1KRSA

Solution structure of the anticodon binding domain of escherichia coli lysyl-trna synthetase and studies of its interactions with trna-lys
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
110
structure length
110
Chain Sequence
FRRDHTSDQLHAEFDGKENEELEALNIEVAVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDDLPEGVYNEQFKKWDLGDILGAKGKLFKTKTGELSIHCTELRLLTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSYL-TRNA SYNTHETASE (PRODUCT OF LYSS GENE)
publication title Solution structure of the anticodon-binding domain of Escherichia coli lysyl-tRNA synthetase and studies of its interaction with tRNA(Lys).
pubmed doi rcsb
source organism Escherichia coli
molecule tags Aminoacyl-trna synthetase
total genus 14
structure length 110
sequence length 110
ec nomenclature ec 6.1.1.6: Lysine--tRNA ligase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1krsA00
1GD7A 1IXRA 1Y1VG 3S16H 3OTOL 4L5QA 4A76A 1GKHA 4P72A 1UE6A 5C4JH 4ALPA 1XNQQ 3U4VA 4BY7G 4QL5A 3CMAA 1Y1WH 1QUQA 1IBKL 4LF8Q 2JA8G 4AIMA 1NMGA 1BVSA 5FLMH 3GTOH 1X3FA 1NTGA 1HR0L 4R4QA 1BKBA 4DAMA 1N36Q 2E2JH 3HOUH 4R4CA 3HOWH 5HY6A 4IPHA 1HNWQ 3PIOA 3CCVA 1XTDA 4MTNA 1IBML 3BU2A 4A3EH 1CKMA 4NXML 1CKNB 4LF6Q 3UDFA 2ZTEA 3E9IA 4JI1Q 1X55A 1YHAA 3CP0A 4P75A 2AKWB 1A62A 1O7IA 1QVCA 5IP9G 5IP7H 3CCEA 4A3KH 1VQNA 3M4OH 1XNRQ 1VQCA 3M85A 4X6AH 2KCMA 5M3MH 4JI5L 2EIFA 1B7YB 2GVBA 5JEAJ 2CCZA 4JC0A 4LF4L 4JI2Q 1X54A 1FGUA 4PZ6A 1J5EL 1JB7A 1N32Q 4DV2Q 1PYBA 4JCVE 3CCUA 1N33Q 2WP8J 1A63A 1KXLA 2PI2E 3AQQA 1E22A 4A3DH 1WFQA 2ZTDA 2JK8A 2YYZA 2K75A 2R93G 5LMNQ 2YTYA 3NBHB 4IJHA 3RN5A 1B70B 1NMFA 1EQQA 2E2IH 2PNHA 4A3LH 2HHHQ 1PFSA 4JV5Q 3F2CA 1Q1EA 3EBEA 1V9PA 1X56A 2F4VL 4UP8A 5GAGC 3SGIA 1VQOA 2EXDA 4JI8Q 4A93H 4K0KL 2EQSA 3CC2A 4HJ5A 3KJPA 1VQPA 2OWOA 1CSQA 2MO1A 3PO2G 1NJIC 5C3EG 1YHQA 3TS0A 3HOUG 3G4SA 1CSPA 3TS2A 4OO1G 3KYHC 4DV5L 4UP9A 1S40A 3A0JA 1TWGH 5LMUL 4B3TQ 4JI7L 4LNQA 3TRZA 3DM3A 4DR6L 2UUCQ 2A8VA 4A3GH 1KD1C 3PSIA 3FKIG 5JJKA 1NBWA 3M9BA 4X64L 2GN5A 4A3KG 2KHIA 4P73A 4DV0L 3CCLA 4HIMA 3U58A 4BA2I 1EFWA 4YWMA 4X62L 3HOXG 2JA5H 2Y0SE 4JI0L 4LFCL 4EX5A 3I56A 2ZM6L 3HOZG 1ASZA 4A3JG 2R7FA 2B63H 3S15H 2BA0A 4DV1L 3WWVA 2V1CC 2R92H 4A3DG 4DV4Q 4DUYQ 4OX9L 2LXKA 3PUYA 4BBSH 4BXXG 1PH8A 1S3OA 1L1OA 3CCRA 2IT1A 2DUDA 2LSSA 3CAMA 3S2HH 1GO3E 3BZCA 4DK3C 4DR3Q 3G48A 3K8AA 4H02A 2QEXA 3HKZG 1C7YA 4A3BG 2NN6I 1UWVA 3J81i 1TWHH 1IBLL 4KHPQ 1Q8KA 1SN8A 3B6YA 1MJCA 4GLVB 3K81C 4GKJQ 1Q46A 2WB1E 1FJGL 4IPCA 4C3IH 1E7ZA 1Q86C 3Q8DA 1HJPA 4A4IA 4A3IG 4GNXA 4NB3A 3GTMH 3J7A5 2NZOA 3F1ZA 5JJIA 5IYDG 4HIKA 3CPWA 3HOVH 4LFBQ 3PGZA 1SE8A 3T1YL 1HNZL 1FVIA 3I4MH 4A3GG 3F2DA 1SLJA 3BZKA 3KLWA 3BJUA 1BBWA 3UE1A 4GOPB 1P8LA 1HZBA 3CCMA 5FJ8G 1Q7YC 1OTCA 2NVQH 2KENA 3FP9A 2B63G 3F2BA 1L1OC 4R4IA 4P74A 3RLFA 2VQEQ 1VQ6A 4DR5L 3OW2A 1IBKQ 2BH8A 3NELA 4DV3L 1VQGA 2K5VA 3RR5A 1HR0Q 2YTVA 2YV5A 2JEAI 3GTGH 4OO1I 1PVOA 4HJAA 4DR7L 4LUVA 4X66Q 2ID0A 1R9TH 3ULPA 1IBMQ 3MEFA 4DV6L 2HQLA 4NXMQ 1T9HA 1V1QA 4R1JA 4IFDG 4AQYL 1C9OA 3CXCA 3I4NH 3S1QH 4IFDJ 2VZAA 3GDEA 4BBRH 2Y0SG 3A5ZB 5BR8L 1XMOL 1L0WA 5M3FG 4PZ7A 1YBYA 2F3IA 3JAMc 1PH4A 3W1BA 1YNXA 2QGQA 3KF8B 3TQYA 3UE0A 2ZJRA 2D62A 1J5EQ 2CQOA 1LYLA 1N34L 2JQOA 5H1SE 4TQUS 4IJLA 5C44H 4UY8C 2JA6G 3KF6A 3H0GG 2B3GA 3KOJA 4NXNQ 1J6QA 1D8LA 2BA1A 3HOVG 3L7ZC 4GN5A 1K73C 3I4MG 1UE1A 3L0OA 1EYGA 1WI5A 1CKOA 1PH7A 3CC4A 1MIUA 3W5OA 2ALYB 1AE2A 3KDFB 1JMCA 4LUZA 3HOYH 3PUWA 4JI4L 3J81j 1XJVA 4IOCA 1I50H 2RCNA 4JBMA 4LFAL 3AFPA 4K0KQ 1AE3A 3PF4A 4JYAL 1C0AA 2IHFA 2L15A 3T1HL 2NN6G 1OXUA 5HGQA 2UUBL 4OWWB 2CWAA 1K8GA 4POFA 1PV4A 2VQFL 1VQ9A 4QIWE 1IL2A 4AH6A 2UUAL 2OCEA 4JI7Q 5LMUQ 3J81c 3DLLA 4DPGA 4PZ8A 3S1RH 1SRUA 4KLKA 1RIPA 2UU9L 4DR4L 4X64Q 4UPAA 1P16A 4A3FH 1YITA 4GLAC 1GVPA 3GTJH 4DV0Q 3E9HA 3RZOH 4B3SL 2N8NA 3HKSA 3S24A 2AMCB 4X62Q 4LFCQ 2YTXA 2ATWA 2ZM6Q 4Y52H 3KJOA 4R4OA 2JA9A 4JBJA 1VQKA 1PH3A 3GTQH 5M5XH 5M5YH 4X65L 4DV1Q 1WCMH 2I5MX 5C4XH 2D0OA 2UXDL 5E7NA 1YI2A 1Q82C 5JJLA 1M1KC 4DR1Q 1EWIA 1Y1WG 4OX9Q 4HJ9A 5FLMG 1HNXL 2VUMH 1SMXA 2MFIA 2N3SA 3ERSX 4IFDI 1EUJA 2KBNA 3JAMi 2ZJPA 5FLXc 3K80C 1VQ4A 3GTLH 4OWTB 1KQSA 3HOWG 4AYBE 4YHHQ 1W3SA 1IBLQ 4B3RL 2OQKA 3GTPH 4A3EG 1XMQQ 4YWLA 2ES2A 1G6PA 5IP7G 2Q2UA 3UDGA 1FJGQ 3A74A 4GKKL 2XTIA 4OONA 5M3MG 4JI6Q 2HT1A 2JA7H 1EIYB 4LWCA 3S1MH 1G291 2AHOB 1X3EA 1HNZQ 1EQRA 2YU9H 2E5LL 4NPSA 4A3MH 5C0XG 4QQBX 1Q1BA 4A3FG 3IRBA 4IPDA 5C0XJ 1IZ6A 4LF9L 3S1NH 5IT9c 1K0RA 3D31A 4JI2L 5LMNW 4A3CH 2VY3A 4DR5Q 4A3LG 1QZGA 3STBD 2ZTCA 4DV3Q 3CW2C 4GLXA 1WCMG 1LM0A 3PUZA 2AWOA 3E0EA 4PMWA 2ASBA 4LF5L 3CCJA 4A93G 1M90C 2JJQA 2KCTA 3AEVA 2CFMA 4ME3A 1VQFA 4DV6Q 1XPOA 5IWAL 3PO3H 2AWNA 4AQYQ 3I7FA 2JEBI 5BR8Q 1FL0A 3UDXA 1B8AA 1K3RA 1XMOQ 4YWKA 1G51A 1I5FA 2PQAB 3TEHB 1H95A 2A1AA 3PUXA 3M4PA 5AJ3L 1X9NA 4MNOA 1Q81C 2K5NA 2E8GA 2DGYA 2PMZE 1YZ6A 3H15A 5IYBH 3CF5A 1N34Q 4QY7A 3OTOQ 1L1OB 2JA5G 1YIJA 4BA1I 1I94L 2JA7G 1OXSC 1TWFH 4L5TA 2MO0A 4C2MH 1JE5A 1E24A 4DKAC 2UXBL 1XPRA 1Y1VH 1Z9FA 1YEZA 1HH2P 2R92G 3RLOA 2HIXA 4BBSG 2JA8H 4DAYB 1VQEA 4JI4Q 3H3VH 1JJGA 1DGSA 4XTCS 4LFAQ 5EAYA 2A19A 1PH2A 5C4XG 2C35B 4GNXB 2NVYH 3T1HQ 4GOPC 3FHWA 1I6HH 2IY5B 3U50C 1VS0A 4PG3A 5ELNA 4JI5Q 1D7QA 2VQFQ 1VQLA 4HIDA 2UUAQ 4IO9A 2IX0A 4LF4Q 1KIXA 3M7NA 2MQHA 4GS3A 1PH1A 1X65A 5C0XI 2UU9Q 1UE7A 1YVCA 4DR4Q 1VCIA 5GADC 4WJ4A 2PI2A 1WJJA 1PH5A 2R7ZH 3KDFA 4B3SQ 1GM5A 3PUVA 3G6EA 1N9WA 3AYHB 3EIVA 1PH6A 2ZJQA 1CKNA 4X65Q 1X3GA 4QJFA 2F4VQ 1E3PA 2K52A 2R93H 2WB1G 1VQIA 4L5RC 2N78A 5GROA 2Q2HA 3U4ZA 3PV0A 1EOVA 1K9MC 3CD6A 4JG2A 4JOIC 3LGJA 1CUKA 3G71A 1HR0W 1UE5A 4DV5Q 1N8RC 2VQEL 4MZ9A 1X6OA 1W2BA 4DR6Q 2XGTA 4B3RQ 3PO2H 5C3EH 3KF6B 1VQMA 1VQJA 2QA4A 3I4NG 4BBRG 1U0LA 3ULLA 4B3ML 2LXJA 5GAHC 1QUQB 4DUZL 4GKKQ 4X66L 1PYSB 2KHJA 5IYCH 4DV7L 1V43A 2B29A 3F8TA 5GAEC 4IPGA 1U5KA 4JI0Q 3FKIH 4DNIA 3MXNB 4LF7L 2CWPA 3VDYA 4XIGS 4DR2L 5K36G 4JI3L 4KHZA 5C44G 3J7ZC 2E5LQ 3K7AH 1AH9A 3I2ZA 3HKZE 5JEAG 3HOXH 4LF9Q 4JBWA 1MJEA 2F52A 1QZHA 2R7ZG 4O0AA 3HOZH 2UXCL 5DLQE 4A3JH 4YY3L 4J15A 1YJ9A 1A0IA 3STBC 1XNQL 3I4OA 3K0XA 3NEMA 4DK6C 3HOYG 4NXNL 4LF8L 4BXXH 4QGUA 4IOAA 1KRSA 1SFOH 2WAQE 4LF5Q 4O2DA 1TXYA 1XPUA 4RG1A 3S2DH 3ER0A 1N36L 2I5LX 4A3BH 1VQHA 4A75A 3GO5A 5IY0A 5IWAQ 1HNWL 3L2PA 1TWAH 2BH2A 3PIPA 4LW1A 4LF6L 4JI1L 3T1YQ 5AJ3Q 1YJNA 1HZAA 2JE6I 1S72A 4POGA 1XNRL 3ICEA 3A5UA 2VW9A 1JT8A 4A3IH 1VQ5A 3M4QA 5GQOA 2GVAA 5IYCG 5IYDH 2RHSB 3J80c 3NENA 4OXPA 2D0PA 1N32L 1I94Q 5M5WH 4DV2L 1N33L 2H5XA 2Z6KA 2Q2TA 2UXBQ 5FJ8H 3I55A 2HIVA 1PHJA 1K83H 1BBUA 1NY4A 1WOCA 1YHBA 4FDBA 3UDIA 5LMNL 2CKZB 1ASYA 3JC66 3W1GA 1SR3A 5J3BA 4L5SA 3S17H 4DR7Q 2N49A 2HHHL 2NVXH 3H3VI 2VUMG 3D0FA 2PQAA 3KFUA 4JV5L 4C3JH 3GTKH 1I3QH 1HZ9A 4JBKA 3CCSA 3RNUA 1A8VA 4UP7A 4WJ3M 4EQ5A 4JI8L 4GOPA 4DR1L 1NE3A 2K50A 2R7DA 1VQBA 2K14A 1Y14B 1KRTA 3RN2A 2K4KA 4Y7NH 2MNAA 3GD7A 4R4TA 2RHQB 3CCQA 3RZDH 3HFZB 1SROA 1VQDA 2I5HA 4YHHL 2VNUD 4B3TL 3CPFA 4APVA 4HIOA 5M3FH 2UUCL 1LUZA 3AFQA 3TREA 2Z0SA 2Z6KC 1XMQL 4YCVA 4C3HH 4HJ8A 2OTJA 1UEBA 2RF4A 2VS1A 4P71A 4AYBG 4BY1H 2OTLA 2IHEA 4A3MG 1YJWA 2JA6H 1KHIA 2WAQG 2E2HH 4JI6L 3H0GH 4BY7H 1OXVA 1TWCH 2FXQA 4TVAB 3OYYA 3EN2A 4A3CG 1KC8C 2WFWA 5ELOA 3ZJYC 3S14H 2OQ0A 3RLNA 4JYAQ 1OXXK 1KAWA 4DV4L 3PF5A 3CMEA 4GN3B 4JOIA 4DUYL 1L2FA 1VQ8A 2UUBQ 1K8AC 2IX1A 4YCUA 4DR3L 1Q12A 3ULJA 4KI0A 4RMFA 2NZHA 1KL9A 2I0QA 3PCOB 3J80i 5IP9H 3PO3G 1VQ7A 4KHPL 3M3YH 1WYDA 2R6GA 4DUZQ 1IYJB 4B3MQ 2VL6A 1E1OA 1EIFA 4DV7Q 4LUOA 2Q2IA 4GKJL 1LTLA 1JJCB 1Z47A 3CC7A 1RL2A 1QVGA 5IE8A 4LF7Q 4GNXC 5IYBG 4DR2Q 3K7UC 1PA6A 4GN4B 4JI3Q 2NVTH 4LFBL 1E1TA 2UXDQ 1QVFA 1MKHA 3CQZH 4HJ7A 1PH9A 1HZCA 1VQAA 1JJ2A 1OXTA 4OWXB 1HNXQ 2K5HA 4YCWA 2UXCQ 4BY1G 4YY3Q
chains in the Genus database with same CATH superfamily
1GD7A 3S16H 1SMYC 4L5QA 3OWFA 1EU4A 5C4JH 1Q3LA 1TS4A 2F4IA 1GUSA 4QL5A 3HKZB 1QUQA 1Y1WH 4A3BB 1JWSD 1NTGA 1BKBA 2E2JH 5CBEE 4OO1H 3HOWH 1PXUA 1JOKA 1PTOH 2A5HA 3PIOA 3CCVA 5I2XA 1CKMA 1XTCD 4NMZA 1OO9B 2JSOA 5IP7H 3M4OH 1QVCA 4H0LC 2WKCA 4CJ1B 4M8AA 3TZDA 3P7JA 3BDOA 2CCZA 2A6HC 2M00A 4JI2Q 5CV8A 1TKWB 5IGDA 3CCUA 1A63A 1E22A 1WFQA 4RFBA 2YYZA 1GUTA 1EQQA 1PFSA 5A35A 1C48A 1W6JA 4JV5Q 4H44C 2DJFC 2F0VA 1X56A 4UP8A 4JI8Q 1AEXA 3E5SA 1STYA 1KDAA 2Z8LA 2Y0SB 2OWOA 2MO1A 5FO8B 1SBBB 1DYQA 4UP9A 5C4ZA 3K57A 4B3TQ 3A0JA 3KLSA 3A8KE 2XWBB 4DR6L 2UUCQ 2G9HD 1AW7A 1WVLA 4A3KG 4P73A 3CCLA 4HIMA 3U58A 1EZ8A 2WV6D 3S14B 2Y0SE 4JI0L 3E3XA 4FF2A 4LK1C 1ASZA 4FXGC 1TIID 2L1BA 2LXKA 3PUYA 4HSPA 3BZCA 3M3YB 2NN6I 1D1KA 5HURA 3FPUB 1KDBA 2Z1CA 1Y8NB 1SN8A 4DA2A 4GLVB 4DAYA 5C3XA 1L0YB 2F0LA 3J80E 4IPCA 4V190 4A4IA 4A3IG 3J7A5 4GNXA 5JJIA 5I9OA 1I4XA 5IYDG 4HIKA 3CPWA 1IL8A 3BYYB 2PW7A 3PGZA 3TP8A 3BZKA 2KCCA 1BBWA 2EPBA 3ZYYX 3GTOB 3F2BA 3RLFA 2VQEQ 1VQ6A 3UI2A 3OW2A 2K7VA 1BCPF 1KABA 3RR5A 4IZ8A 3GTGH 4A3EB 4X66Q 3MC0B 1R9TH 1RTNA 5CV6A 4KY5A 4IFDG 4R1JA 5M3MB 3NTHA 4HMIA 2VZAA 4BBRH 1LTSD 2XN9C 3JAMc 3S1RB 3W1BA 2EYPA 1YNXA 2QGQA 4N9TA 3TBIB 1LTID 2CQOA 2JQOA 1EZ6A 4K14A 5H1SE 4RGNA 4S3SA 2F0TA 4EGVA 4KK7A 2RDGA 3L7ZC 4CJ0B 3OSOA 1WI5A 2B2UC 1MIUA 2ALYB 2QDBA 3J81L 5CMDA 3H91A 3J81j 1XJVA 4JBMA 2RCNA 4LFAL 3AFPA 2RSOA 1WTHA 5C3WA 2IHFA 2L15A 3TP6A 3T1HL 1TWGB 2UUBL 2XNAC 1SAPA 1VQ9A 2OT2A 4AH6A 5FKAC 4DPGA 3K5OA 3S1RH 2JA5B 1SRUA 4KLKA 1D5MC 3TP7A 4CGYB 4B3SL 2N8NA 4QF4A 3S24A 2R92B 5M5XH 5M5YH 5DEHA 2D0OA 2XRSD 1YI2A 4TRDA 1B2TA 1EWIA 1F9SA 1NCVA 4L6TB 2Z9HA 1EUJA 1VQ4A 2F0UA 1PRTF 2PO4A 2KEEA 5FO9B 5JOBA 4CDCC 4C3IB 3J7YW 5DM63 2FMCA 1EY7A 2KCNA 3A74A 4BWGB 5G3LF 2XTIA 4NW2A 4JI6Q 1CM9A 2HT1A 3V96A 1G8ZD 5BN4A 2NVQB 2B2WA 1X3EA 1I6VC 1EQRA 2WB1B 3EROA 4UAIA 1JOQA 4A3FG 5I2YA 4IPDA 2K04A 4LF9L 5LHY1 1UUPA 1K0RA 3D31A 5IT9c 1EIGA 3AU7A 4A3LG 2QCPX 2F0KA 3STBD 5EKKA 1JWMD 1BO0A 3LWEA 5F2DA 3TDQA 3S1QB 3I8ZA 4G7ZC 1D5XC 1VQFA 1DJRD 1XPOA 3L9AX 5KYIA 4L63B 1FL0A 3UDXA 5D3IB 2A6ED 3NTKA 2ZT9C 1RCVD 3M4PA 4RA8A 4MNOA 3NWSA 1NR2A 2DGYA 3H15A 3OTOQ 2J4XA 3LX0A 4RCNA 2JA7G 1Z7TA 2LFNA 4DNRB 2EOTA 2OXPA 3DHQA 2B2TC 2HIXA 3TN2A 3QOJA 1VQEA 3OHXC 1JJGA 1BOSA 1FNWA 4LFAQ 4ZK9B 2L5TA 4K6LA 2C35B 2NVYH 3T1HQ 4LJZC 4H7BA 1I6HH 1CHPD 3T51B 3VYUA 2M2LA 5ELNA 1D7QA 3HP3A 1VQLA 2HCIA 3RD4A 1KIXA 1WTWA 1EYAA 5C0XI 1EY4A 1JQYD 2L11A 4WJ4A 5EBDA 5EPJA 1PH5A 4B3SQ 1GM5A 3PUVA 2NWGA 1SJHD 3KBGA 3D4RA 2VUMB 2A69D 4KJOA 1F2LA 2Q2HA 1K9MC 1EOVA 3LGJA 1CUKA 3G71A 1HR0W 3I72A 4DV5Q 4J1MA 4OGQC 2RVLA 1O7ZA 3KF6B 3HGBA 1TWAB 2QA4A 5GAHC 1QUQB 2D5DA 2KHJA 4AYBB 4DV7L 1A3TA 1UEAB 2B29A 4IUNA 2I46A 4A3MB 4ZUIA 5DNFA 1RD9D 1V8QA 2IL8A 2CWPA 2PCFB 4Q5VA 3S1NB 5K36G 2JP1A 4JI3L 4DAVA 3K7AH 5M5WB 4G57A 5JEAG 4LF9Q 4JBWA 3KK7A 1SEBD 2B2VC 2F52A 2R7ZG 4XQNA 3GTPB 3C46A 1YJ9A 3BZDB 4X3KA 2NTSA 2MGSA 3STBC 2PZUA 3OMGA 1S5BD 1KRSA 1BBXC 4FVMA 3PO3B 3GV6A 1TXYA 1UNSA 3S2DH 1VQHA 4A75A 3GO5A 4Y7NB 1TWAH 2A6EC 3T1YQ 3EA6A 3AMUA 5T1IA 4RHRA 1S72A 4POGA 2VW9A 4A3IH 3Q0AA 4C2MB 5IYDH 2DNCA 4OXPA 4ZRZA 1SE4A 5ELCA 3J80c 4BY1B 1Y1VB 2D0PA 5M5WH 2VB2X 2H5XA 4DGZA 3TP5A 1QJOA 1VMPA 2CW0D 3I55A 1RDPD 1S5FD 1K83H 1NY4A 3GTPH 1SR3A 5I6YA 1LT6D 4Q0FA 1LO5D 1XWEA 3R2TA 3D0FA 3KFUA 5BN5A 1I3QH 3RMHA 1HZ9A 3CCSA 1A8VA 1MBYA 3NHHA 1PFMA 4UP7A 1DD2A 1VQBA 1S5ED 2K4KA 4Y7NH 4IFDH 3FDTA 2BE5D 3EVQA 3LNNA 3HFZB 3OMCA 1H9SB 2VNUD 1LUZA 2F0SA 1CZGA 2Z6KC 4YCVA 1HQRD 1A6XA 4P71A 4BY1H 2F0NA 2OTLA 3R3OA 1YJWA 1DZ1A 2WAQG 5CGKA 1TWCH 4KY7A 2A69C 3SVMA 4A3CG 2D9UA 4JOIA 1L2FA 2H4OA 1HRJA 3PO2B 4DR3L 5JPNC 1SJED 4KI0A 3HOUB 2X6LA 2KOLA 1ZXTA 1VQ7A 4HMJA 1MD2D 5E4WC 3FKIB 1H9JA 1E1OA 2QW7A 3MAQA 1TU2B 4DV7Q 4GKJL 1X3QA 1Z47A 1RL2A 1QVGA 1HA5A 2EY5A 3K7UC 1PA6A 4JI3Q 4LFBL 1VF7A 1JJ2A 1OXTA 4A3DB 1S5DD 2PZTA 1IXRA 2NZ1D 1WTXA 4BY7G 1IBKL 3VA7A 4DXGA 1NMGA 3VR6A 4KMUC 2EY6A 1HR0L 4DAMA 3HOUH 3MXNA 4KN4C 4IPHA 2SNSA 1XTDA 2F03A 3ND8A 1ML0D 3Q22A 3UDFA 3E9IA 1YHAA 2AQ1B 2AKWB 2QDLA 2ZXPA 1VQNA 3M85A 2KCMA 2EY1A 4F8MA 4JI5L 4XYQA 3VYSA 2A73B 4JC0A 1J5EL 1FGUA 1JB7A 2B63B 1PYBA 4JCVE 2WP8J 1D6EC 1SMYD 2PI2E 3AQQA 5ELDA 2CW0C 4A3DH 4CJ2C 1ET6A 1M4VA 3HRZC 2EVBA 3MWYW 5IODA 2E2IH 4A3LH 1BQQT 3F2CA 1Q1EA 3EBEA 2RA4A 2F4VL 1VQOA 2AUKA 1VQPA 4MTKA 2B8GA 3OOCA 2JN4A 2BE5C 3TS0A 1CSPA 3PIP3 2A6HD 5LMUL 4LMQD 2A8VA 2JA6B 3H0GB 4XT1B 1EYCA 2GN5A 2SDFA 4RGOS 3I4MB 1EFWA 4X62L 3HOXG 1F9QA 4RKLA 5EPKA 1BCPB 4EX5A 4FXKC 3I56A 5C4HA 3HOZG 5EPLA 3S15H 2BA0A 4DV1L 1U4MA 1WTOA 1EY9A 4OX9L 2HQEA 3U9OA 2CHBD 1S3OA 4NDXA 1PH8A 4BXXG 4G7OC 2IT1A 1GO3E 4DR3Q 1LTBD 3G48A 4Z9CB 1TWHH 3H3VC 3VR5A 1KLGD 1MJCA 4GKJQ 3SDZA 1FJGL 2CH4W 3RUZA 3G6JB 3BS1A 1Q86C 1A3UA 1FYCA 1HJPA 2LMCB 4NB3A 2MHVA 1B3AA 4LFBQ 1EY8A 2R3ZA 3V05A 2SEBD 1SE8A 3S16B 1A2TA 1U4LA 1HNZL 3I4MH 4A3GG 4CHTB 5I9PA 1SLJA 3UE1A 5C4JB 1Y1WB 1HZBA 1I4GA 1P8LA 2KENA 5D14A 3NBIA 1L1OC 4R4IA 1A3VA 3ERQA 3M7GA 1HUMA 1IBKQ 1G91A 1LABA 3HOWB 4RAUC 4PMCA 5DM73 1HR0Q 2K5VA 4K8JA 5D65A 2YV5A 4I7AA 3JAML 4OO1I 5CC4A 2ID0A 3M4OB 4DV6L 2HQLA 2ICEC 4DK1A 3CXCA 4IFDJ 1AFPA 3HZXA 1L0WA 5M3FG 4PZ7A 1YBYA 1ONLA 1IKLA 2RDFA 2KEDA 4K6DA 1J5EQ 4ZUJA 1HA6A 1N34L 4TQUS 3KF6A 4PQXA 5LL6X 2B3GA 4NXNQ 3HOVG 4GN5A 1K73C 1UE1A 1PRTB 1FR3A 1WCMB 1CKOA 2K6AA 5JVH3 3W5OA 5NUCA 3CRLC 1AE2A 3PUWA 2RDHA 2XVSA 4IOCA 2H1EA 2WACA 1AE3A 3VA5A 4JYAL 1WTPA 3H6MA 2KJXA 2OCEA 5LMUQ 5A2QL 4IUUA 1LTAD 2F0IA 4UPAA 1YITA 1SNMA 5E3FA 1DCZA 3S1MB 3V2TA 1PFNA 2LS01 1JORA 1QCBD 2B2YC 4X62Q 1JICA 3ITPA 4KN7C 2YTXA 2JA9A 3GTQH 4DV1Q 1WCMH 4ODGA 5EKLA 5T1GA 5E7NA 5JJLA 4OX9Q 1E0BA 4HJ9A 1AP0A 3ERSX 3JAMi 3GTLH 3K80C 1HTPA 1KQSA 1EL0A 4YHHQ 2R61A 2F0DA 3SR1A 1MSGA 3MFGA 2QEJC 1XMQQ 4YWLA 2Q2UA 1FJGQ 1SYEA 5IT9L 3J81E 4OONA 5E4XA 3T4AC 3NXWA 1EIYB 3S1MH 2AHOB 4RKBA 2YU9H 1HNZQ 1NSNS 5C0XG 5D3DA 4QQBX 1IZ6A 3DXJC 1H9SA 3A55A 5CORA 3GTGB 5LMNW 4A3CH 3MZ5A 2VY3A 1R9TB 3CW2C 2AWOA 4PMWA 1X3PA 2B2TA 4LF5L 1PZJD 4A93G 1M90C 4RHSA 2F1MA 4BBRB 1H9RA 4DV6Q 3C2PA 2EY2A 5IWAL 1ILPA 4MHEA 1QWYA 1B8AA 1K3RA 4YWKA 4B08A 3A56A 1T5XD 2EYMA 2N88A 1X9NA 1V1PB 2Z6BA 2K5NA 5CYUA 1N34Q 2XRQD 1L1OB 4BA1I 1I94L 1IHZA 4L5TA 4KD4A 1HFGA 2MO0A 3W2DA 4DKAC 1ENCA 2UXBL 1XPRA 4C1NK 1YEZA 4WORA 4BBSG 4DU9A 4RCOA 4K8IA 3H3VH 1O7YA 1DGSA 1FD7D 3QO2A 1TY2A 1MSHA 4GOPC 2IY5B 3U50C 5KEEA 1VS0A 3NQTA 2PW5A 4PG3A 2KQ3A 4HIDA 2IX0A 4KJNA 3M7NA 4U673 4GS3A 1X65A 3Q23A 1UE7A 3D8GA 3HS0C 4ZAIA 3OW7A 5JPMC 2PI2A 5M5XB 5M5YB 3KDFA 4ID6A 1N9WA 3AYHB 3EIVA 1RHPA 5HGTA 2MJ8A 2BDNA 5GROA 1LT3D 3U4ZA 3PV0A 1ZEQX 4NP5A 3VR2A 1N8RC 1ESRA 1TQOA 1W2BA 1JB3A 5C6AA 4DR6Q 4KHVA 1BUVT 1H9MA 4C1NI 1VQJA 3I4NG 1U0LA 2LXJA 4DUZL 1PYSB 3F8TA 4IPGA 2AUJD 2EYLA 4JI0Q 2HD3A 1K8OA 3MXNB 4XIGS 5FO7B 3C1EA 5C44G 3I2ZA 3A7AB 3HOXH 4QMGA 3HOZH 2UXCL 1IYVA 4YY3L 4J15A 1PLFA 3EJIA 1YNND 3HOYG 4BXXH 4C3JB 1SFOH 4LF5Q 2DJGC 4X3TA 1N36L 1ZKOA 2HUGA 2I5LX 1AZQA 5IWAQ 1HNWL 1GUOA 2BH2A 1STEA 4ZYSA 5ELFA 3SK5A 1U4PA 3RZDB 1YJNA 2C5CA 5JVG3 1QG7A 1XNRL 3NQIA 3NPPA 1G6ZA 3M4QA 1SSOA 4C3HB 5IYCG 1ZYRD 2LY7A 3NENA 3SK4A 2FINB 2LKVA 1STHA 1I94Q 1N33L 2Z6KA 2J7ZA 2OEOA 3BDLA 1QNUA 1V1OA 2UXBQ 5C4XG 3UDIA 5LMNL 4OWWB 2KA7A 3JC66 5FLXE 2BCOA 2KECA 3S17H 3D4WA 2NVYB 2HHHL 2NVXH 1I6HB 4C3JH 3GTKH 3RNUA 2Q8RE 4EQ5A 1IW7D 4DR1L 2R7DA 2K14A 1LTGD 1KRTA 2MNAA 2ICIA 3VR4A 3RZDH 1VQDA 4K5VA 3CPFA 5M3FH 3AFQA 5EKIA 2Z0SA 4C3HH 3I90A 4HJ8A 4R8NA 1UEBA 2E2HH 4CBVA 1O78A 1OXVA 3T16A 3EN2A 1HUNA 1KC8C 2WFWA 3ZJYC 2OQ0A 3RLNA 5I6WA 3MVVA 1KAWA 4IUTA 1QB5D 1HHVA 3PF5A 3CMEA 2UUBQ 2WINB 4JW0A 1RTOA 5KIXA 1Q12A 2KUMA 3C3LA 3IFDA 3J80i 2HDMA 5IGBA 1WYDA 4DUZQ 4QUCA 1EY0A 4LUOA 2Q2IA 4A3KB 4DF7A 3BYTB 4EQNA 3NE5B 3K7AB 5IE8A 4GNXC 4GN4B 1LT4D 4KKSA 2KHSA 3CQZH 1HZCA 3T53B 2DY7A 2K5HA 4YCWA 2UXCQ 3TMEA 4YY3Q 3QB3A 3DWPA 4ULLA 1GKHA 4G4KA 1UE6A 1YNNC 3S2DB 3U4VA 2JA8G 2WIIB 2K01A 4AIMA 5KGUA 1K0SA 4R4QA 1N36Q 3OPOA 3E6ZX 1PZID 3EQLC 1HTLD 1HNWQ 1Z6HA 4BS9A 4A3IB 2ZTEA 4XQQA 4CKEA 3CP0A 5IP9G 1A62A 3CCEA 4A3KH 4X6AH 1XNRQ 3L3OC 3A8JE 2GVBA 1ZYRC 4DFAA 4LF4L 4PZ6A 4PV1C 2PPBC 3D3RA 1K83B 1STAA 1N33Q 2RSNA 5C0XH 2K75A 2R93G 5LMNQ 2YTYA 1I3QB 3VR3A 4IJHA 4V0BA 3RN5A 1B70B 1NMFA 4OELB 2HHHQ 1KDCA 5CV7A 5EJWA 3N6RA 5ELEA 5GAGC 3SGIA 1IW7C 3BG3A 4A93H 2EQSA 4K0KL 5ELBA 3WOFA 1EQTA 5K5PA 3KJPA 2O5JC 1CSQA 1NJIC 5C3EG 2WKDA 3G4SA 3TS2A 4OO1G 3KYHC 2AQ2B 3OIPA 4LNQA 1C0AA 1G2SA 3TRZA 1KD1C 1QILA 2NTTA 3PSIA 1JOOA 1TWCB 4X64L 2F0HA 2K05A 4FNFA 4DV0L 1A2UA 2JXMB 1SE3A 3I73A 4BA2I 1LTRD 2XWJB 3GV3A 5IGFA 1I4QA 4A3JG 1U9RA 2R7FA 1SNPA 1V1PA 3W3AA 3WWVA 4BBSH 1L1OA 2LSSA 3S2HH 3CAMA 1DOKA 2QEXA 3HKZG 4A3BG 1B9MA 3FEWX 1UWVA 3QWNA 1JCKB 2F0OA 1Q8KA 3B6YA 2MP1A 1B4OA 2D2CC 3D4DA 3Q8DA 3GTMH 5EBCA 2NZOA 1HXYD 2B2WC 1II3A 5IGEA 3F2DA 3KLWA 3CKIB 3MA2B 1B50A 5CR3A 1SNDA 2RKSA 2QILA 3C1FA 1EEFD 2BH8A 1TS2A 3K5NA 4TSSA 1VQGA 4DV3L 2YTVA 4H13C 4DR7L 4LUVA 3FVQA 1CK1A 3MEFA 1T9HA 1V1QA 3K5LA 4AQYL 1C9OA 3I4NH 2IPKD 2K03A 2Y0SG 3A5ZB 1XMOL 1HCZA 5KNDA 2GA4B 2AQ3B 3IFTA 3KF8B 4A3FB 3UE0A 2K1BA 3NUCA 3GTJB 1PTOC 1LYLA 1Q90A 5C44H 4UY8C 3QOLA 2E2IB 3BVMA 4KD3A 3KOJA 1J6QA 2BA1A 4QIWB 2B2YA 3FRPB 1EYGA 1IKMA 1PH7A 1EWCA 5LL6S 5JAVA 1DXMA 3X3MA 3SK8A 1B53A 3HOYH 3KDFB 4R8IA 3CU7A 1JMCA 1I50H 4K0KQ 2O2LD 2FFKB 1T5EA 2NN6G 5HGQA 1CI3M 1K8GA 4QCLA 3X3NA 4POFA 2VQFL 1IL2A 4QIWE 2UUAL 3TZUA 4HR7B 3DLLA 4IUPA 4K5WA 2UU9L 2EDGA 3JAME 1RIPA 4X64Q 4A3FH 1P16A 2JA7B 3GTJH 4DV0Q 3S15B 3HKSA 2ZXRA 4Y52H 1F2MA 1SDFA 1I4RA 4R4OA 4JBJA 1VQKA 2I5MX 2EJMA 5C4XH 2UXDL 1FGBD 1TT2A 1M1KC 4X3SA 5FLMG 2Z4IA 1HNXL 1SMXA 1TWHB 2MFIA 4J8QA 5FOBB 3E0JA 5FLXc 4OWTB 4DNTB 3G7LA 1HFNA 1W3SA 2OQKA 4A3EG 5J39A 3J7AF 4I7ZC 4QB4A 3LWUA 2BDOA 2E75C 2ES2A 2K5DA 4KKUA 3QG1A 4CKBA 3H94A 4B9WA 5M3MG 4GZYC 4WRDA 3M4YA 2JA7H 2VXWA 4LWCA 1G291 3HEJA 1SNCA 2E5LL 1Q1BA 5C0XJ 4X3UA 5A2QE 4JI2L 3DUZA 4XQJA 3VYRA 1L0XB 4DV3Q 2PMZB 2CVRA 1LM0A 2HDLA 4EQOA 3CCJA 1B9NA 3NSWA 1CA5A 2JJQA 2XIWA 5L37A 2CFMA 4PNYA 4ME3A 2KVMA 1Y69U 4AQYQ 5FK9C 4HAEA 1S5CD 2JEBI 1XMOQ 3TEHB 1H95A 2A1AA 1ICFB 5BN3A 1Q81C 4DXFA 3DMUA 2E8GA 2PMZE 3I70A 3CF5A 2EXZA 2E2DC 1TY0A 4CDDC 2R7ZB 2EJGC 1WTQA 5TSSA 2JA5G 1YIJA 2A68D 1OXSC 1TWFH 4OIJA 1E24A 3T56B 1ICWA 5IT9E 1GHJA 2B2UA 1Z9FA 2R92G 1SNOA 4EVOA 4MIUA 2JA8H 4LAAA 1F77A 1HPCA 5EAYA 2A19A 3GP7A 1PH2A 2K28A 1K3BC 4JI5Q 2F0MA 2VQFQ 4O1NA 4IO9A 2UUAQ 1H9KA 2EYFA 1PH1A 5K36H 4C3IG 2UU9Q 1D1IA 1CQFA 5JEAH 3NWTA 1VCIA 3GTQB 1JR0D 1WJJA 2R7ZH 5IOCA 1PH6A 2ENBA 4HCEA 2F4VQ 1E3PA 2R93H 2WB1G 3GTLB 1VQIA 2JYOA 2N78A 1SYFA 3CD6A 1JE4A 4JG2A 4JOIC 1STBA 1UE5A 2VQEL 4MZ9A 2XGTA 2B39A 3P75A 5M9OA 1MGSA 5C3EH 1VQMA 2HCCA 3ULLA 4B3ML 4X66L 3URYA 4ZCKA 2YU9B 1LT5D 2G9DA 4PMBA 1U5KA 4N8X1 2WAQB 5IGGA 1RODA 3VDYA 4DR2L 3N52A 3MEHA 4KHZA 3J7ZC 2E5LQ 1AH9A 3IAYA 3HKZE 2X6GA 1QOHA 2XSCA 1QZHA 4FO2A 5DLQE 4A3JH 3KLSX 1XNQL 3I4OA 3K0XA 4DK6C 4HCSA 4LF8L 3HG9A 1WD1A 4YIJA 1EFID 2WAQE 1EWHA 1XPUA 3IL8A 4RG1A 3ER0A 1AZPA 5DAUA 4A3BH 1EY6A 5IY0A 4ME5A 4XYOA 1DOLA 1SYBA 3PIPA 4LF6L 4JI1L 1QNKA 2NUCA 1JT8A 1VQ5A 1PFBA 2GVAA 4NKLA 2RHSB 1LACA 5EGTA 4RGMA 2A68C 1N32L 4DV2L 1F9RA 4BY7B 3PQIA 2HIVA 4FDBA 1WOCA 1YHBA 3U9SA 3W1GA 5J3BA 3SEBA 2N49A 3H3VI 2MPMA 2VUMG 2PQAA 3FPPA 4XT3B 3KLRA 4RGTA 4RH6A 4WJ3M 4ZLTF 1RKNA 1Q8IA 4IUQA 4F88A 3T13A 3WOEA 4K5XA 2RHQB 1Y8OB 1SROA 2I5HA 4HIOA 3BVZA 2TSSA 4AYBG 2NVTB 2IHEA 4A3MG 2B8FA 2IWHA 1KHIA 4JI6L 4BY7H 2FXQA 4TVAB 3K0YA 3S14H 1FNVA 4UHVA 4JYAQ 2F3WA 3KF8A 4DV4L 4DUYL 4GN3B 1VQ8A 1E2ZA 1GOZA 1VF5C 2L0CA 4M1UB 1STGA 4IALA 1F2YA 1JC7A 3ULJA 1K28A 2NZHA 1KL9A 2I0QA 2NN6H 3PO3G 2EJFC 4KHPL 4FF4A 3M3YH 4B3MQ 2R6GA 2VL6A 1EIFA 1A15A 1F2ZA 3TSSA 1J9OA 3CC7A 4G7HC 3HOXB 4DR2Q 5IYBG 3HOZB 2NVTH 1J8IA 4ZKCB 1QVFA 1MKHA 4HJ7A 1VQAA 2L9HA 4OWXB 2B2VA 1KAAA 4BY1G 3QJYA 1Y1VG 1SFOB 3I91A 3OTOL 4A76A 5JJZA 1XNQQ 4P72A 4ALPA 1EY5A 3CMAA 3K6OA 5AFWA 4LF8Q 5FLMH 1BVSA 3GTOH 1XX8A 1X3FA 2L4NA 3BDCA 3OIQA 1BR9A 4R4CA 2DN8A 5HY6A 2O5IC 4MTNA 5EQ0A 1IBML 1W6KA 1VDZA 1NAPA 3BU2A 1VMCA 4A3EH 4NXML 1CKNB 4LF6Q 1SYCA 4OHJA 2L55A 1X55A 2MUYA 4JI1Q 2F0JA 3AB9A 4P75A 5C5LA 1O7IA 1PTOF 1CZWA 1VQCA 4A3GB 5M3MH 2EIFA 1B7YB 2X69A 1EEID 5JEAJ 2EYHA 1X54A 3IKJA 4L8JA 1N32Q 4DV2Q 1KXLA 3S17B 1DM0B 2F0GA 2ZTDA 2JK8A 2NVXB 1ENFA 2F3VA 3GTKB 3NBHB 2SOBA 2PNHA 1LTTD 2EYJA 3J80L 1V9PA 3VYTA 2EXDA 4CKCA 3CC2A 3A54A 1D5ZC 2PQEA 4HJ5A 3PO2G 4J6HA 5M3FB 1YHQA 3HOUG 5CV5A 4DV5L 3KUPA 4XDXA 1S40A 4JI7L 1ESFA 1TWGH 3DM3A 4A3GH 3J7AV 3FKIG 2NYZD 4HTHA 2E2HB 1NBWA 5JJKA 3M9BA 1TR5A 3HOVB 4CDEC 2KHIA 1RJTA 4YWMA 2JA5H 2CQAA 4LFCL 4U68A 4DK0A 2ZM6L 1GUWA 1S4ZA 1MHWC 2ZXOA 2V1CC 2R92H 4A3DG 4DV4Q 4DUYQ 3CCRA 3R8BA 1PYWD 2DUDA 5E1FA 4DK3C 4H02A 3K8AA 3ONAB 1C7YA 1I4PA 3J81i 1IBLL 4KHPQ 3K5MA 3K81C 1Q46A 2WB1E 4C3IH 1E7ZA 3CQZB 2A74C 4XXEA 3F1ZA 4KV6A 4K2KA 3HOVH 4P2CB 3T1YL 1FVIA 4JPBW 3BJUA 4CDFC 4GOPB 2CH4A 3CCMA 4FP5D 5FJ8G 1Q7YC 1OTCA 2NVQH 3FP9A 2B63G 2IX3A 4P74A 4DR5L 3NELA 1E2VA 1B1ZA 4OEMB 2JEAI 3P20A 5IGCA 1PVOA 4HJAA 1GHKA 1Y8PB 2K5QA 3WDNA 3ULPA 1IBMQ 1BCPD 4NXMQ 4IN3A 2V4DA 3S1QH 1O80A 3GDEA 1RF2D 2K33A 5BR8L 3MTSA 4FYDA 2VB3X 3DWAA 5J1ZA 2F0QA 2F3IA 1PMRA 1PH4A 5KRUA 4ILWA 3TQYA 2ZJRA 2D62A 1G2TA 2NBFA 1WTVA 3RZOB 2SNMA 4IJLA 2JA6G 3K58A 3H0GG 1LLRD 5J22A 1D8LA 1PDQA 1ENAA 3I4MG 3L0OA 1KTKA 3CC4A 4A93B 3MXGA 4LUZA 1KNAA 3MFYA 4JI4L 2J0TD 3PF4A 3R2IA 1ILQA 1OXUA 1I4HA 2E74C 2CWAA 1F9PA 1U4RA 1PV4A 4JI7Q 4ABNA 4JVZA 3J81c 2IJ0A 4FF3A 1PTOD 4PZ8A 1JWUD 1TVXA 4DAPA 4DR4L 3OWEB 4GLAC 1GVPA 3RZOH 3E9HA 1GXDC 2AMCB 5FLXL 2FHTA 3DM1A 3MHBA 4LFCQ 2ATWA 2ZM6Q 3KJOA 4F7XA 4BBSB 1PH3A 3DWQA 5C5MA 4X65L 3S2HB 1Q82C 4DR1Q 2F0EA 3I3CA 2K32A 1Y1WG 4MN3A 1D2BA 3MXPA 2VUMH 2N3SA 4IFDI 2KBNA 2ZJPA 3R93A 1C4QA 2FJ2A 3O13A 3HOWG 5I4DA 4AYBE 2BOSA 1IBLQ 4B3RL 1K8MA 3GTMB 1PRTD 1G6PA 3NP8A 3MXUA 5IP7G 1DOMA 3UDGA 4GKKL 4ZKBB 4I65A 1HQMC 1AN8A 4DN4M 2EZVA 3H09A 1C8CA 5G3LD 4NPSA 4A3MH 1STNA 3IRBA 3S1NH 3CHBD 4DR5Q 1QZGA 3SHLA 2ZTCA 4WFN3 4GLXA 1WCMG 3PUZA 3E0EA 4E6IA 1YNJD 2ASBA 4HN7A 1M8AA 3I4NB 1NNXA 2KCTA 1BCPC 3AEVA 3P1HA 2OF1A 2AWNA 3PO3H 1EOTA 3I7FA 2TMPA 5BR8Q 1G51A 1I5FA 2PQAB 1SNQA 5KNBA 3PUXA 1R4QB 5AJ3L 5C44B 2IW3A 1IYUA 1B44D 1YZ6A 4R9WA 4C56C 5IYBH 4QY7A 1PZKD 3EFXD 1CTMA 2F0FA 1SE2A 1KLUD 4C2MH 1JE5A 3HOYB 3FMCA 1Y1VH 1I50B 1HH2P 3RLOA 4DAYB 5CV4A 1SXTA 4JI4Q 4O42A 2NB0A 4XTCS 4FXDA 4KY6A 1EQVA 4GNXB 3SK6A 3FHWA 1CT1D 1GUGA 4OIKA 3QR8A 2P5ZX 3ND9A 2F0PA 4LF4Q 2MQHA 1GUNA 5IIFA 4DR4Q 1YVCA 1X32A 5GADC 3QIAA 3G6EA 5C4XB 2ZJQA 1CKNA 2RBMA 2M9VA 4UDUC 4KTAA 1X3GA 4RWSC 4QJFA 4X65Q 2K52A 2K5WA 3CRKC 5COYA 3Q6SA 4L5RC 4TKOB 2L12A 3PIO3 2C9OA 1EU3A 1GJXA 1X6OA 4JK1C 4B3RQ 4HSVA 3NBHA 3PO2H 2FMMA 1PRTC 4BBRG 3Q24A 4KKTA 4GKKQ 2O4XA 5IYCH 1B3QA 1V43A 5GAEC 3A8IE 3FKIH 4DNIA 4LF7L 1BNZA 4IURA 1NR4A 2Q8IB 3GQBA 1WTRA 1XXGA 4ZQ3A 1MJEA 4O0AA 1EIHA 3KBXA 1A0IA 4FF1A 4HEDA 3NEMA 4IOAA 4NXNL 4QGUA 1YNJC 4O2DA 2EE1A 1CHQD 3D6WA 3L2PA 1E2WA 4LW1A 4QUFA 1MI2A 5AJ3Q 2RQXA 1TS3A 1HZAA 2JE6I 3ICEA 3A5UA 1TWFB 5GQOA 1CQVA 3DEPA 4K2LA 5KNCA 5CBAE 4IQZA 2JA8B 2Q2TA 1KNEA 1TS5A 5FJ8H 1PHJA 5KYLA 2B63H 1BBUA 3BVGA 1BF4A 2G5DA 3PMFA 2CKZB 1ASYA 2RCFA 4L5SA 4DR7Q 1R4PB 1O7LA 1XYIA 4JV5L 1QE6A 2EYOA 1NUCA 4JBKA 4JI8L 4GOPA 1NE3A 2K50A 1CFMA 1Y14B 2PYKA 3RN2A 1ET9A 1EYDA 3GD7A 4R4TA 3SXHA 3CCQA 1SYDA 2Z4HA 4YHHL 4B3TL 4APVA 4OL7A 2UUCL 3TREA 1DONA 1XMQL 2OTJA 2VS1A 2RF4A 4EQPA 2R93B 2JA6H 2QF7A 3K59A 3H0GH 2DNEA 3OYYA 4N9PA 3NTIA 2F0WA 5ELOA 2I07B 1OXXK 3NK9A 4WJWA 3DEOA 2Q8TA 2PNRC 1BXTA 5ISRA 2QKIC 1K8AC 1UAPA 2PZWA 2IX1A 3A7LA 1FNUA 4IUVA 5C3EB 4YCUA 2E2JB 3F2UA 4RMFA 4B9XA 1PTOB 1SYGA 3PCOB 5IP9H 4C3JG 1LV9A 1IYJB 3SE0A 1LTLA 1JJCB 1CA6A 3I4LA 3D6CA 2E76C 4F87A 4LF7Q 3S9WA 1BDOA 4A3JB 1E1TA 2UXDQ 2DY8A 1WD0A 1PH9A 2N55A 5CV9A 1HNXQ 4C3HG 4N8FA
chains in the Genus database with same CATH topology
1GD7A 1IXRA 1Y1VG 3S16H 3OTOL 4L5QA 4A76A 1GKHA 4P72A 1UE6A 5C4JH 4ALPA 1XNQQ 3U4VA 4BY7G 4QL5A 3CMAA 1Y1WH 1QUQA 1IBKL 4LF8Q 2JA8G 4AIMA 1NMGA 1BVSA 5FLMH 3GTOH 1X3FA 1NTGA 1HR0L 4R4QA 1BKBA 4DAMA 1N36Q 2E2JH 3HOUH 4R4CA 3HOWH 5HY6A 4IPHA 1HNWQ 3PIOA 3CCVA 1XTDA 4MTNA 1IBML 3BU2A 4A3EH 1CKMA 4NXML 1CKNB 4LF6Q 3UDFA 2ZTEA 3E9IA 4JI1Q 1X55A 1YHAA 3CP0A 4P75A 2AKWB 1A62A 1O7IA 1QVCA 5IP9G 5IP7H 3CCEA 4A3KH 1VQNA 3M4OH 1XNRQ 1VQCA 3M85A 4X6AH 2KCMA 5M3MH 4JI5L 2EIFA 1B7YB 2GVBA 5JEAJ 2CCZA 4JC0A 4LF4L 4JI2Q 1X54A 1FGUA 4PZ6A 1J5EL 1JB7A 1N32Q 4DV2Q 1PYBA 4JCVE 3CCUA 1N33Q 2WP8J 1A63A 1KXLA 2PI2E 3AQQA 1E22A 4A3DH 1WFQA 2ZTDA 2JK8A 2YYZA 2K75A 2R93G 5LMNQ 2YTYA 3NBHB 4IJHA 3RN5A 1B70B 1NMFA 1EQQA 2E2IH 2PNHA 4A3LH 2HHHQ 1PFSA 4JV5Q 3F2CA 1Q1EA 3EBEA 1V9PA 1X56A 2F4VL 4UP8A 5GAGC 3SGIA 1VQOA 2EXDA 4JI8Q 4A93H 4K0KL 2EQSA 3CC2A 4HJ5A 3KJPA 1VQPA 2OWOA 1CSQA 2MO1A 3PO2G 1NJIC 5C3EG 1YHQA 3TS0A 3HOUG 3G4SA 1CSPA 3TS2A 4OO1G 3KYHC 4DV5L 4UP9A 1S40A 3A0JA 1TWGH 5LMUL 4B3TQ 4JI7L 4LNQA 3TRZA 3DM3A 4DR6L 2UUCQ 2A8VA 4A3GH 1KD1C 3PSIA 3FKIG 5JJKA 1NBWA 3M9BA 4X64L 2GN5A 4A3KG 2KHIA 4P73A 4DV0L 3CCLA 4HIMA 3U58A 4BA2I 1EFWA 4YWMA 4X62L 3HOXG 2JA5H 2Y0SE 4JI0L 4LFCL 4EX5A 3I56A 2ZM6L 3HOZG 1ASZA 4A3JG 2R7FA 2B63H 3S15H 2BA0A 4DV1L 3WWVA 2V1CC 2R92H 4A3DG 4DV4Q 4DUYQ 4OX9L 2LXKA 3PUYA 4BBSH 4BXXG 1PH8A 1S3OA 1L1OA 3CCRA 2IT1A 2DUDA 2LSSA 3CAMA 3S2HH 1GO3E 3BZCA 4DK3C 4DR3Q 3G48A 3K8AA 4H02A 2QEXA 3HKZG 1C7YA 4A3BG 2NN6I 1UWVA 3J81i 1TWHH 1IBLL 4KHPQ 1Q8KA 1SN8A 3B6YA 1MJCA 4GLVB 3K81C 4GKJQ 1Q46A 2WB1E 1FJGL 4IPCA 4C3IH 1E7ZA 1Q86C 3Q8DA 1HJPA 4A4IA 4A3IG 4GNXA 4NB3A 3GTMH 3J7A5 2NZOA 3F1ZA 5JJIA 5IYDG 4HIKA 3CPWA 3HOVH 4LFBQ 3PGZA 1SE8A 3T1YL 1HNZL 1FVIA 3I4MH 4A3GG 3F2DA 1SLJA 3BZKA 3KLWA 3BJUA 1BBWA 3UE1A 4GOPB 1P8LA 1HZBA 3CCMA 5FJ8G 1Q7YC 1OTCA 2NVQH 2KENA 3FP9A 2B63G 3F2BA 1L1OC 4R4IA 4P74A 3RLFA 2VQEQ 1VQ6A 4DR5L 3OW2A 1IBKQ 2BH8A 3NELA 4DV3L 1VQGA 2K5VA 3RR5A 1HR0Q 2YTVA 2YV5A 2JEAI 3GTGH 4OO1I 1PVOA 4HJAA 4DR7L 4LUVA 4X66Q 2ID0A 1R9TH 3ULPA 1IBMQ 3MEFA 4DV6L 2HQLA 4NXMQ 1T9HA 1V1QA 4R1JA 4IFDG 4AQYL 1C9OA 3CXCA 3I4NH 3S1QH 4IFDJ 2VZAA 3GDEA 4BBRH 2Y0SG 3A5ZB 5BR8L 1XMOL 1L0WA 5M3FG 4PZ7A 1YBYA 2F3IA 3JAMc 1PH4A 3W1BA 1YNXA 2QGQA 3KF8B 3TQYA 3UE0A 2ZJRA 2D62A 1J5EQ 2CQOA 1LYLA 1N34L 2JQOA 5H1SE 4TQUS 4IJLA 5C44H 4UY8C 2JA6G 3KF6A 3H0GG 2B3GA 3KOJA 4NXNQ 1J6QA 1D8LA 2BA1A 3HOVG 3L7ZC 4GN5A 1K73C 3I4MG 1UE1A 3L0OA 1EYGA 1WI5A 1CKOA 1PH7A 3CC4A 1MIUA 3W5OA 2ALYB 1AE2A 3KDFB 1JMCA 4LUZA 3HOYH 3PUWA 4JI4L 3J81j 1XJVA 4IOCA 1I50H 2RCNA 4JBMA 4LFAL 3AFPA 4K0KQ 1AE3A 3PF4A 4JYAL 1C0AA 2IHFA 2L15A 3T1HL 2NN6G 1OXUA 5HGQA 2UUBL 4OWWB 2CWAA 1K8GA 4POFA 1PV4A 2VQFL 1VQ9A 4QIWE 1IL2A 4AH6A 2UUAL 2OCEA 4JI7Q 5LMUQ 3J81c 3DLLA 4DPGA 4PZ8A 3S1RH 1SRUA 4KLKA 1RIPA 2UU9L 4DR4L 4X64Q 4UPAA 1P16A 4A3FH 1YITA 4GLAC 1GVPA 3GTJH 4DV0Q 3E9HA 3RZOH 4B3SL 2N8NA 3HKSA 3S24A 2AMCB 4X62Q 4LFCQ 2YTXA 2ATWA 2ZM6Q 4Y52H 3KJOA 4R4OA 2JA9A 4JBJA 1VQKA 1PH3A 3GTQH 5M5XH 5M5YH 4X65L 4DV1Q 1WCMH 2I5MX 5C4XH 2D0OA 2UXDL 5E7NA 1YI2A 1Q82C 5JJLA 1M1KC 4DR1Q 1EWIA 1Y1WG 4OX9Q 4HJ9A 5FLMG 1HNXL 2VUMH 1SMXA 2MFIA 2N3SA 3ERSX 4IFDI 1EUJA 2KBNA 3JAMi 2ZJPA 5FLXc 3K80C 1VQ4A 3GTLH 4OWTB 1KQSA 3HOWG 4AYBE 4YHHQ 1W3SA 1IBLQ 4B3RL 2OQKA 3GTPH 4A3EG 1XMQQ 4YWLA 2ES2A 1G6PA 5IP7G 2Q2UA 3UDGA 1FJGQ 3A74A 4GKKL 2XTIA 4OONA 5M3MG 4JI6Q 2HT1A 2JA7H 1EIYB 4LWCA 3S1MH 1G291 2AHOB 1X3EA 1HNZQ 1EQRA 2YU9H 2E5LL 4NPSA 4A3MH 5C0XG 4QQBX 1Q1BA 4A3FG 3IRBA 4IPDA 5C0XJ 1IZ6A 4LF9L 3S1NH 5IT9c 1K0RA 3D31A 4JI2L 5LMNW 4A3CH 2VY3A 4DR5Q 4A3LG 1QZGA 3STBD 2ZTCA 4DV3Q 3CW2C 4GLXA 1WCMG 1LM0A 3PUZA 2AWOA 3E0EA 4PMWA 2ASBA 4LF5L 3CCJA 4A93G 1M90C 2JJQA 2KCTA 3AEVA 2CFMA 4ME3A 1VQFA 4DV6Q 1XPOA 5IWAL 3PO3H 2AWNA 4AQYQ 3I7FA 2JEBI 5BR8Q 1FL0A 3UDXA 1B8AA 1K3RA 1XMOQ 4YWKA 1G51A 1I5FA 2PQAB 3TEHB 1H95A 2A1AA 3PUXA 3M4PA 5AJ3L 1X9NA 4MNOA 1Q81C 2K5NA 2E8GA 2DGYA 2PMZE 1YZ6A 3H15A 5IYBH 3CF5A 1N34Q 4QY7A 3OTOQ 1L1OB 2JA5G 1YIJA 4BA1I 1I94L 2JA7G 1OXSC 1TWFH 4L5TA 2MO0A 4C2MH 1JE5A 1E24A 4DKAC 2UXBL 1XPRA 1Y1VH 1Z9FA 1YEZA 1HH2P 2R92G 3RLOA 2HIXA 4BBSG 2JA8H 4DAYB 1VQEA 4JI4Q 3H3VH 1JJGA 1DGSA 4XTCS 4LFAQ 5EAYA 2A19A 1PH2A 5C4XG 2C35B 4GNXB 2NVYH 3T1HQ 4GOPC 3FHWA 1I6HH 2IY5B 3U50C 1VS0A 4PG3A 5ELNA 4JI5Q 1D7QA 2VQFQ 1VQLA 4HIDA 2UUAQ 4IO9A 2IX0A 4LF4Q 1KIXA 3M7NA 2MQHA 4GS3A 1PH1A 1X65A 5C0XI 2UU9Q 1UE7A 1YVCA 4DR4Q 1VCIA 5GADC 4WJ4A 2PI2A 1WJJA 1PH5A 2R7ZH 3KDFA 4B3SQ 1GM5A 3PUVA 3G6EA 1N9WA 3AYHB 3EIVA 1PH6A 2ZJQA 1CKNA 4X65Q 1X3GA 4QJFA 2F4VQ 1E3PA 2K52A 2R93H 2WB1G 1VQIA 4L5RC 2N78A 5GROA 2Q2HA 3U4ZA 3PV0A 1EOVA 1K9MC 3CD6A 4JG2A 4JOIC 3LGJA 1CUKA 3G71A 1HR0W 1UE5A 4DV5Q 1N8RC 2VQEL 4MZ9A 1X6OA 1W2BA 4DR6Q 2XGTA 4B3RQ 3PO2H 5C3EH 3KF6B 1VQMA 1VQJA 2QA4A 3I4NG 4BBRG 1U0LA 3ULLA 4B3ML 2LXJA 5GAHC 1QUQB 4DUZL 4GKKQ 4X66L 1PYSB 2KHJA 5IYCH 4DV7L 1V43A 2B29A 3F8TA 5GAEC 4IPGA 1U5KA 4JI0Q 3FKIH 4DNIA 3MXNB 4LF7L 2CWPA 3VDYA 4XIGS 4DR2L 5K36G 4JI3L 4KHZA 5C44G 3J7ZC 2E5LQ 3K7AH 1AH9A 3I2ZA 3HKZE 5JEAG 3HOXH 4LF9Q 4JBWA 1MJEA 2F52A 1QZHA 2R7ZG 4O0AA 3HOZH 2UXCL 5DLQE 4A3JH 4YY3L 4J15A 1YJ9A 1A0IA 3STBC 1XNQL 3I4OA 3K0XA 3NEMA 4DK6C 3HOYG 4NXNL 4LF8L 4BXXH 4QGUA 4IOAA 1KRSA 1SFOH 2WAQE 4LF5Q 4O2DA 1TXYA 1XPUA 4RG1A 3S2DH 3ER0A 1N36L 2I5LX 4A3BH 1VQHA 4A75A 3GO5A 5IY0A 5IWAQ 1HNWL 3L2PA 1TWAH 2BH2A 3PIPA 4LW1A 4LF6L 4JI1L 3T1YQ 5AJ3Q 1YJNA 1HZAA 2JE6I 1S72A 4POGA 1XNRL 3ICEA 3A5UA 2VW9A 1JT8A 4A3IH 1VQ5A 3M4QA 5GQOA 2GVAA 5IYCG 5IYDH 2RHSB 3J80c 3NENA 4OXPA 2D0PA 1N32L 1I94Q 5M5WH 4DV2L 1N33L 2H5XA 2Z6KA 2Q2TA 2UXBQ 5FJ8H 3I55A 2HIVA 1PHJA 1K83H 1BBUA 1NY4A 1WOCA 1YHBA 4FDBA 3UDIA 5LMNL 2CKZB 1ASYA 3JC66 3W1GA 1SR3A 5J3BA 4L5SA 3S17H 4DR7Q 2N49A 2HHHL 2NVXH 3H3VI 2VUMG 3D0FA 2PQAA 3KFUA 4JV5L 4C3JH 3GTKH 1I3QH 1HZ9A 4JBKA 3CCSA 3RNUA 1A8VA 4UP7A 4WJ3M 4EQ5A 4JI8L 4GOPA 4DR1L 1NE3A 2K50A 2R7DA 1VQBA 2K14A 1Y14B 1KRTA 3RN2A 2K4KA 4Y7NH 2MNAA 3GD7A 4R4TA 2RHQB 3CCQA 3RZDH 3HFZB 1SROA 1VQDA 2I5HA 4YHHL 2VNUD 4B3TL 3CPFA 4APVA 4HIOA 5M3FH 2UUCL 1LUZA 3AFQA 3TREA 2Z0SA 2Z6KC 1XMQL 4YCVA 4C3HH 4HJ8A 2OTJA 1UEBA 2RF4A 2VS1A 4P71A 4AYBG 4BY1H 2OTLA 2IHEA 4A3MG 1YJWA 2JA6H 1KHIA 2WAQG 2E2HH 4JI6L 3H0GH 4BY7H 1OXVA 1TWCH 2FXQA 4TVAB 3OYYA 3EN2A 4A3CG 1KC8C 2WFWA 5ELOA 3ZJYC 3S14H 2OQ0A 3RLNA 4JYAQ 1OXXK 1KAWA 4DV4L 3PF5A 3CMEA 4GN3B 4JOIA 4DUYL 1L2FA 1VQ8A 2UUBQ 1K8AC 2IX1A 4YCUA 4DR3L 1Q12A 3ULJA 4KI0A 4RMFA 2NZHA 1KL9A 2I0QA 3PCOB 3J80i 5IP9H 3PO3G 1VQ7A 4KHPL 3M3YH 1WYDA 2R6GA 4DUZQ 1IYJB 4B3MQ 2VL6A 1E1OA 1EIFA 4DV7Q 4LUOA 2Q2IA 4GKJL 1LTLA 1JJCB 1Z47A 3CC7A 1RL2A 1QVGA 5IE8A 4LF7Q 4GNXC 5IYBG 4DR2Q 3K7UC 1PA6A 4GN4B 4JI3Q 2NVTH 4LFBL 1E1TA 2UXDQ 1QVFA 1MKHA 3CQZH 4HJ7A 1PH9A 1HZCA 1VQAA 1JJ2A 1OXTA 4OWXB 1HNXQ 2K5HA 4YCWA 2UXCQ 4BY1G 4YY3Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GD7 A;  1IXR A;  1Y1V G;  3S16 H;  3OTO L;  4L5Q A;  4A76 A;  1GKH A;  4P72 A;  1UE6 A;  5C4J H;  4ALP A;  1XNQ Q;  3U4V A;  4BY7 G;  4QL5 A;  3CMA A;  1Y1W H;  1QUQ A;  1IBK L;  4LF8 Q;  2JA8 G;  4AIM A;  1NMG A;  1BVS A;  5FLM H;  3GTO H;  1X3F A;  1NTG A;  1HR0 L;  4R4Q A;  1BKB A;  4DAM A;  1N36 Q;  2E2J H;  3HOU H;  4R4C A;  3HOW H;  5HY6 A;  4IPH A;  1HNW Q;  3PIO A;  3CCV A;  1XTD A;  4MTN A;  1IBM L;  3BU2 A;  4A3E H;  1CKM A;  4NXM L;  1CKN B;  4LF6 Q;  3UDF A;  2ZTE A;  3E9I A;  4JI1 Q;  1X55 A;  1YHA A;  3CP0 A;  4P75 A;  2AKW B;  1A62 A;  1O7I A;  1QVC A;  5IP9 G;  5IP7 H;  3CCE A;  4A3K H;  1VQN A;  3M4O H;  1XNR Q;  1VQC A;  3M85 A;  4X6A H;  2KCM A;  5M3M H;  4JI5 L;  2EIF A;  1B7Y B;  2GVB A;  5JEA J;  2CCZ A;  4JC0 A;  4LF4 L;  4JI2 Q;  1X54 A;  1FGU A;  4PZ6 A;  1J5E L;  1JB7 A;  1N32 Q;  4DV2 Q;  1PYB A;  4JCV E;  3CCU A;  1N33 Q;  2WP8 J;  1A63 A;  1KXL A;  2PI2 E;  3AQQ A;  1E22 A;  4A3D H;  1WFQ A;  2ZTD A;  2JK8 A;  2YYZ A;  2K75 A;  2R93 G;  5LMN Q;  2YTY A;  3NBH B;  4IJH A;  3RN5 A;  1B70 B;  1NMF A;  1EQQ A;  2E2I H;  2PNH A;  4A3L H;  2HHH Q;  1PFS A;  4JV5 Q;  3F2C A;  1Q1E A;  3EBE A;  1V9P A;  1X56 A;  2F4V L;  4UP8 A;  5GAG C;  3SGI A;  1VQO A;  2EXD A;  4JI8 Q;  4A93 H;  4K0K L;  2EQS A;  3CC2 A;  4HJ5 A;  3KJP A;  1VQP A;  2OWO A;  1CSQ A;  2MO1 A;  3PO2 G;  1NJI C;  5C3E G;  1YHQ A;  3TS0 A;  3HOU G;  3G4S A;  1CSP A;  3TS2 A;  4OO1 G;  3KYH C;  4DV5 L;  4UP9 A;  1S40 A;  3A0J A;  1TWG H;  5LMU L;  4B3T Q;  4JI7 L;  4LNQ A;  3TRZ A;  3DM3 A;  4DR6 L;  2UUC Q;  2A8V A;  4A3G H;  1KD1 C;  3PSI A;  3FKI G;  5JJK A;  1NBW A;  3M9B A;  4X64 L;  2GN5 A;  4A3K G;  2KHI A;  4P73 A;  4DV0 L;  3CCL A;  4HIM A;  3U58 A;  4BA2 I;  1EFW A;  4YWM A;  4X62 L;  3HOX G;  2JA5 H;  2Y0S E;  4JI0 L;  4LFC L;  4EX5 A;  3I56 A;  2ZM6 L;  3HOZ G;  1ASZ A;  4A3J G;  2R7F A;  2B63 H;  3S15 H;  2BA0 A;  4DV1 L;  3WWV A;  2V1C C;  2R92 H;  4A3D G;  4DV4 Q;  4DUY Q;  4OX9 L;  2LXK A;  3PUY A;  4BBS H;  4BXX G;  1PH8 A;  1S3O A;  1L1O A;  3CCR A;  2IT1 A;  2DUD A;  2LSS A;  3CAM A;  3S2H H;  1GO3 E;  3BZC A;  4DK3 C;  4DR3 Q;  3G48 A;  3K8A A;  4H02 A;  2QEX A;  3HKZ G;  1C7Y A;  4A3B G;  2NN6 I;  1UWV A;  3J81 i;  1TWH H;  1IBL L;  4KHP Q;  1Q8K A;  1SN8 A;  3B6Y A;  1MJC A;  4GLV B;  3K81 C;  4GKJ Q;  1Q46 A;  2WB1 E;  1FJG L;  4IPC A;  4C3I H;  1E7Z A;  1Q86 C;  3Q8D A;  1HJP A;  4A4I A;  4A3I G;  4GNX A;  4NB3 A;  3GTM H;  3J7A 5;  2NZO A;  3F1Z A;  5JJI A;  5IYD G;  4HIK A;  3CPW A;  3HOV H;  4LFB Q;  3PGZ A;  1SE8 A;  3T1Y L;  1HNZ L;  1FVI A;  3I4M H;  4A3G G;  3F2D A;  1SLJ A;  3BZK A;  3KLW A;  3BJU A;  1BBW A;  3UE1 A;  4GOP B;  1P8L A;  1HZB A;  3CCM A;  5FJ8 G;  1Q7Y C;  1OTC A;  2NVQ H;  2KEN A;  3FP9 A;  2B63 G;  3F2B A;  1L1O C;  4R4I A;  4P74 A;  3RLF A;  2VQE Q;  1VQ6 A;  4DR5 L;  3OW2 A;  1IBK Q;  2BH8 A;  3NEL A;  4DV3 L;  1VQG A;  2K5V A;  3RR5 A;  1HR0 Q;  2YTV A;  2YV5 A;  2JEA I;  3GTG H;  4OO1 I;  1PVO A;  4HJA A;  4DR7 L;  4LUV A;  4X66 Q;  2ID0 A;  1R9T H;  3ULP A;  1IBM Q;  3MEF A;  4DV6 L;  2HQL A;  4NXM Q;  1T9H A;  1V1Q A;  4R1J A;  4IFD G;  4AQY L;  1C9O A;  3CXC A;  3I4N H;  3S1Q H;  4IFD J;  2VZA A;  3GDE A;  4BBR H;  2Y0S G;  3A5Z B;  5BR8 L;  1XMO L;  1L0W A;  5M3F G;  4PZ7 A;  1YBY A;  2F3I A;  3JAM c;  1PH4 A;  3W1B A;  1YNX A;  2QGQ A;  3KF8 B;  3TQY A;  3UE0 A;  2ZJR A;  2D62 A;  1J5E Q;  2CQO A;  1LYL A;  1N34 L;  2JQO A;  5H1S E;  4TQU S;  4IJL A;  5C44 H;  4UY8 C;  2JA6 G;  3KF6 A;  3H0G G;  2B3G A;  3KOJ A;  4NXN Q;  1J6Q A;  1D8L A;  2BA1 A;  3HOV G;  3L7Z C;  4GN5 A;  1K73 C;  3I4M G;  1UE1 A;  3L0O A;  1EYG A;  1WI5 A;  1CKO A;  1PH7 A;  3CC4 A;  1MIU A;  3W5O A;  2ALY B;  1AE2 A;  3KDF B;  1JMC A;  4LUZ A;  3HOY H;  3PUW A;  4JI4 L;  3J81 j;  1XJV A;  4IOC A;  1I50 H;  2RCN A;  4JBM A;  4LFA L;  3AFP A;  4K0K Q;  1AE3 A;  3PF4 A;  4JYA L;  1C0A A;  2IHF A;  2L15 A;  3T1H L;  2NN6 G;  1OXU A;  5HGQ A;  2UUB L;  4OWW B;  2CWA A;  1K8G A;  4POF A;  1PV4 A;  2VQF L;  1VQ9 A;  4QIW E;  1IL2 A;  4AH6 A;  2UUA L;  2OCE A;  4JI7 Q;  5LMU Q;  3J81 c;  3DLL A;  4DPG A;  4PZ8 A;  3S1R H;  1SRU A;  4KLK A;  1RIP A;  2UU9 L;  4DR4 L;  4X64 Q;  4UPA A;  1P16 A;  4A3F H;  1YIT A;  4GLA C;  1GVP A;  3GTJ H;  4DV0 Q;  3E9H A;  3RZO H;  4B3S L;  2N8N A;  3HKS A;  3S24 A;  2AMC B;  4X62 Q;  4LFC Q;  2YTX A;  2ATW A;  2ZM6 Q;  4Y52 H;  3KJO A;  4R4O A;  2JA9 A;  4JBJ A;  1VQK A;  1PH3 A;  3GTQ H;  5M5X H;  5M5Y H;  4X65 L;  4DV1 Q;  1WCM H;  2I5M X;  5C4X H;  2D0O A;  2UXD L;  5E7N A;  1YI2 A;  1Q82 C;  5JJL A;  1M1K C;  4DR1 Q;  1EWI A;  1Y1W G;  4OX9 Q;  4HJ9 A;  5FLM G;  1HNX L;  2VUM H;  1SMX A;  2MFI A;  2N3S A;  3ERS X;  4IFD I;  1EUJ A;  2KBN A;  3JAM i;  2ZJP A;  5FLX c;  3K80 C;  1VQ4 A;  3GTL H;  4OWT B;  1KQS A;  3HOW G;  4AYB E;  4YHH Q;  1W3S A;  1IBL Q;  4B3R L;  2OQK A;  3GTP H;  4A3E G;  1XMQ Q;  4YWL A;  2ES2 A;  1G6P A;  5IP7 G;  2Q2U A;  3UDG A;  1FJG Q;  3A74 A;  4GKK L;  2XTI A;  4OON A;  5M3M G;  4JI6 Q;  2HT1 A;  2JA7 H;  1EIY B;  4LWC A;  3S1M H;  1G29 1;  2AHO B;  1X3E A;  1HNZ Q;  1EQR A;  2YU9 H;  2E5L L;  4NPS A;  4A3M H;  5C0X G;  4QQB X;  1Q1B A;  4A3F G;  3IRB A;  4IPD A;  5C0X J;  1IZ6 A;  4LF9 L;  3S1N H;  5IT9 c;  1K0R A;  3D31 A;  4JI2 L;  5LMN W;  4A3C H;  2VY3 A;  4DR5 Q;  4A3L G;  1QZG A;  3STB D;  2ZTC A;  4DV3 Q;  3CW2 C;  4GLX A;  1WCM G;  1LM0 A;  3PUZ A;  2AWO A;  3E0E A;  4PMW A;  2ASB A;  4LF5 L;  3CCJ A;  4A93 G;  1M90 C;  2JJQ A;  2KCT A;  3AEV A;  2CFM A;  4ME3 A;  1VQF A;  4DV6 Q;  1XPO A;  5IWA L;  3PO3 H;  2AWN A;  4AQY Q;  3I7F A;  2JEB I;  5BR8 Q;  1FL0 A;  3UDX A;  1B8A A;  1K3R A;  1XMO Q;  4YWK A;  1G51 A;  1I5F A;  2PQA B;  3TEH B;  1H95 A;  2A1A A;  3PUX A;  3M4P A;  5AJ3 L;  1X9N A;  4MNO A;  1Q81 C;  2K5N A;  2E8G A;  2DGY A;  2PMZ E;  1YZ6 A;  3H15 A;  5IYB H;  3CF5 A;  1N34 Q;  4QY7 A;  3OTO Q;  1L1O B;  2JA5 G;  1YIJ A;  4BA1 I;  1I94 L;  2JA7 G;  1OXS C;  1TWF H;  4L5T A;  2MO0 A;  4C2M H;  1JE5 A;  1E24 A;  4DKA C;  2UXB L;  1XPR A;  1Y1V H;  1Z9F A;  1YEZ A;  1HH2 P;  2R92 G;  3RLO A;  2HIX A;  4BBS G;  2JA8 H;  4DAY B;  1VQE A;  4JI4 Q;  3H3V H;  1JJG A;  1DGS A;  4XTC S;  4LFA Q;  5EAY A;  2A19 A;  1PH2 A;  5C4X G;  2C35 B;  4GNX B;  2NVY H;  3T1H Q;  4GOP C;  3FHW A;  1I6H H;  2IY5 B;  3U50 C;  1VS0 A;  4PG3 A;  5ELN A;  4JI5 Q;  1D7Q A;  2VQF Q;  1VQL A;  4HID A;  2UUA Q;  4IO9 A;  2IX0 A;  4LF4 Q;  1KIX A;  3M7N A;  2MQH A;  4GS3 A;  1PH1 A;  1X65 A;  5C0X I;  2UU9 Q;  1UE7 A;  1YVC A;  4DR4 Q;  1VCI A;  5GAD C;  4WJ4 A;  2PI2 A;  1WJJ A;  1PH5 A;  2R7Z H;  3KDF A;  4B3S Q;  1GM5 A;  3PUV A;  3G6E A;  1N9W A;  3AYH B;  3EIV A;  1PH6 A;  2ZJQ A;  1CKN A;  4X65 Q;  1X3G A;  4QJF A;  2F4V Q;  1E3P A;  2K52 A;  2R93 H;  2WB1 G;  1VQI A;  4L5R C;  2N78 A;  5GRO A;  2Q2H A;  3U4Z A;  3PV0 A;  1EOV A;  1K9M C;  3CD6 A;  4JG2 A;  4JOI C;  3LGJ A;  1CUK A;  3G71 A;  1HR0 W;  1UE5 A;  4DV5 Q;  1N8R C;  2VQE L;  4MZ9 A;  1X6O A;  1W2B A;  4DR6 Q;  2XGT A;  4B3R Q;  3PO2 H;  5C3E H;  3KF6 B;  1VQM A;  1VQJ A;  2QA4 A;  3I4N G;  4BBR G;  1U0L A;  3ULL A;  4B3M L;  2LXJ A;  5GAH C;  1QUQ B;  4DUZ L;  4GKK Q;  4X66 L;  1PYS B;  2KHJ A;  5IYC H;  4DV7 L;  1V43 A;  2B29 A;  3F8T A;  5GAE C;  4IPG A;  1U5K A;  4JI0 Q;  3FKI H;  4DNI A;  3MXN B;  4LF7 L;  2CWP A;  3VDY A;  4XIG S;  4DR2 L;  5K36 G;  4JI3 L;  4KHZ A;  5C44 G;  3J7Z C;  2E5L Q;  3K7A H;  1AH9 A;  3I2Z A;  3HKZ E;  5JEA G;  3HOX H;  4LF9 Q;  4JBW A;  1MJE A;  2F52 A;  1QZH A;  2R7Z G;  4O0A A;  3HOZ H;  2UXC L;  5DLQ E;  4A3J H;  4YY3 L;  4J15 A;  1YJ9 A;  1A0I A;  3STB C;  1XNQ L;  3I4O A;  3K0X A;  3NEM A;  4DK6 C;  3HOY G;  4NXN L;  4LF8 L;  4BXX H;  4QGU A;  4IOA A;  1KRS A;  1SFO H;  2WAQ E;  4LF5 Q;  4O2D A;  1TXY A;  1XPU A;  4RG1 A;  3S2D H;  3ER0 A;  1N36 L;  2I5L X;  4A3B H;  1VQH A;  4A75 A;  3GO5 A;  5IY0 A;  5IWA Q;  1HNW L;  3L2P A;  1TWA H;  2BH2 A;  3PIP A;  4LW1 A;  4LF6 L;  4JI1 L;  3T1Y Q;  5AJ3 Q;  1YJN A;  1HZA A;  2JE6 I;  1S72 A;  4POG A;  1XNR L;  3ICE A;  3A5U A;  2VW9 A;  1JT8 A;  4A3I H;  1VQ5 A;  3M4Q A;  5GQO A;  2GVA A;  5IYC G;  5IYD H;  2RHS B;  3J80 c;  3NEN A;  4OXP A;  2D0P A;  1N32 L;  1I94 Q;  5M5W H;  4DV2 L;  1N33 L;  2H5X A;  2Z6K A;  2Q2T A;  2UXB Q;  5FJ8 H;  3I55 A;  2HIV A;  1PHJ A;  1K83 H;  1BBU A;  1NY4 A;  1WOC A;  1YHB A;  4FDB A;  3UDI A;  5LMN L;  2CKZ B;  1ASY A;  3JC6 6;  3W1G A;  1SR3 A;  5J3B A;  4L5S A;  3S17 H;  4DR7 Q;  2N49 A;  2HHH L;  2NVX H;  3H3V I;  2VUM G;  3D0F A;  2PQA A;  3KFU A;  4JV5 L;  4C3J H;  3GTK H;  1I3Q H;  1HZ9 A;  4JBK A;  3CCS A;  3RNU A;  1A8V A;  4UP7 A;  4WJ3 M;  4EQ5 A;  4JI8 L;  4GOP A;  4DR1 L;  1NE3 A;  2K50 A;  2R7D A;  1VQB A;  2K14 A;  1Y14 B;  1KRT A;  3RN2 A;  2K4K A;  4Y7N H;  2MNA A;  3GD7 A;  4R4T A;  2RHQ B;  3CCQ A;  3RZD H;  3HFZ B;  1SRO A;  1VQD A;  2I5H A;  4YHH L;  2VNU D;  4B3T L;  3CPF A;  4APV A;  4HIO A;  5M3F H;  2UUC L;  1LUZ A;  3AFQ A;  3TRE A;  2Z0S A;  2Z6K C;  1XMQ L;  4YCV A;  4C3H H;  4HJ8 A;  2OTJ A;  1UEB A;  2RF4 A;  2VS1 A;  4P71 A;  4AYB G;  4BY1 H;  2OTL A;  2IHE A;  4A3M G;  1YJW A;  2JA6 H;  1KHI A;  2WAQ G;  2E2H H;  4JI6 L;  3H0G H;  4BY7 H;  1OXV A;  1TWC H;  2FXQ A;  4TVA B;  3OYY A;  3EN2 A;  4A3C G;  1KC8 C;  2WFW A;  5ELO A;  3ZJY C;  3S14 H;  2OQ0 A;  3RLN A;  4JYA Q;  1OXX K;  1KAW A;  4DV4 L;  3PF5 A;  3CME A;  4GN3 B;  4JOI A;  4DUY L;  1L2F A;  1VQ8 A;  2UUB Q;  1K8A C;  2IX1 A;  4YCU A;  4DR3 L;  1Q12 A;  3ULJ A;  4KI0 A;  4RMF A;  2NZH A;  1KL9 A;  2I0Q A;  3PCO B;  3J80 i;  5IP9 H;  3PO3 G;  1VQ7 A;  4KHP L;  3M3Y H;  1WYD A;  2R6G A;  4DUZ Q;  1IYJ B;  4B3M Q;  2VL6 A;  1E1O A;  1EIF A;  4DV7 Q;  4LUO A;  2Q2I A;  4GKJ L;  1LTL A;  1JJC B;  1Z47 A;  3CC7 A;  1RL2 A;  1QVG A;  5IE8 A;  4LF7 Q;  4GNX C;  5IYB G;  4DR2 Q;  3K7U C;  1PA6 A;  4GN4 B;  4JI3 Q;  2NVT H;  4LFB L;  1E1T A;  2UXD Q;  1QVF A;  1MKH A;  3CQZ H;  4HJ7 A;  1PH9 A;  1HZC A;  1VQA A;  1JJ2 A;  1OXT A;  4OWX B;  1HNX Q;  2K5H A;  4YCW A;  2UXC Q;  4BY1 G;  4YY3 Q; 
#chains in the Genus database with same CATH topology
 1GD7 A;  3S16 H;  1SMY C;  4L5Q A;  3OWF A;  1EU4 A;  5C4J H;  1Q3L A;  1TS4 A;  2F4I A;  1GUS A;  4QL5 A;  3HKZ B;  1QUQ A;  1Y1W H;  4A3B B;  1JWS D;  1NTG A;  1BKB A;  2E2J H;  5CBE E;  4OO1 H;  3HOW H;  1PXU A;  1JOK A;  1PTO H;  2A5H A;  3PIO A;  3CCV A;  5I2X A;  1CKM A;  1XTC D;  4NMZ A;  1OO9 B;  2JSO A;  5IP7 H;  3M4O H;  1QVC A;  4H0L C;  2WKC A;  4CJ1 B;  4M8A A;  3TZD A;  3P7J A;  3BDO A;  2CCZ A;  2A6H C;  2M00 A;  4JI2 Q;  5CV8 A;  1TKW B;  5IGD A;  3CCU A;  1A63 A;  1E22 A;  1WFQ A;  4RFB A;  2YYZ A;  1GUT A;  1EQQ A;  1PFS A;  5A35 A;  1C48 A;  1W6J A;  4JV5 Q;  4H44 C;  2DJF C;  2F0V A;  1X56 A;  4UP8 A;  4JI8 Q;  1AEX A;  3E5S A;  1STY A;  1KDA A;  2Z8L A;  2Y0S B;  2OWO A;  2MO1 A;  5FO8 B;  1SBB B;  1DYQ A;  4UP9 A;  5C4Z A;  3K57 A;  4B3T Q;  3A0J A;  3KLS A;  3A8K E;  2XWB B;  4DR6 L;  2UUC Q;  2G9H D;  1AW7 A;  1WVL A;  4A3K G;  4P73 A;  3CCL A;  4HIM A;  3U58 A;  1EZ8 A;  2WV6 D;  3S14 B;  2Y0S E;  4JI0 L;  3E3X A;  4FF2 A;  4LK1 C;  1ASZ A;  4FXG C;  1TII D;  2L1B A;  2LXK A;  3PUY A;  4HSP A;  3BZC A;  3M3Y B;  2NN6 I;  1D1K A;  5HUR A;  3FPU B;  1KDB A;  2Z1C A;  1Y8N B;  1SN8 A;  4DA2 A;  4GLV B;  4DAY A;  5C3X A;  1L0Y B;  2F0L A;  3J80 E;  4IPC A;  4V19 0;  4A4I A;  4A3I G;  3J7A 5;  4GNX A;  5JJI A;  5I9O A;  1I4X A;  5IYD G;  4HIK A;  3CPW A;  1IL8 A;  3BYY B;  2PW7 A;  3PGZ A;  3TP8 A;  3BZK A;  2KCC A;  1BBW A;  2EPB A;  3ZYY X;  3GTO B;  3F2B A;  3RLF A;  2VQE Q;  1VQ6 A;  3UI2 A;  3OW2 A;  2K7V A;  1BCP F;  1KAB A;  3RR5 A;  4IZ8 A;  3GTG H;  4A3E B;  4X66 Q;  3MC0 B;  1R9T H;  1RTN A;  5CV6 A;  4KY5 A;  4IFD G;  4R1J A;  5M3M B;  3NTH A;  4HMI A;  2VZA A;  4BBR H;  1LTS D;  2XN9 C;  3JAM c;  3S1R B;  3W1B A;  2EYP A;  1YNX A;  2QGQ A;  4N9T A;  3TBI B;  1LTI D;  2CQO A;  2JQO A;  1EZ6 A;  4K14 A;  5H1S E;  4RGN A;  4S3S A;  2F0T A;  4EGV A;  4KK7 A;  2RDG A;  3L7Z C;  4CJ0 B;  3OSO A;  1WI5 A;  2B2U C;  1MIU A;  2ALY B;  2QDB A;  3J81 L;  5CMD A;  3H91 A;  3J81 j;  1XJV A;  4JBM A;  2RCN A;  4LFA L;  3AFP A;  2RSO A;  1WTH A;  5C3W A;  2IHF A;  2L15 A;  3TP6 A;  3T1H L;  1TWG B;  2UUB L;  2XNA C;  1SAP A;  1VQ9 A;  2OT2 A;  4AH6 A;  5FKA C;  4DPG A;  3K5O A;  3S1R H;  2JA5 B;  1SRU A;  4KLK A;  1D5M C;  3TP7 A;  4CGY B;  4B3S L;  2N8N A;  4QF4 A;  3S24 A;  2R92 B;  5M5X H;  5M5Y H;  5DEH A;  2D0O A;  2XRS D;  1YI2 A;  4TRD A;  1B2T A;  1EWI A;  1F9S A;  1NCV A;  4L6T B;  2Z9H A;  1EUJ A;  1VQ4 A;  2F0U A;  1PRT F;  2PO4 A;  2KEE A;  5FO9 B;  5JOB A;  4CDC C;  4C3I B;  3J7Y W;  5DM6 3;  2FMC A;  1EY7 A;  2KCN A;  3A74 A;  4BWG B;  5G3L F;  2XTI A;  4NW2 A;  4JI6 Q;  1CM9 A;  2HT1 A;  3V96 A;  1G8Z D;  5BN4 A;  2NVQ B;  2B2W A;  1X3E A;  1I6V C;  1EQR A;  2WB1 B;  3ERO A;  4UAI A;  1JOQ A;  4A3F G;  5I2Y A;  4IPD A;  2K04 A;  4LF9 L;  5LHY 1;  1UUP A;  1K0R A;  3D31 A;  5IT9 c;  1EIG A;  3AU7 A;  4A3L G;  2QCP X;  2F0K A;  3STB D;  5EKK A;  1JWM D;  1BO0 A;  3LWE A;  5F2D A;  3TDQ A;  3S1Q B;  3I8Z A;  4G7Z C;  1D5X C;  1VQF A;  1DJR D;  1XPO A;  3L9A X;  5KYI A;  4L63 B;  1FL0 A;  3UDX A;  5D3I B;  2A6E D;  3NTK A;  2ZT9 C;  1RCV D;  3M4P A;  4RA8 A;  4MNO A;  3NWS A;  1NR2 A;  2DGY A;  3H15 A;  3OTO Q;  2J4X A;  3LX0 A;  4RCN A;  2JA7 G;  1Z7T A;  2LFN A;  4DNR B;  2EOT A;  2OXP A;  3DHQ A;  2B2T C;  2HIX A;  3TN2 A;  3QOJ A;  1VQE A;  3OHX C;  1JJG A;  1BOS A;  1FNW A;  4LFA Q;  4ZK9 B;  2L5T A;  4K6L A;  2C35 B;  2NVY H;  3T1H Q;  4LJZ C;  4H7B A;  1I6H H;  1CHP D;  3T51 B;  3VYU A;  2M2L A;  5ELN A;  1D7Q A;  3HP3 A;  1VQL A;  2HCI A;  3RD4 A;  1KIX A;  1WTW A;  1EYA A;  5C0X I;  1EY4 A;  1JQY D;  2L11 A;  4WJ4 A;  5EBD A;  5EPJ A;  1PH5 A;  4B3S Q;  1GM5 A;  3PUV A;  2NWG A;  1SJH D;  3KBG A;  3D4R A;  2VUM B;  2A69 D;  4KJO A;  1F2L A;  2Q2H A;  1K9M C;  1EOV A;  3LGJ A;  1CUK A;  3G71 A;  1HR0 W;  3I72 A;  4DV5 Q;  4J1M A;  4OGQ C;  2RVL A;  1O7Z A;  3KF6 B;  3HGB A;  1TWA B;  2QA4 A;  5GAH C;  1QUQ B;  2D5D A;  2KHJ A;  4AYB B;  4DV7 L;  1A3T A;  1UEA B;  2B29 A;  4IUN A;  2I46 A;  4A3M B;  4ZUI A;  5DNF A;  1RD9 D;  1V8Q A;  2IL8 A;  2CWP A;  2PCF B;  4Q5V A;  3S1N B;  5K36 G;  2JP1 A;  4JI3 L;  4DAV A;  3K7A H;  5M5W B;  4G57 A;  5JEA G;  4LF9 Q;  4JBW A;  3KK7 A;  1SEB D;  2B2V C;  2F52 A;  2R7Z G;  4XQN A;  3GTP B;  3C46 A;  1YJ9 A;  3BZD B;  4X3K A;  2NTS A;  2MGS A;  3STB C;  2PZU A;  3OMG A;  1S5B D;  1KRS A;  1BBX C;  4FVM A;  3PO3 B;  3GV6 A;  1TXY A;  1UNS A;  3S2D H;  1VQH A;  4A75 A;  3GO5 A;  4Y7N B;  1TWA H;  2A6E C;  3T1Y Q;  3EA6 A;  3AMU A;  5T1I A;  4RHR A;  1S72 A;  4POG A;  2VW9 A;  4A3I H;  3Q0A A;  4C2M B;  5IYD H;  2DNC A;  4OXP A;  4ZRZ A;  1SE4 A;  5ELC A;  3J80 c;  4BY1 B;  1Y1V B;  2D0P A;  5M5W H;  2VB2 X;  2H5X A;  4DGZ A;  3TP5 A;  1QJO A;  1VMP A;  2CW0 D;  3I55 A;  1RDP D;  1S5F D;  1K83 H;  1NY4 A;  3GTP H;  1SR3 A;  5I6Y A;  1LT6 D;  4Q0F A;  1LO5 D;  1XWE A;  3R2T A;  3D0F A;  3KFU A;  5BN5 A;  1I3Q H;  3RMH A;  1HZ9 A;  3CCS A;  1A8V A;  1MBY A;  3NHH A;  1PFM A;  4UP7 A;  1DD2 A;  1VQB A;  1S5E D;  2K4K A;  4Y7N H;  4IFD H;  3FDT A;  2BE5 D;  3EVQ A;  3LNN A;  3HFZ B;  3OMC A;  1H9S B;  2VNU D;  1LUZ A;  2F0S A;  1CZG A;  2Z6K C;  4YCV A;  1HQR D;  1A6X A;  4P71 A;  4BY1 H;  2F0N A;  2OTL A;  3R3O A;  1YJW A;  1DZ1 A;  2WAQ G;  5CGK A;  1TWC H;  4KY7 A;  2A69 C;  3SVM A;  4A3C G;  2D9U A;  4JOI A;  1L2F A;  2H4O A;  1HRJ A;  3PO2 B;  4DR3 L;  5JPN C;  1SJE D;  4KI0 A;  3HOU B;  2X6L A;  2KOL A;  1ZXT A;  1VQ7 A;  4HMJ A;  1MD2 D;  5E4W C;  3FKI B;  1H9J A;  1E1O A;  2QW7 A;  3MAQ A;  1TU2 B;  4DV7 Q;  4GKJ L;  1X3Q A;  1Z47 A;  1RL2 A;  1QVG A;  1HA5 A;  2EY5 A;  3K7U C;  1PA6 A;  4JI3 Q;  4LFB L;  1VF7 A;  1JJ2 A;  1OXT A;  4A3D B;  1S5D D;  2PZT A;  1IXR A;  2NZ1 D;  1WTX A;  4BY7 G;  1IBK L;  3VA7 A;  4DXG A;  1NMG A;  3VR6 A;  4KMU C;  2EY6 A;  1HR0 L;  4DAM A;  3HOU H;  3MXN A;  4KN4 C;  4IPH A;  2SNS A;  1XTD A;  2F03 A;  3ND8 A;  1ML0 D;  3Q22 A;  3UDF A;  3E9I A;  1YHA A;  2AQ1 B;  2AKW B;  2QDL A;  2ZXP A;  1VQN A;  3M85 A;  2KCM A;  2EY1 A;  4F8M A;  4JI5 L;  4XYQ A;  3VYS A;  2A73 B;  4JC0 A;  1J5E L;  1FGU A;  1JB7 A;  2B63 B;  1PYB A;  4JCV E;  2WP8 J;  1D6E C;  1SMY D;  2PI2 E;  3AQQ A;  5ELD A;  2CW0 C;  4A3D H;  4CJ2 C;  1ET6 A;  1M4V A;  3HRZ C;  2EVB A;  3MWY W;  5IOD A;  2E2I H;  4A3L H;  1BQQ T;  3F2C A;  1Q1E A;  3EBE A;  2RA4 A;  2F4V L;  1VQO A;  2AUK A;  1VQP A;  4MTK A;  2B8G A;  3OOC A;  2JN4 A;  2BE5 C;  3TS0 A;  1CSP A;  3PIP 3;  2A6H D;  5LMU L;  4LMQ D;  2A8V A;  2JA6 B;  3H0G B;  4XT1 B;  1EYC A;  2GN5 A;  2SDF A;  4RGO S;  3I4M B;  1EFW A;  4X62 L;  3HOX G;  1F9Q A;  4RKL A;  5EPK A;  1BCP B;  4EX5 A;  4FXK C;  3I56 A;  5C4H A;  3HOZ G;  5EPL A;  3S15 H;  2BA0 A;  4DV1 L;  1U4M A;  1WTO A;  1EY9 A;  4OX9 L;  2HQE A;  3U9O A;  2CHB D;  1S3O A;  4NDX A;  1PH8 A;  4BXX G;  4G7O C;  2IT1 A;  1GO3 E;  4DR3 Q;  1LTB D;  3G48 A;  4Z9C B;  1TWH H;  3H3V C;  3VR5 A;  1KLG D;  1MJC A;  4GKJ Q;  3SDZ A;  1FJG L;  2CH4 W;  3RUZ A;  3G6J B;  3BS1 A;  1Q86 C;  1A3U A;  1FYC A;  1HJP A;  2LMC B;  4NB3 A;  2MHV A;  1B3A A;  4LFB Q;  1EY8 A;  2R3Z A;  3V05 A;  2SEB D;  1SE8 A;  3S16 B;  1A2T A;  1U4L A;  1HNZ L;  3I4M H;  4A3G G;  4CHT B;  5I9P A;  1SLJ A;  3UE1 A;  5C4J B;  1Y1W B;  1HZB A;  1I4G A;  1P8L A;  2KEN A;  5D14 A;  3NBI A;  1L1O C;  4R4I A;  1A3V A;  3ERQ A;  3M7G A;  1HUM A;  1IBK Q;  1G91 A;  1LAB A;  3HOW B;  4RAU C;  4PMC A;  5DM7 3;  1HR0 Q;  2K5V A;  4K8J A;  5D65 A;  2YV5 A;  4I7A A;  3JAM L;  4OO1 I;  5CC4 A;  2ID0 A;  3M4O B;  4DV6 L;  2HQL A;  2ICE C;  4DK1 A;  3CXC A;  4IFD J;  1AFP A;  3HZX A;  1L0W A;  5M3F G;  4PZ7 A;  1YBY A;  1ONL A;  1IKL A;  2RDF A;  2KED A;  4K6D A;  1J5E Q;  4ZUJ A;  1HA6 A;  1N34 L;  4TQU S;  3KF6 A;  4PQX A;  5LL6 X;  2B3G A;  4NXN Q;  3HOV G;  4GN5 A;  1K73 C;  1UE1 A;  1PRT B;  1FR3 A;  1WCM B;  1CKO A;  2K6A A;  5JVH 3;  3W5O A;  5NUC A;  3CRL C;  1AE2 A;  3PUW A;  2RDH A;  2XVS A;  4IOC A;  2H1E A;  2WAC A;  1AE3 A;  3VA5 A;  4JYA L;  1WTP A;  3H6M A;  2KJX A;  2OCE A;  5LMU Q;  5A2Q L;  4IUU A;  1LTA D;  2F0I A;  4UPA A;  1YIT A;  1SNM A;  5E3F A;  1DCZ A;  3S1M B;  3V2T A;  1PFN A;  2LS0 1;  1JOR A;  1QCB D;  2B2Y C;  4X62 Q;  1JIC A;  3ITP A;  4KN7 C;  2YTX A;  2JA9 A;  3GTQ H;  4DV1 Q;  1WCM H;  4ODG A;  5EKL A;  5T1G A;  5E7N A;  5JJL A;  4OX9 Q;  1E0B A;  4HJ9 A;  1AP0 A;  3ERS X;  3JAM i;  3GTL H;  3K80 C;  1HTP A;  1KQS A;  1EL0 A;  4YHH Q;  2R61 A;  2F0D A;  3SR1 A;  1MSG A;  3MFG A;  2QEJ C;  1XMQ Q;  4YWL A;  2Q2U A;  1FJG Q;  1SYE A;  5IT9 L;  3J81 E;  4OON A;  5E4X A;  3T4A C;  3NXW A;  1EIY B;  3S1M H;  2AHO B;  4RKB A;  2YU9 H;  1HNZ Q;  1NSN S;  5C0X G;  5D3D A;  4QQB X;  1IZ6 A;  3DXJ C;  1H9S A;  3A55 A;  5COR A;  3GTG B;  5LMN W;  4A3C H;  3MZ5 A;  2VY3 A;  1R9T B;  3CW2 C;  2AWO A;  4PMW A;  1X3P A;  2B2T A;  4LF5 L;  1PZJ D;  4A93 G;  1M90 C;  4RHS A;  2F1M A;  4BBR B;  1H9R A;  4DV6 Q;  3C2P A;  2EY2 A;  5IWA L;  1ILP A;  4MHE A;  1QWY A;  1B8A A;  1K3R A;  4YWK A;  4B08 A;  3A56 A;  1T5X D;  2EYM A;  2N88 A;  1X9N A;  1V1P B;  2Z6B A;  2K5N A;  5CYU A;  1N34 Q;  2XRQ D;  1L1O B;  4BA1 I;  1I94 L;  1IHZ A;  4L5T A;  4KD4 A;  1HFG A;  2MO0 A;  3W2D A;  4DKA C;  1ENC A;  2UXB L;  1XPR A;  4C1N K;  1YEZ A;  4WOR A;  4BBS G;  4DU9 A;  4RCO A;  4K8I A;  3H3V H;  1O7Y A;  1DGS A;  1FD7 D;  3QO2 A;  1TY2 A;  1MSH A;  4GOP C;  2IY5 B;  3U50 C;  5KEE A;  1VS0 A;  3NQT A;  2PW5 A;  4PG3 A;  2KQ3 A;  4HID A;  2IX0 A;  4KJN A;  3M7N A;  4U67 3;  4GS3 A;  1X65 A;  3Q23 A;  1UE7 A;  3D8G A;  3HS0 C;  4ZAI A;  3OW7 A;  5JPM C;  2PI2 A;  5M5X B;  5M5Y B;  3KDF A;  4ID6 A;  1N9W A;  3AYH B;  3EIV A;  1RHP A;  5HGT A;  2MJ8 A;  2BDN A;  5GRO A;  1LT3 D;  3U4Z A;  3PV0 A;  1ZEQ X;  4NP5 A;  3VR2 A;  1N8R C;  1ESR A;  1TQO A;  1W2B A;  1JB3 A;  5C6A A;  4DR6 Q;  4KHV A;  1BUV T;  1H9M A;  4C1N I;  1VQJ A;  3I4N G;  1U0L A;  2LXJ A;  4DUZ L;  1PYS B;  3F8T A;  4IPG A;  2AUJ D;  2EYL A;  4JI0 Q;  2HD3 A;  1K8O A;  3MXN B;  4XIG S;  5FO7 B;  3C1E A;  5C44 G;  3I2Z A;  3A7A B;  3HOX H;  4QMG A;  3HOZ H;  2UXC L;  1IYV A;  4YY3 L;  4J15 A;  1PLF A;  3EJI A;  1YNN D;  3HOY G;  4BXX H;  4C3J B;  1SFO H;  4LF5 Q;  2DJG C;  4X3T A;  1N36 L;  1ZKO A;  2HUG A;  2I5L X;  1AZQ A;  5IWA Q;  1HNW L;  1GUO A;  2BH2 A;  1STE A;  4ZYS A;  5ELF A;  3SK5 A;  1U4P A;  3RZD B;  1YJN A;  2C5C A;  5JVG 3;  1QG7 A;  1XNR L;  3NQI A;  3NPP A;  1G6Z A;  3M4Q A;  1SSO A;  4C3H B;  5IYC G;  1ZYR D;  2LY7 A;  3NEN A;  3SK4 A;  2FIN B;  2LKV A;  1STH A;  1I94 Q;  1N33 L;  2Z6K A;  2J7Z A;  2OEO A;  3BDL A;  1QNU A;  1V1O A;  2UXB Q;  5C4X G;  3UDI A;  5LMN L;  4OWW B;  2KA7 A;  3JC6 6;  5FLX E;  2BCO A;  2KEC A;  3S17 H;  3D4W A;  2NVY B;  2HHH L;  2NVX H;  1I6H B;  4C3J H;  3GTK H;  3RNU A;  2Q8R E;  4EQ5 A;  1IW7 D;  4DR1 L;  2R7D A;  2K14 A;  1LTG D;  1KRT A;  2MNA A;  2ICI A;  3VR4 A;  3RZD H;  1VQD A;  4K5V A;  3CPF A;  5M3F H;  3AFQ A;  5EKI A;  2Z0S A;  4C3H H;  3I90 A;  4HJ8 A;  4R8N A;  1UEB A;  2E2H H;  4CBV A;  1O78 A;  1OXV A;  3T16 A;  3EN2 A;  1HUN A;  1KC8 C;  2WFW A;  3ZJY C;  2OQ0 A;  3RLN A;  5I6W A;  3MVV A;  1KAW A;  4IUT A;  1QB5 D;  1HHV A;  3PF5 A;  3CME A;  2UUB Q;  2WIN B;  4JW0 A;  1RTO A;  5KIX A;  1Q12 A;  2KUM A;  3C3L A;  3IFD A;  3J80 i;  2HDM A;  5IGB A;  1WYD A;  4DUZ Q;  4QUC A;  1EY0 A;  4LUO A;  2Q2I A;  4A3K B;  4DF7 A;  3BYT B;  4EQN A;  3NE5 B;  3K7A B;  5IE8 A;  4GNX C;  4GN4 B;  1LT4 D;  4KKS A;  2KHS A;  3CQZ H;  1HZC A;  3T53 B;  2DY7 A;  2K5H A;  4YCW A;  2UXC Q;  3TME A;  4YY3 Q;  3QB3 A;  3DWP A;  4ULL A;  1GKH A;  4G4K A;  1UE6 A;  1YNN C;  3S2D B;  3U4V A;  2JA8 G;  2WII B;  2K01 A;  4AIM A;  5KGU A;  1K0S A;  4R4Q A;  1N36 Q;  3OPO A;  3E6Z X;  1PZI D;  3EQL C;  1HTL D;  1HNW Q;  1Z6H A;  4BS9 A;  4A3I B;  2ZTE A;  4XQQ A;  4CKE A;  3CP0 A;  5IP9 G;  1A62 A;  3CCE A;  4A3K H;  4X6A H;  1XNR Q;  3L3O C;  3A8J E;  2GVB A;  1ZYR C;  4DFA A;  4LF4 L;  4PZ6 A;  4PV1 C;  2PPB C;  3D3R A;  1K83 B;  1STA A;  1N33 Q;  2RSN A;  5C0X H;  2K75 A;  2R93 G;  5LMN Q;  2YTY A;  1I3Q B;  3VR3 A;  4IJH A;  4V0B A;  3RN5 A;  1B70 B;  1NMF A;  4OEL B;  2HHH Q;  1KDC A;  5CV7 A;  5EJW A;  3N6R A;  5ELE A;  5GAG C;  3SGI A;  1IW7 C;  3BG3 A;  4A93 H;  2EQS A;  4K0K L;  5ELB A;  3WOF A;  1EQT A;  5K5P A;  3KJP A;  2O5J C;  1CSQ A;  1NJI C;  5C3E G;  2WKD A;  3G4S A;  3TS2 A;  4OO1 G;  3KYH C;  2AQ2 B;  3OIP A;  4LNQ A;  1C0A A;  1G2S A;  3TRZ A;  1KD1 C;  1QIL A;  2NTT A;  3PSI A;  1JOO A;  1TWC B;  4X64 L;  2F0H A;  2K05 A;  4FNF A;  4DV0 L;  1A2U A;  2JXM B;  1SE3 A;  3I73 A;  4BA2 I;  1LTR D;  2XWJ B;  3GV3 A;  5IGF A;  1I4Q A;  4A3J G;  1U9R A;  2R7F A;  1SNP A;  1V1P A;  3W3A A;  3WWV A;  4BBS H;  1L1O A;  2LSS A;  3S2H H;  3CAM A;  1DOK A;  2QEX A;  3HKZ G;  4A3B G;  1B9M A;  3FEW X;  1UWV A;  3QWN A;  1JCK B;  2F0O A;  1Q8K A;  3B6Y A;  2MP1 A;  1B4O A;  2D2C C;  3D4D A;  3Q8D A;  3GTM H;  5EBC A;  2NZO A;  1HXY D;  2B2W C;  1II3 A;  5IGE A;  3F2D A;  3KLW A;  3CKI B;  3MA2 B;  1B50 A;  5CR3 A;  1SND A;  2RKS A;  2QIL A;  3C1F A;  1EEF D;  2BH8 A;  1TS2 A;  3K5N A;  4TSS A;  1VQG A;  4DV3 L;  2YTV A;  4H13 C;  4DR7 L;  4LUV A;  3FVQ A;  1CK1 A;  3MEF A;  1T9H A;  1V1Q A;  3K5L A;  4AQY L;  1C9O A;  3I4N H;  2IPK D;  2K03 A;  2Y0S G;  3A5Z B;  1XMO L;  1HCZ A;  5KND A;  2GA4 B;  2AQ3 B;  3IFT A;  3KF8 B;  4A3F B;  3UE0 A;  2K1B A;  3NUC A;  3GTJ B;  1PTO C;  1LYL A;  1Q90 A;  5C44 H;  4UY8 C;  3QOL A;  2E2I B;  3BVM A;  4KD3 A;  3KOJ A;  1J6Q A;  2BA1 A;  4QIW B;  2B2Y A;  3FRP B;  1EYG A;  1IKM A;  1PH7 A;  1EWC A;  5LL6 S;  5JAV A;  1DXM A;  3X3M A;  3SK8 A;  1B53 A;  3HOY H;  3KDF B;  4R8I A;  3CU7 A;  1JMC A;  1I50 H;  4K0K Q;  2O2L D;  2FFK B;  1T5E A;  2NN6 G;  5HGQ A;  1CI3 M;  1K8G A;  4QCL A;  3X3N A;  4POF A;  2VQF L;  1IL2 A;  4QIW E;  2UUA L;  3TZU A;  4HR7 B;  3DLL A;  4IUP A;  4K5W A;  2UU9 L;  2EDG A;  3JAM E;  1RIP A;  4X64 Q;  4A3F H;  1P16 A;  2JA7 B;  3GTJ H;  4DV0 Q;  3S15 B;  3HKS A;  2ZXR A;  4Y52 H;  1F2M A;  1SDF A;  1I4R A;  4R4O A;  4JBJ A;  1VQK A;  2I5M X;  2EJM A;  5C4X H;  2UXD L;  1FGB D;  1TT2 A;  1M1K C;  4X3S A;  5FLM G;  2Z4I A;  1HNX L;  1SMX A;  1TWH B;  2MFI A;  4J8Q A;  5FOB B;  3E0J A;  5FLX c;  4OWT B;  4DNT B;  3G7L A;  1HFN A;  1W3S A;  2OQK A;  4A3E G;  5J39 A;  3J7A F;  4I7Z C;  4QB4 A;  3LWU A;  2BDO A;  2E75 C;  2ES2 A;  2K5D A;  4KKU A;  3QG1 A;  4CKB A;  3H94 A;  4B9W A;  5M3M G;  4GZY C;  4WRD A;  3M4Y A;  2JA7 H;  2VXW A;  4LWC A;  1G29 1;  3HEJ A;  1SNC A;  2E5L L;  1Q1B A;  5C0X J;  4X3U A;  5A2Q E;  4JI2 L;  3DUZ A;  4XQJ A;  3VYR A;  1L0X B;  4DV3 Q;  2PMZ B;  2CVR A;  1LM0 A;  2HDL A;  4EQO A;  3CCJ A;  1B9N A;  3NSW A;  1CA5 A;  2JJQ A;  2XIW A;  5L37 A;  2CFM A;  4PNY A;  4ME3 A;  2KVM A;  1Y69 U;  4AQY Q;  5FK9 C;  4HAE A;  1S5C D;  2JEB I;  1XMO Q;  3TEH B;  1H95 A;  2A1A A;  1ICF B;  5BN3 A;  1Q81 C;  4DXF A;  3DMU A;  2E8G A;  2PMZ E;  3I70 A;  3CF5 A;  2EXZ A;  2E2D C;  1TY0 A;  4CDD C;  2R7Z B;  2EJG C;  1WTQ A;  5TSS A;  2JA5 G;  1YIJ A;  2A68 D;  1OXS C;  1TWF H;  4OIJ A;  1E24 A;  3T56 B;  1ICW A;  5IT9 E;  1GHJ A;  2B2U A;  1Z9F A;  2R92 G;  1SNO A;  4EVO A;  4MIU A;  2JA8 H;  4LAA A;  1F77 A;  1HPC A;  5EAY A;  2A19 A;  3GP7 A;  1PH2 A;  2K28 A;  1K3B C;  4JI5 Q;  2F0M A;  2VQF Q;  4O1N A;  4IO9 A;  2UUA Q;  1H9K A;  2EYF A;  1PH1 A;  5K36 H;  4C3I G;  2UU9 Q;  1D1I A;  1CQF A;  5JEA H;  3NWT A;  1VCI A;  3GTQ B;  1JR0 D;  1WJJ A;  2R7Z H;  5IOC A;  1PH6 A;  2ENB A;  4HCE A;  2F4V Q;  1E3P A;  2R93 H;  2WB1 G;  3GTL B;  1VQI A;  2JYO A;  2N78 A;  1SYF A;  3CD6 A;  1JE4 A;  4JG2 A;  4JOI C;  1STB A;  1UE5 A;  2VQE L;  4MZ9 A;  2XGT A;  2B39 A;  3P75 A;  5M9O A;  1MGS A;  5C3E H;  1VQM A;  2HCC A;  3ULL A;  4B3M L;  4X66 L;  3URY A;  4ZCK A;  2YU9 B;  1LT5 D;  2G9D A;  4PMB A;  1U5K A;  4N8X 1;  2WAQ B;  5IGG A;  1ROD A;  3VDY A;  4DR2 L;  3N52 A;  3MEH A;  4KHZ A;  3J7Z C;  2E5L Q;  1AH9 A;  3IAY A;  3HKZ E;  2X6G A;  1QOH A;  2XSC A;  1QZH A;  4FO2 A;  5DLQ E;  4A3J H;  3KLS X;  1XNQ L;  3I4O A;  3K0X A;  4DK6 C;  4HCS A;  4LF8 L;  3HG9 A;  1WD1 A;  4YIJ A;  1EFI D;  2WAQ E;  1EWH A;  1XPU A;  3IL8 A;  4RG1 A;  3ER0 A;  1AZP A;  5DAU A;  4A3B H;  1EY6 A;  5IY0 A;  4ME5 A;  4XYO A;  1DOL A;  1SYB A;  3PIP A;  4LF6 L;  4JI1 L;  1QNK A;  2NUC A;  1JT8 A;  1VQ5 A;  1PFB A;  2GVA A;  4NKL A;  2RHS B;  1LAC A;  5EGT A;  4RGM A;  2A68 C;  1N32 L;  4DV2 L;  1F9R A;  4BY7 B;  3PQI A;  2HIV A;  4FDB A;  1WOC A;  1YHB A;  3U9S A;  3W1G A;  5J3B A;  3SEB A;  2N49 A;  3H3V I;  2MPM A;  2VUM G;  2PQA A;  3FPP A;  4XT3 B;  3KLR A;  4RGT A;  4RH6 A;  4WJ3 M;  4ZLT F;  1RKN A;  1Q8I A;  4IUQ A;  4F88 A;  3T13 A;  3WOE A;  4K5X A;  2RHQ B;  1Y8O B;  1SRO A;  2I5H A;  4HIO A;  3BVZ A;  2TSS A;  4AYB G;  2NVT B;  2IHE A;  4A3M G;  2B8F A;  2IWH A;  1KHI A;  4JI6 L;  4BY7 H;  2FXQ A;  4TVA B;  3K0Y A;  3S14 H;  1FNV A;  4UHV A;  4JYA Q;  2F3W A;  3KF8 A;  4DV4 L;  4DUY L;  4GN3 B;  1VQ8 A;  1E2Z A;  1GOZ A;  1VF5 C;  2L0C A;  4M1U B;  1STG A;  4IAL A;  1F2Y A;  1JC7 A;  3ULJ A;  1K28 A;  2NZH A;  1KL9 A;  2I0Q A;  2NN6 H;  3PO3 G;  2EJF C;  4KHP L;  4FF4 A;  3M3Y H;  4B3M Q;  2R6G A;  2VL6 A;  1EIF A;  1A15 A;  1F2Z A;  3TSS A;  1J9O A;  3CC7 A;  4G7H C;  3HOX B;  4DR2 Q;  5IYB G;  3HOZ B;  2NVT H;  1J8I A;  4ZKC B;  1QVF A;  1MKH A;  4HJ7 A;  1VQA A;  2L9H A;  4OWX B;  2B2V A;  1KAA A;  4BY1 G;  3QJY A;  1Y1V G;  1SFO B;  3I91 A;  3OTO L;  4A76 A;  5JJZ A;  1XNQ Q;  4P72 A;  4ALP A;  1EY5 A;  3CMA A;  3K6O A;  5AFW A;  4LF8 Q;  5FLM H;  1BVS A;  3GTO H;  1XX8 A;  1X3F A;  2L4N A;  3BDC A;  3OIQ A;  1BR9 A;  4R4C A;  2DN8 A;  5HY6 A;  2O5I C;  4MTN A;  5EQ0 A;  1IBM L;  1W6K A;  1VDZ A;  1NAP A;  3BU2 A;  1VMC A;  4A3E H;  4NXM L;  1CKN B;  4LF6 Q;  1SYC A;  4OHJ A;  2L55 A;  1X55 A;  2MUY A;  4JI1 Q;  2F0J A;  3AB9 A;  4P75 A;  5C5L A;  1O7I A;  1PTO F;  1CZW A;  1VQC A;  4A3G B;  5M3M H;  2EIF A;  1B7Y B;  2X69 A;  1EEI D;  5JEA J;  2EYH A;  1X54 A;  3IKJ A;  4L8J A;  1N32 Q;  4DV2 Q;  1KXL A;  3S17 B;  1DM0 B;  2F0G A;  2ZTD A;  2JK8 A;  2NVX B;  1ENF A;  2F3V A;  3GTK B;  3NBH B;  2SOB A;  2PNH A;  1LTT D;  2EYJ A;  3J80 L;  1V9P A;  3VYT A;  2EXD A;  4CKC A;  3CC2 A;  3A54 A;  1D5Z C;  2PQE A;  4HJ5 A;  3PO2 G;  4J6H A;  5M3F B;  1YHQ A;  3HOU G;  5CV5 A;  4DV5 L;  3KUP A;  4XDX A;  1S40 A;  4JI7 L;  1ESF A;  1TWG H;  3DM3 A;  4A3G H;  3J7A V;  3FKI G;  2NYZ D;  4HTH A;  2E2H B;  1NBW A;  5JJK A;  3M9B A;  1TR5 A;  3HOV B;  4CDE C;  2KHI A;  1RJT A;  4YWM A;  2JA5 H;  2CQA A;  4LFC L;  4U68 A;  4DK0 A;  2ZM6 L;  1GUW A;  1S4Z A;  1MHW C;  2ZXO A;  2V1C C;  2R92 H;  4A3D G;  4DV4 Q;  4DUY Q;  3CCR A;  3R8B A;  1PYW D;  2DUD A;  5E1F A;  4DK3 C;  4H02 A;  3K8A A;  3ONA B;  1C7Y A;  1I4P A;  3J81 i;  1IBL L;  4KHP Q;  3K5M A;  3K81 C;  1Q46 A;  2WB1 E;  4C3I H;  1E7Z A;  3CQZ B;  2A74 C;  4XXE A;  3F1Z A;  4KV6 A;  4K2K A;  3HOV H;  4P2C B;  3T1Y L;  1FVI A;  4JPB W;  3BJU A;  4CDF C;  4GOP B;  2CH4 A;  3CCM A;  4FP5 D;  5FJ8 G;  1Q7Y C;  1OTC A;  2NVQ H;  3FP9 A;  2B63 G;  2IX3 A;  4P74 A;  4DR5 L;  3NEL A;  1E2V A;  1B1Z A;  4OEM B;  2JEA I;  3P20 A;  5IGC A;  1PVO A;  4HJA A;  1GHK A;  1Y8P B;  2K5Q A;  3WDN A;  3ULP A;  1IBM Q;  1BCP D;  4NXM Q;  4IN3 A;  2V4D A;  3S1Q H;  1O80 A;  3GDE A;  1RF2 D;  2K33 A;  5BR8 L;  3MTS A;  4FYD A;  2VB3 X;  3DWA A;  5J1Z A;  2F0Q A;  2F3I A;  1PMR A;  1PH4 A;  5KRU A;  4ILW A;  3TQY A;  2ZJR A;  2D62 A;  1G2T A;  2NBF A;  1WTV A;  3RZO B;  2SNM A;  4IJL A;  2JA6 G;  3K58 A;  3H0G G;  1LLR D;  5J22 A;  1D8L A;  1PDQ A;  1ENA A;  3I4M G;  3L0O A;  1KTK A;  3CC4 A;  4A93 B;  3MXG A;  4LUZ A;  1KNA A;  3MFY A;  4JI4 L;  2J0T D;  3PF4 A;  3R2I A;  1ILQ A;  1OXU A;  1I4H A;  2E74 C;  2CWA A;  1F9P A;  1U4R A;  1PV4 A;  4JI7 Q;  4ABN A;  4JVZ A;  3J81 c;  2IJ0 A;  4FF3 A;  1PTO D;  4PZ8 A;  1JWU D;  1TVX A;  4DAP A;  4DR4 L;  3OWE B;  4GLA C;  1GVP A;  3RZO H;  3E9H A;  1GXD C;  2AMC B;  5FLX L;  2FHT A;  3DM1 A;  3MHB A;  4LFC Q;  2ATW A;  2ZM6 Q;  3KJO A;  4F7X A;  4BBS B;  1PH3 A;  3DWQ A;  5C5M A;  4X65 L;  3S2H B;  1Q82 C;  4DR1 Q;  2F0E A;  3I3C A;  2K32 A;  1Y1W G;  4MN3 A;  1D2B A;  3MXP A;  2VUM H;  2N3S A;  4IFD I;  2KBN A;  2ZJP A;  3R93 A;  1C4Q A;  2FJ2 A;  3O13 A;  3HOW G;  5I4D A;  4AYB E;  2BOS A;  1IBL Q;  4B3R L;  1K8M A;  3GTM B;  1PRT D;  1G6P A;  3NP8 A;  3MXU A;  5IP7 G;  1DOM A;  3UDG A;  4GKK L;  4ZKB B;  4I65 A;  1HQM C;  1AN8 A;  4DN4 M;  2EZV A;  3H09 A;  1C8C A;  5G3L D;  4NPS A;  4A3M H;  1STN A;  3IRB A;  3S1N H;  3CHB D;  4DR5 Q;  1QZG A;  3SHL A;  2ZTC A;  4WFN 3;  4GLX A;  1WCM G;  3PUZ A;  3E0E A;  4E6I A;  1YNJ D;  2ASB A;  4HN7 A;  1M8A A;  3I4N B;  1NNX A;  2KCT A;  1BCP C;  3AEV A;  3P1H A;  2OF1 A;  2AWN A;  3PO3 H;  1EOT A;  3I7F A;  2TMP A;  5BR8 Q;  1G51 A;  1I5F A;  2PQA B;  1SNQ A;  5KNB A;  3PUX A;  1R4Q B;  5AJ3 L;  5C44 B;  2IW3 A;  1IYU A;  1B44 D;  1YZ6 A;  4R9W A;  4C56 C;  5IYB H;  4QY7 A;  1PZK D;  3EFX D;  1CTM A;  2F0F A;  1SE2 A;  1KLU D;  4C2M H;  1JE5 A;  3HOY B;  3FMC A;  1Y1V H;  1I50 B;  1HH2 P;  3RLO A;  4DAY B;  5CV4 A;  1SXT A;  4JI4 Q;  4O42 A;  2NB0 A;  4XTC S;  4FXD A;  4KY6 A;  1EQV A;  4GNX B;  3SK6 A;  3FHW A;  1CT1 D;  1GUG A;  4OIK A;  3QR8 A;  2P5Z X;  3ND9 A;  2F0P A;  4LF4 Q;  2MQH A;  1GUN A;  5IIF A;  4DR4 Q;  1YVC A;  1X32 A;  5GAD C;  3QIA A;  3G6E A;  5C4X B;  2ZJQ A;  1CKN A;  2RBM A;  2M9V A;  4UDU C;  4KTA A;  1X3G A;  4RWS C;  4QJF A;  4X65 Q;  2K52 A;  2K5W A;  3CRK C;  5COY A;  3Q6S A;  4L5R C;  4TKO B;  2L12 A;  3PIO 3;  2C9O A;  1EU3 A;  1GJX A;  1X6O A;  4JK1 C;  4B3R Q;  4HSV A;  3NBH A;  3PO2 H;  2FMM A;  1PRT C;  4BBR G;  3Q24 A;  4KKT A;  4GKK Q;  2O4X A;  5IYC H;  1B3Q A;  1V43 A;  5GAE C;  3A8I E;  3FKI H;  4DNI A;  4LF7 L;  1BNZ A;  4IUR A;  1NR4 A;  2Q8I B;  3GQB A;  1WTR A;  1XXG A;  4ZQ3 A;  1MJE A;  4O0A A;  1EIH A;  3KBX A;  1A0I A;  4FF1 A;  4HED A;  3NEM A;  4IOA A;  4NXN L;  4QGU A;  1YNJ C;  4O2D A;  2EE1 A;  1CHQ D;  3D6W A;  3L2P A;  1E2W A;  4LW1 A;  4QUF A;  1MI2 A;  5AJ3 Q;  2RQX A;  1TS3 A;  1HZA A;  2JE6 I;  3ICE A;  3A5U A;  1TWF B;  5GQO A;  1CQV A;  3DEP A;  4K2L A;  5KNC A;  5CBA E;  4IQZ A;  2JA8 B;  2Q2T A;  1KNE A;  1TS5 A;  5FJ8 H;  1PHJ A;  5KYL A;  2B63 H;  1BBU A;  3BVG A;  1BF4 A;  2G5D A;  3PMF A;  2CKZ B;  1ASY A;  2RCF A;  4L5S A;  4DR7 Q;  1R4P B;  1O7L A;  1XYI A;  4JV5 L;  1QE6 A;  2EYO A;  1NUC A;  4JBK A;  4JI8 L;  4GOP A;  1NE3 A;  2K50 A;  1CFM A;  1Y14 B;  2PYK A;  3RN2 A;  1ET9 A;  1EYD A;  3GD7 A;  4R4T A;  3SXH A;  3CCQ A;  1SYD A;  2Z4H A;  4YHH L;  4B3T L;  4APV A;  4OL7 A;  2UUC L;  3TRE A;  1DON A;  1XMQ L;  2OTJ A;  2VS1 A;  2RF4 A;  4EQP A;  2R93 B;  2JA6 H;  2QF7 A;  3K59 A;  3H0G H;  2DNE A;  3OYY A;  4N9P A;  3NTI A;  2F0W A;  5ELO A;  2I07 B;  1OXX K;  3NK9 A;  4WJW A;  3DEO A;  2Q8T A;  2PNR C;  1BXT A;  5ISR A;  2QKI C;  1K8A C;  1UAP A;  2PZW A;  2IX1 A;  3A7L A;  1FNU A;  4IUV A;  5C3E B;  4YCU A;  2E2J B;  3F2U A;  4RMF A;  4B9X A;  1PTO B;  1SYG A;  3PCO B;  5IP9 H;  4C3J G;  1LV9 A;  1IYJ B;  3SE0 A;  1LTL A;  1JJC B;  1CA6 A;  3I4L A;  3D6C A;  2E76 C;  4F87 A;  4LF7 Q;  3S9W A;  1BDO A;  4A3J B;  1E1T A;  2UXD Q;  2DY8 A;  1WD0 A;  1PH9 A;  2N55 A;  5CV9 A;  1HNX Q;  4C3H G;  4N8F A; 
#chains in the Genus database with same CATH homology
 1GD7 A;  1IXR A;  1Y1V G;  3S16 H;  3OTO L;  4L5Q A;  4A76 A;  1GKH A;  4P72 A;  1UE6 A;  5C4J H;  4ALP A;  1XNQ Q;  3U4V A;  4BY7 G;  4QL5 A;  3CMA A;  1Y1W H;  1QUQ A;  1IBK L;  4LF8 Q;  2JA8 G;  4AIM A;  1NMG A;  1BVS A;  5FLM H;  3GTO H;  1X3F A;  1NTG A;  1HR0 L;  4R4Q A;  1BKB A;  4DAM A;  1N36 Q;  2E2J H;  3HOU H;  4R4C A;  3HOW H;  5HY6 A;  4IPH A;  1HNW Q;  3PIO A;  3CCV A;  1XTD A;  4MTN A;  1IBM L;  3BU2 A;  4A3E H;  1CKM A;  4NXM L;  1CKN B;  4LF6 Q;  3UDF A;  2ZTE A;  3E9I A;  4JI1 Q;  1X55 A;  1YHA A;  3CP0 A;  4P75 A;  2AKW B;  1A62 A;  1O7I A;  1QVC A;  5IP9 G;  5IP7 H;  3CCE A;  4A3K H;  1VQN A;  3M4O H;  1XNR Q;  1VQC A;  3M85 A;  4X6A H;  2KCM A;  5M3M H;  4JI5 L;  2EIF A;  1B7Y B;  2GVB A;  5JEA J;  2CCZ A;  4JC0 A;  4LF4 L;  4JI2 Q;  1X54 A;  1FGU A;  4PZ6 A;  1J5E L;  1JB7 A;  1N32 Q;  4DV2 Q;  1PYB A;  4JCV E;  3CCU A;  1N33 Q;  2WP8 J;  1A63 A;  1KXL A;  2PI2 E;  3AQQ A;  1E22 A;  4A3D H;  1WFQ A;  2ZTD A;  2JK8 A;  2YYZ A;  2K75 A;  2R93 G;  5LMN Q;  2YTY A;  3NBH B;  4IJH A;  3RN5 A;  1B70 B;  1NMF A;  1EQQ A;  2E2I H;  2PNH A;  4A3L H;  2HHH Q;  1PFS A;  4JV5 Q;  3F2C A;  1Q1E A;  3EBE A;  1V9P A;  1X56 A;  2F4V L;  4UP8 A;  5GAG C;  3SGI A;  1VQO A;  2EXD A;  4JI8 Q;  4A93 H;  4K0K L;  2EQS A;  3CC2 A;  4HJ5 A;  3KJP A;  1VQP A;  2OWO A;  1CSQ A;  2MO1 A;  3PO2 G;  1NJI C;  5C3E G;  1YHQ A;  3TS0 A;  3HOU G;  3G4S A;  1CSP A;  3TS2 A;  4OO1 G;  3KYH C;  4DV5 L;  4UP9 A;  1S40 A;  3A0J A;  1TWG H;  5LMU L;  4B3T Q;  4JI7 L;  4LNQ A;  3TRZ A;  3DM3 A;  4DR6 L;  2UUC Q;  2A8V A;  4A3G H;  1KD1 C;  3PSI A;  3FKI G;  5JJK A;  1NBW A;  3M9B A;  4X64 L;  2GN5 A;  4A3K G;  2KHI A;  4P73 A;  4DV0 L;  3CCL A;  4HIM A;  3U58 A;  4BA2 I;  1EFW A;  4YWM A;  4X62 L;  3HOX G;  2JA5 H;  2Y0S E;  4JI0 L;  4LFC L;  4EX5 A;  3I56 A;  2ZM6 L;  3HOZ G;  1ASZ A;  4A3J G;  2R7F A;  2B63 H;  3S15 H;  2BA0 A;  4DV1 L;  3WWV A;  2V1C C;  2R92 H;  4A3D G;  4DV4 Q;  4DUY Q;  4OX9 L;  2LXK A;  3PUY A;  4BBS H;  4BXX G;  1PH8 A;  1S3O A;  1L1O A;  3CCR A;  2IT1 A;  2DUD A;  2LSS A;  3CAM A;  3S2H H;  1GO3 E;  3BZC A;  4DK3 C;  4DR3 Q;  3G48 A;  3K8A A;  4H02 A;  2QEX A;  3HKZ G;  1C7Y A;  4A3B G;  2NN6 I;  1UWV A;  3J81 i;  1TWH H;  1IBL L;  4KHP Q;  1Q8K A;  1SN8 A;  3B6Y A;  1MJC A;  4GLV B;  3K81 C;  4GKJ Q;  1Q46 A;  2WB1 E;  1FJG L;  4IPC A;  4C3I H;  1E7Z A;  1Q86 C;  3Q8D A;  1HJP A;  4A4I A;  4A3I G;  4GNX A;  4NB3 A;  3GTM H;  3J7A 5;  2NZO A;  3F1Z A;  5JJI A;  5IYD G;  4HIK A;  3CPW A;  3HOV H;  4LFB Q;  3PGZ A;  1SE8 A;  3T1Y L;  1HNZ L;  1FVI A;  3I4M H;  4A3G G;  3F2D A;  1SLJ A;  3BZK A;  3KLW A;  3BJU A;  1BBW A;  3UE1 A;  4GOP B;  1P8L A;  1HZB A;  3CCM A;  5FJ8 G;  1Q7Y C;  1OTC A;  2NVQ H;  2KEN A;  3FP9 A;  2B63 G;  3F2B A;  1L1O C;  4R4I A;  4P74 A;  3RLF A;  2VQE Q;  1VQ6 A;  4DR5 L;  3OW2 A;  1IBK Q;  2BH8 A;  3NEL A;  4DV3 L;  1VQG A;  2K5V A;  3RR5 A;  1HR0 Q;  2YTV A;  2YV5 A;  2JEA I;  3GTG H;  4OO1 I;  1PVO A;  4HJA A;  4DR7 L;  4LUV A;  4X66 Q;  2ID0 A;  1R9T H;  3ULP A;  1IBM Q;  3MEF A;  4DV6 L;  2HQL A;  4NXM Q;  1T9H A;  1V1Q A;  4R1J A;  4IFD G;  4AQY L;  1C9O A;  3CXC A;  3I4N H;  3S1Q H;  4IFD J;  2VZA A;  3GDE A;  4BBR H;  2Y0S G;  3A5Z B;  5BR8 L;  1XMO L;  1L0W A;  5M3F G;  4PZ7 A;  1YBY A;  2F3I A;  3JAM c;  1PH4 A;  3W1B A;  1YNX A;  2QGQ A;  3KF8 B;  3TQY A;  3UE0 A;  2ZJR A;  2D62 A;  1J5E Q;  2CQO A;  1LYL A;  1N34 L;  2JQO A;  5H1S E;  4TQU S;  4IJL A;  5C44 H;  4UY8 C;  2JA6 G;  3KF6 A;  3H0G G;  2B3G A;  3KOJ A;  4NXN Q;  1J6Q A;  1D8L A;  2BA1 A;  3HOV G;  3L7Z C;  4GN5 A;  1K73 C;  3I4M G;  1UE1 A;  3L0O A;  1EYG A;  1WI5 A;  1CKO A;  1PH7 A;  3CC4 A;  1MIU A;  3W5O A;  2ALY B;  1AE2 A;  3KDF B;  1JMC A;  4LUZ A;  3HOY H;  3PUW A;  4JI4 L;  3J81 j;  1XJV A;  4IOC A;  1I50 H;  2RCN A;  4JBM A;  4LFA L;  3AFP A;  4K0K Q;  1AE3 A;  3PF4 A;  4JYA L;  1C0A A;  2IHF A;  2L15 A;  3T1H L;  2NN6 G;  1OXU A;  5HGQ A;  2UUB L;  4OWW B;  2CWA A;  1K8G A;  4POF A;  1PV4 A;  2VQF L;  1VQ9 A;  4QIW E;  1IL2 A;  4AH6 A;  2UUA L;  2OCE A;  4JI7 Q;  5LMU Q;  3J81 c;  3DLL A;  4DPG A;  4PZ8 A;  3S1R H;  1SRU A;  4KLK A;  1RIP A;  2UU9 L;  4DR4 L;  4X64 Q;  4UPA A;  1P16 A;  4A3F H;  1YIT A;  4GLA C;  1GVP A;  3GTJ H;  4DV0 Q;  3E9H A;  3RZO H;  4B3S L;  2N8N A;  3HKS A;  3S24 A;  2AMC B;  4X62 Q;  4LFC Q;  2YTX A;  2ATW A;  2ZM6 Q;  4Y52 H;  3KJO A;  4R4O A;  2JA9 A;  4JBJ A;  1VQK A;  1PH3 A;  3GTQ H;  5M5X H;  5M5Y H;  4X65 L;  4DV1 Q;  1WCM H;  2I5M X;  5C4X H;  2D0O A;  2UXD L;  5E7N A;  1YI2 A;  1Q82 C;  5JJL A;  1M1K C;  4DR1 Q;  1EWI A;  1Y1W G;  4OX9 Q;  4HJ9 A;  5FLM G;  1HNX L;  2VUM H;  1SMX A;  2MFI A;  2N3S A;  3ERS X;  4IFD I;  1EUJ A;  2KBN A;  3JAM i;  2ZJP A;  5FLX c;  3K80 C;  1VQ4 A;  3GTL H;  4OWT B;  1KQS A;  3HOW G;  4AYB E;  4YHH Q;  1W3S A;  1IBL Q;  4B3R L;  2OQK A;  3GTP H;  4A3E G;  1XMQ Q;  4YWL A;  2ES2 A;  1G6P A;  5IP7 G;  2Q2U A;  3UDG A;  1FJG Q;  3A74 A;  4GKK L;  2XTI A;  4OON A;  5M3M G;  4JI6 Q;  2HT1 A;  2JA7 H;  1EIY B;  4LWC A;  3S1M H;  1G29 1;  2AHO B;  1X3E A;  1HNZ Q;  1EQR A;  2YU9 H;  2E5L L;  4NPS A;  4A3M H;  5C0X G;  4QQB X;  1Q1B A;  4A3F G;  3IRB A;  4IPD A;  5C0X J;  1IZ6 A;  4LF9 L;  3S1N H;  5IT9 c;  1K0R A;  3D31 A;  4JI2 L;  5LMN W;  4A3C H;  2VY3 A;  4DR5 Q;  4A3L G;  1QZG A;  3STB D;  2ZTC A;  4DV3 Q;  3CW2 C;  4GLX A;  1WCM G;  1LM0 A;  3PUZ A;  2AWO A;  3E0E A;  4PMW A;  2ASB A;  4LF5 L;  3CCJ A;  4A93 G;  1M90 C;  2JJQ A;  2KCT A;  3AEV A;  2CFM A;  4ME3 A;  1VQF A;  4DV6 Q;  1XPO A;  5IWA L;  3PO3 H;  2AWN A;  4AQY Q;  3I7F A;  2JEB I;  5BR8 Q;  1FL0 A;  3UDX A;  1B8A A;  1K3R A;  1XMO Q;  4YWK A;  1G51 A;  1I5F A;  2PQA B;  3TEH B;  1H95 A;  2A1A A;  3PUX A;  3M4P A;  5AJ3 L;  1X9N A;  4MNO A;  1Q81 C;  2K5N A;  2E8G A;  2DGY A;  2PMZ E;  1YZ6 A;  3H15 A;  5IYB H;  3CF5 A;  1N34 Q;  4QY7 A;  3OTO Q;  1L1O B;  2JA5 G;  1YIJ A;  4BA1 I;  1I94 L;  2JA7 G;  1OXS C;  1TWF H;  4L5T A;  2MO0 A;  4C2M H;  1JE5 A;  1E24 A;  4DKA C;  2UXB L;  1XPR A;  1Y1V H;  1Z9F A;  1YEZ A;  1HH2 P;  2R92 G;  3RLO A;  2HIX A;  4BBS G;  2JA8 H;  4DAY B;  1VQE A;  4JI4 Q;  3H3V H;  1JJG A;  1DGS A;  4XTC S;  4LFA Q;  5EAY A;  2A19 A;  1PH2 A;  5C4X G;  2C35 B;  4GNX B;  2NVY H;  3T1H Q;  4GOP C;  3FHW A;  1I6H H;  2IY5 B;  3U50 C;  1VS0 A;  4PG3 A;  5ELN A;  4JI5 Q;  1D7Q A;  2VQF Q;  1VQL A;  4HID A;  2UUA Q;  4IO9 A;  2IX0 A;  4LF4 Q;  1KIX A;  3M7N A;  2MQH A;  4GS3 A;  1PH1 A;  1X65 A;  5C0X I;  2UU9 Q;  1UE7 A;  1YVC A;  4DR4 Q;  1VCI A;  5GAD C;  4WJ4 A;  2PI2 A;  1WJJ A;  1PH5 A;  2R7Z H;  3KDF A;  4B3S Q;  1GM5 A;  3PUV A;  3G6E A;  1N9W A;  3AYH B;  3EIV A;  1PH6 A;  2ZJQ A;  1CKN A;  4X65 Q;  1X3G A;  4QJF A;  2F4V Q;  1E3P A;  2K52 A;  2R93 H;  2WB1 G;  1VQI A;  4L5R C;  2N78 A;  5GRO A;  2Q2H A;  3U4Z A;  3PV0 A;  1EOV A;  1K9M C;  3CD6 A;  4JG2 A;  4JOI C;  3LGJ A;  1CUK A;  3G71 A;  1HR0 W;  1UE5 A;  4DV5 Q;  1N8R C;  2VQE L;  4MZ9 A;  1X6O A;  1W2B A;  4DR6 Q;  2XGT A;  4B3R Q;  3PO2 H;  5C3E H;  3KF6 B;  1VQM A;  1VQJ A;  2QA4 A;  3I4N G;  4BBR G;  1U0L A;  3ULL A;  4B3M L;  2LXJ A;  5GAH C;  1QUQ B;  4DUZ L;  4GKK Q;  4X66 L;  1PYS B;  2KHJ A;  5IYC H;  4DV7 L;  1V43 A;  2B29 A;  3F8T A;  5GAE C;  4IPG A;  1U5K A;  4JI0 Q;  3FKI H;  4DNI A;  3MXN B;  4LF7 L;  2CWP A;  3VDY A;  4XIG S;  4DR2 L;  5K36 G;  4JI3 L;  4KHZ A;  5C44 G;  3J7Z C;  2E5L Q;  3K7A H;  1AH9 A;  3I2Z A;  3HKZ E;  5JEA G;  3HOX H;  4LF9 Q;  4JBW A;  1MJE A;  2F52 A;  1QZH A;  2R7Z G;  4O0A A;  3HOZ H;  2UXC L;  5DLQ E;  4A3J H;  4YY3 L;  4J15 A;  1YJ9 A;  1A0I A;  3STB C;  1XNQ L;  3I4O A;  3K0X A;  3NEM A;  4DK6 C;  3HOY G;  4NXN L;  4LF8 L;  4BXX H;  4QGU A;  4IOA A;  1KRS A;  1SFO H;  2WAQ E;  4LF5 Q;  4O2D A;  1TXY A;  1XPU A;  4RG1 A;  3S2D H;  3ER0 A;  1N36 L;  2I5L X;  4A3B H;  1VQH A;  4A75 A;  3GO5 A;  5IY0 A;  5IWA Q;  1HNW L;  3L2P A;  1TWA H;  2BH2 A;  3PIP A;  4LW1 A;  4LF6 L;  4JI1 L;  3T1Y Q;  5AJ3 Q;  1YJN A;  1HZA A;  2JE6 I;  1S72 A;  4POG A;  1XNR L;  3ICE A;  3A5U A;  2VW9 A;  1JT8 A;  4A3I H;  1VQ5 A;  3M4Q A;  5GQO A;  2GVA A;  5IYC G;  5IYD H;  2RHS B;  3J80 c;  3NEN A;  4OXP A;  2D0P A;  1N32 L;  1I94 Q;  5M5W H;  4DV2 L;  1N33 L;  2H5X A;  2Z6K A;  2Q2T A;  2UXB Q;  5FJ8 H;  3I55 A;  2HIV A;  1PHJ A;  1K83 H;  1BBU A;  1NY4 A;  1WOC A;  1YHB A;  4FDB A;  3UDI A;  5LMN L;  2CKZ B;  1ASY A;  3JC6 6;  3W1G A;  1SR3 A;  5J3B A;  4L5S A;  3S17 H;  4DR7 Q;  2N49 A;  2HHH L;  2NVX H;  3H3V I;  2VUM G;  3D0F A;  2PQA A;  3KFU A;  4JV5 L;  4C3J H;  3GTK H;  1I3Q H;  1HZ9 A;  4JBK A;  3CCS A;  3RNU A;  1A8V A;  4UP7 A;  4WJ3 M;  4EQ5 A;  4JI8 L;  4GOP A;  4DR1 L;  1NE3 A;  2K50 A;  2R7D A;  1VQB A;  2K14 A;  1Y14 B;  1KRT A;  3RN2 A;  2K4K A;  4Y7N H;  2MNA A;  3GD7 A;  4R4T A;  2RHQ B;  3CCQ A;  3RZD H;  3HFZ B;  1SRO A;  1VQD A;  2I5H A;  4YHH L;  2VNU D;  4B3T L;  3CPF A;  4APV A;  4HIO A;  5M3F H;  2UUC L;  1LUZ A;  3AFQ A;  3TRE A;  2Z0S A;  2Z6K C;  1XMQ L;  4YCV A;  4C3H H;  4HJ8 A;  2OTJ A;  1UEB A;  2RF4 A;  2VS1 A;  4P71 A;  4AYB G;  4BY1 H;  2OTL A;  2IHE A;  4A3M G;  1YJW A;  2JA6 H;  1KHI A;  2WAQ G;  2E2H H;  4JI6 L;  3H0G H;  4BY7 H;  1OXV A;  1TWC H;  2FXQ A;  4TVA B;  3OYY A;  3EN2 A;  4A3C G;  1KC8 C;  2WFW A;  5ELO A;  3ZJY C;  3S14 H;  2OQ0 A;  3RLN A;  4JYA Q;  1OXX K;  1KAW A;  4DV4 L;  3PF5 A;  3CME A;  4GN3 B;  4JOI A;  4DUY L;  1L2F A;  1VQ8 A;  2UUB Q;  1K8A C;  2IX1 A;  4YCU A;  4DR3 L;  1Q12 A;  3ULJ A;  4KI0 A;  4RMF A;  2NZH A;  1KL9 A;  2I0Q A;  3PCO B;  3J80 i;  5IP9 H;  3PO3 G;  1VQ7 A;  4KHP L;  3M3Y H;  1WYD A;  2R6G A;  4DUZ Q;  1IYJ B;  4B3M Q;  2VL6 A;  1E1O A;  1EIF A;  4DV7 Q;  4LUO A;  2Q2I A;  4GKJ L;  1LTL A;  1JJC B;  1Z47 A;  3CC7 A;  1RL2 A;  1QVG A;  5IE8 A;  4LF7 Q;  4GNX C;  5IYB G;  4DR2 Q;  3K7U C;  1PA6 A;  4GN4 B;  4JI3 Q;  2NVT H;  4LFB L;  1E1T A;  2UXD Q;  1QVF A;  1MKH A;  3CQZ H;  4HJ7 A;  1PH9 A;  1HZC A;  1VQA A;  1JJ2 A;  1OXT A;  4OWX B;  1HNX Q;  2K5H A;  4YCW A;  2UXC Q;  4BY1 G;  4YY3 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...