4DAYB

Crystal structure of the rmi core complex with mm2 peptide from fancm
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
135
structure length
113
Chain Sequence
AGVRLPRSPPLKVLAEQLRRDAAVWMQGRVVMADRGEARLRDPSGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Defining the molecular interface that connects the Fanconi anemia protein FANCM to the Bloom syndrome dissolvasome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/hydrolase
molecule keywords RecQ-mediated genome instability protein 1
total genus 22
structure length 113
sequence length 135
ec nomenclature
pdb deposition date 2012-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16100 RMI2 RecQ-mediated genome instability protein 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dayB00
4BXXH 3AEVA 3CCUA 1TWCH 2UUCQ 2K5VA 4H02A 4IPCA 1UEBA 4XTCS 1M1KC 4YHHL 4GOPA 5JJKA 3HOXG 1X3GA 1X54A 2JK8A 1K73C 1XNRL 3M7NA 1PH7A 2K5HA 4LFBL 3I7FA 1VQFA 1HNZQ 3S1MH 1Y1VG 4JYAL 4OO1I 2UXDQ 1V1QA 3ULLA 2JA7G 5GAGC 2D62A 3Q8DA 1XMOL 2RHQB 3L0OA 1H95A 5IYBG 1D7QA 1U0LA 3NEMA 5IWAQ 4JV5L 4IOCA 2CQOA 4GLXA 4JI7L 4IFDI 2Z0SA 4B3SQ 2VL6A 1WFQA 3FKIG 4LF7L 2AHOB 1YNXA 1YJNA 1XNQL 3PUVA 4APVA 4DR6L 1Q12A 2B29A 4GOPB 5M3MH 1VQOA 1XPRA 3GO5A 5DLQE 1M90C 2F3IA 2HHHL 4LF7Q 4A3BH 2RF4A 4OONA 1SN8A 4Y7NH 1XNQQ 3PIPA 3STBD 1YJ9A 2UUBQ 5M3MG 3CCSA 3HOWH 5IWAL 4QL5A 4GNXC 4QQBX 3FKIH 2R7FA 2F4VQ 1G51A 3L7ZC 5GQOA 2NN6G 2MFIA 4LF9Q 4NXMQ 3M85A 1HNXQ 1GKHA 2BA0A 1XMQQ 3KFUA 1L1OA 4X64Q 2F52A 1K83H 1VQ8A 5GAEC 3PV0A 4YWLA 2VZAA 3K7UC 3W5OA 3OTOL 3FP9A 4YWKA 1Y1VH 5BR8L 1XJVA 3H3VH 1ASYA 1TWFH 1HZ9A 2CWAA 4DR5Q 1N34L 1O7IA 4JI4Q 3RR5A 2ZM6Q 1OXUA 1C0AA 2LSSA 1CSQA 1E1OA 1XPOA 4JI2L 3RZDH 2K50A 1JJ2A 4HIDA 1SLJA 1PH1A 1WI5A 1YZ6A 1G6PA 5AJ3Q 5JJLA 4L5SA 4PZ7A 2PQAB 3WWVA 4DV2L 4YY3Q 3KF8B 1NE3A 1YHAA 2GN5A 1N9WA 4DR2L 1XMQL 1GM5A 3HOWG 4B3TL 4JI3Q 4NPSA 2UXCL 3E9HA 1JJGA 5E7NA 3J81c 1RL2A 3PUZA 4A3BG 2OCEA 4A3EH 4EX5A 1MIUA 1NTGA 2MNAA 4B3TQ 4OWXB 1L0WA 1IL2A 3M4QA 1MJCA 4AIMA 1GO3E 3G4SA 3T1YQ 3GTLH 2KHIA 2IY5B 4YCWA 4DK3C 1OXXK 4DR3Q 1SMXA 5IYBH 4JOIA 3ULJA 4GKJL 3I2ZA 3B6YA 4IFDJ 2E2JH 2JA7H 1YHQA 1K9MC 3TS0A 5J3BA 2WP8J 4C3JH 2E8GA 4LUZA 1UE6A 3ER0A 3W1GA 5FJ8H 3HOXH 2E2HH 4A3FH 1Q82C 3JC66 2EQSA 2JE6I 1QUQB 4O0AA 5C4JH 4JYAQ 3K81C 4BXXG 1MKHA 4MZ9A 3EIVA 4NXNL 1EQQA 3CD6A 4YHHQ 4XIGS 5IP7H 1ASZA 4NXML 1P16A 3GTKH 1X56A 4KHZA 1NMGA 2VW9A 3PO2H 1JMCA 1VQLA 4GKJQ 4K0KL 5C0XG 4A93G 1YITA 5HY6A 4A3JG 2CCZA 1D8LA 1UE7A 1X6OA 3A5ZB 2UUBL 2UUAL 3LGJA 1EUJA 4IPHA 2Q2TA 4L5RC 3CCVA 4LFCL 4PZ8A 4QIWE 1HR0L 3PO3H 1I94L 1QUQA 2UUAQ 3T1HQ 4J15A 4B3RQ 1OXSC 4UP8A 2ZTEA 5JEAG 3J7A5 5LMNL 3PIOA 4JBWA 5ELNA 1Y14B 1KQSA 4A3GH 5M5WH 3F2BA 4JV5Q 4IOAA 3CCEA 2AWNA 4JBMA 3GTMH 4QY7A 1EWIA 1I50H 1YEZA 4LFBQ 3J80c 5H1SE 1VQPA 1PFSA 1OTCA 2OQKA 3T1YL 4P71A 4TVAB 5GAHC 1CUKA 2UUCL 4BY7H 3H0GG 4GN4B 1X9NA 3M4OH 3G71A 4L5TA 3K7AH 3K8AA 1I6HH 4A4IA 1W3SA 1VQCA 3TREA 5C0XJ 1N32Q 2D0PA 4A3DG 3E9IA 4JOIC 4UP9A 4UP7A 3ERSX 1UE5A 1FJGQ 4A3MH 2YU9H 4GKKQ 3CMAA 4DV1Q 4X64L 3CC7A 5IP9H 1KL9A 3CCQA 3S1RH 2WB1G 4X65Q 5C3EG 1BVSA 5LMUQ 2A19A 3KJPA 4BBSH 5IY0A 4KHPL 3S24A 1HJPA 3GTQH 3DM3A 5LMNW 1A62A 2CWPA 1E24A 4P75A 1QZHA 3PF4A 1VQ7A 1BBUA 2DUDA 2PNHA 2RHSB 4WJ4A 1YBYA 3M9BA 5FLXc 5LMUL 4KHPQ 2HIXA 1PYBA 2MO1A 1VS0A 4HJ5A 1VQKA 4BY1H 4P72A 1KIXA 5IYDG 1JE5A 3J7ZC 4A3LG 1B70B 2VNUD 2IT1A 2BH8A 2WAQE 3RNUA 5ELOA 3OW2A 1N33Q 3S15H 4LF8L 4NB3A 3A5UA 1S40A 2JA6G 4B3MQ 4JI4L 1JT8A 3RLFA 2FXQA 3ZJYC 2NVQH 3GTGH 3TRZA 1I5FA 1SR3A 3HOVG 1YHBA 4LF9L 3HKZG 3DLLA 1PH4A 3KOJA 3IRBA 1CKNB 1KAWA 1VQIA 3U50C 3OTOQ 4DV0L 1W2BA 1JB7A 2C35B 2ATWA 4KLKA 4BBRH 2AMCB 5IYCH 4Y52H 1U5KA 2PI2E 3F2CA 2Y0SG 3D31A 3S17H 2DGYA 1QZGA 4POGA 4AQYQ 4LF5L 2A8VA 4LUVA 3I56A 2HHHQ 3W1BA 3UDIA 1LYLA 1X55A 1Z47A 1CKMA 4GN5A 3T1HL 4AYBE 5M3FH 4A3IG 1PH2A 3I4MH 2NVYH 3PUWA 4X66Q 1WCMH 1GVPA 1A63A 4AQYL 3PCOB 4LF5Q 4JI1L 4P73A 4HIKA 4R4IA 2OTLA 1EIYB 3K80C 3GTPH 1Q1EA 3UE0A 3PGZA 3PUYA 3PF5A 1XTDA 4GNXA 2R93G 3KJOA 5GADC 1T9HA 2UXBL 1PH8A 3HOUG 3MXNB 3I55A 5IE8A 2JJQA 1L1OC 1B7YB 1UE1A 1MJEA 2QGQA 2YV5A 1XNRQ 2PI2A 1HZAA 3AQQA 3NELA 3KLWA 1VQJA 2JQOA 2OTJA 3S2HH 1GD7A 1WJJA 2LXKA 3CPFA 5C44G 4DR4Q 2LXJA 4GLVB 3KDFA 4A76A 1N36Q 1EFWA 3VDYA 1VQEA 2ZTCA 2WFWA 4B3ML 4EQ5A 4LF4L 1Z9FA 2BH2A 2B63G 1VCIA 4KI0A 5M5YH 2VUMH 3H3VI 2VQFL 1S3OA 1HZCA 1SROA 4A3DH 3I4NG 3H15A 4DV3Q 4DV6L 4HJ8A 4A3KH 1C7YA 3UDFA 1YIJA 1IBMQ 2KCMA 2GVAA 3PSIA 1PH5A 1Q8KA 3I4OA 2NZHA 4A3CG 3ICEA 4DV0Q 2Z6KA 4DV3L 1TWHH 2VQEL 1Q7YC 2R92H 2OWOA 3BZKA 3CPWA 4OX9Q 4JI6L 3HOYG 4JG2A 3HOZH 2JA8H 4X65L 2ZJRA 2N78A 4C3IH 2R7ZH 3F2DA 1PH9A 1VQ5A 1J5EQ 3A74A 3RZOH 1N33L 1JJCB 4L5QA 3EN2A 3CCMA 1HR0W 4JI8Q 4JCVE 4PZ6A 4LF4Q 5C4XG 1AH9A 3BU2A 1FVIA 4RG1A 2CFMA 1SRUA 3S1QH 4X62L 2QA4A 1E7ZA 1K0RA 4R4TA 1R9TH 1K8AC 2YTYA 2ZTDA 1Y1WH 1EYGA 1BKBA 3D0FA 1VQ6A 1HNXL 1E22A 3PUXA 1V43A 4GOPC 5C4XH 3JAMc 1VQHA 2VS1A 3CW2C 2HQLA 2R7ZG 4RMFA 2JA8G 1Q46A 4FDBA 3U4ZA 4DKAC 2ZJPA 1IBLL 3HOZG 4B3RL 2D0OA 3NENA 4GLAC 5LMNQ 1XPUA 2R92G 2KBNA 5FLMG 3CCLA 3KYHC 3EBEA 4A3CH 2YTXA 2JA5H 4YWMA 4HJ9A 4A3KG 3I4NH 4LWCA 4C3HH 4MTNA 2N8NA 2JA5G 5JJIA 4K0KQ 3STBC 1KD1C 1I94Q 2VUMG 2WB1E 1VQAA 5FLMH 1N36L 2B63H 3TQYA 1E3PA 4DV7L 2JEAI 1SFOH 1Q1BA 1PHJA 4GNXB 2UXDL 4NXNQ 4DUYQ 3RLNA 2R7DA 5C44H 1IBLQ 4IO9A 4A75A 2ALYB 4DNIA 4IFDG 1K8GA 1BBWA 1Y1WG 2NVTH 3HKSA 2MQHA 1FGUA 3SGIA 2NVXH 3JAMi 1EOVA 4DUYL 3MEFA 3HOUH 4X6AH 2MO0A 2BA1A 2HIVA 1Q86C 3F1ZA 4LF8Q 3CC2A 2KENA 3BJUA 3CP0A 4JI1Q 3CAMA 1HR0Q 4X62Q 2B3GA 2CKZB 1AE2A 3HKZE 2K52A 4AYBG 2PQAA 2N49A 3J80i 2HT1A 2ASBA 3HOYH 4JBKA 1HNWL 4YCUA 3KF6B 5M3FG 3UDGA 4A3IH 1V9PA 1KRTA 2ES2A 3GTJH 2EIFA 1PVOA 1QVCA 2UXCQ 1EIFA 2AWOA 1J6QA 4OXPA 1FJGL 2Q2HA 4ME3A 3NBHB 2IHFA 1RIPA 3CXCA 3UDXA 1X3EA 5JEAJ 4DV2Q 1VQBA 4OO1G 2K75A 4DR7Q 1YVCA 4LF6L 4BBRG 4MNOA 4JI0L 4IPGA 4DR1Q 1PYSB 5GROA 4YCVA 2ZJQA 5HGQA 2EXDA 2XGTA 5EAYA 4JI2Q 3CF5A 3HOVH 4UPAA 4DR3L 1IYJB 2UU9L 3RN2A 4DR1L 2JEBI 4JI0Q 2JA6H 2OQ0A 1A0IA 1OXTA 4QJFA 3TEHB 3BZCA 3CCJA 3AYHB 5M5XH 4GN3B 2WAQG 2ZM6L 1EQRA 2YYZA 2IX0A 4HIOA 1KHIA 1LTLA 4JI8L 1NJIC 2UU9Q 4OWWB 3RLOA 3S16H 2R93H 4DR7L 4A3LH 2VQEQ 1QVFA 4BY1G 4JBJA 4OX9L 1VQ4A 4GKKL 1L1OB 4POFA 4DV5Q 1UWVA 1L2FA 1LUZA 2I5HA 3L2PA 4DAYB 4DR2Q 4LNQA 1WCMG 4GS3A 2NN6I 4DV6Q 4LFCQ 3I4MG 4HJ7A 3OYYA 4BA1I 1LM0A 2RCNA 4BBSG 2F4VL 3FHWA 4X66L 2Q2UA 1N32L 2H5XA 1KXLA 1YI2A 1PV4A 1NBWA 4DR5L 4R4CA 3RN5A 4B3SL 1I3QH 4DR4L 5IYCG 5BR8Q 4JC0A 4DV4L 4LUOA 1HZBA 4JI5L 1HNZL 3K0XA 4BY7G 3G48A 3F8TA 4QGUA 3A0JA 4JI7Q 4BA2I 3UE1A 4DPGA 3U58A 3TS2A 1IBKL 1CKOA 5IT9c 4DV4Q 3GDEA 2E2IH 2I0QA 2KCTA 1X3FA 1X65A 2UXBQ 4P74A 1IBKQ 1CKNA 2K5NA 1WOCA 4A3GG 3GD7A 5IYDH 4DV7Q 1NY4A 1PH6A 3S14H 1DGSA 4AH6A 4R4OA 4JI5Q 2I5LX 4R1JA 2Y0SE 1OXVA 1J5EL 2AKWB 3KF6A 2A1AA 2GVBA 3G6EA 1E1TA 1Q81C 4ALPA 1TWAH 2PMZE 1A8VA 3M3YH 4JI3L 5C3EH 1KRSA 2Q2IA 1P8LA 2XTIA 1VQDA 1FL0A 1K3RA 5IP9G 4A3JH 4A93H 1XMOQ 3HFZB 4PMWA 4A3MG 5AJ3L 4LFAL 1VQ9A 1SE8A 1G291 4YY3L 2ID0A 1C9OA 1TXYA 4DV1L 2KHJA 2Z6KC 4IPDA 3AFQA 2QEXA 4DV5L 1S72A 1PA6A 3J81j 4DUZL 4A3FG 2N3SA 5FJ8G 3ULPA 3H0GH 2NZOA 1N34Q 2K14A 2E5LQ 3CC4A 1B8AA 1NMFA 1HNWQ 2JA9A 1AE3A 3J81i 4UY8C 2YTVA 1IZ6A 4DK6C 4C2MH 2L15A 5C0XI 3M4PA 4IJLA 4LF6Q 1CSPA 2VY3A 1HH2P 4R4QA 3GTOH 2I5MX 1QVGA 1TWGH 3KDFB 3E0EA 4IJHA 4LFAQ 3S2DH 4DUZQ 4WJ3M 1WYDA 4JI6Q 5K36G 2IX1A 1VQNA 4PG3A 3CQZH 4HJAA 3PO3G 3U4VA 4A3EG 1YJWA 1IBML 4DAMA 3S1NH 1IXRA 2R6GA 1N8RC 4HIMA 2V1CC 1KC8C 4OWTB 3CMEA 1PH3A 2VQFQ 3AFPA 1VQMA 4LW1A 4TQUS 2K4KA 3PO2G 4DR6Q 5IP7G 2IHEA 1VQGA 3CCRA 4O2DA 2E5LL
chains in the Genus database with same CATH superfamily
4ZKCB 1TWCH 3CCUA 2K5VA 4H02A 4IPCA 1WTVA 2F0DA 3H09A 5JJKA 1XNRL 1K73C 4JYAL 1PZKD 3ULLA 3JAME 2D62A 3Q8DA 1QNKA 2RHQB 1D7QA 3NEMA 4G7ZC 4KD4A 4JV5L 3HG9A 3T4AC 3DEOA 1EYCA 2CQOA 4IOCA 4JI7L 2WIIB 4B3SQ 2DJGC 1YJNA 3PUVA 4APVA 2B29A 1ESFA 1M90C 3GO5A 5DLQE 1IHZA 3DMUA 5BN3A 1XNQQ 2F0NA 1SN8A 4IN3A 3PIPA 1YJ9A 2UUBQ 2R7FA 2ZXRA 1GUNA 1G51A 3L7ZC 5GQOA 4ULLA 1GKHA 3V05A 1L1OA 1WTHA 2F52A 5EJWA 2V4DA 1VQ8A 2EY1A 4KV6A 4YWKA 1Y1VH 1TWFH 1C8CA 2CWAA 1U9RA 3S15B 5I4DA 1K0SA 3SXHA 1E1OA 3P75A 4A3EB 4HIDA 5IGFA 1RTNA 2NN6H 3RD4A 4L5SA 4XYOA 3I8ZA 5M5WB 2GN5A 1HA6A 2L0CA 3HOWG 4B3TL 1STBA 1STEA 4NPSA 1JJGA 2OCEA 4IZ8A 4EX5A 1JCKB 1NTGA 1B44D 1JOKA 4C3JB 3HOWB 3M4QA 3D3RA 3WDNA 1ZYRC 1SEBD 4YCWA 1OXXK 1TVXA 4WORA 2Q8TA 3DWQA 3B6YA 4DNTB 2JA7H 2ICEC 4DAPA 1YHQA 5EKLA 5DM73 2WP8J 3N52A 4FXGC 3TZUA 1D1KA 4RAUC 2OXPA 2EQSA 2MHVA 3BVMA 4O0AA 4JYAQ 4BXXG 1K8MA 1I4GA 4NXML 3PO2H 2XWJB 4K0KL 5JAVA 3KF8A 4RFBA 1YITA 2LFNA 2CCZA 3J7AF 3LGJA 5IGEA 3R2TA 4ZKBB 4QIWE 3KLSX 1B50A 2R3ZA 2E75C 4J15A 1EZ8A 3WOEA 3J7A5 5LMNL 1KQSA 4JBWA 5ELNA 3T51B 3FKIB 2N88A 4QY7A 4LFBQ 1YEZA 3EROA 5H1SE 1B2TA 1OTCA 4RA8A 1CUKA 2UUCL 2Z1CA 1I6HH 2P5ZX 2B2YA 2CQAA 3TREA 2D0PA 4JOIC 1H9JA 4J8QA 1Y8PB 3HOVB 1UE5A 2JP1A 5LL6X 2YU9H 1L0XB 4RCOA 4X64L 1KL9A 3CCQA 4QUCA 4X3TA 5C3EG 1BVSA 1DOKA 2A19A 5LMUQ 5IY0A 2RVLA 4KD3A 3GTQH 1NSNS 2CWPA 2GA4B 3SHLA 4P75A 1ILQA 1BBUA 2DUDA 1YBYA 4HTHA 4KHPQ 2HIXA 1PYBA 2MO1A 1VS0A 4HJ5A 1KIXA 5IYDG 4A3LG 1HFGA 3J7ZC 2WV6D 2HD3A 1XTCD 4K2LA 2VNUD 1EEID 3OW2A 1JE4A 1SE3A 1CQFA 1OO9B 2B8GA 1TY0A 2FXQA 5AFWA 3TRZA 5E1FA 1YHBA 3DLLA 4OELB 1EOTA 3IRBA 1W2BA 1WTXA 2AMCB 2DY8A 1DOMA 1HTLD 4LF5L 2HHHQ 1JOOA 5CV6A 1F9QA 1LYLA 4GN5A 1CKMA 5M3FH 3I4MH 4AQYL 1EIYB 3PQIA 3UE0A 1D1IA 3PUYA 4GNXA 2R93G 1F77A 2EY2A 2FFKB 2FJ2A 4KKUA 2HDLA 3HOUG 3MXNB 4CDFC 1B7YB 4HSPA 2YV5A 3GTMB 4XT1B 4L8JA 3AQQA 1HZAA 5K5PA 2OTJA 2JQOA 4GLVB 3KDFA 2Z4IA 3VDYA 2WFWA 2QEJC 1CI3M 2Q8IB 2BH2A 4IUUA 1VCIA 2PW5A 2SOBA 2EY5A 3H3VI 2CW0C 2FINB 2I46A 2F0KA 4DV6L 2BDNA 4HJ8A 1CQVA 2ICIA 1SYEA 1YIJA 1H9RA 1EY6A 1LTAD 2H4OA 4DV0Q 1BO0A 4EQNA 2OWOA 4OX9Q 4JI6L 3HOYG 1NUCA 4GKKQ 3K6OA 5IGGA 2N78A 1VQ5A 1J5EQ 3LWEA 3OHXC 3S9WA 1I6VC 1WD1A 5EQ0A 4DAVA 2A6ED 4JCVE 4PZ6A 3TP5A 1R4QB 1JWUD 3K57A 1DOLA 3D0FA 1E22A 1BR9A 3PUXA 1V43A 5C4XH 1QJOA 3JAMc 5EPJA 1VQHA 2HQLA 1KDAA 2JA8G 1E0BA 3U4ZA 3ERQA 2ZJPA 3C1EA 2D0OA 2R92G 1XPUA 2EYHA 5FLMG 3CCLA 1K3BC 3EBEA 2YTXA 2JN4A 3I4NH 4LWCA 4C3HH 2N8NA 4DN4M 2O2LD 4K0KQ 2K01A 3N6RA 2MUYA 2SNSA 1VQAA 1PTOD 4B08A 3TQYA 1SFOH 1S5BD 1Q1BA 1PHJA 4NXNQ 5EKKA 5C5MA 3AU7A 5C44H 3KK7A 1IBLQ 2BDOA 1IYVA 1ICWA 2I07B 2NVTH 1I4QA 1CZWA 2MO0A 2RDHA 1GUWA 1A3UA 1Q86C 3BJUA 1HR0Q 2D9UA 4X62Q 2B3GA 2YU9B 1DZ1A 4AYBG 2PQAA 2NTTA 2PQEA 3KF6B 4A3IH 1V9PA 1L0YB 1QVCA 1EIFA 4A3KB 1FJGL 1R4PB 4ME3A 1VMPA 2IHFA 3CXCA 1VDZA 5CORA 3CKIB 5JEAJ 4OO1G 2K03A 3IFTA 4DR7Q 4A3FB 4ZRZA 2RQXA 1PYSB 4YCVA 2ZJQA 5HGQA 1SNDA 1B4OA 2F03A 4OL7A 5EPLA 4DR1L 4JI0Q 2JA6H 2KVMA 2Z6BA 2L11A 2HCIA 1S5CD 2UU9Q 4JI8L 3GTLB 2B2WC 5D14A 3SDZA 4DR7L 2VQEQ 1QVFA 1VQ4A 3T56B 1UWVA 4NW2A 3L2PA 1EYDA 4GS3A 2EYOA 1GXDC 2NVYB 1LM0A 3X3NA 2EVBA 4X66L 3I90A 5CV7A 1PV4A 1TS4A 3UI2A 4DR4L 3J80E 3E6ZX 4LUOA 1LTTD 1FNUA 4BY7G 3G48A 1G2SA 3F8TA 5EBCA 4JI7Q 4BA2I 4DPGA 1CKOA 3NTKA 4KK7A 1BCPF 2KCTA 1X3FA 4FP5D 4HCEA 4BBSB 1IBKQ 1RKNA 1CKNA 2L1BA 1F2ZA 3I4MB 4DU9A 1WOCA 2AQ3B 2LMCB 1SNMA 4R4OA 3CHBD 1ZEQX 5CMDA 2NVQB 1OXVA 2EJFC 1G6ZA 2QDBA 2AKWB 2IWHA 3V2TA 4JI3L 4A3JH 4ZUJA 5C3WA 1LV9A 4PMWA 4A3MG 2ID0A 2M2LA 4DV1L 4IPDA 3GTOB 3AFQA 4DV5L 4U673 1I4XA 1S72A 1PA6A 3J81j 4A3FG 3CC4A 1HNWQ 2JA9A 5I9OA 2JYOA 2L15A 5C0XI 4JVZA 3HEJA 4LF6Q 4R4QA 3S1NB 1HH2P 1PTOF 1PTOH 2I5MX 4ZUIA 2VB2X 5KYIA 5JEAH 3MC0B 4FF4A 2PZWA 2IX1A 2SEBD 1VQNA 5JPMC 3GTKB 3TP7A 3PO3G 3QJYA 1YJWA 1CA6A 4EGVA 4DGZA 1A15A 1N8RC 5C0XH 4OWTB 1S5DD 1PH3A 1HHVA 1X3PA 3LNNA 4LMQD 4TQUS 2IHEA 1K3RA 1Q90A 1T5XD 3AEVA 3OOCA 4XTCS 1M1KC 1TWFB 1W6JA 4GOPA 2JK8A 2K5HA 2AUKA 3I7FA 4A93B 1HNZQ 4RGMA 2KCNA 1V1QA 2E74C 2D2CC 3QWNA 1XMOL 1D6EC 3MXGA 3EQLC 4RWSC 4U68A 1SDFA 2Z0SA 1XNQL 5LHY1 1XPRA 2O4XA 4KY7A 1JWSD 1PLFA 1HPCA 1KABA 2HHHL 4BS9A 3MEHA 3NTIA 1JOQA 5M3MG 1Q3LA 3FKIH 2F4VQ 2MFIA 3LWUA 1SMYC 2K05A 1HNXQ 2EYMA 5GAEC 1G2TA 3OTOL 5G3LF 2E2HB 1AP0A 5D3IB 1N34L 4DR5Q 1O7IA 2XWBB 3RR5A 2LSSA 2D5DA 1XPOA 1PTOC 1WI5A 4I7ZC 1G6PA 5AJ3Q 1EY4A 4PZ7A 5J1ZA 3BVGA 3EVQA 4DR2L 5CBAE 2F0MA 5BN5A 2K5WA 1RL2A 3Q0AA 5C4ZA 3E3XA 5KNCA 4A3EH 4KY6A 1L0WA 1IL2A 1QNUA 4UDUC 4AIMA 1GO3E 3G4SA 2KHIA 1EQTA 4DR3Q 1SMXA 2L9HA 4JOIA 4GKJL 3DXJC 3I2ZA 2NZ1D 3EFXD 5J3BA 4C3JH 1X3QA 2E8GA 4LUZA 3ER0A 5FJ8H 3OMCA 1Q82C 3JC66 5C4JH 1QUQB 5IODA 1K8OA 1MGSA 3CD6A 4YHHQ 4IUPA 1O7YA 4KHZA 1NMGA 4XQQA 1VQLA 4GKJQ 1RODA 5C0XG 2XSCA 4A3GB 2LS01 3A5ZB 1UE7A 2UUAL 3MFYA 3S16B 3CCVA 1K28A 1TKWB 1SYBA 4FXKC 3PO3H 1CT1D 2F0UA 3VR4A 2F0TA 4CDDC 4C3HB 2F3VA 4B3RQ 4ODGA 3IAYA 5JEAG 1ZKOA 1Y14B 4A3GH 1RD9D 1A6XA 1SNCA 3T53B 2AWNA 3HOZB 3GTMH 4FVMA 1EWIA 4EQPA 1VQPA 1PFSA 2OQKA 3T1YL 4RHSA 1PXUA 1YNNC 4OIJA 1X9NA 4ZK9B 3G71A 4L5TA 2K04A 2R61A 1W3SA 1VQCA 1WCMB 5CC4A 3QOJA 4IUQA 1I50B 4UP9A 3ERSX 1PYWD 4RKBA 3TZDA 4A3MH 4P2CB 3MXPA 3CMAA 3MXNA 5DM63 3S1RH 2WB1G 4X65Q 3MAQA 4BBSH 1HJPA 1AZQA 1A62A 3PF4A 2F0QA 2L4NA 1VQ7A 1SMYD 1VQKA 3X3MA 5C5LA 3VYTA 1B70B 1RF2D 2K33A 2BH8A 4BWGB 3S15H 5J39A 1S40A 4JI4L 1IW7D 3CQZB 2CH4A 1EY5A 5NUCA 1B1ZA 1KAWA 2FMCA 2ATWA 5FO9B 4KLKA 4O42A 4BBRH 2PMZB 1F9SA 3D31A 2DJFC 2BE5D 3S17H 1QZGA 1LTRD 3FRPB 4QMGA 3W1BA 1PZJD 1SBBB 3UDIA 1JWMD 2R92B 3PUWA 1MD2D 4K8JA 4R4IA 3BG3A 3IKJA 1Q1EA 3GTPH 2B2WA 3MA2B 1O7ZA 3PF5A 3OWFA 4FYDA 4MHEA 3A55A 4TRDA 3SK5A 2F0HA 3VR5A 2WACA 2PI2A 1XNRQ 2LXKA 4CJ1B 1GUSA 3FPUB 1EFWA 2BE5C 4K2KA 3NWSA 2ZTCA 1S5ED 4EQ5A 1TWHB 2WAQB 3G7LA 2B63G 4CHTB 4KI0A 1LACA 2VQFL 3S14B 5A2QL 1SROA 2WINB 1C7YA 2HCCA 3PSIA 3ICEA 1M8AA 3GTQB 1KNAA 5KGUA 3CPWA 3HOZH 2RDFA 2KEEA 5C44B 2R7ZH 1PH9A 1JJCB 4L5QA 1HR0W 4XXEA 4JI8Q 1AH9A 1C4QA 4RG1A 2CFMA 2X6GA 2Z4HA 4ZLTF 3HOUB 4R4TA 1R9TH 3I4LA 1I6HB 2ZTDA 3NTHA 1EYGA 3VA5A 5ELEA 1HNXL 3FEWX 4GOPC 5CYUA 1STHA 2A5HA 1EY0A 2R7ZG 2NUCA 4RMFA 4DF7A 4DKAC 1PTOB 3HOZG 2BOSA 2LY7A 2NWGA 1VMCA 3NENA 4GLAC 4IURA 4K14A 4LK1C 1U4LA 1LTID 2F0SA 2KBNA 3KYHC 4C3HG 4MTNA 3BDOA 5FLMH 2B2YC 3C46A 2B63H 4DV7L 1EFID 5C4JB 3VR2A 4DUYQ 2R7DA 2ALYB 4DNIA 2O5JC 1BBWA 4DUYL 3K58A 3CP0A 4JI1Q 2CKZB 3BZDB 3CU7A 3HOYH 3J80i 2E2JB 2EYFA 1UUPA 3K59A 1KRTA 4GZYC 3GTJH 2EIFA 2HDMA 3I3CA 2UXCQ 3ZYYX 3VR6A 3NBHB 1WTPA 3UDXA 1S5FD 4DV2Q 2EJMA 2H1EA 1O80A 1YVCA 4LF6L 4BBRG 1D5ZC 4MNOA 5GROA 2EXDA 4JI2Q 3H3VC 4DR3L 1E2WA 1IYJB 4QJFA 5FO8B 5M5XH 3NBHA 1KLUD 2YYZA 2IX0A 4HIOA 1MSHA 1NJIC 1GUGA 2R93H 5EKIA 2KHSA 4MIUA 1J8IA 4OX9L 1EWCA 4GKKL 4KTAA 2QCPX 4DV5Q 1L2FA 3K5OA 1TWAB 4DAYB 4DR2Q 2NN6I 3I4MG 4HJ7A 4BBSG 2RCNA 4DK0A 2WKCA 2Q2UA 1N32L 3JAML 3VYSA 4DNRB 2H5XA 4DR5L 4R4CA 1TIID 1I3QH 3M4OB 4JC0A 2IL8A 1HZBA 3CRKC 2L55A 1SYGA 4CGYB 4KN4C 1IBKL 5F2DA 5KNDA 3ND9A 4HR7B 4R8NA 2I0QA 1CZGA 1MI2A 4E6IA 1X65A 1TT2A 3OSOA 4P74A 4TKOB 4A3GG 3GD7A 1YNND 5IYDH 5JVG3 1PH6A 5EGTA 1DGSA 1KTKA 4F88A 2A6HD 3MXUA 3G6JB 4RGOS 4G57A 1J5EL 3KF6A 2GVBA 1Q81C 2PMZE 1GUOA 3P7JA 3M3YH 1C48A 5C3EH 3KLSA 3HZXA 1TQOA 3DWAA 3E5SA 2XTIA 1VQDA 1FL0A 3T16A 4I7AA 3S1MB 3GTJB 1XMOQ 3S2HB 2PZUA 5AJ3L 4LFAL 3P1HA 1FD7D 1HNZL 3GP7A 3K0YA 2QEXA 5DNFA 1HUNA 2N3SA 5FJ8G 1N34Q 4C3JG 1NMFA 2RBMA 3J81i 1X32A 2KCCA 2JSOA 4DK6C 5JOBA 4A3BB 1U4MA 3GV3A 2A6HC 3KDFB 5D65A 1HQMC 4LFAQ 4DUZQ 1EEFD 4QB4A 1DCZA 4A3EG 4DAMA 2KOLA 3S1NH 4WRDA 5KYLA 2F0JA 4HIMA 5I6YA 3KBXA 3CMEA 4KKSA 1A2TA 1VQMA 3PO2G 3L9AX 1VQGA 1HNWL 4BXXH 2B8FA 1FNVA 4M8AA 1SYDA 1UEBA 1X3GA 1X54A 4FF3A 3TMEA 1S4ZA 4A3JB 1PH7A 1VQFA 2JA7G 1JC7A 3L0OA 4RH6A 1U0LA 3DWPA 5IWAQ 1BOSA 1GJXA 2DNEA 1QWYA 4IFDI 3ITPA 2KECA 1WVLA 1WFQA 3FKIG 2AHOB 1AEXA 4DR6L 1Q12A 5M3MH 1VQOA 4N8X1 4KHVA 1PFMA 2F3IA 3M4YA 4LF7Q 4OONA 4Y7NH 1H9SA 1ILPA 1O7LA 3CCSA 3HOWH 4GNXC 3HOXB 3W3AA 2Z8LA 4LF9Q 2NN6G 4H7BA 4NXMQ 2BA0A 1XMQQ 3VA7A 2PYKA 4X64Q 2VB3X 1VF7A 3A54A 5FKAC 2VZAA 4FXDA 3W5OA 1ZYRD 3SE0A 3ONAB 2K1BA 1RDPD 2ZM6Q 1OXUA 1QOHA 4JI2L 3I73A 1JJ2A 1PH1A 1H9KA 1U4RA 1YZ6A 3IFDA 4FF2A 2EYJA 2PQAB 4DV2L 1ENAA 3KF8B 1XMQL 1GM5A 2MGSA 5DAUA 2WB1B 1STGA 4JI3Q 3BDLA 3E9HA 2UXCL 5E7NA 3J81c 1BXTA 1MIUA 1SAPA 4O1NA 4B3TQ 3L3OC 3P20A 3HOYB 3FVQA 4L6TB 2SDFA 1A2UA 2IY5B 4DK3C 3Q23A 1V1OA 1CFMA 1SYCA 4OHJA 3RUZA 2K32A 3FMCA 2E2JH 1LO5D 1TS3A 1CK1A 5IGCA 4ILWA 4TSSA 3TP6A 4A3IB 4A3FH 1STNA 2EYLA 1Y1WB 1MKHA 4MZ9A 2E2DC 4ME5A 1EWHA 1ASZA 3RZDB 3GTKH 1P16A 1X56A 2VW9A 1JMCA 2N55A 5HY6A 3U9SA 4A3JG 4S3SA 1A3TA 1X6OA 2UUBL 4IPHA 4L5RC 1II3A 2VUMB 2KUMA 2ENBA 1HR0L 1AW7A 1I94L 4IUVA 2ZTEA 4UP8A 4K6LA 2SNMA 2B2VC 5M5WH 3F2BA 5G3LD 4JV5Q 4IOAA 3CCEA 4QIWB 3TDQA 5KRUA 4JBMA 5D3DA 3J80c 2MPMA 1JQYD 4P71A 1JR0D 4UHVA 1QILA 2QILA 3NBIA 4DXGA 4BY7H 1PRTD 3K8AA 4RHRA 4A4IA 1TY2A 3MZ5A 1EIHA 4J1MA 3A56A 4A3DG 4R9WA 1FJGQ 2F0VA 3CC7A 2IX3A 3NK9A 4KHPL 3KJPA 3S24A 2A68D 5CV9A 3DM3A 1E24A 4HAEA 2RHSB 4CDCC 3D8GA 5LMUL 4P72A 3HP3A 3OW7A 4DXFA 3M3YB 4KN7C 2IT1A 2WAQE 3RNUA 4RKLA 5ELOA 1SE4A 1NCVA 4NB3A 2JA6G 4B3MQ 1JT8A 3RLFA 1I5FA 1SR3A 4LF9L 5FK9C 2B2TC 1BNZA 1GUTA 4DV0L 3U50C 2CW0D 2C35B 4PMBA 1QB5D 1JB7A 5IYCH 2J7ZA 2FHTA 4OO1H 2Y0SG 1SNPA 3J81L 4QCLA 2DGYA 3URYA 1TU2B 4LUVA 1X55A 4A3IG 1Z47A 1TWGB 4AYBE 1BCPC 1PH2A 2NBFA 1GVPA 3U9OA 3PCOB 1EY8A 2B2UA 3QG1A 5E4XA 3K80C 4C2MB 5JJZA 4PQXA 3NHHA 1XTDA 3A7AB 3KJOA 3C3LA 1T9HA 1PFNA 3BDCA 2NVXB 4IALA 4DAYA 2XN9C 4NP5A 2JJQA 1L1OC 5I2XA 1UE1A 4Q5VA 2QGQA 1MJEA 3R2IA 3KLWA 1VQJA 5ELBA 2Z9HA 4ZAIA 1GD7A 1WD0A 2LKVA 5C44G 4DR4Q 2LXJA 1N36Q 4IUNA 5CGKA 2EDGA 1VQEA 4B3ML 1Z9FA 2F0WA 2RCFA 5M5YH 1SJHD 1PRTF 5CV5A 1F9RA 1S3OA 2B39A 3I4NG 4DV3Q 1XWEA 1IBMQ 2KCMA 2GVAA 1PH5A 3D4RA 2EZVA 3H94A 2NZHA 2F0EA 1QCBD 3SVMA 4G7HC 1SFOB 2VQEL 3PIO3 2R92H 3HRZC 4JG2A 2JA8H 2ZJRA 4C3IH 4FO2A 3F2DA 3TN2A 3A74A 3RZOH 3NXWA 4MTKA 5C4XG 3EN2A 3SR1A 2C9OA 4LF4Q 3BU2A 1FVIA 2XRQD 1SRUA 3S1QH 5FLXE 2QA4A 3TP8A 1K0RA 2X69A 4B9WA 1K8AC 2YTYA 3AMUA 4CJ2C 1BKBA 2Q8RE 3I4NB 3R3OA 2VS1A 3FPPA 2M00A 1Q46A 3E0JA 4FDBA 5HURA 1HA5A 4F7XA 5C3XA 2JA5H 3KBGA 4YWMA 5JJIA 1EY7A 3STBC 1Y1VB 1KD1C 1I94Q 2WB1E 1NNXA 2MJ8A 1N36L 3RMHA 3Q24A 1E3PA 2JEAI 1B9MA 1E2ZA 3HS0C 4L63B 1I4HA 4IO9A 3D4WA 4IFDG 2DNCA 1Y1WG 4DFAA 3HKSA 4ZYSA 2NVXH 3SGIA 2PW7A 3JAMi 3J80L 3D6WA 3QO2A 3HOUH 4X6AH 4KJNA 4LF8Q 2OF1A 3CC2A 3CAMA 4K5XA 1AE2A 3HKZE 4F8MA 2CH4W 2ASBA 2A74C 1B3QA 4XDXA 1HQRD 5M3FG 3UDGA 5CV8A 1Y69U 1PVOA 3HKZB 3Q22A 4MN3A 5C4XB 2EJGC 1J6QA 3HGBA 4OXPA 2K5QA 2Q2HA 3O13A 1X3EA 1A3VA 2XGTA 1W6KA 4XQNA 3CF5A 3RZOB 3RN2A 3WOFA 1SE2A 1IKLA 5M9OA 1OXTA 3BZCA 5IT9L 4GN3B 2WAQG 2ZM6L 1WTQA 1EQRA 3NUCA 1EU4A 3SK4A 4OWWB 4A3LH 3K5LA 1L1OB 4POFA 1LUZA 2I5HA 1WCMG 4DV6Q 1STYA 2IJ0A 5CR3A 5M3FB 1KLGD 5KEEA 3OYYA 5ELCA 4BA1I 1DD2A 4XT3B 1SNQA 1IL8A 2JXMB 5JVH3 5IT9E 3MFGA 1TWCB 5JPNC 3RN5A 2B2UC 3S1QB 5IGDA 1AN8A 4JI5L 1U4PA 3K0XA 2PO4A 3S2DB 3D6CA 3UE1A 1ZXTA 5DEHA 4DV4Q 2E2IH 4CJ0B 3K5MA 4HSVA 2UXBQ 1HTPA 2K5NA 1NY4A 3S14H 4WFN3 4AH6A 2R93B 2JA5B 3BVZA 5ELFA 1B3AA 1YNJC 1HFNA 2ZXPA 2A1AA 1E1TA 2EXZA 3H6MA 4NDXA 2F0IA 1KRSA 4F87A 4JPBW 2Q2IA 2NTSA 5IP9G 2RSNA 1KNEA 1AFPA 1VQ9A 3I70A 1G291 4YY3L 1C9OA 1TXYA 4KY5A 2F0FA 2KHJA 3I72A 3J7YW 2K7VA 2NVTB 4BBRB 4DUZL 3H0GH 2NZOA 2FMMA 3KUPA 4N9PA 2E5LQ 1B8AA 1MSGA 1XXGA 2YTVA 3S17B 4YIJA 4C2MH 1BCPD 4H44C 4IJLA 2VY3A 4PNYA 4A3DB 2JA6B 5ISRA 2G5DA 3GTOH 4HN7A 2J0TD 1TWGH 3J81E 2CHBD 2A68C 1ET6A 3H0GB 3E0EA 4IJHA 2B2TA 4WJ3M 1WYDA 5K36G 4RCNA 4PG3A 4HJAA 4Y7NB 1IBML 3K5NA 3PMFA 4HMJA 1HRJA 2R6GA 3C2PA 2V1CC 3A8JE 2VQFQ 3AFPA 5M5YB 4LW1A 2K4KA 5IP7G 2EOTA 2OEOA 3T13A 2UUCQ 1VF5C 4H0LC 2F0OA 4YHHL 3HOXG 3M7NA 4R8IA 4XYQA 1ML0D 4LFBL 3S1MH 4OO1I 2UXDQ 1Y1VG 4JW0A 3H91A 5GAGC 5CBEE 1GOZA 5HGTA 5IYBG 1H95A 1PDQA 4GLXA 3SEBA 2VL6A 3CRLC 4LF7L 4PMCA 1YNXA 1JORA 1ICFB 2PZTA 4GOPB 2R7ZB 3PO3B 1K83B 1ENFA 3MVVA 4C56C 1KDBA 5BN4A 2RF4A 4A3BH 1EZ6A 2DY7A 4N9TA 3STBD 5IWAL 4QL5A 2X6LA 4QQBX 4C1NI 1NR2A 1LLRD 4HEDA 3M85A 3KFUA 4K6DA 3GTPB 1K83H 2EY6A 2PCFB 3PV0A 4YWLA 2CVRA 3K7UC 3QB3A 3TSSA 3FP9A 4X3UA 5BR8L 1XJVA 3H3VH 5E4WC 1ASYA 2AQ1B 1HZ9A 3OIQA 4JI4Q 1C0AA 2JA8B 1CSQA 2QF7A 1EU3A 1DJRD 1ET9A 2K50A 4N8FA 4M1UB 3RZDH 1SLJA 1UNSA 1YNJD 5TSSA 3BYTB 5JJLA 2HQEA 3WWVA 2B2VA 2ZXOA 4YY3Q 1NE3A 1F9PA 1YHAA 1N9WA 3I91A 3DUZA 1LTSD 2F0PA 3PUZA 1D5MC 1GHJA 4A3BG 4G7OC 2QDLA 2XNAC 1SXTA 2MNAA 4ABNA 1EIGA 2EPBA 5KIXA 2HUGA 1FYCA 4OWXB 3OIPA 1MJCA 3C1FA 3T1YQ 3GTLH 1KDCA 3SK8A 1DM0B 1LT4D 4NMZA 5IYBH 3A7LA 2A73B 3ULJA 1V1PB 4IFDJ 1BCPB 4BY7B 1K9MC 3TS0A 1SJED 3S1RB 3HOXH 1UE6A 1Z7TA 2F4IA 4UAIA 3W1GA 5I6WA 2E2HH 2JE6I 5IOCA 3K81C 1CHQD 4NXNL 3EIVA 1TS5A 2RSOA 1EQQA 3BS1A 4XIGS 5IP7H 1PFBA 4NKLA 3PIP3 3MHBA 4A93G 1DXMA 3IL8A 2AQ2B 2QW7A 1D8LA 3GQBA 1DYQA 1EUJA 2Q2TA 1WTRA 4LFCL 4PZ8A 2RKSA 3NSWA 1QUQA 1LABA 1PZID 1Q8IA 3T1HQ 2UUAQ 5K36H 1FGBD 1OXSC 5J22A 1D2BA 4Z9CB 3NPPA 3PIOA 1E2VA 2NYZD 1D5XC 1I50H 1F2YA 4TVAB 5GAHC 3VR3A 4I65A 1J9OA 5L37A 3H0GG 4GN4B 2KA7A 3M4OH 4OEMB 3K7AH 5C0XJ 2DN8A 1N32Q 3E9IA 4UP7A 3AB9A 4IUTA 3KLRA 4KKTA 4KJOA 4DV1Q 5IP9H 5I9PA 2KQ3A 5LMNW 1QZHA 2PNHA 4WJ4A 3M9BA 2NB0A 5FLXc 3FDTA 4BY1H 1BDOA 1JE5A 1LT6D 1RCVD 1N33Q 4LF8L 3A5UA 4V190 5EPKA 2NVQH 2A69D 3ZJYC 3GTGH 3HOVG 4X3SA 4CBVA 3HKZG 1PH4A 3KOJA 1CKNB 3OTOQ 1VQIA 4RGNA 4OGQC 1RTOA 2QKIC 4Y52H 1U5KA 2PI2E 1M4VA 1PRTB 3F2CA 4ID6A 4POGA 4AQYQ 3SK6A 2A8VA 3I56A 4A3MB 4Q0FA 4DK1A 1LT3D 2A6EC 3T1HL 1WTWA 3NQTA 2NVYH 4X66Q 1A63A 1WCMH 4EVOA 4LF5Q 4JI1L 4P73A 4HIKA 5T1IA 2OTLA 2VXWA 4FF1A 3PGZA 3LX0A 2PNRC 2K5DA 2F1MA 2AUJD 5GADC 1TS2A 1DONA 2UXBL 1PH8A 2XVSA 1R9TB 1RJTA 5IE8A 3I55A 2MP1A 3R93A 3TBIB 2G9HD 1CM9A 3NELA 3VYRA 1UAPA 3S2HH 1WJJA 3CPFA 1BF4A 4A76A 1V8QA 1PMRA 1Y8OB 4LF4L 4V0BA 2VUMH 5A2QE 5E3FA 4PV1C 1HZCA 1IKMA 1GHKA 3H15A 4A3KH 2TMPA 3UDFA 1Q8KA 3I4OA 4A3CG 2Z6KA 4X3KA 4DV3L 1TWHH 1Q7YC 1BQQT 5FO7B 3BZKA 1MHWC 2ZT9C 4HMIA 4X65L 4CKEA 5I2YA 1N33L 4K5WA 4BY1B 5C6AA 3CCMA 3MTSA 3MWYW 4X62L 4XQJA 4IQZA 1E7ZA 1O78A 1Y1WH 4QF4A 3ND8A 3Q6SA 1VQ6A 1SYFA 4IFDH 4CKBA 1T5EA 1LTGD 1Z6HA 3NQIA 3A8KE 3M7GA 3CW2C 3D4DA 3BYYB 1ENCA 4B3RL 1RHPA 1IBLL 3DEPA 5LMNQ 4J6HA 2RA4A 5IIFA 2WKDA 4A3CH 1KAAA 4B9XA 3QOLA 2K28A 4HJ9A 4A3KG 3W2DA 2JA5G 1QG7A 1CA5A 1IW7C 2VUMG 2F0GA 4LAAA 5M5XB 1CHPD 5M3MB 2TSSA 1BUVT 3QIAA 4GNXB 1XYIA 3RLNA 4C3IB 1FNWA 1WTOA 1EL0A 4A75A 1UEAB 4C1NK 1K8GA 2MQHA 1FGUA 2C5CA 1EOVA 3MEFA 2EE1A 1CTMA 2BA1A 2HIVA 3F1ZA 4KMUC 2KENA 1LTBD 3GV6A 4C3IG 2K52A 2G9DA 3DHQA 2HT1A 2JA7B 2N49A 1NR4A 4JBKA 4ZQ3A 4YCUA 1JICA 1PRTC 2ES2A 1G91A 3F2UA 4OIKA 2AWOA 1XX8A 3PO2B 1RIPA 1VQBA 2RDGA 2K75A 4JI0L 3EJIA 1G8ZD 4IPGA 2KJXA 5COYA 5C4HA 4DR1Q 5EAYA 3HOVH 4UPAA 2UU9L 2PPBC 1HUMA 3J7AV 2JEBI 1AZPA 2OQ0A 1A0IA 3TEHB 2O5IC 3CCJA 3AYHB 2B63B 1B53A 1HCZA 2XRSD 3S16H 1KHIA 1LTLA 3R8BA 3RLOA 1F2LA 2E76C 4BY1G 5FOBB 4JBJA 4LJZC 4CKCA 1B9NA 1ONLA 4LNQA 4LFCQ 5KNBA 2EYPA 4WJWA 1HXYD 5A35A 3K7AB 2F4VL 1NAPA 1QE6A 3FHWA 3OMGA 1KXLA 1YI2A 1EQVA 2A69C 1NBWA 3OPOA 4B3SL 3EA6A 3NWTA 5IYCG 5BR8Q 4DV4L 5IGBA 1I4RA 4CDEC 4QGUA 3A0JA 5LL6S 3NP8A 4H13C 2XIWA 3U58A 3TS2A 3A8IE 5IT9c 2OT2A 3GDEA 1MBYA 2Y0SB 1I3QB 3V96A 4HCSA 1LT5D 4FNFA 1TR5A 1I4PA 1Y8NB 4DV7Q 4K5VA 4JI5Q 4DA2A 2I5LX 4R1JA 4EQOA 2J4XA 5CV4A 2Y0SE 1V1PA 3G6EA 5FLXL 1ESRA 4ALPA 1TWAH 1A8VA 2KEDA 2IW3A 1EY9A 1JB3A 1P8LA 4A93H 3HFZB 1BBXC 3GTGB 1EYAA 2L5TA 1SE8A 4A3DH 2UXDL 2Z6KC 3QR8A 1H9MA 3ULPA 2K14A 1AE3A 1SNOA 4UY8C 4ZCKA 1SSOA 1IZ6A 3M4PA 1CSPA 2F0LA 4K8IA 1QVGA 3OWEB 5T1GA 2L12A 4QUFA 4RGTA 2IPKD 3S2DH 4JK1C 4AYBB 4JI6Q 1F2MA 3CQZH 1FR3A 3DM1A 3U4VA 2K6AA 2M9VA 2E2IB 1IXRA 1H9SB 4G4KA 1STAA 1IYUA 1KC8C 3VYUA 2F3WA 5C3EB 5EBDA 2BCOA 5ELDA 3NE5B 4DR6Q 3CCRA 4O2DA 2E5LL
chains in the Genus database with same CATH topology
4BXXH 3AEVA 3CCUA 1TWCH 2UUCQ 2K5VA 4H02A 4IPCA 1UEBA 4XTCS 1M1KC 4YHHL 4GOPA 5JJKA 3HOXG 1X3GA 1X54A 2JK8A 1K73C 1XNRL 3M7NA 1PH7A 2K5HA 4LFBL 3I7FA 1VQFA 1HNZQ 3S1MH 1Y1VG 4JYAL 4OO1I 2UXDQ 1V1QA 3ULLA 2JA7G 5GAGC 2D62A 3Q8DA 1XMOL 2RHQB 3L0OA 1H95A 5IYBG 1D7QA 1U0LA 3NEMA 5IWAQ 4JV5L 4IOCA 2CQOA 4GLXA 4JI7L 4IFDI 2Z0SA 4B3SQ 2VL6A 1WFQA 3FKIG 4LF7L 2AHOB 1YNXA 1YJNA 1XNQL 3PUVA 4APVA 4DR6L 1Q12A 2B29A 4GOPB 5M3MH 1VQOA 1XPRA 3GO5A 5DLQE 1M90C 2F3IA 2HHHL 4LF7Q 4A3BH 2RF4A 4OONA 1SN8A 4Y7NH 1XNQQ 3PIPA 3STBD 1YJ9A 2UUBQ 5M3MG 3CCSA 3HOWH 5IWAL 4QL5A 4GNXC 4QQBX 3FKIH 2R7FA 2F4VQ 1G51A 3L7ZC 5GQOA 2NN6G 2MFIA 4LF9Q 4NXMQ 3M85A 1HNXQ 1GKHA 2BA0A 1XMQQ 3KFUA 1L1OA 4X64Q 2F52A 1K83H 1VQ8A 5GAEC 3PV0A 4YWLA 2VZAA 3K7UC 3W5OA 3OTOL 3FP9A 4YWKA 1Y1VH 5BR8L 1XJVA 3H3VH 1ASYA 1TWFH 1HZ9A 2CWAA 4DR5Q 1N34L 1O7IA 4JI4Q 3RR5A 2ZM6Q 1OXUA 1C0AA 2LSSA 1CSQA 1E1OA 1XPOA 4JI2L 3RZDH 2K50A 1JJ2A 4HIDA 1SLJA 1PH1A 1WI5A 1YZ6A 1G6PA 5AJ3Q 5JJLA 4L5SA 4PZ7A 2PQAB 3WWVA 4DV2L 4YY3Q 3KF8B 1NE3A 1YHAA 2GN5A 1N9WA 4DR2L 1XMQL 1GM5A 3HOWG 4B3TL 4JI3Q 4NPSA 2UXCL 3E9HA 1JJGA 5E7NA 3J81c 1RL2A 3PUZA 4A3BG 2OCEA 4A3EH 4EX5A 1MIUA 1NTGA 2MNAA 4B3TQ 4OWXB 1L0WA 1IL2A 3M4QA 1MJCA 4AIMA 1GO3E 3G4SA 3T1YQ 3GTLH 2KHIA 2IY5B 4YCWA 4DK3C 1OXXK 4DR3Q 1SMXA 5IYBH 4JOIA 3ULJA 4GKJL 3I2ZA 3B6YA 4IFDJ 2E2JH 2JA7H 1YHQA 1K9MC 3TS0A 5J3BA 2WP8J 4C3JH 2E8GA 4LUZA 1UE6A 3ER0A 3W1GA 5FJ8H 3HOXH 2E2HH 4A3FH 1Q82C 3JC66 2EQSA 2JE6I 1QUQB 4O0AA 5C4JH 4JYAQ 3K81C 4BXXG 1MKHA 4MZ9A 3EIVA 4NXNL 1EQQA 3CD6A 4YHHQ 4XIGS 5IP7H 1ASZA 4NXML 1P16A 3GTKH 1X56A 4KHZA 1NMGA 2VW9A 3PO2H 1JMCA 1VQLA 4GKJQ 4K0KL 5C0XG 4A93G 1YITA 5HY6A 4A3JG 2CCZA 1D8LA 1UE7A 1X6OA 3A5ZB 2UUBL 2UUAL 3LGJA 1EUJA 4IPHA 2Q2TA 4L5RC 3CCVA 4LFCL 4PZ8A 4QIWE 1HR0L 3PO3H 1I94L 1QUQA 2UUAQ 3T1HQ 4J15A 4B3RQ 1OXSC 4UP8A 2ZTEA 5JEAG 3J7A5 5LMNL 3PIOA 4JBWA 5ELNA 1Y14B 1KQSA 4A3GH 5M5WH 3F2BA 4JV5Q 4IOAA 3CCEA 2AWNA 4JBMA 3GTMH 4QY7A 1EWIA 1I50H 1YEZA 4LFBQ 3J80c 5H1SE 1VQPA 1PFSA 1OTCA 2OQKA 3T1YL 4P71A 4TVAB 5GAHC 1CUKA 2UUCL 4BY7H 3H0GG 4GN4B 1X9NA 3M4OH 3G71A 4L5TA 3K7AH 3K8AA 1I6HH 4A4IA 1W3SA 1VQCA 3TREA 5C0XJ 1N32Q 2D0PA 4A3DG 3E9IA 4JOIC 4UP9A 4UP7A 3ERSX 1UE5A 1FJGQ 4A3MH 2YU9H 4GKKQ 3CMAA 4DV1Q 4X64L 3CC7A 5IP9H 1KL9A 3CCQA 3S1RH 2WB1G 4X65Q 5C3EG 1BVSA 5LMUQ 2A19A 3KJPA 4BBSH 5IY0A 4KHPL 3S24A 1HJPA 3GTQH 3DM3A 5LMNW 1A62A 2CWPA 1E24A 4P75A 1QZHA 3PF4A 1VQ7A 1BBUA 2DUDA 2PNHA 2RHSB 4WJ4A 1YBYA 3M9BA 5FLXc 5LMUL 4KHPQ 2HIXA 1PYBA 2MO1A 1VS0A 4HJ5A 1VQKA 4BY1H 4P72A 1KIXA 5IYDG 1JE5A 3J7ZC 4A3LG 1B70B 2VNUD 2IT1A 2BH8A 2WAQE 3RNUA 5ELOA 3OW2A 1N33Q 3S15H 4LF8L 4NB3A 3A5UA 1S40A 2JA6G 4B3MQ 4JI4L 1JT8A 3RLFA 2FXQA 3ZJYC 2NVQH 3GTGH 3TRZA 1I5FA 1SR3A 3HOVG 1YHBA 4LF9L 3HKZG 3DLLA 1PH4A 3KOJA 3IRBA 1CKNB 1KAWA 1VQIA 3U50C 3OTOQ 4DV0L 1W2BA 1JB7A 2C35B 2ATWA 4KLKA 4BBRH 2AMCB 5IYCH 4Y52H 1U5KA 2PI2E 3F2CA 2Y0SG 3D31A 3S17H 2DGYA 1QZGA 4POGA 4AQYQ 4LF5L 2A8VA 4LUVA 3I56A 2HHHQ 3W1BA 3UDIA 1LYLA 1X55A 1Z47A 1CKMA 4GN5A 3T1HL 4AYBE 5M3FH 4A3IG 1PH2A 3I4MH 2NVYH 3PUWA 4X66Q 1WCMH 1GVPA 1A63A 4AQYL 3PCOB 4LF5Q 4JI1L 4P73A 4HIKA 4R4IA 2OTLA 1EIYB 3K80C 3GTPH 1Q1EA 3UE0A 3PGZA 3PUYA 3PF5A 1XTDA 4GNXA 2R93G 3KJOA 5GADC 1T9HA 2UXBL 1PH8A 3HOUG 3MXNB 3I55A 5IE8A 2JJQA 1L1OC 1B7YB 1UE1A 1MJEA 2QGQA 2YV5A 1XNRQ 2PI2A 1HZAA 3AQQA 3NELA 3KLWA 1VQJA 2JQOA 2OTJA 3S2HH 1GD7A 1WJJA 2LXKA 3CPFA 5C44G 4DR4Q 2LXJA 4GLVB 3KDFA 4A76A 1N36Q 1EFWA 3VDYA 1VQEA 2ZTCA 2WFWA 4B3ML 4EQ5A 4LF4L 1Z9FA 2BH2A 2B63G 1VCIA 4KI0A 5M5YH 2VUMH 3H3VI 2VQFL 1S3OA 1HZCA 1SROA 4A3DH 3I4NG 3H15A 4DV3Q 4DV6L 4HJ8A 4A3KH 1C7YA 3UDFA 1YIJA 1IBMQ 2KCMA 2GVAA 3PSIA 1PH5A 1Q8KA 3I4OA 2NZHA 4A3CG 3ICEA 4DV0Q 2Z6KA 4DV3L 1TWHH 2VQEL 1Q7YC 2R92H 2OWOA 3BZKA 3CPWA 4OX9Q 4JI6L 3HOYG 4JG2A 3HOZH 2JA8H 4X65L 2ZJRA 2N78A 4C3IH 2R7ZH 3F2DA 1PH9A 1VQ5A 1J5EQ 3A74A 3RZOH 1N33L 1JJCB 4L5QA 3EN2A 3CCMA 1HR0W 4JI8Q 4JCVE 4PZ6A 4LF4Q 5C4XG 1AH9A 3BU2A 1FVIA 4RG1A 2CFMA 1SRUA 3S1QH 4X62L 2QA4A 1E7ZA 1K0RA 4R4TA 1R9TH 1K8AC 2YTYA 2ZTDA 1Y1WH 1EYGA 1BKBA 3D0FA 1VQ6A 1HNXL 1E22A 3PUXA 1V43A 4GOPC 5C4XH 3JAMc 1VQHA 2VS1A 3CW2C 2HQLA 2R7ZG 4RMFA 2JA8G 1Q46A 4FDBA 3U4ZA 4DKAC 2ZJPA 1IBLL 3HOZG 4B3RL 2D0OA 3NENA 4GLAC 5LMNQ 1XPUA 2R92G 2KBNA 5FLMG 3CCLA 3KYHC 3EBEA 4A3CH 2YTXA 2JA5H 4YWMA 4HJ9A 4A3KG 3I4NH 4LWCA 4C3HH 4MTNA 2N8NA 2JA5G 5JJIA 4K0KQ 3STBC 1KD1C 1I94Q 2VUMG 2WB1E 1VQAA 5FLMH 1N36L 2B63H 3TQYA 1E3PA 4DV7L 2JEAI 1SFOH 1Q1BA 1PHJA 4GNXB 2UXDL 4NXNQ 4DUYQ 3RLNA 2R7DA 5C44H 1IBLQ 4IO9A 4A75A 2ALYB 4DNIA 4IFDG 1K8GA 1BBWA 1Y1WG 2NVTH 3HKSA 2MQHA 1FGUA 3SGIA 2NVXH 3JAMi 1EOVA 4DUYL 3MEFA 3HOUH 4X6AH 2MO0A 2BA1A 2HIVA 1Q86C 3F1ZA 4LF8Q 3CC2A 2KENA 3BJUA 3CP0A 4JI1Q 3CAMA 1HR0Q 4X62Q 2B3GA 2CKZB 1AE2A 3HKZE 2K52A 4AYBG 2PQAA 2N49A 3J80i 2HT1A 2ASBA 3HOYH 4JBKA 1HNWL 4YCUA 3KF6B 5M3FG 3UDGA 4A3IH 1V9PA 1KRTA 2ES2A 3GTJH 2EIFA 1PVOA 1QVCA 2UXCQ 1EIFA 2AWOA 1J6QA 4OXPA 1FJGL 2Q2HA 4ME3A 3NBHB 2IHFA 1RIPA 3CXCA 3UDXA 1X3EA 5JEAJ 4DV2Q 1VQBA 4OO1G 2K75A 4DR7Q 1YVCA 4LF6L 4BBRG 4MNOA 4JI0L 4IPGA 4DR1Q 1PYSB 5GROA 4YCVA 2ZJQA 5HGQA 2EXDA 2XGTA 5EAYA 4JI2Q 3CF5A 3HOVH 4UPAA 4DR3L 1IYJB 2UU9L 3RN2A 4DR1L 2JEBI 4JI0Q 2JA6H 2OQ0A 1A0IA 1OXTA 4QJFA 3TEHB 3BZCA 3CCJA 3AYHB 5M5XH 4GN3B 2WAQG 2ZM6L 1EQRA 2YYZA 2IX0A 4HIOA 1KHIA 1LTLA 4JI8L 1NJIC 2UU9Q 4OWWB 3RLOA 3S16H 2R93H 4DR7L 4A3LH 2VQEQ 1QVFA 4BY1G 4JBJA 4OX9L 1VQ4A 4GKKL 1L1OB 4POFA 4DV5Q 1UWVA 1L2FA 1LUZA 2I5HA 3L2PA 4DAYB 4DR2Q 4LNQA 1WCMG 4GS3A 2NN6I 4DV6Q 4LFCQ 3I4MG 4HJ7A 3OYYA 4BA1I 1LM0A 2RCNA 4BBSG 2F4VL 3FHWA 4X66L 2Q2UA 1N32L 2H5XA 1KXLA 1YI2A 1PV4A 1NBWA 4DR5L 4R4CA 3RN5A 4B3SL 1I3QH 4DR4L 5IYCG 5BR8Q 4JC0A 4DV4L 4LUOA 1HZBA 4JI5L 1HNZL 3K0XA 4BY7G 3G48A 3F8TA 4QGUA 3A0JA 4JI7Q 4BA2I 3UE1A 4DPGA 3U58A 3TS2A 1IBKL 1CKOA 5IT9c 4DV4Q 3GDEA 2E2IH 2I0QA 2KCTA 1X3FA 1X65A 2UXBQ 4P74A 1IBKQ 1CKNA 2K5NA 1WOCA 4A3GG 3GD7A 5IYDH 4DV7Q 1NY4A 1PH6A 3S14H 1DGSA 4AH6A 4R4OA 4JI5Q 2I5LX 4R1JA 2Y0SE 1OXVA 1J5EL 2AKWB 3KF6A 2A1AA 2GVBA 3G6EA 1E1TA 1Q81C 4ALPA 1TWAH 2PMZE 1A8VA 3M3YH 4JI3L 5C3EH 1KRSA 2Q2IA 1P8LA 2XTIA 1VQDA 1FL0A 1K3RA 5IP9G 4A3JH 4A93H 1XMOQ 3HFZB 4PMWA 4A3MG 5AJ3L 4LFAL 1VQ9A 1SE8A 1G291 4YY3L 2ID0A 1C9OA 1TXYA 4DV1L 2KHJA 2Z6KC 4IPDA 3AFQA 2QEXA 4DV5L 1S72A 1PA6A 3J81j 4DUZL 4A3FG 2N3SA 5FJ8G 3ULPA 3H0GH 2NZOA 1N34Q 2K14A 2E5LQ 3CC4A 1B8AA 1NMFA 1HNWQ 2JA9A 1AE3A 3J81i 4UY8C 2YTVA 1IZ6A 4DK6C 4C2MH 2L15A 5C0XI 3M4PA 4IJLA 4LF6Q 1CSPA 2VY3A 1HH2P 4R4QA 3GTOH 2I5MX 1QVGA 1TWGH 3KDFB 3E0EA 4IJHA 4LFAQ 3S2DH 4DUZQ 4WJ3M 1WYDA 4JI6Q 5K36G 2IX1A 1VQNA 4PG3A 3CQZH 4HJAA 3PO3G 3U4VA 4A3EG 1YJWA 1IBML 4DAMA 3S1NH 1IXRA 2R6GA 1N8RC 4HIMA 2V1CC 1KC8C 4OWTB 3CMEA 1PH3A 2VQFQ 3AFPA 1VQMA 4LW1A 4TQUS 2K4KA 3PO2G 4DR6Q 5IP7G 2IHEA 1VQGA 3CCRA 4O2DA 2E5LL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BXX H;  3AEV A;  3CCU A;  1TWC H;  2UUC Q;  2K5V A;  4H02 A;  4IPC A;  1UEB A;  4XTC S;  1M1K C;  4YHH L;  4GOP A;  5JJK A;  3HOX G;  1X3G A;  1X54 A;  2JK8 A;  1K73 C;  1XNR L;  3M7N A;  1PH7 A;  2K5H A;  4LFB L;  3I7F A;  1VQF A;  1HNZ Q;  3S1M H;  1Y1V G;  4JYA L;  4OO1 I;  2UXD Q;  1V1Q A;  3ULL A;  2JA7 G;  5GAG C;  2D62 A;  3Q8D A;  1XMO L;  2RHQ B;  3L0O A;  1H95 A;  5IYB G;  1D7Q A;  1U0L A;  3NEM A;  5IWA Q;  4JV5 L;  4IOC A;  2CQO A;  4GLX A;  4JI7 L;  4IFD I;  2Z0S A;  4B3S Q;  2VL6 A;  1WFQ A;  3FKI G;  4LF7 L;  2AHO B;  1YNX A;  1YJN A;  1XNQ L;  3PUV A;  4APV A;  4DR6 L;  1Q12 A;  2B29 A;  4GOP B;  5M3M H;  1VQO A;  1XPR A;  3GO5 A;  5DLQ E;  1M90 C;  2F3I A;  2HHH L;  4LF7 Q;  4A3B H;  2RF4 A;  4OON A;  1SN8 A;  4Y7N H;  1XNQ Q;  3PIP A;  3STB D;  1YJ9 A;  2UUB Q;  5M3M G;  3CCS A;  3HOW H;  5IWA L;  4QL5 A;  4GNX C;  4QQB X;  3FKI H;  2R7F A;  2F4V Q;  1G51 A;  3L7Z C;  5GQO A;  2NN6 G;  2MFI A;  4LF9 Q;  4NXM Q;  3M85 A;  1HNX Q;  1GKH A;  2BA0 A;  1XMQ Q;  3KFU A;  1L1O A;  4X64 Q;  2F52 A;  1K83 H;  1VQ8 A;  5GAE C;  3PV0 A;  4YWL A;  2VZA A;  3K7U C;  3W5O A;  3OTO L;  3FP9 A;  4YWK A;  1Y1V H;  5BR8 L;  1XJV A;  3H3V H;  1ASY A;  1TWF H;  1HZ9 A;  2CWA A;  4DR5 Q;  1N34 L;  1O7I A;  4JI4 Q;  3RR5 A;  2ZM6 Q;  1OXU A;  1C0A A;  2LSS A;  1CSQ A;  1E1O A;  1XPO A;  4JI2 L;  3RZD H;  2K50 A;  1JJ2 A;  4HID A;  1SLJ A;  1PH1 A;  1WI5 A;  1YZ6 A;  1G6P A;  5AJ3 Q;  5JJL A;  4L5S A;  4PZ7 A;  2PQA B;  3WWV A;  4DV2 L;  4YY3 Q;  3KF8 B;  1NE3 A;  1YHA A;  2GN5 A;  1N9W A;  4DR2 L;  1XMQ L;  1GM5 A;  3HOW G;  4B3T L;  4JI3 Q;  4NPS A;  2UXC L;  3E9H A;  1JJG A;  5E7N A;  3J81 c;  1RL2 A;  3PUZ A;  4A3B G;  2OCE A;  4A3E H;  4EX5 A;  1MIU A;  1NTG A;  2MNA A;  4B3T Q;  4OWX B;  1L0W A;  1IL2 A;  3M4Q A;  1MJC A;  4AIM A;  1GO3 E;  3G4S A;  3T1Y Q;  3GTL H;  2KHI A;  2IY5 B;  4YCW A;  4DK3 C;  1OXX K;  4DR3 Q;  1SMX A;  5IYB H;  4JOI A;  3ULJ A;  4GKJ L;  3I2Z A;  3B6Y A;  4IFD J;  2E2J H;  2JA7 H;  1YHQ A;  1K9M C;  3TS0 A;  5J3B A;  2WP8 J;  4C3J H;  2E8G A;  4LUZ A;  1UE6 A;  3ER0 A;  3W1G A;  5FJ8 H;  3HOX H;  2E2H H;  4A3F H;  1Q82 C;  3JC6 6;  2EQS A;  2JE6 I;  1QUQ B;  4O0A A;  5C4J H;  4JYA Q;  3K81 C;  4BXX G;  1MKH A;  4MZ9 A;  3EIV A;  4NXN L;  1EQQ A;  3CD6 A;  4YHH Q;  4XIG S;  5IP7 H;  1ASZ A;  4NXM L;  1P16 A;  3GTK H;  1X56 A;  4KHZ A;  1NMG A;  2VW9 A;  3PO2 H;  1JMC A;  1VQL A;  4GKJ Q;  4K0K L;  5C0X G;  4A93 G;  1YIT A;  5HY6 A;  4A3J G;  2CCZ A;  1D8L A;  1UE7 A;  1X6O A;  3A5Z B;  2UUB L;  2UUA L;  3LGJ A;  1EUJ A;  4IPH A;  2Q2T A;  4L5R C;  3CCV A;  4LFC L;  4PZ8 A;  4QIW E;  1HR0 L;  3PO3 H;  1I94 L;  1QUQ A;  2UUA Q;  3T1H Q;  4J15 A;  4B3R Q;  1OXS C;  4UP8 A;  2ZTE A;  5JEA G;  3J7A 5;  5LMN L;  3PIO A;  4JBW A;  5ELN A;  1Y14 B;  1KQS A;  4A3G H;  5M5W H;  3F2B A;  4JV5 Q;  4IOA A;  3CCE A;  2AWN A;  4JBM A;  3GTM H;  4QY7 A;  1EWI A;  1I50 H;  1YEZ A;  4LFB Q;  3J80 c;  5H1S E;  1VQP A;  1PFS A;  1OTC A;  2OQK A;  3T1Y L;  4P71 A;  4TVA B;  5GAH C;  1CUK A;  2UUC L;  4BY7 H;  3H0G G;  4GN4 B;  1X9N A;  3M4O H;  3G71 A;  4L5T A;  3K7A H;  3K8A A;  1I6H H;  4A4I A;  1W3S A;  1VQC A;  3TRE A;  5C0X J;  1N32 Q;  2D0P A;  4A3D G;  3E9I A;  4JOI C;  4UP9 A;  4UP7 A;  3ERS X;  1UE5 A;  1FJG Q;  4A3M H;  2YU9 H;  4GKK Q;  3CMA A;  4DV1 Q;  4X64 L;  3CC7 A;  5IP9 H;  1KL9 A;  3CCQ A;  3S1R H;  2WB1 G;  4X65 Q;  5C3E G;  1BVS A;  5LMU Q;  2A19 A;  3KJP A;  4BBS H;  5IY0 A;  4KHP L;  3S24 A;  1HJP A;  3GTQ H;  3DM3 A;  5LMN W;  1A62 A;  2CWP A;  1E24 A;  4P75 A;  1QZH A;  3PF4 A;  1VQ7 A;  1BBU A;  2DUD A;  2PNH A;  2RHS B;  4WJ4 A;  1YBY A;  3M9B A;  5FLX c;  5LMU L;  4KHP Q;  2HIX A;  1PYB A;  2MO1 A;  1VS0 A;  4HJ5 A;  1VQK A;  4BY1 H;  4P72 A;  1KIX A;  5IYD G;  1JE5 A;  3J7Z C;  4A3L G;  1B70 B;  2VNU D;  2IT1 A;  2BH8 A;  2WAQ E;  3RNU A;  5ELO A;  3OW2 A;  1N33 Q;  3S15 H;  4LF8 L;  4NB3 A;  3A5U A;  1S40 A;  2JA6 G;  4B3M Q;  4JI4 L;  1JT8 A;  3RLF A;  2FXQ A;  3ZJY C;  2NVQ H;  3GTG H;  3TRZ A;  1I5F A;  1SR3 A;  3HOV G;  1YHB A;  4LF9 L;  3HKZ G;  3DLL A;  1PH4 A;  3KOJ A;  3IRB A;  1CKN B;  1KAW A;  1VQI A;  3U50 C;  3OTO Q;  4DV0 L;  1W2B A;  1JB7 A;  2C35 B;  2ATW A;  4KLK A;  4BBR H;  2AMC B;  5IYC H;  4Y52 H;  1U5K A;  2PI2 E;  3F2C A;  2Y0S G;  3D31 A;  3S17 H;  2DGY A;  1QZG A;  4POG A;  4AQY Q;  4LF5 L;  2A8V A;  4LUV A;  3I56 A;  2HHH Q;  3W1B A;  3UDI A;  1LYL A;  1X55 A;  1Z47 A;  1CKM A;  4GN5 A;  3T1H L;  4AYB E;  5M3F H;  4A3I G;  1PH2 A;  3I4M H;  2NVY H;  3PUW A;  4X66 Q;  1WCM H;  1GVP A;  1A63 A;  4AQY L;  3PCO B;  4LF5 Q;  4JI1 L;  4P73 A;  4HIK A;  4R4I A;  2OTL A;  1EIY B;  3K80 C;  3GTP H;  1Q1E A;  3UE0 A;  3PGZ A;  3PUY A;  3PF5 A;  1XTD A;  4GNX A;  2R93 G;  3KJO A;  5GAD C;  1T9H A;  2UXB L;  1PH8 A;  3HOU G;  3MXN B;  3I55 A;  5IE8 A;  2JJQ A;  1L1O C;  1B7Y B;  1UE1 A;  1MJE A;  2QGQ A;  2YV5 A;  1XNR Q;  2PI2 A;  1HZA A;  3AQQ A;  3NEL A;  3KLW A;  1VQJ A;  2JQO A;  2OTJ A;  3S2H H;  1GD7 A;  1WJJ A;  2LXK A;  3CPF A;  5C44 G;  4DR4 Q;  2LXJ A;  4GLV B;  3KDF A;  4A76 A;  1N36 Q;  1EFW A;  3VDY A;  1VQE A;  2ZTC A;  2WFW A;  4B3M L;  4EQ5 A;  4LF4 L;  1Z9F A;  2BH2 A;  2B63 G;  1VCI A;  4KI0 A;  5M5Y H;  2VUM H;  3H3V I;  2VQF L;  1S3O A;  1HZC A;  1SRO A;  4A3D H;  3I4N G;  3H15 A;  4DV3 Q;  4DV6 L;  4HJ8 A;  4A3K H;  1C7Y A;  3UDF A;  1YIJ A;  1IBM Q;  2KCM A;  2GVA A;  3PSI A;  1PH5 A;  1Q8K A;  3I4O A;  2NZH A;  4A3C G;  3ICE A;  4DV0 Q;  2Z6K A;  4DV3 L;  1TWH H;  2VQE L;  1Q7Y C;  2R92 H;  2OWO A;  3BZK A;  3CPW A;  4OX9 Q;  4JI6 L;  3HOY G;  4JG2 A;  3HOZ H;  2JA8 H;  4X65 L;  2ZJR A;  2N78 A;  4C3I H;  2R7Z H;  3F2D A;  1PH9 A;  1VQ5 A;  1J5E Q;  3A74 A;  3RZO H;  1N33 L;  1JJC B;  4L5Q A;  3EN2 A;  3CCM A;  1HR0 W;  4JI8 Q;  4JCV E;  4PZ6 A;  4LF4 Q;  5C4X G;  1AH9 A;  3BU2 A;  1FVI A;  4RG1 A;  2CFM A;  1SRU A;  3S1Q H;  4X62 L;  2QA4 A;  1E7Z A;  1K0R A;  4R4T A;  1R9T H;  1K8A C;  2YTY A;  2ZTD A;  1Y1W H;  1EYG A;  1BKB A;  3D0F A;  1VQ6 A;  1HNX L;  1E22 A;  3PUX A;  1V43 A;  4GOP C;  5C4X H;  3JAM c;  1VQH A;  2VS1 A;  3CW2 C;  2HQL A;  2R7Z G;  4RMF A;  2JA8 G;  1Q46 A;  4FDB A;  3U4Z A;  4DKA C;  2ZJP A;  1IBL L;  3HOZ G;  4B3R L;  2D0O A;  3NEN A;  4GLA C;  5LMN Q;  1XPU A;  2R92 G;  2KBN A;  5FLM G;  3CCL A;  3KYH C;  3EBE A;  4A3C H;  2YTX A;  2JA5 H;  4YWM A;  4HJ9 A;  4A3K G;  3I4N H;  4LWC A;  4C3H H;  4MTN A;  2N8N A;  2JA5 G;  5JJI A;  4K0K Q;  3STB C;  1KD1 C;  1I94 Q;  2VUM G;  2WB1 E;  1VQA A;  5FLM H;  1N36 L;  2B63 H;  3TQY A;  1E3P A;  4DV7 L;  2JEA I;  1SFO H;  1Q1B A;  1PHJ A;  4GNX B;  2UXD L;  4NXN Q;  4DUY Q;  3RLN A;  2R7D A;  5C44 H;  1IBL Q;  4IO9 A;  4A75 A;  2ALY B;  4DNI A;  4IFD G;  1K8G A;  1BBW A;  1Y1W G;  2NVT H;  3HKS A;  2MQH A;  1FGU A;  3SGI A;  2NVX H;  3JAM i;  1EOV A;  4DUY L;  3MEF A;  3HOU H;  4X6A H;  2MO0 A;  2BA1 A;  2HIV A;  1Q86 C;  3F1Z A;  4LF8 Q;  3CC2 A;  2KEN A;  3BJU A;  3CP0 A;  4JI1 Q;  3CAM A;  1HR0 Q;  4X62 Q;  2B3G A;  2CKZ B;  1AE2 A;  3HKZ E;  2K52 A;  4AYB G;  2PQA A;  2N49 A;  3J80 i;  2HT1 A;  2ASB A;  3HOY H;  4JBK A;  1HNW L;  4YCU A;  3KF6 B;  5M3F G;  3UDG A;  4A3I H;  1V9P A;  1KRT A;  2ES2 A;  3GTJ H;  2EIF A;  1PVO A;  1QVC A;  2UXC Q;  1EIF A;  2AWO A;  1J6Q A;  4OXP A;  1FJG L;  2Q2H A;  4ME3 A;  3NBH B;  2IHF A;  1RIP A;  3CXC A;  3UDX A;  1X3E A;  5JEA J;  4DV2 Q;  1VQB A;  4OO1 G;  2K75 A;  4DR7 Q;  1YVC A;  4LF6 L;  4BBR G;  4MNO A;  4JI0 L;  4IPG A;  4DR1 Q;  1PYS B;  5GRO A;  4YCV A;  2ZJQ A;  5HGQ A;  2EXD A;  2XGT A;  5EAY A;  4JI2 Q;  3CF5 A;  3HOV H;  4UPA A;  4DR3 L;  1IYJ B;  2UU9 L;  3RN2 A;  4DR1 L;  2JEB I;  4JI0 Q;  2JA6 H;  2OQ0 A;  1A0I A;  1OXT A;  4QJF A;  3TEH B;  3BZC A;  3CCJ A;  3AYH B;  5M5X H;  4GN3 B;  2WAQ G;  2ZM6 L;  1EQR A;  2YYZ A;  2IX0 A;  4HIO A;  1KHI A;  1LTL A;  4JI8 L;  1NJI C;  2UU9 Q;  4OWW B;  3RLO A;  3S16 H;  2R93 H;  4DR7 L;  4A3L H;  2VQE Q;  1QVF A;  4BY1 G;  4JBJ A;  4OX9 L;  1VQ4 A;  4GKK L;  1L1O B;  4POF A;  4DV5 Q;  1UWV A;  1L2F A;  1LUZ A;  2I5H A;  3L2P A;  4DAY B;  4DR2 Q;  4LNQ A;  1WCM G;  4GS3 A;  2NN6 I;  4DV6 Q;  4LFC Q;  3I4M G;  4HJ7 A;  3OYY A;  4BA1 I;  1LM0 A;  2RCN A;  4BBS G;  2F4V L;  3FHW A;  4X66 L;  2Q2U A;  1N32 L;  2H5X A;  1KXL A;  1YI2 A;  1PV4 A;  1NBW A;  4DR5 L;  4R4C A;  3RN5 A;  4B3S L;  1I3Q H;  4DR4 L;  5IYC G;  5BR8 Q;  4JC0 A;  4DV4 L;  4LUO A;  1HZB A;  4JI5 L;  1HNZ L;  3K0X A;  4BY7 G;  3G48 A;  3F8T A;  4QGU A;  3A0J A;  4JI7 Q;  4BA2 I;  3UE1 A;  4DPG A;  3U58 A;  3TS2 A;  1IBK L;  1CKO A;  5IT9 c;  4DV4 Q;  3GDE A;  2E2I H;  2I0Q A;  2KCT A;  1X3F A;  1X65 A;  2UXB Q;  4P74 A;  1IBK Q;  1CKN A;  2K5N A;  1WOC A;  4A3G G;  3GD7 A;  5IYD H;  4DV7 Q;  1NY4 A;  1PH6 A;  3S14 H;  1DGS A;  4AH6 A;  4R4O A;  4JI5 Q;  2I5L X;  4R1J A;  2Y0S E;  1OXV A;  1J5E L;  2AKW B;  3KF6 A;  2A1A A;  2GVB A;  3G6E A;  1E1T A;  1Q81 C;  4ALP A;  1TWA H;  2PMZ E;  1A8V A;  3M3Y H;  4JI3 L;  5C3E H;  1KRS A;  2Q2I A;  1P8L A;  2XTI A;  1VQD A;  1FL0 A;  1K3R A;  5IP9 G;  4A3J H;  4A93 H;  1XMO Q;  3HFZ B;  4PMW A;  4A3M G;  5AJ3 L;  4LFA L;  1VQ9 A;  1SE8 A;  1G29 1;  4YY3 L;  2ID0 A;  1C9O A;  1TXY A;  4DV1 L;  2KHJ A;  2Z6K C;  4IPD A;  3AFQ A;  2QEX A;  4DV5 L;  1S72 A;  1PA6 A;  3J81 j;  4DUZ L;  4A3F G;  2N3S A;  5FJ8 G;  3ULP A;  3H0G H;  2NZO A;  1N34 Q;  2K14 A;  2E5L Q;  3CC4 A;  1B8A A;  1NMF A;  1HNW Q;  2JA9 A;  1AE3 A;  3J81 i;  4UY8 C;  2YTV A;  1IZ6 A;  4DK6 C;  4C2M H;  2L15 A;  5C0X I;  3M4P A;  4IJL A;  4LF6 Q;  1CSP A;  2VY3 A;  1HH2 P;  4R4Q A;  3GTO H;  2I5M X;  1QVG A;  1TWG H;  3KDF B;  3E0E A;  4IJH A;  4LFA Q;  3S2D H;  4DUZ Q;  4WJ3 M;  1WYD A;  4JI6 Q;  5K36 G;  2IX1 A;  1VQN A;  4PG3 A;  3CQZ H;  4HJA A;  3PO3 G;  3U4V A;  4A3E G;  1YJW A;  1IBM L;  4DAM A;  3S1N H;  1IXR A;  2R6G A;  1N8R C;  4HIM A;  2V1C C;  1KC8 C;  4OWT B;  3CME A;  1PH3 A;  2VQF Q;  3AFP A;  1VQM A;  4LW1 A;  4TQU S;  2K4K A;  3PO2 G;  4DR6 Q;  5IP7 G;  2IHE A;  1VQG A;  3CCR A;  4O2D A;  2E5L L; 
#chains in the Genus database with same CATH topology
 4ZKC B;  1TWC H;  3CCU A;  2K5V A;  4H02 A;  4IPC A;  1WTV A;  2F0D A;  3H09 A;  5JJK A;  1XNR L;  1K73 C;  4JYA L;  1PZK D;  3ULL A;  3JAM E;  2D62 A;  3Q8D A;  1QNK A;  2RHQ B;  1D7Q A;  3NEM A;  4G7Z C;  4KD4 A;  4JV5 L;  3HG9 A;  3T4A C;  3DEO A;  1EYC A;  2CQO A;  4IOC A;  4JI7 L;  2WII B;  4B3S Q;  2DJG C;  1YJN A;  3PUV A;  4APV A;  2B29 A;  1ESF A;  1M90 C;  3GO5 A;  5DLQ E;  1IHZ A;  3DMU A;  5BN3 A;  1XNQ Q;  2F0N A;  1SN8 A;  4IN3 A;  3PIP A;  1YJ9 A;  2UUB Q;  2R7F A;  2ZXR A;  1GUN A;  1G51 A;  3L7Z C;  5GQO A;  4ULL A;  1GKH A;  3V05 A;  1L1O A;  1WTH A;  2F52 A;  5EJW A;  2V4D A;  1VQ8 A;  2EY1 A;  4KV6 A;  4YWK A;  1Y1V H;  1TWF H;  1C8C A;  2CWA A;  1U9R A;  3S15 B;  5I4D A;  1K0S A;  3SXH A;  1E1O A;  3P75 A;  4A3E B;  4HID A;  5IGF A;  1RTN A;  2NN6 H;  3RD4 A;  4L5S A;  4XYO A;  3I8Z A;  5M5W B;  2GN5 A;  1HA6 A;  2L0C A;  3HOW G;  4B3T L;  1STB A;  1STE A;  4NPS A;  1JJG A;  2OCE A;  4IZ8 A;  4EX5 A;  1JCK B;  1NTG A;  1B44 D;  1JOK A;  4C3J B;  3HOW B;  3M4Q A;  3D3R A;  3WDN A;  1ZYR C;  1SEB D;  4YCW A;  1OXX K;  1TVX A;  4WOR A;  2Q8T A;  3DWQ A;  3B6Y A;  4DNT B;  2JA7 H;  2ICE C;  4DAP A;  1YHQ A;  5EKL A;  5DM7 3;  2WP8 J;  3N52 A;  4FXG C;  3TZU A;  1D1K A;  4RAU C;  2OXP A;  2EQS A;  2MHV A;  3BVM A;  4O0A A;  4JYA Q;  4BXX G;  1K8M A;  1I4G A;  4NXM L;  3PO2 H;  2XWJ B;  4K0K L;  5JAV A;  3KF8 A;  4RFB A;  1YIT A;  2LFN A;  2CCZ A;  3J7A F;  3LGJ A;  5IGE A;  3R2T A;  4ZKB B;  4QIW E;  3KLS X;  1B50 A;  2R3Z A;  2E75 C;  4J15 A;  1EZ8 A;  3WOE A;  3J7A 5;  5LMN L;  1KQS A;  4JBW A;  5ELN A;  3T51 B;  3FKI B;  2N88 A;  4QY7 A;  4LFB Q;  1YEZ A;  3ERO A;  5H1S E;  1B2T A;  1OTC A;  4RA8 A;  1CUK A;  2UUC L;  2Z1C A;  1I6H H;  2P5Z X;  2B2Y A;  2CQA A;  3TRE A;  2D0P A;  4JOI C;  1H9J A;  4J8Q A;  1Y8P B;  3HOV B;  1UE5 A;  2JP1 A;  5LL6 X;  2YU9 H;  1L0X B;  4RCO A;  4X64 L;  1KL9 A;  3CCQ A;  4QUC A;  4X3T A;  5C3E G;  1BVS A;  1DOK A;  2A19 A;  5LMU Q;  5IY0 A;  2RVL A;  4KD3 A;  3GTQ H;  1NSN S;  2CWP A;  2GA4 B;  3SHL A;  4P75 A;  1ILQ A;  1BBU A;  2DUD A;  1YBY A;  4HTH A;  4KHP Q;  2HIX A;  1PYB A;  2MO1 A;  1VS0 A;  4HJ5 A;  1KIX A;  5IYD G;  4A3L G;  1HFG A;  3J7Z C;  2WV6 D;  2HD3 A;  1XTC D;  4K2L A;  2VNU D;  1EEI D;  3OW2 A;  1JE4 A;  1SE3 A;  1CQF A;  1OO9 B;  2B8G A;  1TY0 A;  2FXQ A;  5AFW A;  3TRZ A;  5E1F A;  1YHB A;  3DLL A;  4OEL B;  1EOT A;  3IRB A;  1W2B A;  1WTX A;  2AMC B;  2DY8 A;  1DOM A;  1HTL D;  4LF5 L;  2HHH Q;  1JOO A;  5CV6 A;  1F9Q A;  1LYL A;  4GN5 A;  1CKM A;  5M3F H;  3I4M H;  4AQY L;  1EIY B;  3PQI A;  3UE0 A;  1D1I A;  3PUY A;  4GNX A;  2R93 G;  1F77 A;  2EY2 A;  2FFK B;  2FJ2 A;  4KKU A;  2HDL A;  3HOU G;  3MXN B;  4CDF C;  1B7Y B;  4HSP A;  2YV5 A;  3GTM B;  4XT1 B;  4L8J A;  3AQQ A;  1HZA A;  5K5P A;  2OTJ A;  2JQO A;  4GLV B;  3KDF A;  2Z4I A;  3VDY A;  2WFW A;  2QEJ C;  1CI3 M;  2Q8I B;  2BH2 A;  4IUU A;  1VCI A;  2PW5 A;  2SOB A;  2EY5 A;  3H3V I;  2CW0 C;  2FIN B;  2I46 A;  2F0K A;  4DV6 L;  2BDN A;  4HJ8 A;  1CQV A;  2ICI A;  1SYE A;  1YIJ A;  1H9R A;  1EY6 A;  1LTA D;  2H4O A;  4DV0 Q;  1BO0 A;  4EQN A;  2OWO A;  4OX9 Q;  4JI6 L;  3HOY G;  1NUC A;  4GKK Q;  3K6O A;  5IGG A;  2N78 A;  1VQ5 A;  1J5E Q;  3LWE A;  3OHX C;  3S9W A;  1I6V C;  1WD1 A;  5EQ0 A;  4DAV A;  2A6E D;  4JCV E;  4PZ6 A;  3TP5 A;  1R4Q B;  1JWU D;  3K57 A;  1DOL A;  3D0F A;  1E22 A;  1BR9 A;  3PUX A;  1V43 A;  5C4X H;  1QJO A;  3JAM c;  5EPJ A;  1VQH A;  2HQL A;  1KDA A;  2JA8 G;  1E0B A;  3U4Z A;  3ERQ A;  2ZJP A;  3C1E A;  2D0O A;  2R92 G;  1XPU A;  2EYH A;  5FLM G;  3CCL A;  1K3B C;  3EBE A;  2YTX A;  2JN4 A;  3I4N H;  4LWC A;  4C3H H;  2N8N A;  4DN4 M;  2O2L D;  4K0K Q;  2K01 A;  3N6R A;  2MUY A;  2SNS A;  1VQA A;  1PTO D;  4B08 A;  3TQY A;  1SFO H;  1S5B D;  1Q1B A;  1PHJ A;  4NXN Q;  5EKK A;  5C5M A;  3AU7 A;  5C44 H;  3KK7 A;  1IBL Q;  2BDO A;  1IYV A;  1ICW A;  2I07 B;  2NVT H;  1I4Q A;  1CZW A;  2MO0 A;  2RDH A;  1GUW A;  1A3U A;  1Q86 C;  3BJU A;  1HR0 Q;  2D9U A;  4X62 Q;  2B3G A;  2YU9 B;  1DZ1 A;  4AYB G;  2PQA A;  2NTT A;  2PQE A;  3KF6 B;  4A3I H;  1V9P A;  1L0Y B;  1QVC A;  1EIF A;  4A3K B;  1FJG L;  1R4P B;  4ME3 A;  1VMP A;  2IHF A;  3CXC A;  1VDZ A;  5COR A;  3CKI B;  5JEA J;  4OO1 G;  2K03 A;  3IFT A;  4DR7 Q;  4A3F B;  4ZRZ A;  2RQX A;  1PYS B;  4YCV A;  2ZJQ A;  5HGQ A;  1SND A;  1B4O A;  2F03 A;  4OL7 A;  5EPL A;  4DR1 L;  4JI0 Q;  2JA6 H;  2KVM A;  2Z6B A;  2L11 A;  2HCI A;  1S5C D;  2UU9 Q;  4JI8 L;  3GTL B;  2B2W C;  5D14 A;  3SDZ A;  4DR7 L;  2VQE Q;  1QVF A;  1VQ4 A;  3T56 B;  1UWV A;  4NW2 A;  3L2P A;  1EYD A;  4GS3 A;  2EYO A;  1GXD C;  2NVY B;  1LM0 A;  3X3N A;  2EVB A;  4X66 L;  3I90 A;  5CV7 A;  1PV4 A;  1TS4 A;  3UI2 A;  4DR4 L;  3J80 E;  3E6Z X;  4LUO A;  1LTT D;  1FNU A;  4BY7 G;  3G48 A;  1G2S A;  3F8T A;  5EBC A;  4JI7 Q;  4BA2 I;  4DPG A;  1CKO A;  3NTK A;  4KK7 A;  1BCP F;  2KCT A;  1X3F A;  4FP5 D;  4HCE A;  4BBS B;  1IBK Q;  1RKN A;  1CKN A;  2L1B A;  1F2Z A;  3I4M B;  4DU9 A;  1WOC A;  2AQ3 B;  2LMC B;  1SNM A;  4R4O A;  3CHB D;  1ZEQ X;  5CMD A;  2NVQ B;  1OXV A;  2EJF C;  1G6Z A;  2QDB A;  2AKW B;  2IWH A;  3V2T A;  4JI3 L;  4A3J H;  4ZUJ A;  5C3W A;  1LV9 A;  4PMW A;  4A3M G;  2ID0 A;  2M2L A;  4DV1 L;  4IPD A;  3GTO B;  3AFQ A;  4DV5 L;  4U67 3;  1I4X A;  1S72 A;  1PA6 A;  3J81 j;  4A3F G;  3CC4 A;  1HNW Q;  2JA9 A;  5I9O A;  2JYO A;  2L15 A;  5C0X I;  4JVZ A;  3HEJ A;  4LF6 Q;  4R4Q A;  3S1N B;  1HH2 P;  1PTO F;  1PTO H;  2I5M X;  4ZUI A;  2VB2 X;  5KYI A;  5JEA H;  3MC0 B;  4FF4 A;  2PZW A;  2IX1 A;  2SEB D;  1VQN A;  5JPM C;  3GTK B;  3TP7 A;  3PO3 G;  3QJY A;  1YJW A;  1CA6 A;  4EGV A;  4DGZ A;  1A15 A;  1N8R C;  5C0X H;  4OWT B;  1S5D D;  1PH3 A;  1HHV A;  1X3P A;  3LNN A;  4LMQ D;  4TQU S;  2IHE A;  1K3R A;  1Q90 A;  1T5X D;  3AEV A;  3OOC A;  4XTC S;  1M1K C;  1TWF B;  1W6J A;  4GOP A;  2JK8 A;  2K5H A;  2AUK A;  3I7F A;  4A93 B;  1HNZ Q;  4RGM A;  2KCN A;  1V1Q A;  2E74 C;  2D2C C;  3QWN A;  1XMO L;  1D6E C;  3MXG A;  3EQL C;  4RWS C;  4U68 A;  1SDF A;  2Z0S A;  1XNQ L;  5LHY 1;  1XPR A;  2O4X A;  4KY7 A;  1JWS D;  1PLF A;  1HPC A;  1KAB A;  2HHH L;  4BS9 A;  3MEH A;  3NTI A;  1JOQ A;  5M3M G;  1Q3L A;  3FKI H;  2F4V Q;  2MFI A;  3LWU A;  1SMY C;  2K05 A;  1HNX Q;  2EYM A;  5GAE C;  1G2T A;  3OTO L;  5G3L F;  2E2H B;  1AP0 A;  5D3I B;  1N34 L;  4DR5 Q;  1O7I A;  2XWB B;  3RR5 A;  2LSS A;  2D5D A;  1XPO A;  1PTO C;  1WI5 A;  4I7Z C;  1G6P A;  5AJ3 Q;  1EY4 A;  4PZ7 A;  5J1Z A;  3BVG A;  3EVQ A;  4DR2 L;  5CBA E;  2F0M A;  5BN5 A;  2K5W A;  1RL2 A;  3Q0A A;  5C4Z A;  3E3X A;  5KNC A;  4A3E H;  4KY6 A;  1L0W A;  1IL2 A;  1QNU A;  4UDU C;  4AIM A;  1GO3 E;  3G4S A;  2KHI A;  1EQT A;  4DR3 Q;  1SMX A;  2L9H A;  4JOI A;  4GKJ L;  3DXJ C;  3I2Z A;  2NZ1 D;  3EFX D;  5J3B A;  4C3J H;  1X3Q A;  2E8G A;  4LUZ A;  3ER0 A;  5FJ8 H;  3OMC A;  1Q82 C;  3JC6 6;  5C4J H;  1QUQ B;  5IOD A;  1K8O A;  1MGS A;  3CD6 A;  4YHH Q;  4IUP A;  1O7Y A;  4KHZ A;  1NMG A;  4XQQ A;  1VQL A;  4GKJ Q;  1ROD A;  5C0X G;  2XSC A;  4A3G B;  2LS0 1;  3A5Z B;  1UE7 A;  2UUA L;  3MFY A;  3S16 B;  3CCV A;  1K28 A;  1TKW B;  1SYB A;  4FXK C;  3PO3 H;  1CT1 D;  2F0U A;  3VR4 A;  2F0T A;  4CDD C;  4C3H B;  2F3V A;  4B3R Q;  4ODG A;  3IAY A;  5JEA G;  1ZKO A;  1Y14 B;  4A3G H;  1RD9 D;  1A6X A;  1SNC A;  3T53 B;  2AWN A;  3HOZ B;  3GTM H;  4FVM A;  1EWI A;  4EQP A;  1VQP A;  1PFS A;  2OQK A;  3T1Y L;  4RHS A;  1PXU A;  1YNN C;  4OIJ A;  1X9N A;  4ZK9 B;  3G71 A;  4L5T A;  2K04 A;  2R61 A;  1W3S A;  1VQC A;  1WCM B;  5CC4 A;  3QOJ A;  4IUQ A;  1I50 B;  4UP9 A;  3ERS X;  1PYW D;  4RKB A;  3TZD A;  4A3M H;  4P2C B;  3MXP A;  3CMA A;  3MXN A;  5DM6 3;  3S1R H;  2WB1 G;  4X65 Q;  3MAQ A;  4BBS H;  1HJP A;  1AZQ A;  1A62 A;  3PF4 A;  2F0Q A;  2L4N A;  1VQ7 A;  1SMY D;  1VQK A;  3X3M A;  5C5L A;  3VYT A;  1B70 B;  1RF2 D;  2K33 A;  2BH8 A;  4BWG B;  3S15 H;  5J39 A;  1S40 A;  4JI4 L;  1IW7 D;  3CQZ B;  2CH4 A;  1EY5 A;  5NUC A;  1B1Z A;  1KAW A;  2FMC A;  2ATW A;  5FO9 B;  4KLK A;  4O42 A;  4BBR H;  2PMZ B;  1F9S A;  3D31 A;  2DJF C;  2BE5 D;  3S17 H;  1QZG A;  1LTR D;  3FRP B;  4QMG A;  3W1B A;  1PZJ D;  1SBB B;  3UDI A;  1JWM D;  2R92 B;  3PUW A;  1MD2 D;  4K8J A;  4R4I A;  3BG3 A;  3IKJ A;  1Q1E A;  3GTP H;  2B2W A;  3MA2 B;  1O7Z A;  3PF5 A;  3OWF A;  4FYD A;  4MHE A;  3A55 A;  4TRD A;  3SK5 A;  2F0H A;  3VR5 A;  2WAC A;  2PI2 A;  1XNR Q;  2LXK A;  4CJ1 B;  1GUS A;  3FPU B;  1EFW A;  2BE5 C;  4K2K A;  3NWS A;  2ZTC A;  1S5E D;  4EQ5 A;  1TWH B;  2WAQ B;  3G7L A;  2B63 G;  4CHT B;  4KI0 A;  1LAC A;  2VQF L;  3S14 B;  5A2Q L;  1SRO A;  2WIN B;  1C7Y A;  2HCC A;  3PSI A;  3ICE A;  1M8A A;  3GTQ B;  1KNA A;  5KGU A;  3CPW A;  3HOZ H;  2RDF A;  2KEE A;  5C44 B;  2R7Z H;  1PH9 A;  1JJC B;  4L5Q A;  1HR0 W;  4XXE A;  4JI8 Q;  1AH9 A;  1C4Q A;  4RG1 A;  2CFM A;  2X6G A;  2Z4H A;  4ZLT F;  3HOU B;  4R4T A;  1R9T H;  3I4L A;  1I6H B;  2ZTD A;  3NTH A;  1EYG A;  3VA5 A;  5ELE A;  1HNX L;  3FEW X;  4GOP C;  5CYU A;  1STH A;  2A5H A;  1EY0 A;  2R7Z G;  2NUC A;  4RMF A;  4DF7 A;  4DKA C;  1PTO B;  3HOZ G;  2BOS A;  2LY7 A;  2NWG A;  1VMC A;  3NEN A;  4GLA C;  4IUR A;  4K14 A;  4LK1 C;  1U4L A;  1LTI D;  2F0S A;  2KBN A;  3KYH C;  4C3H G;  4MTN A;  3BDO A;  5FLM H;  2B2Y C;  3C46 A;  2B63 H;  4DV7 L;  1EFI D;  5C4J B;  3VR2 A;  4DUY Q;  2R7D A;  2ALY B;  4DNI A;  2O5J C;  1BBW A;  4DUY L;  3K58 A;  3CP0 A;  4JI1 Q;  2CKZ B;  3BZD B;  3CU7 A;  3HOY H;  3J80 i;  2E2J B;  2EYF A;  1UUP A;  3K59 A;  1KRT A;  4GZY C;  3GTJ H;  2EIF A;  2HDM A;  3I3C A;  2UXC Q;  3ZYY X;  3VR6 A;  3NBH B;  1WTP A;  3UDX A;  1S5F D;  4DV2 Q;  2EJM A;  2H1E A;  1O80 A;  1YVC A;  4LF6 L;  4BBR G;  1D5Z C;  4MNO A;  5GRO A;  2EXD A;  4JI2 Q;  3H3V C;  4DR3 L;  1E2W A;  1IYJ B;  4QJF A;  5FO8 B;  5M5X H;  3NBH A;  1KLU D;  2YYZ A;  2IX0 A;  4HIO A;  1MSH A;  1NJI C;  1GUG A;  2R93 H;  5EKI A;  2KHS A;  4MIU A;  1J8I A;  4OX9 L;  1EWC A;  4GKK L;  4KTA A;  2QCP X;  4DV5 Q;  1L2F A;  3K5O A;  1TWA B;  4DAY B;  4DR2 Q;  2NN6 I;  3I4M G;  4HJ7 A;  4BBS G;  2RCN A;  4DK0 A;  2WKC A;  2Q2U A;  1N32 L;  3JAM L;  3VYS A;  4DNR B;  2H5X A;  4DR5 L;  4R4C A;  1TII D;  1I3Q H;  3M4O B;  4JC0 A;  2IL8 A;  1HZB A;  3CRK C;  2L55 A;  1SYG A;  4CGY B;  4KN4 C;  1IBK L;  5F2D A;  5KND A;  3ND9 A;  4HR7 B;  4R8N A;  2I0Q A;  1CZG A;  1MI2 A;  4E6I A;  1X65 A;  1TT2 A;  3OSO A;  4P74 A;  4TKO B;  4A3G G;  3GD7 A;  1YNN D;  5IYD H;  5JVG 3;  1PH6 A;  5EGT A;  1DGS A;  1KTK A;  4F88 A;  2A6H D;  3MXU A;  3G6J B;  4RGO S;  4G57 A;  1J5E L;  3KF6 A;  2GVB A;  1Q81 C;  2PMZ E;  1GUO A;  3P7J A;  3M3Y H;  1C48 A;  5C3E H;  3KLS A;  3HZX A;  1TQO A;  3DWA A;  3E5S A;  2XTI A;  1VQD A;  1FL0 A;  3T16 A;  4I7A A;  3S1M B;  3GTJ B;  1XMO Q;  3S2H B;  2PZU A;  5AJ3 L;  4LFA L;  3P1H A;  1FD7 D;  1HNZ L;  3GP7 A;  3K0Y A;  2QEX A;  5DNF A;  1HUN A;  2N3S A;  5FJ8 G;  1N34 Q;  4C3J G;  1NMF A;  2RBM A;  3J81 i;  1X32 A;  2KCC A;  2JSO A;  4DK6 C;  5JOB A;  4A3B B;  1U4M A;  3GV3 A;  2A6H C;  3KDF B;  5D65 A;  1HQM C;  4LFA Q;  4DUZ Q;  1EEF D;  4QB4 A;  1DCZ A;  4A3E G;  4DAM A;  2KOL A;  3S1N H;  4WRD A;  5KYL A;  2F0J A;  4HIM A;  5I6Y A;  3KBX A;  3CME A;  4KKS A;  1A2T A;  1VQM A;  3PO2 G;  3L9A X;  1VQG A;  1HNW L;  4BXX H;  2B8F A;  1FNV A;  4M8A A;  1SYD A;  1UEB A;  1X3G A;  1X54 A;  4FF3 A;  3TME A;  1S4Z A;  4A3J B;  1PH7 A;  1VQF A;  2JA7 G;  1JC7 A;  3L0O A;  4RH6 A;  1U0L A;  3DWP A;  5IWA Q;  1BOS A;  1GJX A;  2DNE A;  1QWY A;  4IFD I;  3ITP A;  2KEC A;  1WVL A;  1WFQ A;  3FKI G;  2AHO B;  1AEX A;  4DR6 L;  1Q12 A;  5M3M H;  1VQO A;  4N8X 1;  4KHV A;  1PFM A;  2F3I A;  3M4Y A;  4LF7 Q;  4OON A;  4Y7N H;  1H9S A;  1ILP A;  1O7L A;  3CCS A;  3HOW H;  4GNX C;  3HOX B;  3W3A A;  2Z8L A;  4LF9 Q;  2NN6 G;  4H7B A;  4NXM Q;  2BA0 A;  1XMQ Q;  3VA7 A;  2PYK A;  4X64 Q;  2VB3 X;  1VF7 A;  3A54 A;  5FKA C;  2VZA A;  4FXD A;  3W5O A;  1ZYR D;  3SE0 A;  3ONA B;  2K1B A;  1RDP D;  2ZM6 Q;  1OXU A;  1QOH A;  4JI2 L;  3I73 A;  1JJ2 A;  1PH1 A;  1H9K A;  1U4R A;  1YZ6 A;  3IFD A;  4FF2 A;  2EYJ A;  2PQA B;  4DV2 L;  1ENA A;  3KF8 B;  1XMQ L;  1GM5 A;  2MGS A;  5DAU A;  2WB1 B;  1STG A;  4JI3 Q;  3BDL A;  3E9H A;  2UXC L;  5E7N A;  3J81 c;  1BXT A;  1MIU A;  1SAP A;  4O1N A;  4B3T Q;  3L3O C;  3P20 A;  3HOY B;  3FVQ A;  4L6T B;  2SDF A;  1A2U A;  2IY5 B;  4DK3 C;  3Q23 A;  1V1O A;  1CFM A;  1SYC A;  4OHJ A;  3RUZ A;  2K32 A;  3FMC A;  2E2J H;  1LO5 D;  1TS3 A;  1CK1 A;  5IGC A;  4ILW A;  4TSS A;  3TP6 A;  4A3I B;  4A3F H;  1STN A;  2EYL A;  1Y1W B;  1MKH A;  4MZ9 A;  2E2D C;  4ME5 A;  1EWH A;  1ASZ A;  3RZD B;  3GTK H;  1P16 A;  1X56 A;  2VW9 A;  1JMC A;  2N55 A;  5HY6 A;  3U9S A;  4A3J G;  4S3S A;  1A3T A;  1X6O A;  2UUB L;  4IPH A;  4L5R C;  1II3 A;  2VUM B;  2KUM A;  2ENB A;  1HR0 L;  1AW7 A;  1I94 L;  4IUV A;  2ZTE A;  4UP8 A;  4K6L A;  2SNM A;  2B2V C;  5M5W H;  3F2B A;  5G3L D;  4JV5 Q;  4IOA A;  3CCE A;  4QIW B;  3TDQ A;  5KRU A;  4JBM A;  5D3D A;  3J80 c;  2MPM A;  1JQY D;  4P71 A;  1JR0 D;  4UHV A;  1QIL A;  2QIL A;  3NBI A;  4DXG A;  4BY7 H;  1PRT D;  3K8A A;  4RHR A;  4A4I A;  1TY2 A;  3MZ5 A;  1EIH A;  4J1M A;  3A56 A;  4A3D G;  4R9W A;  1FJG Q;  2F0V A;  3CC7 A;  2IX3 A;  3NK9 A;  4KHP L;  3KJP A;  3S24 A;  2A68 D;  5CV9 A;  3DM3 A;  1E24 A;  4HAE A;  2RHS B;  4CDC C;  3D8G A;  5LMU L;  4P72 A;  3HP3 A;  3OW7 A;  4DXF A;  3M3Y B;  4KN7 C;  2IT1 A;  2WAQ E;  3RNU A;  4RKL A;  5ELO A;  1SE4 A;  1NCV A;  4NB3 A;  2JA6 G;  4B3M Q;  1JT8 A;  3RLF A;  1I5F A;  1SR3 A;  4LF9 L;  5FK9 C;  2B2T C;  1BNZ A;  1GUT A;  4DV0 L;  3U50 C;  2CW0 D;  2C35 B;  4PMB A;  1QB5 D;  1JB7 A;  5IYC H;  2J7Z A;  2FHT A;  4OO1 H;  2Y0S G;  1SNP A;  3J81 L;  4QCL A;  2DGY A;  3URY A;  1TU2 B;  4LUV A;  1X55 A;  4A3I G;  1Z47 A;  1TWG B;  4AYB E;  1BCP C;  1PH2 A;  2NBF A;  1GVP A;  3U9O A;  3PCO B;  1EY8 A;  2B2U A;  3QG1 A;  5E4X A;  3K80 C;  4C2M B;  5JJZ A;  4PQX A;  3NHH A;  1XTD A;  3A7A B;  3KJO A;  3C3L A;  1T9H A;  1PFN A;  3BDC A;  2NVX B;  4IAL A;  4DAY A;  2XN9 C;  4NP5 A;  2JJQ A;  1L1O C;  5I2X A;  1UE1 A;  4Q5V A;  2QGQ A;  1MJE A;  3R2I A;  3KLW A;  1VQJ A;  5ELB A;  2Z9H A;  4ZAI A;  1GD7 A;  1WD0 A;  2LKV A;  5C44 G;  4DR4 Q;  2LXJ A;  1N36 Q;  4IUN A;  5CGK A;  2EDG A;  1VQE A;  4B3M L;  1Z9F A;  2F0W A;  2RCF A;  5M5Y H;  1SJH D;  1PRT F;  5CV5 A;  1F9R A;  1S3O A;  2B39 A;  3I4N G;  4DV3 Q;  1XWE A;  1IBM Q;  2KCM A;  2GVA A;  1PH5 A;  3D4R A;  2EZV A;  3H94 A;  2NZH A;  2F0E A;  1QCB D;  3SVM A;  4G7H C;  1SFO B;  2VQE L;  3PIO 3;  2R92 H;  3HRZ C;  4JG2 A;  2JA8 H;  2ZJR A;  4C3I H;  4FO2 A;  3F2D A;  3TN2 A;  3A74 A;  3RZO H;  3NXW A;  4MTK A;  5C4X G;  3EN2 A;  3SR1 A;  2C9O A;  4LF4 Q;  3BU2 A;  1FVI A;  2XRQ D;  1SRU A;  3S1Q H;  5FLX E;  2QA4 A;  3TP8 A;  1K0R A;  2X69 A;  4B9W A;  1K8A C;  2YTY A;  3AMU A;  4CJ2 C;  1BKB A;  2Q8R E;  3I4N B;  3R3O A;  2VS1 A;  3FPP A;  2M00 A;  1Q46 A;  3E0J A;  4FDB A;  5HUR A;  1HA5 A;  4F7X A;  5C3X A;  2JA5 H;  3KBG A;  4YWM A;  5JJI A;  1EY7 A;  3STB C;  1Y1V B;  1KD1 C;  1I94 Q;  2WB1 E;  1NNX A;  2MJ8 A;  1N36 L;  3RMH A;  3Q24 A;  1E3P A;  2JEA I;  1B9M A;  1E2Z A;  3HS0 C;  4L63 B;  1I4H A;  4IO9 A;  3D4W A;  4IFD G;  2DNC A;  1Y1W G;  4DFA A;  3HKS A;  4ZYS A;  2NVX H;  3SGI A;  2PW7 A;  3JAM i;  3J80 L;  3D6W A;  3QO2 A;  3HOU H;  4X6A H;  4KJN A;  4LF8 Q;  2OF1 A;  3CC2 A;  3CAM A;  4K5X A;  1AE2 A;  3HKZ E;  4F8M A;  2CH4 W;  2ASB A;  2A74 C;  1B3Q A;  4XDX A;  1HQR D;  5M3F G;  3UDG A;  5CV8 A;  1Y69 U;  1PVO A;  3HKZ B;  3Q22 A;  4MN3 A;  5C4X B;  2EJG C;  1J6Q A;  3HGB A;  4OXP A;  2K5Q A;  2Q2H A;  3O13 A;  1X3E A;  1A3V A;  2XGT A;  1W6K A;  4XQN A;  3CF5 A;  3RZO B;  3RN2 A;  3WOF A;  1SE2 A;  1IKL A;  5M9O A;  1OXT A;  3BZC A;  5IT9 L;  4GN3 B;  2WAQ G;  2ZM6 L;  1WTQ A;  1EQR A;  3NUC A;  1EU4 A;  3SK4 A;  4OWW B;  4A3L H;  3K5L A;  1L1O B;  4POF A;  1LUZ A;  2I5H A;  1WCM G;  4DV6 Q;  1STY A;  2IJ0 A;  5CR3 A;  5M3F B;  1KLG D;  5KEE A;  3OYY A;  5ELC A;  4BA1 I;  1DD2 A;  4XT3 B;  1SNQ A;  1IL8 A;  2JXM B;  5JVH 3;  5IT9 E;  3MFG A;  1TWC B;  5JPN C;  3RN5 A;  2B2U C;  3S1Q B;  5IGD A;  1AN8 A;  4JI5 L;  1U4P A;  3K0X A;  2PO4 A;  3S2D B;  3D6C A;  3UE1 A;  1ZXT A;  5DEH A;  4DV4 Q;  2E2I H;  4CJ0 B;  3K5M A;  4HSV A;  2UXB Q;  1HTP A;  2K5N A;  1NY4 A;  3S14 H;  4WFN 3;  4AH6 A;  2R93 B;  2JA5 B;  3BVZ A;  5ELF A;  1B3A A;  1YNJ C;  1HFN A;  2ZXP A;  2A1A A;  1E1T A;  2EXZ A;  3H6M A;  4NDX A;  2F0I A;  1KRS A;  4F87 A;  4JPB W;  2Q2I A;  2NTS A;  5IP9 G;  2RSN A;  1KNE A;  1AFP A;  1VQ9 A;  3I70 A;  1G29 1;  4YY3 L;  1C9O A;  1TXY A;  4KY5 A;  2F0F A;  2KHJ A;  3I72 A;  3J7Y W;  2K7V A;  2NVT B;  4BBR B;  4DUZ L;  3H0G H;  2NZO A;  2FMM A;  3KUP A;  4N9P A;  2E5L Q;  1B8A A;  1MSG A;  1XXG A;  2YTV A;  3S17 B;  4YIJ A;  4C2M H;  1BCP D;  4H44 C;  4IJL A;  2VY3 A;  4PNY A;  4A3D B;  2JA6 B;  5ISR A;  2G5D A;  3GTO H;  4HN7 A;  2J0T D;  1TWG H;  3J81 E;  2CHB D;  2A68 C;  1ET6 A;  3H0G B;  3E0E A;  4IJH A;  2B2T A;  4WJ3 M;  1WYD A;  5K36 G;  4RCN A;  4PG3 A;  4HJA A;  4Y7N B;  1IBM L;  3K5N A;  3PMF A;  4HMJ A;  1HRJ A;  2R6G A;  3C2P A;  2V1C C;  3A8J E;  2VQF Q;  3AFP A;  5M5Y B;  4LW1 A;  2K4K A;  5IP7 G;  2EOT A;  2OEO A;  3T13 A;  2UUC Q;  1VF5 C;  4H0L C;  2F0O A;  4YHH L;  3HOX G;  3M7N A;  4R8I A;  4XYQ A;  1ML0 D;  4LFB L;  3S1M H;  4OO1 I;  2UXD Q;  1Y1V G;  4JW0 A;  3H91 A;  5GAG C;  5CBE E;  1GOZ A;  5HGT A;  5IYB G;  1H95 A;  1PDQ A;  4GLX A;  3SEB A;  2VL6 A;  3CRL C;  4LF7 L;  4PMC A;  1YNX A;  1JOR A;  1ICF B;  2PZT A;  4GOP B;  2R7Z B;  3PO3 B;  1K83 B;  1ENF A;  3MVV A;  4C56 C;  1KDB A;  5BN4 A;  2RF4 A;  4A3B H;  1EZ6 A;  2DY7 A;  4N9T A;  3STB D;  5IWA L;  4QL5 A;  2X6L A;  4QQB X;  4C1N I;  1NR2 A;  1LLR D;  4HED A;  3M85 A;  3KFU A;  4K6D A;  3GTP B;  1K83 H;  2EY6 A;  2PCF B;  3PV0 A;  4YWL A;  2CVR A;  3K7U C;  3QB3 A;  3TSS A;  3FP9 A;  4X3U A;  5BR8 L;  1XJV A;  3H3V H;  5E4W C;  1ASY A;  2AQ1 B;  1HZ9 A;  3OIQ A;  4JI4 Q;  1C0A A;  2JA8 B;  1CSQ A;  2QF7 A;  1EU3 A;  1DJR D;  1ET9 A;  2K50 A;  4N8F A;  4M1U B;  3RZD H;  1SLJ A;  1UNS A;  1YNJ D;  5TSS A;  3BYT B;  5JJL A;  2HQE A;  3WWV A;  2B2V A;  2ZXO A;  4YY3 Q;  1NE3 A;  1F9P A;  1YHA A;  1N9W A;  3I91 A;  3DUZ A;  1LTS D;  2F0P A;  3PUZ A;  1D5M C;  1GHJ A;  4A3B G;  4G7O C;  2QDL A;  2XNA C;  1SXT A;  2MNA A;  4ABN A;  1EIG A;  2EPB A;  5KIX A;  2HUG A;  1FYC A;  4OWX B;  3OIP A;  1MJC A;  3C1F A;  3T1Y Q;  3GTL H;  1KDC A;  3SK8 A;  1DM0 B;  1LT4 D;  4NMZ A;  5IYB H;  3A7L A;  2A73 B;  3ULJ A;  1V1P B;  4IFD J;  1BCP B;  4BY7 B;  1K9M C;  3TS0 A;  1SJE D;  3S1R B;  3HOX H;  1UE6 A;  1Z7T A;  2F4I A;  4UAI A;  3W1G A;  5I6W A;  2E2H H;  2JE6 I;  5IOC A;  3K81 C;  1CHQ D;  4NXN L;  3EIV A;  1TS5 A;  2RSO A;  1EQQ A;  3BS1 A;  4XIG S;  5IP7 H;  1PFB A;  4NKL A;  3PIP 3;  3MHB A;  4A93 G;  1DXM A;  3IL8 A;  2AQ2 B;  2QW7 A;  1D8L A;  3GQB A;  1DYQ A;  1EUJ A;  2Q2T A;  1WTR A;  4LFC L;  4PZ8 A;  2RKS A;  3NSW A;  1QUQ A;  1LAB A;  1PZI D;  1Q8I A;  3T1H Q;  2UUA Q;  5K36 H;  1FGB D;  1OXS C;  5J22 A;  1D2B A;  4Z9C B;  3NPP A;  3PIO A;  1E2V A;  2NYZ D;  1D5X C;  1I50 H;  1F2Y A;  4TVA B;  5GAH C;  3VR3 A;  4I65 A;  1J9O A;  5L37 A;  3H0G G;  4GN4 B;  2KA7 A;  3M4O H;  4OEM B;  3K7A H;  5C0X J;  2DN8 A;  1N32 Q;  3E9I A;  4UP7 A;  3AB9 A;  4IUT A;  3KLR A;  4KKT A;  4KJO A;  4DV1 Q;  5IP9 H;  5I9P A;  2KQ3 A;  5LMN W;  1QZH A;  2PNH A;  4WJ4 A;  3M9B A;  2NB0 A;  5FLX c;  3FDT A;  4BY1 H;  1BDO A;  1JE5 A;  1LT6 D;  1RCV D;  1N33 Q;  4LF8 L;  3A5U A;  4V19 0;  5EPK A;  2NVQ H;  2A69 D;  3ZJY C;  3GTG H;  3HOV G;  4X3S A;  4CBV A;  3HKZ G;  1PH4 A;  3KOJ A;  1CKN B;  3OTO Q;  1VQI A;  4RGN A;  4OGQ C;  1RTO A;  2QKI C;  4Y52 H;  1U5K A;  2PI2 E;  1M4V A;  1PRT B;  3F2C A;  4ID6 A;  4POG A;  4AQY Q;  3SK6 A;  2A8V A;  3I56 A;  4A3M B;  4Q0F A;  4DK1 A;  1LT3 D;  2A6E C;  3T1H L;  1WTW A;  3NQT A;  2NVY H;  4X66 Q;  1A63 A;  1WCM H;  4EVO A;  4LF5 Q;  4JI1 L;  4P73 A;  4HIK A;  5T1I A;  2OTL A;  2VXW A;  4FF1 A;  3PGZ A;  3LX0 A;  2PNR C;  2K5D A;  2F1M A;  2AUJ D;  5GAD C;  1TS2 A;  1DON A;  2UXB L;  1PH8 A;  2XVS A;  1R9T B;  1RJT A;  5IE8 A;  3I55 A;  2MP1 A;  3R93 A;  3TBI B;  2G9H D;  1CM9 A;  3NEL A;  3VYR A;  1UAP A;  3S2H H;  1WJJ A;  3CPF A;  1BF4 A;  4A76 A;  1V8Q A;  1PMR A;  1Y8O B;  4LF4 L;  4V0B A;  2VUM H;  5A2Q E;  5E3F A;  4PV1 C;  1HZC A;  1IKM A;  1GHK A;  3H15 A;  4A3K H;  2TMP A;  3UDF A;  1Q8K A;  3I4O A;  4A3C G;  2Z6K A;  4X3K A;  4DV3 L;  1TWH H;  1Q7Y C;  1BQQ T;  5FO7 B;  3BZK A;  1MHW C;  2ZT9 C;  4HMI A;  4X65 L;  4CKE A;  5I2Y A;  1N33 L;  4K5W A;  4BY1 B;  5C6A A;  3CCM A;  3MTS A;  3MWY W;  4X62 L;  4XQJ A;  4IQZ A;  1E7Z A;  1O78 A;  1Y1W H;  4QF4 A;  3ND8 A;  3Q6S A;  1VQ6 A;  1SYF A;  4IFD H;  4CKB A;  1T5E A;  1LTG D;  1Z6H A;  3NQI A;  3A8K E;  3M7G A;  3CW2 C;  3D4D A;  3BYY B;  1ENC A;  4B3R L;  1RHP A;  1IBL L;  3DEP A;  5LMN Q;  4J6H A;  2RA4 A;  5IIF A;  2WKD A;  4A3C H;  1KAA A;  4B9X A;  3QOL A;  2K28 A;  4HJ9 A;  4A3K G;  3W2D A;  2JA5 G;  1QG7 A;  1CA5 A;  1IW7 C;  2VUM G;  2F0G A;  4LAA A;  5M5X B;  1CHP D;  5M3M B;  2TSS A;  1BUV T;  3QIA A;  4GNX B;  1XYI A;  3RLN A;  4C3I B;  1FNW A;  1WTO A;  1EL0 A;  4A75 A;  1UEA B;  4C1N K;  1K8G A;  2MQH A;  1FGU A;  2C5C A;  1EOV A;  3MEF A;  2EE1 A;  1CTM A;  2BA1 A;  2HIV A;  3F1Z A;  4KMU C;  2KEN A;  1LTB D;  3GV6 A;  4C3I G;  2K52 A;  2G9D A;  3DHQ A;  2HT1 A;  2JA7 B;  2N49 A;  1NR4 A;  4JBK A;  4ZQ3 A;  4YCU A;  1JIC A;  1PRT C;  2ES2 A;  1G91 A;  3F2U A;  4OIK A;  2AWO A;  1XX8 A;  3PO2 B;  1RIP A;  1VQB A;  2RDG A;  2K75 A;  4JI0 L;  3EJI A;  1G8Z D;  4IPG A;  2KJX A;  5COY A;  5C4H A;  4DR1 Q;  5EAY A;  3HOV H;  4UPA A;  2UU9 L;  2PPB C;  1HUM A;  3J7A V;  2JEB I;  1AZP A;  2OQ0 A;  1A0I A;  3TEH B;  2O5I C;  3CCJ A;  3AYH B;  2B63 B;  1B53 A;  1HCZ A;  2XRS D;  3S16 H;  1KHI A;  1LTL A;  3R8B A;  3RLO A;  1F2L A;  2E76 C;  4BY1 G;  5FOB B;  4JBJ A;  4LJZ C;  4CKC A;  1B9N A;  1ONL A;  4LNQ A;  4LFC Q;  5KNB A;  2EYP A;  4WJW A;  1HXY D;  5A35 A;  3K7A B;  2F4V L;  1NAP A;  1QE6 A;  3FHW A;  3OMG A;  1KXL A;  1YI2 A;  1EQV A;  2A69 C;  1NBW A;  3OPO A;  4B3S L;  3EA6 A;  3NWT A;  5IYC G;  5BR8 Q;  4DV4 L;  5IGB A;  1I4R A;  4CDE C;  4QGU A;  3A0J A;  5LL6 S;  3NP8 A;  4H13 C;  2XIW A;  3U58 A;  3TS2 A;  3A8I E;  5IT9 c;  2OT2 A;  3GDE A;  1MBY A;  2Y0S B;  1I3Q B;  3V96 A;  4HCS A;  1LT5 D;  4FNF A;  1TR5 A;  1I4P A;  1Y8N B;  4DV7 Q;  4K5V A;  4JI5 Q;  4DA2 A;  2I5L X;  4R1J A;  4EQO A;  2J4X A;  5CV4 A;  2Y0S E;  1V1P A;  3G6E A;  5FLX L;  1ESR A;  4ALP A;  1TWA H;  1A8V A;  2KED A;  2IW3 A;  1EY9 A;  1JB3 A;  1P8L A;  4A93 H;  3HFZ B;  1BBX C;  3GTG B;  1EYA A;  2L5T A;  1SE8 A;  4A3D H;  2UXD L;  2Z6K C;  3QR8 A;  1H9M A;  3ULP A;  2K14 A;  1AE3 A;  1SNO A;  4UY8 C;  4ZCK A;  1SSO A;  1IZ6 A;  3M4P A;  1CSP A;  2F0L A;  4K8I A;  1QVG A;  3OWE B;  5T1G A;  2L12 A;  4QUF A;  4RGT A;  2IPK D;  3S2D H;  4JK1 C;  4AYB B;  4JI6 Q;  1F2M A;  3CQZ H;  1FR3 A;  3DM1 A;  3U4V A;  2K6A A;  2M9V A;  2E2I B;  1IXR A;  1H9S B;  4G4K A;  1STA A;  1IYU A;  1KC8 C;  3VYU A;  2F3W A;  5C3E B;  5EBD A;  2BCO A;  5ELD A;  3NE5 B;  4DR6 Q;  3CCR A;  4O2D A;  2E5L L; 
#chains in the Genus database with same CATH homology
 4BXX H;  3AEV A;  3CCU A;  1TWC H;  2UUC Q;  2K5V A;  4H02 A;  4IPC A;  1UEB A;  4XTC S;  1M1K C;  4YHH L;  4GOP A;  5JJK A;  3HOX G;  1X3G A;  1X54 A;  2JK8 A;  1K73 C;  1XNR L;  3M7N A;  1PH7 A;  2K5H A;  4LFB L;  3I7F A;  1VQF A;  1HNZ Q;  3S1M H;  1Y1V G;  4JYA L;  4OO1 I;  2UXD Q;  1V1Q A;  3ULL A;  2JA7 G;  5GAG C;  2D62 A;  3Q8D A;  1XMO L;  2RHQ B;  3L0O A;  1H95 A;  5IYB G;  1D7Q A;  1U0L A;  3NEM A;  5IWA Q;  4JV5 L;  4IOC A;  2CQO A;  4GLX A;  4JI7 L;  4IFD I;  2Z0S A;  4B3S Q;  2VL6 A;  1WFQ A;  3FKI G;  4LF7 L;  2AHO B;  1YNX A;  1YJN A;  1XNQ L;  3PUV A;  4APV A;  4DR6 L;  1Q12 A;  2B29 A;  4GOP B;  5M3M H;  1VQO A;  1XPR A;  3GO5 A;  5DLQ E;  1M90 C;  2F3I A;  2HHH L;  4LF7 Q;  4A3B H;  2RF4 A;  4OON A;  1SN8 A;  4Y7N H;  1XNQ Q;  3PIP A;  3STB D;  1YJ9 A;  2UUB Q;  5M3M G;  3CCS A;  3HOW H;  5IWA L;  4QL5 A;  4GNX C;  4QQB X;  3FKI H;  2R7F A;  2F4V Q;  1G51 A;  3L7Z C;  5GQO A;  2NN6 G;  2MFI A;  4LF9 Q;  4NXM Q;  3M85 A;  1HNX Q;  1GKH A;  2BA0 A;  1XMQ Q;  3KFU A;  1L1O A;  4X64 Q;  2F52 A;  1K83 H;  1VQ8 A;  5GAE C;  3PV0 A;  4YWL A;  2VZA A;  3K7U C;  3W5O A;  3OTO L;  3FP9 A;  4YWK A;  1Y1V H;  5BR8 L;  1XJV A;  3H3V H;  1ASY A;  1TWF H;  1HZ9 A;  2CWA A;  4DR5 Q;  1N34 L;  1O7I A;  4JI4 Q;  3RR5 A;  2ZM6 Q;  1OXU A;  1C0A A;  2LSS A;  1CSQ A;  1E1O A;  1XPO A;  4JI2 L;  3RZD H;  2K50 A;  1JJ2 A;  4HID A;  1SLJ A;  1PH1 A;  1WI5 A;  1YZ6 A;  1G6P A;  5AJ3 Q;  5JJL A;  4L5S A;  4PZ7 A;  2PQA B;  3WWV A;  4DV2 L;  4YY3 Q;  3KF8 B;  1NE3 A;  1YHA A;  2GN5 A;  1N9W A;  4DR2 L;  1XMQ L;  1GM5 A;  3HOW G;  4B3T L;  4JI3 Q;  4NPS A;  2UXC L;  3E9H A;  1JJG A;  5E7N A;  3J81 c;  1RL2 A;  3PUZ A;  4A3B G;  2OCE A;  4A3E H;  4EX5 A;  1MIU A;  1NTG A;  2MNA A;  4B3T Q;  4OWX B;  1L0W A;  1IL2 A;  3M4Q A;  1MJC A;  4AIM A;  1GO3 E;  3G4S A;  3T1Y Q;  3GTL H;  2KHI A;  2IY5 B;  4YCW A;  4DK3 C;  1OXX K;  4DR3 Q;  1SMX A;  5IYB H;  4JOI A;  3ULJ A;  4GKJ L;  3I2Z A;  3B6Y A;  4IFD J;  2E2J H;  2JA7 H;  1YHQ A;  1K9M C;  3TS0 A;  5J3B A;  2WP8 J;  4C3J H;  2E8G A;  4LUZ A;  1UE6 A;  3ER0 A;  3W1G A;  5FJ8 H;  3HOX H;  2E2H H;  4A3F H;  1Q82 C;  3JC6 6;  2EQS A;  2JE6 I;  1QUQ B;  4O0A A;  5C4J H;  4JYA Q;  3K81 C;  4BXX G;  1MKH A;  4MZ9 A;  3EIV A;  4NXN L;  1EQQ A;  3CD6 A;  4YHH Q;  4XIG S;  5IP7 H;  1ASZ A;  4NXM L;  1P16 A;  3GTK H;  1X56 A;  4KHZ A;  1NMG A;  2VW9 A;  3PO2 H;  1JMC A;  1VQL A;  4GKJ Q;  4K0K L;  5C0X G;  4A93 G;  1YIT A;  5HY6 A;  4A3J G;  2CCZ A;  1D8L A;  1UE7 A;  1X6O A;  3A5Z B;  2UUB L;  2UUA L;  3LGJ A;  1EUJ A;  4IPH A;  2Q2T A;  4L5R C;  3CCV A;  4LFC L;  4PZ8 A;  4QIW E;  1HR0 L;  3PO3 H;  1I94 L;  1QUQ A;  2UUA Q;  3T1H Q;  4J15 A;  4B3R Q;  1OXS C;  4UP8 A;  2ZTE A;  5JEA G;  3J7A 5;  5LMN L;  3PIO A;  4JBW A;  5ELN A;  1Y14 B;  1KQS A;  4A3G H;  5M5W H;  3F2B A;  4JV5 Q;  4IOA A;  3CCE A;  2AWN A;  4JBM A;  3GTM H;  4QY7 A;  1EWI A;  1I50 H;  1YEZ A;  4LFB Q;  3J80 c;  5H1S E;  1VQP A;  1PFS A;  1OTC A;  2OQK A;  3T1Y L;  4P71 A;  4TVA B;  5GAH C;  1CUK A;  2UUC L;  4BY7 H;  3H0G G;  4GN4 B;  1X9N A;  3M4O H;  3G71 A;  4L5T A;  3K7A H;  3K8A A;  1I6H H;  4A4I A;  1W3S A;  1VQC A;  3TRE A;  5C0X J;  1N32 Q;  2D0P A;  4A3D G;  3E9I A;  4JOI C;  4UP9 A;  4UP7 A;  3ERS X;  1UE5 A;  1FJG Q;  4A3M H;  2YU9 H;  4GKK Q;  3CMA A;  4DV1 Q;  4X64 L;  3CC7 A;  5IP9 H;  1KL9 A;  3CCQ A;  3S1R H;  2WB1 G;  4X65 Q;  5C3E G;  1BVS A;  5LMU Q;  2A19 A;  3KJP A;  4BBS H;  5IY0 A;  4KHP L;  3S24 A;  1HJP A;  3GTQ H;  3DM3 A;  5LMN W;  1A62 A;  2CWP A;  1E24 A;  4P75 A;  1QZH A;  3PF4 A;  1VQ7 A;  1BBU A;  2DUD A;  2PNH A;  2RHS B;  4WJ4 A;  1YBY A;  3M9B A;  5FLX c;  5LMU L;  4KHP Q;  2HIX A;  1PYB A;  2MO1 A;  1VS0 A;  4HJ5 A;  1VQK A;  4BY1 H;  4P72 A;  1KIX A;  5IYD G;  1JE5 A;  3J7Z C;  4A3L G;  1B70 B;  2VNU D;  2IT1 A;  2BH8 A;  2WAQ E;  3RNU A;  5ELO A;  3OW2 A;  1N33 Q;  3S15 H;  4LF8 L;  4NB3 A;  3A5U A;  1S40 A;  2JA6 G;  4B3M Q;  4JI4 L;  1JT8 A;  3RLF A;  2FXQ A;  3ZJY C;  2NVQ H;  3GTG H;  3TRZ A;  1I5F A;  1SR3 A;  3HOV G;  1YHB A;  4LF9 L;  3HKZ G;  3DLL A;  1PH4 A;  3KOJ A;  3IRB A;  1CKN B;  1KAW A;  1VQI A;  3U50 C;  3OTO Q;  4DV0 L;  1W2B A;  1JB7 A;  2C35 B;  2ATW A;  4KLK A;  4BBR H;  2AMC B;  5IYC H;  4Y52 H;  1U5K A;  2PI2 E;  3F2C A;  2Y0S G;  3D31 A;  3S17 H;  2DGY A;  1QZG A;  4POG A;  4AQY Q;  4LF5 L;  2A8V A;  4LUV A;  3I56 A;  2HHH Q;  3W1B A;  3UDI A;  1LYL A;  1X55 A;  1Z47 A;  1CKM A;  4GN5 A;  3T1H L;  4AYB E;  5M3F H;  4A3I G;  1PH2 A;  3I4M H;  2NVY H;  3PUW A;  4X66 Q;  1WCM H;  1GVP A;  1A63 A;  4AQY L;  3PCO B;  4LF5 Q;  4JI1 L;  4P73 A;  4HIK A;  4R4I A;  2OTL A;  1EIY B;  3K80 C;  3GTP H;  1Q1E A;  3UE0 A;  3PGZ A;  3PUY A;  3PF5 A;  1XTD A;  4GNX A;  2R93 G;  3KJO A;  5GAD C;  1T9H A;  2UXB L;  1PH8 A;  3HOU G;  3MXN B;  3I55 A;  5IE8 A;  2JJQ A;  1L1O C;  1B7Y B;  1UE1 A;  1MJE A;  2QGQ A;  2YV5 A;  1XNR Q;  2PI2 A;  1HZA A;  3AQQ A;  3NEL A;  3KLW A;  1VQJ A;  2JQO A;  2OTJ A;  3S2H H;  1GD7 A;  1WJJ A;  2LXK A;  3CPF A;  5C44 G;  4DR4 Q;  2LXJ A;  4GLV B;  3KDF A;  4A76 A;  1N36 Q;  1EFW A;  3VDY A;  1VQE A;  2ZTC A;  2WFW A;  4B3M L;  4EQ5 A;  4LF4 L;  1Z9F A;  2BH2 A;  2B63 G;  1VCI A;  4KI0 A;  5M5Y H;  2VUM H;  3H3V I;  2VQF L;  1S3O A;  1HZC A;  1SRO A;  4A3D H;  3I4N G;  3H15 A;  4DV3 Q;  4DV6 L;  4HJ8 A;  4A3K H;  1C7Y A;  3UDF A;  1YIJ A;  1IBM Q;  2KCM A;  2GVA A;  3PSI A;  1PH5 A;  1Q8K A;  3I4O A;  2NZH A;  4A3C G;  3ICE A;  4DV0 Q;  2Z6K A;  4DV3 L;  1TWH H;  2VQE L;  1Q7Y C;  2R92 H;  2OWO A;  3BZK A;  3CPW A;  4OX9 Q;  4JI6 L;  3HOY G;  4JG2 A;  3HOZ H;  2JA8 H;  4X65 L;  2ZJR A;  2N78 A;  4C3I H;  2R7Z H;  3F2D A;  1PH9 A;  1VQ5 A;  1J5E Q;  3A74 A;  3RZO H;  1N33 L;  1JJC B;  4L5Q A;  3EN2 A;  3CCM A;  1HR0 W;  4JI8 Q;  4JCV E;  4PZ6 A;  4LF4 Q;  5C4X G;  1AH9 A;  3BU2 A;  1FVI A;  4RG1 A;  2CFM A;  1SRU A;  3S1Q H;  4X62 L;  2QA4 A;  1E7Z A;  1K0R A;  4R4T A;  1R9T H;  1K8A C;  2YTY A;  2ZTD A;  1Y1W H;  1EYG A;  1BKB A;  3D0F A;  1VQ6 A;  1HNX L;  1E22 A;  3PUX A;  1V43 A;  4GOP C;  5C4X H;  3JAM c;  1VQH A;  2VS1 A;  3CW2 C;  2HQL A;  2R7Z G;  4RMF A;  2JA8 G;  1Q46 A;  4FDB A;  3U4Z A;  4DKA C;  2ZJP A;  1IBL L;  3HOZ G;  4B3R L;  2D0O A;  3NEN A;  4GLA C;  5LMN Q;  1XPU A;  2R92 G;  2KBN A;  5FLM G;  3CCL A;  3KYH C;  3EBE A;  4A3C H;  2YTX A;  2JA5 H;  4YWM A;  4HJ9 A;  4A3K G;  3I4N H;  4LWC A;  4C3H H;  4MTN A;  2N8N A;  2JA5 G;  5JJI A;  4K0K Q;  3STB C;  1KD1 C;  1I94 Q;  2VUM G;  2WB1 E;  1VQA A;  5FLM H;  1N36 L;  2B63 H;  3TQY A;  1E3P A;  4DV7 L;  2JEA I;  1SFO H;  1Q1B A;  1PHJ A;  4GNX B;  2UXD L;  4NXN Q;  4DUY Q;  3RLN A;  2R7D A;  5C44 H;  1IBL Q;  4IO9 A;  4A75 A;  2ALY B;  4DNI A;  4IFD G;  1K8G A;  1BBW A;  1Y1W G;  2NVT H;  3HKS A;  2MQH A;  1FGU A;  3SGI A;  2NVX H;  3JAM i;  1EOV A;  4DUY L;  3MEF A;  3HOU H;  4X6A H;  2MO0 A;  2BA1 A;  2HIV A;  1Q86 C;  3F1Z A;  4LF8 Q;  3CC2 A;  2KEN A;  3BJU A;  3CP0 A;  4JI1 Q;  3CAM A;  1HR0 Q;  4X62 Q;  2B3G A;  2CKZ B;  1AE2 A;  3HKZ E;  2K52 A;  4AYB G;  2PQA A;  2N49 A;  3J80 i;  2HT1 A;  2ASB A;  3HOY H;  4JBK A;  1HNW L;  4YCU A;  3KF6 B;  5M3F G;  3UDG A;  4A3I H;  1V9P A;  1KRT A;  2ES2 A;  3GTJ H;  2EIF A;  1PVO A;  1QVC A;  2UXC Q;  1EIF A;  2AWO A;  1J6Q A;  4OXP A;  1FJG L;  2Q2H A;  4ME3 A;  3NBH B;  2IHF A;  1RIP A;  3CXC A;  3UDX A;  1X3E A;  5JEA J;  4DV2 Q;  1VQB A;  4OO1 G;  2K75 A;  4DR7 Q;  1YVC A;  4LF6 L;  4BBR G;  4MNO A;  4JI0 L;  4IPG A;  4DR1 Q;  1PYS B;  5GRO A;  4YCV A;  2ZJQ A;  5HGQ A;  2EXD A;  2XGT A;  5EAY A;  4JI2 Q;  3CF5 A;  3HOV H;  4UPA A;  4DR3 L;  1IYJ B;  2UU9 L;  3RN2 A;  4DR1 L;  2JEB I;  4JI0 Q;  2JA6 H;  2OQ0 A;  1A0I A;  1OXT A;  4QJF A;  3TEH B;  3BZC A;  3CCJ A;  3AYH B;  5M5X H;  4GN3 B;  2WAQ G;  2ZM6 L;  1EQR A;  2YYZ A;  2IX0 A;  4HIO A;  1KHI A;  1LTL A;  4JI8 L;  1NJI C;  2UU9 Q;  4OWW B;  3RLO A;  3S16 H;  2R93 H;  4DR7 L;  4A3L H;  2VQE Q;  1QVF A;  4BY1 G;  4JBJ A;  4OX9 L;  1VQ4 A;  4GKK L;  1L1O B;  4POF A;  4DV5 Q;  1UWV A;  1L2F A;  1LUZ A;  2I5H A;  3L2P A;  4DAY B;  4DR2 Q;  4LNQ A;  1WCM G;  4GS3 A;  2NN6 I;  4DV6 Q;  4LFC Q;  3I4M G;  4HJ7 A;  3OYY A;  4BA1 I;  1LM0 A;  2RCN A;  4BBS G;  2F4V L;  3FHW A;  4X66 L;  2Q2U A;  1N32 L;  2H5X A;  1KXL A;  1YI2 A;  1PV4 A;  1NBW A;  4DR5 L;  4R4C A;  3RN5 A;  4B3S L;  1I3Q H;  4DR4 L;  5IYC G;  5BR8 Q;  4JC0 A;  4DV4 L;  4LUO A;  1HZB A;  4JI5 L;  1HNZ L;  3K0X A;  4BY7 G;  3G48 A;  3F8T A;  4QGU A;  3A0J A;  4JI7 Q;  4BA2 I;  3UE1 A;  4DPG A;  3U58 A;  3TS2 A;  1IBK L;  1CKO A;  5IT9 c;  4DV4 Q;  3GDE A;  2E2I H;  2I0Q A;  2KCT A;  1X3F A;  1X65 A;  2UXB Q;  4P74 A;  1IBK Q;  1CKN A;  2K5N A;  1WOC A;  4A3G G;  3GD7 A;  5IYD H;  4DV7 Q;  1NY4 A;  1PH6 A;  3S14 H;  1DGS A;  4AH6 A;  4R4O A;  4JI5 Q;  2I5L X;  4R1J A;  2Y0S E;  1OXV A;  1J5E L;  2AKW B;  3KF6 A;  2A1A A;  2GVB A;  3G6E A;  1E1T A;  1Q81 C;  4ALP A;  1TWA H;  2PMZ E;  1A8V A;  3M3Y H;  4JI3 L;  5C3E H;  1KRS A;  2Q2I A;  1P8L A;  2XTI A;  1VQD A;  1FL0 A;  1K3R A;  5IP9 G;  4A3J H;  4A93 H;  1XMO Q;  3HFZ B;  4PMW A;  4A3M G;  5AJ3 L;  4LFA L;  1VQ9 A;  1SE8 A;  1G29 1;  4YY3 L;  2ID0 A;  1C9O A;  1TXY A;  4DV1 L;  2KHJ A;  2Z6K C;  4IPD A;  3AFQ A;  2QEX A;  4DV5 L;  1S72 A;  1PA6 A;  3J81 j;  4DUZ L;  4A3F G;  2N3S A;  5FJ8 G;  3ULP A;  3H0G H;  2NZO A;  1N34 Q;  2K14 A;  2E5L Q;  3CC4 A;  1B8A A;  1NMF A;  1HNW Q;  2JA9 A;  1AE3 A;  3J81 i;  4UY8 C;  2YTV A;  1IZ6 A;  4DK6 C;  4C2M H;  2L15 A;  5C0X I;  3M4P A;  4IJL A;  4LF6 Q;  1CSP A;  2VY3 A;  1HH2 P;  4R4Q A;  3GTO H;  2I5M X;  1QVG A;  1TWG H;  3KDF B;  3E0E A;  4IJH A;  4LFA Q;  3S2D H;  4DUZ Q;  4WJ3 M;  1WYD A;  4JI6 Q;  5K36 G;  2IX1 A;  1VQN A;  4PG3 A;  3CQZ H;  4HJA A;  3PO3 G;  3U4V A;  4A3E G;  1YJW A;  1IBM L;  4DAM A;  3S1N H;  1IXR A;  2R6G A;  1N8R C;  4HIM A;  2V1C C;  1KC8 C;  4OWT B;  3CME A;  1PH3 A;  2VQF Q;  3AFP A;  1VQM A;  4LW1 A;  4TQU S;  2K4K A;  3PO2 G;  4DR6 Q;  5IP7 G;  2IHE A;  1VQG A;  3CCR A;  4O2D A;  2E5L L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...