3PUWA

Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
371
structure length
371
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein
publication title Snapshots of the maltose transporter during ATP hydrolysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/transport protein
total genus 105
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3puwA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3puwA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3puwA01
3K0CA 3SQXA 5J4YA 2H92A 3LX5A 1A1VA 1OW3B 1ZCAA 3CZQA 5LD2B 1DGSA 5IY0A 3AUXA 4KYUA 4Z1MA 4YCVA 1WQ1R 1YR8A 1P60A 5J47A 1V5WA 1NIPA 1ZYUA 3G71A 1DARA 2XB2A 4JI2L 5FL7D 2ZS7A 1DTSA 2ZYTX 4KHPQ 1XNJA 1IOZA 2RF4A 4R1JA 1E2IA 1L8QA 4EFNA 4NPSA 3TQCA 1DO2A 3PFIA 2OE2A 3RDPA 3WYFA 1PH4A 4BXXH 3KQUA 1YNJC 1XDBA 4P31A 2Y8EA 3S1AB 1KMHA 3TSOA 4AKEA 4DKXA 4IDNA 1XWIA 3TZUA 2QENA 4TYQA 2F43A 4Q1DA 2V54A 3CWQA 3FMOB 1KI6A 2NO1A 1N8RC 3CCRA 4GOPA 2W6ID 3A4MA 2A7QA 4A4IA 2FNAA 2RHMA 2WJGA 2ECKA 2WKRA 2H17A 1MKYA 2RGGA 1YVCA 2ZRPA 3R20A 4UNNA 3EPKA 3GFTA 4OI0A 1XB2A 2WSSA 4DT1B 4Q18A 2OLKA 4B2IA 1LM0A 4RD2A 4LHVA 3Q72A 4LJZC 2FXQA 3KF6B 1Q82C 3HKZG 2G3YA 1I6VC 3H2YA 4AYWA 1G291 4A3BG 3B2EA 3KXKA 3QPVA 1IHUA 2OHFA 3W3AA 3MJHA 3C5HA 4URUR 4DEYA 2J0SA 4NBSA 2ZM6L 1MR3F 3IHLA 1H8EA 3T1TA 2V7QA 4US2R 4HSEA 3U3OA 2XITA 5FI0B 2JDIA 5CLLA 1MJEA 2NIPA 2PJRA 4G5RA 2WJIA 2IX0A 4GKJL 1DCZA 2YTYA 1G19A 4BA1I 3SDZA 4YY3Q 3HR7A 1VTKA 4KLZA 4MRVA 1UBCA 3IPXA 4JYAQ 2LWIA 1JXOA 3TR5A 4BWYA 1IYJB 4JI4L 1UM8A 4AD8A 1YHAA 3HYTA 4PANA 3I5XA 5JEAJ 4DR4Q 2A78A 1AA9A 2R6CA 4IDOA 5B2ZA 4DUYL 5IWAQ 4KAXA 3I4LA 1E4YA 2CJWA 5H68A 4XSHA 3VR1A 3QOFA 1GUNA 2YOHA 2ZI4A 4CW7A 3S1MH 4K0KL 2ZUBA 3KKNA 4AYTA 221PA 1T3HA 1KK2A 1J8YF 2ZPTX 5JWRA 2J45A 2GVAA 3NIBA 4RZ2A 4KN4C 3SEAA 3VMFA 3CP0A 2DGYA 3CX8A 5J40A 1QJOA 2WKPA 1VQHA 1RL2A 5DIFA 3LXXA 1VS0A 3RZDH 2UU9Q 5FBVB 3DEFA 3SGIA 4B2PA 2K14A 2OQ0A 1KC8C 4A3KG 4JYCA 3SFZA 5JMTA 1YVDA 4X62L 1IN4A 2YTXA 2RH5A 5FL3A 1G7RA 4Q21A 1T9HA 2K52A 1CJVC 4FDBA 3ZJYC 2A9KA 1E98A 2GWHA 2V55B 4XH9B 2ZUDA 4OHWA 1BMFD 3S1RH 4LJ4A 1WBDA 4A93H 1R5BA 1BVSA 2EWVA 4L8GA 4ERNA 1J7KA 3UG7A 4IVPA 3GTLH 5M3FG 2PZFA 1VQNA 1PMRA 2IC5A 1CSQA 4PO1A 4A3JH 1P2TA 1XMIA 4QJ3A 5JSZB 3WWVA 2QRNA 4OK6A 5CLQA 1N36Q 1Z0IA 2AN9A 2G6BA 5EE5B 3GJ4A 2BA1A 2OWOA 5LB4A 1L2FA 2N3SA 2OCYC 4JLMA 4WXPA 1XNQL 3P20A 3UMSA 2X2EA 2QUZA 5KPDA 3AKDA 2A69C 2GJ9A 4DV3L 3C7KA 4B3SL 4QG7A 1PUJA 1LF0A 2CK3D 4JSTA 4AG6A 1GAJA 1BDOA 2WHXA 3LW8A 3UMFA 4KXFB 4Y0AA 1K8AC 1ONLA 4M1YA 4PZ7A 2HLDD 1CFMA 4IRUB 3PUYA 2PI2E 1E94E 1OXTA 1R9TH 1I4LD 4O0AA 4Q4AB 4L5TA 4A3CH 3C15C 3KL4A 3EPLA 2G1JA 4I99A 1K5GA 1T3LA 2EIFA 2GKSA 3GJ6A 3KUCA 1MO3A 2FU5C 2CWAA 1MRSA 2F1RA 1XMOL 2JASA 4KLKA 2GVDC 2ORWA 3O8DA 5EP3A 4DCVA 1EWQA 2GETA 1GTVA 3DO6A 2ODBA 3CCJA 1EFHA 1L2TA 2OUKA 4UJ5A 2ZU0C 1T4GA 4IOMA 1TUEA 4X8LA 4AYXA 3ADDA 1E2DA 2PNRC 1RJ9A 1XJCA 1A63A 4H44C 2BEKA 2W6JD 3KKMA 4X8OA 4KHZA 4DIDA 2IS2A 4OHYA 1YHBA 2DUDA 3BJUA 4OK3A 5F9FA 3X1YA 5JWHA 1P72A 4DSNA 1K5DA 3WY9A 1GRNA 2A5DA 2PMDA 3S14H 1I6HH 2WWWA 1N6LA 1W1WA 4GBMA 4TL7A 1NJFA 3HOWG 1VQKA 1SMYC 2JIZA 2P5TB 4A36A 1XEFA 1KKLA 1LUZA 2X8AA 4OBEA 2C03A 4B3RL 2HXYA 4KN7C 4PZ8A 4LJ9A 4US1R 4RY2A 2RGDA 4TMWA 4HLUC 2KBEA 3U3JA 1KHIA 4G5GA 5CK5A 1E2EA 3QKSB 1VQ6A 4LJ7A 4UXIA 4GN3B 3SU8A 5EXXA 1NVVR 3EBEA 2CCJA 3F3YA 3TAHA 3X2SA 4A1FA 2IYWA 5HKKD 3OAAD 3CCLA 2MSCB 3ZS8A 3DM5A 1XEWX 2FSHA 4GI7A 4RKFA 4Q4HA 4JBWA 1US8B 3K9NA 1NRJB 3K53A 1IM2A 1GD7A 3K8AA 1E9CA 4KODA 2CCGA 1UKZA 1KK0A 1DS6A 1AE3A 1MABB 1Z2AA 3C5CA 4QNMA 2O8BB 4UXHA 4MYCA 5GAHC 2XAUA 3UDXA 2PQAB 4YXWA 2QF7A 4JLJA 4ZDJA 4IPHA 4POGA 1JR3A 1U0JA 3S17H 2HF9A 4A2PA 4JBMA 1AK2A 2OILA 4OONA 4H0LC 2QZ4A 1VCOA 3A1SA 3L0IB 2O5IC 2AK3A 3CMEA 2B63G 1BKDR 3RVBA 4M8NE 4X65L 4LV5B 1WCMH 1MT0A 3U44B 2BMJA 2V1UA 2I5HA 2VL7A 5DSZA 1PHJA 2D0OA 2Z6VA 4LCBA 1L1OB 3AP3A 5SZIA 5CDFE 3WHLA 4M9QA 4KFSA 1VQIA 4BLTA 4GKKL 5EUMA 4MYTA 4HJ5A 4JLAA 5TB5A 5TDHA 2BC9A 4BZQA 3IEVA 4PQYA 4ME3A 2IBMA 2IHEA 4MUBA 3I1FA 3DHWC 2HCJB 1SN8A 1G6HA 3GCGA 1XMVA 3KF8B 3R9IA 4PMWA 3OTOL 4GPTA 3MFYA 5AJVB 2H7VA 1N25A 5BN5A 1DADA 3PVSA 1GUGA 4PC2A 1HEIA 1CI3M 2XSZD 1NBMD 1RW4A 1LV7A 4KI0A 3CF5A 1VQFA 2NZOA 5M5XH 1Z6TA 2YVUA 2UXBQ 1E2FA 3CAMA 1I4TD 2G1KA 3IBYA 4WOPA 3UPUA 4DR3Q 3QKRB 4JKIA 4YDSA 4MGZR 4C0KA 3B1WA 4X66L 1X9NA 3FMFA 4M1OA 4MH0R 1VYVA 2A6HD 4FMBB 4BY7H 2V8OA 3DMNA 5EP2A 2FFHA 3FKSA 1TQDA 5P21A 2JLWA 5A4JA 1X6OA 1OKKA 4LF9L 1XMQL 3QKUA 1XF9A 5AJZA 2BDOA 1D2NA 2G0TA 2P6NA 3QEJA 4CEJA 1OXVA 1SXJD 4PHTA 1U8ZA 3VNVA 3K7AH 1WCV1 4ZI2A 3D0FA 2CVFA 1NSTA 4HAWA 4PX9A 5DHAA 5C3EH 1OH5A 4B74A 1KTVA 3LW7A 5GVSA 1FQKA 4RCZA 1HUQA 2QM7A 4Q48A 4QOSA 5DLQC 1YJNA 4ESHA 5HZHA 3N2IA 1WB9A 1GITA 5FR2A 3LAWA 1CLUA 2F55A 4Q7MB 4H9GA 4B73A 2D74A 2KI5A 4OX9Q 2UXCQ 3CNLA 3RRZA 1Y14B 3FFBA 5L3SA 3TNFA 5K36G 5K8UA 3CNOA 3LQRA 4JZKA 1ETUA 1CU1A 3GTMH 2QORA 5DN6A 5EUQB 1Z29A 1WRBA 2NGRA 3B60A 4BRWA 1E9FA 2IYYA 4TT3D 2RHDA 3W6OA 2A1AA 4PR0A 4RFSA 1TF5A 4LUZA 4IKEA 2IYVA 2YINC 3EZFA 4O0MA 2ZRKA 3ZIAD 2JEOA 4BFWA 1Y1VH 1MO4A 5HY6A 4DEXA 4F92B 2IXGA 3P26A 4I1OA 3SBDA 4GN4B 4A3IG 1XCMA 3NH9A 2P0EA 5KYKA 2NMVA 1F2UA 2EDGA 1VQLA 1LS6A 5G53C 5IK2D 1FX0B 1LYLA 4NXML 2GRJA 4IDHA 3TVDA 3I73A 2E2JH 1IXRC 3ZD6A 1G7TA 1NE3A 1KL9A 2ERYA 3SQWA 5FL7A 4LYJA 3ULJA 5TXGA 1FW6A 2JLQA 3CXCA 5K8LA 4JT4A 2PX0A 4JS0A 4ASUD 3CPWA 3DKPA 3CC7A 3OEEA 4QRHA 2XZOA 1IN5A 2WJJA 1X8LA 1A8VA 1IL2A 1OFUX 2QA5A 4X64Q 3QF7A 4D81A 1YRAA 4RKEA 1CBUA 1I2MA 3UMRA 1VQGA 4A3FG 2Q9CA 1XD2B 1AE2A 4A75A 3LLMA 5C0XH 2W6IA 4JC0A 1N5KA 2GAOA 3GLGA 4A15A 3LH5A 3GJ0A 2ZTSA 1DAEA 3EA5A 3WYGA 4V0ME 4ZCLA 4JLNA 3BB4A 3LVRE 5KOYA 4G7OC 1E2HA 2DWPA 1RRFA 2I3BA 2CW0C 2PZEA 2G9NA 2D7DA 2MNAA 1HURA 1VIAA 3GJ5A 4MDFA 2YU9H 1HR0L 4MA4A 3C14C 3EW9A 1GUOA 2A8VA 2O8FB 4OWXB 2O8DA 1U94A 4IVQA 4B3CA 1DD2A 3WP1B 4DR7L 1KOFA 2EU8A 3JC66 4DSOA 3PUVA 1SVIA 2QAGA 3AB3A 3G82C 3HU1A 1TX4B 2EYUA 2IT1A 1Z6GA 2GZHA 4FMCF 4TTRA 1CRPA 1CKNA 3NEJA 2R6FA 5IYCH 1NN1A 1NY6A 2W58A 2WM9B 3A1WA 1LF5A 1CUKA 4A8JB 4DV1Q 1RVDA 2LCFA 2WOJA 1VHTA 1ZUHA 2BMFA 4JL6A 1LABA 2PEZA 4YMVA 4GNXC 1YZUA 3D7MA 2B8GA 4B3DA 4LHZA 4KKUA 1VPLA 4LV6A 3SC3A 3FKQA 4JLVA 2DN8A 3P32A 3UIEA 3W8RA 1OB2A 4TZ0A 4Z1MD 1Z7TA 2QGNA 5AWFC 5KNDA 2ZM5A 1KHTA 4XVQA 4HR7B 4Q7JB 5G41A 4XVUA 5J4HA 3E9IA 2A30A 3T35A 3GFPA 5G3YA 5M3MG 4KJZA 3E9HA 2VQEQ 1UBFA 4EJSB 3KLWA 1D9XA 1XZPA 2AFIE 1RRPA 1K8OA 4LF4L 2VS1A 3CWZA 4MKIA 3IO5A 1UADA 2GTPA 4LFCL 1A2KC 4ESVA 2GXAA 3EIHA 5JEDA 4R4IA 1PJRA 4LF7L 2A6EC 1NY5A 1SVWA 2EQBA 2J0UA 2XTMA 3J80i 3CNNA 1SXJB 3A1UA 3PIOA 1W5TA 3TSZA 5EE0A 1G8FA 3Q85A 4UP7A 2K5VA 2B6HA 2WP8J 1XTJA 2QPAA 2WSSD 4YMTA 5KTYA 3CM0A 1FNMA 2FMXA 1CKOA 1WP9A 2ZANA 4CEHA 3BWDD 4B75A 2AHOB 4U00A 4ABYA 2VRWA 3EWAA 1DEKA 1Z83A 5HTKA 1FMLA 1DOAA 2GHIA 3QG5A 1E2KA 2BE5C 4UP8A 1NVUQ 1JAHA 5EE1A 1HNWQ 1XZQA 4JT2A 2KWIA 4YONB 3QIAA 2QRZA 2GEUA 4MQBA 4OJQA 4DCUA 1AKEA 2D2CC 1BO6A 1D2EA 4HDCA 4N3NA 1WBBA 3HR8A 1G5TA 3QXXA 3ULPA 5IYCG 5FTLA 5KDOA 2P6UA 2JAQA 2VSXA 4ON9A 3TR0A 4Q4JB 4DCTA 4OK5A 5H8WA 5LB2A 4BBSG 1JEEA 4POFA 2Q21A 2HLDA 3KFVA 2OSBA 4QKQA 1Q20A 4IXMA 4KSBA 4K8OA 4A76A 2BIFA 4P4TA 3WBKA 3EZ7A 4DUZL 5AJ3L 1E1TA 5KSPA 1VQAA 2VUMH 2ALYB 1P16A 1Z9FA 1R8QA 2FFAA 1SQ5A 4KYIB 5CB8A 5FOTA 3SS8A 4CEIB 4IOKA 4LBYA 3HFZB 3K81C 2DFKB 1F60A 1XJVA 3U5ZB 1QHHB 3UK6A 4MRRA 3D4RA 2C9CA 2W6JA 1OXSC 4PPQA 1N0UA 2P3SA 3IIMA 3GEHA 5B57C 5JEAG 1HR0W 1PH3A 2WAQE 5HE8A 2WJYA 4QGHA 3MLEA 2X2FA 2UKDA 3R7WA 1DAIA 3HOVH 2FH5B 2AXPA 1RZ3A 3AVQA 1W47A 2ZS9A 1IBMQ 3AQ4A 1ZAKA 2UUBQ 3OW7A 2WB1E 1TF2A 3PIRA 1OLOA 5IP7H 1E3MA 3KJPA 2NVYH 4NCNA 1E99A 1W36D 1IBKL 2EFDB 4CIDA 1O87A 1KO5A 1S1CA 4JI6Q 1X55A 1GUTA 2JA8H 2E2HH 4N0DA 4XWAA 3TIFA 2O52A 3PGZA 2ANBA 3A4LA 5DNYB 4TL6A 1II9A 3J81j 3FMIA 4P4UA 4V0OA 2QI9C 3PEYA 3HOYH 4UNPA 4BEJA 2V4DA 3OPOA 2QA4A 1JQLB 3HOZH 2ATVA 2IL1A 4JSYA 5L8VA 2UUAL 3S2DH 4A0FA 4QM7A 4UNQA 2NZHA 2Z6KA 3F1ZA 3HWSA 4QNRA 3FHCB 4KHPL 4J0QA 3KQNA 2NO7A 2ZSFA 4A0RA 3AVUA 3OE7A 1A6XA 4M1KA 3T56B 3EZ9A 1B23P 2BBSA 2YJTD 2F1MA 3LXRA 4PC3A 4LUVA 5FTNA 4XTRA 3A7LA 1XD9A 1TWAH 2WAXA 4G0NA 4UQOA 5EP4A 3AVOA 1GHKA 1WMSA 1JT8A 2CL6X 2QQEA 1J5EQ 3EASA 3MMPA 4JLBA 1W2HA 2OCPA 2R62A 1P75A 2VQSA 3T1OA 1RKBA 4TYYA 4B3TQ 4DPGA 1RYFA 1TU4A 1X8KA 4DK3C 1ZRHA 1KMHB 1M2OB 3A8TA 4XTCS 1E9SA 4WJ3M 1F2TA 1G3MA 4GZYC 1NMYA 2ZRIA 4Q9HA 2F43B 3QY0A 3VHXA 4QFMA 4PC1A 2IYUA 1KI6B 3B6EA 4EIWA 3UXMA 4GOPB 1AIPA 2QSYA 4KVAA 2JA7H 1FL0A 2OO7A 4X6AH 1IZ6A 3L8ZA 2WIAA 4FCWA 4A3GH 4C2MH 4XSGA 3CX7A 5EXPA 2WTUA 1IN7A 4ZDWA 1GVPA 4JI7Q 3NG1A 1UKYA 4W9MC 5FI1B 3C8UA 1N0WA 1PH5A 5CITA 4OO1I 3HKZE 2BJVA 4KKTA 3OIYA 2XNSA 4PHHA 2JA1A 1Q44A 4LPKA 3M9BA 2DYKA 5DI3B 1NLZA 1EK0A 2W2TA 3PR1A 4GNKA 2K5NA 1NBMA 1WOCA 4NYIQ 2C35B 4R9UC 1ZW6A 3ZVLA 1E7ZA 3THXA 3K70B 2UUCL 4JYAL 3VAAA 2CCZA 5DO9A 4DLRA 1RIPA 3QSYA 1E1RD 5CJ2A 1I5FA 4A3LG 3W6PA 1FUKA 2WKQA 3TLXA 2BBTA 2ZJBA 3BE4A 5EXTA 3BFKA 4A3DG 1ZC3A 1CJTC 3QEOA 2PCLA 2R92G 2QP3A 2FSGA 2JJ1A 3WYAA 2Z0MA 5FPKA 5JWOA 2CFMA 4HIOA 3O47A 3H3VI 3DMDA 3MRSA 4GOKA 1V1QA 3RR5A 5FLMG 1K8GA 2EFHB 3I8SA 5CJPA 1BS1A 3W5IA 4YXWD 3HDTA 3ZVMA 3FVQA 4J15A 4HJ7A 2ZETA 3M85A 2CJWB 4DK0A 1Y3AA 2VA8A 3QVVA 4D4LA 4HB3A 1YR6A 4TQ9A 4EPRA 1FUUA 2VIIA 4NONA 4DAYB 2K32A 3UWKA 2JLZA 3BB3A 2C8VA 2P2LA 2LMCB 3S15H 3M6AA 5CM9C 4DV6L 2HT1A 2OEPA 4Q9LA 1KO4A 2YZ2A 3H86A 4DDTA 2BCGY 4LZZA 1XX6A 2IEZA 1E1OA 1Q8KA 2QP4A 1NY4A 3E2IA 1Q90A 2KJQA 3KTAA 1IBRA 2IXFA 2NO9A 1XMSA 4IPCA 2P6RA 2PLFA 3STBC 1K8MA 1N36L 2ZRHA 4IFDH 4RD6A 4HZUA 3AF2A 1HY3A 5FUXA 3RHFA 2IWRA 3BH0A 3IIJA 1R8SA 5CYPA 2VP6A 3EWSA 4MDEA 1HCZA 4NYJQ 2QPOA 2VSFA 4MYUA 2MO0A 3GLHA 3LGJA 4C2UA 4O2LA 2ZYWX 1G16A 4RD0A 4M9XA 4C0JA 1G8PA 2IEYA 4DV0Q 3A8KE 1W4BA 2I1VB 2KENA 1YZ6A 2R7FA 1EWIA 1OIVA 4V02A 2ZI5A 3T15A 4BLRA 3LD9A 4P74A 3B1VA 1OKKD 1S3SA 5B58C 1WA5A 3JZMA 3L0OA 4LUCA 5FBWB 3QJYA 2CBZA 4MGKR 3Q7QA 1AJEA 4XD7D 4ZIRA 5JCZA 1ZM2A 821PA 3REGA 4LJYA 4BLPA 1L4UA 2B3GA 4Q4LA 3WMFA 3W5JA 1Z8FA 3NDPA 4A3BH 2RHQB 1KO8A 1S1MA 3U50C 2IF0A 5EE9A 3CX6A 4QHYA 3KYHC 4PAMA 2XXAA 4TVAB 4UNSA 4IHQA 1UF9A 2OFWA 4LSGA 4JVSB 4LC1A 3K80C 1CSPA 1VQEA 3SYNA 4D2IA 5FOVA 3UWOA 4DV5L 3H0GG 1I94L 3HP1A 1OFHA 4JLPA 3PF4A 2CL0X 1PH1A 1RJ9B 3QBVA 3B1ZA 2RGAA 3PCOB 2ODEA 5G3ZA 5KSOA 3GLFA 4IXNA 4GP6A 2BBWA 1QZHA 4A2WA 3I7FA 4EQ6A 5DN6D 1W5SA 1HYQA 1P7CA 4DLUA 2PEYA 4KSCA 2NO0A 3FOZA 2UVQA 3B9QA 1XMJA 2RGNA 4BZXA 4TLBA 1VHLA 3TUIC 3CR8A 3I56A 1ANKA 3NHAA 3K9GA 1E79D 4L9WA 2WJHA 1NG9A 2QU8A 2QG6A 2JE6I 3CQZH 3TSWA 3Q9LA 3RLNA 2A69D 5J3BA 1COWA 1C4OA 3M4OH 4IFDG 4OXPA 1E2GA 2ERXA 2KE5A 4M1TA 1QHSA 1N5IA 1IJFA 1SZPA 1T6NA 2MSDB 3QXHA 3THOA 3L8YA 5L3VA 4HJ9A 5LD2C 1P61B 1TPZA 4JK1C 2XJ4A 4BFSA 2E87A 3UDFA 3MAAC 3OEED 5AR1A 3PF5A 3DL0A 4LBVA 4A3KH 2VW9A 1N34L 1FTNA 4IDPA 4NCHA 1NMXA 4P75A 2DWQA 4EKDA 3NEYA 5L3QA 2XNDA 4XJXA 4Q4HB 1Q57A 1TEXA 4NB3A 1E6CA 1MO5A 1ZM4A 4ITRC 2O5JC 4A6PA 4B32A 1ASZA 1IY1A 1E9EA 4L16A 2BMDA 2ZYUX 4EFMA 3RABA 1G8GA 2GBLA 1EWRA 2AKYA 3ZYCA 1N6IA 5TMPA 3ZD7A 1JBKA 5M3FH 3AFPA 3U7HB 5FOXA 1MIUA 1YR9A 3ZQ6A 1QVFA 3FB4A 2QQ0A 1FMJA 2BM0A 4I1SA 3IO3A 4O2RA 1BBWA 3G48A 3GMTA 1IY0A 4TSFA 2JLVA 1PYBA 5LDDC 3CRQA 3AB9A 1NI3A 2GVBA 2NN6I 1JECA 2A5FA 3CZPA 4D25A 1II0A 3PO3G 4B3MQ 2KA7A 2LXKA 3F2BA 4Q01A 2ASEA 5FUYA 5JS8A 5JI3E 3NKVA 1HNZL 3SJBA 3PEWA 1IBLQ 1R4AA 4QJ4A 1GJXA 4Q5IA 4DV2Q 2FZLA 2AWNA 4DR6Q 2F1JA 4POAA 1HH2P 2TMKA 2W00A 5BWMA 1JJ2A 5E7NA 4ALPA 2NVXH 3GTGH 1CR4A 1G64A 2ZJAA 4MRSA 3U4QA 1JEDA 3GQBA 1QHNA 2UXBL 1QUQA 1R0YA 2VQFQ 4DC9A 1X86B 1B9NA 4DR3L 3KLRA 1HTWA 4HIMA 3RLFA 1NIJA 2IHFA 2GAAA 2PT5A 1PYSB 1E69A 5JLJA 2OV2A 2DR3A 5KO2A 2JEAI 4GL2A 2UXDL 4H1UA 4NCIA 3RRYA 1W4AA 1K3RA 2VO1A 2QL6A 4BFVA 3PJRA 5EAYA 2JA6G 1OJLA 5LMUL 2HYDA 2A68C 1YNNC 4QHSA 4DDWA 1TQ6A 3GJ8A 1Q3TA 4R2IA 3TK1A 1KIMA 4C0BA 5E7IA 4LK1C 2ZJZA 3DDCA 4B43A 5JS7A 2CXXA 3AM1A 2AD1A 4OO1G 1JR3E 3NBFA 1Q12A 3CW2A 3RYTC 4P4SA 5AK0A 4A92A 2AR7A 3RSLA 5F98A 4QC2A 3AVVA 5BR8Q 3U6BA 3HOWH 3DM3A 4YWMA 3A36A 4G5OA 4II7A 4CEJB 3MWJA 2OBLA 1Q86C 5ELXA 2ZYVX 1OH8A 2QTFA 3UE0A 1KSJA 2UXCL 4DV7Q 2J46A 4IEIA 3N2EA 1KNQA 2NVTH 3NH6A 1CJUC 3OOCA 3U58A 4V0KA 2JLUA 3EQLC 1II8A 2R6GA 1U5KA 4JI1L 3KJHA 4DWJA 5L3SB 4L5SA 3JAMi 3A6PC 4NXNL 4B48A 3AKYA 4WBSA 4QL5A 1S3GA 3CMAA 1XP8A 4DR2Q 1Q46A 3IEUA 3L2OB 4LY6A 5FOUA 4OI2A 1P4SA 3WXMA 1LNZA 1HJPA 2Z83A 3ZGXA 1XTIA 3CIOA 1OF1A 4LHWA 1NMGA 1E2NA 5ELOA 3Q5EA 5IP9G 1KZ7B 4OQXA 1CULC 2C77A 1D6JA 3AGPA 3L2PA 1F2UB 4JLKA 4AURA 5C2JB 3EIEA 3T5GA 2GA8A 2WZQA 4WA7A 3PXGA 1ZUIA 3I61A 1RE0A 4YQFA 421PA 1OXXK 2B63H 1ZMXA 4JI5Q 1J8MF 3ZQJA 1KMQA 1YJWA 3CRKC 1IXZA 1U9IC 5DGXA 2N1BA 2LSSA 1M90C 1P2UA 3B82A 2AUKA 5EXSA 4OI1A 4RD1A 2BJWA 3CO5A 2ORVA 4DJTA 2CNWA 4PTLA 4LBZA 3RRMA 3T1VA 2RMKA 3SJZA 1P2VA 3ECCA 2IWHA 2F9MA 5LPNA 1JPNA 1B9MA 3AVTA 3SBEA 1W49A 4JBYA 3GLGB 4DB2A 3M4PA 1GFIA 2BKEA 2QE7D 5D3QA 5FH9A 3SR0A 2CEAA 4R4OA 2L0XA 1MH1A 4PHFA 2JJQA 4RG1A 2ZVQX 1G7CA 4PAQA 4PFSA 5TARA 1S4QA 1YQTA 4BFUA 3O8CA 4LWCA 1Z06A 4LC0A 3VA7A 4PSKA 2O8DB 3W3ZB 3ETLA 1X65A 4ZCIA 4DV1L 3QF4A 5A5GA 3VR3A 4P73A 4K81B 4ACBA 2QAGB 4LF8Q 4O2DA 4Z51A 2ZROA 1Z0JA 2PL3A 2ZI3A 4LFAQ 5IRCD 1JR6A 2QTHA 4Q1FA 5FOWA 1CKNB 1IXSB 3U61B 4QHTA 1E1RA 1N9WA 1LY1A 5SZJA 4OJKA 1M8PA 1ZNXA 3MWLA 1DXMA 1YZQA 3IPYA 2NZJA 5CB6A 1IJEA 2I0QA 4OI4A 3U3KA 1EYGA 1SR3A 2C95A 1NVVQ 3B7GA 4D82A 5GADC 1DG1G 4LF5Q 4B76A 3OE7D 3VHLB 3V4RA 4DCSA 4IJHA 5IHPA 3LLUA 1KAOA 1A62A 2EYQA 4QY7A 2VBCA 2BOVA 1S3OA 3S24A 2IUUA 2R65A 1GUAA 3PITA 1CR2A 4KBGA 2FN4A 3BAFA 2NO6A 3PIPA 1E96A 3GLGE 2FG5A 2ODNA 5K36H 2OCBA 2IS6A 4MKHA 3E0EA 3RS3A 1XNRQ 1VYTA 3BERA 4LJ8A 4RCNA 4HAYA 1IY2A 3GFOA 2V3CC 4JI2Q 1V43A 2PBRA 4QGGA 4PG3A 4DDVA 4JVLA 2GXQA 4DLWA 1MRNA 1ZKOA 2N8NA 2VEDA 1G17A 1HTPA 1ZNWA 4A3IH 1W0KA 2D5DA 1NN3A 2DCUA 1UPTA 2IYZA 5KNBA 4CYMA 3HOXG 4AI6A 5FJ8G 3BJIC 4U5XA 4LGMA 4DIEA 3EIQA 1L1OC 2YNMA 4PQFA 3CR7A 3UANA 1VKJA 3CC2A 3RSOA 2K4KA 2PX3A 1OHHD 4CEHB 4ARZA 1HNWL 5KUTA 1KJYA 5C18A 4ZKEA 4KVGA 3RN5A 1HPCA 4BGDA 1RC8A 1JE5A 2OBNA 5JCPA 2ZJPA 3NBYC 2Q2TA 1KXLA 1N5JA 2PCJA 1CRQA 1SHKA 1RYHA 4DCNA 4D0GA 2NQ2C 3MEFA 4A3FH 4DR1Q 1E0KA 2VP4A 1Z22A 2BHRA 2CLDX 3QPWA 2B8FA 4D80A 4M1WA 3EA0A 3ZZ0A 1DELA 1PH6A 4DR5Q 1EFTA 2OCEA 4UJ3A 5EZ5A 3I4NG 1UKEA 2NN6G 2FPLA 2JJ1D 2ZRCA 5CIWA 5KU1A 4DBLC 3GP8A 3V00A 1HA3A 5DISB 5C4GB 1ZIPA 2CHQA 3RC8A 2FFQA 4Q66C 4XD7A 3MD0A 2CLSA 4GKJQ 3LA6A 1QHXA 1VQ8A 1VQ5A 4RZUA 2F52A 2GK6A 4QL3A 5EP1A 1O7IA 1GL9B 2H16A 3BZCA 4JI4Q 4G1UC 3KDFA 2V4ZA 2F3TA 2OZEA 4TQUS 4IW3B 3CBQA 2EJGC 4LHYA 3UDGA 1KJZA 1LFDB 1GKHA 2PI2A 2WMOB 3WP0A 5SZHB 2IXEA 1LTLA 4OWWB 3ZJYA 2C96A 2VTKA 3BH6A 2HJVA 1ZM7A 4GZMA 1KO7A 3L43A 1WDTA 4JIMA 2UUBL 2R93G 4K0KQ 2OXCA 4IVRA 2MQHA 1TL7C 1CS4C 4WJ4A 4TN1A 2VF7A 3W90A 2ZRDA 3REFA 4B34A 1D7QA 4JLDA 1NN0A 1KK3A 3SN6A 1VDZA 1NLYA 3KJIA 1H8HD 1XPRA 5IYBH 4JI6L 1Z0DA 2IYLD 3K0EA 1DAGA 3M1IA 1I3QH 1E79A 4GN5A 1M74A 5UKDA 3RNUA 2J0VA 2JJ2A 4XWOA 4FMDF 5AJYA 5M3MH 3EZ2A 1NLFA 4PO9A 1JJGA 1OV4A 3LRPA 4PPNA 3OIWA 3T06B 4W5WA 4TQAA 2VP2A 2ZQ5A 3H4MA 1Z08A 4B47A 2ZJYA 1FGUA 1EX6A 4F38A 3IHWA 1J90A 3J80c 5FPTA 3B5JA 3SHWA 1LS1A 1TKWB 3CRLC 3W1BA 1OFIA 1N32L 2RKOA 4HLCA 2KBNA 2D2FA 2QT1A 1M7GA 4HLDA 3SYLA 4C0LA 4BQSA 4DLSA 2HYIC 1N33Q 1ZNZA 1RPZA 4JBKA 4NCJA 4A3MG 1EFCA 1XEWY 3EXAA 3MG9A 3KX2A 4WIAA 3UE1A 1XNQQ 3M7NA 4R71A 4CGZA 5BN3A 2IYQA 2FX3A 1J5EL 4KMUC 1IQPA 4NTZA 4YCWA 5HE9A 1GIAA 2JJ8A 4OQNA 4BRUA 4B3TL 1N5LA 4HZIA 4B3SQ 5A0FA 3T1HL 1TQ2A 3BH7A 1SVLA 2GCNA 2YHSA 2WJVA 1E9BA 3CKLA 2E5LQ 3IUYA 1KZGB 2O0HA 2ZI6A 2WV9A 4PSVA 1TNDA 1Q21A 3CRMA 4TYNA 3GJ7A 2FE4A 1X3FA 4I81A 2DNEA 1JB7A 4OGQC 2ES2A 1QG4A 1YZKA 2ZJ8A 3K0AA 4OHXA 3SNHA 3IQXA 4L5RC 1FTSA 4G7ZC 1ZP6A 2CHVA 4LF6Q 1XMOQ 1YU9A 1VCIA 2BA0A 3CB4A 3M3YH 4P32A 4DLXA 1W4RA 4HUTA 1Q0UA 1AGRA 1CJKC 4JOIC 4BBSH 4GFDA 4YWKA 1AH9A 3SOPA 1YBYA 3BC1A 3WRYC 2ZRLA 4CF7A 1GNRA 4YWLA 2ZS8A 4HLUA 5LBIA 5JHHB 5GQOA 2ORIA 4C4PA 3NE5B 4B71A 5CDFA 1X6VA 4A8JC 1GHJA 1KY2A 3FMCA 1TUIA 1GO3E 3CH5A 5IYBG 4AKHA 1COWD 4FIDA 4V03A 2FEMA 2D0PA 3A5ZB 4FINA 2WVJA 2OFXA 1TADA 2QSZA 3THXB 3ERSX 4N0EA 1D8LA 3MJRA 1XJ0A 4IJLA 1SGWA 2LKCA 3GJXC 3UDIA 4QGFA 3TH5A 4B3RQ 1KDOA 2V1CC 3EPHA 4RD3A 5JEAH 3SJAA 1GKYA 2N42A 3M4QA 2ZR7A 3C4JA 1E9DA 3PO2H 2A5JA 2XNDD 4R2HA 4MZ9A 1A4RA 3AVXA 5IF9A 2ZTEA 3IKJA 2Q3MA 3CCUA 1NVWQ 4EJSC 1I2DA 1X3SA 2K5UA 4M21A 2C78A 1QDEA 4RZXA 2W0MA 2HQLA 1EFRD 1XJQA 1UBGA 5J5CA 2FA9A 1E9AA 2HDNB 3QXCA 4FXPA 4JYBA 4L5BA 3X1DA 1TWCH 1KQSA 1UDXA 1VG9B 4WXRA 2JXMB 3QPUA 2ZTCA 3ZH9B 3AVYA 4ZDIA 4TSFD 3M0EA 1SXJC 4LOAA 1OFTA 1U81A 1ELOA 3UKDA 4G5QA 2N46A 4P33A 2VHCA 1G41A 1E0AA 3OHMA 4JG2A 2F6RA 5LMNL 3I3SR 2WWFA 5JJKA 1WXQA 1NBWA 1GUSA 3KTAB 4B3FX 1N6KA 2H8KA 1P8LA 4Y7NH 3K09C 1EQRA 5GADl 2O8CA 1NBME 4M2LA 2Z43A 4G3XA 1Y1WG 4AKIA 2GF0A 3R9WA 4HZUB 2PLRA 2CHGA 3ULLA 4DV0L 3CPEA 4HB0A 2IYXA 4BY1G 4GKKQ 3P4XA 4LYAA 3RWOA 2EFCB 2ZSAA 1UE7A 2E76C 3C41J 3CUEF 4DRZA 2EFEB 2YV5A 1F48A 1U8YA 2VYFA 2WOOA 3CCSA 3L82B 3G6EA 4M4SA 1LACA 4EQ5A 3WHKA 4TTQA 2D06A 4BUJA 4OL0A 1EGAA 2F4VL 5AUOB 3CCQA 1HT1E 3H1TA 1IN8A 1S2MA 1MO6A 4DK1A 1SXJE 3OEHD 2AMCB 5DYIA 3I62A 4LI0A 3Q3JB 1M34E 3Q8DA 4P72A 4YHHQ 2B21A 1XEXA 2QEXA 4HIDA 1QVGA 4LFBQ 1G5PA 4YDHB 3H94A 2HIVA 4X66Q 2HHHL 2F1IA 3PO2G 4JI8L 1DPFA 2O0JA 2P5SA 2K50A 2QE7A 4NP6A 1R0WA 5BYKA 2C5LA 2C99A 2DY1A 1VYUA 3S1NH 1QVCA 5DE3A 4DV4L 3E1SA 2LKDA 4LF9Q 3LX8A 4JKYA 5KHOC 1IYUA 3CCMA 2VP5A 4HB4A 2OTJA 2J41A 1IN6A 3X1ZA 1P9RA 4I1VA 2XXAB 1XTSA 3A5UA 1GM5A 4Q1CA 3VR5A 1CP2A 4JI3L 1G51A 5FUWA 3RN2A 3THYA 4EPVA 4A3LH 2J87A 2GJ8A 2DB3A 2W83A 2EVBA 3TRZA 2G83A 3PSIA 4TL8A 2REXB 4EPYA 3VTKA 3ZVRA 4A3DH 2ZJQA 4FMCB 2H5XA 1HQMC 2R92H 4C7OA 2JK8A 4EQ6B 5E4FA 4I1UA 3AVWA 2E1RA 1T5LA 1L0WA 1IXRA 2YYZA 1U0LA 2LXJA 5FLMH 3QG1A 2H57A 2UZIR 3K8YA 4ZPXA 5IYDG 2GXUA 1CJMA 1W48A 4DSTA 5AUNB 4EX5A 3I4OA 1IAQA 4NYMR 4BZPA 1KI7A 3GPLA 3BFVA 2C04A 4GP7A 1W3SA 1LVGA 3NC0C 1PA6A 1HV8A 2ZRNA 1NN5A 4Z8XA 1I4DD 1R2QA 4OYHA 4WZAE 4LNQA 4NXMQ 1IONA 2WICA 1G4AE 1S8FA 2CNWD 1JALA 2JLRA 4GLXA 1U8AA 1KO1A 2V6JA 4OQMA 3QUSA 5L3QB 3S16H 1N6OA 2WWGA 1KYIA 2VY3A 2ZI9A 5H1YA 3U7GA 1T5EA 2K33A 4JL5A 2KCCA 3NBXX 2CDNA 3IBGA 2QGQA 2ZAOA 1OYWA 1W0JD 3AFQA 1YKSA 2X1VA 4W5JA 2J1LA 2JLXA 4EAQA 4B3ML 5JBQA 3ZS9A 2BMEA 1AGPA 1AZTA 2HV8A 1A2BA 2WPDA 4GOPC 2JA5H 1R0ZA 4AKGA 1O3YA 1OHHA 5LMNW 3VKHA 1FFHA 2HEIA 4EUNA 4DV2L 4EDHA 4DR6L 1X54A 4YY3L 3CH4B 3CPJB 4GNXA 3VX4A 4EPWA 3ICQB 2JA9A 3NHBA 621PA 2VQFL 4TKOB 2P67A 5CM8B 4DR7Q 2JGNA 3LY5A 4TYWA 3GTKH 3TVTA 1ZUNB 2QGZA 3I55A 1E2PA 4DR4L 3AUYA 4M0LA 5J4KA 1FVIA 5GJBA 5IWAL 1K9MC 2B7BA 3K70C 2JCSA 3FGNA 2AUJD 3NEMA 5J4VA 2CL7X 2XB4A 1PH2A 1QUQB 3H15A 3RS2A 2OESA 2W0SA 4QBGB 5IT9c 2RB4A 4DAMA 4KBFA 5K8TA 4R4CA 1T91A 3I8XA 1KDTA 4BFZA 4BE7B 1X56A 1SFOH 2FOLA 5FOSA 2BEJA 2EWWA 4JVMA 4URZR 1E32A 1U99A 3HOUG 3PUZA 1Z6YA 2ATXA 3J81k 1SULA 3MGCA 3S1QH 2UU9L 1TXYA 3H0GH 1VIYA 1SKYB 1ZU4A 3QQ5A 2PNHA 1KKMA 1HH4A 5A35A 5BR8L 2OBMA 2QBYA 1UEIA 2J7KA 2HT6A 1GG2A 1EFUA 1SE8A 3G0HA 2N49A 4HDQB 1W7AA 1HT2E 5AUPB 4MKGA 4DV7L 1T0JB 4NCKA 3AF0A 1KRSA 2R7DA 4P4SB 3D8BA 4RCYA 4RD4A 3TE6A 4D4JA 1BOFA 5GJWC 4KFRA 1DO0A 4E03A 2OFOA 2EQSA 2XGTA 1W0KD 1ZU5A 4BA2I 521PA 3CPHA 4QM6A 2E2IH 1NSFA 3CF2A 3AKEA 4ZDKA 3GJ3A 1H8HA 1GILA 2R7ZG 4N1AA 4MKFA 5KDLA 3W34A 2DFNA 4C3ZA 2QN6A 1G8YA 2ZJ5A 1QVAA 2FSFA 3U4VA 4MTNA 1HZCA 1VG1A 1NMZA 3LO5A 4X8MA 1W36B 3EN2A 2JA5G 1II8B 3B9PA 2JLYA 2ZRMA 3RS5A 4JI0Q 2Q9AA 3KJEA 4WW0A 1GL7A 3WMGA 1ASYA 4PZZA 4AWXA 2L15A 4G01B 3Q7PA 2A2ZA 1G6PA 2RGBA 1X3EA 1Q3HA 4UY8C 2VHTA 1PUIA 4F93B 3MSXA 3EPJA 2XX3A 1KK1A 4LJ5A 4TMKA 1TAGA 2IHBA 1KI8A 2NVQH 3P1JA 3PG5A 4PC6A 5JI2E 4MRNA 1KSGA 1NP6A 1WF3A 4KITB 4CT5A 3SE0A 1VQCA 2YC2C 2ZU6A 3LBIA 1A7JA 4Q9IA 1E4VA 5JRJA 3CD6A 5SZKB 4A0HA 2ZXUA 1T8UA 2GESA 3FDIA 1G5RA 2XZLA 2XOKD 1XTRA 1RFLA 5FPYA 3PO3H 3A0JA 3EZ6A 2EJMA 2AXNA 3H84A 2BM1A 1CEEA 3BIFA 1PV4A 4PC7A 4TMTA 2ODWA 1E1QA 3FE2A 4Q1EA 4TLDA 5FPHA 5GJCA 3WBJA 4EPTA 4TYPA 1OH7A 1EESA 4DUZQ 3ADCA 5AJ3Q 2A3RA 1P2SA 4GT1A 4DSUA 1IW7C 2WFWA 3T1YQ 1AKYA 2IS4A 2CKZB 4PZ6A 4ZI3A 2RCNA 1HNXQ 1YR7A 4Y0VA 3BU2A 1YJ9A 2E9SA 2F7SA 2Q2HA 3TS0A 2B8WA 4NHOA 1X3GA 1DAHA 3DKVA 4LF8L 5ELNA 4GOXA 2ZTDA 3ER0A 4GOJA 1P9WA 3EIVA 1E0JA 1G20E 1M6NA 2JJ2D 2JLSA 3HPRA 1PH8A 4TWZA 4DXAA 2JA6H 4C3HH 5C44G 3HU3A 3QF4B 2VH5R 3A37A 4NH0A 4KU4A 2AKWB 2QY9A 3BRWD 1AS3A 3A58B 2PH1A 1Z63A 3M4YA 1G1MA 3NDBB 2N78A 3OW2A 1XFAA 4OO1H 1WYDA 3RRNA 3ICEA 1Z6AA 4HUQA 3J81i 4A6XA 2WWIA 1DBSA 1TMKA 1XTDA 5BYJA 3THWA 2R2AA 3K0SA 3A74A 1YHQA 1IBKQ 1XXHA 2Q9BA 1GRQA 2PCFB 1F3OA 4PPFA 3SI7A 3U6KA 3AH8A 4ZKDA 1P3JA 1LTQA 3ZZUA 1OT3A 3X1XA 2Q2IA 1C9OA 2EVWX 1FJGQ 3AEZA 3FYHA 3VKGA 1EFRA 1XNRL 3R8CA 3W9YA 4IOCA 2UUAQ 1AS0A 2Q6TA 3JAMc 2NZ8A 4K46A 3ND8A 2K5HA 4KLNA 1VG8A 1Q81C 1CKEA 3AV0B 3HYRA 3H3VH 1VECA 2I4IA 2YWFA 2MFIA 1Y63A 5IE8A 5C0XJ 2FF7A 2JATA 3FFAA 1EWHA 3F2DA 4NE2A 3U3RA 4GDFA 3VU9A 1B8AA 1QVRA 2ZRJA 3U7EB 4DNTB 3F2CA 3IQWA 3PENA 1T3SA 3B6YA 4QBIA 1J6QA 2A5YB 3VFDA 3FWYA 2IHYA 2ZRGA 1H9RA 1AZSC 3G5UA 4JBXA 2G77B 2PJZA 2RGCA 1G21E 3FHTA 3NENA 5IP9H 1VQPA 1EXMA 1Z6XA 3FHWA 3RS4A 3NBHB 1M7BA 5EZ6B 4I7ZC 4Q00A 1CR1A 3OZXA 1XCGB 2X77A 4KFUA 1OH6A 2C2HA 2OM2A 1KI2A 5C4XG 4HAVA 1PLKA 1KGDA 3VKWA 4ARZB 8OHMA 1G6OA 4DR1L 1KRTA 3TEHB 1Z0KA 2B7CA 3ADKA 1F6BA 5DI3A 4CDGA 3R8FA 3K0FA 3WNCA 4DR5L 2GCOA 5JRZA 3I2ZA 4AQYQ 1A82A 1B7YB 1EUJA 2ZE7A 4DLZA 3NXSA 2PMKA 2FPMA 2IX1A 2VNUD 4DLVA 1GRRA 2IYRA 1H9SA 2VZAA 3W5OA 3MWYW 1CR0A 3FHOA 3NVAA 1VF5C 1N0VC 3KXLA 3OEHA 1UEJA 2AKAB 1P5ZB 3O8RA 5D3MA 3U4ZA 4OHZA 4AH6A 5FBRB 2IUTA 2UUCQ 2WMNB 1NTGA 1SROA 3FTQA 1F5NA 3GEIA 2ANCA 2V9PA 1YNXA 4WAUA 1AS2A 2D2EA 4R7ZA 1G9XA 2IA5A 4BPBA 2FV8A 1R0XA 5DHFA 1OB5A 4OX9L 2J0QA 2CQOA 2VL6A 1EIYB 3TREA 5TV2A 4B3BA 5BXQC 5KPJA 3LNCA 4QJ5A 3HKSA 4UP9A 3KDFB 4Q9JA 2WBLC 4UKDA 1UFQA 1PFSA 1E9RA 4B33A 3AP2A 3ND9A 3KQHA 4Y52H 2ZT9C 4L4UA 3BXZA 2CE7A 1FZQA 5GROA 3T61A 4JV5Q 2D62A 2DHRA 4AG5A 2RAPA 4YC7A 4BXXG 1OE0A 5JZVA 2BCJQ 1ZIOA 5JJLA 4LPSA 4DUGD 4GS3A 1FR3A 3LNNA 3B78A 5B64A 4RFSB 4DV6Q 1DVRA 5CK4A 3CCVA 2K75A 2DFTA 3EG5A 3I32A 2GDJA 3WNDA 1KDRA 3I4MH 1DE0A 1KI3A 3RS0A 1CXZA 4PV1C 4DDUA 3CCEA 1VQOA 2O5VA 4C0AC 4X8HA 1UEBA 2ID0A 3GLIA 1N33L 4X64L 3L0SA 4BEBA 4R4TA 5M5WH 2BVNA 2IF2A 2CLCX 1QZGA 5GAGC 2A19A 1BIFA 1X1SA 2OAQ1 2IX3A 3E5HA 1MJCA 3TRFA 1ZD8A 1VCNA 3BOSA 3QE0A 4CVNA 2NTYC 1QF9A 2F1HA 3I5YA 3H0KA 4GSYA 3HOXH 5FJ8H 1K83H 4EPXA 4IPDA 1QG2A 2E5LL 4V0LA 1TWGH 1P9NA 2PPBC 1VQBA 3A1VA 2Z0SA 4M1SA 5FPSA 1FP6A 4B44A 1Z07A 2XZPA 1W0JA 5FFMA 2WWYA 3X1WA 1E22A 1FQJA 5HGQA 1N6RA 2DBYA 4P3YA 5IT5A 1H95A 4AYBG 4Q47A 4H02A 4LF6L 1PZNA 3GDEA 4C3IH 5E7JA 1JJCB 1YI2A 2YC4C 2OAP1 1SVSA 1GKIA 2IYTA 3EC1A 5AJWA 1VMAA 1G7SA 3K0XA 3K0AB 1XCPA 2DFLA 2FGKA 2O8EA 1KI4A 1QHIA 4L9SA 1GDDA 2VF8A 2Y0SG 2GXSA 3I4NH 3BGWA 5F9HA 2NN6H 1KIXA 2HUPA 4D4MA 2QAGC 1AM4D 4DV5Q 2HCBA 1I94Q 3S2HH 1YRBA 2Z4SA 2ZJOA 3B13B 3KKOA 4WVFA 4O3MA 5EE3A 1S0UA 2C9OA 4Q7LA 4RVCA 4A0GA 4DLYA 2VQEL 2BWJA 2R6DA 2R9VA 3K7UC 4OWTB 1JAIA 3RAPR 2B92A 2D3WA 4XOIA 1UE1A 5FTJA 4A93G 2OT3B 3T5DA 1U0HC 3AF3A 1CTQA 3I4MG 2QEQA 2XTNA 4YMUA 3ONWA 4JJZA 1K8RA 1KNXA 1YZLA 3ADBA 3TW8B 721PA 4A3JG 4F91B 2QMUA 4Q7KA 1G3RA 5HCIA 2R93H 5C0XI 3KB1A 3T53B 4D4KA 4FN5A 2FJUA 4RFVA 3S1AA 3HPQA 3QNUA 3LDAA 3KQKA 1U98A 3ZDQA 2R44A 2F3RA 1VQ9A 1ZINA 3DPUA 3DZDA 1FPMA 3E70C 4LJAA 3CF6R 4DZZA 1FP7A 1O7LA 1XD8A 2J0UB 1N34Q 3JZAA 4I4LA 3G4SA 4C3JH 5GVRA 3OIUA 1U90A 1IYVA 1VQJA 4IDQA 5IDVA 3SYKA 3AQQA 1EFWA 2F3IA 3K9LA 3SHFA 3HJNA 1ZM9A 4DT1A 4NZYA 4TL9A 5E7MA 2WPDD 1TTTA 4NPHA 3KF6A 2KCMA 4DNRB 4A3CG 3NELA 5K8IA 1OTCA 2ZE8A 2H5EA 5KDDA 4M9ZA 4LHXA 2FFBA 2ZJRA 3VDYA 4OQFA 1VQ4A 1GL6A 3RZOH 3KKQA 5HZKA 4C2TA 1G3QA 1XRJA 2WAYA 1KSHA 4DLTA 2IW3A 1R10A 3CRRA 2FSIA 4A3MH 1BH2A 4TMVA 1QZXA 4U02A 2GJKA 2WSMA 1Q1BA 1Y8NB 1GNQA 1YIJA 1VCMA 1A5TA 3CC4A 2O8CB 5KSYA 1AN0A 2GJAA 2ZM6Q 1NJIC 2ZRBA 2PT7A 1HNZQ 4HYYA 4AC9A 4ZV4A 1PLLA 4YMSA 1EOVA 1SVMA 3T34A 3HU2A 3A1TA 1ZVQA 5JECA 2YWEA 5FBLB 1JJVA 3QVUA 4FWIB 1NL3A 3DOEA 1A0IA 4QGAA 4A9AA 4F4IA 1PVOA 1ODFA 5B30A 2E75C 1S72A 1ESNA 4YHHL 1H65A 2XOKA 5C4JH 3F0TA 2R6AA 4DNIA 4HJAA 1S9DA 4CT4B 4LFBL 1EX7A 1OYYA 3IILA 1YZNA 3FKIH 2A6ED 4IPGA 4JVNA 2QAJA 2NPFA 1BBUA 4LRWA 4DUYQ 3MCAA 2GZDA 3J7A5 2E8GA 3LBHA 1N6NA 5FTKA 2UXDQ 2QROA 1IBML 3RNLA 1XEXB 1R5NA 2ZITA 5LMUQ 2AX4A 3TQFA 2CCKA 3EAQA 4RMFA 3KXIA 1C9KA 4DKAC 4MRPA 2WIBA 2KCTA 3AEVA 2HIXA 3R7WB 2CWPA 1UBEA 3ZZTA 4LK2A 5F3WB 1J99A 4NDZA 3L7ZC 4AIMA 1Z28A 2BE5D 4LBWA 1HQCA 4A3EH 4X62Q 1K6MA 2FZ4A 2OG2A 1JI0A 1W2GA 1X8JA 3A7AB 1H9JA 1OIXA 4JJKA 4S35A 1R7RA 1KDPA 3K9HA 3OESA 4GLVB 2JEBI 5BQ5A 5JSZA 3THYB 1Q1ZA 1JMCA 4MUAA 5FBQB 2BV3A 2FWRA 3C16C 4IFDJ 3CONA 2QM8A 3UG6A 4P0TA 1HZ9A 1XPOA 4TMZA 3WNBA 1WCMG 3VR6A 2FGJA 4C7OB 2GK7A 3RANA 4LYFA 1T8TA 4JI1Q 2J59A 2J7PD 1UAAA 3KKPA 4QJFA 4NXNQ 4OHVA 4E5UA 1YZTA 2ZRAA 1U9IA 4HIKA 3GTJH 1AQUA 1T5IA 2ZUCA 3TGPA 3B1XA 1E2LA 4PSAA 1YITA 4DV3Q 3PCRB 4Q4AA 4A82A 5FUVA 3D3QA 1QBKC 2Z6KC 3CF0A 1E3PA 2B8TA 2VPPA 4B6FA 3NTUA 3U60B 4WZ6A 1R5OA 3CRW1 2XEXA 4DB4A 1C0AA 1J70A 4HDOB 1RIFA 3PUWA 1W4CA 5DLQE 3BB1A 4DVGA 3R9XA 1M1YE 1E1QD 1MV5A 2Q2UA 2RGEA 3JVVA 4BFTA 1RRCA 1GSIA 4G7HC 2NOAA 5GAEC 1F2TB 2V1XA 4RSGA 1G18A 4JI7L 2SHKA 5C4MA 1Y8PB 3FKIG 1Y1WH 4JBJA 1NNEA 4BY7G 3BBPA 4HEJA 1XTQA 1Q22A 1QHGA 1Z2CA 2AFHE 3TS2A 3QXJA 1EIFA 2CMKA 4BY1H 4YMWA 1Z0AA 2QMHA 4HB2A 4LDJA 2AWOA 1SLJA 2IS1A 2WWHA 3OFND 4DHEA 1NKTA 4KV9A 2Z5FA 6Q21A 3DZ8A 2KHJA 1R6BX 2FEOA 2QP9X 2QTVB 5C3EG 3CRVA 4W7SA 1P6XA 2IK8A 1GNPA 4HAUA 4JL8A 4H13C 4US0R 4A3EG 4GNXB 3QKSA 1YEZA 4URXR 2G0NA 4Q1BA 3RS7A 2ONKA 1KSFX 4NKRA 3WDNA 2BH8A 4FCVA 4IFEA 1W44A 1G8HA 2I1QA 1Y8OB 5ANRB 1EQQA 1YHNA 4NL4H 3IRBA 3Q8XB 4AIIA 1L4YA 3V4FA 3RLOA 4Q03A 3PEUA 2ZREA 1US8A 2ZJ2A 2YOGA 2I5MX 1NMFA 3QXSA 4HJ8A 1MABA 4B2LA 4IO9A 2H18A 3BFXA 2MO1A 2O8BA 2A6HC 3F5FA 1Y1VG 2PQAA 1QRAA 1CKMA 4C30A 1D8TA 1VF7A 2Q3HA 3SZRA 4FI3C 3VR4A 2MMGA 3TUJC 3FMPB 2OCAA 3N5CA 4URYR 3J7ZC 3DLLA 4XIGS 1N3BA 3KFXA 4F4CA 5DH9A 3PV0A 3U7FB 2QNRA 2QBYB 2V6IA 2YKGA 3AF4A 3CLVA 4CRWB 4JCVE 2W2VA 3U44A 2H1LA 4YLGA 5EQTA 1JB1A 2EXDA 1Y69U 4DK6C 3U9SA 1ZM3A 3NC1C 1L1OA 2BBOA 4PO8A 1DAFA 4BLQA 4AY2A 4M1MA 1V9PA 3ZVNA 1FL9A 2I5LX 3A8IE 1PH9A 2ZR0A 4UXJA 5IYDH 1AQYA 2R8RA 4X65Q 1SHZA 4PQRA 4DUGA 1V8QA 4Q02A 3LWNA 2XJ9A 4D0LB 3I72A 3VX3A 1PH7A 1BMFA 5C0XG 5AJXA 5DYGA 3GO5A 4JI0L 4Q1AA 4U7DA 3SJCA 2K7VA 2HJGA 3MWKA 1G3IA 2MSEB 3T1QA 1E2WA 1ZJ6A 2REOA 4FMDB 3MXNB 4MNOA 5G40A 1HE8B 1QHYA 3BD9A 3EX7C 3GLHB 2QT0A 4KCGA 3K70D 5KNCA 1H8ED 4NU0A 4JLOA 2V7QD 3PQCA 4O25A 3OTOQ 1TQ4A 3VNUA 3QKRA 2JDID 3AF1A 1KI1A 4YCUA 3A8JE 2VSOA 4D0NA 4IOAA 3CPFA 1JJ7A 1SVOA 1OPXA 3L0PA 5FTMA 3I92A 2J3EA 2CK3A 4TLAA 1H9MA 2KBFA 4ACAA 1M7HA 1DG3A 4XVRA 1WFQA 1NVXQ 3TMKA 4BLOA 1KD1C 4F4JA 4ZIRB 2AD5A 3PEVA 3WMEA 1Z3IX 4PZLA 1BYUA 4C9BA 3GEEA 4RZ3A 2CVHA 1XMQQ 3P27A 4GZLA 3T1YL 1JNYA 2KB0A 1N6HA 4BFYA 2OXRA 3KDSE 4L5QA 2FDCA 3MXUA 4Q9KA 5KSZA 1HNXL 3N70A 3LV8A 5AUQA 2GILA 4V0MA 1D5CA 2PMZE 2YTVA 1XPUA 1FOEB 1OIWA 2ZE6A 1LB1B 3OF5A 3T12A 3STBD 3AP1A 3GLFB 2ZE5A 2UZ3A 1GWNA 1S9HA 2XGJA 1FYCA 1W46A 4IFDI 1ESMA 1UE5A 4HAXA 4TLCA 2C98A 2VHUA 1BYIA 4URWR 2Q8IB 1UWVA 3GLHE 1NF3A 2E74C 1B0UA 4IOLA 4TMXA 1ZYRC 1DAKA 3F8TA 3LBNA 4P71A 3U3MA 4IOJA 2PZGA 2GN5A 1LW7A 4QBHA 3QENA 3HOUH 3WRXC 2EJFC 1FX0A 1ZBDA 3FPAA 2Q0HA 1MKHA 3K0CC 3VR2A 2J9RA 2RGNC 4BASA 1ZD9A 2CE2X 1JQJC 3MUFA 3UATA 3TKLA 3LQQA 1KAWA 1FNNA 2FPKA 4LX0A 4KFTA 3TAUA 3W1GA 2OTLA 2WWXA 1VQ7A 3P4YA 4FW9A 4HUQB 3RC3A 2QPTA 4NYMQ 3OAAA 1NKSA 5F2EA 5HKKA 4UNRA 1Z6HA 1Z5ZA 1E2ZA 2OLJA 5J4LA 2D7CA 1FJGL 3THWB 5EJEA 1XXHB 2HF8A 3KZ1E 4KO8A 5GJVC 4TZ6A 2VHJA 4Z54A 1Q7YC 5BW8A 2W2XA 1XD2A 1HZAA 2Z4RA 2ZSBA 3SFVA 1D2MA 3QKTA 1O78A 3W8NA 4HLQB 5HPYB 2R7ZH 5BN4A 3FP9A 1N32Q 1GZSA 1OSNA 3ASYA 4QIWE 5C46F 2KSQA 2BDTA 4FD2A 3N6RA 5H70A 5M04A 5E3HA 1KY3A 3TUZC 1WI5A 1GP2A 1Z47A 4FCTA 2DWOA 4Z8YA 3BG3A 3JVUA 3GLFE 3LWUA 1IW7D 2O8FA 3BDOA 1KAGA 2GBLC 2ATWA 1IBLL 4QBFA 3VU9B 1Z0FA 5HR5A 1K0RA 3OIVA 2ZIAA 2OQKA 4H1VA 3W6NA 4E09A 2VUMG 1G3UA 5CYOA 4JOIA 4CZ2A 3T1HQ 1CF4A 3GTOH 4F7WA 2DPXA 1HE1C 1WE2A 4KKSA 1HR0Q 3ZLJA 1E2QA 1P62B 2BKUA 4B3XA 5JEEA 1W2BA 4C0SA 2KHIA 1XTKA 1I50H 2VHQA 4A8JA 1TF7A 2ZVPX 1ONBA 4LWZA 2GJSA 4WZBE 1MOZA 2QMOA 1Q1QA 4AQYL 5CIQA 1GVNB 2IUSA 4GMXA 4NYIR 3B1YA 3U4QB 3IIKA 4R98A 4EFLA 1U2RA 2JIZD 1X1RA 4BBRH 3GTQH 4HI0E 3DXJC 3HOVG 2HXSA 1ZNYA 1KJWA 4HAZA 1J2JA 1XXHE 5TY0A 5JJIA 2XSZA 3K0FB 4PAOA 3TJZA 2GCOB 1XBTA 1UKVY 2O0KA 2ZSDA 4Q19A 5IP7G 2ASBA 4ILEA 4B35A 4GRAA 4QXAA 4LYHA 121PA 1RRGA 4EJSA 4UPAA 2X19A 2RHSB 5FLXc 4QGUA 1H9SB 2EFGA 2VP0A 1YJ5A 1TU2B 2JA8G 2DNCA 1C7YA 3BS4A 3O8BA 5D3MB 1YZGA 2GF9A 2GZAA 3OYYA 3VQTA 2YWHA 3HOYG 4APVA 4QQBX 2ZEJA 4V0NA 4BFXA 4D6PA 3HOZG 2YWGA 4MITA 3QBTA 2BH2A 1XU4A 4IFBA 1SMXA 3RWMB 1UE6A 1SXJA 4LF4Q 2REBA 3KFUA 1GOTA 3CW2C 1N2CE 1JR3D 2ZRFA 5C44H 4M53A 3D6TB 3KJGA 2XTIA 3TBKA 4A2QA 4LFCQ 4XWKA 5JHGB 3J81c 4JV5L 1SVKA 1T0HB 4D26A 1C1YA 4E22A 2AHOA 3U2QA 4LF7Q 4IQZA 3KJOA 4DR2L 1PLJA 4LV8B 4L8JA 4GLAC 1OXUA 5M5YH 2GEDA 3HGBA 3K09A 3AVPA 5C1BA 3FPPA 1NG1A 2JQOA 1HZBA 1TWHH 3IFTA 3LVQE 4LJ6A 3KOJA 2NPIA 4PZYA 4RJLA 4PHGA 1S40A 3KQLA 2ZAMA 3GTPH 3K1JA 3TW4A 1W36C 4LW1A 2EW1A 2NG1A 4TT3A 4C0HA 3AKCA 2B29A 1Q1EA 2IY5B 4NYJR 3ZIAA 1ZCBA 4AK9A 4JI5L 1TEVA 4OQLA 1S96A 1EG7A 1G4UR 2J7PA 4Q4JA 2JA7G 3GD7A 1SKYE 1NJGA 5LMNQ 4PXAA 1GKUB 2ONJA 4BLSA 5FR1A 4FWTA 5L3RA 1JPJA 3ASZA 2A68D 1KI9A 4A3GG 3B8HA 3QI2A 1TWFH 5E95A 5IK2A 3AYHB 5JFGA 4S2EA 2D4HA 2XTZA 3LFUA 1YE8A 4ZCMA 3GLIB 4E07A 1E24A 4BBRG 1DAMA 3EARA 4IJMA 1CTMA 1UJ2A 4LUOA 2GVZC 4TLEA 2F9LA 5H1SE 3V9PA 1H9KA 1VQDA 1WJJA 1CIPA 4CEIA 4ASUA 4B6EA 1UDWA 1SRUA 3KUDA 4BECA 2A5GA 1M1KC 3FKSD 3IGFA 1VQMA 2ZI7A 1HQYE 3B85A 1QHHA 4HATA 4R4QA 2G88A 3DM9B 1E2MA 1L7VC 2YOFA 2IYSA 2P65A 4W5HA 1TU3A 2VP9A 3A4NA 2GNOA 1SKQA 1ZC4A 2AK2A 2F4VQ 2WAQG 2Q3FA 3NBZC 1E0SA 4GMDA 4ZO4A 4JMPA 4PPGA 1E2JA 3TQYA 2J5XA 5C4XH 3IDQA 2GCPA 5HCNA 4M22A 1B70B 4AYBE 4LFAL 2VLIA 3OFNA 4OKSA 2WB1G 3KB2A 4IEEA 4A4DA 1D9ZA 1P73A 3D31A 2HHHQ 4M9SA 3BZKA 2ZR9A 4JI8Q 4MGIR 2RGXA 2L5TA 4MYHA 5DI9A 1ZD1A 1E2VA 1JXMA 4MGYR 4DV4Q 2C9YA 2QMEA 1N6PA 3BORA 4NMMA 5TVKA 2O8EB 4B3GA 2MMCA 3DOFA 3PUXA 3NWJA 3Q5DA 3BK7A 4L15A 4URVR 2Y0SE 2ZSEA 3EC2A 3DVLA 3AGQA 4LF5L 1VG0B 3T51B 4JI3Q 2AL7A 4G5SA 4TTPA 4C0QC 1BKBA 1K73C 2GEVA 3GLIE
chains in the Genus database with same CATH superfamily
3OA0A 4NBLA 1K88A 3OZVA 2I33A 3CZQA 1DUSA 2E7ZA 4YCVA 1DTSA 2R7MA 1NBEA 3S2GA 1J0EA 2YFKA 5D8DA 2OE2A 2GTHA 3VHQA 2E4AA 3DZCA 3CWQA 1UDBA 3AUJB 5CVTA 1ZUD1 3COSA 2RGGA 5SYAA 3O8OA 2HCFA 4Q18A 4XGNA 1Z82A 1NXPA 1ESFA 1AZQA 3B3FA 1Y80A 3IHLA 2TRSB 1ESEA 1VE7A 1UEXC 3AILA 3IPXA 4D9JA 1DFIA 1XI2A 3STXA 3BTSA 5EIEA 1T35A 2UYQA 4X84A 1WY5A 2EKPA 4IDOA 1R88A 5B2ZA 5DBGA 2OCDA 1E4YA 3VR1A 3KQSA 4RA6B 2V65A 4IKOA 1V3TA 4KN4C 4NP5A 3V46A 1KDCA 4RPLA 2BFAA 3F5SA 1KH3A 1KVQA 2YJ3A 5FL3A 1QIJA 4MCHA 1YB1A 3D7KA 4H0FA 1P2TA 2DEUA 4UBKA 1J4AA 3GJ4A 3UMSA 1M83A 3AEYA 3HDVA 4LQLA 4L78A 4F45A 1TQ8A 5IM5A 1UK9A 4V1CA 4DV3L 4L6AA 3N7TA 1XC7A 3UMFA 4KXFB 1K8AC 4PZ7A 5DU2A 3UK1A 3WAGA 1T3LA 2CWAA 1MF7A 4DCVA 5CG1A 3L7KA 3BXHA 3F67A 3MS7A 4MW9A 2BFDB 1JU9A 1P1JA 4TL7A 5IWAB 1I5EA 1Y4ZA 4MV6A 2IV7A 5KNLA 4KN7C 4PZ8A 2ATEA 2KBEA 4CPDA 5EXXA 5CFZA 3RGWS 1KYTA 4JUDX 3USZA 1XEWX 1NNSA 3C46A 4KIFA 1DCMA 4H31A 4ZK9B 1GD7A 4OGWA 3RAGA 1RQNA 1KFKB 1AE3A 4Y67A 4NK5A 2HMWA 4YXWA 2QF7A 4IPHA 1U2DA 3VAYA 4A2PA 5JCJD 2PGDA 1WCMH 4U6QA 4L6TB 1S5BD 4FHEA 5TDHA 3I9KA 4XE5A 3HY6A 1E1CB 1XDZA 1G0NA 3ET4A 2FFHA 1ISJA 4XUEA 1V9SA 4MVJP 4ZYSA 3QEJA 4E5KA 5JZMA 2X6LA 4B74A 4PGAA 3F97A 3COZA 4HDSB 4H9GA 4CKBA 3TM5A 3ZXIA 1H1DA 4QEKA 4LQ4A 3BEDA 2I46A 1E9FA 4PR0A 4IKEA 3QYPA 1MO4A 1ZIDA 2IXGA 4G26A 2NMVA 3SBDA 1YRQA 3CEMA 1CK4A 4DBLE 3VU1A 3SQWA 1PZXA 4HCJA 4E5PA 4GEGA 3CC7A 4P4GA 2WJJA 3DDZX 4I4TB 5DSXA 1JE0A 1ZRMA 4U3JA 4ZI7A 3AWDA 1TO2E 3MRTA 4JC0A 3SXUB 1LK0A 1RBYA 2AFIB 4TWIA 1NF9A 2ZWPA 3BYZA 3HR4A 4UZFA 2O8DA 1UJNA 1EH5A 4F2HA 4DR1B 3HRKA 2IELA 5AW6A 2R6FA 3H6KA 4ZTBA 3A1WA 1CUBA 4YMVA 2B8GA 5JAVA 4B3DA 1Q6ZA 3UIEA 3E9CA 4IXTA 5TQ0B 2QGNA 4NIMA 4HR7B 4L22A 3IA7A 3L49A 1OWOA 2VS1A 4IIFA 1QZUA 3G7SA 2AKEA 1Y3FE 4M8SA 1NVMB 1UAPA 5AVWA 2OHGA 2YRFA 4NARA 1CD5A 3UFXA 4YONB 2KWIA 3AESA 3KYCB 5JVDB 2JIOA 4Q39A 1BO6A 1G42A 4ERXA 1WBBA 3NAMA 4FTWA 1X9GA 4FGKA 1IOWA 2Z2KA 1E1TA 1JIJA 1Y3BE 1GQRA 5AKEA 1YGYA 3PHBE 3LCUA 2DFKB 1JZSA 1NRIA 3IIMA 5JEAG 4JW0A 4FGJA 1DAIA 4L5IA 5AVJA 1IBMQ 4OLBA 1GYPA 5DYWA 1YAHA 4NCNA 1GT6A 3KT3A 5L6MB 5JAMA 1STYA 4D98A 3FMIA 4B6GA 4RJTA 2AH5A 5KOHB 1TT5A 1EYZA 3I05A 3UUWA 4LSMA 4ZK2A 4JLBA 5IM4A 1RKBA 1FFEA 3HXLA 2IYUA 1U2GC 3KT0A 4A3GH 2H4ZA 4DIFA 4JKOA 2BJVA 3QRWA 4DNFA 1Q0SA 4GNKA 4R8KA 1MZVA 4MHSA 4OREX 1SU6A 5EXTA 4GPAA 1MGPA 1NLMA 3A04A 1VLMA 3ZCVA 4HV4A 1ACJA 2EFHB 3TW6A 1BS1A 3A6LA 2F0FA 4EG0A 4DAYB 4HN7A 5IIFA 4JD5A 3MJEA 5AJHA 5FPPA 1Q8KA 2O3SA 2QP4A 4HEA6 3KTAA 2IXFA 2R66A 3RHTA 2QRJA 4GLJA 1PRYA 1HCZA 1M54A 3KUUA 1YJAA 4OH1A 4PNHA 2O9JA 5MF6A 3JZMA 4RHCA 3BQ9A 4ZOBA 1X1QA 5TMBA 4BNJA 3GUUA 4PAMA 1S2OA 3H2GA 3GRRA 1A9RA 3RUZA 3I34X 1TAQA 2BBWA 1R0SA 4EQ6A 1J0BA 1UOPA 3GHYA 5IX8A 2NZ1D 2G8LA 2H9IA 3R5TA 3W2GA 4UW9A 4NAUA 1IJFA 2FAXA 2PO5A 1BO0A 4EKDA 2DWQA 2RDMA 4NB3A 4RULA 1DP4A 1Y1SA 1XLWA 4MVXA 5H9VA 3LLCA 2JGAA 5C4ZA 3Q3HA 1FMJA 1WUKS 1C1XB 3AB9A 3V8MA 1BQQT 2H31A 2UYCA 2AR9A 7REQA 4WA8A 1CR4A 1FRQA 1MQSA 4YCJA 4CR7A 3FJYA 1E69A 1QP4A 5CR3A 2OV2A 4QVKA 4OJTA 1CB0A 4BFVA 3WL7A 5EAYA 2QRQA 1RCUA 3IRUA 3WWDA 4HFJA 4YPVA 2AD1A 1WXIA 4RGVA 4G81A 4WCFA 1V7CA 4IEIA 4MPPA 1Z35A 5CEJA 4JI1L 4BCCA 5AK3A 3IEUA 1B93A 1X74A 1P4SA 4TUYB 5CC4A 3AGPA 4M0EA 3VOSA 2B63H 4CM7A 5KYIA 3IV9A 2Z56A 2I8LA 1Z68A 3RRMA 3T1VA 1I3QB 2AB0A 3OU7A 1ZD2P 3TFQA 5LQDA 3AVTA 2R11A 2F8SA 1NNI1 1I7PA 3FCAA 4R4OA 4TV9F 4Q3NA 1V4VA 2JJQA 4R68A 4PFSA 3RIMA 1S2DA 4S1WA 3VA7A 2V5VA 3GEPA 4HN2A 4KH1A 1EZ1A 2QW8A 2PUCA 1UJCA 1CUVA 4LFAQ 1P0IA 2Y6UA 3FIUA 2NZJA 2PRKA 4OI4A 4XM1A 2Q5EA 3JAWB 5KKNB 2V0GA 1GUFA 4PZCA 3BAFA 4KWEA 2NO6A 4MUFA 4F8EA 1JQYD 2BL4A 4RCNA 4HAYA 1AKVA 1Y0BA 4QGGA 2HD3A 4PG3A 1W19A 1QDUA 4DLWA 1TMGE 1UPTA 2V7PA 3V4VB 4TTSA 1WZ2A 4OYRA 3FDJA 1S2IA 3R2JA 2J0EA 4QXQA 4BO7A 3FFXA 2L82A 2EGHA 3JQCA 4NI5A 1R6TA 1RQXA 3HRHA 4D80A 1XVVA 2FLKA 5FDFA 2CFIA 2WW8A 3CLSD 5J59A 1VKNA 3A7DA 5CDSA 4CQLB 3ABQB 1LFDB 5K4GA 1ZM7A 4U673 2X3UA 1PUXA 4JIMA 1KR5A 1F0KA 4WWHA 1EJ0A 4NULA 4XGQA 5G1OA 2HC9A 5LHY1 1MD2D 3CF4A 1G9SA 4B47A 3RFCA 3D3WB 5LQNA 2ZR8A 1EDOA 4CQNA 4UFNA 1JNXX 1HORA 1UXOA 3KX2A 3M7NA 2P2SA 1DXYA 5CCEA 4KMUC 1MU0A 3HYCA 4BRUA 4FD3A 6REQB 2WJVA 2HWXA 1ECGA 2WV9A 3FBWA 4WGFA 1XCLA 3R23A 2DQYA 3OQNA 2J6HA 2R1UA 3SYTA 1Q0UA 3WB2A 5D7BA 2XGSA 3HRIA 1O7YA 1STGA 1E6MA 4QU5A 1GHJA 5IASA 3FMCA 1N2OA 5IYBG 3E5RA 1YDFA 3ICPA 2BHTA 1SGWA 2EXXA 2V1CC 2D0IA 5I7SA 3EVQA 1XQ6A 1I1HA 2W0MA 4ABTA 1B44D 4PXSA 1YDEA 1KDBA 1SXJC 2VUIB 1ELOA 3FB1A 1PQPA 3IDZA 1ISFA 3TCXB 3VSEA 4HWGA 2ZIEA 3IC5A 5GADl 2F0HA 5K6RA 2DJIA 4MWBA 1Y1WG 4ULLA 2JFOA 5DM1A 4AVYA 3R9WA 5EKLA 2IYXA 1Y9JA 1DQYA 3G6EA 3IE2A 2D06A 5J2TF 3CCQA 4QAQA 1KEVA 1BDHA 1BHSA 4YHHQ 2LKVA 4HIDA 3Q40A 3ZWYA 2C61A 4X85A 2ETXA 3GVXA 3SM3A 1IYUA 5AI0A 2YZNA 5F1YA 1GM5A 2ZTLA 4QDTA 4A3LH 3GGSA 4B3RB 4JUIA 4WTOA 3BFJA 1GR0A 4WPGA 5KVQA 5FOUA 3PO3B 2I4NA 4QNNA 3ZK9A 4Z4HA 4V24A 1LVGA 3LVBA 2OCIA 2YQZA 1KO1A 2V6JA 4OQMA 1BXKA 4JY7A 3KPWA 3MW8A 2JI8A 2ZI9A 2II6A 4PLHA 3U7GA 1T5EA 3EFXD 1O3YA 3L9XA 1FFHA 5E6RB 3T7DA 4RWSC 1VJ1A 1KQGA 1P5RA 5CM8B 3KLSX 4XCVA 2GOYA 4D5GA 4WI1A 1W6JA 2CMGA 2XB4A 1JUDA 3H15A 3QVMA 5K8TA 5CDYA 1MW8X 4W7HA 2EOTA 2DR0A 3E5SA 2UU9L 3G7UA 4EHNA 5EKUA 1HA6A 4RF5A 2R86A 2QBYA 5ARDA 1F9AA 3G1TA 4F46A 4R1QA 2CT8A 1XZMA 3TE6A 2R7DA 2BTQA 1DO0A 1S4MA 4GYYA 3DO8A 2EQSA 521PA 1NSFA 4AJIA 3OX3A 3QK7A 1CHNA 4U7PB 1WPGA 4Q82A 3DLHA 4KPYA 3J7YW 2OZLA 2JA5G 4WW0A 3WMGA 2O54A 5LC1A 1V4BA 4DXFA 1AQIA 1UMBA 4HYEA 4MRNA 5C1IA 4KITB 4AROA 3S7TA 3D2BA 1HTLD 4DJEC 1CDDA 5EJAA 1L5VA 4IIVA 3W7AA 3E4DA 1MNQA 3EE6A 3BIFA 4PC7A 1EESA 4C7VA 2WFWA 1CLEA 3P0RA 2RCNA 3OFSA 1AQ6A 3U9OA 1G20E 4DXAA 4OGKA 4RNDB 2B1GA 3ICVA 3MEQA 4OO1H 1DIGA 4DL9A 2R2AA 5AVZA 1WTPA 2PCFB 1FJGQ 4RCVA 5K9ZA 2APJA 1Q81C 2AJLI 1Y63A 3U3RA 4YJ2B 3ABRB 1RM4A 3ZU4A 1ADFA 5COBA 5ISRA 4YASA 3DAPA 4OF4A 4J0GA 3I58A 3OFJA 5LYJA 3NBHB 4KFUA 1XCGB 5ECYA 4FKBA 3PWSA 3OD5A 1PEDA 3LGSA 1DWOA 4CDGA 3R8FA 3WNCA 1EUJA 3TIIA 3O8RA 3KXLA 5T3UA 1LWNA 1LLUA 2CQOA 1SUEA 3LNCA 16PKA 4Q9JA 3HUDA 3C98A 4MV7A 1HTTA 1QDLB 1UBOS 4GSKA 1EZ8A 3JY6A 4ALKA 4OO3A 1ORVA 1PWZA 4ALLA 1KI3A 2O5VA 3D3JA 3UQZA 4JUBA 3TNDA 1NOJA 3S28A 3EXHA 4UULA 2IX3A 4YRIA 3UWSA 3G6KA 2NTYC 3OOSA 5EIXA 3A1VA 2Z0SA 2VRBA 4M1SA 1FQJA 1G8MA 1U31A 1S4ZA 3D3KA 1FDIA 4POOA 3KZVA 2O8EA 3GTJB 4WLNA 3OZ7A 5F9HA 2JGIA 2HCBA 2ZZKA 5BWOA 4AZ0B 3K1YA 4B7CA 3ES9A 5G3LD 2CF5A 4N8DA 3PT9A 4KRXA 2FDXA 4UEJA 5HCIA 1Z6ZA 5CXQA 4MR9A 3ZDQA 5IKMA 3ZPXA 2J0UB 4C3JH 4O29A 1IYVA 3HJNA 1ZM9A 4NPHA 3KF6A 1OTHA 4RETA 3RZOH 1KSHA 5CB0A 4WACA 4G0ZA 4TMVA 3SK0A 2DY7A 2GJKA 3CC4A 2BFMA 2ZRBA 1TMYA 3Q12A 1EOVA 3DBLB 5KINB 1ZVQA 2AE1A 3I1YA 1ESNA 4IN3A 3FZQA 1C7QA 5ALEA 4LFBL 4NHEA 5LLDA 2B69A 1DJPA 4FDLA 3R7WB 4Z53A 3L7ZC 3B36A 1PR1A 2YUTA 2Q3JA 1A9SA 2DETA 1D2CA 1V8DA 3DMFA 2WVGA 4N9QA 1LWOA 1EBFA 1QBKC 2XYGA 3ZHXA 4GOLD 2ATIA 1BBXC 3OM9A 1I7NA 3MCUA 4R1NA 6ADHA 2NP6A 1X7WA 4CHGA 2AFHE 2PZTA 1L6IA 2WUFA 2R60A 5CLGA 3RYIA 1KJ8A 4AIRA 1R6BX 4BO8A 4GNXB 4GI1A 1U7UA 1QAQA 1MO2A 1K7SN 1W44A 4ED9A 3GUZA 5BOSB 4EW2A 1I30A 4HJ8A 1WXDA 1DRKA 1JKIA 1J9GA 5EYPB 1ZH8A 3DP7A 1KY5A 4R8VA 2AZDA 3G79A 5JJ5A 1ZM3A 2V74B 1C14A 2C2OA 4M1MA 2R8RA 4YRGA 1P3Y1 4HK4A 4MWCA 4MN3A 2CW5A 5KNCA 3ILYA 4CM3A 4NOKA 3A3YA 3QLUA 4E1AA 1ZXXA 2V8BA 1ZEJA 2PH7A 3PEVA 4RZ3A 3TIVA 3F2IA 1HKHA 4Q9KA 2BGGA 1KU6A 5K5PA 1KEPA 3VDQA 1FYCA 3EJIA 4KNVA 1D3AA 4AUKA 5JZ9A 2CEKA 2VQEB 4MVJA 1HUMA 3JQAB 3DF9A 3TLYA 2P9GA 3D1VA 5A9TA 4EHAA 5HKKA 3N6VA 1Z5ZA 1PL6A 1UBSB 1GZSA 3ORFA 5C46F 3O8LA 1EUCB 1NXTA 2XSCA 4NNPA 3BDOA 2OQKA 1N2CB 3QEKA 4I9GA 4O3FA 4W6ZA 4B3XA 1VMKA 3J7AC 3V32A 2HL6A 1T3ZA 2KYRA 1RS0A 4JU8A 1PR4A 2ETVA 1G38A 4RWZA 1JTEA 2BDUA 1IQ0A 1FYVA 2CVOA 3IE1A 4LGVA 4G5YA 3VQTA 4DJDC 2DWUA 4UCXA 1R37A 5THKA 3DGFC 4D26A 1SVKA 2FOIA 3OIGA 4L8JA 1TEZA 3KOYA 1EFLA 4QF4A 3ZDDA 4PHGA 2QW0X 3KQLA 3AYXB 4TROA 3W0LB 3B53X 1RCFA 2BHLA 3GXBA 4KGVA 5FR1A 1JPJA 3ASZA 5CLFA 4FWTA 1QV9A 3WG9A 1YE8A 3RZDB 1E24A 4IJMA 5JT1A 3FIJA 3ZHRA 5F78A 1VQDA 1WJJA 3HVIA 1Q7RA 3T5TA 3KUDA 2AQIA 2G88A 3DM9B 3NNDA 2P65A 2X1HA 1KPHA 4GMDA 4A3JB 2J5XA 1R18A 1V96A 3SVMA 4NBKA 2YW2A 4FLEA 3CEAA 2J3IA 4B3GA 1ZIYA 3Q5DA 4L15A 4AO7A 4R01A 5D5QA 1N3LA 2OKGA 1ZHFA 5K6TA 1E1DA 1BAPA 1ZCAA 2C57A 5LD2B 1P60A 1N1MA 3OZCA 3QEBZ 2NSDA 4BXXH 4EMUA 1KBOA 1FBNA 1YDGA 4OUDA 2V54A 2EKZA 4UNNA 2CWWA 1LM0A 4NE9A 4LHVA 4LJZC 2G3YA 3FGPA 2EJTA 1P4RA 5JNUA 3AJDA 1H8EA 1VP9A 2JANA 4N5MA 1UK6A 3E0QA 8LDHA 2VJLA 2WABA 3H5NA 1RQPA 4DRXB 1VPWA 4ZZ1A 5CLJA 2ZI4A 3UPDA 4RIHA 2NU8A 3NIBA 2P41A 3QLJA 4A6DA 1M76A 4AY3A 3LXXA 1X1DA 4JYCA 5ALHA 1MNAA 1OTYA 3ED1A 5FPQA 1E8DA 3S1RH 3INRA 4UMFA 3JTMA 1R64A 1J7KA 5KREA 2C4VA 1PMRA 3FNBA 1CSQA 1D5XC 4E5DA 4Y2QA 3A31A 5EE5B 5LB4A 3R5FA 5LSAA 1IATA 3TP8A 5IGEA 2W70A 2IEIA 1B41A 4L28A 4BP3A 4DOMA 2PI2E 3EYWA 5LIPA 3O8DA 3WLKX 3R9XB 4QWMA 3C3XA 4F04A 1EFHA 2H0QA 5BUZA 3D8HA 4X3PA 4KK4A 1P72A 3HL4A 3RYCA 1AC5A 2BRUA 4NBRA 2LDXA 4A36A 1XYYA 5IT0A 4BB0A 4LJ9A 1QH0A 4HLUC 3OJ0A 1VQ6A 5BR8B 4HX2A 4QRIA 4M0FA 2V7EA 2Z8YM 3K8AA 3QGMA 1DOHA 2O8BB 3TO5A 4RTKA 1U0JA 3BSWA 3L05A 3V1NA 1BKDR 1HE4A 5JYEA 4DM3A 4RM3A 3SS9X 5SZIA 2QZSA 4BLTA 2W6CX 4L5YA 2W4QA 1K0FA 3KF8B 1EE9A 1C8KA 2EF1A 2EYOA 5L95A 4Y1EA 1NBMD 1W88A 3H0CA 3DMHA 3D5TA 2BEVA 2G1KA 4L74A 1G8AA 2C3UA 4YDSA 3W9SA 5JPNC 2PUEA 1JOOA 3NAQA 3D9QX 3DMNA 2JLWA 2PW7A 1F8GA 1TVKB 3QQPA 3KPYA 2BDOA 1D4FA 5HK8A 3S29A 4JFRA 4ID3A 3JQEA 3HDYA 1TFRA 3TNFA 5JVDF 2NGRA 3ZIAD 1Y34E 4O0MA 2VUMB 3QWBA 3A27A 3IOBA 4I1OA 1Q92A 4MRMB 1M2VB 5IK2D 3REOA 3GPBA 1XO1A 5JMOA 3SPXA 3IFDA 1X8XA 1YRAA 5CA0F 1MD9A 1VQGA 4N5LA 2ZTSA 3RYFA 2CW0C 2SEBD 2G9NA 3GJ5A 1FS5A 3IUBA 3ILSA 2P2GA 5MN6A 3JC66 3AB3A 2QD5A 4RLFA 4FQ7A 4CN9A 1CUKA 2BP7B 5K8JB 3UXYA 1LABA 1ZDMA 1YBFA 5CB4A 3OTIA 4TZ0A 5A9SA 1CZUA 3P0JA 1JDZA 2Q7XA 2C1XA 1XRNA 4EJSB 1XZPA 2AFIE 1HRKA 4C6HA 1FQWA 2Q46A 4TSRA 1T0PA 1VE1A 1PJRA 4H4EA 3TSZA 1XTJA 3OTWA 2I65A 2O57A 5KGUA 1P4HA 4J1TC 4O1NA 1HNWQ 4FOLA 1XZGA 4MQBA 1P7ZA 1BDBA