3PUWA

Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
371
structure length
371
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of the maltose transporter during ATP hydrolysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/transport protein
molecule keywords Maltose-binding periplasmic protein
total genus 105
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3puwA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3puwA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3puwA01
3B85A 1KDOA 2RAPA 4TMKA 3NEYA 4JLNA 2ECKA 1DARA 4A93H 5E4FA 1FUKA 4DKAC 3CW2A 4GFDA 4DV0L 1H8ED 4B76A 3EPKA 3CF0A 1LFDB 1DAIA 4TL6A 5FI1B 4DR7Q 4XOIA 4DCTA 3S17H 2L5TA 2R44A 4PPQA 5IK2D 4JLBA 2K5UA 3A6PC 3AB3A 4KODA 3EBEA 4HSEA 1IW7D 4IPGA 4KJZA 3EZFA 4PC1A 4YONB 621PA 5KU1A 1XX6A 5L8VA 4DCUA 2O8BB 5FPSA 3EZ7A 2IWHA 5C0XJ 3B1XA 3Q8XB 1KJZA 2Q6TA 1R0YA 1CTQA 2FOLA 5TY0A 1UPTA 3UIEA 1JR3E 1KJYA 2GF0A 3CKLA 2QSZA 4DR5Q 4E5UA 4TT3D 2AKYA 2ZS9A 1A0IA 1FX0A 3FHWA 2IYQA 3GJ5A 1T3LA 2DNCA 1X3GA 3CH4B 4IKEA 5JEAJ 5C18A 1JEDA 1KI6B 1EFCA 1CUKA 3RN2A 2FPMA 2E2JH 1GD7A 1P72A 4GNXA 1TQ6A 4UNRA 4CEIA 2Q3HA 4JOIA 1W4BA 5KSOA 2FXQA 4QJFA 2JA7H 3L82B 4HUTA 1Z6TA 2CL6X 2VP9A 4Q4AB 3W1GA 1FTSA 3C41J 1II9A 4A76A 1SHZA 5HZHA 2JLQA 4L16A 4DEYA 1LUZA 1U8ZA 1UDWA 2Q9BA 3JAMi 1VQ7A 2BBSA 1HV8A 4TWZA 4DB2A 4X6AH 3M4YA 2GZHA 3NKVA 1UEBA 1IYUA 2O5IC 4NMMA 3VNUA 2VYFA 1N6RA 2JLRA 3EC1A 4MKGA 2P65A 4PAOA 4B33A 2D7CA 4C0HA 3H94A 4TTQA 2EVWX 3I4MG 4LC1A 1MT0A 2CVHA 2LWIA 2B63H 5HKKA 1ZYUA 1IN5A 1TF2A 1KI6A 2ODEA 3KKMA 4OK5A 5JECA 5CLQA 2JLVA 1NMZA 3U3OA 4AC9A 1FZQA 4GN3B 1TMKA 3J81i 1GTVA 1XEWY 4F4JA 1XTQA 2KBNA 3FKIG 2ZSDA 4GKJQ 3CLVA 3NDPA 3EPJA 4TYYA 3AEZA 3O47A 4W5WA 3QUSA 521PA 1ZC4A 4NTZA 3NBXX 4NE2A 2JLWA 4JYBA 2K50A 2AHOB 5FOVA 2QEQA 2VSXA 4ILEA 2J0QA 3C15C 2VO1A 2HYIC 4DLXA 5E7NA 3FKIH 1IM2A 4BFSA 4TL7A 2FWRA 3G6EA 1ZUNB 4EPWA 2J59A 2ZI6A 3MJHA 2ZJOA 1Z9FA 3U50C 1TKWB 5IYDH 1XU4A 3KB1A 2PT7A 3EIQA 1MJCA 3HOUG 2RMKA 1IBRA 1I4TD 3VFDA 4BQSA 3OF5A 3TH5A 2Q2TA 1ESMA 2E74C 3BBPA 4GSYA 4BY7H 1T5EA 4NYJQ 3V4FA 3EPHA 1T5IA 1EOVA 1W5SA 3BH6A 4DUGD 2AKWB 2AFIE 3BE4A 1ZM3A 3THYA 3PEVA 2J7KA 4XTCS 4YCWA 1YJNA 4V0NA 4P71A 3U3KA 3B5JA 1NVUQ 2Y0SE 2A3RA 4LHYA 3RRYA 3P1JA 4M2LA 2NG1A 4BGDA 3NEMA 3CXCA 1PH6A 2ZM5A 1CRPA 5M3MH 3GTJH 1AA9A 4C2TA 3I4MH 1MOZA 4B3TQ 3S1AB 1WBDA 3MMPA 4TL8A 4AYTA 4B3SQ 2AR7A 1I6VC 2UU9L 2BIFA 2GCPA 2BE5D 3ULJA 1DCZA 1VQAA 1GG2A 1BYIA 1NVWQ 4DR1Q 1TWHH 4TYPA 1M74A 4FMCB 2FN4A 4V0LA 1CLUA 4URYR 3BIFA 4IFDI 1K8AC 1SVLA 3CF6R 3SJZA 5GROA 5C0XG 4DPGA 4MTNA 1A63A 1A1VA 2O8EA 3WHKA 4P74A 1AGPA 1JNYA 4DR6Q 4CIDA 2CCZA 2HIXA 1Y8OB 1Y69U 3DM5A 4N0DA 4NU0A 3NC1C 1KDRA 4NL4H 1PMRA 3I4OA 2R9VA 1Q57A 3I8XA 4TMWA 4WZBE 4ARZA 2QMHA 3X1XA 2D2FA 1E24A 1N6LA 1CJVC 2NVYH 3WHLA 1OYWA 3DOEA 3RNUA 2YINC 1HTWA 2YVUA 1LW7A 2EWVA 3M7NA 3FMOB 1YVCA 2WTUA 3DL0A 1WRBA 4OHWA 4AQYQ 3QEJA 4IOMA 3KL4A 1XXHB 3QNUA 5FTNA 2QPTA 3B6YA 1P60A 2VHJA 1CJUC 4AKIA 2BKUA 3THXB 5JWRA 2WAYA 3OFNA 1GITA 4PO8A 4TYWA 4GDFA 3OEED 1KQSA 5JHGB 1KDPA 1SROA 3ULPA 3AVOA 4L15A 5KYKA 2YOHA 2VNUD 1JR3D 2AL7A 1U90A 4DLWA 3AUYA 5K36H 4YCUA 3UDXA 2AK3A 4XD7A 3LNCA 3CC4A 4LOAA 2HQLA 2VEDA 4B3DA 4JLDA 1DVRA 4JLOA 4XIGS 2D0PA 1KSGA 1BYUA 4A4IA 1C1YA 5FBLB 2C04A 1KI2A 4P73A 4IO9A 3QKTA 4DAMA 4LF7L 3KJPA 1XPOA 1OKKD 1FUUA 1QZXA 4MGKR 1RC8A 2KCMA 2IW3A 2C99A 4H1UA 2EXDA 4BLPA 2PNRC 2QL6A 2ZRFA 4JLMA 4JT4A 1K8RA 1CR1A 4DAYB 1ZMXA 2J3EA 1Z0JA 1ZM9A 2XSZA 3FKSD 4NPHA 1QZHA 2LKDA 4ACAA 1UE6A 2HIVA 1Q8KA 1E4VA 4DLUA 3NTUA 3UE0A 1HQYE 2GZAA 4P4TA 2A68D 4ALPA 3W3AA 2BE5C 4KMUC 3SDZA 4JI1Q 1XCGB 1XEFA 5JEAG 2CHGA 2CNWA 2PBRA 4PAMA 1E2WA 4RFSB 3BH7A 4D2IA 3IQWA 5TMPA 3SN6A 3U5ZB 2WP8J 3H3VI 3IIMA 1J5EL 1KO7A 1R8QA 4B48A 2I5HA 1C4OA 4URWR 5KPDA 1IN4A 2GJAA 1G8FA 4GZLA 4Q5IA 3KXLA 3QF7A 1Q3HA 1U9IA 4QBGB 3VTKA 1NIJA 4A3BH 1QG2A 4DUYL 4DNIA 1PH1A 1D2MA 2V8OA 1D7QA 2ZAMA 3GLHB 1VG0B 5GAGC 3QIAA 2CBZA 2CHVA 2J87A 4HJAA 2G0NA 1EQRA 2GBLC 3T34A 2WWYA 4TQUS 3HYRA 1YR9A 3C7KA 4JL5A 4UJ5A 4V0ME 2MMGA 4KFSA 4K81B 2YTVA 1EGAA 3ZLJA 2FFBA 1G7CA 2QORA 1DEKA 1XBTA 4KHPQ 5KDOA 1KI1A 2OQ0A 2VSOA 3CF2A 1HH4A 1SVSA 3TS0A 1Z6GA 1VQMA 2GNOA 3JZAA 4ARZB 2ZRNA 5AUQA 2IYLD 3SFVA 5IHPA 4A3IG 2W83A 3KZ1E 1GKUB 1QHHA 1YJ5A 2GCOB 2IY5B 3EA0A 3GJ7A 3W8RA 2IF2A 1JR3A 2ODWA 1HNZQ 1LF5A 3OIVA 5E3HA 2O8EB 1TWGH 2QAGB 3S2DH 3WWVA 3RLOA 4Z8XA 4OO1I 2MFIA 5AJ3Q 3U58A 2DWPA 3FMIA 2UUBQ 5FTJA 1E2FA 5HCNA 4A0GA 3NBHB 2DR3A 4A0RA 4LF8Q 2G1JA 1YRAA 3LA6A 2QT0A 4BRWA 4JVSB 4PC7A 4QRHA 4IDNA 3D4RA 5BW8A 4GLXA 3TGPA 2DFTA 3KYHC 1N6NA 3AVVA 5KNDA 4R2HA 4M8NE 3IPYA 3PUVA 4DSUA 3T15A 1HTPA 2P2LA 2ZS7A 2UXDL 2YWEA 3A1VA 2I3BA 5CB8A 4LJ7A 2WSSD 4OHZA 2J5XA 2IUUA 1VKJA 2MMCA 4DXAA 1YHAA 1GILA 1NIPA 4TLCA 4DSTA 4UJ3A 1Z0DA 1I4DD 1NNEA 3WNDA 2CCGA 4A0FA 1Q90A 2PEZA 1D2NA 1VG9B 5FUWA 1XCMA 4R4OA 3TKLA 4BEBA 1W4AA 3HU3A 4ZI2A 1NBMA 3T1OA 4Z51A 1FL0A 4BBRG 5L3SB 4JLPA 5D3MA 4KLKA 1TTTA 1HR0Q 1E1QD 1T5LA 3REFA 1GKHA 2EQBA 4HAYA 1VG8A 3KKNA 3QJYA 3RYTC 4DLZA 2YKGA 4BFVA 1B9MA 1D8TA 4P0TA 3K1JA 3BH0A 1EWRA 2FF7A 2VP0A 1WB9A 1A62A 5B30A 1S96A 1XMOQ 2ZI5A 1IJEA 2V6IA 1SXJE 3QKRA 4G5QA 2V7QD 5KUTA 2QY9A 3CH5A 2ZTCA 4X66L 1ASZA 1JT8A 3SHWA 3T5GA 1BKDR 2IX1A 5LMUQ 3PCRB 5CJ2A 3RS0A 4JBMA 3A1TA 3F8TA 3F0TA 2W6ID 4RY2A 2IK8A 2CEAA 4KSCA 1YBYA 3X1DA 2QSYA 3DVLA 1G8PA 3G4SA 1KSHA 4NXNQ 3QPWA 1FMJA 1C0AA 3OTOQ 2WKQA 3DDCA 4L9SA 3OHMA 3CCLA 1ZM4A 4LF6L 2GHIA 1M1KC 4FW9A 4EAQA 4LFAQ 3UDFA 1W36B 2JJ2A 2UUCL 1OB2A 1EWQA 4DR2L 4D4JA 4PXAA 2ZETA 1VECA 1VQ4A 3F2DA 2NVQH 2PJRA 3HOUH 3ZIAD 3TZUA 4A3FH 2RGXA 3LO5A 3B6EA 2WOOA 4K8OA 1CJMA 2Q9AA 5DE3A 1O87A 3SYKA 1FVIA 2ZYUX 3H4MA 2K75A 1EFTA 1F6BA 4G7ZC 3TEHB 1OW3B 3VKWA 2OSBA 1SVOA 1CKOA 2XTMA 2BMDA 5L3QB 4GNXB 4IPHA 4I7ZC 5C4GB 1VYUA 1VPLA 4ZDKA 1NMGA 2RKOA 2CKZB 4PC3A 5DNYB 4UKDA 5G41A 1DE0A 3T1YL 2IUSA 3BB4A 1CJTC 1DTSA 2D74A 4RD4A 2X2EA 3CCJA 1NG1A 3GEEA 2FSHA 4JS0A 2X1VA 1BDOA 1EX6A 1J7KA 2NZOA 1D6JA 4M1OA 3EWAA 3MXNB 4N3NA 5H1YA 3TIFA 2EFHB 1R5OA 2WM9B 2F4VQ 3THXA 2NQ2C 1X6OA 2QA5A 5DIFA 3TLXA 4E03A 1J90A 2E5LL 3E0EA 3PO2G 4RMFA 1B0UA 1R9TH 1XNQL 2G6BA 2X19A 4N1AA 4QGGA 4H44C 2RCNA 3QXJA 2REOA 3MFYA 2IXGA 1XTRA 4X8HA 2SHKA 3RWOA 4A9AA 4B75A 3SJBA 4HDCA 1VQ9A 3FB4A 2UUAL 4GOPA 1VQOA 3IUYA 3TR0A 2VQFL 4JBWA 4OQFA 3A5ZB 1S4QA 4Z54A 1SKYB 3OPOA 4Q18A 4DV3Q 2FPKA 2L0XA 4R4TA 5ELNA 1CJKC 2AUJD 1JJGA 2EFCB 2GBLA 1ONBA 3PSIA 1BMFD 1FNNA 4LJ4A 3AVQA 2C9YA 2QP3A 1RW4A 2JEAI 3CQZH 4LY6A 1H9MA 1HCZA 1FQKA 1GNQA 2VPPA 4KU4A 1XD2A 4KHZA 2OCBA 5AJXA 4Z1MD 4A75A 1FPMA 1G3QA 2OLKA 3AQ4A 3HWSA 4P31A 3UWKA 1JPNA 4DV3L 4ACBA 4TSFD 4Q7KA 5FUYA 3FYHA 4RG1A 4I1UA 1ZYRC 3J7ZC 1XMSA 1WJJA 4GOXA 2ZSFA 5JEDA 2O8DB 1J5EQ 2XITA 5JCPA 3H3VH 4G5RA 5LPNA 1VG1A 1XTIA 5K8LA 3LXRA 2Q0HA 1KRTA 3BFXA 4CEHB 2FFAA 4DLTA 4LUOA 2JEOA 2JA8H 3RS7A 2G83A 1NF3A 2BC9A 4WJ3M 1TPZA 1W1WA 4TQ9A 4TZ0A 4JI8Q 1XMQQ 2E5LQ 4YMSA 5HR5A 3KUCA 4POAA 3HOXH 4B2IA 2ZRCA 1MH1A 1HJPA 1NLFA 2FGJA 2DNEA 3H84A 3E9HA 4C9BA 1GL7A 2QZ4A 3KQLA 2F43B 1P6XA 2UXBL 1ZAKA 1LACA 1SXJB 2I1VB 4KN4C 3ERSX 4MZ9A 5C3EH 4NHOA 1G64A 2ZJBA 1Z2AA 2IYXA 4HUQA 4RJLA 3H0KA 4KYUA 4LJZC 3NE5B 2V1UA 1E3MA 1ZKOA 1PUJA 5SZIA 1Z8FA 1S40A 4RKFA 1L1OA 1Z0FA 2RGNA 4QKQA 3MD0A 3I4LA 3A74A 2E8GA 1UM8A 4KLZA 1YZGA 2FA9A 1SHKA 1UEIA 3B1VA 3BRWD 1AH9A 3I8SA 5GJBA 4JL6A 5CJPA 4IVQA 3GTKH 1SVKA 4ZO4A 5GJVC 4DV5L 4YC7A 4TMXA 3W9YA 1G7TA 2CLCX 4BLRA 4TSFA 3GTOH 4D0NA 2WPDD 3TJZA 1RVDA 1RL2A 3DMNA 4AH6A 4ZPXA 2DUDA 1S3SA 3O8CA 2H8KA 4IDHA 5IYBH 5CK5A 3ZZTA 4ZCLA 2B8GA 4MNOA 1YI2A 1EESA 2IYTA 4I1VA 4BFWA 2WKPA 3K0FB 1QHYA 2ZJAA 4PZ6A 2WICA 1AQUA 5BN3A 3LVQE 1W2BA 4Q7MB 3R7WA 4DLVA 3GLIE 4OO1H 1VF5C 2K5VA 2HT6A 1VQ6A 5JJIA 1XRJA 4RKEA 4US1R 1G1MA 2FSFA 2NO1A 1D2EA 3QF4B 1N33Q 1TF7A 3QVUA 3WYFA 1YEZA 3QXCA 1G3MA 3A7LA 1VYVA 4IDOA 3OE7D 1VQJA 2JA5H 2IC5A 1QHNA 4BEJA 2IS6A 2GCNA 4AWXA 1E7ZA 2O5JC 4JVNA 4F38A 4IFDJ 1XPRA 5BYJA 4EPYA 4DV2Q 4B3RQ 3SQXA 1TWFH 1Q44A 4TMZA 3P20A 1R4AA 1RRFA 2VL7A 2DCUA 4TTRA 5DH9A 2YWHA 4DCVA 4CW7A 5JRZA 4JI6L 1N33L 5E95A 2QPOA 4UP7A 3RSOA 1K8MA 2HF9A 5M04A 1ESNA 1CP2A 2BMJA 2HEIA 2PCJA 3K09C 1TQDA 4WVFA 2BMFA 3K8AA 1E2NA 4EKDA 1XWIA 4BBSH 4Q9JA 3RZDH 2LMCB 3TUIC 4YWMA 3U3JA 3ZVLA 1OXVA 5EE9A 4LFCL 2WFWA 4NDZA 2XZLA 2IS1A 3T12A 4Q01A 5IYCH 1BBWA 2N1BA 2K33A 4GMXA 3FP9A 4UNQA 4URZR 2CK3A 5SZHB 5IYDG 1XJCA 4P72A 4Q7LA 1E2QA 3MWLA 4KBGA 1E22A 4DR4Q 4GMDA 2WB1G 3C5CA 5G3ZA 5BXQC 5D3QA 1IBLL 2OTJA 3CCMA 3PF4A 1OIXA 4KKSA 5G53C 3CW2C 3VU9A 2ZPTX 3U9SA 4URVR 1PJRA 4YXWD 4AURA 2O8FB 2R65A 1EQQA 1GUAA 2OT3B 4HAXA 2OCYC 4DZZA 1CIPA 2J46A 2R62A 4Q03A 3F3YA 3DM3A 5LMUL 2ZUCA 1G18A 2VIIA 5LMNW 2IA5A 3SJCA 1P2SA 5JS8A 4PHGA 1S3OA 4I1SA 3R9XA 2AWOA 5AK0A 4O25A 1OYYA 5C2JB 1NJGA 1UBGA 4HLDA 4PPNA 1DO2A 4B3CA 3IIJA 5CK4A 3N5CA 5JS7A 3K0EA 3STBD 1GHJA 1JJ2A 2ZR9A 4BWYA 5GADl 1NTGA 4GZYC 2N49A 4IW3B 1ZVQA 1K8OA 1N0WA 1F3OA 4KN7C 2BBTA 3Q7PA 4DV6L 3GDEA 1CSPA 1D8LA 1A4RA 1XNJA 3K0CA 1ZIPA 3AP2A 4LJ8A 3U60B 1SMXA 221PA 2GXQA 3B13B 2ZREA 3E1SA 4G5OA 2KBFA 1G16A 1MR3F 4CYMA 2NOAA 2AKAB 5FOSA 3SI7A 3K0SA 3NH6A 1PFSA 3DOFA 5EXSA 2NO7A 1GO3E 2QTVB 5KSPA 1F2TA 2EJGC 1ZP6A 1W49A 2OBNA 2W6JD 5J5CA 1JI0A 3VR1A 3B1ZA 2E2HH 1MO6A 2ZVQX 1RIFA 2JIZD 4P3YA 4LV8B 3R7WB 3TSWA 1Z29A 2FEOA 2WJYA 4X62L 5B64A 4BFTA 3IHLA 1OTCA 3OZXA 3LY5A 4OQNA 1CEEA 3G82C 1GUGA 2GVZC 5DHAA 3TNFA 3TQFA 3V9PA 4QNMA 1SVWA 1S8FA 1A7JA 4HZIA 4Q4HA 4QG7A 4GOPC 4B47A 1PVOA 1T3HA 3FFAA 3KJGA 4IPCA 1G5TA 3CMAA 3QOFA 2ZJ8A 2AUKA 2Z6KA 2ZIAA 5J3BA 3AKCA 1UKYA 3FTQA 5FR1A 4PO9A 1S72A 4YMWA 3P4YA 1PZNA 2CHQA 2FU5C 2RGEA 4HEJA 4LUVA 1VS0A 3P4XA 1QVCA 2ODNA 5AJYA 4MA4A 2H57A 1G6HA 4JYAQ 2A30A 2RB4A 1J6QA 1RZ3A 4A3BG 4UNPA 1X86B 4OGQC 1KNXA 3B9QA 4MRRA 4YXWA 5B57C 3U2QA 2HT1A 2JA1A 2WJGA 1U8AA 4UXJA 2QMEA 2I0QA 1XTSA 1OFTA 4A3CG 3J81k 4F4CA 2OG2A 4BLOA 1FOEB 3IQXA 3CD6A 4XWOA 3ADBA 5EP4A 4G1UC 4PAQA 2UXCL 3GLFB 3VAAA 1Q7YC 5BR8L 1PH9A 1N5KA 1XJQA 4O0MA 1H9SB 4ABYA 4Q21A 1I50H 1JECA 1K6MA 1MO3A 1RKBA 3I4NH 1DG3A 3U6BA 2VHTA 2WPDA 4NYJR 4QL3A 3H0GG 4NBSA 4F91B 3BD9A 2R7FA 4LBVA 4IEEA 4M4SA 2G0TA 2WJHA 2O8CB 4YQFA 2HCJB 2KJQA 1I2DA 1XMJA 4Q1EA 1UDXA 3LBNA 1R0WA 1X65A 4LW1A 2CVFA 4IOKA 4G5GA 1JE5A 4RD2A 3W3ZB 1NJIC 1NVVR 1U81A 2VP5A 4D0GA 4DR6L 5F9HA 1PLLA 2A1AA 1NVVQ 5BN4A 2GEVA 1ZD1A 4PMWA 1FFHA 1DELA 5K36G 4CVNA 2GILA 2ZJ2A 1J99A 1AQYA 3T56B 3EXAA 1YRBA 2PNHA 4AKEA 3ZD7A 2P3SA 3A4MA 3RDPA 1IBML 1KD1C 1R0XA 1N3BA 1UAAA 2HDNB 4LHVA 3EASA 4PQFA 1XPUA 2A78A 4HAUA 4PFSA 5H70A 2NZHA 2I4IA 3HKZG 2NZ8A 4LDJA 4WIAA 2QRZA 3VDYA 1J70A 1GDDA 2AXNA 1H65A 3KF6A 3CCVA 1UEJA 2VQSA 2OAP1 2FDCA 4EX5A 1HR0L 2VP4A 3W1BA 1OXTA 2E1RA 5GAEC 5FBWB 4GOPB 1S9HA 1PH4A 1U0JA 3RHFA 1UE7A 1IBMQ 2QM8A 1KI7A 2V6JA 2QM7A 3ASYA 3LW8A 4LFBQ 2R6DA 4JSYA 4Q19A 5CLLA 5L3RA 2K52A 4D6PA 5J4VA 3OTOL 4M1KA 2A8VA 2OCPA 2EFDB 4HB4A 1V1QA 1P2TA 2OESA 1TWCH 1NBMD 2ONJA 1M6NA 5M3MG 4B3XA 2B92A 1T9HA 3VR5A 2V4ZA 1XNRL 1RE0A 1ZIOA 2AK2A 3AF4A 1GOTA 4MYTA 5JSZB 1T91A 2PZGA 2JAQA 2C96A 3TAUA 4ZDJA 1UWVA 3HU2A 5EE0A 1JALA 1GKYA 2J0UA 2W0SA 3SYLA 5J47A 1DAFA 3AP3A 3AUXA 2BV3A 4IDPA 2JJ8A 4PTLA 2ZI9A 1NLYA 5KSYA 1L8QA 3CPWA 3KJIA 4J0QA 3GJXC 5LMNL 4HLCA 1W4CA 4DSNA 2ALYB 1W46A 4PV1C 1NSFA 2MSCB 2UZ3A 4M1SA 2PQAA 5FTMA 4CEJA 2F55A 3D3QA 3Q3JB 3U4ZA 5FL7D 3OFND 1OIWA 3BU2A 3CNOA 3E2IA 5IYBG 1XEXA 1QHXA 5JWHA 4DRZA 3KQNA 1SMYC 5A0FA 3IO3A 1L4YA 2CMKA 1VQEA 4MYCA 2D2CC 2ZJQA 1M7HA 1DAMA 1N5LA 2IYUA 3NBZC 4Q9LA 5FOXA 4MUAA 5B2ZA 1R5BA 1Y8NB 2B29A 2PX3A 1C7YA 2N8NA 3NBFA 4P4UA 2PMZE 4V02A 4ZV4A 1CS4C 1DXMA 1W7AA 1ZINA 1LB1B 3MWJA 5FTKA 3H0GH 1AM4D 2QE7A 3QVVA 2O8CA 1Z22A 1HT1E 4CT5A 1CKNB 3VR2A 4DV2L 5AUOB 1UBFA 1Y63A 3QXXA 3AH8A 4QL5A 4BXXG 2ZRJA 2KHJA 1KZ7B 1N6HA 2QUZA 1H9JA 1TU2B 1LM0A 1Q22A 4ASUD 3A0JA 4JCVE 4YHHQ 4ON9A 2ZRBA 3NHBA 2WWGA 4NYMQ 4US2R 1E1RA 3ND8A 4AG6A 3I5YA 1CTMA 4KHPL 3GLGA 1Z63A 2OCAA 3K0AB 2A5GA 5C46F 1G3IA 1YHBA 2ZSEA 3STBC 2X8AA 4FWTA 1VYTA 3AVWA 4EJSA 4JI4Q 3K70D 4A2QA 1DGSA 1KRSA 3HOWG 2ZYWX 3N2EA 4HATA 1E1TA 1R10A 2QU8A 3AKDA 1XNQQ 3HR7A 4GI7A 4NCJA 5EP1A 4A3DG 3UMFA 3BXZA 2WIAA 4LK1C 4BA1I 4YHHL 4XWKA 1ZM7A 2WAXA 5HTKA 4RD1A 3AB9A 4M9QA 3LW7A 1VQBA 1KKLA 5DI3A 2QQ0A 5AJWA 1HA3A 4QGFA 3DZDA 4D25A 4DIEA 3U7GA 3S2HH 3X1YA 1L1OC 1R2QA 2RGNC 2D3WA 1E2HA 2PLFA 3J81j 3TQYA 2R7ZH 4BZXA 5L3SA 3B1YA 2ORIA 2BMEA 3IBYA 4QGAA 5J4LA 2VHCA 5EUMA 1NVXQ 2F43A 1QBKC 1GIAA 1H95A 1ZU5A 3SQWA 121PA 2QG6A 3BORA 3GFPA 3ZZUA 1HZBA 2LXKA 4DB4A 1HUQA 4L8GA 5EE3A 3K70B 4U00A 4M1WA 2MO0A 1KI9A 5DYIA 1Q81C 5A5GA 4L5BA 4TMTA 1P2VA 2ZTSA 4QY7A 1YJ9A 4UP9A 4C3HH 2P5SA 3PR1A 4A92A 4EPTA 3GP8A 1M90C 4K0KL 4A3IH 1JQLB 3GFTA 3KXIA 3T1HQ 2Z5FA 5DI9A 4A8JA 1HNZL 4JI3L 2WJJA 4HJ5A 2IT1A 5GJWC 3IFTA 2B3GA 1IXRC 3T35A 2QQEA 3NEJA 1K8GA 1MV5A 1HE1C 1ZRHA 4YDHB 1X55A 3F2BA 1KYIA 1IW7C 1ETUA 1YKSA 1UF9A 2WWXA 4HLUC 1JQJC 1XD2B 3JAMc 3THOA 3T06B 5IF9A 2JCSA 2HLDD 1Z83A 3R20A 4KXFB 2E75C 3PO2H 1G4AE 1YU9A 3BERA 4JI3Q 4BUJA 4JYAL 1DADA 2GAAA 3IPXA 4MH0R 3ZS8A 4Y0AA 2FFHA 1N32L 2LCFA 3QY0A 4WJ4A 1W5TA 4JI0L 1HZ9A 2KE5A 2WSSA 3GEIA 3TE6A 3VHXA 1EFHA 5JSZA 2P6NA 1NKTA 4ESVA 1I3QH 1NN1A 2WKRA 1SN8A 4B3SL 1KKMA 1A2BA 1QVAA 3E5HA 5KDLA 3CNNA 2R6FA 3BFVA 1Q1BA 2A6HD 1G4UR 3K9NA 3QPUA 3EARA 2UXCQ 3KDSE 3K81C 1L0WA 4FINA 4HB3A 1B23P 2N78A 3WYAA 4A15A 1GL9B 2DFLA 4IJLA 2QRNA 2ZITA 4PX9A 1CFMA 4C7OB 3LAWA 1GWNA 4MDFA 1NSTA 5FUVA 1GSIA 3G71A 4C3ZA 3A37A 1GNRA 3O8DA 1IJFA 2JJ1D 1KXLA 4D4KA 4JV5Q 1HZAA 2OXCA 3S15H 1P61B 1XDBA 5IE8A 2CW0C 1MIUA 1G6OA 1SXJD 2A5JA 2FEMA 2R8RA 1Y1WH 1Q21A 2VSFA 4JVMA 2QPAA 2RF4A 4TVAB 4Q4LA 4QNRA 3RS2A 3NENA 3GTPH 1E2PA 4GLVB 4GKKL 5TARA 2ID0A 5CM8B 3WBKA 5IWAL 4HJ9A 3CPJB 3KUDA 4X64L 4RFSA 4DHEA 3R8FA 3FHTA 4R4IA 1BOFA 3VX3A 5CDFE 5FJ8H 1B8AA 3ZQJA 5HKKD 5H8WA 1QHGA 1SVMA 4AYXA 2K32A 3LNNA 2LKCA 3UK6A 4YMVA 1ZCAA 5ELOA 3L0IB 4NXNL 5DHFA 4OI1A 2HJGA 1LY1A 4NH0A 5JCZA 1YR8A 4FXPA 1GHKA 5HGQA 1FJGQ 1VQLA 5BYKA 2JDIA 4DIDA 4C0BA 2GZDA 1Y1VG 3CCSA 1Z0IA 1B9NA 1SLJA 5C0XI 3I92A 2VQEQ 4B3FX 4KVAA 4A4DA 1FL9A 4BLTA 5JJKA 4DEXA 2OE2A 3BJIC 2BEKA 5K8TA 1HH2P 4JLJA 1G3UA 5EE1A 1BH2A 4OO1G 1KK3A 1PH3A 2HV8A 2DWQA 1LTLA 2A5FA 1NP6A 4R4QA 1E2MA 3OOCA 1KAOA 4R7ZA 5FBRB 1OXXK 2A6EC 3HKSA 5J4KA 1EFRD 2MSEB 3FKQA 1UKVY 3A1SA 2IF0A 1MKYA 2ZM6Q 3AF2A 1E0AA 4LF5Q 4QGHA 3DO6A 3PUYA 1FP6A 2CL7X 2KCCA 1EIYB 1MRNA 2C9OA 2OILA 4GPTA 4ITRC 2A5DA 2ORVA 1WE2A 2PMDA 2QP4A 2ZUDA 3IEUA 4ZDIA 2R6AA 4U7DA 2V3CC 3KTAA 5IY0A 3LRPA 4DC9A 2MQHA 1NKSA 3FPPA 2QP9X 3QE0A 1BBUA 1E0KA 1WMSA 2YWGA 5L3VA 1UFQA 2XX3A 1GUOA 1JB1A 1KK1A 2D4HA 3TRZA 1IN8A 2ANCA 3KB2A 4OQMA 4DV1L 2CDNA 1WA5A 4A6PA 1SFOH 4MKHA 4LV5B 5FL3A 5JBQA 5H68A 1A8VA 1TF5A 2ZRMA 3AV0B 1EWHA 2ATVA 2JATA 4CGZA 3TAHA 3I62A 1CR2A 1KK0A 2IYSA 3W8NA 2E76C 1BS1A 2DWOA 4Q4HB 1OE0A 3PEWA 3L0PA 4X8OA 1QF9A 1W0JD 1IXSB 3LD9A 1SZPA 3N2IA 4V0MA 2JJ1A 3CRMA 2J1LA 1GKIA 2G88A 3L2PA 1E9CA 4IOJA 4A3MH 4GT1A 4OK6A 3L8ZA 1O7LA 3CCEA 1E94E 1SQ5A 1KL9A 1R5NA 1TNDA 1OXUA 4LHXA 4H02A 1RYFA 3DHWC 3ONWA 3A8KE 4BE7B 1GJXA 2CJWA 1Z47A 4P75A 1UKEA 1XZQA 2F1JA 4CEHA 1E79A 1X6VA 2RHDA 3RRZA 3RZOH 4FWIB 2CLDX 3KKQA 1XJ0A 3B8HA 4JSTA 2AX4A 4TLDA 5DISB 4GL2A 2O5VA 3M4PA 5DSZA 4JC0A 1ZUHA 2ORWA 3RRNA 4DV7L 3W6OA 4JKYA 3S1AA 2JDID 2ZTDA 2ZAOA 4Z1MA 3SFZA 3RSLA 1CKEA 3I1FA 1DAHA 2IHYA 2IX0A 2F1IA 1E2KA 1W3SA 4OHXA 4ZDWA 1E9FA 2VA8A 2BDTA 4TYNA 2QAGA 4TT3A 1I5FA 2BVNA 2ZS8A 5EXPA 2IXFA 2IYWA 1PYBA 2IBMA 2QN6A 4WZ6A 3WP0A 2VF8A 4NONA 2OFXA 3AVTA 2JA6G 2NO9A 4DV7Q 4ZI3A 1DPFA 3SZRA 3G5UA 4FI3C 4BLSA 3I73A 3B9PA 4LC0A 3RS5A 3BFKA 4HIKA 5FPYA 1P2UA 4ZCMA 5J4HA 3LLUA 5JEAH 2QTHA 4PSVA 3SNHA 2VY3A 4GP6A 3ICEA 2DPXA 2PL3A 4HZUA 4HIDA 2QTFA 1ZD9A 3D8BA 2NN6G 4LJ5A 1GRQA 1W48A 4NYMR 3GQBA 4LBWA 4XD7D 4TZ6A 1NY5A 4KCGA 4NCNA 3RANA 1IZ6A 2QBYB 3TSOA 4V0OA 1TUIA 3W6PA 4NXML 4A3DH 3S1MH 1YZNA 3OEHD 4NCIA 4PC2A 4Q02A 1XCPA 4PZ8A 3SU8A 4YWKA 3HOWH 1G51A 4BY1G 3C8UA 3T1HL 4TLAA 4G01B 1LVGA 3S16H 3HOVH 4BLQA 5BR8Q 1BKBA 1US8A 3B2EA 4PANA 3TVDA 2P6RA 5FH9A 2JJQA 4DUYQ 4EFLA 1S2MA 3PIRA 2GVAA 1TQ4A 2J45A 2R7ZG 1KAGA 1TEXA 4I4LA 4GOJA 3FDIA 3EZ6A 4KFUA 2XOKD 1PH8A 2GF9A 1W36C 4NXMQ 4QM7A 2NPFA 2EDGA 3UKDA 4NPSA 2HLDA 5HY6A 1LYLA 2YC2C 3IO5A 2C5LA 2QEXA 1E79D 1HPCA 1YR6A 3UMRA 2JLYA 1II8A 1CRQA 4M22A 4R9UC 4RZXA 4C2UA 2GXUA 4A1FA 4GN4B 2C98A 5BN5A 4JVLA 3EZ2A 3WMFA 1JJCB 3KFVA 4EIWA 3ETLA 1ANKA 2IYZA 4CEIB 3L0OA 1SGWA 1VIAA 2XEXA 1GUSA 1IN6A 1Z0KA 4LFBL 2BJVA 1US8B 2ZU0C 4QHTA 3UG6A 4GNXC 1JAHA 4OHVA 4BASA 1I2MA 3Q8DA 3DM9B 1TL7C 4JLVA 2HHHQ 1G7RA 4B43A 5FTLA 3QENA 4X8LA 1K83H 3ZGXA 3T1TA 4TN1A 3SR0A 1XFAA 3HOYH 1VDZA 5CDFA 3HYTA 3LQQA 5DGXA 2QBYA 1RFLA 1K9MC 4DK6C 3X1WA 3KKPA 4G7HC 3SGIA 1N6PA 2BBOA 2BCGY 1GRRA 1Y3AA 2NPIA 3CWQA 3OIWA 3QKRB 5A35A 4K46A 4DKXA 4AKHA 2WOJA 4AYBG 4RFVA 3EZ9A 3T51B 3U3MA 2PJZA 3AKEA 1TUEA 1GFIA 1KI8A 3J80i 3A58B 3QXSA 2Z0SA 2RGBA 3KLWA 4P32A 4RZ3A 3KDFA 2ZRDA 3AVXA 2YTYA 3VX4A 3AFPA 1G8YA 1Z28A 1VQPA 1Q46A 2Z6VA 5CYPA 1M34E 4R71A 1BO6A 4JI7Q 2B8WA 3FHCB 4JIMA 4Q00A 3PVSA 4Q9HA 1M8PA 1HNWQ 1KMHB 3GTLH 2NN6H 1X1SA 3AEVA 1W44A 3PITA 4DR3Q 4Q7JB 1I94Q 3IDQA 2QF7A 3U7HB 1NMFA 4M1YA 4X64Q 1UE1A 3K09A 1EX7A 2CNWD 1E96A 4PR0A 1X8JA 3UWOA 1KO4A 3TBKA 3SBEA 5AR1A 1NE3A 1E2IA 3FOZA 2OCEA 1HNWL 1Z6AA 2ZE6A 3PEUA 3PG5A 3RAPR 3SBDA 4DDVA 4AG5A 5GVRA 1M2OB 4JI5L 3HOYG 1F2UB 5GVSA 4RZUA 3S24A 2CJWB 3PXGA 1KSFX 5TXGA 3A1WA 4OX9L 2GEDA 3ULLA 3FMCA 5FI0B 4II7A 4XVRA 3QPVA 1U8YA 1WP9A 5G3YA 4Q9KA 5IDVA 1N6IA 3GLIB 5KNBA 3CPHA 2XZOA 4KKTA 2ZI7A 1LV7A 2YNMA 1ODFA 3U61B 5FPTA 3ZD6A 3IKJA 2PZFA 4BA2I 3WMGA 1KMHA 2DBYA 3SE0A 4QHYA 5ANRB 5EJEA 2AWNA 3QBVA 1KY3A 3HR8A 4LF6Q 2ZVPX 1X9NA 2EU8A 3FFBA 4W9MC 1DO0A 2HF8A 2W6JA 3FE2A 3AVYA 2B63G 1YHQA 1IBKQ 2ATWA 4A3LG 3OAAA 3LGJA 1ZUIA 2DN8A 3EA5A 2R92G 4DK3C 3BZCA 2VRWA 3ASZA 4IXMA 4RD3A 1VTKA 2VW9A 2BOVA 1KTVA 4MYHA 1VHTA 2AD5A 2PH1A 4MGIR 2BA1A 3P26A 4XSHA 2KBEA 4NZYA 3DMDA 5EXTA 1MKHA 1PHJA 2C8VA 1N34L 4QC2A 2A2ZA 1K5DA 2K5NA 3CO5A 5JI3E 2R7DA 1U9IC 3RRMA 2DY1A 1V9PA 3CWZA 2HXYA 3K53A 1SKYE 2DFNA 5FL7A 3V00A 4CRWB 1RRCA 4C0KA 3GLFE 2JIZA 2VBCA 3VR6A 3JC66 1G5PA 4B73A 2I5LX 4LF9L 2GXSA 1XMOL 3F1ZA 2BH8A 3W34A 4OI4A 3FMFA 4PZYA 1YNXA 3RR5A 1P7CA 1FQJA 3EAQA 4TLBA 3AF1A 3O8RA 1N2CE 3GLFA 3CRLC 2D2EA 2XZPA 4QM6A 1CSQA 1AZTA 1QDEA 2KSQA 3I55A 4JJKA 1P4SA 4FMBB 1J2JA 2NN6I 1X54A 1X1RA 3AF3A 2UZIR 4PPGA 4Q1FA 1WQ1R 1HY3A 3MRSA 1VQCA 1BVSA 1U99A 3SHFA 2K7VA 3WP1B 2BHRA 2NVXH 4UPAA 1D9XA 1OFHA 2GJ8A 2BH2A 5BWMA 4LNQA 1XP8A 4FN5A 3M1IA 4MDEA 4UQOA 1V8QA 1I4LD 4DNRB 2R2AA 1CULC 4QXAA 1ZNYA 5AJZA 1CI3M 4URXR 1QJOA 1KI3A 3IBGA 4D81A 1SR3A 5C4XH 1IY2A 3SS8A 4LZZA 4E09A 3F5FA 2GKSA 4TYQA 1JAIA 3LBIA 1OH6A 3ZS9A 3GJ0A 1YZUA 1Z5ZA 1WCMH 1YZ6A 1N34Q 4KV9A 1IY1A 2XAUA 4IFBA 1L7VC 2IXEA 8OHMA 1E4YA 4A3KG 2EYUA 1OH8A 5AJ3L 4D4MA 3AVUA 2ZYTX 3GJ3A 1E9EA 2ERYA 4AYWA 4ZKEA 4EQ5A 3LXXA 3EIEA 1HEIA 1KZGB 4R2IA 4D0LB 4C7OA 4HLQB 1E32A 2IWRA 1NBWA 4UP8A 1E2ZA 2DGYA 1Z0AA 2H5EA 4BFXA 4E22A 3M4QA 2CK3D 1WXQA 2Z0MA 3TW4A 3MSXA 1A5TA 1OJLA 2NO6A 2YOFA 3CR8A 2N46A 1Y8PB 2D06A 3CRVA 3P32A 3QBTA 3CCQA 4IHQA 1F60A 1JJ7A 4NYIQ 1H9KA 5F2EA 5TDHA 1JXMA 1Q86C 2AMCB 1M7BA 2WAQE 4H1VA 4PO1A 4B2PA 5HPYB 2ATXA 4PZLA 5CB6A 1DAEA 4KITB 3CCUA 4FCWA 5LBIA 3KXKA 2V9PA 2VS1A 1VCOA 4Y7NH 2FV8A 3CB4A 1KHTA 3KQKA 4OL0A 1RJ9A 4PSAA 1E9RA 2PT5A 3KFXA 3LVRE 4QBIA 4IFDH 1P8LA 1E98A 2W6IA 3ZH9B 4Q66C 2O0KA 2ZYVX 2WMOB 1NMYA 2UU9Q 1ZBDA 3LDAA 1NN0A 2IS4A 2I5MX 3D0FA 2UUAQ 1IQPA 3B82A 3X1ZA 3CM0A 2E9SA 5G40A 5DN6A 4QOSA 1BIFA 1M7GA 2V7QA 2W2TA 5C4JH 1AS0A 1QHIA 3H86A 5C44G 1JEEA 2JLZA 3VKGA 1C9OA 1AIPA 1GUTA 1K5GA 4LI0A 4JKIA 4YMUA 4JMPA 2WJVA 1E0JA 5FBQB 4PHTA 1YZQA 2W2XA 3CRKC 3NH9A 4LBYA 2CE2X 3TQCA 3W5IA 5C4XG 1VQGA 4JBXA 4A3CH 5FOUA 2JLUA 3U6KA 2OZEA 4BFZA 4BZQA 4A8JB 5IP7G 4Q4JA 3ZDQA 4EUNA 3CF5A 3HOVG 1KSJA 1N25A 4QIWE 3LX8A 4LRWA 3J81c 1T6NA 3Q72A 2Y0SG 1KC8C 2IEYA 1DAKA 4M9ZA 4OQLA 4WXRA 3ZQ6A 3AVPA 3SYNA 2J7PD 4YMTA 3THYB 1G19A 1ONLA 4H0LC 4DUGA 2F52A 2WAQG 3Q5DA 5DO9A 1OSNA 1MRSA 2W2VA 3WRXC 4KI0A 4BRUA 4LHZA 4UXHA 2VUMH 2VHQA 2BJWA 4KBFA 1Y1VH 2GJSA 1JXOA 2VZAA 4JI4L 3HOZG 2R6CA 1N9WA 3L7ZC 2V55B 2WZQA 3U44A 4IOLA 4JG2A 4XVUA 4W5JA 1PH7A 5E7MA 3R8CA 1VQFA 1QVFA 2OFOA 3GJ6A 3IGFA 4GNKA 3F2CA 1ZNZA 5IK2A 4QGUA 4OWWB 1P75A 4LYJA 4F92B 2GK7A 2EIFA 2QI9C 2MNAA 5C3EG 1KDTA 4DVGA 3A7AB 2C35B 1Z06A 3HKZE 3PFIA 3PGZA 2AHOA 2V4DA 1E1OA 1S0UA 2F6RA 1I94L 2XNSA 2XNDA 3CP0A 5M3FG 1ZNXA 3KFUA 1VCNA 3EG5A 1CXZA 5FOTA 4TLEA 4NYIR 4B3BA 2G3YA 4LWCA 3WNBA 4YLGA 2GEUA 3IHWA 4HLUA 1BMFA 5CIQA 4OI0A 2FX3A 1P5ZB 3EW9A 1U5KA 4HJ8A 1G291 1NBME 5JRJA 1IHUA 3HU1A 4IFEA 4LFCQ 4MKFA 1KK2A 4DV5Q 1QRAA 4GKJL 3BB3A 1Q82C 4DJTA 3QXHA 4HR7B 4TMVA 2OAQ1 4URUR 2HJVA 4GOKA 1CKNA 3OEHA 1YQTA 4W7SA 4GZMA 4V03A 4KLNA 4WOPA 1CR4A 4LYHA 1CBUA 4HIMA 4GBMA 4PQYA 1LABA 3HOXG 1II8B 1OLOA 1YE8A 1AKYA 2BM0A 3JVUA 4Q48A 4RD0A 721PA 1TQ2A 1G20E 4BFUA 4DT1A 1V43A 3GJ4A 4DLYA 3QG1A 4Q4AA 2GK6A 1PH2A 1FP7A 1XEXB 2P0EA 4XSGA 4X66Q 5JJLA 4D4LA 3KJEA 1K73C 1N6OA 2NGRA 4OWXB 4EPVA 1HQMC 3K7UC 2OBMA 1LF0A 3PUZA 1YNNC 3W5OA 4GN5A 3OESA 4MRSA 1A82A 4C0JA 4H13C 2F9LA 1GVPA 4EQ6B 1OH5A 4YY3Q 1D5CA 1GAJA 3NG1A 3A5UA 1FX0B 5LB2A 1OF1A 2F1RA 4ZCIA 2UUBL 4B71A 3PJRA 4RCZA 4GLAC 2EFEB 2OV2A 2VHUA 3FKSA 4LYFA 4S35A 1LNZA 1A6XA 1N36L 3BDOA 1IBKL 3T61A 4LJYA 3W6NA 1G9XA 1FW6A 4IRUB 3UDIA 4LWZA 2O8BA 4JI7L 3RS3A 2ZJRA 1WBBA 3LQRA 4HZUB 3PO3G 3ZVNA 2C77A 1N8RC 2KENA 2CLSA 1NL3A 3H2YA 3I72A 2VTKA 3D7MA 4U5XA 5AUNB 2KHIA 3GTMH 2AFHE 2A6ED 1K3RA 1MO5A 2FMXA 3K0XA 4OONA 1C9KA 3CX7A 1IN7A 4B6EA 2JA7G 4AI6A 1MABA 4DCSA 3KOJA 2JJ2D 1XMVA 4IOAA 4RCYA 4G7OC 3PIPA 3ADKA 1CR0A 5LB4A 1AZSC 3K7AH 4OJKA 2QGNA 4JI8L 1XMQL 1K0RA 2B6HA 2HXSA 4JYCA 3T1QA 5LD2C 3QSYA 2NO0A 4HIOA 4QHSA 3ZIAA 2OHFA 3FPAA 4PHFA 3AQQA 3PEYA 4PC6A 1E9BA 4Z8YA 5C1BA 1RPZA 4AY2A 2ZRKA 3KJHA 4PPFA 4PSKA 4A2PA 4JBYA 3DPUA 3GLIA 2PI2E 1DAGA 2DYKA 1S1CA 5P21A 2B8FA 5IWAQ 3BS4A 4UNNA 3RS4A 1UKZA 3CC7A 4A0HA 3NHAA 1O7IA 1E2EA 4OXPA 2Q21A 4L5SA 1X8KA 2EWWA 1X56A 2JASA 2QGZA 4A6XA 4B6FA 3QQ5A 4ASUA 5JHHB 1LS6A 2C2HA 2GJ9A 5KHOC 4B32A 5SZJA 4BBSG 2ZE7A 2EW1A 3IILA 2XB2A 1RYHA 4OHYA 1X3EA 3CZPA 2N3SA 2ZJ5A 3B60A 4MRPA 2VQFQ 1NY4A 4O0AA 1Y1WG 1QUQA 2MSDB 2IUTA 3WMEA 2ASBA 1IONA 4IJHA 1U98A 1G21E 1II0A 1UADA 4V0KA 3U4QA 1W0KA 3T53B 4PZ7A 4BPBA 4U02A 2RGAA 2XJ4A 3AF0A 6Q21A 1P9WA 1XTJA 1SULA 1H9SA 3EIVA 4RVCA 4A2WA 3R9WA 2PI2A 3DKPA 1A2KC 4G3XA 2RHMA 4X8MA 4LX0A 4Q1AA 2XXAA 1FJGL 5IRCD 2R93H 3UANA 3WY9A 2EYQA 2J9RA 2UUCQ 1IY0A 1KO8A 1YR7A 2ZSBA 1QG4A 2BDOA 2VH5R 1GUNA 3KDFB 2JLSA 1SXJC 3GCGA 4HDOB 4N0EA 4LSGA 4B44A 5KOYA 2A9KA 4X62Q 4DV6Q 2Q3FA 2GXAA 1EFUA 4DLSA 3O8BA 4LF7Q 2WIBA 3E70C 2W0MA 4BY1H 4L5TA 5DI3B 1N0VC 2R93G 1WCMG 2CQOA 4LF9Q 1Z6HA 2B7CA 2ZRLA 1U94A 3T5DA 3GLGE 2D5DA 1P16A 4IJMA 2K14A 3VA7A 4B35A 4WW0A 1AE3A 3AGQA 4TL9A 4DV1Q 5IT9c 1YVDA 2V54A 4IDQA 4KVGA 5IYCG 4FMDF 4LFAL 4A3JH 1VQ8A 3HFZB 3PCOB 1Y14B 1UJ2A 3R9IA 1YIJA 2JA6H 1T0JB 4LJ6A 4DR7L 3S1QH 1VCIA 3PO3H 1GRNA 3ADDA 1E99A 5M5WH 1G7SA 4IPDA 4PHHA 1KO5A 1Z07A 2JA9A 3AGPA 3CR7A 4KFRA 4YCVA 3TMKA 3WNCA 3ZJYA 2PZEA 5LD2B 3E9IA 1ZD8A 1KY2A 2CCKA 5TV2A 4POGA 2BCJQ 2GVDC 3FMPB 2GDJA 4S2EA 1Q1QA 1DG1G 4QBHA 3CMEA 3RNLA 4UNSA 5M5XH 2ZR7A 4XWAA 5EAYA 1RRGA 3EIHA 3RABA 1VQ5A 2LSSA 1XJVA 1Q0UA 3HP1A 4M21A 4O2LA 2OM2A 2A19A 1KO1A 2FH5B 2JQOA 3HJNA 1G6PA 4HDQB 1NN3A 4M53A 4MITA 4EPXA 4ZIRA 4JI5Q 3J7A5 4KYIB 5KDDA 3ZYCA 4IVPA 1H8EA 1Q1ZA 3THWB 5JWOA 3VR4A 1JPJA 3K9GA 4O2RA 5GAHC 2WWWA 1N0UA 4CEJB 5UKDA 4MQBA 1YZLA 4F4IA 2D62A 2FG5A 1KIMA 4JK1C 2BKEA 2JLXA 3UPUA 1XD8A 2MO1A 5FLMG 2EVBA 3WBJA 5GADC 2Q2IA 2PEYA 2GTPA 1TU3A 1OHHD 1KJWA 5H1SE 2DFKB 2F3TA 3BC1A 4J15A 2JA8G 1E9AA 2J0UB 2IYVA 4TQAA 5AJVB 3RVBA 1YHNA 4B34A 2D0OA 4KSBA 821PA 1N32Q 1ELOA 3MXUA 4DWJA 3GTGH 3GEHA 3CONA 5FLMH 3K8YA 4QFMA 4BY7G 2KA7A 4MRVA 1T8TA 2E2IH 1VQHA 2RGGA 3JVVA 3IIKA 1CU1A 2Z6KC 2YC4C 5KPJA 4DUZQ 4BECA 2PMKA 4A3EH 3VQTA 2B21A 1ASYA 2VUMG 2QMOA 2ZROA 2WB1E 2A69D 1DOAA 2NTYC 3GFOA 1JB7A 3HPRA 1P73A 1KGDA 1E3PA 2Z4SA 3KF6B 2PCFB 1OH7A 2FSIA 1W2HA 4AK9A 4JI2L 5EQTA 3J80c 2QAGC 1EXMA 1FNMA 4A3EG 4LJ9A 2ZI4A 4CT4B 2UKDA 2Z4RA 2H1LA 4I99A 2JXMB 5E7IA 3CCRA 4EFMA 4DUZL 2QROA 3W5JA 1VQIA 1G3RA 3C16C 3QKSA 3AP1A 4Q1CA 5IT5A 1ZU4A 2FFQA 4NCKA 2QE7D 5J40A 1IXRA 2OUKA 4P4SB 1EIFA 3GMTA 5EP3A 3HGBA 1KOFA 4DDUA 2ZJZA 3THWA 1VQKA 2GVBA 1T4GA 4C30A 5FBVB 4B3GA 1AS3A 2ZEJA 1G8GA 3QEOA 1U0HC 4WA7A 3ZVRA 4YWLA 2GAOA 4KO8A 2C95A 2EFGA 2GETA 1XZPA 3VKHA 2YTXA 3MWYW 3SEAA 5KO2A 2NZJA 2EQSA 2UXDQ 4OKSA 2BM1A 1JJVA 3OW2A 5EZ6B 3N6RA 2YZ2A 3UXMA 2AN9A 3A4LA 1OPXA 5JMTA 2CCJA 5DLQE 2FGKA 5FPKA 1X8LA 1Q12A 2X2FA 2Z43A 3K0FA 3VNVA 4B74A 4ERNA 4C0QC 1P9RA 2JA5G 3C5HA 2HHHL 3TVTA 2O0HA 2DHRA 5JZVA 3WXMA 3ZJYC 1JMCA 1R0ZA 2REBA 3CUEF 3Q7QA 2W58A 4HAVA 5DN6D 1N36Q 4AIMA 4DV0Q 1S9DA 4L9WA 4LF5L 4XTRA 1G41A 4HJ7A 4DR2Q 3PF5A 3A4NA 1AK2A 3CIOA 4FMCF 2RH5A 5JI2E 1GM5A 1WYDA 2OEPA 5EE5B 4JBKA 2RGCA 4R98A 2QENA 2ASEA 2CWPA 3BOSA 2JK8A 2Q9CA 2YJTD 3L43A 3S1NH 3EX7C 2A68C 2XB4A 2YHSA 3KTAB 4NP6A 1E0SA 3RLFA 5K8UA 5FUXA 4AIIA 2DB3A 1E2LA 2WBLC 2GWHA 1TAGA 4JBJA 1IYVA 4C0AC 4EJSB 2IHEA 3KQHA 4QJ3A 4R1JA 1QVRA 2XTIA 2WWHA 4JI6Q 3QKUA 4QJ4A 1E1QA 3BG3A 1NLZA 2VL6A 1SXJA 1E2VA 3C4JA 3WRYC 3NDBB 3DLLA 1KIXA 2YWFA 3CNLA 3HPQA 3GLHE 5E7JA 3U4VA 5KNCA 2ZR0A 4C3JH 5B58C 4FIDA 4MGYR 3H1TA 5AUPB 2WSMA 2ZSAA 2YU9H 2F3RA 4POFA 2IEZA 2O0JA 3DEFA 3M4OH 4KFTA 1VQNA 3OIUA 1QUQB 3HDTA 4IEIA 3LBHA 1Z7TA 3H15A 1OIVA 5KSZA 1W47A 5TB5A 1WDTA 4GS3A 2KI5A 4DR5L 4L8JA 4DK1A 1B7YB 3MCAA 3LH5A 3AFQA 1HNXL 4BBRH 3BWDD 4DR3L 3V4RA 2JGNA 1DD2A 2ZTEA 4FD2A 4A3LH 2BWJA 5SZKB 3UDGA 3LV8A 3MG9A 4OX9Q 3L2OB 3EQLC 1SVIA 4CZ2A 1COWA 4P4SA 3LWUA 1XTKA 3FWYA 1XTDA 4A8JC 4JI1L 4RCNA 1D9ZA 3FHOA 2Q3MA 3QG5A 4FCTA 4L4UA 3AM1A 2RHQB 2FJUA 3NIBA 4DR4L 2PCLA 3GTQH 2OO7A 2H17A 1OHHA 1IBLQ 2H16A 3SOPA 2OFWA 2ZU6A 1HNXQ 4DSOA 2NVTH 3NXSA 5FFMA 3MWKA 3B78A 2YV5A 2B8TA 3EN2A 2WJIA 3OE7A 4JZKA 3QI2A 4PZZA 1OT3A 3GJ8A 5C4MA 1RIPA 3EWSA 1PYSB 4BFYA 5GJCA 1PLJA 2Q2HA 4M9SA 1WOCA 2Q2UA 2QAJA 1PV4A 2CFMA 2ZI3A 3Q9LA 2IYRA 3VU9B 3CRRA 4JJZA 2O8FA 1IOZA 4OI2A 4APVA 3TSZA 1OV4A 2VF7A 1E1RD 3LWNA 4JLKA 2IX3A 1XMIA 3GO5A 4G0NA 2JE6I 1QHSA 3KF8B 4A3MG 3I4NG 1OKKA 2N42A 3PQCA 2ONKA 3BGWA 4X65L 3JZMA 3IRBA 4IOCA 2J7PA 4AYBE 2OTLA 421PA 2R92H 3PV0A 5FOWA 4EJSC 1S3GA 1T3SA 2H18A 3LLMA 4OK3A 1HE8B 2CWAA 1Z08A 2CE7A 2E87A 4B3MQ 2FSGA 3OIYA 4EQ6A 4M1TA 2QGQA 2C9CA 4Q47A 3ZVMA 2XJ9A 2UVQA 3CX8A 1COWD 4W5HA 2ZM6L 3NELA 3A8JE 4LF8L 4HB2A 1AE2A 3OEEA 4B3TL 3M85A 4JI0Q 2J41A 4Q1DA 5A4JA 4A3JG 5CITA 5JEEA 2WHXA 4R4CA 2XOKA 4XJXA 1TEVA 1DS6A 2C78A 1G17A 4JV5L 1KNQA 1NN5A 1IYJB 4NB3A 2WVJA 4Q1BA 3UATA 1G8HA 4BXXH 4LGMA 1T8UA 3ECCA 1ZCBA 1TWAH 1Z6YA 4AKGA 1YJWA 1CF4A 1L2FA 2F7SA 3QF4A 2Z83A 1E9DA 1H9RA 1E6CA 5FLXc 1Q20A 2OBLA 3CZQA 2V1XA 2ZXUA 4A3FG 2P67A 1T0HB 1YZTA 2ZUBA 3L0SA 2C03A 4RSGA 3IEVA 4B2LA 1W0JA 5C44H 1EYGA 1XEWX 2WWFA 4QBFA 3MUFA 3ZZ0A 3KX2A 1F48A 1Q1EA 1WFQA 1VMAA 3G0HA 2A69C 1EK0A 3I7FA 3U7FB 1B70B 4US0R 3TK1A 4JT2A 2WV9A 4O2DA 1W0KD 1OFUX 2K5HA 2HYDA 2RGDA 3UMSA 1W4RA 1F5NA 1PH5A 3A36A 4MRNA 2J0SA 4ESHA 4LBZA 1LTQA 2L15A 1ZM2A 1AN0A 1DBSA 3DXJC 5C0XH 3N70A 3BK7A 3Q85A 5KTYA 3MAAC 3VMFA 3TS2A 1OB5A 5BQ5A 1L1OB 1H8HA 3A8IE 5FPHA 1XB2A 1YZKA 4LHWA 5DYGA 2FZ4A 3OYYA 2QT1A 2Q8IB 3LX5A 3CBQA 1NI3A 3MGCA 2ZJPA 4GRAA 3K9HA 3X2SA 3U44B 5D3MB 3B1WA 4JI2Q 3BB1A 1SRUA 3K0AA 4EDHA 4LYAA 3GLGB 1U2RA 4C3IH 2ODBA 1GNPA 2QA4A 3BAFA 5J4YA 3K70C 5IP7H 1X3FA 1NRJB 4FCVA 4HB0A 3AKYA 2F1MA 1W36D 4A36A 1V5WA 3SJAA 3RN5A 1JBKA 3AYHB 1E69A 4F7WA 2XSZD 3SC3A 3UG7A 3L8YA 4C4PA 5CIWA 4ZKDA 1EG7A 4LV6A 5EP2A 2HCBA 2VP2A 2IHFA 2XNDD 3EC2A 1YITA 1MJEA 1HQCA 4OWTB 4Q4JB 5FR2A 2NMVA 1P9NA 4FMDB 5HE8A 3K9LA 1Z3IX 1J8MF 1EUJA 1WI5A 4L5QA 5F9FA 2XGTA 5EUQB 2ZT9C 1WF3A 2FPLA 1KMQA 2REXB 3K0CC 1M1YE 2HUPA 3T1VA 1TXYA 5ELXA 1HT2E 2PLRA 2P5TB 3I32A 3M0EA 4LUCA 4ME3A 2PQAB 1TU4A 3C14C 4MUBA 3RC8A 2A7QA 4M0LA 3VR3A 2GA8A 4NCHA 2H5XA 4JL8A 4C2MH 1P62B 2AXPA 2WMNB 3QKSB 3S1RH 4LF4Q 4Y52H 1GZSA 2IHBA 4C0LA 2QNRA 4C0SA 2OWOA 1XF9A 1AJEA 3U7EB 1QHHB 2A5YB 1VF7A 4A82A 1HR0W 3KKOA 1RJ9B 2GESA 2YOGA 2IL1A 4XH9B 2OQKA 2F4VL 4DDTA 2BEJA 2ZE8A 1PA6A 2XTNA 3U3RA 3CX6A 1MABB 4K0KQ 5CYOA 1GL6A 4M1MA 4EPRA 3PENA 1NY6A 5GQOA 1HURA 2FE4A 4LF4L 3T1YQ 4IFDG 1XXHE 2ZRGA 3CPEA 4QJ5A 4UY8C 2IS2A 4LPKA 4IQZA 5IP9G 5LMNQ 1EWIA 1XD9A 1Z2CA 2VQEL 3RLNA 3GLHA 3MEFA 3A8TA 3LFUA 1G5RA 2GJKA 2J0VA 3W90A 1X3SA 4HI0E 1ZNWA 3I2ZA 2F3IA 4D80A 4F93B 3I61A 4DNTB 2KCTA 1Q3TA 4CDGA 1AS2A 2H7VA 1NMXA 2NIPA 2V1CC 3KJOA 1AGRA 1N5JA 2F9MA 3A1UA 2X77A 5K8IA 4WXPA 3REGA 1KAWA 3BZKA 1NG9A 3Q5EA 4AQYL 2O52A 2ZJYA 5TVKA 3ADCA 5HZKA 1LS1A 4I81A 2G77B 5L3QA 4MYUA 1NJFA 1PLKA 3CC2A 3PUWA 4LUZA 1J8YF 5M3FH 2CXXA 2AD1A 2CL0X 4UXIA 3CRQA 1OXSC 4A3GG 1HYQA 3OW7A 4FDBA 4D26A 4ZIRB 3M3YH 1L4UA 4HAWA 1KI4A 2PPBC 4DT1B 2TMKA 4KKUA 2YYZA 3D6TB 5HCIA 2XTZA 4OBEA 5EZ5A 4DBLC 2D7DA 3ICQB 1QZGA 1R8SA 2PX0A 2EJFC 2I1QA 3VHLB 2QMUA 1E2JA 3M9BA 2ZQ5A 3G48A 2ES2A 4O3MA 3FGNA 2IYYA 1ZW6A 4DK0A 4P33A 4DLRA 3TR5A 1N5IA 3PUXA 4BZPA 3GPLA 2GRJA 4I1OA 2ZRPA 4L5RC 1L2TA 1E2GA 3I56A 4G5SA 3B7GA 1S1MA 3TUJC 3WDNA 4RZ2A 4DR1L 1I6HH 1P3JA 2VP6A 1N6KA 1R6BX 2ZRHA 1W2GA 2W00A 2Y8EA 3MJRA 3GD7A 3ER0A 1UBCA 4NKRA 2B7BA 1VQDA 2ERXA 5F98A 4WBSA 5M5YH 2EJMA 2ZRAA 5IP9H 4QQBX 2OXRA 4HYYA 2KWIA 3DKVA 1U0LA 2WWIA 4OYHA 5AWFC 2ANBA 1XXHA 1ZC3A 1Z6XA 3TUZC 4YY3L 4GP7A 4OQXA 2JEBI 1VIYA 3TREA 2P6UA 2XGJA 1GP2A 3S14H 2UXBQ 2ZRIA 1O78A 1QVGA 3TRFA 5JFGA 3EPLA 2BBWA 3CRW1 5JLJA 3NVAA 3CPFA 1OFIA 4DDWA 4A3GH 1UE5A 5CM9C 4RD6A 4CF7A 1MO4A 4DCNA 1IXZA 2VLIA 1PUIA 3ND9A 1KHIA 3K80C 4HUQB 4X65Q 3UE1A 3HOZH 4M9XA 2G9NA 3TW8B 2R6GA 4Y0VA 2FZLA 3FVQA 4IVRA 4OJQA 4E07A 1JR6A 1GVNB 1SKQA 4MKIA 1HZCA 2XXAB 5LDDC 4H9GA 3DZ8A 4YDSA 4B3ML 2F1HA 3RWMB 4HAZA 5EXXA 3KQUA 4IXNA 1EFRA 2A6HC 3U4QB 1EFWA 1YNJC 3M6AA 1E2DA 1RRPA 4LK2A 4AD8A 1FTNA 3D31A 1F2TB 1TADA 1SE8A 1FMLA 4PQRA 5DLQC 1F2UA 1VCMA 2KB0A 1VHLA 3KLRA 1FYCA 3I3SR 3I5XA 1CKMA 4JOIC 2H92A 1UBEA 4DV4L 1R7RA 4A3KH 2OLJA 4JLAA 2O8DA 2FNAA 2LXJA 4EFNA 2RHSB 4LPSA 3NWJA 3CAMA 1FGUA 1TX4B 2GN5A 1FR3A 1WCV1 1XNRQ 3OAAD 1O3YA 5FJ8G 2BA0A 2G1KA 4WZAE 4LJAA 4TKOB 4B3RL 3MLEA 1ZJ6A 3NBYC 3NC0C 3P27A 2K4KA 4KAXA 4LCBA 4XVQA 5F3WB 4A93G 4PG3A 3PIOA 4Q9IA 5HE9A 3BJUA 1IAQA 4D82A 3RC3A 2ZANA 2ZE5A 4DV4Q 4MGZR 2GCOA 1IL2A 1AKEA 4TTPA 1H8HD 3WYGA 1E9SA 4WAUA 4GKKQ
chains in the Genus database with same CATH superfamily
4BAZA 2WU0A 3B85A 1KDOA 4N9TA 2HHAA 3OQHA 3NEYA 4DDHA 1U2TA 3T3EA 4KPGA 4DKAC 3D2CA 3H83A 4WK0B 3TGWA 3W3AD 3EPKA 1LFDB 1DAIA 1Y81A 1TJNA 3RNOA 1RWXA 4DR7Q 4XOIA 2R44A 5E4JA 3W8FA 2VZLA 4A23A 4O33A 4F7DA 1WLYA 3ZHUA 3TNJA 3WLFA 5FPPA 5BYAA 6LDHA 3EBEA 3L6DA 4IPGA 1PGPA 1WMBA 3EZFA 4OAQA 2G70A 3RPEA 1M9NA 2HIGA 5LWQA 2XWJI 2O57A 3B1XA 4XSVA 1JYEA 3UGQA 1R0YA 2ZVJA 4OF4A 1NOKA 1CTQA 1HTBA 1FFXB 1CZHA 1EEXB 5AI9A 1A2QA 5TY0A 1QUEA 3DAGA 4QELA 4DR7B 2GF0A 2XRSD 3CKLA 3NZEA 4DR5Q 3DEPA 4UDYX 5DCLA 5AM4A 4B3HA 4BNYA 4CLRA 1JKFA 3UW3A 3KPUA 4W63A 3S1SA 1T3LA 3LF1A 2DNCA 3I64A 3TI9A 5DSTA 5C18A 5M2QA 4DKJA 4W4TA 1PK7A 4COOA 1CUKA 4UNRA 4X6UA 4GI3A 2GTIA 2V7UA 5F35A 2UYGA 4RDCA 4N5LA 3WLTA 4EGFA 1LH0A 3TEFA 4QJFA 2JA7H 2XUAA 3KPWA 2OYRA 1A1VA 2VP9A 1A7UA 5AKZA 2PXXA 3W1GA 4EWLA 1FTSA 1DDIA 3C41J 1II9A 4A76A 1SHZA 2PYDA 2C97A 2JLQA 3GUYA 3L1KA 4MPRA 5DT2A 5KI6A 3ZDFA 1UDWA 2Q9BA 3LQYA 3ZZMA 2BBSA 3USCS 1HV8A 4TWZA 4X6AH 3EFOB 3WKCA 4DCMA 1UEBA 3K31A 4JOBA 4NLLA 3EC1A 2YVAA 2P65A 1E3LA 4NSNA 1FFAA 4RA6A 3H94A 5ALWA 3H2BA 2BD0A 2YCLA 4LC1A 4MLCA 4C0HA 1HLFA 4BXOB 1JA0A 1WBJB 5DBHX 5SYAA 1LX6A 3ANNA 3ASVA 1IB0A 4BAGA 1ECGA 3R6GA 2A35A 5E6RA 3VPBA 5CLQA 5BOSB 1UMCA 1NMZA 1G21A 3U3OA 1RR6A 4QO7A 1TMKA 3J80E 4YRPA 1XEWY 1ZEMA 4F4JA 2RI6A 1SIUA 3QPCA 4ZYWA 4LF6B 3CLVA 1WNTA 3SBOA 5K3DA 5DGCA 5HM8A 1XHEA 2P2GA 4JYBA 3T0FA 4DLAA 4E08A 2BFWA 4NULA 5FOVA 2VSXA 3GUUA 4ILEA 1J7JA 3R41A 3C15C 2J0QA 5GONA 2VO1A 2BFNA 3IJ5A 3KLNA 3NIDB 5JSFA 2HYIC 2PZ8A 2OQVA 2IBSA 4H6VA 4W5OA 4B47A 2HHJA 2EKBA 3G6EA 3D8NA 2J59A 1QFSA 1PFWA 1M8KA 1Z9FA 3U50C 1TKWB 1DMSA 1NJ1A 1UC9A 3DDUA 3GLUA 4OG2A 5IBRA 3NTOA 1QB5D 1HRJA 3AIKA 4WUTA 3HOUG 1FTQA 1IBRA 1VHWA 4BQSA 2Q2TA 3BBPA 4GSYA 4BY7H 4EY7A 3PDJA 3EGVA 5JSYA 3W5VA 2NNLD 1EOVA 1CW2B 2XODA 4LOIA 5DBIA 4DUGD 1RQLA 5DM60 4GYJA 1ZM3A 1WETA 3PEVA 4RANA 4XTCS 4KK4A 3PCRB 3WQQA 4BNDA 2A9RA 2Y0SE 3CUYA 2WIDA 5K3BA 1L3CA 1R0LA 4TQGA 1GJRA 3LPCA 1UPBA 1SD5A 5IH3A 3HYNA 5M3MH 4BQQA 2WD8A 4C2TA 1MOZA 1EBUA 4X24A 5AM2A 4EVQA 3EAFA 1QMGA 1WBDA 1P74A 3OURA 1IZ7A 1M2OA 4BV8A 1N78A 2BIFA 1QG0A 3ZCVA 3SC2B 2P30A 3V05A 3ULJA 1PEAA 1GG2A 3SK0A 4YDRA 4PIMA 1Y42X 4TYPA 3PNVA 5EUCA 5F12A 2FN4A 2I3AA 3AJ8A 5G4LA 3EDCA 1EY6A 1W85B 5KBYA 4M7OA 3BIFA 3W0LB 1ZJ4A 1NXTA 4R81A 1ZNQO 3CF6R 4LF4B 3INYA 1BVUA 1AN9A 4YRMA 3WB1A 2GM3A 2H85A 4DPGA 2I4MA 3AESA 4JBNA 3W8EA 4X9XA 2YN4A 1VPVA 2NU9B 4BWGA 1RWVA 5BNTA 5LVAA 1QRDA 2CCZA 1C9YA 5JJCA 4JEUA 1K8ZB 4NU0A 3NC1C 2BFPA 1PMRA 1YBMA 1PNVA 1MB4A 2VDLB 1ECLA 3GZJA 4P6VF 1D1KA 2C3YA 2XWSA 3CZMA 5BWBA 1FTWA 2HPVA 2D7JA 4ZRZA 2NVYH 1JE1A 1UFRA 3RNUA 5C8XA 4UVIA 1HTWA 2XKAA 1C0KA 4OU4A 4PVCA 1ORTA 1HYGA 1Z2PX 1PDVA 3EOBI 1R5JA 4ID9A 1WRBA 4ZKCB 3G2QA 3SK8A 5JAVA 4AQYQ 3L0CA 4HMQA 4IOMA 3CC8A 3QNUA 3FM9A 3S17B 5E4WC 1GPJA 1NJ2A 2XY4A 2VHJA 2WWTA 2XVAA 3FWNA 2BKUA 4P92A 4R31A 4TYWA 1GITA 3A9SA 3WIVA 3MXNA 1M54A 1YJQA 3BMOA 1WPRA 5KYKA 2QI9F 2LUOA 4OLJA 2QHXA 4L15A 5IVIA 2YOHA 1X7XB 3MJVA 3LSYA 1EJ0A 5IKPA 3GT0A 3UDXA 2GEFA 1W8DA 4XD7A 5C35A 4LOAA 4XIIA 5E8JA 3GJQA 5B2EA 2OWDA 3SS9X 3K0YA 1N7IA 5I7OA 4JLOA 4YAUA 3WR5A 2D0PA 5LA6A 4L3VA 1G5IA 3NT2A 4XGNA 1C1YA 4QE3A 2VUHB 1KEPA 3REQA 2C4VA 3L7NA 2DPHA 3QKTA 3S5UA 3KJPA 4OL7A 1QZXA 1FUUA 3NGLA 4DRXB 3FGZA 3UQZA 3I9KA 2JI9A 2C99A 4F8MA 2OTCA 4B8ZA 1BJRE 4BLPA 1KQGA 1M2KA 3O31A 1K8RA 1FFWA 4K9PA 4DAYB 1ZMXA 2J3EA 3TTUA 1ZM9A 4NPHA 2DR0A 3D0QA 2HIVA 2CB0A 1E4VA 2LGJA 3RVSA 3X43A 1RLTA 2GZAA 3EIFA 4O4JA 2A68D 1FFEA 2BE5C 1BD3A 1P1JA 3VYUB 4RFSB 2CNWA 1DIRA 3D6HA 4LVUA 4UFNA 1Z6ZA 5LP1A 3IQWA 4RFLA 5CYFA 5TMPA 3IIMA 2H1SA 3NHRA 4C06A 1J5EL 3GLSA 4Y2YA 4B48A 4KPEC 1YNND 2I5HA 3LWZA 4AS2A 5KPDA 1G59A 1XA0A 4AS1A 1BVRA 4JUDX 4P2BA 4GZLA 3MAJA 4ZZ1A 4QDTA 4Q5IA 2HX1A 2P1RA 1Q3HA 4MCHA 4HS9A 3BE8A 3OO0A 4DNIA 4BY7B 4KVZA 4NPCA 5AO9A 3UMYA 5EC8A 2D2VA 3G2JA 2J87A 4ND4A 5NULA 5DZSA 1IU9A 3P2EA 1LLRD 1PDQA 2GBLC 4IO0A 4AKSA 4F4HA 4UJ5A 3NHHA 1ZI8A 3EVZA 2J4CA 4FUTA 1V71A 2OP0A 3AETA 4D8XA 3HGQA 4DGQA 5K6AA 1YIOA 3OU6A 4LYGA 4OB7A 4K2LA 1CQZA 2FFBA 3HZRA 4JHLA 3I01M 1XBTA 2R8YA 3I09A 2AFHA 4OHOA 3RK4A 4KK7A 2VSOA 3NUQA 3UYKA 2X0NA 3PFKA 2DG2A 1YQUA 3JZAA 3KWMA 2PUBA 5AUQA 3KRTA 3NHJA 2ZPAA 2IYLD 4RK1A 2VG8A 3IAUA 3QBJA 2IVZA 1JWBB 3C45A 2ZIEA 3RJTA 2GHTA 1H2HA 5MDHA 3SSMA 3I9V1 4JLWA 1YJ5A 3H4TA 2IY5B 2OORA 3K30A 2KJXA 5IN5A 3SEFA 4AMBA 5K0TA 3OIVA 3SGLA 1TD1A 4YYEA 3RLOA 4YRLA 4OO1I 1YBHA 4OHRA 3NXWA 5LQDA 5IJAA 5ILQA 1GNVA 1E2FA 2HK6A 3ESDA 3HDHA 4HTFB 4EA9A 1ZXTA 4EL5A 2HLNA 1RTOA 1P7PA 1QJ4A 1UJMA 1RBYA 3OM1A 2I71A 2AFRA 4CIYA 3W4IA 3RM3A 3SEBA 2RC6A 2BTQB 4DQVA 1Y9AA 4BRWA 2IU6A 3E2PA 4JVSB 4QRHA 3ITNA 4IDNA 2P5ZX 3D4RA 2AOTA 2FWIA 3EVTA 2DFTA 3HJUA 4HX9A 3GYBA 5TQ2A 5KNDA 4D44A 3RK0A 4U0JA 3UMGA 4P3PA 2GTHA 4M8NE 5CCXA 3PUVA 1HTPA 1YB2A 5KYIA 4YA6A 2BR3A 4MJ3A 1SEVA 5KQRA 2YWEA 1EKXA 3A1VA 3LYUA 3E5MA 3I91A 3G2PA 4LNUA 1VB3A 2UYYA 2WSSD 3FR7A 2J5XA 3IFSA 4EA8A 4QTYA 2C2BA 1EOTA 2Y1DA 1X80A 2MMCA 2ADFA 2R8EA 3EMVA 2RHTA 3IHKA 4UEKA 4XCXA 4B6GA 1MH9A 2NSJA 2AE2A 2SKCA 4UJ3A 4DSTA 3GTPB 1EFAA 4OB8A 1UJNA 1V1MA 1NXPA 2MINA 2V74B 3IVCA 4MTCA 1ABFA 4LE0A 1D2NA 3RSCA 3STWA 4ABNA 1BBXC 1NU8A 1XCMA 2JH3A 1W4AA 3TINA 3CKMA 4ZI2A 3HVKA 4I66A 1ESRA 1XRRA 2XIJA 4JGIA 4JLPA 4KLKA 1GU1A 4UEOA 1TTTA 3KBBA 4PLTA 2IH4A 3ESYA 1U7OA 4J90A 4MNTA 4KJNA 3RHTA 3I58A 1E20A 4DPKA 1F0YA 1KY5A 1B9MA 4P0TA 4R6XA 1B43A 3MS7A 3WS7A 1E3DA 4JC4A 2FOXA 2VP0A 4H7HA 1A62A 1H6AA 1VLJA 2B94A 1SUCA 2FP4B 3AM5A 3B6MA 3DYBA 1NXQA 2EF0A 2NV0A 3HMKA 2IXTA 5F33A 1ZHOA 3RVJA 4BRSA 2V7QD 3CH5A 1Y3IA 1ZI6A 5C5IA 5JYCA 4X66L 4JX9A 3AFNA 2JFQA 5L3ZA 1HYHA 1BKDR 3GP3A 5LFAA 5CJ2A 2OC9A 1FYDA 3UK7A 5AKEA 3A1TA 2B20A 2GR9A 2CEAA 2IK8A 3HRHA 3QVJA 3D8GA 1YBYA 4MGEA 3S8EA 2QSYA 3DVLA 1UAGA 3G4SA 2OGWA 3MT7A 2V7EA 2VRCD 4NXNQ 2GPAA 3I52A 4EFDA 2JW5A 2Y1XA 3U39A 5CU7A 5CEFA 1U8XX 1E18A 5E6RB 5GV7A 1ZVKA 3RT9A 5F5XA 3CCLA 2D0DA 4C88A 2C9DA 2IYFA 2R7MA 3KLBA 2A86A 2PWPA 1FUYB 1EWQA 2JS7A 4KWCA 4RY0A 4DR2L 4U39A 1MXHA 2XRZA 1EY7A 2ZETA 5FNVF 3F2DA 2NVQH 1UT6A 3HHEA 4RK7A 4DAYA 3MRTA 4ZYTA 3UMMA 3D6MA 1AQIA 5HUJA 3MMXA 4G4SP 3TDNA 1CQFA 2WOOA 4K8OA 3TS1A 4XIFA 2IHNA 1CJMA 2Q9AA 3FYUA 4IJ5A 1O87A 1PQPA 5E3JA 2RHJA 3PL1A 3LSTA 2GH1A 1ISFA 1IPFA 3RZOB 2F8MA 4KXXA 2Q5LA 4Y2JA 3TEHB 3QEMA 4HL6A 3V42A 4G5HA 4D8UA 3N3BC 4TROA 2D0PB 5LA6B 4YHHB 4ZCPA 3FYSA 3C3LA 4OQQA 2WK1A 2NTVA 4I7ZC 2FUKA 1L6RA 4XDXA 1VPLA 2HFKA 3V8MA 1SC1A 1XDUA 1NMGA 1YI0A 1T36B 2RKOA 3JVDA 5JCXA 3TO5A 4PC3A 2BKAA 3P9IA 1SWVA 3CURA 3T1YL 2P4UA 4E5NA 2G7MC 5J2UA 13PKA 3AIMA 3CCJA 4PBRA 4UHVA 3A6GA 1YNJD 1MGOA 2FSHA 2X1VA 5HKBA 5TLSA 3E6ZX 3KUXA 2CFOA 1YUBA 1AK9A 3BWBA 3WMXA 4X97A 4KKVA 3BILA 5ALYA 3QX3A 4XYQA 5EKLA 4C3IB 1MRZA 3H97A 3MTGA 2QA5A 3E9ZA 5FEMA 2OBBA 1B4DA 3E0XA 2E5LL 3E0EA 4RMFA 2EGUA 4FBGA 1XNQL 2B2UA 1QYCA 2X19A 4O4IF 5F73A 5I8PA 3CCBA 4B85A 3A9WA 1H4QA 5HKLA 3ZOZA 4GBED 1MB2A 5KWVA 1O95A 3KOMA 3PHLA 1P5FA 3L4BC 2PX5A 3O73A 3QYAA 1WB5A 4X45A 1VQ9A 4A9AA 3FB4A 4B6PA 4RH3A 2PE5A 1SKYB 3KKZA 5A6SB 4HFRA 4KLCA 4B4UA 2DE0X 4BNWA 2FPKA 1EVYA 2L0XA 3ZS9A 3V4SA 2YNMC 4R4TA 4M8LA 4A2CA 1S7GA 4CN9A 1BMFD 1R0RE 4HO1X 3ADOA 2OQ2A 3F8WA 4GLJA 4ZVOA 3UT0A 3ZGNA 1N9GA 3LBAA 4AZ3A 1CVLA 1Y1KE 3KHSA 3UB3A 3RUEA 1OREA 1A15A 2H08A 2X8JA 4LY6A 4CKWA 1HCZA 1GNQA 4OQPA 3B6KA 4KHZA 5EIAA 4Z1MD 1FPMA 1G3QA 3UWKA 5CHYA 5FA5A 5T67A 4AO6A 3BMQB 3NT4A 3O92A 1L5HB 2V7XA 3L9WA 3UENA 5C81A 1F2MA 4QEZA 3V2GA 3L6RA 1XMSA 2EJCA 1PRTF 4JELA 5JEDA 3RSGA 2P62A 2IOYA 3AI3A 1P33A 2DQ4A 1TUBB 2G6TA 2VNHA 3BFXA 3LXRA 4E31A 4CEHB 1YR1A 4J1SA 1IZYA 2VDUE 2BC9A 2ZSJA 5LYJA 2QX8A 3NGXA 3DMTA 1LPNA 3CLHA 3L5OA 2E5LQ 3LYHA 3C8ZA 4YMSA 4ZEWA 4TXJA 3HOXH 1RP7A 3PQ3A 4GKBA 5AW3A 5D1NA 2ZRCA 2HWXA 2FGJA 3TMAA 3E9HA 1EBFA 3DTNA 1HSOA 3AOEA 4BUCA 3KQLA 2F43B 1T29A 1LACA 1AHHA 1U9JA 4RL4A 5A7GA 3FUUA 4MZ9A 4QFCA 2ZJBA 2IYXA 3CUVA 3HN7A 3IELA 1TVMA 1U3WA 1GA6A 5TPZA 5KKNB 2OENG 4KYUA 4LAFA 3E22A 1E0BA 4M6WB 5ICMA 2V1UA 1Y4SA 2FZVA 1PUJA 1VHQA 1SWWA 5KYXB 4FS3A 4UEWA 4RKFA 1L1OA 1TIBA 1BX0A 1Z0FA 3GBSA 4NH4A 4PLVA 4R41A 4CFSA 1UM8A 1RM5A 3P9KA 1E3JA 5HS4A 2PGJA 1U0RA 1NVAA 2OV6A 3KAPA 3I8SA 3U4DA 1VA4A 4J2HA 4IVQA 2Q4OA 3W9YA 3WRXA 2DHEA 4K8JA 1FY2A 2WPDD 1FXWA 1G8JA 3DMNA 4AH6A 2PUHA 4ZPXA 4FKZA 3O8CA 2H8KA 4WZBB 5JD4A 5C1OA 3S1RB 1T0UA 3DE5X 1G6ZA 4ZCLA 3ZWKA 4MNOA 2WSLA 5CX1A 4W9RA 3TAXA 4JPBW 4KTVE 4BFWA 4LSZA 1JHMA 2DERA 5EJFA 3P2IA 3EB9A 5LR6A 1RKUA 3AR2A 5K0GA 2ZJAA 5A4DA 3R7WA 2WICA 4RTPA 5BN3A 4C3IG 1V26A 2AMYA 1NMEA 5GGYA 3WLQA 1DXHA 3CT6A 4DXGA 2HT6A 1H0SA 1VQ6A 1MVNA 2OAEA 4F87A 3C70A 3EJ6A 2NO1A 1LPPA 1LDYA 1D2EA 2H07A 1N33Q 5JJZA 2K2QB 3D8RA 2ZYIA 3QF4B 3SK4A 4ZO8A 4YJ2B 4QB4A 1YEZA 2Q99A 1ARZA 1XIVA 3NTQA 3HYLA 3RRFA 3VPXA 3WLIA 2XT0A 2DMRA 1QRTA 1VYVA 4IDOA 1U4RA 1JKJA 2YFQA 1NM5C 3U56A 2O5JC 4GXQA 4JVNA 4F38A 1Q1NA 4IFDJ 2Y2UA 4A3FB 3I2KA 4EUEA 1CQJA 4DV2Q 4KUHA 4U7FA 4F84A 3SQXA 2E2WA 4TMZA 4CMBA 3P20A 4ZN6A 3JWGA 2UAGA 1DRKA 2DCUA 3H42B 1GGJA 1Q2XA 2IPXA 1VGQA 4DCVA 1F9PA 4JI6L 5G4KA 2F0DA 2JLVA 2RHLA 1CP2A 1OH6A 1NDUA 2PCJA 3DMHA 1YDEA 3K09C 3H9BA 3BMCB 4JBHA 1XWIA 4BBSH 2X0RA 4UULA 3VH4A 4ZT2A 3TUIC 1AKWA 2RIRA 1FFXA 1SCDA 5EE9A 5M5WB 5ERYA 3OTOB 4D4GA 5BUZA 2XZLA 4DAEA 3VA5A 3JV7A 3T12A 1BBWA 4I46A 2DEUA 2P6MA 1ZHHA 5IYDG 1UQTA 4ZPJA 2QV7A 4Q7LA 4QVKA 3ACCA 3L84A 1E22A 3RASA 2WB1G 4CDFC 2C2GA 3CCMA 2PVCA 2B2WA 1HUMA 5K2MA 1IYZA 3DJFA 4BKOA 4MUNA 3SQLA 2IFTA 1BCRA 4URVR 4BB6A 1UDAA 4JQZA 4EB8A 3E9NA 1AT1A 3IT0A 1EQQA 5BSRA 1UK7A 2OT3B 2B8JA 4MUHA 4P8RA 1EGMB 3WWOA 4Q03A 1T0PA 5CDYA 5CFRA 3DM3A 2P9HA 2FPGB 3SJCA 3R9XA 1CRWG 4MMZB 3UGKA 5C2JB 1UBGA 3RGWS 5F1KA 1VJ0A 3IIJA 1X32A 4LRSB 5CK4A 5TSSA 4PF1A 1F4PA 5GV8A 2ZR9A 3H05A 1JDSA 3UJ3X 2V7BA 4BWYA 5GADl 1NTGA 4GZYC 2QG4A 5D00A 1FDTA 1N0WA 5A71A 4J49A 2J9ZB 3DHNA 3K0CA 3WRWA 1MB0A 2B5OA 2X0IA 1QQBA 1ZIPA 3AP2A 5DM70 1X19A 1SMXA 3VMMA 3ZU3A 2MR5A 1U9ZA 1BOSA 4WH0A 1FYXA 4NEHB 4JI8B 1W88A 2NOAA 2A0WA 3OJ0A 5FOSA 1YNSA 3K0SA 3NH6A 4JJEA 5DULA</