4DAYB

Crystal structure of the rmi core complex with mm2 peptide from fancm
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
135
structure length
113
Chain Sequence
AGVRLPRSPPLKVLAEQLRRDAAVWMQGRVVMADRGEARLRDPSGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RecQ-mediated genome instability protein 1
publication title Defining the molecular interface that connects the Fanconi anemia protein FANCM to the Bloom syndrome dissolvasome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/hydrolase
total genus 22
structure length 113
sequence length 135
ec nomenclature
pdb deposition date 2012-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16100 RMI2 RecQ-mediated genome instability protein 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dayB00
4JI6L 3ULLA 4JV5L 4OO1G 4HIDA 4A3IG 1VQFA 3RZOH 5IP7H 5ELOA 1PV4A 2IX0A 2BA0A 3OYYA 3PO2H 2R92H 4LF7Q 2ZTCA 2HIXA 2K5HA 4LW1A 3Q8DA 2VQEQ 3KF6A 1KQSA 1GO3E 3S1NH 2UXBQ 3CMAA 2RHQB 1BBWA 5IYCG 1Q8KA 4WJ4A 3ERSX 2A1AA 1JB7A 1UE5A 3S2DH 4DK6C 4A3KG 1TWHH 3PIOA 2CKZB 2MNAA 3J7A5 3I4NH 2UXBL 2VQEL 4B3TQ 3GTLH 1JT8A 4DR3Q 1PA6A 2B63G 1VQIA 4BBRH 3CCRA 3S17H 3FP9A 3CCSA 3T1YL 5M5WH 3SGIA 3W5OA 4J15A 4DV3L 4BA2I 2E8GA 2F52A 3AQQA 5IYBH 3I2ZA 1V9PA 2K4KA 1WJJA 4GLXA 4A3FH 1GM5A 4GKJQ 3HFZB 1E1TA 3F2BA 1SMXA 2MO0A 4B3RL 1M90C 4A3BG 4P72A 4B3TL 4LWCA 1K3RA 2AHOB 2K75A 4IFDI 2EXDA 1SN8A 5IP9H 2JEAI 1PH6A 4HIKA 4DR7Q 4R4QA 4A93H 1OXTA 4TQUS 2ALYB 3UDXA 4NPSA 3FKIH 4POGA 4GKKQ 4DR5L 5IWAL 3J81j 4A3JH 1Y1WG 1L0WA 2YYZA 5IT9c 3ULPA 1EFWA 2OWOA 1DGSA 4YWMA 1VQ9A 2K5VA 3I4MH 5IYDH 3KOJA 3G4SA 1HNWQ 4UP7A 4JYAQ 5FJ8G 2UXDL 4UPAA 1VQNA 1L1OB 1YZ6A 5C44H 3IRBA 1YJNA 4DR7L 1IZ6A 1TWAH 2Q2HA 5GADC 1YIJA 3TRZA 4GKKL 2IHFA 2WB1E 4IOCA 1QZHA 4DNIA 1GVPA 1Q1EA 1HJPA 2ATWA 3GDEA 1PH3A 3A0JA 1T9HA 4DR1L 4IPGA 5IE8A 1L2FA 3S2HH 4IJLA 1HNWL 4X62Q 1IBKL 2ID0A 2JE6I 3HOZH 4LNQA 4B3ML 1QVCA 3H0GH 2E5LQ 4DV6L 1S40A 1N32Q 5FLMG 3KJPA 1UE1A 4P74A 3GTJH 3ICEA 1I3QH 5C4XH 1WCMG 3NBHB 4QJFA 4L5QA 5E7NA 3RLFA 2Q2TA 1VQPA 3AFPA 3HOVG 3PO3H 3HOWH 3BU2A 2UUCQ 2Z0SA 3M4QA 1PFSA 4X62L 3E9HA 2QGQA 4GNXA 1X3EA 2UU9Q 2N3SA 2ZM6Q 3U58A 2FXQA 4DV4Q 3VDYA 1BKBA 2E5LL 4DR6L 2ZJRA 3RLOA 1XPOA 3PF4A 4A3GG 4GOPC 4LFAQ 2NN6I 1MJCA 1V43A 3PUZA 4AH6A 3S1RH 3CAMA 3BZCA 2PQAA 1VQ7A 2JA8G 2VUMG 5C4JH 2JA6H 1NTGA 1NMGA 2UUCL 3EBEA 3TREA 1K9MC 4QL5A 1JJGA 3HOXG 2ZM6L 4DV4L 3S14H 2ASBA 3W1BA 1VQBA 4BXXG 4JBMA 4A3MH 3H3VH 3HOUH 3HOYH 3CF5A 1TXYA 4HJ7A 1PHJA 3CD6A 2VY3A 3WWVA 4JI2Q 2PI2A 3JC66 2HHHQ 1E1OA 2WFWA 2UUAQ 3JAMi 5GROA 4DUYQ 4H02A 1OXVA 3KF8B 4JI3Q 5HGQA 1PVOA 1A0IA 4JOIC 1CKNA 4JI6Q 3STBD 1IL2A 4JV5Q 1KL9A 4OX9Q 1Q7YC 1Q12A 1V1QA 2MO1A 1K83H 2WP8J 1WI5A 1EIFA 1G291 4DV5L 5J3BA 3K81C 4LFCL 1I94Q 2UUAL 3DLLA 4AQYL 1YVCA 3M7NA 1GKHA 1N8RC 1KD1C 5IP7G 2LXKA 3CPWA 1TWCH 4JI3L 2JA5H 3H3VI 3J7ZC 3PO2G 1C9OA 2R92G 2H5XA 4OX9L 4JI0L 2NVXH 3BJUA 2V1CC 3CC2A 3K80C 3UDIA 2WAQE 4GN5A 3CCUA 3W1GA 4A3DG 5GAHC 3CW2C 1I94L 4IFDG 1Q1BA 2BH8A 1HNZQ 1EIYB 1MIUA 2KHJA 2DGYA 3I4OA 1AE3A 4LF6L 1NE3A 2VQFL 3T1YQ 4UY8C 2CFMA 1KAWA 4LUZA 1KIXA 4LF9Q 4OWTB 4DV3Q 2CCZA 3I4NG 3L7ZC 3K7UC 1Z47A 2D0PA 4BBRG 3I7FA 3UDGA 1VQCA 1EYGA 1W3SA 4O2DA 5LMNQ 4RMFA 1HH2P 4DV2L 4HIOA 2R93H 1BBUA 4GLAC 1HNZL 5BR8Q 1X55A 5IYBG 3S16H 1LYLA 3AFQA 1I5FA 4NB3A 2JK8A 4YY3L 1PYSB 1PH5A 1N36L 1EQQA 4A3FG 1P16A 4KHPQ 1QZGA 3RN5A 4LF9L 4IOAA 3A5ZB 4DV0L 4HJAA 3MXNB 3JAMc 4B3RQ 3RZDH 4IPDA 4JBKA 3TS0A 1SFOH 4DR5Q 4A3CH 2ES2A 4A76A 3GTPH 5IWAQ 5IP9G 5LMNL 4HJ5A 2HT1A 1X56A 1UE7A 2KCTA 1AE2A 3CQZH 4GNXB 5BR8L 3BZKA 4XIGS 3OTOL 1X54A 1U5KA 2B3GA 2UXCL 2UXDQ 1HR0Q 4KHPL 4P71A 2I0QA 5M5XH 4UP8A 4AIMA 4BY1H 4YCWA 4JI8L 2ZTEA 4POFA 4YHHL 4HJ8A 3AYHB 5IYDG 2WB1G 2NVQH 1UE6A 2PQAB 1U0LA 4GN4B 3I4MG 2XTIA 3CCJA 1JMCA 2VS1A 1N34L 3U4VA 5C44G 1HNXL 4ALPA 1VQOA 4DR1Q 3B6YA 3MEFA 3E9IA 1J5EQ 2GVAA 1IBKQ 1HR0L 1L1OC 2I5HA 4B3MQ 4DV6Q 3CCMA 4IPHA 5LMUQ 2N8NA 4BBSH 1KRSA 1VQKA 1IBML 2NN6G 3KYHC 2R7FA 2R7ZH 1YHBA 3HOZG 1YHAA 2DUDA 1UEBA 4QIWE 4BA1I 3L2PA 1YHQA 3H0GG 3LGJA 1CKNB 5FLXc 1HR0W 1CSPA 3UE1A 1J5EL 5C4XG 2E2IH 3ER0A 4JI5L 4OWXB 2RHSB 2UUBL 1WOCA 4DR6Q 1NY4A 4Y52H 4OONA 4R1JA 3CP0A 4LUVA 3CCEA 5LMUL 3HOWG 3PO3G 4BY7H 2K52A 1Q82C 1XNRL 1E7ZA 1G51A 1VCIA 3T1HQ 3GTMH 1E22A 3K8AA 1K0RA 1VQHA 1KXLA 1VQ6A 5GAGC 4OWWB 4LUOA 5AJ3Q 1QUQA 4WJ3M 3PUWA 4YWKA 1PH9A 1K8AC 4MZ9A 1PH1A 1VQ8A 4DV7L 1LTLA 3PIPA 4C3HH 5HY6A 1X3FA 1EOVA 2B29A 3I56A 2JA6G 4YCUA 3HKZG 4MNOA 2RF4A 3KF6B 4L5SA 1S3OA 3T1HL 1SRUA 4K0KL 1ASYA 1Z9FA 3J80i 5AJ3L 5JJIA 1EQRA 1PYBA 3KFUA 4A3MG 3HOYG 2L15A 3GTQH 3HOUG 2GN5A 1YI2A 4LFBQ 3F2DA 3G6EA 4IPCA 1XNRQ 3CCVA 5DLQE 2VZAA 4X65Q 5M5YH 3GTOH 4A75A 4TVAB 4HIMA 1YJ9A 2LXJA 2PI2E 1PH2A 4X66L 4LF8Q 2YTXA 2N49A 3HKZE 3CPFA 3H15A 1KRTA 4A3EH 1XMQL 1H95A 2A19A 3A74A 4DV5Q 2Y0SE 1I6HH 3RN2A 4LFCQ 4GLVB 4AQYQ 2F4VL 1MKHA 1XPRA 2EIFA 1YITA 4LFBL 2NVYH 3K0XA 1A63A 2JA7H 3CC4A 1CSQA 2YTVA 2OTLA 3U50C 1E24A 1NMFA 4X65L 1O7IA 3OW2A 4B3SL 3KDFA 4JI0Q 4LF8L 2JQOA 1S72A 5JJKA 3D31A 2WAQG 5M3FH 1B8AA 1B70B 1Y1VG 4KLKA 4QY7A 4XTCS 3TQYA 4C3IH 5C3EH 1X6OA 1I50H 2Z6KC 1OXSC 1NBWA 4APVA 4JI4L 4O0AA 4LF6Q 2VQFQ 3K7AH 5IY0A 1FVIA 2CQOA 2KBNA 1PH7A 1YBYA 4BXXH 4A4IA 3RLNA 1EUJA 3KLWA 4X64Q 4JI1L 4GN3B 4C3JH 2MQHA 1JE5A 3PUYA 2XGTA 3A5UA 2VW9A 4DPGA 2R7DA 3J81i 4DV1Q 4DV2Q 2NVTH 5C0XI 3F2CA 1X3GA 1HZBA 4R4IA 1LM0A 4YY3Q 3TS2A 1N36Q 2E2JH 1HZCA 1NJIC 2NZOA 5M3MH 1ASZA 4C2MH 4DV0Q 1KC8C 2KHIA 3J80c 3S15H 1RIPA 4X64L 3KJOA 1VQ4A 1J6QA 1AH9A 1N33Q 3M4OH 3S24A 1B7YB 4DV1L 4IJHA 1Q86C 4P73A 1C7YA 3PCOB 1CKMA 4P75A 3OTOQ 4DAMA 1QVFA 4A3CG 1VQEA 3D0FA 3F8TA 2UXCQ 1D8LA 1WFQA 2OQKA 1VQMA 2LSSA 1TWFH 4GOPA 4A3IH 4JI8Q 2YU9H 1IBLL 4PG3A 4YHHQ 4NXMQ 2PNHA 1CKOA 3GD7A 3STBC 1N33L 1FJGL 1SE8A 3CMEA 4A3DH 1QUQB 1N34Q 3EIVA 4DUZQ 2CWPA 1HNXQ 4A93G 4GNXC 4BY1G 2YV5A 4JCVE 5IYCH 3HKSA 3GTGH 4IFDJ 2K50A 3FKIG 2R6GA 1P8LA 4PMWA 4NXNQ 3I55A 2IX1A 2F3IA 4A3LG 4MTNA 4A3JG 4LF7L 1VQGA 2HIVA 4EQ5A 4UP9A 4A3KH 3M4PA 5EAYA 5H1SE 1X65A 4NXML 2OQ0A 2OCEA 1YJWA 1IBMQ 5LMNW 1FGUA 3S1QH 4ME3A 1IXRA 4DUZL 4A3LH 2B63H 4OO1I 4JOIA 4QGUA 2ZJQA 1JJCB 3M85A 4NXNL 4LF4Q 1FL0A 4OXPA 1N9WA 4BBSG 2R7ZG 4JI5Q 3J81c 4IO9A 1LUZA 3ULJA 2UUBQ 4DR3L 1KHIA 5GQOA 2Z6KA 1R9TH 5JEAJ 2GVBA 2Q2UA 4JI7Q 2QEXA 1EWIA 4A3BH 4X6AH 4DR2Q 1QVGA 3TEHB 2A8VA 1VQ5A 4JBWA 1XNQQ 4LF4L 4BY7G 1K8GA 2JA9A 4GKJL 3KDFB 1PH4A 3NENA 2IHEA 2BA1A 4DV7Q 3PUXA 1OTCA 1Q81C 1RL2A 1Q46A 2N78A 4R4OA 3S1MH 1MJEA 3EN2A 1Y1WH 4YWLA 1X9NA 4JI7L 4DR4Q 3L0OA 2E2HH 4JG2A 1Y14B 4DR2L 3UE0A 4K0KQ 4QQBX 2D62A 1SROA 4DKAC 3DM3A 4Y7NH 3CC7A 1XNQL 5FJ8H 4AYBG 3U4ZA 5JEAG 5C0XJ 5JJLA 4DK3C 3PGZA 2IT1A 1C0AA 2JA5G 2NZHA 3CCLA 3GO5A 4X66Q 3F1ZA 4YCVA 4JYAL 1XMOQ 3M3YH 2CWAA 1HZAA 2K14A 4KHZA 3ZJYC 1XMQQ 4DR4L 2Y0SG 1VS0A 1OXXK 3E0EA 2OTJA 2PMZE 4L5TA 2F4VQ 3FHWA 1A62A 4AYBE 2HQLA 2I5MX 4A3EG 2BH2A 1GD7A 4B3SQ 5FLMH 4GS3A 2JJQA 2K5NA 5ELNA 1XJVA 2KCMA 2C35B 3M9BA 1WCMH 1YNXA 3CXCA 3PF5A 1XMOL 1M1KC 1BVSA 4PZ6A 2ZJPA 3HOVH 1VQJA 2JA7G 5C0XG 2ZTDA 1N32L 2D0OA 4JBJA 3UDFA 4KI0A 3RNUA 2I5LX 1W2BA 4JI4Q 1SR3A 4R4TA 4GOPB 5M3FG 3GTKH 4LF5Q 5C3EG 4A3GH 2VL6A 2JEBI 1SLJA 4JI1Q 1HZ9A 2AMCB 1K73C 4L5RC 3G71A 3PSIA 2UU9L 2VUMH 3PUVA 4RG1A 2JA8H 2MFIA 1TWGH 2AWOA 2RCNA 4PZ8A 1L1OA 4FDBA 4HJ9A 3HOXH 4LFAL 2EQSA 4LF5L 3NEMA 1VQAA 3NELA 2VNUD 2QA4A 1CUKA 1VQLA 1E3PA 3RR5A 1XPUA 4EX5A 1G6PA 4JC0A 3CCQA 1XTDA 2KENA 1YEZA 5M3MG 1PH8A 1D7QA 4R4CA 2AWNA 3AEVA 4JI2L 2Q2IA 3PV0A 1VQDA 2YTYA 3G48A 2HHHL 2R93G 1JJ2A 4DUYL 1IBLQ 5GAEC 4PZ7A 1IYJB 2IY5B 5K36G 1Y1VH 1A8VA 4DAYB 1UWVA 1WYDA 1FJGQ 2AKWB 1OXUA
chains in the Genus database with same CATH superfamily
4JV5L 4OO1G 2LKVA 2G5DA 3LX0A 4A3IG 2V4DA 2PW5A 3L3OC 3TMEA 1HQMC 3BYYB 3KF6A 1GO3E 1F77A 5KNDA 3S1NH 5LL6S 5HGTA 4WJ4A 3ERSX 1GHKA 1EZ8A 2KJXA 1JCKB 2A1AA 5NUCA 1UE5A 4DK6C 1JOKA 4A3KG 1CK1A 1TWHH 1BBXC 2QF7A 1STHA 4M8AA 1Y1WB 2UXBL 2VQEL 2E2HB 1V8QA 4DR3Q 1JWSD 1PTOB 2B63G 1G2TA 3CCRA 1II3A 3FP9A 1DD2A 1GOZA 2CH4W 5C3XA 5M5WH 1ML0D 1LTAD 3W5OA 2F3WA 4J15A 5JVG3 1A6XA 5IYBH 1ENCA 4QUCA 4A3FH 2AUJD 1PYWD 3HFZB 3I70A 4IUUA 4CDFC 4A3BG 2L5TA 4P72A 5IGDA 4LWCA 2AHOB 2K75A 1F2ZA 4DR7Q 3FDTA 3D4WA 4POGA 4DR5L 2FHTA 2OWOA 1ENFA 5C5LA 3SK4A 1BDOA 3G4SA 1LTRD 1PLFA 3HGBA 2EZVA 4UPAA 4NP5A 1IZ6A 1EY5A 3S1RB 1SMYD 4CJ1B 1S5ED 2IHFA 1QZHA 1Q1EA 2ATWA 4HAEA 4DR1L 2KEDA 3E0JA 3QG1A 2ID0A 4LNQA 3V05A 4B3ML 5FK9C 2E5LQ 5FLMG 1UE1A 1ZXTA 3ICEA 1LTID 4L5QA 4QF4A 4YIJA 1LT4D 3P1HA 3M4QA 1PFSA 3N52A 2N3SA 4KMUC 2ZM6Q 4EVOA 1DXMA 4U673 2HCIA 3LWUA 2KOLA 1QILA 3D4RA 1Y8NB 4A3GG 1CM9A 4GOPC 2NN6I 1V43A 3S1RH 5EKKA 4ZK9B 2JA6H 3EBEA 3A8IE 4DV4L 3A8KE 4ZRZA 4ZUJA 5A2QL 1RODA 2F0WA 2WFWA 2J4XA 2DY8A 2JP1A 4PNYA 1OXVA 3S2DB 4R9WA 2QDBA 5M9OA 1CKNA 1IL2A 4JV5Q 5COYA 4DGZA 2MO1A 1PRTC 2PW7A 1SAPA 2RSOA 3GTLB 1KAAA 4DV5L 3K81C 1K0SA 1YVCA 2G9DA 2OXPA 1TU2B 3H3VI 4DAVA 3SK5A 1C9OA 1HQRD 4I7AA 4NW2A 2NVXH 2P5ZX 3CC2A 3K5OA 2WAQE 4CGYB 5IGBA 3W1GA 4C1NI 5GAHC 1I94L 3AU7A 1EIYB 3DWAA 1FNVA 3DHQA 1NE3A 2VQFL 4LF6L 2PPBC 2HD3A 1KIXA 1GHJA 1JQYD 2KHSA 2CCZA 3L7ZC 1Z47A 1MSHA 1VQCA 4OL7A 1RTOA 5I2XA 5LMNQ 2CH4A 1JWMD 4DV2L 3QB3A 1BBUA 4QIWB 2R93H 1QNUA 4OGQC 1TWAB 1X55A 3S16H 1LYLA 4YY3L 2JK8A 4IOAA 4DV0L 4FF3A 1LTSD 4JBKA 1SFOH 4DR5Q 4A76A 2HT1A 5IP9G 2KCTA 1AE2A 3BZKA 3OTOL 4LK1C 5IODA 2R61A 1ENAA 1Z6HA 4ODGA 4P71A 1H9SB 4UP8A 4AIMA 4POFA 4YHHL 2F03A 5IYDG 2PQAB 3HOWB 2XTIA 1WVLA 1JMCA 1EYDA 1V1PB 1VQOA 1EFID 4DR1Q 2LMCB 3OPOA 1G91A 4B3MQ 5E4WC 1B53A 3IL8A 1VQKA 3KYHC 3HKZB 3HOZG 2DUDA 4QIWE 3L2PA 2PZWA 2XSCA 1LO5D 1CSPA 3Q22A 4A3MB 5C4XG 2E2IH 2B2TC 1S5FD 4V0BA 1TT2A 3CP0A 3PO3G 3HZXA 2K52A 1IYUA 1I4HA 1H9KA 5CYUA 1E7ZA 1VCIA 2F0PA 4LUOA 3OWFA 4YWKA 1AZQA 1K8AC 1PH1A 5M3FB 4H13C 4C3HH 4C3IB 1STBA 1EOVA 1NNXA 4YCUA 5CBAE 2KECA 1TWCB 1SRUA 3MA2B 1ASYA 3J80i 1EQRA 3KFUA 3K5MA 3G6EA 3GTOH 3JAML 5JPMC 2N49A 3HKZE 3H15A 1XMQL 1SEBD 3H91A 1SMYC 2AQ1B 4DV5Q 5M3MB 1MKHA 1LT3D 4LFBL 3MXGA 2YTVA 1XNRL 1LABA 4LF8L 3DWPA 2JQOA 1S72A 5DEHA 1XYIA 5M3FH 4C3IH 2QKIC 1OXSC 1TWFB 4APVA 4O0AA 3RZDB 2VQFQ 1CTMA 3K7AH 4LF6Q 1FVIA 1PH7A 1NUCA 1HHVA 1X3PA 3KLWA 1I4GA 5C4HA 2EDGA 4DV1Q 4DV2Q 1X3GA 2L9HA 1LM0A 4YY3Q 1K28A 5M3MH 1ASZA 4C2MH 4DV0Q 5C4ZA 1KC8C 2KHIA 3J80c 4DXGA 4X64L 3KJOA 1VQ4A 2L1BA 4Z9CB 1JORA 2JXMB 1B7YB 4P73A 3PCOB 3OTOQ 3RMHA 1RD9D 4A3CG 2FJ2A 3FRPB 1LV9A 2HUGA 1TWFH 4A3IH 2YU9H 4PG3A 4YHHQ 2PNHA 2Z6BA 1CKOA 3GD7A 1DOLA 5L37A 1N33L 5FO8B 1FGBD 4CKCA 3HKSA 1H9MA 1VQGA 2HIVA 2SOBA 4A3KH 3GTMB 4HSVA 4NXML 2OCEA 3T4AC 4DUZL 4F7XA 2B63H 3NBIA 2K5QA 2ZJQA 4LF4Q 4OXPA 1N9WA 4AYBB 2ZXOA 5E3FA 4IO9A 3ULJA 1KHIA 1QG7A 2F0IA 2X6LA 3QOLA 2C9OA 2Z1CA 2GVBA 1TY0A 4A3BH 1YNND 4DAYA 4RCOA 1W6JA 4IUTA 5M5YB 4BY7G 1O78A 5JPNC 2N78A 3MHBA 4DR4Q 3L0OA 2K7VA 4JG2A 3PIO3 2OEOA 2JA7B 1SROA 3MAQA 4KD4A 3URYA 1GUGA 4IUQA 1MI2A 3CCLA 3GO5A 2NN6H 1RF2D 3F1ZA 3X3MA 1XMOQ 4KHZA 1XMQQ 2K14A 4K8JA 2Y0SG 2X69A 3E0EA 4L5TA 3ITPA 4AYBE 2BH2A 1HA6A 3QJYA 5FLMH 2JJQA 2K5NA 1WTOA 2RKSA 1PDQA 1S5DD 2NVTB 3LWEA 1SE3A 2EY6A 3TBIB 1M1KC 2ZJPA 1U4LA 1VQJA 2ZTDA 1BCPD 1XTCD 2I5LX 3OHXC 5IGGA 4R4TA 4R8IA 3VR3A 4GOPB 3KBGA 3M4OB 5C3EG 1EY9A 4A3GH 2NTTA 1K73C 3RZOB 4L5RC 1F2MA 2UU9L 1D2BA 4PZ8A 1L1OA 2KA7A 3A8JE 1BUVT 5IT9E 1VMCA 1A3TA 3J7AF 2EQSA 4L8JA 4LF5L 3NEMA 1O7YA 1VQAA 3J81L 3BZDB 2F0HA 1FYCA 1CUKA 2NYZD 3Q24A 3GTGB 1E3PA 1UNSA 3CRKC 4CDDC 1PRTB 1QJOA 4GZYC 1UUPA 4K6DA 3Q6SA 4XQNA 2NB0A 2Q2IA 2HHHL 2YTYA 3S1QB 3R2TA 3TSSA 2R93G 5GAEC 1G8ZD 5K36G 1Y1VH 2KCCA 1UWVA 3SR1A 2AKWB 3EJIA 4JI6L 2G9HD 1VQFA 3RZOH 5ELOA 1B2TA 2EJFC 3OYYA 2F3VA 3CMAA 2RHQB 3VYSA 1BBWA 4G4KA 1Q8KA 2XVSA 2DY7A 3D6CA 2Q8RE 1JB7A 2CKZB 3VR4A 3S1MB 2MNAA 4HCEA 3CCSA 5EGTA 3T1YL 1DONA 2B8GA 4DV3L 2E8GA 2SNSA 3I2ZA 2CQAA 2A5HA 4ZAIA 4GLXA 5FO9B 3VR2A 1J9OA 3F2BA 1IW7D 3M3YB 3HOZB 1K3RA 4IFDI 1I4RA 2B39A 5IP9H 1D1IA 2JEAI 1PH6A 2QEJC 4R4QA 4RAUC 4NPSA 4CKBA 3FKIH 4GKKQ 1HTLD 1SNQA 4F8MA 3MFYA 2YYZA 1WCMB 1DGSA 3SK8A 1KDCA 1VQ9A 4J6HA 3HOVB 5IYDH 4RKBA 4FXKC 4UHVA 5ISRA 1HNWQ 1A2UA 1VQNA 1YJNA 4ZUIA 3IRBA 4DR7L 5KEEA 5GADC 3BDOA 4WRDA 3TRZA 1EU3A 3TP5A 1U4PA 3ERQA 1GVPA 1TVXA 2ICIA 2IPKD 3MXPA 1QOHA 3EROA 1T9HA 1EYAA 5IE8A 2L0CA 3S2HH 3HOZH 1Y8OB 3HOXB 1QE6A 4FXGC 4KY5A 5EKIA 3D3RA 4P74A 4WORA 3VA7A 5J22A 3QO2A 2F0GA 1BO0A 1I3QH 3MXNA 5C4XH 1PTOF 2B2YA 2Q2TA 3RLFA 1SNOA 2DNCA 3PO3H 1V1OA 2A69C 1Z7TA 2QW7A 2Z0SA 1JWUD 1PFBA 2QGQA 3E9HA 4GNXA 2UU9Q 3U58A 2AQ3B 2FXQA 2E5LL 4DR6L 3RLOA 1FR3A 2HQEA 3PF4A 3RUZA 1MJCA 3CAMA 1BOSA 1VQ7A 5C4JH 3TDQA 3TREA 1NR2A 4G57A 2ZM6L 3DMUA 3D8GA 3S1NB 3CF5A 4HJ7A 1K8OA 2HHHQ 1D5XC 3C1EA 3LNNA 3I91A 2E2DC 4X3SA 3JAMi 3SXHA 4H02A 4HEDA 5I2YA 1TWHB 1A0IA 2CHBD 3STBD 4JI6Q 1Q7YC 3MVVA 4ABNA 2Q8IB 1G291 3NTKA 1WTRA 4AQYL 3M7NA 1N8RC 1QWYA 2NTSA 2LXKA 3CPWA 3WOEA 4A3FB 3PO2G 5BN4A 2JYOA 1S4ZA 3KBXA 3BDLA 2V1CC 1HFNA 1RDPD 3UDIA 4FF1A 1BCPC 5CORA 4I7ZC 3CW2C 1HNZQ 2K6AA 2KHJA 4S3SA 5EPKA 3I4OA 1AE3A 5ELBA 3T1YQ 5FLXL 4UY8C 2CFMA 1KAWA 4IURA 4DV3Q 4JVZA 3I4NG 2EXZA 2D0PA 2QDLA 4BBRG 3UDGA 1EYGA 1BQQT 3EFXD 3TP8A 4HIOA 4KJOA 2L55A 5EJWA 5J1ZA 5BR8Q 4NB3A 2B8FA 1DJRD 1F9RA 1QZGA 2EYLA 1SNCA 4HJAA 3JAMc 4B3RQ 3VYRA 4A3CH 1CT1D 3K59A 2PO4A 5LMNL 4HJ5A 1WTVA 1UE7A 4QCLA 3CQZH 1BNZA 1U5KA 1HR0Q 2I0QA 2ZTEA 2RSNA 3AYHB 2WB1G 1UE6A 4N8X1 1HUNA 1SSOA 2TSSA 1N34L 3U4VA 4ZCKA 4N8FA 1O80A 2C5CA 3MEFA 4ME5A 1J5EQ 1L1OC 2I5HA 3DEPA 2M9VA 4XT3B 4IPHA 5LMUQ 2N8NA 2JA6B 1IBML 2NN6G 1SJED 5IOCA 1HUMA 1KLUD 1YHBA 2EVBA 2WKCA 3H0GG 1Q90A 1CKNB 5DM63 3GQBA 1O7LA 4K8IA 3H3VC 4PMBA 4OWXB 4Y52H 4DR6Q 1NY4A 4BY7H 2L11A 1K0RA 1KXLA 1VQ6A 5GAGC 2H1EA 5AJ3Q 4WJ3M 1GUSA 1PH9A 1IW7C 4IQZA 4XDXA 2B29A 1D6EC 2RF4A 1HFGA 5JAVA 1HA5A 2WAQB 4RGOS 4WFN3 1CA5A 5I6WA 2NVXB 3HOYG 3HOUG 2L15A 2XIWA 1YI2A 1TS2A 3F2DA 2BOSA 2VZAA 1LLRD 1PZID 2XN9C 5IGCA 4TVAB 4HIMA 1YJ9A 1PH2A 1H95A 2A19A 1EQVA 1NCVA 3E3XA 2Y0SE 1I6HH 3HG9A 4GLVB 4AQYQ 2F4VL 1YITA 1A63A 1C4QA 3S15B 1E2WA 3CC4A 2J7ZA 3U50C 2OTLA 1NMFA 4B3SL 3OW2A 5JJKA 2R93B 4J1MA 2JA5G 3S16B 1B70B 1Y1VG 2XRSD 5C3EH 1WD1A 4FYDA 4I65A 3T16A 4IALA 1SFOB 3SE0A 1F9PA 5IGEA 2RDHA 3FEWX 1YBYA 5F2DA 4FXDA 1UEAB 1F2YA 4F88A 2MQHA 3PUYA 2RVLA 3U9OA 3J81i 2KVMA 5C0XI 1EWCA 4KY6A 3F2CA 2Z4IA 1B44D 2MUYA 3S15H 2CW0D 4DV1L 5CBEE 1Q86C 5K36H 1VQEA 1IKLA 1E2VA 1WFQA 1IBLL 2EE1A 2B2YC 1IHZA 5KGUA 2KEEA 3STBC 1FJGL 4A3DH 3CMEA 4QUFA 1KABA 1N34Q 2AUKA 2CWPA 1LTGD 2VB3X 2E2IB 4GNXC 4BY1G 2YV5A 4FNFA 4FO2A 3QIAA 2K50A 3FKIG 1QNKA 3MTSA 3R93A 4ZLTF 3I55A 4NXNQ 2F3IA 2IX1A 1EYCA 1ESRA 4EQ5A 5H1SE 3R8BA 4RGMA 1YJWA 2E75C 1IBMQ 1NR4A 1JICA 4ME3A 2BDNA 1IXRA 3ZYYX 2PMZB 4H7BA 4JOIA 4C3HB 1QCBD 3M85A 3KLSA 5CV4A 2RCFA 5I6YA 2R7ZG 1KLGD 3J81c 3CU7A 5C5MA 3I73A 2EPBA 2Z6KA 1AN8A 2Q2UA 4JI7Q 1EWIA 3VR5A 4DR2Q 1TR5A 2A8VA 1QB5D 5I9PA 4LF4L 3GTOB 2JA9A 3NENA 3NE5B 2IHEA 1EY0A 2BA1A 1RL2A 3K5NA 1C8CA 1MJEA 3EN2A 1X9NA 2ZXPA 3I3CA 2F0UA 3UE0A 4IZ8A 2D62A 4QQBX 4DKAC 3GTKB 4RCNA 1CFMA 4XXEA 3CC7A 1O7ZA 4H0LC 5J39A 3PGZA 3EVQA 2IT1A 1GUNA 1FD7D 1TQOA 2NZHA 3OOCA 4DR4L 1HZAA 3ZJYC 1DYQA 4OELB 4HMIA 1VS0A 3K7AB 3NWSA 2PMZE 2F4VQ 1GJXA 3ONAB 4KK7A 1B50A 3QWNA 4DA2A 2MJ8A 3QR8A 4A3EG 4B3SQ 4GS3A 3MC0B 1XJVA 2KCMA 3J7AV 1YNXA 5TSSA 3CXCA 1XMOL 3BVGA 3WOFA 2XWBB 4JBJA 4KI0A 4C2MB 1SR3A 3OIPA 3GTKH 3GTJB 1PFMA 1HZ9A 5KYLA 2O2LD 3PSIA 3G71A 3PUVA 4RG1A 2AWOA 4A3IB 2YU9B 3V2TA 1BF4A 2VNUD 1LTBD 2LY7A 5AFWA 1XTDA 1U4MA 1PH8A 4MTKA 3I4NB 4A3KB 3KUPA 4N9TA 1SE2A 4JI2L 2Z9HA 5E1FA 2OT2A 5DM73 1WD0A 2B2WA 3NBHA 1KDBA 4DUYL 1IBLQ 4OIJA 2B63B 4DAYB 1FJGQ 3OSOA 3GTJH 4CBVA 3ULLA 1PXUA 4DF7A 2PZTA 1B4OA 1NSNS 2IX0A 2EOTA 2BA0A 3PO2H 1BCPB 3I90A 2K5HA 3Q8DA 4A3BB 1KQSA 3KLSX 5IYCG 1SYBA 4LAAA 4F87A 3PMFA 3I4NH 2WACA 4B3TQ 1PA6A 1VQIA 4BBRH 3S17H 4KV6A 3GP7A 1STEA 3CHBD 1IYVA 3KF8A 3AQQA 1V9PA 2K4KA 2Q8TA 2A69D 5D3IB 3SVMA 1SYEA 3C1FA 1GM5A 1E1TA 2MO0A 1M90C 3C2PA 2O5IC 1SN8A 2PNRC 1PRTF 4A93H 3UDXA 1GUWA 4N9PA 2CW0C 4KJNA 2IL8A 3J81j 4A3JH 1Y1WG 1L0WA 3ULPA 1EFWA 4YWMA 2K5VA 2ENBA 1L1OB 1YZ6A 2IX3A 3C46A 2Q2HA 1YIJA 4GKKL 3I8ZA 2WB1E 4IOCA 4A3GB 3GDEA 1PH3A 3A0JA 2DJFC 4IPGA 4G7HC 1MD2D 1HNWL 4X62Q 1LACA 2JE6I 3E5SA 1QVCA 1L0XB 3H0GH 1S40A 1LT5D 4UDUC 4QJFA 5E7NA 4TRDA 1T5EA 3BU2A 2UUCQ 4OEMB 4NKLA 2TMPA 5JEAH 4AH6A 2JA5B 3OIQA 1Y1VB 3BZCA 2E76C 2VUMG 2JA8G 4RGTA 3IFDA 1NTGA 1HCZA 4HSPA 1K9MC 4QL5A 4K5WA 1JJGA 5IIFA 1DM0B 1ET9A 2ASBA 3W1BA 3A54A 1RCVD 3H3VH 3HOUH 3HOYH 3P75A 5CV5A 1J8IA 1TXYA 1PHJA 3CD6A 2VY3A 4JI2Q 2PI2A 2XNAC 3D6WA 2UUAQ 3IKJA 4DUYQ 2FINB 1CI3M 3HS0C 5CR3A 1B3QA 1CQFA 2MHVA 5HGQA 4JI3Q 4JOIC 5A35A 4IFDJ 4OX9Q 5D3DA 1Q12A 1V1QA 1K83H 2EY5A 3NXWA 3NTHA 1ONLA 5J3BA 5IT9L 1JC7A 1WTQA 4ZQ3A 1GKHA 1KD1C 2JA5H 5IP7G 2RA4A 5C6AA 5DNFA 1AFPA 3NWTA 2R92G 3T53B 3NPPA 1B9NA 3BJUA 1DOKA 3CCUA 1IL8A 4A3DG 3K5LA 4IFDG 4HCSA 4CJ2C 1RHPA 3FKIB 2NVQB 4LUZA 4LF9Q 1EIHA 1ICFB 2EYPA 3I4LA 2RQXA 3K7UC 3R3OA 3I7FA 2F0LA 4O2DA 5K5PA 1X32A 4DU9A 1HH2P 1HNZL 3AFQA 1I5FA 1PH5A 1PYSB 3M4YA 1N36L 1EQQA 4KHPQ 3RN5A 3A5ZB 3O13A 3MXNB 1I4QA 1B9MA 1TY2A 3RD4A 2ES2A 3GTPH 3UI2A 1D5ZC 3S2HB 1X56A 4GNXB 5BR8L 3S9WA 3A56A 2UXCL 3EQLC 1UAPA 5M5XH 1I3QB 5C4XB 4BY1H 4OIKA 4B3RL 4HJ8A 2Z8LA 3I4MG 2NVQH 3PO3B 3GV3A 3CCJA 2VS1A 5C44G 3P7JA 2AQ2B 1EIGA 2A73B 1JR0D 1E0BA 1HR0L 4KN4C 3X3NA 3K0YA 4G7ZC 2N88A 3CCMA 5CV9A 2E74C 1KRSA 5C4JB 1IKMA 3OW7A 2R7ZH 1ZKOA 1YHAA 1YHQA 3FPPA 1TIID 3TZUA 2Z4HA 1ZYRC 3E6ZX 1J5EL 3VR6A 2JSOA 4JI5L 4CJ0B 4A3EB 2RHSB 3J80E 1TS4A 2UUBL 5LMUL 1T5XD 3CCEA 3HOWG 4KN7C 1Q82C 4X3KA 2B2WC 3T1HQ 1CZWA 1E22A 1SYGA 1VQHA 3K8AA 1QUQA 2A74C 3PUWA 2I07B 4XYOA 4MZ9A 1K8MA 1VQ8A 1SNPA 5HY6A 3I56A 4FF2A 4ZKBB 3EA6A 3HKZG 4MNOA 3BVZA 3KF6B 2EYFA 5JOBA 5IGFA 1S3OA 3IFTA 2F0JA 5FKAC 5AJ3L 4CHTB 1PYBA 4Q0FA 4A3MG 3GTQH 3OWEB 3CCVA 4X65Q 1Y8PB 5CV7A 4A75A 2LXJA 1XX8A 4X66L 1G2SA 4A3EH 3A74A 3H6MA 3RN2A 4XYQA 2EIFA 2OF1A 1MSGA 3K0XA 2B2VA 2XRQD 1CSQA 1QVFA 1E24A 4RH6A 4RKLA 3KDFA 3D31A 4DK0A 3MEHA 1B8AA 3BVMA 4KLKA 3A7LA 3TQYA 1Y69U 1CQVA 4KD3A 1X6OA 5C3WA 3NK9A 1NBWA 5EBCA 4JI4L 5IY0A 1GXDC 2CQOA 3IAYA 2D2CC 2QCPX 4BXXH 3CQZB 3RLNA 1EUJA 2IWHA 3NSWA 1JE5A 2EY1A 4MHEA 4DPGA 1SYDA 4KKTA 3K57A 1HZBA 4R4IA 3TS2A 1DCZA 1N36Q 1HZCA 5CMDA 1S5BD 2O5JC 1KDAA 3P20A 2PYKA 3S24A 4IJHA 1C7YA 2HCCA 2M00A 3D0FA 3F8TA 2UXCQ 1BR9A 1R9TB 1D8LA 2OQKA 2LSSA 5CV8A 1SNDA 3NTIA 3T13A 1SE8A 2A6EC 4A93G 4JCVE 5IYCH 2R6GA 4PMWA 4A3LG 4BY7B 3PQIA 4MTNA 4EQNA 4A3JG 4LF7L 2EYHA 4UP9A 4L6TB 5EAYA 1CHPD 2OQ0A 1FGUA 3G7LA 3TP6A 3HRZC 5DAUA 2RDFA 4OO1I 1JJCB 4NXNL 1FL0A 2DNEA 5EKLA 4BBSG 2F1MA 4JI5Q 1LUZA 2UUBQ 5GQOA 1R9TH 1D1KA 5JEAJ 2X6GA 2Y0SB 1VQ5A 1K3BC 4JBWA 4ILWA 1WTHA 2B2UA 4P2CB 1XNQQ 1K8GA 4GKJL 3DXJC 1ILQA 4R4OA 1I6HB 2KQ3A 1Y1WH 4JI7L 2E2HH 2RDGA 3SK6A 1PTOH 1JOOA 4DR2L 3DM3A 3Q23A 4AYBG 1XWEA 5JEAG 5C0XJ 4DK3C 2MGSA 1VDZA 2VUMB 5C3EB 2JA8B 1TWGB 4NDXA 4X66Q 4YCVA 4JYAL 2CWAA 4JW0A 4NMZA 2OTJA 1A15A 4DFAA 1A62A 1A3VA 4K14A 2HQLA 2I5MX 1JOQA 2ZT9C 3DWQA 1GD7A 4K6LA 3G6JB 3M9BA 3PF5A 4PZ6A 2K32A 2JA7G 5C0XG 1N32L 3RNUA 5A2QE 4JI4Q 2ZXRA 5BN3A 3A55A 1F9QA 2F0SA 4C1NK 3CKIB 1W6KA 2JEBI 1SLJA 2AMCB 3CRLC 5KRUA 5ELFA 4HMJA 2VUMH 2JA8H 4EQPA 2R92B 2MFIA 1TWGH 5HURA 2RCNA 1F9SA 4HJ9A 4RFBA 1PTOD 4LFAL 3BYTB 4C3JG 3W2DA 2A6HD 4A3DB 3BS1A 2QA4A 1EZ6A 4QB4A 2PQEA 5LL6X 2F0OA 4RHSA 5D65A 1XPUA 4EX5A 4PV1C 3NQIA 1D7QA 4R4CA 2FMMA 3AEVA 1DOMA 2SDFA 2IY5B 1SXTA 3M7GA 4UAIA 1A8VA 1STGA 1WYDA 4M1UB 3VDYA 1OXUA 4HIDA 1EQTA 5IP7H 1PV4A 2F0VA 2A68C 2NZ1D 2NUCA 2R92H 4LF7Q 2ZTCA 2HIXA 1H9JA 2D5DA 4LW1A 3KK7A 2VQEQ 2UXBQ 2D9UA 3NQTA 2L4NA 3FPUB 2K01A 3K58A 3WDNA 1EOTA 5T1IA 3SEBA 4IFDH 4PMCA 3S2DH 3PIOA 3I4MB 1GUOA 2WKDA 3J7A5 2LS01 3A7AB 3HEJA 5C44B 3GTLH 1JT8A 1I4XA 5G3LD 3SGIA 1E2ZA 4BA2I 1R4QB 2F52A 1WJJA 1RTNA 5CV6A 5I9OA 4GKJQ 4E6IA 1SMXA 4B3TL 3ND9A 2EXDA 2EYJA 2MP1A 5KIXA 3FMCA 4HIKA 1OXTA 4TQUS 2ALYB 5ELCA 2B2VC 4B08A 5IWAL 4L63B 4K2KA 5IT9c 1Q3LA 4FP5D 3I4MH 3KOJA 3DUZA 4UP7A 1RJTA 5FJ8G 4JYAQ 1MGSA 2UXDL 5C44H 4EQOA 1TWAH 5KNBA 1BCPF 2BE5D 4DNIA 1AW7A 1NAPA 1S5CD 1SNMA 1HJPA 2WV6D 1U9RA 1L2FA 3S14B 4IJLA 3AMUA 2JN4A 1IBKL 2WINB 5D14A 4DV6L 1N32Q 3FVQA 3KJPA 1ILPA 2F0KA 4J8QA 1VF7A 3D4DA 3ND8A 1WCMG 3NBHB 1SDFA 2L12A 1VQPA 3AFPA 3HOVG 3HOWH 2PCFB 4X62L 1X3EA 3JAME 4DV4Q 1BKBA 1EY7A 1YNJD 2ZJRA 1LT6D 4XT1B 1XPOA 2VB2X 1H9SA 4LFAQ 3PUZA 4CKEA 2PQAA 2EY2A 1NMGA 1U4RA 1SBBB 5JJZA 2UUCL 1SE4A 4B9XA 1V1PA 5EPJA 2KCNA 3SHLA 3TZDA 3U9SA 5I4DA 3HOXG 1STYA 3PO2B 3S14H 1VQBA 4BXXG 1A2TA 4JBMA 4A3MH 1DZ1A 1FNWA 3WWVA 3JC66 4KKSA 1E1OA 1STNA 5GROA 2WIIB 5BN5A 5CC4A 2N55A 3KF8B 1PVOA 4G7OC 1KL9A 2WP8J 1OO9B 1WI5A 1EIFA 4IUPA 4BBRB 3S17B 4O1NA 4LFCL 4H44C 1I94Q 2UUAL 3DLLA 5EPLA 3TN2A 1TWCH 5EQ0A 4JI3L 3J7ZC 2B2UC 1BXTA 2FMCA 2H5XA 4OX9L 3Q0AA 1SYFA 4JI0L 2M2LA 2K33A 3K80C 4GN5A 5JVH3 1Q1BA 2BH8A 1AP0A 4A93B 1MIUA 3H09A 1KNAA 2DGYA 4KHVA 2NBFA 3T51B 4OWTB 4A3JB 4IUNA 3DEOA 4QMGA 2XWJB 1I6VC 2WB1B 1W3SA 4ZKCB 4RMFA 1TS3A 2LFNA 4HR7B 4GLAC 4KKUA 1JE4A 1PTOC 5IYBG 1GUTA 1L0YB 2A6HC 4BBSB 4A3FG 4OO1H 1P16A 4LF9L 4BWGB 4K5VA 3RZDH 4IPDA 3AB9A 3TS0A 5IWAQ 4U68A 3L9AX 4XIGS 3H0GB 1X54A 2B3GA 1STAA 2UXDQ 3MXUA 4KHPL 4YCWA 5T1GA 4JI8L 4A3LH 4GN4B 1U0LA 3NP8A 2F0MA 1HNXL 4C56C 2EYOA 4ALPA 1RKNA 1CA6A 4X3TA 4TSSA 3B6YA 3E9IA 3MZ5A 1IBKQ 2GVAA 5EBDA 4DV6Q 4BBSH 4KY7A 2R7FA 4RWSC 3HP3A 1UEBA 4BA1I 1ICWA 3LGJA 3QOJA 4LMQD 5FLXc 1HR0W 1EU4A 3UE1A 3HOUB 3HOYB 1AEXA 3T56B 3ER0A 2K5WA 1WOCA 4OONA 4R1JA 4LUVA 1KNEA 1G51A 5ELDA 5KYIA 2NVYB 3GTMH 2F0NA 4IN3A 4OWWB 2F0DA 1K83B 2ICEC 2SNMA 1B3AA 4DV7L 1LTLA 3PIPA 2EYMA 1CZGA 1X3FA 2IW3A 1VF5C 3R2IA 1I50B 4IUVA 4DK1A 1WTXA 2JA6G 4L5SA 3T1HL 1EY8A 4K0KL 1EEID 1Z9FA 1D5MC 2GA4B 3VA5A 5JJIA 4DAPA 1SJHD 4TKOB 4LFBQ 4MIUA 2GN5A 4C3JB 2K5DA 4KTAA 4IPCA 1XNRQ 1ZYRD 5DLQE 1PZKD 5M5YH 4LF8Q 2PI2E 2YTXA 3CPFA 1KRTA 2IJ0A 2E2JB 1TS5A 4LFCQ 4ULLA 2BE5C 1XPRA 4XQJA 1H9RA 2NVYH 3J81E 2JA7H 4BS9A 5C0XH 4X65L 1O7IA 4JI0Q 2A6ED 2WAQG 3GV6A 4QY7A 4XTCS 1JB3A 2F0TA 1I50H 2Z6KC 2EJMA 4K5XA 1HPCA 3KLRA 3GTPB 2KBNA 4MN3A 4A4IA 4XQQA 4X64Q 4JI1L 4GN3B 2DN8A 4C3JH 3A5UA 4ID6A 2K1BA 2XGTA 2VW9A 3C3LA 2MPMA 2R7DA 1YNJC 2QILA 2EJGC 2NVTH 5M5XB 4CDCC 4BY1B 1HTPA 4WJWA 2E2JH 3W3AA 1NJIC 2NZOA 2R3ZA 1EEFD 1RIPA 1AH9A 1J6QA 3BDCA 1N33Q 3M4OH 1G6ZA 4DXFA 1HXYD 1CKMA 4P75A 4DAMA 1A3UA 1ESFA 1VQMA 2R7ZB 4GOPA 5FO7B 4JI8Q 3MWYW 4NXMQ 1B1ZA 2F0QA 1QUQB 4ZYSA 2K04A 3EIVA 3V96A 4DUZQ 1HNXQ 1ET6A 1M8AA 3GTGH 1Q8IA 1P8LA 2J0TD 4B9WA 4RGNA 3VYUA 1EY4A 3M4PA 1X65A 4RHRA 2FFKB 4Y7NB 5LMNW 5E4XA 3S1QH 1WTPA 2K05A 4OHJA 1SYCA 2O4XA 4HN7A 4O42A 4QGUA 4FVMA 5KNCA 4LJZC 1F2LA 2F0EA 4DR3L 3I72A 3N6RA 4CDEC 2H4OA 1PFNA 2HDLA 5FOBB 2QEXA 4X6AH 3GTQB 3J7YW 1QVGA 3TEHB 2F4IA 3DM1A 5CGKA 3KDFB 1PH4A 1M4VA 3K6OA 2BCOA 4DV7Q 3PUXA 1OTCA 3NUCA 1Q81C 4JPBW 1Q46A 1MBYA 3S1MH 1EWHA 4YWLA 3F2UA 1Y14B 1WTWA 4K2LA 2I46A 2BDOA 4K0KQ 3MFGA 4C3HG 4Y7NH 1XNQL 2K28A 5FJ8H 3U4ZA 2F0FA 2NWGA 5JJLA 1PMRA 1C0AA 5LHY1 3J80L 1PRTD 3M3YH 2VXWA 1OXXK 1VMPA 4HTHA 1AZPA 1EY6A 3FHWA 1R4PB 2HDMA 4EGVA 4DN4M 4FF4A 5ELNA 1CHQD 3NHHA 4R8NA 1KTKA 3BG3A 2C35B 1WCMH 2A68D 1BVSA 3HOVH 3TP7A 2D0OA 3UDFA 1W2BA 1HRJA 1I4PA 1YNNC 5M3FG 4C3IG 4LF5Q 5ELEA 2VL6A 2DJGC 3OMGA 4JI1Q 1EL0A 4X3UA 2CVRA 4V190 4FDBA 4Q5VA 3HOXH 1X3QA 3H94A 3NELA 1C48A 1FNUA 2RBMA 1MHWC 2K03A 1VQLA 4PQXA 1LTTD 3RR5A 2KUMA 4JC0A 1G6PA 3CCQA 2KENA 1YEZA 5M3MG 1ZEQX 3VYTA 1TKWB 2B2TA 4JK1C 4RA8A 4DNRB 2AWNA 3OMCA 1XXGA 2PZUA 1VQDA 3G48A 5M5WB 4DNTB 3SDZA 1PZJD 5FLXE 1JJ2A 4PZ7A 1IYJB 3PIP3 3PV0A 2SEBD 5G3LF
chains in the Genus database with same CATH topology
4JI6L 3ULLA 4JV5L 4OO1G 4HIDA 4A3IG 1VQFA 3RZOH 5IP7H 5ELOA 1PV4A 2IX0A 2BA0A 3OYYA 3PO2H 2R92H 4LF7Q 2ZTCA 2HIXA 2K5HA 4LW1A 3Q8DA 2VQEQ 3KF6A 1KQSA 1GO3E 3S1NH 2UXBQ 3CMAA 2RHQB 1BBWA 5IYCG 1Q8KA 4WJ4A 3ERSX 2A1AA 1JB7A 1UE5A 3S2DH 4DK6C 4A3KG 1TWHH 3PIOA 2CKZB 2MNAA 3J7A5 3I4NH 2UXBL 2VQEL 4B3TQ 3GTLH 1JT8A 4DR3Q 1PA6A 2B63G 1VQIA 4BBRH 3CCRA 3S17H 3FP9A 3CCSA 3T1YL 5M5WH 3SGIA 3W5OA 4J15A 4DV3L 4BA2I 2E8GA 2F52A 3AQQA 5IYBH 3I2ZA 1V9PA 2K4KA 1WJJA 4GLXA 4A3FH 1GM5A 4GKJQ 3HFZB 1E1TA 3F2BA 1SMXA 2MO0A 4B3RL 1M90C 4A3BG 4P72A 4B3TL 4LWCA 1K3RA 2AHOB 2K75A 4IFDI 2EXDA 1SN8A 5IP9H 2JEAI 1PH6A 4HIKA 4DR7Q 4R4QA 4A93H 1OXTA 4TQUS 2ALYB 3UDXA 4NPSA 3FKIH 4POGA 4GKKQ 4DR5L 5IWAL 3J81j 4A3JH 1Y1WG 1L0WA 2YYZA 5IT9c 3ULPA 1EFWA 2OWOA 1DGSA 4YWMA 1VQ9A 2K5VA 3I4MH 5IYDH 3KOJA 3G4SA 1HNWQ 4UP7A 4JYAQ 5FJ8G 2UXDL 4UPAA 1VQNA 1L1OB 1YZ6A 5C44H 3IRBA 1YJNA 4DR7L 1IZ6A 1TWAH 2Q2HA 5GADC 1YIJA 3TRZA 4GKKL 2IHFA 2WB1E 4IOCA 1QZHA 4DNIA 1GVPA 1Q1EA 1HJPA 2ATWA 3GDEA 1PH3A 3A0JA 1T9HA 4DR1L 4IPGA 5IE8A 1L2FA 3S2HH 4IJLA 1HNWL 4X62Q 1IBKL 2ID0A 2JE6I 3HOZH 4LNQA 4B3ML 1QVCA 3H0GH 2E5LQ 4DV6L 1S40A 1N32Q 5FLMG 3KJPA 1UE1A 4P74A 3GTJH 3ICEA 1I3QH 5C4XH 1WCMG 3NBHB 4QJFA 4L5QA 5E7NA 3RLFA 2Q2TA 1VQPA 3AFPA 3HOVG 3PO3H 3HOWH 3BU2A 2UUCQ 2Z0SA 3M4QA 1PFSA 4X62L 3E9HA 2QGQA 4GNXA 1X3EA 2UU9Q 2N3SA 2ZM6Q 3U58A 2FXQA 4DV4Q 3VDYA 1BKBA 2E5LL 4DR6L 2ZJRA 3RLOA 1XPOA 3PF4A 4A3GG 4GOPC 4LFAQ 2NN6I 1MJCA 1V43A 3PUZA 4AH6A 3S1RH 3CAMA 3BZCA 2PQAA 1VQ7A 2JA8G 2VUMG 5C4JH 2JA6H 1NTGA 1NMGA 2UUCL 3EBEA 3TREA 1K9MC 4QL5A 1JJGA 3HOXG 2ZM6L 4DV4L 3S14H 2ASBA 3W1BA 1VQBA 4BXXG 4JBMA 4A3MH 3H3VH 3HOUH 3HOYH 3CF5A 1TXYA 4HJ7A 1PHJA 3CD6A 2VY3A 3WWVA 4JI2Q 2PI2A 3JC66 2HHHQ 1E1OA 2WFWA 2UUAQ 3JAMi 5GROA 4DUYQ 4H02A 1OXVA 3KF8B 4JI3Q 5HGQA 1PVOA 1A0IA 4JOIC 1CKNA 4JI6Q 3STBD 1IL2A 4JV5Q 1KL9A 4OX9Q 1Q7YC 1Q12A 1V1QA 2MO1A 1K83H 2WP8J 1WI5A 1EIFA 1G291 4DV5L 5J3BA 3K81C 4LFCL 1I94Q 2UUAL 3DLLA 4AQYL 1YVCA 3M7NA 1GKHA 1N8RC 1KD1C 5IP7G 2LXKA 3CPWA 1TWCH 4JI3L 2JA5H 3H3VI 3J7ZC 3PO2G 1C9OA 2R92G 2H5XA 4OX9L 4JI0L 2NVXH 3BJUA 2V1CC 3CC2A 3K80C 3UDIA 2WAQE 4GN5A 3CCUA 3W1GA 4A3DG 5GAHC 3CW2C 1I94L 4IFDG 1Q1BA 2BH8A 1HNZQ 1EIYB 1MIUA 2KHJA 2DGYA 3I4OA 1AE3A 4LF6L 1NE3A 2VQFL 3T1YQ 4UY8C 2CFMA 1KAWA 4LUZA 1KIXA 4LF9Q 4OWTB 4DV3Q 2CCZA 3I4NG 3L7ZC 3K7UC 1Z47A 2D0PA 4BBRG 3I7FA 3UDGA 1VQCA 1EYGA 1W3SA 4O2DA 5LMNQ 4RMFA 1HH2P 4DV2L 4HIOA 2R93H 1BBUA 4GLAC 1HNZL 5BR8Q 1X55A 5IYBG 3S16H 1LYLA 3AFQA 1I5FA 4NB3A 2JK8A 4YY3L 1PYSB 1PH5A 1N36L 1EQQA 4A3FG 1P16A 4KHPQ 1QZGA 3RN5A 4LF9L 4IOAA 3A5ZB 4DV0L 4HJAA 3MXNB 3JAMc 4B3RQ 3RZDH 4IPDA 4JBKA 3TS0A 1SFOH 4DR5Q 4A3CH 2ES2A 4A76A 3GTPH 5IWAQ 5IP9G 5LMNL 4HJ5A 2HT1A 1X56A 1UE7A 2KCTA 1AE2A 3CQZH 4GNXB 5BR8L 3BZKA 4XIGS 3OTOL 1X54A 1U5KA 2B3GA 2UXCL 2UXDQ 1HR0Q 4KHPL 4P71A 2I0QA 5M5XH 4UP8A 4AIMA 4BY1H 4YCWA 4JI8L 2ZTEA 4POFA 4YHHL 4HJ8A 3AYHB 5IYDG 2WB1G 2NVQH 1UE6A 2PQAB 1U0LA 4GN4B 3I4MG 2XTIA 3CCJA 1JMCA 2VS1A 1N34L 3U4VA 5C44G 1HNXL 4ALPA 1VQOA 4DR1Q 3B6YA 3MEFA 3E9IA 1J5EQ 2GVAA 1IBKQ 1HR0L 1L1OC 2I5HA 4B3MQ 4DV6Q 3CCMA 4IPHA 5LMUQ 2N8NA 4BBSH 1KRSA 1VQKA 1IBML 2NN6G 3KYHC 2R7FA 2R7ZH 1YHBA 3HOZG 1YHAA 2DUDA 1UEBA 4QIWE 4BA1I 3L2PA 1YHQA 3H0GG 3LGJA 1CKNB 5FLXc 1HR0W 1CSPA 3UE1A 1J5EL 5C4XG 2E2IH 3ER0A 4JI5L 4OWXB 2RHSB 2UUBL 1WOCA 4DR6Q 1NY4A 4Y52H 4OONA 4R1JA 3CP0A 4LUVA 3CCEA 5LMUL 3HOWG 3PO3G 4BY7H 2K52A 1Q82C 1XNRL 1E7ZA 1G51A 1VCIA 3T1HQ 3GTMH 1E22A 3K8AA 1K0RA 1VQHA 1KXLA 1VQ6A 5GAGC 4OWWB 4LUOA 5AJ3Q 1QUQA 4WJ3M 3PUWA 4YWKA 1PH9A 1K8AC 4MZ9A 1PH1A 1VQ8A 4DV7L 1LTLA 3PIPA 4C3HH 5HY6A 1X3FA 1EOVA 2B29A 3I56A 2JA6G 4YCUA 3HKZG 4MNOA 2RF4A 3KF6B 4L5SA 1S3OA 3T1HL 1SRUA 4K0KL 1ASYA 1Z9FA 3J80i 5AJ3L 5JJIA 1EQRA 1PYBA 3KFUA 4A3MG 3HOYG 2L15A 3GTQH 3HOUG 2GN5A 1YI2A 4LFBQ 3F2DA 3G6EA 4IPCA 1XNRQ 3CCVA 5DLQE 2VZAA 4X65Q 5M5YH 3GTOH 4A75A 4TVAB 4HIMA 1YJ9A 2LXJA 2PI2E 1PH2A 4X66L 4LF8Q 2YTXA 2N49A 3HKZE 3CPFA 3H15A 1KRTA 4A3EH 1XMQL 1H95A 2A19A 3A74A 4DV5Q 2Y0SE 1I6HH 3RN2A 4LFCQ 4GLVB 4AQYQ 2F4VL 1MKHA 1XPRA 2EIFA 1YITA 4LFBL 2NVYH 3K0XA 1A63A 2JA7H 3CC4A 1CSQA 2YTVA 2OTLA 3U50C 1E24A 1NMFA 4X65L 1O7IA 3OW2A 4B3SL 3KDFA 4JI0Q 4LF8L 2JQOA 1S72A 5JJKA 3D31A 2WAQG 5M3FH 1B8AA 1B70B 1Y1VG 4KLKA 4QY7A 4XTCS 3TQYA 4C3IH 5C3EH 1X6OA 1I50H 2Z6KC 1OXSC 1NBWA 4APVA 4JI4L 4O0AA 4LF6Q 2VQFQ 3K7AH 5IY0A 1FVIA 2CQOA 2KBNA 1PH7A 1YBYA 4BXXH 4A4IA 3RLNA 1EUJA 3KLWA 4X64Q 4JI1L 4GN3B 4C3JH 2MQHA 1JE5A 3PUYA 2XGTA 3A5UA 2VW9A 4DPGA 2R7DA 3J81i 4DV1Q 4DV2Q 2NVTH 5C0XI 3F2CA 1X3GA 1HZBA 4R4IA 1LM0A 4YY3Q 3TS2A 1N36Q 2E2JH 1HZCA 1NJIC 2NZOA 5M3MH 1ASZA 4C2MH 4DV0Q 1KC8C 2KHIA 3J80c 3S15H 1RIPA 4X64L 3KJOA 1VQ4A 1J6QA 1AH9A 1N33Q 3M4OH 3S24A 1B7YB 4DV1L 4IJHA 1Q86C 4P73A 1C7YA 3PCOB 1CKMA 4P75A 3OTOQ 4DAMA 1QVFA 4A3CG 1VQEA 3D0FA 3F8TA 2UXCQ 1D8LA 1WFQA 2OQKA 1VQMA 2LSSA 1TWFH 4GOPA 4A3IH 4JI8Q 2YU9H 1IBLL 4PG3A 4YHHQ 4NXMQ 2PNHA 1CKOA 3GD7A 3STBC 1N33L 1FJGL 1SE8A 3CMEA 4A3DH 1QUQB 1N34Q 3EIVA 4DUZQ 2CWPA 1HNXQ 4A93G 4GNXC 4BY1G 2YV5A 4JCVE 5IYCH 3HKSA 3GTGH 4IFDJ 2K50A 3FKIG 2R6GA 1P8LA 4PMWA 4NXNQ 3I55A 2IX1A 2F3IA 4A3LG 4MTNA 4A3JG 4LF7L 1VQGA 2HIVA 4EQ5A 4UP9A 4A3KH 3M4PA 5EAYA 5H1SE 1X65A 4NXML 2OQ0A 2OCEA 1YJWA 1IBMQ 5LMNW 1FGUA 3S1QH 4ME3A 1IXRA 4DUZL 4A3LH 2B63H 4OO1I 4JOIA 4QGUA 2ZJQA 1JJCB 3M85A 4NXNL 4LF4Q 1FL0A 4OXPA 1N9WA 4BBSG 2R7ZG 4JI5Q 3J81c 4IO9A 1LUZA 3ULJA 2UUBQ 4DR3L 1KHIA 5GQOA 2Z6KA 1R9TH 5JEAJ 2GVBA 2Q2UA 4JI7Q 2QEXA 1EWIA 4A3BH 4X6AH 4DR2Q 1QVGA 3TEHB 2A8VA 1VQ5A 4JBWA 1XNQQ 4LF4L 4BY7G 1K8GA 2JA9A 4GKJL 3KDFB 1PH4A 3NENA 2IHEA 2BA1A 4DV7Q 3PUXA 1OTCA 1Q81C 1RL2A 1Q46A 2N78A 4R4OA 3S1MH 1MJEA 3EN2A 1Y1WH 4YWLA 1X9NA 4JI7L 4DR4Q 3L0OA 2E2HH 4JG2A 1Y14B 4DR2L 3UE0A 4K0KQ 4QQBX 2D62A 1SROA 4DKAC 3DM3A 4Y7NH 3CC7A 1XNQL 5FJ8H 4AYBG 3U4ZA 5JEAG 5C0XJ 5JJLA 4DK3C 3PGZA 2IT1A 1C0AA 2JA5G 2NZHA 3CCLA 3GO5A 4X66Q 3F1ZA 4YCVA 4JYAL 1XMOQ 3M3YH 2CWAA 1HZAA 2K14A 4KHZA 3ZJYC 1XMQQ 4DR4L 2Y0SG 1VS0A 1OXXK 3E0EA 2OTJA 2PMZE 4L5TA 2F4VQ 3FHWA 1A62A 4AYBE 2HQLA 2I5MX 4A3EG 2BH2A 1GD7A 4B3SQ 5FLMH 4GS3A 2JJQA 2K5NA 5ELNA 1XJVA 2KCMA 2C35B 3M9BA 1WCMH 1YNXA 3CXCA 3PF5A 1XMOL 1M1KC 1BVSA 4PZ6A 2ZJPA 3HOVH 1VQJA 2JA7G 5C0XG 2ZTDA 1N32L 2D0OA 4JBJA 3UDFA 4KI0A 3RNUA 2I5LX 1W2BA 4JI4Q 1SR3A 4R4TA 4GOPB 5M3FG 3GTKH 4LF5Q 5C3EG 4A3GH 2VL6A 2JEBI 1SLJA 4JI1Q 1HZ9A 2AMCB 1K73C 4L5RC 3G71A 3PSIA 2UU9L 2VUMH 3PUVA 4RG1A 2JA8H 2MFIA 1TWGH 2AWOA 2RCNA 4PZ8A 1L1OA 4FDBA 4HJ9A 3HOXH 4LFAL 2EQSA 4LF5L 3NEMA 1VQAA 3NELA 2VNUD 2QA4A 1CUKA 1VQLA 1E3PA 3RR5A 1XPUA 4EX5A 1G6PA 4JC0A 3CCQA 1XTDA 2KENA 1YEZA 5M3MG 1PH8A 1D7QA 4R4CA 2AWNA 3AEVA 4JI2L 2Q2IA 3PV0A 1VQDA 2YTYA 3G48A 2HHHL 2R93G 1JJ2A 4DUYL 1IBLQ 5GAEC 4PZ7A 1IYJB 2IY5B 5K36G 1Y1VH 1A8VA 4DAYB 1UWVA 1WYDA 1FJGQ 2AKWB 1OXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI6 L;  3ULL A;  4JV5 L;  4OO1 G;  4HID A;  4A3I G;  1VQF A;  3RZO H;  5IP7 H;  5ELO A;  1PV4 A;  2IX0 A;  2BA0 A;  3OYY A;  3PO2 H;  2R92 H;  4LF7 Q;  2ZTC A;  2HIX A;  2K5H A;  4LW1 A;  3Q8D A;  2VQE Q;  3KF6 A;  1KQS A;  1GO3 E;  3S1N H;  2UXB Q;  3CMA A;  2RHQ B;  1BBW A;  5IYC G;  1Q8K A;  4WJ4 A;  3ERS X;  2A1A A;  1JB7 A;  1UE5 A;  3S2D H;  4DK6 C;  4A3K G;  1TWH H;  3PIO A;  2CKZ B;  2MNA A;  3J7A 5;  3I4N H;  2UXB L;  2VQE L;  4B3T Q;  3GTL H;  1JT8 A;  4DR3 Q;  1PA6 A;  2B63 G;  1VQI A;  4BBR H;  3CCR A;  3S17 H;  3FP9 A;  3CCS A;  3T1Y L;  5M5W H;  3SGI A;  3W5O A;  4J15 A;  4DV3 L;  4BA2 I;  2E8G A;  2F52 A;  3AQQ A;  5IYB H;  3I2Z A;  1V9P A;  2K4K A;  1WJJ A;  4GLX A;  4A3F H;  1GM5 A;  4GKJ Q;  3HFZ B;  1E1T A;  3F2B A;  1SMX A;  2MO0 A;  4B3R L;  1M90 C;  4A3B G;  4P72 A;  4B3T L;  4LWC A;  1K3R A;  2AHO B;  2K75 A;  4IFD I;  2EXD A;  1SN8 A;  5IP9 H;  2JEA I;  1PH6 A;  4HIK A;  4DR7 Q;  4R4Q A;  4A93 H;  1OXT A;  4TQU S;  2ALY B;  3UDX A;  4NPS A;  3FKI H;  4POG A;  4GKK Q;  4DR5 L;  5IWA L;  3J81 j;  4A3J H;  1Y1W G;  1L0W A;  2YYZ A;  5IT9 c;  3ULP A;  1EFW A;  2OWO A;  1DGS A;  4YWM A;  1VQ9 A;  2K5V A;  3I4M H;  5IYD H;  3KOJ A;  3G4S A;  1HNW Q;  4UP7 A;  4JYA Q;  5FJ8 G;  2UXD L;  4UPA A;  1VQN A;  1L1O B;  1YZ6 A;  5C44 H;  3IRB A;  1YJN A;  4DR7 L;  1IZ6 A;  1TWA H;  2Q2H A;  5GAD C;  1YIJ A;  3TRZ A;  4GKK L;  2IHF A;  2WB1 E;  4IOC A;  1QZH A;  4DNI A;  1GVP A;  1Q1E A;  1HJP A;  2ATW A;  3GDE A;  1PH3 A;  3A0J A;  1T9H A;  4DR1 L;  4IPG A;  5IE8 A;  1L2F A;  3S2H H;  4IJL A;  1HNW L;  4X62 Q;  1IBK L;  2ID0 A;  2JE6 I;  3HOZ H;  4LNQ A;  4B3M L;  1QVC A;  3H0G H;  2E5L Q;  4DV6 L;  1S40 A;  1N32 Q;  5FLM G;  3KJP A;  1UE1 A;  4P74 A;  3GTJ H;  3ICE A;  1I3Q H;  5C4X H;  1WCM G;  3NBH B;  4QJF A;  4L5Q A;  5E7N A;  3RLF A;  2Q2T A;  1VQP A;  3AFP A;  3HOV G;  3PO3 H;  3HOW H;  3BU2 A;  2UUC Q;  2Z0S A;  3M4Q A;  1PFS A;  4X62 L;  3E9H A;  2QGQ A;  4GNX A;  1X3E A;  2UU9 Q;  2N3S A;  2ZM6 Q;  3U58 A;  2FXQ A;  4DV4 Q;  3VDY A;  1BKB A;  2E5L L;  4DR6 L;  2ZJR A;  3RLO A;  1XPO A;  3PF4 A;  4A3G G;  4GOP C;  4LFA Q;  2NN6 I;  1MJC A;  1V43 A;  3PUZ A;  4AH6 A;  3S1R H;  3CAM A;  3BZC A;  2PQA A;  1VQ7 A;  2JA8 G;  2VUM G;  5C4J H;  2JA6 H;  1NTG A;  1NMG A;  2UUC L;  3EBE A;  3TRE A;  1K9M C;  4QL5 A;  1JJG A;  3HOX G;  2ZM6 L;  4DV4 L;  3S14 H;  2ASB A;  3W1B A;  1VQB A;  4BXX G;  4JBM A;  4A3M H;  3H3V H;  3HOU H;  3HOY H;  3CF5 A;  1TXY A;  4HJ7 A;  1PHJ A;  3CD6 A;  2VY3 A;  3WWV A;  4JI2 Q;  2PI2 A;  3JC6 6;  2HHH Q;  1E1O A;  2WFW A;  2UUA Q;  3JAM i;  5GRO A;  4DUY Q;  4H02 A;  1OXV A;  3KF8 B;  4JI3 Q;  5HGQ A;  1PVO A;  1A0I A;  4JOI C;  1CKN A;  4JI6 Q;  3STB D;  1IL2 A;  4JV5 Q;  1KL9 A;  4OX9 Q;  1Q7Y C;  1Q12 A;  1V1Q A;  2MO1 A;  1K83 H;  2WP8 J;  1WI5 A;  1EIF A;  1G29 1;  4DV5 L;  5J3B A;  3K81 C;  4LFC L;  1I94 Q;  2UUA L;  3DLL A;  4AQY L;  1YVC A;  3M7N A;  1GKH A;  1N8R C;  1KD1 C;  5IP7 G;  2LXK A;  3CPW A;  1TWC H;  4JI3 L;  2JA5 H;  3H3V I;  3J7Z C;  3PO2 G;  1C9O A;  2R92 G;  2H5X A;  4OX9 L;  4JI0 L;  2NVX H;  3BJU A;  2V1C C;  3CC2 A;  3K80 C;  3UDI A;  2WAQ E;  4GN5 A;  3CCU A;  3W1G A;  4A3D G;  5GAH C;  3CW2 C;  1I94 L;  4IFD G;  1Q1B A;  2BH8 A;  1HNZ Q;  1EIY B;  1MIU A;  2KHJ A;  2DGY A;  3I4O A;  1AE3 A;  4LF6 L;  1NE3 A;  2VQF L;  3T1Y Q;  4UY8 C;  2CFM A;  1KAW A;  4LUZ A;  1KIX A;  4LF9 Q;  4OWT B;  4DV3 Q;  2CCZ A;  3I4N G;  3L7Z C;  3K7U C;  1Z47 A;  2D0P A;  4BBR G;  3I7F A;  3UDG A;  1VQC A;  1EYG A;  1W3S A;  4O2D A;  5LMN Q;  4RMF A;  1HH2 P;  4DV2 L;  4HIO A;  2R93 H;  1BBU A;  4GLA C;  1HNZ L;  5BR8 Q;  1X55 A;  5IYB G;  3S16 H;  1LYL A;  3AFQ A;  1I5F A;  4NB3 A;  2JK8 A;  4YY3 L;  1PYS B;  1PH5 A;  1N36 L;  1EQQ A;  4A3F G;  1P16 A;  4KHP Q;  1QZG A;  3RN5 A;  4LF9 L;  4IOA A;  3A5Z B;  4DV0 L;  4HJA A;  3MXN B;  3JAM c;  4B3R Q;  3RZD H;  4IPD A;  4JBK A;  3TS0 A;  1SFO H;  4DR5 Q;  4A3C H;  2ES2 A;  4A76 A;  3GTP H;  5IWA Q;  5IP9 G;  5LMN L;  4HJ5 A;  2HT1 A;  1X56 A;  1UE7 A;  2KCT A;  1AE2 A;  3CQZ H;  4GNX B;  5BR8 L;  3BZK A;  4XIG S;  3OTO L;  1X54 A;  1U5K A;  2B3G A;  2UXC L;  2UXD Q;  1HR0 Q;  4KHP L;  4P71 A;  2I0Q A;  5M5X H;  4UP8 A;  4AIM A;  4BY1 H;  4YCW A;  4JI8 L;  2ZTE A;  4POF A;  4YHH L;  4HJ8 A;  3AYH B;  5IYD G;  2WB1 G;  2NVQ H;  1UE6 A;  2PQA B;  1U0L A;  4GN4 B;  3I4M G;  2XTI A;  3CCJ A;  1JMC A;  2VS1 A;  1N34 L;  3U4V A;  5C44 G;  1HNX L;  4ALP A;  1VQO A;  4DR1 Q;  3B6Y A;  3MEF A;  3E9I A;  1J5E Q;  2GVA A;  1IBK Q;  1HR0 L;  1L1O C;  2I5H A;  4B3M Q;  4DV6 Q;  3CCM A;  4IPH A;  5LMU Q;  2N8N A;  4BBS H;  1KRS A;  1VQK A;  1IBM L;  2NN6 G;  3KYH C;  2R7F A;  2R7Z H;  1YHB A;  3HOZ G;  1YHA A;  2DUD A;  1UEB A;  4QIW E;  4BA1 I;  3L2P A;  1YHQ A;  3H0G G;  3LGJ A;  1CKN B;  5FLX c;  1HR0 W;  1CSP A;  3UE1 A;  1J5E L;  5C4X G;  2E2I H;  3ER0 A;  4JI5 L;  4OWX B;  2RHS B;  2UUB L;  1WOC A;  4DR6 Q;  1NY4 A;  4Y52 H;  4OON A;  4R1J A;  3CP0 A;  4LUV A;  3CCE A;  5LMU L;  3HOW G;  3PO3 G;  4BY7 H;  2K52 A;  1Q82 C;  1XNR L;  1E7Z A;  1G51 A;  1VCI A;  3T1H Q;  3GTM H;  1E22 A;  3K8A A;  1K0R A;  1VQH A;  1KXL A;  1VQ6 A;  5GAG C;  4OWW B;  4LUO A;  5AJ3 Q;  1QUQ A;  4WJ3 M;  3PUW A;  4YWK A;  1PH9 A;  1K8A C;  4MZ9 A;  1PH1 A;  1VQ8 A;  4DV7 L;  1LTL A;  3PIP A;  4C3H H;  5HY6 A;  1X3F A;  1EOV A;  2B29 A;  3I56 A;  2JA6 G;  4YCU A;  3HKZ G;  4MNO A;  2RF4 A;  3KF6 B;  4L5S A;  1S3O A;  3T1H L;  1SRU A;  4K0K L;  1ASY A;  1Z9F A;  3J80 i;  5AJ3 L;  5JJI A;  1EQR A;  1PYB A;  3KFU A;  4A3M G;  3HOY G;  2L15 A;  3GTQ H;  3HOU G;  2GN5 A;  1YI2 A;  4LFB Q;  3F2D A;  3G6E A;  4IPC A;  1XNR Q;  3CCV A;  5DLQ E;  2VZA A;  4X65 Q;  5M5Y H;  3GTO H;  4A75 A;  4TVA B;  4HIM A;  1YJ9 A;  2LXJ A;  2PI2 E;  1PH2 A;  4X66 L;  4LF8 Q;  2YTX A;  2N49 A;  3HKZ E;  3CPF A;  3H15 A;  1KRT A;  4A3E H;  1XMQ L;  1H95 A;  2A19 A;  3A74 A;  4DV5 Q;  2Y0S E;  1I6H H;  3RN2 A;  4LFC Q;  4GLV B;  4AQY Q;  2F4V L;  1MKH A;  1XPR A;  2EIF A;  1YIT A;  4LFB L;  2NVY H;  3K0X A;  1A63 A;  2JA7 H;  3CC4 A;  1CSQ A;  2YTV A;  2OTL A;  3U50 C;  1E24 A;  1NMF A;  4X65 L;  1O7I A;  3OW2 A;  4B3S L;  3KDF A;  4JI0 Q;  4LF8 L;  2JQO A;  1S72 A;  5JJK A;  3D31 A;  2WAQ G;  5M3F H;  1B8A A;  1B70 B;  1Y1V G;  4KLK A;  4QY7 A;  4XTC S;  3TQY A;  4C3I H;  5C3E H;  1X6O A;  1I50 H;  2Z6K C;  1OXS C;  1NBW A;  4APV A;  4JI4 L;  4O0A A;  4LF6 Q;  2VQF Q;  3K7A H;  5IY0 A;  1FVI A;  2CQO A;  2KBN A;  1PH7 A;  1YBY A;  4BXX H;  4A4I A;  3RLN A;  1EUJ A;  3KLW A;  4X64 Q;  4JI1 L;  4GN3 B;  4C3J H;  2MQH A;  1JE5 A;  3PUY A;  2XGT A;  3A5U A;  2VW9 A;  4DPG A;  2R7D A;  3J81 i;  4DV1 Q;  4DV2 Q;  2NVT H;  5C0X I;  3F2C A;  1X3G A;  1HZB A;  4R4I A;  1LM0 A;  4YY3 Q;  3TS2 A;  1N36 Q;  2E2J H;  1HZC A;  1NJI C;  2NZO A;  5M3M H;  1ASZ A;  4C2M H;  4DV0 Q;  1KC8 C;  2KHI A;  3J80 c;  3S15 H;  1RIP A;  4X64 L;  3KJO A;  1VQ4 A;  1J6Q A;  1AH9 A;  1N33 Q;  3M4O H;  3S24 A;  1B7Y B;  4DV1 L;  4IJH A;  1Q86 C;  4P73 A;  1C7Y A;  3PCO B;  1CKM A;  4P75 A;  3OTO Q;  4DAM A;  1QVF A;  4A3C G;  1VQE A;  3D0F A;  3F8T A;  2UXC Q;  1D8L A;  1WFQ A;  2OQK A;  1VQM A;  2LSS A;  1TWF H;  4GOP A;  4A3I H;  4JI8 Q;  2YU9 H;  1IBL L;  4PG3 A;  4YHH Q;  4NXM Q;  2PNH A;  1CKO A;  3GD7 A;  3STB C;  1N33 L;  1FJG L;  1SE8 A;  3CME A;  4A3D H;  1QUQ B;  1N34 Q;  3EIV A;  4DUZ Q;  2CWP A;  1HNX Q;  4A93 G;  4GNX C;  4BY1 G;  2YV5 A;  4JCV E;  5IYC H;  3HKS A;  3GTG H;  4IFD J;  2K50 A;  3FKI G;  2R6G A;  1P8L A;  4PMW A;  4NXN Q;  3I55 A;  2IX1 A;  2F3I A;  4A3L G;  4MTN A;  4A3J G;  4LF7 L;  1VQG A;  2HIV A;  4EQ5 A;  4UP9 A;  4A3K H;  3M4P A;  5EAY A;  5H1S E;  1X65 A;  4NXM L;  2OQ0 A;  2OCE A;  1YJW A;  1IBM Q;  5LMN W;  1FGU A;  3S1Q H;  4ME3 A;  1IXR A;  4DUZ L;  4A3L H;  2B63 H;  4OO1 I;  4JOI A;  4QGU A;  2ZJQ A;  1JJC B;  3M85 A;  4NXN L;  4LF4 Q;  1FL0 A;  4OXP A;  1N9W A;  4BBS G;  2R7Z G;  4JI5 Q;  3J81 c;  4IO9 A;  1LUZ A;  3ULJ A;  2UUB Q;  4DR3 L;  1KHI A;  5GQO A;  2Z6K A;  1R9T H;  5JEA J;  2GVB A;  2Q2U A;  4JI7 Q;  2QEX A;  1EWI A;  4A3B H;  4X6A H;  4DR2 Q;  1QVG A;  3TEH B;  2A8V A;  1VQ5 A;  4JBW A;  1XNQ Q;  4LF4 L;  4BY7 G;  1K8G A;  2JA9 A;  4GKJ L;  3KDF B;  1PH4 A;  3NEN A;  2IHE A;  2BA1 A;  4DV7 Q;  3PUX A;  1OTC A;  1Q81 C;  1RL2 A;  1Q46 A;  2N78 A;  4R4O A;  3S1M H;  1MJE A;  3EN2 A;  1Y1W H;  4YWL A;  1X9N A;  4JI7 L;  4DR4 Q;  3L0O A;  2E2H H;  4JG2 A;  1Y14 B;  4DR2 L;  3UE0 A;  4K0K Q;  4QQB X;  2D62 A;  1SRO A;  4DKA C;  3DM3 A;  4Y7N H;  3CC7 A;  1XNQ L;  5FJ8 H;  4AYB G;  3U4Z A;  5JEA G;  5C0X J;  5JJL A;  4DK3 C;  3PGZ A;  2IT1 A;  1C0A A;  2JA5 G;  2NZH A;  3CCL A;  3GO5 A;  4X66 Q;  3F1Z A;  4YCV A;  4JYA L;  1XMO Q;  3M3Y H;  2CWA A;  1HZA A;  2K14 A;  4KHZ A;  3ZJY C;  1XMQ Q;  4DR4 L;  2Y0S G;  1VS0 A;  1OXX K;  3E0E A;  2OTJ A;  2PMZ E;  4L5T A;  2F4V Q;  3FHW A;  1A62 A;  4AYB E;  2HQL A;  2I5M X;  4A3E G;  2BH2 A;  1GD7 A;  4B3S Q;  5FLM H;  4GS3 A;  2JJQ A;  2K5N A;  5ELN A;  1XJV A;  2KCM A;  2C35 B;  3M9B A;  1WCM H;  1YNX A;  3CXC A;  3PF5 A;  1XMO L;  1M1K C;  1BVS A;  4PZ6 A;  2ZJP A;  3HOV H;  1VQJ A;  2JA7 G;  5C0X G;  2ZTD A;  1N32 L;  2D0O A;  4JBJ A;  3UDF A;  4KI0 A;  3RNU A;  2I5L X;  1W2B A;  4JI4 Q;  1SR3 A;  4R4T A;  4GOP B;  5M3F G;  3GTK H;  4LF5 Q;  5C3E G;  4A3G H;  2VL6 A;  2JEB I;  1SLJ A;  4JI1 Q;  1HZ9 A;  2AMC B;  1K73 C;  4L5R C;  3G71 A;  3PSI A;  2UU9 L;  2VUM H;  3PUV A;  4RG1 A;  2JA8 H;  2MFI A;  1TWG H;  2AWO A;  2RCN A;  4PZ8 A;  1L1O A;  4FDB A;  4HJ9 A;  3HOX H;  4LFA L;  2EQS A;  4LF5 L;  3NEM A;  1VQA A;  3NEL A;  2VNU D;  2QA4 A;  1CUK A;  1VQL A;  1E3P A;  3RR5 A;  1XPU A;  4EX5 A;  1G6P A;  4JC0 A;  3CCQ A;  1XTD A;  2KEN A;  1YEZ A;  5M3M G;  1PH8 A;  1D7Q A;  4R4C A;  2AWN A;  3AEV A;  4JI2 L;  2Q2I A;  3PV0 A;  1VQD A;  2YTY A;  3G48 A;  2HHH L;  2R93 G;  1JJ2 A;  4DUY L;  1IBL Q;  5GAE C;  4PZ7 A;  1IYJ B;  2IY5 B;  5K36 G;  1Y1V H;  1A8V A;  4DAY B;  1UWV A;  1WYD A;  1FJG Q;  2AKW B;  1OXU A; 
#chains in the Genus database with same CATH topology
 4JV5 L;  4OO1 G;  2LKV A;  2G5D A;  3LX0 A;  4A3I G;  2V4D A;  2PW5 A;  3L3O C;  3TME A;  1HQM C;  3BYY B;  3KF6 A;  1GO3 E;  1F77 A;  5KND A;  3S1N H;  5LL6 S;  5HGT A;  4WJ4 A;  3ERS X;  1GHK A;  1EZ8 A;  2KJX A;  1JCK B;  2A1A A;  5NUC A;  1UE5 A;  4DK6 C;  1JOK A;  4A3K G;  1CK1 A;  1TWH H;  1BBX C;  2QF7 A;  1STH A;  4M8A A;  1Y1W B;  2UXB L;  2VQE L;  2E2H B;  1V8Q A;  4DR3 Q;  1JWS D;  1PTO B;  2B63 G;  1G2T A;  3CCR A;  1II3 A;  3FP9 A;  1DD2 A;  1GOZ A;  2CH4 W;  5C3X A;  5M5W H;  1ML0 D;  1LTA D;  3W5O A;  2F3W A;  4J15 A;  5JVG 3;  1A6X A;  5IYB H;  1ENC A;  4QUC A;  4A3F H;  2AUJ D;  1PYW D;  3HFZ B;  3I70 A;  4IUU A;  4CDF C;  4A3B G;  2L5T A;  4P72 A;  5IGD A;  4LWC A;  2AHO B;  2K75 A;  1F2Z A;  4DR7 Q;  3FDT A;  3D4W A;  4POG A;  4DR5 L;  2FHT A;  2OWO A;  1ENF A;  5C5L A;  3SK4 A;  1BDO A;  3G4S A;  1LTR D;  1PLF A;  3HGB A;  2EZV A;  4UPA A;  4NP5 A;  1IZ6 A;  1EY5 A;  3S1R B;  1SMY D;  4CJ1 B;  1S5E D;  2IHF A;  1QZH A;  1Q1E A;  2ATW A;  4HAE A;  4DR1 L;  2KED A;  3E0J A;  3QG1 A;  2ID0 A;  4LNQ A;  3V05 A;  4B3M L;  5FK9 C;  2E5L Q;  5FLM G;  1UE1 A;  1ZXT A;  3ICE A;  1LTI D;  4L5Q A;  4QF4 A;  4YIJ A;  1LT4 D;  3P1H A;  3M4Q A;  1PFS A;  3N52 A;  2N3S A;  4KMU C;  2ZM6 Q;  4EVO A;  1DXM A;  4U67 3;  2HCI A;  3LWU A;  2KOL A;  1QIL A;  3D4R A;  1Y8N B;  4A3G G;  1CM9 A;  4GOP C;  2NN6 I;  1V43 A;  3S1R H;  5EKK A;  4ZK9 B;  2JA6 H;  3EBE A;  3A8I E;  4DV4 L;  3A8K E;  4ZRZ A;  4ZUJ A;  5A2Q L;  1ROD A;  2F0W A;  2WFW A;  2J4X A;  2DY8 A;  2JP1 A;  4PNY A;  1OXV A;  3S2D B;  4R9W A;  2QDB A;  5M9O A;  1CKN A;  1IL2 A;  4JV5 Q;  5COY A;  4DGZ A;  2MO1 A;  1PRT C;  2PW7 A;  1SAP A;  2RSO A;  3GTL B;  1KAA A;  4DV5 L;  3K81 C;  1K0S A;  1YVC A;  2G9D A;  2OXP A;  1TU2 B;  3H3V I;  4DAV A;  3SK5 A;  1C9O A;  1HQR D;  4I7A A;  4NW2 A;  2NVX H;  2P5Z X;  3CC2 A;  3K5O A;  2WAQ E;  4CGY B;  5IGB A;  3W1G A;  4C1N I;  5GAH C;  1I94 L;  3AU7 A;  1EIY B;  3DWA A;  1FNV A;  3DHQ A;  1NE3 A;  2VQF L;  4LF6 L;  2PPB C;  2HD3 A;  1KIX A;  1GHJ A;  1JQY D;  2KHS A;  2CCZ A;  3L7Z C;  1Z47 A;  1MSH A;  1VQC A;  4OL7 A;  1RTO A;  5I2X A;  5LMN Q;  2CH4 A;  1JWM D;  4DV2 L;  3QB3 A;  1BBU A;  4QIW B;  2R93 H;  1QNU A;  4OGQ C;  1TWA B;  1X55 A;  3S16 H;  1LYL A;  4YY3 L;  2JK8 A;  4IOA A;  4DV0 L;  4FF3 A;  1LTS D;  4JBK A;  1SFO H;  4DR5 Q;  4A76 A;  2HT1 A;  5IP9 G;  2KCT A;  1AE2 A;  3BZK A;  3OTO L;  4LK1 C;  5IOD A;  2R61 A;  1ENA A;  1Z6H A;  4ODG A;  4P71 A;  1H9S B;  4UP8 A;  4AIM A;  4POF A;  4YHH L;  2F03 A;  5IYD G;  2PQA B;  3HOW B;  2XTI A;  1WVL A;  1JMC A;  1EYD A;  1V1P B;  1VQO A;  1EFI D;  4DR1 Q;  2LMC B;  3OPO A;  1G91 A;  4B3M Q;  5E4W C;  1B53 A;  3IL8 A;  1VQK A;  3KYH C;  3HKZ B;  3HOZ G;  2DUD A;  4QIW E;  3L2P A;  2PZW A;  2XSC A;  1LO5 D;  1CSP A;  3Q22 A;  4A3M B;  5C4X G;  2E2I H;  2B2T C;  1S5F D;  4V0B A;  1TT2 A;  3CP0 A;  3PO3 G;  3HZX A;  2K52 A;  1IYU A;  1I4H A;  1H9K A;  5CYU A;  1E7Z A;  1VCI A;  2F0P A;  4LUO A;  3OWF A;  4YWK A;  1AZQ A;  1K8A C;  1PH1 A;  5M3F B;  4H13 C;  4C3H H;  4C3I B;  1STB A;  1EOV A;  1NNX A;  4YCU A;  5CBA E;  2KEC A;  1TWC B;  1SRU A;  3MA2 B;  1ASY A;  3J80 i;  1EQR A;  3KFU A;  3K5M A;  3G6E A;  3GTO H;  3JAM L;  5JPM C;  2N49 A;  3HKZ E;  3H15 A;  1XMQ L;  1SEB D;  3H91 A;  1SMY C;  2AQ1 B;  4DV5 Q;  5M3M B;  1MKH A;  1LT3 D;  4LFB L;  3MXG A;  2YTV A;  1XNR L;  1LAB A;  4LF8 L;  3DWP A;  2JQO A;  1S72 A;  5DEH A;  1XYI A;  5M3F H;  4C3I H;  2QKI C;  1OXS C;  1TWF B;  4APV A;  4O0A A;  3RZD B;  2VQF Q;  1CTM A;  3K7A H;  4LF6 Q;  1FVI A;  1PH7 A;  1NUC A;  1HHV A;  1X3P A;  3KLW A;  1I4G A;  5C4H A;  2EDG A;  4DV1 Q;  4DV2 Q;  1X3G A;  2L9H A;  1LM0 A;  4YY3 Q;  1K28 A;  5M3M H;  1ASZ A;  4C2M H;  4DV0 Q;  5C4Z A;  1KC8 C;  2KHI A;  3J80 c;  4DXG A;  4X64 L;  3KJO A;  1VQ4 A;  2L1B A;  4Z9C B;  1JOR A;  2JXM B;  1B7Y B;  4P73 A;  3PCO B;  3OTO Q;  3RMH A;  1RD9 D;  4A3C G;  2FJ2 A;  3FRP B;  1LV9 A;  2HUG A;  1TWF H;  4A3I H;  2YU9 H;  4PG3 A;  4YHH Q;  2PNH A;  2Z6B A;  1CKO A;  3GD7 A;  1DOL A;  5L37 A;  1N33 L;  5FO8 B;  1FGB D;  4CKC A;  3HKS A;  1H9M A;  1VQG A;  2HIV A;  2SOB A;  4A3K H;  3GTM B;  4HSV A;  4NXM L;  2OCE A;  3T4A C;  4DUZ L;  4F7X A;  2B63 H;  3NBI A;  2K5Q A;  2ZJQ A;  4LF4 Q;  4OXP A;  1N9W A;  4AYB B;  2ZXO A;  5E3F A;  4IO9 A;  3ULJ A;  1KHI A;  1QG7 A;  2F0I A;  2X6L A;  3QOL A;  2C9O A;  2Z1C A;  2GVB A;  1TY0 A;  4A3B H;  1YNN D;  4DAY A;  4RCO A;  1W6J A;  4IUT A;  5M5Y B;  4BY7 G;  1O78 A;  5JPN C;  2N78 A;  3MHB A;  4DR4 Q;  3L0O A;  2K7V A;  4JG2 A;  3PIO 3;  2OEO A;  2JA7 B;  1SRO A;  3MAQ A;  4KD4 A;  3URY A;  1GUG A;  4IUQ A;  1MI2 A;  3CCL A;  3GO5 A;  2NN6 H;  1RF2 D;  3F1Z A;  3X3M A;  1XMO Q;  4KHZ A;  1XMQ Q;  2K14 A;  4K8J A;  2Y0S G;  2X69 A;  3E0E A;  4L5T A;  3ITP A;  4AYB E;  2BH2 A;  1HA6 A;  3QJY A;  5FLM H;  2JJQ A;  2K5N A;  1WTO A;  2RKS A;  1PDQ A;  1S5D D;  2NVT B;  3LWE A;  1SE3 A;  2EY6 A;  3TBI B;  1M1K C;  2ZJP A;  1U4L A;  1VQJ A;  2ZTD A;  1BCP D;  1XTC D;  2I5L X;  3OHX C;  5IGG A;  4R4T A;  4R8I A;  3VR3 A;  4GOP B;  3KBG A;  3M4O B;  5C3E G;  1EY9 A;  4A3G H;  2NTT A;  1K73 C;  3RZO B;  4L5R C;  1F2M A;  2UU9 L;  1D2B A;  4PZ8 A;  1L1O A;  2KA7 A;  3A8J E;  1BUV T;  5IT9 E;  1VMC A;  1A3T A;  3J7A F;  2EQS A;  4L8J A;  4LF5 L;  3NEM A;  1O7Y A;  1VQA A;  3J81 L;  3BZD B;  2F0H A;  1FYC A;  1CUK A;  2NYZ D;  3Q24 A;  3GTG B;  1E3P A;  1UNS A;  3CRK C;  4CDD C;  1PRT B;  1QJO A;  4GZY C;  1UUP A;  4K6D A;  3Q6S A;  4XQN A;  2NB0 A;  2Q2I A;  2HHH L;  2YTY A;  3S1Q B;  3R2T A;  3TSS A;  2R93 G;  5GAE C;  1G8Z D;  5K36 G;  1Y1V H;  2KCC A;  1UWV A;  3SR1 A;  2AKW B;  3EJI A;  4JI6 L;  2G9H D;  1VQF A;  3RZO H;  5ELO A;  1B2T A;  2EJF C;  3OYY A;  2F3V A;  3CMA A;  2RHQ B;  3VYS A;  1BBW A;  4G4K A;  1Q8K A;  2XVS A;  2DY7 A;  3D6C A;  2Q8R E;  1JB7 A;  2CKZ B;  3VR4 A;  3S1M B;  2MNA A;  4HCE A;  3CCS A;  5EGT A;  3T1Y L;  1DON A;  2B8G A;  4DV3 L;  2E8G A;  2SNS A;  3I2Z A;  2CQA A;  2A5H A;  4ZAI A;  4GLX A;  5FO9 B;  3VR2 A;  1J9O A;  3F2B A;  1IW7 D;  3M3Y B;  3HOZ B;  1K3R A;  4IFD I;  1I4R A;  2B39 A;  5IP9 H;  1D1I A;  2JEA I;  1PH6 A;  2QEJ C;  4R4Q A;  4RAU C;  4NPS A;  4CKB A;  3FKI H;  4GKK Q;  1HTL D;  1SNQ A;  4F8M A;  3MFY A;  2YYZ A;  1WCM B;  1DGS A;  3SK8 A;  1KDC A;  1VQ9 A;  4J6H A;  3HOV B;  5IYD H;  4RKB A;  4FXK C;  4UHV A;  5ISR A;  1HNW Q;  1A2U A;  1VQN A;  1YJN A;  4ZUI A;  3IRB A;  4DR7 L;  5KEE A;  5GAD C;  3BDO A;  4WRD A;  3TRZ A;  1EU3 A;  3TP5 A;  1U4P A;  3ERQ A;  1GVP A;  1TVX A;  2ICI A;  2IPK D;  3MXP A;  1QOH A;  3ERO A;  1T9H A;  1EYA A;  5IE8 A;  2L0C A;  3S2H H;  3HOZ H;  1Y8O B;  3HOX B;  1QE6 A;  4FXG C;  4KY5 A;  5EKI A;  3D3R A;  4P74 A;  4WOR A;  3VA7 A;  5J22 A;  3QO2 A;  2F0G A;  1BO0 A;  1I3Q H;  3MXN A;  5C4X H;  1PTO F;  2B2Y A;  2Q2T A;  3RLF A;  1SNO A;  2DNC A;  3PO3 H;  1V1O A;  2A69 C;  1Z7T A;  2QW7 A;  2Z0S A;  1JWU D;  1PFB A;  2QGQ A;  3E9H A;  4GNX A;  2UU9 Q;  3U58 A;  2AQ3 B;  2FXQ A;  2E5L L;  4DR6 L;  3RLO A;  1FR3 A;  2HQE A;  3PF4 A;  3RUZ A;  1MJC A;  3CAM A;  1BOS A;  1VQ7 A;  5C4J H;  3TDQ A;  3TRE A;  1NR2 A;  4G57 A;  2ZM6 L;  3DMU A;  3D8G A;  3S1N B;  3CF5 A;  4HJ7 A;  1K8O A;  2HHH Q;  1D5X C;  3C1E A;  3LNN A;  3I91 A;  2E2D C;  4X3S A;  3JAM i;  3SXH A;  4H02 A;  4HED A;  5I2Y A;  1TWH B;  1A0I A;  2CHB D;  3STB D;  4JI6 Q;  1Q7Y C;  3MVV A;  4ABN A;  2Q8I B;  1G29 1;  3NTK A;  1WTR A;  4AQY L;  3M7N A;  1N8R C;  1QWY A;  2NTS A;  2LXK A;  3CPW A;  3WOE A;  4A3F B;  3PO2 G;  5BN4 A;  2JYO A;  1S4Z A;  3KBX A;  3BDL A;  2V1C C;  1HFN A;  1RDP D;  3UDI A;  4FF1 A;  1BCP C;  5COR A;  4I7Z C;  3CW2 C;  1HNZ Q;  2K6A A;  2KHJ A;  4S3S A;  5EPK A;  3I4O A;  1AE3 A;  5ELB A;  3T1Y Q;  5FLX L;  4UY8 C;  2CFM A;  1KAW A;  4IUR A;  4DV3 Q;  4JVZ A;  3I4N G;  2EXZ A;  2D0P A;  2QDL A;  4BBR G;  3UDG A;  1EYG A;  1BQQ T;  3EFX D;  3TP8 A;  4HIO A;  4KJO A;  2L55 A;  5EJW A;  5J1Z A;  5BR8 Q;  4NB3 A;  2B8F A;  1DJR D;  1F9R A;  1QZG A;  2EYL A;  1SNC A;  4HJA A;  3JAM c;  4B3R Q;  3VYR A;  4A3C H;  1CT1 D;  3K59 A;  2PO4 A;  5LMN L;  4HJ5 A;  1WTV A;  1UE7 A;  4QCL A;  3CQZ H;  1BNZ A;  1U5K A;  1HR0 Q;  2I0Q A;  2ZTE A;  2RSN A;  3AYH B;  2WB1 G;  1UE6 A;  4N8X 1;  1HUN A;  1SSO A;  2TSS A;  1N34 L;  3U4V A;  4ZCK A;  4N8F A;  1O80 A;  2C5C A;  3MEF A;  4ME5 A;  1J5E Q;  1L1O C;  2I5H A;  3DEP A;  2M9V A;  4XT3 B;  4IPH A;  5LMU Q;  2N8N A;  2JA6 B;  1IBM L;  2NN6 G;  1SJE D;  5IOC A;  1HUM A;  1KLU D;  1YHB A;  2EVB A;  2WKC A;  3H0G G;  1Q90 A;  1CKN B;  5DM6 3;  3GQB A;  1O7L A;  4K8I A;  3H3V C;  4PMB A;  4OWX B;  4Y52 H;  4DR6 Q;  1NY4 A;  4BY7 H;  2L11 A;  1K0R A;  1KXL A;  1VQ6 A;  5GAG C;  2H1E A;  5AJ3 Q;  4WJ3 M;  1GUS A;  1PH9 A;  1IW7 C;  4IQZ A;  4XDX A;  2B29 A;  1D6E C;  2RF4 A;  1HFG A;  5JAV A;  1HA5 A;  2WAQ B;  4RGO S;  4WFN 3;  1CA5 A;  5I6W A;  2NVX B;  3HOY G;  3HOU G;  2L15 A;  2XIW A;  1YI2 A;  1TS2 A;  3F2D A;  2BOS A;  2VZA A;  1LLR D;  1PZI D;  2XN9 C;  5IGC A;  4TVA B;  4HIM A;  1YJ9 A;  1PH2 A;  1H95 A;  2A19 A;  1EQV A;  1NCV A;  3E3X A;  2Y0S E;  1I6H H;  3HG9 A;  4GLV B;  4AQY Q;  2F4V L;  1YIT A;  1A63 A;  1C4Q A;  3S15 B;  1E2W A;  3CC4 A;  2J7Z A;  3U50 C;  2OTL A;  1NMF A;  4B3S L;  3OW2 A;  5JJK A;  2R93 B;  4J1M A;  2JA5 G;  3S16 B;  1B70 B;  1Y1V G;  2XRS D;  5C3E H;  1WD1 A;  4FYD A;  4I65 A;  3T16 A;  4IAL A;  1SFO B;  3SE0 A;  1F9P A;  5IGE A;  2RDH A;  3FEW X;  1YBY A;  5F2D A;  4FXD A;  1UEA B;  1F2Y A;  4F88 A;  2MQH A;  3PUY A;  2RVL A;  3U9O A;  3J81 i;  2KVM A;  5C0X I;  1EWC A;  4KY6 A;  3F2C A;  2Z4I A;  1B44 D;  2MUY A;  3S15 H;  2CW0 D;  4DV1 L;  5CBE E;  1Q86 C;  5K36 H;  1VQE A;  1IKL A;  1E2V A;  1WFQ A;  1IBL L;  2EE1 A;  2B2Y C;  1IHZ A;  5KGU A;  2KEE A;  3STB C;  1FJG L;  4A3D H;  3CME A;  4QUF A;  1KAB A;  1N34 Q;  2AUK A;  2CWP A;  1LTG D;  2VB3 X;  2E2I B;  4GNX C;  4BY1 G;  2YV5 A;  4FNF A;  4FO2 A;  3QIA A;  2K50 A;  3FKI G;  1QNK A;  3MTS A;  3R93 A;  4ZLT F;  3I55 A;  4NXN Q;  2F3I A;  2IX1 A;  1EYC A;  1ESR A;  4EQ5 A;  5H1S E;  3R8B A;  4RGM A;  1YJW A;  2E75 C;  1IBM Q;  1NR4 A;  1JIC A;  4ME3 A;  2BDN A;  1IXR A;  3ZYY X;  2PMZ B;  4H7B A;  4JOI A;  4C3H B;  1QCB D;  3M85 A;  3KLS A;  5CV4 A;  2RCF A;  5I6Y A;  2R7Z G;  1KLG D;  3J81 c;  3CU7 A;  5C5M A;  3I73 A;  2EPB A;  2Z6K A;  1AN8 A;  2Q2U A;  4JI7 Q;  1EWI A;  3VR5 A;  4DR2 Q;  1TR5 A;  2A8V A;  1QB5 D;  5I9P A;  4LF4 L;  3GTO B;  2JA9 A;  3NEN A;  3NE5 B;  2IHE A;  1EY0 A;  2BA1 A;  1RL2 A;  3K5N A;  1C8C A;  1MJE A;  3EN2 A;  1X9N A;  2ZXP A;  3I3C A;  2F0U A;  3UE0 A;  4IZ8 A;  2D62 A;  4QQB X;  4DKA C;  3GTK B;  4RCN A;  1CFM A;  4XXE A;  3CC7 A;  1O7Z A;  4H0L C;  5J39 A;  3PGZ A;  3EVQ A;  2IT1 A;  1GUN A;  1FD7 D;  1TQO A;  2NZH A;  3OOC A;  4DR4 L;  1HZA A;  3ZJY C;  1DYQ A;  4OEL B;  4HMI A;  1VS0 A;  3K7A B;  3NWS A;  2PMZ E;  2F4V Q;  1GJX A;  3ONA B;  4KK7 A;  1B50 A;  3QWN A;  4DA2 A;  2MJ8 A;  3QR8 A;  4A3E G;  4B3S Q;  4GS3 A;  3MC0 B;  1XJV A;  2KCM A;  3J7A V;  1YNX A;  5TSS A;  3CXC A;  1XMO L;  3BVG A;  3WOF A;  2XWB B;  4JBJ A;  4KI0 A;  4C2M B;  1SR3 A;  3OIP A;  3GTK H;  3GTJ B;  1PFM A;  1HZ9 A;  5KYL A;  2O2L D;  3PSI A;  3G71 A;  3PUV A;  4RG1 A;  2AWO A;  4A3I B;  2YU9 B;  3V2T A;  1BF4 A;  2VNU D;  1LTB D;  2LY7 A;  5AFW A;  1XTD A;  1U4M A;  1PH8 A;  4MTK A;  3I4N B;  4A3K B;  3KUP A;  4N9T A;  1SE2 A;  4JI2 L;  2Z9H A;  5E1F A;  2OT2 A;  5DM7 3;  1WD0 A;  2B2W A;  3NBH A;  1KDB A;  4DUY L;  1IBL Q;  4OIJ A;  2B63 B;  4DAY B;  1FJG Q;  3OSO A;  3GTJ H;  4CBV A;  3ULL A;  1PXU A;  4DF7 A;  2PZT A;  1B4O A;  1NSN S;  2IX0 A;  2EOT A;  2BA0 A;  3PO2 H;  1BCP B;  3I90 A;  2K5H A;  3Q8D A;  4A3B B;  1KQS A;  3KLS X;  5IYC G;  1SYB A;  4LAA A;  4F87 A;  3PMF A;  3I4N H;  2WAC A;  4B3T Q;  1PA6 A;  1VQI A;  4BBR H;  3S17 H;  4KV6 A;  3GP7 A;  1STE A;  3CHB D;  1IYV A;  3KF8 A;  3AQQ A;  1V9P A;  2K4K A;  2Q8T A;  2A69 D;  5D3I B;  3SVM A;  1SYE A;  3C1F A;  1GM5 A;  1E1T A;  2MO0 A;  1M90 C;  3C2P A;  2O5I C;  1SN8 A;  2PNR C;  1PRT F;  4A93 H;  3UDX A;  1GUW A;  4N9P A;  2CW0 C;  4KJN A;  2IL8 A;  3J81 j;  4A3J H;  1Y1W G;  1L0W A;  3ULP A;  1EFW A;  4YWM A;  2K5V A;  2ENB A;  1L1O B;  1YZ6 A;  2IX3 A;  3C46 A;  2Q2H A;  1YIJ A;  4GKK L;  3I8Z A;  2WB1 E;  4IOC A;  4A3G B;  3GDE A;  1PH3 A;  3A0J A;  2DJF C;  4IPG A;  4G7H C;  1MD2 D;  1HNW L;  4X62 Q;  1LAC A;  2JE6 I;  3E5S A;  1QVC A;  1L0X B;  3H0G H;  1S40 A;  1LT5 D;  4UDU C;  4QJF A;  5E7N A;  4TRD A;  1T5E A;  3BU2 A;  2UUC Q;  4OEM B;  4NKL A;  2TMP A;  5JEA H;  4AH6 A;  2JA5 B;  3OIQ A;  1Y1V B;  3BZC A;  2E76 C;  2VUM G;  2JA8 G;  4RGT A;  3IFD A;  1NTG A;  1HCZ A;  4HSP A;  1K9M C;  4QL5 A;  4K5W A;  1JJG A;  5IIF A;  1DM0 B;  1ET9 A;  2ASB A;  3W1B A;  3A54 A;  1RCV D;  3H3V H;  3HOU H;  3HOY H;  3P75 A;  5CV5 A;  1J8I A;  1TXY A;  1PHJ A;  3CD6 A;  2VY3 A;  4JI2 Q;  2PI2 A;  2XNA C;  3D6W A;  2UUA Q;  3IKJ A;  4DUY Q;  2FIN B;  1CI3 M;  3HS0 C;  5CR3 A;  1B3Q A;  1CQF A;  2MHV A;  5HGQ A;  4JI3 Q;  4JOI C;  5A35 A;  4IFD J;  4OX9 Q;  5D3D A;  1Q12 A;  1V1Q A;  1K83 H;  2EY5 A;  3NXW A;  3NTH A;  1ONL A;  5J3B A;  5IT9 L;  1JC7 A;  1WTQ A;  4ZQ3 A;  1GKH A;  1KD1 C;  2JA5 H;  5IP7 G;  2RA4 A;  5C6A A;  5DNF A;  1AFP A;  3NWT A;  2R92 G;  3T53 B;  3NPP A;  1B9N A;  3BJU A;  1DOK A;  3CCU A;  1IL8 A;  4A3D G;  3K5L A;  4IFD G;  4HCS A;  4CJ2 C;  1RHP A;  3FKI B;  2NVQ B;  4LUZ A;  4LF9 Q;  1EIH A;  1ICF B;  2EYP A;  3I4L A;  2RQX A;  3K7U C;  3R3O A;  3I7F A;  2F0L A;  4O2D A;  5K5P A;  1X32 A;  4DU9 A;  1HH2 P;  1HNZ L;  3AFQ A;  1I5F A;  1PH5 A;  1PYS B;  3M4Y A;  1N36 L;  1EQQ A;  4KHP Q;  3RN5 A;  3A5Z B;  3O13 A;  3MXN B;  1I4Q A;  1B9M A;  1TY2 A;  3RD4 A;  2ES2 A;  3GTP H;  3UI2 A;  1D5Z C;  3S2H B;  1X56 A;  4GNX B;  5BR8 L;  3S9W A;  3A56 A;  2UXC L;  3EQL C;  1UAP A;  5M5X H;  1I3Q B;  5C4X B;  4BY1 H;  4OIK A;  4B3R L;  4HJ8 A;  2Z8L A;  3I4M G;  2NVQ H;  3PO3 B;  3GV3 A;  3CCJ A;  2VS1 A;  5C44 G;  3P7J A;  2AQ2 B;  1EIG A;  2A73 B;  1JR0 D;  1E0B A;  1HR0 L;  4KN4 C;  3X3N A;  3K0Y A;  4G7Z C;  2N88 A;  3CCM A;  5CV9 A;  2E74 C;  1KRS A;  5C4J B;  1IKM A;  3OW7 A;  2R7Z H;  1ZKO A;  1YHA A;  1YHQ A;  3FPP A;  1TII D;  3TZU A;  2Z4H A;  1ZYR C;  3E6Z X;  1J5E L;  3VR6 A;  2JSO A;  4JI5 L;  4CJ0 B;  4A3E B;  2RHS B;  3J80 E;  1TS4 A;  2UUB L;  5LMU L;  1T5X D;  3CCE A;  3HOW G;  4KN7 C;  1Q82 C;  4X3K A;  2B2W C;  3T1H Q;  1CZW A;  1E22 A;  1SYG A;  1VQH A;  3K8A A;  1QUQ A;  2A74 C;  3PUW A;  2I07 B;  4XYO A;  4MZ9 A;  1K8M A;  1VQ8 A;  1SNP A;  5HY6 A;  3I56 A;  4FF2 A;  4ZKB B;  3EA6 A;  3HKZ G;  4MNO A;  3BVZ A;  3KF6 B;  2EYF A;  5JOB A;  5IGF A;  1S3O A;  3IFT A;  2F0J A;  5FKA C;  5AJ3 L;  4CHT B;  1PYB A;  4Q0F A;  4A3M G;  3GTQ H;  3OWE B;  3CCV A;  4X65 Q;  1Y8P B;  5CV7 A;  4A75 A;  2LXJ A;  1XX8 A;  4X66 L;  1G2S A;  4A3E H;  3A74 A;  3H6M A;  3RN2 A;  4XYQ A;  2EIF A;  2OF1 A;  1MSG A;  3K0X A;  2B2V A;  2XRQ D;  1CSQ A;  1QVF A;  1E24 A;  4RH6 A;  4RKL A;  3KDF A;  3D31 A;  4DK0 A;  3MEH A;  1B8A A;  3BVM A;  4KLK A;  3A7L A;  3TQY A;  1Y69 U;  1CQV A;  4KD3 A;  1X6O A;  5C3W A;  3NK9 A;  1NBW A;  5EBC A;  4JI4 L;  5IY0 A;  1GXD C;  2CQO A;  3IAY A;  2D2C C;  2QCP X;  4BXX H;  3CQZ B;  3RLN A;  1EUJ A;  2IWH A;  3NSW A;  1JE5 A;  2EY1 A;  4MHE A;  4DPG A;  1SYD A;  4KKT A;  3K57 A;  1HZB A;  4R4I A;  3TS2 A;  1DCZ A;  1N36 Q;  1HZC A;  5CMD A;  1S5B D;  2O5J C;  1KDA A;  3P20 A;  2PYK A;  3S24 A;  4IJH A;  1C7Y A;  2HCC A;  2M00 A;  3D0F A;  3F8T A;  2UXC Q;  1BR9 A;  1R9T B;  1D8L A;  2OQK A;  2LSS A;  5CV8 A;  1SND A;  3NTI A;  3T13 A;  1SE8 A;  2A6E C;  4A93 G;  4JCV E;  5IYC H;  2R6G A;  4PMW A;  4A3L G;  4BY7 B;  3PQI A;  4MTN A;  4EQN A;  4A3J G;  4LF7 L;  2EYH A;  4UP9 A;  4L6T B;  5EAY A;  1CHP D;  2OQ0 A;  1FGU A;  3G7L A;  3TP6 A;  3HRZ C;  5DAU A;  2RDF A;  4OO1 I;  1JJC B;  4NXN L;  1FL0 A;  2DNE A;  5EKL A;  4BBS G;  2F1M A;  4JI5 Q;  1LUZ A;  2UUB Q;  5GQO A;  1R9T H;  1D1K A;  5JEA J;  2X6G A;  2Y0S B;  1VQ5 A;  1K3B C;  4JBW A;  4ILW A;  1WTH A;  2B2U A;  4P2C B;  1XNQ Q;  1K8G A;  4GKJ L;  3DXJ C;  1ILQ A;  4R4O A;  1I6H B;  2KQ3 A;  1Y1W H;  4JI7 L;  2E2H H;  2RDG A;  3SK6 A;  1PTO H;  1JOO A;  4DR2 L;  3DM3 A;  3Q23 A;  4AYB G;  1XWE A;  5JEA G;  5C0X J;  4DK3 C;  2MGS A;  1VDZ A;  2VUM B;  5C3E B;  2JA8 B;  1TWG B;  4NDX A;  4X66 Q;  4YCV A;  4JYA L;  2CWA A;  4JW0 A;  4NMZ A;  2OTJ A;  1A15 A;  4DFA A;  1A62 A;  1A3V A;  4K14 A;  2HQL A;  2I5M X;  1JOQ A;  2ZT9 C;  3DWQ A;  1GD7 A;  4K6L A;  3G6J B;  3M9B A;  3PF5 A;  4PZ6 A;  2K32 A;  2JA7 G;  5C0X G;  1N32 L;  3RNU A;  5A2Q E;  4JI4 Q;  2ZXR A;  5BN3 A;  3A55 A;  1F9Q A;  2F0S A;  4C1N K;  3CKI B;  1W6K A;  2JEB I;  1SLJ A;  2AMC B;  3CRL C;  5KRU A;  5ELF A;  4HMJ A;  2VUM H;  2JA8 H;  4EQP A;  2R92 B;  2MFI A;  1TWG H;  5HUR A;  2RCN A;  1F9S A;  4HJ9 A;  4RFB A;  1PTO D;  4LFA L;  3BYT B;  4C3J G;  3W2D A;  2A6H D;  4A3D B;  3BS1 A;  2QA4 A;  1EZ6 A;  4QB4 A;  2PQE A;  5LL6 X;  2F0O A;  4RHS A;  5D65 A;  1XPU A;  4EX5 A;  4PV1 C;  3NQI A;  1D7Q A;  4R4C A;  2FMM A;  3AEV A;  1DOM A;  2SDF A;  2IY5 B;  1SXT A;  3M7G A;  4UAI A;  1A8V A;  1STG A;  1WYD A;  4M1U B;  3VDY A;  1OXU A;  4HID A;  1EQT A;  5IP7 H;  1PV4 A;  2F0V A;  2A68 C;  2NZ1 D;  2NUC A;  2R92 H;  4LF7 Q;  2ZTC A;  2HIX A;  1H9J A;  2D5D A;  4LW1 A;  3KK7 A;  2VQE Q;  2UXB Q;  2D9U A;  3NQT A;  2L4N A;  3FPU B;  2K01 A;  3K58 A;  3WDN A;  1EOT A;  5T1I A;  3SEB A;  4IFD H;  4PMC A;  3S2D H;  3PIO A;  3I4M B;  1GUO A;  2WKD A;  3J7A 5;  2LS0 1;  3A7A B;  3HEJ A;  5C44 B;  3GTL H;  1JT8 A;  1I4X A;  5G3L D;  3SGI A;  1E2Z A;  4BA2 I;  1R4Q B;  2F52 A;  1WJJ A;  1RTN A;  5CV6 A;  5I9O A;  4GKJ Q;  4E6I A;  1SMX A;  4B3T L;  3ND9 A;  2EXD A;  2EYJ A;  2MP1 A;  5KIX A;  3FMC A;  4HIK A;  1OXT A;  4TQU S;  2ALY B;  5ELC A;  2B2V C;  4B08 A;  5IWA L;  4L63 B;  4K2K A;  5IT9 c;  1Q3L A;  4FP5 D;  3I4M H;  3KOJ A;  3DUZ A;  4UP7 A;  1RJT A;  5FJ8 G;  4JYA Q;  1MGS A;  2UXD L;  5C44 H;  4EQO A;  1TWA H;  5KNB A;  1BCP F;  2BE5 D;  4DNI A;  1AW7 A;  1NAP A;  1S5C D;  1SNM A;  1HJP A;  2WV6 D;  1U9R A;  1L2F A;  3S14 B;  4IJL A;  3AMU A;  2JN4 A;  1IBK L;  2WIN B;  5D14 A;  4DV6 L;  1N32 Q;  3FVQ A;  3KJP A;  1ILP A;  2F0K A;  4J8Q A;  1VF7 A;  3D4D A;  3ND8 A;  1WCM G;  3NBH B;  1SDF A;  2L12 A;  1VQP A;  3AFP A;  3HOV G;  3HOW H;  2PCF B;  4X62 L;  1X3E A;  3JAM E;  4DV4 Q;  1BKB A;  1EY7 A;  1YNJ D;  2ZJR A;  1LT6 D;  4XT1 B;  1XPO A;  2VB2 X;  1H9S A;  4LFA Q;  3PUZ A;  4CKE A;  2PQA A;  2EY2 A;  1NMG A;  1U4R A;  1SBB B;  5JJZ A;  2UUC L;  1SE4 A;  4B9X A;  1V1P A;  5EPJ A;  2KCN A;  3SHL A;  3TZD A;  3U9S A;  5I4D A;  3HOX G;  1STY A;  3PO2 B;  3S14 H;  1VQB A;  4BXX G;  1A2T A;  4JBM A;  4A3M H;  1DZ1 A;  1FNW A;  3WWV A;  3JC6 6;  4KKS A;  1E1O A;  1STN A;  5GRO A;  2WII B;  5BN5 A;  5CC4 A;  2N55 A;  3KF8 B;  1PVO A;  4G7O C;  1KL9 A;  2WP8 J;  1OO9 B;  1WI5 A;  1EIF A;  4IUP A;  4BBR B;  3S17 B;  4O1N A;  4LFC L;  4H44 C;  1I94 Q;  2UUA L;  3DLL A;  5EPL A;  3TN2 A;  1TWC H;  5EQ0 A;  4JI3 L;  3J7Z C;  2B2U C;  1BXT A;  2FMC A;  2H5X A;  4OX9 L;  3Q0A A;  1SYF A;  4JI0 L;  2M2L A;  2K33 A;  3K80 C;  4GN5 A;  5JVH 3;  1Q1B A;  2BH8 A;  1AP0 A;  4A93 B;  1MIU A;  3H09 A;  1KNA A;  2DGY A;  4KHV A;  2NBF A;  3T51 B;  4OWT B;  4A3J B;  4IUN A;  3DEO A;  4QMG A;  2XWJ B;  1I6V C;  2WB1 B;  1W3S A;  4ZKC B;  4RMF A;  1TS3 A;  2LFN A;  4HR7 B;  4GLA C;  4KKU A;  1JE4 A;  1PTO C;  5IYB G;  1GUT A;  1L0Y B;  2A6H C;  4BBS B;  4A3F G;  4OO1 H;  1P16 A;  4LF9 L;  4BWG B;  4K5V A;  3RZD H;  4IPD A;  3AB9 A;  3TS0 A;  5IWA Q;  4U68 A;  3L9A X;  4XIG S;  3H0G B;  1X54 A;  2B3G A;  1STA A;  2UXD Q;  3MXU A;  4KHP L;  4YCW A;  5T1G A;  4JI8 L;  4A3L H;  4GN4 B;  1U0L A;  3NP8 A;  2F0M A;  1HNX L;  4C56 C;  2EYO A;  4ALP A;  1RKN A;  1CA6 A;  4X3T A;  4TSS A;  3B6Y A;  3E9I A;  3MZ5 A;  1IBK Q;  2GVA A;  5EBD A;  4DV6 Q;  4BBS H;  4KY7 A;  2R7F A;  4RWS C;  3HP3 A;  1UEB A;  4BA1 I;  1ICW A;  3LGJ A;  3QOJ A;  4LMQ D;  5FLX c;  1HR0 W;  1EU4 A;  3UE1 A;  3HOU B;  3HOY B;  1AEX A;  3T56 B;  3ER0 A;  2K5W A;  1WOC A;  4OON A;  4R1J A;  4LUV A;  1KNE A;  1G51 A;  5ELD A;  5KYI A;  2NVY B;  3GTM H;  2F0N A;  4IN3 A;  4OWW B;  2F0D A;  1K83 B;  2ICE C;  2SNM A;  1B3A A;  4DV7 L;  1LTL A;  3PIP A;  2EYM A;  1CZG A;  1X3F A;  2IW3 A;  1VF5 C;  3R2I A;  1I50 B;  4IUV A;  4DK1 A;  1WTX A;  2JA6 G;  4L5S A;  3T1H L;  1EY8 A;  4K0K L;  1EEI D;  1Z9F A;  1D5M C;  2GA4 B;  3VA5 A;  5JJI A;  4DAP A;  1SJH D;  4TKO B;  4LFB Q;  4MIU A;  2GN5 A;  4C3J B;  2K5D A;  4KTA A;  4IPC A;  1XNR Q;  1ZYR D;  5DLQ E;  1PZK D;  5M5Y H;  4LF8 Q;  2PI2 E;  2YTX A;  3CPF A;  1KRT A;  2IJ0 A;  2E2J B;  1TS5 A;  4LFC Q;  4ULL A;  2BE5 C;  1XPR A;  4XQJ A;  1H9R A;  2NVY H;  3J81 E;  2JA7 H;  4BS9 A;  5C0X H;  4X65 L;  1O7I A;  4JI0 Q;  2A6E D;  2WAQ G;  3GV6 A;  4QY7 A;  4XTC S;  1JB3 A;  2F0T A;  1I50 H;  2Z6K C;  2EJM A;  4K5X A;  1HPC A;  3KLR A;  3GTP B;  2KBN A;  4MN3 A;  4A4I A;  4XQQ A;  4X64 Q;  4JI1 L;  4GN3 B;  2DN8 A;  4C3J H;  3A5U A;  4ID6 A;  2K1B A;  2XGT A;  2VW9 A;  3C3L A;  2MPM A;  2R7D A;  1YNJ C;  2QIL A;  2EJG C;  2NVT H;  5M5X B;  4CDC C;  4BY1 B;  1HTP A;  4WJW A;  2E2J H;  3W3A A;  1NJI C;  2NZO A;  2R3Z A;  1EEF D;  1RIP A;  1AH9 A;  1J6Q A;  3BDC A;  1N33 Q;  3M4O H;  1G6Z A;  4DXF A;  1HXY D;  1CKM A;  4P75 A;  4DAM A;  1A3U A;  1ESF A;  1VQM A;  2R7Z B;  4GOP A;  5FO7 B;  4JI8 Q;  3MWY W;  4NXM Q;  1B1Z A;  2F0Q A;  1QUQ B;  4ZYS A;  2K04 A;  3EIV A;  3V96 A;  4DUZ Q;  1HNX Q;  1ET6 A;  1M8A A;  3GTG H;  1Q8I A;  1P8L A;  2J0T D;  4B9W A;  4RGN A;  3VYU A;  1EY4 A;  3M4P A;  1X65 A;  4RHR A;  2FFK B;  4Y7N B;  5LMN W;  5E4X A;  3S1Q H;  1WTP A;  2K05 A;  4OHJ A;  1SYC A;  2O4X A;  4HN7 A;  4O42 A;  4QGU A;  4FVM A;  5KNC A;  4LJZ C;  1F2L A;  2F0E A;  4DR3 L;  3I72 A;  3N6R A;  4CDE C;  2H4O A;  1PFN A;  2HDL A;  5FOB B;  2QEX A;  4X6A H;  3GTQ B;  3J7Y W;  1QVG A;  3TEH B;  2F4I A;  3DM1 A;  5CGK A;  3KDF B;  1PH4 A;  1M4V A;  3K6O A;  2BCO A;  4DV7 Q;  3PUX A;  1OTC A;  3NUC A;  1Q81 C;  4JPB W;  1Q46 A;  1MBY A;  3S1M H;  1EWH A;  4YWL A;  3F2U A;  1Y14 B;  1WTW A;  4K2L A;  2I46 A;  2BDO A;  4K0K Q;  3MFG A;  4C3H G;  4Y7N H;  1XNQ L;  2K28 A;  5FJ8 H;  3U4Z A;  2F0F A;  2NWG A;  5JJL A;  1PMR A;  1C0A A;  5LHY 1;  3J80 L;  1PRT D;  3M3Y H;  2VXW A;  1OXX K;  1VMP A;  4HTH A;  1AZP A;  1EY6 A;  3FHW A;  1R4P B;  2HDM A;  4EGV A;  4DN4 M;  4FF4 A;  5ELN A;  1CHQ D;  3NHH A;  4R8N A;  1KTK A;  3BG3 A;  2C35 B;  1WCM H;  2A68 D;  1BVS A;  3HOV H;  3TP7 A;  2D0O A;  3UDF A;  1W2B A;  1HRJ A;  1I4P A;  1YNN C;  5M3F G;  4C3I G;  4LF5 Q;  5ELE A;  2VL6 A;  2DJG C;  3OMG A;  4JI1 Q;  1EL0 A;  4X3U A;  2CVR A;  4V19 0;  4FDB A;  4Q5V A;  3HOX H;  1X3Q A;  3H94 A;  3NEL A;  1C48 A;  1FNU A;  2RBM A;  1MHW C;  2K03 A;  1VQL A;  4PQX A;  1LTT D;  3RR5 A;  2KUM A;  4JC0 A;  1G6P A;  3CCQ A;  2KEN A;  1YEZ A;  5M3M G;  1ZEQ X;  3VYT A;  1TKW B;  2B2T A;  4JK1 C;  4RA8 A;  4DNR B;  2AWN A;  3OMC A;  1XXG A;  2PZU A;  1VQD A;  3G48 A;  5M5W B;  4DNT B;  3SDZ A;  1PZJ D;  5FLX E;  1JJ2 A;  4PZ7 A;  1IYJ B;  3PIP 3;  3PV0 A;  2SEB D;  5G3L F; 
#chains in the Genus database with same CATH homology
 4JI6 L;  3ULL A;  4JV5 L;  4OO1 G;  4HID A;  4A3I G;  1VQF A;  3RZO H;  5IP7 H;  5ELO A;  1PV4 A;  2IX0 A;  2BA0 A;  3OYY A;  3PO2 H;  2R92 H;  4LF7 Q;  2ZTC A;  2HIX A;  2K5H A;  4LW1 A;  3Q8D A;  2VQE Q;  3KF6 A;  1KQS A;  1GO3 E;  3S1N H;  2UXB Q;  3CMA A;  2RHQ B;  1BBW A;  5IYC G;  1Q8K A;  4WJ4 A;  3ERS X;  2A1A A;  1JB7 A;  1UE5 A;  3S2D H;  4DK6 C;  4A3K G;  1TWH H;  3PIO A;  2CKZ B;  2MNA A;  3J7A 5;  3I4N H;  2UXB L;  2VQE L;  4B3T Q;  3GTL H;  1JT8 A;  4DR3 Q;  1PA6 A;  2B63 G;  1VQI A;  4BBR H;  3CCR A;  3S17 H;  3FP9 A;  3CCS A;  3T1Y L;  5M5W H;  3SGI A;  3W5O A;  4J15 A;  4DV3 L;  4BA2 I;  2E8G A;  2F52 A;  3AQQ A;  5IYB H;  3I2Z A;  1V9P A;  2K4K A;  1WJJ A;  4GLX A;  4A3F H;  1GM5 A;  4GKJ Q;  3HFZ B;  1E1T A;  3F2B A;  1SMX A;  2MO0 A;  4B3R L;  1M90 C;  4A3B G;  4P72 A;  4B3T L;  4LWC A;  1K3R A;  2AHO B;  2K75 A;  4IFD I;  2EXD A;  1SN8 A;  5IP9 H;  2JEA I;  1PH6 A;  4HIK A;  4DR7 Q;  4R4Q A;  4A93 H;  1OXT A;  4TQU S;  2ALY B;  3UDX A;  4NPS A;  3FKI H;  4POG A;  4GKK Q;  4DR5 L;  5IWA L;  3J81 j;  4A3J H;  1Y1W G;  1L0W A;  2YYZ A;  5IT9 c;  3ULP A;  1EFW A;  2OWO A;  1DGS A;  4YWM A;  1VQ9 A;  2K5V A;  3I4M H;  5IYD H;  3KOJ A;  3G4S A;  1HNW Q;  4UP7 A;  4JYA Q;  5FJ8 G;  2UXD L;  4UPA A;  1VQN A;  1L1O B;  1YZ6 A;  5C44 H;  3IRB A;  1YJN A;  4DR7 L;  1IZ6 A;  1TWA H;  2Q2H A;  5GAD C;  1YIJ A;  3TRZ A;  4GKK L;  2IHF A;  2WB1 E;  4IOC A;  1QZH A;  4DNI A;  1GVP A;  1Q1E A;  1HJP A;  2ATW A;  3GDE A;  1PH3 A;  3A0J A;  1T9H A;  4DR1 L;  4IPG A;  5IE8 A;  1L2F A;  3S2H H;  4IJL A;  1HNW L;  4X62 Q;  1IBK L;  2ID0 A;  2JE6 I;  3HOZ H;  4LNQ A;  4B3M L;  1QVC A;  3H0G H;  2E5L Q;  4DV6 L;  1S40 A;  1N32 Q;  5FLM G;  3KJP A;  1UE1 A;  4P74 A;  3GTJ H;  3ICE A;  1I3Q H;  5C4X H;  1WCM G;  3NBH B;  4QJF A;  4L5Q A;  5E7N A;  3RLF A;  2Q2T A;  1VQP A;  3AFP A;  3HOV G;  3PO3 H;  3HOW H;  3BU2 A;  2UUC Q;  2Z0S A;  3M4Q A;  1PFS A;  4X62 L;  3E9H A;  2QGQ A;  4GNX A;  1X3E A;  2UU9 Q;  2N3S A;  2ZM6 Q;  3U58 A;  2FXQ A;  4DV4 Q;  3VDY A;  1BKB A;  2E5L L;  4DR6 L;  2ZJR A;  3RLO A;  1XPO A;  3PF4 A;  4A3G G;  4GOP C;  4LFA Q;  2NN6 I;  1MJC A;  1V43 A;  3PUZ A;  4AH6 A;  3S1R H;  3CAM A;  3BZC A;  2PQA A;  1VQ7 A;  2JA8 G;  2VUM G;  5C4J H;  2JA6 H;  1NTG A;  1NMG A;  2UUC L;  3EBE A;  3TRE A;  1K9M C;  4QL5 A;  1JJG A;  3HOX G;  2ZM6 L;  4DV4 L;  3S14 H;  2ASB A;  3W1B A;  1VQB A;  4BXX G;  4JBM A;  4A3M H;  3H3V H;  3HOU H;  3HOY H;  3CF5 A;  1TXY A;  4HJ7 A;  1PHJ A;  3CD6 A;  2VY3 A;  3WWV A;  4JI2 Q;  2PI2 A;  3JC6 6;  2HHH Q;  1E1O A;  2WFW A;  2UUA Q;  3JAM i;  5GRO A;  4DUY Q;  4H02 A;  1OXV A;  3KF8 B;  4JI3 Q;  5HGQ A;  1PVO A;  1A0I A;  4JOI C;  1CKN A;  4JI6 Q;  3STB D;  1IL2 A;  4JV5 Q;  1KL9 A;  4OX9 Q;  1Q7Y C;  1Q12 A;  1V1Q A;  2MO1 A;  1K83 H;  2WP8 J;  1WI5 A;  1EIF A;  1G29 1;  4DV5 L;  5J3B A;  3K81 C;  4LFC L;  1I94 Q;  2UUA L;  3DLL A;  4AQY L;  1YVC A;  3M7N A;  1GKH A;  1N8R C;  1KD1 C;  5IP7 G;  2LXK A;  3CPW A;  1TWC H;  4JI3 L;  2JA5 H;  3H3V I;  3J7Z C;  3PO2 G;  1C9O A;  2R92 G;  2H5X A;  4OX9 L;  4JI0 L;  2NVX H;  3BJU A;  2V1C C;  3CC2 A;  3K80 C;  3UDI A;  2WAQ E;  4GN5 A;  3CCU A;  3W1G A;  4A3D G;  5GAH C;  3CW2 C;  1I94 L;  4IFD G;  1Q1B A;  2BH8 A;  1HNZ Q;  1EIY B;  1MIU A;  2KHJ A;  2DGY A;  3I4O A;  1AE3 A;  4LF6 L;  1NE3 A;  2VQF L;  3T1Y Q;  4UY8 C;  2CFM A;  1KAW A;  4LUZ A;  1KIX A;  4LF9 Q;  4OWT B;  4DV3 Q;  2CCZ A;  3I4N G;  3L7Z C;  3K7U C;  1Z47 A;  2D0P A;  4BBR G;  3I7F A;  3UDG A;  1VQC A;  1EYG A;  1W3S A;  4O2D A;  5LMN Q;  4RMF A;  1HH2 P;  4DV2 L;  4HIO A;  2R93 H;  1BBU A;  4GLA C;  1HNZ L;  5BR8 Q;  1X55 A;  5IYB G;  3S16 H;  1LYL A;  3AFQ A;  1I5F A;  4NB3 A;  2JK8 A;  4YY3 L;  1PYS B;  1PH5 A;  1N36 L;  1EQQ A;  4A3F G;  1P16 A;  4KHP Q;  1QZG A;  3RN5 A;  4LF9 L;  4IOA A;  3A5Z B;  4DV0 L;  4HJA A;  3MXN B;  3JAM c;  4B3R Q;  3RZD H;  4IPD A;  4JBK A;  3TS0 A;  1SFO H;  4DR5 Q;  4A3C H;  2ES2 A;  4A76 A;  3GTP H;  5IWA Q;  5IP9 G;  5LMN L;  4HJ5 A;  2HT1 A;  1X56 A;  1UE7 A;  2KCT A;  1AE2 A;  3CQZ H;  4GNX B;  5BR8 L;  3BZK A;  4XIG S;  3OTO L;  1X54 A;  1U5K A;  2B3G A;  2UXC L;  2UXD Q;  1HR0 Q;  4KHP L;  4P71 A;  2I0Q A;  5M5X H;  4UP8 A;  4AIM A;  4BY1 H;  4YCW A;  4JI8 L;  2ZTE A;  4POF A;  4YHH L;  4HJ8 A;  3AYH B;  5IYD G;  2WB1 G;  2NVQ H;  1UE6 A;  2PQA B;  1U0L A;  4GN4 B;  3I4M G;  2XTI A;  3CCJ A;  1JMC A;  2VS1 A;  1N34 L;  3U4V A;  5C44 G;  1HNX L;  4ALP A;  1VQO A;  4DR1 Q;  3B6Y A;  3MEF A;  3E9I A;  1J5E Q;  2GVA A;  1IBK Q;  1HR0 L;  1L1O C;  2I5H A;  4B3M Q;  4DV6 Q;  3CCM A;  4IPH A;  5LMU Q;  2N8N A;  4BBS H;  1KRS A;  1VQK A;  1IBM L;  2NN6 G;  3KYH C;  2R7F A;  2R7Z H;  1YHB A;  3HOZ G;  1YHA A;  2DUD A;  1UEB A;  4QIW E;  4BA1 I;  3L2P A;  1YHQ A;  3H0G G;  3LGJ A;  1CKN B;  5FLX c;  1HR0 W;  1CSP A;  3UE1 A;  1J5E L;  5C4X G;  2E2I H;  3ER0 A;  4JI5 L;  4OWX B;  2RHS B;  2UUB L;  1WOC A;  4DR6 Q;  1NY4 A;  4Y52 H;  4OON A;  4R1J A;  3CP0 A;  4LUV A;  3CCE A;  5LMU L;  3HOW G;  3PO3 G;  4BY7 H;  2K52 A;  1Q82 C;  1XNR L;  1E7Z A;  1G51 A;  1VCI A;  3T1H Q;  3GTM H;  1E22 A;  3K8A A;  1K0R A;  1VQH A;  1KXL A;  1VQ6 A;  5GAG C;  4OWW B;  4LUO A;  5AJ3 Q;  1QUQ A;  4WJ3 M;  3PUW A;  4YWK A;  1PH9 A;  1K8A C;  4MZ9 A;  1PH1 A;  1VQ8 A;  4DV7 L;  1LTL A;  3PIP A;  4C3H H;  5HY6 A;  1X3F A;  1EOV A;  2B29 A;  3I56 A;  2JA6 G;  4YCU A;  3HKZ G;  4MNO A;  2RF4 A;  3KF6 B;  4L5S A;  1S3O A;  3T1H L;  1SRU A;  4K0K L;  1ASY A;  1Z9F A;  3J80 i;  5AJ3 L;  5JJI A;  1EQR A;  1PYB A;  3KFU A;  4A3M G;  3HOY G;  2L15 A;  3GTQ H;  3HOU G;  2GN5 A;  1YI2 A;  4LFB Q;  3F2D A;  3G6E A;  4IPC A;  1XNR Q;  3CCV A;  5DLQ E;  2VZA A;  4X65 Q;  5M5Y H;  3GTO H;  4A75 A;  4TVA B;  4HIM A;  1YJ9 A;  2LXJ A;  2PI2 E;  1PH2 A;  4X66 L;  4LF8 Q;  2YTX A;  2N49 A;  3HKZ E;  3CPF A;  3H15 A;  1KRT A;  4A3E H;  1XMQ L;  1H95 A;  2A19 A;  3A74 A;  4DV5 Q;  2Y0S E;  1I6H H;  3RN2 A;  4LFC Q;  4GLV B;  4AQY Q;  2F4V L;  1MKH A;  1XPR A;  2EIF A;  1YIT A;  4LFB L;  2NVY H;  3K0X A;  1A63 A;  2JA7 H;  3CC4 A;  1CSQ A;  2YTV A;  2OTL A;  3U50 C;  1E24 A;  1NMF A;  4X65 L;  1O7I A;  3OW2 A;  4B3S L;  3KDF A;  4JI0 Q;  4LF8 L;  2JQO A;  1S72 A;  5JJK A;  3D31 A;  2WAQ G;  5M3F H;  1B8A A;  1B70 B;  1Y1V G;  4KLK A;  4QY7 A;  4XTC S;  3TQY A;  4C3I H;  5C3E H;  1X6O A;  1I50 H;  2Z6K C;  1OXS C;  1NBW A;  4APV A;  4JI4 L;  4O0A A;  4LF6 Q;  2VQF Q;  3K7A H;  5IY0 A;  1FVI A;  2CQO A;  2KBN A;  1PH7 A;  1YBY A;  4BXX H;  4A4I A;  3RLN A;  1EUJ A;  3KLW A;  4X64 Q;  4JI1 L;  4GN3 B;  4C3J H;  2MQH A;  1JE5 A;  3PUY A;  2XGT A;  3A5U A;  2VW9 A;  4DPG A;  2R7D A;  3J81 i;  4DV1 Q;  4DV2 Q;  2NVT H;  5C0X I;  3F2C A;  1X3G A;  1HZB A;  4R4I A;  1LM0 A;  4YY3 Q;  3TS2 A;  1N36 Q;  2E2J H;  1HZC A;  1NJI C;  2NZO A;  5M3M H;  1ASZ A;  4C2M H;  4DV0 Q;  1KC8 C;  2KHI A;  3J80 c;  3S15 H;  1RIP A;  4X64 L;  3KJO A;  1VQ4 A;  1J6Q A;  1AH9 A;  1N33 Q;  3M4O H;  3S24 A;  1B7Y B;  4DV1 L;  4IJH A;  1Q86 C;  4P73 A;  1C7Y A;  3PCO B;  1CKM A;  4P75 A;  3OTO Q;  4DAM A;  1QVF A;  4A3C G;  1VQE A;  3D0F A;  3F8T A;  2UXC Q;  1D8L A;  1WFQ A;  2OQK A;  1VQM A;  2LSS A;  1TWF H;  4GOP A;  4A3I H;  4JI8 Q;  2YU9 H;  1IBL L;  4PG3 A;  4YHH Q;  4NXM Q;  2PNH A;  1CKO A;  3GD7 A;  3STB C;  1N33 L;  1FJG L;  1SE8 A;  3CME A;  4A3D H;  1QUQ B;  1N34 Q;  3EIV A;  4DUZ Q;  2CWP A;  1HNX Q;  4A93 G;  4GNX C;  4BY1 G;  2YV5 A;  4JCV E;  5IYC H;  3HKS A;  3GTG H;  4IFD J;  2K50 A;  3FKI G;  2R6G A;  1P8L A;  4PMW A;  4NXN Q;  3I55 A;  2IX1 A;  2F3I A;  4A3L G;  4MTN A;  4A3J G;  4LF7 L;  1VQG A;  2HIV A;  4EQ5 A;  4UP9 A;  4A3K H;  3M4P A;  5EAY A;  5H1S E;  1X65 A;  4NXM L;  2OQ0 A;  2OCE A;  1YJW A;  1IBM Q;  5LMN W;  1FGU A;  3S1Q H;  4ME3 A;  1IXR A;  4DUZ L;  4A3L H;  2B63 H;  4OO1 I;  4JOI A;  4QGU A;  2ZJQ A;  1JJC B;  3M85 A;  4NXN L;  4LF4 Q;  1FL0 A;  4OXP A;  1N9W A;  4BBS G;  2R7Z G;  4JI5 Q;  3J81 c;  4IO9 A;  1LUZ A;  3ULJ A;  2UUB Q;  4DR3 L;  1KHI A;  5GQO A;  2Z6K A;  1R9T H;  5JEA J;  2GVB A;  2Q2U A;  4JI7 Q;  2QEX A;  1EWI A;  4A3B H;  4X6A H;  4DR2 Q;  1QVG A;  3TEH B;  2A8V A;  1VQ5 A;  4JBW A;  1XNQ Q;  4LF4 L;  4BY7 G;  1K8G A;  2JA9 A;  4GKJ L;  3KDF B;  1PH4 A;  3NEN A;  2IHE A;  2BA1 A;  4DV7 Q;  3PUX A;  1OTC A;  1Q81 C;  1RL2 A;  1Q46 A;  2N78 A;  4R4O A;  3S1M H;  1MJE A;  3EN2 A;  1Y1W H;  4YWL A;  1X9N A;  4JI7 L;  4DR4 Q;  3L0O A;  2E2H H;  4JG2 A;  1Y14 B;  4DR2 L;  3UE0 A;  4K0K Q;  4QQB X;  2D62 A;  1SRO A;  4DKA C;  3DM3 A;  4Y7N H;  3CC7 A;  1XNQ L;  5FJ8 H;  4AYB G;  3U4Z A;  5JEA G;  5C0X J;  5JJL A;  4DK3 C;  3PGZ A;  2IT1 A;  1C0A A;  2JA5 G;  2NZH A;  3CCL A;  3GO5 A;  4X66 Q;  3F1Z A;  4YCV A;  4JYA L;  1XMO Q;  3M3Y H;  2CWA A;  1HZA A;  2K14 A;  4KHZ A;  3ZJY C;  1XMQ Q;  4DR4 L;  2Y0S G;  1VS0 A;  1OXX K;  3E0E A;  2OTJ A;  2PMZ E;  4L5T A;  2F4V Q;  3FHW A;  1A62 A;  4AYB E;  2HQL A;  2I5M X;  4A3E G;  2BH2 A;  1GD7 A;  4B3S Q;  5FLM H;  4GS3 A;  2JJQ A;  2K5N A;  5ELN A;  1XJV A;  2KCM A;  2C35 B;  3M9B A;  1WCM H;  1YNX A;  3CXC A;  3PF5 A;  1XMO L;  1M1K C;  1BVS A;  4PZ6 A;  2ZJP A;  3HOV H;  1VQJ A;  2JA7 G;  5C0X G;  2ZTD A;  1N32 L;  2D0O A;  4JBJ A;  3UDF A;  4KI0 A;  3RNU A;  2I5L X;  1W2B A;  4JI4 Q;  1SR3 A;  4R4T A;  4GOP B;  5M3F G;  3GTK H;  4LF5 Q;  5C3E G;  4A3G H;  2VL6 A;  2JEB I;  1SLJ A;  4JI1 Q;  1HZ9 A;  2AMC B;  1K73 C;  4L5R C;  3G71 A;  3PSI A;  2UU9 L;  2VUM H;  3PUV A;  4RG1 A;  2JA8 H;  2MFI A;  1TWG H;  2AWO A;  2RCN A;  4PZ8 A;  1L1O A;  4FDB A;  4HJ9 A;  3HOX H;  4LFA L;  2EQS A;  4LF5 L;  3NEM A;  1VQA A;  3NEL A;  2VNU D;  2QA4 A;  1CUK A;  1VQL A;  1E3P A;  3RR5 A;  1XPU A;  4EX5 A;  1G6P A;  4JC0 A;  3CCQ A;  1XTD A;  2KEN A;  1YEZ A;  5M3M G;  1PH8 A;  1D7Q A;  4R4C A;  2AWN A;  3AEV A;  4JI2 L;  2Q2I A;  3PV0 A;  1VQD A;  2YTY A;  3G48 A;  2HHH L;  2R93 G;  1JJ2 A;  4DUY L;  1IBL Q;  5GAE C;  4PZ7 A;  1IYJ B;  2IY5 B;  5K36 G;  1Y1V H;  1A8V A;  4DAY B;  1UWV A;  1WYD A;  1FJG Q;  2AKW B;  1OXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...