1ICFB

Crystal structure of mhc class ii associated p41 ii fragment in complex with cathepsin l
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
42
structure length
42
Chain Sequence
NNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAASYPTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEIN (CATHEPSIN L: HEAVY CHAIN)
publication title Crystal structure of MHC class II-associated p41 Ii fragment bound to cathepsin L reveals the structural basis for differentiation between cathepsins L and S.
pubmed doi rcsb
total genus 3
structure length 42
sequence length 42
chains with identical sequence D
ec nomenclature ec 3.4.22.15: Cathepsin L.
pdb deposition date 1999-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.170 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Cysteine proteinases. Chain C 1icfB00
1ICFB 1MHWC 2DJFC 4OEMB 4CDDC 4OELB 2DJGC 4CDEC 1K3BC 4CDCC 4CDFC
chains in the Genus database with same CATH superfamily
4IPCA 5EKIA 4JI5L 5HGQA 5FLXE 5HY6A 2FXQA 2K5WA 5C4XH 4EX5A 3A55A 3L3OC 5JOBA 1C0AA 2QDLA 1PTOD 2EQSA 2N3SA 4YCWA 1PDQA 4GNXA 3CAMA 2N55A 4C1NI 4XIGS 4RCNA 5IYCG 3RNUA 3HOYG 4IJLA 4JI0L 3K0XA 4UHVA 4FXGC 1KLGD 4DV5L 2ZT9C 1YEZA 1M90C 1VQDA 1S5CD 4GKKL 5IGBA 2E2HH 3HKZG 4DAYB 2YTVA 2OQKA 3P1HA 4CKEA 1F2LA 1CSQA 1NR4A 3TQYA 3S2HH 3HOUB 4BY7G 1TWHH 5EKLA 1D5MC 1JCKB 3AFPA 3IFDA 4DV3L 1SMYD 3OHXC 5K36G 3L7ZC 4TSSA 2PI2E 5KYLA 1STNA 2K5HA 2CH4W 1Q81C 4WORA 4FF1A 1Y1WH 1NE3A 2B8FA 2JA5H 5CV8A 4A3BG 1CTMA 3J81c 2AQ2B 3PF4A 4BY1B 4IURA 4JC0A 3NP8A 5IT9L 1B53A 2K4KA 2L1BA 4YWLA 3M7NA 1V8QA 5EPJA 4A3IG 2B2YC 1B3QA 1B9MA 2XRQD 4O2DA 2PPBC 1XXGA 4AIMA 3IKJA 1A8VA 1SE8A 1NMFA 1JORA 1UEBA 1EZ6A 3NTKA 1C7YA 1FNWA 1JB3A 4JI3Q 4U673 5M3MH 2EPBA 1HNWQ 3KLSA 1SNQA 4B9WA 3OIPA 1PFBA 2I46A 1ML0D 2RVLA 2ALYB 1WJJA 4F87A 5C44H 1M1KC 4HIDA 4HAEA 2JE6I 1Y1VB 2NN6G 1KIXA 5IP9H 5IGFA 4HMJA 4RCOA 4LFCQ 1RL2A 4IO9A 5IYDG 1F2YA 2J0TD 2L15A 1EY5A 4A93G 1TWAH 4DR4Q 2EVBA 2UXDQ 1G2SA 4DUYQ 1ILQA 2JA8B 1WI5A 4KMUC 1X3FA 3I7FA 2LSSA 3JAME 3SK8A 3J81i 2B63B 3PSIA 4OIKA 3GTOB 3W1GA 1EL0A 1H9KA 4NB3A 1NJIC 1VQAA 1TT2A 1HZ9A 1HNZL 3UDXA 5LMUL 1IW7C 4B3RQ 3RUZA 3F2DA 4WJ4A 2SDFA 1EY6A 2IL8A 4QUFA 5IIFA 5C3WA 2Y0SG 2OQ0A 3NPPA 4P73A 4DK6C 3M4PA 2F0FA 2WB1E 1QB5D 5IY0A 4NXML 3KDFA 2Z4HA 2JQOA 3ND8A 1E7ZA 4YCUA 4LJZC 3KF6A 2G9HD 5ELBA 1R9TH 2F4IA 1DJRD 1PHJA 4O1NA 1VCIA 2M00A 1C48A 2L12A 2RCFA 1IBKL 4P75A 1J9OA 3EIVA 1P16A 2JEBI 3IRBA 3MC0B 4HN7A 4GKKQ 3QR8A 2HD3A 4A3EG 4QIWE 5IGCA 3TMEA 1C4QA 1Q3LA 2EY1A 2L0CA 2F0OA 4HJ8A 1D6EC 4DR6L 2QKIC 1KHIA 3DEPA 3TN2A 2LS01 4IUPA 3SR1A 1TKWB 1RF2D 2CVRA 5ELFA 4JBMA 3S1MH 1JE4A 2RKSA 1K8OA 2XWJB 1CK1A 4OGQC 1KNAA 1CI3M 3HOZB 1OXUA 3M4YA 4R4OA 1BKBA 1B8AA 3GP7A 2YU9B 2ICEC 1F9RA 1SNPA 4ILWA 3K59A 3FKIB 4DR3L 1ZYRD 4NP5A 2UUAQ 4A3JB 3HKSA 1EIYB 4R4TA 2OXPA 3LNNA 4LUOA 3I72A 2PMZE 2R7FA 5CMDA 1PH7A 2AWOA 3TBIB 1EY4A 2KCMA 1HUMA 4R8NA 2JA7G 2NN6I 4GOPC 1EY7A 3GTGB 2F0PA 1E0BA 1PTOF 2K05A 2WB1B 2CKZB 4RGTA 2K7VA 2MO1A 3PIOA 3OWFA 1L1OC 2E2IB 5CC4A 1GUWA 1H9JA 3OTOQ 1UE6A 4GKJQ 5JPNC 1EIHA 4G7OC 3QOJA 3CRKC 4IUUA 1DD2A 5GAHC 1SE2A 4J8QA 5ELOA 1HQRD 2WAQE 1KRTA 2ASBA 4TKOB 4OEMB 3NBHA 5GAGC 4WJ3M 2Z9HA 4A3KH 1EEID 2CQAA 4JI1Q 3HOYB 3QIAA 1ASYA 1SNCA 4LF5L 1SEBD 4LF9L 4QIWB 1A0IA 4HIKA 2Q2IA 5I6YA 1XYIA 1IKMA 1S3OA 4N9TA 4TVAB 2MNAA 4ABNA 4UAIA 1X3GA 3WOFA 1PRTD 4AQYQ 3PUYA 2VZAA 4PZ6A 1B1ZA 1I4PA 2R93G 1AFPA 4BY7B 4X64L 1KD1C 3I4MG 4L63B 5C6AA 4BBSH 4ZCKA 1XNRQ 1KL9A 2PMZB 4KK7A 2ZM6L 1Q7YC 1JQYD 2SEBD 1CA5A 2F3WA 1GUSA 2KOLA 3T53B 2YTYA 2O2LD 2Y0SE 1SYCA 4MTKA 4A3BB 3CQZH 2UUBL 1YNND 3GTMB 2NZHA 4ZKBB 1G6PA 1DOKA 2OT2A 4UDUC 2LMCB 2EXZA 5D14A 3A5UA 2R92B 3F2BA 2CWPA 1E1TA 4B3ML 4MIUA 5M5XB 3GD7A 3ER0A 1UUPA 4QCLA 3J81E 4ZAIA 2R7ZB 1HZCA 1FVIA 3D6WA 2WAQB 4TRDA 4C3JG 4UP8A 2R3ZA 4BBRH 1QVCA 4LNQA 4M1UB 5M3FH 4A3IH 1A63A 3NWTA 3MWYW 2NVQH 4Z9CB 4KHZA 1VS0A 2HUGA 2V4DA 4YWMA 5FLXc 4JPBW 3Q22A 3S2DB 2E76C 4A93B 1X3EA 2KUMA 5C4JH 1Q82C 3ULJA 1R4QB 1JR0D 4OX9Q 3I4NG 4I7AA 4PMCA 1TS4A 1AZPA 3A7AB 2KHSA 1K9MC 1PZKD 4QB4A 4L5RC 3RN5A 3A54A 2MO0A 1K83H 3RD4A 4FXKC 1HR0Q 2SNSA 2NVXB 3T1YL 4DV2Q 5LHY1 4POFA 2Y0SB 1JC7A 1GUNA 1B50A 2B2UA 4HTHA 3AB9A 3F1ZA 5EBCA 1WTHA 1W6KA 2OEOA 3EFXD 1I4QA 4JVZA 1BNZA 3PUWA 1M8AA 1STHA 4JI7L 3TRZA 2EYHA 1L2FA 2IX1A 2Z0SA 3SGIA 2NVTH 2F0UA 5IYBH 2JP1A 2ATWA 3T56B 3HOUG 3MFGA 1X3QA 3RZDH 5JEAH 3MTSA 3MAQA 5FK9C 4DK3C 2JA6G 4RH6A 1ENFA 2WIIB 5BN5A 4QGUA 1XX8A 2CWAA 1IKLA 4DR7Q 1VQLA 1I4RA 3M4QA 1B44D 3UE1A 2B2WC 4CDFC 1VQFA 3OMCA 1EYDA 4BY1G 2AHOB 1CM9A 1EIFA 3E9HA 4PZ8A 1V1PA 1XMOL 4A3EH 3Q6SA 5JVG3 1FGBD 1KAAA 4GNXC 1DONA 2RDGA 3VR4A 1RTOA 2ZM6Q 2XTIA 1ENAA 1I6VC 1MD2D 2Z6KA 1EWHA 4LUZA 4IFDJ 5A2QL 1AW7A 3CU7A 3LWEA 4X65L 2PNRC 2XWBB 1EQQA 1TWGH 4KLKA 2OTJA 2QEJC 2JA7B 1CHQD 3S17H 5TSSA 3TS0A 1VQIA 4GNXB 2EY6A 4RAUC 1Y8OB 3E9IA 3J80i 5CYUA 1VQMA 3JAMc 1H95A 1ESFA 1TY2A 2TSSA 1OTCA 3H09A 3KF8A 2O5JC 1YNNC 3J7AV 1EWCA 5C0XJ 1YNJD 1F9PA 1UE1A 2ZXRA 1D2BA 2Q2TA 1BVSA 2JSOA 1Z7TA 4DGZA 3MXPA 2LKVA 1X65A 4IPGA 3FPUB 5HGTA 3CD6A 2Z8LA 1PRTF 3FEWX 1HHVA 1TY0A 2QF7A 3M3YH 3OMGA 4O42A 1SR3A 1N34Q 3KBXA 1EY0A 1XTCD 1EU4A 4EVOA 3U4ZA 3HOWG 5GADC 2BDOA 4OO1G 3CCVA 3DM1A 3GTKH 1J6QA 4DV6L 2F0LA 4X3TA 5GQOA 3UDFA 1NY4A 1J5EL 4GZYC 5E1FA 1J8IA 2R93B 3I90A 4UP7A 4JK1C 1PZJD 3I2ZA 1CKNB 4O0AA 3DMUA 4ZLTF 1JJ2A 4A3FH 1I4XA 4BXXG 1V1QA 1LT4D 3U9OA 1YBYA 1PH9A 3H3VC 1PH3A 3BU2A 1GJXA 1PH8A 1IYJB 4FYDA 4R1JA 4IJHA 2DNEA 3OIQA 4A3GH 2MPMA 3CCRA 2H5XA 1PH6A 1QILA 1EUJA 2TMPA 2F0VA 2RBMA 1KXLA 1JJGA 4B3TQ 4DA2A 1KDAA 1QUQB 2I5HA 5FJ8G 3A8KE 4KY6A 4JI3L 4JI7Q 3PO2G 3S1RB 1HNWL 3S15B 3I4MH 1KNEA 1VQCA 1HCZA 5LL6X 2IT1A 4DNTB 3TP5A 1WOCA 3NENA 2RDHA 1I6HH 3CC7A 4CDEC 3GTLH 4HCEA 4XQNA 1O7ZA 1KTKA 4H7BA 4OHJA 1G6ZA 4LFCL 5I9PA 1KLUD 3CW2C 2UXDL 3FKIG 4DR4L 4DUYL 2E2JH 4A3JG 4UPAA 2JJQA 5BR8L 1A3TA 1U0LA 3NHHA 1K8GA 4ZYSA 1KDBA 1DM0B 2K5QA 3CRLC 2FJ2A 2F0JA 3CF5A 5EJWA 1WTWA 3NQIA 2L4NA 2FFKB 5JVH3 4X62Q 4A3CG 1RDPD 1NR2A 1PYSB 1HRJA 4B3RL 4K0KQ 3OYYA 1YIJA 1E2WA 4P74A 2RF4A 2CCZA 4RGOS 4C3JH 2KCTA 5DLQE 1NSNS 5CV7A 5CGKA 3BVZA 4A3DB 4DPGA 1WCMG 3BDLA 3I4NB 3ITPA 4ULLA 1CT1D 1A3UA 1QNKA 1D7QA 2HIVA 3DUZA 5IGGA 4JV5L 2B8GA 2K32A 4NDXA 4KV6A 3H0GH 4X65Q 5CV6A 3CCLA 1GKHA 4OIJA 4A3MB 1Q8KA 3P20A 3VYSA 2EJGC 4C3IH 3K81C 2VB2X 2HIXA 4LF7Q 1LTAD 3FPPA 1YJ9A 1HH2P 1EQRA 1SE3A 2EYLA 3J7ZC 3RLNA 3N6RA 2RSNA 3BVMA 4OO1I 4UY8C 2EYFA 4BWGB 4KD3A 1C9OA 2EJMA 2IPKD 1TWCB 3I4LA 3DWPA 3PMFA 1RHPA 2ZTDA 3A8IE 4K5WA 4RKBA 2F0HA 1TWHB 3RLOA 5GROA 3K57A 3MVVA 1SMXA 4MNOA 3DXJC 3URYA 4KY5A 2JA6B 3RR5A 4GN5A 1YNJC 1W2BA 5E4XA 5I2YA 3T13A 2WINB 1STYA 3KK7A 2UUAL 1A2UA 4DKAC 2OTLA 1IHZA 1YHQA 1YNXA 1SE4A 2PZTA 4IUVA 4KJOA 1S5DD 4DV6Q 4A76A 1CA6A 3J80E 1J5EQ 5A35A 1K8MA 4BA2I 3PUVA 2D0PA 2R92G 2OCEA 1B2TA 1K73C 3NE5B 2WP8J 4K14A 2EIFA 2UUCQ 4C3HG 3D4DA 2K50A 5I9OA 1GD7A 1YHAA 4WRDA 2R7ZG 1GUTA 2EYJA 1IZ6A 2WAQG 1MBYA 4HCSA 3OTOL 2KCNA 4IQZA 1JICA 1LTLA 4GKJL 4BY1H 1A15A 5FKAC 3PCOB 3DLLA 1JMCA 2SNMA 3KLRA 4JI1L 3CCMA 1K3RA 2JYOA 1GO3E 4APVA 1UWVA 1Y69U 2KQ3A 3BJUA 3R93A 4F7XA 5BR8Q 4EQ5A 1SDFA 3K7UC 4C1NK 2K1BA 2AMCB 5L37A 5C3XA 2HHHQ 1I94L 2VQEQ 1ILPA 1Y1VH 4NPSA 5EBDA 1CUKA 1Q1BA 4G57A 3ERSX 4AQYL 4MTNA 2ZTCA 3B6YA 2YV5A 4R4CA 2PO4A 1JT8A 3MXNA 4JI4Q 3S1QB 1PV4A 5EQ0A 1F2ZA 4DK0A 1TU2B 2JA8H 3AU7A 2UXCL 4JI6Q 4Q5VA 2MHVA 2K6AA 1XNRL 1ICFB 4IN3A 2B63H 3HOWB 3GTOH 1VQBA 5C3EG 3D3RA 1Z9FA 4JV5Q 2A68D 2F0IA 2XN9C 5AFWA 3TDQA 3U4VA 3ND9A 1H9RA 4P72A 3LGJA 4PMWA 1CQFA 1A6XA 4PV1C 2MFIA 2PQAA 4BA1I 1BOSA 3SK5A 2IHFA 2I5MX 1SFOB 1HTPA 1U4MA 2OF1A 1HZAA 4LK1C 2CW0D 3I55A 3W2DA 3H6MA 3CP0A 1PTOC 1G51A 5CV9A 3AMUA 1QZGA 5KGUA 1RIPA 1ICWA 2F3VA 1N8RC 1S5FD 4RA8A 3PO2B 1GXDC 4QL5A 1T5XD 4BXXH 4KHPL 3PIO3 2XGTA 4NKLA 1TS5A 3QOLA 1Z47A 4Q0FA 1TWFB 4KD4A 1KDCA 1CZWA 3W5OA 1D5ZC 5IWAQ 1PTOB 3FMCA 2X6GA 1HZBA 4K2LA 3TS2A 2ICIA 4PNYA 4ZUJA 2X69A 5FJ8H 4DAYA 3EQLC 3NWSA 1EYGA 1GHKA 4PZ7A 1TS3A 4OX9L 2AUKA 1X3PA 2ENBA 3S16B 1STBA 3NELA 5J3BA 3SXHA 3BYTB 3HOZH 1PH1A 3HOVB 1N32L 3VA5A 1VQ7A 2XRSD 5EPLA 3SK6A 1AN8A 1HA5A 1WYDA 2N78A 2Q8IB 1YHBA 3BDOA 1N36Q 2EJFC 1LACA 3BZKA 2YU9H 5DM73 1LO5D 1SMYC 1HR0L 3FKIH 1UE7A 3D31A 3ICEA 1SXTA 2ID0A 5ELNA 4A3JH 4DV2L 4LWCA 2R6GA 1Y8NB 4OXPA 3STBD 4DAMA 2D0OA 2RCNA 1E2VA 3SE0A 1HPCA 1WCMB 2ZJPA 4H0LC 1UAPA 3QJYA 4KKSA 1OXTA 1E22A 2EYMA 3R2IA 4GOPB 1Q90A 3G71A 1H9SA 3GTGH 4A3CH 3OPOA 2WFWA 1GUOA 3AQQA 4AH6A 2DNCA 4Y7NB 2F0MA 1O7LA 3KBGA 2F0SA 3DM3A 3K5OA 3Q23A 4XTCS 1L1OB 2KHJA 2KEEA 1KRSA 3BZCA 5KIXA 1XPOA 4ME3A 2BOSA 1JOKA 2A69D 5C0XG 3RLFA 2F0GA 1KABA 1LTGD 2G5DA 3HZXA 3J7YW 2KVMA 3BVGA 1Q12A 3I73A 2F03A 2KHIA 3S14H 1B4OA 5LL6S 1I94Q 1CSPA 2E74C 5IYCH 3HOYH 4DR7L 3I3CA 4J1MA 4DUZL 3JC66 4X3KA 2Z6KC 1WTOA 4K2KA 5G3LD 3D8GA 1B7YB 3TZDA 4QQBX 3I70A 1EFWA 2UXCQ 3CMAA 4I7ZC 4NW2A 1I3QB 1IL2A 1D5XC 1ET9A 3OW7A 1S40A 3W1BA 5FLMG 1PH5A 2H1EA 1X9NA 2F4VL 2ZXOA 4F88A 2NTTA 3W3AA 2DY7A 2F3IA 4GN4B 4BY7H 4B3SL 2PI2A 4X6AH 4LF4L 1LTID 1LM0A 1STEA 2AKWB 3C2PA 5K36H 4IUTA 4C3HB 3E0JA 3X3MA 1BCPD 1DZ1A 1JWUD 2A68C 1GOZA 3OSOA 3E0EA 3M85A 1SYGA 4A3BH 2EY2A 4CKBA 3KF8B 2A6ED 3GTMH 3NK9A 3K7AB 2L11A 5FLXL 4KHPQ 1D1IA 3DWAA 2R92H 1L0XB 3E3XA 5J22A 5M5WB 3ULLA 1UE5A 3Q24A 2X6LA 3PGZA 5M5XH 4OONA 3SK4A 1K28A 2IY5B 1GUGA 2N88A 1PVOA 1MHWC 2K03A 2XVSA 5E7NA 4OWXB 4IFDI 3K5NA 2CW0C 1DOMA 1N34L 5D3DA 3IAYA 1BQQT 4A3DG 3Q0AA 2I0QA 1YI2A 1EOVA 3HFZB 5JJLA 1STGA 3EBEA 2Q2HA 5IT9E 3I8ZA 1WTVA 4XYOA 5IP7G 1K0RA 3RZOB 2ZJRA 1N32Q 2NN6H 3G48A 1PFNA 4A3MG 5AJ3Q 1HUNA 1TQOA 3VYRA 1FYCA 4R9WA 1JOOA 5IYDH 3S2DH 5C0XI 1PA6A 4A93H 3CC2A 1YJWA 1B70B 3C46A 2GVAA 2A74C 1ZYRC 3BYYB 3EJIA 4RFBA 2F0WA 4XQQA 1B3AA 4QY7A 4JI2L 5KNBA 1IBMQ 2B3GA 5C3EB 2HT1A 2VQFL 3KLWA 4OWTB 1FJGQ 2M2LA 3PIPA 1DYQA 3TP8A 5DM63 1PH4A 1QJOA 5JEAJ 4B3TL 3PUZA 1CHPD 1VF7A 2DJFC 1VQ6A 1M4VA 2DUDA 2NVXH 1XTDA 3MXGA 4RG1A 3EROA 4QMGA 1RKNA 1QVFA 3T1HL 5CORA 2H4OA 1Y14B 1S5BD 3STBC 3EA6A 2V1CC 4A3LG 2VUMB 5CV5A 5COYA 5KNCA 2J4XA 3J80c 1Y8PB 1F2MA 1ZKOA 2BE5D 4DV1Q 2AQ3B 2IW3A 5FO7B 5GAEC 1S72A 2O4XA 1SYDA 1K8AC 3I91A 4DUZQ 3GTPH 3H3VI 2XIWA 3I56A 1NBWA 4DNIA 2EYPA 3GO5A 2E8GA 4X62L 4CJ0B 1VQHA 2MUYA 4K0KL 5ISRA 3CCEA 4K6LA 4PMBA 3EVQA 1LLRD 2A6HD 3S1NB 1PRTC 3PO3B 2HQLA 1BF4A 2F4VQ 3GTJB 2ZTEA 4IUQA 1V43A 4B3SQ 1HFNA 3GTQB 2NYZD 5IE8A 3JAML 3HOXB 4IOAA 3IL8A 4IALA 4LF4Q 4POGA 3M4OB 2CH4A 4XDXA 2CQOA 1N33Q 5H1SE 3OWEB 4EQPA 5E3FA 4LF7L 2PW5A 1PRTB 4JYAQ 2F0QA 1G8ZD 2KA7A 3VYTA 1OXSC 4LF6Q 3CC4A 4JW0A 3KJOA 3R8BA 3KUPA 1CZGA 2JA7H 4EGVA 1PYBA 2EXDA 5T1IA 2BDNA 4CJ2C 2PW7A 4N8FA 2Q8TA 1T9HA 2K5VA 1I5FA 2K52A 5DAUA 4B08A 2HCCA 4NMZA 2C35B 4J6HA 1U4LA 1ENCA 3AYHB 4IUNA 1G291 5BN3A 5G3LF 1QCBD 1E24A 4DV0Q 1AZQA 3G7LA 2A6EC 4RKLA 5C5LA 1SLJA 4OELB 3I4OA 2F52A 4IZ8A 3ONAB 5CBEE 1TR5A 3CXCA 1SYFA 2I07B 4PQXA 4RMFA 2QEXA 5M5YB 3UDGA 2AQ1B 2JN4A 2J7ZA 4MN3A 2UU9Q 3RMHA 1GVPA 3A74A 4YIJA 2LXKA 4HIOA 3MXUA 1EZ8A 1OO9B 2ZXPA 2BH8A 2UUCL 5JJZA 3C1EA 4G7HC 1HNXL 4DV7Q 2BCOA 4HJ7A 4JI2Q 3PF5A 1VQ4A 2VQFQ 1BCPF 4ID6A 2A19A 2JEAI 4R4QA 1NTGA 4C2MB 2CFMA 2R93H 2B2TA 4YHHQ 1HA6A 4CJ1B 2NVYH 1LV9A 4JCVE 3J81j 1PFMA 1W6JA 2AWNA 4NXNQ 4RWSC 3FRPB 1SROA 3T1HQ 1SNOA 5FOBB 1I4HA 1VQEA 1I50B 2YTXA 4UP9A 1VQ9A 1EQTA 1LUZA 4E6IA 2O5IC 2DY8A 2RDFA 5FLMH 5LMNW 1S5ED 4V0BA 2F1MA 4LFAQ 1CFMA 1A3VA 3H94A 1ET6A 3S1RH 2HHHL 3S15H 2CHBD 3H3VH 1PZID 1LT3D 2VXWA 3NTHA 3HOVG 1V9PA 2VQEL 4DF7A 3NTIA 3GDEA 4ODGA 2R7DA 3D6CA 1EQVA 2KEDA 5EPKA 4DV4Q 1QOHA 4LF8L 1D8LA 3A8JE 2WACA 3U50C 2BE5C 1LTSD 2EYOA 4JI4L 4DR5Q 2XNAC 1AH9A 1AP0A 1U4RA 4JI6L 3MZ5A 2PQEA 1A62A 2JA9A 5ELCA 1XJVA 3KDFB 4CBVA 3HG9A 4GLXA 3KFUA 1O80A 3A0JA 1GM5A 3ZJYC 3DEOA 5C4XB 5JAVA 1EU3A 4ZQ3A 3FVQA 1AE3A 2RA4A 3WWVA 3KF6B 1AE2A 4P2CB 4WJWA 1HXYD 1O7IA 4IOCA 2IX3A 1WVLA 3HS0C 4H13C 1FGUA 1ASZA 4A3DH 4DK1A 2A6HC 3I4NH 2MJ8A 2B2WA 5IP7H 3NXWA 1QZHA 3KLSX 3DHQA 1MJCA 2E2HB 1BO0A 3V96A 4DR2Q 2NZ1D 4HIMA 4A3MH 2VL6A 5HURA 1EY9A 4DFAA 3F2CA 1UNSA 1SJED 3HGBA 4IPHA 5J1ZA 1MI2A 4K8JA 4K5XA 3V2TA 3S2HB 4QJFA 3VR6A 5C5MA 1MJEA 1PXUA 4LAAA 5IGEA 5IWAL 4BBSG 4ALPA 3J81L 2K33A 1HFGA 3M7GA 3PQIA 3CPFA 2HCIA 3VR5A 1Y1WB 2JA5B 3A5ZB 1TWCH 1LTTD 4R8IA 1SN8A 3HOUH 1R4PB 2KBNA 2A8VA 4A3LH 2QILA 4XXEA 5IODA 1N36L 1QWYA 3E5SA 2JA6H 4KKTA 2IX0A 4JG2A 1HNXQ 1BBWA 3QO2A 4LFBQ 2LFNA 3L2PA 4HR7B 2ES2A 1VQPA 4R4IA 1K3BC 5C4ZA 1CKNA 1VQJA 4BBRG 5M3MB 1H9SB 1VQNA 4KKUA 3S9WA 2F0DA 4N9PA 5M3FG 1WTXA 3NBHB 2JXMB 5C44B 2EDGA 3PUXA 3TREA 4S3SA 4KN7C 4KN4C 4HMIA 1NAPA 5IT9c 4V190 2RHQB 2UXBL 4GLAC 1ESRA 4EQOA 4X66Q 1TWAB 3ZYYX 1XMQQ 1QUQA 3A7LA 3RN2A 1OXVA 2KJXA 1O7YA 4JBKA 4DXGA 2NUCA 2KENA 3KYHC 2EY5A 2RSOA 1JWSD 4JOIA 3D0FA 5F2DA 1W3SA 1LT5D 3U9SA 1EFID 3K5LA 4LF8Q 2BA0A 1T5EA 3K58A 3BZDB 3UDIA 3C3LA 3M9BA 4GLVB 3F8TA 5A2QE 4BS9A 5FO9B 4KTAA 1BR9A 4L5QA 3VA7A 4M8AA 4YY3Q 1PLFA 2Z6BA 1B9NA 5EGTA 2C5CA 1VQGA 2F0TA 1F9QA 2GN5A 5ELEA 1LYLA 1R9TB 3A56A 4MHEA 3S1QH 4JI8Q 2E5LQ 1XNQQ 1S4ZA 5IYBG 1UEAB 5KRUA 3ULPA 3HOWH 1RTNA 4X3UA 4JI5Q 1GHJA 2VUMG 5JEAG 3V05A 1LTBD 1PMRA 4H44C 3CPWA 4OO1H 4ME5A 2EE1A 4K5VA 2K04A 1L0YB 3EN2A 4RGMA 1VMCA 2B2VA 4ZK9B 2BA1A 1EIGA 4JI0Q 3S1MB 3NSWA 3VYUA 3BS1A 4CGYB 3T16A 4L6TB 1F77A 4DV5Q 3F2UA 4Y52H 1PH2A 2WKDA 1CKOA 1O78A 2FHTA 2WKCA 2Z1CA 1SFOH 5IOCA 1QG7A 2L5TA 1FNVA 1KC8C 1OXXK 1P8LA 3CKIB 3AEVA 1MKHA 4RHRA 3OOCA 3HP3A 4HJAA 4QF4A 3PO2H 3PO3G 4XQJA 1QE6A 4JBJA 4FF4A 3HKZE 2B2UC 1MGSA 1SNDA 1TWFH 1QNUA 1RCVD 3HOXG 1KQSA 5AJ3L 4DV3Q 2BH2A 1YVCA 1PTOH 2K14A 1Q86C 5NUCA 2QDBA 3Q8DA 1IL8A 3SDZA 1DGSA 4IFDG 1VF5C 1H9MA 3NQTA 3S16H 3TEHB 2VY3A 2F0NA 2QA4A 5BN4A 2VS1A 3H91A 4U68A 1IBML 3HOVH 4OL7A 1FJGL 1PFSA 2VW9A 4FVMA 1X55A 4LW1A 4G4KA 1TVXA 3E6ZX 4A3KB 3QG1A 2E2IH 4EQNA 1E3PA 1EYCA 1WCMH 2HQEA 1WTQA 2UXBQ 5IGDA 3CCUA 1VQ5A 2KECA 4YCVA 3CCQA 4DV1L 3TSSA 4PG3A 4Y7NH 5T1GA 5D3IB 2B2YA 5KNDA 3S14B 2P5ZX 2OWOA 1YJNA 2FINB 1SRUA 4DAPA 2PZWA 4N8X1 2C9OA 1EOTA 1BBXC 4AYBG 4A3FG 1ZEQX 3WDNA 1V1PB 2AUJD 2A73B 3FDTA 2G9DA 1JE5A 3J7AF 3L0OA 4BBSB 4CDCC 2K5NA 3HKZB 4A3GG 2N49A 3OW2A 3K6OA 4F8MA 1JWMD 1XPUA 2IJ0A 3P7JA 1HNZQ 1DXMA 2L9HA 3CQZB 5LMUQ 4IPDA 2PZUA 2FMCA 3SEBA 4GN3B 3ERQA 2MQHA 3VDYA 2IHEA 5DNFA 1N33L 2NWGA 2JK8A 1L0WA 1I3QH 1IBLL 2VNUD 4NXMQ 2ZJQA 1EY8A 5CR3A 2E2DC 1VQOA 1RD9D 4JYAL 1F9SA 3KJPA 3T4AC 1YITA 1FD7D 4ZRZA 4LF6L 1WTRA 4XYQA 2MP1A 2XSCA 4DAVA 3VR2A 1WTPA 1QVGA 3WOEA 1G2TA 3TP7A 4BBRB 2KCCA 1WD1A 5M3FB 4FO2A 3BG3A 4C3HH 1IBKQ 4A3IB 1VQKA 4FP5D 1DCZA 1YZ6A 3MA2B 3CCJA 5ELDA 2NVQB 1I4GA 2R7ZH 3T51B 3J7A5 4L5SA 2QW7A 1II3A 4DR6Q 3PIP3 2NTSA 4DV0L 5C4JB 5CV4A 3C1FA 1HJPA 4KHVA 2RQXA 3K7AH 1K0SA 3MEHA 2EZVA 4MZ9A 1ONLA 4XT3B 5M5WH 5C4XG 3H0GG 1SAPA 1HR0W 3LX0A 2UU9L 1IXRA 3K5MA 5EKKA 4C3IG 1BXTA 2B2TC 1K83B 3G4SA 4DR3Q 1SSOA 2FMMA 2YYZA 4XT1B 1EWIA 3D4WA 2Z4IA 3NUCA 1RODA 4RHSA 2M9VA 4DV7L 1JOQA 4DR1L 3RZOH 4CHTB 3LWUA 3TZUA 3UE0A 4HJ9A 1HQMC 2B29A 5I4DA 4YHHL 4GS3A 3X3NA 2I5LX 1RJTA 3J80L 4NXNL 2NVTB 1MSHA 2A5HA 2L55A 3RZDB 5C3EH 1FR3A 3MHBA 1JB7A 2GVBA 2NZOA 4GOPA 5KYIA 4FF3A 2DN8A 1BBUA 2E75C 3SHLA 1SYEA 2NB0A 2Q8RE 4DNRB 4C56C 3GV6A 4FNFA 4LFAL 3IFTA 2DGYA 1Y1WG 2JA5G 2D9UA 3O13A 1L1OA 3FP9A 3GTPB 4LF5Q 3L9AX 4LF9Q 5C4HA 5JJIA 1LABA 2A69C 2VUMH 1SJHD 4DU9A 4TQUS 4DV4L 3DWQA 4A3EB 3CHBD 4FXDA 1CKMA 2QGQA 1KAWA 1HTLD 4AYBE 4DR5L 2F0KA 3GV3A 1C8CA 4KY7A 5LMNL 1STAA 3G6JB 4YWKA 3R3OA 5JPMC 2B39A 3UI2A 1TIID 5M3MG 4X64Q 3VR3A 1TWGB 1XWEA 3S17B 1V1OA 5C44G 4X3SA 5JJKA 1IBLQ 1G91A 1BDOA 4KJNA 5IP9G 2K28A 1MIUA 3S1NH 1U5KA 3PO3H 1E1OA 1MSGA 2D2CC 1IYUA 3GTJH 4I65A 2UUBQ 5D65A 3GTQH 3HOXH 5K5PA 3TP6A 4DR2L 3M4OH 1FL0A 2F0EA 1CQVA 4ZUIA 4H02A 3P75A 4B3MQ 1Y1VG 2RHSB 2HDMA 4IFDH 1BCPC 5J39A 3SVMA 4WFN3 3H15A 3M3YB 4HJ5A 1PYWD 4K8IA 4G7ZC 1EYAA 3S24A 1Q46A 1X54A 1SBBB 3R2TA 5EAYA 2JA8G 3KOJA 4L8JA 4ZKCB 1X56A 3HRZC 1E2ZA 2B63G 1LT6D 1NUCA 3K80C 2LY7A 4HEDA 3HEJA 1BCPB 3GTKB 3K8AA 3NEMA 1Q8IA 4P71A 2R61A 1TS2A 5C0XH 4FDBA 4OWWB 2QCPX 2MGSA 4AYBB 3NBIA 4LMQD 4A3FB 5FO8B 1NNXA 3CCSA 3PV0A 4QUCA 4K6DA 2WV6D 5M5YH 4LFBL 4DR1Q 4A3GB 2D62A 3QWNA 4A4IA 3MEFA 1Z6HA 4RGNA 5E4WC 1BUVT 3N52A 2NVYB 3T1YQ 3JAMi 3I4MB 3D4RA 3MFYA 2A1AA 4CDDC 2K75A 1D1KA 2EOTA 2GA4B 4A75A 4J15A 1I6HB 1Q1EA 1XPRA 3GTLB 5I2XA 3QB3A 4JOIC 4FF2A 3BDCA 2NBFA 2N8NA 2IWHA 4C2MH 1SNMA 4X66L 1XMQL 2E2JB 1DOLA 1WFQA 1EEFD 1FNUA 1NMGA 3G6EA 1TXYA 2DJGC 5CBAE 3HOZG 1I50H 3GQBA 1VMPA 2VB3X 4HSVA 5DEHA 4DXFA 3FHWA 2HDLA 5KEEA 1IW7D 1SYBA 1AEXA 1ZXTA 3K0YA 2LXJA 1U4PA 4JBWA 4L5TA 3MXNB 1VDZA 5M9OA 2SOBA 4C3JB 1U9RA 1N9WA 3AFQA 3U58A 4KI0A 4YY3L 2D5DA 4DN4M 5LMNQ 5I6WA 2PNHA 2K5DA 1X6OA 1LTRD 4CKCA 1VQ8A 1A2TA 2PYKA 2Q2UA 3H0GB 3CMEA 1WD0A 1X32A 2PCFB 4C3IB 2WB1G 1XMOQ 4A3KG 4JI8L 2B2VC 4LUVA 2E5LL 4HSPA 1IYVA 1XNQL 1NCVA 2PQAB 4B9XA 2K01A 1JJCB
chains in the Genus database with same CATH topology
1ICFB 1MHWC 2DJFC 4OEMB 4CDDC 4OELB 2DJGC 4CDEC 1K3BC 4CDCC 4CDFC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ICF B;  1MHW C;  2DJF C;  4OEM B;  4CDD C;  4OEL B;  2DJG C;  4CDE C;  1K3B C;  4CDC C;  4CDF C; 
#chains in the Genus database with same CATH topology
 4IPC A;  5EKI A;  4JI5 L;  5HGQ A;  5FLX E;  5HY6 A;  2FXQ A;  2K5W A;  5C4X H;  4EX5 A;  3A55 A;  3L3O C;  5JOB A;  1C0A A;  2QDL A;  1PTO D;  2EQS A;  2N3S A;  4YCW A;  1PDQ A;  4GNX A;  3CAM A;  2N55 A;  4C1N I;  4XIG S;  4RCN A;  5IYC G;  3RNU A;  3HOY G;  4IJL A;  4JI0 L;  3K0X A;  4UHV A;  4FXG C;  1KLG D;  4DV5 L;  2ZT9 C;  1YEZ A;  1M90 C;  1VQD A;  1S5C D;  4GKK L;  5IGB A;  2E2H H;  3HKZ G;  4DAY B;  2YTV A;  2OQK A;  3P1H A;  4CKE A;  1F2L A;  1CSQ A;  1NR4 A;  3TQY A;  3S2H H;  3HOU B;  4BY7 G;  1TWH H;  5EKL A;  1D5M C;  1JCK B;  3AFP A;  3IFD A;  4DV3 L;  1SMY D;  3OHX C;  5K36 G;  3L7Z C;  4TSS A;  2PI2 E;  5KYL A;  1STN A;  2K5H A;  2CH4 W;  1Q81 C;  4WOR A;  4FF1 A;  1Y1W H;  1NE3 A;  2B8F A;  2JA5 H;  5CV8 A;  4A3B G;  1CTM A;  3J81 c;  2AQ2 B;  3PF4 A;  4BY1 B;  4IUR A;  4JC0 A;  3NP8 A;  5IT9 L;  1B53 A;  2K4K A;  2L1B A;  4YWL A;  3M7N A;  1V8Q A;  5EPJ A;  4A3I G;  2B2Y C;  1B3Q A;  1B9M A;  2XRQ D;  4O2D A;  2PPB C;  1XXG A;  4AIM A;  3IKJ A;  1A8V A;  1SE8 A;  1NMF A;  1JOR A;  1UEB A;  1EZ6 A;  3NTK A;  1C7Y A;  1FNW A;  1JB3 A;  4JI3 Q;  4U67 3;  5M3M H;  2EPB A;  1HNW Q;  3KLS A;  1SNQ A;  4B9W A;  3OIP A;  1PFB A;  2I46 A;  1ML0 D;  2RVL A;  2ALY B;  1WJJ A;  4F87 A;  5C44 H;  1M1K C;  4HID A;  4HAE A;  2JE6 I;  1Y1V B;  2NN6 G;  1KIX A;  5IP9 H;  5IGF A;  4HMJ A;  4RCO A;  4LFC Q;  1RL2 A;  4IO9 A;  5IYD G;  1F2Y A;  2J0T D;  2L15 A;  1EY5 A;  4A93 G;  1TWA H;  4DR4 Q;  2EVB A;  2UXD Q;  1G2S A;  4DUY Q;  1ILQ A;  2JA8 B;  1WI5 A;  4KMU C;  1X3F A;  3I7F A;  2LSS A;  3JAM E;  3SK8 A;  3J81 i;  2B63 B;  3PSI A;  4OIK A;  3GTO B;  3W1G A;  1EL0 A;  1H9K A;  4NB3 A;  1NJI C;  1VQA A;  1TT2 A;  1HZ9 A;  1HNZ L;  3UDX A;  5LMU L;  1IW7 C;  4B3R Q;  3RUZ A;  3F2D A;  4WJ4 A;  2SDF A;  1EY6 A;  2IL8 A;  4QUF A;  5IIF A;  5C3W A;  2Y0S G;  2OQ0 A;  3NPP A;  4P73 A;  4DK6 C;  3M4P A;  2F0F A;  2WB1 E;  1QB5 D;  5IY0 A;  4NXM L;  3KDF A;  2Z4H A;  2JQO A;  3ND8 A;  1E7Z A;  4YCU A;  4LJZ C;  3KF6 A;  2G9H D;  5ELB A;  1R9T H;  2F4I A;  1DJR D;  1PHJ A;  4O1N A;  1VCI A;  2M00 A;  1C48 A;  2L12 A;  2RCF A;  1IBK L;  4P75 A;  1J9O A;  3EIV A;  1P16 A;  2JEB I;  3IRB A;  3MC0 B;  4HN7 A;  4GKK Q;  3QR8 A;  2HD3 A;  4A3E G;  4QIW E;  5IGC A;  3TME A;  1C4Q A;  1Q3L A;  2EY1 A;  2L0C A;  2F0O A;  4HJ8 A;  1D6E C;  4DR6 L;  2QKI C;  1KHI A;  3DEP A;  3TN2 A;  2LS0 1;  4IUP A;  3SR1 A;  1TKW B;  1RF2 D;  2CVR A;  5ELF A;  4JBM A;  3S1M H;  1JE4 A;  2RKS A;  1K8O A;  2XWJ B;  1CK1 A;  4OGQ C;  1KNA A;  1CI3 M;  3HOZ B;  1OXU A;  3M4Y A;  4R4O A;  1BKB A;  1B8A A;  3GP7 A;  2YU9 B;  2ICE C;  1F9R A;  1SNP A;  4ILW A;  3K59 A;  3FKI B;  4DR3 L;  1ZYR D;  4NP5 A;  2UUA Q;  4A3J B;  3HKS A;  1EIY B;  4R4T A;  2OXP A;  3LNN A;  4LUO A;  3I72 A;  2PMZ E;  2R7F A;  5CMD A;  1PH7 A;  2AWO A;  3TBI B;  1EY4 A;  2KCM A;  1HUM A;  4R8N A;  2JA7 G;  2NN6 I;  4GOP C;  1EY7 A;  3GTG B;  2F0P A;  1E0B A;  1PTO F;  2K05 A;  2WB1 B;  2CKZ B;  4RGT A;  2K7V A;  2MO1 A;  3PIO A;  3OWF A;  1L1O C;  2E2I B;  5CC4 A;  1GUW A;  1H9J A;  3OTO Q;  1UE6 A;  4GKJ Q;  5JPN C;  1EIH A;  4G7O C;  3QOJ A;  3CRK C;  4IUU A;  1DD2 A;  5GAH C;  1SE2 A;  4J8Q A;  5ELO A;  1HQR D;  2WAQ E;  1KRT A;  2ASB A;  4TKO B;  4OEM B;  3NBH A;  5GAG C;  4WJ3 M;  2Z9H A;  4A3K H;  1EEI D;  2CQA A;  4JI1 Q;  3HOY B;  3QIA A;  1ASY A;  1SNC A;  4LF5 L;  1SEB D;  4LF9 L;  4QIW B;  1A0I A;  4HIK A;  2Q2I A;  5I6Y A;  1XYI A;  1IKM A;  1S3O A;  4N9T A;  4TVA B;  2MNA A;  4ABN A;  4UAI A;  1X3G A;  3WOF A;  1PRT D;  4AQY Q;  3PUY A;  2VZA A;  4PZ6 A;  1B1Z A;  1I4P A;  2R93 G;  1AFP A;  4BY7 B;  4X64 L;  1KD1 C;  3I4M G;  4L63 B;  5C6A A;  4BBS H;  4ZCK A;  1XNR Q;  1KL9 A;  2PMZ B;  4KK7 A;  2ZM6 L;  1Q7Y C;  1JQY D;  2SEB D;  1CA5 A;  2F3W A;  1GUS A;  2KOL A;  3T53 B;  2YTY A;  2O2L D;  2Y0S E;  1SYC A;  4MTK A;  4A3B B;  3CQZ H;  2UUB L;  1YNN D;  3GTM B;  2NZH A;  4ZKB B;  1G6P A;  1DOK A;  2OT2 A;  4UDU C;  2LMC B;  2EXZ A;  5D14 A;  3A5U A;  2R92 B;  3F2B A;  2CWP A;  1E1T A;  4B3M L;  4MIU A;  5M5X B;  3GD7 A;  3ER0 A;  1UUP A;  4QCL A;  3J81 E;  4ZAI A;  2R7Z B;  1HZC A;  1FVI A;  3D6W A;  2WAQ B;  4TRD A;  4C3J G;  4UP8 A;  2R3Z A;  4BBR H;  1QVC A;  4LNQ A;  4M1U B;  5M3F H;  4A3I H;  1A63 A;  3NWT A;  3MWY W;  2NVQ H;  4Z9C B;  4KHZ A;  1VS0 A;  2HUG A;  2V4D A;  4YWM A;  5FLX c;  4JPB W;  3Q22 A;  3S2D B;  2E76 C;  4A93 B;  1X3E A;  2KUM A;  5C4J H;  1Q82 C;  3ULJ A;  1R4Q B;  1JR0 D;  4OX9 Q;  3I4N G;  4I7A A;  4PMC A;  1TS4 A;  1AZP A;  3A7A B;  2KHS A;  1K9M C;  1PZK D;  4QB4 A;  4L5R C;  3RN5 A;  3A54 A;  2MO0 A;  1K83 H;  3RD4 A;  4FXK C;  1HR0 Q;  2SNS A;  2NVX B;  3T1Y L;  4DV2 Q;  5LHY 1;  4POF A;  2Y0S B;  1JC7 A;  1GUN A;  1B50 A;  2B2U A;  4HTH A;  3AB9 A;  3F1Z A;  5EBC A;  1WTH A;  1W6K A;  2OEO A;  3EFX D;  1I4Q A;  4JVZ A;  1BNZ A;  3PUW A;  1M8A A;  1STH A;  4JI7 L;  3TRZ A;  2EYH A;  1L2F A;  2IX1 A;  2Z0S A;  3SGI A;  2NVT H;  2F0U A;  5IYB H;  2JP1 A;  2ATW A;  3T56 B;  3HOU G;  3MFG A;  1X3Q A;  3RZD H;  5JEA H;  3MTS A;  3MAQ A;  5FK9 C;  4DK3 C;  2JA6 G;  4RH6 A;  1ENF A;  2WII B;  5BN5 A;  4QGU A;  1XX8 A;  2CWA A;  1IKL A;  4DR7 Q;  1VQL A;  1I4R A;  3M4Q A;  1B44 D;  3UE1 A;  2B2W C;  4CDF C;  1VQF A;  3OMC A;  1EYD A;  4BY1 G;  2AHO B;  1CM9 A;  1EIF A;  3E9H A;  4PZ8 A;  1V1P A;  1XMO L;  4A3E H;  3Q6S A;  5JVG 3;  1FGB D;  1KAA A;  4GNX C;  1DON A;  2RDG A;  3VR4 A;  1RTO A;  2ZM6 Q;  2XTI A;  1ENA A;  1I6V C;  1MD2 D;  2Z6K A;  1EWH A;  4LUZ A;  4IFD J;  5A2Q L;  1AW7 A;  3CU7 A;  3LWE A;  4X65 L;  2PNR C;  2XWB B;  1EQQ A;  1TWG H;  4KLK A;  2OTJ A;  2QEJ C;  2JA7 B;  1CHQ D;  3S17 H;  5TSS A;  3TS0 A;  1VQI A;  4GNX B;  2EY6 A;  4RAU C;  1Y8O B;  3E9I A;  3J80 i;  5CYU A;  1VQM A;  3JAM c;  1H95 A;  1ESF A;  1TY2 A;  2TSS A;  1OTC A;  3H09 A;  3KF8 A;  2O5J C;  1YNN C;  3J7A V;  1EWC A;  5C0X J;  1YNJ D;  1F9P A;  1UE1 A;  2ZXR A;  1D2B A;  2Q2T A;  1BVS A;  2JSO A;  1Z7T A;  4DGZ A;  3MXP A;  2LKV A;  1X65 A;  4IPG A;  3FPU B;  5HGT A;  3CD6 A;  2Z8L A;  1PRT F;  3FEW X;  1HHV A;  1TY0 A;  2QF7 A;  3M3Y H;  3OMG A;  4O42 A;  1SR3 A;  1N34 Q;  3KBX A;  1EY0 A;  1XTC D;  1EU4 A;  4EVO A;  3U4Z A;  3HOW G;  5GAD C;  2BDO A;  4OO1 G;  3CCV A;  3DM1 A;  3GTK H;  1J6Q A;  4DV6 L;  2F0L A;  4X3T A;  5GQO A;  3UDF A;  1NY4 A;  1J5E L;  4GZY C;  5E1F A;  1J8I A;  2R93 B;  3I90 A;  4UP7 A;  4JK1 C;  1PZJ D;  3I2Z A;  1CKN B;  4O0A A;  3DMU A;  4ZLT F;  1JJ2 A;  4A3F H;  1I4X A;  4BXX G;  1V1Q A;  1LT4 D;  3U9O A;  1YBY A;  1PH9 A;  3H3V C;  1PH3 A;  3BU2 A;  1GJX A;  1PH8 A;  1IYJ B;  4FYD A;  4R1J A;  4IJH A;  2DNE A;  3OIQ A;  4A3G H;  2MPM A;  3CCR A;  2H5X A;  1PH6 A;  1QIL A;  1EUJ A;  2TMP A;  2F0V A;  2RBM A;  1KXL A;  1JJG A;  4B3T Q;  4DA2 A;  1KDA A;  1QUQ B;  2I5H A;  5FJ8 G;  3A8K E;  4KY6 A;  4JI3 L;  4JI7 Q;  3PO2 G;  3S1R B;  1HNW L;  3S15 B;  3I4M H;  1KNE A;  1VQC A;  1HCZ A;  5LL6 X;  2IT1 A;  4DNT B;  3TP5 A;  1WOC A;  3NEN A;  2RDH A;  1I6H H;  3CC7 A;  4CDE C;  3GTL H;  4HCE A;  4XQN A;  1O7Z A;  1KTK A;  4H7B A;  4OHJ A;  1G6Z A;  4LFC L;  5I9P A;  1KLU D;  3CW2 C;  2UXD L;  3FKI G;  4DR4 L;  4DUY L;  2E2J H;  4A3J G;  4UPA A;  2JJQ A;  5BR8 L;  1A3T A;  1U0L A;  3NHH A;  1K8G A;  4ZYS A;  1KDB A;  1DM0 B;  2K5Q A;  3CRL C;  2FJ2 A;  2F0J A;  3CF5 A;  5EJW A;  1WTW A;  3NQI A;  2L4N A;  2FFK B;  5JVH 3;  4X62 Q;  4A3C G;  1RDP D;  1NR2 A;  1PYS B;  1HRJ A;  4B3R L;  4K0K Q;  3OYY A;  1YIJ A;  1E2W A;  4P74 A;  2RF4 A;  2CCZ A;  4RGO S;  4C3J H;  2KCT A;  5DLQ E;  1NSN S;  5CV7 A;  5CGK A;  3BVZ A;  4A3D B;  4DPG A;  1WCM G;  3BDL A;  3I4N B;  3ITP A;  4ULL A;  1CT1 D;  1A3U A;  1QNK A;  1D7Q A;  2HIV A;  3DUZ A;  5IGG A;  4JV5 L;  2B8G A;  2K32 A;  4NDX A;  4KV6 A;  3H0G H;  4X65 Q;  5CV6 A;  3CCL A;  1GKH A;  4OIJ A;  4A3M B;  1Q8K A;  3P20 A;  3VYS A;  2EJG C;  4C3I H;  3K81 C;  2VB2 X;  2HIX A;  4LF7 Q;  1LTA D;  3FPP A;  1YJ9 A;  1HH2 P;  1EQR A;  1SE3 A;  2EYL A;  3J7Z C;  3RLN A;  3N6R A;  2RSN A;  3BVM A;  4OO1 I;  4UY8 C;  2EYF A;  4BWG B;  4KD3 A;  1C9O A;  2EJM A;  2IPK D;  1TWC B;  3I4L A;  3DWP A;  3PMF A;  1RHP A;  2ZTD A;  3A8I E;  4K5W A;  4RKB A;  2F0H A;  1TWH B;  3RLO A;  5GRO A;  3K57 A;  3MVV A;  1SMX A;  4MNO A;  3DXJ C;  3URY A;  4KY5 A;  2JA6 B;  3RR5 A;  4GN5 A;  1YNJ C;  1W2B A;  5E4X A;  5I2Y A;  3T13 A;  2WIN B;  1STY A;  3KK7 A;  2UUA L;  1A2U A;  4DKA C;  2OTL A;  1IHZ A;  1YHQ A;  1YNX A;  1SE4 A;  2PZT A;  4IUV A;  4KJO A;  1S5D D;  4DV6 Q;  4A76 A;  1CA6 A;  3J80 E;  1J5E Q;  5A35 A;  1K8M A;  4BA2 I;  3PUV A;  2D0P A;  2R92 G;  2OCE A;  1B2T A;  1K73 C;  3NE5 B;  2WP8 J;  4K14 A;  2EIF A;  2UUC Q;  4C3H G;  3D4D A;  2K50 A;  5I9O A;  1GD7 A;  1YHA A;  4WRD A;  2R7Z G;  1GUT A;  2EYJ A;  1IZ6 A;  2WAQ G;  1MBY A;  4HCS A;  3OTO L;  2KCN A;  4IQZ A;  1JIC A;  1LTL A;  4GKJ L;  4BY1 H;  1A15 A;  5FKA C;  3PCO B;  3DLL A;  1JMC A;  2SNM A;  3KLR A;  4JI1 L;  3CCM A;  1K3R A;  2JYO A;  1GO3 E;  4APV A;  1UWV A;  1Y69 U;  2KQ3 A;  3BJU A;  3R93 A;  4F7X A;  5BR8 Q;  4EQ5 A;  1SDF A;  3K7U C;  4C1N K;  2K1B A;  2AMC B;  5L37 A;  5C3X A;  2HHH Q;  1I94 L;  2VQE Q;  1ILP A;  1Y1V H;  4NPS A;  5EBD A;  1CUK A;  1Q1B A;  4G57 A;  3ERS X;  4AQY L;  4MTN A;  2ZTC A;  3B6Y A;  2YV5 A;  4R4C A;  2PO4 A;  1JT8 A;  3MXN A;  4JI4 Q;  3S1Q B;  1PV4 A;  5EQ0 A;  1F2Z A;  4DK0 A;  1TU2 B;  2JA8 H;  3AU7 A;  2UXC L;  4JI6 Q;  4Q5V A;  2MHV A;  2K6A A;  1XNR L;  1ICF B;  4IN3 A;  2B63 H;  3HOW B;  3GTO H;  1VQB A;  5C3E G;  3D3R A;  1Z9F A;  4JV5 Q;  2A68 D;  2F0I A;  2XN9 C;  5AFW A;  3TDQ A;  3U4V A;  3ND9 A;  1H9R A;  4P72 A;  3LGJ A;  4PMW A;  1CQF A;  1A6X A;  4PV1 C;  2MFI A;  2PQA A;  4BA1 I;  1BOS A;  3SK5 A;  2IHF A;  2I5M X;  1SFO B;  1HTP A;  1U4M A;  2OF1 A;  1HZA A;  4LK1 C;  2CW0 D;  3I55 A;  3W2D A;  3H6M A;  3CP0 A;  1PTO C;  1G51 A;  5CV9 A;  3AMU A;  1QZG A;  5KGU A;  1RIP A;  1ICW A;  2F3V A;  1N8R C;  1S5F D;  4RA8 A;  3PO2 B;  1GXD C;  4QL5 A;  1T5X D;  4BXX H;  4KHP L;  3PIO 3;  2XGT A;  4NKL A;  1TS5 A;  3QOL A;  1Z47 A;  4Q0F A;  1TWF B;  4KD4 A;  1KDC A;  1CZW A;  3W5O A;  1D5Z C;  5IWA Q;  1PTO B;  3FMC A;  2X6G A;  1HZB A;  4K2L A;  3TS2 A;  2ICI A;  4PNY A;  4ZUJ A;  2X69 A;  5FJ8 H;  4DAY A;  3EQL C;  3NWS A;  1EYG A;  1GHK A;  4PZ7 A;  1TS3 A;  4OX9 L;  2AUK A;  1X3P A;  2ENB A;  3S16 B;  1STB A;  3NEL A;  5J3B A;  3SXH A;  3BYT B;  3HOZ H;  1PH1 A;  3HOV B;  1N32 L;  3VA5 A;  1VQ7 A;  2XRS D;  5EPL A;  3SK6 A;  1AN8 A;  1HA5 A;  1WYD A;  2N78 A;  2Q8I B;  1YHB A;  3BDO A;  1N36 Q;  2EJF C;  1LAC A;  3BZK A;  2YU9 H;  5DM7 3;  1LO5 D;  1SMY C;  1HR0 L;  3FKI H;  1UE7 A;  3D31 A;  3ICE A;  1SXT A;  2ID0 A;  5ELN A;  4A3J H;  4DV2 L;  4LWC A;  2R6G A;  1Y8N B;  4OXP A;  3STB D;  4DAM A;  2D0O A;  2RCN A;  1E2V A;  3SE0 A;  1HPC A;  1WCM B;  2ZJP A;  4H0L C;  1UAP A;  3QJY A;  4KKS A;  1OXT A;  1E22 A;  2EYM A;  3R2I A;  4GOP B;  1Q90 A;  3G71 A;  1H9S A;  3GTG H;  4A3C H;  3OPO A;  2WFW A;  1GUO A;  3AQQ A;  4AH6 A;  2DNC A;  4Y7N B;  2F0M A;  1O7L A;  3KBG A;  2F0S A;  3DM3 A;  3K5O A;  3Q23 A;  4XTC S;  1L1O B;  2KHJ A;  2KEE A;  1KRS A;  3BZC A;  5KIX A;  1XPO A;  4ME3 A;  2BOS A;  1JOK A;  2A69 D;  5C0X G;  3RLF A;  2F0G A;  1KAB A;  1LTG D;  2G5D A;  3HZX A;  3J7Y W;  2KVM A;  3BVG A;  1Q12 A;  3I73 A;  2F03 A;  2KHI A;  3S14 H;  1B4O A;  5LL6 S;  1I94 Q;  1CSP A;  2E74 C;  5IYC H;  3HOY H;  4DR7 L;  3I3C A;  4J1M A;  4DUZ L;  3JC6 6;  4X3K A;  2Z6K C;  1WTO A;  4K2K A;  5G3L D;  3D8G A;  1B7Y B;  3TZD A;  4QQB X;  3I70 A;  1EFW A;  2UXC Q;  3CMA A;  4I7Z C;  4NW2 A;  1I3Q B;  1IL2 A;  1D5X C;  1ET9 A;  3OW7 A;  1S40 A;  3W1B A;  5FLM G;  1PH5 A;  2H1E A;  1X9N A;  2F4V L;  2ZXO A;  4F88 A;  2NTT A;  3W3A A;  2DY7 A;  2F3I A;  4GN4 B;  4BY7 H;  4B3S L;  2PI2 A;  4X6A H;  4LF4 L;  1LTI D;  1LM0 A;  1STE A;  2AKW B;  3C2P A;  5K36 H;  4IUT A;  4C3H B;  3E0J A;  3X3M A;  1BCP D;  1DZ1 A;  1JWU D;  2A68 C;  1GOZ A;  3OSO A;  3E0E A;  3M85 A;  1SYG A;  4A3B H;  2EY2 A;  4CKB A;  3KF8 B;  2A6E D;  3GTM H;  3NK9 A;  3K7A B;  2L11 A;  5FLX L;  4KHP Q;  1D1I A;  3DWA A;  2R92 H;  1L0X B;  3E3X A;  5J22 A;  5M5W B;  3ULL A;  1UE5 A;  3Q24 A;  2X6L A;  3PGZ A;  5M5X H;  4OON A;  3SK4 A;  1K28 A;  2IY5 B;  1GUG A;  2N88 A;  1PVO A;  1MHW C;  2K03 A;  2XVS A;  5E7N A;  4OWX B;  4IFD I;  3K5N A;  2CW0 C;  1DOM A;  1N34 L;  5D3D A;  3IAY A;  1BQQ T;  4A3D G;  3Q0A A;  2I0Q A;  1YI2 A;  1EOV A;  3HFZ B;  5JJL A;  1STG A;  3EBE A;  2Q2H A;  5IT9 E;  3I8Z A;  1WTV A;  4XYO A;  5IP7 G;  1K0R A;  3RZO B;  2ZJR A;  1N32 Q;  2NN6 H;  3G48 A;  1PFN A;  4A3M G;  5AJ3 Q;  1HUN A;  1TQO A;  3VYR A;  1FYC A;  4R9W A;  1JOO A;  5IYD H;  3S2D H;  5C0X I;  1PA6 A;  4A93 H;  3CC2 A;  1YJW A;  1B70 B;  3C46 A;  2GVA A;  2A74 C;  1ZYR C;  3BYY B;  3EJI A;  4RFB A;  2F0W A;  4XQQ A;  1B3A A;  4QY7 A;  4JI2 L;  5KNB A;  1IBM Q;  2B3G A;  5C3E B;  2HT1 A;  2VQF L;  3KLW A;  4OWT B;  1FJG Q;  2M2L A;  3PIP A;  1DYQ A;  3TP8 A;  5DM6 3;  1PH4 A;  1QJO A;  5JEA J;  4B3T L;  3PUZ A;  1CHP D;  1VF7 A;  2DJF C;  1VQ6 A;  1M4V A;  2DUD A;  2NVX H;  1XTD A;  3MXG A;  4RG1 A;  3ERO A;  4QMG A;  1RKN A;  1QVF A;  3T1H L;  5COR A;  2H4O A;  1Y14 B;  1S5B D;  3STB C;  3EA6 A;  2V1C C;  4A3L G;  2VUM B;  5CV5 A;  5COY A;  5KNC A;  2J4X A;  3J80 c;  1Y8P B;  1F2M A;  1ZKO A;  2BE5 D;  4DV1 Q;  2AQ3 B;  2IW3 A;  5FO7 B;  5GAE C;  1S72 A;  2O4X A;  1SYD A;  1K8A C;  3I91 A;  4DUZ Q;  3GTP H;  3H3V I;  2XIW A;  3I56 A;  1NBW A;  4DNI A;  2EYP A;  3GO5 A;  2E8G A;  4X62 L;  4CJ0 B;  1VQH A;  2MUY A;  4K0K L;  5ISR A;  3CCE A;  4K6L A;  4PMB A;  3EVQ A;  1LLR D;  2A6H D;  3S1N B;  1PRT C;  3PO3 B;  2HQL A;  1BF4 A;  2F4V Q;  3GTJ B;  2ZTE A;  4IUQ A;  1V43 A;  4B3S Q;  1HFN A;  3GTQ B;  2NYZ D;  5IE8 A;  3JAM L;  3HOX B;  4IOA A;  3IL8 A;  4IAL A;  4LF4 Q;  4POG A;  3M4O B;  2CH4 A;  4XDX A;  2CQO A;  1N33 Q;  5H1S E;  3OWE B;  4EQP A;  5E3F A;  4LF7 L;  2PW5 A;  1PRT B;  4JYA Q;  2F0Q A;  1G8Z D;  2KA7 A;  3VYT A;  1OXS C;  4LF6 Q;  3CC4 A;  4JW0 A;  3KJO A;  3R8B A;  3KUP A;  1CZG A;  2JA7 H;  4EGV A;  1PYB A;  2EXD A;  5T1I A;  2BDN A;  4CJ2 C;  2PW7 A;  4N8F A;  2Q8T A;  1T9H A;  2K5V A;  1I5F A;  2K52 A;  5DAU A;  4B08 A;  2HCC A;  4NMZ A;  2C35 B;  4J6H A;  1U4L A;  1ENC A;  3AYH B;  4IUN A;  1G29 1;  5BN3 A;  5G3L F;  1QCB D;  1E24 A;  4DV0 Q;  1AZQ A;  3G7L A;  2A6E C;  4RKL A;  5C5L A;  1SLJ A;  4OEL B;  3I4O A;  2F52 A;  4IZ8 A;  3ONA B;  5CBE E;  1TR5 A;  3CXC A;  1SYF A;  2I07 B;  4PQX A;  4RMF A;  2QEX A;  5M5Y B;  3UDG A;  2AQ1 B;  2JN4 A;  2J7Z A;  4MN3 A;  2UU9 Q;  3RMH A;  1GVP A;  3A74 A;  4YIJ A;  2LXK A;  4HIO A;  3MXU A;  1EZ8 A;  1OO9 B;  2ZXP A;  2BH8 A;  2UUC L;  5JJZ A;  3C1E A;  4G7H C;  1HNX L;  4DV7 Q;  2BCO A;  4HJ7 A;  4JI2 Q;  3PF5 A;  1VQ4 A;  2VQF Q;  1BCP F;  4ID6 A;  2A19 A;  2JEA I;  4R4Q A;  1NTG A;  4C2M B;  2CFM A;  2R93 H;  2B2T A;  4YHH Q;  1HA6 A;  4CJ1 B;  2NVY H;  1LV9 A;  4JCV E;  3J81 j;  1PFM A;  1W6J A;  2AWN A;  4NXN Q;  4RWS C;  3FRP B;  1SRO A;  3T1H Q;  1SNO A;  5FOB B;  1I4H A;  1VQE A;  1I50 B;  2YTX A;  4UP9 A;  1VQ9 A;  1EQT A;  1LUZ A;  4E6I A;  2O5I C;  2DY8 A;  2RDF A;  5FLM H;  5LMN W;  1S5E D;  4V0B A;  2F1M A;  4LFA Q;  1CFM A;  1A3V A;  3H94 A;  1ET6 A;  3S1R H;  2HHH L;  3S15 H;  2CHB D;  3H3V H;  1PZI D;  1LT3 D;  2VXW A;  3NTH A;  3HOV G;  1V9P A;  2VQE L;  4DF7 A;  3NTI A;  3GDE A;  4ODG A;  2R7D A;  3D6C A;  1EQV A;  2KED A;  5EPK A;  4DV4 Q;  1QOH A;  4LF8 L;  1D8L A;  3A8J E;  2WAC A;  3U50 C;  2BE5 C;  1LTS D;  2EYO A;  4JI4 L;  4DR5 Q;  2XNA C;  1AH9 A;  1AP0 A;  1U4R A;  4JI6 L;  3MZ5 A;  2PQE A;  1A62 A;  2JA9 A;  5ELC A;  1XJV A;  3KDF B;  4CBV A;  3HG9 A;  4GLX A;  3KFU A;  1O80 A;  3A0J A;  1GM5 A;  3ZJY C;  3DEO A;  5C4X B;  5JAV A;  1EU3 A;  4ZQ3 A;  3FVQ A;  1AE3 A;  2RA4 A;  3WWV A;  3KF6 B;  1AE2 A;  4P2C B;  4WJW A;  1HXY D;  1O7I A;  4IOC A;  2IX3 A;  1WVL A;  3HS0 C;  4H13 C;  1FGU A;  1ASZ A;  4A3D H;  4DK1 A;  2A6H C;  3I4N H;  2MJ8 A;  2B2W A;  5IP7 H;  3NXW A;  1QZH A;  3KLS X;  3DHQ A;  1MJC A;  2E2H B;  1BO0 A;  3V96 A;  4DR2 Q;  2NZ1 D;  4HIM A;  4A3M H;  2VL6 A;  5HUR A;  1EY9 A;  4DFA A;  3F2C A;  1UNS A;  1SJE D;  3HGB A;  4IPH A;  5J1Z A;  1MI2 A;  4K8J A;  4K5X A;  3V2T A;  3S2H B;  4QJF A;  3VR6 A;  5C5M A;  1MJE A;  1PXU A;  4LAA A;  5IGE A;  5IWA L;  4BBS G;  4ALP A;  3J81 L;  2K33 A;  1HFG A;  3M7G A;  3PQI A;  3CPF A;  2HCI A;  3VR5 A;  1Y1W B;  2JA5 B;  3A5Z B;  1TWC H;  1LTT D;  4R8I A;  1SN8 A;  3HOU H;  1R4P B;  2KBN A;  2A8V A;  4A3L H;  2QIL A;  4XXE A;  5IOD A;  1N36 L;  1QWY A;  3E5S A;  2JA6 H;  4KKT A;  2IX0 A;  4JG2 A;  1HNX Q;  1BBW A;  3QO2 A;  4LFB Q;  2LFN A;  3L2P A;  4HR7 B;  2ES2 A;  1VQP A;  4R4I A;  1K3B C;  5C4Z A;  1CKN A;  1VQJ A;  4BBR G;  5M3M B;  1H9S B;  1VQN A;  4KKU A;  3S9W A;  2F0D A;  4N9P A;  5M3F G;  1WTX A;  3NBH B;  2JXM B;  5C44 B;  2EDG A;  3PUX A;  3TRE A;  4S3S A;  4KN7 C;  4KN4 C;  4HMI A;  1NAP A;  5IT9 c;  4V19 0;  2RHQ B;  2UXB L;  4GLA C;  1ESR A;  4EQO A;  4X66 Q;  1TWA B;  3ZYY X;  1XMQ Q;  1QUQ A;  3A7L A;  3RN2 A;  1OXV A;  2KJX A;  1O7Y A;  4JBK A;  4DXG A;  2NUC A;  2KEN A;  3KYH C;  2EY5 A;  2RSO A;  1JWS D;  4JOI A;  3D0F A;  5F2D A;  1W3S A;  1LT5 D;  3U9S A;  1EFI D;  3K5L A;  4LF8 Q;  2BA0 A;  1T5E A;  3K58 A;  3BZD B;  3UDI A;  3C3L A;  3M9B A;  4GLV B;  3F8T A;  5A2Q E;  4BS9 A;  5FO9 B;  4KTA A;  1BR9 A;  4L5Q A;  3VA7 A;  4M8A A;  4YY3 Q;  1PLF A;  2Z6B A;  1B9N A;  5EGT A;  2C5C A;  1VQG A;  2F0T A;  1F9Q A;  2GN5 A;  5ELE A;  1LYL A;  1R9T B;  3A56 A;  4MHE A;  3S1Q H;  4JI8 Q;  2E5L Q;  1XNQ Q;  1S4Z A;  5IYB G;  1UEA B;  5KRU A;  3ULP A;  3HOW H;  1RTN A;  4X3U A;  4JI5 Q;  1GHJ A;  2VUM G;  5JEA G;  3V05 A;  1LTB D;  1PMR A;  4H44 C;  3CPW A;  4OO1 H;  4ME5 A;  2EE1 A;  4K5V A;  2K04 A;  1L0Y B;  3EN2 A;  4RGM A;  1VMC A;  2B2V A;  4ZK9 B;  2BA1 A;  1EIG A;  4JI0 Q;  3S1M B;  3NSW A;  3VYU A;  3BS1 A;  4CGY B;  3T16 A;  4L6T B;  1F77 A;  4DV5 Q;  3F2U A;  4Y52 H;  1PH2 A;  2WKD A;  1CKO A;  1O78 A;  2FHT A;  2WKC A;  2Z1C A;  1SFO H;  5IOC A;  1QG7 A;  2L5T A;  1FNV A;  1KC8 C;  1OXX K;  1P8L A;  3CKI B;  3AEV A;  1MKH A;  4RHR A;  3OOC A;  3HP3 A;  4HJA A;  4QF4 A;  3PO2 H;  3PO3 G;  4XQJ A;  1QE6 A;  4JBJ A;  4FF4 A;  3HKZ E;  2B2U C;  1MGS A;  1SND A;  1TWF H;  1QNU A;  1RCV D;  3HOX G;  1KQS A;  5AJ3 L;  4DV3 Q;  2BH2 A;  1YVC A;  1PTO H;  2K14 A;  1Q86 C;  5NUC A;  2QDB A;  3Q8D A;  1IL8 A;  3SDZ A;  1DGS A;  4IFD G;  1VF5 C;  1H9M A;  3NQT A;  3S16 H;  3TEH B;  2VY3 A;  2F0N A;  2QA4 A;  5BN4 A;  2VS1 A;  3H91 A;  4U68 A;  1IBM L;  3HOV H;  4OL7 A;  1FJG L;  1PFS A;  2VW9 A;  4FVM A;  1X55 A;  4LW1 A;  4G4K A;  1TVX A;  3E6Z X;  4A3K B;  3QG1 A;  2E2I H;  4EQN A;  1E3P A;  1EYC A;  1WCM H;  2HQE A;  1WTQ A;  2UXB Q;  5IGD A;  3CCU A;  1VQ5 A;  2KEC A;  4YCV A;  3CCQ A;  4DV1 L;  3TSS A;  4PG3 A;  4Y7N H;  5T1G A;  5D3I B;  2B2Y A;  5KND A;  3S14 B;  2P5Z X;  2OWO A;  1YJN A;  2FIN B;  1SRU A;  4DAP A;  2PZW A;  4N8X 1;  2C9O A;  1EOT A;  1BBX C;  4AYB G;  4A3F G;  1ZEQ X;  3WDN A;  1V1P B;  2AUJ D;  2A73 B;  3FDT A;  2G9D A;  1JE5 A;  3J7A F;  3L0O A;  4BBS B;  4CDC C;  2K5N A;  3HKZ B;  4A3G G;  2N49 A;  3OW2 A;  3K6O A;  4F8M A;  1JWM D;  1XPU A;  2IJ0 A;  3P7J A;  1HNZ Q;  1DXM A;  2L9H A;  3CQZ B;  5LMU Q;  4IPD A;  2PZU A;  2FMC A;  3SEB A;  4GN3 B;  3ERQ A;  2MQH A;  3VDY A;  2IHE A;  5DNF A;  1N33 L;  2NWG A;  2JK8 A;  1L0W A;  1I3Q H;  1IBL L;  2VNU D;  4NXM Q;  2ZJQ A;  1EY8 A;  5CR3 A;  2E2D C;  1VQO A;  1RD9 D;  4JYA L;  1F9S A;  3KJP A;  3T4A C;  1YIT A;  1FD7 D;  4ZRZ A;  4LF6 L;  1WTR A;  4XYQ A;  2MP1 A;  2XSC A;  4DAV A;  3VR2 A;  1WTP A;  1QVG A;  3WOE A;  1G2T A;  3TP7 A;  4BBR B;  2KCC A;  1WD1 A;  5M3F B;  4FO2 A;  3BG3 A;  4C3H H;  1IBK Q;  4A3I B;  1VQK A;  4FP5 D;  1DCZ A;  1YZ6 A;  3MA2 B;  3CCJ A;  5ELD A;  2NVQ B;  1I4G A;  2R7Z H;  3T51 B;  3J7A 5;  4L5S A;  2QW7 A;  1II3 A;  4DR6 Q;  3PIP 3;  2NTS A;  4DV0 L;  5C4J B;  5CV4 A;  3C1F A;  1HJP A;  4KHV A;  2RQX A;  3K7A H;  1K0S A;  3MEH A;  2EZV A;  4MZ9 A;  1ONL A;  4XT3 B;  5M5W H;  5C4X G;  3H0G G;  1SAP A;  1HR0 W;  3LX0 A;  2UU9 L;  1IXR A;  3K5M A;  5EKK A;  4C3I G;  1BXT A;  2B2T C;  1K83 B;  3G4S A;  4DR3 Q;  1SSO A;  2FMM A;  2YYZ A;  4XT1 B;  1EWI A;  3D4W A;  2Z4I A;  3NUC A;  1ROD A;  4RHS A;  2M9V A;  4DV7 L;  1JOQ A;  4DR1 L;  3RZO H;  4CHT B;  3LWU A;  3TZU A;  3UE0 A;  4HJ9 A;  1HQM C;  2B29 A;  5I4D A;  4YHH L;  4GS3 A;  3X3N A;  2I5L X;  1RJT A;  3J80 L;  4NXN L;  2NVT B;  1MSH A;  2A5H A;  2L55 A;  3RZD B;  5C3E H;  1FR3 A;  3MHB A;  1JB7 A;  2GVB A;  2NZO A;  4GOP A;  5KYI A;  4FF3 A;  2DN8 A;  1BBU A;  2E75 C;  3SHL A;  1SYE A;  2NB0 A;  2Q8R E;  4DNR B;  4C56 C;  3GV6 A;  4FNF A;  4LFA L;  3IFT A;  2DGY A;  1Y1W G;  2JA5 G;  2D9U A;  3O13 A;  1L1O A;  3FP9 A;  3GTP B;  4LF5 Q;  3L9A X;  4LF9 Q;  5C4H A;  5JJI A;  1LAB A;  2A69 C;  2VUM H;  1SJH D;  4DU9 A;  4TQU S;  4DV4 L;  3DWQ A;  4A3E B;  3CHB D;  4FXD A;  1CKM A;  2QGQ A;  1KAW A;  1HTL D;  4AYB E;  4DR5 L;  2F0K A;  3GV3 A;  1C8C A;  4KY7 A;  5LMN L;  1STA A;  3G6J B;  4YWK A;  3R3O A;  5JPM C;  2B39 A;  3UI2 A;  1TII D;  5M3M G;  4X64 Q;  3VR3 A;  1TWG B;  1XWE A;  3S17 B;  1V1O A;  5C44 G;  4X3S A;  5JJK A;  1IBL Q;  1G91 A;  1BDO A;  4KJN A;  5IP9 G;  2K28 A;  1MIU A;  3S1N H;  1U5K A;  3PO3 H;  1E1O A;  1MSG A;  2D2C C;  1IYU A;  3GTJ H;  4I65 A;  2UUB Q;  5D65 A;  3GTQ H;  3HOX H;  5K5P A;  3TP6 A;  4DR2 L;  3M4O H;  1FL0 A;  2F0E A;  1CQV A;  4ZUI A;  4H02 A;  3P75 A;  4B3M Q;  1Y1V G;  2RHS B;  2HDM A;  4IFD H;  1BCP C;  5J39 A;  3SVM A;  4WFN 3;  3H15 A;  3M3Y B;  4HJ5 A;  1PYW D;  4K8I A;  4G7Z C;  1EYA A;  3S24 A;  1Q46 A;  1X54 A;  1SBB B;  3R2T A;  5EAY A;  2JA8 G;  3KOJ A;  4L8J A;  4ZKC B;  1X56 A;  3HRZ C;  1E2Z A;  2B63 G;  1LT6 D;  1NUC A;  3K80 C;  2LY7 A;  4HED A;  3HEJ A;  1BCP B;  3GTK B;  3K8A A;  3NEM A;  1Q8I A;  4P71 A;  2R61 A;  1TS2 A;  5C0X H;  4FDB A;  4OWW B;  2QCP X;  2MGS A;  4AYB B;  3NBI A;  4LMQ D;  4A3F B;  5FO8 B;  1NNX A;  3CCS A;  3PV0 A;  4QUC A;  4K6D A;  2WV6 D;  5M5Y H;  4LFB L;  4DR1 Q;  4A3G B;  2D62 A;  3QWN A;  4A4I A;  3MEF A;  1Z6H A;  4RGN A;  5E4W C;  1BUV T;  3N52 A;  2NVY B;  3T1Y Q;  3JAM i;  3I4M B;  3D4R A;  3MFY A;  2A1A A;  4CDD C;  2K75 A;  1D1K A;  2EOT A;  2GA4 B;  4A75 A;  4J15 A;  1I6H B;  1Q1E A;  1XPR A;  3GTL B;  5I2X A;  3QB3 A;  4JOI C;  4FF2 A;  3BDC A;  2NBF A;  2N8N A;  2IWH A;  4C2M H;  1SNM A;  4X66 L;  1XMQ L;  2E2J B;  1DOL A;  1WFQ A;  1EEF D;  1FNU A;  1NMG A;  3G6E A;  1TXY A;  2DJG C;  5CBA E;  3HOZ G;  1I50 H;  3GQB A;  1VMP A;  2VB3 X;  4HSV A;  5DEH A;  4DXF A;  3FHW A;  2HDL A;  5KEE A;  1IW7 D;  1SYB A;  1AEX A;  1ZXT A;  3K0Y A;  2LXJ A;  1U4P A;  4JBW A;  4L5T A;  3MXN B;  1VDZ A;  5M9O A;  2SOB A;  4C3J B;  1U9R A;  1N9W A;  3AFQ A;  3U58 A;  4KI0 A;  4YY3 L;  2D5D A;  4DN4 M;  5LMN Q;  5I6W A;  2PNH A;  2K5D A;  1X6O A;  1LTR D;  4CKC A;  1VQ8 A;  1A2T A;  2PYK A;  2Q2U A;  3H0G B;  3CME A;  1WD0 A;  1X32 A;  2PCF B;  4C3I B;  2WB1 G;  1XMO Q;  4A3K G;  4JI8 L;  2B2V C;  4LUV A;  2E5L L;  4HSP A;  1IYV A;  1XNQ L;  1NCV A;  2PQA B;  4B9X A;  2K01 A;  1JJC B; 
#chains in the Genus database with same CATH homology
 1ICF B;  1MHW C;  2DJF C;  4OEM B;  4CDD C;  4OEL B;  2DJG C;  4CDE C;  1K3B C;  4CDC C;  4CDF C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...