4DAYB

Crystal structure of the rmi core complex with mm2 peptide from fancm
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
135
structure length
113
Chain Sequence
AGVRLPRSPPLKVLAEQLRRDAAVWMQGRVVMADRGEARLRDPSGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Defining the molecular interface that connects the Fanconi anemia protein FANCM to the Bloom syndrome dissolvasome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/hydrolase
molecule keywords RecQ-mediated genome instability protein 1
total genus 22
structure length 113
sequence length 135
ec nomenclature
pdb deposition date 2012-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16100 RMI2 RecQ-mediated genome instability protein 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dayB00
5IYDG 5H1SE 1OXSC 4R4CA 2VUMG 4IFDJ 4BBRH 2E2JH 4PG3A 4R4QA 3F8TA 1GO3E 2NN6I 5JEAJ 2QEXA 1VQ9A 3GD7A 2Y0SE 1PH3A 4JYAQ 2E8GA 4AYBE 4OWWB 1IXRA 3D0FA 2JJQA 3PSIA 3J81j 3M4OH 3STBC 1IBLQ 1N36Q 3M4PA 2HHHQ 4LFAL 1VQDA 1VQ6A 3TRZA 4BBSH 2AKWB 1FGUA 1Y1WH 4IPCA 2E5LL 2YTYA 2XGTA 1N33L 4DK6C 1X55A 3HOUH 4OONA 3HOVG 1XMOQ 5JEAG 3OW2A 1P8LA 2K5HA 4WJ4A 4DR7Q 5IT9c 1HNZL 5M3FH 4NXNL 3KOJA 2JA8G 4YCUA 4A75A 4YCWA 2A1AA 2VL6A 3L2PA 1XMQL 4LFCQ 1X3FA 2LSSA 4GKKL 4IOAA 4A76A 2R7ZH 3K80C 1W3SA 2PMZE 3RLNA 3L0OA 1Y1VG 1ASZA 1Q82C 4YWKA 3A5UA 3BU2A 2UUAL 4JI7L 4YHHL 1XNRQ 3FHWA 1BVSA 2GN5A 4LNQA 3U4VA 3RNUA 1A62A 2D0OA 3UDIA 2VZAA 5IWAQ 3GTJH 1EQQA 1X56A 2D0PA 3D31A 4DV6Q 1I94L 1S72A 4JC0A 5LMNW 3KLWA 1M1KC 1GVPA 1X54A 4BA2I 1IBML 2OCEA 2ZJPA 5IYBG 1EIFA 4LF6Q 4UP7A 2MO0A 2I5HA 1R9TH 2NZHA 1XNQQ 3G6EA 4K0KL 3PF4A 1Z47A 2IY5B 4X62Q 1E3PA 1E24A 1J6QA 3AQQA 1PH4A 2JQOA 5IE8A 1YZ6A 5BR8L 4A3FH 3CC4A 4LF8Q 1VQKA 4JI6L 4X64Q 3ERSX 1Q1EA 2B3GA 2ZTDA 5IYCG 5HY6A 2ZM6L 3AFQA 1BKBA 1WI5A 2F52A 4DAYB 1T9HA 5LMUL 4QIWE 3HOYG 2OTJA 2EQSA 2NVTH 3F2BA 3KFUA 2JA7H 2JA9A 1HZBA 1V1QA 3K8AA 1KRTA 2NN6G 2ZTCA 1SE8A 3GDEA 5E7NA 4DV3Q 2N8NA 4DR5Q 4JYAL 2ID0A 3CC2A 4RMFA 5FLMG 4X66Q 4HJ5A 3T1HL 3DM3A 5ELNA 1IBLL 1JJCB 2OQKA 3JAMc 2CKZB 4DV7L 4C2MH 4LFAQ 2R93G 2Q2IA 4A3GH 1CKNA 1MKHA 1WJJA 2AHOB 2Z0SA 3CP0A 5FLMH 4OWXB 1XMOL 1EUJA 4DR7L 1L2FA 3HOWG 1Q86C 2YU9H 3L7ZC 5HGQA 4DR2L 2L15A 4X65Q 3KDFB 1PHJA 2UUCQ 1YJWA 4B3MQ 1JJGA 3PIPA 4FDBA 2MFIA 4L5QA 1HNXQ 2BH2A 4Y7NH 4YY3L 3CMEA 4J15A 4A3IH 1Q81C 1JB7A 2R92H 3HOUG 2K52A 2ALYB 4DR6L 4QQBX 4DR3Q 1M90C 1VQ4A 1XPUA 3S16H 4HJ8A 1PH9A 4PMWA 2UUAQ 4GS3A 4LF9L 1KAWA 1NMFA 1XPOA 3TS0A 1WCMH 2K50A 2RCNA 1PH1A 1MJEA 4C3HH 2IT1A 4HIOA 5IWAL 1RL2A 3CQZH 1I94Q 5M3MH 1D8LA 4BY1G 2WAQG 5C0XI 2HT1A 1Q7YC 1HZ9A 3J81c 2R93H 5C44H 4B3SQ 2C35B 1IBMQ 1EWIA 1X6OA 1X65A 3MEFA 2VQFQ 1QVGA 5GAGC 2OTLA 1VQ7A 3CCLA 1OXUA 2JK8A 3HOZG 2MQHA 1OTCA 1XNQL 3J80c 4K0KQ 1CKMA 2KBNA 4LF4L 4DR1Q 5EAYA 1HZAA 2JE6I 3BZKA 1YJ9A 5FLXc 5JJIA 5BR8Q 1LTLA 3GTQH 2Q2UA 3I2ZA 5IYCH 2N78A 3F2DA 3OYYA 4GKJQ 2PQAB 2B63H 3RZOH 2KHIA 2BA1A 3S1NH 4BY7H 1HR0Q 5IP9H 4MZ9A 1FJGQ 1EIYB 3F1ZA 2JEBI 2CCZA 3NENA 4GOPC 1X3EA 1PV4A 3RLOA 4DK3C 5IP7H 4DV3L 5IYDH 1L1OB 1Q12A 1UE1A 1L0WA 4P74A 1OXXK 3SGIA 2ZJRA 5LMNQ 5C4JH 3CAMA 1NY4A 3I4NH 3BZCA 3K7UC 5ELOA 3CCJA 2UXBQ 3M4QA 1VS0A 2Q2TA 4ALPA 1B8AA 1VQLA 3J80i 3RLFA 1NJIC 5M5WH 1K73C 2F4VL 3H3VH 2K5NA 4A3BG 3KJPA 2GVAA 3HKSA 3UE1A 3HOYH 1EFWA 1X3GA 1GM5A 1SRUA 3G4SA 3S2DH 4JI3Q 1NTGA 4LFBL 1E1OA 4AQYL 2N3SA 3KJOA 1C7YA 1SROA 2R7ZG 1HZCA 4JI8Q 2A19A 2CWAA 2WB1G 4DR6Q 4DR3L 4QGUA 3FKIH 4P71A 2PI2E 4LF7L 2ASBA 3MXNB 4AH6A 4DV0Q 4LF9Q 4NXMQ 1YVCA 4IPHA 4HJ9A 1AH9A 5GAHC 1Y1WG 3S2HH 2R92G 1YBYA 4A3LH 3E9HA 1EYGA 5IYBH 4GNXB 2AWNA 1E22A 4XTCS 1O7IA 1MIUA 1RIPA 2VQFL 4GNXC 1HNWQ 3CCSA 1GKHA 4YWLA 3TQYA 2PNHA 5M5XH 3I4MH 1LYLA 4B3TQ 4DR1L 2NZOA 1W2BA 4LF5Q 3G48A 3PO2H 2RHQB 3B6YA 3K7AH 3PCOB 2VUMH 1VQOA 4BBRG 4JV5Q 4B3RL 1VQGA 4A3KG 1B70B 1VQ5A 4LUVA 4P75A 3J7A5 1CUKA 3M7NA 2Z6KC 4LUZA 4DAMA 3H0GH 1S40A 1WYDA 1LUZA 3PUWA 1VQEA 4O0AA 3GTGH 1Q46A 1UEBA 1CKOA 3LGJA 4O2DA 2DGYA 5DLQE 3IRBA 1NMGA 5M3FG 2JA8H 2UXCQ 4WJ3M 3CPFA 4A3CH 3OTOL 1TWAH 2IX0A 4RG1A 3KYHC 5LMNL 4JI0Q 1YIJA 4A93H 2VQEL 1SN8A 4TQUS 4JI1L 4JBKA 5C4XH 2WFWA 4DUYQ 2QGQA 1DGSA 1KD1C 1UE6A 5GADC 3PO3G 1XPRA 3CCUA 1OXVA 3M9BA 4JCVE 2F4VQ 4IJHA 4APVA 4KI0A 2E5LQ 1N33Q 3AEVA 1YJNA 3ULLA 1IYJB 4A3EG 3W1BA 1VQMA 4DV2Q 4DV4Q 4GOPB 1Z9FA 2YV5A 1IBKL 3CCRA 1UWVA 4LFBQ 1HJPA 4XIGS 3DLLA 4AQYQ 1CSQA 1XMQQ 1HR0W 2JA5G 3G71A 1YITA 3PF5A 3AYHB 3TEHB 3GTPH 4DV1L 4GN3B 4MTNA 3BJUA 1VCIA 4DUZL 2UXDQ 4GLXA 4A3DH 1N9WA 1N34L 1I6HH 3VDYA 4C3IH 1KRSA 3KF6B 1XNRL 3W5OA 4A3BH 1Y1VH 4LUOA 4UP8A 5IY0A 1K83H 2N49A 1NE3A 1QZGA 4DV6L 1AE3A 2VW9A 1MJCA 3CCEA 1KL9A 1PH6A 3GO5A 1D7QA 2ATWA 1CKNB 2H5XA 4JI4Q 4P72A 4HJ7A 3UDGA 3HFZB 4IPGA 1N36L 3ICEA 1XTDA 4JOIA 2D62A 3K0XA 5C3EG 3I4OA 4DV5L 2QA4A 4A3JH 3KDFA 4OWTB 4X62L 3UE0A 1CSPA 1TWCH 4BY7G 4LF8L 4NXNQ 1E1TA 2KHJA 4R4IA 1KHIA 3EIVA 3S1MH 4GKKQ 2UU9L 1VQNA 2VY3A 2ZM6Q 2RHSB 2JA5H 2AWOA 2JA7G 1E7ZA 1L1OC 2B29A 5K36G 4IJLA 1I5FA 2JA6H 3ZJYC 2WP8J 3U50C 4GNXA 1C0AA 4NPSA 3UDFA 1JJ2A 3I4NG 1Y14B 4QY7A 3S24A 3H0GG 2KCTA 4DPGA 4JI0L 1JT8A 4JI2L 3PO2G 1K9MC 4DR4Q 2E2HH 1KC8C 3GTMH 2HQLA 4YCVA 3PO3H 3T1YQ 3T1HQ 4LW1A 4DUYL 3E0EA 3PUYA 3H3VI 1H95A 4A3MH 2VNUD 3PIOA 4DV7Q 2HIVA 4OO1G 3F2CA 4UY8C 4POFA 1WCMG 4GLAC 2WAQE 4A3IG 2ZJQA 3HKZE 3S17H 3GTKH 2KCMA 2K14A 3J81i 3KF8B 4DV2L 4DV4L 4ME3A 1IBKQ 1JMCA 4DR2Q 3U58A 3ULJA 5GROA 1PA6A 4OX9Q 3NELA 3CXCA 2I0QA 4EX5A 1PH5A 3FP9A 4A3FG 1HNXL 2NVXH 4A3LG 3S15H 1BBUA 4DUZQ 4A3MG 1YHBA 1U5KA 2UXDL 1N34Q 2IX1A 2K75A 1KIXA 2DUDA 1IL2A 3S1QH 1SLJA 3K81C 1N32Q 2IHEA 2K5VA 3JC66 3PUXA 3CCQA 3S14H 1QUQB 4DR5L 4IO9A 4KHZA 3TS2A 1HH2P 2YTVA 1VQPA 4X66L 3EBEA 1OXTA 1G291 4HJAA 4JI4L 4PZ6A 3H15A 4DKAC 1PYBA 4PZ7A 1TXYA 1PVOA 1WOCA 2K4KA 4GOPA 3HKZG 4JBJA 4DV5Q 2KENA 1S3OA 4JG2A 4JBMA 3CD6A 4LF4Q 3NBHB 2Y0SG 2ZTEA 3S1RH 3FKIG 1TWHH 4GN4B 1YHQA 1G6PA 3GTLH 3U4ZA 1U0LA 1A0IA 3AFPA 1I3QH 4X65L 2UUCL 2BA0A 4B3ML 2R6GA 2UU9Q 1HR0L 3ER0A 2UUBL 4YY3Q 2EIFA 1GD7A 4NB3A 1N8RC 1J5EQ 1A8VA 5FJ8H 4C3JH 2OQ0A 1VQIA 3CCMA 1UE7A 5IP9G 2R7FA 1K8AC 1FVIA 3E9IA 2Z6KA 2YTXA 4JI2Q 2MNAA 4DR4L 2PI2A 1K3RA 4JI5L 1PFSA 3T1YL 4A3CG 2BH8A 1YEZA 2LXJA 4X6AH 1TWFH 2I5LX 4HIMA 3A5ZB 3WWVA 1BBWA 2WB1E 3M85A 4B3SL 2YYZA 4GLVB 4DNIA 4OO1I 1VQBA 5C0XJ 1SFOH 1VQFA 5AJ3L 3HOZH 2EXDA 2HIXA 1VQ8A 4POGA 3HOXH 1QZHA 2CFMA 5JJKA 1SR3A 1A63A 3NEMA 4IPDA 4OX9L 5GQOA 4GKJL 3A0JA 3CF5A 3STBD 3CC7A 3I55A 3PUZA 3JAMi 4JOIC 3I4MG 4KHPL 4A93G 4BA1I 4Y52H 2JEAI 1FJGL 1TWGH 2VS1A 3CW2C 4AIMA 5M5YH 2NVQH 3PUVA 4LF7Q 1VQHA 3CMAA 4OXPA 2IHFA 4QL5A 4YWMA 4DV0L 1ASYA 3RZDH 1KQSA 4NXML 5FJ8G 3EN2A 1N32L 4BBSG 3CCVA 1G51A 4LWCA 2GVBA 1V43A 1FL0A 5J3BA 4MNOA 5GAEC 4A3GG 2UXBL 4IFDG 5C3EH 1L1OA 1HNWL 2HHHL 1QVFA 1K8GA 5IP7G 2NVYH 2AMCB 2XTIA 3HOXG 1PH2A 4R4OA 4UPAA 3RN5A 2MO1A 4HIKA 1K0RA 4A3KH 4GN5A 4BY1H 4BXXG 1QVCA 3I56A 4A3DG 4KLKA 1HNZQ 3TREA 1VQJA 4PZ8A 1P16A 4JI3L 5C0XG 3A74A 1EQRA 2OWOA 2CQOA 4IFDI 4LFCL 3RR5A 1IZ6A 4L5SA 1B7YB 4JI8L 3ULPA 2UUBQ 1JE5A 1SMXA 4UP9A 1PH8A 3Q8DA 4QJFA 2FXQA 1J5EL 2PQAA 1VQAA 5JJLA 1QUQA 4A3EH 2RF4A 2UXCL 4P73A 4JI7Q 2E2IH 1Q8KA 4YHHQ 3OTOQ 4L5TA 1YI2A 2F3IA 4EQ5A 3M3YH 1V9PA 2LXKA 2VQEQ 5C44G 3CPWA 4A3JG 2JA6G 4JI1Q 4JI5Q 1NBWA 4JBWA 4A4IA 2Q2HA 4TVAB 3PGZA 1PYSB 5M3MG 4HIDA 3W1GA 1YNXA 3HOVH 5C4XG 1PH7A 1I50H 2A8VA 3RN2A 4LF6L 1UE5A 4H02A 5AJ3Q 1WFQA 4R1JA 4AYBG 4B3TL 2CWPA 4LF5L 1C9OA 1YHAA 2I5MX 2B63G 3I7FA 4B3RQ 4JV5L 4R4TA 2ES2A 4IOCA 1EOVA 1XJVA 1Q1BA 1AE2A 3UDXA 3J7ZC 4L5RC 4BXXH 2R7DA 3KF6A 1X9NA 3PV0A 1KXLA 2V1CC 3GTOH 4JI6Q 1VQCA 4DV1Q 1LM0A 4X64L 4KHPQ 5LMUQ 3HOWH
chains in the Genus database with same CATH superfamily
1D1IA 2E76C 2VUMG 2E2JH 1F2ZA 4R4QA 3BDCA 2QILA 2RVLA 4HN7A 4M1UB 2QEXA 2CW0D 4AYBE 1R4PB 2NN6H 3PSIA 5M3FB 3M4OH 3D4DA 4LFAL 1VQDA 4PQXA 1VQ6A 1HUMA 4BBSH 2K01A 4IPCA 2FMMA 4DK6C 1X55A 2Q8IB 5JEAG 2KVMA 5EBCA 4NXNL 4YCUA 4JPBW 4A75A 2VL6A 4EQNA 3L2PA 5IT9E 3BVZA 4A76A 3V05A 1W3SA 4EQOA 1Y1VG 4CJ2C 2LY7A 1Q82C 3A5UA 2D2CC 3BU2A 3BVMA 4YHHL 1K8MA 2EYHA 1WTXA 1ZKOA 4DNTB 1BVSA 2GN5A 1TY0A 5E4WC 4WFN3 2D0OA 5IWAQ 1D6EC 3FPUB 3R8BA 1I94L 4DV6Q 1S72A 4JC0A 1GVPA 3MVVA 2EPBA 5E3FA 4BA2I 1IBML 2OCEA 4LAAA 4K5VA 2ZJPA 5IYBG 1ESFA 1QOHA 5CV9A 4HSVA 1Z47A 1E3PA 4TKOB 5JPMC 1PH4A 4PMBA 4JI6L 1BBXC 3NQTA 1STHA 5IYCG 2ZXOA 3ITPA 2F52A 2HCCA 3RD4A 2KA7A 3F2BA 4NKLA 1HZBA 1D5XC 4Y7NB 2ID0A 3V96A 4X66Q 3MZ5A 4HJ5A 3DM3A 4J6HA 1ET9A 2OQKA 5DNFA 4DV7L 4C2MH 1SYDA 1H9MA 1IKLA 2Q2IA 4A3GH 1CKNA 1STNA 2AHOB 1WJJA 5A2QE 2Z0SA 3T13A 1ESRA 4OWXB 3HOWG 3OIPA 2UUCQ 4HMIA 1YNNC 2L15A 1JJGA 2M9VA 4Y7NH 2J0TD 5BN5A 3SXHA 2MGSA 4HJ8A 4PMWA 2Z9HA 4GS3A 2K50A 1MJEA 2OXPA 2QCPX 2RKSA 4HIOA 1RL2A 3CQZH 2JSOA 1ML0D 2R92B 4BY1G 1V1PA 2WAQG 1Q8IA 3JAML 2R93H 5C44H 3I8ZA 5GAGC 4ULLA 1H9SB 4K0KQ 2WB1B 3I4NB 2E2DC 1YJ9A 2H4OA 2SNSA 3J80E 2R93B 1A15A 3I2ZA 3F2DA 3S1NH 1HR0Q 3F2UA 3J7YW 5FLXL 1EQTA 2KHSA 2GA4B 4GOPC 1X3EA 4DK3C 5IYDH 1L1OB 2B63B 5C4ZA 4P74A 1NY4A 2G9HD 3K7UC 1JQYD 4GZYC 1T5EA 1AZPA 1B8AA 4A3DB 3J80i 5LHY1 2AQ2B 4ODGA 1BCPC 4A3BG 2GVAA 4ZCKA 4KV6A 1EFWA 1X3GA 5C0XH 4N8FA 1SRUA 2WACA 4RGTA 1NTGA 1SROA 2LFNA 2F0HA 2WB1G 5CMDA 1QE6A 2F0LA 4DR6Q 4QGUA 4DV0Q 3SEBA 3I4LA 1AH9A 4F88A 3S2HH 2R92G 2YU9B 1EYGA 4GNXB 1DOMA 1O7IA 3KK7A 1RIPA 3NQIA 2EJGC 2F03A 2B2VA 5IGCA 4B3TQ 1W2BA 2A73B 3G48A 3PO2H 2RHQB 3B6YA 3PCOB 1VQOA 4K5XA 3M7NA 2Z6KC 3D8GA 1WYDA 2NTSA 3PUWA 3Q0AA 4C3IG 5C4XB 1BOSA 5DLQE 3SR1A 1G2SA 1NMGA 3IRBA 4A3CH 4RG1A 4DGZA 4JI1L 5C4XH 2Y0SB 1KD1C 4UDUC 3PO3G 1XPRA 1OXVA 3J81E 1YJNA 2MHVA 4A3EG 4DV4Q 1IBKL 1RDPD 5C3EB 1AW7A 4AQYQ 2JA5G 3ZYYX 4ZQ3A 1S5BD 1Q3LA 1N34L 1I6HH 1E2WA 1CFMA 1DOLA 1KRSA 4C3IH 3HEJA 2PNRC 4CJ1B 4XQJA 3VR2A 1AE3A 1LTTD 1MJCA 2VW9A 1KL9A 3QWNA 3WDNA 1PH6A 2WIIB 1N36L 3ICEA 2DJFC 3K0XA 1Y1VB 4DV5L 2EYFA 4OWTB 1I4QA 3UE0A 4A93B 1CSPA 3NE5B 2IL8A 4TRDA 3KBXA 2K03A 1XX8A 1OO9B 1XXGA 1EY0A 2DY7A 4OO1H 2UU9L 2RHSB 1X32A 2JA5H 3HOZB 3KUPA 4IJLA 2F0WA 2JA6H 3U50C 3J7AF 1M8AA 4QY7A 3S24A 3S17B 2KCTA 4DPGA 4JI0L 5C5MA 4DR4Q 1ICFB 2SEBD 3GTMH 2HQLA 5TSSA 3H3VI 3PIP3 2H1EA 1EYCA 4A3MH 3E3XA 1W6JA 3PIOA 1CM9A 3M4YA 1WCMG 2WAQE 4A3IG 3GTKH 1EWHA 3R2TA 4DV2L 4ME3A 4DR2Q 1JOOA 2X6GA 5EBDA 1PTOD 3CXCA 2I0QA 3AB9A 2L4NA 4FF1A 1A2TA 4DUZQ 1SDFA 2UXDL 3MFYA 2K75A 1GHJA 3K81C 4WJWA 1VMPA 3JC66 4BS9A 4IO9A 3T51B 1VQPA 4JI4L 1G291 4PZ6A 3X3NA 3DUZA 4B9XA 3HKZB 4JG2A 3BG3A 3J81L 3HRZC 5D3IB 3L9AX 3PO3B 2XVSA 1YHQA 4GN4B 1U0LA 4B3ML 2BA0A 2R6GA 2SNMA 1R9TB 2NYZD 2UUBL 2EIFA 5IGEA 1RJTA 1A8VA 3A55A 1KNAA 5JVH3 3CCMA 4A3FB 1LT5D 1CA6A 1FVIA 3NPPA 2B2TA 4KY5A 1TWCB 1I4XA 3K6OA 2EE1A 1TWFH 4C3JB 3NTKA 5BN3A 3A5ZB 2YYZA 4OO1I 3TZDA 1VQBA 4JW0A 4OGQC 1SFOH 1VQFA 3HOZH 1EY6A 2HIXA 2E75C 1G8ZD 2DY8A 1Y8PB 1SR3A 1A63A 1Y69U 2L9HA 4C1NI 2JEAI 2VS1A 3P7JA 5M5YH 3PUVA 4HTHA 5JEAH 4RCOA 3CMAA 3Q23A 4YWMA 3OWEB 2EYLA 4NXML 4BBSG 1S5ED 5T1GA 1H9JA 5J39A 1XTCD 1FL0A 2B8FA 5J3BA 3T56B 4AYBB 2X69A 1HNWL 5IIFA 2F0VA 1K83B 2XTIA 2AMCB 4UPAA 2BCOA 5G3LD 4A3DG 3K58A 4KLKA 3TREA 1JORA 1P16A 3KLSA 4H7BA 1EQRA 4L5SA 1JE5A 3MHBA 1PH8A 4QJFA 1J5EL 2PQAA 1VQAA 5JJLA 1EIHA 2RF4A 4P73A 1JC7A 2F0OA 4YHHQ 1I50B 2E2IH 1EY9A 1DCZA 4A3JB 4CDDC 3M3YH 4DF7A 3QO2A 5IODA 4A3JG 4FXDA 1BNZA 4JI5Q 4KN7C 2Q2HA 4A4IA 3PGZA 4HIDA 1PLFA 3HG9A 1PH7A 2A8VA 1EYAA 3I90A 5AJ3Q 4OHJA 4QB4A 3K59A 4LF5L 1YHAA 2I5MX 2B63G 1QCBD 4JV5L 1DM0B 1HRJA 2ES2A 5IT9L 1XJVA 4L5RC 1AE2A 3IFDA 3UI2A 2ENBA 1SYCA 3GTOH 1S5DD 1EY8A 4JI6Q 4DV1Q 3G7LA 2K5QA 5H1SE 1OXSC 4BBRH 4PG3A 2NN6I 3BVGA 1VQ9A 4IFDH 5JOBA 2WV6D 4KKUA 1C48A 3IAYA 2A69D 3M4PA 2CQAA 1FGUA 1Y1WH 1N33L 3D6CA 2YTYA 3PF4A 1G6PA 1QNKA 4OONA 4WJ4A 1Z6HA 5IT9c 5M3FH 2JA8G 3MA2B 5HGTA 1XMQL 1X3FA 5IGBA 1ASZA 2B2WA 1F2YA 1XNRQ 2NVYB 2MP1A 3FHWA 1PTOB 4LNQA 4OL7A 4J8QA 5F2DA 2VZAA 5ISRA 2K05A 4IUQA 3KLWA 3SE0A 1M1KC 1X54A 1FR3A 5BN4A 4KHVA 2K33A 2XWBB 1EIFA 4LF6Q 1TR5A 2NUCA 3A8JE 1E2ZA 4K0KL 3GTJB 2IY5B 1I4RA 4X62Q 3M4OB 4C3HB 1GUOA 1VQKA 5JJZA 4RFBA 1J9OA 2B2UC 2L12A 5M3MB 3N52A 3LWEA 1Q1EA 2B3GA 2ZM6L 3AFQA 1BKBA 1DOKA 4DAYB 2EYMA 1TS2A 1EL0A 4CKBA 2NN6G 1EY7A 3GDEA 2N8NA 5IGGA 4JYAL 3CC2A 3TZUA 3T1HL 5ELNA 1IBLL 3JAMc 2CKZB 4MHEA 3SDZA 1BO0A 1XMOL 5FLMH 2K32A 3J80L 2EY5A 5ELDA 3L7ZC 2XIWA 4ZUIA 1PRTF 4X65Q 3KDFB 1YJWA 1Y8NB 1PZID 1ENAA 2HD3A 1F2MA 1H9RA 3NWSA 4PNYA 1VMCA 3CQZB 4J15A 2R92H 4DR6L 4FVMA 4QQBX 2ALYB 1KAWA 2RCNA 1PH1A 3MAQA 4C3HH 4ZK9B 1K0SA 4PV1C 2FMCA 1SYFA 1HZ9A 4B3SQ 2DNEA 3HOZG 2OTLA 1VQ7A 1OXUA 2MQHA 1OTCA 1XNQL 5J1ZA 4B9WA 5CC4A 5EKKA 1LTLA 3GTQH 2Q2UA 5IYCH 4K2KA 4GKJQ 2BA1A 1PRTD 5FKAC 3BYYB 4BY7H 2NWGA 1ONLA 4MZ9A 1F77A 3R93A 4OIKA 2CCZA 5I4DA 5K5PA 3HP3A 5EPLA 2I46A 3E6ZX 5EGTA 4DV3L 3GTOB 3SGIA 5C4JH 2EYOA 2JA5B 3A8KE 5ELOA 1TQOA 2Q2TA 4ALPA 4PMCA 2O5JC 1NSNS 3RLFA 1RTOA 1K73C 3H3VH 2K5NA 2PCFB 1C8CA 4CKCA 3G4SA 3S2DH 4JI3Q 1E1OA 4AQYL 2R7ZG 3KJOA 1C7YA 4ABNA 1HZCA 4JI8Q 2KJXA 2CWAA 1KTKA 5CV5A 1ILPA 3FKIH 2ASBA 4RHRA 3MXNB 4LF9Q 2FJ2A 3EQLC 4IPHA 4EVOA 5GAHC 1Y1WB 4M8AA 2QDBA 3EA6A 4A3LH 1PMRA 3E9HA 1JE4A 2G9DA 1C4QA 1K8OA 1MIUA 2ICEC 2VQFL 4GNXC 2E2JB 4HAEA 1GKHA 2RDGA 4YWLA 5M5XH 3I4MH 1EFID 2KECA 2MPMA 2NZOA 1JOKA 2VUMH 4B3RL 1TKWB 4C56C 1B70B 4P75A 1CHQD 1V1OA 1CUKA 1EQVA 1SNQA 3A54A 1S4ZA 3MFGA 3NK9A 4O0AA 3GTGH 1GJXA 1YNJD 2DGYA 4J1MA 2UXCQ 4WJ3M 1B1ZA 1V8QA 2F0QA 3P1HA 1TWAH 2IX0A 1WVLA 1CHPD 3H0GB 2E74C 3NUCA 4JI0Q 4A93H 1UUPA 4JBKA 4H44C 2WFWA 5GADC 4S3SA 3M9BA 3BYTB 1J8IA 4I7AA 2TSSA 5EKIA 1IYJB 3LX0A 1VQMA 4DV2Q 2B2YC 1HPCA 2YV5A 1CZWA 1I4GA 1UWVA 4LFBQ 1HR0W 4G57A 1CSQA 1IKMA 2Z6BA 3G71A 5CV7A 3PF5A 3AYHB 3GTPH 3H3VC 4MTNA 2XWJB 1EY4A 4DUZL 2UXDQ 1VF7A 5C44B 1LV9A 1HFNA 3ND8A 2AUKA 3W5OA 1F9QA 5IY0A 1QNUA 2N49A 1GHKA 1NE3A 4DV6L 1D7QA 3GTGB 1CKNB 4IQZA 1MGSA 4JI4Q 3U9OA 2DN8A 3H09A 4P72A 4HJ7A 4IPGA 3UDGA 3C2PA 1ZXTA 4JOIA 3I4OA 4JVZA 1TS4A 3QOLA 3W3AA 4K6DA 5ELCA 5CBAE 1TWCH 2C9OA 2M00A 1STBA 2WAQB 5D65A 1KHIA 3S1MH 4GKKQ 2VY3A 1E7ZA 1L1OC 1JR0D 3OPOA 4LK1C 2KEDA 3I4NG 1Y14B 3H0GG 3PO2B 5A35A 1KC8C 3PO3H 2K6AA 4K5WA 1GUWA 1MI2A 4DUYL 3E0EA 1WTPA 4G4KA 2VNUD 3HS0C 4DV7Q 5D14A 2B8GA 4POFA 1KABA 3HKZE 1QB5D 4FXGC 1F2LA 2F1MA 1QJOA 2B2WC 2K14A 3K5MA 1AP0A 4R9WA 1JMCA 3U58A 3ULJA 1DJRD 1PDQA 4EX5A 1PH5A 2NVXH 2KCCA 1BBUA 1YHBA 1DD2A 1JICA 1BF4A 2KOLA 4IUTA 5CYUA 1I4HA 3PUXA 3S14H 3AMUA 4DR5L 4KHZA 3TS2A 4O42A 1U4RA 4IN3A 1HH2P 2YTVA 2B2YA 2F0SA 3EBEA 4HJAA 5AFWA 1B3QA 2FHTA 3H15A 1PYBA 1TXYA 1WOCA 4LJZC 1LTGD 2A6HD 1KDCA 3HKZG 1KDBA 5M5YB 3NBHB 2Y0SG 4F87A 3E0JA 5M9OA 3GTMB 2A74C 1VDZA 4ID6A 1I3QH 1A0IA 3AFPA 3K5LA 1HR0L 4YY3Q 4ZUJA 4NB3A 1N8RC 1J5EQ 1EWCA 5FJ8H 4X3TA 3K7AB 1TWHB 2PZTA 5IP9G 2R7FA 1K8AC 2L5TA 3QJYA 2YTXA 4JI2Q 2PI2A 4JI5L 3T1YL 3HOXB 1JWMD 1YEZA 2BH8A 4ZKBB 3TSSA 3M85A 3DEPA 4RA8A 4GLVB 2B39A 4FNFA 5C0XJ 4A3IB 1D5MC 2EY6A 5AJ3L 5KYLA 4POGA 3HOXH 2PW7A 4WORA 2EOTA 4IPDA 4OX9L 4NW2A 3MXNA 3CC7A 3I55A 3PUZA 4JOIC 4BA1I 5M5XB 3I4MB 1FJGL 3CW2C 2QW7A 4AIMA 1VQHA 2J4XA 2VUMB 4DV0L 5HURA 4DN4M 1KQSA 5FJ8G 3EN2A 1KDAA 3K57A 4OEMB 3VA5A 3FEWX 3EJIA 1JCKB 4MNOA 4A3GG 2UXBL 1L1OA 2EJFC 2F0GA 4V190 1QVFA 1K8GA 3SVMA 5IP7G 2NVYH 2KQ3A 4R4OA 1NUCA 2MO1A 1TWGB 3S16B 4BXXG 1QVCA 3DWAA 1VQJA 4A3BB 5EPKA 2OWOA 3Q24A 5C4JB 1B7YB 3ULPA 1FNWA 2FXQA 4CJ0B 3M7GA 1QUQA 4A3EH 5KNCA 3DWPA 1DZ1A 4DA2A 4EQ5A 3ND9A 1O80A 1V9PA 4BY7B 5C44G 3TP6A 4JI1Q 4C3HG 1NBWA 5CORA 1PYSB 3GTQB 4A3EB 3ONAB 1SSOA 3KLSX 1I50H 3RN2A 4LF6L 1GOZA 1PZJD 4AYBG 1IYVA 2CWPA 1C9OA 2XRQD 2A6ED 3MXUA 1EOVA 3UDXA 3J7ZC 4BXXH 3HOVB 2R7DA 1X9NA 3PV0A 2V1CC 1VQCA 1LM0A 1WTWA 4KHPQ 4MTKA 3R3OA 1E2VA 1MSHA 3QG1A 5IYDG 4BY1B 5C3XA 4IFDJ 1BXTA 1Z7TA 3F8TA 4BBSB 2PZUA 4DAVA 1HA6A 2Y0SE 4JYAQ 2E8GA 3T4AC 4OWWB 3S1RB 2JJQA 3J81j 1EYDA 3STBC 2LKVA 1IBLQ 2BDNA 4DFAA 1RF2D 1N36Q 1CQVA 1SNMA 1B9NA 3NTIA 3TRZA 1V1PB 2AKWB 2CH4W 2RDFA 2HDLA 2E5LL 2XGTA 1XMOQ 3L3OC 1P8LA 3OW2A 2PW5A 4CKEA 3HOWB 4CGYB 2JA8B 3KOJA 2MJ8A 4YCWA 1A2UA 4DU9A 2A69C 2R7ZH 3KF8A 1HTPA 2PMZE 3RLNA 3HZXA 1MSGA 3I70A 2JP1A 2VXWA 4YWKA 3PMFA 5LL6X 4JI7L 2RBMA 4A3KB 1PFBA 3UDIA 3KBGA 3GTJH 3D31A 4RWSC 3OMGA 2F3WA 1XNQQ 2NZHA 3G6EA 4XXEA 3AQQA 1ILQA 3CC4A 4LF8Q 2CW0C 1TWAB 1JWSD 1WD1A 1O7YA 2ZTDA 5LMUL 1WI5A 1HA5A 2OF1A 1T9HA 2EQSA 2XSCA 3KFUA 2D5DA 2JA7H 1V1QA 3K8AA 1KRTA 2EY2A 1SE8A 3D6WA 4XT3B 5JAVA 4DV3Q 4CDCC 2K7VA 2HCIA 1T5XD 5D3DA 4XQQA 5CV4A 5J22A 1F9PA 2NBFA 2O2LD 4FO2A 2VB3X 2Z8LA 1CZGA 4DR7L 1Q86C 5HGQA 4B3MQ 1PHJA 1DONA 3RZDB 1WCMB 4RGMA 4L5QA 1HNXQ 1RKNA 3CMEA 3HOUG 3D3RA 4A3LG 2PO4A 1VQ4A 3S16H 1D5ZC 2UUAQ 2RQXA 1B53A 1EEID 3K5OA 4LF9L 2IT1A 1EZ8A 4QF4A 5DM63 5M3MH 1D8LA 1Q7YC 2PPBC 3TMEA 3J81c 1EWIA 1L0YB 2VQFQ 1QVGA 4LF4L 1HZAA 2JE6I 3BZKA 5FLXc 5BR8Q 1O7ZA 4KTAA 1CK1A 2E2IB 2N78A 1ICWA 4F7XA 4X3KA 3QOJA 5IP9H 1EIYB 3F1ZA 4ZKCB 2JEBI 1BUVT 1XYIA 4RHSA 4U673 1Q12A 1L0WA 2ZJRA 3G6JB 3FPPA 2IPKD 3M4QA 4RGNA 1VQLA 1NJIC 3I72A 5M5WH 4CDEC 5IGFA 2R3ZA 3HKSA 3HOYH 2PYKA 3FRPB 4KKTA 1SNOA 1AEXA 5IGDA 1SNDA 2IX3A 4LFBL 4HR7B 2N3SA 1ENCA 4QMGA 3C46A 4DR3L 4HMJA 1R4QB 4LF7L 4V0BA 2L1BA 3BS1A 1KNEA 2RSNA 4K14A 3TDQA 1YVCA 1ZEQX 1SEBD 1Y1WG 1YBYA 3NTHA 5IYBH 2AWNA 1E22A 5I9OA 4XTCS 3S15B 4FF2A 3GTLB 2K28A 1PRTC 1U4MA 5ELFA 3TP8A 1EZ6A 2X6LA 3TQYA 2PNHA 1RHPA 4DK0A 4DR1L 4IZ8A 4LF5Q 5C6AA 4JV5Q 4BBRG 4CHTB 1VQGA 1BQQT 3NXWA 2MUYA 4LUVA 3J7AV 3J7A5 3DHQA 2OT2A 4DAMA 3H0GH 1HTLD 4EGVA 1GUTA 3C1EA 1BCPD 1UEBA 4I7ZC 1CKOA 4RKBA 3HOYB 4RAUC 4EQPA 1AN8A 3VR4A 5M3FG 2JA8H 3OW7A 1D1KA 3TP5A 3CPFA 3IL8A 3OTOL 3KYHC 5LMNL 1YIJA 2VQEL 1SN8A 5I6WA 2CH4A 4DUYQ 1F9RA 5FO8B 5KYIA 3FKIB 2F4VQ 4IJHA 4O1NA 4APVA 1N33Q 3AEVA 1PTOH 1AFPA 1CI3M 1CTMA 4H0LC 2LS01 4DXFA 3W1BA 1PFNA 3CCRA 3NSWA 1S5CD 3GP7A 3NBHA 4XIGS 3DLLA 1XMQQ 1VCIA 1N9WA 3VDYA 3KF6B 1XNRL 1HQRD 2NTTA 1BCPB 4LUOA 4UP8A 4HEDA 4XDXA 1YNND 3CCEA 2RSOA 3GO5A 3S2DB 2EXZA 5KIXA 2WKDA 1SMYD 3HFZB 5KNDA 2B2UA 3DWQA 5T1IA 3KDFA 4X62L 1IW7D 4KJOA 1WTVA 4BBRB 4FF3A 2JXMB 1PTOF 4QCLA 4DAYA 4NXNQ 5C4HA 1E1TA 1SXTA 4R4IA 3S2HB 3H6MA 2ZM6Q 3GTKB 2JA7G 2B29A 1RODA 5K36G 4K8IA 1I5FA 3Q22A 3HGBA 3ZJYC 4TSSA 4NPSA 3UDFA 1JJ2A 2L0CA 5DEHA 4JI2L 1DYQA 1H95A 3MXPA 4YCVA 4HSPA 3T1YQ 3T1HQ 2NZ1D 3MC0B 4RCNA 2Z4HA 4DAPA 4X3SA 4OO1G 1LTAD 4K8JA 5I2YA 3S17H 2ZJQA 1Y8OB 2KCMA 3VYRA 5A2QL 1MHWC 5GROA 1PA6A 4OX9Q 4K6LA 1ET6A 3FP9A 5I9PA 1TS5A 2EYPA 4A3FG 3PIO3 1BR9A 1TWFB 4A3MG 1U5KA 1NNXA 1KIXA 2DUDA 1IL2A 3S1QH 2M2LA 3NP8A 1SLJA 5KGUA 2IHEA 1QUQB 2NVXB 1SNCA 4P2CB 4X66L 1LACA 4DKAC 3TBIB 3S1QB 4JBJA 4JBMA 2RA4A 3CD6A 5KNBA 3CRKC 3O13A 4KY7A 4E6IA 1H9KA 4XYOA 3S1RH 1SE3A 3FKIG 1TWHH 4R8NA 2E2HB 3GTLH 2UUCL 1IL8A 3DXJC 3EFXD 1SYGA 2A6HC 3VR5A 5FLXE 1U4LA 1TY2A 3E9IA 4A3GB 5CR3A 2F0JA 1SFOB 2Z6KA 2MNAA 5FOBB 5DAUA 4B08A 4A3CG 2LXJA 4FXKC 1PTOC 5I6YA 2I5LX 4HIMA 2NB0A 1FNUA 1LTSD 5ELBA 2F0DA 1SYBA 5C3WA 2HDMA 2A68D 1SJED 2EXDA 2BDOA 5CV6A 1QZHA 2CFMA 5JJKA 3NEMA 5GQOA 3A0JA 3CF5A 1FYCA 2TMPA 5G3LF 3JAMi 2F0TA 3I4MG 4KHPL 4A93G 3VYTA 4A3MB 1RCVD 2NVQH 3A56A 5KRUA 2JYOA 2EVBA 2IHFA 1PVOA 1ASYA 4N9TA 3H91A 3KLRA 1N32L 2A6EC 3CCVA 4LWCA 2GVBA 1HUNA 1V43A 1RTNA 3N6RA 2WKCA 5GAEC 2LMCB 5C3EH 4IUPA 4Q5VA 3SK5A 3VR6A 5JVG3 3HOXG 1EOTA 1TS3A 4KN4C 3RN5A 4BY1H 4HIKA 1K0RA 3QIAA 4GN5A 3I56A 5L37A 1HFGA 2C5CA 3I73A 3S9WA 4IFDI 2SOBA 1IZ6A 1UEAB 3OHXC 1SMYC 1VF5C 4UP9A 3Q8DA 1AZQA 4MIUA 4QIWB 1NCVA 3TN2A 4BWGB 3WOFA 2UXCL 1QG7A 4JI7Q 1Q8KA 3SK8A 4L5TA 1SE4A 4IUVA 2LXKA 2JA6G 3CPWA 5NUCA 3W2DA 4TVAB 5M3MG 4JK1C 4IURA 2NVQB 3W1GA 1YNXA 3CKIB 1JB3A 3HOVH 2NVTB 1STEA 1UE5A 4H02A 3T16A 1WFQA 4R1JA 4B3TL 3NBIA 3X3MA 3I7FA 3ERQA 4ZYSA 4R4TA 2EJMA 1XWEA 2EZVA 1LLRD 1PXUA 4ZLTF 5CBEE 3KF6A 2AQ3B 2F0NA 5CV8A 4N9PA 2B2VC 4L8JA 5LMUQ 3FVQA 1SE2A 1WTHA 3BDOA 4R4CA 1K3BC 1GO3E 1TU2B 5JEAJ 3GD7A 1PH3A 1G91A 3JAME 4NMZA 3MEHA 1IXRA 3D0FA 4RGOS 1CA5A 1YNJC 2HHHQ 2KCNA 1LT6D 2XN9C 3HOUH 3HOVG 3E5SA 1EIGA 2K5HA 4Q0FA 2A68C 4DR7Q 4IUUA 1HNZL 1PYWD 2A1AA 2AUJD 4X3UA 3FMCA 4LFCQ 2LSSA 4GKKL 4IOAA 1A3TA 3OWFA 2PMZB 3K80C 3HOUB 2FINB 2Z1CA 3L0OA 3RMHA 3BZDB 1ZYRD 2K5WA 1L0XB 1B44D 4C2MB 3SHLA 2UUAL 1I3QB 4KY6A 3U4VA 3RNUA 1A62A 1EQQA 3CU7A 1X56A 2D0PA 3S1NB 5LMNW 5DM73 4G7HC 2L11A 4DXGA 2FFKB 3P75A 3DM1A 4UP7A 2MO0A 2I5HA 1R9TH 3GV6A 1TT2A 4DNRB 1E24A 1J6QA 2DJGC 1E0BA 4FYDA 2JQOA 5IE8A 3BDLA 1YZ6A 5BR8L 4A3FH 1O78A 4IUNA 2KUMA 1EU3A 2CVRA 3D4RA 3MXGA 3GV3A 1BCPF 1IHZA 5FO9B 3ERSX 4X64Q 1PFMA 5HY6A 2O4XA 4DK1A 2OTJA 3HOYG 4QIWE 3VYUA 2NVTH 1ZYRC 2JA9A 4C1NK 2AQ1B 2L55A 2ZTCA 5E7NA 3VA7A 5E1FA 4DR5Q 4RMFA 3A7LA 5FLMG 1WTRA 4CDFC 1JJCB 4LFAQ 1JWUD 2R93G 2BE5D 1MKHA 4G7ZC 4IALA 3CP0A 1EUJA 2F0FA 1L2FA 1LO5D 2YU9H 4DR2L 3PIPA 3I3CA 2MFIA 4FDBA 2BH2A 4YY3L 1JB7A 3WOEA 4A3IH 1Q81C 2K52A 2EYJA 4DR3Q 1M90C 1XPUA 2O5IC 1PH9A 1LTID 3OIQA 1NMFA 3CRLC 3TS0A 1XPOA 1WCMH 3DEOA 5IWAL 1I94Q 5C0XI 2HT1A 5EPJA 1TVXA 1GXDC 4OELB 1DXMA 2C35B 1X65A 1X6OA 3MEFA 4F8MA 3IFTA 3D4WA 3VR3A 1IBMQ 3CCLA 2JA7B 1NR4A 2JK8A 1I4PA 3J80c 1CKMA 2KBNA 4RH6A 4DR1Q 5EAYA 4QUFA 2A5HA 5JJIA 2JA6B 4Z9CB 1EU4A 4RKLA 2CHBD 3OYYA 2PQAB 2B63H 3RZOH 2KHIA 1KLUD 1B50A 1FJGQ 1SBBB 1W6KA 2RCFA 2F0EA 3NENA 3OSOA 4KD4A 2IWHA 1G2TA 1WTQA 1PV4A 1LABA 3T53B 1SJHD 3RLOA 1B4OA 5IP7H 1UE1A 2V4DA 5LMNQ 1OXXK 3I91A 1QILA 3CAMA 3I4NH 3BZCA 3CCJA 2UXBQ 1VS0A 4U68A 1MBYA 1GUNA 2SDFA 2F4VL 4XT1B 3KJPA 2QF7A 3UE1A 4FP5D 1KLGD 1GM5A 1U4PA 4OIJA 1LT4D 2B2TC 2EY1A 3S14B 5M5WB 2A19A 2F0PA 3LNNA 5FO7B 2G5DA 3R2IA 2PI2E 1X3PA 3CHBD 4P71A 4AH6A 4NXMQ 4HJ9A 4UHVA 1SNPA 1A3UA 3K0YA 1HCZA 5I2XA 1GUGA 1A3VA 4HCSA 4LMQD 2ZXPA 1NAPA 2I07B 1HNWQ 2N55A 3CCSA 2P5ZX 3P20A 2K5DA 1LYLA 2HUGA 3K7AH 3Q6SA 4ME5A 4A3KG 4KK7A 3RUZA 1VQ5A 1TIID 4LUZA 1S40A 1WD0A 1LUZA 4XQNA 1VQEA 1Q46A 3LGJA 4O2DA 2XRSD 5LL6S 5E4XA 4TQUS 4ZRZA 2QGQA 5C5LA 1DGSA 1UE6A 4XYQA 3CCUA 4JCVE 2E5LQ 3GTPB 4KI0A 4NDXA 5KEEA 5CGKA 1HHVA 2Z4IA 3ULLA 4GOPB 1Z9FA 3URYA 1UNSA 1HJPA 1I6VC 1YITA 2N88A 3TEHB 4DV1L 4GN3B 3BJUA 4GLXA 4A3DH 1CQFA 2K1BA 1STGA 4A3BH 1FNVA 1Y1VH 1LTRD 1B2TA 1K83H 5IOCA 3SK6A 1QZGA 1K28A 1STYA 5FK9C 1O7LA 2ATWA 2H5XA 1XTDA 2BE5C 2D62A 5C3EG 1S5FD 2DNCA 2QA4A 4A3JH 3M3YB 1U9RA 4BY7G 2D9UA 4LF8L 3U9SA 3K5NA 2KHJA 4L63B 4FF4A 3QR8A 2BOSA 3EIVA 4HCEA 1RD9D 1VQNA 2AWOA 3FDTA 4I65A 2WP8J 4GNXA 1C0AA 3PQIA 1JT8A 3PO2G 1K9MC 2E2HH 1JOQA 4LW1A 3VYSA 3PUYA 2JN4A 1EY5A 5EQ0A 2HIVA 3F2CA 4UY8C 4GLAC 2XNAC 2IW3A 4R8IA 2KEEA 3J81i 3KF8B 4DV4L 1IBKQ 3MWYW 3NELA 1FD7D 2OEOA 3EROA 1HNXL 3S15H 2WINB 1N34Q 2IX1A 2ICIA 5EKLA 1G6ZA 1N32Q 1EEFD 2K5VA 3CCQA 1CT1D 3NWTA 1PRTB 4UAIA 3RZOB 5JPNC 1H9SA 2F0IA 1OXTA 2Q8RE 4PZ7A 1ENFA 2K4KA 4GOPA 4DV5Q 4KJNA 2KENA 1S3OA 3AU7A 3OMCA 4LF4Q 2ZTEA 1UAPA 3U4ZA 4K2LA 4X65L 3EVQA 4CBVA 5ELEA 4KKSA 3DMUA 5K36H 2UU9Q 2EDGA 3ER0A 3QB3A 2QEJC 1GD7A 4C3JH 2OQ0A 1VQIA 1UE7A 2F0KA 3MTSA 3SK4A 4DR4L 1K3RA 1PFSA 3GQBA 4X6AH 1M4VA 4NP5A 3WWVA 1BBWA 2WB1E 4B3SL 3S1MB 4DNIA 1B3AA 3V2TA 4KMUC 2QKIC 2QDLA 1VQ8A 2F4IA 3OOCA 4ZAIA 2R61A 2Q8TA 1HQMC 4H13C 1MD2D 4GKJL 2VB2X 3STBD 4MN3A 4Y52H 1TWGH 1HXYD 4LF7Q 1II3A 4OXPA 4QL5A 3RZDH 1A6XA 4C3JG 2HQEA 3IKJA 1IYUA 1LTBD 1G51A 3TP7A 1SAPA 2RDHA 2R7ZB 1PZKD 4IFDG 1B9MA 4L6TB 1LT3D 1SYEA 2HHHL 1BDOA 2PZWA 4N8X1 2K04A 3C1FA 1PH2A 4A3KH 1I6HB 1STAA 1HNZQ 1FGBD 3LWUA 4YIJA 4G7OC 4PZ8A 5C0XG 4JI3L 2F3VA 3A74A 2CQOA 4LFCL 1NR2A 3RR5A 4JI8L 2UUBQ 1SMXA 2ZT9C 2J7ZA 1D2BA 3OTOQ 1YI2A 4KD3A 2F0MA 2F3IA 4QUCA 2VQEQ 4JBWA 5EJWA 2ZXRA 3A8IE 1F9SA 4C3IB 5C4XG 2IJ0A 1WTOA 3C3LA 1KAAA 4ILWA 3H94A 4B3RQ 3NHHA 2PQEA 1IW7C 4IOCA 3A7AB 1Q1BA 1QWYA 2F0UA 1GUSA 1KXLA 4WRDA 4X64L 1X3QA 5COYA 3HOWH 1Q90A
chains in the Genus database with same CATH topology
5IYDG 5H1SE 1OXSC 4R4CA 2VUMG 4IFDJ 4BBRH 2E2JH 4PG3A 4R4QA 3F8TA 1GO3E 2NN6I 5JEAJ 2QEXA 1VQ9A 3GD7A 2Y0SE 1PH3A 4JYAQ 2E8GA 4AYBE 4OWWB 1IXRA 3D0FA 2JJQA 3PSIA 3J81j 3M4OH 3STBC 1IBLQ 1N36Q 3M4PA 2HHHQ 4LFAL 1VQDA 1VQ6A 3TRZA 4BBSH 2AKWB 1FGUA 1Y1WH 4IPCA 2E5LL 2YTYA 2XGTA 1N33L 4DK6C 1X55A 3HOUH 4OONA 3HOVG 1XMOQ 5JEAG 3OW2A 1P8LA 2K5HA 4WJ4A 4DR7Q 5IT9c 1HNZL 5M3FH 4NXNL 3KOJA 2JA8G 4YCUA 4A75A 4YCWA 2A1AA 2VL6A 3L2PA 1XMQL 4LFCQ 1X3FA 2LSSA 4GKKL 4IOAA 4A76A 2R7ZH 3K80C 1W3SA 2PMZE 3RLNA 3L0OA 1Y1VG 1ASZA 1Q82C 4YWKA 3A5UA 3BU2A 2UUAL 4JI7L 4YHHL 1XNRQ 3FHWA 1BVSA 2GN5A 4LNQA 3U4VA 3RNUA 1A62A 2D0OA 3UDIA 2VZAA 5IWAQ 3GTJH 1EQQA 1X56A 2D0PA 3D31A 4DV6Q 1I94L 1S72A 4JC0A 5LMNW 3KLWA 1M1KC 1GVPA 1X54A 4BA2I 1IBML 2OCEA 2ZJPA 5IYBG 1EIFA 4LF6Q 4UP7A 2MO0A 2I5HA 1R9TH 2NZHA 1XNQQ 3G6EA 4K0KL 3PF4A 1Z47A 2IY5B 4X62Q 1E3PA 1E24A 1J6QA 3AQQA 1PH4A 2JQOA 5IE8A 1YZ6A 5BR8L 4A3FH 3CC4A 4LF8Q 1VQKA 4JI6L 4X64Q 3ERSX 1Q1EA 2B3GA 2ZTDA 5IYCG 5HY6A 2ZM6L 3AFQA 1BKBA 1WI5A 2F52A 4DAYB 1T9HA 5LMUL 4QIWE 3HOYG 2OTJA 2EQSA 2NVTH 3F2BA 3KFUA 2JA7H 2JA9A 1HZBA 1V1QA 3K8AA 1KRTA 2NN6G 2ZTCA 1SE8A 3GDEA 5E7NA 4DV3Q 2N8NA 4DR5Q 4JYAL 2ID0A 3CC2A 4RMFA 5FLMG 4X66Q 4HJ5A 3T1HL 3DM3A 5ELNA 1IBLL 1JJCB 2OQKA 3JAMc 2CKZB 4DV7L 4C2MH 4LFAQ 2R93G 2Q2IA 4A3GH 1CKNA 1MKHA 1WJJA 2AHOB 2Z0SA 3CP0A 5FLMH 4OWXB 1XMOL 1EUJA 4DR7L 1L2FA 3HOWG 1Q86C 2YU9H 3L7ZC 5HGQA 4DR2L 2L15A 4X65Q 3KDFB 1PHJA 2UUCQ 1YJWA 4B3MQ 1JJGA 3PIPA 4FDBA 2MFIA 4L5QA 1HNXQ 2BH2A 4Y7NH 4YY3L 3CMEA 4J15A 4A3IH 1Q81C 1JB7A 2R92H 3HOUG 2K52A 2ALYB 4DR6L 4QQBX 4DR3Q 1M90C 1VQ4A 1XPUA 3S16H 4HJ8A 1PH9A 4PMWA 2UUAQ 4GS3A 4LF9L 1KAWA 1NMFA 1XPOA 3TS0A 1WCMH 2K50A 2RCNA 1PH1A 1MJEA 4C3HH 2IT1A 4HIOA 5IWAL 1RL2A 3CQZH 1I94Q 5M3MH 1D8LA 4BY1G 2WAQG 5C0XI 2HT1A 1Q7YC 1HZ9A 3J81c 2R93H 5C44H 4B3SQ 2C35B 1IBMQ 1EWIA 1X6OA 1X65A 3MEFA 2VQFQ 1QVGA 5GAGC 2OTLA 1VQ7A 3CCLA 1OXUA 2JK8A 3HOZG 2MQHA 1OTCA 1XNQL 3J80c 4K0KQ 1CKMA 2KBNA 4LF4L 4DR1Q 5EAYA 1HZAA 2JE6I 3BZKA 1YJ9A 5FLXc 5JJIA 5BR8Q 1LTLA 3GTQH 2Q2UA 3I2ZA 5IYCH 2N78A 3F2DA 3OYYA 4GKJQ 2PQAB 2B63H 3RZOH 2KHIA 2BA1A 3S1NH 4BY7H 1HR0Q 5IP9H 4MZ9A 1FJGQ 1EIYB 3F1ZA 2JEBI 2CCZA 3NENA 4GOPC 1X3EA 1PV4A 3RLOA 4DK3C 5IP7H 4DV3L 5IYDH 1L1OB 1Q12A 1UE1A 1L0WA 4P74A 1OXXK 3SGIA 2ZJRA 5LMNQ 5C4JH 3CAMA 1NY4A 3I4NH 3BZCA 3K7UC 5ELOA 3CCJA 2UXBQ 3M4QA 1VS0A 2Q2TA 4ALPA 1B8AA 1VQLA 3J80i 3RLFA 1NJIC 5M5WH 1K73C 2F4VL 3H3VH 2K5NA 4A3BG 3KJPA 2GVAA 3HKSA 3UE1A 3HOYH 1EFWA 1X3GA 1GM5A 1SRUA 3G4SA 3S2DH 4JI3Q 1NTGA 4LFBL 1E1OA 4AQYL 2N3SA 3KJOA 1C7YA 1SROA 2R7ZG 1HZCA 4JI8Q 2A19A 2CWAA 2WB1G 4DR6Q 4DR3L 4QGUA 3FKIH 4P71A 2PI2E 4LF7L 2ASBA 3MXNB 4AH6A 4DV0Q 4LF9Q 4NXMQ 1YVCA 4IPHA 4HJ9A 1AH9A 5GAHC 1Y1WG 3S2HH 2R92G 1YBYA 4A3LH 3E9HA 1EYGA 5IYBH 4GNXB 2AWNA 1E22A 4XTCS 1O7IA 1MIUA 1RIPA 2VQFL 4GNXC 1HNWQ 3CCSA 1GKHA 4YWLA 3TQYA 2PNHA 5M5XH 3I4MH 1LYLA 4B3TQ 4DR1L 2NZOA 1W2BA 4LF5Q 3G48A 3PO2H 2RHQB 3B6YA 3K7AH 3PCOB 2VUMH 1VQOA 4BBRG 4JV5Q 4B3RL 1VQGA 4A3KG 1B70B 1VQ5A 4LUVA 4P75A 3J7A5 1CUKA 3M7NA 2Z6KC 4LUZA 4DAMA 3H0GH 1S40A 1WYDA 1LUZA 3PUWA 1VQEA 4O0AA 3GTGH 1Q46A 1UEBA 1CKOA 3LGJA 4O2DA 2DGYA 5DLQE 3IRBA 1NMGA 5M3FG 2JA8H 2UXCQ 4WJ3M 3CPFA 4A3CH 3OTOL 1TWAH 2IX0A 4RG1A 3KYHC 5LMNL 4JI0Q 1YIJA 4A93H 2VQEL 1SN8A 4TQUS 4JI1L 4JBKA 5C4XH 2WFWA 4DUYQ 2QGQA 1DGSA 1KD1C 1UE6A 5GADC 3PO3G 1XPRA 3CCUA 1OXVA 3M9BA 4JCVE 2F4VQ 4IJHA 4APVA 4KI0A 2E5LQ 1N33Q 3AEVA 1YJNA 3ULLA 1IYJB 4A3EG 3W1BA 1VQMA 4DV2Q 4DV4Q 4GOPB 1Z9FA 2YV5A 1IBKL 3CCRA 1UWVA 4LFBQ 1HJPA 4XIGS 3DLLA 4AQYQ 1CSQA 1XMQQ 1HR0W 2JA5G 3G71A 1YITA 3PF5A 3AYHB 3TEHB 3GTPH 4DV1L 4GN3B 4MTNA 3BJUA 1VCIA 4DUZL 2UXDQ 4GLXA 4A3DH 1N9WA 1N34L 1I6HH 3VDYA 4C3IH 1KRSA 3KF6B 1XNRL 3W5OA 4A3BH 1Y1VH 4LUOA 4UP8A 5IY0A 1K83H 2N49A 1NE3A 1QZGA 4DV6L 1AE3A 2VW9A 1MJCA 3CCEA 1KL9A 1PH6A 3GO5A 1D7QA 2ATWA 1CKNB 2H5XA 4JI4Q 4P72A 4HJ7A 3UDGA 3HFZB 4IPGA 1N36L 3ICEA 1XTDA 4JOIA 2D62A 3K0XA 5C3EG 3I4OA 4DV5L 2QA4A 4A3JH 3KDFA 4OWTB 4X62L 3UE0A 1CSPA 1TWCH 4BY7G 4LF8L 4NXNQ 1E1TA 2KHJA 4R4IA 1KHIA 3EIVA 3S1MH 4GKKQ 2UU9L 1VQNA 2VY3A 2ZM6Q 2RHSB 2JA5H 2AWOA 2JA7G 1E7ZA 1L1OC 2B29A 5K36G 4IJLA 1I5FA 2JA6H 3ZJYC 2WP8J 3U50C 4GNXA 1C0AA 4NPSA 3UDFA 1JJ2A 3I4NG 1Y14B 4QY7A 3S24A 3H0GG 2KCTA 4DPGA 4JI0L 1JT8A 4JI2L 3PO2G 1K9MC 4DR4Q 2E2HH 1KC8C 3GTMH 2HQLA 4YCVA 3PO3H 3T1YQ 3T1HQ 4LW1A 4DUYL 3E0EA 3PUYA 3H3VI 1H95A 4A3MH 2VNUD 3PIOA 4DV7Q 2HIVA 4OO1G 3F2CA 4UY8C 4POFA 1WCMG 4GLAC 2WAQE 4A3IG 2ZJQA 3HKZE 3S17H 3GTKH 2KCMA 2K14A 3J81i 3KF8B 4DV2L 4DV4L 4ME3A 1IBKQ 1JMCA 4DR2Q 3U58A 3ULJA 5GROA 1PA6A 4OX9Q 3NELA 3CXCA 2I0QA 4EX5A 1PH5A 3FP9A 4A3FG 1HNXL 2NVXH 4A3LG 3S15H 1BBUA 4DUZQ 4A3MG 1YHBA 1U5KA 2UXDL 1N34Q 2IX1A 2K75A 1KIXA 2DUDA 1IL2A 3S1QH 1SLJA 3K81C 1N32Q 2IHEA 2K5VA 3JC66 3PUXA 3CCQA 3S14H 1QUQB 4DR5L 4IO9A 4KHZA 3TS2A 1HH2P 2YTVA 1VQPA 4X66L 3EBEA 1OXTA 1G291 4HJAA 4JI4L 4PZ6A 3H15A 4DKAC 1PYBA 4PZ7A 1TXYA 1PVOA 1WOCA 2K4KA 4GOPA 3HKZG 4JBJA 4DV5Q 2KENA 1S3OA 4JG2A 4JBMA 3CD6A 4LF4Q 3NBHB 2Y0SG 2ZTEA 3S1RH 3FKIG 1TWHH 4GN4B 1YHQA 1G6PA 3GTLH 3U4ZA 1U0LA 1A0IA 3AFPA 1I3QH 4X65L 2UUCL 2BA0A 4B3ML 2R6GA 2UU9Q 1HR0L 3ER0A 2UUBL 4YY3Q 2EIFA 1GD7A 4NB3A 1N8RC 1J5EQ 1A8VA 5FJ8H 4C3JH 2OQ0A 1VQIA 3CCMA 1UE7A 5IP9G 2R7FA 1K8AC 1FVIA 3E9IA 2Z6KA 2YTXA 4JI2Q 2MNAA 4DR4L 2PI2A 1K3RA 4JI5L 1PFSA 3T1YL 4A3CG 2BH8A 1YEZA 2LXJA 4X6AH 1TWFH 2I5LX 4HIMA 3A5ZB 3WWVA 1BBWA 2WB1E 3M85A 4B3SL 2YYZA 4GLVB 4DNIA 4OO1I 1VQBA 5C0XJ 1SFOH 1VQFA 5AJ3L 3HOZH 2EXDA 2HIXA 1VQ8A 4POGA 3HOXH 1QZHA 2CFMA 5JJKA 1SR3A 1A63A 3NEMA 4IPDA 4OX9L 5GQOA 4GKJL 3A0JA 3CF5A 3STBD 3CC7A 3I55A 3PUZA 3JAMi 4JOIC 3I4MG 4KHPL 4A93G 4BA1I 4Y52H 2JEAI 1FJGL 1TWGH 2VS1A 3CW2C 4AIMA 5M5YH 2NVQH 3PUVA 4LF7Q 1VQHA 3CMAA 4OXPA 2IHFA 4QL5A 4YWMA 4DV0L 1ASYA 3RZDH 1KQSA 4NXML 5FJ8G 3EN2A 1N32L 4BBSG 3CCVA 1G51A 4LWCA 2GVBA 1V43A 1FL0A 5J3BA 4MNOA 5GAEC 4A3GG 2UXBL 4IFDG 5C3EH 1L1OA 1HNWL 2HHHL 1QVFA 1K8GA 5IP7G 2NVYH 2AMCB 2XTIA 3HOXG 1PH2A 4R4OA 4UPAA 3RN5A 2MO1A 4HIKA 1K0RA 4A3KH 4GN5A 4BY1H 4BXXG 1QVCA 3I56A 4A3DG 4KLKA 1HNZQ 3TREA 1VQJA 4PZ8A 1P16A 4JI3L 5C0XG 3A74A 1EQRA 2OWOA 2CQOA 4IFDI 4LFCL 3RR5A 1IZ6A 4L5SA 1B7YB 4JI8L 3ULPA 2UUBQ 1JE5A 1SMXA 4UP9A 1PH8A 3Q8DA 4QJFA 2FXQA 1J5EL 2PQAA 1VQAA 5JJLA 1QUQA 4A3EH 2RF4A 2UXCL 4P73A 4JI7Q 2E2IH 1Q8KA 4YHHQ 3OTOQ 4L5TA 1YI2A 2F3IA 4EQ5A 3M3YH 1V9PA 2LXKA 2VQEQ 5C44G 3CPWA 4A3JG 2JA6G 4JI1Q 4JI5Q 1NBWA 4JBWA 4A4IA 2Q2HA 4TVAB 3PGZA 1PYSB 5M3MG 4HIDA 3W1GA 1YNXA 3HOVH 5C4XG 1PH7A 1I50H 2A8VA 3RN2A 4LF6L 1UE5A 4H02A 5AJ3Q 1WFQA 4R1JA 4AYBG 4B3TL 2CWPA 4LF5L 1C9OA 1YHAA 2I5MX 2B63G 3I7FA 4B3RQ 4JV5L 4R4TA 2ES2A 4IOCA 1EOVA 1XJVA 1Q1BA 1AE2A 3UDXA 3J7ZC 4L5RC 4BXXH 2R7DA 3KF6A 1X9NA 3PV0A 1KXLA 2V1CC 3GTOH 4JI6Q 1VQCA 4DV1Q 1LM0A 4X64L 4KHPQ 5LMUQ 3HOWH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IYD G;  5H1S E;  1OXS C;  4R4C A;  2VUM G;  4IFD J;  4BBR H;  2E2J H;  4PG3 A;  4R4Q A;  3F8T A;  1GO3 E;  2NN6 I;  5JEA J;  2QEX A;  1VQ9 A;  3GD7 A;  2Y0S E;  1PH3 A;  4JYA Q;  2E8G A;  4AYB E;  4OWW B;  1IXR A;  3D0F A;  2JJQ A;  3PSI A;  3J81 j;  3M4O H;  3STB C;  1IBL Q;  1N36 Q;  3M4P A;  2HHH Q;  4LFA L;  1VQD A;  1VQ6 A;  3TRZ A;  4BBS H;  2AKW B;  1FGU A;  1Y1W H;  4IPC A;  2E5L L;  2YTY A;  2XGT A;  1N33 L;  4DK6 C;  1X55 A;  3HOU H;  4OON A;  3HOV G;  1XMO Q;  5JEA G;  3OW2 A;  1P8L A;  2K5H A;  4WJ4 A;  4DR7 Q;  5IT9 c;  1HNZ L;  5M3F H;  4NXN L;  3KOJ A;  2JA8 G;  4YCU A;  4A75 A;  4YCW A;  2A1A A;  2VL6 A;  3L2P A;  1XMQ L;  4LFC Q;  1X3F A;  2LSS A;  4GKK L;  4IOA A;  4A76 A;  2R7Z H;  3K80 C;  1W3S A;  2PMZ E;  3RLN A;  3L0O A;  1Y1V G;  1ASZ A;  1Q82 C;  4YWK A;  3A5U A;  3BU2 A;  2UUA L;  4JI7 L;  4YHH L;  1XNR Q;  3FHW A;  1BVS A;  2GN5 A;  4LNQ A;  3U4V A;  3RNU A;  1A62 A;  2D0O A;  3UDI A;  2VZA A;  5IWA Q;  3GTJ H;  1EQQ A;  1X56 A;  2D0P A;  3D31 A;  4DV6 Q;  1I94 L;  1S72 A;  4JC0 A;  5LMN W;  3KLW A;  1M1K C;  1GVP A;  1X54 A;  4BA2 I;  1IBM L;  2OCE A;  2ZJP A;  5IYB G;  1EIF A;  4LF6 Q;  4UP7 A;  2MO0 A;  2I5H A;  1R9T H;  2NZH A;  1XNQ Q;  3G6E A;  4K0K L;  3PF4 A;  1Z47 A;  2IY5 B;  4X62 Q;  1E3P A;  1E24 A;  1J6Q A;  3AQQ A;  1PH4 A;  2JQO A;  5IE8 A;  1YZ6 A;  5BR8 L;  4A3F H;  3CC4 A;  4LF8 Q;  1VQK A;  4JI6 L;  4X64 Q;  3ERS X;  1Q1E A;  2B3G A;  2ZTD A;  5IYC G;  5HY6 A;  2ZM6 L;  3AFQ A;  1BKB A;  1WI5 A;  2F52 A;  4DAY B;  1T9H A;  5LMU L;  4QIW E;  3HOY G;  2OTJ A;  2EQS A;  2NVT H;  3F2B A;  3KFU A;  2JA7 H;  2JA9 A;  1HZB A;  1V1Q A;  3K8A A;  1KRT A;  2NN6 G;  2ZTC A;  1SE8 A;  3GDE A;  5E7N A;  4DV3 Q;  2N8N A;  4DR5 Q;  4JYA L;  2ID0 A;  3CC2 A;  4RMF A;  5FLM G;  4X66 Q;  4HJ5 A;  3T1H L;  3DM3 A;  5ELN A;  1IBL L;  1JJC B;  2OQK A;  3JAM c;  2CKZ B;  4DV7 L;  4C2M H;  4LFA Q;  2R93 G;  2Q2I A;  4A3G H;  1CKN A;  1MKH A;  1WJJ A;  2AHO B;  2Z0S A;  3CP0 A;  5FLM H;  4OWX B;  1XMO L;  1EUJ A;  4DR7 L;  1L2F A;  3HOW G;  1Q86 C;  2YU9 H;  3L7Z C;  5HGQ A;  4DR2 L;  2L15 A;  4X65 Q;  3KDF B;  1PHJ A;  2UUC Q;  1YJW A;  4B3M Q;  1JJG A;  3PIP A;  4FDB A;  2MFI A;  4L5Q A;  1HNX Q;  2BH2 A;  4Y7N H;  4YY3 L;  3CME A;  4J15 A;  4A3I H;  1Q81 C;  1JB7 A;  2R92 H;  3HOU G;  2K52 A;  2ALY B;  4DR6 L;  4QQB X;  4DR3 Q;  1M90 C;  1VQ4 A;  1XPU A;  3S16 H;  4HJ8 A;  1PH9 A;  4PMW A;  2UUA Q;  4GS3 A;  4LF9 L;  1KAW A;  1NMF A;  1XPO A;  3TS0 A;  1WCM H;  2K50 A;  2RCN A;  1PH1 A;  1MJE A;  4C3H H;  2IT1 A;  4HIO A;  5IWA L;  1RL2 A;  3CQZ H;  1I94 Q;  5M3M H;  1D8L A;  4BY1 G;  2WAQ G;  5C0X I;  2HT1 A;  1Q7Y C;  1HZ9 A;  3J81 c;  2R93 H;  5C44 H;  4B3S Q;  2C35 B;  1IBM Q;  1EWI A;  1X6O A;  1X65 A;  3MEF A;  2VQF Q;  1QVG A;  5GAG C;  2OTL A;  1VQ7 A;  3CCL A;  1OXU A;  2JK8 A;  3HOZ G;  2MQH A;  1OTC A;  1XNQ L;  3J80 c;  4K0K Q;  1CKM A;  2KBN A;  4LF4 L;  4DR1 Q;  5EAY A;  1HZA A;  2JE6 I;  3BZK A;  1YJ9 A;  5FLX c;  5JJI A;  5BR8 Q;  1LTL A;  3GTQ H;  2Q2U A;  3I2Z A;  5IYC H;  2N78 A;  3F2D A;  3OYY A;  4GKJ Q;  2PQA B;  2B63 H;  3RZO H;  2KHI A;  2BA1 A;  3S1N H;  4BY7 H;  1HR0 Q;  5IP9 H;  4MZ9 A;  1FJG Q;  1EIY B;  3F1Z A;  2JEB I;  2CCZ A;  3NEN A;  4GOP C;  1X3E A;  1PV4 A;  3RLO A;  4DK3 C;  5IP7 H;  4DV3 L;  5IYD H;  1L1O B;  1Q12 A;  1UE1 A;  1L0W A;  4P74 A;  1OXX K;  3SGI A;  2ZJR A;  5LMN Q;  5C4J H;  3CAM A;  1NY4 A;  3I4N H;  3BZC A;  3K7U C;  5ELO A;  3CCJ A;  2UXB Q;  3M4Q A;  1VS0 A;  2Q2T A;  4ALP A;  1B8A A;  1VQL A;  3J80 i;  3RLF A;  1NJI C;  5M5W H;  1K73 C;  2F4V L;  3H3V H;  2K5N A;  4A3B G;  3KJP A;  2GVA A;  3HKS A;  3UE1 A;  3HOY H;  1EFW A;  1X3G A;  1GM5 A;  1SRU A;  3G4S A;  3S2D H;  4JI3 Q;  1NTG A;  4LFB L;  1E1O A;  4AQY L;  2N3S A;  3KJO A;  1C7Y A;  1SRO A;  2R7Z G;  1HZC A;  4JI8 Q;  2A19 A;  2CWA A;  2WB1 G;  4DR6 Q;  4DR3 L;  4QGU A;  3FKI H;  4P71 A;  2PI2 E;  4LF7 L;  2ASB A;  3MXN B;  4AH6 A;  4DV0 Q;  4LF9 Q;  4NXM Q;  1YVC A;  4IPH A;  4HJ9 A;  1AH9 A;  5GAH C;  1Y1W G;  3S2H H;  2R92 G;  1YBY A;  4A3L H;  3E9H A;  1EYG A;  5IYB H;  4GNX B;  2AWN A;  1E22 A;  4XTC S;  1O7I A;  1MIU A;  1RIP A;  2VQF L;  4GNX C;  1HNW Q;  3CCS A;  1GKH A;  4YWL A;  3TQY A;  2PNH A;  5M5X H;  3I4M H;  1LYL A;  4B3T Q;  4DR1 L;  2NZO A;  1W2B A;  4LF5 Q;  3G48 A;  3PO2 H;  2RHQ B;  3B6Y A;  3K7A H;  3PCO B;  2VUM H;  1VQO A;  4BBR G;  4JV5 Q;  4B3R L;  1VQG A;  4A3K G;  1B70 B;  1VQ5 A;  4LUV A;  4P75 A;  3J7A 5;  1CUK A;  3M7N A;  2Z6K C;  4LUZ A;  4DAM A;  3H0G H;  1S40 A;  1WYD A;  1LUZ A;  3PUW A;  1VQE A;  4O0A A;  3GTG H;  1Q46 A;  1UEB A;  1CKO A;  3LGJ A;  4O2D A;  2DGY A;  5DLQ E;  3IRB A;  1NMG A;  5M3F G;  2JA8 H;  2UXC Q;  4WJ3 M;  3CPF A;  4A3C H;  3OTO L;  1TWA H;  2IX0 A;  4RG1 A;  3KYH C;  5LMN L;  4JI0 Q;  1YIJ A;  4A93 H;  2VQE L;  1SN8 A;  4TQU S;  4JI1 L;  4JBK A;  5C4X H;  2WFW A;  4DUY Q;  2QGQ A;  1DGS A;  1KD1 C;  1UE6 A;  5GAD C;  3PO3 G;  1XPR A;  3CCU A;  1OXV A;  3M9B A;  4JCV E;  2F4V Q;  4IJH A;  4APV A;  4KI0 A;  2E5L Q;  1N33 Q;  3AEV A;  1YJN A;  3ULL A;  1IYJ B;  4A3E G;  3W1B A;  1VQM A;  4DV2 Q;  4DV4 Q;  4GOP B;  1Z9F A;  2YV5 A;  1IBK L;  3CCR A;  1UWV A;  4LFB Q;  1HJP A;  4XIG S;  3DLL A;  4AQY Q;  1CSQ A;  1XMQ Q;  1HR0 W;  2JA5 G;  3G71 A;  1YIT A;  3PF5 A;  3AYH B;  3TEH B;  3GTP H;  4DV1 L;  4GN3 B;  4MTN A;  3BJU A;  1VCI A;  4DUZ L;  2UXD Q;  4GLX A;  4A3D H;  1N9W A;  1N34 L;  1I6H H;  3VDY A;  4C3I H;  1KRS A;  3KF6 B;  1XNR L;  3W5O A;  4A3B H;  1Y1V H;  4LUO A;  4UP8 A;  5IY0 A;  1K83 H;  2N49 A;  1NE3 A;  1QZG A;  4DV6 L;  1AE3 A;  2VW9 A;  1MJC A;  3CCE A;  1KL9 A;  1PH6 A;  3GO5 A;  1D7Q A;  2ATW A;  1CKN B;  2H5X A;  4JI4 Q;  4P72 A;  4HJ7 A;  3UDG A;  3HFZ B;  4IPG A;  1N36 L;  3ICE A;  1XTD A;  4JOI A;  2D62 A;  3K0X A;  5C3E G;  3I4O A;  4DV5 L;  2QA4 A;  4A3J H;  3KDF A;  4OWT B;  4X62 L;  3UE0 A;  1CSP A;  1TWC H;  4BY7 G;  4LF8 L;  4NXN Q;  1E1T A;  2KHJ A;  4R4I A;  1KHI A;  3EIV A;  3S1M H;  4GKK Q;  2UU9 L;  1VQN A;  2VY3 A;  2ZM6 Q;  2RHS B;  2JA5 H;  2AWO A;  2JA7 G;  1E7Z A;  1L1O C;  2B29 A;  5K36 G;  4IJL A;  1I5F A;  2JA6 H;  3ZJY C;  2WP8 J;  3U50 C;  4GNX A;  1C0A A;  4NPS A;  3UDF A;  1JJ2 A;  3I4N G;  1Y14 B;  4QY7 A;  3S24 A;  3H0G G;  2KCT A;  4DPG A;  4JI0 L;  1JT8 A;  4JI2 L;  3PO2 G;  1K9M C;  4DR4 Q;  2E2H H;  1KC8 C;  3GTM H;  2HQL A;  4YCV A;  3PO3 H;  3T1Y Q;  3T1H Q;  4LW1 A;  4DUY L;  3E0E A;  3PUY A;  3H3V I;  1H95 A;  4A3M H;  2VNU D;  3PIO A;  4DV7 Q;  2HIV A;  4OO1 G;  3F2C A;  4UY8 C;  4POF A;  1WCM G;  4GLA C;  2WAQ E;  4A3I G;  2ZJQ A;  3HKZ E;  3S17 H;  3GTK H;  2KCM A;  2K14 A;  3J81 i;  3KF8 B;  4DV2 L;  4DV4 L;  4ME3 A;  1IBK Q;  1JMC A;  4DR2 Q;  3U58 A;  3ULJ A;  5GRO A;  1PA6 A;  4OX9 Q;  3NEL A;  3CXC A;  2I0Q A;  4EX5 A;  1PH5 A;  3FP9 A;  4A3F G;  1HNX L;  2NVX H;  4A3L G;  3S15 H;  1BBU A;  4DUZ Q;  4A3M G;  1YHB A;  1U5K A;  2UXD L;  1N34 Q;  2IX1 A;  2K75 A;  1KIX A;  2DUD A;  1IL2 A;  3S1Q H;  1SLJ A;  3K81 C;  1N32 Q;  2IHE A;  2K5V A;  3JC6 6;  3PUX A;  3CCQ A;  3S14 H;  1QUQ B;  4DR5 L;  4IO9 A;  4KHZ A;  3TS2 A;  1HH2 P;  2YTV A;  1VQP A;  4X66 L;  3EBE A;  1OXT A;  1G29 1;  4HJA A;  4JI4 L;  4PZ6 A;  3H15 A;  4DKA C;  1PYB A;  4PZ7 A;  1TXY A;  1PVO A;  1WOC A;  2K4K A;  4GOP A;  3HKZ G;  4JBJ A;  4DV5 Q;  2KEN A;  1S3O A;  4JG2 A;  4JBM A;  3CD6 A;  4LF4 Q;  3NBH B;  2Y0S G;  2ZTE A;  3S1R H;  3FKI G;  1TWH H;  4GN4 B;  1YHQ A;  1G6P A;  3GTL H;  3U4Z A;  1U0L A;  1A0I A;  3AFP A;  1I3Q H;  4X65 L;  2UUC L;  2BA0 A;  4B3M L;  2R6G A;  2UU9 Q;  1HR0 L;  3ER0 A;  2UUB L;  4YY3 Q;  2EIF A;  1GD7 A;  4NB3 A;  1N8R C;  1J5E Q;  1A8V A;  5FJ8 H;  4C3J H;  2OQ0 A;  1VQI A;  3CCM A;  1UE7 A;  5IP9 G;  2R7F A;  1K8A C;  1FVI A;  3E9I A;  2Z6K A;  2YTX A;  4JI2 Q;  2MNA A;  4DR4 L;  2PI2 A;  1K3R A;  4JI5 L;  1PFS A;  3T1Y L;  4A3C G;  2BH8 A;  1YEZ A;  2LXJ A;  4X6A H;  1TWF H;  2I5L X;  4HIM A;  3A5Z B;  3WWV A;  1BBW A;  2WB1 E;  3M85 A;  4B3S L;  2YYZ A;  4GLV B;  4DNI A;  4OO1 I;  1VQB A;  5C0X J;  1SFO H;  1VQF A;  5AJ3 L;  3HOZ H;  2EXD A;  2HIX A;  1VQ8 A;  4POG A;  3HOX H;  1QZH A;  2CFM A;  5JJK A;  1SR3 A;  1A63 A;  3NEM A;  4IPD A;  4OX9 L;  5GQO A;  4GKJ L;  3A0J A;  3CF5 A;  3STB D;  3CC7 A;  3I55 A;  3PUZ A;  3JAM i;  4JOI C;  3I4M G;  4KHP L;  4A93 G;  4BA1 I;  4Y52 H;  2JEA I;  1FJG L;  1TWG H;  2VS1 A;  3CW2 C;  4AIM A;  5M5Y H;  2NVQ H;  3PUV A;  4LF7 Q;  1VQH A;  3CMA A;  4OXP A;  2IHF A;  4QL5 A;  4YWM A;  4DV0 L;  1ASY A;  3RZD H;  1KQS A;  4NXM L;  5FJ8 G;  3EN2 A;  1N32 L;  4BBS G;  3CCV A;  1G51 A;  4LWC A;  2GVB A;  1V43 A;  1FL0 A;  5J3B A;  4MNO A;  5GAE C;  4A3G G;  2UXB L;  4IFD G;  5C3E H;  1L1O A;  1HNW L;  2HHH L;  1QVF A;  1K8G A;  5IP7 G;  2NVY H;  2AMC B;  2XTI A;  3HOX G;  1PH2 A;  4R4O A;  4UPA A;  3RN5 A;  2MO1 A;  4HIK A;  1K0R A;  4A3K H;  4GN5 A;  4BY1 H;  4BXX G;  1QVC A;  3I56 A;  4A3D G;  4KLK A;  1HNZ Q;  3TRE A;  1VQJ A;  4PZ8 A;  1P16 A;  4JI3 L;  5C0X G;  3A74 A;  1EQR A;  2OWO A;  2CQO A;  4IFD I;  4LFC L;  3RR5 A;  1IZ6 A;  4L5S A;  1B7Y B;  4JI8 L;  3ULP A;  2UUB Q;  1JE5 A;  1SMX A;  4UP9 A;  1PH8 A;  3Q8D A;  4QJF A;  2FXQ A;  1J5E L;  2PQA A;  1VQA A;  5JJL A;  1QUQ A;  4A3E H;  2RF4 A;  2UXC L;  4P73 A;  4JI7 Q;  2E2I H;  1Q8K A;  4YHH Q;  3OTO Q;  4L5T A;  1YI2 A;  2F3I A;  4EQ5 A;  3M3Y H;  1V9P A;  2LXK A;  2VQE Q;  5C44 G;  3CPW A;  4A3J G;  2JA6 G;  4JI1 Q;  4JI5 Q;  1NBW A;  4JBW A;  4A4I A;  2Q2H A;  4TVA B;  3PGZ A;  1PYS B;  5M3M G;  4HID A;  3W1G A;  1YNX A;  3HOV H;  5C4X G;  1PH7 A;  1I50 H;  2A8V A;  3RN2 A;  4LF6 L;  1UE5 A;  4H02 A;  5AJ3 Q;  1WFQ A;  4R1J A;  4AYB G;  4B3T L;  2CWP A;  4LF5 L;  1C9O A;  1YHA A;  2I5M X;  2B63 G;  3I7F A;  4B3R Q;  4JV5 L;  4R4T A;  2ES2 A;  4IOC A;  1EOV A;  1XJV A;  1Q1B A;  1AE2 A;  3UDX A;  3J7Z C;  4L5R C;  4BXX H;  2R7D A;  3KF6 A;  1X9N A;  3PV0 A;  1KXL A;  2V1C C;  3GTO H;  4JI6 Q;  1VQC A;  4DV1 Q;  1LM0 A;  4X64 L;  4KHP Q;  5LMU Q;  3HOW H; 
#chains in the Genus database with same CATH topology
 1D1I A;  2E76 C;  2VUM G;  2E2J H;  1F2Z A;  4R4Q A;  3BDC A;  2QIL A;  2RVL A;  4HN7 A;  4M1U B;  2QEX A;  2CW0 D;  4AYB E;  1R4P B;  2NN6 H;  3PSI A;  5M3F B;  3M4O H;  3D4D A;  4LFA L;  1VQD A;  4PQX A;  1VQ6 A;  1HUM A;  4BBS H;  2K01 A;  4IPC A;  2FMM A;  4DK6 C;  1X55 A;  2Q8I B;  5JEA G;  2KVM A;  5EBC A;  4NXN L;  4YCU A;  4JPB W;  4A75 A;  2VL6 A;  4EQN A;  3L2P A;  5IT9 E;  3BVZ A;  4A76 A;  3V05 A;  1W3S A;  4EQO A;  1Y1V G;  4CJ2 C;  2LY7 A;  1Q82 C;  3A5U A;  2D2C C;  3BU2 A;  3BVM A;  4YHH L;  1K8M A;  2EYH A;  1WTX A;  1ZKO A;  4DNT B;  1BVS A;  2GN5 A;  1TY0 A;  5E4W C;  4WFN 3;  2D0O A;  5IWA Q;  1D6E C;  3FPU B;  3R8B A;  1I94 L;  4DV6 Q;  1S72 A;  4JC0 A;  1GVP A;  3MVV A;  2EPB A;  5E3F A;  4BA2 I;  1IBM L;  2OCE A;  4LAA A;  4K5V A;  2ZJP A;  5IYB G;  1ESF A;  1QOH A;  5CV9 A;  4HSV A;  1Z47 A;  1E3P A;  4TKO B;  5JPM C;  1PH4 A;  4PMB A;  4JI6 L;  1BBX C;  3NQT A;  1STH A;  5IYC G;  2ZXO A;  3ITP A;  2F52 A;  2HCC A;  3RD4 A;  2KA7 A;  3F2B A;  4NKL A;  1HZB A;  1D5X C;  4Y7N B;  2ID0 A;  3V96 A;  4X66 Q;  3MZ5 A;  4HJ5 A;  3DM3 A;  4J6H A;  1ET9 A;  2OQK A;  5DNF A;  4DV7 L;  4C2M H;  1SYD A;  1H9M A;  1IKL A;  2Q2I A;  4A3G H;  1CKN A;  1STN A;  2AHO B;  1WJJ A;  5A2Q E;  2Z0S A;  3T13 A;  1ESR A;  4OWX B;  3HOW G;  3OIP A;  2UUC Q;  4HMI A;  1YNN C;  2L15 A;  1JJG A;  2M9V A;  4Y7N H;  2J0T D;  5BN5 A;  3SXH A;  2MGS A;  4HJ8 A;  4PMW A;  2Z9H A;  4GS3 A;  2K50 A;  1MJE A;  2OXP A;  2QCP X;  2RKS A;  4HIO A;  1RL2 A;  3CQZ H;  2JSO A;  1ML0 D;  2R92 B;  4BY1 G;  1V1P A;  2WAQ G;  1Q8I A;  3JAM L;  2R93 H;  5C44 H;  3I8Z A;  5GAG C;  4ULL A;  1H9S B;  4K0K Q;  2WB1 B;  3I4N B;  2E2D C;  1YJ9 A;  2H4O A;  2SNS A;  3J80 E;  2R93 B;  1A15 A;  3I2Z A;  3F2D A;  3S1N H;  1HR0 Q;  3F2U A;  3J7Y W;  5FLX L;  1EQT A;  2KHS A;  2GA4 B;  4GOP C;  1X3E A;  4DK3 C;  5IYD H;  1L1O B;  2B63 B;  5C4Z A;  4P74 A;  1NY4 A;  2G9H D;  3K7U C;  1JQY D;  4GZY C;  1T5E A;  1AZP A;  1B8A A;  4A3D B;  3J80 i;  5LHY 1;  2AQ2 B;  4ODG A;  1BCP C;  4A3B G;  2GVA A;  4ZCK A;  4KV6 A;  1EFW A;  1X3G A;  5C0X H;  4N8F A;  1SRU A;  2WAC A;  4RGT A;  1NTG A;  1SRO A;  2LFN A;  2F0H A;  2WB1 G;  5CMD A;  1QE6 A;  2F0L A;  4DR6 Q;  4QGU A;  4DV0 Q;  3SEB A;  3I4L A;  1AH9 A;  4F88 A;  3S2H H;  2R92 G;  2YU9 B;  1EYG A;  4GNX B;  1DOM A;  1O7I A;  3KK7 A;  1RIP A;  3NQI A;  2EJG C;  2F03 A;  2B2V A;  5IGC A;  4B3T Q;  1W2B A;  2A73 B;  3G48 A;  3PO2 H;  2RHQ B;  3B6Y A;  3PCO B;  1VQO A;  4K5X A;  3M7N A;  2Z6K C;  3D8G A;  1WYD A;  2NTS A;  3PUW A;  3Q0A A;  4C3I G;  5C4X B;  1BOS A;  5DLQ E;  3SR1 A;  1G2S A;  1NMG A;  3IRB A;  4A3C H;  4RG1 A;  4DGZ A;  4JI1 L;  5C4X H;  2Y0S B;  1KD1 C;  4UDU C;  3PO3 G;  1XPR A;  1OXV A;  3J81 E;  1YJN A;  2MHV A;  4A3E G;  4DV4 Q;  1IBK L;  1RDP D;  5C3E B;  1AW7 A;  4AQY Q;  2JA5 G;  3ZYY X;  4ZQ3 A;  1S5B D;  1Q3L A;  1N34 L;  1I6H H;  1E2W A;  1CFM A;  1DOL A;  1KRS A;  4C3I H;  3HEJ A;  2PNR C;  4CJ1 B;  4XQJ A;  3VR2 A;  1AE3 A;  1LTT D;  1MJC A;  2VW9 A;  1KL9 A;  3QWN A;  3WDN A;  1PH6 A;  2WII B;  1N36 L;  3ICE A;  2DJF C;  3K0X A;  1Y1V B;  4DV5 L;  2EYF A;  4OWT B;  1I4Q A;  3UE0 A;  4A93 B;  1CSP A;  3NE5 B;  2IL8 A;  4TRD A;  3KBX A;  2K03 A;  1XX8 A;  1OO9 B;  1XXG A;  1EY0 A;  2DY7 A;  4OO1 H;  2UU9 L;  2RHS B;  1X32 A;  2JA5 H;  3HOZ B;  3KUP A;  4IJL A;  2F0W A;  2JA6 H;  3U50 C;  3J7A F;  1M8A A;  4QY7 A;  3S24 A;  3S17 B;  2KCT A;  4DPG A;  4JI0 L;  5C5M A;  4DR4 Q;  1ICF B;  2SEB D;  3GTM H;  2HQL A;  5TSS A;  3H3V I;  3PIP 3;  2H1E A;  1EYC A;  4A3M H;  3E3X A;  1W6J A;  3PIO A;  1CM9 A;  3M4Y A;  1WCM G;  2WAQ E;  4A3I G;  3GTK H;  1EWH A;  3R2T A;  4DV2 L;  4ME3 A;  4DR2 Q;  1JOO A;  2X6G A;  5EBD A;  1PTO D;  3CXC A;  2I0Q A;  3AB9 A;  2L4N A;  4FF1 A;  1A2T A;  4DUZ Q;  1SDF A;  2UXD L;  3MFY A;  2K75 A;  1GHJ A;  3K81 C;  4WJW A;  1VMP A;  3JC6 6;  4BS9 A;  4IO9 A;  3T51 B;  1VQP A;  4JI4 L;  1G29 1;  4PZ6 A;  3X3N A;  3DUZ A;  4B9X A;  3HKZ B;  4JG2 A;  3BG3 A;  3J81 L;  3HRZ C;  5D3I B;  3L9A X;  3PO3 B;  2XVS A;  1YHQ A;  4GN4 B;  1U0L A;  4B3M L;  2BA0 A;  2R6G A;  2SNM A;  1R9T B;  2NYZ D;  2UUB L;  2EIF A;  5IGE A;  1RJT A;  1A8V A;  3A55 A;  1KNA A;  5JVH 3;  3CCM A;  4A3F B;  1LT5 D;  1CA6 A;  1FVI A;  3NPP A;  2B2T A;  4KY5 A;  1TWC B;  1I4X A;  3K6O A;  2EE1 A;  1TWF H;  4C3J B;  3NTK A;  5BN3 A;  3A5Z B;  2YYZ A;  4OO1 I;  3TZD A;  1VQB A;  4JW0 A;  4OGQ C;  1SFO H;  1VQF A;  3HOZ H;  1EY6 A;  2HIX A;  2E75 C;  1G8Z D;  2DY8 A;  1Y8P B;  1SR3 A;  1A63 A;  1Y69 U;  2L9H A;  4C1N I;  2JEA I;  2VS1 A;  3P7J A;  5M5Y H;  3PUV A;  4HTH A;  5JEA H;  4RCO A;  3CMA A;  3Q23 A;  4YWM A;  3OWE B;  2EYL A;  4NXM L;  4BBS G;  1S5E D;  5T1G A;  1H9J A;  5J39 A;  1XTC D;  1FL0 A;  2B8F A;  5J3B A;  3T56 B;  4AYB B;  2X69 A;  1HNW L;  5IIF A;  2F0V A;  1K83 B;  2XTI A;  2AMC B;  4UPA A;  2BCO A;  5G3L D;  4A3D G;  3K58 A;  4KLK A;  3TRE A;  1JOR A;  1P16 A;  3KLS A;  4H7B A;  1EQR A;  4L5S A;  1JE5 A;  3MHB A;  1PH8 A;  4QJF A;  1J5E L;  2PQA A;  1VQA A;  5JJL A;  1EIH A;  2RF4 A;  4P73 A;  1JC7 A;  2F0O A;  4YHH Q;  1I50 B;  2E2I H;  1EY9 A;  1DCZ A;  4A3J B;  4CDD C;  3M3Y H;  4DF7 A;  3QO2 A;  5IOD A;  4A3J G;  4FXD A;  1BNZ A;  4JI5 Q;  4KN7 C;  2Q2H A;  4A4I A;  3PGZ A;  4HID A;  1PLF A;  3HG9 A;  1PH7 A;  2A8V A;  1EYA A;  3I90 A;  5AJ3 Q;  4OHJ A;  4QB4 A;  3K59 A;  4LF5 L;  1YHA A;  2I5M X;  2B63 G;  1QCB D;  4JV5 L;  1DM0 B;  1HRJ A;  2ES2 A;  5IT9 L;  1XJV A;  4L5R C;  1AE2 A;  3IFD A;  3UI2 A;  2ENB A;  1SYC A;  3GTO H;  1S5D D;  1EY8 A;  4JI6 Q;  4DV1 Q;  3G7L A;  2K5Q A;  5H1S E;  1OXS C;  4BBR H;  4PG3 A;  2NN6 I;  3BVG A;  1VQ9 A;  4IFD H;  5JOB A;  2WV6 D;  4KKU A;  1C48 A;  3IAY A;  2A69 D;  3M4P A;  2CQA A;  1FGU A;  1Y1W H;  1N33 L;  3D6C A;  2YTY A;  3PF4 A;  1G6P A;  1QNK A;  4OON A;  4WJ4 A;  1Z6H A;  5IT9 c;  5M3F H;  2JA8 G;  3MA2 B;  5HGT A;  1XMQ L;  1X3F A;  5IGB A;  1ASZ A;  2B2W A;  1F2Y A;  1XNR Q;  2NVY B;  2MP1 A;  3FHW A;  1PTO B;  4LNQ A;  4OL7 A;  4J8Q A;  5F2D A;  2VZA A;  5ISR A;  2K05 A;  4IUQ A;  3KLW A;  3SE0 A;  1M1K C;  1X54 A;  1FR3 A;  5BN4 A;  4KHV A;  2K33 A;  2XWB B;  1EIF A;  4LF6 Q;  1TR5 A;  2NUC A;  3A8J E;  1E2Z A;  4K0K L;  3GTJ B;  2IY5 B;  1I4R A;  4X62 Q;  3M4O B;  4C3H B;  1GUO A;  1VQK A;  5JJZ A;  4RFB A;  1J9O A;  2B2U C;  2L12 A;  5M3M B;  3N52 A;  3LWE A;  1Q1E A;  2B3G A;  2ZM6 L;  3AFQ A;  1BKB A;  1DOK A;  4DAY B;  2EYM A;  1TS2 A;  1EL0 A;  4CKB A;  2NN6 G;  1EY7 A;  3GDE A;  2N8N A;  5IGG A;  4JYA L;  3CC2 A;  3TZU A;  3T1H L;  5ELN A;  1IBL L;  3JAM c;  2CKZ B;  4MHE A;  3SDZ A;  1BO0 A;  1XMO L;  5FLM H;  2K32 A;  3J80 L;  2EY5 A;  5ELD A;  3L7Z C;  2XIW A;  4ZUI A;  1PRT F;  4X65 Q;  3KDF B;  1YJW A;  1Y8N B;  1PZI D;  1ENA A;  2HD3 A;  1F2M A;  1H9R A;  3NWS A;  4PNY A;  1VMC A;  3CQZ B;  4J15 A;  2R92 H;  4DR6 L;  4FVM A;  4QQB X;  2ALY B;  1KAW A;  2RCN A;  1PH1 A;  3MAQ A;  4C3H H;  4ZK9 B;  1K0S A;  4PV1 C;  2FMC A;  1SYF A;  1HZ9 A;  4B3S Q;  2DNE A;  3HOZ G;  2OTL A;  1VQ7 A;  1OXU A;  2MQH A;  1OTC A;  1XNQ L;  5J1Z A;  4B9W A;  5CC4 A;  5EKK A;  1LTL A;  3GTQ H;  2Q2U A;  5IYC H;  4K2K A;  4GKJ Q;  2BA1 A;  1PRT D;  5FKA C;  3BYY B;  4BY7 H;  2NWG A;  1ONL A;  4MZ9 A;  1F77 A;  3R93 A;  4OIK A;  2CCZ A;  5I4D A;  5K5P A;  3HP3 A;  5EPL A;  2I46 A;  3E6Z X;  5EGT A;  4DV3 L;  3GTO B;  3SGI A;  5C4J H;  2EYO A;  2JA5 B;  3A8K E;  5ELO A;  1TQO A;  2Q2T A;  4ALP A;  4PMC A;  2O5J C;  1NSN S;  3RLF A;  1RTO A;  1K73 C;  3H3V H;  2K5N A;  2PCF B;  1C8C A;  4CKC A;  3G4S A;  3S2D H;  4JI3 Q;  1E1O A;  4AQY L;  2R7Z G;  3KJO A;  1C7Y A;  4ABN A;  1HZC A;  4JI8 Q;  2KJX A;  2CWA A;  1KTK A;  5CV5 A;  1ILP A;  3FKI H;  2ASB A;  4RHR A;  3MXN B;  4LF9 Q;  2FJ2 A;  3EQL C;  4IPH A;  4EVO A;  5GAH C;  1Y1W B;  4M8A A;  2QDB A;  3EA6 A;  4A3L H;  1PMR A;  3E9H A;  1JE4 A;  2G9D A;  1C4Q A;  1K8O A;  1MIU A;  2ICE C;  2VQF L;  4GNX C;  2E2J B;  4HAE A;  1GKH A;  2RDG A;  4YWL A;  5M5X H;  3I4M H;  1EFI D;  2KEC A;  2MPM A;  2NZO A;  1JOK A;  2VUM H;  4B3R L;  1TKW B;  4C56 C;  1B70 B;  4P75 A;  1CHQ D;  1V1O A;  1CUK A;  1EQV A;  1SNQ A;  3A54 A;  1S4Z A;  3MFG A;  3NK9 A;  4O0A A;  3GTG H;  1GJX A;  1YNJ D;  2DGY A;  4J1M A;  2UXC Q;  4WJ3 M;  1B1Z A;  1V8Q A;  2F0Q A;  3P1H A;  1TWA H;  2IX0 A;  1WVL A;  1CHP D;  3H0G B;  2E74 C;  3NUC A;  4JI0 Q;  4A93 H;  1UUP A;  4JBK A;  4H44 C;  2WFW A;  5GAD C;  4S3S A;  3M9B A;  3BYT B;  1J8I A;  4I7A A;  2TSS A;  5EKI A;  1IYJ B;  3LX0 A;  1VQM A;  4DV2 Q;  2B2Y C;  1HPC A;  2YV5 A;  1CZW A;  1I4G A;  1UWV A;  4LFB Q;  1HR0 W;  4G57 A;  1CSQ A;  1IKM A;  2Z6B A;  3G71 A;  5CV7 A;  3PF5 A;  3AYH B;  3GTP H;  3H3V C;  4MTN A;  2XWJ B;  1EY4 A;  4DUZ L;  2UXD Q;  1VF7 A;  5C44 B;  1LV9 A;  1HFN A;  3ND8 A;  2AUK A;  3W5O A;  1F9Q A;  5IY0 A;  1QNU A;  2N49 A;  1GHK A;  1NE3 A;  4DV6 L;  1D7Q A;  3GTG B;  1CKN B;  4IQZ A;  1MGS A;  4JI4 Q;  3U9O A;  2DN8 A;  3H09 A;  4P72 A;  4HJ7 A;  4IPG A;  3UDG A;  3C2P A;  1ZXT A;  4JOI A;  3I4O A;  4JVZ A;  1TS4 A;  3QOL A;  3W3A A;  4K6D A;  5ELC A;  5CBA E;  1TWC H;  2C9O A;  2M00 A;  1STB A;  2WAQ B;  5D65 A;  1KHI A;  3S1M H;  4GKK Q;  2VY3 A;  1E7Z A;  1L1O C;  1JR0 D;  3OPO A;  4LK1 C;  2KED A;  3I4N G;  1Y14 B;  3H0G G;  3PO2 B;  5A35 A;  1KC8 C;  3PO3 H;  2K6A A;  4K5W A;  1GUW A;  1MI2 A;  4DUY L;  3E0E A;  1WTP A;  4G4K A;  2VNU D;  3HS0 C;  4DV7 Q;  5D14 A;  2B8G A;  4POF A;  1KAB A;  3HKZ E;  1QB5 D;  4FXG C;  1F2L A;  2F1M A;  1QJO A;  2B2W C;  2K14 A;  3K5M A;  1AP0 A;  4R9W A;  1JMC A;  3U58 A;  3ULJ A;  1DJR D;  1PDQ A;  4EX5 A;  1PH5 A;  2NVX H;  2KCC A;  1BBU A;  1YHB A;  1DD2 A;  1JIC A;  1BF4 A;  2KOL A;  4IUT A;  5CYU A;  1I4H A;  3PUX A;  3S14 H;  3AMU A;  4DR5 L;  4KHZ A;  3TS2 A;  4O42 A;  1U4R A;  4IN3 A;  1HH2 P;  2YTV A;  2B2Y A;  2F0S A;  3EBE A;  4HJA A;  5AFW A;  1B3Q A;  2FHT A;  3H15 A;  1PYB A;  1TXY A;  1WOC A;  4LJZ C;  1LTG D;  2A6H D;  1KDC A;  3HKZ G;  1KDB A;  5M5Y B;  3NBH B;  2Y0S G;  4F87 A;  3E0J A;  5M9O A;  3GTM B;  2A74 C;  1VDZ A;  4ID6 A;  1I3Q H;  1A0I A;  3AFP A;  3K5L A;  1HR0 L;  4YY3 Q;  4ZUJ A;  4NB3 A;  1N8R C;  1J5E Q;  1EWC A;  5FJ8 H;  4X3T A;  3K7A B;  1TWH B;  2PZT A;  5IP9 G;  2R7F A;  1K8A C;  2L5T A;  3QJY A;  2YTX A;  4JI2 Q;  2PI2 A;  4JI5 L;  3T1Y L;  3HOX B;  1JWM D;  1YEZ A;  2BH8 A;  4ZKB B;  3TSS A;  3M85 A;  3DEP A;  4RA8 A;  4GLV B;  2B39 A;  4FNF A;  5C0X J;  4A3I B;  1D5M C;  2EY6 A;  5AJ3 L;  5KYL A;  4POG A;  3HOX H;  2PW7 A;  4WOR A;  2EOT A;  4IPD A;  4OX9 L;  4NW2 A;  3MXN A;  3CC7 A;  3I55 A;  3PUZ A;  4JOI C;  4BA1 I;  5M5X B;  3I4M B;  1FJG L;  3CW2 C;  2QW7 A;  4AIM A;  1VQH A;  2J4X A;  2VUM B;  4DV0 L;  5HUR A;  4DN4 M;  1KQS A;  5FJ8 G;  3EN2 A;  1KDA A;  3K57 A;  4OEM B;  3VA5 A;  3FEW X;  3EJI A;  1JCK B;  4MNO A;  4A3G G;  2UXB L;  1L1O A;  2EJF C;  2F0G A;  4V19 0;  1QVF A;  1K8G A;  3SVM A;  5IP7 G;  2NVY H;  2KQ3 A;  4R4O A;  1NUC A;  2MO1 A;  1TWG B;  3S16 B;  4BXX G;  1QVC A;  3DWA A;  1VQJ A;  4A3B B;  5EPK A;  2OWO A;  3Q24 A;  5C4J B;  1B7Y B;  3ULP A;  1FNW A;  2FXQ A;  4CJ0 B;  3M7G A;  1QUQ A;  4A3E H;  5KNC A;  3DWP A;  1DZ1 A;  4DA2 A;  4EQ5 A;  3ND9 A;  1O80 A;  1V9P A;  4BY7 B;  5C44 G;  3TP6 A;  4JI1 Q;  4C3H G;  1NBW A;  5COR A;  1PYS B;  3GTQ B;  4A3E B;  3ONA B;  1SSO A;  3KLS X;  1I50 H;  3RN2 A;  4LF6 L;  1GOZ A;  1PZJ D;  4AYB G;  1IYV A;  2CWP A;  1C9O A;  2XRQ D;  2A6E D;  3MXU A;  1EOV A;  3UDX A;  3J7Z C;  4BXX H;  3HOV B;  2R7D A;  1X9N A;  3PV0 A;  2V1C C;  1VQC A;  1LM0 A;  1WTW A;  4KHP Q;  4MTK A;  3R3O A;  1E2V A;  1MSH A;  3QG1 A;  5IYD G;  4BY1 B;  5C3X A;  4IFD J;  1BXT A;  1Z7T A;  3F8T A;  4BBS B;  2PZU A;  4DAV A;  1HA6 A;  2Y0S E;  4JYA Q;  2E8G A;  3T4A C;  4OWW B;  3S1R B;  2JJQ A;  3J81 j;  1EYD A;  3STB C;  2LKV A;  1IBL Q;  2BDN A;  4DFA A;  1RF2 D;  1N36 Q;  1CQV A;  1SNM A;  1B9N A;  3NTI A;  3TRZ A;  1V1P B;  2AKW B;  2CH4 W;  2RDF A;  2HDL A;  2E5L L;  2XGT A;  1XMO Q;  3L3O C;  1P8L A;  3OW2 A;  2PW5 A;  4CKE A;  3HOW B;  4CGY B;  2JA8 B;  3KOJ A;  2MJ8 A;  4YCW A;  1A2U A;  4DU9 A;  2A69 C;  2R7Z H;  3KF8 A;  1HTP A;  2PMZ E;  3RLN A;  3HZX A;  1MSG A;  3I70 A;  2JP1 A;  2VXW A;  4YWK A;  3PMF A;  5LL6 X;  4JI7 L;  2RBM A;  4A3K B;  1PFB A;  3UDI A;  3KBG A;  3GTJ H;  3D31 A;  4RWS C;  3OMG A;  2F3W A;  1XNQ Q;  2NZH A;  3G6E A;  4XXE A;  3AQQ A;  1ILQ A;  3CC4 A;  4LF8 Q;  2CW0 C;  1TWA B;  1JWS D;  1WD1 A;  1O7Y A;  2ZTD A;  5LMU L;  1WI5 A;  1HA5 A;  2OF1 A;  1T9H A;  2EQS A;  2XSC A;  3KFU A;  2D5D A;  2JA7 H;  1V1Q A;  3K8A A;  1KRT A;  2EY2 A;  1SE8 A;  3D6W A;  4XT3 B;  5JAV A;  4DV3 Q;  4CDC C;  2K7V A;  2HCI A;  1T5X D;  5D3D A;  4XQQ A;  5CV4 A;  5J22 A;  1F9P A;  2NBF A;  2O2L D;  4FO2 A;  2VB3 X;  2Z8L A;  1CZG A;  4DR7 L;  1Q86 C;  5HGQ A;  4B3M Q;  1PHJ A;  1DON A;  3RZD B;  1WCM B;  4RGM A;  4L5Q A;  1HNX Q;  1RKN A;  3CME A;  3HOU G;  3D3R A;  4A3L G;  2PO4 A;  1VQ4 A;  3S16 H;  1D5Z C;  2UUA Q;  2RQX A;  1B53 A;  1EEI D;  3K5O A;  4LF9 L;  2IT1 A;  1EZ8 A;  4QF4 A;  5DM6 3;  5M3M H;  1D8L A;  1Q7Y C;  2PPB C;  3TME A;  3J81 c;  1EWI A;  1L0Y B;  2VQF Q;  1QVG A;  4LF4 L;  1HZA A;  2JE6 I;  3BZK A;  5FLX c;  5BR8 Q;  1O7Z A;  4KTA A;  1CK1 A;  2E2I B;  2N78 A;  1ICW A;  4F7X A;  4X3K A;  3QOJ A;  5IP9 H;  1EIY B;  3F1Z A;  4ZKC B;  2JEB I;  1BUV T;  1XYI A;  4RHS A;  4U67 3;  1Q12 A;  1L0W A;  2ZJR A;  3G6J B;  3FPP A;  2IPK D;  3M4Q A;  4RGN A;  1VQL A;  1NJI C;  3I72 A;  5M5W H;  4CDE C;  5IGF A;  2R3Z A;  3HKS A;  3HOY H;  2PYK A;  3FRP B;  4KKT A;  1SNO A;  1AEX A;  5IGD A;  1SND A;  2IX3 A;  4LFB L;  4HR7 B;  2N3S A;  1ENC A;  4QMG A;  3C46 A;  4DR3 L;  4HMJ A;  1R4Q B;  4LF7 L;  4V0B A;  2L1B A;  3BS1 A;  1KNE A;  2RSN A;  4K14 A;  3TDQ A;  1YVC A;  1ZEQ X;  1SEB D;  1Y1W G;  1YBY A;  3NTH A;  5IYB H;  2AWN A;  1E22 A;  5I9O A;  4XTC S;  3S15 B;  4FF2 A;  3GTL B;  2K28 A;  1PRT C;  1U4M A;  5ELF A;  3TP8 A;  1EZ6 A;  2X6L A;  3TQY A;  2PNH A;  1RHP A;  4DK0 A;  4DR1 L;  4IZ8 A;  4LF5 Q;  5C6A A;  4JV5 Q;  4BBR G;  4CHT B;  1VQG A;  1BQQ T;  3NXW A;  2MUY A;  4LUV A;  3J7A V;  3J7A 5;  3DHQ A;  2OT2 A;  4DAM A;  3H0G H;  1HTL D;  4EGV A;  1GUT A;  3C1E A;  1BCP D;  1UEB A;  4I7Z C;  1CKO A;  4RKB A;  3HOY B;  4RAU C;  4EQP A;  1AN8 A;  3VR4 A;  5M3F G;  2JA8 H;  3OW7 A;  1D1K A;  3TP5 A;  3CPF A;  3IL8 A;  3OTO L;  3KYH C;  5LMN L;  1YIJ A;  2VQE L;  1SN8 A;  5I6W A;  2CH4 A;  4DUY Q;  1F9R A;  5FO8 B;  5KYI A;  3FKI B;  2F4V Q;  4IJH A;  4O1N A;  4APV A;  1N33 Q;  3AEV A;  1PTO H;  1AFP A;  1CI3 M;  1CTM A;  4H0L C;  2LS0 1;  4DXF A;  3W1B A;  1PFN A;  3CCR A;  3NSW A;  1S5C D;  3GP7 A;  3NBH A;  4XIG S;  3DLL A;  1XMQ Q;  1VCI A;  1N9W A;  3VDY A;  3KF6 B;  1XNR L;  1HQR D;  2NTT A;  1BCP B;  4LUO A;  4UP8 A;  4HED A;  4XDX A;  1YNN D;  3CCE A;  2RSO A;  3GO5 A;  3S2D B;  2EXZ A;  5KIX A;  2WKD A;  1SMY D;  3HFZ B;  5KND A;  2B2U A;  3DWQ A;  5T1I A;  3KDF A;  4X62 L;  1IW7 D;  4KJO A;  1WTV A;  4BBR B;  4FF3 A;  2JXM B;  1PTO F;  4QCL A;  4DAY A;  4NXN Q;  5C4H A;  1E1T A;  1SXT A;  4R4I A;  3S2H B;  3H6M A;  2ZM6 Q;  3GTK B;  2JA7 G;  2B29 A;  1ROD A;  5K36 G;  4K8I A;  1I5F A;  3Q22 A;  3HGB A;  3ZJY C;  4TSS A;  4NPS A;  3UDF A;  1JJ2 A;  2L0C A;  5DEH A;  4JI2 L;  1DYQ A;  1H95 A;  3MXP A;  4YCV A;  4HSP A;  3T1Y Q;  3T1H Q;  2NZ1 D;  3MC0 B;  4RCN A;  2Z4H A;  4DAP A;  4X3S A;  4OO1 G;  1LTA D;  4K8J A;  5I2Y A;  3S17 H;  2ZJQ A;  1Y8O B;  2KCM A;  3VYR A;  5A2Q L;  1MHW C;  5GRO A;  1PA6 A;  4OX9 Q;  4K6L A;  1ET6 A;  3FP9 A;  5I9P A;  1TS5 A;  2EYP A;  4A3F G;  3PIO 3;  1BR9 A;  1TWF B;  4A3M G;  1U5K A;  1NNX A;  1KIX A;  2DUD A;  1IL2 A;  3S1Q H;  2M2L A;  3NP8 A;  1SLJ A;  5KGU A;  2IHE A;  1QUQ B;  2NVX B;  1SNC A;  4P2C B;  4X66 L;  1LAC A;  4DKA C;  3TBI B;  3S1Q B;  4JBJ A;  4JBM A;  2RA4 A;  3CD6 A;  5KNB A;  3CRK C;  3O13 A;  4KY7 A;  4E6I A;  1H9K A;  4XYO A;  3S1R H;  1SE3 A;  3FKI G;  1TWH H;  4R8N A;  2E2H B;  3GTL H;  2UUC L;  1IL8 A;  3DXJ C;  3EFX D;  1SYG A;  2A6H C;  3VR5 A;  5FLX E;  1U4L A;  1TY2 A;  3E9I A;  4A3G B;  5CR3 A;  2F0J A;  1SFO B;  2Z6K A;  2MNA A;  5FOB B;  5DAU A;  4B08 A;  4A3C G;  2LXJ A;  4FXK C;  1PTO C;  5I6Y A;  2I5L X;  4HIM A;  2NB0 A;  1FNU A;  1LTS D;  5ELB A;  2F0D A;  1SYB A;  5C3W A;  2HDM A;  2A68 D;  1SJE D;  2EXD A;  2BDO A;  5CV6 A;  1QZH A;  2CFM A;  5JJK A;  3NEM A;  5GQO A;  3A0J A;  3CF5 A;  1FYC A;  2TMP A;  5G3L F;  3JAM i;  2F0T A;  3I4M G;  4KHP L;  4A93 G;  3VYT A;  4A3M B;  1RCV D;  2NVQ H;  3A56 A;  5KRU A;  2JYO A;  2EVB A;  2IHF A;  1PVO A;  1ASY A;  4N9T A;  3H91 A;  3KLR A;  1N32 L;  2A6E C;  3CCV A;  4LWC A;  2GVB A;  1HUN A;  1V43 A;  1RTN A;  3N6R A;  2WKC A;  5GAE C;  2LMC B;  5C3E H;  4IUP A;  4Q5V A;  3SK5 A;  3VR6 A;  5JVG 3;  3HOX G;  1EOT A;  1TS3 A;  4KN4 C;  3RN5 A;  4BY1 H;  4HIK A;  1K0R A;  3QIA A;  4GN5 A;  3I56 A;  5L37 A;  1HFG A;  2C5C A;  3I73 A;  3S9W A;  4IFD I;  2SOB A;  1IZ6 A;  1UEA B;  3OHX C;  1SMY C;  1VF5 C;  4UP9 A;  3Q8D A;  1AZQ A;  4MIU A;  4QIW B;  1NCV A;  3TN2 A;  4BWG B;  3WOF A;  2UXC L;  1QG7 A;  4JI7 Q;  1Q8K A;  3SK8 A;  4L5T A;  1SE4 A;  4IUV A;  2LXK A;  2JA6 G;  3CPW A;  5NUC A;  3W2D A;  4TVA B;  5M3M G;  4JK1 C;  4IUR A;  2NVQ B;  3W1G A;  1YNX A;  3CKI B;  1JB3 A;  3HOV H;  2NVT B;  1STE A;  1UE5 A;  4H02 A;  3T16 A;  1WFQ A;  4R1J A;  4B3T L;  3NBI A;  3X3M A;  3I7F A;  3ERQ A;  4ZYS A;  4R4T A;  2EJM A;  1XWE A;  2EZV A;  1LLR D;  1PXU A;  4ZLT F;  5CBE E;  3KF6 A;  2AQ3 B;  2F0N A;  5CV8 A;  4N9P A;  2B2V C;  4L8J A;  5LMU Q;  3FVQ A;  1SE2 A;  1WTH A;  3BDO A;  4R4C A;  1K3B C;  1GO3 E;  1TU2 B;  5JEA J;  3GD7 A;  1PH3 A;  1G91 A;  3JAM E;  4NMZ A;  3MEH A;  1IXR A;  3D0F A;  4RGO S;  1CA5 A;  1YNJ C;  2HHH Q;  2KCN A;  1LT6 D;  2XN9 C;  3HOU H;  3HOV G;  3E5S A;  1EIG A;  2K5H A;  4Q0F A;  2A68 C;  4DR7 Q;  4IUU A;  1HNZ L;  1PYW D;  2A1A A;  2AUJ D;  4X3U A;  3FMC A;  4LFC Q;  2LSS A;  4GKK L;  4IOA A;  1A3T A;  3OWF A;  2PMZ B;  3K80 C;  3HOU B;  2FIN B;  2Z1C A;  3L0O A;  3RMH A;  3BZD B;  1ZYR D;  2K5W A;  1L0X B;  1B44 D;  4C2M B;  3SHL A;  2UUA L;  1I3Q B;  4KY6 A;  3U4V A;  3RNU A;  1A62 A;  1EQQ A;  3CU7 A;  1X56 A;  2D0P A;  3S1N B;  5LMN W;  5DM7 3;  4G7H C;  2L11 A;  4DXG A;  2FFK B;  3P75 A;  3DM1 A;  4UP7 A;  2MO0 A;  2I5H A;  1R9T H;  3GV6 A;  1TT2 A;  4DNR B;  1E24 A;  1J6Q A;  2DJG C;  1E0B A;  4FYD A;  2JQO A;  5IE8 A;  3BDL A;  1YZ6 A;  5BR8 L;  4A3F H;  1O78 A;  4IUN A;  2KUM A;  1EU3 A;  2CVR A;  3D4R A;  3MXG A;  3GV3 A;  1BCP F;  1IHZ A;  5FO9 B;  3ERS X;  4X64 Q;  1PFM A;  5HY6 A;  2O4X A;  4DK1 A;  2OTJ A;  3HOY G;  4QIW E;  3VYU A;  2NVT H;  1ZYR C;  2JA9 A;  4C1N K;  2AQ1 B;  2L55 A;  2ZTC A;  5E7N A;  3VA7 A;  5E1F A;  4DR5 Q;  4RMF A;  3A7L A;  5FLM G;  1WTR A;  4CDF C;  1JJC B;  4LFA Q;  1JWU D;  2R93 G;  2BE5 D;  1MKH A;  4G7Z C;  4IAL A;  3CP0 A;  1EUJ A;  2F0F A;  1L2F A;  1LO5 D;  2YU9 H;  4DR2 L;  3PIP A;  3I3C A;  2MFI A;  4FDB A;  2BH2 A;  4YY3 L;  1JB7 A;  3WOE A;  4A3I H;  1Q81 C;  2K52 A;  2EYJ A;  4DR3 Q;  1M90 C;  1XPU A;  2O5I C;  1PH9 A;  1LTI D;  3OIQ A;  1NMF A;  3CRL C;  3TS0 A;  1XPO A;  1WCM H;  3DEO A;  5IWA L;  1I94 Q;  5C0X I;  2HT1 A;  5EPJ A;  1TVX A;  1GXD C;  4OEL B;  1DXM A;  2C35 B;  1X65 A;  1X6O A;  3MEF A;  4F8M A;  3IFT A;  3D4W A;  3VR3 A;  1IBM Q;  3CCL A;  2JA7 B;  1NR4 A;  2JK8 A;  1I4P A;  3J80 c;  1CKM A;  2KBN A;  4RH6 A;  4DR1 Q;  5EAY A;  4QUF A;  2A5H A;  5JJI A;  2JA6 B;  4Z9C B;  1EU4 A;  4RKL A;  2CHB D;  3OYY A;  2PQA B;  2B63 H;  3RZO H;  2KHI A;  1KLU D;  1B50 A;  1FJG Q;  1SBB B;  1W6K A;  2RCF A;  2F0E A;  3NEN A;  3OSO A;  4KD4 A;  2IWH A;  1G2T A;  1WTQ A;  1PV4 A;  1LAB A;  3T53 B;  1SJH D;  3RLO A;  1B4O A;  5IP7 H;  1UE1 A;  2V4D A;  5LMN Q;  1OXX K;  3I91 A;  1QIL A;  3CAM A;  3I4N H;  3BZC A;  3CCJ A;  2UXB Q;  1VS0 A;  4U68 A;  1MBY A;  1GUN A;  2SDF A;  2F4V L;  4XT1 B;  3KJP A;  2QF7 A;  3UE1 A;  4FP5 D;  1KLG D;  1GM5 A;  1U4P A;  4OIJ A;  1LT4 D;  2B2T C;  2EY1 A;  3S14 B;  5M5W B;  2A19 A;  2F0P A;  3LNN A;  5FO7 B;  2G5D A;  3R2I A;  2PI2 E;  1X3P A;  3CHB D;  4P71 A;  4AH6 A;  4NXM Q;  4HJ9 A;  4UHV A;  1SNP A;  1A3U A;  3K0Y A;  1HCZ A;  5I2X A;  1GUG A;  1A3V A;  4HCS A;  4LMQ D;  2ZXP A;  1NAP A;  2I07 B;  1HNW Q;  2N55 A;  3CCS A;  2P5Z X;  3P20 A;  2K5D A;  1LYL A;  2HUG A;  3K7A H;  3Q6S A;  4ME5 A;  4A3K G;  4KK7 A;  3RUZ A;  1VQ5 A;  1TII D;  4LUZ A;  1S40 A;  1WD0 A;  1LUZ A;  4XQN A;  1VQE A;  1Q46 A;  3LGJ A;  4O2D A;  2XRS D;  5LL6 S;  5E4X A;  4TQU S;  4ZRZ A;  2QGQ A;  5C5L A;  1DGS A;  1UE6 A;  4XYQ A;  3CCU A;  4JCV E;  2E5L Q;  3GTP B;  4KI0 A;  4NDX A;  5KEE A;  5CGK A;  1HHV A;  2Z4I A;  3ULL A;  4GOP B;  1Z9F A;  3URY A;  1UNS A;  1HJP A;  1I6V C;  1YIT A;  2N88 A;  3TEH B;  4DV1 L;  4GN3 B;  3BJU A;  4GLX A;  4A3D H;  1CQF A;  2K1B A;  1STG A;  4A3B H;  1FNV A;  1Y1V H;  1LTR D;  1B2T A;  1K83 H;  5IOC A;  3SK6 A;  1QZG A;  1K28 A;  1STY A;  5FK9 C;  1O7L A;  2ATW A;  2H5X A;  1XTD A;  2BE5 C;  2D62 A;  5C3E G;  1S5F D;  2DNC A;  2QA4 A;  4A3J H;  3M3Y B;  1U9R A;  4BY7 G;  2D9U A;  4LF8 L;  3U9S A;  3K5N A;  2KHJ A;  4L63 B;  4FF4 A;  3QR8 A;  2BOS A;  3EIV A;  4HCE A;  1RD9 D;  1VQN A;  2AWO A;  3FDT A;  4I65 A;  2WP8 J;  4GNX A;  1C0A A;  3PQI A;  1JT8 A;  3PO2 G;  1K9M C;  2E2H H;  1JOQ A;  4LW1 A;  3VYS A;  3PUY A;  2JN4 A;  1EY5 A;  5EQ0 A;  2HIV A;  3F2C A;  4UY8 C;  4GLA C;  2XNA C;  2IW3 A;  4R8I A;  2KEE A;  3J81 i;  3KF8 B;  4DV4 L;  1IBK Q;  3MWY W;  3NEL A;  1FD7 D;  2OEO A;  3ERO A;  1HNX L;  3S15 H;  2WIN B;  1N34 Q;  2IX1 A;  2ICI A;  5EKL A;  1G6Z A;  1N32 Q;  1EEF D;  2K5V A;  3CCQ A;  1CT1 D;  3NWT A;  1PRT B;  4UAI A;  3RZO B;  5JPN C;  1H9S A;  2F0I A;  1OXT A;  2Q8R E;  4PZ7 A;  1ENF A;  2K4K A;  4GOP A;  4DV5 Q;  4KJN A;  2KEN A;  1S3O A;  3AU7 A;  3OMC A;  4LF4 Q;  2ZTE A;  1UAP A;  3U4Z A;  4K2L A;  4X65 L;  3EVQ A;  4CBV A;  5ELE A;  4KKS A;  3DMU A;  5K36 H;  2UU9 Q;  2EDG A;  3ER0 A;  3QB3 A;  2QEJ C;  1GD7 A;  4C3J H;  2OQ0 A;  1VQI A;  1UE7 A;  2F0K A;  3MTS A;  3SK4 A;  4DR4 L;  1K3R A;  1PFS A;  3GQB A;  4X6A H;  1M4V A;  4NP5 A;  3WWV A;  1BBW A;  2WB1 E;  4B3S L;  3S1M B;  4DNI A;  1B3A A;  3V2T A;  4KMU C;  2QKI C;  2QDL A;  1VQ8 A;  2F4I A;  3OOC A;  4ZAI A;  2R61 A;  2Q8T A;  1HQM C;  4H13 C;  1MD2 D;  4GKJ L;  2VB2 X;  3STB D;  4MN3 A;  4Y52 H;  1TWG H;  1HXY D;  4LF7 Q;  1II3 A;  4OXP A;  4QL5 A;  3RZD H;  1A6X A;  4C3J G;  2HQE A;  3IKJ A;  1IYU A;  1LTB D;  1G51 A;  3TP7 A;  1SAP A;  2RDH A;  2R7Z B;  1PZK D;  4IFD G;  1B9M A;  4L6T B;  1LT3 D;  1SYE A;  2HHH L;  1BDO A;  2PZW A;  4N8X 1;  2K04 A;  3C1F A;  1PH2 A;  4A3K H;  1I6H B;  1STA A;  1HNZ Q;  1FGB D;  3LWU A;  4YIJ A;  4G7O C;  4PZ8 A;  5C0X G;  4JI3 L;  2F3V A;  3A74 A;  2CQO A;  4LFC L;  1NR2 A;  3RR5 A;  4JI8 L;  2UUB Q;  1SMX A;  2ZT9 C;  2J7Z A;  1D2B A;  3OTO Q;  1YI2 A;  4KD3 A;  2F0M A;  2F3I A;  4QUC A;  2VQE Q;  4JBW A;  5EJW A;  2ZXR A;  3A8I E;  1F9S A;  4C3I B;  5C4X G;  2IJ0 A;  1WTO A;  3C3L A;  1KAA A;  4ILW A;  3H94 A;  4B3R Q;  3NHH A;  2PQE A;  1IW7 C;  4IOC A;  3A7A B;  1Q1B A;  1QWY A;  2F0U A;  1GUS A;  1KXL A;  4WRD A;  4X64 L;  1X3Q A;  5COY A;  3HOW H;  1Q90 A; 
#chains in the Genus database with same CATH homology
 5IYD G;  5H1S E;  1OXS C;  4R4C A;  2VUM G;  4IFD J;  4BBR H;  2E2J H;  4PG3 A;  4R4Q A;  3F8T A;  1GO3 E;  2NN6 I;  5JEA J;  2QEX A;  1VQ9 A;  3GD7 A;  2Y0S E;  1PH3 A;  4JYA Q;  2E8G A;  4AYB E;  4OWW B;  1IXR A;  3D0F A;  2JJQ A;  3PSI A;  3J81 j;  3M4O H;  3STB C;  1IBL Q;  1N36 Q;  3M4P A;  2HHH Q;  4LFA L;  1VQD A;  1VQ6 A;  3TRZ A;  4BBS H;  2AKW B;  1FGU A;  1Y1W H;  4IPC A;  2E5L L;  2YTY A;  2XGT A;  1N33 L;  4DK6 C;  1X55 A;  3HOU H;  4OON A;  3HOV G;  1XMO Q;  5JEA G;  3OW2 A;  1P8L A;  2K5H A;  4WJ4 A;  4DR7 Q;  5IT9 c;  1HNZ L;  5M3F H;  4NXN L;  3KOJ A;  2JA8 G;  4YCU A;  4A75 A;  4YCW A;  2A1A A;  2VL6 A;  3L2P A;  1XMQ L;  4LFC Q;  1X3F A;  2LSS A;  4GKK L;  4IOA A;  4A76 A;  2R7Z H;  3K80 C;  1W3S A;  2PMZ E;  3RLN A;  3L0O A;  1Y1V G;  1ASZ A;  1Q82 C;  4YWK A;  3A5U A;  3BU2 A;  2UUA L;  4JI7 L;  4YHH L;  1XNR Q;  3FHW A;  1BVS A;  2GN5 A;  4LNQ A;  3U4V A;  3RNU A;  1A62 A;  2D0O A;  3UDI A;  2VZA A;  5IWA Q;  3GTJ H;  1EQQ A;  1X56 A;  2D0P A;  3D31 A;  4DV6 Q;  1I94 L;  1S72 A;  4JC0 A;  5LMN W;  3KLW A;  1M1K C;  1GVP A;  1X54 A;  4BA2 I;  1IBM L;  2OCE A;  2ZJP A;  5IYB G;  1EIF A;  4LF6 Q;  4UP7 A;  2MO0 A;  2I5H A;  1R9T H;  2NZH A;  1XNQ Q;  3G6E A;  4K0K L;  3PF4 A;  1Z47 A;  2IY5 B;  4X62 Q;  1E3P A;  1E24 A;  1J6Q A;  3AQQ A;  1PH4 A;  2JQO A;  5IE8 A;  1YZ6 A;  5BR8 L;  4A3F H;  3CC4 A;  4LF8 Q;  1VQK A;  4JI6 L;  4X64 Q;  3ERS X;  1Q1E A;  2B3G A;  2ZTD A;  5IYC G;  5HY6 A;  2ZM6 L;  3AFQ A;  1BKB A;  1WI5 A;  2F52 A;  4DAY B;  1T9H A;  5LMU L;  4QIW E;  3HOY G;  2OTJ A;  2EQS A;  2NVT H;  3F2B A;  3KFU A;  2JA7 H;  2JA9 A;  1HZB A;  1V1Q A;  3K8A A;  1KRT A;  2NN6 G;  2ZTC A;  1SE8 A;  3GDE A;  5E7N A;  4DV3 Q;  2N8N A;  4DR5 Q;  4JYA L;  2ID0 A;  3CC2 A;  4RMF A;  5FLM G;  4X66 Q;  4HJ5 A;  3T1H L;  3DM3 A;  5ELN A;  1IBL L;  1JJC B;  2OQK A;  3JAM c;  2CKZ B;  4DV7 L;  4C2M H;  4LFA Q;  2R93 G;  2Q2I A;  4A3G H;  1CKN A;  1MKH A;  1WJJ A;  2AHO B;  2Z0S A;  3CP0 A;  5FLM H;  4OWX B;  1XMO L;  1EUJ A;  4DR7 L;  1L2F A;  3HOW G;  1Q86 C;  2YU9 H;  3L7Z C;  5HGQ A;  4DR2 L;  2L15 A;  4X65 Q;  3KDF B;  1PHJ A;  2UUC Q;  1YJW A;  4B3M Q;  1JJG A;  3PIP A;  4FDB A;  2MFI A;  4L5Q A;  1HNX Q;  2BH2 A;  4Y7N H;  4YY3 L;  3CME A;  4J15 A;  4A3I H;  1Q81 C;  1JB7 A;  2R92 H;  3HOU G;  2K52 A;  2ALY B;  4DR6 L;  4QQB X;  4DR3 Q;  1M90 C;  1VQ4 A;  1XPU A;  3S16 H;  4HJ8 A;  1PH9 A;  4PMW A;  2UUA Q;  4GS3 A;  4LF9 L;  1KAW A;  1NMF A;  1XPO A;  3TS0 A;  1WCM H;  2K50 A;  2RCN A;  1PH1 A;  1MJE A;  4C3H H;  2IT1 A;  4HIO A;  5IWA L;  1RL2 A;  3CQZ H;  1I94 Q;  5M3M H;  1D8L A;  4BY1 G;  2WAQ G;  5C0X I;  2HT1 A;  1Q7Y C;  1HZ9 A;  3J81 c;  2R93 H;  5C44 H;  4B3S Q;  2C35 B;  1IBM Q;  1EWI A;  1X6O A;  1X65 A;  3MEF A;  2VQF Q;  1QVG A;  5GAG C;  2OTL A;  1VQ7 A;  3CCL A;  1OXU A;  2JK8 A;  3HOZ G;  2MQH A;  1OTC A;  1XNQ L;  3J80 c;  4K0K Q;  1CKM A;  2KBN A;  4LF4 L;  4DR1 Q;  5EAY A;  1HZA A;  2JE6 I;  3BZK A;  1YJ9 A;  5FLX c;  5JJI A;  5BR8 Q;  1LTL A;  3GTQ H;  2Q2U A;  3I2Z A;  5IYC H;  2N78 A;  3F2D A;  3OYY A;  4GKJ Q;  2PQA B;  2B63 H;  3RZO H;  2KHI A;  2BA1 A;  3S1N H;  4BY7 H;  1HR0 Q;  5IP9 H;  4MZ9 A;  1FJG Q;  1EIY B;  3F1Z A;  2JEB I;  2CCZ A;  3NEN A;  4GOP C;  1X3E A;  1PV4 A;  3RLO A;  4DK3 C;  5IP7 H;  4DV3 L;  5IYD H;  1L1O B;  1Q12 A;  1UE1 A;  1L0W A;  4P74 A;  1OXX K;  3SGI A;  2ZJR A;  5LMN Q;  5C4J H;  3CAM A;  1NY4 A;  3I4N H;  3BZC A;  3K7U C;  5ELO A;  3CCJ A;  2UXB Q;  3M4Q A;  1VS0 A;  2Q2T A;  4ALP A;  1B8A A;  1VQL A;  3J80 i;  3RLF A;  1NJI C;  5M5W H;  1K73 C;  2F4V L;  3H3V H;  2K5N A;  4A3B G;  3KJP A;  2GVA A;  3HKS A;  3UE1 A;  3HOY H;  1EFW A;  1X3G A;  1GM5 A;  1SRU A;  3G4S A;  3S2D H;  4JI3 Q;  1NTG A;  4LFB L;  1E1O A;  4AQY L;  2N3S A;  3KJO A;  1C7Y A;  1SRO A;  2R7Z G;  1HZC A;  4JI8 Q;  2A19 A;  2CWA A;  2WB1 G;  4DR6 Q;  4DR3 L;  4QGU A;  3FKI H;  4P71 A;  2PI2 E;  4LF7 L;  2ASB A;  3MXN B;  4AH6 A;  4DV0 Q;  4LF9 Q;  4NXM Q;  1YVC A;  4IPH A;  4HJ9 A;  1AH9 A;  5GAH C;  1Y1W G;  3S2H H;  2R92 G;  1YBY A;  4A3L H;  3E9H A;  1EYG A;  5IYB H;  4GNX B;  2AWN A;  1E22 A;  4XTC S;  1O7I A;  1MIU A;  1RIP A;  2VQF L;  4GNX C;  1HNW Q;  3CCS A;  1GKH A;  4YWL A;  3TQY A;  2PNH A;  5M5X H;  3I4M H;  1LYL A;  4B3T Q;  4DR1 L;  2NZO A;  1W2B A;  4LF5 Q;  3G48 A;  3PO2 H;  2RHQ B;  3B6Y A;  3K7A H;  3PCO B;  2VUM H;  1VQO A;  4BBR G;  4JV5 Q;  4B3R L;  1VQG A;  4A3K G;  1B70 B;  1VQ5 A;  4LUV A;  4P75 A;  3J7A 5;  1CUK A;  3M7N A;  2Z6K C;  4LUZ A;  4DAM A;  3H0G H;  1S40 A;  1WYD A;  1LUZ A;  3PUW A;  1VQE A;  4O0A A;  3GTG H;  1Q46 A;  1UEB A;  1CKO A;  3LGJ A;  4O2D A;  2DGY A;  5DLQ E;  3IRB A;  1NMG A;  5M3F G;  2JA8 H;  2UXC Q;  4WJ3 M;  3CPF A;  4A3C H;  3OTO L;  1TWA H;  2IX0 A;  4RG1 A;  3KYH C;  5LMN L;  4JI0 Q;  1YIJ A;  4A93 H;  2VQE L;  1SN8 A;  4TQU S;  4JI1 L;  4JBK A;  5C4X H;  2WFW A;  4DUY Q;  2QGQ A;  1DGS A;  1KD1 C;  1UE6 A;  5GAD C;  3PO3 G;  1XPR A;  3CCU A;  1OXV A;  3M9B A;  4JCV E;  2F4V Q;  4IJH A;  4APV A;  4KI0 A;  2E5L Q;  1N33 Q;  3AEV A;  1YJN A;  3ULL A;  1IYJ B;  4A3E G;  3W1B A;  1VQM A;  4DV2 Q;  4DV4 Q;  4GOP B;  1Z9F A;  2YV5 A;  1IBK L;  3CCR A;  1UWV A;  4LFB Q;  1HJP A;  4XIG S;  3DLL A;  4AQY Q;  1CSQ A;  1XMQ Q;  1HR0 W;  2JA5 G;  3G71 A;  1YIT A;  3PF5 A;  3AYH B;  3TEH B;  3GTP H;  4DV1 L;  4GN3 B;  4MTN A;  3BJU A;  1VCI A;  4DUZ L;  2UXD Q;  4GLX A;  4A3D H;  1N9W A;  1N34 L;  1I6H H;  3VDY A;  4C3I H;  1KRS A;  3KF6 B;  1XNR L;  3W5O A;  4A3B H;  1Y1V H;  4LUO A;  4UP8 A;  5IY0 A;  1K83 H;  2N49 A;  1NE3 A;  1QZG A;  4DV6 L;  1AE3 A;  2VW9 A;  1MJC A;  3CCE A;  1KL9 A;  1PH6 A;  3GO5 A;  1D7Q A;  2ATW A;  1CKN B;  2H5X A;  4JI4 Q;  4P72 A;  4HJ7 A;  3UDG A;  3HFZ B;  4IPG A;  1N36 L;  3ICE A;  1XTD A;  4JOI A;  2D62 A;  3K0X A;  5C3E G;  3I4O A;  4DV5 L;  2QA4 A;  4A3J H;  3KDF A;  4OWT B;  4X62 L;  3UE0 A;  1CSP A;  1TWC H;  4BY7 G;  4LF8 L;  4NXN Q;  1E1T A;  2KHJ A;  4R4I A;  1KHI A;  3EIV A;  3S1M H;  4GKK Q;  2UU9 L;  1VQN A;  2VY3 A;  2ZM6 Q;  2RHS B;  2JA5 H;  2AWO A;  2JA7 G;  1E7Z A;  1L1O C;  2B29 A;  5K36 G;  4IJL A;  1I5F A;  2JA6 H;  3ZJY C;  2WP8 J;  3U50 C;  4GNX A;  1C0A A;  4NPS A;  3UDF A;  1JJ2 A;  3I4N G;  1Y14 B;  4QY7 A;  3S24 A;  3H0G G;  2KCT A;  4DPG A;  4JI0 L;  1JT8 A;  4JI2 L;  3PO2 G;  1K9M C;  4DR4 Q;  2E2H H;  1KC8 C;  3GTM H;  2HQL A;  4YCV A;  3PO3 H;  3T1Y Q;  3T1H Q;  4LW1 A;  4DUY L;  3E0E A;  3PUY A;  3H3V I;  1H95 A;  4A3M H;  2VNU D;  3PIO A;  4DV7 Q;  2HIV A;  4OO1 G;  3F2C A;  4UY8 C;  4POF A;  1WCM G;  4GLA C;  2WAQ E;  4A3I G;  2ZJQ A;  3HKZ E;  3S17 H;  3GTK H;  2KCM A;  2K14 A;  3J81 i;  3KF8 B;  4DV2 L;  4DV4 L;  4ME3 A;  1IBK Q;  1JMC A;  4DR2 Q;  3U58 A;  3ULJ A;  5GRO A;  1PA6 A;  4OX9 Q;  3NEL A;  3CXC A;  2I0Q A;  4EX5 A;  1PH5 A;  3FP9 A;  4A3F G;  1HNX L;  2NVX H;  4A3L G;  3S15 H;  1BBU A;  4DUZ Q;  4A3M G;  1YHB A;  1U5K A;  2UXD L;  1N34 Q;  2IX1 A;  2K75 A;  1KIX A;  2DUD A;  1IL2 A;  3S1Q H;  1SLJ A;  3K81 C;  1N32 Q;  2IHE A;  2K5V A;  3JC6 6;  3PUX A;  3CCQ A;  3S14 H;  1QUQ B;  4DR5 L;  4IO9 A;  4KHZ A;  3TS2 A;  1HH2 P;  2YTV A;  1VQP A;  4X66 L;  3EBE A;  1OXT A;  1G29 1;  4HJA A;  4JI4 L;  4PZ6 A;  3H15 A;  4DKA C;  1PYB A;  4PZ7 A;  1TXY A;  1PVO A;  1WOC A;  2K4K A;  4GOP A;  3HKZ G;  4JBJ A;  4DV5 Q;  2KEN A;  1S3O A;  4JG2 A;  4JBM A;  3CD6 A;  4LF4 Q;  3NBH B;  2Y0S G;  2ZTE A;  3S1R H;  3FKI G;  1TWH H;  4GN4 B;  1YHQ A;  1G6P A;  3GTL H;  3U4Z A;  1U0L A;  1A0I A;  3AFP A;  1I3Q H;  4X65 L;  2UUC L;  2BA0 A;  4B3M L;  2R6G A;  2UU9 Q;  1HR0 L;  3ER0 A;  2UUB L;  4YY3 Q;  2EIF A;  1GD7 A;  4NB3 A;  1N8R C;  1J5E Q;  1A8V A;  5FJ8 H;  4C3J H;  2OQ0 A;  1VQI A;  3CCM A;  1UE7 A;  5IP9 G;  2R7F A;  1K8A C;  1FVI A;  3E9I A;  2Z6K A;  2YTX A;  4JI2 Q;  2MNA A;  4DR4 L;  2PI2 A;  1K3R A;  4JI5 L;  1PFS A;  3T1Y L;  4A3C G;  2BH8 A;  1YEZ A;  2LXJ A;  4X6A H;  1TWF H;  2I5L X;  4HIM A;  3A5Z B;  3WWV A;  1BBW A;  2WB1 E;  3M85 A;  4B3S L;  2YYZ A;  4GLV B;  4DNI A;  4OO1 I;  1VQB A;  5C0X J;  1SFO H;  1VQF A;  5AJ3 L;  3HOZ H;  2EXD A;  2HIX A;  1VQ8 A;  4POG A;  3HOX H;  1QZH A;  2CFM A;  5JJK A;  1SR3 A;  1A63 A;  3NEM A;  4IPD A;  4OX9 L;  5GQO A;  4GKJ L;  3A0J A;  3CF5 A;  3STB D;  3CC7 A;  3I55 A;  3PUZ A;  3JAM i;  4JOI C;  3I4M G;  4KHP L;  4A93 G;  4BA1 I;  4Y52 H;  2JEA I;  1FJG L;  1TWG H;  2VS1 A;  3CW2 C;  4AIM A;  5M5Y H;  2NVQ H;  3PUV A;  4LF7 Q;  1VQH A;  3CMA A;  4OXP A;  2IHF A;  4QL5 A;  4YWM A;  4DV0 L;  1ASY A;  3RZD H;  1KQS A;  4NXM L;  5FJ8 G;  3EN2 A;  1N32 L;  4BBS G;  3CCV A;  1G51 A;  4LWC A;  2GVB A;  1V43 A;  1FL0 A;  5J3B A;  4MNO A;  5GAE C;  4A3G G;  2UXB L;  4IFD G;  5C3E H;  1L1O A;  1HNW L;  2HHH L;  1QVF A;  1K8G A;  5IP7 G;  2NVY H;  2AMC B;  2XTI A;  3HOX G;  1PH2 A;  4R4O A;  4UPA A;  3RN5 A;  2MO1 A;  4HIK A;  1K0R A;  4A3K H;  4GN5 A;  4BY1 H;  4BXX G;  1QVC A;  3I56 A;  4A3D G;  4KLK A;  1HNZ Q;  3TRE A;  1VQJ A;  4PZ8 A;  1P16 A;  4JI3 L;  5C0X G;  3A74 A;  1EQR A;  2OWO A;  2CQO A;  4IFD I;  4LFC L;  3RR5 A;  1IZ6 A;  4L5S A;  1B7Y B;  4JI8 L;  3ULP A;  2UUB Q;  1JE5 A;  1SMX A;  4UP9 A;  1PH8 A;  3Q8D A;  4QJF A;  2FXQ A;  1J5E L;  2PQA A;  1VQA A;  5JJL A;  1QUQ A;  4A3E H;  2RF4 A;  2UXC L;  4P73 A;  4JI7 Q;  2E2I H;  1Q8K A;  4YHH Q;  3OTO Q;  4L5T A;  1YI2 A;  2F3I A;  4EQ5 A;  3M3Y H;  1V9P A;  2LXK A;  2VQE Q;  5C44 G;  3CPW A;  4A3J G;  2JA6 G;  4JI1 Q;  4JI5 Q;  1NBW A;  4JBW A;  4A4I A;  2Q2H A;  4TVA B;  3PGZ A;  1PYS B;  5M3M G;  4HID A;  3W1G A;  1YNX A;  3HOV H;  5C4X G;  1PH7 A;  1I50 H;  2A8V A;  3RN2 A;  4LF6 L;  1UE5 A;  4H02 A;  5AJ3 Q;  1WFQ A;  4R1J A;  4AYB G;  4B3T L;  2CWP A;  4LF5 L;  1C9O A;  1YHA A;  2I5M X;  2B63 G;  3I7F A;  4B3R Q;  4JV5 L;  4R4T A;  2ES2 A;  4IOC A;  1EOV A;  1XJV A;  1Q1B A;  1AE2 A;  3UDX A;  3J7Z C;  4L5R C;  4BXX H;  2R7D A;  3KF6 A;  1X9N A;  3PV0 A;  1KXL A;  2V1C C;  3GTO H;  4JI6 Q;  1VQC A;  4DV1 Q;  1LM0 A;  4X64 L;  4KHP Q;  5LMU Q;  3HOW H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...