4JI3L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLWGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 17
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji3L00
1W2BA 4DR4Q 2NZHA 3PUZA 4KHZA 4A3FH 1T9HA 4BXXG 3AEVA 4YCUA 4A76A 2JA5H 1N32Q 5C4JH 3M4OH 4R4IA 4DV5L 1OXSC 2N3SA 1YIJA 3S2HH 1JT8A 1JJCB 5IYDG 2K75A 2EQSA 2ES2A 2Q2IA 5LMNQ 4LFCL 3G48A 4RG1A 4JBWA 4X66Q 4X66L 3CPFA 5M5XH 3J81c 4IPGA 2B63G 3Q8DA 3H3VI 1UE5A 2WAQE 1OXVA 1Q46A 3M85A 4OX9L 2BH2A 1E3PA 4DUZL 2E2JH 4LF6L 2Q2HA 3D31A 1B8AA 1C9OA 1Q1EA 4ME3A 4C2MH 2UU9Q 3M4PA 1U0LA 3PO2H 1TWGH 1ASYA 4JI5Q 1YJWA 5IE8A 4JBJA 1GD7A 1GVPA 3WWVA 1VQCA 1B70B 2RHQB 1K73C 4POGA 2UUAQ 2KHIA 5HGQA 3LGJA 3PUVA 4HIOA 4A3CG 1YNXA 1VCIA 2WFWA 1BKBA 4JI8Q 3RN5A 4DR7Q 1X55A 4MZ9A 1IZ6A 4QGUA 3W1BA 1K0RA 4DV0L 4FDBA 1C7YA 4GNXB 3PUWA 4GNXC 3UDXA 3CPWA 2KCTA 4P72A 1XNRL 1JE5A 1E1TA 2WP8J 3OYYA 5M3FG 1IL2A 4L5QA 1PH6A 3RLFA 3PF5A 2E2HH 3KDFA 1XPUA 4BBSG 1XMQQ 5IP9G 1IXRA 4IFDJ 3CMEA 3CC4A 3HOUH 2OQ0A 1UE7A 4LF8L 2KHJA 2CFMA 4KLKA 1YBYA 3KJPA 1OTCA 2R7ZG 2EIFA 4LFBQ 3CCRA 4X6AH 3ZJYC 2AMCB 3STBC 2NVYH 3PGZA 1TWFH 1V1QA 5FLXc 5GAEC 3CCVA 3PO3G 4A3GG 4JI3Q 4UY8C 5M5WH 1Y1VG 3HOYH 1PH1A 4GLXA 3TQYA 4GS3A 3L2PA 3AFQA 1PV4A 4OO1G 4DR3Q 1BBUA 3S17H 1AE2A 4DKAC 4X65L 3FHWA 4QIWE 1KHIA 4QJFA 2AWNA 2XGTA 1Y14B 5DLQE 4B3TL 3S1MH 4JYAL 4LF7L 5GAGC 5ELNA 4DV4Q 4IJLA 2R6GA 3S16H 2KCMA 1A0IA 5IWAQ 2CCZA 1HJPA 1NBWA 3B6YA 3GTQH 5GQOA 1VQLA 1VQIA 1I6HH 1NE3A 2I5HA 1O7IA 2K4KA 3A5UA 2QA4A 1S40A 3CC2A 2ZJPA 4BY1H 1UE6A 4KHPQ 5IYDH 3AFPA 4LF7Q 1X3EA 1CKNB 4DR5Q 2VQEQ 4A75A 3J7A5 3I4MG 1SMXA 4XIGS 1I94L 3PF4A 5M3MH 2Q2TA 1UEBA 2PMZE 1G51A 5FJ8H 3F8TA 4GOPC 3I4OA 2VUMG 2A1AA 1MJEA 2C35B 1EQQA 2Q2UA 3UE1A 3PO2G 4A3KH 2OQKA 3ULPA 4C3HH 2YU9H 3I2ZA 4OX9Q 2ZM6Q 2F52A 4LFAQ 1HZAA 2GN5A 5C0XI 5LMUL 4DV1L 1VQAA 3HOWG 5FLMG 4A3JH 2B63H 1K83H 1NY4A 5C0XG 4HJ5A 3TREA 1Q82C 1IBMQ 3KF6B 1L2FA 4DV2L 4DV7L 5JJIA 1U5KA 1G291 4DV5Q 3PSIA 1J5EL 2BA1A 2JK8A 4NXNL 4BBRH 3J81i 4IJHA 1K9MC 2OWOA 1J5EQ 2JA9A 1PFSA 2F3IA 2OTJA 2UUBL 4ALPA 1K8AC 1CSPA 1Z47A 4HJ7A 4DV2Q 2Y0SE 1Q1BA 3NEMA 4JI4Q 4YHHQ 2JA7G 2JA8G 4LF9L 4DV6L 4B3RQ 1QVGA 3H3VH 4AH6A 5J3BA 4YWMA 1NTGA 1HH2P 4B3ML 1A8VA 3EIVA 2KBNA 2UUAL 2BH8A 3CQZH 3PV0A 3CXCA 4DR2Q 1YHBA 4DK6C 4IOCA 4L5RC 3RZOH 3J7ZC 4AQYQ 4GNXA 1JJ2A 2AWOA 1KRSA 1SLJA 3A0JA 3T1YL 4LNQA 3HKSA 1OXXK 4MNOA 1PH2A 2DGYA 1H95A 5BR8L 4X64L 1EWIA 1YHAA 3GTKH 2JE6I 3RZDH 3IRBA 1VQFA 1Y1WG 2VQEL 4P75A 3TS0A 5IP7H 4H02A 4DUZQ 1KIXA 2UXCL 1OXTA 2LXJA 4IPHA 4YCVA 1R9TH 2RCNA 4OONA 2ALYB 2VL6A 4HJ9A 1DGSA 1UWVA 3U58A 2EXDA 1B7YB 5IP7G 4HIKA 3S15H 3S14H 3K81C 5JEAJ 1I50H 2NVXH 1M1KC 2K50A 4JI6L 2UUBQ 4BY7H 4A3GH 3BZCA 3KLWA 4DV4L 1GM5A 4EX5A 4B3SQ 4B3TQ 4JYAQ 1L1OC 1SE8A 1WI5A 3BJUA 1Z9FA 4GKKL 1N36Q 4R4QA 4O0AA 4JI7L 4JI7Q 1ASZA 4A3DH 2I0QA 1X54A 4YWKA 2IX1A 2HIVA 1S72A 2R92G 4XTCS 4HIMA 3UE0A 1HNXL 1RL2A 1VS0A 1L1OB 1PH7A 2NN6I 5C3EG 1X56A 3HOVH 3J80c 3FKIH 1XNQL 1N33Q 2NVQH 3CD6A 2IHFA 2V1CC 4J15A 4LF8Q 1TWAH 2JQOA 5AJ3L 1SRUA 2Y0SG 5IYCG 2UXDL 3PIPA 1KRTA 1IBLL 4BXXH 4R4OA 3TRZA 3CF5A 1NJIC 1SR3A 1IBLQ 4DUYQ 1VQ7A 2VW9A 3CC7A 3FP9A 3E9IA 2N49A 4NB3A 3G71A 2MNAA 1XNRQ 3T1YQ 1LYLA 4AYBG 4OWTB 3H15A 1N33L 4A3MH 1XNQQ 1VQBA 2UUCQ 4A3LH 2JEAI 4DV0Q 3I4MH 1Q7YC 1HNWQ 1QUQB 1X9NA 1KC8C 4B3MQ 4A3BH 1JB7A 4DV6Q 4LF9Q 3W1GA 4NPSA 1HNZQ 3H0GG 3KOJA 3S24A 3KF8B 2JA8H 2XTIA 4R1JA 1KD1C 3STBD 5C4XH 2OTLA 1KAWA 2CWAA 3CAMA 5E7NA 3RN2A 1UE1A 4TVAB 3HOXH 3U4ZA 3G6EA 1XMOQ 3U50C 1SFOH 3MXNB 4JV5Q 4DR6L 5HY6A 2HT1A 4BA1I 4GLAC 4LF6Q 1OXUA 1IBML 2KENA 5EAYA 1S3OA 5IT9c 4LFBL 3G4SA 2NN6G 2NZOA 3S1NH 3F2BA 2JA7H 2MO1A 1YJNA 2UXBL 5LMNL 1V43A 4R4TA 2RHSB 4UPAA 1QZGA 1XMQL 2A19A 2K5VA 4DR6Q 1YVCA 1K3RA 1D8LA 5IYBG 1YI2A 1A62A 1EUJA 1X65A 4IPCA 1GKHA 4UP8A 3CCJA 1Q81C 1M90C 1CKNA 1VQHA 1PH5A 3RLOA 1I94Q 1W3SA 4GN5A 1HR0W 4DR2L 1PYSB 3JC66 4WJ4A 1PYBA 4R4CA 3CCQA 1XTDA 2MFIA 1FVIA 3ULLA 4KHPL 4RMFA 2Z0SA 4QY7A 5M5YH 5C44H 1PH8A 2GVBA 1MJCA 1QVCA 2JEBI 1I5FA 3I7FA 2R7ZH 3K80C 1V9PA 4OO1I 3HOZG 3K8AA 3S2DH 1VQMA 1XPOA 3BZKA 4JI0Q 2R93H 1QUQA 4JI5L 3HKZE 4DUYL 1L0WA 2K5NA 4DR3L 4IO9A 3T1HL 3HOZH 4YWLA 1KQSA 1A63A 3K7UC 2CKZB 1EFWA 2HIXA 3NENA 4PMWA 2WB1E 3L0OA 3OTOL 1HR0L 3GTPH 3MEFA 2ZM6L 3GO5A 5LMUQ 4DR1L 3U4VA 3CP0A 1X3GA 2B29A 2RF4A 4Y52H 4OWWB 3I4NG 4WJ3M 4JOIA 2QGQA 3KDFB 2IHEA 1J6QA 4GKJQ 2HHHQ 3PUYA 5M3MG 1NMGA 2YV5A 2I5MX 2N8NA 1WJJA 1E22A 1QVFA 1PVOA 1SROA 2PNHA 1Q8KA 3H0GH 1EYGA 4DR5L 2PQAB 4QQBX 4B3SL 5C4XG 4JI2Q 2D0OA 3GTGH 4IOAA 1N8RC 1D7QA 3CCLA 1HNWL 4AIMA 4JI1Q 4A3EH 2D0PA 2VQFL 2VQFQ 4A3MG 4UP7A 1EIYB 4JBKA 4PZ7A 5IWAL 4NXML 1IYJB 4GOPA 3EBEA 3A74A 3HKZG 2VY3A 2K14A 4JOIC 1VQOA 2YTXA 3KYHC 2A8VA 2FXQA 2Z6KC 4L5SA 3KFUA 1MKHA 2JA5G 3PCOB 5BR8Q 1EIFA 3PUXA 4YY3Q 1FJGQ 5AJ3Q 3I55A 2Z6KA 4POFA 1QZHA 2UU9L 4JI3L 2AHOB 1L1OA 2VNUD 2CQOA 4PZ8A 2QEXA 4LUZA 2JA6G 4LF4L 1YITA 4JI4L 3CCMA 3RLNA 2IT1A 4DAMA 1CKOA 1WFQA 2K5HA 3PIOA 1N34L 1PHJA 1N36L 3JAMc 4GKKQ 1N32L 2H5XA 3S1QH 1KXLA 4JI0L 4NXNQ 1BBWA 3E0EA 5GROA 5IYBH 3GD7A 4BBSH 2LSSA 1CUKA 4A4IA 2OCEA 1VQGA 3NBHB 2R7DA 3F1ZA 4LF5L 2YTYA 1LTLA 3HOYG 3F2CA 1TWCH 2ID0A 2AKWB 3F2DA 1XPRA 4JI8L 2NVTH 4DV1Q 4HIDA 4LFAL 4DR7L 4JI2L 5K36G 1C0AA 3OW2A 4JBMA 3M9BA 2PQAA 3UDGA 1VQJA 1NMFA 1KL9A 1WYDA 1Q86C 2ATWA 3AQQA 5IP9H 3ICEA 4IFDG 2R7FA 4GKJL 4HJ8A 4BY7G 3AYHB 2IX0A 3D0FA 3CMAA 1K8GA 4AQYL 1VQ9A 4IFDI 3EN2A 2GVAA 1HZ9A 1VQNA 3K7AH 4GN3B 2K52A 4A93H 3I56A 3HOVG 1WOCA 1YHQA 4Y7NH 3OTOQ 1HR0Q 4LW1A 5JEAG 4K0KL 3FKIG 3NELA 4YHHL 3JAMi 4L5TA 2ASBA 4A3DG 4B3RL 3TEHB 5GAHC 5H1SE 4P73A 5FJ8G 4JG2A 3GTMH 1TXYA 2LXKA 4AYBE 4TQUS 4A3FG 1G6PA 1XMOL 1JJGA 1E1OA 4OXPA 4JCVE 4EQ5A 5IY0A 1VQPA 1XJVA 5JJKA 4X65Q 4DNIA 4DR4L 3K0XA 3HOXG 1N34Q 2PI2E 2ZTDA 4DV7Q 4A3JG 5JJLA 3I4NH 1VQ8A 1P8LA 2WAQG 4GOPB 1HNZL 4A3IH 2WB1G 4K0KQ 4MTNA 1P16A 4BY1G 1RIPA 2IY5B 4P71A 1JMCA 3HFZB 3L7ZC 3GTLH 3J80i 2D62A 4JC0A 4C3IH 3M7NA 4A3CH 1PA6A 5ELOA 4A3IG 2F4VL 1GO3E 2MO0A 5GADC 1IBKQ 3CW2C 1VQDA 1VQ5A 3A5ZB 4YY3L 1FJGL 3M3YH 1SN8A 5IYCH 4DPGA 2JJQA 1YZ6A 2VUMH 1Y1WH 3J81j 4QL5A 3ERSX 4DV3Q 3UDFA 2ZJRA 1EOVA 2UXDQ 1CKMA 2YYZA 2UXBQ 2MQHA 1AE3A 5M3FH 1BVSA 4NXMQ 3CCSA 2F4VQ 3BU2A 3HOWH 3KF6A 5C0XJ 5FLMH 2E2IH 4A3LG 3GDEA 3CCUA 1TWHH 4YCWA 3RR5A 4LF5Q 2E5LL 3HOUG 3M4QA 4X62Q 2JA6H 4JV5L 1PH4A 4O2DA 4PZ6A 5LMNW 1PH9A 1AH9A 2YTVA 4BBRG 1WCMH 1YJ9A 2BA0A 4DK3C 2DUDA 2ZTCA 3E9HA 1Y1VH 2HHHL 1FL0A 4PG3A 4DAYB 4LF4Q 1WCMG 1HZBA 2VZAA 3W5OA 4X62L 4JI6Q 1E7ZA 3TS2A 3RNUA 2E5LQ 2ZJQA 3DLLA 3GTOH 1VQEA 2I5LX 2N78A 1VQ6A 4IPDA 2UUCL 4DR1Q 2HQLA 4P74A 3KJOA 1I3QH 1X6OA 4KI0A 4LFCQ 4UP9A 1Q12A 3SGIA 4A93G 1X3FA 2ZTEA 2UXCQ 3ER0A 4C3JH 3ULJA 4APVA 4HJAA 4DV3L 3T1HQ 2PI2A 2R93G 4LWCA 1PH3A 4X64Q 4GLVB 1N9WA 1LM0A 4BA2I 2VS1A 1E24A 3GTJH 1IBKL 3PO3H 3S1RH 1LUZA 3VDYA 2E8GA 3UDIA 1VQKA 1MIUA 4JI1L 2R92H 1VQ4A 4OWXB 3DM3A 4A3BG 1HZCA 1EQRA 4LUOA 2B3GA 1HNXQ 5C3EH 4GN4B 4A3EG 1CSQA 1FGUA 4A3KG 5C44G 3CCEA 4LUVA 2CWPA 2L15A 1YEZA
chains in the Genus database with same CATH superfamily
1BCPC 1F9SA 3U9SA 4RHRA 1W6JA 1G8ZD 1MD2D 4A76A 1YIJA 2N3SA 1JJCB 5IYDG 2EQSA 3E0JA 3BG3A 1BOSA 2I07B 1EIHA 2A68D 3CPFA 1HTPA 4B9WA 4IPGA 5M5XH 3J81c 1UE5A 4OX9L 1OXVA 1E3PA 4G7OC 4RWSC 4LF6L 4F88A 2L9HA 2MP1A 2OF1A 3PO2H 1ASYA 1YNJC 5I4DA 1YJWA 1GVPA 2K1BA 3T53B 1VQCA 2RHQB 3EFXD 3NQTA 2X6LA 2WKDA 1CA5A 3PUVA 5ELEA 3QOLA 1VCIA 2WFWA 1TWCB 4JI8Q 2SEBD 1EEID 1SMYD 3T4AC 3V96A 1A3UA 4P72A 1XNRL 2WP8J 1IL2A 3VR5A 1PH6A 1XPUA 3RLFA 3PF5A 4KY5A 4KN7C 2YU9B 1XMQQ 1F9QA 5J22A 5CGKA 3KJPA 2EIFA 1F2ZA 1LTTD 3PMFA 5E3FA 4LFBQ 3F2UA 4X6AH 3PIO3 3NP8A 2AMCB 2EOTA 2F3WA 3HOYH 3OIPA 3VR3A 4BY1B 5M5XB 1CT1D 1JOQA 3VYRA 4C3IB 4DR3Q 1AE2A 3FHWA 3MFGA 4B3TL 4JYAL 1T5XD 3S16H 2A6HC 4IJLA 2KCMA 2CCZA 4LMQD 5ELDA 1HJPA 3B6YA 3GTQH 1QG7A 3QR8A 1I6HH 1VQIA 1NE3A 2QA4A 1ENCA 4HR7B 2ZJPA 4ILWA 1UE6A 1NNXA 5KYLA 1HA5A 4DR5Q 2VQEQ 4A75A 1SMXA 2L5TA 4DNRB 3C46A 1GUSA 2NYZD 1G51A 5FJ8H 3I4OA 5ELFA 2C35B 3NQIA 3UE1A 3PO2G 4RKBA 4C3HH 2E2HB 3I2ZA 2RCFA 2ZM6Q 2F52A 4DV1L 2GN5A 1PRTC 1K83H 4N8FA 4DV7L 2AUJD 4OEMB 1SJED 2RQXA 3VYUA 1IW7D 2KA7A 3S1QB 4BBRH 4NXNL 1J5EQ 3MC0B 5ELCA 1EZ6A 1LTRD 2CQAA 2UUBL 4PMCA 2IW3A 1DZ1A 4RGTA 2Y0SE 2EVBA 1FYCA 2KCNA 1QVGA 3KK7A 4AH6A 1NTGA 4UHVA 5EPJA 1A8VA 1AFPA 5KYIA 1PMRA 4HCSA 4IOCA 2K28A 4LNQA 1KRSA 1SLJA 3T1YL 4MNOA 5E4XA 1H95A 1B50A 3GTKH 2JE6I 3URYA 3RZDH 1Y1WG 1OO9B 2VQEL 3TS0A 5IP7H 4H02A 2UXCL 2JA7B 3V05A 4DN4M 2LXJA 4IPHA 1GUTA 1R9TH 2VL6A 4HJ9A 1UWVA 3G7LA 2RSNA 3K81C 5JEAJ 2B8GA 4BY7H 2K50A 2A68C 3KLWA 1GM5A 3E5SA 1L1OC 1SE8A 1WI5A 1WTVA 5LL6X 4GKKL 1N36Q 4JI7Q 4GZYC 4X3KA 2MPMA 3OWFA 2I0QA 1X54A 2D5DA 2WINB 2IX1A 1BUVT 1F2MA 1PTOB 5EBDA 1X56A 2NVQH 1TWAH 2JQOA 3MFYA 3AU7A 2Y0SG 3BDCA 1LT3D 1IBLL 4C3JG 3TRZA 1CZGA 3CF5A 1K8MA 1KTKA 4DXFA 1SR3A 1HPCA 2VW9A 1XNRQ 5FLXL 1STGA 2K5DA 1LYLA 3H15A 4A3MH 2HCIA 1VQBA 2UUCQ 2JEAI 1SYCA 4L63B 1UEAB 3KOJA 1JICA 4R1JA 1KD1C 2QF7A 3CAMA 2E2IB 1V8QA 5E7NA 4U68A 5IIFA 1SNOA 3MXNB 2HT1A 4LF6Q 1OXUA 1IBML 4K14A 1SYFA 5IT9c 2NN6G 1PLFA 1PRTF 2NTSA 2UXBL 2Q8IB 2A69D 2EYMA 1K3RA 1D8LA 4ZCKA 5IYBG 1WD0A 4KMUC 3CCJA 1CKNA 2K7VA 2XRQD 2Q8RE 3RLOA 4I7ZC 5DNFA 1T5EA 3MXNA 4DK1A 1EY9A 3J81E 2VB2X 2ICIA 1WTOA 4U673 2F0EA 4KD4A 2F1MA 2EY2A 3K80C 5FLXE 3PQIA 3HOZG 3S1RB 2R93H 1DOMA 4O1NA 2XNAC 3BVGA 2BDNA 4WFN3 4IO9A 4DAVA 1SNPA 3MHBA 1QNKA 1KNEA 2HCCA 3L0OA 4DR1L 5LMUQ 2QDBA 2NZ1D 2H1EA 4Y52H 3VR6A 1BCPD 3MVVA 3DHQA 4JOIA 4K5VA 4ZRZA 3KDFB 5C4ZA 4NW2A 4R9WA 2YV5A 2MUYA 3DEPA 2LMCB 1WJJA 4JK1C 4DAPA 1SROA 1MI2A 4DR5L 2E74C 1O7LA 2A6ED 2DY8A 4JPBW 3GTGH 1D7QA 3CCLA 4JI1Q 4A3MG 2D0PA 4O42A 4KJOA 1TVXA 4NXML 1IYJB 3LX0A 4JOIC 3HKZG 3A74A 2G9HD 2VY3A 2K14A 1X3QA 1VQOA 1EIGA 2FXQA 2Z6KC 1PFBA 3I70A 1MKHA 3MZ5A 4CDDC 5CMDA 1EIFA 3PUXA 1FJGQ 3S1NB 3E3XA 1GHKA 4IUNA 1X32A 4WJWA 1R4PB 2WB1B 2VNUD 4N8X1 5I6WA 2OEOA 4JI4L 4CHTB 4DAMA 2F0HA 3PIOA 3OW7A 2EYFA 1EY8A 1N34L 3JAMc 1LT5D 2H5XA 3S1QH 1KXLA 1BBWA 5GROA 4BBSH 4A4IA 4IZ8A 1K28A 2OCEA 1VQGA 3MTSA 5HGTA 5E4WC 3F1ZA 2EJMA 2XN9C 1CZWA 4JI8L 2NVTH 2B2TC 4DV1Q 5K36G 1NR2A 3OW2A 3AMUA 1SSOA 2B2WA 1HUNA 2PQAA 4Q0FA 1NMFA 4BY7G 1QOHA 1AP0A 3EN2A 1QE6A 1WOCA 5KNDA 4K0KL 5C0XH 4YHHL 3JAMi 4L5TA 2K04A 3GP7A 3P7JA 2TSSA 1TXYA 2BE5D 1F9PA 4A3FG 4IQZA 1G6PA 1B9NA 1JWUD 3SE0A 1E1OA 4QB4A 1ZXTA 2Z8LA 4XQJA 1EYCA 4DNIA 3HOXG 2LKVA 2PI2E 2ZTDA 5FOBB 3NBIA 4K0KQ 3CHBD 2IY5B 2KCCA 4RA8A 1D1KA 3HFZB 3J80i 2D62A 4JC0A 4HSPA 3TMEA 5ELOA 3E6ZX 3TSSA 1VQDA 5DM63 3A5ZB 1YZ6A 4G7ZC 1Y1WH 3QJYA 1B1ZA 1NUCA 1B53A 2YYZA 1AE3A 3WDNA 1TY2A 4OL7A 3HOWH 4NMZA 5C0XJ 3DEOA 2E2IH 4LF5Q 3RR5A 1O7ZA 3HOUG 3GV3A 3M4QA 4JV5L 1SDFA 5LMNW 1PH9A 1STNA 2YTVA 4BBRG 1JB3A 4HN7A 1GUWA 2ZTCA 4CDCC 1FL0A 3NXWA 1S5ED 4KKUA 4OO1H 4LF4Q 1KLGD 1E7ZA 3DLLA 3GTOH 2F0IA 1VQEA 5EQ0A 1VQ6A 4P74A 3KJOA 3U9OA 4ZYSA 1X6OA 1Q12A 5CR3A 4C3JH 4HJAA 4APVA 3T1HQ 1TKWB 1QJOA 3HOVB 5JPMC 1YNND 5CC4A 4BA2I 5FKAC 1E24A 1O78A 1LUZA 3I91A 1VQKA 5EGTA 1MIUA 4HAEA 4JI1L 1VQ4A 1J9OA 4A3BG 1TS2A 3O13A 4GN4B 1CSQA 2F0PA 1C8CA 1D6EC 1UAPA 1YEZA 3OSOA 2NZHA 3HOYB 3EQLC 3PUZA 5C3XA 3HEJA 4F8MA 5IGBA 5C4JH 4KN4C 1OXSC 3KLRA 4HMIA 3SK8A 3QG1A 5TSSA 5EKKA 2Q2IA 3G48A 4RG1A 4QIWB 1LTBD 3EROA 1FNUA 2B63G 3Q8DA 3GV6A 1SE4A 1K8OA 3VR4A 4DUZL 2Q2HA 1B8AA 4C2MH 3JAML 4KY6A 4IUTA 1WCMB 1B70B 1LTID 5IT9L 4HIOA 1YNXA 3RN5A 2A6HD 1X55A 4MZ9A 4ZUJA 1K0RA 3EVQA 3J7YW 4DV0L 2NN6H 4H44C 1C7YA 3UDXA 2F0QA 1E1TA 4L5QA 4RGOS 1RF2D 4K6DA 2DNEA 3MEHA 5J1ZA 2BE5C 5IP9G 2HDMA 2HDLA 3N52A 3K58A 4KLKA 1ESRA 1YBYA 3K59A 2R61A 3BZDB 5J39A 3PGZA 5GAEC 2CH4A 3VR2A 4JI3Q 1BXTA 5M5WH 4EQPA 2F0UA 1PH1A 4GLXA 1EYAA 3TQYA 1PRTD 3A54A 2K05A 1TU2B 4AYBB 1BBUA 1RD9D 1CQFA 1QILA 2NBFA 4QJFA 5JAVA 4V190 1EU3A 1Y14B 3S1MH 4X3UA 3FEWX 3M4OB 2R6GA 4QUFA 4DAYA 1EQVA 1XYIA 1A0IA 5IWAQ 2I5HA 1O7IA 3S14B 1S40A 3J7AF 3FPPA 1HFGA 2FMMA 2K5QA 3AFPA 1DD2A 1R9TB 3I4MG 3MAQA 2DJFC 5EKIA 4XIGS 1EWCA 3LWEA 4CDFC 5M3MH 1UEBA 2A6EC 2L12A 2Q2UA 2SNMA 3P20A 4KV6A 2YU9H 5C0XI 3HOWG 1I4QA 5FLMG 4A3JH 4MTKA 1NY4A 1IBMQ 1L2FA 1TS5A 1U5KA 4DV5Q 3TDQA 3PSIA 1STAA 2XRSD 1STYA 4EQNA 1K9MC 1E2ZA 1PFSA 2F3IA 5D14A 4ALPA 1D2BA 1EYDA 1CSPA 1Z47A 2A73B 4HCEA 4HSVA 4WORA 1Q1BA 5I9PA 5DAUA 2ICEC 4YHHQ 1U4MA 2JA7G 4IUUA 2JA8G 3H3VH 1VMPA 4RH6A 3SXHA 1HA6A 2KECA 2F0NA 2KBNA 2BH8A 3PV0A 3CXCA 4OELB 4L5RC 4HMJA 5ELBA 2AWOA 3A0JA 1SAPA 4K5XA 1LT6D 2PYKA 1OXXK 4IALA 3V2TA 4X64L 5BR8L 3H94A 3R93A 2JN4A 1STHA 1V1PA 5JEAH 1BDOA 2RCNA 4OONA 4OGQC 3U58A 2EXDA 4HIKA 1H9RA 2UUBQ 3BZCA 5G3LF 2PO4A 1W6KA 4IN3A 3BJUA 3S16B 1Z9FA 4R4QA 4JI7L 2E2DC 1ASZA 4A3DH 3HS0C 2GA4B 3UE0A 1RL2A 2F03A 1FNVA 1NSNS 5C3EG 1GOZA 1PH7A 1SNMA 2VB3X 3A56A 5IT9E 1SJHD 3MXGA 1EQTA 2IHFA 2V1CC 3OPOA 1SRUA 2B2YC 2UXDL 3BDOA 3PIPA 1F77A 3NBHA 4BXXH 3W2DA 1VQ7A 3P1HA 3E9IA 1MHWC 1PTOF 2LS01 4FO2A 3T1YQ 1DM0B 4EVOA 1N33L 3KLSX 4K2LA 4OWTB 2BDOA 1IYUA 1X9NA 1ET6A 1JB7A 4LF9Q 3W1GA 3Q6SA 2JA8H 2CWAA 1UE1A 2L1BA 5DEHA 3U4ZA 3G6EA 5IGFA 1XMOQ 1GXDC 1SFOH 1SNCA 5HY6A 4BA1I 4FF1A 3CRLC 2E76C 5COYA 3G4SA 5EJWA 2MO1A 4QF4A 5IGDA 1DJRD 1V43A 1K3BC 4R4TA 4OIJA 5IGCA 1A62A 1X65A 1GKHA 2BOSA 4M8AA 1I94Q 1F2YA 4GN5A 1HR0W 4N9TA 1PYSB 4A3BB 4WJ4A 1LV9A 2MFIA 4KHPL 4QY7A 3K57A 1PH8A 1MJCA 1I5FA 2PNRC 4MN3A 1V9PA 1DOKA 4ZQ3A 1IHZA 1VQMA 2B2VA 3BZKA 5CYUA 1QUQA 4JI5L 3RD4A 1E2WA 3VA5A 1KQSA 5DM73 2CKZB 1G91A 2F0DA 2HIXA 3J7AV 1PFNA 2WB1E 1HR0L 3ND9A 3MEFA 2B29A 3I4NG 1Q90A 5CBEE 1HXYD 3X3MA 1H9JA 2IHEA 1J6QA 1U4LA 2RBMA 3PUYA 1NMGA 4R8NA 4ZAIA 3H0GH 1Q8KA 2RDGA 3DM1A 5D65A 2B2VC 2R93B 1N8RC 4A3EH 2VQFL 2VQFQ 3A55A 4JBKA 4UP7A 4FYDA 5IWAL 3TBIB 2EZVA 2F0WA 3EBEA 3QOJA 5FO8B 3KYHC 2M2LA 3KFUA 4XQQA 2Z9HA 5AJ3Q 2XSCA 2Z6KA 2SDFA 1QZHA 2UU9L 1L1OA 3ND8A 2CQOA 4PZ8A 5FO7B 1VMCA 1EY0A 4LUZA 2JA6G 3HOXB 1YITA 2IT1A 4XQNA 1H9SA 1WFQA 3RZOB 2JA8B 3EA6A 2L11A 1N36L 3ERQA 4GKKQ 1PXUA 1HUMA 1ZYRD 2C9OA 3CKIB 2KVMA 3BS1A 1TIID 2LSSA 3NBHB 2B63B 3F2DA 2EYPA 5EPLA 4HIDA 4LFAL 4A3KB 3TZUA 2AQ2B 1S5BD 2LFNA 1AW7A 4JBMA 5A2QL 2HD3A 2ZXRA 5K5PA 3UDGA 1DYQA 4IFDG 5IP9H 2R7FA 1ZKOA 3I3CA 4HJ8A 2IX0A 3D0FA 3IFDA 2NTTA 3CMAA 4X3TA 1VQ9A 3I90A 3K7AH 3K0YA 2K52A 2L0CA 5JJZA 4FP5D 4LW1A 3FKIG 4ZUIA 4ZK9B 4K6LA 2ASBA 3Q22A 2NVQB 5CBAE 1BCPF 3FKIB 1TS3A 4JG2A 3GTMH 3S1MB 2EDGA 4TQUS 3HOZB 4FF4A 3K5LA 5M5YB 1XMOL 1JJGA 2NVXB 4OXPA 3R3OA 4EQ5A 4HEDA 2NWGA 3BYTB 4X65Q 1UNSA 3DWPA 4DV7Q 2XWJB 4Q5VA 3I4NH 3IFTA 1VQ8A 1P8LA 1HNZL 4GOPB 4G7HC 2WB1G 2Z6BA 2XVSA 1P16A 3L3OC 4KJNA 1JMCA 2EJFC 5KEEA 2KQ3A 3S15B 1EFID 1KABA 4A3IG 2F4VL 1WTQA 1IBKQ 2MO0A 3NTHA 3KBXA 3NUCA 4KKTA 3DXJC 3M3YH 3G6JB 2F3VA 4QL5A 2ZJRA 1I3QB 2UXDQ 2UXBQ 5FK9C 3N6RA 5M3FH 2F4VQ 3BU2A 5FLMH 4CKEA 1TWHH 4YCWA 1QWYA 3A8IE 5M9OA 4X62Q 1UUPA 2PZTA 5CORA 2PZUA 1PTOD 2PQEA 1KDBA 2HHHL 4PG3A 1BO0A 1JOOA 1HZBA 1TWHB 2VZAA 3W5OA 4JI6Q 2I5LX 4TKOB 1BF4A 1D5ZC 4BWGB 1I3QH 2O5JC 3SGIA 4A3MB 3TP7A 4DV3L 2R93G 5IGEA 2KOLA 5HURA 2XIWA 4RCOA 4A3FB 4X64Q 4GLVB 1PZID 2PPBC 2M00A 1LM0A 1SBBB 3NSWA 1TS4A 1BNZA 1TWAB 4ABNA 4OWXB 3DM3A 4LUOA 2EYHA 1CA6A 1HNXQ 5C3EH 1VDZA 3I4NB 2WV6D 4ZKBB 3KUPA 3J81L 1W2BA 2ZT9C 1I6HB 2F0JA 2F0GA 1V1OA 1VF5C 4BXXG 4PNYA 2JA5H 1N32Q 3NE5B 4R4IA 4DV5L 5T1GA 3S2HH 1JT8A 4TRDA 3NTKA 4LFCL 3FDTA 4X66Q 4X66L 2P5ZX 4R8IA 3H3VI 1XWEA 2WAQE 4NKLA 2BH2A 3M85A 3KBGA 2E2JH 3D31A 3VYTA 2UU9Q 2D9UA 1U0LA 4JI5Q 5IE8A 3WWVA 5FO9B 1JOKA 1S5CD 1K73C 1IW7C 1XX8A 1RDPD 1JORA 2KHIA 5HGQA 1M4VA 3TN2A 1BKBA 1HHVA 3W1BA 4ZLTF 4GNXB 1BQQT 2KCTA 1D5XC 1JE5A 3OYYA 5M3FG 5EPKA 4BBSG 4XT1B 2EPBA 4IFDJ 3CMEA 3CC4A 1RODA 1UE7A 4LF8L 2KHJA 2CFMA 1Y8PB 2Z4HA 3CCRA 5C4JB 5K36H 3STBC 2NVYH 5FLXc 1TWFH 3CCVA 3PO3G 2VUMB 5C6AA 5LHY1 4KY7A 4UY8C 1EWHA 1Y1VG 2NUCA 3IL8A 4GS3A 4FNFA 4OO1G 3EJIA 2FFKB 4DA2A 1KHIA 5DLQE 5IODA 5GAGC 5ELNA 4DV4Q 1FR3A 2JA5B 3KLSA 1NBWA 1PZJD 2K03A 5GQOA 3S17B 2TMPA 3CC2A 3A5UA 2B2TA 4KHPQ 5IYDH 4CBVA 1QNUA 5M5WB 1X3EA 1CKNB 5C3EB 2O2LD 3R8BA 1I94L 2Q2TA 1KLUD 2PMZE 1U4PA 5AFWA 4GOPC 1MJEA 4CJ2C 3GTOB 5KNBA 3ULPA 1NAPA 3D8GA 5LMUL 1CTMA 2NVYB 1VQAA 4RGMA 3TREA 3KF6B 3BVMA 2HQEA 4DV2L 5JJIA 1G291 4LAAA 1J5EL 1H9KA 2X6GA 3J81i 4IJHA 4MHEA 2N55A 2JSOA 1O80A 3HOWB 4RCNA 4HJ7A 4DV2Q 1A3TA 3NEMA 4JI4Q 2H4OA 4LF9L 3PIP3 2Z4IA 4H0LC 5D3IB 4DK6C 3RZOH 4AQYQ 4GNXA 3HKSA 4DXGA 2DGYA 5BN5A 1EWIA 4CJ1B 4FF3A 4DF7A 5JVH3 3D4DA 2ALYB 4DK0A 3A8KE 4J8QA 3S15H 3S14H 1M1KC 1A2TA 4DV4L 2VXWA 4B3SQ 5BN4A 1JWSD 4B3TQ 2XWBB 4JYAQ 1A2UA 2R92B 1A15A 4A3EB 4FF2A 4YWKA 2HIVA 2NB0A 2PCFB 2R92G 4XTCS 1PDQA 1HNXL 2D2CC 1XTCD 3H0GB 3HOVH 1I4GA 1BCPB 2QKIC 1GUNA 3J80c 4QCLA 3FKIH 1XNQL 5CV4A 3CD6A 4LF8Q 1FD7D 5AJ3L 4F7XA 5ISRA 3BYYB 4J1MA 3UI2A 5CV5A 1NJIC 2SNSA 1IBLQ 2NVTB 3FMCA 3CC7A 1NR4A 1CK1A 2MNAA 1D5MC 4AYBG 1XNQQ 4A3LH 2KEEA 3I4MH 1Q7YC 1HNWQ 1QUQB 4B3MQ 1KC8C 2J4XA 4IUQA 3H91A 4DV6Q 2CH4W 1DOLA 2WIIB 3STBD 2OTLA 3SDZA 1AN8A 4TVAB 5KNCA 1I50B 3U50C 4A3GB 1Z7TA 3SK4A 1SNQA 2KENA 2K33A 2K6AA 4N9PA 3S1NH 1YJNA 2RHSB 4UPAA 1QZGA 5M3FB 1RJTA 2WKCA 2A19A 2QEJC 3T16A 2KJXA 1YI2A 1EUJA 3LWUA 1Q81C 4UP8A 1PH5A 1HTLD 4KD3A 1SYGA 3JAME 3JC66 1PYBA 4R4CA 3CCQA 3I4MB 1FVIA 4FXKC 2Z0SA 5C44H 4UDUC 4K5WA 2JEBI 2BCOA 3RMHA 3I7FA 2R7ZH 1I4RA 4NDXA 3K8AA 4JI0Q 3DMUA 1L0XB 3HKZE 2K5NA 1GUGA 1GJXA 3HOZH 4C56C 4YWLA 3GTMB 4C3JB 2EXZA 1EFWA 3NENA 4PMWA 3GTPH 3OTOL 2F0VA 2ZM6L 5JPNC 1PTOH 3U4VA 1LLRD 1X3GA 2RF4A 2KUMA 3K7AB 2HHHQ 2N8NA 4FXGC 2KHSA 1WTPA 1QVFA 1PVOA 3OHXC 1EYGA 3AB9A 5CV6A 4CDEC 2PQAB 4B3SL 4S3SA 4BBSB 4JI2Q 3S2DB 2QILA 4AIMA 2L4NA 1KAAA 4B9XA 3IAYA 4GOPA 4C3HG 5KGUA 1LO5D 2YTXA 2A8VA 2RDHA 5A2QE 3PCOB 4CGYB 1B3QA 3I73A 1Y1WB 1JQYD 4POFA 3FRPB 4PV1C 2CHBD 2IWHA 1G2TA 3SEBA 2QEXA 1BR9A 2A69C 3R2TA 4LF4L 3HOUB 3CCMA 2DNCA 3RLNA 3KF8A 3A8JE 4ID6A 4E6IA 4ODGA 4B08A 4JI0L 3GTGB 1EY5A 5IYBH 4NXNQ 1F9RA 2R7DA 2JYOA 4LF5L 2YTYA 1LTLA 3HOYG 3F2CA 2ID0A 5C4XB 1JR0D 3H3VC 1RTOA 4OIKA 1XPRA 5I2XA 1Q86C 3GTPB 3VYSA 4A3JB 5CV8A 2ATWA 1EY7A 4GKJL 1LTSD 2AQ1B 1K8GA 1HZ9A 2C5CA 4F87A 3WOFA 4A93H 3IKJA 1TR5A 3HOVG 1YHQA 1YNNC 3W3AA 1HR0Q 2RVLA 3NELA 4A3DG 5JOBA 4B3RL 4FXDA 1A6XA 4LK1C 1LACA 5H1SE 4P73A 2LXKA 1B44D 4JCVE 2ZXPA 5IY0A 5IGGA 4G4KA 5KRUA 2ENBA 5JJKA 3K0XA 4A3DB 1PTOC 2FJ2A 2ZXOA 2EYJA 1I6VC 2WAQG 1CQVA 4P2CB 4MTNA 2J7ZA 3TP5A 1L0YB 1G2SA 3L7ZC 3GTLH 3RUZA 4C1NK 4IURA 4IUVA 3M7NA 4A3CH 1LTAD 1GO3E 5GADC 3CW2C 1VQ5A 4YY3L 3M4YA 5IYCH 3OMGA 2JJQA 1SNDA 1AZQA 5IOCA 3NWSA 3P75A 4DV3Q 1EOVA 3MXPA 3MXUA 4RAUC 1HFNA 1CKMA 2MQHA 4TSSA 3T56B 3CCSA 4A3LG 3C1FA 3CCUA 1LABA 3ZYYX 2EY5A 3NPPA 3CQZB 5EBCA 4O2DA 4PZ6A 1SFOB 3OWEB 1EU4A 1YJ9A 2B2YA 2B39A 4L8JA 1Y1VH 3Q24A 3BVZA 3I4LA 1WCMG 1A3VA 4X62L 3TS2A 2E5LQ 2ZJQA 3K5NA 3NK9A 2N78A 1Q3LA 4WRDA 4LFCQ 4A93G 2ZTEA 3CU7A 2UXCQ 3ULJA 1JCKB 1SEBD 1ICWA 2K5WA 5LL6S 5I9OA 1N9WA 1IBKL 3SR1A 3PO3H 3S1RH 3VDYA 3HGBA 5M3MB 3HP3A 3UDIA 2R92H 4XYOA 3MA2B 4MIUA 4A3EG 4A3KG 4KHVA 2A74C 5C44G 4LUVA 4YCVA 2FHTA 4DR4Q 5D3DA 4KHZA 4A3FH 1T9HA 3AEVA 4YCUA 3SK5A 3M4OH 2WACA 5C5MA 1ILPA 2K75A 3NTIA 4HTHA 3C1EA 5LMNQ 2ES2A 1RHPA 4JBWA 4NP5A 1Q46A 3A7LA 2FMCA 2EY1A 4PQXA 1C9OA 4ME3A 1Q1EA 3M4PA 1TWGH 1PRTB 4XYQA 3OIQA 4JBJA 1GD7A 4PMBA 3K5OA 2IJ0A 4POGA 1SE3A 1FGBD 1E2VA 2UUAQ 3LGJA 4IUPA 4A3CG 1JWMD 4DR7Q 4ULLA 4BBRB 3C3LA 1WTRA 5T1IA 1JE4A 1TY0A 3LNNA 3QB3A 1IZ6A 4QGUA 4H13C 5NUCA 4FDBA 1PFMA 4H7BA 1MSGA 3PUWA 4GNXC 3CPWA 2HUGA 2DJGC 3D4RA 4LJZC 3J80E 2KEDA 4C3HB 2E2HH 1TT2A 3KDFA 5L37A 3HZXA 4I7AA 2PMZB 1IXRA 1B9MA 4JW0A 2CW0D 3HOUH 2OQ0A 1S4ZA 2EJGC 1OTCA 2R7ZG 4YIJA 3DWAA 2PW5A 3ZJYC 4A3GG 1V1QA 2R3ZA 3FVQA 4V0BA 3L2PA 3AFQA 1PV4A 3S17H 4DKAC 2B2UA 4X65L 4QIWE 5JVG3 4Z9CB 2AWNA 2Z1CA 2XGTA 1EEFD 4LF7L 1HCZA 3WOEA 2O4XA 1SMYC 2Y0SB 4BS9A 1VQLA 2K4KA 3H09A 4BY1H 1B2TA 1AZPA 2LY7A 4LF7Q 1HQRD 1ENFA 2AUKA 5C3WA 3J7A5 3RZDB 3PF4A 3S9WA 3GTKB 3F8TA 2VUMG 3PO3B 2A1AA 1EQQA 4A3KH 4RHSA 2OQKA 1D1IA 2B2UC 4OX9Q 4LFAQ 1HZAA 2B63H 4HJ5A 5C0XG 1BBXC 1VF7A 1Q82C 1MSHA 1PZKD 5CV9A 2FINB 2BA1A 2JK8A 2OWOA 2JA9A 2MJ8A 2X69A 2OTJA 1K8AC 4B3RQ 2MGSA 4DV6L 3I8ZA 3PO2B 5J3BA 4YWMA 3X3NA 1HH2P 4B3ML 3EIVA 1G6ZA 2UUAL 3CQZH 4DR2Q 3M3YB 1YHBA 3OMCA 1I4XA 3J7ZC 1X3PA 1JJ2A 1PH2A 1YHAA 1J8IA 1U9RA 3IRBA 1TWGB 1M8AA 1VQFA 4P75A 1KIXA 4DUZQ 1NCVA 4C2MB 1OXTA 1S5DD 1I4PA 4XDXA 2DN8A 1DGSA 2I46A 3HKZB 1B7YB 5IP7G 1I50H 1CI3M 1U4RA 2NVXH 4JI6L 3GTLB 3DUZA 3GTQB 4A3GH 4EX5A 3J80L 4DGZA 4XT3B 1KDCA 4QMGA 4O0AA 4DFAA 1CFMA 3GTJB 1S72A 4HIMA 4JVZA 1I4HA 1MBYA 1SYBA 1L1OB 1CM9A 1VS0A 2NN6I 5I2YA 1SYEA 2EYOA 2IX3A 4CJ0B 1N33Q 5F2DA 2SOBA 1MGSA 4J15A 1EZ8A 3H6MA 5IYCG 2L55A 1KRTA 1WTXA 4R4OA 4A93B 4DUYQ 3I72A 3HRZC 4NB3A 3FP9A 2N49A 3G71A 2F0KA 5I6YA 3GQBA 4C3IG 1CHPD 4DV0Q 2AQ3B 2CW0C 4A3BH 4NPSA 1HNZQ 3H0GG 3S24A 3KF8B 2XTIA 2R7ZB 5C4XH 1KAWA 1EY6A 1Y1VB 3RN2A 3VA7A 3HOXH 1Y69U 3K6OA 4JV5Q 2RDFA 4DR6L 4RFBA 3TP8A 1ML0D 4GLAC 4ME5A 5EAYA 1S3OA 1DONA 2E2JB 4LFBL 2NZOA 1O7YA 3F2BA 2JA7H 5LMNL 2F0FA 1ESFA 3M7GA 3NHHA 2O5IC 1XMQL 2K5VA 1C48A 4DR6Q 1YVCA 4IPCA 1M90C 1VQHA 3D4WA 1W3SA 4DR2L 4EGVA 4G57A 2RSOA 2RKSA 3QIAA 1ZYRC 2WAQB 1XTDA 3ULLA 1TQOA 4RMFA 5M5YH 3TP6A 1PYWD 2GVBA 1QVCA 4UAIA 2DY7A 2K32A 4OO1I 4IFDH 1JC7A 1WTWA 1DCZA 3S2DH 4QUCA 1XPOA 3T51B 4K8IA 4Y7NB 4DUYL 1L0WA 4L6TB 1Z6HA 4CKCA 4DR3L 3T1HL 1A63A 3K7UC 2K01A 2EE1A 3GO5A 3CP0A 4OWWB 1CHQD 1XXGA 4WJ3M 2QGQA 3SVMA 1ENAA 4GKJQ 3A7AB 5M3MG 2I5MX 1R4QB 3D3RA 1E22A 1FNWA 2PNHA 1K0SA 2PW7A 4QQBX 3HG9A 1LTGD 5C4XG 2D0OA 3ONAB 5A35A 4IOAA 1WTHA 1HNWL 2JXMB 2J0TD 1EIYB 4PZ7A 1H9SB 4M1UB 4X3SA 1ILQA 2M9VA 1ONLA 4L5SA 5E1FA 3QO2A 2JA5G 2JP1A 5BR8Q 4YY3Q 1E0BA 2Q8TA 3I55A 1HQMC 3R2IA 4JI3L 2AHOB 3C2PA 2G9DA 5C5LA 2N88A 4EQOA 2G5DA 2MHVA 5EKLA 3NWTA 1CKOA 1QB5D 2K5HA 3ITPA 1PHJA 1N32L 4DNTB 3Q0AA 4CKBA 3E0EA 3GD7A 1CUKA 2F0OA 3FPUB 1STBA 2F0TA 4KK7A 2EYLA 1TWCH 1LT4D 2AKWB 1IYVA 2B2WC 3QWNA 1YNJD 4C1NI 4DR7L 4JI2L 1C0AA 2V4DA 1IKLA 1F2LA 1ZEQX 3M9BA 4I65A 3T13A 1K83B 1VQJA 1KL9A 1SYDA 1WYDA 3ICEA 3AQQA 1SXTA 3AYHB 4AQYL 1V1PB 4IFDI 2GVAA 4KTAA 1VQNA 3BDLA 4GN3B 1STEA 3DWQA 3I56A 2F0MA 4Y7NH 3OTOQ 5JEAG 1ET9A 2OT2A 3TEHB 5GAHC 4J6HA 5C4HA 5FJ8G 2PZWA 4AYBE 4K8JA 2QCPX 2QW7A 3D6WA 1DXMA 2E75C 1VQPA 1XJVA 3CRKC 1WD1A 1KNAA 1EL0A 4DR4L 2IPKD 1N34Q 1QCBD 1EY4A 4A3JG 5JJLA 3TZDA 1RCVD 4A3IH 2OXPA 4BY1G 1RIPA 1WVLA 4P71A 5C44B 4BY7B 1C4QA 4C3IH 1PA6A 2CVRA 5G3LD 4K2KA 1FJGL 1SN8A 1TWFB 4FVMA 4RKLA 3SHLA 4DPGA 2VUMH 3J81j 3ERSX 2A5HA 1GUOA 3UDFA 3OOCA 1BVSA 4NXMQ 1ICFB 1Y8NB 3KF6A 1Y8OB 2F0SA 3Q23A 4OHJA 1GHJA 3GDEA 2F4IA 1IKMA 1AEXA 2E5LL 1B3AA 2JA6H 1EOTA 1PH4A 3SK6A 2IL8A 5KIXA 1AH9A 3MWYW 1WCMH 1II3A 2BA0A 4DK3C 2B8FA 2DUDA 3E9HA 1HRJA 2JA6B 4DAYB 1S5FD 2RA4A 3K5MA 5CV7A 3RNUA 1IL8A 5BN3A 4IPDA 2UUCL 4DR1Q 2HQLA 1RTNA 3D6CA 4KI0A 4UP9A 1Q8IA 1X3FA 3ER0A 1H9MA 2PI2A 4LWCA 4ZKCB 1PH3A 1B4OA 2EY6A 2VS1A 3GTJH 1RKNA 4XXEA 2E8GA 2QDLA 1SE2A 3S2HB 4RGNA 4A3IB 1HZCA 1EQRA 4DU9A 2B3GA 4KKSA 1KDAA 1FGUA 3CCEA 2F0LA 2CWPA 3L9AX 2L15A
chains in the Genus database with same CATH topology
1W2BA 4DR4Q 2NZHA 3PUZA 4KHZA 4A3FH 1T9HA 4BXXG 3AEVA 4YCUA 4A76A 2JA5H 1N32Q 5C4JH 3M4OH 4R4IA 4DV5L 1OXSC 2N3SA 1YIJA 3S2HH 1JT8A 1JJCB 5IYDG 2K75A 2EQSA 2ES2A 2Q2IA 5LMNQ 4LFCL 3G48A 4RG1A 4JBWA 4X66Q 4X66L 3CPFA 5M5XH 3J81c 4IPGA 2B63G 3Q8DA 3H3VI 1UE5A 2WAQE 1OXVA 1Q46A 3M85A 4OX9L 2BH2A 1E3PA 4DUZL 2E2JH 4LF6L 2Q2HA 3D31A 1B8AA 1C9OA 1Q1EA 4ME3A 4C2MH 2UU9Q 3M4PA 1U0LA 3PO2H 1TWGH 1ASYA 4JI5Q 1YJWA 5IE8A 4JBJA 1GD7A 1GVPA 3WWVA 1VQCA 1B70B 2RHQB 1K73C 4POGA 2UUAQ 2KHIA 5HGQA 3LGJA 3PUVA 4HIOA 4A3CG 1YNXA 1VCIA 2WFWA 1BKBA 4JI8Q 3RN5A 4DR7Q 1X55A 4MZ9A 1IZ6A 4QGUA 3W1BA 1K0RA 4DV0L 4FDBA 1C7YA 4GNXB 3PUWA 4GNXC 3UDXA 3CPWA 2KCTA 4P72A 1XNRL 1JE5A 1E1TA 2WP8J 3OYYA 5M3FG 1IL2A 4L5QA 1PH6A 3RLFA 3PF5A 2E2HH 3KDFA 1XPUA 4BBSG 1XMQQ 5IP9G 1IXRA 4IFDJ 3CMEA 3CC4A 3HOUH 2OQ0A 1UE7A 4LF8L 2KHJA 2CFMA 4KLKA 1YBYA 3KJPA 1OTCA 2R7ZG 2EIFA 4LFBQ 3CCRA 4X6AH 3ZJYC 2AMCB 3STBC 2NVYH 3PGZA 1TWFH 1V1QA 5FLXc 5GAEC 3CCVA 3PO3G 4A3GG 4JI3Q 4UY8C 5M5WH 1Y1VG 3HOYH 1PH1A 4GLXA 3TQYA 4GS3A 3L2PA 3AFQA 1PV4A 4OO1G 4DR3Q 1BBUA 3S17H 1AE2A 4DKAC 4X65L 3FHWA 4QIWE 1KHIA 4QJFA 2AWNA 2XGTA 1Y14B 5DLQE 4B3TL 3S1MH 4JYAL 4LF7L 5GAGC 5ELNA 4DV4Q 4IJLA 2R6GA 3S16H 2KCMA 1A0IA 5IWAQ 2CCZA 1HJPA 1NBWA 3B6YA 3GTQH 5GQOA 1VQLA 1VQIA 1I6HH 1NE3A 2I5HA 1O7IA 2K4KA 3A5UA 2QA4A 1S40A 3CC2A 2ZJPA 4BY1H 1UE6A 4KHPQ 5IYDH 3AFPA 4LF7Q 1X3EA 1CKNB 4DR5Q 2VQEQ 4A75A 3J7A5 3I4MG 1SMXA 4XIGS 1I94L 3PF4A 5M3MH 2Q2TA 1UEBA 2PMZE 1G51A 5FJ8H 3F8TA 4GOPC 3I4OA 2VUMG 2A1AA 1MJEA 2C35B 1EQQA 2Q2UA 3UE1A 3PO2G 4A3KH 2OQKA 3ULPA 4C3HH 2YU9H 3I2ZA 4OX9Q 2ZM6Q 2F52A 4LFAQ 1HZAA 2GN5A 5C0XI 5LMUL 4DV1L 1VQAA 3HOWG 5FLMG 4A3JH 2B63H 1K83H 1NY4A 5C0XG 4HJ5A 3TREA 1Q82C 1IBMQ 3KF6B 1L2FA 4DV2L 4DV7L 5JJIA 1U5KA 1G291 4DV5Q 3PSIA 1J5EL 2BA1A 2JK8A 4NXNL 4BBRH 3J81i 4IJHA 1K9MC 2OWOA 1J5EQ 2JA9A 1PFSA 2F3IA 2OTJA 2UUBL 4ALPA 1K8AC 1CSPA 1Z47A 4HJ7A 4DV2Q 2Y0SE 1Q1BA 3NEMA 4JI4Q 4YHHQ 2JA7G 2JA8G 4LF9L 4DV6L 4B3RQ 1QVGA 3H3VH 4AH6A 5J3BA 4YWMA 1NTGA 1HH2P 4B3ML 1A8VA 3EIVA 2KBNA 2UUAL 2BH8A 3CQZH 3PV0A 3CXCA 4DR2Q 1YHBA 4DK6C 4IOCA 4L5RC 3RZOH 3J7ZC 4AQYQ 4GNXA 1JJ2A 2AWOA 1KRSA 1SLJA 3A0JA 3T1YL 4LNQA 3HKSA 1OXXK 4MNOA 1PH2A 2DGYA 1H95A 5BR8L 4X64L 1EWIA 1YHAA 3GTKH 2JE6I 3RZDH 3IRBA 1VQFA 1Y1WG 2VQEL 4P75A 3TS0A 5IP7H 4H02A 4DUZQ 1KIXA 2UXCL 1OXTA 2LXJA 4IPHA 4YCVA 1R9TH 2RCNA 4OONA 2ALYB 2VL6A 4HJ9A 1DGSA 1UWVA 3U58A 2EXDA 1B7YB 5IP7G 4HIKA 3S15H 3S14H 3K81C 5JEAJ 1I50H 2NVXH 1M1KC 2K50A 4JI6L 2UUBQ 4BY7H 4A3GH 3BZCA 3KLWA 4DV4L 1GM5A 4EX5A 4B3SQ 4B3TQ 4JYAQ 1L1OC 1SE8A 1WI5A 3BJUA 1Z9FA 4GKKL 1N36Q 4R4QA 4O0AA 4JI7L 4JI7Q 1ASZA 4A3DH 2I0QA 1X54A 4YWKA 2IX1A 2HIVA 1S72A 2R92G 4XTCS 4HIMA 3UE0A 1HNXL 1RL2A 1VS0A 1L1OB 1PH7A 2NN6I 5C3EG 1X56A 3HOVH 3J80c 3FKIH 1XNQL 1N33Q 2NVQH 3CD6A 2IHFA 2V1CC 4J15A 4LF8Q 1TWAH 2JQOA 5AJ3L 1SRUA 2Y0SG 5IYCG 2UXDL 3PIPA 1KRTA 1IBLL 4BXXH 4R4OA 3TRZA 3CF5A 1NJIC 1SR3A 1IBLQ 4DUYQ 1VQ7A 2VW9A 3CC7A 3FP9A 3E9IA 2N49A 4NB3A 3G71A 2MNAA 1XNRQ 3T1YQ 1LYLA 4AYBG 4OWTB 3H15A 1N33L 4A3MH 1XNQQ 1VQBA 2UUCQ 4A3LH 2JEAI 4DV0Q 3I4MH 1Q7YC 1HNWQ 1QUQB 1X9NA 1KC8C 4B3MQ 4A3BH 1JB7A 4DV6Q 4LF9Q 3W1GA 4NPSA 1HNZQ 3H0GG 3KOJA 3S24A 3KF8B 2JA8H 2XTIA 4R1JA 1KD1C 3STBD 5C4XH 2OTLA 1KAWA 2CWAA 3CAMA 5E7NA 3RN2A 1UE1A 4TVAB 3HOXH 3U4ZA 3G6EA 1XMOQ 3U50C 1SFOH 3MXNB 4JV5Q 4DR6L 5HY6A 2HT1A 4BA1I 4GLAC 4LF6Q 1OXUA 1IBML 2KENA 5EAYA 1S3OA 5IT9c 4LFBL 3G4SA 2NN6G 2NZOA 3S1NH 3F2BA 2JA7H 2MO1A 1YJNA 2UXBL 5LMNL 1V43A 4R4TA 2RHSB 4UPAA 1QZGA 1XMQL 2A19A 2K5VA 4DR6Q 1YVCA 1K3RA 1D8LA 5IYBG 1YI2A 1A62A 1EUJA 1X65A 4IPCA 1GKHA 4UP8A 3CCJA 1Q81C 1M90C 1CKNA 1VQHA 1PH5A 3RLOA 1I94Q 1W3SA 4GN5A 1HR0W 4DR2L 1PYSB 3JC66 4WJ4A 1PYBA 4R4CA 3CCQA 1XTDA 2MFIA 1FVIA 3ULLA 4KHPL 4RMFA 2Z0SA 4QY7A 5M5YH 5C44H 1PH8A 2GVBA 1MJCA 1QVCA 2JEBI 1I5FA 3I7FA 2R7ZH 3K80C 1V9PA 4OO1I 3HOZG 3K8AA 3S2DH 1VQMA 1XPOA 3BZKA 4JI0Q 2R93H 1QUQA 4JI5L 3HKZE 4DUYL 1L0WA 2K5NA 4DR3L 4IO9A 3T1HL 3HOZH 4YWLA 1KQSA 1A63A 3K7UC 2CKZB 1EFWA 2HIXA 3NENA 4PMWA 2WB1E 3L0OA 3OTOL 1HR0L 3GTPH 3MEFA 2ZM6L 3GO5A 5LMUQ 4DR1L 3U4VA 3CP0A 1X3GA 2B29A 2RF4A 4Y52H 4OWWB 3I4NG 4WJ3M 4JOIA 2QGQA 3KDFB 2IHEA 1J6QA 4GKJQ 2HHHQ 3PUYA 5M3MG 1NMGA 2YV5A 2I5MX 2N8NA 1WJJA 1E22A 1QVFA 1PVOA 1SROA 2PNHA 1Q8KA 3H0GH 1EYGA 4DR5L 2PQAB 4QQBX 4B3SL 5C4XG 4JI2Q 2D0OA 3GTGH 4IOAA 1N8RC 1D7QA 3CCLA 1HNWL 4AIMA 4JI1Q 4A3EH 2D0PA 2VQFL 2VQFQ 4A3MG 4UP7A 1EIYB 4JBKA 4PZ7A 5IWAL 4NXML 1IYJB 4GOPA 3EBEA 3A74A 3HKZG 2VY3A 2K14A 4JOIC 1VQOA 2YTXA 3KYHC 2A8VA 2FXQA 2Z6KC 4L5SA 3KFUA 1MKHA 2JA5G 3PCOB 5BR8Q 1EIFA 3PUXA 4YY3Q 1FJGQ 5AJ3Q 3I55A 2Z6KA 4POFA 1QZHA 2UU9L 4JI3L 2AHOB 1L1OA 2VNUD 2CQOA 4PZ8A 2QEXA 4LUZA 2JA6G 4LF4L 1YITA 4JI4L 3CCMA 3RLNA 2IT1A 4DAMA 1CKOA 1WFQA 2K5HA 3PIOA 1N34L 1PHJA 1N36L 3JAMc 4GKKQ 1N32L 2H5XA 3S1QH 1KXLA 4JI0L 4NXNQ 1BBWA 3E0EA 5GROA 5IYBH 3GD7A 4BBSH 2LSSA 1CUKA 4A4IA 2OCEA 1VQGA 3NBHB 2R7DA 3F1ZA 4LF5L 2YTYA 1LTLA 3HOYG 3F2CA 1TWCH 2ID0A 2AKWB 3F2DA 1XPRA 4JI8L 2NVTH 4DV1Q 4HIDA 4LFAL 4DR7L 4JI2L 5K36G 1C0AA 3OW2A 4JBMA 3M9BA 2PQAA 3UDGA 1VQJA 1NMFA 1KL9A 1WYDA 1Q86C 2ATWA 3AQQA 5IP9H 3ICEA 4IFDG 2R7FA 4GKJL 4HJ8A 4BY7G 3AYHB 2IX0A 3D0FA 3CMAA 1K8GA 4AQYL 1VQ9A 4IFDI 3EN2A 2GVAA 1HZ9A 1VQNA 3K7AH 4GN3B 2K52A 4A93H 3I56A 3HOVG 1WOCA 1YHQA 4Y7NH 3OTOQ 1HR0Q 4LW1A 5JEAG 4K0KL 3FKIG 3NELA 4YHHL 3JAMi 4L5TA 2ASBA 4A3DG 4B3RL 3TEHB 5GAHC 5H1SE 4P73A 5FJ8G 4JG2A 3GTMH 1TXYA 2LXKA 4AYBE 4TQUS 4A3FG 1G6PA 1XMOL 1JJGA 1E1OA 4OXPA 4JCVE 4EQ5A 5IY0A 1VQPA 1XJVA 5JJKA 4X65Q 4DNIA 4DR4L 3K0XA 3HOXG 1N34Q 2PI2E 2ZTDA 4DV7Q 4A3JG 5JJLA 3I4NH 1VQ8A 1P8LA 2WAQG 4GOPB 1HNZL 4A3IH 2WB1G 4K0KQ 4MTNA 1P16A 4BY1G 1RIPA 2IY5B 4P71A 1JMCA 3HFZB 3L7ZC 3GTLH 3J80i 2D62A 4JC0A 4C3IH 3M7NA 4A3CH 1PA6A 5ELOA 4A3IG 2F4VL 1GO3E 2MO0A 5GADC 1IBKQ 3CW2C 1VQDA 1VQ5A 3A5ZB 4YY3L 1FJGL 3M3YH 1SN8A 5IYCH 4DPGA 2JJQA 1YZ6A 2VUMH 1Y1WH 3J81j 4QL5A 3ERSX 4DV3Q 3UDFA 2ZJRA 1EOVA 2UXDQ 1CKMA 2YYZA 2UXBQ 2MQHA 1AE3A 5M3FH 1BVSA 4NXMQ 3CCSA 2F4VQ 3BU2A 3HOWH 3KF6A 5C0XJ 5FLMH 2E2IH 4A3LG 3GDEA 3CCUA 1TWHH 4YCWA 3RR5A 4LF5Q 2E5LL 3HOUG 3M4QA 4X62Q 2JA6H 4JV5L 1PH4A 4O2DA 4PZ6A 5LMNW 1PH9A 1AH9A 2YTVA 4BBRG 1WCMH 1YJ9A 2BA0A 4DK3C 2DUDA 2ZTCA 3E9HA 1Y1VH 2HHHL 1FL0A 4PG3A 4DAYB 4LF4Q 1WCMG 1HZBA 2VZAA 3W5OA 4X62L 4JI6Q 1E7ZA 3TS2A 3RNUA 2E5LQ 2ZJQA 3DLLA 3GTOH 1VQEA 2I5LX 2N78A 1VQ6A 4IPDA 2UUCL 4DR1Q 2HQLA 4P74A 3KJOA 1I3QH 1X6OA 4KI0A 4LFCQ 4UP9A 1Q12A 3SGIA 4A93G 1X3FA 2ZTEA 2UXCQ 3ER0A 4C3JH 3ULJA 4APVA 4HJAA 4DV3L 3T1HQ 2PI2A 2R93G 4LWCA 1PH3A 4X64Q 4GLVB 1N9WA 1LM0A 4BA2I 2VS1A 1E24A 3GTJH 1IBKL 3PO3H 3S1RH 1LUZA 3VDYA 2E8GA 3UDIA 1VQKA 1MIUA 4JI1L 2R92H 1VQ4A 4OWXB 3DM3A 4A3BG 1HZCA 1EQRA 4LUOA 2B3GA 1HNXQ 5C3EH 4GN4B 4A3EG 1CSQA 1FGUA 4A3KG 5C44G 3CCEA 4LUVA 2CWPA 2L15A 1YEZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W2B A;  4DR4 Q;  2NZH A;  3PUZ A;  4KHZ A;  4A3F H;  1T9H A;  4BXX G;  3AEV A;  4YCU A;  4A76 A;  2JA5 H;  1N32 Q;  5C4J H;  3M4O H;  4R4I A;  4DV5 L;  1OXS C;  2N3S A;  1YIJ A;  3S2H H;  1JT8 A;  1JJC B;  5IYD G;  2K75 A;  2EQS A;  2ES2 A;  2Q2I A;  5LMN Q;  4LFC L;  3G48 A;  4RG1 A;  4JBW A;  4X66 Q;  4X66 L;  3CPF A;  5M5X H;  3J81 c;  4IPG A;  2B63 G;  3Q8D A;  3H3V I;  1UE5 A;  2WAQ E;  1OXV A;  1Q46 A;  3M85 A;  4OX9 L;  2BH2 A;  1E3P A;  4DUZ L;  2E2J H;  4LF6 L;  2Q2H A;  3D31 A;  1B8A A;  1C9O A;  1Q1E A;  4ME3 A;  4C2M H;  2UU9 Q;  3M4P A;  1U0L A;  3PO2 H;  1TWG H;  1ASY A;  4JI5 Q;  1YJW A;  5IE8 A;  4JBJ A;  1GD7 A;  1GVP A;  3WWV A;  1VQC A;  1B70 B;  2RHQ B;  1K73 C;  4POG A;  2UUA Q;  2KHI A;  5HGQ A;  3LGJ A;  3PUV A;  4HIO A;  4A3C G;  1YNX A;  1VCI A;  2WFW A;  1BKB A;  4JI8 Q;  3RN5 A;  4DR7 Q;  1X55 A;  4MZ9 A;  1IZ6 A;  4QGU A;  3W1B A;  1K0R A;  4DV0 L;  4FDB A;  1C7Y A;  4GNX B;  3PUW A;  4GNX C;  3UDX A;  3CPW A;  2KCT A;  4P72 A;  1XNR L;  1JE5 A;  1E1T A;  2WP8 J;  3OYY A;  5M3F G;  1IL2 A;  4L5Q A;  1PH6 A;  3RLF A;  3PF5 A;  2E2H H;  3KDF A;  1XPU A;  4BBS G;  1XMQ Q;  5IP9 G;  1IXR A;  4IFD J;  3CME A;  3CC4 A;  3HOU H;  2OQ0 A;  1UE7 A;  4LF8 L;  2KHJ A;  2CFM A;  4KLK A;  1YBY A;  3KJP A;  1OTC A;  2R7Z G;  2EIF A;  4LFB Q;  3CCR A;  4X6A H;  3ZJY C;  2AMC B;  3STB C;  2NVY H;  3PGZ A;  1TWF H;  1V1Q A;  5FLX c;  5GAE C;  3CCV A;  3PO3 G;  4A3G G;  4JI3 Q;  4UY8 C;  5M5W H;  1Y1V G;  3HOY H;  1PH1 A;  4GLX A;  3TQY A;  4GS3 A;  3L2P A;  3AFQ A;  1PV4 A;  4OO1 G;  4DR3 Q;  1BBU A;  3S17 H;  1AE2 A;  4DKA C;  4X65 L;  3FHW A;  4QIW E;  1KHI A;  4QJF A;  2AWN A;  2XGT A;  1Y14 B;  5DLQ E;  4B3T L;  3S1M H;  4JYA L;  4LF7 L;  5GAG C;  5ELN A;  4DV4 Q;  4IJL A;  2R6G A;  3S16 H;  2KCM A;  1A0I A;  5IWA Q;  2CCZ A;  1HJP A;  1NBW A;  3B6Y A;  3GTQ H;  5GQO A;  1VQL A;  1VQI A;  1I6H H;  1NE3 A;  2I5H A;  1O7I A;  2K4K A;  3A5U A;  2QA4 A;  1S40 A;  3CC2 A;  2ZJP A;  4BY1 H;  1UE6 A;  4KHP Q;  5IYD H;  3AFP A;  4LF7 Q;  1X3E A;  1CKN B;  4DR5 Q;  2VQE Q;  4A75 A;  3J7A 5;  3I4M G;  1SMX A;  4XIG S;  1I94 L;  3PF4 A;  5M3M H;  2Q2T A;  1UEB A;  2PMZ E;  1G51 A;  5FJ8 H;  3F8T A;  4GOP C;  3I4O A;  2VUM G;  2A1A A;  1MJE A;  2C35 B;  1EQQ A;  2Q2U A;  3UE1 A;  3PO2 G;  4A3K H;  2OQK A;  3ULP A;  4C3H H;  2YU9 H;  3I2Z A;  4OX9 Q;  2ZM6 Q;  2F52 A;  4LFA Q;  1HZA A;  2GN5 A;  5C0X I;  5LMU L;  4DV1 L;  1VQA A;  3HOW G;  5FLM G;  4A3J H;  2B63 H;  1K83 H;  1NY4 A;  5C0X G;  4HJ5 A;  3TRE A;  1Q82 C;  1IBM Q;  3KF6 B;  1L2F A;  4DV2 L;  4DV7 L;  5JJI A;  1U5K A;  1G29 1;  4DV5 Q;  3PSI A;  1J5E L;  2BA1 A;  2JK8 A;  4NXN L;  4BBR H;  3J81 i;  4IJH A;  1K9M C;  2OWO A;  1J5E Q;  2JA9 A;  1PFS A;  2F3I A;  2OTJ A;  2UUB L;  4ALP A;  1K8A C;  1CSP A;  1Z47 A;  4HJ7 A;  4DV2 Q;  2Y0S E;  1Q1B A;  3NEM A;  4JI4 Q;  4YHH Q;  2JA7 G;  2JA8 G;  4LF9 L;  4DV6 L;  4B3R Q;  1QVG A;  3H3V H;  4AH6 A;  5J3B A;  4YWM A;  1NTG A;  1HH2 P;  4B3M L;  1A8V A;  3EIV A;  2KBN A;  2UUA L;  2BH8 A;  3CQZ H;  3PV0 A;  3CXC A;  4DR2 Q;  1YHB A;  4DK6 C;  4IOC A;  4L5R C;  3RZO H;  3J7Z C;  4AQY Q;  4GNX A;  1JJ2 A;  2AWO A;  1KRS A;  1SLJ A;  3A0J A;  3T1Y L;  4LNQ A;  3HKS A;  1OXX K;  4MNO A;  1PH2 A;  2DGY A;  1H95 A;  5BR8 L;  4X64 L;  1EWI A;  1YHA A;  3GTK H;  2JE6 I;  3RZD H;  3IRB A;  1VQF A;  1Y1W G;  2VQE L;  4P75 A;  3TS0 A;  5IP7 H;  4H02 A;  4DUZ Q;  1KIX A;  2UXC L;  1OXT A;  2LXJ A;  4IPH A;  4YCV A;  1R9T H;  2RCN A;  4OON A;  2ALY B;  2VL6 A;  4HJ9 A;  1DGS A;  1UWV A;  3U58 A;  2EXD A;  1B7Y B;  5IP7 G;  4HIK A;  3S15 H;  3S14 H;  3K81 C;  5JEA J;  1I50 H;  2NVX H;  1M1K C;  2K50 A;  4JI6 L;  2UUB Q;  4BY7 H;  4A3G H;  3BZC A;  3KLW A;  4DV4 L;  1GM5 A;  4EX5 A;  4B3S Q;  4B3T Q;  4JYA Q;  1L1O C;  1SE8 A;  1WI5 A;  3BJU A;  1Z9F A;  4GKK L;  1N36 Q;  4R4Q A;  4O0A A;  4JI7 L;  4JI7 Q;  1ASZ A;  4A3D H;  2I0Q A;  1X54 A;  4YWK A;  2IX1 A;  2HIV A;  1S72 A;  2R92 G;  4XTC S;  4HIM A;  3UE0 A;  1HNX L;  1RL2 A;  1VS0 A;  1L1O B;  1PH7 A;  2NN6 I;  5C3E G;  1X56 A;  3HOV H;  3J80 c;  3FKI H;  1XNQ L;  1N33 Q;  2NVQ H;  3CD6 A;  2IHF A;  2V1C C;  4J15 A;  4LF8 Q;  1TWA H;  2JQO A;  5AJ3 L;  1SRU A;  2Y0S G;  5IYC G;  2UXD L;  3PIP A;  1KRT A;  1IBL L;  4BXX H;  4R4O A;  3TRZ A;  3CF5 A;  1NJI C;  1SR3 A;  1IBL Q;  4DUY Q;  1VQ7 A;  2VW9 A;  3CC7 A;  3FP9 A;  3E9I A;  2N49 A;  4NB3 A;  3G71 A;  2MNA A;  1XNR Q;  3T1Y Q;  1LYL A;  4AYB G;  4OWT B;  3H15 A;  1N33 L;  4A3M H;  1XNQ Q;  1VQB A;  2UUC Q;  4A3L H;  2JEA I;  4DV0 Q;  3I4M H;  1Q7Y C;  1HNW Q;  1QUQ B;  1X9N A;  1KC8 C;  4B3M Q;  4A3B H;  1JB7 A;  4DV6 Q;  4LF9 Q;  3W1G A;  4NPS A;  1HNZ Q;  3H0G G;  3KOJ A;  3S24 A;  3KF8 B;  2JA8 H;  2XTI A;  4R1J A;  1KD1 C;  3STB D;  5C4X H;  2OTL A;  1KAW A;  2CWA A;  3CAM A;  5E7N A;  3RN2 A;  1UE1 A;  4TVA B;  3HOX H;  3U4Z A;  3G6E A;  1XMO Q;  3U50 C;  1SFO H;  3MXN B;  4JV5 Q;  4DR6 L;  5HY6 A;  2HT1 A;  4BA1 I;  4GLA C;  4LF6 Q;  1OXU A;  1IBM L;  2KEN A;  5EAY A;  1S3O A;  5IT9 c;  4LFB L;  3G4S A;  2NN6 G;  2NZO A;  3S1N H;  3F2B A;  2JA7 H;  2MO1 A;  1YJN A;  2UXB L;  5LMN L;  1V43 A;  4R4T A;  2RHS B;  4UPA A;  1QZG A;  1XMQ L;  2A19 A;  2K5V A;  4DR6 Q;  1YVC A;  1K3R A;  1D8L A;  5IYB G;  1YI2 A;  1A62 A;  1EUJ A;  1X65 A;  4IPC A;  1GKH A;  4UP8 A;  3CCJ A;  1Q81 C;  1M90 C;  1CKN A;  1VQH A;  1PH5 A;  3RLO A;  1I94 Q;  1W3S A;  4GN5 A;  1HR0 W;  4DR2 L;  1PYS B;  3JC6 6;  4WJ4 A;  1PYB A;  4R4C A;  3CCQ A;  1XTD A;  2MFI A;  1FVI A;  3ULL A;  4KHP L;  4RMF A;  2Z0S A;  4QY7 A;  5M5Y H;  5C44 H;  1PH8 A;  2GVB A;  1MJC A;  1QVC A;  2JEB I;  1I5F A;  3I7F A;  2R7Z H;  3K80 C;  1V9P A;  4OO1 I;  3HOZ G;  3K8A A;  3S2D H;  1VQM A;  1XPO A;  3BZK A;  4JI0 Q;  2R93 H;  1QUQ A;  4JI5 L;  3HKZ E;  4DUY L;  1L0W A;  2K5N A;  4DR3 L;  4IO9 A;  3T1H L;  3HOZ H;  4YWL A;  1KQS A;  1A63 A;  3K7U C;  2CKZ B;  1EFW A;  2HIX A;  3NEN A;  4PMW A;  2WB1 E;  3L0O A;  3OTO L;  1HR0 L;  3GTP H;  3MEF A;  2ZM6 L;  3GO5 A;  5LMU Q;  4DR1 L;  3U4V A;  3CP0 A;  1X3G A;  2B29 A;  2RF4 A;  4Y52 H;  4OWW B;  3I4N G;  4WJ3 M;  4JOI A;  2QGQ A;  3KDF B;  2IHE A;  1J6Q A;  4GKJ Q;  2HHH Q;  3PUY A;  5M3M G;  1NMG A;  2YV5 A;  2I5M X;  2N8N A;  1WJJ A;  1E22 A;  1QVF A;  1PVO A;  1SRO A;  2PNH A;  1Q8K A;  3H0G H;  1EYG A;  4DR5 L;  2PQA B;  4QQB X;  4B3S L;  5C4X G;  4JI2 Q;  2D0O A;  3GTG H;  4IOA A;  1N8R C;  1D7Q A;  3CCL A;  1HNW L;  4AIM A;  4JI1 Q;  4A3E H;  2D0P A;  2VQF L;  2VQF Q;  4A3M G;  4UP7 A;  1EIY B;  4JBK A;  4PZ7 A;  5IWA L;  4NXM L;  1IYJ B;  4GOP A;  3EBE A;  3A74 A;  3HKZ G;  2VY3 A;  2K14 A;  4JOI C;  1VQO A;  2YTX A;  3KYH C;  2A8V A;  2FXQ A;  2Z6K C;  4L5S A;  3KFU A;  1MKH A;  2JA5 G;  3PCO B;  5BR8 Q;  1EIF A;  3PUX A;  4YY3 Q;  1FJG Q;  5AJ3 Q;  3I55 A;  2Z6K A;  4POF A;  1QZH A;  2UU9 L;  4JI3 L;  2AHO B;  1L1O A;  2VNU D;  2CQO A;  4PZ8 A;  2QEX A;  4LUZ A;  2JA6 G;  4LF4 L;  1YIT A;  4JI4 L;  3CCM A;  3RLN A;  2IT1 A;  4DAM A;  1CKO A;  1WFQ A;  2K5H A;  3PIO A;  1N34 L;  1PHJ A;  1N36 L;  3JAM c;  4GKK Q;  1N32 L;  2H5X A;  3S1Q H;  1KXL A;  4JI0 L;  4NXN Q;  1BBW A;  3E0E A;  5GRO A;  5IYB H;  3GD7 A;  4BBS H;  2LSS A;  1CUK A;  4A4I A;  2OCE A;  1VQG A;  3NBH B;  2R7D A;  3F1Z A;  4LF5 L;  2YTY A;  1LTL A;  3HOY G;  3F2C A;  1TWC H;  2ID0 A;  2AKW B;  3F2D A;  1XPR A;  4JI8 L;  2NVT H;  4DV1 Q;  4HID A;  4LFA L;  4DR7 L;  4JI2 L;  5K36 G;  1C0A A;  3OW2 A;  4JBM A;  3M9B A;  2PQA A;  3UDG A;  1VQJ A;  1NMF A;  1KL9 A;  1WYD A;  1Q86 C;  2ATW A;  3AQQ A;  5IP9 H;  3ICE A;  4IFD G;  2R7F A;  4GKJ L;  4HJ8 A;  4BY7 G;  3AYH B;  2IX0 A;  3D0F A;  3CMA A;  1K8G A;  4AQY L;  1VQ9 A;  4IFD I;  3EN2 A;  2GVA A;  1HZ9 A;  1VQN A;  3K7A H;  4GN3 B;  2K52 A;  4A93 H;  3I56 A;  3HOV G;  1WOC A;  1YHQ A;  4Y7N H;  3OTO Q;  1HR0 Q;  4LW1 A;  5JEA G;  4K0K L;  3FKI G;  3NEL A;  4YHH L;  3JAM i;  4L5T A;  2ASB A;  4A3D G;  4B3R L;  3TEH B;  5GAH C;  5H1S E;  4P73 A;  5FJ8 G;  4JG2 A;  3GTM H;  1TXY A;  2LXK A;  4AYB E;  4TQU S;  4A3F G;  1G6P A;  1XMO L;  1JJG A;  1E1O A;  4OXP A;  4JCV E;  4EQ5 A;  5IY0 A;  1VQP A;  1XJV A;  5JJK A;  4X65 Q;  4DNI A;  4DR4 L;  3K0X A;  3HOX G;  1N34 Q;  2PI2 E;  2ZTD A;  4DV7 Q;  4A3J G;  5JJL A;  3I4N H;  1VQ8 A;  1P8L A;  2WAQ G;  4GOP B;  1HNZ L;  4A3I H;  2WB1 G;  4K0K Q;  4MTN A;  1P16 A;  4BY1 G;  1RIP A;  2IY5 B;  4P71 A;  1JMC A;  3HFZ B;  3L7Z C;  3GTL H;  3J80 i;  2D62 A;  4JC0 A;  4C3I H;  3M7N A;  4A3C H;  1PA6 A;  5ELO A;  4A3I G;  2F4V L;  1GO3 E;  2MO0 A;  5GAD C;  1IBK Q;  3CW2 C;  1VQD A;  1VQ5 A;  3A5Z B;  4YY3 L;  1FJG L;  3M3Y H;  1SN8 A;  5IYC H;  4DPG A;  2JJQ A;  1YZ6 A;  2VUM H;  1Y1W H;  3J81 j;  4QL5 A;  3ERS X;  4DV3 Q;  3UDF A;  2ZJR A;  1EOV A;  2UXD Q;  1CKM A;  2YYZ A;  2UXB Q;  2MQH A;  1AE3 A;  5M3F H;  1BVS A;  4NXM Q;  3CCS A;  2F4V Q;  3BU2 A;  3HOW H;  3KF6 A;  5C0X J;  5FLM H;  2E2I H;  4A3L G;  3GDE A;  3CCU A;  1TWH H;  4YCW A;  3RR5 A;  4LF5 Q;  2E5L L;  3HOU G;  3M4Q A;  4X62 Q;  2JA6 H;  4JV5 L;  1PH4 A;  4O2D A;  4PZ6 A;  5LMN W;  1PH9 A;  1AH9 A;  2YTV A;  4BBR G;  1WCM H;  1YJ9 A;  2BA0 A;  4DK3 C;  2DUD A;  2ZTC A;  3E9H A;  1Y1V H;  2HHH L;  1FL0 A;  4PG3 A;  4DAY B;  4LF4 Q;  1WCM G;  1HZB A;  2VZA A;  3W5O A;  4X62 L;  4JI6 Q;  1E7Z A;  3TS2 A;  3RNU A;  2E5L Q;  2ZJQ A;  3DLL A;  3GTO H;  1VQE A;  2I5L X;  2N78 A;  1VQ6 A;  4IPD A;  2UUC L;  4DR1 Q;  2HQL A;  4P74 A;  3KJO A;  1I3Q H;  1X6O A;  4KI0 A;  4LFC Q;  4UP9 A;  1Q12 A;  3SGI A;  4A93 G;  1X3F A;  2ZTE A;  2UXC Q;  3ER0 A;  4C3J H;  3ULJ A;  4APV A;  4HJA A;  4DV3 L;  3T1H Q;  2PI2 A;  2R93 G;  4LWC A;  1PH3 A;  4X64 Q;  4GLV B;  1N9W A;  1LM0 A;  4BA2 I;  2VS1 A;  1E24 A;  3GTJ H;  1IBK L;  3PO3 H;  3S1R H;  1LUZ A;  3VDY A;  2E8G A;  3UDI A;  1VQK A;  1MIU A;  4JI1 L;  2R92 H;  1VQ4 A;  4OWX B;  3DM3 A;  4A3B G;  1HZC A;  1EQR A;  4LUO A;  2B3G A;  1HNX Q;  5C3E H;  4GN4 B;  4A3E G;  1CSQ A;  1FGU A;  4A3K G;  5C44 G;  3CCE A;  4LUV A;  2CWP A;  2L15 A;  1YEZ A; 
#chains in the Genus database with same CATH topology
 1BCP C;  1F9S A;  3U9S A;  4RHR A;  1W6J A;  1G8Z D;  1MD2 D;  4A76 A;  1YIJ A;  2N3S A;  1JJC B;  5IYD G;  2EQS A;  3E0J A;  3BG3 A;  1BOS A;  2I07 B;  1EIH A;  2A68 D;  3CPF A;  1HTP A;  4B9W A;  4IPG A;  5M5X H;  3J81 c;  1UE5 A;  4OX9 L;  1OXV A;  1E3P A;  4G7O C;  4RWS C;  4LF6 L;  4F88 A;  2L9H A;  2MP1 A;  2OF1 A;  3PO2 H;  1ASY A;  1YNJ C;  5I4D A;  1YJW A;  1GVP A;  2K1B A;  3T53 B;  1VQC A;  2RHQ B;  3EFX D;  3NQT A;  2X6L A;  2WKD A;  1CA5 A;  3PUV A;  5ELE A;  3QOL A;  1VCI A;  2WFW A;  1TWC B;  4JI8 Q;  2SEB D;  1EEI D;  1SMY D;  3T4A C;  3V96 A;  1A3U A;  4P72 A;  1XNR L;  2WP8 J;  1IL2 A;  3VR5 A;  1PH6 A;  1XPU A;  3RLF A;  3PF5 A;  4KY5 A;  4KN7 C;  2YU9 B;  1XMQ Q;  1F9Q A;  5J22 A;  5CGK A;  3KJP A;  2EIF A;  1F2Z A;  1LTT D;  3PMF A;  5E3F A;  4LFB Q;  3F2U A;  4X6A H;  3PIO 3;  3NP8 A;  2AMC B;  2EOT A;  2F3W A;  3HOY H;  3OIP A;  3VR3 A;  4BY1 B;  5M5X B;  1CT1 D;  1JOQ A;  3VYR A;  4C3I B;  4DR3 Q;  1AE2 A;  3FHW A;  3MFG A;  4B3T L;  4JYA L;  1T5X D;  3S16 H;  2A6H C;  4IJL A;  2KCM A;  2CCZ A;  4LMQ D;  5ELD A;  1HJP A;  3B6Y A;  3GTQ H;  1QG7 A;  3QR8 A;  1I6H H;  1VQI A;  1NE3 A;  2QA4 A;  1ENC A;  4HR7 B;  2ZJP A;  4ILW A;  1UE6 A;  1NNX A;  5KYL A;  1HA5 A;  4DR5 Q;  2VQE Q;  4A75 A;  1SMX A;  2L5T A;  4DNR B;  3C46 A;  1GUS A;  2NYZ D;  1G51 A;  5FJ8 H;  3I4O A;  5ELF A;  2C35 B;  3NQI A;  3UE1 A;  3PO2 G;  4RKB A;  4C3H H;  2E2H B;  3I2Z A;  2RCF A;  2ZM6 Q;  2F52 A;  4DV1 L;  2GN5 A;  1PRT C;  1K83 H;  4N8F A;  4DV7 L;  2AUJ D;  4OEM B;  1SJE D;  2RQX A;  3VYU A;  1IW7 D;  2KA7 A;  3S1Q B;  4BBR H;  4NXN L;  1J5E Q;  3MC0 B;  5ELC A;  1EZ6 A;  1LTR D;  2CQA A;  2UUB L;  4PMC A;  2IW3 A;  1DZ1 A;  4RGT A;  2Y0S E;  2EVB A;  1FYC A;  2KCN A;  1QVG A;  3KK7 A;  4AH6 A;  1NTG A;  4UHV A;  5EPJ A;  1A8V A;  1AFP A;  5KYI A;  1PMR A;  4HCS A;  4IOC A;  2K28 A;  4LNQ A;  1KRS A;  1SLJ A;  3T1Y L;  4MNO A;  5E4X A;  1H95 A;  1B50 A;  3GTK H;  2JE6 I;  3URY A;  3RZD H;  1Y1W G;  1OO9 B;  2VQE L;  3TS0 A;  5IP7 H;  4H02 A;  2UXC L;  2JA7 B;  3V05 A;  4DN4 M;  2LXJ A;  4IPH A;  1GUT A;  1R9T H;  2VL6 A;  4HJ9 A;  1UWV A;  3G7L A;  2RSN A;  3K81 C;  5JEA J;  2B8G A;  4BY7 H;  2K50 A;  2A68 C;  3KLW A;  1GM5 A;  3E5S A;  1L1O C;  1SE8 A;  1WI5 A;  1WTV A;  5LL6 X;  4GKK L;  1N36 Q;  4JI7 Q;  4GZY C;  4X3K A;  2MPM A;  3OWF A;  2I0Q A;  1X54 A;  2D5D A;  2WIN B;  2IX1 A;  1BUV T;  1F2M A;  1PTO B;  5EBD A;  1X56 A;  2NVQ H;  1TWA H;  2JQO A;  3MFY A;  3AU7 A;  2Y0S G;  3BDC A;  1LT3 D;  1IBL L;  4C3J G;  3TRZ A;  1CZG A;  3CF5 A;  1K8M A;  1KTK A;  4DXF A;  1SR3 A;  1HPC A;  2VW9 A;  1XNR Q;  5FLX L;  1STG A;  2K5D A;  1LYL A;  3H15 A;  4A3M H;  2HCI A;  1VQB A;  2UUC Q;  2JEA I;  1SYC A;  4L63 B;  1UEA B;  3KOJ A;  1JIC A;  4R1J A;  1KD1 C;  2QF7 A;  3CAM A;  2E2I B;  1V8Q A;  5E7N A;  4U68 A;  5IIF A;  1SNO A;  3MXN B;  2HT1 A;  4LF6 Q;  1OXU A;  1IBM L;  4K14 A;  1SYF A;  5IT9 c;  2NN6 G;  1PLF A;  1PRT F;  2NTS A;  2UXB L;  2Q8I B;  2A69 D;  2EYM A;  1K3R A;  1D8L A;  4ZCK A;  5IYB G;  1WD0 A;  4KMU C;  3CCJ A;  1CKN A;  2K7V A;  2XRQ D;  2Q8R E;  3RLO A;  4I7Z C;  5DNF A;  1T5E A;  3MXN A;  4DK1 A;  1EY9 A;  3J81 E;  2VB2 X;  2ICI A;  1WTO A;  4U67 3;  2F0E A;  4KD4 A;  2F1M A;  2EY2 A;  3K80 C;  5FLX E;  3PQI A;  3HOZ G;  3S1R B;  2R93 H;  1DOM A;  4O1N A;  2XNA C;  3BVG A;  2BDN A;  4WFN 3;  4IO9 A;  4DAV A;  1SNP A;  3MHB A;  1QNK A;  1KNE A;  2HCC A;  3L0O A;  4DR1 L;  5LMU Q;  2QDB A;  2NZ1 D;  2H1E A;  4Y52 H;  3VR6 A;  1BCP D;  3MVV A;  3DHQ A;  4JOI A;  4K5V A;  4ZRZ A;  3KDF B;  5C4Z A;  4NW2 A;  4R9W A;  2YV5 A;  2MUY A;  3DEP A;  2LMC B;  1WJJ A;  4JK1 C;  4DAP A;  1SRO A;  1MI2 A;  4DR5 L;  2E74 C;  1O7L A;  2A6E D;  2DY8 A;  4JPB W;  3GTG H;  1D7Q A;  3CCL A;  4JI1 Q;  4A3M G;  2D0P A;  4O42 A;  4KJO A;  1TVX A;  4NXM L;  1IYJ B;  3LX0 A;  4JOI C;  3HKZ G;  3A74 A;  2G9H D;  2VY3 A;  2K14 A;  1X3Q A;  1VQO A;  1EIG A;  2FXQ A;  2Z6K C;  1PFB A;  3I70 A;  1MKH A;  3MZ5 A;  4CDD C;  5CMD A;  1EIF A;  3PUX A;  1FJG Q;  3S1N B;  3E3X A;  1GHK A;  4IUN A;  1X32 A;  4WJW A;  1R4P B;  2WB1 B;  2VNU D;  4N8X 1;  5I6W A;  2OEO A;  4JI4 L;  4CHT B;  4DAM A;  2F0H A;  3PIO A;  3OW7 A;  2EYF A;  1EY8 A;  1N34 L;  3JAM c;  1LT5 D;  2H5X A;  3S1Q H;  1KXL A;  1BBW A;  5GRO A;  4BBS H;  4A4I A;  4IZ8 A;  1K28 A;  2OCE A;  1VQG A;  3MTS A;  5HGT A;  5E4W C;  3F1Z A;  2EJM A;  2XN9 C;  1CZW A;  4JI8 L;  2NVT H;  2B2T C;  4DV1 Q;  5K36 G;  1NR2 A;  3OW2 A;  3AMU A;  1SSO A;  2B2W A;  1HUN A;  2PQA A;  4Q0F A;  1NMF A;  4BY7 G;  1QOH A;  1AP0 A;  3EN2 A;  1QE6 A;  1WOC A;  5KND A;  4K0K L;  5C0X H;  4YHH L;  3JAM i;  4L5T A;  2K04 A;  3GP7 A;  3P7J A;  2TSS A;  1TXY A;  2BE5 D;  1F9P A;  4A3F G;  4IQZ A;  1G6P A;  1B9N A;  1JWU D;  3SE0 A;  1E1O A;  4QB4 A;  1ZXT A;  2Z8L A;  4XQJ A;  1EYC A;  4DNI A;  3HOX G;  2LKV A;  2PI2 E;  2ZTD A;  5FOB B;  3NBI A;  4K0K Q;  3CHB D;  2IY5 B;  2KCC A;  4RA8 A;  1D1K A;  3HFZ B;  3J80 i;  2D62 A;  4JC0 A;  4HSP A;  3TME A;  5ELO A;  3E6Z X;  3TSS A;  1VQD A;  5DM6 3;  3A5Z B;  1YZ6 A;  4G7Z C;  1Y1W H;  3QJY A;  1B1Z A;  1NUC A;  1B53 A;  2YYZ A;  1AE3 A;  3WDN A;  1TY2 A;  4OL7 A;  3HOW H;  4NMZ A;  5C0X J;  3DEO A;  2E2I H;  4LF5 Q;  3RR5 A;  1O7Z A;  3HOU G;  3GV3 A;  3M4Q A;  4JV5 L;  1SDF A;  5LMN W;  1PH9 A;  1STN A;  2YTV A;  4BBR G;  1JB3 A;  4HN7 A;  1GUW A;  2ZTC A;  4CDC C;  1FL0 A;  3NXW A;  1S5E D;  4KKU A;  4OO1 H;  4LF4 Q;  1KLG D;  1E7Z A;  3DLL A;  3GTO H;  2F0I A;  1VQE A;  5EQ0 A;  1VQ6 A;  4P74 A;  3KJO A;  3U9O A;  4ZYS A;  1X6O A;  1Q12 A;  5CR3 A;  4C3J H;  4HJA A;  4APV A;  3T1H Q;  1TKW B;  1QJO A;  3HOV B;  5JPM C;  1YNN D;  5CC4 A;  4BA2 I;  5FKA C;  1E24 A;  1O78 A;  1LUZ A;  3I91 A;  1VQK A;  5EGT A;  1MIU A;  4HAE A;  4JI1 L;  1VQ4 A;  1J9O A;  4A3B G;  1TS2 A;  3O13 A;  4GN4 B;  1CSQ A;  2F0P A;  1C8C A;  1D6E C;  1UAP A;  1YEZ A;  3OSO A;  2NZH A;  3HOY B;  3EQL C;  3PUZ A;  5C3X A;  3HEJ A;  4F8M A;  5IGB A;  5C4J H;  4KN4 C;  1OXS C;  3KLR A;  4HMI A;  3SK8 A;  3QG1 A;  5TSS A;  5EKK A;  2Q2I A;  3G48 A;  4RG1 A;  4QIW B;  1LTB D;  3ERO A;  1FNU A;  2B63 G;  3Q8D A;  3GV6 A;  1SE4 A;  1K8O A;  3VR4 A;  4DUZ L;  2Q2H A;  1B8A A;  4C2M H;  3JAM L;  4KY6 A;  4IUT A;  1WCM B;  1B70 B;  1LTI D;  5IT9 L;  4HIO A;  1YNX A;  3RN5 A;  2A6H D;  1X55 A;  4MZ9 A;  4ZUJ A;  1K0R A;  3EVQ A;  3J7Y W;  4DV0 L;  2NN6 H;  4H44 C;  1C7Y A;  3UDX A;  2F0Q A;  1E1T A;  4L5Q A;  4RGO S;  1RF2 D;  4K6D A;  2DNE A;  3MEH A;  5J1Z A;  2BE5 C;  5IP9 G;  2HDM A;  2HDL A;  3N52 A;  3K58 A;  4KLK A;  1ESR A;  1YBY A;  3K59 A;  2R61 A;  3BZD B;  5J39 A;  3PGZ A;  5GAE C;  2CH4 A;  3VR2 A;  4JI3 Q;  1BXT A;  5M5W H;  4EQP A;  2F0U A;  1PH1 A;  4GLX A;  1EYA A;  3TQY A;  1PRT D;  3A54 A;  2K05 A;  1TU2 B;  4AYB B;  1BBU A;  1RD9 D;  1CQF A;  1QIL A;  2NBF A;  4QJF A;  5JAV A;  4V19 0;  1EU3 A;  1Y14 B;  3S1M H;  4X3U A;  3FEW X;  3M4O B;  2R6G A;  4QUF A;  4DAY A;  1EQV A;  1XYI A;  1A0I A;  5IWA Q;  2I5H A;  1O7I A;  3S14 B;  1S40 A;  3J7A F;  3FPP A;  1HFG A;  2FMM A;  2K5Q A;  3AFP A;  1DD2 A;  1R9T B;  3I4M G;  3MAQ A;  2DJF C;  5EKI A;  4XIG S;  1EWC A;  3LWE A;  4CDF C;  5M3M H;  1UEB A;  2A6E C;  2L12 A;  2Q2U A;  2SNM A;  3P20 A;  4KV6 A;  2YU9 H;  5C0X I;  3HOW G;  1I4Q A;  5FLM G;  4A3J H;  4MTK A;  1NY4 A;  1IBM Q;  1L2F A;  1TS5 A;  1U5K A;  4DV5 Q;  3TDQ A;  3PSI A;  1STA A;  2XRS D;  1STY A;  4EQN A;  1K9M C;  1E2Z A;  1PFS A;  2F3I A;  5D14 A;  4ALP A;  1D2B A;  1EYD A;  1CSP A;  1Z47 A;  2A73 B;  4HCE A;  4HSV A;  4WOR A;  1Q1B A;  5I9P A;  5DAU A;  2ICE C;  4YHH Q;  1U4M A;  2JA7 G;  4IUU A;  2JA8 G;  3H3V H;  1VMP A;  4RH6 A;  3SXH A;  1HA6 A;  2KEC A;  2F0N A;  2KBN A;  2BH8 A;  3PV0 A;  3CXC A;  4OEL B;  4L5R C;  4HMJ A;  5ELB A;  2AWO A;  3A0J A;  1SAP A;  4K5X A;  1LT6 D;  2PYK A;  1OXX K;  4IAL A;  3V2T A;  4X64 L;  5BR8 L;  3H94 A;  3R93 A;  2JN4 A;  1STH A;  1V1P A;  5JEA H;  1BDO A;  2RCN A;  4OON A;  4OGQ C;  3U58 A;  2EXD A;  4HIK A;  1H9R A;  2UUB Q;  3BZC A;  5G3L F;  2PO4 A;  1W6K A;  4IN3 A;  3BJU A;  3S16 B;  1Z9F A;  4R4Q A;  4JI7 L;  2E2D C;  1ASZ A;  4A3D H;  3HS0 C;  2GA4 B;  3UE0 A;  1RL2 A;  2F03 A;  1FNV A;  1NSN S;  5C3E G;  1GOZ A;  1PH7 A;  1SNM A;  2VB3 X;  3A56 A;  5IT9 E;  1SJH D;  3MXG A;  1EQT A;  2IHF A;  2V1C C;  3OPO A;  1SRU A;  2B2Y C;  2UXD L;  3BDO A;  3PIP A;  1F77 A;  3NBH A;  4BXX H;  3W2D A;  1VQ7 A;  3P1H A;  3E9I A;  1MHW C;  1PTO F;  2LS0 1;  4FO2 A;  3T1Y Q;  1DM0 B;  4EVO A;  1N33 L;  3KLS X;  4K2L A;  4OWT B;  2BDO A;  1IYU A;  1X9N A;  1ET6 A;  1JB7 A;  4LF9 Q;  3W1G A;  3Q6S A;  2JA8 H;  2CWA A;  1UE1 A;  2L1B A;  5DEH A;  3U4Z A;  3G6E A;  5IGF A;  1XMO Q;  1GXD C;  1SFO H;  1SNC A;  5HY6 A;  4BA1 I;  4FF1 A;  3CRL C;  2E76 C;  5COY A;  3G4S A;  5EJW A;  2MO1 A;  4QF4 A;  5IGD A;  1DJR D;  1V43 A;  1K3B C;  4R4T A;  4OIJ A;  5IGC A;  1A62 A;  1X65 A;  1GKH A;  2BOS A;  4M8A A;  1I94 Q;  1F2Y A;  4GN5 A;  1HR0 W;  4N9T A;  1PYS B;  4A3B B;  4WJ4 A;  1LV9 A;  2MFI A;  4KHP L;  4QY7 A;  3K57 A;  1PH8 A;  1MJC A;  1I5F A;  2PNR C;  4MN3 A;  1V9P A;  1DOK A;  4ZQ3 A;  1IHZ A;  1VQM A;  2B2V A;  3BZK A;  5CYU A;  1QUQ A;  4JI5 L;  3RD4 A;  1E2W A;  3VA5 A;  1KQS A;  5DM7 3;  2CKZ B;  1G91 A;  2F0D A;  2HIX A;  3J7A V;  1PFN A;  2WB1 E;  1HR0 L;  3ND9 A;  3MEF A;  2B29 A;  3I4N G;  1Q90 A;  5CBE E;  1HXY D;  3X3M A;  1H9J A;  2IHE A;  1J6Q A;  1U4L A;  2RBM A;  3PUY A;  1NMG A;  4R8N A;  4ZAI A;  3H0G H;  1Q8K A;  2RDG A;  3DM1 A;  5D65 A;  2B2V C;  2R93 B;  1N8R C;  4A3E H;  2VQF L;  2VQF Q;  3A55 A;  4JBK A;  4UP7 A;  4FYD A;  5IWA L;  3TBI B;  2EZV A;  2F0W A;  3EBE A;  3QOJ A;  5FO8 B;  3KYH C;  2M2L A;  3KFU A;  4XQQ A;  2Z9H A;  5AJ3 Q;  2XSC A;  2Z6K A;  2SDF A;  1QZH A;  2UU9 L;  1L1O A;  3ND8 A;  2CQO A;  4PZ8 A;  5FO7 B;  1VMC A;  1EY0 A;  4LUZ A;  2JA6 G;  3HOX B;  1YIT A;  2IT1 A;  4XQN A;  1H9S A;  1WFQ A;  3RZO B;  2JA8 B;  3EA6 A;  2L11 A;  1N36 L;  3ERQ A;  4GKK Q;  1PXU A;  1HUM A;  1ZYR D;  2C9O A;  3CKI B;  2KVM A;  3BS1 A;  1TII D;  2LSS A;  3NBH B;  2B63 B;  3F2D A;  2EYP A;  5EPL A;  4HID A;  4LFA L;  4A3K B;  3TZU A;  2AQ2 B;  1S5B D;  2LFN A;  1AW7 A;  4JBM A;  5A2Q L;  2HD3 A;  2ZXR A;  5K5P A;  3UDG A;  1DYQ A;  4IFD G;  5IP9 H;  2R7F A;  1ZKO A;  3I3C A;  4HJ8 A;  2IX0 A;  3D0F A;  3IFD A;  2NTT A;  3CMA A;  4X3T A;  1VQ9 A;  3I90 A;  3K7A H;  3K0Y A;  2K52 A;  2L0C A;  5JJZ A;  4FP5 D;  4LW1 A;  3FKI G;  4ZUI A;  4ZK9 B;  4K6L A;  2ASB A;  3Q22 A;  2NVQ B;  5CBA E;  1BCP F;  3FKI B;  1TS3 A;  4JG2 A;  3GTM H;  3S1M B;  2EDG A;  4TQU S;  3HOZ B;  4FF4 A;  3K5L A;  5M5Y B;  1XMO L;  1JJG A;  2NVX B;  4OXP A;  3R3O A;  4EQ5 A;  4HED A;  2NWG A;  3BYT B;  4X65 Q;  1UNS A;  3DWP A;  4DV7 Q;  2XWJ B;  4Q5V A;  3I4N H;  3IFT A;  1VQ8 A;  1P8L A;  1HNZ L;  4GOP B;  4G7H C;  2WB1 G;  2Z6B A;  2XVS A;  1P16 A;  3L3O C;  4KJN A;  1JMC A;  2EJF C;  5KEE A;  2KQ3 A;  3S15 B;  1EFI D;  1KAB A;  4A3I G;  2F4V L;  1WTQ A;  1IBK Q;  2MO0 A;  3NTH A;  3KBX A;  3NUC A;  4KKT A;  3DXJ C;  3M3Y H;  3G6J B;  2F3V A;  4QL5 A;  2ZJR A;  1I3Q B;  2UXD Q;  2UXB Q;  5FK9 C;  3N6R A;  5M3F H;  2F4V Q;  3BU2 A;  5FLM H;  4CKE A;  1TWH H;  4YCW A;  1QWY A;  3A8I E;  5M9O A;  4X62 Q;  1UUP A;  2PZT A;  5COR A;  2PZU A;  1PTO D;  2PQE A;  1KDB A;  2HHH L;  4PG3 A;  1BO0 A;  1JOO A;  1HZB A;  1TWH B;  2VZA A;  3W5O A;  4JI6 Q;  2I5L X;  4TKO B;  1BF4 A;  1D5Z C;  4BWG B;  1I3Q H;  2O5J C;  3SGI A;  4A3M B;  3TP7 A;  4DV3 L;  2R93 G;  5IGE A;  2KOL A;  5HUR A;  2XIW A;  4RCO A;  4A3F B;  4X64 Q;  4GLV B;  1PZI D;  2PPB C;  2M00 A;  1LM0 A;  1SBB B;  3NSW A;  1TS4 A;  1BNZ A;  1TWA B;  4ABN A;  4OWX B;  3DM3 A;  4LUO A;  2EYH A;  1CA6 A;  1HNX Q;  5C3E H;  1VDZ A;  3I4N B;  2WV6 D;  4ZKB B;  3KUP A;  3J81 L;  1W2B A;  2ZT9 C;  1I6H B;  2F0J A;  2F0G A;  1V1O A;  1VF5 C;  4BXX G;  4PNY A;  2JA5 H;  1N32 Q;  3NE5 B;  4R4I A;  4DV5 L;  5T1G A;  3S2H H;  1JT8 A;  4TRD A;  3NTK A;  4LFC L;  3FDT A;  4X66 Q;  4X66 L;  2P5Z X;  4R8I A;  3H3V I;  1XWE A;  2WAQ E;  4NKL A;  2BH2 A;  3M85 A;  3KBG A;  2E2J H;  3D31 A;  3VYT A;  2UU9 Q;  2D9U A;  1U0L A;  4JI5 Q;  5IE8 A;  3WWV A;  5FO9 B;  1JOK A;  1S5C D;  1K73 C;  1IW7 C;  1XX8 A;  1RDP D;  1JOR A;  2KHI A;  5HGQ A;  1M4V A;  3TN2 A;  1BKB A;  1HHV A;  3W1B A;  4ZLT F;  4GNX B;  1BQQ T;  2KCT A;  1D5X C;  1JE5 A;  3OYY A;  5M3F G;  5EPK A;  4BBS G;  4XT1 B;  2EPB A;  4IFD J;  3CME A;  3CC4 A;  1ROD A;  1UE7 A;  4LF8 L;  2KHJ A;  2CFM A;  1Y8P B;  2Z4H A;  3CCR A;  5C4J B;  5K36 H;  3STB C;  2NVY H;  5FLX c;  1TWF H;  3CCV A;  3PO3 G;  2VUM B;  5C6A A;  5LHY 1;  4KY7 A;  4UY8 C;  1EWH A;  1Y1V G;  2NUC A;  3IL8 A;  4GS3 A;  4FNF A;  4OO1 G;  3EJI A;  2FFK B;  4DA2 A;  1KHI A;  5DLQ E;  5IOD A;  5GAG C;  5ELN A;  4DV4 Q;  1FR3 A;  2JA5 B;  3KLS A;  1NBW A;  1PZJ D;  2K03 A;  5GQO A;  3S17 B;  2TMP A;  3CC2 A;  3A5U A;  2B2T A;  4KHP Q;  5IYD H;  4CBV A;  1QNU A;  5M5W B;  1X3E A;  1CKN B;  5C3E B;  2O2L D;  3R8B A;  1I94 L;  2Q2T A;  1KLU D;  2PMZ E;  1U4P A;  5AFW A;  4GOP C;  1MJE A;  4CJ2 C;  3GTO B;  5KNB A;  3ULP A;  1NAP A;  3D8G A;  5LMU L;  1CTM A;  2NVY B;  1VQA A;  4RGM A;  3TRE A;  3KF6 B;  3BVM A;  2HQE A;  4DV2 L;  5JJI A;  1G29 1;  4LAA A;  1J5E L;  1H9K A;  2X6G A;  3J81 i;  4IJH A;  4MHE A;  2N55 A;  2JSO A;  1O80 A;  3HOW B;  4RCN A;  4HJ7 A;  4DV2 Q;  1A3T A;  3NEM A;  4JI4 Q;  2H4O A;  4LF9 L;  3PIP 3;  2Z4I A;  4H0L C;  5D3I B;  4DK6 C;  3RZO H;  4AQY Q;  4GNX A;  3HKS A;  4DXG A;  2DGY A;  5BN5 A;  1EWI A;  4CJ1 B;  4FF3 A;  4DF7 A;  5JVH 3;  3D4D A;  2ALY B;  4DK0 A;  3A8K E;  4J8Q A;  3S15 H;  3S14 H;  1M1K C;  1A2T A;  4DV4 L;  2VXW A;  4B3S Q;  5BN4 A;  1JWS D;  4B3T Q;  2XWB B;  4JYA Q;  1A2U A;  2R92 B;  1A15 A;  4A3E B;  4FF2 A;  4YWK A;  2HIV A;  2NB0 A;  2PCF B;  2R92 G;  4XTC S;  1PDQ A;  1HNX L;  2D2C C;  1XTC D;  3H0G B;  3HOV H;  1I4G A;  1BCP B;  2QKI C;  1GUN A;  3J80 c;  4QCL A;  3FKI H;  1XNQ L;  5CV4 A;  3CD6 A;  4LF8 Q;  1FD7 D;  5AJ3 L;  4F7X A;  5ISR A;  3BYY B;  4J1M A;  3UI2 A;  5CV5 A;  1NJI C;  2SNS A;  1IBL Q;  2NVT B;  3FMC A;  3CC7 A;  1NR4 A;  1CK1 A;  2MNA A;  1D5M C;  4AYB G;  1XNQ Q;  4A3L H;  2KEE A;  3I4M H;  1Q7Y C;  1HNW Q;  1QUQ B;  4B3M Q;  1KC8 C;  2J4X A;  4IUQ A;  3H91 A;  4DV6 Q;  2CH4 W;  1DOL A;  2WII B;  3STB D;  2OTL A;  3SDZ A;  1AN8 A;  4TVA B;  5KNC A;  1I50 B;  3U50 C;  4A3G B;  1Z7T A;  3SK4 A;  1SNQ A;  2KEN A;  2K33 A;  2K6A A;  4N9P A;  3S1N H;  1YJN A;  2RHS B;  4UPA A;  1QZG A;  5M3F B;  1RJT A;  2WKC A;  2A19 A;  2QEJ C;  3T16 A;  2KJX A;  1YI2 A;  1EUJ A;  3LWU A;  1Q81 C;  4UP8 A;  1PH5 A;  1HTL D;  4KD3 A;  1SYG A;  3JAM E;  3JC6 6;  1PYB A;  4R4C A;  3CCQ A;  3I4M B;  1FVI A;  4FXK C;  2Z0S A;  5C44 H;  4UDU C;  4K5W A;  2JEB I;  2BCO A;  3RMH A;  3I7F A;  2R7Z H;  1I4R A;  4NDX A;  3K8A A;  4JI0 Q;  3DMU A;  1L0X B;  3HKZ E;  2K5N A;  1GUG A;  1GJX A;  3HOZ H;  4C56 C;  4YWL A;  3GTM B;  4C3J B;  2EXZ A;  1EFW A;  3NEN A;  4PMW A;  3GTP H;  3OTO L;  2F0V A;  2ZM6 L;  5JPN C;  1PTO H;  3U4V A;  1LLR D;  1X3G A;  2RF4 A;  2KUM A;  3K7A B;  2HHH Q;  2N8N A;  4FXG C;  2KHS A;  1WTP A;  1QVF A;  1PVO A;  3OHX C;  1EYG A;  3AB9 A;  5CV6 A;  4CDE C;  2PQA B;  4B3S L;  4S3S A;  4BBS B;  4JI2 Q;  3S2D B;  2QIL A;  4AIM A;  2L4N A;  1KAA A;  4B9X A;  3IAY A;  4GOP A;  4C3H G;  5KGU A;  1LO5 D;  2YTX A;  2A8V A;  2RDH A;  5A2Q E;  3PCO B;  4CGY B;  1B3Q A;  3I73 A;  1Y1W B;  1JQY D;  4POF A;  3FRP B;  4PV1 C;  2CHB D;  2IWH A;  1G2T A;  3SEB A;  2QEX A;  1BR9 A;  2A69 C;  3R2T A;  4LF4 L;  3HOU B;  3CCM A;  2DNC A;  3RLN A;  3KF8 A;  3A8J E;  4ID6 A;  4E6I A;  4ODG A;  4B08 A;  4JI0 L;  3GTG B;  1EY5 A;  5IYB H;  4NXN Q;  1F9R A;  2R7D A;  2JYO A;  4LF5 L;  2YTY A;  1LTL A;  3HOY G;  3F2C A;  2ID0 A;  5C4X B;  1JR0 D;  3H3V C;  1RTO A;  4OIK A;  1XPR A;  5I2X A;  1Q86 C;  3GTP B;  3VYS A;  4A3J B;  5CV8 A;  2ATW A;  1EY7 A;  4GKJ L;  1LTS D;  2AQ1 B;  1K8G A;  1HZ9 A;  2C5C A;  4F87 A;  3WOF A;  4A93 H;  3IKJ A;  1TR5 A;  3HOV G;  1YHQ A;  1YNN C;  3W3A A;  1HR0 Q;  2RVL A;  3NEL A;  4A3D G;  5JOB A;  4B3R L;  4FXD A;  1A6X A;  4LK1 C;  1LAC A;  5H1S E;  4P73 A;  2LXK A;  1B44 D;  4JCV E;  2ZXP A;  5IY0 A;  5IGG A;  4G4K A;  5KRU A;  2ENB A;  5JJK A;  3K0X A;  4A3D B;  1PTO C;  2FJ2 A;  2ZXO A;  2EYJ A;  1I6V C;  2WAQ G;  1CQV A;  4P2C B;  4MTN A;  2J7Z A;  3TP5 A;  1L0Y B;  1G2S A;  3L7Z C;  3GTL H;  3RUZ A;  4C1N K;  4IUR A;  4IUV A;  3M7N A;  4A3C H;  1LTA D;  1GO3 E;  5GAD C;  3CW2 C;  1VQ5 A;  4YY3 L;  3M4Y A;  5IYC H;  3OMG A;  2JJQ A;  1SND A;  1AZQ A;  5IOC A;  3NWS A;  3P75 A;  4DV3 Q;  1EOV A;  3MXP A;  3MXU A;  4RAU C;  1HFN A;  1CKM A;  2MQH A;  4TSS A;  3T56 B;  3CCS A;  4A3L G;  3C1F A;  3CCU A;  1LAB A;  3ZYY X;  2EY5 A;  3NPP A;  3CQZ B;  5EBC A;  4O2D A;  4PZ6 A;  1SFO B;  3OWE B;  1EU4 A;  1YJ9 A;  2B2Y A;  2B39 A;  4L8J A;  1Y1V H;  3Q24 A;  3BVZ A;  3I4L A;  1WCM G;  1A3V A;  4X62 L;  3TS2 A;  2E5L Q;  2ZJQ A;  3K5N A;  3NK9 A;  2N78 A;  1Q3L A;  4WRD A;  4LFC Q;  4A93 G;  2ZTE A;  3CU7 A;  2UXC Q;  3ULJ A;  1JCK B;  1SEB D;  1ICW A;  2K5W A;  5LL6 S;  5I9O A;  1N9W A;  1IBK L;  3SR1 A;  3PO3 H;  3S1R H;  3VDY A;  3HGB A;  5M3M B;  3HP3 A;  3UDI A;  2R92 H;  4XYO A;  3MA2 B;  4MIU A;  4A3E G;  4A3K G;  4KHV A;  2A74 C;  5C44 G;  4LUV A;  4YCV A;  2FHT A;  4DR4 Q;  5D3D A;  4KHZ A;  4A3F H;  1T9H A;  3AEV A;  4YCU A;  3SK5 A;  3M4O H;  2WAC A;  5C5M A;  1ILP A;  2K75 A;  3NTI A;  4HTH A;  3C1E A;  5LMN Q;  2ES2 A;  1RHP A;  4JBW A;  4NP5 A;  1Q46 A;  3A7L A;  2FMC A;  2EY1 A;  4PQX A;  1C9O A;  4ME3 A;  1Q1E A;  3M4P A;  1TWG H;  1PRT B;  4XYQ A;  3OIQ A;  4JBJ A;  1GD7 A;  4PMB A;  3K5O A;  2IJ0 A;  4POG A;  1SE3 A;  1FGB D;  1E2V A;  2UUA Q;  3LGJ A;  4IUP A;  4A3C G;  1JWM D;  4DR7 Q;  4ULL A;  4BBR B;  3C3L A;  1WTR A;  5T1I A;  1JE4 A;  1TY0 A;  3LNN A;  3QB3 A;  1IZ6 A;  4QGU A;  4H13 C;  5NUC A;  4FDB A;  1PFM A;  4H7B A;  1MSG A;  3PUW A;  4GNX C;  3CPW A;  2HUG A;  2DJG C;  3D4R A;  4LJZ C;  3J80 E;  2KED A;  4C3H B;  2E2H H;  1TT2 A;  3KDF A;  5L37 A;  3HZX A;  4I7A A;  2PMZ B;  1IXR A;  1B9M A;  4JW0 A;  2CW0 D;  3HOU H;  2OQ0 A;  1S4Z A;  2EJG C;  1OTC A;  2R7Z G;  4YIJ A;  3DWA A;  2PW5 A;  3ZJY C;  4A3G G;  1V1Q A;  2R3Z A;  3FVQ A;  4V0B A;  3L2P A;  3AFQ A;  1PV4 A;  3S17 H;  4DKA C;  2B2U A;  4X65 L;  4QIW E;  5JVG 3;  4Z9C B;  2AWN A;  2Z1C A;  2XGT A;  1EEF D;  4LF7 L;  1HCZ A;  3WOE A;  2O4X A;  1SMY C;  2Y0S B;  4BS9 A;  1VQL A;  2K4K A;  3H09 A;  4BY1 H;  1B2T A;  1AZP A;  2LY7 A;  4LF7 Q;  1HQR D;  1ENF A;  2AUK A;  5C3W A;  3J7A 5;  3RZD B;  3PF4 A;  3S9W A;  3GTK B;  3F8T A;  2VUM G;  3PO3 B;  2A1A A;  1EQQ A;  4A3K H;  4RHS A;  2OQK A;  1D1I A;  2B2U C;  4OX9 Q;  4LFA Q;  1HZA A;  2B63 H;  4HJ5 A;  5C0X G;  1BBX C;  1VF7 A;  1Q82 C;  1MSH A;  1PZK D;  5CV9 A;  2FIN B;  2BA1 A;  2JK8 A;  2OWO A;  2JA9 A;  2MJ8 A;  2X69 A;  2OTJ A;  1K8A C;  4B3R Q;  2MGS A;  4DV6 L;  3I8Z A;  3PO2 B;  5J3B A;  4YWM A;  3X3N A;  1HH2 P;  4B3M L;  3EIV A;  1G6Z A;  2UUA L;  3CQZ H;  4DR2 Q;  3M3Y B;  1YHB A;  3OMC A;  1I4X A;  3J7Z C;  1X3P A;  1JJ2 A;  1PH2 A;  1YHA A;  1J8I A;  1U9R A;  3IRB A;  1TWG B;  1M8A A;  1VQF A;  4P75 A;  1KIX A;  4DUZ Q;  1NCV A;  4C2M B;  1OXT A;  1S5D D;  1I4P A;  4XDX A;  2DN8 A;  1DGS A;  2I46 A;  3HKZ B;  1B7Y B;  5IP7 G;  1I50 H;  1CI3 M;  1U4R A;  2NVX H;  4JI6 L;  3GTL B;  3DUZ A;  3GTQ B;  4A3G H;  4EX5 A;  3J80 L;  4DGZ A;  4XT3 B;  1KDC A;  4QMG A;  4O0A A;  4DFA A;  1CFM A;  3GTJ B;  1S72 A;  4HIM A;  4JVZ A;  1I4H A;  1MBY A;  1SYB A;  1L1O B;  1CM9 A;  1VS0 A;  2NN6 I;  5I2Y A;  1SYE A;  2EYO A;  2IX3 A;  4CJ0 B;  1N33 Q;  5F2D A;  2SOB A;  1MGS A;  4J15 A;  1EZ8 A;  3H6M A;  5IYC G;  2L55 A;  1KRT A;  1WTX A;  4R4O A;  4A93 B;  4DUY Q;  3I72 A;  3HRZ C;  4NB3 A;  3FP9 A;  2N49 A;  3G71 A;  2F0K A;  5I6Y A;  3GQB A;  4C3I G;  1CHP D;  4DV0 Q;  2AQ3 B;  2CW0 C;  4A3B H;  4NPS A;  1HNZ Q;  3H0G G;  3S24 A;  3KF8 B;  2XTI A;  2R7Z B;  5C4X H;  1KAW A;  1EY6 A;  1Y1V B;  3RN2 A;  3VA7 A;  3HOX H;  1Y69 U;  3K6O A;  4JV5 Q;  2RDF A;  4DR6 L;  4RFB A;  3TP8 A;  1ML0 D;  4GLA C;  4ME5 A;  5EAY A;  1S3O A;  1DON A;  2E2J B;  4LFB L;  2NZO A;  1O7Y A;  3F2B A;  2JA7 H;  5LMN L;  2F0F A;  1ESF A;  3M7G A;  3NHH A;  2O5I C;  1XMQ L;  2K5V A;  1C48 A;  4DR6 Q;  1YVC A;  4IPC A;  1M90 C;  1VQH A;  3D4W A;  1W3S A;  4DR2 L;  4EGV A;  4G57 A;  2RSO A;  2RKS A;  3QIA A;  1ZYR C;  2WAQ B;  1XTD A;  3ULL A;  1TQO A;  4RMF A;  5M5Y H;  3TP6 A;  1PYW D;  2GVB A;  1QVC A;  4UAI A;  2DY7 A;  2K32 A;  4OO1 I;  4IFD H;  1JC7 A;  1WTW A;  1DCZ A;  3S2D H;  4QUC A;  1XPO A;  3T51 B;  4K8I A;  4Y7N B;  4DUY L;  1L0W A;  4L6T B;  1Z6H A;  4CKC A;  4DR3 L;  3T1H L;  1A63 A;  3K7U C;  2K01 A;  2EE1 A;  3GO5 A;  3CP0 A;  4OWW B;  1CHQ D;  1XXG A;  4WJ3 M;  2QGQ A;  3SVM A;  1ENA A;  4GKJ Q;  3A7A B;  5M3M G;  2I5M X;  1R4Q B;  3D3R A;  1E22 A;  1FNW A;  2PNH A;  1K0S A;  2PW7 A;  4QQB X;  3HG9 A;  1LTG D;  5C4X G;  2D0O A;  3ONA B;  5A35 A;  4IOA A;  1WTH A;  1HNW L;  2JXM B;  2J0T D;  1EIY B;  4PZ7 A;  1H9S B;  4M1U B;  4X3S A;  1ILQ A;  2M9V A;  1ONL A;  4L5S A;  5E1F A;  3QO2 A;  2JA5 G;  2JP1 A;  5BR8 Q;  4YY3 Q;  1E0B A;  2Q8T A;  3I55 A;  1HQM C;  3R2I A;  4JI3 L;  2AHO B;  3C2P A;  2G9D A;  5C5L A;  2N88 A;  4EQO A;  2G5D A;  2MHV A;  5EKL A;  3NWT A;  1CKO A;  1QB5 D;  2K5H A;  3ITP A;  1PHJ A;  1N32 L;  4DNT B;  3Q0A A;  4CKB A;  3E0E A;  3GD7 A;  1CUK A;  2F0O A;  3FPU B;  1STB A;  2F0T A;  4KK7 A;  2EYL A;  1TWC H;  1LT4 D;  2AKW B;  1IYV A;  2B2W C;  3QWN A;  1YNJ D;  4C1N I;  4DR7 L;  4JI2 L;  1C0A A;  2V4D A;  1IKL A;  1F2L A;  1ZEQ X;  3M9B A;  4I65 A;  3T13 A;  1K83 B;  1VQJ A;  1KL9 A;  1SYD A;  1WYD A;  3ICE A;  3AQQ A;  1SXT A;  3AYH B;  4AQY L;  1V1P B;  4IFD I;  2GVA A;  4KTA A;  1VQN A;  3BDL A;  4GN3 B;  1STE A;  3DWQ A;  3I56 A;  2F0M A;  4Y7N H;  3OTO Q;  5JEA G;  1ET9 A;  2OT2 A;  3TEH B;  5GAH C;  4J6H A;  5C4H A;  5FJ8 G;  2PZW A;  4AYB E;  4K8J A;  2QCP X;  2QW7 A;  3D6W A;  1DXM A;  2E75 C;  1VQP A;  1XJV A;  3CRK C;  1WD1 A;  1KNA A;  1EL0 A;  4DR4 L;  2IPK D;  1N34 Q;  1QCB D;  1EY4 A;  4A3J G;  5JJL A;  3TZD A;  1RCV D;  4A3I H;  2OXP A;  4BY1 G;  1RIP A;  1WVL A;  4P71 A;  5C44 B;  4BY7 B;  1C4Q A;  4C3I H;  1PA6 A;  2CVR A;  5G3L D;  4K2K A;  1FJG L;  1SN8 A;  1TWF B;  4FVM A;  4RKL A;  3SHL A;  4DPG A;  2VUM H;  3J81 j;  3ERS X;  2A5H A;  1GUO A;  3UDF A;  3OOC A;  1BVS A;  4NXM Q;  1ICF B;  1Y8N B;  3KF6 A;  1Y8O B;  2F0S A;  3Q23 A;  4OHJ A;  1GHJ A;  3GDE A;  2F4I A;  1IKM A;  1AEX A;  2E5L L;  1B3A A;  2JA6 H;  1EOT A;  1PH4 A;  3SK6 A;  2IL8 A;  5KIX A;  1AH9 A;  3MWY W;  1WCM H;  1II3 A;  2BA0 A;  4DK3 C;  2B8F A;  2DUD A;  3E9H A;  1HRJ A;  2JA6 B;  4DAY B;  1S5F D;  2RA4 A;  3K5M A;  5CV7 A;  3RNU A;  1IL8 A;  5BN3 A;  4IPD A;  2UUC L;  4DR1 Q;  2HQL A;  1RTN A;  3D6C A;  4KI0 A;  4UP9 A;  1Q8I A;  1X3F A;  3ER0 A;  1H9M A;  2PI2 A;  4LWC A;  4ZKC B;  1PH3 A;  1B4O A;  2EY6 A;  2VS1 A;  3GTJ H;  1RKN A;  4XXE A;  2E8G A;  2QDL A;  1SE2 A;  3S2H B;  4RGN A;  4A3I B;  1HZC A;  1EQR A;  4DU9 A;  2B3G A;  4KKS A;  1KDA A;  1FGU A;  3CCE A;  2F0L A;  2CWP A;  3L9A X;  2L15 A; 
#chains in the Genus database with same CATH homology
 1W2B A;  4DR4 Q;  2NZH A;  3PUZ A;  4KHZ A;  4A3F H;  1T9H A;  4BXX G;  3AEV A;  4YCU A;  4A76 A;  2JA5 H;  1N32 Q;  5C4J H;  3M4O H;  4R4I A;  4DV5 L;  1OXS C;  2N3S A;  1YIJ A;  3S2H H;  1JT8 A;  1JJC B;  5IYD G;  2K75 A;  2EQS A;  2ES2 A;  2Q2I A;  5LMN Q;  4LFC L;  3G48 A;  4RG1 A;  4JBW A;  4X66 Q;  4X66 L;  3CPF A;  5M5X H;  3J81 c;  4IPG A;  2B63 G;  3Q8D A;  3H3V I;  1UE5 A;  2WAQ E;  1OXV A;  1Q46 A;  3M85 A;  4OX9 L;  2BH2 A;  1E3P A;  4DUZ L;  2E2J H;  4LF6 L;  2Q2H A;  3D31 A;  1B8A A;  1C9O A;  1Q1E A;  4ME3 A;  4C2M H;  2UU9 Q;  3M4P A;  1U0L A;  3PO2 H;  1TWG H;  1ASY A;  4JI5 Q;  1YJW A;  5IE8 A;  4JBJ A;  1GD7 A;  1GVP A;  3WWV A;  1VQC A;  1B70 B;  2RHQ B;  1K73 C;  4POG A;  2UUA Q;  2KHI A;  5HGQ A;  3LGJ A;  3PUV A;  4HIO A;  4A3C G;  1YNX A;  1VCI A;  2WFW A;  1BKB A;  4JI8 Q;  3RN5 A;  4DR7 Q;  1X55 A;  4MZ9 A;  1IZ6 A;  4QGU A;  3W1B A;  1K0R A;  4DV0 L;  4FDB A;  1C7Y A;  4GNX B;  3PUW A;  4GNX C;  3UDX A;  3CPW A;  2KCT A;  4P72 A;  1XNR L;  1JE5 A;  1E1T A;  2WP8 J;  3OYY A;  5M3F G;  1IL2 A;  4L5Q A;  1PH6 A;  3RLF A;  3PF5 A;  2E2H H;  3KDF A;  1XPU A;  4BBS G;  1XMQ Q;  5IP9 G;  1IXR A;  4IFD J;  3CME A;  3CC4 A;  3HOU H;  2OQ0 A;  1UE7 A;  4LF8 L;  2KHJ A;  2CFM A;  4KLK A;  1YBY A;  3KJP A;  1OTC A;  2R7Z G;  2EIF A;  4LFB Q;  3CCR A;  4X6A H;  3ZJY C;  2AMC B;  3STB C;  2NVY H;  3PGZ A;  1TWF H;  1V1Q A;  5FLX c;  5GAE C;  3CCV A;  3PO3 G;  4A3G G;  4JI3 Q;  4UY8 C;  5M5W H;  1Y1V G;  3HOY H;  1PH1 A;  4GLX A;  3TQY A;  4GS3 A;  3L2P A;  3AFQ A;  1PV4 A;  4OO1 G;  4DR3 Q;  1BBU A;  3S17 H;  1AE2 A;  4DKA C;  4X65 L;  3FHW A;  4QIW E;  1KHI A;  4QJF A;  2AWN A;  2XGT A;  1Y14 B;  5DLQ E;  4B3T L;  3S1M H;  4JYA L;  4LF7 L;  5GAG C;  5ELN A;  4DV4 Q;  4IJL A;  2R6G A;  3S16 H;  2KCM A;  1A0I A;  5IWA Q;  2CCZ A;  1HJP A;  1NBW A;  3B6Y A;  3GTQ H;  5GQO A;  1VQL A;  1VQI A;  1I6H H;  1NE3 A;  2I5H A;  1O7I A;  2K4K A;  3A5U A;  2QA4 A;  1S40 A;  3CC2 A;  2ZJP A;  4BY1 H;  1UE6 A;  4KHP Q;  5IYD H;  3AFP A;  4LF7 Q;  1X3E A;  1CKN B;  4DR5 Q;  2VQE Q;  4A75 A;  3J7A 5;  3I4M G;  1SMX A;  4XIG S;  1I94 L;  3PF4 A;  5M3M H;  2Q2T A;  1UEB A;  2PMZ E;  1G51 A;  5FJ8 H;  3F8T A;  4GOP C;  3I4O A;  2VUM G;  2A1A A;  1MJE A;  2C35 B;  1EQQ A;  2Q2U A;  3UE1 A;  3PO2 G;  4A3K H;  2OQK A;  3ULP A;  4C3H H;  2YU9 H;  3I2Z A;  4OX9 Q;  2ZM6 Q;  2F52 A;  4LFA Q;  1HZA A;  2GN5 A;  5C0X I;  5LMU L;  4DV1 L;  1VQA A;  3HOW G;  5FLM G;  4A3J H;  2B63 H;  1K83 H;  1NY4 A;  5C0X G;  4HJ5 A;  3TRE A;  1Q82 C;  1IBM Q;  3KF6 B;  1L2F A;  4DV2 L;  4DV7 L;  5JJI A;  1U5K A;  1G29 1;  4DV5 Q;  3PSI A;  1J5E L;  2BA1 A;  2JK8 A;  4NXN L;  4BBR H;  3J81 i;  4IJH A;  1K9M C;  2OWO A;  1J5E Q;  2JA9 A;  1PFS A;  2F3I A;  2OTJ A;  2UUB L;  4ALP A;  1K8A C;  1CSP A;  1Z47 A;  4HJ7 A;  4DV2 Q;  2Y0S E;  1Q1B A;  3NEM A;  4JI4 Q;  4YHH Q;  2JA7 G;  2JA8 G;  4LF9 L;  4DV6 L;  4B3R Q;  1QVG A;  3H3V H;  4AH6 A;  5J3B A;  4YWM A;  1NTG A;  1HH2 P;  4B3M L;  1A8V A;  3EIV A;  2KBN A;  2UUA L;  2BH8 A;  3CQZ H;  3PV0 A;  3CXC A;  4DR2 Q;  1YHB A;  4DK6 C;  4IOC A;  4L5R C;  3RZO H;  3J7Z C;  4AQY Q;  4GNX A;  1JJ2 A;  2AWO A;  1KRS A;  1SLJ A;  3A0J A;  3T1Y L;  4LNQ A;  3HKS A;  1OXX K;  4MNO A;  1PH2 A;  2DGY A;  1H95 A;  5BR8 L;  4X64 L;  1EWI A;  1YHA A;  3GTK H;  2JE6 I;  3RZD H;  3IRB A;  1VQF A;  1Y1W G;  2VQE L;  4P75 A;  3TS0 A;  5IP7 H;  4H02 A;  4DUZ Q;  1KIX A;  2UXC L;  1OXT A;  2LXJ A;  4IPH A;  4YCV A;  1R9T H;  2RCN A;  4OON A;  2ALY B;  2VL6 A;  4HJ9 A;  1DGS A;  1UWV A;  3U58 A;  2EXD A;  1B7Y B;  5IP7 G;  4HIK A;  3S15 H;  3S14 H;  3K81 C;  5JEA J;  1I50 H;  2NVX H;  1M1K C;  2K50 A;  4JI6 L;  2UUB Q;  4BY7 H;  4A3G H;  3BZC A;  3KLW A;  4DV4 L;  1GM5 A;  4EX5 A;  4B3S Q;  4B3T Q;  4JYA Q;  1L1O C;  1SE8 A;  1WI5 A;  3BJU A;  1Z9F A;  4GKK L;  1N36 Q;  4R4Q A;  4O0A A;  4JI7 L;  4JI7 Q;  1ASZ A;  4A3D H;  2I0Q A;  1X54 A;  4YWK A;  2IX1 A;  2HIV A;  1S72 A;  2R92 G;  4XTC S;  4HIM A;  3UE0 A;  1HNX L;  1RL2 A;  1VS0 A;  1L1O B;  1PH7 A;  2NN6 I;  5C3E G;  1X56 A;  3HOV H;  3J80 c;  3FKI H;  1XNQ L;  1N33 Q;  2NVQ H;  3CD6 A;  2IHF A;  2V1C C;  4J15 A;  4LF8 Q;  1TWA H;  2JQO A;  5AJ3 L;  1SRU A;  2Y0S G;  5IYC G;  2UXD L;  3PIP A;  1KRT A;  1IBL L;  4BXX H;  4R4O A;  3TRZ A;  3CF5 A;  1NJI C;  1SR3 A;  1IBL Q;  4DUY Q;  1VQ7 A;  2VW9 A;  3CC7 A;  3FP9 A;  3E9I A;  2N49 A;  4NB3 A;  3G71 A;  2MNA A;  1XNR Q;  3T1Y Q;  1LYL A;  4AYB G;  4OWT B;  3H15 A;  1N33 L;  4A3M H;  1XNQ Q;  1VQB A;  2UUC Q;  4A3L H;  2JEA I;  4DV0 Q;  3I4M H;  1Q7Y C;  1HNW Q;  1QUQ B;  1X9N A;  1KC8 C;  4B3M Q;  4A3B H;  1JB7 A;  4DV6 Q;  4LF9 Q;  3W1G A;  4NPS A;  1HNZ Q;  3H0G G;  3KOJ A;  3S24 A;  3KF8 B;  2JA8 H;  2XTI A;  4R1J A;  1KD1 C;  3STB D;  5C4X H;  2OTL A;  1KAW A;  2CWA A;  3CAM A;  5E7N A;  3RN2 A;  1UE1 A;  4TVA B;  3HOX H;  3U4Z A;  3G6E A;  1XMO Q;  3U50 C;  1SFO H;  3MXN B;  4JV5 Q;  4DR6 L;  5HY6 A;  2HT1 A;  4BA1 I;  4GLA C;  4LF6 Q;  1OXU A;  1IBM L;  2KEN A;  5EAY A;  1S3O A;  5IT9 c;  4LFB L;  3G4S A;  2NN6 G;  2NZO A;  3S1N H;  3F2B A;  2JA7 H;  2MO1 A;  1YJN A;  2UXB L;  5LMN L;  1V43 A;  4R4T A;  2RHS B;  4UPA A;  1QZG A;  1XMQ L;  2A19 A;  2K5V A;  4DR6 Q;  1YVC A;  1K3R A;  1D8L A;  5IYB G;  1YI2 A;  1A62 A;  1EUJ A;  1X65 A;  4IPC A;  1GKH A;  4UP8 A;  3CCJ A;  1Q81 C;  1M90 C;  1CKN A;  1VQH A;  1PH5 A;  3RLO A;  1I94 Q;  1W3S A;  4GN5 A;  1HR0 W;  4DR2 L;  1PYS B;  3JC6 6;  4WJ4 A;  1PYB A;  4R4C A;  3CCQ A;  1XTD A;  2MFI A;  1FVI A;  3ULL A;  4KHP L;  4RMF A;  2Z0S A;  4QY7 A;  5M5Y H;  5C44 H;  1PH8 A;  2GVB A;  1MJC A;  1QVC A;  2JEB I;  1I5F A;  3I7F A;  2R7Z H;  3K80 C;  1V9P A;  4OO1 I;  3HOZ G;  3K8A A;  3S2D H;  1VQM A;  1XPO A;  3BZK A;  4JI0 Q;  2R93 H;  1QUQ A;  4JI5 L;  3HKZ E;  4DUY L;  1L0W A;  2K5N A;  4DR3 L;  4IO9 A;  3T1H L;  3HOZ H;  4YWL A;  1KQS A;  1A63 A;  3K7U C;  2CKZ B;  1EFW A;  2HIX A;  3NEN A;  4PMW A;  2WB1 E;  3L0O A;  3OTO L;  1HR0 L;  3GTP H;  3MEF A;  2ZM6 L;  3GO5 A;  5LMU Q;  4DR1 L;  3U4V A;  3CP0 A;  1X3G A;  2B29 A;  2RF4 A;  4Y52 H;  4OWW B;  3I4N G;  4WJ3 M;  4JOI A;  2QGQ A;  3KDF B;  2IHE A;  1J6Q A;  4GKJ Q;  2HHH Q;  3PUY A;  5M3M G;  1NMG A;  2YV5 A;  2I5M X;  2N8N A;  1WJJ A;  1E22 A;  1QVF A;  1PVO A;  1SRO A;  2PNH A;  1Q8K A;  3H0G H;  1EYG A;  4DR5 L;  2PQA B;  4QQB X;  4B3S L;  5C4X G;  4JI2 Q;  2D0O A;  3GTG H;  4IOA A;  1N8R C;  1D7Q A;  3CCL A;  1HNW L;  4AIM A;  4JI1 Q;  4A3E H;  2D0P A;  2VQF L;  2VQF Q;  4A3M G;  4UP7 A;  1EIY B;  4JBK A;  4PZ7 A;  5IWA L;  4NXM L;  1IYJ B;  4GOP A;  3EBE A;  3A74 A;  3HKZ G;  2VY3 A;  2K14 A;  4JOI C;  1VQO A;  2YTX A;  3KYH C;  2A8V A;  2FXQ A;  2Z6K C;  4L5S A;  3KFU A;  1MKH A;  2JA5 G;  3PCO B;  5BR8 Q;  1EIF A;  3PUX A;  4YY3 Q;  1FJG Q;  5AJ3 Q;  3I55 A;  2Z6K A;  4POF A;  1QZH A;  2UU9 L;  4JI3 L;  2AHO B;  1L1O A;  2VNU D;  2CQO A;  4PZ8 A;  2QEX A;  4LUZ A;  2JA6 G;  4LF4 L;  1YIT A;  4JI4 L;  3CCM A;  3RLN A;  2IT1 A;  4DAM A;  1CKO A;  1WFQ A;  2K5H A;  3PIO A;  1N34 L;  1PHJ A;  1N36 L;  3JAM c;  4GKK Q;  1N32 L;  2H5X A;  3S1Q H;  1KXL A;  4JI0 L;  4NXN Q;  1BBW A;  3E0E A;  5GRO A;  5IYB H;  3GD7 A;  4BBS H;  2LSS A;  1CUK A;  4A4I A;  2OCE A;  1VQG A;  3NBH B;  2R7D A;  3F1Z A;  4LF5 L;  2YTY A;  1LTL A;  3HOY G;  3F2C A;  1TWC H;  2ID0 A;  2AKW B;  3F2D A;  1XPR A;  4JI8 L;  2NVT H;  4DV1 Q;  4HID A;  4LFA L;  4DR7 L;  4JI2 L;  5K36 G;  1C0A A;  3OW2 A;  4JBM A;  3M9B A;  2PQA A;  3UDG A;  1VQJ A;  1NMF A;  1KL9 A;  1WYD A;  1Q86 C;  2ATW A;  3AQQ A;  5IP9 H;  3ICE A;  4IFD G;  2R7F A;  4GKJ L;  4HJ8 A;  4BY7 G;  3AYH B;  2IX0 A;  3D0F A;  3CMA A;  1K8G A;  4AQY L;  1VQ9 A;  4IFD I;  3EN2 A;  2GVA A;  1HZ9 A;  1VQN A;  3K7A H;  4GN3 B;  2K52 A;  4A93 H;  3I56 A;  3HOV G;  1WOC A;  1YHQ A;  4Y7N H;  3OTO Q;  1HR0 Q;  4LW1 A;  5JEA G;  4K0K L;  3FKI G;  3NEL A;  4YHH L;  3JAM i;  4L5T A;  2ASB A;  4A3D G;  4B3R L;  3TEH B;  5GAH C;  5H1S E;  4P73 A;  5FJ8 G;  4JG2 A;  3GTM H;  1TXY A;  2LXK A;  4AYB E;  4TQU S;  4A3F G;  1G6P A;  1XMO L;  1JJG A;  1E1O A;  4OXP A;  4JCV E;  4EQ5 A;  5IY0 A;  1VQP A;  1XJV A;  5JJK A;  4X65 Q;  4DNI A;  4DR4 L;  3K0X A;  3HOX G;  1N34 Q;  2PI2 E;  2ZTD A;  4DV7 Q;  4A3J G;  5JJL A;  3I4N H;  1VQ8 A;  1P8L A;  2WAQ G;  4GOP B;  1HNZ L;  4A3I H;  2WB1 G;  4K0K Q;  4MTN A;  1P16 A;  4BY1 G;  1RIP A;  2IY5 B;  4P71 A;  1JMC A;  3HFZ B;  3L7Z C;  3GTL H;  3J80 i;  2D62 A;  4JC0 A;  4C3I H;  3M7N A;  4A3C H;  1PA6 A;  5ELO A;  4A3I G;  2F4V L;  1GO3 E;  2MO0 A;  5GAD C;  1IBK Q;  3CW2 C;  1VQD A;  1VQ5 A;  3A5Z B;  4YY3 L;  1FJG L;  3M3Y H;  1SN8 A;  5IYC H;  4DPG A;  2JJQ A;  1YZ6 A;  2VUM H;  1Y1W H;  3J81 j;  4QL5 A;  3ERS X;  4DV3 Q;  3UDF A;  2ZJR A;  1EOV A;  2UXD Q;  1CKM A;  2YYZ A;  2UXB Q;  2MQH A;  1AE3 A;  5M3F H;  1BVS A;  4NXM Q;  3CCS A;  2F4V Q;  3BU2 A;  3HOW H;  3KF6 A;  5C0X J;  5FLM H;  2E2I H;  4A3L G;  3GDE A;  3CCU A;  1TWH H;  4YCW A;  3RR5 A;  4LF5 Q;  2E5L L;  3HOU G;  3M4Q A;  4X62 Q;  2JA6 H;  4JV5 L;  1PH4 A;  4O2D A;  4PZ6 A;  5LMN W;  1PH9 A;  1AH9 A;  2YTV A;  4BBR G;  1WCM H;  1YJ9 A;  2BA0 A;  4DK3 C;  2DUD A;  2ZTC A;  3E9H A;  1Y1V H;  2HHH L;  1FL0 A;  4PG3 A;  4DAY B;  4LF4 Q;  1WCM G;  1HZB A;  2VZA A;  3W5O A;  4X62 L;  4JI6 Q;  1E7Z A;  3TS2 A;  3RNU A;  2E5L Q;  2ZJQ A;  3DLL A;  3GTO H;  1VQE A;  2I5L X;  2N78 A;  1VQ6 A;  4IPD A;  2UUC L;  4DR1 Q;  2HQL A;  4P74 A;  3KJO A;  1I3Q H;  1X6O A;  4KI0 A;  4LFC Q;  4UP9 A;  1Q12 A;  3SGI A;  4A93 G;  1X3F A;  2ZTE A;  2UXC Q;  3ER0 A;  4C3J H;  3ULJ A;  4APV A;  4HJA A;  4DV3 L;  3T1H Q;  2PI2 A;  2R93 G;  4LWC A;  1PH3 A;  4X64 Q;  4GLV B;  1N9W A;  1LM0 A;  4BA2 I;  2VS1 A;  1E24 A;  3GTJ H;  1IBK L;  3PO3 H;  3S1R H;  1LUZ A;  3VDY A;  2E8G A;  3UDI A;  1VQK A;  1MIU A;  4JI1 L;  2R92 H;  1VQ4 A;  4OWX B;  3DM3 A;  4A3B G;  1HZC A;  1EQR A;  4LUO A;  2B3G A;  1HNX Q;  5C3E H;  4GN4 B;  4A3E G;  1CSQ A;  1FGU A;  4A3K G;  5C44 G;  3CCE A;  4LUV A;  2CWP A;  2L15 A;  1YEZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...