2VB2X

Crystal structure of cu(i)cusf
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
75
structure length
75
Chain Sequence
PQVISATGVVKGIDLESKKITIHHDPIAAVNWPEMTMRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords CATION EFFLUX SYSTEM PROTEIN CUSF
publication title Cu(I) Recognition Via Cation-Pi and Methionine Interactions in Cusf.
pubmed doi rcsb
source organism Escherichia coli
total genus 14
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2007-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF11604 CusF_Ec Copper binding periplasmic protein CusF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.320 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2vb2X01
2QCPX 2VB2X 3E6ZX 1ZEQX 2L55A 3TDQA 2VB3X
chains in the Genus database with same CATH superfamily
2LXKA 2BH8A 2BE5C 4YHHL 1Y1WB 3JAML 1X3FA 4RH6A 1JE5A 1TWCB 4A93H 1QCBD 2LMCB 2K32A 2JA8H 1S5ED 5E1FA 4A93G 5CV7A 3IAYA 1PH5A 1BCPF 2JA8G 5IT9E 2ZM6Q 4DPGA 2QKIC 1EYCA 2JA7H 2P5ZX 3NTHA 2KCCA 1IBKQ 1GUOA 4DV4Q 2JA7G 2AUJD 4HN7A 2YTYA 1RTNA 2QDBA 2RKSA 2EYPA 4CKCA 4YWKA 4J6HA 4APVA 1ILPA 4K5VA 2A68C 2ZM6L 2RBMA 4YY3Q 3J80E 4IPGA 1JWUD 3K6OA 1IBKL 2A5HA 4DV4L 2DJFC 3CRLC 3CCUA 1B70B 3BZKA 3I4NB 1CA5A 2ICEC 5L37A 3IFDA 2EJGC 2VW9A 1TY2A 3A7LA 4YY3L 1YVCA 3L9AX 2E2HB 2FJ2A 1QJOA 2A6HD 2RQXA 4O1NA 2AUKA 3A55A 4JBJA 1O7ZA 4LF8Q 2JJQA 3Q8DA 4N8X1 1B8AA 3CHBD 4I7AA 1DZ1A 1G2SA 3HOYB 5E3FA 1QVCA 1BDOA 3LWEA 3J81E 4XDXA 1VF7A 1W6KA 3J81j 4HJ8A 4XYQA 4ZCKA 2DNCA 3PGZA 3E6ZX 5CV5A 1H95A 2PMZE 4A3JB 3I4MB 1YJNA 1UAPA 4KK7A 2A6ED 3A74A 4V190 2VUMH 4ALPA 1OXVA 1CTMA 4A3BH 2D0OA 4KY5A 2VUMG 3HOUH 3M4OB 4KJOA 3KLSA 2PPBC 3M3YH 1STGA 3HKZB 1OTCA 4A3BG 1NTGA 4AYBB 2Z4IA 3HOUG 3I4OA 4C3HB 3L2PA 3A8KE 4DR2Q 2YU9H 1UE5A 2F03A 3D6WA 2UU9L 1CZGA 3WWVA 5IODA 4ME5A 3JC66 5ELOA 5M3FH 1I4HA 4OIJA 1LV9A 1AE2A 1R9TH 3MXNB 2D0PA 2I5MX 3CQZB 1DONA 5M3FG 2IW3A 1VQLA 2L1BA 3TN2A 2AQ1B 4DR2L 1GUGA 1MBYA 2D2CC 3T13A 3PIOA 3LX0A 3S17B 2OQ0A 1A3UA 1VQJA 4IALA 3BDCA 3VYSA 1K83H 1Y8NB 4FO2A 1Z47A 4XT3B 3K0YA 5I9OA 1QNKA 4F7XA 2QW7A 3X3MA 3CC2A 3P20A 2ASBA 2DGYA 3PV0A 2OCEA 1L1OA 2RDGA 4ZUIA 2JQOA 4DV5Q 1UE6A 2MNAA 4JI7Q 2Q8IB 1IL2A 2RCFA 1C4QA 3CMAA 4ME3A 5AFWA 2RHSB 3CPWA 1TWFH 2AWNA 4XIGS 4F88A 4IFDI 2CHBD 1D7QA 4DV5L 4JYAQ 3RLNA 3CCSA 4JI7L 5KYLA 2OQKA 2ENBA 3E9IA 1ESRA 2WKDA 5LMUQ 2R7DA 3MXPA 4O42A 2E8GA 1YNXA 2K7VA 1ZYRD 4JYAL 2R93H 1JWMD 3Q24A 1PH7A 1FGUA 1M4VA 2JA6H 2L4NA 3HOXB 4A3EB 2F3VA 2R93G 1WTWA 2PQAB 2JA6G 1E2ZA 5LMUL 3AU7A 1VDZA 4C3IH 4NPSA 4PG3A 1B9MA 1HA6A 4XT1B 3UE0A 1EFID 4ZK9B 3SVMA 4IUVA 2FMMA 4C3IG 3ITPA 1J8IA 2EVBA 3DMUA 2QA4A 4A3KB 2RCNA 3AB9A 2AWOA 1HNXQ 2IL8A 3F2UA 1KDBA 1PRTC 2K01A 1FGBD 5E7NA 3PCOB 3T56B 3RLFA 5D3IB 3PF4A 4K5XA 2WINB 4QL5A 2NWGA 2JA8B 4TSSA 4ABNA 2EY1A 1L2FA 2RHQB 5EPKA 1HNXL 2RSNA 1X3QA 1N36Q 1UE7A 3ER0A 3NHHA 4UY8C 1ENFA 1RL2A 1E3PA 5IE8A 2PQEA 3SE0A 1SNPA 2GVAA 4RGMA 3PMFA 5FO7B 1LT5D 4CKBA 1A2UA 3HOWH 1RJTA 4A3GH 4O0AA 4MNOA 2UUCQ 3HOWG 1N36L 1HCZA 3E9HA 4B9XA 4HIOA 4A3GG 2F1MA 5IGEA 1B1ZA 1U0LA 3C1EA 4JK1C 2CFMA 1JCKB 4RWSC 1JJCB 4DR1Q 2R92H 1XPOA 2UUCL 1GO3E 2JYOA 1KRTA 2R92G 5KNCA 2B2WC 4R4QA 2WAQB 1MKHA 1VS0A 4LFAQ 3CKIB 4DR1L 1KLGD 5FLXL 1HR0Q 4N8FA 2Z6KA 1KXLA 3K58A 1MJCA 5M5WH 1HUNA 1CM9A 2RDHA 1EEFD 4ID6A 3M7GA 2AQ2B 3FEWX 3NBHB 1TQOA 2IX1A 1LUZA 1VQPA 1EWHA 2IWHA 4OX9Q 5CYUA 1TWGH 5JOBA 4LFAL 1HFNA 1BBUA 1HR0L 1KNEA 4EQPA 2PCFB 2VUMB 4M8AA 1F2MA 3OPOA 2AHOB 1ENCA 3Q0AA 1MI2A 1EY4A 1MSGA 3HOUB 1EQVA 3M3YB 4OX9L 2Q8RE 3VYTA 1SN8A 4M1UB 1SXTA 3Q22A 2IJ0A 3FPUB 4IPDA 1IYVA 3J7A5 4L5RC 2JK8A 4PV1C 1AP0A 2MUYA 3U4ZA 2B2TA 1A3TA 1S4ZA 4DR3Q 2NVXH 1QILA 2BDOA 4Y52H 3V96A 2B63H 3FP9A 2L9HA 2JE6I 1LTRD 2JA5H 1QVGA 1UNSA 5C3EH 2VY3A 2B63G 1JOOA 3J80i 3ZYYX 2CKZB 2JA5G 2GN5A 5KNBA 1SNMA 1NCVA 5C3EG 3WDNA 4DR3L 1PH2A 3ULJA 1PFNA 5FKAC 2J0TD 1EU3A 1L1OC 3VYUA 4CDFC 1SEBD 2CQOA 5DM73 1O7IA 4FDBA 3GTOB 2FHTA 2KHSA 3SK6A 4FVMA 1A0IA 5C5LA 4FF1A 1WYDA 3S1NB 2RA4A 3DM3A 4IUPA 1LLRD 5AJ3Q 3HOVH 2YTVA 1TWFB 4B9WA 3JAMc 3J7YW 1D5MC 3J81i 3HOVG 1R4QB 2HIVA 3R3OA 2QEXA 3ICEA 4R9WA 4RHSA 4UP7A 4FXDA 1I4RA 2E5LQ 1GD7A 1SNOA 4QUCA 3NBIA 1K0RA 1QVFA 3F1ZA 5AJ3L 4IJLA 1BVSA 2X6GA 1HRJA 1HQMC 3BVMA 5J3BA 3K57A 1Q1EA 3A54A 4G57A 4O2DA 1T5XD 5GQOA 4C3JH 2E5LL 3G7LA 4B3TQ 3GQBA 1VQ9A 1EY7A 2ZTEA 4IUNA 1VQDA 3K8AA 2K50A 2LS01 4C3JG 3G6JB 5G3LF 1CKMA 4U673 1D5XC 3TEHB 1SSOA 1FYCA 2O5JC 3K7UC 1Z6HA 2F0TA 4YCVA 4B3TL 1L1OB 2FINB 4BBRH 4C2MB 3S14H 1JQYD 2E75C 4BBRG 3BYYB 3BJUA 1TWAB 2JXMB 3SHLA 1CK1A 2Z4HA 3L7ZC 2G5DA 3OWFA 1WTQA 2EDGA 4H13C 5G3LD 4EQ5A 3DLLA 3JAME 4A75A 1PTOH 1AE3A 1XPRA 3E0EA 5ELNA 4I65A 2L15A 3HOWB 3AQQA 4A3GB 4ILWA 2C5CA 3HEJA 5IP9H 2UXBQ 1S5DD 2EY2A 1QE6A 1NUCA 5IP9G 1K8AC 1ASZA 5CR3A 3J7ZC 4JV5Q 2BDNA 5C3WA 2HUGA 3ERSX 4YWMA 4Z9CB 3CC4A 1PTOD 1TS5A 1YBYA 4PZ8A 5JJZA 5FOBB 2UXBL 2UXCQ 1EU4A 4GN4B 1X9NA 3QWNA 4OXPA 2JEAI 4IPHA 4A3CH 4DGZA 4LUOA 2Q2IA 1F77A 1NMGA 3I90A 1U4RA 4JBKA 4JV5L 3G48A 1IW7C 4A3CG 2K1BA 4DN4M 4PNYA 4JC0A 4B3RQ 3BDOA 3R2TA 4DNTB 1SDFA 2UXCL 3E0JA 2N55A 3SR1A 1TY0A 3EJIA 4LF5Q 1TWHH 1TWGB 1AH9A 3OOCA 1WI5A 2YYZA 5HURA 1LT6D 4B3RL 5HGQA 4GNXA 3RNUA 4ZAIA 4YCWA 1RHPA 2PYKA 3C2PA 3S9WA 3A8IE 1PH6A 2DY7A 4LF5L 2QF7A 4PZ7A 1HH2P 1EYGA 2KECA 5ELCA 5J22A 2Z8LA 3CCMA 4QMGA 1YIJA 2B2TC 2RVLA 4B3ML 3GO5A 2EE1A 1B9NA 1NAPA 3PIPA 2K03A 3DUZA 2KA7A 4V0BA 2ALYB 2KHIA 4BY7B 5C6AA 4OL7A 3KLRA 1JJ2A 1X55A 3HGBA 2NVXB 5IP7H 4NB3A 2B63B 2XN9C 2ZTDA 1TR5A 2PMZB 5CGKA 2XWBB 2JA5B 1JJGA 2F0KA 5IP7G 1KIXA 5I6WA 5JEAJ 5C3EB 3RR5A 2XSCA 1PH9A 2UUBQ 3TP7A 3RN2A 5EPLA 2G9DA 2M2LA 4X3UA 1PYBA 5CV8A 1E22A 4P71A 3NXWA 1FNUA 1AN8A 1BKBA 2N49A 3KLSX 4X64L 1IBMQ 2UUBL 3VR6A 1VQNA 2CW0C 1SNQA 2LSSA 4JI8Q 3U50C 3GTPH 1KD1C 3KOJA 4ZUJA 1Q81C 4HJ7A 4RGOS 1IBML 2D62A 3F2BA 3M7NA 3HS0C 4HEDA 4JI8L 1K8MA 4DA2A 5CV6A 1CHQD 1LM0A 3K5NA 1BXTA 2A73B 4A3IB 2F0UA 1KTKA 2Y0SE 3K0XA 4R4OA 4C3JB 2HHHQ 4CHTB 5JJLA 3PUZA 4HR7B 2MFIA 4LF6Q 2NBFA 1XMOQ 3UDXA 2K6AA 2YTXA 4GOPB 4QQBX 1EY9A 1AZQA 1Y1VH 1X6OA 3PIO3 3VYRA 2R7ZH 1OXTA 5C4XH 3J81c 2HHHL 1Y1VG 2R7ZG 4ZKCB 4YCUA 3NBHA 4LF6L 3S14B 5C4XG 4H44C 1XMOL 1GVPA 3EQLC 1YZ6A 1YNJC 3D31A 1DCZA 3S1QH 4P74A 1K3BC 2IPKD 1KABA 1S40A 2F0MA 3BVGA 1EIHA 3D4DA 1T9HA 2J4XA 4G7ZC 3H3VC 1BR9A 1EY8A 1Q86C 2K75A 1PTOB 1X3PA 3NEMA 3GTJH 3BZCA 4OHJA 2MQHA 1Y69U 1WFQA 3PO2B 4B3SQ 1YHBA 5H1SE 1KAWA 4GN3B 1PHJA 2MGSA 1HPCA 1LO5D 3P75A 4KKSA 1BCPD 2BOSA 2IX0A 2WB1G 4DV0Q 1R4PB 1RF2D 4RGNA 5M5YH 2O5IC 3NPPA 4NW2A 5LMNQ 5T1GA 3V05A 3UDFA 1S3OA 3NWTA 4B3SL 2HCIA 4DKAC 1UEAB 4R4CA 2B3GA 4DUYQ 4CJ2C 5JPNC 3FMCA 2PW5A 2E2IH 4DV0L 5K36H 1C0AA 2F0WA 4N9PA 4P72A 5EKIA 1UEBA 3WOEA 5LMNL 4RGTA 4TQUS 5K36G 1SRUA 5K5PA 1YNNC 4KJNA 1OXSC 3SK5A 4IOCA 5C4ZA 3S2DH 4P75A 4A76A 1Q8IA 1XWEA 1Q7YC 2VQEQ 2NVYH 4DUYL 2BA1A 4QCLA 3AFQA 4UDUC 3FKIB 1UUPA 4X62Q 1TKWB 4IQZA 1QG7A 5JEAH 3TDQA 2EYFA 2VXWA 1D1IA 2SDFA 4DR6Q 1VQCA 5JEAG 4DK0A 2VQEL 2UU9Q 3NUCA 1V1QA 1DM0B 1G6ZA 1E2WA 3S2HH 2B2UC 4LMQD 4X62L 1I6HH 5FLXE 5A2QL 4KY7A 3QR8A 3CCQA 2G9HD 4KD3A 1ZEQX 5FLMH 5D14A 1EIYB 4DR6L 1Z7TA 4TKOB 1GUWA 2JSOA 5FLMG 3PUYA 4J8QA 1MGSA 2UUAQ 5JVH3 4ZYSA 1NY4A 1N32Q 3TZUA 2N88A 3FPPA 2YV5A 3MFGA 5GAGC 1NJIC 3A56A 3JAMi 1AFPA 3I8ZA 3ERQA 5ELEA 3IL8A 3CP0A 1DOLA 2UUAL 2RDFA 3BU2A 3GTKB 4H7BA 3GV6A 1N32L 2N8NA 5CORA 3RZDB 3K5MA 1IZ6A 1KDCA 2FFKB 1SMYD 3MFYA 2H1EA 2KEDA 1SJHD 1KC8C 1CQFA 1E7ZA 1RODA 1WCMH 1BBWA 1EQTA 1MD2D 5J1ZA 4OONA 1P16A 4K14A 2AQ3B 1WCMG 1ONLA 3I7FA 5BN3A 4IJHA 1X32A 2NVTH 2IHFA 1SNDA 2A6HC 2NYZD 1W6JA 2A8VA 4A4IA 2VB2X 4GNXB 3EVQA 1A2TA 1Q1BA 2KHJA 2C9OA 4QB4A 1K9MC 5ELBA 2XRQD 1I3QH 2F4VQ 1LYLA 2A69D 2H5XA 4KKTA 4H0LC 1Y8OB 4DR5Q 2XIWA 1SR3A 2R7FA 3HFZB 4QUFA 4YIJA 2EIFA 5FJ8H 1NR2A 1EIFA 1PZID 2QDLA 2OF1A 5KEEA 3HP3A 2A6EC 1FL0A 5FJ8G 5IY0A 1IKMA 1AZPA 2F4VL 5ELFA 5C5MA 1UWVA 4DR5L 2KCNA 1SFOH 1U4MA 1F9RA 2PW7A 2LKVA 1J5EQ 3GTMH 2MJ8A 2K5VA 4YWLA 1KHIA 4A93B 3G71A 4HTHA 1SYBA 1GKHA 1F2YA 1STEA 4QJFA 1GHKA 1X3GA 4RG1A 1P8LA 1E0BA 3HZXA 5JVG3 2Q2UA 1BCPB 4TVAB 1KNAA 2XWJB 1J5EL 1IYUA 2JA7B 4CKEA 5IGDA 1GUNA 2EQSA 5DLQE 3GTQH 1MIUA 1TS2A 1BF4A 1L0WA 3DWPA 3CD6A 2Y0SG 5IIFA 1V1PA 4DAPA 3STBD 2F0FA 1E1TA 4L6TB 1S5FD 3D0FA 1STBA 2KQ3A 1Q3LA 2PZTA 4L63B 4X65Q 2QGQA 5T1IA 3CXCA 1NNXA 2K33A 1SYEA 1LTGD 2DY8A 5LL6S 3DHQA 5E4WC 4DV3Q 1I50H 4K8IA 2F3IA 1C8CA 1GJXA 3EFXD 2E2IB 4X65L 2F0NA 1DOKA 5I2XA 3SDZA 2BCOA 2EYMA 5EJWA 4DAVA 4EGVA 5M3MH 1G51A 2ES2A 3ZJYC 4DV3L 3MVVA 1ZYRC 5M3MG 4AYBE 3O13A 4Q0FA 5C44H 1I4XA 5A35A 3CU7A 3QOJA 2K52A 5C44G 4DNRB 5C4JH 1IKLA 1LTBD 1TT2A 1GUSA 1JWSD 2B2VA 1JB3A 3I72A 3RUZA 4A3BB 5KNDA 2H4OA 2M9VA 2R6GA 3S2HB 1TU2B 1EY6A 4K2LA 4PZ6A 2D9UA 4OWXB 5FO9B 1DJRD 2B2YA 1U5KA 1D8LA 4ZLTF 5KIXA 2EOTA 2YU9B 3MXGA 4ZRZA 2WIIB 2R3ZA 4BA1I 2K5NA 4X3SA 1C48A 5M3FB 4JVZA 1R9TB 3F8TA 3IKJA 4FNFA 3D4RA 4MTKA 1VQIA 5IGCA 1PXUA 4HMIA 1DOMA 3K7AH 3H09A 3GTLH 4HJ5A 3TREA 1PYSB 3S15H 5HY6A 4X66Q 4GOPA 3BDLA 1W2BA 1K83B 5TSSA 3TQYA 1B3QA 1WTPA 4GZYC 1BNZA 2E2JH 3VDYA 3R2IA 1FR3A 4DXGA 1ILQA 5C0XI 2F0VA 3HG9A 4RCOA 2AMCB 4S3SA 1VQOA 1KDAA 1RD9D 4JI0Q 2NN6I 2OWOA 4BS9A 2F0IA 4X66L 1VQ5A 4BA2I 3CW2C 4LJZC 1CSQA 4JG2A 2EY5A 4L8JA 1EWIA 1N33Q 2N3SA 2NVTB 4KI0A 1VMCA 1CT1D 3CCEA 1XNRQ 4JI0L 1T5EA 4QIWE 5I2YA 3QG1A 2A74C 3D3RA 4JBMA 3OMGA 3RLOA 2RSOA 3VR2A 2EPBA 1N33L 1I3QB 2B8FA 3SGIA 2Z1CA 3V2TA 1LTTD 1XNRL 5DAUA 2F0QA 4K5WA 3T16A 4A3MH 2R93B 1VMPA 1H9KA 1K28A 2WKCA 2JA6B 2PO4A 4A3MG 2K05A 1SE4A 3W5OA 3T1HQ 1FVIA 2MPMA 4IOAA 3PIP3 4L5TA 4C3IB 3CCJA 1GHJA 2WB1E 1JORA 3ULLA 1PH1A 5KRUA 1SLJA 1VQMA 1O80A 3GTMB 3PQIA 3TS2A 2JEBI 2F0LA 4IUUA 3T1HL 2KOLA 3R8BA 4EX5A 3S1MH 3U4VA 1CA6A 3KLWA 1U4PA 1Q8KA 4JOIA 3CMEA 5LL6X 2CCZA 1KL9A 1C9OA 4IN3A 4QY7A 4GLVB 1HZCA 1KRSA 2NTTA 4IUTA 2I5HA 3R93A 4C1NI 4A3LG 2XNAC 3K5OA 2A1AA 4NDXA 4OO1H 2K04A 2I0QA 2SNSA 2ATWA 3ONAB 1CSPA 2WAQE 4OO1G 3GP7A 3HOZH 3RD4A 2VNUD 3HOZG 4KHPQ 2KVMA 5EBDA 4RA8A 2R92B 2OXPA 1LTLA 5JJKA 1TIID 4DNIA 2KBNA 1I50B 4JI2Q 3VR5A 3TP5A 1SYCA 3HKSA 3H15A 2SNMA 5EKLA 2Z6KC 4LF9Q 4KHPL 2SOBA 3P1HA 4AQYQ 1RKNA 5CV9A 5M5WB 4K8JA 5IYBH 1EQQA 4JI2L 1E1OA 2MO1A 3KFUA 3SEBA 3I73A 5IYBG 4LF9L 1BQQT 1IXRA 4AQYL 1VQ7A 3HOYH 2HCCA 5C4JB 3FRPB 3NQIA 4FXGC 4B3MQ 3HOYG 1Q12A 2Z0SA 4OGQC 1OO9B 2K5HA 4DK3C 4FF2A 4L5QA 2VS1A 2HIXA 1N34Q 3E5SA 2B2YC 4X6AH 2KJXA 3H6MA 1CHPD 1YHQA 1VQAA 1V1PB 1RCVD 2FXQA 1RDPD 4NKLA 2N78A 1XTCD 4XQQA 2F4IA 1N9WA 1QB5D 4XQJA 1FJGQ 3I4MG 4OIKA 5LHY1 2BE5D 3MZ5A 3M4OH 1N34L 3H3VH 3W3AA 1PVOA 1NSNS 4XXEA 2X6LA 5C0XJ 3M4YA 2I5LX 1YI2A 1Q82C 1CQVA 1FJGL 4AYBG 1FD7D 2K14A 4GOPC 1F9QA 4JPBW 1SROA 1ICWA 3S15B 3RZOH 1BBXC 5A2QE 4X64Q 4HJAA 1G91A 2IHEA 4KHZA 3CQZH 4KN4C 2WP8J 1W3SA 4RHRA 1I4PA 5GAEC 3I3CA 1EQRA 2CH4W 1VQGA 4A3DH 4N9TA 3S17H 3VA7A 1JR0D 3P7JA 4A3DG 4CDEC 2A68D 2KEEA 2XTIA 3UE1A 2VZAA 1XTDA 5IGGA 1HTPA 3QJYA 1PTOC 2EYJA 4KKUA 3G4SA 3HOVB 1IL8A 3EBEA 1ZXTA 4K0KQ 3GDEA 4XQNA 1S5CD 4R4IA 2R61A 2UXDQ 4K6LA 1EY0A 5EGTA 1TS3A 4HSVA 4K0KL 1D2BA 2JA9A 4LUZA 1PLFA 2EYOA 1QUQB 1K73C 1QZGA 4KY6A 3EIVA 3MWYW 5E4XA 1ICFB 2UXDL 1U4LA 1CKOA 2HT1A 1EEID 1PH8A 5IYCH 2DNEA 1WTRA 4BY1H 2LY7A 1VQKA 5IYCG 3HOXH 3BS1A 4A3EH 4BY1G 4G4KA 4GN5A 1TXYA 4BBRB 3HOXG 4A3EG 4H02A 4CDDC 2TMPA 4JOIC 2IT1A 5IYDH 3I56A 1HHVA 5CBEE 4A3KH 5IYDG 2XVSA 2ZT9C 1XXGA 2Q2TA 1KAAA 4FF3A 4A3KG 3MEFA 3LGJA 5EAYA 3J7AV 1SMXA 4BBSH 3KBGA 1XNQQ 4BBSG 5C3XA 5FLXc 3CPFA 2E2DC 5CV4A 1OXUA 1WD0A 2VL6A 1K8GA 2WV6D 4IUQA 4DAMA 3PSIA 3HOZB 1VQBA 4LF4Q 1XNQL 4DK1A 2VQFQ 3M9BA 2QEJC 1EZ6A 3KF6A 1FNVA 2QCPX 1STAA 2EJFC 4BXXH 2L5TA 4KD4A 1HFGA 1MHWC 2K28A 4QF4A 2EY6A 4LF4L 4BXXG 1A63A 3I2ZA 5FO8B 3NWSA 2VQFL 1G6PA 1JB7A 4HIKA 1STNA 5C0XH 1V43A 2NN6H 4I7ZC 5C0XG 3C1FA 3PO3H 3KF8A 4HSPA 3B6YA 2NN6G 5JPMC 1TWHB 1LTAD 2V4DA 3K59A 2B2WA 3NTKA 3PO3G 2KUMA 1B7YB 2WAQG 5IWAQ 3MHBA 3TZDA 4GNXC 1EL0A 1L0YB 1SE8A 4EQOA 2F0DA 4WRDA 4PMBA 1PRTF 1F9PA 1F9SA 1WJJA 2QILA 2SEBD 3GTGH 4LF8L 4OO1I 3CCVA 1F2ZA 1C7YA 1HZAA 1SAPA 3UDGA 2CH4A 1Q46A 1OXXK 5IWAL 3QOLA 1DGSA 4KV6A 4HMJA 1HZBA 4BWGB 1PFMA 2MO0A 3H0GH 4C56C 1ML0D 1YHAA 2L12A 4KHVA 2OTJA 1TS4A 3IRBA 2KENA 3A0JA 1D1KA 1EYAA 2I07B 3H0GG 4KLKA 3LWUA 3C46A 1PRTD 1B44D 4GKJQ 5JAVA 1NBWA 1HR0W 3MXUA 3RZOB 2F0JA 3WOFA 3W2DA 1G2TA 1STYA 3KYHC 1EIGA 2GA4B 1HQRD 1BCPC 4MZ9A 4DK6C 2PNHA 5EQ0A 2CWPA 3OW7A 4J1MA 1Q90A 3CRKC 1PH3A 4GKKQ 4WFN3 4A3DB 4GKJL 4DV6Q 1CUKA 1EYDA 1I6VC 3EA6A 4HJ9A 1EFWA 1XPUA 2PNRC 2NUCA 1WD1A 2JP1A 3OIQA 4PQXA 1AEXA 4HCSA 1EWCA 3SK4A 4GKKL 3GTPB 1YJWA 4DV6L 1GUTA 3IFTA 3S24A 4JI1Q 3GTOH 2MP1A 4PMWA 1M8AA 3UI2A 4GS3A 1HTLD 2KCTA 2NTSA 3S1NH 1HZ9A 2F0EA 3H3VI 5COYA 3K80C 1DD2A 3I70A 4JI1L 1XJVA 1O78A 3VR3A 4CDCC 4X3TA 5NUCA 3OTOQ 2B8GA 4EQNA 2F3WA 4JI4Q 3NENA 4ZKBB 2ZXRA 5IT9L 1Y1VB 2HQLA 1JOQA 2R7ZB 4BY1B 4XYOA 1LTSD 5C4XB 1B3AA 2DN8A 3BVZA 1CFMA 4QIWB 1ASYA 1PV4A 1LACA 1IYJB 1STHA 2NZHA 1V1OA 2Q2HA 3OTOL 4DV7Q 3GV3A 3Q23A 3ND9A 1RTOA 3I91A 4JI4L 1BOSA 4AH6A 1B4OA 4B08A 4Q5VA 4FYDA 2F0HA 3CC7A 1X3EA 5ELDA 1KLUD 1M90C 2E76C 5IGFA 3S1QB 4WJ3M 3D8GA 1HUMA 3J80L 4Y7NH 4IURA 4DV7L 4C2MH 5GROA 1MSHA 3F2CA 4HAEA 4UHVA 1S72A 4BBSB 2EJMA 3NQTA 1BUVT 1SYDA 5ISRA 3GTJB 1TWAH 2XRSD 1SMYC 5KYIA 2WB1B 5DEHA 3T51B 3TMEA 2OT2A 3U9OA 1A8VA 1N8RC 2ZJQA 1V8QA 3NP8A 2C35B 5M5YB 1PYWD 4CJ0B 1H9SA 1PDQA 4X3KA 1ET9A 4UAIA 3N6RA 4JI5Q 2B39A 1PA6A 1JT8A 1A15A 1PH4A 3FDTA 3KDFA 3G6EA 4RAUC 3J81L 3NTIA 4LNQA 4L5SA 5BN5A 4R8IA 3EROA 5EKKA 3U58A 3S16H 2EXZA 3D4WA 4LW1A 3S1RH 2CWAA 4JI6Q 4JI5L 4ZQ3A 3S2DB 1CKNA 1GM5A 2A69C 2NVYB 2L55A 3HKZE 4DAYA 4A3FH 2Z9HA 3RN5A 1YJ9A 1K0SA 2I46A 4K2KA 4A3FG 4R1JA 4JW0A 5GADC 1JOKA 3PO3B 4POGA 4FF4A 1O7YA 4JI6L 1CI3M 1JC7A 3TBIB 4HIDA 1I5FA 4E6IA 4POFA 1Z9FA 3CF5A 1KQSA 1VQHA 2ZJRA 3PUVA 1E2VA 3AFPA 1PRTB 2PI2E 4DUZQ 3OMCA 3NSWA 3GTGB 4OELB 4LAAA 2F0OA 2EXDA 1I6HB 1H9RA 3FVQA 1SE3A 4UP8A 3EN2A 1J6QA 3TSSA 3T53B 1TVXA 1GOZA 1FNWA 1G291 3K5LA 4RKLA 1SNCA 2CQAA 4K6DA 1WOCA 3KK7A 4MN3A 3H0GB 1QUQA 4DUZL 3AYHB 1QNUA 1X56A 2JN4A 2PZUA 3NE5B 2HDLA 3E3XA 1HNZQ 2L11A 3KF6B 1PFBA 5IOCA 1ESFA 1I4GA 3SK8A 5JJIA 3LNNA 3KJOA 1XMQQ 3MC0B 1Y14B 3D6CA 1EUJA 4OEMB 4CJ1B 5EPJA 1O7LA 5DM63 3STBC 1RIPA 2Z6BA 1HNZL 4BY7H 2NVQH 1JICA 2V1CC 1WCMB 4ODGA 4GLAC 1XMQL 3FHWA 4BY7G 2A19A 3HRZC 1NMFA 1E24A 4DU9A 1ENAA 4NMZA 3KF8B 3AMUA 4JCVE 3BZDB 2EYHA 5CMDA 4LF7Q 1SBBB 1X54A 2ID0A 5M5XH 2ZJPA 1LT4D 3MTSA 3M85A 1NE3A 2DJGC 2NB0A 3SXHA 3TRZA 3DEOA 4IFDJ 1ET6A 3N52A 4LWCA 5GAHC 3C3LA 3GD7A 2K5QA 3TP8A 3T1YQ 4MIUA 1PFSA 3PUXA 3U9SA 4LF7L 2HD3A 2TSSA 3I4LA 4FP5D 3BYTB 4JBWA 4LK1C 3OYYA 1MJEA 2XGTA 3M4QA 1UE1A 4MTNA 4KTAA 1V9PA 3AEVA 3T1YL 4RMFA 2E74C 3F2DA 4G7OC 1A3VA 1Y8PB 4ULLA 3DWAA 4DXFA 4IZ8A 1IW7D 2F0GA 1SJED 2O2LD 5CC4A 3X3NA 1H9MA 3A8JE 2RF4A 1SFOB 1B2TA 3DM1A 1PZJD 3MEHA 1D6EC 3QIAA 4LFCQ 4A3IH 1VCIA 1K3RA 3A5UA 1CZWA 1L0XB 3A5ZB 4CGYB 1GXDC 4RCNA 4A3IG 4DV1Q 4NXMQ 1Y1WH 1AW7A 4AIMA 3CCLA 2EYLA 1Y1WG 2D5DA 5C4HA 3DWQA 3T4AC 2O4XA 2GVBA 5I6YA 4LFCL 3K81C 2OTLA 1K8OA 4PMCA 1TWCH 1VQFA 4UPAA 4A3LH 4WORA 4Y7NB 4GLXA 1WTOA 3GTQB 3QB3A 1YITA 3KJPA 4DV1L 1DYQA 4NXML 2Y0SB 1SE2A 2B29A 3W1GA 1WTVA 5BN4A 4WJ4A 4CBVA 4HCEA 3UDIA 4P73A 1XX8A 2HDMA 4R8NA 4R4TA 3NELA 1A6XA 3L3OC 1A62A 5D3DA 4P2CB 1JMCA 3TP6A 1PZKD 1PTOF 2BH2A 1HNWQ 3OW2A 3PO2H 3DXJC 3KBXA 4DV2Q 2NZOA 3PO2G 1EY5A 1X65A 4F87A 1HXYD 3S16B 4RFBA 4TRDA 3I4NH 1WTXA 3MXNA 2K5DA 1PMRA 3ULPA 1YEZA 1ZKOA 3S1RB 3VR4A 1XYIA 1LTID 4DR4Q 3OIPA 1QZHA 1EOTA 3I4NG 1HNWL 2K4KA 2MHVA 2WACA 2PI2A 5M3MB 2E2HH 3URYA 5F2DA 2L0CA 4WJWA 3OWEB 4J15A 4DV2L 4C1NK 4A3FB 2CW0D 4FXKC 5C44B 2F52A 3L0OA 2LFNA 4OWWB 1LT3D 3ND8A 5HGTA 3CCRA 4DR4L 5IGBA 4LFBQ 2B2VC 2DUDA 3KUPA 3PF5A 1HJPA 1I94Q 4DR7Q 2FMCA 5I9PA 1JE4A 4QGUA 4MHEA 1HA5A 1U9RA 1WVLA 5DNFA 3PUWA 1M1KC 1QWYA 3FKIH 4A3JH 3I4MH 2J7ZA 4IO9A 4U68A 4LFBL 1I94L 3FKIG 3DEPA 4A3JG 4DR7L 1QOHA 1J9OA 1EZ8A 2HQEA 5LMNW 3OHXC 1BO0A 1H9SB 3RMHA 4LUVA 4JI3Q 2ICIA 1VF5C 4IFDH 3I55A 3QO2A 2B2UA 4C3HH 3HKZG 3KDFB 3K7AB 5EBCA 4IFDG 1IHZA 4XTCS 3GTLB 5BR8Q 3Q6SA 4C3HG 1VQ8A 3MA2B 5J39A 4DF7A 2F0PA 5D65A 4JI3L 1YNJD 2E2JB 1D5ZC 5M9OA 2NVQB 1CKNB 2PQAA 1DXMA 4DAYB 5BR8L 2OEOA 2X69A 2VB3X 3W1BA 4IPCA 3BG3A 3GTKH 3M4PA 4UP9A 5FK9C 1H9JA 2IX3A 3J7AF 3RZDH 3TS0A 2LXJA 5I4DA 4RKBA 2K5WA 1LABA 5M5XB 2AKWB 3OSOA 3H94A 2Q8TA 4KMUC 1B53A 2CVRA 1NR4A 2KCMA 5IT9c 1I4QA 1EOVA 2ZTCA 1VQEA 4NP5A 2EZVA 4KN7C 1G8ZD 2WFWA 1VQ4A 1SYGA 1IBLQ 4A3MB 1S5BD 2F0SA 4EVOA 2IY5B 2NZ1D 4NXNQ 2ZXPA 1VQ6A 1YNND 3A7AB 3NK9A 3J80c 2BA0A 3H91A 4F8MA 4HIMA 1F2LA 4YHHQ 1B50A 1WTHA 2PZWA 2ZXOA 5CBAE 3MAQA 1IBLL 4NXNL 4OWTB 2M00A 3CAMA 5KGUA 4G7HC 4DFAA 1SYFA 3VA5A 3S1MB 1II3A
chains in the Genus database with same CATH topology
2BE5C 1Y1WB 3JAML 4RH6A 1TWCB 1QCBD 2LMCB 2K32A 1S5ED 5E1FA 5CV7A 3IAYA 1BCPF 5IT9E 2QKIC 1EYCA 3NTHA 2KCCA 1GUOA 2AUJD 4HN7A 1RTNA 2QDBA 2RKSA 2EYPA 4CKCA 4J6HA 1ILPA 4K5VA 2A68C 2RBMA 3J80E 1JWUD 3K6OA 2A5HA 3CRLC 3I4NB 1CA5A 2ICEC 3IFDA 2EJGC 1TY2A 3A7LA 3L9AX 2E2HB 2FJ2A 1QJOA 2A6HD 2RQXA 4O1NA 2AUKA 3A55A 1O7ZA 3CHBD 1DZ1A 1G2SA 3HOYB 5E3FA 1BDOA 3LWEA 3J81E 4XDXA 1VF7A 1W6KA 4XYQA 2DNCA 3E6ZX 5CV5A 4A3JB 3I4MB 1UAPA 4KK7A 2A6ED 4V190 1OXVA 1CTMA 4KY5A 3M4OB 4KJOA 3KLSA 2PPBC 1STGA 3HKZB 4AYBB 2Z4IA 4C3HB 3A8KE 2F03A 3D6WA 1CZGA 5IODA 4ME5A 1I4HA 4OIJA 1LV9A 3CQZB 1DONA 2IW3A 2L1BA 3TN2A 2AQ1B 1GUGA 1MBYA 2D2CC 3T13A 3LX0A 3S17B 1A3UA 4IALA 3BDCA 3VYSA 4XT3B 1Y8NB 4FO2A 1Z47A 5I9OA 3K0YA 1QNKA 4F7XA 3X3MA 3P20A 3PV0A 2RDGA 4ZUIA 2Q8IB 1C4QA 5AFWA 2AWNA 4XIGS 4F88A 4IFDI 2CHBD 5KYLA 2ENBA 1ESRA 2WKDA 4O42A 3MXPA 2K7VA 1ZYRD 1JWMD 3Q24A 1M4VA 2L4NA 3HOXB 4A3EB 2F3VA 1WTWA 1E2ZA 3AU7A 1VDZA 1B9MA 1HA6A 4XT1B 1EFID 4ZK9B 3SVMA 4IUVA 4C3IG 2FMMA 3ITPA 1J8IA 2EVBA 3DMUA 4A3KB 3AB9A 2AWOA 2IL8A 3F2UA 1KDBA 1PRTC 2K01A 1FGBD 3T56B 3RLFA 5D3IB 4K5XA 2WINB 2NWGA 2JA8B 4TSSA 4ABNA 2EY1A 5EPKA 2RSNA 1X3QA 3NHHA 1ENFA 3SE0A 2PQEA 1SNPA 4RGMA 3PMFA 5FO7B 1LT5D 4CKBA 1A2UA 1RJTA 1HCZA 4B9XA 2F1MA 5IGEA 1B1ZA 3C1EA 4JK1C 1JCKB 4RWSC 2JYOA 5KNCA 2B2WC 2WAQB 3CKIB 1KLGD 5FLXL 3K58A 1HUNA 1CM9A 2RDHA 1EEFD 4ID6A 3M7GA 2AQ2B 3FEWX 1TQOA 2IX1A 1EWHA 2IWHA 5CYUA 5JOBA 1HFNA 1KNEA 4EQPA 2PCFB 2VUMB 4M8AA 1F2MA 3OPOA 3Q0AA 1ENCA 1MI2A 1EY4A 1MSGA 3HOUB 1EQVA 3M3YB 2Q8RE 3VYTA 4M1UB 1SXTA 3Q22A 2IJ0A 3FPUB 1IYVA 4PV1C 1AP0A 2MUYA 2B2TA 1A3TA 1S4ZA 1QILA 2BDOA 3V96A 2L9HA 2JE6I 1LTRD 1UNSA 1JOOA 3ZYYX 5KNBA 1SNMA 1NCVA 3WDNA 1PFNA 5FKAC 2J0TD 1EU3A 3VYUA 1SEBD 5DM73 3GTOB 2FHTA 2KHSA 3SK6A 4FVMA 5C5LA 4FF1A 3S1NB 2RA4A 4IUPA 1LLRD 1TWFB 4B9WA 3J7YW 1D5MC 1R4QB 3R3OA 4R9WA 4RHSA 4FXDA 1I4RA 1SNOA 4QUCA 3NBIA 2X6GA 1HRJA 1HQMC 3BVMA 3K57A 1Q1EA 3A54A 4G57A 1T5XD 3G7LA 3GQBA 1EY7A 4IUNA 4C3JG 2LS01 3G6JB 5G3LF 4U673 1D5XC 1SSOA 1FYCA 2O5JC 1Z6HA 2F0TA 4C2MB 2FINB 1JQYD 2E75C 3BYYB 1TWAB 2JXMB 3SHLA 1CK1A 2Z4HA 3L7ZC 3OWFA 1WTQA 2EDGA 4H13C 5G3LD 3JAME 1PTOH 4I65A 3HOWB 4A3GB 4ILWA 2C5CA 3HEJA 1S5DD 2EY2A 1QE6A 1NUCA 5CR3A 2BDNA 5C3WA 2HUGA 4Z9CB 1PTOD 1TS5A 5JJZA 5FOBB 1EU4A 3QWNA 2JEAI 4DGZA 1F77A 3I90A 1U4RA 1IW7C 2K1BA 4DN4M 4PNYA 3BDOA 3R2TA 4DNTB 1SDFA 3E0JA 2N55A 3SR1A 1TY0A 3EJIA 1TWGB 3OOCA 2YYZA 5HURA 1LT6D 4ZAIA 1RHPA 2PYKA 3C2PA 3S9WA 3A8IE 2DY7A 2QF7A 2KECA 5ELCA 5J22A 2Z8LA 4QMGA 2B2TC 2RVLA 3GO5A 2EE1A 1B9NA 1NAPA 2K03A 3DUZA 2KA7A 4V0BA 4BY7B 5C6AA 4OL7A 3KLRA 3HGBA 2NVXB 2B63B 2XN9C 1TR5A 2PMZB 5CGKA 2XWBB 2JA5B 2F0KA 5I6WA 5JEAJ 5C3EB 2XSCA 3TP7A 5EPLA 2G9DA 2M2LA 4X3UA 5CV8A 3NXWA 1FNUA 1AN8A 3KLSX 3VR6A 2CW0C 1SNQA 4ZUJA 4RGOS 2D62A 3M7NA 3HS0C 4HEDA 4DA2A 1K8MA 5CV6A 1CHQD 3K5NA 1BXTA 2A73B 4A3IB 2F0UA 1KTKA 4C3JB 4CHTB 3PUZA 4HR7B 2NBFA 2K6AA 1EY9A 1AZQA 3PIO3 3VYRA 1OXTA 4ZKCB 3NBHA 3S14B 4H44C 3EQLC 1YNJC 3D31A 1DCZA 2IPKD 1KABA 2F0MA 3BVGA 1EIHA 3D4DA 2J4XA 4G7ZC 3H3VC 1BR9A 1EY8A 1PTOB 1X3PA 4OHJA 1Y69U 3PO2B 2MGSA 1HPCA 1LO5D 3P75A 4KKSA 1BCPD 2BOSA 2IX0A 1R4PB 1RF2D 4RGNA 2O5IC 3NPPA 4NW2A 5T1GA 3V05A 3NWTA 2HCIA 1UEAB 4CJ2C 5JPNC 3FMCA 2PW5A 5K36H 5EKIA 2F0WA 4N9PA 3WOEA 4RGTA 4TQUS 5K36G 5K5PA 1YNNC 4KJNA 1OXSC 3SK5A 5C4ZA 1Q8IA 1XWEA 2BA1A 4QCLA 4UDUC 3FKIB 1UUPA 1TKWB 4IQZA 1QG7A 5JEAH 3TDQA 2EYFA 2VXWA 1D1IA 2SDFA 5JEAG 4DK0A 3NUCA 1DM0B 1G6ZA 1E2WA 2B2UC 4LMQD 5FLXE 5A2QL 4KY7A 2G9HD 4KD3A 1ZEQX 1GUWA 5D14A 1Z7TA 4TKOB 2JSOA 3PUYA 4J8QA 1MGSA 5JVH3 4ZYSA 3TZUA 2N88A 3FPPA 3MFGA 3A56A 1AFPA 3I8ZA 3ERQA 5ELEA 3IL8A 1DOLA 2RDFA 3GTKB 4H7BA 3GV6A 3RZDB 5CORA 3K5MA 1KDCA 2FFKB 1SMYD 3MFYA 2H1EA 2KEDA 1SJHD 1CQFA 1RODA 1EQTA 1MD2D 5J1ZA 4K14A 2AQ3B 1ONLA 5BN3A 1X32A 1SNDA 2A6HC 2NYZD 1W6JA 2VB2X 3EVQA 1A2TA 1Q1BA 2C9OA 4QB4A 5ELBA 2XRQD 2A69D 4KKTA 4H0LC 1Y8OB 2XIWA 4QUFA 4YIJA 1NR2A 1PZID 2OF1A 5KEEA 3HP3A 2A6EC 1IKMA 1AZPA 5ELFA 5C5MA 2KCNA 1U4MA 1F9RA 2PW7A 2LKVA 2MJ8A 4A93B 4HTHA 1SYBA 1F2YA 1STEA 1GHKA 3HZXA 1E0BA 5JVG3 1BCPB 1KNAA 2XWJB 1IYUA 2JA7B 4CKEA 5IGDA 1GUNA 1TS2A 1BF4A 3DWPA 5IIFA 1V1PA 4DAPA 2F0FA 4L6TB 1S5FD 1STBA 2KQ3A 1Q3LA 2PZTA 4L63B 5T1IA 2K33A 1SYEA 1LTGD 2DY8A 5LL6S 3DHQA 5E4WC 4K8IA 1C8CA 1GJXA 3EFXD 2E2IB 2F0NA 1DOKA 5I2XA 3SDZA 2BCOA 2EYMA 5EJWA 4DAVA 4EGVA 3MVVA 1ZYRC 3O13A 4Q0FA 1I4XA 5A35A 3CU7A 3QOJA 4DNRB 1IKLA 1LTBD 1TT2A 1GUSA 1JWSD 2B2VA 1JB3A 3I72A 3RUZA 4A3BB 5KNDA 2H4OA 2M9VA 2R6GA 3S2HB 1TU2B 1EY6A 4K2LA 2D9UA 5FO9B 1DJRD 2B2YA 4ZLTF 5KIXA 2EOTA 2YU9B 3MXGA 4ZRZA 2WIIB 2R3ZA 4BA1I 4X3SA 1C48A 5M3FB 1R9TB 3IKJA 4FNFA 3D4RA 5IGCA 1PXUA 4HMIA 1DOMA 3H09A 3BDLA 1K83B 5TSSA 1WTPA 4GZYC 1BNZA 3R2IA 1FR3A 4DXGA 1ILQA 5C0XI 2F0VA 3HG9A 4RCOA 4S3SA 1KDAA 1RD9D 2NN6I 4BS9A 2F0IA 4BA2I 4LJZC 4L8JA 2EY5A 2NVTB 4KI0A 1VMCA 1CT1D 1T5EA 5I2YA 3QG1A 2A74C 3D3RA 3OMGA 2RSOA 3VR2A 2EPBA 1I3QB 2B8FA 2Z1CA 3V2TA 1LTTD 5DAUA 2F0QA 4K5WA 3T16A 2R93B 1VMPA 1H9KA 2WKCA 2JA6B 2PO4A 2K05A 1SE4A 2MPMA 3PIP3 4C3IB 1GHJA 1JORA 5KRUA 1O80A 3GTMB 2JEBI 2F0LA 4IUUA 2KOLA 3R8BA 1CA6A 1U4PA 5LL6X 4IN3A 2NTTA 4IUTA 3R93A 4C1NI 2XNAC 3K5OA 4NDXA 4OO1H 2K04A 2SNSA 3ONAB 4OO1G 3GP7A 3RD4A 2VNUD 2KVMA 5EBDA 4RA8A 2R92B 2OXPA 1TIID 1I50B 3VR5A 3TP5A 1SYCA 2SNMA 5EKLA 2SOBA 3P1HA 1RKNA 5CV9A 5M5WB 4K8JA 3SEBA 3I73A 1BQQT 2HCCA 5C4JB 3FRPB 3NQIA 4FXGC 1Q12A 4OGQC 1OO9B 4FF2A 3E5SA 2B2YC 2KJXA 3H6MA 1CHPD 1V1PB 1RCVD 1RDPD 4NKLA 1XTCD 4XQQA 2F4IA 1QB5D 4XQJA 4OIKA 5LHY1 2BE5D 3MZ5A 3W3AA 4XXEA 1NSNS 2X6LA 5C0XJ 3M4YA 1CQVA 1FD7D 1F9QA 1ICWA 3S15B 1BBXC 5A2QE 1G91A 4KHZA 4KN4C 2WP8J 4RHRA 1I4PA 3I3CA 4N9TA 3VA7A 1JR0D 3P7JA 2A68D 2KEEA 5IGGA 1HTPA 3QJYA 1PTOC 2EYJA 4KKUA 3HOVB 1IL8A 1ZXTA 4XQNA 1S5CD 2R61A 4K6LA 1EY0A 5EGTA 1TS3A 4HSVA 1D2BA 1PLFA 2EYOA 4KY6A 3MWYW 5E4XA 1U4LA 1EEID 2DNEA 1WTRA 2LY7A 3BS1A 4G4KA 4BBRB 2TMPA 2IT1A 1HHVA 5CBEE 2XVSA 2ZT9C 1XXGA 1KAAA 4FF3A 3J7AV 3KBGA 5C3XA 2E2DC 5CV4A 1OXUA 1WD0A 2WV6D 4IUQA 3HOZB 4DK1A 2QEJC 1EZ6A 1FNVA 2QCPX 1STAA 2EJFC 2L5TA 4KD4A 1HFGA 2K28A 4QF4A 2EY6A 5FO8B 3NWSA 1STNA 5C0XH 1V43A 2NN6H 4I7ZC 5C0XG 3C1FA 3KF8A 4HSPA 2NN6G 5JPMC 1TWHB 1LTAD 2V4DA 3K59A 2B2WA 3NTKA 2KUMA 3MHBA 3TZDA 1EL0A 1L0YB 4EQOA 4WRDA 2F0DA 4PMBA 1PRTF 1F9PA 1F9SA 2QILA 2SEBD 4OO1I 1F2ZA 1SAPA 1OXXK 3QOLA 4KV6A 4HMJA 4BWGB 1PFMA 4C56C 1ML0D 4KHVA 2L12A 1TS4A 1D1KA 1EYAA 2I07B 3LWUA 3C46A 1PRTD 1B44D 5JAVA 3MXUA 3RZOB 2F0JA 3WOFA 3W2DA 1G2TA 1STYA 1EIGA 2GA4B 1HQRD 1BCPC 5EQ0A 3OW7A 4J1MA 1Q90A 3CRKC 4WFN3 4A3DB 1EYDA 1I6VC 3EA6A 2PNRC 2NUCA 1WD1A 2JP1A 3OIQA 4PQXA 1AEXA 4HCSA 1EWCA 3SK4A 3GTPB 1GUTA 3IFTA 2MP1A 4PMWA 1M8AA 3UI2A 1HTLD 2NTSA 2F0EA 5COYA 1DD2A 3I70A 1O78A 3VR3A 4X3TA 5NUCA 2B8GA 4EQNA 2F3WA 4ZKBB 2ZXRA 5IT9L 1Y1VB 1JOQA 2R7ZB 4BY1B 4XYOA 1LTSD 5C4XB 1B3AA 2DN8A 3BVZA 1CFMA 4QIWB 1LACA 1STHA 1V1OA 3GV3A 3Q23A 3ND9A 1RTOA 3I91A 1BOSA 4B08A 1B4OA 4Q5VA 4FYDA 2F0HA 5ELDA 1KLUD 2E76C 5IGFA 3S1QB 3D8GA 1HUMA 3J80L 4IURA 1MSHA 4HAEA 4BBSB 2EJMA 3NQTA 1BUVT 1SYDA 5ISRA 3GTJB 2XRSD 1SMYC 5KYIA 2WB1B 5DEHA 3T51B 3TMEA 2OT2A 3U9OA 1V8QA 3NP8A 5M5YB 1PYWD 4CJ0B 1H9SA 1PDQA 4X3KA 1ET9A 4UAIA 3N6RA 2B39A 1A15A 3FDTA 4RAUC 3J81L 3NTIA 5BN5A 4R8IA 3EROA 5EKKA 2EXZA 3D4WA 4ZQ3A 3S2DB 2A69C 2NVYB 2L55A 4DAYA 2I46A 4K2KA 1JOKA 3PO3B 4FF4A 1O7YA 1CI3M 1JC7A 3TBIB 4E6IA 3PUVA 1E2VA 1PRTB 3OMCA 3NSWA 3GTGB 4LAAA 2F0OA 1I6HB 1H9RA 3FVQA 1SE3A 3TSSA 3T53B 1TVXA 1GOZA 1FNWA 1G291 3K5LA 4RKLA 1SNCA 2CQAA 4K6DA 3KK7A 4MN3A 3H0GB 1QNUA 2PZUA 3NE5B 2HDLA 2L11A 1PFBA 5IOCA 1ESFA 1I4GA 3SK8A 3LNNA 3MC0B 3D6CA 4CJ1B 5EPJA 1O7LA 5DM63 1JICA 1WCMB 4ODGA 3HRZC 4DU9A 1ENAA 4NMZA 3AMUA 3BZDB 2EYHA 5CMDA 1SBBB 2ID0A 1LT4D 3MTSA 3M85A 2NB0A 3SXHA 3DEOA 4IFDJ 1ET6A 3N52A 3C3LA 3GD7A 2K5QA 3TP8A 4MIUA 3PUXA 3U9SA 2TSSA 3I4LA 4FP5D 3BYTB 4JBWA 4LK1C 4KTAA 2E74C 4G7OC 1A3VA 1Y8PB 4ULLA 3DWAA 4DXFA 4IZ8A 1IW7D 2F0GA 1SJED 2O2LD 5CC4A 3X3NA 1H9MA 3A8JE 1SFOB 1B2TA 3DM1A 1PZJD 3MEHA 1D6EC 3QIAA 1VCIA 1CZWA 1L0XB 4CGYB 1GXDC 4RCNA 1AW7A 2EYLA 2D5DA 5C4HA 3DWQA 3T4AC 2O4XA 5I6YA 1K8OA 4PMCA 4WORA 4Y7NB 1WTOA 3GTQB 3QB3A 1DYQA 2Y0SB 1SE2A 1WTVA 5BN4A 4CBVA 4HCEA 1XX8A 2HDMA 4R8NA 1A6XA 3L3OC 5D3DA 4P2CB 3TP6A 1PZKD 1PTOF 3DXJC 3KBXA 1EY5A 4F87A 1HXYD 3S16B 4RFBA 4TRDA 1WTXA 3MXNA 2K5DA 1PMRA 1XYIA 1ZKOA 3S1RB 3VR4A 1LTID 3OIPA 1EOTA 2WACA 2MHVA 5M3MB 3URYA 5F2DA 2L0CA 4WJWA 3OWEB 4C1NK 4A3FB 2CW0D 4FXKC 5C44B 2LFNA 1LT3D 3ND8A 5HGTA 5IGBA 2B2VC 3KUPA 2FMCA 5I9PA 1JE4A 4MHEA 1HA5A 1U9RA 1WVLA 5DNFA 3PUWA 1QWYA 2J7ZA 4U68A 3DEPA 1QOHA 1J9OA 1EZ8A 2HQEA 3OHXC 1BO0A 1H9SB 3RMHA 2ICIA 1VF5C 4IFDH 3QO2A 2B2UA 5EBCA 3K7AB 4IFDG 1IHZA 4XTCS 3GTLB 3Q6SA 4C3HG 3MA2B 5J39A 4DF7A 2F0PA 5D65A 1YNJD 2E2JB 1D5ZC 5M9OA 2NVQB 1DXMA 2OEOA 2X69A 2VB3X 3BG3A 5FK9C 1H9JA 2IX3A 3J7AF 5I4DA 4RKBA 2K5WA 1LABA 5M5XB 3OSOA 3H94A 2Q8TA 4KMUC 1B53A 2CVRA 1NR4A 1I4QA 4NP5A 2EZVA 4KN7C 1G8ZD 1SYGA 4A3MB 1S5BD 2F0SA 4EVOA 2NZ1D 2ZXPA 1YNND 3A7AB 3NK9A 2BA0A 3H91A 4F8MA 1F2LA 1B50A 2ZXOA 2PZWA 5CBAE 3MAQA 2M00A 5KGUA 4G7HC 4DFAA 1SYFA 3VA5A 3S1MB 1II3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QCP X;  2VB2 X;  3E6Z X;  1ZEQ X;  2L55 A;  3TDQ A;  2VB3 X; 
#chains in the Genus database with same CATH topology
 2LXK A;  2BH8 A;  2BE5 C;  4YHH L;  1Y1W B;  3JAM L;  1X3F A;  4RH6 A;  1JE5 A;  1TWC B;  4A93 H;  1QCB D;  2LMC B;  2K32 A;  2JA8 H;  1S5E D;  5E1F A;  4A93 G;  5CV7 A;  3IAY A;  1PH5 A;  1BCP F;  2JA8 G;  5IT9 E;  2ZM6 Q;  4DPG A;  2QKI C;  1EYC A;  2JA7 H;  2P5Z X;  3NTH A;  2KCC A;  1IBK Q;  1GUO A;  4DV4 Q;  2JA7 G;  2AUJ D;  4HN7 A;  2YTY A;  1RTN A;  2QDB A;  2RKS A;  2EYP A;  4CKC A;  4YWK A;  4J6H A;  4APV A;  1ILP A;  4K5V A;  2A68 C;  2ZM6 L;  2RBM A;  4YY3 Q;  3J80 E;  4IPG A;  1JWU D;  3K6O A;  1IBK L;  2A5H A;  4DV4 L;  2DJF C;  3CRL C;  3CCU A;  1B70 B;  3BZK A;  3I4N B;  1CA5 A;  2ICE C;  5L37 A;  3IFD A;  2EJG C;  2VW9 A;  1TY2 A;  3A7L A;  4YY3 L;  1YVC A;  3L9A X;  2E2H B;  2FJ2 A;  1QJO A;  2A6H D;  2RQX A;  4O1N A;  2AUK A;  3A55 A;  4JBJ A;  1O7Z A;  4LF8 Q;  2JJQ A;  3Q8D A;  4N8X 1;  1B8A A;  3CHB D;  4I7A A;  1DZ1 A;  1G2S A;  3HOY B;  5E3F A;  1QVC A;  1BDO A;  3LWE A;  3J81 E;  4XDX A;  1VF7 A;  1W6K A;  3J81 j;  4HJ8 A;  4XYQ A;  4ZCK A;  2DNC A;  3PGZ A;  3E6Z X;  5CV5 A;  1H95 A;  2PMZ E;  4A3J B;  3I4M B;  1YJN A;  1UAP A;  4KK7 A;  2A6E D;  3A74 A;  4V19 0;  2VUM H;  4ALP A;  1OXV A;  1CTM A;  4A3B H;  2D0O A;  4KY5 A;  2VUM G;  3HOU H;  3M4O B;  4KJO A;  3KLS A;  2PPB C;  3M3Y H;  1STG A;  3HKZ B;  1OTC A;  4A3B G;  1NTG A;  4AYB B;  2Z4I A;  3HOU G;  3I4O A;  4C3H B;  3L2P A;  3A8K E;  4DR2 Q;  2YU9 H;  1UE5 A;  2F03 A;  3D6W A;  2UU9 L;  1CZG A;  3WWV A;  5IOD A;  4ME5 A;  3JC6 6;  5ELO A;  5M3F H;  1I4H A;  4OIJ A;  1LV9 A;  1AE2 A;  1R9T H;  3MXN B;  2D0P A;  2I5M X;  3CQZ B;  1DON A;  5M3F G;  2IW3 A;  1VQL A;  2L1B A;  3TN2 A;  2AQ1 B;  4DR2 L;  1GUG A;  1MBY A;  2D2C C;  3T13 A;  3PIO A;  3LX0 A;  3S17 B;  2OQ0 A;  1A3U A;  1VQJ A;  4IAL A;  3BDC A;  3VYS A;  1K83 H;  1Y8N B;  4FO2 A;  1Z47 A;  4XT3 B;  3K0Y A;  5I9O A;  1QNK A;  4F7X A;  2QW7 A;  3X3M A;  3CC2 A;  3P20 A;  2ASB A;  2DGY A;  3PV0 A;  2OCE A;  1L1O A;  2RDG A;  4ZUI A;  2JQO A;  4DV5 Q;  1UE6 A;  2MNA A;  4JI7 Q;  2Q8I B;  1IL2 A;  2RCF A;  1C4Q A;  3CMA A;  4ME3 A;  5AFW A;  2RHS B;  3CPW A;  1TWF H;  2AWN A;  4XIG S;  4F88 A;  4IFD I;  2CHB D;  1D7Q A;  4DV5 L;  4JYA Q;  3RLN A;  3CCS A;  4JI7 L;  5KYL A;  2OQK A;  2ENB A;  3E9I A;  1ESR A;  2WKD A;  5LMU Q;  2R7D A;  3MXP A;  4O42 A;  2E8G A;  1YNX A;  2K7V A;  1ZYR D;  4JYA L;  2R93 H;  1JWM D;  3Q24 A;  1PH7 A;  1FGU A;  1M4V A;  2JA6 H;  2L4N A;  3HOX B;  4A3E B;  2F3V A;  2R93 G;  1WTW A;  2PQA B;  2JA6 G;  1E2Z A;  5LMU L;  3AU7 A;  1VDZ A;  4C3I H;  4NPS A;  4PG3 A;  1B9M A;  1HA6 A;  4XT1 B;  3UE0 A;  1EFI D;  4ZK9 B;  3SVM A;  4IUV A;  2FMM A;  4C3I G;  3ITP A;  1J8I A;  2EVB A;  3DMU A;  2QA4 A;  4A3K B;  2RCN A;  3AB9 A;  2AWO A;  1HNX Q;  2IL8 A;  3F2U A;  1KDB A;  1PRT C;  2K01 A;  1FGB D;  5E7N A;  3PCO B;  3T56 B;  3RLF A;  5D3I B;  3PF4 A;  4K5X A;  2WIN B;  4QL5 A;  2NWG A;  2JA8 B;  4TSS A;  4ABN A;  2EY1 A;  1L2F A;  2RHQ B;  5EPK A;  1HNX L;  2RSN A;  1X3Q A;  1N36 Q;  1UE7 A;  3ER0 A;  3NHH A;  4UY8 C;  1ENF A;  1RL2 A;  1E3P A;  5IE8 A;  2PQE A;  3SE0 A;  1SNP A;  2GVA A;  4RGM A;  3PMF A;  5FO7 B;  1LT5 D;  4CKB A;  1A2U A;  3HOW H;  1RJT A;  4A3G H;  4O0A A;  4MNO A;  2UUC Q;  3HOW G;  1N36 L;  1HCZ A;  3E9H A;  4B9X A;  4HIO A;  4A3G G;  2F1M A;  5IGE A;  1B1Z A;  1U0L A;  3C1E A;  4JK1 C;  2CFM A;  1JCK B;  4RWS C;  1JJC B;  4DR1 Q;  2R92 H;  1XPO A;  2UUC L;  1GO3 E;  2JYO A;  1KRT A;  2R92 G;  5KNC A;  2B2W C;  4R4Q A;  2WAQ B;  1MKH A;  1VS0 A;  4LFA Q;  3CKI B;  4DR1 L;  1KLG D;  5FLX L;  1HR0 Q;  4N8F A;  2Z6K A;  1KXL A;  3K58 A;  1MJC A;  5M5W H;  1HUN A;  1CM9 A;  2RDH A;  1EEF D;  4ID6 A;  3M7G A;  2AQ2 B;  3FEW X;  3NBH B;  1TQO A;  2IX1 A;  1LUZ A;  1VQP A;  1EWH A;  2IWH A;  4OX9 Q;  5CYU A;  1TWG H;  5JOB A;  4LFA L;  1HFN A;  1BBU A;  1HR0 L;  1KNE A;  4EQP A;  2PCF B;  2VUM B;  4M8A A;  1F2M A;  3OPO A;  2AHO B;  1ENC A;  3Q0A A;  1MI2 A;  1EY4 A;  1MSG A;  3HOU B;  1EQV A;  3M3Y B;  4OX9 L;  2Q8R E;  3VYT A;  1SN8 A;  4M1U B;  1SXT A;  3Q22 A;  2IJ0 A;  3FPU B;  4IPD A;  1IYV A;  3J7A 5;  4L5R C;  2JK8 A;  4PV1 C;  1AP0 A;  2MUY A;  3U4Z A;  2B2T A;  1A3T A;  1S4Z A;  4DR3 Q;  2NVX H;  1QIL A;  2BDO A;  4Y52 H;  3V96 A;  2B63 H;  3FP9 A;  2L9H A;  2JE6 I;  1LTR D;  2JA5 H;  1QVG A;  1UNS A;  5C3E H;  2VY3 A;  2B63 G;  1JOO A;  3J80 i;  3ZYY X;  2CKZ B;  2JA5 G;  2GN5 A;  5KNB A;  1SNM A;  1NCV A;  5C3E G;  3WDN A;  4DR3 L;  1PH2 A;  3ULJ A;  1PFN A;  5FKA C;  2J0T D;  1EU3 A;  1L1O C;  3VYU A;  4CDF C;  1SEB D;  2CQO A;  5DM7 3;  1O7I A;  4FDB A;  3GTO B;  2FHT A;  2KHS A;  3SK6 A;  4FVM A;  1A0I A;  5C5L A;  4FF1 A;  1WYD A;  3S1N B;  2RA4 A;  3DM3 A;  4IUP A;  1LLR D;  5AJ3 Q;  3HOV H;  2YTV A;  1TWF B;  4B9W A;  3JAM c;  3J7Y W;  1D5M C;  3J81 i;  3HOV G;  1R4Q B;  2HIV A;  3R3O A;  2QEX A;  3ICE A;  4R9W A;  4RHS A;  4UP7 A;  4FXD A;  1I4R A;  2E5L Q;  1GD7 A;  1SNO A;  4QUC A;  3NBI A;  1K0R A;  1QVF A;  3F1Z A;  5AJ3 L;  4IJL A;  1BVS A;  2X6G A;  1HRJ A;  1HQM C;  3BVM A;  5J3B A;  3K57 A;  1Q1E A;  3A54 A;  4G57 A;  4O2D A;  1T5X D;  5GQO A;  4C3J H;  2E5L L;  3G7L A;  4B3T Q;  3GQB A;  1VQ9 A;  1EY7 A;  2ZTE A;  4IUN A;  1VQD A;  3K8A A;  2K50 A;  2LS0 1;  4C3J G;  3G6J B;  5G3L F;  1CKM A;  4U67 3;  1D5X C;  3TEH B;  1SSO A;  1FYC A;  2O5J C;  3K7U C;  1Z6H A;  2F0T A;  4YCV A;  4B3T L;  1L1O B;  2FIN B;  4BBR H;  4C2M B;  3S14 H;  1JQY D;  2E75 C;  4BBR G;  3BYY B;  3BJU A;  1TWA B;  2JXM B;  3SHL A;  1CK1 A;  2Z4H A;  3L7Z C;  2G5D A;  3OWF A;  1WTQ A;  2EDG A;  4H13 C;  5G3L D;  4EQ5 A;  3DLL A;  3JAM E;  4A75 A;  1PTO H;  1AE3 A;  1XPR A;  3E0E A;  5ELN A;  4I65 A;  2L15 A;  3HOW B;  3AQQ A;  4A3G B;  4ILW A;  2C5C A;  3HEJ A;  5IP9 H;  2UXB Q;  1S5D D;  2EY2 A;  1QE6 A;  1NUC A;  5IP9 G;  1K8A C;  1ASZ A;  5CR3 A;  3J7Z C;  4JV5 Q;  2BDN A;  5C3W A;  2HUG A;  3ERS X;  4YWM A;  4Z9C B;  3CC4 A;  1PTO D;  1TS5 A;  1YBY A;  4PZ8 A;  5JJZ A;  5FOB B;  2UXB L;  2UXC Q;  1EU4 A;  4GN4 B;  1X9N A;  3QWN A;  4OXP A;  2JEA I;  4IPH A;  4A3C H;  4DGZ A;  4LUO A;  2Q2I A;  1F77 A;  1NMG A;  3I90 A;  1U4R A;  4JBK A;  4JV5 L;  3G48 A;  1IW7 C;  4A3C G;  2K1B A;  4DN4 M;  4PNY A;  4JC0 A;  4B3R Q;  3BDO A;  3R2T A;  4DNT B;  1SDF A;  2UXC L;  3E0J A;  2N55 A;  3SR1 A;  1TY0 A;  3EJI A;  4LF5 Q;  1TWH H;  1TWG B;  1AH9 A;  3OOC A;  1WI5 A;  2YYZ A;  5HUR A;  1LT6 D;  4B3R L;  5HGQ A;  4GNX A;  3RNU A;  4ZAI A;  4YCW A;  1RHP A;  2PYK A;  3C2P A;  3S9W A;  3A8I E;  1PH6 A;  2DY7 A;  4LF5 L;  2QF7 A;  4PZ7 A;  1HH2 P;  1EYG A;  2KEC A;  5ELC A;  5J22 A;  2Z8L A;  3CCM A;  4QMG A;  1YIJ A;  2B2T C;  2RVL A;  4B3M L;  3GO5 A;  2EE1 A;  1B9N A;  1NAP A;  3PIP A;  2K03 A;  3DUZ A;  2KA7 A;  4V0B A;  2ALY B;  2KHI A;  4BY7 B;  5C6A A;  4OL7 A;  3KLR A;  1JJ2 A;  1X55 A;  3HGB A;  2NVX B;  5IP7 H;  4NB3 A;  2B63 B;  2XN9 C;  2ZTD A;  1TR5 A;  2PMZ B;  5CGK A;  2XWB B;  2JA5 B;  1JJG A;  2F0K A;  5IP7 G;  1KIX A;  5I6W A;  5JEA J;  5C3E B;  3RR5 A;  2XSC A;  1PH9 A;  2UUB Q;  3TP7 A;  3RN2 A;  5EPL A;  2G9D A;  2M2L A;  4X3U A;  1PYB A;  5CV8 A;  1E22 A;  4P71 A;  3NXW A;  1FNU A;  1AN8 A;  1BKB A;  2N49 A;  3KLS X;  4X64 L;  1IBM Q;  2UUB L;  3VR6 A;  1VQN A;  2CW0 C;  1SNQ A;  2LSS A;  4JI8 Q;  3U50 C;  3GTP H;  1KD1 C;  3KOJ A;  4ZUJ A;  1Q81 C;  4HJ7 A;  4RGO S;  1IBM L;  2D62 A;  3F2B A;  3M7N A;  3HS0 C;  4HED A;  4JI8 L;  1K8M A;  4DA2 A;  5CV6 A;  1CHQ D;  1LM0 A;  3K5N A;  1BXT A;  2A73 B;  4A3I B;  2F0U A;  1KTK A;  2Y0S E;  3K0X A;  4R4O A;  4C3J B;  2HHH Q;  4CHT B;  5JJL A;  3PUZ A;  4HR7 B;  2MFI A;  4LF6 Q;  2NBF A;  1XMO Q;  3UDX A;  2K6A A;  2YTX A;  4GOP B;  4QQB X;  1EY9 A;  1AZQ A;  1Y1V H;  1X6O A;  3PIO 3;  3VYR A;  2R7Z H;  1OXT A;  5C4X H;  3J81 c;  2HHH L;  1Y1V G;  2R7Z G;  4ZKC B;  4YCU A;  3NBH A;  4LF6 L;  3S14 B;  5C4X G;  4H44 C;  1XMO L;  1GVP A;  3EQL C;  1YZ6 A;  1YNJ C;  3D31 A;  1DCZ A;  3S1Q H;  4P74 A;  1K3B C;  2IPK D;  1KAB A;  1S40 A;  2F0M A;  3BVG A;  1EIH A;  3D4D A;  1T9H A;  2J4X A;  4G7Z C;  3H3V C;  1BR9 A;  1EY8 A;  1Q86 C;  2K75 A;  1PTO B;  1X3P A;  3NEM A;  3GTJ H;  3BZC A;  4OHJ A;  2MQH A;  1Y69 U;  1WFQ A;  3PO2 B;  4B3S Q;  1YHB A;  5H1S E;  1KAW A;  4GN3 B;  1PHJ A;  2MGS A;  1HPC A;  1LO5 D;  3P75 A;  4KKS A;  1BCP D;  2BOS A;  2IX0 A;  2WB1 G;  4DV0 Q;  1R4P B;  1RF2 D;  4RGN A;  5M5Y H;  2O5I C;  3NPP A;  4NW2 A;  5LMN Q;  5T1G A;  3V05 A;  3UDF A;  1S3O A;  3NWT A;  4B3S L;  2HCI A;  4DKA C;  1UEA B;  4R4C A;  2B3G A;  4DUY Q;  4CJ2 C;  5JPN C;  3FMC A;  2PW5 A;  2E2I H;  4DV0 L;  5K36 H;  1C0A A;  2F0W A;  4N9P A;  4P72 A;  5EKI A;  1UEB A;  3WOE A;  5LMN L;  4RGT A;  4TQU S;  5K36 G;  1SRU A;  5K5P A;  1YNN C;  4KJN A;  1OXS C;  3SK5 A;  4IOC A;  5C4Z A;  3S2D H;  4P75 A;  4A76 A;  1Q8I A;  1XWE A;  1Q7Y C;  2VQE Q;  2NVY H;  4DUY L;  2BA1 A;  4QCL A;  3AFQ A;  4UDU C;  3FKI B;  1UUP A;  4X62 Q;  1TKW B;  4IQZ A;  1QG7 A;  5JEA H;  3TDQ A;  2EYF A;  2VXW A;  1D1I A;  2SDF A;  4DR6 Q;  1VQC A;  5JEA G;  4DK0 A;  2VQE L;  2UU9 Q;  3NUC A;  1V1Q A;  1DM0 B;  1G6Z A;  1E2W A;  3S2H H;  2B2U C;  4LMQ D;  4X62 L;  1I6H H;  5FLX E;  5A2Q L;  4KY7 A;  3QR8 A;  3CCQ A;  2G9H D;  4KD3 A;  1ZEQ X;  5FLM H;  5D14 A;  1EIY B;  4DR6 L;  1Z7T A;  4TKO B;  1GUW A;  2JSO A;  5FLM G;  3PUY A;  4J8Q A;  1MGS A;  2UUA Q;  5JVH 3;  4ZYS A;  1NY4 A;  1N32 Q;  3TZU A;  2N88 A;  3FPP A;  2YV5 A;  3MFG A;  5GAG C;  1NJI C;  3A56 A;  3JAM i;  1AFP A;  3I8Z A;  3ERQ A;  5ELE A;  3IL8 A;  3CP0 A;  1DOL A;  2UUA L;  2RDF A;  3BU2 A;  3GTK B;  4H7B A;  3GV6 A;  1N32 L;  2N8N A;  5COR A;  3RZD B;  3K5M A;  1IZ6 A;  1KDC A;  2FFK B;  1SMY D;  3MFY A;  2H1E A;  2KED A;  1SJH D;  1KC8 C;  1CQF A;  1E7Z A;  1ROD A;  1WCM H;  1BBW A;  1EQT A;  1MD2 D;  5J1Z A;  4OON A;  1P16 A;  4K14 A;  2AQ3 B;  1WCM G;  1ONL A;  3I7F A;  5BN3 A;  4IJH A;  1X32 A;  2NVT H;  2IHF A;  1SND A;  2A6H C;  2NYZ D;  1W6J A;  2A8V A;  4A4I A;  2VB2 X;  4GNX B;  3EVQ A;  1A2T A;  1Q1B A;  2KHJ A;  2C9O A;  4QB4 A;  1K9M C;  5ELB A;  2XRQ D;  1I3Q H;  2F4V Q;  1LYL A;  2A69 D;  2H5X A;  4KKT A;  4H0L C;  1Y8O B;  4DR5 Q;  2XIW A;  1SR3 A;  2R7F A;  3HFZ B;  4QUF A;  4YIJ A;  2EIF A;  5FJ8 H;  1NR2 A;  1EIF A;  1PZI D;  2QDL A;  2OF1 A;  5KEE A;  3HP3 A;  2A6E C;  1FL0 A;  5FJ8 G;  5IY0 A;  1IKM A;  1AZP A;  2F4V L;  5ELF A;  5C5M A;  1UWV A;  4DR5 L;  2KCN A;  1SFO H;  1U4M A;  1F9R A;  2PW7 A;  2LKV A;  1J5E Q;  3GTM H;  2MJ8 A;  2K5V A;  4YWL A;  1KHI A;  4A93 B;  3G71 A;  4HTH A;  1SYB A;  1GKH A;  1F2Y A;  1STE A;  4QJF A;  1GHK A;  1X3G A;  4RG1 A;  1P8L A;  1E0B A;  3HZX A;  5JVG 3;  2Q2U A;  1BCP B;  4TVA B;  1KNA A;  2XWJ B;  1J5E L;  1IYU A;  2JA7 B;  4CKE A;  5IGD A;  1GUN A;  2EQS A;  5DLQ E;  3GTQ H;  1MIU A;  1TS2 A;  1BF4 A;  1L0W A;  3DWP A;  3CD6 A;  2Y0S G;  5IIF A;  1V1P A;  4DAP A;  3STB D;  2F0F A;  1E1T A;  4L6T B;  1S5F D;  3D0F A;  1STB A;  2KQ3 A;  1Q3L A;  2PZT A;  4L63 B;  4X65 Q;  2QGQ A;  5T1I A;  3CXC A;  1NNX A;  2K33 A;  1SYE A;  1LTG D;  2DY8 A;  5LL6 S;  3DHQ A;  5E4W C;  4DV3 Q;  1I50 H;  4K8I A;  2F3I A;  1C8C A;  1GJX A;  3EFX D;  2E2I B;  4X65 L;  2F0N A;  1DOK A;  5I2X A;  3SDZ A;  2BCO A;  2EYM A;  5EJW A;  4DAV A;  4EGV A;  5M3M H;  1G51 A;  2ES2 A;  3ZJY C;  4DV3 L;  3MVV A;  1ZYR C;  5M3M G;  4AYB E;  3O13 A;  4Q0F A;  5C44 H;  1I4X A;  5A35 A;  3CU7 A;  3QOJ A;  2K52 A;  5C44 G;  4DNR B;  5C4J H;  1IKL A;  1LTB D;  1TT2 A;  1GUS A;  1JWS D;  2B2V A;  1JB3 A;  3I72 A;  3RUZ A;  4A3B B;  5KND A;  2H4O A;  2M9V A;  2R6G A;  3S2H B;  1TU2 B;  1EY6 A;  4K2L A;  4PZ6 A;  2D9U A;  4OWX B;  5FO9 B;  1DJR D;  2B2Y A;  1U5K A;  1D8L A;  4ZLT F;  5KIX A;  2EOT A;  2YU9 B;  3MXG A;  4ZRZ A;  2WII B;  2R3Z A;  4BA1 I;  2K5N A;  4X3S A;  1C48 A;  5M3F B;  4JVZ A;  1R9T B;  3F8T A;  3IKJ A;  4FNF A;  3D4R A;  4MTK A;  1VQI A;  5IGC A;  1PXU A;  4HMI A;  1DOM A;  3K7A H;  3H09 A;  3GTL H;  4HJ5 A;  3TRE A;  1PYS B;  3S15 H;  5HY6 A;  4X66 Q;  4GOP A;  3BDL A;  1W2B A;  1K83 B;  5TSS A;  3TQY A;  1B3Q A;  1WTP A;  4GZY C;  1BNZ A;  2E2J H;  3VDY A;  3R2I A;  1FR3 A;  4DXG A;  1ILQ A;  5C0X I;  2F0V A;  3HG9 A;  4RCO A;  2AMC B;  4S3S A;  1VQO A;  1KDA A;  1RD9 D;  4JI0 Q;  2NN6 I;  2OWO A;  4BS9 A;  2F0I A;  4X66 L;  1VQ5 A;  4BA2 I;  3CW2 C;  4LJZ C;  1CSQ A;  4JG2 A;  2EY5 A;  4L8J A;  1EWI A;  1N33 Q;  2N3S A;  2NVT B;  4KI0 A;  1VMC A;  1CT1 D;  3CCE A;  1XNR Q;  4JI0 L;  1T5E A;  4QIW E;  5I2Y A;  3QG1 A;  2A74 C;  3D3R A;  4JBM A;  3OMG A;  3RLO A;  2RSO A;  3VR2 A;  2EPB A;  1N33 L;  1I3Q B;  2B8F A;  3SGI A;  2Z1C A;  3V2T A;  1LTT D;  1XNR L;  5DAU A;  2F0Q A;  4K5W A;  3T16 A;  4A3M H;  2R93 B;  1VMP A;  1H9K A;  1K28 A;  2WKC A;  2JA6 B;  2PO4 A;  4A3M G;  2K05 A;  1SE4 A;  3W5O A;  3T1H Q;  1FVI A;  2MPM A;  4IOA A;  3PIP 3;  4L5T A;  4C3I B;  3CCJ A;  1GHJ A;  2WB1 E;  1JOR A;  3ULL A;  1PH1 A;  5KRU A;  1SLJ A;  1VQM A;  1O80 A;  3GTM B;  3PQI A;  3TS2 A;  2JEB I;  2F0L A;  4IUU A;  3T1H L;  2KOL A;  3R8B A;  4EX5 A;  3S1M H;  3U4V A;  1CA6 A;  3KLW A;  1U4P A;  1Q8K A;  4JOI A;  3CME A;  5LL6 X;  2CCZ A;  1KL9 A;  1C9O A;  4IN3 A;  4QY7 A;  4GLV B;  1HZC A;  1KRS A;  2NTT A;  4IUT A;  2I5H A;  3R93 A;  4C1N I;  4A3L G;  2XNA C;  3K5O A;  2A1A A;  4NDX A;  4OO1 H;  2K04 A;  2I0Q A;  2SNS A;  2ATW A;  3ONA B;  1CSP A;  2WAQ E;  4OO1 G;  3GP7 A;  3HOZ H;  3RD4 A;  2VNU D;  3HOZ G;  4KHP Q;  2KVM A;  5EBD A;  4RA8 A;  2R92 B;  2OXP A;  1LTL A;  5JJK A;  1TII D;  4DNI A;  2KBN A;  1I50 B;  4JI2 Q;  3VR5 A;  3TP5 A;  1SYC A;  3HKS A;  3H15 A;  2SNM A;  5EKL A;  2Z6K C;  4LF9 Q;  4KHP L;  2SOB A;  3P1H A;  4AQY Q;  1RKN A;  5CV9 A;  5M5W B;  4K8J A;  5IYB H;  1EQQ A;  4JI2 L;  1E1O A;  2MO1 A;  3KFU A;  3SEB A;  3I73 A;  5IYB G;  4LF9 L;  1BQQ T;  1IXR A;  4AQY L;  1VQ7 A;  3HOY H;  2HCC A;  5C4J B;  3FRP B;  3NQI A;  4FXG C;  4B3M Q;  3HOY G;  1Q12 A;  2Z0S A;  4OGQ C;  1OO9 B;  2K5H A;  4DK3 C;  4FF2 A;  4L5Q A;  2VS1 A;  2HIX A;  1N34 Q;  3E5S A;  2B2Y C;  4X6A H;  2KJX A;  3H6M A;  1CHP D;  1YHQ A;  1VQA A;  1V1P B;  1RCV D;  2FXQ A;  1RDP D;  4NKL A;  2N78 A;  1XTC D;  4XQQ A;  2F4I A;  1N9W A;  1QB5 D;  4XQJ A;  1FJG Q;  3I4M G;  4OIK A;  5LHY 1;  2BE5 D;  3MZ5 A;  3M4O H;  1N34 L;  3H3V H;  3W3A A;  1PVO A;  1NSN S;  4XXE A;  2X6L A;  5C0X J;  3M4Y A;  2I5L X;  1YI2 A;  1Q82 C;  1CQV A;  1FJG L;  4AYB G;  1FD7 D;  2K14 A;  4GOP C;  1F9Q A;  4JPB W;  1SRO A;  1ICW A;  3S15 B;  3RZO H;  1BBX C;  5A2Q E;  4X64 Q;  4HJA A;  1G91 A;  2IHE A;  4KHZ A;  3CQZ H;  4KN4 C;  2WP8 J;  1W3S A;  4RHR A;  1I4P A;  5GAE C;  3I3C A;  1EQR A;  2CH4 W;  1VQG A;  4A3D H;  4N9T A;  3S17 H;  3VA7 A;  1JR0 D;  3P7J A;  4A3D G;  4CDE C;  2A68 D;  2KEE A;  2XTI A;  3UE1 A;  2VZA A;  1XTD A;  5IGG A;  1HTP A;  3QJY A;  1PTO C;  2EYJ A;  4KKU A;  3G4S A;  3HOV B;  1IL8 A;  3EBE A;  1ZXT A;  4K0K Q;  3GDE A;  4XQN A;  1S5C D;  4R4I A;  2R61 A;  2UXD Q;  4K6L A;  1EY0 A;  5EGT A;  1TS3 A;  4HSV A;  4K0K L;  1D2B A;  2JA9 A;  4LUZ A;  1PLF A;  2EYO A;  1QUQ B;  1K73 C;  1QZG A;  4KY6 A;  3EIV A;  3MWY W;  5E4X A;  1ICF B;  2UXD L;  1U4L A;  1CKO A;  2HT1 A;  1EEI D;  1PH8 A;  5IYC H;  2DNE A;  1WTR A;  4BY1 H;  2LY7 A;  1VQK A;  5IYC G;  3HOX H;  3BS1 A;  4A3E H;  4BY1 G;  4G4K A;  4GN5 A;  1TXY A;  4BBR B;  3HOX G;  4A3E G;  4H02 A;  4CDD C;  2TMP A;  4JOI C;  2IT1 A;  5IYD H;  3I56 A;  1HHV A;  5CBE E;  4A3K H;  5IYD G;  2XVS A;  2ZT9 C;  1XXG A;  2Q2T A;  1KAA A;  4FF3 A;  4A3K G;  3MEF A;  3LGJ A;  5EAY A;  3J7A V;  1SMX A;  4BBS H;  3KBG A;  1XNQ Q;  4BBS G;  5C3X A;  5FLX c;  3CPF A;  2E2D C;  5CV4 A;  1OXU A;  1WD0 A;  2VL6 A;  1K8G A;  2WV6 D;  4IUQ A;  4DAM A;  3PSI A;  3HOZ B;  1VQB A;  4LF4 Q;  1XNQ L;  4DK1 A;  2VQF Q;  3M9B A;  2QEJ C;  1EZ6 A;  3KF6 A;  1FNV A;  2QCP X;  1STA A;  2EJF C;  4BXX H;  2L5T A;  4KD4 A;  1HFG A;  1MHW C;  2K28 A;  4QF4 A;  2EY6 A;  4LF4 L;  4BXX G;  1A63 A;  3I2Z A;  5FO8 B;  3NWS A;  2VQF L;  1G6P A;  1JB7 A;  4HIK A;  1STN A;  5C0X H;  1V43 A;  2NN6 H;  4I7Z C;  5C0X G;  3C1F A;  3PO3 H;  3KF8 A;  4HSP A;  3B6Y A;  2NN6 G;  5JPM C;  1TWH B;  1LTA D;  2V4D A;  3K59 A;  2B2W A;  3NTK A;  3PO3 G;  2KUM A;  1B7Y B;  2WAQ G;  5IWA Q;  3MHB A;  3TZD A;  4GNX C;  1EL0 A;  1L0Y B;  1SE8 A;  4EQO A;  2F0D A;  4WRD A;  4PMB A;  1PRT F;  1F9P A;  1F9S A;  1WJJ A;  2QIL A;  2SEB D;  3GTG H;  4LF8 L;  4OO1 I;  3CCV A;  1F2Z A;  1C7Y A;  1HZA A;  1SAP A;  3UDG A;  2CH4 A;  1Q46 A;  1OXX K;  5IWA L;  3QOL A;  1DGS A;  4KV6 A;  4HMJ A;  1HZB A;  4BWG B;  1PFM A;  2MO0 A;  3H0G H;  4C56 C;  1ML0 D;  1YHA A;  2L12 A;  4KHV A;  2OTJ A;  1TS4 A;  3IRB A;  2KEN A;  3A0J A;  1D1K A;  1EYA A;  2I07 B;  3H0G G;  4KLK A;  3LWU A;  3C46 A;  1PRT D;  1B44 D;  4GKJ Q;  5JAV A;  1NBW A;  1HR0 W;  3MXU A;  3RZO B;  2F0J A;  3WOF A;  3W2D A;  1G2T A;  1STY A;  3KYH C;  1EIG A;  2GA4 B;  1HQR D;  1BCP C;  4MZ9 A;  4DK6 C;  2PNH A;  5EQ0 A;  2CWP A;  3OW7 A;  4J1M A;  1Q90 A;  3CRK C;  1PH3 A;  4GKK Q;  4WFN 3;  4A3D B;  4GKJ L;  4DV6 Q;  1CUK A;  1EYD A;  1I6V C;  3EA6 A;  4HJ9 A;  1EFW A;  1XPU A;  2PNR C;  2NUC A;  1WD1 A;  2JP1 A;  3OIQ A;  4PQX A;  1AEX A;  4HCS A;  1EWC A;  3SK4 A;  4GKK L;  3GTP B;  1YJW A;  4DV6 L;  1GUT A;  3IFT A;  3S24 A;  4JI1 Q;  3GTO H;  2MP1 A;  4PMW A;  1M8A A;  3UI2 A;  4GS3 A;  1HTL D;  2KCT A;  2NTS A;  3S1N H;  1HZ9 A;  2F0E A;  3H3V I;  5COY A;  3K80 C;  1DD2 A;  3I70 A;  4JI1 L;  1XJV A;  1O78 A;  3VR3 A;  4CDC C;  4X3T A;  5NUC A;  3OTO Q;  2B8G A;  4EQN A;  2F3W A;  4JI4 Q;  3NEN A;  4ZKB B;  2ZXR A;  5IT9 L;  1Y1V B;  2HQL A;  1JOQ A;  2R7Z B;  4BY1 B;  4XYO A;  1LTS D;  5C4X B;  1B3A A;  2DN8 A;  3BVZ A;  1CFM A;  4QIW B;  1ASY A;  1PV4 A;  1LAC A;  1IYJ B;  1STH A;  2NZH A;  1V1O A;  2Q2H A;  3OTO L;  4DV7 Q;  3GV3 A;  3Q23 A;  3ND9 A;  1RTO A;  3I91 A;  4JI4 L;  1BOS A;  4AH6 A;  1B4O A;  4B08 A;  4Q5V A;  4FYD A;  2F0H A;  3CC7 A;  1X3E A;  5ELD A;  1KLU D;  1M90 C;  2E76 C;  5IGF A;  3S1Q B;  4WJ3 M;  3D8G A;  1HUM A;  3J80 L;  4Y7N H;  4IUR A;  4DV7 L;  4C2M H;  5GRO A;  1MSH A;  3F2C A;  4HAE A;  4UHV A;  1S72 A;  4BBS B;  2EJM A;  3NQT A;  1BUV T;  1SYD A;  5ISR A;  3GTJ B;  1TWA H;  2XRS D;  1SMY C;  5KYI A;  2WB1 B;  5DEH A;  3T51 B;  3TME A;  2OT2 A;  3U9O A;  1A8V A;  1N8R C;  2ZJQ A;  1V8Q A;  3NP8 A;  2C35 B;  5M5Y B;  1PYW D;  4CJ0 B;  1H9S A;  1PDQ A;  4X3K A;  1ET9 A;  4UAI A;  3N6R A;  4JI5 Q;  2B39 A;  1PA6 A;  1JT8 A;  1A15 A;  1PH4 A;  3FDT A;  3KDF A;  3G6E A;  4RAU C;  3J81 L;  3NTI A;  4LNQ A;  4L5S A;  5BN5 A;  4R8I A;  3ERO A;  5EKK A;  3U58 A;  3S16 H;  2EXZ A;  3D4W A;  4LW1 A;  3S1R H;  2CWA A;  4JI6 Q;  4JI5 L;  4ZQ3 A;  3S2D B;  1CKN A;  1GM5 A;  2A69 C;  2NVY B;  2L55 A;  3HKZ E;  4DAY A;  4A3F H;  2Z9H A;  3RN5 A;  1YJ9 A;  1K0S A;  2I46 A;  4K2K A;  4A3F G;  4R1J A;  4JW0 A;  5GAD C;  1JOK A;  3PO3 B;  4POG A;  4FF4 A;  1O7Y A;  4JI6 L;  1CI3 M;  1JC7 A;  3TBI B;  4HID A;  1I5F A;  4E6I A;  4POF A;  1Z9F A;  3CF5 A;  1KQS A;  1VQH A;  2ZJR A;  3PUV A;  1E2V A;  3AFP A;  1PRT B;  2PI2 E;  4DUZ Q;  3OMC A;  3NSW A;  3GTG B;  4OEL B;  4LAA A;  2F0O A;  2EXD A;  1I6H B;  1H9R A;  3FVQ A;  1SE3 A;  4UP8 A;  3EN2 A;  1J6Q A;  3TSS A;  3T53 B;  1TVX A;  1GOZ A;  1FNW A;  1G29 1;  3K5L A;  4RKL A;  1SNC A;  2CQA A;  4K6D A;  1WOC A;  3KK7 A;  4MN3 A;  3H0G B;  1QUQ A;  4DUZ L;  3AYH B;  1QNU A;  1X56 A;  2JN4 A;  2PZU A;  3NE5 B;  2HDL A;  3E3X A;  1HNZ Q;  2L11 A;  3KF6 B;  1PFB A;  5IOC A;  1ESF A;  1I4G A;  3SK8 A;  5JJI A;  3LNN A;  3KJO A;  1XMQ Q;  3MC0 B;  1Y14 B;  3D6C A;  1EUJ A;  4OEM B;  4CJ1 B;  5EPJ A;  1O7L A;  5DM6 3;  3STB C;  1RIP A;  2Z6B A;  1HNZ L;  4BY7 H;  2NVQ H;  1JIC A;  2V1C C;  1WCM B;  4ODG A;  4GLA C;  1XMQ L;  3FHW A;  4BY7 G;  2A19 A;  3HRZ C;  1NMF A;  1E24 A;  4DU9 A;  1ENA A;  4NMZ A;  3KF8 B;  3AMU A;  4JCV E;  3BZD B;  2EYH A;  5CMD A;  4LF7 Q;  1SBB B;  1X54 A;  2ID0 A;  5M5X H;  2ZJP A;  1LT4 D;  3MTS A;  3M85 A;  1NE3 A;  2DJG C;  2NB0 A;  3SXH A;  3TRZ A;  3DEO A;  4IFD J;  1ET6 A;  3N52 A;  4LWC A;  5GAH C;  3C3L A;  3GD7 A;  2K5Q A;  3TP8 A;  3T1Y Q;  4MIU A;  1PFS A;  3PUX A;  3U9S A;  4LF7 L;  2HD3 A;  2TSS A;  3I4L A;  4FP5 D;  3BYT B;  4JBW A;  4LK1 C;  3OYY A;  1MJE A;  2XGT A;  3M4Q A;  1UE1 A;  4MTN A;  4KTA A;  1V9P A;  3AEV A;  3T1Y L;  4RMF A;  2E74 C;  3F2D A;  4G7O C;  1A3V A;  1Y8P B;  4ULL A;  3DWA A;  4DXF A;  4IZ8 A;  1IW7 D;  2F0G A;  1SJE D;  2O2L D;  5CC4 A;  3X3N A;  1H9M A;  3A8J E;  2RF4 A;  1SFO B;  1B2T A;  3DM1 A;  1PZJ D;  3MEH A;  1D6E C;  3QIA A;  4LFC Q;  4A3I H;  1VCI A;  1K3R A;  3A5U A;  1CZW A;  1L0X B;  3A5Z B;  4CGY B;  1GXD C;  4RCN A;  4A3I G;  4DV1 Q;  4NXM Q;  1Y1W H;  1AW7 A;  4AIM A;  3CCL A;  2EYL A;  1Y1W G;  2D5D A;  5C4H A;  3DWQ A;  3T4A C;  2O4X A;  2GVB A;  5I6Y A;  4LFC L;  3K81 C;  2OTL A;  1K8O A;  4PMC A;  1TWC H;  1VQF A;  4UPA A;  4A3L H;  4WOR A;  4Y7N B;  4GLX A;  1WTO A;  3GTQ B;  3QB3 A;  1YIT A;  3KJP A;  4DV1 L;  1DYQ A;  4NXM L;  2Y0S B;  1SE2 A;  2B29 A;  3W1G A;  1WTV A;  5BN4 A;  4WJ4 A;  4CBV A;  4HCE A;  3UDI A;  4P73 A;  1XX8 A;  2HDM A;  4R8N A;  4R4T A;  3NEL A;  1A6X A;  3L3O C;  1A62 A;  5D3D A;  4P2C B;  1JMC A;  3TP6 A;  1PZK D;  1PTO F;  2BH2 A;  1HNW Q;  3OW2 A;  3PO2 H;  3DXJ C;  3KBX A;  4DV2 Q;  2NZO A;  3PO2 G;  1EY5 A;  1X65 A;  4F87 A;  1HXY D;  3S16 B;  4RFB A;  4TRD A;  3I4N H;  1WTX A;  3MXN A;  2K5D A;  1PMR A;  3ULP A;  1YEZ A;  1ZKO A;  3S1R B;  3VR4 A;  1XYI A;  1LTI D;  4DR4 Q;  3OIP A;  1QZH A;  1EOT A;  3I4N G;  1HNW L;  2K4K A;  2MHV A;  2WAC A;  2PI2 A;  5M3M B;  2E2H H;  3URY A;  5F2D A;  2L0C A;  4WJW A;  3OWE B;  4J15 A;  4DV2 L;  4C1N K;  4A3F B;  2CW0 D;  4FXK C;  5C44 B;  2F52 A;  3L0O A;  2LFN A;  4OWW B;  1LT3 D;  3ND8 A;  5HGT A;  3CCR A;  4DR4 L;  5IGB A;  4LFB Q;  2B2V C;  2DUD A;  3KUP A;  3PF5 A;  1HJP A;  1I94 Q;  4DR7 Q;  2FMC A;  5I9P A;  1JE4 A;  4QGU A;  4MHE A;  1HA5 A;  1U9R A;  1WVL A;  5DNF A;  3PUW A;  1M1K C;  1QWY A;  3FKI H;  4A3J H;  3I4M H;  2J7Z A;  4IO9 A;  4U68 A;  4LFB L;  1I94 L;  3FKI G;  3DEP A;  4A3J G;  4DR7 L;  1QOH A;  1J9O A;  1EZ8 A;  2HQE A;  5LMN W;  3OHX C;  1BO0 A;  1H9S B;  3RMH A;  4LUV A;  4JI3 Q;  2ICI A;  1VF5 C;  4IFD H;  3I55 A;  3QO2 A;  2B2U A;  4C3H H;  3HKZ G;  3KDF B;  3K7A B;  5EBC A;  4IFD G;  1IHZ A;  4XTC S;  3GTL B;  5BR8 Q;  3Q6S A;  4C3H G;  1VQ8 A;  3MA2 B;  5J39 A;  4DF7 A;  2F0P A;  5D65 A;  4JI3 L;  1YNJ D;  2E2J B;  1D5Z C;  5M9O A;  2NVQ B;  1CKN B;  2PQA A;  1DXM A;  4DAY B;  5BR8 L;  2OEO A;  2X69 A;  2VB3 X;  3W1B A;  4IPC A;  3BG3 A;  3GTK H;  3M4P A;  4UP9 A;  5FK9 C;  1H9J A;  2IX3 A;  3J7A F;  3RZD H;  3TS0 A;  2LXJ A;  5I4D A;  4RKB A;  2K5W A;  1LAB A;  5M5X B;  2AKW B;  3OSO A;  3H94 A;  2Q8T A;  4KMU C;  1B53 A;  2CVR A;  1NR4 A;  2KCM A;  5IT9 c;  1I4Q A;  1EOV A;  2ZTC A;  1VQE A;  4NP5 A;  2EZV A;  4KN7 C;  1G8Z D;  2WFW A;  1VQ4 A;  1SYG A;  1IBL Q;  4A3M B;  1S5B D;  2F0S A;  4EVO A;  2IY5 B;  2NZ1 D;  4NXN Q;  2ZXP A;  1VQ6 A;  1YNN D;  3A7A B;  3NK9 A;  3J80 c;  2BA0 A;  3H91 A;  4F8M A;  4HIM A;  1F2L A;  4YHH Q;  1B50 A;  1WTH A;  2PZW A;  2ZXO A;  5CBA E;  3MAQ A;  1IBL L;  4NXN L;  4OWT B;  2M00 A;  3CAM A;  5KGU A;  4G7H C;  4DFA A;  1SYF A;  3VA5 A;  3S1M B;  1II3 A; 
#chains in the Genus database with same CATH homology
 2BE5 C;  1Y1W B;  3JAM L;  4RH6 A;  1TWC B;  1QCB D;  2LMC B;  2K32 A;  1S5E D;  5E1F A;  5CV7 A;  3IAY A;  1BCP F;  5IT9 E;  2QKI C;  1EYC A;  3NTH A;  2KCC A;  1GUO A;  2AUJ D;  4HN7 A;  1RTN A;  2QDB A;  2RKS A;  2EYP A;  4CKC A;  4J6H A;  1ILP A;  4K5V A;  2A68 C;  2RBM A;  3J80 E;  1JWU D;  3K6O A;  2A5H A;  3CRL C;  3I4N B;  1CA5 A;  2ICE C;  3IFD A;  2EJG C;  1TY2 A;  3A7L A;  3L9A X;  2E2H B;  2FJ2 A;  1QJO A;  2A6H D;  2RQX A;  4O1N A;  2AUK A;  3A55 A;  1O7Z A;  3CHB D;  1DZ1 A;  1G2S A;  3HOY B;  5E3F A;  1BDO A;  3LWE A;  3J81 E;  4XDX A;  1VF7 A;  1W6K A;  4XYQ A;  2DNC A;  3E6Z X;  5CV5 A;  4A3J B;  3I4M B;  1UAP A;  4KK7 A;  2A6E D;  4V19 0;  1OXV A;  1CTM A;  4KY5 A;  3M4O B;  4KJO A;  3KLS A;  2PPB C;  1STG A;  3HKZ B;  4AYB B;  2Z4I A;  4C3H B;  3A8K E;  2F03 A;  3D6W A;  1CZG A;  5IOD A;  4ME5 A;  1I4H A;  4OIJ A;  1LV9 A;  3CQZ B;  1DON A;  2IW3 A;  2L1B A;  3TN2 A;  2AQ1 B;  1GUG A;  1MBY A;  2D2C C;  3T13 A;  3LX0 A;  3S17 B;  1A3U A;  4IAL A;  3BDC A;  3VYS A;  4XT3 B;  1Y8N B;  4FO2 A;  1Z47 A;  5I9O A;  3K0Y A;  1QNK A;  4F7X A;  3X3M A;  3P20 A;  3PV0 A;  2RDG A;  4ZUI A;  2Q8I B;  1C4Q A;  5AFW A;  2AWN A;  4XIG S;  4F88 A;  4IFD I;  2CHB D;  5KYL A;  2ENB A;  1ESR A;  2WKD A;  4O42 A;  3MXP A;  2K7V A;  1ZYR D;  1JWM D;  3Q24 A;  1M4V A;  2L4N A;  3HOX B;  4A3E B;  2F3V A;  1WTW A;  1E2Z A;  3AU7 A;  1VDZ A;  1B9M A;  1HA6 A;  4XT1 B;  1EFI D;  4ZK9 B;  3SVM A;  4IUV A;  4C3I G;  2FMM A;  3ITP A;  1J8I A;  2EVB A;  3DMU A;  4A3K B;  3AB9 A;  2AWO A;  2IL8 A;  3F2U A;  1KDB A;  1PRT C;  2K01 A;  1FGB D;  3T56 B;  3RLF A;  5D3I B;  4K5X A;  2WIN B;  2NWG A;  2JA8 B;  4TSS A;  4ABN A;  2EY1 A;  5EPK A;  2RSN A;  1X3Q A;  3NHH A;  1ENF A;  3SE0 A;  2PQE A;  1SNP A;  4RGM A;  3PMF A;  5FO7 B;  1LT5 D;  4CKB A;  1A2U A;  1RJT A;  1HCZ A;  4B9X A;  2F1M A;  5IGE A;  1B1Z A;  3C1E A;  4JK1 C;  1JCK B;  4RWS C;  2JYO A;  5KNC A;  2B2W C;  2WAQ B;  3CKI B;  1KLG D;  5FLX L;  3K58 A;  1HUN A;  1CM9 A;  2RDH A;  1EEF D;  4ID6 A;  3M7G A;  2AQ2 B;  3FEW X;  1TQO A;  2IX1 A;  1EWH A;  2IWH A;  5CYU A;  5JOB A;  1HFN A;  1KNE A;  4EQP A;  2PCF B;  2VUM B;  4M8A A;  1F2M A;  3OPO A;  3Q0A A;  1ENC A;  1MI2 A;  1EY4 A;  1MSG A;  3HOU B;  1EQV A;  3M3Y B;  2Q8R E;  3VYT A;  4M1U B;  1SXT A;  3Q22 A;  2IJ0 A;  3FPU B;  1IYV A;  4PV1 C;  1AP0 A;  2MUY A;  2B2T A;  1A3T A;  1S4Z A;  1QIL A;  2BDO A;  3V96 A;  2L9H A;  2JE6 I;  1LTR D;  1UNS A;  1JOO A;  3ZYY X;  5KNB A;  1SNM A;  1NCV A;  3WDN A;  1PFN A;  5FKA C;  2J0T D;  1EU3 A;  3VYU A;  1SEB D;  5DM7 3;  3GTO B;  2FHT A;  2KHS A;  3SK6 A;  4FVM A;  5C5L A;  4FF1 A;  3S1N B;  2RA4 A;  4IUP A;  1LLR D;  1TWF B;  4B9W A;  3J7Y W;  1D5M C;  1R4Q B;  3R3O A;  4R9W A;  4RHS A;  4FXD A;  1I4R A;  1SNO A;  4QUC A;  3NBI A;  2X6G A;  1HRJ A;  1HQM C;  3BVM A;  3K57 A;  1Q1E A;  3A54 A;  4G57 A;  1T5X D;  3G7L A;  3GQB A;  1EY7 A;  4IUN A;  4C3J G;  2LS0 1;  3G6J B;  5G3L F;  4U67 3;  1D5X C;  1SSO A;  1FYC A;  2O5J C;  1Z6H A;  2F0T A;  4C2M B;  2FIN B;  1JQY D;  2E75 C;  3BYY B;  1TWA B;  2JXM B;  3SHL A;  1CK1 A;  2Z4H A;  3L7Z C;  3OWF A;  1WTQ A;  2EDG A;  4H13 C;  5G3L D;  3JAM E;  1PTO H;  4I65 A;  3HOW B;  4A3G B;  4ILW A;  2C5C A;  3HEJ A;  1S5D D;  2EY2 A;  1QE6 A;  1NUC A;  5CR3 A;  2BDN A;  5C3W A;  2HUG A;  4Z9C B;  1PTO D;  1TS5 A;  5JJZ A;  5FOB B;  1EU4 A;  3QWN A;  2JEA I;  4DGZ A;  1F77 A;  3I90 A;  1U4R A;  1IW7 C;  2K1B A;  4DN4 M;  4PNY A;  3BDO A;  3R2T A;  4DNT B;  1SDF A;  3E0J A;  2N55 A;  3SR1 A;  1TY0 A;  3EJI A;  1TWG B;  3OOC A;  2YYZ A;  5HUR A;  1LT6 D;  4ZAI A;  1RHP A;  2PYK A;  3C2P A;  3S9W A;  3A8I E;  2DY7 A;  2QF7 A;  2KEC A;  5ELC A;  5J22 A;  2Z8L A;  4QMG A;  2B2T C;  2RVL A;  3GO5 A;  2EE1 A;  1B9N A;  1NAP A;  2K03 A;  3DUZ A;  2KA7 A;  4V0B A;  4BY7 B;  5C6A A;  4OL7 A;  3KLR A;  3HGB A;  2NVX B;  2B63 B;  2XN9 C;  1TR5 A;  2PMZ B;  5CGK A;  2XWB B;  2JA5 B;  2F0K A;  5I6W A;  5JEA J;  5C3E B;  2XSC A;  3TP7 A;  5EPL A;  2G9D A;  2M2L A;  4X3U A;  5CV8 A;  3NXW A;  1FNU A;  1AN8 A;  3KLS X;  3VR6 A;  2CW0 C;  1SNQ A;  4ZUJ A;  4RGO S;  2D62 A;  3M7N A;  3HS0 C;  4HED A;  4DA2 A;  1K8M A;  5CV6 A;  1CHQ D;  3K5N A;  1BXT A;  2A73 B;  4A3I B;  2F0U A;  1KTK A;  4C3J B;  4CHT B;  3PUZ A;  4HR7 B;  2NBF A;  2K6A A;  1EY9 A;  1AZQ A;  3PIO 3;  3VYR A;  1OXT A;  4ZKC B;  3NBH A;  3S14 B;  4H44 C;  3EQL C;  1YNJ C;  3D31 A;  1DCZ A;  2IPK D;  1KAB A;  2F0M A;  3BVG A;  1EIH A;  3D4D A;  2J4X A;  4G7Z C;  3H3V C;  1BR9 A;  1EY8 A;  1PTO B;  1X3P A;  4OHJ A;  1Y69 U;  3PO2 B;  2MGS A;  1HPC A;  1LO5 D;  3P75 A;  4KKS A;  1BCP D;  2BOS A;  2IX0 A;  1R4P B;  1RF2 D;  4RGN A;  2O5I C;  3NPP A;  4NW2 A;  5T1G A;  3V05 A;  3NWT A;  2HCI A;  1UEA B;  4CJ2 C;  5JPN C;  3FMC A;  2PW5 A;  5K36 H;  5EKI A;  2F0W A;  4N9P A;  3WOE A;  4RGT A;  4TQU S;  5K36 G;  5K5P A;  1YNN C;  4KJN A;  1OXS C;  3SK5 A;  5C4Z A;  1Q8I A;  1XWE A;  2BA1 A;  4QCL A;  4UDU C;  3FKI B;  1UUP A;  1TKW B;  4IQZ A;  1QG7 A;  5JEA H;  3TDQ A;  2EYF A;  2VXW A;  1D1I A;  2SDF A;  5JEA G;  4DK0 A;  3NUC A;  1DM0 B;  1G6Z A;  1E2W A;  2B2U C;  4LMQ D;  5FLX E;  5A2Q L;  4KY7 A;  2G9H D;  4KD3 A;  1ZEQ X;  1GUW A;  5D14 A;  1Z7T A;  4TKO B;  2JSO A;  3PUY A;  4J8Q A;  1MGS A;  5JVH 3;  4ZYS A;  3TZU A;  2N88 A;  3FPP A;  3MFG A;  3A56 A;  1AFP A;  3I8Z A;  3ERQ A;  5ELE A;  3IL8 A;  1DOL A;  2RDF A;  3GTK B;  4H7B A;  3GV6 A;  3RZD B;  5COR A;  3K5M A;  1KDC A;  2FFK B;  1SMY D;  3MFY A;  2H1E A;  2KED A;  1SJH D;  1CQF A;  1ROD A;  1EQT A;  1MD2 D;  5J1Z A;  4K14 A;  2AQ3 B;  1ONL A;  5BN3 A;  1X32 A;  1SND A;  2A6H C;  2NYZ D;  1W6J A;  2VB2 X;  3EVQ A;  1A2T A;  1Q1B A;  2C9O A;  4QB4 A;  5ELB A;  2XRQ D;  2A69 D;  4KKT A;  4H0L C;  1Y8O B;  2XIW A;  4QUF A;  4YIJ A;  1NR2 A;  1PZI D;  2OF1 A;  5KEE A;  3HP3 A;  2A6E C;  1IKM A;  1AZP A;  5ELF A;  5C5M A;  2KCN A;  1U4M A;  1F9R A;  2PW7 A;  2LKV A;  2MJ8 A;  4A93 B;  4HTH A;  1SYB A;  1F2Y A;  1STE A;  1GHK A;  3HZX A;  1E0B A;  5JVG 3;  1BCP B;  1KNA A;  2XWJ B;  1IYU A;  2JA7 B;  4CKE A;  5IGD A;  1GUN A;  1TS2 A;  1BF4 A;  3DWP A;  5IIF A;  1V1P A;  4DAP A;  2F0F A;  4L6T B;  1S5F D;  1STB A;  2KQ3 A;  1Q3L A;  2PZT A;  4L63 B;  5T1I A;  2K33 A;  1SYE A;  1LTG D;  2DY8 A;  5LL6 S;  3DHQ A;  5E4W C;  4K8I A;  1C8C A;  1GJX A;  3EFX D;  2E2I B;  2F0N A;  1DOK A;  5I2X A;  3SDZ A;  2BCO A;  2EYM A;  5EJW A;  4DAV A;  4EGV A;  3MVV A;  1ZYR C;  3O13 A;  4Q0F A;  1I4X A;  5A35 A;  3CU7 A;  3QOJ A;  4DNR B;  1IKL A;  1LTB D;  1TT2 A;  1GUS A;  1JWS D;  2B2V A;  1JB3 A;  3I72 A;  3RUZ A;  4A3B B;  5KND A;  2H4O A;  2M9V A;  2R6G A;  3S2H B;  1TU2 B;  1EY6 A;  4K2L A;  2D9U A;  5FO9 B;  1DJR D;  2B2Y A;  4ZLT F;  5KIX A;  2EOT A;  2YU9 B;  3MXG A;  4ZRZ A;  2WII B;  2R3Z A;  4BA1 I;  4X3S A;  1C48 A;  5M3F B;  1R9T B;  3IKJ A;  4FNF A;  3D4R A;  5IGC A;  1PXU A;  4HMI A;  1DOM A;  3H09 A;  3BDL A;  1K83 B;  5TSS A;  1WTP A;  4GZY C;  1BNZ A;  3R2I A;  1FR3 A;  4DXG A;  1ILQ A;  5C0X I;  2F0V A;  3HG9 A;  4RCO A;  4S3S A;  1KDA A;  1RD9 D;  2NN6 I;  4BS9 A;  2F0I A;  4BA2 I;  4LJZ C;  4L8J A;  2EY5 A;  2NVT B;  4KI0 A;  1VMC A;  1CT1 D;  1T5E A;  5I2Y A;  3QG1 A;  2A74 C;  3D3R A;  3OMG A;  2RSO A;  3VR2 A;  2EPB A;  1I3Q B;  2B8F A;  2Z1C A;  3V2T A;  1LTT D;  5DAU A;  2F0Q A;  4K5W A;  3T16 A;  2R93 B;  1VMP A;  1H9K A;  2WKC A;  2JA6 B;  2PO4 A;  2K05 A;  1SE4 A;  2MPM A;  3PIP 3;  4C3I B;  1GHJ A;  1JOR A;  5KRU A;  1O80 A;  3GTM B;  2JEB I;  2F0L A;  4IUU A;  2KOL A;  3R8B A;  1CA6 A;  1U4P A;  5LL6 X;  4IN3 A;  2NTT A;  4IUT A;  3R93 A;  4C1N I;  2XNA C;  3K5O A;  4NDX A;  4OO1 H;  2K04 A;  2SNS A;  3ONA B;  4OO1 G;  3GP7 A;  3RD4 A;  2VNU D;  2KVM A;  5EBD A;  4RA8 A;  2R92 B;  2OXP A;  1TII D;  1I50 B;  3VR5 A;  3TP5 A;  1SYC A;  2SNM A;  5EKL A;  2SOB A;  3P1H A;  1RKN A;  5CV9 A;  5M5W B;  4K8J A;  3SEB A;  3I73 A;  1BQQ T;  2HCC A;  5C4J B;  3FRP B;  3NQI A;  4FXG C;  1Q12 A;  4OGQ C;  1OO9 B;  4FF2 A;  3E5S A;  2B2Y C;  2KJX A;  3H6M A;  1CHP D;  1V1P B;  1RCV D;  1RDP D;  4NKL A;  1XTC D;  4XQQ A;  2F4I A;  1QB5 D;  4XQJ A;  4OIK A;  5LHY 1;  2BE5 D;  3MZ5 A;  3W3A A;  4XXE A;  1NSN S;  2X6L A;  5C0X J;  3M4Y A;  1CQV A;  1FD7 D;  1F9Q A;  1ICW A;  3S15 B;  1BBX C;  5A2Q E;  1G91 A;  4KHZ A;  4KN4 C;  2WP8 J;  4RHR A;  1I4P A;  3I3C A;  4N9T A;  3VA7 A;  1JR0 D;  3P7J A;  2A68 D;  2KEE A;  5IGG A;  1HTP A;  3QJY A;  1PTO C;  2EYJ A;  4KKU A;  3HOV B;  1IL8 A;  1ZXT A;  4XQN A;  1S5C D;  2R61 A;  4K6L A;  1EY0 A;  5EGT A;  1TS3 A;  4HSV A;  1D2B A;  1PLF A;  2EYO A;  4KY6 A;  3MWY W;  5E4X A;  1U4L A;  1EEI D;  2DNE A;  1WTR A;  2LY7 A;  3BS1 A;  4G4K A;  4BBR B;  2TMP A;  2IT1 A;  1HHV A;  5CBE E;  2XVS A;  2ZT9 C;  1XXG A;  1KAA A;  4FF3 A;  3J7A V;  3KBG A;  5C3X A;  2E2D C;  5CV4 A;  1OXU A;  1WD0 A;  2WV6 D;  4IUQ A;  3HOZ B;  4DK1 A;  2QEJ C;  1EZ6 A;  1FNV A;  2QCP X;  1STA A;  2EJF C;  2L5T A;  4KD4 A;  1HFG A;  2K28 A;  4QF4 A;  2EY6 A;  5FO8 B;  3NWS A;  1STN A;  5C0X H;  1V43 A;  2NN6 H;  4I7Z C;  5C0X G;  3C1F A;  3KF8 A;  4HSP A;  2NN6 G;  5JPM C;  1TWH B;  1LTA D;  2V4D A;  3K59 A;  2B2W A;  3NTK A;  2KUM A;  3MHB A;  3TZD A;  1EL0 A;  1L0Y B;  4EQO A;  4WRD A;  2F0D A;  4PMB A;  1PRT F;  1F9P A;  1F9S A;  2QIL A;  2SEB D;  4OO1 I;  1F2Z A;  1SAP A;  1OXX K;  3QOL A;  4KV6 A;  4HMJ A;  4BWG B;  1PFM A;  4C56 C;  1ML0 D;  4KHV A;  2L12 A;  1TS4 A;  1D1K A;  1EYA A;  2I07 B;  3LWU A;  3C46 A;  1PRT D;  1B44 D;  5JAV A;  3MXU A;  3RZO B;  2F0J A;  3WOF A;  3W2D A;  1G2T A;  1STY A;  1EIG A;  2GA4 B;  1HQR D;  1BCP C;  5EQ0 A;  3OW7 A;  4J1M A;  1Q90 A;  3CRK C;  4WFN 3;  4A3D B;  1EYD A;  1I6V C;  3EA6 A;  2PNR C;  2NUC A;  1WD1 A;  2JP1 A;  3OIQ A;  4PQX A;  1AEX A;  4HCS A;  1EWC A;  3SK4 A;  3GTP B;  1GUT A;  3IFT A;  2MP1 A;  4PMW A;  1M8A A;  3UI2 A;  1HTL D;  2NTS A;  2F0E A;  5COY A;  1DD2 A;  3I70 A;  1O78 A;  3VR3 A;  4X3T A;  5NUC A;  2B8G A;  4EQN A;  2F3W A;  4ZKB B;  2ZXR A;  5IT9 L;  1Y1V B;  1JOQ A;  2R7Z B;  4BY1 B;  4XYO A;  1LTS D;  5C4X B;  1B3A A;  2DN8 A;  3BVZ A;  1CFM A;  4QIW B;  1LAC A;  1STH A;  1V1O A;  3GV3 A;  3Q23 A;  3ND9 A;  1RTO A;  3I91 A;  1BOS A;  4B08 A;  1B4O A;  4Q5V A;  4FYD A;  2F0H A;  5ELD A;  1KLU D;  2E76 C;  5IGF A;  3S1Q B;  3D8G A;  1HUM A;  3J80 L;  4IUR A;  1MSH A;  4HAE A;  4BBS B;  2EJM A;  3NQT A;  1BUV T;  1SYD A;  5ISR A;  3GTJ B;  2XRS D;  1SMY C;  5KYI A;  2WB1 B;  5DEH A;  3T51 B;  3TME A;  2OT2 A;  3U9O A;  1V8Q A;  3NP8 A;  5M5Y B;  1PYW D;  4CJ0 B;  1H9S A;  1PDQ A;  4X3K A;  1ET9 A;  4UAI A;  3N6R A;  2B39 A;  1A15 A;  3FDT A;  4RAU C;  3J81 L;  3NTI A;  5BN5 A;  4R8I A;  3ERO A;  5EKK A;  2EXZ A;  3D4W A;  4ZQ3 A;  3S2D B;  2A69 C;  2NVY B;  2L55 A;  4DAY A;  2I46 A;  4K2K A;  1JOK A;  3PO3 B;  4FF4 A;  1O7Y A;  1CI3 M;  1JC7 A;  3TBI B;  4E6I A;  3PUV A;  1E2V A;  1PRT B;  3OMC A;  3NSW A;  3GTG B;  4LAA A;  2F0O A;  1I6H B;  1H9R A;  3FVQ A;  1SE3 A;  3TSS A;  3T53 B;  1TVX A;  1GOZ A;  1FNW A;  1G29 1;  3K5L A;  4RKL A;  1SNC A;  2CQA A;  4K6D A;  3KK7 A;  4MN3 A;  3H0G B;  1QNU A;  2PZU A;  3NE5 B;  2HDL A;  2L11 A;  1PFB A;  5IOC A;  1ESF A;  1I4G A;  3SK8 A;  3LNN A;  3MC0 B;  3D6C A;  4CJ1 B;  5EPJ A;  1O7L A;  5DM6 3;  1JIC A;  1WCM B;  4ODG A;  3HRZ C;  4DU9 A;  1ENA A;  4NMZ A;  3AMU A;  3BZD B;  2EYH A;  5CMD A;  1SBB B;  2ID0 A;  1LT4 D;  3MTS A;  3M85 A;  2NB0 A;  3SXH A;  3DEO A;  4IFD J;  1ET6 A;  3N52 A;  3C3L A;  3GD7 A;  2K5Q A;  3TP8 A;  4MIU A;  3PUX A;  3U9S A;  2TSS A;  3I4L A;  4FP5 D;  3BYT B;  4JBW A;  4LK1 C;  4KTA A;  2E74 C;  4G7O C;  1A3V A;  1Y8P B;  4ULL A;  3DWA A;  4DXF A;  4IZ8 A;  1IW7 D;  2F0G A;  1SJE D;  2O2L D;  5CC4 A;  3X3N A;  1H9M A;  3A8J E;  1SFO B;  1B2T A;  3DM1 A;  1PZJ D;  3MEH A;  1D6E C;  3QIA A;  1VCI A;  1CZW A;  1L0X B;  4CGY B;  1GXD C;  4RCN A;  1AW7 A;  2EYL A;  2D5D A;  5C4H A;  3DWQ A;  3T4A C;  2O4X A;  5I6Y A;  1K8O A;  4PMC A;  4WOR A;  4Y7N B;  1WTO A;  3GTQ B;  3QB3 A;  1DYQ A;  2Y0S B;  1SE2 A;  1WTV A;  5BN4 A;  4CBV A;  4HCE A;  1XX8 A;  2HDM A;  4R8N A;  1A6X A;  3L3O C;  5D3D A;  4P2C B;  3TP6 A;  1PZK D;  1PTO F;  3DXJ C;  3KBX A;  1EY5 A;  4F87 A;  1HXY D;  3S16 B;  4RFB A;  4TRD A;  1WTX A;  3MXN A;  2K5D A;  1PMR A;  1XYI A;  1ZKO A;  3S1R B;  3VR4 A;  1LTI D;  3OIP A;  1EOT A;  2WAC A;  2MHV A;  5M3M B;  3URY A;  5F2D A;  2L0C A;  4WJW A;  3OWE B;  4C1N K;  4A3F B;  2CW0 D;  4FXK C;  5C44 B;  2LFN A;  1LT3 D;  3ND8 A;  5HGT A;  5IGB A;  2B2V C;  3KUP A;  2FMC A;  5I9P A;  1JE4 A;  4MHE A;  1HA5 A;  1U9R A;  1WVL A;  5DNF A;  3PUW A;  1QWY A;  2J7Z A;  4U68 A;  3DEP A;  1QOH A;  1J9O A;  1EZ8 A;  2HQE A;  3OHX C;  1BO0 A;  1H9S B;  3RMH A;  2ICI A;  1VF5 C;  4IFD H;  3QO2 A;  2B2U A;  5EBC A;  3K7A B;  4IFD G;  1IHZ A;  4XTC S;  3GTL B;  3Q6S A;  4C3H G;  3MA2 B;  5J39 A;  4DF7 A;  2F0P A;  5D65 A;  1YNJ D;  2E2J B;  1D5Z C;  5M9O A;  2NVQ B;  1DXM A;  2OEO A;  2X69 A;  2VB3 X;  3BG3 A;  5FK9 C;  1H9J A;  2IX3 A;  3J7A F;  5I4D A;  4RKB A;  2K5W A;  1LAB A;  5M5X B;  3OSO A;  3H94 A;  2Q8T A;  4KMU C;  1B53 A;  2CVR A;  1NR4 A;  1I4Q A;  4NP5 A;  2EZV A;  4KN7 C;  1G8Z D;  1SYG A;  4A3M B;  1S5B D;  2F0S A;  4EVO A;  2NZ1 D;  2ZXP A;  1YNN D;  3A7A B;  3NK9 A;  2BA0 A;  3H91 A;  4F8M A;  1F2L A;  1B50 A;  2ZXO A;  2PZW A;  5CBA E;  3MAQ A;  2M00 A;  5KGU A;  4G7H C;  4DFA A;  1SYF A;  3VA5 A;  3S1M B;  1II3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...