4JI3L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLWGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 17
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji3L00
1XMQQ 4A3EG 1RIPA 2WB1E 4LFCQ 4GS3A 2VY3A 1CSQA 5HGQA 1JJ2A 1X55A 1A62A 4LUOA 4OXPA 1CKOA 3CCJA 4XIGS 4YCUA 5M3MH 2IX0A 4Y7NH 1MKHA 2CFMA 3ULJA 2KCMA 1GM5A 1P16A 3K0XA 2L15A 1IZ6A 1N32L 2OWOA 3PF4A 3RZDH 3TQYA 1L1OC 4UP9A 3HOYG 3NELA 1L1OA 3HOXH 3S1RH 1KC8C 3G6EA 4GLAC 3M3YH 2VZAA 3MXNB 5C0XI 1Q81C 4LWCA 4K0KL 3S1NH 3AFQA 2Q2TA 3RR5A 1VQAA 3JAMc 2OQKA 5BR8L 3F8TA 1VQCA 2PI2A 4A3JH 1QUQB 4HIMA 3U50C 5FJ8G 3TEHB 1I5FA 5FLXc 4DR1L 3HOWH 4DUYL 1EWIA 1Q8KA 4DV2L 2HT1A 2NVTH 1TWCH 3J81c 4R4IA 5IT9c 2K14A 1ASYA 4A3MH 4ALPA 3S17H 5EAYA 3PSIA 4LFAL 1GVPA 1ASZA 1G291 2VUMH 1BBWA 1HH2P 2HHHQ 2EQSA 4YHHQ 1J5EQ 1SR3A 1E3PA 3M4PA 1Q86C 4RMFA 1I94Q 4JI0Q 3S1QH 1TXYA 1LYLA 1UEBA 4POGA 2UUAQ 4YCWA 1M1KC 2N49A 2JJQA 4LF7L 4LF8L 1HZAA 3S16H 3FHWA 4NXMQ 2D62A 2DUDA 3KYHC 4YY3L 2QEXA 1N8RC 2I5HA 2KENA 2JA7G 3FKIH 4X62Q 2AMCB 3BJUA 1BBUA 3CCEA 1XJVA 4TVAB 4DV0L 4IFDG 1DGSA 3M4QA 1PA6A 2XGTA 4DV3Q 4B3RL 1XMOQ 3S2HH 5C4XH 1LUZA 1K73C 2KHJA 3OYYA 2UXCQ 3HFZB 4A3LG 3KF6A 4B3ML 2ZTDA 1GO3E 3I2ZA 1VQKA 1V9PA 4YWMA 3CF5A 2AWNA 3PUYA 3PIPA 1VQBA 4DK6C 5GQOA 5M3FG 1Y1VG 3CP0A 4JI2Q 3AYHB 4P72A 2YU9H 3E9IA 2V1CC 5C3EH 1VQFA 5ELOA 5AJ3L 4DV5Q 2E2HH 2CKZB 1HR0Q 2QGQA 3KDFB 1XNQL 2PQAB 1FJGQ 4GNXC 4GKKQ 1KRTA 4RG1A 3M85A 3G71A 4GNXA 3OW2A 1HNZL 4C3IH 2Q2IA 2JA9A 1KL9A 2MFIA 2YYZA 5IYDH 4JI3L 1HZBA 1J5EL 4J15A 4OWWB 1G6PA 1I94L 4WJ4A 3ULLA 1IBKL 5HY6A 4QQBX 1TWHH 2JK8A 3I4MH 2R92G 3KF8B 3E0EA 2I5MX 4QY7A 4L5QA 4A3BH 4DR7Q 4P74A 4JG2A 3OTOL 2R93H 5C0XG 4P75A 2K5VA 4GN4B 1OXTA 2Y0SE 3H0GG 4BY1H 1VQLA 4JI1Q 1UE5A 4Y52H 1XMOL 2B3GA 3J81i 1UWVA 2A1AA 1IBLQ 1NJIC 1XNRQ 3DLLA 1K8GA 2UXCL 2NZHA 3ULPA 3L2PA 3K7AH 1I50H 4DUZQ 4DR4L 3RLFA 1K9MC 5LMNQ 2VS1A 2NZOA 4JV5L 4DV7L 2EXDA 4JI2L 2FXQA 4LF6L 3M9BA 3U4ZA 2LSSA 3SGIA 3F2CA 4BBRH 3CMAA 4JI5L 4GOPB 1OXSC 3F2BA 2AWOA 4A3JG 2E8GA 1HR0L 4PMWA 4IFDI 3KJPA 4APVA 4UPAA 4HJ8A 4GKJL 3TS0A 1E1OA 4DR6L 4A76A 5IP7G 4AQYQ 1LTLA 1T9HA 4MTNA 2YV5A 3J7ZC 5IE8A 1Y1WG 3U58A 1R9TH 1QZGA 3GTOH 3CC4A 4WJ3M 1UE7A 3CAMA 1YJWA 3GTPH 2F4VL 2F3IA 1JJGA 1X54A 1FVIA 2ZJPA 1MIUA 3S24A 4C3HH 4LF4Q 1LM0A 2OTLA 1RL2A 3D0FA 3EBEA 3TS2A 1EFWA 1WJJA 2B63H 1L1OB 4X66Q 2VW9A 4A3DH 4JYAL 1PH2A 3G48A 4OONA 3M4OH 2PMZE 2IT1A 1IBMQ 2LXKA 4R4OA 2NVXH 3H3VI 2JA6H 2E5LQ 1N34Q 1UE6A 5IYBH 4B3TL 3STBC 1PH3A 1IBLL 1H95A 1OXVA 4UP7A 3KOJA 5M5XH 1YNXA 2UUCL 4JI6L 4IOCA 3KJOA 4EQ5A 4BA2I 1YITA 2F52A 4C2MH 5C4XG 5C44G 3GO5A 1J6QA 2IHFA 3BU2A 3PUWA 4DR5L 4IJHA 4KLKA 5JEAJ 3B6YA 4DV6L 1YI2A 4DV4L 1D7QA 4HJ7A 2R7DA 2A19A 2RHSB 1K8AC 4B3SL 1S40A 3PO3H 3UDGA 4JCVE 3I55A 4DV1L 1PH4A 1IYJB 2DGYA 1UE1A 2K75A 1EIFA 3AQQA 4IPHA 2CWAA 4OX9Q 4A3FG 1Q7YC 4KHPL 2VQFL 2ZM6L 2UXDQ 1V43A 4X65Q 5GAHC 3J81j 1IL2A 4A93G 1JT8A 2JA5G 1B8AA 5M5WH 3WWVA 3CCSA 4YWKA 5IWAQ 4POFA 4JI7Q 1VQOA 4DR3L 1X9NA 1Q1BA 4GLXA 4UY8C 3HOVH 3I4MG 3KLWA 1E7ZA 1Z47A 1Y14B 3PV0A 3GTQH 2UXBQ 1JJCB 3PO2H 1U0LA 4A3IG 1BKBA 4DR2L 1XMQL 2R93G 1PV4A 4LFCL 3GTMH 3W1BA 3PUXA 3NENA 2E5LL 1HZ9A 1EQQA 4DAMA 2ASBA 3HOZH 4NB3A 4YCVA 4OO1G 2Z0SA 4X64Q 2CWPA 4A75A 1QVGA 1X56A 5DLQE 3UDIA 1E24A 1PVOA 2R7ZH 2LXJA 5IP9G 4MZ9A 3HOUG 2PI2E 3RN5A 1VQPA 1VQNA 4R4QA 1VQ7A 4HJ9A 1YHQA 3TRZA 1EUJA 3EIVA 4TQUS 1D8LA 2MO1A 2R7FA 4BBRG 4P71A 2KBNA 1SLJA 3L0OA 4A3GG 1NMFA 2HIVA 4JBMA 4A3KG 3A5ZB 1HNXQ 4BY7H 2K5NA 1VQ4A 3T1YQ 2BH2A 4IFDJ 2C35B 1Q46A 1AE3A 3RZOH 1HJPA 2Z6KC 1N33Q 2N3SA 1YZ6A 2Z6KA 3GD7A 4JC0A 3I4NG 3PUZA 1L0WA 2HHHL 4YHHL 4LUZA 1VQ8A 4H02A 4JI0L 1NBWA 3CQZH 2B63G 3AEVA 3HOYH 2UUAL 1VQGA 4BXXG 2VQEQ 2I5LX 3L7ZC 1PHJA 2JE6I 5LMUQ 5E7NA 2IY5B 4NXML 2NVYH 2XTIA 2JA6G 1W3SA 2IHEA 3S1MH 4IPCA 1SN8A 2VL6A 2EIFA 4EX5A 4X62L 5M3MG 2YTYA 1YHBA 2PNHA 3A0JA 5IYCH 1PH9A 2OQ0A 3Q8DA 4DV3L 5FJ8H 3RNUA 1WYDA 4PG3A 3S14H 5M5YH 1XPUA 1WCMH 2ALYB 3CXCA 1EYGA 3CW2C 1NE3A 1NMGA 3CCLA 4LF9Q 2QA4A 2K4KA 3HOXG 1L2FA 2B29A 3K8AA 2RCNA 1MJEA 4O2DA 3CC7A 1CKNA 1PH1A 4LNQA 1VQDA 4HJAA 3PO3G 1HNXL 1PFSA 1N36Q 4OO1I 4LFBQ 5C0XJ 2UUBQ 3UE0A 4DV5L 3T1YL 2NN6G 3W1GA 2ZJRA 1V1QA 1YEZA 2N78A 4C3JH 4JI4Q 2HIXA 2PQAA 2JA8H 1FJGL 3HOWG 3GTGH 4HIOA 4GKKL 1QVCA 4QIWE 4DR2Q 2K5HA 4A93H 4BBSH 4L5TA 2JA7H 4A3MG 4PZ6A 4KHZA 2BA0A 3CD6A 2JQOA 5FLMH 4JI8Q 4LW1A 3PCOB 4R1JA 4DPGA 1PH7A 2VUMG 1I6HH 1OTCA 5H1SE 1B7YB 1VQJA 3PO2G 5JJLA 4OWXB 1QVFA 3A74A 2MNAA 2KHIA 4DR7L 5JJKA 4A3LH 3ERSX 3HOZG 3CPWA 2NVQH 1KHIA 1A0IA 2ZTEA 1Y1VH 3CMEA 1P8LA 3FP9A 4K0KQ 1YIJA 4JI1L 3E9HA 2MO0A 3FKIG 5BR8Q 1KQSA 2Q2UA 1XNRL 4A3CH 1B70B 1OXUA 1U5KA 1TWGH 1VQIA 2R6GA 4IPGA 4LF9L 1HR0W 4DUZL 1M90C 4DR1Q 5LMNL 1VQMA 4BA1I 1G51A 2ID0A 5JJIA 3T1HQ 1SFOH 4JBJA 4GOPC 1S72A 3ICEA 1N36L 4GOPA 4DKAC 4LFAQ 4LFBL 3PGZA 1X3GA 2BH8A 2KCTA 3RLOA 3CCQA 4HIKA 1TWAH 2D0PA 5C3EG 4JI4L 4JBKA 2R92H 3TREA 4AQYL 2JEAI 1NTGA 3K80C 4IJLA 4LF7Q 4LF8Q 4QJFA 3H0GH 3UDFA 4JI8L 3KFUA 1X6OA 1VS0A 4YY3Q 1WOCA 5IYDG 1YBYA 3G4SA 3PF5A 2E2JH 3GTLH 1BVSA 1K83H 4DV0Q 3PUVA 4LF4L 4L5SA 1S3OA 1QZHA 1VCIA 4XTCS 3UDXA 2I0QA 5ELNA 4B3RQ 4JBWA 4X66L 4NXNQ 1EQRA 2N8NA 3S15H 2NN6I 1SE8A 4LF5Q 4A3BG 5IY0A 1IBML 5LMNW 3KF6B 1YVCA 5GROA 1Z9FA 4B3MQ 3STBD 1EOVA 1N9WA 1N34L 2WP8J 1YJNA 4IOAA 1MJCA 1GD7A 1NY4A 4BY1G 5IYCG 3CCUA 1KAWA 3BZKA 1FGUA 5AJ3Q 1C7YA 4IPDA 1WCMG 2ES2A 1C9OA 1XPOA 1X3EA 5IP7H 5GAEC 3T1HL 2K50A 1XNQQ 1JE5A 3CCVA 1Y1WH 2Q2HA 1C0AA 1VQ6A 1VQ5A 4GNXB 2HQLA 1HNZQ 1PH6A 1X65A 2JEBI 3D31A 3RLNA 4A4IA 4JI3Q 4ME3A 4KI0A 1FL0A 1SMXA 3CPFA 3AFPA 1VQEA 1IBKQ 4OX9L 1QUQA 3ER0A 1O7IA 2JA8G 1W2BA 1YJ9A 4X65L 2ATWA 3IRBA 2UXDL 1JB7A 4R4TA 4A3EH 3OTOQ 4BBSG 3F1ZA 1E22A 4QL5A 1SROA 2OCEA 2CCZA 2UU9Q 3GTKH 4R4CA 5IWAL 4JI7L 5FLMG 3K81C 1XTDA 3A5UA 1A63A 4GN5A 1Q1EA 1OXXK 2UXBL 5K36G 4NXNL 5C44H 2WAQG 4PZ8A 1EIYB 4IO9A 4LF5L 1KRSA 1KIXA 3W5OA 3ZJYC 1Q82C 4A3DG 4DR4Q 1VQHA 1VQ9A 1PH8A 1XPRA 3CC2A 1AH9A 1CKNB 4DAYB 4JV5Q 4DV7Q 4X6AH 4LF6Q 4GLVB 1KD1C 3RN2A 4X64L 4JI5Q 5IYBG 1X3FA 1PYSB 3MEFA 3CCRA 2YTXA 4A3CG 3PIOA 2ZJQA 3K7UC 2GN5A 4A3FH 2IX1A 2BA1A 2WAQE 3VDYA 4GKJQ 1KXLA 2E2IH 1E1TA 4L5RC 2Y0SG 4DR6Q 4AH6A 1JMCA 1YHAA 2JA5H 4DK3C 3HKZG 4GN3B 1PH5A 4DNIA 4HJ5A 3I56A 3S2DH 1TWFH 3DM3A 3NBHB 1GKHA 4A3GH 2F4VQ 1WI5A 1A8VA 4A3IH 2RHQB 2UU9L 3KDFA 3J80i 4JYAQ 1HNWQ 4O0AA 4YWLA 1IXRA 1K3RA 2YTVA 4JOIC 1N33L 2CQOA 2MQHA 3BZCA 4JOIA 3EN2A 3HKZE 4B3TQ 4MNOA 1PYBA 3F2DA 1HZCA 2WFWA 5IP9H 2UUCQ 4JI6Q 3HOUH 3U4VA 2RF4A 3HOVG 3CCMA 4P73A 4UP8A 5C4JH 4HIDA 2OTJA 3I4OA 3GDEA 2VQEL 4DR5Q 2K52A 1N32Q 5LMUL 1WFQA 4QGUA 4DV6Q 4AYBG 4DV4Q 1CKMA 2ZTCA 1AE2A 2D0OA 4AIMA 5M3FH 4OWTB 2A8VA 4A3KH 3UE1A 4B3SQ 4PZ7A 1Q12A 4DV1Q 1SRUA 2R7ZG 4BY7G 2VNUD 3I7FA 2AHOB 4NPSA 5GADC 2WB1G 1I3QH 2VQFQ 2ZM6Q 4KHPQ 3J7A5 3H3VH 2GVBA 4DUYQ 4LUVA 4DV2Q 3JAMi 3J80c 3HKSA 2GVAA 4FDBA 3I4NH 2H5XA 4AYBE 2AKWB 5J3BA 4DR3Q 2UUBL 5JEAG 3JC66 3NEMA 3M7NA 1CUKA 3H15A 1HNWL 5GAGC 1K0RA 4BXXH 3LGJA 3GTJH 1CSPA
chains in the Genus database with same CATH superfamily
5HGQA 1JJ2A 1W6KA 2L5TA 1A62A 3CCJA 1NCVA 4Y7NH 4C3JB 2E75C 2SDFA 2OWOA 3TQYA 3GTGB 5IGGA 4UP9A 1JWMD 3NELA 2OF1A 3HOXH 3V96A 4C1NI 2K01A 3MXNB 1KABA 1E2ZA 3S1NH 3RR5A 5EKKA 1JC7A 1IL8A 1VQAA 5T1GA 5BR8L 2PI2A 4HIMA 5FJ8G 3ND9A 4EQPA 4DUYL 2K14A 4ALPA 1Y1VB 2PW7A 5KRUA 4LFAL 1ILPA 2X6GA 4KJNA 1J5EQ 1SR3A 3S1QH 1Q86C 4RMFA 1I94Q 3ITPA 1EOTA 2E2DC 2JJQA 4HMIA 3BDLA 3FHWA 2JA7G 1H9MA 1N8RC 3FKIH 4X62Q 3CCEA 1XJVA 4IFDG 3OIPA 2XGTA 4F8MA 1LT6D 1LUZA 4C1NK 3RMHA 4KJOA 3KF6A 3H0GB 1GO3E 4DF7A 3PUYA 1VQBA 2A68D 1GHKA 1G2TA 4HEDA 5ELOA 1EWCA 4DV5Q 2CKZB 1HR0Q 1K3BC 1TS5A 1EY6A 2QGQA 3KDFB 3S15B 1G8ZD 1FJGQ 4GKKQ 1KRTA 4WRDA 3NSWA 1HNZL 3I8ZA 2YYZA 5IYDH 2MFIA 4JI3L 1HZBA 1G6PA 4FO2A 4HTHA 5EBCA 3ULLA 3VR2A 3NK9A 1IBKL 5HY6A 2PMZB 2JK8A 2M2LA 1TWCB 5CR3A 5D65A 3I4MH 1FNVA 1SDFA 2R92G 1EQVA 5EBDA 1YNNC 1OXTA 2Y0SE 4BY1H 1SYBA 1VQLA 4JI1Q 1UE5A 1XMOL 1A3VA 3DLLA 1K8GA 2X69A 3ULPA 4DUZQ 4ZKCB 5LMNQ 3VR6A 4JI2L 1JCKB 3CMAA 4X3KA 3F2BA 4A3JG 2E8GA 1JICA 4IFDI 1EY5A 4E6IA 5KIXA 4GKJL 3J80L 4HJ8A 1E1OA 1TY0A 1RTNA 2XSCA 1AFPA 4CKCA 1Y1WG 2OXPA 2NTSA 3U58A 1ESRA 2K5WA 2K7VA 1R9TH 4K2KA 2LS01 5JPMC 3A8JE 1YJWA 5K36H 2G5DA 2F4VL 2F3IA 4A3FB 4JPBW 4C3HH 4LF4Q 3D0FA 1STAA 4JYAL 2JA5B 1RDPD 2IT1A 4WFN3 4IALA 1MSHA 2NVXH 3URYA 5CBEE 5IYBH 4B3TL 1IBLL 5M5XH 4UP7A 2L9HA 1YNXA 3VA7A 4IOCA 4Q0FA 3KJOA 4C2MH 4F88A 5C4XG 2R93B 3PUWA 3U9SA 4IJHA 2FINB 4UHVA 3JAML 2PCFB 1D7QA 2HUGA 2R7DA 2A19A 5FLXL 4H7BA 5IT9L 2A6ED 2NN6H 2B2VA 2VQFL 5GAHC 1FNWA 3J81j 1B8AA 5M5WH 3WWVA 5IWAQ 4RHRA 4B9XA 1PFMA 4XQNA 4A3KB 1SAPA 3Q23A 1X9NA 2UXBQ 2HQEA 3IFTA 1F77A 4A3IG 1LT4D 2R3ZA 3GTMH 1VMPA 1L0YB 2OEOA 3W1BA 3PUXA 2ASBA 1HZ9A 2B8GA 4YCVA 4OO1G 1LTGD 4TKOB 2EY1A 1E24A 3FDTA 1V1PA 4ZKBB 2B63B 4JW0A 4B08A 4FXDA 3RN5A 1HFGA 1PRTF 1VQ7A 4HJ9A 1YHQA 1MD2D 3TRZA 5L37A 2A69C 2R7FA 5M3MB 2N55A 2E74C 5A35A 3L0OA 1ENCA 3MEHA 2AQ1B 3RZDB 4BY7H 1EY7A 3S1RB 1TS4A 1XTCD 2BE5D 2F0VA 1N33Q 4Z9CB 1YZ6A 2K1BA 3I4NG 4LMQD 2HHHL 4YHHL 4LUZA 1D5ZC 4JI0L 3SK5A 3HOWB 1BUVT 2FMCA 4BXXG 2EZVA 4HMJA 5BN5A 1PHJA 3R8BA 2RBMA 3MXUA 5EGTA 1SN8A 2B2WA 2B39A 5I2XA 2YTYA 4B9WA 5IYCH 3A0JA 5A2QL 2B2UA 3S14H 3ZYYX 2K33A 1WCMH 2NBFA 2ALYB 1SYEA 3IKJA 3S16B 2QA4A 1LT5D 3K8AA 4CJ1B 1RJTA 2E76C 3A7LA 3CC7A 4LNQA 5JAVA 1PFSA 4OO1I 5C0XJ 2ZJRA 1V1QA 4C3JH 4JI4Q 2PQAA 3GTGH 4L5TA 4PZ6A 1XWEA 3S9WA 3DMUA 2BA0A 3K6OA 5I6WA 5FLMH 2YU9B 5C3EB 4JI8Q 4DPGA 3KLSA 2VUMG 1GJXA 3Q0AA 2E2HB 1B7YB 4MHEA 4OWXB 1QVFA 5JJKA 2KHIA 1U4MA 2PNRC 4C3IB 2EYPA 3HOZG 2K32A 1JOKA 1RODA 1Y1VH 1PYWD 3E9HA 2MO0A 1YNJC 5BR8Q 4M8AA 1RHPA 2O4XA 5FO7B 4A3CH 2R6GA 4A3BB 2V4DA 3HS0C 2K28A 2JXMB 4CHTB 1A15A 1N36L 4GOPA 4LFAQ 1PTOD 1IKLA 3BG3A 4HIKA 3RLOA 5I9PA 3SVMA 1GUOA 3VR5A 3K7AB 1NAPA 1DONA 2JEAI 3SHLA 5C0XH 3C46A 1GUNA 4DXGA 2F0EA 3H0GH 3KFUA 2SNMA 3W2DA 4KKUA 4I65A 1VCIA 5ELNA 2Z4IA 3A56A 4JBWA 4X66L 2N8NA 4BBSB 3S15H 3WOEA 5CV8A 5JPNC 1Z9FA 5HGTA 3STBD 1I4PA 1NY4A 2QF7A 2WAQB 1JWUD 1KAWA 3BZKA 1FGUA 4A3DB 1NNXA 3HG9A 1K8OA 5IP7H 1TS3A 2AUKA 3T1HL 2K50A 1WTOA 1EWHA 1C0AA 1VQ5A 2D9UA 4GNXB 4J8QA 1HNZQ 1W6JA 3BYYB 3L3OC 2JA6B 1KDCA 4JI3Q 4ME3A 1FL0A 3AFPA 3FVQA 3SK8A 4DU9A 1KDBA 1QUQA 1IBKQ 4OX9L 1ZYRC 1CA5A 1CTMA 3IRBA 2XNAC 3HKZB 2HCIA 3F1ZA 1E22A 1SROA 2OCEA 3VA5A 2EYOA 4R4CA 4JI7L 2RDGA 3DEOA 1ENAA 1XTDA 1WTPA 3EQLC 4UAIA 1JR0D 1OXXK 4NXNL 1EIYB 1S5ED 4PZ8A 4RGOS 1LTRD 4LF5L 1B9NA 3CC2A 1TR5A 2F0SA 2L0CA 1HHVA 3MHBA 4X6AH 3D4RA 3HOVB 1X3FA 3GTQB 2F0HA 2G9DA 1PTOB 3SXHA 4ABNA 3K7UC 3RUZA 4A3FH 1B3AA 4GKJQ 3GV3A 2QILA 1E1TA 2Y0SG 2CW0D 3VYUA 1YHAA 2F0PA 3NUCA 2JA5H 3K5MA 3PMFA 2DJGC 4DNIA 4HJ5A 1PH5A 3R3OA 1GKHA 5ELBA 2F4VQ 2I46A 4RKBA 1CI3M 3R93A 2RHQB 2UU9L 3IAYA 1HTPA 3J80i 4JYAQ 4O0AA 4YWLA 2AUJD 2YTVA 4JOIC 3MFGA 4B3TQ 4K5VA 2WFWA 5IP9H 5KYIA 5BN4A 1Y8OB 2EVBA 1GUTA 4P73A 4HIDA 3I4OA 3QB3A 2VQEL 2DNEA 2K52A 3KF8A 3J81E 1N32Q 1SMYD 3RZOB 4K6LA 4AYBG 2A6HC 2MPMA 5G3LF 1JOOA 1MI2A 4A3KH 4PZ7A 4DK0A 2EY5A 1I4HA 1WTHA 2R7ZG 4NPSA 2VQFQ 4DV2Q 3JAMi 3S1MB 2GVAA 4FDBA 2PZUA 1F2ZA 3OWEB 3C1EA 4KN4C 3M7NA 1CUKA 3H15A 3LGJA 1CSPA 1TIID 1QNKA 1RIPA 2WB1E 4RFBA 4WORA 3D3RA 5M3MH 3DWQA 2DY7A 1Y8NB 2Z9HA 2KCMA 1P16A 2KOLA 5COYA 2L15A 1CHPD 2JA8B 3RZDH 1I4QA 1SJHD 1L1OC 2KQ3A 1ZXTA 1PRTC 3S1RH 4FF2A 2JA7B 2VZAA 1NR2A 4K0KL 3AFQA 2KA7A 1VQCA 2DNCA 4ZQ3A 1QUQB 3K57A 2Z1CA 1I5FA 1AW7A 4DR1L 3HOWH 1I6VC 1EWIA 2HT1A 3J81c 4R4IA 2NVQB 3S17H 4CGYB 4KTAA 3ND8A 1ASZA 1U4RA 1BBWA 3EFXD 2HHHQ 4YHHQ 4DA2A 4JI0Q 4FVMA 5LL6S 1LYLA 1UEBA 2Z8LA 1M1KC 3VYTA 2N49A 4H13C 1SFOB 3S16H 2H1EA 5HURA 2D62A 3FEWX 3KYHC 4CDCC 2KENA 3H09A 2AMCB 3BJUA 1BBUA 1DGSA 3M4QA 2R92B 1EZ8A 3S2HH 1Z6HA 4H44C 1SYCA 1K73C 3OYYA 2UXCQ 4A3LG 1BR9A 3O13A 3TN2A 4YWMA 2L12A 2AWNA 1E0BA 4DK6C 1ICWA 5M3FG 1EY9A 3CP0A 3MVVA 3TZDA 1PXUA 1TVXA 4P72A 5C3EH 2V1CC 2YU9H 2E2HH 5JJZA 1SXTA 4MTKA 1FYCA 4C3IH 4A3JB 3K5OA 4OWWB 3K0YA 1X3PA 4KD4A 5IGCA 1TS2A 3KF8B 4PMCA 3E0EA 2I5MX 4QY7A 4L5QA 1Y1WB 4A3BH 3OTOL 2QW7A 1O7ZA 5F2DA 1UEAB 1SBBB 4R9WA 2A1AA 2O2LD 3L2PA 1LABA 3K7AH 2IWHA 3BYTB 3HRZC 4A3EB 1XX8A 4DV7L 2EXDA 3SR1A 2LSSA 3SGIA 4K6DA 4NW2A 1OXSC 3DWAA 4LJZC 2K5QA 2F0LA 5C4XB 2EYFA 4UPAA 1FNUA 4DR6L 1WVLA 1WD1A 2YV5A 2FFKB 2RSOA 1QZGA 4WJ3M 5DNFA 1UE7A 2ENBA 1B44D 3GTPH 2BDOA 2F03A 3NPPA 2CVRA 1FVIA 2ZJPA 4LK1C 1LM0A 2OTLA 4A3DH 2X6LA 4X66Q 1PH2A 2PMZE 1LV9A 1A3TA 2L4NA 1QG7A 2JA6H 3S2DB 3MXPA 2E5LQ 1UE6A 1PH3A 1EU4A 4ZCKA 1H95A 2UUCL 3R2IA 4A3IB 4IUNA 4MIUA 4DR5L 5CV9A 1B1ZA 5GAGC 4HJ7A 4QCLA 2F0NA 5E4XA 4ZAIA 4B3SL 3PO3H 3UDGA 4DV1L 4IPHA 4OX9Q 3AQQA 1H9SA 2CWAA 4N8FA 2NZ1D 1CZWA 1WTVA 2EYHA 4HSVA 4X3UA 2KJXA 3CCSA 4JI7Q 1SSOA 2Q8IB 2RDFA 3U9OA 1Q1BA 5ISRA 3HOVH 3I4MG 3G6JB 3PV0A 3GTQH 1PTOH 1U0LA 3NTHA 4LFCL 4V0BA 3CRKC 3LWEA 4IQZA 4DAMA 3I4NB 1BXTA 1AP0A 3UDIA 1ZEQX 4MZ9A 3HOUG 2PI2E 2F0WA 1U4LA 4HAEA 1EUJA 5E1FA 2FHTA 5TSSA 1GUSA 2KBNA 2KEEA 1BO0A 1CHQD 1SE3A 3A5ZB 1A6XA 4QIWB 1HPCA 3T1YQ 2RQXA 4CDEC 4IFDJ 3RZOH 2Z6KC 3GD7A 3V2TA 4HR7B 1L0WA 4FXGC 1VQ8A 4RWSC 1M8AA 1NBWA 2UUAL 2NVTB 1VQGA 2VQEQ 2I5LX 4CDFC 4NMZA 1DD2A 1GUWA 2JE6I 1HXYD 2IY5B 5C5LA 2NVYH 2XTIA 1S4ZA 1W3SA 2IHEA 3S1MH 2VUMB 2K6AA 5IIFA 5FO8B 2F0MA 2PNHA 1PH9A 2N88A 5FJ8H 4DV3L 3RNUA 1WYDA 1DXMA 2NUCA 5M5YH 2GA4B 2WKDA 4LF9Q 3CCLA 2RCNA 3QOJA 2JSOA 1CKNA 3EROA 1VQDA 2HCCA 4HJAA 2VXWA 1HNXL 3J7AV 4FP5D 4LFBQ 1E2WA 5DM73 5JVG3 2NN6G 2A74C 1YEZA 1FD7D 2N78A 2JA8H 1QVCA 1F2MA 2K5HA 2JA7H 4A3MG 2F0DA 1Q8IA 4KHZA 4IFDH 4BWGB 1Y69U 1DZ1A 2O5IC 1ESFA 3MXGA 3A74A 3J7AF 3T16A 3ERSX 4CBVA 2NVQH 1KHIA 5JOBA 1A0IA 2M9VA 3OW7A 3X3MA 3FP9A 4K0KQ 1YIJA 2Z4HA 2EJMA 1KQSA 1LTBD 4OHJA 5D3IB 1U5KA 4DR1Q 1T5XD 2F0UA 4K8JA 1SFOH 3ICEA 1SYFA 1T5EA 3EA6A 4DKAC 1L0XB 3PGZA 5DAUA 1PTOF 4KD3A 1IHZA 3GP7A 4JBKA 2R92H 4DNTB 1I50B 3TREA 3V05A 4OL7A 1QCBD 1SNMA 3H91A 1ILQA 4P2CB 4KY6A 1QILA 4BBRB 3PF5A 1WOCA 1X32A 3PUVA 4L5SA 1SNDA 4XTCS 3UDXA 1HRJA 2F1MA 2NN6I 1SE8A 2F0KA 3W3AA 3D4DA 3MTSA 5IY0A 3TP7A 3KF6B 5I6YA 3GTOB 2EY6A 5ELEA 1DM0B 3TZUA 1N9WA 3KBGA 2WP8J 4RGNA 1YJNA 3CCUA 5IYCG 2BCOA 3PQIA 2A68C 1IW7D 1WCMG 2QDLA 2ES2A 1X3EA 1JORA 2KHSA 3M4OB 3Q6SA 1AZPA 1JE5A 1Y1WH 1VQ6A 1VF7A 1B9MA 5K5PA 1D1KA 1A2UA 2A5HA 3VR3A 5DEHA 3D31A 4A4IA 3G7LA 4KI0A 2EJGC 1SMXA 1O7IA 4X65L 1SYGA 4G4KA 2ATWA 2O5JC 1JB7A 4R4TA 4A3EH 3OTOQ 2F3VA 2XIWA 5I2YA 4QL5A 1S5FD 4XT3B 3OHXC 5FLMG 3K81C 3A5UA 1O7YA 2L1BA 5C6AA 1CFMA 4IO9A 3BVZA 1BCPC 4NKLA 1EEID 2WINB 2VB2X 1VQ9A 2K03A 1XPRA 3DEPA 1BNZA 1CKNB 3J80E 4DV7Q 4GLVB 4X64L 3QJYA 4A3CG 3PIOA 3PO2B 3NP8A 2BA1A 2WAQE 1KXLA 2B2TC 1G2SA 2JYOA 2QEJC 4AYBB 5IGDA 4L5RC 4DR6Q 5KEEA 1JMCA 1B3QA 1VDZA 1ET6A 4KV6A 4U673 3I56A 3S2DH 2R7ZB 1TQOA 1A8VA 3R2TA 4A3IH 1VF5C 1II3A 3HEJA 2EY2A 4BS9A 4OIJA 1K3RA 1QB5D 4JOIA 5IODA 1MHWC 3HKZE 3JAME 4MNOA 1PYBA 1WTRA 2UUCQ 1C4QA 3OMGA 2F0OA 2RDHA 4QF4A 5FLXE 1RCVD 3GDEA 4DR5Q 5IT9E 5LMUL 1KLGD 1CKMA 2ZTCA 1AE2A 2IW3A 4AIMA 4OWTB 3X3NA 2ZXPA 1M4VA 4B3SQ 3UE1A 4DV1Q 1SRUA 4X3TA 2NB0A 2A6EC 5GADC 1BQQT 3H3VH 2GVBA 4DUYQ 3J80c 5JVH3 3I4NH 2H5XA 5J3BA 3D6CA 2UUBL 5JEAG 2CHBD 1HNWL 4BXXH 3NHHA 4LFCQ 4GS3A 2VY3A 1CSQA 2EPBA 4OXPA 3MFYA 4XIGS 4YCUA 2IX0A 2J4XA 3KLRA 1STHA 1V1PB 2SNSA 4ZYSA 1IZ6A 3PF4A 3HOYG 1L1OA 1KC8C 5C0XI 1Q81C 1I6HB 3JAMc 2M00A 3F8TA 5C4JB 1EFID 4N8X1 3TEHB 5FLXc 1Q8KA 2NVTH 1TWCH 5IT9c 4XXEA 3PSIA 1GVPA 5CBAE 2VUMH 1HH2P 2BE5C 4XDXA 1SNCA 3FPPA 1R4QB 4PMBA 1TWGB 1E3PA 3NXWA 1TXYA 1ZKOA 5D14A 2UUAQ 4YCWA 5A2QE 4LF7L 1HZAA 4A93G 4YY3L 2DUDA 1RD9D 2I5HA 2EE1A 1EQTA 1TWAB 2G9HD 1PA6A 4DV3Q 1XMOQ 4XYOA 4I7ZC 3HFZB 4B3ML 1VQKA 3PIPA 1E2VA 1XXGA 5GQOA 3GTLB 2E2JB 1K83B 4JI2Q 3AYHB 1HUNA 1H9RA 3E9IA 4ZUIA 1MGSA 2SEBD 1CQFA 2LMCB 2PQAB 4QMGA 5KYLA 2PO4A 4GNXC 4RG1A 3G71A 3OW2A 3TP8A 2JA9A 1TU2B 1J5EL 1I94L 4WJ4A 3I90A 4EQNA 2R93H 1CZGA 2LFNA 4JG2A 2CH4A 1EIHA 2K5VA 4GN4B 1UAPA 2B3GA 1CQVA 1IBLQ 2NZHA 1I50H 1LO5D 3E3XA 3RLFA 1K9MC 2NZOA 3U4ZA 3F2CA 4BBRH 4GOPB 4JI5L 4J1MA 2AWOA 5FOBB 2IX3A 1PTOC 1HR0L 2ICEC 3KJPA 3TS0A 2KCNA 4MTNA 3J7ZC 5C4HA 2XN9C 3GTOH 4ZRZA 3CC4A 3C1FA 2JP1A 4KY7A 2EYMA 1JJGA 1EYDA 1NR4A 1MIUA 3I4LA 3S24A 4WJWA 2E2IB 2B63H 1L1OB 5DM63 3G48A 1PRTB 3M4OH 2TSSA 1AZQA 2XRQD 5C3WA 2RSNA 4R4OA 1TWFB 1B53A 5EPLA 3STBC 3I4MB 3KOJA 4BA2I 1EYAA 4EQ5A 1WTWA 1LT3D 1RTOA 5C44G 3RD4A 3GO5A 1J6QA 2IHFA 3BU2A 3BS1A 2ICIA 3NQIA 3B6YA 4UDUC 4DNRB 4DV6L 1GHJA 1EL0A 1STYA 2RHSB 1K8AC 5FKAC 3HOUB 2HDMA 4JCVE 5I4DA 2KCCA 2RVLA 3MWYW 1IYJB 1JE4A 2DGYA 2K75A 1Q7YC 2ZM6L 4X65Q 4C3IG 1JT8A 4YWKA 4POFA 1VQOA 1WTXA 1IKMA 4GLXA 4A3GG 1Z47A 1Y14B 1PDQA 3PO2H 1BKBA 4DR2L 1XMQL 4N9TA 3UI2A 5EKLA 2FMMA 2MUYA 1NSNS 3H94A 2Z0SA 4X64Q 2CWPA 3K58A 4A75A 1PVOA 2R7ZH 2LXJA 2WIIB 3GTJB 1D2BA 4R4QA 3A55A 3E0JA 4PV1C 3BDOA 2CW0C 4TQUS 2MO1A 4RA8A 4ME5A 4NP5A 2DY8A 1SLJA 1NMFA 4JBMA 1SJED 3IL8A 2K5NA 1PFNA 1LACA 1CM9A 3M3YB 2RA4A 1AE3A 1HTLD 4K8IA 2Z6KA 3PUZA 3DXJC 4JVZA 1ENFA 4X3SA 1ONLA 5KGUA 1HQMC 3SK6A 2IPKD 1RF2D 1EY4A 3L7ZC 5M5WB 4A3MB 2F0QA 1G6ZA 3A8KE 5E7NA 5LMUQ 4K14A 4NXML 2JA6G 1SMYC 2EYLA 1STEA 2B8FA 4EX5A 2VL6A 2EIFA 1QE6A 1YHBA 1D5XC 3EJIA 3I70A 4RH6A 1S5DD 3CXCA 3CW2C 1NE3A 2JN4A 1HA5A 1LLRD 2IJ0A 2K4KA 3HOXG 1L2FA 1MJEA 4EGVA 1STBA 1F2LA 3BVMA 1STNA 4DAYA 4IUTA 3PO3G 1N36Q 2UUBQ 3UE0A 2MHVA 2HIXA 2I07B 4HIOA 4QIWE 2EDGA 4BBSH 4PQXA 5IGFA 1BOSA 4K2LA 3CD6A 1I6HH 3PCOB 4R1JA 1PH7A 1TY2A 1OTCA 1U4PA 5JJLA 4DR7L 5C5MA 1YNND 4A3LH 4RHSA 3CPWA 2ZTEA 1KLUD 1P8LA 3C2PA 3QO2A 4HCSA 4RCOA 3FKIG 3QIAA 2RCFA 1O7LA 1XNRL 1TWHB 3M4YA 3M7GA 1B70B 1TWGH 2QDBA 3K5LA 3P75A 1M90C 4DK1A 1Y8PB 1VQMA 4BA1I 1G51A 2PZWA 3IFDA 3T1HQ 1U9RA 4JBJA 3NQTA 1Q90A 4F7XA 3S14B 3CCQA 1TWAH 2D0PA 4ZUJA 4JI4L 1SE4A 1BF4A 4XQJA 4KKSA 3OIQA 1PFBA 4XT1B 4AQYL 3K80C 4IJLA 4LF7Q 3UDFA 4JI8L 2NTTA 3Q24A 3PIO3 4YY3Q 5IYDG 4KY5A 4F87A 2E2JH 3GTLH 1K83H 3C3LA 2F3WA 4L8JA 5CV6A 1SEBD 2DN8A 4J6HA 1S3OA 1Q3LA 1EQRA 2C9OA 5KNDA 4NXNQ 1BDOA 4O42A 4LF5Q 4QUFA 1IBML 5FO9B 4RGTA 4B3MQ 1OO9B 1EOVA 1N34L 3QG1A 4BY1G 1GD7A 2ZT9C 5CMDA 3TP5A 5GAEC 4KN7C 5CORA 1STGA 3CCVA 2Q2HA 4K5WA 2HQLA 1UNSA 1DYQA 1X65A 1VQEA 2LKVA 3ER0A 1ML0D 4Q5VA 2JA8G 1KDAA 1YJ9A 1W2BA 2UXDL 5IGBA 3FPUB 2UU9Q 2CCZA 2PYKA 4ZLTF 1A63A 4GN5A 5K36G 2XWBB 5E4WC 3LNNA 4C3HG 3H3VC 1KIXA 1Q82C 1B4OA 4FXKC 1AH9A 1KAAA 4CKEA 4DAYB 5ELDA 5EKIA 4ODGA 3RN2A 3T51B 1SNOA 3QR8A 4JI5Q 5IYBG 3MEFA 2YTXA 1TKWB 5C3XA 2WV6D 1HUMA 3P20A 2MJ8A 5LHY1 2E2IH 2B2TA 2A69D 5EJWA 3HOZB 1S5CD 3N52A 1HFNA 1O80A 3TSSA 1TWFH 3DM3A 1PZID 1WD0A 4QUCA 3CHBD 3T4AC 3HZXA 2CQOA 2MQHA 3BZCA 3EN2A 4ULLA 5EPKA 3F2DA 1BCPD 1HZCA 3HOUH 1PMRA 3U4VA 1LTID 4UP8A 2OTJA 2K5DA 1VMCA 1WFQA 4DV6Q 3DHQA 2DJFC 4IUVA 2A8VA 2NYZD 4CJ2C 3CQZB 3ONAB 3HOYB 3I7FA 1F2YA 2AHOB 2VNUD 1H9SB 1PZJD 2WB1G 1SNPA 2ZM6Q 2B2YC 2TMPA 3L9AX 3Q22A 3GQBA 1DOMA 4AYBE 4EQOA 1G91A 4RAUC 2D5DA 3HP3A 3T13A 4V190 3NEMA 3I91A 1BBXC 4IURA 4PNYA 4BY7G 3GTJH 2J7ZA 3PIP3 4DR2Q 1XMQQ 4A3EG 1X55A 4LUOA 1CKOA 1EY8A 3TDQA 1MKHA 2CFMA 3ULJA 1GM5A 2R61A 3K0XA 3KUPA 4QB4A 3FRPB 1N32L 1HCZA 3M3YH 3G6EA 4GLAC 4A93B 1MBYA 4LWCA 1YNJD 3A7AB 2Q2TA 2OQKA 1XYIA 4A3JH 3BDCA 3NTKA 2RKSA 3U50C 5J39A 4DV2L 1ASYA 4A3MH 5EAYA 2HD3A 4HCEA 1G291 1IYVA 2EQSA 3NWTA 4DFAA 3M4PA 5I9OA 1AEXA 4POGA 1BCPB 4U68A 4C3JG 2Y0SB 1S5BD 3J7YW 3VYRA 1CA6A 4LF8L 2VB3X 4N9PA 2WKCA 4NXMQ 2QEXA 4TVAB 4DV0L 2MP1A 4B3RL 5C4XH 3NTIA 2FJ2A 5J1ZA 3BZDB 2KHJA 3VYSA 2ZTDA 1D6EC 3I2ZA 1V9PA 3P7JA 3CF5A 3WDNA 1ET9A 1Y1VG 2PPBC 4OEMB 2Z6BA 1VQFA 5AJ3L 1XNQL 1QJOA 2CQAA 3M85A 4GNXA 1KNEA 2WACA 3AB9A 2Q2IA 1EIGA 1KL9A 1JB3A 3TBIB 3D4WA 4J15A 3E6ZX 4G7OC 1ZYRD 5EQ0A 4QQBX 1TWHH 5J22A 1KTKA 3DWPA 3S17B 1SE2A 4DR7Q 5T1IA 4P74A 1CK1A 1I4RA 4OGQC 3TMEA 5C0XG 4P75A 3OOCA 3H0GG 1EEFD 4LAAA 4OO1H 4Y52H 3D8GA 1K8MA 1KNAA 3J81i 1UWVA 1XNRQ 1NJIC 2UXCL 5CV7A 5FK9C 4G7HC 4DR4L 2VS1A 2NWGA 3GTKB 4JV5L 2FXQA 4LF6L 3M9BA 3AU7A 3SK4A 3OMCA 3S2HB 5C44B 4PMWA 5EPJA 2H4OA 3SE0A 4APVA 5ELCA 4A76A 1J8IA 5IP7G 4AQYQ 1LTLA 1T9HA 2F0FA 5CV4A 5IE8A 2F0JA 3N6RA 2D2CC 4DXFA 3MA2B 5IOCA 3CAMA 1B50A 1X54A 2XVSA 3TS2A 1RL2A 3EBEA 1EFWA 1WJJA 3H6MA 2KVMA 2VW9A 4G57A 4OONA 3SEBA 4DN4M 1CT1D 1IBMQ 2LXKA 2XRSD 1F9RA 1V8QA 3H3VI 1JQYD 1N34Q 1SYDA 4A3GB 1NUCA 1OXVA 4JI6L 1YITA 2F52A 2QKIC 1IW7C 1I4XA 2A6HD 4KLKA 5JEAJ 1YI2A 4DV4L 1K28A 1K0SA 1S40A 3KBXA 2L55A 4ZK9B 3T53B 3FMCA 3J81L 3I55A 1PH4A 1UE1A 1EIFA 2B2VC 3SDZA 4A3FG 4KHPL 1UUPA 1V43A 2UXDQ 1H9KA 2PZTA 1DOLA 1IL2A 2JA5G 5M3FB 3MZ5A 4H0LC 4DR3L 4KK7A 1D5MC 3KLSX 4UY8C 3KLWA 1E7ZA 1JJCB 1I3QB 2R93G 1PV4A 3A54A 4HSPA 2ZXOA 3NENA 2E5LL 1EQQA 3HOZH 3GTPB 4NB3A 2CH4W 3F2UA 2ZXRA 1QWYA 1QVGA 1X56A 5DLQE 1F9PA 4XYQA 1DJRD 2HDLA 3D6WA 5IP9G 1B2TA 1VQPA 1PRTD 1C8CA 3T56B 1VQNA 4FF4A 4MN3A 1MSGA 3EIVA 4RKLA 1WTQA 1D8LA 2P5ZX 4BBRG 4Y7NB 4OIKA 4P71A 3I72A 5M9OA 1ICFB 5JEAH 2SOBA 3LX0A 2HIVA 4KKTA 4A3KG 4NDXA 1HNXQ 3OSOA 5NUCA 1VQ4A 1A2TA 2K04A 3HOXB 2BH2A 2L11A 2C35B 4TRDA 1Q46A 4GZYC 3S1NB 1HJPA 3PO3B 2N3SA 4JC0A 2EOTA 1D1IA 4H02A 2Q8RE 3CQZH 4RCNA 2B63G 3AEVA 3HOYH 1DCZA 2PQEA 4R8NA 5D3DA 2XWJB 2B2WC 4IPCA 4X62L 2A73B 5M3MG 5CYUA 3S1QB 4ILWA 2OQ0A 3Q8DA 2B2UC 3K59A 5ELFA 4PG3A 3WOFA 1XPUA 5BN3A 1EYGA 1NMGA 2B29A 4O2DA 1C48A 1PH1A 3FKIB 4IUPA 5E3FA 4L6TB 1V1OA 2EYJA 4DV5L 3T1YL 5CC4A 3W1GA 5IGEA 5LL6X 1FJGL 3HOWG 4GKKL 4A93H 2J0TD 5C4ZA 2JQOA 3CU7A 4LW1A 3NBHA 3P1HA 5H1SE 1VQJA 2IL8A 2Q8TA 3PO2G 1I4GA 2AQ2B 3KK7A 2MNAA 1LTTD 3CMEA 3NWSA 4JI1L 2Q2UA 1A3UA 2BOSA 1JWSD 3DM1A 1OXUA 2KECA 1VQIA 4CDDC 4LF9L 4IPGA 1HR0W 4DUZL 3QOLA 2NVYB 4EVOA 4C56C 1GUGA 5LMNL 2ID0A 3LWUA 5JJIA 1F9SA 4RGMA 4GOPC 1LTAD 1S72A 4BY1B 4OELB 2QCPX 4LFBL 1X3GA 2BH8A 2EJFC 4HN7A 4XQQA 2KCTA 5M5YB 2OT2A 5CV5A 3AMUA 5C3EG 3CKIB 2PW5A 2C5CA 4YIJA 4IUUA 4ID6A 1NTGA 4FYDA 4LF8Q 4QJFA 3EVQA 3DUZA 1X6OA 1VS0A 1SNQA 1YBYA 3G4SA 1PLFA 5KNCA 1BVSA 1X3QA 3A8IE 4DV0Q 4LF4L 4FNFA 1QZHA 4B3RQ 2I0QA 4K5XA 1LTSD 4A3BG 5LMNW 5GROA 1YVCA 1R9TB 2KEDA 3GV6A 1TT2A 4IOAA 1MJCA 2BDNA 3ERQA 4C3HB 4S3SA 5AJ3Q 3HGBA 1C7YA 4IPDA 1EZ6A 1C9OA 1EYCA 4CKBA 1XPOA 2K05A 1XNQQ 2NVXB 4KHVA 3MXNA 4G7ZC 1PH6A 2JEBI 3RLNA 4IUQA 5M5XB 4M1UB 1AN8A 2KUMA 3CPFA 4C2MB 4FF3A 1HA6A 3MAQA 1FR3A 3CRLC 4BBSG 3GTKH 5IWAL 1IYUA 4IN3A 4O1NA 2UXBL 1Q1EA 1HQRD 5C44H 2WAQG 3QWNA 3NE5B 2LY7A 1KRSA 3W5OA 2F0TA 3ZJYC 4A3DG 4DR4Q 1VQHA 1PH8A 1EY0A 4JV5Q 3BVGA 3OPOA 1KD1C 4LF6Q 1PYSB 3CCRA 3E5SA 4DAVA 1JOQA 2ZJQA 2GN5A 2IX1A 3MC0B 4CJ0B 3VDYA 3GTMB 2EXZA 1GOZA 4AH6A 1DOKA 4R8IA 3K5NA 4DK3C 1Z7TA 1F9QA 3HKZG 4GN3B 1R4PB 3NBHB 4A3GH 4L63B 1WI5A 3OWFA 2WB1B 1QNUA 4FF1A 1PZKD 3KDFA 1HNWQ 4IZ8A 5AFWA 1IXRA 1FGBD 1N33L 1J9OA 4JI6Q 1BCPF 2MGSA 4BY7B 2RF4A 3VR4A 3HOVG 3CCMA 5C4JH 1EU3A 2F0IA 5G3LD 4QGUA 4DV4Q 3NBIA 2D0OA 5M3FH 5KNBA 1Q12A 4DGZA 5CGKA 2F4IA 4KMUC 4KHPQ 1I3QH 1O78A 3TP6A 3J7A5 2F0GA 2B2YA 1GXDC 1H9JA 1QOHA 4LUVA 2AQ3B 3HKSA 4JK1C 2AKWB 3I73A 4DR3Q 3JC66 4TSSA 3I3CA 1WCMB 4I7AA 4DAPA 1RKNA 1K0RA
chains in the Genus database with same CATH topology
1XMQQ 4A3EG 1RIPA 2WB1E 4LFCQ 4GS3A 2VY3A 1CSQA 5HGQA 1JJ2A 1X55A 1A62A 4LUOA 4OXPA 1CKOA 3CCJA 4XIGS 4YCUA 5M3MH 2IX0A 4Y7NH 1MKHA 2CFMA 3ULJA 2KCMA 1GM5A 1P16A 3K0XA 2L15A 1IZ6A 1N32L 2OWOA 3PF4A 3RZDH 3TQYA 1L1OC 4UP9A 3HOYG 3NELA 1L1OA 3HOXH 3S1RH 1KC8C 3G6EA 4GLAC 3M3YH 2VZAA 3MXNB 5C0XI 1Q81C 4LWCA 4K0KL 3S1NH 3AFQA 2Q2TA 3RR5A 1VQAA 3JAMc 2OQKA 5BR8L 3F8TA 1VQCA 2PI2A 4A3JH 1QUQB 4HIMA 3U50C 5FJ8G 3TEHB 1I5FA 5FLXc 4DR1L 3HOWH 4DUYL 1EWIA 1Q8KA 4DV2L 2HT1A 2NVTH 1TWCH 3J81c 4R4IA 5IT9c 2K14A 1ASYA 4A3MH 4ALPA 3S17H 5EAYA 3PSIA 4LFAL 1GVPA 1ASZA 1G291 2VUMH 1BBWA 1HH2P 2HHHQ 2EQSA 4YHHQ 1J5EQ 1SR3A 1E3PA 3M4PA 1Q86C 4RMFA 1I94Q 4JI0Q 3S1QH 1TXYA 1LYLA 1UEBA 4POGA 2UUAQ 4YCWA 1M1KC 2N49A 2JJQA 4LF7L 4LF8L 1HZAA 3S16H 3FHWA 4NXMQ 2D62A 2DUDA 3KYHC 4YY3L 2QEXA 1N8RC 2I5HA 2KENA 2JA7G 3FKIH 4X62Q 2AMCB 3BJUA 1BBUA 3CCEA 1XJVA 4TVAB 4DV0L 4IFDG 1DGSA 3M4QA 1PA6A 2XGTA 4DV3Q 4B3RL 1XMOQ 3S2HH 5C4XH 1LUZA 1K73C 2KHJA 3OYYA 2UXCQ 3HFZB 4A3LG 3KF6A 4B3ML 2ZTDA 1GO3E 3I2ZA 1VQKA 1V9PA 4YWMA 3CF5A 2AWNA 3PUYA 3PIPA 1VQBA 4DK6C 5GQOA 5M3FG 1Y1VG 3CP0A 4JI2Q 3AYHB 4P72A 2YU9H 3E9IA 2V1CC 5C3EH 1VQFA 5ELOA 5AJ3L 4DV5Q 2E2HH 2CKZB 1HR0Q 2QGQA 3KDFB 1XNQL 2PQAB 1FJGQ 4GNXC 4GKKQ 1KRTA 4RG1A 3M85A 3G71A 4GNXA 3OW2A 1HNZL 4C3IH 2Q2IA 2JA9A 1KL9A 2MFIA 2YYZA 5IYDH 4JI3L 1HZBA 1J5EL 4J15A 4OWWB 1G6PA 1I94L 4WJ4A 3ULLA 1IBKL 5HY6A 4QQBX 1TWHH 2JK8A 3I4MH 2R92G 3KF8B 3E0EA 2I5MX 4QY7A 4L5QA 4A3BH 4DR7Q 4P74A 4JG2A 3OTOL 2R93H 5C0XG 4P75A 2K5VA 4GN4B 1OXTA 2Y0SE 3H0GG 4BY1H 1VQLA 4JI1Q 1UE5A 4Y52H 1XMOL 2B3GA 3J81i 1UWVA 2A1AA 1IBLQ 1NJIC 1XNRQ 3DLLA 1K8GA 2UXCL 2NZHA 3ULPA 3L2PA 3K7AH 1I50H 4DUZQ 4DR4L 3RLFA 1K9MC 5LMNQ 2VS1A 2NZOA 4JV5L 4DV7L 2EXDA 4JI2L 2FXQA 4LF6L 3M9BA 3U4ZA 2LSSA 3SGIA 3F2CA 4BBRH 3CMAA 4JI5L 4GOPB 1OXSC 3F2BA 2AWOA 4A3JG 2E8GA 1HR0L 4PMWA 4IFDI 3KJPA 4APVA 4UPAA 4HJ8A 4GKJL 3TS0A 1E1OA 4DR6L 4A76A 5IP7G 4AQYQ 1LTLA 1T9HA 4MTNA 2YV5A 3J7ZC 5IE8A 1Y1WG 3U58A 1R9TH 1QZGA 3GTOH 3CC4A 4WJ3M 1UE7A 3CAMA 1YJWA 3GTPH 2F4VL 2F3IA 1JJGA 1X54A 1FVIA 2ZJPA 1MIUA 3S24A 4C3HH 4LF4Q 1LM0A 2OTLA 1RL2A 3D0FA 3EBEA 3TS2A 1EFWA 1WJJA 2B63H 1L1OB 4X66Q 2VW9A 4A3DH 4JYAL 1PH2A 3G48A 4OONA 3M4OH 2PMZE 2IT1A 1IBMQ 2LXKA 4R4OA 2NVXH 3H3VI 2JA6H 2E5LQ 1N34Q 1UE6A 5IYBH 4B3TL 3STBC 1PH3A 1IBLL 1H95A 1OXVA 4UP7A 3KOJA 5M5XH 1YNXA 2UUCL 4JI6L 4IOCA 3KJOA 4EQ5A 4BA2I 1YITA 2F52A 4C2MH 5C4XG 5C44G 3GO5A 1J6QA 2IHFA 3BU2A 3PUWA 4DR5L 4IJHA 4KLKA 5JEAJ 3B6YA 4DV6L 1YI2A 4DV4L 1D7QA 4HJ7A 2R7DA 2A19A 2RHSB 1K8AC 4B3SL 1S40A 3PO3H 3UDGA 4JCVE 3I55A 4DV1L 1PH4A 1IYJB 2DGYA 1UE1A 2K75A 1EIFA 3AQQA 4IPHA 2CWAA 4OX9Q 4A3FG 1Q7YC 4KHPL 2VQFL 2ZM6L 2UXDQ 1V43A 4X65Q 5GAHC 3J81j 1IL2A 4A93G 1JT8A 2JA5G 1B8AA 5M5WH 3WWVA 3CCSA 4YWKA 5IWAQ 4POFA 4JI7Q 1VQOA 4DR3L 1X9NA 1Q1BA 4GLXA 4UY8C 3HOVH 3I4MG 3KLWA 1E7ZA 1Z47A 1Y14B 3PV0A 3GTQH 2UXBQ 1JJCB 3PO2H 1U0LA 4A3IG 1BKBA 4DR2L 1XMQL 2R93G 1PV4A 4LFCL 3GTMH 3W1BA 3PUXA 3NENA 2E5LL 1HZ9A 1EQQA 4DAMA 2ASBA 3HOZH 4NB3A 4YCVA 4OO1G 2Z0SA 4X64Q 2CWPA 4A75A 1QVGA 1X56A 5DLQE 3UDIA 1E24A 1PVOA 2R7ZH 2LXJA 5IP9G 4MZ9A 3HOUG 2PI2E 3RN5A 1VQPA 1VQNA 4R4QA 1VQ7A 4HJ9A 1YHQA 3TRZA 1EUJA 3EIVA 4TQUS 1D8LA 2MO1A 2R7FA 4BBRG 4P71A 2KBNA 1SLJA 3L0OA 4A3GG 1NMFA 2HIVA 4JBMA 4A3KG 3A5ZB 1HNXQ 4BY7H 2K5NA 1VQ4A 3T1YQ 2BH2A 4IFDJ 2C35B 1Q46A 1AE3A 3RZOH 1HJPA 2Z6KC 1N33Q 2N3SA 1YZ6A 2Z6KA 3GD7A 4JC0A 3I4NG 3PUZA 1L0WA 2HHHL 4YHHL 4LUZA 1VQ8A 4H02A 4JI0L 1NBWA 3CQZH 2B63G 3AEVA 3HOYH 2UUAL 1VQGA 4BXXG 2VQEQ 2I5LX 3L7ZC 1PHJA 2JE6I 5LMUQ 5E7NA 2IY5B 4NXML 2NVYH 2XTIA 2JA6G 1W3SA 2IHEA 3S1MH 4IPCA 1SN8A 2VL6A 2EIFA 4EX5A 4X62L 5M3MG 2YTYA 1YHBA 2PNHA 3A0JA 5IYCH 1PH9A 2OQ0A 3Q8DA 4DV3L 5FJ8H 3RNUA 1WYDA 4PG3A 3S14H 5M5YH 1XPUA 1WCMH 2ALYB 3CXCA 1EYGA 3CW2C 1NE3A 1NMGA 3CCLA 4LF9Q 2QA4A 2K4KA 3HOXG 1L2FA 2B29A 3K8AA 2RCNA 1MJEA 4O2DA 3CC7A 1CKNA 1PH1A 4LNQA 1VQDA 4HJAA 3PO3G 1HNXL 1PFSA 1N36Q 4OO1I 4LFBQ 5C0XJ 2UUBQ 3UE0A 4DV5L 3T1YL 2NN6G 3W1GA 2ZJRA 1V1QA 1YEZA 2N78A 4C3JH 4JI4Q 2HIXA 2PQAA 2JA8H 1FJGL 3HOWG 3GTGH 4HIOA 4GKKL 1QVCA 4QIWE 4DR2Q 2K5HA 4A93H 4BBSH 4L5TA 2JA7H 4A3MG 4PZ6A 4KHZA 2BA0A 3CD6A 2JQOA 5FLMH 4JI8Q 4LW1A 3PCOB 4R1JA 4DPGA 1PH7A 2VUMG 1I6HH 1OTCA 5H1SE 1B7YB 1VQJA 3PO2G 5JJLA 4OWXB 1QVFA 3A74A 2MNAA 2KHIA 4DR7L 5JJKA 4A3LH 3ERSX 3HOZG 3CPWA 2NVQH 1KHIA 1A0IA 2ZTEA 1Y1VH 3CMEA 1P8LA 3FP9A 4K0KQ 1YIJA 4JI1L 3E9HA 2MO0A 3FKIG 5BR8Q 1KQSA 2Q2UA 1XNRL 4A3CH 1B70B 1OXUA 1U5KA 1TWGH 1VQIA 2R6GA 4IPGA 4LF9L 1HR0W 4DUZL 1M90C 4DR1Q 5LMNL 1VQMA 4BA1I 1G51A 2ID0A 5JJIA 3T1HQ 1SFOH 4JBJA 4GOPC 1S72A 3ICEA 1N36L 4GOPA 4DKAC 4LFAQ 4LFBL 3PGZA 1X3GA 2BH8A 2KCTA 3RLOA 3CCQA 4HIKA 1TWAH 2D0PA 5C3EG 4JI4L 4JBKA 2R92H 3TREA 4AQYL 2JEAI 1NTGA 3K80C 4IJLA 4LF7Q 4LF8Q 4QJFA 3H0GH 3UDFA 4JI8L 3KFUA 1X6OA 1VS0A 4YY3Q 1WOCA 5IYDG 1YBYA 3G4SA 3PF5A 2E2JH 3GTLH 1BVSA 1K83H 4DV0Q 3PUVA 4LF4L 4L5SA 1S3OA 1QZHA 1VCIA 4XTCS 3UDXA 2I0QA 5ELNA 4B3RQ 4JBWA 4X66L 4NXNQ 1EQRA 2N8NA 3S15H 2NN6I 1SE8A 4LF5Q 4A3BG 5IY0A 1IBML 5LMNW 3KF6B 1YVCA 5GROA 1Z9FA 4B3MQ 3STBD 1EOVA 1N9WA 1N34L 2WP8J 1YJNA 4IOAA 1MJCA 1GD7A 1NY4A 4BY1G 5IYCG 3CCUA 1KAWA 3BZKA 1FGUA 5AJ3Q 1C7YA 4IPDA 1WCMG 2ES2A 1C9OA 1XPOA 1X3EA 5IP7H 5GAEC 3T1HL 2K50A 1XNQQ 1JE5A 3CCVA 1Y1WH 2Q2HA 1C0AA 1VQ6A 1VQ5A 4GNXB 2HQLA 1HNZQ 1PH6A 1X65A 2JEBI 3D31A 3RLNA 4A4IA 4JI3Q 4ME3A 4KI0A 1FL0A 1SMXA 3CPFA 3AFPA 1VQEA 1IBKQ 4OX9L 1QUQA 3ER0A 1O7IA 2JA8G 1W2BA 1YJ9A 4X65L 2ATWA 3IRBA 2UXDL 1JB7A 4R4TA 4A3EH 3OTOQ 4BBSG 3F1ZA 1E22A 4QL5A 1SROA 2OCEA 2CCZA 2UU9Q 3GTKH 4R4CA 5IWAL 4JI7L 5FLMG 3K81C 1XTDA 3A5UA 1A63A 4GN5A 1Q1EA 1OXXK 2UXBL 5K36G 4NXNL 5C44H 2WAQG 4PZ8A 1EIYB 4IO9A 4LF5L 1KRSA 1KIXA 3W5OA 3ZJYC 1Q82C 4A3DG 4DR4Q 1VQHA 1VQ9A 1PH8A 1XPRA 3CC2A 1AH9A 1CKNB 4DAYB 4JV5Q 4DV7Q 4X6AH 4LF6Q 4GLVB 1KD1C 3RN2A 4X64L 4JI5Q 5IYBG 1X3FA 1PYSB 3MEFA 3CCRA 2YTXA 4A3CG 3PIOA 2ZJQA 3K7UC 2GN5A 4A3FH 2IX1A 2BA1A 2WAQE 3VDYA 4GKJQ 1KXLA 2E2IH 1E1TA 4L5RC 2Y0SG 4DR6Q 4AH6A 1JMCA 1YHAA 2JA5H 4DK3C 3HKZG 4GN3B 1PH5A 4DNIA 4HJ5A 3I56A 3S2DH 1TWFH 3DM3A 3NBHB 1GKHA 4A3GH 2F4VQ 1WI5A 1A8VA 4A3IH 2RHQB 2UU9L 3KDFA 3J80i 4JYAQ 1HNWQ 4O0AA 4YWLA 1IXRA 1K3RA 2YTVA 4JOIC 1N33L 2CQOA 2MQHA 3BZCA 4JOIA 3EN2A 3HKZE 4B3TQ 4MNOA 1PYBA 3F2DA 1HZCA 2WFWA 5IP9H 2UUCQ 4JI6Q 3HOUH 3U4VA 2RF4A 3HOVG 3CCMA 4P73A 4UP8A 5C4JH 4HIDA 2OTJA 3I4OA 3GDEA 2VQEL 4DR5Q 2K52A 1N32Q 5LMUL 1WFQA 4QGUA 4DV6Q 4AYBG 4DV4Q 1CKMA 2ZTCA 1AE2A 2D0OA 4AIMA 5M3FH 4OWTB 2A8VA 4A3KH 3UE1A 4B3SQ 4PZ7A 1Q12A 4DV1Q 1SRUA 2R7ZG 4BY7G 2VNUD 3I7FA 2AHOB 4NPSA 5GADC 2WB1G 1I3QH 2VQFQ 2ZM6Q 4KHPQ 3J7A5 3H3VH 2GVBA 4DUYQ 4LUVA 4DV2Q 3JAMi 3J80c 3HKSA 2GVAA 4FDBA 3I4NH 2H5XA 4AYBE 2AKWB 5J3BA 4DR3Q 2UUBL 5JEAG 3JC66 3NEMA 3M7NA 1CUKA 3H15A 1HNWL 5GAGC 1K0RA 4BXXH 3LGJA 3GTJH 1CSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMQ Q;  4A3E G;  1RIP A;  2WB1 E;  4LFC Q;  4GS3 A;  2VY3 A;  1CSQ A;  5HGQ A;  1JJ2 A;  1X55 A;  1A62 A;  4LUO A;  4OXP A;  1CKO A;  3CCJ A;  4XIG S;  4YCU A;  5M3M H;  2IX0 A;  4Y7N H;  1MKH A;  2CFM A;  3ULJ A;  2KCM A;  1GM5 A;  1P16 A;  3K0X A;  2L15 A;  1IZ6 A;  1N32 L;  2OWO A;  3PF4 A;  3RZD H;  3TQY A;  1L1O C;  4UP9 A;  3HOY G;  3NEL A;  1L1O A;  3HOX H;  3S1R H;  1KC8 C;  3G6E A;  4GLA C;  3M3Y H;  2VZA A;  3MXN B;  5C0X I;  1Q81 C;  4LWC A;  4K0K L;  3S1N H;  3AFQ A;  2Q2T A;  3RR5 A;  1VQA A;  3JAM c;  2OQK A;  5BR8 L;  3F8T A;  1VQC A;  2PI2 A;  4A3J H;  1QUQ B;  4HIM A;  3U50 C;  5FJ8 G;  3TEH B;  1I5F A;  5FLX c;  4DR1 L;  3HOW H;  4DUY L;  1EWI A;  1Q8K A;  4DV2 L;  2HT1 A;  2NVT H;  1TWC H;  3J81 c;  4R4I A;  5IT9 c;  2K14 A;  1ASY A;  4A3M H;  4ALP A;  3S17 H;  5EAY A;  3PSI A;  4LFA L;  1GVP A;  1ASZ A;  1G29 1;  2VUM H;  1BBW A;  1HH2 P;  2HHH Q;  2EQS A;  4YHH Q;  1J5E Q;  1SR3 A;  1E3P A;  3M4P A;  1Q86 C;  4RMF A;  1I94 Q;  4JI0 Q;  3S1Q H;  1TXY A;  1LYL A;  1UEB A;  4POG A;  2UUA Q;  4YCW A;  1M1K C;  2N49 A;  2JJQ A;  4LF7 L;  4LF8 L;  1HZA A;  3S16 H;  3FHW A;  4NXM Q;  2D62 A;  2DUD A;  3KYH C;  4YY3 L;  2QEX A;  1N8R C;  2I5H A;  2KEN A;  2JA7 G;  3FKI H;  4X62 Q;  2AMC B;  3BJU A;  1BBU A;  3CCE A;  1XJV A;  4TVA B;  4DV0 L;  4IFD G;  1DGS A;  3M4Q A;  1PA6 A;  2XGT A;  4DV3 Q;  4B3R L;  1XMO Q;  3S2H H;  5C4X H;  1LUZ A;  1K73 C;  2KHJ A;  3OYY A;  2UXC Q;  3HFZ B;  4A3L G;  3KF6 A;  4B3M L;  2ZTD A;  1GO3 E;  3I2Z A;  1VQK A;  1V9P A;  4YWM A;  3CF5 A;  2AWN A;  3PUY A;  3PIP A;  1VQB A;  4DK6 C;  5GQO A;  5M3F G;  1Y1V G;  3CP0 A;  4JI2 Q;  3AYH B;  4P72 A;  2YU9 H;  3E9I A;  2V1C C;  5C3E H;  1VQF A;  5ELO A;  5AJ3 L;  4DV5 Q;  2E2H H;  2CKZ B;  1HR0 Q;  2QGQ A;  3KDF B;  1XNQ L;  2PQA B;  1FJG Q;  4GNX C;  4GKK Q;  1KRT A;  4RG1 A;  3M85 A;  3G71 A;  4GNX A;  3OW2 A;  1HNZ L;  4C3I H;  2Q2I A;  2JA9 A;  1KL9 A;  2MFI A;  2YYZ A;  5IYD H;  4JI3 L;  1HZB A;  1J5E L;  4J15 A;  4OWW B;  1G6P A;  1I94 L;  4WJ4 A;  3ULL A;  1IBK L;  5HY6 A;  4QQB X;  1TWH H;  2JK8 A;  3I4M H;  2R92 G;  3KF8 B;  3E0E A;  2I5M X;  4QY7 A;  4L5Q A;  4A3B H;  4DR7 Q;  4P74 A;  4JG2 A;  3OTO L;  2R93 H;  5C0X G;  4P75 A;  2K5V A;  4GN4 B;  1OXT A;  2Y0S E;  3H0G G;  4BY1 H;  1VQL A;  4JI1 Q;  1UE5 A;  4Y52 H;  1XMO L;  2B3G A;  3J81 i;  1UWV A;  2A1A A;  1IBL Q;  1NJI C;  1XNR Q;  3DLL A;  1K8G A;  2UXC L;  2NZH A;  3ULP A;  3L2P A;  3K7A H;  1I50 H;  4DUZ Q;  4DR4 L;  3RLF A;  1K9M C;  5LMN Q;  2VS1 A;  2NZO A;  4JV5 L;  4DV7 L;  2EXD A;  4JI2 L;  2FXQ A;  4LF6 L;  3M9B A;  3U4Z A;  2LSS A;  3SGI A;  3F2C A;  4BBR H;  3CMA A;  4JI5 L;  4GOP B;  1OXS C;  3F2B A;  2AWO A;  4A3J G;  2E8G A;  1HR0 L;  4PMW A;  4IFD I;  3KJP A;  4APV A;  4UPA A;  4HJ8 A;  4GKJ L;  3TS0 A;  1E1O A;  4DR6 L;  4A76 A;  5IP7 G;  4AQY Q;  1LTL A;  1T9H A;  4MTN A;  2YV5 A;  3J7Z C;  5IE8 A;  1Y1W G;  3U58 A;  1R9T H;  1QZG A;  3GTO H;  3CC4 A;  4WJ3 M;  1UE7 A;  3CAM A;  1YJW A;  3GTP H;  2F4V L;  2F3I A;  1JJG A;  1X54 A;  1FVI A;  2ZJP A;  1MIU A;  3S24 A;  4C3H H;  4LF4 Q;  1LM0 A;  2OTL A;  1RL2 A;  3D0F A;  3EBE A;  3TS2 A;  1EFW A;  1WJJ A;  2B63 H;  1L1O B;  4X66 Q;  2VW9 A;  4A3D H;  4JYA L;  1PH2 A;  3G48 A;  4OON A;  3M4O H;  2PMZ E;  2IT1 A;  1IBM Q;  2LXK A;  4R4O A;  2NVX H;  3H3V I;  2JA6 H;  2E5L Q;  1N34 Q;  1UE6 A;  5IYB H;  4B3T L;  3STB C;  1PH3 A;  1IBL L;  1H95 A;  1OXV A;  4UP7 A;  3KOJ A;  5M5X H;  1YNX A;  2UUC L;  4JI6 L;  4IOC A;  3KJO A;  4EQ5 A;  4BA2 I;  1YIT A;  2F52 A;  4C2M H;  5C4X G;  5C44 G;  3GO5 A;  1J6Q A;  2IHF A;  3BU2 A;  3PUW A;  4DR5 L;  4IJH A;  4KLK A;  5JEA J;  3B6Y A;  4DV6 L;  1YI2 A;  4DV4 L;  1D7Q A;  4HJ7 A;  2R7D A;  2A19 A;  2RHS B;  1K8A C;  4B3S L;  1S40 A;  3PO3 H;  3UDG A;  4JCV E;  3I55 A;  4DV1 L;  1PH4 A;  1IYJ B;  2DGY A;  1UE1 A;  2K75 A;  1EIF A;  3AQQ A;  4IPH A;  2CWA A;  4OX9 Q;  4A3F G;  1Q7Y C;  4KHP L;  2VQF L;  2ZM6 L;  2UXD Q;  1V43 A;  4X65 Q;  5GAH C;  3J81 j;  1IL2 A;  4A93 G;  1JT8 A;  2JA5 G;  1B8A A;  5M5W H;  3WWV A;  3CCS A;  4YWK A;  5IWA Q;  4POF A;  4JI7 Q;  1VQO A;  4DR3 L;  1X9N A;  1Q1B A;  4GLX A;  4UY8 C;  3HOV H;  3I4M G;  3KLW A;  1E7Z A;  1Z47 A;  1Y14 B;  3PV0 A;  3GTQ H;  2UXB Q;  1JJC B;  3PO2 H;  1U0L A;  4A3I G;  1BKB A;  4DR2 L;  1XMQ L;  2R93 G;  1PV4 A;  4LFC L;  3GTM H;  3W1B A;  3PUX A;  3NEN A;  2E5L L;  1HZ9 A;  1EQQ A;  4DAM A;  2ASB A;  3HOZ H;  4NB3 A;  4YCV A;  4OO1 G;  2Z0S A;  4X64 Q;  2CWP A;  4A75 A;  1QVG A;  1X56 A;  5DLQ E;  3UDI A;  1E24 A;  1PVO A;  2R7Z H;  2LXJ A;  5IP9 G;  4MZ9 A;  3HOU G;  2PI2 E;  3RN5 A;  1VQP A;  1VQN A;  4R4Q A;  1VQ7 A;  4HJ9 A;  1YHQ A;  3TRZ A;  1EUJ A;  3EIV A;  4TQU S;  1D8L A;  2MO1 A;  2R7F A;  4BBR G;  4P71 A;  2KBN A;  1SLJ A;  3L0O A;  4A3G G;  1NMF A;  2HIV A;  4JBM A;  4A3K G;  3A5Z B;  1HNX Q;  4BY7 H;  2K5N A;  1VQ4 A;  3T1Y Q;  2BH2 A;  4IFD J;  2C35 B;  1Q46 A;  1AE3 A;  3RZO H;  1HJP A;  2Z6K C;  1N33 Q;  2N3S A;  1YZ6 A;  2Z6K A;  3GD7 A;  4JC0 A;  3I4N G;  3PUZ A;  1L0W A;  2HHH L;  4YHH L;  4LUZ A;  1VQ8 A;  4H02 A;  4JI0 L;  1NBW A;  3CQZ H;  2B63 G;  3AEV A;  3HOY H;  2UUA L;  1VQG A;  4BXX G;  2VQE Q;  2I5L X;  3L7Z C;  1PHJ A;  2JE6 I;  5LMU Q;  5E7N A;  2IY5 B;  4NXM L;  2NVY H;  2XTI A;  2JA6 G;  1W3S A;  2IHE A;  3S1M H;  4IPC A;  1SN8 A;  2VL6 A;  2EIF A;  4EX5 A;  4X62 L;  5M3M G;  2YTY A;  1YHB A;  2PNH A;  3A0J A;  5IYC H;  1PH9 A;  2OQ0 A;  3Q8D A;  4DV3 L;  5FJ8 H;  3RNU A;  1WYD A;  4PG3 A;  3S14 H;  5M5Y H;  1XPU A;  1WCM H;  2ALY B;  3CXC A;  1EYG A;  3CW2 C;  1NE3 A;  1NMG A;  3CCL A;  4LF9 Q;  2QA4 A;  2K4K A;  3HOX G;  1L2F A;  2B29 A;  3K8A A;  2RCN A;  1MJE A;  4O2D A;  3CC7 A;  1CKN A;  1PH1 A;  4LNQ A;  1VQD A;  4HJA A;  3PO3 G;  1HNX L;  1PFS A;  1N36 Q;  4OO1 I;  4LFB Q;  5C0X J;  2UUB Q;  3UE0 A;  4DV5 L;  3T1Y L;  2NN6 G;  3W1G A;  2ZJR A;  1V1Q A;  1YEZ A;  2N78 A;  4C3J H;  4JI4 Q;  2HIX A;  2PQA A;  2JA8 H;  1FJG L;  3HOW G;  3GTG H;  4HIO A;  4GKK L;  1QVC A;  4QIW E;  4DR2 Q;  2K5H A;  4A93 H;  4BBS H;  4L5T A;  2JA7 H;  4A3M G;  4PZ6 A;  4KHZ A;  2BA0 A;  3CD6 A;  2JQO A;  5FLM H;  4JI8 Q;  4LW1 A;  3PCO B;  4R1J A;  4DPG A;  1PH7 A;  2VUM G;  1I6H H;  1OTC A;  5H1S E;  1B7Y B;  1VQJ A;  3PO2 G;  5JJL A;  4OWX B;  1QVF A;  3A74 A;  2MNA A;  2KHI A;  4DR7 L;  5JJK A;  4A3L H;  3ERS X;  3HOZ G;  3CPW A;  2NVQ H;  1KHI A;  1A0I A;  2ZTE A;  1Y1V H;  3CME A;  1P8L A;  3FP9 A;  4K0K Q;  1YIJ A;  4JI1 L;  3E9H A;  2MO0 A;  3FKI G;  5BR8 Q;  1KQS A;  2Q2U A;  1XNR L;  4A3C H;  1B70 B;  1OXU A;  1U5K A;  1TWG H;  1VQI A;  2R6G A;  4IPG A;  4LF9 L;  1HR0 W;  4DUZ L;  1M90 C;  4DR1 Q;  5LMN L;  1VQM A;  4BA1 I;  1G51 A;  2ID0 A;  5JJI A;  3T1H Q;  1SFO H;  4JBJ A;  4GOP C;  1S72 A;  3ICE A;  1N36 L;  4GOP A;  4DKA C;  4LFA Q;  4LFB L;  3PGZ A;  1X3G A;  2BH8 A;  2KCT A;  3RLO A;  3CCQ A;  4HIK A;  1TWA H;  2D0P A;  5C3E G;  4JI4 L;  4JBK A;  2R92 H;  3TRE A;  4AQY L;  2JEA I;  1NTG A;  3K80 C;  4IJL A;  4LF7 Q;  4LF8 Q;  4QJF A;  3H0G H;  3UDF A;  4JI8 L;  3KFU A;  1X6O A;  1VS0 A;  4YY3 Q;  1WOC A;  5IYD G;  1YBY A;  3G4S A;  3PF5 A;  2E2J H;  3GTL H;  1BVS A;  1K83 H;  4DV0 Q;  3PUV A;  4LF4 L;  4L5S A;  1S3O A;  1QZH A;  1VCI A;  4XTC S;  3UDX A;  2I0Q A;  5ELN A;  4B3R Q;  4JBW A;  4X66 L;  4NXN Q;  1EQR A;  2N8N A;  3S15 H;  2NN6 I;  1SE8 A;  4LF5 Q;  4A3B G;  5IY0 A;  1IBM L;  5LMN W;  3KF6 B;  1YVC A;  5GRO A;  1Z9F A;  4B3M Q;  3STB D;  1EOV A;  1N9W A;  1N34 L;  2WP8 J;  1YJN A;  4IOA A;  1MJC A;  1GD7 A;  1NY4 A;  4BY1 G;  5IYC G;  3CCU A;  1KAW A;  3BZK A;  1FGU A;  5AJ3 Q;  1C7Y A;  4IPD A;  1WCM G;  2ES2 A;  1C9O A;  1XPO A;  1X3E A;  5IP7 H;  5GAE C;  3T1H L;  2K50 A;  1XNQ Q;  1JE5 A;  3CCV A;  1Y1W H;  2Q2H A;  1C0A A;  1VQ6 A;  1VQ5 A;  4GNX B;  2HQL A;  1HNZ Q;  1PH6 A;  1X65 A;  2JEB I;  3D31 A;  3RLN A;  4A4I A;  4JI3 Q;  4ME3 A;  4KI0 A;  1FL0 A;  1SMX A;  3CPF A;  3AFP A;  1VQE A;  1IBK Q;  4OX9 L;  1QUQ A;  3ER0 A;  1O7I A;  2JA8 G;  1W2B A;  1YJ9 A;  4X65 L;  2ATW A;  3IRB A;  2UXD L;  1JB7 A;  4R4T A;  4A3E H;  3OTO Q;  4BBS G;  3F1Z A;  1E22 A;  4QL5 A;  1SRO A;  2OCE A;  2CCZ A;  2UU9 Q;  3GTK H;  4R4C A;  5IWA L;  4JI7 L;  5FLM G;  3K81 C;  1XTD A;  3A5U A;  1A63 A;  4GN5 A;  1Q1E A;  1OXX K;  2UXB L;  5K36 G;  4NXN L;  5C44 H;  2WAQ G;  4PZ8 A;  1EIY B;  4IO9 A;  4LF5 L;  1KRS A;  1KIX A;  3W5O A;  3ZJY C;  1Q82 C;  4A3D G;  4DR4 Q;  1VQH A;  1VQ9 A;  1PH8 A;  1XPR A;  3CC2 A;  1AH9 A;  1CKN B;  4DAY B;  4JV5 Q;  4DV7 Q;  4X6A H;  4LF6 Q;  4GLV B;  1KD1 C;  3RN2 A;  4X64 L;  4JI5 Q;  5IYB G;  1X3F A;  1PYS B;  3MEF A;  3CCR A;  2YTX A;  4A3C G;  3PIO A;  2ZJQ A;  3K7U C;  2GN5 A;  4A3F H;  2IX1 A;  2BA1 A;  2WAQ E;  3VDY A;  4GKJ Q;  1KXL A;  2E2I H;  1E1T A;  4L5R C;  2Y0S G;  4DR6 Q;  4AH6 A;  1JMC A;  1YHA A;  2JA5 H;  4DK3 C;  3HKZ G;  4GN3 B;  1PH5 A;  4DNI A;  4HJ5 A;  3I56 A;  3S2D H;  1TWF H;  3DM3 A;  3NBH B;  1GKH A;  4A3G H;  2F4V Q;  1WI5 A;  1A8V A;  4A3I H;  2RHQ B;  2UU9 L;  3KDF A;  3J80 i;  4JYA Q;  1HNW Q;  4O0A A;  4YWL A;  1IXR A;  1K3R A;  2YTV A;  4JOI C;  1N33 L;  2CQO A;  2MQH A;  3BZC A;  4JOI A;  3EN2 A;  3HKZ E;  4B3T Q;  4MNO A;  1PYB A;  3F2D A;  1HZC A;  2WFW A;  5IP9 H;  2UUC Q;  4JI6 Q;  3HOU H;  3U4V A;  2RF4 A;  3HOV G;  3CCM A;  4P73 A;  4UP8 A;  5C4J H;  4HID A;  2OTJ A;  3I4O A;  3GDE A;  2VQE L;  4DR5 Q;  2K52 A;  1N32 Q;  5LMU L;  1WFQ A;  4QGU A;  4DV6 Q;  4AYB G;  4DV4 Q;  1CKM A;  2ZTC A;  1AE2 A;  2D0O A;  4AIM A;  5M3F H;  4OWT B;  2A8V A;  4A3K H;  3UE1 A;  4B3S Q;  4PZ7 A;  1Q12 A;  4DV1 Q;  1SRU A;  2R7Z G;  4BY7 G;  2VNU D;  3I7F A;  2AHO B;  4NPS A;  5GAD C;  2WB1 G;  1I3Q H;  2VQF Q;  2ZM6 Q;  4KHP Q;  3J7A 5;  3H3V H;  2GVB A;  4DUY Q;  4LUV A;  4DV2 Q;  3JAM i;  3J80 c;  3HKS A;  2GVA A;  4FDB A;  3I4N H;  2H5X A;  4AYB E;  2AKW B;  5J3B A;  4DR3 Q;  2UUB L;  5JEA G;  3JC6 6;  3NEM A;  3M7N A;  1CUK A;  3H15 A;  1HNW L;  5GAG C;  1K0R A;  4BXX H;  3LGJ A;  3GTJ H;  1CSP A; 
#chains in the Genus database with same CATH topology
 5HGQ A;  1JJ2 A;  1W6K A;  2L5T A;  1A62 A;  3CCJ A;  1NCV A;  4Y7N H;  4C3J B;  2E75 C;  2SDF A;  2OWO A;  3TQY A;  3GTG B;  5IGG A;  4UP9 A;  1JWM D;  3NEL A;  2OF1 A;  3HOX H;  3V96 A;  4C1N I;  2K01 A;  3MXN B;  1KAB A;  1E2Z A;  3S1N H;  3RR5 A;  5EKK A;  1JC7 A;  1IL8 A;  1VQA A;  5T1G A;  5BR8 L;  2PI2 A;  4HIM A;  5FJ8 G;  3ND9 A;  4EQP A;  4DUY L;  2K14 A;  4ALP A;  1Y1V B;  2PW7 A;  5KRU A;  4LFA L;  1ILP A;  2X6G A;  4KJN A;  1J5E Q;  1SR3 A;  3S1Q H;  1Q86 C;  4RMF A;  1I94 Q;  3ITP A;  1EOT A;  2E2D C;  2JJQ A;  4HMI A;  3BDL A;  3FHW A;  2JA7 G;  1H9M A;  1N8R C;  3FKI H;  4X62 Q;  3CCE A;  1XJV A;  4IFD G;  3OIP A;  2XGT A;  4F8M A;  1LT6 D;  1LUZ A;  4C1N K;  3RMH A;  4KJO A;  3KF6 A;  3H0G B;  1GO3 E;  4DF7 A;  3PUY A;  1VQB A;  2A68 D;  1GHK A;  1G2T A;  4HED A;  5ELO A;  1EWC A;  4DV5 Q;  2CKZ B;  1HR0 Q;  1K3B C;  1TS5 A;  1EY6 A;  2QGQ A;  3KDF B;  3S15 B;  1G8Z D;  1FJG Q;  4GKK Q;  1KRT A;  4WRD A;  3NSW A;  1HNZ L;  3I8Z A;  2YYZ A;  5IYD H;  2MFI A;  4JI3 L;  1HZB A;  1G6P A;  4FO2 A;  4HTH A;  5EBC A;  3ULL A;  3VR2 A;  3NK9 A;  1IBK L;  5HY6 A;  2PMZ B;  2JK8 A;  2M2L A;  1TWC B;  5CR3 A;  5D65 A;  3I4M H;  1FNV A;  1SDF A;  2R92 G;  1EQV A;  5EBD A;  1YNN C;  1OXT A;  2Y0S E;  4BY1 H;  1SYB A;  1VQL A;  4JI1 Q;  1UE5 A;  1XMO L;  1A3V A;  3DLL A;  1K8G A;  2X69 A;  3ULP A;  4DUZ Q;  4ZKC B;  5LMN Q;  3VR6 A;  4JI2 L;  1JCK B;  3CMA A;  4X3K A;  3F2B A;  4A3J G;  2E8G A;  1JIC A;  4IFD I;  1EY5 A;  4E6I A;  5KIX A;  4GKJ L;  3J80 L;  4HJ8 A;  1E1O A;  1TY0 A;  1RTN A;  2XSC A;  1AFP A;  4CKC A;  1Y1W G;  2OXP A;  2NTS A;  3U58 A;  1ESR A;  2K5W A;  2K7V A;  1R9T H;  4K2K A;  2LS0 1;  5JPM C;  3A8J E;  1YJW A;  5K36 H;  2G5D A;  2F4V L;  2F3I A;  4A3F B;  4JPB W;  4C3H H;  4LF4 Q;  3D0F A;  1STA A;  4JYA L;  2JA5 B;  1RDP D;  2IT1 A;  4WFN 3;  4IAL A;  1MSH A;  2NVX H;  3URY A;  5CBE E;  5IYB H;  4B3T L;  1IBL L;  5M5X H;  4UP7 A;  2L9H A;  1YNX A;  3VA7 A;  4IOC A;  4Q0F A;  3KJO A;  4C2M H;  4F88 A;  5C4X G;  2R93 B;  3PUW A;  3U9S A;  4IJH A;  2FIN B;  4UHV A;  3JAM L;  2PCF B;  1D7Q A;  2HUG A;  2R7D A;  2A19 A;  5FLX L;  4H7B A;  5IT9 L;  2A6E D;  2NN6 H;  2B2V A;  2VQF L;  5GAH C;  1FNW A;  3J81 j;  1B8A A;  5M5W H;  3WWV A;  5IWA Q;  4RHR A;  4B9X A;  1PFM A;  4XQN A;  4A3K B;  1SAP A;  3Q23 A;  1X9N A;  2UXB Q;  2HQE A;  3IFT A;  1F77 A;  4A3I G;  1LT4 D;  2R3Z A;  3GTM H;  1VMP A;  1L0Y B;  2OEO A;  3W1B A;  3PUX A;  2ASB A;  1HZ9 A;  2B8G A;  4YCV A;  4OO1 G;  1LTG D;  4TKO B;  2EY1 A;  1E24 A;  3FDT A;  1V1P A;  4ZKB B;  2B63 B;  4JW0 A;  4B08 A;  4FXD A;  3RN5 A;  1HFG A;  1PRT F;  1VQ7 A;  4HJ9 A;  1YHQ A;  1MD2 D;  3TRZ A;  5L37 A;  2A69 C;  2R7F A;  5M3M B;  2N55 A;  2E74 C;  5A35 A;  3L0O A;  1ENC A;  3MEH A;  2AQ1 B;  3RZD B;  4BY7 H;  1EY7 A;  3S1R B;  1TS4 A;  1XTC D;  2BE5 D;  2F0V A;  1N33 Q;  4Z9C B;  1YZ6 A;  2K1B A;  3I4N G;  4LMQ D;  2HHH L;  4YHH L;  4LUZ A;  1D5Z C;  4JI0 L;  3SK5 A;  3HOW B;  1BUV T;  2FMC A;  4BXX G;  2EZV A;  4HMJ A;  5BN5 A;  1PHJ A;  3R8B A;  2RBM A;  3MXU A;  5EGT A;  1SN8 A;  2B2W A;  2B39 A;  5I2X A;  2YTY A;  4B9W A;  5IYC H;  3A0J A;  5A2Q L;  2B2U A;  3S14 H;  3ZYY X;  2K33 A;  1WCM H;  2NBF A;  2ALY B;  1SYE A;  3IKJ A;  3S16 B;  2QA4 A;  1LT5 D;  3K8A A;  4CJ1 B;  1RJT A;  2E76 C;  3A7L A;  3CC7 A;  4LNQ A;  5JAV A;  1PFS A;  4OO1 I;  5C0X J;  2ZJR A;  1V1Q A;  4C3J H;  4JI4 Q;  2PQA A;  3GTG H;  4L5T A;  4PZ6 A;  1XWE A;  3S9W A;  3DMU A;  2BA0 A;  3K6O A;  5I6W A;  5FLM H;  2YU9 B;  5C3E B;  4JI8 Q;  4DPG A;  3KLS A;  2VUM G;  1GJX A;  3Q0A A;  2E2H B;  1B7Y B;  4MHE A;  4OWX B;  1QVF A;  5JJK A;  2KHI A;  1U4M A;  2PNR C;  4C3I B;  2EYP A;  3HOZ G;  2K32 A;  1JOK A;  1ROD A;  1Y1V H;  1PYW D;  3E9H A;  2MO0 A;  1YNJ C;  5BR8 Q;  4M8A A;  1RHP A;  2O4X A;  5FO7 B;  4A3C H;  2R6G A;  4A3B B;  2V4D A;  3HS0 C;  2K28 A;  2JXM B;  4CHT B;  1A15 A;  1N36 L;  4GOP A;  4LFA Q;  1PTO D;  1IKL A;  3BG3 A;  4HIK A;  3RLO A;  5I9P A;  3SVM A;  1GUO A;  3VR5 A;  3K7A B;  1NAP A;  1DON A;  2JEA I;  3SHL A;  5C0X H;  3C46 A;  1GUN A;  4DXG A;  2F0E A;  3H0G H;  3KFU A;  2SNM A;  3W2D A;  4KKU A;  4I65 A;  1VCI A;  5ELN A;  2Z4I A;  3A56 A;  4JBW A;  4X66 L;  2N8N A;  4BBS B;  3S15 H;  3WOE A;  5CV8 A;  5JPN C;  1Z9F A;  5HGT A;  3STB D;  1I4P A;  1NY4 A;  2QF7 A;  2WAQ B;  1JWU D;  1KAW A;  3BZK A;  1FGU A;  4A3D B;  1NNX A;  3HG9 A;  1K8O A;  5IP7 H;  1TS3 A;  2AUK A;  3T1H L;  2K50 A;  1WTO A;  1EWH A;  1C0A A;  1VQ5 A;  2D9U A;  4GNX B;  4J8Q A;  1HNZ Q;  1W6J A;  3BYY B;  3L3O C;  2JA6 B;  1KDC A;  4JI3 Q;  4ME3 A;  1FL0 A;  3AFP A;  3FVQ A;  3SK8 A;  4DU9 A;  1KDB A;  1QUQ A;  1IBK Q;  4OX9 L;  1ZYR C;  1CA5 A;  1CTM A;  3IRB A;  2XNA C;  3HKZ B;  2HCI A;  3F1Z A;  1E22 A;  1SRO A;  2OCE A;  3VA5 A;  2EYO A;  4R4C A;  4JI7 L;  2RDG A;  3DEO A;  1ENA A;  1XTD A;  1WTP A;  3EQL C;  4UAI A;  1JR0 D;  1OXX K;  4NXN L;  1EIY B;  1S5E D;  4PZ8 A;  4RGO S;  1LTR D;  4LF5 L;  1B9N A;  3CC2 A;  1TR5 A;  2F0S A;  2L0C A;  1HHV A;  3MHB A;  4X6A H;  3D4R A;  3HOV B;  1X3F A;  3GTQ B;  2F0H A;  2G9D A;  1PTO B;  3SXH A;  4ABN A;  3K7U C;  3RUZ A;  4A3F H;  1B3A A;  4GKJ Q;  3GV3 A;  2QIL A;  1E1T A;  2Y0S G;  2CW0 D;  3VYU A;  1YHA A;  2F0P A;  3NUC A;  2JA5 H;  3K5M A;  3PMF A;  2DJG C;  4DNI A;  4HJ5 A;  1PH5 A;  3R3O A;  1GKH A;  5ELB A;  2F4V Q;  2I46 A;  4RKB A;  1CI3 M;  3R93 A;  2RHQ B;  2UU9 L;  3IAY A;  1HTP A;  3J80 i;  4JYA Q;  4O0A A;  4YWL A;  2AUJ D;  2YTV A;  4JOI C;  3MFG A;  4B3T Q;  4K5V A;  2WFW A;  5IP9 H;  5KYI A;  5BN4 A;  1Y8O B;  2EVB A;  1GUT A;  4P73 A;  4HID A;  3I4O A;  3QB3 A;  2VQE L;  2DNE A;  2K52 A;  3KF8 A;  3J81 E;  1N32 Q;  1SMY D;  3RZO B;  4K6L A;  4AYB G;  2A6H C;  2MPM A;  5G3L F;  1JOO A;  1MI2 A;  4A3K H;  4PZ7 A;  4DK0 A;  2EY5 A;  1I4H A;  1WTH A;  2R7Z G;  4NPS A;  2VQF Q;  4DV2 Q;  3JAM i;  3S1M B;  2GVA A;  4FDB A;  2PZU A;  1F2Z A;  3OWE B;  3C1E A;  4KN4 C;  3M7N A;  1CUK A;  3H15 A;  3LGJ A;  1CSP A;  1TII D;  1QNK A;  1RIP A;  2WB1 E;  4RFB A;  4WOR A;  3D3R A;  5M3M H;  3DWQ A;  2DY7 A;  1Y8N B;  2Z9H A;  2KCM A;  1P16 A;  2KOL A;  5COY A;  2L15 A;  1CHP D;  2JA8 B;  3RZD H;  1I4Q A;  1SJH D;  1L1O C;  2KQ3 A;  1ZXT A;  1PRT C;  3S1R H;  4FF2 A;  2JA7 B;  2VZA A;  1NR2 A;  4K0K L;  3AFQ A;  2KA7 A;  1VQC A;  2DNC A;  4ZQ3 A;  1QUQ B;  3K57 A;  2Z1C A;  1I5F A;  1AW7 A;  4DR1 L;  3HOW H;  1I6V C;  1EWI A;  2HT1 A;  3J81 c;  4R4I A;  2NVQ B;  3S17 H;  4CGY B;  4KTA A;  3ND8 A;  1ASZ A;  1U4R A;  1BBW A;  3EFX D;  2HHH Q;  4YHH Q;  4DA2 A;  4JI0 Q;  4FVM A;  5LL6 S;  1LYL A;  1UEB A;  2Z8L A;  1M1K C;  3VYT A;  2N49 A;  4H13 C;  1SFO B;  3S16 H;  2H1E A;  5HUR A;  2D62 A;  3FEW X;  3KYH C;  4CDC C;  2KEN A;  3H09 A;  2AMC B;  3BJU A;  1BBU A;  1DGS A;  3M4Q A;  2R92 B;  1EZ8 A;  3S2H H;  1Z6H A;  4H44 C;  1SYC A;  1K73 C;  3OYY A;  2UXC Q;  4A3L G;  1BR9 A;  3O13 A;  3TN2 A;  4YWM A;  2L12 A;  2AWN A;  1E0B A;  4DK6 C;  1ICW A;  5M3F G;  1EY9 A;  3CP0 A;  3MVV A;  3TZD A;  1PXU A;  1TVX A;  4P72 A;  5C3E H;  2V1C C;  2YU9 H;  2E2H H;  5JJZ A;  1SXT A;  4MTK A;  1FYC A;  4C3I H;  4A3J B;  3K5O A;  4OWW B;  3K0Y A;  1X3P A;  4KD4 A;  5IGC A;  1TS2 A;  3KF8 B;  4PMC A;  3E0E A;  2I5M X;  4QY7 A;  4L5Q A;  1Y1W B;  4A3B H;  3OTO L;  2QW7 A;  1O7Z A;  5F2D A;  1UEA B;  1SBB B;  4R9W A;  2A1A A;  2O2L D;  3L2P A;  1LAB A;  3K7A H;  2IWH A;  3BYT B;  3HRZ C;  4A3E B;  1XX8 A;  4DV7 L;  2EXD A;  3SR1 A;  2LSS A;  3SGI A;  4K6D A;  4NW2 A;  1OXS C;  3DWA A;  4LJZ C;  2K5Q A;  2F0L A;  5C4X B;  2EYF A;  4UPA A;  1FNU A;  4DR6 L;  1WVL A;  1WD1 A;  2YV5 A;  2FFK B;  2RSO A;  1QZG A;  4WJ3 M;  5DNF A;  1UE7 A;  2ENB A;  1B44 D;  3GTP H;  2BDO A;  2F03 A;  3NPP A;  2CVR A;  1FVI A;  2ZJP A;  4LK1 C;  1LM0 A;  2OTL A;  4A3D H;  2X6L A;  4X66 Q;  1PH2 A;  2PMZ E;  1LV9 A;  1A3T A;  2L4N A;  1QG7 A;  2JA6 H;  3S2D B;  3MXP A;  2E5L Q;  1UE6 A;  1PH3 A;  1EU4 A;  4ZCK A;  1H95 A;  2UUC L;  3R2I A;  4A3I B;  4IUN A;  4MIU A;  4DR5 L;  5CV9 A;  1B1Z A;  5GAG C;  4HJ7 A;  4QCL A;  2F0N A;  5E4X A;  4ZAI A;  4B3S L;  3PO3 H;  3UDG A;  4DV1 L;  4IPH A;  4OX9 Q;  3AQQ A;  1H9S A;  2CWA A;  4N8F A;  2NZ1 D;  1CZW A;  1WTV A;  2EYH A;  4HSV A;  4X3U A;  2KJX A;  3CCS A;  4JI7 Q;  1SSO A;  2Q8I B;  2RDF A;  3U9O A;  1Q1B A;  5ISR A;  3HOV H;  3I4M G;  3G6J B;  3PV0 A;  3GTQ H;  1PTO H;  1U0L A;  3NTH A;  4LFC L;  4V0B A;  3CRK C;  3LWE A;  4IQZ A;  4DAM A;  3I4N B;  1BXT A;  1AP0 A;  3UDI A;  1ZEQ X;  4MZ9 A;  3HOU G;  2PI2 E;  2F0W A;  1U4L A;  4HAE A;  1EUJ A;  5E1F A;  2FHT A;  5TSS A;  1GUS A;  2KBN A;  2KEE A;  1BO0 A;  1CHQ D;  1SE3 A;  3A5Z B;  1A6X A;  4QIW B;  1HPC A;  3T1Y Q;  2RQX A;  4CDE C;  4IFD J;  3RZO H;  2Z6K C;  3GD7 A;  3V2T A;  4HR7 B;  1L0W A;  4FXG C;  1VQ8 A;  4RWS C;  1M8A A;  1NBW A;  2UUA L;  2NVT B;  1VQG A;  2VQE Q;  2I5L X;  4CDF C;  4NMZ A;  1DD2 A;  1GUW A;  2JE6 I;  1HXY D;  2IY5 B;  5C5L A;  2NVY H;  2XTI A;  1S4Z A;  1W3S A;  2IHE A;  3S1M H;  2VUM B;  2K6A A;  5IIF A;  5FO8 B;  2F0M A;  2PNH A;  1PH9 A;  2N88 A;  5FJ8 H;  4DV3 L;  3RNU A;  1WYD A;  1DXM A;  2NUC A;  5M5Y H;  2GA4 B;  2WKD A;  4LF9 Q;  3CCL A;  2RCN A;  3QOJ A;  2JSO A;  1CKN A;  3ERO A;  1VQD A;  2HCC A;  4HJA A;  2VXW A;  1HNX L;  3J7A V;  4FP5 D;  4LFB Q;  1E2W A;  5DM7 3;  5JVG 3;  2NN6 G;  2A74 C;  1YEZ A;  1FD7 D;  2N78 A;  2JA8 H;  1QVC A;  1F2M A;  2K5H A;  2JA7 H;  4A3M G;  2F0D A;  1Q8I A;  4KHZ A;  4IFD H;  4BWG B;  1Y69 U;  1DZ1 A;  2O5I C;  1ESF A;  3MXG A;  3A74 A;  3J7A F;  3T16 A;  3ERS X;  4CBV A;  2NVQ H;  1KHI A;  5JOB A;  1A0I A;  2M9V A;  3OW7 A;  3X3M A;  3FP9 A;  4K0K Q;  1YIJ A;  2Z4H A;  2EJM A;  1KQS A;  1LTB D;  4OHJ A;  5D3I B;  1U5K A;  4DR1 Q;  1T5X D;  2F0U A;  4K8J A;  1SFO H;  3ICE A;  1SYF A;  1T5E A;  3EA6 A;  4DKA C;  1L0X B;  3PGZ A;  5DAU A;  1PTO F;  4KD3 A;  1IHZ A;  3GP7 A;  4JBK A;  2R92 H;  4DNT B;  1I50 B;  3TRE A;  3V05 A;  4OL7 A;  1QCB D;  1SNM A;  3H91 A;  1ILQ A;  4P2C B;  4KY6 A;  1QIL A;  4BBR B;  3PF5 A;  1WOC A;  1X32 A;  3PUV A;  4L5S A;  1SND A;  4XTC S;  3UDX A;  1HRJ A;  2F1M A;  2NN6 I;  1SE8 A;  2F0K A;  3W3A A;  3D4D A;  3MTS A;  5IY0 A;  3TP7 A;  3KF6 B;  5I6Y A;  3GTO B;  2EY6 A;  5ELE A;  1DM0 B;  3TZU A;  1N9W A;  3KBG A;  2WP8 J;  4RGN A;  1YJN A;  3CCU A;  5IYC G;  2BCO A;  3PQI A;  2A68 C;  1IW7 D;  1WCM G;  2QDL A;  2ES2 A;  1X3E A;  1JOR A;  2KHS A;  3M4O B;  3Q6S A;  1AZP A;  1JE5 A;  1Y1W H;  1VQ6 A;  1VF7 A;  1B9M A;  5K5P A;  1D1K A;  1A2U A;  2A5H A;  3VR3 A;  5DEH A;  3D31 A;  4A4I A;  3G7L A;  4KI0 A;  2EJG C;  1SMX A;  1O7I A;  4X65 L;  1SYG A;  4G4K A;  2ATW A;  2O5J C;  1JB7 A;  4R4T A;  4A3E H;  3OTO Q;  2F3V A;  2XIW A;  5I2Y A;  4QL5 A;  1S5F D;  4XT3 B;  3OHX C;  5FLM G;  3K81 C;  3A5U A;  1O7Y A;  2L1B A;  5C6A A;  1CFM A;  4IO9 A;  3BVZ A;  1BCP C;  4NKL A;  1EEI D;  2WIN B;  2VB2 X;  1VQ9 A;  2K03 A;  1XPR A;  3DEP A;  1BNZ A;  1CKN B;  3J80 E;  4DV7 Q;  4GLV B;  4X64 L;  3QJY A;  4A3C G;  3PIO A;  3PO2 B;  3NP8 A;  2BA1 A;  2WAQ E;  1KXL A;  2B2T C;  1G2S A;  2JYO A;  2QEJ C;  4AYB B;  5IGD A;  4L5R C;  4DR6 Q;  5KEE A;  1JMC A;  1B3Q A;  1VDZ A;  1ET6 A;  4KV6 A;  4U67 3;  3I56 A;  3S2D H;  2R7Z B;  1TQO A;  1A8V A;  3R2T A;  4A3I H;  1VF5 C;  1II3 A;  3HEJ A;  2EY2 A;  4BS9 A;  4OIJ A;  1K3R A;  1QB5 D;  4JOI A;  5IOD A;  1MHW C;  3HKZ E;  3JAM E;  4MNO A;  1PYB A;  1WTR A;  2UUC Q;  1C4Q A;  3OMG A;  2F0O A;  2RDH A;  4QF4 A;  5FLX E;  1RCV D;  3GDE A;  4DR5 Q;  5IT9 E;  5LMU L;  1KLG D;  1CKM A;  2ZTC A;  1AE2 A;  2IW3 A;  4AIM A;  4OWT B;  3X3N A;  2ZXP A;  1M4V A;  4B3S Q;  3UE1 A;  4DV1 Q;  1SRU A;  4X3T A;  2NB0 A;  2A6E C;  5GAD C;  1BQQ T;  3H3V H;  2GVB A;  4DUY Q;  3J80 c;  5JVH 3;  3I4N H;  2H5X A;  5J3B A;  3D6C A;  2UUB L;  5JEA G;  2CHB D;  1HNW L;  4BXX H;  3NHH A;  4LFC Q;  4GS3 A;  2VY3 A;  1CSQ A;  2EPB A;  4OXP A;  3MFY A;  4XIG S;  4YCU A;  2IX0 A;  2J4X A;  3KLR A;  1STH A;  1V1P B;  2SNS A;  4ZYS A;  1IZ6 A;  3PF4 A;  3HOY G;  1L1O A;  1KC8 C;  5C0X I;  1Q81 C;  1I6H B;  3JAM c;  2M00 A;  3F8T A;  5C4J B;  1EFI D;  4N8X 1;  3TEH B;  5FLX c;  1Q8K A;  2NVT H;  1TWC H;  5IT9 c;  4XXE A;  3PSI A;  1GVP A;  5CBA E;  2VUM H;  1HH2 P;  2BE5 C;  4XDX A;  1SNC A;  3FPP A;  1R4Q B;  4PMB A;  1TWG B;  1E3P A;  3NXW A;  1TXY A;  1ZKO A;  5D14 A;  2UUA Q;  4YCW A;  5A2Q E;  4LF7 L;  1HZA A;  4A93 G;  4YY3 L;  2DUD A;  1RD9 D;  2I5H A;  2EE1 A;  1EQT A;  1TWA B;  2G9H D;  1PA6 A;  4DV3 Q;  1XMO Q;  4XYO A;  4I7Z C;  3HFZ B;  4B3M L;  1VQK A;  3PIP A;  1E2V A;  1XXG A;  5GQO A;  3GTL B;  2E2J B;  1K83 B;  4JI2 Q;  3AYH B;  1HUN A;  1H9R A;  3E9I A;  4ZUI A;  1MGS A;  2SEB D;  1CQF A;  2LMC B;  2PQA B;  4QMG A;  5KYL A;  2PO4 A;  4GNX C;  4RG1 A;  3G71 A;  3OW2 A;  3TP8 A;  2JA9 A;  1TU2 B;  1J5E L;  1I94 L;  4WJ4 A;  3I90 A;  4EQN A;  2R93 H;  1CZG A;  2LFN A;  4JG2 A;  2CH4 A;  1EIH A;  2K5V A;  4GN4 B;  1UAP A;  2B3G A;  1CQV A;  1IBL Q;  2NZH A;  1I50 H;  1LO5 D;  3E3X A;  3RLF A;  1K9M C;  2NZO A;  3U4Z A;  3F2C A;  4BBR H;  4GOP B;  4JI5 L;  4J1M A;  2AWO A;  5FOB B;  2IX3 A;  1PTO C;  1HR0 L;  2ICE C;  3KJP A;  3TS0 A;  2KCN A;  4MTN A;  3J7Z C;  5C4H A;  2XN9 C;  3GTO H;  4ZRZ A;  3CC4 A;  3C1F A;  2JP1 A;  4KY7 A;  2EYM A;  1JJG A;  1EYD A;  1NR4 A;  1MIU A;  3I4L A;  3S24 A;  4WJW A;  2E2I B;  2B63 H;  1L1O B;  5DM6 3;  3G48 A;  1PRT B;  3M4O H;  2TSS A;  1AZQ A;  2XRQ D;  5C3W A;  2RSN A;  4R4O A;  1TWF B;  1B53 A;  5EPL A;  3STB C;  3I4M B;  3KOJ A;  4BA2 I;  1EYA A;  4EQ5 A;  1WTW A;  1LT3 D;  1RTO A;  5C44 G;  3RD4 A;  3GO5 A;  1J6Q A;  2IHF A;  3BU2 A;  3BS1 A;  2ICI A;  3NQI A;  3B6Y A;  4UDU C;  4DNR B;  4DV6 L;  1GHJ A;  1EL0 A;  1STY A;  2RHS B;  1K8A C;  5FKA C;  3HOU B;  2HDM A;  4JCV E;  5I4D A;  2KCC A;  2RVL A;  3MWY W;  1IYJ B;  1JE4 A;  2DGY A;  2K75 A;  1Q7Y C;  2ZM6 L;  4X65 Q;  4C3I G;  1JT8 A;  4YWK A;  4POF A;  1VQO A;  1WTX A;  1IKM A;  4GLX A;  4A3G G;  1Z47 A;  1Y14 B;  1PDQ A;  3PO2 H;  1BKB A;  4DR2 L;  1XMQ L;  4N9T A;  3UI2 A;  5EKL A;  2FMM A;  2MUY A;  1NSN S;  3H94 A;  2Z0S A;  4X64 Q;  2CWP A;  3K58 A;  4A75 A;  1PVO A;  2R7Z H;  2LXJ A;  2WII B;  3GTJ B;  1D2B A;  4R4Q A;  3A55 A;  3E0J A;  4PV1 C;  3BDO A;  2CW0 C;  4TQU S;  2MO1 A;  4RA8 A;  4ME5 A;  4NP5 A;  2DY8 A;  1SLJ A;  1NMF A;  4JBM A;  1SJE D;  3IL8 A;  2K5N A;  1PFN A;  1LAC A;  1CM9 A;  3M3Y B;  2RA4 A;  1AE3 A;  1HTL D;  4K8I A;  2Z6K A;  3PUZ A;  3DXJ C;  4JVZ A;  1ENF A;  4X3S A;  1ONL A;  5KGU A;  1HQM C;  3SK6 A;  2IPK D;  1RF2 D;  1EY4 A;  3L7Z C;  5M5W B;  4A3M B;  2F0Q A;  1G6Z A;  3A8K E;  5E7N A;  5LMU Q;  4K14 A;  4NXM L;  2JA6 G;  1SMY C;  2EYL A;  1STE A;  2B8F A;  4EX5 A;  2VL6 A;  2EIF A;  1QE6 A;  1YHB A;  1D5X C;  3EJI A;  3I70 A;  4RH6 A;  1S5D D;  3CXC A;  3CW2 C;  1NE3 A;  2JN4 A;  1HA5 A;  1LLR D;  2IJ0 A;  2K4K A;  3HOX G;  1L2F A;  1MJE A;  4EGV A;  1STB A;  1F2L A;  3BVM A;  1STN A;  4DAY A;  4IUT A;  3PO3 G;  1N36 Q;  2UUB Q;  3UE0 A;  2MHV A;  2HIX A;  2I07 B;  4HIO A;  4QIW E;  2EDG A;  4BBS H;  4PQX A;  5IGF A;  1BOS A;  4K2L A;  3CD6 A;  1I6H H;  3PCO B;  4R1J A;  1PH7 A;  1TY2 A;  1OTC A;  1U4P A;  5JJL A;  4DR7 L;  5C5M A;  1YNN D;  4A3L H;  4RHS A;  3CPW A;  2ZTE A;  1KLU D;  1P8L A;  3C2P A;  3QO2 A;  4HCS A;  4RCO A;  3FKI G;  3QIA A;  2RCF A;  1O7L A;  1XNR L;  1TWH B;  3M4Y A;  3M7G A;  1B70 B;  1TWG H;  2QDB A;  3K5L A;  3P75 A;  1M90 C;  4DK1 A;  1Y8P B;  1VQM A;  4BA1 I;  1G51 A;  2PZW A;  3IFD A;  3T1H Q;  1U9R A;  4JBJ A;  3NQT A;  1Q90 A;  4F7X A;  3S14 B;  3CCQ A;  1TWA H;  2D0P A;  4ZUJ A;  4JI4 L;  1SE4 A;  1BF4 A;  4XQJ A;  4KKS A;  3OIQ A;  1PFB A;  4XT1 B;  4AQY L;  3K80 C;  4IJL A;  4LF7 Q;  3UDF A;  4JI8 L;  2NTT A;  3Q24 A;  3PIO 3;  4YY3 Q;  5IYD G;  4KY5 A;  4F87 A;  2E2J H;  3GTL H;  1K83 H;  3C3L A;  2F3W A;  4L8J A;  5CV6 A;  1SEB D;  2DN8 A;  4J6H A;  1S3O A;  1Q3L A;  1EQR A;  2C9O A;  5KND A;  4NXN Q;  1BDO A;  4O42 A;  4LF5 Q;  4QUF A;  1IBM L;  5FO9 B;  4RGT A;  4B3M Q;  1OO9 B;  1EOV A;  1N34 L;  3QG1 A;  4BY1 G;  1GD7 A;  2ZT9 C;  5CMD A;  3TP5 A;  5GAE C;  4KN7 C;  5COR A;  1STG A;  3CCV A;  2Q2H A;  4K5W A;  2HQL A;  1UNS A;  1DYQ A;  1X65 A;  1VQE A;  2LKV A;  3ER0 A;  1ML0 D;  4Q5V A;  2JA8 G;  1KDA A;  1YJ9 A;  1W2B A;  2UXD L;  5IGB A;  3FPU B;  2UU9 Q;  2CCZ A;  2PYK A;  4ZLT F;  1A63 A;  4GN5 A;  5K36 G;  2XWB B;  5E4W C;  3LNN A;  4C3H G;  3H3V C;  1KIX A;  1Q82 C;  1B4O A;  4FXK C;  1AH9 A;  1KAA A;  4CKE A;  4DAY B;  5ELD A;  5EKI A;  4ODG A;  3RN2 A;  3T51 B;  1SNO A;  3QR8 A;  4JI5 Q;  5IYB G;  3MEF A;  2YTX A;  1TKW B;  5C3X A;  2WV6 D;  1HUM A;  3P20 A;  2MJ8 A;  5LHY 1;  2E2I H;  2B2T A;  2A69 D;  5EJW A;  3HOZ B;  1S5C D;  3N52 A;  1HFN A;  1O80 A;  3TSS A;  1TWF H;  3DM3 A;  1PZI D;  1WD0 A;  4QUC A;  3CHB D;  3T4A C;  3HZX A;  2CQO A;  2MQH A;  3BZC A;  3EN2 A;  4ULL A;  5EPK A;  3F2D A;  1BCP D;  1HZC A;  3HOU H;  1PMR A;  3U4V A;  1LTI D;  4UP8 A;  2OTJ A;  2K5D A;  1VMC A;  1WFQ A;  4DV6 Q;  3DHQ A;  2DJF C;  4IUV A;  2A8V A;  2NYZ D;  4CJ2 C;  3CQZ B;  3ONA B;  3HOY B;  3I7F A;  1F2Y A;  2AHO B;  2VNU D;  1H9S B;  1PZJ D;  2WB1 G;  1SNP A;  2ZM6 Q;  2B2Y C;  2TMP A;  3L9A X;  3Q22 A;  3GQB A;  1DOM A;  4AYB E;  4EQO A;  1G91 A;  4RAU C;  2D5D A;  3HP3 A;  3T13 A;  4V19 0;  3NEM A;  3I91 A;  1BBX C;  4IUR A;  4PNY A;  4BY7 G;  3GTJ H;  2J7Z A;  3PIP 3;  4DR2 Q;  1XMQ Q;  4A3E G;  1X55 A;  4LUO A;  1CKO A;  1EY8 A;  3TDQ A;  1MKH A;  2CFM A;  3ULJ A;  1GM5 A;  2R61 A;  3K0X A;  3KUP A;  4QB4 A;  3FRP B;  1N32 L;  1HCZ A;  3M3Y H;  3G6E A;  4GLA C;  4A93 B;  1MBY A;  4LWC A;  1YNJ D;  3A7A B;  2Q2T A;  2OQK A;  1XYI A;  4A3J H;  3BDC A;  3NTK A;  2RKS A;  3U50 C;  5J39 A;  4DV2 L;  1ASY A;  4A3M H;  5EAY A;  2HD3 A;  4HCE A;  1G29 1;  1IYV A;  2EQS A;  3NWT A;  4DFA A;  3M4P A;  5I9O A;  1AEX A;  4POG A;  1BCP B;  4U68 A;  4C3J G;  2Y0S B;  1S5B D;  3J7Y W;  3VYR A;  1CA6 A;  4LF8 L;  2VB3 X;  4N9P A;  2WKC A;  4NXM Q;  2QEX A;  4TVA B;  4DV0 L;  2MP1 A;  4B3R L;  5C4X H;  3NTI A;  2FJ2 A;  5J1Z A;  3BZD B;  2KHJ A;  3VYS A;  2ZTD A;  1D6E C;  3I2Z A;  1V9P A;  3P7J A;  3CF5 A;  3WDN A;  1ET9 A;  1Y1V G;  2PPB C;  4OEM B;  2Z6B A;  1VQF A;  5AJ3 L;  1XNQ L;  1QJO A;  2CQA A;  3M85 A;  4GNX A;  1KNE A;  2WAC A;  3AB9 A;  2Q2I A;  1EIG A;  1KL9 A;  1JB3 A;  3TBI B;  3D4W A;  4J15 A;  3E6Z X;  4G7O C;  1ZYR D;  5EQ0 A;  4QQB X;  1TWH H;  5J22 A;  1KTK A;  3DWP A;  3S17 B;  1SE2 A;  4DR7 Q;  5T1I A;  4P74 A;  1CK1 A;  1I4R A;  4OGQ C;  3TME A;  5C0X G;  4P75 A;  3OOC A;  3H0G G;  1EEF D;  4LAA A;  4OO1 H;  4Y52 H;  3D8G A;  1K8M A;  1KNA A;  3J81 i;  1UWV A;  1XNR Q;  1NJI C;  2UXC L;  5CV7 A;  5FK9 C;  4G7H C;  4DR4 L;  2VS1 A;  2NWG A;  3GTK B;  4JV5 L;  2FXQ A;  4LF6 L;  3M9B A;  3AU7 A;  3SK4 A;  3OMC A;  3S2H B;  5C44 B;  4PMW A;  5EPJ A;  2H4O A;  3SE0 A;  4APV A;  5ELC A;  4A76 A;  1J8I A;  5IP7 G;  4AQY Q;  1LTL A;  1T9H A;  2F0F A;  5CV4 A;  5IE8 A;  2F0J A;  3N6R A;  2D2C C;  4DXF A;  3MA2 B;  5IOC A;  3CAM A;  1B50 A;  1X54 A;  2XVS A;  3TS2 A;  1RL2 A;  3EBE A;  1EFW A;  1WJJ A;  3H6M A;  2KVM A;  2VW9 A;  4G57 A;  4OON A;  3SEB A;  4DN4 M;  1CT1 D;  1IBM Q;  2LXK A;  2XRS D;  1F9R A;  1V8Q A;  3H3V I;  1JQY D;  1N34 Q;  1SYD A;  4A3G B;  1NUC A;  1OXV A;  4JI6 L;  1YIT A;  2F52 A;  2QKI C;  1IW7 C;  1I4X A;  2A6H D;  4KLK A;  5JEA J;  1YI2 A;  4DV4 L;  1K28 A;  1K0S A;  1S40 A;  3KBX A;  2L55 A;  4ZK9 B;  3T53 B;  3FMC A;  3J81 L;  3I55 A;  1PH4 A;  1UE1 A;  1EIF A;  2B2V C;  3SDZ A;  4A3F G;  4KHP L;  1UUP A;  1V43 A;  2UXD Q;  1H9K A;  2PZT A;  1DOL A;  1IL2 A;  2JA5 G;  5M3F B;  3MZ5 A;  4H0L C;  4DR3 L;  4KK7 A;  1D5M C;  3KLS X;  4UY8 C;  3KLW A;  1E7Z A;  1JJC B;  1I3Q B;  2R93 G;  1PV4 A;  3A54 A;  4HSP A;  2ZXO A;  3NEN A;  2E5L L;  1EQQ A;  3HOZ H;  3GTP B;  4NB3 A;  2CH4 W;  3F2U A;  2ZXR A;  1QWY A;  1QVG A;  1X56 A;  5DLQ E;  1F9P A;  4XYQ A;  1DJR D;  2HDL A;  3D6W A;  5IP9 G;  1B2T A;  1VQP A;  1PRT D;  1C8C A;  3T56 B;  1VQN A;  4FF4 A;  4MN3 A;  1MSG A;  3EIV A;  4RKL A;  1WTQ A;  1D8L A;  2P5Z X;  4BBR G;  4Y7N B;  4OIK A;  4P71 A;  3I72 A;  5M9O A;  1ICF B;  5JEA H;  2SOB A;  3LX0 A;  2HIV A;  4KKT A;  4A3K G;  4NDX A;  1HNX Q;  3OSO A;  5NUC A;  1VQ4 A;  1A2T A;  2K04 A;  3HOX B;  2BH2 A;  2L11 A;  2C35 B;  4TRD A;  1Q46 A;  4GZY C;  3S1N B;  1HJP A;  3PO3 B;  2N3S A;  4JC0 A;  2EOT A;  1D1I A;  4H02 A;  2Q8R E;  3CQZ H;  4RCN A;  2B63 G;  3AEV A;  3HOY H;  1DCZ A;  2PQE A;  4R8N A;  5D3D A;  2XWJ B;  2B2W C;  4IPC A;  4X62 L;  2A73 B;  5M3M G;  5CYU A;  3S1Q B;  4ILW A;  2OQ0 A;  3Q8D A;  2B2U C;  3K59 A;  5ELF A;  4PG3 A;  3WOF A;  1XPU A;  5BN3 A;  1EYG A;  1NMG A;  2B29 A;  4O2D A;  1C48 A;  1PH1 A;  3FKI B;  4IUP A;  5E3F A;  4L6T B;  1V1O A;  2EYJ A;  4DV5 L;  3T1Y L;  5CC4 A;  3W1G A;  5IGE A;  5LL6 X;  1FJG L;  3HOW G;  4GKK L;  4A93 H;  2J0T D;  5C4Z A;  2JQO A;  3CU7 A;  4LW1 A;  3NBH A;  3P1H A;  5H1S E;  1VQJ A;  2IL8 A;  2Q8T A;  3PO2 G;  1I4G A;  2AQ2 B;  3KK7 A;  2MNA A;  1LTT D;  3CME A;  3NWS A;  4JI1 L;  2Q2U A;  1A3U A;  2BOS A;  1JWS D;  3DM1 A;  1OXU A;  2KEC A;  1VQI A;  4CDD C;  4LF9 L;  4IPG A;  1HR0 W;  4DUZ L;  3QOL A;  2NVY B;  4EVO A;  4C56 C;  1GUG A;  5LMN L;  2ID0 A;  3LWU A;  5JJI A;  1F9S A;  4RGM A;  4GOP C;  1LTA D;  1S72 A;  4BY1 B;  4OEL B;  2QCP X;  4LFB L;  1X3G A;  2BH8 A;  2EJF C;  4HN7 A;  4XQQ A;  2KCT A;  5M5Y B;  2OT2 A;  5CV5 A;  3AMU A;  5C3E G;  3CKI B;  2PW5 A;  2C5C A;  4YIJ A;  4IUU A;  4ID6 A;  1NTG A;  4FYD A;  4LF8 Q;  4QJF A;  3EVQ A;  3DUZ A;  1X6O A;  1VS0 A;  1SNQ A;  1YBY A;  3G4S A;  1PLF A;  5KNC A;  1BVS A;  1X3Q A;  3A8I E;  4DV0 Q;  4LF4 L;  4FNF A;  1QZH A;  4B3R Q;  2I0Q A;  4K5X A;  1LTS D;  4A3B G;  5LMN W;  5GRO A;  1YVC A;  1R9T B;  2KED A;  3GV6 A;  1TT2 A;  4IOA A;  1MJC A;  2BDN A;  3ERQ A;  4C3H B;  4S3S A;  5AJ3 Q;  3HGB A;  1C7Y A;  4IPD A;  1EZ6 A;  1C9O A;  1EYC A;  4CKB A;  1XPO A;  2K05 A;  1XNQ Q;  2NVX B;  4KHV A;  3MXN A;  4G7Z C;  1PH6 A;  2JEB I;  3RLN A;  4IUQ A;  5M5X B;  4M1U B;  1AN8 A;  2KUM A;  3CPF A;  4C2M B;  4FF3 A;  1HA6 A;  3MAQ A;  1FR3 A;  3CRL C;  4BBS G;  3GTK H;  5IWA L;  1IYU A;  4IN3 A;  4O1N A;  2UXB L;  1Q1E A;  1HQR D;  5C44 H;  2WAQ G;  3QWN A;  3NE5 B;  2LY7 A;  1KRS A;  3W5O A;  2F0T A;  3ZJY C;  4A3D G;  4DR4 Q;  1VQH A;  1PH8 A;  1EY0 A;  4JV5 Q;  3BVG A;  3OPO A;  1KD1 C;  4LF6 Q;  1PYS B;  3CCR A;  3E5S A;  4DAV A;  1JOQ A;  2ZJQ A;  2GN5 A;  2IX1 A;  3MC0 B;  4CJ0 B;  3VDY A;  3GTM B;  2EXZ A;  1GOZ A;  4AH6 A;  1DOK A;  4R8I A;  3K5N A;  4DK3 C;  1Z7T A;  1F9Q A;  3HKZ G;  4GN3 B;  1R4P B;  3NBH B;  4A3G H;  4L63 B;  1WI5 A;  3OWF A;  2WB1 B;  1QNU A;  4FF1 A;  1PZK D;  3KDF A;  1HNW Q;  4IZ8 A;  5AFW A;  1IXR A;  1FGB D;  1N33 L;  1J9O A;  4JI6 Q;  1BCP F;  2MGS A;  4BY7 B;  2RF4 A;  3VR4 A;  3HOV G;  3CCM A;  5C4J H;  1EU3 A;  2F0I A;  5G3L D;  4QGU A;  4DV4 Q;  3NBI A;  2D0O A;  5M3F H;  5KNB A;  1Q12 A;  4DGZ A;  5CGK A;  2F4I A;  4KMU C;  4KHP Q;  1I3Q H;  1O78 A;  3TP6 A;  3J7A 5;  2F0G A;  2B2Y A;  1GXD C;  1H9J A;  1QOH A;  4LUV A;  2AQ3 B;  3HKS A;  4JK1 C;  2AKW B;  3I73 A;  4DR3 Q;  3JC6 6;  4TSS A;  3I3C A;  1WCM B;  4I7A A;  4DAP A;  1RKN A;  1K0R A; 
#chains in the Genus database with same CATH homology
 1XMQ Q;  4A3E G;  1RIP A;  2WB1 E;  4LFC Q;  4GS3 A;  2VY3 A;  1CSQ A;  5HGQ A;  1JJ2 A;  1X55 A;  1A62 A;  4LUO A;  4OXP A;  1CKO A;  3CCJ A;  4XIG S;  4YCU A;  5M3M H;  2IX0 A;  4Y7N H;  1MKH A;  2CFM A;  3ULJ A;  2KCM A;  1GM5 A;  1P16 A;  3K0X A;  2L15 A;  1IZ6 A;  1N32 L;  2OWO A;  3PF4 A;  3RZD H;  3TQY A;  1L1O C;  4UP9 A;  3HOY G;  3NEL A;  1L1O A;  3HOX H;  3S1R H;  1KC8 C;  3G6E A;  4GLA C;  3M3Y H;  2VZA A;  3MXN B;  5C0X I;  1Q81 C;  4LWC A;  4K0K L;  3S1N H;  3AFQ A;  2Q2T A;  3RR5 A;  1VQA A;  3JAM c;  2OQK A;  5BR8 L;  3F8T A;  1VQC A;  2PI2 A;  4A3J H;  1QUQ B;  4HIM A;  3U50 C;  5FJ8 G;  3TEH B;  1I5F A;  5FLX c;  4DR1 L;  3HOW H;  4DUY L;  1EWI A;  1Q8K A;  4DV2 L;  2HT1 A;  2NVT H;  1TWC H;  3J81 c;  4R4I A;  5IT9 c;  2K14 A;  1ASY A;  4A3M H;  4ALP A;  3S17 H;  5EAY A;  3PSI A;  4LFA L;  1GVP A;  1ASZ A;  1G29 1;  2VUM H;  1BBW A;  1HH2 P;  2HHH Q;  2EQS A;  4YHH Q;  1J5E Q;  1SR3 A;  1E3P A;  3M4P A;  1Q86 C;  4RMF A;  1I94 Q;  4JI0 Q;  3S1Q H;  1TXY A;  1LYL A;  1UEB A;  4POG A;  2UUA Q;  4YCW A;  1M1K C;  2N49 A;  2JJQ A;  4LF7 L;  4LF8 L;  1HZA A;  3S16 H;  3FHW A;  4NXM Q;  2D62 A;  2DUD A;  3KYH C;  4YY3 L;  2QEX A;  1N8R C;  2I5H A;  2KEN A;  2JA7 G;  3FKI H;  4X62 Q;  2AMC B;  3BJU A;  1BBU A;  3CCE A;  1XJV A;  4TVA B;  4DV0 L;  4IFD G;  1DGS A;  3M4Q A;  1PA6 A;  2XGT A;  4DV3 Q;  4B3R L;  1XMO Q;  3S2H H;  5C4X H;  1LUZ A;  1K73 C;  2KHJ A;  3OYY A;  2UXC Q;  3HFZ B;  4A3L G;  3KF6 A;  4B3M L;  2ZTD A;  1GO3 E;  3I2Z A;  1VQK A;  1V9P A;  4YWM A;  3CF5 A;  2AWN A;  3PUY A;  3PIP A;  1VQB A;  4DK6 C;  5GQO A;  5M3F G;  1Y1V G;  3CP0 A;  4JI2 Q;  3AYH B;  4P72 A;  2YU9 H;  3E9I A;  2V1C C;  5C3E H;  1VQF A;  5ELO A;  5AJ3 L;  4DV5 Q;  2E2H H;  2CKZ B;  1HR0 Q;  2QGQ A;  3KDF B;  1XNQ L;  2PQA B;  1FJG Q;  4GNX C;  4GKK Q;  1KRT A;  4RG1 A;  3M85 A;  3G71 A;  4GNX A;  3OW2 A;  1HNZ L;  4C3I H;  2Q2I A;  2JA9 A;  1KL9 A;  2MFI A;  2YYZ A;  5IYD H;  4JI3 L;  1HZB A;  1J5E L;  4J15 A;  4OWW B;  1G6P A;  1I94 L;  4WJ4 A;  3ULL A;  1IBK L;  5HY6 A;  4QQB X;  1TWH H;  2JK8 A;  3I4M H;  2R92 G;  3KF8 B;  3E0E A;  2I5M X;  4QY7 A;  4L5Q A;  4A3B H;  4DR7 Q;  4P74 A;  4JG2 A;  3OTO L;  2R93 H;  5C0X G;  4P75 A;  2K5V A;  4GN4 B;  1OXT A;  2Y0S E;  3H0G G;  4BY1 H;  1VQL A;  4JI1 Q;  1UE5 A;  4Y52 H;  1XMO L;  2B3G A;  3J81 i;  1UWV A;  2A1A A;  1IBL Q;  1NJI C;  1XNR Q;  3DLL A;  1K8G A;  2UXC L;  2NZH A;  3ULP A;  3L2P A;  3K7A H;  1I50 H;  4DUZ Q;  4DR4 L;  3RLF A;  1K9M C;  5LMN Q;  2VS1 A;  2NZO A;  4JV5 L;  4DV7 L;  2EXD A;  4JI2 L;  2FXQ A;  4LF6 L;  3M9B A;  3U4Z A;  2LSS A;  3SGI A;  3F2C A;  4BBR H;  3CMA A;  4JI5 L;  4GOP B;  1OXS C;  3F2B A;  2AWO A;  4A3J G;  2E8G A;  1HR0 L;  4PMW A;  4IFD I;  3KJP A;  4APV A;  4UPA A;  4HJ8 A;  4GKJ L;  3TS0 A;  1E1O A;  4DR6 L;  4A76 A;  5IP7 G;  4AQY Q;  1LTL A;  1T9H A;  4MTN A;  2YV5 A;  3J7Z C;  5IE8 A;  1Y1W G;  3U58 A;  1R9T H;  1QZG A;  3GTO H;  3CC4 A;  4WJ3 M;  1UE7 A;  3CAM A;  1YJW A;  3GTP H;  2F4V L;  2F3I A;  1JJG A;  1X54 A;  1FVI A;  2ZJP A;  1MIU A;  3S24 A;  4C3H H;  4LF4 Q;  1LM0 A;  2OTL A;  1RL2 A;  3D0F A;  3EBE A;  3TS2 A;  1EFW A;  1WJJ A;  2B63 H;  1L1O B;  4X66 Q;  2VW9 A;  4A3D H;  4JYA L;  1PH2 A;  3G48 A;  4OON A;  3M4O H;  2PMZ E;  2IT1 A;  1IBM Q;  2LXK A;  4R4O A;  2NVX H;  3H3V I;  2JA6 H;  2E5L Q;  1N34 Q;  1UE6 A;  5IYB H;  4B3T L;  3STB C;  1PH3 A;  1IBL L;  1H95 A;  1OXV A;  4UP7 A;  3KOJ A;  5M5X H;  1YNX A;  2UUC L;  4JI6 L;  4IOC A;  3KJO A;  4EQ5 A;  4BA2 I;  1YIT A;  2F52 A;  4C2M H;  5C4X G;  5C44 G;  3GO5 A;  1J6Q A;  2IHF A;  3BU2 A;  3PUW A;  4DR5 L;  4IJH A;  4KLK A;  5JEA J;  3B6Y A;  4DV6 L;  1YI2 A;  4DV4 L;  1D7Q A;  4HJ7 A;  2R7D A;  2A19 A;  2RHS B;  1K8A C;  4B3S L;  1S40 A;  3PO3 H;  3UDG A;  4JCV E;  3I55 A;  4DV1 L;  1PH4 A;  1IYJ B;  2DGY A;  1UE1 A;  2K75 A;  1EIF A;  3AQQ A;  4IPH A;  2CWA A;  4OX9 Q;  4A3F G;  1Q7Y C;  4KHP L;  2VQF L;  2ZM6 L;  2UXD Q;  1V43 A;  4X65 Q;  5GAH C;  3J81 j;  1IL2 A;  4A93 G;  1JT8 A;  2JA5 G;  1B8A A;  5M5W H;  3WWV A;  3CCS A;  4YWK A;  5IWA Q;  4POF A;  4JI7 Q;  1VQO A;  4DR3 L;  1X9N A;  1Q1B A;  4GLX A;  4UY8 C;  3HOV H;  3I4M G;  3KLW A;  1E7Z A;  1Z47 A;  1Y14 B;  3PV0 A;  3GTQ H;  2UXB Q;  1JJC B;  3PO2 H;  1U0L A;  4A3I G;  1BKB A;  4DR2 L;  1XMQ L;  2R93 G;  1PV4 A;  4LFC L;  3GTM H;  3W1B A;  3PUX A;  3NEN A;  2E5L L;  1HZ9 A;  1EQQ A;  4DAM A;  2ASB A;  3HOZ H;  4NB3 A;  4YCV A;  4OO1 G;  2Z0S A;  4X64 Q;  2CWP A;  4A75 A;  1QVG A;  1X56 A;  5DLQ E;  3UDI A;  1E24 A;  1PVO A;  2R7Z H;  2LXJ A;  5IP9 G;  4MZ9 A;  3HOU G;  2PI2 E;  3RN5 A;  1VQP A;  1VQN A;  4R4Q A;  1VQ7 A;  4HJ9 A;  1YHQ A;  3TRZ A;  1EUJ A;  3EIV A;  4TQU S;  1D8L A;  2MO1 A;  2R7F A;  4BBR G;  4P71 A;  2KBN A;  1SLJ A;  3L0O A;  4A3G G;  1NMF A;  2HIV A;  4JBM A;  4A3K G;  3A5Z B;  1HNX Q;  4BY7 H;  2K5N A;  1VQ4 A;  3T1Y Q;  2BH2 A;  4IFD J;  2C35 B;  1Q46 A;  1AE3 A;  3RZO H;  1HJP A;  2Z6K C;  1N33 Q;  2N3S A;  1YZ6 A;  2Z6K A;  3GD7 A;  4JC0 A;  3I4N G;  3PUZ A;  1L0W A;  2HHH L;  4YHH L;  4LUZ A;  1VQ8 A;  4H02 A;  4JI0 L;  1NBW A;  3CQZ H;  2B63 G;  3AEV A;  3HOY H;  2UUA L;  1VQG A;  4BXX G;  2VQE Q;  2I5L X;  3L7Z C;  1PHJ A;  2JE6 I;  5LMU Q;  5E7N A;  2IY5 B;  4NXM L;  2NVY H;  2XTI A;  2JA6 G;  1W3S A;  2IHE A;  3S1M H;  4IPC A;  1SN8 A;  2VL6 A;  2EIF A;  4EX5 A;  4X62 L;  5M3M G;  2YTY A;  1YHB A;  2PNH A;  3A0J A;  5IYC H;  1PH9 A;  2OQ0 A;  3Q8D A;  4DV3 L;  5FJ8 H;  3RNU A;  1WYD A;  4PG3 A;  3S14 H;  5M5Y H;  1XPU A;  1WCM H;  2ALY B;  3CXC A;  1EYG A;  3CW2 C;  1NE3 A;  1NMG A;  3CCL A;  4LF9 Q;  2QA4 A;  2K4K A;  3HOX G;  1L2F A;  2B29 A;  3K8A A;  2RCN A;  1MJE A;  4O2D A;  3CC7 A;  1CKN A;  1PH1 A;  4LNQ A;  1VQD A;  4HJA A;  3PO3 G;  1HNX L;  1PFS A;  1N36 Q;  4OO1 I;  4LFB Q;  5C0X J;  2UUB Q;  3UE0 A;  4DV5 L;  3T1Y L;  2NN6 G;  3W1G A;  2ZJR A;  1V1Q A;  1YEZ A;  2N78 A;  4C3J H;  4JI4 Q;  2HIX A;  2PQA A;  2JA8 H;  1FJG L;  3HOW G;  3GTG H;  4HIO A;  4GKK L;  1QVC A;  4QIW E;  4DR2 Q;  2K5H A;  4A93 H;  4BBS H;  4L5T A;  2JA7 H;  4A3M G;  4PZ6 A;  4KHZ A;  2BA0 A;  3CD6 A;  2JQO A;  5FLM H;  4JI8 Q;  4LW1 A;  3PCO B;  4R1J A;  4DPG A;  1PH7 A;  2VUM G;  1I6H H;  1OTC A;  5H1S E;  1B7Y B;  1VQJ A;  3PO2 G;  5JJL A;  4OWX B;  1QVF A;  3A74 A;  2MNA A;  2KHI A;  4DR7 L;  5JJK A;  4A3L H;  3ERS X;  3HOZ G;  3CPW A;  2NVQ H;  1KHI A;  1A0I A;  2ZTE A;  1Y1V H;  3CME A;  1P8L A;  3FP9 A;  4K0K Q;  1YIJ A;  4JI1 L;  3E9H A;  2MO0 A;  3FKI G;  5BR8 Q;  1KQS A;  2Q2U A;  1XNR L;  4A3C H;  1B70 B;  1OXU A;  1U5K A;  1TWG H;  1VQI A;  2R6G A;  4IPG A;  4LF9 L;  1HR0 W;  4DUZ L;  1M90 C;  4DR1 Q;  5LMN L;  1VQM A;  4BA1 I;  1G51 A;  2ID0 A;  5JJI A;  3T1H Q;  1SFO H;  4JBJ A;  4GOP C;  1S72 A;  3ICE A;  1N36 L;  4GOP A;  4DKA C;  4LFA Q;  4LFB L;  3PGZ A;  1X3G A;  2BH8 A;  2KCT A;  3RLO A;  3CCQ A;  4HIK A;  1TWA H;  2D0P A;  5C3E G;  4JI4 L;  4JBK A;  2R92 H;  3TRE A;  4AQY L;  2JEA I;  1NTG A;  3K80 C;  4IJL A;  4LF7 Q;  4LF8 Q;  4QJF A;  3H0G H;  3UDF A;  4JI8 L;  3KFU A;  1X6O A;  1VS0 A;  4YY3 Q;  1WOC A;  5IYD G;  1YBY A;  3G4S A;  3PF5 A;  2E2J H;  3GTL H;  1BVS A;  1K83 H;  4DV0 Q;  3PUV A;  4LF4 L;  4L5S A;  1S3O A;  1QZH A;  1VCI A;  4XTC S;  3UDX A;  2I0Q A;  5ELN A;  4B3R Q;  4JBW A;  4X66 L;  4NXN Q;  1EQR A;  2N8N A;  3S15 H;  2NN6 I;  1SE8 A;  4LF5 Q;  4A3B G;  5IY0 A;  1IBM L;  5LMN W;  3KF6 B;  1YVC A;  5GRO A;  1Z9F A;  4B3M Q;  3STB D;  1EOV A;  1N9W A;  1N34 L;  2WP8 J;  1YJN A;  4IOA A;  1MJC A;  1GD7 A;  1NY4 A;  4BY1 G;  5IYC G;  3CCU A;  1KAW A;  3BZK A;  1FGU A;  5AJ3 Q;  1C7Y A;  4IPD A;  1WCM G;  2ES2 A;  1C9O A;  1XPO A;  1X3E A;  5IP7 H;  5GAE C;  3T1H L;  2K50 A;  1XNQ Q;  1JE5 A;  3CCV A;  1Y1W H;  2Q2H A;  1C0A A;  1VQ6 A;  1VQ5 A;  4GNX B;  2HQL A;  1HNZ Q;  1PH6 A;  1X65 A;  2JEB I;  3D31 A;  3RLN A;  4A4I A;  4JI3 Q;  4ME3 A;  4KI0 A;  1FL0 A;  1SMX A;  3CPF A;  3AFP A;  1VQE A;  1IBK Q;  4OX9 L;  1QUQ A;  3ER0 A;  1O7I A;  2JA8 G;  1W2B A;  1YJ9 A;  4X65 L;  2ATW A;  3IRB A;  2UXD L;  1JB7 A;  4R4T A;  4A3E H;  3OTO Q;  4BBS G;  3F1Z A;  1E22 A;  4QL5 A;  1SRO A;  2OCE A;  2CCZ A;  2UU9 Q;  3GTK H;  4R4C A;  5IWA L;  4JI7 L;  5FLM G;  3K81 C;  1XTD A;  3A5U A;  1A63 A;  4GN5 A;  1Q1E A;  1OXX K;  2UXB L;  5K36 G;  4NXN L;  5C44 H;  2WAQ G;  4PZ8 A;  1EIY B;  4IO9 A;  4LF5 L;  1KRS A;  1KIX A;  3W5O A;  3ZJY C;  1Q82 C;  4A3D G;  4DR4 Q;  1VQH A;  1VQ9 A;  1PH8 A;  1XPR A;  3CC2 A;  1AH9 A;  1CKN B;  4DAY B;  4JV5 Q;  4DV7 Q;  4X6A H;  4LF6 Q;  4GLV B;  1KD1 C;  3RN2 A;  4X64 L;  4JI5 Q;  5IYB G;  1X3F A;  1PYS B;  3MEF A;  3CCR A;  2YTX A;  4A3C G;  3PIO A;  2ZJQ A;  3K7U C;  2GN5 A;  4A3F H;  2IX1 A;  2BA1 A;  2WAQ E;  3VDY A;  4GKJ Q;  1KXL A;  2E2I H;  1E1T A;  4L5R C;  2Y0S G;  4DR6 Q;  4AH6 A;  1JMC A;  1YHA A;  2JA5 H;  4DK3 C;  3HKZ G;  4GN3 B;  1PH5 A;  4DNI A;  4HJ5 A;  3I56 A;  3S2D H;  1TWF H;  3DM3 A;  3NBH B;  1GKH A;  4A3G H;  2F4V Q;  1WI5 A;  1A8V A;  4A3I H;  2RHQ B;  2UU9 L;  3KDF A;  3J80 i;  4JYA Q;  1HNW Q;  4O0A A;  4YWL A;  1IXR A;  1K3R A;  2YTV A;  4JOI C;  1N33 L;  2CQO A;  2MQH A;  3BZC A;  4JOI A;  3EN2 A;  3HKZ E;  4B3T Q;  4MNO A;  1PYB A;  3F2D A;  1HZC A;  2WFW A;  5IP9 H;  2UUC Q;  4JI6 Q;  3HOU H;  3U4V A;  2RF4 A;  3HOV G;  3CCM A;  4P73 A;  4UP8 A;  5C4J H;  4HID A;  2OTJ A;  3I4O A;  3GDE A;  2VQE L;  4DR5 Q;  2K52 A;  1N32 Q;  5LMU L;  1WFQ A;  4QGU A;  4DV6 Q;  4AYB G;  4DV4 Q;  1CKM A;  2ZTC A;  1AE2 A;  2D0O A;  4AIM A;  5M3F H;  4OWT B;  2A8V A;  4A3K H;  3UE1 A;  4B3S Q;  4PZ7 A;  1Q12 A;  4DV1 Q;  1SRU A;  2R7Z G;  4BY7 G;  2VNU D;  3I7F A;  2AHO B;  4NPS A;  5GAD C;  2WB1 G;  1I3Q H;  2VQF Q;  2ZM6 Q;  4KHP Q;  3J7A 5;  3H3V H;  2GVB A;  4DUY Q;  4LUV A;  4DV2 Q;  3JAM i;  3J80 c;  3HKS A;  2GVA A;  4FDB A;  3I4N H;  2H5X A;  4AYB E;  2AKW B;  5J3B A;  4DR3 Q;  2UUB L;  5JEA G;  3JC6 6;  3NEM A;  3M7N A;  1CUK A;  3H15 A;  1HNW L;  5GAG C;  1K0R A;  4BXX H;  3LGJ A;  3GTJ H;  1CSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...