC L;  1NUC A;  1AN8 A;  1D5M C;  1QCB D;  3CKI B;  3K6O A;  3CC2 A;  4K0K L;  4ZUI A;  3VYR A;  4E6I A;  1PDQ A;  4DR4 L;  2KJX A;  5LL6 S;  1SEB D;  1U4R A;  3HOU G;  1LTA D;  4DFA A;  4A3D G;  5FOB B;  3ITP A;  2NB0 A;  3OOC A;  4A3G H;  1YNX A;  5FLX L;  2DNE A;  1F2M A;  1TS3 A;  2K75 A;  2G5D A;  4IAL A;  4P2C B;  1QUQ B;  3QOJ A;  2UXB Q;  2YTX A;  3J81 i;  2KEC A;  4UDU C;  1XYI A;  1RF2 D;  3PF4 A;  3GTK H;  5C4Z A;  2K5D A;  2D2C C;  1E2Z A;  3S1R H;  1PRT C;  2JA9 A;  3OYY A;  3CMA A;  2XGT A;  1KAB A;  4DU9 A;  2B63 B;  4KD4 A;  1CHQ D;  1IYJ B;  4P74 A;  4DK0 A;  3M3Y H;  1PH7 A;  3RLO A;  1MJC A;  2NZH A;  3KYH C;  3ERO A;  2ZTD A;  3FHW A;  5M3F G;  4JYA Q;  1N9W A;  2Z0S A;  4IFD G;  4OXP A;  2E74 C;  4QJF A;  2OF1 A;  2J4X A;  2D0O A;  4KHP L;  1KC8 C;  4I7A A;  1D5X C;  4DV4 L;  1VQK A;  1Z47 A;  1K0S A;  2AQ3 B;  1SE2 A;  2R7D A;  2VQF L;  4NKL A;  4FF2 A;  4GN4 B;  4LUZ A;  2O5I C;  3D4W A;  4DR7 L;  3GO5 A;  4DNR B;  2YU9 H;  4MZ9 A;  4FYD A;  4NXN Q;  2Q2T A;  3J81 E;  1EY8 A;  3TS0 A;  1J5E Q;  4BY7 G;  3JC6 6;  3CPW A;  1OTC A;  1VF5 C;  1UAP A;  1RTO A;  3P1H A;  2OQK A;  4I7Z C;  1JC7 A;  3J80 i;  5G3L D;  1MI2 A;  4ILW A;  5IYB G;  2A6E D;  5GAD C;  2PMZ B;  2ZXO A;  2E76 C;  3G48 A;  1ASY A;  1V9P A;  3F2C A;  3NTK A;  3GTK B;  1SYE A;  4OO1 G;  3TP5 A;  2J0T D;  1FJG Q;  5CGK A;  5C5L A;  2JA7 G;  4L5S A;  3R2I A;  3SK6 A;  3VR2 A;  2AKW B;  4JK1 C;  3I73 A;  4QL5 A;  2RHQ B;  4G4K A;  4X64 L;  2R93 H;  4GLA C;  2B2T A;  1FNU A;  4YWL A;  3EIV A;  5C0X J;  4DF7 A;  2E2H H;  1W6J A;  3I4N B;  5K36 H;  3NPP A;  3GTJ B;  3AFQ A;  4X6A H;  4A3I B;  3CCE A;  4X62 L;  1I6V C;  4HIM A;  4O2D A;  5IT9 c;  4JBW A;  1UE7 A;  1Z7T A;  5ELE A;  1NBW A;  1JCK B;  3SXH A;  2K52 A;  2KED A;  2JE6 I;  5IWA L;  1EYG A;  1S40 A;  4R4T A;  2WIN B;  3F2D A;  2QKI C;  2L11 A;  3ERS X;  3LWE A;  5J1Z A;  3H3V H;  2F0E A;  3VR5 A;  3RUZ A;  4HJ9 A;  1UE5 A;  5FO7 B;  1YVC A;  5C5M A;  5DAU A;  1EOT A;  4B9X A;  3I2Z A;  3I4N G;  2RDG A;  3H6M A;  1IBL Q;  1WCM H;  5IWA Q;  4R4Q A;  2UXD Q;  2EJM A;  3T16 A;  1YHQ A;  2N78 A;  4HN7 A;  2NBF A;  1SRU A;  3VYS A;  1UE6 A;  2FHT A;  2Z9H A;  3HKZ E;  4IPG A;  4IPH A;  5M3M B;  1QIL A;  4BBS H;  1PRT F;  2K32 A;  1Z9F A;  4CDC C;  1EQR A;  4MTK A;  3S15 H;  4IPC A;  4CKE A;  3Q22 A;  2K7V A;  1HZ9 A;  4A3I G;  1HNZ L;  1O80 A;  4OGQ C;  3J81 j;  3PO2 H;  3W2D A;  4HR7 B;  5T1I A;  4A3D H;  2EYF A;  3AU7 A;  1DD2 A;  1B1Z A;  1LTS D;  1PTO H;  2EXZ A;  1BCP B;  1NE3 A;  3DMU A;  2KEE A;  5LMN Q;  2ICE C;  4A3I H;  5JPN C;  1VQC A;  2Q2U A;  2WKD A;  2CH4 A;  3IRB A;  3U4Z A;  3I7F A;  4QUF A;  2Z1C A;  2IX3 A;  1CSQ A;  2EVB A;  3QIA A;  1IZ6 A;  4JOI C;  2NWG A;  4HTH A;  3KF8 A;  1CKM A;  2F0T A;  1SYD A;  4A3M G;  3E9H A;  4B3T Q;  4Y52 H;  1JJC B;  4BY1 G;  3WOE A;  4JI3 L;  1HUM A;  3K7A B;  1N36 L;  4LF8 Q;  3BVG A;  1G51 A;  2F0D A;  4BBR H;  1SNM A;  2XSC A;  4CJ2 C;  1GOZ A;  1F9R A;  1QNK A;  2O5J C;  5ELF A;  2IX0 A;  4V0B A;  3S1N B;  2OT2 A;  1H9M A;  4TSS A;  5IT9 L;  1HHV A;  4DUY L;  1PVO A;  4JI2 Q;  4KJN A;  1WCM B;  3CC7 A;  2D9U A;  5AJ3 L;  1KNA A;  1PH3 A;  3OPO A;  1IYV A;  1EQV A;  2JN4 A;  2I5L X;  4ZLT F;  1W6K A;  4HAE A;  3KDF B;  1U9R A;  4C1N K;  3ERQ A;  3QB3 A;  4XQN A;  3P7J A;  1HJP A;  2F03 A;  2QEJ C;  2MQH A;  1A62 A;  1PH9 A;  1XXG A;  4ODG A;  1E24 A;  1GJX A;  4B3T L;  3BJU A;  4A3G B;  2Q2H A;  3BZC A;  3HS0 C;  3J7Z C;  1VQI A;  4UP8 A;  5EKL A;  2HHH L;  1X3E A;  4QF4 A;  1QG7 A;  1VMC A;  3NTH A;  3CCV A;  4KHP Q;  2ZXR A;  5D3I B;  4DAP A;  2M2L A;  4A3M H;  5JJK A;  2PMZ E;  3S1R B;  1N32 L;  2JA5 G;  3M7N A;  3H94 A;  4GNX A;  3C1E A;  3DHQ A;  3T51 B;  3K59 A;  4B3M L;  4DR6 Q;  4QQB X;  1FNV A;  3TRZ A;  3GTP H;  4NB3 A;  2HIV A;  4X62 Q;  5EJW A;  3CRL C;  2L9H A;  4OHJ A;  3U9O A;  4NW2 A;  3U4V A;  2EE1 A;  1KLU D;  1R4Q B;  4HIO A;  3T53 B;  5LMN L;  4FF1 A;  3W5O A;  5L37 A;  3NUC A;  2UUB Q;  2G9D A;  3HOW G;  2R7Z G;  4A93 B;  4JOI A;  1V43 A;  5J3B A;  4DAM A;  2FMM A;  1BXT A;  3T4A C;  4DR6 L;  4JBM A;  1Y14 B;  3S17 H;  3S2D H;  5BN5 A;  5C4X G;  2MPM A;  1B9N A;  1SSO A;  4L8J A;  2VQE Q;  1UUP A;  1DJR D;  3J80 E;  1M8A A;  2DJF C;  3KLR A;  1VQN A;  5EQ0 A;  3WOF A;  2VS1 A;  2WP8 J;  1O78 A;  5TSS A;  1TY0 A;  3QOL A;  1XMO Q;  3H3V C;  2PYK A;  4QB4 A;  1M4V A;  3V2T A;  3KLS X;  4XQQ A;  4GKJ L;  4B3S L;  4RGT A;  3D4R A;  3I8Z A;  2AWN A;  1WYD A;  1X56 A;  1KIX A;  4IQZ A;  3CCR A;  4C56 C;  2HQL A;  1QVG A;  4DV7 Q;  1L0Y B;  1RKN A;  4QGU A;  2KCT A;  4FF3 A;  4DV6 Q;  1NTG A;  4YCW A;  5BN3 A;  3HKS A;  2I07 B;  2R61 A;  1LAC A;  3MVV A;  1U4M A;  5I2X A;  3BDO A;  1LTB D;  1IW7 D;  1TT2 A;  2Y0S E;  1XMQ Q;  4KI0 A;  1LT6 D;  3CME A;  5CV9 A;  2E2H B;  3I4N H;  2MO1 A;  2R92 B;  1PTO C;  1Q82 C;  1FR3 A;  1YNJ C;  3RLF A;  1X9N A;  1S5F D;  1NMG A;  3OWF A;  1JOO A;  4RH6 A;  4LUV A;  3S17 B;  3S2D B;  4ZQ3 A;  3NHH A;  1SNQ A;  1V1P B;  4X66 L;  4BY7 B;  3HGB A;  1JMC A;  4K5V A;  2PZT A;  2JA5 B;  4M1U B;  3MEF A;  2OWO A;  1ENA A;  4JBJ A;  2LXJ A;  4X3U A;  4XXE A;  1PTO F;  1SBB B;  3AMU A;  4JI5 L;  1EIH A;  3T1H Q;  2A68 C;  4P75 A;  3L7Z C;  2NVX H;  2BCO A;  4XYQ A;  3A8K E;  2N88 A;  4IJH A;  1Q3L A;  1U5K A;  4KHV A;  4H0L C;  5DM6 3;  1CKN B;  1L2F A;  3KJO A;  2L5T A;  1KQS A;  2UXC Q;  1QZG A;  1GM5 A;  4YWM A;  5JJL A;  4R4O A;  1EZ6 A;  2OEO A;  4FP5 D;  3U50 C;  4CDE C;  2IPK D;  4JI3 Q;  2A69 C;  1KRT A;  1TY2 A;  1HNX Q;  4AYB B;  2PW5 A;  1BOS A;  4C3I H;  3F1Z A;  4RCO A;  1SMY D;  1ET9 A;  3A0J A;  1TU2 B;  2K5V A;  1KDA A;  3RZD B;  2A6H D;  2MFI A;  4ZK9 B;  3PSI A;  4F87 A;  2R92 H;  1TWG H;  2CW0 D;  1IL8 A;  1YJN A;  3TQY A;  2JYO A;  4EX5 A;  1GHK A;  1WTW A;  1PH4 A;  1HA5 A;  3TP8 A;  2A69 D;  3MA2 B;  2PI2 E;  1VQO A;  1EYA A;  2M9V A;  4OEM B;  1PZK D;  1EL0 A;  3NBH A;  4JI0 Q;  3DWA A;  1PFN A;  3TEH B;  1ONL A;  1V1Q A;  4DAY B;  2DGY A;  1FGB D;  2WB1 E;  1JJG A;  1MSH A;  1ILP A;  1EWH A;  1I6H H;  3EBE A;  1KAA A;  3MEH A;  2PO4 A;  4JI4 L;  1VQJ A;  2B2Y A;  1W2B A;  2A68 D;  5M5Y H;  4A4I A;  1PYW D;  4JBK A;  2HDL A;  5LL6 X;  4JI2 L;  4NXM Q;  1A3V A;  2L12 A;  2NTT A;  4DV5 Q;  1S72 A;  1Y1V H;  3T13 A;  5GAE C;  2A1A A;  1M90 C;  1HCZ A;  3SK8 A;  4A75 A;  2OCE A;  3SR1 A;  2EPB A;  2F0U A;  2CFM A;  1U0L A;  5ELN A;  3KOJ A;  3S1M H;  2BE5 C;  3IL8 A;  5J39 A;  4HMJ A;  4MIU A;  3CQZ B;  4DR2 Q;  2NVY H;  2NN6 I;  1M1K C;  4PNY A;  4DNT B;  4DV2 L;  5I6Y A;  1LTG D;  5FJ8 G;  1CZG A;  1I4R A;  1JR0 D;  3HOY B;  1XMO L;  3DUZ A;  3KUP A;  2RCF A;  1YEZ A;  1PTO D;  1YHA A;  1WVL A;  2E2I H;  4A3M B;  2WAC A;  3RR5 A;  1BNZ A;  3VR3 A;  3VR4 A;  5M3F B;  3J7A 5;  1N36 Q;  4ABN A;  4A3L H;  1YIJ A;  4X65 L;  2XNA C;  1C8C A;  2F0N A;  4C3H G;  4BA1 I;  1DGS A;  3K57 A;  1B7Y B;  3TP6 A;  4L5T A;  3GTM H;  1XWE A;  2VL6 A;  1C0A A;  4KJO A;  4DK3 C;  3KFU A;  5EPJ A;  3I72 A;  2RA4 A;  5ELB A;  3QJY A;  2RVL A;  3GTQ B;  2F0S A;  2JA8 H;  1DXM A;  1WJJ A;  5M3M G;  3I4M H;  4GKK L;  4JI6 L;  1VCI A;  1PHJ A;  2GA4 B;  4PZ6 A;  3Q6S A;  2VUM H;  5AFW A;  3MZ5 A;  3VYU A;  2F0I A;  3H0G G;  2HIX A;  1LUZ A;  2NVQ H;  3S1M B;  2E2J B;  3BYY B;  1FD7 D;  2NZ1 D;  4JV5 Q;  4I65 A;  4DAY A;  2K50 A;  5J22 A;  1L1O B;  4C2M H;  1N34 Q;  3TS2 A;  2L4N A;  4KD3 A;  3MHB A;  2LSS A;  4A3E H;  3GTO H;  4AQY Q;  3CCU A;  4EVO A;  3TRE A;  1S5C D;  2Z4H A;  4OX9 L;  1KXL A;  4C3H H;  1HQR D;  2IT1 A;  3HOV B;  2R93 G;  2FXQ A;  4EGV A;  2K5N A;  3STB D;  4ALP A;  2P5Z X;  3D4D A;  1SYG A;  1DYQ A;  1SND A;  3FPP A;  1X32 A;  5CV6 A;  1AZP A;  1I3Q H;  4JI6 Q;  2KVM A;  3ZYY X;  3PIO 3;  1SE3 A;  1RTN A;  1CA6 A;  4B3R L;  1Y1W H;  1PZI D;  2JJQ A;  2ZM6 Q;  5CV8 A;  1XNQ L;  5CR3 A;  1EFI D;  3D6C A;  3H3V I;  1A6X A;  1CTM A;  2QA4 A;  4CDD C;  5CV7 A;  4CGY B;  1VQA A;  2A6H C;  3ONA B;  1SFO H;  2F0Q A;  1C48 A;  4C3J G;  4Z9C B;  3R93 A;  2ATW A;  4RMF A;  5JJI A;  3J7A F;  3WDN A;  4ZKC B;  3J80 L;  1WFQ A;  2JEB I;  1TWA B;  2HHH Q;  3NXW A;  2JA7 B;  1IBK L;  1B9M A;  3K7U C;  4CDF C;  3DWQ A;  2JEA I;  1E22 A;  5LMU Q;  2JA8 G;  4OIK A;  1SRO A;  3CCS A;  2KHJ A;  1TS4 A;  4ZYS A;  3MFY A;  2NVX B;  2VB3 X;  4KN7 C;  3HG9 A;  2X69 A;  1XNR L;  1WTP A;  1SR3 A;  4HID A;  1SAP A;  1Y8P B;  5DM7 3;  3K5L A;  4IFD J;  4CHT B;  1EYD A;  3OW7 A;  4LUO A;  1V1P A;  1XPR A;  4GLV B;  2A8V A;  3MFG A;  3X3N A;  4HED A;  2XWJ B;  4L5R C;  1SDF A;  3H15 A;  3MXU A;  3H91 A;  3PMF A;  4JI0 L;  2B39 A;  3G71 A;  2MO0 A;  5LMU L;  5AJ3 Q;  4K14 A;  3LX0 A;  2SNS A;  3NWT A;  1Q46 A;  4JPB W;  3U58 A;  2UUA L;  2WFW A;  1G6Z A;  3NE5 B;  1AE3 A;  4NPS A;  3Q8D A;  1QVC A;  3ICE A;  1K28 A;  3NP8 A;  1EZ8 A;  1BQQ T;  1EQT A;  2MGS A;  1MKH A;  2F3W A;  2AUK A;  1QJO A;  2Z4I A;  3S2H B;  3BVZ A;  4LF5 L;  2XN9 C;  2KHS A;  3GTL H;  3DEO A;  1F2Z A;  1HZA A;  1JB3 A;  2WV6 D;  4Y7N B;  3HOV G;  5FLM G;  1JWU D;  2K05 A;  2CQO A;  4V19 0;  3NK9 A;  2AQ1 B;  4OWW B;  2K5H A;  2ES2 A;  2OXP A;  4LF4 L;  2MNA A;  4A3J G;  1X3G A;  1B70 B;  4HCS A;  4GZY C;  5GAG C;  4LF7 Q;  3B6Y A;  2XTI A;  4LW1 A;  2CW0 C;  4GOP B;  4X3S A;  1GUW A;  3GDE A;  3ULJ A;  2JA6 H;  4YY3 L;  2ICI A;  1SMY C;  3SVM A;  4N8X 1;  3TME A;  3VDY A;  4DR5 Q;  2F4V L;  2EY6 A;  3KBG A;  2KQ3 A;  2BOS A;  2A5H A;  3F8T A;  3I90 A;  2Q8I B;  4FDB A;  1X54 A;  1EWI A;  1U4P A;  5DEH A;  4QY7 A;  1QWY A;  3STB C;  3PGZ A;  4OX9 Q;  5JEA J;  4JW0 A;  3HOX H;  3M3Y B;  3M9B A;  2K28 A;  2BA0 A;  1E2V A;  3K0X A;  3UE1 A;  3K7A H;  1Z6H A;  1LTI D;  4IJL A;  1BF4 A;  1CFM A;  2BH8 A;  1IBL L;  3UI2 A;  3HOY H;  2HT1 A;  1RJT A;  4Q0F A;  1JB7 A;  1T9H A;  1HR0 W;  1SJE D;  4S3S A;  4DV1 L;  2PQE A;  1DOK A;  3CHB D;  1RHP A;  2X6L A;  3E3X A;  4M8A A;  3ULP A;  1B2T A;  3CCQ A;  2EZV A;  1EU4 A;  1UWV A;  2B2U C;  4LK1 C;  2F1M A;  2OTJ A;  2IHE A;  4DR1 Q;  2I5H A;  4Y7N H;  4FXG C;  4TKO B;  1DOL A;  5FO8 B;  2UXB L;  2R7F A;  4RHR A;  1TWH H;  2KCN A;  2Y0S B;  2KHI A;  4LFA Q;  3SK5 A;  3M85 A;  4BXX G;  1KHI A;  2A6E C;  3WWV A;  5C3E G;  4GOP C;  3CD6 A;  1JOQ A;  1LYL A;  4IOC A;  2EDG A;  3DM3 A;  3HOZ B;  4X3T A;  3QWN A;  3KLS A;  3ER0 A;  1IW7 C;  1BVS A;  1KNE A;  3K0Y A;  3G7L A;  1Y8O B;  3CP0 A;  1JJ2 A;  2F0V A;  2FMC A;  1N32 Q;  1L0X B;  4IUU A;  2VUM B;  2Z8L A;  5C4X H;  3V96 A;  1A3U A;  4JI1 L;  2HCC A;  3HEJ A;  1WTX A;  2E2J H;  3PIO A;  4JI5 Q;  3ULL A;  3HKZ G;  4J6H A;  3MXN A;  2F0J A;  2B2W A;  2QDL A;  4JVZ A;  3SE0 A;  4G57 A;  3L9A X;  1CQF A;  3FKI G;  2SDF A;  2VQF Q;  1PH8 A;  3BU2 A;  1EIG A;  4DV2 Q;  3DEP A;  4A3B G;  1EIY B;  3GTJ H;  1DZ1 A;  5IYC H;  4X65 Q;  1F9S A;  5A2Q L;  1IL2 A;  1Y69 U;  3NEN A;  3MXG A;  4C3H B;  1LTL A;  1ZKO A;  1KD1 C;  4K5W A;  1OXU A;  2BE5 D;  4PG3 A;  3KK7 A;  1PLF A;  5IOD A;  1UNS A;  2F52 A;  5KGU A;  2R3Z A;  3H09 A;  1JOR A;  2RDF A;  4TQU S;  3ND9 A;  1VQ6 A;  1I3Q B;  1WTQ A;  1LTT D;  2ASB A;  1CKO A;  5EGT A;  1Y1W B;  1PRT D;  3CF5 A;  1TWH B;  3HOZ G;  3AEV A;  1EY9 A;  2H5X A;  3NBI A;  1ET6 A;  2TSS A;  5FJ8 H;  1STA A;  2FFK B;  4PQX A;  1CM9 A;  4RGO S;  2IY5 B;  1KDB A;  2MJ8 A;  3GV3 A;  1K73 C;  4IO9 A;  1JE4 A;  4TVA B;  4WFN 3;  1X65 A;  1NNX A;  4WJW A;  4BBS B;  2Z6K C;  1VQH A;  1MJE A;  4DR4 Q;  1OXT A;  1EUJ A;  1O7I A;  1EFW A;  1E1T A;  4DV4 Q;  4L6T B;  3A74 A;  2KCM A;  1SE4 A;  4R4C A;  1SNO A;  1WOC A;  4KN4 C;  1O7L A;  3R8B A;  3D31 A;  1L1O A;  1S3O A;  1W3S A;  4A3D B;  2F3I A;  5K36 G;  4QMG A;  3NWS A;  4OWX B;  2KCC A;  1EY5 A;  1N33 Q;  4G7O C;  2VQE L;  2EIF A;  4QIW E;  1K8M A;  5IT9 E;  3LGJ A;  3SDZ A;  1P8L A;  3T56 B;  3K5N A;  2HDM A;  4UHV A;  1TVX A;  1ILQ A;  4A3K B;  2F0W A;  2DY7 A;  5CMD A;  4N9P A;  4MNO A;  4HJ7 A;  4IUP A;  2EQS A;  2J7Z A;  4DV3 L;  5HY6 A;  5C44 B;  1VQ4 A;  1LTR D;  1Q8I A;  1ICW A;  2ID0 A;  1EEI D;  3PF5 A;  3IAY A;  3KDF A;  3VR6 A;  3G4S A;  3AB9 A;  4C1N I;  3A54 A;  2VNU D;  1T5X D;  2BDN A;  5E4W C;  1TKW B;  4K0K Q;  3PO3 H;  5I4D A;  1NCV A;  3FMC A;  4U68 A;  3GTL B;  4LJZ C;  1XJV A;  1HNZ Q;  3VA5 A;  3KBX A;  4A3K G;  2UUA Q;  1EIF A;  4PZ8 A;  4KV6 A;  2N3S A;  2Q2I A;  1PH5 A;  2NUC A;  1YNJ D;  5KND A;  1EEF D;  3O13 A;  1L0W A;  4ZKB B;  4APV A;  4IN3 A;  1NMF A;  5A2Q E;  5EBC A;  3RZD H;  2JA6 B;  1JE5 A;  5LHY 1;  5E3F A;  1NJI C;  4TRD A;  3S24 A;  5C3E H;  1XNR Q;  3RZO B;  1HUN A;  2E2D C;  1H9R A;  1J8I A;  2EY2 A;  5CV4 A;  4RGM A;  3HOY G;  2GVB A;  4PV1 C;  1CUK A;  1P16 A;  4ZRZ A;  5ISR A;  1OO9 B;  4A3K H;  4YHH Q;  1JQY D;  4G7Z C;  2EYL A;  3TZD A;  5IE8 A;  1TS2 A;  1AP0 A;  4BXX H;  4A93 H;  1SYF A;  2CH4 W;  2KBN A;  2WII B;  4LNQ A;  1F9P A;  2F3V A;  1I50 H;  1PXU A;  5FLX E;  3NBH B;  4LF6 L;  5IYB H;  1G91 A;  3CCL A;  1AEX A;  1WD0 A;  4KLK A;  4DV1 Q;  2PQA B;  1AW7 A;  4HMI A;  4BY1 B;  2B2V C;  3QR8 A;  1BBW A;  1Y1V B;  3OWE B;  1MIU A;  3OMC A;  4JI1 Q;  4EQP A;  1GUN A;  4LWC A;  4YIJ A;  5E7N A;  4KTA A;  4IUV A;  1LO5 D;  1WTH A;  5KNB A;  4EQN A;  4A3C H;  2MHV A;  2NVY B;  3PUZ A;  5EPL A;  1HNW Q;  1KLG D;  4LF4 Q;  1CI3 M;  1X3F A;  1OXV A;  4R8I A;  1GUG A;  2Y0S G;  4O1N A;  3W1G A;  2PQA A;  1MGS A;  3IFD A;  1VQE A;  4B3M Q;  3J80 c;  1PMR A;  2IHF A;  1VQM A;  1AZQ A;  5JVH 3;  2E2I B;  1IBM Q;  3GV6 A;  3HOU H;  4GN3 B;  4R1J A;  4H7B A;  2CCZ A;  5I2Y A;  2Z6B A;  2AMC B;  2XWB B;  1PFB A;  3Q24 A;  4A3F H;  2PZU A;  3EJI A;  5M9O A;  1CZW A;  1O7Y A;  4DV0 L;  2K5Q A;  4GNX B;  2V1C C;  1X3P A;  1HA6 A;  4KKS A;  2L0C A;  2BA1 A;  3BZD B;  4IUN A;  4C3J H;  1VQP A;  3R2T A;  1K8A C;  1J6Q A;  2AUJ D;  2K14 A;  1I50 B;  3D8G A;  2ENB A;  4AIM A;  3A5U A;  5A35 A;  1A63 A;  2LFN A;  1ZYR D;  2M00 A;  4B3R Q;  3M4P A;  4HSP A;  3FPU B;  3I4M B;  1TWC H;  4X3K A;  4BY1 H;  3BYT B;  2JA5 H;  3EFX D;  2NVT B;  1PFS A;  1Q12 A;  1D8L A;  3A8J E;  3CCJ A;  1BKB A;  3T1Y L;  4XT1 B;  1ICF B;  1IKM A;  2ZJQ A;  1ESR A;  4AYB E;  2N55 A;  3F2B A;  3E6Z X;  1D1I A;  1VQ8 A;  3A5Z B;  1A8V A;  2LMC B;  4OL7 A;  1ASZ A;  1BDO A;  1L1O C;  1KL9 A;  4JI7 L;  5GRO A;  3JAM L;  4IFD H;  1JWM D;  3BVM A;  5D65 A;  1K9M C;  3GTO B;  1NR2 A;  1GUS A;  4F8M A;  2EYM A;  2I46 A;  2PPB C;  1GXD C;  1DM0 B;  3MC0 B;  1SLJ A;  2PNR C;  3TDQ A;  3VYT A;  5IYD G;  3DXJ C;  2Z6K A;  4DNI A;  1I94 Q;  3M4Y A;  4ZUJ A;  4WJ4 A;  1NSN S;  2ZT9 C;  4K2K A;  4BS9 A;  1HNW L;  2UUC L;  3I3C A;  1YHB A;  5I9O A;  3UDX A;  4DGZ A;  2QW7 A;  4C3I B;  3LNN A;  3M4Q A;  4OON A;  4BBR G;  1EY6 A;  3OHX C;  3NEL A;  1BBX C;  1EWC A;  3I70 A;  2HD3 A;  5IGG A;  4IUQ A;  1B4O A;  3I56 A;  5IGF A;  1PYB A;  1MD2 D;  2B63 G;  3L0O A;  5CV5 A;  3FVQ A;  4L63 B;  2B2Y C;  2E8G A;  4KMU C;  4DXF A;  1HFG A;  4UY8 C;  2JA7 H;  2CWA A;  1KRS A;  1PRT B;  1TWC B;  4OO1 H;  2EJG C;  1KTK A;  2UU9 L;  3SHL A;  3A55 A;  2B63 H;  3PO3 G;  1HH2 P;  5C44 H;  2RBM A;  3RLN A;  4B3S Q;  4G7H C;  1FL0 A;  2AHO B;  4N8F A;  4IFD I;  4XDX A;  1LV9 A;  2VXW A;  1K0R A;  5M5Y B;  3OTO L;  2WKC A;  3N6R A;  5M5W B;  1F2L A;  4HIK A;  1K8O A;  3A56 A;  1II3 A;  2K33 A;  3K81 C;  3TN2 A;  4AQY L;  1YNN C;  1SYB A;  1YI2 A;  5GQO A;  1WD1 A;  4HSV A;  5JEA H;  4YHH L;  3A8I E;  3HKZ B;  2UUC Q;  1HZB A;  2ZTE A;  1STY A;  3J81 L;  4DPG A;  4KHZ A;  2YU9 B;  5CC4 A;  3CW2 C;  3A7A B;  3JAM c;  1PV4 A;  2ZJP A;  1CSP A;  1HPC A;  1SNC A;  1BCP D;  4FXD A;  3GP7 A;  1IKL A;  5DLQ E;  1V1O A;  4KY7 A;  1J9O A;  2L15 A;  4JI8 Q;  1FJG L;  1B3Q A;  3NQT A;  3S2H H;  2F0P A;  3PCO B;  3FP9 A;  2B2U A;  3T1Y Q;  4BWG B;  4HJ8 A;  2EY1 A;  3PUW A;  5ELD A;  4CKB A;  2XVS A;  1A2T A;  1PH6 A;  2JK8 A;  4CBV A;  3HZX A;  3T1H L;  1D6E C;  5IOC A;  1J5E L;  2L1B A;  5M5X B;  1LAB A;  2PW7 A;  4GLX A;  1Q90 A;  1YBY A;  2B3G A;  3PO2 G;  2C5C A;  4EQO A;  2ZM6 L;  2IW3 A;  3R3O A;  1WI5 A;  5JJZ A;  3K8A A;  3C46 A;  1SMX A;  3KF8 B;  4UP7 A;  2JA8 B;  3E9I A;  2F0G A;  1LLR D;  3UDI A;  1GO3 E;  1F9Q A;  3CU7 A;  1I4G A;  1VF7 A;  2JXM B;  3PUX A;  2B29 A;  2NTS A;  1AH9 A;  1HZC A;  3E0J A;  3S14 H;  4HJA A;  1SJH D;  1DON A;  1Q81 C;  2FIN B;  1RCV D;  4RGN A;  4C2M B;  1Y1V G;  4H44 C;  1AE2 A;  4X66 Q;  1HR0 Q;  5I9P A;  1ENF A;  4ME3 A;  4LFC Q;  2XRS D;  4A3E B;  5IGE A;  1QZH A;  1TWF B;  2D62 A;  2D5D A;  2WB1 G;  1N33 L;  2MUY A;  4DR7 Q;  3RN5 A;  2RF4 A;  3HOX G;  4LF5 Q;  2IX1 A;  2EYH A;  1FVI A;  5C0X I;  3E5S A;  1B8A A;  1S5B D;  2RHS B;  3C2P A;  2RKS A;  1HRJ A;  1JIC A;  2DJG C;  1RDP D;  3K5M A;  4A3F B;  3S16 B;  3QG1 A;  1K3R A;  2LXK A;  5IP7 H;  2DNC A;  4AH6 A;  3J81 c;  3CC4 A;  4JI7 Q;  4CJ0 B;  3OMG A;  2XIW A;  3F2U A;  3HRZ C;  1SFO B;  1KDC A;  4DUZ L;  2RQX A;  1VQF A;  1I4X A;  1WCM G;  4DK1 A;  2E5L L;  2YTY A;  5NUC A;  3EVQ A;  1S4Z A;  1A2U A;  4K5X A;  2VB2 X;  3MTS A;  1TWA H;  3RMH A;  1RD9 D;  3K5O A;  3RD4 A;  1GUT A;  2PCF B;  3MWY W;  2VW9 A;  4KY5 A;  5IGB A;  1S5D D;  5C4X B;  3SK4 A;  5LMN W;  3S14 B;  3KLW A;  3Q23 A;  4UPA A;  1HR0 L;  5EKK A;  2PI2 A;  3KF6 A;  2JA6 G;  1SNP A;  3D0F A;  2N49 A;  4DA2 A;  2A19 A;  2JSO A;  4Q5V A;  1TWF H;  4DR3 L;  4A3B B;  2AWO A;  1AFP A;  4DK6 C;  1PYS B;  4LF9 L;  1I5F A;  2B8F A;  3H0G B;  2E5L Q;  1D5Z C;  2NYZ D;  4LMQ D;  2E75 C;  1IBM L;  2LY7 A;  3IKJ A;  3AFP A;  4A76 A;  2GN5 A;  1E0B A;  4N9T A;  1GKH A;  4JC0 A;  4KY6 A;  1PA6 A;  4R4I A;  2IJ0 A;  1UEA B;  5IGD A;  4FVM A;  1HQM C;  3M4O B;  5HGQ A;  4IOA A;  1E2W A;  5KNC A;  3LWU A;  5ELC A;  1STB A;  1MSG A;  5JVG 3;  4A3E G;  1I94 L;  5IP7 G;  4C3I G;  1IHZ A;  3CXC A;  5T1G A;  3BG3 A;  5FO9 B;  1K3B C;  3CCM A;  2FJ2 A;  3UDG A;  2K03 A;  1SE8 A;  5F2D A;  1VQ7 A;  4NDX A;  3P75 A;  3RN2 A;  2I0Q A;  2NN6 G;  1QNU A;  5IY0 A;  1G2T A;  3M7G A;  4BBS G;  5H1S E;  4LAA A;  3FRP B;  1EY4 A;  3KF6 B;  5C0X G;  2HCI A;  4J8Q A;  3GTG B;  2EYJ A;  4X64 Q;  1EOV A;  3S1Q B;  4P72 A;  2F0K A;  4RA8 A;  2A74 C;  2UUB L;  4RG1 A;  1SYC A;  4ID6 A;  2H4O A;  1Q1B A;  4IUT A;  4GNX C;  1VMP A;  1ESF A;  4OIJ A;  1ROD A;  5HGT A;  5IYC G;  4WOR A;  2N8N A;  4GKK Q;  4A3B H;  3AYH B;  5M5W H;  2ZTC A;  4IUR A;  4YY3 Q;  3UE0 A;  3BZK A;  1DOM A;  1O7Z A;  4LFC L;  2K04 A;  4RWS C;  5IIF A;  3I55 A;  4POF A;  4A3L G;  2MP1 A;  2C35 B;  3HFZ B;  1R4P B;  5JOB A;  4O0A A;  1GUO A;  3HOX B;  1ZEQ X;  1IYU A;  4H13 C;  3M4O H;  2F4I A;  2R6G A;  4LFB Q;  1STG A;  1C4Q A;  4DUZ Q;  4ME5 A;  1E3P A;  2EOT A;  4POG A;  1E7Z A;  1G29 1;  4DV7 L;  1FNW A;  3MXP A;  4JCV E;  2ALY B;  2UXD L;  4RKL A;  1I4Q A;  1BUV T;  2UU9 Q;  2RSO A;  5JPM C;  4HJ5 A;  1RL2 A;  3MAQ A;  2YYZ A;  3IFT A;  4A3G G;  3PO3 B;  1IBK Q;  5KYL A;  2C9O A;  1XTD A;  2CVR A;  1RIP A;  3S15 B;  3TSS A;  1D2B A;  4CJ1 B;  1NAP A;  3PUY A;  4BA2 I;  3TBI B;  3CPF A;  1MHW C;  1H95 A;  4P73 A;  1XTC D;  3GTG H;  2YV5 A;  1X55 A;  4UAI A;  1EY0 A;  1A3T A;  1EYC A;  5M5X H;  1LM0 A;  1SN8 A;  2GVA A;  2I5M X;  1CT1 D;  2WAQ G;  3FKI H;  1JWS D;  2Q8R E;  1F77 A;  4KK7 A;  4XIG S;  5E4X A;  1PTO B;  2JP1 A;  2PNH A;  4WJ3 M;  5KYI A;  4K6D A;  3HOZ H;  4U67 3;  4ZCK A;  1CA5 A;  3OIQ A;  1T5E A;  2XRQ D;  1Q1E A;  1QB5 D;  5D3D A;  4A3J B;  2CQA A;  1OXX K;  5BN4 A;  2B2T C;  3QO2 A;  4L5Q A;  2YTV A;  3D6W A;  4EQ5 A;  1U4L A;  3C1F A;  1D7Q A;  1VDZ A;  4MHE A;  4LF8 L;  1ML0 D;  2B2W C;  1EU3 A;  2WAQ B;  4RCN A;  1S5E D;  2K1B A;  2F0F A;  2F0O A;  4XTC S;  2OQ0 A;  5KRU A;  3S1N H;  4NP5 A;  1TQO A;  4QCL A;  1Y8N B;  2NZO A;  4K8I A;  5C4H A;  3K80 C;  3BS1 A;  1C7Y A;  4JG2 A;  3SEB A;  3NTI A;  1FYC A;  5D14 A;  4QIW B;  1WTR A;  1N8R C;  3HP3 A;  4AYB G;  5IP9 G;  5C3X A;  1QVF A;  4B9W A;  3L3O C;  5C6A A;  3S16 H;  1VQL A;  2TMP A;  4IPD A;  5ELO A;  5EPK A;  1UE1 A;  1Q7Y C;  3C3L A;  2OTL A;  3D3R A;  1TXY A;  5BR8 Q;  5COY A;  1K83 B;  1B44 D;  5FLX c;  4GKJ Q;  3FKI B;  1YJ9 A;  4K8J A;  1VQ9 A;  5KEE A;  1NY4 A;  1D1K A;  4XYO A;  4A3C G;  5FK9 C;  2EXD A;  1LT5 D;  5C3W A;  1TS5 A;  4FF4 A;  2KOL A;  2BH2 A;  3JAM i;  2QIL A;  3HOU B;  1G2S A;  4R9W A;  4MTN A;  5JAV A;  1XMQ L;  4JI4 Q;  1TII D;  3EN2 A;  4DKA C;  1A15 A;  3GTP B;  4HCE A;  1H9S B;  5EBD A;  3PIP A;  4LFB L;  3DM1 A;  4ZAI A;  5C4J B;  2NN6 H;  1TR5 A;  4MN3 A;  5CYU A;  2F0L A;  2KEN A;  2RSN A;  5KIX A;  3P20 A;  1UEB A;  1I6H B;  1KAW A;  4GS3 A;  2QEX A;  2VZA A;  4FNF A;  4DR3 Q;  2CKZ B;  3E0E A;  3N52 A;  3H0G H;  1EY7 A;  2JQO A;  4DN4 M;  2ZXP A;  1I4P A;  1XPO A;  2HUG A;  4UP9 A;  1QUQ A;  4DR1 L;  2PZW A;  5COR A;  3V05 A;  2F0M A;  2K01 A;  4GOP A;  1VQG A;  2LS0 1;  3A7L A;  1B50 A;  2V4D A;  4OEL B;  3URY A;  1MBY A;  2IWH A;  1OXS C;  1H9J A;  2QCP X;  5BR8 L;  2A73 B;  2CWP A;  4J15 A;  5G3L F;  1H9S A;  3NEM A;  4KKU A;  3FEW X;  3ZJY C;  2AQ2 B;  3X3M A;  2QGQ A;  3EA6 A;  2QDB A;  2K5W A;  3NQI A;  3RNU A;  5GAH C;  3PV0 A;  2SOB A;  1CKN A;  4DXG A;  5HUR A;  5C44 G;  4DV6 L;  4H02 A;  3PQI A;  1HTP A;  4NMZ A;  1Q86 C;  4DV3 Q;  2D0P A;  2EYP A;  3CRK C;  4PMW A;  1PZJ D;  1HTL D;  1STN A;  1I4H A;  2KA7 A;  2SNM A;  4RHS A;  1X6O A;  4PZ7 A;  3L2P A;  1GD7 A;  2EYO A;  3S1Q H;  2EJF C;  5C4J H;  3GTM B;  1K8G A;  2RDH A;  5K5P A;  4OWT B;  1BCP F;  1BCP C;  3FDT A;  3W3A A;  3CAM A;  4DV5 L;  1CHP D;  2R7Z H;  3HOW H;  2O2L D;  3TP7 A;  1H9K A;  2HQE A;  5C3E B;  3RZO H;  3G6E A;  3I4L A;  4DUY Q;  1DCZ A;  2WAQ E;  3GTQ H;  1LT4 D;  1WTO A;  4BY7 H;  3UDF A;  1PH2 A;  2ZJR A;  1EQQ A;  1YNN D;  2CHB D;  4OO1 I;  1F2Y A;  1PFM A;  4QUC A;  2KUM A;  2QF7 A;  3BDL A;  5DNF A;  2B8G A;  2NVQ B;  1Q8K A;  2EY5 A;  1N34 L;  1JT8 A;  4YWK A;  3U9S A;  4PMC A;  2F0H A;  4LF7 L;  5CBA E;  2R93 B;  1R9T H;  3KJP A;  3AQQ A;  4F7X A;  3ND8 A;  3TZU A;  2Q8T A;  3VA7 A;  4DR2 L;  2IL8 A;  4PMB A;  4ULL A;  3HOV H;  1X3Q A;  4JI8 L;  2VY3 A;  4JYA L;  1V8Q A;  5IGC A;  3SGI A;  5CBE E;  1JOK A;  2H1E A;  1SXT A;  3OIP A;  1XX8 A;  4RKB A;  4DAV A;  3EQL C;  2O4X A;  1LT3 D;  2DY8 A;  1XPU A;  4JV5 L;  3K58 A;  2B2V A;  5I6W A;  2L55 A;  4RFB A;  1TWG B;  1VS0 A;  4R8N A;  1G8Z D;  5EAY A;  3HOW B;  4A93 G;  3J7Y W;  2R7Z B;  2SEB D;  1E1O A;  1BR9 A;  2VUM G;  4WRD A;  4P71 A;  2K4K A;  4A3J H;  2DN8 A;  1YJW A;  3OSO A;  5M3M H;  3I4M G;  5E1F A;  2DUD A;  5FLM H;  4NXM L;  1IXR A;  5IYD H;  4IZ8 A;  1HFN A;  1YZ6 A;  1C9O A;  2LKV A;  3W1B A;  1CK1 A;  2G9H D;  1PH1 A;  5IP9 H;  4FXK C;  4XT3 B;  3MXN B;  4F88 A; 
#chains in the Genus database with same CATH homology
 1VQ5 A;  2H5X A;  4P75 A;  3DLL A;  5FJ8 H;  3L7Z C;  2NVX H;  1BBU A;  4DUZ L;  3OTO Q;  1VQF A;  1WCM G;  2E5L L;  4IJH A;  1U5K A;  2YTY A;  4DR5 L;  1HNX L;  2F4V Q;  1CKN B;  1VQB A;  1L2F A;  3KJO A;  2IY5 B;  1TWA H;  1K73 C;  4IO9 A;  1KQS A;  4TVA B;  2UXC Q;  1X65 A;  3PUV A;  1FGU A;  1QZG A;  3OW2 A;  1GM5 A;  4LFA L;  2Z6K C;  1VQH A;  4YWM A;  2NVT H;  2RCN A;  1Y1W G;  1MJE A;  4R4O A;  4GN5 A;  2VW9 A;  1OXT A;  1XNQ Q;  4DR4 Q;  5JJL A;  1EUJ A;  1O7I A;  1EFW A;  3U50 C;  1E1T A;  4DV4 Q;  3CQZ H;  3A74 A;  2KCM A;  4JI3 Q;  4LF9 Q;  5LMN W;  4R4C A;  3KLW A;  1G6P A;  1WOC A;  4UPA A;  1KRT A;  1HNX Q;  4C3I H;  1K83 H;  1GVP A;  3F1Z A;  4YCU A;  3D31 A;  1HR0 L;  1L1O A;  2PI2 A;  3KF6 A;  3A0J A;  2K5V A;  3I4O A;  1S3O A;  1W3S A;  3D0F A;  2JA6 G;  2N49 A;  4NXN L;  2MFI A;  2A19 A;  2F3I A;  5K36 G;  1TWF H;  3PSI A;  4DR3 L;  2R92 H;  1VQD A;  1TWG H;  2AWO A;  1YJN A;  4OWX B;  4DK6 C;  3TQY A;  1N33 Q;  1PYS B;  2VQE L;  4YCV A;  2R92 G;  2EIF A;  4LF9 L;  1A0I A;  1I5F A;  4EX5 A;  4QIW E;  1YIT A;  5M3F H;  2E5L Q;  3LGJ A;  4DV0 Q;  1P8L A;  1PH4 A;  5JEA G;  4LF6 Q;  2PI2 E;  1VQO A;  1IBM L;  4A3F G;  3AFP A;  3GD7 A;  2GN5 A;  4A76 A;  2UXC L;  1GKH A;  4JC0 A;  1PA6 A;  3CC2 A;  4R4I A;  4K0K L;  4JI0 Q;  4MNO A;  4HJ7 A;  4DR4 L;  2EQS A;  4DV3 L;  3HOU G;  5HY6 A;  1VQ4 A;  3TEH B;  5HGQ A;  2ID0 A;  4A3D G;  3PF5 A;  1V1Q A;  4DAY B;  2DGY A;  2WB1 E;  3KDF A;  4IOA A;  1JJG A;  4A3G H;  1YNX A;  3G4S A;  2K75 A;  1I6H H;  1QUQ B;  2VNU D;  3EBE A;  4A3E G;  2UXB Q;  1I94 L;  5IP7 G;  4JI4 L;  2YTX A;  1VQJ A;  3CXC A;  3J81 i;  1W2B A;  5M5Y H;  3CCM A;  4A4I A;  4K0K Q;  4JBK A;  3PF4 A;  3PO3 H;  3UDG A;  4JI2 L;  4NXM Q;  3GTK H;  1SE8 A;  1VQ7 A;  4DV5 Q;  3RN2 A;  2I0Q A;  1S72 A;  2NN6 G;  1Y1V H;  5GAE C;  3S1R H;  5IY0 A;  1XJV A;  2A1A A;  2JA9 A;  1HNZ Q;  1M90 C;  4BBS G;  4A3K G;  3OYY A;  5H1S E;  4A75 A;  2OCE A;  3CMA A;  2UUA Q;  2XGT A;  1EIF A;  2CFM A;  3KF6 B;  4PZ8 A;  1U0L A;  5ELN A;  3KOJ A;  2N3S A;  3S1M H;  5C0X G;  2Q2I A;  4DR2 Q;  2NVY H;  1PH5 A;  1IYJ B;  2NN6 I;  4X64 Q;  4P74 A;  1M1K C;  1EOV A;  3M3Y H;  4P72 A;  1PH7 A;  4DV2 L;  3RLO A;  1L0W A;  1MJC A;  2NZH A;  3KYH C;  5FJ8 G;  2UUB L;  4RG1 A;  4APV A;  2ZTD A;  3FHW A;  1NMF A;  5M3F G;  1N9W A;  2Z0S A;  4IFD G;  1XMO L;  4OXP A;  4JYA Q;  1Q1B A;  4GNX C;  1YEZ A;  3RZD H;  4QJF A;  1JE5 A;  5IYC G;  1YHA A;  2N8N A;  1NJI C;  4A3B H;  2E2I H;  2D0O A;  4GKK Q;  3AYH B;  5M5W H;  2ZTC A;  3S24 A;  3RR5 A;  5C3E H;  1KC8 C;  4YY3 Q;  1XNR Q;  3UE0 A;  3BZK A;  4DV4 L;  1VQK A;  1Z47 A;  4LFC L;  3HOY G;  3J7A 5;  2GVB A;  1N36 Q;  2R7D A;  2VQF L;  4A3L H;  1CUK A;  1P16 A;  4GN4 B;  3I55 A;  4LUZ A;  4POF A;  1YIJ A;  4A3L G;  2C35 B;  3HFZ B;  4X65 L;  4DR7 L;  4O0A A;  3GO5 A;  4BA1 I;  2YU9 H;  4MZ9 A;  1DGS A;  4A3K H;  4YHH Q;  4NXN Q;  1B7Y B;  2Q2T A;  4L5T A;  3TS0 A;  3M4O H;  3GTM H;  2VL6 A;  2R6G A;  5IE8 A;  1J5E Q;  4BY7 G;  4LFB Q;  3JC6 6;  3CPW A;  4DUZ Q;  1OTC A;  1C0A A;  1E3P A;  4DK3 C;  4POG A;  4BXX H;  3KFU A;  4A93 H;  1E7Z A;  3J80 i;  2OQK A;  2KBN A;  4LNQ A;  1G29 1;  4DV7 L;  1I50 H;  4JCV E;  5IYB G;  2ALY B;  3NBH B;  4LF6 L;  2UXD L;  5IYB H;  2UU9 Q;  3CCL A;  5GAD C;  4HJ5 A;  1RL2 A;  3G48 A;  4KLK A;  2YYZ A;  4DV1 Q;  1V9P A;  1ASY A;  2PQA B;  2JA8 H;  3F2C A;  4A3G G;  1WJJ A;  5M3M G;  1IBK Q;  3I4M H;  4GKK L;  4OO1 G;  4JI6 L;  1FJG Q;  2JA7 G;  1XTD A;  4L5S A;  1BBW A;  1VCI A;  1PHJ A;  1RIP A;  1MIU A;  4PZ6 A;  4JI1 Q;  2VUM H;  4LWC A;  5E7N A;  3PUY A;  3H0G G;  4BA2 I;  2HIX A;  1LUZ A;  3CPF A;  2NVQ H;  1H95 A;  2AKW B;  4P73 A;  4QL5 A;  2RHQ B;  4JV5 Q;  3GTG H;  4A3C H;  2YV5 A;  1X55 A;  4QQB X;  2K50 A;  3PUZ A;  4X64 L;  1L1O B;  4C2M H;  1N34 Q;  1HNW Q;  5M5X H;  2R93 H;  1LM0 A;  1SN8 A;  1X3F A;  2GVA A;  2I5M X;  4LF4 Q;  1OXV A;  3TS2 A;  2WAQ G;  3FKI H;  4GLA C;  3TRZ A;  2LSS A;  4A3E H;  4YWL A;  3EIV A;  4AQY Q;  3CCU A;  5C0X J;  3GTO H;  2E2H H;  2Y0S G;  4XIG S;  4WJ3 M;  2PNH A;  3TRE A;  2PQA A;  3W1G A;  1VQE A;  4B3M Q;  3AFQ A;  3J80 c;  3HOZ H;  4X6A H;  2IHF A;  1VQM A;  4OX9 L;  3CCE A;  4X62 L;  1KXL A;  4C3H H;  1Q1E A;  4HIM A;  1IBM Q;  2IT1 A;  4O2D A;  2FXQ A;  5IT9 c;  2K5N A;  4JBW A;  3STB D;  4ALP A;  3HOU H;  2R93 G;  4GN3 B;  1UE7 A;  4R1J A;  1OXX K;  2CCZ A;  1NBW A;  4L5Q A;  2AMC B;  2K52 A;  5IWA L;  2JE6 I;  2YTV A;  1I3Q H;  1EYG A;  4JI6 Q;  4EQ5 A;  4A3F H;  1S40 A;  4R4T A;  3F2D A;  4B3R L;  1Y1W H;  1D7Q A;  2ZM6 Q;  2JJQ A;  3ERS X;  4DV0 L;  4LF8 L;  1XNQ L;  3H3V H;  4GNX B;  3H3V I;  4HJ9 A;  1UE5 A;  2V1C C;  4XTC S;  1YVC A;  2QA4 A;  2BA1 A;  3I4N G;  1VQA A;  2OQ0 A;  3I2Z A;  3S1N H;  4C3J H;  1SFO H;  1VQP A;  1IBL Q;  1K8A C;  1J6Q A;  2NZO A;  2K14 A;  1WCM H;  5IWA Q;  4R4Q A;  3K80 C;  4AIM A;  1C7Y A;  3A5U A;  2UXD Q;  2ATW A;  4RMF A;  4JG2 A;  5JJI A;  1A63 A;  1YHQ A;  4B3R Q;  3M4P A;  1WFQ A;  2JEB I;  2N78 A;  1N8R C;  2HHH Q;  1SRU A;  1UE6 A;  4AYB G;  5IP9 G;  1IBK L;  1TWC H;  3HKZ E;  3K7U C;  4BY1 H;  1QVF A;  4IPG A;  4IPH A;  2JEA I;  1E22 A;  5LMU Q;  4BBS H;  2JA5 H;  3S16 H;  1Z9F A;  1VQL A;  1EQR A;  1PFS A;  4IPD A;  3S15 H;  5ELO A;  1Q12 A;  3GTP H;  4IPC A;  1D8L A;  3CCJ A;  1BKB A;  3T1Y L;  2JA8 G;  1Q7Y C;  1UE1 A;  1SRO A;  3CCS A;  2ZJQ A;  1HZ9 A;  2OTL A;  2KHJ A;  1TXY A;  4AYB E;  3F2B A;  5BR8 Q;  4A3I G;  1HNZ L;  1VQ8 A;  3A5Z B;  1A8V A;  1ASZ A;  3J81 j;  1L1O C;  1KL9 A;  4JI7 L;  3PO2 H;  5GRO A;  5FLX c;  4GKJ Q;  1YJ9 A;  1K9M C;  4A3D H;  1XNR L;  1VQ9 A;  1SR3 A;  1NY4 A;  4HID A;  4IFD J;  1NE3 A;  4LUO A;  4A3C G;  1XPR A;  2EXD A;  1SLJ A;  5LMN Q;  4GLV B;  4A3I H;  2BH2 A;  2A8V A;  1VQC A;  5IYD G;  3JAM i;  2Q2U A;  3IRB A;  4L5R C;  2Z6K A;  3U4Z A;  4DNI A;  3I7F A;  1I94 Q;  4JI4 Q;  4MTN A;  1XMQ L;  4WJ4 A;  3H15 A;  1CSQ A;  4JOI C;  1IZ6 A;  1HNW L;  3EN2 A;  4DKA C;  2UUC L;  1CKM A;  4A3M G;  4JI0 L;  1YHB A;  3E9H A;  3G71 A;  4B3T Q;  2MO0 A;  3PIP A;  5LMU L;  5AJ3 Q;  1JJC B;  4BY1 G;  4LFB L;  4JI3 L;  3UDX A;  4Y52 H;  1Q46 A;  2UUA L;  3U58 A;  1N36 L;  2WFW A;  4LF8 Q;  3M4Q A;  4OON A;  1G51 A;  4BBR G;  1AE3 A;  4NPS A;  2KEN A;  3Q8D A;  4BBR H;  1QVC A;  3ICE A;  3NEL A;  2IX0 A;  1UEB A;  1KAW A;  3I56 A;  4GS3 A;  2QEX A;  1PYB A;  2VZA A;  4DUY L;  4DR3 Q;  1MKH A;  4JI2 Q;  3CC7 A;  2CKZ B;  3E0E A;  3L0O A;  3H0G H;  2B63 G;  4KHP L;  1PVO A;  5AJ3 L;  2JQO A;  2E8G A;  1PH3 A;  4LF5 L;  1XPO A;  4UP9 A;  1QUQ A;  4DR1 L;  3GTL H;  4UY8 C;  2JA7 H;  2CWA A;  1HZA A;  1KRS A;  2I5L X;  3HOV G;  5FLM G;  3KDF B;  4GOP A;  2CQO A;  1VQG A;  2UU9 L;  1HJP A;  4OWW B;  2B63 H;  2K5H A;  1A62 A;  2MQH A;  1HH2 P;  5C44 H;  2ES2 A;  1PH9 A;  4LF4 L;  3PO3 G;  2MNA A;  3RLN A;  1OXS C;  4A3J G;  4B3S Q;  1X3G A;  1B70 B;  1E24 A;  1FL0 A;  4B3T L;  5GAG C;  2AHO B;  3BJU A;  4LF7 Q;  5BR8 L;  2CWP A;  3B6Y A;  4J15 A;  2XTI A;  2Q2H A;  3BZC A;  4LW1 A;  4IFD I;  3NEM A;  3J7Z C;  1VQI A;  4UP8 A;  4GOP B;  2HHH L;  1X3E A;  1K0R A;  3ZJY C;  3CCV A;  2QGQ A;  4KHP Q;  3GDE A;  3ULJ A;  3RNU A;  2JA6 H;  5GAH C;  4YY3 L;  3PV0 A;  5C44 G;  1CKN A;  3OTO L;  4DV6 L;  4A3M H;  4H02 A;  3VDY A;  4HIK A;  5JJK A;  2PMZ E;  4DR5 Q;  2F4V L;  1N32 L;  3K81 C;  2JA5 G;  3M7N A;  1Q86 C;  4DV3 Q;  2D0P A;  4GNX A;  4AQY L;  3F8T A;  1YI2 A;  4PMW A;  4FDB A;  5GQO A;  1X54 A;  1EWI A;  4QY7 A;  4YHH L;  4B3M L;  4DR6 Q;  1X6O A;  3STB C;  1HZB A;  2ZTE A;  3PGZ A;  4PZ7 A;  2UUC Q;  4OX9 Q;  4NB3 A;  2HIV A;  4KHZ A;  5JEA J;  4DPG A;  4X62 Q;  3L2P A;  1GD7 A;  3CW2 C;  3M9B A;  3JAM c;  3HOX H;  1PV4 A;  3S1Q H;  2BA0 A;  2ZJP A;  3K0X A;  3UE1 A;  5C4J H;  3K7A H;  1CSP A;  4IJL A;  3U4V A;  2BH8 A;  1IBL L;  3HOY H;  4HIO A;  5LMN L;  1K8G A;  3W5O A;  4OWT B;  2HT1 A;  2UUB Q;  3HOW G;  2R7Z G;  3CAM A;  4JOI A;  1V43 A;  4DV5 L;  2R7Z H;  3HOW H;  5J3B A;  1JB7 A;  5DLQ E;  1T9H A;  1HR0 W;  4DAM A;  3RZO H;  4DR6 L;  4DV1 L;  4JBM A;  3G6E A;  4DUY Q;  1Y14 B;  2WAQ E;  3S17 H;  3S2D H;  2L15 A;  3ULP A;  4JI8 Q;  5C4X G;  3CCQ A;  1FJG L;  3GTQ H;  2VQE Q;  3S2H H;  1UWV A;  4BY7 H;  3PCO B;  3FP9 A;  3UDF A;  2OTJ A;  2IHE A;  4DR1 Q;  1PH2 A;  1VQN A;  2ZJR A;  1EQQ A;  3T1Y Q;  2I5H A;  4HJ8 A;  4OO1 I;  4Y7N H;  2VS1 A;  2WP8 J;  3PUW A;  2UXB L;  2R7F A;  1XMO Q;  1TWH H;  1Q8K A;  2KHI A;  4LFA Q;  1PH6 A;  1N34 L;  1JT8 A;  2JK8 A;  4GKJ L;  4B3S L;  3T1H L;  4YWK A;  3M85 A;  4BXX G;  1J5E L;  1KHI A;  2AWN A;  1WYD A;  4LF7 L;  1X56 A;  3WWV A;  1R9T H;  4GLX A;  5C3E G;  1YBY A;  2B3G A;  3KJP A;  3AQQ A;  1KIX A;  3PO2 G;  4GOP C;  2ZM6 L;  1WI5 A;  3CCR A;  2HQL A;  3K8A A;  1QVG A;  3CD6 A;  4DV7 Q;  1LYL A;  4IOC A;  1SMX A;  3KF8 B;  4UP7 A;  3DM3 A;  4QGU A;  2KCT A;  3E9I A;  3ER0 A;  4DR2 L;  1BVS A;  4DV6 Q;  3UDI A;  1NTG A;  4YCW A;  3HOV H;  1GO3 E;  3CP0 A;  1JJ2 A;  1N32 Q;  3HKS A;  4JI8 L;  2VY3 A;  2B29 A;  3PUX A;  4JYA L;  3SGI A;  5C4X H;  1AH9 A;  1HZC A;  4JI1 L;  3S14 H;  4HJA A;  2E2J H;  4JI5 Q;  3PIO A;  1Q81 C;  3ULL A;  3HKZ G;  1Y1V G;  1XPU A;  1AE2 A;  4JV5 L;  2Y0S E;  4X66 Q;  1HR0 Q;  4ME3 A;  1XMQ Q;  3FKI G;  4KI0 A;  3CME A;  4LFC Q;  2VQF Q;  1PH8 A;  1QZH A;  3BU2 A;  2D62 A;  4DV2 Q;  3I4N H;  2MO1 A;  2WB1 G;  4A3B G;  1VS0 A;  1EIY B;  3GTJ H;  1N33 L;  5IYC H;  4X65 Q;  1Q82 C;  4DR7 Q;  5EAY A;  3RN5 A;  1IL2 A;  2RF4 A;  4A93 G;  3RLF A;  3HOX G;  3NEN A;  4LF5 Q;  1X9N A;  1E1O A;  2IX1 A;  1FVI A;  1LTL A;  1NMG A;  5C0X I;  1KD1 C;  4LUV A;  1B8A A;  2VUM G;  4P71 A;  1OXU A;  2K4K A;  2RHS B;  4PG3 A;  4A3J H;  2F52 A;  1YJW A;  4X66 L;  1JMC A;  4TQU S;  1VQ6 A;  5M3M H;  3I4M G;  2DUD A;  2ASB A;  1CKO A;  3MEF A;  5FLM H;  1K3R A;  4NXM L;  1IXR A;  2OWO A;  5IYD H;  1YZ6 A;  2LXK A;  4JBJ A;  1C9O A;  5IP7 H;  2LXJ A;  3W1B A;  3CF5 A;  4AH6 A;  3J81 c;  1PH1 A;  3HOZ G;  5IP9 H;  3CC4 A;  4JI7 Q;  4JI5 L;  3AEV A;  3MXN B;  3T1H Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...