5AFWA

Assembly of methylated lsd1 and chd1 drives ar-dependent transcription and translocation
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
174
structure length
163
Chain Sequence
EFETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQYLIKWKGWSHIHNTWETEETLKQQNVRGMKKLDNYKKKDQETKRWYNCQQELTDDLHKQYQIVERIIAHSNQKSAAGYPDYYCKWQGLPYSECSWEDGALISKKFQACIDEYFSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Assembly of Methylated Kdm1A and Chd1 Drives Androgen Receptor-Dependent Transcription and Translocation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords CHROMODOMAIN-HELICASE-DNA-BINDING PROTEIN 1
total genus 49
structure length 163
sequence length 174
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5afwA02
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5afwA01
1RODA 2HDLA 3F2UA 4HAEA 3TN2A 3SVMA 1AP0A 1U4PA 2FJ2A 4U68A 2Q8RE 4UAIA 2KVMA 1ICWA 1JICA 4IUQA 1JE4A 2L9HA 1EOTA 2RSNA 4OIJA 5EKIA 5T1IA 4CJ2C 1AZPA 3DEPA 1CM9A 2MJ8A 2FMMA 1HRJA 3G7LA 3KUPA 4XT3B 2JP1A 1SSOA 4OIKA 1CA5A 4X3KA 3I91A 1QG7A 1DOLA 2Q8TA 2HCCA 4MN3A 4ZLTF 2B2WC 1BF4A 2XIWA 1S4ZA 4IUVA 1HUNA 1PDQA 1LV9A 4DN4M 1HUMA 1O7YA 1GUWA 1E0BA 1F9SA 1RTNA 1DOMA 1ML0D 1B4OA 2X6GA 3I8ZA 5E4XA 2VXWA 3R93A 3ONAB 4QUFA 4ZKBB 2L1BA 1NAPA 1RHPA 4IURA 3N52A 4RAUC 2KECA 1PFNA 4X3UA 2HUGA 1X3QA 2X6LA 4O42A 1HFNA 1PFMA 4HCSA 5EPKA 1WTPA 2K03A 1O80A 2B2UC 1VMPA 5COYA 1WTXA 2NWGA 1TVXA 2B2YA 5CBEE 2B2UA 2IL8A 3UI2A 2FFKB 2L4NA 2B2YC 2DY7A 5EPLA 1F9QA 1VMCA 3GV6A 2RSOA 1WD1A 4HEDA 2B2VC 2B2TC 2M2LA 1EIGA 3GV3A 2R3ZA 4IUTA 2K05A 2RA4A 1J9OA 2SDFA 1M8AA 2MPMA 2N55A 1CA6A 3MWYW 2HDMA 4R8IA 1U4MA 1F9RA 2NYZD 4X3TA 5CMDA 1WD0A 1J8IA 1NR4A 4NW2A 3Q6SA 1G2SA 2EOTA 1MSHA 3IFDA 4RA8A 1HFGA 4XDXA 1HHVA 3MTSA 5EPJA 1NR2A 2DY8A 3KBXA 2B2VA 1U4LA 2NZ1D 2KEEA 2MP1A 2K28A 1BBXC 1MI2A 1RTOA 1U4RA 4R9WA 4CJ1B 1C8CA 3FDTA 3HP3A 5T1GA 3P7JA 1MGSA 2KUMA 4IUPA 2K1BA 3TZDA 2FHTA 1SAPA 1A15A 1B53A 3QO2A 5CORA 5D65A 5AFWA 1B3AA 4HSVA 1DONA 1WTQA 1ILPA 1KNAA 1G2TA 1DOKA 1MSGA 3D6WA 2H1EA 1ZXTA 1O7ZA 2RVLA 1IKLA 3H91A 1Q3LA 2K04A 1HA6A 2X69A 1G6ZA 1ILQA 1WTRA 1SDFA 2B2WA 2B2TA 4ZK9B 1AZQA 1EQTA 4XT1B 1DZ1A 3IL8A 1F2LA 3I90A 2CVRA 5D14A 4IUUA 5E4WC 1B2TA 1QE6A 2J7ZA 4QUCA 2BDNA 1RJTA 2L12A 2L11A 3I3CA 1IKMA 1XX8A 1WVLA 1EL0A 2FINB 1KNEA 3DEOA 1F9PA 3FPUB 3DM1A 4LMQD 1WTOA 4CJ0B 1NCVA 2N88A 1X3PA 4RWSC 1QNKA 2KEDA 2HCIA 1PLFA 3LWEA 4MHEA 5EJWA 4ZAIA 5JJZA 1WTVA 2KOLA 1X32A 1WTWA 5CBAE 1EIHA 5DNFA 1PFBA 4ZKCB 1BNZA 4X3SA 2JYOA 2K01A 2EPBA 1XYIA 1BO0A 1ESRA 2D9UA 2EE1A 1IL8A 1B50A 1G91A 2MGSA 5EQ0A
chains in the Genus database with same CATH superfamily
4IO9A 2SEBD 4YWKA 4Q5VA 1HR0W 1X3FA 1Q46A 3K5NA 2UUCQ 3AU7A 1Y8PB 1SN8A 2BA0A 3NHHA 4A3EG 3DEPA 1QUQB 4G4KA 1EY0A 4KN7C 4KK7A 2YYZA 3AFPA 2A74C 2F0OA 1IBLQ 1Q1EA 5I9OA 2WB1G 4QUFA 1IZ6A 4HIOA 2L1BA 5C4JH 1VQ6A 3BYYB 1P8LA 1X3QA 2X6LA 4JI1Q 2PMZB 4AIMA 3D31A 1WTXA 1BR9A 2CHBD 3S1QH 4R4TA 4NXMQ 4CKEA 1A3TA 3K7UC 1STYA 2I07B 1S5FD 1I6HH 1OXVA 2I46A 3NELA 1TWHB 3U4VA 1DGSA 3K59A 3GTMH 1NBWA 2SDFA 2N55A 4R8IA 5J39A 1I94Q 2V4DA 1S5ED 3RZDB 2E8GA 2A68D 1HFGA 3A55A 1A63A 1Y14B 4LF6Q 2KEEA 1H9RA 1FJGL 5C3EG 1SYGA 3CCVA 4GOPC 3HP3A 3EJIA 4BBRB 3P20A 4GLVB 2YU9H 3EIVA 5D65A 4FP5D 4BBSG 1PVOA 1AN8A 3NWSA 4JV5Q 1QJOA 2UUCL 1HA6A 1FGBD 1ILQA 1EEID 3W1BA 1EFWA 4K5WA 2PQAB 3SHLA 3EA6A 1F2LA 4IUUA 2SNSA 1QE6A 3V05A 1X65A 1X6OA 4LF7L 1IKMA 1XX8A 4XQJA 1F2ZA 1EL0A 2I5MX 1KNEA 3AYHB 4GKKQ 4A3LG 1H9SA 3E9IA 5I6YA 1QNKA 1WTVA 4BY7H 3EBEA 5EBDA 3E9HA 1WTWA 4V190 1EIHA 4DGZA 2E2JH 3I70A 5K5PA 3PF5A 2ZT9C 2JA7G 4NXML 4AQYL 2UU9L 4KMUC 1D7QA 2HDLA 2AHOB 3FKIH 3NK9A 3CCRA 4BWGB 5T1IA 2WB1B 3VYSA 2N49A 3QOJA 4LF9L 3D6CA 2JP1A 1QG7A 3GTPH 4B3RL 1PH4A 1LV9A 1OXXK 2BE5D 4UDUC 4E6IA 4HIKA 5CYUA 4RKBA 4FF2A 2GVBA 3I8ZA 3HRZC 1JWUD 4RMFA 4JV5L 4N9PA 4C2MB 1ET6A 3MXPA 2R7ZG 2EY6A 3FEWX 4NB3A 3S1RH 3F1ZA 1EZ8A 5D3IB 1W6KA 2EYMA 4DXFA 3JAME 3I4OA 4DNTB 2R3ZA 2PCFB 3BZDB 4A3JB 1SXTA 1U4MA 1UE7A 4FO2A 1WD0A 4GKKL 1MJCA 1V1PB 5C44G 5FJ8H 3I72A 4FF1A 5EPJA 1C7YA 2PW7A 3H09A 5IWAQ 4GOPA 2MP1A 2XNAC 2R92H 1C4QA 1A2TA 4R4QA 4EGVA 1RTOA 1YNJC 1CHPD 3CW2C 2CQOA 3VYTA 5DAUA 2UXCQ 4DV1Q 3NP8A 4A93B 4K8JA 2GVAA 1ASYA 1B3AA 5E3FA 4IOAA 4BA2I 3CHBD 1O7ZA 2JA9A 3HKZB 4DV0Q 4LF9Q 3KLRA 1CT1D 2YTVA 5JEAJ 1PFSA 3J7YW 4K2LA 3HOUB 4A3MG 1GD7A 3A8KE 1TWCB 3TS2A 1JT8A 1L1OB 3R2IA 2KQ3A 2OEOA 1YNND 4RHSA 2F0SA 3VR2A 3S2HB 1EOVA 2IX0A 4BXXG 3OMCA 1S40A 1YNJD 5M5XB 3D0FA 2B29A 2ATWA 1VQGA 4GS3A 2HCIA 1NNXA 1ENCA 1Y1VH 3SDZA 3S1NH 4DF7A 5BN3A 4ZKCB 5IGCA 2NUCA 2K01A 4X3SA 1QCBD 5LMNQ 4J1MA 5ELNA 3KF6A 3U58A 5A2QE 3PO3G 1STBA 2KENA 2WP8J 2VZAA 3T1HL 4UAIA 1JR0D 1TS2A 1YNNC 1I6VC 2OTJA 2E5LQ 1VQNA 3W5OA 2WV6D 3T13A 3M4YA 2QDBA 1BF4A 1QVFA 4IUVA 4BBRG 4DN4M 5L37A 1KLGD 1XJVA 3I56A 1QVGA 2NZOA 4JI3Q 3I55A 4DV1L 3CC2A 2MFIA 2KECA 3FKIG 2NVTB 3CMEA 5M5WH 2CWPA 3HS0C 1PH8A 1O80A 1AH9A 4DK6C 3U50C 4B3SL 1ZYRD 4CKCA 2R93B 4NXNQ 3DWQA 3UI2A 4X65L 3J7AV 1JOQA 5GADC 4RH6A 2NN6H 5CV8A 2Q2HA 2M2LA 1OXSC 3C46A 5M3MB 1EYGA 1FJGQ 1D6EC 1CA6A 2XGTA 2A5HA 2PO4A 4K14A 1F9RA 1Z47A 3GTOH 3NXWA 1MSHA 1PRTD 4RA8A 4XDXA 1U4LA 1S5DD 3OTOQ 5LMNL 2XTIA 2D0OA 1A3UA 1L0WA 4HTHA 2VQFQ 3CRLC 2K5QA 5D3DA 1B53A 3QO2A 2VW9A 2F3VA 2QKIC 3RLNA 4DUZQ 3DHQA 3K5MA 4OX9L 1PZJD 2NVQH 1PV4A 3TDQA 3TP7A 1C0AA 4NP5A 5FJ8G 4Y7NB 2RHSB 3RZOB 4XT1B 1X55A 2Z4HA 4LUOA 1VQLA 5LMUQ 4OO1G 2L12A 2L11A 3URYA 4AQYQ 4FDBA 1VQ5A 3S14B 3J81L 1HZBA 1V1OA 1X54A 4K6LA 1LT3D 2AKWB 2E2HH 2VUMB 3TMEA 2F0FA 4JPBW 1SYDA 1IYVA 1JWMD 5CV4A 4DFAA 3R3OA 2JA7H 3S15H 3WOFA 5BR8L 4NXNL 4A3MH 1BCPC 4A75A 1BDOA 3J81j 1LABA 4OEMB 2Z1CA 4XQNA 2KVMA 1ICWA 4S3SA 4Y7NH 3NQIA 1JE4A 1R4QB 2RSNA 1Y8NB 2O4XA 3A54A 2ZJQA 1MBYA 3G7LA 4KHPL 5KNBA 2JA8H 2EYHA 5LL6S 1GXDC 1B9NA 2D62A 2HCCA 3K80C 3BVMA 2RDHA 1MD2D 1VQPA 5H1SE 2ZXOA 3KK7A 4F88A 5IGBA 3CCSA 1RTNA 1K0RA 3PO3H 2G5DA 3GD7A 2RCFA 1YHBA 4H7BA 3V2TA 2VB2X 1PFMA 2JSOA 4ILWA 2VL6A 1Q12A 4QMGA 4R8NA 4OX9Q 1TR5A 1XPOA 3GTGH 4IJLA 5BN5A 3HOYH 1II3A 1Q8IA 1KAAA 4EVOA 3T1YQ 4LWCA 2R7FA 2IWHA 3KOJA 5JJIA 2F1MA 2HT1A 1K83H 1XNQL 3CQZH 3K5OA 3NEMA 2ZTCA 4EX5A 1B3QA 2QEXA 3A8JE 3TBIB 3CC4A 3QR8A 4DXGA 2CKZB 2EJGC 2NVTH 1HHVA 4KJNA 1B8AA 4JBKA 1EWCA 1S3OA 1ZYRC 4I7AA 5C5MA 1STEA 1LTLA 2XWBB 3FDTA 1GKHA 2AMCB 4HIDA 1LT6D 4PZ8A 1J6QA 3ERSX 3QWNA 2A69C 1TWGB 1HZCA 3K0YA 1WCMH 1XPRA 3A74A 5EBCA 4DV5L 4QB4A 1HQRD 4L5QA 1CHQD 2OQ0A 4DV6L 2CFMA 3T56B 2WFWA 4CBVA 5IT9E 4L5TA 1SYEA 4WRDA 3RN2A 1ONLA 5HGTA 5IYCG 3UDXA 1JCKB 3KLSA 1X3PA 2M00A 4ZAIA 3E3XA 4FYDA 3STBD 2BE5C 2MQHA 2ZTDA 2R93G 4CDEC 3HOWB 1PA6A 2EE1A 3NBIA 3UDIA 1IL8A 4AYBB 1QZGA 4R9WA 3HOZB 1LTID 4IPDA 3SVMA 1TWCH 1DJRD 3PSIA 1JB3A 3S17H 2KCMA 1EQVA 3BJUA 1KABA 3ZJYC 1KTKA 1STGA 2R61A 5IY0A 1TU2B 1M90C 2MJ8A 2K14A 5CGKA 4X3KA 3CXCA 1V8QA 3HEJA 4AYBE 4P2CB 3AMUA 2NTSA 2PZTA 1HZ9A 4K5VA 3L2PA 1QWYA 1PRTB 4YWMA 3A7AB 2K5NA 2Y0SB 4IURA 1EU4A 3N52A 1FNVA 1O7LA 4LF8L 1RL2A 2UXBL 1D5ZC 1B1ZA 1KDAA 1D5XC 4YCWA 1V9PA 3D4RA 4KD3A 4JI6Q 1J5EL 3T16A 3M9BA 3TRZA 3D3RA 4X66Q 3CC7A 3A5ZB 4HSPA 4L63B 2VQFL 3MHBA 1JC7A 4P74A 4A3IB 1VCIA 2DNCA 4KJOA 4JI4L 2EY2A 4A3FG 1IW7C 1QUQA 2K50A 3MTSA 2F0QA 2E2DC 2PMZE 4JVZA 5JPNC 1UWVA 3KLWA 2Z0SA 5IGEA 3VR6A 1LT4D 1W2BA 2BA1A 4GLAC 5LHY1 3X3MA 4GZYC 4F87A 3GTPB 3GTJH 3G4SA 1DOKA 1UAPA 5I4DA 1Q86C 2H1EA 4PMCA 3TP5A 5K36H 4KKSA 1SRUA 4FNFA 4PZ6A 1DYQA 1DD2A 3H15A 3HOZH 4OO1H 3AFQA 2Y0SG 3A8IE 3P75A 5CV6A 3EN2A 2JQOA 4CJ0B 3HOYG 1NCVA 4LF4Q 2N88A 3KDFB 1VQKA 2JA5G 1KRTA 5JPMC 1E1TA 4FXDA 5KGUA 1VQIA 1EZ6A 1Y1WB 4KHPQ 4DK1A 1EIYB 1BO0A 2D9UA 1BCPB 5GAGC 4UP7A 5EQ0A 3D8GA 4J6HA 1SEBD 2K4KA 1EIFA 2AQ3B 1PH2A 3FPPA 4F8MA 4NPSA 4A3DG 2A8VA 3L9AX 2AUKA 4L6TB 1CM9A 4B3ML 3HOUG 5KRUA 1RDPD 2OCEA 3MXNA 3OW7A 3HOWG 2KJXA 3IFTA 4POFA 3H0GB 1G291 2NZHA 1F9SA 1WTRA 4A3GH 2E2IB 3M4PA 1I50H 1TXYA 3F2DA 2F0UA 3G6JB 1SNMA 1BXTA 2JEAI 4X3UA 2VQEQ 4O42A 1HH2P 5IE8A 2B63B 2DN8A 1Z7TA 4IQZA 1HPCA 3LWUA 2R7ZH 3I73A 2B2YC 3R2TA 2RSOA 2XWJB 1I6HB 4HEDA 3IAYA 4HMJA 1EIGA 4JYAQ 3GV3A 1LLRD 4RCNA 1STAA 3VR4A 2ICIA 3MC0B 5JEAG 1V1PA 4NW2A 3Q6SA 1FD7D 1KLUD 2K33A 1NR2A 1PRTF 3GO5A 2CW0C 1I5FA 1TIID 1PH3A 1EY6A 2ALYB 2WB1E 3T4AC 3CF5A 5LMNW 1MI2A 1LTGD 1K8AC 3WWVA 1RF2D 2EJFC 4I7ZC 4DV6Q 1DONA 2VUMG 4CDFC 2JA8B 4DAYA 1IKLA 2A6ED 4GN3B 1PH5A 4QCLA 2L5TA 1SDFA 1D1KA 1IW7D 1PYWD 4K6DA 1YITA 2NVYB 3Q24A 3H94A 1GUOA 1BUVT 1PYBA 4NDXA 5IP9G 5JJKA 5KYLA 1PTOB 3MVVA 5LL6X 1MKHA 1NJIC 2N78A 3GQBA 1RIPA 1S5BD 5E1FA 5JJZA 4ULLA 5KNCA 1T9HA 3S14H 1A6XA 2CQAA 3JC66 3HG9A 2RQXA 3CCLA 4A93G 1FVIA 1YNXA 1PH9A 1EFID 3N6RA 1B50A 2MGSA 4AH6A 1K3BC 4RFBA 4QQBX 3RZOH 4DV3Q 1A3VA 1SNPA 1LT5D 3TQYA 1HNXL 3H3VC 3OOCA 5IGGA 3P1HA 3HOVH 2JN4A 1KDCA 4LF5L 4X62Q 4LF8Q 2UXBQ 1WTHA 3OPOA 1IBKQ 4GN4B 4X6AH 5JVH3 2XIWA 5HGQA 3NWTA 1E2ZA 5C0XH 1L1OC 5A35A 5E4XA 1HZAA 2RHQB 4IZ8A 4CHTB 4X66L 4XXEA 3H3VI 1TS3A 4KN4C 4LFBL 5EPKA 1WTPA 4MZ9A 2PYKA 5ELDA 5FO9B 3CCMA 1CTMA 5COYA 1CFMA 5CBEE 1IBLL 2CH4W 3U9SA 5M5YH 4DAVA 2LMCB 2ZM6L 4QF4A 2K5DA 2MPMA 1LYLA 1GM5A 2CH4A 1XNRL 4IFDJ 2LKVA 4QJFA 1NMFA 2F0PA 2F0GA 4QIWE 1YHQA 1UNSA 2Z9HA 2NZ1D 3HOXG 3HOXH 3PIP3 2EZVA 1SBBB 4CJ1B 3U4ZA 4NMZA 4DR1L 5HY6A 4DR3L 3M7GA 3TZDA 1MGSA 2EYFA 3I7FA 2XSCA 3CD6A 2FHTA 4DAPA 2IPKD 4Q0FA 4HSVA 2KHJA 3R8BA 1SNDA 4DR4L 4RGNA 3I4MG 3PMFA 2OQKA 1VQ8A 1BKBA 5FKAC 4UP9A 3KJOA 1JJ2A 4HJ5A 2B63G 2M9VA 4KV6A 4QUCA 2CWAA 4MIUA 1RJTA 4PMBA 3SE0A 5JOBA 3GTLH 4KI0A 2IW3A 4DV7L 1A8VA 4JI2L 1TKWB 1PMRA 4IUNA 2PQAA 3S1NB 1XWEA 2KEDA 2C5CA 4LFBQ 2A73B 5FLXL 5M5XH 4B3MQ 4DA2A 5C0XG 3ZYYX 1UE6A 3C1FA 2F0WA 1G91A 4LF7Q 2HIXA 3KDFA 1KXLA 1PYSB 1RODA 3D4WA 5C44H 2FJ2A 4JBJA 3HOUH 2VB3X 5EKIA 3PCOB 5I6WA 3NE5B 3ERQA 1UUPA 1XNRQ 3KUPA 2VQEL 4OIKA 4EQOA 3DUZA 4JI7Q 4A93H 1TWFH 1VQHA 5ELCA 3UE1A 1O7YA 3WDNA 1E0BA 1B7YB 2X6GA 2R7ZB 4OWTB 2VXWA 3ONAB 3J80i 1N32L 4I65A 1K3RA 1FGUA 1RHPA 2B63H 2HUGA 3RNUA 4JBMA 2XRSD 1Q7YC 2LXJA 1H9MA 1I50B 2Z6KC 4A3GB 1DXMA 2F0TA 2PI2E 2L4NA 3H0GH 3GV6A 4ME5A 3S24A 1IYJB 2B2TC 3Q8DA 4C3JH 3J7A5 4A76A 1SJHD 2K05A 1STNA 5G3LF 4DV7Q 4JI2Q 5CMDA 1B9MA 1LTTD 3QIAA 1R4PB 2EOTA 3IFDA 1GUTA 1I4PA 2LXKA 3KF6B 5J3BA 3KBXA 4C3IG 1VQDA 1N33L 3K5LA 2A6EC 2R92G 2B8FA 1U4RA 2WAQG 3HKZG 1Y1WH 1VQAA 4OXPA 1N34L 2RBMA 1IHZA 4YCVA 2XRQD 1PH7A 5IP7H 2NBFA 3NQTA 4BBSB 2WINB 4KLKA 1CKMA 1U0LA 4JI8Q 1G6ZA 1L1OA 2MO0A 2AQ1B 1PHJA 2SNMA 2WKDA 2EYLA 5C5LA 5EAYA 4K0KQ 1PTOC 2BH8A 4DV4Q 2R7DA 1Q1BA 3B6YA 4A3CG 3FPUB 1I94L 4DV0L 4HN7A 2J0TD 4BBSH 4RWSC 1ENFA 4DV3L 4BY7B 1CSQA 4YCUA 3GTJB 1SNQA 2ZXPA 3OHXC 3CCUA 5KIXA 5DNFA 4R4OA 5JEAH 2JYOA 3M3YB 2KCCA 1IBKL 3Q0AA 3BDLA 2K75A 2DUDA 1WJJA 2F52A 4LNQA 4ZCKA 1ENAA 2MHVA 3IKJA 1G8ZD 1Y1WG 1I4QA 5C0XJ 2BCOA 4A3IH 2ICEC 1Q90A 4JI5L 2XVSA 1N8RC 5JVG3 5CV9A 5ELOA 3J80c 1F2MA 5FLXE 1IYUA 3W2DA 4C3JB 2YU9B 3L7ZC 4KKTA 4A3BG 1KDBA 4G57A 3CKIB 1TWAH 3SXHA 2JJQA 1CKNA 1GUGA 4GNXC 3QOLA 1B44D 3RUZA 1GJXA 4JI8L 1U9RA 1BBUA 1WI5A 3GTMB 3SK4A 1TWHH 2F4VL 4O2DA 4JI3L 1TWFB 1MIUA 4PG3A 2EYJA 4L5RC 3C2PA 1SFOH 4M1UB 1J9OA 3J80L 5EKKA 3S1QB 4BA1I 2TSSA 1LACA 1G6PA 2UUAQ 1VQOA 1IBMQ 2BOSA 4B3SQ 3C1EA 1G2SA 3S17B 2AQ2B 5E7NA 4OL7A 5C44B 4R1JA 3LGJA 5C4JB 2K28A 5KYIA 2OF1A 4XQQA 1H9SB 3Q22A 1JJGA 4B9WA 2IY5B 2PW5A 3M4OH 1ILPA 4IPCA 4DNRB 1L0XB 3D6WA 1JJCB 1VQ9A 2Z4IA 3H91A 3RLFA 2OTLA 3K8AA 5ELEA 5IGFA 1QNUA 1JMCA 4H13C 3QJYA 4DK0A 1MJEA 2I5LX 3I3CA 4C1NI 2L15A 2UXDL 3DM3A 1EWIA 4LMQD 1E22A 4UP8A 3TEHB 1TY2A 1S5CD 1WCMB 3PUVA 1TWGH 3PF4A 2JXMB 3KJPA 2QW7A 4G7HC 1FL0A 5C4ZA 2IX1A 1PFBA 1NTGA 4DNIA 3T51B 4JI7L 3MEFA 2L0CA 3F2UA 3TN2A 2MUYA 2QCPX 3H3VH 3PO2H 5IYBG 2Q8RE 1NUCA 4TRDA 3CCEA 2PNRC 2LS01 4IUQA 4M8AA 4OIJA 5EGTA 5GROA 1KL9A 1K28A 2N8NA 2FMMA 4Y52H 1A62A 3CQZB 5C0XI 1K83B 1YHAA 3MXGA 1Z9FA 3I91A 4RGTA 4ZQ3A 1YIJA 3OYYA 4MN3A 1TQOA 1Q8KA 1PDQA 1EUJA 5M5YB 4DAYB 4L8JA 4F7XA 3QB3A 5CV7A 1Q82C 4LUZA 2I0QA 3GTGB 3HFZB 5G3LD 5C3EB 1WYDA 1SNCA 3TP6A 4KKUA 1QZHA 5KNDA 4OONA 1ASZA 3M85A 2NWGA 1E7ZA 3PO3B 4A3KH 2DNEA 4IFDH 2F0MA 2B2UA 4KY6A 3SEBA 2DJFC 3BYTB 4BY1H 4PNYA 3WOEA 1N33Q 2JA8G 1A2UA 3PUZA 1I3QB 1M1KC 4JG2A 3OMGA 4J15A 1M8AA 1V1QA 3ER0A 1E1OA 2E5LL 2V1CC 1HNZL 4OWWB 5FLMH 4LW1A 4LJZC 3HGBA 3VYRA 1TY0A 1VDZA 1KRSA 3CU7A 3GTQB 5M3FG 4ME3A 3OSOA 2E75C 3I2ZA 2WAQE 4ZUJA 2JA7B 4DR2L 2KUMA 4DR6Q 4FXKC 3SK5A 1SMYC 4K0KL 3HKSA 4FF4A 2ENBA 4TSSA 2Q8IB 1ZXTA 2VUMH 3G71A 3I4NB 2E2HB 4JOIA 1SJED 5ELBA 1CZGA 2K5VA 5C6AA 1F77A 1OXTA 3STBC 4JCVE 1BOSA 1ESFA 5C4HA 3I90A 4B3TL 4XYQA 4TKOB 1I4GA 1N9WA 1UEAB 1B2TA 1HXYD 4UY8C 2NVYH 5JAVA 2NN6I 3ITPA 3TZUA 1F2YA 2ES2A 5IYCH 2PZWA 3LWEA 5EJWA 1SLJA 3I4MH 2EVBA 1R9TB 4LK1C 4C3HB 3M4QA 4JI5Q 2EPBA 5J22A 1UEBA 3RLOA 3K7AB 3K6OA 1SMXA 3SGIA 1GVPA 1U4PA 4HJAA 4LFAQ 1XPUA 4A3EH 2ZJRA 4HJ9A 1Y69U 4DUZL 1HJPA 4P73A 4CJ2C 1T5EA 2Y0SE 1N36Q 3W1GA 3A5UA 4A3JG 3ND8A 4MTNA 3BS1A 1QILA 1YI2A 4XT3B 2NVXH 2EQSA 1HNZQ 4FF3A 1LTRD 1AE3A 5M3MH 4K2KA 4ZLTF 1HUNA 5M3MG 3A0JA 5IWAL 3TS0A 2Q2TA 2R93H 4IPGA 4WORA 4ZUIA 4EQNA 2UXCL 3R93A 1K9MC 2OWOA 3S16B 1K8OA 3GDEA 1GUNA 2IHEA 4OWXB 3EROA 3PO2G 1HFNA 5M5WB 4HCSA 1JWSD 2O5JC 3J81c 2YTXA 3J81i 1BCPF 2B2UC 1IBML 2LY7A 2B2YA 1GOZA 2E2IH 4JBWA 2JE6I 4IALA 1EEFD 1U5KA 1BQQT 3PUYA 1WD1A 4OELB 2R6GA 1YZ6A 2SOBA 4XIGS 3I4LA 2J4XA 4CDCC 4IUTA 3RN5A 1AFPA 2YTYA 1CI3M 3PQIA 5IYDH 1WCMG 3FRPB 1DM0B 3F2CA 1LTAD 2F3WA 4X3TA 2E74C 4YHHL 1VQMA 2KCTA 2VY3A 2EYPA 1XMOL 5GAEC 3BZKA 4A3FH 4A3DB 1J5EQ 3GTKB 5I9PA 4A3IG 4C1NK 3MXNB 4C3JG 3Q23A 3FHWA 5CORA 2IT1A 5AFWA 4LFAL 1Y1VB 2PPBC 4H44C 4TQUS 1SNOA 2ZTEA 2OXPA 1N36L 1OXUA 3S2HH 1Y8OB 4XYOA 4ZK9B 3FMCA 5M3FH 1DZ1A 4B9XA 1Q81C 3VA7A 4YIJA 1K0SA 2EXZA 2EIFA 3BG3A 2VNUD 1GO3E 1JE5A 1LTSD 1EYAA 4DK3C 2UU9Q 1XNQQ 4A3LH 4GKJQ 1WTOA 1ZKOA 4A4IA 3D4DA 3NBHB 1BNZA 4DV2Q 1SE4A 4B3RQ 2R92B 3CP0A 5M3FB 3ULLA 4CDDC 1VQBA 2IJ0A 3MA2B 1JICA 3KLSX 4NKLA 3SR1A 1G51A 4O0AA 3E0EA 4YHHQ 5C3XA 1D2BA 1CA5A 5FOBB 1XMOQ 1RKNA 3AB9A 1EY7A 4YWLA 1S4ZA 1SE8A 3OTOL 1QOHA 2EXDA 4QIWB 3DLLA 4DU9A 1KAWA 1B4OA 3S1RB 4JW0A 4FXGC 1I4HA 1GHKA 3GTKH 2NTTA 4C2MH 1PFNA 3BDOA 4A3FB 1BCPD 5DM63 2F4IA 1VMPA 1TVXA 3S1MH 4RHRA 1EQRA 2IL8A 1HR0Q 2JA6G 1EY4A 2FFKB 2DY7A 3KYHC 1VMCA 5I2YA 2F0EA 2B2VC 4RG1A 3KF8B 5LMUL 2JK8A 5CV5A 2HHHL 2BDOA 4HMIA 3ULJA 3ULPA 2VS1A 1JB7A 4K5XA 3EVQA 2XN9C 1O7IA 1SMYD 2K32A 3FKIB 3TP8A 3L3OC 4G7ZC 4B08A 2DJGC 3S16H 4BXXH 4TVAB 2RF4A 1FR3A 3CPFA 1PH1A 4DV2L 4B3TQ 3HOWH 1P16A 1VQEA 2TMPA 3OW2A 2RVLA 2NVXB 3E6ZX 2RDGA 3DWAA 2PQEA 2K04A 2D5DA 4P72A 2OT2A 1IL2A 2B2WA 1H9KA 4PZ7A 1PZID 4A3EB 1JOOA 5DEHA 1AZQA 2UUBQ 1I4XA 3E5SA 4N9TA 5E4WC 3K7AH 1AE2A 3PV0A 1XMQQ 1AW7A 2F0VA 5CC4A 2F0DA 2F0JA 4IPHA 1F9PA 1EYCA 3T1HQ 4MTKA 3KBGA 2A19A 2C35B 1R9TH 3I4MB 3BZCA 3U9OA 4UPAA 1GUSA 1YBYA 1X32A 5DLQE 4EQPA 2JA6B 3S2DB 3OWEB 2O2LD 5FK9C 1RD9D 2PZUA 1HR0L 5FO8B 2EY1A 1W3SA 3V96A 5K36G 1X3GA 3NSWA 1KIXA 2QILA 2HHHQ 2YV5A 4DPGA 5C3WA 1A0IA 5IT9L 1HRJA 3IRBA 2EYOA 4P71A 3SK8A 2WIIB 3TREA 1O78A 4IN3A 1KD1C 1SYCA 3VR3A 5FO7B 4GOPB 1CSPA 4X65Q 3HOYB 4GLXA 1DOMA 1ML0D 1CQVA 3CAMA 2KA7A 1EY5A 3UDFA 3UE0A 2IX3A 1XTCD 3F8TA 3HOZG 4PQXA 2KHIA 1I3QH 1F9QA 2ZXRA 5IGDA 1VF7A 2LFNA 3CCJA 4BY1B 3O13A 1AEXA 1JQYD 1VS0A 5AJ3Q 2HDMA 1J8IA 2KBNA 2G9HD 3RD4A 1VQ7A 5C3EH 3AQQA 5ELFA 4JC0A 4A3MB 3HOVG 3J7AF 4RKLA 2ZM6Q 4J8QA 3OIQA 1YJWA 2E76C 3S15B 3P7JA 2K1BA 1YVCA 3MAQA 3MEHA 1CUKA 4KY5A 1L2FA 1TS5A 1G2TA 1EY9A 1SR3A 3NBHA 2A1AA 3X3NA 3VR5A 4GKJL 1VQ4A 3KFUA 3J80E 4IFDI 5NUCA 4GNXB 3UDGA 2B2TA 1EQTA 4DR3Q 2AWOA 1KHIA 1E2VA 1HCZA 2J7ZA 2BDNA 5BR8Q 2D0PA 2HQEA 1K8MA 1E2WA 4A3BB 1STHA 2K5HA 2PI2A 3DM1A 3S2DH 4KHZA 2JA6H 2EJMA 2NVQB 1VQFA 5TSSA 3LX0A 3HZXA 2D2CC 2JEBI 5IP7G 1PXUA 4HR7B 3HKZE 3W3AA 2GN5A 4JI6L 5JJLA 1JOKA 2Z6BA 3EFXD 2QA4A 3EQLC 4H02A 4HAEA 1AP0A 2FMCA 1LM0A 4U68A 2F0NA 1FNUA 2WKCA 2B3GA 4CGYB 4C3IH 5AJ3L 3GTOB 2F0IA 4ALPA 3ND9A 5BN4A 4HCEA 4JI4Q 1Y1VG 4X64L 3M4OB 1DOLA 2QF7A 4YY3L 4G7OC 2EDGA 1UE1A 2N3SA 1D8LA 4CKBA 1HA5A 3J7ZC 1ET9A 4DUYL 1CZWA 3MFYA 2P5ZX 3A56A 3T1YL 1PTOF 4UHVA 3VDYA 3FVQA 4R4CA 1KQSA 4JK1C 1HQMC 3NTKA 2DGYA 2Q2IA 4PMWA 1VF5C 1I4RA 1SFOB 4A3CH 3I4NG 1EQQA 2QDLA 1KC8C 3PUXA 3CPWA 1SYFA 4Z9CB 1X9NA 2B39A 5GAHC 3S1MB 2NYZD 4LF4L 4IJHA 4WJ3M 2C9OA 4X62L 3AEVA 5IIFA 4ABNA 2DY8A 4HJ7A 2B2VA 1OTCA 2K52A 1TWAB 2HQLA 2F0KA 4U673 4DV5Q 4EQ5A 2UUBL 5IT9c 1VQCA 4LFCL 4V0BA 5T1GA 4DR7L 4IUPA 1S72A 1BBWA 1XMQL 4C3HG 2H4OA 1Q3LA 1WOCA 2X69A 2ASBA 3MZ5A 4JOIC 4YY3Q 2KCNA 1X56A 1N34Q 5IP9H 4DUYQ 3PIOA 1B70B 4POGA 3M3YH 1HTLD 2AWNA 3MXUA 1YJ9A 1V43A 2EY5A 4JI0Q 2F0LA 3RMHA 1W6JA 1PLFA 4MHEA 5HURA 1NE3A 3K57A 2IHFA 1ESRA 5FLXc 4DV4L 4RGMA 4DR1Q 4DR5L 1VQJA 1PZKD 4N8FA 5M9OA 4RCOA 3CMAA 1PH6A 1QB5D 2L9HA 4DR4Q 4WJWA 5IODA 1XTDA 2O5IC 3BDCA 3L0OA 4A3JH 2JA5H 3H0GG 3BVGA 3OWFA 1UE5A 1E24A 2Q8TA 5C4XB 2B2WC 1FYCA 3E0JA 2K5WA 3VA5A 3FP9A 1GUWA 1CKNB 1C9OA 1HNWQ 3ICEA 4RAUC 4A3DH 1LUZA 1T5XD 1Z6HA 4HJ8A 3PIPA 2K03A 2Z6KA 1EU3A 3RR5A 4L5SA 1LTBD 1CQFA 3JAML 2ID0A 1EYDA 4PV1C 1MHWC 5EPLA 1BVSA 1DCZA 1D1IA 2K7VA 5IYDG 4DAMA 2A6HD 5C4XH 2HD3A 3BU2A 5C4XG 2JA5B 3NTIA 4ZYSA 3JAMi 3MWYW 1TT2A 3JAMc 5I2XA 4R4IA 2F03A 1NR4A 1OO9B 1EWHA 1WFQA 1RCVD 3LNNA 4KD4A 5EKLA 1ZEQX 3T53B 4H0LC 1BBXC 2I5HA 5DM73 1FNWA 2BH2A 1C8CA 4DR5Q 4DKAC 1N32Q 2E2JB 2K6AA 2A68C 3MFGA 3QG1A 2UUAL 3CRKC 1HNXQ 1GHJA 4GN5A 1CKOA 4QY7A 2H5XA 2NB0A 3DWPA 4LF6L 5J1ZA 4A3GG 4LF5Q 3K81C 4P75A 2CVRA 2CW0D 4AYBG 4FVMA 4ID6A 3G6EA 4KTAA 4QGUA 1HNWL 2RKSA 3DEOA 3PGZA 4C3HH 5IOCA 3M7NA 4A3KG 3NENA 3OIPA 4IFDG 4N8X1 4ZRZA 5CBAE 2WAQB 4BY7G 4ODGA 4BBRH 4X64Q 3GTLB 1C48A 4KY7A 2UXDQ 1QVCA 4WJ4A 5KEEA 4XTCS 1EOTA 3RZDH 1YEZA 3BVZA 1AZPA 4K8IA 1K8GA 3CCQA 1CK1A 4APVA 3NTHA 3I4NH 1SSOA 1HTPA 3PUWA 1ICFB 2KHSA 3VYUA 4GNXA 3DMUA 1SROA 1LO5D 2GA4B 1HUMA 4MNOA 1EY8A 5F2DA 3F2BA 3HOXB 4ZKBB 3A7LA 2HIVA 1IXRA 5ISRA 3GTQH 4JYAL 1NAPA 1D5MC 4QL5A 1JORA 2QEJC 1SE3A 1NSNS 4O1NA 2F3IA 4WFN3 4IOCA 4OO1I 3K58A 4BS9A 2Z8LA 2RA4A 3G48A 3TSSA 4LFCQ 4DR7Q 1X3EA 4A3KB 1M4VA 3GP7A 1SE2A 3H6MA 4OHJA 4C3IB 5GQOA 1NMGA 2Q2UA 1E3PA 1PTOD 5A2QL 2WACA 4HIMA 1H9JA 4C56C 3S9WA 2L55A 3C3LA 2AUJD 2FXQA 2G9DA 1H95A 3NPPA 2QGQA 1SAPA 1A15A 4LAAA 2PNHA 2NN6G 1WTQA 2A6HC 1KNAA 4JI1L 1MSGA 2RDFA 3PIO3 1TS4A 3K0XA 4KHVA 3HOVB 4JI0L 2MNAA 4A3BH 3PO2B 2F4VQ 3IL8A 4DR2Q 1PRTC 4DR6L 5D14A 5IYBH 1K73C 3SK6A 4OGQC 3J81E 1WVLA 2FINB 4BY1G 2F0HA 1NY4A 1YJNA 4RGOS 2B8GA 1SYBA 5CR3A 2LSSA 2ZJPA 2KOLA 1XXGA 3DXJC 2CCZA 4LUVA 2MO1A 1PTOH 2RCNA 1XYIA 3KF8A 1L0YB 3NUCA 2A69D 5FLMG
chains in the Genus database with same CATH topology
2SEBD 4Q5VA 3K5NA 3AU7A 1Y8PB 2BA0A 3NHHA 3DEPA 4G4KA 1EY0A 4KN7C 4KK7A 2YYZA 2A74C 2F0OA 1Q1EA 5I9OA 4QUFA 2L1BA 3BYYB 1X3QA 2X6LA 2PMZB 3D31A 1WTXA 1BR9A 2CHBD 4CKEA 1A3TA 1STYA 2I07B 1S5FD 1OXVA 2I46A 1TWHB 3K59A 2SDFA 2N55A 4R8IA 5J39A 2V4DA 1S5ED 3RZDB 2A68D 1HFGA 3A55A 2KEEA 1H9RA 1SYGA 3HP3A 3EJIA 4BBRB 3P20A 5D65A 4FP5D 1AN8A 3NWSA 1QJOA 1HA6A 1FGBD 1ILQA 1EEID 4K5WA 3SHLA 3EA6A 1F2LA 4IUUA 2SNSA 1QE6A 3V05A 1IKMA 1XX8A 4XQJA 1F2ZA 1EL0A 1KNEA 1H9SA 5I6YA 1QNKA 1WTVA 5EBDA 1WTWA 4V190 1EIHA 4DGZA 3I70A 5K5PA 2ZT9C 4KMUC 2HDLA 3NK9A 4BWGB 5T1IA 2WB1B 3VYSA 3QOJA 3D6CA 2JP1A 1QG7A 1LV9A 1OXXK 2BE5D 4UDUC 4E6IA 5CYUA 4RKBA 4FF2A 3I8ZA 3HRZC 1JWUD 4N9PA 4C2MB 1ET6A 3MXPA 2EY6A 3FEWX 1EZ8A 5D3IB 1W6KA 2EYMA 4DXFA 3JAME 4DNTB 2R3ZA 2PCFB 3BZDB 4A3JB 1SXTA 1U4MA 4FO2A 1WD0A 1V1PB 3I72A 4FF1A 5EPJA 2PW7A 3H09A 2MP1A 2XNAC 1C4QA 1A2TA 4EGVA 1RTOA 1YNJC 1CHPD 3VYTA 5DAUA 3NP8A 4A93B 4K8JA 1B3AA 5E3FA 4BA2I 3CHBD 1O7ZA 3HKZB 3KLRA 1CT1D 5JEAJ 3J7YW 4K2LA 3HOUB 3A8KE 1TWCB 3R2IA 2KQ3A 2OEOA 1YNND 4RHSA 2F0SA 3VR2A 3S2HB 2IX0A 3OMCA 1YNJD 5M5XB 2HCIA 1ENCA 3SDZA 4DF7A 5BN3A 4ZKCB 5IGCA 2NUCA 2K01A 4X3SA 1QCBD 4J1MA 5A2QE 1STBA 2WP8J 4UAIA 1JR0D 1TS2A 1YNNC 1I6VC 2WV6D 3T13A 3M4YA 2QDBA 1BF4A 4IUVA 4DN4M 1KLGD 2KECA 2NVTB 3HS0C 1O80A 1ZYRD 4CKCA 2R93B 1JOQA 3DWQA 3UI2A 3J7AV 4RH6A 2NN6H 5CV8A 2M2LA 1OXSC 3C46A 5M3MB 1D6EC 1CA6A 2A5HA 2PO4A 4K14A 1F9RA 1Z47A 3NXWA 1MSHA 1PRTD 4RA8A 4XDXA 1U4LA 1S5DD 1A3UA 4HTHA 3CRLC 2K5QA 5D3DA 1B53A 3QO2A 2F3VA 2QKIC 3DHQA 3K5MA 1PZJD 3TDQA 3TP7A 4NP5A 4Y7NB 3RZOB 4XT1B 2Z4HA 4OO1G 2L12A 2L11A 3URYA 3S14B 3J81L 4K6LA 1V1OA 1LT3D 2VUMB 3TMEA 2F0FA 1SYDA 1IYVA 1JWMD 5CV4A 4DFAA 3R3OA 3WOFA 1BCPC 1BDOA 1LABA 2Z1CA 4XQNA 2KVMA 1ICWA 4S3SA 3NQIA 1JE4A 1R4QB 2RSNA 1Y8NB 2O4XA 3A54A 1MBYA 3G7LA 5KNBA 2EYHA 5LL6S 1GXDC 1B9NA 2D62A 2HCCA 3BVMA 2RDHA 1MD2D 2ZXOA 3KK7A 4F88A 5IGBA 1RTNA 3GD7A 4H7BA 3V2TA 2VB2X 1PFMA 2JSOA 4ILWA 1Q12A 4QMGA 4R8NA 1TR5A 5BN5A 1II3A 1Q8IA 1KAAA 4EVOA 2IWHA 2F1MA 3K5OA 3A8JE 3TBIB 4DXGA 2EJGC 1HHVA 4KJNA 1EWCA 1ZYRC 5C5MA 1STEA 2XWBB 3FDTA 1LT6D 3QWNA 2A69C 1TWGB 3K0YA 5EBCA 4QB4A 1HQRD 1CHQD 3T56B 4CBVA 5IT9E 1SYEA 4WRDA 1ONLA 5HGTA 1JCKB 3KLSA 1X3PA 2M00A 4ZAIA 4FYDA 2BE5C 3HOWB 2EE1A 3NBIA 1IL8A 4AYBB 4R9WA 3HOZB 1LTID 3SVMA 1DJRD 1JB3A 1EQVA 1KABA 1KTKA 1STGA 2R61A 1TU2B 2MJ8A 5CGKA 4X3KA 1V8QA 3HEJA 4P2CB 3AMUA 2NTSA 2PZTA 4K5VA 1QWYA 1PRTB 3A7AB 2Y0SB 4IURA 1EU4A 3N52A 1FNVA 1O7LA 1D5ZC 1B1ZA 1KDAA 1D5XC 3D4RA 4KD3A 3T16A 3D3RA 4HSPA 4L63B 3MHBA 1JC7A 4A3IB 1VCIA 2DNCA 4KJOA 2EY2A 1IW7C 3MTSA 2F0QA 2E2DC 5JPNC 5IGEA 3VR6A 1LT4D 2BA1A 5LHY1 3X3MA 4GZYC 4F87A 3GTPB 1DOKA 1UAPA 5I4DA 2H1EA 4PMCA 3TP5A 5K36H 4KKSA 4FNFA 1DYQA 1DD2A 4OO1H 3A8IE 3P75A 5CV6A 4CJ0B 1NCVA 2N88A 5JPMC 4FXDA 5KGUA 1EZ6A 1Y1WB 4DK1A 1BO0A 2D9UA 1BCPB 5EQ0A 3D8GA 4J6HA 1SEBD 2AQ3B 3FPPA 4F8MA 3L9AX 2AUKA 4L6TB 1CM9A 5KRUA 1RDPD 3MXNA 3OW7A 2KJXA 3IFTA 3H0GB 1G291 1F9SA 1WTRA 2E2IB 2F0UA 3G6JB 1SNMA 1BXTA 2JEAI 4X3UA 4O42A 2B63B 2DN8A 1Z7TA 4IQZA 1HPCA 3LWUA 3I73A 2B2YC 3R2TA 2RSOA 2XWJB 1I6HB 4HEDA 3IAYA 4HMJA 1EIGA 3GV3A 1LLRD 4RCNA 1STAA 3VR4A 2ICIA 3MC0B 5JEAG 1V1PA 4NW2A 3Q6SA 1FD7D 1KLUD 2K33A 1NR2A 1PRTF 3GO5A 2CW0C 1TIID 1EY6A 3T4AC 1MI2A 1LTGD 1RF2D 2EJFC 4I7ZC 1DONA 2JA8B 4DAYA 1IKLA 2A6ED 4QCLA 2L5TA 1SDFA 1D1KA 1IW7D 1PYWD 4K6DA 2NVYB 3Q24A 3H94A 1GUOA 1BUVT 4NDXA 5KYLA 1PTOB 3MVVA 5LL6X 3GQBA 1S5BD 5E1FA 5JJZA 4ULLA 5KNCA 1A6XA 2CQAA 3HG9A 2RQXA 1EFID 3N6RA 1B50A 2MGSA 4RFBA 1A3VA 1SNPA 1LT5D 3H3VC 3OOCA 5IGGA 3P1HA 1KDCA 3OPOA 5JVH3 2XIWA 3NWTA 1E2ZA 5C0XH 5A35A 5E4XA 4IZ8A 4CHTB 4XXEA 1TS3A 4KN4C 5EPKA 1WTPA 2PYKA 5ELDA 5FO9B 1CTMA 5COYA 1CFMA 5CBEE 3U9SA 4DAVA 2LMCB 4QF4A 2K5DA 2MPMA 4IFDJ 2LKVA 2F0PA 2F0GA 1UNSA 2NZ1D 3PIP3 2EZVA 1SBBB 4CJ1B 4NMZA 3M7GA 3TZDA 1MGSA 2EYFA 2XSCA 2FHTA 4DAPA 2IPKD 4Q0FA 4HSVA 3R8BA 1SNDA 4RGNA 3PMFA 5FKAC 2M9VA 4KV6A 4QUCA 4MIUA 1RJTA 4PMBA 3SE0A 5JOBA 4KI0A 2IW3A 1TKWB 1PMRA 4IUNA 3S1NB 1XWEA 2KEDA 2C5CA 2A73B 5FLXL 4DA2A 5C0XG 3ZYYX 3C1FA 2F0WA 1G91A 1RODA 3D4WA 2FJ2A 2VB3X 5EKIA 5I6WA 3NE5B 3ERQA 1UUPA 3KUPA 4OIKA 4EQOA 3DUZA 5ELCA 1O7YA 3WDNA 1E0BA 2X6GA 2R7ZB 2VXWA 3ONAB 4I65A 1RHPA 2HUGA 2XRSD 1H9MA 1I50B 4A3GB 1DXMA 2F0TA 2L4NA 3GV6A 4ME5A 2B2TC 1SJHD 2K05A 1STNA 5G3LF 5CMDA 1B9MA 1LTTD 3QIAA 1R4PB 2EOTA 3IFDA 1GUTA 1I4PA 3KBXA 4C3IG 3K5LA 2A6EC 2B8FA 1U4RA 2RBMA 1IHZA 2XRQD 2NBFA 3NQTA 4BBSB 2WINB 1G6ZA 2AQ1B 2SNMA 2WKDA 2EYLA 5C5LA 1PTOC 1Q1BA 3FPUB 4HN7A 2J0TD 4RWSC 1ENFA 4BY7B 3GTJB 1SNQA 2ZXPA 3OHXC 5KIXA 5DNFA 5JEAH 2JYOA 3M3YB 2KCCA 3Q0AA 3BDLA 1ENAA 2MHVA 3IKJA 1G8ZD 1I4QA 5C0XJ 2BCOA 2ICEC 1Q90A 2XVSA 5JVG3 5CV9A 1F2MA 5FLXE 1IYUA 3W2DA 4C3JB 2YU9B 3L7ZC 4KKTA 1KDBA 4G57A 3CKIB 3SXHA 1GUGA 3QOLA 1B44D 3RUZA 1GJXA 1U9RA 3GTMB 3SK4A 1TWFB 2EYJA 3C2PA 4M1UB 1J9OA 3J80L 5EKKA 3S1QB 4BA1I 2TSSA 1LACA 2BOSA 3C1EA 1G2SA 3S17B 2AQ2B 4OL7A 5C44B 5C4JB 2K28A 5KYIA 2OF1A 4XQQA 1H9SB 3Q22A 4B9WA 2PW5A 1ILPA 4DNRB 1L0XB 3D6WA 2Z4IA 3H91A 3RLFA 5ELEA 5IGFA 1QNUA 4H13C 3QJYA 4DK0A 3I3CA 4C1NI 4LMQD 1TY2A 1S5CD 1WCMB 3PUVA 2JXMB 4G7HC 5C4ZA 2IX1A 1PFBA 3T51B 2L0CA 3F2UA 3TN2A 2MUYA 2QCPX 2Q8RE 1NUCA 4TRDA 2PNRC 2LS01 4IUQA 4M8AA 4OIJA 5EGTA 2FMMA 3CQZB 5C0XI 1K83B 3MXGA 3I91A 4RGTA 4ZQ3A 4MN3A 1TQOA 1PDQA 5M5YB 4L8JA 4F7XA 3QB3A 5CV7A 3GTGB 5C3EB 5G3LD 1SNCA 3TP6A 4KKUA 5KNDA 3M85A 2NWGA 3PO3B 2DNEA 4IFDH 2F0MA 2B2UA 4KY6A 3SEBA 3BYTB 4PNYA 3WOEA 1A2UA 3PUZA 1I3QB 3OMGA 1M8AA 4LJZC 3HGBA 3VYRA 1TY0A 1VDZA 3CU7A 3GTQB 3OSOA 2E75C 4ZUJA 2JA7B 2KUMA 4FXKC 3SK5A 1SMYC 4FF4A 2ENBA 4TSSA 2Q8IB 1ZXTA 3I4NB 2E2HB 1SJED 5ELBA 1CZGA 5C6AA 1F77A 1OXTA 1BOSA 1ESFA 5C4HA 3I90A 4XYQA 4TKOB 1I4GA 1UEAB 1B2TA 1HXYD 5JAVA 2NN6I 3ITPA 3TZUA 1F2YA 2PZWA 5EJWA 3LWEA 2EVBA 1R9TB 4LK1C 4C3HB 2EPBA 5J22A 3K7AB 3K6OA 1U4PA 1Y69U 4CJ2C 1T5EA 3ND8A 3BS1A 1QILA 4XT3B 4FF3A 1LTRD 4K2KA 4ZLTF 1HUNA 4ZUIA 4WORA 4EQNA 3R93A 3S16B 1K8OA 1GUNA 3EROA 1HFNA 5M5WB 4HCSA 1JWSD 2O5JC 1BCPF 2B2UC 2LY7A 2B2YA 1GOZA 4JBWA 2JE6I 4IALA 1EEFD 1BQQT 3PUYA 1WD1A 2R6GA 2SOBA 4XIGS 3I4LA 2J4XA 4IUTA 1AFPA 1CI3M 3FRPB 1DM0B 1LTAD 2F3WA 4X3TA 2E74C 2EYPA 4A3DB 3GTKB 5I9PA 4C1NK 4C3JG 3Q23A 5CORA 2IT1A 5AFWA 1Y1VB 2PPBC 4H44C 4TQUS 1SNOA 2OXPA 1OXUA 1Y8OB 4XYOA 4ZK9B 3FMCA 1DZ1A 4B9XA 3VA7A 4YIJA 2EXZA 3BG3A 2VNUD 1LTSD 1EYAA 1WTOA 1ZKOA 3D4DA 1BNZA 1SE4A 2R92B 5M3FB 2IJ0A 3MA2B 1JICA 3KLSX 4NKLA 3SR1A 5C3XA 1D2BA 1CA5A 5FOBB 1RKNA 3AB9A 1EY7A 1S4ZA 1QOHA 4QIWB 4DU9A 1B4OA 3S1RB 4FXGC 1I4HA 1GHKA 2NTTA 1PFNA 3BDOA 4A3FB 1BCPD 5DM63 2F4IA 1VMPA 1TVXA 4RHRA 2IL8A 1EY4A 2FFKB 2DY7A 1VMCA 5I2YA 2F0EA 2B2VC 5CV5A 2BDOA 4HMIA 4K5XA 3EVQA 2XN9C 1SMYD 2K32A 3FKIB 3TP8A 3L3OC 4G7ZC 4B08A 1FR3A 2TMPA 2RVLA 2NVXB 3E6ZX 2RDGA 3DWAA 2PQEA 2K04A 2D5DA 2OT2A 2B2WA 1H9KA 1AZQA 1PZID 4A3EB 1JOOA 5DEHA 1I4XA 3E5SA 4N9TA 5E4WC 3PV0A 1AW7A 2F0VA 5CC4A 2F0DA 2F0JA 1F9PA 1EYCA 3KBGA 3I4MB 3U9OA 1GUSA 1X32A 4EQPA 2JA6B 3S2DB 3OWEB 2O2LD 5FK9C 1RD9D 2PZUA 5FO8B 2EY1A 3V96A 5K36G 3NSWA 2QILA 5C3WA 5IT9L 1HRJA 2EYOA 3SK8A 2WIIB 1O78A 4IN3A 1SYCA 3VR3A 5FO7B 3HOYB 1DOMA 1ML0D 1CQVA 2KA7A 1EY5A 2IX3A 1XTCD 4PQXA 1F9QA 2ZXRA 5IGDA 1VF7A 2LFNA 4BY1B 3O13A 1AEXA 1JQYD 2HDMA 1J8IA 2G9HD 3RD4A 5ELFA 4A3MB 3J7AF 4RKLA 4J8QA 3OIQA 2E76C 3S15B 3P7JA 2K1BA 3MAQA 3MEHA 4KY5A 1TS5A 1G2TA 1EY9A 3NBHA 3X3NA 3VR5A 3J80E 4IFDI 5NUCA 2B2TA 1EQTA 2AWOA 1E2VA 1HCZA 2J7ZA 2BDNA 2HQEA 4A3BB 1K8MA 1E2WA 1STHA 3DM1A 2NVQB 4KHZA 2EJMA 5TSSA 3LX0A 3HZXA 2D2CC 2JEBI 1PXUA 4HR7B 3W3AA 1JOKA 3EFXD 3EQLC 4HAEA 1AP0A 2FMCA 4U68A 2F0NA 1FNUA 2WKCA 4CGYB 3GTOB 2F0IA 3ND9A 5BN4A 4HCEA 3M4OB 1DOLA 2QF7A 4G7OC 2EDGA 4CKBA 1HA5A 1ET9A 1CZWA 3MFYA 3A56A 1PTOF 3FVQA 4JK1C 1HQMC 3NTKA 4PMWA 1VF5C 1I4RA 1SFOB 3PUXA 1SYFA 4Z9CB 2B39A 3S1MB 2NYZD 2C9OA 5IIFA 4ABNA 2DY8A 2B2VA 1TWAB 2F0KA 4U673 4V0BA 5T1GA 4IUPA 4C3HG 2H4OA 1Q3LA 2X69A 3MZ5A 2KCNA 1HTLD 2AWNA 3MXUA 1V43A 2EY5A 2F0LA 3RMHA 1W6JA 1PLFA 4MHEA 5HURA 3K57A 1ESRA 4RGMA 1PZKD 5M9OA 4RCOA 1QB5D 2L9HA 4WJWA 5IODA 2O5IC 3BDCA 3BVGA 3OWFA 2Q8TA 5C4XB 2B2WC 1FYCA 3E0JA 2K5WA 3VA5A 1GUWA 4RAUC 1T5XD 1Z6HA 2K03A 1EU3A 1LTBD 1CQFA 3JAML 2ID0A 1EYDA 4PV1C 5EPLA 1DCZA 1D1IA 2K7VA 2A6HD 2JA5B 3NTIA 4ZYSA 3MWYW 1TT2A 5I2XA 2F03A 1NR4A 1OO9B 1EWHA 1RCVD 3LNNA 4KD4A 5EKLA 1ZEQX 3T53B 4H0LC 1BBXC 5DM73 1FNWA 1C8CA 2E2JB 2K6AA 2A68C 3MFGA 3QG1A 3CRKC 1GHJA 2NB0A 3DWPA 5J1ZA 2CVRA 2CW0D 4FVMA 4ID6A 4KTAA 2RKSA 3DEOA 5IOCA 3M7NA 3OIPA 4IFDG 4ZRZA 5CBAE 2WAQB 4ODGA 3GTLB 1C48A 4KY7A 5KEEA 4XTCS 1EOTA 1AZPA 3BVZA 4K8IA 1CK1A 3NTHA 1SSOA 1HTPA 3PUWA 2KHSA 3VYUA 3DMUA 1LO5D 2GA4B 1HUMA 1EY8A 5F2DA 3HOXB 4ZKBB 3A7LA 5ISRA 1NAPA 1D5MC 1JORA 2QEJC 1SE3A 1NSNS 4O1NA 4WFN3 4OO1I 3K58A 4BS9A 2Z8LA 2RA4A 3TSSA 4A3KB 1M4VA 3GP7A 1SE2A 3H6MA 4OHJA 4C3IB 1PTOD 5A2QL 2WACA 1H9JA 4C56C 3S9WA 2L55A 3C3LA 2AUJD 2G9DA 3NPPA 1SAPA 1A15A 4LAAA 2NN6G 1WTQA 2A6HC 1KNAA 1MSGA 3PIO3 2RDFA 1TS4A 4KHVA 3HOVB 3PO2B 3IL8A 1PRTC 5D14A 3SK6A 4OGQC 3J81E 1WVLA 2FINB 2F0HA 4RGOS 2B8GA 1SYBA 5CR3A 2KOLA 1XXGA 3DXJC 1PTOH 1XYIA 3KF8A 1L0YB 3NUCA 2A69D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ROD A;  2HDL A;  3F2U A;  4HAE A;  3TN2 A;  3SVM A;  1AP0 A;  1U4P A;  2FJ2 A;  4U68 A;  2Q8R E;  4UAI A;  2KVM A;  1ICW A;  1JIC A;  4IUQ A;  1JE4 A;  2L9H A;  1EOT A;  2RSN A;  4OIJ A;  5EKI A;  5T1I A;  4CJ2 C;  1AZP A;  3DEP A;  1CM9 A;  2MJ8 A;  2FMM A;  1HRJ A;  3G7L A;  3KUP A;  4XT3 B;  2JP1 A;  1SSO A;  4OIK A;  1CA5 A;  4X3K A;  3I91 A;  1QG7 A;  1DOL A;  2Q8T A;  2HCC A;  4MN3 A;  4ZLT F;  2B2W C;  1BF4 A;  2XIW A;  1S4Z A;  4IUV A;  1HUN A;  1PDQ A;  1LV9 A;  4DN4 M;  1HUM A;  1O7Y A;  1GUW A;  1E0B A;  1F9S A;  1RTN A;  1DOM A;  1ML0 D;  1B4O A;  2X6G A;  3I8Z A;  5E4X A;  2VXW A;  3R93 A;  3ONA B;  4QUF A;  4ZKB B;  2L1B A;  1NAP A;  1RHP A;  4IUR A;  3N52 A;  4RAU C;  2KEC A;  1PFN A;  4X3U A;  2HUG A;  1X3Q A;  2X6L A;  4O42 A;  1HFN A;  1PFM A;  4HCS A;  5EPK A;  1WTP A;  2K03 A;  1O80 A;  2B2U C;  1VMP A;  5COY A;  1WTX A;  2NWG A;  1TVX A;  2B2Y A;  5CBE E;  2B2U A;  2IL8 A;  3UI2 A;  2FFK B;  2L4N A;  2B2Y C;  2DY7 A;  5EPL A;  1F9Q A;  1VMC A;  3GV6 A;  2RSO A;  1WD1 A;  4HED A;  2B2V C;  2B2T C;  2M2L A;  1EIG A;  3GV3 A;  2R3Z A;  4IUT A;  2K05 A;  2RA4 A;  1J9O A;  2SDF A;  1M8A A;  2MPM A;  2N55 A;  1CA6 A;  3MWY W;  2HDM A;  4R8I A;  1U4M A;  1F9R A;  2NYZ D;  4X3T A;  5CMD A;  1WD0 A;  1J8I A;  1NR4 A;  4NW2 A;  3Q6S A;  1G2S A;  2EOT A;  1MSH A;  3IFD A;  4RA8 A;  1HFG A;  4XDX A;  1HHV A;  3MTS A;  5EPJ A;  1NR2 A;  2DY8 A;  3KBX A;  2B2V A;  1U4L A;  2NZ1 D;  2KEE A;  2MP1 A;  2K28 A;  1BBX C;  1MI2 A;  1RTO A;  1U4R A;  4R9W A;  4CJ1 B;  1C8C A;  3FDT A;  3HP3 A;  5T1G A;  3P7J A;  1MGS A;  2KUM A;  4IUP A;  2K1B A;  3TZD A;  2FHT A;  1SAP A;  1A15 A;  1B53 A;  3QO2 A;  5COR A;  5D65 A;  5AFW A;  1B3A A;  4HSV A;  1DON A;  1WTQ A;  1ILP A;  1KNA A;  1G2T A;  1DOK A;  1MSG A;  3D6W A;  2H1E A;  1ZXT A;  1O7Z A;  2RVL A;  1IKL A;  3H91 A;  1Q3L A;  2K04 A;  1HA6 A;  2X69 A;  1G6Z A;  1ILQ A;  1WTR A;  1SDF A;  2B2W A;  2B2T A;  4ZK9 B;  1AZQ A;  1EQT A;  4XT1 B;  1DZ1 A;  3IL8 A;  1F2L A;  3I90 A;  2CVR A;  5D14 A;  4IUU A;  5E4W C;  1B2T A;  1QE6 A;  2J7Z A;  4QUC A;  2BDN A;  1RJT A;  2L12 A;  2L11 A;  3I3C A;  1IKM A;  1XX8 A;  1WVL A;  1EL0 A;  2FIN B;  1KNE A;  3DEO A;  1F9P A;  3FPU B;  3DM1 A;  4LMQ D;  1WTO A;  4CJ0 B;  1NCV A;  2N88 A;  1X3P A;  4RWS C;  1QNK A;  2KED A;  2HCI A;  1PLF A;  3LWE A;  4MHE A;  5EJW A;  4ZAI A;  5JJZ A;  1WTV A;  2KOL A;  1X32 A;  1WTW A;  5CBA E;  1EIH A;  5DNF A;  1PFB A;  4ZKC B;  1BNZ A;  4X3S A;  2JYO A;  2K01 A;  2EPB A;  1XYI A;  1BO0 A;  1ESR A;  2D9U A;  2EE1 A;  1IL8 A;  1B50 A;  1G91 A;  2MGS A;  5EQ0 A; 
#chains in the Genus database with same CATH topology
 4IO9 A;  2SEB D;  4YWK A;  4Q5V A;  1HR0 W;  1X3F A;  1Q46 A;  3K5N A;  2UUC Q;  3AU7 A;  1Y8P B;  1SN8 A;  2BA0 A;  3NHH A;  4A3E G;  3DEP A;  1QUQ B;  4G4K A;  1EY0 A;  4KN7 C;  4KK7 A;  2YYZ A;  3AFP A;  2A74 C;  2F0O A;  1IBL Q;  1Q1E A;  5I9O A;  2WB1 G;  4QUF A;  1IZ6 A;  4HIO A;  2L1B A;  5C4J H;  1VQ6 A;  3BYY B;  1P8L A;  1X3Q A;  2X6L A;  4JI1 Q;  2PMZ B;  4AIM A;  3D31 A;  1WTX A;  1BR9 A;  2CHB D;  3S1Q H;  4R4T A;  4NXM Q;  4CKE A;  1A3T A;  3K7U C;  1STY A;  2I07 B;  1S5F D;  1I6H H;  1OXV A;  2I46 A;  3NEL A;  1TWH B;  3U4V A;  1DGS A;  3K59 A;  3GTM H;  1NBW A;  2SDF A;  2N55 A;  4R8I A;  5J39 A;  1I94 Q;  2V4D A;  1S5E D;  3RZD B;  2E8G A;  2A68 D;  1HFG A;  3A55 A;  1A63 A;  1Y14 B;  4LF6 Q;  2KEE A;  1H9R A;  1FJG L;  5C3E G;  1SYG A;  3CCV A;  4GOP C;  3HP3 A;  3EJI A;  4BBR B;  3P20 A;  4GLV B;  2YU9 H;  3EIV A;  5D65 A;  4FP5 D;  4BBS G;  1PVO A;  1AN8 A;  3NWS A;  4JV5 Q;  1QJO A;  2UUC L;  1HA6 A;  1FGB D;  1ILQ A;  1EEI D;  3W1B A;  1EFW A;  4K5W A;  2PQA B;  3SHL A;  3EA6 A;  1F2L A;  4IUU A;  2SNS A;  1QE6 A;  3V05 A;  1X65 A;  1X6O A;  4LF7 L;  1IKM A;  1XX8 A;  4XQJ A;  1F2Z A;  1EL0 A;  2I5M X;  1KNE A;  3AYH B;  4GKK Q;  4A3L G;  1H9S A;  3E9I A;  5I6Y A;  1QNK A;  1WTV A;  4BY7 H;  3EBE A;  5EBD A;  3E9H A;  1WTW A;  4V19 0;  1EIH A;  4DGZ A;  2E2J H;  3I70 A;  5K5P A;  3PF5 A;  2ZT9 C;  2JA7 G;  4NXM L;  4AQY L;  2UU9 L;  4KMU C;  1D7Q A;  2HDL A;  2AHO B;  3FKI H;  3NK9 A;  3CCR A;  4BWG B;  5T1I A;  2WB1 B;  3VYS A;  2N49 A;  3QOJ A;  4LF9 L;  3D6C A;  2JP1 A;  1QG7 A;  3GTP H;  4B3R L;  1PH4 A;  1LV9 A;  1OXX K;  2BE5 D;  4UDU C;  4E6I A;  4HIK A;  5CYU A;  4RKB A;  4FF2 A;  2GVB A;  3I8Z A;  3HRZ C;  1JWU D;  4RMF A;  4JV5 L;  4N9P A;  4C2M B;  1ET6 A;  3MXP A;  2R7Z G;  2EY6 A;  3FEW X;  4NB3 A;  3S1R H;  3F1Z A;  1EZ8 A;  5D3I B;  1W6K A;  2EYM A;  4DXF A;  3JAM E;  3I4O A;  4DNT B;  2R3Z A;  2PCF B;  3BZD B;  4A3J B;  1SXT A;  1U4M A;  1UE7 A;  4FO2 A;  1WD0 A;  4GKK L;  1MJC A;  1V1P B;  5C44 G;  5FJ8 H;  3I72 A;  4FF1 A;  5EPJ A;  1C7Y A;  2PW7 A;  3H09 A;  5IWA Q;  4GOP A;  2MP1 A;  2XNA C;  2R92 H;  1C4Q A;  1A2T A;  4R4Q A;  4EGV A;  1RTO A;  1YNJ C;  1CHP D;  3CW2 C;  2CQO A;  3VYT A;  5DAU A;  2UXC Q;  4DV1 Q;  3NP8 A;  4A93 B;  4K8J A;  2GVA A;  1ASY A;  1B3A A;  5E3F A;  4IOA A;  4BA2 I;  3CHB D;  1O7Z A;  2JA9 A;  3HKZ B;  4DV0 Q;  4LF9 Q;  3KLR A;  1CT1 D;  2YTV A;  5JEA J;  1PFS A;  3J7Y W;  4K2L A;  3HOU B;  4A3M G;  1GD7 A;  3A8K E;  1TWC B;  3TS2 A;  1JT8 A;  1L1O B;  3R2I A;  2KQ3 A;  2OEO A;  1YNN D;  4RHS A;  2F0S A;  3VR2 A;  3S2H B;  1EOV A;  2IX0 A;  4BXX G;  3OMC A;  1S40 A;  1YNJ D;  5M5X B;  3D0F A;  2B29 A;  2ATW A;  1VQG A;  4GS3 A;  2HCI A;  1NNX A;  1ENC A;  1Y1V H;  3SDZ A;  3S1N H;  4DF7 A;  5BN3 A;  4ZKC B;  5IGC A;  2NUC A;  2K01 A;  4X3S A;  1QCB D;  5LMN Q;  4J1M A;  5ELN A;  3KF6 A;  3U58 A;  5A2Q E;  3PO3 G;  1STB A;  2KEN A;  2WP8 J;  2VZA A;  3T1H L;  4UAI A;  1JR0 D;  1TS2 A;  1YNN C;  1I6V C;  2OTJ A;  2E5L Q;  1VQN A;  3W5O A;  2WV6 D;  3T13 A;  3M4Y A;  2QDB A;  1BF4 A;  1QVF A;  4IUV A;  4BBR G;  4DN4 M;  5L37 A;  1KLG D;  1XJV A;  3I56 A;  1QVG A;  2NZO A;  4JI3 Q;  3I55 A;  4DV1 L;  3CC2 A;  2MFI A;  2KEC A;  3FKI G;  2NVT B;  3CME A;  5M5W H;  2CWP A;  3HS0 C;  1PH8 A;  1O80 A;  1AH9 A;  4DK6 C;  3U50 C;  4B3S L;  1ZYR D;  4CKC A;  2R93 B;  4NXN Q;  3DWQ A;  3UI2 A;  4X65 L;  3J7A V;  1JOQ A;  5GAD C;  4RH6 A;  2NN6 H;  5CV8 A;  2Q2H A;  2M2L A;  1OXS C;  3C46 A;  5M3M B;  1EYG A;  1FJG Q;  1D6E C;  1CA6 A;  2XGT A;  2A5H A;  2PO4 A;  4K14 A;  1F9R A;  1Z47 A;  3GTO H;  3NXW A;  1MSH A;  1PRT D;  4RA8 A;  4XDX A;  1U4L A;  1S5D D;  3OTO Q;  5LMN L;  2XTI A;  2D0O A;  1A3U A;  1L0W A;  4HTH A;  2VQF Q;  3CRL C;  2K5Q A;  5D3D A;  1B53 A;  3QO2 A;  2VW9 A;  2F3V A;  2QKI C;  3RLN A;  4DUZ Q;  3DHQ A;  3K5M A;  4OX9 L;  1PZJ D;  2NVQ H;  1PV4 A;  3TDQ A;  3TP7 A;  1C0A A;  4NP5 A;  5FJ8 G;  4Y7N B;  2RHS B;  3RZO B;  4XT1 B;  1X55 A;  2Z4H A;  4LUO A;  1VQL A;  5LMU Q;  4OO1 G;  2L12 A;  2L11 A;  3URY A;  4AQY Q;  4FDB A;  1VQ5 A;  3S14 B;  3J81 L;  1HZB A;  1V1O A;  1X54 A;  4K6L A;  1LT3 D;  2AKW B;  2E2H H;  2VUM B;  3TME A;  2F0F A;  4JPB W;  1SYD A;  1IYV A;  1JWM D;  5CV4 A;  4DFA A;  3R3O A;  2JA7 H;  3S15 H;  3WOF A;  5BR8 L;  4NXN L;  4A3M H;  1BCP C;  4A75 A;  1BDO A;  3J81 j;  1LAB A;  4OEM B;  2Z1C A;  4XQN A;  2KVM A;  1ICW A;  4S3S A;  4Y7N H;  3NQI A;  1JE4 A;  1R4Q B;  2RSN A;  1Y8N B;  2O4X A;  3A54 A;  2ZJQ A;  1MBY A;  3G7L A;  4KHP L;  5KNB A;  2JA8 H;  2EYH A;  5LL6 S;  1GXD C;  1B9N A;  2D62 A;  2HCC A;  3K80 C;  3BVM A;  2RDH A;  1MD2 D;  1VQP A;  5H1S E;  2ZXO A;  3KK7 A;  4F88 A;  5IGB A;  3CCS A;  1RTN A;  1K0R A;  3PO3 H;  2G5D A;  3GD7 A;  2RCF A;  1YHB A;  4H7B A;  3V2T A;  2VB2 X;  1PFM A;  2JSO A;  4ILW A;  2VL6 A;  1Q12 A;  4QMG A;  4R8N A;  4OX9 Q;  1TR5 A;  1XPO A;  3GTG H;  4IJL A;  5BN5 A;  3HOY H;  1II3 A;  1Q8I A;  1KAA A;  4EVO A;  3T1Y Q;  4LWC A;  2R7F A;  2IWH A;  3KOJ A;  5JJI A;  2F1M A;  2HT1 A;  1K83 H;  1XNQ L;  3CQZ H;  3K5O A;  3NEM A;  2ZTC A;  4EX5 A;  1B3Q A;  2QEX A;  3A8J E;  3TBI B;  3CC4 A;  3QR8 A;  4DXG A;  2CKZ B;  2EJG C;  2NVT H;  1HHV A;  4KJN A;  1B8A A;  4JBK A;  1EWC A;  1S3O A;  1ZYR C;  4I7A A;  5C5M A;  1STE A;  1LTL A;  2XWB B;  3FDT A;  1GKH A;  2AMC B;  4HID A;  1LT6 D;  4PZ8 A;  1J6Q A;  3ERS X;  3QWN A;  2A69 C;  1TWG B;  1HZC A;  3K0Y A;  1WCM H;  1XPR A;  3A74 A;  5EBC A;  4DV5 L;  4QB4 A;  1HQR D;  4L5Q A;  1CHQ D;  2OQ0 A;  4DV6 L;  2CFM A;  3T56 B;  2WFW A;  4CBV A;  5IT9 E;  4L5T A;  1SYE A;  4WRD A;  3RN2 A;  1ONL A;  5HGT A;  5IYC G;  3UDX A;  1JCK B;  3KLS A;  1X3P A;  2M00 A;  4ZAI A;  3E3X A;  4FYD A;  3STB D;  2BE5 C;  2MQH A;  2ZTD A;  2R93 G;  4CDE C;  3HOW B;  1PA6 A;  2EE1 A;  3NBI A;  3UDI A;  1IL8 A;  4AYB B;  1QZG A;  4R9W A;  3HOZ B;  1LTI D;  4IPD A;  3SVM A;  1TWC H;  1DJR D;  3PSI A;  1JB3 A;  3S17 H;  2KCM A;  1EQV A;  3BJU A;  1KAB A;  3ZJY C;  1KTK A;  1STG A;  2R61 A;  5IY0 A;  1TU2 B;  1M90 C;  2MJ8 A;  2K14 A;  5CGK A;  4X3K A;  3CXC A;  1V8Q A;  3HEJ A;  4AYB E;  4P2C B;  3AMU A;  2NTS A;  2PZT A;  1HZ9 A;  4K5V A;  3L2P A;  1QWY A;  1PRT B;  4YWM A;  3A7A B;  2K5N A;  2Y0S B;  4IUR A;  1EU4 A;  3N52 A;  1FNV A;  1O7L A;  4LF8 L;  1RL2 A;  2UXB L;  1D5Z C;  1B1Z A;  1KDA A;  1D5X C;  4YCW A;  1V9P A;  3D4R A;  4KD3 A;  4JI6 Q;  1J5E L;  3T16 A;  3M9B A;  3TRZ A;  3D3R A;  4X66 Q;  3CC7 A;  3A5Z B;  4HSP A;  4L63 B;  2VQF L;  3MHB A;  1JC7 A;  4P74 A;  4A3I B;  1VCI A;  2DNC A;  4KJO A;  4JI4 L;  2EY2 A;  4A3F G;  1IW7 C;  1QUQ A;  2K50 A;  3MTS A;  2F0Q A;  2E2D C;  2PMZ E;  4JVZ A;  5JPN C;  1UWV A;  3KLW A;  2Z0S A;  5IGE A;  3VR6 A;  1LT4 D;  1W2B A;  2BA1 A;  4GLA C;  5LHY 1;  3X3M A;  4GZY C;  4F87 A;  3GTP B;  3GTJ H;  3G4S A;  1DOK A;  1UAP A;  5I4D A;  1Q86 C;  2H1E A;  4PMC A;  3TP5 A;  5K36 H;  4KKS A;  1SRU A;  4FNF A;  4PZ6 A;  1DYQ A;  1DD2 A;  3H15 A;  3HOZ H;  4OO1 H;  3AFQ A;  2Y0S G;  3A8I E;  3P75 A;  5CV6 A;  3EN2 A;  2JQO A;  4CJ0 B;  3HOY G;  1NCV A;  4LF4 Q;  2N88 A;  3KDF B;  1VQK A;  2JA5 G;  1KRT A;  5JPM C;  1E1T A;  4FXD A;  5KGU A;  1VQI A;  1EZ6 A;  1Y1W B;  4KHP Q;  4DK1 A;  1EIY B;  1BO0 A;  2D9U A;  1BCP B;  5GAG C;  4UP7 A;  5EQ0 A;  3D8G A;  4J6H A;  1SEB D;  2K4K A;  1EIF A;  2AQ3 B;  1PH2 A;  3FPP A;  4F8M A;  4NPS A;  4A3D G;  2A8V A;  3L9A X;  2AUK A;  4L6T B;  1CM9 A;  4B3M L;  3HOU G;  5KRU A;  1RDP D;  2OCE A;  3MXN A;  3OW7 A;  3HOW G;  2KJX A;  3IFT A;  4POF A;  3H0G B;  1G29 1;  2NZH A;  1F9S A;  1WTR A;  4A3G H;  2E2I B;  3M4P A;  1I50 H;  1TXY A;  3F2D A;  2F0U A;  3G6J B;  1SNM A;  1BXT A;  2JEA I;  4X3U A;  2VQE Q;  4O42 A;  1HH2 P;  5IE8 A;  2B63 B;  2DN8 A;  1Z7T A;  4IQZ A;  1HPC A;  3LWU A;  2R7Z H;  3I73 A;  2B2Y C;  3R2T A;  2RSO A;  2XWJ B;  1I6H B;  4HED A;  3IAY A;  4HMJ A;  1EIG A;  4JYA Q;  3GV3 A;  1LLR D;  4RCN A;  1STA A;  3VR4 A;  2ICI A;  3MC0 B;  5JEA G;  1V1P A;  4NW2 A;  3Q6S A;  1FD7 D;  1KLU D;  2K33 A;  1NR2 A;  1PRT F;  3GO5 A;  2CW0 C;  1I5F A;  1TII D;  1PH3 A;  1EY6 A;  2ALY B;  2WB1 E;  3T4A C;  3CF5 A;  5LMN W;  1MI2 A;  1LTG D;  1K8A C;  3WWV A;  1RF2 D;  2EJF C;  4I7Z C;  4DV6 Q;  1DON A;  2VUM G;  4CDF C;  2JA8 B;  4DAY A;  1IKL A;  2A6E D;  4GN3 B;  1PH5 A;  4QCL A;  2L5T A;  1SDF A;  1D1K A;  1IW7 D;  1PYW D;  4K6D A;  1YIT A;  2NVY B;  3Q24 A;  3H94 A;  1GUO A;  1BUV T;  1PYB A;  4NDX A;  5IP9 G;  5JJK A;  5KYL A;  1PTO B;  3MVV A;  5LL6 X;  1MKH A;  1NJI C;  2N78 A;  3GQB A;  1RIP A;  1S5B D;  5E1F A;  5JJZ A;  4ULL A;  5KNC A;  1T9H A;  3S14 H;  1A6X A;  2CQA A;  3JC6 6;  3HG9 A;  2RQX A;  3CCL A;  4A93 G;  1FVI A;  1YNX A;  1PH9 A;  1EFI D;  3N6R A;  1B50 A;  2MGS A;  4AH6 A;  1K3B C;  4RFB A;  4QQB X;  3RZO H;  4DV3 Q;  1A3V A;  1SNP A;  1LT5 D;  3TQY A;  1HNX L;  3H3V C;  3OOC A;  5IGG A;  3P1H A;  3HOV H;  2JN4 A;  1KDC A;  4LF5 L;  4X62 Q;  4LF8 Q;  2UXB Q;  1WTH A;  3OPO A;  1IBK Q;  4GN4 B;  4X6A H;  5JVH 3;  2XIW A;  5HGQ A;  3NWT A;  1E2Z A;  5C0X H;  1L1O C;  5A35 A;  5E4X A;  1HZA A;  2RHQ B;  4IZ8 A;  4CHT B;  4X66 L;  4XXE A;  3H3V I;  1TS3 A;  4KN4 C;  4LFB L;  5EPK A;  1WTP A;  4MZ9 A;  2PYK A;  5ELD A;  5FO9 B;  3CCM A;  1CTM A;  5COY A;  1CFM A;  5CBE E;  1IBL L;  2CH4 W;  3U9S A;  5M5Y H;  4DAV A;  2LMC B;  2ZM6 L;  4QF4 A;  2K5D A;  2MPM A;  1LYL A;  1GM5 A;  2CH4 A;  1XNR L;  4IFD J;  2LKV A;  4QJF A;  1NMF A;  2F0P A;  2F0G A;  4QIW E;  1YHQ A;  1UNS A;  2Z9H A;  2NZ1 D;  3HOX G;  3HOX H;  3PIP 3;  2EZV A;  1SBB B;  4CJ1 B;  3U4Z A;  4NMZ A;  4DR1 L;  5HY6 A;  4DR3 L;  3M7G A;  3TZD A;  1MGS A;  2EYF A;  3I7F A;  2XSC A;  3CD6 A;  2FHT A;  4DAP A;  2IPK D;  4Q0F A;  4HSV A;  2KHJ A;  3R8B A;  1SND A;  4DR4 L;  4RGN A;  3I4M G;  3PMF A;  2OQK A;  1VQ8 A;  1BKB A;  5FKA C;  4UP9 A;  3KJO A;  1JJ2 A;  4HJ5 A;  2B63 G;  2M9V A;  4KV6 A;  4QUC A;  2CWA A;  4MIU A;  1RJT A;  4PMB A;  3SE0 A;  5JOB A;  3GTL H;  4KI0 A;  2IW3 A;  4DV7 L;  1A8V A;  4JI2 L;  1TKW B;  1PMR A;  4IUN A;  2PQA A;  3S1N B;  1XWE A;  2KED A;  2C5C A;  4LFB Q;  2A73 B;  5FLX L;  5M5X H;  4B3M Q;  4DA2 A;  5C0X G;  3ZYY X;  1UE6 A;  3C1F A;  2F0W A;  1G91 A;  4LF7 Q;  2HIX A;  3KDF A;  1KXL A;  1PYS B;  1ROD A;  3D4W A;  5C44 H;  2FJ2 A;  4JBJ A;  3HOU H;  2VB3 X;  5EKI A;  3PCO B;  5I6W A;  3NE5 B;  3ERQ A;  1UUP A;  1XNR Q;  3KUP A;  2VQE L;  4OIK A;  4EQO A;  3DUZ A;  4JI7 Q;  4A93 H;  1TWF H;  1VQH A;  5ELC A;  3UE1 A;  1O7Y A;  3WDN A;  1E0B A;  1B7Y B;  2X6G A;  2R7Z B;  4OWT B;  2VXW A;  3ONA B;  3J80 i;  1N32 L;  4I65 A;  1K3R A;  1FGU A;  1RHP A;  2B63 H;  2HUG A;  3RNU A;  4JBM A;  2XRS D;  1Q7Y C;  2LXJ A;  1H9M A;  1I50 B;  2Z6K C;  4A3G B;  1DXM A;  2F0T A;  2PI2 E;  2L4N A;  3H0G H;  3GV6 A;  4ME5 A;  3S24 A;  1IYJ B;  2B2T C;  3Q8D A;  4C3J H;  3J7A 5;  4A76 A;  1SJH D;  2K05 A;  1STN A;  5G3L F;  4DV7 Q;  4JI2 Q;  5CMD A;  1B9M A;  1LTT D;  3QIA A;  1R4P B;  2EOT A;  3IFD A;  1GUT A;  1I4P A;  2LXK A;  3KF6 B;  5J3B A;  3KBX A;  4C3I G;  1VQD A;  1N33 L;  3K5L A;  2A6E C;  2R92 G;  2B8F A;  1U4R A;  2WAQ G;  3HKZ G;  1Y1W H;  1VQA A;  4OXP A;  1N34 L;  2RBM A;  1IHZ A;  4YCV A;  2XRQ D;  1PH7 A;  5IP7 H;  2NBF A;  3NQT A;  4BBS B;  2WIN B;  4KLK A;  1CKM A;  1U0L A;  4JI8 Q;  1G6Z A;  1L1O A;  2MO0 A;  2AQ1 B;  1PHJ A;  2SNM A;  2WKD A;  2EYL A;  5C5L A;  5EAY A;  4K0K Q;  1PTO C;  2BH8 A;  4DV4 Q;  2R7D A;  1Q1B A;  3B6Y A;  4A3C G;  3FPU B;  1I94 L;  4DV0 L;  4HN7 A;  2J0T D;  4BBS H;  4RWS C;  1ENF A;  4DV3 L;  4BY7 B;  1CSQ A;  4YCU A;  3GTJ B;  1SNQ A;  2ZXP A;  3OHX C;  3CCU A;  5KIX A;  5DNF A;  4R4O A;  5JEA H;  2JYO A;  3M3Y B;  2KCC A;  1IBK L;  3Q0A A;  3BDL A;  2K75 A;  2DUD A;  1WJJ A;  2F52 A;  4LNQ A;  4ZCK A;  1ENA A;  2MHV A;  3IKJ A;  1G8Z D;  1Y1W G;  1I4Q A;  5C0X J;  2BCO A;  4A3I H;  2ICE C;  1Q90 A;  4JI5 L;  2XVS A;  1N8R C;  5JVG 3;  5CV9 A;  5ELO A;  3J80 c;  1F2M A;  5FLX E;  1IYU A;  3W2D A;  4C3J B;  2YU9 B;  3L7Z C;  4KKT A;  4A3B G;  1KDB A;  4G57 A;  3CKI B;  1TWA H;  3SXH A;  2JJQ A;  1CKN A;  1GUG A;  4GNX C;  3QOL A;  1B44 D;  3RUZ A;  1GJX A;  4JI8 L;  1U9R A;  1BBU A;  1WI5 A;  3GTM B;  3SK4 A;  1TWH H;  2F4V L;  4O2D A;  4JI3 L;  1TWF B;  1MIU A;  4PG3 A;  2EYJ A;  4L5R C;  3C2P A;  1SFO H;  4M1U B;  1J9O A;  3J80 L;  5EKK A;  3S1Q B;  4BA1 I;  2TSS A;  1LAC A;  1G6P A;  2UUA Q;  1VQO A;  1IBM Q;  2BOS A;  4B3S Q;  3C1E A;  1G2S A;  3S17 B;  2AQ2 B;  5E7N A;  4OL7 A;  5C44 B;  4R1J A;  3LGJ A;  5C4J B;  2K28 A;  5KYI A;  2OF1 A;  4XQQ A;  1H9S B;  3Q22 A;  1JJG A;  4B9W A;  2IY5 B;  2PW5 A;  3M4O H;  1ILP A;  4IPC A;  4DNR B;  1L0X B;  3D6W A;  1JJC B;  1VQ9 A;  2Z4I A;  3H91 A;  3RLF A;  2OTL A;  3K8A A;  5ELE A;  5IGF A;  1QNU A;  1JMC A;  4H13 C;  3QJY A;  4DK0 A;  1MJE A;  2I5L X;  3I3C A;  4C1N I;  2L15 A;  2UXD L;  3DM3 A;  1EWI A;  4LMQ D;  1E22 A;  4UP8 A;  3TEH B;  1TY2 A;  1S5C D;  1WCM B;  3PUV A;  1TWG H;  3PF4 A;  2JXM B;  3KJP A;  2QW7 A;  4G7H C;  1FL0 A;  5C4Z A;  2IX1 A;  1PFB A;  1NTG A;  4DNI A;  3T51 B;  4JI7 L;  3MEF A;  2L0C A;  3F2U A;  3TN2 A;  2MUY A;  2QCP X;  3H3V H;  3PO2 H;  5IYB G;  2Q8R E;  1NUC A;  4TRD A;  3CCE A;  2PNR C;  2LS0 1;  4IUQ A;  4M8A A;  4OIJ A;  5EGT A;  5GRO A;  1KL9 A;  1K28 A;  2N8N A;  2FMM A;  4Y52 H;  1A62 A;  3CQZ B;  5C0X I;  1K83 B;  1YHA A;  3MXG A;  1Z9F A;  3I91 A;  4RGT A;  4ZQ3 A;  1YIJ A;  3OYY A;  4MN3 A;  1TQO A;  1Q8K A;  1PDQ A;  1EUJ A;  5M5Y B;  4DAY B;  4L8J A;  4F7X A;  3QB3 A;  5CV7 A;  1Q82 C;  4LUZ A;  2I0Q A;  3GTG B;  3HFZ B;  5G3L D;  5C3E B;  1WYD A;  1SNC A;  3TP6 A;  4KKU A;  1QZH A;  5KND A;  4OON A;  1ASZ A;  3M85 A;  2NWG A;  1E7Z A;  3PO3 B;  4A3K H;  2DNE A;  4IFD H;  2F0M A;  2B2U A;  4KY6 A;  3SEB A;  2DJF C;  3BYT B;  4BY1 H;  4PNY A;  3WOE A;  1N33 Q;  2JA8 G;  1A2U A;  3PUZ A;  1I3Q B;  1M1K C;  4JG2 A;  3OMG A;  4J15 A;  1M8A A;  1V1Q A;  3ER0 A;  1E1O A;  2E5L L;  2V1C C;  1HNZ L;  4OWW B;  5FLM H;  4LW1 A;  4LJZ C;  3HGB A;  3VYR A;  1TY0 A;  1VDZ A;  1KRS A;  3CU7 A;  3GTQ B;  5M3F G;  4ME3 A;  3OSO A;  2E75 C;  3I2Z A;  2WAQ E;  4ZUJ A;  2JA7 B;  4DR2 L;  2KUM A;  4DR6 Q;  4FXK C;  3SK5 A;  1SMY C;  4K0K L;  3HKS A;  4FF4 A;  2ENB A;  4TSS A;  2Q8I B;  1ZXT A;  2VUM H;  3G71 A;  3I4N B;  2E2H B;  4JOI A;  1SJE D;  5ELB A;  1CZG A;  2K5V A;  5C6A A;  1F77 A;  1OXT A;  3STB C;  4JCV E;  1BOS A;  1ESF A;  5C4H A;  3I90 A;  4B3T L;  4XYQ A;  4TKO B;  1I4G A;  1N9W A;  1UEA B;  1B2T A;  1HXY D;  4UY8 C;  2NVY H;  5JAV A;  2NN6 I;  3ITP A;  3TZU A;  1F2Y A;  2ES2 A;  5IYC H;  2PZW A;  3LWE A;  5EJW A;  1SLJ A;  3I4M H;  2EVB A;  1R9T B;  4LK1 C;  4C3H B;  3M4Q A;  4JI5 Q;  2EPB A;  5J22 A;  1UEB A;  3RLO A;  3K7A B;  3K6O A;  1SMX A;  3SGI A;  1GVP A;  1U4P A;  4HJA A;  4LFA Q;  1XPU A;  4A3E H;  2ZJR A;  4HJ9 A;  1Y69 U;  4DUZ L;  1HJP A;  4P73 A;  4CJ2 C;  1T5E A;  2Y0S E;  1N36 Q;  3W1G A;  3A5U A;  4A3J G;  3ND8 A;  4MTN A;  3BS1 A;  1QIL A;  1YI2 A;  4XT3 B;  2NVX H;  2EQS A;  1HNZ Q;  4FF3 A;  1LTR D;  1AE3 A;  5M3M H;  4K2K A;  4ZLT F;  1HUN A;  5M3M G;  3A0J A;  5IWA L;  3TS0 A;  2Q2T A;  2R93 H;  4IPG A;  4WOR A;  4ZUI A;  4EQN A;  2UXC L;  3R93 A;  1K9M C;  2OWO A;  3S16 B;  1K8O A;  3GDE A;  1GUN A;  2IHE A;  4OWX B;  3ERO A;  3PO2 G;  1HFN A;  5M5W B;  4HCS A;  1JWS D;  2O5J C;  3J81 c;  2YTX A;  3J81 i;  1BCP F;  2B2U C;  1IBM L;  2LY7 A;  2B2Y A;  1GOZ A;  2E2I H;  4JBW A;  2JE6 I;  4IAL A;  1EEF D;  1U5K A;  1BQQ T;  3PUY A;  1WD1 A;  4OEL B;  2R6G A;  1YZ6 A;  2SOB A;  4XIG S;  3I4L A;  2J4X A;  4CDC C;  4IUT A;  3RN5 A;  1AFP A;  2YTY A;  1CI3 M;  3PQI A;  5IYD H;  1WCM G;  3FRP B;  1DM0 B;  3F2C A;  1LTA D;  2F3W A;  4X3T A;  2E74 C;  4YHH L;  1VQM A;  2KCT A;  2VY3 A;  2EYP A;  1XMO L;  5GAE C;  3BZK A;  4A3F H;  4A3D B;  1J5E Q;  3GTK B;  5I9P A;  4A3I G;  4C1N K;  3MXN B;  4C3J G;  3Q23 A;  3FHW A;  5COR A;  2IT1 A;  5AFW A;  4LFA L;  1Y1V B;  2PPB C;  4H44 C;  4TQU S;  1SNO A;  2ZTE A;  2OXP A;  1N36 L;  1OXU A;  3S2H H;  1Y8O B;  4XYO A;  4ZK9 B;  3FMC A;  5M3F H;  1DZ1 A;  4B9X A;  1Q81 C;  3VA7 A;  4YIJ A;  1K0S A;  2EXZ A;  2EIF A;  3BG3 A;  2VNU D;  1GO3 E;  1JE5 A;  1LTS D;  1EYA A;  4DK3 C;  2UU9 Q;  1XNQ Q;  4A3L H;  4GKJ Q;  1WTO A;  1ZKO A;  4A4I A;  3D4D A;  3NBH B;  1BNZ A;  4DV2 Q;  1SE4 A;  4B3R Q;  2R92 B;  3CP0 A;  5M3F B;  3ULL A;  4CDD C;  1VQB A;  2IJ0 A;  3MA2 B;  1JIC A;  3KLS X;  4NKL A;  3SR1 A;  1G51 A;  4O0A A;  3E0E A;  4YHH Q;  5C3X A;  1D2B A;  1CA5 A;  5FOB B;  1XMO Q;  1RKN A;  3AB9 A;  1EY7 A;  4YWL A;  1S4Z A;  1SE8 A;  3OTO L;  1QOH A;  2EXD A;  4QIW B;  3DLL A;  4DU9 A;  1KAW A;  1B4O A;  3S1R B;  4JW0 A;  4FXG C;  1I4H A;  1GHK A;  3GTK H;  2NTT A;  4C2M H;  1PFN A;  3BDO A;  4A3F B;  1BCP D;  5DM6 3;  2F4I A;  1VMP A;  1TVX A;  3S1M H;  4RHR A;  1EQR A;  2IL8 A;  1HR0 Q;  2JA6 G;  1EY4 A;  2FFK B;  2DY7 A;  3KYH C;  1VMC A;  5I2Y A;  2F0E A;  2B2V C;  4RG1 A;  3KF8 B;  5LMU L;  2JK8 A;  5CV5 A;  2HHH L;  2BDO A;  4HMI A;  3ULJ A;  3ULP A;  2VS1 A;  1JB7 A;  4K5X A;  3EVQ A;  2XN9 C;  1O7I A;  1SMY D;  2K32 A;  3FKI B;  3TP8 A;  3L3O C;  4G7Z C;  4B08 A;  2DJG C;  3S16 H;  4BXX H;  4TVA B;  2RF4 A;  1FR3 A;  3CPF A;  1PH1 A;  4DV2 L;  4B3T Q;  3HOW H;  1P16 A;  1VQE A;  2TMP A;  3OW2 A;  2RVL A;  2NVX B;  3E6Z X;  2RDG A;  3DWA A;  2PQE A;  2K04 A;  2D5D A;  4P72 A;  2OT2 A;  1IL2 A;  2B2W A;  1H9K A;  4PZ7 A;  1PZI D;  4A3E B;  1JOO A;  5DEH A;  1AZQ A;  2UUB Q;  1I4X A;  3E5S A;  4N9T A;  5E4W C;  3K7A H;  1AE2 A;  3PV0 A;  1XMQ Q;  1AW7 A;  2F0V A;  5CC4 A;  2F0D A;  2F0J A;  4IPH A;  1F9P A;  1EYC A;  3T1H Q;  4MTK A;  3KBG A;  2A19 A;  2C35 B;  1R9T H;  3I4M B;  3BZC A;  3U9O A;  4UPA A;  1GUS A;  1YBY A;  1X32 A;  5DLQ E;  4EQP A;  2JA6 B;  3S2D B;  3OWE B;  2O2L D;  5FK9 C;  1RD9 D;  2PZU A;  1HR0 L;  5FO8 B;  2EY1 A;  1W3S A;  3V96 A;  5K36 G;  1X3G A;  3NSW A;  1KIX A;  2QIL A;  2HHH Q;  2YV5 A;  4DPG A;  5C3W A;  1A0I A;  5IT9 L;  1HRJ A;  3IRB A;  2EYO A;  4P71 A;  3SK8 A;  2WII B;  3TRE A;  1O78 A;  4IN3 A;  1KD1 C;  1SYC A;  3VR3 A;  5FO7 B;  4GOP B;  1CSP A;  4X65 Q;  3HOY B;  4GLX A;  1DOM A;  1ML0 D;  1CQV A;  3CAM A;  2KA7 A;  1EY5 A;  3UDF A;  3UE0 A;  2IX3 A;  1XTC D;  3F8T A;  3HOZ G;  4PQX A;  2KHI A;  1I3Q H;  1F9Q A;  2ZXR A;  5IGD A;  1VF7 A;  2LFN A;  3CCJ A;  4BY1 B;  3O13 A;  1AEX A;  1JQY D;  1VS0 A;  5AJ3 Q;  2HDM A;  1J8I A;  2KBN A;  2G9H D;  3RD4 A;  1VQ7 A;  5C3E H;  3AQQ A;  5ELF A;  4JC0 A;  4A3M B;  3HOV G;  3J7A F;  4RKL A;  2ZM6 Q;  4J8Q A;  3OIQ A;  1YJW A;  2E76 C;  3S15 B;  3P7J A;  2K1B A;  1YVC A;  3MAQ A;  3MEH A;  1CUK A;  4KY5 A;  1L2F A;  1TS5 A;  1G2T A;  1EY9 A;  1SR3 A;  3NBH A;  2A1A A;  3X3N A;  3VR5 A;  4GKJ L;  1VQ4 A;  3KFU A;  3J80 E;  4IFD I;  5NUC A;  4GNX B;  3UDG A;  2B2T A;  1EQT A;  4DR3 Q;  2AWO A;  1KHI A;  1E2V A;  1HCZ A;  2J7Z A;  2BDN A;  5BR8 Q;  2D0P A;  2HQE A;  1K8M A;  1E2W A;  4A3B B;  1STH A;  2K5H A;  2PI2 A;  3DM1 A;  3S2D H;  4KHZ A;  2JA6 H;  2EJM A;  2NVQ B;  1VQF A;  5TSS A;  3LX0 A;  3HZX A;  2D2C C;  2JEB I;  5IP7 G;  1PXU A;  4HR7 B;  3HKZ E;  3W3A A;  2GN5 A;  4JI6 L;  5JJL A;  1JOK A;  2Z6B A;  3EFX D;  2QA4 A;  3EQL C;  4H02 A;  4HAE A;  1AP0 A;  2FMC A;  1LM0 A;  4U68 A;  2F0N A;  1FNU A;  2WKC A;  2B3G A;  4CGY B;  4C3I H;  5AJ3 L;  3GTO B;  2F0I A;  4ALP A;  3ND9 A;  5BN4 A;  4HCE A;  4JI4 Q;  1Y1V G;  4X64 L;  3M4O B;  1DOL A;  2QF7 A;  4YY3 L;  4G7O C;  2EDG A;  1UE1 A;  2N3S A;  1D8L A;  4CKB A;  1HA5 A;  3J7Z C;  1ET9 A;  4DUY L;  1CZW A;  3MFY A;  2P5Z X;  3A56 A;  3T1Y L;  1PTO F;  4UHV A;  3VDY A;  3FVQ A;  4R4C A;  1KQS A;  4JK1 C;  1HQM C;  3NTK A;  2DGY A;  2Q2I A;  4PMW A;  1VF5 C;  1I4R A;  1SFO B;  4A3C H;  3I4N G;  1EQQ A;  2QDL A;  1KC8 C;  3PUX A;  3CPW A;  1SYF A;  4Z9C B;  1X9N A;  2B39 A;  5GAH C;  3S1M B;  2NYZ D;  4LF4 L;  4IJH A;  4WJ3 M;  2C9O A;  4X62 L;  3AEV A;  5IIF A;  4ABN A;  2DY8 A;  4HJ7 A;  2B2V A;  1OTC A;  2K52 A;  1TWA B;  2HQL A;  2F0K A;  4U67 3;  4DV5 Q;  4EQ5 A;  2UUB L;  5IT9 c;  1VQC A;  4LFC L;  4V0B A;  5T1G A;  4DR7 L;  4IUP A;  1S72 A;  1BBW A;  1XMQ L;  4C3H G;  2H4O A;  1Q3L A;  1WOC A;  2X69 A;  2ASB A;  3MZ5 A;  4JOI C;  4YY3 Q;  2KCN A;  1X56 A;  1N34 Q;  5IP9 H;  4DUY Q;  3PIO A;  1B70 B;  4POG A;  3M3Y H;  1HTL D;  2AWN A;  3MXU A;  1YJ9 A;  1V43 A;  2EY5 A;  4JI0 Q;  2F0L A;  3RMH A;  1W6J A;  1PLF A;  4MHE A;  5HUR A;  1NE3 A;  3K57 A;  2IHF A;  1ESR A;  5FLX c;  4DV4 L;  4RGM A;  4DR1 Q;  4DR5 L;  1VQJ A;  1PZK D;  4N8F A;  5M9O A;  4RCO A;  3CMA A;  1PH6 A;  1QB5 D;  2L9H A;  4DR4 Q;  4WJW A;  5IOD A;  1XTD A;  2O5I C;  3BDC A;  3L0O A;  4A3J H;  2JA5 H;  3H0G G;  3BVG A;  3OWF A;  1UE5 A;  1E24 A;  2Q8T A;  5C4X B;  2B2W C;  1FYC A;  3E0J A;  2K5W A;  3VA5 A;  3FP9 A;  1GUW A;  1CKN B;  1C9O A;  1HNW Q;  3ICE A;  4RAU C;  4A3D H;  1LUZ A;  1T5X D;  1Z6H A;  4HJ8 A;  3PIP A;  2K03 A;  2Z6K A;  1EU3 A;  3RR5 A;  4L5S A;  1LTB D;  1CQF A;  3JAM L;  2ID0 A;  1EYD A;  4PV1 C;  1MHW C;  5EPL A;  1BVS A;  1DCZ A;  1D1I A;  2K7V A;  5IYD G;  4DAM A;  2A6H D;  5C4X H;  2HD3 A;  3BU2 A;  5C4X G;  2JA5 B;  3NTI A;  4ZYS A;  3JAM i;  3MWY W;  1TT2 A;  3JAM c;  5I2X A;  4R4I A;  2F03 A;  1NR4 A;  1OO9 B;  1EWH A;  1WFQ A;  1RCV D;  3LNN A;  4KD4 A;  5EKL A;  1ZEQ X;  3T53 B;  4H0L C;  1BBX C;  2I5H A;  5DM7 3;  1FNW A;  2BH2 A;  1C8C A;  4DR5 Q;  4DKA C;  1N32 Q;  2E2J B;  2K6A A;  2A68 C;  3MFG A;  3QG1 A;  2UUA L;  3CRK C;  1HNX Q;  1GHJ A;  4GN5 A;  1CKO A;  4QY7 A;  2H5X A;  2NB0 A;  3DWP A;  4LF6 L;  5J1Z A;  4A3G G;  4LF5 Q;  3K81 C;  4P75 A;  2CVR A;  2CW0 D;  4AYB G;  4FVM A;  4ID6 A;  3G6E A;  4KTA A;  4QGU A;  1HNW L;  2RKS A;  3DEO A;  3PGZ A;  4C3H H;  5IOC A;  3M7N A;  4A3K G;  3NEN A;  3OIP A;  4IFD G;  4N8X 1;  4ZRZ A;  5CBA E;  2WAQ B;  4BY7 G;  4ODG A;  4BBR H;  4X64 Q;  3GTL B;  1C48 A;  4KY7 A;  2UXD Q;  1QVC A;  4WJ4 A;  5KEE A;  4XTC S;  1EOT A;  3RZD H;  1YEZ A;  3BVZ A;  1AZP A;  4K8I A;  1K8G A;  3CCQ A;  1CK1 A;  4APV A;  3NTH A;  3I4N H;  1SSO A;  1HTP A;  3PUW A;  1ICF B;  2KHS A;  3VYU A;  4GNX A;  3DMU A;  1SRO A;  1LO5 D;  2GA4 B;  1HUM A;  4MNO A;  1EY8 A;  5F2D A;  3F2B A;  3HOX B;  4ZKB B;  3A7L A;  2HIV A;  1IXR A;  5ISR A;  3GTQ H;  4JYA L;  1NAP A;  1D5M C;  4QL5 A;  1JOR A;  2QEJ C;  1SE3 A;  1NSN S;  4O1N A;  2F3I A;  4WFN 3;  4IOC A;  4OO1 I;  3K58 A;  4BS9 A;  2Z8L A;  2RA4 A;  3G48 A;  3TSS A;  4LFC Q;  4DR7 Q;  1X3E A;  4A3K B;  1M4V A;  3GP7 A;  1SE2 A;  3H6M A;  4OHJ A;  4C3I B;  5GQO A;  1NMG A;  2Q2U A;  1E3P A;  1PTO D;  5A2Q L;  2WAC A;  4HIM A;  1H9J A;  4C56 C;  3S9W A;  2L55 A;  3C3L A;  2AUJ D;  2FXQ A;  2G9D A;  1H95 A;  3NPP A;  2QGQ A;  1SAP A;  1A15 A;  4LAA A;  2PNH A;  2NN6 G;  1WTQ A;  2A6H C;  1KNA A;  4JI1 L;  1MSG A;  2RDF A;  3PIO 3;  1TS4 A;  3K0X A;  4KHV A;  3HOV B;  4JI0 L;  2MNA A;  4A3B H;  3PO2 B;  2F4V Q;  3IL8 A;  4DR2 Q;  1PRT C;  4DR6 L;  5D14 A;  5IYB H;  1K73 C;  3SK6 A;  4OGQ C;  3J81 E;  1WVL A;  2FIN B;  4BY1 G;  2F0H A;  1NY4 A;  1YJN A;  4RGO S;  2B8G A;  1SYB A;  5CR3 A;  2LSS A;  2ZJP A;  2KOL A;  1XXG A;  3DXJ C;  2CCZ A;  4LUV A;  2MO1 A;  1PTO H;  2RCN A;  1XYI A;  3KF8 A;  1L0Y B;  3NUC A;  2A69 D;  5FLM G; 
#chains in the Genus database with same CATH homology
 2SEB D;  4Q5V A;  3K5N A;  3AU7 A;  1Y8P B;  2BA0 A;  3NHH A;  3DEP A;  4G4K A;  1EY0 A;  4KN7 C;  4KK7 A;  2YYZ A;  2A74 C;  2F0O A;  1Q1E A;  5I9O A;  4QUF A;  2L1B A;  3BYY B;  1X3Q A;  2X6L A;  2PMZ B;  3D31 A;  1WTX A;  1BR9 A;  2CHB D;  4CKE A;  1A3T A;  1STY A;  2I07 B;  1S5F D;  1OXV A;  2I46 A;  1TWH B;  3K59 A;  2SDF A;  2N55 A;  4R8I A;  5J39 A;  2V4D A;  1S5E D;  3RZD B;  2A68 D;  1HFG A;  3A55 A;  2KEE A;  1H9R A;  1SYG A;  3HP3 A;  3EJI A;  4BBR B;  3P20 A;  5D65 A;  4FP5 D;  1AN8 A;  3NWS A;  1QJO A;  1HA6 A;  1FGB D;  1ILQ A;  1EEI D;  4K5W A;  3SHL A;  3EA6 A;  1F2L A;  4IUU A;  2SNS A;  1QE6 A;  3V05 A;  1IKM A;  1XX8 A;  4XQJ A;  1F2Z A;  1EL0 A;  1KNE A;  1H9S A;  5I6Y A;  1QNK A;  1WTV A;  5EBD A;  1WTW A;  4V19 0;  1EIH A;  4DGZ A;  3I70 A;  5K5P A;  2ZT9 C;  4KMU C;  2HDL A;  3NK9 A;  4BWG B;  5T1I A;  2WB1 B;  3VYS A;  3QOJ A;  3D6C A;  2JP1 A;  1QG7 A;  1LV9 A;  1OXX K;  2BE5 D;  4UDU C;  4E6I A;  5CYU A;  4RKB A;  4FF2 A;  3I8Z A;  3HRZ C;  1JWU D;  4N9P A;  4C2M B;  1ET6 A;  3MXP A;  2EY6 A;  3FEW X;  1EZ8 A;  5D3I B;  1W6K A;  2EYM A;  4DXF A;  3JAM E;  4DNT B;  2R3Z A;  2PCF B;  3BZD B;  4A3J B;  1SXT A;  1U4M A;  4FO2 A;  1WD0 A;  1V1P B;  3I72 A;  4FF1 A;  5EPJ A;  2PW7 A;  3H09 A;  2MP1 A;  2XNA C;  1C4Q A;  1A2T A;  4EGV A;  1RTO A;  1YNJ C;  1CHP D;  3VYT A;  5DAU A;  3NP8 A;  4A93 B;  4K8J A;  1B3A A;  5E3F A;  4BA2 I;  3CHB D;  1O7Z A;  3HKZ B;  3KLR A;  1CT1 D;  5JEA J;  3J7Y W;  4K2L A;  3HOU B;  3A8K E;  1TWC B;  3R2I A;  2KQ3 A;  2OEO A;  1YNN D;  4RHS A;  2F0S A;  3VR2 A;  3S2H B;  2IX0 A;  3OMC A;  1YNJ D;  5M5X B;  2HCI A;  1ENC A;  3SDZ A;  4DF7 A;  5BN3 A;  4ZKC B;  5IGC A;  2NUC A;  2K01 A;  4X3S A;  1QCB D;  4J1M A;  5A2Q E;  1STB A;  2WP8 J;  4UAI A;  1JR0 D;  1TS2 A;  1YNN C;  1I6V C;  2WV6 D;  3T13 A;  3M4Y A;  2QDB A;  1BF4 A;  4IUV A;  4DN4 M;  1KLG D;  2KEC A;  2NVT B;  3HS0 C;  1O80 A;  1ZYR D;  4CKC A;  2R93 B;  1JOQ A;  3DWQ A;  3UI2 A;  3J7A V;  4RH6 A;  2NN6 H;  5CV8 A;  2M2L A;  1OXS C;  3C46 A;  5M3M B;  1D6E C;  1CA6 A;  2A5H A;  2PO4 A;  4K14 A;  1F9R A;  1Z47 A;  3NXW A;  1MSH A;  1PRT D;  4RA8 A;  4XDX A;  1U4L A;  1S5D D;  1A3U A;  4HTH A;  3CRL C;  2K5Q A;  5D3D A;  1B53 A;  3QO2 A;  2F3V A;  2QKI C;  3DHQ A;  3K5M A;  1PZJ D;  3TDQ A;  3TP7 A;  4NP5 A;  4Y7N B;  3RZO B;  4XT1 B;  2Z4H A;  4OO1 G;  2L12 A;  2L11 A;  3URY A;  3S14 B;  3J81 L;  4K6L A;  1V1O A;  1LT3 D;  2VUM B;  3TME A;  2F0F A;  1SYD A;  1IYV A;  1JWM D;  5CV4 A;  4DFA A;  3R3O A;  3WOF A;  1BCP C;  1BDO A;  1LAB A;  2Z1C A;  4XQN A;  2KVM A;  1ICW A;  4S3S A;  3NQI A;  1JE4 A;  1R4Q B;  2RSN A;  1Y8N B;  2O4X A;  3A54 A;  1MBY A;  3G7L A;  5KNB A;  2EYH A;  5LL6 S;  1GXD C;  1B9N A;  2D62 A;  2HCC A;  3BVM A;  2RDH A;  1MD2 D;  2ZXO A;  3KK7 A;  4F88 A;  5IGB A;  1RTN A;  3GD7 A;  4H7B A;  3V2T A;  2VB2 X;  1PFM A;  2JSO A;  4ILW A;  1Q12 A;  4QMG A;  4R8N A;  1TR5 A;  5BN5 A;  1II3 A;  1Q8I A;  1KAA A;  4EVO A;  2IWH A;  2F1M A;  3K5O A;  3A8J E;  3TBI B;  4DXG A;  2EJG C;  1HHV A;  4KJN A;  1EWC A;  1ZYR C;  5C5M A;  1STE A;  2XWB B;  3FDT A;  1LT6 D;  3QWN A;  2A69 C;  1TWG B;  3K0Y A;  5EBC A;  4QB4 A;  1HQR D;  1CHQ D;  3T56 B;  4CBV A;  5IT9 E;  1SYE A;  4WRD A;  1ONL A;  5HGT A;  1JCK B;  3KLS A;  1X3P A;  2M00 A;  4ZAI A;  4FYD A;  2BE5 C;  3HOW B;  2EE1 A;  3NBI A;  1IL8 A;  4AYB B;  4R9W A;  3HOZ B;  1LTI D;  3SVM A;  1DJR D;  1JB3 A;  1EQV A;  1KAB A;  1KTK A;  1STG A;  2R61 A;  1TU2 B;  2MJ8 A;  5CGK A;  4X3K A;  1V8Q A;  3HEJ A;  4P2C B;  3AMU A;  2NTS A;  2PZT A;  4K5V A;  1QWY A;  1PRT B;  3A7A B;  2Y0S B;  4IUR A;  1EU4 A;  3N52 A;  1FNV A;  1O7L A;  1D5Z C;  1B1Z A;  1KDA A;  1D5X C;  3D4R A;  4KD3 A;  3T16 A;  3D3R A;  4HSP A;  4L63 B;  3MHB A;  1JC7 A;  4A3I B;  1VCI A;  2DNC A;  4KJO A;  2EY2 A;  1IW7 C;  3MTS A;  2F0Q A;  2E2D C;  5JPN C;  5IGE A;  3VR6 A;  1LT4 D;  2BA1 A;  5LHY 1;  3X3M A;  4GZY C;  4F87 A;  3GTP B;  1DOK A;  1UAP A;  5I4D A;  2H1E A;  4PMC A;  3TP5 A;  5K36 H;  4KKS A;  4FNF A;  1DYQ A;  1DD2 A;  4OO1 H;  3A8I E;  3P75 A;  5CV6 A;  4CJ0 B;  1NCV A;  2N88 A;  5JPM C;  4FXD A;  5KGU A;  1EZ6 A;  1Y1W B;  4DK1 A;  1BO0 A;  2D9U A;  1BCP B;  5EQ0 A;  3D8G A;  4J6H A;  1SEB D;  2AQ3 B;  3FPP A;  4F8M A;  3L9A X;  2AUK A;  4L6T B;  1CM9 A;  5KRU A;  1RDP D;  3MXN A;  3OW7 A;  2KJX A;  3IFT A;  3H0G B;  1G29 1;  1F9S A;  1WTR A;  2E2I B;  2F0U A;  3G6J B;  1SNM A;  1BXT A;  2JEA I;  4X3U A;  4O42 A;  2B63 B;  2DN8 A;  1Z7T A;  4IQZ A;  1HPC A;  3LWU A;  3I73 A;  2B2Y C;  3R2T A;  2RSO A;  2XWJ B;  1I6H B;  4HED A;  3IAY A;  4HMJ A;  1EIG A;  3GV3 A;  1LLR D;  4RCN A;  1STA A;  3VR4 A;  2ICI A;  3MC0 B;  5JEA G;  1V1P A;  4NW2 A;  3Q6S A;  1FD7 D;  1KLU D;  2K33 A;  1NR2 A;  1PRT F;  3GO5 A;  2CW0 C;  1TII D;  1EY6 A;  3T4A C;  1MI2 A;  1LTG D;  1RF2 D;  2EJF C;  4I7Z C;  1DON A;  2JA8 B;  4DAY A;  1IKL A;  2A6E D;  4QCL A;  2L5T A;  1SDF A;  1D1K A;  1IW7 D;  1PYW D;  4K6D A;  2NVY B;  3Q24 A;  3H94 A;  1GUO A;  1BUV T;  4NDX A;  5KYL A;  1PTO B;  3MVV A;  5LL6 X;  3GQB A;  1S5B D;  5E1F A;  5JJZ A;  4ULL A;  5KNC A;  1A6X A;  2CQA A;  3HG9 A;  2RQX A;  1EFI D;  3N6R A;  1B50 A;  2MGS A;  4RFB A;  1A3V A;  1SNP A;  1LT5 D;  3H3V C;  3OOC A;  5IGG A;  3P1H A;  1KDC A;  3OPO A;  5JVH 3;  2XIW A;  3NWT A;  1E2Z A;  5C0X H;  5A35 A;  5E4X A;  4IZ8 A;  4CHT B;  4XXE A;  1TS3 A;  4KN4 C;  5EPK A;  1WTP A;  2PYK A;  5ELD A;  5FO9 B;  1CTM A;  5COY A;  1CFM A;  5CBE E;  3U9S A;  4DAV A;  2LMC B;  4QF4 A;  2K5D A;  2MPM A;  4IFD J;  2LKV A;  2F0P A;  2F0G A;  1UNS A;  2NZ1 D;  3PIP 3;  2EZV A;  1SBB B;  4CJ1 B;  4NMZ A;  3M7G A;  3TZD A;  1MGS A;  2EYF A;  2XSC A;  2FHT A;  4DAP A;  2IPK D;  4Q0F A;  4HSV A;  3R8B A;  1SND A;  4RGN A;  3PMF A;  5FKA C;  2M9V A;  4KV6 A;  4QUC A;  4MIU A;  1RJT A;  4PMB A;  3SE0 A;  5JOB A;  4KI0 A;  2IW3 A;  1TKW B;  1PMR A;  4IUN A;  3S1N B;  1XWE A;  2KED A;  2C5C A;  2A73 B;  5FLX L;  4DA2 A;  5C0X G;  3ZYY X;  3C1F A;  2F0W A;  1G91 A;  1ROD A;  3D4W A;  2FJ2 A;  2VB3 X;  5EKI A;  5I6W A;  3NE5 B;  3ERQ A;  1UUP A;  3KUP A;  4OIK A;  4EQO A;  3DUZ A;  5ELC A;  1O7Y A;  3WDN A;  1E0B A;  2X6G A;  2R7Z B;  2VXW A;  3ONA B;  4I65 A;  1RHP A;  2HUG A;  2XRS D;  1H9M A;  1I50 B;  4A3G B;  1DXM A;  2F0T A;  2L4N A;  3GV6 A;  4ME5 A;  2B2T C;  1SJH D;  2K05 A;  1STN A;  5G3L F;  5CMD A;  1B9M A;  1LTT D;  3QIA A;  1R4P B;  2EOT A;  3IFD A;  1GUT A;  1I4P A;  3KBX A;  4C3I G;  3K5L A;  2A6E C;  2B8F A;  1U4R A;  2RBM A;  1IHZ A;  2XRQ D;  2NBF A;  3NQT A;  4BBS B;  2WIN B;  1G6Z A;  2AQ1 B;  2SNM A;  2WKD A;  2EYL A;  5C5L A;  1PTO C;  1Q1B A;  3FPU B;  4HN7 A;  2J0T D;  4RWS C;  1ENF A;  4BY7 B;  3GTJ B;  1SNQ A;  2ZXP A;  3OHX C;  5KIX A;  5DNF A;  5JEA H;  2JYO A;  3M3Y B;  2KCC A;  3Q0A A;  3BDL A;  1ENA A;  2MHV A;  3IKJ A;  1G8Z D;  1I4Q A;  5C0X J;  2BCO A;  2ICE C;  1Q90 A;  2XVS A;  5JVG 3;  5CV9 A;  1F2M A;  5FLX E;  1IYU A;  3W2D A;  4C3J B;  2YU9 B;  3L7Z C;  4KKT A;  1KDB A;  4G57 A;  3CKI B;  3SXH A;  1GUG A;  3QOL A;  1B44 D;  3RUZ A;  1GJX A;  1U9R A;  3GTM B;  3SK4 A;  1TWF B;  2EYJ A;  3C2P A;  4M1U B;  1J9O A;  3J80 L;  5EKK A;  3S1Q B;  4BA1 I;  2TSS A;  1LAC A;  2BOS A;  3C1E A;  1G2S A;  3S17 B;  2AQ2 B;  4OL7 A;  5C44 B;  5C4J B;  2K28 A;  5KYI A;  2OF1 A;  4XQQ A;  1H9S B;  3Q22 A;  4B9W A;  2PW5 A;  1ILP A;  4DNR B;  1L0X B;  3D6W A;  2Z4I A;  3H91 A;  3RLF A;  5ELE A;  5IGF A;  1QNU A;  4H13 C;  3QJY A;  4DK0 A;  3I3C A;  4C1N I;  4LMQ D;  1TY2 A;  1S5C D;  1WCM B;  3PUV A;  2JXM B;  4G7H C;  5C4Z A;  2IX1 A;  1PFB A;  3T51 B;  2L0C A;  3F2U A;  3TN2 A;  2MUY A;  2QCP X;  2Q8R E;  1NUC A;  4TRD A;  2PNR C;  2LS0 1;  4IUQ A;  4M8A A;  4OIJ A;  5EGT A;  2FMM A;  3CQZ B;  5C0X I;  1K83 B;  3MXG A;  3I91 A;  4RGT A;  4ZQ3 A;  4MN3 A;  1TQO A;  1PDQ A;  5M5Y B;  4L8J A;  4F7X A;  3QB3 A;  5CV7 A;  3GTG B;  5C3E B;  5G3L D;  1SNC A;  3TP6 A;  4KKU A;  5KND A;  3M85 A;  2NWG A;  3PO3 B;  2DNE A;  4IFD H;  2F0M A;  2B2U A;  4KY6 A;  3SEB A;  3BYT B;  4PNY A;  3WOE A;  1A2U A;  3PUZ A;  1I3Q B;  3OMG A;  1M8A A;  4LJZ C;  3HGB A;  3VYR A;  1TY0 A;  1VDZ A;  3CU7 A;  3GTQ B;  3OSO A;  2E75 C;  4ZUJ A;  2JA7 B;  2KUM A;  4FXK C;  3SK5 A;  1SMY C;  4FF4 A;  2ENB A;  4TSS A;  2Q8I B;  1ZXT A;  3I4N B;  2E2H B;  1SJE D;  5ELB A;  1CZG A;  5C6A A;  1F77 A;  1OXT A;  1BOS A;  1ESF A;  5C4H A;  3I90 A;  4XYQ A;  4TKO B;  1I4G A;  1UEA B;  1B2T A;  1HXY D;  5JAV A;  2NN6 I;  3ITP A;  3TZU A;  1F2Y A;  2PZW A;  5EJW A;  3LWE A;  2EVB A;  1R9T B;  4LK1 C;  4C3H B;  2EPB A;  5J22 A;  3K7A B;  3K6O A;  1U4P A;  1Y69 U;  4CJ2 C;  1T5E A;  3ND8 A;  3BS1 A;  1QIL A;  4XT3 B;  4FF3 A;  1LTR D;  4K2K A;  4ZLT F;  1HUN A;  4ZUI A;  4WOR A;  4EQN A;  3R93 A;  3S16 B;  1K8O A;  1GUN A;  3ERO A;  1HFN A;  5M5W B;  4HCS A;  1JWS D;  2O5J C;  1BCP F;  2B2U C;  2LY7 A;  2B2Y A;  1GOZ A;  4JBW A;  2JE6 I;  4IAL A;  1EEF D;  1BQQ T;  3PUY A;  1WD1 A;  2R6G A;  2SOB A;  4XIG S;  3I4L A;  2J4X A;  4IUT A;  1AFP A;  1CI3 M;  3FRP B;  1DM0 B;  1LTA D;  2F3W A;  4X3T A;  2E74 C;  2EYP A;  4A3D B;  3GTK B;  5I9P A;  4C1N K;  4C3J G;  3Q23 A;  5COR A;  2IT1 A;  5AFW A;  1Y1V B;  2PPB C;  4H44 C;  4TQU S;  1SNO A;  2OXP A;  1OXU A;  1Y8O B;  4XYO A;  4ZK9 B;  3FMC A;  1DZ1 A;  4B9X A;  3VA7 A;  4YIJ A;  2EXZ A;  3BG3 A;  2VNU D;  1LTS D;  1EYA A;  1WTO A;  1ZKO A;  3D4D A;  1BNZ A;  1SE4 A;  2R92 B;  5M3F B;  2IJ0 A;  3MA2 B;  1JIC A;  3KLS X;  4NKL A;  3SR1 A;  5C3X A;  1D2B A;  1CA5 A;  5FOB B;  1RKN A;  3AB9 A;  1EY7 A;  1S4Z A;  1QOH A;  4QIW B;  4DU9 A;  1B4O A;  3S1R B;  4FXG C;  1I4H A;  1GHK A;  2NTT A;  1PFN A;  3BDO A;  4A3F B;  1BCP D;  5DM6 3;  2F4I A;  1VMP A;  1TVX A;  4RHR A;  2IL8 A;  1EY4 A;  2FFK B;  2DY7 A;  1VMC A;  5I2Y A;  2F0E A;  2B2V C;  5CV5 A;  2BDO A;  4HMI A;  4K5X A;  3EVQ A;  2XN9 C;  1SMY D;  2K32 A;  3FKI B;  3TP8 A;  3L3O C;  4G7Z C;  4B08 A;  1FR3 A;  2TMP A;  2RVL A;  2NVX B;  3E6Z X;  2RDG A;  3DWA A;  2PQE A;  2K04 A;  2D5D A;  2OT2 A;  2B2W A;  1H9K A;  1AZQ A;  1PZI D;  4A3E B;  1JOO A;  5DEH A;  1I4X A;  3E5S A;  4N9T A;  5E4W C;  3PV0 A;  1AW7 A;  2F0V A;  5CC4 A;  2F0D A;  2F0J A;  1F9P A;  1EYC A;  3KBG A;  3I4M B;  3U9O A;  1GUS A;  1X32 A;  4EQP A;  2JA6 B;  3S2D B;  3OWE B;  2O2L D;  5FK9 C;  1RD9 D;  2PZU A;  5FO8 B;  2EY1 A;  3V96 A;  5K36 G;  3NSW A;  2QIL A;  5C3W A;  5IT9 L;  1HRJ A;  2EYO A;  3SK8 A;  2WII B;  1O78 A;  4IN3 A;  1SYC A;  3VR3 A;  5FO7 B;  3HOY B;  1DOM A;  1ML0 D;  1CQV A;  2KA7 A;  1EY5 A;  2IX3 A;  1XTC D;  4PQX A;  1F9Q A;  2ZXR A;  5IGD A;  1VF7 A;  2LFN A;  4BY1 B;  3O13 A;  1AEX A;  1JQY D;  2HDM A;  1J8I A;  2G9H D;  3RD4 A;  5ELF A;  4A3M B;  3J7A F;  4RKL A;  4J8Q A;  3OIQ A;  2E76 C;  3S15 B;  3P7J A;  2K1B A;  3MAQ A;  3MEH A;  4KY5 A;  1TS5 A;  1G2T A;  1EY9 A;  3NBH A;  3X3N A;  3VR5 A;  3J80 E;  4IFD I;  5NUC A;  2B2T A;  1EQT A;  2AWO A;  1E2V A;  1HCZ A;  2J7Z A;  2BDN A;  2HQE A;  4A3B B;  1K8M A;  1E2W A;  1STH A;  3DM1 A;  2NVQ B;  4KHZ A;  2EJM A;  5TSS A;  3LX0 A;  3HZX A;  2D2C C;  2JEB I;  1PXU A;  4HR7 B;  3W3A A;  1JOK A;  3EFX D;  3EQL C;  4HAE A;  1AP0 A;  2FMC A;  4U68 A;  2F0N A;  1FNU A;  2WKC A;  4CGY B;  3GTO B;  2F0I A;  3ND9 A;  5BN4 A;  4HCE A;  3M4O B;  1DOL A;  2QF7 A;  4G7O C;  2EDG A;  4CKB A;  1HA5 A;  1ET9 A;  1CZW A;  3MFY A;  3A56 A;  1PTO F;  3FVQ A;  4JK1 C;  1HQM C;  3NTK A;  4PMW A;  1VF5 C;  1I4R A;  1SFO B;  3PUX A;  1SYF A;  4Z9C B;  2B39 A;  3S1M B;  2NYZ D;  2C9O A;  5IIF A;  4ABN A;  2DY8 A;  2B2V A;  1TWA B;  2F0K A;  4U67 3;  4V0B A;  5T1G A;  4IUP A;  4C3H G;  2H4O A;  1Q3L A;  2X69 A;  3MZ5 A;  2KCN A;  1HTL D;  2AWN A;  3MXU A;  1V43 A;  2EY5 A;  2F0L A;  3RMH A;  1W6J A;  1PLF A;  4MHE A;  5HUR A;  3K57 A;  1ESR A;  4RGM A;  1PZK D;  5M9O A;  4RCO A;  1QB5 D;  2L9H A;  4WJW A;  5IOD A;  2O5I C;  3BDC A;  3BVG A;  3OWF A;  2Q8T A;  5C4X B;  2B2W C;  1FYC A;  3E0J A;  2K5W A;  3VA5 A;  1GUW A;  4RAU C;  1T5X D;  1Z6H A;  2K03 A;  1EU3 A;  1LTB D;  1CQF A;  3JAM L;  2ID0 A;  1EYD A;  4PV1 C;  5EPL A;  1DCZ A;  1D1I A;  2K7V A;  2A6H D;  2JA5 B;  3NTI A;  4ZYS A;  3MWY W;  1TT2 A;  5I2X A;  2F03 A;  1NR4 A;  1OO9 B;  1EWH A;  1RCV D;  3LNN A;  4KD4 A;  5EKL A;  1ZEQ X;  3T53 B;  4H0L C;  1BBX C;  5DM7 3;  1FNW A;  1C8C A;  2E2J B;  2K6A A;  2A68 C;  3MFG A;  3QG1 A;  3CRK C;  1GHJ A;  2NB0 A;  3DWP A;  5J1Z A;  2CVR A;  2CW0 D;  4FVM A;  4ID6 A;  4KTA A;  2RKS A;  3DEO A;  5IOC A;  3M7N A;  3OIP A;  4IFD G;  4ZRZ A;  5CBA E;  2WAQ B;  4ODG A;  3GTL B;  1C48 A;  4KY7 A;  5KEE A;  4XTC S;  1EOT A;  1AZP A;  3BVZ A;  4K8I A;  1CK1 A;  3NTH A;  1SSO A;  1HTP A;  3PUW A;  2KHS A;  3VYU A;  3DMU A;  1LO5 D;  2GA4 B;  1HUM A;  1EY8 A;  5F2D A;  3HOX B;  4ZKB B;  3A7L A;  5ISR A;  1NAP A;  1D5M C;  1JOR A;  2QEJ C;  1SE3 A;  1NSN S;  4O1N A;  4WFN 3;  4OO1 I;  3K58 A;  4BS9 A;  2Z8L A;  2RA4 A;  3TSS A;  4A3K B;  1M4V A;  3GP7 A;  1SE2 A;  3H6M A;  4OHJ A;  4C3I B;  1PTO D;  5A2Q L;  2WAC A;  1H9J A;  4C56 C;  3S9W A;  2L55 A;  3C3L A;  2AUJ D;  2G9D A;  3NPP A;  1SAP A;  1A15 A;  4LAA A;  2NN6 G;  1WTQ A;  2A6H C;  1KNA A;  1MSG A;  3PIO 3;  2RDF A;  1TS4 A;  4KHV A;  3HOV B;  3PO2 B;  3IL8 A;  1PRT C;  5D14 A;  3SK6 A;  4OGQ C;  3J81 E;  1WVL A;  2FIN B;  2F0H A;  4RGO S;  2B8G A;  1SYB A;  5CR3 A;  2KOL A;  1XXG A;  3DXJ C;  1PTO H;  1XYI A;  3KF8 A;  1L0Y B;  3NUC A;  2A69 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...