5AFWA

Assembly of methylated lsd1 and chd1 drives ar-dependent transcription and translocation
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
174
structure length
163
Chain Sequence
EFETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQYLIKWKGWSHIHNTWETEETLKQQNVRGMKKLDNYKKKDQETKRWYNCQQELTDDLHKQYQIVERIIAHSNQKSAAGYPDYYCKWQGLPYSECSWEDGALISKKFQACIDEYFSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CHROMODOMAIN-HELICASE-DNA-BINDING PROTEIN 1
publication title Assembly of Methylated Kdm1A and Chd1 Drives Androgen Receptor-Dependent Transcription and Translocation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 49
structure length 163
sequence length 174
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5afwA02
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5afwA01
2KOLA 4X3TA 1ZXTA 2HDLA 2K28A 1WTWA 1X32A 4CJ0B 4X3SA 1F9RA 1KNEA 1J8IA 2DY8A 1BBXC 1SDFA 3F2UA 3Q6SA 1GUWA 2MPMA 1HUNA 2IL8A 2KEEA 1WTOA 3D6WA 2MGSA 1MGSA 2K01A 3MTSA 2B2WC 2K04A 2B2WA 2M2LA 5T1GA 3UI2A 5E4XA 4R8IA 1CA6A 2Q8TA 4IUTA 1B50A 1RODA 3N52A 1CA5A 4O42A 3SVMA 1RTOA 4HCSA 1BO0A 1DZ1A 1JE4A 5CMDA 3FDTA 3IFDA 3LWEA 3R93A 3TN2A 3TZDA 3FPUB 1WVLA 1SAPA 2H1EA 5CORA 2HCCA 1HFGA 1B4OA 1VMPA 2J7ZA 2FINB 1HUMA 2KUMA 4NW2A 2NZ1D 2Q8RE 1EQTA 1WTPA 4ZAIA 1U4MA 5EPJA 2KEDA 2MP1A 5T1IA 5D14A 5EQ0A 2VXWA 3H91A 1U4RA 1DOLA 1TVXA 2RSOA 1AZQA 1PFMA 4CJ1B 1JICA 5EKIA 2EOTA 4HSVA 5CBEE 2L1BA 2CVRA 3KBXA 4R9WA 4RA8A 5DNFA 2X6LA 4IURA 1HFNA 3P7JA 2EPBA 1X3PA 1SSOA 2X6GA 4HAEA 2B2TC 2B2TA 1EL0A 4HEDA 1WTRA 1EIGA 1G2SA 1BF4A 1F2LA 1PFBA 3DM1A 4ZK9B 3QO2A 2HCIA 1EOTA 4CJ2C 1S4ZA 2FFKB 4XT1B 3DEPA 4U68A 2N88A 2R3ZA 4OIJA 2KVMA 2L9HA 4ZLTF 2B2YC 4IUVA 1QG7A 2B2YA 1ILQA 3HP3A 1RHPA 3I90A 5CBAE 2JP1A 3DEOA 2RVLA 1C8CA 1J9OA 3G7LA 1DOKA 3I3CA 5D65A 1O7YA 4IUUA 5EPKA 1BNZA 1KNAA 1HRJA 1U4PA 1M8AA 1Q3LA 1NCVA 2KECA 3MWYW 1XX8A 1IL8A 1F9QA 1RJTA 1HHVA 1O80A 4UAIA 2EE1A 2B2VC 2B2VA 4QUFA 1ILPA 2K05A 2L11A 3GV6A 1NAPA 1ML0D 2D9UA 2FHTA 4QUCA 4X3UA 2NYZD 4XDXA 4OIKA 2HUGA 5COYA 1IKMA 2MJ8A 2XIWA 3I8ZA 1DOMA 1ICWA 4DN4M 1CM9A 1PDQA 1F9SA 1F9PA 1A15A 4MHEA 2BDNA 1QE6A 3IL8A 1B2TA 2HDMA 1WTQA 2JYOA 1B3AA 4ZKCB 1LV9A 5JJZA 1MI2A 2FJ2A 2RSNA 4IUQA 1ESRA 3ONAB 1PLFA 4ZKBB 3I91A 2K03A 1E0BA 3GV3A 1U4LA 1WTXA 4X3KA 1WD1A 1MSGA 1PFNA 1QNKA 2RA4A 1NR4A 2N55A 4RAUC 1AP0A 2X69A 4XT3B 1HA6A 2L4NA 2FMMA 4RWSC 1G91A 2L12A 5E4WC 1B53A 1O7ZA 4LMQD 2K1BA 4MN3A 5EJWA 2SDFA 1WTVA 2B2UC 5AFWA 2B2UA 5EPLA 1WD0A 1EIHA 3KUPA 1RTNA 1MSHA 1DONA 4IUPA 1G6ZA 2DY7A 1G2TA 1NR2A 2NWGA 1IKLA 1X3QA 1XYIA 1VMCA 1AZPA
chains in the Genus database with same CATH superfamily
1RKNA 3F2BA 1R9TH 4KKTA 2UXCL 1EYCA 1HNXL 4LF4Q 3CMAA 3F8TA 1PH5A 4LFAQ 5E4XA 1CA6A 4A3JH 1V1QA 5M3FG 3RR5A 5ISRA 3PF4A 1Y1VH 3J80i 2MO1A 3BU2A 3MEHA 2A68C 1AEXA 3FHWA 1PTOD 3ERSX 1I4PA 3E0EA 3UDIA 5CV8A 2PMZE 3NPPA 3SE0A 4QMGA 1TVXA 1PH6A 4DV7L 3WWVA 2KHIA 5GAGC 2X6LA 4A3KG 3P7JA 2IHEA 1SSOA 4C3JB 1X54A 2IW3A 1CHPD 1LYLA 4JI6Q 4A3GH 1Z9FA 1V1OA 2OQ0A 1X3FA 2PI2E 4CJ2C 3NBIA 3T1HQ 1N33L 3RN5A 2R3ZA 1UE5A 3G71A 2L9HA 3V96A 5IY0A 3H15A 3E5SA 1VQNA 3G7LA 1BNZA 3DXJC 2EY6A 1V1PB 1S5DD 2VQFL 2R7DA 3MWYW 3NBHB 1B7YB 2IX0A 4CDEC 2B63B 1BQQT 4BA1I 1PRTD 3CPFA 4WORA 1ML0D 3CQZB 1KAAA 5C3WA 2NBFA 3T53B 2ICEC 3P20A 3OOCA 1PH8A 1K8AC 3V05A 3RLNA 5M5XB 3I72A 3HKZE 1RCVD 2Y0SB 1QE6A 2JA8G 2I5HA 4B3TL 3E9HA 4DPGA 1EY5A 4IUQA 5JEAJ 2R92G 2AWOA 4ZUJA 3GTPH 3HOYG 1LTSD 2NB0A 3OIQA 4B3RQ 3HEJA 3G6JB 3I70A 4JI8L 5E4WC 1MIUA 1PFSA 3RZOH 1CQVA 4AIMA 1YITA 1GHKA 2DJGC 2DY7A 2NWGA 4GOPC 3VR4A 2K75A 1XMQL 5CV9A 3GTGH 4ME5A 4OIJA 1N34L 5KNDA 5D3DA 1SNDA 1A62A 4X62Q 4Q0FA 4H0LC 3MAQA 2R7FA 5K36G 4RGMA 2A19A 1FL0A 1EY0A 5I2XA 1YHQA 2JA6B 1WOCA 2EIFA 5FJ8G 3N52A 1PVOA 1EUJA 4L5TA 3PO3B 4X6AH 4LAAA 3UE0A 2C5CA 2I46A 4OGQC 4F7XA 3TS0A 1HR0Q 3TMEA 2H1EA 3HOUH 1MBYA 4KHPQ 4RGNA 4H13C 2B29A 2XRSD 4LUVA 4HMJA 3T56B 2A6HD 4RKLA 3A5ZB 3RD4A 1A3UA 3BVGA 5C0XJ 3GTQB 1M4VA 1JORA 1JOQA 4LF4L 4G7OC 4XYQA 5CBEE 4IOCA 4LFAL 2F0EA 3CXCA 1X3PA 1I3QH 2X6GA 4DV2Q 2XN9C 1XNRQ 5CV4A 4N8FA 4GOPB 4B3SQ 1D7QA 2EYJA 1KDBA 3I4MH 1RF2D 3X3NA 4HJ7A 4Y7NB 3P75A 2PO4A 1FD7D 1FGUA 4IFDH 2B2YC 3GTJB 5LMUQ 2E5LQ 3KYHC 1C8CA 1PZKD 2VZAA 4OXPA 4IUUA 1RIPA 1KNAA 5IGGA 5IGFA 1Y14B 2B3GA 1V9PA 1SE2A 2DJFC 4QUFA 4R4OA 2L11A 3TRZA 4A3JG 4APVA 2NVYB 3S17H 2IX1A 1K73C 4JI6L 4DN4M 3CCMA 4DNTB 3PO2H 2L15A 2VW9A 1E2WA 4N8X1 2JXMB 5E7NA 3VYRA 1F2ZA 1N8RC 1GUOA 4JG2A 3GV3A 1CUKA 1WTXA 2IHFA 4RAUC 4P2CB 1SNCA 1SYBA 2CKZB 5C44B 1ASZA 4X66Q 5IE8A 2WKCA 1O7ZA 3KLSX 2YU9H 1X56A 1IBKL 1FNUA 1C0AA 1NR2A 1V8QA 1EQQA 3S15H 1VQCA 4RMFA 1U0LA 1JC7A 4A3GG 1BVSA 3L9AX 3ULLA 4NB3A 3HOXB 1QUQB 4H02A 4DV5Q 1W2BA 5A35A 3K5NA 1CTMA 1PYBA 2M2LA 3IKJA 1P16A 2FXQA 1HR0W 4R8IA 3V2TA 3K7AB 2L5TA 4C1NI 2Q8IB 5M3MH 1KRSA 4GN4B 1XMOQ 2WP8J 3MXNA 2HIVA 4L6TB 1A3TA 2HT1A 4IUNA 3EIVA 1WTPA 3U58A 3OYYA 4ZAIA 1U4MA 5EPJA 3FP9A 3AEVA 4X62L 3S1QB 2VXWA 2QA4A 1JB3A 1JWMD 5M5YH 2R93B 3VDYA 3S2DH 3J81i 3PQIA 3NHHA 1A0IA 2WB1G 3BS1A 2EPBA 1VQBA 4GN3B 2A69D 5EKLA 2RDHA 4POGA 1UE6A 4DAPA 5J22A 1VQOA 4CDFC 3CCQA 1PH4A 3AQQA 1AFPA 1JJ2A 3DWAA 4A3IB 1HR0L 1S5ED 3A54A 5C3EB 4JYAQ 4KHPL 2KVMA 1R9TB 2K14A 2R61A 5CBAE 4CHTB 4DV0L 4LNQA 4K0KQ 4LWCA 1DOKA 4WJ4A 3A7LA 5JJLA 1D2BA 4KK7A 4PZ8A 4BWGB 3CCVA 1SYFA 3BDOA 2VUMH 4UHVA 1RJTA 5KNCA 1K8MA 3CRLC 3HKZB 3QG1A 4A3JB 2YYZA 4FVMA 4OWTB 1XPOA 2YTVA 4XDXA 2QF7A 3HOVB 1Y1WG 4DV2L 1XNRL 1Y1VB 4B3SL 1XXGA 4IQZA 4MHEA 4EQ5A 4MTKA 3IL8A 3Q22A 1CSQA 3J7YW 1B3AA 1Q8KA 4NPSA 2A1AA 1LTAD 5JJZA 1PTOC 3HOUG 5IYBG 4GKJQ 3KLWA 3RMHA 1ONLA 1OXXK 1XTCD 1L2FA 3BZKA 3J81E 2K03A 5LMUL 2E5LL 4C3IH 3LWUA 2KCTA 3J81L 4XT3B 2A68D 2P5ZX 1Z6HA 2L12A 1WTVA 1H9JA 2GVBA 5KEEA 1I4QA 4ZYSA 3VR3A 4F87A 4C2MH 2R6GA 2G5DA 1KABA 4A3GB 1XYIA 5KYLA 2KOLA 1WTWA 2K28A 4HTHA 1YNNC 5FLXE 5IGEA 1A6XA 1M1KC 3D6CA 3Q6SA 5FLXL 1WTOA 1YEZA 4IFDG 1OXSC 2K01A 2K04A 4A3FG 2B2WA 5IT9E 2LMCB 4HIDA 3K0YA 5I9PA 2Q8TA 3H3VC 5IT9L 2PQAA 5C4ZA 1WTHA 4X66L 1VF5C 1GD7A 2K5NA 3KK7A 1UEAB 3C2PA 1E1TA 1PRTC 1FGBD 1UEBA 2N49A 4KJNA 1A8VA 1HUMA 2IX3A 1LT5D 1Y69U 1SE4A 1VQ7A 4QF4A 1J6QA 5JVG3 2E2DC 1AZQA 2Z0SA 3QWNA 3GTPB 4BY1G 2KCMA 4X65Q 4LF7Q 1W6JA 1LO5D 2D2CC 2QGQA 3PV0A 1FVIA 1PYSB 3D3RA 1YJNA 1BBUA 3HOWH 4C56C 2OT2A 2D0OA 2F0VA 3RZOB 3VR5A 1NMGA 3STBD 1GUGA 3M9BA 1DXMA 2ZXPA 2K52A 4DA2A 3GTGB 1TS5A 2F03A 2DGYA 4HSPA 1LM0A 1GUSA 3I3CA 4A3LG 2EYLA 2KECA 1X55A 5EAYA 2Z6KC 1H9KA 4PMWA 2LFNA 4YY3Q 1NMFA 4A93H 1OTCA 1BUVT 2AWNA 1NE3A 2C35B 1IBLQ 2JJQA 5K5PA 1G291 4DUYL 3J81j 4QB4A 1LT6D 1LLRD 1T9HA 1MI2A 2BH2A 3RN2A 2J0TD 2MFIA 1PH2A 2UU9L 4JYAL 1JT8A 4DF7A 4RH6A 5C0XI 4K0KL 3CCUA 4LF5Q 1C9OA 3O13A 4RKBA 2RBMA 2UUCQ 3KOJA 4HJ8A 3MHBA 1PYWD 4OO1H 3EBEA 4R4QA 2EYOA 4AYBE 1Q81C 4DAYA 1I3QB 4QL5A 3OHXC 5CR3A 3M4YA 3A5UA 1ICFB 3I4MB 1D5MC 4JOIA 4X3TA 2Z9HA 5IYDH 4G7ZC 5CV5A 1E22A 2KQ3A 5I2YA 4DR5Q 5GAEC 1VQDA 3ZJYC 1BBXC 3F2UA 1GUWA 3ERQA 2MPMA 2KEEA 1EWIA 4GKJL 1FYCA 2VY3A 4JI4Q 2Q2IA 5IOCA 1JCKB 1DGSA 3BYYB 1VQIA 2SOBA 3JC66 4Q5VA 1KDCA 4IALA 1B50A 4GNXC 1VCIA 2O2LD 1MJEA 1B3QA 4MZ9A 3GTMH 5HY6A 1EY7A 1YNJC 3HZXA 3S17B 4N9TA 1CK1A 4Y7NH 4CDDC 3PO2B 3IAYA 4A76A 4NW2A 3I7FA 2D0PA 1KTKA 3D4RA 2LS01 2E2HH 1Y8PB 1SLJA 3KF6A 3SDZA 3CCEA 3SK4A 3KLSA 2NVYH 1HPCA 3CC7A 1D8LA 2CCZA 2O5IC 3TEHB 2XRQD 1BBWA 1W6KA 2YU9B 4M1UB 1XNQL 2RHQB 3FEWX 3CP0A 4DR1Q 3S15B 1HZ9A 4U68A 1SMXA 4ZLTF 1VQ9A 2GA4B 1C4QA 1I6HH 5EPKA 1I50H 1M8AA 4GNXB 3U4ZA 1VQ6A 4UAIA 4LF7L 4CDCC 3HGBA 1KRTA 3DLLA 2NYZD 1JQYD 4HCEA 1B9NA 4C3JG 5M3MB 3I2ZA 5EKKA 4RHSA 2XWBB 3K5LA 1XTDA 1WTQA 4WJWA 2IPKD 3HOXH 4R4TA 4L5QA 1TWCH 5JPMC 2ATWA 2RHSB 4X3KA 1WD1A 2VQEQ 2RCFA 1N32L 5M5YB 2X69A 1Q82C 1FJGL 4CKEA 4DKAC 1PH7A 1B53A 3S2DB 4RHRA 4ZRZA 2AKWB 4XXEA 2B63G 4OHJA 3CAMA 1SJED 4GLAC 1QB5D 1DONA 1GHJA 3FKIH 4GOPA 1IBLL 1RDPD 2O4XA 2OTLA 3M4OH 5C4XH 5HGQA 2Z6BA 1VQAA 1ZXTA 4DAVA 1EOVA 4LFBL 2Y0SG 2A69C 1J8IA 3HKSA 4EQOA 1SDFA 4FF3A 2IL8A 1PTOF 4DV3L 3TDQA 3M85A 4I65A 1JB7A 3R3OA 3UI2A 1LTID 4BBRH 1Q1BA 1YJ9A 2VUMB 1RODA 1U5KA 1RTOA 2DN8A 3HOZB 2AQ1B 1STYA 3FDTA 4M8AA 2QEXA 3CMEA 1OO9B 1X6OA 4JI3Q 5I6WA 3K81C 2NZ1D 2OXPA 4LF6Q 3SK8A 4DR3Q 5T1IA 2TSSA 2AQ2B 2V1CC 2OWOA 4XQNA 4C3IB 1HFNA 2ZM6Q 4K5WA 3AU7A 1IBMQ 3HOVH 2JA6G 2F0NA 2WIIB 2B2TC 3L3OC 1AE3A 2E74C 3U9SA 3PO3G 1TR5A 4ILWA 1WTRA 1F2LA 1QOHA 3DM1A 2F0DA 3ZYYX 4F8MA 3DWQA 4LF8Q 3W3AA 3C1FA 1PRTF 4C2MB 4PV1C 2ID0A 3SXHA 2F0TA 1BXTA 2B2YA 1DD2A 5BN4A 3ICEA 1G51A 1QUQA 4UY8C 1R4QB 4ABNA 3K6OA 1O80A 3EQLC 1QZHA 1PMRA 1YNND 2EYPA 1B2TA 4CGYB 1O78A 4BXXH 5FO9B 3OMCA 3OMGA 1ET9A 4A3DH 1XPUA 1NY4A 2DNCA 1HJPA 2ASBA 4LK1C 1I4RA 4LJZC 4ULLA 3Q23A 4ID6A 2KBNA 1TT2A 3S16H 1L1OC 2DUDA 5CYUA 1WCMH 1YVCA 1H9SB 3HOWB 1H95A 2OF1A 3NSWA 1BOSA 4JPBW 4J8QA 5FLMH 3Q24A 2JA9A 5IIFA 2ZXOA 3STBC 3CC4A 3TP7A 1B44D 4QIWE 3NWTA 4JI2Q 1X65A 1KAWA 5C44G 4A93B 3K0XA 3TN2A 4ZCKA 3VR6A 3A74A 3MZ5A 3NEMA 2IT1A 1TQOA 1CFMA 4N9PA 2FMCA 4AH6A 5FO8B 1IYJB 1DOLA 5IWAQ 3HOXG 1STBA 1OXTA 1HTPA 3T4AC 5GADC 3NE5B 1BR9A 5H1SE 4RA8A 1AW7A 1X3EA 1L1OB 1GVPA 1HQRD 5IYCG 5C4JH 1QCBD 2AHOB 4JI5Q 1GOZA 1PFBA 5C3EH 1EZ8A 3QJYA 2PZUA 2JK8A 2EQSA 1NTGA 5LMNQ 4HN7A 4LUZA 2JN4A 4DR3L 3DEOA 1TU2B 5M5WH 1PZID 4QCLA 5ELEA 1NCVA 1IZ6A 4B3MQ 1IL8A 4OWXB 2R93G 2ZM6L 1VDZA 1L0YB 2F0GA 4O0AA 1IBML 1IKMA 3TZUA 3NTKA 2F4IA 1RD9D 1F9PA 3T1YQ 3GTMB 4YCUA 2NTTA 1J5EQ 4DR7Q 2LKVA 5G3LF 2F4VQ 2UXBQ 4KY7A 1LV9A 2RSNA 4A3IG 1PLFA 5C3EG 3JAMi 3MXPA 4KI0A 3ND9A 1W3SA 2MUYA 1KDAA 2PCFB 3RUZA 5C3XA 2E2HB 1YNJD 1JOOA 2XNAC 1KL9A 5EJWA 3J81c 3FVQA 1VQMA 3M7GA 3TP6A 1MSHA 3HKZG 2I0QA 1DJRD 2RDFA 3HOVG 1Y1VG 2VB3X 3SHLA 3MC0B 4FXDA 2BOSA 4KLKA 4NDXA 3AYHB 3BVZA 3T1HL 3BZCA 5F2DA 4FF4A 1MGSA 5FKAC 4A3EH 4NXNQ 1E7ZA 1G6PA 3L2PA 1I6HB 5FLXc 4BY7H 4R1JA 1I50B 2C9OA 3PMFA 1NUCA 4ZUIA 5G3LD 3W5OA 3TS2A 2CWAA 3SVMA 1D1IA 3CKIB 1I5FA 5IT9c 1HNZQ 3M4PA 3FPUB 3OSOA 5CORA 2B39A 1M90C 1JE5A 2ICIA 1VQLA 3WDNA 4QY7A 3JAME 4OEMB 3RLFA 4I7ZC 3TP5A 4CKBA 1LTTD 2MP1A 1D5ZC 3RLOA 1Q1EA 3JAML 4JBKA 2YTYA 1TWCB 3I4NH 2B8FA 4BXXG 2ZTCA 2K33A 4B3RL 3IRBA 2JA5B 1LT4D 3S14B 1Q86C 1ASYA 1CKNA 4BBSH 4JW0A 4GS3A 2A73B 4JI2L 1JMCA 1SBBB 2UXDQ 4LF9Q 5HURA 3M3YB 5JJIA 2PMZB 1MHWC 3KF8A 3FKIB 5GAHC 2FFKB 2UUBQ 3M7NA 3M4OB 5C4XB 5KYIA 4HJ5A 1DYQA 2JP1A 4K2LA 2QDBA 4IPDA 3G6EA 1E1OA 4YWKA 2Z6KA 2HD3A 2NUCA 4DAMA 3S2HH 4QUCA 4X3UA 4BBRB 4DV1Q 2LSSA 1VQJA 1IYUA 2XIWA 3I8ZA 5C5MA 1HH2P 4JI5L 4DNIA 1A15A 4J6HA 2EZVA 1RL2A 5BR8Q 3D0FA 2F0SA 4LUOA 2FJ2A 3KJOA 4HMIA 3J7AV 3TSSA 1LUZA 5JEAH 4A3CH 1E0BA 1KIXA 4LFCQ 2N55A 1QVCA 3AFPA 1FR3A 1EIHA 1X3GA 3HOZH 3W1GA 5JVH3 2H5XA 1G6ZA 2A6ED 1K83H 2CH4A 1X3QA 3URYA 3T1YL 4K8JA 1J5EL 4QIWB 4KHZA 2UXBL 2G9HD 1HUNA 4UP8A 4HJ9A 2CWPA 1GJXA 1S5FD 4WRDA 1BDOA 4GNXA 3H0GB 1SNPA 4RGTA 3LWEA 1NSNS 4DXFA 2MQHA 2IJ0A 4XYOA 2WAQE 2QDLA 1K9MC 2HQLA 3I4MG 1I4HA 4G57A 3CW2C 1HZCA 3GTOH 3H91A 3F1ZA 3TBIB 5DLQE 4A3DB 4NXNL 5C0XH 2CVRA 2F0WA 4OONA 1Q12A 3G48A 3MXUA 2Z4IA 1KXLA 2Q2TA 2SNMA 5CV6A 1STNA 1EIYB 4FXKC 3S16B 3OWFA 3PIPA 5GROA 4NP5A 4Z9CB 5C6AA 3J7AF 1WCMB 2HQEA 4DR6Q 2CFMA 3MFGA 1UAPA 4YIJA 5FK9C 3PO2G 1MD2D 1SR3A 1EY4A 3E9IA 5D65A 4E6IA 1HRJA 4JV5Q 4DV5L 3PIP3 2BE5C 2PYKA 3NTIA 1N36Q 2D9UA 1E24A 2EVBA 3A8JE 1DOMA 1IXRA 1F9SA 5FO7B 2UXDL 4LF9L 2F0KA 1XMOL 1UE1A 2EY2A 2K4KA 4ZKCB 5IP7H 1SMYC 3AB9A 1EYAA 2UUBL 4IJLA 1TWAH 2F1MA 3ONAB 3ULPA 1E2VA 2IWHA 1U4LA 3FRPB 2ZXRA 1AE2A 1K3BC 1NR4A 3S24A 2NVXH 3SR1A 4GLXA 5J3BA 1VQ8A 3Q8DA 2SDFA 1WD0A 5EPLA 4TRDA 1OXUA 5J1ZA 5C4JB 4DV1L 4ODGA 5I6YA 2PW7A 1BCPC 3A0JA 4A3MH 3H09A 5M3MG 3EROA 5BR8L 5JJKA 4PMCA 1Z47A 5D3IB 1TWFH 4DV6Q 4O2DA 1EQRA 2EYHA 3MTSA 3PSIA 1KHIA 5M5WB 2EJFC 4FP5D 5I9OA 2R7ZH 1TWGH 2YV5A 2F0PA 1B70B 3CD6A 2EYFA 2Z8LA 2ZTEA 3R93A 1Q8IA 2BA1A 3CPWA 2KCCA 1SAPA 2BA0A 3S1NH 1HFGA 1B4OA 1VMPA 2VS1A 2FINB 3CCLA 3KDFB 1SN8A 2JA7H 1HNWQ 5EQ0A 1JJCB 1QJOA 2LXKA 5M3FH 4CJ1B 2EXDA 1D5XC 2N8NA 1EWCA 2L1BA 5DM73 4XTCS 1V1PA 3NBHA 1CKMA 1KLUD 4KY5A 1PHJA 2B2TA 2VUMG 1BCPB 1GUNA 1TXYA 3SK6A 3PUZA 5GQOA 4ZK9B 3HOZG 1Y8NB 2HCIA 1H9SA 1I4XA 2UXCQ 2Y0SE 4A4IA 1ILQA 4JVZA 2RVLA 1G8ZD 4HR7B 4A3KH 1L0XB 3ND8A 4H44C 5AJ3Q 1LTBD 1XX8A 4A3EB 3E0JA 4K2KA 1YHBA 4QJFA 1YBYA 2K05A 4C3IG 4BY7B 5TSSA 1S40A 1STHA 1T5XD 3F2DA 1I6VC 2K50A 3R8BA 3VA5A 2NZOA 5CC4A 4S3SA 4K8IA 1PH1A 3X3MA 4K5XA 2UUAQ 3HFZB 4J1MA 1EQVA 4P75A 2EJGC 2VNUD 4A75A 4L63B 1PH9A 1D6EC 2LY7A 3HG9A 1QNKA 3K7UC 3I4NB 2NN6I 4JV5L 4YWMA 1G91A 4X65L 4BBSB 2WKDA 1L1OA 1RTNA 1N36L 5IGBA 1S5BD 1IKLA 2R92H 3LX0A 3CHBD 3HOYH 1IL2A 3HS0C 1E2ZA 3QOLA 2F52A 3BZDB 2E8GA 4JBJA 3EVQA 3I4LA 1QWYA 2VQFQ 3D6WA 1LACA 3NP8A 2JA5H 3S14H 3QB3A 5T1GA 1HTLD 1TIID 1EFID 1STGA 1UE7A 5JOBA 2WAQB 3NWSA 4YY3L 3S2HB 4KJOA 2F3VA 3PUVA 3M3YH 3T51B 3K57A 4AQYQ 2D62A 4KKUA 3MFYA 4B3TQ 1CQFA 5K36H 3CCRA 3HOWG 4RG1A 2E2JH 2AUKA 4RFBA 5KRUA 1P8LA 3I55A 2F0QA 3VYTA 5IP7G 2PQAB 3GTLH 3DM3A 2EJMA 2K5DA 4R9WA 4EGVA 4F88A 3PIOA 4IURA 4OWWB 4LF5L 3CCSA 2UUCL 3S1MH 3VA7A 4C3HB 1XMQQ 2PNRC 1N34Q 1EIGA 4HIKA 3BJUA 1EYDA 4A93G 2PNHA 4DR4Q 4IFDJ 1K83B 1Z7TA 4XT1B 4ME3A 3I56A 4I7AA 3K58A 3DMUA 3PIO3 4HIMA 2A6EC 2O5JC 3AFQA 4DR5L 1CKOA 1HA5A 1O7YA 2MNAA 1Q3LA 4JI0Q 4R4IA 2CQAA 1F9QA 1FNWA 4KV6A 4JI4L 5EBDA 1ILPA 2E2IH 1NAPA 2LXJA 2I07B 2K5VA 4PMBA 5COYA 2MJ8A 2SEBD 1EY9A 4DNRB 3M4QA 1H9MA 4IJHA 3GD7A 1STAA 1UUPA 4P71A 4UDUC 4OO1G 1EWHA 4FNFA 3FMCA 3EA6A 2KCNA 4B9WA 1QNUA 1ESRA 3E3XA 4KKSA 1VS0A 1HZBA 2MO0A 5IYDG 1Q7YC 4MIUA 3C1EA 3GTOB 5FOBB 2ZJPA 2JA7G 1A3VA 1HCZA 1SYCA 5AJ3L 1HA6A 4PG3A 3CRKC 1HXYD 1TWHH 3H0GH 4BS9A 2I5LX 2B2UC 3GQBA 3D31A 3DHQA 1JR0D 4GKKQ 3A55A 4A3BB 1AZPA 4OX9Q 1JWUD 4NXMQ 2QW7A 2XTIA 4DR1L 2EY5A 1PZJD 3U50C 4QQBX 2F0UA 1SFOH 1O7LA 3MVVA 1ENFA 2UUAL 3GDEA 1ESFA 4HIOA 2K32A 4C1NK 4AYBB 1VQ4A 1YIJA 1UWVA 2VB2X 4DAYB 4K6DA 5HGTA 3EJIA 3S9WA 4HCSA 3I73A 1BO0A 1A63A 1GUTA 2K5WA 2PI2A 4JBWA 5A2QE 2J7ZA 1ZYRD 1BCPF 4EQPA 2N3SA 1EQTA 2M00A 5A2QL 2ZT9C 3T16A 1SJHD 2BE5D 4KN7C 2RSOA 3MA2B 1TWAB 2ENBA 3K5MA 3JAMc 1TS3A 3J80E 3KJPA 5DNFA 2DNEA 2VQEL 1IBKQ 3J80L 2NVXB 1EU4A 4R4CA 3NENA 4HAEA 5EGTA 1EL0A 4P73A 1TS4A 1PTOH 1SMYD 2QCPX 1SE3A 1A2TA 4AQYL 2VL6A 1K0SA 3K80C 1STEA 4B9XA 1S4ZA 2AUJD 1CHQD 4A3MB 1QG7A 3NQIA 4CBVA 5I4DA 4HJAA 2NVTH 3KF6B 4UP7A 4DUZQ 2BCOA 1EEFD 1CZGA 1HZAA 1TWFB 1TY2A 1QVFA 4L8JA 2B2VC 2JA5G 1BCPD 2E76C 2R7ZB 1TWGB 3PCOB 4P74A 3U4VA 3Q0AA 1I94Q 4V190 2YTXA 2RDGA 1KD1C 3KFUA 1PDQA 4ZQ3A 1O7IA 4FO2A 4BA2I 4FXGC 4JI3L 5IODA 3FKIG 4DR4L 3S1NB 5E1FA 3NTHA 5DEHA 3GP7A 3E6ZX 5C4XG 3H3VH 4ZKBB 5LHY1 4LF6L 2JA7B 1WYDA 5C4HA 1K8OA 2WV6D 2XVSA 5M3FB 1Q90A 1Y1WH 1SE8A 2FMMA 2L4NA 2HHHQ 1VQGA 2EYMA 3K8AA 4JI0L 1SNMA 4EX5A 4FYDA 2K1BA 1ZKOA 2WACA 5EBCA 2AQ3B 2NVQH 1TKWB 4K14A 3CCJA 5CV7A 1S5CD 1DM0B 4BBRG 2B8GA 3OTOQ 5IYBH 3BDCA 1VMCA 1F77A 4KY6A 3I4OA 5M9OA 4LF8L 1F9RA 4DV0Q 2ZTDA 1KQSA 1F2MA 4OELB 2H4OA 2MGSA 2F3IA 3QIAA 4EQNA 4YWLA 4DV4Q 4DR2Q 1F2YA 4K6LA 1WFQA 3NXWA 4A3KB 2Z4HA 1IW7D 3NUCA 1CA5A 4NMZA 3ER0A 3KBGA 2WB1E 3S1RH 2L55A 4PZ6A 4IPGA 1WVLA 4GKKL 2Q8RE 5IP9H 4OX9L 4NXML 4A3FH 3GO5A 1U4RA 4GZYC 4IOAA 1PFMA 1TS2A 5EKIA 4HSVA 3G4SA 4JI7Q 2EY1A 3PUYA 2JA8B 2EXZA 1KLGD 3H0GG 2PZTA 4JI1Q 4XQQA 1EYGA 3T13A 2R92B 1YJWA 3HOYB 3CF5A 5DAUA 2CQOA 4BY1H 4IUVA 3H3VI 3PGZA 1RHPA 3R2TA 1EEID 2JQOA 2D5DA 1A2UA 2RKSA 1BKBA 1QVGA 1HHVA 2EE1A 2I5MX 4ALPA 1E3PA 4A3DG 2Q2UA 5LMNW 1SNOA 5NUCA 2ES2A 2QEJC 1CM9A 2A8VA 5LL6S 1GO3E 5LL6X 4A3LH 1S72A 1AH9A 1WCMG 4DK0A 3OIPA 2E2JB 3KDFA 3I91A 1FNVA 2E75C 1PXUA 1NNXA 4DUZL 1YZ6A 5FLMG 1LT3D 3RZDH 5IWAL 2JSOA 4RWSC 3GTLB 5ELNA 4R8NA 4LMQD 2CH4W 2Q2HA 4L5RC 5AFWA 4JCVE 3GTKH 2ALYB 1G2TA 3S1MB 5KNBA 1I94L 2BDOA 1XWEA 1C48A 1VQFA 5ELBA 1CT1D 1X32A 4IFDI 2F0HA 2KHSA 1SEBD 1II3A 3NELA 2WINB 4GN5A 4X3SA 5C5LA 4CJ0B 1B1ZA 2GN5A 2DY8A 5LMNL 4LW1A 4FDBA 3PUWA 2PW5A 4K5VA 4YHHQ 2JE6I 1JJGA 4JBMA 1PA6A 3UDGA 1K28A 4KD3A 2HHHL 3BYTB 2SNSA 4C3HH 4B3ML 4FF1A 4DUYQ 2E2IB 4KN4C 1EZ6A 3J7ZC 3PF5A 1EFWA 3OTOL 3SGIA 2F0MA 1V43A 2N78A 2UU9Q 2KA7A 3BG3A 3BVMA 4DR7L 2KEDA 3EN2A 2F4VL 1WJJA 2CW0D 4IZ8A 1JICA 4EVOA 4DV4L 4DR2L 2AMCB 4DK6C 1ZEQX 1TWHB 1EY8A 3EFXD 4WFN3 1AN8A 4V0BA 3N6RA 1K8GA 4Y52H 3DEPA 1EIFA 2KENA 1X9NA 3DWPA 3CU7A 3I90A 4DK3C 5KIXA 3MXGA 1SFOB 1J9OA 3TQYA 1S3OA 3ULJA 1PV4A 1YNXA 2TMPA 4POFA 1MJCA 2NZHA 1LTLA 1XJVA 4X64Q 1C7YA 2FHTA 4JI7L 1CSPA 3D4DA 1L0WA 1R4PB 3OW7A 1CI3M 4A3BH 1ICWA 2F0OA 3UDXA 2NTSA 4JI1L 1VF7A 2HDMA 2IY5B 1HNZL 1N9WA 4OL7A 4PNYA 3UDFA 5BN5A 3L0OA 4MNOA 1LTRD 1ZYRC 5IP9G 1NJIC 4CKCA 1SYGA 1MSGA 1PFNA 1AP0A 1SRUA 3F2CA 3D4WA 4C3JH 2Z1CA 2PPBC 5ELCA 4A3EG 1ET6A 3B6YA 1CZWA 1XNQQ 1VQHA 3H6MA 3KUPA 5BN3A 4BY7G 2EDGA 5J39A 3AMUA 1SYDA 2RF4A 1PTOB 1YHAA 2ZJQA 2HDLA 3W2DA 2XGTA 1B8AA 1KNEA 4PQXA 2OEOA 4JC0A 2A74C 1EY6A 2B63H 3WOEA 2NVTB 5JAVA 4KD4A 2WB1B 3CQZH 4TSSA 4IUTA 3I4NG 2OTJA 5M5XH 5CMDA 4BBSG 3TZDA 3IFDA 1D1KA 2HCCA 2KUMA 5ELOA 4YCVA 1LTGD 1VQKA 1XPRA 5D14A 1KC8C 1N32Q 3HRZC 4H7BA 4TVAB 3TREA 5L37A 3NK9A 1FJGQ 1UNSA 2EOTA 4RGOS 2F0IA 2L0CA 2NN6H 4LFCL 4YHHL 1OXVA 4DU9A 1Y1WB 1PRTB 2K6AA 1EU3A 2WAQG 2NVQB 4LFBQ 3LGJA 3QO2A 4XQJA 2GVAA 3DUZA 1I4GA 3HOUB 3D8GA 3OPOA 2KHJA 4DV3Q 2MHVA 1ENCA 1Q46A 2HIXA 3P1HA 1CKNB 2JA6H 2A6HC 3OWEB 3PO3H 4P72A 1GM5A 5JEAG 4A3CG 2QILA 3ITPA 5E3FA 3KF8B 3MXNB 3KLRA 1DCZA 4OIKA 4C3HG 1TY0A 3S1RB 2BDNA 1IW7C 1LABA 2ZJRA 2PQEA 3C3LA 2JYOA 5ELDA 4QGUA 2F0FA 3TP8A 1IYVA 1HNXQ 4G4KA 2RQXA 3GTQH 4A3FB 1JWSD 3A8KE 2A5HA 3W1BA 1JOKA 4JK1C 3VR2A 2CHBD 1GKHA 2KJXA 3UE1A 3FPPA 3R2IA 2B2UA 4NKLA 2K7VA 4PZ7A 4TKOB 3K5OA 4X64L 3H94A 1IHZA 4IUPA 4J15A 4TQUS 2XWJB 1VQPA 3C46A 1SXTA 3GTJH 1MKHA 4DV7Q 4DR6L 4MTNA 2OQKA 4BY1B 4L5SA 5IGDA 3SEBA 3QOJA 1VQEA 2B2WC 1YI2A 5CGKA 3A7AB 2WFWA 3LNNA 4O42A 2JEAI 2JA8H 3WOFA 5C0XG 4U673 1DZ1A 1JE4A 4KTAA 1SNQA 3SK5A 3J7A5 3VYSA 1N33Q 4IPHA 1VQ5A 3QR8A 4A3BG 2K5HA 2F3WA 1U9RA 4B08A 1NBWA 4IPCA 5C44H 1SROA 2K5QA 1K3RA 4UP9A 3A8IE 3KBXA 1GXDC 2OCEA 3RZDB 4DK1A 4OO1I 4AYBG 1H9RA 2V4DA 1B9MA 4XIGS 3PUXA 4HEDA 3J80c 1G2SA 4DXGA 1BF4A 3GTKB 1EOTA 1ENAA 4KMUC 2N88A 2M9VA 5KGUA 3HP3A 1Y8OB 1WI5A 4YCWA 5IYCH 5FJ8H 4JI8Q 1U4PA 3K59A 2J4XA 4RCNA 4FF2A 3K7AH 3A56A 4DV6L 3BDLA 2B2VA 5IGCA 2F0LA 3GV6A 4IO9A 1PH3A 2HUGA 1QZGA 3L7ZC 4DGZA 4G7HC 3VYUA 2JEBI 3U9OA 3S1QH 3NQTA 4IN3A 1SYEA 4WJ3M 4A3MG 2R93H 1HQMC 1K0RA 1HNWL 2RA4A 2G9DA 1T5EA 2RCNA 3OW2A 3IFTA 2F0JA 4GLVB 2CW0C 4MN3A 3CC2A 5JPNC 4O1NA 1QILA 2XSCA 2NN6G 4KHVA 4RCOA 5ELFA 4DFAA 3RNUA 4UPAA 2PZWA 2R7ZG 2BH8A 4A3IH 5DM63 2QKIC 3MEFA 4JOIC
chains in the Genus database with same CATH topology
1RKNA 4KKTA 1EYCA 5E4XA 1CA6A 5ISRA 3MEHA 2A68C 1AEXA 1PTOD 1I4PA 5CV8A 3NPPA 3SE0A 4QMGA 1TVXA 2X6LA 3P7JA 1SSOA 4C3JB 2IW3A 1CHPD 1V1OA 4CJ2C 3NBIA 2R3ZA 2L9HA 3V96A 3E5SA 3G7LA 1BNZA 3DXJC 2EY6A 1V1PB 1S5DD 3MWYW 2IX0A 2B63B 1BQQT 4BA1I 1PRTD 4WORA 1ML0D 3CQZB 1KAAA 5C3WA 2NBFA 3T53B 2ICEC 3P20A 3OOCA 3V05A 5M5XB 3I72A 1RCVD 2Y0SB 1QE6A 1EY5A 4IUQA 5JEAJ 2AWOA 4ZUJA 1LTSD 2NB0A 3OIQA 3HEJA 3G6JB 3I70A 5E4WC 1CQVA 1GHKA 2DY7A 2NWGA 3VR4A 5CV9A 4ME5A 4OIJA 5KNDA 5D3DA 1SNDA 4Q0FA 4H0LC 3MAQA 5K36G 4RGMA 1EY0A 5I2XA 2JA6B 3N52A 3PO3B 4LAAA 2C5CA 2I46A 4OGQC 4F7XA 3TMEA 2H1EA 1MBYA 4RGNA 4H13C 2XRSD 4HMJA 3T56B 2A6HD 4RKLA 3RD4A 1A3UA 3BVGA 5C0XJ 3GTQB 1M4VA 1JORA 1JOQA 4G7OC 4XYQA 5CBEE 2F0EA 1X3PA 2X6GA 2XN9C 5CV4A 2EYJA 1KDBA 1RF2D 3X3NA 4Y7NB 3P75A 2PO4A 1FD7D 4IFDH 2B2YC 3GTJB 1C8CA 1PZKD 4IUUA 1KNAA 5IGGA 5IGFA 1SE2A 4QUFA 2L11A 2NVYB 2IX1A 4DN4M 4DNTB 1E2WA 2JXMB 3VYRA 1F2ZA 1GUOA 3GV3A 1WTXA 4RAUC 4P2CB 1SNCA 1SYBA 5C44B 2WKCA 1O7ZA 3KLSX 1FNUA 1NR2A 1V8QA 1JC7A 3L9AX 3HOXB 5A35A 3K5NA 1CTMA 2M2LA 3IKJA 4R8IA 3V2TA 3K7AB 2L5TA 4C1NI 2Q8IB 2WP8J 3MXNA 4L6TB 1A3TA 4IUNA 1WTPA 4ZAIA 1U4MA 5EPJA 3S1QB 2VXWA 1JB3A 1JWMD 2R93B 3NHHA 3BS1A 2EPBA 2A69D 5EKLA 2RDHA 4DAPA 5J22A 1AFPA 3DWAA 4A3IB 1S5ED 3A54A 5C3EB 2KVMA 1R9TB 2R61A 5CBAE 4CHTB 1DOKA 3A7LA 1D2BA 4KK7A 4BWGB 1SYFA 3BDOA 1RJTA 5KNCA 1K8MA 3CRLC 3HKZB 3QG1A 4A3JB 2YYZA 4FVMA 4XDXA 2QF7A 3HOVB 1Y1VB 1XXGA 4IQZA 4MHEA 3IL8A 3Q22A 3J7YW 1B3AA 1LTAD 5JJZA 1PTOC 3RMHA 1ONLA 1OXXK 1XTCD 3J81E 2K03A 3LWUA 3J81L 4XT3B 2A68D 1Z6HA 2L12A 1WTVA 1H9JA 5KEEA 4ZYSA 1I4QA 3VR3A 4F87A 2R6GA 1KABA 4A3GB 1XYIA 5KYLA 2KOLA 1WTWA 2K28A 4HTHA 1YNNC 5FLXE 5IGEA 1A6XA 3D6CA 3Q6SA 5FLXL 1WTOA 4IFDG 1OXSC 2K01A 2K04A 2B2WA 5IT9E 2LMCB 3K0YA 5I9PA 2Q8TA 3H3VC 5IT9L 5C4ZA 1VF5C 3KK7A 1UEAB 3C2PA 1PRTC 1FGBD 4KJNA 1HUMA 2IX3A 1LT5D 1Y69U 1SE4A 4QF4A 5JVG3 2E2DC 1AZQA 3QWNA 3GTPB 1W6JA 1LO5D 2D2CC 3PV0A 3D3RA 4C56C 2OT2A 2F0VA 3RZOB 3VR5A 1GUGA 1DXMA 2ZXPA 3GTGB 4DA2A 1TS5A 2F03A 4HSPA 1GUSA 3I3CA 2EYLA 2KECA 4PMWA 1H9KA 2LFNA 1BUVT 2AWNA 5K5PA 1G291 4QB4A 1LT6D 1LLRD 1MI2A 2J0TD 4DF7A 4RH6A 5C0XI 3O13A 4RKBA 2RBMA 3MHBA 1PYWD 4OO1H 2EYOA 4DAYA 1I3QB 3OHXC 5CR3A 3M4YA 3I4MB 1D5MC 4X3TA 4G7ZC 5CV5A 2KQ3A 5I2YA 1BBXC 3F2UA 1GUWA 3ERQA 2MPMA 2KEEA 1FYCA 5IOCA 1JCKB 3BYYB 2SOBA 4Q5VA 1KDCA 4IALA 1B50A 1VCIA 2O2LD 1EY7A 1YNJC 3HZXA 3S17B 4N9TA 1CK1A 3PO2B 3IAYA 4NW2A 1KTKA 3D4RA 2LS01 1Y8PB 3SDZA 3SK4A 3KLSA 1HPCA 2O5IC 2XRQD 1W6KA 2YU9B 4M1UB 3FEWX 3S15B 4U68A 4ZLTF 2GA4B 1C4QA 5EPKA 1M8AA 4UAIA 3HGBA 2NYZD 1JQYD 4HCEA 1B9NA 4C3JG 5M3MB 5EKKA 4RHSA 2XWBB 3K5LA 1WTQA 4WJWA 2IPKD 5JPMC 4X3KA 1WD1A 5M5YB 2X69A 4CKEA 1B53A 3S2DB 4RHRA 4ZRZA 4XXEA 4OHJA 1SJED 1QB5D 1DONA 1GHJA 1RDPD 2O4XA 1ZXTA 4DAVA 2A69C 1J8IA 4EQOA 1SDFA 4FF3A 2IL8A 1PTOF 3TDQA 3M85A 4I65A 3R3OA 3UI2A 1LTID 1Q1BA 2VUMB 1RODA 1RTOA 2DN8A 3HOZB 2AQ1B 1STYA 3FDTA 4M8AA 1OO9B 5I6WA 2NZ1D 2OXPA 3SK8A 5T1IA 2TSSA 2AQ2B 4XQNA 4C3IB 1HFNA 4K5WA 3AU7A 2F0NA 2WIIB 2B2TC 3L3OC 2E74C 3U9SA 1TR5A 4ILWA 1WTRA 1F2LA 1QOHA 3DM1A 2F0DA 4F8MA 3ZYYX 3DWQA 3W3AA 3C1FA 1PRTF 4C2MB 4PV1C 2ID0A 3SXHA 2F0TA 1BXTA 2B2YA 1DD2A 5BN4A 1R4QB 4ABNA 3K6OA 1O80A 3EQLC 1PMRA 1YNND 2EYPA 1B2TA 4CGYB 1O78A 5FO9B 3OMCA 3OMGA 1ET9A 2DNCA 4LK1C 1I4RA 4LJZC 4ULLA 3Q23A 4ID6A 1TT2A 5CYUA 1H9SB 3HOWB 2OF1A 3NSWA 1BOSA 4J8QA 3Q24A 5IIFA 2ZXOA 3TP7A 1B44D 3NWTA 4A93B 3TN2A 3VR6A 3MZ5A 2IT1A 1TQOA 1CFMA 4N9PA 2FMCA 5FO8B 1DOLA 1STBA 1OXTA 1HTPA 3T4AC 3NE5B 1BR9A 4RA8A 1AW7A 1HQRD 1QCBD 1GOZA 1PFBA 1EZ8A 3QJYA 2PZUA 4HN7A 3DEOA 1TU2B 1PZID 4QCLA 5ELEA 1NCVA 1IL8A 1VDZA 1L0YB 2F0GA 1IKMA 3TZUA 3NTKA 2F4IA 1RD9D 1F9PA 3GTMB 2NTTA 2LKVA 5G3LF 4KY7A 1LV9A 2RSNA 1PLFA 3MXPA 4KI0A 3ND9A 2MUYA 1KDAA 2PCFB 5C3XA 3RUZA 2E2HB 1YNJD 1JOOA 2XNAC 5EJWA 3FVQA 3M7GA 3TP6A 1MSHA 1DJRD 2RDFA 2VB3X 3SHLA 3MC0B 4FXDA 2BOSA 4NDXA 3BVZA 5F2DA 4FF4A 1MGSA 5FKAC 1I6HB 1I50B 2C9OA 3PMFA 1NUCA 4ZUIA 5G3LD 3SVMA 1D1IA 3CKIB 3FPUB 3OSOA 5CORA 2B39A 2ICIA 3WDNA 3JAME 3RLFA 4CKBA 4I7ZC 3TP5A 1LTTD 2MP1A 1D5ZC 1Q1EA 3JAML 1TWCB 2B8FA 2K33A 2JA5B 1LT4D 3S14B 2A73B 1SBBB 5HURA 3M3YB 2PMZB 3KF8A 3FKIB 2FFKB 3M7NA 3M4OB 5C4XB 5KYIA 1DYQA 2JP1A 4K2LA 2QDBA 2NUCA 4QUCA 4X3UA 4BBRB 1IYUA 2XIWA 3I8ZA 5C5MA 1A15A 4J6HA 2EZVA 2F0SA 2FJ2A 4HMIA 3J7AV 3TSSA 5JEAH 1E0BA 2N55A 1FR3A 1EIHA 5JVH3 1G6ZA 2A6ED 1X3QA 3URYA 4K8JA 4QIWB 4KHZA 2G9HD 1HUNA 1GJXA 1S5FD 4WRDA 1BDOA 3H0GB 1SNPA 4RGTA 3LWEA 1NSNS 4DXFA 2IJ0A 4XYOA 1I4HA 4G57A 3H91A 3TBIB 4A3DB 5C0XH 2CVRA 2F0WA 1Q12A 3MXUA 2Z4IA 2SNMA 5CV6A 1STNA 4FXKC 3S16B 3OWFA 4NP5A 4Z9CB 5C6AA 3J7AF 1WCMB 2HQEA 3MFGA 1UAPA 4YIJA 5FK9C 1MD2D 1EY4A 5D65A 4E6IA 1HRJA 3PIP3 2BE5C 2PYKA 3NTIA 2D9UA 2EVBA 3A8JE 1DOMA 1F9SA 5FO7B 2F0KA 2EY2A 4ZKCB 1SMYC 3AB9A 1EYAA 2F1MA 3ONAB 1E2VA 2IWHA 1U4LA 3FRPB 2ZXRA 1NR4A 3SR1A 2SDFA 1WD0A 5EPLA 4TRDA 1OXUA 5J1ZA 5C4JB 4ODGA 5I6YA 2PW7A 1BCPC 3H09A 3EROA 4PMCA 1Z47A 5D3IB 2EYHA 3MTSA 5M5WB 2EJFC 4FP5D 5I9OA 2F0PA 2EYFA 2Z8LA 3R93A 1Q8IA 2BA1A 2KCCA 1SAPA 2BA0A 1HFGA 1B4OA 1VMPA 2FINB 5EQ0A 1QJOA 4CJ1B 1D5XC 1EWCA 2L1BA 5DM73 4XTCS 1V1PA 3NBHA 1KLUD 4KY5A 2B2TA 1BCPB 1GUNA 3SK6A 3PUZA 4ZK9B 1Y8NB 2HCIA 1H9SA 1I4XA 1ILQA 2RVLA 1G8ZD 4HR7B 1L0XB 3ND8A 4H44C 1LTBD 1XX8A 4A3EB 3E0JA 4K2KA 2K05A 4BY7B 4C3IG 5TSSA 1STHA 1T5XD 1I6VC 3R8BA 3VA5A 5CC4A 4S3SA 4K8IA 3X3MA 4K5XA 4J1MA 1EQVA 2EJGC 2VNUD 4L63B 1D6EC 2LY7A 3HG9A 1QNKA 3I4NB 2NN6I 1G91A 4BBSB 2WKDA 1RTNA 5IGBA 1S5BD 1IKLA 3LX0A 3CHBD 3HS0C 1E2ZA 3QOLA 3BZDB 3EVQA 3I4LA 1QWYA 3D6WA 1LACA 3NP8A 3QB3A 5T1GA 1HTLD 1TIID 1EFID 1STGA 5JOBA 2WAQB 3NWSA 3S2HB 4KJOA 2F3VA 3PUVA 3T51B 3K57A 2D62A 4KKUA 3MFYA 1CQFA 5K36H 2AUKA 4RFBA 5KRUA 2F0QA 3VYTA 2EJMA 2K5DA 4F88A 4R9WA 4EGVA 4IURA 3VA7A 4C3HB 2PNRC 1EIGA 1EYDA 4IFDJ 1K83B 1Z7TA 4XT1B 3K58A 3DMUA 3PIO3 2A6EC 2O5JC 1HA5A 1O7YA 1Q3LA 2CQAA 1F9QA 1FNWA 4KV6A 5EBDA 1ILPA 1NAPA 2I07B 4PMBA 5COYA 2MJ8A 2SEBD 1EY9A 4DNRB 1H9MA 3GD7A 1STAA 1UUPA 4UDUC 4OO1G 1EWHA 4FNFA 3FMCA 3EA6A 2KCNA 4B9WA 1QNUA 1ESRA 4KKSA 4MIUA 3C1EA 3GTOB 5FOBB 1A3VA 1HCZA 1SYCA 1HA6A 3CRKC 1HXYD 4BS9A 2B2UC 3GQBA 3D31A 3DHQA 1JR0D 3A55A 4A3BB 1AZPA 1JWUD 2EY5A 1PZJD 2F0UA 1O7LA 3MVVA 1ENFA 1ESFA 2K32A 4C1NK 4AYBB 2VB2X 4K6DA 5HGTA 3EJIA 3S9WA 4HCSA 3I73A 1BO0A 1GUTA 2K5WA 4JBWA 5A2QE 2J7ZA 1ZYRD 1BCPF 4EQPA 1EQTA 2M00A 5A2QL 2ZT9C 3T16A 1SJHD 2BE5D 4KN7C 2RSOA 3MA2B 1TWAB 2ENBA 3K5MA 3J80E 1TS3A 5DNFA 2DNEA 3J80L 2NVXB 1EU4A 4HAEA 5EGTA 1EL0A 1TS4A 1PTOH 1SMYD 2QCPX 1SE3A 1A2TA 1STEA 4B9XA 1S4ZA 2AUJD 1CHQD 4A3MB 1QG7A 3NQIA 4CBVA 5I4DA 2BCOA 1EEFD 1CZGA 1TWFB 1TY2A 4L8JA 2B2VC 1BCPD 2E76C 2R7ZB 1TWGB 3Q0AA 4V190 2RDGA 1PDQA 4ZQ3A 4FO2A 4BA2I 4FXGC 5IODA 3S1NB 5E1FA 3NTHA 5DEHA 3GP7A 3E6ZX 4ZKBB 5LHY1 2JA7B 5C4HA 1K8OA 2WV6D 2XVSA 5M3FB 1Q90A 2L4NA 2FMMA 4FYDA 2EYMA 1SNMA 2K1BA 1ZKOA 2WACA 5EBCA 2AQ3B 1TKWB 4K14A 5CV7A 1S5CD 1DM0B 2B8GA 3BDCA 1VMCA 4KY6A 1F77A 5M9OA 1F9RA 1F2MA 2H4OA 2MGSA 3QIAA 4EQNA 1F2YA 4K6LA 4A3KB 3NXWA 2Z4HA 1IW7D 3NUCA 1CA5A 4NMZA 3KBGA 2L55A 1WVLA 2Q8RE 3GO5A 1U4RA 4GZYC 1PFMA 1TS2A 5EKIA 4HSVA 2EY1A 3PUYA 2JA8B 2EXZA 1KLGD 2PZTA 4XQQA 3T13A 2R92B 3HOYB 5DAUA 4IUVA 1RHPA 3R2TA 1EEID 2D5DA 1A2UA 2RKSA 1HHVA 2EE1A 1SNOA 5NUCA 2QEJC 1CM9A 5LL6S 5LL6X 4DK0A 3OIPA 2E2JB 3I91A 1FNVA 2E75C 1PXUA 1LT3D 2JSOA 4RWSC 3GTLB 4R8NA 4LMQD 5AFWA 1G2TA 3S1MB 5KNBA 2BDOA 1XWEA 1C48A 5ELBA 1CT1D 1X32A 4IFDI 2F0HA 2KHSA 1SEBD 1II3A 4X3SA 2WINB 5C5LA 4CJ0B 1B1ZA 2DY8A 3PUWA 2PW5A 4K5VA 2JE6I 4KD3A 4FF1A 3BYTB 2SNSA 2E2IB 4KN4C 1EZ6A 2F0MA 1V43A 2KA7A 3BG3A 3BVMA 2KEDA 2CW0D 4IZ8A 1JICA 4EVOA 1ZEQX 1TWHB 1EY8A 3EFXD 4WFN3 1AN8A 4V0BA 3N6RA 3DEPA 3DWPA 3CU7A 3I90A 5KIXA 3MXGA 1SFOB 1J9OA 2TMPA 2FHTA 3D4DA 1R4PB 3OW7A 1CI3M 1ICWA 2F0OA 2NTSA 1VF7A 2HDMA 4OL7A 4PNYA 5BN5A 1LTRD 1ZYRC 4CKCA 1SYGA 1MSGA 1PFNA 1AP0A 3D4WA 2Z1CA 2PPBC 5ELCA 1ET6A 1CZWA 3H6MA 3KUPA 5BN3A 2EDGA 5J39A 3AMUA 1SYDA 1PTOB 2HDLA 3W2DA 1KNEA 4PQXA 2OEOA 2A74C 1EY6A 3WOEA 2NVTB 5JAVA 4KD4A 2WB1B 4TSSA 4IUTA 5CMDA 3TZDA 3IFDA 1D1KA 2HCCA 2KUMA 1LTGD 5D14A 3HRZC 4H7BA 3NK9A 1UNSA 2EOTA 4RGOS 2F0IA 2L0CA 2NN6H 1OXVA 4DU9A 1Y1WB 1PRTB 2K6AA 1EU3A 2NVQB 3QO2A 4XQJA 3DUZA 1I4GA 3HOUB 3D8GA 3OPOA 2MHVA 1ENCA 3P1HA 2A6HC 3OWEB 5JEAG 2QILA 3ITPA 5E3FA 3KLRA 1DCZA 4OIKA 4C3HG 1TY0A 3S1RB 2BDNA 1IW7C 1LABA 3C3LA 2PQEA 2JYOA 5ELDA 2F0FA 3TP8A 1IYVA 2RQXA 4G4KA 4A3FB 1JWSD 3A8KE 2A5HA 1JOKA 4JK1C 3VR2A 2CHBD 2KJXA 3FPPA 3R2IA 2B2UA 4NKLA 2K7VA 4TKOB 3K5OA 3H94A 1IHZA 4IUPA 4TQUS 2XWJB 3C46A 1SXTA 4BY1B 5IGDA 3SEBA 3QOJA 2B2WC 5CGKA 3A7AB 3LNNA 4O42A 2JEAI 3WOFA 5C0XG 4U673 1DZ1A 1JE4A 4KTAA 1SNQA 3SK5A 3VYSA 2F3WA 1U9RA 4B08A 2K5QA 3A8IE 3KBXA 1GXDC 3RZDB 4DK1A 4OO1I 1H9RA 2V4DA 1B9MA 4XIGS 3PUXA 4HEDA 1G2SA 4DXGA 1BF4A 3GTKB 1EOTA 1ENAA 4KMUC 2N88A 2M9VA 5KGUA 3HP3A 1Y8OB 1U4PA 3K59A 2J4XA 4RCNA 4FF2A 3A56A 3BDLA 2B2VA 5IGCA 2F0LA 3GV6A 2HUGA 3L7ZC 4DGZA 4G7HC 3VYUA 2JEBI 3U9OA 3NQTA 4IN3A 1SYEA 1HQMC 2RA4A 2G9DA 1T5EA 3IFTA 2F0JA 2CW0C 4MN3A 5JPNC 4O1NA 1QILA 2XSCA 5ELFA 2NN6G 4KHVA 4RCOA 4DFAA 2PZWA 5DM63 2QKIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KOL A;  4X3T A;  1ZXT A;  2HDL A;  2K28 A;  1WTW A;  1X32 A;  4CJ0 B;  4X3S A;  1F9R A;  1KNE A;  1J8I A;  2DY8 A;  1BBX C;  1SDF A;  3F2U A;  3Q6S A;  1GUW A;  2MPM A;  1HUN A;  2IL8 A;  2KEE A;  1WTO A;  3D6W A;  2MGS A;  1MGS A;  2K01 A;  3MTS A;  2B2W C;  2K04 A;  2B2W A;  2M2L A;  5T1G A;  3UI2 A;  5E4X A;  4R8I A;  1CA6 A;  2Q8T A;  4IUT A;  1B50 A;  1ROD A;  3N52 A;  1CA5 A;  4O42 A;  3SVM A;  1RTO A;  4HCS A;  1BO0 A;  1DZ1 A;  1JE4 A;  5CMD A;  3FDT A;  3IFD A;  3LWE A;  3R93 A;  3TN2 A;  3TZD A;  3FPU B;  1WVL A;  1SAP A;  2H1E A;  5COR A;  2HCC A;  1HFG A;  1B4O A;  1VMP A;  2J7Z A;  2FIN B;  1HUM A;  2KUM A;  4NW2 A;  2NZ1 D;  2Q8R E;  1EQT A;  1WTP A;  4ZAI A;  1U4M A;  5EPJ A;  2KED A;  2MP1 A;  5T1I A;  5D14 A;  5EQ0 A;  2VXW A;  3H91 A;  1U4R A;  1DOL A;  1TVX A;  2RSO A;  1AZQ A;  1PFM A;  4CJ1 B;  1JIC A;  5EKI A;  2EOT A;  4HSV A;  5CBE E;  2L1B A;  2CVR A;  3KBX A;  4R9W A;  4RA8 A;  5DNF A;  2X6L A;  4IUR A;  1HFN A;  3P7J A;  2EPB A;  1X3P A;  1SSO A;  2X6G A;  4HAE A;  2B2T C;  2B2T A;  1EL0 A;  4HED A;  1WTR A;  1EIG A;  1G2S A;  1BF4 A;  1F2L A;  1PFB A;  3DM1 A;  4ZK9 B;  3QO2 A;  2HCI A;  1EOT A;  4CJ2 C;  1S4Z A;  2FFK B;  4XT1 B;  3DEP A;  4U68 A;  2N88 A;  2R3Z A;  4OIJ A;  2KVM A;  2L9H A;  4ZLT F;  2B2Y C;  4IUV A;  1QG7 A;  2B2Y A;  1ILQ A;  3HP3 A;  1RHP A;  3I90 A;  5CBA E;  2JP1 A;  3DEO A;  2RVL A;  1C8C A;  1J9O A;  3G7L A;  1DOK A;  3I3C A;  5D65 A;  1O7Y A;  4IUU A;  5EPK A;  1BNZ A;  1KNA A;  1HRJ A;  1U4P A;  1M8A A;  1Q3L A;  1NCV A;  2KEC A;  3MWY W;  1XX8 A;  1IL8 A;  1F9Q A;  1RJT A;  1HHV A;  1O80 A;  4UAI A;  2EE1 A;  2B2V C;  2B2V A;  4QUF A;  1ILP A;  2K05 A;  2L11 A;  3GV6 A;  1NAP A;  1ML0 D;  2D9U A;  2FHT A;  4QUC A;  4X3U A;  2NYZ D;  4XDX A;  4OIK A;  2HUG A;  5COY A;  1IKM A;  2MJ8 A;  2XIW A;  3I8Z A;  1DOM A;  1ICW A;  4DN4 M;  1CM9 A;  1PDQ A;  1F9S A;  1F9P A;  1A15 A;  4MHE A;  2BDN A;  1QE6 A;  3IL8 A;  1B2T A;  2HDM A;  1WTQ A;  2JYO A;  1B3A A;  4ZKC B;  1LV9 A;  5JJZ A;  1MI2 A;  2FJ2 A;  2RSN A;  4IUQ A;  1ESR A;  3ONA B;  1PLF A;  4ZKB B;  3I91 A;  2K03 A;  1E0B A;  3GV3 A;  1U4L A;  1WTX A;  4X3K A;  1WD1 A;  1MSG A;  1PFN A;  1QNK A;  2RA4 A;  1NR4 A;  2N55 A;  4RAU C;  1AP0 A;  2X69 A;  4XT3 B;  1HA6 A;  2L4N A;  2FMM A;  4RWS C;  1G91 A;  2L12 A;  5E4W C;  1B53 A;  1O7Z A;  4LMQ D;  2K1B A;  4MN3 A;  5EJW A;  2SDF A;  1WTV A;  2B2U C;  5AFW A;  2B2U A;  5EPL A;  1WD0 A;  1EIH A;  3KUP A;  1RTN A;  1MSH A;  1DON A;  4IUP A;  1G6Z A;  2DY7 A;  1G2T A;  1NR2 A;  2NWG A;  1IKL A;  1X3Q A;  1XYI A;  1VMC A;  1AZP A; 
#chains in the Genus database with same CATH topology
 1RKN A;  3F2B A;  1R9T H;  4KKT A;  2UXC L;  1EYC A;  1HNX L;  4LF4 Q;  3CMA A;  3F8T A;  1PH5 A;  4LFA Q;  5E4X A;  1CA6 A;  4A3J H;  1V1Q A;  5M3F G;  3RR5 A;  5ISR A;  3PF4 A;  1Y1V H;  3J80 i;  2MO1 A;  3BU2 A;  3MEH A;  2A68 C;  1AEX A;  3FHW A;  1PTO D;  3ERS X;  1I4P A;  3E0E A;  3UDI A;  5CV8 A;  2PMZ E;  3NPP A;  3SE0 A;  4QMG A;  1TVX A;  1PH6 A;  4DV7 L;  3WWV A;  2KHI A;  5GAG C;  2X6L A;  4A3K G;  3P7J A;  2IHE A;  1SSO A;  4C3J B;  1X54 A;  2IW3 A;  1CHP D;  1LYL A;  4JI6 Q;  4A3G H;  1Z9F A;  1V1O A;  2OQ0 A;  1X3F A;  2PI2 E;  4CJ2 C;  3NBI A;  3T1H Q;  1N33 L;  3RN5 A;  2R3Z A;  1UE5 A;  3G71 A;  2L9H A;  3V96 A;  5IY0 A;  3H15 A;  3E5S A;  1VQN A;  3G7L A;  1BNZ A;  3DXJ C;  2EY6 A;  1V1P B;  1S5D D;  2VQF L;  2R7D A;  3MWY W;  3NBH B;  1B7Y B;  2IX0 A;  4CDE C;  2B63 B;  1BQQ T;  4BA1 I;  1PRT D;  3CPF A;  4WOR A;  1ML0 D;  3CQZ B;  1KAA A;  5C3W A;  2NBF A;  3T53 B;  2ICE C;  3P20 A;  3OOC A;  1PH8 A;  1K8A C;  3V05 A;  3RLN A;  5M5X B;  3I72 A;  3HKZ E;  1RCV D;  2Y0S B;  1QE6 A;  2JA8 G;  2I5H A;  4B3T L;  3E9H A;  4DPG A;  1EY5 A;  4IUQ A;  5JEA J;  2R92 G;  2AWO A;  4ZUJ A;  3GTP H;  3HOY G;  1LTS D;  2NB0 A;  3OIQ A;  4B3R Q;  3HEJ A;  3G6J B;  3I70 A;  4JI8 L;  5E4W C;  1MIU A;  1PFS A;  3RZO H;  1CQV A;  4AIM A;  1YIT A;  1GHK A;  2DJG C;  2DY7 A;  2NWG A;  4GOP C;  3VR4 A;  2K75 A;  1XMQ L;  5CV9 A;  3GTG H;  4ME5 A;  4OIJ A;  1N34 L;  5KND A;  5D3D A;  1SND A;  1A62 A;  4X62 Q;  4Q0F A;  4H0L C;  3MAQ A;  2R7F A;  5K36 G;  4RGM A;  2A19 A;  1FL0 A;  1EY0 A;  5I2X A;  1YHQ A;  2JA6 B;  1WOC A;  2EIF A;  5FJ8 G;  3N52 A;  1PVO A;  1EUJ A;  4L5T A;  3PO3 B;  4X6A H;  4LAA A;  3UE0 A;  2C5C A;  2I46 A;  4OGQ C;  4F7X A;  3TS0 A;  1HR0 Q;  3TME A;  2H1E A;  3HOU H;  1MBY A;  4KHP Q;  4RGN A;  4H13 C;  2B29 A;  2XRS D;  4LUV A;  4HMJ A;  3T56 B;  2A6H D;  4RKL A;  3A5Z B;  3RD4 A;  1A3U A;  3BVG A;  5C0X J;  3GTQ B;  1M4V A;  1JOR A;  1JOQ A;  4LF4 L;  4G7O C;  4XYQ A;  5CBE E;  4IOC A;  4LFA L;  2F0E A;  3CXC A;  1X3P A;  1I3Q H;  2X6G A;  4DV2 Q;  2XN9 C;  1XNR Q;  5CV4 A;  4N8F A;  4GOP B;  4B3S Q;  1D7Q A;  2EYJ A;  1KDB A;  3I4M H;  1RF2 D;  3X3N A;  4HJ7 A;  4Y7N B;  3P75 A;  2PO4 A;  1FD7 D;  1FGU A;  4IFD H;  2B2Y C;  3GTJ B;  5LMU Q;  2E5L Q;  3KYH C;  1C8C A;  1PZK D;  2VZA A;  4OXP A;  4IUU A;  1RIP A;  1KNA A;  5IGG A;  5IGF A;  1Y14 B;  2B3G A;  1V9P A;  1SE2 A;  2DJF C;  4QUF A;  4R4O A;  2L11 A;  3TRZ A;  4A3J G;  4APV A;  2NVY B;  3S17 H;  2IX1 A;  1K73 C;  4JI6 L;  4DN4 M;  3CCM A;  4DNT B;  3PO2 H;  2L15 A;  2VW9 A;  1E2W A;  4N8X 1;  2JXM B;  5E7N A;  3VYR A;  1F2Z A;  1N8R C;  1GUO A;  4JG2 A;  3GV3 A;  1CUK A;  1WTX A;  2IHF A;  4RAU C;  4P2C B;  1SNC A;  1SYB A;  2CKZ B;  5C44 B;  1ASZ A;  4X66 Q;  5IE8 A;  2WKC A;  1O7Z A;  3KLS X;  2YU9 H;  1X56 A;  1IBK L;  1FNU A;  1C0A A;  1NR2 A;  1V8Q A;  1EQQ A;  3S15 H;  1VQC A;  4RMF A;  1U0L A;  1JC7 A;  4A3G G;  1BVS A;  3L9A X;  3ULL A;  4NB3 A;  3HOX B;  1QUQ B;  4H02 A;  4DV5 Q;  1W2B A;  5A35 A;  3K5N A;  1CTM A;  1PYB A;  2M2L A;  3IKJ A;  1P16 A;  2FXQ A;  1HR0 W;  4R8I A;  3V2T A;  3K7A B;  2L5T A;  4C1N I;  2Q8I B;  5M3M H;  1KRS A;  4GN4 B;  1XMO Q;  2WP8 J;  3MXN A;  2HIV A;  4L6T B;  1A3T A;  2HT1 A;  4IUN A;  3EIV A;  1WTP A;  3U58 A;  3OYY A;  4ZAI A;  1U4M A;  5EPJ A;  3FP9 A;  3AEV A;  4X62 L;  3S1Q B;  2VXW A;  2QA4 A;  1JB3 A;  1JWM D;  5M5Y H;  2R93 B;  3VDY A;  3S2D H;  3J81 i;  3PQI A;  3NHH A;  1A0I A;  2WB1 G;  3BS1 A;  2EPB A;  1VQB A;  4GN3 B;  2A69 D;  5EKL A;  2RDH A;  4POG A;  1UE6 A;  4DAP A;  5J22 A;  1VQO A;  4CDF C;  3CCQ A;  1PH4 A;  3AQQ A;  1AFP A;  1JJ2 A;  3DWA A;  4A3I B;  1HR0 L;  1S5E D;  3A54 A;  5C3E B;  4JYA Q;  4KHP L;  2KVM A;  1R9T B;  2K14 A;  2R61 A;  5CBA E;  4CHT B;  4DV0 L;  4LNQ A;  4K0K Q;  4LWC A;  1DOK A;  4WJ4 A;  3A7L A;  5JJL A;  1D2B A;  4KK7 A;  4PZ8 A;  4BWG B;  3CCV A;  1SYF A;  3BDO A;  2VUM H;  4UHV A;  1RJT A;  5KNC A;  1K8M A;  3CRL C;  3HKZ B;  3QG1 A;  4A3J B;  2YYZ A;  4FVM A;  4OWT B;  1XPO A;  2YTV A;  4XDX A;  2QF7 A;  3HOV B;  1Y1W G;  4DV2 L;  1XNR L;  1Y1V B;  4B3S L;  1XXG A;  4IQZ A;  4MHE A;  4EQ5 A;  4MTK A;  3IL8 A;  3Q22 A;  1CSQ A;  3J7Y W;  1B3A A;  1Q8K A;  4NPS A;  2A1A A;  1LTA D;  5JJZ A;  1PTO C;  3HOU G;  5IYB G;  4GKJ Q;  3KLW A;  3RMH A;  1ONL A;  1OXX K;  1XTC D;  1L2F A;  3BZK A;  3J81 E;  2K03 A;  5LMU L;  2E5L L;  4C3I H;  3LWU A;  2KCT A;  3J81 L;  4XT3 B;  2A68 D;  2P5Z X;  1Z6H A;  2L12 A;  1WTV A;  1H9J A;  2GVB A;  5KEE A;  1I4Q A;  4ZYS A;  3VR3 A;  4F87 A;  4C2M H;  2R6G A;  2G5D A;  1KAB A;  4A3G B;  1XYI A;  5KYL A;  2KOL A;  1WTW A;  2K28 A;  4HTH A;  1YNN C;  5FLX E;  5IGE A;  1A6X A;  1M1K C;  3D6C A;  3Q6S A;  5FLX L;  1WTO A;  1YEZ A;  4IFD G;  1OXS C;  2K01 A;  2K04 A;  4A3F G;  2B2W A;  5IT9 E;  2LMC B;  4HID A;  3K0Y A;  5I9P A;  2Q8T A;  3H3V C;  5IT9 L;  2PQA A;  5C4Z A;  1WTH A;  4X66 L;  1VF5 C;  1GD7 A;  2K5N A;  3KK7 A;  1UEA B;  3C2P A;  1E1T A;  1PRT C;  1FGB D;  1UEB A;  2N49 A;  4KJN A;  1A8V A;  1HUM A;  2IX3 A;  1LT5 D;  1Y69 U;  1SE4 A;  1VQ7 A;  4QF4 A;  1J6Q A;  5JVG 3;  2E2D C;  1AZQ A;  2Z0S A;  3QWN A;  3GTP B;  4BY1 G;  2KCM A;  4X65 Q;  4LF7 Q;  1W6J A;  1LO5 D;  2D2C C;  2QGQ A;  3PV0 A;  1FVI A;  1PYS B;  3D3R A;  1YJN A;  1BBU A;  3HOW H;  4C56 C;  2OT2 A;  2D0O A;  2F0V A;  3RZO B;  3VR5 A;  1NMG A;  3STB D;  1GUG A;  3M9B A;  1DXM A;  2ZXP A;  2K52 A;  4DA2 A;  3GTG B;  1TS5 A;  2F03 A;  2DGY A;  4HSP A;  1LM0 A;  1GUS A;  3I3C A;  4A3L G;  2EYL A;  2KEC A;  1X55 A;  5EAY A;  2Z6K C;  1H9K A;  4PMW A;  2LFN A;  4YY3 Q;  1NMF A;  4A93 H;  1OTC A;  1BUV T;  2AWN A;  1NE3 A;  2C35 B;  1IBL Q;  2JJQ A;  5K5P A;  1G29 1;  4DUY L;  3J81 j;  4QB4 A;  1LT6 D;  1LLR D;  1T9H A;  1MI2 A;  2BH2 A;  3RN2 A;  2J0T D;  2MFI A;  1PH2 A;  2UU9 L;  4JYA L;  1JT8 A;  4DF7 A;  4RH6 A;  5C0X I;  4K0K L;  3CCU A;  4LF5 Q;  1C9O A;  3O13 A;  4RKB A;  2RBM A;  2UUC Q;  3KOJ A;  4HJ8 A;  3MHB A;  1PYW D;  4OO1 H;  3EBE A;  4R4Q A;  2EYO A;  4AYB E;  1Q81 C;  4DAY A;  1I3Q B;  4QL5 A;  3OHX C;  5CR3 A;  3M4Y A;  3A5U A;  1ICF B;  3I4M B;  1D5M C;  4JOI A;  4X3T A;  2Z9H A;  5IYD H;  4G7Z C;  5CV5 A;  1E22 A;  2KQ3 A;  5I2Y A;  4DR5 Q;  5GAE C;  1VQD A;  3ZJY C;  1BBX C;  3F2U A;  1GUW A;  3ERQ A;  2MPM A;  2KEE A;  1EWI A;  4GKJ L;  1FYC A;  2VY3 A;  4JI4 Q;  2Q2I A;  5IOC A;  1JCK B;  1DGS A;  3BYY B;  1VQI A;  2SOB A;  3JC6 6;  4Q5V A;  1KDC A;  4IAL A;  1B50 A;  4GNX C;  1VCI A;  2O2L D;  1MJE A;  1B3Q A;  4MZ9 A;  3GTM H;  5HY6 A;  1EY7 A;  1YNJ C;  3HZX A;  3S17 B;  4N9T A;  1CK1 A;  4Y7N H;  4CDD C;  3PO2 B;  3IAY A;  4A76 A;  4NW2 A;  3I7F A;  2D0P A;  1KTK A;  3D4R A;  2LS0 1;  2E2H H;  1Y8P B;  1SLJ A;  3KF6 A;  3SDZ A;  3CCE A;  3SK4 A;  3KLS A;  2NVY H;  1HPC A;  3CC7 A;  1D8L A;  2CCZ A;  2O5I C;  3TEH B;  2XRQ D;  1BBW A;  1W6K A;  2YU9 B;  4M1U B;  1XNQ L;  2RHQ B;  3FEW X;  3CP0 A;  4DR1 Q;  3S15 B;  1HZ9 A;  4U68 A;  1SMX A;  4ZLT F;  1VQ9 A;  2GA4 B;  1C4Q A;  1I6H H;  5EPK A;  1I50 H;  1M8A A;  4GNX B;  3U4Z A;  1VQ6 A;  4UAI A;  4LF7 L;  4CDC C;  3HGB A;  1KRT A;  3DLL A;  2NYZ D;  1JQY D;  4HCE A;  1B9N A;  4C3J G;  5M3M B;  3I2Z A;  5EKK A;  4RHS A;  2XWB B;  3K5L A;  1XTD A;  1WTQ A;  4WJW A;  2IPK D;  3HOX H;  4R4T A;  4L5Q A;  1TWC H;  5JPM C;  2ATW A;  2RHS B;  4X3K A;  1WD1 A;  2VQE Q;  2RCF A;  1N32 L;  5M5Y B;  2X69 A;  1Q82 C;  1FJG L;  4CKE A;  4DKA C;  1PH7 A;  1B53 A;  3S2D B;  4RHR A;  4ZRZ A;  2AKW B;  4XXE A;  2B63 G;  4OHJ A;  3CAM A;  1SJE D;  4GLA C;  1QB5 D;  1DON A;  1GHJ A;  3FKI H;  4GOP A;  1IBL L;  1RDP D;  2O4X A;  2OTL A;  3M4O H;  5C4X H;  5HGQ A;  2Z6B A;  1VQA A;  1ZXT A;  4DAV A;  1EOV A;  4LFB L;  2Y0S G;  2A69 C;  1J8I A;  3HKS A;  4EQO A;  1SDF A;  4FF3 A;  2IL8 A;  1PTO F;  4DV3 L;  3TDQ A;  3M85 A;  4I65 A;  1JB7 A;  3R3O A;  3UI2 A;  1LTI D;  4BBR H;  1Q1B A;  1YJ9 A;  2VUM B;  1ROD A;  1U5K A;  1RTO A;  2DN8 A;  3HOZ B;  2AQ1 B;  1STY A;  3FDT A;  4M8A A;  2QEX A;  3CME A;  1OO9 B;  1X6O A;  4JI3 Q;  5I6W A;  3K81 C;  2NZ1 D;  2OXP A;  4LF6 Q;  3SK8 A;  4DR3 Q;  5T1I A;  2TSS A;  2AQ2 B;  2V1C C;  2OWO A;  4XQN A;  4C3I B;  1HFN A;  2ZM6 Q;  4K5W A;  3AU7 A;  1IBM Q;  3HOV H;  2JA6 G;  2F0N A;  2WII B;  2B2T C;  3L3O C;  1AE3 A;  2E74 C;  3U9S A;  3PO3 G;  1TR5 A;  4ILW A;  1WTR A;  1F2L A;  1QOH A;  3DM1 A;  2F0D A;  3ZYY X;  4F8M A;  3DWQ A;  4LF8 Q;  3W3A A;  3C1F A;  1PRT F;  4C2M B;  4PV1 C;  2ID0 A;  3SXH A;  2F0T A;  1BXT A;  2B2Y A;  1DD2 A;  5BN4 A;  3ICE A;  1G51 A;  1QUQ A;  4UY8 C;  1R4Q B;  4ABN A;  3K6O A;  1O80 A;  3EQL C;  1QZH A;  1PMR A;  1YNN D;  2EYP A;  1B2T A;  4CGY B;  1O78 A;  4BXX H;  5FO9 B;  3OMC A;  3OMG A;  1ET9 A;  4A3D H;  1XPU A;  1NY4 A;  2DNC A;  1HJP A;  2ASB A;  4LK1 C;  1I4R A;  4LJZ C;  4ULL A;  3Q23 A;  4ID6 A;  2KBN A;  1TT2 A;  3S16 H;  1L1O C;  2DUD A;  5CYU A;  1WCM H;  1YVC A;  1H9S B;  3HOW B;  1H95 A;  2OF1 A;  3NSW A;  1BOS A;  4JPB W;  4J8Q A;  5FLM H;  3Q24 A;  2JA9 A;  5IIF A;  2ZXO A;  3STB C;  3CC4 A;  3TP7 A;  1B44 D;  4QIW E;  3NWT A;  4JI2 Q;  1X65 A;  1KAW A;  5C44 G;  4A93 B;  3K0X A;  3TN2 A;  4ZCK A;  3VR6 A;  3A74 A;  3MZ5 A;  3NEM A;  2IT1 A;  1TQO A;  1CFM A;  4N9P A;  2FMC A;  4AH6 A;  5FO8 B;  1IYJ B;  1DOL A;  5IWA Q;  3HOX G;  1STB A;  1OXT A;  1HTP A;  3T4A C;  5GAD C;  3NE5 B;  1BR9 A;  5H1S E;  4RA8 A;  1AW7 A;  1X3E A;  1L1O B;  1GVP A;  1HQR D;  5IYC G;  5C4J H;  1QCB D;  2AHO B;  4JI5 Q;  1GOZ A;  1PFB A;  5C3E H;  1EZ8 A;  3QJY A;  2PZU A;  2JK8 A;  2EQS A;  1NTG A;  5LMN Q;  4HN7 A;  4LUZ A;  2JN4 A;  4DR3 L;  3DEO A;  1TU2 B;  5M5W H;  1PZI D;  4QCL A;  5ELE A;  1NCV A;  1IZ6 A;  4B3M Q;  1IL8 A;  4OWX B;  2R93 G;  2ZM6 L;  1VDZ A;  1L0Y B;  2F0G A;  4O0A A;  1IBM L;  1IKM A;  3TZU A;  3NTK A;  2F4I A;  1RD9 D;  1F9P A;  3T1Y Q;  3GTM B;  4YCU A;  2NTT A;  1J5E Q;  4DR7 Q;  2LKV A;  5G3L F;  2F4V Q;  2UXB Q;  4KY7 A;  1LV9 A;  2RSN A;  4A3I G;  1PLF A;  5C3E G;  3JAM i;  3MXP A;  4KI0 A;  3ND9 A;  1W3S A;  2MUY A;  1KDA A;  2PCF B;  3RUZ A;  5C3X A;  2E2H B;  1YNJ D;  1JOO A;  2XNA C;  1KL9 A;  5EJW A;  3J81 c;  3FVQ A;  1VQM A;  3M7G A;  3TP6 A;  1MSH A;  3HKZ G;  2I0Q A;  1DJR D;  2RDF A;  3HOV G;  1Y1V G;  2VB3 X;  3SHL A;  3MC0 B;  4FXD A;  2BOS A;  4KLK A;  4NDX A;  3AYH B;  3BVZ A;  3T1H L;  3BZC A;  5F2D A;  4FF4 A;  1MGS A;  5FKA C;  4A3E H;  4NXN Q;  1E7Z A;  1G6P A;  3L2P A;  1I6H B;  5FLX c;  4BY7 H;  4R1J A;  1I50 B;  2C9O A;  3PMF A;  1NUC A;  4ZUI A;  5G3L D;  3W5O A;  3TS2 A;  2CWA A;  3SVM A;  1D1I A;  3CKI B;  1I5F A;  5IT9 c;  1HNZ Q;  3M4P A;  3FPU B;  3OSO A;  5COR A;  2B39 A;  1M90 C;  1JE5 A;  2ICI A;  1VQL A;  3WDN A;  4QY7 A;  3JAM E;  4OEM B;  3RLF A;  4I7Z C;  3TP5 A;  4CKB A;  1LTT D;  2MP1 A;  1D5Z C;  3RLO A;  1Q1E A;  3JAM L;  4JBK A;  2YTY A;  1TWC B;  3I4N H;  2B8F A;  4BXX G;  2ZTC A;  2K33 A;  4B3R L;  3IRB A;  2JA5 B;  1LT4 D;  3S14 B;  1Q86 C;  1ASY A;  1CKN A;  4BBS H;  4JW0 A;  4GS3 A;  2A73 B;  4JI2 L;  1JMC A;  1SBB B;  2UXD Q;  4LF9 Q;  5HUR A;  3M3Y B;  5JJI A;  2PMZ B;  1MHW C;  3KF8 A;  3FKI B;  5GAH C;  2FFK B;  2UUB Q;  3M7N A;  3M4O B;  5C4X B;  5KYI A;  4HJ5 A;  1DYQ A;  2JP1 A;  4K2L A;  2QDB A;  4IPD A;  3G6E A;  1E1O A;  4YWK A;  2Z6K A;  2HD3 A;  2NUC A;  4DAM A;  3S2H H;  4QUC A;  4X3U A;  4BBR B;  4DV1 Q;  2LSS A;  1VQJ A;  1IYU A;  2XIW A;  3I8Z A;  5C5M A;  1HH2 P;  4JI5 L;  4DNI A;  1A15 A;  4J6H A;  2EZV A;  1RL2 A;  5BR8 Q;  3D0F A;  2F0S A;  4LUO A;  2FJ2 A;  3KJO A;  4HMI A;  3J7A V;  3TSS A;  1LUZ A;  5JEA H;  4A3C H;  1E0B A;  1KIX A;  4LFC Q;  2N55 A;  1QVC A;  3AFP A;  1FR3 A;  1EIH A;  1X3G A;  3HOZ H;  3W1G A;  5JVH 3;  2H5X A;  1G6Z A;  2A6E D;  1K83 H;  2CH4 A;  1X3Q A;  3URY A;  3T1Y L;  4K8J A;  1J5E L;  4QIW B;  4KHZ A;  2UXB L;  2G9H D;  1HUN A;  4UP8 A;  4HJ9 A;  2CWP A;  1GJX A;  1S5F D;  4WRD A;  1BDO A;  4GNX A;  3H0G B;  1SNP A;  4RGT A;  3LWE A;  1NSN S;  4DXF A;  2MQH A;  2IJ0 A;  4XYO A;  2WAQ E;  2QDL A;  1K9M C;  2HQL A;  3I4M G;  1I4H A;  4G57 A;  3CW2 C;  1HZC A;  3GTO H;  3H91 A;  3F1Z A;  3TBI B;  5DLQ E;  4A3D B;  4NXN L;  5C0X H;  2CVR A;  2F0W A;  4OON A;  1Q12 A;  3G48 A;  3MXU A;  2Z4I A;  1KXL A;  2Q2T A;  2SNM A;  5CV6 A;  1STN A;  1EIY B;  4FXK C;  3S16 B;  3OWF A;  3PIP A;  5GRO A;  4NP5 A;  4Z9C B;  5C6A A;  3J7A F;  1WCM B;  2HQE A;  4DR6 Q;  2CFM A;  3MFG A;  1UAP A;  4YIJ A;  5FK9 C;  3PO2 G;  1MD2 D;  1SR3 A;  1EY4 A;  3E9I A;  5D65 A;  4E6I A;  1HRJ A;  4JV5 Q;  4DV5 L;  3PIP 3;  2BE5 C;  2PYK A;  3NTI A;  1N36 Q;  2D9U A;  1E24 A;  2EVB A;  3A8J E;  1DOM A;  1IXR A;  1F9S A;  5FO7 B;  2UXD L;  4LF9 L;  2F0K A;  1XMO L;  1UE1 A;  2EY2 A;  2K4K A;  4ZKC B;  5IP7 H;  1SMY C;  3AB9 A;  1EYA A;  2UUB L;  4IJL A;  1TWA H;  2F1M A;  3ONA B;  3ULP A;  1E2V A;  2IWH A;  1U4L A;  3FRP B;  2ZXR A;  1AE2 A;  1K3B C;  1NR4 A;  3S24 A;  2NVX H;  3SR1 A;  4GLX A;  5J3B A;  1VQ8 A;  3Q8D A;  2SDF A;  1WD0 A;  5EPL A;  4TRD A;  1OXU A;  5J1Z A;  5C4J B;  4DV1 L;  4ODG A;  5I6Y A;  2PW7 A;  1BCP C;  3A0J A;  4A3M H;  3H09 A;  5M3M G;  3ERO A;  5BR8 L;  5JJK A;  4PMC A;  1Z47 A;  5D3I B;  1TWF H;  4DV6 Q;  4O2D A;  1EQR A;  2EYH A;  3MTS A;  3PSI A;  1KHI A;  5M5W B;  2EJF C;  4FP5 D;  5I9O A;  2R7Z H;  1TWG H;  2YV5 A;  2F0P A;  1B70 B;  3CD6 A;  2EYF A;  2Z8L A;  2ZTE A;  3R93 A;  1Q8I A;  2BA1 A;  3CPW A;  2KCC A;  1SAP A;  2BA0 A;  3S1N H;  1HFG A;  1B4O A;  1VMP A;  2VS1 A;  2FIN B;  3CCL A;  3KDF B;  1SN8 A;  2JA7 H;  1HNW Q;  5EQ0 A;  1JJC B;  1QJO A;  2LXK A;  5M3F H;  4CJ1 B;  2EXD A;  1D5X C;  2N8N A;  1EWC A;  2L1B A;  5DM7 3;  4XTC S;  1V1P A;  3NBH A;  1CKM A;  1KLU D;  4KY5 A;  1PHJ A;  2B2T A;  2VUM G;  1BCP B;  1GUN A;  1TXY A;  3SK6 A;  3PUZ A;  5GQO A;  4ZK9 B;  3HOZ G;  1Y8N B;  2HCI A;  1H9S A;  1I4X A;  2UXC Q;  2Y0S E;  4A4I A;  1ILQ A;  4JVZ A;  2RVL A;  1G8Z D;  4HR7 B;  4A3K H;  1L0X B;  3ND8 A;  4H44 C;  5AJ3 Q;  1LTB D;  1XX8 A;  4A3E B;  3E0J A;  4K2K A;  1YHB A;  4QJF A;  1YBY A;  2K05 A;  4C3I G;  4BY7 B;  5TSS A;  1S40 A;  1STH A;  1T5X D;  3F2D A;  1I6V C;  2K50 A;  3R8B A;  3VA5 A;  2NZO A;  5CC4 A;  4S3S A;  4K8I A;  1PH1 A;  3X3M A;  4K5X A;  2UUA Q;  3HFZ B;  4J1M A;  1EQV A;  4P75 A;  2EJG C;  2VNU D;  4A75 A;  4L63 B;  1PH9 A;  1D6E C;  2LY7 A;  3HG9 A;  1QNK A;  3K7U C;  3I4N B;  2NN6 I;  4JV5 L;  4YWM A;  1G91 A;  4X65 L;  4BBS B;  2WKD A;  1L1O A;  1RTN A;  1N36 L;  5IGB A;  1S5B D;  1IKL A;  2R92 H;  3LX0 A;  3CHB D;  3HOY H;  1IL2 A;  3HS0 C;  1E2Z A;  3QOL A;  2F52 A;  3BZD B;  2E8G A;  4JBJ A;  3EVQ A;  3I4L A;  1QWY A;  2VQF Q;  3D6W A;  1LAC A;  3NP8 A;  2JA5 H;  3S14 H;  3QB3 A;  5T1G A;  1HTL D;  1TII D;  1EFI D;  1STG A;  1UE7 A;  5JOB A;  2WAQ B;  3NWS A;  4YY3 L;  3S2H B;  4KJO A;  2F3V A;  3PUV A;  3M3Y H;  3T51 B;  3K57 A;  4AQY Q;  2D62 A;  4KKU A;  3MFY A;  4B3T Q;  1CQF A;  5K36 H;  3CCR A;  3HOW G;  4RG1 A;  2E2J H;  2AUK A;  4RFB A;  5KRU A;  1P8L A;  3I55 A;  2F0Q A;  3VYT A;  5IP7 G;  2PQA B;  3GTL H;  3DM3 A;  2EJM A;  2K5D A;  4R9W A;  4EGV A;  4F88 A;  3PIO A;  4IUR A;  4OWW B;  4LF5 L;  3CCS A;  2UUC L;  3S1M H;  3VA7 A;  4C3H B;  1XMQ Q;  2PNR C;  1N34 Q;  1EIG A;  4HIK A;  3BJU A;  1EYD A;  4A93 G;  2PNH A;  4DR4 Q;  4IFD J;  1K83 B;  1Z7T A;  4XT1 B;  4ME3 A;  3I56 A;  4I7A A;  3K58 A;  3DMU A;  3PIO 3;  4HIM A;  2A6E C;  2O5J C;  3AFQ A;  4DR5 L;  1CKO A;  1HA5 A;  1O7Y A;  2MNA A;  1Q3L A;  4JI0 Q;  4R4I A;  2CQA A;  1F9Q A;  1FNW A;  4KV6 A;  4JI4 L;  5EBD A;  1ILP A;  2E2I H;  1NAP A;  2LXJ A;  2I07 B;  2K5V A;  4PMB A;  5COY A;  2MJ8 A;  2SEB D;  1EY9 A;  4DNR B;  3M4Q A;  1H9M A;  4IJH A;  3GD7 A;  1STA A;  1UUP A;  4P71 A;  4UDU C;  4OO1 G;  1EWH A;  4FNF A;  3FMC A;  3EA6 A;  2KCN A;  4B9W A;  1QNU A;  1ESR A;  3E3X A;  4KKS A;  1VS0 A;  1HZB A;  2MO0 A;  5IYD G;  1Q7Y C;  4MIU A;  3C1E A;  3GTO B;  5FOB B;  2ZJP A;  2JA7 G;  1A3V A;  1HCZ A;  1SYC A;  5AJ3 L;  1HA6 A;  4PG3 A;  3CRK C;  1HXY D;  1TWH H;  3H0G H;  4BS9 A;  2I5L X;  2B2U C;  3GQB A;  3D31 A;  3DHQ A;  1JR0 D;  4GKK Q;  3A55 A;  4A3B B;  1AZP A;  4OX9 Q;  1JWU D;  4NXM Q;  2QW7 A;  2XTI A;  4DR1 L;  2EY5 A;  1PZJ D;  3U50 C;  4QQB X;  2F0U A;  1SFO H;  1O7L A;  3MVV A;  1ENF A;  2UUA L;  3GDE A;  1ESF A;  4HIO A;  2K32 A;  4C1N K;  4AYB B;  1VQ4 A;  1YIJ A;  1UWV A;  2VB2 X;  4DAY B;  4K6D A;  5HGT A;  3EJI A;  3S9W A;  4HCS A;  3I73 A;  1BO0 A;  1A63 A;  1GUT A;  2K5W A;  2PI2 A;  4JBW A;  5A2Q E;  2J7Z A;  1ZYR D;  1BCP F;  4EQP A;  2N3S A;  1EQT A;  2M00 A;  5A2Q L;  2ZT9 C;  3T16 A;  1SJH D;  2BE5 D;  4KN7 C;  2RSO A;  3MA2 B;  1TWA B;  2ENB A;  3K5M A;  3JAM c;  1TS3 A;  3J80 E;  3KJP A;  5DNF A;  2DNE A;  2VQE L;  1IBK Q;  3J80 L;  2NVX B;  1EU4 A;  4R4C A;  3NEN A;  4HAE A;  5EGT A;  1EL0 A;  4P73 A;  1TS4 A;  1PTO H;  1SMY D;  2QCP X;  1SE3 A;  1A2T A;  4AQY L;  2VL6 A;  1K0S A;  3K80 C;  1STE A;  4B9X A;  1S4Z A;  2AUJ D;  1CHQ D;  4A3M B;  1QG7 A;  3NQI A;  4CBV A;  5I4D A;  4HJA A;  2NVT H;  3KF6 B;  4UP7 A;  4DUZ Q;  2BCO A;  1EEF D;  1CZG A;  1HZA A;  1TWF B;  1TY2 A;  1QVF A;  4L8J A;  2B2V C;  2JA5 G;  1BCP D;  2E76 C;  2R7Z B;  1TWG B;  3PCO B;  4P74 A;  3U4V A;  3Q0A A;  1I94 Q;  4V19 0;  2YTX A;  2RDG A;  1KD1 C;  3KFU A;  1PDQ A;  4ZQ3 A;  1O7I A;  4FO2 A;  4BA2 I;  4FXG C;  4JI3 L;  5IOD A;  3FKI G;  4DR4 L;  3S1N B;  5E1F A;  3NTH A;  5DEH A;  3GP7 A;  3E6Z X;  5C4X G;  3H3V H;  4ZKB B;  5LHY 1;  4LF6 L;  2JA7 B;  1WYD A;  5C4H A;  1K8O A;  2WV6 D;  2XVS A;  5M3F B;  1Q90 A;  1Y1W H;  1SE8 A;  2FMM A;  2L4N A;  2HHH Q;  1VQG A;  2EYM A;  3K8A A;  4JI0 L;  1SNM A;  4EX5 A;  4FYD A;  2K1B A;  1ZKO A;  2WAC A;  5EBC A;  2AQ3 B;  2NVQ H;  1TKW B;  4K14 A;  3CCJ A;  5CV7 A;  1S5C D;  1DM0 B;  4BBR G;  2B8G A;  3OTO Q;  5IYB H;  3BDC A;  1VMC A;  1F77 A;  4KY6 A;  3I4O A;  5M9O A;  4LF8 L;  1F9R A;  4DV0 Q;  2ZTD A;  1KQS A;  1F2M A;  4OEL B;  2H4O A;  2MGS A;  2F3I A;  3QIA A;  4EQN A;  4YWL A;  4DV4 Q;  4DR2 Q;  1F2Y A;  4K6L A;  1WFQ A;  3NXW A;  4A3K B;  2Z4H A;  1IW7 D;  3NUC A;  1CA5 A;  4NMZ A;  3ER0 A;  3KBG A;  2WB1 E;  3S1R H;  2L55 A;  4PZ6 A;  4IPG A;  1WVL A;  4GKK L;  2Q8R E;  5IP9 H;  4OX9 L;  4NXM L;  4A3F H;  3GO5 A;  1U4R A;  4GZY C;  4IOA A;  1PFM A;  1TS2 A;  5EKI A;  4HSV A;  3G4S A;  4JI7 Q;  2EY1 A;  3PUY A;  2JA8 B;  2EXZ A;  1KLG D;  3H0G G;  2PZT A;  4JI1 Q;  4XQQ A;  1EYG A;  3T13 A;  2R92 B;  1YJW A;  3HOY B;  3CF5 A;  5DAU A;  2CQO A;  4BY1 H;  4IUV A;  3H3V I;  3PGZ A;  1RHP A;  3R2T A;  1EEI D;  2JQO A;  2D5D A;  1A2U A;  2RKS A;  1BKB A;  1QVG A;  1HHV A;  2EE1 A;  2I5M X;  4ALP A;  1E3P A;  4A3D G;  2Q2U A;  5LMN W;  1SNO A;  5NUC A;  2ES2 A;  2QEJ C;  1CM9 A;  2A8V A;  5LL6 S;  1GO3 E;  5LL6 X;  4A3L H;  1S72 A;  1AH9 A;  1WCM G;  4DK0 A;  3OIP A;  2E2J B;  3KDF A;  3I91 A;  1FNV A;  2E75 C;  1PXU A;  1NNX A;  4DUZ L;  1YZ6 A;  5FLM G;  1LT3 D;  3RZD H;  5IWA L;  2JSO A;  4RWS C;  3GTL B;  5ELN A;  4R8N A;  4LMQ D;  2CH4 W;  2Q2H A;  4L5R C;  5AFW A;  4JCV E;  3GTK H;  2ALY B;  1G2T A;  3S1M B;  5KNB A;  1I94 L;  2BDO A;  1XWE A;  1C48 A;  1VQF A;  5ELB A;  1CT1 D;  1X32 A;  4IFD I;  2F0H A;  2KHS A;  1SEB D;  1II3 A;  3NEL A;  2WIN B;  4GN5 A;  4X3S A;  5C5L A;  4CJ0 B;  1B1Z A;  2GN5 A;  2DY8 A;  5LMN L;  4LW1 A;  4FDB A;  3PUW A;  2PW5 A;  4K5V A;  4YHH Q;  2JE6 I;  1JJG A;  4JBM A;  1PA6 A;  3UDG A;  1K28 A;  4KD3 A;  2HHH L;  3BYT B;  2SNS A;  4C3H H;  4B3M L;  4FF1 A;  4DUY Q;  2E2I B;  4KN4 C;  1EZ6 A;  3J7Z C;  3PF5 A;  1EFW A;  3OTO L;  3SGI A;  2F0M A;  1V43 A;  2N78 A;  2UU9 Q;  2KA7 A;  3BG3 A;  3BVM A;  4DR7 L;  2KED A;  3EN2 A;  2F4V L;  1WJJ A;  2CW0 D;  4IZ8 A;  1JIC A;  4EVO A;  4DV4 L;  4DR2 L;  2AMC B;  4DK6 C;  1ZEQ X;  1TWH B;  1EY8 A;  3EFX D;  4WFN 3;  1AN8 A;  4V0B A;  3N6R A;  1K8G A;  4Y52 H;  3DEP A;  1EIF A;  2KEN A;  1X9N A;  3DWP A;  3CU7 A;  3I90 A;  4DK3 C;  5KIX A;  3MXG A;  1SFO B;  1J9O A;  3TQY A;  1S3O A;  3ULJ A;  1PV4 A;  1YNX A;  2TMP A;  4POF A;  1MJC A;  2NZH A;  1LTL A;  1XJV A;  4X64 Q;  1C7Y A;  2FHT A;  4JI7 L;  1CSP A;  3D4D A;  1L0W A;  1R4P B;  3OW7 A;  1CI3 M;  4A3B H;  1ICW A;  2F0O A;  3UDX A;  2NTS A;  4JI1 L;  1VF7 A;  2HDM A;  2IY5 B;  1HNZ L;  1N9W A;  4OL7 A;  4PNY A;  3UDF A;  5BN5 A;  3L0O A;  4MNO A;  1LTR D;  1ZYR C;  5IP9 G;  1NJI C;  4CKC A;  1SYG A;  1MSG A;  1PFN A;  1AP0 A;  1SRU A;  3F2C A;  3D4W A;  4C3J H;  2Z1C A;  2PPB C;  5ELC A;  4A3E G;  1ET6 A;  3B6Y A;  1CZW A;  1XNQ Q;  1VQH A;  3H6M A;  3KUP A;  5BN3 A;  4BY7 G;  2EDG A;  5J39 A;  3AMU A;  1SYD A;  2RF4 A;  1PTO B;  1YHA A;  2ZJQ A;  2HDL A;  3W2D A;  2XGT A;  1B8A A;  1KNE A;  4PQX A;  2OEO A;  4JC0 A;  2A74 C;  1EY6 A;  2B63 H;  3WOE A;  2NVT B;  5JAV A;  4KD4 A;  2WB1 B;  3CQZ H;  4TSS A;  4IUT A;  3I4N G;  2OTJ A;  5M5X H;  5CMD A;  4BBS G;  3TZD A;  3IFD A;  1D1K A;  2HCC A;  2KUM A;  5ELO A;  4YCV A;  1LTG D;  1VQK A;  1XPR A;  5D14 A;  1KC8 C;  1N32 Q;  3HRZ C;  4H7B A;  4TVA B;  3TRE A;  5L37 A;  3NK9 A;  1FJG Q;  1UNS A;  2EOT A;  4RGO S;  2F0I A;  2L0C A;  2NN6 H;  4LFC L;  4YHH L;  1OXV A;  4DU9 A;  1Y1W B;  1PRT B;  2K6A A;  1EU3 A;  2WAQ G;  2NVQ B;  4LFB Q;  3LGJ A;  3QO2 A;  4XQJ A;  2GVA A;  3DUZ A;  1I4G A;  3HOU B;  3D8G A;  3OPO A;  2KHJ A;  4DV3 Q;  2MHV A;  1ENC A;  1Q46 A;  2HIX A;  3P1H A;  1CKN B;  2JA6 H;  2A6H C;  3OWE B;  3PO3 H;  4P72 A;  1GM5 A;  5JEA G;  4A3C G;  2QIL A;  3ITP A;  5E3F A;  3KF8 B;  3MXN B;  3KLR A;  1DCZ A;  4OIK A;  4C3H G;  1TY0 A;  3S1R B;  2BDN A;  1IW7 C;  1LAB A;  2ZJR A;  2PQE A;  3C3L A;  2JYO A;  5ELD A;  4QGU A;  2F0F A;  3TP8 A;  1IYV A;  1HNX Q;  4G4K A;  2RQX A;  3GTQ H;  4A3F B;  1JWS D;  3A8K E;  2A5H A;  3W1B A;  1JOK A;  4JK1 C;  3VR2 A;  2CHB D;  1GKH A;  2KJX A;  3UE1 A;  3FPP A;  3R2I A;  2B2U A;  4NKL A;  2K7V A;  4PZ7 A;  4TKO B;  3K5O A;  4X64 L;  3H94 A;  1IHZ A;  4IUP A;  4J15 A;  4TQU S;  2XWJ B;  1VQP A;  3C46 A;  1SXT A;  3GTJ H;  1MKH A;  4DV7 Q;  4DR6 L;  4MTN A;  2OQK A;  4BY1 B;  4L5S A;  5IGD A;  3SEB A;  3QOJ A;  1VQE A;  2B2W C;  1YI2 A;  5CGK A;  3A7A B;  2WFW A;  3LNN A;  4O42 A;  2JEA I;  2JA8 H;  3WOF A;  5C0X G;  4U67 3;  1DZ1 A;  1JE4 A;  4KTA A;  1SNQ A;  3SK5 A;  3J7A 5;  3VYS A;  1N33 Q;  4IPH A;  1VQ5 A;  3QR8 A;  4A3B G;  2K5H A;  2F3W A;  1U9R A;  4B08 A;  1NBW A;  4IPC A;  5C44 H;  1SRO A;  2K5Q A;  1K3R A;  4UP9 A;  3A8I E;  3KBX A;  1GXD C;  2OCE A;  3RZD B;  4DK1 A;  4OO1 I;  4AYB G;  1H9R A;  2V4D A;  1B9M A;  4XIG S;  3PUX A;  4HED A;  3J80 c;  1G2S A;  4DXG A;  1BF4 A;  3GTK B;  1EOT A;  1ENA A;  4KMU C;  2N88 A;  2M9V A;  5KGU A;  3HP3 A;  1Y8O B;  1WI5 A;  4YCW A;  5IYC H;  5FJ8 H;  4JI8 Q;  1U4P A;  3K59 A;  2J4X A;  4RCN A;  4FF2 A;  3K7A H;  3A56 A;  4DV6 L;  3BDL A;  2B2V A;  5IGC A;  2F0L A;  3GV6 A;  4IO9 A;  1PH3 A;  2HUG A;  1QZG A;  3L7Z C;  4DGZ A;  4G7H C;  3VYU A;  2JEB I;  3U9O A;  3S1Q H;  3NQT A;  4IN3 A;  1SYE A;  4WJ3 M;  4A3M G;  2R93 H;  1HQM C;  1K0R A;  1HNW L;  2RA4 A;  2G9D A;  1T5E A;  2RCN A;  3OW2 A;  3IFT A;  2F0J A;  4GLV B;  2CW0 C;  4MN3 A;  3CC2 A;  5JPN C;  4O1N A;  1QIL A;  2XSC A;  2NN6 G;  4KHV A;  4RCO A;  5ELF A;  4DFA A;  3RNU A;  4UPA A;  2PZW A;  2R7Z G;  2BH8 A;  4A3I H;  5DM6 3;  2QKI C;  3MEF A;  4JOI C; 
#chains in the Genus database with same CATH homology
 1RKN A;  4KKT A;  1EYC A;  5E4X A;  1CA6 A;  5ISR A;  3MEH A;  2A68 C;  1AEX A;  1PTO D;  1I4P A;  5CV8 A;  3NPP A;  3SE0 A;  4QMG A;  1TVX A;  2X6L A;  3P7J A;  1SSO A;  4C3J B;  2IW3 A;  1CHP D;  1V1O A;  4CJ2 C;  3NBI A;  2R3Z A;  2L9H A;  3V96 A;  3E5S A;  3G7L A;  1BNZ A;  3DXJ C;  2EY6 A;  1V1P B;  1S5D D;  3MWY W;  2IX0 A;  2B63 B;  1BQQ T;  4BA1 I;  1PRT D;  4WOR A;  1ML0 D;  3CQZ B;  1KAA A;  5C3W A;  2NBF A;  3T53 B;  2ICE C;  3P20 A;  3OOC A;  3V05 A;  5M5X B;  3I72 A;  1RCV D;  2Y0S B;  1QE6 A;  1EY5 A;  4IUQ A;  5JEA J;  2AWO A;  4ZUJ A;  1LTS D;  2NB0 A;  3OIQ A;  3HEJ A;  3G6J B;  3I70 A;  5E4W C;  1CQV A;  1GHK A;  2DY7 A;  2NWG A;  3VR4 A;  5CV9 A;  4ME5 A;  4OIJ A;  5KND A;  5D3D A;  1SND A;  4Q0F A;  4H0L C;  3MAQ A;  5K36 G;  4RGM A;  1EY0 A;  5I2X A;  2JA6 B;  3N52 A;  3PO3 B;  4LAA A;  2C5C A;  2I46 A;  4OGQ C;  4F7X A;  3TME A;  2H1E A;  1MBY A;  4RGN A;  4H13 C;  2XRS D;  4HMJ A;  3T56 B;  2A6H D;  4RKL A;  3RD4 A;  1A3U A;  3BVG A;  5C0X J;  3GTQ B;  1M4V A;  1JOR A;  1JOQ A;  4G7O C;  4XYQ A;  5CBE E;  2F0E A;  1X3P A;  2X6G A;  2XN9 C;  5CV4 A;  2EYJ A;  1KDB A;  1RF2 D;  3X3N A;  4Y7N B;  3P75 A;  2PO4 A;  1FD7 D;  4IFD H;  2B2Y C;  3GTJ B;  1C8C A;  1PZK D;  4IUU A;  1KNA A;  5IGG A;  5IGF A;  1SE2 A;  4QUF A;  2L11 A;  2NVY B;  2IX1 A;  4DN4 M;  4DNT B;  1E2W A;  2JXM B;  3VYR A;  1F2Z A;  1GUO A;  3GV3 A;  1WTX A;  4RAU C;  4P2C B;  1SNC A;  1SYB A;  5C44 B;  2WKC A;  1O7Z A;  3KLS X;  1FNU A;  1NR2 A;  1V8Q A;  1JC7 A;  3L9A X;  3HOX B;  5A35 A;  3K5N A;  1CTM A;  2M2L A;  3IKJ A;  4R8I A;  3V2T A;  3K7A B;  2L5T A;  4C1N I;  2Q8I B;  2WP8 J;  3MXN A;  4L6T B;  1A3T A;  4IUN A;  1WTP A;  4ZAI A;  1U4M A;  5EPJ A;  3S1Q B;  2VXW A;  1JB3 A;  1JWM D;  2R93 B;  3NHH A;  3BS1 A;  2EPB A;  2A69 D;  5EKL A;  2RDH A;  4DAP A;  5J22 A;  1AFP A;  3DWA A;  4A3I B;  1S5E D;  3A54 A;  5C3E B;  2KVM A;  1R9T B;  2R61 A;  5CBA E;  4CHT B;  1DOK A;  3A7L A;  1D2B A;  4KK7 A;  4BWG B;  1SYF A;  3BDO A;  1RJT A;  5KNC A;  1K8M A;  3CRL C;  3HKZ B;  3QG1 A;  4A3J B;  2YYZ A;  4FVM A;  4XDX A;  2QF7 A;  3HOV B;  1Y1V B;  1XXG A;  4IQZ A;  4MHE A;  3IL8 A;  3Q22 A;  3J7Y W;  1B3A A;  1LTA D;  5JJZ A;  1PTO C;  3RMH A;  1ONL A;  1OXX K;  1XTC D;  3J81 E;  2K03 A;  3LWU A;  3J81 L;  4XT3 B;  2A68 D;  1Z6H A;  2L12 A;  1WTV A;  1H9J A;  5KEE A;  4ZYS A;  1I4Q A;  3VR3 A;  4F87 A;  2R6G A;  1KAB A;  4A3G B;  1XYI A;  5KYL A;  2KOL A;  1WTW A;  2K28 A;  4HTH A;  1YNN C;  5FLX E;  5IGE A;  1A6X A;  3D6C A;  3Q6S A;  5FLX L;  1WTO A;  4IFD G;  1OXS C;  2K01 A;  2K04 A;  2B2W A;  5IT9 E;  2LMC B;  3K0Y A;  5I9P A;  2Q8T A;  3H3V C;  5IT9 L;  5C4Z A;  1VF5 C;  3KK7 A;  1UEA B;  3C2P A;  1PRT C;  1FGB D;  4KJN A;  1HUM A;  2IX3 A;  1LT5 D;  1Y69 U;  1SE4 A;  4QF4 A;  5JVG 3;  2E2D C;  1AZQ A;  3QWN A;  3GTP B;  1W6J A;  1LO5 D;  2D2C C;  3PV0 A;  3D3R A;  4C56 C;  2OT2 A;  2F0V A;  3RZO B;  3VR5 A;  1GUG A;  1DXM A;  2ZXP A;  3GTG B;  4DA2 A;  1TS5 A;  2F03 A;  4HSP A;  1GUS A;  3I3C A;  2EYL A;  2KEC A;  4PMW A;  1H9K A;  2LFN A;  1BUV T;  2AWN A;  5K5P A;  1G29 1;  4QB4 A;  1LT6 D;  1LLR D;  1MI2 A;  2J0T D;  4DF7 A;  4RH6 A;  5C0X I;  3O13 A;  4RKB A;  2RBM A;  3MHB A;  1PYW D;  4OO1 H;  2EYO A;  4DAY A;  1I3Q B;  3OHX C;  5CR3 A;  3M4Y A;  3I4M B;  1D5M C;  4X3T A;  4G7Z C;  5CV5 A;  2KQ3 A;  5I2Y A;  1BBX C;  3F2U A;  1GUW A;  3ERQ A;  2MPM A;  2KEE A;  1FYC A;  5IOC A;  1JCK B;  3BYY B;  2SOB A;  4Q5V A;  1KDC A;  4IAL A;  1B50 A;  1VCI A;  2O2L D;  1EY7 A;  1YNJ C;  3HZX A;  3S17 B;  4N9T A;  1CK1 A;  3PO2 B;  3IAY A;  4NW2 A;  1KTK A;  3D4R A;  2LS0 1;  1Y8P B;  3SDZ A;  3SK4 A;  3KLS A;  1HPC A;  2O5I C;  2XRQ D;  1W6K A;  2YU9 B;  4M1U B;  3FEW X;  3S15 B;  4U68 A;  4ZLT F;  2GA4 B;  1C4Q A;  5EPK A;  1M8A A;  4UAI A;  3HGB A;  2NYZ D;  1JQY D;  4HCE A;  1B9N A;  4C3J G;  5M3M B;  5EKK A;  4RHS A;  2XWB B;  3K5L A;  1WTQ A;  4WJW A;  2IPK D;  5JPM C;  4X3K A;  1WD1 A;  5M5Y B;  2X69 A;  4CKE A;  1B53 A;  3S2D B;  4RHR A;  4ZRZ A;  4XXE A;  4OHJ A;  1SJE D;  1QB5 D;  1DON A;  1GHJ A;  1RDP D;  2O4X A;  1ZXT A;  4DAV A;  2A69 C;  1J8I A;  4EQO A;  1SDF A;  4FF3 A;  2IL8 A;  1PTO F;  3TDQ A;  3M85 A;  4I65 A;  3R3O A;  3UI2 A;  1LTI D;  1Q1B A;  2VUM B;  1ROD A;  1RTO A;  2DN8 A;  3HOZ B;  2AQ1 B;  1STY A;  3FDT A;  4M8A A;  1OO9 B;  5I6W A;  2NZ1 D;  2OXP A;  3SK8 A;  5T1I A;  2TSS A;  2AQ2 B;  4XQN A;  4C3I B;  1HFN A;  4K5W A;  3AU7 A;  2F0N A;  2WII B;  2B2T C;  3L3O C;  2E74 C;  3U9S A;  1TR5 A;  4ILW A;  1WTR A;  1F2L A;  1QOH A;  3DM1 A;  2F0D A;  4F8M A;  3ZYY X;  3DWQ A;  3W3A A;  3C1F A;  1PRT F;  4C2M B;  4PV1 C;  2ID0 A;  3SXH A;  2F0T A;  1BXT A;  2B2Y A;  1DD2 A;  5BN4 A;  1R4Q B;  4ABN A;  3K6O A;  1O80 A;  3EQL C;  1PMR A;  1YNN D;  2EYP A;  1B2T A;  4CGY B;  1O78 A;  5FO9 B;  3OMC A;  3OMG A;  1ET9 A;  2DNC A;  4LK1 C;  1I4R A;  4LJZ C;  4ULL A;  3Q23 A;  4ID6 A;  1TT2 A;  5CYU A;  1H9S B;  3HOW B;  2OF1 A;  3NSW A;  1BOS A;  4J8Q A;  3Q24 A;  5IIF A;  2ZXO A;  3TP7 A;  1B44 D;  3NWT A;  4A93 B;  3TN2 A;  3VR6 A;  3MZ5 A;  2IT1 A;  1TQO A;  1CFM A;  4N9P A;  2FMC A;  5FO8 B;  1DOL A;  1STB A;  1OXT A;  1HTP A;  3T4A C;  3NE5 B;  1BR9 A;  4RA8 A;  1AW7 A;  1HQR D;  1QCB D;  1GOZ A;  1PFB A;  1EZ8 A;  3QJY A;  2PZU A;  4HN7 A;  3DEO A;  1TU2 B;  1PZI D;  4QCL A;  5ELE A;  1NCV A;  1IL8 A;  1VDZ A;  1L0Y B;  2F0G A;  1IKM A;  3TZU A;  3NTK A;  2F4I A;  1RD9 D;  1F9P A;  3GTM B;  2NTT A;  2LKV A;  5G3L F;  4KY7 A;  1LV9 A;  2RSN A;  1PLF A;  3MXP A;  4KI0 A;  3ND9 A;  2MUY A;  1KDA A;  2PCF B;  5C3X A;  3RUZ A;  2E2H B;  1YNJ D;  1JOO A;  2XNA C;  5EJW A;  3FVQ A;  3M7G A;  3TP6 A;  1MSH A;  1DJR D;  2RDF A;  2VB3 X;  3SHL A;  3MC0 B;  4FXD A;  2BOS A;  4NDX A;  3BVZ A;  5F2D A;  4FF4 A;  1MGS A;  5FKA C;  1I6H B;  1I50 B;  2C9O A;  3PMF A;  1NUC A;  4ZUI A;  5G3L D;  3SVM A;  1D1I A;  3CKI B;  3FPU B;  3OSO A;  5COR A;  2B39 A;  2ICI A;  3WDN A;  3JAM E;  3RLF A;  4CKB A;  4I7Z C;  3TP5 A;  1LTT D;  2MP1 A;  1D5Z C;  1Q1E A;  3JAM L;  1TWC B;  2B8F A;  2K33 A;  2JA5 B;  1LT4 D;  3S14 B;  2A73 B;  1SBB B;  5HUR A;  3M3Y B;  2PMZ B;  3KF8 A;  3FKI B;  2FFK B;  3M7N A;  3M4O B;  5C4X B;  5KYI A;  1DYQ A;  2JP1 A;  4K2L A;  2QDB A;  2NUC A;  4QUC A;  4X3U A;  4BBR B;  1IYU A;  2XIW A;  3I8Z A;  5C5M A;  1A15 A;  4J6H A;  2EZV A;  2F0S A;  2FJ2 A;  4HMI A;  3J7A V;  3TSS A;  5JEA H;  1E0B A;  2N55 A;  1FR3 A;  1EIH A;  5JVH 3;  1G6Z A;  2A6E D;  1X3Q A;  3URY A;  4K8J A;  4QIW B;  4KHZ A;  2G9H D;  1HUN A;  1GJX A;  1S5F D;  4WRD A;  1BDO A;  3H0G B;  1SNP A;  4RGT A;  3LWE A;  1NSN S;  4DXF A;  2IJ0 A;  4XYO A;  1I4H A;  4G57 A;  3H91 A;  3TBI B;  4A3D B;  5C0X H;  2CVR A;  2F0W A;  1Q12 A;  3MXU A;  2Z4I A;  2SNM A;  5CV6 A;  1STN A;  4FXK C;  3S16 B;  3OWF A;  4NP5 A;  4Z9C B;  5C6A A;  3J7A F;  1WCM B;  2HQE A;  3MFG A;  1UAP A;  4YIJ A;  5FK9 C;  1MD2 D;  1EY4 A;  5D65 A;  4E6I A;  1HRJ A;  3PIP 3;  2BE5 C;  2PYK A;  3NTI A;  2D9U A;  2EVB A;  3A8J E;  1DOM A;  1F9S A;  5FO7 B;  2F0K A;  2EY2 A;  4ZKC B;  1SMY C;  3AB9 A;  1EYA A;  2F1M A;  3ONA B;  1E2V A;  2IWH A;  1U4L A;  3FRP B;  2ZXR A;  1NR4 A;  3SR1 A;  2SDF A;  1WD0 A;  5EPL A;  4TRD A;  1OXU A;  5J1Z A;  5C4J B;  4ODG A;  5I6Y A;  2PW7 A;  1BCP C;  3H09 A;  3ERO A;  4PMC A;  1Z47 A;  5D3I B;  2EYH A;  3MTS A;  5M5W B;  2EJF C;  4FP5 D;  5I9O A;  2F0P A;  2EYF A;  2Z8L A;  3R93 A;  1Q8I A;  2BA1 A;  2KCC A;  1SAP A;  2BA0 A;  1HFG A;  1B4O A;  1VMP A;  2FIN B;  5EQ0 A;  1QJO A;  4CJ1 B;  1D5X C;  1EWC A;  2L1B A;  5DM7 3;  4XTC S;  1V1P A;  3NBH A;  1KLU D;  4KY5 A;  2B2T A;  1BCP B;  1GUN A;  3SK6 A;  3PUZ A;  4ZK9 B;  1Y8N B;  2HCI A;  1H9S A;  1I4X A;  1ILQ A;  2RVL A;  1G8Z D;  4HR7 B;  1L0X B;  3ND8 A;  4H44 C;  1LTB D;  1XX8 A;  4A3E B;  3E0J A;  4K2K A;  2K05 A;  4BY7 B;  4C3I G;  5TSS A;  1STH A;  1T5X D;  1I6V C;  3R8B A;  3VA5 A;  5CC4 A;  4S3S A;  4K8I A;  3X3M A;  4K5X A;  4J1M A;  1EQV A;  2EJG C;  2VNU D;  4L63 B;  1D6E C;  2LY7 A;  3HG9 A;  1QNK A;  3I4N B;  2NN6 I;  1G91 A;  4BBS B;  2WKD A;  1RTN A;  5IGB A;  1S5B D;  1IKL A;  3LX0 A;  3CHB D;  3HS0 C;  1E2Z A;  3QOL A;  3BZD B;  3EVQ A;  3I4L A;  1QWY A;  3D6W A;  1LAC A;  3NP8 A;  3QB3 A;  5T1G A;  1HTL D;  1TII D;  1EFI D;  1STG A;  5JOB A;  2WAQ B;  3NWS A;  3S2H B;  4KJO A;  2F3V A;  3PUV A;  3T51 B;  3K57 A;  2D62 A;  4KKU A;  3MFY A;  1CQF A;  5K36 H;  2AUK A;  4RFB A;  5KRU A;  2F0Q A;  3VYT A;  2EJM A;  2K5D A;  4F88 A;  4R9W A;  4EGV A;  4IUR A;  3VA7 A;  4C3H B;  2PNR C;  1EIG A;  1EYD A;  4IFD J;  1K83 B;  1Z7T A;  4XT1 B;  3K58 A;  3DMU A;  3PIO 3;  2A6E C;  2O5J C;  1HA5 A;  1O7Y A;  1Q3L A;  2CQA A;  1F9Q A;  1FNW A;  4KV6 A;  5EBD A;  1ILP A;  1NAP A;  2I07 B;  4PMB A;  5COY A;  2MJ8 A;  2SEB D;  1EY9 A;  4DNR B;  1H9M A;  3GD7 A;  1STA A;  1UUP A;  4UDU C;  4OO1 G;  1EWH A;  4FNF A;  3FMC A;  3EA6 A;  2KCN A;  4B9W A;  1QNU A;  1ESR A;  4KKS A;  4MIU A;  3C1E A;  3GTO B;  5FOB B;  1A3V A;  1HCZ A;  1SYC A;  1HA6 A;  3CRK C;  1HXY D;  4BS9 A;  2B2U C;  3GQB A;  3D31 A;  3DHQ A;  1JR0 D;  3A55 A;  4A3B B;  1AZP A;  1JWU D;  2EY5 A;  1PZJ D;  2F0U A;  1O7L A;  3MVV A;  1ENF A;  1ESF A;  2K32 A;  4C1N K;  4AYB B;  2VB2 X;  4K6D A;  5HGT A;  3EJI A;  3S9W A;  4HCS A;  3I73 A;  1BO0 A;  1GUT A;  2K5W A;  4JBW A;  5A2Q E;  2J7Z A;  1ZYR D;  1BCP F;  4EQP A;  1EQT A;  2M00 A;  5A2Q L;  2ZT9 C;  3T16 A;  1SJH D;  2BE5 D;  4KN7 C;  2RSO A;  3MA2 B;  1TWA B;  2ENB A;  3K5M A;  3J80 E;  1TS3 A;  5DNF A;  2DNE A;  3J80 L;  2NVX B;  1EU4 A;  4HAE A;  5EGT A;  1EL0 A;  1TS4 A;  1PTO H;  1SMY D;  2QCP X;  1SE3 A;  1A2T A;  1STE A;  4B9X A;  1S4Z A;  2AUJ D;  1CHQ D;  4A3M B;  1QG7 A;  3NQI A;  4CBV A;  5I4D A;  2BCO A;  1EEF D;  1CZG A;  1TWF B;  1TY2 A;  4L8J A;  2B2V C;  1BCP D;  2E76 C;  2R7Z B;  1TWG B;  3Q0A A;  4V19 0;  2RDG A;  1PDQ A;  4ZQ3 A;  4FO2 A;  4BA2 I;  4FXG C;  5IOD A;  3S1N B;  5E1F A;  3NTH A;  5DEH A;  3GP7 A;  3E6Z X;  4ZKB B;  5LHY 1;  2JA7 B;  5C4H A;  1K8O A;  2WV6 D;  2XVS A;  5M3F B;  1Q90 A;  2L4N A;  2FMM A;  4FYD A;  2EYM A;  1SNM A;  2K1B A;  1ZKO A;  2WAC A;  5EBC A;  2AQ3 B;  1TKW B;  4K14 A;  5CV7 A;  1S5C D;  1DM0 B;  2B8G A;  3BDC A;  1VMC A;  4KY6 A;  1F77 A;  5M9O A;  1F9R A;  1F2M A;  2H4O A;  2MGS A;  3QIA A;  4EQN A;  1F2Y A;  4K6L A;  4A3K B;  3NXW A;  2Z4H A;  1IW7 D;  3NUC A;  1CA5 A;  4NMZ A;  3KBG A;  2L55 A;  1WVL A;  2Q8R E;  3GO5 A;  1U4R A;  4GZY C;  1PFM A;  1TS2 A;  5EKI A;  4HSV A;  2EY1 A;  3PUY A;  2JA8 B;  2EXZ A;  1KLG D;  2PZT A;  4XQQ A;  3T13 A;  2R92 B;  3HOY B;  5DAU A;  4IUV A;  1RHP A;  3R2T A;  1EEI D;  2D5D A;  1A2U A;  2RKS A;  1HHV A;  2EE1 A;  1SNO A;  5NUC A;  2QEJ C;  1CM9 A;  5LL6 S;  5LL6 X;  4DK0 A;  3OIP A;  2E2J B;  3I91 A;  1FNV A;  2E75 C;  1PXU A;  1LT3 D;  2JSO A;  4RWS C;  3GTL B;  4R8N A;  4LMQ D;  5AFW A;  1G2T A;  3S1M B;  5KNB A;  2BDO A;  1XWE A;  1C48 A;  5ELB A;  1CT1 D;  1X32 A;  4IFD I;  2F0H A;  2KHS A;  1SEB D;  1II3 A;  4X3S A;  2WIN B;  5C5L A;  4CJ0 B;  1B1Z A;  2DY8 A;  3PUW A;  2PW5 A;  4K5V A;  2JE6 I;  4KD3 A;  4FF1 A;  3BYT B;  2SNS A;  2E2I B;  4KN4 C;  1EZ6 A;  2F0M A;  1V43 A;  2KA7 A;  3BG3 A;  3BVM A;  2KED A;  2CW0 D;  4IZ8 A;  1JIC A;  4EVO A;  1ZEQ X;  1TWH B;  1EY8 A;  3EFX D;  4WFN 3;  1AN8 A;  4V0B A;  3N6R A;  3DEP A;  3DWP A;  3CU7 A;  3I90 A;  5KIX A;  3MXG A;  1SFO B;  1J9O A;  2TMP A;  2FHT A;  3D4D A;  1R4P B;  3OW7 A;  1CI3 M;  1ICW A;  2F0O A;  2NTS A;  1VF7 A;  2HDM A;  4OL7 A;  4PNY A;  5BN5 A;  1LTR D;  1ZYR C;  4CKC A;  1SYG A;  1MSG A;  1PFN A;  1AP0 A;  3D4W A;  2Z1C A;  2PPB C;  5ELC A;  1ET6 A;  1CZW A;  3H6M A;  3KUP A;  5BN3 A;  2EDG A;  5J39 A;  3AMU A;  1SYD A;  1PTO B;  2HDL A;  3W2D A;  1KNE A;  4PQX A;  2OEO A;  2A74 C;  1EY6 A;  3WOE A;  2NVT B;  5JAV A;  4KD4 A;  2WB1 B;  4TSS A;  4IUT A;  5CMD A;  3TZD A;  3IFD A;  1D1K A;  2HCC A;  2KUM A;  1LTG D;  5D14 A;  3HRZ C;  4H7B A;  3NK9 A;  1UNS A;  2EOT A;  4RGO S;  2F0I A;  2L0C A;  2NN6 H;  1OXV A;  4DU9 A;  1Y1W B;  1PRT B;  2K6A A;  1EU3 A;  2NVQ B;  3QO2 A;  4XQJ A;  3DUZ A;  1I4G A;  3HOU B;  3D8G A;  3OPO A;  2MHV A;  1ENC A;  3P1H A;  2A6H C;  3OWE B;  5JEA G;  2QIL A;  3ITP A;  5E3F A;  3KLR A;  1DCZ A;  4OIK A;  4C3H G;  1TY0 A;  3S1R B;  2BDN A;  1IW7 C;  1LAB A;  3C3L A;  2PQE A;  2JYO A;  5ELD A;  2F0F A;  3TP8 A;  1IYV A;  2RQX A;  4G4K A;  4A3F B;  1JWS D;  3A8K E;  2A5H A;  1JOK A;  4JK1 C;  3VR2 A;  2CHB D;  2KJX A;  3FPP A;  3R2I A;  2B2U A;  4NKL A;  2K7V A;  4TKO B;  3K5O A;  3H94 A;  1IHZ A;  4IUP A;  4TQU S;  2XWJ B;  3C46 A;  1SXT A;  4BY1 B;  5IGD A;  3SEB A;  3QOJ A;  2B2W C;  5CGK A;  3A7A B;  3LNN A;  4O42 A;  2JEA I;  3WOF A;  5C0X G;  4U67 3;  1DZ1 A;  1JE4 A;  4KTA A;  1SNQ A;  3SK5 A;  3VYS A;  2F3W A;  1U9R A;  4B08 A;  2K5Q A;  3A8I E;  3KBX A;  1GXD C;  3RZD B;  4DK1 A;  4OO1 I;  1H9R A;  2V4D A;  1B9M A;  4XIG S;  3PUX A;  4HED A;  1G2S A;  4DXG A;  1BF4 A;  3GTK B;  1EOT A;  1ENA A;  4KMU C;  2N88 A;  2M9V A;  5KGU A;  3HP3 A;  1Y8O B;  1U4P A;  3K59 A;  2J4X A;  4RCN A;  4FF2 A;  3A56 A;  3BDL A;  2B2V A;  5IGC A;  2F0L A;  3GV6 A;  2HUG A;  3L7Z C;  4DGZ A;  4G7H C;  3VYU A;  2JEB I;  3U9O A;  3NQT A;  4IN3 A;  1SYE A;  1HQM C;  2RA4 A;  2G9D A;  1T5E A;  3IFT A;  2F0J A;  2CW0 C;  4MN3 A;  5JPN C;  4O1N A;  1QIL A;  2XSC A;  5ELF A;  2NN6 G;  4KHV A;  4RCO A;  4DFA A;  2PZW A;  5DM6 3;  2QKI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...