3PUWA

Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
371
structure length
371
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transport protein
molecule keywords Maltose-binding periplasmic protein
publication title Snapshots of the maltose transporter during ATP hydrolysis.
pubmed doi rcsb
source organism Escherichia coli
total genus 105
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3puwA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3puwA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3puwA01
4HDCA 4X6AH 3K9LA 4TMVA 1CUKA 1PUIA 3QOFA 2EJMA 4LYFA 3W6PA 2B3GA 2ANCA 4EJSA 3KKNA 2PQAB 2ZEJA 2IYTA 5A0FA 2PI2E 2Q9AA 2DFLA 3ICQB 2MFIA 3J80i 2Q9BA 1HA3A 2ZUDA 4JI6L 5FBWB 5FPYA 4LJZC 2E74C 2BWJA 1CI3M 1NG9A 3WYGA 1PH3A 4H1UA 1E98A 3DKVA 1EWRA 1YBYA 3MG9A 4PFSA 4DV6L 2OCBA 2PL3A 4NB3A 2R6AA 1FZQA 1HV8A 2RGXA 2NG1A 4PC1A 4OBEA 1HURA 4NL4H 5DH9A 2PMKA 3KFXA 1GIAA 4NHOA 3PUYA 4JJZA 2BKUA 2CLCX 1G3RA 5JRJA 5JWHA 2P6RA 1NVVQ 1FQKA 2OM2A 2VTKA 5M5XH 3ZIAA 3ZLJA 2ZE6A 3SE0A 1CKNB 1DO0A 2VNUD 2ORIA 2WWXA 5LB2A 4DEYA 4DR4Q 2ZU6A 4HSEA 2X77A 3GEIA 1TU2B 3DM3A 3RRNA 3B1ZA 1TKWB 1DARA 1DO2A 2QROA 3CRVA 5IYBH 3EZFA 4NXMQ 4IVQA 3SJAA 3TRFA 3UMFA 2WKPA 2UUAQ 1QG2A 4URWR 3D4RA 1XMQL 2ZRGA 3AGQA 3I5YA 3M7NA 4B44A 3PUVA 2Y0SE 2IYQA 3KL4A 1S3OA 1Z0IA 3EQLC 2IXFA 2ZRPA 5FI1B 2A69C 2ZYUX 3FE2A 3NIBA 3U44B 3N70A 1TF5A 2AR7A 3U4QB 1IL2A 3FMPB 1VPLA 4TMXA 3KOJA 1LS1A 4YY3Q 4WIAA 4Q9HA 1F6BA 2F1HA 2Q3HA 1UE1A 2UXDQ 1DG1G 1E2GA 4D0NA 1WP9A 1U94A 2YV5A 1TUIA 5B58C 4PHGA 4DK1A 1KO1A 2REOA 3VR2A 1N0UA 4DLYA 5DLQC 1N34Q 1IOZA 2ECKA 4DV3Q 2VSXA 2O8CA 4YLGA 2ZT9C 5H1SE 2IYZA 3A7AB 4GN5A 2EFCB 2L0XA 3U4ZA 1J5EQ 1F48A 3GJ3A 5EE5B 2X1VA 4NXNQ 3LBIA 2IS6A 3PQCA 4IOMA 2OCEA 4WJ3M 4DB2A 1U81A 2ZRFA 3VNUA 2A68D 1W5SA 5BXQC 1XCGB 3AQQA 1SXJA 2QSZA 2EWWA 2IX3A 2NO7A 3QKSA 4G5OA 3VU9A 1YZKA 5DHFA 3A4NA 3SZRA 4DNIA 4K46A 1NY4A 1YJ9A 3MWLA 4BBRH 3CPWA 2HJVA 3M0EA 1OFTA 2H16A 3ZGXA 2OE2A 3E2IA 4QM7A 4DLUA 4OK3A 3VR3A 3S14H 1TWCH 3RN2A 3PIPA 1DE0A 1F2TA 4V0KA 4AYXA 4IEEA 3X1WA 4BFYA 3BK7A 4BLOA 2CFMA 1EQRA 5IYCG 4DUGA 1NLZA 2L5TA 2B63H 2QE7A 4URVR 1KY3A 3I4NG 4WA7A 5FJ8H 1VQLA 2FOLA 3QE0A 5UKDA 2CE7A 2YWHA 5AJVB 3SN6A 3AF2A 2O8BA 3TSZA 1PH4A 1M8PA 3SJCA 1IW7D 4UPAA 1I4TD 4B3RQ 2IX1A 1Z2CA 1L2FA 4FMCF 4UNSA 5JHGB 1GOTA 4JYBA 4PZYA 1P61B 4PC2A 5FL7A 4A9AA 4LSGA 1IM2A 2QM8A 3EIQA 3HYRA 4GFDA 5B2ZA 2DB3A 1GUSA 2CDNA 2UKDA 3HDTA 3WMFA 4B75A 1ZUIA 5ELXA 4DV1Q 3F2DA 2BA1A 3X1YA 2ZSEA 4RY2A 3E0EA 1FMJA 2CQOA 2BCJQ 3T56B 1QRAA 2QBYB 2WWYA 1VQGA 3GPLA 1EFRA 1KNQA 2GWHA 1GVNB 2W0MA 4V0NA 5IWAL 3K0SA 2BHRA 1WBDA 2B7CA 1UE5A 3HOVH 1E9AA 4QBHA 3AVTA 3RLFA 3CPFA 2JA6H 1KI6B 5C4XH 1YHNA 2QENA 4DV5L 1WFQA 1N33L 1ZD8A 3R8CA 4LFAL 4OYHA 4QGAA 5CDFE 1N2CE 1GUGA 2DYKA 2HYDA 2XEXA 5AWFC 3U3JA 2AWNA 1G6PA 1BKBA 3ULPA 3FMOB 3X2SA 1TL7C 3JC66 1T91A 1HY3A 1VHLA 1GWNA 4LK2A 1XTSA 4C3ZA 5E7MA 5BW8A 2NO0A 1CR0A 2QORA 3W34A 3X1XA 1HQMC 1QUQB 4TTQA 5FR1A 2V3CC 2F3IA 1N32Q 4JG2A 2OEPA 2NVTH 3EG5A 4C0JA 2HEIA 1CFMA 3JAMc 1HNWQ 1SE8A 1L7VC 2H1LA 1TWHH 1S40A 4DK0A 2IEYA 2B8TA 2WICA 4M9XA 4A2QA 2F4VL 2D74A 1S1MA 3N5CA 2ZRLA 3K0CC 1Z28A 1GJXA 1GFIA 3UDXA 1T0JB 5DSZA 4PMWA 5TDHA 1AS0A 4ZIRB 1R4AA 4HR7B 1U9IA 1W0KA 1UF9A 3LBHA 1V43A 2ORVA 1ZD1A 4OO1H 2YC2C 1E1OA 2BBTA 1N6IA 4JYAL 1DAGA 3GTMH 3QF4A 1P8LA 2F52A 5HZHA 3JVUA 4A3BG 4JYCA 4IRUB 1K8MA 3M4QA 4P75A 4X8OA 3WP0A 4AURA 1MKHA 2WMNB 2D4HA 4B2IA 4BLRA 1Y8OB 1CJUC 4FCTA 5FR2A 1Q21A 4G7OC 3A1SA 1C1YA 1E9DA 1A1VA 4OQLA 3U58A 1NY6A 2GCPA 2ZI9A 1KHIA 2X8AA 4MDFA 3G0HA 4APVA 1E69A 1U98A 4ZDJA 4PC6A 4KVAA 3WP1B 3K0EA 3QNUA 4YMWA 2OAQ1 2V1UA 1I6HH 2O5IC 3B60A 2LMCB 3GEHA 4Q47A 1Z83A 3PXGA 1RE0A 2NVXH 2IHYA 4JJKA 2AK3A 5SZHB 4TTPA 2EJFC 4H13C 2F1JA 3GLIA 4PQFA 4A3JG 3U61B 3CRMA 1E3MA 3R7WA 1KMHA 3QXSA 2OLJA 5CLLA 4EAQA 2ZS9A 1OXTA 1RJ9B 2A6HC 3Q7PA 4A2PA 3HPRA 2RKOA 1BBUA 4LF4Q 2Z4SA 1PH5A 4R4IA 2K75A 1E2WA 2FE4A 4HAVA 4P31A 2G9NA 1FTNA 3DEFA 1UBEA 2BE5C 3TMKA 3G5UA 4G1UC 5M3FG 4TT3D 1Z0DA 3A8TA 3P32A 3FMCA 4LV5B 4BUJA 4JC0A 5IT9c 4XSHA 4DCNA 4LF9Q 1N25A 2P6NA 2ZRCA 4K81B 3RC3A 5IY0A 2WZQA 2DFTA 2O0KA 2PEYA 1UKYA 4JI1Q 3EIEA 3LQQA 4IKEA 3SHWA 1ZUHA 1NBMA 1Y1VG 2N1BA 2BH8A 2E8GA 2YTVA 4EPXA 4R1JA 4JI5L 4XVUA 4AKHA 3QJYA 1I2MA 1KK0A 1AJEA 5AJZA 3CCSA 2FEOA 5M3MH 3A5UA 1FUKA 4Q1DA 1W0JA 4O0AA 2CBZA 1DTSA 4GKJQ 3RLNA 2QEQA 1AIPA 2ZTSA 5D3MB 1CR2A 521PA 3TKLA 4TQ9A 1E9SA 1WA5A 4NCKA 5LD2B 2J7PD 4B3ML 2NO6A 4ME3A 1XP8A 3G71A 1KJYA 3LFUA 4IDOA 4U7DA 2IW3A 2EFDB 2QTFA 4KSBA 3OTOQ 2QG6A 1XTDA 1GNQA 3HU2A 2AKYA 2CCJA 4TQUS 1LB1B 2R62A 4ZKDA 2O8FA 1KO7A 1BMFD 1HCZA 1ZIOA 2O0HA 3KQHA 4GBMA 1YZ6A 5BQ5A 3BB4A 1I6VC 2NIPA 3UDGA 1U8AA 3CRRA 4AK9A 2AX4A 2GK7A 3KQKA 4UNRA 5K8UA 2BJWA 1XZQA 3UATA 2GBLA 2IXGA 4LWCA 1Q1BA 4F4CA 1B23P 1VQIA 2QGQA 3CC2A 3PO3G 2GA8A 3E9HA 2JDID 3KB2A 3NKVA 3TQCA 3ND9A 4CEHB 3TSWA 3FWYA 4Q66C 1W4CA 4DVGA 2DNEA 2XTNA 4JOIC 4MTNA 2H8KA 2E75C 4JI3Q 3L2PA 3CWQA 2VHQA 1SQ5A 3PEUA 5JEDA 5L3QB 4D82A 4BA2I 1DOAA 2F7SA 2IA5A 3Q85A 1VG0B 1N6LA 2FGKA 3EPJA 4BEBA 4POFA 1K9MC 4E07A 621PA 3K81C 3KLWA 3FHOA 4HZUA 1U8YA 1QHXA 5G41A 5FUWA 3A8IE 1MR3F 4QGGA 4BLPA 4A0HA 4B3XA 4PSKA 3CPHA 1ZBDA 1NRJB 2CEAA 3SEAA 3DZDA 4AH6A 1HZAA 1CLUA 1ZIPA 4GKKL 2BBOA 3C16C 1O78A 1GKUB 4TYPA 1VDZA 1MABA 1KOFA 4A1FA 1YZQA 1FL0A 2ZR9A 4EQ5A 4KFUA 4Q5IA 3FB4A 5K36H 2QAJA 1P2UA 3KKOA 1Z7TA 2IT1A 4KKUA 2Q8IB 3MUFA 2YOHA 1Q3HA 1TMKA 2ES2A 4NCHA 4OX9L 4WBSA 2YVUA 4JI2L 1IYUA 3PJRA 4LJYA 4UKDA 3NE5B 4JBJA 4K0KL 2EFHB 4D4MA 2PLFA 2VH5R 1JXMA 3A4LA 4LCBA 5EQTA 5L3RA 2KHIA 3RS5A 2B8FA 2BA0A 2ZM6L 4Q1BA 4B3SQ 4PSVA 5LD2C 4Q7KA 3BC1A 2G77B 3BB1A 4LHYA 4YDSA 3OOCA 4NPSA 4JBWA 3W5OA 1FJGL 1XD2B 3TQYA 2QY9A 4B76A 1HYQA 3KTAB 3GMTA 1XEXB 3RN5A 4AQYL 4Q1AA 3ZVNA 1NIJA 1WMSA 4KBGA 4LUCA 3RLOA 1J7KA 2ZRBA 2QP4A 5FBQB 2OT3B 1M7BA 4II7A 2KBNA 3LV8A 4JKIA 4TWZA 3TR0A 1JNYA 2ZRAA 1GDDA 1ANKA 4Q1FA 2HYIC 4C0LA 1NVWQ 4CEJA 3NELA 4BY7G 121PA 4C0BA 2J0UA 4JI0L 4CF7A 1H9KA 4DAYB 4G7ZC 1E0SA 1K8RA 2KBFA 2R9VA 3IO3A 3LW8A 3LXRA 3PCOB 4E22A 1SR3A 5JI2E 3MGCA 4JVMA 3WYAA 4FMCB 3T5GA 4PZ7A 4AIMA 4LF6Q 3F8TA 3NC0C 2OQKA 2FPLA 3CM0A 3K09A 5EZ5A 1JB1A 1HE1C 1H8EA 2OXCA 5C2JB 2QQ0A 1HH2P 3TREA 1M7HA 4A75A 3I92A 3ZS9A 3K7UC 4DR6L 4NKRA 4CDGA 3T35A 2A2ZA 2HV8A 2XOKD 4GRAA 1O7IA 2PLRA 1XPRA 1SVWA 4DR4L 1U0JA 2ZJ2A 1K3RA 2IYVA 2J3EA 4IPDA 5C3EG 4Q4HB 4UP7A 1DELA 4JBKA 2E87A 4LJAA 3CH5A 4TVAB 4OI4A 4A3IG 3I4OA 4IHQA 4MGKR 3ADCA 1CTQA 2GN5A 1W2BA 3KUDA 3HKZG 1DAKA 3OF5A 3J81j 3STBD 5IDVA 1JPNA 4X62Q 1DAFA 4AIIA 4IPHA 1G8HA 1W3SA 1XZPA 2OV2A 2JLZA 2X2FA 5FOVA 3VHLB 4HLDA 2BVNA 3GLHA 4Q4JB 4MITA 1ZNYA 1TWGH 2QP3A 1XEWX 2VEDA 1HQCA 4LUOA 1XFAA 1YEZA 1PVOA 1ELOA 2CHQA 1R5BA 3V4FA 1GM5A 1U0LA 3HOXG 3B8HA 1DXMA 1N34L 1CJKC 2WBLC 1JR3E 4DV3L 2P5TB 2ZQ5A 4N0DA 1ZINA 3KB1A 1C9OA 3EC2A 2LSSA 2ZTDA 3IFTA 3Q8DA 3PV0A 1UPTA 2KI5A 3I56A 3MCAA 2P67A 3FGNA 1XEFA 3PO2G 4NXNL 2P6UA 3GCGA 3K09C 4L5SA 3OEEA 4PV1C 3SHFA 3ZZUA 4DLZA 3HKSA 4IPGA 2GXQA 1Q12A 2R8RA 4URZR 4UXIA 5SZIA 4GLXA 2C96A 2VP2A 1II8B 3U6KA 2EW1A 5JJIA 1X1RA 4JLPA 3L8ZA 4IFDJ 1RIFA 2BEKA 2WIBA 4M4SA 4X8HA 2QAGA 2ZJ5A 1Z6GA 1BO6A 3D31A 1AN0A 1KDTA 5C44H 4OXPA 3QG5A 1UBGA 1UEJA 4ARZB 3VR4A 2GEUA 4QHSA 3ZIAD 1EUJA 5CYPA 2FDCA 1KIMA 2OLKA 3K9NA 1LNZA 4M1OA 3LVQE 5CM8B 1GSIA 4HLCA 1S4QA 3GJ6A 2JE6I 4OONA 2C9YA 2IHFA 1YI2A 1Y3AA 5HKKA 2JA7H 3OIWA 4URUR 2HQLA 1US8B 4DXAA 1IN6A 2XXAA 3LY5A 2O8DA 4B3RL 4S35A 1IN5A 2NPIA 4HJ7A 4LPSA 3U60B 2K7VA 2D7CA 1IBKL 3WDNA 1RKBA 3LXXA 3V00A 1E2JA 4DPGA 2EXDA 1AZTA 2C77A 3F2CA 1GL7A 2Z5FA 3LBNA 4HIDA 4A3MG 1YRBA 4XD7A 4C2UA 1YNXA 2DWQA 3EWSA 3L0PA 4X64L 4CVNA 3R9XA 3LNCA 1TWFH 4BLTA 5GJBA 3GQBA 4BPBA 2IY5B 3K1JA 2KA7A 3AP1A 3BS4A 3UK6A 1T8UA 3PEVA 5GQOA 1COWA 1E9EA 3RAPR 4PHHA 4DCSA 2BBSA 2A5GA 3GLIE 5C0XJ 3AKYA 5GAGC 2BH2A 4KCGA 3CX6A 4MRPA 3ERSX 3LX8A 4PZLA 1XXHA 4YC7A 1BIFA 3BOSA 4JI4Q 2BBWA 1G7TA 3SJBA 4WXRA 1ZP6A 3THYA 2DCUA 2WB1G 3B9QA 2CL0X 2R6CA 1CRQA 3AGPA 2UUCL 4R7ZA 3ULLA 3L0SA 1NN0A 5HE8A 4ASUA 1SFOH 1VQBA 1SXJD 4RZUA 1W2HA 2NGRA 4P73A 2AD5A 3L8YA 1C0AA 3TVDA 2IF2A 2JXMB 1VQPA 1TNDA 4QGUA 1YJNA 3F2BA 4JVSB 2JLVA 4GSYA 1KQSA 2CK3A 3F0TA 1WJJA 2ORWA 2DWPA 4G3XA 3GD7A 1N9WA 2IUTA 3S2HH 4YWKA 1VQHA 1T0HB 1AA9A 4H1VA 1EFUA 1NBME 3TH5A 4DDWA 2IS2A 4D4LA 4B2LA 4GOJA 4DKXA 2QE7D 2XGJA 1LUZA 1N6NA 2R65A 4BBSG 3D0FA 1IAQA 3DL0A 1D2EA 3LAWA 4G5SA 4H02A 3RR5A 4UNNA 1XX6A 2O5VA 5DI3B 5F2EA 5FFMA 4QRHA 5C4MA 4D2IA 2QP9X 3A4MA 3VA7A 3BFKA 3OFNA 1G41A 1FL9A 4OHXA 2XZLA 2VP4A 3KYHC 2IK8A 3B9PA 3GJ0A 1KI7A 2QSYA 3KKMA 4CEIA 1Z63A 2PMZE 2V4ZA 2JEAI 2VP0A 2WAYA 3AF4A 1B0UA 5FL7D 3UPUA 4TYQA 5M5YH 1JAHA 3AB3A 1TF7A 3K0FA 4L8GA 1G4AE 2ZUCA 2IYRA 4P74A 3CF0A 5KPDA 1E2EA 2PZGA 2VQFL 1LV7A 1EFRD 1TQ2A 4QJ3A 3P26A 4IFDG 5JFGA 4YWMA 4KN7C 2VYFA 4B32A 3PEYA 3M4PA 4NYMR 4F38A 2OCYC 5FBRB 3CMEA 1RW4A 4IJLA 1E2KA 4W5HA 3KDFA 3D8BA 2A6ED 3LH5A 1JBKA 4DV2Q 1XJVA 2NZ8A 4KYIB 4TMTA 3SR0A 4GZYC 4EKDA 1J6QA 2F43A 4O2RA 2CCZA 3KX2A 4QOSA 4A8JA 5EE9A 3SU8A 3H0GG 2A9KA 1PMRA 2CW0C 2CL7X 3BORA 4B3DA 4F4JA 1F2UB 4LJ9A 5BN3A 3CWZA 4BRWA 5E7IA 4GMXA 2H7VA 2A6HD 4GNKA 4QC2A 2NVQH 1AM4D 2FSGA 4MRNA 4M21A 5DN6A 3UIEA 4FD2A 5B30A 5LBIA 3SQWA 4LF9L 1YITA 3KQNA 5DI9A 1H9SA 2ZTEA 2RH5A 4B6EA 4DLXA 2QMEA 1KGDA 2HIVA 2ZRHA 2BM1A 2WWFA 4TYYA 1GTVA 1J2JA 1KSHA 2K5UA 4G5RA 4RZ3A 4TLDA 4DWJA 1QHHB 4Q18A 1LY1A 5K8TA 4PTLA 3U7FB 1LABA 4PAOA 3CCUA 1K73C 1N36Q 2E2HH 2OSBA 4KHPQ 3LA6A 2N78A 1AZSC 2FZLA 1W2GA 1PA6A 3DM9B 4JLJA 5IHPA 2J45A 2VL6A 1QG4A 2OCPA 2JLQA 3M1IA 1XF9A 4XWOA 2ZJQA 4S2EA 3RS4A 2IC5A 2KSQA 1WQ1R 2WAQG 1QVGA 3K70C 4DR3L 2IYXA 1RRGA 4IOJA 3LVRE 2QMOA 2JLXA 4B3TQ 1YR8A 4QL3A 2QGZA 1E24A 3GLIB 1ZM4A 3B6YA 3QKRA 1G3MA 1P62B 3TZUA 2K32A 5DNYB 4A0GA 3H3VI 2ODBA 2ZJAA 1AE2A 4WZAE 1HZ9A 2XOKA 1YHAA 2B92A 3BJIC 4P3YA 4OWWB 2CJWA 2FSHA 4KODA 5IYCH 5FOTA 1NMGA 3RS0A 4HB4A 3W1BA 1KI3A 2AHOB 4DV0L 5SZJA 1OKKA 5TMPA 2IX0A 1Z6XA 2KBEA 2Z43A 4HUQB 4U00A 3A0JA 1SVOA 3I62A 1OXSC 1E2IA 1P6XA 1U0HC 3B78A 2JA5G 2K5NA 3O47A 2ASEA 3QPUA 4BLSA 1OB5A 2PJRA 1A63A 2A5DA 3OAAA 4Y7NH 1ZUNB 1JEDA 1JJ7A 1EWIA 1ZM7A 1FTSA 2WJHA 2J5XA 3C14C 4XVRA 1A6XA 3FHWA 2GVBA 3CONA 2NOAA 4PHFA 3TAUA 2R93G 5E7JA 4LBWA 1OJLA 4EQ6B 1Z6AA 1YZNA 2ID0A 3REGA 4RMFA 3WHKA 3ZQ6A 4EFNA 4JI3L 1SVSA 3BB3A 3U3MA 1DGSA 2RHQB 1FX0A 2QL6A 1EXMA 3P1JA 2NPFA 4DSNA 4DR5L 1NBMD 3UDFA 3IHLA 3OIYA 1M2OB 3WMEA 2B8WA 3KJGA 4AWXA 4AYTA 4US1R 5A5GA 5DYIA 3BWDD 2GRJA 4US2R 3EZ9A 2ZRNA 4B43A 2J7KA 2QPOA 1S0UA 4L4UA 3C15C 1GNRA 2IYWA 2UVQA 4M2LA 4BQSA 2DFKB 1PV4A 1W0JD 5GJCA 3GJ8A 1CKOA 2KCCA 1IBRA 4DNTB 3QXHA 2ZUBA 3SQXA 2R44A 4OHYA 1NN1A 1Y14B 2K14A 1I2DA 3UANA 2HT6A 1D9ZA 2EDGA 1X6OA 5FLMG 3AF3A 821PA 2H57A 1KI4A 4A0RA 1FP7A 3EPLA 1VYVA 2ZRMA 3G6EA 1KZ7B 2VPPA 1FPMA 2QMUA 5ELNA 1WBBA 1ZVQA 4KBFA 1KAOA 2CVHA 1QVCA 3CR8A 4BXXG 3FKQA 4IFEA 4WAUA 4C0AC 1JMCA 1EWHA 1FQJA 1RYHA 3EZ2A 1NMFA 4DK6C 1HPCA 4UJ5A 3AVVA 1OB2A 1IBLL 3TRZA 3NDPA 2GJ8A 3B1YA 3TSOA 3KJEA 4A3BH 3HR7A 5L3SA 1VCIA 2ASBA 5HE9A 4LDJA 4IQZA 3J80c 1FNMA 4GS3A 4ZKEA 4LI0A 1BS1A 5JSZB 1XTKA 2PT7A 4NCJA 4QQBX 2IF0A 4PZZA 1MO6A 3AUXA 2OWOA 1VQEA 4LZZA 4OQXA 3H2YA 3QI2A 1LTLA 4DIDA 5IRCD 4JT4A 2V9PA 3THXA 2JJ1A 4KHZA 4ERNA 1GL9B 4FWIB 3J81i 4DLSA 4FDBA 2Q2HA 1E1RA 2A78A 1NN3A 2F6RA 1IY2A 4JLMA 3RSOA 4E5UA 3BBPA 1NG1A 2O8CB 3H15A 2GF0A 2W6JA 4PPGA 3HKZE 2VBCA 1PZNA 5IP7G 3ZVRA 3VFDA 4XWAA 3EASA 3W6NA 3AVPA 4A3JH 2WJIA 1PFSA 3KXIA 4KO8A 1RRFA 4TKOB 1UADA 4ITRC 4KFTA 3IRBA 3K80C 1GKYA 2DFNA 4JSYA 3W9YA 3KJOA 1N6OA 1OPXA 1R0ZA 3QKSB 3UG7A 3U44A 1XMSA 4RCYA 3GTOH 3VU9B 2QN6A 3KQUA 1RIPA 4MQBA 4DRZA 1G9XA 1KI1A 3TIFA 2LXKA 1JB7A 4LF5L 1YJWA 1LF0A 2BMEA 4OI1A 3VX4A 3CXCA 2WV9A 1RZ3A 5M3FH 3AM1A 3KXKA 4B73A 1P7CA 1JJ2A 2QQEA 1DADA 1F2TB 4KLZA 1RFLA 3NBHB 1IJFA 3W8RA 5F3WB 1G20E 4ILEA 4ALPA 5FPHA 1VQJA 1JQLB 3LW7A 3SI7A 4B47A 3PSIA 1GUAA 4YWLA 2P2LA 1GITA 4LHVA 4A92A 2N3SA 1Y1VH 1EQQA 3K0CA 1SN8A 5AUQA 2K5VA 1PH6A 3IILA 2O8BB 4NYIQ 2QPTA 5KSZA 2G0TA 2H17A 1XD8A 5LMNL 2IXEA 1Z6HA 2H5XA 2IYUA 2V55B 2W00A 3U7GA 3BFXA 3FOZA 3K8YA 5FUYA 1ZW6A 4GN3B 2JK8A 2MMCA 3NEYA 5EE3A 1LYLA 2VF7A 3D6TB 1SHZA 2YYZA 2C78A 1G18A 2I4IA 3HP1A 3OHMA 2OZEA 4DR7Q 2VQSA 3QEOA 3CD6A 4QGFA 1W36D 1T9HA 4M9ZA 2AKWB 1P9WA 3Q9LA 4DDUA 2ZI3A 4QBFA 1RL2A 4H9GA 3WBKA 2GCNA 3U4VA 4MUBA 1HZCA 4ZO4A 5IK2A 3SNHA 1SLJA 4A4DA 3QUSA 4W9MC 1E2DA 2BJVA 3NBZC 3VR6A 3PVSA 2OTLA 2VO1A 2DN8A 1GKHA 1T6NA 4V0ME 1CR1A 1H8ED 2DNCA 5JLJA 4DDVA 2WVJA 2A5JA 2NTYC 4DUYQ 4OQNA 4PHTA 1G1MA 1RVDA 2FFAA 2IHBA 1A82A 1Z2AA 2J46A 1S72A 1HTWA 5AUNB 4LK1C 3C4JA 2VSFA 3R9IA 2NVYH 4MRRA 2VW9A 1WDTA 5B64A 3NTUA 1G8PA 1NVVR 5TVKA 2EIFA 1G21E 1NP6A 3E9IA 3PO3H 5TV2A 2YWGA 1I94L 3NH6A 1MH1A 3PUZA 2UXBQ 5KSOA 5LDDC 3I4LA 1E2NA 1E2PA 4BECA 1KI6A 4F91B 1H9JA 1VG1A 4JI7L 2KHJA 1QHSA 2FEMA 3S2DH 2V6JA 3KFVA 4WOPA 1P73A 1HZBA 3ICEA 1GNPA 2WB1E 2RHDA 1EYGA 4YMSA 4LFCQ 2KE5A 3UXMA 5BR8L 3X1DA 1WE2A 3MXNB 1G16A 1H65A 3NEMA 5JJLA 3QVVA 4D26A 2FV8A 5KTYA 1NNEA 3QEJA 1AS2A 1N5IA 4TLBA 5FBLB 1JJCB 3CP0A 1XNRL 1ZD9A 2JIZD 2UXCL 2ONKA 2VQEQ 4DT1A 1QHNA 4A93G 4JI4L 3S1NH 1MJCA 4RFSB 2E2IH 5FTNA 2RGNC 3TE6A 1D6JA 4LRWA 4YHHQ 3OEED 1J99A 2UUBQ 3CPEA 3K0AA 1D2NA 1JI0A 1LW7A 2X2EA 4Q9LA 3FPPA 5J3BA 3A7LA 1HNZQ 3BZKA 2CL6X 2D2FA 2V8OA 1NSTA 1SHKA 2F1IA 4DCTA 3CRKC 4Z1MA 1Z0FA 2Q0HA 2V1XA 3NG1A 1XEWY 2AFHE 2XZPA 4Z8XA 5J5CA 4JLVA 3TJZA 2EVBA 2GEDA 3R7WB 1HEIA 5K8IA 221PA 3NBFA 3CF6R 1E99A 3FMFA 1F3OA 4QIWE 3NEJA 3C8UA 1VECA 4TMKA 2UU9Q 1KO4A 2A1AA 2OAP1 4HIMA 1JALA 2GXAA 1PJRA 4BFVA 4KKSA 3G48A 4F4IA 2ZJYA 2ZYVX 2FSIA 3M4YA 3BDOA 3T61A 5HKKD 2Q2IA 3CNOA 4CW7A 4L9SA 1OIXA 2P65A 1E79A 4KVGA 5CM9C 5G3ZA 5DISB 5TXGA 4WJ4A 3A1WA 2RHMA 4QJFA 3HOYH 4NCIA 5SZKB 1K8AC 3IEVA 4LNQA 3BH0A 1UEBA 4BY7H 4FXPA 4KJZA 2YNMA 4C3JH 5KSPA 4DC9A 1NVUQ 3RWMB 3AVWA 5AK0A 4XD7D 1KI2A 2YINC 3QXXA 2CE2X 2DBYA 3MWKA 1HR0L 3NBYC 5HCIA 2YWEA 1E9CA 3W90A 4LHXA 4QNMA 1L4YA 3ZQJA 4DK3C 4JOIA 2WWGA 1RJ9A 1GRNA 1P2TA 1Y1WG 1FUUA 1LFDB 4FCWA 4FMBB 3CBQA 2WWIA 4O25A 1COWD 3S1AB 4JV5Q 4JVLA 1HH4A 2WSSA 2EYQA 3VTKA 1K83H 3DMDA 4IXNA 1X55A 3W6OA 1H95A 1JT8A 1FMLA 1A0IA 1E22A 1CR4A 3TUIC 1KKMA 3UWKA 1VIYA 1UDXA 4RCNA 3EARA 1N3BA 3NC1C 5C3EH 3H3VH 4I81A 2BIFA 4GP7A 3H4MA 4A3IH 3SOPA 3BGWA 1ESNA 1CJTC 2GDJA 5F9FA 4ASUD 1RRCA 4IFBA 4PC7A 3KJPA 1TU3A 2O8FB 1VF5C 3I8XA 4U5XA 2PCLA 2QT1A 2GVDC 3J7ZC 1R6BX 2D06A 4A3DG 5GADC 2CK3D 4R4TA 3D7MA 4XH9B 3C7KA 5GVSA 1VQMA 2Q2UA 3TEHB 2AFIE 1Y8PB 1AQUA 3M4OH 5J47A 1ASZA 5IP9G 4PSAA 4KFSA 3RWOA 4FINA 1KL9A 3KDSE 3Q3JB 1YR9A 1VQAA 1Z0JA 1OSNA 3BAFA 4JL6A 2FFHA 5J4HA 5AJ3Q 1PLLA 3E1SA 4EIWA 3HOXH 1B9MA 1R0YA 1Z3IX 2QA4A 1N36L 4Q19A 5J4LA 2OFOA 3I72A 1WCMG 1LACA 3BG3A 2E5LQ 2EQBA 3OFND 4M53A 1MV5A 2WJJA 3RS2A 3T12A 5B57C 1E0AA 2CNWA 3GLFA 5E7NA 3R20A 1P2SA 1YZTA 3PO2H 4LJ4A 4DLTA 6Q21A 3BH7A 1W47A 5J4KA 4DB4A 3CB4A 3VKHA 1KXLA 4P4SB 4Q1CA 3S15H 4C4PA 3QQ5A 1C4OA 1SROA 3FKSA 4TQAA 2ZXUA 3P20A 2JA1A 1R10A 3LX5A 4BFWA 4B3TL 1E2MA 1DCZA 4GOPB 1NN5A 2OUKA 3LRPA 1TU4A 1CULC 2YHSA 4YDHB 3H86A 3HU3A 3RZOH 4HJ8A 4NYJQ 1ETUA 2ZI6A 3VKGA 1HT2E 3GJ7A 4AY2A 5C46F 1Z22A 2P5SA 2A5YB 2JQOA 2KCTA 5JS8A 1MABB 1NKTA 2FZ4A 1GUTA 1Q90A 3T1HL 2WHXA 2ZI4A 3R8FA 2XJ4A 3BJUA 2G0NA 3DLLA 4CEHA 2OTJA 4DDTA 1YZGA 2IYYA 2FMXA 2G83A 2PNRC 2Z0SA 3J81k 2ZU0C 4YMUA 3CPJB 3T1TA 3LQRA 4GLAC 4Q7JB 4C30A 3DXJC 2LWIA 2VA8A 2W6IA 4JIMA 3THOA 1XNQQ 3VHXA 2GTPA 3CC7A 3S24A 1OIVA 4MA4A 4P4TA 3TVTA 1Q0UA 4ZV4A 4R2IA 3UE0A 1L1OB 2AXNA 1MIUA 4US0R 1FNNA 4LYHA 4D81A 5DN6D 4A3MH 4JI6Q 1JJGA 4YQFA 3V4RA 1MKYA 3A6PC 1HNXQ 3HOWG 2G1KA 2V7QA 3ADDA 4O2LA 1NL3A 2XZOA 3GTKH 5JRZA 4DV6Q 2NO1A 3B1XA 1Q86C 4BFSA 1A2BA 3GP8A 4QL5A 1KTVA 1GRRA 3AVUA 3A1TA 1JEEA 1Z08A 1G5PA 1VCOA 3OESA 2PZEA 2YOFA 5AUPB 2H92A 4RKFA 1W36B 3HOYG 2XB2A 2GJKA 4Q4AB 3K8AA 4QHYA 5JEAJ 1SXJE 4A3GG 1K8GA 1L4UA 3I4MG 8OHMA 3UKDA 4A82A 1TWAH 1E2QA 4LF8Q 1XD2A 3S1QH 4A3EG 3HWSA 4DUZQ 5FLXc 3CNLA 3KTAA 3U3KA 5HR5A 2AMCB 1F60A 2HLDA 4I1UA 3EIHA 4HAXA 4Q1EA 4W5JA 3MWYW 3REFA 3TGPA 2D2CC 1CIPA 3CZQA 1IXZA 3LWUA 1E0JA 4R2HA 3Q5EA 5ELOA 4IXMA 1M1YE 2FH5B 1IN7A 2FJUA 5F98A 1R5NA 2HDNB 4BBSH 1OKKD 2PH1A 3SFVA 1KIXA 4UP9A 4P33A 1VQ9A 2ZIAA 4JMPA 3TS0A 2O8EB 3AUYA 1NTGA 4NXML 1OFHA 1W1WA 3P4XA 2VS1A 5E3HA 3U6BA 5TB5A 1OF1A 4GNXB 2IEZA 2UUAL 2ZS8A 3H84A 3OAAD 4KFRA 1YHBA 5DIFA 2OCAA 1VS0A 5EP2A 4XVQA 1ESMA 1N0WA 1IJEA 3M85A 1E94E 1R5OA 2F3RA 3IPXA 3QKTA 3NWJA 3ONWA 3DOFA 1W4AA 2A68C 2PI2A 2W83A 4BASA 1VQ4A 1G19A 3PEWA 2P0EA 2VUMG 4HDQB 1CJVC 2GCOA 4RSGA 1KNXA 4R4CA 3G82C 1XJ0A 4FW9A 4YY3L 1OH6A 4KMUC 1EGAA 1MO3A 2UXDL 3CZPA 4QGHA 2A69D 4JLNA 3I32A 4P32A 4IFDH 1GHKA 3TW4A 3JZMA 5EJEA 1B70B 2C8VA 4LGMA 2XJ9A 4HB3A 1TF2A 4Q4HA 4A15A 3EPHA 1Z6YA 2B7BA 1Q81C 2JIZA 3ADBA 1FW6A 1L1OC 1AGPA 2OO7A 3U3RA 4BFZA 4GLVB 2FFQA 3I73A 3FPAA 1PH7A 1HE8B 2ZRJA 4BFXA 4BFUA 1J5EL 1X8KA 1KSFX 2MSEB 4PZ6A 1TQ6A 4JZKA 1MO5A 4Q03A 1TPZA 5C18A 2QUZA 4Q48A 5DE3A 4DZZA 3H0GH 3KF8B 3GFOA 2GXSA 4Q4JA 3TUZC 4C7OA 4ZI2A 3THWB 1D5CA 1G7CA 3DM5A 2JA8G 3A5ZB 4OWXB 4UY8C 2ZRIA 5TARA 2YTYA 2QAGB 1OHHA 2HXSA 1B9NA 1M74A 4ABYA 1ZCBA 3HOZG 2QF7A 3KFUA 5CK4A 1TEXA 2IBMA 2BKEA 2ZTCA 2VL7A 3KF6A 2HIXA 3ZZ0A 3A8KE 4E03A 5CITA 3PENA 3PF4A 5H70A 5ANRB 4MYCA 4DHEA 4POAA 1MJEA 3OEHA 4KV9A 4BFTA 3UG6A 4G5GA 1VG8A 3H0KA 2WP8J 1E6CA 1NKSA 4UXHA 4F92B 1ZYRC 2N49A 4A3CG 3RNLA 1TTTA 2O8DB 3LGJA 5IWAQ 3QXJA 5LPNA 3ZDQA 2BDTA 4KLKA 2F3TA 2GNOA 1KMQA 5DO9A 1ZAKA 1B8AA 3SYNA 1N33Q 4LFAQ 1C7YA 1II8A 3GTQH 4D80A 1LF5A 3L43A 5HCNA 5JEAG 2I5HA 4DR7L 4IDHA 1EG7A 1SMYC 5JS7A 3KUCA 4DV1L 4HDOB 4MZ9A 3AEZA 3EZ6A 2W2VA 1R9TH 5FTKA 2KJQA 2JJ1D 2REBA 4B33A 2MMGA 3N6RA 1P16A 1E1RD 1VQ7A 2EJGC 1EWQA 1UE6A 3QBVA 3U7HB 4P71A 2R7ZG 3W8NA 2W6JD 3WNDA 5LMUQ 3HGBA 2W2TA 1XXHB 2FGJA 1S3GA 2PCFB 4X8MA 2JASA 2F4VQ 2D62A 1ZM2A 5JECA 1EFHA 2C99A 4LBYA 4AKEA 2JLSA 3NXSA 2D3WA 1VG9B 3PF5A 4ZDKA 2K50A 1CXZA 1KI8A 2JA5H 2C03A 2PNHA 3EA0A 4TZ0A 3D3QA 4J0QA 1N32L 2QPAA 1H8HD 4KAXA 4OK6A 3K53A 1HNWL 2K33A 4GP6A 4BE7B 3AVQA 4RCZA 2XSZA 2A7QA 4UQOA 2UXBL 2YTXA 1FOEB 3GLGA 4PPNA 2R93H 3SDZA 1E2FA 1VKJA 2RGCA 2TMKA 4GZMA 4TMWA 5FPSA 4A3FG 2MSCB 4V0OA 3CW2C 3L82B 1TQDA 4AKGA 3PUXA 1CEEA 5FL3A 1VTKA 2YC4C 4NCNA 4DSTA 5HGQA 4IOKA 1E0KA 1WXQA 4P0TA 5JHHB 1P60A 3PGZA 1FGUA 5F9HA 1UFQA 1X3EA 4LFCL 3DOEA 1YVCA 1NMYA 3MSXA 4JVNA 1S8FA 2QT0A 1NY5A 3UMRA 1Q57A 1R8SA 4MGIR 2F55A 4B34A 4CEIB 4IPCA 1W48A 2RGAA 4F93B 3CCJA 1GILA 1ZU4A 2F9LA 4PXAA 4DLRA 3IBGA 2VQEL 3P27A 5L8VA 2Q2TA 3ZVMA 4TLCA 2D2EA 1XBTA 3WRXC 1BOFA 1SZPA 4G7HC 1RPZA 4HLUC 3S1MH 4EFLA 3ZH9B 4LFBQ 4YHHL 2XX3A 3VR1A 2WJYA 4C9BA 2IUSA 2W2XA 5IK2D 4NMMA 4DR2Q 2PBRA 2W0SA 3PG5A 5FLMH 1HNZL 1G5TA 4MNOA 3B82A 5EXXA 1CS4C 4GOXA 4JI8Q 5BWMA 4X66Q 2N46A 3WWVA 4AG5A 1CTMA 2GJ9A 1MRSA 4BXXH 1I4DD 3P4YA 4JLOA 1HQYE 2EVWX 2F43B 4DV7Q 2XAUA 1QHIA 1XU4A 2ZJZA 2FNAA 2BM0A 2ZANA 3LLUA 1G5RA 4D4JA 3WY9A 4LF4L 3LD9A 4Z51A 2QM7A 3KZ1E 3CF5A 4DIEA 1YR7A 4F7WA 1VQDA 4TYNA 1NI3A 1TAGA 2ZE8A 2EFGA 3LWNA 3VX3A 4L8JA 3ER0A 4Y52H 1Z8FA 2AXPA 5FOSA 1XMOQ 2WJVA 3GLFE 2AUJD 4PQYA 2E9SA 1UE7A 3FTQA 1DPFA 3ASZA 1H9SB 3A74A 1N8RC 1GVPA 3GFPA 2XTIA 3OIVA 4PZ8A 1J90A 1E9RA 2ERXA 4AC9A 4AD8A 5FUXA 2BE5D 2N8NA 1N0VC 4JI1L 2ODNA 3AYHB 1Q1EA 1CU1A 4HATA 1ZNWA 2ANBA 3A1VA 1S9HA 3DPUA 1UBCA 2CKZB 4L5QA 4L5BA 3EAQA 4DJTA 4B3MQ 4LHZA 3OZXA 3CCEA 2NZJA 2G1JA 3WNBA 4H44C 3B6EA 4A3LG 1BYUA 5C0XG 2XGTA 4J15A 5IP7H 1SMXA 4AYBG 2I0QA 4MDEA 2QRNA 1AS3A 4BZXA 4TZ6A 5AUOB 1CP2A 4FWTA 4XTCS 1IQPA 2WWWA 4IDQA 3AVYA 2JEBI 1E1TA 4LF7Q 1PYSB 4C0SA 3W1GA 4GKJL 2Z6VA 3IUYA 2YJTD 4LBZA 4MH0R 4LOAA 2CLDX 4OK5A 2ZM5A 1KDPA 1L8QA 4QKQA 2VP5A 1KK3A 4QBGB 3QKRB 1W4RA 3A58B 3T1YQ 1D2MA 3OTOL 1DG3A 1FVIA 1E32A 3M3YH 1F5NA 1UM8A 2KWIA 2ZYTX 5AJYA 3GFTA 5FBVB 4TL8A 1G8YA 4PO1A 2HXYA 1PUJA 1SKQA 4Z1MD 2P3SA 2CJWB 2FN4A 4M9QA 5FTLA 4CT5A 2YKGA 3I3SR 1KC8C 1VQOA 2FX3A 1IYVA 3QPVA 2RGBA 4KSCA 4BZQA 3PIRA 1YJ5A 1QZHA 1EFTA 2CLSA 2OG2A 3ADKA 5DHAA 4H0LC 4DCUA 4I1SA 3FHCB 5BYJA 4V0LA 4CT4B 1E79D 2RHSB 2E5LL 1K5GA 3VKWA 4OGQC 2J1LA 2Z4RA 5BYKA 2WFWA 4ZDWA 2C95A 1T4GA 5EUQB 5A4JA 4OJQA 1FX0B 2AD1A 5KOYA 1E1QA 5KUTA 1VCNA 2ZE7A 4FCVA 4PAQA 4EJSB 1E9FA 4HIOA 3Q7QA 3HU1A 3CCVA 2WTUA 3CO5A 2IWRA 4EQ6A 3BFVA 4X8LA 4A3KG 2GZHA 3BRWD 4JI2Q 1CKEA 1O7LA 2WSSD 2E1RA 2HHHQ 3RABA 3QBTA 4HAZA 1YQTA 5JCPA 1AK2A 4FI3C 2J0SA 2ZM6Q 4RD2A 1O3YA 3TBKA 5EP1A 1K0RA 2ZJOA 1UJ2A 2D0OA 1FJGQ 1TUEA 4GPTA 1FFHA 2C98A 2R92G 3NBXX 4KYUA 4YONB 2NZOA 1P9RA 4AQYQ 3OYYA 1XNQL 4L15A 4QY7A 5JBQA 2ZRDA 2WMOB 3TK1A 4A2WA 2L15A 3GLHE 3OW7A 2PQAA 1XWIA 3IGFA 4NONA 2Z6KC 3Q8XB 4B3SL 1JAIA 2Y8EA 1P5ZB 1HNXL 4EUNA 2JA9A 1XNJA 4NE2A 2C9CA 4U02A 4BY1G 2FF7A 4JI0Q 4RKEA 5FPTA 1GZSA 5L3SB 4IOAA 1Z07A 3SC3A 2XNDA 3BE4A 2JLWA 1G17A 3L0IB 4HLQB 3QY0A 4TN1A 1R0WA 1CSPA 4IOCA 3EXAA 3GJXC 3IHWA 2GEVA 3ZS8A 1C9KA 3O8CA 3QSYA 1E4YA 3WBJA 2K52A 3CH4B 4LC0A 1RC8A 4NZYA 5IYDG 1A4RA 1M1KC 2FPKA 1XCMA 2CNWD 1HT1E 3Q72A 4A93H 4R4OA 2AK2A 1WYDA 4DR6Q 2XB4A 5GJVC 3FKIG 3THXB 1VIAA 1L0WA 3AQ4A 1HJPA 5LB4A 3CF2A 4N0EA 2IS4A 4BA1I 2BMDA 3F5FA 2EQSA 1EFCA 2ZJRA 1CKNA 4RZ2A 3M9BA 1VQNA 2JCSA 3FKSD 4LF6L 2Q3MA 3STBC 4LF8L 5KO2A 3BXZA 1KD1C 3A8JE 1YIJA 4QM6A 2A8VA 1Z5ZA 4KN4C 3GTLH 4DUZL 2F1RA 3JZAA 1G3QA 2BCGY 4BWYA 3O8RA 4C3HH 2HCBA 2WKQA 4DSUA 4KLNA 4JLKA 1CBUA 4CYMA 2VHTA 2YU9H 2PZFA 5CYOA 4NU0A 1WOCA 3RANA 1M6NA 2RGGA 4HB2A 4JKYA 5JSZA 1SXJB 2R7FA 3VQTA 1R2QA 4R71A 4HB0A 1ZCAA 4EJSC 1AKEA 3U4QA 1H8HA 3K9GA 1U90A 4IEIA 1ZJ6A 3CKLA 4EPRA 5FTMA 1GUNA 2PEZA 2W6ID 3QENA 3IDQA 4QFMA 2DUDA 4MRVA 4A6XA 2OHFA 1XB2A 3RDPA 1V8QA 2VIIA 3E70C 4X62L 3X1ZA 3HR8A 1OIWA 2YZ2A 1X54A 4YMVA 5HTKA 3RVBA 1XPUA 4TL6A 1QHYA 3I55A 2YOGA 2REXB 3W3AA 1GUOA 4ZCLA 1X1SA 3J81c 3HOUG 1ZYUA 2V7QD 4TTRA 4IOLA 1KSGA 1T8TA 1DAHA 2H18A 2JAQA 1Y1WH 1XTQA 2UZIR 3O8DA 4ACBA 2I3BA 3KJHA 2O52A 2ZETA 4TMZA 1XJCA 1X65A 1MOZA 3KJIA 1PH1A 1XXHE 4PQRA 4Q00A 5L3VA 4YXWA 3VAAA 3DVLA 2B8GA 2ZAOA 4IFDI 4GDFA 1NSFA 1EK0A 1UKVY 2NMVA 1W4BA 2PMDA 1CF4A 1KHTA 3FP9A 5GAHC 4PAMA 5G53C 4C0QC 1EESA 4ACAA 2ALYB 1D8LA 3GLGE 4LJ5A 2EWVA 1UDWA 4I1OA 3B85A 2RGNA 1KRSA 1DVRA 3A37A 1XPOA 5M5WH 2Z0MA 4A3DH 3TLXA 1L2TA 2BC9A 2HLDD 3GTGH 1G64A 2JEOA 1NLFA 3JAMi 1FP6A 4L16A 1MO4A 4JL5A 3HYTA 1AE3A 4IJHA 2Q6TA 3GO5A 3FDIA 3RSLA 3BH6A 4RFVA 2JLUA 1IBKQ 4ESHA 5IP9H 3B1VA 2EU8A 2NN6H 2RB4A 2IUUA 2OQ0A 2WPDA 2BEJA 3MD0A 2XITA 3BD9A 5J4YA 2BDOA 2I5MX 4X64Q 1QF9A 2GVAA 1T3HA 1QZGA 2J87A 1UKZA 1WCMH 1YZLA 4NTZA 1O87A 1ZM3A 4KITB 4HUTA 2QBYA 3ZD6A 1CSQA 3O8BA 2GAAA 4JSTA 1NIPA 2B29A 2RGDA 4IDPA 4JBMA 4DR1Q 2FG5A 3J7A5 3B2EA 1PLKA 5H68A 2SHKA 4URXR 4E09A 2J59A 2QNRA 1KJZA 4N3NA 1FYCA 1N6PA 1JR3A 5C0XI 1N6RA 1SXJC 3IKJA 3LDAA 3NVAA 4IJMA 4LY6A 1YU9A 3RC8A 1DAEA 1AKYA 3KKPA 3MEFA 1I4LD 2JJ2A 1PH8A 3QF4B 3T1VA 5KSYA 3QG1A 1JJVA 1ZU5A 1OFUX 2UUCQ 5GADl 4R98A 4POGA 4HIKA 1IN4A 2G88A 3B13B 4LBVA 1A5TA 3AVOA 4HAWA 5EXTA 3AF0A 1QUQA 3CRLC 3ULJA 4DT1B 5LMUL 3CCRA 2Q9CA 3S1RH 1KYIA 4I1VA 1R0XA 1Z0KA 3EA5A 1SVIA 1IBMQ 3RRMA 1D7QA 2LCFA 4QNRA 3T5DA 4GMDA 1N6HA 2VP6A 3I8SA 1EOVA 5CK5A 1E2VA 1Z9FA 1UBFA 1X8JA 2AN9A 1Q1QA 2B6HA 3K0AB 4ZIRA 4GOKA 2LKDA 3NH9A 1Z0AA 4TSFA 2ZITA 3CCLA 1VF7A 1E4VA 1Q1ZA 2CXXA 4XIGS 5P21A 2HF9A 1EX6A 4TLAA 4Y0AA 1MT0A 4Q7LA 5IYBG 1OHHD 3CR7A 1P72A 2DR3A 4HI0E 1OH7A 1IZ6A 2IWHA 4EPVA 1KMHB 1W49A 4GT1A 3T53B 1QZXA 3HOWH 4DSOA 4A36A 2V54A 4YCVA 1XJQA 4WXPA 1KSJA 3OEHD 2MO0A 1JR6A 3ND8A 3AP2A 4O2DA 3AEVA 5E95A 4W7SA 2OFWA 2R6GA 1CKMA 4BZPA 3OE7A 3W3ZB 2VF8A 2YWFA 2QGNA 3DKPA 4Z54A 3N2EA 4RFSA 2VQFQ 4JBYA 1I50H 2A6EC 4YCUA 3DMNA 4Q02A 4EPYA 3HJNA 1ZNZA 2MO1A 3F3YA 4EFMA 1IXRA 4LV6A 4PX9A 5EXSA 1E3PA 1X86B 4X65Q 1NBWA 2BOVA 4GN4B 4LX0A 3PCRB 4Q9IA 2C9OA 4NYIR 4Q21A 2WM9B 2RAPA 3RNUA 3UE1A 4A3GH 1LS6A 1FR3A 4OI0A 4RJLA 1XCPA 5FI0B 3I4MH 1DS6A 1TQ4A 3EBEA 2I1QA 4DV4Q 4LFBL 2VHCA 4M0LA 2I1VB 4BEJA 4PC3A 1HUQA 1LVGA 4NH0A 4A3EH 4UNPA 2VY3A 4DR2L 1BVSA 1OXXK 1BYIA 3MRSA 3VR5A 1OTCA 3L0OA 2ZR0A 4I99A 4V03A 3RRYA 4JI8L 3VDYA 5JMTA 1SKYB 4BBRG 2WOJA 4X66L 1U9IC 4Q9JA 2HT1A 5EXPA 4EX5A 4AKIA 2ZROA 1YNNC 1S96A 1NMZA 4B35A 4DV2L 4HZIA 2J9RA 5FTJA 1QVRA 1U8ZA 1PHJA 2C5LA 5G3YA 2FA9A 4DV7L 1T3SA 2MSDB 5EE0A 3EZ7A 2D5DA 2ZRKA 1VCMA 3GTPH 3R9WA 2ZI7A 1E2HA 1LM0A 2B63G 4LYAA 4ESVA 1KJWA 1II9A 3OW2A 4IVRA 3LLMA 5FJ8G 4Q4LA 1P75A 2A3RA 1X3GA 4JLBA 1CJMA 4JS0A 4AYBE 1XMOL 1G6HA 2RMKA 1QVFA 2XSZD 4V02A 2IHEA 4LUZA 2X19A 4M8NE 3EC1A 721PA 3CLVA 1ZC4A 2JGNA 1D9XA 3W5IA 3S1AA 4C2TA 2VLIA 4AG6A 4MRSA 5EAYA 5FUVA 1GD7A 2H5EA 2VUMH 2QZ4A 4RZXA 3PIOA 5BN4A 3U2QA 2NN6G 1T5EA 3PUWA 2DWOA 2WAQE 4M22A 1IXRC 2GJSA 3FHTA 3B1WA 1X9NA 2G6BA 4OJKA 5D3MA 4OHWA 4DR3Q 1Y69U 4IO9A 1M7GA 4WZBE 1Q20A 1E7ZA 3AH8A 4KHPL 4DCVA 2IS1A 3BZCA 3AB9A 3IQWA 3ZVLA 5CB8A 4OQMA 2ZSDA 4B74A 5EUMA 3GLFB 4JL8A 1EIYB 3HOVG 3TS2A 2JA6G 5DLQE 3ZYCA 5C4XG 5KPJA 5C1BA 4LF7L 3SGIA 3CC4A 1U99A 1ZKOA 3CMAA 2BMJA 3T15A 4EPTA 1I3QH 1A62A 2PT5A 2R6DA 2ZR7A 4MYUA 3T1QA 2HCJB 4UXJA 2OBNA 4DV0Q 3CRW1 4KKTA 3QPWA 4DEXA 3KQLA 4GL2A 1KO5A 2XNSA 2ZVQX 1VMAA 2JA8H 2RF4A 3T34A 2ERYA 4JCVE 3T1YL 4HZUB 4LJ8A 4NBSA 4A76A 1JQJC 3L7ZC 4RG1A 1Y8NB 4KI0A 3AFPA 1U2RA 3HOZH 3AKCA 1ODFA 3CIOA 1OV4A 1ZMXA 2ZPTX 3AF1A 4GZLA 3CAMA 5GJWC 1TX4B 2K5HA 5JJKA 3K70D 3B5JA 2OFXA 4ON9A 1X3FA 5IE8A 3U3OA 1SVMA 1T3LA 2B21A 1N5JA 3PITA 5HY6A 2ZREA 3IEUA 4URYR 2ONJA 3IBYA 2DGYA 4OWTB 1OE0A 4A3CH 3RS7A 4PPQA 1KK1A 3OPOA 4OO1G 1X6VA 2JJ8A 4P4SA 4DR5Q 2ZI5A 1S1CA 3FFAA 4HAYA 5L3QA 1E96A 3U9SA 1V5WA 1P2VA 2V4DA 2FSFA 3U50C 3CX8A 4GOPA 4M1KA 5DGXA 4BRUA 2AKAB 1X3SA 4IVPA 4CRWB 1YKSA 4KU4A 4EPWA 5JEAH 3NHBA 3OIUA 3MJRA 4L5RC 4HJ5A 3C5HA 2QA5A 2ATWA 3ASYA 1KDRA 4XJXA 1UEIA 2CHGA 1VYTA 1J70A 3B7GA 3CUEF 4FIDA 1SVKA 4I4LA 2AUKA 4LPKA 3SYKA 4LWZA 5KDOA 1Z29A 1AQYA 4IW3B 4AI6A 4PO9A 2R7ZH 1K5DA 4W5WA 5IT5A 3ETLA 4MYHA 5C4JH 1EFWA 3IPYA 5FPKA 4CEJB 1I5FA 2IYLD 3TAHA 2HHHL 2BV3A 2XTMA 2J0UB 4FMDF 1JXOA 5CLQA 1W7AA 5J40A 1YR6A 4JT2A 2LXJA 2VSOA 1L1OA 2GILA 2ZJ8A 4XTRA 3KLRA 2AL7A 2GBLC 2WSMA 4EDHA 3WRYC 1NF3A 4YCWA 1IBLQ 2PX0A 2R2AA 4KXFB 3H1TA 1XEXA 1P4SA 2NO9A 3MJHA 4CZ2A 4A3FH 1ASYA 2OESA 5IF9A 1XMQQ 5JEEA 2V1CC 1IY1A 3T06B 3BU2A 2KCMA 4C3IH 1Z06A 1QHGA 3DO6A 4HAUA 4P72A 1BH2A 3CRQA 1IY0A 1TADA 1Q7YC 1IONA 1J8MF 4OHVA 2I5LX 1E2ZA 4Q4AA 1E9BA 5CJ2A 3K9HA 4CIDA 4GOPC 2FFBA 2ATXA 3GEEA 5KYKA 3KKQA 3V9PA 2QI9C 4M1MA 3AKDA 1RYFA 3IO5A 3QVUA 3RS3A 2GXUA 2OBMA 4TYWA 1D8TA 2ODWA 4FN5A 1OYYA 2JLRA 3ECCA 2VHUA 1SRUA 1GL6A 4AYWA 1YNJC 2VRWA 1G6OA 4UP8A 3GLHB 1G3UA 2Y0SG 3I1FA 1KAGA 4LV8B 3RHFA 2FXQA 3GTJH 5M3MG 1WF3A 5BN5A 5A35A 2GCOB 4OKSA 3U7EB 3MFYA 4UJ3A 1XMJA 2O5JC 1YVDA 1S3SA 3UWOA 1GAJA 4LW1A 3LO5A 4Z8YA 3SFZA 1E1QD 2A5FA 2ZYWX 1Q8KA 3NENA 2GZDA 1OXVA 3SBDA 1EX7A 1BBWA 1GO3E 5KNDA 1KRTA 4PR0A 1G7RA 3FVQA 4TL9A 1GHJA 3WHLA 3FFBA 4L9WA 4LF5Q 1OXUA 2O8EA 1T5LA 3KXLA 2O0JA 4DAMA 1PH2A 2Q21A 1KK2A 4R4QA 4GNXA 1IXSB 1NJFA 2LKCA 2ZSFA 5HZKA 5M04A 3FYHA 1G3IA 2CWPA 1VQ5A 1OT3A 1RRPA 1XRJA 4NYJR 4C7OB 4MGZR 1IW7C 3T51B 1NJIC 2FPMA 2WAXA 2PX3A 5AJWA 1QBKC 4QG7A 2GJAA 1G8GA 1QVAA 1H9MA 4RD1A 2GESA 1V1QA 5AJXA 3UDIA 4TL7A 1CRPA 5J4VA 1W36C 4P4UA 5LMNQ 3CX7A 3KF6B 5JI3E 2GETA 2Z83A 3RRZA 4O3MA 5KDDA 3A1UA 5D3QA 5TY0A 4CGZA 2AWOA 4RD4A 3SJZA 1N6KA 3AP3A 1UKEA 1SULA 3E5HA 4DLWA 3JVVA 4MKGA 3SBEA 5GAEC 4NYMQ 3FMIA 3CW2A 2ZAMA 1XMVA 4MKIA 4RVCA 5EP3A 2XXAB 2PPBC 3AFQA 5LMNW 2MQHA 4A3LH 2XNDD 4NDZA 5C0XH 2BMFA 3LNNA 3CQZH 2F9MA 2FWRA 2OXRA 1MRNA 3THWA 1KZGB 4N1AA 4PPFA 4HJ9A 4G5QA 4DV5Q 1S9DA 1X8LA 2R6FA 3TQFA 1WCV1 1G7SA 3NHAA 4LC1A 1II0A 2GKSA 3PR1A 4HYYA 2WIAA 1OH8A 1GKIA 4ARZA 1A8VA 4D6PA 4JLAA 5KNBA 4GNXC 2J0QA 3I61A 3F1ZA 2K4KA 2V6IA 5K36G 3IIJA 2OBLA 3I7FA 3EX7C 4HLUA 2N42A 2PCJA 2GF9A 4C0KA 1I94Q 2ZE5A 4TT3A 5K8LA 1US8A 3C41J 3CNNA 4C0HA 4DUYL 1KDOA 4A0FA 3DZ8A 2ZSAA 3QKUA 5C4GB 4ZCMA 2NZHA 3THYB 2ZJBA 4XSGA 4JI7Q 1KO8A 1M90C 2HF8A 2WKRA 4M9SA 3SYLA 3TR5A 1VHTA 4XWKA 3EN2A 4LJ6A 2QRZA 4M1WA 4C2MH 1SVLA 1VQ8A 4D0LB 3GLGB 5BR8Q 4JYAQ 2FU5C 2NN6I 1Q44A 2CVFA 1TEVA 4QXAA 3RZDH 4IDNA 2VZAA 1R8QA 1KKLA 5FOUA 4DR1L 4O0MA 2ATVA 4B3CA 3AVXA 1JPJA 1XNRQ 4JK1C 2ZSBA 2UXCQ 1LTQA 1KY2A 1OLOA 1QDEA 1Q46A 1DBSA 3QXCA 1VQKA 3GDEA 2WJGA 4LYJA 4Q7MB 3RYTC 1VYUA 3M6AA 2J7PA 1IYJB 1G51A 4OHZA 2ZJPA 4JLDA 4MYTA 2QAGC 5KDLA 4A3KH 4WVFA 4ZCIA 1GRQA 1G4UR 2J0VA 1XMIA 3K7AH 4PANA 4Q01A 4R9UC 4Q9KA 1SKYE 1ONBA 5EE1A 2IYSA 4D0GA 4YXWD 1N5LA 1IBML 1XTIA 1BMFA 4V0MA 3VNVA 3DHWC 2QMHA 3K0FB 4LHWA 2MNAA 1ZNXA 1ZRHA 5CDFA 3MAAC 1ZC3A 5GVRA 1NMXA 1VQCA 2GAOA 2JJQA 4M1TA 1B7YB 4PO8A 3MMPA 4ZI3A 4DUGD 2UUBL 4RD3A 2R92H 5JWOA 3H94A 1NJGA 4LJ7A 4MKFA 3K70B 1VQFA 5CJPA 4B3BA 3DDCA 2DPXA 1WB9A 4I7ZC 2ZS7A 2DY1A 4QHTA 3KDFB 5DI3A 3WXMA 2JDIA 4G01B 4JBXA 1Z47A 1P3JA 1N5KA 4OO1I 1S2MA 5KNCA 2KB0A 1NVXQ 5H1YA 4QJ5A 3SS8A 3L2OB 4BY1H 1U5KA 4LUVA 2UU9L 1DAIA 4A8JB 2C04A 2GHIA 2WPDD 1TXYA 3Q5DA 4ZPXA 2VHJA 2EYUA 1HR0Q 3S16H 3CCQA 2UZ3A 1GP2A 4MKHA 1J8YF 3QIAA 3BIFA 4B2PA 3QF7A 5FOWA 3WMGA 1NLYA 3GJ4A 3TW8B 2JLYA 3A36A 4JI5Q 2QTHA 1Q3TA 1DEKA 5IYDH 4X65L 2GVZC 3U5ZB 3FKIH 4NPHA 1OH5A 5JZVA 1YE8A 1YRAA 2CCKA 2QTVB 2WOOA 1HTPA 3AKEA 1JR3D 3VMFA 1HR0W 1QJOA 2C2HA 1WRBA 3MXUA 4DV4L 1XD9A 5E4FA 1Q22A 2VP9A 1IHUA 1YZUA 4OQFA 2JJ2D 4TLEA 5FH9A 5DYGA 2D0PA 4ZDIA 4JV5L 2R7DA 1UWVA 2CCGA 3IIMA 1YHQA 3ZJYA 2CMKA 1AGRA 3MLEA 1Z6TA 4RD6A 1F2UA 4WZ6A 3TNFA 4B71A 4GI7A 4Y0VA 2GK6A 4UNQA 1PYBA 3UMSA 4A4IA 4B48A 1ZM9A 1W44A 1OW3B 2OILA 5CIQA 5C44G 5FOXA 2D7DA 3EIVA 3MWJA 1WI5A 3K0XA 4L5TA 2HJGA 2A30A 2E2JH 3WYFA 4B6FA 5JCZA 1DD2A 3I5XA 1W0KD 1Q82C 2ODEA 2W58A 4OI2A 3C5CA 4K8OA 4FMDB 4TSFD 1G291 4RD0A 1Y63A 3AV0B 3T1OA 4D4KA 1KI9A 2QEXA 4DLVA 1QHHA 2E76C 4HJAA 1PLJA 1T5IA 2JA7G 1DAMA 1PH9A 4OL0A 4WW0A 4XOIA 1P9NA 1ONLA 5CB6A 5KHOC 1GG2A 3EW9A 5G40A 1OFIA 3S17H 4DBLC 1AH9A 3HOUH 2GZAA 3GJ5A 1E2LA 3NDBB 2Z6KA 1XDBA 4A6PA 4D25A 5AJ3L 1NE3A 1K8OA 3OE7D 4QBIA 1SGWA 2JATA 2RCNA 2J41A 2CHVA 1EIFA 5EZ6B 5KU1A 3HPQA 4M1YA 3EPKA 2Q3FA 3TUJC 5EP4A 3I2ZA 4DKAC 1OYWA 4MUAA 3PFIA 3IIKA 4NP6A 3IQXA 3G4SA 4A8JC 4PG3A 3T1HQ 4GKKQ 2DHRA 1G8FA 421PA 4YMTA 4QJ4A 2C35B 5H8WA 2HUPA 2EFEB 4MGYR 4BLQA 3I4NH 3ZJYC 1H9RA 1XTRA 2NQ2C 3W5JA 2AHOA 3N2IA 1KAWA 2F1MA 4BGDA 1UAAA 4HUQA 1V9PA 2A19A 1A2KC 4B3FX 4DNRB 5GROA 1W5TA 2ZVPX 2XTZA 3EWAA 3ZD7A 1BDOA 4B3GA 3CCMA 4OX9Q 2KENA 1W46A 1K6MA 4G0NA 1R7RA 2RGEA 3ZZTA 1M34E 4M1SA 1VQ6A 4K0KQ 4HEJA 1IN8A 2IL1A 2WWHA 3WNCA 5AR1A 3HFZB 2PJZA 5JWRA 1JECA 1BKDR 1X56A 1XTJA 5CIWA 3BERA 2G3YA 2QU8A 5HPYB 1JE5A 2CWAA 1A7JA
chains in the Genus database with same CATH superfamily
3JAME 2CFTA 4C2MB 1NQ5A 5K3FB 1M2OA 3ZGNA 2XYRA 3P2YA 1CI3M 4KH1A 4PBSA 2PL3A 4NB3A 3QBDA 2BGGA 1KYTA 4RMGA 4YP6A 4HTHA 4ZOCA 4AX8A 2C29D 1M6HA 3E5SA 3KEMA 3L5OA 2PBZA 1FLVA 4I5EA 1WUKS 4R9SA 4RAQA 2Z8YA 3ENWA 1PNVA 2ZRGA 3PUVA 3DE2X 2IY7A 5JR3A 3NIBA 1PFMA 3FE2A 1QVWA 2NUCA 2XIWA 2UUOA 1GA6A 5BR1A 5TGTA 4DZRA 2BFBA 1OI7A 3RS8A 4DV3Q 3VNQA 3A7AB 3IVMA 1AKQA 2PGXA 3T16A 5D1NA 1RXIA 1NY4A 4IG9A 1ZMOA 5LP6F 3WNQA 2CFMA 1NLZA 1VZ2A 5C3MA 1HSZA 2O8BA 3P9ZA 4UPAA 1SXHA 1WKVA 1DHTA 3ENKA 2DB3A 3OT4A 1ZJJA 1N2XA 3HBAA 4ZUJA 4V0NA 4PY2A 4DVJA 2JA6H 4TS1A 4HGNA 4DV5L 1N33L 4QGAA 1HA6A 2PS3A 2YYSA 3ZKWB 4NXMB 1U80A 3F6EX 3NPPA 2Y0DA 3EIXA 5LDGA 4YV1A 2X7XA 4ZVVA 5SV2A 3R7BA 4YY3B 1XVVA 1XRQA 1W0KA 2YC2C 2H8GA 1BU5A 3R75A 4JGBA 1DAGA 3P0RA 4A10A 3G59A 2VJOA 3OX3A 4B2IA 4JP5A 1D7AA 1Y8OB 3FWKA 1XQXA 4EVRA 3KLOA 4O4HB 2XLBA 2V1UA 2HDHA 2IHYA 2K5QA 4JP8A 5CCEA 1QGED 3WIDA 1SNPA 3U61B 3M1LA 3IP8A 4IN3A 3N8KA 4BVJA 5C32A 4W1SA 1M33A 4RXMA 1DMSA 3G5UA 2G9ZA 1AK1A 3STUA 2DFTA 4XUCA 1V8ZA 3L7KA 1BJKA 2HMAA 2Y67A 1EAYA 1K8QA 4L72A 3OQNA 1W0JA 3L7AA 1Z35A 2NO6A 3E3AA 2JG3A 3IUMA 2PXXA 4MA5A 2PZLA 4ZKDA 1EYDA 3DP7A 5KNBH 2O20A 2AEEA 1YT5A 2NU7A 2XTAA 4OLAA 4LWCA 3IKTA 3PFFA 4CM4B 3FWYA 4WCVA 3AERA 1UAYA 1PTOH 2ACWA 2FCRA 4UBOA 2V97A 1R0LA 1MR3F 2XIQA 2I29A 1EVKA 1LDMA 3D2BA 4LYDA 2ZR9A 2P8SA 4NCHA 3W2FA 1IYUA 3JQPA 2H1HA 2KHIA 5JJZA 2WUGA 5F1KA 3UB3A 1P80A 4JJ6A 4AY3A 4YDSA 5HFNA 4IKOA 4UUAA 1IVNA 5JG7A 4F21A 2A0UA 2B1RA 4IJ5A 2XODA 1YJBA 4IAOA 3IB3A 4HAEA 2J0UA 2VHXA 4AZVA 4JVMA 1AW7A 4U1RA 1ILPA 2B78A 4JQSA 3EMBA 2A2ZA 3DONA 3L0YA 4QQRA 2PLRA 2AJDA 3IH5A 3RR2A 3VV3A 4IHQA 1NHGA 1W2BA 5A02A 3QE3A 4FT2A 3ZC3A 3VHLB 4K7JA 3HGQA 3EIWA 1BX0A 1ELOA 3DBHA 3QWBA 1IJBA 2Y0SB 2FPSA 2R1ZA 2PVCA 3E9DA 2L0CA 4P0PB 2H9AA 2GKOA 3HKEA 1B6TA 2EW1A 3U3XA 1HGXA 3K20A 5DM60 3CT6A 2CXQA 2WLTA 1WEHA 4XM1A 1CUWA 1BCPF 3GJ6A 1VP3A 3PNBA 3W4KA 1XAJA 5JBNA 3D8UA 2PGDA 4NH4A 2C77A 4A3MG 1JW9B 4LNAA 3PGKA 3ZBQA 3K1JA 2EKPA 4R1UA 2BLNA 1CIJA 3I8ZA 4OQQA 3OWHA 1C3OA 4QELA 2WB1G 1DIHA 3TOZA 2P3LA 3GARA 2DBRA 3R3OA 2XGSA 1WY5A 2R4TA 2CZCA 3LAWA 4FGKA 1USKA 2YDYA 4HEHA 2OZLB 3J7AC 1G21A 4W7HA 2POCA 1XK6A 1XYVA 4HS4A 3R76A 4TRDA 3WQRA 4YWMA 5G02A 8ABPA 5AM4A 2H51A 5EBDA 2CCZA 3KX2A 2A9KA 4NCAA 4B3DA 3EXFB 1I0LA 1T8WA 4H15A 2PKYX 4QC2A 3WR5A 1VGQA 4F88A 4DLXA 1USVA 3O7WA 4DWJA 1NQXA 1QHHB 5LMUB 2O57A 4R0MA 2JGKA 3JQ7A 4ZO6A 1FP2A 1AN9A 2C2XA 1I0ZA 2AHRA 3DOUA 4PWYA 3ABQB 1BNZA 2Q9UA 4DA8A 4W1RA 3OVMA 2X0NA 1C4WA 1GPYA 3MVEA 1NWCA 3G5AA 2OB2A 3CJQA 4NJMB 3WNVA 4EYOA 3FYSA 4IXDA 1SCQA 3ZU3A 1FTSA 1A6XA 16PKA 5T4FA 4XYMA 2XBMA 1OJLA 2ID0A 1EWKA 4RMFA 4C4TA 3R93A 3AJDA 3I6BA 4N0MA 2HF7A 1NBMD 1M2OB 2RHHA 3A1NA 2ZRNA 2YIMA 2Y1FA 4PIVA 1S5FD 2YY7A 3KR1A 4D8TA 1POWA 2R8BA 2QYTA 2HT6A 1FCJA 2H57A 1KI4A 2ZCUA 2C7QA 4W9RA 4A7PA 1JMCA 4RGTA 1CUBA 4UJ5A 1HPCA 1ZIXA 4Z4GA 5LQKA 2DUMA 2OZKA 2VWQA 1FNMA 4OXIA 1WPXA 2B9EA 1XZKA 2VYQA 2BFBB 4C7KA 1KDAA 5JXIA 3RVQA 4XWAA 4K87A 4A3JH 4IMIB 1O6CA 2WZDA 1EGHA 4JSYA 1YNJD 3W9YA 1EYCA 3ZHOA 4DDMA 4YVFA 4Z0HO 4P22A 4R0NA 4M9CA 4KXQA 4Y2HA 1AHHA 1VQJA 3PSIA 3BWVA 4LHVA 2XB8A 2O8BB 2WHPA 3DAYA 3VPHA 4M9ZA 1P9WA 3F5DA 5BVGA 1O0BA 4YJDA 3SEFA 2GCNA 3COSA 4V0ME 2WVJA 1WPQA 1RWXA 1C1XB 2J46A 2LCIA 5H80A 3KSRA 5B64A 1SELA 4L63B 2NVWA 3PUZA 2A59A 4Y2QA 2Z1CA 3WMXA 4JENA 4CR6A 1U4NA 4JI7L 2Q5HA 5DEIA 1HZBA 3VNSA 5A2QA 4LMBA 4TWJA 1H65A 1CDOA 1OBVA 1XNRL 4C22A 1AH2A 3R44A 1QHNA 4RFSB 2PLWA 5CFOA 1LW7A 2X2EA 5F3RA 2YVQA 4X93A 4L5YA 2JIPA 3TJMA 3NEJA 4AUEA 2F0NA 3HEMA 1QRUA 3IODA 5HKKD 3I5AA 5C81A 4CW7A 1IEWA 3MEQA 4QJFA 1VLMA 4C3JH 3I53A 4BJ3A 2YINC 5HCIA 1L3BA 2WWGA 4PLCA 3OSZA 3VU3A 3RMHA 1E22A 1NXSA 1BDBA 3H3VH 4GP7A 3DDNA 1XMPA 3T8YA 3DQZA 1TRHA 2NV0A 4LE1A 3WGQA 4ABTA 5J2UF 3GRUA 3UC9A 5ALDA 4HNRA 2OXEA 5K3EA 4P3XA 5E7NA 6Q21A 2GLUA 3LPMA 1VPWA 3CB4A 4AJ4A 1ICFB 2VPZA 3FR8A 3CLSC 5TE9A 2JKVA 3LRPA 4I6JA 5K2MA 3GV6A 3U7JA 4UOZA 2VH1A 3E05A 2G9UA 5G4KB 4EI2A 4Q7JB 3LFTA 4JIMA 1BX1A 1LT6D 4RDIA 3S28A 2EP8A 3UE0A 1DKNA 4LYHA 3ZCVA 4MV1A 1A2BA 4HSVA 5DWVA 1UBLS 1VCOA 4KXMA 2H92A 4GEGA 4RZIA 2VUHB 3DT9A 3DLTA 1CQVA 2PZKA 3UKDA 2MR5A 3S1QH 2PX8A 4P36A 1T15A 3KTAA 1GL3A 4Q1EA 5E4TA 1PDOA 1IXZA 2B2UC 1IN7A 2FJUA 2DVMA 4BBSH 3NK9A 2OAGA 4TVBA 3P4XA 2RARA 2YS7A 5EP2A 1T10A 2O2XA 1E94E 1L4NA 3CNEA 3FWZA 2CMFA 2J9YB 1D7OA 4QGHA 2OXTA 3KK0A 4P32A 3JZMA 3V8NA 4RK5A 4D3DA 4KWIA 1P7PA 5ERYA 1ONNA 3EOAI 2MSEB 2Z2JA 2O2SA 1QYXA 3EEOA 1HEYA 3H0GH 4Q4JA 5ABPA 3HKEB 2B4YA 4JI6B 4UY8C 2PWYA 3PGXA 3PIIA 3IAM1 1JLSA 5K4GA 4JHXA 3PF4A 2YXLA 3H2GA 1I24A 3PPXA 3PXXA 4BFTA 4G5GA 2WP8J 3ZNPA 4N8FA 3K2QA 1B8AA 1E1LA 2Q1YA 3WRVA 3AI3A 3U0BA 4RMNA 3CRNA 3WZ2A 1HUNA 1RDPD 4O5OA 1E3QA 1UODA 1C48A 5I9PA 2D62A 2I7DA 1J07A 1XCLA 2JA5H 4MVWA 2Q4TA 5DGDA 2XSZA 3GLGA 4DIBA 3J80L 3V80A 4D3YA 2ARKA 5IC5A 3FWPA 3UNXA 2X5JO 4LFCL 3GTKB 2HCFA 1CX9B 1G21B 1YIAA 3AM4A 5IBRA 1W48A 2A4KA 2VQEL 4ZEMA 5DM2A 5L8VA 1H2RS 4DMRA 1VC2A 3NXWA 1UKBA 2XVMA 4YHHL 4CMCA 2IUSA 4D9HA 5FHRA 3B82A 2Z57A 1JSZA 2P69A 3KVRA 4YYZA 5GGXA 4YJKA 2ZJZA 4DV7Q 5IWAB 3EQZA 3LU1A 1VQDA 1WIWA 2P2NA 4KNVA 3LWNA 1JDUA 4ND2A 2VPQA 4YDRA 1WZEA 1PQ4A 3E8MA 2E5FA 2CD7A 2WU8A 3UUFA 2PRJA 1TFUA 4G9EA 1S9HA 3DPUA 4CKZA 4Q4DA 4LHZA 3JQ7B 3IAEA 2NO5A 4OMFG 3OPMA 1P8AA 1XA0A 3N8HA 4J76A 4RH6A 1T2FA 1TMYA 2WJZB 1W4RA 3M3YH 3KZKA 3MWDA 4M9QA 4RQTA 2F00A 4KSCA 3H6MA 2EY6A 1L5SA 2OG2A 3U09A 4ZZ0A 1EFVA 4OGQC 5IC4A 2BSXA 3EAFA 3PA8A 5D1HA 4JI8B 3MPOA 1EWCA 3N8NA 4X8LA 1VI6A 3SXPA 5CDSA 4FGSA 2PA0A 4OSEA 3NTRA 4ZTZB 1DEHA 4CQMD 2KQUA 2ZRDA 4JJEA 1NYTA 2R93B 1XWIA 4ARBA 1HNXL 1IDN1 1HMYA 4RKEA 5F4ZA 1NTRA 1NC1A 3GP5A 3O8CA 4RTLA 5DX1A 1HQRD 3G9UA 3AF5A 3OHXC 1P3Y1 5EMJA 1L0WA 3AB8A 4OBBA 4BA1I 1PJ8A 5K0SA 4LF8L 3A8JE 2DHQA 3DAFA 4ND7A 2H07A 2AV6A 4RVNA 4JLKA 4AP6A 1KVRA 3SR4A 1AKVA 1SBQA 4OG2A 4JW0A 2W6ID 3G8YA 1O7JA 1XB2A 2VIIA 4R1NA 5HTKA 1QHYA 3COVA 3E7PA 4PF1A 5HIAA 1ZONA 4ISBA 1NF8A 3Q3GE 2WHPB 1XJCA 1VJ1A 4HGOA 1KYWA 5KAPA 3ZCXA 3N7UA 1DT5A 1YR1A 3ZR4B 3OU7A 1D5ZC 4L5IA 1JX6A 2BHNA 1KRSA 4BBPA 4Q1AA 1G64A 4EUNA 1NLFA 4TZKA 3ZVNA 1AE3A 4ESHA 3K8QA 2XITA 2PFSA 2I5MX 3LCJA 5I3ZA 4KLCA 1UJMA 2ISSD 2INGX 4KITB 4HUTA 3O8BA 3W2TA 1JDPA 2R25B 4IDPA 4JBMA 2BHSA 3B2EA 4LTDA 1TYCA 3NVAA 3E2PA 4Z53A 1TFRA 3QF4B 4NK5A 3RSZA 3M3HA 3SBOA 4ZJPA 1KYIA 4H7PA 2WYOA 3V46A 3DXYA 2FQ1A 2AUMA 1Z9FA 3WO1A 1FGBD 2LKDA 2I8AA 5AM5A 2PS0A 4TLAA 3HB0A 4I36A 2C7RA 4RF4A 3TCXB 3HB7A 4ZOAA 3HOWH 3LKZA 4YCVA 2PMWB 1Y81A 4LWPA 1AHNA 3G8DA 2QX4A 1IY8A 2R4QA 3E81A 4Z54A 2MO1A 5EXSA 4BNVA 2HR1A 2NT4A 1C0PA 1IATA 2ZT8A 4PHCA 3EEQA 5CGQB 1YMVA 1ZH6A 3MIIA 2VY3A 2EV9A 4Y2JA 3QV1A 1FIUA 1VIVA 1GGEA 4D9JA 3RBZA 1O9GA 4YS6A 4K6HA 1I5EA 2IJGX 4B40A 1V95A 2PS1A 1H1TA 3K2EA 1VKRA 3VYVA 4CJXA 1SIWA 1GD7A 4ZWNA 2VUMH 1YC2A 1E7SA 2AMJA 5ER6A 4UEQA 3O0DA 5DLYA 2ONZA 3AH8A 3PX2A 4OQMA 4UASA 5KPJA 3AFNA 1PNRA 1YZVA 1DQSA 2Q6LA 1VMAA 2NU8A 3CTMA 4A76A 3VR1A 1DRKA 3SEZA 3MSCA 4U7WA 1KP3A 4A3DB 4KOAA 4PYOA 4YK7A 2PIDA 3WKBA 5C80A 2MSWA 3PITA 4XQ9A 1ZMRA 5KJFA 1VRCA 4A3CH 3KOMA 4OO3A 1J6UA 1E96A 4X61A 2AKAB 4GLJA 4MO2A 1PR2A 4BVBA 1NQVA 3JS5A 1Z29A 4KYTA 1GFSA 4WINA 1X9GA 1FNCA 3TAHA 1W7AA 1U3GA 3LP5A 2ZJ8A 1ONSA 4EDHA 3BIJA 4CMEA 1V4BA 1ASYA 3RC9A 2KCMA 4Y2TA 4IDGA 2QI9C 1F8YA 4DBZA 1Z5VA 1I50B 3ECCA 4ZMBA 1MLDA 1ISHA 1RMYA 2Y0SG 4H59A 2FRVA 1YRQA 3IERA 5FWDA 4OKSA 1QU2A 3UAVA 2O1WA 5FHQA 2W6NA 5KINB 1BBWA 1KRTA 1IQ0A 1SXTA 5LXTA 5HZKA 4HQRA 1WW3A 3MQ4A 4NYJR 4I65A 1QBKC 4JNCA 2YHIA 2GQ0A 4WRDA 1PIWA 1CRPA 1P1KA 1Y3HA 5DBHX 2C3MA 4J03A 1XMVA 4ZARA 4RVCA 3A6ZA 1RWNA 5AOBA 2F9MA 4U6QA 2I6XA 2V8BA 1G55A 4DV5Q 1YUMA 1GV1A 2D7JA 2H1CA 3U26A 4BN5A 1ZJYA 2OZPA 3E22A 5KNLA 4QUBA 1LBEA 2PUHA 1E4OA 1SO8A 5C4GB 4KR0A 2IIPA 4Q24A 2QRZA 3GLGB 4BWGB 1C9DB 3SXJA 1Q44A 3DH0A 1TEVA 4IDNA 3G8AA 3VJLA 2OHXA 1KKLA 2VHVA 1EJ2A 2JPDA 1THGA 1AOXA 3MA2B 3M5WA 5ITVA 5ITSA 4C1NI 4E70A 2J0VA 1E6WA 2D5IA 3H19A 1IBML 1Q95A 4HWOA 1JJFA 2XTJA 2FUG6 2GAOA 1QU3A 2QCPX 1B7YB 4CM3A 3TAXA 2QDLA 4JB8A 1NJGA 1VQFA 2HW8A 2VYCA 3FSEA 2WHEA 2BP7A 4XIJA 1YRHA 5BY2A 1CNFA 1GG8A 4U63A 3S16H 4JC4A 5FOWA 2X22A 4NKLA 3W3AH 2GVZC 5IGGA 1YBMA 3JQGA 4L4SA 3KPYA 4HVLA 4TWBA 4MW9A 1L5QA 2H0QA 1I94B 5DK4A 1Q91A 4MW7A 4XIYA 4EX7A 3UCFA 3MEHA 3G85A 4RD6A 2VDUE 2ZZNA 5K0LA 2CD9A 1D2CA 1QYDA 3EIVA 2E2JH 2EERA 1U7TA 3R6GA 2EP7A 3AV0B 3MWDB 2FMKA 4UEWA 4E3ZA 4IINA 3S3TA 1TVKA 4DBLC 2YUIA 4QBTA 2ENWA 4N41A 3H1BA 3KCNA 1EFVB 3GEDA 1XYIA 1YL7A 2PUCA 3H3XA 2EY2A 4KTVE 2QG4A 1C4QA 1SU6A 4RM2A 5TS3A 2PDAA 2VSQA 2B39A 4YMTA 3OLXA 3Q24A 3ANLA 3BJEA 1VKHA 3L7NA 1A2KC 2YHUA 2EFYA 3E27A 4ZT7A 3CLRC 1M4VA 1H3FA 3V1YA 5AR1A 5B12A 4GUDA 2I4MA 3AJRA 4ZHQA 1FFEA 3IALA 2QR3A 4OU4A 4WLEA 3LQ4A 2XKJE 5FPYA 2ZUDA 4B6RA 2BWJA 1LBSA 3LPNA 1HURA 1L4LA 3D3NA 5DH9A 2HRCA 1KWGA 4X60A 5IUKC 1O2DA 2CLCX 4JJZA 1G3RA 2XN9C 2P35A 4E4RA 3ZGZA 4PWZA 1TKWB 3CGGA 4Q3BA 2UUAQ 2H4FA 5JARA 3RROA 1XMQL 3AGQA 3HCFA 1UT8A 3F74A 3EQLC 1X77A 2OMEA 4HPJB 1YTUA 3GT3A 5KQPA 2FPIA 2Q3HA 1M54A 3ADOA 2UYQA 3VR2A 3IT0A 3WZMA 4MR7A 1WXWA 2L0XA 3FKIB 2V7UA 1DFGA 3EXHA 4IOMA 4WJ3M 1LPAB 2O07A 3MWLA 3LDGA 5F76A 2ZXFA 3RUAA 4DLUA 2BHLA 3SK4A 2GCGA 5ELMA 4IEEA 3DCIA 3D0RA 4QRDA 4URVR 4KAAA 4D3FA 4KV7A 1FYEA 3O93A 4ZT2A 4RHCA 2RAUA 1Z2CA 4M1QA 5JHGB 2CF5A 4A8TA 5B2ZA 2UKDA 3NHMA 5BRNA 2BCJQ 3JWEA 1DX9A 2GWHA 5B37A 1SCJA 4NP5A 2CSUA 3OWEB 1N0HA 1EVEA 1O8BA 4ZZ3A 1AQNA 4MVJE 1XQ6A 2FW6A 4TTQA 5KNDD 2QILA 2WM3A 1SE8A 4Q3AA 2C88A 3O9ZA 4EWLA 2P40A 3JXEA 1AS0A 1LI5A 3DEJA 4QOIA 2Z3WA 3VU1A 5MN6A 2BBTA 3FUXA 2Y93A 4EKEA 3B36A 4LE2A 1YS4A 1WLSA 4P35A 4D8UA 2DCMA 2I2BA 2YYYA 1A1VA 3KAJA 2NV2B 2DE0X 2VAWA 4PC6A 1OBHA 4BLUA 2XCOA 3IPCA 4HRYA 1I6HH 5EMKA 4H13C 4XQGA 4PQFA 4ND1A 3W1EA 2HIAA 5AVXA 3Q7PA 3EVEA 4LF4Q 1E2WA 2XUOA 1ODCA 1PTOF 3FMCA 2O3TA 5IT9c 1DAOA 2IOQA 3PC3A 3EIEA 3L4JA 4ALNA 3HZOA 4X3SA 3BHMA 3L93A 4CFYA 1N32B 3NV7A 4TQ9A 1VBNA 2O23A 3TLEA 3INNA 1Z37A 2R62A 1JFLA 2O8FA 3JZIA 1HCZA 1ZIOA 1PGNA 1RPJA 1KEZA 3CUYA