4JI3L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLWGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji3L00
1KXLA 3KF6A 5DLQE 4HJAA 1QZHA 2KHJA 1A62A 4DV3L 3H3VI 5M5XH 1LTLA 2I5MX 2UXCQ 2KHIA 4AIMA 1SE8A 4DV6L 2VQFQ 1VQ7A 4RMFA 3CCUA 4UY8C 1E7ZA 4A3LG 1TWFH 2N49A 3OTOQ 1U5KA 3ULPA 2JA5G 3RN2A 4DR4L 2B63G 3TRZA 1GD7A 3OYYA 4YWMA 1MKHA 5LMNL 4JYAQ 4PZ7A 4K0KQ 4OXPA 4A3GH 4B3TQ 2WP8J 1EIYB 5IY0A 1IXRA 5JJKA 4YCVA 1E1OA 1UE7A 3H3VH 3B6YA 4X62Q 4A3DH 3EN2A 3RZOH 1WCMG 2E2IH 1YNXA 5C3EG 3SGIA 5BR8Q 1EQQA 4LW1A 4IFDG 2NVXH 3KJPA 1E24A 2PI2A 4P73A 4A3EG 2ZJQA 1Q12A 2R7ZG 1QUQA 2MO1A 1IBKL 4DR1L 1HNZQ 3PUVA 1IBMQ 4DV4Q 1I50H 4YWLA 5M5WH 1FJGL 1NJIC 3GTOH 1N8RC 2VY3A 4AQYQ 5JJIA 1NMGA 2Y0SG 1L0WA 3ZJYC 3H0GH 1A0IA 1KIXA 1AH9A 1HR0L 4IJHA 3NENA 1E3PA 1NE3A 4P71A 4POFA 1K8AC 2IX1A 5IYCH 3G48A 4B3RQ 4A3JH 3K81C 1C9OA 2BH2A 1VQHA 4DR6L 3HOXG 3S1NH 5AJ3L 2A1AA 1X65A 4AYBG 5H1SE 1CKMA 1C7YA 1HNXQ 3BZKA 2YTVA 1XMOL 2E2JH 2VQEL 3GDEA 2RCNA 2Z0SA 1YHAA 3A5UA 1SROA 4LF6Q 3UDXA 3CCEA 3I7FA 2ZM6Q 1Y1VH 1HZAA 2UXCL 1EOVA 4LF8Q 1PH9A 2K5HA 5C4XH 3GTGH 2WB1E 2N3SA 3T1HL 1KRSA 4Y7NH 2E2HH 4Y52H 1QZGA 3STBD 2YV5A 3U50C 4OO1I 1R9TH 2Z6KA 1X55A 4J15A 2Q2TA 4OX9Q 3OTOL 1B70B 4HJ5A 1JMCA 4DV1L 1Q8KA 4JYAL 4K0KL 4BA1I 4KLKA 4OWXB 2I0QA 1JJGA 3F2DA 5GQOA 4DV7Q 2BA0A 1PH5A 1HNWQ 5JJLA 2CQOA 4IO9A 3H0GG 1XMQQ 1U0LA 2EQSA 3CW2C 1OXVA 1CKNA 5IE8A 2UXDQ 3UDFA 1L1OC 1WOCA 1XJVA 4JV5Q 5IYCG 1PYBA 3KOJA 4A3JG 3KF6B 1PH1A 1MIUA 3FP9A 5BR8L 4A3MH 1GKHA 4QIWE 3DM3A 4JI4Q 3KYHC 3F2BA 1K73C 2UXBQ 3GTJH 3IRBA 1PYSB 4DR3Q 4LF9L 4JI2Q 3J7ZC 1VQ6A 3AFPA 2UUBQ 3EBEA 1HNZL 4DV4L 1O7IA 3GTLH 1N36L 1K0RA 1Y1VG 4JI1Q 2LXKA 2MO0A 2RF4A 4HIKA 3HKZE 5M3MH 2XTIA 5C4XG 3ERSX 1X9NA 1TXYA 1XTDA 3A5ZB 2EIFA 4UPAA 3W5OA 4A76A 4LF4L 4B3RL 4WJ4A 3PGZA 5LMUQ 2KENA 3HOZG 1VQ4A 4LFBQ 3KDFB 4B3MQ 1IL2A 1W3SA 2AWOA 5FLMH 4IPDA 1N34Q 2DGYA 2K50A 4JI6Q 2WAQG 4A3KH 1PH8A 2N8NA 4BA2I 1CSQA 4UP8A 2Z6KC 2BH8A 3RLNA 2NN6I 2F4VL 3HOVG 4GLVB 4LF6L 2NVTH 3PIPA 1YI2A 2IHEA 1VQNA 3PV0A 3H15A 2ZM6L 1L1OB 4A3MG 1XNQL 1SFOH 4BY7G 4DR5Q 1A63A 1VQMA 1OXSC 1YEZA 1M90C 1KRTA 1VQDA 1G51A 2PQAB 3CCSA 3PUYA 2VW9A 1IBLQ 4QQBX 5IP9H 1G291 1RL2A 1X6OA 3U4ZA 1S72A 2ES2A 1MJEA 3S17H 1AE3A 4LUOA 1VQGA 2UUAQ 5M3MG 4C3HH 3CD6A 1EIFA 4DV7L 3T1YQ 2PI2E 4YHHQ 3CF5A 3S1RH 2UU9Q 4LF7Q 1HNWL 1XMQL 3HFZB 1LUZA 4JBJA 4BBSH 3CCQA 3KF8B 4NXML 2V1CC 3K7AH 3TREA 4JV5L 2DUDA 2VUMH 3OW2A 3HOYH 3CC2A 4GNXA 5IYDG 5FLMG 5M3FG 4A3FG 2JA6H 3RZDH 4LFAL 4DR7Q 2CCZA 4JI4L 4A3KG 4LFCL 3CMEA 1N32L 2UUCL 1ASZA 4DR3L 4TQUS 1B7YB 5IP7H 4DUYL 1BBWA 2OTJA 5IWAQ 1YJWA 4UP7A 3M85A 2R7FA 2CWAA 1NY4A 2EXDA 2IT1A 1I94Q 4L5QA 2K5NA 1IZ6A 1SN8A 3KLWA 2R7DA 2PNHA 2ID0A 2K14A 4R1JA 1W2BA 4JOIC 1CKOA 3TQYA 4R4OA 2FXQA 5IP9G 5LMUL 3TS2A 2Q2IA 3NBHB 4B3ML 4GKJQ 3A0JA 4JBWA 1GVPA 2QGQA 1Q1BA 4JI6L 2JQOA 1EUJA 3KFUA 4JI8Q 3RNUA 2R92H 2D62A 1TWHH 4DUZL 4B3SQ 3J81i 2VUMG 5IT9c 4R4TA 2HT1A 4YCUA 2PMZE 3UE0A 3S16H 1Y14B 4X65Q 2A8VA 2JA6G 3HOUH 4ME3A 1Y1WH 1JT8A 2E5LQ 3CQZH 2XGTA 2ZJRA 3PO2H 4A3GG 1NBWA 5IP7G 2YYZA 4YWKA 1XPUA 1OXXK 4LF5L 1VQBA 1K3RA 4A3CH 3M4OH 1IBLL 3L2PA 4GLAC 2WFWA 4DR2Q 3CCMA 1GM5A 4A3DG 4X66Q 3T1YL 2K5VA 3J80i 4YHHL 4BBRH 2JA9A 2UU9L 4C3IH 2NVYH 2VQFL 3AEVA 4L5SA 1IYJB 1XPOA 1WJJA 3UDIA 3CP0A 1C0AA 3AYHB 1YIJA 1ASYA 3AQQA 2JA8H 4PMWA 2R93H 1VCIA 3J81j 1PH7A 2OWOA 4JI5Q 2KCMA 4DR7L 4H02A 1CUKA 1HR0W 2QEXA 4B3TL 5ELNA 4MNOA 2R92G 4JBMA 5C0XI 1FL0A 2LSSA 1KHIA 1HZBA 1SR3A 1VQJA 1E1TA 5J3BA 1WI5A 5IWAL 4HIDA 4X62L 4HJ8A 1HZ9A 4BY1H 4JI3Q 2IY5B 2VS1A 1E22A 2K4KA 4UP9A 3MXNB 5GADC 4DV0Q 1I94L 1YHBA 3K7UC 1KD1C 3STBC 4C3JH 3NELA 3JC66 4YY3Q 1YVCA 2R6GA 2I5HA 3DLLA 1PH2A 1G6PA 3M9BA 1UWVA 2QA4A 1IBML 1PFSA 2CFMA 4AH6A 2K75A 3PO3H 1K83H 4P74A 3M7NA 4OWWB 1I3QH 3CPFA 4DNIA 4AQYL 1KAWA 1YZ6A 2OQKA 2VZAA 3FKIH 4PZ6A 1TWGH 3PUZA 1PA6A 4LWCA 2C35B 2ZTDA 4B3SL 1X54A 4GN4B 4OWTB 3RR5A 4DR4Q 2F52A 1WYDA 4X65L 3K0XA 3M4PA 2JA8G 1EFWA 4KHPQ 2R93G 4DV2Q 1VQCA 4HIMA 3PSIA 3PF4A 1HNXL 3I55A 2CKZB 4DAMA 2A19A 2ZJPA 1QUQB 1X3FA 3PUXA 3I4NH 2HIXA 2D0OA 2OTLA 1TWCH 2MQHA 4P72A 4X66L 2Y0SE 2ZTCA 1RIPA 4DK3C 3RN5A 1EYGA 4LF8L 2KCTA 3S1QH 4OO1G 4C2MH 1PH3A 3E9HA 1YITA 1J6QA 4IFDI 1WFQA 2HQLA 4R4CA 1EWIA 3GO5A 4OX9L 1FJGQ 1S40A 1YJ9A 1VQLA 3PO3G 1I5FA 1Z9FA 1PHJA 2I5LX 3FHWA 4AYBE 2LXJA 5JEAJ 2BA1A 4XTCS 3FKIG 1VQKA 4KHZA 4HJ9A 4GN3B 4QL5A 3TS0A 3S1MH 2WB1G 1VS0A 1HR0Q 2UXDL 2NZHA 4JI3L 2GVBA 1BVSA 2JEBI 5C3EH 1M1KC 3CCJA 3VDYA 4IJLA 3J81c 3U58A 1MJCA 2NZOA 1FGUA 4JI7Q 2UXBL 1SMXA 4YCWA 4QGUA 4L5RC 2R7ZH 4JI2L 1Q82C 1VQIA 4FDBA 2VQEQ 1VQPA 1Z47A 2UUBL 3I4NG 2HHHQ 1J5EQ 1P16A 1XNRQ 5E7NA 2JEAI 3CPWA 4NB3A 4JI1L 1VQ8A 3KJOA 1K8GA 1P8LA 4OONA 3T1HQ 1YBYA 3M4QA 1H95A 3G4SA 2YU9H 4A3IH 1OXTA 3BU2A 1HJPA 1UEBA 2RHSB 1CKNB 3J80c 4BXXH 3S2HH 4LFBL 3ICEA 4DV1Q 4KHPL 3JAMi 2K52A 4DV2L 1N9WA 2AHOB 1N34L 2ALYB 3NEMA 2NN6G 3E9IA 5FJ8H 3HOXH 2AWNA 5M5YH 3HKZG 2MFIA 2B29A 2KBNA 4BBSG 1OXUA 4PG3A 4A3BH 4JI0Q 4GLXA 3S2DH 5HGQA 3KDFA 1V9PA 5LMNW 3HOYG 3W1BA 4ALPA 3S14H 3A74A 4POGA 1UE6A 4GOPA 4LUZA 1VQFA 2IX0A 2GN5A 4O0AA 4DR5L 2RHQB 4IPHA 4LF9Q 3CCVA 2D0PA 3UDGA 4DPGA 5JEAG 4X64Q 4A75A 4GNXC 1L1OA 1GO3E 3J7A5 5FLXc 1UE1A 1N36Q 3PF5A 2WAQE 1KL9A 3G71A 4EQ5A 3RLOA 3Q8DA 2UUAL 1EQRA 2AMCB 4KI0A 1HZCA 1LM0A 4LF7L 3M3YH 4A3IG 2PQAA 1Q86C 1UE5A 1A8VA 1KQSA 3UE1A 4LF4Q 3D0FA 1D7QA 1S3OA 4BXXG 4IOAA 3HOWH 1V43A 3RLFA 1Q7YC 5FJ8G 1I6HH 1VQEA 1VQ5A 1N33Q 2F3IA 4JI7L 3GTKH 4GKKQ 2B3GA 4O2DA 4L5TA 4GN5A 4IPGA 2E8GA 4A3BG 4NXNQ 2F4VQ 2VNUD 5C0XJ 4PZ8A 3G6EA 2HHHL 4X6AH 2VL6A 3L7ZC 3U4VA 1PH6A 1J5EL 1XNRL 4A93H 1X56A 4P75A 1B8AA 5IYBH 1JJCB 4DV5Q 3F8TA 1Y1WG 1XNQQ 3HOUG 4JC0A 2N78A 1QVCA 3L0OA 3GD7A 3PO2G 1VQAA 2OCEA 5GROA 3CC4A 4A3CG 3AFQA 4A4IA 4MTNA 3CXCA 4IPCA 1PVOA 3I2ZA 1Q46A 3D31A 4GOPC 4DV3Q 1PH4A 1JJ2A 3HOZH 3LGJA 1K9MC 4GKJL 3PUWA 4DKAC 5EAYA 3HKSA 4GNXB 2JA7H 4DV6Q 1JE5A 4BBRG 3GTMH 1L2FA 4MZ9A 4QY7A 4JI8L 1AE2A 3CMAA 1T9HA 2L15A 3S15H 4NXMQ 1PV4A 2OQ0A 2IHFA 2AKWB 4JI0L 1CSPA 3GTQH 5HY6A 3HOVH 2CWPA 4RG1A 2NVQH 3HOWG 4IOCA 1Q81C 1VQOA 5C44H 1QVFA 3K8AA 2ASBA 2JJQA 1SRUA 2ZTEA 4GS3A 2JE6I 4LFAQ 3WWVA 5LMNQ 1N32Q 4LFCQ 4APVA 2E5LL 4BY7H 4HIOA 2UUCQ 3I4MH 5GAEC 3I56A 3BJUA 1YJNA 1YHQA 5K36G 4DUYQ 3PCOB 2YTXA 4BY1G 1V1QA 4X64L 1NTGA 4DR2L 3F1ZA 3GTPH 4A93G 5IYBG 1X3EA 2Q2UA 4NPSA 5GAGC 1Q1EA 4QJFA 1VQ9A 3BZCA 4EX5A 3W1GA 2HIVA 1KC8C 1DGSA 4WJ3M 1LYLA 4HJ7A 1JB7A 3TEHB 2YTYA 1IBKQ 4IFDJ 4A3LH 4DR1Q 1FVIA 3K80C 1XPRA 2GVAA 2JA5H 5C4JH 2B63H 4A3FH 5M3FH 5IYDH 3PIOA 5GAHC 4JCVE 4DAYB 1D8LA 4JI5L 5C0XG 3CAMA 1SLJA 4GOPB 1N33L 2JA7G 4GKKL 2ATWA 2JK8A 3I4OA 1BBUA 3ULJA 1BKBA 3S24A 3ULLA 4NXNL 4TVAB 3JAMc 3CCRA 4DUZQ 3F2CA 1HH2P 4JOIA 1TWAH 4R4QA 3MEFA 1WCMH 5C44G 4DV5L 3EIVA 1OTCA 4DK6C 1X3GA 4DV0L 4LNQA 4DR6Q 2Q2HA 3I4MG 4XIGS 3CCLA 3E0EA 3ER0A 4R4IA 5AJ3Q 2MNAA 4JG2A 4A3EH 4LUVA 4LF5Q 4YY3L 5ELOA 3CC7A 1NMFA 1XMOQ 4JBKA 2H5XA 1QVGA
chains in the Genus database with same CATH superfamily
5CGKA 4HJAA 1A62A 1Y1VB 2DY8A 3OMCA 4N8X1 1SNDA 2F0JA 2KHIA 3TZUA 4XT3B 2VQFQ 3RMHA 2RDHA 3FPUB 1E7ZA 5IT9E 1TWFH 3ULPA 1U5KA 2JA5G 1JE4A 3BDLA 1WTXA 4FXDA 4JYAQ 4K0KQ 4OXPA 1PZKD 2FJ2A 4B3TQ 1NR4A 2K7VA 1IXRA 4YCVA 3H3VH 3GTQB 3IAYA 1RCVD 1EIGA 5I4DA 1TS2A 5J1ZA 5C3EG 1STHA 3SGIA 2MGSA 1EQQA 1HHVA 4BY7B 2PI2A 1O7LA 2F0FA 2SEBD 4X3KA 2K6AA 3BS1A 1IBMQ 4RGTA 3K57A 1PZJD 1D2BA 3MVVA 1SSOA 1A2UA 3MXUA 3OOCA 3H0GH 1XXGA 1HR0L 4IJHA 1K8AC 1NE3A 4P71A 4B3RQ 3K81C 1C9OA 3A7AB 3S1NH 2M9VA 4JK1C 3VR2A 1SROA 2ZM6Q 2B2VC 1HUMA 2L12A 5EPJA 5JPNC 1KRSA 4NDXA 3STBD 5KGUA 5DEHA 2Z6KA 4OX9Q 1TIID 1B70B 1JMCA 4KY6A 5KYIA 1Q8KA 4ODGA 4JYAL 5C5LA 4K0KL 5IGEA 1HNWQ 2CQOA 2M2LA 1XMQQ 4MN3A 2EQSA 1CKNA 1L1OC 1WOCA 1PYBA 3KOJA 4A3JG 3J7AF 1CZWA 1PH1A 4A3MH 1F9QA 1GKHA 4OO1H 2IPKD 2Z6BA 3DM3A 5JOBA 1H9RA 3I91A 1CFMA 2LY7A 2EXZA 1U4PA 2JP1A 3GTLH 5CV9A 1K0RA 1Y1VG 2LXKA 2RF4A 2RCFA 4U68A 3DUZA 3SK4A 4QUFA 2KVMA 4M1UB 1X9NA 2BCOA 2EZVA 2EIFA 4A76A 4B3RL 3PGZA 4RCNA 3KDFB 3HZXA 4IPDA 2K50A 3EVQA 3NE5B 1H9SA 2N8NA 4KJNA 5IGFA 2NN6I 3C1FA 3OHXC 1DOKA 4GLVB 1FR3A 2ZM6L 3Q22A 4BY7G 4G57A 2Z4HA 2IL8A 1YEZA 2Q8RE 4HEDA 5E4XA 3CCSA 2EYHA 1STAA 1LLRD 5IP9H 1S72A 2H4OA 1BF4A 3S17H 1EIFA 1HNWL 2NVYB 2NBFA 2A6EC 2N55A 1XMQL 3HFZB 3KF8B 2V1CC 3MZ5A 3OW2A 4RGNA 2R93B 1HPCA 3RZDH 3EJIA 2CCZA 4TQUS 5IP7H 4FF1A 4DUYL 3CKIB 3FDTA 1BBWA 5D65A 1A6XA 5IWAQ 3R3OA 5FLXE 4UAIA 2CWAA 1NY4A 2IT1A 2JXMB 3P75A 1I94Q 2BOSA 4L5QA 3KLWA 2R7DA 3K5MA 1F9PA 4H0LC 1W2BA 2E74C 1KDBA 3PO3B 2O4XA 5A2QL 1K83B 3I3CA 3FVQA 3GTLB 3NBHB 1CT1D 3A0JA 2QGQA 4KN4C 4NW2A 4EQPA 1TWGB 3RNUA 1B53A 2WB1B 3T51B 1IL8A 5K5PA 4B3SQ 4QB4A 2HT1A 1V1PB 2PMZE 3I72A 5EQ0A 1Y1WH 1D5MC 2XGTA 3PO2H 2ZXRA 1ML0D 2EJMA 4A3CH 3I4NB 2WFWA 2RVLA 1WTHA 4HSVA 5DNFA 4O42A 3J80i 2JA9A 4C3IH 5E4WC 4L5SA 1IYJB 3L9AX 4KTAA 3CP0A 3AYHB 2PCFB 4IZ8A 3S17B 2EYFA 2EDGA 3Q0AA 1EY4A 1PRTD 2MUYA 4FF4A 4JI5Q 1WTVA 2JA8H 4H02A 2L9HA 2QEXA 5ELNA 1BQQT 5IGDA 1DXMA 1FL0A 1SR3A 1WI5A 5IWAL 4X62L 2IY5B 4TKOB 5CBEE 4UP9A 1B9MA 4IALA 3H6MA 5GADC 1I94L 1IKMA 2SNSA 3STBC 3NELA 4S3SA 4YY3Q 2I5HA 3M9BA 2QA4A 1VF5C 2QCPX 3QB3A 1MGSA 3M7NA 4CKEA 2NUCA 1I3QH 4AQYL 1KAWA 4MTKA 3T16A 4PZ6A 4XQQA 3H09A 3HGBA 3PUZA 3BDOA 1PA6A 4B3SL 3RR5A 4K8IA 4DR4Q 1WYDA 4WORA 3MHBA 2R93G 1VQCA 1F2YA 3PSIA 3PF4A 1L0YB 3QR8A 4A3BB 2A19A 1W6JA 4DA2A 1Y1WB 2F0QA 1TWCH 4P72A 2ZTCA 3RN5A 4OO1G 3PO2B 4LF8L 3DWAA 4IUPA 4NKLA 5KIXA 1STNA 1EEFD 1QNKA 1EWIA 1O78A 4KD3A 3PO3G 1S40A 1SMYD 1S5FD 2I5LX 5FO7B 2LXJA 5JEAJ 2TMPA 4XTCS 1S5CD 4KHZA 4HJ9A 1GUOA 2WB1G 5CR3A 1K28A 2G9HD 1CI3M 4FXKC 4WFN3 4FVMA 4XXEA 1IYUA 4IJLA 3J81c 3U58A 4DF7A 1D5ZC 4K5VA 3BVGA 2G9DA 1SMXA 2QEJC 4KN7C 4JI7Q 4JI2L 1Q82C 4FDBA 4V0BA 2F03A 2UUBL 3NQIA 3I4NG 4RCOA 2BDOA 2I46A 2K32A 3CPWA 3P20A 1YNJD 1K8GA 3ERQA 1YBYA 1UEBA 2XRSD 3PMFA 1ILPA 4I65A 4HCSA 1EU3A 3JAMi 1N9WA 2AHOB 1PTOB 1HA6A 2B2VA 3E9IA 1M8AA 2F0NA 1ICFB 2MFIA 3BYYB 1KLGD 4PG3A 1QB5D 1XX8A 5EKIA 4GLXA 4OIKA 5JVG3 3I73A 5FK9C 2K5WA 1CA5A 1RTNA 2B2YC 2RHQB 1I4GA 1K3BC 2D0PA 2IX3A 2OXPA 3UDGA 5JEAG 4I7ZC 4GNXC 1L1OA 2VXWA 1TWCB 3PF5A 2A69D 1EYDA 1STYA 1EQRA 2AMCB 4KI0A 1YNND 2PQAA 1UE5A 4LK1C 2K33A 4CDEC 2B63B 3HOWH 4IOAA 1EQVA 2PNRC 1RF2D 4JI7L 2Z9HA 2B3GA 4F8MA 4IPGA 4A3BG 1QNUA 1O7ZA 3LX0A 3U4VA 1PH6A 4CBVA 2R3ZA 1B8AA 3MXGA 1Y1WG 4X3TA 4U673 4A3EB 3L0OA 3PO2G 1VQAA 3E5SA 1HQMC 1BXTA 4A3CG 3AFQA 4MTNA 3CXCA 1UAPA 1PRTC 1STGA 2EJGC 1SNPA 3I2ZA 3K58A 4GOPC 1LTSD 2Q8IB 1PH4A 1JJ2A 3HOZH 3LGJA 3O13A 4RKBA 1K9MC 3MEHA 4GKJL 3HKSA 5ELBA 5CBAE 1L2FA 4MZ9A 1ET6A 2L15A 4NXMQ 4JPBW 3AU7A 1U4LA 3HOVH 2CWPA 4RG1A 3CRKC 3KLSX 1VQOA 5C44H 4K2KA 5EKLA 1N32Q 2JE6I 4DK1A 1SYEA 5GAEC 2O2LD 4K5WA 1L0XB 1H9KA 1V1QA 1A3VA 1X3EA 4H7BA 4QJFA 2XWBB 5C3XA 1KC8C 2LS01 1JB7A 2K03A 4IFDJ 2ZT9C 1I50B 1XPRA 1NCVA 4IUTA 5C4JH 2JA5H 4A3FH 5IYDH 4KD4A 1SLJA 3WDNA 2EJFC 4C56C 3SK5A 4LAAA 1HH2P 4MIUA 4UDUC 4C1NK 5IGGA 4P2CB 1S5ED 1X3PA 4DV0L 2O5IC 4K2LA 3EFXD 4JBKA 1SMYC 5KNCA 5ELCA 3KF6A 3SVMA 3MXNA 1C4QA 3H3VI 1SJHD 5C4XB 2UXCQ 1NSNS 5CMDA 4CDDC 1VQ7A 1R9TB 3CCUA 3HP3A 3HOZB 2N49A 3OTOQ 5EPLA 2B63G 1GD7A 3OYYA 4YWMA 4KKTA 1QWYA 1II3A 4A3GH 2WP8J 3A8KE 5JJZA 4CJ1B 3MFYA 1UE7A 3HOVB 1BDOA 3B6YA 3D4DA 3RZOH 4R8IA 1EYAA 4IFDG 5DM73 1E24A 4P73A 4A3EG 2ZJQA 1Q12A 5HGTA 2MO1A 3H91A 3PUVA 1HNZQ 4DV4Q 1NJIC 3D3RA 1SYFA 2HQEA 2J7ZA 1L0WA 1NNXA 1KIXA 1AH9A 1XWEA 4A3JH 1BR9A 4A3FB 1VQHA 2F0EA 3TSSA 2O5JC 2EYOA 4EQNA 1CKMA 3VR5A 3BZKA 2E2JH 2A69C 2Z0SA 4LF6Q 3UDXA 2Z4IA 1SDFA 1UUPA 1Y1VH 1HZAA 1YNNC 2UXCL 3NBIA 2F1MA 1PH9A 1RTOA 2WB1E 1RDPD 2N3SA 3T1HL 4OO1I 5KEEA 4J15A 2Q2TA 2F0WA 3OTOL 4DV1L 4C3HB 1K8MA 4JVZA 3F2DA 4DV7Q 1PH5A 1GHKA 4WRDA 2KHSA 3QWNA 3CW2C 1OXVA 2K1BA 1XJVA 4JV5Q 5IYCG 4ZAIA 2JA6B 1H9JA 4K5XA 2NTTA 1MIUA 2F0PA 3FP9A 4PNYA 3A54A 4A3GB 2UXBQ 1K73C 3IRBA 1PYSB 4L6TB 3W2DA 4LF9L 2TSSA 1E2WA 1HNZL 4DV4L 5HURA 2C9OA 2IW3A 4JI1Q 3GQBA 1S5BD 5C4XG 1S5DD 4V190 1XTDA 4WJ4A 4LFBQ 4ZKCB 3HOZG 4B3MQ 4IN3A 1Y8OB 2AWOA 1PTOD 1WD1A 2DGYA 1Y8NB 2RDFA 1F2MA 2R92B 1CSQA 4UP8A 4KV6A 2BH8A 3RLNA 1CQFA 1EY7A 1EZ6A 2BE5D 3CHBD 3HOVG 3S16B 4LF6L 1YI2A 4G4KA 4L63B 3PV0A 2DN8A 4KMUC 2ZXPA 1ESRA 1OXSC 5JVH3 4H13C 1VQDA 2RA4A 3A7LA 3PUYA 3AMUA 1IBLQ 1RL2A 1X6OA 2IJ0A 4DNRB 2ES2A 2Z8LA 2CQAA 1AE3A 1VQGA 2UUAQ 1GHJA 1JJGA 1G91A 4DV7L 4YHHQ 2WINB 3CF5A 2UU9Q 4BBSH 3CCQA 3OIQA 4JV5L 4DGZA 3HOYH 4GNXA 5IYDG 1EY5A 4A3FG 4FF2A 1A3UA 2EVBA 3CMEA 1ASZA 1FNWA 4EGVA 2X6LA 1EZ8A 1EQTA 2SDFA 5ELEA 1RHPA 4C3JB 3OW7A 2K5NA 1SN8A 1GUNA 1BOSA 2K5QA 3QJYA 2K14A 2R61A 1CKOA 2FXQA 3D6WA 2Q2IA 1HFGA 4B3ML 1GVPA 2OF1A 1Q1BA 3BVMA 4C3HG 1EL0A 3FKIB 4L8JA 4JI8Q 4DUZL 3I4LA 4R4TA 3U9OA 4YCUA 4X65Q 1JT8A 2A8VA 2JA6G 3HOUH 2E5LQ 2ZJRA 4A3GG 4OEMB 1XPUA 1VQBA 1K3RA 1SYCA 3C3LA 3M4OH 2A74C 1IBLL 3L2PA 3LWUA 1PXUA 4CHTB 1PFMA 4YHHL 4QIWB 2UU9L 2NVYH 2VQFL 1XPOA 1C0AA 5C3WA 2QF7A 2QILA 4IUUA 2KECA 1YIJA 1ASYA 4N8FA 3AQQA 1O80A 2R93H 4ZK9B 1PH7A 2OWOA 1AP0A 4B3TL 3S1MB 4B9XA 2OEOA 4BBSB 4MNOA 2R92G 4JBMA 1AEXA 3DXJC 5K36H 2EE1A 3HOYB 1HZ9A 1WTPA 2AQ3B 2K4KA 3K7UC 3JC66 4HSPA 4RA8A 1EFID 1WTWA 1BNZA 1UWVA 1PRTF 1PFSA 1IBML 3PO3H 4ZUIA 1K83H 4P74A 1SE4A 4KKSA 4G7ZC 4OWWB 2QKIC 4DNIA 1YZ6A 2OQKA 4A3IB 2YU9B 2VZAA 1TWGH 3WOEA 1EWCA 1X54A 2F52A 4X65L 3K0XA 3M4PA 1EFWA 1VDZA 4DV2Q 2B2WC 2WIIB 1DYQA 2OT2A 3S2DB 3I55A 2CKZB 4DAMA 2XSCA 1QUQB 3PUXA 4H44C 3I4NH 3HOUB 5DM63 2F0KA 2VB2X 4OHJA 4DK3C 4C3JG 4K6DA 2F0IA 2KCTA 2B8GA 4C2MH 3E9HA 1YITA 5BN4A 2F3VA 2EY6A 1J6QA 3PQIA 4IFDI 3M4OB 4R4CA 3GO5A 4OX9L 1PTOC 1FJGQ 1YJ9A 1SEBD 4CKBA 5CC4A 1HTPA 2A68D 3FKIG 2BE5C 1VQKA 5FO8B 5CV5A 1VS0A 3A8JE 2JEBI 3IFDA 4XYQA 4JW0A 1QG7A 3HS0C 3VDYA 3DEPA 2NZOA 4YCWA 2VQEQ 3NP8A 1VQPA 5JEAH 4A93B 1XNRQ 3C1EA 2JEAI 4OONA 1FNVA 3J80c 2EY5A 4WJWA 3ICEA 3NPPA 2K52A 4DV2L 1TQOA 2ALYB 3GTMB 1HA5A 3HOXH 3CU7A 2KCCA 4BBSG 1OXUA 4A3BH 4JI0Q 1BCPB 1ZYRD 1E2VA 3KDFA 3DHQA 3HOYG 3W1BA 3S14H 2MJ8A 3C46A 1VQFA 3GV6A 1MBYA 3OPOA 3NWTA 3GV3A 4HMIA 3JAML 3GTPB 4X64Q 1GUGA 1GO3E 1EYCA 4DAPA 1N36Q 3G71A 3MTSA 3J7YW 3Q8DA 4C2MB 2KCNA 5T1IA 3J81L 4A3IG 1A8VA 3BDCA 1KQSA 2B2UC 3UE1A 4LF4Q 3D0FA 4ILWA 2ICEC 1EY8A 1V43A 5DAUA 3KF8A 1LTAD 3KLSA 2F0MA 4GN5A 2VNUD 1LTID 4NXNQ 2F4VQ 4PZ8A 1LTBD 3G6EA 1WCMB 3L7ZC 1XNRL 4DV5Q 1XNQQ 3HOUG 2PPBC 4RWSC 2B2TC 4RHSA 3FPPA 1CTMA 2OCEA 3NK9A 3CC4A 4DXFA 1DD2A 3T4AC 1SE2A 4IPCA 5KNBA 1PVOA 1W6KA 1I4RA 5KYLA 5EAYA 2PZUA 2Y0SB 1JE5A 1PTOH 4QY7A 1AE2A 3S15H 3G7LA 3GP7A 4JI0L 4KKUA 3V05A 4EVOA 5HY6A 3NBHA 5D3IB 2DNCA 2NVQH 2D9UA 3K8AA 4DU9A 3WWVA 4LFAQ 3HOXB 4LFCQ 3D4RA 4AYBB 2UUCQ 3BJUA 2XIWA 5K36G 3PCOB 2PYKA 2YTXA 1V1PA 4X64L 1NTGA 3S14B 4DK0A 4A93G 2Q2UA 4R8NA 5C4ZA 1VQ9A 3W1GA 2HIVA 1DGSA 3DM1A 4HJ7A 3TN2A 1EOTA 3OWEB 1IBKQ 3GTOB 4QMGA 4DR1Q 1K8OA 2A6HD 2F3WA 1SXTA 3MAQA 2B63H 3AB9A 3PIOA 2PZWA 4DAYB 1CM9A 4JI5L 3I4OA 3NXWA 1ILQA 3S24A 3JAMc 4NXNL 1ZXTA 1V8QA 1KNEA 1MSHA 4R4QA 3MEFA 1FGBD 4ULLA 4DV5L 4DR6Q 4LNQA 4IFDH 4ZKBB 1RKNA 3SEBA 4R4IA 3ER0A 5AJ3Q 2MNAA 4A3EH 3J7AV 4LF5Q 4YY3L 5ELOA 3CC7A 4PZ7A 1QVGA 2FMMA 1KXLA 5DLQE 2LFNA 2KHJA 5M5XH 2A68C 1LTLA 2I5MX 3GTGB 4AIMA 1SE8A 2E2HB 2KA7A 2F0TA 4XQJA 2Z1CA 4OL7A 4DR4L 2DJFC 4HMJA 5EKKA 3TRZA 1MKHA 2D5DA 4O1NA 3SR1A 3S15B 3Q23A 3CRLC 4CDCC 1BO0A 2NVQB 4A3DH 3EN2A 1WCMG 1Z7TA 5BR8Q 4LW1A 2NVXH 3KJPA 3GTJB 3F2UA 1IBKL 1ENCA 1F77A 2CW0D 4DR1L 1C8CA 2I07B 1I50H 3NWSA 4YWLA 3K6OA 5M3MB 2L1BA 1E0BA 2Y0SG 1ZYRC 3ZJYC 3A56A 3H94A 3OMGA 3OWFA 4XDXA 5CYUA 2IX1A 1G2SA 1ZKOA 4ME5A 5IYCH 3IL8A 4DR6L 2XNAC 4A3KB 5LL6S 3HOXG 5AJ3L 1TU2B 2A1AA 4AYBG 5H1SE 1C7YA 1HNXQ 2C5CA 1ONLA 2KUMA 2RCNA 1YHAA 3A5UA 3CCEA 4N9TA 1DJRD 1D1IA 3I7FA 4IUQA 1T5XD 1EOVA 1MHWC 2B2WA 2K5HA 5C4XH 2EYLA 2YV5A 1R9TH 1WVLA 3K5LA 4F88A 1FYCA 1LACA 4HJ5A 5M5XB 1IHZA 2RBMA 3UI2A 2I0QA 5GQOA 5JJLA 2EY2A 1U0LA 3VA7A 1KABA 2UXDQ 5A2QE 2VUMB 3KF6B 3KBXA 5BR8L 2EYMA 4QIWE 4JI4Q 3NTIA 3R2TA 1V1OA 3MXPA 1KNAA 2CH4A 4J6HA 1VQ6A 2HD3A 3EBEA 1D6EC 4A3DB 2PW7A 4PMCA 2NVXB 2MO0A 4HIKA 1TKWB 2XTIA 1DOLA 1DZ1A 3TZDA 3ERSX 3RUZA 1EY6A 3W5OA 5TSSA 5LMUQ 2A73B 2KENA 2WACA 1VQ4A 1IL2A 1N34Q 5A35A 3IFTA 3J81E 1PH8A 3ITPA 2Z6KC 2J4XA 1I4HA 1BCPD 2AQ2B 1SNCA 1SNMA 2NVTH 3PIPA 3TP7A 1EWHA 4KY7A 3SXHA 3H15A 5CV7A 4DN4M 5CORA 4ZLTF 1VQNA 1SFOH 2KJXA 4DR5Q 1JOKA 1VQMA 1M90C 2A6HC 1KRTA 1G51A 2SNMA 3D4WA 1PTOF 3U4ZA 5M3MG 4C3HH 3T1YQ 1A2TA 4LF7Q 1LUZA 4JBJA 3MFGA 1Q90A 4NXML 3K7AH 5ISRA 3TREA 2HCIA 1DM0B 4IUVA 5EPKA 1KDAA 1RD9D 1F9SA 2DUDA 1NUCA 4ZQ3A 3BZDB 5FLMG 3K5NA 2JA6H 1N32L 3I70A 1JOOA 4JI4L 4A3KG 2EYPA 2N88A 3MWYW 3SK8A 3SE0A 1YJWA 1YNJC 4UP7A 3T53B 1S4ZA 4FNFA 4YIJA 2PNHA 1JCKB 2F0HA 4JOIC 5FO9B 1EIHA 4NP5A 3ND8A 4R4OA 1RODA 5LMUL 4PQXA 3TS2A 2B39A 4JBWA 3DWQA 1Q8IA 2JQOA 1EUJA 5EGTA 4CJ0B 3FMCA 2R92H 2D62A 4MHEA 2VUMG 5IT9c 3S16H 1HCZA 3N6RA 4ME3A 1B2TA 3CQZH 4YWKA 1QE6A 2FINB 4ABNA 2NVTB 5COYA 4RHRA 3CCMA 5I2XA 4DR2Q 4J1MA 1GM5A 4A3DG 1SFOB 2DJGC 4X66Q 1JORA 1TR5A 5E3FA 3FEWX 3T1YL 2K5VA 4HTHA 4BBRH 1D5XC 4XQNA 3AEVA 2Q8TA 1JR0D 3P7JA 2V4DA 1STBA 5KNDA 3J81j 4IURA 1NAPA 2KCMA 1HR0W 2XVSA 3HKZB 3K7AB 1KHIA 1VQJA 1HZBA 2LSSA 5J3BA 4BY1H 4HIDA 4JI3Q 3OIPA 2VS1A 1E22A 1YHBA 4C3JH 1YVCA 2R6GA 3DLLA 1PH2A 1G6PA 2ICIA 2QDBA 2K05A 2AQ1B 2CFMA 4AH6A 2K75A 2ZXOA 1G2TA 5C4HA 3SK6A 5C0XH 3SDZA 3FKIH 4RKLA 4DAVA 3S2HB 4RH6A 4HIMA 1B1ZA 1VMCA 1AZPA 3N52A 2ZJPA 2HIXA 1LV9A 2D0OA 3R2IA 2OTLA 3EQLC 1DCZA 4X66L 1EYGA 2Y0SE 3CQZB 1RIPA 3S1QH 1QILA 5D14A 4OIJA 1VQLA 1PDQA 1Z9FA 3D8GA 4CJ2C 4AYBE 4BBRB 4QUCA 1TS4A 3VYRA 1BCPC 2PW5A 5I6YA 4R9WA 4GN3B 3TP8A 2B2YA 3S1MH 2A6ED 1HR0Q 1PYWD 4JI3L 4HCEA 1BVSA 1GOZA 4K6LA 3HEJA 1J9OA 3ZYYX 1FGUA 2UXBL 1U9RA 3WOFA 3T13A 4QGUA 4L5RC 2R7ZH 2NYZD 1VQIA 4BY1B 3TMEA 3NTKA 5FOBB 1J5EQ 1P16A 1XTCD 1WTQA 4NB3A 4JI1L 2DY7A 2RSNA 5IIFA 3M4QA 3G4SA 2YU9H 4A3IH 1IYVA 1HJPA 2RHSB 1LT3D 5BN5A 5I9PA 1TY0A 1CKNB 3X3MA 3D6CA 1O7YA 4LFBL 2JA7B 2QW7A 4DXGA 5M5YH 3HKZG 4IQZA 2B29A 1VF7A 5IODA 3S2DH 1V9PA 5LMNW 4TRDA 4ALPA 3A74A 3KUPA 4GOPA 4LUZA 3I4MB 2GN5A 4O0AA 4RGMA 4X3SA 2K5DA 4ZRZA 4CDFC 1VMPA 5FLXc 5G3LD 1KL9A 3S1QB 5D3DA 3RLOA 2UUAL 4Z9CB 1HZCA 1LM0A 1G8ZD 1H9SB 3TP6A 4FF3A 1JC7A 1D7QA 4BXXG 3R8BA 3RLFA 2NWGA 1Q7YC 5FJ8G 3OSOA 5J22A 3GTKH 4O2DA 4L5TA 1QJOA 1TWAB 5C0XJ 2F0DA 2VL6A 1J5EL 1SAPA 1WTRA 4A93H 1X56A 4P75A 3J80L 1JJCB 4J8QA 4JC0A 3GD7A 2F0VA 1U4RA 2R7ZB 2F0GA 1Q46A 3D31A 4DV3Q 3PUWA 4M8AA 4DV6Q 2KEEA 2LMCB 4BBRG 3GTMH 4JI8L 3CMAA 1T9HA 2OQ0A 2IHFA 2AKWB 1TWFB 1CSPA 3LWEA 3M4YA 2XN9C 4IOCA 2ASBA 2JJQA 1SRUA 2RKSA 1Z6HA 2ZTEA 5I9OA 5LMNQ 2E5LL 4HIOA 3TBIB 5M5YB 3I56A 1A3TA 1NR2A 4DUYQ 3URYA 4BY1G 1WTOA 3QOJA 3ND9A 3GTPH 4NMZA 4GZYC 5IYBG 2F0OA 3LNNA 4NPSA 1PFBA 5GAGC 5I2YA 4Q0FA 4EX5A 1H9MA 4WJ3M 4UHVA 1KAAA 3E6ZX 1MD2D 1G6ZA 2YTYA 5IGBA 2PZTA 3K80C 2F0UA 3R93A 2GVAA 4F87A 5M3FH 5GAHC 5C0XG 2JA7G 1D8LA 2E75C 4HN7A 3H0GB 1BBUA 1KLUD 3ULJA 5L37A 1LT6D 3CCRA 4KHVA 3KLRA 4TVAB 1BBXC 4FYDA 4JOIA 3V96A 1WCMH 2VB3X 3S1NB 3K5OA 3GTKB 3I4MG 4RAUC 3E0EA 3CCLA 1SYGA 1JWMD 4JG2A 4LUVA 1XMOQ 4OWTB 2H5XA 1QZHA 4DV3L 2HDMA 1TS5A 4DV6L 3E3XA 4RMFA 3Q24A 4A3LG 4UY8C 4ZCKA 3RN2A 3NQTA 3W3AA 2WAQB 2XRQD 3KK7A 5LMNL 1EY9A 3VR3A 1EIYB 5IY0A 5KRUA 1Y69U 5JJKA 1E1OA 4X62Q 2E2IH 4A3MB 1YNXA 2EOTA 5ELFA 3VYUA 2SOBA 2X69A 5JAVA 2R7ZG 1QUQA 1DOMA 2WKDA 1HUNA 2L5TA 1PZID 3GTOH 1FJGL 4HR7B 5M5WH 1I4XA 1N8RC 3U9SA 2VY3A 1ESFA 4AQYQ 5EJWA 5JJIA 4OGQC 1MSGA 1NMGA 4RFBA 1A0IA 1LT5D 3NENA 1E3PA 4POFA 1CHQD 1AFPA 4PMBA 3G48A 2H1EA 2RSOA 5M3FB 5JPMC 2BH2A 1IKLA 3T56B 2P5ZX 2CHBD 2MPMA 1X65A 5EBCA 2YTVA 1XMOL 4G7OC 2VQEL 3GDEA 2KEDA 2EYJA 2K04A 2L11A 2HCCA 2E76C 2NZ1D 4LF8Q 3GTGH 2E2HH 4Y52H 4Y7NH 1QZGA 2KQ3A 3FRPB 3U50C 3VA5A 1X55A 2QDLA 3VR4A 4LJZC 1C48A 4BA1I 4LMQD 4KLKA 4OWXB 1U4MA 1I4PA 2BA0A 4IO9A 3H0GG 5IE8A 1LTRD 3UDFA 5T1GA 3Q6SA 1JOQA 4KY5A 1QCBD 1E2ZA 1SJED 4C1NI 3RZDB 1B50A 1ET9A 3KYHC 3F2BA 3DEOA 1RJTA 3GTJH 4DR3Q 1J8IA 4JI2Q 3J7ZC 3AFPA 2WV6D 3PIO3 2UUBQ 2E2IB 1O7IA 3I90A 4KJOA 3I8ZA 1N36L 3BVZA 1AZQA 4I7AA 1MI2A 3HKZE 5M3MH 1TXYA 3A5ZB 4UPAA 2ENBA 4LF4L 5M5WB 1W3SA 5FLMH 4JI6Q 1LT4D 2WAQG 1SBBB 1SYDA 4K14A 4A3KH 1B3QA 3NUCA 2FMCA 4BA2I 3X3NA 1PLFA 3TP5A 2F4VL 5F2DA 4KK7A 3A8IE 2KOLA 2IHEA 3ONAB 4A3MG 1L1OB 1XNQL 1HRJA 1TVXA 4FP5D 1A63A 1EY0A 2PO4A 2PQAB 1GUSA 2VW9A 3J80E 4QQBX 1G291 1MJEA 4LUOA 2PQEA 5LL6X 3CD6A 2NN6H 4C3IB 4OELB 2PI2E 3S1RH 4Y7NB 1BCPF 1X32A 2JN4A 1IW7D 4K8JA 2VUMH 3HRZC 1X3QA 3CC2A 1JWSD 2JA8B 3E0JA 5M3FG 4LFAL 4DR7Q 4LFCL 2UUCL 4DR3L 1B7YB 4BS9A 1A15A 2OTJA 2B8FA 4IUNA 3M85A 2R7FA 4CKCA 2L55A 2EXDA 1IZ6A 2CH4W 2ID0A 2WKCA 4R1JA 4RGOS 3TQYA 1B3AA 1CHPD 2RQXA 5IP9G 2A5HA 4GKJQ 1I3QB 3P1HA 4JI6L 2EY1A 4DNTB 3KFUA 3QOLA 1F2ZA 4ID6A 1TWHH 1SNOA 3J81i 5J39A 3UE0A 1LTTD 1Y14B 4DAYA 1UEAB 1STEA 1NBWA 5IP7G 2YYZA 1OXXK 2AUJD 2E2DC 4LF5L 4BWGB 4GLAC 3MC0B 1WD0A 2MP1A 2IWHA 1CQVA 1WJJA 3UDIA 4CGYB 5BN3A 1TT2A 1GUTA 1D1KA 1DONA 4PMWA 1VCIA 4DR7L 3S1RB 1CUKA 3EROA 5C6AA 2RDGA 2FHTA 4HAEA 5C0XI 3QO2A 4HJ8A 1E1TA 2NB0A 3MXNB 4DV0Q 1KD1C 1CZGA 5IGCA 1ICWA 2F0SA 1HFNA 5IT9L 2XWJB 1R4QB 3CPFA 4N9PA 1KTKA 3DMUA 4C3IG 3PIP3 1T5EA 3JAME 4LWCA 2C35B 2ZTDA 4X3UA 4GN4B 3BYTB 1B4OA 2JA8G 1GJXA 4KHPQ 2K28A 2F0LA 1HNXL 1TWHB 5LHY1 1EU4A 1X3FA 1I6VC 1CK1A 4B08A 1LABA 4ZYSA 2LKVA 2MQHA 1JWUD 3V2TA 1JB3A 1R4PB 1PH3A 4Q5VA 1WFQA 2HQLA 1AW7A 1I5FA 2BDNA 3C2PA 1PHJA 5NUCA 3L3OC 1HXYD 3FHWA 4EQOA 5ELDA 2BA1A 1Q3LA 2X6GA 3TS0A 4QL5A 1GXDC 2L4NA 2UXDL 2NZHA 3HOWB 2HDLA 2GVBA 1EEID 4F7XA 1PFNA 3K0YA 5C3EH 1M1KC 3CCJA 3QIAA 1MJCA 2JSOA 4XT1B 1FNUA 1Y8PB 2G5DA 1OO9B 1Z47A 2HHHQ 4E6IA 2B2UA 5E7NA 2PMZB 1VQ8A 3KJOA 3NSWA 1P8LA 3T1HQ 1H95A 2MHVA 1IW7C 1OXTA 3BU2A 2CVRA 1GUWA 1K0SA 1HTLD 4BXXH 3S2HH 4DV1Q 4KHPL 5CV4A 1N34L 3NEMA 1FD7D 2NN6G 1UNSA 5FJ8H 2AWNA 1PMRA 2B2TA 2KBNA 2F4IA 5AFWA 2M00A 5HGQA 1LO5D 5C44B 1BUVT 1M4VA 1UE6A 4POGA 5IOCA 3NTHA 2IX0A 4DR5L 4IPHA 4LF9Q 3VR6A 2CW0C 3CCVA 3M7GA 4DPGA 4A75A 4PV1C 1UE1A 2WAQE 1TY2A 3RD4A 4EQ5A 1ENFA 3TDQA 3G6JB 2GA4B 5FKAC 4LF7L 3M3YH 1Q86C 1JQYD 5M9OA 4XYOA 4DFAA 1S3OA 5C4JB 5E1FA 2JA5B 1XYIA 1SNQA 3H3VC 1I6HH 1VQEA 1VQ5A 1N33Q 2F3IA 4GKKQ 3VYTA 2E8GA 4G7HC 4FO2A 3VYSA 2HHHL 2K01A 5G3LF 3EA6A 2J0TD 5C3EB 5IYBH 5EBDA 3F8TA 2N78A 1QVCA 1ZEQX 3KBGA 2NTSA 5GROA 1AN8A 2AUKA 5C5MA 4A4IA 2HUGA 3HG9A 5CV8A 4DKAC 4GNXB 2JA7H 4QCLA 4FXGC 4X6AH 1SYBA 1PV4A 3BG3A 3GTQH 1JICA 3HOWG 1Q81C 1QVFA 1HQRD 1I4QA 4GS3A 2D2CC 5FLXL 1F2LA 5I6WA 1QOHA 4APVA 4BY7H 2EPBA 3I4MH 1YJNA 1YHQA 2FFKB 1B44D 1B9NA 3RZOB 3MA2B 4DR2L 3F1ZA 4B9WA 1KDCA 4TSSA 1Q1EA 5CV6A 2DNEA 3BZCA 3K59A 1LYLA 3S9WA 1TS3A 3TEHB 3IKJA 4ZUJA 1SE3A 2JYOA 4A3LH 1FVIA 3QG1A 1PRTB 4JCVE 3J7A5 3CAMA 4GOPB 1N33L 3M3YB 4GKKL 1ENAA 2ATWA 2JK8A 1F9RA 1BKBA 3ULLA 4DUZQ 2L0CA 3F2CA 3SHLA 4A3JB 1TWAH 5C44G 3NHHA 3EIVA 4QF4A 1OTCA 4DK6C 1X3GA 1I6HB 1LTGD 2Q2HA 4XIGS 3DWPA 1CA6A 2E2JB 3A55A 1NMFA
chains in the Genus database with same CATH topology
1KXLA 3KF6A 5DLQE 4HJAA 1QZHA 2KHJA 1A62A 4DV3L 3H3VI 5M5XH 1LTLA 2I5MX 2UXCQ 2KHIA 4AIMA 1SE8A 4DV6L 2VQFQ 1VQ7A 4RMFA 3CCUA 4UY8C 1E7ZA 4A3LG 1TWFH 2N49A 3OTOQ 1U5KA 3ULPA 2JA5G 3RN2A 4DR4L 2B63G 3TRZA 1GD7A 3OYYA 4YWMA 1MKHA 5LMNL 4JYAQ 4PZ7A 4K0KQ 4OXPA 4A3GH 4B3TQ 2WP8J 1EIYB 5IY0A 1IXRA 5JJKA 4YCVA 1E1OA 1UE7A 3H3VH 3B6YA 4X62Q 4A3DH 3EN2A 3RZOH 1WCMG 2E2IH 1YNXA 5C3EG 3SGIA 5BR8Q 1EQQA 4LW1A 4IFDG 2NVXH 3KJPA 1E24A 2PI2A 4P73A 4A3EG 2ZJQA 1Q12A 2R7ZG 1QUQA 2MO1A 1IBKL 4DR1L 1HNZQ 3PUVA 1IBMQ 4DV4Q 1I50H 4YWLA 5M5WH 1FJGL 1NJIC 3GTOH 1N8RC 2VY3A 4AQYQ 5JJIA 1NMGA 2Y0SG 1L0WA 3ZJYC 3H0GH 1A0IA 1KIXA 1AH9A 1HR0L 4IJHA 3NENA 1E3PA 1NE3A 4P71A 4POFA 1K8AC 2IX1A 5IYCH 3G48A 4B3RQ 4A3JH 3K81C 1C9OA 2BH2A 1VQHA 4DR6L 3HOXG 3S1NH 5AJ3L 2A1AA 1X65A 4AYBG 5H1SE 1CKMA 1C7YA 1HNXQ 3BZKA 2YTVA 1XMOL 2E2JH 2VQEL 3GDEA 2RCNA 2Z0SA 1YHAA 3A5UA 1SROA 4LF6Q 3UDXA 3CCEA 3I7FA 2ZM6Q 1Y1VH 1HZAA 2UXCL 1EOVA 4LF8Q 1PH9A 2K5HA 5C4XH 3GTGH 2WB1E 2N3SA 3T1HL 1KRSA 4Y7NH 2E2HH 4Y52H 1QZGA 3STBD 2YV5A 3U50C 4OO1I 1R9TH 2Z6KA 1X55A 4J15A 2Q2TA 4OX9Q 3OTOL 1B70B 4HJ5A 1JMCA 4DV1L 1Q8KA 4JYAL 4K0KL 4BA1I 4KLKA 4OWXB 2I0QA 1JJGA 3F2DA 5GQOA 4DV7Q 2BA0A 1PH5A 1HNWQ 5JJLA 2CQOA 4IO9A 3H0GG 1XMQQ 1U0LA 2EQSA 3CW2C 1OXVA 1CKNA 5IE8A 2UXDQ 3UDFA 1L1OC 1WOCA 1XJVA 4JV5Q 5IYCG 1PYBA 3KOJA 4A3JG 3KF6B 1PH1A 1MIUA 3FP9A 5BR8L 4A3MH 1GKHA 4QIWE 3DM3A 4JI4Q 3KYHC 3F2BA 1K73C 2UXBQ 3GTJH 3IRBA 1PYSB 4DR3Q 4LF9L 4JI2Q 3J7ZC 1VQ6A 3AFPA 2UUBQ 3EBEA 1HNZL 4DV4L 1O7IA 3GTLH 1N36L 1K0RA 1Y1VG 4JI1Q 2LXKA 2MO0A 2RF4A 4HIKA 3HKZE 5M3MH 2XTIA 5C4XG 3ERSX 1X9NA 1TXYA 1XTDA 3A5ZB 2EIFA 4UPAA 3W5OA 4A76A 4LF4L 4B3RL 4WJ4A 3PGZA 5LMUQ 2KENA 3HOZG 1VQ4A 4LFBQ 3KDFB 4B3MQ 1IL2A 1W3SA 2AWOA 5FLMH 4IPDA 1N34Q 2DGYA 2K50A 4JI6Q 2WAQG 4A3KH 1PH8A 2N8NA 4BA2I 1CSQA 4UP8A 2Z6KC 2BH8A 3RLNA 2NN6I 2F4VL 3HOVG 4GLVB 4LF6L 2NVTH 3PIPA 1YI2A 2IHEA 1VQNA 3PV0A 3H15A 2ZM6L 1L1OB 4A3MG 1XNQL 1SFOH 4BY7G 4DR5Q 1A63A 1VQMA 1OXSC 1YEZA 1M90C 1KRTA 1VQDA 1G51A 2PQAB 3CCSA 3PUYA 2VW9A 1IBLQ 4QQBX 5IP9H 1G291 1RL2A 1X6OA 3U4ZA 1S72A 2ES2A 1MJEA 3S17H 1AE3A 4LUOA 1VQGA 2UUAQ 5M3MG 4C3HH 3CD6A 1EIFA 4DV7L 3T1YQ 2PI2E 4YHHQ 3CF5A 3S1RH 2UU9Q 4LF7Q 1HNWL 1XMQL 3HFZB 1LUZA 4JBJA 4BBSH 3CCQA 3KF8B 4NXML 2V1CC 3K7AH 3TREA 4JV5L 2DUDA 2VUMH 3OW2A 3HOYH 3CC2A 4GNXA 5IYDG 5FLMG 5M3FG 4A3FG 2JA6H 3RZDH 4LFAL 4DR7Q 2CCZA 4JI4L 4A3KG 4LFCL 3CMEA 1N32L 2UUCL 1ASZA 4DR3L 4TQUS 1B7YB 5IP7H 4DUYL 1BBWA 2OTJA 5IWAQ 1YJWA 4UP7A 3M85A 2R7FA 2CWAA 1NY4A 2EXDA 2IT1A 1I94Q 4L5QA 2K5NA 1IZ6A 1SN8A 3KLWA 2R7DA 2PNHA 2ID0A 2K14A 4R1JA 1W2BA 4JOIC 1CKOA 3TQYA 4R4OA 2FXQA 5IP9G 5LMUL 3TS2A 2Q2IA 3NBHB 4B3ML 4GKJQ 3A0JA 4JBWA 1GVPA 2QGQA 1Q1BA 4JI6L 2JQOA 1EUJA 3KFUA 4JI8Q 3RNUA 2R92H 2D62A 1TWHH 4DUZL 4B3SQ 3J81i 2VUMG 5IT9c 4R4TA 2HT1A 4YCUA 2PMZE 3UE0A 3S16H 1Y14B 4X65Q 2A8VA 2JA6G 3HOUH 4ME3A 1Y1WH 1JT8A 2E5LQ 3CQZH 2XGTA 2ZJRA 3PO2H 4A3GG 1NBWA 5IP7G 2YYZA 4YWKA 1XPUA 1OXXK 4LF5L 1VQBA 1K3RA 4A3CH 3M4OH 1IBLL 3L2PA 4GLAC 2WFWA 4DR2Q 3CCMA 1GM5A 4A3DG 4X66Q 3T1YL 2K5VA 3J80i 4YHHL 4BBRH 2JA9A 2UU9L 4C3IH 2NVYH 2VQFL 3AEVA 4L5SA 1IYJB 1XPOA 1WJJA 3UDIA 3CP0A 1C0AA 3AYHB 1YIJA 1ASYA 3AQQA 2JA8H 4PMWA 2R93H 1VCIA 3J81j 1PH7A 2OWOA 4JI5Q 2KCMA 4DR7L 4H02A 1CUKA 1HR0W 2QEXA 4B3TL 5ELNA 4MNOA 2R92G 4JBMA 5C0XI 1FL0A 2LSSA 1KHIA 1HZBA 1SR3A 1VQJA 1E1TA 5J3BA 1WI5A 5IWAL 4HIDA 4X62L 4HJ8A 1HZ9A 4BY1H 4JI3Q 2IY5B 2VS1A 1E22A 2K4KA 4UP9A 3MXNB 5GADC 4DV0Q 1I94L 1YHBA 3K7UC 1KD1C 3STBC 4C3JH 3NELA 3JC66 4YY3Q 1YVCA 2R6GA 2I5HA 3DLLA 1PH2A 1G6PA 3M9BA 1UWVA 2QA4A 1IBML 1PFSA 2CFMA 4AH6A 2K75A 3PO3H 1K83H 4P74A 3M7NA 4OWWB 1I3QH 3CPFA 4DNIA 4AQYL 1KAWA 1YZ6A 2OQKA 2VZAA 3FKIH 4PZ6A 1TWGH 3PUZA 1PA6A 4LWCA 2C35B 2ZTDA 4B3SL 1X54A 4GN4B 4OWTB 3RR5A 4DR4Q 2F52A 1WYDA 4X65L 3K0XA 3M4PA 2JA8G 1EFWA 4KHPQ 2R93G 4DV2Q 1VQCA 4HIMA 3PSIA 3PF4A 1HNXL 3I55A 2CKZB 4DAMA 2A19A 2ZJPA 1QUQB 1X3FA 3PUXA 3I4NH 2HIXA 2D0OA 2OTLA 1TWCH 2MQHA 4P72A 4X66L 2Y0SE 2ZTCA 1RIPA 4DK3C 3RN5A 1EYGA 4LF8L 2KCTA 3S1QH 4OO1G 4C2MH 1PH3A 3E9HA 1YITA 1J6QA 4IFDI 1WFQA 2HQLA 4R4CA 1EWIA 3GO5A 4OX9L 1FJGQ 1S40A 1YJ9A 1VQLA 3PO3G 1I5FA 1Z9FA 1PHJA 2I5LX 3FHWA 4AYBE 2LXJA 5JEAJ 2BA1A 4XTCS 3FKIG 1VQKA 4KHZA 4HJ9A 4GN3B 4QL5A 3TS0A 3S1MH 2WB1G 1VS0A 1HR0Q 2UXDL 2NZHA 4JI3L 2GVBA 1BVSA 2JEBI 5C3EH 1M1KC 3CCJA 3VDYA 4IJLA 3J81c 3U58A 1MJCA 2NZOA 1FGUA 4JI7Q 2UXBL 1SMXA 4YCWA 4QGUA 4L5RC 2R7ZH 4JI2L 1Q82C 1VQIA 4FDBA 2VQEQ 1VQPA 1Z47A 2UUBL 3I4NG 2HHHQ 1J5EQ 1P16A 1XNRQ 5E7NA 2JEAI 3CPWA 4NB3A 4JI1L 1VQ8A 3KJOA 1K8GA 1P8LA 4OONA 3T1HQ 1YBYA 3M4QA 1H95A 3G4SA 2YU9H 4A3IH 1OXTA 3BU2A 1HJPA 1UEBA 2RHSB 1CKNB 3J80c 4BXXH 3S2HH 4LFBL 3ICEA 4DV1Q 4KHPL 3JAMi 2K52A 4DV2L 1N9WA 2AHOB 1N34L 2ALYB 3NEMA 2NN6G 3E9IA 5FJ8H 3HOXH 2AWNA 5M5YH 3HKZG 2MFIA 2B29A 2KBNA 4BBSG 1OXUA 4PG3A 4A3BH 4JI0Q 4GLXA 3S2DH 5HGQA 3KDFA 1V9PA 5LMNW 3HOYG 3W1BA 4ALPA 3S14H 3A74A 4POGA 1UE6A 4GOPA 4LUZA 1VQFA 2IX0A 2GN5A 4O0AA 4DR5L 2RHQB 4IPHA 4LF9Q 3CCVA 2D0PA 3UDGA 4DPGA 5JEAG 4X64Q 4A75A 4GNXC 1L1OA 1GO3E 3J7A5 5FLXc 1UE1A 1N36Q 3PF5A 2WAQE 1KL9A 3G71A 4EQ5A 3RLOA 3Q8DA 2UUAL 1EQRA 2AMCB 4KI0A 1HZCA 1LM0A 4LF7L 3M3YH 4A3IG 2PQAA 1Q86C 1UE5A 1A8VA 1KQSA 3UE1A 4LF4Q 3D0FA 1D7QA 1S3OA 4BXXG 4IOAA 3HOWH 1V43A 3RLFA 1Q7YC 5FJ8G 1I6HH 1VQEA 1VQ5A 1N33Q 2F3IA 4JI7L 3GTKH 4GKKQ 2B3GA 4O2DA 4L5TA 4GN5A 4IPGA 2E8GA 4A3BG 4NXNQ 2F4VQ 2VNUD 5C0XJ 4PZ8A 3G6EA 2HHHL 4X6AH 2VL6A 3L7ZC 3U4VA 1PH6A 1J5EL 1XNRL 4A93H 1X56A 4P75A 1B8AA 5IYBH 1JJCB 4DV5Q 3F8TA 1Y1WG 1XNQQ 3HOUG 4JC0A 2N78A 1QVCA 3L0OA 3GD7A 3PO2G 1VQAA 2OCEA 5GROA 3CC4A 4A3CG 3AFQA 4A4IA 4MTNA 3CXCA 4IPCA 1PVOA 3I2ZA 1Q46A 3D31A 4GOPC 4DV3Q 1PH4A 1JJ2A 3HOZH 3LGJA 1K9MC 4GKJL 3PUWA 4DKAC 5EAYA 3HKSA 4GNXB 2JA7H 4DV6Q 1JE5A 4BBRG 3GTMH 1L2FA 4MZ9A 4QY7A 4JI8L 1AE2A 3CMAA 1T9HA 2L15A 3S15H 4NXMQ 1PV4A 2OQ0A 2IHFA 2AKWB 4JI0L 1CSPA 3GTQH 5HY6A 3HOVH 2CWPA 4RG1A 2NVQH 3HOWG 4IOCA 1Q81C 1VQOA 5C44H 1QVFA 3K8AA 2ASBA 2JJQA 1SRUA 2ZTEA 4GS3A 2JE6I 4LFAQ 3WWVA 5LMNQ 1N32Q 4LFCQ 4APVA 2E5LL 4BY7H 4HIOA 2UUCQ 3I4MH 5GAEC 3I56A 3BJUA 1YJNA 1YHQA 5K36G 4DUYQ 3PCOB 2YTXA 4BY1G 1V1QA 4X64L 1NTGA 4DR2L 3F1ZA 3GTPH 4A93G 5IYBG 1X3EA 2Q2UA 4NPSA 5GAGC 1Q1EA 4QJFA 1VQ9A 3BZCA 4EX5A 3W1GA 2HIVA 1KC8C 1DGSA 4WJ3M 1LYLA 4HJ7A 1JB7A 3TEHB 2YTYA 1IBKQ 4IFDJ 4A3LH 4DR1Q 1FVIA 3K80C 1XPRA 2GVAA 2JA5H 5C4JH 2B63H 4A3FH 5M3FH 5IYDH 3PIOA 5GAHC 4JCVE 4DAYB 1D8LA 4JI5L 5C0XG 3CAMA 1SLJA 4GOPB 1N33L 2JA7G 4GKKL 2ATWA 2JK8A 3I4OA 1BBUA 3ULJA 1BKBA 3S24A 3ULLA 4NXNL 4TVAB 3JAMc 3CCRA 4DUZQ 3F2CA 1HH2P 4JOIA 1TWAH 4R4QA 3MEFA 1WCMH 5C44G 4DV5L 3EIVA 1OTCA 4DK6C 1X3GA 4DV0L 4LNQA 4DR6Q 2Q2HA 3I4MG 4XIGS 3CCLA 3E0EA 3ER0A 4R4IA 5AJ3Q 2MNAA 4JG2A 4A3EH 4LUVA 4LF5Q 4YY3L 5ELOA 3CC7A 1NMFA 1XMOQ 4JBKA 2H5XA 1QVGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KXL A;  3KF6 A;  5DLQ E;  4HJA A;  1QZH A;  2KHJ A;  1A62 A;  4DV3 L;  3H3V I;  5M5X H;  1LTL A;  2I5M X;  2UXC Q;  2KHI A;  4AIM A;  1SE8 A;  4DV6 L;  2VQF Q;  1VQ7 A;  4RMF A;  3CCU A;  4UY8 C;  1E7Z A;  4A3L G;  1TWF H;  2N49 A;  3OTO Q;  1U5K A;  3ULP A;  2JA5 G;  3RN2 A;  4DR4 L;  2B63 G;  3TRZ A;  1GD7 A;  3OYY A;  4YWM A;  1MKH A;  5LMN L;  4JYA Q;  4PZ7 A;  4K0K Q;  4OXP A;  4A3G H;  4B3T Q;  2WP8 J;  1EIY B;  5IY0 A;  1IXR A;  5JJK A;  4YCV A;  1E1O A;  1UE7 A;  3H3V H;  3B6Y A;  4X62 Q;  4A3D H;  3EN2 A;  3RZO H;  1WCM G;  2E2I H;  1YNX A;  5C3E G;  3SGI A;  5BR8 Q;  1EQQ A;  4LW1 A;  4IFD G;  2NVX H;  3KJP A;  1E24 A;  2PI2 A;  4P73 A;  4A3E G;  2ZJQ A;  1Q12 A;  2R7Z G;  1QUQ A;  2MO1 A;  1IBK L;  4DR1 L;  1HNZ Q;  3PUV A;  1IBM Q;  4DV4 Q;  1I50 H;  4YWL A;  5M5W H;  1FJG L;  1NJI C;  3GTO H;  1N8R C;  2VY3 A;  4AQY Q;  5JJI A;  1NMG A;  2Y0S G;  1L0W A;  3ZJY C;  3H0G H;  1A0I A;  1KIX A;  1AH9 A;  1HR0 L;  4IJH A;  3NEN A;  1E3P A;  1NE3 A;  4P71 A;  4POF A;  1K8A C;  2IX1 A;  5IYC H;  3G48 A;  4B3R Q;  4A3J H;  3K81 C;  1C9O A;  2BH2 A;  1VQH A;  4DR6 L;  3HOX G;  3S1N H;  5AJ3 L;  2A1A A;  1X65 A;  4AYB G;  5H1S E;  1CKM A;  1C7Y A;  1HNX Q;  3BZK A;  2YTV A;  1XMO L;  2E2J H;  2VQE L;  3GDE A;  2RCN A;  2Z0S A;  1YHA A;  3A5U A;  1SRO A;  4LF6 Q;  3UDX A;  3CCE A;  3I7F A;  2ZM6 Q;  1Y1V H;  1HZA A;  2UXC L;  1EOV A;  4LF8 Q;  1PH9 A;  2K5H A;  5C4X H;  3GTG H;  2WB1 E;  2N3S A;  3T1H L;  1KRS A;  4Y7N H;  2E2H H;  4Y52 H;  1QZG A;  3STB D;  2YV5 A;  3U50 C;  4OO1 I;  1R9T H;  2Z6K A;  1X55 A;  4J15 A;  2Q2T A;  4OX9 Q;  3OTO L;  1B70 B;  4HJ5 A;  1JMC A;  4DV1 L;  1Q8K A;  4JYA L;  4K0K L;  4BA1 I;  4KLK A;  4OWX B;  2I0Q A;  1JJG A;  3F2D A;  5GQO A;  4DV7 Q;  2BA0 A;  1PH5 A;  1HNW Q;  5JJL A;  2CQO A;  4IO9 A;  3H0G G;  1XMQ Q;  1U0L A;  2EQS A;  3CW2 C;  1OXV A;  1CKN A;  5IE8 A;  2UXD Q;  3UDF A;  1L1O C;  1WOC A;  1XJV A;  4JV5 Q;  5IYC G;  1PYB A;  3KOJ A;  4A3J G;  3KF6 B;  1PH1 A;  1MIU A;  3FP9 A;  5BR8 L;  4A3M H;  1GKH A;  4QIW E;  3DM3 A;  4JI4 Q;  3KYH C;  3F2B A;  1K73 C;  2UXB Q;  3GTJ H;  3IRB A;  1PYS B;  4DR3 Q;  4LF9 L;  4JI2 Q;  3J7Z C;  1VQ6 A;  3AFP A;  2UUB Q;  3EBE A;  1HNZ L;  4DV4 L;  1O7I A;  3GTL H;  1N36 L;  1K0R A;  1Y1V G;  4JI1 Q;  2LXK A;  2MO0 A;  2RF4 A;  4HIK A;  3HKZ E;  5M3M H;  2XTI A;  5C4X G;  3ERS X;  1X9N A;  1TXY A;  1XTD A;  3A5Z B;  2EIF A;  4UPA A;  3W5O A;  4A76 A;  4LF4 L;  4B3R L;  4WJ4 A;  3PGZ A;  5LMU Q;  2KEN A;  3HOZ G;  1VQ4 A;  4LFB Q;  3KDF B;  4B3M Q;  1IL2 A;  1W3S A;  2AWO A;  5FLM H;  4IPD A;  1N34 Q;  2DGY A;  2K50 A;  4JI6 Q;  2WAQ G;  4A3K H;  1PH8 A;  2N8N A;  4BA2 I;  1CSQ A;  4UP8 A;  2Z6K C;  2BH8 A;  3RLN A;  2NN6 I;  2F4V L;  3HOV G;  4GLV B;  4LF6 L;  2NVT H;  3PIP A;  1YI2 A;  2IHE A;  1VQN A;  3PV0 A;  3H15 A;  2ZM6 L;  1L1O B;  4A3M G;  1XNQ L;  1SFO H;  4BY7 G;  4DR5 Q;  1A63 A;  1VQM A;  1OXS C;  1YEZ A;  1M90 C;  1KRT A;  1VQD A;  1G51 A;  2PQA B;  3CCS A;  3PUY A;  2VW9 A;  1IBL Q;  4QQB X;  5IP9 H;  1G29 1;  1RL2 A;  1X6O A;  3U4Z A;  1S72 A;  2ES2 A;  1MJE A;  3S17 H;  1AE3 A;  4LUO A;  1VQG A;  2UUA Q;  5M3M G;  4C3H H;  3CD6 A;  1EIF A;  4DV7 L;  3T1Y Q;  2PI2 E;  4YHH Q;  3CF5 A;  3S1R H;  2UU9 Q;  4LF7 Q;  1HNW L;  1XMQ L;  3HFZ B;  1LUZ A;  4JBJ A;  4BBS H;  3CCQ A;  3KF8 B;  4NXM L;  2V1C C;  3K7A H;  3TRE A;  4JV5 L;  2DUD A;  2VUM H;  3OW2 A;  3HOY H;  3CC2 A;  4GNX A;  5IYD G;  5FLM G;  5M3F G;  4A3F G;  2JA6 H;  3RZD H;  4LFA L;  4DR7 Q;  2CCZ A;  4JI4 L;  4A3K G;  4LFC L;  3CME A;  1N32 L;  2UUC L;  1ASZ A;  4DR3 L;  4TQU S;  1B7Y B;  5IP7 H;  4DUY L;  1BBW A;  2OTJ A;  5IWA Q;  1YJW A;  4UP7 A;  3M85 A;  2R7F A;  2CWA A;  1NY4 A;  2EXD A;  2IT1 A;  1I94 Q;  4L5Q A;  2K5N A;  1IZ6 A;  1SN8 A;  3KLW A;  2R7D A;  2PNH A;  2ID0 A;  2K14 A;  4R1J A;  1W2B A;  4JOI C;  1CKO A;  3TQY A;  4R4O A;  2FXQ A;  5IP9 G;  5LMU L;  3TS2 A;  2Q2I A;  3NBH B;  4B3M L;  4GKJ Q;  3A0J A;  4JBW A;  1GVP A;  2QGQ A;  1Q1B A;  4JI6 L;  2JQO A;  1EUJ A;  3KFU A;  4JI8 Q;  3RNU A;  2R92 H;  2D62 A;  1TWH H;  4DUZ L;  4B3S Q;  3J81 i;  2VUM G;  5IT9 c;  4R4T A;  2HT1 A;  4YCU A;  2PMZ E;  3UE0 A;  3S16 H;  1Y14 B;  4X65 Q;  2A8V A;  2JA6 G;  3HOU H;  4ME3 A;  1Y1W H;  1JT8 A;  2E5L Q;  3CQZ H;  2XGT A;  2ZJR A;  3PO2 H;  4A3G G;  1NBW A;  5IP7 G;  2YYZ A;  4YWK A;  1XPU A;  1OXX K;  4LF5 L;  1VQB A;  1K3R A;  4A3C H;  3M4O H;  1IBL L;  3L2P A;  4GLA C;  2WFW A;  4DR2 Q;  3CCM A;  1GM5 A;  4A3D G;  4X66 Q;  3T1Y L;  2K5V A;  3J80 i;  4YHH L;  4BBR H;  2JA9 A;  2UU9 L;  4C3I H;  2NVY H;  2VQF L;  3AEV A;  4L5S A;  1IYJ B;  1XPO A;  1WJJ A;  3UDI A;  3CP0 A;  1C0A A;  3AYH B;  1YIJ A;  1ASY A;  3AQQ A;  2JA8 H;  4PMW A;  2R93 H;  1VCI A;  3J81 j;  1PH7 A;  2OWO A;  4JI5 Q;  2KCM A;  4DR7 L;  4H02 A;  1CUK A;  1HR0 W;  2QEX A;  4B3T L;  5ELN A;  4MNO A;  2R92 G;  4JBM A;  5C0X I;  1FL0 A;  2LSS A;  1KHI A;  1HZB A;  1SR3 A;  1VQJ A;  1E1T A;  5J3B A;  1WI5 A;  5IWA L;  4HID A;  4X62 L;  4HJ8 A;  1HZ9 A;  4BY1 H;  4JI3 Q;  2IY5 B;  2VS1 A;  1E22 A;  2K4K A;  4UP9 A;  3MXN B;  5GAD C;  4DV0 Q;  1I94 L;  1YHB A;  3K7U C;  1KD1 C;  3STB C;  4C3J H;  3NEL A;  3JC6 6;  4YY3 Q;  1YVC A;  2R6G A;  2I5H A;  3DLL A;  1PH2 A;  1G6P A;  3M9B A;  1UWV A;  2QA4 A;  1IBM L;  1PFS A;  2CFM A;  4AH6 A;  2K75 A;  3PO3 H;  1K83 H;  4P74 A;  3M7N A;  4OWW B;  1I3Q H;  3CPF A;  4DNI A;  4AQY L;  1KAW A;  1YZ6 A;  2OQK A;  2VZA A;  3FKI H;  4PZ6 A;  1TWG H;  3PUZ A;  1PA6 A;  4LWC A;  2C35 B;  2ZTD A;  4B3S L;  1X54 A;  4GN4 B;  4OWT B;  3RR5 A;  4DR4 Q;  2F52 A;  1WYD A;  4X65 L;  3K0X A;  3M4P A;  2JA8 G;  1EFW A;  4KHP Q;  2R93 G;  4DV2 Q;  1VQC A;  4HIM A;  3PSI A;  3PF4 A;  1HNX L;  3I55 A;  2CKZ B;  4DAM A;  2A19 A;  2ZJP A;  1QUQ B;  1X3F A;  3PUX A;  3I4N H;  2HIX A;  2D0O A;  2OTL A;  1TWC H;  2MQH A;  4P72 A;  4X66 L;  2Y0S E;  2ZTC A;  1RIP A;  4DK3 C;  3RN5 A;  1EYG A;  4LF8 L;  2KCT A;  3S1Q H;  4OO1 G;  4C2M H;  1PH3 A;  3E9H A;  1YIT A;  1J6Q A;  4IFD I;  1WFQ A;  2HQL A;  4R4C A;  1EWI A;  3GO5 A;  4OX9 L;  1FJG Q;  1S40 A;  1YJ9 A;  1VQL A;  3PO3 G;  1I5F A;  1Z9F A;  1PHJ A;  2I5L X;  3FHW A;  4AYB E;  2LXJ A;  5JEA J;  2BA1 A;  4XTC S;  3FKI G;  1VQK A;  4KHZ A;  4HJ9 A;  4GN3 B;  4QL5 A;  3TS0 A;  3S1M H;  2WB1 G;  1VS0 A;  1HR0 Q;  2UXD L;  2NZH A;  4JI3 L;  2GVB A;  1BVS A;  2JEB I;  5C3E H;  1M1K C;  3CCJ A;  3VDY A;  4IJL A;  3J81 c;  3U58 A;  1MJC A;  2NZO A;  1FGU A;  4JI7 Q;  2UXB L;  1SMX A;  4YCW A;  4QGU A;  4L5R C;  2R7Z H;  4JI2 L;  1Q82 C;  1VQI A;  4FDB A;  2VQE Q;  1VQP A;  1Z47 A;  2UUB L;  3I4N G;  2HHH Q;  1J5E Q;  1P16 A;  1XNR Q;  5E7N A;  2JEA I;  3CPW A;  4NB3 A;  4JI1 L;  1VQ8 A;  3KJO A;  1K8G A;  1P8L A;  4OON A;  3T1H Q;  1YBY A;  3M4Q A;  1H95 A;  3G4S A;  2YU9 H;  4A3I H;  1OXT A;  3BU2 A;  1HJP A;  1UEB A;  2RHS B;  1CKN B;  3J80 c;  4BXX H;  3S2H H;  4LFB L;  3ICE A;  4DV1 Q;  4KHP L;  3JAM i;  2K52 A;  4DV2 L;  1N9W A;  2AHO B;  1N34 L;  2ALY B;  3NEM A;  2NN6 G;  3E9I A;  5FJ8 H;  3HOX H;  2AWN A;  5M5Y H;  3HKZ G;  2MFI A;  2B29 A;  2KBN A;  4BBS G;  1OXU A;  4PG3 A;  4A3B H;  4JI0 Q;  4GLX A;  3S2D H;  5HGQ A;  3KDF A;  1V9P A;  5LMN W;  3HOY G;  3W1B A;  4ALP A;  3S14 H;  3A74 A;  4POG A;  1UE6 A;  4GOP A;  4LUZ A;  1VQF A;  2IX0 A;  2GN5 A;  4O0A A;  4DR5 L;  2RHQ B;  4IPH A;  4LF9 Q;  3CCV A;  2D0P A;  3UDG A;  4DPG A;  5JEA G;  4X64 Q;  4A75 A;  4GNX C;  1L1O A;  1GO3 E;  3J7A 5;  5FLX c;  1UE1 A;  1N36 Q;  3PF5 A;  2WAQ E;  1KL9 A;  3G71 A;  4EQ5 A;  3RLO A;  3Q8D A;  2UUA L;  1EQR A;  2AMC B;  4KI0 A;  1HZC A;  1LM0 A;  4LF7 L;  3M3Y H;  4A3I G;  2PQA A;  1Q86 C;  1UE5 A;  1A8V A;  1KQS A;  3UE1 A;  4LF4 Q;  3D0F A;  1D7Q A;  1S3O A;  4BXX G;  4IOA A;  3HOW H;  1V43 A;  3RLF A;  1Q7Y C;  5FJ8 G;  1I6H H;  1VQE A;  1VQ5 A;  1N33 Q;  2F3I A;  4JI7 L;  3GTK H;  4GKK Q;  2B3G A;  4O2D A;  4L5T A;  4GN5 A;  4IPG A;  2E8G A;  4A3B G;  4NXN Q;  2F4V Q;  2VNU D;  5C0X J;  4PZ8 A;  3G6E A;  2HHH L;  4X6A H;  2VL6 A;  3L7Z C;  3U4V A;  1PH6 A;  1J5E L;  1XNR L;  4A93 H;  1X56 A;  4P75 A;  1B8A A;  5IYB H;  1JJC B;  4DV5 Q;  3F8T A;  1Y1W G;  1XNQ Q;  3HOU G;  4JC0 A;  2N78 A;  1QVC A;  3L0O A;  3GD7 A;  3PO2 G;  1VQA A;  2OCE A;  5GRO A;  3CC4 A;  4A3C G;  3AFQ A;  4A4I A;  4MTN A;  3CXC A;  4IPC A;  1PVO A;  3I2Z A;  1Q46 A;  3D31 A;  4GOP C;  4DV3 Q;  1PH4 A;  1JJ2 A;  3HOZ H;  3LGJ A;  1K9M C;  4GKJ L;  3PUW A;  4DKA C;  5EAY A;  3HKS A;  4GNX B;  2JA7 H;  4DV6 Q;  1JE5 A;  4BBR G;  3GTM H;  1L2F A;  4MZ9 A;  4QY7 A;  4JI8 L;  1AE2 A;  3CMA A;  1T9H A;  2L15 A;  3S15 H;  4NXM Q;  1PV4 A;  2OQ0 A;  2IHF A;  2AKW B;  4JI0 L;  1CSP A;  3GTQ H;  5HY6 A;  3HOV H;  2CWP A;  4RG1 A;  2NVQ H;  3HOW G;  4IOC A;  1Q81 C;  1VQO A;  5C44 H;  1QVF A;  3K8A A;  2ASB A;  2JJQ A;  1SRU A;  2ZTE A;  4GS3 A;  2JE6 I;  4LFA Q;  3WWV A;  5LMN Q;  1N32 Q;  4LFC Q;  4APV A;  2E5L L;  4BY7 H;  4HIO A;  2UUC Q;  3I4M H;  5GAE C;  3I56 A;  3BJU A;  1YJN A;  1YHQ A;  5K36 G;  4DUY Q;  3PCO B;  2YTX A;  4BY1 G;  1V1Q A;  4X64 L;  1NTG A;  4DR2 L;  3F1Z A;  3GTP H;  4A93 G;  5IYB G;  1X3E A;  2Q2U A;  4NPS A;  5GAG C;  1Q1E A;  4QJF A;  1VQ9 A;  3BZC A;  4EX5 A;  3W1G A;  2HIV A;  1KC8 C;  1DGS A;  4WJ3 M;  1LYL A;  4HJ7 A;  1JB7 A;  3TEH B;  2YTY A;  1IBK Q;  4IFD J;  4A3L H;  4DR1 Q;  1FVI A;  3K80 C;  1XPR A;  2GVA A;  2JA5 H;  5C4J H;  2B63 H;  4A3F H;  5M3F H;  5IYD H;  3PIO A;  5GAH C;  4JCV E;  4DAY B;  1D8L A;  4JI5 L;  5C0X G;  3CAM A;  1SLJ A;  4GOP B;  1N33 L;  2JA7 G;  4GKK L;  2ATW A;  2JK8 A;  3I4O A;  1BBU A;  3ULJ A;  1BKB A;  3S24 A;  3ULL A;  4NXN L;  4TVA B;  3JAM c;  3CCR A;  4DUZ Q;  3F2C A;  1HH2 P;  4JOI A;  1TWA H;  4R4Q A;  3MEF A;  1WCM H;  5C44 G;  4DV5 L;  3EIV A;  1OTC A;  4DK6 C;  1X3G A;  4DV0 L;  4LNQ A;  4DR6 Q;  2Q2H A;  3I4M G;  4XIG S;  3CCL A;  3E0E A;  3ER0 A;  4R4I A;  5AJ3 Q;  2MNA A;  4JG2 A;  4A3E H;  4LUV A;  4LF5 Q;  4YY3 L;  5ELO A;  3CC7 A;  1NMF A;  1XMO Q;  4JBK A;  2H5X A;  1QVG A; 
#chains in the Genus database with same CATH topology
 5CGK A;  4HJA A;  1A62 A;  1Y1V B;  2DY8 A;  3OMC A;  4N8X 1;  1SND A;  2F0J A;  2KHI A;  3TZU A;  4XT3 B;  2VQF Q;  3RMH A;  2RDH A;  3FPU B;  1E7Z A;  5IT9 E;  1TWF H;  3ULP A;  1U5K A;  2JA5 G;  1JE4 A;  3BDL A;  1WTX A;  4FXD A;  4JYA Q;  4K0K Q;  4OXP A;  1PZK D;  2FJ2 A;  4B3T Q;  1NR4 A;  2K7V A;  1IXR A;  4YCV A;  3H3V H;  3GTQ B;  3IAY A;  1RCV D;  1EIG A;  5I4D A;  1TS2 A;  5J1Z A;  5C3E G;  1STH A;  3SGI A;  2MGS A;  1EQQ A;  1HHV A;  4BY7 B;  2PI2 A;  1O7L A;  2F0F A;  2SEB D;  4X3K A;  2K6A A;  3BS1 A;  1IBM Q;  4RGT A;  3K57 A;  1PZJ D;  1D2B A;  3MVV A;  1SSO A;  1A2U A;  3MXU A;  3OOC A;  3H0G H;  1XXG A;  1HR0 L;  4IJH A;  1K8A C;  1NE3 A;  4P71 A;  4B3R Q;  3K81 C;  1C9O A;  3A7A B;  3S1N H;  2M9V A;  4JK1 C;  3VR2 A;  1SRO A;  2ZM6 Q;  2B2V C;  1HUM A;  2L12 A;  5EPJ A;  5JPN C;  1KRS A;  4NDX A;  3STB D;  5KGU A;  5DEH A;  2Z6K A;  4OX9 Q;  1TII D;  1B70 B;  1JMC A;  4KY6 A;  5KYI A;  1Q8K A;  4ODG A;  4JYA L;  5C5L A;  4K0K L;  5IGE A;  1HNW Q;  2CQO A;  2M2L A;  1XMQ Q;  4MN3 A;  2EQS A;  1CKN A;  1L1O C;  1WOC A;  1PYB A;  3KOJ A;  4A3J G;  3J7A F;  1CZW A;  1PH1 A;  4A3M H;  1F9Q A;  1GKH A;  4OO1 H;  2IPK D;  2Z6B A;  3DM3 A;  5JOB A;  1H9R A;  3I91 A;  1CFM A;  2LY7 A;  2EXZ A;  1U4P A;  2JP1 A;  3GTL H;  5CV9 A;  1K0R A;  1Y1V G;  2LXK A;  2RF4 A;  2RCF A;  4U68 A;  3DUZ A;  3SK4 A;  4QUF A;  2KVM A;  4M1U B;  1X9N A;  2BCO A;  2EZV A;  2EIF A;  4A76 A;  4B3R L;  3PGZ A;  4RCN A;  3KDF B;  3HZX A;  4IPD A;  2K50 A;  3EVQ A;  3NE5 B;  1H9S A;  2N8N A;  4KJN A;  5IGF A;  2NN6 I;  3C1F A;  3OHX C;  1DOK A;  4GLV B;  1FR3 A;  2ZM6 L;  3Q22 A;  4BY7 G;  4G57 A;  2Z4H A;  2IL8 A;  1YEZ A;  2Q8R E;  4HED A;  5E4X A;  3CCS A;  2EYH A;  1STA A;  1LLR D;  5IP9 H;  1S72 A;  2H4O A;  1BF4 A;  3S17 H;  1EIF A;  1HNW L;  2NVY B;  2NBF A;  2A6E C;  2N55 A;  1XMQ L;  3HFZ B;  3KF8 B;  2V1C C;  3MZ5 A;  3OW2 A;  4RGN A;  2R93 B;  1HPC A;  3RZD H;  3EJI A;  2CCZ A;  4TQU S;  5IP7 H;  4FF1 A;  4DUY L;  3CKI B;  3FDT A;  1BBW A;  5D65 A;  1A6X A;  5IWA Q;  3R3O A;  5FLX E;  4UAI A;  2CWA A;  1NY4 A;  2IT1 A;  2JXM B;  3P75 A;  1I94 Q;  2BOS A;  4L5Q A;  3KLW A;  2R7D A;  3K5M A;  1F9P A;  4H0L C;  1W2B A;  2E74 C;  1KDB A;  3PO3 B;  2O4X A;  5A2Q L;  1K83 B;  3I3C A;  3FVQ A;  3GTL B;  3NBH B;  1CT1 D;  3A0J A;  2QGQ A;  4KN4 C;  4NW2 A;  4EQP A;  1TWG B;  3RNU A;  1B53 A;  2WB1 B;  3T51 B;  1IL8 A;  5K5P A;  4B3S Q;  4QB4 A;  2HT1 A;  1V1P B;  2PMZ E;  3I72 A;  5EQ0 A;  1Y1W H;  1D5M C;  2XGT A;  3PO2 H;  2ZXR A;  1ML0 D;  2EJM A;  4A3C H;  3I4N B;  2WFW A;  2RVL A;  1WTH A;  4HSV A;  5DNF A;  4O42 A;  3J80 i;  2JA9 A;  4C3I H;  5E4W C;  4L5S A;  1IYJ B;  3L9A X;  4KTA A;  3CP0 A;  3AYH B;  2PCF B;  4IZ8 A;  3S17 B;  2EYF A;  2EDG A;  3Q0A A;  1EY4 A;  1PRT D;  2MUY A;  4FF4 A;  4JI5 Q;  1WTV A;  2JA8 H;  4H02 A;  2L9H A;  2QEX A;  5ELN A;  1BQQ T;  5IGD A;  1DXM A;  1FL0 A;  1SR3 A;  1WI5 A;  5IWA L;  4X62 L;  2IY5 B;  4TKO B;  5CBE E;  4UP9 A;  1B9M A;  4IAL A;  3H6M A;  5GAD C;  1I94 L;  1IKM A;  2SNS A;  3STB C;  3NEL A;  4S3S A;  4YY3 Q;  2I5H A;  3M9B A;  2QA4 A;  1VF5 C;  2QCP X;  3QB3 A;  1MGS A;  3M7N A;  4CKE A;  2NUC A;  1I3Q H;  4AQY L;  1KAW A;  4MTK A;  3T16 A;  4PZ6 A;  4XQQ A;  3H09 A;  3HGB A;  3PUZ A;  3BDO A;  1PA6 A;  4B3S L;  3RR5 A;  4K8I A;  4DR4 Q;  1WYD A;  4WOR A;  3MHB A;  2R93 G;  1VQC A;  1F2Y A;  3PSI A;  3PF4 A;  1L0Y B;  3QR8 A;  4A3B B;  2A19 A;  1W6J A;  4DA2 A;  1Y1W B;  2F0Q A;  1TWC H;  4P72 A;  2ZTC A;  3RN5 A;  4OO1 G;  3PO2 B;  4LF8 L;  3DWA A;  4IUP A;  4NKL A;  5KIX A;  1STN A;  1EEF D;  1QNK A;  1EWI A;  1O78 A;  4KD3 A;  3PO3 G;  1S40 A;  1SMY D;  1S5F D;  2I5L X;  5FO7 B;  2LXJ A;  5JEA J;  2TMP A;  4XTC S;  1S5C D;  4KHZ A;  4HJ9 A;  1GUO A;  2WB1 G;  5CR3 A;  1K28 A;  2G9H D;  1CI3 M;  4FXK C;  4WFN 3;  4FVM A;  4XXE A;  1IYU A;  4IJL A;  3J81 c;  3U58 A;  4DF7 A;  1D5Z C;  4K5V A;  3BVG A;  2G9D A;  1SMX A;  2QEJ C;  4KN7 C;  4JI7 Q;  4JI2 L;  1Q82 C;  4FDB A;  4V0B A;  2F03 A;  2UUB L;  3NQI A;  3I4N G;  4RCO A;  2BDO A;  2I46 A;  2K32 A;  3CPW A;  3P20 A;  1YNJ D;  1K8G A;  3ERQ A;  1YBY A;  1UEB A;  2XRS D;  3PMF A;  1ILP A;  4I65 A;  4HCS A;  1EU3 A;  3JAM i;  1N9W A;  2AHO B;  1PTO B;  1HA6 A;  2B2V A;  3E9I A;  1M8A A;  2F0N A;  1ICF B;  2MFI A;  3BYY B;  1KLG D;  4PG3 A;  1QB5 D;  1XX8 A;  5EKI A;  4GLX A;  4OIK A;  5JVG 3;  3I73 A;  5FK9 C;  2K5W A;  1CA5 A;  1RTN A;  2B2Y C;  2RHQ B;  1I4G A;  1K3B C;  2D0P A;  2IX3 A;  2OXP A;  3UDG A;  5JEA G;  4I7Z C;  4GNX C;  1L1O A;  2VXW A;  1TWC B;  3PF5 A;  2A69 D;  1EYD A;  1STY A;  1EQR A;  2AMC B;  4KI0 A;  1YNN D;  2PQA A;  1UE5 A;  4LK1 C;  2K33 A;  4CDE C;  2B63 B;  3HOW H;  4IOA A;  1EQV A;  2PNR C;  1RF2 D;  4JI7 L;  2Z9H A;  2B3G A;  4F8M A;  4IPG A;  4A3B G;  1QNU A;  1O7Z A;  3LX0 A;  3U4V A;  1PH6 A;  4CBV A;  2R3Z A;  1B8A A;  3MXG A;  1Y1W G;  4X3T A;  4U67 3;  4A3E B;  3L0O A;  3PO2 G;  1VQA A;  3E5S A;  1HQM C;  1BXT A;  4A3C G;  3AFQ A;  4MTN A;  3CXC A;  1UAP A;  1PRT C;  1STG A;  2EJG C;  1SNP A;  3I2Z A;  3K58 A;  4GOP C;  1LTS D;  2Q8I B;  1PH4 A;  1JJ2 A;  3HOZ H;  3LGJ A;  3O13 A;  4RKB A;  1K9M C;  3MEH A;  4GKJ L;  3HKS A;  5ELB A;  5CBA E;  1L2F A;  4MZ9 A;  1ET6 A;  2L15 A;  4NXM Q;  4JPB W;  3AU7 A;  1U4L A;  3HOV H;  2CWP A;  4RG1 A;  3CRK C;  3KLS X;  1VQO A;  5C44 H;  4K2K A;  5EKL A;  1N32 Q;  2JE6 I;  4DK1 A;  1SYE A;  5GAE C;  2O2L D;  4K5W A;  1L0X B;  1H9K A;  1V1Q A;  1A3V A;  1X3E A;  4H7B A;  4QJF A;  2XWB B;  5C3X A;  1KC8 C;  2LS0 1;  1JB7 A;  2K03 A;  4IFD J;  2ZT9 C;  1I50 B;  1XPR A;  1NCV A;  4IUT A;  5C4J H;  2JA5 H;  4A3F H;  5IYD H;  4KD4 A;  1SLJ A;  3WDN A;  2EJF C;  4C56 C;  3SK5 A;  4LAA A;  1HH2 P;  4MIU A;  4UDU C;  4C1N K;  5IGG A;  4P2C B;  1S5E D;  1X3P A;  4DV0 L;  2O5I C;  4K2L A;  3EFX D;  4JBK A;  1SMY C;  5KNC A;  5ELC A;  3KF6 A;  3SVM A;  3MXN A;  1C4Q A;  3H3V I;  1SJH D;  5C4X B;  2UXC Q;  1NSN S;  5CMD A;  4CDD C;  1VQ7 A;  1R9T B;  3CCU A;  3HP3 A;  3HOZ B;  2N49 A;  3OTO Q;  5EPL A;  2B63 G;  1GD7 A;  3OYY A;  4YWM A;  4KKT A;  1QWY A;  1II3 A;  4A3G H;  2WP8 J;  3A8K E;  5JJZ A;  4CJ1 B;  3MFY A;  1UE7 A;  3HOV B;  1BDO A;  3B6Y A;  3D4D A;  3RZO H;  4R8I A;  1EYA A;  4IFD G;  5DM7 3;  1E24 A;  4P73 A;  4A3E G;  2ZJQ A;  1Q12 A;  5HGT A;  2MO1 A;  3H91 A;  3PUV A;  1HNZ Q;  4DV4 Q;  1NJI C;  3D3R A;  1SYF A;  2HQE A;  2J7Z A;  1L0W A;  1NNX A;  1KIX A;  1AH9 A;  1XWE A;  4A3J H;  1BR9 A;  4A3F B;  1VQH A;  2F0E A;  3TSS A;  2O5J C;  2EYO A;  4EQN A;  1CKM A;  3VR5 A;  3BZK A;  2E2J H;  2A69 C;  2Z0S A;  4LF6 Q;  3UDX A;  2Z4I A;  1SDF A;  1UUP A;  1Y1V H;  1HZA A;  1YNN C;  2UXC L;  3NBI A;  2F1M A;  1PH9 A;  1RTO A;  2WB1 E;  1RDP D;  2N3S A;  3T1H L;  4OO1 I;  5KEE A;  4J15 A;  2Q2T A;  2F0W A;  3OTO L;  4DV1 L;  4C3H B;  1K8M A;  4JVZ A;  3F2D A;  4DV7 Q;  1PH5 A;  1GHK A;  4WRD A;  2KHS A;  3QWN A;  3CW2 C;  1OXV A;  2K1B A;  1XJV A;  4JV5 Q;  5IYC G;  4ZAI A;  2JA6 B;  1H9J A;  4K5X A;  2NTT A;  1MIU A;  2F0P A;  3FP9 A;  4PNY A;  3A54 A;  4A3G B;  2UXB Q;  1K73 C;  3IRB A;  1PYS B;  4L6T B;  3W2D A;  4LF9 L;  2TSS A;  1E2W A;  1HNZ L;  4DV4 L;  5HUR A;  2C9O A;  2IW3 A;  4JI1 Q;  3GQB A;  1S5B D;  5C4X G;  1S5D D;  4V19 0;  1XTD A;  4WJ4 A;  4LFB Q;  4ZKC B;  3HOZ G;  4B3M Q;  4IN3 A;  1Y8O B;  2AWO A;  1PTO D;  1WD1 A;  2DGY A;  1Y8N B;  2RDF A;  1F2M A;  2R92 B;  1CSQ A;  4UP8 A;  4KV6 A;  2BH8 A;  3RLN A;  1CQF A;  1EY7 A;  1EZ6 A;  2BE5 D;  3CHB D;  3HOV G;  3S16 B;  4LF6 L;  1YI2 A;  4G4K A;  4L63 B;  3PV0 A;  2DN8 A;  4KMU C;  2ZXP A;  1ESR A;  1OXS C;  5JVH 3;  4H13 C;  1VQD A;  2RA4 A;  3A7L A;  3PUY A;  3AMU A;  1IBL Q;  1RL2 A;  1X6O A;  2IJ0 A;  4DNR B;  2ES2 A;  2Z8L A;  2CQA A;  1AE3 A;  1VQG A;  2UUA Q;  1GHJ A;  1JJG A;  1G91 A;  4DV7 L;  4YHH Q;  2WIN B;  3CF5 A;  2UU9 Q;  4BBS H;  3CCQ A;  3OIQ A;  4JV5 L;  4DGZ A;  3HOY H;  4GNX A;  5IYD G;  1EY5 A;  4A3F G;  4FF2 A;  1A3U A;  2EVB A;  3CME A;  1ASZ A;  1FNW A;  4EGV A;  2X6L A;  1EZ8 A;  1EQT A;  2SDF A;  5ELE A;  1RHP A;  4C3J B;  3OW7 A;  2K5N A;  1SN8 A;  1GUN A;  1BOS A;  2K5Q A;  3QJY A;  2K14 A;  2R61 A;  1CKO A;  2FXQ A;  3D6W A;  2Q2I A;  1HFG A;  4B3M L;  1GVP A;  2OF1 A;  1Q1B A;  3BVM A;  4C3H G;  1EL0 A;  3FKI B;  4L8J A;  4JI8 Q;  4DUZ L;  3I4L A;  4R4T A;  3U9O A;  4YCU A;  4X65 Q;  1JT8 A;  2A8V A;  2JA6 G;  3HOU H;  2E5L Q;  2ZJR A;  4A3G G;  4OEM B;  1XPU A;  1VQB A;  1K3R A;  1SYC A;  3C3L A;  3M4O H;  2A74 C;  1IBL L;  3L2P A;  3LWU A;  1PXU A;  4CHT B;  1PFM A;  4YHH L;  4QIW B;  2UU9 L;  2NVY H;  2VQF L;  1XPO A;  1C0A A;  5C3W A;  2QF7 A;  2QIL A;  4IUU A;  2KEC A;  1YIJ A;  1ASY A;  4N8F A;  3AQQ A;  1O80 A;  2R93 H;  4ZK9 B;  1PH7 A;  2OWO A;  1AP0 A;  4B3T L;  3S1M B;  4B9X A;  2OEO A;  4BBS B;  4MNO A;  2R92 G;  4JBM A;  1AEX A;  3DXJ C;  5K36 H;  2EE1 A;  3HOY B;  1HZ9 A;  1WTP A;  2AQ3 B;  2K4K A;  3K7U C;  3JC6 6;  4HSP A;  4RA8 A;  1EFI D;  1WTW A;  1BNZ A;  1UWV A;  1PRT F;  1PFS A;  1IBM L;  3PO3 H;  4ZUI A;  1K83 H;  4P74 A;  1SE4 A;  4KKS A;  4G7Z C;  4OWW B;  2QKI C;  4DNI A;  1YZ6 A;  2OQK A;  4A3I B;  2YU9 B;  2VZA A;  1TWG H;  3WOE A;  1EWC A;  1X54 A;  2F52 A;  4X65 L;  3K0X A;  3M4P A;  1EFW A;  1VDZ A;  4DV2 Q;  2B2W C;  2WII B;  1DYQ A;  2OT2 A;  3S2D B;  3I55 A;  2CKZ B;  4DAM A;  2XSC A;  1QUQ B;  3PUX A;  4H44 C;  3I4N H;  3HOU B;  5DM6 3;  2F0K A;  2VB2 X;  4OHJ A;  4DK3 C;  4C3J G;  4K6D A;  2F0I A;  2KCT A;  2B8G A;  4C2M H;  3E9H A;  1YIT A;  5BN4 A;  2F3V A;  2EY6 A;  1J6Q A;  3PQI A;  4IFD I;  3M4O B;  4R4C A;  3GO5 A;  4OX9 L;  1PTO C;  1FJG Q;  1YJ9 A;  1SEB D;  4CKB A;  5CC4 A;  1HTP A;  2A68 D;  3FKI G;  2BE5 C;  1VQK A;  5FO8 B;  5CV5 A;  1VS0 A;  3A8J E;  2JEB I;  3IFD A;  4XYQ A;  4JW0 A;  1QG7 A;  3HS0 C;  3VDY A;  3DEP A;  2NZO A;  4YCW A;  2VQE Q;  3NP8 A;  1VQP A;  5JEA H;  4A93 B;  1XNR Q;  3C1E A;  2JEA I;  4OON A;  1FNV A;  3J80 c;  2EY5 A;  4WJW A;  3ICE A;  3NPP A;  2K52 A;  4DV2 L;  1TQO A;  2ALY B;  3GTM B;  1HA5 A;  3HOX H;  3CU7 A;  2KCC A;  4BBS G;  1OXU A;  4A3B H;  4JI0 Q;  1BCP B;  1ZYR D;  1E2V A;  3KDF A;  3DHQ A;  3HOY G;  3W1B A;  3S14 H;  2MJ8 A;  3C46 A;  1VQF A;  3GV6 A;  1MBY A;  3OPO A;  3NWT A;  3GV3 A;  4HMI A;  3JAM L;  3GTP B;  4X64 Q;  1GUG A;  1GO3 E;  1EYC A;  4DAP A;  1N36 Q;  3G71 A;  3MTS A;  3J7Y W;  3Q8D A;  4C2M B;  2KCN A;  5T1I A;  3J81 L;  4A3I G;  1A8V A;  3BDC A;  1KQS A;  2B2U C;  3UE1 A;  4LF4 Q;  3D0F A;  4ILW A;  2ICE C;  1EY8 A;  1V43 A;  5DAU A;  3KF8 A;  1LTA D;  3KLS A;  2F0M A;  4GN5 A;  2VNU D;  1LTI D;  4NXN Q;  2F4V Q;  4PZ8 A;  1LTB D;  3G6E A;  1WCM B;  3L7Z C;  1XNR L;  4DV5 Q;  1XNQ Q;  3HOU G;  2PPB C;  4RWS C;  2B2T C;  4RHS A;  3FPP A;  1CTM A;  2OCE A;  3NK9 A;  3CC4 A;  4DXF A;  1DD2 A;  3T4A C;  1SE2 A;  4IPC A;  5KNB A;  1PVO A;  1W6K A;  1I4R A;  5KYL A;  5EAY A;  2PZU A;  2Y0S B;  1JE5 A;  1PTO H;  4QY7 A;  1AE2 A;  3S15 H;  3G7L A;  3GP7 A;  4JI0 L;  4KKU A;  3V05 A;  4EVO A;  5HY6 A;  3NBH A;  5D3I B;  2DNC A;  2NVQ H;  2D9U A;  3K8A A;  4DU9 A;  3WWV A;  4LFA Q;  3HOX B;  4LFC Q;  3D4R A;  4AYB B;  2UUC Q;  3BJU A;  2XIW A;  5K36 G;  3PCO B;  2PYK A;  2YTX A;  1V1P A;  4X64 L;  1NTG A;  3S14 B;  4DK0 A;  4A93 G;  2Q2U A;  4R8N A;  5C4Z A;  1VQ9 A;  3W1G A;  2HIV A;  1DGS A;  3DM1 A;  4HJ7 A;  3TN2 A;  1EOT A;  3OWE B;  1IBK Q;  3GTO B;  4QMG A;  4DR1 Q;  1K8O A;  2A6H D;  2F3W A;  1SXT A;  3MAQ A;  2B63 H;  3AB9 A;  3PIO A;  2PZW A;  4DAY B;  1CM9 A;  4JI5 L;  3I4O A;  3NXW A;  1ILQ A;  3S24 A;  3JAM c;  4NXN L;  1ZXT A;  1V8Q A;  1KNE A;  1MSH A;  4R4Q A;  3MEF A;  1FGB D;  4ULL A;  4DV5 L;  4DR6 Q;  4LNQ A;  4IFD H;  4ZKB B;  1RKN A;  3SEB A;  4R4I A;  3ER0 A;  5AJ3 Q;  2MNA A;  4A3E H;  3J7A V;  4LF5 Q;  4YY3 L;  5ELO A;  3CC7 A;  4PZ7 A;  1QVG A;  2FMM A;  1KXL A;  5DLQ E;  2LFN A;  2KHJ A;  5M5X H;  2A68 C;  1LTL A;  2I5M X;  3GTG B;  4AIM A;  1SE8 A;  2E2H B;  2KA7 A;  2F0T A;  4XQJ A;  2Z1C A;  4OL7 A;  4DR4 L;  2DJF C;  4HMJ A;  5EKK A;  3TRZ A;  1MKH A;  2D5D A;  4O1N A;  3SR1 A;  3S15 B;  3Q23 A;  3CRL C;  4CDC C;  1BO0 A;  2NVQ B;  4A3D H;  3EN2 A;  1WCM G;  1Z7T A;  5BR8 Q;  4LW1 A;  2NVX H;  3KJP A;  3GTJ B;  3F2U A;  1IBK L;  1ENC A;  1F77 A;  2CW0 D;  4DR1 L;  1C8C A;  2I07 B;  1I50 H;  3NWS A;  4YWL A;  3K6O A;  5M3M B;  2L1B A;  1E0B A;  2Y0S G;  1ZYR C;  3ZJY C;  3A56 A;  3H94 A;  3OMG A;  3OWF A;  4XDX A;  5CYU A;  2IX1 A;  1G2S A;  1ZKO A;  4ME5 A;  5IYC H;  3IL8 A;  4DR6 L;  2XNA C;  4A3K B;  5LL6 S;  3HOX G;  5AJ3 L;  1TU2 B;  2A1A A;  4AYB G;  5H1S E;  1C7Y A;  1HNX Q;  2C5C A;  1ONL A;  2KUM A;  2RCN A;  1YHA A;  3A5U A;  3CCE A;  4N9T A;  1DJR D;  1D1I A;  3I7F A;  4IUQ A;  1T5X D;  1EOV A;  1MHW C;  2B2W A;  2K5H A;  5C4X H;  2EYL A;  2YV5 A;  1R9T H;  1WVL A;  3K5L A;  4F88 A;  1FYC A;  1LAC A;  4HJ5 A;  5M5X B;  1IHZ A;  2RBM A;  3UI2 A;  2I0Q A;  5GQO A;  5JJL A;  2EY2 A;  1U0L A;  3VA7 A;  1KAB A;  2UXD Q;  5A2Q E;  2VUM B;  3KF6 B;  3KBX A;  5BR8 L;  2EYM A;  4QIW E;  4JI4 Q;  3NTI A;  3R2T A;  1V1O A;  3MXP A;  1KNA A;  2CH4 A;  4J6H A;  1VQ6 A;  2HD3 A;  3EBE A;  1D6E C;  4A3D B;  2PW7 A;  4PMC A;  2NVX B;  2MO0 A;  4HIK A;  1TKW B;  2XTI A;  1DOL A;  1DZ1 A;  3TZD A;  3ERS X;  3RUZ A;  1EY6 A;  3W5O A;  5TSS A;  5LMU Q;  2A73 B;  2KEN A;  2WAC A;  1VQ4 A;  1IL2 A;  1N34 Q;  5A35 A;  3IFT A;  3J81 E;  1PH8 A;  3ITP A;  2Z6K C;  2J4X A;  1I4H A;  1BCP D;  2AQ2 B;  1SNC A;  1SNM A;  2NVT H;  3PIP A;  3TP7 A;  1EWH A;  4KY7 A;  3SXH A;  3H15 A;  5CV7 A;  4DN4 M;  5COR A;  4ZLT F;  1VQN A;  1SFO H;  2KJX A;  4DR5 Q;  1JOK A;  1VQM A;  1M90 C;  2A6H C;  1KRT A;  1G51 A;  2SNM A;  3D4W A;  1PTO F;  3U4Z A;  5M3M G;  4C3H H;  3T1Y Q;  1A2T A;  4LF7 Q;  1LUZ A;  4JBJ A;  3MFG A;  1Q90 A;  4NXM L;  3K7A H;  5ISR A;  3TRE A;  2HCI A;  1DM0 B;  4IUV A;  5EPK A;  1KDA A;  1RD9 D;  1F9S A;  2DUD A;  1NUC A;  4ZQ3 A;  3BZD B;  5FLM G;  3K5N A;  2JA6 H;  1N32 L;  3I70 A;  1JOO A;  4JI4 L;  4A3K G;  2EYP A;  2N88 A;  3MWY W;  3SK8 A;  3SE0 A;  1YJW A;  1YNJ C;  4UP7 A;  3T53 B;  1S4Z A;  4FNF A;  4YIJ A;  2PNH A;  1JCK B;  2F0H A;  4JOI C;  5FO9 B;  1EIH A;  4NP5 A;  3ND8 A;  4R4O A;  1ROD A;  5LMU L;  4PQX A;  3TS2 A;  2B39 A;  4JBW A;  3DWQ A;  1Q8I A;  2JQO A;  1EUJ A;  5EGT A;  4CJ0 B;  3FMC A;  2R92 H;  2D62 A;  4MHE A;  2VUM G;  5IT9 c;  3S16 H;  1HCZ A;  3N6R A;  4ME3 A;  1B2T A;  3CQZ H;  4YWK A;  1QE6 A;  2FIN B;  4ABN A;  2NVT B;  5COY A;  4RHR A;  3CCM A;  5I2X A;  4DR2 Q;  4J1M A;  1GM5 A;  4A3D G;  1SFO B;  2DJG C;  4X66 Q;  1JOR A;  1TR5 A;  5E3F A;  3FEW X;  3T1Y L;  2K5V A;  4HTH A;  4BBR H;  1D5X C;  4XQN A;  3AEV A;  2Q8T A;  1JR0 D;  3P7J A;  2V4D A;  1STB A;  5KND A;  3J81 j;  4IUR A;  1NAP A;  2KCM A;  1HR0 W;  2XVS A;  3HKZ B;  3K7A B;  1KHI A;  1VQJ A;  1HZB A;  2LSS A;  5J3B A;  4BY1 H;  4HID A;  4JI3 Q;  3OIP A;  2VS1 A;  1E22 A;  1YHB A;  4C3J H;  1YVC A;  2R6G A;  3DLL A;  1PH2 A;  1G6P A;  2ICI A;  2QDB A;  2K05 A;  2AQ1 B;  2CFM A;  4AH6 A;  2K75 A;  2ZXO A;  1G2T A;  5C4H A;  3SK6 A;  5C0X H;  3SDZ A;  3FKI H;  4RKL A;  4DAV A;  3S2H B;  4RH6 A;  4HIM A;  1B1Z A;  1VMC A;  1AZP A;  3N52 A;  2ZJP A;  2HIX A;  1LV9 A;  2D0O A;  3R2I A;  2OTL A;  3EQL C;  1DCZ A;  4X66 L;  1EYG A;  2Y0S E;  3CQZ B;  1RIP A;  3S1Q H;  1QIL A;  5D14 A;  4OIJ A;  1VQL A;  1PDQ A;  1Z9F A;  3D8G A;  4CJ2 C;  4AYB E;  4BBR B;  4QUC A;  1TS4 A;  3VYR A;  1BCP C;  2PW5 A;  5I6Y A;  4R9W A;  4GN3 B;  3TP8 A;  2B2Y A;  3S1M H;  2A6E D;  1HR0 Q;  1PYW D;  4JI3 L;  4HCE A;  1BVS A;  1GOZ A;  4K6L A;  3HEJ A;  1J9O A;  3ZYY X;  1FGU A;  2UXB L;  1U9R A;  3WOF A;  3T13 A;  4QGU A;  4L5R C;  2R7Z H;  2NYZ D;  1VQI A;  4BY1 B;  3TME A;  3NTK A;  5FOB B;  1J5E Q;  1P16 A;  1XTC D;  1WTQ A;  4NB3 A;  4JI1 L;  2DY7 A;  2RSN A;  5IIF A;  3M4Q A;  3G4S A;  2YU9 H;  4A3I H;  1IYV A;  1HJP A;  2RHS B;  1LT3 D;  5BN5 A;  5I9P A;  1TY0 A;  1CKN B;  3X3M A;  3D6C A;  1O7Y A;  4LFB L;  2JA7 B;  2QW7 A;  4DXG A;  5M5Y H;  3HKZ G;  4IQZ A;  2B29 A;  1VF7 A;  5IOD A;  3S2D H;  1V9P A;  5LMN W;  4TRD A;  4ALP A;  3A74 A;  3KUP A;  4GOP A;  4LUZ A;  3I4M B;  2GN5 A;  4O0A A;  4RGM A;  4X3S A;  2K5D A;  4ZRZ A;  4CDF C;  1VMP A;  5FLX c;  5G3L D;  1KL9 A;  3S1Q B;  5D3D A;  3RLO A;  2UUA L;  4Z9C B;  1HZC A;  1LM0 A;  1G8Z D;  1H9S B;  3TP6 A;  4FF3 A;  1JC7 A;  1D7Q A;  4BXX G;  3R8B A;  3RLF A;  2NWG A;  1Q7Y C;  5FJ8 G;  3OSO A;  5J22 A;  3GTK H;  4O2D A;  4L5T A;  1QJO A;  1TWA B;  5C0X J;  2F0D A;  2VL6 A;  1J5E L;  1SAP A;  1WTR A;  4A93 H;  1X56 A;  4P75 A;  3J80 L;  1JJC B;  4J8Q A;  4JC0 A;  3GD7 A;  2F0V A;  1U4R A;  2R7Z B;  2F0G A;  1Q46 A;  3D31 A;  4DV3 Q;  3PUW A;  4M8A A;  4DV6 Q;  2KEE A;  2LMC B;  4BBR G;  3GTM H;  4JI8 L;  3CMA A;  1T9H A;  2OQ0 A;  2IHF A;  2AKW B;  1TWF B;  1CSP A;  3LWE A;  3M4Y A;  2XN9 C;  4IOC A;  2ASB A;  2JJQ A;  1SRU A;  2RKS A;  1Z6H A;  2ZTE A;  5I9O A;  5LMN Q;  2E5L L;  4HIO A;  3TBI B;  5M5Y B;  3I56 A;  1A3T A;  1NR2 A;  4DUY Q;  3URY A;  4BY1 G;  1WTO A;  3QOJ A;  3ND9 A;  3GTP H;  4NMZ A;  4GZY C;  5IYB G;  2F0O A;  3LNN A;  4NPS A;  1PFB A;  5GAG C;  5I2Y A;  4Q0F A;  4EX5 A;  1H9M A;  4WJ3 M;  4UHV A;  1KAA A;  3E6Z X;  1MD2 D;  1G6Z A;  2YTY A;  5IGB A;  2PZT A;  3K80 C;  2F0U A;  3R93 A;  2GVA A;  4F87 A;  5M3F H;  5GAH C;  5C0X G;  2JA7 G;  1D8L A;  2E75 C;  4HN7 A;  3H0G B;  1BBU A;  1KLU D;  3ULJ A;  5L37 A;  1LT6 D;  3CCR A;  4KHV A;  3KLR A;  4TVA B;  1BBX C;  4FYD A;  4JOI A;  3V96 A;  1WCM H;  2VB3 X;  3S1N B;  3K5O A;  3GTK B;  3I4M G;  4RAU C;  3E0E A;  3CCL A;  1SYG A;  1JWM D;  4JG2 A;  4LUV A;  1XMO Q;  4OWT B;  2H5X A;  1QZH A;  4DV3 L;  2HDM A;  1TS5 A;  4DV6 L;  3E3X A;  4RMF A;  3Q24 A;  4A3L G;  4UY8 C;  4ZCK A;  3RN2 A;  3NQT A;  3W3A A;  2WAQ B;  2XRQ D;  3KK7 A;  5LMN L;  1EY9 A;  3VR3 A;  1EIY B;  5IY0 A;  5KRU A;  1Y69 U;  5JJK A;  1E1O A;  4X62 Q;  2E2I H;  4A3M B;  1YNX A;  2EOT A;  5ELF A;  3VYU A;  2SOB A;  2X69 A;  5JAV A;  2R7Z G;  1QUQ A;  1DOM A;  2WKD A;  1HUN A;  2L5T A;  1PZI D;  3GTO H;  1FJG L;  4HR7 B;  5M5W H;  1I4X A;  1N8R C;  3U9S A;  2VY3 A;  1ESF A;  4AQY Q;  5EJW A;  5JJI A;  4OGQ C;  1MSG A;  1NMG A;  4RFB A;  1A0I A;  1LT5 D;  3NEN A;  1E3P A;  4POF A;  1CHQ D;  1AFP A;  4PMB A;  3G48 A;  2H1E A;  2RSO A;  5M3F B;  5JPM C;  2BH2 A;  1IKL A;  3T56 B;  2P5Z X;  2CHB D;  2MPM A;  1X65 A;  5EBC A;  2YTV A;  1XMO L;  4G7O C;  2VQE L;  3GDE A;  2KED A;  2EYJ A;  2K04 A;  2L11 A;  2HCC A;  2E76 C;  2NZ1 D;  4LF8 Q;  3GTG H;  2E2H H;  4Y52 H;  4Y7N H;  1QZG A;  2KQ3 A;  3FRP B;  3U50 C;  3VA5 A;  1X55 A;  2QDL A;  3VR4 A;  4LJZ C;  1C48 A;  4BA1 I;  4LMQ D;  4KLK A;  4OWX B;  1U4M A;  1I4P A;  2BA0 A;  4IO9 A;  3H0G G;  5IE8 A;  1LTR D;  3UDF A;  5T1G A;  3Q6S A;  1JOQ A;  4KY5 A;  1QCB D;  1E2Z A;  1SJE D;  4C1N I;  3RZD B;  1B50 A;  1ET9 A;  3KYH C;  3F2B A;  3DEO A;  1RJT A;  3GTJ H;  4DR3 Q;  1J8I A;  4JI2 Q;  3J7Z C;  3AFP A;  2WV6 D;  3PIO 3;  2UUB Q;  2E2I B;  1O7I A;  3I90 A;  4KJO A;  3I8Z A;  1N36 L;  3BVZ A;  1AZQ A;  4I7A A;  1MI2 A;  3HKZ E;  5M3M H;  1TXY A;  3A5Z B;  4UPA A;  2ENB A;  4LF4 L;  5M5W B;  1W3S A;  5FLM H;  4JI6 Q;  1LT4 D;  2WAQ G;  1SBB B;  1SYD A;  4K14 A;  4A3K H;  1B3Q A;  3NUC A;  2FMC A;  4BA2 I;  3X3N A;  1PLF A;  3TP5 A;  2F4V L;  5F2D A;  4KK7 A;  3A8I E;  2KOL A;  2IHE A;  3ONA B;  4A3M G;  1L1O B;  1XNQ L;  1HRJ A;  1TVX A;  4FP5 D;  1A63 A;  1EY0 A;  2PO4 A;  2PQA B;  1GUS A;  2VW9 A;  3J80 E;  4QQB X;  1G29 1;  1MJE A;  4LUO A;  2PQE A;  5LL6 X;  3CD6 A;  2NN6 H;  4C3I B;  4OEL B;  2PI2 E;  3S1R H;  4Y7N B;  1BCP F;  1X32 A;  2JN4 A;  1IW7 D;  4K8J A;  2VUM H;  3HRZ C;  1X3Q A;  3CC2 A;  1JWS D;  2JA8 B;  3E0J A;  5M3F G;  4LFA L;  4DR7 Q;  4LFC L;  2UUC L;  4DR3 L;  1B7Y B;  4BS9 A;  1A15 A;  2OTJ A;  2B8F A;  4IUN A;  3M85 A;  2R7F A;  4CKC A;  2L55 A;  2EXD A;  1IZ6 A;  2CH4 W;  2ID0 A;  2WKC A;  4R1J A;  4RGO S;  3TQY A;  1B3A A;  1CHP D;  2RQX A;  5IP9 G;  2A5H A;  4GKJ Q;  1I3Q B;  3P1H A;  4JI6 L;  2EY1 A;  4DNT B;  3KFU A;  3QOL A;  1F2Z A;  4ID6 A;  1TWH H;  1SNO A;  3J81 i;  5J39 A;  3UE0 A;  1LTT D;  1Y14 B;  4DAY A;  1UEA B;  1STE A;  1NBW A;  5IP7 G;  2YYZ A;  1OXX K;  2AUJ D;  2E2D C;  4LF5 L;  4BWG B;  4GLA C;  3MC0 B;  1WD0 A;  2MP1 A;  2IWH A;  1CQV A;  1WJJ A;  3UDI A;  4CGY B;  5BN3 A;  1TT2 A;  1GUT A;  1D1K A;  1DON A;  4PMW A;  1VCI A;  4DR7 L;  3S1R B;  1CUK A;  3ERO A;  5C6A A;  2RDG A;  2FHT A;  4HAE A;  5C0X I;  3QO2 A;  4HJ8 A;  1E1T A;  2NB0 A;  3MXN B;  4DV0 Q;  1KD1 C;  1CZG A;  5IGC A;  1ICW A;  2F0S A;  1HFN A;  5IT9 L;  2XWJ B;  1R4Q B;  3CPF A;  4N9P A;  1KTK A;  3DMU A;  4C3I G;  3PIP 3;  1T5E A;  3JAM E;  4LWC A;  2C35 B;  2ZTD A;  4X3U A;  4GN4 B;  3BYT B;  1B4O A;  2JA8 G;  1GJX A;  4KHP Q;  2K28 A;  2F0L A;  1HNX L;  1TWH B;  5LHY 1;  1EU4 A;  1X3F A;  1I6V C;  1CK1 A;  4B08 A;  1LAB A;  4ZYS A;  2LKV A;  2MQH A;  1JWU D;  3V2T A;  1JB3 A;  1R4P B;  1PH3 A;  4Q5V A;  1WFQ A;  2HQL A;  1AW7 A;  1I5F A;  2BDN A;  3C2P A;  1PHJ A;  5NUC A;  3L3O C;  1HXY D;  3FHW A;  4EQO A;  5ELD A;  2BA1 A;  1Q3L A;  2X6G A;  3TS0 A;  4QL5 A;  1GXD C;  2L4N A;  2UXD L;  2NZH A;  3HOW B;  2HDL A;  2GVB A;  1EEI D;  4F7X A;  1PFN A;  3K0Y A;  5C3E H;  1M1K C;  3CCJ A;  3QIA A;  1MJC A;  2JSO A;  4XT1 B;  1FNU A;  1Y8P B;  2G5D A;  1OO9 B;  1Z47 A;  2HHH Q;  4E6I A;  2B2U A;  5E7N A;  2PMZ B;  1VQ8 A;  3KJO A;  3NSW A;  1P8L A;  3T1H Q;  1H95 A;  2MHV A;  1IW7 C;  1OXT A;  3BU2 A;  2CVR A;  1GUW A;  1K0S A;  1HTL D;  4BXX H;  3S2H H;  4DV1 Q;  4KHP L;  5CV4 A;  1N34 L;  3NEM A;  1FD7 D;  2NN6 G;  1UNS A;  5FJ8 H;  2AWN A;  1PMR A;  2B2T A;  2KBN A;  2F4I A;  5AFW A;  2M00 A;  5HGQ A;  1LO5 D;  5C44 B;  1BUV T;  1M4V A;  1UE6 A;  4POG A;  5IOC A;  3NTH A;  2IX0 A;  4DR5 L;  4IPH A;  4LF9 Q;  3VR6 A;  2CW0 C;  3CCV A;  3M7G A;  4DPG A;  4A75 A;  4PV1 C;  1UE1 A;  2WAQ E;  1TY2 A;  3RD4 A;  4EQ5 A;  1ENF A;  3TDQ A;  3G6J B;  2GA4 B;  5FKA C;  4LF7 L;  3M3Y H;  1Q86 C;  1JQY D;  5M9O A;  4XYO A;  4DFA A;  1S3O A;  5C4J B;  5E1F A;  2JA5 B;  1XYI A;  1SNQ A;  3H3V C;  1I6H H;  1VQE A;  1VQ5 A;  1N33 Q;  2F3I A;  4GKK Q;  3VYT A;  2E8G A;  4G7H C;  4FO2 A;  3VYS A;  2HHH L;  2K01 A;  5G3L F;  3EA6 A;  2J0T D;  5C3E B;  5IYB H;  5EBD A;  3F8T A;  2N78 A;  1QVC A;  1ZEQ X;  3KBG A;  2NTS A;  5GRO A;  1AN8 A;  2AUK A;  5C5M A;  4A4I A;  2HUG A;  3HG9 A;  5CV8 A;  4DKA C;  4GNX B;  2JA7 H;  4QCL A;  4FXG C;  4X6A H;  1SYB A;  1PV4 A;  3BG3 A;  3GTQ H;  1JIC A;  3HOW G;  1Q81 C;  1QVF A;  1HQR D;  1I4Q A;  4GS3 A;  2D2C C;  5FLX L;  1F2L A;  5I6W A;  1QOH A;  4APV A;  4BY7 H;  2EPB A;  3I4M H;  1YJN A;  1YHQ A;  2FFK B;  1B44 D;  1B9N A;  3RZO B;  3MA2 B;  4DR2 L;  3F1Z A;  4B9W A;  1KDC A;  4TSS A;  1Q1E A;  5CV6 A;  2DNE A;  3BZC A;  3K59 A;  1LYL A;  3S9W A;  1TS3 A;  3TEH B;  3IKJ A;  4ZUJ A;  1SE3 A;  2JYO A;  4A3L H;  1FVI A;  3QG1 A;  1PRT B;  4JCV E;  3J7A 5;  3CAM A;  4GOP B;  1N33 L;  3M3Y B;  4GKK L;  1ENA A;  2ATW A;  2JK8 A;  1F9R A;  1BKB A;  3ULL A;  4DUZ Q;  2L0C A;  3F2C A;  3SHL A;  4A3J B;  1TWA H;  5C44 G;  3NHH A;  3EIV A;  4QF4 A;  1OTC A;  4DK6 C;  1X3G A;  1I6H B;  1LTG D;  2Q2H A;  4XIG S;  3DWP A;  1CA6 A;  2E2J B;  3A55 A;  1NMF A; 
#chains in the Genus database with same CATH homology
 1KXL A;  3KF6 A;  5DLQ E;  4HJA A;  1QZH A;  2KHJ A;  1A62 A;  4DV3 L;  3H3V I;  5M5X H;  1LTL A;  2I5M X;  2UXC Q;  2KHI A;  4AIM A;  1SE8 A;  4DV6 L;  2VQF Q;  1VQ7 A;  4RMF A;  3CCU A;  4UY8 C;  1E7Z A;  4A3L G;  1TWF H;  2N49 A;  3OTO Q;  1U5K A;  3ULP A;  2JA5 G;  3RN2 A;  4DR4 L;  2B63 G;  3TRZ A;  1GD7 A;  3OYY A;  4YWM A;  1MKH A;  5LMN L;  4JYA Q;  4PZ7 A;  4K0K Q;  4OXP A;  4A3G H;  4B3T Q;  2WP8 J;  1EIY B;  5IY0 A;  1IXR A;  5JJK A;  4YCV A;  1E1O A;  1UE7 A;  3H3V H;  3B6Y A;  4X62 Q;  4A3D H;  3EN2 A;  3RZO H;  1WCM G;  2E2I H;  1YNX A;  5C3E G;  3SGI A;  5BR8 Q;  1EQQ A;  4LW1 A;  4IFD G;  2NVX H;  3KJP A;  1E24 A;  2PI2 A;  4P73 A;  4A3E G;  2ZJQ A;  1Q12 A;  2R7Z G;  1QUQ A;  2MO1 A;  1IBK L;  4DR1 L;  1HNZ Q;  3PUV A;  1IBM Q;  4DV4 Q;  1I50 H;  4YWL A;  5M5W H;  1FJG L;  1NJI C;  3GTO H;  1N8R C;  2VY3 A;  4AQY Q;  5JJI A;  1NMG A;  2Y0S G;  1L0W A;  3ZJY C;  3H0G H;  1A0I A;  1KIX A;  1AH9 A;  1HR0 L;  4IJH A;  3NEN A;  1E3P A;  1NE3 A;  4P71 A;  4POF A;  1K8A C;  2IX1 A;  5IYC H;  3G48 A;  4B3R Q;  4A3J H;  3K81 C;  1C9O A;  2BH2 A;  1VQH A;  4DR6 L;  3HOX G;  3S1N H;  5AJ3 L;  2A1A A;  1X65 A;  4AYB G;  5H1S E;  1CKM A;  1C7Y A;  1HNX Q;  3BZK A;  2YTV A;  1XMO L;  2E2J H;  2VQE L;  3GDE A;  2RCN A;  2Z0S A;  1YHA A;  3A5U A;  1SRO A;  4LF6 Q;  3UDX A;  3CCE A;  3I7F A;  2ZM6 Q;  1Y1V H;  1HZA A;  2UXC L;  1EOV A;  4LF8 Q;  1PH9 A;  2K5H A;  5C4X H;  3GTG H;  2WB1 E;  2N3S A;  3T1H L;  1KRS A;  4Y7N H;  2E2H H;  4Y52 H;  1QZG A;  3STB D;  2YV5 A;  3U50 C;  4OO1 I;  1R9T H;  2Z6K A;  1X55 A;  4J15 A;  2Q2T A;  4OX9 Q;  3OTO L;  1B70 B;  4HJ5 A;  1JMC A;  4DV1 L;  1Q8K A;  4JYA L;  4K0K L;  4BA1 I;  4KLK A;  4OWX B;  2I0Q A;  1JJG A;  3F2D A;  5GQO A;  4DV7 Q;  2BA0 A;  1PH5 A;  1HNW Q;  5JJL A;  2CQO A;  4IO9 A;  3H0G G;  1XMQ Q;  1U0L A;  2EQS A;  3CW2 C;  1OXV A;  1CKN A;  5IE8 A;  2UXD Q;  3UDF A;  1L1O C;  1WOC A;  1XJV A;  4JV5 Q;  5IYC G;  1PYB A;  3KOJ A;  4A3J G;  3KF6 B;  1PH1 A;  1MIU A;  3FP9 A;  5BR8 L;  4A3M H;  1GKH A;  4QIW E;  3DM3 A;  4JI4 Q;  3KYH C;  3F2B A;  1K73 C;  2UXB Q;  3GTJ H;  3IRB A;  1PYS B;  4DR3 Q;  4LF9 L;  4JI2 Q;  3J7Z C;  1VQ6 A;  3AFP A;  2UUB Q;  3EBE A;  1HNZ L;  4DV4 L;  1O7I A;  3GTL H;  1N36 L;  1K0R A;  1Y1V G;  4JI1 Q;  2LXK A;  2MO0 A;  2RF4 A;  4HIK A;  3HKZ E;  5M3M H;  2XTI A;  5C4X G;  3ERS X;  1X9N A;  1TXY A;  1XTD A;  3A5Z B;  2EIF A;  4UPA A;  3W5O A;  4A76 A;  4LF4 L;  4B3R L;  4WJ4 A;  3PGZ A;  5LMU Q;  2KEN A;  3HOZ G;  1VQ4 A;  4LFB Q;  3KDF B;  4B3M Q;  1IL2 A;  1W3S A;  2AWO A;  5FLM H;  4IPD A;  1N34 Q;  2DGY A;  2K50 A;  4JI6 Q;  2WAQ G;  4A3K H;  1PH8 A;  2N8N A;  4BA2 I;  1CSQ A;  4UP8 A;  2Z6K C;  2BH8 A;  3RLN A;  2NN6 I;  2F4V L;  3HOV G;  4GLV B;  4LF6 L;  2NVT H;  3PIP A;  1YI2 A;  2IHE A;  1VQN A;  3PV0 A;  3H15 A;  2ZM6 L;  1L1O B;  4A3M G;  1XNQ L;  1SFO H;  4BY7 G;  4DR5 Q;  1A63 A;  1VQM A;  1OXS C;  1YEZ A;  1M90 C;  1KRT A;  1VQD A;  1G51 A;  2PQA B;  3CCS A;  3PUY A;  2VW9 A;  1IBL Q;  4QQB X;  5IP9 H;  1G29 1;  1RL2 A;  1X6O A;  3U4Z A;  1S72 A;  2ES2 A;  1MJE A;  3S17 H;  1AE3 A;  4LUO A;  1VQG A;  2UUA Q;  5M3M G;  4C3H H;  3CD6 A;  1EIF A;  4DV7 L;  3T1Y Q;  2PI2 E;  4YHH Q;  3CF5 A;  3S1R H;  2UU9 Q;  4LF7 Q;  1HNW L;  1XMQ L;  3HFZ B;  1LUZ A;  4JBJ A;  4BBS H;  3CCQ A;  3KF8 B;  4NXM L;  2V1C C;  3K7A H;  3TRE A;  4JV5 L;  2DUD A;  2VUM H;  3OW2 A;  3HOY H;  3CC2 A;  4GNX A;  5IYD G;  5FLM G;  5M3F G;  4A3F G;  2JA6 H;  3RZD H;  4LFA L;  4DR7 Q;  2CCZ A;  4JI4 L;  4A3K G;  4LFC L;  3CME A;  1N32 L;  2UUC L;  1ASZ A;  4DR3 L;  4TQU S;  1B7Y B;  5IP7 H;  4DUY L;  1BBW A;  2OTJ A;  5IWA Q;  1YJW A;  4UP7 A;  3M85 A;  2R7F A;  2CWA A;  1NY4 A;  2EXD A;  2IT1 A;  1I94 Q;  4L5Q A;  2K5N A;  1IZ6 A;  1SN8 A;  3KLW A;  2R7D A;  2PNH A;  2ID0 A;  2K14 A;  4R1J A;  1W2B A;  4JOI C;  1CKO A;  3TQY A;  4R4O A;  2FXQ A;  5IP9 G;  5LMU L;  3TS2 A;  2Q2I A;  3NBH B;  4B3M L;  4GKJ Q;  3A0J A;  4JBW A;  1GVP A;  2QGQ A;  1Q1B A;  4JI6 L;  2JQO A;  1EUJ A;  3KFU A;  4JI8 Q;  3RNU A;  2R92 H;  2D62 A;  1TWH H;  4DUZ L;  4B3S Q;  3J81 i;  2VUM G;  5IT9 c;  4R4T A;  2HT1 A;  4YCU A;  2PMZ E;  3UE0 A;  3S16 H;  1Y14 B;  4X65 Q;  2A8V A;  2JA6 G;  3HOU H;  4ME3 A;  1Y1W H;  1JT8 A;  2E5L Q;  3CQZ H;  2XGT A;  2ZJR A;  3PO2 H;  4A3G G;  1NBW A;  5IP7 G;  2YYZ A;  4YWK A;  1XPU A;  1OXX K;  4LF5 L;  1VQB A;  1K3R A;  4A3C H;  3M4O H;  1IBL L;  3L2P A;  4GLA C;  2WFW A;  4DR2 Q;  3CCM A;  1GM5 A;  4A3D G;  4X66 Q;  3T1Y L;  2K5V A;  3J80 i;  4YHH L;  4BBR H;  2JA9 A;  2UU9 L;  4C3I H;  2NVY H;  2VQF L;  3AEV A;  4L5S A;  1IYJ B;  1XPO A;  1WJJ A;  3UDI A;  3CP0 A;  1C0A A;  3AYH B;  1YIJ A;  1ASY A;  3AQQ A;  2JA8 H;  4PMW A;  2R93 H;  1VCI A;  3J81 j;  1PH7 A;  2OWO A;  4JI5 Q;  2KCM A;  4DR7 L;  4H02 A;  1CUK A;  1HR0 W;  2QEX A;  4B3T L;  5ELN A;  4MNO A;  2R92 G;  4JBM A;  5C0X I;  1FL0 A;  2LSS A;  1KHI A;  1HZB A;  1SR3 A;  1VQJ A;  1E1T A;  5J3B A;  1WI5 A;  5IWA L;  4HID A;  4X62 L;  4HJ8 A;  1HZ9 A;  4BY1 H;  4JI3 Q;  2IY5 B;  2VS1 A;  1E22 A;  2K4K A;  4UP9 A;  3MXN B;  5GAD C;  4DV0 Q;  1I94 L;  1YHB A;  3K7U C;  1KD1 C;  3STB C;  4C3J H;  3NEL A;  3JC6 6;  4YY3 Q;  1YVC A;  2R6G A;  2I5H A;  3DLL A;  1PH2 A;  1G6P A;  3M9B A;  1UWV A;  2QA4 A;  1IBM L;  1PFS A;  2CFM A;  4AH6 A;  2K75 A;  3PO3 H;  1K83 H;  4P74 A;  3M7N A;  4OWW B;  1I3Q H;  3CPF A;  4DNI A;  4AQY L;  1KAW A;  1YZ6 A;  2OQK A;  2VZA A;  3FKI H;  4PZ6 A;  1TWG H;  3PUZ A;  1PA6 A;  4LWC A;  2C35 B;  2ZTD A;  4B3S L;  1X54 A;  4GN4 B;  4OWT B;  3RR5 A;  4DR4 Q;  2F52 A;  1WYD A;  4X65 L;  3K0X A;  3M4P A;  2JA8 G;  1EFW A;  4KHP Q;  2R93 G;  4DV2 Q;  1VQC A;  4HIM A;  3PSI A;  3PF4 A;  1HNX L;  3I55 A;  2CKZ B;  4DAM A;  2A19 A;  2ZJP A;  1QUQ B;  1X3F A;  3PUX A;  3I4N H;  2HIX A;  2D0O A;  2OTL A;  1TWC H;  2MQH A;  4P72 A;  4X66 L;  2Y0S E;  2ZTC A;  1RIP A;  4DK3 C;  3RN5 A;  1EYG A;  4LF8 L;  2KCT A;  3S1Q H;  4OO1 G;  4C2M H;  1PH3 A;  3E9H A;  1YIT A;  1J6Q A;  4IFD I;  1WFQ A;  2HQL A;  4R4C A;  1EWI A;  3GO5 A;  4OX9 L;  1FJG Q;  1S40 A;  1YJ9 A;  1VQL A;  3PO3 G;  1I5F A;  1Z9F A;  1PHJ A;  2I5L X;  3FHW A;  4AYB E;  2LXJ A;  5JEA J;  2BA1 A;  4XTC S;  3FKI G;  1VQK A;  4KHZ A;  4HJ9 A;  4GN3 B;  4QL5 A;  3TS0 A;  3S1M H;  2WB1 G;  1VS0 A;  1HR0 Q;  2UXD L;  2NZH A;  4JI3 L;  2GVB A;  1BVS A;  2JEB I;  5C3E H;  1M1K C;  3CCJ A;  3VDY A;  4IJL A;  3J81 c;  3U58 A;  1MJC A;  2NZO A;  1FGU A;  4JI7 Q;  2UXB L;  1SMX A;  4YCW A;  4QGU A;  4L5R C;  2R7Z H;  4JI2 L;  1Q82 C;  1VQI A;  4FDB A;  2VQE Q;  1VQP A;  1Z47 A;  2UUB L;  3I4N G;  2HHH Q;  1J5E Q;  1P16 A;  1XNR Q;  5E7N A;  2JEA I;  3CPW A;  4NB3 A;  4JI1 L;  1VQ8 A;  3KJO A;  1K8G A;  1P8L A;  4OON A;  3T1H Q;  1YBY A;  3M4Q A;  1H95 A;  3G4S A;  2YU9 H;  4A3I H;  1OXT A;  3BU2 A;  1HJP A;  1UEB A;  2RHS B;  1CKN B;  3J80 c;  4BXX H;  3S2H H;  4LFB L;  3ICE A;  4DV1 Q;  4KHP L;  3JAM i;  2K52 A;  4DV2 L;  1N9W A;  2AHO B;  1N34 L;  2ALY B;  3NEM A;  2NN6 G;  3E9I A;  5FJ8 H;  3HOX H;  2AWN A;  5M5Y H;  3HKZ G;  2MFI A;  2B29 A;  2KBN A;  4BBS G;  1OXU A;  4PG3 A;  4A3B H;  4JI0 Q;  4GLX A;  3S2D H;  5HGQ A;  3KDF A;  1V9P A;  5LMN W;  3HOY G;  3W1B A;  4ALP A;  3S14 H;  3A74 A;  4POG A;  1UE6 A;  4GOP A;  4LUZ A;  1VQF A;  2IX0 A;  2GN5 A;  4O0A A;  4DR5 L;  2RHQ B;  4IPH A;  4LF9 Q;  3CCV A;  2D0P A;  3UDG A;  4DPG A;  5JEA G;  4X64 Q;  4A75 A;  4GNX C;  1L1O A;  1GO3 E;  3J7A 5;  5FLX c;  1UE1 A;  1N36 Q;  3PF5 A;  2WAQ E;  1KL9 A;  3G71 A;  4EQ5 A;  3RLO A;  3Q8D A;  2UUA L;  1EQR A;  2AMC B;  4KI0 A;  1HZC A;  1LM0 A;  4LF7 L;  3M3Y H;  4A3I G;  2PQA A;  1Q86 C;  1UE5 A;  1A8V A;  1KQS A;  3UE1 A;  4LF4 Q;  3D0F A;  1D7Q A;  1S3O A;  4BXX G;  4IOA A;  3HOW H;  1V43 A;  3RLF A;  1Q7Y C;  5FJ8 G;  1I6H H;  1VQE A;  1VQ5 A;  1N33 Q;  2F3I A;  4JI7 L;  3GTK H;  4GKK Q;  2B3G A;  4O2D A;  4L5T A;  4GN5 A;  4IPG A;  2E8G A;  4A3B G;  4NXN Q;  2F4V Q;  2VNU D;  5C0X J;  4PZ8 A;  3G6E A;  2HHH L;  4X6A H;  2VL6 A;  3L7Z C;  3U4V A;  1PH6 A;  1J5E L;  1XNR L;  4A93 H;  1X56 A;  4P75 A;  1B8A A;  5IYB H;  1JJC B;  4DV5 Q;  3F8T A;  1Y1W G;  1XNQ Q;  3HOU G;  4JC0 A;  2N78 A;  1QVC A;  3L0O A;  3GD7 A;  3PO2 G;  1VQA A;  2OCE A;  5GRO A;  3CC4 A;  4A3C G;  3AFQ A;  4A4I A;  4MTN A;  3CXC A;  4IPC A;  1PVO A;  3I2Z A;  1Q46 A;  3D31 A;  4GOP C;  4DV3 Q;  1PH4 A;  1JJ2 A;  3HOZ H;  3LGJ A;  1K9M C;  4GKJ L;  3PUW A;  4DKA C;  5EAY A;  3HKS A;  4GNX B;  2JA7 H;  4DV6 Q;  1JE5 A;  4BBR G;  3GTM H;  1L2F A;  4MZ9 A;  4QY7 A;  4JI8 L;  1AE2 A;  3CMA A;  1T9H A;  2L15 A;  3S15 H;  4NXM Q;  1PV4 A;  2OQ0 A;  2IHF A;  2AKW B;  4JI0 L;  1CSP A;  3GTQ H;  5HY6 A;  3HOV H;  2CWP A;  4RG1 A;  2NVQ H;  3HOW G;  4IOC A;  1Q81 C;  1VQO A;  5C44 H;  1QVF A;  3K8A A;  2ASB A;  2JJQ A;  1SRU A;  2ZTE A;  4GS3 A;  2JE6 I;  4LFA Q;  3WWV A;  5LMN Q;  1N32 Q;  4LFC Q;  4APV A;  2E5L L;  4BY7 H;  4HIO A;  2UUC Q;  3I4M H;  5GAE C;  3I56 A;  3BJU A;  1YJN A;  1YHQ A;  5K36 G;  4DUY Q;  3PCO B;  2YTX A;  4BY1 G;  1V1Q A;  4X64 L;  1NTG A;  4DR2 L;  3F1Z A;  3GTP H;  4A93 G;  5IYB G;  1X3E A;  2Q2U A;  4NPS A;  5GAG C;  1Q1E A;  4QJF A;  1VQ9 A;  3BZC A;  4EX5 A;  3W1G A;  2HIV A;  1KC8 C;  1DGS A;  4WJ3 M;  1LYL A;  4HJ7 A;  1JB7 A;  3TEH B;  2YTY A;  1IBK Q;  4IFD J;  4A3L H;  4DR1 Q;  1FVI A;  3K80 C;  1XPR A;  2GVA A;  2JA5 H;  5C4J H;  2B63 H;  4A3F H;  5M3F H;  5IYD H;  3PIO A;  5GAH C;  4JCV E;  4DAY B;  1D8L A;  4JI5 L;  5C0X G;  3CAM A;  1SLJ A;  4GOP B;  1N33 L;  2JA7 G;  4GKK L;  2ATW A;  2JK8 A;  3I4O A;  1BBU A;  3ULJ A;  1BKB A;  3S24 A;  3ULL A;  4NXN L;  4TVA B;  3JAM c;  3CCR A;  4DUZ Q;  3F2C A;  1HH2 P;  4JOI A;  1TWA H;  4R4Q A;  3MEF A;  1WCM H;  5C44 G;  4DV5 L;  3EIV A;  1OTC A;  4DK6 C;  1X3G A;  4DV0 L;  4LNQ A;  4DR6 Q;  2Q2H A;  3I4M G;  4XIG S;  3CCL A;  3E0E A;  3ER0 A;  4R4I A;  5AJ3 Q;  2MNA A;  4JG2 A;  4A3E H;  4LUV A;  4LF5 Q;  4YY3 L;  5ELO A;  3CC7 A;  1NMF A;  1XMO Q;  4JBK A;  2H5X A;  1QVG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...