2VB2X

Crystal structure of cu(i)cusf
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
75
structure length
75
Chain Sequence
PQVISATGVVKGIDLESKKITIHHDPIAAVNWPEMTMRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cu(I) Recognition Via Cation-Pi and Methionine Interactions in Cusf.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal transport
molecule keywords CATION EFFLUX SYSTEM PROTEIN CUSF
total genus 14
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2007-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF11604 CusF_Ec Copper binding periplasmic protein CusF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.320 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2vb2X01
2VB3X 1ZEQX 3TDQA 2VB2X 3E6ZX 2QCPX 2L55A
chains in the Genus database with same CATH superfamily
1ZXTA 2YTXA 1GUTA 4H7BA 2KENA 2MFIA 4HIOA 3CMEA 2WAQE 1WTWA 2B2VA 2G5DA 5CC4A 1CK1A 4DFAA 4OWWB 3AB9A 4BBRB 4K5VA 2M00A 4V0BA 1SAPA 3A8KE 4F87A 3S9WA 1KIXA 3PIP3 3K0YA 2E2IB 1KDBA 5IWAL 2JEBI 3GDEA 1UEBA 1NAPA 5HGQA 4A3IB 1F9SA 1YBYA 2JEAI 1QWYA 2GVAA 2L12A 4AH6A 2IWHA 4IJHA 2Z4IA 1VQ9A 1D7QA 1HNXQ 4DK1A 1SLJA 1HHVA 4PQXA 4O2DA 1G51A 1JCKB 3K8AA 1E3PA 1B8AA 3F8TA 2K5VA 4ME5A 1WYDA 5C3XA 2UUCL 1FJGL 3J7ZC 1I4QA 1HUMA 1V1OA 2Z9HA 4LF9Q 2Z6KA 3DXJC 1A63A 3I3CA 1TS3A 2QF7A 3ZYYX 1E2WA 3HOXH 3AFPA 3H0GB 1TT2A 3FKIB 5LL6X 3ICEA 4A3DH 1R4QB 3KLSX 1Y8PB 4AIMA 4A3CH 5ELFA 3NHHA 2HDLA 3G71A 4DV0L 3U58A 4C56C 4KKUA 1TQOA 3UDXA 2B8FA 1HA6A 5GADC 5FOBB 1CTMA 3HP3A 1BVSA 3VA5A 4LNQA 5C0XI 1YJ9A 3NTHA 3NXWA 4IPDA 2CW0C 3PUYA 1GKHA 3DEPA 1EU4A 4YWKA 1UNSA 1G291 1PH7A 1N32L 3FMCA 1K0SA 1JQYD 5C3WA 5JJZA 4GZYC 2JSOA 5IYCH 4DR7Q 2KEDA 3CCRA 2IX3A 4CDCC 1SYGA 3UE0A 4LUOA 4X64L 2Z6KC 2BOSA 3G48A 2HCCA 2UXCL 4BY7B 2R7ZG 1L1OC 3CMAA 4BBRG 4J6HA 2HHHL 2XRQD 2VXWA 5ELNA 5CBEE 2G9HD 2PW5A 5I6YA 3C3LA 4DUZL 4ALPA 4GKJL 1AFPA 4POFA 2PYKA 1HNWL 4JI8L 4B9XA 4IZ8A 1BOSA 2BH2A 4XYQA 4BBSB 1D2BA 1NR4A 2E75C 3C46A 1IBLQ 1HA5A 1OXVA 4PZ6A 2Y0SB 1OXTA 1Q90A 3LWUA 4NW2A 3Q24A 3G6JB 2K28A 5KNCA 3MXNB 1CZGA 2KEEA 1B3QA 4ME3A 4BS9A 2XTIA 1BF4A 3GTMB 1HRJA 2BCOA 1PYWD 1N34Q 1RJTA 4ZKBB 4YCWA 4GN5A 1K73C 2PZUA 4BY7H 2E8GA 3UDIA 1S5DD 3AFQA 2ATWA 2B2UA 3A56A 1UE7A 4QB4A 5C4HA 1T5XD 3TZDA 1JB7A 2CQOA 5KRUA 4JC0A 1L0XB 1RTNA 2EYFA 2EIFA 1KXLA 1KABA 1PRTF 1U4LA 3DM1A 1PH3A 4DR4Q 2F0HA 4C3IH 3V2TA 3JAME 1VQAA 3HKZB 1E22A 1PFSA 4TKOB 1I3QB 1J5EL 4HIMA 2IHFA 2K6AA 4GLVB 5IOCA 3BVMA 3BS1A 1LTBD 3D0FA 4DV5L 3R93A 1I50H 3GTQB 3J80i 5JAVA 1K28A 3VYUA 1TVXA 4LUZA 5C5LA 1S5BD 2MO0A 5EPKA 1XYIA 5C0XH 2JK8A 4LAAA 4GKKQ 3S24A 5JVH3 1D5MC 3TP8A 5I2YA 3DWPA 4IUPA 1GM5A 4C3IG 1YNJD 1EY8A 3HOUH 2LMCB 3S1NH 1PZID 1MD2D 3SK8A 4BXXG 3PO2B 1XMQL 2OCEA 4UP7A 3RR5A 3VDYA 1CA5A 2I0QA 3HOXB 1XX8A 3SHLA 4DV0Q 4EGVA 4AQYL 2YYZA 3T1HQ 3M7NA 4GOPA 1WOCA 4R4OA 5IGEA 1P16A 2NVYB 5C4ZA 4A3EB 2LKVA 2Q8IB 4OL7A 3DM3A 3I4LA 2HDMA 3LNNA 3ND9A 2LS01 4IUNA 3J81L 3GTPB 5KNBA 1EOVA 1A15A 1LTAD 2RDHA 4KD3A 3QG1A 4G4KA 3VR4A 2R93H 1VQNA 1STAA 1D6EC 3S1MB 4MHEA 3RN5A 1KC8C 1LTGD 1ASZA 2OTLA 3PUXA 4H44C 4UP8A 1DXMA 2A74C 4KHVA 4K6LA 3S15H 3KBXA 2BDOA 4KY5A 5J3BA 4DV3Q 3F2UA 4BY1B 1VQ6A 4B3RL 3MEHA 4JI0Q 3TRZA 1DONA 2B2YC 2OT2A 4Q0FA 2XNAC 1TS2A 2H1EA 1X9NA 2NTTA 5IGCA 3EJIA 1EY0A 4QCLA 1F9QA 1A3VA 3GTOB 1G6PA 3X3MA 3QOJA 2KBNA 3J81c 4FVMA 4WORA 3J81j 3URYA 3KF6B 1EOTA 3AEVA 2JA8G 4GNXC 1QNKA 2B2WA 2RSNA 2Q8TA 2LXKA 5G3LF 3WWVA 1YEZA 4JV5L 5M5YB 2YV5A 3A7LA 4DAMA 1HNZL 4B3TL 4IPGA 1XJVA 1WTOA 2MUYA 3CHBD 3NTIA 4IPCA 4QGUA 5M3MH 2EJFC 2K1BA 3BDLA 1XNRL 1STEA 4G7ZC 2MQHA 3C2PA 2RF4A 4A3MG 1MJEA 3T51B 1LT4D 4IALA 4DV6L 1SE4A 4ODGA 1II3A 3I4NH 2JA8H 4JYAL 2CFMA 2EJGC 2HIXA 2K5NA 1W6JA 4ZK9B 4LFCL 5BN3A 1VQHA 2DJGC 3ULPA 3E6ZX 1JOKA 3HOWB 4QQBX 1HFNA 3VYTA 5C0XJ 4KKTA 3E9HA 4JI4L 2E5LQ 1EYCA 5FJ8G 4H0LC 4ZRZA 4J15A 4KJOA 3PO2H 1UEAB 4QY7A 1V1QA 2E74C 1TXYA 2I5HA 3H3VC 3HKZG 1Y1VH 1K8MA 1J5EQ 3S17B 4XQNA 3KJPA 1VQOA 5IP7H 2MP1A 1GD7A 3L2PA 4LF6Q 2XWBB 3EA6A 1SNCA 4X62L 4BY1G 2F4VL 2SNSA 2L55A 3RMHA 1KLUD 1KTKA 2YTYA 3H15A 1D5ZC 2NYZD 3CCMA 4OO1G 2F3IA 1LTTD 4LFCQ 1OO9B 1YNJC 4UPAA 4A3LH 2IW3A 1DJRD 3JAMi 4OX9L 1H9KA 4OGQC 4WRDA 2EE1A 4O42A 2PW7A 2ZXRA 5CV9A 1EY9A 4L8JA 4EQPA 3VYSA 4FF3A 2OWOA 4TRDA 5FLXE 1A8VA 5CV5A 4P2CB 2GA4B 1Z47A 2PZTA 5BR8Q 5CORA 3I4MG 2K03A 2F0OA 4A3LG 1SBBB 3BYYB 1E2ZA 5JOBA 3TBIB 4B3ML 2OTJA 3FKIH 1JWMD 2IX0A 3SK4A 4APVA 1PZKD 2F0TA 1IYUA 2P5ZX 3KFUA 1PLFA 4DAPA 1V8QA 2B2YA 4DNTB 3W3AA 2WB1E 1B53A 2A5HA 4MN3A 2R92B 5E1FA 4OIKA 2MGSA 5J1ZA 2KUMA 4KLKA 2D9UA 1E0BA 3IL8A 1IYJB 4Q5VA 3MXGA 2A6HD 1WCMB 1EQVA 5M5YH 4WFN3 5D3IB 4JBKA 1BBUA 1LTID 1F2YA 3S2DH 3S1MH 3PQIA 1PA6A 2D0PA 2SNMA 2ZJQA 4CJ1B 2AQ3B 3J81E 5IP9H 5I6WA 1OXSC 4FXKC 4OELB 1ILPA 1STGA 5K36G 4Y7NB 3H91A 2K75A 4LWCA 1M4VA 3HKZE 2PNHA 3DLLA 3RLFA 4IFDJ 3QJYA 1JC7A 5FLXL 1SFOH 1SRUA 3CQZH 1HZCA 1H95A 4B08A 4FP5D 3SEBA 2DNEA 1VQ5A 2AHOB 1VQMA 1GUSA 3S1NB 4OWTB 3M4PA 3I2ZA 1TIID 5K36H 2EYLA 4ZCKA 1EQRA 4QF4A 1X3PA 1A2UA 1W6KA 1V43A 3KBGA 1BO0A 1SMXA 3T53B 4S3SA 1ONLA 5BN4A 5M5XH 2F0NA 4KI0A 4PMCA 1YIJA 4DAVA 1X56A 1TS4A 1LV9A 1SFOB 4R8IA 2DY7A 3S14H 1IW7D 1S5FD 3B6YA 4PMBA 1ZEQX 5KIXA 1TWHB 5I9OA 3J7A5 2B8GA 3PUWA 3S1RB 4QIWE 1CT1D 1U4RA 1RHPA 3CRLC 3OWFA 3HG9A 4LFBL 2XRSD 1GUGA 4IUUA 1TKWB 1QE6A 1VQCA 1LTLA 2Z8LA 1Y1WH 3KF8A 4QUFA 1FVIA 4X3TA 2SDFA 2IHEA 2K5DA 2HT1A 1HZAA 4RGNA 2QA4A 4HMJA 2UXDL 1PTOD 4X65Q 1Q8IA 4R1JA 2A8VA 5CV4A 1VF7A 3LWEA 2ZM6Q 1WCMH 3W1GA 2VQEL 1BXTA 1I3QH 2F0IA 1XXGA 3OWEB 1Q8KA 4LF9L 2F0MA 4DV4L 1K8OA 1D1KA 1MGSA 1Y1WG 5ELOA 4K5XA 2QEXA 2R7ZB 4UY8C 1TU2B 1ET9A 1G8ZD 3K5OA 1KL9A 1SE2A 4RGMA 3MTSA 4CJ2C 1HNZQ 2NZOA 2OXPA 2ZTCA 2R3ZA 2L9HA 3N6RA 3OPOA 3PV0A 5ELBA 2J4XA 1NBWA 4RHRA 2IT1A 1SSOA 4ZQ3A 4B9WA 3FVQA 3CRKC 4EX5A 2UXDQ 2KCCA 4JI1Q 1U9RA 3NUCA 2YU9B 1L0WA 3Q23A 1VQDA 1X32A 4ZUJA 1A62A 1UE1A 1RKNA 4O0AA 3TS2A 4KN7C 3SDZA 2UXBQ 4CHTB 5G3LD 4DF7A 4C1NI 1Y14B 5JPMC 1OXUA 2DY8A 4CDFC 1EIGA 2R6GA 4NXNQ 2OQ0A 2EYJA 4ZKCB 5JJLA 4HN7A 1JT8A 3RZOH 1EYAA 1WI5A 5EGTA 4PMWA 4WJ3M 4A4IA 4A93G 1SR3A 1ESRA 1PH2A 2F1MA 3MFGA 4KKSA 3TS0A 4NXMQ 4RA8A 3Q6SA 4IOAA 3A0JA 1FYCA 3R2IA 1SXTA 1C9OA 5A2QE 1BBWA 2CWPA 5C44G 1O7YA 2AWOA 5H1SE 3J81i 1VF5C 2E5LL 3PO3B 4C3HH 4KV6A 3M4OB 3HOWH 1DZ1A 4A93H 2N88A 3GV6A 4NB3A 5C3EB 3EROA 3K5NA 4DV2Q 3C1EA 2NZ1D 4DR3Q 1EU3A 4IO9A 4DV7L 3I4NB 1EY4A 2X6LA 4YWLA 1IL2A 2FJ2A 2N78A 4ZAIA 4O1NA 4FO2A 2B2TA 2HQLA 1ML0D 5EKKA 2JA9A 1M8AA 3Q0AA 5GQOA 3CCQA 1SNPA 2ASBA 2RQXA 3UDFA 2GN5A 4UAIA 4C3HG 5M3FH 2EOTA 4HJ9A 2Q8RE 3CD6A 1GHJA 3JAML 2AQ1B 3K58A 2RCNA 3BDCA 4PNYA 5KGUA 2BA1A 3GTJH 1R9TH 4L5QA 1F77A 3NP8A 1EIHA 3A8JE 1IBKL 2JA7H 2R61A 1XTCD 1H9SA 3SK5A 2CQAA 2D2CC 1XNQQ 1TWFB 2F0SA 2KCNA 3H3VI 4HJ5A 3S1QH 5M3FG 3W1BA 1M90C 1N33Q 3J7AV 3FPUB 4OIJA 4OO1I 2BE5D 4CKEA 3E3XA 2J0TD 2C35B 3S16B 3I8ZA 3HOVG 4K0KQ 4B3TQ 3RLOA 3SE0A 4A3BH 4EQOA 3S16H 3AMUA 4CJ0B 1F9PA 1HQMC 2KHIA 1NCVA 1PH6A 2A68D 1I4XA 2IL8A 4K2KA 1K3RA 1ICFB 1Y8OB 2KHSA 2Q2HA 4HR7B 1GUWA 4A3KG 1VS0A 2UUAL 3U50C 4R4IA 3DWAA 1C7YA 2Q2IA 4LF7Q 1ZKOA 2FMMA 3VR2A 5C44B 5DM63 2R92H 3FDTA 4WJWA 1B2TA 2OF1A 3RNUA 3S1RH 2X6GA 2V1CC 1B70B 4JCVE 3AU7A 4FF1A 1SYEA 3R8BA 3HOVH 1YVCA 1YI2A 1IBKQ 2WP8J 4DUZQ 3I4OA 1B3AA 1CKNB 2WB1G 2RBMA 4UP9A 3JAMc 4JW0A 4RCNA 4IURA 4JG2A 5GROA 3DMUA 2VB2X 2F0EA 4A3KH 2B63B 1XWEA 4K6DA 1KRTA 1KDCA 4A3FH 2VQFL 2R92G 3NEMA 2LFNA 2E2JH 5IYDH 5CYUA 1TWAH 3SGIA 5IYBH 1VQLA 1S4ZA 2Q2TA 1ASYA 3KOJA 5E7NA 3HOYH 4L5SA 3QR8A 2B2VC 2WFWA 3ER0A 2EJMA 4MNOA 1VQPA 1N34L 1AE3A 2Y0SE 2NBFA 1G91A 3CQZB 3W2DA 1UUPA 1BKBA 1G2SA 4A3FG 1QILA 2EY2A 2Z0SA 5LMNQ 1G6ZA 4R8NA 3GTLH 4Z9CB 4HSVA 5IYDG 5LMUQ 5IYBG 3GQBA 4NXML 2UUCQ 4JI6L 1ENFA 3BDOA 2UUBQ 4B3SQ 3K6OA 4LF4L 2A6HC 4J8QA 5EPLA 3OIPA 5C4XH 3S17H 4GS3A 4XQQA 1QNUA 4RAUC 1J8IA 1NY4A 1ILQA 4JV5Q 2O2LD 5IGBA 4QJFA 2O5IC 5JPNC 1C8CA 1CKMA 3CCLA 1RDPD 1C0AA 4C3JG 4ZYSA 4LK1C 3KLSA 2TSSA 4DR5Q 4R4CA 3FP9A 3J7YW 4X3SA 5D3DA 4DPGA 1EIYB 4XXEA 4DR4L 1K83H 1MSGA 4I7AA 3K7AH 1LO5D 2A1AA 1CI3M 4YIJA 1YJWA 4R9WA 1CZWA 1EWHA 2E2HH 3UE1A 2VQEQ 1M1KC 1CKOA 2V4DA 3FEWX 4G7OC 4HJAA 2KJXA 4RKBA 4C3JH 5GAEC 2JA5H 4JI4Q 4X3KA 1PDQA 1W2BA 4XT3B 3PIPA 1SNMA 1PFNA 5DLQE 5IGFA 1E1TA 3I55A 2IPKD 2MHVA 5J39A 1EZ8A 3KLRA 5L37A 3V96A 2EY5A 3I56A 1Q12A 1B1ZA 3HOZH 2JA5B 1KAWA 1BCPF 3BYTB 4IJLA 1DOKA 1N33L 1LTSD 2JQOA 1N36Q 3MZ5A 1CHQD 1EFID 3BU2A 2KQ3A 4QMGA 1O7ZA 1STHA 4C2MH 1EWCA 1TWCH 5IGGA 1KDAA 3A7AB 4YHHQ 1ET6A 2WAQG 1FL0A 5D65A 4HIKA 3HOZG 5KYLA 1XTDA 5M5WH 3G7LA 2AWNA 3M3YH 2G9DA 4RWSC 1Y1WB 4H02A 1CFMA 2WB1B 3MXPA 3EBEA 3H3VH 2FINB 1CHPD 2PZWA 1HR0L 2PI2E 3KDFB 1EUJA 1D8LA 1K9MC 4GN3B 1EQTA 5BR8L 4A3JH 4DR1L 3RUZA 1B9NA 2EQSA 3ULJA 3Q22A 4CBVA 5F2DA 2B39A 4IN3A 5T1IA 2IJ0A 1QVFA 3CAMA 1DOMA 2CWAA 4DU9A 4JI2Q 3H0GH 4HTHA 5KEEA 3WOEA 4XIGS 4JBMA 1F9RA 1ESFA 1S3OA 3KLWA 2WACA 2ZTEA 4PZ8A 4A3GH 1CSPA 1JJGA 2VUMH 1XMOL 4A3JG 4YCUA 2A69C 1B7YB 5I4DA 1MKHA 5CBAE 1HH2P 1WD1A 1BCPB 1PFBA 2QILA 2F0PA 2K7VA 2I5MX 2Z6BA 4UDUC 4CKBA 4IFDH 2E2JB 1ENAA 2L15A 2N55A 5IODA 4JBWA 4A3GB 3M7GA 1TY2A 2NN6I 4L6TB 1LUZA 4TSSA 4OEMB 4A3KB 4A3IH 2F0VA 2VUMG 3IFTA 4LMQD 1EEID 3MHBA 1PYBA 3S1QB 4C3IB 4R4QA 5A35A 2I5LX 1STYA 1VQIA 1VQBA 2EY1A 3BZCA 4YY3L 1HFGA 5HY6A 5ELCA 3LGJA 2H5XA 2JA7B 3ZJYC 5D14A 3HOZB 1U5KA 1ICWA 4K0KL 2F3VA 2NZHA 3CC2A 3DWQA 1AE2A 1RD9D 3KDFA 3BVGA 3ERSX 1MI2A 1V1PB 1H9SB 2QCPX 1WTPA 2NVTB 2FHTA 4ID6A 1PH8A 5M5WB 3KF8B 1VQ7A 1PVOA 5JEAJ 4GNXA 1FNUA 4XYOA 4A3EG 3J7AF 4GLXA 1AW7A 2MPMA 3DEOA 3CF5A 2HQEA 4JI1L 3Q8DA 1AZQA 2R93B 2I07B 5GAGC 4DK3C 3NENA 1H9RA 1F2ZA 2JJQA 3K57A 1BCPC 5FO8B 1TWGH 1U4MA 5E4WC 3W5OA 2ES2A 3HOUG 3PUVA 1JOQA 1IW7C 2EPBA 2RA4A 2NVYH 4A3EH 2FFKB 2L1BA 3KF6A 1CUKA 2JE6I 5C4JH 1LLRD 2FXQA 1SEBD 5NUCA 1EIFA 3I70A 2AQ2B 3IKJA 4NKLA 4KHZA 1I4PA 4DV1Q 2RSOA 1IL8A 1PHJA 3ND8A 2D62A 2WKDA 3GTGH 3DHQA 2K52A 2K01A 3E5SA 4X65L 2HIVA 4RHSA 3TZUA 3H09A 2UU9Q 3GTLB 4FYDA 4JI3L 1HQRD 1XPOA 2F0JA 2R93G 5I2XA 1L1OA 2QDLA 3A54A 2EXZA 1DOLA 5DNFA 3MAQA 4A93B 3T56B 4OXPA 1MJCA 3GTGB 1EL0A 4CKCA 4DR3L 4DNIA 3GTKB 1YNXA 3HOYB 3MWYW 3HEJA 4GKKL 2K32A 1HZBA 5A2QL 3T4AC 4JI2L 3I73A 3CKIB 2UXCQ 1J6QA 1GHKA 4MTNA 3KUPA 1V1PA 4XQJA 4DV6Q 3NE5B 4IOCA 2K5QA 1CSQA 5C4XB 3HOXG 5LMUL 2AUKA 4DK6C 2F0LA 3TP6A 3RN2A 2AUJD 1XMQQ 3O13A 4DV1L 4A3DG 1G2TA 1Q1BA 4KY6A 1QZGA 2HHHQ 2VB3X 3TMEA 1HJPA 2BH8A 5IE8A 2F03A 3T1YQ 3VR6A 4A3CG 5I9PA 4GKJQ 1PFMA 1T5EA 3CW2C 1J9OA 3U4ZA 4JI3Q 2E2DC 1LACA 1VQJA 3OW7A 3D4DA 2BA0A 1FJGQ 2GVBA 5M3MG 5DAUA 1I94Q 2PMZE 4BBSH 1O7LA 1JICA 3NQIA 1SYBA 2RCFA 4L5TA 5DEHA 4OONA 1CQFA 2WV6D 2EYOA 1L1OB 5CR3A 4A3BB 1OXXK 5JEAH 5AJ3L 2WKCA 3EFXD 1R4PB 2NVTH 5IYCG 5IY0A 2KOLA 1YJNA 5EKIA 4DV3L 1VQGA 1HPCA 2VW9A 3ULLA 4JI0L 4N8X1 4BBSG 3EIVA 3HZXA 3HOVB 5FJ8H 3T1YL 4RH6A 1NTGA 1VQFA 1I4GA 5ISRA 2R7ZH 1X3FA 1Y69U 5HGTA 4BBRH 2NN6H 5JEAG 3GTJB 1Y1VG 3EN2A 2ZM6L 4X66Q 5IP7G 3MA2B 2B63G 1FNVA 4JI5L 3F2BA 2PNRC 3L3OC 1I94L 3OHXC 4F8MA 4DAYB 1A3TA 1UWVA 1AZPA 3AYHB 3QO2A 1KAAA 4ILWA 4QL5A 3QWNA 1SMYD 3AQQA 4OO1H 4TVAB 2PMZB 1GVPA 1N32Q 2NN6G 3CP0A 1PH5A 1GUNA 2N3SA 3MXUA 4I65A 3MFYA 1PZJD 4A3FB 2K33A 1TWFH 1PTOH 2PCFB 3J80c 1B50A 4L5RC 1GOZA 2B63H 4JYAQ 1U4PA 1BR9A 3K5MA 4KMUC 4BY7G 1DCZA 1JR0D 1R9TB 4OHJA 1EYGA 1JMCA 2B3GA 1SN8A 2CH4W 4NMZA 4MZ9A 4JI6Q 4B3SL 4LF4Q 4WJ4A 2EYMA 2RVLA 4GOPB 3I4MH 1FR3A 3ERQA 5M3FB 1KNAA 2D0OA 3HOUB 3FKIG 4L63B 4N9TA 4N8FA 2ZT9C 1SJHD 3RZDH 2LY7A 4J1MA 1JORA 1IHZA 3M4QA 2QDBA 1BQQT 1PH9A 2NUCA 5J22A 5IT9c 1FGBD 2O4XA 2UXBL 2F0KA 3GTKH 5C0XG 3A55A 4NXNL 1HNXL 2QW7A 2NVQB 1XPRA 2LSSA 3D4WA 3STBC 5T1GA 2JA6B 1LABA 4DNRB 1AP0A 4KHPQ 1B4OA 5KYIA 4BXXH 5E3FA 3P7JA 4Y7NH 1GO3E 4FDBA 1NE3A 3HKSA 1EFWA 2F3WA 1O78A 1O7IA 2VL6A 4E6IA 1RL2A 3H6MA 2BDNA 3U4VA 1PXUA 1EYDA 3NTKA 1EY5A 4V190 4LW1A 4DV2L 4P72A 5C4JB 4K8JA 4POGA 3P75A 1AN8A 3N52A 3U9OA 3TP5A 1JE4A 4G57A 5EQ0A 2KCTA 3K59A 3SXHA 1K83B 4X6AH 1VQEA 1Q81C 2MJ8A 4HJ8A 4RGTA 1I6HH 4RFBA 2YU9H 2B2TC 2NVQH 1CA6A 4PV1C 1EY7A 1SNQA 1S40A 1PRTD 4BA1I 3PUZA 2DJFC 5C5MA 3KK7A 3VYRA 1QOHA 4AQYQ 1EQQA 2JA6G 4DR2Q 3M9BA 3DUZA 2EZVA 1S72A 4P75A 1O80A 1AH9A 3J80E 1LTRD 3OW2A 2OEOA 4RKLA 1E1OA 4F7XA 2Z4HA 5TSSA 2K14A 4DV4Q 3ONAB 1SYFA 4X64Q 5EJWA 3UDGA 3RLNA 4PZ7A 3TN2A 1FD7D 1WFQA 3OTOL 2JA6H 1KD1C 4X62Q 4G7HC 1HUNA 2F4VQ 3CPWA 1ENCA 5IGDA 1WTVA 1QVGA 4ULLA 4IQZA 2RKSA 5CV8A 2CH4A 1QUQB 4A3MH 3GV3A 2F0QA 3WOFA 1N8RC 1H9JA 3OOCA 1STBA 1RTOA 3I4NG 4FNFA 4MIUA 2C5CA 3CCJA 1TS5A 4JK1C 1FGUA 1B44D 1VMCA 2A6EC 2L0CA 4RG1A 3A5ZB 1TWAB 1TY0A 3QOLA 2VUMB 4CDDC 2DN8A 3I4MB 4FXGC 1HTLD 5FLMG 1PRTB 2AMCB 2PQAA 4HEDA 1Q86C 1KQSA 1D5XC 1VMPA 5DM73 5E4XA 5JJIA 2EXDA 3S14B 2UUAQ 3PO2G 1TR5A 1EWIA 2RHQB 1QUQA 2F0WA 3VR3A 2MNAA 2NVXH 2K5HA 2IY5B 1UE6A 2ZJRA 3CCEA 1WTQA 3CU7A 5IT9L 2BE5C 3PGZA 5GAHC 1IXRA 2WAQB 1SROA 3F1ZA 1X65A 2N8NA 3KYHC 2QEJC 3PCOB 5FLMH 4BY1H 1HZ9A 2F0GA 2I46A 3I90A 2HD3A 3NBHB 2M9VA 1SNOA 5AJ3Q 1YHQA 4LF8Q 1V9PA 3HRZC 2L5TA 4LUVA 4KHPL 2DGYA 2KCMA 3R2TA 3M3YB 4JOIC 3PIO3 1I4HA 1MIUA 1LT3D 4QUCA 3SK6A 2E2IH 1FNWA 3D8GA 2EY6A 4EVOA 1QB5D 1BDOA 3E0EA 3BG3A 5AFWA 4YCVA 1QVCA 2XN9C 4KK7A 4DK0A 2JXMB 2F4IA 1PH1A 1XNQL 2Z1CA 1QZHA 2EVBA 2HCIA 4BA2I 2K05A 3OIQA 1X54A 1SYDA 4JI5Q 3R3OA 2JP1A 3E0JA 2J7ZA 5LMNL 1PV4A 3CCVA 5M5XB 3PSIA 3L9AX 5IIFA 4DKAC 3NBIA 1CM9A 5CV6A 4HIDA 1BUVT 2SEBD 1L2FA 1UAPA 3MC0B 1C48A 1Y8NB 4M1UB 4CDEC 2VS1A 1MHWC 3BVZA 4OX9Q 3WDNA 1SJED 1PH4A 5C3EH 3HS0C 3BJUA 4RMFA 2UU9L 2R7FA 3J80L 4IUTA 5EAYA 3K5LA 2N49A 4FF2A 4OWXB 2SOBA 3PMFA 2KECA 4DUYQ 1IBMQ 3GTPH 1Q1EA 3P20A 3PIOA 3GTQH 1JJCB 2K04A 3D31A 3IRBA 1NSNS 4DXFA 4DR6L 2NTSA 2HUGA 2VY3A 3G6EA 4K14A 3OTOQ 3PO3H 1EEFD 2XWJB 3NSWA 5IP9G 1I5FA 5C3EG 1Z7TA 2B2WC 3S2HH 3MEFA 2AKWB 3HFZB 1N36L 2JA7G 4GLAC 1LYLA 4PG3A 4DGZA 3HGBA 3PF5A 3S2HB 2CHBD 1JB3A 1VQKA 4LF5Q 5FO7B 1L0YB 1P8LA 2ICIA 3VA7A 1WTHA 1DYQA 3PO3G 4NPSA 4DN4M 1E7ZA 3A8IE 1CKNA 1KRSA 1EY6A 2VNUD 2ENBA 1X3EA 2XIWA 1BCPD 1A6XA 4DV5Q 1TWCB 1ZYRD 2ZJPA 4RCOA 2VQFQ 2PPBC 1EZ6A 4C2MB 3QIAA 3CC7A 4DR1Q 5ELDA 4KTAA 4LJZC 4X3UA 1DGSA 3D4RA 1IZ6A 1I6HB 3FPPA 3BZDB 2EYPA 3K81C 3FRPB 4GNXB 1MSHA 1WTXA 3MXNA 1XNRQ 1D1IA 2R7DA 3U9SA 3T13A 3TEHB 1KHIA 1ZYRC 2CCZA 4JOIA 1HTPA 3X3NA 4K2LA 4JI7L 2LXJA 4YWMA 1YHAA 2ZXOA 5EKLA 2K5WA 1NUCA 2EYHA 1I6VC 3M4YA 3PF4A 3GTOH 5COYA 1JOOA 2M2LA 4I7ZC 1K8AC 2E2HB 4JI8Q 1WTRA 1DD2A 3K7AB 2C9OA 4LF8L 3KJOA 3K0XA 1QG7A 5HURA 1Q3LA 3IFDA 1LT6D 1IYVA 1IKLA 2F0DA 3TP7A 4P71A 1C4QA 1Q7YC 4AYBB 4XTCS 1SYCA 4QIWB 3HOYG 1WCMG 1Z6HA 2Y0SG 4U68A 4JBJA 2O5JC 3I7FA 4NDXA 3FHWA 4H13C 4RGOS 3H94A 1VQ8A 1Q82C 1E24A 2B2UC 1OTCA 4DR5L 1F2MA 1SE3A 1GJXA 4B3MQ 2CW0D 3OSOA 3K7UC 1GXDC 2D5DA 1KLGD 3GP7A 1JWUD 3IAYA 3RZDB 5LMNW 5JVG3 3L7ZC 1S5CD 1DM0B 5C4XG 1KNEA 1RCVD 4LFBQ 1Z9FA 2PQAB 3STBD 4HJ7A 4BWGB 2ZXPA 4XDXA 1PTOF 3CC4A 2JYOA 1YITA 1E2VA 1TWHH 1RIPA 2ICEC 1RODA 2E76C 3L0OA 1NMFA 4Y52H 4GN4B 2VZAA 4P73A 1GUOA 3G4SA 3NPPA 5KNDA 4K8IA 4LFAL 5C6AA 1SDFA 5EBCA 5CV7A 3BZKA 1YNND 4ZLTF 1N9WA 5CMDA 3NQTA 1X3GA 1PRTC 4AYBG 1T9HA 5M3MB 1HR0Q 4HMIA 1K3BC 4YHHL 3TSSA 1XPUA 1BBXC 3OYYA 3TQYA 2KVMA 5EPJA 1PYSB 3CXCA 4A3MB 2F52A 1LM0A 1I50B 4JVZA 1A0IA 1I4RA 2QGQA 2DNCA 1YZ6A 3NWTA 3M4OH 2WINB 2JA5G 4U673 1NJIC 1IKMA 1K0RA 1A3UA 2X69A 2CVRA 5JJKA 4A3JB 5LL6S 5EBDA 1SMYC 5IT9E 5C44H 4HCEA 4A76A 2NB0A 1NR2A 1Q46A 3RD4A 3S15B 1VCIA 3SR1A 2B29A 1SE8A 2KHJA 3HOWG 4C3JB 2OQKA 3LX0A 1IBLL 4XT1B 5FO9B 2XGTA 4KJNA 1RF2D 4C1NK 2PQEA 3S2DB 3JC66 2L11A 2EDGA 3NBHA 3QB3A 3E9IA 5FKAC 2A6ED 3A5UA 5IWAQ 4IFDI 4YY3Q 4JI7Q 1XMOQ 4JPBW 4UHVA 2A68C 3OMGA 4B3RQ 3VR5A 2H4OA 5BN5A 1JE5A 2CKZB 3EQLC 1HCZA 3GD7A 3NWSA 3T16A 1HXYD 2NVXB 4DA2A 2IX1A 4DR2L 4C3HB 2K50A 4MTKA 1S5ED 4IUVA 1HR0W 1X3QA 1X55A 4DXGA 1SNDA 3EVQA 1UE5A 3GO5A 3I91A 3P1HA 3H0GG 5FK9C 1A2TA 1U0LA 1PMRA 4CGYB 3MVVA 4EQ5A 2F0FA 2F0UA 3TREA 2ID0A 5LHY1 1W3SA 1PTOC 4FF4A 4A3GG 1JJ2A 4FXDA 2TMPA 4AYBE 4DV7Q 4A3BG 4KN4C 3A74A 3TDQA 3CCUA 1YHBA 4A75A 2K4KA 2DUDA 2A73B 4IFDG 3OMCA 4HCSA 4IUQA 2QKIC 2WIIB 4HAEA 4KY7A 3D3RA 3NELA 3D6WA 3CPFA 3UI2A 2UUBL 3F2DA 2PI2A 1F2LA 4M8AA 5CGKA 4DUYL 1IBML 4A3IG 5ELEA 1JWSD 5K5PA 4GOPC 4P74A 3F2CA 1VQ4A 1WVLA 4K5WA 3CCSA 1MBYA 3NK9A 1Y1VB 2A19A 4LF5L 1QJOA 4DR7L 2XVSA 4TQUS 3RZOB 4EQNA 4NP5A 4DR6Q 4A3DB 4X66L 4F88A 3SVMA 2FMCA 4LF6L 4LFAQ 1NNXA 2L4NA 2MO1A 1WJJA 3GTMH 1STNA 4R4TA 5M9OA 1B9MA 2A69D 2RDFA 2JA8B 3T1HL 1CQVA 1X6OA 1LT5D 3I72A 2XSCA 4N9PA 5FLXc 1PTOB 2RHSB 3V05A 2NWGA 2Q2UA 1K8GA 4IPHA 2JN4A 1VDZA 1AEXA 3C1FA 4HSPA 1TWGB 4ABNA 3D6CA 4KD4A 2YTVA 3K80C 3ITPA 4LF7L 1WD0A 1BNZA 2ZTDA 1H9MA 2ALYB 3M85A 1NMGA 1QCBD 1HNWQ 4ZUIA 1YNNC 4DAYA 2PO4A 2RDGA 2KA7A
chains in the Genus database with same CATH topology
1ZXTA 1GUTA 4H7BA 1WTWA 2B2VA 5CC4A 1CK1A 4DFAA 3AB9A 4BBRB 4K5VA 2M00A 4V0BA 1SAPA 3A8KE 4F87A 3S9WA 3PIP3 3K0YA 2E2IB 1KDBA 2JEBI 1NAPA 4A3IB 1F9SA 2JEAI 1QWYA 2L12A 2IWHA 2Z4IA 4DK1A 1HHVA 4PQXA 1JCKB 4ME5A 5C3XA 1V1OA 1HUMA 1I4QA 3DXJC 3I3CA 1TS3A 2QF7A 3ZYYX 1E2WA 3H0GB 1TT2A 3FKIB 5LL6X 1R4QB 3KLSX 1Y8PB 5ELFA 3NHHA 2HDLA 4C56C 4KKUA 1TQOA 2B8FA 1HA6A 5FOBB 1CTMA 3HP3A 3VA5A 5C0XI 3NTHA 3NXWA 2CW0C 3PUYA 3DEPA 1EU4A 1UNSA 1G291 3FMCA 1JQYD 5C3WA 5JJZA 4GZYC 2JSOA 2KEDA 2IX3A 1SYGA 2BOSA 2HCCA 4BY7B 4J6HA 2XRQD 2VXWA 5CBEE 2G9HD 2PW5A 5I6YA 3C3LA 1AFPA 2PYKA 4B9XA 4IZ8A 1BOSA 4XYQA 4BBSB 1D2BA 1NR4A 2E75C 3C46A 1HA5A 1OXVA 2Y0SB 1OXTA 1Q90A 3LWUA 4NW2A 3Q24A 3G6JB 2K28A 5KNCA 1CZGA 2KEEA 4BS9A 1BF4A 3GTMB 1HRJA 2BCOA 1PYWD 1RJTA 4ZKBB 2PZUA 1S5DD 2B2UA 3A56A 4QB4A 5C4HA 1T5XD 3TZDA 5KRUA 1L0XB 1RTNA 2EYFA 1KABA 1PRTF 1U4LA 3DM1A 2F0HA 3V2TA 3JAME 3HKZB 4TKOB 1I3QB 2K6AA 5IOCA 3BVMA 3BS1A 1LTBD 3R93A 3GTQB 5JAVA 3VYUA 1TVXA 5C5LA 1S5BD 5EPKA 1XYIA 5C0XH 4LAAA 5JVH3 1D5MC 3TP8A 5I2YA 3DWPA 4IUPA 4C3IG 1YNJD 1EY8A 2LMCB 1PZID 1MD2D 3SK8A 3PO2B 1CA5A 3HOXB 1XX8A 3SHLA 4EGVA 3M7NA 2YYZA 5IGEA 5C4ZA 2NVYB 4A3EB 2LKVA 2Q8IB 4OL7A 3I4LA 2HDMA 3LNNA 3ND9A 2LS01 4IUNA 3J81L 3GTPB 5KNBA 1A15A 1LTAD 2RDHA 4KD3A 3QG1A 4G4KA 3VR4A 1STAA 1D6EC 3S1MB 4MHEA 1LTGD 3PUXA 4H44C 1DXMA 2A74C 4KHVA 4K6LA 3KBXA 2BDOA 4KY5A 3F2UA 4BY1B 3MEHA 1DONA 2B2YC 2OT2A 4Q0FA 2XNAC 1TS2A 2H1EA 2NTTA 5IGCA 3EJIA 1EY0A 4QCLA 1F9QA 1A3VA 3GTOB 3X3MA 3QOJA 4FVMA 4WORA 3URYA 1EOTA 1QNKA 2B2WA 2RSNA 2Q8TA 5G3LF 5M5YB 3A7LA 1WTOA 2MUYA 3CHBD 3NTIA 2EJFC 2K1BA 3BDLA 1STEA 4G7ZC 3C2PA 3T51B 1LT4D 4IALA 1SE4A 4ODGA 1II3A 2EJGC 1W6JA 4ZK9B 5BN3A 3E6ZX 1JOKA 3HOWB 1HFNA 3VYTA 5C0XJ 4KKTA 1EYCA 4H0LC 4ZRZA 4KJOA 1UEAB 2E74C 3H3VC 1K8MA 3S17B 4XQNA 2MP1A 2XWBB 3EA6A 1SNCA 2SNSA 2L55A 3RMHA 1KLUD 1KTKA 1D5ZC 2NYZD 4OO1G 1LTTD 1OO9B 1YNJC 2IW3A 1DJRD 1H9KA 4OGQC 4WRDA 2EE1A 4O42A 2PW7A 2ZXRA 5CV9A 1EY9A 4L8JA 4EQPA 3VYSA 4FF3A 4TRDA 5FLXE 5CV5A 4P2CB 2GA4B 1Z47A 2PZTA 5CORA 2K03A 2F0OA 1SBBB 3BYYB 1E2ZA 5JOBA 3TBIB 1JWMD 2IX0A 3SK4A 1PZKD 2F0TA 1IYUA 1PLFA 4DAPA 1V8QA 2B2YA 4DNTB 3W3AA 1B53A 2A5HA 4MN3A 2R92B 5E1FA 4OIKA 2MGSA 5J1ZA 2KUMA 2D9UA 1E0BA 3IL8A 4Q5VA 3MXGA 2A6HD 1WCMB 1EQVA 4WFN3 5D3IB 1LTID 1F2YA 2SNMA 4CJ1B 2AQ3B 3J81E 5I6WA 1OXSC 4FXKC 1ILPA 1STGA 5K36G 4Y7NB 3H91A 1M4VA 3RLFA 4IFDJ 3QJYA 1JC7A 5FLXL 4B08A 4FP5D 3SEBA 2DNEA 1GUSA 3S1NB 1TIID 5K36H 2EYLA 4QF4A 1X3PA 1A2UA 1W6KA 1V43A 3KBGA 1BO0A 3T53B 4S3SA 1ONLA 5BN4A 2F0NA 4KI0A 4PMCA 4DAVA 1TS4A 1LV9A 1SFOB 4R8IA 2DY7A 1IW7D 1S5FD 4PMBA 1ZEQX 5KIXA 1TWHB 5I9OA 2B8GA 3PUWA 3S1RB 1CT1D 1U4RA 1RHPA 3CRLC 3OWFA 3HG9A 2XRSD 1GUGA 4IUUA 1TKWB 1QE6A 2Z8LA 3KF8A 4QUFA 4X3TA 2SDFA 2K5DA 4RGNA 4HMJA 1PTOD 1Q8IA 5CV4A 1VF7A 3LWEA 1BXTA 2F0IA 1XXGA 3OWEB 2F0MA 1K8OA 1D1KA 1MGSA 4K5XA 2R7ZB 1TU2B 1ET9A 1G8ZD 3K5OA 1SE2A 4RGMA 3MTSA 4CJ2C 2OXPA 2R3ZA 2L9HA 3N6RA 3OPOA 3PV0A 5ELBA 2J4XA 4RHRA 2IT1A 1SSOA 4ZQ3A 4B9WA 3FVQA 3CRKC 2KCCA 1U9RA 3NUCA 2YU9B 3Q23A 1X32A 4ZUJA 1RKNA 4KN7C 3SDZA 4CHTB 5G3LD 4DF7A 4C1NI 5JPMC 1OXUA 2DY8A 1EIGA 2R6GA 2EYJA 4ZKCB 4HN7A 1EYAA 5EGTA 4PMWA 1ESRA 2F1MA 3MFGA 4KKSA 4RA8A 3Q6SA 1FYCA 3R2IA 1SXTA 5A2QE 1O7YA 2AWOA 1VF5C 3PO3B 4KV6A 3M4OB 1DZ1A 2N88A 3GV6A 5C3EB 3EROA 3K5NA 3C1EA 2NZ1D 1EU3A 3I4NB 1EY4A 2X6LA 2FJ2A 4ZAIA 4O1NA 4FO2A 2B2TA 1ML0D 5EKKA 1M8AA 3Q0AA 1SNPA 2RQXA 4UAIA 4C3HG 2EOTA 2Q8RE 1GHJA 3JAML 2AQ1B 3K58A 3BDCA 4PNYA 5KGUA 2BA1A 1F77A 3NP8A 1EIHA 3A8JE 2R61A 1XTCD 1H9SA 3SK5A 2CQAA 2D2CC 1TWFB 2F0SA 2KCNA 3J7AV 3FPUB 4OIJA 4OO1I 2BE5D 4CKEA 2J0TD 3S16B 3I8ZA 3SE0A 4EQOA 3AMUA 4CJ0B 1F9PA 1HQMC 1NCVA 2A68D 1I4XA 2IL8A 4K2KA 2KHSA 1Y8OB 4HR7B 1GUWA 3DWAA 1ZKOA 2FMMA 3VR2A 5C44B 5DM63 3FDTA 4WJWA 1B2TA 2OF1A 2X6GA 3AU7A 4FF1A 1SYEA 3R8BA 2WP8J 1B3AA 2RBMA 4RCNA 4IURA 3DMUA 2VB2X 2F0EA 2B63B 1XWEA 4K6DA 1KDCA 2LFNA 5CYUA 1S4ZA 2B2VC 2EJMA 2NBFA 1G91A 3CQZB 3W2DA 1UUPA 1G2SA 1QILA 2EY2A 1G6ZA 4R8NA 4Z9CB 4HSVA 3GQBA 1ENFA 3BDOA 3K6OA 2A6HC 4J8QA 5EPLA 3OIPA 4XQQA 1QNUA 4RAUC 1J8IA 1ILQA 2O2LD 5IGBA 2O5IC 1C8CA 5JPNC 1RDPD 4C3JG 4ZYSA 4LK1C 3KLSA 2TSSA 3J7YW 4X3SA 5D3DA 4XXEA 1MSGA 1LO5D 1CI3M 4YIJA 4R9WA 1CZWA 1EWHA 2V4DA 3FEWX 4G7OC 2KJXA 4RKBA 4X3KA 1PDQA 4XT3B 1SNMA 1PFNA 5IGFA 2IPKD 2MHVA 5J39A 1EZ8A 3KLRA 3V96A 2EY5A 1Q12A 1B1ZA 2JA5B 1BCPF 3BYTB 1DOKA 1LTSD 3MZ5A 1CHQD 1EFID 4QMGA 2KQ3A 1O7ZA 1STHA 1EWCA 5IGGA 1KDAA 3A7AB 1ET6A 5D65A 5KYLA 3G7LA 2AWNA 2G9DA 4RWSC 1Y1WB 1CFMA 2WB1B 3MXPA 2FINB 1CHPD 2PZWA 1EQTA 3RUZA 1B9NA 3Q22A 4CBVA 5F2DA 2B39A 4IN3A 5T1IA 2IJ0A 1DOMA 4DU9A 4HTHA 5KEEA 3WOEA 4XIGS 1F9RA 1ESFA 2WACA 2A69C 5I4DA 5CBAE 1WD1A 1BCPB 1PFBA 2QILA 2F0PA 2K7VA 4UDUC 4CKBA 4IFDH 2E2JB 1ENAA 4A3GB 2N55A 5IODA 4JBWA 3M7GA 1TY2A 2NN6I 4L6TB 4TSSA 4A3KB 2F0VA 3IFTA 4LMQD 1EEID 3MHBA 3S1QB 4C3IB 5A35A 1STYA 2EY1A 1HFGA 5ELCA 2JA7B 5D14A 3HOZB 1ICWA 2F3VA 3DWQA 1RD9D 3BVGA 1MI2A 1V1PB 1H9SB 2QCPX 1WTPA 2NVTB 2FHTA 4ID6A 5M5WB 5JEAJ 1FNUA 4XYOA 3J7AF 1AW7A 2MPMA 3DEOA 2HQEA 2R93B 1AZQA 2I07B 1H9RA 1F2ZA 3K57A 1BCPC 5FO8B 1U4MA 5E4WC 3PUVA 1JOQA 1IW7C 2EPBA 2RA4A 2FFKB 2L1BA 2JE6I 1LLRD 1SEBD 5NUCA 3I70A 2AQ2B 3IKJA 4NKLA 4KHZA 1I4PA 2RSOA 1IL8A 3ND8A 2D62A 2WKDA 3DHQA 2K01A 3E5SA 4RHSA 3TZUA 3H09A 3GTLB 4FYDA 1HQRD 2F0JA 5I2XA 3A54A 2EXZA 1DOLA 5DNFA 3MAQA 4A93B 3T56B 3GTGB 1EL0A 4CKCA 3GTKB 3HOYB 3MWYW 3HEJA 2K32A 5A2QL 3T4AC 3I73A 3CKIB 1GHKA 3KUPA 1V1PA 4XQJA 3NE5B 2K5QA 5C4XB 2AUKA 2F0LA 3TP6A 2AUJD 3O13A 1G2TA 1Q1BA 4KY6A 2VB3X 3TMEA 2F03A 3VR6A 5I9PA 1PFMA 1T5EA 1J9OA 2E2DC 1LACA 3OW7A 3D4DA 2BA0A 5DAUA 1O7LA 1JICA 3NQIA 1SYBA 5DEHA 1CQFA 2WV6D 2EYOA 5CR3A 4A3BB 1OXXK 5JEAH 2WKCA 3EFXD 1R4PB 2KOLA 5EKIA 1HPCA 3HZXA 3HOVB 4RH6A 5ISRA 1I4GA 1Y69U 5HGTA 2NN6H 5JEAG 3GTJB 3MA2B 1FNVA 2PNRC 3L3OC 3OHXC 4F8MA 1A3TA 1AZPA 3QO2A 1KAAA 4ILWA 3QWNA 1SMYD 4OO1H 2PMZB 2NN6G 1GUNA 3MXUA 4I65A 3MFYA 1PZJD 4A3FB 2K33A 1PTOH 2PCFB 1B50A 1GOZA 1U4PA 1BR9A 3K5MA 4KMUC 1DCZA 1JR0D 1R9TB 4OHJA 4NMZA 2EYMA 2RVLA 1FR3A 3ERQA 5M3FB 1KNAA 3HOUB 4L63B 4N9TA 2ZT9C 1SJHD 2LY7A 4J1MA 1JORA 1IHZA 2QDBA 1BQQT 2NUCA 5J22A 1FGBD 2O4XA 2F0KA 5C0XG 3A55A 2NVQB 3D4WA 5T1GA 2JA6B 1LABA 4DNRB 1AP0A 1B4OA 5KYIA 5E3FA 3P7JA 2F3WA 1O78A 4E6IA 3H6MA 2BDNA 1PXUA 1EYDA 3NTKA 1EY5A 4V190 5C4JB 4K8JA 3P75A 1AN8A 3N52A 3U9OA 3TP5A 1JE4A 4G57A 5EQ0A 3K59A 3SXHA 1K83B 2MJ8A 4RGTA 4RFBA 2B2TC 1CA6A 4PV1C 1EY7A 1SNQA 1PRTD 4BA1I 3PUZA 5C5MA 3KK7A 3VYRA 1QOHA 3DUZA 2EZVA 1O80A 3J80E 1LTRD 2OEOA 4RKLA 4F7XA 2Z4HA 5TSSA 3ONAB 1SYFA 5EJWA 3TN2A 1FD7D 4G7HC 1HUNA 1ENCA 5IGDA 1WTVA 4ULLA 4IQZA 2RKSA 5CV8A 3GV3A 2F0QA 3WOFA 1H9JA 3OOCA 1STBA 1RTOA 4FNFA 4MIUA 2C5CA 1TS5A 4JK1C 1B44D 1VMCA 2A6EC 2L0CA 1TWAB 1TY0A 3QOLA 2VUMB 2DN8A 3I4MB 4FXGC 1HTLD 1PRTB 4HEDA 1D5XC 1VMPA 5DM73 5E4XA 3S14B 1TR5A 2F0WA 3VR3A 1WTQA 3CU7A 5IT9L 2BE5C 2WAQB 2QEJC 2F0GA 2I46A 3I90A 2M9VA 1SNOA 3HRZC 2L5TA 3R2TA 3M3YB 3PIO3 1I4HA 1LT3D 4QUCA 3SK6A 1FNWA 3D8GA 2EY6A 4EVOA 1QB5D 1BDOA 3BG3A 5AFWA 2XN9C 4KK7A 4DK0A 2JXMB 2F4IA 2Z1CA 2EVBA 2HCIA 4BA2I 2K05A 3OIQA 1SYDA 3R3OA 2JP1A 3E0JA 2J7ZA 5M5XB 3L9AX 5IIFA 3NBIA 1CM9A 5CV6A 1BUVT 2SEBD 1UAPA 3MC0B 1C48A 1Y8NB 4M1UB 3BVZA 3WDNA 1SJED 3HS0C 3J80L 4IUTA 4FF2A 3K5LA 2SOBA 3PMFA 2KECA 1Q1EA 3P20A 2K04A 3D31A 1NSNS 4DXFA 2NTSA 2HUGA 4K14A 1EEFD 2XWJB 3NSWA 1Z7TA 2B2WC 4DGZA 3HGBA 3S2HB 2CHBD 1JB3A 5FO7B 1L0YB 2ICIA 3VA7A 1DYQA 4DN4M 3A8IE 1EY6A 2VNUD 2ENBA 2XIWA 1BCPD 1A6XA 1TWCB 1ZYRD 4RCOA 2PPBC 1EZ6A 4C2MB 3QIAA 5ELDA 4KTAA 4LJZC 4X3UA 3D4RA 1I6HB 3FPPA 3BZDB 2EYPA 3FRPB 1MSHA 1WTXA 3MXNA 1D1IA 3U9SA 3T13A 1ZYRC 1HTPA 3X3NA 4K2LA 2ZXOA 5EKLA 2K5WA 1NUCA 2EYHA 1I6VC 3M4YA 5COYA 1JOOA 2M2LA 4I7ZC 2E2HB 1WTRA 1DD2A 3K7AB 2C9OA 1QG7A 5HURA 1Q3LA 3IFDA 1LT6D 1IYVA 1IKLA 2F0DA 3TP7A 1C4QA 4AYBB 4XTCS 1SYCA 4QIWB 1Z6HA 4U68A 2O5JC 4NDXA 4H13C 4RGOS 3H94A 2B2UC 1F2MA 1SE3A 1GJXA 2CW0D 3OSOA 1GXDC 2D5DA 1KLGD 3GP7A 1JWUD 3IAYA 3RZDB 5JVG3 3L7ZC 1S5CD 1DM0B 1KNEA 1RCVD 4BWGB 2ZXPA 4XDXA 1PTOF 2JYOA 1E2VA 2ICEC 1RODA 2E76C 1GUOA 3NPPA 5KNDA 4K8IA 5C6AA 1SDFA 5EBCA 5CV7A 1YNND 4ZLTF 5CMDA 3NQTA 1PRTC 5M3MB 4HMIA 3TSSA 1BBXC 4A3MB 2KVMA 5EPJA 1I50B 1I4RA 2DNCA 3NWTA 2WINB 4U673 1IKMA 1A3UA 2X69A 2CVRA 4A3JB 5LL6S 5EBDA 1SMYC 5IT9E 4HCEA 2NB0A 1NR2A 3RD4A 3S15B 1VCIA 3SR1A 4C3JB 3LX0A 4XT1B 5FO9B 4KJNA 1RF2D 4C1NK 2PQEA 3S2DB 2L11A 2EDGA 3NBHA 3QB3A 5FKAC 2A6ED 4IFDI 2A68C 3OMGA 3VR5A 2H4OA 5BN5A 3EQLC 1HCZA 3GD7A 3NWSA 3T16A 1HXYD 2NVXB 4DA2A 2IX1A 4C3HB 1S5ED 4IUVA 1X3QA 4DXGA 1SNDA 3EVQA 3GO5A 3I91A 3P1HA 5FK9C 1A2TA 1PMRA 4CGYB 3MVVA 2F0FA 2F0UA 2ID0A 5LHY1 4FF4A 1PTOC 4FXDA 2TMPA 4KN4C 3TDQA 2A73B 4IFDG 3OMCA 4HCSA 4IUQA 2QKIC 2WIIB 4HAEA 4KY7A 3D3RA 3D6WA 3UI2A 1F2LA 4M8AA 5CGKA 5K5PA 1JWSD 5ELEA 1WVLA 4K5WA 1MBYA 3NK9A 1Y1VB 1QJOA 2XVSA 4TQUS 3RZOB 4EQNA 4NP5A 4A3DB 4F88A 3SVMA 2FMCA 2L4NA 1STNA 5M9OA 1B9MA 2A69D 2RDFA 2JA8B 1CQVA 1LT5D 3I72A 2XSCA 4N9PA 1PTOB 3V05A 2NWGA 1VDZA 1AEXA 3C1FA 4HSPA 1TWGB 4ABNA 3D6CA 4KD4A 3ITPA 1WD0A 1BNZA 1H9MA 3M85A 1QCBD 4ZUIA 1YNNC 4DAYA 2PO4A 2RDGA 2KA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VB3 X;  1ZEQ X;  3TDQ A;  2VB2 X;  3E6Z X;  2QCP X;  2L55 A; 
#chains in the Genus database with same CATH topology
 1ZXT A;  2YTX A;  1GUT A;  4H7B A;  2KEN A;  2MFI A;  4HIO A;  3CME A;  2WAQ E;  1WTW A;  2B2V A;  2G5D A;  5CC4 A;  1CK1 A;  4DFA A;  4OWW B;  3AB9 A;  4BBR B;  4K5V A;  2M00 A;  4V0B A;  1SAP A;  3A8K E;  4F87 A;  3S9W A;  1KIX A;  3PIP 3;  3K0Y A;  2E2I B;  1KDB A;  5IWA L;  2JEB I;  3GDE A;  1UEB A;  1NAP A;  5HGQ A;  4A3I B;  1F9S A;  1YBY A;  2JEA I;  1QWY A;  2GVA A;  2L12 A;  4AH6 A;  2IWH A;  4IJH A;  2Z4I A;  1VQ9 A;  1D7Q A;  1HNX Q;  4DK1 A;  1SLJ A;  1HHV A;  4PQX A;  4O2D A;  1G51 A;  1JCK B;  3K8A A;  1E3P A;  1B8A A;  3F8T A;  2K5V A;  4ME5 A;  1WYD A;  5C3X A;  2UUC L;  1FJG L;  3J7Z C;  1I4Q A;  1HUM A;  1V1O A;  2Z9H A;  4LF9 Q;  2Z6K A;  3DXJ C;  1A63 A;  3I3C A;  1TS3 A;  2QF7 A;  3ZYY X;  1E2W A;  3HOX H;  3AFP A;  3H0G B;  1TT2 A;  3FKI B;  5LL6 X;  3ICE A;  4A3D H;  1R4Q B;  3KLS X;  1Y8P B;  4AIM A;  4A3C H;  5ELF A;  3NHH A;  2HDL A;  3G71 A;  4DV0 L;  3U58 A;  4C56 C;  4KKU A;  1TQO A;  3UDX A;  2B8F A;  1HA6 A;  5GAD C;  5FOB B;  1CTM A;  3HP3 A;  1BVS A;  3VA5 A;  4LNQ A;  5C0X I;  1YJ9 A;  3NTH A;  3NXW A;  4IPD A;  2CW0 C;  3PUY A;  1GKH A;  3DEP A;  1EU4 A;  4YWK A;  1UNS A;  1G29 1;  1PH7 A;  1N32 L;  3FMC A;  1K0S A;  1JQY D;  5C3W A;  5JJZ A;  4GZY C;  2JSO A;  5IYC H;  4DR7 Q;  2KED A;  3CCR A;  2IX3 A;  4CDC C;  1SYG A;  3UE0 A;  4LUO A;  4X64 L;  2Z6K C;  2BOS A;  3G48 A;  2HCC A;  2UXC L;  4BY7 B;  2R7Z G;  1L1O C;  3CMA A;  4BBR G;  4J6H A;  2HHH L;  2XRQ D;  2VXW A;  5ELN A;  5CBE E;  2G9H D;  2PW5 A;  5I6Y A;  3C3L A;  4DUZ L;  4ALP A;  4GKJ L;  1AFP A;  4POF A;  2PYK A;  1HNW L;  4JI8 L;  4B9X A;  4IZ8 A;  1BOS A;  2BH2 A;  4XYQ A;  4BBS B;  1D2B A;  1NR4 A;  2E75 C;  3C46 A;  1IBL Q;  1HA5 A;  1OXV A;  4PZ6 A;  2Y0S B;  1OXT A;  1Q90 A;  3LWU A;  4NW2 A;  3Q24 A;  3G6J B;  2K28 A;  5KNC A;  3MXN B;  1CZG A;  2KEE A;  1B3Q A;  4ME3 A;  4BS9 A;  2XTI A;  1BF4 A;  3GTM B;  1HRJ A;  2BCO A;  1PYW D;  1N34 Q;  1RJT A;  4ZKB B;  4YCW A;  4GN5 A;  1K73 C;  2PZU A;  4BY7 H;  2E8G A;  3UDI A;  1S5D D;  3AFQ A;  2ATW A;  2B2U A;  3A56 A;  1UE7 A;  4QB4 A;  5C4H A;  1T5X D;  3TZD A;  1JB7 A;  2CQO A;  5KRU A;  4JC0 A;  1L0X B;  1RTN A;  2EYF A;  2EIF A;  1KXL A;  1KAB A;  1PRT F;  1U4L A;  3DM1 A;  1PH3 A;  4DR4 Q;  2F0H A;  4C3I H;  3V2T A;  3JAM E;  1VQA A;  3HKZ B;  1E22 A;  1PFS A;  4TKO B;  1I3Q B;  1J5E L;  4HIM A;  2IHF A;  2K6A A;  4GLV B;  5IOC A;  3BVM A;  3BS1 A;  1LTB D;  3D0F A;  4DV5 L;  3R93 A;  1I50 H;  3GTQ B;  3J80 i;  5JAV A;  1K28 A;  3VYU A;  1TVX A;  4LUZ A;  5C5L A;  1S5B D;  2MO0 A;  5EPK A;  1XYI A;  5C0X H;  2JK8 A;  4LAA A;  4GKK Q;  3S24 A;  5JVH 3;  1D5M C;  3TP8 A;  5I2Y A;  3DWP A;  4IUP A;  1GM5 A;  4C3I G;  1YNJ D;  1EY8 A;  3HOU H;  2LMC B;  3S1N H;  1PZI D;  1MD2 D;  3SK8 A;  4BXX G;  3PO2 B;  1XMQ L;  2OCE A;  4UP7 A;  3RR5 A;  3VDY A;  1CA5 A;  2I0Q A;  3HOX B;  1XX8 A;  3SHL A;  4DV0 Q;  4EGV A;  4AQY L;  2YYZ A;  3T1H Q;  3M7N A;  4GOP A;  1WOC A;  4R4O A;  5IGE A;  1P16 A;  2NVY B;  5C4Z A;  4A3E B;  2LKV A;  2Q8I B;  4OL7 A;  3DM3 A;  3I4L A;  2HDM A;  3LNN A;  3ND9 A;  2LS0 1;  4IUN A;  3J81 L;  3GTP B;  5KNB A;  1EOV A;  1A15 A;  1LTA D;  2RDH A;  4KD3 A;  3QG1 A;  4G4K A;  3VR4 A;  2R93 H;  1VQN A;  1STA A;  1D6E C;  3S1M B;  4MHE A;  3RN5 A;  1KC8 C;  1LTG D;  1ASZ A;  2OTL A;  3PUX A;  4H44 C;  4UP8 A;  1DXM A;  2A74 C;  4KHV A;  4K6L A;  3S15 H;  3KBX A;  2BDO A;  4KY5 A;  5J3B A;  4DV3 Q;  3F2U A;  4BY1 B;  1VQ6 A;  4B3R L;  3MEH A;  4JI0 Q;  3TRZ A;  1DON A;  2B2Y C;  2OT2 A;  4Q0F A;  2XNA C;  1TS2 A;  2H1E A;  1X9N A;  2NTT A;  5IGC A;  3EJI A;  1EY0 A;  4QCL A;  1F9Q A;  1A3V A;  3GTO B;  1G6P A;  3X3M A;  3QOJ A;  2KBN A;  3J81 c;  4FVM A;  4WOR A;  3J81 j;  3URY A;  3KF6 B;  1EOT A;  3AEV A;  2JA8 G;  4GNX C;  1QNK A;  2B2W A;  2RSN A;  2Q8T A;  2LXK A;  5G3L F;  3WWV A;  1YEZ A;  4JV5 L;  5M5Y B;  2YV5 A;  3A7L A;  4DAM A;  1HNZ L;  4B3T L;  4IPG A;  1XJV A;  1WTO A;  2MUY A;  3CHB D;  3NTI A;  4IPC A;  4QGU A;  5M3M H;  2EJF C;  2K1B A;  3BDL A;  1XNR L;  1STE A;  4G7Z C;  2MQH A;  3C2P A;  2RF4 A;  4A3M G;  1MJE A;  3T51 B;  1LT4 D;  4IAL A;  4DV6 L;  1SE4 A;  4ODG A;  1II3 A;  3I4N H;  2JA8 H;  4JYA L;  2CFM A;  2EJG C;  2HIX A;  2K5N A;  1W6J A;  4ZK9 B;  4LFC L;  5BN3 A;  1VQH A;  2DJG C;  3ULP A;  3E6Z X;  1JOK A;  3HOW B;  4QQB X;  1HFN A;  3VYT A;  5C0X J;  4KKT A;  3E9H A;  4JI4 L;  2E5L Q;  1EYC A;  5FJ8 G;  4H0L C;  4ZRZ A;  4J15 A;  4KJO A;  3PO2 H;  1UEA B;  4QY7 A;  1V1Q A;  2E74 C;  1TXY A;  2I5H A;  3H3V C;  3HKZ G;  1Y1V H;  1K8M A;  1J5E Q;  3S17 B;  4XQN A;  3KJP A;  1VQO A;  5IP7 H;  2MP1 A;  1GD7 A;  3L2P A;  4LF6 Q;  2XWB B;  3EA6 A;  1SNC A;  4X62 L;  4BY1 G;  2F4V L;  2SNS A;  2L55 A;  3RMH A;  1KLU D;  1KTK A;  2YTY A;  3H15 A;  1D5Z C;  2NYZ D;  3CCM A;  4OO1 G;  2F3I A;  1LTT D;  4LFC Q;  1OO9 B;  1YNJ C;  4UPA A;  4A3L H;  2IW3 A;  1DJR D;  3JAM i;  4OX9 L;  1H9K A;  4OGQ C;  4WRD A;  2EE1 A;  4O42 A;  2PW7 A;  2ZXR A;  5CV9 A;  1EY9 A;  4L8J A;  4EQP A;  3VYS A;  4FF3 A;  2OWO A;  4TRD A;  5FLX E;  1A8V A;  5CV5 A;  4P2C B;  2GA4 B;  1Z47 A;  2PZT A;  5BR8 Q;  5COR A;  3I4M G;  2K03 A;  2F0O A;  4A3L G;  1SBB B;  3BYY B;  1E2Z A;  5JOB A;  3TBI B;  4B3M L;  2OTJ A;  3FKI H;  1JWM D;  2IX0 A;  3SK4 A;  4APV A;  1PZK D;  2F0T A;  1IYU A;  2P5Z X;  3KFU A;  1PLF A;  4DAP A;  1V8Q A;  2B2Y A;  4DNT B;  3W3A A;  2WB1 E;  1B53 A;  2A5H A;  4MN3 A;  2R92 B;  5E1F A;  4OIK A;  2MGS A;  5J1Z A;  2KUM A;  4KLK A;  2D9U A;  1E0B A;  3IL8 A;  1IYJ B;  4Q5V A;  3MXG A;  2A6H D;  1WCM B;  1EQV A;  5M5Y H;  4WFN 3;  5D3I B;  4JBK A;  1BBU A;  1LTI D;  1F2Y A;  3S2D H;  3S1M H;  3PQI A;  1PA6 A;  2D0P A;  2SNM A;  2ZJQ A;  4CJ1 B;  2AQ3 B;  3J81 E;  5IP9 H;  5I6W A;  1OXS C;  4FXK C;  4OEL B;  1ILP A;  1STG A;  5K36 G;  4Y7N B;  3H91 A;  2K75 A;  4LWC A;  1M4V A;  3HKZ E;  2PNH A;  3DLL A;  3RLF A;  4IFD J;  3QJY A;  1JC7 A;  5FLX L;  1SFO H;  1SRU A;  3CQZ H;  1HZC A;  1H95 A;  4B08 A;  4FP5 D;  3SEB A;  2DNE A;  1VQ5 A;  2AHO B;  1VQM A;  1GUS A;  3S1N B;  4OWT B;  3M4P A;  3I2Z A;  1TII D;  5K36 H;  2EYL A;  4ZCK A;  1EQR A;  4QF4 A;  1X3P A;  1A2U A;  1W6K A;  1V43 A;  3KBG A;  1BO0 A;  1SMX A;  3T53 B;  4S3S A;  1ONL A;  5BN4 A;  5M5X H;  2F0N A;  4KI0 A;  4PMC A;  1YIJ A;  4DAV A;  1X56 A;  1TS4 A;  1LV9 A;  1SFO B;  4R8I A;  2DY7 A;  3S14 H;  1IW7 D;  1S5F D;  3B6Y A;  4PMB A;  1ZEQ X;  5KIX A;  1TWH B;  5I9O A;  3J7A 5;  2B8G A;  3PUW A;  3S1R B;  4QIW E;  1CT1 D;  1U4R A;  1RHP A;  3CRL C;  3OWF A;  3HG9 A;  4LFB L;  2XRS D;  1GUG A;  4IUU A;  1TKW B;  1QE6 A;  1VQC A;  1LTL A;  2Z8L A;  1Y1W H;  3KF8 A;  4QUF A;  1FVI A;  4X3T A;  2SDF A;  2IHE A;  2K5D A;  2HT1 A;  1HZA A;  4RGN A;  2QA4 A;  4HMJ A;  2UXD L;  1PTO D;  4X65 Q;  1Q8I A;  4R1J A;  2A8V A;  5CV4 A;  1VF7 A;  3LWE A;  2ZM6 Q;  1WCM H;  3W1G A;  2VQE L;  1BXT A;  1I3Q H;  2F0I A;  1XXG A;  3OWE B;  1Q8K A;  4LF9 L;  2F0M A;  4DV4 L;  1K8O A;  1D1K A;  1MGS A;  1Y1W G;  5ELO A;  4K5X A;  2QEX A;  2R7Z B;  4UY8 C;  1TU2 B;  1ET9 A;  1G8Z D;  3K5O A;  1KL9 A;  1SE2 A;  4RGM A;  3MTS A;  4CJ2 C;  1HNZ Q;  2NZO A;  2OXP A;  2ZTC A;  2R3Z A;  2L9H A;  3N6R A;  3OPO A;  3PV0 A;  5ELB A;  2J4X A;  1NBW A;  4RHR A;  2IT1 A;  1SSO A;  4ZQ3 A;  4B9W A;  3FVQ A;  3CRK C;  4EX5 A;  2UXD Q;  2KCC A;  4JI1 Q;  1U9R A;  3NUC A;  2YU9 B;  1L0W A;  3Q23 A;  1VQD A;  1X32 A;  4ZUJ A;  1A62 A;  1UE1 A;  1RKN A;  4O0A A;  3TS2 A;  4KN7 C;  3SDZ A;  2UXB Q;  4CHT B;  5G3L D;  4DF7 A;  4C1N I;  1Y14 B;  5JPM C;  1OXU A;  2DY8 A;  4CDF C;  1EIG A;  2R6G A;  4NXN Q;  2OQ0 A;  2EYJ A;  4ZKC B;  5JJL A;  4HN7 A;  1JT8 A;  3RZO H;  1EYA A;  1WI5 A;  5EGT A;  4PMW A;  4WJ3 M;  4A4I A;  4A93 G;  1SR3 A;  1ESR A;  1PH2 A;  2F1M A;  3MFG A;  4KKS A;  3TS0 A;  4NXM Q;  4RA8 A;  3Q6S A;  4IOA A;  3A0J A;  1FYC A;  3R2I A;  1SXT A;  1C9O A;  5A2Q E;  1BBW A;  2CWP A;  5C44 G;  1O7Y A;  2AWO A;  5H1S E;  3J81 i;  1VF5 C;  2E5L L;  3PO3 B;  4C3H H;  4KV6 A;  3M4O B;  3HOW H;  1DZ1 A;  4A93 H;  2N88 A;  3GV6 A;  4NB3 A;  5C3E B;  3ERO A;  3K5N A;  4DV2 Q;  3C1E A;  2NZ1 D;  4DR3 Q;  1EU3 A;  4IO9 A;  4DV7 L;  3I4N B;  1EY4 A;  2X6L A;  4YWL A;  1IL2 A;  2FJ2 A;  2N78 A;  4ZAI A;  4O1N A;  4FO2 A;  2B2T A;  2HQL A;  1ML0 D;  5EKK A;  2JA9 A;  1M8A A;  3Q0A A;  5GQO A;  3CCQ A;  1SNP A;  2ASB A;  2RQX A;  3UDF A;  2GN5 A;  4UAI A;  4C3H G;  5M3F H;  2EOT A;  4HJ9 A;  2Q8R E;  3CD6 A;  1GHJ A;  3JAM L;  2AQ1 B;  3K58 A;  2RCN A;  3BDC A;  4PNY A;  5KGU A;  2BA1 A;  3GTJ H;  1R9T H;  4L5Q A;  1F77 A;  3NP8 A;  1EIH A;  3A8J E;  1IBK L;  2JA7 H;  2R61 A;  1XTC D;  1H9S A;  3SK5 A;  2CQA A;  2D2C C;  1XNQ Q;  1TWF B;  2F0S A;  2KCN A;  3H3V I;  4HJ5 A;  3S1Q H;  5M3F G;  3W1B A;  1M90 C;  1N33 Q;  3J7A V;  3FPU B;  4OIJ A;  4OO1 I;  2BE5 D;  4CKE A;  3E3X A;  2J0T D;  2C35 B;  3S16 B;  3I8Z A;  3HOV G;  4K0K Q;  4B3T Q;  3RLO A;  3SE0 A;  4A3B H;  4EQO A;  3S16 H;  3AMU A;  4CJ0 B;  1F9P A;  1HQM C;  2KHI A;  1NCV A;  1PH6 A;  2A68 D;  1I4X A;  2IL8 A;  4K2K A;  1K3R A;  1ICF B;  1Y8O B;  2KHS A;  2Q2H A;  4HR7 B;  1GUW A;  4A3K G;  1VS0 A;  2UUA L;  3U50 C;  4R4I A;  3DWA A;  1C7Y A;  2Q2I A;  4LF7 Q;  1ZKO A;  2FMM A;  3VR2 A;  5C44 B;  5DM6 3;  2R92 H;  3FDT A;  4WJW A;  1B2T A;  2OF1 A;  3RNU A;  3S1R H;  2X6G A;  2V1C C;  1B70 B;  4JCV E;  3AU7 A;  4FF1 A;  1SYE A;  3R8B A;  3HOV H;  1YVC A;  1YI2 A;  1IBK Q;  2WP8 J;  4DUZ Q;  3I4O A;  1B3A A;  1CKN B;  2WB1 G;  2RBM A;  4UP9 A;  3JAM c;  4JW0 A;  4RCN A;  4IUR A;  4JG2 A;  5GRO A;  3DMU A;  2VB2 X;  2F0E A;  4A3K H;  2B63 B;  1XWE A;  4K6D A;  1KRT A;  1KDC A;  4A3F H;  2VQF L;  2R92 G;  3NEM A;  2LFN A;  2E2J H;  5IYD H;  5CYU A;  1TWA H;  3SGI A;  5IYB H;  1VQL A;  1S4Z A;  2Q2T A;  1ASY A;  3KOJ A;  5E7N A;  3HOY H;  4L5S A;  3QR8 A;  2B2V C;  2WFW A;  3ER0 A;  2EJM A;  4MNO A;  1VQP A;  1N34 L;  1AE3 A;  2Y0S E;  2NBF A;  1G91 A;  3CQZ B;  3W2D A;  1UUP A;  1BKB A;  1G2S A;  4A3F G;  1QIL A;  2EY2 A;  2Z0S A;  5LMN Q;  1G6Z A;  4R8N A;  3GTL H;  4Z9C B;  4HSV A;  5IYD G;  5LMU Q;  5IYB G;  3GQB A;  4NXM L;  2UUC Q;  4JI6 L;  1ENF A;  3BDO A;  2UUB Q;  4B3S Q;  3K6O A;  4LF4 L;  2A6H C;  4J8Q A;  5EPL A;  3OIP A;  5C4X H;  3S17 H;  4GS3 A;  4XQQ A;  1QNU A;  4RAU C;  1J8I A;  1NY4 A;  1ILQ A;  4JV5 Q;  2O2L D;  5IGB A;  4QJF A;  2O5I C;  5JPN C;  1C8C A;  1CKM A;  3CCL A;  1RDP D;  1C0A A;  4C3J G;  4ZYS A;  4LK1 C;  3KLS A;  2TSS A;  4DR5 Q;  4R4C A;  3FP9 A;  3J7Y W;  4X3S A;  5D3D A;  4DPG A;  1EIY B;  4XXE A;  4DR4 L;  1K83 H;  1MSG A;  4I7A A;  3K7A H;  1LO5 D;  2A1A A;  1CI3 M;  4YIJ A;  1YJW A;  4R9W A;  1CZW A;  1EWH A;  2E2H H;  3UE1 A;  2VQE Q;  1M1K C;  1CKO A;  2V4D A;  3FEW X;  4G7O C;  4HJA A;  2KJX A;  4RKB A;  4C3J H;  5GAE C;  2JA5 H;  4JI4 Q;  4X3K A;  1PDQ A;  1W2B A;  4XT3 B;  3PIP A;  1SNM A;  1PFN A;  5DLQ E;  5IGF A;  1E1T A;  3I55 A;  2IPK D;  2MHV A;  5J39 A;  1EZ8 A;  3KLR A;  5L37 A;  3V96 A;  2EY5 A;  3I56 A;  1Q12 A;  1B1Z A;  3HOZ H;  2JA5 B;  1KAW A;  1BCP F;  3BYT B;  4IJL A;  1DOK A;  1N33 L;  1LTS D;  2JQO A;  1N36 Q;  3MZ5 A;  1CHQ D;  1EFI D;  3BU2 A;  2KQ3 A;  4QMG A;  1O7Z A;  1STH A;  4C2M H;  1EWC A;  1TWC H;  5IGG A;  1KDA A;  3A7A B;  4YHH Q;  1ET6 A;  2WAQ G;  1FL0 A;  5D65 A;  4HIK A;  3HOZ G;  5KYL A;  1XTD A;  5M5W H;  3G7L A;  2AWN A;  3M3Y H;  2G9D A;  4RWS C;  1Y1W B;  4H02 A;  1CFM A;  2WB1 B;  3MXP A;  3EBE A;  3H3V H;  2FIN B;  1CHP D;  2PZW A;  1HR0 L;  2PI2 E;  3KDF B;  1EUJ A;  1D8L A;  1K9M C;  4GN3 B;  1EQT A;  5BR8 L;  4A3J H;  4DR1 L;  3RUZ A;  1B9N A;  2EQS A;  3ULJ A;  3Q22 A;  4CBV A;  5F2D A;  2B39 A;  4IN3 A;  5T1I A;  2IJ0 A;  1QVF A;  3CAM A;  1DOM A;  2CWA A;  4DU9 A;  4JI2 Q;  3H0G H;  4HTH A;  5KEE A;  3WOE A;  4XIG S;  4JBM A;  1F9R A;  1ESF A;  1S3O A;  3KLW A;  2WAC A;  2ZTE A;  4PZ8 A;  4A3G H;  1CSP A;  1JJG A;  2VUM H;  1XMO L;  4A3J G;  4YCU A;  2A69 C;  1B7Y B;  5I4D A;  1MKH A;  5CBA E;  1HH2 P;  1WD1 A;  1BCP B;  1PFB A;  2QIL A;  2F0P A;  2K7V A;  2I5M X;  2Z6B A;  4UDU C;  4CKB A;  4IFD H;  2E2J B;  1ENA A;  2L15 A;  2N55 A;  5IOD A;  4JBW A;  4A3G B;  3M7G A;  1TY2 A;  2NN6 I;  4L6T B;  1LUZ A;  4TSS A;  4OEM B;  4A3K B;  4A3I H;  2F0V A;  2VUM G;  3IFT A;  4LMQ D;  1EEI D;  3MHB A;  1PYB A;  3S1Q B;  4C3I B;  4R4Q A;  5A35 A;  2I5L X;  1STY A;  1VQI A;  1VQB A;  2EY1 A;  3BZC A;  4YY3 L;  1HFG A;  5HY6 A;  5ELC A;  3LGJ A;  2H5X A;  2JA7 B;  3ZJY C;  5D14 A;  3HOZ B;  1U5K A;  1ICW A;  4K0K L;  2F3V A;  2NZH A;  3CC2 A;  3DWQ A;  1AE2 A;  1RD9 D;  3KDF A;  3BVG A;  3ERS X;  1MI2 A;  1V1P B;  1H9S B;  2QCP X;  1WTP A;  2NVT B;  2FHT A;  4ID6 A;  1PH8 A;  5M5W B;  3KF8 B;  1VQ7 A;  1PVO A;  5JEA J;  4GNX A;  1FNU A;  4XYO A;  4A3E G;  3J7A F;  4GLX A;  1AW7 A;  2MPM A;  3DEO A;  3CF5 A;  2HQE A;  4JI1 L;  3Q8D A;  1AZQ A;  2R93 B;  2I07 B;  5GAG C;  4DK3 C;  3NEN A;  1H9R A;  1F2Z A;  2JJQ A;  3K57 A;  1BCP C;  5FO8 B;  1TWG H;  1U4M A;  5E4W C;  3W5O A;  2ES2 A;  3HOU G;  3PUV A;  1JOQ A;  1IW7 C;  2EPB A;  2RA4 A;  2NVY H;  4A3E H;  2FFK B;  2L1B A;  3KF6 A;  1CUK A;  2JE6 I;  5C4J H;  1LLR D;  2FXQ A;  1SEB D;  5NUC A;  1EIF A;  3I70 A;  2AQ2 B;  3IKJ A;  4NKL A;  4KHZ A;  1I4P A;  4DV1 Q;  2RSO A;  1IL8 A;  1PHJ A;  3ND8 A;  2D62 A;  2WKD A;  3GTG H;  3DHQ A;  2K52 A;  2K01 A;  3E5S A;  4X65 L;  2HIV A;  4RHS A;  3TZU A;  3H09 A;  2UU9 Q;  3GTL B;  4FYD A;  4JI3 L;  1HQR D;  1XPO A;  2F0J A;  2R93 G;  5I2X A;  1L1O A;  2QDL A;  3A54 A;  2EXZ A;  1DOL A;  5DNF A;  3MAQ A;  4A93 B;  3T56 B;  4OXP A;  1MJC A;  3GTG B;  1EL0 A;  4CKC A;  4DR3 L;  4DNI A;  3GTK B;  1YNX A;  3HOY B;  3MWY W;  3HEJ A;  4GKK L;  2K32 A;  1HZB A;  5A2Q L;  3T4A C;  4JI2 L;  3I73 A;  3CKI B;  2UXC Q;  1J6Q A;  1GHK A;  4MTN A;  3KUP A;  1V1P A;  4XQJ A;  4DV6 Q;  3NE5 B;  4IOC A;  2K5Q A;  1CSQ A;  5C4X B;  3HOX G;  5LMU L;  2AUK A;  4DK6 C;  2F0L A;  3TP6 A;  3RN2 A;  2AUJ D;  1XMQ Q;  3O13 A;  4DV1 L;  4A3D G;  1G2T A;  1Q1B A;  4KY6 A;  1QZG A;  2HHH Q;  2VB3 X;  3TME A;  1HJP A;  2BH8 A;  5IE8 A;  2F03 A;  3T1Y Q;  3VR6 A;  4A3C G;  5I9P A;  4GKJ Q;  1PFM A;  1T5E A;  3CW2 C;  1J9O A;  3U4Z A;  4JI3 Q;  2E2D C;  1LAC A;  1VQJ A;  3OW7 A;  3D4D A;  2BA0 A;  1FJG Q;  2GVB A;  5M3M G;  5DAU A;  1I94 Q;  2PMZ E;  4BBS H;  1O7L A;  1JIC A;  3NQI A;  1SYB A;  2RCF A;  4L5T A;  5DEH A;  4OON A;  1CQF A;  2WV6 D;  2EYO A;  1L1O B;  5CR3 A;  4A3B B;  1OXX K;  5JEA H;  5AJ3 L;  2WKC A;  3EFX D;  1R4P B;  2NVT H;  5IYC G;  5IY0 A;  2KOL A;  1YJN A;  5EKI A;  4DV3 L;  1VQG A;  1HPC A;  2VW9 A;  3ULL A;  4JI0 L;  4N8X 1;  4BBS G;  3EIV A;  3HZX A;  3HOV B;  5FJ8 H;  3T1Y L;  4RH6 A;  1NTG A;  1VQF A;  1I4G A;  5ISR A;  2R7Z H;  1X3F A;  1Y69 U;  5HGT A;  4BBR H;  2NN6 H;  5JEA G;  3GTJ B;  1Y1V G;  3EN2 A;  2ZM6 L;  4X66 Q;  5IP7 G;  3MA2 B;  2B63 G;  1FNV A;  4JI5 L;  3F2B A;  2PNR C;  3L3O C;  1I94 L;  3OHX C;  4F8M A;  4DAY B;  1A3T A;  1UWV A;  1AZP A;  3AYH B;  3QO2 A;  1KAA A;  4ILW A;  4QL5 A;  3QWN A;  1SMY D;  3AQQ A;  4OO1 H;  4TVA B;  2PMZ B;  1GVP A;  1N32 Q;  2NN6 G;  3CP0 A;  1PH5 A;  1GUN A;  2N3S A;  3MXU A;  4I65 A;  3MFY A;  1PZJ D;  4A3F B;  2K33 A;  1TWF H;  1PTO H;  2PCF B;  3J80 c;  1B50 A;  4L5R C;  1GOZ A;  2B63 H;  4JYA Q;  1U4P A;  1BR9 A;  3K5M A;  4KMU C;  4BY7 G;  1DCZ A;  1JR0 D;  1R9T B;  4OHJ A;  1EYG A;  1JMC A;  2B3G A;  1SN8 A;  2CH4 W;  4NMZ A;  4MZ9 A;  4JI6 Q;  4B3S L;  4LF4 Q;  4WJ4 A;  2EYM A;  2RVL A;  4GOP B;  3I4M H;  1FR3 A;  3ERQ A;  5M3F B;  1KNA A;  2D0O A;  3HOU B;  3FKI G;  4L63 B;  4N9T A;  4N8F A;  2ZT9 C;  1SJH D;  3RZD H;  2LY7 A;  4J1M A;  1JOR A;  1IHZ A;  3M4Q A;  2QDB A;  1BQQ T;  1PH9 A;  2NUC A;  5J22 A;  5IT9 c;  1FGB D;  2O4X A;  2UXB L;  2F0K A;  3GTK H;  5C0X G;  3A55 A;  4NXN L;  1HNX L;  2QW7 A;  2NVQ B;  1XPR A;  2LSS A;  3D4W A;  3STB C;  5T1G A;  2JA6 B;  1LAB A;  4DNR B;  1AP0 A;  4KHP Q;  1B4O A;  5KYI A;  4BXX H;  5E3F A;  3P7J A;  4Y7N H;  1GO3 E;  4FDB A;  1NE3 A;  3HKS A;  1EFW A;  2F3W A;  1O78 A;  1O7I A;  2VL6 A;  4E6I A;  1RL2 A;  3H6M A;  2BDN A;  3U4V A;  1PXU A;  1EYD A;  3NTK A;  1EY5 A;  4V19 0;  4LW1 A;  4DV2 L;  4P72 A;  5C4J B;  4K8J A;  4POG A;  3P75 A;  1AN8 A;  3N52 A;  3U9O A;  3TP5 A;  1JE4 A;  4G57 A;  5EQ0 A;  2KCT A;  3K59 A;  3SXH A;  1K83 B;  4X6A H;  1VQE A;  1Q81 C;  2MJ8 A;  4HJ8 A;  4RGT A;  1I6H H;  4RFB A;  2YU9 H;  2B2T C;  2NVQ H;  1CA6 A;  4PV1 C;  1EY7 A;  1SNQ A;  1S40 A;  1PRT D;  4BA1 I;  3PUZ A;  2DJF C;  5C5M A;  3KK7 A;  3VYR A;  1QOH A;  4AQY Q;  1EQQ A;  2JA6 G;  4DR2 Q;  3M9B A;  3DUZ A;  2EZV A;  1S72 A;  4P75 A;  1O80 A;  1AH9 A;  3J80 E;  1LTR D;  3OW2 A;  2OEO A;  4RKL A;  1E1O A;  4F7X A;  2Z4H A;  5TSS A;  2K14 A;  4DV4 Q;  3ONA B;  1SYF A;  4X64 Q;  5EJW A;  3UDG A;  3RLN A;  4PZ7 A;  3TN2 A;  1FD7 D;  1WFQ A;  3OTO L;  2JA6 H;  1KD1 C;  4X62 Q;  4G7H C;  1HUN A;  2F4V Q;  3CPW A;  1ENC A;  5IGD A;  1WTV A;  1QVG A;  4ULL A;  4IQZ A;  2RKS A;  5CV8 A;  2CH4 A;  1QUQ B;  4A3M H;  3GV3 A;  2F0Q A;  3WOF A;  1N8R C;  1H9J A;  3OOC A;  1STB A;  1RTO A;  3I4N G;  4FNF A;  4MIU A;  2C5C A;  3CCJ A;  1TS5 A;  4JK1 C;  1FGU A;  1B44 D;  1VMC A;  2A6E C;  2L0C A;  4RG1 A;  3A5Z B;  1TWA B;  1TY0 A;  3QOL A;  2VUM B;  4CDD C;  2DN8 A;  3I4M B;  4FXG C;  1HTL D;  5FLM G;  1PRT B;  2AMC B;  2PQA A;  4HED A;  1Q86 C;  1KQS A;  1D5X C;  1VMP A;  5DM7 3;  5E4X A;  5JJI A;  2EXD A;  3S14 B;  2UUA Q;  3PO2 G;  1TR5 A;  1EWI A;  2RHQ B;  1QUQ A;  2F0W A;  3VR3 A;  2MNA A;  2NVX H;  2K5H A;  2IY5 B;  1UE6 A;  2ZJR A;  3CCE A;  1WTQ A;  3CU7 A;  5IT9 L;  2BE5 C;  3PGZ A;  5GAH C;  1IXR A;  2WAQ B;  1SRO A;  3F1Z A;  1X65 A;  2N8N A;  3KYH C;  2QEJ C;  3PCO B;  5FLM H;  4BY1 H;  1HZ9 A;  2F0G A;  2I46 A;  3I90 A;  2HD3 A;  3NBH B;  2M9V A;  1SNO A;  5AJ3 Q;  1YHQ A;  4LF8 Q;  1V9P A;  3HRZ C;  2L5T A;  4LUV A;  4KHP L;  2DGY A;  2KCM A;  3R2T A;  3M3Y B;  4JOI C;  3PIO 3;  1I4H A;  1MIU A;  1LT3 D;  4QUC A;  3SK6 A;  2E2I H;  1FNW A;  3D8G A;  2EY6 A;  4EVO A;  1QB5 D;  1BDO A;  3E0E A;  3BG3 A;  5AFW A;  4YCV A;  1QVC A;  2XN9 C;  4KK7 A;  4DK0 A;  2JXM B;  2F4I A;  1PH1 A;  1XNQ L;  2Z1C A;  1QZH A;  2EVB A;  2HCI A;  4BA2 I;  2K05 A;  3OIQ A;  1X54 A;  1SYD A;  4JI5 Q;  3R3O A;  2JP1 A;  3E0J A;  2J7Z A;  5LMN L;  1PV4 A;  3CCV A;  5M5X B;  3PSI A;  3L9A X;  5IIF A;  4DKA C;  3NBI A;  1CM9 A;  5CV6 A;  4HID A;  1BUV T;  2SEB D;  1L2F A;  1UAP A;  3MC0 B;  1C48 A;  1Y8N B;  4M1U B;  4CDE C;  2VS1 A;  1MHW C;  3BVZ A;  4OX9 Q;  3WDN A;  1SJE D;  1PH4 A;  5C3E H;  3HS0 C;  3BJU A;  4RMF A;  2UU9 L;  2R7F A;  3J80 L;  4IUT A;  5EAY A;  3K5L A;  2N49 A;  4FF2 A;  4OWX B;  2SOB A;  3PMF A;  2KEC A;  4DUY Q;  1IBM Q;  3GTP H;  1Q1E A;  3P20 A;  3PIO A;  3GTQ H;  1JJC B;  2K04 A;  3D31 A;  3IRB A;  1NSN S;  4DXF A;  4DR6 L;  2NTS A;  2HUG A;  2VY3 A;  3G6E A;  4K14 A;  3OTO Q;  3PO3 H;  1EEF D;  2XWJ B;  3NSW A;  5IP9 G;  1I5F A;  5C3E G;  1Z7T A;  2B2W C;  3S2H H;  3MEF A;  2AKW B;  3HFZ B;  1N36 L;  2JA7 G;  4GLA C;  1LYL A;  4PG3 A;  4DGZ A;  3HGB A;  3PF5 A;  3S2H B;  2CHB D;  1JB3 A;  1VQK A;  4LF5 Q;  5FO7 B;  1L0Y B;  1P8L A;  2ICI A;  3VA7 A;  1WTH A;  1DYQ A;  3PO3 G;  4NPS A;  4DN4 M;  1E7Z A;  3A8I E;  1CKN A;  1KRS A;  1EY6 A;  2VNU D;  2ENB A;  1X3E A;  2XIW A;  1BCP D;  1A6X A;  4DV5 Q;  1TWC B;  1ZYR D;  2ZJP A;  4RCO A;  2VQF Q;  2PPB C;  1EZ6 A;  4C2M B;  3QIA A;  3CC7 A;  4DR1 Q;  5ELD A;  4KTA A;  4LJZ C;  4X3U A;  1DGS A;  3D4R A;  1IZ6 A;  1I6H B;  3FPP A;  3BZD B;  2EYP A;  3K81 C;  3FRP B;  4GNX B;  1MSH A;  1WTX A;  3MXN A;  1XNR Q;  1D1I A;  2R7D A;  3U9S A;  3T13 A;  3TEH B;  1KHI A;  1ZYR C;  2CCZ A;  4JOI A;  1HTP A;  3X3N A;  4K2L A;  4JI7 L;  2LXJ A;  4YWM A;  1YHA A;  2ZXO A;  5EKL A;  2K5W A;  1NUC A;  2EYH A;  1I6V C;  3M4Y A;  3PF4 A;  3GTO H;  5COY A;  1JOO A;  2M2L A;  4I7Z C;  1K8A C;  2E2H B;  4JI8 Q;  1WTR A;  1DD2 A;  3K7A B;  2C9O A;  4LF8 L;  3KJO A;  3K0X A;  1QG7 A;  5HUR A;  1Q3L A;  3IFD A;  1LT6 D;  1IYV A;  1IKL A;  2F0D A;  3TP7 A;  4P71 A;  1C4Q A;  1Q7Y C;  4AYB B;  4XTC S;  1SYC A;  4QIW B;  3HOY G;  1WCM G;  1Z6H A;  2Y0S G;  4U68 A;  4JBJ A;  2O5J C;  3I7F A;  4NDX A;  3FHW A;  4H13 C;  4RGO S;  3H94 A;  1VQ8 A;  1Q82 C;  1E24 A;  2B2U C;  1OTC A;  4DR5 L;  1F2M A;  1SE3 A;  1GJX A;  4B3M Q;  2CW0 D;  3OSO A;  3K7U C;  1GXD C;  2D5D A;  1KLG D;  3GP7 A;  1JWU D;  3IAY A;  3RZD B;  5LMN W;  5JVG 3;  3L7Z C;  1S5C D;  1DM0 B;  5C4X G;  1KNE A;  1RCV D;  4LFB Q;  1Z9F A;  2PQA B;  3STB D;  4HJ7 A;  4BWG B;  2ZXP A;  4XDX A;  1PTO F;  3CC4 A;  2JYO A;  1YIT A;  1E2V A;  1TWH H;  1RIP A;  2ICE C;  1ROD A;  2E76 C;  3L0O A;  1NMF A;  4Y52 H;  4GN4 B;  2VZA A;  4P73 A;  1GUO A;  3G4S A;  3NPP A;  5KND A;  4K8I A;  4LFA L;  5C6A A;  1SDF A;  5EBC A;  5CV7 A;  3BZK A;  1YNN D;  4ZLT F;  1N9W A;  5CMD A;  3NQT A;  1X3G A;  1PRT C;  4AYB G;  1T9H A;  5M3M B;  1HR0 Q;  4HMI A;  1K3B C;  4YHH L;  3TSS A;  1XPU A;  1BBX C;  3OYY A;  3TQY A;  2KVM A;  5EPJ A;  1PYS B;  3CXC A;  4A3M B;  2F52 A;  1LM0 A;  1I50 B;  4JVZ A;  1A0I A;  1I4R A;  2QGQ A;  2DNC A;  1YZ6 A;  3NWT A;  3M4O H;  2WIN B;  2JA5 G;  4U67 3;  1NJI C;  1IKM A;  1K0R A;  1A3U A;  2X69 A;  2CVR A;  5JJK A;  4A3J B;  5LL6 S;  5EBD A;  1SMY C;  5IT9 E;  5C44 H;  4HCE A;  4A76 A;  2NB0 A;  1NR2 A;  1Q46 A;  3RD4 A;  3S15 B;  1VCI A;  3SR1 A;  2B29 A;  1SE8 A;  2KHJ A;  3HOW G;  4C3J B;  2OQK A;  3LX0 A;  1IBL L;  4XT1 B;  5FO9 B;  2XGT A;  4KJN A;  1RF2 D;  4C1N K;  2PQE A;  3S2D B;  3JC6 6;  2L11 A;  2EDG A;  3NBH A;  3QB3 A;  3E9I A;  5FKA C;  2A6E D;  3A5U A;  5IWA Q;  4IFD I;  4YY3 Q;  4JI7 Q;  1XMO Q;  4JPB W;  4UHV A;  2A68 C;  3OMG A;  4B3R Q;  3VR5 A;  2H4O A;  5BN5 A;  1JE5 A;  2CKZ B;  3EQL C;  1HCZ A;  3GD7 A;  3NWS A;  3T16 A;  1HXY D;  2NVX B;  4DA2 A;  2IX1 A;  4DR2 L;  4C3H B;  2K50 A;  4MTK A;  1S5E D;  4IUV A;  1HR0 W;  1X3Q A;  1X55 A;  4DXG A;  1SND A;  3EVQ A;  1UE5 A;  3GO5 A;  3I91 A;  3P1H A;  3H0G G;  5FK9 C;  1A2T A;  1U0L A;  1PMR A;  4CGY B;  3MVV A;  4EQ5 A;  2F0F A;  2F0U A;  3TRE A;  2ID0 A;  5LHY 1;  1W3S A;  1PTO C;  4FF4 A;  4A3G G;  1JJ2 A;  4FXD A;  2TMP A;  4AYB E;  4DV7 Q;  4A3B G;  4KN4 C;  3A74 A;  3TDQ A;  3CCU A;  1YHB A;  4A75 A;  2K4K A;  2DUD A;  2A73 B;  4IFD G;  3OMC A;  4HCS A;  4IUQ A;  2QKI C;  2WII B;  4HAE A;  4KY7 A;  3D3R A;  3NEL A;  3D6W A;  3CPF A;  3UI2 A;  2UUB L;  3F2D A;  2PI2 A;  1F2L A;  4M8A A;  5CGK A;  4DUY L;  1IBM L;  4A3I G;  5ELE A;  1JWS D;  5K5P A;  4GOP C;  4P74 A;  3F2C A;  1VQ4 A;  1WVL A;  4K5W A;  3CCS A;  1MBY A;  3NK9 A;  1Y1V B;  2A19 A;  4LF5 L;  1QJO A;  4DR7 L;  2XVS A;  4TQU S;  3RZO B;  4EQN A;  4NP5 A;  4DR6 Q;  4A3D B;  4X66 L;  4F88 A;  3SVM A;  2FMC A;  4LF6 L;  4LFA Q;  1NNX A;  2L4N A;  2MO1 A;  1WJJ A;  3GTM H;  1STN A;  4R4T A;  5M9O A;  1B9M A;  2A69 D;  2RDF A;  2JA8 B;  3T1H L;  1CQV A;  1X6O A;  1LT5 D;  3I72 A;  2XSC A;  4N9P A;  5FLX c;  1PTO B;  2RHS B;  3V05 A;  2NWG A;  2Q2U A;  1K8G A;  4IPH A;  2JN4 A;  1VDZ A;  1AEX A;  3C1F A;  4HSP A;  1TWG B;  4ABN A;  3D6C A;  4KD4 A;  2YTV A;  3K80 C;  3ITP A;  4LF7 L;  1WD0 A;  1BNZ A;  2ZTD A;  1H9M A;  2ALY B;  3M85 A;  1NMG A;  1QCB D;  1HNW Q;  4ZUI A;  1YNN C;  4DAY A;  2PO4 A;  2RDG A;  2KA7 A; 
#chains in the Genus database with same CATH homology
 1ZXT A;  1GUT A;  4H7B A;  1WTW A;  2B2V A;  5CC4 A;  1CK1 A;  4DFA A;  3AB9 A;  4BBR B;  4K5V A;  2M00 A;  4V0B A;  1SAP A;  3A8K E;  4F87 A;  3S9W A;  3PIP 3;  3K0Y A;  2E2I B;  1KDB A;  2JEB I;  1NAP A;  4A3I B;  1F9S A;  2JEA I;  1QWY A;  2L12 A;  2IWH A;  2Z4I A;  4DK1 A;  1HHV A;  4PQX A;  1JCK B;  4ME5 A;  5C3X A;  1V1O A;  1HUM A;  1I4Q A;  3DXJ C;  3I3C A;  1TS3 A;  2QF7 A;  3ZYY X;  1E2W A;  3H0G B;  1TT2 A;  3FKI B;  5LL6 X;  1R4Q B;  3KLS X;  1Y8P B;  5ELF A;  3NHH A;  2HDL A;  4C56 C;  4KKU A;  1TQO A;  2B8F A;  1HA6 A;  5FOB B;  1CTM A;  3HP3 A;  3VA5 A;  5C0X I;  3NTH A;  3NXW A;  2CW0 C;  3PUY A;  3DEP A;  1EU4 A;  1UNS A;  1G29 1;  3FMC A;  1JQY D;  5C3W A;  5JJZ A;  4GZY C;  2JSO A;  2KED A;  2IX3 A;  1SYG A;  2BOS A;  2HCC A;  4BY7 B;  4J6H A;  2XRQ D;  2VXW A;  5CBE E;  2G9H D;  2PW5 A;  5I6Y A;  3C3L A;  1AFP A;  2PYK A;  4B9X A;  4IZ8 A;  1BOS A;  4XYQ A;  4BBS B;  1D2B A;  1NR4 A;  2E75 C;  3C46 A;  1HA5 A;  1OXV A;  2Y0S B;  1OXT A;  1Q90 A;  3LWU A;  4NW2 A;  3Q24 A;  3G6J B;  2K28 A;  5KNC A;  1CZG A;  2KEE A;  4BS9 A;  1BF4 A;  3GTM B;  1HRJ A;  2BCO A;  1PYW D;  1RJT A;  4ZKB B;  2PZU A;  1S5D D;  2B2U A;  3A56 A;  4QB4 A;  5C4H A;  1T5X D;  3TZD A;  5KRU A;  1L0X B;  1RTN A;  2EYF A;  1KAB A;  1PRT F;  1U4L A;  3DM1 A;  2F0H A;  3V2T A;  3JAM E;  3HKZ B;  4TKO B;  1I3Q B;  2K6A A;  5IOC A;  3BVM A;  3BS1 A;  1LTB D;  3R93 A;  3GTQ B;  5JAV A;  3VYU A;  1TVX A;  5C5L A;  1S5B D;  5EPK A;  1XYI A;  5C0X H;  4LAA A;  5JVH 3;  1D5M C;  3TP8 A;  5I2Y A;  3DWP A;  4IUP A;  4C3I G;  1YNJ D;  1EY8 A;  2LMC B;  1PZI D;  1MD2 D;  3SK8 A;  3PO2 B;  1CA5 A;  3HOX B;  1XX8 A;  3SHL A;  4EGV A;  3M7N A;  2YYZ A;  5IGE A;  5C4Z A;  2NVY B;  4A3E B;  2LKV A;  2Q8I B;  4OL7 A;  3I4L A;  2HDM A;  3LNN A;  3ND9 A;  2LS0 1;  4IUN A;  3J81 L;  3GTP B;  5KNB A;  1A15 A;  1LTA D;  2RDH A;  4KD3 A;  3QG1 A;  4G4K A;  3VR4 A;  1STA A;  1D6E C;  3S1M B;  4MHE A;  1LTG D;  3PUX A;  4H44 C;  1DXM A;  2A74 C;  4KHV A;  4K6L A;  3KBX A;  2BDO A;  4KY5 A;  3F2U A;  4BY1 B;  3MEH A;  1DON A;  2B2Y C;  2OT2 A;  4Q0F A;  2XNA C;  1TS2 A;  2H1E A;  2NTT A;  5IGC A;  3EJI A;  1EY0 A;  4QCL A;  1F9Q A;  1A3V A;  3GTO B;  3X3M A;  3QOJ A;  4FVM A;  4WOR A;  3URY A;  1EOT A;  1QNK A;  2B2W A;  2RSN A;  2Q8T A;  5G3L F;  5M5Y B;  3A7L A;  1WTO A;  2MUY A;  3CHB D;  3NTI A;  2EJF C;  2K1B A;  3BDL A;  1STE A;  4G7Z C;  3C2P A;  3T51 B;  1LT4 D;  4IAL A;  1SE4 A;  4ODG A;  1II3 A;  2EJG C;  1W6J A;  4ZK9 B;  5BN3 A;  3E6Z X;  1JOK A;  3HOW B;  1HFN A;  3VYT A;  5C0X J;  4KKT A;  1EYC A;  4H0L C;  4ZRZ A;  4KJO A;  1UEA B;  2E74 C;  3H3V C;  1K8M A;  3S17 B;  4XQN A;  2MP1 A;  2XWB B;  3EA6 A;  1SNC A;  2SNS A;  2L55 A;  3RMH A;  1KLU D;  1KTK A;  1D5Z C;  2NYZ D;  4OO1 G;  1LTT D;  1OO9 B;  1YNJ C;  2IW3 A;  1DJR D;  1H9K A;  4OGQ C;  4WRD A;  2EE1 A;  4O42 A;  2PW7 A;  2ZXR A;  5CV9 A;  1EY9 A;  4L8J A;  4EQP A;  3VYS A;  4FF3 A;  4TRD A;  5FLX E;  5CV5 A;  4P2C B;  2GA4 B;  1Z47 A;  2PZT A;  5COR A;  2K03 A;  2F0O A;  1SBB B;  3BYY B;  1E2Z A;  5JOB A;  3TBI B;  1JWM D;  2IX0 A;  3SK4 A;  1PZK D;  2F0T A;  1IYU A;  1PLF A;  4DAP A;  1V8Q A;  2B2Y A;  4DNT B;  3W3A A;  1B53 A;  2A5H A;  4MN3 A;  2R92 B;  5E1F A;  4OIK A;  2MGS A;  5J1Z A;  2KUM A;  2D9U A;  1E0B A;  3IL8 A;  4Q5V A;  3MXG A;  2A6H D;  1WCM B;  1EQV A;  4WFN 3;  5D3I B;  1LTI D;  1F2Y A;  2SNM A;  4CJ1 B;  2AQ3 B;  3J81 E;  5I6W A;  1OXS C;  4FXK C;  1ILP A;  1STG A;  5K36 G;  4Y7N B;  3H91 A;  1M4V A;  3RLF A;  4IFD J;  3QJY A;  1JC7 A;  5FLX L;  4B08 A;  4FP5 D;  3SEB A;  2DNE A;  1GUS A;  3S1N B;  1TII D;  5K36 H;  2EYL A;  4QF4 A;  1X3P A;  1A2U A;  1W6K A;  1V43 A;  3KBG A;  1BO0 A;  3T53 B;  4S3S A;  1ONL A;  5BN4 A;  2F0N A;  4KI0 A;  4PMC A;  4DAV A;  1TS4 A;  1LV9 A;  1SFO B;  4R8I A;  2DY7 A;  1IW7 D;  1S5F D;  4PMB A;  1ZEQ X;  5KIX A;  1TWH B;  5I9O A;  2B8G A;  3PUW A;  3S1R B;  1CT1 D;  1U4R A;  1RHP A;  3CRL C;  3OWF A;  3HG9 A;  2XRS D;  1GUG A;  4IUU A;  1TKW B;  1QE6 A;  2Z8L A;  3KF8 A;  4QUF A;  4X3T A;  2SDF A;  2K5D A;  4RGN A;  4HMJ A;  1PTO D;  1Q8I A;  5CV4 A;  1VF7 A;  3LWE A;  1BXT A;  2F0I A;  1XXG A;  3OWE B;  2F0M A;  1K8O A;  1D1K A;  1MGS A;  4K5X A;  2R7Z B;  1TU2 B;  1ET9 A;  1G8Z D;  3K5O A;  1SE2 A;  4RGM A;  3MTS A;  4CJ2 C;  2OXP A;  2R3Z A;  2L9H A;  3N6R A;  3OPO A;  3PV0 A;  5ELB A;  2J4X A;  4RHR A;  2IT1 A;  1SSO A;  4ZQ3 A;  4B9W A;  3FVQ A;  3CRK C;  2KCC A;  1U9R A;  3NUC A;  2YU9 B;  3Q23 A;  1X32 A;  4ZUJ A;  1RKN A;  4KN7 C;  3SDZ A;  4CHT B;  5G3L D;  4DF7 A;  4C1N I;  5JPM C;  1OXU A;  2DY8 A;  1EIG A;  2R6G A;  2EYJ A;  4ZKC B;  4HN7 A;  1EYA A;  5EGT A;  4PMW A;  1ESR A;  2F1M A;  3MFG A;  4KKS A;  4RA8 A;  3Q6S A;  1FYC A;  3R2I A;  1SXT A;  5A2Q E;  1O7Y A;  2AWO A;  1VF5 C;  3PO3 B;  4KV6 A;  3M4O B;  1DZ1 A;  2N88 A;  3GV6 A;  5C3E B;  3ERO A;  3K5N A;  3C1E A;  2NZ1 D;  1EU3 A;  3I4N B;  1EY4 A;  2X6L A;  2FJ2 A;  4ZAI A;  4O1N A;  4FO2 A;  2B2T A;  1ML0 D;  5EKK A;  1M8A A;  3Q0A A;  1SNP A;  2RQX A;  4UAI A;  4C3H G;  2EOT A;  2Q8R E;  1GHJ A;  3JAM L;  2AQ1 B;  3K58 A;  3BDC A;  4PNY A;  5KGU A;  2BA1 A;  1F77 A;  3NP8 A;  1EIH A;  3A8J E;  2R61 A;  1XTC D;  1H9S A;  3SK5 A;  2CQA A;  2D2C C;  1TWF B;  2F0S A;  2KCN A;  3J7A V;  3FPU B;  4OIJ A;  4OO1 I;  2BE5 D;  4CKE A;  2J0T D;  3S16 B;  3I8Z A;  3SE0 A;  4EQO A;  3AMU A;  4CJ0 B;  1F9P A;  1HQM C;  1NCV A;  2A68 D;  1I4X A;  2IL8 A;  4K2K A;  2KHS A;  1Y8O B;  4HR7 B;  1GUW A;  3DWA A;  1ZKO A;  2FMM A;  3VR2 A;  5C44 B;  5DM6 3;  3FDT A;  4WJW A;  1B2T A;  2OF1 A;  2X6G A;  3AU7 A;  4FF1 A;  1SYE A;  3R8B A;  2WP8 J;  1B3A A;  2RBM A;  4RCN A;  4IUR A;  3DMU A;  2VB2 X;  2F0E A;  2B63 B;  1XWE A;  4K6D A;  1KDC A;  2LFN A;  5CYU A;  1S4Z A;  2B2V C;  2EJM A;  2NBF A;  1G91 A;  3CQZ B;  3W2D A;  1UUP A;  1G2S A;  1QIL A;  2EY2 A;  1G6Z A;  4R8N A;  4Z9C B;  4HSV A;  3GQB A;  1ENF A;  3BDO A;  3K6O A;  2A6H C;  4J8Q A;  5EPL A;  3OIP A;  4XQQ A;  1QNU A;  4RAU C;  1J8I A;  1ILQ A;  2O2L D;  5IGB A;  2O5I C;  1C8C A;  5JPN C;  1RDP D;  4C3J G;  4ZYS A;  4LK1 C;  3KLS A;  2TSS A;  3J7Y W;  4X3S A;  5D3D A;  4XXE A;  1MSG A;  1LO5 D;  1CI3 M;  4YIJ A;  4R9W A;  1CZW A;  1EWH A;  2V4D A;  3FEW X;  4G7O C;  2KJX A;  4RKB A;  4X3K A;  1PDQ A;  4XT3 B;  1SNM A;  1PFN A;  5IGF A;  2IPK D;  2MHV A;  5J39 A;  1EZ8 A;  3KLR A;  3V96 A;  2EY5 A;  1Q12 A;  1B1Z A;  2JA5 B;  1BCP F;  3BYT B;  1DOK A;  1LTS D;  3MZ5 A;  1CHQ D;  1EFI D;  4QMG A;  2KQ3 A;  1O7Z A;  1STH A;  1EWC A;  5IGG A;  1KDA A;  3A7A B;  1ET6 A;  5D65 A;  5KYL A;  3G7L A;  2AWN A;  2G9D A;  4RWS C;  1Y1W B;  1CFM A;  2WB1 B;  3MXP A;  2FIN B;  1CHP D;  2PZW A;  1EQT A;  3RUZ A;  1B9N A;  3Q22 A;  4CBV A;  5F2D A;  2B39 A;  4IN3 A;  5T1I A;  2IJ0 A;  1DOM A;  4DU9 A;  4HTH A;  5KEE A;  3WOE A;  4XIG S;  1F9R A;  1ESF A;  2WAC A;  2A69 C;  5I4D A;  5CBA E;  1WD1 A;  1BCP B;  1PFB A;  2QIL A;  2F0P A;  2K7V A;  4UDU C;  4CKB A;  4IFD H;  2E2J B;  1ENA A;  4A3G B;  2N55 A;  5IOD A;  4JBW A;  3M7G A;  1TY2 A;  2NN6 I;  4L6T B;  4TSS A;  4A3K B;  2F0V A;  3IFT A;  4LMQ D;  1EEI D;  3MHB A;  3S1Q B;  4C3I B;  5A35 A;  1STY A;  2EY1 A;  1HFG A;  5ELC A;  2JA7 B;  5D14 A;  3HOZ B;  1ICW A;  2F3V A;  3DWQ A;  1RD9 D;  3BVG A;  1MI2 A;  1V1P B;  1H9S B;  2QCP X;  1WTP A;  2NVT B;  2FHT A;  4ID6 A;  5M5W B;  5JEA J;  1FNU A;  4XYO A;  3J7A F;  1AW7 A;  2MPM A;  3DEO A;  2HQE A;  2R93 B;  1AZQ A;  2I07 B;  1H9R A;  1F2Z A;  3K57 A;  1BCP C;  5FO8 B;  1U4M A;  5E4W C;  3PUV A;  1JOQ A;  1IW7 C;  2EPB A;  2RA4 A;  2FFK B;  2L1B A;  2JE6 I;  1LLR D;  1SEB D;  5NUC A;  3I70 A;  2AQ2 B;  3IKJ A;  4NKL A;  4KHZ A;  1I4P A;  2RSO A;  1IL8 A;  3ND8 A;  2D62 A;  2WKD A;  3DHQ A;  2K01 A;  3E5S A;  4RHS A;  3TZU A;  3H09 A;  3GTL B;  4FYD A;  1HQR D;  2F0J A;  5I2X A;  3A54 A;  2EXZ A;  1DOL A;  5DNF A;  3MAQ A;  4A93 B;  3T56 B;  3GTG B;  1EL0 A;  4CKC A;  3GTK B;  3HOY B;  3MWY W;  3HEJ A;  2K32 A;  5A2Q L;  3T4A C;  3I73 A;  3CKI B;  1GHK A;  3KUP A;  1V1P A;  4XQJ A;  3NE5 B;  2K5Q A;  5C4X B;  2AUK A;  2F0L A;  3TP6 A;  2AUJ D;  3O13 A;  1G2T A;  1Q1B A;  4KY6 A;  2VB3 X;  3TME A;  2F03 A;  3VR6 A;  5I9P A;  1PFM A;  1T5E A;  1J9O A;  2E2D C;  1LAC A;  3OW7 A;  3D4D A;  2BA0 A;  5DAU A;  1O7L A;  1JIC A;  3NQI A;  1SYB A;  5DEH A;  1CQF A;  2WV6 D;  2EYO A;  5CR3 A;  4A3B B;  1OXX K;  5JEA H;  2WKC A;  3EFX D;  1R4P B;  2KOL A;  5EKI A;  1HPC A;  3HZX A;  3HOV B;  4RH6 A;  5ISR A;  1I4G A;  1Y69 U;  5HGT A;  2NN6 H;  5JEA G;  3GTJ B;  3MA2 B;  1FNV A;  2PNR C;  3L3O C;  3OHX C;  4F8M A;  1A3T A;  1AZP A;  3QO2 A;  1KAA A;  4ILW A;  3QWN A;  1SMY D;  4OO1 H;  2PMZ B;  2NN6 G;  1GUN A;  3MXU A;  4I65 A;  3MFY A;  1PZJ D;  4A3F B;  2K33 A;  1PTO H;  2PCF B;  1B50 A;  1GOZ A;  1U4P A;  1BR9 A;  3K5M A;  4KMU C;  1DCZ A;  1JR0 D;  1R9T B;  4OHJ A;  4NMZ A;  2EYM A;  2RVL A;  1FR3 A;  3ERQ A;  5M3F B;  1KNA A;  3HOU B;  4L63 B;  4N9T A;  2ZT9 C;  1SJH D;  2LY7 A;  4J1M A;  1JOR A;  1IHZ A;  2QDB A;  1BQQ T;  2NUC A;  5J22 A;  1FGB D;  2O4X A;  2F0K A;  5C0X G;  3A55 A;  2NVQ B;  3D4W A;  5T1G A;  2JA6 B;  1LAB A;  4DNR B;  1AP0 A;  1B4O A;  5KYI A;  5E3F A;  3P7J A;  2F3W A;  1O78 A;  4E6I A;  3H6M A;  2BDN A;  1PXU A;  1EYD A;  3NTK A;  1EY5 A;  4V19 0;  5C4J B;  4K8J A;  3P75 A;  1AN8 A;  3N52 A;  3U9O A;  3TP5 A;  1JE4 A;  4G57 A;  5EQ0 A;  3K59 A;  3SXH A;  1K83 B;  2MJ8 A;  4RGT A;  4RFB A;  2B2T C;  1CA6 A;  4PV1 C;  1EY7 A;  1SNQ A;  1PRT D;  4BA1 I;  3PUZ A;  5C5M A;  3KK7 A;  3VYR A;  1QOH A;  3DUZ A;  2EZV A;  1O80 A;  3J80 E;  1LTR D;  2OEO A;  4RKL A;  4F7X A;  2Z4H A;  5TSS A;  3ONA B;  1SYF A;  5EJW A;  3TN2 A;  1FD7 D;  4G7H C;  1HUN A;  1ENC A;  5IGD A;  1WTV A;  4ULL A;  4IQZ A;  2RKS A;  5CV8 A;  3GV3 A;  2F0Q A;  3WOF A;  1H9J A;  3OOC A;  1STB A;  1RTO A;  4FNF A;  4MIU A;  2C5C A;  1TS5 A;  4JK1 C;  1B44 D;  1VMC A;  2A6E C;  2L0C A;  1TWA B;  1TY0 A;  3QOL A;  2VUM B;  2DN8 A;  3I4M B;  4FXG C;  1HTL D;  1PRT B;  4HED A;  1D5X C;  1VMP A;  5DM7 3;  5E4X A;  3S14 B;  1TR5 A;  2F0W A;  3VR3 A;  1WTQ A;  3CU7 A;  5IT9 L;  2BE5 C;  2WAQ B;  2QEJ C;  2F0G A;  2I46 A;  3I90 A;  2M9V A;  1SNO A;  3HRZ C;  2L5T A;  3R2T A;  3M3Y B;  3PIO 3;  1I4H A;  1LT3 D;  4QUC A;  3SK6 A;  1FNW A;  3D8G A;  2EY6 A;  4EVO A;  1QB5 D;  1BDO A;  3BG3 A;  5AFW A;  2XN9 C;  4KK7 A;  4DK0 A;  2JXM B;  2F4I A;  2Z1C A;  2EVB A;  2HCI A;  4BA2 I;  2K05 A;  3OIQ A;  1SYD A;  3R3O A;  2JP1 A;  3E0J A;  2J7Z A;  5M5X B;  3L9A X;  5IIF A;  3NBI A;  1CM9 A;  5CV6 A;  1BUV T;  2SEB D;  1UAP A;  3MC0 B;  1C48 A;  1Y8N B;  4M1U B;  3BVZ A;  3WDN A;  1SJE D;  3HS0 C;  3J80 L;  4IUT A;  4FF2 A;  3K5L A;  2SOB A;  3PMF A;  2KEC A;  1Q1E A;  3P20 A;  2K04 A;  3D31 A;  1NSN S;  4DXF A;  2NTS A;  2HUG A;  4K14 A;  1EEF D;  2XWJ B;  3NSW A;  1Z7T A;  2B2W C;  4DGZ A;  3HGB A;  3S2H B;  2CHB D;  1JB3 A;  5FO7 B;  1L0Y B;  2ICI A;  3VA7 A;  1DYQ A;  4DN4 M;  3A8I E;  1EY6 A;  2VNU D;  2ENB A;  2XIW A;  1BCP D;  1A6X A;  1TWC B;  1ZYR D;  4RCO A;  2PPB C;  1EZ6 A;  4C2M B;  3QIA A;  5ELD A;  4KTA A;  4LJZ C;  4X3U A;  3D4R A;  1I6H B;  3FPP A;  3BZD B;  2EYP A;  3FRP B;  1MSH A;  1WTX A;  3MXN A;  1D1I A;  3U9S A;  3T13 A;  1ZYR C;  1HTP A;  3X3N A;  4K2L A;  2ZXO A;  5EKL A;  2K5W A;  1NUC A;  2EYH A;  1I6V C;  3M4Y A;  5COY A;  1JOO A;  2M2L A;  4I7Z C;  2E2H B;  1WTR A;  1DD2 A;  3K7A B;  2C9O A;  1QG7 A;  5HUR A;  1Q3L A;  3IFD A;  1LT6 D;  1IYV A;  1IKL A;  2F0D A;  3TP7 A;  1C4Q A;  4AYB B;  4XTC S;  1SYC A;  4QIW B;  1Z6H A;  4U68 A;  2O5J C;  4NDX A;  4H13 C;  4RGO S;  3H94 A;  2B2U C;  1F2M A;  1SE3 A;  1GJX A;  2CW0 D;  3OSO A;  1GXD C;  2D5D A;  1KLG D;  3GP7 A;  1JWU D;  3IAY A;  3RZD B;  5JVG 3;  3L7Z C;  1S5C D;  1DM0 B;  1KNE A;  1RCV D;  4BWG B;  2ZXP A;  4XDX A;  1PTO F;  2JYO A;  1E2V A;  2ICE C;  1ROD A;  2E76 C;  1GUO A;  3NPP A;  5KND A;  4K8I A;  5C6A A;  1SDF A;  5EBC A;  5CV7 A;  1YNN D;  4ZLT F;  5CMD A;  3NQT A;  1PRT C;  5M3M B;  4HMI A;  3TSS A;  1BBX C;  4A3M B;  2KVM A;  5EPJ A;  1I50 B;  1I4R A;  2DNC A;  3NWT A;  2WIN B;  4U67 3;  1IKM A;  1A3U A;  2X69 A;  2CVR A;  4A3J B;  5LL6 S;  5EBD A;  1SMY C;  5IT9 E;  4HCE A;  2NB0 A;  1NR2 A;  3RD4 A;  3S15 B;  1VCI A;  3SR1 A;  4C3J B;  3LX0 A;  4XT1 B;  5FO9 B;  4KJN A;  1RF2 D;  4C1N K;  2PQE A;  3S2D B;  2L11 A;  2EDG A;  3NBH A;  3QB3 A;  5FKA C;  2A6E D;  4IFD I;  2A68 C;  3OMG A;  3VR5 A;  2H4O A;  5BN5 A;  3EQL C;  1HCZ A;  3GD7 A;  3NWS A;  3T16 A;  1HXY D;  2NVX B;  4DA2 A;  2IX1 A;  4C3H B;  1S5E D;  4IUV A;  1X3Q A;  4DXG A;  1SND A;  3EVQ A;  3GO5 A;  3I91 A;  3P1H A;  5FK9 C;  1A2T A;  1PMR A;  4CGY B;  3MVV A;  2F0F A;  2F0U A;  2ID0 A;  5LHY 1;  4FF4 A;  1PTO C;  4FXD A;  2TMP A;  4KN4 C;  3TDQ A;  2A73 B;  4IFD G;  3OMC A;  4HCS A;  4IUQ A;  2QKI C;  2WII B;  4HAE A;  4KY7 A;  3D3R A;  3D6W A;  3UI2 A;  1F2L A;  4M8A A;  5CGK A;  5K5P A;  1JWS D;  5ELE A;  1WVL A;  4K5W A;  1MBY A;  3NK9 A;  1Y1V B;  1QJO A;  2XVS A;  4TQU S;  3RZO B;  4EQN A;  4NP5 A;  4A3D B;  4F88 A;  3SVM A;  2FMC A;  2L4N A;  1STN A;  5M9O A;  1B9M A;  2A69 D;  2RDF A;  2JA8 B;  1CQV A;  1LT5 D;  3I72 A;  2XSC A;  4N9P A;  1PTO B;  3V05 A;  2NWG A;  1VDZ A;  1AEX A;  3C1F A;  4HSP A;  1TWG B;  4ABN A;  3D6C A;  4KD4 A;  3ITP A;  1WD0 A;  1BNZ A;  1H9M A;  3M85 A;  1QCB D;  4ZUI A;  1YNN C;  4DAY A;  2PO4 A;  2RDG A;  2KA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...