4JI3L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLWGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 17
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji3L00
4P71A 2WFWA 2IX0A 1EIFA 5M5YH 1V1QA 3RN5A 3ERSX 1HJPA 1X54A 2NZOA 4L5TA 1VQOA 4DK3C 1YI2A 2ASBA 2VL6A 3U50C 1VQ5A 4UP8A 1VQPA 4EX5A 4BY1H 4BA1I 1YITA 2UUBQ 4JI2L 5ELOA 3DLLA 4LUZA 2ZJRA 2GVAA 2HIVA 3CC2A 4JYAL 4IJHA 3HOYG 5BR8Q 1FL0A 4X65L 4NXMQ 4JI2Q 3AYHB 5GROA 3RZOH 2RHSB 5C3EH 2OCEA 3GTMH 3Q8DA 3PO2G 4JI4L 1HNWQ 2UXDQ 5C4XG 3I4MH 4X65Q 4DR6L 1L1OA 3RLOA 4DK6C 3F2DA 1E3PA 5ELNA 3A74A 1XMOL 4A3GG 3ULJA 2K50A 1WCMH 5HGQA 4GOPC 1NMFA 2JA6G 1Y14B 3B6YA 1B7YB 2JA5G 3PUZA 4C3IH 2VQEQ 2ZTEA 1NJIC 2E2HH 2YTYA 1SROA 3UE0A 1QUQA 3I56A 5IYDH 1A63A 1HZAA 5IWAL 5AJ3Q 4JI7Q 3K7UC 1SMXA 1TWCH 3EN2A 1VQDA 1KIXA 1FGUA 4C2MH 3KLWA 4BY7H 3FHWA 5AJ3L 4FDBA 5FLXc 4GLXA 3S16H 1JJ2A 4A3MG 2JA9A 4PG3A 2CQOA 4YHHL 4BY7G 1HZ9A 2Q2UA 2K52A 4AYBG 4DR3Q 2UUAQ 4LNQA 1WOCA 1VQ4A 3CW2C 4IFDI 1MJCA 3L7ZC 5EAYA 4LFAQ 3TREA 2N8NA 3CCSA 1I94Q 3CCLA 2H5XA 3PO3G 4RMFA 1SRUA 3J80i 3HOWG 4J15A 3OW2A 1LM0A 3PUYA 4A3BH 1GKHA 2N49A 5JEAG 4A3EG 2E2JH 1VQ8A 5JJIA 1R9TH 4KLKA 5FLMH 4JOIA 2LXJA 1PA6A 2RCNA 1IZ6A 1L1OB 1UE5A 3AFPA 2KCMA 4UP7A 3CC7A 3S14H 1WFQA 4APVA 2F4VQ 4DV7Q 1BBUA 3E9HA 5IP9H 1HR0Q 1VQKA 3PF4A 3PF5A 3TQYA 4YY3Q 4X64Q 4BBRG 1VQMA 3DM3A 5J3BA 5C0XJ 4DV7L 4YCWA 5DLQE 3ULPA 4A3KH 3HFZB 2DGYA 1A8VA 4JOIC 2QA4A 4DR1Q 2OQ0A 1A62A 1VQCA 1VQEA 2NVQH 1QVFA 3T1YQ 3KDFB 5GADC 1LTLA 1YJ9A 1W3SA 3ICEA 4O0AA 5IYCG 1DGSA 4JI3L 4WJ3M 2XGTA 3M9BA 1GVPA 2RHQB 2L15A 1EWIA 4JI8Q 1T9HA 5GAEC 5IYCH 3J80c 3T1YL 2AHOB 1CKMA 3H15A 4JI3Q 2ES2A 1BVSA 1PV4A 4A3LG 1K0RA 4LF4L 3HOVH 4K0KQ 2MO0A 1QVGA 3STBD 5IWAQ 3PUVA 1VQNA 3BU2A 3G4SA 2E5LQ 4BA2I 1K8GA 3FKIG 1IBKQ 2IHFA 3CP0A 3GTOH 1P16A 1FJGL 4JI6L 2PQAB 4Y7NH 1PH5A 1Q1EA 4YHHQ 2F4VL 3H0GG 1RIPA 4BBSH 5H1SE 2UUCL 1J5EL 2R92H 4KHPL 2OTLA 4A76A 2K5VA 1XMQQ 4LF6Q 2EIFA 4BBSG 3I55A 3PUWA 4NXML 4PZ7A 1MKHA 1NTGA 4IO9A 5C4JH 1HNWL 3E0EA 1Y1VG 4L5RC 2KHIA 3SGIA 1B70B 3U4ZA 5M5XH 3BZCA 1WJJA 3GTPH 1VQBA 2UUAL 3I2ZA 2ZJQA 1SN8A 4DUZQ 4EQ5A 1JMCA 4DR4L 1Q1BA 2N3SA 1OTCA 4A93H 3BJUA 3KF6B 1IBLL 1JJGA 3K0XA 4QGUA 3RZDH 4AH6A 3EIVA 5C4XH 3RR5A 3I7FA 2UXCQ 2ZTCA 3CMEA 2R6GA 1CKNB 3K7AH 3A5UA 4DAYB 1IBLQ 2JA6H 2K5NA 1XNRQ 4X64L 2VUMH 3EBEA 4ME3A 1S72A 2VQFQ 4LW1A 2B29A 3H3VH 3PGZA 4DR5L 1I3QH 4QY7A 3W5OA 4DR1L 3M7NA 2MFIA 3S1RH 1UE1A 2NVYH 3CCMA 3AFQA 4NXNL 1XPRA 3K8AA 1VQ6A 1UE7A 2Y0SE 4O2DA 4GKKQ 4AQYQ 2MQHA 3I4NH 4DNIA 1N8RC 1N36Q 1TWFH 1XMOQ 3NELA 4MTNA 3OTOQ 2KHJA 1LYLA 3JC66 4BXXG 4B3ML 1KRSA 4A3DH 4R4TA 1N36L 4P74A 2VQEL 4DV6Q 4OWTB 2HT1A 3NENA 2A8VA 4JI8L 4DPGA 2PMZE 2WB1G 3F2CA 3CCEA 1EYGA 1YJWA 3D31A 1FJGQ 4IPHA 4JV5Q 2UXCL 2HIXA 3PIPA 1QVCA 4B3SQ 3K80C 2JEBI 1X9NA 1L2FA 1Q12A 3GD7A 1JJCB 4MNOA 2KCTA 1PYBA 3HOUH 3CF5A 1YJNA 1HR0L 3TS2A 2PI2E 2R93G 4DR5Q 2F52A 2DUDA 3HOUG 2VS1A 1E22A 1PH9A 1HZBA 1G6PA 4DR2Q 1PH8A 3TS0A 1ASYA 2R93H 3K81C 5JJKA 2ZM6Q 4OWXB 4HIKA 1VQHA 1X55A 3KJOA 4PMWA 5IP7H 1PYSB 1YVCA 1KRTA 4B3RQ 4DV3L 1K73C 4BBRH 2VW9A 1UE6A 4B3MQ 4AYBE 4OX9L 1VQ9A 4LF9Q 2VY3A 2JA8H 3RNUA 1SE8A 5M3MH 2V1CC 1TXYA 2Z6KC 2GN5A 1EOVA 4H02A 4OX9Q 2VNUD 2ID0A 4A3JH 4X66Q 1AE3A 1VQGA 4JV5L 2E5LL 3CCUA 3NEMA 1E1OA 1XPUA 1PH1A 3FKIH 1K9MC 4DV2L 2R7FA 4IJLA 2LXKA 4X66L 2K4KA 3W1BA 2HHHQ 4L5QA 3W1GA 5M5WH 4JBMA 1YHAA 2D0OA 4A4IA 2Q2TA 1N34Q 5BR8L 5IY0A 3IRBA 2JE6I 2OWOA 3F2BA 4JI0L 2R92G 1TWAH 4HIDA 4DAMA 3U58A 4QQBX 4DV1L 4GNXA 3RN2A 1PVOA 4OONA 5E7NA 1E7ZA 1PH3A 4OXPA 1N9WA 4HJ5A 4GKKL 4JI1L 5LMNQ 1HNZQ 1Y1VH 4LF4Q 4IOAA 2JK8A 2PI2A 2NVXH 4IFDG 3MEFA 1Q7YC 1Z47A 1LUZA 4GOPA 5C3EG 3PO2H 5GQOA 3M4PA 1IBKL 2BH8A 4B3SL 2VZAA 4QIWE 1KC8C 1XPOA 2R7DA 4UP9A 4XIGS 3HOYH 1X65A 4GKJL 3HOZG 4GN4B 4NB3A 3KDFA 1SFOH 1WYDA 4UPAA 4R4CA 2IX1A 3S17H 3HOZH 5GAGC 3G71A 3A0JA 1X56A 3CPWA 2JA5H 3CC4A 3S2DH 3ULLA 2UUBL 3M4OH 4TVAB 1WI5A 5K36G 4YWKA 2CCZA 4X62Q 4DV4L 1PFSA 1N34L 2KBNA 2XTIA 4DV0Q 3UE1A 2ZJPA 1S40A 4POGA 4POFA 1WCMG 2AKWB 2AWNA 1ASZA 4LFCQ 1BBWA 1SR3A 4DV1Q 4DV4Q 4JI4Q 1X3GA 3AEVA 1N32L 2WP8J 1CSPA 2AMCB 1RL2A 5IYDG 2JEAI 1P8LA 1Q86C 1EFWA 3M85A 4IOCA 2I5MX 3GDEA 1QZGA 4B3RL 3GTJH 4NPSA 1KL9A 4GN5A 4LUOA 1N32Q 1X3FA 1U5KA 3I4NG 3RLNA 3LGJA 2B63H 4HIOA 2NN6I 1G51A 4A3MH 4LF5L 4OO1I 2B3GA 1QZHA 5C44G 3J81c 3CCVA 1Y1WG 2B63G 4B3TQ 4RG1A 1K8AC 4ALPA 5C44H 3UDXA 1CKOA 3F8TA 4LFBL 1VQLA 1VQFA 4X6AH 4KHPQ 1OXVA 1GD7A 4X62L 3GTQH 4YWLA 4A3CG 1Q46A 2D62A 3RLFA 1XJVA 4WJ4A 4DR2L 4P75A 2RF4A 4LUVA 5IP9G 3F1ZA 1PHJA 4A3EH 3T1HQ 1HNXL 1IYJB 2C35B 3CQZH 2WAQE 1E1TA 5FLMG 1K3RA 4DR7Q 3GO5A 1JT8A 1D8LA 4TQUS 3I4OA 3H3VI 1HZCA 1IXRA 4A3KG 3CMAA 4GOPB 3S2HH 4DV5L 1N33Q 1SLJA 3CPFA 1A0IA 2JA7G 3GTLH 1K83H 5C0XG 3FP9A 1Q81C 3PV0A 1Q82C 1V9PA 3J7ZC 1E24A 1NE3A 1Q8KA 4JI6Q 2BH2A 2I0QA 1XNQL 3HKSA 2WB1E 3J7A5 2HQLA 2R7ZH 2Y0SG 4GNXC 4A3LH 1M1KC 1X3EA 4IPGA 3S24A 3ER0A 4IPDA 4MZ9A 5M3MG 1J5EQ 1KHIA 2NVTH 3KFUA 3CAMA 2NN6G 4JBJA 1YIJA 4HJ8A 5IE8A 2BA1A 1KAWA 3GTGH 2Q2HA 2OTJA 1NMGA 3GTKH 1NBWA 1I5FA 3HOXH 4DUYL 3G48A 1G291 3HOVG 1OXTA 1I50H 2MO1A 4AQYL 4DV0L 3H0GH 1OXXK 1FVIA 4KHZA 4R1JA 3CCJA 5FJ8H 3OTOL 3CD6A 2Z6KA 2E8GA 3A5ZB 5JEAJ 1PH4A 4UY8C 5LMNW 1UWVA 4DR6Q 2E2IH 4GS3A 5FJ8G 1VS0A 4A3IG 2OQKA 4IPCA 2JQOA 1EIYB 1IL2A 4HIMA 3J81i 4DV2Q 4A3IH 4XTCS 1L1OC 3S1QH 4LFBQ 4BY1G 2VQFL 2Z0SA 4HJ9A 2KENA 4JC0A 4YY3L 4LF5Q 3UDIA 1XNQQ 1IBMQ 1CSQA 1U0LA 1HR0W 3NBHB 2UU9Q 1M90C 1KD1C 4DUZL 4P72A 5HY6A 2QGQA 2IHEA 1CKNA 3D0FA 3KF6A 4GLAC 5IYBH 3ZJYC 3T1HL 1HNXQ 2WAQG 4A3GH 5GAHC 5M3FH 3L2PA 3I4MG 4A93G 2UXBQ 1AH9A 3AQQA 4OO1G 1TWHH 2ZM6L 3HKZE 5IYBG 4LFCL 5M3FG 3BZKA 3M4QA 2UXBL 3TEHB 3WWVA 4L5SA 1AE2A 1TWGH 4DR3L 2VUMG 1YZ6A 4IFDJ 4DR4Q 2CWPA 3OYYA 4GKJQ 4LF9L 4YCVA 1I6HH 3CXCA 3TRZA 1W2BA 1C9OA 1H95A 2IY5B 4GNXB 3G6EA 3KJPA 4AIMA 3VDYA 1XNRL 2YU9H 5LMUQ 1S3OA 3L0OA 1Y1WH 3KOJA 3PIOA 4B3TL 4LF7L 4C3JH 2ATWA 4LF8Q 1D7QA 3UDFA 1GO3E 2UUCQ 1PH7A 3M3YH 4YWMA 4Y52H 4BXXH 1XMQL 4DUYQ 2CWAA 4A3DG 3U4VA 2YTVA 4LF7Q 1Z9FA 2IT1A 4JBWA 4R4IA 4KI0A 2EXDA 3E9IA 2UU9L 4LF8L 4LWCA 3CCRA 2PNHA 4JI0Q 1J6QA 4A3BG 2AWOA 1I94L 4A3CH 1QUQB 2K75A 4JYAQ 3JAMi 2I5HA 1OXSC 1UEBA 5C0XI 3PO3H 3S1NH 1O7IA 2GVBA 4GLVB 3HOWH 2D0PA 4JG2A 2A1AA 2UXDL 4JI1Q 5IT9c 5LMNL 1HNZL 5JJLA 2YTXA 2CKZB 3CCQA 1XTDA 4JI5L 4PZ8A 4C3HH 1JE5A 4HJAA 1VCIA 3PUXA 1OXUA 1X6OA 1BKBA 4JI5Q 5IP7G 3S1MH 1YHQA 3S15H 1HH2P 2LSSA 3J81j 3UDGA 1IBML 4K0KL 2BA0A 2I5LX 3STBC 1C7YA 2JA8G 1B8AA 1CUKA 1YBYA 2HHHL 1JB7A 3PSIA 1KXLA 1EQRA 5LMUL 2EQSA 4A3FG 3PCOB 2PQAA 2JA7H 4NXNQ 1MIUA 4GN3B 4DKAC 4JI7L 4HJ7A 4A3JG 3HKZG 3JAMc 4A3FH 1PH2A 2Q2IA 2QEXA 2K14A 4JBKA 4LFAL 4DR7L 1YHBA 4PZ6A 1MJEA 4JCVE 4R4OA 2MNAA 1PH6A 4R4QA 2ZTDA 2K5HA 4QJFA 2F3IA 4A75A 1VQJA 1EQQA 1L0WA 2R7ZG 1VQ7A 4DV5Q 4LF6L 4YCUA 3KF8B 2JJQA 1N33L 1YNXA 1KQSA 1C0AA 1EUJA 2NZHA 2YYZA 1YEZA 4DV3Q 4DV6L 2N78A 2FXQA 1VQAA 1NY4A 2CFMA 3MXNB 2A19A 2YV5A 1VQIA 3KYHC 2ALYB 4P73A 4OWWB 3HOXG 1GM5A 4QL5A 1V43A
chains in the Genus database with same CATH superfamily
2BDNA 1A6XA 3MXUA 3ERSX 2DN8A 1X54A 3NUCA 5IOCA 2WAQB 1BQQT 4LUZA 2HIVA 4JYAL 1II3A 4IJHA 3V96A 3S17B 4JI2Q 2RHSB 4HAEA 2OCEA 5C4XG 3Q8DA 2UXDQ 4X65Q 4IZ8A 4DR6L 1W6JA 2F0JA 1B53A 1EYAA 1E3PA 1QCBD 4GOPC 3B6YA 3OIPA 3H0GB 2ZTEA 2E2HH 3T53B 4LK1C 3UE0A 5IWAL 1RF2D 1SMXA 1TWCH 1IW7D 1OO9B 1DOMA 1G8ZD 5FLXc 3S16H 4A3MG 4PG3A 1SBBB 1HZ9A 2JN4A 5JPMC 4LNQA 3MA2B 3L7ZC 5EAYA 4A3IB 1KTKA 2N8NA 1X3PA 3AMUA 3UI2A 5COYA 3GTJB 5I2XA 4RMFA 1HXYD 2RQXA 4DK1A 1CT1D 5KRUA 1GKHA 1HTLD 5ELBA 5I9OA 4A3EG 3SVMA 1VQ8A 1HUMA 1EQVA 1EZ6A 1IW7C 4NMZA 1L1OB 1UE5A 2KCMA 4APVA 2F4VQ 1BBUA 2PPBC 4YY3Q 1LT3D 3QWNA 1SFOB 2F3VA 4A3KH 2DGYA 4JOIC 3A7AB 2A6EC 2QA4A 3I70A 1VQCA 1VQEA 2NVQH 1QVFA 3T1YQ 1LTLA 1DGSA 2B63B 4WJ3M 3M9BA 5C0XH 3P1HA 1STNA 5IYCH 2NVXB 1K8MA 1EYDA 4LF4L 3STBD 5IWAQ 1VQNA 3BU2A 5L37A 4A3EB 2K7VA 1CZGA 3CKIB 2X6GA 2IHFA 4OEMB 3GTOH 4JI6L 4ILWA 1DD2A 4Y7NH 3QG1A 2WIIB 3H0GG 1XTCD 2EYLA 4BBSH 1LTRD 2UUCL 1Y1WB 5EBCA 2VB2X 3OW7A 2EIFA 5C5MA 4PZ7A 1MKHA 1NTGA 5JPNC 3S15B 3D4WA 2E2JB 1B70B 3GTPH 1VQBA 2EJGC 5FO9B 1SN8A 4LMQD 4EQ5A 4DR4L 4A93H 2OEOA 3K0XA 4N9PA 4K14A 4G7ZC 4AH6A 5C4XH 3RZDH 2UXCQ 4P2CB 3PO3B 4DF7A 4X64L 4ME3A 1I4XA 4KK7A 2VQFQ 3H3VH 3PGZA 4BY7B 4QY7A 4DR1L 2F0EA 1F2YA 3S1RH 3BDOA 2NVYH 5ELCA 3BYYB 5FO7B 3CCMA 4FF1A 3FKIB 2Y0SE 2DY7A 4AQYQ 1EFID 4DNRB 1XMOQ 3NELA 2B2TA 1LYLA 2F0NA 3FPUB 4ID6A 5M3MB 1QB5D 4MN3A 1N36L 2WB1B 3OSOA 5EGTA 1RJTA 2PW7A 3URYA 2B2WA 1H9SB 2HT1A 2A8VA 1TKWB 4JI8L 1H9KA 3JAME 1NUCA 5IGDA 1ENAA 3GTMB 3K80C 2JEBI 1X9NA 2PO4A 4JVZA 4A3KB 1JJCB 4MNOA 3T13A 5IODA 2F0QA 2NUCA 2F52A 2DUDA 3HOUG 4BS9A 5JJKA 3K81C 3T51B 4F88A 1X55A 3RZDB 4B3RQ 4A93B 2IL8A 1EIGA 4AYBE 1VQ9A 1PTOH 2VY3A 3TP6A 4LF9Q 2JA8H 3RNUA 4J8QA 2Z6KC 1E2WA 1FR3A 4H02A 4OX9Q 2ID0A 1I50B 1VQGA 5A2QE 5C6AA 3I4NB 4JV5L 3CCUA 3GTQB 2WKCA 1PH1A 4LAAA 4CDFC 2HHHQ 5M5WH 2L55A 3HP3A 1YHAA 2D0OA 2Q2TA 3L9AX 1N34Q 5BR8L 5IY0A 5D3IB 2OWOA 2WACA 5CV6A 2R92G 3MXGA 3E6ZX 1TWAH 5C3WA 3U58A 4PNYA 1WTQA 3NWTA 3A8IE 1SEBD 4HJ5A 4JI1L 1HNZQ 1Y1VH 2OF1A 2PI2A 3EJIA 1CFMA 2NVXH 4IFDG 2TSSA 3PO2H 2Z9HA 5GQOA 3M4PA 1I4GA 1JWUD 1VMPA 1LTAD 1TVXA 2R7DA 1FNWA 3AU7A 3S9WA 3KDFA 1EZ8A 1SFOH 1WYDA 3K5MA 2F0PA 3S17H 3HOZH 5EQ0A 5D14A 2F0DA 2IX1A 5GAGC 1QG7A 2JA5H 1X56A 3CPWA 3S2DH 2JA7B 3ULLA 2UUBL 4TVAB 1WI5A 4YWKA 3HRZC 3K0YA 2CCZA 2KBNA 2EY5A 3UE1A 2ZJPA 1S40A 1HCZA 1PRTD 3R2TA 4DV1Q 3GV3A 1X3GA 3KBXA 3AEVA 1L0YB 2WP8J 1CZWA 3H91A 2JEAI 4WFN3 1E2ZA 1SMYD 3M85A 4IOCA 4B3RL 3GDEA 4S3SA 3GTJH 4NPSA 4LUOA 1X3FA 3BZDB 3D4DA 2B3GA 5JVH3 2RVLA 4XQQA 2J7ZA 4B3TQ 4RG1A 3S16B 4QMGA 3CRKC 4U673 1C8CA 1CKOA 2R92B 3F8TA 4LFBL 2P5ZX 1DXMA 2RA4A 3NBHA 4A3CG 1Q46A 4DR2L 1HNXL 1GHKA 1IYJB 5FLMG 2WAQE 3CQZH 4ZRZA 2B2UC 2CH4A 2EYMA 1H9MA 3E5SA 4RGMA 2JXMB 3J7ZC 1NE3A 2I0QA 1G6ZA 2R7ZH 1WVLA 3PIO3 3ER0A 1PDQA 4J6HA 4DNTB 3E0JA 5DAUA 2Q2HA 2OTJA 3GTKH 4FVMA 3HOXH 1STEA 3HOVG 1I50H 1PZID 5IGEA 3K6OA 1VF5C 3OTOL 3A5ZB 2E8GA 1PH4A 1PTOB 2JA8B 4GS3A 1VS0A 4ZCKA 3TP8A 5I6YA 4L6TB 4HCEA 1LTID 1EIYB 1F2MA 3DXJC 4H13C 3J81i 2ZXPA 5KNBA 4G4KA 4I7AA 3GTGB 5J39A 2DJGC 5KNDA 2KENA 4JC0A 4YY3L 1AP0A 2BDOA 1QILA 1O7YA 3NBHB 1B3QA 5HY6A 1EY6A 4GLAC 3T1HL 1U4RA 4V0BA 1TWHH 3HKZE 5IYBG 2JA6B 4LFCL 3M4QA 2B39A 5T1IA 1TWGH 2Q8IB 2VUMG 2D9UA 4GKJQ 2EY6A 4C3IG 1I6HH 4KY7A 2A68D 1STGA 3SR1A 3CXCA 2SNSA 3TRZA 3KK7A 5I9PA 2H4OA 1ML0D 1NSNS 3R93A 5C3EB 5G3LD 2YU9H 2ATWA 3KOJA 3PIOA 1D7QA 4LF8Q 1MD2D 1PH7A 2A74C 3S1RB 4YWMA 3M3YH 1LT6D 4LF7Q 2UU9L 4KI0A 3E9IA 4ODGA 5A2QL 4ZQ3A 4JI0Q 4HR7B 1J6QA 4CDEC 2WKDA 3MFGA 3PO3H 4JK1C 3Q22A 4V190 1O7IA 1D5ZC 2GVBA 1CHQD 5C4XB 1QNKA 2A1AA 3NQIA 3CHBD 2YTXA 5DM63 4IUVA 1XTDA 4C3HH 4HJAA 3SXHA 3GTPB 2A69C 3K5LA 1OXUA 1BKBA 2CW0D 5CV4A 2F4IA 4IURA 3S15H 2L9HA 3UDGA 2BA0A 1BO0A 3STBC 3NTKA 1HPCA 1B3AA 1GXDC 1SE3A 3SK8A 3ND9A 4A3FG 3PCOB 1V1PA 4A3JG 2MHVA 3HKZG 4Y7NB 2K14A 5I2YA 2K5HA 3TSSA 1VQJA 1EQQA 2R7ZG 5C4ZA 1VQ7A 3A8KE 2RDHA 1G91A 1YNXA 1KQSA 2K05A 2NZHA 1TS2A 2Y0SB 4UHVA 4QF4A 1H9SA 3KYHC 4P73A 2B8GA 1KABA 3HOXG 3S1NH 3NBIA 3QOLA 1VQOA 3U50C 3OIQA 1VQPA 5KNCA 4BA1I 1BDOA 5BN4A 1JICA 2GVAA 3CC2A 2F0WA 3HOYG 2EDGA 1FL0A 4L8JA 5KEEA 4KJOA 3QR8A 4JI4L 3I4MH 1I4PA 1KDCA 1L1OA 1LACA 3EQLC 4DK6C 1CQVA 2PZUA 4CJ2C 1WCMH 5EKLA 2JA6G 1HHVA 4FXDA 2YTYA 3V2TA 1PFNA 3HOXB 3I56A 1M4VA 3GTKB 2C5CA 1AZPA 1PZJD 3K7UC 1WTRA 3G6JB 4N9TA 1TS5A 2EYPA 3FHWA 4KTAA 5C5LA 4GLXA 2R7ZB 1SYDA 3MZ5A 3BDCA 1Y8OB 4DR3Q 2UUAQ 1WOCA 4WJ4A 1F9QA 1MJCA 3TREA 1I94Q 1ZEQX 2XSCA 2PNRC 4G7OC 2IPKD 1TY2A 4NDXA 5BN3A 2X69A 4J1MA 3PUYA 1K0SA 2KEEA 2N49A 5JJIA 4RKLA 2B2UA 5HURA 2LXJA 2HCCA 2RCNA 1IZ6A 4UP7A 4O1NA 1TIID 4DV7Q 3E9HA 3R8BA 5IP9H 3PF4A 3PF5A 1RCVD 4FO2A 1VQMA 1SNCA 3Q0AA 1ZYRC 2J0TD 5C0XJ 4YCWA 1O78A 3BVGA 5DLQE 3NSWA 3HFZB 1STYA 1UUPA 2OQ0A 1EY4A 1W3SA 3ICEA 5EKKA 2XGTA 1GVPA 2RHQB 2L15A 1EWIA 3CU7A 3OMGA 1U9RA 2D5DA 1ZXTA 2AQ2B 5GAEC 2NB0A 2XRQD 1CKMA 5E4XA 3VR2A 3H15A 4JI3Q 1BOSA 4XYQA 2DNCA 3PUVA 3QB3A 5E3FA 4OL7A 2E5LQ 5C4JB 1K8GA 1IBKQ 3VYUA 1P16A 5CV7A 2AQ3B 3DWAA 3K57A 1PH5A 1Q1EA 1FD7D 3U9OA 1LT5D 1EIHA 2JA5B 3SK6A 5I4DA 2OTLA 4Q5VA 1VMCA 4BBSG 2RKSA 3MHBA 5JJZA 4NXML 3VYSA 1HNWL 4L5RC 3BZCA 1WJJA 2ZJQA 4DUZQ 5T1GA 4TRDA 3BJUA 3EIVA 3RR5A 2F0GA 3CMEA 3A5UA 4DAYB 3OPOA 2LFNA 1TWAB 3EBEA 2HUGA 2L11A 2KCNA 1RTOA 2B29A 4LW1A 3OHXC 3W5OA 2MFIA 3HOUB 3T4AC 3HZXA 3AFQA 3K8AA 1VQ6A 4KHVA 4O2DA 1WTWA 3C2PA 3I4NH 1TWFH 4Z9CB 1NR2A 3R3OA 5DNFA 1BCPD 2QEJC 3NPPA 1KRSA 2EJFC 2X6LA 4M1UB 2VQEL 2PZWA 4DV6Q 4A3DB 3MXNA 4CHTB 2PMZE 2WB1G 3F2CA 1XX8A 1YJWA 1FJGQ 3I4MB 4IPHA 4JV5Q 5JEAH 1ESRA 5IT9L 3GD7A 3J81E 3BS1A 2FMCA 4ZLTF 5CBAE 3CF5A 1HR0L 4CKEA 2PI2E 3X3NA 4DR5Q 2VS1A 2XN9C 1PH9A 4K2KA 1G6PA 2ENBA 4N8FA 4OWXB 4HIKA 1ICFB 3KJOA 2A69D 2DY8A 4F7XA 1EY8A 1Z7TA 1KRTA 4DV3L 2VW9A 2A5HA 4OX9L 1M8AA 5M3MH 3TBIB 1TXYA 1PTOD 4OIKA 1A3VA 4KY6A 4K5XA 1WTPA 2FINB 4CKBA 1B2TA 1SAPA 1AE3A 3M4YA 3NEMA 1E1OA 3FKIH 4DXGA 2LXKA 2K4KA 4NP5A 3W1GA 1HRJA 1RODA 4HMIA 3F2BA 3Q23A 3RN2A 1PVOA 3CRLC 4OONA 5M5YB 1N9WA 2KHSA 1PTOC 2PZTA 3BVZA 1EL0A 3MEFA 1Z47A 1AN8A 4QIWE 5EPJA 1X65A 5KYLA 4GN4B 4XT1B 1RHPA 2NZ1D 4BBSB 3QOJA 3CC4A 3TZDA 1CHPD 1IKLA 4DV0Q 1PTOF 4OO1H 3NTIA 3EA6A 4WJWA 3LWEA 1JWSD 3WOFA 4EVOA 4OHJA 4POFA 1ASZA 4RFBA 2B2WC 2JP1A 1CSPA 5E1FA 1RL2A 5IYDG 1Y8NB 5J1ZA 1P8LA 2DJFC 2FJ2A 4F8MA 1KL9A 1H9RA 1U5KA 3I4NG 1S5DD 3RLNA 3LGJA 2B63H 1R4QB 1F9RA 1TWHB 4B9WA 2O5JC 2NN6I 4LF5L 3DWPA 1PFMA 5C44G 1Y1WG 1FYCA 1F77A 2A6ED 4ALPA 1EY7A 2GA4B 4GZYC 3RLFA 2D62A 2RF4A 4C3IB 3HOYB 2C35B 3GO5A 1D8LA 4A3KG 1N33Q 1A0IA 4OIJA 1BBXC 1TT2A 3KUPA 5C0XG 3J7AF 4ZUJA 4JI6Q 4KMUC 3HKSA 1XYIA 2Y0SG 3ND8A 1M1KC 4RGTA 5M3MG 1PRTF 4IPDA 3KFUA 1KHIA 1BCPF 2NN6G 5IE8A 2N88A 1NMGA 1I5FA 3G48A 1G291 4A3JB 2J4XA 3H0GH 1OXXK 4KHZA 1SE4A 1EWCA 5FJ8H 2E2IB 1VDZA 5JEAJ 4UY8C 2B2TC 5LMNW 1UWVA 1YNND 2E2IH 1IKMA 1FGBD 1V1OA 4A3IG 2OQKA 1W6KA 4X3TA 4KJNA 4KKUA 1ET6A 4IUTA 4UAIA 1PLFA 1SYBA 4HJ9A 4LF5Q 1IBMQ 1JQYD 1U0LA 1HQMC 1M90C 1BNZA 2OT2A 4P72A 2QGQA 2BE5C 4K6LA 3KF6A 1ENCA 5M3FH 3L2PA 2A73B 1SJHD 2XVSA 2QILA 3K7AB 3BZKA 2UXBL 1QWYA 3WWVA 2KECA 4JPBW 3ONAB 1LT4D 4IFDJ 2CWPA 1STBA 1SMYC 3MVVA 3G6EA 3KJPA 2F0TA 3L0OA 5C3XA 4MIUA 2B2VC 3DEPA 4LF7L 1K8OA 2K28A 4R8NA 4HSVA 3S2DB 1U4MA 4BXXH 4DUYQ 1GUNA 4A3DG 1A2TA 4RH6A 3CCRA 1JR0D 2K75A 4JYAQ 1UEBA 1CM9A 4GLVB 2D0PA 4JG2A 1C4QA 2UXDL 4JI1Q 1HNZL 1HA6A 3CCQA 2CKZB 4PZ8A 1JE5A 1Y1VB 3FMCA 5DEHA 1VCIA 2K6AA 2NTSA 1YHQA 3BYTB 1EOTA 4C1NK 1IBML 2O5IC 4F87A 1DYQA 4OGQC 4NKLA 2AQ1B 4RKBA 3FPPA 1CUKA 1YBYA 2IW3A 1JB7A 1C7YA 2HHHL 2JA8G 1EQRA 1EEFD 2PQAA 4DGZA 2C9OA 4JI7L 3I3CA 1DZ1A 5C44B 2Z4HA 4A3FH 4LFAL 2Q2IA 2CQAA 2TMPA 4DR7L 1YHBA 1MJEA 1D2BA 1D5XC 2SOBA 1PYWD 4R4QA 4QJFA 2F3IA 1DCZA 1L0WA 4A3MB 4DV5Q 4LF6L 1MBYA 2JJQA 4ZK9B 1X32A 5FOBB 4M8AA 4DV3Q 2NN6H 4DV6L 3W2DA 4C3HB 2FXQA 3MXNB 2CFMA 2YV5A 5KYIA 2RBMA 4DUZL 3F2UA 1GM5A 4P71A 2WFWA 5M5YH 1IL8A 1EQTA 2HD3A 3RN5A 4L5TA 1YI2A 4IFDH 3VR4A 1VQ5A 4BY1H 1YITA 2UUBQ 3IFTA 5ELOA 3M4OB 3DLLA 2ZJRA 1GOZA 1QNUA 2M00A 3S14B 3GV6A 5JOBA 5C3EH 3GTMH 3I91A 2CW0C 4HN7A 3F2DA 3VA5A 5ELNA 1O80A 5EBDA 3J7AV 4OELB 5HGQA 3A7LA 1NMFA 1Y14B 5NUCA 1B7YB 3JAML 3PUZA 2VQEQ 1NJIC 2NTTA 1DM0B 3DUZA 4JI7Q 3I73A 1ET9A 3SDZA 2NVYB 3KLWA 4BY7H 2G9HD 5AJ3L 1JJ2A 3VYRA 4YHHL 2CQOA 1B4OA 1PXUA 1U4PA 4AYBG 3CW2C 4LFAQ 4WRDA 3CCLA 3G7LA 5CORA 1A3TA 1PZKD 3TDQA 3HOWG 3J80i 4ZKCB 4J15A 1DOKA 4R9WA 1H9JA 2RSNA 2E2JH 4KN7C 2F0UA 4BBRB 4BWGB 1R9TH 5FLMH 2MPMA 4JOIA 1TWFB 1V8QA 2K5WA 3CC7A 1WFQA 1VQKA 1JB3A 2R3ZA 4RA8A 4X64Q 4BBRG 4RAUC 4DV7L 3FDTA 4DR1Q 3RUZA 2KJXA 1A62A 3KLRA 3V05A 3J80E 2JSOA 3KDFB 5GADC 4JI3L 5LHY1 2K1BA 4JI8Q 3P7JA 1T9HA 4XDXA 4L63B 1BVSA 1PV4A 4A3LG 1K0RA 4DAVA 3HOVH 1JCKB 3E3XA 4BA2I 4QCLA 2NVQB 4ME5A 3NXWA 4PMCA 1UEAB 1SJED 1V1PB 2PW5A 4YHHQ 1KNEA 2K5QA 2MGSA 2HDMA 2R92H 1J5EL 1I3QB 2K5VA 4A76A 1Y8PB 2Z1CA 3I55A 3PUWA 4H7BA 3DMUA 5C4JH 3C1FA 5IIFA 1Y1VG 3SGIA 2F0KA 3HEJA 3KLSA 1IHZA 2A68C 1JMCA 3A55A 1Q1BA 1S5ED 3KF6B 1JJGA 2EYJA 1B44D 4QGUA 5K36H 2RSOA 3I7FA 1CKNB 3K7AH 3OWFA 2LY7A 4XQNA 1IBLQ 5M3FB 2VUMH 2MUYA 3N52A 1GUWA 3T16A 2RCFA 1B9NA 4QIWB 4DR5L 1I3QH 2L0CA 1TR5A 1TWCB 4NXNL 1XPRA 2B2VA 1EU4A 2MQHA 4DNIA 2EPBA 2BOSA 2FMMA 2E2HB 1XWEA 4G7HC 4MTNA 1CI3M 4B3ML 2BE5D 4R4TA 4P74A 3ITPA 2R61A 1SYFA 4RCOA 1EYGA 5DM73 2HIXA 1NR4A 3PIPA 1QVCA 1I4QA 5IGCA 4B3SQ 1L2FA 1Q12A 1IYUA 3MTSA 1PYBA 3OWEB 1YJNA 1MSGA 2PCFB 5KGUA 3TS2A 2R93G 5M5WB 1FNVA 1MGSA 2N55A 4DR2Q 3TS0A 2ZM6Q 3S1QB 1VQHA 3QIAA 4PMWA 2ZXRA 5IP7H 1AEXA 1K73C 4BBRH 1UE6A 2FHTA 2QDBA 2EY1A 1SE8A 2GN5A 3H09A 1EOVA 4KV6A 1JC7A 1D6EC 2F0MA 2I46A 5JAVA 4DV2L 1T5XD 3K5OA 4RCNA 4X66L 3W1BA 3IRBA 4PQXA 5C4HA 1YNNC 4IALA 4DAMA 4QQBX 3IL8A 4HSPA 5D65A 5I6WA 1E7ZA 1NAPA 4OXPA 1PH3A 1K83B 2JK8A 2MP1A 1PRTC 1JOOA 4DK0A 4DN4M 3FVQA 1Q7YC 4GOPA 1LV9A 4RGOS 1IBKL 2BH8A 2F0VA 4B3SL 1PRTB 5LL6S 1XPOA 4UP9A 4KKTA 3SHLA 4QB4A 1JWMD 1ICWA 3MFYA 1LTBD 4R4CA 4RWSC 3G71A 2NYZD 3A0JA 5K36G 3M4OH 2LMCB 1PFSA 1D1KA 1QOHA 2HCIA 2XTIA 4POGA 1B9MA 2EXZA 1KNAA 5IT9E 2AWNA 4LFCQ 4DV4Q 1R9TB 3MC0B 5G3LF 3BDLA 1K3BC 3LX0A 3Q24A 1Q86C 1EFWA 5CR3A 1F2ZA 3D4RA 4GN5A 1N32Q 2E75C 1D5MC 2F1MA 3U9SA 4A3MH 4U68A 4OO1I 1BR9A 3HKZB 3CCVA 4PV1C 2B63G 1C48A 1K8AC 4B9XA 2K03A 4KD4A 4A3FB 1R4PB 5C44H 3UDXA 1LTTD 1GJXA 4FF2A 4X6AH 1E0BA 2WINB 4IN3A 2YU9B 4KHPQ 1OXVA 4X62L 4C1NI 2SEBD 4XQJA 3GTOB 5IP9G 3F1ZA 1SXTA 1PHJA 4A3EH 1AZQA 3T1HQ 3MWYW 1BCPB 4DR7Q 1E1TA 1K3RA 3MEHA 2E76C 2O4XA 3H3VI 3CMAA 4CBVA 1BCPC 4DV5L 1AW7A 3CPFA 1WTXA 2JA7G 4HEDA 3GTLH 1Z6HA 2EZVA 1K83H 1Q90A 3PV0A 1CQFA 1TQOA 1E24A 1SYGA 4HMJA 1Q8KA 2L5TA 1PFBA 2V4DA 2IWHA 4GNXC 1NCVA 1X3EA 4IPGA 4MZ9A 4I7ZC 4BY1B 2NVTH 3CAMA 4HJ8A 4CJ1B 2KOLA 3H94A 1AFPA 1KAWA 4FP5D 3GTGH 1WD1A 3NE5B 2XWBB 1OXTA 2MO1A 5ELEA 1WTVA 2CHBD 1FVIA 1FNUA 1QJOA 3CCJA 1Q3LA 3CD6A 2BCOA 2Z6KA 4I65A 3OOCA 4DR6Q 1NNXA 5FJ8G 4FXKC 1E2VA 2F0HA 5D3DA 1K28A 1SDFA 1STHA 2EVBA 1IL2A 1LABA 2XIWA 4A3IH 3S1QH 4LFBQ 2PYKA 1EY5A 2ZT9C 1XNQQ 3UDIA 3DEOA 1CSQA 4R8IA 1KD1C 3D6WA 1TS4A 1CKNA 3D0FA 1JE4A 4YIJA 1HNXQ 3ZJYC 4A3GH 2WAQG 4A93G 2UXBQ 1UAPA 3I4MG 2PMZB 1X3QA 1RKNA 3HS0C 1HFGA 3A56A 5CYUA 5M3FG 5HGTA 4L5SA 1AE2A 2SDFA 4DR4Q 3OYYA 4YCVA 3IFDA 1W2BA 2IY5B 4C3JG 4IUNA 4IUPA 5LMUQ 4B3TL 2KVMA 3DHQA 2UUCQ 1RD9D 2F0OA 1KLUD 2IT1A 4R4IA 2EXDA 2PNHA 4ULLA 4A3BG 1I94L 1ILQA 4EQPA 4A3CH 2I5HA 4K5VA 2KEDA 1OXSC 5C0XI 2F0IA 4FXGC 3C3LA 1BXTA 3M7GA 5LMNL 2D2CC 2HDLA 2F0FA 5JJLA 3FRPB 1EY0A 1GUOA 4CKCA 1X6OA 4ZAIA 4CGYB 4JI5Q 1CTMA 3J81j 2LSSA 2ICEC 1B8AA 1KXLA 3PSIA 2WV6D 1I4HA 1MI2A 1Q8IA 4DXFA 2JA7H 4NXNQ 1MIUA 4DKAC 3K58A 4HJ7A 3HOZB 3JAMc 2QEXA 1SNQA 4QUFA 2ZTDA 4A75A 1N33L 3KF8B 1I4RA 2A6HC 3TMEA 1B50A 4K5WA 2N78A 2K01A 1VQAA 1SNOA 2A19A 3AB9A 2ALYB 4QL5A 5IGFA 3HOWB 2IX0A 1EIFA 1V1QA 1S5CD 3HGBA 1HJPA 2NZOA 4K8IA 2ASBA 4DK3C 2VL6A 4DFAA 4A3GB 4AYBB 4UP8A 4EX5A 5FKAC 1A3UA 4JI2L 3A8JE 2IJ0A 5EPLA 2EOTA 2E74C 5BR8Q 4C3JB 4X65L 4NXMQ 5CV9A 2K5DA 3AYHB 5GROA 3RZOH 3PO2G 1HNWQ 4FF4A 1O7ZA 3WOEA 3RLOA 3K59A 3SK5A 4ABNA 4E6IA 3A74A 1XMOL 4A3GG 4K6DA 3N6RA 3SE0A 3ULJA 2K50A 1MSHA 1ZKOA 2JA5G 3KLSX 4C3IH 5ELDA 1XXGA 1SROA 1BUVT 5IYDH 1QUQA 3EFXD 1A63A 1HZAA 4FYDA 5AJ3Q 1A2UA 3EN2A 1VQDA 2L4NA 1KIXA 1FGUA 2NVTB 1EYCA 4C2MH 4FDBA 1SNPA 3EROA 2JA9A 2Z6BA 5TSSA 1DJRD 4BY7G 2Q2UA 1SNDA 2I07B 1IYVA 2K52A 4X3SA 1VQ4A 4IFDI 3CCSA 2G9DA 3S1NB 1RTNA 3GTLB 2H5XA 3PO3G 1SRUA 3TZUA 3DWQA 3X3MA 3OW2A 1LM0A 2EYHA 4A3BH 5JEAG 4KLKA 3TP7A 3I90A 1PA6A 3PQIA 2H1EA 3AFPA 3S14H 4QUCA 1HR0Q 3TQYA 3DM3A 2L12A 5J3BA 3PMFA 3ULPA 4Q0FA 1DOLA 1A8VA 3L3OC 1YJ9A 4HCSA 4MTKA 4O0AA 2L1BA 5IYCG 4KD3A 1BF4A 5CC4A 2HQEA 1EWHA 3J80c 1J9OA 3T1YL 3NK9A 2AHOB 5BN5A 3S2HB 2ES2A 2K32A 1S5FD 5EKIA 4K0KQ 2EY2A 2MO0A 1QVGA 1Y69U 3C1EA 3MXPA 5FLXE 3G4SA 5J22A 3FKIG 3CP0A 4EGVA 1CK1A 1FJGL 2PQAB 1T5EA 2F4VL 2EE1A 4DAPA 3M3YB 1RIPA 2SNMA 3BG3A 5ELFA 2Q8TA 5H1SE 4KHPL 1XMQQ 4LF6Q 2XNAC 1GHJA 4DAYA 4O42A 3SK4A 4IO9A 4X3UA 3E0EA 3VR5A 2KHIA 3U4ZA 5M5XH 3NTHA 2EYOA 3D6CA 1STAA 3K5NA 4G57A 2UUAL 3I2ZA 1DONA 1OTCA 2N3SA 1IBLL 1GUGA 5A35A 3C46A 1QE6A 1JORA 1GUSA 2ZTCA 2R6GA 3Q6SA 2JA6H 2XRSD 5CBEE 2K5NA 1XNRQ 2JYOA 1S72A 1KLGD 3M7NA 2KA7A 1UE1A 2B2YC 1UE7A 4GKKQ 3D8GA 4KKSA 1N8RC 2ZXOA 1N36Q 1EU3A 3P20A 4NW2A 3OTOQ 2KHJA 1LTSD 1TY0A 3JC66 4BXXG 4A3DH 1WD0A 1HUNA 1S4ZA 2VB3X 4OWTB 3GP7A 3NENA 4XT3B 4ZYSA 4DPGA 5IGBA 3CCEA 2KCCA 1HA5A 3D31A 4FNFA 2VXWA 2UXCL 1B1ZA 1HTPA 2KCTA 3D3RA 3HOUH 3HG9A 4C56C 1F2LA 1E22A 2KUMA 4RHRA 1HZBA 1O7LA 4TSSA 3T56B 3MAQA 1PH8A 1ASYA 1G2SA 2R93H 2K04A 4DU9A 1PYSB 1YVCA 4B3MQ 4B08A 1S5BD 5CGKA 4MHEA 2V1CC 1LLRD 3CQZB 4X3KA 2VNUD 2A6HD 4A3JH 4X66Q 5FK9C 3KF8A 2E5LL 2RDFA 2O2LD 3RMHA 1XPUA 2R93B 1K9MC 2R7FA 4IJLA 2F3WA 5CV5A 2IX3A 4L5QA 3P75A 4JBMA 4N8X1 4A4IA 1U4LA 2RDGA 2JE6I 4FF3A 3J81L 4JI0L 3VR6A 1CA6A 2VUMB 4HIDA 4DV1L 4GNXA 5E7NA 3DM1A 2F03A 2Z8LA 5EJWA 4TKOB 5LMNQ 4GKKL 4LF4Q 4IOAA 3I72A 2LKVA 1LUZA 5C3EG 3EVQA 1ILPA 2AUKA 5LL6X 2VZAA 3A54A 4WORA 1KC8C 4XIGS 2CVRA 4RHSA 3SEBA 1WTOA 2M2LA 3HOYH 4GKJL 3HOZG 4NB3A 2NWGA 1ESFA 3ERQA 1KAAA 4UPAA 1JOQA 1GUTA 5K5PA 5CMDA 4X62Q 4DV4L 1JOKA 1N34L 3H6MA 1UNSA 1WCMG 2AKWB 1BBWA 1SR3A 2QCPX 4JI4Q 1YNJC 3S1MB 1RDPD 3HOVB 1N32L 2AMCB 3PO2B 2I5MX 1QZGA 3NHHA 4IUQA 1EY9A 5M5XB 4HIOA 3VR3A 1G51A 1QZHA 3J81c 3PIP3 5AFWA 4CJ0B 1EEID 2QF7A 1VQLA 1VQFA 4CDDC 4IQZA 3GTQH 1GD7A 4YWLA 1LTGD 1XJVA 5ISRA 1A15A 4LJZC 2XWJB 2Q8RE 4LUVA 3KBGA 4P75A 2EJMA 4ZKBB 3OMCA 3ZYYX 1JT8A 1WCMB 4TQUS 1KDBA 3I4OA 3I4LA 1HZCA 3LWUA 1IXRA 2QKIC 4GOPB 3S2HH 1SLJA 3GQBA 4EQNA 2ICIA 4DA2A 3IKJA 3FP9A 2B8FA 1Q81C 2NBFA 2Z4IA 1Q82C 1V9PA 2BH2A 1XNQL 2WB1E 3J7A5 2HQLA 3H3VC 4JW0A 3QO2A 4A3LH 1HQRD 3NQTA 3S24A 1J5EQ 4JBJA 1YIJA 1MHWC 2BA1A 5CV8A 1ZYRD 1NBWA 4DUYL 2LS01 4AQYL 4DV0L 4PMBA 4R1JA 3O13A 4A3BB 2F0SA 3J7YW 1I6HB 5FO8B 5M9OA 1WTHA 3W3AA 1TS3A 1YNJD 4IPCA 2JQOA 1D1IA 1J8IA 4HIMA 4DV2Q 1LO5D 4XTCS 1L1OC 3WDNA 2E2DC 2QDLA 4BY1G 4XYOA 2VQFL 2Z0SA 1SYEA 1SYCA 2KQ3A 1HR0W 1F9PA 4XXEA 2UU9Q 4C2MB 2IHEA 5IYBH 2G5DA 5GAHC 1AH9A 5F2DA 3NP8A 1ONLA 2CH4W 3AQQA 4OO1G 2ZM6L 3TEHB 4K2LA 1VF7A 3LNNA 3I8ZA 1L0XB 4DR3L 3R2IA 1YZ6A 3RD4A 1PMRA 3VA7A 1CA5A 4LF9L 3QJYA 2AUJD 4CDCC 1C9OA 1H95A 4GNXB 4AIMA 2DNEA 3VDYA 1XNRL 1ENFA 2K33A 3RZOB 1G2TA 1S3OA 4H44C 1Y1WH 1HFNA 3BVMA 4C3JH 3NWSA 1GO3E 1SNMA 3UDFA 4Y52H 2B2YA 1XMQL 2CWAA 3U4VA 2YTVA 3IAYA 1Z9FA 4JBWA 4KY5A 4LF8L 5E4WC 4LWCA 1F9SA 1SE2A 2AWOA 1QUQB 5KIXA 3JAMi 4HTHA 4RGNA 4EQOA 1I6VC 3HOWH 4C3HG 5IT9c 4ZUIA 3FEWX 5JVG3 4JI5L 1TWGB 3PUXA 3S1MH 2FFKB 5IP7G 2MJ8A 1HH2P 4K0KL 2I5LX 2OXPA 2F0LA 5LMUL 2EQSA 1TU2B 2QW7A 4KN4C 1KDAA 4GN3B 5EPKA 3J80L 1PH2A 4JBKA 2PQEA 4PZ6A 4JCVE 4R4OA 3TN2A 4H0LC 2MNAA 1PH6A 2EYFA 5FLXL 2M9VA 4YCUA 1C0AA 3VYTA 1EUJA 2YYZA 1YEZA 4IUUA 5IGGA 1NY4A 3TP5A 4OWWB 1VQIA 4UDUC 4K8JA 1SSOA 1V43A
chains in the Genus database with same CATH topology
4P71A 2WFWA 2IX0A 1EIFA 5M5YH 1V1QA 3RN5A 3ERSX 1HJPA 1X54A 2NZOA 4L5TA 1VQOA 4DK3C 1YI2A 2ASBA 2VL6A 3U50C 1VQ5A 4UP8A 1VQPA 4EX5A 4BY1H 4BA1I 1YITA 2UUBQ 4JI2L 5ELOA 3DLLA 4LUZA 2ZJRA 2GVAA 2HIVA 3CC2A 4JYAL 4IJHA 3HOYG 5BR8Q 1FL0A 4X65L 4NXMQ 4JI2Q 3AYHB 5GROA 3RZOH 2RHSB 5C3EH 2OCEA 3GTMH 3Q8DA 3PO2G 4JI4L 1HNWQ 2UXDQ 5C4XG 3I4MH 4X65Q 4DR6L 1L1OA 3RLOA 4DK6C 3F2DA 1E3PA 5ELNA 3A74A 1XMOL 4A3GG 3ULJA 2K50A 1WCMH 5HGQA 4GOPC 1NMFA 2JA6G 1Y14B 3B6YA 1B7YB 2JA5G 3PUZA 4C3IH 2VQEQ 2ZTEA 1NJIC 2E2HH 2YTYA 1SROA 3UE0A 1QUQA 3I56A 5IYDH 1A63A 1HZAA 5IWAL 5AJ3Q 4JI7Q 3K7UC 1SMXA 1TWCH 3EN2A 1VQDA 1KIXA 1FGUA 4C2MH 3KLWA 4BY7H 3FHWA 5AJ3L 4FDBA 5FLXc 4GLXA 3S16H 1JJ2A 4A3MG 2JA9A 4PG3A 2CQOA 4YHHL 4BY7G 1HZ9A 2Q2UA 2K52A 4AYBG 4DR3Q 2UUAQ 4LNQA 1WOCA 1VQ4A 3CW2C 4IFDI 1MJCA 3L7ZC 5EAYA 4LFAQ 3TREA 2N8NA 3CCSA 1I94Q 3CCLA 2H5XA 3PO3G 4RMFA 1SRUA 3J80i 3HOWG 4J15A 3OW2A 1LM0A 3PUYA 4A3BH 1GKHA 2N49A 5JEAG 4A3EG 2E2JH 1VQ8A 5JJIA 1R9TH 4KLKA 5FLMH 4JOIA 2LXJA 1PA6A 2RCNA 1IZ6A 1L1OB 1UE5A 3AFPA 2KCMA 4UP7A 3CC7A 3S14H 1WFQA 4APVA 2F4VQ 4DV7Q 1BBUA 3E9HA 5IP9H 1HR0Q 1VQKA 3PF4A 3PF5A 3TQYA 4YY3Q 4X64Q 4BBRG 1VQMA 3DM3A 5J3BA 5C0XJ 4DV7L 4YCWA 5DLQE 3ULPA 4A3KH 3HFZB 2DGYA 1A8VA 4JOIC 2QA4A 4DR1Q 2OQ0A 1A62A 1VQCA 1VQEA 2NVQH 1QVFA 3T1YQ 3KDFB 5GADC 1LTLA 1YJ9A 1W3SA 3ICEA 4O0AA 5IYCG 1DGSA 4JI3L 4WJ3M 2XGTA 3M9BA 1GVPA 2RHQB 2L15A 1EWIA 4JI8Q 1T9HA 5GAEC 5IYCH 3J80c 3T1YL 2AHOB 1CKMA 3H15A 4JI3Q 2ES2A 1BVSA 1PV4A 4A3LG 1K0RA 4LF4L 3HOVH 4K0KQ 2MO0A 1QVGA 3STBD 5IWAQ 3PUVA 1VQNA 3BU2A 3G4SA 2E5LQ 4BA2I 1K8GA 3FKIG 1IBKQ 2IHFA 3CP0A 3GTOH 1P16A 1FJGL 4JI6L 2PQAB 4Y7NH 1PH5A 1Q1EA 4YHHQ 2F4VL 3H0GG 1RIPA 4BBSH 5H1SE 2UUCL 1J5EL 2R92H 4KHPL 2OTLA 4A76A 2K5VA 1XMQQ 4LF6Q 2EIFA 4BBSG 3I55A 3PUWA 4NXML 4PZ7A 1MKHA 1NTGA 4IO9A 5C4JH 1HNWL 3E0EA 1Y1VG 4L5RC 2KHIA 3SGIA 1B70B 3U4ZA 5M5XH 3BZCA 1WJJA 3GTPH 1VQBA 2UUAL 3I2ZA 2ZJQA 1SN8A 4DUZQ 4EQ5A 1JMCA 4DR4L 1Q1BA 2N3SA 1OTCA 4A93H 3BJUA 3KF6B 1IBLL 1JJGA 3K0XA 4QGUA 3RZDH 4AH6A 3EIVA 5C4XH 3RR5A 3I7FA 2UXCQ 2ZTCA 3CMEA 2R6GA 1CKNB 3K7AH 3A5UA 4DAYB 1IBLQ 2JA6H 2K5NA 1XNRQ 4X64L 2VUMH 3EBEA 4ME3A 1S72A 2VQFQ 4LW1A 2B29A 3H3VH 3PGZA 4DR5L 1I3QH 4QY7A 3W5OA 4DR1L 3M7NA 2MFIA 3S1RH 1UE1A 2NVYH 3CCMA 3AFQA 4NXNL 1XPRA 3K8AA 1VQ6A 1UE7A 2Y0SE 4O2DA 4GKKQ 4AQYQ 2MQHA 3I4NH 4DNIA 1N8RC 1N36Q 1TWFH 1XMOQ 3NELA 4MTNA 3OTOQ 2KHJA 1LYLA 3JC66 4BXXG 4B3ML 1KRSA 4A3DH 4R4TA 1N36L 4P74A 2VQEL 4DV6Q 4OWTB 2HT1A 3NENA 2A8VA 4JI8L 4DPGA 2PMZE 2WB1G 3F2CA 3CCEA 1EYGA 1YJWA 3D31A 1FJGQ 4IPHA 4JV5Q 2UXCL 2HIXA 3PIPA 1QVCA 4B3SQ 3K80C 2JEBI 1X9NA 1L2FA 1Q12A 3GD7A 1JJCB 4MNOA 2KCTA 1PYBA 3HOUH 3CF5A 1YJNA 1HR0L 3TS2A 2PI2E 2R93G 4DR5Q 2F52A 2DUDA 3HOUG 2VS1A 1E22A 1PH9A 1HZBA 1G6PA 4DR2Q 1PH8A 3TS0A 1ASYA 2R93H 3K81C 5JJKA 2ZM6Q 4OWXB 4HIKA 1VQHA 1X55A 3KJOA 4PMWA 5IP7H 1PYSB 1YVCA 1KRTA 4B3RQ 4DV3L 1K73C 4BBRH 2VW9A 1UE6A 4B3MQ 4AYBE 4OX9L 1VQ9A 4LF9Q 2VY3A 2JA8H 3RNUA 1SE8A 5M3MH 2V1CC 1TXYA 2Z6KC 2GN5A 1EOVA 4H02A 4OX9Q 2VNUD 2ID0A 4A3JH 4X66Q 1AE3A 1VQGA 4JV5L 2E5LL 3CCUA 3NEMA 1E1OA 1XPUA 1PH1A 3FKIH 1K9MC 4DV2L 2R7FA 4IJLA 2LXKA 4X66L 2K4KA 3W1BA 2HHHQ 4L5QA 3W1GA 5M5WH 4JBMA 1YHAA 2D0OA 4A4IA 2Q2TA 1N34Q 5BR8L 5IY0A 3IRBA 2JE6I 2OWOA 3F2BA 4JI0L 2R92G 1TWAH 4HIDA 4DAMA 3U58A 4QQBX 4DV1L 4GNXA 3RN2A 1PVOA 4OONA 5E7NA 1E7ZA 1PH3A 4OXPA 1N9WA 4HJ5A 4GKKL 4JI1L 5LMNQ 1HNZQ 1Y1VH 4LF4Q 4IOAA 2JK8A 2PI2A 2NVXH 4IFDG 3MEFA 1Q7YC 1Z47A 1LUZA 4GOPA 5C3EG 3PO2H 5GQOA 3M4PA 1IBKL 2BH8A 4B3SL 2VZAA 4QIWE 1KC8C 1XPOA 2R7DA 4UP9A 4XIGS 3HOYH 1X65A 4GKJL 3HOZG 4GN4B 4NB3A 3KDFA 1SFOH 1WYDA 4UPAA 4R4CA 2IX1A 3S17H 3HOZH 5GAGC 3G71A 3A0JA 1X56A 3CPWA 2JA5H 3CC4A 3S2DH 3ULLA 2UUBL 3M4OH 4TVAB 1WI5A 5K36G 4YWKA 2CCZA 4X62Q 4DV4L 1PFSA 1N34L 2KBNA 2XTIA 4DV0Q 3UE1A 2ZJPA 1S40A 4POGA 4POFA 1WCMG 2AKWB 2AWNA 1ASZA 4LFCQ 1BBWA 1SR3A 4DV1Q 4DV4Q 4JI4Q 1X3GA 3AEVA 1N32L 2WP8J 1CSPA 2AMCB 1RL2A 5IYDG 2JEAI 1P8LA 1Q86C 1EFWA 3M85A 4IOCA 2I5MX 3GDEA 1QZGA 4B3RL 3GTJH 4NPSA 1KL9A 4GN5A 4LUOA 1N32Q 1X3FA 1U5KA 3I4NG 3RLNA 3LGJA 2B63H 4HIOA 2NN6I 1G51A 4A3MH 4LF5L 4OO1I 2B3GA 1QZHA 5C44G 3J81c 3CCVA 1Y1WG 2B63G 4B3TQ 4RG1A 1K8AC 4ALPA 5C44H 3UDXA 1CKOA 3F8TA 4LFBL 1VQLA 1VQFA 4X6AH 4KHPQ 1OXVA 1GD7A 4X62L 3GTQH 4YWLA 4A3CG 1Q46A 2D62A 3RLFA 1XJVA 4WJ4A 4DR2L 4P75A 2RF4A 4LUVA 5IP9G 3F1ZA 1PHJA 4A3EH 3T1HQ 1HNXL 1IYJB 2C35B 3CQZH 2WAQE 1E1TA 5FLMG 1K3RA 4DR7Q 3GO5A 1JT8A 1D8LA 4TQUS 3I4OA 3H3VI 1HZCA 1IXRA 4A3KG 3CMAA 4GOPB 3S2HH 4DV5L 1N33Q 1SLJA 3CPFA 1A0IA 2JA7G 3GTLH 1K83H 5C0XG 3FP9A 1Q81C 3PV0A 1Q82C 1V9PA 3J7ZC 1E24A 1NE3A 1Q8KA 4JI6Q 2BH2A 2I0QA 1XNQL 3HKSA 2WB1E 3J7A5 2HQLA 2R7ZH 2Y0SG 4GNXC 4A3LH 1M1KC 1X3EA 4IPGA 3S24A 3ER0A 4IPDA 4MZ9A 5M3MG 1J5EQ 1KHIA 2NVTH 3KFUA 3CAMA 2NN6G 4JBJA 1YIJA 4HJ8A 5IE8A 2BA1A 1KAWA 3GTGH 2Q2HA 2OTJA 1NMGA 3GTKH 1NBWA 1I5FA 3HOXH 4DUYL 3G48A 1G291 3HOVG 1OXTA 1I50H 2MO1A 4AQYL 4DV0L 3H0GH 1OXXK 1FVIA 4KHZA 4R1JA 3CCJA 5FJ8H 3OTOL 3CD6A 2Z6KA 2E8GA 3A5ZB 5JEAJ 1PH4A 4UY8C 5LMNW 1UWVA 4DR6Q 2E2IH 4GS3A 5FJ8G 1VS0A 4A3IG 2OQKA 4IPCA 2JQOA 1EIYB 1IL2A 4HIMA 3J81i 4DV2Q 4A3IH 4XTCS 1L1OC 3S1QH 4LFBQ 4BY1G 2VQFL 2Z0SA 4HJ9A 2KENA 4JC0A 4YY3L 4LF5Q 3UDIA 1XNQQ 1IBMQ 1CSQA 1U0LA 1HR0W 3NBHB 2UU9Q 1M90C 1KD1C 4DUZL 4P72A 5HY6A 2QGQA 2IHEA 1CKNA 3D0FA 3KF6A 4GLAC 5IYBH 3ZJYC 3T1HL 1HNXQ 2WAQG 4A3GH 5GAHC 5M3FH 3L2PA 3I4MG 4A93G 2UXBQ 1AH9A 3AQQA 4OO1G 1TWHH 2ZM6L 3HKZE 5IYBG 4LFCL 5M3FG 3BZKA 3M4QA 2UXBL 3TEHB 3WWVA 4L5SA 1AE2A 1TWGH 4DR3L 2VUMG 1YZ6A 4IFDJ 4DR4Q 2CWPA 3OYYA 4GKJQ 4LF9L 4YCVA 1I6HH 3CXCA 3TRZA 1W2BA 1C9OA 1H95A 2IY5B 4GNXB 3G6EA 3KJPA 4AIMA 3VDYA 1XNRL 2YU9H 5LMUQ 1S3OA 3L0OA 1Y1WH 3KOJA 3PIOA 4B3TL 4LF7L 4C3JH 2ATWA 4LF8Q 1D7QA 3UDFA 1GO3E 2UUCQ 1PH7A 3M3YH 4YWMA 4Y52H 4BXXH 1XMQL 4DUYQ 2CWAA 4A3DG 3U4VA 2YTVA 4LF7Q 1Z9FA 2IT1A 4JBWA 4R4IA 4KI0A 2EXDA 3E9IA 2UU9L 4LF8L 4LWCA 3CCRA 2PNHA 4JI0Q 1J6QA 4A3BG 2AWOA 1I94L 4A3CH 1QUQB 2K75A 4JYAQ 3JAMi 2I5HA 1OXSC 1UEBA 5C0XI 3PO3H 3S1NH 1O7IA 2GVBA 4GLVB 3HOWH 2D0PA 4JG2A 2A1AA 2UXDL 4JI1Q 5IT9c 5LMNL 1HNZL 5JJLA 2YTXA 2CKZB 3CCQA 1XTDA 4JI5L 4PZ8A 4C3HH 1JE5A 4HJAA 1VCIA 3PUXA 1OXUA 1X6OA 1BKBA 4JI5Q 5IP7G 3S1MH 1YHQA 3S15H 1HH2P 2LSSA 3J81j 3UDGA 1IBML 4K0KL 2BA0A 2I5LX 3STBC 1C7YA 2JA8G 1B8AA 1CUKA 1YBYA 2HHHL 1JB7A 3PSIA 1KXLA 1EQRA 5LMUL 2EQSA 4A3FG 3PCOB 2PQAA 2JA7H 4NXNQ 1MIUA 4GN3B 4DKAC 4JI7L 4HJ7A 4A3JG 3HKZG 3JAMc 4A3FH 1PH2A 2Q2IA 2QEXA 2K14A 4JBKA 4LFAL 4DR7L 1YHBA 4PZ6A 1MJEA 4JCVE 4R4OA 2MNAA 1PH6A 4R4QA 2ZTDA 2K5HA 4QJFA 2F3IA 4A75A 1VQJA 1EQQA 1L0WA 2R7ZG 1VQ7A 4DV5Q 4LF6L 4YCUA 3KF8B 2JJQA 1N33L 1YNXA 1KQSA 1C0AA 1EUJA 2NZHA 2YYZA 1YEZA 4DV3Q 4DV6L 2N78A 2FXQA 1VQAA 1NY4A 2CFMA 3MXNB 2A19A 2YV5A 1VQIA 3KYHC 2ALYB 4P73A 4OWWB 3HOXG 1GM5A 4QL5A 1V43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P71 A;  2WFW A;  2IX0 A;  1EIF A;  5M5Y H;  1V1Q A;  3RN5 A;  3ERS X;  1HJP A;  1X54 A;  2NZO A;  4L5T A;  1VQO A;  4DK3 C;  1YI2 A;  2ASB A;  2VL6 A;  3U50 C;  1VQ5 A;  4UP8 A;  1VQP A;  4EX5 A;  4BY1 H;  4BA1 I;  1YIT A;  2UUB Q;  4JI2 L;  5ELO A;  3DLL A;  4LUZ A;  2ZJR A;  2GVA A;  2HIV A;  3CC2 A;  4JYA L;  4IJH A;  3HOY G;  5BR8 Q;  1FL0 A;  4X65 L;  4NXM Q;  4JI2 Q;  3AYH B;  5GRO A;  3RZO H;  2RHS B;  5C3E H;  2OCE A;  3GTM H;  3Q8D A;  3PO2 G;  4JI4 L;  1HNW Q;  2UXD Q;  5C4X G;  3I4M H;  4X65 Q;  4DR6 L;  1L1O A;  3RLO A;  4DK6 C;  3F2D A;  1E3P A;  5ELN A;  3A74 A;  1XMO L;  4A3G G;  3ULJ A;  2K50 A;  1WCM H;  5HGQ A;  4GOP C;  1NMF A;  2JA6 G;  1Y14 B;  3B6Y A;  1B7Y B;  2JA5 G;  3PUZ A;  4C3I H;  2VQE Q;  2ZTE A;  1NJI C;  2E2H H;  2YTY A;  1SRO A;  3UE0 A;  1QUQ A;  3I56 A;  5IYD H;  1A63 A;  1HZA A;  5IWA L;  5AJ3 Q;  4JI7 Q;  3K7U C;  1SMX A;  1TWC H;  3EN2 A;  1VQD A;  1KIX A;  1FGU A;  4C2M H;  3KLW A;  4BY7 H;  3FHW A;  5AJ3 L;  4FDB A;  5FLX c;  4GLX A;  3S16 H;  1JJ2 A;  4A3M G;  2JA9 A;  4PG3 A;  2CQO A;  4YHH L;  4BY7 G;  1HZ9 A;  2Q2U A;  2K52 A;  4AYB G;  4DR3 Q;  2UUA Q;  4LNQ A;  1WOC A;  1VQ4 A;  3CW2 C;  4IFD I;  1MJC A;  3L7Z C;  5EAY A;  4LFA Q;  3TRE A;  2N8N A;  3CCS A;  1I94 Q;  3CCL A;  2H5X A;  3PO3 G;  4RMF A;  1SRU A;  3J80 i;  3HOW G;  4J15 A;  3OW2 A;  1LM0 A;  3PUY A;  4A3B H;  1GKH A;  2N49 A;  5JEA G;  4A3E G;  2E2J H;  1VQ8 A;  5JJI A;  1R9T H;  4KLK A;  5FLM H;  4JOI A;  2LXJ A;  1PA6 A;  2RCN A;  1IZ6 A;  1L1O B;  1UE5 A;  3AFP A;  2KCM A;  4UP7 A;  3CC7 A;  3S14 H;  1WFQ A;  4APV A;  2F4V Q;  4DV7 Q;  1BBU A;  3E9H A;  5IP9 H;  1HR0 Q;  1VQK A;  3PF4 A;  3PF5 A;  3TQY A;  4YY3 Q;  4X64 Q;  4BBR G;  1VQM A;  3DM3 A;  5J3B A;  5C0X J;  4DV7 L;  4YCW A;  5DLQ E;  3ULP A;  4A3K H;  3HFZ B;  2DGY A;  1A8V A;  4JOI C;  2QA4 A;  4DR1 Q;  2OQ0 A;  1A62 A;  1VQC A;  1VQE A;  2NVQ H;  1QVF A;  3T1Y Q;  3KDF B;  5GAD C;  1LTL A;  1YJ9 A;  1W3S A;  3ICE A;  4O0A A;  5IYC G;  1DGS A;  4JI3 L;  4WJ3 M;  2XGT A;  3M9B A;  1GVP A;  2RHQ B;  2L15 A;  1EWI A;  4JI8 Q;  1T9H A;  5GAE C;  5IYC H;  3J80 c;  3T1Y L;  2AHO B;  1CKM A;  3H15 A;  4JI3 Q;  2ES2 A;  1BVS A;  1PV4 A;  4A3L G;  1K0R A;  4LF4 L;  3HOV H;  4K0K Q;  2MO0 A;  1QVG A;  3STB D;  5IWA Q;  3PUV A;  1VQN A;  3BU2 A;  3G4S A;  2E5L Q;  4BA2 I;  1K8G A;  3FKI G;  1IBK Q;  2IHF A;  3CP0 A;  3GTO H;  1P16 A;  1FJG L;  4JI6 L;  2PQA B;  4Y7N H;  1PH5 A;  1Q1E A;  4YHH Q;  2F4V L;  3H0G G;  1RIP A;  4BBS H;  5H1S E;  2UUC L;  1J5E L;  2R92 H;  4KHP L;  2OTL A;  4A76 A;  2K5V A;  1XMQ Q;  4LF6 Q;  2EIF A;  4BBS G;  3I55 A;  3PUW A;  4NXM L;  4PZ7 A;  1MKH A;  1NTG A;  4IO9 A;  5C4J H;  1HNW L;  3E0E A;  1Y1V G;  4L5R C;  2KHI A;  3SGI A;  1B70 B;  3U4Z A;  5M5X H;  3BZC A;  1WJJ A;  3GTP H;  1VQB A;  2UUA L;  3I2Z A;  2ZJQ A;  1SN8 A;  4DUZ Q;  4EQ5 A;  1JMC A;  4DR4 L;  1Q1B A;  2N3S A;  1OTC A;  4A93 H;  3BJU A;  3KF6 B;  1IBL L;  1JJG A;  3K0X A;  4QGU A;  3RZD H;  4AH6 A;  3EIV A;  5C4X H;  3RR5 A;  3I7F A;  2UXC Q;  2ZTC A;  3CME A;  2R6G A;  1CKN B;  3K7A H;  3A5U A;  4DAY B;  1IBL Q;  2JA6 H;  2K5N A;  1XNR Q;  4X64 L;  2VUM H;  3EBE A;  4ME3 A;  1S72 A;  2VQF Q;  4LW1 A;  2B29 A;  3H3V H;  3PGZ A;  4DR5 L;  1I3Q H;  4QY7 A;  3W5O A;  4DR1 L;  3M7N A;  2MFI A;  3S1R H;  1UE1 A;  2NVY H;  3CCM A;  3AFQ A;  4NXN L;  1XPR A;  3K8A A;  1VQ6 A;  1UE7 A;  2Y0S E;  4O2D A;  4GKK Q;  4AQY Q;  2MQH A;  3I4N H;  4DNI A;  1N8R C;  1N36 Q;  1TWF H;  1XMO Q;  3NEL A;  4MTN A;  3OTO Q;  2KHJ A;  1LYL A;  3JC6 6;  4BXX G;  4B3M L;  1KRS A;  4A3D H;  4R4T A;  1N36 L;  4P74 A;  2VQE L;  4DV6 Q;  4OWT B;  2HT1 A;  3NEN A;  2A8V A;  4JI8 L;  4DPG A;  2PMZ E;  2WB1 G;  3F2C A;  3CCE A;  1EYG A;  1YJW A;  3D31 A;  1FJG Q;  4IPH A;  4JV5 Q;  2UXC L;  2HIX A;  3PIP A;  1QVC A;  4B3S Q;  3K80 C;  2JEB I;  1X9N A;  1L2F A;  1Q12 A;  3GD7 A;  1JJC B;  4MNO A;  2KCT A;  1PYB A;  3HOU H;  3CF5 A;  1YJN A;  1HR0 L;  3TS2 A;  2PI2 E;  2R93 G;  4DR5 Q;  2F52 A;  2DUD A;  3HOU G;  2VS1 A;  1E22 A;  1PH9 A;  1HZB A;  1G6P A;  4DR2 Q;  1PH8 A;  3TS0 A;  1ASY A;  2R93 H;  3K81 C;  5JJK A;  2ZM6 Q;  4OWX B;  4HIK A;  1VQH A;  1X55 A;  3KJO A;  4PMW A;  5IP7 H;  1PYS B;  1YVC A;  1KRT A;  4B3R Q;  4DV3 L;  1K73 C;  4BBR H;  2VW9 A;  1UE6 A;  4B3M Q;  4AYB E;  4OX9 L;  1VQ9 A;  4LF9 Q;  2VY3 A;  2JA8 H;  3RNU A;  1SE8 A;  5M3M H;  2V1C C;  1TXY A;  2Z6K C;  2GN5 A;  1EOV A;  4H02 A;  4OX9 Q;  2VNU D;  2ID0 A;  4A3J H;  4X66 Q;  1AE3 A;  1VQG A;  4JV5 L;  2E5L L;  3CCU A;  3NEM A;  1E1O A;  1XPU A;  1PH1 A;  3FKI H;  1K9M C;  4DV2 L;  2R7F A;  4IJL A;  2LXK A;  4X66 L;  2K4K A;  3W1B A;  2HHH Q;  4L5Q A;  3W1G A;  5M5W H;  4JBM A;  1YHA A;  2D0O A;  4A4I A;  2Q2T A;  1N34 Q;  5BR8 L;  5IY0 A;  3IRB A;  2JE6 I;  2OWO A;  3F2B A;  4JI0 L;  2R92 G;  1TWA H;  4HID A;  4DAM A;  3U58 A;  4QQB X;  4DV1 L;  4GNX A;  3RN2 A;  1PVO A;  4OON A;  5E7N A;  1E7Z A;  1PH3 A;  4OXP A;  1N9W A;  4HJ5 A;  4GKK L;  4JI1 L;  5LMN Q;  1HNZ Q;  1Y1V H;  4LF4 Q;  4IOA A;  2JK8 A;  2PI2 A;  2NVX H;  4IFD G;  3MEF A;  1Q7Y C;  1Z47 A;  1LUZ A;  4GOP A;  5C3E G;  3PO2 H;  5GQO A;  3M4P A;  1IBK L;  2BH8 A;  4B3S L;  2VZA A;  4QIW E;  1KC8 C;  1XPO A;  2R7D A;  4UP9 A;  4XIG S;  3HOY H;  1X65 A;  4GKJ L;  3HOZ G;  4GN4 B;  4NB3 A;  3KDF A;  1SFO H;  1WYD A;  4UPA A;  4R4C A;  2IX1 A;  3S17 H;  3HOZ H;  5GAG C;  3G71 A;  3A0J A;  1X56 A;  3CPW A;  2JA5 H;  3CC4 A;  3S2D H;  3ULL A;  2UUB L;  3M4O H;  4TVA B;  1WI5 A;  5K36 G;  4YWK A;  2CCZ A;  4X62 Q;  4DV4 L;  1PFS A;  1N34 L;  2KBN A;  2XTI A;  4DV0 Q;  3UE1 A;  2ZJP A;  1S40 A;  4POG A;  4POF A;  1WCM G;  2AKW B;  2AWN A;  1ASZ A;  4LFC Q;  1BBW A;  1SR3 A;  4DV1 Q;  4DV4 Q;  4JI4 Q;  1X3G A;  3AEV A;  1N32 L;  2WP8 J;  1CSP A;  2AMC B;  1RL2 A;  5IYD G;  2JEA I;  1P8L A;  1Q86 C;  1EFW A;  3M85 A;  4IOC A;  2I5M X;  3GDE A;  1QZG A;  4B3R L;  3GTJ H;  4NPS A;  1KL9 A;  4GN5 A;  4LUO A;  1N32 Q;  1X3F A;  1U5K A;  3I4N G;  3RLN A;  3LGJ A;  2B63 H;  4HIO A;  2NN6 I;  1G51 A;  4A3M H;  4LF5 L;  4OO1 I;  2B3G A;  1QZH A;  5C44 G;  3J81 c;  3CCV A;  1Y1W G;  2B63 G;  4B3T Q;  4RG1 A;  1K8A C;  4ALP A;  5C44 H;  3UDX A;  1CKO A;  3F8T A;  4LFB L;  1VQL A;  1VQF A;  4X6A H;  4KHP Q;  1OXV A;  1GD7 A;  4X62 L;  3GTQ H;  4YWL A;  4A3C G;  1Q46 A;  2D62 A;  3RLF A;  1XJV A;  4WJ4 A;  4DR2 L;  4P75 A;  2RF4 A;  4LUV A;  5IP9 G;  3F1Z A;  1PHJ A;  4A3E H;  3T1H Q;  1HNX L;  1IYJ B;  2C35 B;  3CQZ H;  2WAQ E;  1E1T A;  5FLM G;  1K3R A;  4DR7 Q;  3GO5 A;  1JT8 A;  1D8L A;  4TQU S;  3I4O A;  3H3V I;  1HZC A;  1IXR A;  4A3K G;  3CMA A;  4GOP B;  3S2H H;  4DV5 L;  1N33 Q;  1SLJ A;  3CPF A;  1A0I A;  2JA7 G;  3GTL H;  1K83 H;  5C0X G;  3FP9 A;  1Q81 C;  3PV0 A;  1Q82 C;  1V9P A;  3J7Z C;  1E24 A;  1NE3 A;  1Q8K A;  4JI6 Q;  2BH2 A;  2I0Q A;  1XNQ L;  3HKS A;  2WB1 E;  3J7A 5;  2HQL A;  2R7Z H;  2Y0S G;  4GNX C;  4A3L H;  1M1K C;  1X3E A;  4IPG A;  3S24 A;  3ER0 A;  4IPD A;  4MZ9 A;  5M3M G;  1J5E Q;  1KHI A;  2NVT H;  3KFU A;  3CAM A;  2NN6 G;  4JBJ A;  1YIJ A;  4HJ8 A;  5IE8 A;  2BA1 A;  1KAW A;  3GTG H;  2Q2H A;  2OTJ A;  1NMG A;  3GTK H;  1NBW A;  1I5F A;  3HOX H;  4DUY L;  3G48 A;  1G29 1;  3HOV G;  1OXT A;  1I50 H;  2MO1 A;  4AQY L;  4DV0 L;  3H0G H;  1OXX K;  1FVI A;  4KHZ A;  4R1J A;  3CCJ A;  5FJ8 H;  3OTO L;  3CD6 A;  2Z6K A;  2E8G A;  3A5Z B;  5JEA J;  1PH4 A;  4UY8 C;  5LMN W;  1UWV A;  4DR6 Q;  2E2I H;  4GS3 A;  5FJ8 G;  1VS0 A;  4A3I G;  2OQK A;  4IPC A;  2JQO A;  1EIY B;  1IL2 A;  4HIM A;  3J81 i;  4DV2 Q;  4A3I H;  4XTC S;  1L1O C;  3S1Q H;  4LFB Q;  4BY1 G;  2VQF L;  2Z0S A;  4HJ9 A;  2KEN A;  4JC0 A;  4YY3 L;  4LF5 Q;  3UDI A;  1XNQ Q;  1IBM Q;  1CSQ A;  1U0L A;  1HR0 W;  3NBH B;  2UU9 Q;  1M90 C;  1KD1 C;  4DUZ L;  4P72 A;  5HY6 A;  2QGQ A;  2IHE A;  1CKN A;  3D0F A;  3KF6 A;  4GLA C;  5IYB H;  3ZJY C;  3T1H L;  1HNX Q;  2WAQ G;  4A3G H;  5GAH C;  5M3F H;  3L2P A;  3I4M G;  4A93 G;  2UXB Q;  1AH9 A;  3AQQ A;  4OO1 G;  1TWH H;  2ZM6 L;  3HKZ E;  5IYB G;  4LFC L;  5M3F G;  3BZK A;  3M4Q A;  2UXB L;  3TEH B;  3WWV A;  4L5S A;  1AE2 A;  1TWG H;  4DR3 L;  2VUM G;  1YZ6 A;  4IFD J;  4DR4 Q;  2CWP A;  3OYY A;  4GKJ Q;  4LF9 L;  4YCV A;  1I6H H;  3CXC A;  3TRZ A;  1W2B A;  1C9O A;  1H95 A;  2IY5 B;  4GNX B;  3G6E A;  3KJP A;  4AIM A;  3VDY A;  1XNR L;  2YU9 H;  5LMU Q;  1S3O A;  3L0O A;  1Y1W H;  3KOJ A;  3PIO A;  4B3T L;  4LF7 L;  4C3J H;  2ATW A;  4LF8 Q;  1D7Q A;  3UDF A;  1GO3 E;  2UUC Q;  1PH7 A;  3M3Y H;  4YWM A;  4Y52 H;  4BXX H;  1XMQ L;  4DUY Q;  2CWA A;  4A3D G;  3U4V A;  2YTV A;  4LF7 Q;  1Z9F A;  2IT1 A;  4JBW A;  4R4I A;  4KI0 A;  2EXD A;  3E9I A;  2UU9 L;  4LF8 L;  4LWC A;  3CCR A;  2PNH A;  4JI0 Q;  1J6Q A;  4A3B G;  2AWO A;  1I94 L;  4A3C H;  1QUQ B;  2K75 A;  4JYA Q;  3JAM i;  2I5H A;  1OXS C;  1UEB A;  5C0X I;  3PO3 H;  3S1N H;  1O7I A;  2GVB A;  4GLV B;  3HOW H;  2D0P A;  4JG2 A;  2A1A A;  2UXD L;  4JI1 Q;  5IT9 c;  5LMN L;  1HNZ L;  5JJL A;  2YTX A;  2CKZ B;  3CCQ A;  1XTD A;  4JI5 L;  4PZ8 A;  4C3H H;  1JE5 A;  4HJA A;  1VCI A;  3PUX A;  1OXU A;  1X6O A;  1BKB A;  4JI5 Q;  5IP7 G;  3S1M H;  1YHQ A;  3S15 H;  1HH2 P;  2LSS A;  3J81 j;  3UDG A;  1IBM L;  4K0K L;  2BA0 A;  2I5L X;  3STB C;  1C7Y A;  2JA8 G;  1B8A A;  1CUK A;  1YBY A;  2HHH L;  1JB7 A;  3PSI A;  1KXL A;  1EQR A;  5LMU L;  2EQS A;  4A3F G;  3PCO B;  2PQA A;  2JA7 H;  4NXN Q;  1MIU A;  4GN3 B;  4DKA C;  4JI7 L;  4HJ7 A;  4A3J G;  3HKZ G;  3JAM c;  4A3F H;  1PH2 A;  2Q2I A;  2QEX A;  2K14 A;  4JBK A;  4LFA L;  4DR7 L;  1YHB A;  4PZ6 A;  1MJE A;  4JCV E;  4R4O A;  2MNA A;  1PH6 A;  4R4Q A;  2ZTD A;  2K5H A;  4QJF A;  2F3I A;  4A75 A;  1VQJ A;  1EQQ A;  1L0W A;  2R7Z G;  1VQ7 A;  4DV5 Q;  4LF6 L;  4YCU A;  3KF8 B;  2JJQ A;  1N33 L;  1YNX A;  1KQS A;  1C0A A;  1EUJ A;  2NZH A;  2YYZ A;  1YEZ A;  4DV3 Q;  4DV6 L;  2N78 A;  2FXQ A;  1VQA A;  1NY4 A;  2CFM A;  3MXN B;  2A19 A;  2YV5 A;  1VQI A;  3KYH C;  2ALY B;  4P73 A;  4OWW B;  3HOX G;  1GM5 A;  4QL5 A;  1V43 A; 
#chains in the Genus database with same CATH topology
 2BDN A;  1A6X A;  3MXU A;  3ERS X;  2DN8 A;  1X54 A;  3NUC A;  5IOC A;  2WAQ B;  1BQQ T;  4LUZ A;  2HIV A;  4JYA L;  1II3 A;  4IJH A;  3V96 A;  3S17 B;  4JI2 Q;  2RHS B;  4HAE A;  2OCE A;  5C4X G;  3Q8D A;  2UXD Q;  4X65 Q;  4IZ8 A;  4DR6 L;  1W6J A;  2F0J A;  1B53 A;  1EYA A;  1E3P A;  1QCB D;  4GOP C;  3B6Y A;  3OIP A;  3H0G B;  2ZTE A;  2E2H H;  3T53 B;  4LK1 C;  3UE0 A;  5IWA L;  1RF2 D;  1SMX A;  1TWC H;  1IW7 D;  1OO9 B;  1DOM A;  1G8Z D;  5FLX c;  3S16 H;  4A3M G;  4PG3 A;  1SBB B;  1HZ9 A;  2JN4 A;  5JPM C;  4LNQ A;  3MA2 B;  3L7Z C;  5EAY A;  4A3I B;  1KTK A;  2N8N A;  1X3P A;  3AMU A;  3UI2 A;  5COY A;  3GTJ B;  5I2X A;  4RMF A;  1HXY D;  2RQX A;  4DK1 A;  1CT1 D;  5KRU A;  1GKH A;  1HTL D;  5ELB A;  5I9O A;  4A3E G;  3SVM A;  1VQ8 A;  1HUM A;  1EQV A;  1EZ6 A;  1IW7 C;  4NMZ A;  1L1O B;  1UE5 A;  2KCM A;  4APV A;  2F4V Q;  1BBU A;  2PPB C;  4YY3 Q;  1LT3 D;  3QWN A;  1SFO B;  2F3V A;  4A3K H;  2DGY A;  4JOI C;  3A7A B;  2A6E C;  2QA4 A;  3I70 A;  1VQC A;  1VQE A;  2NVQ H;  1QVF A;  3T1Y Q;  1LTL A;  1DGS A;  2B63 B;  4WJ3 M;  3M9B A;  5C0X H;  3P1H A;  1STN A;  5IYC H;  2NVX B;  1K8M A;  1EYD A;  4LF4 L;  3STB D;  5IWA Q;  1VQN A;  3BU2 A;  5L37 A;  4A3E B;  2K7V A;  1CZG A;  3CKI B;  2X6G A;  2IHF A;  4OEM B;  3GTO H;  4JI6 L;  4ILW A;  1DD2 A;  4Y7N H;  3QG1 A;  2WII B;  3H0G G;  1XTC D;  2EYL A;  4BBS H;  1LTR D;  2UUC L;  1Y1W B;  5EBC A;  2VB2 X;  3OW7 A;  2EIF A;  5C5M A;  4PZ7 A;  1MKH A;  1NTG A;  5JPN C;  3S15 B;  3D4W A;  2E2J B;  1B70 B;  3GTP H;  1VQB A;  2EJG C;  5FO9 B;  1SN8 A;  4LMQ D;  4EQ5 A;  4DR4 L;  4A93 H;  2OEO A;  3K0X A;  4N9P A;  4K14 A;  4G7Z C;  4AH6 A;  5C4X H;  3RZD H;  2UXC Q;  4P2C B;  3PO3 B;  4DF7 A;  4X64 L;  4ME3 A;  1I4X A;  4KK7 A;  2VQF Q;  3H3V H;  3PGZ A;  4BY7 B;  4QY7 A;  4DR1 L;  2F0E A;  1F2Y A;  3S1R H;  3BDO A;  2NVY H;  5ELC A;  3BYY B;  5FO7 B;  3CCM A;  4FF1 A;  3FKI B;  2Y0S E;  2DY7 A;  4AQY Q;  1EFI D;  4DNR B;  1XMO Q;  3NEL A;  2B2T A;  1LYL A;  2F0N A;  3FPU B;  4ID6 A;  5M3M B;  1QB5 D;  4MN3 A;  1N36 L;  2WB1 B;  3OSO A;  5EGT A;  1RJT A;  2PW7 A;  3URY A;  2B2W A;  1H9S B;  2HT1 A;  2A8V A;  1TKW B;  4JI8 L;  1H9K A;  3JAM E;  1NUC A;  5IGD A;  1ENA A;  3GTM B;  3K80 C;  2JEB I;  1X9N A;  2PO4 A;  4JVZ A;  4A3K B;  1JJC B;  4MNO A;  3T13 A;  5IOD A;  2F0Q A;  2NUC A;  2F52 A;  2DUD A;  3HOU G;  4BS9 A;  5JJK A;  3K81 C;  3T51 B;  4F88 A;  1X55 A;  3RZD B;  4B3R Q;  4A93 B;  2IL8 A;  1EIG A;  4AYB E;  1VQ9 A;  1PTO H;  2VY3 A;  3TP6 A;  4LF9 Q;  2JA8 H;  3RNU A;  4J8Q A;  2Z6K C;  1E2W A;  1FR3 A;  4H02 A;  4OX9 Q;  2ID0 A;  1I50 B;  1VQG A;  5A2Q E;  5C6A A;  3I4N B;  4JV5 L;  3CCU A;  3GTQ B;  2WKC A;  1PH1 A;  4LAA A;  4CDF C;  2HHH Q;  5M5W H;  2L55 A;  3HP3 A;  1YHA A;  2D0O A;  2Q2T A;  3L9A X;  1N34 Q;  5BR8 L;  5IY0 A;  5D3I B;  2OWO A;  2WAC A;  5CV6 A;  2R92 G;  3MXG A;  3E6Z X;  1TWA H;  5C3W A;  3U58 A;  4PNY A;  1WTQ A;  3NWT A;  3A8I E;  1SEB D;  4HJ5 A;  4JI1 L;  1HNZ Q;  1Y1V H;  2OF1 A;  2PI2 A;  3EJI A;  1CFM A;  2NVX H;  4IFD G;  2TSS A;  3PO2 H;  2Z9H A;  5GQO A;  3M4P A;  1I4G A;  1JWU D;  1VMP A;  1LTA D;  1TVX A;  2R7D A;  1FNW A;  3AU7 A;  3S9W A;  3KDF A;  1EZ8 A;  1SFO H;  1WYD A;  3K5M A;  2F0P A;  3S17 H;  3HOZ H;  5EQ0 A;  5D14 A;  2F0D A;  2IX1 A;  5GAG C;  1QG7 A;  2JA5 H;  1X56 A;  3CPW A;  3S2D H;  2JA7 B;  3ULL A;  2UUB L;  4TVA B;  1WI5 A;  4YWK A;  3HRZ C;  3K0Y A;  2CCZ A;  2KBN A;  2EY5 A;  3UE1 A;  2ZJP A;  1S40 A;  1HCZ A;  1PRT D;  3R2T A;  4DV1 Q;  3GV3 A;  1X3G A;  3KBX A;  3AEV A;  1L0Y B;  2WP8 J;  1CZW A;  3H91 A;  2JEA I;  4WFN 3;  1E2Z A;  1SMY D;  3M85 A;  4IOC A;  4B3R L;  3GDE A;  4S3S A;  3GTJ H;  4NPS A;  4LUO A;  1X3F A;  3BZD B;  3D4D A;  2B3G A;  5JVH 3;  2RVL A;  4XQQ A;  2J7Z A;  4B3T Q;  4RG1 A;  3S16 B;  4QMG A;  3CRK C;  4U67 3;  1C8C A;  1CKO A;  2R92 B;  3F8T A;  4LFB L;  2P5Z X;  1DXM A;  2RA4 A;  3NBH A;  4A3C G;  1Q46 A;  4DR2 L;  1HNX L;  1GHK A;  1IYJ B;  5FLM G;  2WAQ E;  3CQZ H;  4ZRZ A;  2B2U C;  2CH4 A;  2EYM A;  1H9M A;  3E5S A;  4RGM A;  2JXM B;  3J7Z C;  1NE3 A;  2I0Q A;  1G6Z A;  2R7Z H;  1WVL A;  3PIO 3;  3ER0 A;  1PDQ A;  4J6H A;  4DNT B;  3E0J A;  5DAU A;  2Q2H A;  2OTJ A;  3GTK H;  4FVM A;  3HOX H;  1STE A;  3HOV G;  1I50 H;  1PZI D;  5IGE A;  3K6O A;  1VF5 C;  3OTO L;  3A5Z B;  2E8G A;  1PH4 A;  1PTO B;  2JA8 B;  4GS3 A;  1VS0 A;  4ZCK A;  3TP8 A;  5I6Y A;  4L6T B;  4HCE A;  1LTI D;  1EIY B;  1F2M A;  3DXJ C;  4H13 C;  3J81 i;  2ZXP A;  5KNB A;  4G4K A;  4I7A A;  3GTG B;  5J39 A;  2DJG C;  5KND A;  2KEN A;  4JC0 A;  4YY3 L;  1AP0 A;  2BDO A;  1QIL A;  1O7Y A;  3NBH B;  1B3Q A;  5HY6 A;  1EY6 A;  4GLA C;  3T1H L;  1U4R A;  4V0B A;  1TWH H;  3HKZ E;  5IYB G;  2JA6 B;  4LFC L;  3M4Q A;  2B39 A;  5T1I A;  1TWG H;  2Q8I B;  2VUM G;  2D9U A;  4GKJ Q;  2EY6 A;  4C3I G;  1I6H H;  4KY7 A;  2A68 D;  1STG A;  3SR1 A;  3CXC A;  2SNS A;  3TRZ A;  3KK7 A;  5I9P A;  2H4O A;  1ML0 D;  1NSN S;  3R93 A;  5C3E B;  5G3L D;  2YU9 H;  2ATW A;  3KOJ A;  3PIO A;  1D7Q A;  4LF8 Q;  1MD2 D;  1PH7 A;  2A74 C;  3S1R B;  4YWM A;  3M3Y H;  1LT6 D;  4LF7 Q;  2UU9 L;  4KI0 A;  3E9I A;  4ODG A;  5A2Q L;  4ZQ3 A;  4JI0 Q;  4HR7 B;  1J6Q A;  4CDE C;  2WKD A;  3MFG A;  3PO3 H;  4JK1 C;  3Q22 A;  4V19 0;  1O7I A;  1D5Z C;  2GVB A;  1CHQ D;  5C4X B;  1QNK A;  2A1A A;  3NQI A;  3CHB D;  2YTX A;  5DM6 3;  4IUV A;  1XTD A;  4C3H H;  4HJA A;  3SXH A;  3GTP B;  2A69 C;  3K5L A;  1OXU A;  1BKB A;  2CW0 D;  5CV4 A;  2F4I A;  4IUR A;  3S15 H;  2L9H A;  3UDG A;  2BA0 A;  1BO0 A;  3STB C;  3NTK A;  1HPC A;  1B3A A;  1GXD C;  1SE3 A;  3SK8 A;  3ND9 A;  4A3F G;  3PCO B;  1V1P A;  4A3J G;  2MHV A;  3HKZ G;  4Y7N B;  2K14 A;  5I2Y A;  2K5H A;  3TSS A;  1VQJ A;  1EQQ A;  2R7Z G;  5C4Z A;  1VQ7 A;  3A8K E;  2RDH A;  1G91 A;  1YNX A;  1KQS A;  2K05 A;  2NZH A;  1TS2 A;  2Y0S B;  4UHV A;  4QF4 A;  1H9S A;  3KYH C;  4P73 A;  2B8G A;  1KAB A;  3HOX G;  3S1N H;  3NBI A;  3QOL A;  1VQO A;  3U50 C;  3OIQ A;  1VQP A;  5KNC A;  4BA1 I;  1BDO A;  5BN4 A;  1JIC A;  2GVA A;  3CC2 A;  2F0W A;  3HOY G;  2EDG A;  1FL0 A;  4L8J A;  5KEE A;  4KJO A;  3QR8 A;  4JI4 L;  3I4M H;  1I4P A;  1KDC A;  1L1O A;  1LAC A;  3EQL C;  4DK6 C;  1CQV A;  2PZU A;  4CJ2 C;  1WCM H;  5EKL A;  2JA6 G;  1HHV A;  4FXD A;  2YTY A;  3V2T A;  1PFN A;  3HOX B;  3I56 A;  1M4V A;  3GTK B;  2C5C A;  1AZP A;  1PZJ D;  3K7U C;  1WTR A;  3G6J B;  4N9T A;  1TS5 A;  2EYP A;  3FHW A;  4KTA A;  5C5L A;  4GLX A;  2R7Z B;  1SYD A;  3MZ5 A;  3BDC A;  1Y8O B;  4DR3 Q;  2UUA Q;  1WOC A;  4WJ4 A;  1F9Q A;  1MJC A;  3TRE A;  1I94 Q;  1ZEQ X;  2XSC A;  2PNR C;  4G7O C;  2IPK D;  1TY2 A;  4NDX A;  5BN3 A;  2X69 A;  4J1M A;  3PUY A;  1K0S A;  2KEE A;  2N49 A;  5JJI A;  4RKL A;  2B2U A;  5HUR A;  2LXJ A;  2HCC A;  2RCN A;  1IZ6 A;  4UP7 A;  4O1N A;  1TII D;  4DV7 Q;  3E9H A;  3R8B A;  5IP9 H;  3PF4 A;  3PF5 A;  1RCV D;  4FO2 A;  1VQM A;  1SNC A;  3Q0A A;  1ZYR C;  2J0T D;  5C0X J;  4YCW A;  1O78 A;  3BVG A;  5DLQ E;  3NSW A;  3HFZ B;  1STY A;  1UUP A;  2OQ0 A;  1EY4 A;  1W3S A;  3ICE A;  5EKK A;  2XGT A;  1GVP A;  2RHQ B;  2L15 A;  1EWI A;  3CU7 A;  3OMG A;  1U9R A;  2D5D A;  1ZXT A;  2AQ2 B;  5GAE C;  2NB0 A;  2XRQ D;  1CKM A;  5E4X A;  3VR2 A;  3H15 A;  4JI3 Q;  1BOS A;  4XYQ A;  2DNC A;  3PUV A;  3QB3 A;  5E3F A;  4OL7 A;  2E5L Q;  5C4J B;  1K8G A;  1IBK Q;  3VYU A;  1P16 A;  5CV7 A;  2AQ3 B;  3DWA A;  3K57 A;  1PH5 A;  1Q1E A;  1FD7 D;  3U9O A;  1LT5 D;  1EIH A;  2JA5 B;  3SK6 A;  5I4D A;  2OTL A;  4Q5V A;  1VMC A;  4BBS G;  2RKS A;  3MHB A;  5JJZ A;  4NXM L;  3VYS A;  1HNW L;  4L5R C;  3BZC A;  1WJJ A;  2ZJQ A;  4DUZ Q;  5T1G A;  4TRD A;  3BJU A;  3EIV A;  3RR5 A;  2F0G A;  3CME A;  3A5U A;  4DAY B;  3OPO A;  2LFN A;  1TWA B;  3EBE A;  2HUG A;  2L11 A;  2KCN A;  1RTO A;  2B29 A;  4LW1 A;  3OHX C;  3W5O A;  2MFI A;  3HOU B;  3T4A C;  3HZX A;  3AFQ A;  3K8A A;  1VQ6 A;  4KHV A;  4O2D A;  1WTW A;  3C2P A;  3I4N H;  1TWF H;  4Z9C B;  1NR2 A;  3R3O A;  5DNF A;  1BCP D;  2QEJ C;  3NPP A;  1KRS A;  2EJF C;  2X6L A;  4M1U B;  2VQE L;  2PZW A;  4DV6 Q;  4A3D B;  3MXN A;  4CHT B;  2PMZ E;  2WB1 G;  3F2C A;  1XX8 A;  1YJW A;  1FJG Q;  3I4M B;  4IPH A;  4JV5 Q;  5JEA H;  1ESR A;  5IT9 L;  3GD7 A;  3J81 E;  3BS1 A;  2FMC A;  4ZLT F;  5CBA E;  3CF5 A;  1HR0 L;  4CKE A;  2PI2 E;  3X3N A;  4DR5 Q;  2VS1 A;  2XN9 C;  1PH9 A;  4K2K A;  1G6P A;  2ENB A;  4N8F A;  4OWX B;  4HIK A;  1ICF B;  3KJO A;  2A69 D;  2DY8 A;  4F7X A;  1EY8 A;  1Z7T A;  1KRT A;  4DV3 L;  2VW9 A;  2A5H A;  4OX9 L;  1M8A A;  5M3M H;  3TBI B;  1TXY A;  1PTO D;  4OIK A;  1A3V A;  4KY6 A;  4K5X A;  1WTP A;  2FIN B;  4CKB A;  1B2T A;  1SAP A;  1AE3 A;  3M4Y A;  3NEM A;  1E1O A;  3FKI H;  4DXG A;  2LXK A;  2K4K A;  4NP5 A;  3W1G A;  1HRJ A;  1ROD A;  4HMI A;  3F2B A;  3Q23 A;  3RN2 A;  1PVO A;  3CRL C;  4OON A;  5M5Y B;  1N9W A;  2KHS A;  1PTO C;  2PZT A;  3BVZ A;  1EL0 A;  3MEF A;  1Z47 A;  1AN8 A;  4QIW E;  5EPJ A;  1X65 A;  5KYL A;  4GN4 B;  4XT1 B;  1RHP A;  2NZ1 D;  4BBS B;  3QOJ A;  3CC4 A;  3TZD A;  1CHP D;  1IKL A;  4DV0 Q;  1PTO F;  4OO1 H;  3NTI A;  3EA6 A;  4WJW A;  3LWE A;  1JWS D;  3WOF A;  4EVO A;  4OHJ A;  4POF A;  1ASZ A;  4RFB A;  2B2W C;  2JP1 A;  1CSP A;  5E1F A;  1RL2 A;  5IYD G;  1Y8N B;  5J1Z A;  1P8L A;  2DJF C;  2FJ2 A;  4F8M A;  1KL9 A;  1H9R A;  1U5K A;  3I4N G;  1S5D D;  3RLN A;  3LGJ A;  2B63 H;  1R4Q B;  1F9R A;  1TWH B;  4B9W A;  2O5J C;  2NN6 I;  4LF5 L;  3DWP A;  1PFM A;  5C44 G;  1Y1W G;  1FYC A;  1F77 A;  2A6E D;  4ALP A;  1EY7 A;  2GA4 B;  4GZY C;  3RLF A;  2D62 A;  2RF4 A;  4C3I B;  3HOY B;  2C35 B;  3GO5 A;  1D8L A;  4A3K G;  1N33 Q;  1A0I A;  4OIJ A;  1BBX C;  1TT2 A;  3KUP A;  5C0X G;  3J7A F;  4ZUJ A;  4JI6 Q;  4KMU C;  3HKS A;  1XYI A;  2Y0S G;  3ND8 A;  1M1K C;  4RGT A;  5M3M G;  1PRT F;  4IPD A;  3KFU A;  1KHI A;  1BCP F;  2NN6 G;  5IE8 A;  2N88 A;  1NMG A;  1I5F A;  3G48 A;  1G29 1;  4A3J B;  2J4X A;  3H0G H;  1OXX K;  4KHZ A;  1SE4 A;  1EWC A;  5FJ8 H;  2E2I B;  1VDZ A;  5JEA J;  4UY8 C;  2B2T C;  5LMN W;  1UWV A;  1YNN D;  2E2I H;  1IKM A;  1FGB D;  1V1O A;  4A3I G;  2OQK A;  1W6K A;  4X3T A;  4KJN A;  4KKU A;  1ET6 A;  4IUT A;  4UAI A;  1PLF A;  1SYB A;  4HJ9 A;  4LF5 Q;  1IBM Q;  1JQY D;  1U0L A;  1HQM C;  1M90 C;  1BNZ A;  2OT2 A;  4P72 A;  2QGQ A;  2BE5 C;  4K6L A;  3KF6 A;  1ENC A;  5M3F H;  3L2P A;  2A73 B;  1SJH D;  2XVS A;  2QIL A;  3K7A B;  3BZK A;  2UXB L;  1QWY A;  3WWV A;  2KEC A;  4JPB W;  3ONA B;  1LT4 D;  4IFD J;  2CWP A;  1STB A;  1SMY C;  3MVV A;  3G6E A;  3KJP A;  2F0T A;  3L0O A;  5C3X A;  4MIU A;  2B2V C;  3DEP A;  4LF7 L;  1K8O A;  2K28 A;  4R8N A;  4HSV A;  3S2D B;  1U4M A;  4BXX H;  4DUY Q;  1GUN A;  4A3D G;  1A2T A;  4RH6 A;  3CCR A;  1JR0 D;  2K75 A;  4JYA Q;  1UEB A;  1CM9 A;  4GLV B;  2D0P A;  4JG2 A;  1C4Q A;  2UXD L;  4JI1 Q;  1HNZ L;  1HA6 A;  3CCQ A;  2CKZ B;  4PZ8 A;  1JE5 A;  1Y1V B;  3FMC A;  5DEH A;  1VCI A;  2K6A A;  2NTS A;  1YHQ A;  3BYT B;  1EOT A;  4C1N K;  1IBM L;  2O5I C;  4F87 A;  1DYQ A;  4OGQ C;  4NKL A;  2AQ1 B;  4RKB A;  3FPP A;  1CUK A;  1YBY A;  2IW3 A;  1JB7 A;  1C7Y A;  2HHH L;  2JA8 G;  1EQR A;  1EEF D;  2PQA A;  4DGZ A;  2C9O A;  4JI7 L;  3I3C A;  1DZ1 A;  5C44 B;  2Z4H A;  4A3F H;  4LFA L;  2Q2I A;  2CQA A;  2TMP A;  4DR7 L;  1YHB A;  1MJE A;  1D2B A;  1D5X C;  2SOB A;  1PYW D;  4R4Q A;  4QJF A;  2F3I A;  1DCZ A;  1L0W A;  4A3M B;  4DV5 Q;  4LF6 L;  1MBY A;  2JJQ A;  4ZK9 B;  1X32 A;  5FOB B;  4M8A A;  4DV3 Q;  2NN6 H;  4DV6 L;  3W2D A;  4C3H B;  2FXQ A;  3MXN B;  2CFM A;  2YV5 A;  5KYI A;  2RBM A;  4DUZ L;  3F2U A;  1GM5 A;  4P71 A;  2WFW A;  5M5Y H;  1IL8 A;  1EQT A;  2HD3 A;  3RN5 A;  4L5T A;  1YI2 A;  4IFD H;  3VR4 A;  1VQ5 A;  4BY1 H;  1YIT A;  2UUB Q;  3IFT A;  5ELO A;  3M4O B;  3DLL A;  2ZJR A;  1GOZ A;  1QNU A;  2M00 A;  3S14 B;  3GV6 A;  5JOB A;  5C3E H;  3GTM H;  3I91 A;  2CW0 C;  4HN7 A;  3F2D A;  3VA5 A;  5ELN A;  1O80 A;  5EBD A;  3J7A V;  4OEL B;  5HGQ A;  3A7L A;  1NMF A;  1Y14 B;  5NUC A;  1B7Y B;  3JAM L;  3PUZ A;  2VQE Q;  1NJI C;  2NTT A;  1DM0 B;  3DUZ A;  4JI7 Q;  3I73 A;  1ET9 A;  3SDZ A;  2NVY B;  3KLW A;  4BY7 H;  2G9H D;  5AJ3 L;  1JJ2 A;  3VYR A;  4YHH L;  2CQO A;  1B4O A;  1PXU A;  1U4P A;  4AYB G;  3CW2 C;  4LFA Q;  4WRD A;  3CCL A;  3G7L A;  5COR A;  1A3T A;  1PZK D;  3TDQ A;  3HOW G;  3J80 i;  4ZKC B;  4J15 A;  1DOK A;  4R9W A;  1H9J A;  2RSN A;  2E2J H;  4KN7 C;  2F0U A;  4BBR B;  4BWG B;  1R9T H;  5FLM H;  2MPM A;  4JOI A;  1TWF B;  1V8Q A;  2K5W A;  3CC7 A;  1WFQ A;  1VQK A;  1JB3 A;  2R3Z A;  4RA8 A;  4X64 Q;  4BBR G;  4RAU C;  4DV7 L;  3FDT A;  4DR1 Q;  3RUZ A;  2KJX A;  1A62 A;  3KLR A;  3V05 A;  3J80 E;  2JSO A;  3KDF B;  5GAD C;  4JI3 L;  5LHY 1;  2K1B A;  4JI8 Q;  3P7J A;  1T9H A;  4XDX A;  4L63 B;  1BVS A;  1PV4 A;  4A3L G;  1K0R A;  4DAV A;  3HOV H;  1JCK B;  3E3X A;  4BA2 I;  4QCL A;  2NVQ B;  4ME5 A;  3NXW A;  4PMC A;  1UEA B;  1SJE D;  1V1P B;  2PW5 A;  4YHH Q;  1KNE A;  2K5Q A;  2MGS A;  2HDM A;  2R92 H;  1J5E L;  1I3Q B;  2K5V A;  4A76 A;  1Y8P B;  2Z1C A;  3I55 A;  3PUW A;  4H7B A;  3DMU A;  5C4J H;  3C1F A;  5IIF A;  1Y1V G;  3SGI A;  2F0K A;  3HEJ A;  3KLS A;  1IHZ A;  2A68 C;  1JMC A;  3A55 A;  1Q1B A;  1S5E D;  3KF6 B;  1JJG A;  2EYJ A;  1B44 D;  4QGU A;  5K36 H;  2RSO A;  3I7F A;  1CKN B;  3K7A H;  3OWF A;  2LY7 A;  4XQN A;  1IBL Q;  5M3F B;  2VUM H;  2MUY A;  3N52 A;  1GUW A;  3T16 A;  2RCF A;  1B9N A;  4QIW B;  4DR5 L;  1I3Q H;  2L0C A;  1TR5 A;  1TWC B;  4NXN L;  1XPR A;  2B2V A;  1EU4 A;  2MQH A;  4DNI A;  2EPB A;  2BOS A;  2FMM A;  2E2H B;  1XWE A;  4G7H C;  4MTN A;  1CI3 M;  4B3M L;  2BE5 D;  4R4T A;  4P74 A;  3ITP A;  2R61 A;  1SYF A;  4RCO A;  1EYG A;  5DM7 3;  2HIX A;  1NR4 A;  3PIP A;  1QVC A;  1I4Q A;  5IGC A;  4B3S Q;  1L2F A;  1Q12 A;  1IYU A;  3MTS A;  1PYB A;  3OWE B;  1YJN A;  1MSG A;  2PCF B;  5KGU A;  3TS2 A;  2R93 G;  5M5W B;  1FNV A;  1MGS A;  2N55 A;  4DR2 Q;  3TS0 A;  2ZM6 Q;  3S1Q B;  1VQH A;  3QIA A;  4PMW A;  2ZXR A;  5IP7 H;  1AEX A;  1K73 C;  4BBR H;  1UE6 A;  2FHT A;  2QDB A;  2EY1 A;  1SE8 A;  2GN5 A;  3H09 A;  1EOV A;  4KV6 A;  1JC7 A;  1D6E C;  2F0M A;  2I46 A;  5JAV A;  4DV2 L;  1T5X D;  3K5O A;  4RCN A;  4X66 L;  3W1B A;  3IRB A;  4PQX A;  5C4H A;  1YNN C;  4IAL A;  4DAM A;  4QQB X;  3IL8 A;  4HSP A;  5D65 A;  5I6W A;  1E7Z A;  1NAP A;  4OXP A;  1PH3 A;  1K83 B;  2JK8 A;  2MP1 A;  1PRT C;  1JOO A;  4DK0 A;  4DN4 M;  3FVQ A;  1Q7Y C;  4GOP A;  1LV9 A;  4RGO S;  1IBK L;  2BH8 A;  2F0V A;  4B3S L;  1PRT B;  5LL6 S;  1XPO A;  4UP9 A;  4KKT A;  3SHL A;  4QB4 A;  1JWM D;  1ICW A;  3MFY A;  1LTB D;  4R4C A;  4RWS C;  3G71 A;  2NYZ D;  3A0J A;  5K36 G;  3M4O H;  2LMC B;  1PFS A;  1D1K A;  1QOH A;  2HCI A;  2XTI A;  4POG A;  1B9M A;  2EXZ A;  1KNA A;  5IT9 E;  2AWN A;  4LFC Q;  4DV4 Q;  1R9T B;  3MC0 B;  5G3L F;  3BDL A;  1K3B C;  3LX0 A;  3Q24 A;  1Q86 C;  1EFW A;  5CR3 A;  1F2Z A;  3D4R A;  4GN5 A;  1N32 Q;  2E75 C;  1D5M C;  2F1M A;  3U9S A;  4A3M H;  4U68 A;  4OO1 I;  1BR9 A;  3HKZ B;  3CCV A;  4PV1 C;  2B63 G;  1C48 A;  1K8A C;  4B9X A;  2K03 A;  4KD4 A;  4A3F B;  1R4P B;  5C44 H;  3UDX A;  1LTT D;  1GJX A;  4FF2 A;  4X6A H;  1E0B A;  2WIN B;  4IN3 A;  2YU9 B;  4KHP Q;  1OXV A;  4X62 L;  4C1N I;  2SEB D;  4XQJ A;  3GTO B;  5IP9 G;  3F1Z A;  1SXT A;  1PHJ A;  4A3E H;  1AZQ A;  3T1H Q;  3MWY W;  1BCP B;  4DR7 Q;  1E1T A;  1K3R A;  3MEH A;  2E76 C;  2O4X A;  3H3V I;  3CMA A;  4CBV A;  1BCP C;  4DV5 L;  1AW7 A;  3CPF A;  1WTX A;  2JA7 G;  4HED A;  3GTL H;  1Z6H A;  2EZV A;  1K83 H;  1Q90 A;  3PV0 A;  1CQF A;  1TQO A;  1E24 A;  1SYG A;  4HMJ A;  1Q8K A;  2L5T A;  1PFB A;  2V4D A;  2IWH A;  4GNX C;  1NCV A;  1X3E A;  4IPG A;  4MZ9 A;  4I7Z C;  4BY1 B;  2NVT H;  3CAM A;  4HJ8 A;  4CJ1 B;  2KOL A;  3H94 A;  1AFP A;  1KAW A;  4FP5 D;  3GTG H;  1WD1 A;  3NE5 B;  2XWB B;  1OXT A;  2MO1 A;  5ELE A;  1WTV A;  2CHB D;  1FVI A;  1FNU A;  1QJO A;  3CCJ A;  1Q3L A;  3CD6 A;  2BCO A;  2Z6K A;  4I65 A;  3OOC A;  4DR6 Q;  1NNX A;  5FJ8 G;  4FXK C;  1E2V A;  2F0H A;  5D3D A;  1K28 A;  1SDF A;  1STH A;  2EVB A;  1IL2 A;  1LAB A;  2XIW A;  4A3I H;  3S1Q H;  4LFB Q;  2PYK A;  1EY5 A;  2ZT9 C;  1XNQ Q;  3UDI A;  3DEO A;  1CSQ A;  4R8I A;  1KD1 C;  3D6W A;  1TS4 A;  1CKN A;  3D0F A;  1JE4 A;  4YIJ A;  1HNX Q;  3ZJY C;  4A3G H;  2WAQ G;  4A93 G;  2UXB Q;  1UAP A;  3I4M G;  2PMZ B;  1X3Q A;  1RKN A;  3HS0 C;  1HFG A;  3A56 A;  5CYU A;  5M3F G;  5HGT A;  4L5S A;  1AE2 A;  2SDF A;  4DR4 Q;  3OYY A;  4YCV A;  3IFD A;  1W2B A;  2IY5 B;  4C3J G;  4IUN A;  4IUP A;  5LMU Q;  4B3T L;  2KVM A;  3DHQ A;  2UUC Q;  1RD9 D;  2F0O A;  1KLU D;  2IT1 A;  4R4I A;  2EXD A;  2PNH A;  4ULL A;  4A3B G;  1I94 L;  1ILQ A;  4EQP A;  4A3C H;  2I5H A;  4K5V A;  2KED A;  1OXS C;  5C0X I;  2F0I A;  4FXG C;  3C3L A;  1BXT A;  3M7G A;  5LMN L;  2D2C C;  2HDL A;  2F0F A;  5JJL A;  3FRP B;  1EY0 A;  1GUO A;  4CKC A;  1X6O A;  4ZAI A;  4CGY B;  4JI5 Q;  1CTM A;  3J81 j;  2LSS A;  2ICE C;  1B8A A;  1KXL A;  3PSI A;  2WV6 D;  1I4H A;  1MI2 A;  1Q8I A;  4DXF A;  2JA7 H;  4NXN Q;  1MIU A;  4DKA C;  3K58 A;  4HJ7 A;  3HOZ B;  3JAM c;  2QEX A;  1SNQ A;  4QUF A;  2ZTD A;  4A75 A;  1N33 L;  3KF8 B;  1I4R A;  2A6H C;  3TME A;  1B50 A;  4K5W A;  2N78 A;  2K01 A;  1VQA A;  1SNO A;  2A19 A;  3AB9 A;  2ALY B;  4QL5 A;  5IGF A;  3HOW B;  2IX0 A;  1EIF A;  1V1Q A;  1S5C D;  3HGB A;  1HJP A;  2NZO A;  4K8I A;  2ASB A;  4DK3 C;  2VL6 A;  4DFA A;  4A3G B;  4AYB B;  4UP8 A;  4EX5 A;  5FKA C;  1A3U A;  4JI2 L;  3A8J E;  2IJ0 A;  5EPL A;  2EOT A;  2E74 C;  5BR8 Q;  4C3J B;  4X65 L;  4NXM Q;  5CV9 A;  2K5D A;  3AYH B;  5GRO A;  3RZO H;  3PO2 G;  1HNW Q;  4FF4 A;  1O7Z A;  3WOE A;  3RLO A;  3K59 A;  3SK5 A;  4ABN A;  4E6I A;  3A74 A;  1XMO L;  4A3G G;  4K6D A;  3N6R A;  3SE0 A;  3ULJ A;  2K50 A;  1MSH A;  1ZKO A;  2JA5 G;  3KLS X;  4C3I H;  5ELD A;  1XXG A;  1SRO A;  1BUV T;  5IYD H;  1QUQ A;  3EFX D;  1A63 A;  1HZA A;  4FYD A;  5AJ3 Q;  1A2U A;  3EN2 A;  1VQD A;  2L4N A;  1KIX A;  1FGU A;  2NVT B;  1EYC A;  4C2M H;  4FDB A;  1SNP A;  3ERO A;  2JA9 A;  2Z6B A;  5TSS A;  1DJR D;  4BY7 G;  2Q2U A;  1SND A;  2I07 B;  1IYV A;  2K52 A;  4X3S A;  1VQ4 A;  4IFD I;  3CCS A;  2G9D A;  3S1N B;  1RTN A;  3GTL B;  2H5X A;  3PO3 G;  1SRU A;  3TZU A;  3DWQ A;  3X3M A;  3OW2 A;  1LM0 A;  2EYH A;  4A3B H;  5JEA G;  4KLK A;  3TP7 A;  3I90 A;  1PA6 A;  3PQI A;  2H1E A;  3AFP A;  3S14 H;  4QUC A;  1HR0 Q;  3TQY A;  3DM3 A;  2L12 A;  5J3B A;  3PMF A;  3ULP A;  4Q0F A;  1DOL A;  1A8V A;  3L3O C;  1YJ9 A;  4HCS A;  4MTK A;  4O0A A;  2L1B A;  5IYC G;  4KD3 A;  1BF4 A;  5CC4 A;  2HQE A;  1EWH A;  3J80 c;  1J9O A;  3T1Y L;  3NK9 A;  2AHO B;  5BN5 A;  3S2H B;  2ES2 A;  2K32 A;  1S5F D;  5EKI A;  4K0K Q;  2EY2 A;  2MO0 A;  1QVG A;  1Y69 U;  3C1E A;  3MXP A;  5FLX E;  3G4S A;  5J22 A;  3FKI G;  3CP0 A;  4EGV A;  1CK1 A;  1FJG L;  2PQA B;  1T5E A;  2F4V L;  2EE1 A;  4DAP A;  3M3Y B;  1RIP A;  2SNM A;  3BG3 A;  5ELF A;  2Q8T A;  5H1S E;  4KHP L;  1XMQ Q;  4LF6 Q;  2XNA C;  1GHJ A;  4DAY A;  4O42 A;  3SK4 A;  4IO9 A;  4X3U A;  3E0E A;  3VR5 A;  2KHI A;  3U4Z A;  5M5X H;  3NTH A;  2EYO A;  3D6C A;  1STA A;  3K5N A;  4G57 A;  2UUA L;  3I2Z A;  1DON A;  1OTC A;  2N3S A;  1IBL L;  1GUG A;  5A35 A;  3C46 A;  1QE6 A;  1JOR A;  1GUS A;  2ZTC A;  2R6G A;  3Q6S A;  2JA6 H;  2XRS D;  5CBE E;  2K5N A;  1XNR Q;  2JYO A;  1S72 A;  1KLG D;  3M7N A;  2KA7 A;  1UE1 A;  2B2Y C;  1UE7 A;  4GKK Q;  3D8G A;  4KKS A;  1N8R C;  2ZXO A;  1N36 Q;  1EU3 A;  3P20 A;  4NW2 A;  3OTO Q;  2KHJ A;  1LTS D;  1TY0 A;  3JC6 6;  4BXX G;  4A3D H;  1WD0 A;  1HUN A;  1S4Z A;  2VB3 X;  4OWT B;  3GP7 A;  3NEN A;  4XT3 B;  4ZYS A;  4DPG A;  5IGB A;  3CCE A;  2KCC A;  1HA5 A;  3D31 A;  4FNF A;  2VXW A;  2UXC L;  1B1Z A;  1HTP A;  2KCT A;  3D3R A;  3HOU H;  3HG9 A;  4C56 C;  1F2L A;  1E22 A;  2KUM A;  4RHR A;  1HZB A;  1O7L A;  4TSS A;  3T56 B;  3MAQ A;  1PH8 A;  1ASY A;  1G2S A;  2R93 H;  2K04 A;  4DU9 A;  1PYS B;  1YVC A;  4B3M Q;  4B08 A;  1S5B D;  5CGK A;  4MHE A;  2V1C C;  1LLR D;  3CQZ B;  4X3K A;  2VNU D;  2A6H D;  4A3J H;  4X66 Q;  5FK9 C;  3KF8 A;  2E5L L;  2RDF A;  2O2L D;  3RMH A;  1XPU A;  2R93 B;  1K9M C;  2R7F A;  4IJL A;  2F3W A;  5CV5 A;  2IX3 A;  4L5Q A;  3P75 A;  4JBM A;  4N8X 1;  4A4I A;  1U4L A;  2RDG A;  2JE6 I;  4FF3 A;  3J81 L;  4JI0 L;  3VR6 A;  1CA6 A;  2VUM B;  4HID A;  4DV1 L;  4GNX A;  5E7N A;  3DM1 A;  2F03 A;  2Z8L A;  5EJW A;  4TKO B;  5LMN Q;  4GKK L;  4LF4 Q;  4IOA A;  3I72 A;  2LKV A;  1LUZ A;  5C3E G;  3EVQ A;  1ILP A;  2AUK A;  5LL6 X;  2VZA A;  3A54 A;  4WOR A;  1KC8 C;  4XIG S;  2CVR A;  4RHS A;  3SEB A;  1WTO A;  2M2L A;  3HOY H;  4GKJ L;  3HOZ G;  4NB3 A;  2NWG A;  1ESF A;  3ERQ A;  1KAA A;  4UPA A;  1JOQ A;  1GUT A;  5K5P A;  5CMD A;  4X62 Q;  4DV4 L;  1JOK A;  1N34 L;  3H6M A;  1UNS A;  1WCM G;  2AKW B;  1BBW A;  1SR3 A;  2QCP X;  4JI4 Q;  1YNJ C;  3S1M B;  1RDP D;  3HOV B;  1N32 L;  2AMC B;  3PO2 B;  2I5M X;  1QZG A;  3NHH A;  4IUQ A;  1EY9 A;  5M5X B;  4HIO A;  3VR3 A;  1G51 A;  1QZH A;  3J81 c;  3PIP 3;  5AFW A;  4CJ0 B;  1EEI D;  2QF7 A;  1VQL A;  1VQF A;  4CDD C;  4IQZ A;  3GTQ H;  1GD7 A;  4YWL A;  1LTG D;  1XJV A;  5ISR A;  1A15 A;  4LJZ C;  2XWJ B;  2Q8R E;  4LUV A;  3KBG A;  4P75 A;  2EJM A;  4ZKB B;  3OMC A;  3ZYY X;  1JT8 A;  1WCM B;  4TQU S;  1KDB A;  3I4O A;  3I4L A;  1HZC A;  3LWU A;  1IXR A;  2QKI C;  4GOP B;  3S2H H;  1SLJ A;  3GQB A;  4EQN A;  2ICI A;  4DA2 A;  3IKJ A;  3FP9 A;  2B8F A;  1Q81 C;  2NBF A;  2Z4I A;  1Q82 C;  1V9P A;  2BH2 A;  1XNQ L;  2WB1 E;  3J7A 5;  2HQL A;  3H3V C;  4JW0 A;  3QO2 A;  4A3L H;  1HQR D;  3NQT A;  3S24 A;  1J5E Q;  4JBJ A;  1YIJ A;  1MHW C;  2BA1 A;  5CV8 A;  1ZYR D;  1NBW A;  4DUY L;  2LS0 1;  4AQY L;  4DV0 L;  4PMB A;  4R1J A;  3O13 A;  4A3B B;  2F0S A;  3J7Y W;  1I6H B;  5FO8 B;  5M9O A;  1WTH A;  3W3A A;  1TS3 A;  1YNJ D;  4IPC A;  2JQO A;  1D1I A;  1J8I A;  4HIM A;  4DV2 Q;  1LO5 D;  4XTC S;  1L1O C;  3WDN A;  2E2D C;  2QDL A;  4BY1 G;  4XYO A;  2VQF L;  2Z0S A;  1SYE A;  1SYC A;  2KQ3 A;  1HR0 W;  1F9P A;  4XXE A;  2UU9 Q;  4C2M B;  2IHE A;  5IYB H;  2G5D A;  5GAH C;  1AH9 A;  5F2D A;  3NP8 A;  1ONL A;  2CH4 W;  3AQQ A;  4OO1 G;  2ZM6 L;  3TEH B;  4K2L A;  1VF7 A;  3LNN A;  3I8Z A;  1L0X B;  4DR3 L;  3R2I A;  1YZ6 A;  3RD4 A;  1PMR A;  3VA7 A;  1CA5 A;  4LF9 L;  3QJY A;  2AUJ D;  4CDC C;  1C9O A;  1H95 A;  4GNX B;  4AIM A;  2DNE A;  3VDY A;  1XNR L;  1ENF A;  2K33 A;  3RZO B;  1G2T A;  1S3O A;  4H44 C;  1Y1W H;  1HFN A;  3BVM A;  4C3J H;  3NWS A;  1GO3 E;  1SNM A;  3UDF A;  4Y52 H;  2B2Y A;  1XMQ L;  2CWA A;  3U4V A;  2YTV A;  3IAY A;  1Z9F A;  4JBW A;  4KY5 A;  4LF8 L;  5E4W C;  4LWC A;  1F9S A;  1SE2 A;  2AWO A;  1QUQ B;  5KIX A;  3JAM i;  4HTH A;  4RGN A;  4EQO A;  1I6V C;  3HOW H;  4C3H G;  5IT9 c;  4ZUI A;  3FEW X;  5JVG 3;  4JI5 L;  1TWG B;  3PUX A;  3S1M H;  2FFK B;  5IP7 G;  2MJ8 A;  1HH2 P;  4K0K L;  2I5L X;  2OXP A;  2F0L A;  5LMU L;  2EQS A;  1TU2 B;  2QW7 A;  4KN4 C;  1KDA A;  4GN3 B;  5EPK A;  3J80 L;  1PH2 A;  4JBK A;  2PQE A;  4PZ6 A;  4JCV E;  4R4O A;  3TN2 A;  4H0L C;  2MNA A;  1PH6 A;  2EYF A;  5FLX L;  2M9V A;  4YCU A;  1C0A A;  3VYT A;  1EUJ A;  2YYZ A;  1YEZ A;  4IUU A;  5IGG A;  1NY4 A;  3TP5 A;  4OWW B;  1VQI A;  4UDU C;  4K8J A;  1SSO A;  1V43 A; 
#chains in the Genus database with same CATH homology
 4P71 A;  2WFW A;  2IX0 A;  1EIF A;  5M5Y H;  1V1Q A;  3RN5 A;  3ERS X;  1HJP A;  1X54 A;  2NZO A;  4L5T A;  1VQO A;  4DK3 C;  1YI2 A;  2ASB A;  2VL6 A;  3U50 C;  1VQ5 A;  4UP8 A;  1VQP A;  4EX5 A;  4BY1 H;  4BA1 I;  1YIT A;  2UUB Q;  4JI2 L;  5ELO A;  3DLL A;  4LUZ A;  2ZJR A;  2GVA A;  2HIV A;  3CC2 A;  4JYA L;  4IJH A;  3HOY G;  5BR8 Q;  1FL0 A;  4X65 L;  4NXM Q;  4JI2 Q;  3AYH B;  5GRO A;  3RZO H;  2RHS B;  5C3E H;  2OCE A;  3GTM H;  3Q8D A;  3PO2 G;  4JI4 L;  1HNW Q;  2UXD Q;  5C4X G;  3I4M H;  4X65 Q;  4DR6 L;  1L1O A;  3RLO A;  4DK6 C;  3F2D A;  1E3P A;  5ELN A;  3A74 A;  1XMO L;  4A3G G;  3ULJ A;  2K50 A;  1WCM H;  5HGQ A;  4GOP C;  1NMF A;  2JA6 G;  1Y14 B;  3B6Y A;  1B7Y B;  2JA5 G;  3PUZ A;  4C3I H;  2VQE Q;  2ZTE A;  1NJI C;  2E2H H;  2YTY A;  1SRO A;  3UE0 A;  1QUQ A;  3I56 A;  5IYD H;  1A63 A;  1HZA A;  5IWA L;  5AJ3 Q;  4JI7 Q;  3K7U C;  1SMX A;  1TWC H;  3EN2 A;  1VQD A;  1KIX A;  1FGU A;  4C2M H;  3KLW A;  4BY7 H;  3FHW A;  5AJ3 L;  4FDB A;  5FLX c;  4GLX A;  3S16 H;  1JJ2 A;  4A3M G;  2JA9 A;  4PG3 A;  2CQO A;  4YHH L;  4BY7 G;  1HZ9 A;  2Q2U A;  2K52 A;  4AYB G;  4DR3 Q;  2UUA Q;  4LNQ A;  1WOC A;  1VQ4 A;  3CW2 C;  4IFD I;  1MJC A;  3L7Z C;  5EAY A;  4LFA Q;  3TRE A;  2N8N A;  3CCS A;  1I94 Q;  3CCL A;  2H5X A;  3PO3 G;  4RMF A;  1SRU A;  3J80 i;  3HOW G;  4J15 A;  3OW2 A;  1LM0 A;  3PUY A;  4A3B H;  1GKH A;  2N49 A;  5JEA G;  4A3E G;  2E2J H;  1VQ8 A;  5JJI A;  1R9T H;  4KLK A;  5FLM H;  4JOI A;  2LXJ A;  1PA6 A;  2RCN A;  1IZ6 A;  1L1O B;  1UE5 A;  3AFP A;  2KCM A;  4UP7 A;  3CC7 A;  3S14 H;  1WFQ A;  4APV A;  2F4V Q;  4DV7 Q;  1BBU A;  3E9H A;  5IP9 H;  1HR0 Q;  1VQK A;  3PF4 A;  3PF5 A;  3TQY A;  4YY3 Q;  4X64 Q;  4BBR G;  1VQM A;  3DM3 A;  5J3B A;  5C0X J;  4DV7 L;  4YCW A;  5DLQ E;  3ULP A;  4A3K H;  3HFZ B;  2DGY A;  1A8V A;  4JOI C;  2QA4 A;  4DR1 Q;  2OQ0 A;  1A62 A;  1VQC A;  1VQE A;  2NVQ H;  1QVF A;  3T1Y Q;  3KDF B;  5GAD C;  1LTL A;  1YJ9 A;  1W3S A;  3ICE A;  4O0A A;  5IYC G;  1DGS A;  4JI3 L;  4WJ3 M;  2XGT A;  3M9B A;  1GVP A;  2RHQ B;  2L15 A;  1EWI A;  4JI8 Q;  1T9H A;  5GAE C;  5IYC H;  3J80 c;  3T1Y L;  2AHO B;  1CKM A;  3H15 A;  4JI3 Q;  2ES2 A;  1BVS A;  1PV4 A;  4A3L G;  1K0R A;  4LF4 L;  3HOV H;  4K0K Q;  2MO0 A;  1QVG A;  3STB D;  5IWA Q;  3PUV A;  1VQN A;  3BU2 A;  3G4S A;  2E5L Q;  4BA2 I;  1K8G A;  3FKI G;  1IBK Q;  2IHF A;  3CP0 A;  3GTO H;  1P16 A;  1FJG L;  4JI6 L;  2PQA B;  4Y7N H;  1PH5 A;  1Q1E A;  4YHH Q;  2F4V L;  3H0G G;  1RIP A;  4BBS H;  5H1S E;  2UUC L;  1J5E L;  2R92 H;  4KHP L;  2OTL A;  4A76 A;  2K5V A;  1XMQ Q;  4LF6 Q;  2EIF A;  4BBS G;  3I55 A;  3PUW A;  4NXM L;  4PZ7 A;  1MKH A;  1NTG A;  4IO9 A;  5C4J H;  1HNW L;  3E0E A;  1Y1V G;  4L5R C;  2KHI A;  3SGI A;  1B70 B;  3U4Z A;  5M5X H;  3BZC A;  1WJJ A;  3GTP H;  1VQB A;  2UUA L;  3I2Z A;  2ZJQ A;  1SN8 A;  4DUZ Q;  4EQ5 A;  1JMC A;  4DR4 L;  1Q1B A;  2N3S A;  1OTC A;  4A93 H;  3BJU A;  3KF6 B;  1IBL L;  1JJG A;  3K0X A;  4QGU A;  3RZD H;  4AH6 A;  3EIV A;  5C4X H;  3RR5 A;  3I7F A;  2UXC Q;  2ZTC A;  3CME A;  2R6G A;  1CKN B;  3K7A H;  3A5U A;  4DAY B;  1IBL Q;  2JA6 H;  2K5N A;  1XNR Q;  4X64 L;  2VUM H;  3EBE A;  4ME3 A;  1S72 A;  2VQF Q;  4LW1 A;  2B29 A;  3H3V H;  3PGZ A;  4DR5 L;  1I3Q H;  4QY7 A;  3W5O A;  4DR1 L;  3M7N A;  2MFI A;  3S1R H;  1UE1 A;  2NVY H;  3CCM A;  3AFQ A;  4NXN L;  1XPR A;  3K8A A;  1VQ6 A;  1UE7 A;  2Y0S E;  4O2D A;  4GKK Q;  4AQY Q;  2MQH A;  3I4N H;  4DNI A;  1N8R C;  1N36 Q;  1TWF H;  1XMO Q;  3NEL A;  4MTN A;  3OTO Q;  2KHJ A;  1LYL A;  3JC6 6;  4BXX G;  4B3M L;  1KRS A;  4A3D H;  4R4T A;  1N36 L;  4P74 A;  2VQE L;  4DV6 Q;  4OWT B;  2HT1 A;  3NEN A;  2A8V A;  4JI8 L;  4DPG A;  2PMZ E;  2WB1 G;  3F2C A;  3CCE A;  1EYG A;  1YJW A;  3D31 A;  1FJG Q;  4IPH A;  4JV5 Q;  2UXC L;  2HIX A;  3PIP A;  1QVC A;  4B3S Q;  3K80 C;  2JEB I;  1X9N A;  1L2F A;  1Q12 A;  3GD7 A;  1JJC B;  4MNO A;  2KCT A;  1PYB A;  3HOU H;  3CF5 A;  1YJN A;  1HR0 L;  3TS2 A;  2PI2 E;  2R93 G;  4DR5 Q;  2F52 A;  2DUD A;  3HOU G;  2VS1 A;  1E22 A;  1PH9 A;  1HZB A;  1G6P A;  4DR2 Q;  1PH8 A;  3TS0 A;  1ASY A;  2R93 H;  3K81 C;  5JJK A;  2ZM6 Q;  4OWX B;  4HIK A;  1VQH A;  1X55 A;  3KJO A;  4PMW A;  5IP7 H;  1PYS B;  1YVC A;  1KRT A;  4B3R Q;  4DV3 L;  1K73 C;  4BBR H;  2VW9 A;  1UE6 A;  4B3M Q;  4AYB E;  4OX9 L;  1VQ9 A;  4LF9 Q;  2VY3 A;  2JA8 H;  3RNU A;  1SE8 A;  5M3M H;  2V1C C;  1TXY A;  2Z6K C;  2GN5 A;  1EOV A;  4H02 A;  4OX9 Q;  2VNU D;  2ID0 A;  4A3J H;  4X66 Q;  1AE3 A;  1VQG A;  4JV5 L;  2E5L L;  3CCU A;  3NEM A;  1E1O A;  1XPU A;  1PH1 A;  3FKI H;  1K9M C;  4DV2 L;  2R7F A;  4IJL A;  2LXK A;  4X66 L;  2K4K A;  3W1B A;  2HHH Q;  4L5Q A;  3W1G A;  5M5W H;  4JBM A;  1YHA A;  2D0O A;  4A4I A;  2Q2T A;  1N34 Q;  5BR8 L;  5IY0 A;  3IRB A;  2JE6 I;  2OWO A;  3F2B A;  4JI0 L;  2R92 G;  1TWA H;  4HID A;  4DAM A;  3U58 A;  4QQB X;  4DV1 L;  4GNX A;  3RN2 A;  1PVO A;  4OON A;  5E7N A;  1E7Z A;  1PH3 A;  4OXP A;  1N9W A;  4HJ5 A;  4GKK L;  4JI1 L;  5LMN Q;  1HNZ Q;  1Y1V H;  4LF4 Q;  4IOA A;  2JK8 A;  2PI2 A;  2NVX H;  4IFD G;  3MEF A;  1Q7Y C;  1Z47 A;  1LUZ A;  4GOP A;  5C3E G;  3PO2 H;  5GQO A;  3M4P A;  1IBK L;  2BH8 A;  4B3S L;  2VZA A;  4QIW E;  1KC8 C;  1XPO A;  2R7D A;  4UP9 A;  4XIG S;  3HOY H;  1X65 A;  4GKJ L;  3HOZ G;  4GN4 B;  4NB3 A;  3KDF A;  1SFO H;  1WYD A;  4UPA A;  4R4C A;  2IX1 A;  3S17 H;  3HOZ H;  5GAG C;  3G71 A;  3A0J A;  1X56 A;  3CPW A;  2JA5 H;  3CC4 A;  3S2D H;  3ULL A;  2UUB L;  3M4O H;  4TVA B;  1WI5 A;  5K36 G;  4YWK A;  2CCZ A;  4X62 Q;  4DV4 L;  1PFS A;  1N34 L;  2KBN A;  2XTI A;  4DV0 Q;  3UE1 A;  2ZJP A;  1S40 A;  4POG A;  4POF A;  1WCM G;  2AKW B;  2AWN A;  1ASZ A;  4LFC Q;  1BBW A;  1SR3 A;  4DV1 Q;  4DV4 Q;  4JI4 Q;  1X3G A;  3AEV A;  1N32 L;  2WP8 J;  1CSP A;  2AMC B;  1RL2 A;  5IYD G;  2JEA I;  1P8L A;  1Q86 C;  1EFW A;  3M85 A;  4IOC A;  2I5M X;  3GDE A;  1QZG A;  4B3R L;  3GTJ H;  4NPS A;  1KL9 A;  4GN5 A;  4LUO A;  1N32 Q;  1X3F A;  1U5K A;  3I4N G;  3RLN A;  3LGJ A;  2B63 H;  4HIO A;  2NN6 I;  1G51 A;  4A3M H;  4LF5 L;  4OO1 I;  2B3G A;  1QZH A;  5C44 G;  3J81 c;  3CCV A;  1Y1W G;  2B63 G;  4B3T Q;  4RG1 A;  1K8A C;  4ALP A;  5C44 H;  3UDX A;  1CKO A;  3F8T A;  4LFB L;  1VQL A;  1VQF A;  4X6A H;  4KHP Q;  1OXV A;  1GD7 A;  4X62 L;  3GTQ H;  4YWL A;  4A3C G;  1Q46 A;  2D62 A;  3RLF A;  1XJV A;  4WJ4 A;  4DR2 L;  4P75 A;  2RF4 A;  4LUV A;  5IP9 G;  3F1Z A;  1PHJ A;  4A3E H;  3T1H Q;  1HNX L;  1IYJ B;  2C35 B;  3CQZ H;  2WAQ E;  1E1T A;  5FLM G;  1K3R A;  4DR7 Q;  3GO5 A;  1JT8 A;  1D8L A;  4TQU S;  3I4O A;  3H3V I;  1HZC A;  1IXR A;  4A3K G;  3CMA A;  4GOP B;  3S2H H;  4DV5 L;  1N33 Q;  1SLJ A;  3CPF A;  1A0I A;  2JA7 G;  3GTL H;  1K83 H;  5C0X G;  3FP9 A;  1Q81 C;  3PV0 A;  1Q82 C;  1V9P A;  3J7Z C;  1E24 A;  1NE3 A;  1Q8K A;  4JI6 Q;  2BH2 A;  2I0Q A;  1XNQ L;  3HKS A;  2WB1 E;  3J7A 5;  2HQL A;  2R7Z H;  2Y0S G;  4GNX C;  4A3L H;  1M1K C;  1X3E A;  4IPG A;  3S24 A;  3ER0 A;  4IPD A;  4MZ9 A;  5M3M G;  1J5E Q;  1KHI A;  2NVT H;  3KFU A;  3CAM A;  2NN6 G;  4JBJ A;  1YIJ A;  4HJ8 A;  5IE8 A;  2BA1 A;  1KAW A;  3GTG H;  2Q2H A;  2OTJ A;  1NMG A;  3GTK H;  1NBW A;  1I5F A;  3HOX H;  4DUY L;  3G48 A;  1G29 1;  3HOV G;  1OXT A;  1I50 H;  2MO1 A;  4AQY L;  4DV0 L;  3H0G H;  1OXX K;  1FVI A;  4KHZ A;  4R1J A;  3CCJ A;  5FJ8 H;  3OTO L;  3CD6 A;  2Z6K A;  2E8G A;  3A5Z B;  5JEA J;  1PH4 A;  4UY8 C;  5LMN W;  1UWV A;  4DR6 Q;  2E2I H;  4GS3 A;  5FJ8 G;  1VS0 A;  4A3I G;  2OQK A;  4IPC A;  2JQO A;  1EIY B;  1IL2 A;  4HIM A;  3J81 i;  4DV2 Q;  4A3I H;  4XTC S;  1L1O C;  3S1Q H;  4LFB Q;  4BY1 G;  2VQF L;  2Z0S A;  4HJ9 A;  2KEN A;  4JC0 A;  4YY3 L;  4LF5 Q;  3UDI A;  1XNQ Q;  1IBM Q;  1CSQ A;  1U0L A;  1HR0 W;  3NBH B;  2UU9 Q;  1M90 C;  1KD1 C;  4DUZ L;  4P72 A;  5HY6 A;  2QGQ A;  2IHE A;  1CKN A;  3D0F A;  3KF6 A;  4GLA C;  5IYB H;  3ZJY C;  3T1H L;  1HNX Q;  2WAQ G;  4A3G H;  5GAH C;  5M3F H;  3L2P A;  3I4M G;  4A93 G;  2UXB Q;  1AH9 A;  3AQQ A;  4OO1 G;  1TWH H;  2ZM6 L;  3HKZ E;  5IYB G;  4LFC L;  5M3F G;  3BZK A;  3M4Q A;  2UXB L;  3TEH B;  3WWV A;  4L5S A;  1AE2 A;  1TWG H;  4DR3 L;  2VUM G;  1YZ6 A;  4IFD J;  4DR4 Q;  2CWP A;  3OYY A;  4GKJ Q;  4LF9 L;  4YCV A;  1I6H H;  3CXC A;  3TRZ A;  1W2B A;  1C9O A;  1H95 A;  2IY5 B;  4GNX B;  3G6E A;  3KJP A;  4AIM A;  3VDY A;  1XNR L;  2YU9 H;  5LMU Q;  1S3O A;  3L0O A;  1Y1W H;  3KOJ A;  3PIO A;  4B3T L;  4LF7 L;  4C3J H;  2ATW A;  4LF8 Q;  1D7Q A;  3UDF A;  1GO3 E;  2UUC Q;  1PH7 A;  3M3Y H;  4YWM A;  4Y52 H;  4BXX H;  1XMQ L;  4DUY Q;  2CWA A;  4A3D G;  3U4V A;  2YTV A;  4LF7 Q;  1Z9F A;  2IT1 A;  4JBW A;  4R4I A;  4KI0 A;  2EXD A;  3E9I A;  2UU9 L;  4LF8 L;  4LWC A;  3CCR A;  2PNH A;  4JI0 Q;  1J6Q A;  4A3B G;  2AWO A;  1I94 L;  4A3C H;  1QUQ B;  2K75 A;  4JYA Q;  3JAM i;  2I5H A;  1OXS C;  1UEB A;  5C0X I;  3PO3 H;  3S1N H;  1O7I A;  2GVB A;  4GLV B;  3HOW H;  2D0P A;  4JG2 A;  2A1A A;  2UXD L;  4JI1 Q;  5IT9 c;  5LMN L;  1HNZ L;  5JJL A;  2YTX A;  2CKZ B;  3CCQ A;  1XTD A;  4JI5 L;  4PZ8 A;  4C3H H;  1JE5 A;  4HJA A;  1VCI A;  3PUX A;  1OXU A;  1X6O A;  1BKB A;  4JI5 Q;  5IP7 G;  3S1M H;  1YHQ A;  3S15 H;  1HH2 P;  2LSS A;  3J81 j;  3UDG A;  1IBM L;  4K0K L;  2BA0 A;  2I5L X;  3STB C;  1C7Y A;  2JA8 G;  1B8A A;  1CUK A;  1YBY A;  2HHH L;  1JB7 A;  3PSI A;  1KXL A;  1EQR A;  5LMU L;  2EQS A;  4A3F G;  3PCO B;  2PQA A;  2JA7 H;  4NXN Q;  1MIU A;  4GN3 B;  4DKA C;  4JI7 L;  4HJ7 A;  4A3J G;  3HKZ G;  3JAM c;  4A3F H;  1PH2 A;  2Q2I A;  2QEX A;  2K14 A;  4JBK A;  4LFA L;  4DR7 L;  1YHB A;  4PZ6 A;  1MJE A;  4JCV E;  4R4O A;  2MNA A;  1PH6 A;  4R4Q A;  2ZTD A;  2K5H A;  4QJF A;  2F3I A;  4A75 A;  1VQJ A;  1EQQ A;  1L0W A;  2R7Z G;  1VQ7 A;  4DV5 Q;  4LF6 L;  4YCU A;  3KF8 B;  2JJQ A;  1N33 L;  1YNX A;  1KQS A;  1C0A A;  1EUJ A;  2NZH A;  2YYZ A;  1YEZ A;  4DV3 Q;  4DV6 L;  2N78 A;  2FXQ A;  1VQA A;  1NY4 A;  2CFM A;  3MXN B;  2A19 A;  2YV5 A;  1VQI A;  3KYH C;  2ALY B;  4P73 A;  4OWW B;  3HOX G;  1GM5 A;  4QL5 A;  1V43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...