5AFWA

Assembly of methylated lsd1 and chd1 drives ar-dependent transcription and translocation
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
174
structure length
163
Chain Sequence
EFETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQYLIKWKGWSHIHNTWETEETLKQQNVRGMKKLDNYKKKDQETKRWYNCQQELTDDLHKQYQIVERIIAHSNQKSAAGYPDYYCKWQGLPYSECSWEDGALISKKFQACIDEYFSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords CHROMODOMAIN-HELICASE-DNA-BINDING PROTEIN 1
publication title Assembly of Methylated Kdm1A and Chd1 Drives Androgen Receptor-Dependent Transcription and Translocation.
pubmed doi rcsb
source organism Homo sapiens
total genus 49
structure length 163
sequence length 174
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5afwA02
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5afwA01
1U4MA 1M8AA 1DONA 1HUMA 1G2SA 1EIHA 2B2WA 1O7YA 3GV3A 1DOLA 1MSHA 1MI2A 1DZ1A 4ZAIA 2JP1A 2B2TC 2EE1A 2FINB 4LMQD 5EPKA 1J8IA 4IURA 2MP1A 1GUWA 1KNEA 2L11A 2RVLA 3I90A 1B2TA 4MHEA 1HRJA 2RA4A 4RA8A 1XYIA 2H1EA 4R8IA 1AZPA 4XDXA 1C8CA 3G7LA 2N55A 1B3AA 1NCVA 2M2LA 2K1BA 1F9RA 4RAUC 3I91A 3N52A 1RODA 1PFMA 4XT1B 1BNZA 2XIWA 2SDFA 3IL8A 1G91A 5D14A 5E4XA 3F2UA 1WTXA 1WD0A 2NZ1D 1HFNA 1O80A 1E0BA 2DY7A 5CORA 3SVMA 1HA6A 4IUUA 4X3SA 2KUMA 2B2UC 4MN3A 2IL8A 5DNFA 2B2YA 1WTQA 2R3ZA 2HCIA 5COYA 5JJZA 2JYOA 1AZQA 2HCCA 1NR2A 1WVLA 2B2VC 1SAPA 2KOLA 2Q8RE 3DEOA 1BO0A 1EIGA 4RWSC 5E4WC 1CA5A 1A15A 1JICA 3GV6A 2B2WC 1RTNA 4X3TA 1S4ZA 2N88A 1O7ZA 1PFNA 2J7ZA 1CM9A 4CJ0B 5AFWA 1TVXA 2NWGA 3Q6SA 5CBEE 2CVRA 2HUGA 4U68A 2L12A 3MWYW 1KNAA 3R93A 1B4OA 4X3UA 5CBAE 1WTOA 1EOTA 1F2LA 1VMCA 5EKIA 1RTOA 2K04A 2HDMA 4XT3B 4NW2A 2L1BA 3H91A 2RSOA 2K01A 1PLFA 3LWEA 4ZK9B 1WTRA 2MJ8A 1F9PA 3DM1A 2HDLA 1SSOA 1ICWA 1EQTA 1G2TA 3UI2A 2K28A 2MPMA 1WD1A 4OIKA 1NR4A 2K05A 3IFDA 1U4LA 4QUCA 3TZDA 4QUFA 1IKMA 2FHTA 2X69A 1F9SA 2D9UA 3ONAB 1F9QA 1ILPA 1Q3LA 1QE6A 2RSNA 2K03A 3DEPA 3D6WA 2X6GA 1ESRA 1DOMA 1U4PA 1ILQA 2VXWA 3I3CA 2Q8TA 5CMDA 2B2YC 2FFKB 1MGSA 2B2TA 4O42A 5EQ0A 2KECA 5EJWA 1DOKA 1WTWA 2B2VA 4X3KA 1QG7A 1X3QA 2FMMA 1G6ZA 2EOTA 4IUTA 1B53A 4HEDA 1SDFA 2KEEA 2EPBA 5T1GA 5D65A 1PDQA 1X3PA 1XX8A 2FJ2A 1HUNA 1CA6A 3HP3A 1IL8A 1ZXTA 1VMPA 4IUPA 1RJTA 1JE4A 3QO2A 2X6LA 3TN2A 1WTPA 4IUQA 3I8ZA 1ML0D 1MSGA 3KBXA 1PFBA 1RHPA 4HAEA 1HHVA 1J9OA 4OIJA 1X32A 1HFGA 4UAIA 3KUPA 2KVMA 2L9HA 5EPLA 1WTVA 3MTSA 4CJ1B 1BBXC 1EL0A 1QNKA 3FDTA 1AP0A 3P7JA 1IKLA 1U4RA 2KEDA 5T1IA 4IUVA 1BF4A 4R9WA 4ZKBB 4ZLTF 1B50A 2NYZD 2B2UA 2BDNA 2L4NA 2MGSA 5EPJA 1LV9A 2DY8A 4DN4M 4HCSA 4HSVA 4ZKCB 3FPUB 4CJ2C 1NAPA
chains in the Genus database with same CATH superfamily
1Q46A 4AH6A 2B39A 1VQFA 3CPFA 4OWWB 4RHRA 1QVGA 1S5DD 3CC7A 3I90A 2RVLA 4ZQ3A 3WOFA 3DWAA 1OXVA 3K5LA 4GZYC 2F0MA 2BCOA 4C2MH 1VCIA 4V0BA 4DR3L 3D3RA 1EYDA 4V190 3F2BA 4XQJA 3FRPB 4JI7L 2YTYA 1PH4A 5CV7A 1FD7D 4XT1B 4RKBA 1PXUA 4OWXB 3URYA 1JCKB 1R4PB 1K28A 1CKNB 1F77A 2NUCA 3HOUH 3CCQA 1LO5D 3TDQA 5HGTA 4PMBA 5C44B 4RWSC 5M5WB 4DV3L 5AJ3L 1KHIA 2YV5A 1TS5A 5IGFA 4U68A 1EFID 1EQVA 4LF6Q 3RLFA 2NVYB 1F2LA 3IRBA 2IX3A 2DGYA 1TY2A 1RIPA 3NUCA 4XT3B 5GAGC 1X56A 2UU9Q 4RH6A 3LWEA 4OELB 1EY4A 1EEFD 1FNVA 3DM1A 5M9OA 4B3RQ 1EY8A 2KHJA 1CT1D 4RHSA 2UXBQ 4DV6Q 5KRUA 2CWAA 3A55A 2EJGC 1CUKA 2B2YC 2H5XA 2VB2X 4HIMA 2AKWB 1TWGH 1I6VC 1PTOC 3U4VA 1I6HH 2KEEA 2F3IA 5C0XG 1ET6A 1FL0A 2PO4A 1CA6A 5E1FA 3MA2B 5IOCA 4YY3Q 1NY4A 2F0VA 1D1KA 4DV4Q 1LYLA 3CCVA 4JOIA 3A8JE 2UXCQ 5FK9C 1M1KC 1ET9A 1H9SA 2B2UA 1VQGA 3DUZA 1A8VA 2TSSA 1TWFH 5G3LF 2E75C 2JA9A 1PH3A 1Q1BA 3MEHA 1U4MA 1M8AA 4WRDA 1G51A 3HOUB 3P1HA 1VQ5A 4A93G 4AYBE 4A3BH 3PSIA 3T1HL 1DZ1A 4AYBB 2VB3X 2Z6KC 4O0AA 4BA1I 2EYOA 3UDXA 3CCJA 4FVMA 3T13A 1S5BD 3MFGA 3VYTA 4LWCA 2R92H 4UPAA 1W3SA 2D62A 1C8CA 1J6QA 1YIJA 2M2LA 1S5ED 1B9NA 2K1BA 5I6YA 1HR0Q 4B3MQ 3I91A 2NZHA 5CV5A 1Y8NB 1FVIA 3IL8A 1D1IA 4BBRB 3C3LA 1VQBA 1PTOF 2DY7A 2A6HC 1Q8IA 1EYCA 1VQHA 1L1OC 4QMGA 4WJ3M 3OSOA 2AUKA 3BJUA 4NDXA 1G8ZD 3PGZA 1GHJA 4RCNA 2B2WC 3S2HH 1XMOQ 2VQEL 2AQ2B 1TVXA 1TWGB 1GUTA 5JPMC 3S1QH 1I6HB 1E2WA 3MWYW 4JI4L 4X3UA 1PZJD 5M5XH 3OTOQ 3K5NA 4IFDH 4DXFA 5TSSA 2MHVA 2MJ8A 3IKJA 1PYWD 2UXDL 1VQ4A 1KLUD 2ZJRA 2MPMA 3J7YW 3TEHB 2D9UA 3D4WA 1SNMA 2QW7A 1TWFB 1EU4A 2X6GA 4KI0A 2PI2E 2MO1A 2VXWA 2Q8TA 4IQZA 2FFKB 2ICEC 1B8AA 1WTWA 1EY7A 2A74C 4P73A 1KC8C 1QG7A 4A3BB 1Z9FA 4S3SA 1GOZA 4DGZA 1FGUA 2CQOA 3LWUA 3EROA 5IY0A 3F2CA 1KXLA 3I8ZA 4A3GB 5EKLA 2R92B 3SEBA 4R4OA 1J9OA 3PUWA 1LTTD 2KQ3A 4X66Q 4LF6L 3HFZB 1B50A 2Q2UA 4GOPC 4DUZQ 2XVSA 1BCPF 4ZKCB 4G7OC 1C0AA 1MJEA 2D0PA 1DM0B 2RHQB 3W3AA 4C3HH 4K5VA 1B9MA 4PQXA 3K6OA 1FJGQ 2XRQD 2VW9A 1KNEA 4IFDJ 5BN3A 2HIVA 2LMCB 2I5LX 2RA4A 5FKAC 3S2HB 4GLVB 3QIAA 3S1QB 1ONLA 1CKMA 2F4IA 2RCFA 2D0OA 4JYAL 1RL2A 5M5XB 1BXTA 1EWCA 1QVFA 4IPCA 4YY3L 2A68D 1E0BA 2K5VA 3I70A 1HA6A 5GQOA 4JI2Q 4LF7L 4ME3A 5IGCA 3HS0C 3DHQA 4HJ7A 1YEZA 3H0GH 1EYAA 1BBWA 1LACA 1WCMG 5FO8B 1N33L 4FXKC 1IZ6A 3H3VC 4JI3Q 3G4SA 3R93A 2H4OA 5CBAE 4BWGB 2B3GA 3D6CA 1PH7A 1A6XA 1MD2D 1JORA 4R4TA 3CAMA 5C5MA 5IGGA 2XSCA 1Z6HA 2B29A 4GKJL 3NTKA 4JVZA 5LMNQ 1ASZA 3HOVH 4NMZA 4PMCA 4C3IG 4NXMQ 3ULJA 5KGUA 1ILQA 2Q2IA 1RD9D 4YIJA 1RF2D 1CKNA 3KLWA 2SOBA 4C3HB 5FLXE 4DUYL 1JOQA 2JA7G 4A3MH 5D3IB 2B63B 1MSGA 5ELOA 1NBWA 1XMOL 1HFGA 5C0XI 4IO9A 2UUBL 4OX9L 5M3FG 1UUPA 1JE5A 1STNA 4IN3A 1GUGA 3NTIA 3RR5A 3L7ZC 2JA8H 1IYVA 4GS3A 1YI2A 1FGBD 3QOLA 2A8VA 2BH8A 2NN6I 1W6JA 2B8GA 4MIUA 3CCUA 4G7HC 1QCBD 1DYQA 3GTOH 1K83H 4KV6A 1STHA 1SBBB 2KCTA 3H0GB 3GTQH 4FF2A 2JE6I 2VQFQ 3MVVA 5IYBH 2K33A 2WAQE 5C6AA 4KKUA 3KLRA 1K9MC 3GQBA 1PHJA 3I4MH 1F2ZA 1TIID 2PNHA 5D14A 5C4XG 4KY6A 3HOXH 1VQJA 4IJHA 2NZ1D 4K5WA 4EQPA 2K5DA 4DK3C 1E3PA 2IL8A 4DR5L 2E2IH 3T56B 4CKCA 2IY5B 3HOVB 2CHBD 3HOWB 4NXNQ 5IP7H 4GNXA 1A15A 5IGDA 4AQYL 4X3TA 2F0HA 4A76A 4EQ5A 3Q22A 3NBHB 1TR5A 1Z7TA 3KDFB 2Y0SB 2JA6H 3GTGH 2HUGA 3VR5A 1SE2A 4QL5A 2VNUD 3VDYA 4RGMA 2F0JA 3V2TA 2FXQA 4A3LG 5IT9c 2F3VA 3KLSA 1O7LA 4KN4C 1EZ8A 1U4LA 3J80E 2L0CA 2X69A 1S72A 3SXHA 4DV7Q 1YVCA 5F2DA 1X65A 2A19A 3G71A 2JA8B 4JG2A 3A7AB 4O42A 4JI0Q 4HIOA 5IP9G 2AWOA 3FP9A 4X3KA 1S5CD 1CZWA 5DM73 4B3TQ 4BY7B 1SNCA 3BZCA 1N8RC 2NVTH 3GTOB 2ZXOA 4X6AH 2LFNA 3QO2A 4O2DA 2XWBB 4OGQC 3GTQB 4HAEA 3BU2A 3VYSA 4JK1C 3GTPH 1CSPA 1Y8PB 4Y52H 5A35A 3R3OA 3IFTA 4JBJA 5M3MH 4CJ1B 4DPGA 4KD4A 3I55A 3I4MB 1LTRD 3T53B 3C2PA 5EPJA 2MNAA 1LV9A 1E1TA 1Y1WH 3HOXB 4DV5L 3QB3A 1I4GA 2M9VA 4CGYB 1WD1A 1L0YB 5DAUA 4DR3Q 2VZAA 1G2SA 2L5TA 2E2IB 4JI7Q 4IOCA 4YHHL 2ZM6Q 3GV3A 1C9OA 3G48A 1OTCA 4LMQD 1TU2B 2PI2A 1A3VA 3E3XA 4PZ7A 4TRDA 4A3KG 4LUOA 1DJRD 2JA6B 1JOOA 3GTGB 3NEMA 1BKBA 1QZHA 2PCFB 2O5JC 1PFMA 3TBIB 1PTOD 4H7BA 3RZDH 1B44D 4DV3Q 5E4XA 5ELBA 2RF4A 5AJ3Q 5IYDG 5ELNA 1WOCA 3KF6A 2R93G 2UUCL 4ZCKA 2NVQH 1H9KA 3KOJA 3BVGA 3I56A 3PF5A 1KDBA 1WVLA 3I2ZA 4P74A 2F0NA 2QGQA 4BS9A 3GV6A 3ULLA 4GN3B 4BXXG 4DK6C 2NWGA 1RDPD 2OWOA 2L12A 2NVTB 1GD7A 3H94A 4KD3A 1DD2A 4G7ZC 4ZK9B 3GTPB 3S1NH 4CDFC 1YNXA 1F9PA 4N9TA 5M3MB 4DA2A 4JI6L 2K28A 3NELA 3P20A 3SK6A 4J6HA 2K05A 4KJOA 4C3JH 1DOMA 1Y1WB 3OIPA 2AWNA 1AH9A 1LT4D 3H3VH 2AUJD 1GHKA 3FVQA 3KLSX 1K3BC 3RUZA 5C4JH 2WACA 4EQOA 2A6HD 1SLJA 1VQ6A 1AE3A 4DR1L 3HP3A 4NXNL 1ML0D 5C3XA 3CMEA 4HR7B 1QUQB 2IX0A 4A3JG 2NTSA 1KDCA 3T1HQ 4FF3A 5JVG3 1GM5A 1H95A 1BCPD 3RZDB 2L4NA 4IALA 2JXMB 1O7IA 3AEVA 4OO1H 4KK7A 3RD4A 4DN4M 4BA2I 3EBEA 5EPKA 2QEJC 3HKZG 4ZUIA 3S14H 2NVQB 1A63A 1CHPD 3CW2C 3DWPA 4A3CG 1Q82C 1EY0A 2FINB 4HTHA 5BR8L 1Q81C 2L11A 1UWVA 2OF1A 1VQAA 3JAMi 1GXDC 4JI0L 1VQMA 2LY7A 2OTJA 1XPRA 4LFBL 1N36Q 2WB1B 5JEAG 4B9WA 4KHVA 3GTJH 4QGUA 1XNRQ 1PMRA 1CSQA 4KHZA 4BBSG 3PO2B 1HA5A 3S1NB 1WD0A 2F0WA 3FKIG 3CRKC 2VQEQ 1CTMA 3W2DA 4Z9CB 1XNQL 5LHY1 4JI4Q 1EWIA 1LTGD 4C3JB 4FXGC 2KBNA 2KOLA 3NWTA 4FYDA 2UXDQ 5C3WA 2IHFA 1PFNA 2J7ZA 4LFCL 5C4JB 3SHLA 2Z6BA 2ZM6L 3CF5A 2ICIA 1KNAA 1EYGA 1VMCA 2KCMA 1V1PB 3HOYH 2L1BA 5HURA 5IYCG 4B9XA 2ES2A 2TMPA 4QUCA 4J1MA 1SJED 1HPCA 3PIP3 2PYKA 3V05A 1QE6A 2BA1A 4JI1L 3I3CA 3MAQA 1WYDA 3SR1A 1HZAA 3BDOA 4L6TB 4A93H 1MGSA 1UE5A 2KECA 4A3EH 3S14B 2HIXA 4DV1L 3V96A 1X3QA 2D5DA 2G5DA 3EFXD 1B53A 4KY5A 4Q0FA 3U9OA 4EX5A 5CYUA 3GTMB 1WJJA 1BDOA 3RMHA 4UDUC 3GP7A 1KIXA 3X3MA 1B1ZA 4M1UB 3SK5A 1P8LA 4YWMA 3NBHA 3VA7A 3W1GA 3KDFA 3J81E 1H9JA 2DJFC 3KJOA 1X3FA 3M4QA 3P7JA 3GTJB 2KEDA 4K0KL 4HJAA 4OEMB 2DY8A 2Z8LA 2K5QA 3QOJA 5C3EG 2RQXA 2LXJA 4JYAQ 1Q86C 3CKIB 4IZ8A 5KNBA 2EIFA 2EE1A 4HJ8A 1KAAA 3W1BA 3HOZG 4C2MB 2F0DA 2UUAL 1A3UA 2E5LL 4MNOA 4XXEA 3L9AX 4LF7Q 4RAUC 3BS1A 3CCEA 4FF1A 1C4QA 3C1EA 5DM63 5NUCA 2NN6G 2L55A 5CR3A 4GNXB 3HOYB 2AQ3B 3OMGA 1PYSB 1N33Q 3C46A 2WKDA 4HJ9A 4DR4Q 2Z4HA 4GKKQ 1QZGA 2B2UC 3S15H 4YCUA 1QOHA 1YHAA 4XIGS 1SNOA 5KYLA 5JJZA 4LF9Q 1H9MA 3HOUG 4A93B 1ZYRC 4A3EB 1PH5A 2Z6KA 2YTXA 4AYBG 4GKJQ 3PUZA 4K14A 1N32L 1JB3A 4QIWE 3SE0A 2N3SA 4QIWB 3WOEA 2I5HA 2NTTA 4WORA 5LMUL 1IL2A 1K8MA 2VUMG 3ND8A 2K52A 4H0LC 3K5MA 1EQTA 4DUYQ 1SFOH 2A1AA 3MZ5A 3MXNB 1N36L 2NBFA 1STYA 3IFDA 4BBRG 3RNUA 2ZTDA 2FHTA 5J3BA 1F9QA 1KTKA 1HNZL 3EA6A 1NUCA 1XNRL 2K03A 3OW2A 4KN7C 2EJMA 1IW7C 2E2DC 3K8AA 1TQOA 4DR6Q 1BCPC 3L3OC 4RGOS 2EDGA 3FEWX 1HJPA 3M4PA 4BY1H 4ZUJA 2UUBQ 4OX9Q 2EPBA 1VQKA 4L5SA 1V9PA 2RCNA 3HGBA 4LAAA 5CGKA 3PIPA 4RKLA 2ZTEA 3A54A 4IUPA 1RJTA 5EGTA 3Q0AA 2F0IA 2LXKA 2DJGC 1G291 1X3GA 1CKOA 3EVQA 5KNDA 3PUYA 2F3WA 4KY7A 4NKLA 4R9WA 4ZKBB 2CWPA 3VA5A 1E1OA 2EYPA 3CXCA 5IE8A 4GN4B 2K4KA 4KKSA 3S15B 3NPPA 4RGNA 4C1NI 1K8OA 1QILA 1SYEA 3UE0A 2HQEA 4JW0A 1M90C 3RLOA 1B3QA 1PRTC 4LF4Q 2EY6A 3KF6B 2KA7A 3TREA 4L5RC 2H1EA 3BVZA 1TWHH 4XDXA 1LM0A 4ULLA 4DR5Q 2KJXA 2C35B 4L63B 4F7XA 4A3GG 2R92G 4N9PA 3CU7A 4ILWA 5FLMG 1RODA 2F0TA 4A3FH 4DV0L 2F0KA 4JI8L 3ICEA 4AQYQ 4HMIA 2PQAB 2YYZA 1EIFA 1EY9A 2R61A 2JN4A 5JJIA 1QUQA 4LUZA 1D2BA 1G6PA 5CV6A 3D0FA 1SFOB 2F0SA 2QDLA 4HIDA 3TMEA 1V8QA 2QILA 2HCCA 1NR2A 1J5EL 2B2VC 1VQ7A 1SAPA 1EIYB 1HNWL 1BO0A 1NSNS 1XTDA 1STAA 4ZRZA 2JA7H 4XYOA 5FLXc 4BY1B 3Q23A 3A5UA 4ABNA 1WFQA 2SNSA 1D5ZC 3RZOH 3NHHA 1X3EA 2RKSA 3FPPA 2J4XA 3I4NH 5M3FH 2MUYA 4IFDG 1PRTF 5CV8A 4F88A 1LTBD 1JR0D 2RSNA 5I6WA 3E0JA 3WDNA 3B6YA 1Y14B 1D7QA 5EJWA 4EQNA 1TS3A 4DR4L 4GKKL 4A75A 4Q5VA 2QKIC 1G6ZA 1E7ZA 1PZID 1K3RA 1CFMA 5A2QE 4R4CA 4LF9L 5GAHC 2A73B 4DV5Q 3KK7A 3K7AH 1A3TA 3CC2A 3AQQA 4UAIA 5EKKA 4YHHQ 1L0XB 3VR2A 4J8QA 4RG1A 1U4RA 4A3FB 1O78A 4IUVA 3J80L 2AHOB 3NXWA 1V1PA 2PW5A 1OXUA 3I4LA 4HCSA 1DGSA 3I4OA 3CCMA 3OMCA 1JMCA 1PFSA 3GD7A 3CC4A 2GVAA 3NBIA 4U673 3E9HA 4XQQA 3PO3H 4DNRB 2F0UA 1I4XA 5ELCA 1LTID 1VF5C 4C3HG 2UUCQ 1I3QH 3GTKH 4DR6L 2JA7B 2B63G 3W5OA 5I9OA 1ESFA 1B70B 2IHEA 2L15A 1VQNA 3NWSA 3STBD 2DN8A 1PTOH 3RZOB 4I7AA 1K8GA 4POGA 3I4NB 4FF4A 1HCZA 4DKAC 3J80c 3MHBA 1OXSC 1SMYC 4JV5L 2JYOA 4A3DH 1VQ8A 5IP9H 3UDGA 5E4WC 4H13C 1UAPA 5IT9L 2N8NA 4X65L 1RKNA 4JI6Q 2HHHL 4KMUC 3I73A 2WKCA 2XN9C 2ASBA 2WAQB 3AFPA 4K2KA 3H0GG 1I94L 2F52A 5IGEA 3M85A 1P16A 2C5CA 2A6EC 3K7AB 5LL6S 4LF4L 2F0PA 1GUOA 2RSOA 1PLFA 5EAYA 3VR4A 4DNIA 1VQEA 1Y1VH 1TWAH 2J0TD 1I5FA 4DR1Q 2ZXPA 2NVXH 2PZWA 3DEPA 2OXPA 1STBA 1PVOA 1CI3M 1E2ZA 5CMDA 1HH2P 3ZJYC 1EQRA 2I07B 5D3DA 3E0EA 1DOKA 2CW0C 1GUNA 1TS2A 3HOWG 5C4HA 4IUTA 4A3MB 3LGJA 1SDFA 3PO3B 5D65A 3TN2A 3UDFA 1HQMC 2A5HA 1KQSA 3OWEB 1KL9A 2Y0SG 4K6DA 3D4RA 1I3QB 3GTKB 4OIJA 2LKVA 3TZUA 1YBYA 1QNKA 4F87A 3KBGA 5BR8Q 2VY3A 2R93H 4KHPL 2QA4A 5FOBB 1PTOB 2VL6A 4OL7A 2N78A 3FPUB 4DF7A 1KRSA 2F0OA 4CJ2C 4LFBQ 1DONA 5K36H 3MXNA 2HT1A 1O7YA 1DOLA 3SGIA 1K83B 4A3DB 2JA5G 1KDAA 4JBMA 1QJOA 1J8IA 2MP1A 2WFWA 1DCZA 1VF7A 4MHEA 5JVH3 1SYBA 3MFYA 4RA8A 4BY7G 4LJZC 1S3OA 1XNQQ 2F03A 4I65A 1EY6A 4LW1A 5G3LD 1NCVA 1BOSA 2IWHA 2R7ZH 1NE3A 1TKWB 3LNNA 4FNFA 2SDFA 3EN2A 2ATWA 5IYBG 4KLKA 1YITA 1HFNA 2CH4A 4YWLA 3I4MG 4LFCQ 1Y1VB 3K7UC 1TWAB 4QCLA 4L8JA 4MN3A 3NQTA 1WTQA 2JEAI 1M4VA 4N8X1 2HCIA 5COYA 1AZQA 2K7VA 3L2PA 1YHQA 1ENAA 1LT5D 2Z1CA 1Z47A 2Q8IB 3QWNA 4LF5Q 4ME5A 1Q7YC 4P75A 1C7YA 1Q90A 1O7ZA 2YU9H 1YNND 3KFUA 3A56A 5IP7G 2F0FA 2EYLA 1AFPA 1OXXK 1Q12A 3RN5A 1WTOA 4JI1Q 2O4XA 2OT2A 4A3JH 5M5YH 4WJ4A 2JA6G 1L1OB 1HZ9A 1SE8A 4AIMA 1WTRA 1AEXA 5JAVA 4DV1Q 1ICWA 4DR2L 1PV4A 4B3SL 5IGBA 4FXDA 3UI2A 1SR3A 4OIKA 3ITPA 1F9SA 3SK8A 5JOBA 3S1MH 4QF4A 1ESRA 1BCPB 3J7A5 2PQAA 4PZ8A 2B2TA 4IFDI 4A3CH 2RHSB 1FYCA 1TS4A 2Z4IA 4K0KQ 2EY2A 2FJ2A 3K0XA 3OPOA 3T16A 3VR6A 1A62A 5IWAL 4RGTA 1AW7A 3EJIA 5IIFA 2ENBA 1X32A 3A5ZB 1VQ9A 3FMCA 1ZYRD 1D5XC 2R7ZB 1IYJB 4EGVA 1IKLA 5BN4A 2F0LA 2BDNA 2MGSA 2K75A 5M3MG 4UY8C 1V1QA 1CHQD 2UUAQ 1IBML 2E5LQ 3OYYA 1NAPA 4JCVE 4A3IG 3M7GA 4RMFA 3UDIA 3STBC 2K50A 1Y1WG 2E74C 1MSHA 2IPKD 1MI2A 1IYUA 4ZAIA 5C4ZA 4LF8Q 4A4IA 5JJLA 5HY6A 3IAYA 3T1YL 4HSPA 1QVCA 1XMQL 4GOPB 1AZPA 2YU9B 3PMFA 1IW7D 2N55A 1JJGA 4KTAA 3BYTB 3J81L 1F9RA 4R8NA 1IXRA 3R2IA 1LTLA 1BNZA 1G91A 3UE1A 4A3JB 5M5YB 5BN5A 1S40A 2V1CC 1WTXA 4DNTB 1O80A 1N32Q 2N49A 2KUMA 3F1ZA 4MTKA 1VQIA 2R3ZA 3HG9A 1GO3E 4YCWA 3S1MB 5LMUQ 2Q8RE 3DEOA 1CA5A 1XWEA 4KJNA 1LT3D 2M00A 3WWVA 1EQQA 4JBWA 2DNCA 3HKSA 1VQPA 2EJFC 1TXYA 1TWCH 1HNZQ 5LL6X 1B4OA 1D6EC 3S2DH 4ZYSA 3SK4A 1RTOA 3NQIA 2WB1G 3K80C 1BQQT 3OWFA 1PRTD 4PMWA 3J81c 4G57A 4DAMA 2F0GA 3M3YH 3PO2G 2Q2HA 4QB4A 3H6MA 3G6EA 5C3EH 1LTSD 3TSSA 3VR3A 3CMAA 1X54A 1W2BA 2QF7A 5C0XH 3OIQA 4C3JG 1OXTA 1U5KA 4R4QA 1V1OA 2MFIA 5FJ8G 2G9HD 2NB0A 3HOZH 5CV9A 1XX8A 1HUNA 4LF5L 3M4OH 1IL8A 1VMPA 1E2VA 2ZXRA 1SJHD 4IUNA 1PH1A 1N9WA 3A8IE 4DAYB 1MHWC 3AU7A 4P2CB 2NN6H 4XTCS 3S24A 5JPNC 2F4VL 2A69C 5T1IA 1EU3A 4ZLTF 4GLXA 1IHZA 2NZOA 2E8GA 4UHVA 1D5MC 1STEA 5ISRA 4HSVA 2D2CC 3D4DA 1ICFB 2GA4B 1ZEQX 5C44G 2E76C 5CV4A 4OO1G 4QJFA 3QJYA 3ZYYX 4NPSA 4F8MA 4DV0Q 5E7NA 4JI8Q 3JAME 1SYFA 1TY0A 5EBDA 3NTHA 2K5NA 4TKOB 4C56C 5J1ZA 2GVBA 3E9IA 1VDZA 1NJIC 4APVA 1TWCB 2XNAC 3BZDB 4FDBA 4K5XA 1J5EQ 3ER0A 3G6JB 1BBUA 1HNWQ 3S2DB 1E22A 2VUMH 1NMFA 1YNNC 2BH2A 3PIO3 1E24A 1XTCD 2JQOA 1SEBD 3CD6A 5C0XJ 4BBRH 1B7YB 1X55A 3HRZC 2PW7A 1BR9A 2B2YA 3M3YB 2K5HA 2LSSA 1YHBA 1U9RA 2OEOA 1BVSA 1H9RA 3CHBD 5C3EB 1JQYD 4GN5A 1EZ6A 3A74A 1STGA 4WFN3 1T9HA 3K0YA 2XWJB 1LLRD 3E5SA 3CCLA 2SEBD 1PYBA 5KNCA 2CVRA 3U58A 2YTVA 3HOZB 3BVMA 4IPDA 4LF8L 2ZJPA 3S17H 3M4OB 2XGTA 4K8JA 2K04A 2HDMA 4JOIC 5L37A 3BZKA 1SROA 2Z9HA 4MZ9A 3M7NA 2WV6D 1XPOA 3BYYB 4HMJA 1NNXA 1JJ2A 3HOYG 4HCEA 3C1FA 1CQFA 3ONAB 1FNUA 2PZTA 1PA6A 1NTGA 4Y7NH 3E6ZX 1XJVA 4DV2L 2FMMA 1RCVD 2EOTA 3F8TA 1SNDA 4LK1C 3CRLC 1PDQA 4A3EG 1ZXTA 3N6RA 1SMYD 4NP5A 4UP7A 1HHVA 1YJ9A 2E2JH 3S1RH 2EYFA 2HQLA 4A3GH 1A2TA 3Q24A 5CC4A 3KUPA 5FLMH 3L0OA 1EL0A 3BG3A 2EYHA 4DR7Q 2RBMA 2VUMB 2DNEA 2NYZD 3CQZH 3KF8B 1L1OA 4X64Q 3AFQA 3U9SA 4CDEC 1UE1A 1YJWA 2A6ED 1S5FD 1EIHA 1SYGA 2B2WA 2EXDA 3A7LA 2IX1A 5A2QL 3TP5A 5J22A 2I5MX 1B2TA 1HR0W 2CCZA 2KENA 3G7LA 4LFAL 1B3AA 5HGQA 4JV5Q 4OXPA 2CW0D 2EYMA 2JJQA 2R7DA 3S17B 1X6OA 3NENA 2XIWA 1SYDA 1PH2A 3HZXA 4X65Q 1SYCA 1DXMA 2HHHQ 1GJXA 5KEEA 1HTPA 2OTLA 5CORA 3M9BA 2DUDA 4X3SA 5FLXL 1QNUA 4HN7A 5KYIA 1I94Q 1IBLQ 4HIKA 1WCMH 2KCNA 3TQYA 1SRUA 4A3BG 3PIOA 1JICA 4Y7NB 3MEFA 2BE5D 1ZKOA 5GROA 5KIXA 1CM9A 1Y69U 3Q6SA 3MXPA 1MKHA 2EXZA 1HXYD 4WJWA 2QEXA 2E2JB 3S1RB 2CKZB 2O2LD 4GOPA 4UP9A 1UNSA 4C3IH 2K32A 4UP8A 1HTLD 2RDGA 1UEBA 5I9PA 4PG3A 3CQZB 4DU9A 3U4ZA 3PCOB 1SXTA 3Q8DA 3DMUA 2UU9L 5GADC 3KJPA 2B2VA 2F0QA 2CFMA 4B3RL 5DLQE 3J7ZC 1HNXQ 1I50H 4KHPQ 2UXBL 1GVPA 4DV6L 2X6LA 4PZ6A 2EZVA 2B63H 3NK9A 1PFBA 4BY1G 2I0QA 1AN8A 1I4RA 3DXJC 4H02A 4IOAA 1GUSA 4C1NK 3QR8A 3MTSA 3H3VI 3OW7A 3JC66 4LUVA 3TS0A 3AYHB 3R8BA 5EBCA 1UEAB 1SN8A 1F2MA 4H44C 3PQIA 1OO9B 4XQNA 1R9TH 4K8IA 1L0WA 2ALYB 2ZTCA 2K5WA 4R1JA 3K57A 4G4KA 4DV4L 2BOSA 1HUMA 1ASYA 5H1SE 1VQLA 1KRTA 1PZKD 2GN5A 1EY5A 2R7FA 4O1NA 1WCMB 2UXCL 4MTNA 5I2YA 3DLLA 1TWHB 4JPBW 3J7AF 4OO1I 1JWUD 1KLGD 4XYQA 2MQHA 4N8FA 5C4XH 3DM3A 1A2UA 4R4IA 1IBKQ 3A8KE 4TVAB 4QY7A 1K0RA 3ULPA 2VS1A 2B8FA 2V4DA 1HZCA 1F2YA 4HJ5A 4DAYA 1YNJD 3CP0A 4A3FG 4C3IB 1CQVA 3SVMA 2HD3A 4CDCC 4B3ML 1HR0L 4DR7L 1N34Q 1JWMD 4JI5Q 3OHXC 4X64L 1EIGA 2ZT9C 3HOWH 2ID0A 1JJCB 4RFBA 4DK1A 4DR2Q 4B3SQ 1V43A 5IODA 1YZ6A 1D8LA 4A3LH 1I50B 2KHSA 4DK0A 5CBEE 2E2HH 1C48A 2Q2TA 3PV0A 1T5EA 2Z0SA 3ERSX 4X62Q 4LNQA 1HQRD 4NW2A 2JEBI 1EOVA 3H91A 5LMNW 5FO7B 3TP6A 5FO9B 1EFWA 5M3FB 2HDLA 2PNRC 1I4HA 2AMCB 3K58A 2LS01 1ILPA 4JBKA 5IWAQ 1Q3LA 3J80i 1I4QA 3GO5A 3I4NG 5ELEA 3S16H 1R9TB 3OTOL 1ENCA 1Y8OB 2FMCA 1SNQA 2JK8A 3DWQA 1JWSD 5EQ0A 2JA5H 2KHIA 3ND9A 1XXGA 4OHJA 4EVOA 1QB5D 2ZJQA 1IBLL 1X3PA 2F1MA 4K2LA 1WTPA 1SNPA 4BY7H 1JC7A 3ERQA 1IBMQ 2WAQG 1RHPA 1KABA 4P71A 4QQBX 3BDLA 1X9NA 5EPLA 2KVMA 2L9HA 5C4XB 1BBXC 1AP0A 3HEJA 1BF4A 2BDOA 1PH9A 5C5LA 3T1YQ 4JC0A 1XMQQ 2EVBA 1MJCA 5DEHA 3HOVG 2PZUA 3H15A 5GAEC 1II3A 1LTAD 1EUJA 1MIUA 2AQ1B 2KCCA 3U50C 4GNXC 4PNYA 2PQEA 1R4QB 4A3KH 4B08A 3X3NA 2EYJA 4X66L 4IURA 4DUZL 1GUWA 1VQCA 1AE2A 4A3MG 1HRJA 3P75A 1XYIA 5E3FA 3PO3G 2Y0SE 3TS2A 1HNXL 2E2HB 5IYDH 4YCVA 2BE5C 2EY1A 5JJKA 3NE5B 4TSSA 3F2UA 3D31A 1FJGL 3EQLC 2QCPX 4IUUA 3VYUA 3TRZA 5DNFA 2JA8G 4CBVA 1T5XD 1PH8A 1LUZA 3PUXA 3KF8A 4BXXH 3S16B 2A69D 3K5OA 4GLAC 4L5TA 4ODGA 1RTNA 1S4ZA 2RDFA 4A3DG 2JA5B 3D8GA 4CJ0B 3CPWA 4JI2L 2IJ0A 4DXGA 1JOKA 3F2DA 1EOTA 3CCSA 1H9SB 3AMUA 3GTLH 2K01A 4I7ZC 3GDEA 2QDBA 3M4YA 2OQKA 1FNWA 4OWTB 3HOXG 1NR4A 1IBKL 4QUFA 5ELDA 2NVXB 2SNMA 4JI3L 2C9OA 4OONA 3EIVA 1Y1VG 1U4PA 3OOCA 3VYRA 3SDZA 4A3IH 1WTHA 4FP5D 4CHTB 4TQUS 2O5IC 2XTIA 2F4VQ 5J39A 4POFA 2EY5A 4A3KB 1EWHA 1TT2A 5LMNL 1N34L 1XPUA 3R2TA 2A68C 4J15A 4JI5L 4CDDC 3I7FA 1JE4A 4NXML 4IUQA 5IT9E 4KKTA 4K6LA 1KAWA 1EEID 1Q1EA 3A0JA 3RLNA 2R93B 1K73C 1ENFA 3PF4A 1WI5A 4X62L 4E6IA 1SE3A 1JB7A 1LT6D 2PMZE 3NSWA 3MXGA 3O13A 2PMZB 4IPHA 4M8AA 3T51B 2IT1A 3FHWA 1YNJC 2JP1A 2B2TC 2K14A 3J7AV 5K36G 1CK1A 1K0SA 5JEAH 2WP8J 2EQSA 1FR3A 1VQDA 4R8IA 1UE7A 1SMXA 1UE6A 4L5QA 2BA0A 2CH4W 4BBSH 1GKHA 4RCOA 3KYHC 3N52A 2OQ0A 3FKIH 2IW3A 3PUVA 2RDHA 4ID6A 3CCRA 3GTLB 3I72A 2R7ZG 1KD1C 2CQAA 2XRSD 3H09A 2WINB 3PO2H 3NP8A 1W6KA 2VQFL 4IJLA 1PRTB 3LX0A 4CKEA 2PPBC 1QWYA 3JAML 4A3IB 3S9WA 5FJ8H 4DFAA 1HZBA 2N88A 1VQOA 5K5PA 5AFWA 1SE4A 5IYCH 2I46A 3QG1A 5EKIA 2P5ZX 3TP7A 3MC0B 1PH6A 4DV2Q 1SSOA 2MO0A 2K6AA 1G2TA 1K8AC 1VS0A 3HKZE 3TZDA 2R6GA 1IKMA 1U0LA 3HKZB 2F0EA 2OCEA 3D6WA 3RN2A 5C44H 4PV1C 5JEAJ 5M5WH 1Q8KA 1CZGA 3K59A 1NMGA 1YJNA 1A0IA 2G9DA 3BDCA 4HEDA 3TP8A 4NB3A 2WIIB 2JSOA 4IPGA 5T1GA 3J81j 3JAMc 3K81C 2NVYH 4DV7L 4ALPA 4YWKA 4DAVA 3GTMH 3KBXA 4DAPA 3AB9A 5I4DA 1WTVA 4CKBA 4BBSB 5ELFA 3FDTA 3T4AC 2WB1E 1JT8A 1I4PA 3FKIB 3J81i 1L2FA 4B3TL 4FO2A 1BUVT 4P72A 1LABA 3MXUA 5I2XA 1MBYA 4LFAQ
chains in the Genus database with same CATH topology
2B39A 4RHRA 1S5DD 3I90A 2RVLA 4ZQ3A 3WOFA 3DWAA 1OXVA 3K5LA 4GZYC 2F0MA 2BCOA 1VCIA 4V0BA 3D3RA 1EYDA 4V190 4XQJA 3FRPB 5CV7A 1FD7D 4XT1B 4RKBA 1PXUA 3URYA 1JCKB 1R4PB 1F77A 2NUCA 1LO5D 3TDQA 5HGTA 4PMBA 5C44B 4RWSC 5M5WB 1TS5A 5IGFA 4U68A 1EFID 1EQVA 3RLFA 2NVYB 1F2LA 2IX3A 3NUCA 1TY2A 4XT3B 4RH6A 3LWEA 1EY4A 1EEFD 1FNVA 3DM1A 5M9OA 1EY8A 1CT1D 4RHSA 5KRUA 3A55A 2EJGC 2B2YC 2VB2X 1I6VC 1PTOC 2KEEA 5C0XG 1ET6A 2PO4A 1CA6A 5E1FA 3MA2B 5IOCA 2F0VA 1D1KA 3A8JE 5FK9C 1ET9A 1H9SA 2B2UA 3DUZA 2TSSA 5G3LF 2E75C 1Q1BA 3MEHA 1U4MA 1M8AA 4WRDA 3HOUB 3P1HA 1DZ1A 4AYBB 2VB3X 4BA1I 2EYOA 4FVMA 3T13A 1S5BD 3MFGA 3VYTA 2D62A 1C8CA 2M2LA 1S5ED 1B9NA 2K1BA 5I6YA 3I91A 5CV5A 1Y8NB 3IL8A 1D1IA 4BBRB 3C3LA 1PTOF 2DY7A 2A6HC 1Q8IA 1EYCA 4QMGA 3OSOA 2AUKA 4NDXA 1G8ZD 1GHJA 4RCNA 2B2WC 2AQ2B 1TVXA 1TWGB 1GUTA 5JPMC 1I6HB 1E2WA 3MWYW 4X3UA 1PZJD 3K5NA 4IFDH 4DXFA 5TSSA 2MHVA 2MJ8A 3IKJA 1PYWD 1KLUD 2MPMA 3J7YW 2D9UA 3D4WA 1SNMA 1TWFB 1EU4A 2X6GA 4KI0A 2VXWA 2Q8TA 4IQZA 2FFKB 2ICEC 1WTWA 1EY7A 2A74C 1QG7A 4A3BB 4S3SA 1GOZA 4DGZA 3LWUA 3EROA 3I8ZA 4A3GB 5EKLA 2R92B 3SEBA 1J9OA 1LTTD 3PUWA 2KQ3A 1B50A 2XVSA 1BCPF 4ZKCB 4G7OC 1DM0B 3W3AA 4K5VA 1B9MA 4PQXA 3K6OA 2XRQD 1KNEA 4IFDJ 5BN3A 2LMCB 5FKAC 2RA4A 3S2HB 3QIAA 3S1QB 1ONLA 2F4IA 5M5XB 1BXTA 1EWCA 2A68D 1E0BA 3I70A 1HA6A 5IGCA 3HS0C 3DHQA 1EYAA 1LACA 5FO8B 4FXKC 3H3VC 3R93A 2H4OA 5CBAE 4BWGB 3D6CA 1A6XA 1MD2D 1JORA 5C5MA 5IGGA 2XSCA 1Z6HA 3NTKA 4NMZA 4PMCA 4C3IG 5KGUA 1ILQA 1RD9D 4YIJA 1RF2D 2SOBA 4C3HB 5FLXE 1JOQA 5D3IB 2B63B 1MSGA 1HFGA 5C0XI 1UUPA 1STNA 4IN3A 1GUGA 3NTIA 3L7ZC 1IYVA 1FGBD 3QOLA 2NN6I 1W6JA 2B8GA 4MIUA 4G7HC 1QCBD 1DYQA 4KV6A 1STHA 1SBBB 3H0GB 4FF2A 2JE6I 3MVVA 2K33A 5C6AA 4KKUA 3KLRA 3GQBA 1F2ZA 1TIID 5D14A 4KY6A 4K5WA 2NZ1D 4EQPA 2K5DA 2IL8A 3T56B 4CKCA 3HOVB 2CHBD 3HOWB 1A15A 5IGDA 4X3TA 2F0HA 3Q22A 1TR5A 1Z7TA 2Y0SB 2HUGA 3VR5A 1SE2A 2VNUD 4RGMA 2F0JA 3V2TA 2F3VA 3KLSA 1O7LA 4KN4C 1EZ8A 1U4LA 3J80E 2L0CA 2X69A 3SXHA 5F2DA 2JA8B 3A7AB 4O42A 2AWOA 4X3KA 1S5CD 1CZWA 5DM73 4BY7B 1SNCA 3GTOB 2ZXOA 2LFNA 3QO2A 2XWBB 4OGQC 3GTQB 4HAEA 3VYSA 4JK1C 1Y8PB 5A35A 3R3OA 3IFTA 4CJ1B 4KD4A 3I4MB 1LTRD 3T53B 3C2PA 5EPJA 1LV9A 3HOXB 3QB3A 1I4GA 2M9VA 4CGYB 1WD1A 1L0YB 5DAUA 1G2SA 2L5TA 2E2IB 3GV3A 4LMQD 1TU2B 1A3VA 4TRDA 1DJRD 2JA6B 1JOOA 3GTGB 2PCFB 2O5JC 1PFMA 3TBIB 1PTOD 4H7BA 1B44D 5E4XA 5ELBA 1H9KA 3BVGA 1KDBA 1WVLA 2F0NA 4BS9A 3GV6A 2NWGA 1RDPD 2L12A 2NVTB 3H94A 4KD3A 1DD2A 4G7ZC 4ZK9B 3GTPB 1F9PA 4N9TA 5M3MB 4DA2A 2K28A 3P20A 3SK6A 4J6HA 2K05A 4KJOA 1DOMA 1Y1WB 3OIPA 2AWNA 1LT4D 2AUJD 1GHKA 3FVQA 3KLSX 3RUZA 2WACA 4EQOA 2A6HD 3HP3A 1ML0D 5C3XA 4HR7B 2IX0A 2NTSA 1KDCA 4FF3A 5JVG3 1BCPD 3RZDB 2L4NA 4IALA 2JXMB 4OO1H 4KK7A 3RD4A 4DN4M 4BA2I 5EPKA 2QEJC 4ZUIA 2NVQB 1CHPD 3DWPA 1EY0A 2FINB 4HTHA 2L11A 2OF1A 1GXDC 2LY7A 2WB1B 5JEAG 4B9WA 4KHVA 1PMRA 4KHZA 3PO2B 1HA5A 3S1NB 1WD0A 2F0WA 3CRKC 1CTMA 3W2DA 4Z9CB 5LHY1 1LTGD 4C3JB 4FXGC 2KOLA 3NWTA 4FYDA 5C3WA 1PFNA 2J7ZA 5C4JB 3SHLA 2ICIA 1KNAA 1VMCA 1V1PB 2L1BA 5HURA 4B9XA 2TMPA 4QUCA 4J1MA 1SJED 1HPCA 3PIP3 2PYKA 3V05A 1QE6A 2BA1A 3I3CA 3MAQA 3SR1A 3BDOA 4L6TB 1MGSA 2KECA 3S14B 3V96A 1X3QA 2D5DA 3EFXD 1B53A 4KY5A 4Q0FA 3U9OA 5CYUA 3GTMB 1BDOA 3RMHA 4UDUC 3GP7A 3X3MA 1B1ZA 4M1UB 3SK5A 3NBHA 3VA7A 3J81E 1H9JA 3P7JA 3GTJB 2KEDA 2DY8A 2Z8LA 2K5QA 3QOJA 2RQXA 3CKIB 4IZ8A 5KNBA 2EE1A 1KAAA 4C2MB 2F0DA 1A3UA 4XXEA 3L9AX 4RAUC 3BS1A 4FF1A 1C4QA 3C1EA 5DM63 5NUCA 2NN6G 2L55A 5CR3A 3HOYB 2AQ3B 3OMGA 3C46A 2WKDA 2Z4HA 2B2UC 1QOHA 4XIGS 1SNOA 5KYLA 5JJZA 1H9MA 4A93B 1ZYRC 4A3EB 3PUZA 4K14A 1JB3A 3SE0A 4QIWB 3WOEA 2NTTA 4WORA 1K8MA 3ND8A 4H0LC 3K5MA 1EQTA 3MZ5A 2NBFA 1STYA 3IFDA 2FHTA 1F9QA 1KTKA 3EA6A 1NUCA 2K03A 4KN7C 2EJMA 1IW7C 2E2DC 1TQOA 1BCPC 3L3OC 4RGOS 2EDGA 3FEWX 4ZUJA 2EPBA 3HGBA 4LAAA 5CGKA 4RKLA 3A54A 4IUPA 1RJTA 5EGTA 3Q0AA 2F0IA 1G291 3EVQA 5KNDA 3PUYA 2F3WA 4KY7A 4NKLA 4R9WA 4ZKBB 3VA5A 2EYPA 4KKSA 3S15B 3NPPA 4RGNA 4C1NI 1K8OA 1QILA 1SYEA 2HQEA 1PRTC 2EY6A 2KA7A 2H1EA 3BVZA 4XDXA 4ULLA 2KJXA 4L63B 4F7XA 4N9PA 3CU7A 4ILWA 1RODA 2F0TA 2F0KA 4HMIA 2YYZA 1EY9A 2R61A 1D2BA 5CV6A 1SFOB 2F0SA 3TMEA 1V8QA 2HCCA 1NR2A 2QILA 2B2VC 1SAPA 1BO0A 1NSNS 1STAA 4ZRZA 4XYOA 4BY1B 3Q23A 4ABNA 2SNSA 1D5ZC 3NHHA 2RKSA 3FPPA 2J4XA 2MUYA 4IFDG 1PRTF 5CV8A 4F88A 1LTBD 1JR0D 2RSNA 5I6WA 3E0JA 3WDNA 5EJWA 4EQNA 1TS3A 4Q5VA 2QKIC 1G6ZA 1PZID 1CFMA 5A2QE 2A73B 3KK7A 1A3TA 4UAIA 5EKKA 1L0XB 3VR2A 4J8QA 1U4RA 4A3FB 1O78A 4IUVA 3J80L 3NXWA 1V1PA 2PW5A 1OXUA 3I4LA 4HCSA 3OMCA 3GD7A 3NBIA 4U673 4XQQA 4DNRB 2F0UA 1I4XA 5ELCA 1LTID 1VF5C 4C3HG 2JA7B 5I9OA 1ESFA 3NWSA 2DN8A 1PTOH 3RZOB 3I4NB 4FF4A 1HCZA 3MHBA 1OXSC 1SMYC 2JYOA 5E4WC 4H13C 1UAPA 5IT9L 1RKNA 4KMUC 3I73A 2WKCA 2XN9C 2WAQB 4K2KA 5IGEA 3M85A 5LL6S 2C5CA 2A6EC 3K7AB 2F0PA 1GUOA 2RSOA 1PLFA 3VR4A 2J0TD 2ZXPA 2PZWA 3DEPA 2OXPA 1STBA 1CI3M 1E2ZA 5CMDA 2I07B 5D3DA 1DOKA 2CW0C 1GUNA 1TS2A 5C4HA 4IUTA 4A3MB 1SDFA 3PO3B 5D65A 3TN2A 1HQMC 2A5HA 3OWEB 4K6DA 3D4RA 1I3QB 3GTKB 4OIJA 2LKVA 3TZUA 1QNKA 4F87A 3KBGA 5FOBB 1PTOB 4OL7A 4DF7A 3FPUB 2F0OA 4CJ2C 1DONA 5K36H 3MXNA 1O7YA 1DOLA 1K83B 4A3DB 1KDAA 1QJOA 1J8IA 2MP1A 1DCZA 1VF7A 4MHEA 5JVH3 1SYBA 3MFYA 4RA8A 4LJZC 2F03A 4I65A 1EY6A 5G3LD 1NCVA 1BOSA 2IWHA 1TKWB 3LNNA 4FNFA 2SDFA 1HFNA 1Y1VB 1TWAB 4QCLA 4L8JA 4MN3A 3NQTA 1WTQA 2JEAI 1M4VA 2HCIA 5COYA 1AZQA 2K7VA 1ENAA 1LT5D 2Z1CA 1Z47A 2Q8IB 3QWNA 4ME5A 1Q90A 1O7ZA 1YNND 3A56A 2F0FA 2EYLA 1AFPA 1OXXK 1Q12A 1WTOA 2O4XA 2OT2A 1WTRA 1AEXA 5JAVA 1ICWA 4FXDA 5IGBA 3UI2A 4OIKA 3ITPA 1F9SA 3SK8A 5JOBA 4QF4A 1ESRA 1BCPB 2B2TA 4IFDI 1FYCA 1TS4A 2Z4IA 2EY2A 2FJ2A 3OPOA 3T16A 3VR6A 4RGTA 1AW7A 3EJIA 5IIFA 2ENBA 1X32A 3FMCA 1ZYRD 1D5XC 2R7ZB 4EGVA 1IKLA 5BN4A 2F0LA 2BDNA 2MGSA 1CHQD 1NAPA 3M7GA 2E74C 1MSHA 2IPKD 1MI2A 1IYUA 4ZAIA 5C4ZA 3IAYA 4HSPA 1AZPA 2YU9B 3PMFA 1IW7D 2N55A 4KTAA 3BYTB 3J81L 1F9RA 4R8NA 3R2IA 1BNZA 1G91A 4A3JB 5M5YB 5BN5A 1WTXA 4DNTB 1O80A 2KUMA 2R3ZA 3HG9A 3S1MB 2Q8RE 3DEOA 1CA5A 1XWEA 4KJNA 1LT3D 2M00A 4JBWA 2DNCA 2EJFC 5LL6X 1B4OA 1D6EC 4ZYSA 3SK4A 1RTOA 3NQIA 1BQQT 3OWFA 1PRTD 4PMWA 4G57A 2F0GA 4QB4A 3H6MA 1LTSD 3TSSA 3VR3A 2QF7A 5C0XH 3OIQA 4C3JG 1OXTA 1V1OA 2G9HD 2NB0A 5CV9A 1XX8A 1HUNA 1IL8A 1VMPA 1E2VA 2ZXRA 1SJHD 4IUNA 3A8IE 3AU7A 4P2CB 2NN6H 4XTCS 5JPNC 2A69C 5T1IA 1EU3A 4ZLTF 1IHZA 1D5MC 1STEA 5ISRA 4HSVA 2D2CC 3D4DA 2GA4B 1ZEQX 2E76C 5CV4A 4OO1G 3QJYA 3ZYYX 4F8MA 3JAME 1SYFA 1TY0A 5EBDA 3NTHA 4TKOB 4C56C 5J1ZA 1VDZA 1TWCB 2XNAC 3BZDB 4K5XA 3G6JB 3S2DB 1YNNC 3PIO3 1XTCD 1SEBD 5C0XJ 3HRZC 2PW7A 1BR9A 2B2YA 3M3YB 1U9RA 2OEOA 3CHBD 1H9RA 5C3EB 1JQYD 1EZ6A 1STGA 4WFN3 3K0YA 2XWJB 1LLRD 3E5SA 2SEBD 5KNCA 2CVRA 3HOZB 3BVMA 3M4OB 4K8JA 2K04A 2HDMA 3M7NA 2WV6D 3BYYB 4HMJA 4HCEA 3C1FA 1CQFA 3ONAB 1FNUA 2PZTA 3E6ZX 2FMMA 1RCVD 2EOTA 1SNDA 4LK1C 3CRLC 1PDQA 1ZXTA 3N6RA 1SMYD 4NP5A 1HHVA 2EYFA 1A2TA 3Q24A 5CC4A 3KUPA 1EL0A 3BG3A 2EYHA 2VUMB 2RBMA 2DNEA 2NYZD 3U9SA 2A6ED 1S5FD 1EIHA 1SYGA 2B2WA 2IX1A 3A7LA 5A2QL 3TP5A 5J22A 1B2TA 3G7LA 1B3AA 2CW0D 2EYMA 3S17B 2XIWA 1SYDA 3HZXA 1SYCA 1DXMA 1GJXA 5KEEA 1HTPA 5CORA 4X3SA 5FLXL 1QNUA 4HN7A 5KYIA 2KCNA 1JICA 4Y7NB 2BE5D 1ZKOA 5KIXA 1CM9A 1Y69U 3Q6SA 3MXPA 2EXZA 1HXYD 4WJWA 2E2JB 3S1RB 2O2LD 1UNSA 2K32A 1HTLD 2RDGA 5I9PA 3CQZB 4DU9A 1SXTA 3DMUA 2B2VA 2F0QA 2X6LA 2EZVA 3NK9A 1PFBA 1AN8A 1I4RA 3DXJC 1GUSA 4C1NK 3MTSA 3OW7A 3R8BA 5EBCA 1UEAB 1F2MA 4H44C 1OO9B 4XQNA 4K8IA 2K5WA 3K57A 4G4KA 2BOSA 1HUMA 1PZKD 1EY5A 4O1NA 1WCMB 5I2YA 1TWHB 3J7AF 4OO1I 1JWUD 1KLGD 4XYQA 1A2UA 3A8KE 2B8FA 2V4DA 1F2YA 4DAYA 1YNJD 4C3IB 1CQVA 3SVMA 1JWMD 3OHXC 1EIGA 2ZT9C 2ID0A 4RFBA 4DK1A 1V43A 5IODA 1I50B 2KHSA 4DK0A 5CBEE 1C48A 3PV0A 1T5EA 1HQRD 4NW2A 2JEBI 3H91A 5FO7B 3TP6A 5FO9B 5M3FB 2HDLA 2PNRC 1I4HA 3K58A 2LS01 1ILPA 1Q3LA 1I4QA 3GO5A 5ELEA 1R9TB 1ENCA 1Y8OB 2FMCA 1SNQA 3DWQA 1JWSD 5EQ0A 3ND9A 1XXGA 4OHJA 4EVOA 1QB5D 1X3PA 2F1MA 4K2LA 1WTPA 1SNPA 1JC7A 3ERQA 1RHPA 1KABA 3BDLA 5EPLA 2KVMA 2L9HA 5C4XB 1BBXC 1AP0A 3HEJA 1BF4A 2BDOA 5C5LA 2EVBA 5DEHA 2PZUA 1II3A 1LTAD 2AQ1B 2KCCA 4PNYA 2PQEA 1R4QB 4B08A 3X3NA 2EYJA 4IURA 1GUWA 1HRJA 3P75A 1XYIA 5E3FA 2E2HB 2BE5C 2EY1A 3NE5B 4TSSA 3F2UA 3D31A 3EQLC 2QCPX 4IUUA 3VYUA 5DNFA 4CBVA 1T5XD 3PUXA 3KF8A 3S16B 2A69D 3K5OA 4ODGA 1RTNA 1S4ZA 2RDFA 2JA5B 3D8GA 4CJ0B 2IJ0A 4DXGA 1JOKA 1EOTA 1H9SB 3AMUA 2K01A 4I7ZC 2QDBA 3M4YA 1FNWA 1NR4A 4QUFA 5ELDA 2NVXB 2SNMA 2C9OA 1U4PA 3OOCA 3VYRA 3SDZA 4FP5D 4CHTB 4TQUS 2O5IC 5J39A 2EY5A 4A3KB 1EWHA 1TT2A 3R2TA 2A68C 1JE4A 4IUQA 5IT9E 4KKTA 4K6LA 1EEID 1Q1EA 2R93B 1ENFA 4E6IA 1SE3A 1LT6D 3NSWA 3MXGA 3O13A 2PMZB 4M8AA 3T51B 2IT1A 1YNJC 2JP1A 2B2TC 3J7AV 5K36G 1CK1A 5JEAH 2WP8J 1FR3A 4R8IA 2BA0A 4RCOA 3N52A 2IW3A 3PUVA 2RDHA 4ID6A 3GTLB 3I72A 2CQAA 2XRSD 3H09A 2WINB 3NP8A 1W6KA 1PRTB 3LX0A 4CKEA 2PPBC 1QWYA 3JAML 4A3IB 3S9WA 4DFAA 2N88A 5K5PA 5AFWA 1SE4A 2I46A 3QG1A 5EKIA 3TP7A 3MC0B 1SSOA 2K6AA 1G2TA 3TZDA 2R6GA 1IKMA 3HKZB 2F0EA 3D6WA 4PV1C 5JEAJ 1CZGA 3K59A 2G9DA 3BDCA 4HEDA 3TP8A 2WIIB 2JSOA 5T1GA 4DAVA 3KBXA 4DAPA 3AB9A 5I4DA 1WTVA 4CKBA 4BBSB 5ELFA 3FDTA 3T4AC 1I4PA 3FKIB 4FO2A 1BUVT 1LABA 3MXUA 5I2XA 1MBYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U4M A;  1M8A A;  1DON A;  1HUM A;  1G2S A;  1EIH A;  2B2W A;  1O7Y A;  3GV3 A;  1DOL A;  1MSH A;  1MI2 A;  1DZ1 A;  4ZAI A;  2JP1 A;  2B2T C;  2EE1 A;  2FIN B;  4LMQ D;  5EPK A;  1J8I A;  4IUR A;  2MP1 A;  1GUW A;  1KNE A;  2L11 A;  2RVL A;  3I90 A;  1B2T A;  4MHE A;  1HRJ A;  2RA4 A;  4RA8 A;  1XYI A;  2H1E A;  4R8I A;  1AZP A;  4XDX A;  1C8C A;  3G7L A;  2N55 A;  1B3A A;  1NCV A;  2M2L A;  2K1B A;  1F9R A;  4RAU C;  3I91 A;  3N52 A;  1ROD A;  1PFM A;  4XT1 B;  1BNZ A;  2XIW A;  2SDF A;  3IL8 A;  1G91 A;  5D14 A;  5E4X A;  3F2U A;  1WTX A;  1WD0 A;  2NZ1 D;  1HFN A;  1O80 A;  1E0B A;  2DY7 A;  5COR A;  3SVM A;  1HA6 A;  4IUU A;  4X3S A;  2KUM A;  2B2U C;  4MN3 A;  2IL8 A;  5DNF A;  2B2Y A;  1WTQ A;  2R3Z A;  2HCI A;  5COY A;  5JJZ A;  2JYO A;  1AZQ A;  2HCC A;  1NR2 A;  1WVL A;  2B2V C;  1SAP A;  2KOL A;  2Q8R E;  3DEO A;  1BO0 A;  1EIG A;  4RWS C;  5E4W C;  1CA5 A;  1A15 A;  1JIC A;  3GV6 A;  2B2W C;  1RTN A;  4X3T A;  1S4Z A;  2N88 A;  1O7Z A;  1PFN A;  2J7Z A;  1CM9 A;  4CJ0 B;  5AFW A;  1TVX A;  2NWG A;  3Q6S A;  5CBE E;  2CVR A;  2HUG A;  4U68 A;  2L12 A;  3MWY W;  1KNA A;  3R93 A;  1B4O A;  4X3U A;  5CBA E;  1WTO A;  1EOT A;  1F2L A;  1VMC A;  5EKI A;  1RTO A;  2K04 A;  2HDM A;  4XT3 B;  4NW2 A;  2L1B A;  3H91 A;  2RSO A;  2K01 A;  1PLF A;  3LWE A;  4ZK9 B;  1WTR A;  2MJ8 A;  1F9P A;  3DM1 A;  2HDL A;  1SSO A;  1ICW A;  1EQT A;  1G2T A;  3UI2 A;  2K28 A;  2MPM A;  1WD1 A;  4OIK A;  1NR4 A;  2K05 A;  3IFD A;  1U4L A;  4QUC A;  3TZD A;  4QUF A;  1IKM A;  2FHT A;  2X69 A;  1F9S A;  2D9U A;  3ONA B;  1F9Q A;  1ILP A;  1Q3L A;  1QE6 A;  2RSN A;  2K03 A;  3DEP A;  3D6W A;  2X6G A;  1ESR A;  1DOM A;  1U4P A;  1ILQ A;  2VXW A;  3I3C A;  2Q8T A;  5CMD A;  2B2Y C;  2FFK B;  1MGS A;  2B2T A;  4O42 A;  5EQ0 A;  2KEC A;  5EJW A;  1DOK A;  1WTW A;  2B2V A;  4X3K A;  1QG7 A;  1X3Q A;  2FMM A;  1G6Z A;  2EOT A;  4IUT A;  1B53 A;  4HED A;  1SDF A;  2KEE A;  2EPB A;  5T1G A;  5D65 A;  1PDQ A;  1X3P A;  1XX8 A;  2FJ2 A;  1HUN A;  1CA6 A;  3HP3 A;  1IL8 A;  1ZXT A;  1VMP A;  4IUP A;  1RJT A;  1JE4 A;  3QO2 A;  2X6L A;  3TN2 A;  1WTP A;  4IUQ A;  3I8Z A;  1ML0 D;  1MSG A;  3KBX A;  1PFB A;  1RHP A;  4HAE A;  1HHV A;  1J9O A;  4OIJ A;  1X32 A;  1HFG A;  4UAI A;  3KUP A;  2KVM A;  2L9H A;  5EPL A;  1WTV A;  3MTS A;  4CJ1 B;  1BBX C;  1EL0 A;  1QNK A;  3FDT A;  1AP0 A;  3P7J A;  1IKL A;  1U4R A;  2KED A;  5T1I A;  4IUV A;  1BF4 A;  4R9W A;  4ZKB B;  4ZLT F;  1B50 A;  2NYZ D;  2B2U A;  2BDN A;  2L4N A;  2MGS A;  5EPJ A;  1LV9 A;  2DY8 A;  4DN4 M;  4HCS A;  4HSV A;  4ZKC B;  3FPU B;  4CJ2 C;  1NAP A; 
#chains in the Genus database with same CATH topology
 1Q46 A;  4AH6 A;  2B39 A;  1VQF A;  3CPF A;  4OWW B;  4RHR A;  1QVG A;  1S5D D;  3CC7 A;  3I90 A;  2RVL A;  4ZQ3 A;  3WOF A;  3DWA A;  1OXV A;  3K5L A;  4GZY C;  2F0M A;  2BCO A;  4C2M H;  1VCI A;  4V0B A;  4DR3 L;  3D3R A;  1EYD A;  4V19 0;  3F2B A;  4XQJ A;  3FRP B;  4JI7 L;  2YTY A;  1PH4 A;  5CV7 A;  1FD7 D;  4XT1 B;  4RKB A;  1PXU A;  4OWX B;  3URY A;  1JCK B;  1R4P B;  1K28 A;  1CKN B;  1F77 A;  2NUC A;  3HOU H;  3CCQ A;  1LO5 D;  3TDQ A;  5HGT A;  4PMB A;  5C44 B;  4RWS C;  5M5W B;  4DV3 L;  5AJ3 L;  1KHI A;  2YV5 A;  1TS5 A;  5IGF A;  4U68 A;  1EFI D;  1EQV A;  4LF6 Q;  3RLF A;  2NVY B;  1F2L A;  3IRB A;  2IX3 A;  2DGY A;  1TY2 A;  1RIP A;  3NUC A;  4XT3 B;  5GAG C;  1X56 A;  2UU9 Q;  4RH6 A;  3LWE A;  4OEL B;  1EY4 A;  1EEF D;  1FNV A;  3DM1 A;  5M9O A;  4B3R Q;  1EY8 A;  2KHJ A;  1CT1 D;  4RHS A;  2UXB Q;  4DV6 Q;  5KRU A;  2CWA A;  3A55 A;  2EJG C;  1CUK A;  2B2Y C;  2H5X A;  2VB2 X;  4HIM A;  2AKW B;  1TWG H;  1I6V C;  1PTO C;  3U4V A;  1I6H H;  2KEE A;  2F3I A;  5C0X G;  1ET6 A;  1FL0 A;  2PO4 A;  1CA6 A;  5E1F A;  3MA2 B;  5IOC A;  4YY3 Q;  1NY4 A;  2F0V A;  1D1K A;  4DV4 Q;  1LYL A;  3CCV A;  4JOI A;  3A8J E;  2UXC Q;  5FK9 C;  1M1K C;  1ET9 A;  1H9S A;  2B2U A;  1VQG A;  3DUZ A;  1A8V A;  2TSS A;  1TWF H;  5G3L F;  2E75 C;  2JA9 A;  1PH3 A;  1Q1B A;  3MEH A;  1U4M A;  1M8A A;  4WRD A;  1G51 A;  3HOU B;  3P1H A;  1VQ5 A;  4A93 G;  4AYB E;  4A3B H;  3PSI A;  3T1H L;  1DZ1 A;  4AYB B;  2VB3 X;  2Z6K C;  4O0A A;  4BA1 I;  2EYO A;  3UDX A;  3CCJ A;  4FVM A;  3T13 A;  1S5B D;  3MFG A;  3VYT A;  4LWC A;  2R92 H;  4UPA A;  1W3S A;  2D62 A;  1C8C A;  1J6Q A;  1YIJ A;  2M2L A;  1S5E D;  1B9N A;  2K1B A;  5I6Y A;  1HR0 Q;  4B3M Q;  3I91 A;  2NZH A;  5CV5 A;  1Y8N B;  1FVI A;  3IL8 A;  1D1I A;  4BBR B;  3C3L A;  1VQB A;  1PTO F;  2DY7 A;  2A6H C;  1Q8I A;  1EYC A;  1VQH A;  1L1O C;  4QMG A;  4WJ3 M;  3OSO A;  2AUK A;  3BJU A;  4NDX A;  1G8Z D;  3PGZ A;  1GHJ A;  4RCN A;  2B2W C;  3S2H H;  1XMO Q;  2VQE L;  2AQ2 B;  1TVX A;  1TWG B;  1GUT A;  5JPM C;  3S1Q H;  1I6H B;  1E2W A;  3MWY W;  4JI4 L;  4X3U A;  1PZJ D;  5M5X H;  3OTO Q;  3K5N A;  4IFD H;  4DXF A;  5TSS A;  2MHV A;  2MJ8 A;  3IKJ A;  1PYW D;  2UXD L;  1VQ4 A;  1KLU D;  2ZJR A;  2MPM A;  3J7Y W;  3TEH B;  2D9U A;  3D4W A;  1SNM A;  2QW7 A;  1TWF B;  1EU4 A;  2X6G A;  4KI0 A;  2PI2 E;  2MO1 A;  2VXW A;  2Q8T A;  4IQZ A;  2FFK B;  2ICE C;  1B8A A;  1WTW A;  1EY7 A;  2A74 C;  4P73 A;  1KC8 C;  1QG7 A;  4A3B B;  1Z9F A;  4S3S A;  1GOZ A;  4DGZ A;  1FGU A;  2CQO A;  3LWU A;  3ERO A;  5IY0 A;  3F2C A;  1KXL A;  3I8Z A;  4A3G B;  5EKL A;  2R92 B;  3SEB A;  4R4O A;  1J9O A;  3PUW A;  1LTT D;  2KQ3 A;  4X66 Q;  4LF6 L;  3HFZ B;  1B50 A;  2Q2U A;  4GOP C;  4DUZ Q;  2XVS A;  1BCP F;  4ZKC B;  4G7O C;  1C0A A;  1MJE A;  2D0P A;  1DM0 B;  2RHQ B;  3W3A A;  4C3H H;  4K5V A;  1B9M A;  4PQX A;  3K6O A;  1FJG Q;  2XRQ D;  2VW9 A;  1KNE A;  4IFD J;  5BN3 A;  2HIV A;  2LMC B;  2I5L X;  2RA4 A;  5FKA C;  3S2H B;  4GLV B;  3QIA A;  3S1Q B;  1ONL A;  1CKM A;  2F4I A;  2RCF A;  2D0O A;  4JYA L;  1RL2 A;  5M5X B;  1BXT A;  1EWC A;  1QVF A;  4IPC A;  4YY3 L;  2A68 D;  1E0B A;  2K5V A;  3I70 A;  1HA6 A;  5GQO A;  4JI2 Q;  4LF7 L;  4ME3 A;  5IGC A;  3HS0 C;  3DHQ A;  4HJ7 A;  1YEZ A;  3H0G H;  1EYA A;  1BBW A;  1LAC A;  1WCM G;  5FO8 B;  1N33 L;  4FXK C;  1IZ6 A;  3H3V C;  4JI3 Q;  3G4S A;  3R93 A;  2H4O A;  5CBA E;  4BWG B;  2B3G A;  3D6C A;  1PH7 A;  1A6X A;  1MD2 D;  1JOR A;  4R4T A;  3CAM A;  5C5M A;  5IGG A;  2XSC A;  1Z6H A;  2B29 A;  4GKJ L;  3NTK A;  4JVZ A;  5LMN Q;  1ASZ A;  3HOV H;  4NMZ A;  4PMC A;  4C3I G;  4NXM Q;  3ULJ A;  5KGU A;  1ILQ A;  2Q2I A;  1RD9 D;  4YIJ A;  1RF2 D;  1CKN A;  3KLW A;  2SOB A;  4C3H B;  5FLX E;  4DUY L;  1JOQ A;  2JA7 G;  4A3M H;  5D3I B;  2B63 B;  1MSG A;  5ELO A;  1NBW A;  1XMO L;  1HFG A;  5C0X I;  4IO9 A;  2UUB L;  4OX9 L;  5M3F G;  1UUP A;  1JE5 A;  1STN A;  4IN3 A;  1GUG A;  3NTI A;  3RR5 A;  3L7Z C;  2JA8 H;  1IYV A;  4GS3 A;  1YI2 A;  1FGB D;  3QOL A;  2A8V A;  2BH8 A;  2NN6 I;  1W6J A;  2B8G A;  4MIU A;  3CCU A;  4G7H C;  1QCB D;  1DYQ A;  3GTO H;  1K83 H;  4KV6 A;  1STH A;  1SBB B;  2KCT A;  3H0G B;  3GTQ H;  4FF2 A;  2JE6 I;  2VQF Q;  3MVV A;  5IYB H;  2K33 A;  2WAQ E;  5C6A A;  4KKU A;  3KLR A;  1K9M C;  3GQB A;  1PHJ A;  3I4M H;  1F2Z A;  1TII D;  2PNH A;  5D14 A;  5C4X G;  4KY6 A;  3HOX H;  1VQJ A;  4IJH A;  2NZ1 D;  4K5W A;  4EQP A;  2K5D A;  4DK3 C;  1E3P A;  2IL8 A;  4DR5 L;  2E2I H;  3T56 B;  4CKC A;  2IY5 B;  3HOV B;  2CHB D;  3HOW B;  4NXN Q;  5IP7 H;  4GNX A;  1A15 A;  5IGD A;  4AQY L;  4X3T A;  2F0H A;  4A76 A;  4EQ5 A;  3Q22 A;  3NBH B;  1TR5 A;  1Z7T A;  3KDF B;  2Y0S B;  2JA6 H;  3GTG H;  2HUG A;  3VR5 A;  1SE2 A;  4QL5 A;  2VNU D;  3VDY A;  4RGM A;  2F0J A;  3V2T A;  2FXQ A;  4A3L G;  5IT9 c;  2F3V A;  3KLS A;  1O7L A;  4KN4 C;  1EZ8 A;  1U4L A;  3J80 E;  2L0C A;  2X69 A;  1S72 A;  3SXH A;  4DV7 Q;  1YVC A;  5F2D A;  1X65 A;  2A19 A;  3G71 A;  2JA8 B;  4JG2 A;  3A7A B;  4O42 A;  4JI0 Q;  4HIO A;  5IP9 G;  2AWO A;  3FP9 A;  4X3K A;  1S5C D;  1CZW A;  5DM7 3;  4B3T Q;  4BY7 B;  1SNC A;  3BZC A;  1N8R C;  2NVT H;  3GTO B;  2ZXO A;  4X6A H;  2LFN A;  3QO2 A;  4O2D A;  2XWB B;  4OGQ C;  3GTQ B;  4HAE A;  3BU2 A;  3VYS A;  4JK1 C;  3GTP H;  1CSP A;  1Y8P B;  4Y52 H;  5A35 A;  3R3O A;  3IFT A;  4JBJ A;  5M3M H;  4CJ1 B;  4DPG A;  4KD4 A;  3I55 A;  3I4M B;  1LTR D;  3T53 B;  3C2P A;  5EPJ A;  2MNA A;  1LV9 A;  1E1T A;  1Y1W H;  3HOX B;  4DV5 L;  3QB3 A;  1I4G A;  2M9V A;  4CGY B;  1WD1 A;  1L0Y B;  5DAU A;  4DR3 Q;  2VZA A;  1G2S A;  2L5T A;  2E2I B;  4JI7 Q;  4IOC A;  4YHH L;  2ZM6 Q;  3GV3 A;  1C9O A;  3G48 A;  1OTC A;  4LMQ D;  1TU2 B;  2PI2 A;  1A3V A;  3E3X A;  4PZ7 A;  4TRD A;  4A3K G;  4LUO A;  1DJR D;  2JA6 B;  1JOO A;  3GTG B;  3NEM A;  1BKB A;  1QZH A;  2PCF B;  2O5J C;  1PFM A;  3TBI B;  1PTO D;  4H7B A;  3RZD H;  1B44 D;  4DV3 Q;  5E4X A;  5ELB A;  2RF4 A;  5AJ3 Q;  5IYD G;  5ELN A;  1WOC A;  3KF6 A;  2R93 G;  2UUC L;  4ZCK A;  2NVQ H;  1H9K A;  3KOJ A;  3BVG A;  3I56 A;  3PF5 A;  1KDB A;  1WVL A;  3I2Z A;  4P74 A;  2F0N A;  2QGQ A;  4BS9 A;  3GV6 A;  3ULL A;  4GN3 B;  4BXX G;  4DK6 C;  2NWG A;  1RDP D;  2OWO A;  2L12 A;  2NVT B;  1GD7 A;  3H94 A;  4KD3 A;  1DD2 A;  4G7Z C;  4ZK9 B;  3GTP B;  3S1N H;  4CDF C;  1YNX A;  1F9P A;  4N9T A;  5M3M B;  4DA2 A;  4JI6 L;  2K28 A;  3NEL A;  3P20 A;  3SK6 A;  4J6H A;  2K05 A;  4KJO A;  4C3J H;  1DOM A;  1Y1W B;  3OIP A;  2AWN A;  1AH9 A;  1LT4 D;  3H3V H;  2AUJ D;  1GHK A;  3FVQ A;  3KLS X;  1K3B C;  3RUZ A;  5C4J H;  2WAC A;  4EQO A;  2A6H D;  1SLJ A;  1VQ6 A;  1AE3 A;  4DR1 L;  3HP3 A;  4NXN L;  1ML0 D;  5C3X A;  3CME A;  4HR7 B;  1QUQ B;  2IX0 A;  4A3J G;  2NTS A;  1KDC A;  3T1H Q;  4FF3 A;  5JVG 3;  1GM5 A;  1H95 A;  1BCP D;  3RZD B;  2L4N A;  4IAL A;  2JXM B;  1O7I A;  3AEV A;  4OO1 H;  4KK7 A;  3RD4 A;  4DN4 M;  4BA2 I;  3EBE A;  5EPK A;  2QEJ C;  3HKZ G;  4ZUI A;  3S14 H;  2NVQ B;  1A63 A;  1CHP D;  3CW2 C;  3DWP A;  4A3C G;  1Q82 C;  1EY0 A;  2FIN B;  4HTH A;  5BR8 L;  1Q81 C;  2L11 A;  1UWV A;  2OF1 A;  1VQA A;  3JAM i;  1GXD C;  4JI0 L;  1VQM A;  2LY7 A;  2OTJ A;  1XPR A;  4LFB L;  1N36 Q;  2WB1 B;  5JEA G;  4B9W A;  4KHV A;  3GTJ H;  4QGU A;  1XNR Q;  1PMR A;  1CSQ A;  4KHZ A;  4BBS G;  3PO2 B;  1HA5 A;  3S1N B;  1WD0 A;  2F0W A;  3FKI G;  3CRK C;  2VQE Q;  1CTM A;  3W2D A;  4Z9C B;  1XNQ L;  5LHY 1;  4JI4 Q;  1EWI A;  1LTG D;  4C3J B;  4FXG C;  2KBN A;  2KOL A;  3NWT A;  4FYD A;  2UXD Q;  5C3W A;  2IHF A;  1PFN A;  2J7Z A;  4LFC L;  5C4J B;  3SHL A;  2Z6B A;  2ZM6 L;  3CF5 A;  2ICI A;  1KNA A;  1EYG A;  1VMC A;  2KCM A;  1V1P B;  3HOY H;  2L1B A;  5HUR A;  5IYC G;  4B9X A;  2ES2 A;  2TMP A;  4QUC A;  4J1M A;  1SJE D;  1HPC A;  3PIP 3;  2PYK A;  3V05 A;  1QE6 A;  2BA1 A;  4JI1 L;  3I3C A;  3MAQ A;  1WYD A;  3SR1 A;  1HZA A;  3BDO A;  4L6T B;  4A93 H;  1MGS A;  1UE5 A;  2KEC A;  4A3E H;  3S14 B;  2HIX A;  4DV1 L;  3V96 A;  1X3Q A;  2D5D A;  2G5D A;  3EFX D;  1B53 A;  4KY5 A;  4Q0F A;  3U9O A;  4EX5 A;  5CYU A;  3GTM B;  1WJJ A;  1BDO A;  3RMH A;  4UDU C;  3GP7 A;  1KIX A;  3X3M A;  1B1Z A;  4M1U B;  3SK5 A;  1P8L A;  4YWM A;  3NBH A;  3VA7 A;  3W1G A;  3KDF A;  3J81 E;  1H9J A;  2DJF C;  3KJO A;  1X3F A;  3M4Q A;  3P7J A;  3GTJ B;  2KED A;  4K0K L;  4HJA A;  4OEM B;  2DY8 A;  2Z8L A;  2K5Q A;  3QOJ A;  5C3E G;  2RQX A;  2LXJ A;  4JYA Q;  1Q86 C;  3CKI B;  4IZ8 A;  5KNB A;  2EIF A;  2EE1 A;  4HJ8 A;  1KAA A;  3W1B A;  3HOZ G;  4C2M B;  2F0D A;  2UUA L;  1A3U A;  2E5L L;  4MNO A;  4XXE A;  3L9A X;  4LF7 Q;  4RAU C;  3BS1 A;  3CCE A;  4FF1 A;  1C4Q A;  3C1E A;  5DM6 3;  5NUC A;  2NN6 G;  2L55 A;  5CR3 A;  4GNX B;  3HOY B;  2AQ3 B;  3OMG A;  1PYS B;  1N33 Q;  3C46 A;  2WKD A;  4HJ9 A;  4DR4 Q;  2Z4H A;  4GKK Q;  1QZG A;  2B2U C;  3S15 H;  4YCU A;  1QOH A;  1YHA A;  4XIG S;  1SNO A;  5KYL A;  5JJZ A;  4LF9 Q;  1H9M A;  3HOU G;  4A93 B;  1ZYR C;  4A3E B;  1PH5 A;  2Z6K A;  2YTX A;  4AYB G;  4GKJ Q;  3PUZ A;  4K14 A;  1N32 L;  1JB3 A;  4QIW E;  3SE0 A;  2N3S A;  4QIW B;  3WOE A;  2I5H A;  2NTT A;  4WOR A;  5LMU L;  1IL2 A;  1K8M A;  2VUM G;  3ND8 A;  2K52 A;  4H0L C;  3K5M A;  1EQT A;  4DUY Q;  1SFO H;  2A1A A;  3MZ5 A;  3MXN B;  1N36 L;  2NBF A;  1STY A;  3IFD A;  4BBR G;  3RNU A;  2ZTD A;  2FHT A;  5J3B A;  1F9Q A;  1KTK A;  1HNZ L;  3EA6 A;  1NUC A;  1XNR L;  2K03 A;  3OW2 A;  4KN7 C;  2EJM A;  1IW7 C;  2E2D C;  3K8A A;  1TQO A;  4DR6 Q;  1BCP C;  3L3O C;  4RGO S;  2EDG A;  3FEW X;  1HJP A;  3M4P A;  4BY1 H;  4ZUJ A;  2UUB Q;  4OX9 Q;  2EPB A;  1VQK A;  4L5S A;  1V9P A;  2RCN A;  3HGB A;  4LAA A;  5CGK A;  3PIP A;  4RKL A;  2ZTE A;  3A54 A;  4IUP A;  1RJT A;  5EGT A;  3Q0A A;  2F0I A;  2LXK A;  2DJG C;  1G29 1;  1X3G A;  1CKO A;  3EVQ A;  5KND A;  3PUY A;  2F3W A;  4KY7 A;  4NKL A;  4R9W A;  4ZKB B;  2CWP A;  3VA5 A;  1E1O A;  2EYP A;  3CXC A;  5IE8 A;  4GN4 B;  2K4K A;  4KKS A;  3S15 B;  3NPP A;  4RGN A;  4C1N I;  1K8O A;  1QIL A;  1SYE A;  3UE0 A;  2HQE A;  4JW0 A;  1M90 C;  3RLO A;  1B3Q A;  1PRT C;  4LF4 Q;  2EY6 A;  3KF6 B;  2KA7 A;  3TRE A;  4L5R C;  2H1E A;  3BVZ A;  1TWH H;  4XDX A;  1LM0 A;  4ULL A;  4DR5 Q;  2KJX A;  2C35 B;  4L63 B;  4F7X A;  4A3G G;  2R92 G;  4N9P A;  3CU7 A;  4ILW A;  5FLM G;  1ROD A;  2F0T A;  4A3F H;  4DV0 L;  2F0K A;  4JI8 L;  3ICE A;  4AQY Q;  4HMI A;  2PQA B;  2YYZ A;  1EIF A;  1EY9 A;  2R61 A;  2JN4 A;  5JJI A;  1QUQ A;  4LUZ A;  1D2B A;  1G6P A;  5CV6 A;  3D0F A;  1SFO B;  2F0S A;  2QDL A;  4HID A;  3TME A;  1V8Q A;  2QIL A;  2HCC A;  1NR2 A;  1J5E L;  2B2V C;  1VQ7 A;  1SAP A;  1EIY B;  1HNW L;  1BO0 A;  1NSN S;  1XTD A;  1STA A;  4ZRZ A;  2JA7 H;  4XYO A;  5FLX c;  4BY1 B;  3Q23 A;  3A5U A;  4ABN A;  1WFQ A;  2SNS A;  1D5Z C;  3RZO H;  3NHH A;  1X3E A;  2RKS A;  3FPP A;  2J4X A;  3I4N H;  5M3F H;  2MUY A;  4IFD G;  1PRT F;  5CV8 A;  4F88 A;  1LTB D;  1JR0 D;  2RSN A;  5I6W A;  3E0J A;  3WDN A;  3B6Y A;  1Y14 B;  1D7Q A;  5EJW A;  4EQN A;  1TS3 A;  4DR4 L;  4GKK L;  4A75 A;  4Q5V A;  2QKI C;  1G6Z A;  1E7Z A;  1PZI D;  1K3R A;  1CFM A;  5A2Q E;  4R4C A;  4LF9 L;  5GAH C;  2A73 B;  4DV5 Q;  3KK7 A;  3K7A H;  1A3T A;  3CC2 A;  3AQQ A;  4UAI A;  5EKK A;  4YHH Q;  1L0X B;  3VR2 A;  4J8Q A;  4RG1 A;  1U4R A;  4A3F B;  1O78 A;  4IUV A;  3J80 L;  2AHO B;  3NXW A;  1V1P A;  2PW5 A;  1OXU A;  3I4L A;  4HCS A;  1DGS A;  3I4O A;  3CCM A;  3OMC A;  1JMC A;  1PFS A;  3GD7 A;  3CC4 A;  2GVA A;  3NBI A;  4U67 3;  3E9H A;  4XQQ A;  3PO3 H;  4DNR B;  2F0U A;  1I4X A;  5ELC A;  1LTI D;  1VF5 C;  4C3H G;  2UUC Q;  1I3Q H;  3GTK H;  4DR6 L;  2JA7 B;  2B63 G;  3W5O A;  5I9O A;  1ESF A;  1B70 B;  2IHE A;  2L15 A;  1VQN A;  3NWS A;  3STB D;  2DN8 A;  1PTO H;  3RZO B;  4I7A A;  1K8G A;  4POG A;  3I4N B;  4FF4 A;  1HCZ A;  4DKA C;  3J80 c;  3MHB A;  1OXS C;  1SMY C;  4JV5 L;  2JYO A;  4A3D H;  1VQ8 A;  5IP9 H;  3UDG A;  5E4W C;  4H13 C;  1UAP A;  5IT9 L;  2N8N A;  4X65 L;  1RKN A;  4JI6 Q;  2HHH L;  4KMU C;  3I73 A;  2WKC A;  2XN9 C;  2ASB A;  2WAQ B;  3AFP A;  4K2K A;  3H0G G;  1I94 L;  2F52 A;  5IGE A;  3M85 A;  1P16 A;  2C5C A;  2A6E C;  3K7A B;  5LL6 S;  4LF4 L;  2F0P A;  1GUO A;  2RSO A;  1PLF A;  5EAY A;  3VR4 A;  4DNI A;  1VQE A;  1Y1V H;  1TWA H;  2J0T D;  1I5F A;  4DR1 Q;  2ZXP A;  2NVX H;  2PZW A;  3DEP A;  2OXP A;  1STB A;  1PVO A;  1CI3 M;  1E2Z A;  5CMD A;  1HH2 P;  3ZJY C;  1EQR A;  2I07 B;  5D3D A;  3E0E A;  1DOK A;  2CW0 C;  1GUN A;  1TS2 A;  3HOW G;  5C4H A;  4IUT A;  4A3M B;  3LGJ A;  1SDF A;  3PO3 B;  5D65 A;  3TN2 A;  3UDF A;  1HQM C;  2A5H A;  1KQS A;  3OWE B;  1KL9 A;  2Y0S G;  4K6D A;  3D4R A;  1I3Q B;  3GTK B;  4OIJ A;  2LKV A;  3TZU A;  1YBY A;  1QNK A;  4F87 A;  3KBG A;  5BR8 Q;  2VY3 A;  2R93 H;  4KHP L;  2QA4 A;  5FOB B;  1PTO B;  2VL6 A;  4OL7 A;  2N78 A;  3FPU B;  4DF7 A;  1KRS A;  2F0O A;  4CJ2 C;  4LFB Q;  1DON A;  5K36 H;  3MXN A;  2HT1 A;  1O7Y A;  1DOL A;  3SGI A;  1K83 B;  4A3D B;  2JA5 G;  1KDA A;  4JBM A;  1QJO A;  1J8I A;  2MP1 A;  2WFW A;  1DCZ A;  1VF7 A;  4MHE A;  5JVH 3;  1SYB A;  3MFY A;  4RA8 A;  4BY7 G;  4LJZ C;  1S3O A;  1XNQ Q;  2F03 A;  4I65 A;  1EY6 A;  4LW1 A;  5G3L D;  1NCV A;  1BOS A;  2IWH A;  2R7Z H;  1NE3 A;  1TKW B;  3LNN A;  4FNF A;  2SDF A;  3EN2 A;  2ATW A;  5IYB G;  4KLK A;  1YIT A;  1HFN A;  2CH4 A;  4YWL A;  3I4M G;  4LFC Q;  1Y1V B;  3K7U C;  1TWA B;  4QCL A;  4L8J A;  4MN3 A;  3NQT A;  1WTQ A;  2JEA I;  1M4V A;  4N8X 1;  2HCI A;  5COY A;  1AZQ A;  2K7V A;  3L2P A;  1YHQ A;  1ENA A;  1LT5 D;  2Z1C A;  1Z47 A;  2Q8I B;  3QWN A;  4LF5 Q;  4ME5 A;  1Q7Y C;  4P75 A;  1C7Y A;  1Q90 A;  1O7Z A;  2YU9 H;  1YNN D;  3KFU A;  3A56 A;  5IP7 G;  2F0F A;  2EYL A;  1AFP A;  1OXX K;  1Q12 A;  3RN5 A;  1WTO A;  4JI1 Q;  2O4X A;  2OT2 A;  4A3J H;  5M5Y H;  4WJ4 A;  2JA6 G;  1L1O B;  1HZ9 A;  1SE8 A;  4AIM A;  1WTR A;  1AEX A;  5JAV A;  4DV1 Q;  1ICW A;  4DR2 L;  1PV4 A;  4B3S L;  5IGB A;  4FXD A;  3UI2 A;  1SR3 A;  4OIK A;  3ITP A;  1F9S A;  3SK8 A;  5JOB A;  3S1M H;  4QF4 A;  1ESR A;  1BCP B;  3J7A 5;  2PQA A;  4PZ8 A;  2B2T A;  4IFD I;  4A3C H;  2RHS B;  1FYC A;  1TS4 A;  2Z4I A;  4K0K Q;  2EY2 A;  2FJ2 A;  3K0X A;  3OPO A;  3T16 A;  3VR6 A;  1A62 A;  5IWA L;  4RGT A;  1AW7 A;  3EJI A;  5IIF A;  2ENB A;  1X32 A;  3A5Z B;  1VQ9 A;  3FMC A;  1ZYR D;  1D5X C;  2R7Z B;  1IYJ B;  4EGV A;  1IKL A;  5BN4 A;  2F0L A;  2BDN A;  2MGS A;  2K75 A;  5M3M G;  4UY8 C;  1V1Q A;  1CHQ D;  2UUA Q;  1IBM L;  2E5L Q;  3OYY A;  1NAP A;  4JCV E;  4A3I G;  3M7G A;  4RMF A;  3UDI A;  3STB C;  2K50 A;  1Y1W G;  2E74 C;  1MSH A;  2IPK D;  1MI2 A;  1IYU A;  4ZAI A;  5C4Z A;  4LF8 Q;  4A4I A;  5JJL A;  5HY6 A;  3IAY A;  3T1Y L;  4HSP A;  1QVC A;  1XMQ L;  4GOP B;  1AZP A;  2YU9 B;  3PMF A;  1IW7 D;  2N55 A;  1JJG A;  4KTA A;  3BYT B;  3J81 L;  1F9R A;  4R8N A;  1IXR A;  3R2I A;  1LTL A;  1BNZ A;  1G91 A;  3UE1 A;  4A3J B;  5M5Y B;  5BN5 A;  1S40 A;  2V1C C;  1WTX A;  4DNT B;  1O80 A;  1N32 Q;  2N49 A;  2KUM A;  3F1Z A;  4MTK A;  1VQI A;  2R3Z A;  3HG9 A;  1GO3 E;  4YCW A;  3S1M B;  5LMU Q;  2Q8R E;  3DEO A;  1CA5 A;  1XWE A;  4KJN A;  1LT3 D;  2M00 A;  3WWV A;  1EQQ A;  4JBW A;  2DNC A;  3HKS A;  1VQP A;  2EJF C;  1TXY A;  1TWC H;  1HNZ Q;  5LL6 X;  1B4O A;  1D6E C;  3S2D H;  4ZYS A;  3SK4 A;  1RTO A;  3NQI A;  2WB1 G;  3K80 C;  1BQQ T;  3OWF A;  1PRT D;  4PMW A;  3J81 c;  4G57 A;  4DAM A;  2F0G A;  3M3Y H;  3PO2 G;  2Q2H A;  4QB4 A;  3H6M A;  3G6E A;  5C3E H;  1LTS D;  3TSS A;  3VR3 A;  3CMA A;  1X54 A;  1W2B A;  2QF7 A;  5C0X H;  3OIQ A;  4C3J G;  1OXT A;  1U5K A;  4R4Q A;  1V1O A;  2MFI A;  5FJ8 G;  2G9H D;  2NB0 A;  3HOZ H;  5CV9 A;  1XX8 A;  1HUN A;  4LF5 L;  3M4O H;  1IL8 A;  1VMP A;  1E2V A;  2ZXR A;  1SJH D;  4IUN A;  1PH1 A;  1N9W A;  3A8I E;  4DAY B;  1MHW C;  3AU7 A;  4P2C B;  2NN6 H;  4XTC S;  3S24 A;  5JPN C;  2F4V L;  2A69 C;  5T1I A;  1EU3 A;  4ZLT F;  4GLX A;  1IHZ A;  2NZO A;  2E8G A;  4UHV A;  1D5M C;  1STE A;  5ISR A;  4HSV A;  2D2C C;  3D4D A;  1ICF B;  2GA4 B;  1ZEQ X;  5C44 G;  2E76 C;  5CV4 A;  4OO1 G;  4QJF A;  3QJY A;  3ZYY X;  4NPS A;  4F8M A;  4DV0 Q;  5E7N A;  4JI8 Q;  3JAM E;  1SYF A;  1TY0 A;  5EBD A;  3NTH A;  2K5N A;  4TKO B;  4C56 C;  5J1Z A;  2GVB A;  3E9I A;  1VDZ A;  1NJI C;  4APV A;  1TWC B;  2XNA C;  3BZD B;  4FDB A;  4K5X A;  1J5E Q;  3ER0 A;  3G6J B;  1BBU A;  1HNW Q;  3S2D B;  1E22 A;  2VUM H;  1NMF A;  1YNN C;  2BH2 A;  3PIO 3;  1E24 A;  1XTC D;  2JQO A;  1SEB D;  3CD6 A;  5C0X J;  4BBR H;  1B7Y B;  1X55 A;  3HRZ C;  2PW7 A;  1BR9 A;  2B2Y A;  3M3Y B;  2K5H A;  2LSS A;  1YHB A;  1U9R A;  2OEO A;  1BVS A;  1H9R A;  3CHB D;  5C3E B;  1JQY D;  4GN5 A;  1EZ6 A;  3A74 A;  1STG A;  4WFN 3;  1T9H A;  3K0Y A;  2XWJ B;  1LLR D;  3E5S A;  3CCL A;  2SEB D;  1PYB A;  5KNC A;  2CVR A;  3U58 A;  2YTV A;  3HOZ B;  3BVM A;  4IPD A;  4LF8 L;  2ZJP A;  3S17 H;  3M4O B;  2XGT A;  4K8J A;  2K04 A;  2HDM A;  4JOI C;  5L37 A;  3BZK A;  1SRO A;  2Z9H A;  4MZ9 A;  3M7N A;  2WV6 D;  1XPO A;  3BYY B;  4HMJ A;  1NNX A;  1JJ2 A;  3HOY G;  4HCE A;  3C1F A;  1CQF A;  3ONA B;  1FNU A;  2PZT A;  1PA6 A;  1NTG A;  4Y7N H;  3E6Z X;  1XJV A;  4DV2 L;  2FMM A;  1RCV D;  2EOT A;  3F8T A;  1SND A;  4LK1 C;  3CRL C;  1PDQ A;  4A3E G;  1ZXT A;  3N6R A;  1SMY D;  4NP5 A;  4UP7 A;  1HHV A;  1YJ9 A;  2E2J H;  3S1R H;  2EYF A;  2HQL A;  4A3G H;  1A2T A;  3Q24 A;  5CC4 A;  3KUP A;  5FLM H;  3L0O A;  1EL0 A;  3BG3 A;  2EYH A;  4DR7 Q;  2RBM A;  2VUM B;  2DNE A;  2NYZ D;  3CQZ H;  3KF8 B;  1L1O A;  4X64 Q;  3AFQ A;  3U9S A;  4CDE C;  1UE1 A;  1YJW A;  2A6E D;  1S5F D;  1EIH A;  1SYG A;  2B2W A;  2EXD A;  3A7L A;  2IX1 A;  5A2Q L;  3TP5 A;  5J22 A;  2I5M X;  1B2T A;  1HR0 W;  2CCZ A;  2KEN A;  3G7L A;  4LFA L;  1B3A A;  5HGQ A;  4JV5 Q;  4OXP A;  2CW0 D;  2EYM A;  2JJQ A;  2R7D A;  3S17 B;  1X6O A;  3NEN A;  2XIW A;  1SYD A;  1PH2 A;  3HZX A;  4X65 Q;  1SYC A;  1DXM A;  2HHH Q;  1GJX A;  5KEE A;  1HTP A;  2OTL A;  5COR A;  3M9B A;  2DUD A;  4X3S A;  5FLX L;  1QNU A;  4HN7 A;  5KYI A;  1I94 Q;  1IBL Q;  4HIK A;  1WCM H;  2KCN A;  3TQY A;  1SRU A;  4A3B G;  3PIO A;  1JIC A;  4Y7N B;  3MEF A;  2BE5 D;  1ZKO A;  5GRO A;  5KIX A;  1CM9 A;  1Y69 U;  3Q6S A;  3MXP A;  1MKH A;  2EXZ A;  1HXY D;  4WJW A;  2QEX A;  2E2J B;  3S1R B;  2CKZ B;  2O2L D;  4GOP A;  4UP9 A;  1UNS A;  4C3I H;  2K32 A;  4UP8 A;  1HTL D;  2RDG A;  1UEB A;  5I9P A;  4PG3 A;  3CQZ B;  4DU9 A;  3U4Z A;  3PCO B;  1SXT A;  3Q8D A;  3DMU A;  2UU9 L;  5GAD C;  3KJP A;  2B2V A;  2F0Q A;  2CFM A;  4B3R L;  5DLQ E;  3J7Z C;  1HNX Q;  1I50 H;  4KHP Q;  2UXB L;  1GVP A;  4DV6 L;  2X6L A;  4PZ6 A;  2EZV A;  2B63 H;  3NK9 A;  1PFB A;  4BY1 G;  2I0Q A;  1AN8 A;  1I4R A;  3DXJ C;  4H02 A;  4IOA A;  1GUS A;  4C1N K;  3QR8 A;  3MTS A;  3H3V I;  3OW7 A;  3JC6 6;  4LUV A;  3TS0 A;  3AYH B;  3R8B A;  5EBC A;  1UEA B;  1SN8 A;  1F2M A;  4H44 C;  3PQI A;  1OO9 B;  4XQN A;  1R9T H;  4K8I A;  1L0W A;  2ALY B;  2ZTC A;  2K5W A;  4R1J A;  3K57 A;  4G4K A;  4DV4 L;  2BOS A;  1HUM A;  1ASY A;  5H1S E;  1VQL A;  1KRT A;  1PZK D;  2GN5 A;  1EY5 A;  2R7F A;  4O1N A;  1WCM B;  2UXC L;  4MTN A;  5I2Y A;  3DLL A;  1TWH B;  4JPB W;  3J7A F;  4OO1 I;  1JWU D;  1KLG D;  4XYQ A;  2MQH A;  4N8F A;  5C4X H;  3DM3 A;  1A2U A;  4R4I A;  1IBK Q;  3A8K E;  4TVA B;  4QY7 A;  1K0R A;  3ULP A;  2VS1 A;  2B8F A;  2V4D A;  1HZC A;  1F2Y A;  4HJ5 A;  4DAY A;  1YNJ D;  3CP0 A;  4A3F G;  4C3I B;  1CQV A;  3SVM A;  2HD3 A;  4CDC C;  4B3M L;  1HR0 L;  4DR7 L;  1N34 Q;  1JWM D;  4JI5 Q;  3OHX C;  4X64 L;  1EIG A;  2ZT9 C;  3HOW H;  2ID0 A;  1JJC B;  4RFB A;  4DK1 A;  4DR2 Q;  4B3S Q;  1V43 A;  5IOD A;  1YZ6 A;  1D8L A;  4A3L H;  1I50 B;  2KHS A;  4DK0 A;  5CBE E;  2E2H H;  1C48 A;  2Q2T A;  3PV0 A;  1T5E A;  2Z0S A;  3ERS X;  4X62 Q;  4LNQ A;  1HQR D;  4NW2 A;  2JEB I;  1EOV A;  3H91 A;  5LMN W;  5FO7 B;  3TP6 A;  5FO9 B;  1EFW A;  5M3F B;  2HDL A;  2PNR C;  1I4H A;  2AMC B;  3K58 A;  2LS0 1;  1ILP A;  4JBK A;  5IWA Q;  1Q3L A;  3J80 i;  1I4Q A;  3GO5 A;  3I4N G;  5ELE A;  3S16 H;  1R9T B;  3OTO L;  1ENC A;  1Y8O B;  2FMC A;  1SNQ A;  2JK8 A;  3DWQ A;  1JWS D;  5EQ0 A;  2JA5 H;  2KHI A;  3ND9 A;  1XXG A;  4OHJ A;  4EVO A;  1QB5 D;  2ZJQ A;  1IBL L;  1X3P A;  2F1M A;  4K2L A;  1WTP A;  1SNP A;  4BY7 H;  1JC7 A;  3ERQ A;  1IBM Q;  2WAQ G;  1RHP A;  1KAB A;  4P71 A;  4QQB X;  3BDL A;  1X9N A;  5EPL A;  2KVM A;  2L9H A;  5C4X B;  1BBX C;  1AP0 A;  3HEJ A;  1BF4 A;  2BDO A;  1PH9 A;  5C5L A;  3T1Y Q;  4JC0 A;  1XMQ Q;  2EVB A;  1MJC A;  5DEH A;  3HOV G;  2PZU A;  3H15 A;  5GAE C;  1II3 A;  1LTA D;  1EUJ A;  1MIU A;  2AQ1 B;  2KCC A;  3U50 C;  4GNX C;  4PNY A;  2PQE A;  1R4Q B;  4A3K H;  4B08 A;  3X3N A;  2EYJ A;  4X66 L;  4IUR A;  4DUZ L;  1GUW A;  1VQC A;  1AE2 A;  4A3M G;  1HRJ A;  3P75 A;  1XYI A;  5E3F A;  3PO3 G;  2Y0S E;  3TS2 A;  1HNX L;  2E2H B;  5IYD H;  4YCV A;  2BE5 C;  2EY1 A;  5JJK A;  3NE5 B;  4TSS A;  3F2U A;  3D31 A;  1FJG L;  3EQL C;  2QCP X;  4IUU A;  3VYU A;  3TRZ A;  5DNF A;  2JA8 G;  4CBV A;  1T5X D;  1PH8 A;  1LUZ A;  3PUX A;  3KF8 A;  4BXX H;  3S16 B;  2A69 D;  3K5O A;  4GLA C;  4L5T A;  4ODG A;  1RTN A;  1S4Z A;  2RDF A;  4A3D G;  2JA5 B;  3D8G A;  4CJ0 B;  3CPW A;  4JI2 L;  2IJ0 A;  4DXG A;  1JOK A;  3F2D A;  1EOT A;  3CCS A;  1H9S B;  3AMU A;  3GTL H;  2K01 A;  4I7Z C;  3GDE A;  2QDB A;  3M4Y A;  2OQK A;  1FNW A;  4OWT B;  3HOX G;  1NR4 A;  1IBK L;  4QUF A;  5ELD A;  2NVX B;  2SNM A;  4JI3 L;  2C9O A;  4OON A;  3EIV A;  1Y1V G;  1U4P A;  3OOC A;  3VYR A;  3SDZ A;  4A3I H;  1WTH A;  4FP5 D;  4CHT B;  4TQU S;  2O5I C;  2XTI A;  2F4V Q;  5J39 A;  4POF A;  2EY5 A;  4A3K B;  1EWH A;  1TT2 A;  5LMN L;  1N34 L;  1XPU A;  3R2T A;  2A68 C;  4J15 A;  4JI5 L;  4CDD C;  3I7F A;  1JE4 A;  4NXM L;  4IUQ A;  5IT9 E;  4KKT A;  4K6L A;  1KAW A;  1EEI D;  1Q1E A;  3A0J A;  3RLN A;  2R93 B;  1K73 C;  1ENF A;  3PF4 A;  1WI5 A;  4X62 L;  4E6I A;  1SE3 A;  1JB7 A;  1LT6 D;  2PMZ E;  3NSW A;  3MXG A;  3O13 A;  2PMZ B;  4IPH A;  4M8A A;  3T51 B;  2IT1 A;  3FHW A;  1YNJ C;  2JP1 A;  2B2T C;  2K14 A;  3J7A V;  5K36 G;  1CK1 A;  1K0S A;  5JEA H;  2WP8 J;  2EQS A;  1FR3 A;  1VQD A;  4R8I A;  1UE7 A;  1SMX A;  1UE6 A;  4L5Q A;  2BA0 A;  2CH4 W;  4BBS H;  1GKH A;  4RCO A;  3KYH C;  3N52 A;  2OQ0 A;  3FKI H;  2IW3 A;  3PUV A;  2RDH A;  4ID6 A;  3CCR A;  3GTL B;  3I72 A;  2R7Z G;  1KD1 C;  2CQA A;  2XRS D;  3H09 A;  2WIN B;  3PO2 H;  3NP8 A;  1W6K A;  2VQF L;  4IJL A;  1PRT B;  3LX0 A;  4CKE A;  2PPB C;  1QWY A;  3JAM L;  4A3I B;  3S9W A;  5FJ8 H;  4DFA A;  1HZB A;  2N88 A;  1VQO A;  5K5P A;  5AFW A;  1SE4 A;  5IYC H;  2I46 A;  3QG1 A;  5EKI A;  2P5Z X;  3TP7 A;  3MC0 B;  1PH6 A;  4DV2 Q;  1SSO A;  2MO0 A;  2K6A A;  1G2T A;  1K8A C;  1VS0 A;  3HKZ E;  3TZD A;  2R6G A;  1IKM A;  1U0L A;  3HKZ B;  2F0E A;  2OCE A;  3D6W A;  3RN2 A;  5C44 H;  4PV1 C;  5JEA J;  5M5W H;  1Q8K A;  1CZG A;  3K59 A;  1NMG A;  1YJN A;  1A0I A;  2G9D A;  3BDC A;  4HED A;  3TP8 A;  4NB3 A;  2WII B;  2JSO A;  4IPG A;  5T1G A;  3J81 j;  3JAM c;  3K81 C;  2NVY H;  4DV7 L;  4ALP A;  4YWK A;  4DAV A;  3GTM H;  3KBX A;  4DAP A;  3AB9 A;  5I4D A;  1WTV A;  4CKB A;  4BBS B;  5ELF A;  3FDT A;  3T4A C;  2WB1 E;  1JT8 A;  1I4P A;  3FKI B;  3J81 i;  1L2F A;  4B3T L;  4FO2 A;  1BUV T;  4P72 A;  1LAB A;  3MXU A;  5I2X A;  1MBY A;  4LFA Q; 
#chains in the Genus database with same CATH homology
 2B39 A;  4RHR A;  1S5D D;  3I90 A;  2RVL A;  4ZQ3 A;  3WOF A;  3DWA A;  1OXV A;  3K5L A;  4GZY C;  2F0M A;  2BCO A;  1VCI A;  4V0B A;  3D3R A;  1EYD A;  4V19 0;  4XQJ A;  3FRP B;  5CV7 A;  1FD7 D;  4XT1 B;  4RKB A;  1PXU A;  3URY A;  1JCK B;  1R4P B;  1F77 A;  2NUC A;  1LO5 D;  3TDQ A;  5HGT A;  4PMB A;  5C44 B;  4RWS C;  5M5W B;  1TS5 A;  5IGF A;  4U68 A;  1EFI D;  1EQV A;  3RLF A;  2NVY B;  1F2L A;  2IX3 A;  3NUC A;  1TY2 A;  4XT3 B;  4RH6 A;  3LWE A;  1EY4 A;  1EEF D;  1FNV A;  3DM1 A;  5M9O A;  1EY8 A;  1CT1 D;  4RHS A;  5KRU A;  3A55 A;  2EJG C;  2B2Y C;  2VB2 X;  1I6V C;  1PTO C;  2KEE A;  5C0X G;  1ET6 A;  2PO4 A;  1CA6 A;  5E1F A;  3MA2 B;  5IOC A;  2F0V A;  1D1K A;  3A8J E;  5FK9 C;  1ET9 A;  1H9S A;  2B2U A;  3DUZ A;  2TSS A;  5G3L F;  2E75 C;  1Q1B A;  3MEH A;  1U4M A;  1M8A A;  4WRD A;  3HOU B;  3P1H A;  1DZ1 A;  4AYB B;  2VB3 X;  4BA1 I;  2EYO A;  4FVM A;  3T13 A;  1S5B D;  3MFG A;  3VYT A;  2D62 A;  1C8C A;  2M2L A;  1S5E D;  1B9N A;  2K1B A;  5I6Y A;  3I91 A;  5CV5 A;  1Y8N B;  3IL8 A;  1D1I A;  4BBR B;  3C3L A;  1PTO F;  2DY7 A;  2A6H C;  1Q8I A;  1EYC A;  4QMG A;  3OSO A;  2AUK A;  4NDX A;  1G8Z D;  1GHJ A;  4RCN A;  2B2W C;  2AQ2 B;  1TVX A;  1TWG B;  1GUT A;  5JPM C;  1I6H B;  1E2W A;  3MWY W;  4X3U A;  1PZJ D;  3K5N A;  4IFD H;  4DXF A;  5TSS A;  2MHV A;  2MJ8 A;  3IKJ A;  1PYW D;  1KLU D;  2MPM A;  3J7Y W;  2D9U A;  3D4W A;  1SNM A;  1TWF B;  1EU4 A;  2X6G A;  4KI0 A;  2VXW A;  2Q8T A;  4IQZ A;  2FFK B;  2ICE C;  1WTW A;  1EY7 A;  2A74 C;  1QG7 A;  4A3B B;  4S3S A;  1GOZ A;  4DGZ A;  3LWU A;  3ERO A;  3I8Z A;  4A3G B;  5EKL A;  2R92 B;  3SEB A;  1J9O A;  1LTT D;  3PUW A;  2KQ3 A;  1B50 A;  2XVS A;  1BCP F;  4ZKC B;  4G7O C;  1DM0 B;  3W3A A;  4K5V A;  1B9M A;  4PQX A;  3K6O A;  2XRQ D;  1KNE A;  4IFD J;  5BN3 A;  2LMC B;  5FKA C;  2RA4 A;  3S2H B;  3QIA A;  3S1Q B;  1ONL A;  2F4I A;  5M5X B;  1BXT A;  1EWC A;  2A68 D;  1E0B A;  3I70 A;  1HA6 A;  5IGC A;  3HS0 C;  3DHQ A;  1EYA A;  1LAC A;  5FO8 B;  4FXK C;  3H3V C;  3R93 A;  2H4O A;  5CBA E;  4BWG B;  3D6C A;  1A6X A;  1MD2 D;  1JOR A;  5C5M A;  5IGG A;  2XSC A;  1Z6H A;  3NTK A;  4NMZ A;  4PMC A;  4C3I G;  5KGU A;  1ILQ A;  1RD9 D;  4YIJ A;  1RF2 D;  2SOB A;  4C3H B;  5FLX E;  1JOQ A;  5D3I B;  2B63 B;  1MSG A;  1HFG A;  5C0X I;  1UUP A;  1STN A;  4IN3 A;  1GUG A;  3NTI A;  3L7Z C;  1IYV A;  1FGB D;  3QOL A;  2NN6 I;  1W6J A;  2B8G A;  4MIU A;  4G7H C;  1QCB D;  1DYQ A;  4KV6 A;  1STH A;  1SBB B;  3H0G B;  4FF2 A;  2JE6 I;  3MVV A;  2K33 A;  5C6A A;  4KKU A;  3KLR A;  3GQB A;  1F2Z A;  1TII D;  5D14 A;  4KY6 A;  4K5W A;  2NZ1 D;  4EQP A;  2K5D A;  2IL8 A;  3T56 B;  4CKC A;  3HOV B;  2CHB D;  3HOW B;  1A15 A;  5IGD A;  4X3T A;  2F0H A;  3Q22 A;  1TR5 A;  1Z7T A;  2Y0S B;  2HUG A;  3VR5 A;  1SE2 A;  2VNU D;  4RGM A;  2F0J A;  3V2T A;  2F3V A;  3KLS A;  1O7L A;  4KN4 C;  1EZ8 A;  1U4L A;  3J80 E;  2L0C A;  2X69 A;  3SXH A;  5F2D A;  2JA8 B;  3A7A B;  4O42 A;  2AWO A;  4X3K A;  1S5C D;  1CZW A;  5DM7 3;  4BY7 B;  1SNC A;  3GTO B;  2ZXO A;  2LFN A;  3QO2 A;  2XWB B;  4OGQ C;  3GTQ B;  4HAE A;  3VYS A;  4JK1 C;  1Y8P B;  5A35 A;  3R3O A;  3IFT A;  4CJ1 B;  4KD4 A;  3I4M B;  1LTR D;  3T53 B;  3C2P A;  5EPJ A;  1LV9 A;  3HOX B;  3QB3 A;  1I4G A;  2M9V A;  4CGY B;  1WD1 A;  1L0Y B;  5DAU A;  1G2S A;  2L5T A;  2E2I B;  3GV3 A;  4LMQ D;  1TU2 B;  1A3V A;  4TRD A;  1DJR D;  2JA6 B;  1JOO A;  3GTG B;  2PCF B;  2O5J C;  1PFM A;  3TBI B;  1PTO D;  4H7B A;  1B44 D;  5E4X A;  5ELB A;  1H9K A;  3BVG A;  1KDB A;  1WVL A;  2F0N A;  4BS9 A;  3GV6 A;  2NWG A;  1RDP D;  2L12 A;  2NVT B;  3H94 A;  4KD3 A;  1DD2 A;  4G7Z C;  4ZK9 B;  3GTP B;  1F9P A;  4N9T A;  5M3M B;  4DA2 A;  2K28 A;  3P20 A;  3SK6 A;  4J6H A;  2K05 A;  4KJO A;  1DOM A;  1Y1W B;  3OIP A;  2AWN A;  1LT4 D;  2AUJ D;  1GHK A;  3FVQ A;  3KLS X;  3RUZ A;  2WAC A;  4EQO A;  2A6H D;  3HP3 A;  1ML0 D;  5C3X A;  4HR7 B;  2IX0 A;  2NTS A;  1KDC A;  4FF3 A;  5JVG 3;  1BCP D;  3RZD B;  2L4N A;  4IAL A;  2JXM B;  4OO1 H;  4KK7 A;  3RD4 A;  4DN4 M;  4BA2 I;  5EPK A;  2QEJ C;  4ZUI A;  2NVQ B;  1CHP D;  3DWP A;  1EY0 A;  2FIN B;  4HTH A;  2L11 A;  2OF1 A;  1GXD C;  2LY7 A;  2WB1 B;  5JEA G;  4B9W A;  4KHV A;  1PMR A;  4KHZ A;  3PO2 B;  1HA5 A;  3S1N B;  1WD0 A;  2F0W A;  3CRK C;  1CTM A;  3W2D A;  4Z9C B;  5LHY 1;  1LTG D;  4C3J B;  4FXG C;  2KOL A;  3NWT A;  4FYD A;  5C3W A;  1PFN A;  2J7Z A;  5C4J B;  3SHL A;  2ICI A;  1KNA A;  1VMC A;  1V1P B;  2L1B A;  5HUR A;  4B9X A;  2TMP A;  4QUC A;  4J1M A;  1SJE D;  1HPC A;  3PIP 3;  2PYK A;  3V05 A;  1QE6 A;  2BA1 A;  3I3C A;  3MAQ A;  3SR1 A;  3BDO A;  4L6T B;  1MGS A;  2KEC A;  3S14 B;  3V96 A;  1X3Q A;  2D5D A;  3EFX D;  1B53 A;  4KY5 A;  4Q0F A;  3U9O A;  5CYU A;  3GTM B;  1BDO A;  3RMH A;  4UDU C;  3GP7 A;  3X3M A;  1B1Z A;  4M1U B;  3SK5 A;  3NBH A;  3VA7 A;  3J81 E;  1H9J A;  3P7J A;  3GTJ B;  2KED A;  2DY8 A;  2Z8L A;  2K5Q A;  3QOJ A;  2RQX A;  3CKI B;  4IZ8 A;  5KNB A;  2EE1 A;  1KAA A;  4C2M B;  2F0D A;  1A3U A;  4XXE A;  3L9A X;  4RAU C;  3BS1 A;  4FF1 A;  1C4Q A;  3C1E A;  5DM6 3;  5NUC A;  2NN6 G;  2L55 A;  5CR3 A;  3HOY B;  2AQ3 B;  3OMG A;  3C46 A;  2WKD A;  2Z4H A;  2B2U C;  1QOH A;  4XIG S;  1SNO A;  5KYL A;  5JJZ A;  1H9M A;  4A93 B;  1ZYR C;  4A3E B;  3PUZ A;  4K14 A;  1JB3 A;  3SE0 A;  4QIW B;  3WOE A;  2NTT A;  4WOR A;  1K8M A;  3ND8 A;  4H0L C;  3K5M A;  1EQT A;  3MZ5 A;  2NBF A;  1STY A;  3IFD A;  2FHT A;  1F9Q A;  1KTK A;  3EA6 A;  1NUC A;  2K03 A;  4KN7 C;  2EJM A;  1IW7 C;  2E2D C;  1TQO A;  1BCP C;  3L3O C;  4RGO S;  2EDG A;  3FEW X;  4ZUJ A;  2EPB A;  3HGB A;  4LAA A;  5CGK A;  4RKL A;  3A54 A;  4IUP A;  1RJT A;  5EGT A;  3Q0A A;  2F0I A;  1G29 1;  3EVQ A;  5KND A;  3PUY A;  2F3W A;  4KY7 A;  4NKL A;  4R9W A;  4ZKB B;  3VA5 A;  2EYP A;  4KKS A;  3S15 B;  3NPP A;  4RGN A;  4C1N I;  1K8O A;  1QIL A;  1SYE A;  2HQE A;  1PRT C;  2EY6 A;  2KA7 A;  2H1E A;  3BVZ A;  4XDX A;  4ULL A;  2KJX A;  4L63 B;  4F7X A;  4N9P A;  3CU7 A;  4ILW A;  1ROD A;  2F0T A;  2F0K A;  4HMI A;  2YYZ A;  1EY9 A;  2R61 A;  1D2B A;  5CV6 A;  1SFO B;  2F0S A;  3TME A;  1V8Q A;  2HCC A;  1NR2 A;  2QIL A;  2B2V C;  1SAP A;  1BO0 A;  1NSN S;  1STA A;  4ZRZ A;  4XYO A;  4BY1 B;  3Q23 A;  4ABN A;  2SNS A;  1D5Z C;  3NHH A;  2RKS A;  3FPP A;  2J4X A;  2MUY A;  4IFD G;  1PRT F;  5CV8 A;  4F88 A;  1LTB D;  1JR0 D;  2RSN A;  5I6W A;  3E0J A;  3WDN A;  5EJW A;  4EQN A;  1TS3 A;  4Q5V A;  2QKI C;  1G6Z A;  1PZI D;  1CFM A;  5A2Q E;  2A73 B;  3KK7 A;  1A3T A;  4UAI A;  5EKK A;  1L0X B;  3VR2 A;  4J8Q A;  1U4R A;  4A3F B;  1O78 A;  4IUV A;  3J80 L;  3NXW A;  1V1P A;  2PW5 A;  1OXU A;  3I4L A;  4HCS A;  3OMC A;  3GD7 A;  3NBI A;  4U67 3;  4XQQ A;  4DNR B;  2F0U A;  1I4X A;  5ELC A;  1LTI D;  1VF5 C;  4C3H G;  2JA7 B;  5I9O A;  1ESF A;  3NWS A;  2DN8 A;  1PTO H;  3RZO B;  3I4N B;  4FF4 A;  1HCZ A;  3MHB A;  1OXS C;  1SMY C;  2JYO A;  5E4W C;  4H13 C;  1UAP A;  5IT9 L;  1RKN A;  4KMU C;  3I73 A;  2WKC A;  2XN9 C;  2WAQ B;  4K2K A;  5IGE A;  3M85 A;  5LL6 S;  2C5C A;  2A6E C;  3K7A B;  2F0P A;  1GUO A;  2RSO A;  1PLF A;  3VR4 A;  2J0T D;  2ZXP A;  2PZW A;  3DEP A;  2OXP A;  1STB A;  1CI3 M;  1E2Z A;  5CMD A;  2I07 B;  5D3D A;  1DOK A;  2CW0 C;  1GUN A;  1TS2 A;  5C4H A;  4IUT A;  4A3M B;  1SDF A;  3PO3 B;  5D65 A;  3TN2 A;  1HQM C;  2A5H A;  3OWE B;  4K6D A;  3D4R A;  1I3Q B;  3GTK B;  4OIJ A;  2LKV A;  3TZU A;  1QNK A;  4F87 A;  3KBG A;  5FOB B;  1PTO B;  4OL7 A;  4DF7 A;  3FPU B;  2F0O A;  4CJ2 C;  1DON A;  5K36 H;  3MXN A;  1O7Y A;  1DOL A;  1K83 B;  4A3D B;  1KDA A;  1QJO A;  1J8I A;  2MP1 A;  1DCZ A;  1VF7 A;  4MHE A;  5JVH 3;  1SYB A;  3MFY A;  4RA8 A;  4LJZ C;  2F03 A;  4I65 A;  1EY6 A;  5G3L D;  1NCV A;  1BOS A;  2IWH A;  1TKW B;  3LNN A;  4FNF A;  2SDF A;  1HFN A;  1Y1V B;  1TWA B;  4QCL A;  4L8J A;  4MN3 A;  3NQT A;  1WTQ A;  2JEA I;  1M4V A;  2HCI A;  5COY A;  1AZQ A;  2K7V A;  1ENA A;  1LT5 D;  2Z1C A;  1Z47 A;  2Q8I B;  3QWN A;  4ME5 A;  1Q90 A;  1O7Z A;  1YNN D;  3A56 A;  2F0F A;  2EYL A;  1AFP A;  1OXX K;  1Q12 A;  1WTO A;  2O4X A;  2OT2 A;  1WTR A;  1AEX A;  5JAV A;  1ICW A;  4FXD A;  5IGB A;  3UI2 A;  4OIK A;  3ITP A;  1F9S A;  3SK8 A;  5JOB A;  4QF4 A;  1ESR A;  1BCP B;  2B2T A;  4IFD I;  1FYC A;  1TS4 A;  2Z4I A;  2EY2 A;  2FJ2 A;  3OPO A;  3T16 A;  3VR6 A;  4RGT A;  1AW7 A;  3EJI A;  5IIF A;  2ENB A;  1X32 A;  3FMC A;  1ZYR D;  1D5X C;  2R7Z B;  4EGV A;  1IKL A;  5BN4 A;  2F0L A;  2BDN A;  2MGS A;  1CHQ D;  1NAP A;  3M7G A;  2E74 C;  1MSH A;  2IPK D;  1MI2 A;  1IYU A;  4ZAI A;  5C4Z A;  3IAY A;  4HSP A;  1AZP A;  2YU9 B;  3PMF A;  1IW7 D;  2N55 A;  4KTA A;  3BYT B;  3J81 L;  1F9R A;  4R8N A;  3R2I A;  1BNZ A;  1G91 A;  4A3J B;  5M5Y B;  5BN5 A;  1WTX A;  4DNT B;  1O80 A;  2KUM A;  2R3Z A;  3HG9 A;  3S1M B;  2Q8R E;  3DEO A;  1CA5 A;  1XWE A;  4KJN A;  1LT3 D;  2M00 A;  4JBW A;  2DNC A;  2EJF C;  5LL6 X;  1B4O A;  1D6E C;  4ZYS A;  3SK4 A;  1RTO A;  3NQI A;  1BQQ T;  3OWF A;  1PRT D;  4PMW A;  4G57 A;  2F0G A;  4QB4 A;  3H6M A;  1LTS D;  3TSS A;  3VR3 A;  2QF7 A;  5C0X H;  3OIQ A;  4C3J G;  1OXT A;  1V1O A;  2G9H D;  2NB0 A;  5CV9 A;  1XX8 A;  1HUN A;  1IL8 A;  1VMP A;  1E2V A;  2ZXR A;  1SJH D;  4IUN A;  3A8I E;  3AU7 A;  4P2C B;  2NN6 H;  4XTC S;  5JPN C;  2A69 C;  5T1I A;  1EU3 A;  4ZLT F;  1IHZ A;  1D5M C;  1STE A;  5ISR A;  4HSV A;  2D2C C;  3D4D A;  2GA4 B;  1ZEQ X;  2E76 C;  5CV4 A;  4OO1 G;  3QJY A;  3ZYY X;  4F8M A;  3JAM E;  1SYF A;  1TY0 A;  5EBD A;  3NTH A;  4TKO B;  4C56 C;  5J1Z A;  1VDZ A;  1TWC B;  2XNA C;  3BZD B;  4K5X A;  3G6J B;  3S2D B;  1YNN C;  3PIO 3;  1XTC D;  1SEB D;  5C0X J;  3HRZ C;  2PW7 A;  1BR9 A;  2B2Y A;  3M3Y B;  1U9R A;  2OEO A;  3CHB D;  1H9R A;  5C3E B;  1JQY D;  1EZ6 A;  1STG A;  4WFN 3;  3K0Y A;  2XWJ B;  1LLR D;  3E5S A;  2SEB D;  5KNC A;  2CVR A;  3HOZ B;  3BVM A;  3M4O B;  4K8J A;  2K04 A;  2HDM A;  3M7N A;  2WV6 D;  3BYY B;  4HMJ A;  4HCE A;  3C1F A;  1CQF A;  3ONA B;  1FNU A;  2PZT A;  3E6Z X;  2FMM A;  1RCV D;  2EOT A;  1SND A;  4LK1 C;  3CRL C;  1PDQ A;  1ZXT A;  3N6R A;  1SMY D;  4NP5 A;  1HHV A;  2EYF A;  1A2T A;  3Q24 A;  5CC4 A;  3KUP A;  1EL0 A;  3BG3 A;  2EYH A;  2VUM B;  2RBM A;  2DNE A;  2NYZ D;  3U9S A;  2A6E D;  1S5F D;  1EIH A;  1SYG A;  2B2W A;  2IX1 A;  3A7L A;  5A2Q L;  3TP5 A;  5J22 A;  1B2T A;  3G7L A;  1B3A A;  2CW0 D;  2EYM A;  3S17 B;  2XIW A;  1SYD A;  3HZX A;  1SYC A;  1DXM A;  1GJX A;  5KEE A;  1HTP A;  5COR A;  4X3S A;  5FLX L;  1QNU A;  4HN7 A;  5KYI A;  2KCN A;  1JIC A;  4Y7N B;  2BE5 D;  1ZKO A;  5KIX A;  1CM9 A;  1Y69 U;  3Q6S A;  3MXP A;  2EXZ A;  1HXY D;  4WJW A;  2E2J B;  3S1R B;  2O2L D;  1UNS A;  2K32 A;  1HTL D;  2RDG A;  5I9P A;  3CQZ B;  4DU9 A;  1SXT A;  3DMU A;  2B2V A;  2F0Q A;  2X6L A;  2EZV A;  3NK9 A;  1PFB A;  1AN8 A;  1I4R A;  3DXJ C;  1GUS A;  4C1N K;  3MTS A;  3OW7 A;  3R8B A;  5EBC A;  1UEA B;  1F2M A;  4H44 C;  1OO9 B;  4XQN A;  4K8I A;  2K5W A;  3K57 A;  4G4K A;  2BOS A;  1HUM A;  1PZK D;  1EY5 A;  4O1N A;  1WCM B;  5I2Y A;  1TWH B;  3J7A F;  4OO1 I;  1JWU D;  1KLG D;  4XYQ A;  1A2U A;  3A8K E;  2B8F A;  2V4D A;  1F2Y A;  4DAY A;  1YNJ D;  4C3I B;  1CQV A;  3SVM A;  1JWM D;  3OHX C;  1EIG A;  2ZT9 C;  2ID0 A;  4RFB A;  4DK1 A;  1V43 A;  5IOD A;  1I50 B;  2KHS A;  4DK0 A;  5CBE E;  1C48 A;  3PV0 A;  1T5E A;  1HQR D;  4NW2 A;  2JEB I;  3H91 A;  5FO7 B;  3TP6 A;  5FO9 B;  5M3F B;  2HDL A;  2PNR C;  1I4H A;  3K58 A;  2LS0 1;  1ILP A;  1Q3L A;  1I4Q A;  3GO5 A;  5ELE A;  1R9T B;  1ENC A;  1Y8O B;  2FMC A;  1SNQ A;  3DWQ A;  1JWS D;  5EQ0 A;  3ND9 A;  1XXG A;  4OHJ A;  4EVO A;  1QB5 D;  1X3P A;  2F1M A;  4K2L A;  1WTP A;  1SNP A;  1JC7 A;  3ERQ A;  1RHP A;  1KAB A;  3BDL A;  5EPL A;  2KVM A;  2L9H A;  5C4X B;  1BBX C;  1AP0 A;  3HEJ A;  1BF4 A;  2BDO A;  5C5L A;  2EVB A;  5DEH A;  2PZU A;  1II3 A;  1LTA D;  2AQ1 B;  2KCC A;  4PNY A;  2PQE A;  1R4Q B;  4B08 A;  3X3N A;  2EYJ A;  4IUR A;  1GUW A;  1HRJ A;  3P75 A;  1XYI A;  5E3F A;  2E2H B;  2BE5 C;  2EY1 A;  3NE5 B;  4TSS A;  3F2U A;  3D31 A;  3EQL C;  2QCP X;  4IUU A;  3VYU A;  5DNF A;  4CBV A;  1T5X D;  3PUX A;  3KF8 A;  3S16 B;  2A69 D;  3K5O A;  4ODG A;  1RTN A;  1S4Z A;  2RDF A;  2JA5 B;  3D8G A;  4CJ0 B;  2IJ0 A;  4DXG A;  1JOK A;  1EOT A;  1H9S B;  3AMU A;  2K01 A;  4I7Z C;  2QDB A;  3M4Y A;  1FNW A;  1NR4 A;  4QUF A;  5ELD A;  2NVX B;  2SNM A;  2C9O A;  1U4P A;  3OOC A;  3VYR A;  3SDZ A;  4FP5 D;  4CHT B;  4TQU S;  2O5I C;  5J39 A;  2EY5 A;  4A3K B;  1EWH A;  1TT2 A;  3R2T A;  2A68 C;  1JE4 A;  4IUQ A;  5IT9 E;  4KKT A;  4K6L A;  1EEI D;  1Q1E A;  2R93 B;  1ENF A;  4E6I A;  1SE3 A;  1LT6 D;  3NSW A;  3MXG A;  3O13 A;  2PMZ B;  4M8A A;  3T51 B;  2IT1 A;  1YNJ C;  2JP1 A;  2B2T C;  3J7A V;  5K36 G;  1CK1 A;  5JEA H;  2WP8 J;  1FR3 A;  4R8I A;  2BA0 A;  4RCO A;  3N52 A;  2IW3 A;  3PUV A;  2RDH A;  4ID6 A;  3GTL B;  3I72 A;  2CQA A;  2XRS D;  3H09 A;  2WIN B;  3NP8 A;  1W6K A;  1PRT B;  3LX0 A;  4CKE A;  2PPB C;  1QWY A;  3JAM L;  4A3I B;  3S9W A;  4DFA A;  2N88 A;  5K5P A;  5AFW A;  1SE4 A;  2I46 A;  3QG1 A;  5EKI A;  3TP7 A;  3MC0 B;  1SSO A;  2K6A A;  1G2T A;  3TZD A;  2R6G A;  1IKM A;  3HKZ B;  2F0E A;  3D6W A;  4PV1 C;  5JEA J;  1CZG A;  3K59 A;  2G9D A;  3BDC A;  4HED A;  3TP8 A;  2WII B;  2JSO A;  5T1G A;  4DAV A;  3KBX A;  4DAP A;  3AB9 A;  5I4D A;  1WTV A;  4CKB A;  4BBS B;  5ELF A;  3FDT A;  3T4A C;  1I4P A;  3FKI B;  4FO2 A;  1BUV T;  1LAB A;  3MXU A;  5I2X A;  1MBY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...