1KRSA

Solution structure of the anticodon binding domain of escherichia coli lysyl-trna synthetase and studies of its interactions with trna-lys
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
110
structure length
110
Chain Sequence
b'FRRDHTSDQLHAEFDGKENEELEALNIEVAVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDDLPEGVYNEQFKKWDLGDILGAKGKLFKTKTGELSIHCTELRLLTKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSYL-TRNA SYNTHETASE (PRODUCT OF LYSS GENE)
publication title Solution structure of the anticodon-binding domain of Escherichia coli lysyl-tRNA synthetase and studies of its interaction with tRNA(Lys).
pubmed doi rcsb
source organism Escherichia coli
molecule tags Aminoacyl-trna synthetase
total genus 14
structure length 110
sequence length 110
ec nomenclature ec 6.1.1.6: Lysine--tRNA ligase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1krsA00
4JI2L 1D8LA 1VQIA 3MEFA 4AQYL 3L2PA 4B3SQ 4POGA 2Y0SE 4JOIC 4YCWA 2I0QA 4AIMA 3L0OA 1TWGH 5M5WH 4DV4L 4DR5Q 2AKWB 1K3RA 3KDFB 4P74A 3IRBA 4DUYL 1XPRA 3CCLA 4A3GH 4H02A 1C7YA 4OONA 1HZCA 1N34L 3M4QA 2HHHL 3HOXH 2UUAQ 2R7ZG 1I50H 1CSPA 3Q8DA 1XPOA 2RHSB 4LFCQ 3FKIH 1VQKA 2BH2A 3F8TA 1VQ6A 1TWCH 3K80C 3GTQH 4IFDG 2K5HA 2KCMA 1GO3E 2VZAA 5J3BA 2VS1A 4JI8L 4HIMA 1NMGA 4B3RL 4QJFA 2RCNA 5LMUL 4DUZQ 1VQPA 4C3HH 1VQGA 3KLWA 4UP7A 1I94Q 3CD6A 1Q12A 1G291 1N33Q 4DNIA 4GN4B 1JMCA 4A4IA 4A3BH 4TQUS 1Y1VH 4R4OA 3HOVH 1WYDA 1K83H 4A3GG 2NVXH 4LF7Q 4IJLA 3AFPA 5JEAJ 3HOXG 3WWVA 3S1NH 3AQQA 4GKJL 4OXPA 2UXCQ 3FKIG 3F2DA 2I5LX 3RZOH 4LUOA 2VQEQ 5IP9H 4X66Q 4ALPA 2EXDA 4HIDA 1A62A 1S40A 4L5RC 4JBWA 3S1RH 3KF8B 4C3JH 1FJGL 4JBJA 1JJCB 4AYBG 5AJ3Q 1BBUA 4JV5Q 1UE6A 4NXNQ 3K7UC 4DR7L 3DM3A 1X56A 3M4OH 1Q46A 1Q1EA 2B29A 1VQ5A 1PH3A 3OTOL 1SLJA 2B3GA 1J6QA 4ME3A 4DV3Q 4A3CH 5FLMH 1XMOL 1GKHA 1N9WA 2Y0SG 3F1ZA 4C3IH 4X62L 4IO9A 2KENA 1OXSC 2MO0A 3ULPA 1HR0Q 5DLQE 1X6OA 5IP9G 2UUCQ 3K8AA 4R1JA 3GTMH 3T1HL 1XNQQ 4JI5L 2N8NA 2KHJA 3KF6A 4JG2A 1LM0A 1VQJA 4QGUA 1XMQQ 2BH8A 2MQHA 1J5EQ 3PIOA 3HOZH 4A93H 4K0KQ 1N32Q 1AH9A 1YJ9A 4A3FH 3ICEA 1UEBA 4GLXA 2ZJQA 4A3DH 4DV1Q 1KC8C 4UY8C 4QL5A 3CP0A 3JAMc 4A76A 1Q81C 3S16H 2AWNA 2KBNA 4OX9L 2Q2IA 4A3JH 1K0RA 4IPDA 1PH5A 1VQAA 3CC4A 4A3CG 1YJWA 2VL6A 5FLMG 1N36L 4LF5Q 4KHPL 5JJKA 4XTCS 4GKKQ 4JI0L 3ERSX 2R92H 2UXDL 1HZAA 4O2DA 1W3SA 1VQHA 4X64L 1E22A 2NN6G 1MJCA 1S3OA 3PCOB 4A93G 3HOZG 4B3ML 1CKNB 2F4VQ 4A3FG 3CCRA 3K0XA 4HJ9A 1YIJA 1D7QA 4X65Q 2OQ0A 2LXJA 1NE3A 1SRUA 3U50C 4A3DG 5IWAQ 4C2MH 1A0IA 1YI2A 2YU9H 1YZ6A 1E1TA 2IX0A 2GVBA 5C3EG 2I5MX 5LMNL 4DV6Q 3UDFA 3H15A 4A3JG 1KD1C 4GOPC 1ASZA 3J80i 4JI2Q 4A3IH 1UE5A 3PIPA 3CCMA 4AQYQ 2XGTA 1PH4A 1IL2A 1XPUA 2QGQA 2PQAA 3I4OA 2VW9A 2HIXA 4LNQA 3H3VI 1OXUA 4O0AA 4DV4Q 1VQMA 4NXML 2KCTA 3E0EA 1EIFA 1X3GA 3EIVA 4DUYQ 1LTLA 1Y1WG 1G51A 1HZ9A 3E9HA 1N34Q 2MFIA 3S2HH 3A0JA 2WB1G 3ULLA 4OO1I 1L1OA 2B63H 2Z6KC 3L7ZC 3PF5A 1EUJA 3UDXA 1Q82C 1HNXL 2OTLA 4JI8Q 4GLVB 4LF4L 4PZ8A 2MO1A 2ZJRA 3UDGA 4B3RQ 5LMUQ 5IY0A 4IOCA 4A3IG 2XTIA 2JE6I 4YY3L 4UPAA 3RLFA 3NBHB 1K73C 3S1QH 5JJLA 1B8AA 5IT9c 4KHZA 1Z47A 2E8GA 2ZTCA 4LFBL 4JBMA 2ZM6L 4GKJQ 2ZJPA 1BBWA 1WJJA 4HJ8A 1C9OA 3NENA 1VQ4A 4DR2L 3KJPA 1S72A 2B63G 4GNXB 1VQBA 1IBLL 3FP9A 3FHWA 3W1GA 1P16A 3HFZB 4PZ6A 2ID0A 1DGSA 4GNXC 2K75A 4JI6L 1IBKQ 4LF8L 3CCSA 2E2JH 5GAEC 2CKZB 4KLKA 1FJGQ 1QUQA 3GTKH 4LUZA 2E5LL 1VQCA 1EOVA 1PH9A 1Z9FA 3I4MH 3SGIA 4DV2Q 1WCMH 1TWFH 1ASYA 1IXRA 1BVSA 2Z6KA 4DR4Q 1GVPA 2LSSA 4YWLA 1VQDA 2NZOA 2BA1A 1XNRL 4LF9L 2JA8H 4A75A 3CW2C 3OTOQ 1FL0A 1EQQA 4GLAC 2K5VA 4APVA 4A3LH 1UE7A 5C44G 3M85A 4BXXH 4MZ9A 1KXLA 2IT1A 1XJVA 1V43A 2ES2A 2EQSA 2V1CC 3GTGH 1Q8KA 4JI5Q 1QVCA 4B3TL 2E2IH 2UUBL 4HJ5A 3PUXA 3W1BA 1GD7A 1QVGA 1N8RC 1V9PA 4JOIA 2VUMG 2AMCB 3KYHC 3S2DH 1Q1BA 4LFAL 3RN2A 3KF6B 3I4MG 1WCMG 1YJNA 3H0GG 4OWWB 2WFWA 2FXQA 3HKZE 4DK3C 1E7ZA 4PZ7A 3CPWA 1WI5A 4L5SA 2JA8G 1EWIA 2YYZA 1VQLA 1HJPA 2CWAA 3MXNB 4PG3A 1VQOA 5C0XI 4J15A 1N36Q 1YHQA 1JB7A 4A3LG 4Y7NH 4BXXG 1LYLA 4KHPQ 3UDIA 3ZJYC 1VCIA 4DV7L 2L15A 3CAMA 2UXDQ 2Q2HA 4BA1I 5FJ8H 5M3MH 2WB1E 4IOAA 3UE0A 3TS2A 5C0XJ 1P8LA 4B3MQ 5M5YH 1FVIA 1X3FA 4JC0A 5GADC 3CPFA 3PV0A 1B7YB 4DR6L 4LWCA 3E9IA 1U5KA 3I2ZA 5GAGC 3OYYA 2ZTEA 3J81i 1B70B 3TEHB 1V1QA 5HGQA 1PH7A 2HQLA 4DR3L 4JBKA 4JCVE 2N78A 4L5QA 4DAMA 3GTOH 5GROA 1MJEA 1CKOA 1SFOH 2EIFA 5FJ8G 3ULJA 5C3EH 1I94L 2Q2UA 3J7A5 3ER0A 1VQNA 3PF4A 5M3MG 4IFDI 3JC66 2E2HH 4HJ7A 1JJGA 1VQ7A 2D0OA 1PYBA 2PQAB 2N49A 3TS0A 3CCQA 2QA4A 3OW2A 2K50A 1Q86C 1O7IA 4R4IA 3RZDH 1HR0W 2DGYA 2UXCL 2CQOA 5IYDH 3J7ZC 2I5HA 4IFDJ 4OWXB 1Y1WH 1K8GA 4LF4Q 3S15H 4R4QA 3UE1A 1L1OB 2K14A 4Y52H 4POFA 3CCUA 1VS0A 2NZHA 4EX5A 4KI0A 4BY1H 2PI2E 4YY3Q 4JV5L 4WJ3M 3HKZG 1NMFA 5IYBH 1VQ9A 4JI4L 3DLLA 4LFBQ 2H5XA 4UP9A 1U0LA 2ZM6Q 3BZKA 4QIWE 4DV0L 5IYCH 4DR2Q 1PHJA 4JI7L 3CXCA 4LF6L 2UXBL 2VNUD 5IYDG 4L5TA 2OWOA 1X65A 3HKSA 2ALYB 4IPHA 3U4ZA 1JJ2A 2RF4A 5GQOA 4JI3L 2HHHQ 2YV5A 4JI6Q 4LF8Q 3CCEA 5JEAG 3PO3H 4BBSH 3EN2A 4BY1G 2E5LQ 1PH2A 1PV4A 4K0KL 1TWHH 2PI2A 1EYGA 1IBML 2R7FA 1KRTA 3T1YL 2NVYH 5IYBG 1QUQB 1MIUA 4UP8A 1HNZL 4LF9Q 1E1OA 2UU9L 1E24A 1NTGA 1YVCA 4XIGS 2VQFL 3CMAA 2AWOA 2IHFA 5IYCG 1W2BA 1I5FA 3I56A 1YEZA 3GD7A 3GTPH 1KL9A 1VQEA 1SE8A 2K5NA 3PUVA 3PSIA 2RHQB 1PH8A 1OTCA 2JQOA 4GOPA 4B3TQ 4QQBX 3TREA 4IPCA 3U4VA 2UUBQ 3PO3G 4BBSG 2YTVA 5C44H 1M1KC 2ATWA 5GAHC 1AE2A 2F3IA 4LFAQ 1SROA 1E3PA 1PYSB 3A5ZB 1GM5A 1CUKA 2F4VL 5JJIA 5BR8L 4DV5L 2R93G 4DR1L 3HOWH 2VUMH 3M7NA 1H95A 4OWTB 1K9MC 3NELA 1C0AA 2IX1A 4DR7Q 2NN6I 1UWVA 3GO5A 3KJOA 1PH1A 4HIOA 3H0GH 4MTNA 3GTJH 4DV7Q 1HZBA 4A3KH 1PFSA 4JYAL 3A5UA 3PUZA 3CC7A 2OQKA 4R4TA 1XMOQ 4X62Q 3RLNA 1IBLQ 2DUDA 1RL2A 3JAMi 4RMFA 3RN5A 4NPSA 1NBWA 3PUYA 3BZCA 2WAQE 5IP7H 3T1HQ 2Z0SA 1YNXA 2CFMA 1OXXK 3G6EA 4DR6Q 3G48A 3HOWG 4JI1L 4FDBA 2K4KA 5C4XH 3J80c 2KHIA 1Y14B 3KFUA 5IE8A 4YCUA 5ELOA 3RLOA 4DR3Q 2JA5H 3S1MH 1RIPA 2NVTH 3RR5A 1T9HA 3H3VH 4YHHL 4DPGA 3F2BA 4A3KG 4GNXA 1HNWL 4OX9Q 2C35B 2CWPA 3F2CA 2NVQH 3CF5A 4A3EH 1A63A 1AE3A 4R4CA 2OCEA 4A3MH 4JI0Q 3KDFA 4B3SL 5IP7G 1CKMA 2LXKA 1KAWA 3BJUA 1UE1A 4X64Q 1SN8A 1K8AC 4DR5L 1VQFA 3W5OA 5C4XG 4GN3B 4QY7A 1PVOA 1X9NA 2GN5A 2JA5G 3S17H 3K7AH 1IBKL 2UUAL 2JEBI 4HJAA 4LFCL 2ASBA 1M90C 5C4JH 5LMNQ 2IHEA 1NJIC 4JI4Q 4DV2L 3I4NH 4DR4L 2PNHA 1TWAH 4A3EG 4A3BG 3HOVG 1Y1VG 5FLXc 5K36G 1EFWA 4A3MG 4DUZL 2JA7H 1NY4A 4OO1G 2Q2TA 4X6AH 2AHOB 1WFQA 1XTDA 2A1AA 2QEXA 5ELNA 4DV0Q 4JI7Q 4LF6Q 4NXMQ 3AEVA 2UXBQ 1N33L 1TXYA 5H1SE 3G4SA 1MKHA 2WP8J 4LUVA 4P71A 4IJHA 2MNAA 5M3FH 1EQRA 4JI3Q 2HIVA 4LF7L 2GVAA 1L2FA 3S14H 1OXTA 4YCVA 4P73A 1YHBA 1I6HH 4MNOA 1HNXQ 2WAQG 1SMXA 1IBMQ 2VQEL 4X66L 3T1YQ 2YTXA 4BA2I 3M3YH 1X55A 3I4NG 1HNZQ 2K52A 1I3QH 3PUWA 5LMNW 3M4PA 5M5XH 1KIXA 2UU9Q 1HH2P 3NEMA 4GS3A 5AJ3L 1X3EA 2VQFQ 2JA7G 1IYJB 2CCZA 4NXNL 3U58A 1WOCA 3CCJA 4DK6C 1L1OC 3G71A 3D0FA 2JEAI 3HOYH 4HIKA 3K81C 5M3FG 1EIYB 4LW1A 3PO2H 2JA6H 1YHAA 2A19A 3GDEA 3KOJA 1KHIA 4DV3L 1JT8A 1R9TH 4PMWA 5HY6A 3TQYA 1PA6A 4GOPB 1HR0L 1QZGA 4TVAB 2UUCL 1JE5A 2ZTDA 3TRZA 1QZHA 5BR8Q 4DV5Q 4BY7H 4DR1Q 1XNQL 1KQSA 2BA0A 3HOUH 3BU2A 1L0WA 4DKAC 1N32L 1CSQA 3STBD 3A74A 3J81j 1XMQL 1J5EL 4WJ4A 2HT1A 1QVFA 1G6PA 2R93H 2F52A 2D0PA 3CMEA 1VQ8A 1XNRQ 4EQ5A 4BBRH 3PGZA 2A8VA 4JYAQ 3CQZH 4DV1L 3HOYG 2JA9A 3CC2A 2R92G 3PO2G 2IY5B 2JA6G 5E7NA 2JJQA 1SR3A 3M9BA 3RNUA 1OXVA 2R7DA 4P72A 4LF5L 1A8VA 4GN5A 5EAYA 1PH6A 2D62A 3LGJA 4GKKL 3J81c 4BY7G 4P75A 2OTJA 2YTYA 1CKNA 3VDYA 2N3SA 2JK8A 4IPGA 4YWKA 3D31A 4JI1Q 3HOUG 3S24A 5C0XG 2VY3A 3GTLH 3CCVA 3AYHB 4AYBE 1Q7YC 3EBEA 1YITA 1FGUA 3B6YA 4DAYB 2R7ZH 4X65L 4YHHQ 1X54A 3STBC 1IZ6A 1BKBA 4BBRG 3I7FA 5IWAL 3I55A 1HNWQ 4YWMA 1KRSA 4NB3A 2PMZE 3AFQA 4RG1A 1YBYA 4DV6L 2R6GA 1LUZA 4AH6A
chains in the Genus database with same CATH superfamily
2IWHA 4CBVA 2XRSD 1PFBA 1CQVA 4YCWA 2I0QA 2SDFA 1TWGH 1GOZA 4DV4L 1K3RA 3EVQA 2XSCA 3IRBA 1HZCA 5C4JB 2HHHL 3FRPB 2UUAQ 2R7ZG 3VA5A 2RHSB 2BH2A 2AQ3B 1TY2A 3K80C 2F0VA 2KCMA 2VZAA 4JI8L 4HIMA 1R4QB 1QB5D 1STGA 4RWSC 1VQPA 1U4MA 2M00A 1EY8A 2Z8LA 1JMCA 4A4IA 4TQUS 3HOVH 2CH4W 4NDXA 4R4OA 1WYDA 3J7AF 3S1NH 4GKJL 4ZKCB 1WTHA 4OXPA 1D5ZC 2EXDA 4HIDA 4L5RC 2NTTA 3KF8B 3GQBA 4JBJA 1OO9B 4AYBG 4C3HG 2A74C 2X6LA 1LLRD 3K7UC 2X69A 4O1NA 1R9TB 4E6IA 2B3GA 4ME3A 5IOCA 4DV3Q 1XMOL 1CA5A 4G7HC 1N9WA 4X62L 3F1ZA 4IO9A 1IBLL 2MO0A 4CJ0B 1IHZA 1XNQQ 1RTNA 4MTKA 4JG2A 1VQJA 1X3PA 4J1MA 4A93H 4BBRB 3C3LA 1UEBA 1K8OA 2K28A 3MXNA 2ZJQA 4DV1Q 1CA6A 1SAPA 3CP0A 3JAMc 2KBNA 2L4NA 1PH5A 1VQAA 2XNAC 1IL8A 4JK1C 1PTOF 3A55A 3BZDB 1S5ED 2UXDL 4O2DA 1JC7A 1VQHA 1TS4A 4X64L 2R7ZB 1E22A 4HCEA 3PCOB 4RCOA 3HOZG 1SNOA 4FP5D 4X65Q 1GUSA 3K57A 4XXEA 1YZ6A 1X32A 4DAPA 2IX0A 5LMNL 2I5MX 4A3JG 3UDFA 5D65A 1YNJD 1JOKA 3J80i 2GA4B 4JI2Q 1JB3A 2OT2A 4A3IH 3PIPA 4AQYQ 3J7YW 1RF2D 2PQAA 3WDNA 3KBXA 1VF5C 1EIFA 3ND9A 3NP8A 1I50B 4DUYQ 3E0JA 2A68C 1N34Q 3S2HH 3A0JA 3GTQB 3MWYW 3ULLA 1L1OA 1A6XA 4FNFA 1SE4A 3PF5A 1HNXL 3GV3A 3KBGA 2MO1A 3ND8A 4AYBB 4C3HB 4B3RQ 5C4HA 2XTIA 2JE6I 4YY3L 3A8KE 3RLFA 2Z4IA 1K73C 2NVXB 3S1QH 1AN8A 5IT9c 2ZM6L 5LL6X 1BBWA 1WJJA 1ZKOA 3S1RB 3FP9A 3FHWA 1ONLA 2ID0A 1PRTB 4JI6L 1IBKQ 1ESFA 1W6JA 4ILWA 1FJGQ 5EKLA 2ZXRA 2E5LL 1SYFA 4ZLTF 1PH9A 2ZXPA 1TWFH 1BVSA 2E75C 2LSSA 5JPMC 5A2QE 2RKSA 2K5WA 4O42A 3D4DA 1XNRL 1CT1D 2F0JA 3CW2C 1LTAD 4A3LH 5C44G 2MHVA 1XJVA 2ES2A 1NR4A 2KHSA 5CV5A 1LTRD 3HOZB 3VA7A 1G91A 1STYA 4K14A 3W1BA 4HJ5A 4DAYA 1QVGA 1N8RC 4JOIA 2VUMG 5I6YA 2PCFB 4I7AA 1WCMG 3S16B 1STNA 3OMGA 3H0GG 4NP5A 4A3JB 1YJNA 4L5SA 4X3UA 2LKVA 4FO2A 2C5CA 1XXGA 1SEBD 2YYZA 1BF4A 2CWAA 3VYTA 5C0XI 2JYOA 1JB7A 3BVZA 1YHQA 4KHPQ 3D6WA 1BXTA 3IAYA 2A6ED 1ESRA 5FJ8H 1AZPA 2EPBA 4FXDA 1JWMD 3TS2A 1B9NA 4QCLA 1HQMC 4C2MB 1X3FA 5CV7A 4B9XA 1B70B 1BNZA 3TEHB 1T5XD 3FVQA 2J4XA 4I65A 3BDCA 5HGQA 3VYSA 1X3QA 1PZID 4JBKA 4JCVE 3ER0A 1VQNA 2EYHA 1GUNA 2QA4A 4R4IA 3RZDH 1JCKB 3J7ZC 1E2WA 4KY6A 4G7ZC 2NZHA 1TT2A 3K0YA 1E2VA 5IYBH 2A73B 3DHQA 1VQ9A 1MSGA 4K6DA 3M7GA 5CYUA 4L63B 4DNRB 4LFBQ 1UNSA 4QIWE 1LABA 4J8QA 4DR2Q 2VNUD 1ILPA 1PRTF 3AB9A 5IYDG 2OWOA 1X65A 2E2JB 1EQVA 4N9TA 3C1EA 2HHHQ 3H09A 3QOLA 3QG1A 1STHA 1WCMB 4RHRA 1EYGA 1JORA 1WVLA 1FYCA 3T1YL 1A15A 2NVYH 1MIUA 4MN3A 4HMJA 4UP8A 3E3XA 1E1OA 1PTOC 1E24A 1I4XA 4C56C 3GTGB 3I56A 3PUVA 1OTCA 1A2TA 1EY7A 2VXWA 4QMGA 1LTBD 4GOPA 2SOBA 1EY9A 4BBSG 3CRLC 1M1KC 2ATWA 2XWJB 2F3IA 1H9KA 1PYSB 5FKAC 1QILA 2PZWA 1EOTA 1WTVA 5BN3A 1H95A 1K9MC 4Y7NB 4CKEA 3NELA 5EPKA 3KJOA 4HIOA 4HCSA 5LL6S 4DV7Q 4A3KH 3I90A 1PFSA 4JYAL 5JVH3 1F2MA 4R4TA 1KNAA 2XWBB 1XMOQ 4X62Q 1EQTA 1IBLQ 1PFMA 4RGNA 2CFMA 3KLSX 2CVRA 3V05A 2K4KA 5C4XH 2KHIA 5C5LA 2JA5H 3TDQA 3RR5A 1T9HA 2A69C 3F2BA 4L8JA 2NVQH 2B2YA 4A3EH 1A63A 5EQ0A 2L0CA 1AE3A 5EKKA 3KDFA 5IP7G 4HSPA 2F0FA 2LXKA 3L9AX 4X64Q 1SN8A 3NQTA 5CV9A 3HG9A 1QOHA 1SYGA 1PVOA 5FO7B 3KLRA 4RKLA 2UUAL 2JEBI 4CKBA 2HQEA 5LMNQ 2IHEA 1NJIC 4IN3A 2KCNA 5I4DA 3HOVG 3OSOA 2RSOA 1NY4A 4OO1G 4X6AH 3VR3A 4ZUIA 4LF6Q 1BDOA 4BBSB 1HA5A 3DEOA 1L0YB 2LY7A 5NUCA 1LTSD 5M3FH 1EQRA 2FINB 1JE4A 1JR0D 4MNOA 5FK9C 4XQJA 1HNXQ 5DM73 3M3YH 3OMCA 3PUWA 3VR5A 5LMNW 3J7AV 3DMUA 4CJ1B 1ENFA 3TZUA 4DAVA 3CRKC 1KTKA 1ENCA 1L1OC 1M4VA 1HTLD 4QIWB 3PO2H 5CMDA 1LT3D 1H9SA 4DV3L 3TQYA 5IGBA 1QZGA 4TVAB 4DA2A 2O5IC 2ZTDA 3GTKB 1ZYRD 1QZHA 4BY7H 1TU2B 1XNQL 4DK0A 2BA0A 3HOUH 5HGTA 4DKAC 3J81j 3A8JE 4WJ4A 1BO0A 1SNQA 4K8JA 1XNRQ 3A56A 4IALA 3CQZH 4DV1L 2F03A 2K33A 3HOYG 2EYLA 4KTAA 2R7DA 2NYZD 4GN5A 1I4GA 5A35A 4NW2A 3IL8A 1CM9A 2KQ3A 3U9OA 4ULLA 3R2IA 3AYHB 4S3SA 1Q7YC 1YITA 2BDNA 2V4DA 4X65L 1NR2A 4YHHQ 1HNWQ 1WD0A 1SNPA 5I2XA 2PMZE 3AFQA 4RG1A 2VB3X 4JI2L 1PRTC 1VQIA 2NTSA 4AQYL 4POGA 4KY7A 4JOIC 2EJFC 4AIMA 3L0OA 1EWCA 1CQFA 2R3ZA 1WTQA 4DR5Q 3S17B 2AKWB 4DUYL 1XPRA 4H02A 4OONA 1N34L 1XPOA 3Q8DA 3R93A 1S5CD 2VS1A 1SFOB 2MGSA 4B3RL 3NBHA 1SE2A 1O7LA 4LK1C 4UP7A 5KRUA 1G291 3QJYA 2MJ8A 3I73A 4DXGA 4A3GG 1I6HB 5D14A 5JJZA 3HOXG 4IQZA 3WWVA 3FKIG 1V1PA 2WV6D 3RZOH 5M5XB 1S40A 1S5FD 4NMZA 4ME5A 4Q0FA 1I4QA 4C3JH 1FJGL 1JJCB 2EZVA 5AJ3Q 1BBUA 1UE6A 5C5MA 3HOYB 1ZEQX 3M4OH 1Q46A 1Q1EA 4FF3A 4K5VA 2B29A 1Y8OB 1PH3A 1TS5A 1SLJA 1FR3A 1J6QA 4A3CH 4CJ2C 3IKJA 4C3IH 3LWEA 5M9OA 2UUCQ 5IP9G 4DK1A 2BDOA 2Z1CA 3GTMH 3CHBD 2HDLA 2R93B 5ELDA 4QGUA 2MQHA 1J5EQ 3J80L 3PIOA 1AH9A 1YJ9A 4A3FH 4GLXA 3TP5A 4A3DH 1XYIA 2B2UC 4UY8C 2F0GA 2AWNA 4DGZA 4OX9L 2Q2IA 5FLMG 5C6AA 5JPNC 4KHPL 1CZGA 3OPOA 1DOKA 1GXDC 4JI0L 3ERSX 2R92H 1HZAA 2ICEC 2KOLA 4BS9A 2NN6G 1MJCA 1CKNB 3GV6A 3CCRA 1YIJA 3U50C 1GHKA 1NE3A 2K01A 4MIUA 5IWAQ 2HD3A 5LHY1 2YU9H 2NBFA 2CW0D 2GVBA 2EJMA 3H15A 1A3UA 1BR9A 4GOPC 3VYRA 3RMHA 1UE5A 1IL2A 5E1FA 2K1BA 3H3VI 4A3GB 4LNQA 1QE6A 1OXUA 1QNKA 1VQMA 1AEXA 2KCTA 3E0EA 1X3GA 3PMFA 2FFKB 3HOXB 2MPMA 3FKIB 1TWCB 2MFIA 3P1HA 1PTOB 4OO1I 1KAAA 4XDXA 3BS1A 1TIID 2OTLA 3UDXA 5KIXA 2B39A 3I3CA 2AUKA 4M1UB 2ZJRA 3UDGA 3D3RA 1ILQA 4X3SA 2PZTA 5AFWA 5LMUQ 4IOCA 3G7LA 4A3BB 1Y1VB 1YNJC 3J80E 1K83B 2PMZB 1SJHD 4CDEC 2C9OA 1EY4A 4LFBL 4JBMA 1U4PA 1ICFB 3NSWA 1F2ZA 1C9OA 1VQ4A 4DR2L 3BG3A 2B63G 5L37A 4PZ6A 1DGSA 1RHPA 3GTKH 2B2YC 1QUQA 2DJFC 4LUZA 2IW3A 1UUPA 1VQCA 5KEEA 1EOVA 4DN4M 1Z9FA 3I4MH 3SGIA 1ASYA 2SNMA 1IXRA 2Z6KA 1NCVA 4YWLA 1Z6HA 5CV4A 3QOJA 4GLAC 2K5VA 4APVA 2ICIA 1UE7A 4BXXH 1MBYA 1EYAA 4FXGC 1KXLA 2IL8A 2RSNA 1Y69U 2V1CC 3MFYA 2E2IH 5ISRA 5CBAE 3P75A 3W2DA 2AMCB 3KYHC 3V96A 3S2DH 1Q1BA 1D5XC 5DNFA 2FXQA 4DK3C 1E7ZA 4PZ7A 2JA8G 5T1IA 5DM63 1VQLA 1HJPA 4KKSA 1K8MA 3MXNB 3SXHA 5CC4A 1BOSA 1VCIA 2MUYA 4DV7L 3CAMA 2Q2HA 1EIHA 4R8NA 5M3MH 2EY5A 2MP1A 2RDHA 4HR7B 3VR6A 3UE0A 4HMIA 4X3KA 1P8LA 4B3MQ 5M5YH 1FVIA 4JC0A 4H0LC 3OWEB 1B7YB 3NWSA 3PV0A 3E9IA 4LWCA 1Q8IA 3J81i 1WD1A 1PH7A 3OW7A 4IUQA 4F8MA 2KVMA 1CKOA 1SFOH 1HXYD 5C3EH 3J7A5 1JJGA 4HJ7A 3DUZA 2A6EC 2PQAB 2B63B 2KEEA 3OW2A 1U9RA 3H91A 1JWSD 1II3A 2I5HA 4IFDJ 1Y1WH 4LF4Q 3S15H 3UE1A 1L1OB 2K14A 3TZDA 3NTHA 5JEAH 3CCUA 4EX5A 4BY1H 1JWUD 2PZUA 4WJ3M 1HUMA 4WRDA 1NMFA 2F0UA 4KV6A 1IKLA 1U0LA 2F0KA 2F0QA 3G6JB 3MXUA 3K5MA 1J9OA 3H94A 1PHJA 4LF6L 4L5TA 4OL7A 4B9WA 3H6MA 4IPHA 5IGDA 1JOQA 1DJRD 2O4XA 2RDFA 3BYYB 4EGVA 2J0TD 4KKTA 3EJIA 3CCEA 2B2TA 1PH2A 1TWHH 2PI2A 2JA8B 3F2UA 4ZUJA 1KRTA 4LF9Q 1BCPD 4MHEA 1T5EA 4EQNA 1LT5D 1YVCA 4XIGS 2IHFA 2PQEA 5IYCG 3H3VC 1RODA 3GD7A 1FNUA 3GTPH 2K5NA 1PH8A 1NSNS 2JQOA 4HN7A 4QQBX 3U4VA 2F0SA 3PO3G 1GHJA 3IFTA 5GAHC 1AE2A 1Y8NB 5FOBB 3A5ZB 1E3PA 1PXUA 1GM5A 2ENBA 2N55A 2PO4A 5JJIA 1XX8A 3HOWH 3URYA 4OWTB 1C0AA 2IX1A 2NN6I 2KCCA 1PLFA 3X3NA 2PW7A 3A5UA 3FPPA 1ZXTA 2OQKA 3CC7A 2O5JC 4ZK9B 3Q23A 2G9DA 3RN5A 2WAQE 5KNDA 2M2LA 3G6EA 4U673 2RVLA 3J80c 1DZ1A 5IIFA 4C1NI 3GTOB 3KFUA 1STBA 4QB4A 5IE8A 5ELOA 3RLOA 3Q6SA 4DR3Q 1STEA 2NVTH 3HRZC 4YHHL 4DPGA 2L11A 2E2HB 4GNXA 2KJXA 1HNWL 4OX9Q 2C35B 2CWPA 1EZ8A 2WKDA 2OCEA 4A3MH 4JI0Q 1DOLA 2Z9HA 1CKMA 3AU7A 1PMRA 2B2WA 1KAWA 3BJUA 2EDGA 3KUPA 4DR5L 2PNRC 1SYCA 5I9OA 4QY7A 4PMCA 1SNMA 1XTCD 3KK7A 3LNNA 3WOFA 4HJAA 4R8IA 5C4JH 4KN7C 3EQLC 3SK4A 4JI4Q 4DR4L 3FDTA 2WACA 5K36G 3FMCA 2F0PA 4L6TB 1SNDA 4DV0Q 1WFQA 1F9QA 3HEJA 1B53A 3QR8A 1ET9A 1TXYA 3PO3B 4LUVA 2WP8J 4P71A 3T4AC 1HQRD 2EY6A 1EEFD 3HS0C 1YHBA 4K5WA 2WAQG 1SMXA 2E74C 3MAQA 2QF7A 4CGYB 1X55A 3I4NG 1M8AA 1HNZQ 4LJZC 4XYQA 2UU9Q 1KIXA 1HH2P 4PMBA 5AJ3L 4YIJA 2JA7G 1IYJB 2CCZA 3U58A 3DWAA 2P5ZX 4DK6C 5C44B 1E0BA 4JW0A 4KK7A 4LW1A 2A19A 2E76C 3GDEA 3FEWX 3ITPA 1KHIA 3KOJA 1JT8A 2M9VA 1R9TH 1VMCA 4PMWA 1PA6A 4GOPB 2VUMB 2UUCL 1XWEA 1QJOA 5BR8Q 4DV5Q 3O13A 4EQPA 4DR1Q 2EYJA 1KQSA 1H9JA 3H0GB 3STBD 5C0XH 1J5EL 3GTJB 2HT1A 4V190 1QVFA 1G6PA 3C1FA 2D0PA 3T51B 4OHJA 4EQ5A 4BBRH 1R4PB 3E6ZX 5FLXL 3DWQA 2JA9A 3SE0A 2R92G 2JA6G 1GUGA 4P72A 2Z4HA 1G8ZD 4DF7A 1SMYD 1EFID 2YTYA 5HURA 1ICWA 2VB2X 4JI1Q 2BE5D 3S1MB 1ZYRC 3A8IE 3S24A 1KDBA 1FGUA 3WOEA 2R7ZH 1GUWA 3I7FA 5IWAL 2K32A 1WTPA 4YWMA 4KY5A 3T56B 4PV1C 1YBYA 4RHSA 5CV8A 1LUZA 1E2ZA 4AH6A 1D8LA 4I7ZC 3TMEA 4B3SQ 3PQIA 2F0WA 4JPBW 3KDFB 3K7AB 3CCLA 1BUVT 3ZYYX 1C7YA 2WAQB 2K5QA 3M4QA 4H13C 1I50H 2KEDA 1VQ6A 3EROA 3F8TA 3I4NB 4FXKC 1TWAB 5F2DA 3GTQH 4IFDG 2F4IA 2RA4A 1GO3E 2JA7B 2PW5A 2O2LD 4QJFA 5LMUL 4KMUC 1TQOA 4DUZQ 4C3HH 2DJGC 1VQGA 3KLWA 4UAIA 2QKIC 4XQQA 5IGCA 1LT4D 4GN4B 4RGMA 1IW7D 3S14B 4N9PA 4CDCC 2NVXH 2R61A 4IJLA 3AFPA 2OXPA 1I4PA 3AQQA 4H7BA 4GZYC 2QDBA 1GUTA 4K2LA 5BN4A 4OEMB 3F2DA 4ALPA 4X66Q 3TP8A 3VYUA 3MC0B 2NZ1D 3S1RH 4WORA 5IGGA 4DR7L 2K6AA 1PYWD 2XRQD 1QCBD 4DFAA 1HFGA 4BWGB 1YNND 1HA6A 3T53B 1HTPA 2WKCA 2Q8TA 1GKHA 1HR0Q 3NTIA 3ULPA 2KENA 1OXSC 1EY0A 1X6OA 1IKMA 3K8AA 5J39A 1H9SB 2N8NA 3KF6A 4IURA 1LM0A 2BH8A 3P7JA 3HOZH 3U9SA 3ICEA 2BCOA 1HRJA 1EL0A 1KC8C 4QL5A 1TVXA 3S16H 1K0SA 4A3JH 4IPDA 4X3TA 2VL6A 5JJKA 1F2LA 2B2TC 5EJWA 1EU4A 5DAUA 3GTLB 1W3SA 1VDZA 3VR2A 4A93G 4B3ML 2JXMB 3K0XA 3MXGA 5I6WA 1D7QA 2OQ0A 1SRUA 4C2MH 1A0IA 1F9RA 1KDCA 4PQXA 2H4OA 3Q24A 1YI2A 5C3EG 3DXJC 1ASZA 1KD1C 5C4ZA 1TWGB 3CCMA 1PH4A 2XGTA 1XPUA 1BCPF 4LAAA 5FO9B 1SSOA 4O0AA 4HEDA 3A7LA 3EIVA 5EBDA 1Y1WG 3E9HA 5I9PA 4NKLA 2A5HA 2WB1G 1TY0A 1FD7D 4OELB 3S9WA 3R3OA 3L7ZC 1EUJA 3E5SA 1Q82C 2JP1A 4GLVB 1EU3A 1U4LA 2F0HA 4LF4L 4RKBA 5KNBA 4FF4A 4P2CB 4A3IG 2CW0C 5D3DA 3HOVB 4LMQD 5JAVA 3NBHB 3RUZA 4KHZA 5TSSA 1Z47A 2E8GA 2ZTCA 3ERQA 1DD2A 4HJ8A 3NENA 3KJPA 1FNWA 1EY6A 3W1GA 1P16A 2XN9C 4GNXC 3L3OC 2K75A 1F9SA 4KJOA 2E2JH 4H44C 1Q3LA 1V1PB 2CKZB 5GAEC 1B3QA 4UHVA 1WCMH 4DR4Q 2HUGA 1VQDA 2NZOA 3SK5A 3P20A 4LF9L 4A75A 4ODGA 3OTOQ 1CZWA 1RCVD 3NWTA 4MZ9A 2HCCA 3GTGH 2DY7A 4JI5Q 4A93B 1QVCA 3J81L 5DEHA 1GJXA 3PUXA 1GD7A 1V9PA 1I3QB 3BYTB 1O7YA 1DCZA 1W6KA 4OWWB 2F1MA 1WI5A 4FVMA 4U68A 2PYKA 1VQOA 1N36Q 4A3LG 4Y7NH 1LYLA 1MGSA 3NQIA 2JSOA 2NUCA 2H1EA 2G5DA 3W3AA 3CPFA 2B2VA 2AUJD 3I2ZA 2ZTEA 2EOTA 4ZKBB 4A3IB 3FPUB 1V1QA 1AFPA 2HQLA 2IJ0A 3BVGA 3CKIB 3MA2B 3K5LA 2N88A 4DR3L 1SYDA 2N78A 4L5QA 1KNEA 3PIP3 4DAMA 1B44D 5FJ8G 2Q2UA 3ULJA 1I94L 3PF4A 3S2HB 4IFDI 1NNXA 3JC66 2A6HD 2D0OA 1PYBA 4G57A 3TS0A 1Q86C 2I46A 2UXCL 5IYDH 3DEPA 5ELBA 1QG7A 3NUCA 4R4QA 4Y52H 3J81E 1VS0A 4OIJA 1SNCA 4KI0A 4RFBA 2PI2E 3S1QB 1A2UA 1SJED 2TSSA 1B3AA 4JV5L 4WFN3 2Q8RE 4JI4L 3OOCA 5M5WB 2EYOA 3I91A 2Q8IB 4UP9A 1EYDA 4DV0L 4ZQ3A 5CBEE 3CXCA 4KN4C 1MD2D 2ALYB 3M4YA 2RF4A 5GQOA 4LF8Q 1K3BC 4BBSH 2F0MA 3SK6A 1TWFB 1F77A 3T13A 1Y8PB 2LMCB 1PV4A 1BBXC 4K0KL 3NE5B 2R7FA 4DNTB 5IYBG 4K8IA 1QUQB 2L1BA 2QEJC 1HNZL 2UU9L 1NTGA 5C3WA 3MVVA 2AWOA 5ELEA 3X3MA 1W2BA 1WTOA 2F0DA 5E4WC 1KL9A 3PSIA 5JOBA 4B3TQ 2UUBQ 4IPCA 2YTVA 1ENAA 4LFAQ 1CUKA 2F4VL 5BR8L 4DV5L 1FGBD 2AQ1B 4DR1L 3HZXA 2D9UA 4DR7Q 5J22A 1BCPC 1D1IA 1PH1A 5IGEA 4MTNA 4RA8A 2X6GA 2DUDA 1RL2A 3LX0A 4K2KA 3JAMi 4RMFA 4NPSA 1JQYD 3BZCA 3ONAB 5IP7H 2Z0SA 4DR6Q 2DNCA 3GP7A 4QF4A 4JI1L 1B9MA 1SBBB 1CFMA 1Y14B 5KYIA 3K58A 4XT3B 1RIPA 3H3VH 4A3KG 4CDFC 3K5NA 1SXTA 3BVMA 2F0OA 3RZDB 3I70A 3D6CA 1DM0B 4QUCA 1SYEA 4B3SL 4OO1H 5D3IB 1UE1A 1VQFA 3W5OA 2EYMA 5C4XG 3TN2A 3SR1A 2WINB 1PZKD 3D4RA 2JA5G 3S17H 2ASBA 1M90C 1KLGD 1HCZA 2SNSA 4DV2L 3I4LA 3DWPA 2L12A 2PNHA 4A3EG 3OHXC 4DUZL 3QIAA 5EPLA 5JVG3 2Q2TA 2A1AA 4CKCA 4JI7Q 2UXBQ 5I2YA 5H1SE 3G4SA 1AW7A 1JICA 1S5DD 2AQ2B 4JI3Q 2HIVA 3K6OA 1L2FA 2NVYB 2Z6BA 4P73A 3KF8A 1I6HH 1IBMQ 3SEBA 4X66L 3K5OA 2YTXA 4BA2I 5G3LD 2K52A 1I3QH 2ZXOA 4KHVA 5M5XH 3Q22A 1DONA 1IYVA 1SDFA 2VQFQ 1X3EA 1I4RA 5IODA 1WOCA 1V1OA 2FMCA 3G71A 4J6HA 2EYPA 4RGTA 3HOYH 3K81C 5M3FG 4IUNA 4IUUA 4RH6A 5HY6A 1HR0L 1RDPD 2SEBD 5A2QL 4UDUC 2B8FA 1L0WA 3Q0AA 2NB0A 1CSQA 2L5TA 4PNYA 4A3KB 2LS01 3KLSA 1B2TA 1VF7A 2R93H 2F52A 1VQ8A 5E4XA 2RQXA 3PGZA 3LWUA 1QWYA 3PO2G 5CV6A 2IY5B 4DXFA 5E7NA 2JJQA 3HP3A 5EBCA 3C2PA 1A8VA 1PH6A 1KABA 2D62A 5CGKA 5C4XB 3TP7A 3J81c 2EE1A 4OGQC 4P75A 4BY7G 3DM1A 3VDYA 2N3SA 4IPGA 3HOUG 2JA5B 1HUNA 1VMPA 1DXMA 1BQQT 4DAYB 2NVQB 3STBC 3D4WA 1IZ6A 4A3EB 2DN8A 1EEID 2LFNA 1WTXA 2R6GA 4GNXB 3MEFA 3L2PA 3MHBA 2Y0SE 3TBIB 5M5WH 2QILA 4QUFA 4P74A 1SMYC 4A3GH 2EVBA 3HOXH 2BE5C 1CSPA 1EY5A 1EZ6A 4LFCQ 1DYQA 3FKIH 3IFDA 3D8GA 1TR5A 4K5XA 1VQKA 1TWCH 1PTOH 2K5HA 5CORA 5J3BA 4XT1B 1NMGA 3QB3A 2RCNA 1C4QA 1WTRA 1I94Q 4IUPA 3CD6A 1Q12A 5M3FB 1N33Q 4DNIA 2B2VC 1S4ZA 4A3BH 1Y1VH 1EYCA 1K83H 4WJWA 4TKOB 4LF7Q 1ML0D 5JEAJ 2UXCQ 2HDMA 3M3YB 2KUMA 2I5LX 1TKWB 4LUOA 5IP9H 2VQEQ 4OIKA 1A62A 3CU7A 3V2TA 4JBWA 4RGOS 4Z9CB 4JV5Q 2JN4A 4NXNQ 3DM3A 1X56A 3PO2B 1ET6A 1VQ5A 3OTOL 4XQNA 4M8AA 1IW7C 2CHBD 4BY7B 5FLMH 1PFNA 2Y0SG 3HOUB 2FHTA 5DLQE 4R1JA 3T1HL 3EFXD 4JI5L 2KHJA 3NXWA 3UI2A 1CHPD 4C3JG 2NN6H 4K0KQ 1XMQQ 1N32Q 3CQZB 1B50A 4A76A 1Q81C 1K0RA 4N8X1 4ZCKA 3CC4A 4A3CG 1YJWA 1N36L 1D1KA 4LF5Q 1YNNC 4C3IG 4XTCS 4CHTB 4GKKQ 3TSSA 1IYUA 2A68D 4F88A 1AZQA 1EWHA 4XYOA 3MTSA 1I4HA 1S3OA 2F4VQ 4A3FG 4HJ9A 3TP6A 1RKNA 2LXJA 4A3DG 1STAA 1HFNA 1E1TA 3MEHA 4F87A 4DV6Q 5J1ZA 2QCPX 4IZ8A 1H9RA 4N8FA 2K05A 2QGQA 3I4OA 2VW9A 2HIXA 4DV4Q 2B2UA 4NXML 2IX3A 1LTLA 2K5DA 1G51A 1HZ9A 3NK9A 2B63H 1TS3A 2Z6KC 3BDLA 4JI8Q 4PZ8A 5IY0A 1D6EC 4UPAA 2HCIA 4F7XA 2BOSA 4FF1A 3I8ZA 5JJLA 1B8AA 4TRDA 2I07B 2Y0SB 2QDLA 4TSSA 3QWNA 2ZJPA 4GKJQ 3RZOB 1QNUA 4FF2A 1S72A 3NTKA 1VQBA 1BCPB 3R8BA 4C3JB 3HFZB 4DU9A 4ABNA 5KGUA 4LF8L 3N52A 3CCSA 5BN5A 1F9PA 4KLKA 3RD4A 3M4OB 4KKUA 1RJTA 1CI3M 4DV2Q 3OWFA 1GVPA 1SYBA 2E2DC 2BA1A 4IUTA 2JA8H 4CDDC 4C3IB 1FL0A 1EQQA 1LT6D 2FMMA 1D5MC 3GTMB 1FNVA 3M85A 2EY2A 4ZYSA 2IT1A 1V43A 2EQSA 5FLXE 1Q8KA 4B3TL 5EGTA 2UUBL 4A3FB 5E3FA 1DOMA 2DNEA 3QO2A 3PIO3 4C1NK 4A3DB 5KNCA 4LFAL 3RN2A 3KF6B 3I4MG 1D2BA 2WFWA 3HKZE 3CPWA 2IPKD 1EWIA 3SVMA 2F0IA 1UAPA 1RD9D 4PG3A 2R92B 4J15A 2D2CC 2K7VA 3VR4A 2JA6B 4BXXG 3UDIA 3NBIA 3ZJYC 4JVZA 2L15A 2UXDQ 4BA1I 1UEAB 2RBMA 2WB1E 4KD3A 4IOAA 5C0XJ 5T1GA 5GADC 2YU9B 1NAPA 1LV9A 3MZ5A 4DR6L 1U5KA 5GAGC 1WTWA 3OYYA 1LACA 3N6RA 2K03A 1LTGD 2B8GA 3GTOH 5G3LF 5GROA 1G2TA 1MJEA 1B4OA 2RCFA 2EIFA 1TS2A 5M3MG 2E2HH 2F0TA 1VQ7A 2TMPA 3A7AB 2N49A 3CCQA 2K50A 2DY8A 1HR0W 1O7IA 2XVSA 2DGYA 4EVOA 2CQOA 1JOOA 4OWXB 1K8GA 5KYLA 2F0NA 4POFA 1G2SA 1Z7TA 3R2TA 4YY3Q 5EKIA 1PTOD 3HKZG 3DLLA 2F3VA 2H5XA 3BDOA 2ZM6Q 1C8CA 3BZKA 1G6ZA 2A6HC 2K04A 5IYCH 4JI7L 2UXBL 3HKSA 4K6LA 3U4ZA 2OF1A 1JJ2A 4JI6Q 4JI3L 2YV5A 5JEAG 3PO3H 4HSVA 3I4MB 3EN2A 4BY1G 2E5LQ 4KJNA 1IBML 2G9HD 3NPPA 3CMAA 2VQFL 3JAML 1LO5D 1I5FA 3K59A 2J7ZA 1YEZA 3S1NB 2E2IB 1A3TA 1VQEA 1SE8A 2EY1A 2RHQB 4KD4A 3TREA 3S2DB 1KDAA 5IGFA 5C44H 1U4RA 1SROA 2KA7A 2CQAA 1HPCA 3A54A 3SK8A 2R93G 2VUMH 3M7NA 5COYA 3T16A 2L9HA 2A69D 1UWVA 3GO5A 4ZRZA 3I72A 3H0GH 4V0BA 2B2WC 5M3MB 1HZBA 3GTJH 3PUZA 1LTID 5FO8B 5M5YB 3MXPA 3RLNA 3OIPA 1NBWA 3PUYA 3T1HQ 1YNXA 1OXXK 3G48A 3HOWG 4FDBA 2F0EA 1K28A 4EQOA 4YCUA 2EJGC 3S1MH 5C3EB 3HKZB 4G7OC 2L55A 1MSHA 3F2CA 3CF5A 3HGBA 4R4CA 5K36H 5IT9L 1CTMA 2QW7A 1Y1WB 3S15B 3AMUA 3JAME 5K5PA 2WB1B 2D5DA 1K8AC 4FYDA 4GN3B 4BY1B 1AP0A 3OIQA 1X9NA 1PZJD 2GN5A 1RTOA 4G4KA 3K7AH 1IBKL 4LFCL 3SHLA 2EYFA 3NHHA 1V8QA 3I4NH 1TWAH 4HAEA 4A3BG 1Y1VG 4RCNA 5FLXc 1GUOA 1EFWA 4HTHA 4A3MG 1HHVA 2JA7H 2AHOB 1XTDA 2QEXA 5ELNA 3AEVA 4NXMQ 1N33L 1PDQA 1MKHA 2NWGA 4IJHA 1S5BD 2MNAA 1TWHB 1F2YA 4LF7L 2GVAA 3S14H 1OXTA 3C46A 5EPJA 4YCVA 2WIIB 1MHWC 2VQEL 3T1YQ 3M4PA 3NEMA 1MI2A 4GS3A 3GTPB 1SE3A 1O80A 4NXNL 4RAUC 5ELCA 3CCJA 3D0FA 1EIGA 2JEAI 4HIKA 1EIYB 2OEOA 1YHAA 4ID6A 2JA6H 1Q90A 5C3XA 5CR3A 1O78A 2EXZA 3HOWB 3TRZA 5IT9E 1JE5A 3SDZA 4B08A 3BU2A 2F0LA 2RDGA 2ZT9C 1N32L 1XMQL 3A74A 4IUVA 1NUCA 2KECA 3CMEA 4R9WA 2A8VA 4JYAQ 1J8IA 1L0XB 1PRTD 3CC2A 2XIWA 1SR3A 3M9BA 3RNUA 1OXVA 4LF5L 5EAYA 1I6VC 3LGJA 4GKKL 2OTJA 3MFGA 4ZAIA 1CKNA 5ELFA 1KLUD 2JK8A 4YWKA 2CH4A 3D31A 1CHQD 1O7ZA 2NVTB 5C0XG 2VY3A 3GTLH 3CCVA 4AYBE 3EBEA 1A3VA 3B6YA 1C48A 4Q5VA 1LTTD 1X54A 1BKBA 4BBRG 3I55A 1H9MA 4IFDH 1KRSA 3EA6A 4A3MB 2F3WA 4NB3A 1B1ZA 4DV6L 2PPBC 2FJ2A 1CK1A
chains in the Genus database with same CATH topology
4JI2L 1D8LA 1VQIA 3MEFA 4AQYL 3L2PA 4B3SQ 4POGA 2Y0SE 4JOIC 4YCWA 2I0QA 4AIMA 3L0OA 1TWGH 5M5WH 4DV4L 4DR5Q 2AKWB 1K3RA 3KDFB 4P74A 3IRBA 4DUYL 1XPRA 3CCLA 4A3GH 4H02A 1C7YA 4OONA 1HZCA 1N34L 3M4QA 2HHHL 3HOXH 2UUAQ 2R7ZG 1I50H 1CSPA 3Q8DA 1XPOA 2RHSB 4LFCQ 3FKIH 1VQKA 2BH2A 3F8TA 1VQ6A 1TWCH 3K80C 3GTQH 4IFDG 2K5HA 2KCMA 1GO3E 2VZAA 5J3BA 2VS1A 4JI8L 4HIMA 1NMGA 4B3RL 4QJFA 2RCNA 5LMUL 4DUZQ 1VQPA 4C3HH 1VQGA 3KLWA 4UP7A 1I94Q 3CD6A 1Q12A 1G291 1N33Q 4DNIA 4GN4B 1JMCA 4A4IA 4A3BH 4TQUS 1Y1VH 4R4OA 3HOVH 1WYDA 1K83H 4A3GG 2NVXH 4LF7Q 4IJLA 3AFPA 5JEAJ 3HOXG 3WWVA 3S1NH 3AQQA 4GKJL 4OXPA 2UXCQ 3FKIG 3F2DA 2I5LX 3RZOH 4LUOA 2VQEQ 5IP9H 4X66Q 4ALPA 2EXDA 4HIDA 1A62A 1S40A 4L5RC 4JBWA 3S1RH 3KF8B 4C3JH 1FJGL 4JBJA 1JJCB 4AYBG 5AJ3Q 1BBUA 4JV5Q 1UE6A 4NXNQ 3K7UC 4DR7L 3DM3A 1X56A 3M4OH 1Q46A 1Q1EA 2B29A 1VQ5A 1PH3A 3OTOL 1SLJA 2B3GA 1J6QA 4ME3A 4DV3Q 4A3CH 5FLMH 1XMOL 1GKHA 1N9WA 2Y0SG 3F1ZA 4C3IH 4X62L 4IO9A 2KENA 1OXSC 2MO0A 3ULPA 1HR0Q 5DLQE 1X6OA 5IP9G 2UUCQ 3K8AA 4R1JA 3GTMH 3T1HL 1XNQQ 4JI5L 2N8NA 2KHJA 3KF6A 4JG2A 1LM0A 1VQJA 4QGUA 1XMQQ 2BH8A 2MQHA 1J5EQ 3PIOA 3HOZH 4A93H 4K0KQ 1N32Q 1AH9A 1YJ9A 4A3FH 3ICEA 1UEBA 4GLXA 2ZJQA 4A3DH 4DV1Q 1KC8C 4UY8C 4QL5A 3CP0A 3JAMc 4A76A 1Q81C 3S16H 2AWNA 2KBNA 4OX9L 2Q2IA 4A3JH 1K0RA 4IPDA 1PH5A 1VQAA 3CC4A 4A3CG 1YJWA 2VL6A 5FLMG 1N36L 4LF5Q 4KHPL 5JJKA 4XTCS 4GKKQ 4JI0L 3ERSX 2R92H 2UXDL 1HZAA 4O2DA 1W3SA 1VQHA 4X64L 1E22A 2NN6G 1MJCA 1S3OA 3PCOB 4A93G 3HOZG 4B3ML 1CKNB 2F4VQ 4A3FG 3CCRA 3K0XA 4HJ9A 1YIJA 1D7QA 4X65Q 2OQ0A 2LXJA 1NE3A 1SRUA 3U50C 4A3DG 5IWAQ 4C2MH 1A0IA 1YI2A 2YU9H 1YZ6A 1E1TA 2IX0A 2GVBA 5C3EG 2I5MX 5LMNL 4DV6Q 3UDFA 3H15A 4A3JG 1KD1C 4GOPC 1ASZA 3J80i 4JI2Q 4A3IH 1UE5A 3PIPA 3CCMA 4AQYQ 2XGTA 1PH4A 1IL2A 1XPUA 2QGQA 2PQAA 3I4OA 2VW9A 2HIXA 4LNQA 3H3VI 1OXUA 4O0AA 4DV4Q 1VQMA 4NXML 2KCTA 3E0EA 1EIFA 1X3GA 3EIVA 4DUYQ 1LTLA 1Y1WG 1G51A 1HZ9A 3E9HA 1N34Q 2MFIA 3S2HH 3A0JA 2WB1G 3ULLA 4OO1I 1L1OA 2B63H 2Z6KC 3L7ZC 3PF5A 1EUJA 3UDXA 1Q82C 1HNXL 2OTLA 4JI8Q 4GLVB 4LF4L 4PZ8A 2MO1A 2ZJRA 3UDGA 4B3RQ 5LMUQ 5IY0A 4IOCA 4A3IG 2XTIA 2JE6I 4YY3L 4UPAA 3RLFA 3NBHB 1K73C 3S1QH 5JJLA 1B8AA 5IT9c 4KHZA 1Z47A 2E8GA 2ZTCA 4LFBL 4JBMA 2ZM6L 4GKJQ 2ZJPA 1BBWA 1WJJA 4HJ8A 1C9OA 3NENA 1VQ4A 4DR2L 3KJPA 1S72A 2B63G 4GNXB 1VQBA 1IBLL 3FP9A 3FHWA 3W1GA 1P16A 3HFZB 4PZ6A 2ID0A 1DGSA 4GNXC 2K75A 4JI6L 1IBKQ 4LF8L 3CCSA 2E2JH 5GAEC 2CKZB 4KLKA 1FJGQ 1QUQA 3GTKH 4LUZA 2E5LL 1VQCA 1EOVA 1PH9A 1Z9FA 3I4MH 3SGIA 4DV2Q 1WCMH 1TWFH 1ASYA 1IXRA 1BVSA 2Z6KA 4DR4Q 1GVPA 2LSSA 4YWLA 1VQDA 2NZOA 2BA1A 1XNRL 4LF9L 2JA8H 4A75A 3CW2C 3OTOQ 1FL0A 1EQQA 4GLAC 2K5VA 4APVA 4A3LH 1UE7A 5C44G 3M85A 4BXXH 4MZ9A 1KXLA 2IT1A 1XJVA 1V43A 2ES2A 2EQSA 2V1CC 3GTGH 1Q8KA 4JI5Q 1QVCA 4B3TL 2E2IH 2UUBL 4HJ5A 3PUXA 3W1BA 1GD7A 1QVGA 1N8RC 1V9PA 4JOIA 2VUMG 2AMCB 3KYHC 3S2DH 1Q1BA 4LFAL 3RN2A 3KF6B 3I4MG 1WCMG 1YJNA 3H0GG 4OWWB 2WFWA 2FXQA 3HKZE 4DK3C 1E7ZA 4PZ7A 3CPWA 1WI5A 4L5SA 2JA8G 1EWIA 2YYZA 1VQLA 1HJPA 2CWAA 3MXNB 4PG3A 1VQOA 5C0XI 4J15A 1N36Q 1YHQA 1JB7A 4A3LG 4Y7NH 4BXXG 1LYLA 4KHPQ 3UDIA 3ZJYC 1VCIA 4DV7L 2L15A 3CAMA 2UXDQ 2Q2HA 4BA1I 5FJ8H 5M3MH 2WB1E 4IOAA 3UE0A 3TS2A 5C0XJ 1P8LA 4B3MQ 5M5YH 1FVIA 1X3FA 4JC0A 5GADC 3CPFA 3PV0A 1B7YB 4DR6L 4LWCA 3E9IA 1U5KA 3I2ZA 5GAGC 3OYYA 2ZTEA 3J81i 1B70B 3TEHB 1V1QA 5HGQA 1PH7A 2HQLA 4DR3L 4JBKA 4JCVE 2N78A 4L5QA 4DAMA 3GTOH 5GROA 1MJEA 1CKOA 1SFOH 2EIFA 5FJ8G 3ULJA 5C3EH 1I94L 2Q2UA 3J7A5 3ER0A 1VQNA 3PF4A 5M3MG 4IFDI 3JC66 2E2HH 4HJ7A 1JJGA 1VQ7A 2D0OA 1PYBA 2PQAB 2N49A 3TS0A 3CCQA 2QA4A 3OW2A 2K50A 1Q86C 1O7IA 4R4IA 3RZDH 1HR0W 2DGYA 2UXCL 2CQOA 5IYDH 3J7ZC 2I5HA 4IFDJ 4OWXB 1Y1WH 1K8GA 4LF4Q 3S15H 4R4QA 3UE1A 1L1OB 2K14A 4Y52H 4POFA 3CCUA 1VS0A 2NZHA 4EX5A 4KI0A 4BY1H 2PI2E 4YY3Q 4JV5L 4WJ3M 3HKZG 1NMFA 5IYBH 1VQ9A 4JI4L 3DLLA 4LFBQ 2H5XA 4UP9A 1U0LA 2ZM6Q 3BZKA 4QIWE 4DV0L 5IYCH 4DR2Q 1PHJA 4JI7L 3CXCA 4LF6L 2UXBL 2VNUD 5IYDG 4L5TA 2OWOA 1X65A 3HKSA 2ALYB 4IPHA 3U4ZA 1JJ2A 2RF4A 5GQOA 4JI3L 2HHHQ 2YV5A 4JI6Q 4LF8Q 3CCEA 5JEAG 3PO3H 4BBSH 3EN2A 4BY1G 2E5LQ 1PH2A 1PV4A 4K0KL 1TWHH 2PI2A 1EYGA 1IBML 2R7FA 1KRTA 3T1YL 2NVYH 5IYBG 1QUQB 1MIUA 4UP8A 1HNZL 4LF9Q 1E1OA 2UU9L 1E24A 1NTGA 1YVCA 4XIGS 2VQFL 3CMAA 2AWOA 2IHFA 5IYCG 1W2BA 1I5FA 3I56A 1YEZA 3GD7A 3GTPH 1KL9A 1VQEA 1SE8A 2K5NA 3PUVA 3PSIA 2RHQB 1PH8A 1OTCA 2JQOA 4GOPA 4B3TQ 4QQBX 3TREA 4IPCA 3U4VA 2UUBQ 3PO3G 4BBSG 2YTVA 5C44H 1M1KC 2ATWA 5GAHC 1AE2A 2F3IA 4LFAQ 1SROA 1E3PA 1PYSB 3A5ZB 1GM5A 1CUKA 2F4VL 5JJIA 5BR8L 4DV5L 2R93G 4DR1L 3HOWH 2VUMH 3M7NA 1H95A 4OWTB 1K9MC 3NELA 1C0AA 2IX1A 4DR7Q 2NN6I 1UWVA 3GO5A 3KJOA 1PH1A 4HIOA 3H0GH 4MTNA 3GTJH 4DV7Q 1HZBA 4A3KH 1PFSA 4JYAL 3A5UA 3PUZA 3CC7A 2OQKA 4R4TA 1XMOQ 4X62Q 3RLNA 1IBLQ 2DUDA 1RL2A 3JAMi 4RMFA 3RN5A 4NPSA 1NBWA 3PUYA 3BZCA 2WAQE 5IP7H 3T1HQ 2Z0SA 1YNXA 2CFMA 1OXXK 3G6EA 4DR6Q 3G48A 3HOWG 4JI1L 4FDBA 2K4KA 5C4XH 3J80c 2KHIA 1Y14B 3KFUA 5IE8A 4YCUA 5ELOA 3RLOA 4DR3Q 2JA5H 3S1MH 1RIPA 2NVTH 3RR5A 1T9HA 3H3VH 4YHHL 4DPGA 3F2BA 4A3KG 4GNXA 1HNWL 4OX9Q 2C35B 2CWPA 3F2CA 2NVQH 3CF5A 4A3EH 1A63A 1AE3A 4R4CA 2OCEA 4A3MH 4JI0Q 3KDFA 4B3SL 5IP7G 1CKMA 2LXKA 1KAWA 3BJUA 1UE1A 4X64Q 1SN8A 1K8AC 4DR5L 1VQFA 3W5OA 5C4XG 4GN3B 4QY7A 1PVOA 1X9NA 2GN5A 2JA5G 3S17H 3K7AH 1IBKL 2UUAL 2JEBI 4HJAA 4LFCL 2ASBA 1M90C 5C4JH 5LMNQ 2IHEA 1NJIC 4JI4Q 4DV2L 3I4NH 4DR4L 2PNHA 1TWAH 4A3EG 4A3BG 3HOVG 1Y1VG 5FLXc 5K36G 1EFWA 4A3MG 4DUZL 2JA7H 1NY4A 4OO1G 2Q2TA 4X6AH 2AHOB 1WFQA 1XTDA 2A1AA 2QEXA 5ELNA 4DV0Q 4JI7Q 4LF6Q 4NXMQ 3AEVA 2UXBQ 1N33L 1TXYA 5H1SE 3G4SA 1MKHA 2WP8J 4LUVA 4P71A 4IJHA 2MNAA 5M3FH 1EQRA 4JI3Q 2HIVA 4LF7L 2GVAA 1L2FA 3S14H 1OXTA 4YCVA 4P73A 1YHBA 1I6HH 4MNOA 1HNXQ 2WAQG 1SMXA 1IBMQ 2VQEL 4X66L 3T1YQ 2YTXA 4BA2I 3M3YH 1X55A 3I4NG 1HNZQ 2K52A 1I3QH 3PUWA 5LMNW 3M4PA 5M5XH 1KIXA 2UU9Q 1HH2P 3NEMA 4GS3A 5AJ3L 1X3EA 2VQFQ 2JA7G 1IYJB 2CCZA 4NXNL 3U58A 1WOCA 3CCJA 4DK6C 1L1OC 3G71A 3D0FA 2JEAI 3HOYH 4HIKA 3K81C 5M3FG 1EIYB 4LW1A 3PO2H 2JA6H 1YHAA 2A19A 3GDEA 3KOJA 1KHIA 4DV3L 1JT8A 1R9TH 4PMWA 5HY6A 3TQYA 1PA6A 4GOPB 1HR0L 1QZGA 4TVAB 2UUCL 1JE5A 2ZTDA 3TRZA 1QZHA 5BR8Q 4DV5Q 4BY7H 4DR1Q 1XNQL 1KQSA 2BA0A 3HOUH 3BU2A 1L0WA 4DKAC 1N32L 1CSQA 3STBD 3A74A 3J81j 1XMQL 1J5EL 4WJ4A 2HT1A 1QVFA 1G6PA 2R93H 2F52A 2D0PA 3CMEA 1VQ8A 1XNRQ 4EQ5A 4BBRH 3PGZA 2A8VA 4JYAQ 3CQZH 4DV1L 3HOYG 2JA9A 3CC2A 2R92G 3PO2G 2IY5B 2JA6G 5E7NA 2JJQA 1SR3A 3M9BA 3RNUA 1OXVA 2R7DA 4P72A 4LF5L 1A8VA 4GN5A 5EAYA 1PH6A 2D62A 3LGJA 4GKKL 3J81c 4BY7G 4P75A 2OTJA 2YTYA 1CKNA 3VDYA 2N3SA 2JK8A 4IPGA 4YWKA 3D31A 4JI1Q 3HOUG 3S24A 5C0XG 2VY3A 3GTLH 3CCVA 3AYHB 4AYBE 1Q7YC 3EBEA 1YITA 1FGUA 3B6YA 4DAYB 2R7ZH 4X65L 4YHHQ 1X54A 3STBC 1IZ6A 1BKBA 4BBRG 3I7FA 5IWAL 3I55A 1HNWQ 4YWMA 1KRSA 4NB3A 2PMZE 3AFQA 4RG1A 1YBYA 4DV6L 2R6GA 1LUZA 4AH6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI2 L;  1D8L A;  1VQI A;  3MEF A;  4AQY L;  3L2P A;  4B3S Q;  4POG A;  2Y0S E;  4JOI C;  4YCW A;  2I0Q A;  4AIM A;  3L0O A;  1TWG H;  5M5W H;  4DV4 L;  4DR5 Q;  2AKW B;  1K3R A;  3KDF B;  4P74 A;  3IRB A;  4DUY L;  1XPR A;  3CCL A;  4A3G H;  4H02 A;  1C7Y A;  4OON A;  1HZC A;  1N34 L;  3M4Q A;  2HHH L;  3HOX H;  2UUA Q;  2R7Z G;  1I50 H;  1CSP A;  3Q8D A;  1XPO A;  2RHS B;  4LFC Q;  3FKI H;  1VQK A;  2BH2 A;  3F8T A;  1VQ6 A;  1TWC H;  3K80 C;  3GTQ H;  4IFD G;  2K5H A;  2KCM A;  1GO3 E;  2VZA A;  5J3B A;  2VS1 A;  4JI8 L;  4HIM A;  1NMG A;  4B3R L;  4QJF A;  2RCN A;  5LMU L;  4DUZ Q;  1VQP A;  4C3H H;  1VQG A;  3KLW A;  4UP7 A;  1I94 Q;  3CD6 A;  1Q12 A;  1G29 1;  1N33 Q;  4DNI A;  4GN4 B;  1JMC A;  4A4I A;  4A3B H;  4TQU S;  1Y1V H;  4R4O A;  3HOV H;  1WYD A;  1K83 H;  4A3G G;  2NVX H;  4LF7 Q;  4IJL A;  3AFP A;  5JEA J;  3HOX G;  3WWV A;  3S1N H;  3AQQ A;  4GKJ L;  4OXP A;  2UXC Q;  3FKI G;  3F2D A;  2I5L X;  3RZO H;  4LUO A;  2VQE Q;  5IP9 H;  4X66 Q;  4ALP A;  2EXD A;  4HID A;  1A62 A;  1S40 A;  4L5R C;  4JBW A;  3S1R H;  3KF8 B;  4C3J H;  1FJG L;  4JBJ A;  1JJC B;  4AYB G;  5AJ3 Q;  1BBU A;  4JV5 Q;  1UE6 A;  4NXN Q;  3K7U C;  4DR7 L;  3DM3 A;  1X56 A;  3M4O H;  1Q46 A;  1Q1E A;  2B29 A;  1VQ5 A;  1PH3 A;  3OTO L;  1SLJ A;  2B3G A;  1J6Q A;  4ME3 A;  4DV3 Q;  4A3C H;  5FLM H;  1XMO L;  1GKH A;  1N9W A;  2Y0S G;  3F1Z A;  4C3I H;  4X62 L;  4IO9 A;  2KEN A;  1OXS C;  2MO0 A;  3ULP A;  1HR0 Q;  5DLQ E;  1X6O A;  5IP9 G;  2UUC Q;  3K8A A;  4R1J A;  3GTM H;  3T1H L;  1XNQ Q;  4JI5 L;  2N8N A;  2KHJ A;  3KF6 A;  4JG2 A;  1LM0 A;  1VQJ A;  4QGU A;  1XMQ Q;  2BH8 A;  2MQH A;  1J5E Q;  3PIO A;  3HOZ H;  4A93 H;  4K0K Q;  1N32 Q;  1AH9 A;  1YJ9 A;  4A3F H;  3ICE A;  1UEB A;  4GLX A;  2ZJQ A;  4A3D H;  4DV1 Q;  1KC8 C;  4UY8 C;  4QL5 A;  3CP0 A;  3JAM c;  4A76 A;  1Q81 C;  3S16 H;  2AWN A;  2KBN A;  4OX9 L;  2Q2I A;  4A3J H;  1K0R A;  4IPD A;  1PH5 A;  1VQA A;  3CC4 A;  4A3C G;  1YJW A;  2VL6 A;  5FLM G;  1N36 L;  4LF5 Q;  4KHP L;  5JJK A;  4XTC S;  4GKK Q;  4JI0 L;  3ERS X;  2R92 H;  2UXD L;  1HZA A;  4O2D A;  1W3S A;  1VQH A;  4X64 L;  1E22 A;  2NN6 G;  1MJC A;  1S3O A;  3PCO B;  4A93 G;  3HOZ G;  4B3M L;  1CKN B;  2F4V Q;  4A3F G;  3CCR A;  3K0X A;  4HJ9 A;  1YIJ A;  1D7Q A;  4X65 Q;  2OQ0 A;  2LXJ A;  1NE3 A;  1SRU A;  3U50 C;  4A3D G;  5IWA Q;  4C2M H;  1A0I A;  1YI2 A;  2YU9 H;  1YZ6 A;  1E1T A;  2IX0 A;  2GVB A;  5C3E G;  2I5M X;  5LMN L;  4DV6 Q;  3UDF A;  3H15 A;  4A3J G;  1KD1 C;  4GOP C;  1ASZ A;  3J80 i;  4JI2 Q;  4A3I H;  1UE5 A;  3PIP A;  3CCM A;  4AQY Q;  2XGT A;  1PH4 A;  1IL2 A;  1XPU A;  2QGQ A;  2PQA A;  3I4O A;  2VW9 A;  2HIX A;  4LNQ A;  3H3V I;  1OXU A;  4O0A A;  4DV4 Q;  1VQM A;  4NXM L;  2KCT A;  3E0E A;  1EIF A;  1X3G A;  3EIV A;  4DUY Q;  1LTL A;  1Y1W G;  1G51 A;  1HZ9 A;  3E9H A;  1N34 Q;  2MFI A;  3S2H H;  3A0J A;  2WB1 G;  3ULL A;  4OO1 I;  1L1O A;  2B63 H;  2Z6K C;  3L7Z C;  3PF5 A;  1EUJ A;  3UDX A;  1Q82 C;  1HNX L;  2OTL A;  4JI8 Q;  4GLV B;  4LF4 L;  4PZ8 A;  2MO1 A;  2ZJR A;  3UDG A;  4B3R Q;  5LMU Q;  5IY0 A;  4IOC A;  4A3I G;  2XTI A;  2JE6 I;  4YY3 L;  4UPA A;  3RLF A;  3NBH B;  1K73 C;  3S1Q H;  5JJL A;  1B8A A;  5IT9 c;  4KHZ A;  1Z47 A;  2E8G A;  2ZTC A;  4LFB L;  4JBM A;  2ZM6 L;  4GKJ Q;  2ZJP A;  1BBW A;  1WJJ A;  4HJ8 A;  1C9O A;  3NEN A;  1VQ4 A;  4DR2 L;  3KJP A;  1S72 A;  2B63 G;  4GNX B;  1VQB A;  1IBL L;  3FP9 A;  3FHW A;  3W1G A;  1P16 A;  3HFZ B;  4PZ6 A;  2ID0 A;  1DGS A;  4GNX C;  2K75 A;  4JI6 L;  1IBK Q;  4LF8 L;  3CCS A;  2E2J H;  5GAE C;  2CKZ B;  4KLK A;  1FJG Q;  1QUQ A;  3GTK H;  4LUZ A;  2E5L L;  1VQC A;  1EOV A;  1PH9 A;  1Z9F A;  3I4M H;  3SGI A;  4DV2 Q;  1WCM H;  1TWF H;  1ASY A;  1IXR A;  1BVS A;  2Z6K A;  4DR4 Q;  1GVP A;  2LSS A;  4YWL A;  1VQD A;  2NZO A;  2BA1 A;  1XNR L;  4LF9 L;  2JA8 H;  4A75 A;  3CW2 C;  3OTO Q;  1FL0 A;  1EQQ A;  4GLA C;  2K5V A;  4APV A;  4A3L H;  1UE7 A;  5C44 G;  3M85 A;  4BXX H;  4MZ9 A;  1KXL A;  2IT1 A;  1XJV A;  1V43 A;  2ES2 A;  2EQS A;  2V1C C;  3GTG H;  1Q8K A;  4JI5 Q;  1QVC A;  4B3T L;  2E2I H;  2UUB L;  4HJ5 A;  3PUX A;  3W1B A;  1GD7 A;  1QVG A;  1N8R C;  1V9P A;  4JOI A;  2VUM G;  2AMC B;  3KYH C;  3S2D H;  1Q1B A;  4LFA L;  3RN2 A;  3KF6 B;  3I4M G;  1WCM G;  1YJN A;  3H0G G;  4OWW B;  2WFW A;  2FXQ A;  3HKZ E;  4DK3 C;  1E7Z A;  4PZ7 A;  3CPW A;  1WI5 A;  4L5S A;  2JA8 G;  1EWI A;  2YYZ A;  1VQL A;  1HJP A;  2CWA A;  3MXN B;  4PG3 A;  1VQO A;  5C0X I;  4J15 A;  1N36 Q;  1YHQ A;  1JB7 A;  4A3L G;  4Y7N H;  4BXX G;  1LYL A;  4KHP Q;  3UDI A;  3ZJY C;  1VCI A;  4DV7 L;  2L15 A;  3CAM A;  2UXD Q;  2Q2H A;  4BA1 I;  5FJ8 H;  5M3M H;  2WB1 E;  4IOA A;  3UE0 A;  3TS2 A;  5C0X J;  1P8L A;  4B3M Q;  5M5Y H;  1FVI A;  1X3F A;  4JC0 A;  5GAD C;  3CPF A;  3PV0 A;  1B7Y B;  4DR6 L;  4LWC A;  3E9I A;  1U5K A;  3I2Z A;  5GAG C;  3OYY A;  2ZTE A;  3J81 i;  1B70 B;  3TEH B;  1V1Q A;  5HGQ A;  1PH7 A;  2HQL A;  4DR3 L;  4JBK A;  4JCV E;  2N78 A;  4L5Q A;  4DAM A;  3GTO H;  5GRO A;  1MJE A;  1CKO A;  1SFO H;  2EIF A;  5FJ8 G;  3ULJ A;  5C3E H;  1I94 L;  2Q2U A;  3J7A 5;  3ER0 A;  1VQN A;  3PF4 A;  5M3M G;  4IFD I;  3JC6 6;  2E2H H;  4HJ7 A;  1JJG A;  1VQ7 A;  2D0O A;  1PYB A;  2PQA B;  2N49 A;  3TS0 A;  3CCQ A;  2QA4 A;  3OW2 A;  2K50 A;  1Q86 C;  1O7I A;  4R4I A;  3RZD H;  1HR0 W;  2DGY A;  2UXC L;  2CQO A;  5IYD H;  3J7Z C;  2I5H A;  4IFD J;  4OWX B;  1Y1W H;  1K8G A;  4LF4 Q;  3S15 H;  4R4Q A;  3UE1 A;  1L1O B;  2K14 A;  4Y52 H;  4POF A;  3CCU A;  1VS0 A;  2NZH A;  4EX5 A;  4KI0 A;  4BY1 H;  2PI2 E;  4YY3 Q;  4JV5 L;  4WJ3 M;  3HKZ G;  1NMF A;  5IYB H;  1VQ9 A;  4JI4 L;  3DLL A;  4LFB Q;  2H5X A;  4UP9 A;  1U0L A;  2ZM6 Q;  3BZK A;  4QIW E;  4DV0 L;  5IYC H;  4DR2 Q;  1PHJ A;  4JI7 L;  3CXC A;  4LF6 L;  2UXB L;  2VNU D;  5IYD G;  4L5T A;  2OWO A;  1X65 A;  3HKS A;  2ALY B;  4IPH A;  3U4Z A;  1JJ2 A;  2RF4 A;  5GQO A;  4JI3 L;  2HHH Q;  2YV5 A;  4JI6 Q;  4LF8 Q;  3CCE A;  5JEA G;  3PO3 H;  4BBS H;  3EN2 A;  4BY1 G;  2E5L Q;  1PH2 A;  1PV4 A;  4K0K L;  1TWH H;  2PI2 A;  1EYG A;  1IBM L;  2R7F A;  1KRT A;  3T1Y L;  2NVY H;  5IYB G;  1QUQ B;  1MIU A;  4UP8 A;  1HNZ L;  4LF9 Q;  1E1O A;  2UU9 L;  1E24 A;  1NTG A;  1YVC A;  4XIG S;  2VQF L;  3CMA A;  2AWO A;  2IHF A;  5IYC G;  1W2B A;  1I5F A;  3I56 A;  1YEZ A;  3GD7 A;  3GTP H;  1KL9 A;  1VQE A;  1SE8 A;  2K5N A;  3PUV A;  3PSI A;  2RHQ B;  1PH8 A;  1OTC A;  2JQO A;  4GOP A;  4B3T Q;  4QQB X;  3TRE A;  4IPC A;  3U4V A;  2UUB Q;  3PO3 G;  4BBS G;  2YTV A;  5C44 H;  1M1K C;  2ATW A;  5GAH C;  1AE2 A;  2F3I A;  4LFA Q;  1SRO A;  1E3P A;  1PYS B;  3A5Z B;  1GM5 A;  1CUK A;  2F4V L;  5JJI A;  5BR8 L;  4DV5 L;  2R93 G;  4DR1 L;  3HOW H;  2VUM H;  3M7N A;  1H95 A;  4OWT B;  1K9M C;  3NEL A;  1C0A A;  2IX1 A;  4DR7 Q;  2NN6 I;  1UWV A;  3GO5 A;  3KJO A;  1PH1 A;  4HIO A;  3H0G H;  4MTN A;  3GTJ H;  4DV7 Q;  1HZB A;  4A3K H;  1PFS A;  4JYA L;  3A5U A;  3PUZ A;  3CC7 A;  2OQK A;  4R4T A;  1XMO Q;  4X62 Q;  3RLN A;  1IBL Q;  2DUD A;  1RL2 A;  3JAM i;  4RMF A;  3RN5 A;  4NPS A;  1NBW A;  3PUY A;  3BZC A;  2WAQ E;  5IP7 H;  3T1H Q;  2Z0S A;  1YNX A;  2CFM A;  1OXX K;  3G6E A;  4DR6 Q;  3G48 A;  3HOW G;  4JI1 L;  4FDB A;  2K4K A;  5C4X H;  3J80 c;  2KHI A;  1Y14 B;  3KFU A;  5IE8 A;  4YCU A;  5ELO A;  3RLO A;  4DR3 Q;  2JA5 H;  3S1M H;  1RIP A;  2NVT H;  3RR5 A;  1T9H A;  3H3V H;  4YHH L;  4DPG A;  3F2B A;  4A3K G;  4GNX A;  1HNW L;  4OX9 Q;  2C35 B;  2CWP A;  3F2C A;  2NVQ H;  3CF5 A;  4A3E H;  1A63 A;  1AE3 A;  4R4C A;  2OCE A;  4A3M H;  4JI0 Q;  3KDF A;  4B3S L;  5IP7 G;  1CKM A;  2LXK A;  1KAW A;  3BJU A;  1UE1 A;  4X64 Q;  1SN8 A;  1K8A C;  4DR5 L;  1VQF A;  3W5O A;  5C4X G;  4GN3 B;  4QY7 A;  1PVO A;  1X9N A;  2GN5 A;  2JA5 G;  3S17 H;  3K7A H;  1IBK L;  2UUA L;  2JEB I;  4HJA A;  4LFC L;  2ASB A;  1M90 C;  5C4J H;  5LMN Q;  2IHE A;  1NJI C;  4JI4 Q;  4DV2 L;  3I4N H;  4DR4 L;  2PNH A;  1TWA H;  4A3E G;  4A3B G;  3HOV G;  1Y1V G;  5FLX c;  5K36 G;  1EFW A;  4A3M G;  4DUZ L;  2JA7 H;  1NY4 A;  4OO1 G;  2Q2T A;  4X6A H;  2AHO B;  1WFQ A;  1XTD A;  2A1A A;  2QEX A;  5ELN A;  4DV0 Q;  4JI7 Q;  4LF6 Q;  4NXM Q;  3AEV A;  2UXB Q;  1N33 L;  1TXY A;  5H1S E;  3G4S A;  1MKH A;  2WP8 J;  4LUV A;  4P71 A;  4IJH A;  2MNA A;  5M3F H;  1EQR A;  4JI3 Q;  2HIV A;  4LF7 L;  2GVA A;  1L2F A;  3S14 H;  1OXT A;  4YCV A;  4P73 A;  1YHB A;  1I6H H;  4MNO A;  1HNX Q;  2WAQ G;  1SMX A;  1IBM Q;  2VQE L;  4X66 L;  3T1Y Q;  2YTX A;  4BA2 I;  3M3Y H;  1X55 A;  3I4N G;  1HNZ Q;  2K52 A;  1I3Q H;  3PUW A;  5LMN W;  3M4P A;  5M5X H;  1KIX A;  2UU9 Q;  1HH2 P;  3NEM A;  4GS3 A;  5AJ3 L;  1X3E A;  2VQF Q;  2JA7 G;  1IYJ B;  2CCZ A;  4NXN L;  3U58 A;  1WOC A;  3CCJ A;  4DK6 C;  1L1O C;  3G71 A;  3D0F A;  2JEA I;  3HOY H;  4HIK A;  3K81 C;  5M3F G;  1EIY B;  4LW1 A;  3PO2 H;  2JA6 H;  1YHA A;  2A19 A;  3GDE A;  3KOJ A;  1KHI A;  4DV3 L;  1JT8 A;  1R9T H;  4PMW A;  5HY6 A;  3TQY A;  1PA6 A;  4GOP B;  1HR0 L;  1QZG A;  4TVA B;  2UUC L;  1JE5 A;  2ZTD A;  3TRZ A;  1QZH A;  5BR8 Q;  4DV5 Q;  4BY7 H;  4DR1 Q;  1XNQ L;  1KQS A;  2BA0 A;  3HOU H;  3BU2 A;  1L0W A;  4DKA C;  1N32 L;  1CSQ A;  3STB D;  3A74 A;  3J81 j;  1XMQ L;  1J5E L;  4WJ4 A;  2HT1 A;  1QVF A;  1G6P A;  2R93 H;  2F52 A;  2D0P A;  3CME A;  1VQ8 A;  1XNR Q;  4EQ5 A;  4BBR H;  3PGZ A;  2A8V A;  4JYA Q;  3CQZ H;  4DV1 L;  3HOY G;  2JA9 A;  3CC2 A;  2R92 G;  3PO2 G;  2IY5 B;  2JA6 G;  5E7N A;  2JJQ A;  1SR3 A;  3M9B A;  3RNU A;  1OXV A;  2R7D A;  4P72 A;  4LF5 L;  1A8V A;  4GN5 A;  5EAY A;  1PH6 A;  2D62 A;  3LGJ A;  4GKK L;  3J81 c;  4BY7 G;  4P75 A;  2OTJ A;  2YTY A;  1CKN A;  3VDY A;  2N3S A;  2JK8 A;  4IPG A;  4YWK A;  3D31 A;  4JI1 Q;  3HOU G;  3S24 A;  5C0X G;  2VY3 A;  3GTL H;  3CCV A;  3AYH B;  4AYB E;  1Q7Y C;  3EBE A;  1YIT A;  1FGU A;  3B6Y A;  4DAY B;  2R7Z H;  4X65 L;  4YHH Q;  1X54 A;  3STB C;  1IZ6 A;  1BKB A;  4BBR G;  3I7F A;  5IWA L;  3I55 A;  1HNW Q;  4YWM A;  1KRS A;  4NB3 A;  2PMZ E;  3AFQ A;  4RG1 A;  1YBY A;  4DV6 L;  2R6G A;  1LUZ A;  4AH6 A; 
#chains in the Genus database with same CATH topology
 2IWH A;  4CBV A;  2XRS D;  1PFB A;  1CQV A;  4YCW A;  2I0Q A;  2SDF A;  1TWG H;  1GOZ A;  4DV4 L;  1K3R A;  3EVQ A;  2XSC A;  3IRB A;  1HZC A;  5C4J B;  2HHH L;  3FRP B;  2UUA Q;  2R7Z G;  3VA5 A;  2RHS B;  2BH2 A;  2AQ3 B;  1TY2 A;  3K80 C;  2F0V A;  2KCM A;  2VZA A;  4JI8 L;  4HIM A;  1R4Q B;  1QB5 D;  1STG A;  4RWS C;  1VQP A;  1U4M A;  2M00 A;  1EY8 A;  2Z8L A;  1JMC A;  4A4I A;  4TQU S;  3HOV H;  2CH4 W;  4NDX A;  4R4O A;  1WYD A;  3J7A F;  3S1N H;  4GKJ L;  4ZKC B;  1WTH A;  4OXP A;  1D5Z C;  2EXD A;  4HID A;  4L5R C;  2NTT A;  3KF8 B;  3GQB A;  4JBJ A;  1OO9 B;  4AYB G;  4C3H G;  2A74 C;  2X6L A;  1LLR D;  3K7U C;  2X69 A;  4O1N A;  1R9T B;  4E6I A;  2B3G A;  4ME3 A;  5IOC A;  4DV3 Q;  1XMO L;  1CA5 A;  4G7H C;  1N9W A;  4X62 L;  3F1Z A;  4IO9 A;  1IBL L;  2MO0 A;  4CJ0 B;  1IHZ A;  1XNQ Q;  1RTN A;  4MTK A;  4JG2 A;  1VQJ A;  1X3P A;  4J1M A;  4A93 H;  4BBR B;  3C3L A;  1UEB A;  1K8O A;  2K28 A;  3MXN A;  2ZJQ A;  4DV1 Q;  1CA6 A;  1SAP A;  3CP0 A;  3JAM c;  2KBN A;  2L4N A;  1PH5 A;  1VQA A;  2XNA C;  1IL8 A;  4JK1 C;  1PTO F;  3A55 A;  3BZD B;  1S5E D;  2UXD L;  4O2D A;  1JC7 A;  1VQH A;  1TS4 A;  4X64 L;  2R7Z B;  1E22 A;  4HCE A;  3PCO B;  4RCO A;  3HOZ G;  1SNO A;  4FP5 D;  4X65 Q;  1GUS A;  3K57 A;  4XXE A;  1YZ6 A;  1X32 A;  4DAP A;  2IX0 A;  5LMN L;  2I5M X;  4A3J G;  3UDF A;  5D65 A;  1YNJ D;  1JOK A;  3J80 i;  2GA4 B;  4JI2 Q;  1JB3 A;  2OT2 A;  4A3I H;  3PIP A;  4AQY Q;  3J7Y W;  1RF2 D;  2PQA A;  3WDN A;  3KBX A;  1VF5 C;  1EIF A;  3ND9 A;  3NP8 A;  1I50 B;  4DUY Q;  3E0J A;  2A68 C;  1N34 Q;  3S2H H;  3A0J A;  3GTQ B;  3MWY W;  3ULL A;  1L1O A;  1A6X A;  4FNF A;  1SE4 A;  3PF5 A;  1HNX L;  3GV3 A;  3KBG A;  2MO1 A;  3ND8 A;  4AYB B;  4C3H B;  4B3R Q;  5C4H A;  2XTI A;  2JE6 I;  4YY3 L;  3A8K E;  3RLF A;  2Z4I A;  1K73 C;  2NVX B;  3S1Q H;  1AN8 A;  5IT9 c;  2ZM6 L;  5LL6 X;  1BBW A;  1WJJ A;  1ZKO A;  3S1R B;  3FP9 A;  3FHW A;  1ONL A;  2ID0 A;  1PRT B;  4JI6 L;  1IBK Q;  1ESF A;  1W6J A;  4ILW A;  1FJG Q;  5EKL A;  2ZXR A;  2E5L L;  1SYF A;  4ZLT F;  1PH9 A;  2ZXP A;  1TWF H;  1BVS A;  2E75 C;  2LSS A;  5JPM C;  5A2Q E;  2RKS A;  2K5W A;  4O42 A;  3D4D A;  1XNR L;  1CT1 D;  2F0J A;  3CW2 C;  1LTA D;  4A3L H;  5C44 G;  2MHV A;  1XJV A;  2ES2 A;  1NR4 A;  2KHS A;  5CV5 A;  1LTR D;  3HOZ B;  3VA7 A;  1G91 A;  1STY A;  4K14 A;  3W1B A;  4HJ5 A;  4DAY A;  1QVG A;  1N8R C;  4JOI A;  2VUM G;  5I6Y A;  2PCF B;  4I7A A;  1WCM G;  3S16 B;  1STN A;  3OMG A;  3H0G G;  4NP5 A;  4A3J B;  1YJN A;  4L5S A;  4X3U A;  2LKV A;  4FO2 A;  2C5C A;  1XXG A;  1SEB D;  2YYZ A;  1BF4 A;  2CWA A;  3VYT A;  5C0X I;  2JYO A;  1JB7 A;  3BVZ A;  1YHQ A;  4KHP Q;  3D6W A;  1BXT A;  3IAY A;  2A6E D;  1ESR A;  5FJ8 H;  1AZP A;  2EPB A;  4FXD A;  1JWM D;  3TS2 A;  1B9N A;  4QCL A;  1HQM C;  4C2M B;  1X3F A;  5CV7 A;  4B9X A;  1B70 B;  1BNZ A;  3TEH B;  1T5X D;  3FVQ A;  2J4X A;  4I65 A;  3BDC A;  5HGQ A;  3VYS A;  1X3Q A;  1PZI D;  4JBK A;  4JCV E;  3ER0 A;  1VQN A;  2EYH A;  1GUN A;  2QA4 A;  4R4I A;  3RZD H;  1JCK B;  3J7Z C;  1E2W A;  4KY6 A;  4G7Z C;  2NZH A;  1TT2 A;  3K0Y A;  1E2V A;  5IYB H;  2A73 B;  3DHQ A;  1VQ9 A;  1MSG A;  4K6D A;  3M7G A;  5CYU A;  4L63 B;  4DNR B;  4LFB Q;  1UNS A;  4QIW E;  1LAB A;  4J8Q A;  4DR2 Q;  2VNU D;  1ILP A;  1PRT F;  3AB9 A;  5IYD G;  2OWO A;  1X65 A;  2E2J B;  1EQV A;  4N9T A;  3C1E A;  2HHH Q;  3H09 A;  3QOL A;  3QG1 A;  1STH A;  1WCM B;  4RHR A;  1EYG A;  1JOR A;  1WVL A;  1FYC A;  3T1Y L;  1A15 A;  2NVY H;  1MIU A;  4MN3 A;  4HMJ A;  4UP8 A;  3E3X A;  1E1O A;  1PTO C;  1E24 A;  1I4X A;  4C56 C;  3GTG B;  3I56 A;  3PUV A;  1OTC A;  1A2T A;  1EY7 A;  2VXW A;  4QMG A;  1LTB D;  4GOP A;  2SOB A;  1EY9 A;  4BBS G;  3CRL C;  1M1K C;  2ATW A;  2XWJ B;  2F3I A;  1H9K A;  1PYS B;  5FKA C;  1QIL A;  2PZW A;  1EOT A;  1WTV A;  5BN3 A;  1H95 A;  1K9M C;  4Y7N B;  4CKE A;  3NEL A;  5EPK A;  3KJO A;  4HIO A;  4HCS A;  5LL6 S;  4DV7 Q;  4A3K H;  3I90 A;  1PFS A;  4JYA L;  5JVH 3;  1F2M A;  4R4T A;  1KNA A;  2XWB B;  1XMO Q;  4X62 Q;  1EQT A;  1IBL Q;  1PFM A;  4RGN A;  2CFM A;  3KLS X;  2CVR A;  3V05 A;  2K4K A;  5C4X H;  2KHI A;  5C5L A;  2JA5 H;  3TDQ A;  3RR5 A;  1T9H A;  2A69 C;  3F2B A;  4L8J A;  2NVQ H;  2B2Y A;  4A3E H;  1A63 A;  5EQ0 A;  2L0C A;  1AE3 A;  5EKK A;  3KDF A;  5IP7 G;  4HSP A;  2F0F A;  2LXK A;  3L9A X;  4X64 Q;  1SN8 A;  3NQT A;  5CV9 A;  3HG9 A;  1QOH A;  1SYG A;  1PVO A;  5FO7 B;  3KLR A;  4RKL A;  2UUA L;  2JEB I;  4CKB A;  2HQE A;  5LMN Q;  2IHE A;  1NJI C;  4IN3 A;  2KCN A;  5I4D A;  3HOV G;  3OSO A;  2RSO A;  1NY4 A;  4OO1 G;  4X6A H;  3VR3 A;  4ZUI A;  4LF6 Q;  1BDO A;  4BBS B;  1HA5 A;  3DEO A;  1L0Y B;  2LY7 A;  5NUC A;  1LTS D;  5M3F H;  1EQR A;  2FIN B;  1JE4 A;  1JR0 D;  4MNO A;  5FK9 C;  4XQJ A;  1HNX Q;  5DM7 3;  3M3Y H;  3OMC A;  3PUW A;  3VR5 A;  5LMN W;  3J7A V;  3DMU A;  4CJ1 B;  1ENF A;  3TZU A;  4DAV A;  3CRK C;  1KTK A;  1ENC A;  1L1O C;  1M4V A;  1HTL D;  4QIW B;  3PO2 H;  5CMD A;  1LT3 D;  1H9S A;  4DV3 L;  3TQY A;  5IGB A;  1QZG A;  4TVA B;  4DA2 A;  2O5I C;  2ZTD A;  3GTK B;  1ZYR D;  1QZH A;  4BY7 H;  1TU2 B;  1XNQ L;  4DK0 A;  2BA0 A;  3HOU H;  5HGT A;  4DKA C;  3J81 j;  3A8J E;  4WJ4 A;  1BO0 A;  1SNQ A;  4K8J A;  1XNR Q;  3A56 A;  4IAL A;  3CQZ H;  4DV1 L;  2F03 A;  2K33 A;  3HOY G;  2EYL A;  4KTA A;  2R7D A;  2NYZ D;  4GN5 A;  1I4G A;  5A35 A;  4NW2 A;  3IL8 A;  1CM9 A;  2KQ3 A;  3U9O A;  4ULL A;  3R2I A;  3AYH B;  4S3S A;  1Q7Y C;  1YIT A;  2BDN A;  2V4D A;  4X65 L;  1NR2 A;  4YHH Q;  1HNW Q;  1WD0 A;  1SNP A;  5I2X A;  2PMZ E;  3AFQ A;  4RG1 A;  2VB3 X;  4JI2 L;  1PRT C;  1VQI A;  2NTS A;  4AQY L;  4POG A;  4KY7 A;  4JOI C;  2EJF C;  4AIM A;  3L0O A;  1EWC A;  1CQF A;  2R3Z A;  1WTQ A;  4DR5 Q;  3S17 B;  2AKW B;  4DUY L;  1XPR A;  4H02 A;  4OON A;  1N34 L;  1XPO A;  3Q8D A;  3R93 A;  1S5C D;  2VS1 A;  1SFO B;  2MGS A;  4B3R L;  3NBH A;  1SE2 A;  1O7L A;  4LK1 C;  4UP7 A;  5KRU A;  1G29 1;  3QJY A;  2MJ8 A;  3I73 A;  4DXG A;  4A3G G;  1I6H B;  5D14 A;  5JJZ A;  3HOX G;  4IQZ A;  3WWV A;  3FKI G;  1V1P A;  2WV6 D;  3RZO H;  5M5X B;  1S40 A;  1S5F D;  4NMZ A;  4ME5 A;  4Q0F A;  1I4Q A;  4C3J H;  1FJG L;  1JJC B;  2EZV A;  5AJ3 Q;  1BBU A;  1UE6 A;  5C5M A;  3HOY B;  1ZEQ X;  3M4O H;  1Q46 A;  1Q1E A;  4FF3 A;  4K5V A;  2B29 A;  1Y8O B;  1PH3 A;  1TS5 A;  1SLJ A;  1FR3 A;  1J6Q A;  4A3C H;  4CJ2 C;  3IKJ A;  4C3I H;  3LWE A;  5M9O A;  2UUC Q;  5IP9 G;  4DK1 A;  2BDO A;  2Z1C A;  3GTM H;  3CHB D;  2HDL A;  2R93 B;  5ELD A;  4QGU A;  2MQH A;  1J5E Q;  3J80 L;  3PIO A;  1AH9 A;  1YJ9 A;  4A3F H;  4GLX A;  3TP5 A;  4A3D H;  1XYI A;  2B2U C;  4UY8 C;  2F0G A;  2AWN A;  4DGZ A;  4OX9 L;  2Q2I A;  5FLM G;  5C6A A;  5JPN C;  4KHP L;  1CZG A;  3OPO A;  1DOK A;  1GXD C;  4JI0 L;  3ERS X;  2R92 H;  1HZA A;  2ICE C;  2KOL A;  4BS9 A;  2NN6 G;  1MJC A;  1CKN B;  3GV6 A;  3CCR A;  1YIJ A;  3U50 C;  1GHK A;  1NE3 A;  2K01 A;  4MIU A;  5IWA Q;  2HD3 A;  5LHY 1;  2YU9 H;  2NBF A;  2CW0 D;  2GVB A;  2EJM A;  3H15 A;  1A3U A;  1BR9 A;  4GOP C;  3VYR A;  3RMH A;  1UE5 A;  1IL2 A;  5E1F A;  2K1B A;  3H3V I;  4A3G B;  4LNQ A;  1QE6 A;  1OXU A;  1QNK A;  1VQM A;  1AEX A;  2KCT A;  3E0E A;  1X3G A;  3PMF A;  2FFK B;  3HOX B;  2MPM A;  3FKI B;  1TWC B;  2MFI A;  3P1H A;  1PTO B;  4OO1 I;  1KAA A;  4XDX A;  3BS1 A;  1TII D;  2OTL A;  3UDX A;  5KIX A;  2B39 A;  3I3C A;  2AUK A;  4M1U B;  2ZJR A;  3UDG A;  3D3R A;  1ILQ A;  4X3S A;  2PZT A;  5AFW A;  5LMU Q;  4IOC A;  3G7L A;  4A3B B;  1Y1V B;  1YNJ C;  3J80 E;  1K83 B;  2PMZ B;  1SJH D;  4CDE C;  2C9O A;  1EY4 A;  4LFB L;  4JBM A;  1U4P A;  1ICF B;  3NSW A;  1F2Z A;  1C9O A;  1VQ4 A;  4DR2 L;  3BG3 A;  2B63 G;  5L37 A;  4PZ6 A;  1DGS A;  1RHP A;  3GTK H;  2B2Y C;  1QUQ A;  2DJF C;  4LUZ A;  2IW3 A;  1UUP A;  1VQC A;  5KEE A;  1EOV A;  4DN4 M;  1Z9F A;  3I4M H;  3SGI A;  1ASY A;  2SNM A;  1IXR A;  2Z6K A;  1NCV A;  4YWL A;  1Z6H A;  5CV4 A;  3QOJ A;  4GLA C;  2K5V A;  4APV A;  2ICI A;  1UE7 A;  4BXX H;  1MBY A;  1EYA A;  4FXG C;  1KXL A;  2IL8 A;  2RSN A;  1Y69 U;  2V1C C;  3MFY A;  2E2I H;  5ISR A;  5CBA E;  3P75 A;  3W2D A;  2AMC B;  3KYH C;  3V96 A;  3S2D H;  1Q1B A;  1D5X C;  5DNF A;  2FXQ A;  4DK3 C;  1E7Z A;  4PZ7 A;  2JA8 G;  5T1I A;  5DM6 3;  1VQL A;  1HJP A;  4KKS A;  1K8M A;  3MXN B;  3SXH A;  5CC4 A;  1BOS A;  1VCI A;  2MUY A;  4DV7 L;  3CAM A;  2Q2H A;  1EIH A;  4R8N A;  5M3M H;  2EY5 A;  2MP1 A;  2RDH A;  4HR7 B;  3VR6 A;  3UE0 A;  4HMI A;  4X3K A;  1P8L A;  4B3M Q;  5M5Y H;  1FVI A;  4JC0 A;  4H0L C;  3OWE B;  1B7Y B;  3NWS A;  3PV0 A;  3E9I A;  4LWC A;  1Q8I A;  3J81 i;  1WD1 A;  1PH7 A;  3OW7 A;  4IUQ A;  4F8M A;  2KVM A;  1CKO A;  1SFO H;  1HXY D;  5C3E H;  3J7A 5;  1JJG A;  4HJ7 A;  3DUZ A;  2A6E C;  2PQA B;  2B63 B;  2KEE A;  3OW2 A;  1U9R A;  3H91 A;  1JWS D;  1II3 A;  2I5H A;  4IFD J;  1Y1W H;  4LF4 Q;  3S15 H;  3UE1 A;  1L1O B;  2K14 A;  3TZD A;  3NTH A;  5JEA H;  3CCU A;  4EX5 A;  4BY1 H;  1JWU D;  2PZU A;  4WJ3 M;  1HUM A;  4WRD A;  1NMF A;  2F0U A;  4KV6 A;  1IKL A;  1U0L A;  2F0K A;  2F0Q A;  3G6J B;  3MXU A;  3K5M A;  1J9O A;  3H94 A;  1PHJ A;  4LF6 L;  4L5T A;  4OL7 A;  4B9W A;  3H6M A;  4IPH A;  5IGD A;  1JOQ A;  1DJR D;  2O4X A;  2RDF A;  3BYY B;  4EGV A;  2J0T D;  4KKT A;  3EJI A;  3CCE A;  2B2T A;  1PH2 A;  1TWH H;  2PI2 A;  2JA8 B;  3F2U A;  4ZUJ A;  1KRT A;  4LF9 Q;  1BCP D;  4MHE A;  1T5E A;  4EQN A;  1LT5 D;  1YVC A;  4XIG S;  2IHF A;  2PQE A;  5IYC G;  3H3V C;  1ROD A;  3GD7 A;  1FNU A;  3GTP H;  2K5N A;  1PH8 A;  1NSN S;  2JQO A;  4HN7 A;  4QQB X;  3U4V A;  2F0S A;  3PO3 G;  1GHJ A;  3IFT A;  5GAH C;  1AE2 A;  1Y8N B;  5FOB B;  3A5Z B;  1E3P A;  1PXU A;  1GM5 A;  2ENB A;  2N55 A;  2PO4 A;  5JJI A;  1XX8 A;  3HOW H;  3URY A;  4OWT B;  1C0A A;  2IX1 A;  2NN6 I;  2KCC A;  1PLF A;  3X3N A;  2PW7 A;  3A5U A;  3FPP A;  1ZXT A;  2OQK A;  3CC7 A;  2O5J C;  4ZK9 B;  3Q23 A;  2G9D A;  3RN5 A;  2WAQ E;  5KND A;  2M2L A;  3G6E A;  4U67 3;  2RVL A;  3J80 c;  1DZ1 A;  5IIF A;  4C1N I;  3GTO B;  3KFU A;  1STB A;  4QB4 A;  5IE8 A;  5ELO A;  3RLO A;  3Q6S A;  4DR3 Q;  1STE A;  2NVT H;  3HRZ C;  4YHH L;  4DPG A;  2L11 A;  2E2H B;  4GNX A;  2KJX A;  1HNW L;  4OX9 Q;  2C35 B;  2CWP A;  1EZ8 A;  2WKD A;  2OCE A;  4A3M H;  4JI0 Q;  1DOL A;  2Z9H A;  1CKM A;  3AU7 A;  1PMR A;  2B2W A;  1KAW A;  3BJU A;  2EDG A;  3KUP A;  4DR5 L;  2PNR C;  1SYC A;  5I9O A;  4QY7 A;  4PMC A;  1SNM A;  1XTC D;  3KK7 A;  3LNN A;  3WOF A;  4HJA A;  4R8I A;  5C4J H;  4KN7 C;  3EQL C;  3SK4 A;  4JI4 Q;  4DR4 L;  3FDT A;  2WAC A;  5K36 G;  3FMC A;  2F0P A;  4L6T B;  1SND A;  4DV0 Q;  1WFQ A;  1F9Q A;  3HEJ A;  1B53 A;  3QR8 A;  1ET9 A;  1TXY A;  3PO3 B;  4LUV A;  2WP8 J;  4P71 A;  3T4A C;  1HQR D;  2EY6 A;  1EEF D;  3HS0 C;  1YHB A;  4K5W A;  2WAQ G;  1SMX A;  2E74 C;  3MAQ A;  2QF7 A;  4CGY B;  1X55 A;  3I4N G;  1M8A A;  1HNZ Q;  4LJZ C;  4XYQ A;  2UU9 Q;  1KIX A;  1HH2 P;  4PMB A;  5AJ3 L;  4YIJ A;  2JA7 G;  1IYJ B;  2CCZ A;  3U58 A;  3DWA A;  2P5Z X;  4DK6 C;  5C44 B;  1E0B A;  4JW0 A;  4KK7 A;  4LW1 A;  2A19 A;  2E76 C;  3GDE A;  3FEW X;  3ITP A;  1KHI A;  3KOJ A;  1JT8 A;  2M9V A;  1R9T H;  1VMC A;  4PMW A;  1PA6 A;  4GOP B;  2VUM B;  2UUC L;  1XWE A;  1QJO A;  5BR8 Q;  4DV5 Q;  3O13 A;  4EQP A;  4DR1 Q;  2EYJ A;  1KQS A;  1H9J A;  3H0G B;  3STB D;  5C0X H;  1J5E L;  3GTJ B;  2HT1 A;  4V19 0;  1QVF A;  1G6P A;  3C1F A;  2D0P A;  3T51 B;  4OHJ A;  4EQ5 A;  4BBR H;  1R4P B;  3E6Z X;  5FLX L;  3DWQ A;  2JA9 A;  3SE0 A;  2R92 G;  2JA6 G;  1GUG A;  4P72 A;  2Z4H A;  1G8Z D;  4DF7 A;  1SMY D;  1EFI D;  2YTY A;  5HUR A;  1ICW A;  2VB2 X;  4JI1 Q;  2BE5 D;  3S1M B;  1ZYR C;  3A8I E;  3S24 A;  1KDB A;  1FGU A;  3WOE A;  2R7Z H;  1GUW A;  3I7F A;  5IWA L;  2K32 A;  1WTP A;  4YWM A;  4KY5 A;  3T56 B;  4PV1 C;  1YBY A;  4RHS A;  5CV8 A;  1LUZ A;  1E2Z A;  4AH6 A;  1D8L A;  4I7Z C;  3TME A;  4B3S Q;  3PQI A;  2F0W A;  4JPB W;  3KDF B;  3K7A B;  3CCL A;  1BUV T;  3ZYY X;  1C7Y A;  2WAQ B;  2K5Q A;  3M4Q A;  4H13 C;  1I50 H;  2KED A;  1VQ6 A;  3ERO A;  3F8T A;  3I4N B;  4FXK C;  1TWA B;  5F2D A;  3GTQ H;  4IFD G;  2F4I A;  2RA4 A;  1GO3 E;  2JA7 B;  2PW5 A;  2O2L D;  4QJF A;  5LMU L;  4KMU C;  1TQO A;  4DUZ Q;  4C3H H;  2DJG C;  1VQG A;  3KLW A;  4UAI A;  2QKI C;  4XQQ A;  5IGC A;  1LT4 D;  4GN4 B;  4RGM A;  1IW7 D;  3S14 B;  4N9P A;  4CDC C;  2NVX H;  2R61 A;  4IJL A;  3AFP A;  2OXP A;  1I4P A;  3AQQ A;  4H7B A;  4GZY C;  2QDB A;  1GUT A;  4K2L A;  5BN4 A;  4OEM B;  3F2D A;  4ALP A;  4X66 Q;  3TP8 A;  3VYU A;  3MC0 B;  2NZ1 D;  3S1R H;  4WOR A;  5IGG A;  4DR7 L;  2K6A A;  1PYW D;  2XRQ D;  1QCB D;  4DFA A;  1HFG A;  4BWG B;  1YNN D;  1HA6 A;  3T53 B;  1HTP A;  2WKC A;  2Q8T A;  1GKH A;  1HR0 Q;  3NTI A;  3ULP A;  2KEN A;  1OXS C;  1EY0 A;  1X6O A;  1IKM A;  3K8A A;  5J39 A;  1H9S B;  2N8N A;  3KF6 A;  4IUR A;  1LM0 A;  2BH8 A;  3P7J A;  3HOZ H;  3U9S A;  3ICE A;  2BCO A;  1HRJ A;  1EL0 A;  1KC8 C;  4QL5 A;  1TVX A;  3S16 H;  1K0S A;  4A3J H;  4IPD A;  4X3T A;  2VL6 A;  5JJK A;  1F2L A;  2B2T C;  5EJW A;  1EU4 A;  5DAU A;  3GTL B;  1W3S A;  1VDZ A;  3VR2 A;  4A93 G;  4B3M L;  2JXM B;  3K0X A;  3MXG A;  5I6W A;  1D7Q A;  2OQ0 A;  1SRU A;  4C2M H;  1A0I A;  1F9R A;  1KDC A;  4PQX A;  2H4O A;  3Q24 A;  1YI2 A;  5C3E G;  3DXJ C;  1ASZ A;  1KD1 C;  5C4Z A;  1TWG B;  3CCM A;  1PH4 A;  2XGT A;  1XPU A;  1BCP F;  4LAA A;  5FO9 B;  1SSO A;  4O0A A;  4HED A;  3A7L A;  3EIV A;  5EBD A;  1Y1W G;  3E9H A;  5I9P A;  4NKL A;  2A5H A;  2WB1 G;  1TY0 A;  1FD7 D;  4OEL B;  3S9W A;  3R3O A;  3L7Z C;  1EUJ A;  3E5S A;  1Q82 C;  2JP1 A;  4GLV B;  1EU3 A;  1U4L A;  2F0H A;  4LF4 L;  4RKB A;  5KNB A;  4FF4 A;  4P2C B;  4A3I G;  2CW0 C;  5D3D A;  3HOV B;  4LMQ D;  5JAV A;  3NBH B;  3RUZ A;  4KHZ A;  5TSS A;  1Z47 A;  2E8G A;  2ZTC A;  3ERQ A;  1DD2 A;  4HJ8 A;  3NEN A;  3KJP A;  1FNW A;  1EY6 A;  3W1G A;  1P16 A;  2XN9 C;  4GNX C;  3L3O C;  2K75 A;  1F9S A;  4KJO A;  2E2J H;  4H44 C;  1Q3L A;  1V1P B;  2CKZ B;  5GAE C;  1B3Q A;  4UHV A;  1WCM H;  4DR4 Q;  2HUG A;  1VQD A;  2NZO A;  3SK5 A;  3P20 A;  4LF9 L;  4A75 A;  4ODG A;  3OTO Q;  1CZW A;  1RCV D;  3NWT A;  4MZ9 A;  2HCC A;  3GTG H;  2DY7 A;  4JI5 Q;  4A93 B;  1QVC A;  3J81 L;  5DEH A;  1GJX A;  3PUX A;  1GD7 A;  1V9P A;  1I3Q B;  3BYT B;  1O7Y A;  1DCZ A;  1W6K A;  4OWW B;  2F1M A;  1WI5 A;  4FVM A;  4U68 A;  2PYK A;  1VQO A;  1N36 Q;  4A3L G;  4Y7N H;  1LYL A;  1MGS A;  3NQI A;  2JSO A;  2NUC A;  2H1E A;  2G5D A;  3W3A A;  3CPF A;  2B2V A;  2AUJ D;  3I2Z A;  2ZTE A;  2EOT A;  4ZKB B;  4A3I B;  3FPU B;  1V1Q A;  1AFP A;  2HQL A;  2IJ0 A;  3BVG A;  3CKI B;  3MA2 B;  3K5L A;  2N88 A;  4DR3 L;  1SYD A;  2N78 A;  4L5Q A;  1KNE A;  3PIP 3;  4DAM A;  1B44 D;  5FJ8 G;  2Q2U A;  3ULJ A;  1I94 L;  3PF4 A;  3S2H B;  4IFD I;  1NNX A;  3JC6 6;  2A6H D;  2D0O A;  1PYB A;  4G57 A;  3TS0 A;  1Q86 C;  2I46 A;  2UXC L;  5IYD H;  3DEP A;  5ELB A;  1QG7 A;  3NUC A;  4R4Q A;  4Y52 H;  3J81 E;  1VS0 A;  4OIJ A;  1SNC A;  4KI0 A;  4RFB A;  2PI2 E;  3S1Q B;  1A2U A;  1SJE D;  2TSS A;  1B3A A;  4JV5 L;  4WFN 3;  2Q8R E;  4JI4 L;  3OOC A;  5M5W B;  2EYO A;  3I91 A;  2Q8I B;  4UP9 A;  1EYD A;  4DV0 L;  4ZQ3 A;  5CBE E;  3CXC A;  4KN4 C;  1MD2 D;  2ALY B;  3M4Y A;  2RF4 A;  5GQO A;  4LF8 Q;  1K3B C;  4BBS H;  2F0M A;  3SK6 A;  1TWF B;  1F77 A;  3T13 A;  1Y8P B;  2LMC B;  1PV4 A;  1BBX C;  4K0K L;  3NE5 B;  2R7F A;  4DNT B;  5IYB G;  4K8I A;  1QUQ B;  2L1B A;  2QEJ C;  1HNZ L;  2UU9 L;  1NTG A;  5C3W A;  3MVV A;  2AWO A;  5ELE A;  3X3M A;  1W2B A;  1WTO A;  2F0D A;  5E4W C;  1KL9 A;  3PSI A;  5JOB A;  4B3T Q;  2UUB Q;  4IPC A;  2YTV A;  1ENA A;  4LFA Q;  1CUK A;  2F4V L;  5BR8 L;  4DV5 L;  1FGB D;  2AQ1 B;  4DR1 L;  3HZX A;  2D9U A;  4DR7 Q;  5J22 A;  1BCP C;  1D1I A;  1PH1 A;  5IGE A;  4MTN A;  4RA8 A;  2X6G A;  2DUD A;  1RL2 A;  3LX0 A;  4K2K A;  3JAM i;  4RMF A;  4NPS A;  1JQY D;  3BZC A;  3ONA B;  5IP7 H;  2Z0S A;  4DR6 Q;  2DNC A;  3GP7 A;  4QF4 A;  4JI1 L;  1B9M A;  1SBB B;  1CFM A;  1Y14 B;  5KYI A;  3K58 A;  4XT3 B;  1RIP A;  3H3V H;  4A3K G;  4CDF C;  3K5N A;  1SXT A;  3BVM A;  2F0O A;  3RZD B;  3I70 A;  3D6C A;  1DM0 B;  4QUC A;  1SYE A;  4B3S L;  4OO1 H;  5D3I B;  1UE1 A;  1VQF A;  3W5O A;  2EYM A;  5C4X G;  3TN2 A;  3SR1 A;  2WIN B;  1PZK D;  3D4R A;  2JA5 G;  3S17 H;  2ASB A;  1M90 C;  1KLG D;  1HCZ A;  2SNS A;  4DV2 L;  3I4L A;  3DWP A;  2L12 A;  2PNH A;  4A3E G;  3OHX C;  4DUZ L;  3QIA A;  5EPL A;  5JVG 3;  2Q2T A;  2A1A A;  4CKC A;  4JI7 Q;  2UXB Q;  5I2Y A;  5H1S E;  3G4S A;  1AW7 A;  1JIC A;  1S5D D;  2AQ2 B;  4JI3 Q;  2HIV A;  3K6O A;  1L2F A;  2NVY B;  2Z6B A;  4P73 A;  3KF8 A;  1I6H H;  1IBM Q;  3SEB A;  4X66 L;  3K5O A;  2YTX A;  4BA2 I;  5G3L D;  2K52 A;  1I3Q H;  2ZXO A;  4KHV A;  5M5X H;  3Q22 A;  1DON A;  1IYV A;  1SDF A;  2VQF Q;  1X3E A;  1I4R A;  5IOD A;  1WOC A;  1V1O A;  2FMC A;  3G71 A;  4J6H A;  2EYP A;  4RGT A;  3HOY H;  3K81 C;  5M3F G;  4IUN A;  4IUU A;  4RH6 A;  5HY6 A;  1HR0 L;  1RDP D;  2SEB D;  5A2Q L;  4UDU C;  2B8F A;  1L0W A;  3Q0A A;  2NB0 A;  1CSQ A;  2L5T A;  4PNY A;  4A3K B;  2LS0 1;  3KLS A;  1B2T A;  1VF7 A;  2R93 H;  2F52 A;  1VQ8 A;  5E4X A;  2RQX A;  3PGZ A;  3LWU A;  1QWY A;  3PO2 G;  5CV6 A;  2IY5 B;  4DXF A;  5E7N A;  2JJQ A;  3HP3 A;  5EBC A;  3C2P A;  1A8V A;  1PH6 A;  1KAB A;  2D62 A;  5CGK A;  5C4X B;  3TP7 A;  3J81 c;  2EE1 A;  4OGQ C;  4P75 A;  4BY7 G;  3DM1 A;  3VDY A;  2N3S A;  4IPG A;  3HOU G;  2JA5 B;  1HUN A;  1VMP A;  1DXM A;  1BQQ T;  4DAY B;  2NVQ B;  3STB C;  3D4W A;  1IZ6 A;  4A3E B;  2DN8 A;  1EEI D;  2LFN A;  1WTX A;  2R6G A;  4GNX B;  3MEF A;  3L2P A;  3MHB A;  2Y0S E;  3TBI B;  5M5W H;  2QIL A;  4QUF A;  4P74 A;  1SMY C;  4A3G H;  2EVB A;  3HOX H;  2BE5 C;  1CSP A;  1EY5 A;  1EZ6 A;  4LFC Q;  1DYQ A;  3FKI H;  3IFD A;  3D8G A;  1TR5 A;  4K5X A;  1VQK A;  1TWC H;  1PTO H;  2K5H A;  5COR A;  5J3B A;  4XT1 B;  1NMG A;  3QB3 A;  2RCN A;  1C4Q A;  1WTR A;  1I94 Q;  4IUP A;  3CD6 A;  1Q12 A;  5M3F B;  1N33 Q;  4DNI A;  2B2V C;  1S4Z A;  4A3B H;  1Y1V H;  1EYC A;  1K83 H;  4WJW A;  4TKO B;  4LF7 Q;  1ML0 D;  5JEA J;  2UXC Q;  2HDM A;  3M3Y B;  2KUM A;  2I5L X;  1TKW B;  4LUO A;  5IP9 H;  2VQE Q;  4OIK A;  1A62 A;  3CU7 A;  3V2T A;  4JBW A;  4RGO S;  4Z9C B;  4JV5 Q;  2JN4 A;  4NXN Q;  3DM3 A;  1X56 A;  3PO2 B;  1ET6 A;  1VQ5 A;  3OTO L;  4XQN A;  4M8A A;  1IW7 C;  2CHB D;  4BY7 B;  5FLM H;  1PFN A;  2Y0S G;  3HOU B;  2FHT A;  5DLQ E;  4R1J A;  3T1H L;  3EFX D;  4JI5 L;  2KHJ A;  3NXW A;  3UI2 A;  1CHP D;  4C3J G;  2NN6 H;  4K0K Q;  1XMQ Q;  1N32 Q;  3CQZ B;  1B50 A;  4A76 A;  1Q81 C;  1K0R A;  4N8X 1;  4ZCK A;  3CC4 A;  4A3C G;  1YJW A;  1N36 L;  1D1K A;  4LF5 Q;  1YNN C;  4C3I G;  4XTC S;  4CHT B;  4GKK Q;  3TSS A;  1IYU A;  2A68 D;  4F88 A;  1AZQ A;  1EWH A;  4XYO A;  3MTS A;  1I4H A;  1S3O A;  2F4V Q;  4A3F G;  4HJ9 A;  3TP6 A;  1RKN A;  2LXJ A;  4A3D G;  1STA A;  1HFN A;  1E1T A;  3MEH A;  4F87 A;  4DV6 Q;  5J1Z A;  2QCP X;  4IZ8 A;  1H9R A;  4N8F A;  2K05 A;  2QGQ A;  3I4O A;  2VW9 A;  2HIX A;  4DV4 Q;  2B2U A;  4NXM L;  2IX3 A;  1LTL A;  2K5D A;  1G51 A;  1HZ9 A;  3NK9 A;  2B63 H;  1TS3 A;  2Z6K C;  3BDL A;  4JI8 Q;  4PZ8 A;  5IY0 A;  1D6E C;  4UPA A;  2HCI A;  4F7X A;  2BOS A;  4FF1 A;  3I8Z A;  5JJL A;  1B8A A;  4TRD A;  2I07 B;  2Y0S B;  2QDL A;  4TSS A;  3QWN A;  2ZJP A;  4GKJ Q;  3RZO B;  1QNU A;  4FF2 A;  1S72 A;  3NTK A;  1VQB A;  1BCP B;  3R8B A;  4C3J B;  3HFZ B;  4DU9 A;  4ABN A;  5KGU A;  4LF8 L;  3N52 A;  3CCS A;  5BN5 A;  1F9P A;  4KLK A;  3RD4 A;  3M4O B;  4KKU A;  1RJT A;  1CI3 M;  4DV2 Q;  3OWF A;  1GVP A;  1SYB A;  2E2D C;  2BA1 A;  4IUT A;  2JA8 H;  4CDD C;  4C3I B;  1FL0 A;  1EQQ A;  1LT6 D;  2FMM A;  1D5M C;  3GTM B;  1FNV A;  3M85 A;  2EY2 A;  4ZYS A;  2IT1 A;  1V43 A;  2EQS A;  5FLX E;  1Q8K A;  4B3T L;  5EGT A;  2UUB L;  4A3F B;  5E3F A;  1DOM A;  2DNE A;  3QO2 A;  3PIO 3;  4C1N K;  4A3D B;  5KNC A;  4LFA L;  3RN2 A;  3KF6 B;  3I4M G;  1D2B A;  2WFW A;  3HKZ E;  3CPW A;  2IPK D;  1EWI A;  3SVM A;  2F0I A;  1UAP A;  1RD9 D;  4PG3 A;  2R92 B;  4J15 A;  2D2C C;  2K7V A;  3VR4 A;  2JA6 B;  4BXX G;  3UDI A;  3NBI A;  3ZJY C;  4JVZ A;  2L15 A;  2UXD Q;  4BA1 I;  1UEA B;  2RBM A;  2WB1 E;  4KD3 A;  4IOA A;  5C0X J;  5T1G A;  5GAD C;  2YU9 B;  1NAP A;  1LV9 A;  3MZ5 A;  4DR6 L;  1U5K A;  5GAG C;  1WTW A;  3OYY A;  1LAC A;  3N6R A;  2K03 A;  1LTG D;  2B8G A;  3GTO H;  5G3L F;  5GRO A;  1G2T A;  1MJE A;  1B4O A;  2RCF A;  2EIF A;  1TS2 A;  5M3M G;  2E2H H;  2F0T A;  1VQ7 A;  2TMP A;  3A7A B;  2N49 A;  3CCQ A;  2K50 A;  2DY8 A;  1HR0 W;  1O7I A;  2XVS A;  2DGY A;  4EVO A;  2CQO A;  1JOO A;  4OWX B;  1K8G A;  5KYL A;  2F0N A;  4POF A;  1G2S A;  1Z7T A;  3R2T A;  4YY3 Q;  5EKI A;  1PTO D;  3HKZ G;  3DLL A;  2F3V A;  2H5X A;  3BDO A;  2ZM6 Q;  1C8C A;  3BZK A;  1G6Z A;  2A6H C;  2K04 A;  5IYC H;  4JI7 L;  2UXB L;  3HKS A;  4K6L A;  3U4Z A;  2OF1 A;  1JJ2 A;  4JI6 Q;  4JI3 L;  2YV5 A;  5JEA G;  3PO3 H;  4HSV A;  3I4M B;  3EN2 A;  4BY1 G;  2E5L Q;  4KJN A;  1IBM L;  2G9H D;  3NPP A;  3CMA A;  2VQF L;  3JAM L;  1LO5 D;  1I5F A;  3K59 A;  2J7Z A;  1YEZ A;  3S1N B;  2E2I B;  1A3T A;  1VQE A;  1SE8 A;  2EY1 A;  2RHQ B;  4KD4 A;  3TRE A;  3S2D B;  1KDA A;  5IGF A;  5C44 H;  1U4R A;  1SRO A;  2KA7 A;  2CQA A;  1HPC A;  3A54 A;  3SK8 A;  2R93 G;  2VUM H;  3M7N A;  5COY A;  3T16 A;  2L9H A;  2A69 D;  1UWV A;  3GO5 A;  4ZRZ A;  3I72 A;  3H0G H;  4V0B A;  2B2W C;  5M3M B;  1HZB A;  3GTJ H;  3PUZ A;  1LTI D;  5FO8 B;  5M5Y B;  3MXP A;  3RLN A;  3OIP A;  1NBW A;  3PUY A;  3T1H Q;  1YNX A;  1OXX K;  3G48 A;  3HOW G;  4FDB A;  2F0E A;  1K28 A;  4EQO A;  4YCU A;  2EJG C;  3S1M H;  5C3E B;  3HKZ B;  4G7O C;  2L55 A;  1MSH A;  3F2C A;  3CF5 A;  3HGB A;  4R4C A;  5K36 H;  5IT9 L;  1CTM A;  2QW7 A;  1Y1W B;  3S15 B;  3AMU A;  3JAM E;  5K5P A;  2WB1 B;  2D5D A;  1K8A C;  4FYD A;  4GN3 B;  4BY1 B;  1AP0 A;  3OIQ A;  1X9N A;  1PZJ D;  2GN5 A;  1RTO A;  4G4K A;  3K7A H;  1IBK L;  4LFC L;  3SHL A;  2EYF A;  3NHH A;  1V8Q A;  3I4N H;  1TWA H;  4HAE A;  4A3B G;  1Y1V G;  4RCN A;  5FLX c;  1GUO A;  1EFW A;  4HTH A;  4A3M G;  1HHV A;  2JA7 H;  2AHO B;  1XTD A;  2QEX A;  5ELN A;  3AEV A;  4NXM Q;  1N33 L;  1PDQ A;  1MKH A;  2NWG A;  4IJH A;  1S5B D;  2MNA A;  1TWH B;  1F2Y A;  4LF7 L;  2GVA A;  3S14 H;  1OXT A;  3C46 A;  5EPJ A;  4YCV A;  2WII B;  1MHW C;  2VQE L;  3T1Y Q;  3M4P A;  3NEM A;  1MI2 A;  4GS3 A;  3GTP B;  1SE3 A;  1O80 A;  4NXN L;  4RAU C;  5ELC A;  3CCJ A;  3D0F A;  1EIG A;  2JEA I;  4HIK A;  1EIY B;  2OEO A;  1YHA A;  4ID6 A;  2JA6 H;  1Q90 A;  5C3X A;  5CR3 A;  1O78 A;  2EXZ A;  3HOW B;  3TRZ A;  5IT9 E;  1JE5 A;  3SDZ A;  4B08 A;  3BU2 A;  2F0L A;  2RDG A;  2ZT9 C;  1N32 L;  1XMQ L;  3A74 A;  4IUV A;  1NUC A;  2KEC A;  3CME A;  4R9W A;  2A8V A;  4JYA Q;  1J8I A;  1L0X B;  1PRT D;  3CC2 A;  2XIW A;  1SR3 A;  3M9B A;  3RNU A;  1OXV A;  4LF5 L;  5EAY A;  1I6V C;  3LGJ A;  4GKK L;  2OTJ A;  3MFG A;  4ZAI A;  1CKN A;  5ELF A;  1KLU D;  2JK8 A;  4YWK A;  2CH4 A;  3D31 A;  1CHQ D;  1O7Z A;  2NVT B;  5C0X G;  2VY3 A;  3GTL H;  3CCV A;  4AYB E;  3EBE A;  1A3V A;  3B6Y A;  1C48 A;  4Q5V A;  1LTT D;  1X54 A;  1BKB A;  4BBR G;  3I55 A;  1H9M A;  4IFD H;  1KRS A;  3EA6 A;  4A3M B;  2F3W A;  4NB3 A;  1B1Z A;  4DV6 L;  2PPB C;  2FJ2 A;  1CK1 A; 
#chains in the Genus database with same CATH homology
 4JI2 L;  1D8L A;  1VQI A;  3MEF A;  4AQY L;  3L2P A;  4B3S Q;  4POG A;  2Y0S E;  4JOI C;  4YCW A;  2I0Q A;  4AIM A;  3L0O A;  1TWG H;  5M5W H;  4DV4 L;  4DR5 Q;  2AKW B;  1K3R A;  3KDF B;  4P74 A;  3IRB A;  4DUY L;  1XPR A;  3CCL A;  4A3G H;  4H02 A;  1C7Y A;  4OON A;  1HZC A;  1N34 L;  3M4Q A;  2HHH L;  3HOX H;  2UUA Q;  2R7Z G;  1I50 H;  1CSP A;  3Q8D A;  1XPO A;  2RHS B;  4LFC Q;  3FKI H;  1VQK A;  2BH2 A;  3F8T A;  1VQ6 A;  1TWC H;  3K80 C;  3GTQ H;  4IFD G;  2K5H A;  2KCM A;  1GO3 E;  2VZA A;  5J3B A;  2VS1 A;  4JI8 L;  4HIM A;  1NMG A;  4B3R L;  4QJF A;  2RCN A;  5LMU L;  4DUZ Q;  1VQP A;  4C3H H;  1VQG A;  3KLW A;  4UP7 A;  1I94 Q;  3CD6 A;  1Q12 A;  1G29 1;  1N33 Q;  4DNI A;  4GN4 B;  1JMC A;  4A4I A;  4A3B H;  4TQU S;  1Y1V H;  4R4O A;  3HOV H;  1WYD A;  1K83 H;  4A3G G;  2NVX H;  4LF7 Q;  4IJL A;  3AFP A;  5JEA J;  3HOX G;  3WWV A;  3S1N H;  3AQQ A;  4GKJ L;  4OXP A;  2UXC Q;  3FKI G;  3F2D A;  2I5L X;  3RZO H;  4LUO A;  2VQE Q;  5IP9 H;  4X66 Q;  4ALP A;  2EXD A;  4HID A;  1A62 A;  1S40 A;  4L5R C;  4JBW A;  3S1R H;  3KF8 B;  4C3J H;  1FJG L;  4JBJ A;  1JJC B;  4AYB G;  5AJ3 Q;  1BBU A;  4JV5 Q;  1UE6 A;  4NXN Q;  3K7U C;  4DR7 L;  3DM3 A;  1X56 A;  3M4O H;  1Q46 A;  1Q1E A;  2B29 A;  1VQ5 A;  1PH3 A;  3OTO L;  1SLJ A;  2B3G A;  1J6Q A;  4ME3 A;  4DV3 Q;  4A3C H;  5FLM H;  1XMO L;  1GKH A;  1N9W A;  2Y0S G;  3F1Z A;  4C3I H;  4X62 L;  4IO9 A;  2KEN A;  1OXS C;  2MO0 A;  3ULP A;  1HR0 Q;  5DLQ E;  1X6O A;  5IP9 G;  2UUC Q;  3K8A A;  4R1J A;  3GTM H;  3T1H L;  1XNQ Q;  4JI5 L;  2N8N A;  2KHJ A;  3KF6 A;  4JG2 A;  1LM0 A;  1VQJ A;  4QGU A;  1XMQ Q;  2BH8 A;  2MQH A;  1J5E Q;  3PIO A;  3HOZ H;  4A93 H;  4K0K Q;  1N32 Q;  1AH9 A;  1YJ9 A;  4A3F H;  3ICE A;  1UEB A;  4GLX A;  2ZJQ A;  4A3D H;  4DV1 Q;  1KC8 C;  4UY8 C;  4QL5 A;  3CP0 A;  3JAM c;  4A76 A;  1Q81 C;  3S16 H;  2AWN A;  2KBN A;  4OX9 L;  2Q2I A;  4A3J H;  1K0R A;  4IPD A;  1PH5 A;  1VQA A;  3CC4 A;  4A3C G;  1YJW A;  2VL6 A;  5FLM G;  1N36 L;  4LF5 Q;  4KHP L;  5JJK A;  4XTC S;  4GKK Q;  4JI0 L;  3ERS X;  2R92 H;  2UXD L;  1HZA A;  4O2D A;  1W3S A;  1VQH A;  4X64 L;  1E22 A;  2NN6 G;  1MJC A;  1S3O A;  3PCO B;  4A93 G;  3HOZ G;  4B3M L;  1CKN B;  2F4V Q;  4A3F G;  3CCR A;  3K0X A;  4HJ9 A;  1YIJ A;  1D7Q A;  4X65 Q;  2OQ0 A;  2LXJ A;  1NE3 A;  1SRU A;  3U50 C;  4A3D G;  5IWA Q;  4C2M H;  1A0I A;  1YI2 A;  2YU9 H;  1YZ6 A;  1E1T A;  2IX0 A;  2GVB A;  5C3E G;  2I5M X;  5LMN L;  4DV6 Q;  3UDF A;  3H15 A;  4A3J G;  1KD1 C;  4GOP C;  1ASZ A;  3J80 i;  4JI2 Q;  4A3I H;  1UE5 A;  3PIP A;  3CCM A;  4AQY Q;  2XGT A;  1PH4 A;  1IL2 A;  1XPU A;  2QGQ A;  2PQA A;  3I4O A;  2VW9 A;  2HIX A;  4LNQ A;  3H3V I;  1OXU A;  4O0A A;  4DV4 Q;  1VQM A;  4NXM L;  2KCT A;  3E0E A;  1EIF A;  1X3G A;  3EIV A;  4DUY Q;  1LTL A;  1Y1W G;  1G51 A;  1HZ9 A;  3E9H A;  1N34 Q;  2MFI A;  3S2H H;  3A0J A;  2WB1 G;  3ULL A;  4OO1 I;  1L1O A;  2B63 H;  2Z6K C;  3L7Z C;  3PF5 A;  1EUJ A;  3UDX A;  1Q82 C;  1HNX L;  2OTL A;  4JI8 Q;  4GLV B;  4LF4 L;  4PZ8 A;  2MO1 A;  2ZJR A;  3UDG A;  4B3R Q;  5LMU Q;  5IY0 A;  4IOC A;  4A3I G;  2XTI A;  2JE6 I;  4YY3 L;  4UPA A;  3RLF A;  3NBH B;  1K73 C;  3S1Q H;  5JJL A;  1B8A A;  5IT9 c;  4KHZ A;  1Z47 A;  2E8G A;  2ZTC A;  4LFB L;  4JBM A;  2ZM6 L;  4GKJ Q;  2ZJP A;  1BBW A;  1WJJ A;  4HJ8 A;  1C9O A;  3NEN A;  1VQ4 A;  4DR2 L;  3KJP A;  1S72 A;  2B63 G;  4GNX B;  1VQB A;  1IBL L;  3FP9 A;  3FHW A;  3W1G A;  1P16 A;  3HFZ B;  4PZ6 A;  2ID0 A;  1DGS A;  4GNX C;  2K75 A;  4JI6 L;  1IBK Q;  4LF8 L;  3CCS A;  2E2J H;  5GAE C;  2CKZ B;  4KLK A;  1FJG Q;  1QUQ A;  3GTK H;  4LUZ A;  2E5L L;  1VQC A;  1EOV A;  1PH9 A;  1Z9F A;  3I4M H;  3SGI A;  4DV2 Q;  1WCM H;  1TWF H;  1ASY A;  1IXR A;  1BVS A;  2Z6K A;  4DR4 Q;  1GVP A;  2LSS A;  4YWL A;  1VQD A;  2NZO A;  2BA1 A;  1XNR L;  4LF9 L;  2JA8 H;  4A75 A;  3CW2 C;  3OTO Q;  1FL0 A;  1EQQ A;  4GLA C;  2K5V A;  4APV A;  4A3L H;  1UE7 A;  5C44 G;  3M85 A;  4BXX H;  4MZ9 A;  1KXL A;  2IT1 A;  1XJV A;  1V43 A;  2ES2 A;  2EQS A;  2V1C C;  3GTG H;  1Q8K A;  4JI5 Q;  1QVC A;  4B3T L;  2E2I H;  2UUB L;  4HJ5 A;  3PUX A;  3W1B A;  1GD7 A;  1QVG A;  1N8R C;  1V9P A;  4JOI A;  2VUM G;  2AMC B;  3KYH C;  3S2D H;  1Q1B A;  4LFA L;  3RN2 A;  3KF6 B;  3I4M G;  1WCM G;  1YJN A;  3H0G G;  4OWW B;  2WFW A;  2FXQ A;  3HKZ E;  4DK3 C;  1E7Z A;  4PZ7 A;  3CPW A;  1WI5 A;  4L5S A;  2JA8 G;  1EWI A;  2YYZ A;  1VQL A;  1HJP A;  2CWA A;  3MXN B;  4PG3 A;  1VQO A;  5C0X I;  4J15 A;  1N36 Q;  1YHQ A;  1JB7 A;  4A3L G;  4Y7N H;  4BXX G;  1LYL A;  4KHP Q;  3UDI A;  3ZJY C;  1VCI A;  4DV7 L;  2L15 A;  3CAM A;  2UXD Q;  2Q2H A;  4BA1 I;  5FJ8 H;  5M3M H;  2WB1 E;  4IOA A;  3UE0 A;  3TS2 A;  5C0X J;  1P8L A;  4B3M Q;  5M5Y H;  1FVI A;  1X3F A;  4JC0 A;  5GAD C;  3CPF A;  3PV0 A;  1B7Y B;  4DR6 L;  4LWC A;  3E9I A;  1U5K A;  3I2Z A;  5GAG C;  3OYY A;  2ZTE A;  3J81 i;  1B70 B;  3TEH B;  1V1Q A;  5HGQ A;  1PH7 A;  2HQL A;  4DR3 L;  4JBK A;  4JCV E;  2N78 A;  4L5Q A;  4DAM A;  3GTO H;  5GRO A;  1MJE A;  1CKO A;  1SFO H;  2EIF A;  5FJ8 G;  3ULJ A;  5C3E H;  1I94 L;  2Q2U A;  3J7A 5;  3ER0 A;  1VQN A;  3PF4 A;  5M3M G;  4IFD I;  3JC6 6;  2E2H H;  4HJ7 A;  1JJG A;  1VQ7 A;  2D0O A;  1PYB A;  2PQA B;  2N49 A;  3TS0 A;  3CCQ A;  2QA4 A;  3OW2 A;  2K50 A;  1Q86 C;  1O7I A;  4R4I A;  3RZD H;  1HR0 W;  2DGY A;  2UXC L;  2CQO A;  5IYD H;  3J7Z C;  2I5H A;  4IFD J;  4OWX B;  1Y1W H;  1K8G A;  4LF4 Q;  3S15 H;  4R4Q A;  3UE1 A;  1L1O B;  2K14 A;  4Y52 H;  4POF A;  3CCU A;  1VS0 A;  2NZH A;  4EX5 A;  4KI0 A;  4BY1 H;  2PI2 E;  4YY3 Q;  4JV5 L;  4WJ3 M;  3HKZ G;  1NMF A;  5IYB H;  1VQ9 A;  4JI4 L;  3DLL A;  4LFB Q;  2H5X A;  4UP9 A;  1U0L A;  2ZM6 Q;  3BZK A;  4QIW E;  4DV0 L;  5IYC H;  4DR2 Q;  1PHJ A;  4JI7 L;  3CXC A;  4LF6 L;  2UXB L;  2VNU D;  5IYD G;  4L5T A;  2OWO A;  1X65 A;  3HKS A;  2ALY B;  4IPH A;  3U4Z A;  1JJ2 A;  2RF4 A;  5GQO A;  4JI3 L;  2HHH Q;  2YV5 A;  4JI6 Q;  4LF8 Q;  3CCE A;  5JEA G;  3PO3 H;  4BBS H;  3EN2 A;  4BY1 G;  2E5L Q;  1PH2 A;  1PV4 A;  4K0K L;  1TWH H;  2PI2 A;  1EYG A;  1IBM L;  2R7F A;  1KRT A;  3T1Y L;  2NVY H;  5IYB G;  1QUQ B;  1MIU A;  4UP8 A;  1HNZ L;  4LF9 Q;  1E1O A;  2UU9 L;  1E24 A;  1NTG A;  1YVC A;  4XIG S;  2VQF L;  3CMA A;  2AWO A;  2IHF A;  5IYC G;  1W2B A;  1I5F A;  3I56 A;  1YEZ A;  3GD7 A;  3GTP H;  1KL9 A;  1VQE A;  1SE8 A;  2K5N A;  3PUV A;  3PSI A;  2RHQ B;  1PH8 A;  1OTC A;  2JQO A;  4GOP A;  4B3T Q;  4QQB X;  3TRE A;  4IPC A;  3U4V A;  2UUB Q;  3PO3 G;  4BBS G;  2YTV A;  5C44 H;  1M1K C;  2ATW A;  5GAH C;  1AE2 A;  2F3I A;  4LFA Q;  1SRO A;  1E3P A;  1PYS B;  3A5Z B;  1GM5 A;  1CUK A;  2F4V L;  5JJI A;  5BR8 L;  4DV5 L;  2R93 G;  4DR1 L;  3HOW H;  2VUM H;  3M7N A;  1H95 A;  4OWT B;  1K9M C;  3NEL A;  1C0A A;  2IX1 A;  4DR7 Q;  2NN6 I;  1UWV A;  3GO5 A;  3KJO A;  1PH1 A;  4HIO A;  3H0G H;  4MTN A;  3GTJ H;  4DV7 Q;  1HZB A;  4A3K H;  1PFS A;  4JYA L;  3A5U A;  3PUZ A;  3CC7 A;  2OQK A;  4R4T A;  1XMO Q;  4X62 Q;  3RLN A;  1IBL Q;  2DUD A;  1RL2 A;  3JAM i;  4RMF A;  3RN5 A;  4NPS A;  1NBW A;  3PUY A;  3BZC A;  2WAQ E;  5IP7 H;  3T1H Q;  2Z0S A;  1YNX A;  2CFM A;  1OXX K;  3G6E A;  4DR6 Q;  3G48 A;  3HOW G;  4JI1 L;  4FDB A;  2K4K A;  5C4X H;  3J80 c;  2KHI A;  1Y14 B;  3KFU A;  5IE8 A;  4YCU A;  5ELO A;  3RLO A;  4DR3 Q;  2JA5 H;  3S1M H;  1RIP A;  2NVT H;  3RR5 A;  1T9H A;  3H3V H;  4YHH L;  4DPG A;  3F2B A;  4A3K G;  4GNX A;  1HNW L;  4OX9 Q;  2C35 B;  2CWP A;  3F2C A;  2NVQ H;  3CF5 A;  4A3E H;  1A63 A;  1AE3 A;  4R4C A;  2OCE A;  4A3M H;  4JI0 Q;  3KDF A;  4B3S L;  5IP7 G;  1CKM A;  2LXK A;  1KAW A;  3BJU A;  1UE1 A;  4X64 Q;  1SN8 A;  1K8A C;  4DR5 L;  1VQF A;  3W5O A;  5C4X G;  4GN3 B;  4QY7 A;  1PVO A;  1X9N A;  2GN5 A;  2JA5 G;  3S17 H;  3K7A H;  1IBK L;  2UUA L;  2JEB I;  4HJA A;  4LFC L;  2ASB A;  1M90 C;  5C4J H;  5LMN Q;  2IHE A;  1NJI C;  4JI4 Q;  4DV2 L;  3I4N H;  4DR4 L;  2PNH A;  1TWA H;  4A3E G;  4A3B G;  3HOV G;  1Y1V G;  5FLX c;  5K36 G;  1EFW A;  4A3M G;  4DUZ L;  2JA7 H;  1NY4 A;  4OO1 G;  2Q2T A;  4X6A H;  2AHO B;  1WFQ A;  1XTD A;  2A1A A;  2QEX A;  5ELN A;  4DV0 Q;  4JI7 Q;  4LF6 Q;  4NXM Q;  3AEV A;  2UXB Q;  1N33 L;  1TXY A;  5H1S E;  3G4S A;  1MKH A;  2WP8 J;  4LUV A;  4P71 A;  4IJH A;  2MNA A;  5M3F H;  1EQR A;  4JI3 Q;  2HIV A;  4LF7 L;  2GVA A;  1L2F A;  3S14 H;  1OXT A;  4YCV A;  4P73 A;  1YHB A;  1I6H H;  4MNO A;  1HNX Q;  2WAQ G;  1SMX A;  1IBM Q;  2VQE L;  4X66 L;  3T1Y Q;  2YTX A;  4BA2 I;  3M3Y H;  1X55 A;  3I4N G;  1HNZ Q;  2K52 A;  1I3Q H;  3PUW A;  5LMN W;  3M4P A;  5M5X H;  1KIX A;  2UU9 Q;  1HH2 P;  3NEM A;  4GS3 A;  5AJ3 L;  1X3E A;  2VQF Q;  2JA7 G;  1IYJ B;  2CCZ A;  4NXN L;  3U58 A;  1WOC A;  3CCJ A;  4DK6 C;  1L1O C;  3G71 A;  3D0F A;  2JEA I;  3HOY H;  4HIK A;  3K81 C;  5M3F G;  1EIY B;  4LW1 A;  3PO2 H;  2JA6 H;  1YHA A;  2A19 A;  3GDE A;  3KOJ A;  1KHI A;  4DV3 L;  1JT8 A;  1R9T H;  4PMW A;  5HY6 A;  3TQY A;  1PA6 A;  4GOP B;  1HR0 L;  1QZG A;  4TVA B;  2UUC L;  1JE5 A;  2ZTD A;  3TRZ A;  1QZH A;  5BR8 Q;  4DV5 Q;  4BY7 H;  4DR1 Q;  1XNQ L;  1KQS A;  2BA0 A;  3HOU H;  3BU2 A;  1L0W A;  4DKA C;  1N32 L;  1CSQ A;  3STB D;  3A74 A;  3J81 j;  1XMQ L;  1J5E L;  4WJ4 A;  2HT1 A;  1QVF A;  1G6P A;  2R93 H;  2F52 A;  2D0P A;  3CME A;  1VQ8 A;  1XNR Q;  4EQ5 A;  4BBR H;  3PGZ A;  2A8V A;  4JYA Q;  3CQZ H;  4DV1 L;  3HOY G;  2JA9 A;  3CC2 A;  2R92 G;  3PO2 G;  2IY5 B;  2JA6 G;  5E7N A;  2JJQ A;  1SR3 A;  3M9B A;  3RNU A;  1OXV A;  2R7D A;  4P72 A;  4LF5 L;  1A8V A;  4GN5 A;  5EAY A;  1PH6 A;  2D62 A;  3LGJ A;  4GKK L;  3J81 c;  4BY7 G;  4P75 A;  2OTJ A;  2YTY A;  1CKN A;  3VDY A;  2N3S A;  2JK8 A;  4IPG A;  4YWK A;  3D31 A;  4JI1 Q;  3HOU G;  3S24 A;  5C0X G;  2VY3 A;  3GTL H;  3CCV A;  3AYH B;  4AYB E;  1Q7Y C;  3EBE A;  1YIT A;  1FGU A;  3B6Y A;  4DAY B;  2R7Z H;  4X65 L;  4YHH Q;  1X54 A;  3STB C;  1IZ6 A;  1BKB A;  4BBR G;  3I7F A;  5IWA L;  3I55 A;  1HNW Q;  4YWM A;  1KRS A;  4NB3 A;  2PMZ E;  3AFQ A;  4RG1 A;  1YBY A;  4DV6 L;  2R6G A;  1LUZ A;  4AH6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...