5AFWA

Assembly of methylated lsd1 and chd1 drives ar-dependent transcription and translocation
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
174
structure length
163
Chain Sequence
EFETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQYLIKWKGWSHIHNTWETEETLKQQNVRGMKKLDNYKKKDQETKRWYNCQQELTDDLHKQYQIVERIIAHSNQKSAAGYPDYYCKWQGLPYSECSWEDGALISKKFQACIDEYFSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Assembly of Methylated Kdm1A and Chd1 Drives Androgen Receptor-Dependent Transcription and Translocation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords CHROMODOMAIN-HELICASE-DNA-BINDING PROTEIN 1
total genus 49
structure length 163
sequence length 174
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5afwA02
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5afwA01
4ZKCB 2B2VC 1RTNA 2KUMA 4LMQD 1WD1A 1WTRA 5EPLA 1ZXTA 4RA8A 2K03A 2L11A 3MTSA 4X3KA 4NW2A 2B2WA 4ZK9B 2HUGA 2MP1A 1HUMA 1PFMA 3D6WA 4IUQA 4R8IA 3IL8A 1BO0A 1G6ZA 1PFBA 2DY8A 1A15A 1PDQA 2MGSA 1IKMA 2N55A 1DONA 1DZ1A 1B53A 2K04A 4MN3A 1O80A 1PLFA 3DM1A 2J7ZA 1HUNA 3HP3A 1Q3LA 1RTOA 2R3ZA 1IKLA 3MWYW 1WTPA 3UI2A 3FPUB 5COYA 1G91A 3R93A 1F9RA 1IL8A 5EKIA 2D9UA 1ICWA 2KEEA 5D65A 1QE6A 4DN4M 2HCCA 3I8ZA 2NZ1D 1U4LA 2VXWA 2B2UC 3GV6A 3ONAB 1J8IA 1SSOA 4OIJA 1WTXA 4OIKA 2KECA 1EL0A 1PFNA 2B2YC 4ZAIA 1BNZA 2IL8A 1JICA 1F9QA 1WTOA 1MI2A 2K01A 2HCIA 3KBXA 1B4OA 1QG7A 1CM9A 2JYOA 1RHPA 2L4NA 1EIHA 5T1IA 1WTQA 1KNEA 2FHTA 1EIGA 1DOKA 2Q8RE 1O7ZA 1B50A 1F2LA 4R9WA 4QUFA 4HCSA 4XT3B 2EOTA 5CBEE 1LV9A 1GUWA 2X6GA 1U4PA 5EPKA 5CORA 4O42A 1C8CA 2HDMA 1MSHA 1AP0A 1G2TA 1X3QA 1ESRA 2RSOA 2XIWA 3FDTA 3I3CA 1KNAA 3I91A 5AFWA 4CJ1B 3SVMA 4ZKBB 1WD0A 1HFGA 2NWGA 4HAEA 2B2VA 1U4MA 2B2WC 2FMMA 2HDLA 2RA4A 4IUUA 4RWSC 5E4XA 1G2SA 3I90A 1E0BA 4IUPA 4MHEA 1CA5A 5DNFA 2MPMA 1X32A 3KUPA 1MGSA 1BF4A 2FJ2A 2N88A 4U68A 1DOLA 2M2LA 1NR2A 3Q6SA 2FINB 3TN2A 1AZQA 1M8AA 1VMPA 1O7YA 3LWEA 1B3AA 2BDNA 2K1BA 3G7LA 1U4RA 2L9HA 1X3PA 1XX8A 1WTVA 2L12A 1MSGA 1F9SA 5EJWA 1F9PA 5CBAE 3F2UA 4IUTA 4XDXA 1RJTA 4RAUC 1HA6A 2KEDA 1SAPA 4QUCA 4X3SA 1WVLA 2B2YA 3DEPA 5JJZA 2EPBA 3DEOA 1DOMA 1J9OA 2K28A 2RSNA 5E4WC 3IFDA 1HHVA 3N52A 1QNKA 2X6LA 4IUVA 5T1GA 2B2UA 1RODA 4HSVA 1EOTA 2DY7A 2KVMA 5EPJA 1B2TA 1EQTA 4UAIA 2FFKB 2SDFA 1BBXC 2EE1A 3P7JA 3H91A 1HRJA 3GV3A 2X69A 1ILPA 1ML0D 1WTWA 4X3TA 1NAPA 4ZLTF 1VMCA 4IURA 4CJ2C 1XYIA 2CVRA 2RVLA 2B2TA 1NR4A 4HEDA 5EQ0A 3TZDA 1HFNA 1TVXA 1NCVA 4X3UA 2B2TC 1JE4A 2JP1A 2NYZD 1ILQA 3QO2A 2H1EA 1AZPA 2KOLA 2L1BA 2K05A 4XT1B 5D14A 4CJ0B 1S4ZA 2Q8TA 1SDFA 5CMDA 2MJ8A 1CA6A
chains in the Genus database with same CATH superfamily
2N8NA 4HR7B 3SDZA 2R7ZB 3S1NH 4ZK9B 4C3IG 5GAHC 1PFMA 1QB5D 3A8KE 1LTAD 1Y1WH 3T56B 3T1HL 2EXDA 4LFBL 4PV1C 4B3TQ 5EKIA 3NBHB 3OOCA 1S5BD 4N8X1 3G6JB 4DUYL 1Q1BA 1UEBA 1VS0A 2NZHA 3ND8A 3U9SA 5G3LD 2EYPA 5FLXc 4CDFC 5M3MH 1X56A 1QJOA 1K9MC 1F9QA 3HOXB 1LT5D 4DAYB 1JOQA 4B9WA 3SK5A 2F4VL 4DR1Q 1KHIA 1O7ZA 5I2YA 5AJ3L 4FO2A 3CCJA 1J6QA 4P71A 2VQEQ 2Q2HA 1E24A 1E3PA 4RMFA 4LF8L 3KLRA 4A3DH 3Q0AA 2NVYH 4KKTA 2HIXA 3VYTA 4YY3Q 4LF4L 3I3CA 2EXZA 5J1ZA 4EQNA 1PH6A 4K8IA 1PHJA 4ZKBB 4KMUC 4BXXG 3P75A 5M5YB 1U4MA 3HOUH 2B63G 1XXGA 3T51B 3TBIB 1LTTD 1JB7A 3B6YA 2EYJA 4NPSA 4C1NI 2CH4W 2Q2TA 2FJ2A 1KLGD 4U68A 3I56A 5K36H 1F2MA 2FINB 1YVCA 2JN4A 1SE2A 4CBVA 3MFGA 1ET6A 5IT9c 1U4RA 1VQ8A 3GTKB 3M7GA 4FDBA 1CSQA 3PO2H 2F0DA 4DV5Q 1MJCA 1EEFD 3M85A 2ICIA 2VS1A 2B2YA 1J9OA 2I5LX 1O7LA 3Q22A 1TT2A 4LFCL 2XN9C 3AYHB 1ZKOA 1RODA 1OXSC 1B2TA 3MVVA 1QNUA 4BY7B 3K81C 5JJKA 1N34L 2X69A 2R93G 2F3WA 2QGQA 4JI4L 2K4KA 3H0GH 1VCIA 3RLOA 3OSOA 3I4MB 3GTOH 1PH2A 1CQFA 4TVAB 5I9PA 3J81E 2CW0C 2NYZD 1UE5A 1Z7TA 3UDGA 3NUCA 3BVGA 1NMGA 2AWOA 5J39A 4JCVE 4YIJA 5FJ8G 3H6MA 5C4XH 2NZOA 1W6JA 1HUMA 1AFPA 4XIGS 2LKVA 3S1QB 1SJED 4DV7L 3SK6A 5LL6S 5BN4A 4LF8Q 2J7ZA 1WI5A 5AJ3Q 1NY4A 4QGUA 1SN8A 2RHSB 3S16H 4BA2I 4KLKA 1GVPA 1EYDA 3I7FA 1YJ9A 3TP5A 1BKBA 4ZAIA 1UE7A 3FVQA 2HCIA 1TWCB 1GO3E 3OWEB 3C2PA 4HMJA 4B3TL 3NSWA 4X62Q 4R4CA 3AMUA 4DV2L 3PUXA 1GUWA 4CDCC 4RKBA 2SNMA 4HIOA 5CORA 1MBYA 4OO1I 2PCFB 2K7VA 4OWWB 3CMEA 1HFGA 3GTKH 2B2WC 4AYBE 2BA1A 3A74A 1X32A 2Z9HA 2IJ0A 1FL0A 1DOLA 1NE3A 4AQYL 3BVMA 1AZQA 5IWAQ 3HOXG 2KHJA 3S15B 2ZM6L 1LT4D 1GUNA 3IKJA 1SFOB 2IHFA 1MSGA 4IPGA 5LL6X 2I0QA 3DMUA 3G48A 2WACA 4GN3B 2K5HA 4B08A 1UUPA 2NVYB 2OQ0A 3STBD 2X6LA 5JEAG 4IUVA 4IOCA 2R93B 3NTHA 4HSVA 4IPHA 1EQTA 1KD1C 3OTOQ 1QILA 3RLFA 4KY7A 2L15A 4A3KB 3I4MG 2EIFA 2NTTA 4L5RC 4DAVA 3SGIA 3HOXH 2WIIB 2BE5C 2J4XA 2DGYA 5I6WA 5KNBA 4L63B 1IW7D 5C6AA 5C44B 1VQ7A 2L1BA 3BYYB 1K8MA 3QG1A 5CMDA 3I4NG 3GTLH 1U9RA 2B2VC 3UDXA 2KUMA 1TY2A 4IFDJ 1JJ2A 3AQQA 4O2DA 3MC0B 4NW2A 2E5LL 2EVBA 3D6WA 5EBDA 2ATWA 4DK1A 1QUQA 2LFNA 1PVOA 1PDQA 2CQOA 4YHHL 2RHQB 4RGMA 1V43A 2XGTA 5ELBA 3D4WA 2R7ZH 2DN8A 1HJPA 3T1YQ 2YTXA 4FVMA 1UWVA 5E7NA 1BVSA 2F0GA 2P5ZX 5LMNQ 1H9JA 1CZWA 5JOBA 4XQNA 1D5ZC 1HNXQ 2B2UC 4YCWA 1KDBA 3CAMA 3PUZA 2WKCA 1XMQQ 1S40A 1VQFA 4OX9L 1GUSA 2KECA 2HT1A 1HZAA 2B2YC 1S3OA 4JBJA 1TU2B 3U58A 4ALPA 3NEMA 1XNQL 4DV4Q 4DV3L 4K6LA 5T1IA 1KNEA 5CV9A 2FHTA 5JPMC 4JI2L 1XNRQ 2IX1A 3IFTA 1YI2A 1B50A 1PXUA 4KD4A 3GTGB 1GHJA 5EAYA 4X64Q 1DJRD 3DHQA 1D5MC 1A3TA 2WKDA 1PH3A 1XPOA 3M4YA 4QF4A 1TXYA 3M4OB 1K0SA 4K8JA 2O5JC 1TS3A 1WD0A 1VQPA 2NWGA 2VW9A 3KLSA 3S1MB 1XTCD 3S2DH 2B63H 2HHHQ 3MXNB 3T1YL 4KN7C 5HURA 3HOWG 4OGQC 3RZOH 2F4IA 3S2HH 4K5XA 4A3EG 3F2UA 4WJWA 2ID0A 3CRKC 5J22A 3NPPA 3HOVG 4MNOA 3MFYA 1TWGH 1HPCA 3KFUA 2K5VA 3PGZA 1STGA 2G9HD 1PRTB 3VR3A 5LHY1 3CCQA 1C4QA 1YJNA 4JI0L 3K7AB 3J81L 4JC0A 2A68C 1J5EQ 2ENBA 2ICEC 3HOWH 2WB1B 2FMCA 4RCNA 2OTJA 2Z4HA 1JWUD 2EY2A 4N9TA 4DNIA 2BDOA 2XRSD 1DM0B 4IJHA 4NB3A 1E1TA 5C4HA 2RCNA 1OXUA 1VQDA 1S4ZA 3Q8DA 2Q8TA 4ZKCB 3J7AV 1M90C 5EPLA 1X6OA 1BDOA 3K7UC 4A3GB 3I72A 5JEAJ 2M00A 3GTQB 4M1UB 3FHWA 4KHPL 4A3FG 4BY1B 5C4JH 2DY8A 1IKMA 4LW1A 1BQQT 4PG3A 3OWFA 4F8MA 3JAMi 4UP7A 3HP3A 3MWYW 3ND9A 4POFA 4A3MH 3E9HA 3H3VH 3FKIH 3MEFA 4CKCA 2HD3A 3JC66 2H4OA 4J15A 3HKZB 1BCPD 4C3IH 1EWIA 4DPGA 3K58A 4IPCA 1GJXA 1GOZA 4A3CG 3UDIA 4FF4A 4P75A 3BDOA 4HCSA 4XT3B 4DUZQ 4JI7Q 3KDFA 4I65A 3MXNA 4XYQA 3FDTA 5EBCA 4A93G 2BH8A 2A5HA 2F0NA 1FNWA 1S5DD 5E4XA 4MHEA 2F0IA 1MIUA 2MPMA 1T5XD 1ASYA 4IFDG 1Y14B 3KF8A 2B63B 1C0AA 2LXKA 2Z8LA 1IYJB 1VMPA 2E2IB 3F2CA 1EOVA 2PQAB 2KENA 2V4DA 1EY5A 2UU9L 3S14H 4DNTB 2D0PA 1Y8NB 1PH4A 4OL7A 4QUCA 1HTPA 1SE8A 4BBRB 3HOVB 1HA5A 3UDFA 2UUCQ 3CRLC 2WB1G 2B8FA 4UAIA 1X3GA 3H0GG 2ZTDA 2WAQG 3D4RA 3WOEA 1QVCA 1W6KA 2KBNA 5KNDA 4YWLA 4HEDA 1LABA 5M3MB 4RFBA 1B1ZA 3FKIB 1II3A 4ZUIA 5IYBG 1AZPA 2DJFC 2K05A 1W3SA 2ZJPA 4LF9L 4DUYQ 1SDFA 1VQGA 1WD1A 1B9MA 3QIAA 3TSSA 2K03A 2L11A 5BR8Q 3MTSA 2PZUA 5IT9L 2B29A 3VR5A 2NVXH 1P16A 2F0FA 1PH5A 4BY1H 4GNXB 3IL8A 5CV5A 2N55A 4A3GH 4C3JG 1K83B 4M8AA 2K04A 5J3BA 2MO1A 1UNSA 1XYIA 1Z9FA 2VUMH 3GTLB 1XMOL 3KJPA 1HZCA 2QDBA 3R3OA 2QEJC 4BS9A 1OO9B 4E6IA 3S9WA 3I70A 1EIYB 2L0CA 2B3GA 4A3GG 1PYSB 5JAVA 2NN6H 3U4ZA 1LV9A 5LMUL 2KCMA 1DXMA 1ESFA 1BUVT 4IPDA 2PW5A 1QUQB 1WTHA 2F4VQ 3HOVH 4A3BH 1I50B 3J7ZC 4DA2A 4B9XA 4JI1L 4K0KQ 1L1OB 4HN7A 1YZ6A 4N8FA 4RGTA 2OEOA 5DNFA 5FJ8H 3A56A 2BOSA 2ZXPA 3ICEA 1KRTA 1RDPD 2RCFA 1D2BA 1GKHA 3J80L 1KDAA 2KHIA 2E8GA 2F0UA 2XNAC 1IZ6A 3ERSX 1S5FD 2VNUD 4IUTA 2XVSA 2AQ3B 1SNMA 4HJ7A 1GUTA 4A3EB 2UU9Q 4GNXA 1EZ6A 4RGNA 1HNZQ 1L1OC 5BR8L 3U50C 3HOZG 1R9TB 1IHZA 1EOTA 1EY6A 2R7DA 4K2KA 1KAAA 3LNNA 3I4LA 2NB0A 3DWAA 2CHBD 4ZRZA 1EEID 1X54A 4A3FB 3L7ZC 4CKBA 1CKOA 1STYA 2WAQB 5KYLA 4BBSB 1WOCA 3K6OA 4KN4C 2TSSA 4KKUA 4XXEA 1I6VC 2JP1A 2PNRC 3PUVA 1YBYA 4DFAA 3RZDB 4AH6A 1TQOA 4JI7L 2WP8J 1CA6A 4C2MB 4H44C 5TSSA 2UUCL 2IX3A 2Q2UA 3D6CA 2VQFQ 4S3SA 3PO3B 5C4JB 1MKHA 3QJYA 4IJLA 1SYGA 3LWUA 1XPUA 3H09A 3GTPH 1LT6D 1LTGD 4K14A 5COYA 1G91A 3W2DA 1F9RA 3K57A 2UUBL 1EQRA 4L6TB 1VQ5A 4CDEC 3T13A 3KBGA 1VQJA 2NZ1D 2A19A 1H9RA 4QB4A 4BBSH 3HOWB 4DAMA 4JI3Q 2F0EA 4I7ZC 3K7AH 3KDFB 1L2FA 1VQ4A 1KL9A 2A68D 4F88A 1U4PA 1A2TA 2OQKA 4J8QA 2OXPA 4IFDI 3H94A 1G291 5ELCA 1G2TA 1CK1A 2DNEA 2JEBI 2WINB 4HCEA 1Z47A 3E3XA 3T16A 1HNWL 2FMMA 1G2SA 3I90A 5D3DA 2G5DA 3DM3A 3GTJB 1EYAA 3HKZG 3Q6SA 4GKKQ 1TY0A 3HFZB 3RN5A 3MAQA 2GVAA 2LSSA 1CUKA 1JWSD 3KLWA 1EU4A 3OMCA 4JI8L 1QZGA 5FKAC 2MQHA 3DEPA 4YWKA 1HHVA 1QNKA 2UUAQ 3HRZC 2QILA 4DV0Q 1CT1D 3CC2A 2UXBQ 1FJGL 4BY1G 2Z4IA 1CZGA 4A3LH 2CKZB 4MZ9A 2QCPX 1KDCA 3OHXC 2UXCL 4KHPQ 4HJAA 4O1NA 4LNQA 3VR6A 1FGBD 3BDCA 4F7XA 3GQBA 3I73A 3HEJA 3I55A 4FF3A 4KJOA 2NVTH 5CV7A 1AE3A 2H1EA 5D14A 1VQNA 1K8AC 2ZXRA 4DR5L 3EFXD 3VR2A 3URYA 4ABNA 3L9AX 5A2QL 1PRTF 3ZYYX 1VDZA 2D62A 2HUGA 3UE0A 1G6ZA 3G4SA 2E75C 4DR7L 1BR9A 2EQSA 4JK1C 4A3KG 1PZID 5C4XB 1PLFA 2F0HA 3DM1A 4P2CB 3TS2A 1E2VA 1IKLA 4DR3L 3SXHA 3NTIA 5IWAL 4P74A 3CC4A 3I8ZA 2NVTB 1J8IA 3M3YB 1SSOA 5KRUA 1WTXA 1G8ZD 4HJ8A 2F0JA 2K5QA 3D8GA 3CPFA 4L5TA 4HMIA 2D0OA 1WCMH 5C0XJ 3MXPA 5C3EB 4DR3Q 5JJIA 2EJGC 1G6PA 3KK7A 4X62L 1X3FA 1JORA 1TWGB 1N36L 3JAMc 2B8GA 1QZHA 2EJFC 4X64L 1B70B 1WTQA 1XMQL 4NP5A 4JI2Q 2D2CC 1XNRL 2F0KA 2UXCQ 3ULLA 2JA8B 1CKNA 2C9OA 3U4VA 4DK6C 4HJ9A 3C46A 1H9SA 1FJGQ 1T5EA 2F0WA 2CWPA 1O7YA 3VDYA 5A2QE 5M5WB 4P72A 2YTVA 1PA6A 1KQSA 4ZQ3A 1ASZA 1EY7A 1SAPA 5LMNL 1PTOF 3I4NH 1ENFA 3CCVA 3DEOA 1DOMA 5E4WC 2RSNA 1V1OA 3IFDA 2E74C 1HTLD 3TREA 2A6EC 1I5FA 2ZM6Q 2C5CA 2IHEA 4QMGA 4LF6Q 2Z1CA 1FVIA 1TWCH 5IOCA 1VQ6A 1T9HA 4X3TA 1BXTA 1NUCA 4YWMA 4KD3A 4HIKA 4G7HC 1HH2P 3M7NA 2VL6A 1ICFB 3VYRA 4WJ3M 3NP8A 2VUMB 1HZBA 1HNWQ 4RA8A 4DU9A 4KI0A 4X66L 3A54A 1Y1VB 3OW7A 1X55A 3PF4A 1STHA 4Q5VA 1UE1A 2I46A 3GTMH 1SNPA 2JA6G 3DXJC 5FOBB 1K8OA 1RTOA 2K50A 3FPUB 1UEAB 4LK1C 3VR4A 3RZDH 2A6HC 1TWAB 3S24A 2WFWA 2HCCA 2UUBQ 3D4DA 2SOBA 2YV5A 3K5OA 4A3LG 1EL0A 1BNZA 1XJVA 1DYQA 3HKZE 3BZDB 4DV1L 1CM9A 1A63A 4YY3L 2A74C 5BN3A 3NQTA 3A8IE 3VYUA 2R93H 3P1HA 2E2JB 5EPKA 4A3JH 2KCNA 4BBRH 4DR1L 1H9SB 2V1CC 1BCPF 4LWCA 4KHZA 1Q1EA 2QKIC 2F3VA 5C5LA 4POGA 4RGOS 4IUPA 4A4IA 5IGBA 4R8NA 1N34Q 3TDQA 3SR1A 1IBKL 2JA8H 5IYDH 1AEXA 4U673 1PZJD 1JOOA 2L12A 3AFQA 3TP7A 4R1JA 1F77A 3T1HQ 4RAUC 1D1IA 4X3SA 4PZ7A 1JOKA 3HOYB 4DR4L 2K6AA 4A3JB 3TP8A 4A3IH 5EKLA 3RN2A 1YHBA 4JI5Q 3OYYA 3EIVA 4GS3A 2MNAA 4DR6Q 4IUNA 1GUOA 1LTRD 2OWOA 1ILPA 1ML0D 5I4DA 4JI8Q 4B3ML 4FXKC 1R4PB 1NAPA 3NBHA 3X3NA 4JBKA 5D3IB 3M3YH 2PPBC 2KCTA 3CC7A 4HIDA 4XQJA 5FLXE 4LF4Q 1IYUA 1R4QB 1YHQA 5M5XB 2N49A 4LMQD 4AYBB 2Q8IB 5IT9E 2Z6KA 3J80c 1XPRA 5ELDA 4ME3A 1M4VA 4R8IA 1N32L 2PMZE 2F52A 3NENA 1YNJD 2NTSA 4DV5L 3BDLA 4KJNA 3X3MA 5IYCH 2BH2A 1I94Q 5IP7G 4OONA 1PFSA 1G51A 1QWYA 3RUZA 1NSNS 3PF5A 1SE3A 4DN4M 5CYUA 2BCOA 5KEEA 4A93H 1PTOB 3MXUA 3K5MA 4EGVA 3RR5A 5EKKA 3AU7A 1ET9A 3KBXA 1B4OA 3HS0C 4PQXA 4DR6L 1O7IA 4K2LA 1YNXA 1DOKA 1XMOQ 4IN3A 1HR0L 2SNSA 1F2LA 4R9WA 2R92G 3CPWA 1WCMG 2X6GA 3CQZB 3D3RA 3PO2G 2XRQD 3HOYH 5C0XG 3HOZB 1K3RA 1NBWA 1WFQA 3EBEA 4JI1Q 3I4NB 4K0KL 1AP0A 4GOPC 2ZJQA 3KF6A 3KF8B 5AFWA 3LX0A 2VQFL 4JPBW 2YU9H 3BU2A 1X65A 5IODA 4P73A 4NXNQ 5M5WH 2VQEL 2CFMA 4C3HB 1Q81C 2EYMA 2QDLA 4OO1H 4KHVA 2BDNA 2MO0A 4NXNL 1XX8A 2O4XA 5C0XH 1TWFB 1YNNC 4B3SL 2R7ZG 1YEZA 1IBLQ 1I4RA 3C3LA 3K80C 3M4PA 4GOPB 5NUCA 1L1OA 1XTDA 4X6AH 1HR0Q 4JOIA 3CCRA 1WCMB 2JSOA 4OWTB 1EFWA 2YYZA 4DR4Q 1A62A 4C3IB 4NXMQ 2PO4A 1VQOA 4QY7A 3O13A 1SNQA 5E1FA 1STNA 4K6DA 1TWAH 3CCMA 1HA6A 4A3MB 2MJ8A 1SYFA 4EQPA 2K5WA 2F03A 5IYDG 4PZ8A 2PI2E 3GTMB 3PO3G 3DWPA 1N32Q 1VQHA 1A15A 4G4KA 2E2HH 4L8JA 1O80A 5F2DA 1MD2D 4A3MG 4EQOA 1LYLA 3UI2A 4ULLA 1SYBA 3W1BA 3U9OA 1KABA 1CI3M 3J81c 2FXQA 4GLVB 4GLXA 1JMCA 4LUVA 3J80E 1I3QB 3MZ5A 5DLQE 1KRSA 1A3VA 3RLNA 3FP9A 1JICA 1WTOA 1HCZA 3W1GA 2MFIA 1JQYD 2PQEA 4UP9A 1EIGA 1IXRA 4LF6L 1Q7YC 4R4TA 2UXDQ 2IW3A 4A3IB 2F0VA 1I6HB 3K0YA 1EZ8A 2OT2A 4JW0A 1KNAA 4XQQA 3RZOB 4IFDH 5CC4A 1JWMD 4LF7L 4RWSC 4RHRA 3PIPA 4LF9Q 2VB3X 1YNND 3PIP3 3BVZA 1BF4A 3J7A5 1HQRD 1VQCA 3QR8A 3PMFA 1EIFA 4LAAA 4PZ6A 2OCEA 2QW7A 2JQOA 4LF5L 1VQIA 4N9PA 1H9MA 5M5YH 3F2DA 1U0LA 1OXVA 1FYCA 4DGZA 1SRUA 3NQIA 2XTIA 2LMCB 2F0TA 2R92B 5BN5A 4A3BB 2AKWB 4OXPA 4ODGA 4JYAQ 4JI0Q 5LMNW 3BS1A 2F0PA 1PV4A 2DY7A 2ZT9C 1RF2D 2EYFA 2FFKB 4RHSA 3VYSA 3C1FA 4C3JB 2R7FA 3TQYA 5GAGC 3P7JA 2EJMA 3C1EA 1EU3A 1XWEA 3NHHA 5ISRA 2JK8A 3I2ZA 2NUCA 1JE5A 1SMYD 2EDGA 2RVLA 2B2TA 5HY6A 2I07B 2PYKA 2CQAA 1I3QH 3TP6A 3MA2B 4KY5A 4DR2Q 1E7ZA 1RD9D 4GN5A 2O5IC 4CJ0B 1SYEA 1LTLA 1NMFA 4BXXH 1QOHA 5JEAH 4QCLA 1OXXK 2F1MA 1JJCB 1EYCA 1SYDA 1ZXTA 2PZTA 5C3WA 1K83H 3RMHA 1E2WA 1LM0A 5K36G 4OELB 1QVFA 5KYIA 4JYAL 3S1RB 1ZYRD 1BO0A 4RH6A 1J5EL 4DXFA 4EX5A 1DONA 1N33L 4LFAQ 4K5WA 1I4HA 1VQAA 1IBMQ 3WWVA 2R61A 4DR5Q 3CW2C 2JXMB 1ICWA 5DM63 2QA4A 1EQVA 3A8JE 4DV3Q 5D65A 1PH1A 1QE6A 1HQMC 4I7AA 2F0MA 4DR2L 1UE6A 2TMPA 3M9BA 4NDXA 1PFNA 3H0GB 1SROA 3IAYA 3DWQA 1E1OA 3QB3A 5G3LF 2PW7A 3TS0A 4JOIC 2MHVA 1JB3A 2UXBL 2Y0SG 4Y7NH 3BZCA 1X3EA 4BBRG 5C5MA 2F0SA 3CCLA 4JV5L 2KCCA 3NTKA 5K5PA 1STEA 4YHHQ 4Y52H 5I2XA 1MSHA 2O2LD 1X3QA 1ESRA 4DAPA 4CJ1B 1TS4A 4LUZA 4DAYA 2E5LQ 1SFOH 3S2HB 1BOSA 1AW7A 4PMWA 2EY5A 3A0JA 3K5NA 3H3VI 4PMCA 1YJWA 2LY7A 5I6YA 4TRDA 3NE5B 2A73B 4QQBX 4G57A 4AYBG 3NWSA 1DGSA 2JA7B 2JA6H 2I5HA 2DNCA 1YNJC 4OX9Q 3CCEA 1HNXL 1B8AA 3GD7A 1EY8A 2EY6A 1NNXA 1Q8KA 2EPBA 5CGKA 4H13C 2KVMA 1VF5C 1EWCA 4L5SA 4CDDC 2K5NA 3H91A 3KLSX 4JI3L 4UPAA 3BYTB 1I4QA 2F3IA 4KK7A 1A0IA 1HFNA 2AUJD 5IP9H 4GKKL 3QO2A 3CMAA 4WFN3 3KYHC 4XT1B 1PMRA 5M3FH 1Q46A 2EYOA 3IRBA 1ONLA 4OHJA 4TSSA 4A3JG 2LS01 2XWJB 1WTRA 4DK3C 2PNHA 1H9KA 1PH8A 1N33Q 1N8RC 1A2UA 2HQLA 2B2WA 1B7YB 4IUQA 1CHPD 2A8VA 5DEHA 1W2BA 1GD7A 5JJLA 2NVXB 5FO9B 3PO3H 3ER0A 4FNFA 2CW0D 1HUNA 1Q3LA 2EYLA 1JJGA 5M5XH 4C2MH 1V1QA 2D9UA 4FF1A 4Q0FA 3OMGA 2JA5G 2OF1A 1LUZA 1C9OA 2CWAA 1S72A 1IW7C 5C44H 3ONAB 4CGYB 4OIJA 1K3BC 3I4MH 2Z6BA 1I4PA 2ZTCA 3EJIA 2M9VA 1MI2A 1E2ZA 2N78A 5IIFA 4A3FH 4UDUC 4AQYQ 2L4NA 4BY7H 4HSPA 5FLMG 4ME5A 2AWNA 4A75A 4UHVA 1MJEA 1VQKA 5M9OA 3E9IA 4HJ5A 1NJIC 5GQOA 1C8CA 1PYBA 3PQIA 4BA1I 1LACA 4C56C 3HOUG 3SE0A 2G9DA 4V0BA 3SK4A 1VQBA 3TZUA 2JA6B 2B2VA 3S15H 4R4OA 3QOJA 4BBSG 1MGSA 3N6RA 1Y1VG 3GTJH 5FLMH 3HKSA 1SMXA 2M2LA 2RBMA 3S2DB 1PTOD 4ZYSA 1CQVA 3TN2A 5IE8A 1A8VA 1Q8IA 5E3FA 1Y1WG 1LO5D 4BWGB 5IGFA 1X3PA 1WTVA 4G7ZC 1LTID 4IO9A 2YU9B 1F9SA 3OIQA 3VA5A 4GZYC 1B44D 1I50H 1HR0W 2K28A 3AFPA 1Q82C 4DV0L 1VQLA 5T1GA 3PIOA 2B2UA 2BE5D 4IOAA 3P20A 3SEBA 1EY0A 4KV6A 3TMEA 4FYDA 2RQXA 3K5LA 2EE1A 3QOLA 1AE2A 1HRJA 1SBBB 3EN2A 4IALA 1TWHB 2F0QA 3ERQA 3J7AF 3BJUA 5FO7B 2CVRA 2K52A 1NR4A 4OWXB 3A55A 3E5SA 2A69D 4FXGC 5IGEA 1BBUA 1HZ9A 3I4OA 3HG9A 5KGUA 3RNUA 1H95A 4JBMA 4FP5D 4Z9CB 3W5OA 5ELOA 1V1PA 4QJFA 1K28A 2JE6I 3GTQH 4B3SQ 1PFBA 2MGSA 3H3VC 1DZ1A 2H5XA 1BBWA 1OXTA 3S1NB 5LMUQ 4FF2A 3D31A 1EY4A 1U5KA 2AUKA 2NN6G 1GUGA 3NELA 2N3SA 1EY9A 4O0AA 2ZXOA 1VQMA 1PRTC 2Y0SB 3G6EA 1PYWD 3GTOB 1EFID 1JC7A 4B3MQ 1DD2A 3SK8A 5I9OA 2Z0SA 4YCVA 4C3HG 2NVQB 4C3JH 1LTSD 2Q8RE 4LJZC 4UP8A 2ZTEA 1VQEA 4JI5L 1CHQD 2VUMG 4R4QA 4LFBQ 2NN6I 1IBLL 1JCKB 1A6XA 4K5VA 1EYGA 3J80i 3FPPA 2K14A 2BA0A 1KXLA 5JPNC 1IL2A 2RDGA 3R2TA 3CCUA 3J81i 4H02A 2JA7H 4KKSA 3GP7A 1CA5A 3A7AB 3KUPA 1PH9A 5C4XG 3AEVA 5KNCA 1X9NA 1L0XB 2A69C 1IBKQ 2ZJRA 3ULJA 2CCZA 3EVQA 4RG1A 2JA8G 3HOUB 1B3AA 2L9HA 1D6EC 3K59A 4PMBA 5EJWA 1HXYD 1F9PA 3DLLA 5CBAE 3PCOB 4XDXA 3ULPA 3F1ZA 3FKIG 2AMCB 3K8AA 2VY3A 3V2TA 4X66Q 4R4IA 4RCOA 2RDHA 1HNZL 2QF7A 2K5DA 2I5MX 3KOJA 3E0EA 3PUYA 5C3EG 3NWTA 5HGQA 4TQUS 3JAML 1GXDC 3CXCA 4DXGA 2J0TD 4ZLTF 1VMCA 4IURA 1JR0D 4CJ2C 2KQ3A 3TZDA 2IY5B 3ZJYC 1ILQA 3TRZA 1UAPA 3STBC 4WRDA 5C44G 1RIPA 1RCVD 1RTNA 3GDEA 1I94L 3R2IA 2HQEA 1FD7D 2AQ1B 2E2HB 5DAUA 5H1SE 1Y1WB 3S1QH 3S1RH 3SHLA 1A3UA 2ES2A 1B53A 1KAWA 1WTPA 3CHBD 1SEBD 4HIMA 3F8TA 3R93A 5FO8B 4A3DG 4GKJQ 2RDFA 4CHTB 1CTMA 2VXWA 3GV6A 5CR3A 3OW2A 2IL8A 2QEXA 5IGCA 2HIVA 4TKOB 2K01A 1EWHA 4OEMB 1QG7A 4OO1G 1TS2A 4QIWE 4QIWB 3LGJA 5JVG3 4QUFA 5CBEE 1R9TH 4JV5Q 2LXJA 1AN8A 4JG2A 2AHOB 4O42A 2R92H 4F87A 2HDMA 4NMZA 5FLXL 3I91A 2EY1A 4PNYA 3SVMA 3OPOA 4RKLA 2JA5B 4HAEA 2RA4A 2E2IH 1E0BA 2K75A 3CU7A 2HHHL 3A5UA 4UY8C 1NR2A 1LT3D 2PMZB 3S1MH 1FR3A 1QVGA 4GN4B 2K1BA 4APVA 2IWHA 3CD6A 4LFAL 1SNCA 1S5CD 3WDNA 4DNRB 2EZVA 1M1KC 3M4OH 1RJTA 5C4ZA 4J1MA 5C0XI 4JVZA 1IYVA 1FGUA 4H0LC 1N36Q 1Q90A 1I6HH 3CQZH 1SE4A 1PZKD 3K0XA 3EQLC 3W3AA 4XYOA 4JI6L 1QCBD 2E2DC 2VZAA 1BBXC 1Z6HA 1DCZA 1D7QA 2NVQH 1E22A 2WV6D 4L5QA 4DV1Q 2Q2IA 2OTLA 1Q86C 1D5XC 1PTOH 1TIID 1C7YA 5IGGA 3QWNA 2B2TC 4EVOA 1SNOA 4X65Q 2GN5A 4V190 5ELNA 2KOLA 1BCPC 3MEHA 1I4GA 1FNVA 1VQ9A 1GHKA 1EQQA 3D0FA 2DUDA 5GADC 4A76A 2UUAL 3KF6B 1ENAA 4GOPA 1WJJA 3GTPB 2GVBA 3EROA 3NK9A 1F2YA 1Q12A 5IYCG 4HTHA 1SR3A 4DUZL 1CFMA 1B9NA 1K0RA 2R3ZA 2IPKD 4B3RQ 3CF5A 5M3FB 5C3XA 1TR5A 5M3MG 4KY6A 3J7YW 2RKSA 3J81j 1D8LA 4LF7Q 4OIKA 5JVH3 3FMCA 3Q23A 1N9WA 2ASBA 1SMYC 3T4AC 5DM73 2JYOA 4A3KH 1YITA 1F2ZA 3E0JA 4B3RL 2IX0A 1SLJA 4FXDA 3G71A 3A7LA 1MHWC 1L0YB 3CP0A 1CKMA 3VA7A 5GAEC 2L55A 4IZ8A 4G7OC 2XWBB 2RSOA 2XIWA 1EIHA 1TWFH 1Y8OB 3M4QA 3S14B 1O78A 3PUWA 2XSCA 3T53B 1JT8A 1NTGA 1SYCA 1B3QA 2AQ2B 2A1AA 2PZWA 4X65L 3MHBA 1C48A 3LWEA 4DV6L 3AB9A 2MUYA 4YCUA 1WYDA 5ELEA 4A3CH 3KJOA 2RF4A 3PIO3 5IP7H 1S5ED 2KEDA 3HOYG 1WVLA 1K73C 5JJZA 1PTOC 2JJQA 3MXGA 3S17B 1V9PA 3GO5A 3FRPB 3JAME 4MTNA 3OTOL 4A3DB 5FK9C 2R6GA 3GTGH 1TS5A 2IT1A 2Y0SE 3EA6A 1LLRD 2ALYB 4ZUJA 1IBML 5EPJA 1STAA 2SDFA 4ZCKA 2F0LA 3DUZA 3OIPA 1KTKA 5CV8A 1XNQQ 1BCPB 4J6HA 5EQ0A 4DV6Q 1P8LA 1RKNA 1NCVA 4ILWA 4X3UA 2GA4B 4AIMA 1D1KA 4JBWA 1YHAA 1I4XA 3L3OC 5IGDA 4X3KA 1SXTA 5ELFA 4DR7Q 4DV7Q 5GROA 2MP1A 3TEHB 2WAQE 5HGTA 2YTYA 5L37A 1LTBD 2Z6KC 5KIXA 3L0OA 1Y1VH 5CV6A 4MN3A 4C1NK 1YIJA 4GLAC 1PH7A 3NBIA 3HGBA 4DV2Q 2JA9A 4GNXC 4CKEA 5IYBH 3CKIB 1IL8A 4DV4L 3UE1A 4LUOA 2KEEA 1GM5A 4H7BA 3BZKA 1U4LA 1KC8C 3V96A 4DK0A 2VB2X 3A5ZB 4EQ5A 1CSPA 1ZEQX 3NXWA 1STBA 1TKWB 1TWHH 2EYHA 4LF5Q 3FEWX 4IQZA 4JI4Q 1K8GA 4DF7A 4ID6A 1RHPA 4GKJL 1KIXA 2CH4A 2UXDL 3CCSA 2EOTA 4LFCQ 2A6HD 2F0OA 1ZYRC 3Q24A 1ENCA 2KJXA 1EUJA 2E76C 4A3EH 3S17H 4KTAA 2KHSA 1CKNB 3HZXA 4NKLA 1Y69U 2NBFA 2K32A 3PO2B 5A35A 2HDLA 2L5TA 4IUUA 2JEAI 3F2BA 1AH9A 5IY0A 1KLUD 3PSIA 1RL2A 4XTCS 2N88A 4MIUA 3H15A 2PQAA 1L0WA 4C3HH 3L2PA 4WJ4A 1Y8PB 1M8AA 2WB1E 3G7LA 3RD4A 4DKAC 5IP9G 2JA5H 3V05A 4A3BG 4QL5A 2KA7A 3PV0A 3E6ZX 2SEBD 3HOZH 2PI2A 5M3FG 3N52A 4JI6Q 2E2JH 2C35B 1FNUA 5EGTA 1OTCA 4Y7NB 4WORA 5C3EH 2JA7G 4BY7G 4MTKA 3GV3A 2DJGC 2B39A 3BG3A 1WTWA 2K33A 1SNDA 2A6ED 1SJHD 1V8QA 1PRTD 4A93B 1TVXA 2D5DA 1VF7A 1JE4A 4NXML 3R8BA 3WOFA 3S16B 3ITPA 5CV4A 4A3IG 1V1PB
chains in the Genus database with same CATH topology
4HR7B 3SDZA 2R7ZB 4ZK9B 4C3IG 1PFMA 1QB5D 3A8KE 1LTAD 3T56B 4PV1C 5EKIA 3OOCA 1S5BD 3G6JB 1Q1BA 3ND8A 3U9SA 5G3LD 2EYPA 1QJOA 1F9QA 3HOXB 1LT5D 1JOQA 4B9WA 3SK5A 1O7ZA 5I2YA 4FO2A 3KLRA 3Q0AA 4KKTA 3VYTA 3I3CA 2EXZA 5J1ZA 4EQNA 4K8IA 4ZKBB 4KMUC 3P75A 5M5YB 1U4MA 1XXGA 3T51B 3TBIB 1LTTD 2EYJA 4C1NI 2FJ2A 1KLGD 4U68A 5K36H 1F2MA 2FINB 1SE2A 4CBVA 3MFGA 1ET6A 1U4RA 3GTKB 3M7GA 2F0DA 1EEFD 3M85A 2ICIA 2B2YA 1J9OA 3Q22A 1O7LA 1TT2A 2XN9C 1ZKOA 1RODA 1OXSC 1B2TA 3MVVA 1QNUA 4BY7B 2X69A 2F3WA 1VCIA 3OSOA 3I4MB 1CQFA 5I9PA 3J81E 2CW0C 2NYZD 1Z7TA 3NUCA 3BVGA 2AWOA 5J39A 4YIJA 3H6MA 1W6JA 1HUMA 1AFPA 4XIGS 2LKVA 3S1QB 1SJED 3SK6A 5LL6S 5BN4A 2J7ZA 4BA2I 1EYDA 3TP5A 4ZAIA 3FVQA 2HCIA 1TWCB 3OWEB 3C2PA 4HMJA 3NSWA 3AMUA 3PUXA 1GUWA 4RKBA 2SNMA 5CORA 1MBYA 4OO1I 2PCFB 2K7VA 1HFGA 2B2WC 2BA1A 1X32A 2IJ0A 1DOLA 3BVMA 1AZQA 3S15B 1LT4D 1GUNA 3IKJA 1SFOB 1MSGA 5LL6X 3DMUA 2WACA 4B08A 1UUPA 2NVYB 2X6LA 5JEAG 4IUVA 2R93B 3NTHA 4HSVA 1EQTA 1QILA 3RLFA 4KY7A 4A3KB 2NTTA 4DAVA 2WIIB 2BE5C 2J4XA 5KNBA 5I6WA 4L63B 1IW7D 5C6AA 5C44B 2L1BA 3BYYB 1K8MA 3QG1A 5CMDA 1U9RA 2B2VC 2KUMA 1TY2A 4IFDJ 3MC0B 4NW2A 2EVBA 3D6WA 5EBDA 4DK1A 2LFNA 1PDQA 4RGMA 1V43A 5ELBA 3D4WA 2DN8A 4FVMA 2F0GA 1H9JA 1CZWA 5JOBA 4XQNA 1D5ZC 2B2UC 1KDBA 3PUZA 2WKCA 1GUSA 2KECA 2B2YC 1TU2B 4K6LA 5T1IA 1KNEA 5CV9A 2FHTA 5JPMC 2IX1A 3IFTA 1B50A 1PXUA 4KD4A 3GTGB 1GHJA 1DJRD 3DHQA 1D5MC 1A3TA 2WKDA 3M4YA 4QF4A 3M4OB 4K8JA 2O5JC 1TS3A 1WD0A 2NWGA 3KLSA 3S1MB 1XTCD 4KN7C 5HURA 4OGQC 2F4IA 4K5XA 3F2UA 4WJWA 2ID0A 3CRKC 5J22A 3NPPA 3MFYA 1HPCA 1STGA 2G9HD 1PRTB 3VR3A 5LHY1 1C4QA 3K7AB 3J81L 2A68C 2ENBA 2ICEC 2WB1B 2FMCA 4RCNA 2Z4HA 1JWUD 2EY2A 4N9TA 2BDOA 2XRSD 1DM0B 5C4HA 1OXUA 1S4ZA 2Q8TA 4ZKCB 3J7AV 5EPLA 1BDOA 4A3GB 3I72A 5JEAJ 2M00A 3GTQB 4M1UB 4BY1B 2DY8A 1IKMA 1BQQT 3OWFA 4F8MA 3HP3A 3MWYW 3ND9A 4CKCA 2H4OA 3HKZB 1BCPD 3K58A 1GJXA 1GOZA 4FF4A 3BDOA 4HCSA 4XT3B 4I65A 3MXNA 4XYQA 3FDTA 5EBCA 2A5HA 2F0NA 1FNWA 1S5DD 5E4XA 4MHEA 2F0IA 2MPMA 1T5XD 4IFDG 3KF8A 2B63B 2Z8LA 1VMPA 2E2IB 2V4DA 1EY5A 4DNTB 1Y8NB 4OL7A 4QUCA 1HTPA 4BBRB 3HOVB 1HA5A 3CRLC 2B8FA 4UAIA 3D4RA 3WOEA 1W6KA 5KNDA 4HEDA 5M3MB 1LABA 4RFBA 1B1ZA 3FKIB 1II3A 4ZUIA 1AZPA 2K05A 1SDFA 1WD1A 1B9MA 3QIAA 3TSSA 2K03A 2L11A 3MTSA 2PZUA 5IT9L 3VR5A 2F0FA 3IL8A 5CV5A 2N55A 4C3JG 1K83B 4M8AA 2K04A 1UNSA 1XYIA 3GTLB 2QDBA 3R3OA 2QEJC 4BS9A 1OO9B 4E6IA 3S9WA 3I70A 2L0CA 5JAVA 2NN6H 1LV9A 1DXMA 1ESFA 1BUVT 2PW5A 1I50B 4DA2A 4B9XA 4HN7A 4RGTA 2OEOA 5DNFA 3A56A 2BOSA 2ZXPA 1RDPD 1D2BA 3J80L 1KDAA 2F0UA 2XNAC 1S5FD 2VNUD 4IUTA 2XVSA 2AQ3B 1SNMA 1GUTA 4A3EB 1EZ6A 4RGNA 1R9TB 1IHZA 1EOTA 1EY6A 4K2KA 1KAAA 3LNNA 3I4LA 2NB0A 3DWAA 2CHBD 4ZRZA 1EEID 4A3FB 3L7ZC 4CKBA 1STYA 2WAQB 5KYLA 4BBSB 3K6OA 4KN4C 2TSSA 4KKUA 4XXEA 1I6VC 2JP1A 2PNRC 3PUVA 4DFAA 3RZDB 1TQOA 2WP8J 1CA6A 4C2MB 4H44C 5TSSA 2IX3A 3D6CA 4S3SA 3PO3B 5C4JB 3QJYA 1SYGA 3LWUA 3H09A 1LT6D 1LTGD 4K14A 5COYA 1G91A 3W2DA 1F9RA 3K57A 4L6TB 3T13A 3KBGA 2NZ1D 1H9RA 4QB4A 3HOWB 2F0EA 4I7ZC 2A68D 4F88A 1U4PA 1A2TA 4J8QA 2OXPA 4IFDI 3H94A 1G291 5ELCA 1G2TA 1CK1A 2DNEA 2JEBI 2WINB 4HCEA 1Z47A 3T16A 2FMMA 1G2SA 3I90A 5D3DA 3GTJB 1EYAA 3Q6SA 1TY0A 3MAQA 1JWSD 3OMCA 1EU4A 5FKAC 3DEPA 1HHVA 1QNKA 3HRZC 2QILA 1CT1D 2Z4IA 1CZGA 2QCPX 1KDCA 3OHXC 4O1NA 3VR6A 1FGBD 3BDCA 4F7XA 3GQBA 3I73A 3HEJA 4FF3A 4KJOA 5CV7A 2H1EA 5D14A 2ZXRA 3EFXD 3VR2A 3URYA 4ABNA 3L9AX 5A2QL 1PRTF 3ZYYX 1VDZA 2D62A 2HUGA 1G6ZA 2E75C 1BR9A 4JK1C 1PZID 5C4XB 1PLFA 2F0HA 3DM1A 4P2CB 1E2VA 1IKLA 3SXHA 3NTIA 3I8ZA 2NVTB 1J8IA 3M3YB 1SSOA 5KRUA 1WTXA 1G8ZD 2F0JA 2K5QA 3D8GA 4HMIA 5C0XJ 3MXPA 5C3EB 2EJGC 3KK7A 1JORA 1TWGB 2B8GA 2EJFC 1WTQA 4NP5A 2D2CC 2F0KA 2JA8B 2C9OA 3C46A 1H9SA 1T5EA 2F0WA 1O7YA 5A2QE 5M5WB 4ZQ3A 1EY7A 1SAPA 1PTOF 1ENFA 3DEOA 1DOMA 5E4WC 2RSNA 1V1OA 3IFDA 2E74C 1HTLD 2A6EC 2C5CA 4QMGA 2Z1CA 5IOCA 4X3TA 1BXTA 1NUCA 4KD3A 4G7HC 3M7NA 3VYRA 3NP8A 2VUMB 4RA8A 4DU9A 4KI0A 3A54A 1Y1VB 3OW7A 1STHA 4Q5VA 2I46A 1SNPA 3DXJC 5FOBB 1K8OA 1RTOA 3FPUB 1UEAB 4LK1C 3VR4A 2A6HC 1TWAB 2HCCA 3D4DA 2SOBA 3K5OA 1EL0A 1BNZA 1DYQA 3BZDB 1CM9A 2A74C 5BN3A 3NQTA 3A8IE 3VYUA 3P1HA 2E2JB 5EPKA 2KCNA 1H9SB 1BCPF 4KHZA 1Q1EA 2QKIC 2F3VA 5C5LA 4RGOS 4IUPA 5IGBA 4R8NA 3TDQA 3SR1A 1AEXA 4U673 1PZJD 1JOOA 2L12A 3TP7A 1F77A 4RAUC 1D1IA 4X3SA 1JOKA 3HOYB 2K6AA 4A3JB 3TP8A 5EKLA 4IUNA 1GUOA 1LTRD 1ILPA 1ML0D 5I4DA 4FXKC 1R4PB 1NAPA 3NBHA 3X3NA 5D3IB 2PPBC 4XQJA 5FLXE 1IYUA 1R4QB 5M5XB 4LMQD 4AYBB 2Q8IB 5IT9E 5ELDA 1M4VA 4R8IA 1YNJD 2NTSA 3BDLA 4KJNA 3X3MA 1QWYA 3RUZA 1NSNS 1SE3A 4DN4M 5CYUA 2BCOA 5KEEA 1PTOB 3MXUA 3K5MA 4EGVA 5EKKA 3AU7A 1ET9A 3KBXA 1B4OA 3HS0C 4PQXA 4K2LA 1DOKA 4IN3A 2SNSA 1F2LA 4R9WA 2X6GA 3CQZB 3D3RA 2XRQD 5C0XG 3HOZB 3I4NB 1AP0A 5AFWA 3LX0A 5IODA 4C3HB 2EYMA 4OO1H 4KHVA 2BDNA 1XX8A 2O4XA 5C0XH 1TWFB 1YNNC 1I4RA 3C3LA 5NUCA 1WCMB 2JSOA 2YYZA 4C3IB 2PO4A 3O13A 1SNQA 5E1FA 1STNA 4K6DA 1HA6A 4A3MB 2MJ8A 1SYFA 4EQPA 2K5WA 2F03A 3GTMB 3DWPA 1A15A 4G4KA 4L8JA 1O80A 5F2DA 1MD2D 4EQOA 3UI2A 4ULLA 1SYBA 3U9OA 1KABA 1CI3M 3J80E 1I3QB 3MZ5A 1A3VA 1JICA 1WTOA 1HCZA 1JQYD 2PQEA 1EIGA 2IW3A 4A3IB 2F0VA 1I6HB 3K0YA 1EZ8A 2OT2A 1KNAA 4XQQA 3RZOB 4IFDH 5CC4A 1JWMD 4RWSC 4RHRA 2VB3X 1YNND 3PIP3 3BVZA 1BF4A 1HQRD 3PMFA 4LAAA 4N9PA 1H9MA 1OXVA 1FYCA 4DGZA 3NQIA 2LMCB 2F0TA 2R92B 5BN5A 4A3BB 4ODGA 3BS1A 2F0PA 2DY7A 2ZT9C 1RF2D 2EYFA 2FFKB 4RHSA 3VYSA 3C1FA 4C3JB 3P7JA 2EJMA 3C1EA 1EU3A 1XWEA 3NHHA 5ISRA 2NUCA 1SMYD 2EDGA 2RVLA 2B2TA 2I07B 2PYKA 2CQAA 3TP6A 3MA2B 4KY5A 1RD9D 2O5IC 4CJ0B 1SYEA 1QOHA 5JEAH 4QCLA 1OXXK 2F1MA 1EYCA 1SYDA 1ZXTA 2PZTA 5C3WA 3RMHA 1E2WA 5K36G 5KYIA 3S1RB 1ZYRD 1BO0A 4RH6A 4DXFA 1DONA 4K5WA 1I4HA 2R61A 2JXMB 1ICWA 5DM63 1EQVA 3A8JE 5D65A 1QE6A 1HQMC 2F0MA 2TMPA 4NDXA 1PFNA 3H0GB 3IAYA 3DWQA 3QB3A 5G3LF 2PW7A 2MHVA 1JB3A 5C5MA 2F0SA 2KCCA 3NTKA 5K5PA 1STEA 5I2XA 1MSHA 2O2LD 1X3QA 1ESRA 4DAPA 4CJ1B 1TS4A 4DAYA 3S2HB 1BOSA 1AW7A 4PMWA 2EY5A 3K5NA 4PMCA 2LY7A 5I6YA 4TRDA 3NE5B 2A73B 4G57A 3NWSA 2JA7B 2DNCA 1YNJC 3GD7A 1EY8A 2EY6A 2EPBA 5CGKA 4H13C 2KVMA 1VF5C 1EWCA 3H91A 3KLSX 3BYTB 1I4QA 4KK7A 1HFNA 2AUJD 3QO2A 4WFN3 4XT1B 1PMRA 2EYOA 4OHJA 1ONLA 4TSSA 2LS01 2XWJB 1WTRA 1H9KA 1A2UA 2B2WA 4IUQA 1CHPD 5DEHA 2NVXB 5FO9B 4FNFA 2CW0D 1HUNA 1Q3LA 2EYLA 2D9UA 4FF1A 4Q0FA 3OMGA 2OF1A 1IW7C 3ONAB 4CGYB 4OIJA 1I4PA 3EJIA 2M9VA 1MI2A 1E2ZA 5IIFA 4UDUC 2L4NA 4HSPA 4ME5A 2AWNA 5M9OA 1C8CA 4BA1I 1LACA 4C56C 3SE0A 2G9DA 4V0BA 3SK4A 3TZUA 2JA6B 2B2VA 3QOJA 1MGSA 3N6RA 2RBMA 2M2LA 3S2DB 1PTOD 4ZYSA 1CQVA 3TN2A 1Q8IA 5E3FA 1LO5D 4BWGB 5IGFA 1X3PA 1WTVA 4G7ZC 1LTID 2YU9B 1F9SA 3OIQA 3VA5A 4GZYC 1B44D 2K28A 5T1GA 2B2UA 2BE5D 3P20A 3SEBA 1EY0A 4KV6A 3TMEA 4FYDA 2RQXA 3K5LA 2EE1A 3QOLA 1HRJA 1SBBB 4IALA 1TWHB 2F0QA 3ERQA 3J7AF 5FO7B 2CVRA 1NR4A 3A55A 3E5SA 2A69D 4FXGC 5IGEA 3HG9A 5KGUA 4FP5D 4Z9CB 1V1PA 2JE6I 1PFBA 2MGSA 3H3VC 1DZ1A 1OXTA 3S1NB 4FF2A 3D31A 1EY4A 2AUKA 2NN6G 1GUGA 1EY9A 2ZXOA 1PRTC 2Y0SB 1PYWD 3GTOB 1EFID 1JC7A 1DD2A 3SK8A 5I9OA 4C3HG 2NVQB 1LTSD 2Q8RE 4LJZC 1CHQD 2NN6I 1JCKB 1A6XA 4K5VA 3FPPA 2BA0A 5JPNC 2RDGA 3R2TA 4KKSA 3GP7A 1CA5A 3A7AB 3KUPA 5KNCA 1L0XB 2A69C 3EVQA 3HOUB 1B3AA 2L9HA 1D6EC 3K59A 4PMBA 5EJWA 1HXYD 1F9PA 5CBAE 4XDXA 3V2TA 4RCOA 2RDHA 2QF7A 2K5DA 3PUYA 3NWTA 4TQUS 3JAML 1GXDC 4DXGA 2J0TD 4ZLTF 1VMCA 4IURA 1JR0D 4CJ2C 2KQ3A 3TZDA 1ILQA 1UAPA 4WRDA 1RCVD 1RTNA 3R2IA 2HQEA 1FD7D 2AQ1B 2E2HB 5DAUA 1Y1WB 3SHLA 1A3UA 1B53A 1WTPA 3CHBD 1SEBD 3R93A 5FO8B 2RDFA 4CHTB 1CTMA 2VXWA 3GV6A 5CR3A 2IL8A 5IGCA 4TKOB 2K01A 1EWHA 1QG7A 4OO1G 1TS2A 4QIWB 5JVG3 4QUFA 5CBEE 1AN8A 4O42A 4F87A 2HDMA 4NMZA 5FLXL 3I91A 2EY1A 4PNYA 3SVMA 3OPOA 4RKLA 2JA5B 4HAEA 2RA4A 1E0BA 3CU7A 1NR2A 1LT3D 2PMZB 1FR3A 2K1BA 2IWHA 1SNCA 1S5CD 3WDNA 4DNRB 2EZVA 1RJTA 5C4ZA 4J1MA 5C0XI 1IYVA 4H0LC 1Q90A 1SE4A 1PZKD 3EQLC 3W3AA 4XYOA 1QCBD 2E2DC 1BBXC 1Z6HA 1DCZA 2WV6D 1D5XC 1PTOH 1TIID 5IGGA 3QWNA 2B2TC 4EVOA 1SNOA 4V190 2KOLA 1BCPC 3MEHA 1I4GA 1FNVA 1GHKA 1ENAA 3GTPB 3EROA 3NK9A 1F2YA 1Q12A 4HTHA 1CFMA 1B9NA 2R3ZA 2IPKD 5M3FB 5C3XA 1TR5A 4KY6A 3J7YW 2RKSA 4OIKA 5JVH3 3FMCA 3Q23A 1SMYC 3T4AC 5DM73 2JYOA 1F2ZA 3E0JA 2IX0A 4FXDA 3A7LA 1L0YB 3VA7A 2L55A 4IZ8A 4G7OC 2XWBB 2RSOA 2XIWA 1EIHA 1Y8OB 3S14B 1O78A 3PUWA 2XSCA 3T53B 1SYCA 2AQ2B 2PZWA 3MHBA 1C48A 3LWEA 3AB9A 2MUYA 5ELEA 3PIO3 1S5ED 2KEDA 1WVLA 5JJZA 1PTOC 3MXGA 3S17B 3GO5A 3FRPB 3JAME 4A3DB 5FK9C 2R6GA 1TS5A 2IT1A 3EA6A 1LLRD 4ZUJA 5EPJA 1STAA 2SDFA 2F0LA 3DUZA 3OIPA 1KTKA 5CV8A 1BCPB 4J6HA 5EQ0A 1RKNA 1NCVA 4ILWA 4X3UA 2GA4B 1D1KA 4JBWA 1I4XA 3L3OC 5IGDA 4X3KA 1SXTA 5ELFA 2MP1A 5HGTA 1LTBD 5KIXA 5CV6A 4MN3A 4C1NK 3NBIA 3HGBA 4CKEA 3CKIB 1IL8A 2KEEA 4H7BA 1U4LA 3V96A 4DK0A 2VB2X 1ZEQX 3NXWA 1STBA 1TKWB 2EYHA 3FEWX 4IQZA 4DF7A 4ID6A 1RHPA 2EOTA 2A6HD 2F0OA 1ZYRC 3Q24A 1ENCA 2KJXA 2E76C 4KTAA 2KHSA 3HZXA 4NKLA 1Y69U 2NBFA 2K32A 3PO2B 5A35A 2HDLA 2L5TA 4IUUA 2JEAI 1KLUD 4XTCS 2N88A 4MIUA 1Y8PB 1M8AA 3G7LA 3RD4A 3V05A 2KA7A 3PV0A 3E6ZX 2SEBD 3N52A 1FNUA 5EGTA 4Y7NB 4WORA 2B39A 3GV3A 3BG3A 1WTWA 2K33A 1SNDA 2A6ED 1SJHD 1V8QA 1PRTD 4A93B 1TVXA 2D5DA 1VF7A 1JE4A 3R8BA 3WOFA 3S16B 3ITPA 5CV4A 1V1PB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZKC B;  2B2V C;  1RTN A;  2KUM A;  4LMQ D;  1WD1 A;  1WTR A;  5EPL A;  1ZXT A;  4RA8 A;  2K03 A;  2L11 A;  3MTS A;  4X3K A;  4NW2 A;  2B2W A;  4ZK9 B;  2HUG A;  2MP1 A;  1HUM A;  1PFM A;  3D6W A;  4IUQ A;  4R8I A;  3IL8 A;  1BO0 A;  1G6Z A;  1PFB A;  2DY8 A;  1A15 A;  1PDQ A;  2MGS A;  1IKM A;  2N55 A;  1DON A;  1DZ1 A;  1B53 A;  2K04 A;  4MN3 A;  1O80 A;  1PLF A;  3DM1 A;  2J7Z A;  1HUN A;  3HP3 A;  1Q3L A;  1RTO A;  2R3Z A;  1IKL A;  3MWY W;  1WTP A;  3UI2 A;  3FPU B;  5COY A;  1G91 A;  3R93 A;  1F9R A;  1IL8 A;  5EKI A;  2D9U A;  1ICW A;  2KEE A;  5D65 A;  1QE6 A;  4DN4 M;  2HCC A;  3I8Z A;  2NZ1 D;  1U4L A;  2VXW A;  2B2U C;  3GV6 A;  3ONA B;  1J8I A;  1SSO A;  4OIJ A;  1WTX A;  4OIK A;  2KEC A;  1EL0 A;  1PFN A;  2B2Y C;  4ZAI A;  1BNZ A;  2IL8 A;  1JIC A;  1F9Q A;  1WTO A;  1MI2 A;  2K01 A;  2HCI A;  3KBX A;  1B4O A;  1QG7 A;  1CM9 A;  2JYO A;  1RHP A;  2L4N A;  1EIH A;  5T1I A;  1WTQ A;  1KNE A;  2FHT A;  1EIG A;  1DOK A;  2Q8R E;  1O7Z A;  1B50 A;  1F2L A;  4R9W A;  4QUF A;  4HCS A;  4XT3 B;  2EOT A;  5CBE E;  1LV9 A;  1GUW A;  2X6G A;  1U4P A;  5EPK A;  5COR A;  4O42 A;  1C8C A;  2HDM A;  1MSH A;  1AP0 A;  1G2T A;  1X3Q A;  1ESR A;  2RSO A;  2XIW A;  3FDT A;  3I3C A;  1KNA A;  3I91 A;  5AFW A;  4CJ1 B;  3SVM A;  4ZKB B;  1WD0 A;  1HFG A;  2NWG A;  4HAE A;  2B2V A;  1U4M A;  2B2W C;  2FMM A;  2HDL A;  2RA4 A;  4IUU A;  4RWS C;  5E4X A;  1G2S A;  3I90 A;  1E0B A;  4IUP A;  4MHE A;  1CA5 A;  5DNF A;  2MPM A;  1X32 A;  3KUP A;  1MGS A;  1BF4 A;  2FJ2 A;  2N88 A;  4U68 A;  1DOL A;  2M2L A;  1NR2 A;  3Q6S A;  2FIN B;  3TN2 A;  1AZQ A;  1M8A A;  1VMP A;  1O7Y A;  3LWE A;  1B3A A;  2BDN A;  2K1B A;  3G7L A;  1U4R A;  2L9H A;  1X3P A;  1XX8 A;  1WTV A;  2L12 A;  1MSG A;  1F9S A;  5EJW A;  1F9P A;  5CBA E;  3F2U A;  4IUT A;  4XDX A;  1RJT A;  4RAU C;  1HA6 A;  2KED A;  1SAP A;  4QUC A;  4X3S A;  1WVL A;  2B2Y A;  3DEP A;  5JJZ A;  2EPB A;  3DEO A;  1DOM A;  1J9O A;  2K28 A;  2RSN A;  5E4W C;  3IFD A;  1HHV A;  3N52 A;  1QNK A;  2X6L A;  4IUV A;  5T1G A;  2B2U A;  1ROD A;  4HSV A;  1EOT A;  2DY7 A;  2KVM A;  5EPJ A;  1B2T A;  1EQT A;  4UAI A;  2FFK B;  2SDF A;  1BBX C;  2EE1 A;  3P7J A;  3H91 A;  1HRJ A;  3GV3 A;  2X69 A;  1ILP A;  1ML0 D;  1WTW A;  4X3T A;  1NAP A;  4ZLT F;  1VMC A;  4IUR A;  4CJ2 C;  1XYI A;  2CVR A;  2RVL A;  2B2T A;  1NR4 A;  4HED A;  5EQ0 A;  3TZD A;  1HFN A;  1TVX A;  1NCV A;  4X3U A;  2B2T C;  1JE4 A;  2JP1 A;  2NYZ D;  1ILQ A;  3QO2 A;  2H1E A;  1AZP A;  2KOL A;  2L1B A;  2K05 A;  4XT1 B;  5D14 A;  4CJ0 B;  1S4Z A;  2Q8T A;  1SDF A;  5CMD A;  2MJ8 A;  1CA6 A; 
#chains in the Genus database with same CATH topology
 2N8N A;  4HR7 B;  3SDZ A;  2R7Z B;  3S1N H;  4ZK9 B;  4C3I G;  5GAH C;  1PFM A;  1QB5 D;  3A8K E;  1LTA D;  1Y1W H;  3T56 B;  3T1H L;  2EXD A;  4LFB L;  4PV1 C;  4B3T Q;  5EKI A;  3NBH B;  3OOC A;  1S5B D;  4N8X 1;  3G6J B;  4DUY L;  1Q1B A;  1UEB A;  1VS0 A;  2NZH A;  3ND8 A;  3U9S A;  5G3L D;  2EYP A;  5FLX c;  4CDF C;  5M3M H;  1X56 A;  1QJO A;  1K9M C;  1F9Q A;  3HOX B;  1LT5 D;  4DAY B;  1JOQ A;  4B9W A;  3SK5 A;  2F4V L;  4DR1 Q;  1KHI A;  1O7Z A;  5I2Y A;  5AJ3 L;  4FO2 A;  3CCJ A;  1J6Q A;  4P71 A;  2VQE Q;  2Q2H A;  1E24 A;  1E3P A;  4RMF A;  4LF8 L;  3KLR A;  4A3D H;  3Q0A A;  2NVY H;  4KKT A;  2HIX A;  3VYT A;  4YY3 Q;  4LF4 L;  3I3C A;  2EXZ A;  5J1Z A;  4EQN A;  1PH6 A;  4K8I A;  1PHJ A;  4ZKB B;  4KMU C;  4BXX G;  3P75 A;  5M5Y B;  1U4M A;  3HOU H;  2B63 G;  1XXG A;  3T51 B;  3TBI B;  1LTT D;  1JB7 A;  3B6Y A;  2EYJ A;  4NPS A;  4C1N I;  2CH4 W;  2Q2T A;  2FJ2 A;  1KLG D;  4U68 A;  3I56 A;  5K36 H;  1F2M A;  2FIN B;  1YVC A;  2JN4 A;  1SE2 A;  4CBV A;  3MFG A;  1ET6 A;  5IT9 c;  1U4R A;  1VQ8 A;  3GTK B;  3M7G A;  4FDB A;  1CSQ A;  3PO2 H;  2F0D A;  4DV5 Q;  1MJC A;  1EEF D;  3M85 A;  2ICI A;  2VS1 A;  2B2Y A;  1J9O A;  2I5L X;  1O7L A;  3Q22 A;  1TT2 A;  4LFC L;  2XN9 C;  3AYH B;  1ZKO A;  1ROD A;  1OXS C;  1B2T A;  3MVV A;  1QNU A;  4BY7 B;  3K81 C;  5JJK A;  1N34 L;  2X69 A;  2R93 G;  2F3W A;  2QGQ A;  4JI4 L;  2K4K A;  3H0G H;  1VCI A;  3RLO A;  3OSO A;  3I4M B;  3GTO H;  1PH2 A;  1CQF A;  4TVA B;  5I9P A;  3J81 E;  2CW0 C;  2NYZ D;  1UE5 A;  1Z7T A;  3UDG A;  3NUC A;  3BVG A;  1NMG A;  2AWO A;  5J39 A;  4JCV E;  4YIJ A;  5FJ8 G;  3H6M A;  5C4X H;  2NZO A;  1W6J A;  1HUM A;  1AFP A;  4XIG S;  2LKV A;  3S1Q B;  1SJE D;  4DV7 L;  3SK6 A;  5LL6 S;  5BN4 A;  4LF8 Q;  2J7Z A;  1WI5 A;  5AJ3 Q;  1NY4 A;  4QGU A;  1SN8 A;  2RHS B;  3S16 H;  4BA2 I;  4KLK A;  1GVP A;  1EYD A;  3I7F A;  1YJ9 A;  3TP5 A;  1BKB A;  4ZAI A;  1UE7 A;  3FVQ A;  2HCI A;  1TWC B;  1GO3 E;  3OWE B;  3C2P A;  4HMJ A;  4B3T L;  3NSW A;  4X62 Q;  4R4C A;  3AMU A;  4DV2 L;  3PUX A;  1GUW A;  4CDC C;  4RKB A;  2SNM A;  4HIO A;  5COR A;  1MBY A;  4OO1 I;  2PCF B;  2K7V A;  4OWW B;  3CME A;  1HFG A;  3GTK H;  2B2W C;  4AYB E;  2BA1 A;  3A74 A;  1X32 A;  2Z9H A;  2IJ0 A;  1FL0 A;  1DOL A;  1NE3 A;  4AQY L;  3BVM A;  1AZQ A;  5IWA Q;  3HOX G;  2KHJ A;  3S15 B;  2ZM6 L;  1LT4 D;  1GUN A;  3IKJ A;  1SFO B;  2IHF A;  1MSG A;  4IPG A;  5LL6 X;  2I0Q A;  3DMU A;  3G48 A;  2WAC A;  4GN3 B;  2K5H A;  4B08 A;  1UUP A;  2NVY B;  2OQ0 A;  3STB D;  2X6L A;  5JEA G;  4IUV A;  4IOC A;  2R93 B;  3NTH A;  4HSV A;  4IPH A;  1EQT A;  1KD1 C;  3OTO Q;  1QIL A;  3RLF A;  4KY7 A;  2L15 A;  4A3K B;  3I4M G;  2EIF A;  2NTT A;  4L5R C;  4DAV A;  3SGI A;  3HOX H;  2WII B;  2BE5 C;  2J4X A;  2DGY A;  5I6W A;  5KNB A;  4L63 B;  1IW7 D;  5C6A A;  5C44 B;  1VQ7 A;  2L1B A;  3BYY B;  1K8M A;  3QG1 A;  5CMD A;  3I4N G;  3GTL H;  1U9R A;  2B2V C;  3UDX A;  2KUM A;  1TY2 A;  4IFD J;  1JJ2 A;  3AQQ A;  4O2D A;  3MC0 B;  4NW2 A;  2E5L L;  2EVB A;  3D6W A;  5EBD A;  2ATW A;  4DK1 A;  1QUQ A;  2LFN A;  1PVO A;  1PDQ A;  2CQO A;  4YHH L;  2RHQ B;  4RGM A;  1V43 A;  2XGT A;  5ELB A;  3D4W A;  2R7Z H;  2DN8 A;  1HJP A;  3T1Y Q;  2YTX A;  4FVM A;  1UWV A;  5E7N A;  1BVS A;  2F0G A;  2P5Z X;  5LMN Q;  1H9J A;  1CZW A;  5JOB A;  4XQN A;  1D5Z C;  1HNX Q;  2B2U C;  4YCW A;  1KDB A;  3CAM A;  3PUZ A;  2WKC A;  1XMQ Q;  1S40 A;  1VQF A;  4OX9 L;  1GUS A;  2KEC A;  2HT1 A;  1HZA A;  2B2Y C;  1S3O A;  4JBJ A;  1TU2 B;  3U58 A;  4ALP A;  3NEM A;  1XNQ L;  4DV4 Q;  4DV3 L;  4K6L A;  5T1I A;  1KNE A;  5CV9 A;  2FHT A;  5JPM C;  4JI2 L;  1XNR Q;  2IX1 A;  3IFT A;  1YI2 A;  1B50 A;  1PXU A;  4KD4 A;  3GTG B;  1GHJ A;  5EAY A;  4X64 Q;  1DJR D;  3DHQ A;  1D5M C;  1A3T A;  2WKD A;  1PH3 A;  1XPO A;  3M4Y A;  4QF4 A;  1TXY A;  3M4O B;  1K0S A;  4K8J A;  2O5J C;  1TS3 A;  1WD0 A;  1VQP A;  2NWG A;  2VW9 A;  3KLS A;  3S1M B;  1XTC D;  3S2D H;  2B63 H;  2HHH Q;  3MXN B;  3T1Y L;  4KN7 C;  5HUR A;  3HOW G;  4OGQ C;  3RZO H;  2F4I A;  3S2H H;  4K5X A;  4A3E G;  3F2U A;  4WJW A;  2ID0 A;  3CRK C;  5J22 A;  3NPP A;  3HOV G;  4MNO A;  3MFY A;  1TWG H;  1HPC A;  3KFU A;  2K5V A;  3PGZ A;  1STG A;  2G9H D;  1PRT B;  3VR3 A;  5LHY 1;  3CCQ A;  1C4Q A;  1YJN A;  4JI0 L;  3K7A B;  3J81 L;  4JC0 A;  2A68 C;  1J5E Q;  2ENB A;  2ICE C;  3HOW H;  2WB1 B;  2FMC A;  4RCN A;  2OTJ A;  2Z4H A;  1JWU D;  2EY2 A;  4N9T A;  4DNI A;  2BDO A;  2XRS D;  1DM0 B;  4IJH A;  4NB3 A;  1E1T A;  5C4H A;  2RCN A;  1OXU A;  1VQD A;  1S4Z A;  3Q8D A;  2Q8T A;  4ZKC B;  3J7A V;  1M90 C;  5EPL A;  1X6O A;  1BDO A;  3K7U C;  4A3G B;  3I72 A;  5JEA J;  2M00 A;  3GTQ B;  4M1U B;  3FHW A;  4KHP L;  4A3F G;  4BY1 B;  5C4J H;  2DY8 A;  1IKM A;  4LW1 A;  1BQQ T;  4PG3 A;  3OWF A;  4F8M A;  3JAM i;  4UP7 A;  3HP3 A;  3MWY W;  3ND9 A;  4POF A;  4A3M H;  3E9H A;  3H3V H;  3FKI H;  3MEF A;  4CKC A;  2HD3 A;  3JC6 6;  2H4O A;  4J15 A;  3HKZ B;  1BCP D;  4C3I H;  1EWI A;  4DPG A;  3K58 A;  4IPC A;  1GJX A;  1GOZ A;  4A3C G;  3UDI A;  4FF4 A;  4P75 A;  3BDO A;  4HCS A;  4XT3 B;  4DUZ Q;  4JI7 Q;  3KDF A;  4I65 A;  3MXN A;  4XYQ A;  3FDT A;  5EBC A;  4A93 G;  2BH8 A;  2A5H A;  2F0N A;  1FNW A;  1S5D D;  5E4X A;  4MHE A;  2F0I A;  1MIU A;  2MPM A;  1T5X D;  1ASY A;  4IFD G;  1Y14 B;  3KF8 A;  2B63 B;  1C0A A;  2LXK A;  2Z8L A;  1IYJ B;  1VMP A;  2E2I B;  3F2C A;  1EOV A;  2PQA B;  2KEN A;  2V4D A;  1EY5 A;  2UU9 L;  3S14 H;  4DNT B;  2D0P A;  1Y8N B;  1PH4 A;  4OL7 A;  4QUC A;  1HTP A;  1SE8 A;  4BBR B;  3HOV B;  1HA5 A;  3UDF A;  2UUC Q;  3CRL C;  2WB1 G;  2B8F A;  4UAI A;  1X3G A;  3H0G G;  2ZTD A;  2WAQ G;  3D4R A;  3WOE A;  1QVC A;  1W6K A;  2KBN A;  5KND A;  4YWL A;  4HED A;  1LAB A;  5M3M B;  4RFB A;  1B1Z A;  3FKI B;  1II3 A;  4ZUI A;  5IYB G;  1AZP A;  2DJF C;  2K05 A;  1W3S A;  2ZJP A;  4LF9 L;  4DUY Q;  1SDF A;  1VQG A;  1WD1 A;  1B9M A;  3QIA A;  3TSS A;  2K03 A;  2L11 A;  5BR8 Q;  3MTS A;  2PZU A;  5IT9 L;  2B29 A;  3VR5 A;  2NVX H;  1P16 A;  2F0F A;  1PH5 A;  4BY1 H;  4GNX B;  3IL8 A;  5CV5 A;  2N55 A;  4A3G H;  4C3J G;  1K83 B;  4M8A A;  2K04 A;  5J3B A;  2MO1 A;  1UNS A;  1XYI A;  1Z9F A;  2VUM H;  3GTL B;  1XMO L;  3KJP A;  1HZC A;  2QDB A;  3R3O A;  2QEJ C;  4BS9 A;  1OO9 B;  4E6I A;  3S9W A;  3I70 A;  1EIY B;  2L0C A;  2B3G A;  4A3G G;  1PYS B;  5JAV A;  2NN6 H;  3U4Z A;  1LV9 A;  5LMU L;  2KCM A;  1DXM A;  1ESF A;  1BUV T;  4IPD A;  2PW5 A;  1QUQ B;  1WTH A;  2F4V Q;  3HOV H;  4A3B H;  1I50 B;  3J7Z C;  4DA2 A;  4B9X A;  4JI1 L;  4K0K Q;  1L1O B;  4HN7 A;  1YZ6 A;  4N8F A;  4RGT A;  2OEO A;  5DNF A;  5FJ8 H;  3A56 A;  2BOS A;  2ZXP A;  3ICE A;  1KRT A;  1RDP D;  2RCF A;  1D2B A;  1GKH A;  3J80 L;  1KDA A;  2KHI A;  2E8G A;  2F0U A;  2XNA C;  1IZ6 A;  3ERS X;  1S5F D;  2VNU D;  4IUT A;  2XVS A;  2AQ3 B;  1SNM A;  4HJ7 A;  1GUT A;  4A3E B;  2UU9 Q;  4GNX A;  1EZ6 A;  4RGN A;  1HNZ Q;  1L1O C;  5BR8 L;  3U50 C;  3HOZ G;  1R9T B;  1IHZ A;  1EOT A;  1EY6 A;  2R7D A;  4K2K A;  1KAA A;  3LNN A;  3I4L A;  2NB0 A;  3DWA A;  2CHB D;  4ZRZ A;  1EEI D;  1X54 A;  4A3F B;  3L7Z C;  4CKB A;  1CKO A;  1STY A;  2WAQ B;  5KYL A;  4BBS B;  1WOC A;  3K6O A;  4KN4 C;  2TSS A;  4KKU A;  4XXE A;  1I6V C;  2JP1 A;  2PNR C;  3PUV A;  1YBY A;  4DFA A;  3RZD B;  4AH6 A;  1TQO A;  4JI7 L;  2WP8 J;  1CA6 A;  4C2M B;  4H44 C;  5TSS A;  2UUC L;  2IX3 A;  2Q2U A;  3D6C A;  2VQF Q;  4S3S A;  3PO3 B;  5C4J B;  1MKH A;  3QJY A;  4IJL A;  1SYG A;  3LWU A;  1XPU A;  3H09 A;  3GTP H;  1LT6 D;  1LTG D;  4K14 A;  5COY A;  1G91 A;  3W2D A;  1F9R A;  3K57 A;  2UUB L;  1EQR A;  4L6T B;  1VQ5 A;  4CDE C;  3T13 A;  3KBG A;  1VQJ A;  2NZ1 D;  2A19 A;  1H9R A;  4QB4 A;  4BBS H;  3HOW B;  4DAM A;  4JI3 Q;  2F0E A;  4I7Z C;  3K7A H;  3KDF B;  1L2F A;  1VQ4 A;  1KL9 A;  2A68 D;  4F88 A;  1U4P A;  1A2T A;  2OQK A;  4J8Q A;  2OXP A;  4IFD I;  3H94 A;  1G29 1;  5ELC A;  1G2T A;  1CK1 A;  2DNE A;  2JEB I;  2WIN B;  4HCE A;  1Z47 A;  3E3X A;  3T16 A;  1HNW L;  2FMM A;  1G2S A;  3I90 A;  5D3D A;  2G5D A;  3DM3 A;  3GTJ B;  1EYA A;  3HKZ G;  3Q6S A;  4GKK Q;  1TY0 A;  3HFZ B;  3RN5 A;  3MAQ A;  2GVA A;  2LSS A;  1CUK A;  1JWS D;  3KLW A;  1EU4 A;  3OMC A;  4JI8 L;  1QZG A;  5FKA C;  2MQH A;  3DEP A;  4YWK A;  1HHV A;  1QNK A;  2UUA Q;  3HRZ C;  2QIL A;  4DV0 Q;  1CT1 D;  3CC2 A;  2UXB Q;  1FJG L;  4BY1 G;  2Z4I A;  1CZG A;  4A3L H;  2CKZ B;  4MZ9 A;  2QCP X;  1KDC A;  3OHX C;  2UXC L;  4KHP Q;  4HJA A;  4O1N A;  4LNQ A;  3VR6 A;  1FGB D;  3BDC A;  4F7X A;  3GQB A;  3I73 A;  3HEJ A;  3I55 A;  4FF3 A;  4KJO A;  2NVT H;  5CV7 A;  1AE3 A;  2H1E A;  5D14 A;  1VQN A;  1K8A C;  2ZXR A;  4DR5 L;  3EFX D;  3VR2 A;  3URY A;  4ABN A;  3L9A X;  5A2Q L;  1PRT F;  3ZYY X;  1VDZ A;  2D62 A;  2HUG A;  3UE0 A;  1G6Z A;  3G4S A;  2E75 C;  4DR7 L;  1BR9 A;  2EQS A;  4JK1 C;  4A3K G;  1PZI D;  5C4X B;  1PLF A;  2F0H A;  3DM1 A;  4P2C B;  3TS2 A;  1E2V A;  1IKL A;  4DR3 L;  3SXH A;  3NTI A;  5IWA L;  4P74 A;  3CC4 A;  3I8Z A;  2NVT B;  1J8I A;  3M3Y B;  1SSO A;  5KRU A;  1WTX A;  1G8Z D;  4HJ8 A;  2F0J A;  2K5Q A;  3D8G A;  3CPF A;  4L5T A;  4HMI A;  2D0O A;  1WCM H;  5C0X J;  3MXP A;  5C3E B;  4DR3 Q;  5JJI A;  2EJG C;  1G6P A;  3KK7 A;  4X62 L;  1X3F A;  1JOR A;  1TWG B;  1N36 L;  3JAM c;  2B8G A;  1QZH A;  2EJF C;  4X64 L;  1B70 B;  1WTQ A;  1XMQ L;  4NP5 A;  4JI2 Q;  2D2C C;  1XNR L;  2F0K A;  2UXC Q;  3ULL A;  2JA8 B;  1CKN A;  2C9O A;  3U4V A;  4DK6 C;  4HJ9 A;  3C46 A;  1H9S A;  1FJG Q;  1T5E A;  2F0W A;  2CWP A;  1O7Y A;  3VDY A;  5A2Q E;  5M5W B;  4P72 A;  2YTV A;  1PA6 A;  1KQS A;  4ZQ3 A;  1ASZ A;  1EY7 A;  1SAP A;  5LMN L;  1PTO F;  3I4N H;  1ENF A;  3CCV A;  3DEO A;  1DOM A;  5E4W C;  2RSN A;  1V1O A;  3IFD A;  2E74 C;  1HTL D;  3TRE A;  2A6E C;  1I5F A;  2ZM6 Q;  2C5C A;  2IHE A;  4QMG A;  4LF6 Q;  2Z1C A;  1FVI A;  1TWC H;  5IOC A;  1VQ6 A;  1T9H A;  4X3T A;  1BXT A;  1NUC A;  4YWM A;  4KD3 A;  4HIK A;  4G7H C;  1HH2 P;  3M7N A;  2VL6 A;  1ICF B;  3VYR A;  4WJ3 M;  3NP8 A;  2VUM B;  1HZB A;  1HNW Q;  4RA8 A;  4DU9 A;  4KI0 A;  4X66 L;  3A54 A;  1Y1V B;  3OW7 A;  1X55 A;  3PF4 A;  1STH A;  4Q5V A;  1UE1 A;  2I46 A;  3GTM H;  1SNP A;  2JA6 G;  3DXJ C;  5FOB B;  1K8O A;  1RTO A;  2K50 A;  3FPU B;  1UEA B;  4LK1 C;  3VR4 A;  3RZD H;  2A6H C;  1TWA B;  3S24 A;  2WFW A;  2HCC A;  2UUB Q;  3D4D A;  2SOB A;  2YV5 A;  3K5O A;  4A3L G;  1EL0 A;  1BNZ A;  1XJV A;  1DYQ A;  3HKZ E;  3BZD B;  4DV1 L;  1CM9 A;  1A63 A;  4YY3 L;  2A74 C;  5BN3 A;  3NQT A;  3A8I E;  3VYU A;  2R93 H;  3P1H A;  2E2J B;  5EPK A;  4A3J H;  2KCN A;  4BBR H;  4DR1 L;  1H9S B;  2V1C C;  1BCP F;  4LWC A;  4KHZ A;  1Q1E A;  2QKI C;  2F3V A;  5C5L A;  4POG A;  4RGO S;  4IUP A;  4A4I A;  5IGB A;  4R8N A;  1N34 Q;  3TDQ A;  3SR1 A;  1IBK L;  2JA8 H;  5IYD H;  1AEX A;  4U67 3;  1PZJ D;  1JOO A;  2L12 A;  3AFQ A;  3TP7 A;  4R1J A;  1F77 A;  3T1H Q;  4RAU C;  1D1I A;  4X3S A;  4PZ7 A;  1JOK A;  3HOY B;  4DR4 L;  2K6A A;  4A3J B;  3TP8 A;  4A3I H;  5EKL A;  3RN2 A;  1YHB A;  4JI5 Q;  3OYY A;  3EIV A;  4GS3 A;  2MNA A;  4DR6 Q;  4IUN A;  1GUO A;  1LTR D;  2OWO A;  1ILP A;  1ML0 D;  5I4D A;  4JI8 Q;  4B3M L;  4FXK C;  1R4P B;  1NAP A;  3NBH A;  3X3N A;  4JBK A;  5D3I B;  3M3Y H;  2PPB C;  2KCT A;  3CC7 A;  4HID A;  4XQJ A;  5FLX E;  4LF4 Q;  1IYU A;  1R4Q B;  1YHQ A;  5M5X B;  2N49 A;  4LMQ D;  4AYB B;  2Q8I B;  5IT9 E;  2Z6K A;  3J80 c;  1XPR A;  5ELD A;  4ME3 A;  1M4V A;  4R8I A;  1N32 L;  2PMZ E;  2F52 A;  3NEN A;  1YNJ D;  2NTS A;  4DV5 L;  3BDL A;  4KJN A;  3X3M A;  5IYC H;  2BH2 A;  1I94 Q;  5IP7 G;  4OON A;  1PFS A;  1G51 A;  1QWY A;  3RUZ A;  1NSN S;  3PF5 A;  1SE3 A;  4DN4 M;  5CYU A;  2BCO A;  5KEE A;  4A93 H;  1PTO B;  3MXU A;  3K5M A;  4EGV A;  3RR5 A;  5EKK A;  3AU7 A;  1ET9 A;  3KBX A;  1B4O A;  3HS0 C;  4PQX A;  4DR6 L;  1O7I A;  4K2L A;  1YNX A;  1DOK A;  1XMO Q;  4IN3 A;  1HR0 L;  2SNS A;  1F2L A;  4R9W A;  2R92 G;  3CPW A;  1WCM G;  2X6G A;  3CQZ B;  3D3R A;  3PO2 G;  2XRQ D;  3HOY H;  5C0X G;  3HOZ B;  1K3R A;  1NBW A;  1WFQ A;  3EBE A;  4JI1 Q;  3I4N B;  4K0K L;  1AP0 A;  4GOP C;  2ZJQ A;  3KF6 A;  3KF8 B;  5AFW A;  3LX0 A;  2VQF L;  4JPB W;  2YU9 H;  3BU2 A;  1X65 A;  5IOD A;  4P73 A;  4NXN Q;  5M5W H;  2VQE L;  2CFM A;  4C3H B;  1Q81 C;  2EYM A;  2QDL A;  4OO1 H;  4KHV A;  2BDN A;  2MO0 A;  4NXN L;  1XX8 A;  2O4X A;  5C0X H;  1TWF B;  1YNN C;  4B3S L;  2R7Z G;  1YEZ A;  1IBL Q;  1I4R A;  3C3L A;  3K80 C;  3M4P A;  4GOP B;  5NUC A;  1L1O A;  1XTD A;  4X6A H;  1HR0 Q;  4JOI A;  3CCR A;  1WCM B;  2JSO A;  4OWT B;  1EFW A;  2YYZ A;  4DR4 Q;  1A62 A;  4C3I B;  4NXM Q;  2PO4 A;  1VQO A;  4QY7 A;  3O13 A;  1SNQ A;  5E1F A;  1STN A;  4K6D A;  1TWA H;  3CCM A;  1HA6 A;  4A3M B;  2MJ8 A;  1SYF A;  4EQP A;  2K5W A;  2F03 A;  5IYD G;  4PZ8 A;  2PI2 E;  3GTM B;  3PO3 G;  3DWP A;  1N32 Q;  1VQH A;  1A15 A;  4G4K A;  2E2H H;  4L8J A;  1O80 A;  5F2D A;  1MD2 D;  4A3M G;  4EQO A;  1LYL A;  3UI2 A;  4ULL A;  1SYB A;  3W1B A;  3U9O A;  1KAB A;  1CI3 M;  3J81 c;  2FXQ A;  4GLV B;  4GLX A;  1JMC A;  4LUV A;  3J80 E;  1I3Q B;  3MZ5 A;  5DLQ E;  1KRS A;  1A3V A;  3RLN A;  3FP9 A;  1JIC A;  1WTO A;  1HCZ A;  3W1G A;  2MFI A;  1JQY D;  2PQE A;  4UP9 A;  1EIG A;  1IXR A;  4LF6 L;  1Q7Y C;  4R4T A;  2UXD Q;  2IW3 A;  4A3I B;  2F0V A;  1I6H B;  3K0Y A;  1EZ8 A;  2OT2 A;  4JW0 A;  1KNA A;  4XQQ A;  3RZO B;  4IFD H;  5CC4 A;  1JWM D;  4LF7 L;  4RWS C;  4RHR A;  3PIP A;  4LF9 Q;  2VB3 X;  1YNN D;  3PIP 3;  3BVZ A;  1BF4 A;  3J7A 5;  1HQR D;  1VQC A;  3QR8 A;  3PMF A;  1EIF A;  4LAA A;  4PZ6 A;  2OCE A;  2QW7 A;  2JQO A;  4LF5 L;  1VQI A;  4N9P A;  1H9M A;  5M5Y H;  3F2D A;  1U0L A;  1OXV A;  1FYC A;  4DGZ A;  1SRU A;  3NQI A;  2XTI A;  2LMC B;  2F0T A;  2R92 B;  5BN5 A;  4A3B B;  2AKW B;  4OXP A;  4ODG A;  4JYA Q;  4JI0 Q;  5LMN W;  3BS1 A;  2F0P A;  1PV4 A;  2DY7 A;  2ZT9 C;  1RF2 D;  2EYF A;  2FFK B;  4RHS A;  3VYS A;  3C1F A;  4C3J B;  2R7F A;  3TQY A;  5GAG C;  3P7J A;  2EJM A;  3C1E A;  1EU3 A;  1XWE A;  3NHH A;  5ISR A;  2JK8 A;  3I2Z A;  2NUC A;  1JE5 A;  1SMY D;  2EDG A;  2RVL A;  2B2T A;  5HY6 A;  2I07 B;  2PYK A;  2CQA A;  1I3Q H;  3TP6 A;  3MA2 B;  4KY5 A;  4DR2 Q;  1E7Z A;  1RD9 D;  4GN5 A;  2O5I C;  4CJ0 B;  1SYE A;  1LTL A;  1NMF A;  4BXX H;  1QOH A;  5JEA H;  4QCL A;  1OXX K;  2F1M A;  1JJC B;  1EYC A;  1SYD A;  1ZXT A;  2PZT A;  5C3W A;  1K83 H;  3RMH A;  1E2W A;  1LM0 A;  5K36 G;  4OEL B;  1QVF A;  5KYI A;  4JYA L;  3S1R B;  1ZYR D;  1BO0 A;  4RH6 A;  1J5E L;  4DXF A;  4EX5 A;  1DON A;  1N33 L;  4LFA Q;  4K5W A;  1I4H A;  1VQA A;  1IBM Q;  3WWV A;  2R61 A;  4DR5 Q;  3CW2 C;  2JXM B;  1ICW A;  5DM6 3;  2QA4 A;  1EQV A;  3A8J E;  4DV3 Q;  5D65 A;  1PH1 A;  1QE6 A;  1HQM C;  4I7A A;  2F0M A;  4DR2 L;  1UE6 A;  2TMP A;  3M9B A;  4NDX A;  1PFN A;  3H0G B;  1SRO A;  3IAY A;  3DWQ A;  1E1O A;  3QB3 A;  5G3L F;  2PW7 A;  3TS0 A;  4JOI C;  2MHV A;  1JB3 A;  2UXB L;  2Y0S G;  4Y7N H;  3BZC A;  1X3E A;  4BBR G;  5C5M A;  2F0S A;  3CCL A;  4JV5 L;  2KCC A;  3NTK A;  5K5P A;  1STE A;  4YHH Q;  4Y52 H;  5I2X A;  1MSH A;  2O2L D;  1X3Q A;  1ESR A;  4DAP A;  4CJ1 B;  1TS4 A;  4LUZ A;  4DAY A;  2E5L Q;  1SFO H;  3S2H B;  1BOS A;  1AW7 A;  4PMW A;  2EY5 A;  3A0J A;  3K5N A;  3H3V I;  4PMC A;  1YJW A;  2LY7 A;  5I6Y A;  4TRD A;  3NE5 B;  2A73 B;  4QQB X;  4G57 A;  4AYB G;  3NWS A;  1DGS A;  2JA7 B;  2JA6 H;  2I5H A;  2DNC A;  1YNJ C;  4OX9 Q;  3CCE A;  1HNX L;  1B8A A;  3GD7 A;  1EY8 A;  2EY6 A;  1NNX A;  1Q8K A;  2EPB A;  5CGK A;  4H13 C;  2KVM A;  1VF5 C;  1EWC A;  4L5S A;  4CDD C;  2K5N A;  3H91 A;  3KLS X;  4JI3 L;  4UPA A;  3BYT B;  1I4Q A;  2F3I A;  4KK7 A;  1A0I A;  1HFN A;  2AUJ D;  5IP9 H;  4GKK L;  3QO2 A;  3CMA A;  4WFN 3;  3KYH C;  4XT1 B;  1PMR A;  5M3F H;  1Q46 A;  2EYO A;  3IRB A;  1ONL A;  4OHJ A;  4TSS A;  4A3J G;  2LS0 1;  2XWJ B;  1WTR A;  4DK3 C;  2PNH A;  1H9K A;  1PH8 A;  1N33 Q;  1N8R C;  1A2U A;  2HQL A;  2B2W A;  1B7Y B;  4IUQ A;  1CHP D;  2A8V A;  5DEH A;  1W2B A;  1GD7 A;  5JJL A;  2NVX B;  5FO9 B;  3PO3 H;  3ER0 A;  4FNF A;  2CW0 D;  1HUN A;  1Q3L A;  2EYL A;  1JJG A;  5M5X H;  4C2M H;  1V1Q A;  2D9U A;  4FF1 A;  4Q0F A;  3OMG A;  2JA5 G;  2OF1 A;  1LUZ A;  1C9O A;  2CWA A;  1S72 A;  1IW7 C;  5C44 H;  3ONA B;  4CGY B;  4OIJ A;  1K3B C;  3I4M H;  2Z6B A;  1I4P A;  2ZTC A;  3EJI A;  2M9V A;  1MI2 A;  1E2Z A;  2N78 A;  5IIF A;  4A3F H;  4UDU C;  4AQY Q;  2L4N A;  4BY7 H;  4HSP A;  5FLM G;  4ME5 A;  2AWN A;  4A75 A;  4UHV A;  1MJE A;  1VQK A;  5M9O A;  3E9I A;  4HJ5 A;  1NJI C;  5GQO A;  1C8C A;  1PYB A;  3PQI A;  4BA1 I;  1LAC A;  4C56 C;  3HOU G;  3SE0 A;  2G9D A;  4V0B A;  3SK4 A;  1VQB A;  3TZU A;  2JA6 B;  2B2V A;  3S15 H;  4R4O A;  3QOJ A;  4BBS G;  1MGS A;  3N6R A;  1Y1V G;  3GTJ H;  5FLM H;  3HKS A;  1SMX A;  2M2L A;  2RBM A;  3S2D B;  1PTO D;  4ZYS A;  1CQV A;  3TN2 A;  5IE8 A;  1A8V A;  1Q8I A;  5E3F A;  1Y1W G;  1LO5 D;  4BWG B;  5IGF A;  1X3P A;  1WTV A;  4G7Z C;  1LTI D;  4IO9 A;  2YU9 B;  1F9S A;  3OIQ A;  3VA5 A;  4GZY C;  1B44 D;  1I50 H;  1HR0 W;  2K28 A;  3AFP A;  1Q82 C;  4DV0 L;  1VQL A;  5T1G A;  3PIO A;  2B2U A;  2BE5 D;  4IOA A;  3P20 A;  3SEB A;  1EY0 A;  4KV6 A;  3TME A;  4FYD A;  2RQX A;  3K5L A;  2EE1 A;  3QOL A;  1AE2 A;  1HRJ A;  1SBB B;  3EN2 A;  4IAL A;  1TWH B;  2F0Q A;  3ERQ A;  3J7A F;  3BJU A;  5FO7 B;  2CVR A;  2K52 A;  1NR4 A;  4OWX B;  3A55 A;  3E5S A;  2A69 D;  4FXG C;  5IGE A;  1BBU A;  1HZ9 A;  3I4O A;  3HG9 A;  5KGU A;  3RNU A;  1H95 A;  4JBM A;  4FP5 D;  4Z9C B;  3W5O A;  5ELO A;  1V1P A;  4QJF A;  1K28 A;  2JE6 I;  3GTQ H;  4B3S Q;  1PFB A;  2MGS A;  3H3V C;  1DZ1 A;  2H5X A;  1BBW A;  1OXT A;  3S1N B;  5LMU Q;  4FF2 A;  3D31 A;  1EY4 A;  1U5K A;  2AUK A;  2NN6 G;  1GUG A;  3NEL A;  2N3S A;  1EY9 A;  4O0A A;  2ZXO A;  1VQM A;  1PRT C;  2Y0S B;  3G6E A;  1PYW D;  3GTO B;  1EFI D;  1JC7 A;  4B3M Q;  1DD2 A;  3SK8 A;  5I9O A;  2Z0S A;  4YCV A;  4C3H G;  2NVQ B;  4C3J H;  1LTS D;  2Q8R E;  4LJZ C;  4UP8 A;  2ZTE A;  1VQE A;  4JI5 L;  1CHQ D;  2VUM G;  4R4Q A;  4LFB Q;  2NN6 I;  1IBL L;  1JCK B;  1A6X A;  4K5V A;  1EYG A;  3J80 i;  3FPP A;  2K14 A;  2BA0 A;  1KXL A;  5JPN C;  1IL2 A;  2RDG A;  3R2T A;  3CCU A;  3J81 i;  4H02 A;  2JA7 H;  4KKS A;  3GP7 A;  1CA5 A;  3A7A B;  3KUP A;  1PH9 A;  5C4X G;  3AEV A;  5KNC A;  1X9N A;  1L0X B;  2A69 C;  1IBK Q;  2ZJR A;  3ULJ A;  2CCZ A;  3EVQ A;  4RG1 A;  2JA8 G;  3HOU B;  1B3A A;  2L9H A;  1D6E C;  3K59 A;  4PMB A;  5EJW A;  1HXY D;  1F9P A;  3DLL A;  5CBA E;  3PCO B;  4XDX A;  3ULP A;  3F1Z A;  3FKI G;  2AMC B;  3K8A A;  2VY3 A;  3V2T A;  4X66 Q;  4R4I A;  4RCO A;  2RDH A;  1HNZ L;  2QF7 A;  2K5D A;  2I5M X;  3KOJ A;  3E0E A;  3PUY A;  5C3E G;  3NWT A;  5HGQ A;  4TQU S;  3JAM L;  1GXD C;  3CXC A;  4DXG A;  2J0T D;  4ZLT F;  1VMC A;  4IUR A;  1JR0 D;  4CJ2 C;  2KQ3 A;  3TZD A;  2IY5 B;  3ZJY C;  1ILQ A;  3TRZ A;  1UAP A;  3STB C;  4WRD A;  5C44 G;  1RIP A;  1RCV D;  1RTN A;  3GDE A;  1I94 L;  3R2I A;  2HQE A;  1FD7 D;  2AQ1 B;  2E2H B;  5DAU A;  5H1S E;  1Y1W B;  3S1Q H;  3S1R H;  3SHL A;  1A3U A;  2ES2 A;  1B53 A;  1KAW A;  1WTP A;  3CHB D;  1SEB D;  4HIM A;  3F8T A;  3R93 A;  5FO8 B;  4A3D G;  4GKJ Q;  2RDF A;  4CHT B;  1CTM A;  2VXW A;  3GV6 A;  5CR3 A;  3OW2 A;  2IL8 A;  2QEX A;  5IGC A;  2HIV A;  4TKO B;  2K01 A;  1EWH A;  4OEM B;  1QG7 A;  4OO1 G;  1TS2 A;  4QIW E;  4QIW B;  3LGJ A;  5JVG 3;  4QUF A;  5CBE E;  1R9T H;  4JV5 Q;  2LXJ A;  1AN8 A;  4JG2 A;  2AHO B;  4O42 A;  2R92 H;  4F87 A;  2HDM A;  4NMZ A;  5FLX L;  3I91 A;  2EY1 A;  4PNY A;  3SVM A;  3OPO A;  4RKL A;  2JA5 B;  4HAE A;  2RA4 A;  2E2I H;  1E0B A;  2K75 A;  3CU7 A;  2HHH L;  3A5U A;  4UY8 C;  1NR2 A;  1LT3 D;  2PMZ B;  3S1M H;  1FR3 A;  1QVG A;  4GN4 B;  2K1B A;  4APV A;  2IWH A;  3CD6 A;  4LFA L;  1SNC A;  1S5C D;  3WDN A;  4DNR B;  2EZV A;  1M1K C;  3M4O H;  1RJT A;  5C4Z A;  4J1M A;  5C0X I;  4JVZ A;  1IYV A;  1FGU A;  4H0L C;  1N36 Q;  1Q90 A;  1I6H H;  3CQZ H;  1SE4 A;  1PZK D;  3K0X A;  3EQL C;  3W3A A;  4XYO A;  4JI6 L;  1QCB D;  2E2D C;  2VZA A;  1BBX C;  1Z6H A;  1DCZ A;  1D7Q A;  2NVQ H;  1E22 A;  2WV6 D;  4L5Q A;  4DV1 Q;  2Q2I A;  2OTL A;  1Q86 C;  1D5X C;  1PTO H;  1TII D;  1C7Y A;  5IGG A;  3QWN A;  2B2T C;  4EVO A;  1SNO A;  4X65 Q;  2GN5 A;  4V19 0;  5ELN A;  2KOL A;  1BCP C;  3MEH A;  1I4G A;  1FNV A;  1VQ9 A;  1GHK A;  1EQQ A;  3D0F A;  2DUD A;  5GAD C;  4A76 A;  2UUA L;  3KF6 B;  1ENA A;  4GOP A;  1WJJ A;  3GTP B;  2GVB A;  3ERO A;  3NK9 A;  1F2Y A;  1Q12 A;  5IYC G;  4HTH A;  1SR3 A;  4DUZ L;  1CFM A;  1B9N A;  1K0R A;  2R3Z A;  2IPK D;  4B3R Q;  3CF5 A;  5M3F B;  5C3X A;  1TR5 A;  5M3M G;  4KY6 A;  3J7Y W;  2RKS A;  3J81 j;  1D8L A;  4LF7 Q;  4OIK A;  5JVH 3;  3FMC A;  3Q23 A;  1N9W A;  2ASB A;  1SMY C;  3T4A C;  5DM7 3;  2JYO A;  4A3K H;  1YIT A;  1F2Z A;  3E0J A;  4B3R L;  2IX0 A;  1SLJ A;  4FXD A;  3G71 A;  3A7L A;  1MHW C;  1L0Y B;  3CP0 A;  1CKM A;  3VA7 A;  5GAE C;  2L55 A;  4IZ8 A;  4G7O C;  2XWB B;  2RSO A;  2XIW A;  1EIH A;  1TWF H;  1Y8O B;  3M4Q A;  3S14 B;  1O78 A;  3PUW A;  2XSC A;  3T53 B;  1JT8 A;  1NTG A;  1SYC A;  1B3Q A;  2AQ2 B;  2A1A A;  2PZW A;  4X65 L;  3MHB A;  1C48 A;  3LWE A;  4DV6 L;  3AB9 A;  2MUY A;  4YCU A;  1WYD A;  5ELE A;  4A3C H;  3KJO A;  2RF4 A;  3PIO 3;  5IP7 H;  1S5E D;  2KED A;  3HOY G;  1WVL A;  1K73 C;  5JJZ A;  1PTO C;  2JJQ A;  3MXG A;  3S17 B;  1V9P A;  3GO5 A;  3FRP B;  3JAM E;  4MTN A;  3OTO L;  4A3D B;  5FK9 C;  2R6G A;  3GTG H;  1TS5 A;  2IT1 A;  2Y0S E;  3EA6 A;  1LLR D;  2ALY B;  4ZUJ A;  1IBM L;  5EPJ A;  1STA A;  2SDF A;  4ZCK A;  2F0L A;  3DUZ A;  3OIP A;  1KTK A;  5CV8 A;  1XNQ Q;  1BCP B;  4J6H A;  5EQ0 A;  4DV6 Q;  1P8L A;  1RKN A;  1NCV A;  4ILW A;  4X3U A;  2GA4 B;  4AIM A;  1D1K A;  4JBW A;  1YHA A;  1I4X A;  3L3O C;  5IGD A;  4X3K A;  1SXT A;  5ELF A;  4DR7 Q;  4DV7 Q;  5GRO A;  2MP1 A;  3TEH B;  2WAQ E;  5HGT A;  2YTY A;  5L37 A;  1LTB D;  2Z6K C;  5KIX A;  3L0O A;  1Y1V H;  5CV6 A;  4MN3 A;  4C1N K;  1YIJ A;  4GLA C;  1PH7 A;  3NBI A;  3HGB A;  4DV2 Q;  2JA9 A;  4GNX C;  4CKE A;  5IYB H;  3CKI B;  1IL8 A;  4DV4 L;  3UE1 A;  4LUO A;  2KEE A;  1GM5 A;  4H7B A;  3BZK A;  1U4L A;  1KC8 C;  3V96 A;  4DK0 A;  2VB2 X;  3A5Z B;  4EQ5 A;  1CSP A;  1ZEQ X;  3NXW A;  1STB A;  1TKW B;  1TWH H;  2EYH A;  4LF5 Q;  3FEW X;  4IQZ A;  4JI4 Q;  1K8G A;  4DF7 A;  4ID6 A;  1RHP A;  4GKJ L;  1KIX A;  2CH4 A;  2UXD L;  3CCS A;  2EOT A;  4LFC Q;  2A6H D;  2F0O A;  1ZYR C;  3Q24 A;  1ENC A;  2KJX A;  1EUJ A;  2E76 C;  4A3E H;  3S17 H;  4KTA A;  2KHS A;  1CKN B;  3HZX A;  4NKL A;  1Y69 U;  2NBF A;  2K32 A;  3PO2 B;  5A35 A;  2HDL A;  2L5T A;  4IUU A;  2JEA I;  3F2B A;  1AH9 A;  5IY0 A;  1KLU D;  3PSI A;  1RL2 A;  4XTC S;  2N88 A;  4MIU A;  3H15 A;  2PQA A;  1L0W A;  4C3H H;  3L2P A;  4WJ4 A;  1Y8P B;  1M8A A;  2WB1 E;  3G7L A;  3RD4 A;  4DKA C;  5IP9 G;  2JA5 H;  3V05 A;  4A3B G;  4QL5 A;  2KA7 A;  3PV0 A;  3E6Z X;  2SEB D;  3HOZ H;  2PI2 A;  5M3F G;  3N52 A;  4JI6 Q;  2E2J H;  2C35 B;  1FNU A;  5EGT A;  1OTC A;  4Y7N B;  4WOR A;  5C3E H;  2JA7 G;  4BY7 G;  4MTK A;  3GV3 A;  2DJG C;  2B39 A;  3BG3 A;  1WTW A;  2K33 A;  1SND A;  2A6E D;  1SJH D;  1V8Q A;  1PRT D;  4A93 B;  1TVX A;  2D5D A;  1VF7 A;  1JE4 A;  4NXM L;  3R8B A;  3WOF A;  3S16 B;  3ITP A;  5CV4 A;  4A3I G;  1V1P B; 
#chains in the Genus database with same CATH homology
 4HR7 B;  3SDZ A;  2R7Z B;  4ZK9 B;  4C3I G;  1PFM A;  1QB5 D;  3A8K E;  1LTA D;  3T56 B;  4PV1 C;  5EKI A;  3OOC A;  1S5B D;  3G6J B;  1Q1B A;  3ND8 A;  3U9S A;  5G3L D;  2EYP A;  1QJO A;  1F9Q A;  3HOX B;  1LT5 D;  1JOQ A;  4B9W A;  3SK5 A;  1O7Z A;  5I2Y A;  4FO2 A;  3KLR A;  3Q0A A;  4KKT A;  3VYT A;  3I3C A;  2EXZ A;  5J1Z A;  4EQN A;  4K8I A;  4ZKB B;  4KMU C;  3P75 A;  5M5Y B;  1U4M A;  1XXG A;  3T51 B;  3TBI B;  1LTT D;  2EYJ A;  4C1N I;  2FJ2 A;  1KLG D;  4U68 A;  5K36 H;  1F2M A;  2FIN B;  1SE2 A;  4CBV A;  3MFG A;  1ET6 A;  1U4R A;  3GTK B;  3M7G A;  2F0D A;  1EEF D;  3M85 A;  2ICI A;  2B2Y A;  1J9O A;  3Q22 A;  1O7L A;  1TT2 A;  2XN9 C;  1ZKO A;  1ROD A;  1OXS C;  1B2T A;  3MVV A;  1QNU A;  4BY7 B;  2X69 A;  2F3W A;  1VCI A;  3OSO A;  3I4M B;  1CQF A;  5I9P A;  3J81 E;  2CW0 C;  2NYZ D;  1Z7T A;  3NUC A;  3BVG A;  2AWO A;  5J39 A;  4YIJ A;  3H6M A;  1W6J A;  1HUM A;  1AFP A;  4XIG S;  2LKV A;  3S1Q B;  1SJE D;  3SK6 A;  5LL6 S;  5BN4 A;  2J7Z A;  4BA2 I;  1EYD A;  3TP5 A;  4ZAI A;  3FVQ A;  2HCI A;  1TWC B;  3OWE B;  3C2P A;  4HMJ A;  3NSW A;  3AMU A;  3PUX A;  1GUW A;  4RKB A;  2SNM A;  5COR A;  1MBY A;  4OO1 I;  2PCF B;  2K7V A;  1HFG A;  2B2W C;  2BA1 A;  1X32 A;  2IJ0 A;  1DOL A;  3BVM A;  1AZQ A;  3S15 B;  1LT4 D;  1GUN A;  3IKJ A;  1SFO B;  1MSG A;  5LL6 X;  3DMU A;  2WAC A;  4B08 A;  1UUP A;  2NVY B;  2X6L A;  5JEA G;  4IUV A;  2R93 B;  3NTH A;  4HSV A;  1EQT A;  1QIL A;  3RLF A;  4KY7 A;  4A3K B;  2NTT A;  4DAV A;  2WII B;  2BE5 C;  2J4X A;  5KNB A;  5I6W A;  4L63 B;  1IW7 D;  5C6A A;  5C44 B;  2L1B A;  3BYY B;  1K8M A;  3QG1 A;  5CMD A;  1U9R A;  2B2V C;  2KUM A;  1TY2 A;  4IFD J;  3MC0 B;  4NW2 A;  2EVB A;  3D6W A;  5EBD A;  4DK1 A;  2LFN A;  1PDQ A;  4RGM A;  1V43 A;  5ELB A;  3D4W A;  2DN8 A;  4FVM A;  2F0G A;  1H9J A;  1CZW A;  5JOB A;  4XQN A;  1D5Z C;  2B2U C;  1KDB A;  3PUZ A;  2WKC A;  1GUS A;  2KEC A;  2B2Y C;  1TU2 B;  4K6L A;  5T1I A;  1KNE A;  5CV9 A;  2FHT A;  5JPM C;  2IX1 A;  3IFT A;  1B50 A;  1PXU A;  4KD4 A;  3GTG B;  1GHJ A;  1DJR D;  3DHQ A;  1D5M C;  1A3T A;  2WKD A;  3M4Y A;  4QF4 A;  3M4O B;  4K8J A;  2O5J C;  1TS3 A;  1WD0 A;  2NWG A;  3KLS A;  3S1M B;  1XTC D;  4KN7 C;  5HUR A;  4OGQ C;  2F4I A;  4K5X A;  3F2U A;  4WJW A;  2ID0 A;  3CRK C;  5J22 A;  3NPP A;  3MFY A;  1HPC A;  1STG A;  2G9H D;  1PRT B;  3VR3 A;  5LHY 1;  1C4Q A;  3K7A B;  3J81 L;  2A68 C;  2ENB A;  2ICE C;  2WB1 B;  2FMC A;  4RCN A;  2Z4H A;  1JWU D;  2EY2 A;  4N9T A;  2BDO A;  2XRS D;  1DM0 B;  5C4H A;  1OXU A;  1S4Z A;  2Q8T A;  4ZKC B;  3J7A V;  5EPL A;  1BDO A;  4A3G B;  3I72 A;  5JEA J;  2M00 A;  3GTQ B;  4M1U B;  4BY1 B;  2DY8 A;  1IKM A;  1BQQ T;  3OWF A;  4F8M A;  3HP3 A;  3MWY W;  3ND9 A;  4CKC A;  2H4O A;  3HKZ B;  1BCP D;  3K58 A;  1GJX A;  1GOZ A;  4FF4 A;  3BDO A;  4HCS A;  4XT3 B;  4I65 A;  3MXN A;  4XYQ A;  3FDT A;  5EBC A;  2A5H A;  2F0N A;  1FNW A;  1S5D D;  5E4X A;  4MHE A;  2F0I A;  2MPM A;  1T5X D;  4IFD G;  3KF8 A;  2B63 B;  2Z8L A;  1VMP A;  2E2I B;  2V4D A;  1EY5 A;  4DNT B;  1Y8N B;  4OL7 A;  4QUC A;  1HTP A;  4BBR B;  3HOV B;  1HA5 A;  3CRL C;  2B8F A;  4UAI A;  3D4R A;  3WOE A;  1W6K A;  5KND A;  4HED A;  5M3M B;  1LAB A;  4RFB A;  1B1Z A;  3FKI B;  1II3 A;  4ZUI A;  1AZP A;  2K05 A;  1SDF A;  1WD1 A;  1B9M A;  3QIA A;  3TSS A;  2K03 A;  2L11 A;  3MTS A;  2PZU A;  5IT9 L;  3VR5 A;  2F0F A;  3IL8 A;  5CV5 A;  2N55 A;  4C3J G;  1K83 B;  4M8A A;  2K04 A;  1UNS A;  1XYI A;  3GTL B;  2QDB A;  3R3O A;  2QEJ C;  4BS9 A;  1OO9 B;  4E6I A;  3S9W A;  3I70 A;  2L0C A;  5JAV A;  2NN6 H;  1LV9 A;  1DXM A;  1ESF A;  1BUV T;  2PW5 A;  1I50 B;  4DA2 A;  4B9X A;  4HN7 A;  4RGT A;  2OEO A;  5DNF A;  3A56 A;  2BOS A;  2ZXP A;  1RDP D;  1D2B A;  3J80 L;  1KDA A;  2F0U A;  2XNA C;  1S5F D;  2VNU D;  4IUT A;  2XVS A;  2AQ3 B;  1SNM A;  1GUT A;  4A3E B;  1EZ6 A;  4RGN A;  1R9T B;  1IHZ A;  1EOT A;  1EY6 A;  4K2K A;  1KAA A;  3LNN A;  3I4L A;  2NB0 A;  3DWA A;  2CHB D;  4ZRZ A;  1EEI D;  4A3F B;  3L7Z C;  4CKB A;  1STY A;  2WAQ B;  5KYL A;  4BBS B;  3K6O A;  4KN4 C;  2TSS A;  4KKU A;  4XXE A;  1I6V C;  2JP1 A;  2PNR C;  3PUV A;  4DFA A;  3RZD B;  1TQO A;  2WP8 J;  1CA6 A;  4C2M B;  4H44 C;  5TSS A;  2IX3 A;  3D6C A;  4S3S A;  3PO3 B;  5C4J B;  3QJY A;  1SYG A;  3LWU A;  3H09 A;  1LT6 D;  1LTG D;  4K14 A;  5COY A;  1G91 A;  3W2D A;  1F9R A;  3K57 A;  4L6T B;  3T13 A;  3KBG A;  2NZ1 D;  1H9R A;  4QB4 A;  3HOW B;  2F0E A;  4I7Z C;  2A68 D;  4F88 A;  1U4P A;  1A2T A;  4J8Q A;  2OXP A;  4IFD I;  3H94 A;  1G29 1;  5ELC A;  1G2T A;  1CK1 A;  2DNE A;  2JEB I;  2WIN B;  4HCE A;  1Z47 A;  3T16 A;  2FMM A;  1G2S A;  3I90 A;  5D3D A;  3GTJ B;  1EYA A;  3Q6S A;  1TY0 A;  3MAQ A;  1JWS D;  3OMC A;  1EU4 A;  5FKA C;  3DEP A;  1HHV A;  1QNK A;  3HRZ C;  2QIL A;  1CT1 D;  2Z4I A;  1CZG A;  2QCP X;  1KDC A;  3OHX C;  4O1N A;  3VR6 A;  1FGB D;  3BDC A;  4F7X A;  3GQB A;  3I73 A;  3HEJ A;  4FF3 A;  4KJO A;  5CV7 A;  2H1E A;  5D14 A;  2ZXR A;  3EFX D;  3VR2 A;  3URY A;  4ABN A;  3L9A X;  5A2Q L;  1PRT F;  3ZYY X;  1VDZ A;  2D62 A;  2HUG A;  1G6Z A;  2E75 C;  1BR9 A;  4JK1 C;  1PZI D;  5C4X B;  1PLF A;  2F0H A;  3DM1 A;  4P2C B;  1E2V A;  1IKL A;  3SXH A;  3NTI A;  3I8Z A;  2NVT B;  1J8I A;  3M3Y B;  1SSO A;  5KRU A;  1WTX A;  1G8Z D;  2F0J A;  2K5Q A;  3D8G A;  4HMI A;  5C0X J;  3MXP A;  5C3E B;  2EJG C;  3KK7 A;  1JOR A;  1TWG B;  2B8G A;  2EJF C;  1WTQ A;  4NP5 A;  2D2C C;  2F0K A;  2JA8 B;  2C9O A;  3C46 A;  1H9S A;  1T5E A;  2F0W A;  1O7Y A;  5A2Q E;  5M5W B;  4ZQ3 A;  1EY7 A;  1SAP A;  1PTO F;  1ENF A;  3DEO A;  1DOM A;  5E4W C;  2RSN A;  1V1O A;  3IFD A;  2E74 C;  1HTL D;  2A6E C;  2C5C A;  4QMG A;  2Z1C A;  5IOC A;  4X3T A;  1BXT A;  1NUC A;  4KD3 A;  4G7H C;  3M7N A;  3VYR A;  3NP8 A;  2VUM B;  4RA8 A;  4DU9 A;  4KI0 A;  3A54 A;  1Y1V B;  3OW7 A;  1STH A;  4Q5V A;  2I46 A;  1SNP A;  3DXJ C;  5FOB B;  1K8O A;  1RTO A;  3FPU B;  1UEA B;  4LK1 C;  3VR4 A;  2A6H C;  1TWA B;  2HCC A;  3D4D A;  2SOB A;  3K5O A;  1EL0 A;  1BNZ A;  1DYQ A;  3BZD B;  1CM9 A;  2A74 C;  5BN3 A;  3NQT A;  3A8I E;  3VYU A;  3P1H A;  2E2J B;  5EPK A;  2KCN A;  1H9S B;  1BCP F;  4KHZ A;  1Q1E A;  2QKI C;  2F3V A;  5C5L A;  4RGO S;  4IUP A;  5IGB A;  4R8N A;  3TDQ A;  3SR1 A;  1AEX A;  4U67 3;  1PZJ D;  1JOO A;  2L12 A;  3TP7 A;  1F77 A;  4RAU C;  1D1I A;  4X3S A;  1JOK A;  3HOY B;  2K6A A;  4A3J B;  3TP8 A;  5EKL A;  4IUN A;  1GUO A;  1LTR D;  1ILP A;  1ML0 D;  5I4D A;  4FXK C;  1R4P B;  1NAP A;  3NBH A;  3X3N A;  5D3I B;  2PPB C;  4XQJ A;  5FLX E;  1IYU A;  1R4Q B;  5M5X B;  4LMQ D;  4AYB B;  2Q8I B;  5IT9 E;  5ELD A;  1M4V A;  4R8I A;  1YNJ D;  2NTS A;  3BDL A;  4KJN A;  3X3M A;  1QWY A;  3RUZ A;  1NSN S;  1SE3 A;  4DN4 M;  5CYU A;  2BCO A;  5KEE A;  1PTO B;  3MXU A;  3K5M A;  4EGV A;  5EKK A;  3AU7 A;  1ET9 A;  3KBX A;  1B4O A;  3HS0 C;  4PQX A;  4K2L A;  1DOK A;  4IN3 A;  2SNS A;  1F2L A;  4R9W A;  2X6G A;  3CQZ B;  3D3R A;  2XRQ D;  5C0X G;  3HOZ B;  3I4N B;  1AP0 A;  5AFW A;  3LX0 A;  5IOD A;  4C3H B;  2EYM A;  4OO1 H;  4KHV A;  2BDN A;  1XX8 A;  2O4X A;  5C0X H;  1TWF B;  1YNN C;  1I4R A;  3C3L A;  5NUC A;  1WCM B;  2JSO A;  2YYZ A;  4C3I B;  2PO4 A;  3O13 A;  1SNQ A;  5E1F A;  1STN A;  4K6D A;  1HA6 A;  4A3M B;  2MJ8 A;  1SYF A;  4EQP A;  2K5W A;  2F03 A;  3GTM B;  3DWP A;  1A15 A;  4G4K A;  4L8J A;  1O80 A;  5F2D A;  1MD2 D;  4EQO A;  3UI2 A;  4ULL A;  1SYB A;  3U9O A;  1KAB A;  1CI3 M;  3J80 E;  1I3Q B;  3MZ5 A;  1A3V A;  1JIC A;  1WTO A;  1HCZ A;  1JQY D;  2PQE A;  1EIG A;  2IW3 A;  4A3I B;  2F0V A;  1I6H B;  3K0Y A;  1EZ8 A;  2OT2 A;  1KNA A;  4XQQ A;  3RZO B;  4IFD H;  5CC4 A;  1JWM D;  4RWS C;  4RHR A;  2VB3 X;  1YNN D;  3PIP 3;  3BVZ A;  1BF4 A;  1HQR D;  3PMF A;  4LAA A;  4N9P A;  1H9M A;  1OXV A;  1FYC A;  4DGZ A;  3NQI A;  2LMC B;  2F0T A;  2R92 B;  5BN5 A;  4A3B B;  4ODG A;  3BS1 A;  2F0P A;  2DY7 A;  2ZT9 C;  1RF2 D;  2EYF A;  2FFK B;  4RHS A;  3VYS A;  3C1F A;  4C3J B;  3P7J A;  2EJM A;  3C1E A;  1EU3 A;  1XWE A;  3NHH A;  5ISR A;  2NUC A;  1SMY D;  2EDG A;  2RVL A;  2B2T A;  2I07 B;  2PYK A;  2CQA A;  3TP6 A;  3MA2 B;  4KY5 A;  1RD9 D;  2O5I C;  4CJ0 B;  1SYE A;  1QOH A;  5JEA H;  4QCL A;  1OXX K;  2F1M A;  1EYC A;  1SYD A;  1ZXT A;  2PZT A;  5C3W A;  3RMH A;  1E2W A;  5K36 G;  5KYI A;  3S1R B;  1ZYR D;  1BO0 A;  4RH6 A;  4DXF A;  1DON A;  4K5W A;  1I4H A;  2R61 A;  2JXM B;  1ICW A;  5DM6 3;  1EQV A;  3A8J E;  5D65 A;  1QE6 A;  1HQM C;  2F0M A;  2TMP A;  4NDX A;  1PFN A;  3H0G B;  3IAY A;  3DWQ A;  3QB3 A;  5G3L F;  2PW7 A;  2MHV A;  1JB3 A;  5C5M A;  2F0S A;  2KCC A;  3NTK A;  5K5P A;  1STE A;  5I2X A;  1MSH A;  2O2L D;  1X3Q A;  1ESR A;  4DAP A;  4CJ1 B;  1TS4 A;  4DAY A;  3S2H B;  1BOS A;  1AW7 A;  4PMW A;  2EY5 A;  3K5N A;  4PMC A;  2LY7 A;  5I6Y A;  4TRD A;  3NE5 B;  2A73 B;  4G57 A;  3NWS A;  2JA7 B;  2DNC A;  1YNJ C;  3GD7 A;  1EY8 A;  2EY6 A;  2EPB A;  5CGK A;  4H13 C;  2KVM A;  1VF5 C;  1EWC A;  3H91 A;  3KLS X;  3BYT B;  1I4Q A;  4KK7 A;  1HFN A;  2AUJ D;  3QO2 A;  4WFN 3;  4XT1 B;  1PMR A;  2EYO A;  4OHJ A;  1ONL A;  4TSS A;  2LS0 1;  2XWJ B;  1WTR A;  1H9K A;  1A2U A;  2B2W A;  4IUQ A;  1CHP D;  5DEH A;  2NVX B;  5FO9 B;  4FNF A;  2CW0 D;  1HUN A;  1Q3L A;  2EYL A;  2D9U A;  4FF1 A;  4Q0F A;  3OMG A;  2OF1 A;  1IW7 C;  3ONA B;  4CGY B;  4OIJ A;  1I4P A;  3EJI A;  2M9V A;  1MI2 A;  1E2Z A;  5IIF A;  4UDU C;  2L4N A;  4HSP A;  4ME5 A;  2AWN A;  5M9O A;  1C8C A;  4BA1 I;  1LAC A;  4C56 C;  3SE0 A;  2G9D A;  4V0B A;  3SK4 A;  3TZU A;  2JA6 B;  2B2V A;  3QOJ A;  1MGS A;  3N6R A;  2RBM A;  2M2L A;  3S2D B;  1PTO D;  4ZYS A;  1CQV A;  3TN2 A;  1Q8I A;  5E3F A;  1LO5 D;  4BWG B;  5IGF A;  1X3P A;  1WTV A;  4G7Z C;  1LTI D;  2YU9 B;  1F9S A;  3OIQ A;  3VA5 A;  4GZY C;  1B44 D;  2K28 A;  5T1G A;  2B2U A;  2BE5 D;  3P20 A;  3SEB A;  1EY0 A;  4KV6 A;  3TME A;  4FYD A;  2RQX A;  3K5L A;  2EE1 A;  3QOL A;  1HRJ A;  1SBB B;  4IAL A;  1TWH B;  2F0Q A;  3ERQ A;  3J7A F;  5FO7 B;  2CVR A;  1NR4 A;  3A55 A;  3E5S A;  2A69 D;  4FXG C;  5IGE A;  3HG9 A;  5KGU A;  4FP5 D;  4Z9C B;  1V1P A;  2JE6 I;  1PFB A;  2MGS A;  3H3V C;  1DZ1 A;  1OXT A;  3S1N B;  4FF2 A;  3D31 A;  1EY4 A;  2AUK A;  2NN6 G;  1GUG A;  1EY9 A;  2ZXO A;  1PRT C;  2Y0S B;  1PYW D;  3GTO B;  1EFI D;  1JC7 A;  1DD2 A;  3SK8 A;  5I9O A;  4C3H G;  2NVQ B;  1LTS D;  2Q8R E;  4LJZ C;  1CHQ D;  2NN6 I;  1JCK B;  1A6X A;  4K5V A;  3FPP A;  2BA0 A;  5JPN C;  2RDG A;  3R2T A;  4KKS A;  3GP7 A;  1CA5 A;  3A7A B;  3KUP A;  5KNC A;  1L0X B;  2A69 C;  3EVQ A;  3HOU B;  1B3A A;  2L9H A;  1D6E C;  3K59 A;  4PMB A;  5EJW A;  1HXY D;  1F9P A;  5CBA E;  4XDX A;  3V2T A;  4RCO A;  2RDH A;  2QF7 A;  2K5D A;  3PUY A;  3NWT A;  4TQU S;  3JAM L;  1GXD C;  4DXG A;  2J0T D;  4ZLT F;  1VMC A;  4IUR A;  1JR0 D;  4CJ2 C;  2KQ3 A;  3TZD A;  1ILQ A;  1UAP A;  4WRD A;  1RCV D;  1RTN A;  3R2I A;  2HQE A;  1FD7 D;  2AQ1 B;  2E2H B;  5DAU A;  1Y1W B;  3SHL A;  1A3U A;  1B53 A;  1WTP A;  3CHB D;  1SEB D;  3R93 A;  5FO8 B;  2RDF A;  4CHT B;  1CTM A;  2VXW A;  3GV6 A;  5CR3 A;  2IL8 A;  5IGC A;  4TKO B;  2K01 A;  1EWH A;  1QG7 A;  4OO1 G;  1TS2 A;  4QIW B;  5JVG 3;  4QUF A;  5CBE E;  1AN8 A;  4O42 A;  4F87 A;  2HDM A;  4NMZ A;  5FLX L;  3I91 A;  2EY1 A;  4PNY A;  3SVM A;  3OPO A;  4RKL A;  2JA5 B;  4HAE A;  2RA4 A;  1E0B A;  3CU7 A;  1NR2 A;  1LT3 D;  2PMZ B;  1FR3 A;  2K1B A;  2IWH A;  1SNC A;  1S5C D;  3WDN A;  4DNR B;  2EZV A;  1RJT A;  5C4Z A;  4J1M A;  5C0X I;  1IYV A;  4H0L C;  1Q90 A;  1SE4 A;  1PZK D;  3EQL C;  3W3A A;  4XYO A;  1QCB D;  2E2D C;  1BBX C;  1Z6H A;  1DCZ A;  2WV6 D;  1D5X C;  1PTO H;  1TII D;  5IGG A;  3QWN A;  2B2T C;  4EVO A;  1SNO A;  4V19 0;  2KOL A;  1BCP C;  3MEH A;  1I4G A;  1FNV A;  1GHK A;  1ENA A;  3GTP B;  3ERO A;  3NK9 A;  1F2Y A;  1Q12 A;  4HTH A;  1CFM A;  1B9N A;  2R3Z A;  2IPK D;  5M3F B;  5C3X A;  1TR5 A;  4KY6 A;  3J7Y W;  2RKS A;  4OIK A;  5JVH 3;  3FMC A;  3Q23 A;  1SMY C;  3T4A C;  5DM7 3;  2JYO A;  1F2Z A;  3E0J A;  2IX0 A;  4FXD A;  3A7L A;  1L0Y B;  3VA7 A;  2L55 A;  4IZ8 A;  4G7O C;  2XWB B;  2RSO A;  2XIW A;  1EIH A;  1Y8O B;  3S14 B;  1O78 A;  3PUW A;  2XSC A;  3T53 B;  1SYC A;  2AQ2 B;  2PZW A;  3MHB A;  1C48 A;  3LWE A;  3AB9 A;  2MUY A;  5ELE A;  3PIO 3;  1S5E D;  2KED A;  1WVL A;  5JJZ A;  1PTO C;  3MXG A;  3S17 B;  3GO5 A;  3FRP B;  3JAM E;  4A3D B;  5FK9 C;  2R6G A;  1TS5 A;  2IT1 A;  3EA6 A;  1LLR D;  4ZUJ A;  5EPJ A;  1STA A;  2SDF A;  2F0L A;  3DUZ A;  3OIP A;  1KTK A;  5CV8 A;  1BCP B;  4J6H A;  5EQ0 A;  1RKN A;  1NCV A;  4ILW A;  4X3U A;  2GA4 B;  1D1K A;  4JBW A;  1I4X A;  3L3O C;  5IGD A;  4X3K A;  1SXT A;  5ELF A;  2MP1 A;  5HGT A;  1LTB D;  5KIX A;  5CV6 A;  4MN3 A;  4C1N K;  3NBI A;  3HGB A;  4CKE A;  3CKI B;  1IL8 A;  2KEE A;  4H7B A;  1U4L A;  3V96 A;  4DK0 A;  2VB2 X;  1ZEQ X;  3NXW A;  1STB A;  1TKW B;  2EYH A;  3FEW X;  4IQZ A;  4DF7 A;  4ID6 A;  1RHP A;  2EOT A;  2A6H D;  2F0O A;  1ZYR C;  3Q24 A;  1ENC A;  2KJX A;  2E76 C;  4KTA A;  2KHS A;  3HZX A;  4NKL A;  1Y69 U;  2NBF A;  2K32 A;  3PO2 B;  5A35 A;  2HDL A;  2L5T A;  4IUU A;  2JEA I;  1KLU D;  4XTC S;  2N88 A;  4MIU A;  1Y8P B;  1M8A A;  3G7L A;  3RD4 A;  3V05 A;  2KA7 A;  3PV0 A;  3E6Z X;  2SEB D;  3N52 A;  1FNU A;  5EGT A;  4Y7N B;  4WOR A;  2B39 A;  3GV3 A;  3BG3 A;  1WTW A;  2K33 A;  1SND A;  2A6E D;  1SJH D;  1V8Q A;  1PRT D;  4A93 B;  1TVX A;  2D5D A;  1VF7 A;  1JE4 A;  3R8B A;  3WOF A;  3S16 B;  3ITP A;  5CV4 A;  1V1P B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...