4JI3L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLWGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 17
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji3L00
4JG2A 1G291 1A0IA 1FVIA 5IYDH 2I5MX 1VQNA 3AEVA 3S1MH 4P75A 3L0OA 1YBYA 3F2DA 3ULJA 4JI5L 4JI2Q 3PIOA 4OX9Q 3PUZA 4DV4Q 2IHFA 4BY1G 1VQHA 2ZJQA 1UEBA 2HQLA 2K75A 4DV5L 4P73A 2I5HA 5GAEC 4DR5Q 1XNRQ 4YWKA 4GS3A 3CCEA 1WYDA 2K5NA 4A93G 4NXNL 1A8VA 4GOPA 4X64L 3LGJA 5M3FH 4A3LG 3Q8DA 4BXXH 4TQUS 1PYSB 1UE1A 4B3SQ 4YWLA 3CC2A 4LF9Q 1VQAA 2IX0A 4YCUA 1IYJB 2BH8A 4WJ4A 1GM5A 3I4OA 3J81j 1HR0W 3ICEA 1YNXA 1IBMQ 4WJ3M 1X54A 1L2FA 4OXPA 5JJKA 1PH4A 3I4MG 4JI7L 2LSSA 4A3CH 4O2DA 5IYDG 1WCMH 2K14A 3I55A 3G4SA 4L5SA 4LF6L 4A3BH 4JBMA 4JBKA 2Q2HA 4A3JG 5GQOA 1A63A 2NN6I 1I94L 1JMCA 3I4NH 1YHAA 4YCWA 1XMOL 1Y1WG 3HOUG 4QQBX 1PH6A 3PUXA 4A3EH 2KHJA 4R4TA 1VQIA 3GTJH 3CC4A 2RHQB 2N8NA 4HJ8A 1FJGQ 5GADC 2OQKA 5GAGC 3CPFA 3HOWG 2K52A 3M3YH 2OQ0A 4JBJA 1IBML 3KYHC 4K0KL 1Q1EA 3CAMA 4GLVB 3E9IA 3G48A 4GN4B 3M85A 1VQ4A 2R7FA 1GO3E 1HH2P 3CMEA 4JBWA 4C3JH 3J7ZC 4B3ML 2NVQH 2JA6H 4X65Q 1NE3A 5IT9c 2KENA 1S3OA 3T1HL 2RHSB 2K4KA 4JC0A 3K7AH 2B29A 2E2JH 4LFAQ 3GTMH 4XTCS 1UE6A 1XNQL 3TREA 2QGQA 4A3JH 2Z6KA 3E0EA 4LUZA 1KAWA 2RCNA 2V1CC 2NZOA 1VQLA 2E8GA 4LF4L 5C44H 3W1BA 1N32L 4GLAC 1CKOA 4IPDA 3K8AA 1E7ZA 4ME3A 5M5YH 1CSPA 2I0QA 3TRZA 2IY5B 4PMWA 3IRBA 3U58A 3PCOB 1HZ9A 2KHIA 1Q81C 1VQFA 2PQAB 3STBD 1K8GA 3BZCA 3PF4A 4JYAL 3L7ZC 3HOYH 4KI0A 1P8LA 3W1GA 1MIUA 4AH6A 1V1QA 2C35B 4RG1A 5GAHC 1N8RC 1N34Q 2H5XA 4BBRH 4A93H 2PNHA 3PV0A 3CCUA 4JI1L 3FKIH 3KFUA 1P16A 3RZOH 1VQ5A 4LW1A 4KHZA 1CUKA 2VS1A 3NBHB 1EIYB 1VQDA 3RN5A 1NJIC 1X6OA 4A3GH 4YCVA 1PH8A 3H3VH 4DR4Q 3BJUA 4L5QA 4JI1Q 5IYBG 4AYBG 5C3EH 1L1OA 1J5EL 2IHEA 4BY7G 1B70B 4LF8Q 2GVBA 3J7A5 1PVOA 1K8AC 1B7YB 1X3FA 1WCMG 1CSQA 4NXNQ 1QZHA 3W5OA 1E1TA 3HOZH 2OTJA 1CKMA 3RNUA 1Q86C 1N34L 4JI3L 2VUMG 4OO1I 2VY3A 3KLWA 4DV5Q 3ULLA 5IYCG 4A3EG 4YY3L 3D0FA 2ES2A 4DV0Q 4IFDI 2R6GA 3I2ZA 4LF7Q 2OTLA 3PUVA 1VQ9A 2DUDA 4POGA 2PQAA 4Y52H 1W3SA 2XGTA 4C3HH 4LF8L 5FLMG 1PH7A 2JJQA 3S1RH 1NBWA 2AMCB 1SRUA 3TS2A 4A3KG 4NXML 5AJ3L 4TVAB 1TWGH 4A3GG 4A3FH 2R7ZH 1Q12A 2Z6KC 4J15A 4DNIA 5C3EG 4R4CA 4X65L 3UE0A 1C9OA 4R4IA 1I5FA 3T1HQ 5JJLA 2B63G 4DV7Q 1G6PA 3T1YQ 4HIKA 1G51A 2CWPA 4BBSH 5IP7G 1OXUA 3H3VI 4A3DG 1YHQA 1R9TH 1VQCA 3S15H 5E7NA 2NVTH 4GKKQ 4UP7A 2ZJPA 1HNXQ 3HKZG 2CWAA 2JA8H 4DUYQ 3HOVH 2PI2A 4A76A 1KQSA 2OCEA 4OWWB 1IZ6A 3EIVA 2BH2A 2R7DA 1A62A 3UE1A 3PUWA 2MQHA 4A3IH 2JA5H 5IWAL 4L5TA 1YITA 1LTLA 4QY7A 3L2PA 2ZM6Q 2PMZE 3ER0A 1SR3A 5FJ8H 4POFA 1VQEA 1WI5A 3GO5A 4LWCA 3OTOQ 4UP8A 4JI7Q 3F1ZA 3GTLH 4OO1G 4LF6Q 5LMNW 5C4XG 3RR5A 2JK8A 1VCIA 1E1OA 3TEHB 2K5HA 4DR3L 5BR8L 3VDYA 3HKSA 1YJ9A 2N49A 2RF4A 1XPUA 1UE5A 1Q7YC 1EYGA 4KLKA 4HJ7A 3M4PA 1I6HH 1AE3A 2IT1A 3BZKA 2UXBQ 1Z47A 4DR5L 4JI8Q 2VQEQ 3CCMA 1SFOH 3HOVG 3HOZG 1K3RA 1L1OB 3S24A 3M7NA 1VQKA 4MZ9A 3B6YA 4R1JA 4EX5A 2VUMH 4JCVE 2UXDQ 1JE5A 4IOCA 4KHPL 2HHHL 1Q46A 4JI4L 2VW9A 3H15A 3NEMA 3NENA 3CCLA 3ULPA 2EIFA 2YTXA 2JA7G 3ZJYC 4PZ7A 5BR8Q 2FXQA 1V43A 1Q1BA 1X56A 2CFMA 5C4XH 1EQQA 5HGQA 5HY6A 4OWXB 3PO2G 4IFDG 2K5VA 3TQYA 2MNAA 4DV3L 2YTYA 1VS0A 1QVCA 3J81c 3F8TA 2NVYH 1Q8KA 1SN8A 2D0PA 4QL5A 1M90C 2B3GA 1LM0A 1JJ2A 4A3FG 4KHPQ 4BA1I 5IWAQ 4LF9L 1NY4A 1I3QH 1AH9A 1YHBA 1LUZA 4JI4Q 4QIWE 4QJFA 4B3RQ 1EOVA 2CCZA 2UXDL 1WJJA 3HFZB 1U5KA 4A3MH 5M3FG 3PO3G 4IFDJ 4GNXC 4BXXG 1XNRL 3CCSA 4JI8L 2VQEL 1EWIA 4A3DH 2WP8J 1IBKQ 3M9BA 4R4QA 1YIJA 4A3LH 4OX9L 4GN3B 3U50C 3GTKH 1KHIA 1HNZL 4IPGA 4IPHA 2NVXH 1OXTA 2HT1A 4AQYQ 1FGUA 1S40A 1KRTA 4IO9A 4DR3Q 2E2IH 4DV2Q 4JV5L 5LMNQ 1H95A 2R92H 5J3BA 2VNUD 5ELOA 2JEAI 4APVA 3GD7A 2ZTDA 3HOXG 2CQOA 5FLXc 2Q2UA 5GROA 1EIFA 1YVCA 2JQOA 2K50A 4DV6L 4HIOA 2NN6G 5LMNL 1YZ6A 5M3MH 3GTPH 5IP9H 1GD7A 2ZTCA 4DV2L 4JV5Q 4LFBQ 5C0XJ 4YWMA 1N33Q 3I4NG 4B3TQ 3J81i 4LNQA 4DUYL 4PG3A 1XMQQ 3CF5A 1M1KC 1FL0A 3UDGA 1BKBA 2F4VL 3S1QH 3H0GG 4BY1H 4GKKL 3I56A 4UPAA 1QVFA 3RLNA 3EBEA 4HJ9A 2AKWB 4UY8C 3GTGH 3NELA 4LF5L 3M4OH 1WOCA 4RMFA 1EFWA 1VQJA 1HNWL 4DAMA 2WAQE 1NMGA 4JI0L 3A74A 1K9MC 1SLJA 4BA2I 3PSIA 2A1AA 1VQBA 1HZAA 2JA6G 3AYHB 2F52A 3MXNB 4LFBL 4LUOA 3TS0A 5IY0A 1VQ8A 1VQ6A 1YJWA 3CCJA 1BVSA 5M3MG 2N78A 1HR0L 1AE2A 4A3CG 5DLQE 3PO2H 4A3BG 1PYBA 1NTGA 4DK3C 2R92G 2I5LX 3K80C 2DGYA 4XIGS 5C44G 4DV0L 4JOIA 5LMUL 1N9WA 4LF7L 2HHHQ 3PO3H 4JI3Q 1TXYA 4DV1L 4OWTB 2E5LL 1PHJA 1KL9A 1Y1WH 3HOUH 1C7YA 1Z9FA 5LMUQ 3AFPA 2JE6I 2YV5A 4HJ5A 4BBRG 4A75A 1PA6A 4QGUA 1EQRA 1TWFH 2VQFL 1TWHH 2ZJRA 1N32Q 3HOYG 3FKIG 1J5EQ 2GN5A 3A5UA 1GVPA 3KF6A 4DPGA 3F2CA 3DM3A 2WB1E 3KJPA 1J6QA 5ELNA 1SMXA 3CD6A 1RL2A 2UUCQ 4BY7H 3M4QA 3RZDH 3J80c 5IYBH 4YHHL 1PV4A 4X62L 2KBNA 2A19A 2CKZB 4X66Q 3KDFA 1CKNB 3CP0A 2OWOA 2ZTEA 4LFCQ 5C0XG 3CCRA 2UU9Q 3GDEA 3CCQA 4LUVA 5IYCH 4GLXA 4LF5Q 3J80i 1U0LA 1QZGA 3I7FA 1SROA 3UDIA 3WWVA 1PH3A 4K0KQ 1O7IA 4JI6Q 1YI2A 3OYYA 1OXVA 3H0GH 1XMQL 2NZHA 4HIDA 2QEXA 4JI6L 1LYLA 2AWNA 1HZBA 3PGZA 3GTQH 3A0JA 3RN2A 1XMOQ 3PUYA 3STBC 1YEZA 3K0XA 4P74A 3T1YL 1XJVA 3F2BA 4X66L 2UU9L 1UE7A 4GNXA 2LXJA 4LFCL 5M5XH 4O0AA 1XNQQ 3S2HH 1Y1VG 2YYZA 1VQOA 5M5WH 1XPRA 1OXXK 4LFAL 2UUCL 2YU9H 2R7ZG 3S17H 2WFWA 1S72A 3MEFA 4Y7NH 3JAMi 3U4ZA 2N3SA 3AQQA 1Q82C 4P71A 3PF5A 5AJ3Q 3G71A 4IJLA 2D0OA 3OW2A 2B63H 3S1NH 1UWVA 5IP7H 4MTNA 2VQFQ 1IBKL 2JA8G 1E24A 3CQZH 4C3IH 4P72A 2MFIA 1OTCA 1FJGL 3K7UC 5JEAJ 1E3PA 3HKZE 1HJPA 1QVGA 1PH2A 2R93G 3KF6B 4YY3Q 4B3RL 1KRSA 1TWCH 4DV4L 4JI5Q 1JT8A 4DV1Q 4A3IG 2AHOB 1X9NA 1VQMA 2JA5G 3FP9A 3D31A 1I94Q 1KXLA 4NB3A 4AIMA 1XPOA 1E22A 4HJAA 4DV3Q 3UDXA 1PH1A 5FLMH 5JEAG 1I50H 4X62Q 4YHHQ 4A3KH 2XTIA 2Y0SG 2A8VA 3FHWA 3CW2C 2EQSA 4DR4L 1D8LA 2QA4A 4HIMA 4DR1L 4OONA 1K73C 3GTOH 2HIVA 4AYBE 4GOPB 1DGSA 1X3GA 5H1SE 4B3SL 4DKAC 5JJIA 2JA9A 3BU2A 1OXSC 4FDBA 2L15A 3KOJA 3RLOA 1D7QA 1NMFA 1BBUA 4PZ8A 1ASYA 2E2HH 4IPCA 1TWAH 4BBSG 1HNWQ 4X64Q 4JOIC 1VQPA 4JYAQ 2UXBL 2HIXA 1WFQA 4ALPA 1IBLL 3AFQA 4MNOA 4DR2L 2E5LQ 3K81C 4JI2L 2R93H 1EUJA 3S14H 2WAQG 4NPSA 3UDFA 5C4JH 3ERSX 2Q2TA 2F4VQ 2JA7H 3HOWH 2Q2IA 1PH5A 4GOPC 1MJEA 2WB1G 4EQ5A 1JJCB 1HZCA 3E9HA 1X55A 2KCTA 3A5ZB 3RLFA 1YJNA 4LF4Q 1Y14B 1HR0Q 2ASBA 3I4MH 4H02A 3U4VA 3DLLA 1N33L 2BA1A 4DR7L 4GN5A 1VQGA 3CPWA 2MO0A 3OTOL 1IXRA 4UP9A 3S16H 5FJ8G 2AWOA 2ZM6L 4DV6Q 1K0RA 1L0WA 2KCMA 2UUBL 2UXCQ 1Y1VH 4R4OA 1BBWA 4IJHA 5C0XI 1KC8C 1KD1C 1ASZA 4DUZL 3PIPA 1KIXA 2IX1A 1SE8A 3CXCA 2JEBI 1QUQA 4A3MG 1HNZQ 4IOAA 4GKJL 1JJGA 4B3MQ 2F3IA 1N36L 3SGIA 4AQYL 3CCVA 1W2BA 4JI0Q 1X3EA 2BA0A 3KF8B 1X65A 1MKHA 5IE8A 3G6EA 4GNXB 1HNXL 4DR6L 1PFSA 2UUAL 1VQ7A 1QUQB 2ALYB 2LXKA 2VL6A 3S2DH 2YTVA 4DR2Q 1IBLQ 4X6AH 5K36G 1CKNA 2ATWA 2EXDA 1PH9A 1N36Q 4L5RC 4DAYB 2PI2E 2Z0SA 4PZ6A 4DV7L 2UUAQ 4DR6Q 2VZAA 2ID0A 3EN2A 4C2MH 1RIPA 1K83H 1XTDA 4B3TL 1JB7A 1B8AA 4GKJQ 3JAMc 2UUBQ 1IL2A 2UXCL 4DUZQ 4A4IA 1GKHA 3CMAA 2Y0SE 4DR7Q 1MJCA 3CC7A 4NXMQ 3JC66 4DR1Q 5IP9G 1T9HA 2D62A 4DK6C 3HOXH 1V9PA 5EAYA 3KDFB 2MO1A 1L1OC 2GVAA 3KJOA 1C0AA
chains in the Genus database with same CATH superfamily
1A0IA 5IYDH 5ISRA 3BG3A 1JR0D 2WB1B 4LJZC 4RFBA 3ZYYX 3F2DA 4J6HA 5KRUA 4JI5L 1Y1WB 3HOUB 2V4DA 2LMCB 1U9RA 1ENCA 4DR5Q 2B2UC 4YWKA 4IUVA 1XNRQ 4A93G 1HA5A 4X64L 4A3LG 5JPNC 4BXXH 4TQUS 1PYSB 1U4MA 4YWLA 3CC2A 1VQAA 1ILQA 4YCUA 1IYJB 5C4ZA 1GM5A 2FMMA 3GV6A 1YNXA 1LO5D 5FLXE 3I4MG 3GV3A 1AW7A 1V1OA 4O2DA 2B2UA 3I55A 3NQTA 2Q2HA 3KBXA 5G3LD 1YHAA 4QQBX 3OWFA 1EIGA 1LLRD 2KHJA 1VQIA 4HJ8A 2QF7A 2A73B 2OQKA 4LK1C 3CPFA 3HOWG 2K52A 2OQ0A 3E0JA 4GN4B 3I4NB 2DNCA 4JBWA 1KABA 4UAIA 2K4KA 1IW7D 5IODA 4CDCC 3ONAB 3IFTA 4XTCS 3E0EA 2EJFC 1ICFB 4K2KA 5ELBA 2RCNA 2E8GA 1IW7C 2ZXOA 3H6MA 4GLAC 1E7ZA 1CFMA 4ME3A 2I0QA 3HP3A 1W6KA 3QWNA 3HOZB 1HZ9A 2MUYA 3BZCA 2IX3A 3L7ZC 3HOYH 5JVG3 4A93H 1V1QA 5GAHC 4RG1A 2R92B 4ID6A 2PNHA 1SYBA 2KEDA 2E76C 3FDTA 1PTOH 3RZOH 1CUKA 1SYEA 3RN5A 1X6OA 5FOBB 3G6JB 3BJUA 4JI1Q 5E4XA 4BBRB 2IHEA 1CT1D 4DF7A 1K8AC 1CSQA 4NXNQ 1SNDA 1DOKA 1E1TA 1V1PA 1CKMA 2PYKA 4DK1A 3DUZA 4OO1I 3KLWA 4NMZA 3ULLA 3HKZB 1ESRA 1TY2A 1SFOB 1ET9A 4POGA 1DCZA 1W3SA 3DWQA 4C3HH 3S9WA 4FYDA 3S1RH 2AMCB 3L3OC 2RVLA 2Q8RE 3GTLB 1TWGH 1TR5A 4A3FH 2R7ZH 2Z6KC 5CC4A 4FF2A 1PZID 4RGOS 1DOLA 1PDQA 1FNWA 3EROA 3AB9A 3UI2A 1CHQD 3S14B 1VQCA 3HEJA 1UEAB 3S15H 4GKKQ 2QW7A 4FF4A 4Q0FA 4UP7A 4A3EB 2CWAA 2JA8H 4A76A 2R3ZA 1Q8IA 3C2PA 4OWWB 2BH2A 3D3RA 1A62A 5ELEA 2QCPX 2MQHA 4A3IH 4A3BB 5IWAL 4QY7A 4QCLA 4QB4A 3ER0A 1F2ZA 1VQEA 2JN4A 3GO5A 2F1MA 4OO1G 2CH4W 5LMNW 1ET6A 2JK8A 3KK7A 1SAPA 1E1OA 4P2CB 4DR3L 2KJXA 2F0OA 2EOTA 1MHWC 2RF4A 3M4PA 1JE4A 4DXFA 5C3WA 2UXBQ 1Z47A 2BDOA 5JOBA 2VQEQ 3CCMA 5DNFA 3S24A 3M7NA 4EX5A 1CQFA 3BVZA 4PNYA 3D4DA 4EQOA 4JI4L 1R4PB 3MXPA 3P75A 4PZ7A 2E74C 2FXQA 3J81L 1VF5C 1KDCA 1Q1BA 1X56A 2CFMA 2F0WA 4ZKBB 3KLRA 4IQZA 4H44C 2MNAA 4DV3L 2YTYA 1VS0A 3F8TA 1Q8KA 3SK6A 4CDEC 1AH9A 1BF4A 4IN3A 4JI4Q 4WJWA 1EOVA 2UXDL 1TS4A 3HFZB 1U5KA 3S2DB 2A74C 4GNXC 2PNRC 3P20A 4A3LH 1WD1A 3FRPB 3Q24A 4HR7B 3NTHA 2K5WA 3J7AV 1OXTA 2F0SA 2M9VA 4IUPA 4DR3Q 2E2IH 2H1EA 4KN7C 5LMNQ 1H95A 1YNJD 4BS9A 4R9WA 2PQEA 4OHJA 3GD7A 5FLXc 1O78A 4RHSA 1BO0A 4HIOA 3K7AB 2ZT9C 2NUCA 5D3IB 1LACA 2JA7B 1VMCA 2KOLA 1JOOA 1TWHB 2Q8IB 1XMQQ 1M1KC 1SYFA 1LTAD 1D2BA 3PO3B 3M7GA 2AKWB 4UY8C 4V190 4FVMA 1RD9D 3NELA 4LF5L 1WOCA 4RMFA 3VYRA 4XT1B 1HNWL 3M3YB 4DAMA 2WAQE 4JI0L 3A74A 1K9MC 1SLJA 1AEXA 4BA2I 2A1AA 4HSVA 5I4DA 3I90A 3D8GA 1VQBA 4LFBL 1EYAA 2SEBD 3S1RB 3TS0A 3H91A 2JP1A 4RH6A 3VR2A 1WTOA 4XIGS 1SE3A 1V1PB 5C44G 5C0XH 1N9WA 4JI3Q 1TXYA 1A6XA 1PHJA 1KL9A 3OWEB 1C7YA 2KCCA 4QF4A 1EY8A 3SVMA 2JE6I 3AFPA 3HOWH 3I72A 1PA6A 3PO3H 4H13C 1TWHH 1J5EQ 4WORA 3QO2A 2DJGC 4DPGA 4ZLTF 1ZEQX 1AZPA 3KJPA 1G91A 1D5XC 1EY6A 3O13A 4O1NA 3RZOB 1QE6A 1O7YA 3M4QA 2A6HD 1CA5A 2CKZB 3PQIA 2ZTEA 2BCOA 3S2HB 2UU9Q 5ELDA 3CCQA 1CZWA 1DD2A 3J80i 3I7FA 1PH3A 1LT4D 4KHVA 4C2MB 2KA7A 1B4OA 1RTNA 1GUTA 3BVGA 2F03A 4JI6L 3BDLA 3MC0B 5FLXL 3GQBA 1YEZA 4DFAA 3T1YL 2IWHA 2RDHA 1NUCA 1BQQT 2E75C 5M5WH 1XPRA 3ND9A 3AQQA 3PF5A 2F0EA 3MFGA 4K8IA 4HCEA 2JA8G 1E24A 1I4GA 3FVQA 1IHZA 1F2YA 5JEAJ 1HJPA 2XNAC 1EU4A 3HS0C 2IL8A 2R93G 3T53B 4YY3Q 3HG9A 3SK4A 1STGA 1JT8A 2JA5G 1VQMA 3FP9A 3D31A 4K5VA 4AIMA 4HAEA 4DV3Q 1PH1A 3L9AX 1CTMA 1SNPA 1I50H 4X62Q 4YHHQ 3URYA 2JYOA 2A8VA 3I8ZA 1Q90A 2B2TC 4DR1L 2Z6BA 5IT9L 4GOPB 1KDBA 1PTOF 5I6YA 5H1SE 4DKAC 3P7JA 5JJIA 4FDBA 3RLOA 2IW3A 3T51B 1KLGD 1NMFA 4IPCA 1TWAH 4EGVA 2JA8B 4RKLA 4KKTA 2A69C 2R93H 3AFQA 1ICWA 3K81C 3CRKC 1EUJA 3S14H 4NPSA 3UDFA 2F4VQ 1WD0A 2MHVA 1O7LA 2WB1G 3TP7A 1YJNA 1HZCA 1IKLA 1X55A 4EQPA 2ASBA 2IJ0A 2HCCA 2HD3A 4A3GB 1IXRA 4FP5D 5FJ8G 1K0RA 1L0WA 2KCMA 3HOXB 2UXCQ 1BBWA 2IX1A 3A7AB 1SE8A 2JEBI 5EBCA 1JJGA 2HQEA 3CCVA 4JI0Q 3T13A 3G6EA 3KF8B 1MKHA 3E6ZX 2VL6A 1EY0A 4IZ8A 1DM0B 4X6AH 2A6ED 1HCZA 4IALA 2ATWA 3G7LA 5M5YB 2NWGA 1I3QB 3QB3A 4C2MH 1XTDA 5AFWA 3JAMc 2EYLA 2DNEA 4ZKCB 3CMAA 2Y0SE 2K01A 1MJCA 5C4XB 1YNNC 5JEAH 4MN3A 2MO1A 3I91A 3KJOA 1HFGA 1TS2A 1PMRA 4JG2A 2OT2A 1G291 1FVIA 1TWFB 3S1MH 3L0OA 3MAQA 4KMUC 4JI2Q 4OX9Q 3PUZA 4DV4Q 2IHFA 1S5DD 1VQHA 1UEBA 2HQLA 2K75A 3PMFA 4ZCKA 4DV5L 4P73A 3J80E 1CM9A 2K5NA 3HOWB 5COYA 1A8VA 3CHBD 1F9RA 1RKNA 4RKBA 4B3SQ 3NP8A 2IX0A 2BH8A 3DXJC 4B9XA 3J81j 4N9TA 1EY5A 4QUFA 1U4LA 1L2FA 2SNSA 4M8AA 4OXPA 2O5IC 5JJKA 1EIHA 4IUUA 5IYDG 1GXDC 2JA5B 4JBMA 3JAML 3I4NH 4YCWA 4IUTA 1B9MA 1Y1WG 3HOUG 1PH6A 3PUXA 1PZKD 3OPOA 2K03A 1YNND 5M3FB 4OIJA 3MEHA 1A3UA 4CJ1B 3M3YH 1QB5D 5EQ0A 4K0KL 1H9JA 1FYCA 1VQ4A 1BOSA 4ME5A 1AFPA 2YU9B 3CMEA 4B3ML 2JA6H 2N88A 1JWMD 4X65Q 4JC0A 3K7AH 2Z4IA 4F87A 2CHBD 4LFAQ 1SNQA 2WKDA 3QJYA 1UE6A 5CGKA 1D6EC 3M4YA 2Z6KA 4B9WA 4LUZA 2KECA 5IGFA 5C44H 2B2YC 1STAA 5IGGA 1CKOA 3K8AA 3TRZA 4CKCA 3R2IA 1AN8A 1QWYA 3U58A 3PCOB 3STBD 1K8GA 3PF4A 3W1GA 2C35B 4RAUC 4KJNA 1Q3LA 4XQQA 3NBHB 5LHY1 3EQLC 4DR4Q 5C3EH 1VF7A 2CW0C 4LF8Q 2L4NA 3J7A5 1PVOA 1B7YB 3Q6SA 1B1ZA 1R4QB 2PCFB 5C5MA 1RF2D 2EY1A 5J1ZA 4DV5Q 3D0FA 2ES2A 4DV0Q 4ZK9B 1BDOA 4IFDI 2R6GA 1TIID 4X3KA 3PUVA 1VQ9A 2PQAA 1G2TA 5C6AA 1PRTC 1SXTA 4LF8L 5FLMG 1SRUA 2PPBC 4KN4C 5T1GA 5AJ3L 4PQXA 5CV6A 4KJOA 1SBBB 3A55A 4J15A 4DNIA 5C3EG 4R4CA 3I4MB 1C9OA 2F0VA 2E2JB 2B63G 1FNVA 1G6PA 4HIKA 1NNXA 1G51A 5IP7G 1VDZA 2NVTH 2QDBA 4RWSC 1C48A 4DUYQ 3KLSX 3NSWA 3TP6A 1KNEA 2WACA 2EJMA 5HURA 2R7DA 5IGBA 3PUWA 2RSNA 2JA5H 1I4QA 3X3NA 3DEPA 1LTLA 1YITA 1SYDA 3OSOA 2ZM6Q 2QILA 5FJ8H 3FPPA 1STHA 1T5EA 2KUMA 4DAVA 5C4XG 2C5CA 1K28A 2CQAA 3I4LA 4A3FB 5BR8L 1I6VC 3VDYA 1B9NA 3HKSA 1HQRD 3BVMA 2N49A 1Q7YC 3Q22A 3Q23A 1I6HH 1AE3A 2RKSA 1IL8A 4C3HB 1SFOH 1O80A 3HOZG 1L1OB 4DXGA 1VQKA 3VYUA 4MZ9A 3B6YA 2VUMH 3S1MB 2UXDQ 1PZJD 2NVYB 1PRTB 2HHHL 4KHPL 3NENA 2EIFA 2JA7G 2PZUA 3ZJYC 5BR8Q 3RMHA 5C4XH 4KTAA 4IFDG 2NB0A 3TQYA 5EPJA 3NK9A 2D0PA 4MTKA 1GUNA 1JJ2A 1TY0A 4KHPQ 1NY4A 1I3QH 1PTOB 2F0GA 4QJFA 4B3RQ 5KEEA 3H0GB 3C46A 1CZGA 3PO3G 4DGZA 3X3MA 2VUMB 2Z8LA 1XNRL 4BXXG 3CCSA 2VQEL 5IIFA 1EWIA 4LMQD 4J8QA 4RGTA 4R4QA 4OX9L 3U50C 4A3JB 1KHIA 1HNZL 4IPHA 2NVXH 2BOSA 4F8MA 1S40A 3LWUA 3GP7A 1ZYRD 5J3BA 4APVA 1GJXA 5GROA 1YVCA 2F3VA 2JQOA 5IGCA 5FO9B 5M3MH 5IP9H 2ZTCA 4PMCA 1B2TA 4YWMA 1N33Q 3I4NG 1LV9A 1PFNA 1ZKOA 4JW0A 4B3TQ 4DUYL 3CF5A 3NHHA 1HTLD 3QG1A 2X6LA 4BY1H 3I56A 3GTJB 1NR2A 3RLNA 4HJ9A 4L63B 3GTGH 4H7BA 3BDOA 2MP1A 2EY2A 3PSIA 4KY7A 2JA6G 2KQ3A 4FXDA 2F52A 1PRTF 4NKLA 2LY7A 1JCKB 3U9SA 5IY0A 2F0QA 3EJIA 1BVSA 4HMIA 5M3MG 3J81E 2EYOA 2NTSA 5CYUA 1SJHD 3A56A 2NTTA 2BE5C 4DV0L 4JOIA 3GTKB 3TDQA 1KNAA 3EVQA 2HHHQ 1FNUA 2PMZB 5EPLA 1Z9FA 4PMBA 4FXGC 4HJ5A 3S1QB 4QGUA 4PV1C 2VQFL 3Q0AA 2ZJRA 1Y69U 1N32Q 4I7ZC 3A5UA 1DYQA 1HUMA 1FGBD 3NXWA 3DM3A 3W2DA 3I70A 2UUCQ 1M4VA 3NWSA 3J80c 4YHHL 4X62L 1A15A 2KBNA 1LT6D 1CKNB 5LL6X 5C0XG 3CCRA 1NAPA 4LUVA 3A8KE 3KBGA 4LF5Q 1U0LA 4K0KQ 5BN4A 1B53A 3OYYA 1QNUA 2A68C 1XMQL 1AZQA 4HN7A 3PGZA 2KEEA 1RDPD 1XMOQ 5C44B 3DWAA 2EZVA 1BCPF 5E1FA 5E3FA 1XNQQ 1X3PA 4O0AA 5EKIA 3QOLA 3MZ5A 4GZYC 1BCPC 2O5JC 3SDZA 4KD3A 4NDXA 5AJ3Q 2B63H 3OW2A 3A7LA 1UWVA 1K3BC 5JAVA 5IP7H 4XDXA 1OTCA 4O42A 1LTTD 1E3PA 3CRLC 3KF6B 1KRSA 4DV4L 1X9NA 3QOJA 1KXLA 1XPOA 5FLMH 4G4KA 5JEAG 4A3KH 2OF1A 3C1FA 1U4PA 1Y8PB 2B2WC 2EQSA 1F9QA 2B39A 1D8LA 3MXGA 2QA4A 1K73C 4DR4L 3PO2B 2HIVA 1K8OA 1T5XD 1DGSA 1X3GA 1ILPA 4B3SL 3OIPA 2JA9A 3BU2A 5IT9E 1OXSC 3KOJA 5I6WA 1PTOC 1E2WA 2ZXRA 4BBSG 4X64Q 1I4PA 1VQPA 2UXBL 3VYSA 1BCPD 3H94A 2E5LQ 4JI2L 5C4JH 2IPKD 4DU9A 2JA7H 2B63B 2A68D 1QNKA 1B3AA 4C56C 4C3IB 1MJEA 4YIJA 2GA4B 2KCTA 4LF4Q 4C1NI 3J7AF 1KTKA 1Y14B 3MFYA 3DHQA 4H02A 3U4VA 1N33L 2BA1A 1PFMA 2B2VA 2MO0A 2EJGC 3SHLA 1ENAA 1Y8OB 2UUBL 1KD1C 4LFBQ 4IJHA 1U4RA 3AMUA 2AUKA 3FKIB 5FO8B 3ND8A 4N9PA 1HNZQ 4IOAA 1N36L 3SGIA 3T4AC 1W2BA 1WTRA 4GNXB 4DR6L 1GUOA 4S3SA 5CV5A 5EGTA 3S2DH 1EYDA 1TS5A 1KLUD 5K36G 1CKNA 1SMYC 4DAYB 2PI2E 4OIKA 1XYIA 2UUAQ 1J8IA 2ID0A 4C3JG 4ZYSA 2R61A 1JB7A 4GKJQ 2UXCL 3EA6A 4A4IA 3N52A 4NW2A 3GTMB 2J0TD 5IP9G 3HOXH 3KDFB 1C0AA 4BY7B 3NWTA 1BNZA 2HCIA 3HGBA 1VQNA 2XSCA 4P75A 3ULJA 1S5CD 4BY1G 2LFNA 2XRQD 5GAEC 2Z1CA 2WKCA 1EQVA 3CCEA 4UHVA 5NUCA 4NXNL 2R93B 2K32A 3LGJA 3R93A 3N6RA 1UE1A 4LF9Q 4I7AA 4WJ4A 5IGEA 1WVLA 2WINB 1NSNS 1X54A 4CJ2C 5KNBA 3JAME 1E2ZA 3FEWX 4JI7L 5J22A 2LSSA 4XQJA 2VB2X 1HTPA 1KDAA 2NN6H 4A3IB 1I50B 4L5SA 4A3BH 4A3JG 1A63A 2NN6I 4V0BA 3VR6A 1XMOL 3IL8A 4A3EH 2JXMB 3CC4A 3GTJH 2RHQB 2N8NA 1FJGQ 4BY1B 5I9PA 3S15B 1ONLA 2SDFA 4JBJA 2KHSA 3KYHC 1Q1EA 3M85A 3E9IA 1HA6A 2E2DC 1EFID 4HSPA 1H9RA 4C3JH 4BBSB 1XTCD 1NE3A 5IT9c 1VMPA 1S3OA 2TMPA 2L55A 2RCFA 2MJ8A 3HRZC 3GTMH 2O4XA 3CKIB 2F0JA 2QGQA 4KY5A 4A3JH 4XQNA 1BR9A 4K2LA 4DNRB 2NZOA 3MVVA 4LF4L 4HCSA 1TKWB 3W1BA 1N32L 4IPDA 1DJRD 2PZTA 2IY5B 4PMWA 2XVSA 4TKOB 1L0XB 2EPBA 2KHIA 4DAPA 4K14A 1VQFA 1WTHA 1SE4A 4X3TA 3V96A 4G7HC 1EWCA 1H9KA 2XRSD 1PYWD 1G2SA 2OXPA 1P8LA 4A3MB 3I3CA 4AH6A 1N8RC 4BBRH 3PV0A 3FKIH 4LW1A 1VQDA 5IYBG 4AYBG 1DONA 1L1OA 1J5EL 1B70B 3HOYB 2K6AA 1WCMG 3IKJA 1QZHA 4CHTB 3BYYB 3HOZH 2OTJA 3RNUA 1Q86C 4JI3L 2VUMG 2EDGA 3D4RA 4A3EG 4YY3L 2EE1A 2FMCA 2RDFA 5FK9C 2OTLA 4LF7Q 1HHVA 2DUDA 2I07B 4J1MA 2F0NA 1EOTA 1HQMC 3J80L 2WV6D 4HEDA 1CQVA 1PH7A 2JJQA 3A8IE 1NBWA 4IFDH 4A3KG 5DM63 4NXML 4TVAB 2KVMA 1MGSA 4R4IA 1I5FA 2HDLA 4XT3B 3M4OB 3T1YQ 4FF1A 4BBSH 3H3VI 1R9TH 2NVTB 5BN5A 3LWEA 2ZJPA 1HNXQ 3HKZG 3NE5B 3W3AA 3HOVB 2PI2A 2OCEA 1WTVA 4CGYB 4IUNA 3I73A 4L5TA 4CDFC 2PMZE 1GHKA 4LWCA 4JI7Q 4MHEA 4UP8A 3F1ZA 4KD4A 1VCIA 2EYMA 3NUCA 2E2IB 5CV7A 4F7XA 1XPUA 4KLKA 5K36H 2BE5D 2CVRA 2IT1A 3K59A 3OHXC 2LS01 2DY7A 1IYUA 1SNCA 4JI8Q 3CQZB 4R1JA 4MIUA 3TMEA 3NEMA 1NR4A 3CCLA 4RGMA 2M2LA 1RHPA 2F0HA 3NTIA 5M9OA 2Y0SB 1EQQA 1JWSD 5KNDA 5HY6A 2B8GA 2K5VA 4ULLA 4DN4M 3J81c 1QVCA 1IBML 1SN8A 3D4WA 2XIWA 3OMGA 1K83B 4BA1I 5IWAQ 5JVH3 1XX8A 4QIWE 1QOHA 2B2TA 2CCZA 4IFDJ 2K1BA 2N55A 1WTXA 2WP8J 1IBKQ 1XWEA 1J9OA 1S5FD 2EVBA 4GN3B 4X3SA 3GTKH 4DAYA 2F4IA 4IPGA 4K5XA 2HT1A 1FGUA 4IO9A 2F0TA 2K5DA 3SXHA 2F0KA 1MI2A 1TVXA 2XN9C 4FXKC 2O2LD 2JEAI 3HOXG 2K50A 1SDFA 5EKLA 2NN6G 1CK1A 1YZ6A 2P5ZX 5LMNL 3GTPH 1CI3M 1GD7A 1STEA 3J81i 2A6HC 4JK1C 4RCNA 1FL0A 3UDGA 1BKBA 4DNTB 4FF3A 3NTKA 1B44D 4GKKL 1QVFA 3A54A 3TP5A 3M4OH 1A2UA 1BCPB 1YNJC 2TSSA 1EQTA 2EYPA 2VXWA 4KY6A 3GTOB 2PO4A 1BUVT 4K6LA 1KAAA 2MPMA 1VQ8A 2Z4HA 2N78A 4A3CG 2K05A 4AYBB 1SMYD 3K5NA 3PO2H 5K5PA 4A3BG 1PYBA 4DK3C 2I5LX 3K80C 2DGYA 4CKEA 5LMUL 2EYJA 4LF7L 2F3WA 5E4WC 4DV1L 5TSSA 1EZ6A 2SNMA 4JVZA 4OWTB 5LMUQ 5A35A 4A75A 1QCBD 1TWFH 2F0DA 1GVPA 1HPCA 3KF6A 3F2CA 4Y7NB 3K5MA 3MWYW 3S17B 2WB1E 1F9SA 1J6QA 5ELNA 1SMXA 4ABNA 1W6JA 5HGTA 2D5DA 2SOBA 4KV6A 1EY9A 3RZDH 5IYBH 5KNCA 3TN2A 3CP0A 4G57A 2OWOA 2LKVA 1EEFD 1H9SA 3WWVA 3UDIA 1GUWA 1BXTA 4JI6Q 3TSSA 1YI2A 1SSOA 1OXVA 2NZHA 4ODGA 4ZRZA 2QEXA 2AWNA 3OW7A 3H09A 1K8MA 3STBC 5CBEE 1D1IA 1GUSA 4CKBA 2UU9L 1STBA 1LT3D 2LXJA 4LFCL 1TT2A 1H9SB 2K04A 2YYZA 2UUCL 5KYIA 3MEFA 2ENBA 2N3SA 3G71A 4IJLA 2WIIB 3C3LA 1IBKL 2VQFQ 1EZ8A 3WOEA 3CQZH 2B2WA 1B50A 3K7UC 3HKZE 2F0IA 1D5ZC 1TWCH 1SNMA 2D9UA 1FD7D 1LTID 4ZUIA 4JI5Q 1QJOA 2J4XA 5J39A 4F88A 1I94Q 1E22A 1D5MC 3UDXA 5C3XA 1SJED 3CU7A 4C3HG 2Y0SG 3FHWA 1I4XA 2EYHA 3CW2C 3HZXA 4Y52H 3NPPA 5CV8A 5KIXA 3E3XA 5LL6S 2L15A 4FO2A 3SK5A 2HUGA 4WFN3 4U68A 1Z7TA 1D7QA 1BBUA 5CORA 1HNWQ 1EU3A 2HIXA 1IBLL 4MNOA 1TWCB 3ERSX 5IOCA 3GTGB 1JICA 1PH5A 2NZ1D 4EQ5A 3A5ZB 3E9HA 3RLFA 5M5WB 1HR0Q 3OIQA 2L9HA 1MSGA 4DR7L 4GN5A 5JPMC 3OTOL 1HXYD 4UP9A 2K7VA 3S16H 2FFKB 3QIAA 3T16A 5C0XI 1KC8C 1RCVD 4DUZL 3PIPA 1KIXA 3CXCA 2B2YA 4B3MQ 4Z9CB 1X3EA 2BA0A 1HNXL 1X65A 4A3DB 1VQ7A 2NVXB 1EL0A 2G9HD 2YTVA 1LT5D 3DEOA 5EJWA 4M1UB 5C5LA 2EXDA 1PH9A 4L5RC 1GHJA 4PZ6A 4CDDC 4DV7L 2VZAA 1F77A 1RIPA 3BDCA 4G7ZC 1EWHA 1B8AA 1F2MA 3BZDB 1HRJA 4DUZQ 2A6EC 2FJ2A 2CH4A 3JC66 3CC7A 1Y1VB 4DR1Q 2D62A 4DK6C 3U9OA 3TZUA 3RZDB 1LTGD 3F2UA 5C4JB 2I5MX 2K5QA 3AEVA 1YBYA 1JB3A 3PIOA 1F9PA 2ZJQA 1DXMA 1I4HA 1RTOA 2I5HA 4GS3A 3PIP3 1WYDA 2L5TA 4GOPA 3BS1A 5M3FH 1SE2A 3Q8DA 5CV4A 3TZDA 3AU7A 1GUGA 2E2HB 1SYGA 1ZYRC 3V05A 3I4OA 4OGQC 1HR0W 1I6HB 3ICEA 4A3KB 1IBMQ 4WJ3M 1A2TA 1PH4A 1GOZA 1PXUA 4A3CH 1WCMH 2K14A 4C3JB 3G4SA 4LF6L 4JBKA 5GQOA 1I94L 2FHTA 1JMCA 2EYFA 3DWPA 4R4TA 3MXNA 5GADC 1RODA 5GAGC 1H9MA 3CAMA 4GLVB 3G48A 2R7FA 1UNSA 1GO3E 1HH2P 3J7ZC 2NVQH 2KENA 3K57A 3T1HL 2RHSB 2B29A 2E2JH 4RGNA 5C4HA 4JPBW 1XNQL 4K6DA 3TREA 4OL7A 4EVOA 1KAWA 2V1CC 5DM73 1VQLA 2PW5A 1V8QA 3SE0A 3WOFA 1UAPA 1LTRD 5M5YH 1CSPA 4RHRA 3IRBA 3IAYA 1Q81C 2PQAB 2MGSA 4JYAL 5EPKA 4KI0A 1MIUA 1S4ZA 2DN8A 1N34Q 2H5XA 2L11A 3CCUA 4JI1L 3KFUA 1P16A 1VQ5A 1ZXTA 4KHZA 2VS1A 4RA8A 1EIYB 1JC7A 1F2LA 1PTOD 5C3EB 2M00A 2DY8A 4YCVA 1NJIC 1PH8A 3H3VH 4A3GH 4L5QA 3IFDA 2G5DA 4BY7G 2GVBA 2HDMA 2NBFA 1X3FA 2ICEC 3W5OA 1NCVA 1N34L 1O7ZA 1BBXC 2VB3X 4TSSA 2VY3A 5IYCG 1WTWA 4FNFA 1E2VA 3I2ZA 5G3LF 3H3VC 1II3A 4N8FA 1TWAB 3ERQA 2XGTA 1DOMA 2XWJB 3TS2A 5DEHA 4U673 4ZAIA 4KKUA 4OO1H 4A3GG 1JWUD 1PRTD 1Q12A 1C8CA 1XXGA 4X65L 5D65A 3UE0A 1A3TA 3T1HQ 5JJLA 3VR4A 4DV7Q 2CWPA 2JA6B 1OXUA 4A3DG 1YHQA 4G7OC 5E7NA 3MTSA 4LAAA 3D6WA 4IURA 4R8NA 2PW7A 1SEBD 1EY4A 2I46A 4B08A 3HOVH 1KQSA 1IZ6A 3FMCA 5M3MB 3EIVA 3J7YW 1HFNA 3UE1A 1R9TB 1WCMB 2B2VC 3L2PA 4TRDA 1TWGB 1SR3A 4POFA 1PFBA 1WI5A 1D1KA 2RSOA 3OTOQ 2AQ2B 3GTLH 4LF6Q 3RR5A 1TS3A 3LX0A 1M8AA 3TEHB 1MSHA 1LTSD 2K5HA 1IKMA 1YJ9A 3MXUA 1CHPD 1Z6HA 2BDNA 3VR5A 3ITPA 4OEMB 1UE5A 1EYGA 4DK0A 4HJ7A 3BZKA 4N8X1 3E5SA 4DR5L 3HOVG 1K3RA 4L6TB 5I9OA 2F0LA 4JCVE 5EKKA 1JE5A 4IOCA 1HUNA 1Q46A 2VW9A 1ENFA 4EQNA 3H15A 1A3VA 3ULPA 2YTXA 1C4QA 4QIWB 2RQXA 4E6IA 1V43A 3R2TA 5HGQA 3T56B 1SYCA 4OWXB 3PO2G 4KKSA 4KK7A 1E0BA 2NVYH 3OOCA 2R92H 4ZUJA 4QL5A 1M90C 4A93B 2B3GA 1LM0A 3D6CA 4A3FG 4UDUC 4R8IA 4LF9L 1Y8NB 1YHBA 4CBVA 1RJTA 1LUZA 1TQOA 1STNA 2QDLA 1WJJA 4A3MH 5M3FG 5A2QL 5KGUA 4JI8L 1WTQA 4ILWA 4A3DH 3M9BA 1YIJA 1AP0A 3P1HA 4X3UA 4XXEA 4AQYQ 3S16B 1KRTA 1X3QA 4DV2Q 4JV5L 1S5ED 3QR8A 2VNUD 5ELOA 2ZTDA 3RD4A 2CQOA 2DJFC 2CW0D 4DV6L 1EIFA 2L12A 2A69D 2Q2UA 3C1EA 3V2TA 4DV2L 3K5LA 3FPUB 2AQ1B 4JV5Q 5C0XJ 4LNQA 2RDGA 4PG3A 2F4VL 3S1QH 3H0GG 5EBDA 1STYA 4UPAA 3EBEA 2X69A 1PLFA 3KLSA 5L37A 1EFWA 1B3QA 1VQJA 2L1BA 1NMGA 2C9OA 1HZAA 1ESFA 3AYHB 3MXNB 4ZQ3A 5BN3A 4LUOA 2G9DA 5KYLA 1VQ6A 1YJWA 3CCJA 2WAQB 3VA7A 1QG7A 1AE2A 3SK8A 3SR1A 1HR0L 5DLQE 4C3IG 1NTGA 2R92G 4BWGB 1IYVA 4C1NK 5T1IA 4DA2A 5CBAE 1MD2D 4XYOA 2E5LL 1Y1WH 3HOUH 1UUPA 3R3OA 2YV5A 3KUPA 4BBRG 1EQRA 4HTHA 3HOYG 3VYTA 1L0YB 3FKIG 2GN5A 3NBHA 5I2YA 1EEID 1TU2B 1I4RA 4QUCA 2AQ3B 2B8FA 3MHBA 3CD6A 3EFXD 1RL2A 5I2XA 4BY7H 4WRDA 2A5HA 1PV4A 2A19A 4X66Q 3KDFA 4LFCQ 5DAUA 3GDEA 5IYCH 4GLXA 1JOKA 1K0SA 2H4OA 1QZGA 4NP5A 1FR3A 1SROA 5CV9A 1O7IA 3H0GH 4HIDA 3K5OA 1LYLA 3GTQH 1HZBA 3A0JA 3RN2A 3PUYA 2ZXPA 4HMJA 3K0XA 4P74A 1XJVA 4XYQA 4X66L 3F2BA 2F0PA 3LNNA 1UE7A 4GNXA 5M5XH 5D14A 3S2HH 1Y1VG 1VQOA 5IGDA 1OXXK 2FINB 4LFAL 2Q8TA 3SEBA 2YU9H 2R7ZG 3S17H 2WFWA 1S72A 4Y7NH 3JAMi 2Z9HA 3U4ZA 1Q82C 4P71A 5JJZA 2D0OA 3VA5A 1X32A 2NVQB 3S1NH 1ML0D 4L8JA 2L0CA 2NYZD 4MTNA 2ICIA 4IUQA 2K28A 4C3IH 4P72A 2MFIA 1FJGL 5ELCA 1QVGA 4Q5VA 3NQIA 1PH2A 4B3RL 4K8JA 2JSOA 3BYTB 2EXZA 4DV1Q 4A3IG 2AHOB 5FKAC 3WDNA 3RUZA 3TBIB 3PIO3 4NB3A 3TP8A 5A2QE 4HJAA 2QKIC 1WTPA 2XTIA 2XWBB 1JQYD 4K5WA 1JORA 2R7ZB 4HIMA 3GTOH 5CMDA 4OONA 1JOQA 4AYBE 4H0LC 3K0YA 3OMCA 1OO9B 2F0UA 2K33A 4PZ8A 1ASYA 2E2HH 5ELFA 3R8BA 1LABA 4JOIC 2F0FA 4JYAQ 1WFQA 4ALPA 4DR2L 2WAQG 5D3DA 1CA6A 3S1NB 2Q2TA 1MBYA 4OELB 2Q2IA 3K58A 4GOPC 3GTPB 1JJCB 1G8ZD 1QILA 3MA2B 3I4MH 3DLLA 2AUJD 5M5XB 1VQGA 1S5BD 1SNOA 4I65A 3CPWA 2KCNA 2X6GA 2EY6A 4DV6Q 2AWOA 2ZM6L 3DM1A 3VR3A 1DZ1A 1Y1VH 2J7ZA 4R4OA 1ASZA 4QMGA 3GTQB 1QUQA 4A3MG 4GKJL 2F3IA 4AQYL 3KF8A 5IE8A 3A8JE 1PFSA 2UUAL 2F0MA 1QUQB 2ALYB 2LXKA 4DR2Q 4CJ0B 1IBLQ 2RBMA 2RA4A 1N36Q 2Z0SA 2D2CC 2EY5A 4DR6Q 3EN2A 1EYCA 1K83H 4RCOA 4B3TL 5CR3A 2UUBQ 3DMUA 1IL2A 1EY7A 1GKHA 3NBIA 1G6ZA 2OEOA 5F2DA 5FO7B 4DR7Q 4NXMQ 1T9HA 2QEJC 1V9PA 5EAYA 2PZWA 1L1OC 2GVAA 1LTBD 3K6OA
chains in the Genus database with same CATH topology
4JG2A 1G291 1A0IA 1FVIA 5IYDH 2I5MX 1VQNA 3AEVA 3S1MH 4P75A 3L0OA 1YBYA 3F2DA 3ULJA 4JI5L 4JI2Q 3PIOA 4OX9Q 3PUZA 4DV4Q 2IHFA 4BY1G 1VQHA 2ZJQA 1UEBA 2HQLA 2K75A 4DV5L 4P73A 2I5HA 5GAEC 4DR5Q 1XNRQ 4YWKA 4GS3A 3CCEA 1WYDA 2K5NA 4A93G 4NXNL 1A8VA 4GOPA 4X64L 3LGJA 5M3FH 4A3LG 3Q8DA 4BXXH 4TQUS 1PYSB 1UE1A 4B3SQ 4YWLA 3CC2A 4LF9Q 1VQAA 2IX0A 4YCUA 1IYJB 2BH8A 4WJ4A 1GM5A 3I4OA 3J81j 1HR0W 3ICEA 1YNXA 1IBMQ 4WJ3M 1X54A 1L2FA 4OXPA 5JJKA 1PH4A 3I4MG 4JI7L 2LSSA 4A3CH 4O2DA 5IYDG 1WCMH 2K14A 3I55A 3G4SA 4L5SA 4LF6L 4A3BH 4JBMA 4JBKA 2Q2HA 4A3JG 5GQOA 1A63A 2NN6I 1I94L 1JMCA 3I4NH 1YHAA 4YCWA 1XMOL 1Y1WG 3HOUG 4QQBX 1PH6A 3PUXA 4A3EH 2KHJA 4R4TA 1VQIA 3GTJH 3CC4A 2RHQB 2N8NA 4HJ8A 1FJGQ 5GADC 2OQKA 5GAGC 3CPFA 3HOWG 2K52A 3M3YH 2OQ0A 4JBJA 1IBML 3KYHC 4K0KL 1Q1EA 3CAMA 4GLVB 3E9IA 3G48A 4GN4B 3M85A 1VQ4A 2R7FA 1GO3E 1HH2P 3CMEA 4JBWA 4C3JH 3J7ZC 4B3ML 2NVQH 2JA6H 4X65Q 1NE3A 5IT9c 2KENA 1S3OA 3T1HL 2RHSB 2K4KA 4JC0A 3K7AH 2B29A 2E2JH 4LFAQ 3GTMH 4XTCS 1UE6A 1XNQL 3TREA 2QGQA 4A3JH 2Z6KA 3E0EA 4LUZA 1KAWA 2RCNA 2V1CC 2NZOA 1VQLA 2E8GA 4LF4L 5C44H 3W1BA 1N32L 4GLAC 1CKOA 4IPDA 3K8AA 1E7ZA 4ME3A 5M5YH 1CSPA 2I0QA 3TRZA 2IY5B 4PMWA 3IRBA 3U58A 3PCOB 1HZ9A 2KHIA 1Q81C 1VQFA 2PQAB 3STBD 1K8GA 3BZCA 3PF4A 4JYAL 3L7ZC 3HOYH 4KI0A 1P8LA 3W1GA 1MIUA 4AH6A 1V1QA 2C35B 4RG1A 5GAHC 1N8RC 1N34Q 2H5XA 4BBRH 4A93H 2PNHA 3PV0A 3CCUA 4JI1L 3FKIH 3KFUA 1P16A 3RZOH 1VQ5A 4LW1A 4KHZA 1CUKA 2VS1A 3NBHB 1EIYB 1VQDA 3RN5A 1NJIC 1X6OA 4A3GH 4YCVA 1PH8A 3H3VH 4DR4Q 3BJUA 4L5QA 4JI1Q 5IYBG 4AYBG 5C3EH 1L1OA 1J5EL 2IHEA 4BY7G 1B70B 4LF8Q 2GVBA 3J7A5 1PVOA 1K8AC 1B7YB 1X3FA 1WCMG 1CSQA 4NXNQ 1QZHA 3W5OA 1E1TA 3HOZH 2OTJA 1CKMA 3RNUA 1Q86C 1N34L 4JI3L 2VUMG 4OO1I 2VY3A 3KLWA 4DV5Q 3ULLA 5IYCG 4A3EG 4YY3L 3D0FA 2ES2A 4DV0Q 4IFDI 2R6GA 3I2ZA 4LF7Q 2OTLA 3PUVA 1VQ9A 2DUDA 4POGA 2PQAA 4Y52H 1W3SA 2XGTA 4C3HH 4LF8L 5FLMG 1PH7A 2JJQA 3S1RH 1NBWA 2AMCB 1SRUA 3TS2A 4A3KG 4NXML 5AJ3L 4TVAB 1TWGH 4A3GG 4A3FH 2R7ZH 1Q12A 2Z6KC 4J15A 4DNIA 5C3EG 4R4CA 4X65L 3UE0A 1C9OA 4R4IA 1I5FA 3T1HQ 5JJLA 2B63G 4DV7Q 1G6PA 3T1YQ 4HIKA 1G51A 2CWPA 4BBSH 5IP7G 1OXUA 3H3VI 4A3DG 1YHQA 1R9TH 1VQCA 3S15H 5E7NA 2NVTH 4GKKQ 4UP7A 2ZJPA 1HNXQ 3HKZG 2CWAA 2JA8H 4DUYQ 3HOVH 2PI2A 4A76A 1KQSA 2OCEA 4OWWB 1IZ6A 3EIVA 2BH2A 2R7DA 1A62A 3UE1A 3PUWA 2MQHA 4A3IH 2JA5H 5IWAL 4L5TA 1YITA 1LTLA 4QY7A 3L2PA 2ZM6Q 2PMZE 3ER0A 1SR3A 5FJ8H 4POFA 1VQEA 1WI5A 3GO5A 4LWCA 3OTOQ 4UP8A 4JI7Q 3F1ZA 3GTLH 4OO1G 4LF6Q 5LMNW 5C4XG 3RR5A 2JK8A 1VCIA 1E1OA 3TEHB 2K5HA 4DR3L 5BR8L 3VDYA 3HKSA 1YJ9A 2N49A 2RF4A 1XPUA 1UE5A 1Q7YC 1EYGA 4KLKA 4HJ7A 3M4PA 1I6HH 1AE3A 2IT1A 3BZKA 2UXBQ 1Z47A 4DR5L 4JI8Q 2VQEQ 3CCMA 1SFOH 3HOVG 3HOZG 1K3RA 1L1OB 3S24A 3M7NA 1VQKA 4MZ9A 3B6YA 4R1JA 4EX5A 2VUMH 4JCVE 2UXDQ 1JE5A 4IOCA 4KHPL 2HHHL 1Q46A 4JI4L 2VW9A 3H15A 3NEMA 3NENA 3CCLA 3ULPA 2EIFA 2YTXA 2JA7G 3ZJYC 4PZ7A 5BR8Q 2FXQA 1V43A 1Q1BA 1X56A 2CFMA 5C4XH 1EQQA 5HGQA 5HY6A 4OWXB 3PO2G 4IFDG 2K5VA 3TQYA 2MNAA 4DV3L 2YTYA 1VS0A 1QVCA 3J81c 3F8TA 2NVYH 1Q8KA 1SN8A 2D0PA 4QL5A 1M90C 2B3GA 1LM0A 1JJ2A 4A3FG 4KHPQ 4BA1I 5IWAQ 4LF9L 1NY4A 1I3QH 1AH9A 1YHBA 1LUZA 4JI4Q 4QIWE 4QJFA 4B3RQ 1EOVA 2CCZA 2UXDL 1WJJA 3HFZB 1U5KA 4A3MH 5M3FG 3PO3G 4IFDJ 4GNXC 4BXXG 1XNRL 3CCSA 4JI8L 2VQEL 1EWIA 4A3DH 2WP8J 1IBKQ 3M9BA 4R4QA 1YIJA 4A3LH 4OX9L 4GN3B 3U50C 3GTKH 1KHIA 1HNZL 4IPGA 4IPHA 2NVXH 1OXTA 2HT1A 4AQYQ 1FGUA 1S40A 1KRTA 4IO9A 4DR3Q 2E2IH 4DV2Q 4JV5L 5LMNQ 1H95A 2R92H 5J3BA 2VNUD 5ELOA 2JEAI 4APVA 3GD7A 2ZTDA 3HOXG 2CQOA 5FLXc 2Q2UA 5GROA 1EIFA 1YVCA 2JQOA 2K50A 4DV6L 4HIOA 2NN6G 5LMNL 1YZ6A 5M3MH 3GTPH 5IP9H 1GD7A 2ZTCA 4DV2L 4JV5Q 4LFBQ 5C0XJ 4YWMA 1N33Q 3I4NG 4B3TQ 3J81i 4LNQA 4DUYL 4PG3A 1XMQQ 3CF5A 1M1KC 1FL0A 3UDGA 1BKBA 2F4VL 3S1QH 3H0GG 4BY1H 4GKKL 3I56A 4UPAA 1QVFA 3RLNA 3EBEA 4HJ9A 2AKWB 4UY8C 3GTGH 3NELA 4LF5L 3M4OH 1WOCA 4RMFA 1EFWA 1VQJA 1HNWL 4DAMA 2WAQE 1NMGA 4JI0L 3A74A 1K9MC 1SLJA 4BA2I 3PSIA 2A1AA 1VQBA 1HZAA 2JA6G 3AYHB 2F52A 3MXNB 4LFBL 4LUOA 3TS0A 5IY0A 1VQ8A 1VQ6A 1YJWA 3CCJA 1BVSA 5M3MG 2N78A 1HR0L 1AE2A 4A3CG 5DLQE 3PO2H 4A3BG 1PYBA 1NTGA 4DK3C 2R92G 2I5LX 3K80C 2DGYA 4XIGS 5C44G 4DV0L 4JOIA 5LMUL 1N9WA 4LF7L 2HHHQ 3PO3H 4JI3Q 1TXYA 4DV1L 4OWTB 2E5LL 1PHJA 1KL9A 1Y1WH 3HOUH 1C7YA 1Z9FA 5LMUQ 3AFPA 2JE6I 2YV5A 4HJ5A 4BBRG 4A75A 1PA6A 4QGUA 1EQRA 1TWFH 2VQFL 1TWHH 2ZJRA 1N32Q 3HOYG 3FKIG 1J5EQ 2GN5A 3A5UA 1GVPA 3KF6A 4DPGA 3F2CA 3DM3A 2WB1E 3KJPA 1J6QA 5ELNA 1SMXA 3CD6A 1RL2A 2UUCQ 4BY7H 3M4QA 3RZDH 3J80c 5IYBH 4YHHL 1PV4A 4X62L 2KBNA 2A19A 2CKZB 4X66Q 3KDFA 1CKNB 3CP0A 2OWOA 2ZTEA 4LFCQ 5C0XG 3CCRA 2UU9Q 3GDEA 3CCQA 4LUVA 5IYCH 4GLXA 4LF5Q 3J80i 1U0LA 1QZGA 3I7FA 1SROA 3UDIA 3WWVA 1PH3A 4K0KQ 1O7IA 4JI6Q 1YI2A 3OYYA 1OXVA 3H0GH 1XMQL 2NZHA 4HIDA 2QEXA 4JI6L 1LYLA 2AWNA 1HZBA 3PGZA 3GTQH 3A0JA 3RN2A 1XMOQ 3PUYA 3STBC 1YEZA 3K0XA 4P74A 3T1YL 1XJVA 3F2BA 4X66L 2UU9L 1UE7A 4GNXA 2LXJA 4LFCL 5M5XH 4O0AA 1XNQQ 3S2HH 1Y1VG 2YYZA 1VQOA 5M5WH 1XPRA 1OXXK 4LFAL 2UUCL 2YU9H 2R7ZG 3S17H 2WFWA 1S72A 3MEFA 4Y7NH 3JAMi 3U4ZA 2N3SA 3AQQA 1Q82C 4P71A 3PF5A 5AJ3Q 3G71A 4IJLA 2D0OA 3OW2A 2B63H 3S1NH 1UWVA 5IP7H 4MTNA 2VQFQ 1IBKL 2JA8G 1E24A 3CQZH 4C3IH 4P72A 2MFIA 1OTCA 1FJGL 3K7UC 5JEAJ 1E3PA 3HKZE 1HJPA 1QVGA 1PH2A 2R93G 3KF6B 4YY3Q 4B3RL 1KRSA 1TWCH 4DV4L 4JI5Q 1JT8A 4DV1Q 4A3IG 2AHOB 1X9NA 1VQMA 2JA5G 3FP9A 3D31A 1I94Q 1KXLA 4NB3A 4AIMA 1XPOA 1E22A 4HJAA 4DV3Q 3UDXA 1PH1A 5FLMH 5JEAG 1I50H 4X62Q 4YHHQ 4A3KH 2XTIA 2Y0SG 2A8VA 3FHWA 3CW2C 2EQSA 4DR4L 1D8LA 2QA4A 4HIMA 4DR1L 4OONA 1K73C 3GTOH 2HIVA 4AYBE 4GOPB 1DGSA 1X3GA 5H1SE 4B3SL 4DKAC 5JJIA 2JA9A 3BU2A 1OXSC 4FDBA 2L15A 3KOJA 3RLOA 1D7QA 1NMFA 1BBUA 4PZ8A 1ASYA 2E2HH 4IPCA 1TWAH 4BBSG 1HNWQ 4X64Q 4JOIC 1VQPA 4JYAQ 2UXBL 2HIXA 1WFQA 4ALPA 1IBLL 3AFQA 4MNOA 4DR2L 2E5LQ 3K81C 4JI2L 2R93H 1EUJA 3S14H 2WAQG 4NPSA 3UDFA 5C4JH 3ERSX 2Q2TA 2F4VQ 2JA7H 3HOWH 2Q2IA 1PH5A 4GOPC 1MJEA 2WB1G 4EQ5A 1JJCB 1HZCA 3E9HA 1X55A 2KCTA 3A5ZB 3RLFA 1YJNA 4LF4Q 1Y14B 1HR0Q 2ASBA 3I4MH 4H02A 3U4VA 3DLLA 1N33L 2BA1A 4DR7L 4GN5A 1VQGA 3CPWA 2MO0A 3OTOL 1IXRA 4UP9A 3S16H 5FJ8G 2AWOA 2ZM6L 4DV6Q 1K0RA 1L0WA 2KCMA 2UUBL 2UXCQ 1Y1VH 4R4OA 1BBWA 4IJHA 5C0XI 1KC8C 1KD1C 1ASZA 4DUZL 3PIPA 1KIXA 2IX1A 1SE8A 3CXCA 2JEBI 1QUQA 4A3MG 1HNZQ 4IOAA 4GKJL 1JJGA 4B3MQ 2F3IA 1N36L 3SGIA 4AQYL 3CCVA 1W2BA 4JI0Q 1X3EA 2BA0A 3KF8B 1X65A 1MKHA 5IE8A 3G6EA 4GNXB 1HNXL 4DR6L 1PFSA 2UUAL 1VQ7A 1QUQB 2ALYB 2LXKA 2VL6A 3S2DH 2YTVA 4DR2Q 1IBLQ 4X6AH 5K36G 1CKNA 2ATWA 2EXDA 1PH9A 1N36Q 4L5RC 4DAYB 2PI2E 2Z0SA 4PZ6A 4DV7L 2UUAQ 4DR6Q 2VZAA 2ID0A 3EN2A 4C2MH 1RIPA 1K83H 1XTDA 4B3TL 1JB7A 1B8AA 4GKJQ 3JAMc 2UUBQ 1IL2A 2UXCL 4DUZQ 4A4IA 1GKHA 3CMAA 2Y0SE 4DR7Q 1MJCA 3CC7A 4NXMQ 3JC66 4DR1Q 5IP9G 1T9HA 2D62A 4DK6C 3HOXH 1V9PA 5EAYA 3KDFB 2MO1A 1L1OC 2GVAA 3KJOA 1C0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JG2 A;  1G29 1;  1A0I A;  1FVI A;  5IYD H;  2I5M X;  1VQN A;  3AEV A;  3S1M H;  4P75 A;  3L0O A;  1YBY A;  3F2D A;  3ULJ A;  4JI5 L;  4JI2 Q;  3PIO A;  4OX9 Q;  3PUZ A;  4DV4 Q;  2IHF A;  4BY1 G;  1VQH A;  2ZJQ A;  1UEB A;  2HQL A;  2K75 A;  4DV5 L;  4P73 A;  2I5H A;  5GAE C;  4DR5 Q;  1XNR Q;  4YWK A;  4GS3 A;  3CCE A;  1WYD A;  2K5N A;  4A93 G;  4NXN L;  1A8V A;  4GOP A;  4X64 L;  3LGJ A;  5M3F H;  4A3L G;  3Q8D A;  4BXX H;  4TQU S;  1PYS B;  1UE1 A;  4B3S Q;  4YWL A;  3CC2 A;  4LF9 Q;  1VQA A;  2IX0 A;  4YCU A;  1IYJ B;  2BH8 A;  4WJ4 A;  1GM5 A;  3I4O A;  3J81 j;  1HR0 W;  3ICE A;  1YNX A;  1IBM Q;  4WJ3 M;  1X54 A;  1L2F A;  4OXP A;  5JJK A;  1PH4 A;  3I4M G;  4JI7 L;  2LSS A;  4A3C H;  4O2D A;  5IYD G;  1WCM H;  2K14 A;  3I55 A;  3G4S A;  4L5S A;  4LF6 L;  4A3B H;  4JBM A;  4JBK A;  2Q2H A;  4A3J G;  5GQO A;  1A63 A;  2NN6 I;  1I94 L;  1JMC A;  3I4N H;  1YHA A;  4YCW A;  1XMO L;  1Y1W G;  3HOU G;  4QQB X;  1PH6 A;  3PUX A;  4A3E H;  2KHJ A;  4R4T A;  1VQI A;  3GTJ H;  3CC4 A;  2RHQ B;  2N8N A;  4HJ8 A;  1FJG Q;  5GAD C;  2OQK A;  5GAG C;  3CPF A;  3HOW G;  2K52 A;  3M3Y H;  2OQ0 A;  4JBJ A;  1IBM L;  3KYH C;  4K0K L;  1Q1E A;  3CAM A;  4GLV B;  3E9I A;  3G48 A;  4GN4 B;  3M85 A;  1VQ4 A;  2R7F A;  1GO3 E;  1HH2 P;  3CME A;  4JBW A;  4C3J H;  3J7Z C;  4B3M L;  2NVQ H;  2JA6 H;  4X65 Q;  1NE3 A;  5IT9 c;  2KEN A;  1S3O A;  3T1H L;  2RHS B;  2K4K A;  4JC0 A;  3K7A H;  2B29 A;  2E2J H;  4LFA Q;  3GTM H;  4XTC S;  1UE6 A;  1XNQ L;  3TRE A;  2QGQ A;  4A3J H;  2Z6K A;  3E0E A;  4LUZ A;  1KAW A;  2RCN A;  2V1C C;  2NZO A;  1VQL A;  2E8G A;  4LF4 L;  5C44 H;  3W1B A;  1N32 L;  4GLA C;  1CKO A;  4IPD A;  3K8A A;  1E7Z A;  4ME3 A;  5M5Y H;  1CSP A;  2I0Q A;  3TRZ A;  2IY5 B;  4PMW A;  3IRB A;  3U58 A;  3PCO B;  1HZ9 A;  2KHI A;  1Q81 C;  1VQF A;  2PQA B;  3STB D;  1K8G A;  3BZC A;  3PF4 A;  4JYA L;  3L7Z C;  3HOY H;  4KI0 A;  1P8L A;  3W1G A;  1MIU A;  4AH6 A;  1V1Q A;  2C35 B;  4RG1 A;  5GAH C;  1N8R C;  1N34 Q;  2H5X A;  4BBR H;  4A93 H;  2PNH A;  3PV0 A;  3CCU A;  4JI1 L;  3FKI H;  3KFU A;  1P16 A;  3RZO H;  1VQ5 A;  4LW1 A;  4KHZ A;  1CUK A;  2VS1 A;  3NBH B;  1EIY B;  1VQD A;  3RN5 A;  1NJI C;  1X6O A;  4A3G H;  4YCV A;  1PH8 A;  3H3V H;  4DR4 Q;  3BJU A;  4L5Q A;  4JI1 Q;  5IYB G;  4AYB G;  5C3E H;  1L1O A;  1J5E L;  2IHE A;  4BY7 G;  1B70 B;  4LF8 Q;  2GVB A;  3J7A 5;  1PVO A;  1K8A C;  1B7Y B;  1X3F A;  1WCM G;  1CSQ A;  4NXN Q;  1QZH A;  3W5O A;  1E1T A;  3HOZ H;  2OTJ A;  1CKM A;  3RNU A;  1Q86 C;  1N34 L;  4JI3 L;  2VUM G;  4OO1 I;  2VY3 A;  3KLW A;  4DV5 Q;  3ULL A;  5IYC G;  4A3E G;  4YY3 L;  3D0F A;  2ES2 A;  4DV0 Q;  4IFD I;  2R6G A;  3I2Z A;  4LF7 Q;  2OTL A;  3PUV A;  1VQ9 A;  2DUD A;  4POG A;  2PQA A;  4Y52 H;  1W3S A;  2XGT A;  4C3H H;  4LF8 L;  5FLM G;  1PH7 A;  2JJQ A;  3S1R H;  1NBW A;  2AMC B;  1SRU A;  3TS2 A;  4A3K G;  4NXM L;  5AJ3 L;  4TVA B;  1TWG H;  4A3G G;  4A3F H;  2R7Z H;  1Q12 A;  2Z6K C;  4J15 A;  4DNI A;  5C3E G;  4R4C A;  4X65 L;  3UE0 A;  1C9O A;  4R4I A;  1I5F A;  3T1H Q;  5JJL A;  2B63 G;  4DV7 Q;  1G6P A;  3T1Y Q;  4HIK A;  1G51 A;  2CWP A;  4BBS H;  5IP7 G;  1OXU A;  3H3V I;  4A3D G;  1YHQ A;  1R9T H;  1VQC A;  3S15 H;  5E7N A;  2NVT H;  4GKK Q;  4UP7 A;  2ZJP A;  1HNX Q;  3HKZ G;  2CWA A;  2JA8 H;  4DUY Q;  3HOV H;  2PI2 A;  4A76 A;  1KQS A;  2OCE A;  4OWW B;  1IZ6 A;  3EIV A;  2BH2 A;  2R7D A;  1A62 A;  3UE1 A;  3PUW A;  2MQH A;  4A3I H;  2JA5 H;  5IWA L;  4L5T A;  1YIT A;  1LTL A;  4QY7 A;  3L2P A;  2ZM6 Q;  2PMZ E;  3ER0 A;  1SR3 A;  5FJ8 H;  4POF A;  1VQE A;  1WI5 A;  3GO5 A;  4LWC A;  3OTO Q;  4UP8 A;  4JI7 Q;  3F1Z A;  3GTL H;  4OO1 G;  4LF6 Q;  5LMN W;  5C4X G;  3RR5 A;  2JK8 A;  1VCI A;  1E1O A;  3TEH B;  2K5H A;  4DR3 L;  5BR8 L;  3VDY A;  3HKS A;  1YJ9 A;  2N49 A;  2RF4 A;  1XPU A;  1UE5 A;  1Q7Y C;  1EYG A;  4KLK A;  4HJ7 A;  3M4P A;  1I6H H;  1AE3 A;  2IT1 A;  3BZK A;  2UXB Q;  1Z47 A;  4DR5 L;  4JI8 Q;  2VQE Q;  3CCM A;  1SFO H;  3HOV G;  3HOZ G;  1K3R A;  1L1O B;  3S24 A;  3M7N A;  1VQK A;  4MZ9 A;  3B6Y A;  4R1J A;  4EX5 A;  2VUM H;  4JCV E;  2UXD Q;  1JE5 A;  4IOC A;  4KHP L;  2HHH L;  1Q46 A;  4JI4 L;  2VW9 A;  3H15 A;  3NEM A;  3NEN A;  3CCL A;  3ULP A;  2EIF A;  2YTX A;  2JA7 G;  3ZJY C;  4PZ7 A;  5BR8 Q;  2FXQ A;  1V43 A;  1Q1B A;  1X56 A;  2CFM A;  5C4X H;  1EQQ A;  5HGQ A;  5HY6 A;  4OWX B;  3PO2 G;  4IFD G;  2K5V A;  3TQY A;  2MNA A;  4DV3 L;  2YTY A;  1VS0 A;  1QVC A;  3J81 c;  3F8T A;  2NVY H;  1Q8K A;  1SN8 A;  2D0P A;  4QL5 A;  1M90 C;  2B3G A;  1LM0 A;  1JJ2 A;  4A3F G;  4KHP Q;  4BA1 I;  5IWA Q;  4LF9 L;  1NY4 A;  1I3Q H;  1AH9 A;  1YHB A;  1LUZ A;  4JI4 Q;  4QIW E;  4QJF A;  4B3R Q;  1EOV A;  2CCZ A;  2UXD L;  1WJJ A;  3HFZ B;  1U5K A;  4A3M H;  5M3F G;  3PO3 G;  4IFD J;  4GNX C;  4BXX G;  1XNR L;  3CCS A;  4JI8 L;  2VQE L;  1EWI A;  4A3D H;  2WP8 J;  1IBK Q;  3M9B A;  4R4Q A;  1YIJ A;  4A3L H;  4OX9 L;  4GN3 B;  3U50 C;  3GTK H;  1KHI A;  1HNZ L;  4IPG A;  4IPH A;  2NVX H;  1OXT A;  2HT1 A;  4AQY Q;  1FGU A;  1S40 A;  1KRT A;  4IO9 A;  4DR3 Q;  2E2I H;  4DV2 Q;  4JV5 L;  5LMN Q;  1H95 A;  2R92 H;  5J3B A;  2VNU D;  5ELO A;  2JEA I;  4APV A;  3GD7 A;  2ZTD A;  3HOX G;  2CQO A;  5FLX c;  2Q2U A;  5GRO A;  1EIF A;  1YVC A;  2JQO A;  2K50 A;  4DV6 L;  4HIO A;  2NN6 G;  5LMN L;  1YZ6 A;  5M3M H;  3GTP H;  5IP9 H;  1GD7 A;  2ZTC A;  4DV2 L;  4JV5 Q;  4LFB Q;  5C0X J;  4YWM A;  1N33 Q;  3I4N G;  4B3T Q;  3J81 i;  4LNQ A;  4DUY L;  4PG3 A;  1XMQ Q;  3CF5 A;  1M1K C;  1FL0 A;  3UDG A;  1BKB A;  2F4V L;  3S1Q H;  3H0G G;  4BY1 H;  4GKK L;  3I56 A;  4UPA A;  1QVF A;  3RLN A;  3EBE A;  4HJ9 A;  2AKW B;  4UY8 C;  3GTG H;  3NEL A;  4LF5 L;  3M4O H;  1WOC A;  4RMF A;  1EFW A;  1VQJ A;  1HNW L;  4DAM A;  2WAQ E;  1NMG A;  4JI0 L;  3A74 A;  1K9M C;  1SLJ A;  4BA2 I;  3PSI A;  2A1A A;  1VQB A;  1HZA A;  2JA6 G;  3AYH B;  2F52 A;  3MXN B;  4LFB L;  4LUO A;  3TS0 A;  5IY0 A;  1VQ8 A;  1VQ6 A;  1YJW A;  3CCJ A;  1BVS A;  5M3M G;  2N78 A;  1HR0 L;  1AE2 A;  4A3C G;  5DLQ E;  3PO2 H;  4A3B G;  1PYB A;  1NTG A;  4DK3 C;  2R92 G;  2I5L X;  3K80 C;  2DGY A;  4XIG S;  5C44 G;  4DV0 L;  4JOI A;  5LMU L;  1N9W A;  4LF7 L;  2HHH Q;  3PO3 H;  4JI3 Q;  1TXY A;  4DV1 L;  4OWT B;  2E5L L;  1PHJ A;  1KL9 A;  1Y1W H;  3HOU H;  1C7Y A;  1Z9F A;  5LMU Q;  3AFP A;  2JE6 I;  2YV5 A;  4HJ5 A;  4BBR G;  4A75 A;  1PA6 A;  4QGU A;  1EQR A;  1TWF H;  2VQF L;  1TWH H;  2ZJR A;  1N32 Q;  3HOY G;  3FKI G;  1J5E Q;  2GN5 A;  3A5U A;  1GVP A;  3KF6 A;  4DPG A;  3F2C A;  3DM3 A;  2WB1 E;  3KJP A;  1J6Q A;  5ELN A;  1SMX A;  3CD6 A;  1RL2 A;  2UUC Q;  4BY7 H;  3M4Q A;  3RZD H;  3J80 c;  5IYB H;  4YHH L;  1PV4 A;  4X62 L;  2KBN A;  2A19 A;  2CKZ B;  4X66 Q;  3KDF A;  1CKN B;  3CP0 A;  2OWO A;  2ZTE A;  4LFC Q;  5C0X G;  3CCR A;  2UU9 Q;  3GDE A;  3CCQ A;  4LUV A;  5IYC H;  4GLX A;  4LF5 Q;  3J80 i;  1U0L A;  1QZG A;  3I7F A;  1SRO A;  3UDI A;  3WWV A;  1PH3 A;  4K0K Q;  1O7I A;  4JI6 Q;  1YI2 A;  3OYY A;  1OXV A;  3H0G H;  1XMQ L;  2NZH A;  4HID A;  2QEX A;  4JI6 L;  1LYL A;  2AWN A;  1HZB A;  3PGZ A;  3GTQ H;  3A0J A;  3RN2 A;  1XMO Q;  3PUY A;  3STB C;  1YEZ A;  3K0X A;  4P74 A;  3T1Y L;  1XJV A;  3F2B A;  4X66 L;  2UU9 L;  1UE7 A;  4GNX A;  2LXJ A;  4LFC L;  5M5X H;  4O0A A;  1XNQ Q;  3S2H H;  1Y1V G;  2YYZ A;  1VQO A;  5M5W H;  1XPR A;  1OXX K;  4LFA L;  2UUC L;  2YU9 H;  2R7Z G;  3S17 H;  2WFW A;  1S72 A;  3MEF A;  4Y7N H;  3JAM i;  3U4Z A;  2N3S A;  3AQQ A;  1Q82 C;  4P71 A;  3PF5 A;  5AJ3 Q;  3G71 A;  4IJL A;  2D0O A;  3OW2 A;  2B63 H;  3S1N H;  1UWV A;  5IP7 H;  4MTN A;  2VQF Q;  1IBK L;  2JA8 G;  1E24 A;  3CQZ H;  4C3I H;  4P72 A;  2MFI A;  1OTC A;  1FJG L;  3K7U C;  5JEA J;  1E3P A;  3HKZ E;  1HJP A;  1QVG A;  1PH2 A;  2R93 G;  3KF6 B;  4YY3 Q;  4B3R L;  1KRS A;  1TWC H;  4DV4 L;  4JI5 Q;  1JT8 A;  4DV1 Q;  4A3I G;  2AHO B;  1X9N A;  1VQM A;  2JA5 G;  3FP9 A;  3D31 A;  1I94 Q;  1KXL A;  4NB3 A;  4AIM A;  1XPO A;  1E22 A;  4HJA A;  4DV3 Q;  3UDX A;  1PH1 A;  5FLM H;  5JEA G;  1I50 H;  4X62 Q;  4YHH Q;  4A3K H;  2XTI A;  2Y0S G;  2A8V A;  3FHW A;  3CW2 C;  2EQS A;  4DR4 L;  1D8L A;  2QA4 A;  4HIM A;  4DR1 L;  4OON A;  1K73 C;  3GTO H;  2HIV A;  4AYB E;  4GOP B;  1DGS A;  1X3G A;  5H1S E;  4B3S L;  4DKA C;  5JJI A;  2JA9 A;  3BU2 A;  1OXS C;  4FDB A;  2L15 A;  3KOJ A;  3RLO A;  1D7Q A;  1NMF A;  1BBU A;  4PZ8 A;  1ASY A;  2E2H H;  4IPC A;  1TWA H;  4BBS G;  1HNW Q;  4X64 Q;  4JOI C;  1VQP A;  4JYA Q;  2UXB L;  2HIX A;  1WFQ A;  4ALP A;  1IBL L;  3AFQ A;  4MNO A;  4DR2 L;  2E5L Q;  3K81 C;  4JI2 L;  2R93 H;  1EUJ A;  3S14 H;  2WAQ G;  4NPS A;  3UDF A;  5C4J H;  3ERS X;  2Q2T A;  2F4V Q;  2JA7 H;  3HOW H;  2Q2I A;  1PH5 A;  4GOP C;  1MJE A;  2WB1 G;  4EQ5 A;  1JJC B;  1HZC A;  3E9H A;  1X55 A;  2KCT A;  3A5Z B;  3RLF A;  1YJN A;  4LF4 Q;  1Y14 B;  1HR0 Q;  2ASB A;  3I4M H;  4H02 A;  3U4V A;  3DLL A;  1N33 L;  2BA1 A;  4DR7 L;  4GN5 A;  1VQG A;  3CPW A;  2MO0 A;  3OTO L;  1IXR A;  4UP9 A;  3S16 H;  5FJ8 G;  2AWO A;  2ZM6 L;  4DV6 Q;  1K0R A;  1L0W A;  2KCM A;  2UUB L;  2UXC Q;  1Y1V H;  4R4O A;  1BBW A;  4IJH A;  5C0X I;  1KC8 C;  1KD1 C;  1ASZ A;  4DUZ L;  3PIP A;  1KIX A;  2IX1 A;  1SE8 A;  3CXC A;  2JEB I;  1QUQ A;  4A3M G;  1HNZ Q;  4IOA A;  4GKJ L;  1JJG A;  4B3M Q;  2F3I A;  1N36 L;  3SGI A;  4AQY L;  3CCV A;  1W2B A;  4JI0 Q;  1X3E A;  2BA0 A;  3KF8 B;  1X65 A;  1MKH A;  5IE8 A;  3G6E A;  4GNX B;  1HNX L;  4DR6 L;  1PFS A;  2UUA L;  1VQ7 A;  1QUQ B;  2ALY B;  2LXK A;  2VL6 A;  3S2D H;  2YTV A;  4DR2 Q;  1IBL Q;  4X6A H;  5K36 G;  1CKN A;  2ATW A;  2EXD A;  1PH9 A;  1N36 Q;  4L5R C;  4DAY B;  2PI2 E;  2Z0S A;  4PZ6 A;  4DV7 L;  2UUA Q;  4DR6 Q;  2VZA A;  2ID0 A;  3EN2 A;  4C2M H;  1RIP A;  1K83 H;  1XTD A;  4B3T L;  1JB7 A;  1B8A A;  4GKJ Q;  3JAM c;  2UUB Q;  1IL2 A;  2UXC L;  4DUZ Q;  4A4I A;  1GKH A;  3CMA A;  2Y0S E;  4DR7 Q;  1MJC A;  3CC7 A;  4NXM Q;  3JC6 6;  4DR1 Q;  5IP9 G;  1T9H A;  2D62 A;  4DK6 C;  3HOX H;  1V9P A;  5EAY A;  3KDF B;  2MO1 A;  1L1O C;  2GVA A;  3KJO A;  1C0A A; 
#chains in the Genus database with same CATH topology
 1A0I A;  5IYD H;  5ISR A;  3BG3 A;  1JR0 D;  2WB1 B;  4LJZ C;  4RFB A;  3ZYY X;  3F2D A;  4J6H A;  5KRU A;  4JI5 L;  1Y1W B;  3HOU B;  2V4D A;  2LMC B;  1U9R A;  1ENC A;  4DR5 Q;  2B2U C;  4YWK A;  4IUV A;  1XNR Q;  4A93 G;  1HA5 A;  4X64 L;  4A3L G;  5JPN C;  4BXX H;  4TQU S;  1PYS B;  1U4M A;  4YWL A;  3CC2 A;  1VQA A;  1ILQ A;  4YCU A;  1IYJ B;  5C4Z A;  1GM5 A;  2FMM A;  3GV6 A;  1YNX A;  1LO5 D;  5FLX E;  3I4M G;  3GV3 A;  1AW7 A;  1V1O A;  4O2D A;  2B2U A;  3I55 A;  3NQT A;  2Q2H A;  3KBX A;  5G3L D;  1YHA A;  4QQB X;  3OWF A;  1EIG A;  1LLR D;  2KHJ A;  1VQI A;  4HJ8 A;  2QF7 A;  2A73 B;  2OQK A;  4LK1 C;  3CPF A;  3HOW G;  2K52 A;  2OQ0 A;  3E0J A;  4GN4 B;  3I4N B;  2DNC A;  4JBW A;  1KAB A;  4UAI A;  2K4K A;  1IW7 D;  5IOD A;  4CDC C;  3ONA B;  3IFT A;  4XTC S;  3E0E A;  2EJF C;  1ICF B;  4K2K A;  5ELB A;  2RCN A;  2E8G A;  1IW7 C;  2ZXO A;  3H6M A;  4GLA C;  1E7Z A;  1CFM A;  4ME3 A;  2I0Q A;  3HP3 A;  1W6K A;  3QWN A;  3HOZ B;  1HZ9 A;  2MUY A;  3BZC A;  2IX3 A;  3L7Z C;  3HOY H;  5JVG 3;  4A93 H;  1V1Q A;  5GAH C;  4RG1 A;  2R92 B;  4ID6 A;  2PNH A;  1SYB A;  2KED A;  2E76 C;  3FDT A;  1PTO H;  3RZO H;  1CUK A;  1SYE A;  3RN5 A;  1X6O A;  5FOB B;  3G6J B;  3BJU A;  4JI1 Q;  5E4X A;  4BBR B;  2IHE A;  1CT1 D;  4DF7 A;  1K8A C;  1CSQ A;  4NXN Q;  1SND A;  1DOK A;  1E1T A;  1V1P A;  1CKM A;  2PYK A;  4DK1 A;  3DUZ A;  4OO1 I;  3KLW A;  4NMZ A;  3ULL A;  3HKZ B;  1ESR A;  1TY2 A;  1SFO B;  1ET9 A;  4POG A;  1DCZ A;  1W3S A;  3DWQ A;  4C3H H;  3S9W A;  4FYD A;  3S1R H;  2AMC B;  3L3O C;  2RVL A;  2Q8R E;  3GTL B;  1TWG H;  1TR5 A;  4A3F H;  2R7Z H;  2Z6K C;  5CC4 A;  4FF2 A;  1PZI D;  4RGO S;  1DOL A;  1PDQ A;  1FNW A;  3ERO A;  3AB9 A;  3UI2 A;  1CHQ D;  3S14 B;  1VQC A;  3HEJ A;  1UEA B;  3S15 H;  4GKK Q;  2QW7 A;  4FF4 A;  4Q0F A;  4UP7 A;  4A3E B;  2CWA A;  2JA8 H;  4A76 A;  2R3Z A;  1Q8I A;  3C2P A;  4OWW B;  2BH2 A;  3D3R A;  1A62 A;  5ELE A;  2QCP X;  2MQH A;  4A3I H;  4A3B B;  5IWA L;  4QY7 A;  4QCL A;  4QB4 A;  3ER0 A;  1F2Z A;  1VQE A;  2JN4 A;  3GO5 A;  2F1M A;  4OO1 G;  2CH4 W;  5LMN W;  1ET6 A;  2JK8 A;  3KK7 A;  1SAP A;  1E1O A;  4P2C B;  4DR3 L;  2KJX A;  2F0O A;  2EOT A;  1MHW C;  2RF4 A;  3M4P A;  1JE4 A;  4DXF A;  5C3W A;  2UXB Q;  1Z47 A;  2BDO A;  5JOB A;  2VQE Q;  3CCM A;  5DNF A;  3S24 A;  3M7N A;  4EX5 A;  1CQF A;  3BVZ A;  4PNY A;  3D4D A;  4EQO A;  4JI4 L;  1R4P B;  3MXP A;  3P75 A;  4PZ7 A;  2E74 C;  2FXQ A;  3J81 L;  1VF5 C;  1KDC A;  1Q1B A;  1X56 A;  2CFM A;  2F0W A;  4ZKB B;  3KLR A;  4IQZ A;  4H44 C;  2MNA A;  4DV3 L;  2YTY A;  1VS0 A;  3F8T A;  1Q8K A;  3SK6 A;  4CDE C;  1AH9 A;  1BF4 A;  4IN3 A;  4JI4 Q;  4WJW A;  1EOV A;  2UXD L;  1TS4 A;  3HFZ B;  1U5K A;  3S2D B;  2A74 C;  4GNX C;  2PNR C;  3P20 A;  4A3L H;  1WD1 A;  3FRP B;  3Q24 A;  4HR7 B;  3NTH A;  2K5W A;  3J7A V;  1OXT A;  2F0S A;  2M9V A;  4IUP A;  4DR3 Q;  2E2I H;  2H1E A;  4KN7 C;  5LMN Q;  1H95 A;  1YNJ D;  4BS9 A;  4R9W A;  2PQE A;  4OHJ A;  3GD7 A;  5FLX c;  1O78 A;  4RHS A;  1BO0 A;  4HIO A;  3K7A B;  2ZT9 C;  2NUC A;  5D3I B;  1LAC A;  2JA7 B;  1VMC A;  2KOL A;  1JOO A;  1TWH B;  2Q8I B;  1XMQ Q;  1M1K C;  1SYF A;  1LTA D;  1D2B A;  3PO3 B;  3M7G A;  2AKW B;  4UY8 C;  4V19 0;  4FVM A;  1RD9 D;  3NEL A;  4LF5 L;  1WOC A;  4RMF A;  3VYR A;  4XT1 B;  1HNW L;  3M3Y B;  4DAM A;  2WAQ E;  4JI0 L;  3A74 A;  1K9M C;  1SLJ A;  1AEX A;  4BA2 I;  2A1A A;  4HSV A;  5I4D A;  3I90 A;  3D8G A;  1VQB A;  4LFB L;  1EYA A;  2SEB D;  3S1R B;  3TS0 A;  3H91 A;  2JP1 A;  4RH6 A;  3VR2 A;  1WTO A;  4XIG S;  1SE3 A;  1V1P B;  5C44 G;  5C0X H;  1N9W A;  4JI3 Q;  1TXY A;  1A6X A;  1PHJ A;  1KL9 A;  3OWE B;  1C7Y A;  2KCC A;  4QF4 A;  1EY8 A;  3SVM A;  2JE6 I;  3AFP A;  3HOW H;  3I72 A;  1PA6 A;  3PO3 H;  4H13 C;  1TWH H;  1J5E Q;  4WOR A;  3QO2 A;  2DJG C;  4DPG A;  4ZLT F;  1ZEQ X;  1AZP A;  3KJP A;  1G91 A;  1D5X C;  1EY6 A;  3O13 A;  4O1N A;  3RZO B;  1QE6 A;  1O7Y A;  3M4Q A;  2A6H D;  1CA5 A;  2CKZ B;  3PQI A;  2ZTE A;  2BCO A;  3S2H B;  2UU9 Q;  5ELD A;  3CCQ A;  1CZW A;  1DD2 A;  3J80 i;  3I7F A;  1PH3 A;  1LT4 D;  4KHV A;  4C2M B;  2KA7 A;  1B4O A;  1RTN A;  1GUT A;  3BVG A;  2F03 A;  4JI6 L;  3BDL A;  3MC0 B;  5FLX L;  3GQB A;  1YEZ A;  4DFA A;  3T1Y L;  2IWH A;  2RDH A;  1NUC A;  1BQQ T;  2E75 C;  5M5W H;  1XPR A;  3ND9 A;  3AQQ A;  3PF5 A;  2F0E A;  3MFG A;  4K8I A;  4HCE A;  2JA8 G;  1E24 A;  1I4G A;  3FVQ A;  1IHZ A;  1F2Y A;  5JEA J;  1HJP A;  2XNA C;  1EU4 A;  3HS0 C;  2IL8 A;  2R93 G;  3T53 B;  4YY3 Q;  3HG9 A;  3SK4 A;  1STG A;  1JT8 A;  2JA5 G;  1VQM A;  3FP9 A;  3D31 A;  4K5V A;  4AIM A;  4HAE A;  4DV3 Q;  1PH1 A;  3L9A X;  1CTM A;  1SNP A;  1I50 H;  4X62 Q;  4YHH Q;  3URY A;  2JYO A;  2A8V A;  3I8Z A;  1Q90 A;  2B2T C;  4DR1 L;  2Z6B A;  5IT9 L;  4GOP B;  1KDB A;  1PTO F;  5I6Y A;  5H1S E;  4DKA C;  3P7J A;  5JJI A;  4FDB A;  3RLO A;  2IW3 A;  3T51 B;  1KLG D;  1NMF A;  4IPC A;  1TWA H;  4EGV A;  2JA8 B;  4RKL A;  4KKT A;  2A69 C;  2R93 H;  3AFQ A;  1ICW A;  3K81 C;  3CRK C;  1EUJ A;  3S14 H;  4NPS A;  3UDF A;  2F4V Q;  1WD0 A;  2MHV A;  1O7L A;  2WB1 G;  3TP7 A;  1YJN A;  1HZC A;  1IKL A;  1X55 A;  4EQP A;  2ASB A;  2IJ0 A;  2HCC A;  2HD3 A;  4A3G B;  1IXR A;  4FP5 D;  5FJ8 G;  1K0R A;  1L0W A;  2KCM A;  3HOX B;  2UXC Q;  1BBW A;  2IX1 A;  3A7A B;  1SE8 A;  2JEB I;  5EBC A;  1JJG A;  2HQE A;  3CCV A;  4JI0 Q;  3T13 A;  3G6E A;  3KF8 B;  1MKH A;  3E6Z X;  2VL6 A;  1EY0 A;  4IZ8 A;  1DM0 B;  4X6A H;  2A6E D;  1HCZ A;  4IAL A;  2ATW A;  3G7L A;  5M5Y B;  2NWG A;  1I3Q B;  3QB3 A;  4C2M H;  1XTD A;  5AFW A;  3JAM c;  2EYL A;  2DNE A;  4ZKC B;  3CMA A;  2Y0S E;  2K01 A;  1MJC A;  5C4X B;  1YNN C;  5JEA H;  4MN3 A;  2MO1 A;  3I91 A;  3KJO A;  1HFG A;  1TS2 A;  1PMR A;  4JG2 A;  2OT2 A;  1G29 1;  1FVI A;  1TWF B;  3S1M H;  3L0O A;  3MAQ A;  4KMU C;  4JI2 Q;  4OX9 Q;  3PUZ A;  4DV4 Q;  2IHF A;  1S5D D;  1VQH A;  1UEB A;  2HQL A;  2K75 A;  3PMF A;  4ZCK A;  4DV5 L;  4P73 A;  3J80 E;  1CM9 A;  2K5N A;  3HOW B;  5COY A;  1A8V A;  3CHB D;  1F9R A;  1RKN A;  4RKB A;  4B3S Q;  3NP8 A;  2IX0 A;  2BH8 A;  3DXJ C;  4B9X A;  3J81 j;  4N9T A;  1EY5 A;  4QUF A;  1U4L A;  1L2F A;  2SNS A;  4M8A A;  4OXP A;  2O5I C;  5JJK A;  1EIH A;  4IUU A;  5IYD G;  1GXD C;  2JA5 B;  4JBM A;  3JAM L;  3I4N H;  4YCW A;  4IUT A;  1B9M A;  1Y1W G;  3HOU G;  1PH6 A;  3PUX A;  1PZK D;  3OPO A;  2K03 A;  1YNN D;  5M3F B;  4OIJ A;  3MEH A;  1A3U A;  4CJ1 B;  3M3Y H;  1QB5 D;  5EQ0 A;  4K0K L;  1H9J A;  1FYC A;  1VQ4 A;  1BOS A;  4ME5 A;  1AFP A;  2YU9 B;  3CME A;  4B3M L;  2JA6 H;  2N88 A;  1JWM D;  4X65 Q;  4JC0 A;  3K7A H;  2Z4I A;  4F87 A;  2CHB D;  4LFA Q;  1SNQ A;  2WKD A;  3QJY A;  1UE6 A;  5CGK A;  1D6E C;  3M4Y A;  2Z6K A;  4B9W A;  4LUZ A;  2KEC A;  5IGF A;  5C44 H;  2B2Y C;  1STA A;  5IGG A;  1CKO A;  3K8A A;  3TRZ A;  4CKC A;  3R2I A;  1AN8 A;  1QWY A;  3U58 A;  3PCO B;  3STB D;  1K8G A;  3PF4 A;  3W1G A;  2C35 B;  4RAU C;  4KJN A;  1Q3L A;  4XQQ A;  3NBH B;  5LHY 1;  3EQL C;  4DR4 Q;  5C3E H;  1VF7 A;  2CW0 C;  4LF8 Q;  2L4N A;  3J7A 5;  1PVO A;  1B7Y B;  3Q6S A;  1B1Z A;  1R4Q B;  2PCF B;  5C5M A;  1RF2 D;  2EY1 A;  5J1Z A;  4DV5 Q;  3D0F A;  2ES2 A;  4DV0 Q;  4ZK9 B;  1BDO A;  4IFD I;  2R6G A;  1TII D;  4X3K A;  3PUV A;  1VQ9 A;  2PQA A;  1G2T A;  5C6A A;  1PRT C;  1SXT A;  4LF8 L;  5FLM G;  1SRU A;  2PPB C;  4KN4 C;  5T1G A;  5AJ3 L;  4PQX A;  5CV6 A;  4KJO A;  1SBB B;  3A55 A;  4J15 A;  4DNI A;  5C3E G;  4R4C A;  3I4M B;  1C9O A;  2F0V A;  2E2J B;  2B63 G;  1FNV A;  1G6P A;  4HIK A;  1NNX A;  1G51 A;  5IP7 G;  1VDZ A;  2NVT H;  2QDB A;  4RWS C;  1C48 A;  4DUY Q;  3KLS X;  3NSW A;  3TP6 A;  1KNE A;  2WAC A;  2EJM A;  5HUR A;  2R7D A;  5IGB A;  3PUW A;  2RSN A;  2JA5 H;  1I4Q A;  3X3N A;  3DEP A;  1LTL A;  1YIT A;  1SYD A;  3OSO A;  2ZM6 Q;  2QIL A;  5FJ8 H;  3FPP A;  1STH A;  1T5E A;  2KUM A;  4DAV A;  5C4X G;  2C5C A;  1K28 A;  2CQA A;  3I4L A;  4A3F B;  5BR8 L;  1I6V C;  3VDY A;  1B9N A;  3HKS A;  1HQR D;  3BVM A;  2N49 A;  1Q7Y C;  3Q22 A;  3Q23 A;  1I6H H;  1AE3 A;  2RKS A;  1IL8 A;  4C3H B;  1SFO H;  1O80 A;  3HOZ G;  1L1O B;  4DXG A;  1VQK A;  3VYU A;  4MZ9 A;  3B6Y A;  2VUM H;  3S1M B;  2UXD Q;  1PZJ D;  2NVY B;  1PRT B;  2HHH L;  4KHP L;  3NEN A;  2EIF A;  2JA7 G;  2PZU A;  3ZJY C;  5BR8 Q;  3RMH A;  5C4X H;  4KTA A;  4IFD G;  2NB0 A;  3TQY A;  5EPJ A;  3NK9 A;  2D0P A;  4MTK A;  1GUN A;  1JJ2 A;  1TY0 A;  4KHP Q;  1NY4 A;  1I3Q H;  1PTO B;  2F0G A;  4QJF A;  4B3R Q;  5KEE A;  3H0G B;  3C46 A;  1CZG A;  3PO3 G;  4DGZ A;  3X3M A;  2VUM B;  2Z8L A;  1XNR L;  4BXX G;  3CCS A;  2VQE L;  5IIF A;  1EWI A;  4LMQ D;  4J8Q A;  4RGT A;  4R4Q A;  4OX9 L;  3U50 C;  4A3J B;  1KHI A;  1HNZ L;  4IPH A;  2NVX H;  2BOS A;  4F8M A;  1S40 A;  3LWU A;  3GP7 A;  1ZYR D;  5J3B A;  4APV A;  1GJX A;  5GRO A;  1YVC A;  2F3V A;  2JQO A;  5IGC A;  5FO9 B;  5M3M H;  5IP9 H;  2ZTC A;  4PMC A;  1B2T A;  4YWM A;  1N33 Q;  3I4N G;  1LV9 A;  1PFN A;  1ZKO A;  4JW0 A;  4B3T Q;  4DUY L;  3CF5 A;  3NHH A;  1HTL D;  3QG1 A;  2X6L A;  4BY1 H;  3I56 A;  3GTJ B;  1NR2 A;  3RLN A;  4HJ9 A;  4L63 B;  3GTG H;  4H7B A;  3BDO A;  2MP1 A;  2EY2 A;  3PSI A;  4KY7 A;  2JA6 G;  2KQ3 A;  4FXD A;  2F52 A;  1PRT F;  4NKL A;  2LY7 A;  1JCK B;  3U9S A;  5IY0 A;  2F0Q A;  3EJI A;  1BVS A;  4HMI A;  5M3M G;  3J81 E;  2EYO A;  2NTS A;  5CYU A;  1SJH D;  3A56 A;  2NTT A;  2BE5 C;  4DV0 L;  4JOI A;  3GTK B;  3TDQ A;  1KNA A;  3EVQ A;  2HHH Q;  1FNU A;  2PMZ B;  5EPL A;  1Z9F A;  4PMB A;  4FXG C;  4HJ5 A;  3S1Q B;  4QGU A;  4PV1 C;  2VQF L;  3Q0A A;  2ZJR A;  1Y69 U;  1N32 Q;  4I7Z C;  3A5U A;  1DYQ A;  1HUM A;  1FGB D;  3NXW A;  3DM3 A;  3W2D A;  3I70 A;  2UUC Q;  1M4V A;  3NWS A;  3J80 c;  4YHH L;  4X62 L;  1A15 A;  2KBN A;  1LT6 D;  1CKN B;  5LL6 X;  5C0X G;  3CCR A;  1NAP A;  4LUV A;  3A8K E;  3KBG A;  4LF5 Q;  1U0L A;  4K0K Q;  5BN4 A;  1B53 A;  3OYY A;  1QNU A;  2A68 C;  1XMQ L;  1AZQ A;  4HN7 A;  3PGZ A;  2KEE A;  1RDP D;  1XMO Q;  5C44 B;  3DWA A;  2EZV A;  1BCP F;  5E1F A;  5E3F A;  1XNQ Q;  1X3P A;  4O0A A;  5EKI A;  3QOL A;  3MZ5 A;  4GZY C;  1BCP C;  2O5J C;  3SDZ A;  4KD3 A;  4NDX A;  5AJ3 Q;  2B63 H;  3OW2 A;  3A7L A;  1UWV A;  1K3B C;  5JAV A;  5IP7 H;  4XDX A;  1OTC A;  4O42 A;  1LTT D;  1E3P A;  3CRL C;  3KF6 B;  1KRS A;  4DV4 L;  1X9N A;  3QOJ A;  1KXL A;  1XPO A;  5FLM H;  4G4K A;  5JEA G;  4A3K H;  2OF1 A;  3C1F A;  1U4P A;  1Y8P B;  2B2W C;  2EQS A;  1F9Q A;  2B39 A;  1D8L A;  3MXG A;  2QA4 A;  1K73 C;  4DR4 L;  3PO2 B;  2HIV A;  1K8O A;  1T5X D;  1DGS A;  1X3G A;  1ILP A;  4B3S L;  3OIP A;  2JA9 A;  3BU2 A;  5IT9 E;  1OXS C;  3KOJ A;  5I6W A;  1PTO C;  1E2W A;  2ZXR A;  4BBS G;  4X64 Q;  1I4P A;  1VQP A;  2UXB L;  3VYS A;  1BCP D;  3H94 A;  2E5L Q;  4JI2 L;  5C4J H;  2IPK D;  4DU9 A;  2JA7 H;  2B63 B;  2A68 D;  1QNK A;  1B3A A;  4C56 C;  4C3I B;  1MJE A;  4YIJ A;  2GA4 B;  2KCT A;  4LF4 Q;  4C1N I;  3J7A F;  1KTK A;  1Y14 B;  3MFY A;  3DHQ A;  4H02 A;  3U4V A;  1N33 L;  2BA1 A;  1PFM A;  2B2V A;  2MO0 A;  2EJG C;  3SHL A;  1ENA A;  1Y8O B;  2UUB L;  1KD1 C;  4LFB Q;  4IJH A;  1U4R A;  3AMU A;  2AUK A;  3FKI B;  5FO8 B;  3ND8 A;  4N9P A;  1HNZ Q;  4IOA A;  1N36 L;  3SGI A;  3T4A C;  1W2B A;  1WTR A;  4GNX B;  4DR6 L;  1GUO A;  4S3S A;  5CV5 A;  5EGT A;  3S2D H;  1EYD A;  1TS5 A;  1KLU D;  5K36 G;  1CKN A;  1SMY C;  4DAY B;  2PI2 E;  4OIK A;  1XYI A;  2UUA Q;  1J8I A;  2ID0 A;  4C3J G;  4ZYS A;  2R61 A;  1JB7 A;  4GKJ Q;  2UXC L;  3EA6 A;  4A4I A;  3N52 A;  4NW2 A;  3GTM B;  2J0T D;  5IP9 G;  3HOX H;  3KDF B;  1C0A A;  4BY7 B;  3NWT A;  1BNZ A;  2HCI A;  3HGB A;  1VQN A;  2XSC A;  4P75 A;  3ULJ A;  1S5C D;  4BY1 G;  2LFN A;  2XRQ D;  5GAE C;  2Z1C A;  2WKC A;  1EQV A;  3CCE A;  4UHV A;  5NUC A;  4NXN L;  2R93 B;  2K32 A;  3LGJ A;  3R93 A;  3N6R A;  1UE1 A;  4LF9 Q;  4I7A A;  4WJ4 A;  5IGE A;  1WVL A;  2WIN B;  1NSN S;  1X54 A;  4CJ2 C;  5KNB A;  3JAM E;  1E2Z A;  3FEW X;  4JI7 L;  5J22 A;  2LSS A;  4XQJ A;  2VB2 X;  1HTP A;  1KDA A;  2NN6 H;  4A3I B;  1I50 B;  4L5S A;  4A3B H;  4A3J G;  1A63 A;  2NN6 I;  4V0B A;  3VR6 A;  1XMO L;  3IL8 A;  4A3E H;  2JXM B;  3CC4 A;  3GTJ H;  2RHQ B;  2N8N A;  1FJG Q;  4BY1 B;  5I9P A;  3S15 B;  1ONL A;  2SDF A;  4JBJ A;  2KHS A;  3KYH C;  1Q1E A;  3M85 A;  3E9I A;  1HA6 A;  2E2D C;  1EFI D;  4HSP A;  1H9R A;  4C3J H;  4BBS B;  1XTC D;  1NE3 A;  5IT9 c;  1VMP A;  1S3O A;  2TMP A;  2L55 A;  2RCF A;  2MJ8 A;  3HRZ C;  3GTM H;  2O4X A;  3CKI B;  2F0J A;  2QGQ A;  4KY5 A;  4A3J H;  4XQN A;  1BR9 A;  4K2L A;  4DNR B;  2NZO A;  3MVV A;  4LF4 L;  4HCS A;  1TKW B;  3W1B A;  1N32 L;  4IPD A;  1DJR D;  2PZT A;  2IY5 B;  4PMW A;  2XVS A;  4TKO B;  1L0X B;  2EPB A;  2KHI A;  4DAP A;  4K14 A;  1VQF A;  1WTH A;  1SE4 A;  4X3T A;  3V96 A;  4G7H C;  1EWC A;  1H9K A;  2XRS D;  1PYW D;  1G2S A;  2OXP A;  1P8L A;  4A3M B;  3I3C A;  4AH6 A;  1N8R C;  4BBR H;  3PV0 A;  3FKI H;  4LW1 A;  1VQD A;  5IYB G;  4AYB G;  1DON A;  1L1O A;  1J5E L;  1B70 B;  3HOY B;  2K6A A;  1WCM G;  3IKJ A;  1QZH A;  4CHT B;  3BYY B;  3HOZ H;  2OTJ A;  3RNU A;  1Q86 C;  4JI3 L;  2VUM G;  2EDG A;  3D4R A;  4A3E G;  4YY3 L;  2EE1 A;  2FMC A;  2RDF A;  5FK9 C;  2OTL A;  4LF7 Q;  1HHV A;  2DUD A;  2I07 B;  4J1M A;  2F0N A;  1EOT A;  1HQM C;  3J80 L;  2WV6 D;  4HED A;  1CQV A;  1PH7 A;  2JJQ A;  3A8I E;  1NBW A;  4IFD H;  4A3K G;  5DM6 3;  4NXM L;  4TVA B;  2KVM A;  1MGS A;  4R4I A;  1I5F A;  2HDL A;  4XT3 B;  3M4O B;  3T1Y Q;  4FF1 A;  4BBS H;  3H3V I;  1R9T H;  2NVT B;  5BN5 A;  3LWE A;  2ZJP A;  1HNX Q;  3HKZ G;  3NE5 B;  3W3A A;  3HOV B;  2PI2 A;  2OCE A;  1WTV A;  4CGY B;  4IUN A;  3I73 A;  4L5T A;  4CDF C;  2PMZ E;  1GHK A;  4LWC A;  4JI7 Q;  4MHE A;  4UP8 A;  3F1Z A;  4KD4 A;  1VCI A;  2EYM A;  3NUC A;  2E2I B;  5CV7 A;  4F7X A;  1XPU A;  4KLK A;  5K36 H;  2BE5 D;  2CVR A;  2IT1 A;  3K59 A;  3OHX C;  2LS0 1;  2DY7 A;  1IYU A;  1SNC A;  4JI8 Q;  3CQZ B;  4R1J A;  4MIU A;  3TME A;  3NEM A;  1NR4 A;  3CCL A;  4RGM A;  2M2L A;  1RHP A;  2F0H A;  3NTI A;  5M9O A;  2Y0S B;  1EQQ A;  1JWS D;  5KND A;  5HY6 A;  2B8G A;  2K5V A;  4ULL A;  4DN4 M;  3J81 c;  1QVC A;  1IBM L;  1SN8 A;  3D4W A;  2XIW A;  3OMG A;  1K83 B;  4BA1 I;  5IWA Q;  5JVH 3;  1XX8 A;  4QIW E;  1QOH A;  2B2T A;  2CCZ A;  4IFD J;  2K1B A;  2N55 A;  1WTX A;  2WP8 J;  1IBK Q;  1XWE A;  1J9O A;  1S5F D;  2EVB A;  4GN3 B;  4X3S A;  3GTK H;  4DAY A;  2F4I A;  4IPG A;  4K5X A;  2HT1 A;  1FGU A;  4IO9 A;  2F0T A;  2K5D A;  3SXH A;  2F0K A;  1MI2 A;  1TVX A;  2XN9 C;  4FXK C;  2O2L D;  2JEA I;  3HOX G;  2K50 A;  1SDF A;  5EKL A;  2NN6 G;  1CK1 A;  1YZ6 A;  2P5Z X;  5LMN L;  3GTP H;  1CI3 M;  1GD7 A;  1STE A;  3J81 i;  2A6H C;  4JK1 C;  4RCN A;  1FL0 A;  3UDG A;  1BKB A;  4DNT B;  4FF3 A;  3NTK A;  1B44 D;  4GKK L;  1QVF A;  3A54 A;  3TP5 A;  3M4O H;  1A2U A;  1BCP B;  1YNJ C;  2TSS A;  1EQT A;  2EYP A;  2VXW A;  4KY6 A;  3GTO B;  2PO4 A;  1BUV T;  4K6L A;  1KAA A;  2MPM A;  1VQ8 A;  2Z4H A;  2N78 A;  4A3C G;  2K05 A;  4AYB B;  1SMY D;  3K5N A;  3PO2 H;  5K5P A;  4A3B G;  1PYB A;  4DK3 C;  2I5L X;  3K80 C;  2DGY A;  4CKE A;  5LMU L;  2EYJ A;  4LF7 L;  2F3W A;  5E4W C;  4DV1 L;  5TSS A;  1EZ6 A;  2SNM A;  4JVZ A;  4OWT B;  5LMU Q;  5A35 A;  4A75 A;  1QCB D;  1TWF H;  2F0D A;  1GVP A;  1HPC A;  3KF6 A;  3F2C A;  4Y7N B;  3K5M A;  3MWY W;  3S17 B;  2WB1 E;  1F9S A;  1J6Q A;  5ELN A;  1SMX A;  4ABN A;  1W6J A;  5HGT A;  2D5D A;  2SOB A;  4KV6 A;  1EY9 A;  3RZD H;  5IYB H;  5KNC A;  3TN2 A;  3CP0 A;  4G57 A;  2OWO A;  2LKV A;  1EEF D;  1H9S A;  3WWV A;  3UDI A;  1GUW A;  1BXT A;  4JI6 Q;  3TSS A;  1YI2 A;  1SSO A;  1OXV A;  2NZH A;  4ODG A;  4ZRZ A;  2QEX A;  2AWN A;  3OW7 A;  3H09 A;  1K8M A;  3STB C;  5CBE E;  1D1I A;  1GUS A;  4CKB A;  2UU9 L;  1STB A;  1LT3 D;  2LXJ A;  4LFC L;  1TT2 A;  1H9S B;  2K04 A;  2YYZ A;  2UUC L;  5KYI A;  3MEF A;  2ENB A;  2N3S A;  3G71 A;  4IJL A;  2WII B;  3C3L A;  1IBK L;  2VQF Q;  1EZ8 A;  3WOE A;  3CQZ H;  2B2W A;  1B50 A;  3K7U C;  3HKZ E;  2F0I A;  1D5Z C;  1TWC H;  1SNM A;  2D9U A;  1FD7 D;  1LTI D;  4ZUI A;  4JI5 Q;  1QJO A;  2J4X A;  5J39 A;  4F88 A;  1I94 Q;  1E22 A;  1D5M C;  3UDX A;  5C3X A;  1SJE D;  3CU7 A;  4C3H G;  2Y0S G;  3FHW A;  1I4X A;  2EYH A;  3CW2 C;  3HZX A;  4Y52 H;  3NPP A;  5CV8 A;  5KIX A;  3E3X A;  5LL6 S;  2L15 A;  4FO2 A;  3SK5 A;  2HUG A;  4WFN 3;  4U68 A;  1Z7T A;  1D7Q A;  1BBU A;  5COR A;  1HNW Q;  1EU3 A;  2HIX A;  1IBL L;  4MNO A;  1TWC B;  3ERS X;  5IOC A;  3GTG B;  1JIC A;  1PH5 A;  2NZ1 D;  4EQ5 A;  3A5Z B;  3E9H A;  3RLF A;  5M5W B;  1HR0 Q;  3OIQ A;  2L9H A;  1MSG A;  4DR7 L;  4GN5 A;  5JPM C;  3OTO L;  1HXY D;  4UP9 A;  2K7V A;  3S16 H;  2FFK B;  3QIA A;  3T16 A;  5C0X I;  1KC8 C;  1RCV D;  4DUZ L;  3PIP A;  1KIX A;  3CXC A;  2B2Y A;  4B3M Q;  4Z9C B;  1X3E A;  2BA0 A;  1HNX L;  1X65 A;  4A3D B;  1VQ7 A;  2NVX B;  1EL0 A;  2G9H D;  2YTV A;  1LT5 D;  3DEO A;  5EJW A;  4M1U B;  5C5L A;  2EXD A;  1PH9 A;  4L5R C;  1GHJ A;  4PZ6 A;  4CDD C;  4DV7 L;  2VZA A;  1F77 A;  1RIP A;  3BDC A;  4G7Z C;  1EWH A;  1B8A A;  1F2M A;  3BZD B;  1HRJ A;  4DUZ Q;  2A6E C;  2FJ2 A;  2CH4 A;  3JC6 6;  3CC7 A;  1Y1V B;  4DR1 Q;  2D62 A;  4DK6 C;  3U9O A;  3TZU A;  3RZD B;  1LTG D;  3F2U A;  5C4J B;  2I5M X;  2K5Q A;  3AEV A;  1YBY A;  1JB3 A;  3PIO A;  1F9P A;  2ZJQ A;  1DXM A;  1I4H A;  1RTO A;  2I5H A;  4GS3 A;  3PIP 3;  1WYD A;  2L5T A;  4GOP A;  3BS1 A;  5M3F H;  1SE2 A;  3Q8D A;  5CV4 A;  3TZD A;  3AU7 A;  1GUG A;  2E2H B;  1SYG A;  1ZYR C;  3V05 A;  3I4O A;  4OGQ C;  1HR0 W;  1I6H B;  3ICE A;  4A3K B;  1IBM Q;  4WJ3 M;  1A2T A;  1PH4 A;  1GOZ A;  1PXU A;  4A3C H;  1WCM H;  2K14 A;  4C3J B;  3G4S A;  4LF6 L;  4JBK A;  5GQO A;  1I94 L;  2FHT A;  1JMC A;  2EYF A;  3DWP A;  4R4T A;  3MXN A;  5GAD C;  1ROD A;  5GAG C;  1H9M A;  3CAM A;  4GLV B;  3G48 A;  2R7F A;  1UNS A;  1GO3 E;  1HH2 P;  3J7Z C;  2NVQ H;  2KEN A;  3K57 A;  3T1H L;  2RHS B;  2B29 A;  2E2J H;  4RGN A;  5C4H A;  4JPB W;  1XNQ L;  4K6D A;  3TRE A;  4OL7 A;  4EVO A;  1KAW A;  2V1C C;  5DM7 3;  1VQL A;  2PW5 A;  1V8Q A;  3SE0 A;  3WOF A;  1UAP A;  1LTR D;  5M5Y H;  1CSP A;  4RHR A;  3IRB A;  3IAY A;  1Q81 C;  2PQA B;  2MGS A;  4JYA L;  5EPK A;  4KI0 A;  1MIU A;  1S4Z A;  2DN8 A;  1N34 Q;  2H5X A;  2L11 A;  3CCU A;  4JI1 L;  3KFU A;  1P16 A;  1VQ5 A;  1ZXT A;  4KHZ A;  2VS1 A;  4RA8 A;  1EIY B;  1JC7 A;  1F2L A;  1PTO D;  5C3E B;  2M00 A;  2DY8 A;  4YCV A;  1NJI C;  1PH8 A;  3H3V H;  4A3G H;  4L5Q A;  3IFD A;  2G5D A;  4BY7 G;  2GVB A;  2HDM A;  2NBF A;  1X3F A;  2ICE C;  3W5O A;  1NCV A;  1N34 L;  1O7Z A;  1BBX C;  2VB3 X;  4TSS A;  2VY3 A;  5IYC G;  1WTW A;  4FNF A;  1E2V A;  3I2Z A;  5G3L F;  3H3V C;  1II3 A;  4N8F A;  1TWA B;  3ERQ A;  2XGT A;  1DOM A;  2XWJ B;  3TS2 A;  5DEH A;  4U67 3;  4ZAI A;  4KKU A;  4OO1 H;  4A3G G;  1JWU D;  1PRT D;  1Q12 A;  1C8C A;  1XXG A;  4X65 L;  5D65 A;  3UE0 A;  1A3T A;  3T1H Q;  5JJL A;  3VR4 A;  4DV7 Q;  2CWP A;  2JA6 B;  1OXU A;  4A3D G;  1YHQ A;  4G7O C;  5E7N A;  3MTS A;  4LAA A;  3D6W A;  4IUR A;  4R8N A;  2PW7 A;  1SEB D;  1EY4 A;  2I46 A;  4B08 A;  3HOV H;  1KQS A;  1IZ6 A;  3FMC A;  5M3M B;  3EIV A;  3J7Y W;  1HFN A;  3UE1 A;  1R9T B;  1WCM B;  2B2V C;  3L2P A;  4TRD A;  1TWG B;  1SR3 A;  4POF A;  1PFB A;  1WI5 A;  1D1K A;  2RSO A;  3OTO Q;  2AQ2 B;  3GTL H;  4LF6 Q;  3RR5 A;  1TS3 A;  3LX0 A;  1M8A A;  3TEH B;  1MSH A;  1LTS D;  2K5H A;  1IKM A;  1YJ9 A;  3MXU A;  1CHP D;  1Z6H A;  2BDN A;  3VR5 A;  3ITP A;  4OEM B;  1UE5 A;  1EYG A;  4DK0 A;  4HJ7 A;  3BZK A;  4N8X 1;  3E5S A;  4DR5 L;  3HOV G;  1K3R A;  4L6T B;  5I9O A;  2F0L A;  4JCV E;  5EKK A;  1JE5 A;  4IOC A;  1HUN A;  1Q46 A;  2VW9 A;  1ENF A;  4EQN A;  3H15 A;  1A3V A;  3ULP A;  2YTX A;  1C4Q A;  4QIW B;  2RQX A;  4E6I A;  1V43 A;  3R2T A;  5HGQ A;  3T56 B;  1SYC A;  4OWX B;  3PO2 G;  4KKS A;  4KK7 A;  1E0B A;  2NVY H;  3OOC A;  2R92 H;  4ZUJ A;  4QL5 A;  1M90 C;  4A93 B;  2B3G A;  1LM0 A;  3D6C A;  4A3F G;  4UDU C;  4R8I A;  4LF9 L;  1Y8N B;  1YHB A;  4CBV A;  1RJT A;  1LUZ A;  1TQO A;  1STN A;  2QDL A;  1WJJ A;  4A3M H;  5M3F G;  5A2Q L;  5KGU A;  4JI8 L;  1WTQ A;  4ILW A;  4A3D H;  3M9B A;  1YIJ A;  1AP0 A;  3P1H A;  4X3U A;  4XXE A;  4AQY Q;  3S16 B;  1KRT A;  1X3Q A;  4DV2 Q;  4JV5 L;  1S5E D;  3QR8 A;  2VNU D;  5ELO A;  2ZTD A;  3RD4 A;  2CQO A;  2DJF C;  2CW0 D;  4DV6 L;  1EIF A;  2L12 A;  2A69 D;  2Q2U A;  3C1E A;  3V2T A;  4DV2 L;  3K5L A;  3FPU B;  2AQ1 B;  4JV5 Q;  5C0X J;  4LNQ A;  2RDG A;  4PG3 A;  2F4V L;  3S1Q H;  3H0G G;  5EBD A;  1STY A;  4UPA A;  3EBE A;  2X69 A;  1PLF A;  3KLS A;  5L37 A;  1EFW A;  1B3Q A;  1VQJ A;  2L1B A;  1NMG A;  2C9O A;  1HZA A;  1ESF A;  3AYH B;  3MXN B;  4ZQ3 A;  5BN3 A;  4LUO A;  2G9D A;  5KYL A;  1VQ6 A;  1YJW A;  3CCJ A;  2WAQ B;  3VA7 A;  1QG7 A;  1AE2 A;  3SK8 A;  3SR1 A;  1HR0 L;  5DLQ E;  4C3I G;  1NTG A;  2R92 G;  4BWG B;  1IYV A;  4C1N K;  5T1I A;  4DA2 A;  5CBA E;  1MD2 D;  4XYO A;  2E5L L;  1Y1W H;  3HOU H;  1UUP A;  3R3O A;  2YV5 A;  3KUP A;  4BBR G;  1EQR A;  4HTH A;  3HOY G;  3VYT A;  1L0Y B;  3FKI G;  2GN5 A;  3NBH A;  5I2Y A;  1EEI D;  1TU2 B;  1I4R A;  4QUC A;  2AQ3 B;  2B8F A;  3MHB A;  3CD6 A;  3EFX D;  1RL2 A;  5I2X A;  4BY7 H;  4WRD A;  2A5H A;  1PV4 A;  2A19 A;  4X66 Q;  3KDF A;  4LFC Q;  5DAU A;  3GDE A;  5IYC H;  4GLX A;  1JOK A;  1K0S A;  2H4O A;  1QZG A;  4NP5 A;  1FR3 A;  1SRO A;  5CV9 A;  1O7I A;  3H0G H;  4HID A;  3K5O A;  1LYL A;  3GTQ H;  1HZB A;  3A0J A;  3RN2 A;  3PUY A;  2ZXP A;  4HMJ A;  3K0X A;  4P74 A;  1XJV A;  4XYQ A;  4X66 L;  3F2B A;  2F0P A;  3LNN A;  1UE7 A;  4GNX A;  5M5X H;  5D14 A;  3S2H H;  1Y1V G;  1VQO A;  5IGD A;  1OXX K;  2FIN B;  4LFA L;  2Q8T A;  3SEB A;  2YU9 H;  2R7Z G;  3S17 H;  2WFW A;  1S72 A;  4Y7N H;  3JAM i;  2Z9H A;  3U4Z A;  1Q82 C;  4P71 A;  5JJZ A;  2D0O A;  3VA5 A;  1X32 A;  2NVQ B;  3S1N H;  1ML0 D;  4L8J A;  2L0C A;  2NYZ D;  4MTN A;  2ICI A;  4IUQ A;  2K28 A;  4C3I H;  4P72 A;  2MFI A;  1FJG L;  5ELC A;  1QVG A;  4Q5V A;  3NQI A;  1PH2 A;  4B3R L;  4K8J A;  2JSO A;  3BYT B;  2EXZ A;  4DV1 Q;  4A3I G;  2AHO B;  5FKA C;  3WDN A;  3RUZ A;  3TBI B;  3PIO 3;  4NB3 A;  3TP8 A;  5A2Q E;  4HJA A;  2QKI C;  1WTP A;  2XTI A;  2XWB B;  1JQY D;  4K5W A;  1JOR A;  2R7Z B;  4HIM A;  3GTO H;  5CMD A;  4OON A;  1JOQ A;  4AYB E;  4H0L C;  3K0Y A;  3OMC A;  1OO9 B;  2F0U A;  2K33 A;  4PZ8 A;  1ASY A;  2E2H H;  5ELF A;  3R8B A;  1LAB A;  4JOI C;  2F0F A;  4JYA Q;  1WFQ A;  4ALP A;  4DR2 L;  2WAQ G;  5D3D A;  1CA6 A;  3S1N B;  2Q2T A;  1MBY A;  4OEL B;  2Q2I A;  3K58 A;  4GOP C;  3GTP B;  1JJC B;  1G8Z D;  1QIL A;  3MA2 B;  3I4M H;  3DLL A;  2AUJ D;  5M5X B;  1VQG A;  1S5B D;  1SNO A;  4I65 A;  3CPW A;  2KCN A;  2X6G A;  2EY6 A;  4DV6 Q;  2AWO A;  2ZM6 L;  3DM1 A;  3VR3 A;  1DZ1 A;  1Y1V H;  2J7Z A;  4R4O A;  1ASZ A;  4QMG A;  3GTQ B;  1QUQ A;  4A3M G;  4GKJ L;  2F3I A;  4AQY L;  3KF8 A;  5IE8 A;  3A8J E;  1PFS A;  2UUA L;  2F0M A;  1QUQ B;  2ALY B;  2LXK A;  4DR2 Q;  4CJ0 B;  1IBL Q;  2RBM A;  2RA4 A;  1N36 Q;  2Z0S A;  2D2C C;  2EY5 A;  4DR6 Q;  3EN2 A;  1EYC A;  1K83 H;  4RCO A;  4B3T L;  5CR3 A;  2UUB Q;  3DMU A;  1IL2 A;  1EY7 A;  1GKH A;  3NBI A;  1G6Z A;  2OEO A;  5F2D A;  5FO7 B;  4DR7 Q;  4NXM Q;  1T9H A;  2QEJ C;  1V9P A;  5EAY A;  2PZW A;  1L1O C;  2GVA A;  1LTB D;  3K6O A; 
#chains in the Genus database with same CATH homology
 4JG2 A;  1G29 1;  1A0I A;  1FVI A;  5IYD H;  2I5M X;  1VQN A;  3AEV A;  3S1M H;  4P75 A;  3L0O A;  1YBY A;  3F2D A;  3ULJ A;  4JI5 L;  4JI2 Q;  3PIO A;  4OX9 Q;  3PUZ A;  4DV4 Q;  2IHF A;  4BY1 G;  1VQH A;  2ZJQ A;  1UEB A;  2HQL A;  2K75 A;  4DV5 L;  4P73 A;  2I5H A;  5GAE C;  4DR5 Q;  1XNR Q;  4YWK A;  4GS3 A;  3CCE A;  1WYD A;  2K5N A;  4A93 G;  4NXN L;  1A8V A;  4GOP A;  4X64 L;  3LGJ A;  5M3F H;  4A3L G;  3Q8D A;  4BXX H;  4TQU S;  1PYS B;  1UE1 A;  4B3S Q;  4YWL A;  3CC2 A;  4LF9 Q;  1VQA A;  2IX0 A;  4YCU A;  1IYJ B;  2BH8 A;  4WJ4 A;  1GM5 A;  3I4O A;  3J81 j;  1HR0 W;  3ICE A;  1YNX A;  1IBM Q;  4WJ3 M;  1X54 A;  1L2F A;  4OXP A;  5JJK A;  1PH4 A;  3I4M G;  4JI7 L;  2LSS A;  4A3C H;  4O2D A;  5IYD G;  1WCM H;  2K14 A;  3I55 A;  3G4S A;  4L5S A;  4LF6 L;  4A3B H;  4JBM A;  4JBK A;  2Q2H A;  4A3J G;  5GQO A;  1A63 A;  2NN6 I;  1I94 L;  1JMC A;  3I4N H;  1YHA A;  4YCW A;  1XMO L;  1Y1W G;  3HOU G;  4QQB X;  1PH6 A;  3PUX A;  4A3E H;  2KHJ A;  4R4T A;  1VQI A;  3GTJ H;  3CC4 A;  2RHQ B;  2N8N A;  4HJ8 A;  1FJG Q;  5GAD C;  2OQK A;  5GAG C;  3CPF A;  3HOW G;  2K52 A;  3M3Y H;  2OQ0 A;  4JBJ A;  1IBM L;  3KYH C;  4K0K L;  1Q1E A;  3CAM A;  4GLV B;  3E9I A;  3G48 A;  4GN4 B;  3M85 A;  1VQ4 A;  2R7F A;  1GO3 E;  1HH2 P;  3CME A;  4JBW A;  4C3J H;  3J7Z C;  4B3M L;  2NVQ H;  2JA6 H;  4X65 Q;  1NE3 A;  5IT9 c;  2KEN A;  1S3O A;  3T1H L;  2RHS B;  2K4K A;  4JC0 A;  3K7A H;  2B29 A;  2E2J H;  4LFA Q;  3GTM H;  4XTC S;  1UE6 A;  1XNQ L;  3TRE A;  2QGQ A;  4A3J H;  2Z6K A;  3E0E A;  4LUZ A;  1KAW A;  2RCN A;  2V1C C;  2NZO A;  1VQL A;  2E8G A;  4LF4 L;  5C44 H;  3W1B A;  1N32 L;  4GLA C;  1CKO A;  4IPD A;  3K8A A;  1E7Z A;  4ME3 A;  5M5Y H;  1CSP A;  2I0Q A;  3TRZ A;  2IY5 B;  4PMW A;  3IRB A;  3U58 A;  3PCO B;  1HZ9 A;  2KHI A;  1Q81 C;  1VQF A;  2PQA B;  3STB D;  1K8G A;  3BZC A;  3PF4 A;  4JYA L;  3L7Z C;  3HOY H;  4KI0 A;  1P8L A;  3W1G A;  1MIU A;  4AH6 A;  1V1Q A;  2C35 B;  4RG1 A;  5GAH C;  1N8R C;  1N34 Q;  2H5X A;  4BBR H;  4A93 H;  2PNH A;  3PV0 A;  3CCU A;  4JI1 L;  3FKI H;  3KFU A;  1P16 A;  3RZO H;  1VQ5 A;  4LW1 A;  4KHZ A;  1CUK A;  2VS1 A;  3NBH B;  1EIY B;  1VQD A;  3RN5 A;  1NJI C;  1X6O A;  4A3G H;  4YCV A;  1PH8 A;  3H3V H;  4DR4 Q;  3BJU A;  4L5Q A;  4JI1 Q;  5IYB G;  4AYB G;  5C3E H;  1L1O A;  1J5E L;  2IHE A;  4BY7 G;  1B70 B;  4LF8 Q;  2GVB A;  3J7A 5;  1PVO A;  1K8A C;  1B7Y B;  1X3F A;  1WCM G;  1CSQ A;  4NXN Q;  1QZH A;  3W5O A;  1E1T A;  3HOZ H;  2OTJ A;  1CKM A;  3RNU A;  1Q86 C;  1N34 L;  4JI3 L;  2VUM G;  4OO1 I;  2VY3 A;  3KLW A;  4DV5 Q;  3ULL A;  5IYC G;  4A3E G;  4YY3 L;  3D0F A;  2ES2 A;  4DV0 Q;  4IFD I;  2R6G A;  3I2Z A;  4LF7 Q;  2OTL A;  3PUV A;  1VQ9 A;  2DUD A;  4POG A;  2PQA A;  4Y52 H;  1W3S A;  2XGT A;  4C3H H;  4LF8 L;  5FLM G;  1PH7 A;  2JJQ A;  3S1R H;  1NBW A;  2AMC B;  1SRU A;  3TS2 A;  4A3K G;  4NXM L;  5AJ3 L;  4TVA B;  1TWG H;  4A3G G;  4A3F H;  2R7Z H;  1Q12 A;  2Z6K C;  4J15 A;  4DNI A;  5C3E G;  4R4C A;  4X65 L;  3UE0 A;  1C9O A;  4R4I A;  1I5F A;  3T1H Q;  5JJL A;  2B63 G;  4DV7 Q;  1G6P A;  3T1Y Q;  4HIK A;  1G51 A;  2CWP A;  4BBS H;  5IP7 G;  1OXU A;  3H3V I;  4A3D G;  1YHQ A;  1R9T H;  1VQC A;  3S15 H;  5E7N A;  2NVT H;  4GKK Q;  4UP7 A;  2ZJP A;  1HNX Q;  3HKZ G;  2CWA A;  2JA8 H;  4DUY Q;  3HOV H;  2PI2 A;  4A76 A;  1KQS A;  2OCE A;  4OWW B;  1IZ6 A;  3EIV A;  2BH2 A;  2R7D A;  1A62 A;  3UE1 A;  3PUW A;  2MQH A;  4A3I H;  2JA5 H;  5IWA L;  4L5T A;  1YIT A;  1LTL A;  4QY7 A;  3L2P A;  2ZM6 Q;  2PMZ E;  3ER0 A;  1SR3 A;  5FJ8 H;  4POF A;  1VQE A;  1WI5 A;  3GO5 A;  4LWC A;  3OTO Q;  4UP8 A;  4JI7 Q;  3F1Z A;  3GTL H;  4OO1 G;  4LF6 Q;  5LMN W;  5C4X G;  3RR5 A;  2JK8 A;  1VCI A;  1E1O A;  3TEH B;  2K5H A;  4DR3 L;  5BR8 L;  3VDY A;  3HKS A;  1YJ9 A;  2N49 A;  2RF4 A;  1XPU A;  1UE5 A;  1Q7Y C;  1EYG A;  4KLK A;  4HJ7 A;  3M4P A;  1I6H H;  1AE3 A;  2IT1 A;  3BZK A;  2UXB Q;  1Z47 A;  4DR5 L;  4JI8 Q;  2VQE Q;  3CCM A;  1SFO H;  3HOV G;  3HOZ G;  1K3R A;  1L1O B;  3S24 A;  3M7N A;  1VQK A;  4MZ9 A;  3B6Y A;  4R1J A;  4EX5 A;  2VUM H;  4JCV E;  2UXD Q;  1JE5 A;  4IOC A;  4KHP L;  2HHH L;  1Q46 A;  4JI4 L;  2VW9 A;  3H15 A;  3NEM A;  3NEN A;  3CCL A;  3ULP A;  2EIF A;  2YTX A;  2JA7 G;  3ZJY C;  4PZ7 A;  5BR8 Q;  2FXQ A;  1V43 A;  1Q1B A;  1X56 A;  2CFM A;  5C4X H;  1EQQ A;  5HGQ A;  5HY6 A;  4OWX B;  3PO2 G;  4IFD G;  2K5V A;  3TQY A;  2MNA A;  4DV3 L;  2YTY A;  1VS0 A;  1QVC A;  3J81 c;  3F8T A;  2NVY H;  1Q8K A;  1SN8 A;  2D0P A;  4QL5 A;  1M90 C;  2B3G A;  1LM0 A;  1JJ2 A;  4A3F G;  4KHP Q;  4BA1 I;  5IWA Q;  4LF9 L;  1NY4 A;  1I3Q H;  1AH9 A;  1YHB A;  1LUZ A;  4JI4 Q;  4QIW E;  4QJF A;  4B3R Q;  1EOV A;  2CCZ A;  2UXD L;  1WJJ A;  3HFZ B;  1U5K A;  4A3M H;  5M3F G;  3PO3 G;  4IFD J;  4GNX C;  4BXX G;  1XNR L;  3CCS A;  4JI8 L;  2VQE L;  1EWI A;  4A3D H;  2WP8 J;  1IBK Q;  3M9B A;  4R4Q A;  1YIJ A;  4A3L H;  4OX9 L;  4GN3 B;  3U50 C;  3GTK H;  1KHI A;  1HNZ L;  4IPG A;  4IPH A;  2NVX H;  1OXT A;  2HT1 A;  4AQY Q;  1FGU A;  1S40 A;  1KRT A;  4IO9 A;  4DR3 Q;  2E2I H;  4DV2 Q;  4JV5 L;  5LMN Q;  1H95 A;  2R92 H;  5J3B A;  2VNU D;  5ELO A;  2JEA I;  4APV A;  3GD7 A;  2ZTD A;  3HOX G;  2CQO A;  5FLX c;  2Q2U A;  5GRO A;  1EIF A;  1YVC A;  2JQO A;  2K50 A;  4DV6 L;  4HIO A;  2NN6 G;  5LMN L;  1YZ6 A;  5M3M H;  3GTP H;  5IP9 H;  1GD7 A;  2ZTC A;  4DV2 L;  4JV5 Q;  4LFB Q;  5C0X J;  4YWM A;  1N33 Q;  3I4N G;  4B3T Q;  3J81 i;  4LNQ A;  4DUY L;  4PG3 A;  1XMQ Q;  3CF5 A;  1M1K C;  1FL0 A;  3UDG A;  1BKB A;  2F4V L;  3S1Q H;  3H0G G;  4BY1 H;  4GKK L;  3I56 A;  4UPA A;  1QVF A;  3RLN A;  3EBE A;  4HJ9 A;  2AKW B;  4UY8 C;  3GTG H;  3NEL A;  4LF5 L;  3M4O H;  1WOC A;  4RMF A;  1EFW A;  1VQJ A;  1HNW L;  4DAM A;  2WAQ E;  1NMG A;  4JI0 L;  3A74 A;  1K9M C;  1SLJ A;  4BA2 I;  3PSI A;  2A1A A;  1VQB A;  1HZA A;  2JA6 G;  3AYH B;  2F52 A;  3MXN B;  4LFB L;  4LUO A;  3TS0 A;  5IY0 A;  1VQ8 A;  1VQ6 A;  1YJW A;  3CCJ A;  1BVS A;  5M3M G;  2N78 A;  1HR0 L;  1AE2 A;  4A3C G;  5DLQ E;  3PO2 H;  4A3B G;  1PYB A;  1NTG A;  4DK3 C;  2R92 G;  2I5L X;  3K80 C;  2DGY A;  4XIG S;  5C44 G;  4DV0 L;  4JOI A;  5LMU L;  1N9W A;  4LF7 L;  2HHH Q;  3PO3 H;  4JI3 Q;  1TXY A;  4DV1 L;  4OWT B;  2E5L L;  1PHJ A;  1KL9 A;  1Y1W H;  3HOU H;  1C7Y A;  1Z9F A;  5LMU Q;  3AFP A;  2JE6 I;  2YV5 A;  4HJ5 A;  4BBR G;  4A75 A;  1PA6 A;  4QGU A;  1EQR A;  1TWF H;  2VQF L;  1TWH H;  2ZJR A;  1N32 Q;  3HOY G;  3FKI G;  1J5E Q;  2GN5 A;  3A5U A;  1GVP A;  3KF6 A;  4DPG A;  3F2C A;  3DM3 A;  2WB1 E;  3KJP A;  1J6Q A;  5ELN A;  1SMX A;  3CD6 A;  1RL2 A;  2UUC Q;  4BY7 H;  3M4Q A;  3RZD H;  3J80 c;  5IYB H;  4YHH L;  1PV4 A;  4X62 L;  2KBN A;  2A19 A;  2CKZ B;  4X66 Q;  3KDF A;  1CKN B;  3CP0 A;  2OWO A;  2ZTE A;  4LFC Q;  5C0X G;  3CCR A;  2UU9 Q;  3GDE A;  3CCQ A;  4LUV A;  5IYC H;  4GLX A;  4LF5 Q;  3J80 i;  1U0L A;  1QZG A;  3I7F A;  1SRO A;  3UDI A;  3WWV A;  1PH3 A;  4K0K Q;  1O7I A;  4JI6 Q;  1YI2 A;  3OYY A;  1OXV A;  3H0G H;  1XMQ L;  2NZH A;  4HID A;  2QEX A;  4JI6 L;  1LYL A;  2AWN A;  1HZB A;  3PGZ A;  3GTQ H;  3A0J A;  3RN2 A;  1XMO Q;  3PUY A;  3STB C;  1YEZ A;  3K0X A;  4P74 A;  3T1Y L;  1XJV A;  3F2B A;  4X66 L;  2UU9 L;  1UE7 A;  4GNX A;  2LXJ A;  4LFC L;  5M5X H;  4O0A A;  1XNQ Q;  3S2H H;  1Y1V G;  2YYZ A;  1VQO A;  5M5W H;  1XPR A;  1OXX K;  4LFA L;  2UUC L;  2YU9 H;  2R7Z G;  3S17 H;  2WFW A;  1S72 A;  3MEF A;  4Y7N H;  3JAM i;  3U4Z A;  2N3S A;  3AQQ A;  1Q82 C;  4P71 A;  3PF5 A;  5AJ3 Q;  3G71 A;  4IJL A;  2D0O A;  3OW2 A;  2B63 H;  3S1N H;  1UWV A;  5IP7 H;  4MTN A;  2VQF Q;  1IBK L;  2JA8 G;  1E24 A;  3CQZ H;  4C3I H;  4P72 A;  2MFI A;  1OTC A;  1FJG L;  3K7U C;  5JEA J;  1E3P A;  3HKZ E;  1HJP A;  1QVG A;  1PH2 A;  2R93 G;  3KF6 B;  4YY3 Q;  4B3R L;  1KRS A;  1TWC H;  4DV4 L;  4JI5 Q;  1JT8 A;  4DV1 Q;  4A3I G;  2AHO B;  1X9N A;  1VQM A;  2JA5 G;  3FP9 A;  3D31 A;  1I94 Q;  1KXL A;  4NB3 A;  4AIM A;  1XPO A;  1E22 A;  4HJA A;  4DV3 Q;  3UDX A;  1PH1 A;  5FLM H;  5JEA G;  1I50 H;  4X62 Q;  4YHH Q;  4A3K H;  2XTI A;  2Y0S G;  2A8V A;  3FHW A;  3CW2 C;  2EQS A;  4DR4 L;  1D8L A;  2QA4 A;  4HIM A;  4DR1 L;  4OON A;  1K73 C;  3GTO H;  2HIV A;  4AYB E;  4GOP B;  1DGS A;  1X3G A;  5H1S E;  4B3S L;  4DKA C;  5JJI A;  2JA9 A;  3BU2 A;  1OXS C;  4FDB A;  2L15 A;  3KOJ A;  3RLO A;  1D7Q A;  1NMF A;  1BBU A;  4PZ8 A;  1ASY A;  2E2H H;  4IPC A;  1TWA H;  4BBS G;  1HNW Q;  4X64 Q;  4JOI C;  1VQP A;  4JYA Q;  2UXB L;  2HIX A;  1WFQ A;  4ALP A;  1IBL L;  3AFQ A;  4MNO A;  4DR2 L;  2E5L Q;  3K81 C;  4JI2 L;  2R93 H;  1EUJ A;  3S14 H;  2WAQ G;  4NPS A;  3UDF A;  5C4J H;  3ERS X;  2Q2T A;  2F4V Q;  2JA7 H;  3HOW H;  2Q2I A;  1PH5 A;  4GOP C;  1MJE A;  2WB1 G;  4EQ5 A;  1JJC B;  1HZC A;  3E9H A;  1X55 A;  2KCT A;  3A5Z B;  3RLF A;  1YJN A;  4LF4 Q;  1Y14 B;  1HR0 Q;  2ASB A;  3I4M H;  4H02 A;  3U4V A;  3DLL A;  1N33 L;  2BA1 A;  4DR7 L;  4GN5 A;  1VQG A;  3CPW A;  2MO0 A;  3OTO L;  1IXR A;  4UP9 A;  3S16 H;  5FJ8 G;  2AWO A;  2ZM6 L;  4DV6 Q;  1K0R A;  1L0W A;  2KCM A;  2UUB L;  2UXC Q;  1Y1V H;  4R4O A;  1BBW A;  4IJH A;  5C0X I;  1KC8 C;  1KD1 C;  1ASZ A;  4DUZ L;  3PIP A;  1KIX A;  2IX1 A;  1SE8 A;  3CXC A;  2JEB I;  1QUQ A;  4A3M G;  1HNZ Q;  4IOA A;  4GKJ L;  1JJG A;  4B3M Q;  2F3I A;  1N36 L;  3SGI A;  4AQY L;  3CCV A;  1W2B A;  4JI0 Q;  1X3E A;  2BA0 A;  3KF8 B;  1X65 A;  1MKH A;  5IE8 A;  3G6E A;  4GNX B;  1HNX L;  4DR6 L;  1PFS A;  2UUA L;  1VQ7 A;  1QUQ B;  2ALY B;  2LXK A;  2VL6 A;  3S2D H;  2YTV A;  4DR2 Q;  1IBL Q;  4X6A H;  5K36 G;  1CKN A;  2ATW A;  2EXD A;  1PH9 A;  1N36 Q;  4L5R C;  4DAY B;  2PI2 E;  2Z0S A;  4PZ6 A;  4DV7 L;  2UUA Q;  4DR6 Q;  2VZA A;  2ID0 A;  3EN2 A;  4C2M H;  1RIP A;  1K83 H;  1XTD A;  4B3T L;  1JB7 A;  1B8A A;  4GKJ Q;  3JAM c;  2UUB Q;  1IL2 A;  2UXC L;  4DUZ Q;  4A4I A;  1GKH A;  3CMA A;  2Y0S E;  4DR7 Q;  1MJC A;  3CC7 A;  4NXM Q;  3JC6 6;  4DR1 Q;  5IP9 G;  1T9H A;  2D62 A;  4DK6 C;  3HOX H;  1V9P A;  5EAY A;  3KDF B;  2MO1 A;  1L1O C;  2GVA A;  3KJO A;  1C0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...