5AFWA

Assembly of methylated lsd1 and chd1 drives ar-dependent transcription and translocation
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
174
structure length
163
Chain Sequence
EFETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQYLIKWKGWSHIHNTWETEETLKQQNVRGMKKLDNYKKKDQETKRWYNCQQELTDDLHKQYQIVERIIAHSNQKSAAGYPDYYCKWQGLPYSECSWEDGALISKKFQACIDEYFSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CHROMODOMAIN-HELICASE-DNA-BINDING PROTEIN 1
publication title Assembly of Methylated Kdm1A and Chd1 Drives Androgen Receptor-Dependent Transcription and Translocation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 49
structure length 163
sequence length 174
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5afwA02
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5afwA01
3Q6SA 2NZ1D 2NYZD 1F9PA 5CORA 3UI2A 1BNZA 1IL8A 1CA5A 2J7ZA 5EKIA 5D14A 5EQ0A 5EJWA 1B53A 2K03A 1X3PA 4MN3A 4CJ1B 1IKMA 1AP0A 2FINB 3R93A 1MSGA 3DEPA 2B2WA 4IUPA 3GV3A 1Q3LA 2DY8A 4HSVA 4CJ2C 1ILPA 3DEOA 1CM9A 1NAPA 3TZDA 1PFNA 2Q8RE 1O80A 1QE6A 4X3KA 5DNFA 2XIWA 1HRJA 1ESRA 2B2UC 4RA8A 1GUWA 4XDXA 1U4LA 1TVXA 3I8ZA 2L12A 2HCIA 2B2UA 4HEDA 5COYA 1WTXA 3D6WA 2FJ2A 4IUQA 1HFGA 1ML0D 1G6ZA 2L9HA 2BDNA 2MJ8A 4HAEA 5E4WC 4O42A 2RSNA 1QG7A 1RJTA 3KBXA 1KNEA 1QNKA 5E4XA 2K05A 4ZAIA 1X32A 1RTOA 2B2VC 2JYOA 3KUPA 4HCSA 3GV6A 3DM1A 5JJZA 1IKLA 2H1EA 2B2YC 5EPLA 1U4RA 4MHEA 1WTOA 2EPBA 3I3CA 4IURA 1S4ZA 5CBEE 1B3AA 4R8IA 5AFWA 1DONA 2B2TC 2K01A 5EPJA 1RODA 4XT3B 3TN2A 1J8IA 1SDFA 4ZKBB 1PFBA 1VMCA 2HCCA 2RA4A 1NR4A 2KECA 1O7YA 3IL8A 5CBAE 1HUNA 2Q8TA 2K04A 4ZLTF 4OIJA 4QUFA 1WD0A 1MI2A 1MGSA 1SSOA 2R3ZA 4IUUA 4RWSC 4UAIA 5T1GA 1G91A 2KVMA 2EE1A 1F9SA 2N55A 2X6LA 4RAUC 2X69A 4DN4M 2KUMA 1M8AA 1EQTA 2L11A 1RHPA 4U68A 1B50A 1ILQA 2B2VA 1XYIA 4NW2A 1CA6A 1G2TA 2K28A 4LMQD 1PLFA 1G2SA 1RTNA 3I90A 2B2YA 1XX8A 1F9QA 2MPMA 1WTQA 1EIHA 2HDLA 4XT1B 1SAPA 2K1BA 3FDTA 1DOKA 2IL8A 3I91A 2B2TA 2KEDA 2L4NA 1EIGA 1PDQA 3IFDA 4IUTA 1X3QA 1KNAA 3H91A 2KEEA 3G7LA 4ZK9B 4OIKA 1NCVA 1O7ZA 1J9OA 4CJ0B 1U4MA 3HP3A 1MSHA 1WTPA 1VMPA 4IUVA 5CMDA 1HFNA 1NR2A 1DOMA 2CVRA 3P7JA 1E0BA 5EPKA 2N88A 4X3UA 2HDMA 1PFMA 3F2UA 2M2LA 1U4PA 1JE4A 2B2WC 1JICA 2SDFA 1WTRA 2X6GA 3MTSA 2EOTA 2L1BA 1BBXC 1WD1A 1BO0A 2VXWA 1DOLA 1F2LA 1WTWA 1AZQA 1HUMA 1HA6A 1HHVA 3MWYW 2DY7A 2HUGA 2FMMA 3FPUB 1WVLA 1B4OA 2JP1A 2KOLA 1WTVA 2MGSA 3QO2A 4QUCA 5T1IA 1DZ1A 1BF4A 2RVLA 1AZPA 2RSOA 1ZXTA 2MP1A 1LV9A 2NWGA 4X3TA 1F9RA 3LWEA 3ONAB 5D65A 4ZKCB 1A15A 3SVMA 2FFKB 2D9UA 1C8CA 2FHTA 1B2TA 4X3SA 1EL0A 4R9WA 3N52A 1ICWA 1EOTA
chains in the Genus database with same CATH superfamily
1SYFA 2CHBD 1KRSA 2NZ1D 2LSSA 1LTID 3BYYB 3VYRA 4IPDA 1I4PA 4DAMA 4BA1I 4BY1G 1CK1A 5C0XG 4A3EG 2IX0A 5J1ZA 4RA8A 3D6WA 2YTXA 1I4QA 3OTOL 3IRBA 3HOVH 1JCKB 4YHHQ 3M4QA 3PF5A 3MAQA 3SEBA 4ILWA 2EPBA 3I3CA 2JSOA 2CW0D 2R92G 3TP6A 3M3YH 1CI3M 1R4QB 4DFAA 5FLXc 3M4YA 3KOJA 1KDAA 1RIPA 3I55A 4BY7H 1K0SA 1NMFA 4P74A 2A73B 1I50H 1KQSA 4A3KH 3GTGH 2G9HD 1LM0A 2EE1A 2WACA 1XNQL 1PTOD 1M8AA 1EQTA 2L11A 1GJXA 4A3GG 4LMQD 3OTOQ 4XQNA 1YITA 4UHVA 1FR3A 4KV6A 1NBWA 1S3OA 3HS0C 3BVMA 5C3EB 4LUOA 1Y1WB 1PH3A 1DOKA 3PO2H 3C3LA 3IFDA 1TXYA 5IYCG 4X64L 4B3RL 2UUBL 2IW3A 2F0FA 3K5LA 1VQ9A 2F03A 4C1NI 4I65A 2HD3A 3P7JA 3KF6A 1VQ7A 1E0BA 2N88A 1JMCA 3F2UA 1PRTC 1Y8PB 1WJJA 1WCMG 4PZ8A 5FLXE 5C4ZA 4FF4A 2RF4A 3TREA 1XNQQ 4DNRB 3J81i 3TDQA 3S1QH 2VS1A 4DR3L 2MO0A 5FOBB 1ASYA 2R7FA 3HOZB 4K5XA 3FRPB 3MXUA 4LAAA 1UE1A 2ZXOA 3ONAB 4JI5L 5M5XH 2E2DC 3WDNA 2K5HA 4CHTB 4IJHA 4R9WA 1EOTA 5FO9B 4X64Q 3FVQA 4GNXB 4B3RQ 1IL8A 2DN8A 1UWVA 1XTDA 2UUBQ 4DXGA 1X3PA 2EDGA 1A3VA 5LL6X 3H3VC 5GAEC 1EU4A 4HIOA 2HIVA 4CGYB 3J80c 4I7AA 2EJGC 4YWMA 1TS4A 1YNXA 4KKTA 1YZ6A 4Q5VA 2G5DA 2D0OA 4DAPA 2KA7A 1J6QA 3ND9A 1EQVA 2ZTDA 4QF4A 4B9XA 4ZAIA 5IYDG 4DR3Q 1BUVT 3KUPA 4HCSA 1CKMA 2R6GA 3I4LA 1PH4A 1F2ZA 2F1MA 1VQNA 1BOSA 4LF8L 2F0IA 2KBNA 4AYBB 1IYUA 4JI5Q 4G7ZC 2XWBB 4JW0A 3J7YW 4R4OA 5JEAH 4ZKBB 1Z47A 1N36L 5I4DA 4DKAC 2MO1A 2PQAB 1QVGA 1EIYB 5CR3A 4IUUA 1P8LA 1G91A 1VQFA 2PYKA 3QOJA 2Z6KA 1TWAH 5LMNW 1B70B 3CF5A 2F3WA 1D1IA 2HDLA 4A3IB 1PH8A 1K8AC 1EIGA 4LF8Q 1X3QA 4C56C 3H91A 3S14H 4C3IB 1L0YB 1J9OA 4YCWA 3CC4A 5JEAJ 2PNRC 4DV4L 1O7LA 5KNDA 2JA7G 2OEOA 1N36Q 4X3UA 3E9HA 4DR5L 3S16B 1KAAA 3Q0AA 5K36G 4OWXB 1E24A 2NTTA 5C6AA 4EX5A 1WD1A 1MKHA 1BO0A 4A3FB 1VQDA 3OYYA 1W6JA 1HA6A 1HHVA 3PIO3 3ERQA 4C2MH 1KD1C 4I7ZC 3FPUB 1PTOH 3QO2A 2NN6I 2FMCA 5CV5A 3OIPA 1EWHA 2L15A 3G6JB 3SVMA 3NQTA 1TWCH 3OOCA 1STYA 2D62A 2NYZD 1BNZA 1Z7TA 3PUZA 3FEWX 3GTOH 1BCPF 5M5YH 2BCOA 4IUPA 4B3SL 4DV4Q 3VR3A 2N8NA 4CJ2C 1YJNA 1M90C 1X6OA 2JQOA 1JWSD 4BY1B 1RCVD 4DR5Q 1IHZA 4X3KA 5DNFA 4A3EB 3NUCA 1FYCA 2F0EA 4PZ6A 2VW9A 2A5HA 2FJ2A 3Q24A 1Q81C 2EXDA 4O1NA 4S3SA 2PZUA 4LF6L 3PCOB 1SE2A 1KL9A 1NNXA 1LLRD 3CKIB 3GV6A 2RDGA 5DLQE 3DLLA 2HHHL 4FF2A 4DXFA 3S2HB 3W1BA 4R4IA 1IL2A 4OL7A 3CPFA 4H7BA 3UDIA 1TWFH 2R92B 4GNXA 4EQNA 2IY5B 4ULLA 1FNVA 1FD7D 3D8GA 4RKLA 4JI0L 1NE3A 2K04A 2A68C 4B3SQ 4QUFA 3ULJA 4QGUA 1SNDA 1PRTB 3SGIA 3DXJC 1CSQA 2F0KA 3S1NB 5ELOA 3M9BA 4A3GB 4XYOA 1YNJD 3WWVA 3PO3H 1G2SA 4LF6Q 1CQVA 1V1QA 1PYWD 4XXEA 3D4DA 2K1BA 2NB0A 3NTHA 2HHHQ 2YU9B 3HFZB 3K6OA 1V8QA 4A3DG 1PHJA 3MVVA 3LX0A 4JI1L 5IWAL 4N9PA 1UEBA 2LS01 2OQ0A 2JK8A 3HRZC 1IYJB 3STBC 2A6EC 2Z0SA 4IUVA 2E76C 3E5SA 2PQAA 4JI0Q 1GO3E 2A69D 1BXTA 1I4RA 5JJLA 1WCMB 2ICIA 4A75A 2HUGA 2RBMA 3EIVA 2K5VA 1WVLA 4BBSH 2JP1A 1EZ6A 1NUCA 3A56A 4IFDI 4M1UB 4IPGA 1RKNA 3GTMB 1XWEA 2RCFA 1TWHH 2PQEA 4IQZA 5GAGC 1X9NA 4JI1Q 5IWAQ 2PI2E 3F2BA 3DEPA 2B2WA 5L37A 1A8VA 3DEOA 2B8FA 1KLUD 2F0HA 2F0DA 2XIWA 4FVMA 3I4NG 1W3SA 1N8RC 4E6IA 3JAMi 4X6AH 3BG3A 5COYA 3SK8A 3DMUA 1B3QA 1KNEA 1Q82C 4A3JH 3J80i 4G7HC 2YTYA 4L8JA 3H0GH 1YJWA 3HOZH 4MIUA 3IAYA 5C3WA 1Z9FA 1B3AA 1A6XA 4OHJA 1EZ8A 3TN2A 1OXVA 2JEAI 1JOQA 2RA4A 4Y7NH 1JR0D 4RGMA 2F3IA 1KABA 1DJRD 1K8MA 1UE6A 1JJ2A 1F9SA 2F4IA 1RHPA 2LKVA 3FP9A 1SBBB 3E9IA 1M1KC 1XYIA 3M7GA 4HMJA 4HTHA 5KNBA 1WI5A 3I73A 3CMEA 3P1HA 2BDOA 1O78A 1MIUA 2F0GA 1CFMA 2RDFA 1Y69U 4P71A 1VQMA 1SMYD 3KDFB 2KEEA 2E8GA 2NVTH 4CJ0B 5KEEA 1U4MA 3KFUA 1G6PA 2Z6BA 4C3HG 3HOXG 2O5IC 2JA7B 1PTOF 3TMEA 4HJ8A 2PO4A 3A5UA 1BBXC 4RGTA 4A3CG 3GQBA 4JC0A 3W5OA 3T1YL 1EY4A 1XMOL 2IX3A 2QEJC 3V05A 3HOWG 2ZJPA 4UP8A 2CH4W 4EQ5A 4JBJA 4A3MG 3QB3A 1DGSA 4X3SA 2XVSA 2N78A 3NENA 5IP9G 2UXDL 1VQ4A 1F9PA 1OXTA 4L5QA 3UI2A 5C4XH 2JA8G 4L63B 4LFAL 3GTQB 3PUWA 5EKIA 5EJWA 4MZ9A 3X3MA 1MSGA 1RDPD 2O5JC 5EBCA 1QCBD 2F4VL 4POFA 5A2QL 3A8JE 4F7XA 1G6ZA 2SOBA 2MUYA 2JE6I 2RSNA 4L5TA 4GKKL 3SE0A 3T1YQ 5JJZA 2NN6H 1IKLA 1XMOQ 2QGQA 2XWJB 4BBRB 2WB1G 5IGDA 2UXDQ 1IW7C 1LT5D 1VQIA 1VQEA 4FDBA 3HG9A 4LFAQ 1SDFA 1PFBA 2HCCA 5LMNL 4LNQA 1HH2P 3CCLA 2F4VQ 3EBEA 2JA5G 2KCNA 2KVMA 5G3LF 1BKBA 5GAHC 1KDCA 3K5MA 2WKDA 4ZYSA 1CA6A 2LFNA 3BJUA 2B2YA 2VB2X 3EVQA 3J7A5 4GKKQ 3KF8B 1E1TA 1H9SB 3HGBA 4HIMA 2R93H 3CRKC 3W2DA 4A3LH 1PFSA 1IBKL 2BE5D 4A3DB 1SNMA 3HEJA 4WORA 4QB4A 2C5CA 1PMRA 4ZK9B 5M3MH 4LUVA 3QOLA 4ODGA 2PZTA 3AMUA 3H09A 5KNCA 3KK7A 1STAA 4AH6A 1GD7A 5LMNQ 3U50C 2CQOA 2DNCA 4DNIA 2K7VA 3G6EA 5GQOA 1F77A 2EZVA 3AQQA 4ZQ3A 3NBHB 4QJFA 2E2HB 3S1NH 5ISRA 1HZAA 1B4OA 1GUTA 3W1GA 4GZYC 4PZ7A 5T1IA 1AZPA 3GTPH 5HGQA 3NTIA 1ZXTA 2NWGA 3V2TA 1C9OA 1C8CA 5IP7G 1YI2A 2NUCA 2R7ZH 3S2DB 4H13C 1ET9A 3L3OC 2EYJA 2AQ3B 3KDFA 3HOUH 1IBKQ 1Y14B 3AYHB 2IHFA 2JA6B 3GTLH 4KKUA 5FO8B 5LMUL 3GV3A 3EN2A 2OTJA 3OPOA 1DYQA 4PMBA 2LMCB 4IPCA 3NP8A 3FKIG 2WINB 3MEFA 3AU7A 5M3FH 1QILA 2B2UC 3I4NB 1CKOA 3RN2A 1BBWA 1EIHA 4HEDA 4R4TA 1DM0B 2AMCB 3KBGA 2MJ8A 5E4WC 1FNUA 1QG7A 1SE8A 3BVGA 4FXKC 4TVAB 5K5PA 3TS0A 1QZHA 4IFDH 4QIWB 4A93G 1B9NA 2J4XA 2XTIA 1CZWA 2ASBA 3I4MH 4JVZA 5CBEE 1I3QB 3TRZA 4DV0L 1CZGA 4YIJA 4CKBA 4OO1G 3J7AV 1HZCA 3K58A 1W2BA 4BXXH 3T13A 2YV5A 2I5MX 5LMUQ 3GP7A 3RZOH 5HURA 2WAQE 1CT1D 5J39A 4M8AA 5IYBG 4OXPA 4RAUC 3PIPA 1V1OA 4DK6C 4UP7A 5C4JB 2GA4B 5KYLA 2RCNA 3CQZB 4K2KA 2E2JH 4MTNA 4IFDJ 3ULPA 1K83H 4LF4L 1EYCA 3MZ5A 4NMZA 1LTGD 4JBWA 3QWNA 4A3BG 1Y1VG 2YYZA 1EEID 1I6VC 4DV0Q 2SNMA 1ENAA 3TBIB 3A74A 4K14A 3JAML 4C3HB 4J1MA 3HOXB 1Y8NB 4QIWE 1HFNA 3KLWA 5FK9C 2L1BA 1PH5A 3I7FA 1BBUA 1F2LA 5M9OA 2ENBA 5IT9c 4MNOA 4GLXA 5IY0A 4IJLA 3S9WA 4JK1C 1SFOH 2GN5A 4PMWA 3VA7A 3NWTA 3KF8A 1KC8C 1H9SA 2RSOA 3EROA 1EWIA 3RNUA 4K2LA 4J15A 5D65A 3HOWB 3TZUA 1A0IA 1MJCA 2FHTA 4LF4Q 1EL0A 3FMCA 3DM3A 3N52A 1YNND 4A3MB 1SYEA 2F0VA 3A55A 2JA8B 3DUZA 2FINB 5LL6S 1X56A 3NXWA 5C44G 1SE3A 1UE7A 1PYSB 3OSOA 3A8KE 1O80A 4DPGA 3CCUA 2KHIA 1BDOA 4LK1C 2B63G 1HRJA 3NBHA 2OF1A 3A5ZB 1B9MA 3GTJB 4HAEA 3P75A 3BDOA 3KBXA 1EFWA 2IT1A 4RG1A 1X32A 1STNA 3CAMA 2F3VA 5EPLA 1MD2D 5IT9E 1WTOA 1GHJA 1OTCA 4GN5A 1IZ6A 3QIAA 1Q90A 4OONA 2WB1B 5J3BA 1Q8IA 1TWGB 1TR5A 5JOBA 1RF2D 4RMFA 5FKAC 2O2LD 3S1RH 3KJPA 2SEBD 3HOYB 3A7AB 3C1EA 4NDXA 5EKKA 1F2MA 4R4QA 1L0WA 2GVBA 4G7OC 2F0NA 2IWHA 4U68A 1V9PA 1PZJD 4NXNL 2MNAA 3C46A 4JI8L 2ID0A 5KGUA 3HOVG 4EQOA 2NVQH 1NSNS 3X3NA 2ZJQA 5IGBA 4DR1L 4IN3A 4WRDA 3KJOA 3VA5A 3UDXA 4ZRZA 3EQLC 4BBRH 1N34L 2EJMA 3UDGA 2CVRA 3S17H 3BZCA 4KHVA 2HDMA 4BY7G 2F0UA 5D3IB 1ZYRD 5IGEA 3NBIA 4A3KG 1XPRA 2WB1E 4XYQA 2X6GA 5ELEA 5M5WB 1D5XC 1XPUA 1B8AA 3OWEB 1BCPC 4CDFC 1A62A 1L1OC 4NXNQ 4N8FA 1XNRL 4HCEA 4JI8Q 1CUKA 1I6HB 2VY3A 3OMCA 3SXHA 2MP1A 2K14A 3D4RA 3SK6A 2FFKB 3PO2G 5IGFA 4DR1Q 2RHSB 4JOIC 1EYAA 5D14A 3M4PA 2Q2HA 3SDZA 4AYBE 1N34Q 4QCLA 1S5CD 3PUXA 2RQXA 4G57A 1OXSC 4EVOA 3FKIB 1PXUA 3EJIA 1JB3A 2AUKA 4R1JA 2F0PA 2F0QA 4AIMA 3EFXD 2KQ3A 4IUQA 2I46A 2VUMG 1G291 2HIXA 1UEAB 3K5OA 4O42A 1GUOA 1K28A 1JOOA 5DM73 3UE0A 1PA6A 1XNRQ 1QWYA 3VR6A 4HIDA 4A93B 2TMPA 2A6HC 1H9MA 3AFQA 1GVPA 1JB7A 3OMGA 3RD4A 3I4OA 1RD9D 1D5MC 4PMCA 1PH1A 5KIXA 3RLFA 4UDUC 2DJGC 1O7YA 4N8X1 5CBAE 4KN7C 2BA1A 4KN4C 2R61A 1ZKOA 2JA6H 3ZJYC 4RWSC 1OO9B 5J22A 1LT4D 1TU2B 3U9OA 1V43A 2C9OA 2B2VA 1H9JA 2F0TA 4JI3L 1FL0A 1F9QA 3L0OA 1I94L 3GTKB 2E2IB 1SAPA 3K7AB 3CCJA 3FDTA 2B2TA 4U673 1HCZA 2ICEC 1SMXA 4DK0A 4OIKA 1Y1VB 3M4OB 5ELBA 3E0EA 5JEAG 2OCEA 1DOMA 1II3A 4X66L 3RZDB 3FHWA 1R9TB 1QB5D 4J8QA 1YHAA 4K8IA 1AZQA 1E2VA 4HJAA 3BDCA 2FXQA 2E75C 1EYDA 2H5XA 4BS9A 2ZTEA 3K5NA 2K32A 1WTVA 1LT3D 4JI3Q 1X54A 1I94Q 1AE3A 2ZXPA 3C1FA 1F9RA 3ER0A 2UUAL 2KCMA 3EA6A 3CC7A 1VQJA 4NXML 4FO2A 2CQAA 1SR3A 2RDHA 3KLSX 1B53A 2AWNA 3H15A 4JI7L 1CM9A 1NAPA 4X66Q 4KHZA 1PFNA 4F88A 1A63A 3TP7A 2GVAA 1JORA 3Q8DA 2E5LL 2B63B 1HJPA 1EUJA 3JC66 3T16A 2B2UA 3S15B 2KHSA 1C48A 1N33L 5C3EH 1LYLA 3HZXA 1YEZA 1Y1WH 2EYFA 4HMIA 4V0BA 4DV5L 3VDYA 2OQKA 1QUQB 2UUAQ 4LF5L 4NP5A 2SNSA 1JQYD 4NXMQ 1RODA 1GUNA 1J5EL 2CW0C 5I9OA 2EYPA 3A0JA 3BDLA 4OIJA 4DA2A 1E3PA 4JI7Q 1WD0A 1KXLA 2R3ZA 3R3OA 3GO5A 5FJ8H 2RKSA 4DN4M 2E5LQ 1K73C 3L2PA 1L1OB 2K28A 2XNAC 1UAPA 1PLFA 1SNPA 1PTOC 5CV6A 3HOVB 1N33Q 1VDZA 4KMUC 5A35A 4TSSA 5BN5A 2EY6A 4QY7A 1NY4A 4DV5Q 3I91A 3HKZG 2Z8LA 3J81L 2L4NA 4K5WA 5CGKA 4LF5Q 4DF7A 3E0JA 4DR7L 1PRTD 3M3YB 1MSHA 1AEXA 1DD2A 1J5EQ 3MEHA 3TEHB 4FNFA 4BY7B 3CMAA 3MFGA 1I50B 3HOYH 3CCSA 3MTSA 4A3KB 3GTGB 1VQCA 2DNEA 4JG2A 2DY7A 3H6MA 2L0CA 1D2BA 3CPWA 5HY6A 1TKWB 3PO3G 1B44D 3ICEA 2EYLA 1CHQD 2I0QA 2CH4A 1I5FA 4O0AA 5JPNC 1SLJA 3B6YA 4K8JA 3PO2B 3Q6SA 3Q23A 5CORA 3T4AC 4B3TL 2J7ZA 1Q1BA 4DR7Q 2K03A 4YCUA 4LW1A 3J7ZC 5E7NA 4LFCL 4DK3C 5DAUA 1ILPA 2Y0SG 5C4HA 4DR4L 1QE6A 4JBMA 1YJ9A 2Z4HA 2UUCL 3I8ZA 2HQLA 1LACA 5BN4A 1ML0D 1GXDC 2VUMB 3S1QB 4BBSG 3U4ZA 1LT6D 2K05A 4A3IH 4B9WA 3BYTB 1S4ZA 3BS1A 3VR2A 4C3IH 3FPPA 5IP7H 2P5ZX 2EY2A 4B3TQ 4IOAA 5H1SE 1VMCA 1FVIA 4R4CA 3VR4A 3S16H 4LFCQ 2BH8A 1NTGA 5FLMH 1MI2A 2HQEA 2I07B 1RL2A 4DR4Q 1Q12A 4A3FH 3OIQA 1SYCA 3R2IA 2UUCQ 2QILA 2F0WA 4Z9CB 4NW2A 1QVCA 4KJNA 1AW7A 2K6AA 2E74C 1PH6A 4A3JG 4WJ3M 3TSSA 3D3RA 5CV9A 4KY7A 3H0GG 1JC7A 3HOZG 1SJED 1Q86C 2V1CC 1QUQA 3J81j 4X62L 2AUJD 2EJFC 1I4HA 4DAVA 3M85A 2VQEL 3PIOA 5EPKA 1PFMA 4BY1H 4N9TA 2IPKD 2QF7A 3E6ZX 1WYDA 3O13A 1TS3A 5C0XH 2AHOB 4A3EH 1STGA 1WTRA 5JPMC 2J0TD 2R7DA 2L5TA 3VYSA 3L7ZC 3UDFA 1A3UA 1L1OA 4LF9L 3S2HH 1BF4A 1EU3A 2WFWA 1EY9A 4DUYL 3GTKH 3P20A 1E22A 2I5HA 3NEMA 2R92H 3K7UC 1ICWA 1ICFB 4X62Q 1HPCA 2B3GA 5JJKA 4GN3B 3TQYA 4JOIA 3S14B 4GNXC 1BVSA 2F0OA 2KCTA 4OWTB 2VQEQ 2N3SA 3ERSX 5ELFA 2PW7A 3BZDB 5C0XJ 4LFBL 3RZDH 2UU9L 1TQOA 1R9TH 1GUWA 3H94A 2LXJA 3RN5A 4A3GH 4KKSA 4RCOA 5EKLA 2VQFL 1VQ5A 4C2MB 5E4XA 1DXMA 1MBYA 1PTOB 2JYOA 4LF9Q 2YU9H 1SROA 5KYIA 1H95A 2A1AA 3F2DA 4DUYQ 5IYCH 1TS5A 1AFPA 4IZ8A 1TWCB 4NPSA 3VYUA 5FLXL 1M4VA 1OXUA 4BA2I 4WJ4A 1DONA 3PQIA 2K01A 2A68D 5C4XG 1L0XB 5IOCA 1D1KA 5I2YA 1CQFA 1EY7A 1J8IA 3H3VH 3GTOB 1YIJA 5DEHA 2V4DA 5M5YB 5JJIA 1WCMH 4UAIA 2KJXA 3D31A 2OXPA 3V96A 4EQPA 4LFBQ 2F52A 2UU9Q 1SNOA 3CCRA 2ZM6L 1H9KA 3K81C 1ILQA 3T53B 1Q7YC 1G2TA 2VQFQ 2N49A 1RTNA 1VQKA 4TRDA 2DUDA 3NSWA 4YY3L 3GTMH 4HJ7A 4GOPC 2QDLA 5FO7B 4XT1B 2NN6G 1YNJC 3ND8A 4JI4L 4RHRA 3STBD 4IUTA 3HKZB 5A2QE 1VQ6A 2CKZB 2XN9C 3AEVA 3G7LA 1TWFB 4OX9L 3A54A 4IOCA 2AQ1B 1EWCA 1NR2A 4QMGA 3K59A 2D5DA 1MHWC 2B2WC 1JICA 5EGTA 4Y52H 1GUSA 3D4WA 2A69C 3MWYW 3SR1A 1UE5A 3NQIA 3I56A 3OWFA 4G4KA 2ZM6Q 5IYDH 3ZYYX 1VQPA 3TS2A 4HSPA 3PO3B 4YY3Q 1O7IA 2MHVA 4LWCA 1X3FA 1L2FA 1HR0W 2Z9HA 2R93G 4JI4Q 4A3LG 3CXCA 4JBKA 4GKJL 2WP8J 5M3MG 4KY5A 4OX9Q 3J80L 4DAYB 4CJ1B 1VQAA 5GADC 1S5ED 1FGUA 3T56B 1Q3LA 5LHY1 2Y0SB 3HKZE 1H9RA 2AWOA 5ELNA 1ESRA 2ZXRA 4H02A 1EQQA 1TVXA 4P73A 4TKOB 3PUYA 1I4XA 1HFGA 2L9HA 2BDNA 2K4KA 1QNKA 4BBSB 1Y8OB 3LWUA 4IALA 1S40A 3DM1A 2H1EA 3IKJA 2K5WA 2ZJRA 2JXMB 2R7ZG 4PNYA 5EBDA 3TP8A 1TWHB 4JI2L 4C3JG 4AQYL 3HOUG 1HQRD 1SE4A 3G4SA 2Q2UA 4GKJQ 4XT3B 1ESFA 1NMGA 4KHPL 2JA7H 3MXNB 2B29A 4ME3A 4HJ9A 4ABNA 5D3DA 5K36H 1YHBA 2QA4A 2X6LA 2N55A 1CKNB 5BR8L 5M3FG 2G9DA 3PV0A 4ZUJA 1EQRA 4LUZA 4DV7L 1D8LA 1ENCA 4IPHA 4NKLA 1HZ9A 5IGCA 3RR5A 1GM5A 1D6EC 1HTLD 2Y0SE 3PMFA 1U0LA 1VF7A 2VUMH 4A3JB 1K8GA 4IFDG 3DWQA 3H0GB 3MA2B 4XIGS 1HA5A 3MHBA 3K57A 1PDQA 1SRUA 3I4MG 3GTQH 1KNAA 4UP9A 1FGBD 4X65L 1GOZA 2DJFC 2ATWA 1O7ZA 2BOSA 2JJQA 3F8TA 4JI2Q 4CBVA 2NTSA 4AQYQ 1WTPA 1VMPA 1VQ8A 3CU7A 3MXPA 1SMYC 3PGZA 4KHPQ 2JA5B 3LNNA 4BXXG 4Y7NB 2K5NA 3A8IE 4ZUIA 3JAMc 4JI6L 4DV1L 1U4PA 1Z6HA 2K5DA 1KLGD 1JWMD 1ENFA 1PH9A 1EOVA 5BR8Q 1WTHA 5TSSA 4DV7Q 2FMMA 3K0XA 2NZHA 5CYUA 4GLAC 4NB3A 1BQQT 4RH6A 2RVLA 1LTSD 3NHHA 1GKHA 2EVBA 2VL6A 5G3LD 1VF5C 4L6TB 4ALPA 4UY8C 1PRTF 1X55A 2D9UA 2JN4A 2A19A 3NPPA 1AH9A 1V1PB 3BVZA 1XJVA 3NE5B 1KIXA 5EQ0A 4X65Q 4MN3A 3WOEA 2Q8IB 4DV2L 4JYAL 1HNWL 2NVTB 1SYBA 1K3BC 5BN3A 1GUGA 3GD7A 2ALYB 5GROA 2D2CC 4KD3A 1CSPA 3R2TA 1LTAD 4JI6Q 4DV1Q 3J7AF 2MQHA 1A2UA 5KRUA 2IHEA 4QL5A 2HCIA 1QNUA 5E1FA 1XMQL 4YCVA 3AFPA 3JAME 1C4QA 3S1MB 1SEBD 1JOKA 3J80E 1IW7D 2B2YC 4GOPB 4DGZA 2PPBC 1WOCA 5I6WA 4A3DH 1C0AA 1SNCA 2A74C 3CW2C 1KHIA 4LF7L 2NVYB 5C4XB 4GN4B 3VYTA 4DAYA 2KCCA 1NR4A 1HNWQ 4DV2Q 3IL8A 4JYAQ 2QDBA 3CHBD 2Q8TA 4JCVE 2F0MA 2QW7A 1PZID 4HR7B 3URYA 1VQLA 1PH2A 1ASZA 3GDEA 2E2HH 1XXGA 4LJZC 3AB9A 1IBML 4F87A 1VCIA 2EXZA 5F2DA 1XMQQ 3I90A 5IIFA 4RFBA 1UUPA 3PUVA 4CKCA 5C5MA 2B39A 2YTVA 3S2DH 4ID6A 2PMZB 1PVOA 1DCZA 1PV4A 4OO1I 2MFIA 1JJCB 3VR5A 4C1NK 5DM63 2VNUD 5C0XI 2Q2IA 4DR6L 1XPOA 4LF7Q 1AE2A 3CCEA 2BE5C 1X3EA 3MXNA 1EEFD 1EYGA 4DNTB 4KI0A 1STEA 2CWAA 3I4NH 1CKNA 4KD4A 1G8ZD 2PNHA 1HUMA 1FNWA 3N6RA 4DV6L 1IBMQ 2K75A 2ZT9C 4QUCA 2PZWA 4UPAA 5CV4A 4ZCKA 1EY6A 4A3BB 2NVXB 1I3QH 2CFMA 1HZBA 3E3XA 3KYHC 1ONLA 2R93B 3Q22A 2LXKA 3G48A 3CC2A 3QR8A 1AP0A 4BBRG 4CDEC 4EGVA 4OELB 5M3MB 3NK9A 1QVFA 4DR6Q 1VS0A 5JVH3 2M9VA 2DY8A 4HSVA 1EY0A 4DV3L 3D0FA 3TZDA 1YHQA 3OW2A 2PMZE 3HKSA 1GHKA 4KTAA 2WV6D 4HIKA 1TY0A 4XDXA 3D6CA 5C4JH 4RCNA 4HN7A 3S24A 3RUZA 1JWUD 4DV6Q 3CQZH 2K5QA 3W3AA 5ELDA 1EY5A 1PYBA 2NBFA 4FXGC 2NZOA 4V190 3GTPB 2EY5A 3H3VI 4R8IA 4K0KL 3OW7A 1S5BD 5AFWA 2R7ZB 3RLOA 1V1PA 4C3JB 5C44B 1E1OA 4C3HH 3HOUB 3HOXH 4JPBW 1SYGA 1KTKA 5JAVA 1KRTA 4RGNA 1ET6A 4JV5L 4K6LA 1YBYA 2KHJA 3GTLB 2EYMA 4FXDA 3SK5A 3CP0A 4O2DA 4DV3Q 1IXRA 2K50A 4CKEA 3DHQA 4A3CH 5M3FB 1I4GA 1B50A 2XRQD 2EYHA 1SXTA 1U5KA 1B1ZA 4CDCC 5HGTA 1S5FD 3HOWH 3MC0B 1VQOA 3F1ZA 4GOPA 3PIP3 4P75A 1IBLL 4A3MH 2KEDA 5CV8A 2CCZA 5IP9H 4FF3A 4K0KQ 4PQXA 2JA8H 3I4MB 1N32L 1F2YA 2D0PA 2WAQG 2WKCA 1QZGA 4F8MA 1E2ZA 5CC4A 2JA9A 3LGJA 4JV5Q 3NELA 2JA6G 1JE4A 1VQBA 1BCPB 2SDFA 3MXGA 3RZOB 2ES2A 3CRLC 3KLRA 1HR0L 3IFTA 2IJ0A 3GTJH 1WTWA 2UXBL 2XGTA 1Q1EA 2XRSD 3K80C 1Q8KA 1T5XD 3ULLA 1EIFA 4CDDC 1HNZL 4B3ML 2EYOA 4OGQC 4YWKA 4L5RC 2C35B 2E2JB 2CWPA 2I5LX 3L9AX 1K83B 1IBLQ 2F0LA 1TWGH 5IGGA 1D7QA 3QJYA 3F2CA 1K9MC 4DR2L 1N32Q 4XQJA 3NTKA 3MFYA 1YNNC 3CD6A 1K8OA 1TT2A 2Z4IA 4K5VA 1TY2A 4P72A 2JA5H 1KAWA 3TP5A 1CTMA 2K33A 1VQHA 3CCMA 1R4PB 1T9HA 4FYDA 1HR0Q 2UXBQ 4XTCS 1S5DD 1JJGA 1LTLA 2O4XA 5ELCA 3T51B 1RTOA 1SFOB 1U9RA 1HNZQ 4B3MQ 1E2WA 1U4RA 4MHEA 4IURA 2QCPX 4IO9A 2EIFA 5EPJA 5IE8A 4DR2Q 2VB3X 2KECA 1EY8A 1HNXL 3R8BA 4H44C 1MGSA 1SSOA 3WOFA 5M5WH 4XQQA 5T1GA 4H0LC 2OTLA 2Q2TA 4ME5A 4FP5D 2Z6KC 4K6DA 3M7NA 2X69A 4IUNA 2KUMA 1PZKD 3CCVA 4P2CB 1I6HH 1WTQA 1XX8A 2MPMA 5C3EG 5M5XB 2EY1A 1Y1WG 1HTPA 3S1MH 5C3XA 2IL8A 4MTKA 1K0RA 2PI2A 3RMHA 1D5ZC 1C7YA 1OXXK 4KK7A 2UXCL 1STHA 1AN8A 1VQGA 2DGYA 3J81c 4Q0FA 5CMDA 3OHXC 4QQBX 2NVYH 3S1RB 5I9PA 2BA0A 1BCPD 1HNXQ 3FKIH 1JT8A 1PH7A 3DWAA 4RGOS 2HT1A 4DU9A 2EOTA 4A4IA 1SNQA 5FJ8G 4L5SA 3ITPA 4FF1A 1DOLA 4B08A 1ZYRC 4KJOA 3U58A 1A3TA 2AKWB 4KLKA 2MGSA 2PCFB 1DZ1A 1LTBD 4A93H 4GS3A 2NVQB 4X3TA 1BR9A 2PW5A 5EAYA 3LWEA 1MJEA 1FJGL 1W6KA 1N9WA 1STBA 1IYVA 2UXCQ 1NJIC 1CA5A 4OO1H 1K3RA 1YVCA 1EFID 5CV7A 1IKMA 1HQMC 3R93A 2OWOA 1LTTD 3NWSA 1T5EA 1TS2A 3S17B 3U9SA 2Q8RE 4GLVB 1TWAB 3PSIA 5IYBH 3J81E 3HOYG 1HXYD 1U4LA 2A8VA 2L12A 5E3FA 2H4OA 1LUZA 1WTXA 2BH2A 1SJHD 1WFQA 4RHSA 3C2PA 2A6HD 3G71A 1JE5A 1LTRD 1RJTA 2E2IH 1LABA 2B2VC 1XTCD 3K7AH 1X3GA 4PV1C 3I70A 2EQSA 1UNSA 4AYBG 1FJGQ 1SYDA 4TQUS 2NVXH 1Y1VH 4APVA 3M4OH 4A3BH 4BWGB 3KLSA 2B2TC 4WFN3 1X65A 1TIID 4KY6A 1KDBA 4OWWB 2RHQB 1HUNA 3KF6B 4ZLTF 3RLNA 2QKIC 4J6HA 2QEXA 5JVG3 1QOHA 4YWLA 3I2ZA 2XSCA 4POGA 4DUZL 3QG1A 4A76A 3T1HL 3PF4A 3SK4A 2L55A 2IX1A 5IODA 5C5LA 4R8NA 3UE1A 2KENA 1ZEQX 5I6YA 3BZKA 4A3IG 5AJ3L 1Q46A 1G51A 2F0JA 3BU2A 1S72A 2ZTCA 4C3IG 1NCVA 3HP3A 2AQ2B 3K8AA 2WAQB 3K0YA 4C3JH 5C44H 1P16A 4DK1A 1B7YB 3CCQA 2K52A 1LO5D 2M2LA 4OEMB 3U4VA 5FLMG 5IT9L 1SN8A 2B63H 2B8GA 1A2TA 4A3FG 2JEBI 5NUCA 2TSSA 2VXWA 4DUZQ 2OT2A 4PG3A 3S15H 3T1HQ 3I72A 2M00A 4HJ5A 2KOLA 3SHLA 4YHHL 2WIIB 2A6ED 2F0SA 2VZAA 5I2XA 4WJWA 1LV9A 2LY7A 4RKBA 1CHPD 3DWPA 2Z1CA 1A15A 4ZKCB 1B2TA 5AJ3Q 1QJOA 1E7ZA 3A7LA
chains in the Genus database with same CATH topology
1SYFA 2CHBD 2NZ1D 1LTID 3BYYB 3VYRA 1I4PA 4BA1I 1CK1A 5C0XG 2IX0A 5J1ZA 4RA8A 3D6WA 1I4QA 1JCKB 3MAQA 3SEBA 4ILWA 2EPBA 3I3CA 2JSOA 2CW0D 3TP6A 1CI3M 1R4QB 4DFAA 3M4YA 1KDAA 2A73B 2G9HD 2WACA 2EE1A 1PTOD 1M8AA 1EQTA 2L11A 1GJXA 4LMQD 4XQNA 1FR3A 4KV6A 3HS0C 3BVMA 5C3EB 1Y1WB 1DOKA 3C3LA 3IFDA 2IW3A 2F0FA 3K5LA 2F03A 4C1NI 4I65A 3P7JA 1E0BA 2N88A 3F2UA 1PRTC 1Y8PB 5FLXE 5C4ZA 4FF4A 4DNRB 3TDQA 5FOBB 3HOZB 4K5XA 3FRPB 3MXUA 4LAAA 2ZXOA 3ONAB 2E2DC 3WDNA 4CHTB 4R9WA 1EOTA 5FO9B 3FVQA 1IL8A 2DN8A 4DXGA 1X3PA 2EDGA 1A3VA 5LL6X 3H3VC 1EU4A 4CGYB 2EJGC 1TS4A 4KKTA 4Q5VA 4DAPA 2KA7A 3ND9A 4QF4A 1EQVA 4B9XA 4ZAIA 1BUVT 3KUPA 4HCSA 2R6GA 3I4LA 1F2ZA 2F1MA 1BOSA 2F0IA 4AYBB 1IYUA 4G7ZC 2XWBB 3J7YW 5JEAH 4ZKBB 1Z47A 5I4DA 5CR3A 4IUUA 1G91A 2PYKA 3QOJA 2F3WA 1D1IA 2HDLA 4A3IB 1EIGA 1X3QA 4C56C 3H91A 4C3IB 1L0YB 1J9OA 5JEAJ 2PNRC 1O7LA 5KNDA 2OEOA 4X3UA 3S16B 1KAAA 3Q0AA 5K36G 2NTTA 5C6AA 1WD1A 1BO0A 4A3FB 1W6JA 1HA6A 1HHVA 3PIO3 3ERQA 4I7ZC 3FPUB 1PTOH 3QO2A 2NN6I 2FMCA 5CV5A 3OIPA 1EWHA 3G6JB 3SVMA 3NQTA 3OOCA 1STYA 2D62A 2NYZD 1BNZA 1Z7TA 3PUZA 3FEWX 1BCPF 2BCOA 4IUPA 3VR3A 4CJ2C 1JWSD 4BY1B 1RCVD 1IHZA 4X3KA 5DNFA 4A3EB 3NUCA 1FYCA 2F0EA 2A5HA 2FJ2A 3Q24A 4O1NA 4S3SA 2PZUA 1SE2A 1LLRD 3CKIB 3GV6A 2RDGA 3S2HB 4FF2A 4DXFA 4OL7A 4H7BA 2R92B 4EQNA 4ULLA 1FNVA 1FD7D 3D8GA 4RKLA 2K04A 2A68C 4QUFA 1SNDA 1PRTB 3DXJC 2F0KA 3S1NB 4A3GB 4XYOA 1YNJD 1G2SA 1CQVA 1PYWD 4XXEA 3D4DA 2K1BA 2NB0A 3NTHA 2YU9B 3K6OA 1V8QA 3MVVA 3LX0A 4N9PA 2LS01 3HRZC 2A6EC 4IUVA 2E76C 3E5SA 2A69D 1BXTA 1I4RA 1WCMB 2ICIA 2HUGA 2RBMA 1WVLA 2JP1A 1EZ6A 1NUCA 3A56A 4IFDI 4M1UB 1RKNA 3GTMB 1XWEA 2PQEA 4IQZA 3DEPA 2B2WA 3DEOA 2B8FA 1KLUD 2F0HA 2F0DA 2XIWA 4FVMA 4E6IA 5COYA 3BG3A 3SK8A 3DMUA 1KNEA 4G7HC 4L8JA 4MIUA 3IAYA 5C3WA 1B3AA 1A6XA 4OHJA 1EZ8A 3TN2A 1OXVA 2JEAI 1JOQA 2RA4A 1JR0D 4RGMA 1KABA 1DJRD 1K8MA 1F9SA 2F4IA 1RHPA 2LKVA 1SBBB 1XYIA 3M7GA 4HMJA 4HTHA 5KNBA 3I73A 3P1HA 2BDOA 1O78A 2F0GA 1CFMA 2RDFA 1Y69U 1SMYD 2KEEA 4CJ0B 5KEEA 1U4MA 4C3HG 2O5IC 2JA7B 1PTOF 3TMEA 2PO4A 1BBXC 4RGTA 3GQBA 1EY4A 2IX3A 2QEJC 3V05A 3QB3A 4X3SA 2XVSA 1F9PA 1OXTA 3UI2A 4L63B 3GTQB 3PUWA 5EKIA 5EJWA 3X3MA 1MSGA 1RDPD 2O5JC 5EBCA 1QCBD 5A2QL 3A8JE 4F7XA 1G6ZA 2SOBA 2MUYA 2JE6I 2RSNA 3SE0A 5JJZA 2NN6H 1IKLA 2XWJB 4BBRB 5IGDA 1IW7C 1LT5D 3HG9A 1SDFA 1PFBA 2HCCA 2KCNA 2KVMA 5G3LF 1KDCA 3K5MA 2WKDA 4ZYSA 1CA6A 2LFNA 2B2YA 2VB2X 3EVQA 1H9SB 3HGBA 3CRKC 3W2DA 2BE5D 4A3DB 1SNMA 3HEJA 4WORA 4QB4A 2C5CA 1PMRA 4ZK9B 3QOLA 4ODGA 2PZTA 3AMUA 3H09A 5KNCA 3KK7A 1STAA 2DNCA 2K7VA 1F77A 2EZVA 4ZQ3A 2E2HB 5ISRA 1B4OA 1GUTA 4GZYC 5T1IA 1AZPA 3NTIA 1ZXTA 2NWGA 3V2TA 1C8CA 2NUCA 3S2DB 4H13C 1ET9A 3L3OC 2EYJA 2AQ3B 2JA6B 4KKUA 5FO8B 3GV3A 3OPOA 1DYQA 4PMBA 2LMCB 3NP8A 2WINB 3AU7A 1QILA 2B2UC 3I4NB 1EIHA 4HEDA 1DM0B 3KBGA 2MJ8A 5E4WC 1FNUA 1QG7A 3BVGA 4FXKC 5K5PA 4IFDH 4QIWB 1B9NA 2J4XA 1CZWA 5CBEE 1I3QB 1CZGA 4YIJA 4CKBA 4OO1G 3J7AV 3K58A 3T13A 3GP7A 5HURA 1CT1D 5J39A 4M8AA 4RAUC 1V1OA 5C4JB 2GA4B 5KYLA 3CQZB 4K2KA 4IFDJ 1EYCA 3MZ5A 4NMZA 1LTGD 4JBWA 3QWNA 2YYZA 1EEID 1I6VC 2SNMA 1ENAA 3TBIB 4K14A 3JAML 4C3HB 4J1MA 3HOXB 1Y8NB 1HFNA 5FK9C 2L1BA 1F2LA 5M9OA 2ENBA 3S9WA 4JK1C 4PMWA 3VA7A 3NWTA 3KF8A 1H9SA 2RSOA 3EROA 4K2LA 5D65A 3HOWB 3TZUA 2FHTA 1EL0A 3FMCA 4A3MB 3N52A 1YNND 1SYEA 2F0VA 3A55A 2JA8B 3DUZA 2FINB 5LL6S 3NXWA 1SE3A 3OSOA 3A8KE 1O80A 1BDOA 4LK1C 1HRJA 3NBHA 2OF1A 1B9MA 3GTJB 4HAEA 3P75A 3BDOA 3KBXA 2IT1A 1X32A 1STNA 2F3VA 5EPLA 1MD2D 5IT9E 1WTOA 1GHJA 3QIAA 1Q90A 2WB1B 1Q8IA 1TWGB 1TR5A 5JOBA 1RF2D 5FKAC 2O2LD 2SEBD 3HOYB 3A7AB 3C1EA 4NDXA 5EKKA 1F2MA 4G7OC 2F0NA 2IWHA 4U68A 1PZJD 3C46A 2ID0A 5KGUA 4EQOA 1NSNS 3X3NA 5IGBA 4IN3A 4WRDA 3VA5A 4ZRZA 3EQLC 2EJMA 2CVRA 4KHVA 2HDMA 2F0UA 5D3IB 1ZYRD 5IGEA 3NBIA 4XYQA 2X6GA 5ELEA 5M5WB 1D5XC 1BCPC 3OWEB 4HCEA 1I6HB 3OMCA 3SXHA 2MP1A 3D4RA 3SK6A 2FFKB 5IGFA 1EYAA 5D14A 3SDZA 4QCLA 1S5CD 3PUXA 2RQXA 4G57A 1OXSC 4EVOA 3FKIB 1PXUA 3EJIA 1JB3A 2AUKA 2F0PA 2F0QA 3EFXD 2KQ3A 4IUQA 2I46A 1G291 3K5OA 1UEAB 4O42A 1GUOA 1JOOA 5DM73 1QWYA 3VR6A 4A93B 2TMPA 2A6HC 1H9MA 3OMGA 3RD4A 1RD9D 1D5MC 4PMCA 5KIXA 3RLFA 4UDUC 1O7YA 5CBAE 4KN7C 2BA1A 4KN4C 2R61A 1ZKOA 4RWSC 1OO9B 5J22A 1LT4D 1TU2B 3U9OA 1V43A 2C9OA 2B2VA 1H9JA 2F0TA 1F9QA 3GTKB 2E2IB 1SAPA 3K7AB 3FDTA 2B2TA 4U673 1HCZA 2ICEC 4DK0A 4OIKA 1Y1VB 3M4OB 5ELBA 5JEAG 1DOMA 1II3A 3RZDB 1R9TB 1QB5D 4J8QA 4K8IA 1AZQA 1E2VA 3BDCA 2E75C 1EYDA 4BS9A 3K5NA 2K32A 1WTVA 1LT3D 3C1FA 2ZXPA 1F9RA 3EA6A 4FO2A 2CQAA 2RDHA 3KLSX 1B53A 2AWNA 1CM9A 1NAPA 4KHZA 1PFNA 4F88A 3TP7A 1JORA 2B63B 3T16A 2B2UA 3S15B 2KHSA 1C48A 3HZXA 2EYFA 4HMIA 4V0BA 4NP5A 2SNSA 1JQYD 1RODA 1GUNA 2CW0C 5I9OA 2EYPA 3BDLA 4OIJA 4DA2A 1WD0A 2R3ZA 3R3OA 3GO5A 2RKSA 4DN4M 2K28A 2XNAC 1UAPA 1PLFA 1SNPA 1PTOC 5CV6A 3HOVB 1VDZA 4KMUC 5A35A 4TSSA 5BN5A 2EY6A 3I91A 2Z8LA 3J81L 2L4NA 4K5WA 5CGKA 4DF7A 3E0JA 1PRTD 3M3YB 1MSHA 1AEXA 1DD2A 3MEHA 4FNFA 4BY7B 3MFGA 1I50B 3MTSA 4A3KB 3GTGB 2DNEA 2DY7A 3H6MA 2L0CA 1D2BA 1TKWB 1B44D 2EYLA 1CHQD 5JPNC 4K8JA 3PO2B 3Q6SA 3Q23A 5CORA 3T4AC 2J7ZA 1Q1BA 2K03A 5DAUA 1ILPA 5C4HA 1QE6A 2Z4HA 3I8ZA 1LACA 5BN4A 1ML0D 1GXDC 2VUMB 3S1QB 1LT6D 2K05A 4B9WA 3BYTB 1S4ZA 3BS1A 3VR2A 3FPPA 2EY2A 1VMCA 3VR4A 1MI2A 2HQEA 2I07B 1Q12A 3OIQA 1SYCA 3R2IA 2QILA 2F0WA 4Z9CB 4NW2A 4KJNA 1AW7A 2K6AA 2E74C 3TSSA 3D3RA 5CV9A 4KY7A 1JC7A 1SJED 2AUJD 2EJFC 1I4HA 4DAVA 3M85A 5EPKA 1PFMA 4N9TA 2IPKD 2QF7A 3E6ZX 3O13A 1TS3A 5C0XH 1STGA 1WTRA 5JPMC 2J0TD 2L5TA 3VYSA 3L7ZC 1A3UA 1BF4A 1EU3A 1EY9A 3P20A 1ICWA 1HPCA 3S14B 2F0OA 5ELFA 2PW7A 3BZDB 5C0XJ 1TQOA 1GUWA 3H94A 4KKSA 4RCOA 5EKLA 4C2MB 5E4XA 1DXMA 1MBYA 1PTOB 2JYOA 5KYIA 1TS5A 1AFPA 4IZ8A 1TWCB 3VYUA 5FLXL 4BA2I 1M4VA 1OXUA 1DONA 2K01A 2A68D 1L0XB 5IOCA 1D1KA 5I2YA 1CQFA 1EY7A 1J8IA 3GTOB 5DEHA 2V4DA 5M5YB 4UAIA 2KJXA 3D31A 2OXPA 3V96A 4EQPA 1SNOA 1H9KA 1ILQA 3T53B 1G2TA 1RTNA 4TRDA 3NSWA 5FO7B 4XT1B 2NN6G 1YNJC 3ND8A 4RHRA 4IUTA 3HKZB 5A2QE 2XN9C 3G7LA 1TWFB 3A54A 2AQ1B 1EWCA 1NR2A 4QMGA 3K59A 2D5DA 2B2WC 1JICA 5EGTA 1GUSA 3D4WA 2A69C 3MWYW 3SR1A 3NQIA 3OWFA 4G4KA 3ZYYX 4HSPA 3PO3B 2MHVA 2WP8J 4KY5A 3J80L 4CJ1B 1S5ED 3T56B 1Q3LA 5LHY1 2Y0SB 1H9RA 2AWOA 1ESRA 2ZXRA 1TVXA 4TKOB 3PUYA 1I4XA 1HFGA 2L9HA 2BDNA 1QNKA 4BBSB 1Y8OB 3LWUA 4IALA 3DM1A 2H1EA 3IKJA 2K5WA 2JXMB 4PNYA 5EBDA 3TP8A 1TWHB 4C3JG 1HQRD 1SE4A 4XT3B 1ESFA 4ABNA 5D3DA 5K36H 2X6LA 2N55A 2G9DA 3PV0A 4ZUJA 1ENCA 4NKLA 5IGCA 1D6EC 1HTLD 3PMFA 1VF7A 4A3JB 4IFDG 3DWQA 3H0GB 3MA2B 4XIGS 1HA5A 3MHBA 3K57A 1PDQA 1KNAA 1FGBD 1GOZA 1O7ZA 2BOSA 4CBVA 2NTSA 1WTPA 1VMPA 3CU7A 3MXPA 1SMYC 2JA5B 3LNNA 4Y7NB 3A8IE 4ZUIA 1U4PA 1Z6HA 2K5DA 1KLGD 1JWMD 1ENFA 5TSSA 2FMMA 5CYUA 1BQQT 4RH6A 2RVLA 1LTSD 3NHHA 2EVBA 5G3LD 1VF5C 4L6TB 1PRTF 2D9UA 3NPPA 1V1PB 3BVZA 3NE5B 5EQ0A 4MN3A 3WOEA 2Q8IB 2NVTB 1SYBA 5BN3A 1GUGA 3GD7A 2D2CC 4KD3A 3R2TA 1LTAD 3J7AF 1A2UA 5KRUA 2HCIA 1QNUA 5E1FA 3JAME 1C4QA 3S1MB 1SEBD 1JOKA 3J80E 1IW7D 2B2YC 4DGZA 2PPBC 5I6WA 1SNCA 2A74C 2NVYB 5C4XB 3VYTA 4DAYA 2KCCA 1NR4A 3IL8A 2QDBA 3CHBD 2Q8TA 2F0MA 1PZID 4HR7B 3URYA 1XXGA 4LJZC 3AB9A 4F87A 1VCIA 2EXZA 5F2DA 3I90A 5IIFA 4RFBA 1UUPA 3PUVA 4CKCA 5C5MA 2B39A 4ID6A 2PMZB 1DCZA 4OO1I 4C1NK 3VR5A 5DM63 2VNUD 5C0XI 2BE5C 3MXNA 1EEFD 4DNTB 4KI0A 1STEA 4KD4A 1G8ZD 1HUMA 1FNWA 3N6RA 2ZT9C 4QUCA 2PZWA 5CV4A 1EY6A 4A3BB 2NVXB 1ONLA 2R93B 3Q22A 1AP0A 4EGVA 5M3MB 3NK9A 5JVH3 2M9VA 2DY8A 4HSVA 1EY0A 3TZDA 1GHKA 4KTAA 2WV6D 1TY0A 4XDXA 3D6CA 4RCNA 4HN7A 3RUZA 1JWUD 2K5QA 3W3AA 5ELDA 1EY5A 2NBFA 4FXGC 4V190 3GTPB 2EY5A 4R8IA 3OW7A 1S5BD 5AFWA 2R7ZB 1V1PA 4C3JB 5C44B 3HOUB 1SYGA 1KTKA 5JAVA 4RGNA 1ET6A 4K6LA 3GTLB 2EYMA 4FXDA 3SK5A 4CKEA 3DHQA 5M3FB 1I4GA 1B50A 2XRQD 2EYHA 1SXTA 1B1ZA 5HGTA 1S5FD 3MC0B 3PIP3 2KEDA 5CV8A 4FF3A 4PQXA 3I4MB 1F2YA 2WKCA 4F8MA 1E2ZA 5CC4A 1JE4A 1BCPB 2SDFA 3MXGA 3RZOB 3CRLC 3KLRA 3IFTA 2IJ0A 1WTWA 1Q1EA 2XRSD 1T5XD 2EYOA 4OGQC 2E2JB 3L9AX 1K83B 2F0LA 5IGGA 3QJYA 4XQJA 3NTKA 3MFYA 1YNNC 1K8OA 1TT2A 2Z4IA 4K5VA 1TY2A 3TP5A 1CTMA 2K33A 1R4PB 4FYDA 4XTCS 1S5DD 2O4XA 5ELCA 3T51B 1RTOA 1SFOB 1U9RA 1E2WA 1U4RA 4MHEA 4IURA 2QCPX 5EPJA 2VB3X 2KECA 1EY8A 3R8BA 4H44C 1MGSA 1SSOA 3WOFA 4XQQA 5T1GA 4H0LC 4ME5A 4FP5D 4K6DA 3M7NA 2X69A 4IUNA 2KUMA 1PZKD 4P2CB 1WTQA 1XX8A 2MPMA 5M5XB 2EY1A 1HTPA 5C3XA 2IL8A 3RMHA 1D5ZC 1OXXK 4KK7A 1STHA 1AN8A 4Q0FA 5CMDA 3OHXC 3S1RB 5I9PA 2BA0A 1BCPD 3DWAA 4RGOS 4DU9A 2EOTA 1SNQA 4FF1A 3ITPA 1DOLA 4B08A 1ZYRC 4KJOA 1A3TA 2MGSA 2PCFB 1DZ1A 1LTBD 2NVQB 4X3TA 1BR9A 2PW5A 3LWEA 1W6KA 1STBA 1IYVA 1CA5A 4OO1H 1EFID 5CV7A 1IKMA 1HQMC 3R93A 1LTTD 3NWSA 1T5EA 1TS2A 3S17B 3U9SA 2Q8RE 1TWAB 3J81E 1HXYD 1U4LA 5E3FA 2L12A 2H4OA 1WTXA 1SJHD 4RHSA 3C2PA 2A6HD 1LTRD 1RJTA 1LABA 2B2VC 1XTCD 4PV1C 3I70A 1UNSA 1SYDA 4TQUS 4BWGB 3KLSA 2B2TC 4WFN3 1TIID 4KY6A 1KDBA 1HUNA 4ZLTF 2QKIC 4J6HA 5JVG3 1QOHA 2XSCA 3QG1A 3SK4A 2L55A 2IX1A 5IODA 5C5LA 4R8NA 1ZEQX 5I6YA 2F0JA 4C3IG 1NCVA 3HP3A 2AQ2B 2WAQB 3K0YA 4DK1A 1LO5D 2M2LA 5IT9L 2B8GA 1A2TA 2JEBI 5NUCA 2TSSA 2VXWA 2OT2A 3I72A 2M00A 2KOLA 3SHLA 2WIIB 2A6ED 2F0SA 5I2XA 4WJWA 1LV9A 2LY7A 4RKBA 1CHPD 3DWPA 1A15A 2Z1CA 4ZKCB 1B2TA 1QJOA 3A7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q6S A;  2NZ1 D;  2NYZ D;  1F9P A;  5COR A;  3UI2 A;  1BNZ A;  1IL8 A;  1CA5 A;  2J7Z A;  5EKI A;  5D14 A;  5EQ0 A;  5EJW A;  1B53 A;  2K03 A;  1X3P A;  4MN3 A;  4CJ1 B;  1IKM A;  1AP0 A;  2FIN B;  3R93 A;  1MSG A;  3DEP A;  2B2W A;  4IUP A;  3GV3 A;  1Q3L A;  2DY8 A;  4HSV A;  4CJ2 C;  1ILP A;  3DEO A;  1CM9 A;  1NAP A;  3TZD A;  1PFN A;  2Q8R E;  1O80 A;  1QE6 A;  4X3K A;  5DNF A;  2XIW A;  1HRJ A;  1ESR A;  2B2U C;  4RA8 A;  1GUW A;  4XDX A;  1U4L A;  1TVX A;  3I8Z A;  2L12 A;  2HCI A;  2B2U A;  4HED A;  5COY A;  1WTX A;  3D6W A;  2FJ2 A;  4IUQ A;  1HFG A;  1ML0 D;  1G6Z A;  2L9H A;  2BDN A;  2MJ8 A;  4HAE A;  5E4W C;  4O42 A;  2RSN A;  1QG7 A;  1RJT A;  3KBX A;  1KNE A;  1QNK A;  5E4X A;  2K05 A;  4ZAI A;  1X32 A;  1RTO A;  2B2V C;  2JYO A;  3KUP A;  4HCS A;  3GV6 A;  3DM1 A;  5JJZ A;  1IKL A;  2H1E A;  2B2Y C;  5EPL A;  1U4R A;  4MHE A;  1WTO A;  2EPB A;  3I3C A;  4IUR A;  1S4Z A;  5CBE E;  1B3A A;  4R8I A;  5AFW A;  1DON A;  2B2T C;  2K01 A;  5EPJ A;  1ROD A;  4XT3 B;  3TN2 A;  1J8I A;  1SDF A;  4ZKB B;  1PFB A;  1VMC A;  2HCC A;  2RA4 A;  1NR4 A;  2KEC A;  1O7Y A;  3IL8 A;  5CBA E;  1HUN A;  2Q8T A;  2K04 A;  4ZLT F;  4OIJ A;  4QUF A;  1WD0 A;  1MI2 A;  1MGS A;  1SSO A;  2R3Z A;  4IUU A;  4RWS C;  4UAI A;  5T1G A;  1G91 A;  2KVM A;  2EE1 A;  1F9S A;  2N55 A;  2X6L A;  4RAU C;  2X69 A;  4DN4 M;  2KUM A;  1M8A A;  1EQT A;  2L11 A;  1RHP A;  4U68 A;  1B50 A;  1ILQ A;  2B2V A;  1XYI A;  4NW2 A;  1CA6 A;  1G2T A;  2K28 A;  4LMQ D;  1PLF A;  1G2S A;  1RTN A;  3I90 A;  2B2Y A;  1XX8 A;  1F9Q A;  2MPM A;  1WTQ A;  1EIH A;  2HDL A;  4XT1 B;  1SAP A;  2K1B A;  3FDT A;  1DOK A;  2IL8 A;  3I91 A;  2B2T A;  2KED A;  2L4N A;  1EIG A;  1PDQ A;  3IFD A;  4IUT A;  1X3Q A;  1KNA A;  3H91 A;  2KEE A;  3G7L A;  4ZK9 B;  4OIK A;  1NCV A;  1O7Z A;  1J9O A;  4CJ0 B;  1U4M A;  3HP3 A;  1MSH A;  1WTP A;  1VMP A;  4IUV A;  5CMD A;  1HFN A;  1NR2 A;  1DOM A;  2CVR A;  3P7J A;  1E0B A;  5EPK A;  2N88 A;  4X3U A;  2HDM A;  1PFM A;  3F2U A;  2M2L A;  1U4P A;  1JE4 A;  2B2W C;  1JIC A;  2SDF A;  1WTR A;  2X6G A;  3MTS A;  2EOT A;  2L1B A;  1BBX C;  1WD1 A;  1BO0 A;  2VXW A;  1DOL A;  1F2L A;  1WTW A;  1AZQ A;  1HUM A;  1HA6 A;  1HHV A;  3MWY W;  2DY7 A;  2HUG A;  2FMM A;  3FPU B;  1WVL A;  1B4O A;  2JP1 A;  2KOL A;  1WTV A;  2MGS A;  3QO2 A;  4QUC A;  5T1I A;  1DZ1 A;  1BF4 A;  2RVL A;  1AZP A;  2RSO A;  1ZXT A;  2MP1 A;  1LV9 A;  2NWG A;  4X3T A;  1F9R A;  3LWE A;  3ONA B;  5D65 A;  4ZKC B;  1A15 A;  3SVM A;  2FFK B;  2D9U A;  1C8C A;  2FHT A;  1B2T A;  4X3S A;  1EL0 A;  4R9W A;  3N52 A;  1ICW A;  1EOT A; 
#chains in the Genus database with same CATH topology
 1SYF A;  2CHB D;  1KRS A;  2NZ1 D;  2LSS A;  1LTI D;  3BYY B;  3VYR A;  4IPD A;  1I4P A;  4DAM A;  4BA1 I;  4BY1 G;  1CK1 A;  5C0X G;  4A3E G;  2IX0 A;  5J1Z A;  4RA8 A;  3D6W A;  2YTX A;  1I4Q A;  3OTO L;  3IRB A;  3HOV H;  1JCK B;  4YHH Q;  3M4Q A;  3PF5 A;  3MAQ A;  3SEB A;  4ILW A;  2EPB A;  3I3C A;  2JSO A;  2CW0 D;  2R92 G;  3TP6 A;  3M3Y H;  1CI3 M;  1R4Q B;  4DFA A;  5FLX c;  3M4Y A;  3KOJ A;  1KDA A;  1RIP A;  3I55 A;  4BY7 H;  1K0S A;  1NMF A;  4P74 A;  2A73 B;  1I50 H;  1KQS A;  4A3K H;  3GTG H;  2G9H D;  1LM0 A;  2EE1 A;  2WAC A;  1XNQ L;  1PTO D;  1M8A A;  1EQT A;  2L11 A;  1GJX A;  4A3G G;  4LMQ D;  3OTO Q;  4XQN A;  1YIT A;  4UHV A;  1FR3 A;  4KV6 A;  1NBW A;  1S3O A;  3HS0 C;  3BVM A;  5C3E B;  4LUO A;  1Y1W B;  1PH3 A;  1DOK A;  3PO2 H;  3C3L A;  3IFD A;  1TXY A;  5IYC G;  4X64 L;  4B3R L;  2UUB L;  2IW3 A;  2F0F A;  3K5L A;  1VQ9 A;  2F03 A;  4C1N I;  4I65 A;  2HD3 A;  3P7J A;  3KF6 A;  1VQ7 A;  1E0B A;  2N88 A;  1JMC A;  3F2U A;  1PRT C;  1Y8P B;  1WJJ A;  1WCM G;  4PZ8 A;  5FLX E;  5C4Z A;  4FF4 A;  2RF4 A;  3TRE A;  1XNQ Q;  4DNR B;  3J81 i;  3TDQ A;  3S1Q H;  2VS1 A;  4DR3 L;  2MO0 A;  5FOB B;  1ASY A;  2R7F A;  3HOZ B;  4K5X A;  3FRP B;  3MXU A;  4LAA A;  1UE1 A;  2ZXO A;  3ONA B;  4JI5 L;  5M5X H;  2E2D C;  3WDN A;  2K5H A;  4CHT B;  4IJH A;  4R9W A;  1EOT A;  5FO9 B;  4X64 Q;  3FVQ A;  4GNX B;  4B3R Q;  1IL8 A;  2DN8 A;  1UWV A;  1XTD A;  2UUB Q;  4DXG A;  1X3P A;  2EDG A;  1A3V A;  5LL6 X;  3H3V C;  5GAE C;  1EU4 A;  4HIO A;  2HIV A;  4CGY B;  3J80 c;  4I7A A;  2EJG C;  4YWM A;  1TS4 A;  1YNX A;  4KKT A;  1YZ6 A;  4Q5V A;  2G5D A;  2D0O A;  4DAP A;  2KA7 A;  1J6Q A;  3ND9 A;  1EQV A;  2ZTD A;  4QF4 A;  4B9X A;  4ZAI A;  5IYD G;  4DR3 Q;  1BUV T;  3KUP A;  4HCS A;  1CKM A;  2R6G A;  3I4L A;  1PH4 A;  1F2Z A;  2F1M A;  1VQN A;  1BOS A;  4LF8 L;  2F0I A;  2KBN A;  4AYB B;  1IYU A;  4JI5 Q;  4G7Z C;  2XWB B;  4JW0 A;  3J7Y W;  4R4O A;  5JEA H;  4ZKB B;  1Z47 A;  1N36 L;  5I4D A;  4DKA C;  2MO1 A;  2PQA B;  1QVG A;  1EIY B;  5CR3 A;  4IUU A;  1P8L A;  1G91 A;  1VQF A;  2PYK A;  3QOJ A;  2Z6K A;  1TWA H;  5LMN W;  1B70 B;  3CF5 A;  2F3W A;  1D1I A;  2HDL A;  4A3I B;  1PH8 A;  1K8A C;  1EIG A;  4LF8 Q;  1X3Q A;  4C56 C;  3H91 A;  3S14 H;  4C3I B;  1L0Y B;  1J9O A;  4YCW A;  3CC4 A;  5JEA J;  2PNR C;  4DV4 L;  1O7L A;  5KND A;  2JA7 G;  2OEO A;  1N36 Q;  4X3U A;  3E9H A;  4DR5 L;  3S16 B;  1KAA A;  3Q0A A;  5K36 G;  4OWX B;  1E24 A;  2NTT A;  5C6A A;  4EX5 A;  1WD1 A;  1MKH A;  1BO0 A;  4A3F B;  1VQD A;  3OYY A;  1W6J A;  1HA6 A;  1HHV A;  3PIO 3;  3ERQ A;  4C2M H;  1KD1 C;  4I7Z C;  3FPU B;  1PTO H;  3QO2 A;  2NN6 I;  2FMC A;  5CV5 A;  3OIP A;  1EWH A;  2L15 A;  3G6J B;  3SVM A;  3NQT A;  1TWC H;  3OOC A;  1STY A;  2D62 A;  2NYZ D;  1BNZ A;  1Z7T A;  3PUZ A;  3FEW X;  3GTO H;  1BCP F;  5M5Y H;  2BCO A;  4IUP A;  4B3S L;  4DV4 Q;  3VR3 A;  2N8N A;  4CJ2 C;  1YJN A;  1M90 C;  1X6O A;  2JQO A;  1JWS D;  4BY1 B;  1RCV D;  4DR5 Q;  1IHZ A;  4X3K A;  5DNF A;  4A3E B;  3NUC A;  1FYC A;  2F0E A;  4PZ6 A;  2VW9 A;  2A5H A;  2FJ2 A;  3Q24 A;  1Q81 C;  2EXD A;  4O1N A;  4S3S A;  2PZU A;  4LF6 L;  3PCO B;  1SE2 A;  1KL9 A;  1NNX A;  1LLR D;  3CKI B;  3GV6 A;  2RDG A;  5DLQ E;  3DLL A;  2HHH L;  4FF2 A;  4DXF A;  3S2H B;  3W1B A;  4R4I A;  1IL2 A;  4OL7 A;  3CPF A;  4H7B A;  3UDI A;  1TWF H;  2R92 B;  4GNX A;  4EQN A;  2IY5 B;  4ULL A;  1FNV A;  1FD7 D;  3D8G A;  4RKL A;  4JI0 L;  1NE3 A;  2K04 A;  2A68 C;  4B3S Q;  4QUF A;  3ULJ A;  4QGU A;  1SND A;  1PRT B;  3SGI A;  3DXJ C;  1CSQ A;  2F0K A;  3S1N B;  5ELO A;  3M9B A;  4A3G B;  4XYO A;  1YNJ D;  3WWV A;  3PO3 H;  1G2S A;  4LF6 Q;  1CQV A;  1V1Q A;  1PYW D;  4XXE A;  3D4D A;  2K1B A;  2NB0 A;  3NTH A;  2HHH Q;  2YU9 B;  3HFZ B;  3K6O A;  1V8Q A;  4A3D G;  1PHJ A;  3MVV A;  3LX0 A;  4JI1 L;  5IWA L;  4N9P A;  1UEB A;  2LS0 1;  2OQ0 A;  2JK8 A;  3HRZ C;  1IYJ B;  3STB C;  2A6E C;  2Z0S A;  4IUV A;  2E76 C;  3E5S A;  2PQA A;  4JI0 Q;  1GO3 E;  2A69 D;  1BXT A;  1I4R A;  5JJL A;  1WCM B;  2ICI A;  4A75 A;  2HUG A;  2RBM A;  3EIV A;  2K5V A;  1WVL A;  4BBS H;  2JP1 A;  1EZ6 A;  1NUC A;  3A56 A;  4IFD I;  4M1U B;  4IPG A;  1RKN A;  3GTM B;  1XWE A;  2RCF A;  1TWH H;  2PQE A;  4IQZ A;  5GAG C;  1X9N A;  4JI1 Q;  5IWA Q;  2PI2 E;  3F2B A;  3DEP A;  2B2W A;  5L37 A;  1A8V A;  3DEO A;  2B8F A;  1KLU D;  2F0H A;  2F0D A;  2XIW A;  4FVM A;  3I4N G;  1W3S A;  1N8R C;  4E6I A;  3JAM i;  4X6A H;  3BG3 A;  5COY A;  3SK8 A;  3DMU A;  1B3Q A;  1KNE A;  1Q82 C;  4A3J H;  3J80 i;  4G7H C;  2YTY A;  4L8J A;  3H0G H;  1YJW A;  3HOZ H;  4MIU A;  3IAY A;  5C3W A;  1Z9F A;  1B3A A;  1A6X A;  4OHJ A;  1EZ8 A;  3TN2 A;  1OXV A;  2JEA I;  1JOQ A;  2RA4 A;  4Y7N H;  1JR0 D;  4RGM A;  2F3I A;  1KAB A;  1DJR D;  1K8M A;  1UE6 A;  1JJ2 A;  1F9S A;  2F4I A;  1RHP A;  2LKV A;  3FP9 A;  1SBB B;  3E9I A;  1M1K C;  1XYI A;  3M7G A;  4HMJ A;  4HTH A;  5KNB A;  1WI5 A;  3I73 A;  3CME A;  3P1H A;  2BDO A;  1O78 A;  1MIU A;  2F0G A;  1CFM A;  2RDF A;  1Y69 U;  4P71 A;  1VQM A;  1SMY D;  3KDF B;  2KEE A;  2E8G A;  2NVT H;  4CJ0 B;  5KEE A;  1U4M A;  3KFU A;  1G6P A;  2Z6B A;  4C3H G;  3HOX G;  2O5I C;  2JA7 B;  1PTO F;  3TME A;  4HJ8 A;  2PO4 A;  3A5U A;  1BBX C;  4RGT A;  4A3C G;  3GQB A;  4JC0 A;  3W5O A;  3T1Y L;  1EY4 A;  1XMO L;  2IX3 A;  2QEJ C;  3V05 A;  3HOW G;  2ZJP A;  4UP8 A;  2CH4 W;  4EQ5 A;  4JBJ A;  4A3M G;  3QB3 A;  1DGS A;  4X3S A;  2XVS A;  2N78 A;  3NEN A;  5IP9 G;  2UXD L;  1VQ4 A;  1F9P A;  1OXT A;  4L5Q A;  3UI2 A;  5C4X H;  2JA8 G;  4L63 B;  4LFA L;  3GTQ B;  3PUW A;  5EKI A;  5EJW A;  4MZ9 A;  3X3M A;  1MSG A;  1RDP D;  2O5J C;  5EBC A;  1QCB D;  2F4V L;  4POF A;  5A2Q L;  3A8J E;  4F7X A;  1G6Z A;  2SOB A;  2MUY A;  2JE6 I;  2RSN A;  4L5T A;  4GKK L;  3SE0 A;  3T1Y Q;  5JJZ A;  2NN6 H;  1IKL A;  1XMO Q;  2QGQ A;  2XWJ B;  4BBR B;  2WB1 G;  5IGD A;  2UXD Q;  1IW7 C;  1LT5 D;  1VQI A;  1VQE A;  4FDB A;  3HG9 A;  4LFA Q;  1SDF A;  1PFB A;  2HCC A;  5LMN L;  4LNQ A;  1HH2 P;  3CCL A;  2F4V Q;  3EBE A;  2JA5 G;  2KCN A;  2KVM A;  5G3L F;  1BKB A;  5GAH C;  1KDC A;  3K5M A;  2WKD A;  4ZYS A;  1CA6 A;  2LFN A;  3BJU A;  2B2Y A;  2VB2 X;  3EVQ A;  3J7A 5;  4GKK Q;  3KF8 B;  1E1T A;  1H9S B;  3HGB A;  4HIM A;  2R93 H;  3CRK C;  3W2D A;  4A3L H;  1PFS A;  1IBK L;  2BE5 D;  4A3D B;  1SNM A;  3HEJ A;  4WOR A;  4QB4 A;  2C5C A;  1PMR A;  4ZK9 B;  5M3M H;  4LUV A;  3QOL A;  4ODG A;  2PZT A;  3AMU A;  3H09 A;  5KNC A;  3KK7 A;  1STA A;  4AH6 A;  1GD7 A;  5LMN Q;  3U50 C;  2CQO A;  2DNC A;  4DNI A;  2K7V A;  3G6E A;  5GQO A;  1F77 A;  2EZV A;  3AQQ A;  4ZQ3 A;  3NBH B;  4QJF A;  2E2H B;  3S1N H;  5ISR A;  1HZA A;  1B4O A;  1GUT A;  3W1G A;  4GZY C;  4PZ7 A;  5T1I A;  1AZP A;  3GTP H;  5HGQ A;  3NTI A;  1ZXT A;  2NWG A;  3V2T A;  1C9O A;  1C8C A;  5IP7 G;  1YI2 A;  2NUC A;  2R7Z H;  3S2D B;  4H13 C;  1ET9 A;  3L3O C;  2EYJ A;  2AQ3 B;  3KDF A;  3HOU H;  1IBK Q;  1Y14 B;  3AYH B;  2IHF A;  2JA6 B;  3GTL H;  4KKU A;  5FO8 B;  5LMU L;  3GV3 A;  3EN2 A;  2OTJ A;  3OPO A;  1DYQ A;  4PMB A;  2LMC B;  4IPC A;  3NP8 A;  3FKI G;  2WIN B;  3MEF A;  3AU7 A;  5M3F H;  1QIL A;  2B2U C;  3I4N B;  1CKO A;  3RN2 A;  1BBW A;  1EIH A;  4HED A;  4R4T A;  1DM0 B;  2AMC B;  3KBG A;  2MJ8 A;  5E4W C;  1FNU A;  1QG7 A;  1SE8 A;  3BVG A;  4FXK C;  4TVA B;  5K5P A;  3TS0 A;  1QZH A;  4IFD H;  4QIW B;  4A93 G;  1B9N A;  2J4X A;  2XTI A;  1CZW A;  2ASB A;  3I4M H;  4JVZ A;  5CBE E;  1I3Q B;  3TRZ A;  4DV0 L;  1CZG A;  4YIJ A;  4CKB A;  4OO1 G;  3J7A V;  1HZC A;  3K58 A;  1W2B A;  4BXX H;  3T13 A;  2YV5 A;  2I5M X;  5LMU Q;  3GP7 A;  3RZO H;  5HUR A;  2WAQ E;  1CT1 D;  5J39 A;  4M8A A;  5IYB G;  4OXP A;  4RAU C;  3PIP A;  1V1O A;  4DK6 C;  4UP7 A;  5C4J B;  2GA4 B;  5KYL A;  2RCN A;  3CQZ B;  4K2K A;  2E2J H;  4MTN A;  4IFD J;  3ULP A;  1K83 H;  4LF4 L;  1EYC A;  3MZ5 A;  4NMZ A;  1LTG D;  4JBW A;  3QWN A;  4A3B G;  1Y1V G;  2YYZ A;  1EEI D;  1I6V C;  4DV0 Q;  2SNM A;  1ENA A;  3TBI B;  3A74 A;  4K14 A;  3JAM L;  4C3H B;  4J1M A;  3HOX B;  1Y8N B;  4QIW E;  1HFN A;  3KLW A;  5FK9 C;  2L1B A;  1PH5 A;  3I7F A;  1BBU A;  1F2L A;  5M9O A;  2ENB A;  5IT9 c;  4MNO A;  4GLX A;  5IY0 A;  4IJL A;  3S9W A;  4JK1 C;  1SFO H;  2GN5 A;  4PMW A;  3VA7 A;  3NWT A;  3KF8 A;  1KC8 C;  1H9S A;  2RSO A;  3ERO A;  1EWI A;  3RNU A;  4K2L A;  4J15 A;  5D65 A;  3HOW B;  3TZU A;  1A0I A;  1MJC A;  2FHT A;  4LF4 Q;  1EL0 A;  3FMC A;  3DM3 A;  3N52 A;  1YNN D;  4A3M B;  1SYE A;  2F0V A;  3A55 A;  2JA8 B;  3DUZ A;  2FIN B;  5LL6 S;  1X56 A;  3NXW A;  5C44 G;  1SE3 A;  1UE7 A;  1PYS B;  3OSO A;  3A8K E;  1O80 A;  4DPG A;  3CCU A;  2KHI A;  1BDO A;  4LK1 C;  2B63 G;  1HRJ A;  3NBH A;  2OF1 A;  3A5Z B;  1B9M A;  3GTJ B;  4HAE A;  3P75 A;  3BDO A;  3KBX A;  1EFW A;  2IT1 A;  4RG1 A;  1X32 A;  1STN A;  3CAM A;  2F3V A;  5EPL A;  1MD2 D;  5IT9 E;  1WTO A;  1GHJ A;  1OTC A;  4GN5 A;  1IZ6 A;  3QIA A;  1Q90 A;  4OON A;  2WB1 B;  5J3B A;  1Q8I A;  1TWG B;  1TR5 A;  5JOB A;  1RF2 D;  4RMF A;  5FKA C;  2O2L D;  3S1R H;  3KJP A;  2SEB D;  3HOY B;  3A7A B;  3C1E A;  4NDX A;  5EKK A;  1F2M A;  4R4Q A;  1L0W A;  2GVB A;  4G7O C;  2F0N A;  2IWH A;  4U68 A;  1V9P A;  1PZJ D;  4NXN L;  2MNA A;  3C46 A;  4JI8 L;  2ID0 A;  5KGU A;  3HOV G;  4EQO A;  2NVQ H;  1NSN S;  3X3N A;  2ZJQ A;  5IGB A;  4DR1 L;  4IN3 A;  4WRD A;  3KJO A;  3VA5 A;  3UDX A;  4ZRZ A;  3EQL C;  4BBR H;  1N34 L;  2EJM A;  3UDG A;  2CVR A;  3S17 H;  3BZC A;  4KHV A;  2HDM A;  4BY7 G;  2F0U A;  5D3I B;  1ZYR D;  5IGE A;  3NBI A;  4A3K G;  1XPR A;  2WB1 E;  4XYQ A;  2X6G A;  5ELE A;  5M5W B;  1D5X C;  1XPU A;  1B8A A;  3OWE B;  1BCP C;  4CDF C;  1A62 A;  1L1O C;  4NXN Q;  4N8F A;  1XNR L;  4HCE A;  4JI8 Q;  1CUK A;  1I6H B;  2VY3 A;  3OMC A;  3SXH A;  2MP1 A;  2K14 A;  3D4R A;  3SK6 A;  2FFK B;  3PO2 G;  5IGF A;  4DR1 Q;  2RHS B;  4JOI C;  1EYA A;  5D14 A;  3M4P A;  2Q2H A;  3SDZ A;  4AYB E;  1N34 Q;  4QCL A;  1S5C D;  3PUX A;  2RQX A;  4G57 A;  1OXS C;  4EVO A;  3FKI B;  1PXU A;  3EJI A;  1JB3 A;  2AUK A;  4R1J A;  2F0P A;  2F0Q A;  4AIM A;  3EFX D;  2KQ3 A;  4IUQ A;  2I46 A;  2VUM G;  1G29 1;  2HIX A;  1UEA B;  3K5O A;  4O42 A;  1GUO A;  1K28 A;  1JOO A;  5DM7 3;  3UE0 A;  1PA6 A;  1XNR Q;  1QWY A;  3VR6 A;  4HID A;  4A93 B;  2TMP A;  2A6H C;  1H9M A;  3AFQ A;  1GVP A;  1JB7 A;  3OMG A;  3RD4 A;  3I4O A;  1RD9 D;  1D5M C;  4PMC A;  1PH1 A;  5KIX A;  3RLF A;  4UDU C;  2DJG C;  1O7Y A;  4N8X 1;  5CBA E;  4KN7 C;  2BA1 A;  4KN4 C;  2R61 A;  1ZKO A;  2JA6 H;  3ZJY C;  4RWS C;  1OO9 B;  5J22 A;  1LT4 D;  1TU2 B;  3U9O A;  1V43 A;  2C9O A;  2B2V A;  1H9J A;  2F0T A;  4JI3 L;  1FL0 A;  1F9Q A;  3L0O A;  1I94 L;  3GTK B;  2E2I B;  1SAP A;  3K7A B;  3CCJ A;  3FDT A;  2B2T A;  4U67 3;  1HCZ A;  2ICE C;  1SMX A;  4DK0 A;  4OIK A;  1Y1V B;  3M4O B;  5ELB A;  3E0E A;  5JEA G;  2OCE A;  1DOM A;  1II3 A;  4X66 L;  3RZD B;  3FHW A;  1R9T B;  1QB5 D;  4J8Q A;  1YHA A;  4K8I A;  1AZQ A;  1E2V A;  4HJA A;  3BDC A;  2FXQ A;  2E75 C;  1EYD A;  2H5X A;  4BS9 A;  2ZTE A;  3K5N A;  2K32 A;  1WTV A;  1LT3 D;  4JI3 Q;  1X54 A;  1I94 Q;  1AE3 A;  2ZXP A;  3C1F A;  1F9R A;  3ER0 A;  2UUA L;  2KCM A;  3EA6 A;  3CC7 A;  1VQJ A;  4NXM L;  4FO2 A;  2CQA A;  1SR3 A;  2RDH A;  3KLS X;  1B53 A;  2AWN A;  3H15 A;  4JI7 L;  1CM9 A;  1NAP A;  4X66 Q;  4KHZ A;  1PFN A;  4F88 A;  1A63 A;  3TP7 A;  2GVA A;  1JOR A;  3Q8D A;  2E5L L;  2B63 B;  1HJP A;  1EUJ A;  3JC6 6;  3T16 A;  2B2U A;  3S15 B;  2KHS A;  1C48 A;  1N33 L;  5C3E H;  1LYL A;  3HZX A;  1YEZ A;  1Y1W H;  2EYF A;  4HMI A;  4V0B A;  4DV5 L;  3VDY A;  2OQK A;  1QUQ B;  2UUA Q;  4LF5 L;  4NP5 A;  2SNS A;  1JQY D;  4NXM Q;  1ROD A;  1GUN A;  1J5E L;  2CW0 C;  5I9O A;  2EYP A;  3A0J A;  3BDL A;  4OIJ A;  4DA2 A;  1E3P A;  4JI7 Q;  1WD0 A;  1KXL A;  2R3Z A;  3R3O A;  3GO5 A;  5FJ8 H;  2RKS A;  4DN4 M;  2E5L Q;  1K73 C;  3L2P A;  1L1O B;  2K28 A;  2XNA C;  1UAP A;  1PLF A;  1SNP A;  1PTO C;  5CV6 A;  3HOV B;  1N33 Q;  1VDZ A;  4KMU C;  5A35 A;  4TSS A;  5BN5 A;  2EY6 A;  4QY7 A;  1NY4 A;  4DV5 Q;  3I91 A;  3HKZ G;  2Z8L A;  3J81 L;  2L4N A;  4K5W A;  5CGK A;  4LF5 Q;  4DF7 A;  3E0J A;  4DR7 L;  1PRT D;  3M3Y B;  1MSH A;  1AEX A;  1DD2 A;  1J5E Q;  3MEH A;  3TEH B;  4FNF A;  4BY7 B;  3CMA A;  3MFG A;  1I50 B;  3HOY H;  3CCS A;  3MTS A;  4A3K B;  3GTG B;  1VQC A;  2DNE A;  4JG2 A;  2DY7 A;  3H6M A;  2L0C A;  1D2B A;  3CPW A;  5HY6 A;  1TKW B;  3PO3 G;  1B44 D;  3ICE A;  2EYL A;  1CHQ D;  2I0Q A;  2CH4 A;  1I5F A;  4O0A A;  5JPN C;  1SLJ A;  3B6Y A;  4K8J A;  3PO2 B;  3Q6S A;  3Q23 A;  5COR A;  3T4A C;  4B3T L;  2J7Z A;  1Q1B A;  4DR7 Q;  2K03 A;  4YCU A;  4LW1 A;  3J7Z C;  5E7N A;  4LFC L;  4DK3 C;  5DAU A;  1ILP A;  2Y0S G;  5C4H A;  4DR4 L;  1QE6 A;  4JBM A;  1YJ9 A;  2Z4H A;  2UUC L;  3I8Z A;  2HQL A;  1LAC A;  5BN4 A;  1ML0 D;  1GXD C;  2VUM B;  3S1Q B;  4BBS G;  3U4Z A;  1LT6 D;  2K05 A;  4A3I H;  4B9W A;  3BYT B;  1S4Z A;  3BS1 A;  3VR2 A;  4C3I H;  3FPP A;  5IP7 H;  2P5Z X;  2EY2 A;  4B3T Q;  4IOA A;  5H1S E;  1VMC A;  1FVI A;  4R4C A;  3VR4 A;  3S16 H;  4LFC Q;  2BH8 A;  1NTG A;  5FLM H;  1MI2 A;  2HQE A;  2I07 B;  1RL2 A;  4DR4 Q;  1Q12 A;  4A3F H;  3OIQ A;  1SYC A;  3R2I A;  2UUC Q;  2QIL A;  2F0W A;  4Z9C B;  4NW2 A;  1QVC A;  4KJN A;  1AW7 A;  2K6A A;  2E74 C;  1PH6 A;  4A3J G;  4WJ3 M;  3TSS A;  3D3R A;  5CV9 A;  4KY7 A;  3H0G G;  1JC7 A;  3HOZ G;  1SJE D;  1Q86 C;  2V1C C;  1QUQ A;  3J81 j;  4X62 L;  2AUJ D;  2EJF C;  1I4H A;  4DAV A;  3M85 A;  2VQE L;  3PIO A;  5EPK A;  1PFM A;  4BY1 H;  4N9T A;  2IPK D;  2QF7 A;  3E6Z X;  1WYD A;  3O13 A;  1TS3 A;  5C0X H;  2AHO B;  4A3E H;  1STG A;  1WTR A;  5JPM C;  2J0T D;  2R7D A;  2L5T A;  3VYS A;  3L7Z C;  3UDF A;  1A3U A;  1L1O A;  4LF9 L;  3S2H H;  1BF4 A;  1EU3 A;  2WFW A;  1EY9 A;  4DUY L;  3GTK H;  3P20 A;  1E22 A;  2I5H A;  3NEM A;  2R92 H;  3K7U C;  1ICW A;  1ICF B;  4X62 Q;  1HPC A;  2B3G A;  5JJK A;  4GN3 B;  3TQY A;  4JOI A;  3S14 B;  4GNX C;  1BVS A;  2F0O A;  2KCT A;  4OWT B;  2VQE Q;  2N3S A;  3ERS X;  5ELF A;  2PW7 A;  3BZD B;  5C0X J;  4LFB L;  3RZD H;  2UU9 L;  1TQO A;  1R9T H;  1GUW A;  3H94 A;  2LXJ A;  3RN5 A;  4A3G H;  4KKS A;  4RCO A;  5EKL A;  2VQF L;  1VQ5 A;  4C2M B;  5E4X A;  1DXM A;  1MBY A;  1PTO B;  2JYO A;  4LF9 Q;  2YU9 H;  1SRO A;  5KYI A;  1H95 A;  2A1A A;  3F2D A;  4DUY Q;  5IYC H;  1TS5 A;  1AFP A;  4IZ8 A;  1TWC B;  4NPS A;  3VYU A;  5FLX L;  1M4V A;  1OXU A;  4BA2 I;  4WJ4 A;  1DON A;  3PQI A;  2K01 A;  2A68 D;  5C4X G;  1L0X B;  5IOC A;  1D1K A;  5I2Y A;  1CQF A;  1EY7 A;  1J8I A;  3H3V H;  3GTO B;  1YIJ A;  5DEH A;  2V4D A;  5M5Y B;  5JJI A;  1WCM H;  4UAI A;  2KJX A;  3D31 A;  2OXP A;  3V96 A;  4EQP A;  4LFB Q;  2F52 A;  2UU9 Q;  1SNO A;  3CCR A;  2ZM6 L;  1H9K A;  3K81 C;  1ILQ A;  3T53 B;  1Q7Y C;  1G2T A;  2VQF Q;  2N49 A;  1RTN A;  1VQK A;  4TRD A;  2DUD A;  3NSW A;  4YY3 L;  3GTM H;  4HJ7 A;  4GOP C;  2QDL A;  5FO7 B;  4XT1 B;  2NN6 G;  1YNJ C;  3ND8 A;  4JI4 L;  4RHR A;  3STB D;  4IUT A;  3HKZ B;  5A2Q E;  1VQ6 A;  2CKZ B;  2XN9 C;  3AEV A;  3G7L A;  1TWF B;  4OX9 L;  3A54 A;  4IOC A;  2AQ1 B;  1EWC A;  1NR2 A;  4QMG A;  3K59 A;  2D5D A;  1MHW C;  2B2W C;  1JIC A;  5EGT A;  4Y52 H;  1GUS A;  3D4W A;  2A69 C;  3MWY W;  3SR1 A;  1UE5 A;  3NQI A;  3I56 A;  3OWF A;  4G4K A;  2ZM6 Q;  5IYD H;  3ZYY X;  1VQP A;  3TS2 A;  4HSP A;  3PO3 B;  4YY3 Q;  1O7I A;  2MHV A;  4LWC A;  1X3F A;  1L2F A;  1HR0 W;  2Z9H A;  2R93 G;  4JI4 Q;  4A3L G;  3CXC A;  4JBK A;  4GKJ L;  2WP8 J;  5M3M G;  4KY5 A;  4OX9 Q;  3J80 L;  4DAY B;  4CJ1 B;  1VQA A;  5GAD C;  1S5E D;  1FGU A;  3T56 B;  1Q3L A;  5LHY 1;  2Y0S B;  3HKZ E;  1H9R A;  2AWO A;  5ELN A;  1ESR A;  2ZXR A;  4H02 A;  1EQQ A;  1TVX A;  4P73 A;  4TKO B;  3PUY A;  1I4X A;  1HFG A;  2L9H A;  2BDN A;  2K4K A;  1QNK A;  4BBS B;  1Y8O B;  3LWU A;  4IAL A;  1S40 A;  3DM1 A;  2H1E A;  3IKJ A;  2K5W A;  2ZJR A;  2JXM B;  2R7Z G;  4PNY A;  5EBD A;  3TP8 A;  1TWH B;  4JI2 L;  4C3J G;  4AQY L;  3HOU G;  1HQR D;  1SE4 A;  3G4S A;  2Q2U A;  4GKJ Q;  4XT3 B;  1ESF A;  1NMG A;  4KHP L;  2JA7 H;  3MXN B;  2B29 A;  4ME3 A;  4HJ9 A;  4ABN A;  5D3D A;  5K36 H;  1YHB A;  2QA4 A;  2X6L A;  2N55 A;  1CKN B;  5BR8 L;  5M3F G;  2G9D A;  3PV0 A;  4ZUJ A;  1EQR A;  4LUZ A;  4DV7 L;  1D8L A;  1ENC A;  4IPH A;  4NKL A;  1HZ9 A;  5IGC A;  3RR5 A;  1GM5 A;  1D6E C;  1HTL D;  2Y0S E;  3PMF A;  1U0L A;  1VF7 A;  2VUM H;  4A3J B;  1K8G A;  4IFD G;  3DWQ A;  3H0G B;  3MA2 B;  4XIG S;  1HA5 A;  3MHB A;  3K57 A;  1PDQ A;  1SRU A;  3I4M G;  3GTQ H;  1KNA A;  4UP9 A;  1FGB D;  4X65 L;  1GOZ A;  2DJF C;  2ATW A;  1O7Z A;  2BOS A;  2JJQ A;  3F8T A;  4JI2 Q;  4CBV A;  2NTS A;  4AQY Q;  1WTP A;  1VMP A;  1VQ8 A;  3CU7 A;  3MXP A;  1SMY C;  3PGZ A;  4KHP Q;  2JA5 B;  3LNN A;  4BXX G;  4Y7N B;  2K5N A;  3A8I E;  4ZUI A;  3JAM c;  4JI6 L;  4DV1 L;  1U4P A;  1Z6H A;  2K5D A;  1KLG D;  1JWM D;  1ENF A;  1PH9 A;  1EOV A;  5BR8 Q;  1WTH A;  5TSS A;  4DV7 Q;  2FMM A;  3K0X A;  2NZH A;  5CYU A;  4GLA C;  4NB3 A;  1BQQ T;  4RH6 A;  2RVL A;  1LTS D;  3NHH A;  1GKH A;  2EVB A;  2VL6 A;  5G3L D;  1VF5 C;  4L6T B;  4ALP A;  4UY8 C;  1PRT F;  1X55 A;  2D9U A;  2JN4 A;  2A19 A;  3NPP A;  1AH9 A;  1V1P B;  3BVZ A;  1XJV A;  3NE5 B;  1KIX A;  5EQ0 A;  4X65 Q;  4MN3 A;  3WOE A;  2Q8I B;  4DV2 L;  4JYA L;  1HNW L;  2NVT B;  1SYB A;  1K3B C;  5BN3 A;  1GUG A;  3GD7 A;  2ALY B;  5GRO A;  2D2C C;  4KD3 A;  1CSP A;  3R2T A;  1LTA D;  4JI6 Q;  4DV1 Q;  3J7A F;  2MQH A;  1A2U A;  5KRU A;  2IHE A;  4QL5 A;  2HCI A;  1QNU A;  5E1F A;  1XMQ L;  4YCV A;  3AFP A;  3JAM E;  1C4Q A;  3S1M B;  1SEB D;  1JOK A;  3J80 E;  1IW7 D;  2B2Y C;  4GOP B;  4DGZ A;  2PPB C;  1WOC A;  5I6W A;  4A3D H;  1C0A A;  1SNC A;  2A74 C;  3CW2 C;  1KHI A;  4LF7 L;  2NVY B;  5C4X B;  4GN4 B;  3VYT A;  4DAY A;  2KCC A;  1NR4 A;  1HNW Q;  4DV2 Q;  3IL8 A;  4JYA Q;  2QDB A;  3CHB D;  2Q8T A;  4JCV E;  2F0M A;  2QW7 A;  1PZI D;  4HR7 B;  3URY A;  1VQL A;  1PH2 A;  1ASZ A;  3GDE A;  2E2H H;  1XXG A;  4LJZ C;  3AB9 A;  1IBM L;  4F87 A;  1VCI A;  2EXZ A;  5F2D A;  1XMQ Q;  3I90 A;  5IIF A;  4RFB A;  1UUP A;  3PUV A;  4CKC A;  5C5M A;  2B39 A;  2YTV A;  3S2D H;  4ID6 A;  2PMZ B;  1PVO A;  1DCZ A;  1PV4 A;  4OO1 I;  2MFI A;  1JJC B;  3VR5 A;  4C1N K;  5DM6 3;  2VNU D;  5C0X I;  2Q2I A;  4DR6 L;  1XPO A;  4LF7 Q;  1AE2 A;  3CCE A;  2BE5 C;  1X3E A;  3MXN A;  1EEF D;  1EYG A;  4DNT B;  4KI0 A;  1STE A;  2CWA A;  3I4N H;  1CKN A;  4KD4 A;  1G8Z D;  2PNH A;  1HUM A;  1FNW A;  3N6R A;  4DV6 L;  1IBM Q;  2K75 A;  2ZT9 C;  4QUC A;  2PZW A;  4UPA A;  5CV4 A;  4ZCK A;  1EY6 A;  4A3B B;  2NVX B;  1I3Q H;  2CFM A;  1HZB A;  3E3X A;  3KYH C;  1ONL A;  2R93 B;  3Q22 A;  2LXK A;  3G48 A;  3CC2 A;  3QR8 A;  1AP0 A;  4BBR G;  4CDE C;  4EGV A;  4OEL B;  5M3M B;  3NK9 A;  1QVF A;  4DR6 Q;  1VS0 A;  5JVH 3;  2M9V A;  2DY8 A;  4HSV A;  1EY0 A;  4DV3 L;  3D0F A;  3TZD A;  1YHQ A;  3OW2 A;  2PMZ E;  3HKS A;  1GHK A;  4KTA A;  2WV6 D;  4HIK A;  1TY0 A;  4XDX A;  3D6C A;  5C4J H;  4RCN A;  4HN7 A;  3S24 A;  3RUZ A;  1JWU D;  4DV6 Q;  3CQZ H;  2K5Q A;  3W3A A;  5ELD A;  1EY5 A;  1PYB A;  2NBF A;  4FXG C;  2NZO A;  4V19 0;  3GTP B;  2EY5 A;  3H3V I;  4R8I A;  4K0K L;  3OW7 A;  1S5B D;  5AFW A;  2R7Z B;  3RLO A;  1V1P A;  4C3J B;  5C44 B;  1E1O A;  4C3H H;  3HOU B;  3HOX H;  4JPB W;  1SYG A;  1KTK A;  5JAV A;  1KRT A;  4RGN A;  1ET6 A;  4JV5 L;  4K6L A;  1YBY A;  2KHJ A;  3GTL B;  2EYM A;  4FXD A;  3SK5 A;  3CP0 A;  4O2D A;  4DV3 Q;  1IXR A;  2K50 A;  4CKE A;  3DHQ A;  4A3C H;  5M3F B;  1I4G A;  1B50 A;  2XRQ D;  2EYH A;  1SXT A;  1U5K A;  1B1Z A;  4CDC C;  5HGT A;  1S5F D;  3HOW H;  3MC0 B;  1VQO A;  3F1Z A;  4GOP A;  3PIP 3;  4P75 A;  1IBL L;  4A3M H;  2KED A;  5CV8 A;  2CCZ A;  5IP9 H;  4FF3 A;  4K0K Q;  4PQX A;  2JA8 H;  3I4M B;  1N32 L;  1F2Y A;  2D0P A;  2WAQ G;  2WKC A;  1QZG A;  4F8M A;  1E2Z A;  5CC4 A;  2JA9 A;  3LGJ A;  4JV5 Q;  3NEL A;  2JA6 G;  1JE4 A;  1VQB A;  1BCP B;  2SDF A;  3MXG A;  3RZO B;  2ES2 A;  3CRL C;  3KLR A;  1HR0 L;  3IFT A;  2IJ0 A;  3GTJ H;  1WTW A;  2UXB L;  2XGT A;  1Q1E A;  2XRS D;  3K80 C;  1Q8K A;  1T5X D;  3ULL A;  1EIF A;  4CDD C;  1HNZ L;  4B3M L;  2EYO A;  4OGQ C;  4YWK A;  4L5R C;  2C35 B;  2E2J B;  2CWP A;  2I5L X;  3L9A X;  1K83 B;  1IBL Q;  2F0L A;  1TWG H;  5IGG A;  1D7Q A;  3QJY A;  3F2C A;  1K9M C;  4DR2 L;  1N32 Q;  4XQJ A;  3NTK A;  3MFY A;  1YNN C;  3CD6 A;  1K8O A;  1TT2 A;  2Z4I A;  4K5V A;  1TY2 A;  4P72 A;  2JA5 H;  1KAW A;  3TP5 A;  1CTM A;  2K33 A;  1VQH A;  3CCM A;  1R4P B;  1T9H A;  4FYD A;  1HR0 Q;  2UXB Q;  4XTC S;  1S5D D;  1JJG A;  1LTL A;  2O4X A;  5ELC A;  3T51 B;  1RTO A;  1SFO B;  1U9R A;  1HNZ Q;  4B3M Q;  1E2W A;  1U4R A;  4MHE A;  4IUR A;  2QCP X;  4IO9 A;  2EIF A;  5EPJ A;  5IE8 A;  4DR2 Q;  2VB3 X;  2KEC A;  1EY8 A;  1HNX L;  3R8B A;  4H44 C;  1MGS A;  1SSO A;  3WOF A;  5M5W H;  4XQQ A;  5T1G A;  4H0L C;  2OTL A;  2Q2T A;  4ME5 A;  4FP5 D;  2Z6K C;  4K6D A;  3M7N A;  2X69 A;  4IUN A;  2KUM A;  1PZK D;  3CCV A;  4P2C B;  1I6H H;  1WTQ A;  1XX8 A;  2MPM A;  5C3E G;  5M5X B;  2EY1 A;  1Y1W G;  1HTP A;  3S1M H;  5C3X A;  2IL8 A;  4MTK A;  1K0R A;  2PI2 A;  3RMH A;  1D5Z C;  1C7Y A;  1OXX K;  4KK7 A;  2UXC L;  1STH A;  1AN8 A;  1VQG A;  2DGY A;  3J81 c;  4Q0F A;  5CMD A;  3OHX C;  4QQB X;  2NVY H;  3S1R B;  5I9P A;  2BA0 A;  1BCP D;  1HNX Q;  3FKI H;  1JT8 A;  1PH7 A;  3DWA A;  4RGO S;  2HT1 A;  4DU9 A;  2EOT A;  4A4I A;  1SNQ A;  5FJ8 G;  4L5S A;  3ITP A;  4FF1 A;  1DOL A;  4B08 A;  1ZYR C;  4KJO A;  3U58 A;  1A3T A;  2AKW B;  4KLK A;  2MGS A;  2PCF B;  1DZ1 A;  1LTB D;  4A93 H;  4GS3 A;  2NVQ B;  4X3T A;  1BR9 A;  2PW5 A;  5EAY A;  3LWE A;  1MJE A;  1FJG L;  1W6K A;  1N9W A;  1STB A;  1IYV A;  2UXC Q;  1NJI C;  1CA5 A;  4OO1 H;  1K3R A;  1YVC A;  1EFI D;  5CV7 A;  1IKM A;  1HQM C;  3R93 A;  2OWO A;  1LTT D;  3NWS A;  1T5E A;  1TS2 A;  3S17 B;  3U9S A;  2Q8R E;  4GLV B;  1TWA B;  3PSI A;  5IYB H;  3J81 E;  3HOY G;  1HXY D;  1U4L A;  2A8V A;  2L12 A;  5E3F A;  2H4O A;  1LUZ A;  1WTX A;  2BH2 A;  1SJH D;  1WFQ A;  4RHS A;  3C2P A;  2A6H D;  3G71 A;  1JE5 A;  1LTR D;  1RJT A;  2E2I H;  1LAB A;  2B2V C;  1XTC D;  3K7A H;  1X3G A;  4PV1 C;  3I70 A;  2EQS A;  1UNS A;  4AYB G;  1FJG Q;  1SYD A;  4TQU S;  2NVX H;  1Y1V H;  4APV A;  3M4O H;  4A3B H;  4BWG B;  3KLS A;  2B2T C;  4WFN 3;  1X65 A;  1TII D;  4KY6 A;  1KDB A;  4OWW B;  2RHQ B;  1HUN A;  3KF6 B;  4ZLT F;  3RLN A;  2QKI C;  4J6H A;  2QEX A;  5JVG 3;  1QOH A;  4YWL A;  3I2Z A;  2XSC A;  4POG A;  4DUZ L;  3QG1 A;  4A76 A;  3T1H L;  3PF4 A;  3SK4 A;  2L55 A;  2IX1 A;  5IOD A;  5C5L A;  4R8N A;  3UE1 A;  2KEN A;  1ZEQ X;  5I6Y A;  3BZK A;  4A3I G;  5AJ3 L;  1Q46 A;  1G51 A;  2F0J A;  3BU2 A;  1S72 A;  2ZTC A;  4C3I G;  1NCV A;  3HP3 A;  2AQ2 B;  3K8A A;  2WAQ B;  3K0Y A;  4C3J H;  5C44 H;  1P16 A;  4DK1 A;  1B7Y B;  3CCQ A;  2K52 A;  1LO5 D;  2M2L A;  4OEM B;  3U4V A;  5FLM G;  5IT9 L;  1SN8 A;  2B63 H;  2B8G A;  1A2T A;  4A3F G;  2JEB I;  5NUC A;  2TSS A;  2VXW A;  4DUZ Q;  2OT2 A;  4PG3 A;  3S15 H;  3T1H Q;  3I72 A;  2M00 A;  4HJ5 A;  2KOL A;  3SHL A;  4YHH L;  2WII B;  2A6E D;  2F0S A;  2VZA A;  5I2X A;  4WJW A;  1LV9 A;  2LY7 A;  4RKB A;  1CHP D;  3DWP A;  2Z1C A;  1A15 A;  4ZKC B;  1B2T A;  5AJ3 Q;  1QJO A;  1E7Z A;  3A7L A; 
#chains in the Genus database with same CATH homology
 1SYF A;  2CHB D;  2NZ1 D;  1LTI D;  3BYY B;  3VYR A;  1I4P A;  4BA1 I;  1CK1 A;  5C0X G;  2IX0 A;  5J1Z A;  4RA8 A;  3D6W A;  1I4Q A;  1JCK B;  3MAQ A;  3SEB A;  4ILW A;  2EPB A;  3I3C A;  2JSO A;  2CW0 D;  3TP6 A;  1CI3 M;  1R4Q B;  4DFA A;  3M4Y A;  1KDA A;  2A73 B;  2G9H D;  2WAC A;  2EE1 A;  1PTO D;  1M8A A;  1EQT A;  2L11 A;  1GJX A;  4LMQ D;  4XQN A;  1FR3 A;  4KV6 A;  3HS0 C;  3BVM A;  5C3E B;  1Y1W B;  1DOK A;  3C3L A;  3IFD A;  2IW3 A;  2F0F A;  3K5L A;  2F03 A;  4C1N I;  4I65 A;  3P7J A;  1E0B A;  2N88 A;  3F2U A;  1PRT C;  1Y8P B;  5FLX E;  5C4Z A;  4FF4 A;  4DNR B;  3TDQ A;  5FOB B;  3HOZ B;  4K5X A;  3FRP B;  3MXU A;  4LAA A;  2ZXO A;  3ONA B;  2E2D C;  3WDN A;  4CHT B;  4R9W A;  1EOT A;  5FO9 B;  3FVQ A;  1IL8 A;  2DN8 A;  4DXG A;  1X3P A;  2EDG A;  1A3V A;  5LL6 X;  3H3V C;  1EU4 A;  4CGY B;  2EJG C;  1TS4 A;  4KKT A;  4Q5V A;  4DAP A;  2KA7 A;  3ND9 A;  4QF4 A;  1EQV A;  4B9X A;  4ZAI A;  1BUV T;  3KUP A;  4HCS A;  2R6G A;  3I4L A;  1F2Z A;  2F1M A;  1BOS A;  2F0I A;  4AYB B;  1IYU A;  4G7Z C;  2XWB B;  3J7Y W;  5JEA H;  4ZKB B;  1Z47 A;  5I4D A;  5CR3 A;  4IUU A;  1G91 A;  2PYK A;  3QOJ A;  2F3W A;  1D1I A;  2HDL A;  4A3I B;  1EIG A;  1X3Q A;  4C56 C;  3H91 A;  4C3I B;  1L0Y B;  1J9O A;  5JEA J;  2PNR C;  1O7L A;  5KND A;  2OEO A;  4X3U A;  3S16 B;  1KAA A;  3Q0A A;  5K36 G;  2NTT A;  5C6A A;  1WD1 A;  1BO0 A;  4A3F B;  1W6J A;  1HA6 A;  1HHV A;  3PIO 3;  3ERQ A;  4I7Z C;  3FPU B;  1PTO H;  3QO2 A;  2NN6 I;  2FMC A;  5CV5 A;  3OIP A;  1EWH A;  3G6J B;  3SVM A;  3NQT A;  3OOC A;  1STY A;  2D62 A;  2NYZ D;  1BNZ A;  1Z7T A;  3PUZ A;  3FEW X;  1BCP F;  2BCO A;  4IUP A;  3VR3 A;  4CJ2 C;  1JWS D;  4BY1 B;  1RCV D;  1IHZ A;  4X3K A;  5DNF A;  4A3E B;  3NUC A;  1FYC A;  2F0E A;  2A5H A;  2FJ2 A;  3Q24 A;  4O1N A;  4S3S A;  2PZU A;  1SE2 A;  1LLR D;  3CKI B;  3GV6 A;  2RDG A;  3S2H B;  4FF2 A;  4DXF A;  4OL7 A;  4H7B A;  2R92 B;  4EQN A;  4ULL A;  1FNV A;  1FD7 D;  3D8G A;  4RKL A;  2K04 A;  2A68 C;  4QUF A;  1SND A;  1PRT B;  3DXJ C;  2F0K A;  3S1N B;  4A3G B;  4XYO A;  1YNJ D;  1G2S A;  1CQV A;  1PYW D;  4XXE A;  3D4D A;  2K1B A;  2NB0 A;  3NTH A;  2YU9 B;  3K6O A;  1V8Q A;  3MVV A;  3LX0 A;  4N9P A;  2LS0 1;  3HRZ C;  2A6E C;  4IUV A;  2E76 C;  3E5S A;  2A69 D;  1BXT A;  1I4R A;  1WCM B;  2ICI A;  2HUG A;  2RBM A;  1WVL A;  2JP1 A;  1EZ6 A;  1NUC A;  3A56 A;  4IFD I;  4M1U B;  1RKN A;  3GTM B;  1XWE A;  2PQE A;  4IQZ A;  3DEP A;  2B2W A;  3DEO A;  2B8F A;  1KLU D;  2F0H A;  2F0D A;  2XIW A;  4FVM A;  4E6I A;  5COY A;  3BG3 A;  3SK8 A;  3DMU A;  1KNE A;  4G7H C;  4L8J A;  4MIU A;  3IAY A;  5C3W A;  1B3A A;  1A6X A;  4OHJ A;  1EZ8 A;  3TN2 A;  1OXV A;  2JEA I;  1JOQ A;  2RA4 A;  1JR0 D;  4RGM A;  1KAB A;  1DJR D;  1K8M A;  1F9S A;  2F4I A;  1RHP A;  2LKV A;  1SBB B;  1XYI A;  3M7G A;  4HMJ A;  4HTH A;  5KNB A;  3I73 A;  3P1H A;  2BDO A;  1O78 A;  2F0G A;  1CFM A;  2RDF A;  1Y69 U;  1SMY D;  2KEE A;  4CJ0 B;  5KEE A;  1U4M A;  4C3H G;  2O5I C;  2JA7 B;  1PTO F;  3TME A;  2PO4 A;  1BBX C;  4RGT A;  3GQB A;  1EY4 A;  2IX3 A;  2QEJ C;  3V05 A;  3QB3 A;  4X3S A;  2XVS A;  1F9P A;  1OXT A;  3UI2 A;  4L63 B;  3GTQ B;  3PUW A;  5EKI A;  5EJW A;  3X3M A;  1MSG A;  1RDP D;  2O5J C;  5EBC A;  1QCB D;  5A2Q L;  3A8J E;  4F7X A;  1G6Z A;  2SOB A;  2MUY A;  2JE6 I;  2RSN A;  3SE0 A;  5JJZ A;  2NN6 H;  1IKL A;  2XWJ B;  4BBR B;  5IGD A;  1IW7 C;  1LT5 D;  3HG9 A;  1SDF A;  1PFB A;  2HCC A;  2KCN A;  2KVM A;  5G3L F;  1KDC A;  3K5M A;  2WKD A;  4ZYS A;  1CA6 A;  2LFN A;  2B2Y A;  2VB2 X;  3EVQ A;  1H9S B;  3HGB A;  3CRK C;  3W2D A;  2BE5 D;  4A3D B;  1SNM A;  3HEJ A;  4WOR A;  4QB4 A;  2C5C A;  1PMR A;  4ZK9 B;  3QOL A;  4ODG A;  2PZT A;  3AMU A;  3H09 A;  5KNC A;  3KK7 A;  1STA A;  2DNC A;  2K7V A;  1F77 A;  2EZV A;  4ZQ3 A;  2E2H B;  5ISR A;  1B4O A;  1GUT A;  4GZY C;  5T1I A;  1AZP A;  3NTI A;  1ZXT A;  2NWG A;  3V2T A;  1C8C A;  2NUC A;  3S2D B;  4H13 C;  1ET9 A;  3L3O C;  2EYJ A;  2AQ3 B;  2JA6 B;  4KKU A;  5FO8 B;  3GV3 A;  3OPO A;  1DYQ A;  4PMB A;  2LMC B;  3NP8 A;  2WIN B;  3AU7 A;  1QIL A;  2B2U C;  3I4N B;  1EIH A;  4HED A;  1DM0 B;  3KBG A;  2MJ8 A;  5E4W C;  1FNU A;  1QG7 A;  3BVG A;  4FXK C;  5K5P A;  4IFD H;  4QIW B;  1B9N A;  2J4X A;  1CZW A;  5CBE E;  1I3Q B;  1CZG A;  4YIJ A;  4CKB A;  4OO1 G;  3J7A V;  3K58 A;  3T13 A;  3GP7 A;  5HUR A;  1CT1 D;  5J39 A;  4M8A A;  4RAU C;  1V1O A;  5C4J B;  2GA4 B;  5KYL A;  3CQZ B;  4K2K A;  4IFD J;  1EYC A;  3MZ5 A;  4NMZ A;  1LTG D;  4JBW A;  3QWN A;  2YYZ A;  1EEI D;  1I6V C;  2SNM A;  1ENA A;  3TBI B;  4K14 A;  3JAM L;  4C3H B;  4J1M A;  3HOX B;  1Y8N B;  1HFN A;  5FK9 C;  2L1B A;  1F2L A;  5M9O A;  2ENB A;  3S9W A;  4JK1 C;  4PMW A;  3VA7 A;  3NWT A;  3KF8 A;  1H9S A;  2RSO A;  3ERO A;  4K2L A;  5D65 A;  3HOW B;  3TZU A;  2FHT A;  1EL0 A;  3FMC A;  4A3M B;  3N52 A;  1YNN D;  1SYE A;  2F0V A;  3A55 A;  2JA8 B;  3DUZ A;  2FIN B;  5LL6 S;  3NXW A;  1SE3 A;  3OSO A;  3A8K E;  1O80 A;  1BDO A;  4LK1 C;  1HRJ A;  3NBH A;  2OF1 A;  1B9M A;  3GTJ B;  4HAE A;  3P75 A;  3BDO A;  3KBX A;  2IT1 A;  1X32 A;  1STN A;  2F3V A;  5EPL A;  1MD2 D;  5IT9 E;  1WTO A;  1GHJ A;  3QIA A;  1Q90 A;  2WB1 B;  1Q8I A;  1TWG B;  1TR5 A;  5JOB A;  1RF2 D;  5FKA C;  2O2L D;  2SEB D;  3HOY B;  3A7A B;  3C1E A;  4NDX A;  5EKK A;  1F2M A;  4G7O C;  2F0N A;  2IWH A;  4U68 A;  1PZJ D;  3C46 A;  2ID0 A;  5KGU A;  4EQO A;  1NSN S;  3X3N A;  5IGB A;  4IN3 A;  4WRD A;  3VA5 A;  4ZRZ A;  3EQL C;  2EJM A;  2CVR A;  4KHV A;  2HDM A;  2F0U A;  5D3I B;  1ZYR D;  5IGE A;  3NBI A;  4XYQ A;  2X6G A;  5ELE A;  5M5W B;  1D5X C;  1BCP C;  3OWE B;  4HCE A;  1I6H B;  3OMC A;  3SXH A;  2MP1 A;  3D4R A;  3SK6 A;  2FFK B;  5IGF A;  1EYA A;  5D14 A;  3SDZ A;  4QCL A;  1S5C D;  3PUX A;  2RQX A;  4G57 A;  1OXS C;  4EVO A;  3FKI B;  1PXU A;  3EJI A;  1JB3 A;  2AUK A;  2F0P A;  2F0Q A;  3EFX D;  2KQ3 A;  4IUQ A;  2I46 A;  1G29 1;  3K5O A;  1UEA B;  4O42 A;  1GUO A;  1JOO A;  5DM7 3;  1QWY A;  3VR6 A;  4A93 B;  2TMP A;  2A6H C;  1H9M A;  3OMG A;  3RD4 A;  1RD9 D;  1D5M C;  4PMC A;  5KIX A;  3RLF A;  4UDU C;  1O7Y A;  5CBA E;  4KN7 C;  2BA1 A;  4KN4 C;  2R61 A;  1ZKO A;  4RWS C;  1OO9 B;  5J22 A;  1LT4 D;  1TU2 B;  3U9O A;  1V43 A;  2C9O A;  2B2V A;  1H9J A;  2F0T A;  1F9Q A;  3GTK B;  2E2I B;  1SAP A;  3K7A B;  3FDT A;  2B2T A;  4U67 3;  1HCZ A;  2ICE C;  4DK0 A;  4OIK A;  1Y1V B;  3M4O B;  5ELB A;  5JEA G;  1DOM A;  1II3 A;  3RZD B;  1R9T B;  1QB5 D;  4J8Q A;  4K8I A;  1AZQ A;  1E2V A;  3BDC A;  2E75 C;  1EYD A;  4BS9 A;  3K5N A;  2K32 A;  1WTV A;  1LT3 D;  3C1F A;  2ZXP A;  1F9R A;  3EA6 A;  4FO2 A;  2CQA A;  2RDH A;  3KLS X;  1B53 A;  2AWN A;  1CM9 A;  1NAP A;  4KHZ A;  1PFN A;  4F88 A;  3TP7 A;  1JOR A;  2B63 B;  3T16 A;  2B2U A;  3S15 B;  2KHS A;  1C48 A;  3HZX A;  2EYF A;  4HMI A;  4V0B A;  4NP5 A;  2SNS A;  1JQY D;  1ROD A;  1GUN A;  2CW0 C;  5I9O A;  2EYP A;  3BDL A;  4OIJ A;  4DA2 A;  1WD0 A;  2R3Z A;  3R3O A;  3GO5 A;  2RKS A;  4DN4 M;  2K28 A;  2XNA C;  1UAP A;  1PLF A;  1SNP A;  1PTO C;  5CV6 A;  3HOV B;  1VDZ A;  4KMU C;  5A35 A;  4TSS A;  5BN5 A;  2EY6 A;  3I91 A;  2Z8L A;  3J81 L;  2L4N A;  4K5W A;  5CGK A;  4DF7 A;  3E0J A;  1PRT D;  3M3Y B;  1MSH A;  1AEX A;  1DD2 A;  3MEH A;  4FNF A;  4BY7 B;  3MFG A;  1I50 B;  3MTS A;  4A3K B;  3GTG B;  2DNE A;  2DY7 A;  3H6M A;  2L0C A;  1D2B A;  1TKW B;  1B44 D;  2EYL A;  1CHQ D;  5JPN C;  4K8J A;  3PO2 B;  3Q6S A;  3Q23 A;  5COR A;  3T4A C;  2J7Z A;  1Q1B A;  2K03 A;  5DAU A;  1ILP A;  5C4H A;  1QE6 A;  2Z4H A;  3I8Z A;  1LAC A;  5BN4 A;  1ML0 D;  1GXD C;  2VUM B;  3S1Q B;  1LT6 D;  2K05 A;  4B9W A;  3BYT B;  1S4Z A;  3BS1 A;  3VR2 A;  3FPP A;  2EY2 A;  1VMC A;  3VR4 A;  1MI2 A;  2HQE A;  2I07 B;  1Q12 A;  3OIQ A;  1SYC A;  3R2I A;  2QIL A;  2F0W A;  4Z9C B;  4NW2 A;  4KJN A;  1AW7 A;  2K6A A;  2E74 C;  3TSS A;  3D3R A;  5CV9 A;  4KY7 A;  1JC7 A;  1SJE D;  2AUJ D;  2EJF C;  1I4H A;  4DAV A;  3M85 A;  5EPK A;  1PFM A;  4N9T A;  2IPK D;  2QF7 A;  3E6Z X;  3O13 A;  1TS3 A;  5C0X H;  1STG A;  1WTR A;  5JPM C;  2J0T D;  2L5T A;  3VYS A;  3L7Z C;  1A3U A;  1BF4 A;  1EU3 A;  1EY9 A;  3P20 A;  1ICW A;  1HPC A;  3S14 B;  2F0O A;  5ELF A;  2PW7 A;  3BZD B;  5C0X J;  1TQO A;  1GUW A;  3H94 A;  4KKS A;  4RCO A;  5EKL A;  4C2M B;  5E4X A;  1DXM A;  1MBY A;  1PTO B;  2JYO A;  5KYI A;  1TS5 A;  1AFP A;  4IZ8 A;  1TWC B;  3VYU A;  5FLX L;  4BA2 I;  1M4V A;  1OXU A;  1DON A;  2K01 A;  2A68 D;  1L0X B;  5IOC A;  1D1K A;  5I2Y A;  1CQF A;  1EY7 A;  1J8I A;  3GTO B;  5DEH A;  2V4D A;  5M5Y B;  4UAI A;  2KJX A;  3D31 A;  2OXP A;  3V96 A;  4EQP A;  1SNO A;  1H9K A;  1ILQ A;  3T53 B;  1G2T A;  1RTN A;  4TRD A;  3NSW A;  5FO7 B;  4XT1 B;  2NN6 G;  1YNJ C;  3ND8 A;  4RHR A;  4IUT A;  3HKZ B;  5A2Q E;  2XN9 C;  3G7L A;  1TWF B;  3A54 A;  2AQ1 B;  1EWC A;  1NR2 A;  4QMG A;  3K59 A;  2D5D A;  2B2W C;  1JIC A;  5EGT A;  1GUS A;  3D4W A;  2A69 C;  3MWY W;  3SR1 A;  3NQI A;  3OWF A;  4G4K A;  3ZYY X;  4HSP A;  3PO3 B;  2MHV A;  2WP8 J;  4KY5 A;  3J80 L;  4CJ1 B;  1S5E D;  3T56 B;  1Q3L A;  5LHY 1;  2Y0S B;  1H9R A;  2AWO A;  1ESR A;  2ZXR A;  1TVX A;  4TKO B;  3PUY A;  1I4X A;  1HFG A;  2L9H A;  2BDN A;  1QNK A;  4BBS B;  1Y8O B;  3LWU A;  4IAL A;  3DM1 A;  2H1E A;  3IKJ A;  2K5W A;  2JXM B;  4PNY A;  5EBD A;  3TP8 A;  1TWH B;  4C3J G;  1HQR D;  1SE4 A;  4XT3 B;  1ESF A;  4ABN A;  5D3D A;  5K36 H;  2X6L A;  2N55 A;  2G9D A;  3PV0 A;  4ZUJ A;  1ENC A;  4NKL A;  5IGC A;  1D6E C;  1HTL D;  3PMF A;  1VF7 A;  4A3J B;  4IFD G;  3DWQ A;  3H0G B;  3MA2 B;  4XIG S;  1HA5 A;  3MHB A;  3K57 A;  1PDQ A;  1KNA A;  1FGB D;  1GOZ A;  1O7Z A;  2BOS A;  4CBV A;  2NTS A;  1WTP A;  1VMP A;  3CU7 A;  3MXP A;  1SMY C;  2JA5 B;  3LNN A;  4Y7N B;  3A8I E;  4ZUI A;  1U4P A;  1Z6H A;  2K5D A;  1KLG D;  1JWM D;  1ENF A;  5TSS A;  2FMM A;  5CYU A;  1BQQ T;  4RH6 A;  2RVL A;  1LTS D;  3NHH A;  2EVB A;  5G3L D;  1VF5 C;  4L6T B;  1PRT F;  2D9U A;  3NPP A;  1V1P B;  3BVZ A;  3NE5 B;  5EQ0 A;  4MN3 A;  3WOE A;  2Q8I B;  2NVT B;  1SYB A;  5BN3 A;  1GUG A;  3GD7 A;  2D2C C;  4KD3 A;  3R2T A;  1LTA D;  3J7A F;  1A2U A;  5KRU A;  2HCI A;  1QNU A;  5E1F A;  3JAM E;  1C4Q A;  3S1M B;  1SEB D;  1JOK A;  3J80 E;  1IW7 D;  2B2Y C;  4DGZ A;  2PPB C;  5I6W A;  1SNC A;  2A74 C;  2NVY B;  5C4X B;  3VYT A;  4DAY A;  2KCC A;  1NR4 A;  3IL8 A;  2QDB A;  3CHB D;  2Q8T A;  2F0M A;  1PZI D;  4HR7 B;  3URY A;  1XXG A;  4LJZ C;  3AB9 A;  4F87 A;  1VCI A;  2EXZ A;  5F2D A;  3I90 A;  5IIF A;  4RFB A;  1UUP A;  3PUV A;  4CKC A;  5C5M A;  2B39 A;  4ID6 A;  2PMZ B;  1DCZ A;  4OO1 I;  4C1N K;  3VR5 A;  5DM6 3;  2VNU D;  5C0X I;  2BE5 C;  3MXN A;  1EEF D;  4DNT B;  4KI0 A;  1STE A;  4KD4 A;  1G8Z D;  1HUM A;  1FNW A;  3N6R A;  2ZT9 C;  4QUC A;  2PZW A;  5CV4 A;  1EY6 A;  4A3B B;  2NVX B;  1ONL A;  2R93 B;  3Q22 A;  1AP0 A;  4EGV A;  5M3M B;  3NK9 A;  5JVH 3;  2M9V A;  2DY8 A;  4HSV A;  1EY0 A;  3TZD A;  1GHK A;  4KTA A;  2WV6 D;  1TY0 A;  4XDX A;  3D6C A;  4RCN A;  4HN7 A;  3RUZ A;  1JWU D;  2K5Q A;  3W3A A;  5ELD A;  1EY5 A;  2NBF A;  4FXG C;  4V19 0;  3GTP B;  2EY5 A;  4R8I A;  3OW7 A;  1S5B D;  5AFW A;  2R7Z B;  1V1P A;  4C3J B;  5C44 B;  3HOU B;  1SYG A;  1KTK A;  5JAV A;  4RGN A;  1ET6 A;  4K6L A;  3GTL B;  2EYM A;  4FXD A;  3SK5 A;  4CKE A;  3DHQ A;  5M3F B;  1I4G A;  1B50 A;  2XRQ D;  2EYH A;  1SXT A;  1B1Z A;  5HGT A;  1S5F D;  3MC0 B;  3PIP 3;  2KED A;  5CV8 A;  4FF3 A;  4PQX A;  3I4M B;  1F2Y A;  2WKC A;  4F8M A;  1E2Z A;  5CC4 A;  1JE4 A;  1BCP B;  2SDF A;  3MXG A;  3RZO B;  3CRL C;  3KLR A;  3IFT A;  2IJ0 A;  1WTW A;  1Q1E A;  2XRS D;  1T5X D;  2EYO A;  4OGQ C;  2E2J B;  3L9A X;  1K83 B;  2F0L A;  5IGG A;  3QJY A;  4XQJ A;  3NTK A;  3MFY A;  1YNN C;  1K8O A;  1TT2 A;  2Z4I A;  4K5V A;  1TY2 A;  3TP5 A;  1CTM A;  2K33 A;  1R4P B;  4FYD A;  4XTC S;  1S5D D;  2O4X A;  5ELC A;  3T51 B;  1RTO A;  1SFO B;  1U9R A;  1E2W A;  1U4R A;  4MHE A;  4IUR A;  2QCP X;  5EPJ A;  2VB3 X;  2KEC A;  1EY8 A;  3R8B A;  4H44 C;  1MGS A;  1SSO A;  3WOF A;  4XQQ A;  5T1G A;  4H0L C;  4ME5 A;  4FP5 D;  4K6D A;  3M7N A;  2X69 A;  4IUN A;  2KUM A;  1PZK D;  4P2C B;  1WTQ A;  1XX8 A;  2MPM A;  5M5X B;  2EY1 A;  1HTP A;  5C3X A;  2IL8 A;  3RMH A;  1D5Z C;  1OXX K;  4KK7 A;  1STH A;  1AN8 A;  4Q0F A;  5CMD A;  3OHX C;  3S1R B;  5I9P A;  2BA0 A;  1BCP D;  3DWA A;  4RGO S;  4DU9 A;  2EOT A;  1SNQ A;  4FF1 A;  3ITP A;  1DOL A;  4B08 A;  1ZYR C;  4KJO A;  1A3T A;  2MGS A;  2PCF B;  1DZ1 A;  1LTB D;  2NVQ B;  4X3T A;  1BR9 A;  2PW5 A;  3LWE A;  1W6K A;  1STB A;  1IYV A;  1CA5 A;  4OO1 H;  1EFI D;  5CV7 A;  1IKM A;  1HQM C;  3R93 A;  1LTT D;  3NWS A;  1T5E A;  1TS2 A;  3S17 B;  3U9S A;  2Q8R E;  1TWA B;  3J81 E;  1HXY D;  1U4L A;  5E3F A;  2L12 A;  2H4O A;  1WTX A;  1SJH D;  4RHS A;  3C2P A;  2A6H D;  1LTR D;  1RJT A;  1LAB A;  2B2V C;  1XTC D;  4PV1 C;  3I70 A;  1UNS A;  1SYD A;  4TQU S;  4BWG B;  3KLS A;  2B2T C;  4WFN 3;  1TII D;  4KY6 A;  1KDB A;  1HUN A;  4ZLT F;  2QKI C;  4J6H A;  5JVG 3;  1QOH A;  2XSC A;  3QG1 A;  3SK4 A;  2L55 A;  2IX1 A;  5IOD A;  5C5L A;  4R8N A;  1ZEQ X;  5I6Y A;  2F0J A;  4C3I G;  1NCV A;  3HP3 A;  2AQ2 B;  2WAQ B;  3K0Y A;  4DK1 A;  1LO5 D;  2M2L A;  5IT9 L;  2B8G A;  1A2T A;  2JEB I;  5NUC A;  2TSS A;  2VXW A;  2OT2 A;  3I72 A;  2M00 A;  2KOL A;  3SHL A;  2WII B;  2A6E D;  2F0S A;  5I2X A;  4WJW A;  1LV9 A;  2LY7 A;  4RKB A;  1CHP D;  3DWP A;  1A15 A;  2Z1C A;  4ZKC B;  1B2T A;  1QJO A;  3A7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...