4DAYB

Crystal structure of the rmi core complex with mm2 peptide from fancm
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
135
structure length
113
Chain Sequence
b'AGVRLPRSPPLKVLAEQLRRDAAVWMQGRVVMADRGEARLRDPSGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RecQ-mediated genome instability protein 1
publication title Defining the molecular interface that connects the Fanconi anemia protein FANCM to the Bloom syndrome dissolvasome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/hydrolase
total genus 22
structure length 113
sequence length 135
ec nomenclature
pdb deposition date 2012-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16100 RMI2 RecQ-mediated genome instability protein 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dayB00
5GROA 2LXKA 4R4IA 1TWHH 5C0XG 5M3MH 1XMOQ 1NY4A 3EN2A 5C4XH 2DUDA 4P71A 3OTOQ 4HIDA 1YITA 3CD6A 4WJ3M 3B6YA 4X66Q 4A3LH 4UY8C 4LF6Q 1E7ZA 3A5ZB 4JI3Q 2YTVA 5IT9c 3AFQA 3HFZB 4OWXB 2MO0A 4A3IH 1IXRA 3PSIA 4A4IA 1Y1WG 4DR2Q 1KAWA 1EYGA 3FKIH 1PH1A 1LYLA 2V1CC 1EFWA 5JJKA 4LFAQ 2JA8H 4NB3A 1IBLQ 2NVTH 1G291 1S3OA 3RLFA 1KQSA 2VUMG 1VQHA 3ERSX 1DGSA 2WAQG 2JQOA 3F8TA 4APVA 4BXXG 4LFCL 4A93G 1D7QA 3CPWA 1N9WA 1EOVA 2KCTA 4KLKA 4NXNL 3VDYA 3HKZG 5DLQE 4AYBG 3OW2A 1YJWA 3CCRA 5IYBG 1XJVA 1Q1BA 1CSQA 3GDEA 1C0AA 4JI0L 2B3GA 1IBKL 3JAMi 2I5LX 3FHWA 2MFIA 2ID0A 3TS0A 4KI0A 3PGZA 5BR8L 2VUMH 3BJUA 4IPDA 4NXMQ 4LW1A 4A3BH 2E8GA 4DUZL 5IWAL 3J7ZC 1K8AC 1WJJA 2UUCQ 4JI1L 1N32L 2EXDA 3G71A 4JI6L 3M4PA 4GLAC 4LF8L 3L0OA 1K73C 5IYBH 1I94Q 3AEVA 2HIVA 4IPHA 3S17H 4IFDI 3J81i 4JYAL 2JA9A 2EIFA 2ZJRA 2E2JH 4DV5L 1MIUA 2Z6KA 4JOIC 4GOPA 4PZ8A 2OWOA 1BBWA 1EUJA 4YWMA 4JI2L 1AE3A 2JEAI 3CXCA 4DR4L 4IFDG 3TS2A 1SE8A 1S72A 4YCVA 4DK3C 1TWGH 5AJ3L 3ICEA 2OQ0A 4K0KQ 1L1OA 4O2DA 3U4VA 4GNXB 3J81j 4A3KH 4DV6L 1BKBA 4A3MG 4LF9L 4A3CG 4JV5Q 2UXDL 1NJIC 4A3GG 1FJGQ 3NENA 5JEAG 1VCIA 3RLOA 4B3SQ 1WYDA 4BA1I 2YTYA 2K5VA 4JI8Q 4DV0Q 4JI4L 1MJCA 4JI7L 1B8AA 4LF4Q 3RN5A 1KXLA 4Y52H 1HNZQ 4A3CH 4AQYL 3S2HH 4X62Q 4JC0A 5GQOA 1HH2P 1MKHA 1N36L 2RHSB 3AYHB 4DV1Q 2K52A 3H0GH 2JA5G 4BBSG 4DR6Q 5IYDG 4JI5L 2CQOA 3UDGA 1JJCB 4DR1L 3CCLA 2NVYH 1SRUA 3M4QA 3HOXG 4DV3Q 3PCOB 1XNQQ 2F3IA 3I2ZA 4X64L 3RN2A 4J15A 1VQMA 2UXBL 4FDBA 1P8LA 5FLMG 1SROA 3E9HA 4HJ5A 2UUAQ 4QL5A 4QGUA 1XMQL 4L5SA 1QVFA 4B3RQ 2HQLA 3MEFA 2JA5H 2N8NA 2PNHA 1HJPA 2B29A 4AH6A 4IOCA 4JI3L 4JBWA 5C3EH 1KIXA 2BH2A 2AWNA 4KHZA 2I0QA 1YEZA 2VS1A 1VQEA 4IOAA 4XIGS 3PIOA 4OX9Q 3PF5A 4GKJQ 1OXSC 3W5OA 1VQOA 4DAMA 3PIPA 3KF6B 2XGTA 4EQ5A 5FJ8H 2ZJQA 1YHAA 2E2IH 2D0OA 4BY1H 1VQPA 2R92H 1VQGA 4TVAB 3GO5A 4DV2Q 4BA2I 3D31A 5IY0A 1YJNA 1X65A 4GNXA 2CCZA 4A3DG 1IBMQ 3E9IA 1YNXA 1NMGA 2VY3A 3T1YL 1PV4A 1VS0A 1GD7A 3I7FA 4GLXA 3BZCA 1PFSA 1JB7A 2N78A 2PI2A 2VZAA 2Z0SA 5GAEC 4DR5Q 5C0XI 1M90C 4RMFA 4UP8A 4B3ML 2UXCL 5M3FH 3PUXA 2WAQE 5M5XH 2UU9Q 4QY7A 4DR7Q 3LGJA 1PVOA 3J80i 4OO1G 3EIVA 2DGYA 2EQSA 3KJOA 3PO3G 1Q1EA 4GKKQ 3HKZE 3A5UA 1KHIA 4IJHA 3WWVA 2KBNA 3PUZA 4LFBQ 5JJLA 2PI2E 1L1OB 4HJ8A 5IP7G 1VQDA 3PV0A 2JK8A 1X3FA 2HIXA 4DKAC 1QVGA 5GADC 2AMCB 2QGQA 3UE0A 2F4VQ 3HOZG 2JA7G 2NVQH 1B7YB 2QA4A 5C44G 1YJ9A 3G48A 4IPGA 4X65L 3S1NH 2E5LQ 5FLXc 2RHQB 4K0KL 3AQQA 3HOVG 1I3QH 2Q2HA 3CC2A 2E2HH 4UP9A 2QEXA 3U50C 3M85A 1UE7A 3T1HQ 3RZDH 1HNXL 4DV7L 3NELA 4PZ6A 5IP7H 4LUOA 1X56A 4TQUS 1MJEA 2KENA 4OWTB 3KOJA 2IHEA 1J5EL 1JMCA 1JT8A 4KHPL 2JA7H 4R4QA 3KF6A 3ZJYC 5C44H 1XPUA 1IL2A 4P73A 3HKSA 3CPFA 1Y1WH 4HJ7A 3A74A 4L5RC 2VW9A 2R6GA 2VQEQ 5C4JH 4JBJA 4HJAA 2LXJA 3STBC 2ZJPA 4DR6L 3U4ZA 2PMZE 3UE1A 2IHFA 4YHHL 3S1QH 2PQAA 4A93H 4BXXH 2Y0SE 1X55A 2JA6G 1YVCA 1K0RA 2K5NA 1SN8A 4C3HH 2HT1A 3MXNB 2VQFQ 4A3EG 1N34L 2YV5A 3GD7A 2Q2IA 2K14A 3RR5A 3PO2G 4B3RL 1FGUA 1HR0W 1FL0A 1V1QA 4H02A 1E22A 3M3YH 1Y1VG 3F1ZA 1JE5A 1Q81C 1WFQA 4LUVA 1VQ5A 2ALYB 3KYHC 2UUBL 2A1AA 4MZ9A 4JOIA 1K83H 1VQKA 2ZTCA 4LF7L 3JAMc 1YHQA 1CSPA 1GM5A 5LMUQ 2NVXH 2N3SA 1CKNA 3FP9A 4QQBX 4RG1A 2I5HA 4XTCS 1TXYA 3TREA 2NZOA 1VQLA 4B3TQ 3J7A5 2WB1E 3NEMA 1K3RA 1C7YA 2IX1A 5LMNQ 1VQBA 3CMAA 3M7NA 1OXTA 2ASBA 5IE8A 5J3BA 4O0AA 4C3JH 5GAHC 4GOPC 1IBML 1PH2A 3J81c 4YY3L 3G4SA 4UPAA 1HNWL 4HIMA 4MTNA 4A3MH 4PMWA 5M5WH 3RLNA 4DV4L 2C35B 4A3FG 3H3VI 3HOUG 2R93G 2K75A 4A3GH 1PYSB 2R7ZG 4MNOA 1WCMG 3STBD 4DR3L 5HY6A 1A8VA 1PH6A 2KHIA 1UE6A 1RL2A 3K80C 1HR0L 2N49A 2HHHL 1LTLA 2R7DA 3CCVA 1PYBA 4DV2L 3A0JA 3M9BA 4OX9L 3NBHB 3ULJA 3PUWA 4GN4B 1PH5A 3K7UC 3I4OA 5ELNA 2D0PA 1XTDA 4BY7G 1IYJB 1EIFA 1L2FA 3S15H 3JC66 4DNIA 1XMOL 1PH7A 4LFCQ 1E24A 2WP8J 2R93H 1OTCA 4PG3A 3KF8B 2K4KA 1CUKA 3PUYA 3OTOL 1EQQA 4NXNQ 1KRTA 4LWCA 4BBSH 4X66L 4OWWB 4OXPA 2MQHA 2F4VL 5IYDH 4LF6L 3E0EA 1OXXK 1XPRA 4JI0Q 5C0XJ 2ZM6Q 3H3VH 3S1MH 4GS3A 3HOXH 4AIMA 1W2BA 1PH9A 2NN6I 1A63A 1VQCA 1TWCH 1EIYB 4P74A 5BR8Q 4DR2L 1X3GA 2Q2UA 5FLMH 4LUZA 4LFAL 3GTPH 5IWAQ 2K5HA 1IBLL 1N32Q 4JI1Q 1Q7YC 1YHBA 2Q2TA 3I4NG 4JI6Q 4LF5Q 5IP9G 2NN6G 1QZGA 4LF8Q 2ZTEA 4JYAQ 1PH4A 3DM3A 5K36G 4DV5Q 4P72A 2F52A 2PQAB 4DUYQ 5LMNW 5IYCG 3K81C 4JI2Q 1PH8A 4BBRG 1SR3A 2K50A 2VQEL 1J6QA 2B63H 4DR4Q 3CCQA 3EBEA 4OO1I 1EWIA 5AJ3Q 1M1KC 4KHPQ 4LF9Q 3CC4A 3KLWA 4NXML 3ULLA 1Y14B 3CCSA 2UXDQ 4A3DH 1QUQB 2UUCL 3F2CA 1G6PA 4GNXC 1K8GA 1I94L 1ASZA 2RF4A 2GVAA 4AYBE 4JI4Q 1E1OA 3CMEA 2MNAA 2GVBA 1U5KA 4JI7Q 2A8VA 1QZHA 2B63G 2CWPA 3W1GA 1U0LA 1V43A 1CKNB 1PHJA 1KRSA 1VQIA 3GTMH 4OONA 4LNQA 1P16A 3S24A 3W1BA 4P75A 5M3MG 1VQ9A 5C4XG 2AHOB 1AH9A 1N36Q 2IX0A 1YI2A 3GTOH 3IRBA 1R9TH 4A3LG 4JV5L 1X54A 2AWOA 1VQFA 3SGIA 1SMXA 4DR1Q 1E1TA 3PO3H 4IO9A 1PH3A 1FJGL 1WI5A 1SLJA 4A3IG 4IFDJ 3BU2A 4JCVE 4X64Q 4B3SL 1SFOH 2UXBQ 3FKIG 1X3EA 4C3IH 3J80c 4JI8L 4DV0L 3UDXA 3HOZH 1YZ6A 2JA8G 1XMQQ 4LF4L 1C9OA 1AE2A 4HJ9A 4GLVB 5JEAJ 3CF5A 2IT1A 1UE1A 1HNZL 1XNRQ 3K8AA 3HOVH 4X62L 5ELOA 3CW2C 2IY5B 2NZHA 4JBMA 1Z47A 4DV1L 2FXQA 1VQ7A 3I4MG 3M4OH 4IJLA 1N8RC 2D62A 4DV3L 2MO1A 1NMFA 2L15A 3OYYA 1XNQL 4L5TA 4Y7NH 5GAGC 1VQNA 1VQ6A 2WFWA 3KDFB 1CKMA 3GTQH 1YIJA 2R7FA 4A76A 2UUAL 4A3BG 4X6AH 4R1JA 5EAYA 1Q82C 1N33Q 1GO3E 1YBYA 4DK6C 1QUQA 4NPSA 3DLLA 1L0WA 3T1YQ 3I4MH 3GTLH 4R4OA 2ZM6L 2JA6H 1Q8KA 1Z9FA 3CQZH 4GKJL 2LSSA 5E7NA 3HOWH 1UE5A 4A3EH 2ZTDA 3Q8DA 3H15A 3K7AH 4B3MQ 2VL6A 2CWAA 3PO2H 2UXCQ 1H95A 1VQJA 1JJ2A 1VQAA 2CKZB 4LF5L 4A3KG 1Y1VH 1G51A 1K9MC 2VNUD 3RZOH 3KFUA 2Z6KC 1X6OA 4YCUA 3S16H 1KC8C 4UP7A 3CCUA 4DUYL 2KCMA 4L5QA 1UWVA 1E3PA 1L1OC 4X65Q 3TRZA 1TWAH 4C2MH 4DR5L 1KL9A 2I5MX 4DAYB 5JJIA 1NBWA 4ME3A 3CP0A 1HNXQ 1V9PA 1O7IA 3UDFA 2A19A 2RCNA 3F2BA 4DV7Q 4HIKA 3I55A 4A3JG 2JE6I 2UU9L 3H0GG 1OXVA 3S2DH 2BA0A 4DR7L 2Y0SG 3CC7A 1IZ6A 1J5EQ 4GKKL 2KHJA 1LM0A 5H1SE 4LFBL 3ER0A 4YWKA 4A3FH 3HOUH 1CKOA 1TWFH 1FVIA 2R7ZH 1WCMH 1EQRA 4GN3B 1PA6A 4GN5A 4JBKA 2OTLA 1LUZA 1Q46A 3BZKA 5M5YH 4YCWA 1I50H 3KJPA 3KDFA 5HGQA 3AFPA 4A3JH 1WOCA 1IBKQ 2E5LL 3I56A 3L7ZC 1UEBA 3L2PA 4R4CA 2BA1A 3GTGH 4BY7H 3CAMA 5C3EG 4YHHQ 4A75A 2OQKA 1VQ8A 3T1HL 4DUZQ 1S40A 3K0XA 3G6EA 1NTGA 1Q12A 1QVCA 2OCEA 4IPCA 3CCMA 4POFA 2WB1G 5FJ8G 1N34Q 4JG2A 1HZ9A 4QJFA 4BY1G 1BVSA 1BBUA 1A0IA 2R92G 3PF4A 1RIPA 1XNRL 3PUVA 1GVPA 2UUBQ 3CCJA 3HOYG 3GTJH 1B70B 1I6HH 4PZ7A 4LF7Q 2H5XA 3I4NH 2CFMA 1Q86C 5IP9H 1XPOA 3CCEA 4DV6Q 1D8LA 1GKHA 2ATWA 3F2DA 3ULPA 1OXUA 1VQ4A 1I5FA 3U58A 3TEHB 2VQFL 2AKWB 5IYCH 3HOYH 1W3SA 4YWLA 4BBRH 2OTJA 5M3FG 4ALPA 3GTKH 1N33L 4R4TA 4WJ4A 4YY3Q 2YU9H 4DPGA 3HOWG 3S14H 2BH8A 1HNWQ 3D0FA 4AQYQ 2YYZA 4DV4Q 4QIWE 3TQYA 2GN5A 4HIOA 3RNUA 1T9HA 2JJQA 3S1RH 2JEBI 4DR3Q 1A62A 1X9NA 5LMUL 1ASYA 4JI5Q 2ES2A 1KD1C 1JJGA 1NE3A 4POGA 1HR0Q 1HZCA 1HZBA 4GOPB 2YTXA 2HHHQ 4B3TL 2XTIA 1HZAA 4EX5A 5LMNL 3UDIA
chains in the Genus database with same CATH superfamily
3NTHA 2EY6A 1Q8IA 1Y8OB 2LXKA 1O7YA 4R4IA 1GHKA 1QOHA 2K05A 2DUDA 4HIDA 4WJ3M 1ENAA 4LF6Q 1E7ZA 3A5ZB 1MSGA 2BDOA 2YTVA 4LK1C 5IT9c 4OWXB 3RD4A 4YIJA 3HZXA 3J80E 4FF1A 1Y1WG 1EFWA 1SNCA 4LFAQ 4NB3A 1IBLQ 3HOWB 1PTOB 1G291 2WKDA 2XWJB 1S3OA 3OWEB 2JP1A 5FO7B 2WAQG 1JCKB 3F8TA 4BXXG 5C4XB 3T53B 3KLRA 3HS0C 1FD7D 4DK0A 4JI0L 1IBKL 4O1NA 4RGMA 5BR8L 2VUMH 4EQNA 4NXMQ 2PNRC 1NNXA 1B50A 4JI1L 1OO9B 3BVMA 3M4PA 1K8MA 2LMCB 5IYBH 5NUCA 1I94Q 4IPHA 3C3LA 3EVQA 3J81i 1JR0D 1F9QA 2QDBA 3I70A 3CXCA 4DR4L 1SE8A 3CU7A 4LF9L 1BKBA 1NJIC 5JEAG 4C3HB 3HKZB 3T13A 4AYBB 4B3SQ 3OSOA 2LS01 3S17B 1GUWA 2YTYA 1O78A 2K5VA 3DEOA 4WORA 2B2VA 1B8AA 5I2XA 4OHJA 3SR1A 1HNZQ 3ERQA 4X62Q 1HH2P 1MKHA 1K83B 3DUZA 2KOLA 1LTSD 3F2UA 1AZQA 3QJYA 2HDMA 2MP1A 5C6AA 4G7HC 1AZPA 2NVYH 1SRUA 3PCOB 5L37A 2Z4IA 2ZXPA 4RA8A 1VQMA 4ILWA 1IKLA 5JAVA 4HJ5A 2B2WA 1BF4A 1HJPA 4KD3A 3S2HB 4JBWA 3OIQA 2AWNA 2I0QA 2PMZB 2VB3X 3PIOA 4GKJQ 1DXMA 1SE4A 2ZJQA 4CGYB 1DD2A 2D0OA 2F0DA 1LLRD 4TVAB 1W6KA 5IY0A 1YJNA 5JPMC 3MC0B 4GNXA 4CDFC 2CCZA 4A3DG 4BS9A 1AEXA 1NMGA 2K04A 5LHY1 3T1YL 1VS0A 1GD7A 3I7FA 5C3EB 5CORA 4GLXA 1JB7A 1PFSA 2ZXRA 2VZAA 4ZUIA 3VYTA 3SVMA 2HUGA 2TMPA 4B3ML 3PUXA 2Q8TA 5M5XH 4QY7A 2R92B 4DR7Q 3LGJA 3J80i 1EY5A 4TKOB 3HKZE 3WWVA 4LFBQ 5JJLA 3PUZA 1L0XB 4HJ8A 3SDZA 2F0JA 3BDLA 2NBFA 4HTHA 4C3IG 3HOZG 4RFBA 4X65L 1SYFA 5E3FA 5FO8B 1MBYA 1I3QH 3NTIA 3HOVG 2K5WA 4UP9A 3OWFA 3U50C 1HNXL 1S5BD 2LFNA 2F0NA 1RD9D 4PZ6A 5IP7H 4I65A 1X56A 4TQUS 1MJEA 1MSHA 2BDNA 3KOJA 4G7ZC 4DNRB 2X6LA 2NTTA 1EZ6A 3KBGA 1WTHA 1Y1WH 3A74A 4L5RC 2PW7A 2VW9A 2CVRA 5C4JH 2LXJA 3U4ZA 2PMZE 3VR5A 2I46A 1R4QB 5CV8A 1GJXA 3S1QH 2EY1A 4BXXH 2EZVA 2JA6G 1A2TA 2CW0C 2HT1A 2JSOA 1ZYRC 4KKSA 1N34L 1LT4D 3GD7A 1SMYD 1ENFA 5C44B 1EZ8A 4KJOA 1FL0A 4B9WA 1Y1VG 1JE5A 1Q81C 4LUVA 3FDTA 3H94A 2HCCA 4MZ9A 2B2TA 1KTKA 1I4HA 4LF7L 1YHQA 2L1BA 2NVXH 4B08A 1CKNA 3FP9A 4QQBX 2NZOA 4FF3A 5KIXA 3NEMA 2IX1A 4IUUA 3J7AF 3O13A 2O4XA 1FGBD 3J81c 3G4SA 2TSSA 4FXDA 5M5WH 5JVG3 1ONLA 1PYSB 5HY6A 1A8VA 5D65A 4RKBA 2MGSA 3SK5A 3A0JA 3M9BA 4DXFA 4GN4B 3PUWA 4KHVA 1PH5A 4C56C 1L2FA 1XMOL 4LFCQ 1E24A 2WP8J 2R93H 1QG7A 1V1PB 4PG3A 2PZUA 2K4KA 3PUYA 4LWCA 1STEA 4FXKC 4OXPA 3K59A 2ZM6Q 1A63A 4GS3A 1PH9A 1A15A 1F2YA 1BUVT 5IGEA 1EIYB 1A3TA 2IWHA 5FKAC 1X3GA 2Q2UA 2SDFA 2Q2TA 3SK6A 1HPCA 2A6EC 3HOUB 2ZTEA 3CRLC 1PH4A 4DV5Q 4BBSB 4DUYQ 3K81C 4JI2Q 1J6QA 1MHWC 4HR7B 1L0YB 3HOXB 5KGUA 2DJGC 5AJ3Q 2A68D 3NQTA 2NN6H 3CC4A 1R4PB 2F0UA 3KLWA 2XRSD 3I4LA 3ULLA 2UXDQ 4A3DH 1UNSA 3F2CA 1G6PA 2F0HA 1J9OA 1ASZA 4DAYA 2L9HA 4JI4Q 3Q0AA 1E1OA 1EWHA 4JK1C 1PTOD 2CWPA 1U0LA 5I9OA 3L9AX 3R3OA 1P16A 4P75A 1EWCA 1VQ9A 5C4XG 2DY7A 2DN8A 2PPBC 1EY8A 5KYIA 5C4ZA 2PZWA 3SGIA 1SMXA 1E1TA 5C3WA 1PH3A 4IFDJ 4RAUC 4JCVE 1SFOH 1JICA 2J7ZA 4C3IH 3J80c 2KJXA 3HOZH 3NE5B 3UDXA 3E5SA 4CBVA 4LF4L 3P1HA 2A69D 4DU9A 1EY0A 2IT1A 3HOVH 3GTMB 3BS1A 4JBMA 1E0BA 3FEWX 2FXQA 5A35A 2C9OA 1G2SA 4DV3L 1XNQL 4Y7NH 5T1IA 1A2UA 2AUKA 4K8IA 3AU7A 5M3MB 2R7FA 4A3BG 3D8GA 1CHPD 1GO3E 4DK6C 1QUQA 4NPSA 1L0WA 1T5EA 2ZM6L 2HDLA 2JA6H 3DWAA 2LSSA 1GOZA 1H9JA 1MGSA 3I8ZA 1X3QA 4CKBA 2ZTDA 2VL6A 2B2UC 4G4KA 5JVH3 1C48A 2EE1A 4EVOA 1Y1VH 3NQIA 1K9MC 2VNUD 4HAEA 3GTQB 2O5JC 1ESRA 4KY6A 4YCUA 3S16H 3TBIB 2CH4W 4N8X1 4DUYL 2KCMA 1UWVA 1LABA 2F0WA 3TRZA 1JB3A 2M2LA 1KL9A 1J8IA 3D3RA 1HHVA 4QUFA 1PZJD 3CP0A 3EFXD 3URYA 4A3JG 2A19A 2Z1CA 4IUQA 3PO2B 2A74C 3I55A 2UU9L 4GKKL 2D2CC 4YWKA 1TWFH 1FVIA 1XTCD 3RUZA 4HEDA 4GN5A 1LUZA 5HGQA 4DGZA 1HFNA 3I56A 2XVSA 1BCPD 2NWGA 3CAMA 1KNAA 5C3EG 5K5PA 3T1HL 3G6EA 1QVCA 2SNSA 4KKUA 2B2WC 3CCMA 1TS3A 3WDNA 1BVSA 2R92G 3PF4A 1RIPA 3FVQA 2M00A 4K6LA 2UUBQ 1E2ZA 3HOYG 3GTJH 2L4NA 1XYIA 1I6HH 1EFID 1DM0B 4FNFA 3GTGB 4BY7B 3V05A 3FPUB 2K7VA 3U58A 3TEHB 3HGBA 1B53A 2KHSA 3GTKH 1B1ZA 4WJ4A 4FVMA 4YY3Q 3S14H 2QF7A 4IZ8A 3D0FA 4AQYQ 4RWSC 4IQZA 3TQYA 1D1KA 1T9HA 2F03A 3R93A 4DR3Q 1HRJA 1A62A 1TVXA 3I4NB 4JI5Q 2ES2A 5C5LA 3QOJA 1NE3A 1JJGA 1HZCA 1HA6A 4DV2Q 1HZAA 3HOWH 1PTOF 5GROA 1HUMA 1TWHH 5C0XG 1EOTA 5KRUA 3EN2A 4MIUA 5C4XH 1QWYA 2R61A 3BYTB 1C4QA 2EYFA 3B6YA 3DWPA 5D3IB 4UY8C 3AFQA 3HFZB 5HGTA 4UHVA 3GV6A 2MO0A 3DM1A 1IXRA 5IOCA 5E1FA 1KAWA 3DWQA 4XXEA 2DJFC 1LYLA 2V1CC 4DR2Q 1PH1A 2K33A 4XDXA 1KQSA 3A8KE 2VUMG 1FNWA 1VQHA 1MI2A 4MN3A 1D7QA 4NXNL 3OW2A 4ABNA 5IYBG 3MEHA 1XJVA 1Q1BA 3GDEA 2EDGA 2B3GA 3J7AV 1CFMA 1SNQA 3PGZA 4IPDA 1I6VC 2KQ3A 4LW1A 2E8GA 3IKJA 1EEID 3J7ZC 4A3BH 1WJJA 1N32L 1RTNA 3TSSA 3MFGA 2NVTB 4JI6L 4LF8L 1F9PA 5C3XA 3S17H 4S3SA 5DNFA 1DYQA 2ZJRA 1ILQA 5LL6X 1MIUA 4PZ8A 2B2TC 4C3JG 1IYVA 1AE3A 1S72A 2G9HD 4CKCA 4DK3C 1V1OA 3ICEA 2OQ0A 4K0KQ 4O2DA 4KHPL 1NUCA 3TP6A 3RLOA 4BA1I 1JOKA 4JI8Q 4IFDH 4I7ZC 1QE6A 3RN5A 1KXLA 1PMRA 1CA6A 4AQYL 3S2HH 1I4GA 1RCVD 2RHSB 1II3A 4DV1Q 2K52A 4BBSG 2Z6BA 4R8IA 5DEHA 4A3KB 4JI5L 5BN3A 3UDGA 4DR1L 3CCLA 2J0TD 1LACA 2RKSA 2RCFA 3HOXG 3BYYB 3I2ZA 1JE4A 4MTKA 1LTGD 1YNNC 3E9HA 2UUAQ 4B3RQ 3MXGA 3MEFA 1ILPA 2KEDA 1BCPF 3MAQA 2B29A 5C3EH 2RBMA 1YEZA 2F0PA 1VQEA 4IOAA 4XIGS 3PF5A 5DM63 4DAMA 3KF6B 4EQ5A 1YHAA 1SNOA 2R92H 1KDAA 1VQGA 3GO5A 5EPJA 1X65A 2A73B 2EYJA 5CR3A 1IBMQ 1ZXTA 3E9IA 1SYCA 5EKLA 2JA5B 2VY3A 1CTMA 3BZCA 4N9TA 4X3TA 3S1MB 1B44D 4DR5Q 4FO2A 3W3AA 4CKEA 1M90C 4UP8A 2EYHA 5I6YA 1PVOA 5KNBA 4OO1G 5JOBA 3EIVA 2SNMA 1RHPA 4NP5A 4RHSA 3A5UA 1SMYC 2PI2E 5IP7G 1VQDA 3PV0A 2JK8A 5GADC 1F9RA 2QA4A 2K6AA 1WD1A 3A56A 1FR3A 2E5LQ 4K0KL 1V1PA 2Q2HA 3CC2A 5C0XH 3M85A 1UE7A 2WV6D 2C5CA 4DV7L 2SEBD 2KENA 2FFKB 1TS2A 3ZJYC 5C44H 1XPUA 1D2BA 2NZ1D 2EOTA 3HKSA 1I4RA 2NVQB 2VQEQ 3EA6A 3S1NB 4JBJA 2IL8A 1LTTD 1K8OA 1HFGA 4RCOA 2OT2A 4KK7A 1K0RA 1SN8A 2B2UA 2VQFQ 4N8FA 3D4WA 3ND8A 2Q2IA 2JA7B 2K14A 3PO2G 4B3RL 4NDXA 5FLXL 1CZWA 1IHZA 4OIKA 5DM73 4H02A 4EGVA 3IAYA 3F1ZA 1PRTC 2A1AA 4FF4A 4K14A 2ZTCA 2I07B 1CSPA 3VR3A 2MJ8A 2N3SA 1WTVA 4A93B 1TXYA 3J7A5 2WB1E 1C7YA 3LWEA 1A3UA 1H9SB 1VQBA 3M7NA 3R2TA 2L11A 4C3JH 2QKIC 4GOPC 5GAHC 1IBML 1KDCA 4Q0FA 1S4ZA 3OW7A 5J22A 3M3YB 4UPAA 4QIWB 1HA5A 3FRPB 3KBXA 5CGKA 4PMWA 2R93G 4MNOA 1DJRD 1H9RA 1PH6A 1EYAA 1UE6A 3QB3A 2HHHL 4L6TB 3C1EA 4OX9L 3ULJA 1LTBD 1PXUA 3K7UC 3I4OA 4QCLA 2D0PA 4BY7G 1EIFA 2WIIB 1O7LA 3CKIB 4HSPA 3X3NA 1PH7A 1OTCA 1PTOC 1STNA 3KF8B 3KLSA 4BBSH 1CUKA 1EIHA 1EQQA 1KRTA 1XWEA 1LT3D 4LF6L 3E0EA 3VA7A 3TP7A 1XPRA 2F0FA 3MXNA 2G9DA 3HOXH 1W2BA 4H0LC 2NN6I 1TWCH 2AUJD 1RTOA 3PQIA 4LUZA 4LFAL 5CBAE 5IWAQ 2K5HA 1IBLL 1SNDA 1YHBA 5EPLA 3I4NG 2NN6G 4CJ0B 1NR4A 1LV9A 3S15B 4JYAQ 2A69C 3DM3A 5K36G 1BCPB 5IYCG 1PH8A 5LL6S 1EL0A 1EYCA 2VQEL 3SE0A 3CCQA 1M1KC 1K28A 4QMGA 1TQOA 2H4OA 2M9VA 2QW7A 4NXML 1HTLD 1EU3A 1PDQA 2NTSA 4Z9CB 4EQPA 1I94L 2RF4A 1F9SA 2NUCA 4AYBE 3CMEA 2G5DA 2GVBA 4JI7Q 3X3MA 5DAUA 5ELBA 1KRSA 3G7LA 4EQOA 3NBHA 3KLSX 3GTMH 4OIJA 4RCNA 3MZ5A 1DOKA 1JORA 3D4DA 1N36Q 5CMDA 4OO1H 3TZUA 3E3XA 2D9UA 5EGTA 4X64Q 2RDFA 4B3SL 2UXBQ 3MFYA 5FLXE 1VMCA 1XMQQ 1AE2A 1JC7A 4HN7A 4HJ9A 4GLVB 3NBIA 1UE1A 1HNZL 4X62L 4L63B 1PZKD 3QOLA 2P5ZX 4NMZA 2EY2A 5IODA 1O80A 3GTOB 4LMQD 3I72A 4IJLA 3K5OA 2D62A 1X32A 2MO1A 1NMFA 1G91A 1SDFA 3K5NA 4L5TA 3GTQH 2VB2X 5EAYA 2B8FA 3E0JA 1F77A 3DLLA 3SEBA 1Q8KA 1Z9FA 2BE5D 4GKJL 4G57A 3R2IA 5E7NA 4KY5A 1RDPD 4UDUC 3M4OB 1SJHD 2JN4A 2UXCQ 3PO2H 3U9OA 3N52A 5FO9B 1Z6HA 1AW7A 3DHQA 4A3KG 1AN8A 5IT9L 1BNZA 1ZKOA 3KFUA 4UP7A 3CCUA 3BVGA 3I4MB 1E3PA 4KKTA 1QILA 1NBWA 2OF1A 1Y69U 3QG1A 4A3EB 3H0GG 4DR7L 2BA0A 4U673 3U9SA 1TKWB 3RZOB 1J5EQ 1LM0A 5H1SE 4LFBL 3ER0A 1RJTA 2QDLA 4QB4A 4GN3B 2OTLA 1Q46A 4YCWA 3KJPA 3KDFA 1TWAB 4CDEC 4C2MB 1UEBA 4ZLTF 3GP7A 2BA1A 3GTGH 4BY7H 4YHHQ 4A75A 2OQKA 4ZKBB 1NTGA 1TY0A 4IPCA 4LAAA 1LTAD 2WB1G 2KVMA 4XQJA 2EPBA 1I50B 1B70B 4PZ7A 4RKLA 2F0OA 2FHTA 3I4NH 2CFMA 1EEFD 4DV6Q 1SYGA 5K36H 1KNEA 1I5FA 2KECA 2VXWA 3TMEA 3HEJA 5IYCH 4BWGB 4YWLA 5CC4A 2OTJA 4ALPA 3M7GA 3VR6A 3HOWG 4DPGA 2RDHA 2AQ3B 1HNWQ 2XN9C 1NR2A 1CQFA 4DV4Q 2GN5A 4KTAA 2JJQA 4XT3B 1X9NA 1ASYA 4PQXA 4POGA 1HR0Q 1KLUD 2XTIA 2ZXOA 4ZYSA 3CHBD 5IGFA 1EYDA 4IUTA 4BBRB 1NY4A 5EKIA 3OTOQ 1YITA 2A6HD 4X66Q 3W2DA 1C8CA 4JI3Q 2RSOA 3TDQA 1WVLA 1H9MA 3PSIA 5JJKA 5KYLA 1Z7TA 1SYBA 5M5XB 2NVTH 1KLGD 3BDOA 4APVA 4A93G 4LFCL 2PO4A 2R3ZA 2DNCA 1EOVA 2KCTA 3L3OC 2KEEA 3VDYA 4C3HG 3HKZG 5DLQE 4AYBG 1YJWA 1C0AA 1CSQA 1D6EC 2F0LA 2I5LX 2MFIA 2ID0A 4A3IB 4XQQA 1YNJD 1M4VA 2RSNA 1V8QA 3FKIB 3AB9A 5ELDA 2JA8B 1EY6A 1K8AC 2UUCQ 4GLAC 5C5MA 4IFDI 1CK1A 2EIFA 4DF7A 4DV5L 4GOPA 1ET6A 1PFNA 1BBWA 1Y1WB 4JI2L 5EQ0A 2JEAI 4IFDG 3TS2A 1JOQA 4YCVA 5AJ3L 1RF2D 4GNXB 4A3KH 3J81j 4DV6L 4JV5Q 2WAQB 2UXDL 1IW7C 1FJGQ 3NK9A 1STBA 4ZKCB 1LT5D 5F2DA 4DV0Q 4JI4L 1MJCA 3I90A 3BZDB 2E2JB 2KCNA 1H9KA 1FYCA 4A3CH 5GQOA 2K5DA 2IX3A 3GQBA 3AYHB 5E4WC 3H0GH 1TWGB 5JJZA 5IYDG 2CQOA 1JJCB 2F3IA 4ZUJA 4J15A 4FDBA 2AQ1B 1ZYRD 1SROA 1QVFA 4QL5A 2IPKD 4QGUA 4FXGC 4E6IA 3Q24A 2JA5H 2N8NA 1MD2D 5EKKA 1I4XA 1K3BC 4AH6A 4IOCA 4JI3L 1KIXA 5M5WB 4KHZA 2VS1A 4RH6A 4FF2A 3K58A 1G8ZD 4OX9Q 4LJZC 1VQOA 3D6CA 3OOCA 2XGTA 4X3KA 3Q23A 1VQPA 1KABA 3EQLC 4PMBA 5I9PA 4XYQA 4C1NI 1PV4A 1VMPA 1H9SA 2N78A 1GUTA 2EJMA 1BXTA 5GAEC 1TS4A 1CHQD 4ZQ3A 5C0XI 2D5DA 2E2IB 1B4OA 4BY1B 2WAQE 1I4QA 1PTOH 2EYLA 1LT6D 2EQSA 1Q1EA 3EJIA 1UAPA 1KHIA 2KBNA 1L1OB 3KUPA 1D1IA 2HIXA 4K2KA 4K2LA 3Q22A 3UE0A 2NVQH 5C44G 4L8JA 3G48A 1YJ9A 3S1NH 1AFPA 5FLXc 2RHQB 3P20A 3AQQA 1BOSA 1IL8A 2RVLA 5M3FB 4KN4C 5EBCA 3NELA 4LUOA 4OWTB 2NYZD 4HCSA 2JA7H 1A3VA 3VR4A 5IGCA 1IL2A 3HP3A 3BG3A 4P73A 5COYA 1SYDA 2R6GA 4DNTB 4HJAA 1CA5A 1BO0A 2ZJPA 2N55A 5J39A 2BCOA 2ENBA 2CQAA 3UE1A 2IHFA 2E2HB 4A93H 1ET9A 1BDOA 3RZDB 4GZYC 1X55A 4HMJA 2Z8LA 2K5NA 4C3HH 1O7ZA 3MWYW 4A3EG 3HOZB 2YV5A 3RR5A 5TSSA 1V1QA 3M3YH 1E22A 1EY9A 2CHBD 3HOVB 2UUBL 3MXUA 2ALYB 3KYHC 3SXHA 4JOIA 1K83H 4Q5VA 2MHVA 5KNCA 5C4HA 5LMUQ 4K5XA 1Q3LA 5CYUA 3TREA 4B3TQ 4OL7A 5LMNQ 2EJGC 3G6JB 2ASBA 3H91A 3IFTA 5J3BA 4O42A 4YY3L 5E4XA 4HIMA 4MTNA 3RLNA 2C35B 3HOUG 3FPPA 4MHEA 3STBD 4DR3L 4U68A 2KHIA 1RL2A 3D6WA 1PFMA 3K80C 2K28A 2N49A 1LTLA 2R7DA 4DV2L 4PMCA 4FP5D 1GHJA 5ELNA 1XTDA 1IYJB 3S15H 3JC66 3M4YA 2O2LD 3JAML 3K0YA 5IYDH 4OWWB 1STHA 2MQHA 4A3MB 4R9WA 4JI0Q 3H3VH 4A3GB 3S9WA 1PYWD 5BR8Q 4DR2L 4HSVA 3PIO3 5D14A 2QILA 4JI1Q 1Q7YC 1QZGA 2WKCA 3T16A 3MHBA 4P72A 2PQAB 5CV6A 5LMNW 3ND9A 5EPKA 4BBRG 1SR3A 2K50A 2X6GA 4DR4Q 4OO1I 2XWBB 4LF9Q 1S5FD 3CCSA 3GTPB 3V96A 1QUQB 5EJWA 4G7OC 2EJFC 1K8GA 3TN2A 4DFAA 5ISRA 1E2WA 4OGQC 1Y8NB 3HG9A 2MNAA 2A8VA 1QZHA 5ELFA 3P7JA 3W1GA 1PHJA 2B2YC 1DOMA 5M3MG 1I6HB 2X69A 3A8IE 3GTOH 3IRBA 5HURA 4A3LG 1X54A 2AWOA 3MTSA 4IO9A 5CV4A 3D4RA 1WI5A 3C1FA 4ZCKA 4A3IG 3FKIG 1BBXC 4JI8L 1F2ZA 1YZ6A 2JA8G 3GTKB 4NKLA 3S14B 3GV3A 5JEAJ 4WJWA 3K8AA 5ELOA 2NZHA 1Z47A 4DV1L 1VQ7A 3SHLA 2WINB 1R9TB 5I6WA 3M4OH 3PO3B 3RMHA 5BN5A 2KCCA 1SE3A 5GAGC 1CKMA 1TWHB 2L5TA 3TP5A 4KN7C 3OMCA 1U9RA 4A76A 2UUAL 2K32A 4R1JA 5CBEE 1YBYA 3SK8A 2L55A 3T1YQ 3I4MH 3NXWA 1ML0D 4R4OA 1UE5A 4F7XA 5I2YA 4A3EH 3Q8DA 4B3MQ 1IYUA 4KJNA 2MPMA 2CKZB 3VYRA 3RZOH 3N6RA 3H09A 1KC8C 3JAME 2F0SA 3ONAB 3GTLB 1T5XD 4KY7A 1RODA 4B9XA 4X65Q 1TT2A 1TWAH 3OPOA 3CQZB 2A68C 4C2MH 4DR5L 1WD0A 4ME3A 1HNXQ 1V9PA 1O7IA 3K7AB 2RCNA 3UDFA 3F2BA 4HIKA 4A3BB 2JE6I 4HMIA 1ICFB 5ELEA 4H44C 4P2CB 3Q6SA 4IN3A 1IZ6A 3TP8A 3HOUH 1TIID 3I3CA 1LTID 3BZKA 1I50H 3P75A 2E5LL 3L2PA 3QR8A 1SE2A 3OIPA 1EQVA 2E76C 4R4CA 4CHTB 1U4RA 3NHHA 4DUZQ 1S40A 3PIP3 1ZEQX 1Q12A 3S2DB 1HTPA 5FJ8G 1N34Q 4RGNA 4A3FB 1HZ9A 1M8AA 1K0SA 3A54A 4BY1G 1U4MA 1BBUA 1I4PA 1WCMB 2R7ZB 2A6HC 3PUVA 4WFN3 5IIFA 3CCJA 5M5YB 1Q90A 1S5ED 4A3JB 1KAAA 4LF7Q 2H5XA 3WOEA 3CCEA 1D8LA 1TY2A 2E75C 1JQYD 4M1UB 3F2DA 3ULPA 1OXUA 1VQ4A 2ICEC 2XRQD 3QIAA 2VQFL 2GA4B 2AKWB 1WTWA 3K57A 3I73A 4BBRH 5M3FG 2RA4A 2Z9HA 5FOBB 3ZYYX 1QCBD 2HCIA 4QIWE 3RNUA 4HIOA 2A5HA 3DEPA 4K6DA 5G3LD 1YNJC 3MA2B 2EYPA 2ICIA 2FINB 4XYOA 1HZBA 5KNDA 2YTXA 3K5LA 1QVGA 3UDIA 4RHRA 5JPNC 4HCEA 3HOYB 5M3MH 1XMOQ 1F2MA 1YNND 4P71A 2YU9B 1DOLA 3CD6A 2RQXA 1HQRD 4A3LH 4F87A 3S1RB 4A3IH 1JWSD 3QWNA 1PFBA 4A4IA 2F0QA 1EYGA 3FKIH 4DAVA 2JA8H 5IGGA 2B63B 2PZTA 5D3DA 1F2LA 3RLFA 4F88A 2PCFB 4DK1A 3ERSX 1DGSA 2JQOA 1VF5C 3CPWA 1N9WA 4KLKA 2KA7A 3C46A 2FMMA 3CCRA 3ITPA 1ICWA 3JAMi 3FHWA 1BCPC 4J1MA 2Q8IB 3TS0A 4KI0A 1EIGA 3BJUA 2PQEA 3H3VC 4JPBW 4DUZL 5IWAL 4X3UA 2EXDA 3G71A 1EQTA 3L0OA 1K73C 3AEVA 2CH4A 2HIVA 4JYAL 1B3AA 2JA9A 1U4PA 2XSCA 2E2JH 2Z6KA 4JOIC 2OWOA 5IGDA 1EUJA 4YWMA 5I4DA 2FMCA 1ESFA 1TWGH 2AQ2B 3VA5A 1L1OA 3U4VA 4A3CG 2VUMB 4QUCA 4A3MG 2B8GA 2B39A 4XT1B 4KMUC 3IFDA 4A3GG 3NENA 4ZRZA 1VCIA 1WYDA 4JI7L 3HRZC 4LF4Q 4Y52H 4ODGA 4WRDA 4JC0A 5J1ZA 4IURA 1N36L 3VYSA 5JEAH 2JA5G 4DR6Q 3BDCA 4NW2A 1QNKA 3AMUA 1TU2B 3M4QA 4DV3Q 1Y8PB 2ZT9C 1WTRA 1XNQQ 3IL8A 4X64L 2V4DA 3RN2A 2UXBL 1P8LA 4C3JB 5FLMG 4DN4M 4L5SA 3E6ZX 1XMQL 4ME5A 1DONA 2HQLA 2PNHA 2F0VA 2BH2A 1PRTD 2OEOA 1OXSC 3W5OA 2Y0SB 3PIPA 5FJ8H 1DCZA 2E2IH 2NVYB 1TS5A 2OXPA 4BY1H 1NSNS 3D31A 4BA2I 1CZGA 2WACA 3C2PA 1YNXA 4DAPA 1CQVA 2F4IA 1HXYD 2MUYA 3NPPA 3NTKA 2PI2A 2Z0SA 3NUCA 2B2YA 1TWCB 1WTQA 3UI2A 4RMFA 1JOOA 1NCVA 2UXCL 5M3FH 1CM9A 2UU9Q 2DGYA 3KJOA 3PO3G 4GKKQ 4DA2A 4IJHA 3CRKC 3A7AB 2E74C 1X3FA 5G3LF 4DKAC 2F4VQ 2AMCB 2QGQA 5CV5A 4F8MA 2JA7G 3FMCA 1B7YB 4IPGA 2E2DC 3VR2A 1PZID 2KUMA 1RKNA 2E2HH 4TSSA 2QEXA 1DZ1A 3T1HQ 3RZDH 4K5VA 2K01A 3DXJC 5IT9E 2IHEA 1J5EL 1ENCA 1JMCA 1JT8A 4ULLA 4R4QA 3KF6A 2F0EA 1SXTA 3CPFA 5FK9C 4CJ2C 4HJ7A 3TZDA 1PLFA 4XQNA 3STBC 1SBBB 2IW3A 3H6MA 4DR6L 1I3QB 4YHHL 3KK7A 2PQAA 1S5DD 2Y0SE 1FNVA 1UEAB 1YVCA 3LWUA 3MXNB 1SAPA 1FGUA 1HR0W 1XXGA 4V0BA 1WFQA 1VQ5A 4OELB 5C4JB 3NP8A 1VQKA 1UUPA 1SSOA 3JAMc 1GM5A 1WTPA 5BN4A 3S1QB 4RG1A 2I5HA 4XTCS 1VQLA 1K3RA 1JWMD 5AFWA 3CMAA 1OXTA 5IE8A 5EBDA 4O0AA 3T4AC 1PH2A 4M8AA 1HNWL 4ID6A 1BR9A 2EXZA 4A3MH 4I7AA 3H3VI 4DV4L 4A3FG 3DMUA 2K75A 4A3GH 2R7ZG 1WCMG 3A8JE 2NVXB 1CI3M 1EY7A 3K6OA 3NWTA 1HR0L 3CCVA 1PYBA 3NBHB 1GUNA 2F3WA 2CW0D 2B2VC 3A55A 1SEBD 4IALA 5M9OA 4DNIA 3EROA 2L12A 3OTOL 1GUGA 4NXNQ 4X66L 2F4VL 2JXMB 1OXXK 3OHXC 5C0XJ 3S1MH 4AIMA 1VQCA 4R8NA 1SNMA 3R8BA 4P74A 5FLMH 3J81L 3GTPH 1N32Q 1QJOA 2HQEA 4H7BA 5A2QL 4JI6Q 5IP9G 4LF5Q 4LF8Q 3I91A 2EYMA 1PRTF 2R93B 2F52A 2XNAC 4IUNA 4QF4A 2FJ2A 3EBEA 1EWIA 2EYOA 2PW5A 1U4LA 1B2TA 4KHPQ 1D5MC 1QB5D 4OEMB 1Y14B 3T56B 1CT1D 2UUCL 1SJED 2F0KA 4GNXC 3NSWA 4RGOS 3SK4A 1KDBA 2GVAA 4ZK9B 3BVZA 1U5KA 2B63G 2F0IA 1GUSA 1V43A 3A7LA 1CKNB 1VQIA 4OONA 4LNQA 4H13C 3S24A 3W1BA 1AH9A 2AHOB 2IX0A 1YI2A 2K5QA 3KF8A 1R9TH 4JV5L 1VQFA 3PO3H 4DR1Q 4A3DB 1FJGL 4IUPA 1SLJA 1W6JA 4K5WA 3BU2A 1X3EA 4DV0L 2A6ED 1S5CD 1GXDC 4UAIA 1C9OA 5CV9A 3CF5A 1XNRQ 3PMFA 1LO5D 2L0CA 3CW2C 2IY5B 3I4MG 4V190 1N8RC 2EY5A 1B9NA 2L15A 3OYYA 2DY8A 4JVZA 1VQNA 1SFOB 2WFWA 3KDFB 1VQ6A 4C3IB 1YIJA 1HQMC 4X6AH 1Q82C 1N33Q 2NB0A 5KEEA 4DXGA 2SOBA 3GTLH 4CJ1B 1STYA 1B3QA 3CQZH 5ELCA 2J4XA 1HCZA 3T51B 2Q8RE 3J80L 1B9MA 4PNYA 3H15A 3K7AH 1H95A 2CWAA 2K1BA 3V2TA 1VQJA 1JJ2A 1VQAA 4LF5L 4Y7NB 1G51A 1EY4A 1X6OA 2Z6KC 2HD3A 1WTXA 2F0GA 1FNUA 4RGTA 1E2VA 3VYUA 1IKMA 3LX0A 1VDZA 4L5QA 1L1OC 2H1EA 2JA6B 1VF7A 1D5XC 2I5MX 4DAYB 5JJIA 2EVBA 3J81E 4DV7Q 4FYDA 4CDDC 1OXVA 3S2DH 5A2QE 1WTOA 2Y0SG 1Y1VB 4KV6A 1BQQT 3CC7A 2KHJA 5IGBA 3S16B 4A3FH 1AP0A 1CKOA 2R7ZH 1WCMH 1EQRA 1PA6A 4JBKA 1G2TA 3LNNA 5M5YH 3MVVA 4J8QA 4A3JH 1QNUA 1X3PA 1WOCA 2JYOA 3AFPA 1IBKQ 3L7ZC 2F1MA 2Z4HA 4N9PA 1TR5A 1JWUD 1VQ8A 1SYEA 2N88A 1EU4A 3K0XA 1HUNA 2OCEA 4PV1C 2RDGA 4POFA 3J7YW 4JG2A 3NWSA 1TWFB 4QJFA 4X3SA 1A0IA 1STGA 1XNRL 4JW0A 1GVPA 4IUVA 2F0TA 1D5ZC 1NAPA 1SNPA 2LKVA 3H0GB 4J6HA 2DNEA 1Q86C 4K8JA 5IP9H 1XPOA 2O5IC 1GKHA 2LY7A 3QO2A 1LTRD 3OMGA 2ATWA 1IW7D 2K03A 1A6XA 5CV7A 3HOYH 1W3SA 1PRTB 2PYKA 3MXPA 5T1GA 3K5MA 2QEJC 4KD4A 4R4TA 1N33L 1G6ZA 2YU9H 2IJ0A 2F3VA 4ZAIA 2BH8A 2BOSA 2F0MA 4TRDA 3WOFA 4CDCC 2YYZA 3GTJB 2QCPX 2BE5C 2XIWA 4C1NK 1XX8A 3S1RH 2JEBI 1GUOA 5LMUL 2WB1B 1KD1C 1STAA 4B3TL 2HHHQ 4GOPB 2B63H 4EX5A 5LMNL
chains in the Genus database with same CATH topology
5GROA 2LXKA 4R4IA 1TWHH 5C0XG 5M3MH 1XMOQ 1NY4A 3EN2A 5C4XH 2DUDA 4P71A 3OTOQ 4HIDA 1YITA 3CD6A 4WJ3M 3B6YA 4X66Q 4A3LH 4UY8C 4LF6Q 1E7ZA 3A5ZB 4JI3Q 2YTVA 5IT9c 3AFQA 3HFZB 4OWXB 2MO0A 4A3IH 1IXRA 3PSIA 4A4IA 1Y1WG 4DR2Q 1KAWA 1EYGA 3FKIH 1PH1A 1LYLA 2V1CC 1EFWA 5JJKA 4LFAQ 2JA8H 4NB3A 1IBLQ 2NVTH 1G291 1S3OA 3RLFA 1KQSA 2VUMG 1VQHA 3ERSX 1DGSA 2WAQG 2JQOA 3F8TA 4APVA 4BXXG 4LFCL 4A93G 1D7QA 3CPWA 1N9WA 1EOVA 2KCTA 4KLKA 4NXNL 3VDYA 3HKZG 5DLQE 4AYBG 3OW2A 1YJWA 3CCRA 5IYBG 1XJVA 1Q1BA 1CSQA 3GDEA 1C0AA 4JI0L 2B3GA 1IBKL 3JAMi 2I5LX 3FHWA 2MFIA 2ID0A 3TS0A 4KI0A 3PGZA 5BR8L 2VUMH 3BJUA 4IPDA 4NXMQ 4LW1A 4A3BH 2E8GA 4DUZL 5IWAL 3J7ZC 1K8AC 1WJJA 2UUCQ 4JI1L 1N32L 2EXDA 3G71A 4JI6L 3M4PA 4GLAC 4LF8L 3L0OA 1K73C 5IYBH 1I94Q 3AEVA 2HIVA 4IPHA 3S17H 4IFDI 3J81i 4JYAL 2JA9A 2EIFA 2ZJRA 2E2JH 4DV5L 1MIUA 2Z6KA 4JOIC 4GOPA 4PZ8A 2OWOA 1BBWA 1EUJA 4YWMA 4JI2L 1AE3A 2JEAI 3CXCA 4DR4L 4IFDG 3TS2A 1SE8A 1S72A 4YCVA 4DK3C 1TWGH 5AJ3L 3ICEA 2OQ0A 4K0KQ 1L1OA 4O2DA 3U4VA 4GNXB 3J81j 4A3KH 4DV6L 1BKBA 4A3MG 4LF9L 4A3CG 4JV5Q 2UXDL 1NJIC 4A3GG 1FJGQ 3NENA 5JEAG 1VCIA 3RLOA 4B3SQ 1WYDA 4BA1I 2YTYA 2K5VA 4JI8Q 4DV0Q 4JI4L 1MJCA 4JI7L 1B8AA 4LF4Q 3RN5A 1KXLA 4Y52H 1HNZQ 4A3CH 4AQYL 3S2HH 4X62Q 4JC0A 5GQOA 1HH2P 1MKHA 1N36L 2RHSB 3AYHB 4DV1Q 2K52A 3H0GH 2JA5G 4BBSG 4DR6Q 5IYDG 4JI5L 2CQOA 3UDGA 1JJCB 4DR1L 3CCLA 2NVYH 1SRUA 3M4QA 3HOXG 4DV3Q 3PCOB 1XNQQ 2F3IA 3I2ZA 4X64L 3RN2A 4J15A 1VQMA 2UXBL 4FDBA 1P8LA 5FLMG 1SROA 3E9HA 4HJ5A 2UUAQ 4QL5A 4QGUA 1XMQL 4L5SA 1QVFA 4B3RQ 2HQLA 3MEFA 2JA5H 2N8NA 2PNHA 1HJPA 2B29A 4AH6A 4IOCA 4JI3L 4JBWA 5C3EH 1KIXA 2BH2A 2AWNA 4KHZA 2I0QA 1YEZA 2VS1A 1VQEA 4IOAA 4XIGS 3PIOA 4OX9Q 3PF5A 4GKJQ 1OXSC 3W5OA 1VQOA 4DAMA 3PIPA 3KF6B 2XGTA 4EQ5A 5FJ8H 2ZJQA 1YHAA 2E2IH 2D0OA 4BY1H 1VQPA 2R92H 1VQGA 4TVAB 3GO5A 4DV2Q 4BA2I 3D31A 5IY0A 1YJNA 1X65A 4GNXA 2CCZA 4A3DG 1IBMQ 3E9IA 1YNXA 1NMGA 2VY3A 3T1YL 1PV4A 1VS0A 1GD7A 3I7FA 4GLXA 3BZCA 1PFSA 1JB7A 2N78A 2PI2A 2VZAA 2Z0SA 5GAEC 4DR5Q 5C0XI 1M90C 4RMFA 4UP8A 4B3ML 2UXCL 5M3FH 3PUXA 2WAQE 5M5XH 2UU9Q 4QY7A 4DR7Q 3LGJA 1PVOA 3J80i 4OO1G 3EIVA 2DGYA 2EQSA 3KJOA 3PO3G 1Q1EA 4GKKQ 3HKZE 3A5UA 1KHIA 4IJHA 3WWVA 2KBNA 3PUZA 4LFBQ 5JJLA 2PI2E 1L1OB 4HJ8A 5IP7G 1VQDA 3PV0A 2JK8A 1X3FA 2HIXA 4DKAC 1QVGA 5GADC 2AMCB 2QGQA 3UE0A 2F4VQ 3HOZG 2JA7G 2NVQH 1B7YB 2QA4A 5C44G 1YJ9A 3G48A 4IPGA 4X65L 3S1NH 2E5LQ 5FLXc 2RHQB 4K0KL 3AQQA 3HOVG 1I3QH 2Q2HA 3CC2A 2E2HH 4UP9A 2QEXA 3U50C 3M85A 1UE7A 3T1HQ 3RZDH 1HNXL 4DV7L 3NELA 4PZ6A 5IP7H 4LUOA 1X56A 4TQUS 1MJEA 2KENA 4OWTB 3KOJA 2IHEA 1J5EL 1JMCA 1JT8A 4KHPL 2JA7H 4R4QA 3KF6A 3ZJYC 5C44H 1XPUA 1IL2A 4P73A 3HKSA 3CPFA 1Y1WH 4HJ7A 3A74A 4L5RC 2VW9A 2R6GA 2VQEQ 5C4JH 4JBJA 4HJAA 2LXJA 3STBC 2ZJPA 4DR6L 3U4ZA 2PMZE 3UE1A 2IHFA 4YHHL 3S1QH 2PQAA 4A93H 4BXXH 2Y0SE 1X55A 2JA6G 1YVCA 1K0RA 2K5NA 1SN8A 4C3HH 2HT1A 3MXNB 2VQFQ 4A3EG 1N34L 2YV5A 3GD7A 2Q2IA 2K14A 3RR5A 3PO2G 4B3RL 1FGUA 1HR0W 1FL0A 1V1QA 4H02A 1E22A 3M3YH 1Y1VG 3F1ZA 1JE5A 1Q81C 1WFQA 4LUVA 1VQ5A 2ALYB 3KYHC 2UUBL 2A1AA 4MZ9A 4JOIA 1K83H 1VQKA 2ZTCA 4LF7L 3JAMc 1YHQA 1CSPA 1GM5A 5LMUQ 2NVXH 2N3SA 1CKNA 3FP9A 4QQBX 4RG1A 2I5HA 4XTCS 1TXYA 3TREA 2NZOA 1VQLA 4B3TQ 3J7A5 2WB1E 3NEMA 1K3RA 1C7YA 2IX1A 5LMNQ 1VQBA 3CMAA 3M7NA 1OXTA 2ASBA 5IE8A 5J3BA 4O0AA 4C3JH 5GAHC 4GOPC 1IBML 1PH2A 3J81c 4YY3L 3G4SA 4UPAA 1HNWL 4HIMA 4MTNA 4A3MH 4PMWA 5M5WH 3RLNA 4DV4L 2C35B 4A3FG 3H3VI 3HOUG 2R93G 2K75A 4A3GH 1PYSB 2R7ZG 4MNOA 1WCMG 3STBD 4DR3L 5HY6A 1A8VA 1PH6A 2KHIA 1UE6A 1RL2A 3K80C 1HR0L 2N49A 2HHHL 1LTLA 2R7DA 3CCVA 1PYBA 4DV2L 3A0JA 3M9BA 4OX9L 3NBHB 3ULJA 3PUWA 4GN4B 1PH5A 3K7UC 3I4OA 5ELNA 2D0PA 1XTDA 4BY7G 1IYJB 1EIFA 1L2FA 3S15H 3JC66 4DNIA 1XMOL 1PH7A 4LFCQ 1E24A 2WP8J 2R93H 1OTCA 4PG3A 3KF8B 2K4KA 1CUKA 3PUYA 3OTOL 1EQQA 4NXNQ 1KRTA 4LWCA 4BBSH 4X66L 4OWWB 4OXPA 2MQHA 2F4VL 5IYDH 4LF6L 3E0EA 1OXXK 1XPRA 4JI0Q 5C0XJ 2ZM6Q 3H3VH 3S1MH 4GS3A 3HOXH 4AIMA 1W2BA 1PH9A 2NN6I 1A63A 1VQCA 1TWCH 1EIYB 4P74A 5BR8Q 4DR2L 1X3GA 2Q2UA 5FLMH 4LUZA 4LFAL 3GTPH 5IWAQ 2K5HA 1IBLL 1N32Q 4JI1Q 1Q7YC 1YHBA 2Q2TA 3I4NG 4JI6Q 4LF5Q 5IP9G 2NN6G 1QZGA 4LF8Q 2ZTEA 4JYAQ 1PH4A 3DM3A 5K36G 4DV5Q 4P72A 2F52A 2PQAB 4DUYQ 5LMNW 5IYCG 3K81C 4JI2Q 1PH8A 4BBRG 1SR3A 2K50A 2VQEL 1J6QA 2B63H 4DR4Q 3CCQA 3EBEA 4OO1I 1EWIA 5AJ3Q 1M1KC 4KHPQ 4LF9Q 3CC4A 3KLWA 4NXML 3ULLA 1Y14B 3CCSA 2UXDQ 4A3DH 1QUQB 2UUCL 3F2CA 1G6PA 4GNXC 1K8GA 1I94L 1ASZA 2RF4A 2GVAA 4AYBE 4JI4Q 1E1OA 3CMEA 2MNAA 2GVBA 1U5KA 4JI7Q 2A8VA 1QZHA 2B63G 2CWPA 3W1GA 1U0LA 1V43A 1CKNB 1PHJA 1KRSA 1VQIA 3GTMH 4OONA 4LNQA 1P16A 3S24A 3W1BA 4P75A 5M3MG 1VQ9A 5C4XG 2AHOB 1AH9A 1N36Q 2IX0A 1YI2A 3GTOH 3IRBA 1R9TH 4A3LG 4JV5L 1X54A 2AWOA 1VQFA 3SGIA 1SMXA 4DR1Q 1E1TA 3PO3H 4IO9A 1PH3A 1FJGL 1WI5A 1SLJA 4A3IG 4IFDJ 3BU2A 4JCVE 4X64Q 4B3SL 1SFOH 2UXBQ 3FKIG 1X3EA 4C3IH 3J80c 4JI8L 4DV0L 3UDXA 3HOZH 1YZ6A 2JA8G 1XMQQ 4LF4L 1C9OA 1AE2A 4HJ9A 4GLVB 5JEAJ 3CF5A 2IT1A 1UE1A 1HNZL 1XNRQ 3K8AA 3HOVH 4X62L 5ELOA 3CW2C 2IY5B 2NZHA 4JBMA 1Z47A 4DV1L 2FXQA 1VQ7A 3I4MG 3M4OH 4IJLA 1N8RC 2D62A 4DV3L 2MO1A 1NMFA 2L15A 3OYYA 1XNQL 4L5TA 4Y7NH 5GAGC 1VQNA 1VQ6A 2WFWA 3KDFB 1CKMA 3GTQH 1YIJA 2R7FA 4A76A 2UUAL 4A3BG 4X6AH 4R1JA 5EAYA 1Q82C 1N33Q 1GO3E 1YBYA 4DK6C 1QUQA 4NPSA 3DLLA 1L0WA 3T1YQ 3I4MH 3GTLH 4R4OA 2ZM6L 2JA6H 1Q8KA 1Z9FA 3CQZH 4GKJL 2LSSA 5E7NA 3HOWH 1UE5A 4A3EH 2ZTDA 3Q8DA 3H15A 3K7AH 4B3MQ 2VL6A 2CWAA 3PO2H 2UXCQ 1H95A 1VQJA 1JJ2A 1VQAA 2CKZB 4LF5L 4A3KG 1Y1VH 1G51A 1K9MC 2VNUD 3RZOH 3KFUA 2Z6KC 1X6OA 4YCUA 3S16H 1KC8C 4UP7A 3CCUA 4DUYL 2KCMA 4L5QA 1UWVA 1E3PA 1L1OC 4X65Q 3TRZA 1TWAH 4C2MH 4DR5L 1KL9A 2I5MX 4DAYB 5JJIA 1NBWA 4ME3A 3CP0A 1HNXQ 1V9PA 1O7IA 3UDFA 2A19A 2RCNA 3F2BA 4DV7Q 4HIKA 3I55A 4A3JG 2JE6I 2UU9L 3H0GG 1OXVA 3S2DH 2BA0A 4DR7L 2Y0SG 3CC7A 1IZ6A 1J5EQ 4GKKL 2KHJA 1LM0A 5H1SE 4LFBL 3ER0A 4YWKA 4A3FH 3HOUH 1CKOA 1TWFH 1FVIA 2R7ZH 1WCMH 1EQRA 4GN3B 1PA6A 4GN5A 4JBKA 2OTLA 1LUZA 1Q46A 3BZKA 5M5YH 4YCWA 1I50H 3KJPA 3KDFA 5HGQA 3AFPA 4A3JH 1WOCA 1IBKQ 2E5LL 3I56A 3L7ZC 1UEBA 3L2PA 4R4CA 2BA1A 3GTGH 4BY7H 3CAMA 5C3EG 4YHHQ 4A75A 2OQKA 1VQ8A 3T1HL 4DUZQ 1S40A 3K0XA 3G6EA 1NTGA 1Q12A 1QVCA 2OCEA 4IPCA 3CCMA 4POFA 2WB1G 5FJ8G 1N34Q 4JG2A 1HZ9A 4QJFA 4BY1G 1BVSA 1BBUA 1A0IA 2R92G 3PF4A 1RIPA 1XNRL 3PUVA 1GVPA 2UUBQ 3CCJA 3HOYG 3GTJH 1B70B 1I6HH 4PZ7A 4LF7Q 2H5XA 3I4NH 2CFMA 1Q86C 5IP9H 1XPOA 3CCEA 4DV6Q 1D8LA 1GKHA 2ATWA 3F2DA 3ULPA 1OXUA 1VQ4A 1I5FA 3U58A 3TEHB 2VQFL 2AKWB 5IYCH 3HOYH 1W3SA 4YWLA 4BBRH 2OTJA 5M3FG 4ALPA 3GTKH 1N33L 4R4TA 4WJ4A 4YY3Q 2YU9H 4DPGA 3HOWG 3S14H 2BH8A 1HNWQ 3D0FA 4AQYQ 2YYZA 4DV4Q 4QIWE 3TQYA 2GN5A 4HIOA 3RNUA 1T9HA 2JJQA 3S1RH 2JEBI 4DR3Q 1A62A 1X9NA 5LMUL 1ASYA 4JI5Q 2ES2A 1KD1C 1JJGA 1NE3A 4POGA 1HR0Q 1HZCA 1HZBA 4GOPB 2YTXA 2HHHQ 4B3TL 2XTIA 1HZAA 4EX5A 5LMNL 3UDIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GRO A;  2LXK A;  4R4I A;  1TWH H;  5C0X G;  5M3M H;  1XMO Q;  1NY4 A;  3EN2 A;  5C4X H;  2DUD A;  4P71 A;  3OTO Q;  4HID A;  1YIT A;  3CD6 A;  4WJ3 M;  3B6Y A;  4X66 Q;  4A3L H;  4UY8 C;  4LF6 Q;  1E7Z A;  3A5Z B;  4JI3 Q;  2YTV A;  5IT9 c;  3AFQ A;  3HFZ B;  4OWX B;  2MO0 A;  4A3I H;  1IXR A;  3PSI A;  4A4I A;  1Y1W G;  4DR2 Q;  1KAW A;  1EYG A;  3FKI H;  1PH1 A;  1LYL A;  2V1C C;  1EFW A;  5JJK A;  4LFA Q;  2JA8 H;  4NB3 A;  1IBL Q;  2NVT H;  1G29 1;  1S3O A;  3RLF A;  1KQS A;  2VUM G;  1VQH A;  3ERS X;  1DGS A;  2WAQ G;  2JQO A;  3F8T A;  4APV A;  4BXX G;  4LFC L;  4A93 G;  1D7Q A;  3CPW A;  1N9W A;  1EOV A;  2KCT A;  4KLK A;  4NXN L;  3VDY A;  3HKZ G;  5DLQ E;  4AYB G;  3OW2 A;  1YJW A;  3CCR A;  5IYB G;  1XJV A;  1Q1B A;  1CSQ A;  3GDE A;  1C0A A;  4JI0 L;  2B3G A;  1IBK L;  3JAM i;  2I5L X;  3FHW A;  2MFI A;  2ID0 A;  3TS0 A;  4KI0 A;  3PGZ A;  5BR8 L;  2VUM H;  3BJU A;  4IPD A;  4NXM Q;  4LW1 A;  4A3B H;  2E8G A;  4DUZ L;  5IWA L;  3J7Z C;  1K8A C;  1WJJ A;  2UUC Q;  4JI1 L;  1N32 L;  2EXD A;  3G71 A;  4JI6 L;  3M4P A;  4GLA C;  4LF8 L;  3L0O A;  1K73 C;  5IYB H;  1I94 Q;  3AEV A;  2HIV A;  4IPH A;  3S17 H;  4IFD I;  3J81 i;  4JYA L;  2JA9 A;  2EIF A;  2ZJR A;  2E2J H;  4DV5 L;  1MIU A;  2Z6K A;  4JOI C;  4GOP A;  4PZ8 A;  2OWO A;  1BBW A;  1EUJ A;  4YWM A;  4JI2 L;  1AE3 A;  2JEA I;  3CXC A;  4DR4 L;  4IFD G;  3TS2 A;  1SE8 A;  1S72 A;  4YCV A;  4DK3 C;  1TWG H;  5AJ3 L;  3ICE A;  2OQ0 A;  4K0K Q;  1L1O A;  4O2D A;  3U4V A;  4GNX B;  3J81 j;  4A3K H;  4DV6 L;  1BKB A;  4A3M G;  4LF9 L;  4A3C G;  4JV5 Q;  2UXD L;  1NJI C;  4A3G G;  1FJG Q;  3NEN A;  5JEA G;  1VCI A;  3RLO A;  4B3S Q;  1WYD A;  4BA1 I;  2YTY A;  2K5V A;  4JI8 Q;  4DV0 Q;  4JI4 L;  1MJC A;  4JI7 L;  1B8A A;  4LF4 Q;  3RN5 A;  1KXL A;  4Y52 H;  1HNZ Q;  4A3C H;  4AQY L;  3S2H H;  4X62 Q;  4JC0 A;  5GQO A;  1HH2 P;  1MKH A;  1N36 L;  2RHS B;  3AYH B;  4DV1 Q;  2K52 A;  3H0G H;  2JA5 G;  4BBS G;  4DR6 Q;  5IYD G;  4JI5 L;  2CQO A;  3UDG A;  1JJC B;  4DR1 L;  3CCL A;  2NVY H;  1SRU A;  3M4Q A;  3HOX G;  4DV3 Q;  3PCO B;  1XNQ Q;  2F3I A;  3I2Z A;  4X64 L;  3RN2 A;  4J15 A;  1VQM A;  2UXB L;  4FDB A;  1P8L A;  5FLM G;  1SRO A;  3E9H A;  4HJ5 A;  2UUA Q;  4QL5 A;  4QGU A;  1XMQ L;  4L5S A;  1QVF A;  4B3R Q;  2HQL A;  3MEF A;  2JA5 H;  2N8N A;  2PNH A;  1HJP A;  2B29 A;  4AH6 A;  4IOC A;  4JI3 L;  4JBW A;  5C3E H;  1KIX A;  2BH2 A;  2AWN A;  4KHZ A;  2I0Q A;  1YEZ A;  2VS1 A;  1VQE A;  4IOA A;  4XIG S;  3PIO A;  4OX9 Q;  3PF5 A;  4GKJ Q;  1OXS C;  3W5O A;  1VQO A;  4DAM A;  3PIP A;  3KF6 B;  2XGT A;  4EQ5 A;  5FJ8 H;  2ZJQ A;  1YHA A;  2E2I H;  2D0O A;  4BY1 H;  1VQP A;  2R92 H;  1VQG A;  4TVA B;  3GO5 A;  4DV2 Q;  4BA2 I;  3D31 A;  5IY0 A;  1YJN A;  1X65 A;  4GNX A;  2CCZ A;  4A3D G;  1IBM Q;  3E9I A;  1YNX A;  1NMG A;  2VY3 A;  3T1Y L;  1PV4 A;  1VS0 A;  1GD7 A;  3I7F A;  4GLX A;  3BZC A;  1PFS A;  1JB7 A;  2N78 A;  2PI2 A;  2VZA A;  2Z0S A;  5GAE C;  4DR5 Q;  5C0X I;  1M90 C;  4RMF A;  4UP8 A;  4B3M L;  2UXC L;  5M3F H;  3PUX A;  2WAQ E;  5M5X H;  2UU9 Q;  4QY7 A;  4DR7 Q;  3LGJ A;  1PVO A;  3J80 i;  4OO1 G;  3EIV A;  2DGY A;  2EQS A;  3KJO A;  3PO3 G;  1Q1E A;  4GKK Q;  3HKZ E;  3A5U A;  1KHI A;  4IJH A;  3WWV A;  2KBN A;  3PUZ A;  4LFB Q;  5JJL A;  2PI2 E;  1L1O B;  4HJ8 A;  5IP7 G;  1VQD A;  3PV0 A;  2JK8 A;  1X3F A;  2HIX A;  4DKA C;  1QVG A;  5GAD C;  2AMC B;  2QGQ A;  3UE0 A;  2F4V Q;  3HOZ G;  2JA7 G;  2NVQ H;  1B7Y B;  2QA4 A;  5C44 G;  1YJ9 A;  3G48 A;  4IPG A;  4X65 L;  3S1N H;  2E5L Q;  5FLX c;  2RHQ B;  4K0K L;  3AQQ A;  3HOV G;  1I3Q H;  2Q2H A;  3CC2 A;  2E2H H;  4UP9 A;  2QEX A;  3U50 C;  3M85 A;  1UE7 A;  3T1H Q;  3RZD H;  1HNX L;  4DV7 L;  3NEL A;  4PZ6 A;  5IP7 H;  4LUO A;  1X56 A;  4TQU S;  1MJE A;  2KEN A;  4OWT B;  3KOJ A;  2IHE A;  1J5E L;  1JMC A;  1JT8 A;  4KHP L;  2JA7 H;  4R4Q A;  3KF6 A;  3ZJY C;  5C44 H;  1XPU A;  1IL2 A;  4P73 A;  3HKS A;  3CPF A;  1Y1W H;  4HJ7 A;  3A74 A;  4L5R C;  2VW9 A;  2R6G A;  2VQE Q;  5C4J H;  4JBJ A;  4HJA A;  2LXJ A;  3STB C;  2ZJP A;  4DR6 L;  3U4Z A;  2PMZ E;  3UE1 A;  2IHF A;  4YHH L;  3S1Q H;  2PQA A;  4A93 H;  4BXX H;  2Y0S E;  1X55 A;  2JA6 G;  1YVC A;  1K0R A;  2K5N A;  1SN8 A;  4C3H H;  2HT1 A;  3MXN B;  2VQF Q;  4A3E G;  1N34 L;  2YV5 A;  3GD7 A;  2Q2I A;  2K14 A;  3RR5 A;  3PO2 G;  4B3R L;  1FGU A;  1HR0 W;  1FL0 A;  1V1Q A;  4H02 A;  1E22 A;  3M3Y H;  1Y1V G;  3F1Z A;  1JE5 A;  1Q81 C;  1WFQ A;  4LUV A;  1VQ5 A;  2ALY B;  3KYH C;  2UUB L;  2A1A A;  4MZ9 A;  4JOI A;  1K83 H;  1VQK A;  2ZTC A;  4LF7 L;  3JAM c;  1YHQ A;  1CSP A;  1GM5 A;  5LMU Q;  2NVX H;  2N3S A;  1CKN A;  3FP9 A;  4QQB X;  4RG1 A;  2I5H A;  4XTC S;  1TXY A;  3TRE A;  2NZO A;  1VQL A;  4B3T Q;  3J7A 5;  2WB1 E;  3NEM A;  1K3R A;  1C7Y A;  2IX1 A;  5LMN Q;  1VQB A;  3CMA A;  3M7N A;  1OXT A;  2ASB A;  5IE8 A;  5J3B A;  4O0A A;  4C3J H;  5GAH C;  4GOP C;  1IBM L;  1PH2 A;  3J81 c;  4YY3 L;  3G4S A;  4UPA A;  1HNW L;  4HIM A;  4MTN A;  4A3M H;  4PMW A;  5M5W H;  3RLN A;  4DV4 L;  2C35 B;  4A3F G;  3H3V I;  3HOU G;  2R93 G;  2K75 A;  4A3G H;  1PYS B;  2R7Z G;  4MNO A;  1WCM G;  3STB D;  4DR3 L;  5HY6 A;  1A8V A;  1PH6 A;  2KHI A;  1UE6 A;  1RL2 A;  3K80 C;  1HR0 L;  2N49 A;  2HHH L;  1LTL A;  2R7D A;  3CCV A;  1PYB A;  4DV2 L;  3A0J A;  3M9B A;  4OX9 L;  3NBH B;  3ULJ A;  3PUW A;  4GN4 B;  1PH5 A;  3K7U C;  3I4O A;  5ELN A;  2D0P A;  1XTD A;  4BY7 G;  1IYJ B;  1EIF A;  1L2F A;  3S15 H;  3JC6 6;  4DNI A;  1XMO L;  1PH7 A;  4LFC Q;  1E24 A;  2WP8 J;  2R93 H;  1OTC A;  4PG3 A;  3KF8 B;  2K4K A;  1CUK A;  3PUY A;  3OTO L;  1EQQ A;  4NXN Q;  1KRT A;  4LWC A;  4BBS H;  4X66 L;  4OWW B;  4OXP A;  2MQH A;  2F4V L;  5IYD H;  4LF6 L;  3E0E A;  1OXX K;  1XPR A;  4JI0 Q;  5C0X J;  2ZM6 Q;  3H3V H;  3S1M H;  4GS3 A;  3HOX H;  4AIM A;  1W2B A;  1PH9 A;  2NN6 I;  1A63 A;  1VQC A;  1TWC H;  1EIY B;  4P74 A;  5BR8 Q;  4DR2 L;  1X3G A;  2Q2U A;  5FLM H;  4LUZ A;  4LFA L;  3GTP H;  5IWA Q;  2K5H A;  1IBL L;  1N32 Q;  4JI1 Q;  1Q7Y C;  1YHB A;  2Q2T A;  3I4N G;  4JI6 Q;  4LF5 Q;  5IP9 G;  2NN6 G;  1QZG A;  4LF8 Q;  2ZTE A;  4JYA Q;  1PH4 A;  3DM3 A;  5K36 G;  4DV5 Q;  4P72 A;  2F52 A;  2PQA B;  4DUY Q;  5LMN W;  5IYC G;  3K81 C;  4JI2 Q;  1PH8 A;  4BBR G;  1SR3 A;  2K50 A;  2VQE L;  1J6Q A;  2B63 H;  4DR4 Q;  3CCQ A;  3EBE A;  4OO1 I;  1EWI A;  5AJ3 Q;  1M1K C;  4KHP Q;  4LF9 Q;  3CC4 A;  3KLW A;  4NXM L;  3ULL A;  1Y14 B;  3CCS A;  2UXD Q;  4A3D H;  1QUQ B;  2UUC L;  3F2C A;  1G6P A;  4GNX C;  1K8G A;  1I94 L;  1ASZ A;  2RF4 A;  2GVA A;  4AYB E;  4JI4 Q;  1E1O A;  3CME A;  2MNA A;  2GVB A;  1U5K A;  4JI7 Q;  2A8V A;  1QZH A;  2B63 G;  2CWP A;  3W1G A;  1U0L A;  1V43 A;  1CKN B;  1PHJ A;  1KRS A;  1VQI A;  3GTM H;  4OON A;  4LNQ A;  1P16 A;  3S24 A;  3W1B A;  4P75 A;  5M3M G;  1VQ9 A;  5C4X G;  2AHO B;  1AH9 A;  1N36 Q;  2IX0 A;  1YI2 A;  3GTO H;  3IRB A;  1R9T H;  4A3L G;  4JV5 L;  1X54 A;  2AWO A;  1VQF A;  3SGI A;  1SMX A;  4DR1 Q;  1E1T A;  3PO3 H;  4IO9 A;  1PH3 A;  1FJG L;  1WI5 A;  1SLJ A;  4A3I G;  4IFD J;  3BU2 A;  4JCV E;  4X64 Q;  4B3S L;  1SFO H;  2UXB Q;  3FKI G;  1X3E A;  4C3I H;  3J80 c;  4JI8 L;  4DV0 L;  3UDX A;  3HOZ H;  1YZ6 A;  2JA8 G;  1XMQ Q;  4LF4 L;  1C9O A;  1AE2 A;  4HJ9 A;  4GLV B;  5JEA J;  3CF5 A;  2IT1 A;  1UE1 A;  1HNZ L;  1XNR Q;  3K8A A;  3HOV H;  4X62 L;  5ELO A;  3CW2 C;  2IY5 B;  2NZH A;  4JBM A;  1Z47 A;  4DV1 L;  2FXQ A;  1VQ7 A;  3I4M G;  3M4O H;  4IJL A;  1N8R C;  2D62 A;  4DV3 L;  2MO1 A;  1NMF A;  2L15 A;  3OYY A;  1XNQ L;  4L5T A;  4Y7N H;  5GAG C;  1VQN A;  1VQ6 A;  2WFW A;  3KDF B;  1CKM A;  3GTQ H;  1YIJ A;  2R7F A;  4A76 A;  2UUA L;  4A3B G;  4X6A H;  4R1J A;  5EAY A;  1Q82 C;  1N33 Q;  1GO3 E;  1YBY A;  4DK6 C;  1QUQ A;  4NPS A;  3DLL A;  1L0W A;  3T1Y Q;  3I4M H;  3GTL H;  4R4O A;  2ZM6 L;  2JA6 H;  1Q8K A;  1Z9F A;  3CQZ H;  4GKJ L;  2LSS A;  5E7N A;  3HOW H;  1UE5 A;  4A3E H;  2ZTD A;  3Q8D A;  3H15 A;  3K7A H;  4B3M Q;  2VL6 A;  2CWA A;  3PO2 H;  2UXC Q;  1H95 A;  1VQJ A;  1JJ2 A;  1VQA A;  2CKZ B;  4LF5 L;  4A3K G;  1Y1V H;  1G51 A;  1K9M C;  2VNU D;  3RZO H;  3KFU A;  2Z6K C;  1X6O A;  4YCU A;  3S16 H;  1KC8 C;  4UP7 A;  3CCU A;  4DUY L;  2KCM A;  4L5Q A;  1UWV A;  1E3P A;  1L1O C;  4X65 Q;  3TRZ A;  1TWA H;  4C2M H;  4DR5 L;  1KL9 A;  2I5M X;  4DAY B;  5JJI A;  1NBW A;  4ME3 A;  3CP0 A;  1HNX Q;  1V9P A;  1O7I A;  3UDF A;  2A19 A;  2RCN A;  3F2B A;  4DV7 Q;  4HIK A;  3I55 A;  4A3J G;  2JE6 I;  2UU9 L;  3H0G G;  1OXV A;  3S2D H;  2BA0 A;  4DR7 L;  2Y0S G;  3CC7 A;  1IZ6 A;  1J5E Q;  4GKK L;  2KHJ A;  1LM0 A;  5H1S E;  4LFB L;  3ER0 A;  4YWK A;  4A3F H;  3HOU H;  1CKO A;  1TWF H;  1FVI A;  2R7Z H;  1WCM H;  1EQR A;  4GN3 B;  1PA6 A;  4GN5 A;  4JBK A;  2OTL A;  1LUZ A;  1Q46 A;  3BZK A;  5M5Y H;  4YCW A;  1I50 H;  3KJP A;  3KDF A;  5HGQ A;  3AFP A;  4A3J H;  1WOC A;  1IBK Q;  2E5L L;  3I56 A;  3L7Z C;  1UEB A;  3L2P A;  4R4C A;  2BA1 A;  3GTG H;  4BY7 H;  3CAM A;  5C3E G;  4YHH Q;  4A75 A;  2OQK A;  1VQ8 A;  3T1H L;  4DUZ Q;  1S40 A;  3K0X A;  3G6E A;  1NTG A;  1Q12 A;  1QVC A;  2OCE A;  4IPC A;  3CCM A;  4POF A;  2WB1 G;  5FJ8 G;  1N34 Q;  4JG2 A;  1HZ9 A;  4QJF A;  4BY1 G;  1BVS A;  1BBU A;  1A0I A;  2R92 G;  3PF4 A;  1RIP A;  1XNR L;  3PUV A;  1GVP A;  2UUB Q;  3CCJ A;  3HOY G;  3GTJ H;  1B70 B;  1I6H H;  4PZ7 A;  4LF7 Q;  2H5X A;  3I4N H;  2CFM A;  1Q86 C;  5IP9 H;  1XPO A;  3CCE A;  4DV6 Q;  1D8L A;  1GKH A;  2ATW A;  3F2D A;  3ULP A;  1OXU A;  1VQ4 A;  1I5F A;  3U58 A;  3TEH B;  2VQF L;  2AKW B;  5IYC H;  3HOY H;  1W3S A;  4YWL A;  4BBR H;  2OTJ A;  5M3F G;  4ALP A;  3GTK H;  1N33 L;  4R4T A;  4WJ4 A;  4YY3 Q;  2YU9 H;  4DPG A;  3HOW G;  3S14 H;  2BH8 A;  1HNW Q;  3D0F A;  4AQY Q;  2YYZ A;  4DV4 Q;  4QIW E;  3TQY A;  2GN5 A;  4HIO A;  3RNU A;  1T9H A;  2JJQ A;  3S1R H;  2JEB I;  4DR3 Q;  1A62 A;  1X9N A;  5LMU L;  1ASY A;  4JI5 Q;  2ES2 A;  1KD1 C;  1JJG A;  1NE3 A;  4POG A;  1HR0 Q;  1HZC A;  1HZB A;  4GOP B;  2YTX A;  2HHH Q;  4B3T L;  2XTI A;  1HZA A;  4EX5 A;  5LMN L;  3UDI A; 
#chains in the Genus database with same CATH topology
 3NTH A;  2EY6 A;  1Q8I A;  1Y8O B;  2LXK A;  1O7Y A;  4R4I A;  1GHK A;  1QOH A;  2K05 A;  2DUD A;  4HID A;  4WJ3 M;  1ENA A;  4LF6 Q;  1E7Z A;  3A5Z B;  1MSG A;  2BDO A;  2YTV A;  4LK1 C;  5IT9 c;  4OWX B;  3RD4 A;  4YIJ A;  3HZX A;  3J80 E;  4FF1 A;  1Y1W G;  1EFW A;  1SNC A;  4LFA Q;  4NB3 A;  1IBL Q;  3HOW B;  1PTO B;  1G29 1;  2WKD A;  2XWJ B;  1S3O A;  3OWE B;  2JP1 A;  5FO7 B;  2WAQ G;  1JCK B;  3F8T A;  4BXX G;  5C4X B;  3T53 B;  3KLR A;  3HS0 C;  1FD7 D;  4DK0 A;  4JI0 L;  1IBK L;  4O1N A;  4RGM A;  5BR8 L;  2VUM H;  4EQN A;  4NXM Q;  2PNR C;  1NNX A;  1B50 A;  4JI1 L;  1OO9 B;  3BVM A;  3M4P A;  1K8M A;  2LMC B;  5IYB H;  5NUC A;  1I94 Q;  4IPH A;  3C3L A;  3EVQ A;  3J81 i;  1JR0 D;  1F9Q A;  2QDB A;  3I70 A;  3CXC A;  4DR4 L;  1SE8 A;  3CU7 A;  4LF9 L;  1BKB A;  1NJI C;  5JEA G;  4C3H B;  3HKZ B;  3T13 A;  4AYB B;  4B3S Q;  3OSO A;  2LS0 1;  3S17 B;  1GUW A;  2YTY A;  1O78 A;  2K5V A;  3DEO A;  4WOR A;  2B2V A;  1B8A A;  5I2X A;  4OHJ A;  3SR1 A;  1HNZ Q;  3ERQ A;  4X62 Q;  1HH2 P;  1MKH A;  1K83 B;  3DUZ A;  2KOL A;  1LTS D;  3F2U A;  1AZQ A;  3QJY A;  2HDM A;  2MP1 A;  5C6A A;  4G7H C;  1AZP A;  2NVY H;  1SRU A;  3PCO B;  5L37 A;  2Z4I A;  2ZXP A;  4RA8 A;  1VQM A;  4ILW A;  1IKL A;  5JAV A;  4HJ5 A;  2B2W A;  1BF4 A;  1HJP A;  4KD3 A;  3S2H B;  4JBW A;  3OIQ A;  2AWN A;  2I0Q A;  2PMZ B;  2VB3 X;  3PIO A;  4GKJ Q;  1DXM A;  1SE4 A;  2ZJQ A;  4CGY B;  1DD2 A;  2D0O A;  2F0D A;  1LLR D;  4TVA B;  1W6K A;  5IY0 A;  1YJN A;  5JPM C;  3MC0 B;  4GNX A;  4CDF C;  2CCZ A;  4A3D G;  4BS9 A;  1AEX A;  1NMG A;  2K04 A;  5LHY 1;  3T1Y L;  1VS0 A;  1GD7 A;  3I7F A;  5C3E B;  5COR A;  4GLX A;  1JB7 A;  1PFS A;  2ZXR A;  2VZA A;  4ZUI A;  3VYT A;  3SVM A;  2HUG A;  2TMP A;  4B3M L;  3PUX A;  2Q8T A;  5M5X H;  4QY7 A;  2R92 B;  4DR7 Q;  3LGJ A;  3J80 i;  1EY5 A;  4TKO B;  3HKZ E;  3WWV A;  4LFB Q;  5JJL A;  3PUZ A;  1L0X B;  4HJ8 A;  3SDZ A;  2F0J A;  3BDL A;  2NBF A;  4HTH A;  4C3I G;  3HOZ G;  4RFB A;  4X65 L;  1SYF A;  5E3F A;  5FO8 B;  1MBY A;  1I3Q H;  3NTI A;  3HOV G;  2K5W A;  4UP9 A;  3OWF A;  3U50 C;  1HNX L;  1S5B D;  2LFN A;  2F0N A;  1RD9 D;  4PZ6 A;  5IP7 H;  4I65 A;  1X56 A;  4TQU S;  1MJE A;  1MSH A;  2BDN A;  3KOJ A;  4G7Z C;  4DNR B;  2X6L A;  2NTT A;  1EZ6 A;  3KBG A;  1WTH A;  1Y1W H;  3A74 A;  4L5R C;  2PW7 A;  2VW9 A;  2CVR A;  5C4J H;  2LXJ A;  3U4Z A;  2PMZ E;  3VR5 A;  2I46 A;  1R4Q B;  5CV8 A;  1GJX A;  3S1Q H;  2EY1 A;  4BXX H;  2EZV A;  2JA6 G;  1A2T A;  2CW0 C;  2HT1 A;  2JSO A;  1ZYR C;  4KKS A;  1N34 L;  1LT4 D;  3GD7 A;  1SMY D;  1ENF A;  5C44 B;  1EZ8 A;  4KJO A;  1FL0 A;  4B9W A;  1Y1V G;  1JE5 A;  1Q81 C;  4LUV A;  3FDT A;  3H94 A;  2HCC A;  4MZ9 A;  2B2T A;  1KTK A;  1I4H A;  4LF7 L;  1YHQ A;  2L1B A;  2NVX H;  4B08 A;  1CKN A;  3FP9 A;  4QQB X;  2NZO A;  4FF3 A;  5KIX A;  3NEM A;  2IX1 A;  4IUU A;  3J7A F;  3O13 A;  2O4X A;  1FGB D;  3J81 c;  3G4S A;  2TSS A;  4FXD A;  5M5W H;  5JVG 3;  1ONL A;  1PYS B;  5HY6 A;  1A8V A;  5D65 A;  4RKB A;  2MGS A;  3SK5 A;  3A0J A;  3M9B A;  4DXF A;  4GN4 B;  3PUW A;  4KHV A;  1PH5 A;  4C56 C;  1L2F A;  1XMO L;  4LFC Q;  1E24 A;  2WP8 J;  2R93 H;  1QG7 A;  1V1P B;  4PG3 A;  2PZU A;  2K4K A;  3PUY A;  4LWC A;  1STE A;  4FXK C;  4OXP A;  3K59 A;  2ZM6 Q;  1A63 A;  4GS3 A;  1PH9 A;  1A15 A;  1F2Y A;  1BUV T;  5IGE A;  1EIY B;  1A3T A;  2IWH A;  5FKA C;  1X3G A;  2Q2U A;  2SDF A;  2Q2T A;  3SK6 A;  1HPC A;  2A6E C;  3HOU B;  2ZTE A;  3CRL C;  1PH4 A;  4DV5 Q;  4BBS B;  4DUY Q;  3K81 C;  4JI2 Q;  1J6Q A;  1MHW C;  4HR7 B;  1L0Y B;  3HOX B;  5KGU A;  2DJG C;  5AJ3 Q;  2A68 D;  3NQT A;  2NN6 H;  3CC4 A;  1R4P B;  2F0U A;  3KLW A;  2XRS D;  3I4L A;  3ULL A;  2UXD Q;  4A3D H;  1UNS A;  3F2C A;  1G6P A;  2F0H A;  1J9O A;  1ASZ A;  4DAY A;  2L9H A;  4JI4 Q;  3Q0A A;  1E1O A;  1EWH A;  4JK1 C;  1PTO D;  2CWP A;  1U0L A;  5I9O A;  3L9A X;  3R3O A;  1P16 A;  4P75 A;  1EWC A;  1VQ9 A;  5C4X G;  2DY7 A;  2DN8 A;  2PPB C;  1EY8 A;  5KYI A;  5C4Z A;  2PZW A;  3SGI A;  1SMX A;  1E1T A;  5C3W A;  1PH3 A;  4IFD J;  4RAU C;  4JCV E;  1SFO H;  1JIC A;  2J7Z A;  4C3I H;  3J80 c;  2KJX A;  3HOZ H;  3NE5 B;  3UDX A;  3E5S A;  4CBV A;  4LF4 L;  3P1H A;  2A69 D;  4DU9 A;  1EY0 A;  2IT1 A;  3HOV H;  3GTM B;  3BS1 A;  4JBM A;  1E0B A;  3FEW X;  2FXQ A;  5A35 A;  2C9O A;  1G2S A;  4DV3 L;  1XNQ L;  4Y7N H;  5T1I A;  1A2U A;  2AUK A;  4K8I A;  3AU7 A;  5M3M B;  2R7F A;  4A3B G;  3D8G A;  1CHP D;  1GO3 E;  4DK6 C;  1QUQ A;  4NPS A;  1L0W A;  1T5E A;  2ZM6 L;  2HDL A;  2JA6 H;  3DWA A;  2LSS A;  1GOZ A;  1H9J A;  1MGS A;  3I8Z A;  1X3Q A;  4CKB A;  2ZTD A;  2VL6 A;  2B2U C;  4G4K A;  5JVH 3;  1C48 A;  2EE1 A;  4EVO A;  1Y1V H;  3NQI A;  1K9M C;  2VNU D;  4HAE A;  3GTQ B;  2O5J C;  1ESR A;  4KY6 A;  4YCU A;  3S16 H;  3TBI B;  2CH4 W;  4N8X 1;  4DUY L;  2KCM A;  1UWV A;  1LAB A;  2F0W A;  3TRZ A;  1JB3 A;  2M2L A;  1KL9 A;  1J8I A;  3D3R A;  1HHV A;  4QUF A;  1PZJ D;  3CP0 A;  3EFX D;  3URY A;  4A3J G;  2A19 A;  2Z1C A;  4IUQ A;  3PO2 B;  2A74 C;  3I55 A;  2UU9 L;  4GKK L;  2D2C C;  4YWK A;  1TWF H;  1FVI A;  1XTC D;  3RUZ A;  4HED A;  4GN5 A;  1LUZ A;  5HGQ A;  4DGZ A;  1HFN A;  3I56 A;  2XVS A;  1BCP D;  2NWG A;  3CAM A;  1KNA A;  5C3E G;  5K5P A;  3T1H L;  3G6E A;  1QVC A;  2SNS A;  4KKU A;  2B2W C;  3CCM A;  1TS3 A;  3WDN A;  1BVS A;  2R92 G;  3PF4 A;  1RIP A;  3FVQ A;  2M00 A;  4K6L A;  2UUB Q;  1E2Z A;  3HOY G;  3GTJ H;  2L4N A;  1XYI A;  1I6H H;  1EFI D;  1DM0 B;  4FNF A;  3GTG B;  4BY7 B;  3V05 A;  3FPU B;  2K7V A;  3U58 A;  3TEH B;  3HGB A;  1B53 A;  2KHS A;  3GTK H;  1B1Z A;  4WJ4 A;  4FVM A;  4YY3 Q;  3S14 H;  2QF7 A;  4IZ8 A;  3D0F A;  4AQY Q;  4RWS C;  4IQZ A;  3TQY A;  1D1K A;  1T9H A;  2F03 A;  3R93 A;  4DR3 Q;  1HRJ A;  1A62 A;  1TVX A;  3I4N B;  4JI5 Q;  2ES2 A;  5C5L A;  3QOJ A;  1NE3 A;  1JJG A;  1HZC A;  1HA6 A;  4DV2 Q;  1HZA A;  3HOW H;  1PTO F;  5GRO A;  1HUM A;  1TWH H;  5C0X G;  1EOT A;  5KRU A;  3EN2 A;  4MIU A;  5C4X H;  1QWY A;  2R61 A;  3BYT B;  1C4Q A;  2EYF A;  3B6Y A;  3DWP A;  5D3I B;  4UY8 C;  3AFQ A;  3HFZ B;  5HGT A;  4UHV A;  3GV6 A;  2MO0 A;  3DM1 A;  1IXR A;  5IOC A;  5E1F A;  1KAW A;  3DWQ A;  4XXE A;  2DJF C;  1LYL A;  2V1C C;  4DR2 Q;  1PH1 A;  2K33 A;  4XDX A;  1KQS A;  3A8K E;  2VUM G;  1FNW A;  1VQH A;  1MI2 A;  4MN3 A;  1D7Q A;  4NXN L;  3OW2 A;  4ABN A;  5IYB G;  3MEH A;  1XJV A;  1Q1B A;  3GDE A;  2EDG A;  2B3G A;  3J7A V;  1CFM A;  1SNQ A;  3PGZ A;  4IPD A;  1I6V C;  2KQ3 A;  4LW1 A;  2E8G A;  3IKJ A;  1EEI D;  3J7Z C;  4A3B H;  1WJJ A;  1N32 L;  1RTN A;  3TSS A;  3MFG A;  2NVT B;  4JI6 L;  4LF8 L;  1F9P A;  5C3X A;  3S17 H;  4S3S A;  5DNF A;  1DYQ A;  2ZJR A;  1ILQ A;  5LL6 X;  1MIU A;  4PZ8 A;  2B2T C;  4C3J G;  1IYV A;  1AE3 A;  1S72 A;  2G9H D;  4CKC A;  4DK3 C;  1V1O A;  3ICE A;  2OQ0 A;  4K0K Q;  4O2D A;  4KHP L;  1NUC A;  3TP6 A;  3RLO A;  4BA1 I;  1JOK A;  4JI8 Q;  4IFD H;  4I7Z C;  1QE6 A;  3RN5 A;  1KXL A;  1PMR A;  1CA6 A;  4AQY L;  3S2H H;  1I4G A;  1RCV D;  2RHS B;  1II3 A;  4DV1 Q;  2K52 A;  4BBS G;  2Z6B A;  4R8I A;  5DEH A;  4A3K B;  4JI5 L;  5BN3 A;  3UDG A;  4DR1 L;  3CCL A;  2J0T D;  1LAC A;  2RKS A;  2RCF A;  3HOX G;  3BYY B;  3I2Z A;  1JE4 A;  4MTK A;  1LTG D;  1YNN C;  3E9H A;  2UUA Q;  4B3R Q;  3MXG A;  3MEF A;  1ILP A;  2KED A;  1BCP F;  3MAQ A;  2B29 A;  5C3E H;  2RBM A;  1YEZ A;  2F0P A;  1VQE A;  4IOA A;  4XIG S;  3PF5 A;  5DM6 3;  4DAM A;  3KF6 B;  4EQ5 A;  1YHA A;  1SNO A;  2R92 H;  1KDA A;  1VQG A;  3GO5 A;  5EPJ A;  1X65 A;  2A73 B;  2EYJ A;  5CR3 A;  1IBM Q;  1ZXT A;  3E9I A;  1SYC A;  5EKL A;  2JA5 B;  2VY3 A;  1CTM A;  3BZC A;  4N9T A;  4X3T A;  3S1M B;  1B44 D;  4DR5 Q;  4FO2 A;  3W3A A;  4CKE A;  1M90 C;  4UP8 A;  2EYH A;  5I6Y A;  1PVO A;  5KNB A;  4OO1 G;  5JOB A;  3EIV A;  2SNM A;  1RHP A;  4NP5 A;  4RHS A;  3A5U A;  1SMY C;  2PI2 E;  5IP7 G;  1VQD A;  3PV0 A;  2JK8 A;  5GAD C;  1F9R A;  2QA4 A;  2K6A A;  1WD1 A;  3A56 A;  1FR3 A;  2E5L Q;  4K0K L;  1V1P A;  2Q2H A;  3CC2 A;  5C0X H;  3M85 A;  1UE7 A;  2WV6 D;  2C5C A;  4DV7 L;  2SEB D;  2KEN A;  2FFK B;  1TS2 A;  3ZJY C;  5C44 H;  1XPU A;  1D2B A;  2NZ1 D;  2EOT A;  3HKS A;  1I4R A;  2NVQ B;  2VQE Q;  3EA6 A;  3S1N B;  4JBJ A;  2IL8 A;  1LTT D;  1K8O A;  1HFG A;  4RCO A;  2OT2 A;  4KK7 A;  1K0R A;  1SN8 A;  2B2U A;  2VQF Q;  4N8F A;  3D4W A;  3ND8 A;  2Q2I A;  2JA7 B;  2K14 A;  3PO2 G;  4B3R L;  4NDX A;  5FLX L;  1CZW A;  1IHZ A;  4OIK A;  5DM7 3;  4H02 A;  4EGV A;  3IAY A;  3F1Z A;  1PRT C;  2A1A A;  4FF4 A;  4K14 A;  2ZTC A;  2I07 B;  1CSP A;  3VR3 A;  2MJ8 A;  2N3S A;  1WTV A;  4A93 B;  1TXY A;  3J7A 5;  2WB1 E;  1C7Y A;  3LWE A;  1A3U A;  1H9S B;  1VQB A;  3M7N A;  3R2T A;  2L11 A;  4C3J H;  2QKI C;  4GOP C;  5GAH C;  1IBM L;  1KDC A;  4Q0F A;  1S4Z A;  3OW7 A;  5J22 A;  3M3Y B;  4UPA A;  4QIW B;  1HA5 A;  3FRP B;  3KBX A;  5CGK A;  4PMW A;  2R93 G;  4MNO A;  1DJR D;  1H9R A;  1PH6 A;  1EYA A;  1UE6 A;  3QB3 A;  2HHH L;  4L6T B;  3C1E A;  4OX9 L;  3ULJ A;  1LTB D;  1PXU A;  3K7U C;  3I4O A;  4QCL A;  2D0P A;  4BY7 G;  1EIF A;  2WII B;  1O7L A;  3CKI B;  4HSP A;  3X3N A;  1PH7 A;  1OTC A;  1PTO C;  1STN A;  3KF8 B;  3KLS A;  4BBS H;  1CUK A;  1EIH A;  1EQQ A;  1KRT A;  1XWE A;  1LT3 D;  4LF6 L;  3E0E A;  3VA7 A;  3TP7 A;  1XPR A;  2F0F A;  3MXN A;  2G9D A;  3HOX H;  1W2B A;  4H0L C;  2NN6 I;  1TWC H;  2AUJ D;  1RTO A;  3PQI A;  4LUZ A;  4LFA L;  5CBA E;  5IWA Q;  2K5H A;  1IBL L;  1SND A;  1YHB A;  5EPL A;  3I4N G;  2NN6 G;  4CJ0 B;  1NR4 A;  1LV9 A;  3S15 B;  4JYA Q;  2A69 C;  3DM3 A;  5K36 G;  1BCP B;  5IYC G;  1PH8 A;  5LL6 S;  1EL0 A;  1EYC A;  2VQE L;  3SE0 A;  3CCQ A;  1M1K C;  1K28 A;  4QMG A;  1TQO A;  2H4O A;  2M9V A;  2QW7 A;  4NXM L;  1HTL D;  1EU3 A;  1PDQ A;  2NTS A;  4Z9C B;  4EQP A;  1I94 L;  2RF4 A;  1F9S A;  2NUC A;  4AYB E;  3CME A;  2G5D A;  2GVB A;  4JI7 Q;  3X3M A;  5DAU A;  5ELB A;  1KRS A;  3G7L A;  4EQO A;  3NBH A;  3KLS X;  3GTM H;  4OIJ A;  4RCN A;  3MZ5 A;  1DOK A;  1JOR A;  3D4D A;  1N36 Q;  5CMD A;  4OO1 H;  3TZU A;  3E3X A;  2D9U A;  5EGT A;  4X64 Q;  2RDF A;  4B3S L;  2UXB Q;  3MFY A;  5FLX E;  1VMC A;  1XMQ Q;  1AE2 A;  1JC7 A;  4HN7 A;  4HJ9 A;  4GLV B;  3NBI A;  1UE1 A;  1HNZ L;  4X62 L;  4L63 B;  1PZK D;  3QOL A;  2P5Z X;  4NMZ A;  2EY2 A;  5IOD A;  1O80 A;  3GTO B;  4LMQ D;  3I72 A;  4IJL A;  3K5O A;  2D62 A;  1X32 A;  2MO1 A;  1NMF A;  1G91 A;  1SDF A;  3K5N A;  4L5T A;  3GTQ H;  2VB2 X;  5EAY A;  2B8F A;  3E0J A;  1F77 A;  3DLL A;  3SEB A;  1Q8K A;  1Z9F A;  2BE5 D;  4GKJ L;  4G57 A;  3R2I A;  5E7N A;  4KY5 A;  1RDP D;  4UDU C;  3M4O B;  1SJH D;  2JN4 A;  2UXC Q;  3PO2 H;  3U9O A;  3N52 A;  5FO9 B;  1Z6H A;  1AW7 A;  3DHQ A;  4A3K G;  1AN8 A;  5IT9 L;  1BNZ A;  1ZKO A;  3KFU A;  4UP7 A;  3CCU A;  3BVG A;  3I4M B;  1E3P A;  4KKT A;  1QIL A;  1NBW A;  2OF1 A;  1Y69 U;  3QG1 A;  4A3E B;  3H0G G;  4DR7 L;  2BA0 A;  4U67 3;  3U9S A;  1TKW B;  3RZO B;  1J5E Q;  1LM0 A;  5H1S E;  4LFB L;  3ER0 A;  1RJT A;  2QDL A;  4QB4 A;  4GN3 B;  2OTL A;  1Q46 A;  4YCW A;  3KJP A;  3KDF A;  1TWA B;  4CDE C;  4C2M B;  1UEB A;  4ZLT F;  3GP7 A;  2BA1 A;  3GTG H;  4BY7 H;  4YHH Q;  4A75 A;  2OQK A;  4ZKB B;  1NTG A;  1TY0 A;  4IPC A;  4LAA A;  1LTA D;  2WB1 G;  2KVM A;  4XQJ A;  2EPB A;  1I50 B;  1B70 B;  4PZ7 A;  4RKL A;  2F0O A;  2FHT A;  3I4N H;  2CFM A;  1EEF D;  4DV6 Q;  1SYG A;  5K36 H;  1KNE A;  1I5F A;  2KEC A;  2VXW A;  3TME A;  3HEJ A;  5IYC H;  4BWG B;  4YWL A;  5CC4 A;  2OTJ A;  4ALP A;  3M7G A;  3VR6 A;  3HOW G;  4DPG A;  2RDH A;  2AQ3 B;  1HNW Q;  2XN9 C;  1NR2 A;  1CQF A;  4DV4 Q;  2GN5 A;  4KTA A;  2JJQ A;  4XT3 B;  1X9N A;  1ASY A;  4PQX A;  4POG A;  1HR0 Q;  1KLU D;  2XTI A;  2ZXO A;  4ZYS A;  3CHB D;  5IGF A;  1EYD A;  4IUT A;  4BBR B;  1NY4 A;  5EKI A;  3OTO Q;  1YIT A;  2A6H D;  4X66 Q;  3W2D A;  1C8C A;  4JI3 Q;  2RSO A;  3TDQ A;  1WVL A;  1H9M A;  3PSI A;  5JJK A;  5KYL A;  1Z7T A;  1SYB A;  5M5X B;  2NVT H;  1KLG D;  3BDO A;  4APV A;  4A93 G;  4LFC L;  2PO4 A;  2R3Z A;  2DNC A;  1EOV A;  2KCT A;  3L3O C;  2KEE A;  3VDY A;  4C3H G;  3HKZ G;  5DLQ E;  4AYB G;  1YJW A;  1C0A A;  1CSQ A;  1D6E C;  2F0L A;  2I5L X;  2MFI A;  2ID0 A;  4A3I B;  4XQQ A;  1YNJ D;  1M4V A;  2RSN A;  1V8Q A;  3FKI B;  3AB9 A;  5ELD A;  2JA8 B;  1EY6 A;  1K8A C;  2UUC Q;  4GLA C;  5C5M A;  4IFD I;  1CK1 A;  2EIF A;  4DF7 A;  4DV5 L;  4GOP A;  1ET6 A;  1PFN A;  1BBW A;  1Y1W B;  4JI2 L;  5EQ0 A;  2JEA I;  4IFD G;  3TS2 A;  1JOQ A;  4YCV A;  5AJ3 L;  1RF2 D;  4GNX B;  4A3K H;  3J81 j;  4DV6 L;  4JV5 Q;  2WAQ B;  2UXD L;  1IW7 C;  1FJG Q;  3NK9 A;  1STB A;  4ZKC B;  1LT5 D;  5F2D A;  4DV0 Q;  4JI4 L;  1MJC A;  3I90 A;  3BZD B;  2E2J B;  2KCN A;  1H9K A;  1FYC A;  4A3C H;  5GQO A;  2K5D A;  2IX3 A;  3GQB A;  3AYH B;  5E4W C;  3H0G H;  1TWG B;  5JJZ A;  5IYD G;  2CQO A;  1JJC B;  2F3I A;  4ZUJ A;  4J15 A;  4FDB A;  2AQ1 B;  1ZYR D;  1SRO A;  1QVF A;  4QL5 A;  2IPK D;  4QGU A;  4FXG C;  4E6I A;  3Q24 A;  2JA5 H;  2N8N A;  1MD2 D;  5EKK A;  1I4X A;  1K3B C;  4AH6 A;  4IOC A;  4JI3 L;  1KIX A;  5M5W B;  4KHZ A;  2VS1 A;  4RH6 A;  4FF2 A;  3K58 A;  1G8Z D;  4OX9 Q;  4LJZ C;  1VQO A;  3D6C A;  3OOC A;  2XGT A;  4X3K A;  3Q23 A;  1VQP A;  1KAB A;  3EQL C;  4PMB A;  5I9P A;  4XYQ A;  4C1N I;  1PV4 A;  1VMP A;  1H9S A;  2N78 A;  1GUT A;  2EJM A;  1BXT A;  5GAE C;  1TS4 A;  1CHQ D;  4ZQ3 A;  5C0X I;  2D5D A;  2E2I B;  1B4O A;  4BY1 B;  2WAQ E;  1I4Q A;  1PTO H;  2EYL A;  1LT6 D;  2EQS A;  1Q1E A;  3EJI A;  1UAP A;  1KHI A;  2KBN A;  1L1O B;  3KUP A;  1D1I A;  2HIX A;  4K2K A;  4K2L A;  3Q22 A;  3UE0 A;  2NVQ H;  5C44 G;  4L8J A;  3G48 A;  1YJ9 A;  3S1N H;  1AFP A;  5FLX c;  2RHQ B;  3P20 A;  3AQQ A;  1BOS A;  1IL8 A;  2RVL A;  5M3F B;  4KN4 C;  5EBC A;  3NEL A;  4LUO A;  4OWT B;  2NYZ D;  4HCS A;  2JA7 H;  1A3V A;  3VR4 A;  5IGC A;  1IL2 A;  3HP3 A;  3BG3 A;  4P73 A;  5COY A;  1SYD A;  2R6G A;  4DNT B;  4HJA A;  1CA5 A;  1BO0 A;  2ZJP A;  2N55 A;  5J39 A;  2BCO A;  2ENB A;  2CQA A;  3UE1 A;  2IHF A;  2E2H B;  4A93 H;  1ET9 A;  1BDO A;  3RZD B;  4GZY C;  1X55 A;  4HMJ A;  2Z8L A;  2K5N A;  4C3H H;  1O7Z A;  3MWY W;  4A3E G;  3HOZ B;  2YV5 A;  3RR5 A;  5TSS A;  1V1Q A;  3M3Y H;  1E22 A;  1EY9 A;  2CHB D;  3HOV B;  2UUB L;  3MXU A;  2ALY B;  3KYH C;  3SXH A;  4JOI A;  1K83 H;  4Q5V A;  2MHV A;  5KNC A;  5C4H A;  5LMU Q;  4K5X A;  1Q3L A;  5CYU A;  3TRE A;  4B3T Q;  4OL7 A;  5LMN Q;  2EJG C;  3G6J B;  2ASB A;  3H91 A;  3IFT A;  5J3B A;  4O42 A;  4YY3 L;  5E4X A;  4HIM A;  4MTN A;  3RLN A;  2C35 B;  3HOU G;  3FPP A;  4MHE A;  3STB D;  4DR3 L;  4U68 A;  2KHI A;  1RL2 A;  3D6W A;  1PFM A;  3K80 C;  2K28 A;  2N49 A;  1LTL A;  2R7D A;  4DV2 L;  4PMC A;  4FP5 D;  1GHJ A;  5ELN A;  1XTD A;  1IYJ B;  3S15 H;  3JC6 6;  3M4Y A;  2O2L D;  3JAM L;  3K0Y A;  5IYD H;  4OWW B;  1STH A;  2MQH A;  4A3M B;  4R9W A;  4JI0 Q;  3H3V H;  4A3G B;  3S9W A;  1PYW D;  5BR8 Q;  4DR2 L;  4HSV A;  3PIO 3;  5D14 A;  2QIL A;  4JI1 Q;  1Q7Y C;  1QZG A;  2WKC A;  3T16 A;  3MHB A;  4P72 A;  2PQA B;  5CV6 A;  5LMN W;  3ND9 A;  5EPK A;  4BBR G;  1SR3 A;  2K50 A;  2X6G A;  4DR4 Q;  4OO1 I;  2XWB B;  4LF9 Q;  1S5F D;  3CCS A;  3GTP B;  3V96 A;  1QUQ B;  5EJW A;  4G7O C;  2EJF C;  1K8G A;  3TN2 A;  4DFA A;  5ISR A;  1E2W A;  4OGQ C;  1Y8N B;  3HG9 A;  2MNA A;  2A8V A;  1QZH A;  5ELF A;  3P7J A;  3W1G A;  1PHJ A;  2B2Y C;  1DOM A;  5M3M G;  1I6H B;  2X69 A;  3A8I E;  3GTO H;  3IRB A;  5HUR A;  4A3L G;  1X54 A;  2AWO A;  3MTS A;  4IO9 A;  5CV4 A;  3D4R A;  1WI5 A;  3C1F A;  4ZCK A;  4A3I G;  3FKI G;  1BBX C;  4JI8 L;  1F2Z A;  1YZ6 A;  2JA8 G;  3GTK B;  4NKL A;  3S14 B;  3GV3 A;  5JEA J;  4WJW A;  3K8A A;  5ELO A;  2NZH A;  1Z47 A;  4DV1 L;  1VQ7 A;  3SHL A;  2WIN B;  1R9T B;  5I6W A;  3M4O H;  3PO3 B;  3RMH A;  5BN5 A;  2KCC A;  1SE3 A;  5GAG C;  1CKM A;  1TWH B;  2L5T A;  3TP5 A;  4KN7 C;  3OMC A;  1U9R A;  4A76 A;  2UUA L;  2K32 A;  4R1J A;  5CBE E;  1YBY A;  3SK8 A;  2L55 A;  3T1Y Q;  3I4M H;  3NXW A;  1ML0 D;  4R4O A;  1UE5 A;  4F7X A;  5I2Y A;  4A3E H;  3Q8D A;  4B3M Q;  1IYU A;  4KJN A;  2MPM A;  2CKZ B;  3VYR A;  3RZO H;  3N6R A;  3H09 A;  1KC8 C;  3JAM E;  2F0S A;  3ONA B;  3GTL B;  1T5X D;  4KY7 A;  1ROD A;  4B9X A;  4X65 Q;  1TT2 A;  1TWA H;  3OPO A;  3CQZ B;  2A68 C;  4C2M H;  4DR5 L;  1WD0 A;  4ME3 A;  1HNX Q;  1V9P A;  1O7I A;  3K7A B;  2RCN A;  3UDF A;  3F2B A;  4HIK A;  4A3B B;  2JE6 I;  4HMI A;  1ICF B;  5ELE A;  4H44 C;  4P2C B;  3Q6S A;  4IN3 A;  1IZ6 A;  3TP8 A;  3HOU H;  1TII D;  3I3C A;  1LTI D;  3BZK A;  1I50 H;  3P75 A;  2E5L L;  3L2P A;  3QR8 A;  1SE2 A;  3OIP A;  1EQV A;  2E76 C;  4R4C A;  4CHT B;  1U4R A;  3NHH A;  4DUZ Q;  1S40 A;  3PIP 3;  1ZEQ X;  1Q12 A;  3S2D B;  1HTP A;  5FJ8 G;  1N34 Q;  4RGN A;  4A3F B;  1HZ9 A;  1M8A A;  1K0S A;  3A54 A;  4BY1 G;  1U4M A;  1BBU A;  1I4P A;  1WCM B;  2R7Z B;  2A6H C;  3PUV A;  4WFN 3;  5IIF A;  3CCJ A;  5M5Y B;  1Q90 A;  1S5E D;  4A3J B;  1KAA A;  4LF7 Q;  2H5X A;  3WOE A;  3CCE A;  1D8L A;  1TY2 A;  2E75 C;  1JQY D;  4M1U B;  3F2D A;  3ULP A;  1OXU A;  1VQ4 A;  2ICE C;  2XRQ D;  3QIA A;  2VQF L;  2GA4 B;  2AKW B;  1WTW A;  3K57 A;  3I73 A;  4BBR H;  5M3F G;  2RA4 A;  2Z9H A;  5FOB B;  3ZYY X;  1QCB D;  2HCI A;  4QIW E;  3RNU A;  4HIO A;  2A5H A;  3DEP A;  4K6D A;  5G3L D;  1YNJ C;  3MA2 B;  2EYP A;  2ICI A;  2FIN B;  4XYO A;  1HZB A;  5KND A;  2YTX A;  3K5L A;  1QVG A;  3UDI A;  4RHR A;  5JPN C;  4HCE A;  3HOY B;  5M3M H;  1XMO Q;  1F2M A;  1YNN D;  4P71 A;  2YU9 B;  1DOL A;  3CD6 A;  2RQX A;  1HQR D;  4A3L H;  4F87 A;  3S1R B;  4A3I H;  1JWS D;  3QWN A;  1PFB A;  4A4I A;  2F0Q A;  1EYG A;  3FKI H;  4DAV A;  2JA8 H;  5IGG A;  2B63 B;  2PZT A;  5D3D A;  1F2L A;  3RLF A;  4F88 A;  2PCF B;  4DK1 A;  3ERS X;  1DGS A;  2JQO A;  1VF5 C;  3CPW A;  1N9W A;  4KLK A;  2KA7 A;  3C46 A;  2FMM A;  3CCR A;  3ITP A;  1ICW A;  3JAM i;  3FHW A;  1BCP C;  4J1M A;  2Q8I B;  3TS0 A;  4KI0 A;  1EIG A;  3BJU A;  2PQE A;  3H3V C;  4JPB W;  4DUZ L;  5IWA L;  4X3U A;  2EXD A;  3G71 A;  1EQT A;  3L0O A;  1K73 C;  3AEV A;  2CH4 A;  2HIV A;  4JYA L;  1B3A A;  2JA9 A;  1U4P A;  2XSC A;  2E2J H;  2Z6K A;  4JOI C;  2OWO A;  5IGD A;  1EUJ A;  4YWM A;  5I4D A;  2FMC A;  1ESF A;  1TWG H;  2AQ2 B;  3VA5 A;  1L1O A;  3U4V A;  4A3C G;  2VUM B;  4QUC A;  4A3M G;  2B8G A;  2B39 A;  4XT1 B;  4KMU C;  3IFD A;  4A3G G;  3NEN A;  4ZRZ A;  1VCI A;  1WYD A;  4JI7 L;  3HRZ C;  4LF4 Q;  4Y52 H;  4ODG A;  4WRD A;  4JC0 A;  5J1Z A;  4IUR A;  1N36 L;  3VYS A;  5JEA H;  2JA5 G;  4DR6 Q;  3BDC A;  4NW2 A;  1QNK A;  3AMU A;  1TU2 B;  3M4Q A;  4DV3 Q;  1Y8P B;  2ZT9 C;  1WTR A;  1XNQ Q;  3IL8 A;  4X64 L;  2V4D A;  3RN2 A;  2UXB L;  1P8L A;  4C3J B;  5FLM G;  4DN4 M;  4L5S A;  3E6Z X;  1XMQ L;  4ME5 A;  1DON A;  2HQL A;  2PNH A;  2F0V A;  2BH2 A;  1PRT D;  2OEO A;  1OXS C;  3W5O A;  2Y0S B;  3PIP A;  5FJ8 H;  1DCZ A;  2E2I H;  2NVY B;  1TS5 A;  2OXP A;  4BY1 H;  1NSN S;  3D31 A;  4BA2 I;  1CZG A;  2WAC A;  3C2P A;  1YNX A;  4DAP A;  1CQV A;  2F4I A;  1HXY D;  2MUY A;  3NPP A;  3NTK A;  2PI2 A;  2Z0S A;  3NUC A;  2B2Y A;  1TWC B;  1WTQ A;  3UI2 A;  4RMF A;  1JOO A;  1NCV A;  2UXC L;  5M3F H;  1CM9 A;  2UU9 Q;  2DGY A;  3KJO A;  3PO3 G;  4GKK Q;  4DA2 A;  4IJH A;  3CRK C;  3A7A B;  2E74 C;  1X3F A;  5G3L F;  4DKA C;  2F4V Q;  2AMC B;  2QGQ A;  5CV5 A;  4F8M A;  2JA7 G;  3FMC A;  1B7Y B;  4IPG A;  2E2D C;  3VR2 A;  1PZI D;  2KUM A;  1RKN A;  2E2H H;  4TSS A;  2QEX A;  1DZ1 A;  3T1H Q;  3RZD H;  4K5V A;  2K01 A;  3DXJ C;  5IT9 E;  2IHE A;  1J5E L;  1ENC A;  1JMC A;  1JT8 A;  4ULL A;  4R4Q A;  3KF6 A;  2F0E A;  1SXT A;  3CPF A;  5FK9 C;  4CJ2 C;  4HJ7 A;  3TZD A;  1PLF A;  4XQN A;  3STB C;  1SBB B;  2IW3 A;  3H6M A;  4DR6 L;  1I3Q B;  4YHH L;  3KK7 A;  2PQA A;  1S5D D;  2Y0S E;  1FNV A;  1UEA B;  1YVC A;  3LWU A;  3MXN B;  1SAP A;  1FGU A;  1HR0 W;  1XXG A;  4V0B A;  1WFQ A;  1VQ5 A;  4OEL B;  5C4J B;  3NP8 A;  1VQK A;  1UUP A;  1SSO A;  3JAM c;  1GM5 A;  1WTP A;  5BN4 A;  3S1Q B;  4RG1 A;  2I5H A;  4XTC S;  1VQL A;  1K3R A;  1JWM D;  5AFW A;  3CMA A;  1OXT A;  5IE8 A;  5EBD A;  4O0A A;  3T4A C;  1PH2 A;  4M8A A;  1HNW L;  4ID6 A;  1BR9 A;  2EXZ A;  4A3M H;  4I7A A;  3H3V I;  4DV4 L;  4A3F G;  3DMU A;  2K75 A;  4A3G H;  2R7Z G;  1WCM G;  3A8J E;  2NVX B;  1CI3 M;  1EY7 A;  3K6O A;  3NWT A;  1HR0 L;  3CCV A;  1PYB A;  3NBH B;  1GUN A;  2F3W A;  2CW0 D;  2B2V C;  3A55 A;  1SEB D;  4IAL A;  5M9O A;  4DNI A;  3ERO A;  2L12 A;  3OTO L;  1GUG A;  4NXN Q;  4X66 L;  2F4V L;  2JXM B;  1OXX K;  3OHX C;  5C0X J;  3S1M H;  4AIM A;  1VQC A;  4R8N A;  1SNM A;  3R8B A;  4P74 A;  5FLM H;  3J81 L;  3GTP H;  1N32 Q;  1QJO A;  2HQE A;  4H7B A;  5A2Q L;  4JI6 Q;  5IP9 G;  4LF5 Q;  4LF8 Q;  3I91 A;  2EYM A;  1PRT F;  2R93 B;  2F52 A;  2XNA C;  4IUN A;  4QF4 A;  2FJ2 A;  3EBE A;  1EWI A;  2EYO A;  2PW5 A;  1U4L A;  1B2T A;  4KHP Q;  1D5M C;  1QB5 D;  4OEM B;  1Y14 B;  3T56 B;  1CT1 D;  2UUC L;  1SJE D;  2F0K A;  4GNX C;  3NSW A;  4RGO S;  3SK4 A;  1KDB A;  2GVA A;  4ZK9 B;  3BVZ A;  1U5K A;  2B63 G;  2F0I A;  1GUS A;  1V43 A;  3A7L A;  1CKN B;  1VQI A;  4OON A;  4LNQ A;  4H13 C;  3S24 A;  3W1B A;  1AH9 A;  2AHO B;  2IX0 A;  1YI2 A;  2K5Q A;  3KF8 A;  1R9T H;  4JV5 L;  1VQF A;  3PO3 H;  4DR1 Q;  4A3D B;  1FJG L;  4IUP A;  1SLJ A;  1W6J A;  4K5W A;  3BU2 A;  1X3E A;  4DV0 L;  2A6E D;  1S5C D;  1GXD C;  4UAI A;  1C9O A;  5CV9 A;  3CF5 A;  1XNR Q;  3PMF A;  1LO5 D;  2L0C A;  3CW2 C;  2IY5 B;  3I4M G;  4V19 0;  1N8R C;  2EY5 A;  1B9N A;  2L15 A;  3OYY A;  2DY8 A;  4JVZ A;  1VQN A;  1SFO B;  2WFW A;  3KDF B;  1VQ6 A;  4C3I B;  1YIJ A;  1HQM C;  4X6A H;  1Q82 C;  1N33 Q;  2NB0 A;  5KEE A;  4DXG A;  2SOB A;  3GTL H;  4CJ1 B;  1STY A;  1B3Q A;  3CQZ H;  5ELC A;  2J4X A;  1HCZ A;  3T51 B;  2Q8R E;  3J80 L;  1B9M A;  4PNY A;  3H15 A;  3K7A H;  1H95 A;  2CWA A;  2K1B A;  3V2T A;  1VQJ A;  1JJ2 A;  1VQA A;  4LF5 L;  4Y7N B;  1G51 A;  1EY4 A;  1X6O A;  2Z6K C;  2HD3 A;  1WTX A;  2F0G A;  1FNU A;  4RGT A;  1E2V A;  3VYU A;  1IKM A;  3LX0 A;  1VDZ A;  4L5Q A;  1L1O C;  2H1E A;  2JA6 B;  1VF7 A;  1D5X C;  2I5M X;  4DAY B;  5JJI A;  2EVB A;  3J81 E;  4DV7 Q;  4FYD A;  4CDD C;  1OXV A;  3S2D H;  5A2Q E;  1WTO A;  2Y0S G;  1Y1V B;  4KV6 A;  1BQQ T;  3CC7 A;  2KHJ A;  5IGB A;  3S16 B;  4A3F H;  1AP0 A;  1CKO A;  2R7Z H;  1WCM H;  1EQR A;  1PA6 A;  4JBK A;  1G2T A;  3LNN A;  5M5Y H;  3MVV A;  4J8Q A;  4A3J H;  1QNU A;  1X3P A;  1WOC A;  2JYO A;  3AFP A;  1IBK Q;  3L7Z C;  2F1M A;  2Z4H A;  4N9P A;  1TR5 A;  1JWU D;  1VQ8 A;  1SYE A;  2N88 A;  1EU4 A;  3K0X A;  1HUN A;  2OCE A;  4PV1 C;  2RDG A;  4POF A;  3J7Y W;  4JG2 A;  3NWS A;  1TWF B;  4QJF A;  4X3S A;  1A0I A;  1STG A;  1XNR L;  4JW0 A;  1GVP A;  4IUV A;  2F0T A;  1D5Z C;  1NAP A;  1SNP A;  2LKV A;  3H0G B;  4J6H A;  2DNE A;  1Q86 C;  4K8J A;  5IP9 H;  1XPO A;  2O5I C;  1GKH A;  2LY7 A;  3QO2 A;  1LTR D;  3OMG A;  2ATW A;  1IW7 D;  2K03 A;  1A6X A;  5CV7 A;  3HOY H;  1W3S A;  1PRT B;  2PYK A;  3MXP A;  5T1G A;  3K5M A;  2QEJ C;  4KD4 A;  4R4T A;  1N33 L;  1G6Z A;  2YU9 H;  2IJ0 A;  2F3V A;  4ZAI A;  2BH8 A;  2BOS A;  2F0M A;  4TRD A;  3WOF A;  4CDC C;  2YYZ A;  3GTJ B;  2QCP X;  2BE5 C;  2XIW A;  4C1N K;  1XX8 A;  3S1R H;  2JEB I;  1GUO A;  5LMU L;  2WB1 B;  1KD1 C;  1STA A;  4B3T L;  2HHH Q;  4GOP B;  2B63 H;  4EX5 A;  5LMN L; 
#chains in the Genus database with same CATH homology
 5GRO A;  2LXK A;  4R4I A;  1TWH H;  5C0X G;  5M3M H;  1XMO Q;  1NY4 A;  3EN2 A;  5C4X H;  2DUD A;  4P71 A;  3OTO Q;  4HID A;  1YIT A;  3CD6 A;  4WJ3 M;  3B6Y A;  4X66 Q;  4A3L H;  4UY8 C;  4LF6 Q;  1E7Z A;  3A5Z B;  4JI3 Q;  2YTV A;  5IT9 c;  3AFQ A;  3HFZ B;  4OWX B;  2MO0 A;  4A3I H;  1IXR A;  3PSI A;  4A4I A;  1Y1W G;  4DR2 Q;  1KAW A;  1EYG A;  3FKI H;  1PH1 A;  1LYL A;  2V1C C;  1EFW A;  5JJK A;  4LFA Q;  2JA8 H;  4NB3 A;  1IBL Q;  2NVT H;  1G29 1;  1S3O A;  3RLF A;  1KQS A;  2VUM G;  1VQH A;  3ERS X;  1DGS A;  2WAQ G;  2JQO A;  3F8T A;  4APV A;  4BXX G;  4LFC L;  4A93 G;  1D7Q A;  3CPW A;  1N9W A;  1EOV A;  2KCT A;  4KLK A;  4NXN L;  3VDY A;  3HKZ G;  5DLQ E;  4AYB G;  3OW2 A;  1YJW A;  3CCR A;  5IYB G;  1XJV A;  1Q1B A;  1CSQ A;  3GDE A;  1C0A A;  4JI0 L;  2B3G A;  1IBK L;  3JAM i;  2I5L X;  3FHW A;  2MFI A;  2ID0 A;  3TS0 A;  4KI0 A;  3PGZ A;  5BR8 L;  2VUM H;  3BJU A;  4IPD A;  4NXM Q;  4LW1 A;  4A3B H;  2E8G A;  4DUZ L;  5IWA L;  3J7Z C;  1K8A C;  1WJJ A;  2UUC Q;  4JI1 L;  1N32 L;  2EXD A;  3G71 A;  4JI6 L;  3M4P A;  4GLA C;  4LF8 L;  3L0O A;  1K73 C;  5IYB H;  1I94 Q;  3AEV A;  2HIV A;  4IPH A;  3S17 H;  4IFD I;  3J81 i;  4JYA L;  2JA9 A;  2EIF A;  2ZJR A;  2E2J H;  4DV5 L;  1MIU A;  2Z6K A;  4JOI C;  4GOP A;  4PZ8 A;  2OWO A;  1BBW A;  1EUJ A;  4YWM A;  4JI2 L;  1AE3 A;  2JEA I;  3CXC A;  4DR4 L;  4IFD G;  3TS2 A;  1SE8 A;  1S72 A;  4YCV A;  4DK3 C;  1TWG H;  5AJ3 L;  3ICE A;  2OQ0 A;  4K0K Q;  1L1O A;  4O2D A;  3U4V A;  4GNX B;  3J81 j;  4A3K H;  4DV6 L;  1BKB A;  4A3M G;  4LF9 L;  4A3C G;  4JV5 Q;  2UXD L;  1NJI C;  4A3G G;  1FJG Q;  3NEN A;  5JEA G;  1VCI A;  3RLO A;  4B3S Q;  1WYD A;  4BA1 I;  2YTY A;  2K5V A;  4JI8 Q;  4DV0 Q;  4JI4 L;  1MJC A;  4JI7 L;  1B8A A;  4LF4 Q;  3RN5 A;  1KXL A;  4Y52 H;  1HNZ Q;  4A3C H;  4AQY L;  3S2H H;  4X62 Q;  4JC0 A;  5GQO A;  1HH2 P;  1MKH A;  1N36 L;  2RHS B;  3AYH B;  4DV1 Q;  2K52 A;  3H0G H;  2JA5 G;  4BBS G;  4DR6 Q;  5IYD G;  4JI5 L;  2CQO A;  3UDG A;  1JJC B;  4DR1 L;  3CCL A;  2NVY H;  1SRU A;  3M4Q A;  3HOX G;  4DV3 Q;  3PCO B;  1XNQ Q;  2F3I A;  3I2Z A;  4X64 L;  3RN2 A;  4J15 A;  1VQM A;  2UXB L;  4FDB A;  1P8L A;  5FLM G;  1SRO A;  3E9H A;  4HJ5 A;  2UUA Q;  4QL5 A;  4QGU A;  1XMQ L;  4L5S A;  1QVF A;  4B3R Q;  2HQL A;  3MEF A;  2JA5 H;  2N8N A;  2PNH A;  1HJP A;  2B29 A;  4AH6 A;  4IOC A;  4JI3 L;  4JBW A;  5C3E H;  1KIX A;  2BH2 A;  2AWN A;  4KHZ A;  2I0Q A;  1YEZ A;  2VS1 A;  1VQE A;  4IOA A;  4XIG S;  3PIO A;  4OX9 Q;  3PF5 A;  4GKJ Q;  1OXS C;  3W5O A;  1VQO A;  4DAM A;  3PIP A;  3KF6 B;  2XGT A;  4EQ5 A;  5FJ8 H;  2ZJQ A;  1YHA A;  2E2I H;  2D0O A;  4BY1 H;  1VQP A;  2R92 H;  1VQG A;  4TVA B;  3GO5 A;  4DV2 Q;  4BA2 I;  3D31 A;  5IY0 A;  1YJN A;  1X65 A;  4GNX A;  2CCZ A;  4A3D G;  1IBM Q;  3E9I A;  1YNX A;  1NMG A;  2VY3 A;  3T1Y L;  1PV4 A;  1VS0 A;  1GD7 A;  3I7F A;  4GLX A;  3BZC A;  1PFS A;  1JB7 A;  2N78 A;  2PI2 A;  2VZA A;  2Z0S A;  5GAE C;  4DR5 Q;  5C0X I;  1M90 C;  4RMF A;  4UP8 A;  4B3M L;  2UXC L;  5M3F H;  3PUX A;  2WAQ E;  5M5X H;  2UU9 Q;  4QY7 A;  4DR7 Q;  3LGJ A;  1PVO A;  3J80 i;  4OO1 G;  3EIV A;  2DGY A;  2EQS A;  3KJO A;  3PO3 G;  1Q1E A;  4GKK Q;  3HKZ E;  3A5U A;  1KHI A;  4IJH A;  3WWV A;  2KBN A;  3PUZ A;  4LFB Q;  5JJL A;  2PI2 E;  1L1O B;  4HJ8 A;  5IP7 G;  1VQD A;  3PV0 A;  2JK8 A;  1X3F A;  2HIX A;  4DKA C;  1QVG A;  5GAD C;  2AMC B;  2QGQ A;  3UE0 A;  2F4V Q;  3HOZ G;  2JA7 G;  2NVQ H;  1B7Y B;  2QA4 A;  5C44 G;  1YJ9 A;  3G48 A;  4IPG A;  4X65 L;  3S1N H;  2E5L Q;  5FLX c;  2RHQ B;  4K0K L;  3AQQ A;  3HOV G;  1I3Q H;  2Q2H A;  3CC2 A;  2E2H H;  4UP9 A;  2QEX A;  3U50 C;  3M85 A;  1UE7 A;  3T1H Q;  3RZD H;  1HNX L;  4DV7 L;  3NEL A;  4PZ6 A;  5IP7 H;  4LUO A;  1X56 A;  4TQU S;  1MJE A;  2KEN A;  4OWT B;  3KOJ A;  2IHE A;  1J5E L;  1JMC A;  1JT8 A;  4KHP L;  2JA7 H;  4R4Q A;  3KF6 A;  3ZJY C;  5C44 H;  1XPU A;  1IL2 A;  4P73 A;  3HKS A;  3CPF A;  1Y1W H;  4HJ7 A;  3A74 A;  4L5R C;  2VW9 A;  2R6G A;  2VQE Q;  5C4J H;  4JBJ A;  4HJA A;  2LXJ A;  3STB C;  2ZJP A;  4DR6 L;  3U4Z A;  2PMZ E;  3UE1 A;  2IHF A;  4YHH L;  3S1Q H;  2PQA A;  4A93 H;  4BXX H;  2Y0S E;  1X55 A;  2JA6 G;  1YVC A;  1K0R A;  2K5N A;  1SN8 A;  4C3H H;  2HT1 A;  3MXN B;  2VQF Q;  4A3E G;  1N34 L;  2YV5 A;  3GD7 A;  2Q2I A;  2K14 A;  3RR5 A;  3PO2 G;  4B3R L;  1FGU A;  1HR0 W;  1FL0 A;  1V1Q A;  4H02 A;  1E22 A;  3M3Y H;  1Y1V G;  3F1Z A;  1JE5 A;  1Q81 C;  1WFQ A;  4LUV A;  1VQ5 A;  2ALY B;  3KYH C;  2UUB L;  2A1A A;  4MZ9 A;  4JOI A;  1K83 H;  1VQK A;  2ZTC A;  4LF7 L;  3JAM c;  1YHQ A;  1CSP A;  1GM5 A;  5LMU Q;  2NVX H;  2N3S A;  1CKN A;  3FP9 A;  4QQB X;  4RG1 A;  2I5H A;  4XTC S;  1TXY A;  3TRE A;  2NZO A;  1VQL A;  4B3T Q;  3J7A 5;  2WB1 E;  3NEM A;  1K3R A;  1C7Y A;  2IX1 A;  5LMN Q;  1VQB A;  3CMA A;  3M7N A;  1OXT A;  2ASB A;  5IE8 A;  5J3B A;  4O0A A;  4C3J H;  5GAH C;  4GOP C;  1IBM L;  1PH2 A;  3J81 c;  4YY3 L;  3G4S A;  4UPA A;  1HNW L;  4HIM A;  4MTN A;  4A3M H;  4PMW A;  5M5W H;  3RLN A;  4DV4 L;  2C35 B;  4A3F G;  3H3V I;  3HOU G;  2R93 G;  2K75 A;  4A3G H;  1PYS B;  2R7Z G;  4MNO A;  1WCM G;  3STB D;  4DR3 L;  5HY6 A;  1A8V A;  1PH6 A;  2KHI A;  1UE6 A;  1RL2 A;  3K80 C;  1HR0 L;  2N49 A;  2HHH L;  1LTL A;  2R7D A;  3CCV A;  1PYB A;  4DV2 L;  3A0J A;  3M9B A;  4OX9 L;  3NBH B;  3ULJ A;  3PUW A;  4GN4 B;  1PH5 A;  3K7U C;  3I4O A;  5ELN A;  2D0P A;  1XTD A;  4BY7 G;  1IYJ B;  1EIF A;  1L2F A;  3S15 H;  3JC6 6;  4DNI A;  1XMO L;  1PH7 A;  4LFC Q;  1E24 A;  2WP8 J;  2R93 H;  1OTC A;  4PG3 A;  3KF8 B;  2K4K A;  1CUK A;  3PUY A;  3OTO L;  1EQQ A;  4NXN Q;  1KRT A;  4LWC A;  4BBS H;  4X66 L;  4OWW B;  4OXP A;  2MQH A;  2F4V L;  5IYD H;  4LF6 L;  3E0E A;  1OXX K;  1XPR A;  4JI0 Q;  5C0X J;  2ZM6 Q;  3H3V H;  3S1M H;  4GS3 A;  3HOX H;  4AIM A;  1W2B A;  1PH9 A;  2NN6 I;  1A63 A;  1VQC A;  1TWC H;  1EIY B;  4P74 A;  5BR8 Q;  4DR2 L;  1X3G A;  2Q2U A;  5FLM H;  4LUZ A;  4LFA L;  3GTP H;  5IWA Q;  2K5H A;  1IBL L;  1N32 Q;  4JI1 Q;  1Q7Y C;  1YHB A;  2Q2T A;  3I4N G;  4JI6 Q;  4LF5 Q;  5IP9 G;  2NN6 G;  1QZG A;  4LF8 Q;  2ZTE A;  4JYA Q;  1PH4 A;  3DM3 A;  5K36 G;  4DV5 Q;  4P72 A;  2F52 A;  2PQA B;  4DUY Q;  5LMN W;  5IYC G;  3K81 C;  4JI2 Q;  1PH8 A;  4BBR G;  1SR3 A;  2K50 A;  2VQE L;  1J6Q A;  2B63 H;  4DR4 Q;  3CCQ A;  3EBE A;  4OO1 I;  1EWI A;  5AJ3 Q;  1M1K C;  4KHP Q;  4LF9 Q;  3CC4 A;  3KLW A;  4NXM L;  3ULL A;  1Y14 B;  3CCS A;  2UXD Q;  4A3D H;  1QUQ B;  2UUC L;  3F2C A;  1G6P A;  4GNX C;  1K8G A;  1I94 L;  1ASZ A;  2RF4 A;  2GVA A;  4AYB E;  4JI4 Q;  1E1O A;  3CME A;  2MNA A;  2GVB A;  1U5K A;  4JI7 Q;  2A8V A;  1QZH A;  2B63 G;  2CWP A;  3W1G A;  1U0L A;  1V43 A;  1CKN B;  1PHJ A;  1KRS A;  1VQI A;  3GTM H;  4OON A;  4LNQ A;  1P16 A;  3S24 A;  3W1B A;  4P75 A;  5M3M G;  1VQ9 A;  5C4X G;  2AHO B;  1AH9 A;  1N36 Q;  2IX0 A;  1YI2 A;  3GTO H;  3IRB A;  1R9T H;  4A3L G;  4JV5 L;  1X54 A;  2AWO A;  1VQF A;  3SGI A;  1SMX A;  4DR1 Q;  1E1T A;  3PO3 H;  4IO9 A;  1PH3 A;  1FJG L;  1WI5 A;  1SLJ A;  4A3I G;  4IFD J;  3BU2 A;  4JCV E;  4X64 Q;  4B3S L;  1SFO H;  2UXB Q;  3FKI G;  1X3E A;  4C3I H;  3J80 c;  4JI8 L;  4DV0 L;  3UDX A;  3HOZ H;  1YZ6 A;  2JA8 G;  1XMQ Q;  4LF4 L;  1C9O A;  1AE2 A;  4HJ9 A;  4GLV B;  5JEA J;  3CF5 A;  2IT1 A;  1UE1 A;  1HNZ L;  1XNR Q;  3K8A A;  3HOV H;  4X62 L;  5ELO A;  3CW2 C;  2IY5 B;  2NZH A;  4JBM A;  1Z47 A;  4DV1 L;  2FXQ A;  1VQ7 A;  3I4M G;  3M4O H;  4IJL A;  1N8R C;  2D62 A;  4DV3 L;  2MO1 A;  1NMF A;  2L15 A;  3OYY A;  1XNQ L;  4L5T A;  4Y7N H;  5GAG C;  1VQN A;  1VQ6 A;  2WFW A;  3KDF B;  1CKM A;  3GTQ H;  1YIJ A;  2R7F A;  4A76 A;  2UUA L;  4A3B G;  4X6A H;  4R1J A;  5EAY A;  1Q82 C;  1N33 Q;  1GO3 E;  1YBY A;  4DK6 C;  1QUQ A;  4NPS A;  3DLL A;  1L0W A;  3T1Y Q;  3I4M H;  3GTL H;  4R4O A;  2ZM6 L;  2JA6 H;  1Q8K A;  1Z9F A;  3CQZ H;  4GKJ L;  2LSS A;  5E7N A;  3HOW H;  1UE5 A;  4A3E H;  2ZTD A;  3Q8D A;  3H15 A;  3K7A H;  4B3M Q;  2VL6 A;  2CWA A;  3PO2 H;  2UXC Q;  1H95 A;  1VQJ A;  1JJ2 A;  1VQA A;  2CKZ B;  4LF5 L;  4A3K G;  1Y1V H;  1G51 A;  1K9M C;  2VNU D;  3RZO H;  3KFU A;  2Z6K C;  1X6O A;  4YCU A;  3S16 H;  1KC8 C;  4UP7 A;  3CCU A;  4DUY L;  2KCM A;  4L5Q A;  1UWV A;  1E3P A;  1L1O C;  4X65 Q;  3TRZ A;  1TWA H;  4C2M H;  4DR5 L;  1KL9 A;  2I5M X;  4DAY B;  5JJI A;  1NBW A;  4ME3 A;  3CP0 A;  1HNX Q;  1V9P A;  1O7I A;  3UDF A;  2A19 A;  2RCN A;  3F2B A;  4DV7 Q;  4HIK A;  3I55 A;  4A3J G;  2JE6 I;  2UU9 L;  3H0G G;  1OXV A;  3S2D H;  2BA0 A;  4DR7 L;  2Y0S G;  3CC7 A;  1IZ6 A;  1J5E Q;  4GKK L;  2KHJ A;  1LM0 A;  5H1S E;  4LFB L;  3ER0 A;  4YWK A;  4A3F H;  3HOU H;  1CKO A;  1TWF H;  1FVI A;  2R7Z H;  1WCM H;  1EQR A;  4GN3 B;  1PA6 A;  4GN5 A;  4JBK A;  2OTL A;  1LUZ A;  1Q46 A;  3BZK A;  5M5Y H;  4YCW A;  1I50 H;  3KJP A;  3KDF A;  5HGQ A;  3AFP A;  4A3J H;  1WOC A;  1IBK Q;  2E5L L;  3I56 A;  3L7Z C;  1UEB A;  3L2P A;  4R4C A;  2BA1 A;  3GTG H;  4BY7 H;  3CAM A;  5C3E G;  4YHH Q;  4A75 A;  2OQK A;  1VQ8 A;  3T1H L;  4DUZ Q;  1S40 A;  3K0X A;  3G6E A;  1NTG A;  1Q12 A;  1QVC A;  2OCE A;  4IPC A;  3CCM A;  4POF A;  2WB1 G;  5FJ8 G;  1N34 Q;  4JG2 A;  1HZ9 A;  4QJF A;  4BY1 G;  1BVS A;  1BBU A;  1A0I A;  2R92 G;  3PF4 A;  1RIP A;  1XNR L;  3PUV A;  1GVP A;  2UUB Q;  3CCJ A;  3HOY G;  3GTJ H;  1B70 B;  1I6H H;  4PZ7 A;  4LF7 Q;  2H5X A;  3I4N H;  2CFM A;  1Q86 C;  5IP9 H;  1XPO A;  3CCE A;  4DV6 Q;  1D8L A;  1GKH A;  2ATW A;  3F2D A;  3ULP A;  1OXU A;  1VQ4 A;  1I5F A;  3U58 A;  3TEH B;  2VQF L;  2AKW B;  5IYC H;  3HOY H;  1W3S A;  4YWL A;  4BBR H;  2OTJ A;  5M3F G;  4ALP A;  3GTK H;  1N33 L;  4R4T A;  4WJ4 A;  4YY3 Q;  2YU9 H;  4DPG A;  3HOW G;  3S14 H;  2BH8 A;  1HNW Q;  3D0F A;  4AQY Q;  2YYZ A;  4DV4 Q;  4QIW E;  3TQY A;  2GN5 A;  4HIO A;  3RNU A;  1T9H A;  2JJQ A;  3S1R H;  2JEB I;  4DR3 Q;  1A62 A;  1X9N A;  5LMU L;  1ASY A;  4JI5 Q;  2ES2 A;  1KD1 C;  1JJG A;  1NE3 A;  4POG A;  1HR0 Q;  1HZC A;  1HZB A;  4GOP B;  2YTX A;  2HHH Q;  4B3T L;  2XTI A;  1HZA A;  4EX5 A;  5LMN L;  3UDI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...