2VB2X

Crystal structure of cu(i)cusf
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
75
structure length
75
Chain Sequence
PQVISATGVVKGIDLESKKITIHHDPIAAVNWPEMTMRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATION EFFLUX SYSTEM PROTEIN CUSF
publication title Cu(I) Recognition Via Cation-Pi and Methionine Interactions in Cusf.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal transport
total genus 14
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2007-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF11604 CusF_Ec Copper binding periplasmic protein CusF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.320 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2vb2X01
1ZEQX 3E6ZX 2L55A 2VB2X 2QCPX 3TDQA 2VB3X
chains in the Genus database with same CATH superfamily
4MTKA 1C4QA 2DY8A 1DGSA 3KFUA 1STNA 2J7ZA 1Q7YC 4AYBB 3GTQB 3H3VC 3I55A 2GN5A 3NQTA 1TY2A 5IGCA 1EY8A 3J81L 3CQZH 5C5MA 4Y52H 1NBWA 1JOOA 2K4KA 1G6PA 4NXNL 5J22A 1A63A 2QEXA 3I70A 4CDCC 1PLFA 1Q1BA 2KCNA 5HGQA 2FMMA 4X62L 4L5QA 5C3WA 1E1TA 3CCMA 3G6EA 2B2VA 4LF5L 2UUAL 3K5NA 4A3DB 4ZYSA 1NMFA 4IO9A 3S16H 1PFSA 2KA7A 5CV9A 4NMZA 4E6IA 2DNEA 3QB3A 1N36L 3HZXA 3L7ZC 2IWHA 2OF1A 3D0FA 4FXGC 4G7OC 3KLWA 1EL0A 1VQAA 4JYAQ 2PI2A 3M4YA 1PH8A 4PZ7A 1PTOF 1SBBB 3T1HQ 5IYDH 4LF7L 4DR6L 1ONLA 1EIGA 4LF9L 3KBXA 2K75A 3PO3H 1SSOA 3KJOA 3K58A 1VMPA 2EOTA 3GV3A 3QOLA 4CDEC 3D4WA 4GNXA 3SXHA 2VQEQ 2DN8A 2N3SA 2F0GA 4C3HB 4IJLA 2D0PA 1OXVA 3S1NB 1XPOA 1LM0A 3ND8A 4K0KQ 2R61A 1RDPD 2B63G 2AHOB 3QOJA 1V1QA 3CMEA 1TWGB 2OTLA 3HOVH 1XPRA 3OTOQ 3PO2G 3MA2B 1PZKD 1NTGA 2LKVA 5CV8A 1TVXA 4IALA 5JPMC 3TS0A 3BZKA 3EVQA 5D3DA 3CD6A 1QZHA 1FJGQ 4IUPA 2L5TA 2L55A 4IUQA 4AH6A 1GO3E 5IYCH 4DV4Q 3RLOA 1GUTA 4QF4A 5NUCA 3BYTB 1XMQQ 2AUJD 2EYMA 4KV6A 1FNVA 1A6XA 1FL0A 1NR2A 1PMRA 4YWKA 4ZK9B 5KIXA 1S3OA 1F2MA 1RD9D 2Y0SE 1HTPA 1AE3A 3A54A 3GTPB 1Y1VB 5CV4A 1BBUA 4IUUA 3CCJA 4DV3Q 3VYSA 1NMGA 4Q5VA 5JVG3 1IZ6A 4DKAC 1YJNA 1M4VA 3PV0A 2GVBA 5IT9c 3AYHB 4TVAB 3EROA 2FJ2A 4NB3A 1C8CA 2Z6KA 3K59A 2NYZD 1OXSC 1LACA 4PQXA 1ICFB 5IE8A 1Y69U 3LWEA 5ELDA 2CKZB 1VQIA 4IUNA 3GTOH 3LNNA 2JA5H 1RCVD 4A76A 1EWCA 1HZBA 1QZGA 1HNZQ 4JYAL 4KHVA 1HHVA 1ML0D 3HOZH 3J81c 4HSPA 2K33A 2P5ZX 5IT9E 3H3VH 4OO1G 4J15A 5EKIA 3T1HL 1LV9A 2EYJA 3G71A 5JPNC 1F9QA 2LY7A 2K1BA 1HR0Q 5DNFA 3K81C 2B2UA 1K73C 1AFPA 3GTJB 3DMUA 4EQOA 2HIXA 1QJOA 5D65A 2PQEA 1LT3D 2Z8LA 1RODA 4UAIA 1GHKA 3HKZE 2E2JH 1KDBA 1S40A 2PYKA 2VQEL 3J81E 3EN2A 4X3KA 2A6ED 2ES2A 4RKLA 1TWAH 3Q24A 2MJ8A 1L2FA 4IPGA 4A3CG 1LTTD 4K0KL 1W6KA 1D5ZC 2F4IA 5T1GA 1HRJA 3A8KE 4A3GG 1N8RC 3BYYB 3KF6B 3NPPA 4AYBG 4K8IA 2JA8H 3OTOL 2EYPA 3T16A 4BBRH 1CK1A 1U4PA 4GN4B 1WTWA 3PF5A 4HMJA 3I56A 2JA7G 4YWLA 4ZUJA 4DV4L 1MJEA 1XMQL 4N8FA 2EYLA 1IKLA 3T13A 5BN3A 1D8LA 4I7AA 4A3JG 2CW0C 1MBYA 4LW1A 2FFKB 3J81i 1YIJA 5A2QL 1XX8A 3ICEA 3EFXD 4B3SQ 1GHJA 3G48A 4DV3L 1FD7D 4IURA 2OXPA 2WB1E 3KDFA 4H44C 1GUSA 1TT2A 2B29A 4EVOA 1PRTC 3CCEA 2F4VQ 1O7LA 2F3WA 1JORA 1H9SB 2KOLA 2K52A 3NBHB 2YTXA 1NY4A 2UUCQ 1SAPA 2C5CA 1WTQA 1FGUA 3SDZA 1M1KC 4HJ5A 2D5DA 5CR3A 1X56A 1M90C 4IFDH 3H0GB 1YJWA 4JVZA 4KKUA 3ER0A 1HNZL 1ZYRC 3NBIA 4OX9Q 3VR6A 3U58A 2B63H 4JC0A 1TY0A 2EE1A 2VZAA 5C0XG 1Q81C 3HOVB 1SFOH 1BUVT 4IOCA 1HR0L 3NSWA 3M4OH 4CJ1B 2WKDA 1A3TA 3RZDB 1AE2A 3STBD 4FF3A 3J7YW 4DXFA 2XVSA 4A3EH 3VR5A 3ONAB 1HFGA 1HH2P 2PCFB 3HOYG 1BVSA 4DNIA 1OTCA 2X69A 3BVZA 1N9WA 1F77A 2F3VA 5C4XG 1IBKQ 3GTLB 2OQ0A 4IUTA 1CQVA 1WTPA 1ENFA 1VQPA 1UWVA 1G2SA 4C1NK 2DGYA 5DEHA 3ND9A 2L1BA 3B6YA 3RN5A 2JJQA 1K83H 3Q0AA 1EY0A 4DV5Q 4A3KB 4XTCS 1P8LA 4DAYB 1A0IA 2LXKA 1KRTA 2Q2UA 1BOSA 1MHWC 1ENAA 4KD3A 4AYBE 4P74A 4L5SA 2VY3A 5E4WC 3K5MA 1ENCA 1PFNA 3M7GA 4C2MH 3DWPA 3OYYA 3CF5A 1Q3LA 4NXMQ 1XPUA 2F0EA 1Q8IA 3GTOB 4RHRA 3N52A 4YHHQ 5I9PA 2L15A 3QG1A 1J6QA 2K01A 5IWAQ 2JA5B 4KN4C 1LT5D 4B3SL 2NWGA 4LFAQ 1BQQT 2RSNA 2YU9H 3CRLC 3SE0A 5A35A 2Z1CA 5J39A 1GKHA 1SYFA 3Q8DA 4CHTB 4ID6A 4X64Q 2F4VL 2CFMA 4JI8Q 4WORA 3P75A 4G57A 1HCZA 2RCFA 2UXBQ 2UUCL 2K5VA 2K14A 3TZDA 1F9RA 3GD7A 2UXDQ 1D7QA 3C1FA 4B3MQ 4A3CH 3SHLA 4DK3C 1YNJD 1RL2A 1D5MC 3G7LA 4XXEA 4L5RC 4OX9L 2KUMA 1JICA 1LT4D 1HZCA 2FHTA 4H02A 3T53B 4QUCA 4A3GH 4A3LG 3GTQH 1J5EQ 1RTNA 5EBDA 4A3IB 3PIOA 4UPAA 1KHIA 1XYIA 1WOCA 2ZTEA 3UE1A 1SYDA 1U4LA 3E0JA 2JXMB 2MO1A 5ELOA 3EJIA 5G3LD 3H94A 1C9OA 1YNNC 1IBKL 1K28A 1AZPA 4P73A 2EYOA 1KDAA 3D6WA 5A2QE 2EVBA 1V1PB 4DV2Q 3KF8B 3H3VI 2F0OA 5FJ8G 1PFBA 1RTOA 1EY5A 1KAWA 3F2UA 4IN3A 2B2YC 4QMGA 4DV5L 4BY7G 3PMFA 3TREA 2E2IB 3J80L 5EJWA 2K5DA 1ET9A 3S14H 1PA6A 4DAMA 4RCOA 1CT1D 1QB5D 1JWMD 5KNBA 1QUQA 2VW9A 4WFN3 1EZ8A 4JI1Q 4RG1A 1PYBA 2ASBA 1Z6HA 3FEWX 4K6DA 4NXML 3HRZC 2H4OA 5DM73 4U68A 5IP9G 1EYAA 4YHHL 2CQAA 1OXTA 5IWAL 3D4RA 4HIOA 3TRZA 2NVYB 4NDXA 1HZAA 4F7XA 1VF7A 2N55A 3Q22A 4LFAL 1SMYC 2WAQG 1L1OC 4HEDA 1KD1C 1TQOA 1WTHA 1AP0A 1SFOB 3PO2B 2X6LA 5FLXL 2ALYB 2VB2X 4P72A 2ZJPA 3IL8A 1WI5A 2MO0A 3S1NH 4DK1A 4YCUA 4X64L 3UDIA 2KQ3A 3HOYH 4DGZA 4JI8L 3CCSA 1JMCA 2PPBC 1ILQA 3IFDA 4LFCQ 1B1ZA 1K3BC 3NXWA 4JG2A 5JJIA 2UXBL 3S1MB 1TWGH 1IXRA 3S9WA 5I9OA 3FP9A 1E3PA 2UXDL 3SK4A 4B3ML 4N9PA 1VQGA 1SLJA 1TWHH 4BY1G 2Q2TA 1VQEA 2KHSA 3GQBA 1LTRD 2HDMA 3BDCA 2M2LA 4GLAC 4YCVA 1QVGA 3DLLA 5CBAE 1STEA 1J5EL 1YZ6A 3J7AV 2DUDA 4YWMA 4X65Q 2RDGA 4GLXA 1TS2A 1BCPF 1VQBA 4N8X1 1CA5A 4DAVA 2QW7A 3I8ZA 2JE6I 3GTPH 2EY1A 1Y1VH 2VQFQ 2E2HB 3CU7A 5ELEA 5IYBG 1X3QA 4C3IG 1PH3A 1W2BA 4HTHA 2PZTA 4IFDI 1IBMQ 4ME3A 4UY8C 3PIP3 2JQOA 4H7BA 2JSOA 4DF7A 2ZXRA 4DV2L 5CYUA 5KNCA 3GTGB 1F9PA 1R4PB 1RF2D 2SEBD 1KTKA 2K03A 3KLRA 2D2CC 2VNUD 1O7YA 5I6YA 2KHJA 1G2TA 2A69C 1G51A 2HCIA 1UEBA 2IL8A 2A6HD 4U673 2A1AA 1AEXA 1STAA 2XGTA 1EU3A 3F1ZA 3CHBD 4JI1L 4A3MB 5BN4A 3CCLA 2IW3A 4K2LA 1F9SA 2XRSD 3SK6A 3TS2A 1G91A 1I6VC 3NEMA 3GTJH 2JA6G 4IUVA 2VUMG 1QWYA 5IODA 2K5NA 2K7VA 1GVPA 2HHHQ 4A3GB 4XQNA 3I4NG 1OXUA 2I5MX 4OWXB 4A3LH 1AN8A 1XXGA 1FGBD 4DUYQ 1STBA 3CXCA 1A8VA 1EFID 4MNOA 5ELNA 2JA7B 3MXNA 4RA8A 4DV1Q 2O5JC 1PDQA 4LFCL 3BG3A 1IL8A 2Z9HA 4BXXH 1PYSB 1PRTB 1CI3M 1NSNS 2IHFA 5IP7G 4A3JB 4A3IG 4HJ8A 1PH9A 2BDNA 1JWSD 3P7JA 3I90A 5C3EB 3WWVA 1VQ8A 1PTOC 2DJGC 3ITPA 3T4AC 1AZQA 3HS0C 2NVTB 4KY6A 2PNRC 2O2LD 4AIMA 3UDGA 2NZOA 2ZXOA 4RFBA 4IFDJ 5GAHC 2PO4A 4ABNA 1ICWA 3S14B 5IGFA 1CZGA 4X65L 3TDQA 4MIUA 3S17H 1J8IA 1VQKA 1B2TA 1CKNB 2VQFL 1T5XD 3C1EA 5GADC 4DPGA 3A8IE 1IBML 4JI6Q 3DEOA 1WD1A 5IP9H 2A74C 4MZ9A 5M3MG 2A68D 1Z9FA 2I5HA 2IT1A 1GD7A 4JI2Q 1VQFA 4OGQC 1SYBA 3E6ZX 3M4QA 4R4IA 2R7FA 3NWTA 2EJGC 2JA9A 5FLXE 1NE3A 1HA5A 3D31A 4EGVA 1ZEQX 3BS1A 3Q23A 1KNEA 5C6AA 2F0FA 3G6JB 3NTIA 3PF4A 3C3LA 1H9KA 4B08A 1LYLA 4KHPQ 3H0GH 1D2BA 2KCCA 4LAAA 3HOYB 4X3UA 3JC66 2PW7A 2NZHA 1A2UA 5C4XB 4BWGB 4PMWA 3WOEA 3CAMA 1KL9A 5C44G 4R4CA 3O13A 4BS9A 5IOCA 2KVMA 2FMCA 3S2HB 3RZDH 3BZDB 1PH7A 1CFMA 3VR3A 1TWHB 2PQAA 1L0YB 1H9JA 2YYZA 2HHHL 1SE4A 4R8IA 3GTLH 5KYLA 4DUYL 4R1JA 2NTTA 1Q46A 1HXYD 1MKHA 1SROA 3NP8A 1E2WA 2B2VC 3IRBA 5HURA 4UDUC 2H1EA 4DR3Q 1VQOA 4TKOB 4ZAIA 3GDEA 4DV1L 1DOMA 2N88A 4X3TA 5DAUA 2IX3A 4C3IH 4A3KH 1ZXTA 1EQTA 1WYDA 1I4PA 1PH5A 4EX5A 1QG7A 3K8AA 1K8OA 2QF7A 4GOPA 1SDFA 1K8MA 2Q8IB 2NN6G 4A93G 5M5YH 1PHJA 3S15B 3L9AX 1LT6D 4OIKA 4PMBA 1PZID 1IYJB 4XT1B 1EOTA 3DWAA 2C35B 3OIQA 2WIIB 1TU2B 2BE5C 3FKIG 1CKMA 1SJHD 1PV4A 3MVVA 1U9RA 2ENBA 2F0LA 3CCVA 4ZUIA 3E0EA 2UXCQ 2F0QA 3AQQA 5LL6X 1IBLQ 4HIMA 2OWOA 1JJGA 1Y8PB 1K0SA 1Q86C 1L0XB 2K28A 2LXJA 4ZRZA 3D6CA 1VS0A 2KEEA 1CM9A 1HPCA 1F2YA 4JCVE 5CV5A 3EIVA 4FVMA 4HAEA 2K50A 2JA6H 4OXPA 4JI2L 1VF5C 3TN2A 3MHBA 3UI2A 1G8ZD 2NBFA 4Z9CB 3I4NH 4KKTA 1FNUA 3FVQA 5EPLA 4A3MG 3GO5A 2PMZB 2Z4HA 4YY3Q 2F0JA 1VQHA 4DFAA 4HR7B 4OWTB 2X6GA 4KHPL 1XWEA 2SNSA 1PTOH 1U4RA 4RGNA 1PXUA 3URYA 2KCTA 1EY4A 3CP0A 2WV6D 2MGSA 1X55A 4K6LA 5JOBA 3VR4A 1HJPA 5FK9C 1SNCA 4OL7A 3MFGA 4QIWB 3M7NA 5IP7H 2RBMA 4DN4M 4GS3A 4A3IH 1X9NA 2MPMA 5M5XB 1M8AA 5CMDA 2F3IA 1FJGL 1I6HB 2F0SA 2NTSA 5C5LA 1KAAA 4BY7B 3QJYA 1N33Q 2K05A 3U4ZA 1SYGA 4MHEA 4CKBA 1U0LA 3S17B 3PUWA 4DR3L 5C3EG 1L1OB 3RMHA 2Z6KC 3JAML 1JE4A 4UP7A 5I4DA 5HGTA 3SVMA 1B8AA 5KNDA 3CCUA 4WJ4A 2E2IH 3VYRA 5JEAJ 4ALPA 1W6JA 4RMFA 5LMNQ 4O2DA 1SEBD 1KLGD 2F0VA 2XIWA 3KLSX 2WAQB 3MFYA 4B3RQ 4WJ3M 1PFMA 4GKJQ 3WDNA 3FPUB 1E2VA 4J6HA 2ATWA 2NVQH 2UXCL 2IPKD 5ISRA 2CWPA 1B3AA 2NVYH 3J7ZC 4HJ7A 1IBLL 1JJCB 3CMAA 5D14A 3PSIA 3ZYYX 1E7ZA 2L0CA 5AFWA 3PO2H 2CW0D 3IFTA 2E8GA 4DR2Q 4P75A 1DD2A 4N9TA 2BOSA 1O78A 4IPCA 1ESRA 1JOQA 3PQIA 4IPDA 4BY1B 4IPHA 5JJZA 3I73A 4JV5Q 4APVA 3C46A 1FNWA 2MP1A 2XWJB 3S1MH 2K32A 4DU9A 2E5LQ 4LUVA 3MEHA 2K5HA 4UP8A 4YY3L 2KECA 3OWFA 1Y1WG 3KJPA 3U4VA 5FLMG 4ZKCB 1PH4A 1Z7TA 4ILWA 3VDYA 1IW7C 4C3IB 4KY7A 4K5VA 3J81j 2AQ1B 2ZT9C 1SE2A 2F0MA 3AFPA 4LF6Q 1EZ6A 2EQSA 2V4DA 2H5XA 2NB0A 5M5YB 2YV5A 2XTIA 3PUVA 1DONA 1ZYRD 2YTYA 4ZQ3A 1GUWA 5FO9B 3NE5B 2F52A 2ZTCA 4XDXA 2E2HH 1JCKB 1DZ1A 2HT1A 1N33L 4FF1A 1JJ2A 1V1OA 5IY0A 4LWCA 4LFBQ 1HUNA 5CV6A 1SNPA 1BXTA 5EKLA 3F2BA 4FP5D 4C56C 1HA6A 4KJNA 5M9OA 5K5PA 3GTGH 1EY6A 4PV1C 1CQFA 2G9HD 1ZKOA 4OO1H 2OT2A 1VMCA 4GZYC 1JOKA 4OELB 4ME5A 1EIHA 3NWSA 4DR4Q 1FR3A 4R4TA 1D6EC 1B9MA 3C2PA 3KF6A 4H0LC 1LO5D 5KRUA 1BKBA 2JA6B 2MQHA 2XWBB 5LMNL 1GOZA 2D9UA 4C3JB 3CC7A 2VUMB 3T51B 2B2WA 1VDZA 2I5LX 4S3SA 1MGSA 3I4NB 4GKKQ 1C7YA 3HOWG 1B9NA 4A3MH 4B3RL 1BBXC 4GKJL 5FO8B 3TBIB 2WKCA 3GTMB 1EEFD 1PTOB 1Q8KA 3A5UA 1EY9A 4RH6A 3HOUB 4GLVB 1CHPD 3A7AB 3BZCA 4KN7C 2EIFA 4LJZC 1H9MA 1VQLA 4I7ZC 2RA4A 4QL5A 3MXGA 5IGGA 3BDOA 3ZJYC 1HZ9A 1STHA 1ILPA 1KQSA 4RGOS 1L0WA 4NKLA 1QVFA 1WTOA 4JBMA 3BU2A 5G3LF 2DJFC 5I2XA 2D0OA 4DR2L 3ULPA 1SNOA 3NUCA 4A3FG 1LTGD 3F8TA 2RHSB 1P16A 2M00A 4ZCKA 2EZVA 2JA7H 2OQKA 1HR0W 4G7HC 4JK1C 4A3BG 1H9SA 4L6TB 1N34Q 3I4LA 4JV5L 4OWWB 3NBHA 2AKWB 4CBVA 4A3JH 2E5LL 4CDDC 4IOAA 3PGZA 5D3IB 1X3FA 2NVXH 4JBKA 1S5ED 2CVRA 4QCLA 2NUCA 5C3EH 2Z0SA 3A5ZB 3RUZA 1LTID 3CW2C 2NVTH 1D5XC 2IHEA 3H09A 3DHQA 4BA1I 5IIFA 3EQLC 4LF6L 1IYVA 3CPFA 3PUYA 5M3MB 2F1MA 1JB3A 5FO7B 3M3YB 2ICEC 1QNUA 4EQNA 2F03A 3V96A 1YEZA 1VQCA 4IQZA 2F0DA 4XYQA 1BNZA 5JJLA 4LFBL 1KIXA 4WJWA 1A62A 3IAYA 2NVQB 3R2TA 2F0KA 2L4NA 3OIPA 2QILA 2AQ2B 3CC4A 2BH2A 3QO2A 2R92B 3OMCA 5EKKA 5LHY1 3MC0B 2L11A 2IY5B 1YNND 5C0XH 5C44B 3BJUA 4J1MA 2WACA 4DR4L 3MZ5A 2JK8A 1LABA 4DAYA 3CRKC 1MIUA 5CV7A 3V2TA 3CCQA 4B3TQ 1CUKA 2ICIA 5C4XH 2EY5A 4GKKL 3DM3A 4R4OA 3MTSA 4NPSA 1I4XA 2C9OA 3PUXA 2MFIA 5TSSA 4K14A 3S2HH 1Y1WH 4I65A 1KXLA 1BCPC 1XTDA 1SJED 4X66Q 2BH8A 1TR5A 3FPPA 5I6WA 4DUZQ 1YHQA 1PH2A 1MSGA 1CTMA 1WVLA 2B8GA 3FRPB 1BF4A 3AFQA 3M85A 3G4SA 1RHPA 2RVLA 1LLRD 4A93B 1HNXQ 2G9DA 1LTLA 1V9PA 4KTAA 2AUKA 1Q90A 4GNXB 1SMYD 2WB1B 1N34L 3FKIB 2TSSA 1YHAA 4DK0A 1S5BD 3DM1A 2HQEA 3P20A 1F2LA 2KCMA 2MUYA 1RIPA 1WD0A 3S15H 2WINB 2WP8J 4JOIC 4RCNA 4JI4Q 3W3AA 3RZOB 4PZ6A 1TKWB 3M9BA 5M3FB 3VA5A 3U9OA 2RCNA 3D3RA 1HQRD 1U4MA 2E75C 3RD4A 4DA2A 3SK8A 3I4MG 2FINB 3IKJA 1TWFH 5HY6A 2EPBA 2R7ZB 1UE5A 3L2PA 1XJVA 2CCZA 2L9HA 4V190 2ID0A 4O0AA 2VXWA 4X6AH 1NCVA 1V43A 3FHWA 2QCPX 1I3QH 4C3JG 4B9WA 2O4XA 1V1PA 3KF8A 1VQ6A 3HOZG 3RR5A 4DK6C 3CC2A 4FF2A 5IT9L 1X3EA 2NZ1D 2WAQE 4JI5Q 3J80c 3ULJA 5E7NA 4A3FH 1X54A 1VQDA 4QUFA 3HOUG 5LL6S 4HJ9A 2PNHA 2Q8TA 5J1ZA 3I3CA 4B3TL 2R6GA 2B2TC 1I5FA 1RKNA 4A3BH 2PZUA 4KD4A 4FNFA 4L63B 5JAVA 2QA4A 1DOLA 2A69D 3TP7A 2IX0A 5KYIA 5E4XA 2EY2A 3NTKA 1C0AA 2KHIA 2Y0SG 2NVXB 4OO1I 5M5XH 3TMEA 4CJ2C 2F0WA 4L5TA 4X66L 4QJFA 5FJ8H 1WTVA 1I6HH 4DUZL 2A68C 3UE0A 3J80E 4BY7H 4QY7A 3H15A 4LUOA 4DR5Q 1YNXA 2JA8G 3VYUA 5EGTA 1HNXL 5FLXc 1T9HA 4NP5A 2AWNA 4BBRG 1B70B 3GV6A 2GVAA 1S5FD 4HIKA 1VQ4A 2QKIC 4IJHA 1JQYD 1GXDC 3K5LA 2F0TA 2Q2IA 3OMGA 2HCCA 1I4RA 4FO2A 2ZXPA 4KK7A 3SGIA 2VB3X 1SNMA 4KLKA 4JI4L 2B3GA 3J7AF 5C4JB 1EQQA 4Y7NH 4FF4A 3J80i 3S1RB 1I4QA 1SNQA 1K8AC 3BDLA 3TP5A 4DR7Q 4JPBW 1VQ9A 1PTOD 5JJKA 2YTVA 3HKZG 2R92G 1RJTA 3EBEA 4ZKBB 1EWHA 5DM63 3HEJA 1BBWA 2RF4A 3H6MA 3TEHB 4K5XA 2ZJQA 4FXKC 1Y1WB 1DYQA 2PW5A 1ET6A 3ERQA 4HCEA 2UUBQ 4BBSB 2J0TD 2V1CC 2BA1A 3S2DB 5EPJA 4IFDG 5K36G 3AB9A 4BY1H 2RDFA 4XYOA 3PIPA 4XIGS 3FMCA 3KDFB 4FDBA 5IGDA 3S1QH 3V05A 2R93G 3KK7A 3L0OA 3W1BA 1QOHA 3OSOA 3E5SA 4JI5L 1TWCB 1ASZA 1OXXK 2K5WA 3K6OA 4H13C 1KC8C 1WCMB 3RLNA 2Q8RE 4LMQD 3AMUA 4M8AA 4J8QA 3PCOB 4A4IA 4A3EG 2VL6A 4G4KA 5IYBH 1NJIC 1EIYB 1J9OA 3A56A 3UDXA 4JI3Q 1I50H 5IGBA 1C48A 1S4ZA 4O42A 1PH1A 5C0XI 2ZM6Q 3QIAA 2O5IC 1SN8A 1BDOA 3KYHC 1JE5A 4EQPA 2WB1G 3OW7A 1FVIA 1KDCA 3U9SA 3OPOA 1EEID 3HOXB 4DR5L 1TIID 2B39A 3LGJA 1EQVA 4F88A 3I2ZA 2A6EC 1NNXA 3I4MH 1TWFB 2GA4B 3BVMA 4DR1Q 4P2CB 3I72A 2CH4A 3HOWB 4GNXC 2JP1A 2RDHA 5M3FG 5ELBA 4P71A 4JI6L 4OHJA 4DNRB 1QNKA 5GAEC 1STYA 1I3QB 4PNYA 3HG9A 1A2TA 5E3FA 3MAQA 1MI2A 1F2ZA 2KENA 2VUMH 4C3JH 2AQ3B 3D4DA 3E9IA 2R7ZG 1AW7A 4TRDA 3NK9A 3NENA 1U5KA 4HSVA 2ZTDA 3SEBA 4R9WA 1SNDA 3GTKH 2Q2HA 1XNRQ 2WFWA 1WJJA 2OEOA 5H1SE 3I4OA 4DV7Q 4K8JA 3RNUA 4A3FB 1B44D 4DR7L 3GTMH 3T56B 3DUZA 1S5CD 1PVOA 3HOUH 1B4OA 5BR8Q 3KLSA 4CGYB 2XSCA 3VR2A 1E22A 5CC4A 4KI0A 4A3BB 1BR9A 2BE5D 1CKNA 2IJ0A 2JEAI 2OTJA 4R4QA 5EBCA 1A3VA 5E1FA 5M5WH 2EYHA 2LFNA 2KJXA 4JI0Q 4K5WA 3CQZB 2UUBL 1LTAD 3A0JA 2D62A 3TP8A 1X32A 3I91A 1I94Q 3R8BA 5AJ3Q 4MTNA 4HMIA 1JR0D 2F0PA 1SRUA 1SXTA 1VCIA 4LF4Q 1A15A 3K0XA 3S24A 2K5QA 4CJ0B 4KMUC 2K04A 1JC7A 1KRSA 1NAPA 5CGKA 4UHVA 4TQUS 5CBEE 1XNQQ 4RGMA 2XN9C 4GOPC 2QGQA 4KHZA 2HD3A 3S16B 3M4PA 3SK5A 1JWUD 5BN5A 5C0XJ 1N32Q 3K7AH 4X3SA 3K80C 2PI2E 2SDFA 4JI3L 5IGEA 1SE3A 2HDLA 2HIVA 2MHVA 5M3MH 3CCRA 2F0HA 4AQYQ 4A3DG 2EJMA 2XNAC 4EQ5A 2ZM6L 1YJ9A 3STBC 3PIO3 3M3YH 3X3NA 1AH9A 3VYTA 2AMCB 4Y7NB 1VQNA 2F0UA 2R7DA 1GUOA 4OIJA 1EFWA 1BCPB 2B2UC 3NQIA 3BVGA 3DWQA 3PO3B 3R3OA 1SYEA 3SR1A 2CH4W 4DR1L 1VQ5A 2R92H 5T1IA 2N78A 2EDGA 2EJFC 3ERSX 5C44H 1JB7A 3F2CA 4DV6Q 1E2ZA 2QDBA 2R3ZA 2KBNA 1PRTF 3W1GA 5K36H 3T1YQ 4DAPA 1Y14B 2EXDA 4DXGA 3AEVA 3S1QB 1D1KA 1II3A 2R93H 1SE8A 4DNTB 1XNRL 3MXUA 3NHHA 1PRTD 3D8GA 4RAUC 3CKIB 1QUQB 1X6OA 4C3HG 1QCBD 2MNAA 1CSPA 4DV7L 1NUCA 4GN5A 3NTHA 1TXYA 4BBSG 1EYGA 5JEAG 3HKSA 5BR8L 2KEDA 2K6AA 3FDTA 2HUGA 4QQBX 3I7FA 1I50B 1UE6A 2E74C 5DLQE 5GAGC 3L3OC 4KY5A 1PZJD 5GROA 4Q0FA 3PUZA 3K0YA 1Q82C 1B50A 1V8QA 5I2YA 4JI0L 5KGUA 2NN6H 5COYA 4A93H 4HCSA 3OOCA 1NR4A 5GQOA 1WCMG 1I94L 3DEPA 5AJ3L 1A3UA 1LTBD 3DXJC 3KOJA 4LF4L 3FKIH 3GP7A 1CSQA 4HIDA 1HQMC 3RN2A 2PZWA 4O1NA 1DOKA 1XMOQ 4JBJA 3I4MB 1XNQL 3AU7A 5KEEA 3LWUA 4HN7A 3W2DA 2XRQD 1DM0B 2B8FA 2TMPA 1UEAB 2F0IA 1N32L 1YNJC 1Y1VG 4DV0Q 2BCOA 2B2YA 3K7UC 3RZOH 1EWIA 1EYDA 2A73B 4RWSC 3HGBA 5M3FH 1GJXA 3HOXG 1IYUA 3KBGA 2LSSA 1E0BA 2N8NA 1EOVA 1IL2A 4ZLTF 1KNAA 4AQYL 2DY7A 1IW7D 3QWNA 4LNQA 2A5HA 2DNCA 3HOZB 2R7ZH 1TS3A 1YVCA 4FYDA 5EAYA 3CPWA 3GTKB 5ELCA 3NELA 1ASYA 3J7A5 3OWEB 2E2DC 1R9TH 3Q6SA 4KJOA 3HP3A 2J4XA 1L1OA 2E2JB 3A55A 1XTCD 1QILA 3JAMc 1K9MC 2CWAA 3TZUA 4PMCA 1KLUD 2LMCB 1CHQD 5M5WB 1O7ZA 2Y0SB 1K0RA 1D1IA 2JEBI 4PZ8A 4DV6L 1TWAB 3LX0A 4JW0A 5L37A 3H91A 1CA6A 1G6ZA 4PG3A 4XQJA 5C3XA 5LMUQ 1CZWA 4LK1C 3T1YL 1GM5A 1HTLD 1O80A 1HUMA 3P1HA 1W3SA 2QDLA 1Q12A 3RLFA 3MWYW 2JA8B 1EY7A 1DCZA 4POGA 4JI7Q 4POFA 3JAME 4TSSA 2Z6BA 1LUZA 4R8NA 4BBRB 3EA6A 3K7AB 1UE1A 3ULLA 4LF8Q 4QB4A 2N49A 1X3PA 4QGUA 5CORA 4K2KA 3U50C 4BXXG 4A75A 2IX1A 5JVH3 1YHBA 1GUGA 5EQ0A 4A3DH 1OO9B 3A8JE 1EYCA 2BDOA 3UDFA 1PYWD 1QVCA 1GUNA 3VA7A 4YCWA 3R2IA 1PH6A 3R93A 3A74A 1XMOL 4B9XA 3MXNB 4IZ8A 3HKZB 2EY6A 1LTSD 5C4HA 2A19A 1SMXA 3E9HA 2B2WC 2EYFA 3JAMi 4JOIA 1JT8A 4MN3A 4DV0L 1Z47A 1K3RA 5IYDG 5C4JH 2A8VA 1QE6A 4XT3B 2I0QA 3S1RH 2QEJC 1VQMA 4CKEA 4OEMB 4RGTA 5F2DA 2UU9Q 1BO0A 2OCEA 4RHSA 1S5DD 3PO3G 2EXZA 2FXQA 1HNWQ 4HJAA 3OHXC 1R4QB 2HQLA 1UUPA 4FXDA 2B63B 1FYCA 2R93B 3KUPA 5LMNW 4V0BA 1TS5A 3MXPA 5ELFA 4C3HH 3M4OB 5EPKA 2RHQB 2AWOA 5FLMH 4BBSH 1YITA 4L8JA 3S2DH 3OW2A 1IHZA 3H0GG 5JEAH 4A3EB 4NXNQ 4JBWA 3K57A 4RKBA 1O7IA 1ESFA 4XQQA 1EIFA 2E76C 2I07B 4X62Q 2VS1A 1KABA 2JYOA 3HOVG 4OONA 4LF5Q 1EUJA 3QR8A 2UUAQ 1TWCH 1E24A 3HFZB 4NW2A 1VQ7A 2PMZE 1WCMH 2ZJRA 2SNMA 2A6HC 5LMUL 3E3XA 1K83B 2CQOA 3MEFA 2SOBA 2B2TA 4LUZA 5IYCG 4UP9A 1K8GA 2L12A 4ULLA 1N36Q 2JN4A 1EQRA 1CKOA 1DJRD 3X3MA 4JI7L 4WRDA 4QIWE 2F0NA 1I4GA 1B53A 1STGA 1WTXA 4CKCA 4BA2I 2RSOA 1TS4A 4LF8L 1IKMA 4C2MB 1YBYA 2CHBD 1Q1EA 4LF7Q 4A3KG 4DR6Q 1Y8OB 3HOXH 1SYCA 2M9VA 4F8MA 4LF9Q 1MD2D 3A7LA 3TSSA 1BCPD 1T5EA 1E1OA 4KKSA 5J3BA 2G5DA 1G291 4G7ZC 3TP6A 1H9RA 1H95A 2PQAB 1UNSA 2BA0A 1I4HA 2Z4IA 4GN3B 3WOFA 3N6RA 1DXMA 3TQYA 3HOWH 1X65A 1B3QA 1SR3A 2YU9B 2LS01 1MJCA 4F87A 1UE7A 3K5OA 1VQJA 1WFQA 1R9TB 2JA5G 3W5OA 1WTRA 1UAPA 1HFNA 5C4ZA 4M1UB 4CDFC 1X3GA 2I46A 1B7YB 2NN6I 4GOPB 1MSHA 2RKSA 4YIJA 1YI2A 5FKAC 4ODGA 3F2DA 2RQXA 2UU9L 4C1NI 1EU4A 1S72A 1HNWL 1Y8NB 5FOBB
chains in the Genus database with same CATH topology
1C4QA 2DY8A 1STNA 2J7ZA 3GTQB 4AYBB 3H3VC 3NQTA 1TY2A 5IGCA 1EY8A 3J81L 5C5MA 1JOOA 5J22A 3I70A 1PLFA 1Q1BA 2KCNA 2FMMA 5C3WA 2B2VA 3K5NA 4A3DB 4ZYSA 2KA7A 5CV9A 4NMZA 4E6IA 2DNEA 3QB3A 3HZXA 3L7ZC 2IWHA 2OF1A 4FXGC 4G7OC 1EL0A 3M4YA 1PTOF 1SBBB 1ONLA 1EIGA 3KBXA 1SSOA 3K58A 1VMPA 2EOTA 3GV3A 3QOLA 3D4WA 3SXHA 2DN8A 2F0GA 4C3HB 1OXVA 3S1NB 3ND8A 2R61A 1RDPD 3QOJA 1TWGB 3MA2B 1PZKD 2LKVA 5CV8A 1TVXA 4IALA 5JPMC 3EVQA 5D3DA 4IUPA 2L5TA 2L55A 4IUQA 1GUTA 4QF4A 5NUCA 3BYTB 2AUJD 2EYMA 4KV6A 1FNVA 1A6XA 1NR2A 1PMRA 5KIXA 4ZK9B 1F2MA 1RD9D 1HTPA 3A54A 3GTPB 1Y1VB 5CV4A 4IUUA 3VYSA 5JVG3 4Q5VA 1M4VA 3PV0A 3EROA 2FJ2A 1C8CA 3K59A 2NYZD 1OXSC 1LACA 4PQXA 1Y69U 3LWEA 5ELDA 4IUNA 3LNNA 1RCVD 1EWCA 4KHVA 1HHVA 1ML0D 4HSPA 2K33A 5IT9E 4OO1G 5EKIA 1LV9A 2EYJA 5JPNC 1F9QA 2LY7A 2K1BA 5DNFA 2B2UA 1AFPA 3GTJB 3DMUA 4EQOA 1QJOA 5D65A 2PQEA 1LT3D 2Z8LA 1RODA 4UAIA 1GHKA 1KDBA 2PYKA 3J81E 4X3KA 2A6ED 4RKLA 3Q24A 2MJ8A 1LTTD 1W6KA 1D5ZC 2F4IA 5T1GA 1HRJA 3A8KE 3BYYB 3NPPA 4K8IA 2EYPA 3T16A 1CK1A 1U4PA 1WTWA 4HMJA 4ZUJA 2EYLA 1IKLA 3T13A 5BN3A 2CW0C 1MBYA 2FFKB 5A2QL 1XX8A 3EFXD 1GHJA 1FD7D 4IURA 2OXPA 4H44C 1GUSA 1TT2A 4EVOA 1PRTC 1O7LA 2F3WA 1JORA 1H9SB 2KOLA 1SAPA 2C5CA 1WTQA 3SDZA 2D5DA 5CR3A 4IFDH 3H0GB 4KKUA 1ZYRC 3NBIA 3VR6A 1TY0A 2EE1A 5C0XG 3HOVB 1BUVT 3NSWA 4CJ1B 2WKDA 1A3TA 3RZDB 4FF3A 3J7YW 4DXFA 2XVSA 3VR5A 3ONAB 1HFGA 2PCFB 2X69A 3BVZA 1F77A 2F3VA 3GTLB 4IUTA 1CQVA 1WTPA 1ENFA 1G2SA 4C1NK 5DEHA 3ND9A 2L1BA 3Q0AA 1EY0A 4A3KB 4XTCS 1BOSA 1ENAA 4KD3A 5E4WC 3K5MA 1ENCA 1PFNA 3M7GA 3DWPA 1Q3LA 2F0EA 1Q8IA 3GTOB 4RHRA 3N52A 2JA5B 5I9PA 3QG1A 2K01A 4KN4C 1LT5D 2NWGA 1BQQT 2RSNA 3CRLC 3SE0A 5A35A 2Z1CA 5J39A 1SYFA 4CHTB 4ID6A 4WORA 3P75A 4G57A 1HCZA 3TZDA 1F9RA 3GD7A 3C1FA 3SHLA 1YNJD 1D5MC 3G7LA 4XXEA 2KUMA 1JICA 1LT4D 2FHTA 3T53B 4QUCA 1RTNA 5EBDA 4A3IB 1XYIA 1SYDA 1U4LA 3E0JA 2JXMB 3EJIA 5G3LD 3H94A 1YNNC 1AZPA 2EYOA 1KDAA 3D6WA 5A2QE 2EVBA 1V1PB 2F0OA 1PFBA 1RTOA 1EY5A 3F2UA 4IN3A 2B2YC 4QMGA 3PMFA 2E2IB 3J80L 5EJWA 2K5DA 1ET9A 4RCOA 1CT1D 1QB5D 1JWMD 5KNBA 4WFN3 1EZ8A 1Z6HA 3FEWX 4K6DA 3HRZC 2H4OA 5DM73 4U68A 1EYAA 2CQAA 1OXTA 3D4RA 2NVYB 4NDXA 4F7XA 1VF7A 2N55A 3Q22A 1SMYC 4HEDA 1TQOA 1AP0A 1SFOB 3PO2B 2X6LA 5FLXL 2VB2X 3IL8A 4DK1A 2KQ3A 4DGZA 2PPBC 1ILQA 3IFDA 1B1ZA 3NXWA 3S1MB 3S9WA 5I9OA 3SK4A 4N9PA 2KHSA 3GQBA 1LTRD 2HDMA 3BDCA 2M2LA 5CBAE 1STEA 3J7AV 2RDGA 1TS2A 1BCPF 1CA5A 4DAVA 3I8ZA 2JE6I 2EY1A 2E2HB 3CU7A 5ELEA 1X3QA 4C3IG 4HTHA 2PZTA 4IFDI 3PIP3 4H7BA 2JSOA 4DF7A 2ZXRA 5CYUA 5KNCA 3GTGB 1F9PA 1R4PB 1RF2D 2SEBD 1KTKA 2K03A 3KLRA 2D2CC 2VNUD 1O7YA 5I6YA 1G2TA 2A69C 2HCIA 2IL8A 2A6HD 4U673 1AEXA 1STAA 1EU3A 3CHBD 4A3MB 5BN4A 2IW3A 4K2LA 1F9SA 2XRSD 3SK6A 1G91A 1I6VC 4IUVA 1QWYA 5IODA 2K7VA 4A3GB 4XQNA 1OXUA 1AN8A 1XXGA 1FGBD 1STBA 1EFID 2JA7B 3MXNA 4RA8A 2O5JC 1PDQA 3BG3A 1IL8A 1PRTB 1CI3M 1NSNS 4A3JB 2BDNA 1JWSD 3P7JA 3I90A 5C3EB 1PTOC 3ITPA 3T4AC 1AZQA 3HS0C 2NVTB 4KY6A 2PNRC 2O2LD 2ZXOA 4RFBA 4IFDJ 2PO4A 4ABNA 1ICWA 3S14B 5IGFA 1CZGA 3TDQA 4MIUA 1J8IA 1B2TA 1T5XD 3C1EA 3A8IE 3DEOA 1WD1A 2A74C 2A68D 2IT1A 4OGQC 1SYBA 3E6ZX 3NWTA 2EJGC 5FLXE 1HA5A 3D31A 4EGVA 1ZEQX 3BS1A 3Q23A 1KNEA 5C6AA 2F0FA 3G6JB 3NTIA 3C3LA 1H9KA 4B08A 1D2BA 2KCCA 4LAAA 3HOYB 4X3UA 2PW7A 1A2UA 5C4XB 4BWGB 4PMWA 3WOEA 3O13A 4BS9A 5IOCA 2KVMA 2FMCA 3S2HB 3BZDB 1CFMA 3VR3A 1TWHB 1L0YB 1H9JA 2YYZA 1SE4A 4R8IA 5KYLA 2NTTA 1HXYD 3NP8A 1E2WA 2B2VC 5HURA 4UDUC 2H1EA 4TKOB 4ZAIA 1DOMA 2N88A 4X3TA 5DAUA 2IX3A 1ZXTA 1EQTA 1I4PA 1QG7A 1K8OA 2QF7A 1SDFA 1K8MA 2Q8IB 2NN6G 3S15B 3L9AX 1LT6D 4OIKA 4PMBA 1PZID 4XT1B 1EOTA 3DWAA 3OIQA 2WIIB 1TU2B 2BE5C 1SJHD 3MVVA 1U9RA 2ENBA 2F0LA 4ZUIA 2F0QA 5LL6X 1Y8PB 1L0XB 2K28A 4ZRZA 3D6CA 2KEEA 1CM9A 1HPCA 1F2YA 5CV5A 4FVMA 4HAEA 1VF5C 3TN2A 3MHBA 3UI2A 1G8ZD 2NBFA 4Z9CB 4KKTA 1FNUA 3FVQA 5EPLA 3GO5A 2PMZB 2Z4HA 2F0JA 4DFAA 4HR7B 2X6GA 1XWEA 2SNSA 1PTOH 1U4RA 4RGNA 1PXUA 3URYA 1EY4A 2WV6D 2MGSA 4K6LA 5JOBA 3VR4A 5FK9C 1SNCA 4OL7A 3MFGA 4QIWB 3M7NA 2RBMA 4DN4M 2MPMA 5M5XB 1M8AA 5CMDA 1I6HB 2F0SA 2NTSA 5C5LA 1KAAA 4BY7B 3QJYA 2K05A 1SYGA 4MHEA 4CKBA 3S17B 3PUWA 3RMHA 3JAML 1JE4A 5I4DA 5HGTA 3SVMA 5KNDA 3VYRA 5JEAJ 1W6JA 1SEBD 1KLGD 2F0VA 2XIWA 3KLSX 2WAQB 3MFYA 1PFMA 3WDNA 3FPUB 1E2VA 4J6HA 2IPKD 5ISRA 1B3AA 5D14A 3ZYYX 2L0CA 5AFWA 2CW0D 3IFTA 1DD2A 4N9TA 2BOSA 1O78A 1ESRA 1JOQA 4BY1B 5JJZA 3I73A 3C46A 1FNWA 2MP1A 2XWJB 2K32A 4DU9A 3MEHA 2KECA 3OWFA 4ZKCB 1Z7TA 4ILWA 1IW7C 4C3IB 4KY7A 4K5VA 2AQ1B 2ZT9C 1SE2A 2F0MA 1EZ6A 2V4DA 2NB0A 5M5YB 3PUVA 1DONA 1ZYRD 1GUWA 4ZQ3A 5FO9B 3NE5B 4XDXA 1JCKB 1DZ1A 4FF1A 1V1OA 1HUNA 5CV6A 1SNPA 1BXTA 5EKLA 4FP5D 4C56C 1HA6A 4KJNA 5M9OA 5K5PA 1EY6A 4PV1C 1CQFA 2G9HD 1ZKOA 4OO1H 2OT2A 1VMCA 4GZYC 1JOKA 4ME5A 1EIHA 3NWSA 1FR3A 1D6EC 1B9MA 3C2PA 4H0LC 1LO5D 5KRUA 2JA6B 2XWBB 1GOZA 2D9UA 4C3JB 2VUMB 3T51B 2B2WA 1VDZA 4S3SA 1MGSA 3I4NB 1B9NA 1BBXC 5FO8B 3TBIB 2WKCA 3GTMB 1EEFD 1PTOB 1EY9A 4RH6A 3HOUB 4KN7C 1CHPD 3A7AB 4LJZC 1H9MA 4I7ZC 2RA4A 3MXGA 5IGGA 3BDOA 1STHA 1ILPA 4RGOS 4NKLA 1WTOA 5G3LF 5I2XA 1SNOA 3NUCA 1LTGD 2M00A 2EZVA 4G7HC 4JK1C 1H9SA 4L6TB 3I4LA 3NBHA 4CBVA 5D3IB 1S5ED 2CVRA 4QCLA 2NUCA 3RUZA 1LTID 1D5XC 3H09A 3DHQA 4BA1I 5IIFA 3EQLC 1IYVA 3PUYA 5M3MB 2F1MA 1JB3A 5FO7B 3M3YB 2ICEC 1QNUA 4EQNA 2F03A 3V96A 4IQZA 2F0DA 4XYQA 1BNZA 4WJWA 3IAYA 2NVQB 3R2TA 2F0KA 2L4NA 3OIPA 2QILA 2AQ2B 3QO2A 2R92B 3OMCA 5EKKA 5LHY1 3MC0B 2L11A 1YNND 5C0XH 5C44B 4J1MA 2WACA 3MZ5A 1LABA 4DAYA 3CRKC 5CV7A 3V2TA 2ICIA 2EY5A 3MTSA 1I4XA 2C9OA 3PUXA 5TSSA 4K14A 4I65A 1BCPC 1SJED 1TR5A 3FPPA 5I6WA 1MSGA 1CTMA 1WVLA 2B8GA 3FRPB 1BF4A 3M85A 1RHPA 2RVLA 1LLRD 4A93B 2G9DA 4KTAA 2AUKA 1Q90A 1SMYD 2WB1B 3FKIB 2TSSA 4DK0A 1S5BD 3DM1A 2HQEA 3P20A 1F2LA 2MUYA 1WD0A 2WINB 2WP8J 4RCNA 3W3AA 3RZOB 1TKWB 5M3FB 3VA5A 3U9OA 3D3RA 1HQRD 1U4MA 2E75C 3RD4A 4DA2A 3SK8A 2FINB 3IKJA 2EPBA 2R7ZB 2L9HA 4V190 2ID0A 2VXWA 1NCVA 1V43A 2QCPX 4C3JG 4B9WA 2O4XA 1V1PA 3KF8A 4FF2A 5IT9L 2NZ1D 4QUFA 5LL6S 2Q8TA 5J1ZA 3I3CA 2R6GA 2B2TC 1RKNA 2PZUA 4KD4A 4FNFA 4L63B 5JAVA 1DOLA 2A69D 3TP7A 2IX0A 5KYIA 5E4XA 2EY2A 3NTKA 2NVXB 4OO1I 3TMEA 4CJ2C 2F0WA 1WTVA 2A68C 3J80E 3VYUA 5EGTA 4NP5A 2AWNA 3GV6A 1S5FD 2QKIC 1JQYD 1GXDC 3K5LA 2F0TA 3OMGA 2HCCA 1I4RA 4FO2A 2ZXPA 4KK7A 2VB3X 1SNMA 3J7AF 5C4JB 4FF4A 3S1RB 1I4QA 1SNQA 3BDLA 3TP5A 1PTOD 1RJTA 4ZKBB 1EWHA 5DM63 3HEJA 3H6MA 4K5XA 4FXKC 1Y1WB 1DYQA 2PW5A 1ET6A 3ERQA 4HCEA 4BBSB 2J0TD 2BA1A 3S2DB 5EPJA 4IFDG 5K36G 3AB9A 2RDFA 4XYOA 4XIGS 3FMCA 5IGDA 3V05A 3KK7A 1QOHA 3OSOA 3E5SA 1TWCB 1OXXK 2K5WA 3K6OA 4H13C 1WCMB 2Q8RE 4LMQD 3AMUA 4M8AA 4J8QA 4G4KA 1J9OA 3A56A 5IGBA 1C48A 1S4ZA 4O42A 5C0XI 3QIAA 2O5IC 1BDOA 4EQPA 3OW7A 1KDCA 3U9SA 3OPOA 1EEID 3HOXB 1TIID 2B39A 1EQVA 4F88A 2A6EC 1TWFB 2GA4B 3BVMA 4P2CB 3I72A 3HOWB 2JP1A 2RDHA 5ELBA 4OHJA 4DNRB 1QNKA 1STYA 1I3QB 4PNYA 3HG9A 1A2TA 5E3FA 3MAQA 1MI2A 1F2ZA 2AQ3B 3D4DA 1AW7A 4TRDA 3NK9A 4HSVA 3SEBA 4R9WA 1SNDA 2OEOA 4K8JA 4A3FB 1B44D 3T56B 3DUZA 1S5CD 1B4OA 5CC4A 3KLSA 4CGYB 2XSCA 3VR2A 4KI0A 4A3BB 1BR9A 2BE5D 2IJ0A 2JEAI 5EBCA 1A3VA 5E1FA 2EYHA 2LFNA 2KJXA 4K5WA 3CQZB 1LTAD 2D62A 3TP8A 1X32A 3I91A 3R8BA 4HMIA 1JR0D 2F0PA 1SXTA 1VCIA 1A15A 2K5QA 4CJ0B 4KMUC 2K04A 1JC7A 1NAPA 5CGKA 4TQUS 5CBEE 4RGMA 2XN9C 4KHZA 3S16B 3SK5A 1JWUD 5BN5A 5C0XJ 4X3SA 2SDFA 5IGEA 1SE3A 2HDLA 2MHVA 2F0HA 2EJMA 2XNAC 3PIO3 3X3NA 3VYTA 4Y7NB 2F0UA 1GUOA 4OIJA 1BCPB 2B2UC 3NQIA 3BVGA 3DWQA 3PO3B 3R3OA 1SYEA 3SR1A 5T1IA 2EDGA 2EJFC 1E2ZA 2QDBA 2R3ZA 1PRTF 5K36H 4DAPA 4DXGA 3S1QB 1D1KA 1II3A 4DNTB 3MXUA 3NHHA 1PRTD 3D8GA 4RAUC 3CKIB 4C3HG 1QCBD 1NUCA 3NTHA 5JEAG 2KEDA 2K6AA 3FDTA 2HUGA 1I50B 2E74C 3L3OC 4KY5A 1PZJD 4Q0FA 3PUZA 3K0YA 1B50A 1V8QA 5I2YA 5KGUA 2NN6H 5COYA 4HCSA 3OOCA 1NR4A 3DEPA 1A3UA 1LTBD 3DXJC 3GP7A 1HQMC 2PZWA 4O1NA 1DOKA 3I4MB 3AU7A 5KEEA 3LWUA 4HN7A 3W2DA 2XRQD 1DM0B 2B8FA 2TMPA 1UEAB 2F0IA 1YNJC 2BCOA 2B2YA 1EYDA 2A73B 4RWSC 3HGBA 1GJXA 1IYUA 3KBGA 1E0BA 4ZLTF 1KNAA 2DY7A 1IW7D 3QWNA 2A5HA 2DNCA 3HOZB 1TS3A 4FYDA 3GTKB 5ELCA 3OWEB 2E2DC 3Q6SA 4KJOA 3HP3A 2J4XA 2E2JB 3A55A 1XTCD 1QILA 3TZUA 4PMCA 1KLUD 2LMCB 1CHQD 5M5WB 1O7ZA 2Y0SB 1D1IA 2JEBI 1TWAB 3LX0A 3H91A 1CA6A 1G6ZA 4XQJA 5C3XA 4LK1C 1CZWA 1HTLD 1O80A 1HUMA 3P1HA 1Q12A 3RLFA 3MWYW 2JA8B 1EY7A 1DCZA 3JAME 4TSSA 4R8NA 4BBRB 3EA6A 3K7AB 4QB4A 1X3PA 5CORA 4K2KA 2IX1A 5JVH3 5EQ0A 1GUGA 1OO9B 3A8JE 1EYCA 2BDOA 1PYWD 1GUNA 3VA7A 3R2IA 3R93A 4B9XA 4IZ8A 3HKZB 2EY6A 1LTSD 5C4HA 2B2WC 2EYFA 4MN3A 1Z47A 1QE6A 4XT3B 2QEJC 4CKEA 4RGTA 5F2DA 1BO0A 4RHSA 1S5DD 2EXZA 3OHXC 1R4QB 1UUPA 4FXDA 2B63B 1FYCA 2R93B 3KUPA 4V0BA 1TS5A 3MXPA 5ELFA 3M4OB 5EPKA 2AWOA 4L8JA 1IHZA 5JEAH 4A3EB 4JBWA 3K57A 4RKBA 1ESFA 4XQQA 2E76C 2I07B 1KABA 2JYOA 4NW2A 2SNMA 2A6HC 1K83B 2SOBA 2B2TA 2L12A 4ULLA 1DJRD 3X3MA 4WRDA 2F0NA 1I4GA 1B53A 1STGA 1WTXA 4CKCA 4BA2I 2RSOA 1TS4A 1IKMA 4C2MB 2CHBD 1Q1EA 1Y8OB 1SYCA 2M9VA 4F8MA 1MD2D 3A7LA 3TSSA 1BCPD 1T5EA 4KKSA 4G7ZC 1G291 3TP6A 1H9RA 1UNSA 2BA0A 1I4HA 2Z4IA 3WOFA 3N6RA 1DXMA 2YU9B 2LS01 4F87A 3K5OA 1R9TB 1WTRA 1UAPA 1HFNA 5C4ZA 4M1UB 2I46A 2NN6I 1MSHA 2RKSA 4YIJA 5FKAC 4ODGA 2RQXA 4C1NI 1EU4A 1Y8NB 5FOBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZEQ X;  3E6Z X;  2L55 A;  2VB2 X;  2QCP X;  3TDQ A;  2VB3 X; 
#chains in the Genus database with same CATH topology
 4MTK A;  1C4Q A;  2DY8 A;  1DGS A;  3KFU A;  1STN A;  2J7Z A;  1Q7Y C;  4AYB B;  3GTQ B;  3H3V C;  3I55 A;  2GN5 A;  3NQT A;  1TY2 A;  5IGC A;  1EY8 A;  3J81 L;  3CQZ H;  5C5M A;  4Y52 H;  1NBW A;  1JOO A;  2K4K A;  1G6P A;  4NXN L;  5J22 A;  1A63 A;  2QEX A;  3I70 A;  4CDC C;  1PLF A;  1Q1B A;  2KCN A;  5HGQ A;  2FMM A;  4X62 L;  4L5Q A;  5C3W A;  1E1T A;  3CCM A;  3G6E A;  2B2V A;  4LF5 L;  2UUA L;  3K5N A;  4A3D B;  4ZYS A;  1NMF A;  4IO9 A;  3S16 H;  1PFS A;  2KA7 A;  5CV9 A;  4NMZ A;  4E6I A;  2DNE A;  3QB3 A;  1N36 L;  3HZX A;  3L7Z C;  2IWH A;  2OF1 A;  3D0F A;  4FXG C;  4G7O C;  3KLW A;  1EL0 A;  1VQA A;  4JYA Q;  2PI2 A;  3M4Y A;  1PH8 A;  4PZ7 A;  1PTO F;  1SBB B;  3T1H Q;  5IYD H;  4LF7 L;  4DR6 L;  1ONL A;  1EIG A;  4LF9 L;  3KBX A;  2K75 A;  3PO3 H;  1SSO A;  3KJO A;  3K58 A;  1VMP A;  2EOT A;  3GV3 A;  3QOL A;  4CDE C;  3D4W A;  4GNX A;  3SXH A;  2VQE Q;  2DN8 A;  2N3S A;  2F0G A;  4C3H B;  4IJL A;  2D0P A;  1OXV A;  3S1N B;  1XPO A;  1LM0 A;  3ND8 A;  4K0K Q;  2R61 A;  1RDP D;  2B63 G;  2AHO B;  3QOJ A;  1V1Q A;  3CME A;  1TWG B;  2OTL A;  3HOV H;  1XPR A;  3OTO Q;  3PO2 G;  3MA2 B;  1PZK D;  1NTG A;  2LKV A;  5CV8 A;  1TVX A;  4IAL A;  5JPM C;  3TS0 A;  3BZK A;  3EVQ A;  5D3D A;  3CD6 A;  1QZH A;  1FJG Q;  4IUP A;  2L5T A;  2L55 A;  4IUQ A;  4AH6 A;  1GO3 E;  5IYC H;  4DV4 Q;  3RLO A;  1GUT A;  4QF4 A;  5NUC A;  3BYT B;  1XMQ Q;  2AUJ D;  2EYM A;  4KV6 A;  1FNV A;  1A6X A;  1FL0 A;  1NR2 A;  1PMR A;  4YWK A;  4ZK9 B;  5KIX A;  1S3O A;  1F2M A;  1RD9 D;  2Y0S E;  1HTP A;  1AE3 A;  3A54 A;  3GTP B;  1Y1V B;  5CV4 A;  1BBU A;  4IUU A;  3CCJ A;  4DV3 Q;  3VYS A;  1NMG A;  4Q5V A;  5JVG 3;  1IZ6 A;  4DKA C;  1YJN A;  1M4V A;  3PV0 A;  2GVB A;  5IT9 c;  3AYH B;  4TVA B;  3ERO A;  2FJ2 A;  4NB3 A;  1C8C A;  2Z6K A;  3K59 A;  2NYZ D;  1OXS C;  1LAC A;  4PQX A;  1ICF B;  5IE8 A;  1Y69 U;  3LWE A;  5ELD A;  2CKZ B;  1VQI A;  4IUN A;  3GTO H;  3LNN A;  2JA5 H;  1RCV D;  4A76 A;  1EWC A;  1HZB A;  1QZG A;  1HNZ Q;  4JYA L;  4KHV A;  1HHV A;  1ML0 D;  3HOZ H;  3J81 c;  4HSP A;  2K33 A;  2P5Z X;  5IT9 E;  3H3V H;  4OO1 G;  4J15 A;  5EKI A;  3T1H L;  1LV9 A;  2EYJ A;  3G71 A;  5JPN C;  1F9Q A;  2LY7 A;  2K1B A;  1HR0 Q;  5DNF A;  3K81 C;  2B2U A;  1K73 C;  1AFP A;  3GTJ B;  3DMU A;  4EQO A;  2HIX A;  1QJO A;  5D65 A;  2PQE A;  1LT3 D;  2Z8L A;  1ROD A;  4UAI A;  1GHK A;  3HKZ E;  2E2J H;  1KDB A;  1S40 A;  2PYK A;  2VQE L;  3J81 E;  3EN2 A;  4X3K A;  2A6E D;  2ES2 A;  4RKL A;  1TWA H;  3Q24 A;  2MJ8 A;  1L2F A;  4IPG A;  4A3C G;  1LTT D;  4K0K L;  1W6K A;  1D5Z C;  2F4I A;  5T1G A;  1HRJ A;  3A8K E;  4A3G G;  1N8R C;  3BYY B;  3KF6 B;  3NPP A;  4AYB G;  4K8I A;  2JA8 H;  3OTO L;  2EYP A;  3T16 A;  4BBR H;  1CK1 A;  1U4P A;  4GN4 B;  1WTW A;  3PF5 A;  4HMJ A;  3I56 A;  2JA7 G;  4YWL A;  4ZUJ A;  4DV4 L;  1MJE A;  1XMQ L;  4N8F A;  2EYL A;  1IKL A;  3T13 A;  5BN3 A;  1D8L A;  4I7A A;  4A3J G;  2CW0 C;  1MBY A;  4LW1 A;  2FFK B;  3J81 i;  1YIJ A;  5A2Q L;  1XX8 A;  3ICE A;  3EFX D;  4B3S Q;  1GHJ A;  3G48 A;  4DV3 L;  1FD7 D;  4IUR A;  2OXP A;  2WB1 E;  3KDF A;  4H44 C;  1GUS A;  1TT2 A;  2B29 A;  4EVO A;  1PRT C;  3CCE A;  2F4V Q;  1O7L A;  2F3W A;  1JOR A;  1H9S B;  2KOL A;  2K52 A;  3NBH B;  2YTX A;  1NY4 A;  2UUC Q;  1SAP A;  2C5C A;  1WTQ A;  1FGU A;  3SDZ A;  1M1K C;  4HJ5 A;  2D5D A;  5CR3 A;  1X56 A;  1M90 C;  4IFD H;  3H0G B;  1YJW A;  4JVZ A;  4KKU A;  3ER0 A;  1HNZ L;  1ZYR C;  3NBI A;  4OX9 Q;  3VR6 A;  3U58 A;  2B63 H;  4JC0 A;  1TY0 A;  2EE1 A;  2VZA A;  5C0X G;  1Q81 C;  3HOV B;  1SFO H;  1BUV T;  4IOC A;  1HR0 L;  3NSW A;  3M4O H;  4CJ1 B;  2WKD A;  1A3T A;  3RZD B;  1AE2 A;  3STB D;  4FF3 A;  3J7Y W;  4DXF A;  2XVS A;  4A3E H;  3VR5 A;  3ONA B;  1HFG A;  1HH2 P;  2PCF B;  3HOY G;  1BVS A;  4DNI A;  1OTC A;  2X69 A;  3BVZ A;  1N9W A;  1F77 A;  2F3V A;  5C4X G;  1IBK Q;  3GTL B;  2OQ0 A;  4IUT A;  1CQV A;  1WTP A;  1ENF A;  1VQP A;  1UWV A;  1G2S A;  4C1N K;  2DGY A;  5DEH A;  3ND9 A;  2L1B A;  3B6Y A;  3RN5 A;  2JJQ A;  1K83 H;  3Q0A A;  1EY0 A;  4DV5 Q;  4A3K B;  4XTC S;  1P8L A;  4DAY B;  1A0I A;  2LXK A;  1KRT A;  2Q2U A;  1BOS A;  1MHW C;  1ENA A;  4KD3 A;  4AYB E;  4P74 A;  4L5S A;  2VY3 A;  5E4W C;  3K5M A;  1ENC A;  1PFN A;  3M7G A;  4C2M H;  3DWP A;  3OYY A;  3CF5 A;  1Q3L A;  4NXM Q;  1XPU A;  2F0E A;  1Q8I A;  3GTO B;  4RHR A;  3N52 A;  4YHH Q;  5I9P A;  2L15 A;  3QG1 A;  1J6Q A;  2K01 A;  5IWA Q;  2JA5 B;  4KN4 C;  1LT5 D;  4B3S L;  2NWG A;  4LFA Q;  1BQQ T;  2RSN A;  2YU9 H;  3CRL C;  3SE0 A;  5A35 A;  2Z1C A;  5J39 A;  1GKH A;  1SYF A;  3Q8D A;  4CHT B;  4ID6 A;  4X64 Q;  2F4V L;  2CFM A;  4JI8 Q;  4WOR A;  3P75 A;  4G57 A;  1HCZ A;  2RCF A;  2UXB Q;  2UUC L;  2K5V A;  2K14 A;  3TZD A;  1F9R A;  3GD7 A;  2UXD Q;  1D7Q A;  3C1F A;  4B3M Q;  4A3C H;  3SHL A;  4DK3 C;  1YNJ D;  1RL2 A;  1D5M C;  3G7L A;  4XXE A;  4L5R C;  4OX9 L;  2KUM A;  1JIC A;  1LT4 D;  1HZC A;  2FHT A;  4H02 A;  3T53 B;  4QUC A;  4A3G H;  4A3L G;  3GTQ H;  1J5E Q;  1RTN A;  5EBD A;  4A3I B;  3PIO A;  4UPA A;  1KHI A;  1XYI A;  1WOC A;  2ZTE A;  3UE1 A;  1SYD A;  1U4L A;  3E0J A;  2JXM B;  2MO1 A;  5ELO A;  3EJI A;  5G3L D;  3H94 A;  1C9O A;  1YNN C;  1IBK L;  1K28 A;  1AZP A;  4P73 A;  2EYO A;  1KDA A;  3D6W A;  5A2Q E;  2EVB A;  1V1P B;  4DV2 Q;  3KF8 B;  3H3V I;  2F0O A;  5FJ8 G;  1PFB A;  1RTO A;  1EY5 A;  1KAW A;  3F2U A;  4IN3 A;  2B2Y C;  4QMG A;  4DV5 L;  4BY7 G;  3PMF A;  3TRE A;  2E2I B;  3J80 L;  5EJW A;  2K5D A;  1ET9 A;  3S14 H;  1PA6 A;  4DAM A;  4RCO A;  1CT1 D;  1QB5 D;  1JWM D;  5KNB A;  1QUQ A;  2VW9 A;  4WFN 3;  1EZ8 A;  4JI1 Q;  4RG1 A;  1PYB A;  2ASB A;  1Z6H A;  3FEW X;  4K6D A;  4NXM L;  3HRZ C;  2H4O A;  5DM7 3;  4U68 A;  5IP9 G;  1EYA A;  4YHH L;  2CQA A;  1OXT A;  5IWA L;  3D4R A;  4HIO A;  3TRZ A;  2NVY B;  4NDX A;  1HZA A;  4F7X A;  1VF7 A;  2N55 A;  3Q22 A;  4LFA L;  1SMY C;  2WAQ G;  1L1O C;  4HED A;  1KD1 C;  1TQO A;  1WTH A;  1AP0 A;  1SFO B;  3PO2 B;  2X6L A;  5FLX L;  2ALY B;  2VB2 X;  4P72 A;  2ZJP A;  3IL8 A;  1WI5 A;  2MO0 A;  3S1N H;  4DK1 A;  4YCU A;  4X64 L;  3UDI A;  2KQ3 A;  3HOY H;  4DGZ A;  4JI8 L;  3CCS A;  1JMC A;  2PPB C;  1ILQ A;  3IFD A;  4LFC Q;  1B1Z A;  1K3B C;  3NXW A;  4JG2 A;  5JJI A;  2UXB L;  3S1M B;  1TWG H;  1IXR A;  3S9W A;  5I9O A;  3FP9 A;  1E3P A;  2UXD L;  3SK4 A;  4B3M L;  4N9P A;  1VQG A;  1SLJ A;  1TWH H;  4BY1 G;  2Q2T A;  1VQE A;  2KHS A;  3GQB A;  1LTR D;  2HDM A;  3BDC A;  2M2L A;  4GLA C;  4YCV A;  1QVG A;  3DLL A;  5CBA E;  1STE A;  1J5E L;  1YZ6 A;  3J7A V;  2DUD A;  4YWM A;  4X65 Q;  2RDG A;  4GLX A;  1TS2 A;  1BCP F;  1VQB A;  4N8X 1;  1CA5 A;  4DAV A;  2QW7 A;  3I8Z A;  2JE6 I;  3GTP H;  2EY1 A;  1Y1V H;  2VQF Q;  2E2H B;  3CU7 A;  5ELE A;  5IYB G;  1X3Q A;  4C3I G;  1PH3 A;  1W2B A;  4HTH A;  2PZT A;  4IFD I;  1IBM Q;  4ME3 A;  4UY8 C;  3PIP 3;  2JQO A;  4H7B A;  2JSO A;  4DF7 A;  2ZXR A;  4DV2 L;  5CYU A;  5KNC A;  3GTG B;  1F9P A;  1R4P B;  1RF2 D;  2SEB D;  1KTK A;  2K03 A;  3KLR A;  2D2C C;  2VNU D;  1O7Y A;  5I6Y A;  2KHJ A;  1G2T A;  2A69 C;  1G51 A;  2HCI A;  1UEB A;  2IL8 A;  2A6H D;  4U67 3;  2A1A A;  1AEX A;  1STA A;  2XGT A;  1EU3 A;  3F1Z A;  3CHB D;  4JI1 L;  4A3M B;  5BN4 A;  3CCL A;  2IW3 A;  4K2L A;  1F9S A;  2XRS D;  3SK6 A;  3TS2 A;  1G91 A;  1I6V C;  3NEM A;  3GTJ H;  2JA6 G;  4IUV A;  2VUM G;  1QWY A;  5IOD A;  2K5N A;  2K7V A;  1GVP A;  2HHH Q;  4A3G B;  4XQN A;  3I4N G;  1OXU A;  2I5M X;  4OWX B;  4A3L H;  1AN8 A;  1XXG A;  1FGB D;  4DUY Q;  1STB A;  3CXC A;  1A8V A;  1EFI D;  4MNO A;  5ELN A;  2JA7 B;  3MXN A;  4RA8 A;  4DV1 Q;  2O5J C;  1PDQ A;  4LFC L;  3BG3 A;  1IL8 A;  2Z9H A;  4BXX H;  1PYS B;  1PRT B;  1CI3 M;  1NSN S;  2IHF A;  5IP7 G;  4A3J B;  4A3I G;  4HJ8 A;  1PH9 A;  2BDN A;  1JWS D;  3P7J A;  3I90 A;  5C3E B;  3WWV A;  1VQ8 A;  1PTO C;  2DJG C;  3ITP A;  3T4A C;  1AZQ A;  3HS0 C;  2NVT B;  4KY6 A;  2PNR C;  2O2L D;  4AIM A;  3UDG A;  2NZO A;  2ZXO A;  4RFB A;  4IFD J;  5GAH C;  2PO4 A;  4ABN A;  1ICW A;  3S14 B;  5IGF A;  1CZG A;  4X65 L;  3TDQ A;  4MIU A;  3S17 H;  1J8I A;  1VQK A;  1B2T A;  1CKN B;  2VQF L;  1T5X D;  3C1E A;  5GAD C;  4DPG A;  3A8I E;  1IBM L;  4JI6 Q;  3DEO A;  1WD1 A;  5IP9 H;  2A74 C;  4MZ9 A;  5M3M G;  2A68 D;  1Z9F A;  2I5H A;  2IT1 A;  1GD7 A;  4JI2 Q;  1VQF A;  4OGQ C;  1SYB A;  3E6Z X;  3M4Q A;  4R4I A;  2R7F A;  3NWT A;  2EJG C;  2JA9 A;  5FLX E;  1NE3 A;  1HA5 A;  3D31 A;  4EGV A;  1ZEQ X;  3BS1 A;  3Q23 A;  1KNE A;  5C6A A;  2F0F A;  3G6J B;  3NTI A;  3PF4 A;  3C3L A;  1H9K A;  4B08 A;  1LYL A;  4KHP Q;  3H0G H;  1D2B A;  2KCC A;  4LAA A;  3HOY B;  4X3U A;  3JC6 6;  2PW7 A;  2NZH A;  1A2U A;  5C4X B;  4BWG B;  4PMW A;  3WOE A;  3CAM A;  1KL9 A;  5C44 G;  4R4C A;  3O13 A;  4BS9 A;  5IOC A;  2KVM A;  2FMC A;  3S2H B;  3RZD H;  3BZD B;  1PH7 A;  1CFM A;  3VR3 A;  1TWH B;  2PQA A;  1L0Y B;  1H9J A;  2YYZ A;  2HHH L;  1SE4 A;  4R8I A;  3GTL H;  5KYL A;  4DUY L;  4R1J A;  2NTT A;  1Q46 A;  1HXY D;  1MKH A;  1SRO A;  3NP8 A;  1E2W A;  2B2V C;  3IRB A;  5HUR A;  4UDU C;  2H1E A;  4DR3 Q;  1VQO A;  4TKO B;  4ZAI A;  3GDE A;  4DV1 L;  1DOM A;  2N88 A;  4X3T A;  5DAU A;  2IX3 A;  4C3I H;  4A3K H;  1ZXT A;  1EQT A;  1WYD A;  1I4P A;  1PH5 A;  4EX5 A;  1QG7 A;  3K8A A;  1K8O A;  2QF7 A;  4GOP A;  1SDF A;  1K8M A;  2Q8I B;  2NN6 G;  4A93 G;  5M5Y H;  1PHJ A;  3S15 B;  3L9A X;  1LT6 D;  4OIK A;  4PMB A;  1PZI D;  1IYJ B;  4XT1 B;  1EOT A;  3DWA A;  2C35 B;  3OIQ A;  2WII B;  1TU2 B;  2BE5 C;  3FKI G;  1CKM A;  1SJH D;  1PV4 A;  3MVV A;  1U9R A;  2ENB A;  2F0L A;  3CCV A;  4ZUI A;  3E0E A;  2UXC Q;  2F0Q A;  3AQQ A;  5LL6 X;  1IBL Q;  4HIM A;  2OWO A;  1JJG A;  1Y8P B;  1K0S A;  1Q86 C;  1L0X B;  2K28 A;  2LXJ A;  4ZRZ A;  3D6C A;  1VS0 A;  2KEE A;  1CM9 A;  1HPC A;  1F2Y A;  4JCV E;  5CV5 A;  3EIV A;  4FVM A;  4HAE A;  2K50 A;  2JA6 H;  4OXP A;  4JI2 L;  1VF5 C;  3TN2 A;  3MHB A;  3UI2 A;  1G8Z D;  2NBF A;  4Z9C B;  3I4N H;  4KKT A;  1FNU A;  3FVQ A;  5EPL A;  4A3M G;  3GO5 A;  2PMZ B;  2Z4H A;  4YY3 Q;  2F0J A;  1VQH A;  4DFA A;  4HR7 B;  4OWT B;  2X6G A;  4KHP L;  1XWE A;  2SNS A;  1PTO H;  1U4R A;  4RGN A;  1PXU A;  3URY A;  2KCT A;  1EY4 A;  3CP0 A;  2WV6 D;  2MGS A;  1X55 A;  4K6L A;  5JOB A;  3VR4 A;  1HJP A;  5FK9 C;  1SNC A;  4OL7 A;  3MFG A;  4QIW B;  3M7N A;  5IP7 H;  2RBM A;  4DN4 M;  4GS3 A;  4A3I H;  1X9N A;  2MPM A;  5M5X B;  1M8A A;  5CMD A;  2F3I A;  1FJG L;  1I6H B;  2F0S A;  2NTS A;  5C5L A;  1KAA A;  4BY7 B;  3QJY A;  1N33 Q;  2K05 A;  3U4Z A;  1SYG A;  4MHE A;  4CKB A;  1U0L A;  3S17 B;  3PUW A;  4DR3 L;  5C3E G;  1L1O B;  3RMH A;  2Z6K C;  3JAM L;  1JE4 A;  4UP7 A;  5I4D A;  5HGT A;  3SVM A;  1B8A A;  5KND A;  3CCU A;  4WJ4 A;  2E2I H;  3VYR A;  5JEA J;  4ALP A;  1W6J A;  4RMF A;  5LMN Q;  4O2D A;  1SEB D;  1KLG D;  2F0V A;  2XIW A;  3KLS X;  2WAQ B;  3MFY A;  4B3R Q;  4WJ3 M;  1PFM A;  4GKJ Q;  3WDN A;  3FPU B;  1E2V A;  4J6H A;  2ATW A;  2NVQ H;  2UXC L;  2IPK D;  5ISR A;  2CWP A;  1B3A A;  2NVY H;  3J7Z C;  4HJ7 A;  1IBL L;  1JJC B;  3CMA A;  5D14 A;  3PSI A;  3ZYY X;  1E7Z A;  2L0C A;  5AFW A;  3PO2 H;  2CW0 D;  3IFT A;  2E8G A;  4DR2 Q;  4P75 A;  1DD2 A;  4N9T A;  2BOS A;  1O78 A;  4IPC A;  1ESR A;  1JOQ A;  3PQI A;  4IPD A;  4BY1 B;  4IPH A;  5JJZ A;  3I73 A;  4JV5 Q;  4APV A;  3C46 A;  1FNW A;  2MP1 A;  2XWJ B;  3S1M H;  2K32 A;  4DU9 A;  2E5L Q;  4LUV A;  3MEH A;  2K5H A;  4UP8 A;  4YY3 L;  2KEC A;  3OWF A;  1Y1W G;  3KJP A;  3U4V A;  5FLM G;  4ZKC B;  1PH4 A;  1Z7T A;  4ILW A;  3VDY A;  1IW7 C;  4C3I B;  4KY7 A;  4K5V A;  3J81 j;  2AQ1 B;  2ZT9 C;  1SE2 A;  2F0M A;  3AFP A;  4LF6 Q;  1EZ6 A;  2EQS A;  2V4D A;  2H5X A;  2NB0 A;  5M5Y B;  2YV5 A;  2XTI A;  3PUV A;  1DON A;  1ZYR D;  2YTY A;  4ZQ3 A;  1GUW A;  5FO9 B;  3NE5 B;  2F52 A;  2ZTC A;  4XDX A;  2E2H H;  1JCK B;  1DZ1 A;  2HT1 A;  1N33 L;  4FF1 A;  1JJ2 A;  1V1O A;  5IY0 A;  4LWC A;  4LFB Q;  1HUN A;  5CV6 A;  1SNP A;  1BXT A;  5EKL A;  3F2B A;  4FP5 D;  4C56 C;  1HA6 A;  4KJN A;  5M9O A;  5K5P A;  3GTG H;  1EY6 A;  4PV1 C;  1CQF A;  2G9H D;  1ZKO A;  4OO1 H;  2OT2 A;  1VMC A;  4GZY C;  1JOK A;  4OEL B;  4ME5 A;  1EIH A;  3NWS A;  4DR4 Q;  1FR3 A;  4R4T A;  1D6E C;  1B9M A;  3C2P A;  3KF6 A;  4H0L C;  1LO5 D;  5KRU A;  1BKB A;  2JA6 B;  2MQH A;  2XWB B;  5LMN L;  1GOZ A;  2D9U A;  4C3J B;  3CC7 A;  2VUM B;  3T51 B;  2B2W A;  1VDZ A;  2I5L X;  4S3S A;  1MGS A;  3I4N B;  4GKK Q;  1C7Y A;  3HOW G;  1B9N A;  4A3M H;  4B3R L;  1BBX C;  4GKJ L;  5FO8 B;  3TBI B;  2WKC A;  3GTM B;  1EEF D;  1PTO B;  1Q8K A;  3A5U A;  1EY9 A;  4RH6 A;  3HOU B;  4GLV B;  1CHP D;  3A7A B;  3BZC A;  4KN7 C;  2EIF A;  4LJZ C;  1H9M A;  1VQL A;  4I7Z C;  2RA4 A;  4QL5 A;  3MXG A;  5IGG A;  3BDO A;  3ZJY C;  1HZ9 A;  1STH A;  1ILP A;  1KQS A;  4RGO S;  1L0W A;  4NKL A;  1QVF A;  1WTO A;  4JBM A;  3BU2 A;  5G3L F;  2DJF C;  5I2X A;  2D0O A;  4DR2 L;  3ULP A;  1SNO A;  3NUC A;  4A3F G;  1LTG D;  3F8T A;  2RHS B;  1P16 A;  2M00 A;  4ZCK A;  2EZV A;  2JA7 H;  2OQK A;  1HR0 W;  4G7H C;  4JK1 C;  4A3B G;  1H9S A;  4L6T B;  1N34 Q;  3I4L A;  4JV5 L;  4OWW B;  3NBH A;  2AKW B;  4CBV A;  4A3J H;  2E5L L;  4CDD C;  4IOA A;  3PGZ A;  5D3I B;  1X3F A;  2NVX H;  4JBK A;  1S5E D;  2CVR A;  4QCL A;  2NUC A;  5C3E H;  2Z0S A;  3A5Z B;  3RUZ A;  1LTI D;  3CW2 C;  2NVT H;  1D5X C;  2IHE A;  3H09 A;  3DHQ A;  4BA1 I;  5IIF A;  3EQL C;  4LF6 L;  1IYV A;  3CPF A;  3PUY A;  5M3M B;  2F1M A;  1JB3 A;  5FO7 B;  3M3Y B;  2ICE C;  1QNU A;  4EQN A;  2F03 A;  3V96 A;  1YEZ A;  1VQC A;  4IQZ A;  2F0D A;  4XYQ A;  1BNZ A;  5JJL A;  4LFB L;  1KIX A;  4WJW A;  1A62 A;  3IAY A;  2NVQ B;  3R2T A;  2F0K A;  2L4N A;  3OIP A;  2QIL A;  2AQ2 B;  3CC4 A;  2BH2 A;  3QO2 A;  2R92 B;  3OMC A;  5EKK A;  5LHY 1;  3MC0 B;  2L11 A;  2IY5 B;  1YNN D;  5C0X H;  5C44 B;  3BJU A;  4J1M A;  2WAC A;  4DR4 L;  3MZ5 A;  2JK8 A;  1LAB A;  4DAY A;  3CRK C;  1MIU A;  5CV7 A;  3V2T A;  3CCQ A;  4B3T Q;  1CUK A;  2ICI A;  5C4X H;  2EY5 A;  4GKK L;  3DM3 A;  4R4O A;  3MTS A;  4NPS A;  1I4X A;  2C9O A;  3PUX A;  2MFI A;  5TSS A;  4K14 A;  3S2H H;  1Y1W H;  4I65 A;  1KXL A;  1BCP C;  1XTD A;  1SJE D;  4X66 Q;  2BH8 A;  1TR5 A;  3FPP A;  5I6W A;  4DUZ Q;  1YHQ A;  1PH2 A;  1MSG A;  1CTM A;  1WVL A;  2B8G A;  3FRP B;  1BF4 A;  3AFQ A;  3M85 A;  3G4S A;  1RHP A;  2RVL A;  1LLR D;  4A93 B;  1HNX Q;  2G9D A;  1LTL A;  1V9P A;  4KTA A;  2AUK A;  1Q90 A;  4GNX B;  1SMY D;  2WB1 B;  1N34 L;  3FKI B;  2TSS A;  1YHA A;  4DK0 A;  1S5B D;  3DM1 A;  2HQE A;  3P20 A;  1F2L A;  2KCM A;  2MUY A;  1RIP A;  1WD0 A;  3S15 H;  2WIN B;  2WP8 J;  4JOI C;  4RCN A;  4JI4 Q;  3W3A A;  3RZO B;  4PZ6 A;  1TKW B;  3M9B A;  5M3F B;  3VA5 A;  3U9O A;  2RCN A;  3D3R A;  1HQR D;  1U4M A;  2E75 C;  3RD4 A;  4DA2 A;  3SK8 A;  3I4M G;  2FIN B;  3IKJ A;  1TWF H;  5HY6 A;  2EPB A;  2R7Z B;  1UE5 A;  3L2P A;  1XJV A;  2CCZ A;  2L9H A;  4V19 0;  2ID0 A;  4O0A A;  2VXW A;  4X6A H;  1NCV A;  1V43 A;  3FHW A;  2QCP X;  1I3Q H;  4C3J G;  4B9W A;  2O4X A;  1V1P A;  3KF8 A;  1VQ6 A;  3HOZ G;  3RR5 A;  4DK6 C;  3CC2 A;  4FF2 A;  5IT9 L;  1X3E A;  2NZ1 D;  2WAQ E;  4JI5 Q;  3J80 c;  3ULJ A;  5E7N A;  4A3F H;  1X54 A;  1VQD A;  4QUF A;  3HOU G;  5LL6 S;  4HJ9 A;  2PNH A;  2Q8T A;  5J1Z A;  3I3C A;  4B3T L;  2R6G A;  2B2T C;  1I5F A;  1RKN A;  4A3B H;  2PZU A;  4KD4 A;  4FNF A;  4L63 B;  5JAV A;  2QA4 A;  1DOL A;  2A69 D;  3TP7 A;  2IX0 A;  5KYI A;  5E4X A;  2EY2 A;  3NTK A;  1C0A A;  2KHI A;  2Y0S G;  2NVX B;  4OO1 I;  5M5X H;  3TME A;  4CJ2 C;  2F0W A;  4L5T A;  4X66 L;  4QJF A;  5FJ8 H;  1WTV A;  1I6H H;  4DUZ L;  2A68 C;  3UE0 A;  3J80 E;  4BY7 H;  4QY7 A;  3H15 A;  4LUO A;  4DR5 Q;  1YNX A;  2JA8 G;  3VYU A;  5EGT A;  1HNX L;  5FLX c;  1T9H A;  4NP5 A;  2AWN A;  4BBR G;  1B70 B;  3GV6 A;  2GVA A;  1S5F D;  4HIK A;  1VQ4 A;  2QKI C;  4IJH A;  1JQY D;  1GXD C;  3K5L A;  2F0T A;  2Q2I A;  3OMG A;  2HCC A;  1I4R A;  4FO2 A;  2ZXP A;  4KK7 A;  3SGI A;  2VB3 X;  1SNM A;  4KLK A;  4JI4 L;  2B3G A;  3J7A F;  5C4J B;  1EQQ A;  4Y7N H;  4FF4 A;  3J80 i;  3S1R B;  1I4Q A;  1SNQ A;  1K8A C;  3BDL A;  3TP5 A;  4DR7 Q;  4JPB W;  1VQ9 A;  1PTO D;  5JJK A;  2YTV A;  3HKZ G;  2R92 G;  1RJT A;  3EBE A;  4ZKB B;  1EWH A;  5DM6 3;  3HEJ A;  1BBW A;  2RF4 A;  3H6M A;  3TEH B;  4K5X A;  2ZJQ A;  4FXK C;  1Y1W B;  1DYQ A;  2PW5 A;  1ET6 A;  3ERQ A;  4HCE A;  2UUB Q;  4BBS B;  2J0T D;  2V1C C;  2BA1 A;  3S2D B;  5EPJ A;  4IFD G;  5K36 G;  3AB9 A;  4BY1 H;  2RDF A;  4XYO A;  3PIP A;  4XIG S;  3FMC A;  3KDF B;  4FDB A;  5IGD A;  3S1Q H;  3V05 A;  2R93 G;  3KK7 A;  3L0O A;  3W1B A;  1QOH A;  3OSO A;  3E5S A;  4JI5 L;  1TWC B;  1ASZ A;  1OXX K;  2K5W A;  3K6O A;  4H13 C;  1KC8 C;  1WCM B;  3RLN A;  2Q8R E;  4LMQ D;  3AMU A;  4M8A A;  4J8Q A;  3PCO B;  4A4I A;  4A3E G;  2VL6 A;  4G4K A;  5IYB H;  1NJI C;  1EIY B;  1J9O A;  3A56 A;  3UDX A;  4JI3 Q;  1I50 H;  5IGB A;  1C48 A;  1S4Z A;  4O42 A;  1PH1 A;  5C0X I;  2ZM6 Q;  3QIA A;  2O5I C;  1SN8 A;  1BDO A;  3KYH C;  1JE5 A;  4EQP A;  2WB1 G;  3OW7 A;  1FVI A;  1KDC A;  3U9S A;  3OPO A;  1EEI D;  3HOX B;  4DR5 L;  1TII D;  2B39 A;  3LGJ A;  1EQV A;  4F88 A;  3I2Z A;  2A6E C;  1NNX A;  3I4M H;  1TWF B;  2GA4 B;  3BVM A;  4DR1 Q;  4P2C B;  3I72 A;  2CH4 A;  3HOW B;  4GNX C;  2JP1 A;  2RDH A;  5M3F G;  5ELB A;  4P71 A;  4JI6 L;  4OHJ A;  4DNR B;  1QNK A;  5GAE C;  1STY A;  1I3Q B;  4PNY A;  3HG9 A;  1A2T A;  5E3F A;  3MAQ A;  1MI2 A;  1F2Z A;  2KEN A;  2VUM H;  4C3J H;  2AQ3 B;  3D4D A;  3E9I A;  2R7Z G;  1AW7 A;  4TRD A;  3NK9 A;  3NEN A;  1U5K A;  4HSV A;  2ZTD A;  3SEB A;  4R9W A;  1SND A;  3GTK H;  2Q2H A;  1XNR Q;  2WFW A;  1WJJ A;  2OEO A;  5H1S E;  3I4O A;  4DV7 Q;  4K8J A;  3RNU A;  4A3F B;  1B44 D;  4DR7 L;  3GTM H;  3T56 B;  3DUZ A;  1S5C D;  1PVO A;  3HOU H;  1B4O A;  5BR8 Q;  3KLS A;  4CGY B;  2XSC A;  3VR2 A;  1E22 A;  5CC4 A;  4KI0 A;  4A3B B;  1BR9 A;  2BE5 D;  1CKN A;  2IJ0 A;  2JEA I;  2OTJ A;  4R4Q A;  5EBC A;  1A3V A;  5E1F A;  5M5W H;  2EYH A;  2LFN A;  2KJX A;  4JI0 Q;  4K5W A;  3CQZ B;  2UUB L;  1LTA D;  3A0J A;  2D62 A;  3TP8 A;  1X32 A;  3I91 A;  1I94 Q;  3R8B A;  5AJ3 Q;  4MTN A;  4HMI A;  1JR0 D;  2F0P A;  1SRU A;  1SXT A;  1VCI A;  4LF4 Q;  1A15 A;  3K0X A;  3S24 A;  2K5Q A;  4CJ0 B;  4KMU C;  2K04 A;  1JC7 A;  1KRS A;  1NAP A;  5CGK A;  4UHV A;  4TQU S;  5CBE E;  1XNQ Q;  4RGM A;  2XN9 C;  4GOP C;  2QGQ A;  4KHZ A;  2HD3 A;  3S16 B;  3M4P A;  3SK5 A;  1JWU D;  5BN5 A;  5C0X J;  1N32 Q;  3K7A H;  4X3S A;  3K80 C;  2PI2 E;  2SDF A;  4JI3 L;  5IGE A;  1SE3 A;  2HDL A;  2HIV A;  2MHV A;  5M3M H;  3CCR A;  2F0H A;  4AQY Q;  4A3D G;  2EJM A;  2XNA C;  4EQ5 A;  2ZM6 L;  1YJ9 A;  3STB C;  3PIO 3;  3M3Y H;  3X3N A;  1AH9 A;  3VYT A;  2AMC B;  4Y7N B;  1VQN A;  2F0U A;  2R7D A;  1GUO A;  4OIJ A;  1EFW A;  1BCP B;  2B2U C;  3NQI A;  3BVG A;  3DWQ A;  3PO3 B;  3R3O A;  1SYE A;  3SR1 A;  2CH4 W;  4DR1 L;  1VQ5 A;  2R92 H;  5T1I A;  2N78 A;  2EDG A;  2EJF C;  3ERS X;  5C44 H;  1JB7 A;  3F2C A;  4DV6 Q;  1E2Z A;  2QDB A;  2R3Z A;  2KBN A;  1PRT F;  3W1G A;  5K36 H;  3T1Y Q;  4DAP A;  1Y14 B;  2EXD A;  4DXG A;  3AEV A;  3S1Q B;  1D1K A;  1II3 A;  2R93 H;  1SE8 A;  4DNT B;  1XNR L;  3MXU A;  3NHH A;  1PRT D;  3D8G A;  4RAU C;  3CKI B;  1QUQ B;  1X6O A;  4C3H G;  1QCB D;  2MNA A;  1CSP A;  4DV7 L;  1NUC A;  4GN5 A;  3NTH A;  1TXY A;  4BBS G;  1EYG A;  5JEA G;  3HKS A;  5BR8 L;  2KED A;  2K6A A;  3FDT A;  2HUG A;  4QQB X;  3I7F A;  1I50 B;  1UE6 A;  2E74 C;  5DLQ E;  5GAG C;  3L3O C;  4KY5 A;  1PZJ D;  5GRO A;  4Q0F A;  3PUZ A;  3K0Y A;  1Q82 C;  1B50 A;  1V8Q A;  5I2Y A;  4JI0 L;  5KGU A;  2NN6 H;  5COY A;  4A93 H;  4HCS A;  3OOC A;  1NR4 A;  5GQO A;  1WCM G;  1I94 L;  3DEP A;  5AJ3 L;  1A3U A;  1LTB D;  3DXJ C;  3KOJ A;  4LF4 L;  3FKI H;  3GP7 A;  1CSQ A;  4HID A;  1HQM C;  3RN2 A;  2PZW A;  4O1N A;  1DOK A;  1XMO Q;  4JBJ A;  3I4M B;  1XNQ L;  3AU7 A;  5KEE A;  3LWU A;  4HN7 A;  3W2D A;  2XRQ D;  1DM0 B;  2B8F A;  2TMP A;  1UEA B;  2F0I A;  1N32 L;  1YNJ C;  1Y1V G;  4DV0 Q;  2BCO A;  2B2Y A;  3K7U C;  3RZO H;  1EWI A;  1EYD A;  2A73 B;  4RWS C;  3HGB A;  5M3F H;  1GJX A;  3HOX G;  1IYU A;  3KBG A;  2LSS A;  1E0B A;  2N8N A;  1EOV A;  1IL2 A;  4ZLT F;  1KNA A;  4AQY L;  2DY7 A;  1IW7 D;  3QWN A;  4LNQ A;  2A5H A;  2DNC A;  3HOZ B;  2R7Z H;  1TS3 A;  1YVC A;  4FYD A;  5EAY A;  3CPW A;  3GTK B;  5ELC A;  3NEL A;  1ASY A;  3J7A 5;  3OWE B;  2E2D C;  1R9T H;  3Q6S A;  4KJO A;  3HP3 A;  2J4X A;  1L1O A;  2E2J B;  3A55 A;  1XTC D;  1QIL A;  3JAM c;  1K9M C;  2CWA A;  3TZU A;  4PMC A;  1KLU D;  2LMC B;  1CHQ D;  5M5W B;  1O7Z A;  2Y0S B;  1K0R A;  1D1I A;  2JEB I;  4PZ8 A;  4DV6 L;  1TWA B;  3LX0 A;  4JW0 A;  5L37 A;  3H91 A;  1CA6 A;  1G6Z A;  4PG3 A;  4XQJ A;  5C3X A;  5LMU Q;  1CZW A;  4LK1 C;  3T1Y L;  1GM5 A;  1HTL D;  1O80 A;  1HUM A;  3P1H A;  1W3S A;  2QDL A;  1Q12 A;  3RLF A;  3MWY W;  2JA8 B;  1EY7 A;  1DCZ A;  4POG A;  4JI7 Q;  4POF A;  3JAM E;  4TSS A;  2Z6B A;  1LUZ A;  4R8N A;  4BBR B;  3EA6 A;  3K7A B;  1UE1 A;  3ULL A;  4LF8 Q;  4QB4 A;  2N49 A;  1X3P A;  4QGU A;  5COR A;  4K2K A;  3U50 C;  4BXX G;  4A75 A;  2IX1 A;  5JVH 3;  1YHB A;  1GUG A;  5EQ0 A;  4A3D H;  1OO9 B;  3A8J E;  1EYC A;  2BDO A;  3UDF A;  1PYW D;  1QVC A;  1GUN A;  3VA7 A;  4YCW A;  3R2I A;  1PH6 A;  3R93 A;  3A74 A;  1XMO L;  4B9X A;  3MXN B;  4IZ8 A;  3HKZ B;  2EY6 A;  1LTS D;  5C4H A;  2A19 A;  1SMX A;  3E9H A;  2B2W C;  2EYF A;  3JAM i;  4JOI A;  1JT8 A;  4MN3 A;  4DV0 L;  1Z47 A;  1K3R A;  5IYD G;  5C4J H;  2A8V A;  1QE6 A;  4XT3 B;  2I0Q A;  3S1R H;  2QEJ C;  1VQM A;  4CKE A;  4OEM B;  4RGT A;  5F2D A;  2UU9 Q;  1BO0 A;  2OCE A;  4RHS A;  1S5D D;  3PO3 G;  2EXZ A;  2FXQ A;  1HNW Q;  4HJA A;  3OHX C;  1R4Q B;  2HQL A;  1UUP A;  4FXD A;  2B63 B;  1FYC A;  2R93 B;  3KUP A;  5LMN W;  4V0B A;  1TS5 A;  3MXP A;  5ELF A;  4C3H H;  3M4O B;  5EPK A;  2RHQ B;  2AWO A;  5FLM H;  4BBS H;  1YIT A;  4L8J A;  3S2D H;  3OW2 A;  1IHZ A;  3H0G G;  5JEA H;  4A3E B;  4NXN Q;  4JBW A;  3K57 A;  4RKB A;  1O7I A;  1ESF A;  4XQQ A;  1EIF A;  2E76 C;  2I07 B;  4X62 Q;  2VS1 A;  1KAB A;  2JYO A;  3HOV G;  4OON A;  4LF5 Q;  1EUJ A;  3QR8 A;  2UUA Q;  1TWC H;  1E24 A;  3HFZ B;  4NW2 A;  1VQ7 A;  2PMZ E;  1WCM H;  2ZJR A;  2SNM A;  2A6H C;  5LMU L;  3E3X A;  1K83 B;  2CQO A;  3MEF A;  2SOB A;  2B2T A;  4LUZ A;  5IYC G;  4UP9 A;  1K8G A;  2L12 A;  4ULL A;  1N36 Q;  2JN4 A;  1EQR A;  1CKO A;  1DJR D;  3X3M A;  4JI7 L;  4WRD A;  4QIW E;  2F0N A;  1I4G A;  1B53 A;  1STG A;  1WTX A;  4CKC A;  4BA2 I;  2RSO A;  1TS4 A;  4LF8 L;  1IKM A;  4C2M B;  1YBY A;  2CHB D;  1Q1E A;  4LF7 Q;  4A3K G;  4DR6 Q;  1Y8O B;  3HOX H;  1SYC A;  2M9V A;  4F8M A;  4LF9 Q;  1MD2 D;  3A7L A;  3TSS A;  1BCP D;  1T5E A;  1E1O A;  4KKS A;  5J3B A;  2G5D A;  1G29 1;  4G7Z C;  3TP6 A;  1H9R A;  1H95 A;  2PQA B;  1UNS A;  2BA0 A;  1I4H A;  2Z4I A;  4GN3 B;  3WOF A;  3N6R A;  1DXM A;  3TQY A;  3HOW H;  1X65 A;  1B3Q A;  1SR3 A;  2YU9 B;  2LS0 1;  1MJC A;  4F87 A;  1UE7 A;  3K5O A;  1VQJ A;  1WFQ A;  1R9T B;  2JA5 G;  3W5O A;  1WTR A;  1UAP A;  1HFN A;  5C4Z A;  4M1U B;  4CDF C;  1X3G A;  2I46 A;  1B7Y B;  2NN6 I;  4GOP B;  1MSH A;  2RKS A;  4YIJ A;  1YI2 A;  5FKA C;  4ODG A;  3F2D A;  2RQX A;  2UU9 L;  4C1N I;  1EU4 A;  1S72 A;  1HNW L;  1Y8N B;  5FOB B; 
#chains in the Genus database with same CATH homology
 1C4Q A;  2DY8 A;  1STN A;  2J7Z A;  3GTQ B;  4AYB B;  3H3V C;  3NQT A;  1TY2 A;  5IGC A;  1EY8 A;  3J81 L;  5C5M A;  1JOO A;  5J22 A;  3I70 A;  1PLF A;  1Q1B A;  2KCN A;  2FMM A;  5C3W A;  2B2V A;  3K5N A;  4A3D B;  4ZYS A;  2KA7 A;  5CV9 A;  4NMZ A;  4E6I A;  2DNE A;  3QB3 A;  3HZX A;  3L7Z C;  2IWH A;  2OF1 A;  4FXG C;  4G7O C;  1EL0 A;  3M4Y A;  1PTO F;  1SBB B;  1ONL A;  1EIG A;  3KBX A;  1SSO A;  3K58 A;  1VMP A;  2EOT A;  3GV3 A;  3QOL A;  3D4W A;  3SXH A;  2DN8 A;  2F0G A;  4C3H B;  1OXV A;  3S1N B;  3ND8 A;  2R61 A;  1RDP D;  3QOJ A;  1TWG B;  3MA2 B;  1PZK D;  2LKV A;  5CV8 A;  1TVX A;  4IAL A;  5JPM C;  3EVQ A;  5D3D A;  4IUP A;  2L5T A;  2L55 A;  4IUQ A;  1GUT A;  4QF4 A;  5NUC A;  3BYT B;  2AUJ D;  2EYM A;  4KV6 A;  1FNV A;  1A6X A;  1NR2 A;  1PMR A;  5KIX A;  4ZK9 B;  1F2M A;  1RD9 D;  1HTP A;  3A54 A;  3GTP B;  1Y1V B;  5CV4 A;  4IUU A;  3VYS A;  5JVG 3;  4Q5V A;  1M4V A;  3PV0 A;  3ERO A;  2FJ2 A;  1C8C A;  3K59 A;  2NYZ D;  1OXS C;  1LAC A;  4PQX A;  1Y69 U;  3LWE A;  5ELD A;  4IUN A;  3LNN A;  1RCV D;  1EWC A;  4KHV A;  1HHV A;  1ML0 D;  4HSP A;  2K33 A;  5IT9 E;  4OO1 G;  5EKI A;  1LV9 A;  2EYJ A;  5JPN C;  1F9Q A;  2LY7 A;  2K1B A;  5DNF A;  2B2U A;  1AFP A;  3GTJ B;  3DMU A;  4EQO A;  1QJO A;  5D65 A;  2PQE A;  1LT3 D;  2Z8L A;  1ROD A;  4UAI A;  1GHK A;  1KDB A;  2PYK A;  3J81 E;  4X3K A;  2A6E D;  4RKL A;  3Q24 A;  2MJ8 A;  1LTT D;  1W6K A;  1D5Z C;  2F4I A;  5T1G A;  1HRJ A;  3A8K E;  3BYY B;  3NPP A;  4K8I A;  2EYP A;  3T16 A;  1CK1 A;  1U4P A;  1WTW A;  4HMJ A;  4ZUJ A;  2EYL A;  1IKL A;  3T13 A;  5BN3 A;  2CW0 C;  1MBY A;  2FFK B;  5A2Q L;  1XX8 A;  3EFX D;  1GHJ A;  1FD7 D;  4IUR A;  2OXP A;  4H44 C;  1GUS A;  1TT2 A;  4EVO A;  1PRT C;  1O7L A;  2F3W A;  1JOR A;  1H9S B;  2KOL A;  1SAP A;  2C5C A;  1WTQ A;  3SDZ A;  2D5D A;  5CR3 A;  4IFD H;  3H0G B;  4KKU A;  1ZYR C;  3NBI A;  3VR6 A;  1TY0 A;  2EE1 A;  5C0X G;  3HOV B;  1BUV T;  3NSW A;  4CJ1 B;  2WKD A;  1A3T A;  3RZD B;  4FF3 A;  3J7Y W;  4DXF A;  2XVS A;  3VR5 A;  3ONA B;  1HFG A;  2PCF B;  2X69 A;  3BVZ A;  1F77 A;  2F3V A;  3GTL B;  4IUT A;  1CQV A;  1WTP A;  1ENF A;  1G2S A;  4C1N K;  5DEH A;  3ND9 A;  2L1B A;  3Q0A A;  1EY0 A;  4A3K B;  4XTC S;  1BOS A;  1ENA A;  4KD3 A;  5E4W C;  3K5M A;  1ENC A;  1PFN A;  3M7G A;  3DWP A;  1Q3L A;  2F0E A;  1Q8I A;  3GTO B;  4RHR A;  3N52 A;  2JA5 B;  5I9P A;  3QG1 A;  2K01 A;  4KN4 C;  1LT5 D;  2NWG A;  1BQQ T;  2RSN A;  3CRL C;  3SE0 A;  5A35 A;  2Z1C A;  5J39 A;  1SYF A;  4CHT B;  4ID6 A;  4WOR A;  3P75 A;  4G57 A;  1HCZ A;  3TZD A;  1F9R A;  3GD7 A;  3C1F A;  3SHL A;  1YNJ D;  1D5M C;  3G7L A;  4XXE A;  2KUM A;  1JIC A;  1LT4 D;  2FHT A;  3T53 B;  4QUC A;  1RTN A;  5EBD A;  4A3I B;  1XYI A;  1SYD A;  1U4L A;  3E0J A;  2JXM B;  3EJI A;  5G3L D;  3H94 A;  1YNN C;  1AZP A;  2EYO A;  1KDA A;  3D6W A;  5A2Q E;  2EVB A;  1V1P B;  2F0O A;  1PFB A;  1RTO A;  1EY5 A;  3F2U A;  4IN3 A;  2B2Y C;  4QMG A;  3PMF A;  2E2I B;  3J80 L;  5EJW A;  2K5D A;  1ET9 A;  4RCO A;  1CT1 D;  1QB5 D;  1JWM D;  5KNB A;  4WFN 3;  1EZ8 A;  1Z6H A;  3FEW X;  4K6D A;  3HRZ C;  2H4O A;  5DM7 3;  4U68 A;  1EYA A;  2CQA A;  1OXT A;  3D4R A;  2NVY B;  4NDX A;  4F7X A;  1VF7 A;  2N55 A;  3Q22 A;  1SMY C;  4HED A;  1TQO A;  1AP0 A;  1SFO B;  3PO2 B;  2X6L A;  5FLX L;  2VB2 X;  3IL8 A;  4DK1 A;  2KQ3 A;  4DGZ A;  2PPB C;  1ILQ A;  3IFD A;  1B1Z A;  3NXW A;  3S1M B;  3S9W A;  5I9O A;  3SK4 A;  4N9P A;  2KHS A;  3GQB A;  1LTR D;  2HDM A;  3BDC A;  2M2L A;  5CBA E;  1STE A;  3J7A V;  2RDG A;  1TS2 A;  1BCP F;  1CA5 A;  4DAV A;  3I8Z A;  2JE6 I;  2EY1 A;  2E2H B;  3CU7 A;  5ELE A;  1X3Q A;  4C3I G;  4HTH A;  2PZT A;  4IFD I;  3PIP 3;  4H7B A;  2JSO A;  4DF7 A;  2ZXR A;  5CYU A;  5KNC A;  3GTG B;  1F9P A;  1R4P B;  1RF2 D;  2SEB D;  1KTK A;  2K03 A;  3KLR A;  2D2C C;  2VNU D;  1O7Y A;  5I6Y A;  1G2T A;  2A69 C;  2HCI A;  2IL8 A;  2A6H D;  4U67 3;  1AEX A;  1STA A;  1EU3 A;  3CHB D;  4A3M B;  5BN4 A;  2IW3 A;  4K2L A;  1F9S A;  2XRS D;  3SK6 A;  1G91 A;  1I6V C;  4IUV A;  1QWY A;  5IOD A;  2K7V A;  4A3G B;  4XQN A;  1OXU A;  1AN8 A;  1XXG A;  1FGB D;  1STB A;  1EFI D;  2JA7 B;  3MXN A;  4RA8 A;  2O5J C;  1PDQ A;  3BG3 A;  1IL8 A;  1PRT B;  1CI3 M;  1NSN S;  4A3J B;  2BDN A;  1JWS D;  3P7J A;  3I90 A;  5C3E B;  1PTO C;  3ITP A;  3T4A C;  1AZQ A;  3HS0 C;  2NVT B;  4KY6 A;  2PNR C;  2O2L D;  2ZXO A;  4RFB A;  4IFD J;  2PO4 A;  4ABN A;  1ICW A;  3S14 B;  5IGF A;  1CZG A;  3TDQ A;  4MIU A;  1J8I A;  1B2T A;  1T5X D;  3C1E A;  3A8I E;  3DEO A;  1WD1 A;  2A74 C;  2A68 D;  2IT1 A;  4OGQ C;  1SYB A;  3E6Z X;  3NWT A;  2EJG C;  5FLX E;  1HA5 A;  3D31 A;  4EGV A;  1ZEQ X;  3BS1 A;  3Q23 A;  1KNE A;  5C6A A;  2F0F A;  3G6J B;  3NTI A;  3C3L A;  1H9K A;  4B08 A;  1D2B A;  2KCC A;  4LAA A;  3HOY B;  4X3U A;  2PW7 A;  1A2U A;  5C4X B;  4BWG B;  4PMW A;  3WOE A;  3O13 A;  4BS9 A;  5IOC A;  2KVM A;  2FMC A;  3S2H B;  3BZD B;  1CFM A;  3VR3 A;  1TWH B;  1L0Y B;  1H9J A;  2YYZ A;  1SE4 A;  4R8I A;  5KYL A;  2NTT A;  1HXY D;  3NP8 A;  1E2W A;  2B2V C;  5HUR A;  4UDU C;  2H1E A;  4TKO B;  4ZAI A;  1DOM A;  2N88 A;  4X3T A;  5DAU A;  2IX3 A;  1ZXT A;  1EQT A;  1I4P A;  1QG7 A;  1K8O A;  2QF7 A;  1SDF A;  1K8M A;  2Q8I B;  2NN6 G;  3S15 B;  3L9A X;  1LT6 D;  4OIK A;  4PMB A;  1PZI D;  4XT1 B;  1EOT A;  3DWA A;  3OIQ A;  2WII B;  1TU2 B;  2BE5 C;  1SJH D;  3MVV A;  1U9R A;  2ENB A;  2F0L A;  4ZUI A;  2F0Q A;  5LL6 X;  1Y8P B;  1L0X B;  2K28 A;  4ZRZ A;  3D6C A;  2KEE A;  1CM9 A;  1HPC A;  1F2Y A;  5CV5 A;  4FVM A;  4HAE A;  1VF5 C;  3TN2 A;  3MHB A;  3UI2 A;  1G8Z D;  2NBF A;  4Z9C B;  4KKT A;  1FNU A;  3FVQ A;  5EPL A;  3GO5 A;  2PMZ B;  2Z4H A;  2F0J A;  4DFA A;  4HR7 B;  2X6G A;  1XWE A;  2SNS A;  1PTO H;  1U4R A;  4RGN A;  1PXU A;  3URY A;  1EY4 A;  2WV6 D;  2MGS A;  4K6L A;  5JOB A;  3VR4 A;  5FK9 C;  1SNC A;  4OL7 A;  3MFG A;  4QIW B;  3M7N A;  2RBM A;  4DN4 M;  2MPM A;  5M5X B;  1M8A A;  5CMD A;  1I6H B;  2F0S A;  2NTS A;  5C5L A;  1KAA A;  4BY7 B;  3QJY A;  2K05 A;  1SYG A;  4MHE A;  4CKB A;  3S17 B;  3PUW A;  3RMH A;  3JAM L;  1JE4 A;  5I4D A;  5HGT A;  3SVM A;  5KND A;  3VYR A;  5JEA J;  1W6J A;  1SEB D;  1KLG D;  2F0V A;  2XIW A;  3KLS X;  2WAQ B;  3MFY A;  1PFM A;  3WDN A;  3FPU B;  1E2V A;  4J6H A;  2IPK D;  5ISR A;  1B3A A;  5D14 A;  3ZYY X;  2L0C A;  5AFW A;  2CW0 D;  3IFT A;  1DD2 A;  4N9T A;  2BOS A;  1O78 A;  1ESR A;  1JOQ A;  4BY1 B;  5JJZ A;  3I73 A;  3C46 A;  1FNW A;  2MP1 A;  2XWJ B;  2K32 A;  4DU9 A;  3MEH A;  2KEC A;  3OWF A;  4ZKC B;  1Z7T A;  4ILW A;  1IW7 C;  4C3I B;  4KY7 A;  4K5V A;  2AQ1 B;  2ZT9 C;  1SE2 A;  2F0M A;  1EZ6 A;  2V4D A;  2NB0 A;  5M5Y B;  3PUV A;  1DON A;  1ZYR D;  1GUW A;  4ZQ3 A;  5FO9 B;  3NE5 B;  4XDX A;  1JCK B;  1DZ1 A;  4FF1 A;  1V1O A;  1HUN A;  5CV6 A;  1SNP A;  1BXT A;  5EKL A;  4FP5 D;  4C56 C;  1HA6 A;  4KJN A;  5M9O A;  5K5P A;  1EY6 A;  4PV1 C;  1CQF A;  2G9H D;  1ZKO A;  4OO1 H;  2OT2 A;  1VMC A;  4GZY C;  1JOK A;  4ME5 A;  1EIH A;  3NWS A;  1FR3 A;  1D6E C;  1B9M A;  3C2P A;  4H0L C;  1LO5 D;  5KRU A;  2JA6 B;  2XWB B;  1GOZ A;  2D9U A;  4C3J B;  2VUM B;  3T51 B;  2B2W A;  1VDZ A;  4S3S A;  1MGS A;  3I4N B;  1B9N A;  1BBX C;  5FO8 B;  3TBI B;  2WKC A;  3GTM B;  1EEF D;  1PTO B;  1EY9 A;  4RH6 A;  3HOU B;  4KN7 C;  1CHP D;  3A7A B;  4LJZ C;  1H9M A;  4I7Z C;  2RA4 A;  3MXG A;  5IGG A;  3BDO A;  1STH A;  1ILP A;  4RGO S;  4NKL A;  1WTO A;  5G3L F;  5I2X A;  1SNO A;  3NUC A;  1LTG D;  2M00 A;  2EZV A;  4G7H C;  4JK1 C;  1H9S A;  4L6T B;  3I4L A;  3NBH A;  4CBV A;  5D3I B;  1S5E D;  2CVR A;  4QCL A;  2NUC A;  3RUZ A;  1LTI D;  1D5X C;  3H09 A;  3DHQ A;  4BA1 I;  5IIF A;  3EQL C;  1IYV A;  3PUY A;  5M3M B;  2F1M A;  1JB3 A;  5FO7 B;  3M3Y B;  2ICE C;  1QNU A;  4EQN A;  2F03 A;  3V96 A;  4IQZ A;  2F0D A;  4XYQ A;  1BNZ A;  4WJW A;  3IAY A;  2NVQ B;  3R2T A;  2F0K A;  2L4N A;  3OIP A;  2QIL A;  2AQ2 B;  3QO2 A;  2R92 B;  3OMC A;  5EKK A;  5LHY 1;  3MC0 B;  2L11 A;  1YNN D;  5C0X H;  5C44 B;  4J1M A;  2WAC A;  3MZ5 A;  1LAB A;  4DAY A;  3CRK C;  5CV7 A;  3V2T A;  2ICI A;  2EY5 A;  3MTS A;  1I4X A;  2C9O A;  3PUX A;  5TSS A;  4K14 A;  4I65 A;  1BCP C;  1SJE D;  1TR5 A;  3FPP A;  5I6W A;  1MSG A;  1CTM A;  1WVL A;  2B8G A;  3FRP B;  1BF4 A;  3M85 A;  1RHP A;  2RVL A;  1LLR D;  4A93 B;  2G9D A;  4KTA A;  2AUK A;  1Q90 A;  1SMY D;  2WB1 B;  3FKI B;  2TSS A;  4DK0 A;  1S5B D;  3DM1 A;  2HQE A;  3P20 A;  1F2L A;  2MUY A;  1WD0 A;  2WIN B;  2WP8 J;  4RCN A;  3W3A A;  3RZO B;  1TKW B;  5M3F B;  3VA5 A;  3U9O A;  3D3R A;  1HQR D;  1U4M A;  2E75 C;  3RD4 A;  4DA2 A;  3SK8 A;  2FIN B;  3IKJ A;  2EPB A;  2R7Z B;  2L9H A;  4V19 0;  2ID0 A;  2VXW A;  1NCV A;  1V43 A;  2QCP X;  4C3J G;  4B9W A;  2O4X A;  1V1P A;  3KF8 A;  4FF2 A;  5IT9 L;  2NZ1 D;  4QUF A;  5LL6 S;  2Q8T A;  5J1Z A;  3I3C A;  2R6G A;  2B2T C;  1RKN A;  2PZU A;  4KD4 A;  4FNF A;  4L63 B;  5JAV A;  1DOL A;  2A69 D;  3TP7 A;  2IX0 A;  5KYI A;  5E4X A;  2EY2 A;  3NTK A;  2NVX B;  4OO1 I;  3TME A;  4CJ2 C;  2F0W A;  1WTV A;  2A68 C;  3J80 E;  3VYU A;  5EGT A;  4NP5 A;  2AWN A;  3GV6 A;  1S5F D;  2QKI C;  1JQY D;  1GXD C;  3K5L A;  2F0T A;  3OMG A;  2HCC A;  1I4R A;  4FO2 A;  2ZXP A;  4KK7 A;  2VB3 X;  1SNM A;  3J7A F;  5C4J B;  4FF4 A;  3S1R B;  1I4Q A;  1SNQ A;  3BDL A;  3TP5 A;  1PTO D;  1RJT A;  4ZKB B;  1EWH A;  5DM6 3;  3HEJ A;  3H6M A;  4K5X A;  4FXK C;  1Y1W B;  1DYQ A;  2PW5 A;  1ET6 A;  3ERQ A;  4HCE A;  4BBS B;  2J0T D;  2BA1 A;  3S2D B;  5EPJ A;  4IFD G;  5K36 G;  3AB9 A;  2RDF A;  4XYO A;  4XIG S;  3FMC A;  5IGD A;  3V05 A;  3KK7 A;  1QOH A;  3OSO A;  3E5S A;  1TWC B;  1OXX K;  2K5W A;  3K6O A;  4H13 C;  1WCM B;  2Q8R E;  4LMQ D;  3AMU A;  4M8A A;  4J8Q A;  4G4K A;  1J9O A;  3A56 A;  5IGB A;  1C48 A;  1S4Z A;  4O42 A;  5C0X I;  3QIA A;  2O5I C;  1BDO A;  4EQP A;  3OW7 A;  1KDC A;  3U9S A;  3OPO A;  1EEI D;  3HOX B;  1TII D;  2B39 A;  1EQV A;  4F88 A;  2A6E C;  1TWF B;  2GA4 B;  3BVM A;  4P2C B;  3I72 A;  3HOW B;  2JP1 A;  2RDH A;  5ELB A;  4OHJ A;  4DNR B;  1QNK A;  1STY A;  1I3Q B;  4PNY A;  3HG9 A;  1A2T A;  5E3F A;  3MAQ A;  1MI2 A;  1F2Z A;  2AQ3 B;  3D4D A;  1AW7 A;  4TRD A;  3NK9 A;  4HSV A;  3SEB A;  4R9W A;  1SND A;  2OEO A;  4K8J A;  4A3F B;  1B44 D;  3T56 B;  3DUZ A;  1S5C D;  1B4O A;  5CC4 A;  3KLS A;  4CGY B;  2XSC A;  3VR2 A;  4KI0 A;  4A3B B;  1BR9 A;  2BE5 D;  2IJ0 A;  2JEA I;  5EBC A;  1A3V A;  5E1F A;  2EYH A;  2LFN A;  2KJX A;  4K5W A;  3CQZ B;  1LTA D;  2D62 A;  3TP8 A;  1X32 A;  3I91 A;  3R8B A;  4HMI A;  1JR0 D;  2F0P A;  1SXT A;  1VCI A;  1A15 A;  2K5Q A;  4CJ0 B;  4KMU C;  2K04 A;  1JC7 A;  1NAP A;  5CGK A;  4TQU S;  5CBE E;  4RGM A;  2XN9 C;  4KHZ A;  3S16 B;  3SK5 A;  1JWU D;  5BN5 A;  5C0X J;  4X3S A;  2SDF A;  5IGE A;  1SE3 A;  2HDL A;  2MHV A;  2F0H A;  2EJM A;  2XNA C;  3PIO 3;  3X3N A;  3VYT A;  4Y7N B;  2F0U A;  1GUO A;  4OIJ A;  1BCP B;  2B2U C;  3NQI A;  3BVG A;  3DWQ A;  3PO3 B;  3R3O A;  1SYE A;  3SR1 A;  5T1I A;  2EDG A;  2EJF C;  1E2Z A;  2QDB A;  2R3Z A;  1PRT F;  5K36 H;  4DAP A;  4DXG A;  3S1Q B;  1D1K A;  1II3 A;  4DNT B;  3MXU A;  3NHH A;  1PRT D;  3D8G A;  4RAU C;  3CKI B;  4C3H G;  1QCB D;  1NUC A;  3NTH A;  5JEA G;  2KED A;  2K6A A;  3FDT A;  2HUG A;  1I50 B;  2E74 C;  3L3O C;  4KY5 A;  1PZJ D;  4Q0F A;  3PUZ A;  3K0Y A;  1B50 A;  1V8Q A;  5I2Y A;  5KGU A;  2NN6 H;  5COY A;  4HCS A;  3OOC A;  1NR4 A;  3DEP A;  1A3U A;  1LTB D;  3DXJ C;  3GP7 A;  1HQM C;  2PZW A;  4O1N A;  1DOK A;  3I4M B;  3AU7 A;  5KEE A;  3LWU A;  4HN7 A;  3W2D A;  2XRQ D;  1DM0 B;  2B8F A;  2TMP A;  1UEA B;  2F0I A;  1YNJ C;  2BCO A;  2B2Y A;  1EYD A;  2A73 B;  4RWS C;  3HGB A;  1GJX A;  1IYU A;  3KBG A;  1E0B A;  4ZLT F;  1KNA A;  2DY7 A;  1IW7 D;  3QWN A;  2A5H A;  2DNC A;  3HOZ B;  1TS3 A;  4FYD A;  3GTK B;  5ELC A;  3OWE B;  2E2D C;  3Q6S A;  4KJO A;  3HP3 A;  2J4X A;  2E2J B;  3A55 A;  1XTC D;  1QIL A;  3TZU A;  4PMC A;  1KLU D;  2LMC B;  1CHQ D;  5M5W B;  1O7Z A;  2Y0S B;  1D1I A;  2JEB I;  1TWA B;  3LX0 A;  3H91 A;  1CA6 A;  1G6Z A;  4XQJ A;  5C3X A;  4LK1 C;  1CZW A;  1HTL D;  1O80 A;  1HUM A;  3P1H A;  1Q12 A;  3RLF A;  3MWY W;  2JA8 B;  1EY7 A;  1DCZ A;  3JAM E;  4TSS A;  4R8N A;  4BBR B;  3EA6 A;  3K7A B;  4QB4 A;  1X3P A;  5COR A;  4K2K A;  2IX1 A;  5JVH 3;  5EQ0 A;  1GUG A;  1OO9 B;  3A8J E;  1EYC A;  2BDO A;  1PYW D;  1GUN A;  3VA7 A;  3R2I A;  3R93 A;  4B9X A;  4IZ8 A;  3HKZ B;  2EY6 A;  1LTS D;  5C4H A;  2B2W C;  2EYF A;  4MN3 A;  1Z47 A;  1QE6 A;  4XT3 B;  2QEJ C;  4CKE A;  4RGT A;  5F2D A;  1BO0 A;  4RHS A;  1S5D D;  2EXZ A;  3OHX C;  1R4Q B;  1UUP A;  4FXD A;  2B63 B;  1FYC A;  2R93 B;  3KUP A;  4V0B A;  1TS5 A;  3MXP A;  5ELF A;  3M4O B;  5EPK A;  2AWO A;  4L8J A;  1IHZ A;  5JEA H;  4A3E B;  4JBW A;  3K57 A;  4RKB A;  1ESF A;  4XQQ A;  2E76 C;  2I07 B;  1KAB A;  2JYO A;  4NW2 A;  2SNM A;  2A6H C;  1K83 B;  2SOB A;  2B2T A;  2L12 A;  4ULL A;  1DJR D;  3X3M A;  4WRD A;  2F0N A;  1I4G A;  1B53 A;  1STG A;  1WTX A;  4CKC A;  4BA2 I;  2RSO A;  1TS4 A;  1IKM A;  4C2M B;  2CHB D;  1Q1E A;  1Y8O B;  1SYC A;  2M9V A;  4F8M A;  1MD2 D;  3A7L A;  3TSS A;  1BCP D;  1T5E A;  4KKS A;  4G7Z C;  1G29 1;  3TP6 A;  1H9R A;  1UNS A;  2BA0 A;  1I4H A;  2Z4I A;  3WOF A;  3N6R A;  1DXM A;  2YU9 B;  2LS0 1;  4F87 A;  3K5O A;  1R9T B;  1WTR A;  1UAP A;  1HFN A;  5C4Z A;  4M1U B;  2I46 A;  2NN6 I;  1MSH A;  2RKS A;  4YIJ A;  5FKA C;  4ODG A;  2RQX A;  4C1N I;  1EU4 A;  1Y8N B;  5FOB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...