3PUWA

Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
371
structure length
371
Chain Sequence
b'ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein
publication title Snapshots of the maltose transporter during ATP hydrolysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/transport protein
total genus 105
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3puwA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3puwA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3puwA01
2YYZA 4EPYA 1E2WA 1IN6A 3HKZG 2IYQA 1HQCA 1R5NA 3OEHD 3GLFA 3G82C 5KU1A 2C35B 3RC8A 1KAWA 2BMFA 5L3QB 2QUZA 1XTSA 1Z29A 1XTJA 1HNZQ 1PH7A 121PA 1N9WA 3S17H 1QHYA 3BJUA 1MOZA 1H8ED 5M5YH 4X8LA 2JLXA 1N0VC 5CM8B 1N6OA 4Q48A 3Q9LA 4L4UA 4BY1H 3MXUA 1PMRA 1QHXA 3MCAA 2H5EA 2I5HA 3LNNA 5BR8L 3W3ZB 2Q8IB 1IXSB 2EU8A 3T53B 3M4QA 4JC0A 4P72A 4KFSA 1CKEA 1YNNC 1YZ6A 1AM4D 3VR4A 2R7FA 4PAOA 3RC3A 4YXWA 4DV2Q 4LYHA 3H0GG 2JA7G 5J47A 4OONA 1E79D 1VG9B 4KHPL 2PZFA 4TLEA 2WSSA 1F2UA 4JI4Q 2IHFA 1JE5A 1LM0A 1FJGL 4JV5L 4PAMA 3HGBA 1HH4A 2OLKA 4EJSA 2WP8J 5F9FA 3L0SA 2JAQA 3OESA 3J80i 4JVMA 3T1YL 1KO1A 2WAYA 4JI1Q 4DWJA 1KAOA 4DB4A 4UP9A 4LJ4A 2E74C 1DAMA 3DZDA 2RAPA 4O3MA 3EWSA 3ETLA 4JJZA 4WZBE 5C4MA 2V7QD 1Z47A 2OM2A 2Q3MA 1NY5A 1DG1G 2VQEQ 3SJBA 4DEXA 4C0QC 2DY1A 4ON9A 4E5UA 4H02A 1J8MF 2ORVA 2O8EA 1WCMG 4Q00A 4H1UA 3RZOH 5AJ3Q 5FL3A 5GVRA 4JI0Q 1U0JA 3SI7A 2HXSA 4X64Q 5FJ8G 1WQ1R 1Z0DA 4DHEA 4URXR 1SVOA 1XTDA 3K70D 3CAMA 4GKJL 2AK3A 2ZJRA 2PNRC 1LNZA 1OIXA 1P72A 2XGTA 2ZUBA 3B1YA 3DVLA 1E9RA 2KCTA 2FX3A 4DXAA 1DG3A 2AK2A 2JJ1A 2W2TA 2XJ4A 2QT1A 5SZJA 1TADA 1MABB 3B7GA 4Q4JB 3R7WA 3AQ4A 4L5TA 1GD7A 2BBOA 3Q3JB 4TTRA 2R92G 1KI1A 4Q1CA 2GJAA 3GTOH 3QXSA 4RZUA 4GL2A 2RGAA 2WWIA 4PTLA 1HQMC 2UZ3A 3CRVA 4LV8B 3RAPR 4DC9A 3AH8A 4CEHB 1KMHB 2JLYA 4ZIRA 3LFUA 2R6GA 4JI5L 5SZHB 1BMFD 4JG2A 1Q7YC 3EX7C 1E2HA 3A1SA 2WFWA 3I5YA 4MYTA 2BE5C 3UMFA 2GXAA 4NCJA 1TTTA 4V0KA 1YJ9A 1BH2A 4AD8A 4QL5A 1XD9A 4Q19A 1I94Q 4OWTB 3HOVH 3KOJA 1NF3A 2C77A 1SXJD 4RD1A 3TJZA 1EYGA 4AH6A 5EP2A 1I4TD 2NN6H 2FSIA 2PLRA 2FFHA 2O5JC 4A2QA 4EPVA 2CLCX 1AGRA 1FR3A 4A3EH 5CIQA 2ID0A 2N8NA 5DI9A 3RRYA 4JLOA 1LABA 1FGUA 5JEDA 1IM2A 1G3UA 2H7VA 3D0FA 4POFA 1NKTA 5M5XH 3CIOA 2QEXA 4QGFA 3ND9A 5IYBG 3FPAA 3IBGA 3V4FA 3EPHA 2FWRA 2H18A 1UE7A 3KYHC 3LQRA 1SZPA 3CXCA 1UBFA 4XVUA 1UEBA 1MO4A 4KBGA 5GAHC 1F2TB 3VU9B 3H86A 1D2MA 3QF7A 1VCOA 4NYIR 3LH5A 3N6RA 1L1OC 3KJPA 2HF8A 4Q7LA 5BN3A 4TLAA 5F3WB 5C3EG 4UKDA 4A8JB 3WRYC 4CIDA 3E1SA 2EWWA 3KXKA 1E2QA 3DHWC 4LZZA 5K8TA 1Z6HA 3K0CA 3L82B 4LJ6A 2EQBA 1BYUA 1PH8A 1QRAA 3PXGA 2G77B 2FOLA 4TYWA 4DNIA 2R93G 1XP8A 3QKUA 3KJOA 1EWHA 1C0AA 2WKRA 2R2AA 2RGDA 3E2IA 3NBXX 4KHZA 2ANBA 1H9SB 3EZ7A 2V1CC 1OH7A 1Q3HA 3A7LA 1DAEA 3B6YA 3PO2G 2J7KA 1QVCA 2HIVA 1MO5A 4BEJA 3QUSA 4KODA 5LMNL 3KZ1E 2FE4A 3M4PA 3D4RA 2F1HA 2TMKA 1SMYC 1ZYUA 1GL7A 3FHOA 3T61A 4ZKDA 2ZM6Q 1VQNA 2IHBA 2YTXA 1JR6A 2VQFL 3LWUA 4KLNA 1SHKA 3U44B 4A1FA 4ZDIA 1N6IA 3ZD6A 3DM3A 3EASA 1EESA 3ER0A 4A3FG 4LYFA 2WM9B 1N34L 1Q81C 4GN4B 2ANCA 1W5SA 2ZYVX 4IKEA 3X1XA 4NPHA 3A8KE 3VR3A 4DKXA 3S1AA 1EFTA 5FLMG 4BZQA 1H9KA 4LUCA 1P5ZB 4DV1Q 3WNBA 1IXZA 1T0HB 3L43A 3U3JA 2WOOA 4CF7A 2IS2A 2Q3FA 1W3SA 1WI5A 4IPCA 4DKAC 3HOXG 1AZSC 3IGFA 3EA5A 1QBKC 1DARA 1MR3F 1X8LA 1E1OA 2QP3A 3DOEA 4KO8A 4AQYQ 2PMKA 4UQOA 1YR8A 1IBLQ 3HOYH 2I5LX 3ULLA 2F6RA 1Y3AA 1HCZA 4US1R 2NVXH 2P2LA 3BJIC 4OL0A 3SYNA 3WXMA 1GVNB 4HIDA 2RGCA 3CC7A 1N6LA 4UNPA 4LUOA 1KI6B 4DCNA 1E99A 3OFNA 4DV5L 1E2NA 2XAUA 4M53A 3KDFB 5H70A 1XEWX 2WJIA 3WBKA 4NKRA 5AJYA 5JI2E 5H8WA 3DEFA 1Z83A 1CUKA 1WP9A 1ZNZA 1UFQA 1HNWL 1QHHA 1T5LA 2JK8A 4O2LA 4Q9IA 3BOSA 2ODEA 2QENA 2VHJA 1WXQA 4TT3D 2YV5A 5DISB 5K8IA 5EE9A 5KDDA 2NZ8A 1ZM3A 2XGJA 4PV1C 4DK3C 3PO3G 3Q85A 4BLOA 1RRFA 4LJYA 1IJFA 5FI1B 1IHUA 1XMIA 5JWRA 1T9HA 4I1SA 4XTCS 4CEJB 2XXAB 4PPGA 2CWAA 3HOUH 3HOZH 3IO3A 4A0HA 4LBWA 1Q82C 2DWPA 4D0LB 1Z3IX 2EFDB 5JLJA 3H2YA 2IEZA 2QMEA 1ONBA 2QTFA 3ZIAA 3U50C 1YIJA 3C16C 3DMNA 4W5WA 1X3SA 3TK1A 2OFXA 4BGDA 2IEYA 5B58C 2JLQA 4GP7A 4DK1A 1YITA 4KMUC 1UBCA 4S2EA 2K32A 3DMDA 1XXHA 4LJAA 1K73C 1ASZA 3MWYW 3AF0A 3AV0B 4MNOA 5C4XH 4YMVA 4V03A 1GUSA 2XOKD 3KB1A 3B9PA 2PT5A 2JA8H 4YCWA 1E1QA 1N5IA 3ZLJA 4NE2A 1P9RA 1GNQA 4POAA 5D3MB 1N6RA 3S15H 2FEMA 5CK5A 1CP2A 3IIJA 5EUMA 3ULJA 3L0PA 1MT0A 1UKZA 1XMQL 1TU2B 1W2GA 2RH5A 3TS0A 1DELA 2KBEA 5FOTA 2ATXA 2VEDA 3MSXA 1NMGA 2NVQH 1WBBA 1W4CA 4QQBX 3K0FA 1W4BA 1CR0A 1W49A 2IUTA 4O0AA 1G7SA 4HDQB 2FFAA 3SR0A 3T15A 1A1VA 4Q03A 1E2VA 2F43B 4M1SA 3THWB 4TZ0A 2C04A 1E3MA 2J9RA 4A6XA 1RJ9A 3B8HA 3KUCA 2I0QA 2PQAB 4B3ML 1TWGH 5IYCH 1WCV1 5M3MG 3VX4A 1UDWA 1YZLA 2ERXA 2W0MA 5E3HA 3KQKA 1RC8A 2CVHA 1E1TA 3PUVA 2BKUA 3THYA 1NMFA 2IC5A 2ZE5A 4NHOA 1TQ2A 1X9NA 3QPWA 3RSLA 4B47A 4FXPA 5SZKB 4L8JA 1MO6A 1S3GA 2PT7A 1FUKA 1I4LD 1XEWY 1ZRHA 3IQWA 3Q8DA 4NCHA 2XX3A 2HCJB 3ND8A 1E9SA 4GLVB 3CD6A 2FFBA 3EW9A 3QKRA 4R2HA 4GN5A 1KKLA 2ZXUA 5JJKA 3IHWA 1IY0A 1II8A 1SMXA 3H4MA 3I73A 3TUZC 2B8GA 1WBDA 2YOHA 4GDFA 4BY7H 1SQ5A 1QF9A 2MQHA 1SXJE 1VTKA 2R9VA 4G5GA 1MKHA 1BOFA 1OXVA 3EBEA 4KV9A 4TYPA 1CFMA 3T1OA 3EN2A 1KNXA 2CL6X 4PC3A 3AEVA 2E2HH 4E22A 1QVRA 3UE0A 1FW6A 3KF6A 1ZU5A 3FFBA 3QKSA 4M1YA 1NN1A 4JI7L 1LY1A 3IILA 2KB0A 3NHAA 4FMCF 2BMDA 5KO2A 1B0UA 1NN0A 2G83A 3W8NA 3OEHA 3I4MG 2JE6I 4JI8Q 2HYIC 1Z63A 3T51B 3BAFA 1HYQA 3GEIA 3CUEF 5EP4A 4D26A 2FDCA 1PA6A 1K6MA 2VP4A 3CPWA 4TVAB 1XMVA 3BFKA 1E69A 3QPVA 4HUQB 1H8EA 4O25A 2N42A 1ZNXA 4IQZA 2IS1A 1UBEA 3NWJA 3CPJB 1N8RC 4MKHA 4OI0A 4D25A 1HT2E 1VF5C 4KCGA 4QHSA 1L2FA 1AQYA 1HURA 4JL8A 2NO7A 1CS4C 2ZJ2A 3BRWD 5KYKA 4I1OA 3STBD 1NBMD 3GLHB 3FMFA 3CCLA 3FOZA 3R9IA 4P74A 4MZ9A 4JL6A 4OWWB 3UDFA 2JXMB 5CM9C 1E79A 4A4DA 4NCIA 4Q5IA 1IBML 4GN3B 1CJVC 3LX5A 1G8PA 4LWZA 3D8BA 4II7A 3SJAA 2QT0A 4Y7NH 1VQ5A 2WIBA 1XMOL 1N25A 4QJ3A 1RFLA 1TF5A 2ZRKA 3P20A 4HJ7A 4MITA 4PZLA 1PLLA 1NY6A 1VQLA 4F4CA 1EXMA 2GK6A 4XWKA 5FTLA 4GBMA 4A3DH 3G6EA 1E2KA 3D7MA 4KSBA 3CPHA 1KI8A 2V7QA 4BLPA 4MRNA 1KI9A 5JWOA 1GUGA 1IY2A 1CSQA 2XSZD 2B8WA 3AVOA 1BKDR 2OUKA 3EIHA 2UXBL 4Q1AA 1W36D 3K9HA 1CJMA 1GHJA 3AFQA 3W8RA 2LWIA 5FPYA 1EFHA 3PJRA 5DYIA 2JA9A 3W90A 1P2TA 4URYR 4ARZB 1SKQA 4Q4HB 1NKSA 4QKQA 3C5CA 2VZAA 1ZM7A 3AVUA 4AKEA 3BH6A 5GADC 1IN4A 1OSNA 3GFTA 3C7KA 4PSVA 5L8VA 3VFDA 2FH5B 1FX0B 4G0NA 4OJKA 4V02A 4BBRG 2FU5C 4F92B 4ZDKA 1G3QA 1JPJA 2NPFA 1AS3A 2R7DA 2GF9A 4K46A 2O8FA 1RL2A 1EX6A 3A8TA 1U0LA 3BBPA 2E5LQ 4HZUB 4WOPA 2E2IH 4DLTA 5GJCA 4B75A 1ZIOA 3MUFA 4A3MG 4AC9A 4DJTA 2ZU6A 1XEFA 5KTYA 4FWIB 1PZNA 4EX5A 1QHGA 2YVUA 2WSSD 4NYJQ 4B44A 1BMFA 5TY0A 5KNDA 1W4AA 3A4LA 3K0SA 3A74A 1KJWA 2IYUA 3QVVA 4OK5A 4DDWA 2PNHA 1Q86C 3SE0A 2C2HA 3KXLA 4L5BA 1SXJA 2D3WA 3G48A 2A19A 2BMJA 3A1VA 4Q7JB 3EIVA 1YRBA 4BA1I 1RZ3A 1M90C 4EQ6A 1KSHA 4GNXC 4IPGA 1DS6A 2FJUA 2FEOA 2R6CA 3UG7A 5KNBA 3DLLA 4RMFA 5JRZA 1Q90A 1YZKA 1L8QA 2EWVA 4A8JC 5JS7A 3H3VI 2O8DB 1XF9A 4LFAL 5GQOA 2CVFA 2FA9A 3BD9A 2FSHA 3GJ0A 2V3CC 2KCMA 1OPXA 3K9LA 1OH5A 3CCUA 1XTIA 5J4KA 1VQCA 2D2FA 3GLGA 1BO6A 2Q9CA 2E8GA 1X6OA 2CNWD 1F3OA 5C0XH 4RVCA 1OXSC 4YMWA 4DR5L 1E9FA 2FGKA 4QJFA 1HZBA 1BYIA 3CWZA 3GFPA 3HU1A 4F91B 1QVGA 3CM0A 5UKDA 4P31A 3RS0A 1VIYA 1U94A 2AXNA 3RLOA 2QRNA 3KTAB 4C7OB 1TUEA 2GKSA 1HA3A 2J45A 2OV2A 3CCQA 3IBYA 4DUYL 5TXGA 3QKTA 5EP1A 4O0MA 3NBFA 3TR0A 4JKYA 4TL8A 5IT5A 1YR9A 5A4JA 1R10A 1OV4A 1PFSA 3RS7A 3K9GA 2Z6KC 1S9HA 1N33Q 5KOYA 4JIMA 4ACAA 3EPJA 1IY1A 4NB3A 1CU1A 4LF8L 4GOPA 2QG6A 2PI2E 1UE6A 3DM5A 2DYKA 1N36Q 2BWJA 1FNMA 1I50H 3CX7A 3P4YA 3QVUA 5KPJA 4G5RA 2C9OA 4OBEA 3L8ZA 1EWQA 3U4QB 1LFDB 3K0AA 4WZAE 1P75A 1XWIA 3KKOA 3W6OA 5GADl 2ZRPA 2K5VA 4QGHA 2XZOA 4OK6A 1GG2A 2YNMA 5DHAA 4C0JA 1OXUA 3KFXA 1I6VC 4Q66C 1MIUA 5DN6D 4K0KQ 3W5OA 2F1JA 2V4ZA 1M1YE 1D9ZA 2UU9L 1QJOA 4TKOB 1SN8A 4DR2Q 1IBKQ 2D62A 1MKYA 1E32A 2VQSA 2WOJA 3THOA 3TQFA 3WHLA 1AKYA 1DAFA 2O52A 3ZS8A 3ZS9A 2ATVA 2J7PD 3QBTA 1VG8A 4KKUA 4DEYA 1FUUA 4BFZA 4MGZR 3L2PA 1NVXQ 3EQLC 2W58A 5CJPA 1NJFA 5FBVB 5DNYB 1O7IA 1EGAA 3TW8B 2QEQA 2JEOA 3M0EA 2WJYA 3O8BA 2A3RA 2OTLA 4NMMA 3D6TB 1X1RA 2CW0C 3AF4A 5M04A 2QGZA 4A93G 4K81B 4ABYA 1D2NA 3RHFA 1NLYA 3PQCA 4TT3A 2LXKA 1E2GA 3L8YA 2KI5A 1L1OB 2CMKA 2ODNA 2F9LA 3U58A 1ZD1A 4XTRA 4BFYA 1VS0A 4LY6A 4BPBA 4HAWA 1G1MA 1XD2A 4TWZA 3BU2A 4JI6Q 5C0XJ 1KHIA 2QMHA 4BECA 3I4NG 1E2EA 1FX0A 1VQDA 1G21E 3CMAA 1U9IA 4DV2L 1JB7A 2J41A 3SBDA 3TMKA 5AUOB 1ELOA 2NO1A 3BC1A 4B32A 1SR3A 2AWNA 4JI4L 4GOKA 4A6PA 3TEHB 1NN3A 4LHYA 3WMFA 2BEKA 4HB0A 2REOA 2WJJA 2J0UB 3UG6A 4JI1L 1COWA 3HOWG 1OYWA 5A5GA 2UXBQ 2B29A 1XCGB 2WVJA 4H1VA 6Q21A 2ZI5A 2ZI7A 2VQEL 2XOKA 4OQMA 3A1UA 2GCOB 1DAGA 1UKVY 4ZPXA 4IW3B 4ASUD 1I6HH 2UZIR 3I3SR 5AJ3L 5TARA 1KK3A 4JVNA 4JI0L 3GTGH 3ADDA 2DFLA 1OXTA 3BE4A 4X64L 3KX2A 3PSIA 4XOIA 2KE5A 2A68C 2OCEA 4A3IG 1YRAA 1R5BA 4IEIA 4RCZA 4W5HA 4M0LA 4JLBA 2DFNA 3W5IA 3QY0A 3KKNA 5J4HA 4DAMA 2OFOA 4HYYA 1XNJA 4DT1B 2MSCB 1Q8KA 4DUZL 2YINC 3M4YA 1W5TA 2E1RA 3BDOA 2PI2A 1KI2A 3NEYA 2ORWA 3A1WA 4DB2A 3A4MA 3IO5A 1K8OA 4L9SA 4Y0VA 3Q5DA 5FBRB 2GAAA 2JLRA 1WRBA 4PQYA 3CRMA 5JEEA 2LKCA 2ZI4A 2Q0HA 1XJVA 3HJNA 3QXJA 1N5LA 4P33A 3MWJA 5HR5A 2VSXA 4DV3Q 5DHFA 1KSFX 1I94L 4EPWA 1Q3TA 4GLAC 4A75A 4DLVA 1XPUA 5HE8A 3W1GA 2PJZA 3CZQA 1X55A 1G64A 2GNOA 2RKOA 4IO9A 3CRRA 2QSYA 3A58B 5EE3A 5C44G 4LFAQ 2X1VA 2DGYA 3M3YH 1ZYRC 3I1FA 521PA 5JBQA 3EAQA 2AR7A 5LPNA 1W7AA 2HDNB 2V9PA 2CK3D 4H9GA 4A2WA 2CE7A 4YONB 2PPBC 4MUBA 2O5IC 2IK8A 4B3FX 1WDTA 4TLBA 3FB4A 3TLXA 2B7BA 5E7IA 2YWGA 1SVWA 1SKYE 4DR6L 4DPGA 1UF9A 2VP6A 4R9UC 1LB1B 2Q3HA 4NYMQ 4Q9JA 4BRUA 2MFIA 4KSCA 3T1QA 1HTPA 4AYXA 5FTJA 3KF8B 4Z8XA 1G8FA 4DIDA 2CBZA 5FBQB 4QY7A 1N6NA 2WTUA 4EQ5A 1C1YA 2I1VB 1XB2A 4KJZA 2QAGC 1UJ2A 4M1WA 3GLIB 3ZZ0A 1JEDA 2OBMA 2LSSA 4QM7A 3GJ3A 1IAQA 1BBUA 1XNRQ 3OIUA 4B3XA 1RW4A 3SBEA 3R8FA 4M2LA 1VQEA 1Y63A 4HLDA 4QBGB 1G18A 3IDQA 3CNNA 1NBMA 1YJ5A 4V0NA 2GZAA 1HE1C 1Z9FA 2X2FA 2NOAA 2WV9A 2ZE7A 1X86B 3PIOA 2ECKA 1VQPA 5ELNA 3G4SA 3EARA 4LX0A 4CDGA 3CF6R 4LUVA 2NO9A 3VA7A 4C0HA 1K8AC 1KRTA 2A69D 4HR7B 1W0JD 1D8TA 1ANKA 2ZM6L 1II0A 4G01B 5HE9A 1NMZA 4FMDB 3GJ7A 1WE2A 2JLSA 3U3RA 2OQKA 2KJQA 1JR3D 2IY5B 3REGA 3CCRA 3CC2A 3H0GH 2JA7H 2DFKB 2JCSA 3FWYA 3NC0C 4RFSB 4QGUA 2GF0A 4DR4Q 4MQBA 2F1RA 4RCNA 4UJ5A 4D4JA 5IT9c 1X56A 1P2VA 2MMCA 1P2SA 2CCJA 1E98A 2XSZA 4QHYA 4DV1L 1O3YA 3OW7A 1GOTA 1S1CA 3A4NA 4BE7B 1X8KA 3L7ZC 1T8UA 3LV8A 4IXNA 4B71A 4AQYL 2UXDQ 3N2EA 2RGNC 1IBLL 1B7YB 5AJVB 4CGZA 1UKYA 1GJXA 2IWRA 3U61B 3F2CA 1H9RA 1I2MA 4MUAA 1A2KC 2HXYA 1Q1QA 4P4SB 1FQKA 5EUQB 3U3OA 1WCMH 3IPXA 5IP7G 1G5PA 4GMDA 2WWYA 1NP6A 1ZW6A 2IYTA 2Q9BA 2IF0A 2QMOA 2Z83A 4I1VA 4P3YA 1UAAA 1VMAA 1U8YA 1W48A 5E7MA 2O8CB 4P71A 5FJ8H 1C9KA 1Z6GA 4RFVA 4JSTA 4LV6A 1QUQB 1J2JA 2IT1A 3GTQH 1E1RD 1G9XA 2CXXA 2G3YA 4PXAA 4D2IA 5LDDC 5DI3A 3ADCA 2KBNA 2W6JA 3PCOB 1DADA 1W47A 1XZQA 2DUDA 2O0KA 1NVVQ 4N0EA 4Q9KA 1J99A 3RS5A 3LNCA 4Q1DA 1IZ6A 1AK2A 4MGYR 2R92H 2ORIA 4TN1A 2J0QA 3PUXA 3I55A 3U4ZA 5G3YA 4M4SA 1E9AA 2CLDX 1Q1BA 1NI3A 4M8NE 1M74A 5CLLA 2GN5A 4A3GG 4XSGA 3IEVA 5KSZA 1AE3A 4YLGA 2D74A 2JLZA 3OTOQ 1N6PA 3TREA 5L3VA 4URUR 1MRNA 2BA1A 4PQRA 1SLJA 1MV5A 2V6JA 4JKIA 1ZJ6A 5L3RA 1QZXA 4F93B 3GDEA 4HB4A 1E6CA 3GLGE 1CKOA 1DO0A 3O8CA 3M7NA 2AL7A 1JAIA 5JSZA 3PUZA 4EFLA 2RGGA 2VO1A 1E94E 2BOVA 4D4LA 3PEYA 1YZQA 2H5XA 1NIPA 3RRMA 1JQJC 1TL7C 1D6JA 4G7ZC 3B5JA 4S35A 4NP6A 5K8LA 2WPDD 3H94A 2ZJOA 2CNWA 2ZR7A 3GMTA 5B57C 4JI3L 1PH6A 1YZUA 1MH1A 1NTGA 3PF4A 2FGJA 4DUZQ 4Q1EA 1JI0A 4LJ7A 4UNSA 5IYBH 1US8B 2VH5R 2W2VA 2ZYTX 3CW2A 4EDHA 2BC9A 4BXXG 4HUTA 1QG4A 4UNNA 2VS1A 2VUMG 3HWSA 4FDBA 3W9YA 3DZ8A 4LC0A 4WW0A 5HCIA 4MA4A 5M3FG 5IK2D 5FPSA 3L0IB 1S8FA 3KJHA 2VTKA 4DLWA 5C3EH 2VP9A 3IPYA 5FOWA 2O8BB 3WBJA 4ME3A 5F98A 3GJ6A 1OKKD 2HJGA 2V54A 3K09C 1Y1WG 1W2BA 2GK7A 3K8YA 4KYIB 3NBHB 1JPNA 4TL9A 3SC3A 1YEZA 1PVOA 1P9WA 2VF8A 3BFVA 3JAMc 1YHAA 1KK1A 2WKQA 2YTVA 1D2EA 3P27A 5FBWB 4DV7Q 2OHFA 2R93H 4M21A 1E0KA 4PC6A 5G3ZA 2GJSA 3U7EB 3H3VH 3AQQA 5H1SE 1EQRA 3A37A 4CRWB 1CEEA 3PO2H 5IP9G 2UKDA 4URZR 4Q1BA 1V43A 1T5IA 5DN6A 1PUIA 4DR7Q 4TTQA 3LQQA 1G16A 3AM1A 3IIKA 1XXHE 2RMKA 5TV2A 4AG6A 5JFGA 3R8CA 3QG1A 3TAHA 3VR6A 3FP9A 5ELOA 3B82A 1GP2A 1Q1ZA 4Z1MD 1QZGA 2J7PA 1BVSA 1K8MA 3A8JE 4GNXB 4DR6Q 4A3FH 2F3RA 1HY3A 4NCNA 4G5QA 1GUAA 4GS3A 4W7SA 4AG5A 4PPFA 1KY3A 5JEAG 4OX9L 5FLMH 2F3TA 4R4OA 2MSDB 3GJ4A 1VQFA 4IFDH 2HIXA 4Q1FA 1P16A 4JI8L 1VHTA 2BVNA 2VBCA 2AD5A 2DB3A 3Q7QA 1OIVA 3HOXH 2YWFA 4TYNA 3OZXA 2A78A 3OHMA 1B23P 2PL3A 1CI3M 4IPHA 3VKGA 5KDOA 3AVYA 1AJEA 3PITA 3V4RA 2NZHA 4F4JA 4LF4Q 1ESMA 4TMVA 2OLJA 1VDZA 4GFDA 4LBYA 3T5GA 2N49A 5L3QA 3KB2A 3IUYA 1CJTC 3CMEA 3A6PC 1T91A 2F52A 2W0SA 3T1VA 4DV0Q 1EX7A 2A5DA 2GBLC 3MEFA 2IYYA 4QNRA 3VNUA 4TL6A 3S1NH 1U8AA 2H17A 1XTQA 3B85A 4FCVA 3LGJA 1KGDA 5FUVA 4C0KA 2OCBA 3OIVA 3RN2A 2R8RA 2CFMA 4KN4C 3ONWA 3PO3H 3BWDD 4JBXA 3IEUA 1S3SA 4JK1C 3AP1A 4TMZA 1IW7D 1HNXQ 4HLUA 5IY0A 1YJNA 1JXOA 2G1KA 3OAAD 4BFWA 2YWHA 4B3SQ 3DOFA 1U0HC 1HJPA 5BQ5A 4EIWA 2DPXA 3F3YA 4U7DA 3NELA 2GZDA 2H1LA 1HZ9A 3VR1A 3AKCA 5FUWA 1Y1VG 4LV5B 1G7CA 3ZVLA 3OOCA 4JI2Q 1DAHA 1EFRD 1JR3E 3QOFA 2AFIE 4I99A 2HUPA 4ASUA 4C3IH 1J90A 2A6HC 2FSFA 3AF1A 2UUCL 4DSTA 2CEAA 621PA 4PZZA 5B2ZA 4ZKEA 4AYWA 1A62A 4FW9A 1OB2A 2BHRA 2Q2TA 1N6KA 5IWAQ 3ASYA 1GO3E 1Q20A 1TQ4A 4GMXA 4LRWA 3FKSD 4QJ4A 3AKYA 3HR8A 3P4XA 2AHOB 4QBHA 2R62A 2BV3A 8OHMA 4NCKA 1TNDA 4R4QA 3CF0A 3B1ZA 1Q1EA 3JZMA 1OE0A 4OGQC 4RJLA 2JASA 4XWAA 3X1WA 5JHHB 2E5LL 1NSFA 4EJSC 1YHBA 4A3LG 3LD9A 4DCTA 4CEIB 2IWHA 4TQUS 2ZEJA 1CKNB 4FINA 2DFTA 1A8VA 2A5GA 4A3KG 3KFUA 1XJ0A 1G6OA 1MABA 4Q4JA 3T56B 4IFDJ 2Z5FA 3SFVA 4MH0R 1RPZA 1W2HA 2ZETA 1HR0Q 3BB4A 1NMXA 3OF5A 2OT3B 1SFOH 2LXJA 3UDGA 3I4LA 1VQKA 1CR2A 1ZAKA 4I1UA 5EZ5A 4HB3A 1LV7A 4CEHA 1KMHA 1N6HA 3TNFA 1COWD 3X2SA 3BS4A 5M3MH 1G51A 2PJRA 4FMBB 1FMLA 5C18A 3SZRA 2CL0X 2QROA 4C3HH 1ZUIA 4GZMA 1E0AA 2UUBQ 1KDPA 3KFVA 1RIPA 1Q57A 4GP6A 1Z22A 2DR3A 4DCVA 2BDOA 3GTKH 3I8XA 3QBVA 3C8UA 3WP0A 2EFCB 4CT5A 2CK3A 1EFWA 1XZPA 1ZNYA 2VNUD 2FF7A 2N3SA 2QGQA 4LFBQ 1GNRA 2VA8A 4R4TA 3GJXC 4EFMA 4JI3Q 1DVRA 1ZKOA 2CHQA 1DXMA 2OAP1 3CWQA 2HT1A 1FP7A 3A1TA 4QFMA 4Q7KA 1LF0A 3PV0A 1T0JB 2ZR0A 3NKVA 4G5OA 4KBFA 2VPPA 4DRZA 2J1LA 1TF2A 2GEDA 2ZRGA 2QL6A 3GTPH 4OHXA 1F5NA 5DIFA 5EE5B 1ZM4A 4C3ZA 4WXRA 4YWLA 2OILA 1ONLA 2W6ID 1VCNA 5A0FA 3B9QA 2R44A 4NZYA 3U60B 3CRQA 2OAQ1 4NDZA 2B63G 3WP1B 2JA6G 1F2TA 1QVAA 3I4MH 3VU9A 5FH9A 4OHYA 5FR2A 2FSGA 3I56A 1HZAA 1XFAA 3MD0A 5G40A 3TW4A 1KI3A 3NEMA 3IQXA 4A8JA 4ESVA 3ICEA 1L7VC 2ZRDA 1N33L 3EZ6A 4WIAA 5L3SB 4LOAA 3QSYA 2MSEB 1OLOA 2WZQA 1E22A 3LBNA 3A7AB 2XTMA 4N3NA 1CJUC 4DDVA 3L0OA 1N36L 5JI3E 1W0JA 4LF5L 1ZC3A 2J5XA 5FOUA 1J5EQ 1CRPA 3TSOA 2WIAA 2QBYB 4LHZA 4GPTA 4IOKA 2ES2A 2X19A 1H9SA 2A6EC 1ZINA 4NL4H 4L16A 4V0MA 1JR3A 4CVNA 2QA4A 1G7TA 2C78A 2ZRNA 2ZS8A 1IOZA 1TU3A 2GCPA 2Z6VA 4TYYA 4IRUB 5DSZA 4K0KL 3SJZA 4K8OA 1LYLA 4DR2L 1IBKL 1L2TA 1Z0IA 3U44A 3I7FA 4QC2A 4OX9Q 3DM9B 1G3IA 2H8KA 4ITRC 1QHIA 2FPLA 2XTZA 2Y8EA 1EWIA 3K0CC 2BE5D 2YOFA 3Q72A 4KITB 2NPIA 1E3PA 3DKVA 4BWYA 3I62A 4TSFA 2H92A 2R7ZG 1T4GA 1Z07A 5AUNB 2AUJD 4HAUA 1L0WA 4JOIC 1U5KA 4APVA 1PJRA 4YMTA 3HP1A 2PLFA 1Z5ZA 4ALPA 1XMSA 4FD2A 4Z8YA 4A3JG 2YWEA 1WYDA 1XEXB 4AIIA 4A0GA 4DDTA 1XCPA 4URVR 2BBWA 3GEEA 3H0KA 1AH9A 1Y8PB 4TLDA 4GZLA 4B2LA 3FMCA 1TQDA 2C98A 1JBKA 2Z4RA 2K7VA 3QG5A 2B21A 1NG1A 1E1RA 1BKBA 4HJ9A 1KZ7B 1KI6A 4QG7A 4NYMR 4BBSG 1E2FA 1YBYA 3KDFA 2P67A 2QRZA 4A15A 4PAQA 1TF7A 3WYGA 1OB5A 2ZJ5A 5AJZA 4C0SA 4GZYC 4BBRH 2HF9A 3KDSE 1A82A 4CT4B 4JI6L 2QAGB 2HJVA 3U7FB 3KLRA 2BA0A 1GHKA 1DGSA 1X3GA 1E2ZA 1VCMA 2EXDA 4A3MH 1SVMA 4KKTA 1FZQA 3P1JA 4BFSA 1JALA 2CJWB 2JQOA 2ZE6A 5E95A 1KQSA 1ZC4A 4CEJA 2GCNA 1M34E 5GAGC 2R6DA 2XXAA 1OFTA 4X8HA 1AZTA 1RRCA 1D9XA 2WWGA 4DR1L 3RNLA 5DLQE 3IIMA 3DDCA 4RD2A 1T5EA 1W0KA 5IF9A 4A0RA 3GLHE 2UUCQ 1XNQQ 3WYFA 4ZCMA 1B8AA 1DBSA 2ZM5A 1Y14B 1E2LA 2DNEA 1SHZA 2OO7A 4B35A 3RABA 3UATA 2IYXA 4JVLA 5JWHA 2D0PA 2E2JH 3MWLA 3NIBA 4KKSA 4IFBA 4JLVA 1AQUA 1KIMA 2QU8A 3I92A 4MYHA 4P4UA 4V0OA 3MMPA 4PC7A 4W5JA 3SHFA 3A5UA 1CTQA 5LMUQ 2WPDA 2EQSA 2ZYUX 4OHZA 1ZCBA 1IONA 4IOLA 3UANA 2QI9C 2ZREA 3B1VA 4D82A 2P65A 2PZEA 4HLQB 3GQBA 4JLNA 3RRZA 5M5WH 2EFGA 4JLMA 4OQLA 4QRHA 3O47A 1H95A 5D3MA 3UMSA 3U5ZB 4L5RC 1L4YA 2W6JD 3CQZH 3A36A 4QHTA 3KL4A 2A5JA 5FUXA 4A4IA 3QNUA 3ZDQA 5IK2A 1P7CA 2B6HA 2ZTCA 2K5NA 2EJFC 4B3TL 2E76C 4LF7Q 2I3BA 1CR1A 1LTLA 3OIWA 3PEUA 5FOSA 3F2DA 1S72A 1OKKA 2F43A 3CCEA 1YU9A 4KN7C 3MG9A 2NVYH 1RRPA 5FTKA 3THWA 4JCVE 1G291 1G5TA 1OJLA 4LK1C 3QXCA 1KDTA 4E07A 5KDLA 2IXGA 4LK2A 2PQAA 3B1WA 5JCPA 4OQFA 4DV3L 2UUAQ 1T3SA 4CW7A 4M9ZA 1M2OB 4YHHQ 3VHXA 5EE0A 3KQLA 2N78A 3S2HH 2V1XA 3LVRE 2EYQA 1E0SA 2WB1E 4C0BA 4LJ5A 3EWAA 4OO1G 3CH4B 3K7AH 4DK6C 2XNSA 4HSEA 1Z6TA 2VHQA 3P32A 3JAMi 2FG5A 1VIAA 1M8PA 3TKLA 3OPOA 1YVCA 3TVTA 4J15A 4Z1MA 3U4VA 4UXIA 1GM5A 2ZANA 3BK7A 3CKLA 1CXZA 4UNRA 4B48A 3S1QH 2DNCA 1NN5A 2WWXA 5FOVA 2B8FA 1ASYA 3AKEA 1R5OA 3U7GA 2Z4SA 4LPKA 2JLVA 4YY3L 1JXMA 2G6BA 3ZJYA 5C46F 1KIXA 1VECA 5CDFA 2A5FA 4NYIQ 4AYBE 2AUKA 1VYTA 1XU4A 2L0XA 4R2IA 1NVUQ 2IYZA 5EXPA 2A2ZA 4A76A 2ZJYA 3EZ2A 4B43A 4B74A 3HPRA 4NXMQ 2N1BA 4GKKL 5KUTA 1OH6A 4DSNA 2OCYC 4PPNA 5GROA 1A4RA 3S1MH 2X8AA 5BN4A 1XNRL 4WZ6A 2ZTSA 4JLJA 4OI2A 1IN8A 1E24A 2DWQA 1X3FA 1ZUHA 2OEPA 4HUQA 3HYRA 4LF5Q 1KK0A 3OEED 2AWOA 4RSGA 5FTNA 4GT1A 2C9YA 3BG3A 4HIKA 1MJEA 4A93H 1AS2A 4OJQA 5TDHA 1H9MA 4BFTA 3PFIA 1V8QA 2PCJA 1S9DA 2REBA 2IA5A 221PA 2ZI3A 3B2EA 1G4AE 2SHKA 3GLHA 3WNDA 1S0UA 5CB8A 4LGMA 3VNVA 2O5VA 2HHHQ 3M85A 3OAAA 3ERSX 3I4NH 1AGPA 3M1IA 3QEOA 1Y8OB 1YHNA 4PC2A 3U3MA 3FHTA 3S2DH 1DTSA 4RKEA 5CJ2A 3HFZB 4DR4L 1XTKA 2WHXA 1CF4A 1C9OA 3GEHA 3TRFA 1E2IA 1VYVA 4A0FA 3T1TA 2KENA 1J7KA 2QM7A 4WJ4A 1E0JA 1EFRA 4MGIR 1TAGA 3ECCA 4BRWA 4PSAA 4L8GA 3QF4B 5FFMA 5KPDA 3RS3A 4D81A 3HOWH 2WB1G 2IUSA 4BEBA 1EK0A 2UXDL 5IDVA 1N32Q 3B1XA 2EYUA 2GJ9A 3MJRA 2EJMA 1B9MA 2MO1A 4HAXA 3FKSA 4QBIA 4OXPA 1E2DA 1PH9A 1I3QH 4N1AA 4Q4AB 4A92A 3F0TA 4ZDWA 3F2BA 1HUQA 3Q8XB 4DLSA 3PEWA 3LLUA 4ARZA 3BH0A 4ILEA 4OHWA 4Q4HA 3U2QA 4OI4A 4O2DA 3THXB 2FV8A 4TMKA 4DR3Q 4A3IH 1QZHA 2CWPA 2GVAA 3CNLA 3TAUA 4C2UA 2YZ2A 4NONA 3RANA 4X62Q 5JS8A 2X77A 3UKDA 3J81k 1N5KA 4AYBG 2NZJA 2IHEA 3J7A5 4YCUA 1TEVA 3CF5A 2JIZD 3CRLC 4B2IA 1E9DA 4DV6Q 4PO8A 4LF9Q 1KD1C 2HV8A 4HZUA 4QBFA 2D2CC 1NBME 2PCFB 3AYHB 3K7UC 1GRRA 3SGIA 4ZCIA 1HR0W 4EPRA 2ZRJA 1I2DA 5CIWA 1RRGA 2P6RA 2EW1A 1G7RA 4DR1Q 2GDJA 5CITA 2GILA 3JC66 5AJWA 1JEEA 2V6IA 3BIFA 3CR7A 4IJHA 3OTOL 3G5UA 4NBSA 4DLXA 3MJHA 1TWAH 1R0XA 4TZ6A 1ZMXA 2PEZA 5K8UA 1Z6AA 1G8HA 1XJQA 2XEXA 1DPFA 1A2BA 1GKUB 2GXSA 1GSIA 1P4SA 1J70A 4BZXA 2ZUDA 3GLFB 3GP8A 2PBRA 4R71A 1K0RA 4BLQA 4BLSA 1IYUA 3KJGA 3H84A 5FI0B 4DSUA 4E03A 2F1MA 4X8OA 5P21A 4GOXA 4B2PA 2O8DA 1G17A 4X6AH 2ZPTX 1CR4A 4A3CH 1HV8A 2W6IA 5JMTA 5IE8A 4JVSB 4MKIA 2ATWA 1Z08A 4LSGA 1VQ8A 1E96A 4D4KA 4QJ5A 1P3JA 1XTRA 2IL1A 4B3TQ 4HAYA 1TX4B 3FMOB 1SXJC 2FMXA 1VHLA 3LO5A 2YKGA 1IN5A 3SYLA 1PH1A 2G1JA 2QY9A 4ZCLA 1EQQA 2HLDA 1TQ6A 3TSZA 2JDID 2KHIA 4ZI3A 5EJEA 2GEVA 4LJ9A 1Z2AA 3KTAA 4C7OA 1F2UB 4DZZA 1K5GA 4RD0A 5GJBA 3EC1A 4P0TA 2GRJA 4IHQA 5IRCD 4M1MA 1VF7A 1G3MA 2VHCA 4EJSB 1E4VA 2OESA 1HQYE 3SYKA 1V1QA 1HTWA 2Q21A 3U6KA 2GXQA 2A1AA 3VR5A 1D8LA 4DV7L 2HEIA 1NBWA 4G1UC 4IOJA 1RVDA 4YDSA 4EAQA 2XZLA 5LBIA 2K14A 2VW9A 4ZDJA 3FMIA 1VQMA 1Q22A 2F7SA 3GCGA 1OFIA 1G6PA 1JECA 1EIFA 1H65A 2O8EB 1G20E 1M7GA 2YOGA 3FHWA 4YWMA 3U4QA 2GEUA 4DR7L 2K33A 1QVFA 3J81c 1NVWQ 2GHIA 2R6AA 1GDDA 2Y0SE 4X65Q 4JZKA 4BLRA 5JJLA 4YY3Q 5J40A 4LUZA 4ZI2A 1ZP6A 3LBHA 3LRPA 3W1BA 2XB4A 1ZNWA 2K4KA 2ODWA 4AK9A 4C0AC 4JBYA 4PSKA 1ZD9A 2B3GA 1Z7TA 4GKKQ 3ZH9B 2YC2C 5JCZA 3R7WB 2W2XA 3FDIA 1P73A 3M9BA 3LX8A 4TTPA 3E0EA 3AF2A 4GOPC 2ZSEA 3AP3A 3K53A 2Z0SA 1AKEA 5TMPA 2IYRA 2XNDD 3BZCA 2BCGY 4NTZA 1VQOA 3DO6A 5K36G 3K0EA 2ZRMA 4ZIRB 4LF4L 3MRSA 2ZT9C 3RVBA 5KHOC 5IP7H 1JB1A 3VKHA 3CF2A 4TMTA 1IXRC 4UY8C 1FL9A 3DPUA 4JS0A 3I4OA 1NY4A 3OIYA 3WHKA 5IHPA 3K80C 3I32A 5EXTA 1S40A 4DV0L 2K75A 1GVPA 2JA5G 4AYTA 2ONJA 4DCUA 1M7BA 3U9SA 2BBSA 4DLRA 2D7CA 1KTVA 2LKDA 3U6BA 4A3BG 1L1OA 3FKIG 4LCBA 4BA2I 1GILA 4XD7D 2WAQE 2QN6A 1I4DD 1JJ7A 4JT2A 2YTYA 2ERYA 3GLIE 4TYQA 1HNXL 2F9MA 3LY5A 4RCYA 3CX6A 4TQ9A 2IS6A 1E9EA 1LS1A 1H9JA 4B3SL 2VF7A 1LS6A 3UK6A 2QTHA 1D7QA 3CLVA 5FL7D 5IYDG 1YVDA 3PR1A 1P9NA 4WBSA 2CCKA 3TE6A 3PF5A 4A3GH 4F4IA 2EVWX 2PMDA 1SE8A 4TSFD 4JI2L 2J0UA 4MYUA 1LACA 5C4JH 1ESNA 1VG0B 3CX8A 3Q5EA 1H8HD 1A5TA 1X3EA 2K52A 3EZ9A 3EZFA 3ZQ6A 3CONA 1UADA 1YI2A 3ICQB 5J5CA 4XJXA 5CYPA 1SGWA 5IWAL 1M7HA 1GRNA 2Y0SG 2ZJQA 1FFHA 1TMKA 2G0TA 2GCOA 4TLCA 3AVWA 5LB4A 4ACBA 4I81A 4C0LA 1U9IC 1RYFA 5TB5A 2CDNA 3K0XA 4OO1I 5HCNA 1Z0FA 1U99A 2JGNA 3PEVA 4FWTA 3NC1C 1Q44A 1VQIA 2AKWB 4X66Q 4ZV4A 4GNKA 4CZ2A 4GOJA 4H0LC 4R7ZA 3PUWA 2IYLD 4FCWA 3BB1A 1NMYA 3HU2A 3ZVMA 3NENA 2JATA 1O87A 4KLKA 3C41J 4BXXH 4JT4A 4DT1A 1WF3A 2P0EA 2VUMH 1CRQA 1DE0A 1OW3B 1HR0L 4HIMA 2J3EA 4NXNQ 4IDQA 3RDPA 4EPTA 1Z6XA 3S24A 2GA8A 5M3FH 4EUNA 1OXXK 1G8YA 2QE7D 4HB2A 1TU4A 1YZGA 4B3DA 4E09A 5JSZB 1PV4A 5A35A 1ZIPA 1FMJA 5D3QA 4PFSA 1W0KD 3S1AB 4HAVA 4YMSA 1Y1WH 1PYSB 2XITA 3ASZA 3TRZA 5FPTA 2KHJA 1KDOA 4A2PA 2RHQB 1IYVA 1R8QA 2UUBL 1U90A 3T34A 3WY9A 1JNYA 2R65A 1GFIA 1GTVA 1SVKA 2NIPA 3PIPA 1GL9B 2FFQA 2WAQG 1OT3A 2GVDC 4JLPA 5DGXA 4EPXA 2D7DA 4DUGD 4ERNA 1IBRA 4F7WA 3GTMH 1NJGA 2C9CA 4LFBL 1QHNA 2AKAB 4QOSA 2ZJ8A 4QNMA 3TGPA 1X54A 5IP9H 4LYJA 1Z06A 3I72A 4IDOA 3OE7D 5AUPB 3KQHA 3ADBA 3DXJC 2KSQA 3QE0A 2IYVA 3TZUA 2D06A 1QDEA 3KXIA 4U5XA 2ZS9A 1XX6A 3CNOA 1QHHB 1ODFA 4Q9LA 4BY1G 3VX3A 3CPEA 3P26A 2F4VQ 4DK0A 3UXMA 4Z54A 3SQXA 5HTKA 5JEAH 2ZR9A 3W6NA 4OK3A 1FTSA 1VQ6A 1VQ7A 2PX3A 4R98A 1P60A 3SHWA 3KKPA 4Q7MB 3C5HA 1ZUNB 5TVKA 1ZD8A 2ZIAA 3QENA 2VP0A 1UKEA 2G0NA 2ODBA 2EDGA 2PH1A 3FFAA 3OEEA 4I4LA 4MGKR 4POGA 5SZIA 4YQFA 3GLIA 2A68D 1ZM2A 4PANA 5C0XI 1ETUA 1TWCH 1K9MC 2BCJQ 3C14C 2C5LA 4MRSA 1K3RA 1A7JA 2RF4A 1N2CE 2O0JA 3EC2A 4NYJR 4U00A 4ESHA 4QL3A 3T1HQ 2WWWA 1J5EL 3ZZTA 4HDCA 1LTQA 1OIWA 4IJLA 2I1QA 1XXHB 3TIFA 4DIEA 4WVFA 2IUUA 4IVPA 4KFRA 1ZVQA 2PEYA 3OW2A 5JJIA 4KXFB 3R9WA 3J81j 2NO0A 3FHCB 5FUYA 3ZVNA 3HYTA 1KRSA 2ZYWX 3AVPA 4G5SA 4DVGA 2V1UA 1Z28A 1K8GA 1GL6A 1EFUA 1KI7A 3ULPA 3I8SA 3MWKA 4N0DA 4RFSA 3W34A 1EFCA 2P3SA 4A9AA 2NG1A 4C4PA 1YJWA 2GVZC 2J87A 2JJQA 1CIPA 2Q9AA 2OSBA 1Y1VH 1FP6A 3HDTA 4M1KA 3A5ZB 3K0FB 4OYHA 3STBC 1O78A 1D5CA 5LD2C 4JYAQ 1G6HA 1YNJC 2QPOA 4B3GA 4OWXB 1RJ9B 4UNQA 3OYYA 3B60A 4RD3A 4P4SA 4JBMA 2A30A 1OH8A 1FOEB 4B6EA 3FPPA 4G3XA 4LFCL 1CULC 3VKWA 2UXCQ 5ANRB 2ZU0C 2O8CA 1PUJA 2IYWA 4HZIA 4PR0A 1HEIA 2JIZA 3KQNA 3THYB 5HY6A 4HATA 3TUJC 2ZQ5A 3HOVG 3UMRA 1OFUX 1QUQA 4TMWA 3O8DA 3BXZA 3LLMA 4LBZA 2NN6G 4A3LH 3QKRB 4OKSA 4JOIA 1AE2A 1PH3A 3B13B 1W36C 3TBKA 1MRSA 2CHGA 4A3EG 1II8B 5JEAJ 4A3KH 1SVSA 4WAUA 5HKKD 1RE0A 5F2EA 1U98A 4PHFA 1HH2P 1J8YF 4JBJA 4FI3C 4WXPA 1OTCA 4V0ME 2ZJZA 3TH5A 2GESA 1LUZA 2ZSFA 3MGCA 1C4OA 1UDXA 2GXUA 4BQSA 3KF6B 1XNQL 1KO8A 3NG1A 3QKSB 2QGNA 4D4MA 2OCAA 2ZRLA 3QXHA 3AVQA 4IJMA 2IHYA 2QQ0A 3I2ZA 4JBKA 3TQCA 3VHLB 4D80A 4MKFA 3NDBB 3DKPA 2ZRCA 3D31A 1MO3A 2KCCA 4YWKA 2WWHA 4KFTA 4GRAA 2BH2A 4UXJA 2HT6A 3QJYA 2YU9H 3N70A 2RGBA 4IFDG 5LMUL 2FPKA 3GTLH 3BGWA 3RYTC 5JRJA 5FPKA 1SVLA 2JLWA 1W44A 2CQOA 5C1BA 2E9SA 4FN5A 1T8TA 3J7ZC 2ZVPX 1E9CA 4I7ZC 1CSPA 1JJGA 2VL6A 4M9QA 2QQEA 3LBIA 1IYJB 1KHTA 3BERA 1L4UA 4XWOA 1U2RA 1B70B 1S1MA 3RZDH 4PZYA 1GIAA 1K83H 1QHSA 1US8A 5H68A 2HCBA 2JDIA 4DSOA 4BZPA 4LF7L 2ZI9A 1VYUA 1UM8A 4JL5A 5BR8Q 3X1YA 2DBYA 3T35A 2B63H 3GFOA 2BIFA 2C8VA 2JA6H 5EXXA 5G41A 3UWKA 3GPLA 4B3BA 821PA 5KSOA 2V55B 1AS0A 1KZGB 2VLIA 1T3HA 2FN4A 2VY3A 1NIJA 2RB4A 4LJZC 4KHPQ 2GVBA 2F55A 1TKWB 2O8BA 3VR2A 2UUAL 3S14H 4EFNA 4P32A 4JV5Q 2JJ2D 1FJGQ 4YHHL 2MMGA 3VMFA 2VSOA 1IQPA 4M9XA 4BFXA 3T1YQ 3EG5A 3EPKA 1EIYB 1DAKA 4LDJA 1Q46A 2ZSAA 3CW2C 3QEJA 3HOYG 3UPUA 4IOCA 4OQXA 2DN8A 1NJIC 4IVRA 3K70B 1IN7A 2A5YB 1XRJA 2ZRFA 2IYSA 2AD1A 3QI2A 1R9TH 4MRPA 1UE5A 1U8ZA 5GVSA 4QGGA 5E7NA 2EFHB 2J0VA 4KVAA 2A8VA 3W6PA 4M1TA 3J81i 1WFQA 2JJ8A 2F1IA 4Q47A 1KY2A 2DCUA 3PUYA 2YHSA 3EIQA 2O8FB 4GKJQ 4GNXA 4M22A 3K8AA 4LW1A 2KWIA 5E4FA 2IS4A 4QXAA 2AKYA 3AF3A 5E7JA 5CYOA 2XNDA 1VCIA 3RN5A 4NXML 2EFEB 2R7ZH 1VQAA 4BFUA 4G7HC 4LJ8A 2HLDD 3SN6A 2ZS7A 3FGNA 4IDPA 4B3CA 5BXQC 1VQHA 2FXQA 2ZRAA 3B78A 1YHQA 3RS2A 5GJWC 4BUJA 1FL0A 4A3JH 3HOUG 3HOZG 5DYGA 3WRXC 1KO4A 2NO6A 2GWHA 2BEJA 4DCSA 4DLYA 1TXYA 3WMGA 4IDNA 4MDFA 3MFYA 1XPOA 4UPAA 5LB2A 3CH5A 3UDXA 2IBMA 4JYBA 1KSGA 1SXJB 4D6PA 4JI5Q 3AB9A 4BBSH 2QM8A 3CRW1 4XD7A 4EQ6B 3E9HA 1VQ4A 3KUDA 1WB9A 2YC4C 4PHHA 5AR1A 3TUIC 1M6NA 3RWMB 1PH2A 2HHHL 5C4XG 2H57A 5BYJA 1Y69U 2WJHA 4HJ5A 1LF5A 1YE8A 1FVIA 1G3RA 4RY2A 2JA8G 1DOAA 2CE2X 3TQYA 5FL7A 4F38A 3I5XA 4JBWA 2Z6KA 1OF1A 2QP9X 2ZVQX 1RKBA 3ZD7A 3RR5A 3H1TA 4LWCA 3GJ8A 1YKSA 4PHTA 1JJVA 4PPQA 1GZSA 4MYCA 3GLGB 3M4OH 3AP2A 4B73A 1H8HA 5CB6A 3VAAA 1FYCA 1LVGA 4Y52H 1NSTA 1OHHD 3KJEA 2NGRA 2R6FA 3UDIA 1E2MA 3CR8A 1N32L 2LCFA 1YR7A 1Z0KA 2OXCA 2P5TB 2D2EA 2ONKA 3JVUA 4DV4L 2QTVB 3LWNA 4BFVA 5HZHA 2KA7A 4HAZA 4C30A 5CDFE 1GUOA 2JEBI 1KOFA 3GJ5A 4JLDA 4XH9B 1GNPA 1NLFA 5G53C 4H44C 2WKPA 4LFCQ 3QQ5A 3R20A 3CO5A 5BWMA 4KYUA 5IYCG 4JLAA 1YNXA 1Z8FA 1CBUA 2OXRA 3IFTA 1A0IA 2QPTA 3ZQJA 1KMQA 4DR3L 2OG2A 2CCZA 3NBZC 3WNCA 1M1KC 4HLUC 721PA 2FZLA 2AHOA 4X62L 1R0WA 4GOPB 4LBVA 1GUNA 2QF7A 1BBWA 1C7YA 3ZZUA 1J6QA 2ZRBA 2GAOA 1BIFA 2C03A 4DV6L 1YZTA 4LF9L 3EIEA 3K0AB 4IEEA 3UWOA 2ZUCA 1UPTA 1G8GA 3C4JA 4RD4A 4CEIA 1EOVA 4P73A 2QE7A 1N0WA 1CKNA 3AUXA 3KKMA 2BJVA 2JLUA 2OQ0A 2VYFA 4UP8A 3NH6A 5LMNQ 1T3LA 4IDHA 1WJJA 1N0UA 3M6AA 4BY7G 3S1RH 2W00A 4DNRB 2ZTDA 1FQJA 1X1SA 4HJAA 1GAJA 2G9NA 3AVXA 2VQFQ 1WMSA 2PX0A 4NH0A 1Z6YA 1R0YA 1SULA 4PO9A 1F60A 4NPSA 1UEJA 1VQ9A 3RWOA 1JAHA 2L5TA 1N34Q 1KKMA 2VSFA 2PCLA 3FYHA 2EVBA 2BM0A 1OYYA 2D0OA 2CLSA 4PQFA 4X8MA 4DUGA 1X8JA 2IW3A 1TEXA 2V4DA 4Q21A 2K50A 5BN5A 2IXFA 5EXSA 4OO1H 1KO7A 4RZXA 4QM6A 3HKSA 3OE7A 2D5DA 5JZVA 4DLZA 2JEAI 2ZSBA 1NE3A 3NXSA 1HT1E 1GWNA 2ZAMA 4KI0A 4RZ3A 4XIGS 5BYKA 2ASBA 1Q12A 1K5DA 4Q02A 4TQAA 2BBTA 3WWVA 2BKEA 2RGXA 4AIMA 4AY2A 3T06B 4DV5Q 3MAAC 4IOMA 2L15A 2VHTA 4FCTA 4IXMA 1TPZA 4R1JA 3CZPA 5HGQA 4KVGA 2FNAA 4C3JH 1E9BA 4LNQA 1TUIA 2Z0MA 4FMDF 1YZNA 1FNNA 4KU4A 1HNWQ 1PH5A 1XD2B 4Y0AA 4PZ8A 2A6HD 2HQLA 3V00A 3AGPA 2OWOA 4LHWA 3U3KA 3SQWA 1RIFA 2PMZE 3MLEA 1FPMA 1KNQA 3J80c 2AN9A 4DDUA 5H1YA 421PA 3TS2A 1NVVR 3L2OB 3G0HA 3CCJA 2YJTD 4HI0E 4YXWD 3NBYC 3SDZA 2VIIA 4AURA 4A3DG 2H16A 1R8SA 4FIDA 3SU8A 1ZBDA 4XVRA 4C9BA 1HPCA 5L3SA 1EG7A 1GKIA 1SVIA 4RD6A 5FTMA 3K9NA 4GLXA 4M1OA 4RZ2A 5DH9A 3NH9A 3TR5A 4YCVA 3GTJH 2RHDA 2VP5A 1UBGA 3FVQA 3LW8A 4C2MH 2QBYA 1VQGA 1Z0AA 1LW7A 1PLJA 4X65L 3GD7A 2ZI6A 3Q7PA 4P4TA 4URWR 4JMPA 4OHVA 2NZOA 1MJCA 2E75C 2P6NA 4LHXA 1XPRA 2GTPA 2NN6I 2QORA 2P5SA 3N2IA 3SOPA 3SNHA 3SS8A 4V0LA 2VRWA 2XTIA 3DL0A 2ALYB 1HE8B 2RHSB 4L5SA 1A63A 2ZRIA 3NVAA 5J4LA 2MNAA 3F5FA 2XB2A 1KXLA 1XMQQ 2C99A 3TVDA 3LXXA 1E7ZA 3EPLA 2IX1A 5CLQA 4XSHA 3E70C 2A69C 2WSMA 3KKQA 3CP0A 1NLZA 2JJ1D 3EA0A 3LDAA 3PGZA 1R2QA 2ZITA 4IPDA 3D3QA 3ZYCA 2NMVA 1FTNA 1DCZA 1UWVA 2IXEA 2OE2A 1S3OA 1CLUA 3BB3A 1XEXA 5EE1A 4PG3A 1R6BX 1GKYA 4A82A 2VP2A 4C2TA 3QPUA 4Q01A 1KJYA 2ZTEA 2NVTH 2A7QA 3ADKA 3PG5A 2K5HA 5EP3A 4AKIA 3X1DA 1I5FA 1VQJA 4B3MQ 2QP4A 3AKDA 3NTUA 4B33A 2ZAOA 4A36A 4IFDI 1DO2A 1Q0UA 3VDYA 1KI4A 4HDOB 3SEAA 2F3IA 2CL7X 4PX9A 2CKZB 3KJIA 3GO5A 4AKHA 2FZ4A 4Q18A 1JQLB 3K81C 2V8OA 4WA7A 5HKKA 5GAEC 2GZHA 2QAGA 1G19A 1JJCB 3HR7A 3ZGXA 2C96A 5AUQA 3QIAA 1KSJA 2CCGA 3PVSA 4L9WA 4EKDA 2E87A 2BM1A 4B76A 3A0JA 4LF6L 4B3RL 1II9A 2WJVA 3AGQA 5BW8A 2UVQA 2CJWA 1Y8NB 3NDPA 5DO9A 5AWFC 4YMUA 1AIPA 3FE2A 2WAXA 2CHVA 1IXRA 1YR6A 4LC1A 2OBLA 1CTMA 5C0XG 3BZKA 3UE1A 4DV4Q 2B92A 3NHBA 1IJEA 5GJVC 2OBNA 4AI6A 4JSYA 2EJGC 4D0GA 4HJ8A 1JT8A 1KJZA 5EQTA 3E5HA 1F6BA 1P62B 2BDTA 4PZ6A 2X2EA 1CJKC 3UIEA 5F9HA 4KAXA 4JI7Q 2FPMA 2ZJAA 3HU3A 1PHJA 2A6ED 2ZROA 3BH7A 4QIWE 3CB4A 3FKQA 1K8RA 4LPSA 1KC8C 1SRUA 2ASEA 2D4HA 3RSOA 5JECA 2BH8A 1DEKA 2VHUA 4Q4LA 4X66L 2B7CA 5LD2B 4H13C 1GKHA 4JJKA 4MKGA 2AFHE 1BS1A 1HNZL 3X1ZA 5J3BA 3RLNA 2RGNA 2XJ9A 2OTJA 2QNRA 4DNTB 3LW7A 4RG1A 2P6UA 4B34A 2BMEA 4NXNL 1Z0JA 1ZCAA 2K5UA 1SROA 1UEIA 2N46A 2RGEA 4Q9HA 5AJXA 2O0HA 1NRJB 3WDNA 4QGAA 3TSWA 3CCVA 3K70C 1IBMQ 4UXHA 3F8TA 1XDBA 3RNUA 2JJ2A 3E9IA 3KQUA 3FMPB 1XMOQ 2W83A 2NQ2C 2GJKA 4HLCA 4P75A 5AK0A 2VL7A 3T5DA 1W36B 1P6XA 1WA5A 5FOXA 3IKJA 2NTYC 5FBLB 1X65A 2REXB 3JZAA 3QXXA 3AVVA 2QZ4A 2WWFA 4IFEA 4XVQA 5C44H 3CRKC 1T6NA 1W46A 2WBLC 5HZKA 1F48A 4O2RA 4US0R 1S4QA 1NL3A 3K1JA 1S2MA 2Q2IA 1B9NA 4WJ3M 2AX4A 1Z2CA 3VTKA 4G7OC 5ELXA 1XMJA 2I5MX 1KL9A 3AB3A 2XTNA 3B6EA 3NEJA 4IVQA 2J0SA 1S96A 2ZE8A 3OFND 4W9MC 5DI3B 3A8IE 2F4VL 1N5JA 4TL7A 3V9PA 4OI1A 4KFUA 4R4IA 5FPHA 1ZU4A 1KAGA 2A9KA 3HPQA 3LAWA 3GLFE 1JMCA 2OZEA 4FMCB 4LI0A 3RS4A 2HYDA 3AFPA 2I4IA 5KNCA 1KO5A 4U02A 3LA6A 1G4UR 1WOCA 2WICA 5CK4A 3CPFA 3PIRA 1U81A 5K36H 4M9SA 4LHVA 1DD2A 4UP7A 2RHMA 2WMOB 2IF2A 1VQBA 3AEZA 4JYCA 3T1HL 3LVQE 2AMCB 5B30A 1UE1A 1O7LA 3CCMA 3VQTA 3I61A 1ZM9A 2LMCB 2JA5H 1VKJA 2WMNB 3SFZA 1W1WA 3ZJYC 4PHGA 4TMXA 2ZSDA 3ZIAD 2IX0A 2MO0A 3LXRA 3T12A 5KSYA 4PO1A 3AUYA 3C15C 2Q2HA 1A6XA 4A3BH 1SKYB 3FKIH 1KDRA 3JVVA 5HPYB 3NE5B 4R4CA 2Q2UA 1KK2A 3U7HB 5DE3A 1AN0A 3CC4A 3HKZE 1PH4A 3K09A 1CKMA 3F1ZA 1E2JA 4MRRA 2ZJBA 5C4GB 3H15A 4CYMA 3G71A 4DAYB 1OHHA 1XD8A 2PZGA 2KBFA 2QAJA 3IHLA 5IYDH 1E1QD 1BDOA 4L15A 3W5JA 2XZPA 4PMWA 1G5RA 2JA1A 1G41A 4HEJA 1GITA 2DWOA 3CBQA 1V5WA 4DLUA 4A3CG 3QF4A 3IRBA 4GSYA 4B6FA 5JHGB 2AXPA 2QA5A 2QMUA 4LYAA 4JYAL 1P8LA 1TWFH 2C95A 4PC1A 4AWXA 4DR5Q 2J46A 1V9PA 5DLQC 1RYHA 1NG9A 2Z43A 4BLTA 2IX3A 2BJWA 1IW7C 5EAYA 5FR1A 4Q4AA 3AVTA 1E4YA 2ZJPA 3BFXA 4DUYQ 4MTNA 5B64A 4US2R 2UXCL 5KSPA 4AKGA 1R0ZA 2QSZA 3FTQA 3THXA 1PLKA 1PYBA 1E2PA 3R9XA 3PCRB 4Z51A 2GETA 1R7RA 4KLZA 2WJGA 2QPAA 3SJCA 4DBLC 4LF8Q 1Q21A 4IOAA 2G88A 1VG1A 4OQNA 4YC7A 3ZVRA 5C2JB 2EIFA 1W4RA 1TWHH 4GI7A 4J0QA 4BASA 3S16H 1JJ2A 4LF6Q 4B3RQ 4HIOA 4NU0A 2OCPA 1GUTA 5LMNW 2GJ8A 1EWRA 1R4AA 2OFWA 3O8RA 1DAIA 3RRNA 3BORA 3WMEA 5FLXc 4RKFA 4YDHB 2B8TA 4MRVA 3CCSA 3PENA 1VPLA 3RLFA 4D0NA 2ZRHA 1N3BA 1OFHA 1P2UA 4PZ7A 2GBLA 3W3AA 1XBTA 1IL2A 1XCMA 3EXAA 1GRQA 4JLKA 4L5QA 2UU9Q 4UJ3A 2RCNA 3WYAA 1P61B 3KLWA 1YQTA 4ZO4A 2Q6TA 5EZ6B 1KYIA 2DHRA 3MXNB 1HZCA 1QG2A 3REFA 5J4YA 1EUJA 1AA9A 1X6VA 2J59A 3N5CA 1XJCA 5J4VA 1NNEA 4MDEA
chains in the Genus database with same CATH superfamily
2C7GA 1E3SA 3SX0A 3G82C 4OB6A 1Z29A 3H2SA 2XADA 1SURA 2G06A 3OBIA 5M5YH 3WIUA 2H5EA 2UVPA 1GTJ1 5EMKA 1ZXBA 3O95A 3RC3A 4PAOA 2FSPA 3Q3HA 4TLEA 4Q24A 3O3MB 1FJGL 2QRMA 4PAMA 1SOVA 3K1ZA 2WAYA 1DKQA 2CC2A 1L3CA 1BXGB 4QWWA 3U31A 1CFJA 1JG4A 5AJ3Q 5KYWB 1RQXA 5K0BA 4HNAA 1KH2A 4LDPA 1YZHA 5AKZA 1R16A 4DXAA 2YCLA 3HE3A 4NBTA 2JLBA 2W2TA 1LQTA 1YVRA 2FZWA 5T1GA 3R7WA 3CGGA 2UZ3A 2X3FA 3ZY4A 4JI5L 3WOVA 1BMFD 2PUHA 3RASA 4J3NA 1JCKB 4MYTA 1LZKA 1XD9A 3FDZB 1S6YA 1E66A 3JRWA 1TZMA 1FR3A 1LABA 1FGUA 4DV5B 1P2DA 1HNWB 5EPEA 3LKZA 4H6PA 4Q7LA 1VHJA 1VE1A 3VDNB 4FFOA 1BQEA 4K8IA 5LL6S 3FYUB 2X22A 1ZMOA 3ZZ1A 3QUSA 1ZYUA 3CVOA 4WZBA 2IHBA 1SHKA 5HA5A 4B34A 1W5SA 4LUCA 5FQNA 2PLAA 3KEQA 5JT1A 4C88A 4KO8A 1IBLQ 1YQQA 1NUPA 2B2TA 1E2NA 1P7VA 4ZTZB 1Z83A 4EJ0A 3OQ6A 1A69A 3PRYA 3PO3G 1YD7A 4PYRA 4RVNA 5JWRA 5BSFA 4CEJB 2XXAB 1QR6A 3BA1A 4LBWA 2JFUA 3SEZA 4GRDA 3ZIAA 4GP7A 3R8BA 1TB4A 3DMDA 4LJAA 1FXWA 4Y30A 5FADA 4IWNA 1J07A 3U80A 3IHKA 2P4UA 4POAA 4G2TA 2JG3A 3ERQA 5EUMA 3L06A 3ZEIA 4K6FA 3AFOA 2ATXA 1XRLA 2HI0A 1CR0A 3SR0A 1M2FA 4ZT6A 1WCV1 1YZLA 2VT6A 1BD3A 2JJYA 1OC2A 4ZYLA 1I32A 2ZBRA 3PQIA 3A04A 1EDEA 3EF3A 4GN5A 1IY0A 1WBDA 2WQZA 1XF1A 1MKHA 1BOFA 3EBEA 3EMKA 3UT0A 5CDGA 3IILA 1L9KA 3ROEA 3R3UA 4FXKC 4LRSB 3BAFA 3V1UA 4IIXA 1XMVA 2ZT8A 2PX4A 1UP6A 4IQZA 3FTEA 1MA0A 1OT5A 3GLHB 1YNJD 1QYIA 1CJVC 1QH8A 3QOWA 4ND5A 2ZRKA 1PLLA 1EXMA 1FVFA 3GZ4A 2PXAA 3UHJA 3DMTA 2XSZD 4QEZA 1BKDR 2QLBA 2WZCA 2CNKA 4BGEA 1IN4A 1JLSA 1VB3A 3R44A 3D3WB 4H16A 1RL2A 3ZHQA 2QVBA 3QE2A 3O2QB 3NASA 5IC5A 1ZIOA 3DBIA 3C8DA 4BNXA 3ICWA 4QPNA 1Q0QA 1HXHA 3K0SA 1T4MA 1RKXA 1VA5A 2C2HA 5DB4A 4PS0A 5A5FA 3EIVA 3W2FA 4AYBB 3TTTA 1RYMA 1SE4A 3EK2A 1MB2A 5JSYA 1YZKA 4A8JC 2E82A 1DOMA 2V3CC 2KCMA 2G71A 4M0PA 3TF5A 2GM9A 3CRNA 4DWVA 3HCEA 3OPMA 2EY5A 3CXRA 4KSYA 4DR5L 2YJ4A 1SC1A 4ZT4A 1U94A 3KWFA 1TUEA 4JI4B 4MPJA 1RJFA 1GCIA 2AEJA 3ZYYX 3S28A 3E35A 1JX6A 3ZW7A 1M9NA 1WXIA 4QUIA 2C9OA 2X0DA 5KX5B 1M34A 1XWIA 4MVYA 4RNDB 4DBZA 2ODTX 4P58A 2X58A 2FCAA 3JSAA 4DEYA 4RA9A 1VFNA 3OTIA 1GSHA 1JQYD 1YR2A 2QEQA 3A70A 3O8BA 1XL0A 4J3FA 1ODJA 4AJ2A 5JD3A 3H91A 2PU7A 4RAUC 4TT3A 1PRTC 1E2GA 4I6EA 1DPGA 1E2EA 4YCMA 1VGQA 2IOFK 4E6PA 3NDJA 2XMZA 1PJ8A 2HF2A 4JI1L 3OZUA 1H2YA 1YB1A 4J1NA 2D8AA 2ZI7A 3SIWA 3A1UA 2GCOB 1I6HH 2O54A 4CKEB 4XOIA 4M0LA 4IJ6A 4H35A 4PN3A 1R8JA 1IH8A 3B70A 1TWFB 3M4YA 3E9YA 4AAYA 3A1WA 2GOYA 4D7AA 1U1CA 1YB5A 2CUNA 1UR5A 4BCDA 3H9GA 1M1YA 1QV7A 2CDBA 1KJIA 5ALOA 5LPNA 3M3YH 1TYBE 1MG0A 2O5IC 5A1TA 3TM5A 2G6TA 1Y1SA 1LB1B 4Q9JA 3A25A 3L6EA 2MFIA 4BBJA 4K9KA 2XNCA 4NFHA 1YJ5A 1F1BA 2XLCA 1H2EA 3GARA 3JY6A 3R3ZA 2ZIEA 3U16A 4ROSA 2A69D 2F0EA 4PLYA 3UAVA 2JCSA 2DFKB 4N39A 5LYJF 4EI9A 3KD2A 2OZPA 1AURA 2BEUB 1G5PA 1J9GA 1FNVA 1ZW6A 2NU8B 3GGOA 1C9KA 5FYQA 3JQAD 3QLJA 1V26A 5JAZA 2VPYA 1UFVA 1AD2A 3KLBA 4PZCA 1M74A 1NW7A 4XSGA 1NVTA 2D74A 3Q0EA 3PVCA 2H5JA 2OZLA 1YVPA 2GEJA 7ADHA 3PX3A 2AKEA 5J1ZA 1QG0A 3TXAA 3CH6A 1F6WA 1AHIA 3RQIA 2HU8A 2FMTA 1E58A 2GUGA 3HCCA 5A3QA 2VS1A 3QE4A 2CV2A 1J56A 3DZ8A 1AQ6A 1DBIA 3HY4A 2QUIA 4MA4A 2Y67A 3VV3A 4R2KA 2YXNA 4BO5A 4RGYA 1DX4A 1K0UA 1DBRA 1L4GA 1JAZA 3ZLUA 3P27A 2OHFA 1HF3A 4Y2SA 1I7DA 5LIPA 2IHZA 3ETEA 1T5IA 4IMRA 1ZBQA 1JWAB 3AM1A 3MVVA 1S01A 3FP9A 1NFRA 4L73A 2WR8A 2J7PA 3V4VB 4W7SA 1PQ4A 4ZYYA 2NU6B 5CAEA 5E1MA 2IEIA 2NV0A 4C3IB 4TMVA 3LX6A 2Y0CA 3B85A 1TT5A 3L93A 4FHFA 4JK1C 1HJPA 3KT0A 2BFBA 4YRTA 1HZ9A 4BGIA 3FETA 3KOWA 4UUAA 2SICE 4OXQA 1LPAB 1ULHA 1TYAE 3IQEA 2AG6A 4DSTA 3STHA 4JIGA 1OB2A 1KAAA 2A5LA 2BLLA 3QV1A 2GHQA 1PGQA 4X6XA 1N33B 4RZIA 3RTCA 4R4QA 3OSUA 2E5LL 1U7ZA 5DF1A 3T56B 1A9XB 1RPZA 2D5LA 2PN1A 2DQZA 1LV7A 5CGQB 3SSNA 1RYBA 2EJUA 3NJ4A 3C1AA 2GBPA 5D5QA 5ALMA 3KHTA 5LKRA 3IUMA 2VC2B 4IKPA 3LT2A 1DXMA 3GHYA 5M34A 3KQOA 4ZVPA 4WXRA 2R44A 1P18A 3WIOA 4XQGA 2JA6G 2D6FA 5G40A 1Y7LA 1ABFA 2Q5EA 4DMGA 2R96A 3L0OA 1N36L 3UHAA 2IKQA 4G97A 3TSOA 4FF2A 4GPTA 4IOKA 1ZINA 2JGFA 1ZRNA 1IOZA 5AVSA 1WIWA 3BM5A 1U5CA 1P1KA 2FPLA 2REQB 4TLMB 2NPIA 4OLHA 3RU9A 3LLSA 2PLFA 3TJRA 4DDTA 1JKMA 3K57A 4KY5A 3VDQA 1Z56C 4JP1A 1FMFA 1UZNA 1FRQA 3TOVA 2NQTA 4AUMA 5EJ6A 3A6FA 4YAWA 1YBHA 1PSZA 3IQDB 1KYTA 3GGGA 4KJXA 3KZVA 4KTVE 2B1QA 3NIBA 2BGJA 3UN1A 3IAUA 3N86A 3S2HB 3FJYA 4I4TB 4DA6A 4HLQB 3SEBA 3A0UA 2EFGA 1KH3A 3A4IA 4X3TA 5IK2A 1IIBA 2EJFC 4J2HA 1FSSA 4U7GA 1MEJA 4W1QA 2CLKB 4E07A 2BEVB 3TZDA 1WD1A 4DJJA 3CZRA 3Q8KA 1FDUA 4KZPA 1JHXA 4C0BA 2H00A 4HSEA 4X3UA 4J15A 3U4VA 2ZJ3A 3BIXA 3WWCA 2G6BA 5IGDA 1KIXA 1QHEA 1QDLB 2C2WA 4NYIQ 1XU4A 3G13A 5LZ9A 1LTID 4RVGA 1XHLA 2G5DA 3EDCA 1KK0A 3L02A 4BO3A 5JYEA 4PRYA 4X00A 4LGMA 3M1IA 2O2YA 4IALA 3S2YA 5CH8A 3TOSA 3BDLA 3ZIUA 1TAGA 3LWDA 1QS0A 4HAIA 4HAXA 2QD1A 4N1AA 2RDGA 1NYTA 2I2DA 1XU9A 3F2BA 4G9EA 3CT6A 4IPTA 2GR9A 4TMKA 3TAUA 1QZHA 2YZ2A 5AKLA 3UKDA 3IDFA 2VT2A 4QBFA 4ZVNA 2HLPA 3R2IA 2ZRJA 4V3CA 4DR6B 4H7EA 3G5UA 5U4QA 5HF9A 2P2GA 3FUCA 4ZOLF 2GXSA 2PBRA 4WUTA 1V3UA 1PWYE 2CXUA 1ZGBA 1G17A 4X6AH 3DL7A 3VGPA 4IR7A 1VJ1A 4KMOA 1XTRA 1V9SA 4FFMA 1HUNA 1HDOA 1PSWA 1EQQA 3FLBA 4P0TA 1V1QA 1A88A 1ML4A 4KDFA 5DTRA 2HBQA 4IOJA 1MB3A 1ODIA 2QMYA 3T1NA 1MX1A 1H65A 3FHWA 4CCAA 2GHIA 3B52X 3G8CA 1HFNA 5CVCA 4ZI2A 4C0AC 3O94A 2QS9A 1OTYA 2G80A 3LX8A 1MXHA 2I46A 1WHSA 3NTIA 3CTPA 4BDTA 5K36G 4ZIRB 1VDMA 5IP7H 3DGEC 3FJ1A 5EEHA 1N5MA 5EJWA 2KS6A 3OIYA 5LU9A 2XUDA 3HFSA 2K75A 3EZYA 2AQHA 3V7UA 1NRXA 2WAQE 3U4GA 4PZUA 4LFBB 4OQZA 3DHVA 3I8OA 4L4XA 3OTHA 4WBSA 5G4LA 5AVUA 4WI1A 3AJEA 3I9FA 5B2FA 2QSUA 5CYPA 5LDGA 2RVLA 1V4NA 2WJPA 5MN6A 4UDUC 1EWYA 4CJ0B 4GOJA 2O7QA 2OPHA 3SLRA 3WLIA 3IUNA 4NXNQ 1UWLA 4OP3A 4RLSA 4WJKB 4C4RA 4EW3A 3TRZA 3INNA 3M4NA 5JYBA 3Q7RA 1NVEA 4G5HA 2Q5QA 4OSOA 2GHRA 4K1LA 2J48A 2BAGA 1RWQA 2BFOA 2IBSA 2IW1A 2AYYA 4YMHA 3IV9A 3UAOA 3W6NA 5B4UA 3TBHA 4F1JA 3KF8A 1ZD8A 4Q15A 3QENA 5DWVA 3IJEB 1KNEA 3GLIA 4BMZA 3Q24A 1FBTA 2BM9A 4QREA 2D5CA 4QARA 2V7EA 2QD5A 4KVZA 3TIGA 2XVYA 2B69A 4KXFB 3BMOB 1KI7A 4R1MA 1YJWA 1EJ2A 3NJRA 2EBUA 4OYHA 2XA2A 1OOEA 4ZQCB 1SM4A 1Y3HA 2OEOA 3L9AX 1RLOA 3K2IA 2C31A 1NI5A 4UNQA 5FUQA 1AW7A 2QTNA 3OT4A 3E1GA 4G3XA 2YU9B 2UUAB 3VZDA 2C3MA 4HATA 1KEUA 4LBZA 5EUCA 3B13B 3NOQA 4JOQA 3RC7A 1J8YF 2A9RA 3CVUA 2Y1LA 2VATA 3MGCA 4MWCA 3NG1A 1GUDA 3QXHA 4IJMA 2QQGA 4CCWA 3FOBA 3D8GA 4GRAA 4TOIA 3INYA 4CKCB 4IFDG 3BGWA 2F0QA 4E21A 2GA4B 1IYJB 3BXOA 3WWDA 3FWPA 1NRWA 4QPJC 1T9KA 4JL5A 5BR8Q 4X1IB 1TZKA 5EXDA 4HWPA 4WN3A 1PR4A 4JNKA 2F55A 1Y3DE 1LT5D 2CFSA 3KVVA 3NBHA 1IVSA 1BKSB 3EG5A 4TVOA 9ATCA 4OQXA 2DN8A 1NJIC 5BSGA 2AD1A 1RABA 5JMOA 1T2VA 4IIJA 5IARA 3W6PA 1EEXB 3W5CA 2DUNA 4LW1A 3AF3A 5E7JA 2RH9B 1QMPA 5GJWC 2Q4OA 3GLKA 5DYGA 3C2PA 1G2IA 4MDHA 5KNCD 3MFYA 4F7XA 2AG0A 1SXJB 1O0CA 3I6IA 4CETA 3B5EA 3T4XA 4ABTA 1LC3A 5BOSB 5BYJA 2Q8NA 1EWCA 1DOAA 2ZBDA 4BVLA 4BO1A 3RHTA 2HNAA 3D7LA 3RJ9A 4WLNA 2NGRA 3T7KA 2P5TB 1JIXA 3PRHA 5AW4A 1GNPA 5L40A 3HKCA 1GCGA 1M1KC 4HLUC 2DSNA 1J6QA 2C3PA 4N9WA 3SZ3A 4EGVA 4LF9L 3QY9A 4Z4HA 1IBSA 3NVMB 2BZSA 1CX9B 5ES4B 5CCDA 1DT3A 3OZAA 2O2JA 3NH6A 4MRMA 5C5CA 4BNJA 1X9IA 3RIXA 2NVYB 4PCVA 5FRDA 1KKMA 2BM0A 4DY4A 3S2FA 3LP8A 2D5BA 4S1OA 2RHLA 4Q21A 5EXSA 1V11A 3D02A 2RA4A 3NXSA 3UHFA 1GWNA 1F4LA 2FZ5A 4YLEA 4JXZA 5L4SA 4EFKA 1TY2A 4BJ3A 3SXUB 1EDZA 1F14A 4WKOA 3C6QA 2AJBA 3FPSA 3L2OB 4HI0E 2FDXA 3KB8A 2PQ0A 4FM9A 3GPDG 5H3HA 4W7HA 4NFSA 4EQZA 3SSOA 2X5JO 1MJNA 4C08A 3H3XA 4L0CA 4D9GA 1CY7A 4IF4A 3TZQA 4MV4A 3RIGA 4KGXA 1RKVA 1NLZA 2NMVA 1WTOA 3I28A 4RVFA 2NVTH 2JLCA 3PIP3 1U2SA 1WW3A 3WV5A 3GL9A 1NF2A 1U5BA 4J75A 4MI9A 3QIAA 3AI1A 4B3RL 2WJVA 1J23A 3MYRA 1STAA 2V0GA 3FWNA 3QTTA 1YCFA 1POXA 2CHVA 3AUUA 4G23A 1K3TA 5CMLA 2DUMA 2WSIA 1BHO1 3G59A 3OLZA 1SE3A 3IEKA 1K8RA 3PPWA 4QPZA 5AHWA 3MWEB 1RYDA 5I6DA 3EMVA 3DCNA 2QU7A 4FHDA 3MWDA 1AQJA 1KEKA 1GG8A 4FOTA 2DUWA 3FZEA 2PD3A 2P5YA 1NRJB 1RHUA 4QTYA 3IDSA 2NW6A 5K3EA 2J4FA 4LEIA 4PX2A 3W1EA 4ROTA 1U2PA 4O2RA 5K0CA 1TA4A 2AX4A 4WJ3M 4JMLA 1O0BA 3EW7A 3VUEA 1KLUD 3A8IE 3ZV5A 5FDFA 3RS8A 3UFXB 1UXIA 3O4IA 2X3YA 2WAAA 1B50A 3MTEA 4D5EA 3A6LA 1I7LA 4H1TA 4M9SA 3FI0A 2I2BA 3ILYA 1O7LA 1N9KA 4Q16A 2WMNB 5F78A 5FB3A 5ICFA 4GICA 4PSUA 3U7HB 5DE3A 3D0KA 2B78A 2KMLA 2ALJA 1B6GA 3TIXB 1XD8A 3PDWA 4UNNA 4L15A 3W5JA 5CBKA 1JDUA 1G41A 2VBGA 2WLSA 4E5NA 2AXPA 4ZYWA 4ADSG 2P3LA 1NG9A 3OLYA 5IJWA 3VYUA 4K5WA 2ZJPA 3GPCA 4ZARA 2B5VA 3NAMA 2WJGA 4Z3DA 1UQUA 2QJFA 3HCDA 1L7EA 4QUEA 1L5OA 2Z6AA 2BZ0A 4X9XA 3O21A 3O38A 4RTNA 1R4AA 4DF3A 3VO1A 2H1WA 2AV6A 2I1WA 4D0NA 2P4SA 3DWGA 1P2UA 1ZL2A 3HUFA 3A0RB 5A7HA 1YSCA 2DHRA 4ZV7A 2BMWA 3EEFA 1RT9A 1Z0SA 4EB3A 4GGPA 2VG8A 2YYZA 4CGYA 2JL1A 3G1UA 1QJ4A 1DV1A 1XCJA 1W4LA 1JA9A 1QHYA 4L74A 3W3ZB 3ZHRA 1GD1O 4P72A 1CKEA 3N2KB 3VR4A 4ZANA 1PZFA 5F9FA 2JAQA 3T1YL 1F8YA 1V9LA 3G02A 4DWJA 5BNWA 1UQRA 1Y3CE 2Q3MA 4U2DA 4JUBA 5H59A 3JTMA 3RR2A 5DGIA 5I7RA 1XTDA 4EDFA 2AK3A 3DVLA 4FYPA 3H9BA 4RV5A 1MC5A 4YTEA 5FEMA 1WU7A 3CKKA 1QOZA 4EMTA 3E3NA 3IAAA 4UDOA 1PF7E 1B3QA 4EB8A 3Q0IA 1QX4A 4V0KA 3QX3A 1F7UA 5E3FA 2FFHA 4EPVA 2CLCX 4U8GA 1G3UA 4IGFA 3X44A 1C2TA 2H18A 2NU7A 3NYRA 2H29A 3VU9B 1M75A 5F7OA 2QM3A 2AJCA 4AJNA 2EC5A 3C6XA 3WRYC 3IKMB 3DHWC 5K8TA 3K0CA 3L82B 3R41A 4GPAA 5JJZA 4CM9A 2CSXA 1O8BA 2P1RA 2WKRA 5LZ8A 1H9SB 2HIVA 4DTCA 3A10A 3MOIA 4FR5A 2Z30A 1I7NA 3AFMA 5ICSA 4UUOA 4LYFA 1N34L 2IYNA 2OV3A 4DKXA 3S14B 3BZDB 1VLVA 3IP9A 2OO5A 3NM6B 1TLTA 1DKUA 3CC7A 5HSGA 1U8CB 1XEWX 3UAXA 4TWIA 5JO9A 4A5OA 3BOSA 2VHJA 1PQPA 1NOKA 3ZTYA 1W52X 2FKAA 1IHUA 3LFHA 4QAJA 3C3WA 4X7RA 4DCGA 2PT9A 4ZU6X 3Q8WA 4DV4B 5JNWA 3KXDA 1YIJA 2PVSA 2FPXA 1JEYB 1H69A 4V03A 4BMOB 3U9TA 1U3CA 4D1YA 1N5IA 4WKBA 5ESXA 1N6RA 3T9FA 3L0PA 5ERGB 1DELA 1NZDA 2X5XA 3K0FA 1FD7D 4IURA 1XMOB 3L07A 1PYOA 2PQAB 2X2OA 5FV7A 1ZI8A 3V7NA 2Q4BA 3E3OA 1X9NA 5CNIA 4FXPA 2PT7A 5DNCA 4ZYSA 3CD6A 1KKLA 2P0YA 3PUJA 5C80A 3NU1A 3S29A 2RSLA 4CUZA 3Q88A 3BA6A 1H9BA 1EI9A 4B08A 4JI7L 3NHAA 3JARB 1NN0A 3W8NA 1A8IA 4G9BA 1QK5A 4RJIA 1QFXA 1KEZA 4ZREA 4QQFA 1CPYA 1IBML 1ENZA 4BQRA 4Y7NH 1FSFA 3H3JA 1VQLA 3RBXA 2GK6A 3ANSA 2KHZA