1C4QA

Mutated shiga-like toxin b subunit (f30a/w34a) complexed with receptor gb3 analogue
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
69
structure length
69
Chain Sequence
b'TPDCVTGKVEYTKYNDDDTFTVKVGDKELATNRANLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (SHIGA-LIKE TOXIN I SUBUNIT B)
publication title Identification of the Primary Receptor Binding Site of Shiga-Like Toxin B Subunits: Structures of Mutated Shiga-Like Toxin I B-Pentamer with and without Bound Carbohydrate
rcsb
source organism Escherichia coli
molecule tags Toxin
total genus 16
structure length 69
sequence length 69
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 1999-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1c4qA00
4ULLA 1QOHA 1CQFA 4P2CB 1C48A 1CZWA 4M1UB 1D1IA 1QNUA 2GA4B 3MXGA 2BOSA 1D1KA 1R4PB 1C4QA 1BOSA 2XSCA 1R4QB 1CZGA 1DM0B 2C5CA
chains in the Genus database with same CATH superfamily
1JOKA 2KCMA 4IJLA 2A74C 2BE5C 2B8GA 4ILWA 2AUKA 2AMCB 3MEHA 1F2LA 3K80C 1IYVA 1KXLA 4POGA 1TS4A 4YWKA 2Q8TA 1K83B 4CJ2C 5K5PA 1Z7TA 1C0AA 2EYHA 4LF7L 3H3VC 1A6XA 1EQVA 2EYMA 2PQEA 1X32A 4DR3Q 1V9PA 4A93G 1LTTD 1U4MA 3HS0C 4BY1B 5LMNW 4OX9Q 3HOVG 1KDCA 2N3SA 5GAGC 5C3EG 4OEMB 3C1EA 5IGFA 2I5MX 3PUWA 4MHEA 4ABNA 3RNUA 4LF6Q 2J4XA 4C3JG 1PRTC 1Z6HA 2FXQA 1N32L 1NMGA 1Y1VB 1PTOD 1GD7A 5F2DA 4O1NA 2PCFB 5IT9L 1CHPD 1S5FD 2D62A 4BA2I 4QIWE 2K6AA 5AFWA 4OO1G 2NN6H 1VF5C 1VQHA 2EY1A 3SE0A 1O7ZA 1E22A 3K7AB 2E8GA 3V05A 3PIP3 4JI3L 4EVOA 1EUJA 4X66L 2IX3A 3VDYA 4JI6L 2L0CA 2PW7A 1SE2A 1XNRQ 1KIXA 4QGUA 3DHQA 4YY3L 4A3BG 1YHQA 5DAUA 4DV0Q 1SYFA 2BA1A 4DR6L 1SNQA 4HEDA 4JBMA 1ESRA 3R8BA 3J80L 1WOCA 5HURA 5FLXL 5D3IB 5M5WH 2Y0SB 1J5EL 1WI5A 2EYOA 2KEDA 3KDFB 4HAEA 1Q90A 3CRLC 1JB3A 1R9TB 1SYCA 4LW1A 4G4KA 2L1BA 3OYYA 4LFAQ 2WV6D 1RKNA 3SVMA 5CV8A 1TU2B 1OXUA 4LF9Q 3A8IE 2F0PA 3ERQA 3P7JA 1YNXA 2D9UA 2MHVA 1XX8A 4GOPA 3NENA 3E0EA 3M4OH 4IPGA 1PFMA 1TWHH 4Z9CB 4A3MB 1N8RC 3GTQB 4BBSB 3L3OC 5IP9G 1EY0A 1PFNA 1VQGA 4K0KL 1HHVA 1IL2A 1STHA 1N34L 2A68D 1JT8A 1DCZA 2RDGA 2K75A 2CHBD 2DJFC 4KKTA 3U50C 1AP0A 1Y8OB 2QKIC 1FGBD 3NELA 2VUMG 5G3LD 4HMJA 4X64Q 3ERSX 1XTDA 1PFSA 4LF8Q 1DJRD 1DOLA 4NB3A 2Z6KA 3S1QH 4ZQ3A 4WJ4A 3MFGA 3GV3A 4ZKBB 2MUYA 1PVOA 1KHIA 1XXGA 1J9OA 3CPWA 1DM0B 4AQYQ 1STGA 4HCEA 3VR6A 1J8IA 3RD4A 1E24A 1SJED 2AQ1B 2F3WA 3ULJA 1X9NA 1K8AC 1K28A 5AJ3L 2R92B 4MNOA 1JJ2A 3N52A 1F9SA 1QWYA 2F4IA 3TP7A 1CKNB 5CBEE 2JSOA 1WJJA 2VQEL 1PYBA 1WTOA 3S2DH 3NP8A 3A8KE 4JOIA 2BCOA 4IJHA 3FKIB 4X3TA 5C4XH 4CKCA 3NEMA 1JQYD 1LT4D 1D5MC 1HNZQ 2JA5H 3WOFA 3PUYA 1EFID 5EBCA 3A5UA 2D0OA 3KDFA 2RBMA 2K33A 4OWTB 4C3IB 2YU9H 3LWEA 2HHHL 1H9KA 3CCLA 3S2HH 1A0IA 1HRJA 3PUVA 5G3LF 3T16A 3F1ZA 1GO3E 1HXYD 2XVSA 3DXJC 3D8GA 3U4ZA 2B8FA 2X6LA 2RHSB 1QZGA 4U68A 4JCVE 2WACA 2EZVA 1VQ7A 2F0WA 2K01A 2SOBA 2L55A 3AFQA 2R93G 5EKKA 4K6LA 5T1IA 2EE1A 3KLRA 4A3LH 2PPBC 1SYEA 1HNWQ 1TY0A 5CR3A 2RKSA 3DMUA 4R8IA 3BDCA 4TSSA 4EQOA 3SDZA 2C35B 1NJIC 5FK9C 1ZKOA 1YZ6A 4BY1H 4APVA 2UUCL 1MI2A 4NXMQ 4IQZA 3PUZA 4GLAC 2B63H 1BNZA 5DNFA 1BBWA 5GADC 1EZ8A 1GUGA 3DLLA 2F0LA 2IY5B 1BCPB 3V2TA 3K58A 1Y1VH 4OHJA 1BR9A 4R4OA 4XIGS 1T9HA 4NXNQ 1EY4A 4X65Q 1P16A 3DEPA 1QE6A 1XNQQ 2KJXA 5GAHC 3FP9A 1K3RA 5IYDG 2HIVA 1AEXA 4HCSA 1EU3A 3K7AH 3CC4A 2JA7B 4WFN3 2NN6G 4DUYQ 3UDFA 1CKNA 4GLVB 3M3YB 2YTYA 1GUTA 1IKLA 1SYBA 1EWIA 2B2YA 2RCFA 4NW2A 1AZPA 3HG9A 2RSOA 1KC8C 3HKZB 5NUCA 4DV6L 1K8OA 2ZTEA 3M4YA 1SFOH 1SDFA 3ULLA 2MPMA 1F9PA 4POFA 1EY5A 3D4DA 1PH1A 4LUZA 3K81C 2Z6KC 3J81L 2ZXPA 1LACA 4B3MQ 1BXTA 3T4AC 3AU7A 5M5YB 1Q3LA 1E3PA 5GAEC 1HNXQ 1EU4A 1W6JA 2MO1A 3IL8A 3K8AA 3VYSA 1U0LA 2R7DA 4HIMA 1SYDA 1I4XA 3EFXD 3GDEA 1G8ZD 1W6KA 2KHSA 3K57A 3I73A 4DV5L 3P20A 4A3MH 4XXEA 3VA7A 1YI2A 3GTQH 4BBSH 4RGNA 2SDFA 1KNAA 1H9JA 2JYOA 1IKMA 1Q46A 4BXXH 1CZGA 3CCJA 1EIHA 1F77A 4UDUC 5CV5A 1KL9A 1SJHD 4XYOA 3GQBA 4J6HA 3KLSX 1PZID 3C2PA 1HZBA 3BU2A 2F0OA 2XRSD 2F4VQ 1HTLD 4DFAA 1GHJA 2A69D 3J7AF 5H1SE 4ZRZA 2RA4A 4DV1L 3PQIA 2CH4A 1WTHA 1O7LA 1Y1WG 3FMCA 2MQHA 2R7ZH 2RCNA 1EYCA 4R4TA 2E2JH 1VQFA 1B70B 2KCTA 1O7IA 3JAML 2BE5D 1JJCB 2EOTA 1C7YA 1B53A 1S4ZA 1A63A 4ZUIA 2D0PA 4KMUC 3TS0A 1CQVA 4XYQA 1CHQD 4JYAQ 1I94L 3FKIH 1VQCA 1LTRD 1UE5A 1C8CA 2N8NA 3FDTA 5C4XG 2VB2X 2CFMA 4R1JA 4C3IH 2VB3X 1QUQB 5M3MB 2JA5G 1PRTD 1D6EC 5JPNC 2E2HB 4PMBA 4L6TB 2QDBA 2BDNA 3OHXC 1RJTA 1Y8PB 1FJGL 1GM5A 3KF8B 4DK0A 1P8LA 1T5XD 4P71A 2EJGC 2MGSA 2JXMB 4AYBG 1GXDC 3F8TA 1IHZA 2B2TA 3WWVA 2UUBQ 3MEFA 2F0FA 2B2YC 1HUMA 2LKVA 1MD2D 2EY6A 3CCQA 1SN8A 1IW7C 2N78A 3VR5A 4O0AA 4DNRB 1TKWB 3TP5A 3WOEA 1HFGA 1EOTA 2EDGA 4DV7L 3GTLB 4DV3Q 1JOOA 3T56B 5ELOA 1S5ED 4XDXA 4KN4C 2HCIA 2R6GA 1SROA 3D4WA 4EQPA 3NTIA 2B63G 3HOUB 1CSQA 3D4RA 4GN4B 1GHKA 2XWJB 4RFBA 4JI1L 4JI4Q 2Q2HA 4RG1A 1PRTF 1MSHA 1EIFA 5I4DA 1CK1A 1PXUA 3HGBA 2F03A 5T1GA 1W3SA 4QIWB 4JC0A 1CTMA 2OEOA 4JI2Q 2KUMA 1HR0Q 1VQ5A 2JA7H 1L0YB 2CW0D 4JV5L 5LL6S 1NE3A 1PH7A 5EPJA 3CF5A 4K14A 3VR3A 4B08A 2R3ZA 1L1OB 4KJOA 2IX1A 4DN4M 3AB9A 3I2ZA 2RDHA 3BZKA 4DPGA 5C3WA 1WCMG 4XQNA 4A3JB 3T13A 3M4QA 4O2DA 1I6HB 4QY7A 1VQ6A 1IBLQ 1BCPC 4WRDA 3RZOH 5M5YH 4OWWB 1HPCA 2K5NA 1I4GA 4DGZA 1XMOL 3KF8A 3HOXG 1KD1C 2JA6B 3L7ZC 5J1ZA 2EXZA 1G91A 4KD4A 1UEAB 1I3QB 4K8IA 1HUNA 4JK1C 4A3MG 4BY7G 4K5VA 4BBSG 1SNOA 5LMNQ 3H0GG 1DYQA 1YNJC 3T1HQ 2D2CC 1M4VA 4LF7Q 3EN2A 5EKIA 5EQ0A 1PYSB 1Z9FA 4CKBA 2WB1G 4JBWA 4GN5A 1V8QA 4RWSC 1TQOA 1STEA 3EQLC 3BYTB 2CH4W 1ENCA 3DUZA 4CDDC 2OQKA 2I07B 5TSSA 4RAUC 3ND8A 2IHFA 3NSWA 4GKJL 3SGIA 1MBYA 1EOVA 3RZDH 2F0DA 3TQYA 1N32Q 2K5VA 3W3AA 1X65A 1XMQQ 1FVIA 2UXCQ 1H9MA 2B2TC 2R7ZG 1B4OA 2OXPA 2M2LA 3HRZC 2IT1A 3S24A 2QCPX 2WP8J 2E2IB 2FMMA 4UHVA 2Q8IB 4RCOA 1EL0A 4PG3A 4X66Q 4A3IB 4FDBA 4JI6Q 5CC4A 1N33L 4YY3Q 4DR4L 1V1PB 5M3FG 4XTCS 4FF3A 2JEAI 1PHJA 1STNA 1IZ6A 3J80i 3I4MG 3H3VH 5M3MH 1J5EQ 4LMQD 2KOLA 4RMFA 1VQEA 1GUOA 3U4VA 5I2YA 4HMIA 2E2HH 5FLMH 3AYHB 1XPRA 4E6IA 4C3IG 1O78A 1KDAA 1OTCA 3QWNA 4O42A 1HZCA 2N88A 2XGTA 2J7ZA 3CHBD 1EY8A 1RD9D 4X6AH 1LM0A 1LT5D 4LF5L 4HSPA 2DNEA 3S1MH 2QW7A 3OWFA 3DEOA 1XJVA 3NXWA 2ZXRA 1CT1D 1ET6A 2VQFL 2F1MA 4FF2A 1PLFA 2PO4A 1JMCA 4FO2A 3RMHA 2MP1A 5C0XI 2L5TA 3B6YA 5K36G 3HZXA 3AFPA 4UP7A 4ODGA 4OONA 3E6ZX 4ID6A 5C0XH 3HOZG 4GNXB 1N34Q 3R2TA 4PV1C 1VS0A 2ZJRA 3URYA 2IL8A 1H9RA 2ID0A 4R4IA 2KQ3A 3CC2A 3HOUH 1VQ9A 2PNHA 4XT1B 5ELCA 1MKHA 3OMCA 5IGCA 2JE6I 2PMZE 1BBUA 2TMPA 3G48A 1VQDA 2RDFA 1KRSA 1UUPA 2L11A 2G5DA 2H4OA 5E7NA 2B2VC 5EPKA 5ELFA 1ILPA 4IPDA 1KABA 2GA4B 5C5LA 4CHTB 1BDOA 1HTPA 2JA7G 1TWFB 4CKEA 4KV6A 1TS2A 3FEWX 1B3AA 1O80A 4DV4L 3KLSA 2NUCA 4JI0L 1V1OA 1ENAA 1E2WA 2KECA 5C44H 3GTGB 1LTBD 4R4CA 3HEJA 2EY5A 1U4PA 1I6HH 2NVYB 4DA2A 1KAWA 4YWLA 4BS9A 1IBML 3VR2A 2HHHQ 1PTOB 1UAPA 4C1NI 1U5KA 1CI3M 2K28A 3NBHA 2JA6H 4XQJA 1RIPA 5IGDA 5I9PA 1IYJB 5IWAL 1HQMC 1X3EA 3Q6SA 2FJ2A 5KEEA 3CCSA 4B3RL 1EIGA 4FXGC 3PO3B 1TWAB 3GTJH 1LLRD 1VF7A 4LF4L 1AE3A 1I3QH 4A3GH 1B8AA 4DF7A 4QUCA 5IGBA 1A2TA 1L1OC 1CA6A 1EEID 1D1KA 1R4PB 1UNSA 2MNAA 2K5QA 4TRDA 2F0HA 4OXPA 2XSCA 3X3MA 1WD1A 3T1YQ 3SK5A 1M90C 1OO9B 2VXWA 5EBDA 1RTNA 2BH8A 1HCZA 4LFBQ 2LXJA 2SNMA 1N36L 1TWCB 3I4NB 1I4HA 4ME5A 1SRUA 1VMPA 3HKSA 1STBA 3S14B 4BBRB 3HOWH 1AFPA 3U9OA 1NNXA 4L8JA 5ELEA 4QUFA 4BA1I 3P1HA 4A3EB 3F2DA 3D31A 3NQTA 2LMCB 2QEXA 1JB7A 3BVZA 2E2IH 3T51B 1CSPA 1U4LA 4MIUA 4A3KG 4KI0A 3J81j 4A3IH 1W2BA 4OX9L 3OIPA 2Z4IA 3GTOB 1SLJA 2G9HD 5CGKA 1DOKA 4LF6L 4CDEC 1Z47A 1D7QA 3K7UC 1WD0A 3CCUA 2F0TA 3MWYW 1XPOA 4H13C 1LUZA 2ZJQA 1STYA 1VQLA 4A3DB 3RLOA 4JI7L 3S9WA 2PQAB 2O5JC 1NR2A 2P5ZX 4HJ7A 3J81i 1ZXTA 4DR5L 1RF2D 3UDXA 4DV2L 3STBC 5JOBA 5FO7B 3VYRA 3L2PA 2B2WA 2X6GA 5FLMG 2PZUA 4FF1A 4MTNA 2JP1A 1SEBD 2RHQB 1X56A 3R3OA 3FRPB 4DV0L 2WAQG 4L5TA 2A6ED 1D2BA 3TRZA 1G2TA 3GP7A 4DR1Q 4GN3B 1FR3A 4EX5A 1AZQA 2R61A 3J7AV 5FKAC 2Q2TA 3PF4A 1EWCA 2JA8B 3BG3A 1K83H 2QGQA 4DK1A 1IBKQ 1SE8A 1VQJA 1WTQA 2DN8A 3KLWA 1EZ6A 3OOCA 1IL8A 1F2MA 3UI2A 3UDGA 2VL6A 3VR4A 1JWSD 3CKIB 1BCPD 4HN7A 1ZYRD 4AYBE 3S1RB 3H94A 1PH2A 1SNMA 4B3SL 4V190 5E4XA 2VZAA 3LWUA 2OQ0A 4JBKA 5C5MA 4HTHA 2EIFA 5EGTA 2UUAL 3C3LA 3TS2A 4HJAA 4KY7A 4UPAA 4FYDA 3GD7A 3JAMi 2ES2A 4F8MA 4OL7A 4IPHA 4TVAB 4KTAA 1F9RA 2LSSA 2K32A 5M9OA 1QVCA 2EYJA 1PZKD 3F2CA 2E74C 1B50A 1YIJA 2E2DC 5C4ZA 4HSVA 3FVQA 3KBGA 5C3EB 2AQ2B 2VNUD 3CD6A 1NSNS 3EIVA 4X64L 2PZWA 1YNJD 4I65A 4RHSA 3K5MA 4GNXC 4N9TA 4RA8A 2CQOA 3BZCA 2I0QA 3GTGH 5JJIA 2NTTA 4C3JB 5GROA 3A7AB 4P72A 4LFCQ 1S5CD 3OMGA 3RR5A 2NVYH 1KLGD 1DGSA 4JI5Q 2QA4A 4OGQC 1NY4A 2EJFC 5C44G 3PIOA 2WINB 5ELNA 4DUZQ 4AQYL 2EY2A 1B2TA 1SE3A 3DM3A 2PQAA 1R9TH 2CWAA 3R2IA 2NYZD 1WTWA 1KNEA 4CJ0B 1VQPA 1NBWA 1BCPF 2WKDA 3DWPA 2IW3A 1YNNC 2F0QA 3BVMA 2CQAA 3SK6A 3NWTA 2KVMA 4FF4A 1RODA 1TWAH 2JA6G 4A3BB 3CU7A 5A2QE 3C1FA 4WORA 4ZAIA 3NQIA 2AKWB 5CMDA 1HNZL 2ZM6Q 3Q24A 1PYWD 2L12A 1EIYB 3ONAB 3GV6A 2EJMA 4A3GG 1LTAD 4XQQA 1TVXA 4HJ5A 1D1IA 1LTSD 1JOQA 5CV9A 3E3XA 1XPUA 2F52A 3S16B 3CQZB 2Z8LA 1EFWA 1NAPA 3ICEA 5D65A 3K0YA 4DAMA 3S14H 5BR8Q 2ICEC 4X3SA 2B2WC 3MXNB 1DOMA 1WTXA 2B39A 3PF5A 1PTOC 5JPMC 2UU9L 2PI2A 4KHVA 4JI1Q 1MJCA 3MXGA 3AQQA 1BUVT 1K3BC 4HIKA 1PH4A 5C4JB 5KYIA 3HOWG 2QILA 4RGOS 5COYA 4X62L 1SE4A 3FPPA 4IALA 4R4QA 3S15B 3PUXA 4DK3C 2AHOB 2WB1E 4QMGA 2R92H 4NXML 1II3A 2DNCA 4LWCA 3GTOH 2VUMB 4JV5Q 3E9HA 2NBFA 2WFWA 4IUTA 3QOJA 4A3IG 2GN5A 5IYCH 4GLXA 3D0FA 1TIID 5JJKA 5CBAE 4IFDI 2ZJPA 3TSSA 4A3DH 1K8GA 2KHIA 4X65L 1DZ1A 1XNQL 4WJ3M 2A6HC 4K5XA 2O5IC 3I90A 4H7BA 4C56C 1EY7A 4P2CB 4JG2A 1ICWA 1LT3D 4G7HC 1XMOQ 1MHWC 4KHPQ 2AUJD 3NE5B 3S17B 4YHHQ 1JE4A 4QL5A 2D5DA 3I55A 2SNSA 1YBYA 2A68C 2A5HA 1VQMA 1A3TA 2B2UC 2JA8H 1BKBA 3GTMB 4B3TQ 3CAMA 1U4RA 2DY7A 5IT9c 3EVQA 4C1NK 4A3LG 1VQ8A 1CKOA 5J39A 1FGUA 1LTID 1HNXL 2PZTA 3A54A 1WFQA 4KKSA 5JEAH 2E5LL 1QVGA 1D8LA 4Y52H 1BOSA 4KY5A 2A1AA 1Q8KA 3DM1A 4K8JA 4BY1G 5KIXA 3W1BA 1KLUD 3A8JE 2PMZB 4IUUA 3LX0A 4LNQA 2R93B 1E2VA 4IOAA 1EQRA 5I9OA 1NR4A 4LUVA 4NPSA 3J80c 3NBIA 5FLXc 2NVXB 2PW5A 2NZ1D 2ZTCA 3CCEA 4G7ZC 3S1NB 3PCOB 1OXTA 3J7A5 4L5QA 2UXDQ 1Y1VG 1F9QA 2FINB 4UAIA 5FO8B 2V1CC 1H95A 4JI8Q 5DM73 3ND9A 1CFMA 2KHJA 3E0JA 3NPPA 3VA5A 4DK6C 2F0UA 1CA5A 5J22A 2HQEA 1UE7A 4C3HB 4YCUA 3DWAA 5M5XB 4DR2Q 3M3YH 1N33Q 4PMWA 5ELDA 4DR4Q 3SK8A 3SR1A 3TZUA 3RLFA 2Z6BA 4OO1I 4TQUS 3VYTA 2HDLA 3IKJA 4PNYA 3NUCA 1SMYC 2UXBQ 1SAPA 3K6OA 4X3KA 4OO1H 4AIMA 1YJWA 2Y0SG 4P75A 4QB4A 3FHWA 4DAYB 1QUQA 5LMUL 1U9RA 2OF1A 3D6WA 1HH2P 1JICA 4C2MB 1Q82C 1LABA 1PH8A 1BVSA 1CKMA 1WVLA 3QB3A 1E1OA 1E0BA 5GQOA 1Y69U 5IYBH 2XWBB 3PV0A 1NCVA 2VQFQ 2BH2A 2NTSA 3Q23A 1NUCA 4Q0FA 3H6MA 2YTXA 2JN4A 2B2VA 1JCKB 4DR7L 1F2ZA 1UEBA 4M1UB 2DGYA 2EYFA 4QJFA 1BO0A 4RH6A 2JJQA 5CORA 1HJPA 4NMZA 5JEAJ 3S16H 2QF7A 1GVPA 1LTLA 3PGZA 2XN9C 3D6CA 4UP9A 4A3FB 2PYKA 4JPBW 1VCIA 2RQXA 4V0BA 2C5CA 2Z9HA 5JVH3 3KBXA 3CXCA 3I70A 1ESFA 4FP5D 4X3UA 2HD3A 4BXXG 2I5LX 3CCRA 3STBD 5C6AA 2ENBA 3G6JB 5CYUA 5EKLA 1OXXK 2EYPA 3MHBA 3X3NA 3TN2A 5KNCA 5C4JH 4GS3A 4DXGA 2K5WA 2DY8A 3S15H 1S5BD 3I8ZA 4HJ9A 1GUSA 2VUMH 1E2ZA 1ILQA 2XNAC 1NTGA 2NVQB 4N8FA 3RN5A 1A62A 2BDOA 2R92G 2B3GA 4JI3Q 1PH6A 2HUGA 1SR3A 2K5HA 1GUWA 1Y1WB 1Q86C 1L1OA 3OSOA 4F88A 3FKIG 1SNPA 4DR6Q 3I91A 5IE8A 3BZDB 1G291 1X54A 3G7LA 5J3BA 1S40A 1VQNA 4PZ6A 4B9WA 1HR0L 1IBMQ 3NWSA 2H1EA 3MFYA 4IO9A 3PMFA 5C4HA 1AN8A 1A2UA 1L2FA 1I50B 2RVLA 4B3RQ 1I5FA 4J15A 3S2DB 2A73B 2FHTA 2PNRC 3A55A 3BS1A 4H02A 4CDFC 3MVVA 4LJZC 5C4XB 5IT9E 1K0SA 2AWNA 1ASYA 3MXUA 4RKLA 5IY0A 3GTMH 1QOHA 3Q0AA 3C46A 1K9MC 4P74A 1G6PA 1GKHA 3M7GA 1HQRD 2KBNA 2A19A 2YU9B 4PMCA 2DJGC 2A69C 3BDLA 4K0KQ 3A7LA 3GTLH 1DXMA 3TP8A 3HOYB 1TS3A 3A0JA 3J80E 5FLXE 1N36Q 4KHZA 2WAQE 4GOPB 4G57A 5JEAG 1YNND 3UE0A 2R93H 5JJLA 2NVXH 2CWPA 3S1NH 5BN3A 2YV5A 2KEEA 3CW2C 1VMCA 3MA2B 5A35A 3EROA 2F0JA 4IUVA 5LMNL 1JORA 1OXVA 3J81c 1HA5A 3T1HL 3W5OA 4R8NA 2NZOA 3I7FA 4C3HH 5M5XH 5AJ3Q 1LTGD 1RHPA 2F0NA 3O13A 2K05A 2B63B 4DAPA 1A8VA 2VQEQ 3TBIB 5KRUA 3TZDA 4H44C 3A74A 1O7YA 4EQNA 1V1PA 3K5NA 3HKZG 1XMQL 1DONA 4KN7C 5I6WA 2UXCL 5IYDH 2L9HA 4A3JH 2NN6I 5IP7H 4JI7Q 1FD7D 4A3CH 2NVTB 4L63B 2KENA 5KGUA 3ZJYC 4DR5Q 4YCVA 1YJ9A 4OELB 4DV2Q 4EGVA 4M8AA 4C2MH 2BOSA 4GKKL 3QOLA 1X3GA 3OTOL 1I4RA 1ZEQX 4BWGB 1D5XC 4HJ8A 2HDMA 3R93A 4ULLA 3Q8DA 2JK8A 1G2SA 4DXFA 5LHY1 5DM63 4AH6A 5KNBA 4KLKA 5C0XJ 2LXKA 1WCMB 5IYBG 1SFOB 1CZWA 3KF6B 2F0MA 4A3FH 2CVRA 1I6VC 1VQ4A 3JAMc 4L5SA 1EEFD 3ULPA 4DNIA 5HGQA 3HOXB 2A6HD 4GNXA 2GVAA 1TS5A 2X69A 2UUCQ 1EY9A 2CKZB 4ME3A 3JC66 4EQ5A 1TXYA 2HIXA 4HR7B 3H15A 3PIO3 4B3SQ 5ISRA 1PTOF 1KAAA 3LNNA 4IUQA 2F3VA 5IIFA 3A5ZB 2ZTDA 4IOCA 4I7AA 4BY7B 2UUAQ 3TMEA 3H09A 2RSNA 2CW0C 4OWXB 1K73C 2OCEA 3IRBA 4ZLTF 4FNFA 3H0GB 2FFKB 1R4QB 4K2LA 2K5DA 1Q1EA 1KRTA 1T5EA 2WB1B 2NVQH 3LGJA 5FOBB 4DR3L 3J7YW 1IW7D 3CP0A 1KQSA 2WKCA 2K03A 1Y1WH 4I7ZC 5C3XA 1EWHA 2IJ0A 1QCBD 4IN3A 4DV6Q 2GVBA 4K5WA 1S5DD 2R7ZB 3EJIA 2K4KA 3UDIA 3TDQA 2BA0A 2E76C 2E2JB 4IURA 4YCWA 5M3MG 4J8QA 2LS01 3KJPA 1I50H 2JEBI 3QR8A 5JJZA 2Q2UA 3N6RA 5DEHA 1VQOA 1SXTA 1SYGA 1RCVD 5M3FB 2XIWA 1XNRL 4JW0A 3SK4A 3AMUA 4DNTB 3I4MB 3RN2A 1FNWA 2M00A 1WYDA 3PO2B 4DV5Q 4HIDA 2HT1A 4QCLA 1M1KC 3KF6A 3Q22A 3CRKC 4FXKC 5LL6X 2G9DA 2LY7A 1SMYD 3GO5A 4ZYSA 3I4LA 4ZK9B 3KOJA 3HOYH 1D5ZC 5C0XG 1TWGB 2EYLA 2H5XA 1EYDA 4LFAL 5HGTA 1YJNA 4LF9L 1VDZA 2V4DA 3M4PA 1LT6D 3TREA 2UU9Q 4A76A 1PZJD 3J81E 1B9NA 3PIPA 3V96A 1MIUA 5KNDA 3HOUG 2F0EA 4OIKA 4DV1Q 2TSSA 1V1QA 3VYUA 4KK7A 3HOZB 1HA6A 4X62Q 1S3OA 2IX0A 3KK7A 4Y7NB 3T1YL 2ZT9C 2ASBA 1JJGA 1BF4A 1FYCA 2QEJC 4LFBL 3UE1A 4B9XA 3L0OA 4A93B 1TWFH 3CMEA 3HOVB 1NMFA 4C3HG 4H0LC 3CCVA 2N55A 3MZ5A 4U673 2ATWA 1B7YB 4QQBX 1I94Q 5BN5A 1Q7YC 2NB0A 1EQTA 4LF8L 2B2UA 4TKOB 2Z1CA 4RGTA 3E5SA 5I2XA 2XRQD 2NVTH 4GOPC 2ZXOA 1HZAA 4A3CG 4A3JG 5IP7G 1JE5A 4RCNA 1LYLA 1PTOH 1QG7A 2VS1A 1X3FA 1I4PA 2K04A 3ITPA 5CV6A 5E3FA 3ZYYX 3GTPB 2N49A 1FJGQ 1A15A 3PSIA 3PO3H 1SMXA 4FVMA 4NKLA 3JAME 3G6EA 1WCMH 1I4QA 1PDQA 3QIAA 1CM9A 1IXRA 3SXHA 3NHHA 3KUPA 1SNCA 2Y0SE 1LO5D 3P75A 4IPCA 1QB5D 1RL2A 3HOXH 4A3FG 2RF4A 5ELBA 3I4OA 3RZOB 1JWMD 2JQOA 2M9VA 3G4SA 4ZCKA 2E5LQ 4DV7Q 4HIOA 1TWCH 1CQFA 3KYHC 3I4NH 2F0VA 1G51A 3BDOA 4OIJA 5EAYA 1X55A 3BJUA 4BBRH 4DR1L 3M9BA 4BY7H 1AW7A 4JOIC 4A4IA 3GTKB 1XWEA 1MJEA 3OW7A 1VQAA 1DD2A 3H0GH 4A3EH 1IBKL 1HNWL 3TP6A 1UE6A 3EA6A 3E9IA 5HY6A 3QJYA 1TR5A 4L5RC 3OW2A 1QILA 4GZYC 3M85A 3D3RA 3W1GA 1YHAA 1EYGA 1C48A 2F3IA 2YYZA 3NTHA 3AEVA 4J1MA 2QDLA 1PMRA 4QF4A 1RTOA 4DAVA 1M8AA 4RKBA 3RZDB 2MO0A 5D3DA 5FJ8H 2EQSA 1TT2A 5A2QL 4NXNL 4IFDH 3I3CA 3CPFA 1GOZA 5IGGA 2MFIA 1V43A 4A3KB 5D14A 2KA7A 5LMUQ 1B3QA 1YVCA 4MZ9A 1PH3A 3IAYA 1EY6A 2SEBD 5M3FH 4UY8C 3EBEA 4DUYL 4XT3B 1FNUA 1QNKA 2C9OA 1YEZA 3I4MH 3MAQA 1QNUA 1YHBA 4LFCL 1A3UA 1C4QA 1PH5A 2E75C 3PO2H 4JI5L 1PV4A 1Q81C 4DR7Q 4DUZL 2R7FA 1A3VA 3MXPA 1VQBA 2K50A 1JR0D 4MN3A 5EPLA 4MTKA 1L0XB 4B3ML 1FNVA 3WDNA 1TWGH 1XTCD 3U58A 2NZHA 5DLQE 1PRTB 1B1ZA 3HOYG 3MC0B 2WAQB 1B44D 1LV9A 3S1RH 4NDXA 3S1MB 4LAAA 1QVFA 2ZM6L 1GUNA 2IWHA 3G71A 2IHEA 5K36H 3MXNA 3M7NA 1YITA 2A8VA 4GKJQ 3HOZH 1JWUD 2CCZA 4Y7NH 1ML0D 3F2BA 3MTSA 3QO2A 2EPBA 2DUDA 1GJXA 3I72A 2K1BA 2Z0SA 2J0TD 1SBBB 4P73A 2MJ8A 4A93H 4ZKCB 3DWQA 3HOVH 2I5HA 4DKAC 1EYAA 4RGMA 5C3EH 5IGEA 3ER0A 5BR8L 4KKUA 3CCMA 1UE1A 2F4VL 4LK1C 2PI2E 4IFDJ 1QZHA 4NP5A 4C3JH 2L15A 4KJNA 1XYIA 3SHLA 4CGYB 2YTVA 3F2UA 4IUNA 3K5LA 2O2LD 2JA9A 2OTLA 2VY3A 3OIQA 3OPOA 3CC7A 2AQ3B 1FL0A 3IFTA 2VW9A 4FXDA 1JC7A 2EXDA 5BN4A 3GTPH 4Q5VA 2A6EC 4A75A 2HCCA 5CV4A 2F0KA 5E1FA 1Q8IA 2F0IA 3NK9A 3K0XA 4CBVA 4A3BH 4JYAL 4LF5Q 1L0WA 3W2DA 5JVG3 2AWOA 3FPUB 3KFUA 3T53B 3PO3G 5JAVA 1B9MA 3HKZE 3HP3A 4K2KA 5C44B 2HQLA 3K59A 2KCCA 4K6DA 5M5WB 4PZ8A 1SNDA 4YWMA 3CQZH 1Y14B 1PA6A 1ZYRC 4YIJA 3RUZA 1Y8NB 2O4XA 3RLNA 4PQXA 1H9SB 1MGSA 4RHRA 4KHPL 4S3SA 4YHHL 3L9AX 2NWGA 4KD3A 2KCNA 1HFNA 2F0SA 3GTJB 3I4NG 3SEBA 3GTKH 3J7ZC 4A3GB 4BBRG 1N9WA 5KYLA 2UUBL 1AH9A 3CMAA 2OT2A 5IODA 5IP9H 4B3TL 1IYUA 5CV7A 1BBXC 3M4OB 5L37A 1TWHB 5FO9B 1Q1BA 2OWOA 4N9PA 4UP8A 2K52A 4A3EG 1BQQT 1SSOA 1E7ZA 4LUOA 1PFBA 5EJWA 3K5OA 1VQIA 2K7VA 1K8MA 4DV3L 4G7OC 5E4WC 4R9WA 2Q8RE 1MSGA 1ET9A 1ONLA 3H91A 5I6YA 2Q2IA 3U9SA 2ALYB 4DV4Q 4JI0Q 4JI4L 1ASZA 3HOWB 4F7XA 5IYCG 1KDBA 1F2YA 1G6ZA 3S1QB 4CJ1B 4N8X1 1J6QA 1UWVA 2UXDL 4A3KH 3TEHB 5FJ8G 1AE2A 3A56A 4A3DG 4JI8L 1CUKA 4IFDG 1OXSC 4GKKQ 1QJOA 3OTOQ 1ICFB 4JI2L 2LFNA 1RDPD 1STAA 4DAYA 2IPKD 1HZ9A 1KTKA 4DU9A 4DR2L 2FMCA 1Q12A 4F87A 2K14A 5IWAQ 1E1TA 1VQKA 4PZ7A 2OTJA 3S17H 3H3VI 1HR0W 2XTIA 1K0RA 1X6OA 1EQQA 1WTPA 4KY6A 4LF4Q 3BVGA 4JVZA 3QG1A 5IOCA 2EVBA 2UXBL 1ENFA 4JBJA 2F0GA 3OWEB 1C9OA 3PO2G 4IZ8A 1X3QA 2L4NA 2JA5B 2WIIB 1X3PA 1TY2A 3KJOA 2I46A 4WJWA 3NBHB 3BYYB 1IBLL 2JA8G 2B29A 3IFDA 4ALPA 3I56A 3S2HB 2Z4HA 4IUPA 2ICIA 1H9SA 1WTVA 4ZUJA 1WTRA 1S72A 4AYBB 1PH9A 3NTKA 3HFZB 4CDCC
chains in the Genus database with same CATH topology
1JOKA 2A74C 2BE5C 2B8GA 4ILWA 2AUKA 3MEHA 1F2LA 1IYVA 1TS4A 2Q8TA 1K83B 4CJ2C 5K5PA 1Z7TA 2EYHA 3H3VC 1A6XA 1EQVA 2EYMA 2PQEA 1X32A 1LTTD 1U4MA 3HS0C 4BY1B 1KDCA 3C1EA 5IGFA 4MHEA 3PUWA 4ABNA 2J4XA 4C3JG 1PRTC 1Z6HA 1Y1VB 1PTOD 5F2DA 4O1NA 2PCFB 5IT9L 1CHPD 1S5FD 2D62A 4BA2I 2K6AA 5AFWA 4OO1G 2NN6H 1VF5C 2EY1A 3SE0A 1O7ZA 3K7AB 3V05A 3PIP3 4EVOA 2IX3A 2L0CA 2PW7A 1SE2A 3DHQA 5DAUA 1SYFA 2BA1A 1SNQA 4HEDA 1ESRA 3R8BA 3J80L 5HURA 5FLXL 5D3IB 2Y0SB 2EYOA 2KEDA 4HAEA 1Q90A 3CRLC 1JB3A 1R9TB 1SYCA 4G4KA 2L1BA 2WV6D 1RKNA 3SVMA 5CV8A 1TU2B 1OXUA 3A8IE 2F0PA 3ERQA 3P7JA 2D9UA 2MHVA 1XX8A 1PFMA 4Z9CB 4A3MB 3GTQB 4BBSB 3L3OC 1EY0A 1PFNA 1HHVA 1STHA 2A68D 1DCZA 2RDGA 2CHBD 4KKTA 1AP0A 1Y8OB 2QKIC 1FGBD 5G3LD 4HMJA 1DJRD 1DOLA 4ZQ3A 3MFGA 3GV3A 4ZKBB 2MUYA 1XXGA 1J9OA 1DM0B 1STGA 4HCEA 3VR6A 1J8IA 3RD4A 1SJED 2AQ1B 2F3WA 2R92B 3N52A 1F9SA 1QWYA 2F4IA 3TP7A 5CBEE 2JSOA 1WTOA 3NP8A 3A8KE 2BCOA 3FKIB 4X3TA 4CKCA 1JQYD 1LT4D 1D5MC 3WOFA 3PUYA 1EFID 5EBCA 2RBMA 2K33A 4C3IB 3LWEA 1H9KA 1HRJA 3PUVA 5G3LF 3T16A 1HXYD 2XVSA 3DXJC 3D8GA 2B8FA 2X6LA 4U68A 2WACA 2EZVA 2F0WA 2K01A 2SOBA 2L55A 5EKKA 4K6LA 5T1IA 2EE1A 3KLRA 2PPBC 1SYEA 1TY0A 5CR3A 2RKSA 3DMUA 4R8IA 3BDCA 4TSSA 4EQOA 3SDZA 5FK9C 1ZKOA 1MI2A 4IQZA 3PUZA 1BNZA 5DNFA 1EZ8A 1GUGA 2F0LA 1BCPB 3V2TA 3K58A 4XIGS 4OHJA 1BR9A 1EY4A 3DEPA 1QE6A 2KJXA 1AEXA 4HCSA 1EU3A 2JA7B 4WFN3 2NN6G 3M3YB 1GUTA 1IKLA 1SYBA 2B2YA 4NW2A 1AZPA 3HG9A 2RSOA 3HKZB 5NUCA 1K8OA 3M4YA 1SDFA 2MPMA 1F9PA 1EY5A 3D4DA 3J81L 2ZXPA 1LACA 1BXTA 3T4AC 3AU7A 5M5YB 1Q3LA 1EU4A 1W6JA 3IL8A 3VYSA 1SYDA 1I4XA 3EFXD 1G8ZD 1W6KA 2KHSA 3K57A 3I73A 3P20A 4XXEA 3VA7A 4RGNA 2SDFA 1KNAA 1H9JA 2JYOA 1IKMA 1CZGA 1EIHA 1F77A 4UDUC 5CV5A 1SJHD 4XYOA 3GQBA 4J6HA 3KLSX 1PZID 3C2PA 2F0OA 2XRSD 1HTLD 4DFAA 1GHJA 2A69D 3J7AF 4ZRZA 2RA4A 1O7LA 3FMCA 1EYCA 3JAML 2BE5D 2EOTA 1B53A 1S4ZA 4ZUIA 4KMUC 1CQVA 4XYQA 1CHQD 1LTRD 1C8CA 3FDTA 2VB2X 2VB3X 5M3MB 1PRTD 1D6EC 5JPNC 2E2HB 4PMBA 4L6TB 2QDBA 2BDNA 1RJTA 1Y8PB 3OHXC 4DK0A 1T5XD 2EJGC 2MGSA 2JXMB 1GXDC 1IHZA 2B2TA 2F0FA 2B2YC 1HUMA 2LKVA 1MD2D 2EY6A 1IW7C 3VR5A 4DNRB 1TKWB 3TP5A 3WOEA 1HFGA 1EOTA 2EDGA 3GTLB 1JOOA 3T56B 1S5ED 4XDXA 4KN4C 2HCIA 2R6GA 3D4WA 4EQPA 3NTIA 3HOUB 3D4RA 1GHKA 2XWJB 4RFBA 1PRTF 1MSHA 5I4DA 1CK1A 1PXUA 3HGBA 2F03A 5T1GA 4QIWB 1CTMA 2OEOA 2KUMA 1L0YB 2CW0D 5LL6S 5EPJA 4K14A 3VR3A 4B08A 2R3ZA 4KJOA 2IX1A 4DN4M 3AB9A 2RDHA 5C3WA 4XQNA 4A3JB 3T13A 1I6HB 1BCPC 4WRDA 1HPCA 1I4GA 4DGZA 3KF8A 2JA6B 3L7ZC 5J1ZA 2EXZA 1G91A 4KD4A 1UEAB 1I3QB 4K8IA 1HUNA 4JK1C 4K5VA 1SNOA 1DYQA 1YNJC 2D2CC 1M4VA 5EKIA 5EQ0A 4CKBA 4JBWA 4RWSC 1V8QA 1TQOA 1STEA 3EQLC 3BYTB 1ENCA 3DUZA 2I07B 5TSSA 4RAUC 3ND8A 3NSWA 1MBYA 2F0DA 3W3AA 1H9MA 2B2TC 1B4OA 2OXPA 2M2LA 3HRZC 2IT1A 2QCPX 2WP8J 2E2IB 2FMMA 1EL0A 2Q8IB 4RCOA 4A3IB 5CC4A 1V1PB 2JEAI 4XTCS 4FF3A 1STNA 4LMQD 2KOLA 5I2YA 1GUOA 4HMIA 4E6IA 4C3IG 1O78A 1KDAA 3QWNA 4O42A 2N88A 2J7ZA 3CHBD 1EY8A 1RD9D 1LT5D 4HSPA 2DNEA 3OWFA 3DEOA 3NXWA 2ZXRA 1CT1D 1ET6A 2F1MA 4FF2A 1PLFA 2PO4A 4FO2A 3RMHA 2MP1A 5C0XI 2L5TA 5K36G 3HZXA 4ODGA 5C0XH 3E6ZX 4ID6A 3R2TA 4PV1C 3URYA 2IL8A 1H9RA 2ID0A 2KQ3A 4XT1B 5ELCA 5IGCA 3OMCA 2JE6I 2TMPA 2RDFA 1UUPA 2L11A 2H4OA 2B2VC 5EPKA 5ELFA 1ILPA 1KABA 2GA4B 5C5LA 4CHTB 1BDOA 1HTPA 1TWFB 4CKEA 4KV6A 1TS2A 3FEWX 1B3AA 1O80A 3KLSA 2NUCA 1V1OA 1ENAA 1E2WA 2KECA 3GTGB 1LTBD 3HEJA 2EY5A 1U4PA 2NVYB 4DA2A 4BS9A 3VR2A 1PTOB 1UAPA 4C1NI 1CI3M 2K28A 3NBHA 4XQJA 5IGDA 5I9PA 1HQMC 3Q6SA 2FJ2A 5KEEA 1EIGA 4FXGC 3PO3B 1TWAB 1LLRD 1VF7A 4DF7A 4QUCA 5IGBA 1A2TA 1CA6A 1EEID 1D1KA 1R4PB 1UNSA 2K5QA 4TRDA 2F0HA 2XSCA 3X3MA 1WD1A 3SK5A 1OO9B 2VXWA 5EBDA 1RTNA 1HCZA 2SNMA 1TWCB 3I4NB 1I4HA 4ME5A 1VMPA 1STBA 3S14B 4BBRB 1AFPA 3U9OA 4L8JA 5ELEA 4QUFA 4BA1I 3P1HA 4A3EB 3D31A 3NQTA 2LMCB 3BVZA 3T51B 1U4LA 4MIUA 4KI0A 3OIPA 2Z4IA 3GTOB 2G9HD 5CGKA 1DOKA 1Z47A 1WD0A 2F0TA 3MWYW 4H13C 1STYA 4A3DB 3S9WA 2O5JC 1NR2A 1ZXTA 1RF2D 5JOBA 5FO7B 3VYRA 2B2WA 2X6GA 2PZUA 4FF1A 2JP1A 1SEBD 3R3OA 3FRPB 2A6ED 1D2BA 1G2TA 3GP7A 1FR3A 1AZQA 2R61A 3J7AV 5FKAC 1EWCA 2JA8B 3BG3A 4DK1A 1WTQA 2DN8A 1EZ6A 3OOCA 1IL8A 1F2MA 3UI2A 3VR4A 1JWSD 3CKIB 1BCPD 4HN7A 1ZYRD 3S1RB 3H94A 1SNMA 4V190 5E4XA 3LWUA 5C5MA 4HTHA 5EGTA 3C3LA 4KY7A 4FYDA 3GD7A 4F8MA 4OL7A 4KTAA 1F9RA 2K32A 5M9OA 2EYJA 1PZKD 2E74C 1B50A 2E2DC 5C4ZA 4HSVA 3FVQA 3KBGA 5C3EB 2AQ2B 2VNUD 1NSNS 2PZWA 1YNJD 4I65A 4RHSA 3K5MA 4N9TA 4RA8A 2NTTA 4C3JB 3A7AB 1S5CD 3OMGA 1KLGD 4OGQC 2EJFC 2WINB 2EY2A 1B2TA 1SE3A 3R2IA 2NYZD 1WTWA 1KNEA 4CJ0B 1BCPF 2WKDA 3DWPA 2IW3A 1YNNC 2F0QA 3BVMA 2CQAA 3SK6A 3NWTA 2KVMA 4FF4A 1RODA 4A3BB 3CU7A 5A2QE 3C1FA 4WORA 4ZAIA 3NQIA 5CMDA 3Q24A 1PYWD 2L12A 3ONAB 3GV6A 2EJMA 1LTAD 4XQQA 1TVXA 1D1IA 1LTSD 1JOQA 5CV9A 3S16B 3CQZB 2Z8LA 1NAPA 5D65A 3K0YA 2ICEC 4X3SA 2B2WC 1DOMA 1WTXA 2B39A 1PTOC 5JPMC 4KHVA 3MXGA 1BUVT 5C4JB 5KYIA 2QILA 4RGOS 5COYA 1SE4A 3FPPA 4IALA 3S15B 3PUXA 4QMGA 1II3A 2DNCA 2VUMB 2NBFA 4IUTA 3QOJA 1TIID 5CBAE 4IFDI 3TSSA 1DZ1A 2A6HC 4K5XA 2O5IC 3I90A 4H7BA 4C56C 1EY7A 4P2CB 1ICWA 1LT3D 4G7HC 2AUJD 3NE5B 3S17B 1JE4A 2D5DA 2SNSA 2A68C 2A5HA 1A3TA 2B2UC 3GTMB 1U4RA 2DY7A 3EVQA 4C1NK 5J39A 1LTID 2PZTA 3A54A 4KKSA 5JEAH 1BOSA 4KY5A 3DM1A 4K8JA 5KIXA 1KLUD 3A8JE 2PMZB 4IUUA 3LX0A 2R93B 1E2VA 5I9OA 1NR4A 3NBIA 2NVXB 2PW5A 2NZ1D 4G7ZC 3S1NB 1OXTA 1F9QA 2FINB 4UAIA 5FO8B 5DM73 3ND9A 1CFMA 3E0JA 3NPPA 3VA5A 2F0UA 1CA5A 5J22A 2HQEA 4C3HB 3DWAA 5M5XB 4PMWA 5ELDA 3SK8A 3SR1A 3TZUA 3RLFA 4OO1I 4TQUS 3VYTA 2HDLA 3IKJA 4PNYA 3NUCA 1SMYC 1SAPA 3K6OA 4X3KA 4OO1H 4QB4A 1U9RA 2OF1A 3D6WA 1JICA 4C2MB 1LABA 1WVLA 3QB3A 1E0BA 1Y69U 2XWBB 3PV0A 1NCVA 2NTSA 3Q23A 1NUCA 4Q0FA 3H6MA 2B2VA 1JCKB 1F2ZA 4M1UB 2EYFA 4RH6A 1BO0A 5CORA 4NMZA 5JEAJ 2QF7A 2XN9C 3D6CA 4A3FB 2PYKA 1VCIA 2RQXA 4V0BA 2C5CA 5JVH3 3KBXA 3I70A 1ESFA 4FP5D 4X3UA 5C6AA 2ENBA 3G6JB 5CYUA 5EKLA 1OXXK 2EYPA 3MHBA 3X3NA 3TN2A 5KNCA 4DXGA 2K5WA 2DY8A 1S5BD 3I8ZA 1GUSA 1E2ZA 1ILQA 2XNAC 2NVQB 2BDOA 2HUGA 1GUWA 1Y1WB 3OSOA 4F88A 1SNPA 3I91A 3BZDB 1G291 3G7LA 4B9WA 3NWSA 2H1EA 3MFYA 3PMFA 5C4HA 1AN8A 1A2UA 1I50B 2RVLA 3S2DB 2A73B 2FHTA 2PNRC 3A55A 3BS1A 3MVVA 4LJZC 5C4XB 5IT9E 2AWNA 3MXUA 4RKLA 1QOHA 3Q0AA 3C46A 3M7GA 1HQRD 2YU9B 4PMCA 3BDLA 2A69C 3A7LA 1DXMA 3TP8A 3HOYB 1TS3A 3J80E 5FLXE 4KHZA 4G57A 5JEAG 1YNND 5BN3A 2KEEA 1VMCA 3MA2B 5A35A 3EROA 2F0JA 4IUVA 1JORA 1OXVA 1HA5A 4R8NA 1LTGD 1RHPA 2F0NA 3O13A 2K05A 2B63B 4DAPA 3TBIB 5KRUA 3TZDA 4H44C 1O7YA 4EQNA 1V1PA 3K5NA 1DONA 4KN7C 5I6WA 2L9HA 2NN6I 1FD7D 2NVTB 4L63B 5KGUA 4EGVA 4M8AA 2BOSA 3QOLA 1I4RA 1ZEQX 4BWGB 1D5XC 2HDMA 3R93A 4ULLA 1G2SA 4DXFA 5LHY1 5DM63 5KNBA 5C0XJ 1WCMB 1SFOB 1CZWA 2F0MA 2CVRA 1I6VC 1EEFD 3HOXB 2A6HD 1TS5A 2X69A 1EY9A 4HR7B 3PIO3 5ISRA 1PTOF 1KAAA 3LNNA 4IUQA 2F3VA 5IIFA 4BY7B 3TMEA 3H09A 2RSNA 2CW0C 4ZLTF 4FNFA 3H0GB 2FFKB 1R4QB 4K2LA 2K5DA 1Q1EA 1T5EA 2WB1B 5FOBB 3J7YW 1IW7D 2WKCA 2K03A 4I7ZC 5C3XA 1EWHA 2IJ0A 1QCBD 4IN3A 4K5WA 1S5DD 2R7ZB 3EJIA 3TDQA 2BA0A 2E76C 2E2JB 4IURA 4J8QA 2LS01 2JEBI 5JJZA 3N6RA 5DEHA 1SXTA 1SYGA 1RCVD 5M3FB 2XIWA 3SK4A 3AMUA 4DNTB 3I4MB 1FNWA 2M00A 3PO2B 4QCLA 3Q22A 3CRKC 4FXKC 5LL6X 2G9DA 2LY7A 1SMYD 3GO5A 4ZYSA 3I4LA 4ZK9B 1D5ZC 5C0XG 1TWGB 2EYLA 1EYDA 5HGTA 1VDZA 2V4DA 1LT6D 1PZJD 3J81E 1B9NA 3V96A 5KNDA 2F0EA 4OIKA 2TSSA 3VYUA 4KK7A 3HOZB 1HA6A 2IX0A 3KK7A 4Y7NB 2ZT9C 1BF4A 1FYCA 2QEJC 4B9XA 4A93B 3HOVB 4C3HG 4H0LC 2N55A 3MZ5A 4U673 5BN5A 2NB0A 1EQTA 2B2UA 4TKOB 2Z1CA 4RGTA 3E5SA 5I2XA 2XRQD 2ZXOA 4RCNA 1PTOH 1QG7A 1I4PA 2K04A 3ITPA 5CV6A 5E3FA 3ZYYX 3GTPB 1A15A 4FVMA 4NKLA 3JAME 1I4QA 1PDQA 3QIAA 1CM9A 3SXHA 3NHHA 3KUPA 1SNCA 1LO5D 3P75A 1QB5D 5ELBA 3RZOB 1JWMD 2M9VA 1CQFA 2F0VA 4OIJA 3BDOA 1AW7A 3GTKB 1XWEA 3OW7A 1DD2A 3TP6A 3EA6A 3QJYA 1TR5A 1QILA 4GZYC 3M85A 3D3RA 1C48A 2YYZA 3NTHA 4J1MA 1PMRA 4QF4A 1RTOA 4DAVA 1M8AA 4RKBA 3RZDB 5D3DA 1TT2A 5A2QL 4IFDH 3I3CA 1GOZA 5IGGA 1V43A 4A3KB 5D14A 2KA7A 3IAYA 1EY6A 2SEBD 4XT3B 1FNUA 1QNKA 2C9OA 3MAQA 1QNUA 1A3UA 1C4QA 2E75C 1A3VA 3MXPA 1JR0D 4MN3A 5EPLA 1L0XB 1FNVA 3WDNA 1XTCD 1PRTB 1B1ZA 3MC0B 2WAQB 1B44D 1LV9A 3S1MB 4NDXA 4LAAA 1GUNA 2IWHA 5K36H 3MXNA 3M7NA 1JWUD 1ML0D 3MTSA 3QO2A 2EPBA 1GJXA 3I72A 2K1BA 2J0TD 1SBBB 2MJ8A 4ZKCB 3DWQA 1EYAA 4RGMA 5IGEA 4KKUA 4LK1C 4IFDJ 4NP5A 4KJNA 1XYIA 3SHLA 4CGYB 3F2UA 4IUNA 3K5LA 2O2LD 3OIQA 3OPOA 2AQ3B 3IFTA 4FXDA 1JC7A 5BN4A 4Q5VA 2A6EC 2HCCA 5CV4A 2F0KA 5E1FA 1Q8IA 2F0IA 3NK9A 4CBVA 3W2DA 5JVG3 2AWOA 3FPUB 3T53B 5JAVA 1B9MA 3HP3A 4K2KA 5C44B 3K59A 2KCCA 4K6DA 5M5WB 1SNDA 1ZYRC 4YIJA 3RUZA 1Y8NB 2O4XA 4PQXA 1H9SB 1MGSA 4RHRA 4S3SA 3L9AX 2NWGA 4KD3A 2KCNA 1HFNA 2F0SA 3GTJB 3SEBA 4A3GB 5KYLA 2OT2A 5IODA 1IYUA 5CV7A 1BBXC 3M4OB 1TWHB 5FO9B 1Q1BA 4N9PA 1BQQT 1SSOA 1PFBA 5EJWA 3K5OA 4G7OC 2K7VA 1K8MA 5E4WC 4R9WA 2Q8RE 1MSGA 1ET9A 1ONLA 3H91A 5I6YA 3U9SA 3HOWB 4F7XA 1KDBA 1F2YA 1G6ZA 3S1QB 4CJ1B 3A56A 4IFDG 1OXSC 1QJOA 2LFNA 1RDPD 1STAA 4DAYA 2IPKD 1KTKA 4DU9A 2FMCA 1Q12A 4F87A 1WTPA 4KY6A 3BVGA 3QG1A 5IOCA 2EVBA 1ENFA 2F0GA 3OWEB 4IZ8A 1X3QA 2L4NA 2JA5B 2WIIB 1X3PA 1TY2A 2I46A 4WJWA 3BYYB 3IFDA 3S2HB 2Z4HA 4IUPA 2ICIA 1H9SA 1WTVA 4ZUJA 1WTRA 4AYBB 3NTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ULL A;  1QOH A;  1CQF A;  4P2C B;  1C48 A;  1CZW A;  4M1U B;  1D1I A;  1QNU A;  2GA4 B;  3MXG A;  2BOS A;  1D1K A;  1R4P B;  1C4Q A;  1BOS A;  2XSC A;  1R4Q B;  1CZG A;  1DM0 B;  2C5C A; 
#chains in the Genus database with same CATH topology
 1JOK A;  2KCM A;  4IJL A;  2A74 C;  2BE5 C;  2B8G A;  4ILW A;  2AUK A;  2AMC B;  3MEH A;  1F2L A;  3K80 C;  1IYV A;  1KXL A;  4POG A;  1TS4 A;  4YWK A;  2Q8T A;  1K83 B;  4CJ2 C;  5K5P A;  1Z7T A;  1C0A A;  2EYH A;  4LF7 L;  3H3V C;  1A6X A;  1EQV A;  2EYM A;  2PQE A;  1X32 A;  4DR3 Q;  1V9P A;  4A93 G;  1LTT D;  1U4M A;  3HS0 C;  4BY1 B;  5LMN W;  4OX9 Q;  3HOV G;  1KDC A;  2N3S A;  5GAG C;  5C3E G;  4OEM B;  3C1E A;  5IGF A;  2I5M X;  3PUW A;  4MHE A;  4ABN A;  3RNU A;  4LF6 Q;  2J4X A;  4C3J G;  1PRT C;  1Z6H A;  2FXQ A;  1N32 L;  1NMG A;  1Y1V B;  1PTO D;  1GD7 A;  5F2D A;  4O1N A;  2PCF B;  5IT9 L;  1CHP D;  1S5F D;  2D62 A;  4BA2 I;  4QIW E;  2K6A A;  5AFW A;  4OO1 G;  2NN6 H;  1VF5 C;  1VQH A;  2EY1 A;  3SE0 A;  1O7Z A;  1E22 A;  3K7A B;  2E8G A;  3V05 A;  3PIP 3;  4JI3 L;  4EVO A;  1EUJ A;  4X66 L;  2IX3 A;  3VDY A;  4JI6 L;  2L0C A;  2PW7 A;  1SE2 A;  1XNR Q;  1KIX A;  4QGU A;  3DHQ A;  4YY3 L;  4A3B G;  1YHQ A;  5DAU A;  4DV0 Q;  1SYF A;  2BA1 A;  4DR6 L;  1SNQ A;  4HED A;  4JBM A;  1ESR A;  3R8B A;  3J80 L;  1WOC A;  5HUR A;  5FLX L;  5D3I B;  5M5W H;  2Y0S B;  1J5E L;  1WI5 A;  2EYO A;  2KED A;  3KDF B;  4HAE A;  1Q90 A;  3CRL C;  1JB3 A;  1R9T B;  1SYC A;  4LW1 A;  4G4K A;  2L1B A;  3OYY A;  4LFA Q;  2WV6 D;  1RKN A;  3SVM A;  5CV8 A;  1TU2 B;  1OXU A;  4LF9 Q;  3A8I E;  2F0P A;  3ERQ A;  3P7J A;  1YNX A;  2D9U A;  2MHV A;  1XX8 A;  4GOP A;  3NEN A;  3E0E A;  3M4O H;  4IPG A;  1PFM A;  1TWH H;  4Z9C B;  4A3M B;  1N8R C;  3GTQ B;  4BBS B;  3L3O C;  5IP9 G;  1EY0 A;  1PFN A;  1VQG A;  4K0K L;  1HHV A;  1IL2 A;  1STH A;  1N34 L;  2A68 D;  1JT8 A;  1DCZ A;  2RDG A;  2K75 A;  2CHB D;  2DJF C;  4KKT A;  3U50 C;  1AP0 A;  1Y8O B;  2QKI C;  1FGB D;  3NEL A;  2VUM G;  5G3L D;  4HMJ A;  4X64 Q;  3ERS X;  1XTD A;  1PFS A;  4LF8 Q;  1DJR D;  1DOL A;  4NB3 A;  2Z6K A;  3S1Q H;  4ZQ3 A;  4WJ4 A;  3MFG A;  3GV3 A;  4ZKB B;  2MUY A;  1PVO A;  1KHI A;  1XXG A;  1J9O A;  3CPW A;  1DM0 B;  4AQY Q;  1STG A;  4HCE A;  3VR6 A;  1J8I A;  3RD4 A;  1E24 A;  1SJE D;  2AQ1 B;  2F3W A;  3ULJ A;  1X9N A;  1K8A C;  1K28 A;  5AJ3 L;  2R92 B;  4MNO A;  1JJ2 A;  3N52 A;  1F9S A;  1QWY A;  2F4I A;  3TP7 A;  1CKN B;  5CBE E;  2JSO A;  1WJJ A;  2VQE L;  1PYB A;  1WTO A;  3S2D H;  3NP8 A;  3A8K E;  4JOI A;  2BCO A;  4IJH A;  3FKI B;  4X3T A;  5C4X H;  4CKC A;  3NEM A;  1JQY D;  1LT4 D;  1D5M C;  1HNZ Q;  2JA5 H;  3WOF A;  3PUY A;  1EFI D;  5EBC A;  3A5U A;  2D0O A;  3KDF A;  2RBM A;  2K33 A;  4OWT B;  4C3I B;  2YU9 H;  3LWE A;  2HHH L;  1H9K A;  3CCL A;  3S2H H;  1A0I A;  1HRJ A;  3PUV A;  5G3L F;  3T16 A;  3F1Z A;  1GO3 E;  1HXY D;  2XVS A;  3DXJ C;  3D8G A;  3U4Z A;  2B8F A;  2X6L A;  2RHS B;  1QZG A;  4U68 A;  4JCV E;  2WAC A;  2EZV A;  1VQ7 A;  2F0W A;  2K01 A;  2SOB A;  2L55 A;  3AFQ A;  2R93 G;  5EKK A;  4K6L A;  5T1I A;  2EE1 A;  3KLR A;  4A3L H;  2PPB C;  1SYE A;  1HNW Q;  1TY0 A;  5CR3 A;  2RKS A;  3DMU A;  4R8I A;  3BDC A;  4TSS A;  4EQO A;  3SDZ A;  2C35 B;  1NJI C;  5FK9 C;  1ZKO A;  1YZ6 A;  4BY1 H;  4APV A;  2UUC L;  1MI2 A;  4NXM Q;  4IQZ A;  3PUZ A;  4GLA C;  2B63 H;  1BNZ A;  5DNF A;  1BBW A;  5GAD C;  1EZ8 A;  1GUG A;  3DLL A;  2F0L A;  2IY5 B;  1BCP B;  3V2T A;  3K58 A;  1Y1V H;  4OHJ A;  1BR9 A;  4R4O A;  4XIG S;  1T9H A;  4NXN Q;  1EY4 A;  4X65 Q;  1P16 A;  3DEP A;  1QE6 A;  1XNQ Q;  2KJX A;  5GAH C;  3FP9 A;  1K3R A;  5IYD G;  2HIV A;  1AEX A;  4HCS A;  1EU3 A;  3K7A H;  3CC4 A;  2JA7 B;  4WFN 3;  2NN6 G;  4DUY Q;  3UDF A;  1CKN A;  4GLV B;  3M3Y B;  2YTY A;  1GUT A;  1IKL A;  1SYB A;  1EWI A;  2B2Y A;  2RCF A;  4NW2 A;  1AZP A;  3HG9 A;  2RSO A;  1KC8 C;  3HKZ B;  5NUC A;  4DV6 L;  1K8O A;  2ZTE A;  3M4Y A;  1SFO H;  1SDF A;  3ULL A;  2MPM A;  1F9P A;  4POF A;  1EY5 A;  3D4D A;  1PH1 A;  4LUZ A;  3K81 C;  2Z6K C;  3J81 L;  2ZXP A;  1LAC A;  4B3M Q;  1BXT A;  3T4A C;  3AU7 A;  5M5Y B;  1Q3L A;  1E3P A;  5GAE C;  1HNX Q;  1EU4 A;  1W6J A;  2MO1 A;  3IL8 A;  3K8A A;  3VYS A;  1U0L A;  2R7D A;  4HIM A;  1SYD A;  1I4X A;  3EFX D;  3GDE A;  1G8Z D;  1W6K A;  2KHS A;  3K57 A;  3I73 A;  4DV5 L;  3P20 A;  4A3M H;  4XXE A;  3VA7 A;  1YI2 A;  3GTQ H;  4BBS H;  4RGN A;  2SDF A;  1KNA A;  1H9J A;  2JYO A;  1IKM A;  1Q46 A;  4BXX H;  1CZG A;  3CCJ A;  1EIH A;  1F77 A;  4UDU C;  5CV5 A;  1KL9 A;  1SJH D;  4XYO A;  3GQB A;  4J6H A;  3KLS X;  1PZI D;  3C2P A;  1HZB A;  3BU2 A;  2F0O A;  2XRS D;  2F4V Q;  1HTL D;  4DFA A;  1GHJ A;  2A69 D;  3J7A F;  5H1S E;  4ZRZ A;  2RA4 A;  4DV1 L;  3PQI A;  2CH4 A;  1WTH A;  1O7L A;  1Y1W G;  3FMC A;  2MQH A;  2R7Z H;  2RCN A;  1EYC A;  4R4T A;  2E2J H;  1VQF A;  1B70 B;  2KCT A;  1O7I A;  3JAM L;  2BE5 D;  1JJC B;  2EOT A;  1C7Y A;  1B53 A;  1S4Z A;  1A63 A;  4ZUI A;  2D0P A;  4KMU C;  3TS0 A;  1CQV A;  4XYQ A;  1CHQ D;  4JYA Q;  1I94 L;  3FKI H;  1VQC A;  1LTR D;  1UE5 A;  1C8C A;  2N8N A;  3FDT A;  5C4X G;  2VB2 X;  2CFM A;  4R1J A;  4C3I H;  2VB3 X;  1QUQ B;  5M3M B;  2JA5 G;  1PRT D;  1D6E C;  5JPN C;  2E2H B;  4PMB A;  4L6T B;  2QDB A;  2BDN A;  3OHX C;  1RJT A;  1Y8P B;  1FJG L;  1GM5 A;  3KF8 B;  4DK0 A;  1P8L A;  1T5X D;  4P71 A;  2EJG C;  2MGS A;  2JXM B;  4AYB G;  1GXD C;  3F8T A;  1IHZ A;  2B2T A;  3WWV A;  2UUB Q;  3MEF A;  2F0F A;  2B2Y C;  1HUM A;  2LKV A;  1MD2 D;  2EY6 A;  3CCQ A;  1SN8 A;  1IW7 C;  2N78 A;  3VR5 A;  4O0A A;  4DNR B;  1TKW B;  3TP5 A;  3WOE A;  1HFG A;  1EOT A;  2EDG A;  4DV7 L;  3GTL B;  4DV3 Q;  1JOO A;  3T56 B;  5ELO A;  1S5E D;  4XDX A;  4KN4 C;  2HCI A;  2R6G A;  1SRO A;  3D4W A;  4EQP A;  3NTI A;  2B63 G;  3HOU B;  1CSQ A;  3D4R A;  4GN4 B;  1GHK A;  2XWJ B;  4RFB A;  4JI1 L;  4JI4 Q;  2Q2H A;  4RG1 A;  1PRT F;  1MSH A;  1EIF A;  5I4D A;  1CK1 A;  1PXU A;  3HGB A;  2F03 A;  5T1G A;  1W3S A;  4QIW B;  4JC0 A;  1CTM A;  2OEO A;  4JI2 Q;  2KUM A;  1HR0 Q;  1VQ5 A;  2JA7 H;  1L0Y B;  2CW0 D;  4JV5 L;  5LL6 S;  1NE3 A;  1PH7 A;  5EPJ A;  3CF5 A;  4K14 A;  3VR3 A;  4B08 A;  2R3Z A;  1L1O B;  4KJO A;  2IX1 A;  4DN4 M;  3AB9 A;  3I2Z A;  2RDH A;  3BZK A;  4DPG A;  5C3W A;  1WCM G;  4XQN A;  4A3J B;  3T13 A;  3M4Q A;  4O2D A;  1I6H B;  4QY7 A;  1VQ6 A;  1IBL Q;  1BCP C;  4WRD A;  3RZO H;  5M5Y H;  4OWW B;  1HPC A;  2K5N A;  1I4G A;  4DGZ A;  1XMO L;  3KF8 A;  3HOX G;  1KD1 C;  2JA6 B;  3L7Z C;  5J1Z A;  2EXZ A;  1G91 A;  4KD4 A;  1UEA B;  1I3Q B;  4K8I A;  1HUN A;  4JK1 C;  4A3M G;  4BY7 G;  4K5V A;  4BBS G;  1SNO A;  5LMN Q;  3H0G G;  1DYQ A;  1YNJ C;  3T1H Q;  2D2C C;  1M4V A;  4LF7 Q;  3EN2 A;  5EKI A;  5EQ0 A;  1PYS B;  1Z9F A;  4CKB A;  2WB1 G;  4JBW A;  4GN5 A;  1V8Q A;  4RWS C;  1TQO A;  1STE A;  3EQL C;  3BYT B;  2CH4 W;  1ENC A;  3DUZ A;  4CDD C;  2OQK A;  2I07 B;  5TSS A;  4RAU C;  3ND8 A;  2IHF A;  3NSW A;  4GKJ L;  3SGI A;  1MBY A;  1EOV A;  3RZD H;  2F0D A;  3TQY A;  1N32 Q;  2K5V A;  3W3A A;  1X65 A;  1XMQ Q;  1FVI A;  2UXC Q;  1H9M A;  2B2T C;  2R7Z G;  1B4O A;  2OXP A;  2M2L A;  3HRZ C;  2IT1 A;  3S24 A;  2QCP X;  2WP8 J;  2E2I B;  2FMM A;  4UHV A;  2Q8I B;  4RCO A;  1EL0 A;  4PG3 A;  4X66 Q;  4A3I B;  4FDB A;  4JI6 Q;  5CC4 A;  1N33 L;  4YY3 Q;  4DR4 L;  1V1P B;  5M3F G;  4XTC S;  4FF3 A;  2JEA I;  1PHJ A;  1STN A;  1IZ6 A;  3J80 i;  3I4M G;  3H3V H;  5M3M H;  1J5E Q;  4LMQ D;  2KOL A;  4RMF A;  1VQE A;  1GUO A;  3U4V A;  5I2Y A;  4HMI A;  2E2H H;  5FLM H;  3AYH B;  1XPR A;  4E6I A;  4C3I G;  1O78 A;  1KDA A;  1OTC A;  3QWN A;  4O42 A;  1HZC A;  2N88 A;  2XGT A;  2J7Z A;  3CHB D;  1EY8 A;  1RD9 D;  4X6A H;  1LM0 A;  1LT5 D;  4LF5 L;  4HSP A;  2DNE A;  3S1M H;  2QW7 A;  3OWF A;  3DEO A;  1XJV A;  3NXW A;  2ZXR A;  1CT1 D;  1ET6 A;  2VQF L;  2F1M A;  4FF2 A;  1PLF A;  2PO4 A;  1JMC A;  4FO2 A;  3RMH A;  2MP1 A;  5C0X I;  2L5T A;  3B6Y A;  5K36 G;  3HZX A;  3AFP A;  4UP7 A;  4ODG A;  4OON A;  3E6Z X;  4ID6 A;  5C0X H;  3HOZ G;  4GNX B;  1N34 Q;  3R2T A;  4PV1 C;  1VS0 A;  2ZJR A;  3URY A;  2IL8 A;  1H9R A;  2ID0 A;  4R4I A;  2KQ3 A;  3CC2 A;  3HOU H;  1VQ9 A;  2PNH A;  4XT1 B;  5ELC A;  1MKH A;  3OMC A;  5IGC A;  2JE6 I;  2PMZ E;  1BBU A;  2TMP A;  3G48 A;  1VQD A;  2RDF A;  1KRS A;  1UUP A;  2L11 A;  2G5D A;  2H4O A;  5E7N A;  2B2V C;  5EPK A;  5ELF A;  1ILP A;  4IPD A;  1KAB A;  2GA4 B;  5C5L A;  4CHT B;  1BDO A;  1HTP A;  2JA7 G;  1TWF B;  4CKE A;  4KV6 A;  1TS2 A;  3FEW X;  1B3A A;  1O80 A;  4DV4 L;  3KLS A;  2NUC A;  4JI0 L;  1V1O A;  1ENA A;  1E2W A;  2KEC A;  5C44 H;  3GTG B;  1LTB D;  4R4C A;  3HEJ A;  2EY5 A;  1U4P A;  1I6H H;  2NVY B;  4DA2 A;  1KAW A;  4YWL A;  4BS9 A;  1IBM L;  3VR2 A;  2HHH Q;  1PTO B;  1UAP A;  4C1N I;  1U5K A;  1CI3 M;  2K28 A;  3NBH A;  2JA6 H;  4XQJ A;  1RIP A;  5IGD A;  5I9P A;  1IYJ B;  5IWA L;  1HQM C;  1X3E A;  3Q6S A;  2FJ2 A;  5KEE A;  3CCS A;  4B3R L;  1EIG A;  4FXG C;  3PO3 B;  1TWA B;  3GTJ H;  1LLR D;  1VF7 A;  4LF4 L;  1AE3 A;  1I3Q H;  4A3G H;  1B8A A;  4DF7 A;  4QUC A;  5IGB A;  1A2T A;  1L1O C;  1CA6 A;  1EEI D;  1D1K A;  1R4P B;  1UNS A;  2MNA A;  2K5Q A;  4TRD A;  2F0H A;  4OXP A;  2XSC A;  3X3M A;  1WD1 A;  3T1Y Q;  3SK5 A;  1M90 C;  1OO9 B;  2VXW A;  5EBD A;  1RTN A;  2BH8 A;  1HCZ A;  4LFB Q;  2LXJ A;  2SNM A;  1N36 L;  1TWC B;  3I4N B;  1I4H A;  4ME5 A;  1SRU A;  1VMP A;  3HKS A;  1STB A;  3S14 B;  4BBR B;  3HOW H;  1AFP A;  3U9O A;  1NNX A;  4L8J A;  5ELE A;  4QUF A;  4BA1 I;  3P1H A;  4A3E B;  3F2D A;  3D31 A;  3NQT A;  2LMC B;  2QEX A;  1JB7 A;  3BVZ A;  2E2I H;  3T51 B;  1CSP A;  1U4L A;  4MIU A;  4A3K G;  4KI0 A;  3J81 j;  4A3I H;  1W2B A;  4OX9 L;  3OIP A;  2Z4I A;  3GTO B;  1SLJ A;  2G9H D;  5CGK A;  1DOK A;  4LF6 L;  4CDE C;  1Z47 A;  1D7Q A;  3K7U C;  1WD0 A;  3CCU A;  2F0T A;  3MWY W;  1XPO A;  4H13 C;  1LUZ A;  2ZJQ A;  1STY A;  1VQL A;  4A3D B;  3RLO A;  4JI7 L;  3S9W A;  2PQA B;  2O5J C;  1NR2 A;  2P5Z X;  4HJ7 A;  3J81 i;  1ZXT A;  4DR5 L;  1RF2 D;  3UDX A;  4DV2 L;  3STB C;  5JOB A;  5FO7 B;  3VYR A;  3L2P A;  2B2W A;  2X6G A;  5FLM G;  2PZU A;  4FF1 A;  4MTN A;  2JP1 A;  1SEB D;  2RHQ B;  1X56 A;  3R3O A;  3FRP B;  4DV0 L;  2WAQ G;  4L5T A;  2A6E D;  1D2B A;  3TRZ A;  1G2T A;  3GP7 A;  4DR1 Q;  4GN3 B;  1FR3 A;  4EX5 A;  1AZQ A;  2R61 A;  3J7A V;  5FKA C;  2Q2T A;  3PF4 A;  1EWC A;  2JA8 B;  3BG3 A;  1K83 H;  2QGQ A;  4DK1 A;  1IBK Q;  1SE8 A;  1VQJ A;  1WTQ A;  2DN8 A;  3KLW A;  1EZ6 A;  3OOC A;  1IL8 A;  1F2M A;  3UI2 A;  3UDG A;  2VL6 A;  3VR4 A;  1JWS D;  3CKI B;  1BCP D;  4HN7 A;  1ZYR D;  4AYB E;  3S1R B;  3H94 A;  1PH2 A;  1SNM A;  4B3S L;  4V19 0;  5E4X A;  2VZA A;  3LWU A;  2OQ0 A;  4JBK A;  5C5M A;  4HTH A;  2EIF A;  5EGT A;  2UUA L;  3C3L A;  3TS2 A;  4HJA A;  4KY7 A;  4UPA A;  4FYD A;  3GD7 A;  3JAM i;  2ES2 A;  4F8M A;  4OL7 A;  4IPH A;  4TVA B;  4KTA A;  1F9R A;  2LSS A;  2K32 A;  5M9O A;  1QVC A;  2EYJ A;  1PZK D;  3F2C A;  2E74 C;  1B50 A;  1YIJ A;  2E2D C;  5C4Z A;  4HSV A;  3FVQ A;  3KBG A;  5C3E B;  2AQ2 B;  2VNU D;  3CD6 A;  1NSN S;  3EIV A;  4X64 L;  2PZW A;  1YNJ D;  4I65 A;  4RHS A;  3K5M A;  4GNX C;  4N9T A;  4RA8 A;  2CQO A;  3BZC A;  2I0Q A;  3GTG H;  5JJI A;  2NTT A;  4C3J B;  5GRO A;  3A7A B;  4P72 A;  4LFC Q;  1S5C D;  3OMG A;  3RR5 A;  2NVY H;  1KLG D;  1DGS A;  4JI5 Q;  2QA4 A;  4OGQ C;  1NY4 A;  2EJF C;  5C44 G;  3PIO A;  2WIN B;  5ELN A;  4DUZ Q;  4AQY L;  2EY2 A;  1B2T A;  1SE3 A;  3DM3 A;  2PQA A;  1R9T H;  2CWA A;  3R2I A;  2NYZ D;  1WTW A;  1KNE A;  4CJ0 B;  1VQP A;  1NBW A;  1BCP F;  2WKD A;  3DWP A;  2IW3 A;  1YNN C;  2F0Q A;  3BVM A;  2CQA A;  3SK6 A;  3NWT A;  2KVM A;  4FF4 A;  1ROD A;  1TWA H;  2JA6 G;  4A3B B;  3CU7 A;  5A2Q E;  3C1F A;  4WOR A;  4ZAI A;  3NQI A;  2AKW B;  5CMD A;  1HNZ L;  2ZM6 Q;  3Q24 A;  1PYW D;  2L12 A;  1EIY B;  3ONA B;  3GV6 A;  2EJM A;  4A3G G;  1LTA D;  4XQQ A;  1TVX A;  4HJ5 A;  1D1I A;  1LTS D;  1JOQ A;  5CV9 A;  3E3X A;  1XPU A;  2F52 A;  3S16 B;  3CQZ B;  2Z8L A;  1EFW A;  1NAP A;  3ICE A;  5D65 A;  3K0Y A;  4DAM A;  3S14 H;  5BR8 Q;  2ICE C;  4X3S A;  2B2W C;  3MXN B;  1DOM A;  1WTX A;  2B39 A;  3PF5 A;  1PTO C;  5JPM C;  2UU9 L;  2PI2 A;  4KHV A;  4JI1 Q;  1MJC A;  3MXG A;  3AQQ A;  1BUV T;  1K3B C;  4HIK A;  1PH4 A;  5C4J B;  5KYI A;  3HOW G;  2QIL A;  4RGO S;  5COY A;  4X62 L;  1SE4 A;  3FPP A;  4IAL A;  4R4Q A;  3S15 B;  3PUX A;  4DK3 C;  2AHO B;  2WB1 E;  4QMG A;  2R92 H;  4NXM L;  1II3 A;  2DNC A;  4LWC A;  3GTO H;  2VUM B;  4JV5 Q;  3E9H A;  2NBF A;  2WFW A;  4IUT A;  3QOJ A;  4A3I G;  2GN5 A;  5IYC H;  4GLX A;  3D0F A;  1TII D;  5JJK A;  5CBA E;  4IFD I;  2ZJP A;  3TSS A;  4A3D H;  1K8G A;  2KHI A;  4X65 L;  1DZ1 A;  1XNQ L;  4WJ3 M;  2A6H C;  4K5X A;  2O5I C;  3I90 A;  4H7B A;  4C56 C;  1EY7 A;  4P2C B;  4JG2 A;  1ICW A;  1LT3 D;  4G7H C;  1XMO Q;  1MHW C;  4KHP Q;  2AUJ D;  3NE5 B;  3S17 B;  4YHH Q;  1JE4 A;  4QL5 A;  2D5D A;  3I55 A;  2SNS A;  1YBY A;  2A68 C;  2A5H A;  1VQM A;  1A3T A;  2B2U C;  2JA8 H;  1BKB A;  3GTM B;  4B3T Q;  3CAM A;  1U4R A;  2DY7 A;  5IT9 c;  3EVQ A;  4C1N K;  4A3L G;  1VQ8 A;  1CKO A;  5J39 A;  1FGU A;  1LTI D;  1HNX L;  2PZT A;  3A54 A;  1WFQ A;  4KKS A;  5JEA H;  2E5L L;  1QVG A;  1D8L A;  4Y52 H;  1BOS A;  4KY5 A;  2A1A A;  1Q8K A;  3DM1 A;  4K8J A;  4BY1 G;  5KIX A;  3W1B A;  1KLU D;  3A8J E;  2PMZ B;  4IUU A;  3LX0 A;  4LNQ A;  2R93 B;  1E2V A;  4IOA A;  1EQR A;  5I9O A;  1NR4 A;  4LUV A;  4NPS A;  3J80 c;  3NBI A;  5FLX c;  2NVX B;  2PW5 A;  2NZ1 D;  2ZTC A;  3CCE A;  4G7Z C;  3S1N B;  3PCO B;  1OXT A;  3J7A 5;  4L5Q A;  2UXD Q;  1Y1V G;  1F9Q A;  2FIN B;  4UAI A;  5FO8 B;  2V1C C;  1H95 A;  4JI8 Q;  5DM7 3;  3ND9 A;  1CFM A;  2KHJ A;  3E0J A;  3NPP A;  3VA5 A;  4DK6 C;  2F0U A;  1CA5 A;  5J22 A;  2HQE A;  1UE7 A;  4C3H B;  4YCU A;  3DWA A;  5M5X B;  4DR2 Q;  3M3Y H;  1N33 Q;  4PMW A;  5ELD A;  4DR4 Q;  3SK8 A;  3SR1 A;  3TZU A;  3RLF A;  2Z6B A;  4OO1 I;  4TQU S;  3VYT A;  2HDL A;  3IKJ A;  4PNY A;  3NUC A;  1SMY C;  2UXB Q;  1SAP A;  3K6O A;  4X3K A;  4OO1 H;  4AIM A;  1YJW A;  2Y0S G;  4P75 A;  4QB4 A;  3FHW A;  4DAY B;  1QUQ A;  5LMU L;  1U9R A;  2OF1 A;  3D6W A;  1HH2 P;  1JIC A;  4C2M B;  1Q82 C;  1LAB A;  1PH8 A;  1BVS A;  1CKM A;  1WVL A;  3QB3 A;  1E1O A;  1E0B A;  5GQO A;  1Y69 U;  5IYB H;  2XWB B;  3PV0 A;  1NCV A;  2VQF Q;  2BH2 A;  2NTS A;  3Q23 A;  1NUC A;  4Q0F A;  3H6M A;  2YTX A;  2JN4 A;  2B2V A;  1JCK B;  4DR7 L;  1F2Z A;  1UEB A;  4M1U B;  2DGY A;  2EYF A;  4QJF A;  1BO0 A;  4RH6 A;  2JJQ A;  5COR A;  1HJP A;  4NMZ A;  5JEA J;  3S16 H;  2QF7 A;  1GVP A;  1LTL A;  3PGZ A;  2XN9 C;  3D6C A;  4UP9 A;  4A3F B;  2PYK A;  4JPB W;  1VCI A;  2RQX A;  4V0B A;  2C5C A;  2Z9H A;  5JVH 3;  3KBX A;  3CXC A;  3I70 A;  1ESF A;  4FP5 D;  4X3U A;  2HD3 A;  4BXX G;  2I5L X;  3CCR A;  3STB D;  5C6A A;  2ENB A;  3G6J B;  5CYU A;  5EKL A;  1OXX K;  2EYP A;  3MHB A;  3X3N A;  3TN2 A;  5KNC A;  5C4J H;  4GS3 A;  4DXG A;  2K5W A;  2DY8 A;  3S15 H;  1S5B D;  3I8Z A;  4HJ9 A;  1GUS A;  2VUM H;  1E2Z A;  1ILQ A;  2XNA C;  1NTG A;  2NVQ B;  4N8F A;  3RN5 A;  1A62 A;  2BDO A;  2R92 G;  2B3G A;  4JI3 Q;  1PH6 A;  2HUG A;  1SR3 A;  2K5H A;  1GUW A;  1Y1W B;  1Q86 C;  1L1O A;  3OSO A;  4F88 A;  3FKI G;  1SNP A;  4DR6 Q;  3I91 A;  5IE8 A;  3BZD B;  1G29 1;  1X54 A;  3G7L A;  5J3B A;  1S40 A;  1VQN A;  4PZ6 A;  4B9W A;  1HR0 L;  1IBM Q;  3NWS A;  2H1E A;  3MFY A;  4IO9 A;  3PMF A;  5C4H A;  1AN8 A;  1A2U A;  1L2F A;  1I50 B;  2RVL A;  4B3R Q;  1I5F A;  4J15 A;  3S2D B;  2A73 B;  2FHT A;  2PNR C;  3A55 A;  3BS1 A;  4H02 A;  4CDF C;  3MVV A;  4LJZ C;  5C4X B;  5IT9 E;  1K0S A;  2AWN A;  1ASY A;  3MXU A;  4RKL A;  5IY0 A;  3GTM H;  1QOH A;  3Q0A A;  3C46 A;  1K9M C;  4P74 A;  1G6P A;  1GKH A;  3M7G A;  1HQR D;  2KBN A;  2A19 A;  2YU9 B;  4PMC A;  2DJG C;  2A69 C;  3BDL A;  4K0K Q;  3A7L A;  3GTL H;  1DXM A;  3TP8 A;  3HOY B;  1TS3 A;  3A0J A;  3J80 E;  5FLX E;  1N36 Q;  4KHZ A;  2WAQ E;  4GOP B;  4G57 A;  5JEA G;  1YNN D;  3UE0 A;  2R93 H;  5JJL A;  2NVX H;  2CWP A;  3S1N H;  5BN3 A;  2YV5 A;  2KEE A;  3CW2 C;  1VMC A;  3MA2 B;  5A35 A;  3ERO A;  2F0J A;  4IUV A;  5LMN L;  1JOR A;  1OXV A;  3J81 c;  1HA5 A;  3T1H L;  3W5O A;  4R8N A;  2NZO A;  3I7F A;  4C3H H;  5M5X H;  5AJ3 Q;  1LTG D;  1RHP A;  2F0N A;  3O13 A;  2K05 A;  2B63 B;  4DAP A;  1A8V A;  2VQE Q;  3TBI B;  5KRU A;  3TZD A;  4H44 C;  3A74 A;  1O7Y A;  4EQN A;  1V1P A;  3K5N A;  3HKZ G;  1XMQ L;  1DON A;  4KN7 C;  5I6W A;  2UXC L;  5IYD H;  2L9H A;  4A3J H;  2NN6 I;  5IP7 H;  4JI7 Q;  1FD7 D;  4A3C H;  2NVT B;  4L63 B;  2KEN A;  5KGU A;  3ZJY C;  4DR5 Q;  4YCV A;  1YJ9 A;  4OEL B;  4DV2 Q;  4EGV A;  4M8A A;  4C2M H;  2BOS A;  4GKK L;  3QOL A;  1X3G A;  3OTO L;  1I4R A;  1ZEQ X;  4BWG B;  1D5X C;  4HJ8 A;  2HDM A;  3R93 A;  4ULL A;  3Q8D A;  2JK8 A;  1G2S A;  4DXF A;  5LHY 1;  5DM6 3;  4AH6 A;  5KNB A;  4KLK A;  5C0X J;  2LXK A;  1WCM B;  5IYB G;  1SFO B;  1CZW A;  3KF6 B;  2F0M A;  4A3F H;  2CVR A;  1I6V C;  1VQ4 A;  3JAM c;  4L5S A;  1EEF D;  3ULP A;  4DNI A;  5HGQ A;  3HOX B;  2A6H D;  4GNX A;  2GVA A;  1TS5 A;  2X69 A;  2UUC Q;  1EY9 A;  2CKZ B;  4ME3 A;  3JC6 6;  4EQ5 A;  1TXY A;  2HIX A;  4HR7 B;  3H15 A;  3PIO 3;  4B3S Q;  5ISR A;  1PTO F;  1KAA A;  3LNN A;  4IUQ A;  2F3V A;  5IIF A;  3A5Z B;  2ZTD A;  4IOC A;  4I7A A;  4BY7 B;  2UUA Q;  3TME A;  3H09 A;  2RSN A;  2CW0 C;  4OWX B;  1K73 C;  2OCE A;  3IRB A;  4ZLT F;  4FNF A;  3H0G B;  2FFK B;  1R4Q B;  4K2L A;  2K5D A;  1Q1E A;  1KRT A;  1T5E A;  2WB1 B;  2NVQ H;  3LGJ A;  5FOB B;  4DR3 L;  3J7Y W;  1IW7 D;  3CP0 A;  1KQS A;  2WKC A;  2K03 A;  1Y1W H;  4I7Z C;  5C3X A;  1EWH A;  2IJ0 A;  1QCB D;  4IN3 A;  4DV6 Q;  2GVB A;  4K5W A;  1S5D D;  2R7Z B;  3EJI A;  2K4K A;  3UDI A;  3TDQ A;  2BA0 A;  2E76 C;  2E2J B;  4IUR A;  4YCW A;  5M3M G;  4J8Q A;  2LS0 1;  3KJP A;  1I50 H;  2JEB I;  3QR8 A;  5JJZ A;  2Q2U A;  3N6R A;  5DEH A;  1VQO A;  1SXT A;  1SYG A;  1RCV D;  5M3F B;  2XIW A;  1XNR L;  4JW0 A;  3SK4 A;  3AMU A;  4DNT B;  3I4M B;  3RN2 A;  1FNW A;  2M00 A;  1WYD A;  3PO2 B;  4DV5 Q;  4HID A;  2HT1 A;  4QCL A;  1M1K C;  3KF6 A;  3Q22 A;  3CRK C;  4FXK C;  5LL6 X;  2G9D A;  2LY7 A;  1SMY D;  3GO5 A;  4ZYS A;  3I4L A;  4ZK9 B;  3KOJ A;  3HOY H;  1D5Z C;  5C0X G;  1TWG B;  2EYL A;  2H5X A;  1EYD A;  4LFA L;  5HGT A;  1YJN A;  4LF9 L;  1VDZ A;  2V4D A;  3M4P A;  1LT6 D;  3TRE A;  2UU9 Q;  4A76 A;  1PZJ D;  3J81 E;  1B9N A;  3PIP A;  3V96 A;  1MIU A;  5KND A;  3HOU G;  2F0E A;  4OIK A;  4DV1 Q;  2TSS A;  1V1Q A;  3VYU A;  4KK7 A;  3HOZ B;  1HA6 A;  4X62 Q;  1S3O A;  2IX0 A;  3KK7 A;  4Y7N B;  3T1Y L;  2ZT9 C;  2ASB A;  1JJG A;  1BF4 A;  1FYC A;  2QEJ C;  4LFB L;  3UE1 A;  4B9X A;  3L0O A;  4A93 B;  1TWF H;  3CME A;  3HOV B;  1NMF A;  4C3H G;  4H0L C;  3CCV A;  2N55 A;  3MZ5 A;  4U67 3;  2ATW A;  1B7Y B;  4QQB X;  1I94 Q;  5BN5 A;  1Q7Y C;  2NB0 A;  1EQT A;  4LF8 L;  2B2U A;  4TKO B;  2Z1C A;  4RGT A;  3E5S A;  5I2X A;  2XRQ D;  2NVT H;  4GOP C;  2ZXO A;  1HZA A;  4A3C G;  4A3J G;  5IP7 G;  1JE5 A;  4RCN A;  1LYL A;  1PTO H;  1QG7 A;  2VS1 A;  1X3F A;  1I4P A;  2K04 A;  3ITP A;  5CV6 A;  5E3F A;  3ZYY X;  3GTP B;  2N49 A;  1FJG Q;  1A15 A;  3PSI A;  3PO3 H;  1SMX A;  4FVM A;  4NKL A;  3JAM E;  3G6E A;  1WCM H;  1I4Q A;  1PDQ A;  3QIA A;  1CM9 A;  1IXR A;  3SXH A;  3NHH A;  3KUP A;  1SNC A;  2Y0S E;  1LO5 D;  3P75 A;  4IPC A;  1QB5 D;  1RL2 A;  3HOX H;  4A3F G;  2RF4 A;  5ELB A;  3I4O A;  3RZO B;  1JWM D;  2JQO A;  2M9V A;  3G4S A;  4ZCK A;  2E5L Q;  4DV7 Q;  4HIO A;  1TWC H;  1CQF A;  3KYH C;  3I4N H;  2F0V A;  1G51 A;  3BDO A;  4OIJ A;  5EAY A;  1X55 A;  3BJU A;  4BBR H;  4DR1 L;  3M9B A;  4BY7 H;  1AW7 A;  4JOI C;  4A4I A;  3GTK B;  1XWE A;  1MJE A;  3OW7 A;  1VQA A;  1DD2 A;  3H0G H;  4A3E H;  1IBK L;  1HNW L;  3TP6 A;  1UE6 A;  3EA6 A;  3E9I A;  5HY6 A;  3QJY A;  1TR5 A;  4L5R C;  3OW2 A;  1QIL A;  4GZY C;  3M85 A;  3D3R A;  3W1G A;  1YHA A;  1EYG A;  1C48 A;  2F3I A;  2YYZ A;  3NTH A;  3AEV A;  4J1M A;  2QDL A;  1PMR A;  4QF4 A;  1RTO A;  4DAV A;  1M8A A;  4RKB A;  3RZD B;  2MO0 A;  5D3D A;  5FJ8 H;  2EQS A;  1TT2 A;  5A2Q L;  4NXN L;  4IFD H;  3I3C A;  3CPF A;  1GOZ A;  5IGG A;  2MFI A;  1V43 A;  4A3K B;  5D14 A;  2KA7 A;  5LMU Q;  1B3Q A;  1YVC A;  4MZ9 A;  1PH3 A;  3IAY A;  1EY6 A;  2SEB D;  5M3F H;  4UY8 C;  3EBE A;  4DUY L;  4XT3 B;  1FNU A;  1QNK A;  2C9O A;  1YEZ A;  3I4M H;  3MAQ A;  1QNU A;  1YHB A;  4LFC L;  1A3U A;  1C4Q A;  1PH5 A;  2E75 C;  3PO2 H;  4JI5 L;  1PV4 A;  1Q81 C;  4DR7 Q;  4DUZ L;  2R7F A;  1A3V A;  3MXP A;  1VQB A;  2K50 A;  1JR0 D;  4MN3 A;  5EPL A;  4MTK A;  1L0X B;  4B3M L;  1FNV A;  3WDN A;  1TWG H;  1XTC D;  3U58 A;  2NZH A;  5DLQ E;  1PRT B;  1B1Z A;  3HOY G;  3MC0 B;  2WAQ B;  1B44 D;  1LV9 A;  3S1R H;  4NDX A;  3S1M B;  4LAA A;  1QVF A;  2ZM6 L;  1GUN A;  2IWH A;  3G71 A;  2IHE A;  5K36 H;  3MXN A;  3M7N A;  1YIT A;  2A8V A;  4GKJ Q;  3HOZ H;  1JWU D;  2CCZ A;  4Y7N H;  1ML0 D;  3F2B A;  3MTS A;  3QO2 A;  2EPB A;  2DUD A;  1GJX A;  3I72 A;  2K1B A;  2Z0S A;  2J0T D;  1SBB B;  4P73 A;  2MJ8 A;  4A93 H;  4ZKC B;  3DWQ A;  3HOV H;  2I5H A;  4DKA C;  1EYA A;  4RGM A;  5C3E H;  5IGE A;  3ER0 A;  5BR8 L;  4KKU A;  3CCM A;  1UE1 A;  2F4V L;  4LK1 C;  2PI2 E;  4IFD J;  1QZH A;  4NP5 A;  4C3J H;  2L15 A;  4KJN A;  1XYI A;  3SHL A;  4CGY B;  2YTV A;  3F2U A;  4IUN A;  3K5L A;  2O2L D;  2JA9 A;  2OTL A;  2VY3 A;  3OIQ A;  3OPO A;  3CC7 A;  2AQ3 B;  1FL0 A;  3IFT A;  2VW9 A;  4FXD A;  1JC7 A;  2EXD A;  5BN4 A;  3GTP H;  4Q5V A;  2A6E C;  4A75 A;  2HCC A;  5CV4 A;  2F0K A;  5E1F A;  1Q8I A;  2F0I A;  3NK9 A;  3K0X A;  4CBV A;  4A3B H;  4JYA L;  4LF5 Q;  1L0W A;  3W2D A;  5JVG 3;  2AWO A;  3FPU B;  3KFU A;  3T53 B;  3PO3 G;  5JAV A;  1B9M A;  3HKZ E;  3HP3 A;  4K2K A;  5C44 B;  2HQL A;  3K59 A;  2KCC A;  4K6D A;  5M5W B;  4PZ8 A;  1SND A;  4YWM A;  3CQZ H;  1Y14 B;  1PA6 A;  1ZYR C;  4YIJ A;  3RUZ A;  1Y8N B;  2O4X A;  3RLN A;  4PQX A;  1H9S B;  1MGS A;  4RHR A;  4KHP L;  4S3S A;  4YHH L;  3L9A X;  2NWG A;  4KD3 A;  2KCN A;  1HFN A;  2F0S A;  3GTJ B;  3I4N G;  3SEB A;  3GTK H;  3J7Z C;  4A3G B;  4BBR G;  1N9W A;  5KYL A;  2UUB L;  1AH9 A;  3CMA A;  2OT2 A;  5IOD A;  5IP9 H;  4B3T L;  1IYU A;  5CV7 A;  1BBX C;  3M4O B;  5L37 A;  1TWH B;  5FO9 B;  1Q1B A;  2OWO A;  4N9P A;  4UP8 A;  2K52 A;  4A3E G;  1BQQ T;  1SSO A;  1E7Z A;  4LUO A;  1PFB A;  5EJW A;  3K5O A;  1VQI A;  2K7V A;  1K8M A;  4DV3 L;  4G7O C;  5E4W C;  4R9W A;  2Q8R E;  1MSG A;  1ET9 A;  1ONL A;  3H91 A;  5I6Y A;  2Q2I A;  3U9S A;  2ALY B;  4DV4 Q;  4JI0 Q;  4JI4 L;  1ASZ A;  3HOW B;  4F7X A;  5IYC G;  1KDB A;  1F2Y A;  1G6Z A;  3S1Q B;  4CJ1 B;  4N8X 1;  1J6Q A;  1UWV A;  2UXD L;  4A3K H;  3TEH B;  5FJ8 G;  1AE2 A;  3A56 A;  4A3D G;  4JI8 L;  1CUK A;  4IFD G;  1OXS C;  4GKK Q;  1QJO A;  3OTO Q;  1ICF B;  4JI2 L;  2LFN A;  1RDP D;  1STA A;  4DAY A;  2IPK D;  1HZ9 A;  1KTK A;  4DU9 A;  4DR2 L;  2FMC A;  1Q12 A;  4F87 A;  2K14 A;  5IWA Q;  1E1T A;  1VQK A;  4PZ7 A;  2OTJ A;  3S17 H;  3H3V I;  1HR0 W;  2XTI A;  1K0R A;  1X6O A;  1EQQ A;  1WTP A;  4KY6 A;  4LF4 Q;  3BVG A;  4JVZ A;  3QG1 A;  5IOC A;  2EVB A;  2UXB L;  1ENF A;  4JBJ A;  2F0G A;  3OWE B;  1C9O A;  3PO2 G;  4IZ8 A;  1X3Q A;  2L4N A;  2JA5 B;  2WII B;  1X3P A;  1TY2 A;  3KJO A;  2I46 A;  4WJW A;  3NBH B;  3BYY B;  1IBL L;  2JA8 G;  2B29 A;  3IFD A;  4ALP A;  3I56 A;  3S2H B;  2Z4H A;  4IUP A;  2ICI A;  1H9S A;  1WTV A;  4ZUJ A;  1WTR A;  1S72 A;  4AYB B;  1PH9 A;  3NTK A;  3HFZ B;  4CDC C; 
#chains in the Genus database with same CATH homology
 1JOK A;  2A74 C;  2BE5 C;  2B8G A;  4ILW A;  2AUK A;  3MEH A;  1F2L A;  1IYV A;  1TS4 A;  2Q8T A;  1K83 B;  4CJ2 C;  5K5P A;  1Z7T A;  2EYH A;  3H3V C;  1A6X A;  1EQV A;  2EYM A;  2PQE A;  1X32 A;  1LTT D;  1U4M A;  3HS0 C;  4BY1 B;  1KDC A;  3C1E A;  5IGF A;  4MHE A;  3PUW A;  4ABN A;  2J4X A;  4C3J G;  1PRT C;  1Z6H A;  1Y1V B;  1PTO D;  5F2D A;  4O1N A;  2PCF B;  5IT9 L;  1CHP D;  1S5F D;  2D62 A;  4BA2 I;  2K6A A;  5AFW A;  4OO1 G;  2NN6 H;  1VF5 C;  2EY1 A;  3SE0 A;  1O7Z A;  3K7A B;  3V05 A;  3PIP 3;  4EVO A;  2IX3 A;  2L0C A;  2PW7 A;  1SE2 A;  3DHQ A;  5DAU A;  1SYF A;  2BA1 A;  1SNQ A;  4HED A;  1ESR A;  3R8B A;  3J80 L;  5HUR A;  5FLX L;  5D3I B;  2Y0S B;  2EYO A;  2KED A;  4HAE A;  1Q90 A;  3CRL C;  1JB3 A;  1R9T B;  1SYC A;  4G4K A;  2L1B A;  2WV6 D;  1RKN A;  3SVM A;  5CV8 A;  1TU2 B;  1OXU A;  3A8I E;  2F0P A;  3ERQ A;  3P7J A;  2D9U A;  2MHV A;  1XX8 A;  1PFM A;  4Z9C B;  4A3M B;  3GTQ B;  4BBS B;  3L3O C;  1EY0 A;  1PFN A;  1HHV A;  1STH A;  2A68 D;  1DCZ A;  2RDG A;  2CHB D;  4KKT A;  1AP0 A;  1Y8O B;  2QKI C;  1FGB D;  5G3L D;  4HMJ A;  1DJR D;  1DOL A;  4ZQ3 A;  3MFG A;  3GV3 A;  4ZKB B;  2MUY A;  1XXG A;  1J9O A;  1DM0 B;  1STG A;  4HCE A;  3VR6 A;  1J8I A;  3RD4 A;  1SJE D;  2AQ1 B;  2F3W A;  2R92 B;  3N52 A;  1F9S A;  1QWY A;  2F4I A;  3TP7 A;  5CBE E;  2JSO A;  1WTO A;  3NP8 A;  3A8K E;  2BCO A;  3FKI B;  4X3T A;  4CKC A;  1JQY D;  1LT4 D;  1D5M C;  3WOF A;  3PUY A;  1EFI D;  5EBC A;  2RBM A;  2K33 A;  4C3I B;  3LWE A;  1H9K A;  1HRJ A;  3PUV A;  5G3L F;  3T16 A;  1HXY D;  2XVS A;  3DXJ C;  3D8G A;  2B8F A;  2X6L A;  4U68 A;  2WAC A;  2EZV A;  2F0W A;  2K01 A;  2SOB A;  2L55 A;  5EKK A;  4K6L A;  5T1I A;  2EE1 A;  3KLR A;  2PPB C;  1SYE A;  1TY0 A;  5CR3 A;  2RKS A;  3DMU A;  4R8I A;  3BDC A;  4TSS A;  4EQO A;  3SDZ A;  5FK9 C;  1ZKO A;  1MI2 A;  4IQZ A;  3PUZ A;  1BNZ A;  5DNF A;  1EZ8 A;  1GUG A;  2F0L A;  1BCP B;  3V2T A;  3K58 A;  4XIG S;  4OHJ A;  1BR9 A;  1EY4 A;  3DEP A;  1QE6 A;  2KJX A;  1AEX A;  4HCS A;  1EU3 A;  2JA7 B;  4WFN 3;  2NN6 G;  3M3Y B;  1GUT A;  1IKL A;  1SYB A;  2B2Y A;  4NW2 A;  1AZP A;  3HG9 A;  2RSO A;  3HKZ B;  5NUC A;  1K8O A;  3M4Y A;  1SDF A;  2MPM A;  1F9P A;  1EY5 A;  3D4D A;  3J81 L;  2ZXP A;  1LAC A;  1BXT A;  3T4A C;  3AU7 A;  5M5Y B;  1Q3L A;  1EU4 A;  1W6J A;  3IL8 A;  3VYS A;  1SYD A;  1I4X A;  3EFX D;  1G8Z D;  1W6K A;  2KHS A;  3K57 A;  3I73 A;  3P20 A;  4XXE A;  3VA7 A;  4RGN A;  2SDF A;  1KNA A;  1H9J A;  2JYO A;  1IKM A;  1CZG A;  1EIH A;  1F77 A;  4UDU C;  5CV5 A;  1SJH D;  4XYO A;  3GQB A;  4J6H A;  3KLS X;  1PZI D;  3C2P A;  2F0O A;  2XRS D;  1HTL D;  4DFA A;  1GHJ A;  2A69 D;  3J7A F;  4ZRZ A;  2RA4 A;  1O7L A;  3FMC A;  1EYC A;  3JAM L;  2BE5 D;  2EOT A;  1B53 A;  1S4Z A;  4ZUI A;  4KMU C;  1CQV A;  4XYQ A;  1CHQ D;  1LTR D;  1C8C A;  3FDT A;  2VB2 X;  2VB3 X;  5M3M B;  1PRT D;  1D6E C;  5JPN C;  2E2H B;  4PMB A;  4L6T B;  2QDB A;  2BDN A;  1RJT A;  1Y8P B;  3OHX C;  4DK0 A;  1T5X D;  2EJG C;  2MGS A;  2JXM B;  1GXD C;  1IHZ A;  2B2T A;  2F0F A;  2B2Y C;  1HUM A;  2LKV A;  1MD2 D;  2EY6 A;  1IW7 C;  3VR5 A;  4DNR B;  1TKW B;  3TP5 A;  3WOE A;  1HFG A;  1EOT A;  2EDG A;  3GTL B;  1JOO A;  3T56 B;  1S5E D;  4XDX A;  4KN4 C;  2HCI A;  2R6G A;  3D4W A;  4EQP A;  3NTI A;  3HOU B;  3D4R A;  1GHK A;  2XWJ B;  4RFB A;  1PRT F;  1MSH A;  5I4D A;  1CK1 A;  1PXU A;  3HGB A;  2F03 A;  5T1G A;  4QIW B;  1CTM A;  2OEO A;  2KUM A;  1L0Y B;  2CW0 D;  5LL6 S;  5EPJ A;  4K14 A;  3VR3 A;  4B08 A;  2R3Z A;  4KJO A;  2IX1 A;  4DN4 M;  3AB9 A;  2RDH A;  5C3W A;  4XQN A;  4A3J B;  3T13 A;  1I6H B;  1BCP C;  4WRD A;  1HPC A;  1I4G A;  4DGZ A;  3KF8 A;  2JA6 B;  3L7Z C;  5J1Z A;  2EXZ A;  1G91 A;  4KD4 A;  1UEA B;  1I3Q B;  4K8I A;  1HUN A;  4JK1 C;  4K5V A;  1SNO A;  1DYQ A;  1YNJ C;  2D2C C;  1M4V A;  5EKI A;  5EQ0 A;  4CKB A;  4JBW A;  4RWS C;  1V8Q A;  1TQO A;  1STE A;  3EQL C;  3BYT B;  1ENC A;  3DUZ A;  2I07 B;  5TSS A;  4RAU C;  3ND8 A;  3NSW A;  1MBY A;  2F0D A;  3W3A A;  1H9M A;  2B2T C;  1B4O A;  2OXP A;  2M2L A;  3HRZ C;  2IT1 A;  2QCP X;  2WP8 J;  2E2I B;  2FMM A;  1EL0 A;  2Q8I B;  4RCO A;  4A3I B;  5CC4 A;  1V1P B;  2JEA I;  4XTC S;  4FF3 A;  1STN A;  4LMQ D;  2KOL A;  5I2Y A;  1GUO A;  4HMI A;  4E6I A;  4C3I G;  1O78 A;  1KDA A;  3QWN A;  4O42 A;  2N88 A;  2J7Z A;  3CHB D;  1EY8 A;  1RD9 D;  1LT5 D;  4HSP A;  2DNE A;  3OWF A;  3DEO A;  3NXW A;  2ZXR A;  1CT1 D;  1ET6 A;  2F1M A;  4FF2 A;  1PLF A;  2PO4 A;  4FO2 A;  3RMH A;  2MP1 A;  5C0X I;  2L5T A;  5K36 G;  3HZX A;  4ODG A;  5C0X H;  3E6Z X;  4ID6 A;  3R2T A;  4PV1 C;  3URY A;  2IL8 A;  1H9R A;  2ID0 A;  2KQ3 A;  4XT1 B;  5ELC A;  5IGC A;  3OMC A;  2JE6 I;  2TMP A;  2RDF A;  1UUP A;  2L11 A;  2H4O A;  2B2V C;  5EPK A;  5ELF A;  1ILP A;  1KAB A;  2GA4 B;  5C5L A;  4CHT B;  1BDO A;  1HTP A;  1TWF B;  4CKE A;  4KV6 A;  1TS2 A;  3FEW X;  1B3A A;  1O80 A;  3KLS A;  2NUC A;  1V1O A;  1ENA A;  1E2W A;  2KEC A;  3GTG B;  1LTB D;  3HEJ A;  2EY5 A;  1U4P A;  2NVY B;  4DA2 A;  4BS9 A;  3VR2 A;  1PTO B;  1UAP A;  4C1N I;  1CI3 M;  2K28 A;  3NBH A;  4XQJ A;  5IGD A;  5I9P A;  1HQM C;  3Q6S A;  2FJ2 A;  5KEE A;  1EIG A;  4FXG C;  3PO3 B;  1TWA B;  1LLR D;  1VF7 A;  4DF7 A;  4QUC A;  5IGB A;  1A2T A;  1CA6 A;  1EEI D;  1D1K A;  1R4P B;  1UNS A;  2K5Q A;  4TRD A;  2F0H A;  2XSC A;  3X3M A;  1WD1 A;  3SK5 A;  1OO9 B;  2VXW A;  5EBD A;  1RTN A;  1HCZ A;  2SNM A;  1TWC B;  3I4N B;  1I4H A;  4ME5 A;  1VMP A;  1STB A;  3S14 B;  4BBR B;  1AFP A;  3U9O A;  4L8J A;  5ELE A;  4QUF A;  4BA1 I;  3P1H A;  4A3E B;  3D31 A;  3NQT A;  2LMC B;  3BVZ A;  3T51 B;  1U4L A;  4MIU A;  4KI0 A;  3OIP A;  2Z4I A;  3GTO B;  2G9H D;  5CGK A;  1DOK A;  1Z47 A;  1WD0 A;  2F0T A;  3MWY W;  4H13 C;  1STY A;  4A3D B;  3S9W A;  2O5J C;  1NR2 A;  1ZXT A;  1RF2 D;  5JOB A;  5FO7 B;  3VYR A;  2B2W A;  2X6G A;  2PZU A;  4FF1 A;  2JP1 A;  1SEB D;  3R3O A;  3FRP B;  2A6E D;  1D2B A;  1G2T A;  3GP7 A;  1FR3 A;  1AZQ A;  2R61 A;  3J7A V;  5FKA C;  1EWC A;  2JA8 B;  3BG3 A;  4DK1 A;  1WTQ A;  2DN8 A;  1EZ6 A;  3OOC A;  1IL8 A;  1F2M A;  3UI2 A;  3VR4 A;  1JWS D;  3CKI B;  1BCP D;  4HN7 A;  1ZYR D;  3S1R B;  3H94 A;  1SNM A;  4V19 0;  5E4X A;  3LWU A;  5C5M A;  4HTH A;  5EGT A;  3C3L A;  4KY7 A;  4FYD A;  3GD7 A;  4F8M A;  4OL7 A;  4KTA A;  1F9R A;  2K32 A;  5M9O A;  2EYJ A;  1PZK D;  2E74 C;  1B50 A;  2E2D C;  5C4Z A;  4HSV A;  3FVQ A;  3KBG A;  5C3E B;  2AQ2 B;  2VNU D;  1NSN S;  2PZW A;  1YNJ D;  4I65 A;  4RHS A;  3K5M A;  4N9T A;  4RA8 A;  2NTT A;  4C3J B;  3A7A B;  1S5C D;  3OMG A;  1KLG D;  4OGQ C;  2EJF C;  2WIN B;  2EY2 A;  1B2T A;  1SE3 A;  3R2I A;  2NYZ D;  1WTW A;  1KNE A;  4CJ0 B;  1BCP F;  2WKD A;  3DWP A;  2IW3 A;  1YNN C;  2F0Q A;  3BVM A;  2CQA A;  3SK6 A;  3NWT A;  2KVM A;  4FF4 A;  1ROD A;  4A3B B;  3CU7 A;  5A2Q E;  3C1F A;  4WOR A;  4ZAI A;  3NQI A;  5CMD A;  3Q24 A;  1PYW D;  2L12 A;  3ONA B;  3GV6 A;  2EJM A;  1LTA D;  4XQQ A;  1TVX A;  1D1I A;  1LTS D;  1JOQ A;  5CV9 A;  3S16 B;  3CQZ B;  2Z8L A;  1NAP A;  5D65 A;  3K0Y A;  2ICE C;  4X3S A;  2B2W C;  1DOM A;  1WTX A;  2B39 A;  1PTO C;  5JPM C;  4KHV A;  3MXG A;  1BUV T;  5C4J B;  5KYI A;  2QIL A;  4RGO S;  5COY A;  1SE4 A;  3FPP A;  4IAL A;  3S15 B;  3PUX A;  4QMG A;  1II3 A;  2DNC A;  2VUM B;  2NBF A;  4IUT A;  3QOJ A;  1TII D;  5CBA E;  4IFD I;  3TSS A;  1DZ1 A;  2A6H C;  4K5X A;  2O5I C;  3I90 A;  4H7B A;  4C56 C;  1EY7 A;  4P2C B;  1ICW A;  1LT3 D;  4G7H C;  2AUJ D;  3NE5 B;  3S17 B;  1JE4 A;  2D5D A;  2SNS A;  2A68 C;  2A5H A;  1A3T A;  2B2U C;  3GTM B;  1U4R A;  2DY7 A;  3EVQ A;  4C1N K;  5J39 A;  1LTI D;  2PZT A;  3A54 A;  4KKS A;  5JEA H;  1BOS A;  4KY5 A;  3DM1 A;  4K8J A;  5KIX A;  1KLU D;  3A8J E;  2PMZ B;  4IUU A;  3LX0 A;  2R93 B;  1E2V A;  5I9O A;  1NR4 A;  3NBI A;  2NVX B;  2PW5 A;  2NZ1 D;  4G7Z C;  3S1N B;  1OXT A;  1F9Q A;  2FIN B;  4UAI A;  5FO8 B;  5DM7 3;  3ND9 A;  1CFM A;  3E0J A;  3NPP A;  3VA5 A;  2F0U A;  1CA5 A;  5J22 A;  2HQE A;  4C3H B;  3DWA A;  5M5X B;  4PMW A;  5ELD A;  3SK8 A;  3SR1 A;  3TZU A;  3RLF A;  4OO1 I;  4TQU S;  3VYT A;  2HDL A;  3IKJ A;  4PNY A;  3NUC A;  1SMY C;  1SAP A;  3K6O A;  4X3K A;  4OO1 H;  4QB4 A;  1U9R A;  2OF1 A;  3D6W A;  1JIC A;  4C2M B;  1LAB A;  1WVL A;  3QB3 A;  1E0B A;  1Y69 U;  2XWB B;  3PV0 A;  1NCV A;  2NTS A;  3Q23 A;  1NUC A;  4Q0F A;  3H6M A;  2B2V A;  1JCK B;  1F2Z A;  4M1U B;  2EYF A;  4RH6 A;  1BO0 A;  5COR A;  4NMZ A;  5JEA J;  2QF7 A;  2XN9 C;  3D6C A;  4A3F B;  2PYK A;  1VCI A;  2RQX A;  4V0B A;  2C5C A;  5JVH 3;  3KBX A;  3I70 A;  1ESF A;  4FP5 D;  4X3U A;  5C6A A;  2ENB A;  3G6J B;  5CYU A;  5EKL A;  1OXX K;  2EYP A;  3MHB A;  3X3N A;  3TN2 A;  5KNC A;  4DXG A;  2K5W A;  2DY8 A;  1S5B D;  3I8Z A;  1GUS A;  1E2Z A;  1ILQ A;  2XNA C;  2NVQ B;  2BDO A;  2HUG A;  1GUW A;  1Y1W B;  3OSO A;  4F88 A;  1SNP A;  3I91 A;  3BZD B;  1G29 1;  3G7L A;  4B9W A;  3NWS A;  2H1E A;  3MFY A;  3PMF A;  5C4H A;  1AN8 A;  1A2U A;  1I50 B;  2RVL A;  3S2D B;  2A73 B;  2FHT A;  2PNR C;  3A55 A;  3BS1 A;  3MVV A;  4LJZ C;  5C4X B;  5IT9 E;  2AWN A;  3MXU A;  4RKL A;  1QOH A;  3Q0A A;  3C46 A;  3M7G A;  1HQR D;  2YU9 B;  4PMC A;  3BDL A;  2A69 C;  3A7L A;  1DXM A;  3TP8 A;  3HOY B;  1TS3 A;  3J80 E;  5FLX E;  4KHZ A;  4G57 A;  5JEA G;  1YNN D;  5BN3 A;  2KEE A;  1VMC A;  3MA2 B;  5A35 A;  3ERO A;  2F0J A;  4IUV A;  1JOR A;  1OXV A;  1HA5 A;  4R8N A;  1LTG D;  1RHP A;  2F0N A;  3O13 A;  2K05 A;  2B63 B;  4DAP A;  3TBI B;  5KRU A;  3TZD A;  4H44 C;  1O7Y A;  4EQN A;  1V1P A;  3K5N A;  1DON A;  4KN7 C;  5I6W A;  2L9H A;  2NN6 I;  1FD7 D;  2NVT B;  4L63 B;  5KGU A;  4EGV A;  4M8A A;  2BOS A;  3QOL A;  1I4R A;  1ZEQ X;  4BWG B;  1D5X C;  2HDM A;  3R93 A;  4ULL A;  1G2S A;  4DXF A;  5LHY 1;  5DM6 3;  5KNB A;  5C0X J;  1WCM B;  1SFO B;  1CZW A;  2F0M A;  2CVR A;  1I6V C;  1EEF D;  3HOX B;  2A6H D;  1TS5 A;  2X69 A;  1EY9 A;  4HR7 B;  3PIO 3;  5ISR A;  1PTO F;  1KAA A;  3LNN A;  4IUQ A;  2F3V A;  5IIF A;  4BY7 B;  3TME A;  3H09 A;  2RSN A;  2CW0 C;  4ZLT F;  4FNF A;  3H0G B;  2FFK B;  1R4Q B;  4K2L A;  2K5D A;  1Q1E A;  1T5E A;  2WB1 B;  5FOB B;  3J7Y W;  1IW7 D;  2WKC A;  2K03 A;  4I7Z C;  5C3X A;  1EWH A;  2IJ0 A;  1QCB D;  4IN3 A;  4K5W A;  1S5D D;  2R7Z B;  3EJI A;  3TDQ A;  2BA0 A;  2E76 C;  2E2J B;  4IUR A;  4J8Q A;  2LS0 1;  2JEB I;  5JJZ A;  3N6R A;  5DEH A;  1SXT A;  1SYG A;  1RCV D;  5M3F B;  2XIW A;  3SK4 A;  3AMU A;  4DNT B;  3I4M B;  1FNW A;  2M00 A;  3PO2 B;  4QCL A;  3Q22 A;  3CRK C;  4FXK C;  5LL6 X;  2G9D A;  2LY7 A;  1SMY D;  3GO5 A;  4ZYS A;  3I4L A;  4ZK9 B;  1D5Z C;  5C0X G;  1TWG B;  2EYL A;  1EYD A;  5HGT A;  1VDZ A;  2V4D A;  1LT6 D;  1PZJ D;  3J81 E;  1B9N A;  3V96 A;  5KND A;  2F0E A;  4OIK A;  2TSS A;  3VYU A;  4KK7 A;  3HOZ B;  1HA6 A;  2IX0 A;  3KK7 A;  4Y7N B;  2ZT9 C;  1BF4 A;  1FYC A;  2QEJ C;  4B9X A;  4A93 B;  3HOV B;  4C3H G;  4H0L C;  2N55 A;  3MZ5 A;  4U67 3;  5BN5 A;  2NB0 A;  1EQT A;  2B2U A;  4TKO B;  2Z1C A;  4RGT A;  3E5S A;  5I2X A;  2XRQ D;  2ZXO A;  4RCN A;  1PTO H;  1QG7 A;  1I4P A;  2K04 A;  3ITP A;  5CV6 A;  5E3F A;  3ZYY X;  3GTP B;  1A15 A;  4FVM A;  4NKL A;  3JAM E;  1I4Q A;  1PDQ A;  3QIA A;  1CM9 A;  3SXH A;  3NHH A;  3KUP A;  1SNC A;  1LO5 D;  3P75 A;  1QB5 D;  5ELB A;  3RZO B;  1JWM D;  2M9V A;  1CQF A;  2F0V A;  4OIJ A;  3BDO A;  1AW7 A;  3GTK B;  1XWE A;  3OW7 A;  1DD2 A;  3TP6 A;  3EA6 A;  3QJY A;  1TR5 A;  1QIL A;  4GZY C;  3M85 A;  3D3R A;  1C48 A;  2YYZ A;  3NTH A;  4J1M A;  1PMR A;  4QF4 A;  1RTO A;  4DAV A;  1M8A A;  4RKB A;  3RZD B;  5D3D A;  1TT2 A;  5A2Q L;  4IFD H;  3I3C A;  1GOZ A;  5IGG A;  1V43 A;  4A3K B;  5D14 A;  2KA7 A;  3IAY A;  1EY6 A;  2SEB D;  4XT3 B;  1FNU A;  1QNK A;  2C9O A;  3MAQ A;  1QNU A;  1A3U A;  1C4Q A;  2E75 C;  1A3V A;  3MXP A;  1JR0 D;  4MN3 A;  5EPL A;  1L0X B;  1FNV A;  3WDN A;  1XTC D;  1PRT B;  1B1Z A;  3MC0 B;  2WAQ B;  1B44 D;  1LV9 A;  3S1M B;  4NDX A;  4LAA A;  1GUN A;  2IWH A;  5K36 H;  3MXN A;  3M7N A;  1JWU D;  1ML0 D;  3MTS A;  3QO2 A;  2EPB A;  1GJX A;  3I72 A;  2K1B A;  2J0T D;  1SBB B;  2MJ8 A;  4ZKC B;  3DWQ A;  1EYA A;  4RGM A;  5IGE A;  4KKU A;  4LK1 C;  4IFD J;  4NP5 A;  4KJN A;  1XYI A;  3SHL A;  4CGY B;  3F2U A;  4IUN A;  3K5L A;  2O2L D;  3OIQ A;  3OPO A;  2AQ3 B;  3IFT A;  4FXD A;  1JC7 A;  5BN4 A;  4Q5V A;  2A6E C;  2HCC A;  5CV4 A;  2F0K A;  5E1F A;  1Q8I A;  2F0I A;  3NK9 A;  4CBV A;  3W2D A;  5JVG 3;  2AWO A;  3FPU B;  3T53 B;  5JAV A;  1B9M A;  3HP3 A;  4K2K A;  5C44 B;  3K59 A;  2KCC A;  4K6D A;  5M5W B;  1SND A;  1ZYR C;  4YIJ A;  3RUZ A;  1Y8N B;  2O4X A;  4PQX A;  1H9S B;  1MGS A;  4RHR A;  4S3S A;  3L9A X;  2NWG A;  4KD3 A;  2KCN A;  1HFN A;  2F0S A;  3GTJ B;  3SEB A;  4A3G B;  5KYL A;  2OT2 A;  5IOD A;  1IYU A;  5CV7 A;  1BBX C;  3M4O B;  1TWH B;  5FO9 B;  1Q1B A;  4N9P A;  1BQQ T;  1SSO A;  1PFB A;  5EJW A;  3K5O A;  4G7O C;  2K7V A;  1K8M A;  5E4W C;  4R9W A;  2Q8R E;  1MSG A;  1ET9 A;  1ONL A;  3H91 A;  5I6Y A;  3U9S A;  3HOW B;  4F7X A;  1KDB A;  1F2Y A;  1G6Z A;  3S1Q B;  4CJ1 B;  3A56 A;  4IFD G;  1OXS C;  1QJO A;  2LFN A;  1RDP D;  1STA A;  4DAY A;  2IPK D;  1KTK A;  4DU9 A;  2FMC A;  1Q12 A;  4F87 A;  1WTP A;  4KY6 A;  3BVG A;  3QG1 A;  5IOC A;  2EVB A;  1ENF A;  2F0G A;  3OWE B;  4IZ8 A;  1X3Q A;  2L4N A;  2JA5 B;  2WII B;  1X3P A;  1TY2 A;  2I46 A;  4WJW A;  3BYY B;  3IFD A;  3S2H B;  2Z4H A;  4IUP A;  2ICI A;  1H9S A;  1WTV A;  4ZUJ A;  1WTR A;  4AYB B;  3NTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...