1ICFB

Crystal structure of mhc class ii associated p41 ii fragment in complex with cathepsin l
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
42
structure length
42
Chain Sequence
NNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAASYPTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CATHEPSIN L: HEAVY CHAIN)
publication title Crystal structure of MHC class II-associated p41 Ii fragment bound to cathepsin L reveals the structural basis for differentiation between cathepsins L and S.
pubmed doi rcsb
molecule tags Hydrolase
total genus 3
structure length 42
sequence length 42
chains with identical sequence D
ec nomenclature ec 3.4.22.15: Cathepsin L.
pdb deposition date 1999-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.170 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Cysteine proteinases. Chain C 1icfB00
4CDCC 4OELB 1MHWC 4CDFC 2DJGC 2DJFC 4CDDC 1ICFB 4CDEC 1K3BC 4OEMB
chains in the Genus database with same CATH superfamily
1ESFA 1B9MA 4QUFA 3E0EA 3UI2A 4QUCA 1K3BC 4JI4Q 3HOXB 5EGTA 4DXFA 4AYBB 1TKWB 2KECA 4LF7Q 2CWAA 3QIAA 1CQVA 4RHSA 4Q5VA 2OF1A 4K2KA 1D5MC 3GTMH 1PYSB 2FMMA 3CCJA 2F1MA 4OWTB 1Z9FA 1G6PA 4UDUC 5C0XI 3G71A 3MTSA 2ZJQA 5CV6A 1VQLA 1HR0Q 1K3RA 1G2SA 1NCVA 4F87A 1GUSA 2MUYA 1LTSD 5DNFA 1A2UA 4RGTA 1C4QA 1U0LA 1IKLA 3NBHB 1SROA 1YNNC 4C3IB 1EU4A 5EKIA 5E4WC 3DM3A 1STGA 3W3AA 1AE3A 1EWIA 4DR5L 2UXBL 2X6LA 4DUZQ 4QCLA 2HIXA 1P8LA 3I72A 3NK9A 4BBRG 1HR0W 5JPMC 5K36H 1CKNB 1NJIC 5KYLA 1STNA 4UAIA 1WD0A 5D14A 2D0PA 1JB7A 3HS0C 1I94Q 3CRKC 4A4IA 3Q23A 1QUQA 2F0KA 3A8JE 2NZ1D 3P1HA 2L1BA 4A3KG 1ENFA 1NE3A 2RKSA 1EL0A 3F2CA 1F2MA 4DV1Q 2KENA 3VR3A 5I6YA 1DM0B 5C3EH 2JA9A 5TSSA 4G7HC 4ZKCB 2F0UA 4IOAA 1PRTD 2Z6KC 3S16H 4TQUS 2PW7A 5FLMH 3WDNA 3EN2A 1WYDA 3T51B 3MC0B 3IFDA 1TY0A 3CHBD 2F3WA 5KYIA 3AEVA 3C1FA 5HURA 1WI5A 5JEAG 4A3DH 4JI1Q 1XNQQ 1XWEA 2EE1A 3NTHA 4M8AA 3K6OA 1R9TH 4N8FA 1IBKQ 2GVAA 3ULJA 4L8JA 5C3XA 4DAVA 2AKWB 1CKMA 5FO9B 2DN8A 3K80C 1GD7A 1TWCB 3HKSA 3S14H 4LAAA 1NR4A 1E24A 1OXVA 1XNRL 4NDXA 2R92B 3S24A 1FD7D 1KHIA 3OTOQ 2NVXB 4HIMA 3VA7A 4HCEA 3MAQA 1JE4A 2WB1G 3K0YA 2BH2A 2N78A 1U4MA 2NN6I 4OGQC 1F2LA 3FKIB 2XWJB 5ISRA 3PIO3 1S4ZA 5BR8L 2UU9Q 2R7ZB 2K33A 1CFMA 5D65A 5C4JB 4RMFA 4LF8L 1CHQD 2XWBB 4KV6A 2ZTEA 4YY3L 1Q90A 1AE2A 4GN4B 3TRZA 2F4IA 4IUPA 1P16A 3SK8A 2HDLA 5CR3A 4EQPA 1BO0A 4DV0Q 1HXYD 4BBRH 2B2TC 5CORA 3IRBA 4RHRA 1UE1A 1A3UA 1MSGA 2RVLA 2YTVA 1JJGA 4JYAQ 3M85A 2OWOA 2L11A 2PMZB 4KN7C 1G2TA 2MGSA 3S2HB 1TWHB 4IURA 2EYHA 3CCQA 3GTMB 3OSOA 4XYOA 1F9RA 2A6HD 3DWPA 3HOWG 2A6ED 3J80i 1TIID 2F4VQ 2RQXA 2K5NA 3TREA 1S72A 3RD4A 4KI0A 4X65Q 3CCLA 3R2IA 2B63G 4DR1Q 2E2HH 1VQKA 2CW0D 1Q12A 1WVLA 2NZOA 1X6OA 3I7FA 3J81L 1VQ8A 1BCPB 1XNQL 3U4ZA 4FYDA 5J3BA 3S9WA 2R3ZA 1G8ZD 4RKBA 4JI5Q 1Q8IA 1UWVA 5GQOA 2K7VA 2E2JH 2VB2X 4NMZA 4KK7A 2CWPA 1SR3A 1KLUD 1RDPD 1LTRD 2C5CA 2PZTA 4XTCS 3NTKA 1W6JA 3K5LA 3I70A 4AYBE 3GTOB 3F2BA 4DR7Q 1KDAA 2MO1A 2YYZA 1LLRD 2N88A 4KTAA 4C2MB 1B3QA 3I56A 5C3EB 4OO1H 1DGSA 1UUPA 1JICA 2Y0SG 3TP7A 5IGGA 3UDXA 5IGBA 3S16B 4ID6A 3SR1A 2LXKA 4BY7B 2NVTB 4YWMA 5FLXE 1XX8A 1O7ZA 2EYMA 1MIUA 4CKCA 2K5DA 4LUVA 1KQSA 1STBA 4JBKA 5CV4A 3PV0A 3ZJYC 1XXGA 1AZPA 1R9TB 5FJ8H 4O0AA 4H0LC 4R4CA 3CC4A 3KYHC 1BQQT 2B2VA 1Y1VG 2I5LX 3H3VH 1G291 5KGUA 2I0QA 1JC7A 2GA4B 1R4QB 4QY7A 1Y8OB 2PI2A 1PH8A 3S14B 2OTJA 4FXDA 1E1OA 3K5NA 1HH2P 1IBMQ 4PZ6A 2A68D 3HOWH 1N33L 3V96A 1X32A 4DV4L 3TS2A 3SEBA 2B63H 4K8JA 4C3HG 3J7YW 1K9MC 2KHSA 1S5ED 4IPGA 2A5HA 2UUCQ 2VUMG 1GUWA 4R4OA 4BA1I 2VQEQ 1EY5A 1HNWQ 3GP7A 4LFCL 4NXNQ 4GKKQ 2PQAA 4BBRB 4POFA 4ZQ3A 1EEFD 2Z1CA 1V1PA 5DM73 3W1BA 2C35B 1XPRA 2CVRA 5IP7G 4LF9L 4A3KB 5K5PA 1I3QB 1HNXQ 1CT1D 2UUAQ 1JWSD 1PTOF 1W3SA 1SE2A 1F2YA 2M00A 5J1ZA 3BS1A 2E2HB 4A76A 1VS0A 5EPJA 1TU2B 2QA4A 4H44C 3KFUA 4DF7A 3V2TA 1A2TA 4JI8L 1YJWA 1EIHA 2DNEA 3HOUG 1GUGA 1U4PA 3NPPA 1PH9A 1KRTA 4PG3A 1HNZQ 2E2JB 5AFWA 1J5EQ 1XTDA 1Y1VH 4HMJA 4HIKA 1HQMC 4B08A 4OX9L 1GHJA 3WWVA 2F52A 3P75A 5C4XG 2EPBA 3Q24A 2Q2IA 4F88A 1EY0A 4QIWE 5DLQE 3K57A 1VF7A 3AU7A 2WB1B 3DHQA 4EGVA 1YJNA 2ATWA 1YHBA 1GJXA 1L0XB 1RF2D 1QWYA 1YBYA 2V1CC 2VW9A 1E3PA 3QB3A 4JI7L 1WTRA 1WTVA 2JA7H 5LL6S 1GVPA 4RGNA 3UE1A 2VUMH 2B2UA 1HNWL 4HAEA 1CI3M 2ZXPA 4GKKL 1MKHA 3VYRA 2ES2A 3OYYA 4IZ8A 1B4OA 3DMUA 4FF3A 1PLFA 4XYQA 1I6HH 1FGUA 3DLLA 4UHVA 4EQOA 2N49A 1WCMG 4JCVE 4IFDJ 2V4DA 3J80L 4HR7B 1JOQA 1X65A 1ZEQX 2QDBA 3KUPA 2WAQB 1PTOH 2MP1A 2NUCA 5BN5A 4DV3Q 1KC8C 1X9NA 3HOWB 1SMYC 2B39A 2B8GA 4A93H 1C7YA 1IBLL 2B63B 3GDEA 2JE6I 1VQNA 1DD2A 1H9RA 3K0XA 3CMAA 4JI3Q 2DY8A 3NWSA 3WOFA 1DOLA 3A55A 4ME3A 4DR3Q 3KK7A 3GV3A 5FO7B 4B3TL 1KNAA 5KNDA 2IX0A 3AB9A 3IAYA 4P72A 1XPUA 2ZXRA 4A3BG 3AYHB 4KKUA 5NUCA 2KCTA 3ZYYX 4P74A 4EQNA 3KJPA 5C4XH 2IHFA 4A3CG 4K6LA 3H6MA 2QEXA 4X3KA 2WFWA 3RN5A 2E75C 1IKMA 3HFZB 4G7OC 2RSOA 2B2WA 1X3QA 1I4HA 1NBWA 1YNJD 2DY7A 3AQQA 4RH6A 2Y0SB 4KHZA 3CMEA 1H95A 1BUVT 5IGFA 3T13A 2XVSA 2PYKA 4BBSG 3MHBA 2EYJA 4NXMQ 2MNAA 4KKTA 3OW2A 1VQJA 2EYFA 3F1ZA 3E9HA 1O80A 3AFQA 1ASZA 4JI6L 3NUCA 4WJ3M 1SN8A 2KCCA 2HQLA 1PVOA 2IPKD 2D9UA 5C44G 4GKJQ 1L1OA 2E74C 1VMCA 1LT3D 1U5KA 3EIVA 1Y1VB 4GOPB 3FMCA 5KIXA 4FVMA 2RHSB 2HT1A 5JAVA 1YEZA 2BH8A 1M4VA 4XIGS 1VQAA 3OPOA 1A15A 3KLSX 1B3AA 5CGKA 5KRUA 4JOIA 2XSCA 2JN4A 3C1EA 1VQ7A 4KN4C 1PYWD 3T1HQ 4C3HB 1VQGA 2EY5A 4U673 2EJMA 3EA6A 2IJ0A 4N8X1 3RZDH 5I2XA 4DUYQ 2B2VC 3RLNA 5EQ0A 1RIPA 5CV9A 4OWXB 1G91A 3JC66 4HSPA 2PCFB 3J81j 4EQ5A 5IYBG 3L2PA 4DK1A 1Q3LA 1V1OA 1LUZA 3DEPA 1I6HB 1Y1WG 3OHXC 3LNNA 1IYJB 5EKLA 4A3BH 2I46A 4GNXB 2B2YA 4X62Q 2YU9H 4A3CH 5BN3A 2RF4A 1PTOB 4KHVA 1GUTA 4OXPA 3G4SA 1E1TA 2QDLA 3T16A 3CCSA 2WB1E 3EROA 1FVIA 3V05A 1IZ6A 4F7XA 5M3MG 4GN3B 3UE0A 1YNND 4BBSH 5JJLA 4OONA 3MEHA 5FK9C 1GUOA 4PMCA 5CV5A 4X66Q 4LFAQ 3J81i 3HOUB 5FLXc 1N36Q 1QCBD 4HSVA 4YIJA 4NPSA 3HKZG 3K5OA 3G7LA 2EXZA 1V1PB 3TEHB 5H1SE 3RMHA 3JAME 3SK4A 4DV6L 3RLOA 2FINB 1EQRA 3CRLC 4DV5Q 1GOZA 5C4XB 2R92H 4QJFA 1NNXA 3NELA 5JVG3 5EJWA 2NVXH 3T1HL 1IYVA 3G48A 2DUDA 4CDEC 3FKIH 2NTSA 1VQFA 5JJIA 1C9OA 1UE6A 1RKNA 1GUNA 3K81C 1S3OA 3TN2A 5IGCA 1I4PA 1ZYRC 2KBNA 2RCFA 2K75A 5D3DA 2EOTA 1N32L 3J7ZC 4C56C 3SE0A 1I4RA 5IYBH 1JOKA 1SRUA 4XDXA 5I2YA 1E2ZA 1S5CD 5DEHA 1PZJD 4DK3C 5I6WA 3I4OA 1Y1WH 4A3IG 4AQYL 4X62L 1WCMB 2L0CA 1Q81C 3ERQA 1K0SA 1HQRD 4ODGA 3S2HH 1WFQA 1TWHH 3J7AV 2ICEC 3S1MH 3NTIA 1F77A 1JR0D 4J6HA 4N9TA 3FPPA 4DR6Q 2B2UC 3SDZA 2NVQH 3FRPB 4MTKA 2Y0SE 5M3MH 1KNEA 2JP1A 4O1NA 4KJOA 4G4KA 4GZYC 3LWEA 3RZDB 3KBGA 1KIXA 4X66L 2X69A 4DAYA 4P71A 4LUOA 4C1NI 5D3IB 3TMEA 3CCUA 4B3RQ 1S5DD 2BE5C 2RDFA 4KD4A 2CQOA 3A74A 1K83H 1PZKD 1YNXA 1RCVD 2D62A 2M2LA 4HN7A 4DR4Q 2QW7A 3KJOA 4A3BB 1QB5D 2SNMA 3GTOH 3BZCA 2CHBD 3SVMA 1SEBD 3R2TA 4A3EG 2YU9B 5J39A 4PZ8A 2VQFQ 4JW0A 4C2MH 1SMXA 1OXXK 3E6ZX 1BCPD 1EZ8A 4DA2A 5ELBA 5T1GA 2JA8G 2F0IA 4JI0L 2UXCQ 1UEBA 5ELEA 1O7YA 4AH6A 1WOCA 3SXHA 2F0TA 4UP9A 2F0LA 2AHOB 1KDBA 4TKOB 4DR2L 1WTOA 4BY7H 4BBSB 3R3OA 2NVTH 1T5EA 3AMUA 3HOVG 3S15B 5DM63 1K8MA 4L5RC 3Q6SA 1LTLA 3D6WA 2MFIA 3K8AA 2WIIB 4XT3B 1L0WA 2I5HA 2R7DA 4K5WA 1AN8A 4FDBA 4JI4L 1I4GA 1B70B 5C44B 3GTPH 3QJYA 1F9PA 3DWQA 3T4AC 4DV7Q 2CFMA 2XRSD 4A3IH 2TSSA 4LF7L 3RZOB 1VQDA 1KRSA 4LF6Q 1H9JA 3EJIA 2B2WC 2O5JC 5ELDA 1GHKA 4HMIA 2WKCA 3EVQA 3PSIA 1D8LA 4RFBA 3L7ZC 4GS3A 1FJGQ 3I2ZA 1T5XD 1IL8A 1EYDA 2D0OA 2FMCA 1EYAA 1LACA 2CH4A 2VL6A 1HR0L 4J8QA 1CK1A 1A0IA 1S40A 3CD6A 1JMCA 4ILWA 5A2QE 4FO2A 3U50C 4WJ4A 5KEEA 2K50A 1CTMA 1FL0A 4CJ0B 1UEAB 4JBJA 4LK1C 1F2ZA 2EXDA 4DUZL 1SYBA 4O42A 2Q2HA 5FO8B 1B7YB 2LSSA 4RAUC 1Y1WB 1I94L 4MHEA 2QKIC 4JOIC 4U68A 4P2CB 1I4QA 4R4IA 4F8MA 2VQFL 4A3KH 4DV1L 4A3EH 4B3MQ 2WAQG 4DNIA 3BYTB 1I3QH 3S1MB 2J7ZA 1RD9D 2F3VA 3BYYB 1UE7A 5BN4A 2JA8H 1HUNA 4R8NA 3C46A 2NVQB 2SDFA 5M3MB 2KEEA 2RCNA 4H13C 3KF8A 4OL7A 4JI1L 1Q1BA 4IUVA 4KD3A 5M9OA 2ZTDA 2E76C 5JEAH 3CPFA 1NSNS 2TMPA 1IBKL 1Y8PB 2B2YC 3FP9A 4UP8A 1PFMA 3QO2A 5T1IA 1EQQA 3A56A 2NZHA 2BDOA 5L37A 5E3FA 4A3MG 1LT6D 3OW7A 1PRTC 4OWWB 1K83B 4LUZA 3HKZB 5EAYA 3RLFA 1EOVA 1U4LA 5G3LF 2A73B 2K5QA 3OTOL 4YHHQ 1I50B 3BVMA 1YJ9A 4IFDG 4GLAC 4DNTB 3PO2G 1STAA 2QILA 2UU9L 3LX0A 3OWFA 4PZ7A 3AFPA 2PNRC 4NP5A 4K0KQ 2BDNA 2K5VA 3H91A 3Q8DA 3Q22A 4RCOA 1Z6HA 1ML0D 2DJFC 4TVAB 1WTQA 2HHHQ 1UE5A 1E2VA 1SNQA 1D6EC 2RHQB 3FVQA 1SDFA 2KHIA 5IT9L 4DV0L 1SSOA 2AQ1B 1XMQQ 2LXJA 3TZDA 2X6GA 2EJGC 2L4NA 3ULPA 3GTPB 4JYAL 3NHHA 4A3IB 1PDQA 5LHY1 1ZKOA 3A8KE 5IE8A 2CH4W 1VQ9A 2PW5A 4L5QA 2NWGA 5IWAQ 1M1KC 2D2CC 2F4VL 4X65L 4NB3A 4X3SA 5AJ3Q 4DR1L 2O2LD 3CC7A 1H9KA 3ND8A 1OO9B 2JJQA 4XQQA 1A63A 3F8TA 3T53B 1IHZA 5C5MA 1HFGA 1JJ2A 1EY9A 1KL9A 2WP8J 1ICFB 1CZGA 3CC2A 2R7FA 1YIJA 1K8GA 4B9WA 4JI5L 4IUUA 2ID0A 4BY1G 1CUKA 1SYDA 2A6HC 2AMCB 4P75A 1X54A 3MXNA 5C0XG 3EBEA 1TWAH 4A3MH 3G6EA 3D31A 2CW0C 5C5LA 4DR7L 3PUYA 1VQMA 5E4XA 3S1QH 2XTIA 2EIFA 5C4HA 1CHPD 4A3EB 3S17H 1C48A 1QOHA 4IFDH 1K8AC 3JAMc 3PO2H 3D0FA 1SYEA 4KJNA 1Q86C 4LW1A 1AFPA 2JA8B 2C9OA 4KMUC 3X3NA 1LABA 2F0GA 1STEA 1EEID 2SNSA 3HEJA 5CMDA 4XQNA 1Y8NB 3CCRA 2GVBA 1TS4A 3HOVB 4JK1C 3GTGB 4LF5Q 2H1EA 4B3SQ 1C0AA 4A75A 1SJED 5M5XH 4NW2A 4KHPQ 1II3A 4OIKA 4PMWA 2QCPX 1U4RA 3H0GG 4PQXA 1B53A 1DJRD 1SNOA 1XMOQ 3N6RA 1IBML 3BVZA 4KY6A 3CCEA 4IO9A 3J7A5 2PMZE 1RTNA 1QUQB 3IL8A 5M5WB 3TP5A 2OEOA 3K5MA 2EJFC 4FXKC 4KY7A 1KXLA 4ME5A 4DAPA 2B29A 4X3TA 1X3EA 1QE6A 4IUNA 2Z9HA 1EQVA 4C3HH 3X3MA 2AWNA 1N34Q 3BDCA 2F0FA 2UUCL 1BBWA 1B9NA 1ET6A 4HCSA 4CDCC 1EIGA 2VQEL 2JA5G 2NYZD 1SYFA 4BY1H 1EUJA 4NXNL 1NR2A 2A68C 3RR5A 1QNKA 1LV9A 1EWCA 5EBCA 5C0XH 2ICIA 1NMGA 2NN6G 1AW7A 4HJ7A 4YCWA 3D3RA 2ZTCA 2NBFA 3NBHA 3HKZE 4K8IA 4UY8C 2PNHA 5IP7H 2XGTA 3KF6A 4E6IA 3K58A 1HNXL 4XXEA 2UUAL 2FFKB 2KCMA 3GTQB 1N8RC 2VY3A 1EY8A 1CKNA 2CCZA 4R1JA 1E7ZA 4K5XA 4KY5A 1QZHA 2K01A 2VS1A 1AP0A 4B3SL 1MD2D 2F0JA 3M4PA 4X64Q 4X3UA 1VQEA 3K59A 1HNZL 3HOUH 1PMRA 3E3XA 3MZ5A 4K14A 4B9XA 1J5EL 1V43A 5CV8A 1CKOA 4JPBW 1KLGD 1TWAB 4A3MB 3H0GH 1KAAA 4GLVB 4R8IA 1BDOA 1PTOD 1ASYA 4CDFC 4JBMA 4A3LG 5KNCA 1EQTA 1E22A 5C4ZA 3S1QB 1VMPA 2ZJPA 3S17B 1BVSA 1W2BA 1WTHA 3SHLA 3PO2B 5EBDA 2MHVA 3CPWA 1IW7C 1WTXA 4LF4Q 3J81E 2KJXA 3HOZG 3ULLA 5LMNQ 1ICWA 3VR4A 2A69C 5ELCA 3NEMA 1ENCA 2ZM6Q 2JA5H 4DV2Q 4JV5Q 1U9RA 4X6AH 3S2DH 4MZ9A 4DGZA 2NB0A 5M5XB 2NN6H 3T56B 4IN3A 3I8ZA 2AWOA 2HUGA 5LMNW 1VQ4A 1SLJA 1WCMH 2H4OA 2WKDA 4J15A 4Q0FA 1WTWA 2K4KA 2IT1A 5CYUA 2E5LQ 4DV3L 1EY6A 3BZDB 1Q8KA 1KDCA 1PYBA 1QVCA 4IPCA 1SNPA 2VB3X 3VA5A 4OO1I 2EY6A 3NP8A 4XQJA 1UNSA 4JI3L 1HHVA 5GAEC 1DXMA 2N55A 4R9WA 3SK6A 5IT9E 4DR3L 3M3YH 5E1FA 2R6GA 3F2UA 1ILPA 1QG7A 4BY1B 3OOCA 3CKIB 2EYOA 2HQEA 1CSQA 4ZRZA 4A3JG 1Y14B 2KVMA 2E8GA 4M1UB 1I4XA 3H3VI 4ZLTF 2DGYA 3P7JA 1HZ9A 2KQ3A 1HFNA 3KDFA 4CHTB 2L5TA 3BVGA 2O5IC 1S5BD 1SNMA 4C3JG 1ET9A 1YI2A 2B8FA 1V1QA 3H94A 4G57A 2SEBD 3I90A 3S1RH 3A5UA 3HOZH 1DCZA 3RNUA 3H15A 3OMGA 4NXML 2LFNA 1TT2A 3DXJC 3A7AB 2RDGA 2LS01 2AUJD 1A62A 1VQOA 3S15H 2SOBA 4WJWA 5JJZA 5FKAC 1A8VA 5EKKA 4EX5A 3MXGA 1PFNA 2Z4IA 1VQPA 4GKJL 4WFN3 1EIYB 5C44H 1YNJC 2PQAB 1PH3A 3RZOH 3H0GB 4CJ2C 1XYIA 3CW2C 2JEBI 3CCMA 3PQIA 1D1KA 3TDQA 3PUXA 4DAMA 5IGEA 1X3FA 2Z4HA 2IW3A 3L3OC 5CBEE 2F0QA 5COYA 2WAQE 1STYA 3H09A 2IX3A 4FF1A 5LL6X 5FLXL 1PRTF 3CQZH 1G51A 4JC0A 2UXBQ 2K5HA 1SNCA 5K36G 4FP5D 2XIWA 4DN4M 4CGYB 4DUYL 2VZAA 2ALYB 4LFBQ 2EZVA 2JA5B 2OTLA 4P73A 5ELOA 1J8IA 2HIVA 3STBC 2RDHA 2XN9C 3GD7A 3S2DB 4A3JH 1NY4A 3TZUA 3D8GA 3ICEA 2QGQA 1FGBD 1KAWA 1MI2A 1PH7A 1JT8A 2RBMA 1JOOA 4RG1A 3R93A 3FPUB 5FLMG 4CJ1B 2F0OA 4ABNA 4PNYA 1D5XC 4RA8A 1EYCA 3SGIA 1OXTA 4A3DG 3I73A 3CF5A 1KTKA 2A19A 4IJHA 1MJCA 1F9SA 1TR5A 3KLSA 3PUWA 1STHA 2BA1A 5JVH3 4OELB 3I4NG 3GTLH 4A3FG 3M3YB 3L0OA 4LWCA 4LFAL 3M7NA 1N36L 4KLKA 1AZQA 5J22A 1OTCA 1XNRQ 2MPMA 3I91A 2FJ2A 1WTPA 3MXPA 1GKHA 3MA2B 2PQEA 2MQHA 1KD1C 3J80E 2N3SA 1B44D 1L0YB 2L55A 2I5MX 4MNOA 3HOYG 5BR8Q 4DV5L 3OIPA 4H02A 4I65A 3DWAA 3M4QA 4BS9A 4LF8Q 4POGA 1I50H 1LTTD 3KF6B 2AUKA 1QJOA 4YY3Q 5M5YH 5IOCA 3OIQA 4DK0A 1RJTA 3HGBA 2PZUA 2F0HA 1TWFB 4DFAA 3HP3A 4APVA 3S1RB 2GN5A 3HOZB 2P5ZX 1E0BA 2F0VA 4QF4A 4LFBL 1D7QA 1RODA 3PGZA 3GTKH 4DXGA 1LTID 3K7AB 1ILQA 1FNVA 3TP6A 2R93G 1DYQA 2Z6BA 4O2DA 3PIOA 2F0SA 3RUZA 3VR2A 3NWTA 1HA6A 3QOLA 5JPNC 3JAMi 2K5WA 2BA0A 4JBWA 1Z7TA 3ER0A 1LM0A 1YHAA 4L63B 4V0BA 2F3IA 1SE8A 2PI2E 5DAUA 1BOSA 4L5SA 1NTGA 1I5FA 4DR6L 1IXRA 3ONAB 3QWNA 2DJGC 2F03A 4AIMA 3GV6A 4FF2A 3CQZB 1BF4A 1NMFA 1LTBD 2EYPA 2HD3A 1D5ZC 3I4NH 1BXTA 1PV4A 4A3FH 2CQAA 1J6QA 2G9DA 2EY1A 2KA7A 1VDZA 3CAMA 3D4RA 1YHQA 1L1OC 3MXUA 2JSOA 1H9SA 2OXPA 2Z8LA 3M4YA 1K28A 1T9HA 4BXXG 4CKEA 5IY0A 2RSNA 4B3RL 3MVVA 3VYTA 4J1MA 3NXWA 3NE5B 1L1OB 4DR4L 4A3JB 2E2DC 4OO1G 3PO3G 1VQCA 1PH5A 1KABA 3HOYH 4FNFA 3C3LA 5C3WA 5LMUQ 2EYLA 1SE4A 4S3SA 2A8VA 1BBXC 3GQBA 1VQ6A 2LMCB 2NVYB 5ELFA 2A74C 2EY2A 3KOJA 4C3JB 2UXCL 3BG3A 2K6AA 2YV5A 5FJ8G 1VQ5A 2KEDA 3I4LA 3MEFA 1K8OA 3TSSA 3U4VA 3NBIA 3GTLB 1X3GA 2H5XA 3J81c 4GN5A 2JA6G 1LO5D 1SYCA 3HOVH 3BU2A 3GTGH 1HZBA 2YTXA 1M8AA 1TS2A 4RGMA 5IGDA 2R93H 4QIWB 3CCVA 1PH4A 1X56A 4DV7L 1BCPC 5IODA 2ASBA 3A54A 2VNUD 4LF6L 1HZAA 1N33Q 4DV4Q 3OMCA 3PIPA 1LT4D 1HJPA 3DEOA 4ZK9B 4Y7NH 1LTAD 1FJGL 1SYGA 3KDFB 5C6AA 3DM1A 5M5WH 4HIOA 2F0PA 1OXUA 3BZKA 3J7AF 1MHWC 4YCUA 5M5YB 1PRTB 1VQHA 4EVOA 2JEAI 1CZWA 1HCZA 2WINB 3RN2A 4LJZC 4HJ5A 1PXUA 2M9VA 4LFCQ 1QVGA 4DNRB 4GOPA 3VR5A 3GTKB 3A8IE 1VQIA 1C8CA 3GO5A 1L2FA 4BXXH 4QMGA 5GADC 2Q8TA 5IT9c 4LF9Q 1G6ZA 3T1YQ 4DU9A 2F0DA 1FNUA 5CV7A 2K52A 1BKBA 3R8BA 3I55A 3PO3H 3PUVA 5LMUL 5M3FG 3PIP3 3GTJH 4B3ML 1QVFA 5HGTA 1MGSA 4RWSC 1S5FD 1WD1A 2JXMB 4A3DB 2G9HD 4JI8Q 4CBVA 1NAPA 3K7UC 3GTQH 3I4NB 1WJJA 4A3FB 3HG9A 1PH2A 2BOSA 1TWGH 2OQ0A 2JA6H 4GNXA 4HJ8A 4JG2A 1I6VC 1M90C 3LGJA 1JWMD 1SJHD 4QGUA 4ZKBB 1CM9A 1PH6A 1HPCA 3U58A 1MJEA 4OX9Q 4WORA 2F0EA 1R4PB 2A6EC 3B6YA 1SFOH 1PHJA 2MJ8A 2J4XA 2F0MA 3QOJA 4NKLA 3HRZC 2QF7A 4BA2I 1F9QA 2PPBC 3HOYB 2K1BA 4YHHL 1ENAA 3M9BA 5JEAJ 2UUBQ 4ZCKA 2JA7G 3D6CA 4JI7Q 1GM5A 1HZCA 1EZ6A 2ZJRA 1EYGA 3FDTA 5F2DA 1FYCA 1HTPA 4K0KL 4G7ZC 3KLWA 1SMYD 4HEDA 2Q8IB 2Q2UA 5FOBB 3SK5A 4C1NK 2EDGA 1NUCA 2HHHL 4IUQA 2AQ2B 4BWGB 1N9WA 4DAYB 2K05A 3UDFA 3P20A 3T1YL 5G3LD 1XMQL 2HDMA 3JAML 3KLRA 2R93B 1JCKB 4LMQD 3W1GA 3ND9A 4JVZA 2XNAC 1EFWA 4A93G 4QL5A 3ITPA 4QB4A 1A3VA 1Q82C 1IBLQ 1ZXTA 4K2LA 5M3FH 4Z9CB 1D2BA 1BR9A 1IYUA 5IWAL 4Y7NB 3UDIA 1ONLA 1PZID 2Q2TA 2L12A 1CA6A 5AJ3L 4GLXA 2IWHA 2QEJC 3E5SA 1QZGA 1PA6A 1ESRA 2LKVA 2KOLA 4B3TQ 1A6XA 2BCOA 1IW7D 2IL8A 4JI2Q 4IPDA 5CC4A 1SAPA 4ZUIA 3NQIA 3A0JA 3F2DA 3E9IA 2UXDQ 1EY4A 5GAHC 2A69D 1O7LA 3LWUA 2PZWA 1K73C 2NTTA 4OHJA 4A3GG 3TBIB 3PCOB 3A5ZB 1B1ZA 1PFSA 5GAGC 3VYUA 1Q7YC 3HZXA 4IOCA 3I3CA 3A7LA 2K14A 2Q8RE 2OQKA 3PO3B 4HTHA 3C2PA 2UUBL 2L15A 3W2DA 3PF5A 2IY5B 2E2IH 3GTJB 3ERSX 4R4QA 3J80c 3I4MG 3EFXD 4CDDC 4DKAC 3H3VC 4OIJA 5HGQA 1B2TA 1HA5A 3U9SA 4JI6Q 4RGOS 3VDYA 3QG1A 1VQBA 3HOXG 2K04A 2IX1A 1H9MA 4YCVA 2K28A 1TWGB 5ELNA 4AYBG 2JA6B 1FR3A 4LF5L 1H9SB 4UPAA 1EWHA 2ZXOA 4ALPA 4KHPL 1Q46A 1QILA 4FF4A 1TY2A 1HUMA 5HY6A 2I07B 1SFOB 4R4TA 2EVBA 1XMOL 2ZT9C 5EPLA 3U9OA 1O78A 4DK6C 1D1IA 5KNBA 3UDGA 1VCIA 3BDOA 4YWLA 4C3IG 3O13A 2OCEA 1TS3A 3PF4A 5GROA 1PFBA 1EY7A 3S1NH 1TXYA 1HRJA 5I9PA 1JB3A 2Z6KA 4KKSA 1K0RA 4JI2L 1B8AA 1N34L 2OT2A 3TQYA 3QR8A 2AQ3B 2KCNA 2UXDL 1AEXA 3M4OH 1V9PA 4XT1B 1EFID 3VYSA 4MTNA 5IYDG 1RTOA 3E0JA 1JWUD 2J0TD 3FEWX 3KF8B 2HCCA 4QQBX 4ZYSA 2VXWA 1JORA 4MN3A 4A3GH 4TSSA 2F0WA 1J9OA 3WOEA 2RA4A 1YZ6A 2R61A 2PO4A 4TRDA 1DOKA 2CKZB 1DZ1A 2Z0SA 4IJLA 5M3FB 4CKBA 5CBAE 2EQSA 3D4WA 2FXQA 1TVXA 2L9HA 5A2QL 5E7NA 3URYA 1XJVA 3I4MH 1B50A 4GOPC 4V190 1JJCB 1MSHA 2LY7A 5C0XJ 4HIDA 3PMFA 2JQOA 1PH1A 3CXCA 4HJ9A 1DONA 1HTLD 1X3PA 1Q1EA 3HOXH 2KUMA 3EQLC 2N8NA 5IIFA 4H7BA 4L6TB 4RCNA 1TQOA 4X64L 1ZYRD 2MO0A 4DV6Q 4I7AA 2B2TA 2R92G 4PV1C 5EPKA 3STBD 1CQFA 1EU3A 1GXDC 3FKIG 1UAPA 2YTYA 4FXGC 1CSPA 4PMBA 2R7ZG 3M7GA 2XRQD 5IP9G 4A3LH 3L9AX 4C3IH 1FNWA 2G5DA 2E2IB 1XTCD 4K6DA 2O4XA 5IYCG 3MFGA 2JA7B 3DUZA 4UP7A 4I7ZC 4K5VA 1OXSC 1BBUA 2VUMB 3NSWA 4RKLA 1Y69U 1TWFH 3CU7A 4GNXC 2DNCA 4LF4L 3NENA 1N32Q 1LTGD 5A35A 1X55A 4ZUJA 1JQYD 5LMNL 3TP8A 2JYOA 1A3TA 1PTOC 3FHWA 1SBBB 5IYDH 1SE3A 2ZM6L 1LYLA 4L5TA 4DPGA 3TS0A 4DV2L 4JV5L 4AQYQ 2D5DA 1DOMA 3K7AH 5JOBA 2K32A 1Z47A 4ZAIA 1E2WA 4ULLA 1V8QA 3W5OA 4WRDA 1EIFA 3MXNB 4OEMB 4A93B 1VF5C 1GO3E 2BE5D 2WACA 5JJKA 3G6JB 4N9PA 2E5LL 3CP0A 4LNQA 2HCIA 5I4DA 2K03A 4HJAA 1LT5D 4IFDI 3S1NB 1RL2A 1BCPF 4MIUA 4YWKA 1XPOA 4IPHA 4DR5Q 3BJUA 3D4DA 3M4OB 3MFYA 2A1AA 1YITA 1SXTA 1TWCH 3PUZA 1SNDA 1QNUA 1IL2A 3OWEB 4IQZA 4A3GB 1EOTA 2B3GA 3BDLA 3NQTA 3Q0AA 5C3EG 3IFTA 1RHPA 2ENBA 4IUTA 2KHJA 5I9OA 1MBYA 1BNZA 1JE5A 2F0NA 5IP9H 3N52A 1CA5A 2R7ZH 5C4JH 2FHTA 1AH9A 4JI0Q 1TS5A 2IHEA 3MWYW 4IALA 1YVCA 5IYCH 1W6KA 4BY7G 2WV6D 3KBXA 2NVYH 3I4MB 2JK8A 4DR2Q 1O7IA 4Y52H 3VR6A 3IKJA 4C3JH
chains in the Genus database with same CATH topology
4CDCC 4OELB 1MHWC 4CDFC 2DJGC 2DJFC 4CDDC 1ICFB 4CDEC 1K3BC 4OEMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CDC C;  4OEL B;  1MHW C;  4CDF C;  2DJG C;  2DJF C;  4CDD C;  1ICF B;  4CDE C;  1K3B C;  4OEM B; 
#chains in the Genus database with same CATH topology
 1ESF A;  1B9M A;  4QUF A;  3E0E A;  3UI2 A;  4QUC A;  1K3B C;  4JI4 Q;  3HOX B;  5EGT A;  4DXF A;  4AYB B;  1TKW B;  2KEC A;  4LF7 Q;  2CWA A;  3QIA A;  1CQV A;  4RHS A;  4Q5V A;  2OF1 A;  4K2K A;  1D5M C;  3GTM H;  1PYS B;  2FMM A;  3CCJ A;  2F1M A;  4OWT B;  1Z9F A;  1G6P A;  4UDU C;  5C0X I;  3G71 A;  3MTS A;  2ZJQ A;  5CV6 A;  1VQL A;  1HR0 Q;  1K3R A;  1G2S A;  1NCV A;  4F87 A;  1GUS A;  2MUY A;  1LTS D;  5DNF A;  1A2U A;  4RGT A;  1C4Q A;  1U0L A;  1IKL A;  3NBH B;  1SRO A;  1YNN C;  4C3I B;  1EU4 A;  5EKI A;  5E4W C;  3DM3 A;  1STG A;  3W3A A;  1AE3 A;  1EWI A;  4DR5 L;  2UXB L;  2X6L A;  4DUZ Q;  4QCL A;  2HIX A;  1P8L A;  3I72 A;  3NK9 A;  4BBR G;  1HR0 W;  5JPM C;  5K36 H;  1CKN B;  1NJI C;  5KYL A;  1STN A;  4UAI A;  1WD0 A;  5D14 A;  2D0P A;  1JB7 A;  3HS0 C;  1I94 Q;  3CRK C;  4A4I A;  3Q23 A;  1QUQ A;  2F0K A;  3A8J E;  2NZ1 D;  3P1H A;  2L1B A;  4A3K G;  1ENF A;  1NE3 A;  2RKS A;  1EL0 A;  3F2C A;  1F2M A;  4DV1 Q;  2KEN A;  3VR3 A;  5I6Y A;  1DM0 B;  5C3E H;  2JA9 A;  5TSS A;  4G7H C;  4ZKC B;  2F0U A;  4IOA A;  1PRT D;  2Z6K C;  3S16 H;  4TQU S;  2PW7 A;  5FLM H;  3WDN A;  3EN2 A;  1WYD A;  3T51 B;  3MC0 B;  3IFD A;  1TY0 A;  3CHB D;  2F3W A;  5KYI A;  3AEV A;  3C1F A;  5HUR A;  1WI5 A;  5JEA G;  4A3D H;  4JI1 Q;  1XNQ Q;  1XWE A;  2EE1 A;  3NTH A;  4M8A A;  3K6O A;  1R9T H;  4N8F A;  1IBK Q;  2GVA A;  3ULJ A;  4L8J A;  5C3X A;  4DAV A;  2AKW B;  1CKM A;  5FO9 B;  2DN8 A;  3K80 C;  1GD7 A;  1TWC B;  3HKS A;  3S14 H;  4LAA A;  1NR4 A;  1E24 A;  1OXV A;  1XNR L;  4NDX A;  2R92 B;  3S24 A;  1FD7 D;  1KHI A;  3OTO Q;  2NVX B;  4HIM A;  3VA7 A;  4HCE A;  3MAQ A;  1JE4 A;  2WB1 G;  3K0Y A;  2BH2 A;  2N78 A;  1U4M A;  2NN6 I;  4OGQ C;  1F2L A;  3FKI B;  2XWJ B;  5ISR A;  3PIO 3;  1S4Z A;  5BR8 L;  2UU9 Q;  2R7Z B;  2K33 A;  1CFM A;  5D65 A;  5C4J B;  4RMF A;  4LF8 L;  1CHQ D;  2XWB B;  4KV6 A;  2ZTE A;  4YY3 L;  1Q90 A;  1AE2 A;  4GN4 B;  3TRZ A;  2F4I A;  4IUP A;  1P16 A;  3SK8 A;  2HDL A;  5CR3 A;  4EQP A;  1BO0 A;  4DV0 Q;  1HXY D;  4BBR H;  2B2T C;  5COR A;  3IRB A;  4RHR A;  1UE1 A;  1A3U A;  1MSG A;  2RVL A;  2YTV A;  1JJG A;  4JYA Q;  3M85 A;  2OWO A;  2L11 A;  2PMZ B;  4KN7 C;  1G2T A;  2MGS A;  3S2H B;  1TWH B;  4IUR A;  2EYH A;  3CCQ A;  3GTM B;  3OSO A;  4XYO A;  1F9R A;  2A6H D;  3DWP A;  3HOW G;  2A6E D;  3J80 i;  1TII D;  2F4V Q;  2RQX A;  2K5N A;  3TRE A;  1S72 A;  3RD4 A;  4KI0 A;  4X65 Q;  3CCL A;  3R2I A;  2B63 G;  4DR1 Q;  2E2H H;  1VQK A;  2CW0 D;  1Q12 A;  1WVL A;  2NZO A;  1X6O A;  3I7F A;  3J81 L;  1VQ8 A;  1BCP B;  1XNQ L;  3U4Z A;  4FYD A;  5J3B A;  3S9W A;  2R3Z A;  1G8Z D;  4RKB A;  4JI5 Q;  1Q8I A;  1UWV A;  5GQO A;  2K7V A;  2E2J H;  2VB2 X;  4NMZ A;  4KK7 A;  2CWP A;  1SR3 A;  1KLU D;  1RDP D;  1LTR D;  2C5C A;  2PZT A;  4XTC S;  3NTK A;  1W6J A;  3K5L A;  3I70 A;  4AYB E;  3GTO B;  3F2B A;  4DR7 Q;  1KDA A;  2MO1 A;  2YYZ A;  1LLR D;  2N88 A;  4KTA A;  4C2M B;  1B3Q A;  3I56 A;  5C3E B;  4OO1 H;  1DGS A;  1UUP A;  1JIC A;  2Y0S G;  3TP7 A;  5IGG A;  3UDX A;  5IGB A;  3S16 B;  4ID6 A;  3SR1 A;  2LXK A;  4BY7 B;  2NVT B;  4YWM A;  5FLX E;  1XX8 A;  1O7Z A;  2EYM A;  1MIU A;  4CKC A;  2K5D A;  4LUV A;  1KQS A;  1STB A;  4JBK A;  5CV4 A;  3PV0 A;  3ZJY C;  1XXG A;  1AZP A;  1R9T B;  5FJ8 H;  4O0A A;  4H0L C;  4R4C A;  3CC4 A;  3KYH C;  1BQQ T;  2B2V A;  1Y1V G;  2I5L X;  3H3V H;  1G29 1;  5KGU A;  2I0Q A;  1JC7 A;  2GA4 B;  1R4Q B;  4QY7 A;  1Y8O B;  2PI2 A;  1PH8 A;  3S14 B;  2OTJ A;  4FXD A;  1E1O A;  3K5N A;  1HH2 P;  1IBM Q;  4PZ6 A;  2A68 D;  3HOW H;  1N33 L;  3V96 A;  1X32 A;  4DV4 L;  3TS2 A;  3SEB A;  2B63 H;  4K8J A;  4C3H G;  3J7Y W;  1K9M C;  2KHS A;  1S5E D;  4IPG A;  2A5H A;  2UUC Q;  2VUM G;  1GUW A;  4R4O A;  4BA1 I;  2VQE Q;  1EY5 A;  1HNW Q;  3GP7 A;  4LFC L;  4NXN Q;  4GKK Q;  2PQA A;  4BBR B;  4POF A;  4ZQ3 A;  1EEF D;  2Z1C A;  1V1P A;  5DM7 3;  3W1B A;  2C35 B;  1XPR A;  2CVR A;  5IP7 G;  4LF9 L;  4A3K B;  5K5P A;  1I3Q B;  1HNX Q;  1CT1 D;  2UUA Q;  1JWS D;  1PTO F;  1W3S A;  1SE2 A;  1F2Y A;  2M00 A;  5J1Z A;  3BS1 A;  2E2H B;  4A76 A;  1VS0 A;  5EPJ A;  1TU2 B;  2QA4 A;  4H44 C;  3KFU A;  4DF7 A;  3V2T A;  1A2T A;  4JI8 L;  1YJW A;  1EIH A;  2DNE A;  3HOU G;  1GUG A;  1U4P A;  3NPP A;  1PH9 A;  1KRT A;  4PG3 A;  1HNZ Q;  2E2J B;  5AFW A;  1J5E Q;  1XTD A;  1Y1V H;  4HMJ A;  4HIK A;  1HQM C;  4B08 A;  4OX9 L;  1GHJ A;  3WWV A;  2F52 A;  3P75 A;  5C4X G;  2EPB A;  3Q24 A;  2Q2I A;  4F88 A;  1EY0 A;  4QIW E;  5DLQ E;  3K57 A;  1VF7 A;  3AU7 A;  2WB1 B;  3DHQ A;  4EGV A;  1YJN A;  2ATW A;  1YHB A;  1GJX A;  1L0X B;  1RF2 D;  1QWY A;  1YBY A;  2V1C C;  2VW9 A;  1E3P A;  3QB3 A;  4JI7 L;  1WTR A;  1WTV A;  2JA7 H;  5LL6 S;  1GVP A;  4RGN A;  3UE1 A;  2VUM H;  2B2U A;  1HNW L;  4HAE A;  1CI3 M;  2ZXP A;  4GKK L;  1MKH A;  3VYR A;  2ES2 A;  3OYY A;  4IZ8 A;  1B4O A;  3DMU A;  4FF3 A;  1PLF A;  4XYQ A;  1I6H H;  1FGU A;  3DLL A;  4UHV A;  4EQO A;  2N49 A;  1WCM G;  4JCV E;  4IFD J;  2V4D A;  3J80 L;  4HR7 B;  1JOQ A;  1X65 A;  1ZEQ X;  2QDB A;  3KUP A;  2WAQ B;  1PTO H;  2MP1 A;  2NUC A;  5BN5 A;  4DV3 Q;  1KC8 C;  1X9N A;  3HOW B;  1SMY C;  2B39 A;  2B8G A;  4A93 H;  1C7Y A;  1IBL L;  2B63 B;  3GDE A;  2JE6 I;  1VQN A;  1DD2 A;  1H9R A;  3K0X A;  3CMA A;  4JI3 Q;  2DY8 A;  3NWS A;  3WOF A;  1DOL A;  3A55 A;  4ME3 A;  4DR3 Q;  3KK7 A;  3GV3 A;  5FO7 B;  4B3T L;  1KNA A;  5KND A;  2IX0 A;  3AB9 A;  3IAY A;  4P72 A;  1XPU A;  2ZXR A;  4A3B G;  3AYH B;  4KKU A;  5NUC A;  2KCT A;  3ZYY X;  4P74 A;  4EQN A;  3KJP A;  5C4X H;  2IHF A;  4A3C G;  4K6L A;  3H6M A;  2QEX A;  4X3K A;  2WFW A;  3RN5 A;  2E75 C;  1IKM A;  3HFZ B;  4G7O C;  2RSO A;  2B2W A;  1X3Q A;  1I4H A;  1NBW A;  1YNJ D;  2DY7 A;  3AQQ A;  4RH6 A;  2Y0S B;  4KHZ A;  3CME A;  1H95 A;  1BUV T;  5IGF A;  3T13 A;  2XVS A;  2PYK A;  4BBS G;  3MHB A;  2EYJ A;  4NXM Q;  2MNA A;  4KKT A;  3OW2 A;  1VQJ A;  2EYF A;  3F1Z A;  3E9H A;  1O80 A;  3AFQ A;  1ASZ A;  4JI6 L;  3NUC A;  4WJ3 M;  1SN8 A;  2KCC A;  2HQL A;  1PVO A;  2IPK D;  2D9U A;  5C44 G;  4GKJ Q;  1L1O A;  2E74 C;  1VMC A;  1LT3 D;  1U5K A;  3EIV A;  1Y1V B;  4GOP B;  3FMC A;  5KIX A;  4FVM A;  2RHS B;  2HT1 A;  5JAV A;  1YEZ A;  2BH8 A;  1M4V A;  4XIG S;  1VQA A;  3OPO A;  1A15 A;  3KLS X;  1B3A A;  5CGK A;  5KRU A;  4JOI A;  2XSC A;  2JN4 A;  3C1E A;  1VQ7 A;  4KN4 C;  1PYW D;  3T1H Q;  4C3H B;  1VQG A;  2EY5 A;  4U67 3;  2EJM A;  3EA6 A;  2IJ0 A;  4N8X 1;  3RZD H;  5I2X A;  4DUY Q;  2B2V C;  3RLN A;  5EQ0 A;  1RIP A;  5CV9 A;  4OWX B;  1G91 A;  3JC6 6;  4HSP A;  2PCF B;  3J81 j;  4EQ5 A;  5IYB G;  3L2P A;  4DK1 A;  1Q3L A;  1V1O A;  1LUZ A;  3DEP A;  1I6H B;  1Y1W G;  3OHX C;  3LNN A;  1IYJ B;  5EKL A;  4A3B H;  2I46 A;  4GNX B;  2B2Y A;  4X62 Q;  2YU9 H;  4A3C H;  5BN3 A;  2RF4 A;  1PTO B;  4KHV A;  1GUT A;  4OXP A;  3G4S A;  1E1T A;  2QDL A;  3T16 A;  3CCS A;  2WB1 E;  3ERO A;  1FVI A;  3V05 A;  1IZ6 A;  4F7X A;  5M3M G;  4GN3 B;  3UE0 A;  1YNN D;  4BBS H;  5JJL A;  4OON A;  3MEH A;  5FK9 C;  1GUO A;  4PMC A;  5CV5 A;  4X66 Q;  4LFA Q;  3J81 i;  3HOU B;  5FLX c;  1N36 Q;  1QCB D;  4HSV A;  4YIJ A;  4NPS A;  3HKZ G;  3K5O A;  3G7L A;  2EXZ A;  1V1P B;  3TEH B;  5H1S E;  3RMH A;  3JAM E;  3SK4 A;  4DV6 L;  3RLO A;  2FIN B;  1EQR A;  3CRL C;  4DV5 Q;  1GOZ A;  5C4X B;  2R92 H;  4QJF A;  1NNX A;  3NEL A;  5JVG 3;  5EJW A;  2NVX H;  3T1H L;  1IYV A;  3G48 A;  2DUD A;  4CDE C;  3FKI H;  2NTS A;  1VQF A;  5JJI A;  1C9O A;  1UE6 A;  1RKN A;  1GUN A;  3K81 C;  1S3O A;  3TN2 A;  5IGC A;  1I4P A;  1ZYR C;  2KBN A;  2RCF A;  2K75 A;  5D3D A;  2EOT A;  1N32 L;  3J7Z C;  4C56 C;  3SE0 A;  1I4R A;  5IYB H;  1JOK A;  1SRU A;  4XDX A;  5I2Y A;  1E2Z A;  1S5C D;  5DEH A;  1PZJ D;  4DK3 C;  5I6W A;  3I4O A;  1Y1W H;  4A3I G;  4AQY L;  4X62 L;  1WCM B;  2L0C A;  1Q81 C;  3ERQ A;  1K0S A;  1HQR D;  4ODG A;  3S2H H;  1WFQ A;  1TWH H;  3J7A V;  2ICE C;  3S1M H;  3NTI A;  1F77 A;  1JR0 D;  4J6H A;  4N9T A;  3FPP A;  4DR6 Q;  2B2U C;  3SDZ A;  2NVQ H;  3FRP B;  4MTK A;  2Y0S E;  5M3M H;  1KNE A;  2JP1 A;  4O1N A;  4KJO A;  4G4K A;  4GZY C;  3LWE A;  3RZD B;  3KBG A;  1KIX A;  4X66 L;  2X69 A;  4DAY A;  4P71 A;  4LUO A;  4C1N I;  5D3I B;  3TME A;  3CCU A;  4B3R Q;  1S5D D;  2BE5 C;  2RDF A;  4KD4 A;  2CQO A;  3A74 A;  1K83 H;  1PZK D;  1YNX A;  1RCV D;  2D62 A;  2M2L A;  4HN7 A;  4DR4 Q;  2QW7 A;  3KJO A;  4A3B B;  1QB5 D;  2SNM A;  3GTO H;  3BZC A;  2CHB D;  3SVM A;  1SEB D;  3R2T A;  4A3E G;  2YU9 B;  5J39 A;  4PZ8 A;  2VQF Q;  4JW0 A;  4C2M H;  1SMX A;  1OXX K;  3E6Z X;  1BCP D;  1EZ8 A;  4DA2 A;  5ELB A;  5T1G A;  2JA8 G;  2F0I A;  4JI0 L;  2UXC Q;  1UEB A;  5ELE A;  1O7Y A;  4AH6 A;  1WOC A;  3SXH A;  2F0T A;  4UP9 A;  2F0L A;  2AHO B;  1KDB A;  4TKO B;  4DR2 L;  1WTO A;  4BY7 H;  4BBS B;  3R3O A;  2NVT H;  1T5E A;  3AMU A;  3HOV G;  3S15 B;  5DM6 3;  1K8M A;  4L5R C;  3Q6S A;  1LTL A;  3D6W A;  2MFI A;  3K8A A;  2WII B;  4XT3 B;  1L0W A;  2I5H A;  2R7D A;  4K5W A;  1AN8 A;  4FDB A;  4JI4 L;  1I4G A;  1B70 B;  5C44 B;  3GTP H;  3QJY A;  1F9P A;  3DWQ A;  3T4A C;  4DV7 Q;  2CFM A;  2XRS D;  4A3I H;  2TSS A;  4LF7 L;  3RZO B;  1VQD A;  1KRS A;  4LF6 Q;  1H9J A;  3EJI A;  2B2W C;  2O5J C;  5ELD A;  1GHK A;  4HMI A;  2WKC A;  3EVQ A;  3PSI A;  1D8L A;  4RFB A;  3L7Z C;  4GS3 A;  1FJG Q;  3I2Z A;  1T5X D;  1IL8 A;  1EYD A;  2D0O A;  2FMC A;  1EYA A;  1LAC A;  2CH4 A;  2VL6 A;  1HR0 L;  4J8Q A;  1CK1 A;  1A0I A;  1S40 A;  3CD6 A;  1JMC A;  4ILW A;  5A2Q E;  4FO2 A;  3U50 C;  4WJ4 A;  5KEE A;  2K50 A;  1CTM A;  1FL0 A;  4CJ0 B;  1UEA B;  4JBJ A;  4LK1 C;  1F2Z A;  2EXD A;  4DUZ L;  1SYB A;  4O42 A;  2Q2H A;  5FO8 B;  1B7Y B;  2LSS A;  4RAU C;  1Y1W B;  1I94 L;  4MHE A;  2QKI C;  4JOI C;  4U68 A;  4P2C B;  1I4Q A;  4R4I A;  4F8M A;  2VQF L;  4A3K H;  4DV1 L;  4A3E H;  4B3M Q;  2WAQ G;  4DNI A;  3BYT B;  1I3Q H;  3S1M B;  2J7Z A;  1RD9 D;  2F3V A;  3BYY B;  1UE7 A;  5BN4 A;  2JA8 H;  1HUN A;  4R8N A;  3C46 A;  2NVQ B;  2SDF A;  5M3M B;  2KEE A;  2RCN A;  4H13 C;  3KF8 A;  4OL7 A;  4JI1 L;  1Q1B A;  4IUV A;  4KD3 A;  5M9O A;  2ZTD A;  2E76 C;  5JEA H;  3CPF A;  1NSN S;  2TMP A;  1IBK L;  1Y8P B;  2B2Y C;  3FP9 A;  4UP8 A;  1PFM A;  3QO2 A;  5T1I A;  1EQQ A;  3A56 A;  2NZH A;  2BDO A;  5L37 A;  5E3F A;  4A3M G;  1LT6 D;  3OW7 A;  1PRT C;  4OWW B;  1K83 B;  4LUZ A;  3HKZ B;  5EAY A;  3RLF A;  1EOV A;  1U4L A;  5G3L F;  2A73 B;  2K5Q A;  3OTO L;  4YHH Q;  1I50 B;  3BVM A;  1YJ9 A;  4IFD G;  4GLA C;  4DNT B;  3PO2 G;  1STA A;  2QIL A;  2UU9 L;  3LX0 A;  3OWF A;  4PZ7 A;  3AFP A;  2PNR C;  4NP5 A;  4K0K Q;  2BDN A;  2K5V A;  3H91 A;  3Q8D A;  3Q22 A;  4RCO A;  1Z6H A;  1ML0 D;  2DJF C;  4TVA B;  1WTQ A;  2HHH Q;  1UE5 A;  1E2V A;  1SNQ A;  1D6E C;  2RHQ B;  3FVQ A;  1SDF A;  2KHI A;  5IT9 L;  4DV0 L;  1SSO A;  2AQ1 B;  1XMQ Q;  2LXJ A;  3TZD A;  2X6G A;  2EJG C;  2L4N A;  3ULP A;  3GTP B;  4JYA L;  3NHH A;  4A3I B;  1PDQ A;  5LHY 1;  1ZKO A;  3A8K E;  5IE8 A;  2CH4 W;  1VQ9 A;  2PW5 A;  4L5Q A;  2NWG A;  5IWA Q;  1M1K C;  2D2C C;  2F4V L;  4X65 L;  4NB3 A;  4X3S A;  5AJ3 Q;  4DR1 L;  2O2L D;  3CC7 A;  1H9K A;  3ND8 A;  1OO9 B;  2JJQ A;  4XQQ A;  1A63 A;  3F8T A;  3T53 B;  1IHZ A;  5C5M A;  1HFG A;  1JJ2 A;  1EY9 A;  1KL9 A;  2WP8 J;  1ICF B;  1CZG A;  3CC2 A;  2R7F A;  1YIJ A;  1K8G A;  4B9W A;  4JI5 L;  4IUU A;  2ID0 A;  4BY1 G;  1CUK A;  1SYD A;  2A6H C;  2AMC B;  4P75 A;  1X54 A;  3MXN A;  5C0X G;  3EBE A;  1TWA H;  4A3M H;  3G6E A;  3D31 A;  2CW0 C;  5C5L A;  4DR7 L;  3PUY A;  1VQM A;  5E4X A;  3S1Q H;  2XTI A;  2EIF A;  5C4H A;  1CHP D;  4A3E B;  3S17 H;  1C48 A;  1QOH A;  4IFD H;  1K8A C;  3JAM c;  3PO2 H;  3D0F A;  1SYE A;  4KJN A;  1Q86 C;  4LW1 A;  1AFP A;  2JA8 B;  2C9O A;  4KMU C;  3X3N A;  1LAB A;  2F0G A;  1STE A;  1EEI D;  2SNS A;  3HEJ A;  5CMD A;  4XQN A;  1Y8N B;  3CCR A;  2GVB A;  1TS4 A;  3HOV B;  4JK1 C;  3GTG B;  4LF5 Q;  2H1E A;  4B3S Q;  1C0A A;  4A75 A;  1SJE D;  5M5X H;  4NW2 A;  4KHP Q;  1II3 A;  4OIK A;  4PMW A;  2QCP X;  1U4R A;  3H0G G;  4PQX A;  1B53 A;  1DJR D;  1SNO A;  1XMO Q;  3N6R A;  1IBM L;  3BVZ A;  4KY6 A;  3CCE A;  4IO9 A;  3J7A 5;  2PMZ E;  1RTN A;  1QUQ B;  3IL8 A;  5M5W B;  3TP5 A;  2OEO A;  3K5M A;  2EJF C;  4FXK C;  4KY7 A;  1KXL A;  4ME5 A;  4DAP A;  2B29 A;  4X3T A;  1X3E A;  1QE6 A;  4IUN A;  2Z9H A;  1EQV A;  4C3H H;  3X3M A;  2AWN A;  1N34 Q;  3BDC A;  2F0F A;  2UUC L;  1BBW A;  1B9N A;  1ET6 A;  4HCS A;  4CDC C;  1EIG A;  2VQE L;  2JA5 G;  2NYZ D;  1SYF A;  4BY1 H;  1EUJ A;  4NXN L;  1NR2 A;  2A68 C;  3RR5 A;  1QNK A;  1LV9 A;  1EWC A;  5EBC A;  5C0X H;  2ICI A;  1NMG A;  2NN6 G;  1AW7 A;  4HJ7 A;  4YCW A;  3D3R A;  2ZTC A;  2NBF A;  3NBH A;  3HKZ E;  4K8I A;  4UY8 C;  2PNH A;  5IP7 H;  2XGT A;  3KF6 A;  4E6I A;  3K58 A;  1HNX L;  4XXE A;  2UUA L;  2FFK B;  2KCM A;  3GTQ B;  1N8R C;  2VY3 A;  1EY8 A;  1CKN A;  2CCZ A;  4R1J A;  1E7Z A;  4K5X A;  4KY5 A;  1QZH A;  2K01 A;  2VS1 A;  1AP0 A;  4B3S L;  1MD2 D;  2F0J A;  3M4P A;  4X64 Q;  4X3U A;  1VQE A;  3K59 A;  1HNZ L;  3HOU H;  1PMR A;  3E3X A;  3MZ5 A;  4K14 A;  4B9X A;  1J5E L;  1V43 A;  5CV8 A;  1CKO A;  4JPB W;  1KLG D;  1TWA B;  4A3M B;  3H0G H;  1KAA A;  4GLV B;  4R8I A;  1BDO A;  1PTO D;  1ASY A;  4CDF C;  4JBM A;  4A3L G;  5KNC A;  1EQT A;  1E22 A;  5C4Z A;  3S1Q B;  1VMP A;  2ZJP A;  3S17 B;  1BVS A;  1W2B A;  1WTH A;  3SHL A;  3PO2 B;  5EBD A;  2MHV A;  3CPW A;  1IW7 C;  1WTX A;  4LF4 Q;  3J81 E;  2KJX A;  3HOZ G;  3ULL A;  5LMN Q;  1ICW A;  3VR4 A;  2A69 C;  5ELC A;  3NEM A;  1ENC A;  2ZM6 Q;  2JA5 H;  4DV2 Q;  4JV5 Q;  1U9R A;  4X6A H;  3S2D H;  4MZ9 A;  4DGZ A;  2NB0 A;  5M5X B;  2NN6 H;  3T56 B;  4IN3 A;  3I8Z A;  2AWO A;  2HUG A;  5LMN W;  1VQ4 A;  1SLJ A;  1WCM H;  2H4O A;  2WKD A;  4J15 A;  4Q0F A;  1WTW A;  2K4K A;  2IT1 A;  5CYU A;  2E5L Q;  4DV3 L;  1EY6 A;  3BZD B;  1Q8K A;  1KDC A;  1PYB A;  1QVC A;  4IPC A;  1SNP A;  2VB3 X;  3VA5 A;  4OO1 I;  2EY6 A;  3NP8 A;  4XQJ A;  1UNS A;  4JI3 L;  1HHV A;  5GAE C;  1DXM A;  2N55 A;  4R9W A;  3SK6 A;  5IT9 E;  4DR3 L;  3M3Y H;  5E1F A;  2R6G A;  3F2U A;  1ILP A;  1QG7 A;  4BY1 B;  3OOC A;  3CKI B;  2EYO A;  2HQE A;  1CSQ A;  4ZRZ A;  4A3J G;  1Y14 B;  2KVM A;  2E8G A;  4M1U B;  1I4X A;  3H3V I;  4ZLT F;  2DGY A;  3P7J A;  1HZ9 A;  2KQ3 A;  1HFN A;  3KDF A;  4CHT B;  2L5T A;  3BVG A;  2O5I C;  1S5B D;  1SNM A;  4C3J G;  1ET9 A;  1YI2 A;  2B8F A;  1V1Q A;  3H94 A;  4G57 A;  2SEB D;  3I90 A;  3S1R H;  3A5U A;  3HOZ H;  1DCZ A;  3RNU A;  3H15 A;  3OMG A;  4NXM L;  2LFN A;  1TT2 A;  3DXJ C;  3A7A B;  2RDG A;  2LS0 1;  2AUJ D;  1A62 A;  1VQO A;  3S15 H;  2SOB A;  4WJW A;  5JJZ A;  5FKA C;  1A8V A;  5EKK A;  4EX5 A;  3MXG A;  1PFN A;  2Z4I A;  1VQP A;  4GKJ L;  4WFN 3;  1EIY B;  5C44 H;  1YNJ C;  2PQA B;  1PH3 A;  3RZO H;  3H0G B;  4CJ2 C;  1XYI A;  3CW2 C;  2JEB I;  3CCM A;  3PQI A;  1D1K A;  3TDQ A;  3PUX A;  4DAM A;  5IGE A;  1X3F A;  2Z4H A;  2IW3 A;  3L3O C;  5CBE E;  2F0Q A;  5COY A;  2WAQ E;  1STY A;  3H09 A;  2IX3 A;  4FF1 A;  5LL6 X;  5FLX L;  1PRT F;  3CQZ H;  1G51 A;  4JC0 A;  2UXB Q;  2K5H A;  1SNC A;  5K36 G;  4FP5 D;  2XIW A;  4DN4 M;  4CGY B;  4DUY L;  2VZA A;  2ALY B;  4LFB Q;  2EZV A;  2JA5 B;  2OTL A;  4P73 A;  5ELO A;  1J8I A;  2HIV A;  3STB C;  2RDH A;  2XN9 C;  3GD7 A;  3S2D B;  4A3J H;  1NY4 A;  3TZU A;  3D8G A;  3ICE A;  2QGQ A;  1FGB D;  1KAW A;  1MI2 A;  1PH7 A;  1JT8 A;  2RBM A;  1JOO A;  4RG1 A;  3R93 A;  3FPU B;  5FLM G;  4CJ1 B;  2F0O A;  4ABN A;  4PNY A;  1D5X C;  4RA8 A;  1EYC A;  3SGI A;  1OXT A;  4A3D G;  3I73 A;  3CF5 A;  1KTK A;  2A19 A;  4IJH A;  1MJC A;  1F9S A;  1TR5 A;  3KLS A;  3PUW A;  1STH A;  2BA1 A;  5JVH 3;  4OEL B;  3I4N G;  3GTL H;  4A3F G;  3M3Y B;  3L0O A;  4LWC A;  4LFA L;  3M7N A;  1N36 L;  4KLK A;  1AZQ A;  5J22 A;  1OTC A;  1XNR Q;  2MPM A;  3I91 A;  2FJ2 A;  1WTP A;  3MXP A;  1GKH A;  3MA2 B;  2PQE A;  2MQH A;  1KD1 C;  3J80 E;  2N3S A;  1B44 D;  1L0Y B;  2L55 A;  2I5M X;  4MNO A;  3HOY G;  5BR8 Q;  4DV5 L;  3OIP A;  4H02 A;  4I65 A;  3DWA A;  3M4Q A;  4BS9 A;  4LF8 Q;  4POG A;  1I50 H;  1LTT D;  3KF6 B;  2AUK A;  1QJO A;  4YY3 Q;  5M5Y H;  5IOC A;  3OIQ A;  4DK0 A;  1RJT A;  3HGB A;  2PZU A;  2F0H A;  1TWF B;  4DFA A;  3HP3 A;  4APV A;  3S1R B;  2GN5 A;  3HOZ B;  2P5Z X;  1E0B A;  2F0V A;  4QF4 A;  4LFB L;  1D7Q A;  1ROD A;  3PGZ A;  3GTK H;  4DXG A;  1LTI D;  3K7A B;  1ILQ A;  1FNV A;  3TP6 A;  2R93 G;  1DYQ A;  2Z6B A;  4O2D A;  3PIO A;  2F0S A;  3RUZ A;  3VR2 A;  3NWT A;  1HA6 A;  3QOL A;  5JPN C;  3JAM i;  2K5W A;  2BA0 A;  4JBW A;  1Z7T A;  3ER0 A;  1LM0 A;  1YHA A;  4L63 B;  4V0B A;  2F3I A;  1SE8 A;  2PI2 E;  5DAU A;  1BOS A;  4L5S A;  1NTG A;  1I5F A;  4DR6 L;  1IXR A;  3ONA B;  3QWN A;  2DJG C;  2F03 A;  4AIM A;  3GV6 A;  4FF2 A;  3CQZ B;  1BF4 A;  1NMF A;  1LTB D;  2EYP A;  2HD3 A;  1D5Z C;  3I4N H;  1BXT A;  1PV4 A;  4A3F H;  2CQA A;  1J6Q A;  2G9D A;  2EY1 A;  2KA7 A;  1VDZ A;  3CAM A;  3D4R A;  1YHQ A;  1L1O C;  3MXU A;  2JSO A;  1H9S A;  2OXP A;  2Z8L A;  3M4Y A;  1K28 A;  1T9H A;  4BXX G;  4CKE A;  5IY0 A;  2RSN A;  4B3R L;  3MVV A;  3VYT A;  4J1M A;  3NXW A;  3NE5 B;  1L1O B;  4DR4 L;  4A3J B;  2E2D C;  4OO1 G;  3PO3 G;  1VQC A;  1PH5 A;  1KAB A;  3HOY H;  4FNF A;  3C3L A;  5C3W A;  5LMU Q;  2EYL A;  1SE4 A;  4S3S A;  2A8V A;  1BBX C;  3GQB A;  1VQ6 A;  2LMC B;  2NVY B;  5ELF A;  2A74 C;  2EY2 A;  3KOJ A;  4C3J B;  2UXC L;  3BG3 A;  2K6A A;  2YV5 A;  5FJ8 G;  1VQ5 A;  2KED A;  3I4L A;  3MEF A;  1K8O A;  3TSS A;  3U4V A;  3NBI A;  3GTL B;  1X3G A;  2H5X A;  3J81 c;  4GN5 A;  2JA6 G;  1LO5 D;  1SYC A;  3HOV H;  3BU2 A;  3GTG H;  1HZB A;  2YTX A;  1M8A A;  1TS2 A;  4RGM A;  5IGD A;  2R93 H;  4QIW B;  3CCV A;  1PH4 A;  1X56 A;  4DV7 L;  1BCP C;  5IOD A;  2ASB A;  3A54 A;  2VNU D;  4LF6 L;  1HZA A;  1N33 Q;  4DV4 Q;  3OMC A;  3PIP A;  1LT4 D;  1HJP A;  3DEO A;  4ZK9 B;  4Y7N H;  1LTA D;  1FJG L;  1SYG A;  3KDF B;  5C6A A;  3DM1 A;  5M5W H;  4HIO A;  2F0P A;  1OXU A;  3BZK A;  3J7A F;  1MHW C;  4YCU A;  5M5Y B;  1PRT B;  1VQH A;  4EVO A;  2JEA I;  1CZW A;  1HCZ A;  2WIN B;  3RN2 A;  4LJZ C;  4HJ5 A;  1PXU A;  2M9V A;  4LFC Q;  1QVG A;  4DNR B;  4GOP A;  3VR5 A;  3GTK B;  3A8I E;  1VQI A;  1C8C A;  3GO5 A;  1L2F A;  4BXX H;  4QMG A;  5GAD C;  2Q8T A;  5IT9 c;  4LF9 Q;  1G6Z A;  3T1Y Q;  4DU9 A;  2F0D A;  1FNU A;  5CV7 A;  2K52 A;  1BKB A;  3R8B A;  3I55 A;  3PO3 H;  3PUV A;  5LMU L;  5M3F G;  3PIP 3;  3GTJ H;  4B3M L;  1QVF A;  5HGT A;  1MGS A;  4RWS C;  1S5F D;  1WD1 A;  2JXM B;  4A3D B;  2G9H D;  4JI8 Q;  4CBV A;  1NAP A;  3K7U C;  3GTQ H;  3I4N B;  1WJJ A;  4A3F B;  3HG9 A;  1PH2 A;  2BOS A;  1TWG H;  2OQ0 A;  2JA6 H;  4GNX A;  4HJ8 A;  4JG2 A;  1I6V C;  1M90 C;  3LGJ A;  1JWM D;  1SJH D;  4QGU A;  4ZKB B;  1CM9 A;  1PH6 A;  1HPC A;  3U58 A;  1MJE A;  4OX9 Q;  4WOR A;  2F0E A;  1R4P B;  2A6E C;  3B6Y A;  1SFO H;  1PHJ A;  2MJ8 A;  2J4X A;  2F0M A;  3QOJ A;  4NKL A;  3HRZ C;  2QF7 A;  4BA2 I;  1F9Q A;  2PPB C;  3HOY B;  2K1B A;  4YHH L;  1ENA A;  3M9B A;  5JEA J;  2UUB Q;  4ZCK A;  2JA7 G;  3D6C A;  4JI7 Q;  1GM5 A;  1HZC A;  1EZ6 A;  2ZJR A;  1EYG A;  3FDT A;  5F2D A;  1FYC A;  1HTP A;  4K0K L;  4G7Z C;  3KLW A;  1SMY D;  4HED A;  2Q8I B;  2Q2U A;  5FOB B;  3SK5 A;  4C1N K;  2EDG A;  1NUC A;  2HHH L;  4IUQ A;  2AQ2 B;  4BWG B;  1N9W A;  4DAY B;  2K05 A;  3UDF A;  3P20 A;  3T1Y L;  5G3L D;  1XMQ L;  2HDM A;  3JAM L;  3KLR A;  2R93 B;  1JCK B;  4LMQ D;  3W1G A;  3ND9 A;  4JVZ A;  2XNA C;  1EFW A;  4A93 G;  4QL5 A;  3ITP A;  4QB4 A;  1A3V A;  1Q82 C;  1IBL Q;  1ZXT A;  4K2L A;  5M3F H;  4Z9C B;  1D2B A;  1BR9 A;  1IYU A;  5IWA L;  4Y7N B;  3UDI A;  1ONL A;  1PZI D;  2Q2T A;  2L12 A;  1CA6 A;  5AJ3 L;  4GLX A;  2IWH A;  2QEJ C;  3E5S A;  1QZG A;  1PA6 A;  1ESR A;  2LKV A;  2KOL A;  4B3T Q;  1A6X A;  2BCO A;  1IW7 D;  2IL8 A;  4JI2 Q;  4IPD A;  5CC4 A;  1SAP A;  4ZUI A;  3NQI A;  3A0J A;  3F2D A;  3E9I A;  2UXD Q;  1EY4 A;  5GAH C;  2A69 D;  1O7L A;  3LWU A;  2PZW A;  1K73 C;  2NTT A;  4OHJ A;  4A3G G;  3TBI B;  3PCO B;  3A5Z B;  1B1Z A;  1PFS A;  5GAG C;  3VYU A;  1Q7Y C;  3HZX A;  4IOC A;  3I3C A;  3A7L A;  2K14 A;  2Q8R E;  2OQK A;  3PO3 B;  4HTH A;  3C2P A;  2UUB L;  2L15 A;  3W2D A;  3PF5 A;  2IY5 B;  2E2I H;  3GTJ B;  3ERS X;  4R4Q A;  3J80 c;  3I4M G;  3EFX D;  4CDD C;  4DKA C;  3H3V C;  4OIJ A;  5HGQ A;  1B2T A;  1HA5 A;  3U9S A;  4JI6 Q;  4RGO S;  3VDY A;  3QG1 A;  1VQB A;  3HOX G;  2K04 A;  2IX1 A;  1H9M A;  4YCV A;  2K28 A;  1TWG B;  5ELN A;  4AYB G;  2JA6 B;  1FR3 A;  4LF5 L;  1H9S B;  4UPA A;  1EWH A;  2ZXO A;  4ALP A;  4KHP L;  1Q46 A;  1QIL A;  4FF4 A;  1TY2 A;  1HUM A;  5HY6 A;  2I07 B;  1SFO B;  4R4T A;  2EVB A;  1XMO L;  2ZT9 C;  5EPL A;  3U9O A;  1O78 A;  4DK6 C;  1D1I A;  5KNB A;  3UDG A;  1VCI A;  3BDO A;  4YWL A;  4C3I G;  3O13 A;  2OCE A;  1TS3 A;  3PF4 A;  5GRO A;  1PFB A;  1EY7 A;  3S1N H;  1TXY A;  1HRJ A;  5I9P A;  1JB3 A;  2Z6K A;  4KKS A;  1K0R A;  4JI2 L;  1B8A A;  1N34 L;  2OT2 A;  3TQY A;  3QR8 A;  2AQ3 B;  2KCN A;  2UXD L;  1AEX A;  3M4O H;  1V9P A;  4XT1 B;  1EFI D;  3VYS A;  4MTN A;  5IYD G;  1RTO A;  3E0J A;  1JWU D;  2J0T D;  3FEW X;  3KF8 B;  2HCC A;  4QQB X;  4ZYS A;  2VXW A;  1JOR A;  4MN3 A;  4A3G H;  4TSS A;  2F0W A;  1J9O A;  3WOE A;  2RA4 A;  1YZ6 A;  2R61 A;  2PO4 A;  4TRD A;  1DOK A;  2CKZ B;  1DZ1 A;  2Z0S A;  4IJL A;  5M3F B;  4CKB A;  5CBA E;  2EQS A;  3D4W A;  2FXQ A;  1TVX A;  2L9H A;  5A2Q L;  5E7N A;  3URY A;  1XJV A;  3I4M H;  1B50 A;  4GOP C;  4V19 0;  1JJC B;  1MSH A;  2LY7 A;  5C0X J;  4HID A;  3PMF A;  2JQO A;  1PH1 A;  3CXC A;  4HJ9 A;  1DON A;  1HTL D;  1X3P A;  1Q1E A;  3HOX H;  2KUM A;  3EQL C;  2N8N A;  5IIF A;  4H7B A;  4L6T B;  4RCN A;  1TQO A;  4X64 L;  1ZYR D;  2MO0 A;  4DV6 Q;  4I7A A;  2B2T A;  2R92 G;  4PV1 C;  5EPK A;  3STB D;  1CQF A;  1EU3 A;  1GXD C;  3FKI G;  1UAP A;  2YTY A;  4FXG C;  1CSP A;  4PMB A;  2R7Z G;  3M7G A;  2XRQ D;  5IP9 G;  4A3L H;  3L9A X;  4C3I H;  1FNW A;  2G5D A;  2E2I B;  1XTC D;  4K6D A;  2O4X A;  5IYC G;  3MFG A;  2JA7 B;  3DUZ A;  4UP7 A;  4I7Z C;  4K5V A;  1OXS C;  1BBU A;  2VUM B;  3NSW A;  4RKL A;  1Y69 U;  1TWF H;  3CU7 A;  4GNX C;  2DNC A;  4LF4 L;  3NEN A;  1N32 Q;  1LTG D;  5A35 A;  1X55 A;  4ZUJ A;  1JQY D;  5LMN L;  3TP8 A;  2JYO A;  1A3T A;  1PTO C;  3FHW A;  1SBB B;  5IYD H;  1SE3 A;  2ZM6 L;  1LYL A;  4L5T A;  4DPG A;  3TS0 A;  4DV2 L;  4JV5 L;  4AQY Q;  2D5D A;  1DOM A;  3K7A H;  5JOB A;  2K32 A;  1Z47 A;  4ZAI A;  1E2W A;  4ULL A;  1V8Q A;  3W5O A;  4WRD A;  1EIF A;  3MXN B;  4OEM B;  4A93 B;  1VF5 C;  1GO3 E;  2BE5 D;  2WAC A;  5JJK A;  3G6J B;  4N9P A;  2E5L L;  3CP0 A;  4LNQ A;  2HCI A;  5I4D A;  2K03 A;  4HJA A;  1LT5 D;  4IFD I;  3S1N B;  1RL2 A;  1BCP F;  4MIU A;  4YWK A;  1XPO A;  4IPH A;  4DR5 Q;  3BJU A;  3D4D A;  3M4O B;  3MFY A;  2A1A A;  1YIT A;  1SXT A;  1TWC H;  3PUZ A;  1SND A;  1QNU A;  1IL2 A;  3OWE B;  4IQZ A;  4A3G B;  1EOT A;  2B3G A;  3BDL A;  3NQT A;  3Q0A A;  5C3E G;  3IFT A;  1RHP A;  2ENB A;  4IUT A;  2KHJ A;  5I9O A;  1MBY A;  1BNZ A;  1JE5 A;  2F0N A;  5IP9 H;  3N52 A;  1CA5 A;  2R7Z H;  5C4J H;  2FHT A;  1AH9 A;  4JI0 Q;  1TS5 A;  2IHE A;  3MWY W;  4IAL A;  1YVC A;  5IYC H;  1W6K A;  4BY7 G;  2WV6 D;  3KBX A;  2NVY H;  3I4M B;  2JK8 A;  4DR2 Q;  1O7I A;  4Y52 H;  3VR6 A;  3IKJ A;  4C3J H; 
#chains in the Genus database with same CATH homology
 4CDC C;  4OEL B;  1MHW C;  4CDF C;  2DJG C;  2DJF C;  4CDD C;  1ICF B;  4CDE C;  1K3B C;  4OEM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...