1C4QA

Mutated shiga-like toxin b subunit (f30a/w34a) complexed with receptor gb3 analogue
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
69
structure length
69
Chain Sequence
TPDCVTGKVEYTKYNDDDTFTVKVGDKELATNRANLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (SHIGA-LIKE TOXIN I SUBUNIT B)
publication title Identification of the Primary Receptor Binding Site of Shiga-Like Toxin B Subunits: Structures of Mutated Shiga-Like Toxin I B-Pentamer with and without Bound Carbohydrate
rcsb
source organism Escherichia coli
molecule tags Toxin
total genus 16
structure length 69
sequence length 69
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 1999-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1c4qA00
2C5CA 1R4QB 2XSCA 1C4QA 1CZWA 4ULLA 1DM0B 1BOSA 4M1UB 1CQFA 1R4PB 1QOHA 1D1IA 1D1KA 1CZGA 2BOSA 3MXGA 4P2CB 1QNUA 2GA4B 1C48A
chains in the Genus database with same CATH superfamily
4Z9CB 1N33Q 5IP7H 3CCLA 1S5FD 1B1ZA 4JI2L 2K14A 3IFDA 3MAQA 2ICIA 2N55A 1TKWB 4JG2A 1AE2A 5IOCA 4A3MG 5IYBH 4RWSC 4NXNQ 3BDLA 4OX9L 3W3AA 1XWEA 3STBC 3I55A 4GN4B 4ZQ3A 1L2FA 2A68D 4P2CB 1EL0A 5C4XG 1SN8A 4DXGA 1NAPA 1PRTB 4L5RC 4DR7Q 3B6YA 2BE5C 3FPUB 1XPOA 3GO5A 1PYSB 1KRSA 5JPMC 2WFWA 4NMZA 2Z6KC 4YY3L 1NE3A 1SSOA 3Q0AA 5EJWA 1BOSA 4LUOA 4HSVA 2NVXB 4C3HG 4A3IH 4JI4Q 4IURA 4KY6A 4JK1C 4FVMA 5CBAE 4V190 2VXWA 2K7VA 2P5ZX 4DUYL 4KKUA 2Q2UA 1HNXQ 4K5XA 4HAEA 4AYBE 4KLKA 4QCLA 4ODGA 2B2TC 2V4DA 4CJ2C 4I7ZC 2ZXRA 3PO3B 3AYHB 3F8TA 3PO2G 4PQXA 4OO1H 4LNQA 4JOIA 2B63G 2IY5B 2XRQD 5C44B 3MXUA 4B3MQ 1N33L 4DFAA 2N49A 1PH1A 2M2LA 2L1BA 4H13C 2L4NA 2RSNA 2Z8LA 3T13A 3TQYA 3AMUA 1HRJA 1VQOA 4MIUA 1K3BC 4BY1B 4NXNL 2NBFA 4B08A 4CJ1B 5D65A 4QIWB 1VQCA 5CMDA 4QJFA 1HR0L 3H3VI 2VL6A 1U4MA 4DR7L 1SYDA 3HG9A 4B9WA 5GQOA 1UWVA 3J81c 1LO5D 3RLFA 4ULLA 3GTJH 2HHHQ 5EKIA 1HJPA 4DU9A 1CSQA 1E1OA 2UU9Q 2B2YA 2Q8IB 2CH4A 2Z1CA 4JI4L 3HKZB 1KLGD 5KYLA 2EVBA 1YITA 3RN2A 3ULLA 4J15A 4LF6Q 4K8JA 2ZTDA 1VQJA 3I72A 3MTSA 4JBJA 2RHSB 1LACA 3UDIA 2ZT9C 2PZUA 5CC4A 4E6IA 1WTVA 2LSSA 3BDOA 1GHKA 1LTSD 1TY0A 4DAPA 4X62L 2B29A 4NKLA 1XNQQ 1VQ8A 2CW0D 4DV3L 1G6PA 1CQVA 2KENA 3AEVA 1DGSA 3I4OA 1IBMQ 5IYDG 1QWYA 3K57A 3HOUG 4G7ZC 1CK1A 3PUYA 1Q1BA 3PGZA 3J80L 5ELNA 4OONA 5CV9A 5LL6S 3GTKB 3PO3H 3H3VH 4NP5A 2G5DA 3J81E 3K81C 4IFDH 4A3MB 4JV5Q 1K73C 4RGMA 4CBVA 1G2SA 4N8FA 4Q0FA 1PV4A 1YNNC 2K5HA 2KEDA 3M3YB 3I3CA 1ZYRD 3I7FA 1C8CA 3OSOA 2JA7G 1SR3A 1UEAB 1WTPA 4RKLA 1F2MA 5C4XB 4IOAA 2F0PA 1PRTC 5CV8A 2EJFC 1UE7A 1K28A 5GAGC 3QIAA 1EQRA 2Q8TA 1V43A 2XWJB 2I07B 2HD3A 3OTOQ 1MIUA 1AZQA 4C1NI 4A3EG 4DV0L 1I4HA 5KYIA 2CWPA 1AEXA 4GNXA 2K1BA 4C3HB 2XGTA 1UE6A 2M00A 1O7ZA 1HA5A 1IXRA 1IW7C 2L0CA 1S40A 3S1NB 4Y52H 1EWIA 2E2JB 5LMNQ 3C1EA 3BVMA 1C7YA 5DEHA 3ZYYX 1JE5A 1HQRD 2E74C 3S9WA 3F1ZA 1B53A 1IBML 3K0XA 3PO2B 4H02A 2B63B 3MFGA 4HJAA 1J5EQ 5LL6X 3RD4A 1STYA 3C46A 3S2HB 3VYRA 1WTXA 2KOLA 4F88A 2EJMA 4ZUIA 4HIMA 4JV5L 2IHFA 3AQQA 1IYJB 3BYTB 2RCNA 5C0XJ 3GP7A 2F1MA 1VDZA 2K04A 2Q2TA 3CCUA 3NTKA 3HEJA 5L37A 5C0XG 2KCTA 1K8MA 3NQTA 3HFZB 2KJXA 2JA5G 1KDCA 2IWHA 2BH2A 1TR5A 4IN3A 3EQLC 1F2ZA 4EGVA 1ENAA 1MKHA 1YJWA 5JJKA 4JI6Q 5EBDA 3S1MB 3EIVA 1ONLA 3V96A 1JOOA 5LMNL 4LWCA 5K36H 4OWXB 1SROA 5DM63 3P20A 1RD9D 2ID0A 2HT1A 4TVAB 1J5EL 1QUQB 3J7AF 2F0JA 2NTSA 1K83H 4YCUA 2OQKA 3G48A 4R4OA 5LMUQ 1G291 2Y0SG 3HOUB 1XJVA 1CKMA 2PQEA 2L11A 4DXFA 2E2HB 1J8IA 2VUMG 5FJ8G 2JA8G 2VW9A 2JK8A 1SNOA 4KHZA 4IUUA 4BA2I 3SR1A 4HIOA 5I9PA 2JA7B 2F52A 3GQBA 3I4MG 1QZHA 3CW2C 4JI6L 4IOCA 1XMOL 3EVQA 3S16B 3E3XA 1L0WA 4OIJA 5GAHC 2WB1E 3FPPA 3PMFA 1GJXA 4C3JG 4A3EB 1QUQA 3U4VA 3W1BA 4LF4Q 4QQBX 2PO4A 4YHHQ 1I94Q 1E1TA 1VMPA 3S1QB 2YTVA 3ULJA 4CKCA 2NVYH 4JBMA 3S1MH 1BXTA 1I5FA 4DNIA 5T1GA 4FF2A 2Z0SA 1RL2A 1Y1WH 2MO0A 2JA6G 4LF5Q 3SHLA 3KDFB 4DF7A 4KD3A 1EWCA 3X3NA 1Y8OB 1QOHA 2HCIA 3QB3A 4KKSA 4A3JH 4A3LH 1PH2A 2AKWB 4DGZA 1CA6A 4LUZA 4LK1C 3C2PA 2L15A 1HZCA 4JVZA 4FXGC 1ESRA 1W6KA 2CHBD 2QW7A 2RQXA 3RLNA 3I70A 2F0IA 3HOUH 2UUAQ 1X3FA 5FO7B 2YU9H 1X55A 3CCQA 4YCWA 2JA5B 1I50H 3QWNA 2DJGC 2E2HH 1WI5A 4M1UB 2WKDA 1VQLA 4APVA 4R9WA 4IUTA 1KRTA 3CQZB 1SE2A 3M4PA 4K5WA 3HOZG 1AFPA 4NPSA 4JI3Q 4LF4L 4YHHL 2JEAI 4EQNA 2QEXA 1SNDA 5BR8Q 2JA7H 3Q23A 1D2BA 2EYLA 1PYBA 2QA4A 1AW7A 5C0XI 1PZJD 4A3DH 4GLVB 3A54A 2EYPA 2F0SA 3I4NH 4J1MA 4LF5L 2DNEA 2OQ0A 2RF4A 1CA5A 4KK7A 3F2UA 5IWAQ 4L5TA 1LTGD 1BQQT 3NUCA 2GN5A 2K5VA 1HZAA 5IGCA 1JICA 3S1QH 5AJ3Q 4QF4A 2FJ2A 1TWGB 3NBHA 1H9JA 2Y0SB 4RAUC 3DWAA 5IGGA 4DR4Q 3R93A 5IODA 1EYDA 2VUMB 4BXXG 1BBWA 2UUAL 2JA8B 3CHBD 4WJ4A 2EY5A 4ZLTF 1VQ6A 4DKAC 4LF8L 2OCEA 1EUJA 4U68A 2LXKA 1N8RC 1K9MC 4DR1Q 5KIXA 1GVPA 4G7HC 3BJUA 2Z6BA 3KJPA 3I4MB 1DONA 2WACA 4PZ6A 5IGFA 2WAQG 4CKBA 3TP7A 1CKOA 3PUVA 3NTHA 1IBLQ 3OIQA 4OEMB 1D7QA 2A5HA 4K2LA 4LFCL 1B3QA 5FO8B 4C3JB 1IL8A 1TY2A 3CXCA 2UXCL 3OHXC 4PMWA 3PCOB 1SBBB 2PZTA 4HEDA 5IWAL 1XXGA 4DV1L 3KK7A 2OT2A 3HKZE 2SEBD 5K5PA 5EPKA 1Y8PB 2SDFA 4L63B 2JA6B 4DR4L 3F2DA 2PW7A 1X6OA 3KF6B 1SMYD 1SE3A 4DV5Q 1RJTA 4UP9A 1WTQA 3EN2A 4LUVA 1II3A 1CKNA 3D4DA 5IYCG 4F8MA 4O1NA 2UXDQ 3PIP3 3TDQA 1VQKA 1D5ZC 2ZJPA 2IJ0A 3M7GA 5C5LA 2HIVA 3HRZC 4DR1L 4A3BH 3DM1A 4B3SQ 5C5MA 4JCVE 2B39A 2NVTH 1N9WA 1IBKQ 5J39A 1IBLL 1N34L 5A2QL 4FF3A 5FJ8H 4IPHA 1M8AA 5HGTA 1JR0D 2JA8H 4G7OC 3SK6A 2H1EA 3WDNA 5JAVA 1X3EA 3IKJA 3QG1A 3HOZB 1XNRL 3R8BA 2AHOB 2K28A 1DOLA 4DUZQ 4GKKQ 3M4OB 1HNZQ 1HFGA 1SYFA 5GROA 3KF6A 2F03A 4LFAQ 1OXVA 3DWPA 1YJNA 2HUGA 2NZHA 1B7YB 1I4RA 4K0KQ 4JI7Q 2K01A 3W2DA 4XQJA 4DV5L 2QDBA 4KHPQ 2IHEA 3JC66 5KNCA 4RCNA 2F0DA 3KLSA 1U4LA 2UUBQ 3KBGA 4KJNA 3J80c 2UXDL 2KVMA 1W6JA 1YHBA 3J81j 1MSHA 1S4ZA 4O2DA 1EWHA 1X54A 1LT3D 1QILA 4B3SL 2EYHA 3C1FA 5DLQE 4F7XA 2H5XA 2KCMA 3GTPB 1H9SB 1PDQA 1NCVA 3QOJA 4Q5VA 3CMAA 1Q3LA 1IBKL 2J0TD 2FMCA 5T1IA 3FP9A 4A3FG 1U4RA 3FKIG 1Y1VG 4DV6L 2B8GA 2E76C 3ULPA 2G9DA 2EJGC 1JWMD 1QE6A 1PXUA 4HCEA 1H95A 1NTGA 2WAQB 4DUZL 3HOVG 3CCVA 4GKKL 4H0LC 1MBYA 4FNFA 2B2WA 1HNZL 2A69C 3S1RH 1HNWQ 1VQGA 4LF9Q 1AE3A 2PYKA 4A3KG 1OTCA 1GUGA 2DNCA 4IUPA 3DLLA 1TWFH 2KHSA 2NB0A 3GTQH 2RCFA 3S17H 2JQOA 4JI7L 4KHPL 2QCPX 3J7ZC 3M4OH 1B2TA 4HMIA 1YNJC 4YY3Q 2UUBL 5I4DA 2E2DC 2M9VA 5I6WA 2A6HD 3KLSX 3UI2A 1N32Q 2R3ZA 5BN4A 3D3RA 2ICEC 1ENFA 4DUYQ 3K5LA 4L5SA 1Q1EA 2K5QA 1S72A 1MJEA 2BDNA 3I90A 5IGEA 5FLXL 1FL0A 3Q8DA 2KUMA 4EX5A 4BBSH 4HJ7A 3EBEA 1NUCA 2AQ2B 2F4VQ 4HR7B 2MPMA 3GDEA 4PMBA 1X65A 3A5UA 4IPCA 1D6EC 5M5YB 1B9NA 4RCOA 3Q24A 4AQYQ 4DN4M 5M9OA 1LTLA 4KN7C 3KBXA 1LT6D 2K5DA 4FF1A 1HNWL 2KCNA 4LF9L 5JEAJ 2NZ1D 1CM9A 1HR0Q 1SXTA 4K2KA 4HIDA 1E2VA 1WTOA 3S14H 3K58A 3K5MA 1PFSA 1E22A 2O2LD 4Y7NB 2EQSA 1YNXA 5JEAG 4U673 1F77A 1HZ9A 3H09A 4GS3A 2X69A 4N9PA 2F0OA 3VYTA 1JJ2A 1CQFA 1XX8A 3TRZA 1OXUA 3AFQA 1N32L 3NQIA 3D4WA 1BUVT 2V1CC 2I0QA 4IZ8A 4ZRZA 1ML0D 1WJJA 1MGSA 2R93H 2F3IA 2KBNA 2NWGA 1TXYA 1YEZA 3A5ZB 1F9SA 2JA9A 4I65A 4GN5A 2QEJC 5M5WH 3UDXA 1SLJA 3GD7A 2PW5A 4C3IG 2F4VL 4QMGA 1CI3M 4X62Q 1CTMA 1J6QA 3O13A 1PFMA 4DV3Q 4BS9A 4XTCS 2R92G 4BBRG 4A3FB 1KABA 4AQYL 3FKIB 1F9PA 1Y1VB 3PIPA 1HA6A 4YWMA 2R7ZH 4RFBA 1JOQA 3STBD 4A75A 2ZJQA 4DNTB 3BDCA 5FLMH 2VQFL 2JE6I 1I4QA 4XIGS 3HOVB 3CPFA 1SFOB 4MNOA 2BE5D 2LMCB 2N88A 3G6JB 3EA6A 5KNBA 1O78A 1XMQQ 1TWAB 3CC7A 1KHIA 4KMUC 3CKIB 4R4TA 3BG3A 1EIYB 4A3KB 4JI0L 2MFIA 4FXDA 1L0YB 3MXNA 4QY7A 4QGUA 3OW7A 1S5BD 2OTLA 2Z4HA 1ILPA 3NXWA 2X6LA 2K32A 1UNSA 2FINB 1DYQA 4OELB 1LLRD 2RSOA 4ME5A 4DV0Q 3FVQA 3GTOB 2EXDA 3V05A 4JBWA 5G3LD 1KLUD 1SYBA 2LXJA 4GNXB 2MJ8A 2Z9HA 1Q12A 3D6WA 2NVXH 2QKIC 1D5MC 1MSGA 1ET6A 4P73A 1G6ZA 1EY4A 1V1PA 2AUKA 1SYEA 2QILA 4LJZC 1VQMA 1BF4A 1EIFA 1B8AA 1FJGQ 2SOBA 3HOYG 2Y0SE 1KL9A 2AWNA 4JOIC 4HJ5A 2ATWA 1QNKA 1SNPA 4POGA 3EFXD 5C44H 1BCPD 2LFNA 1NBWA 1PTOF 4G4KA 3Q6SA 1XMQL 3PUXA 5M5XB 2IX3A 4BY1H 3FKIH 3FHWA 3VYSA 2L12A 2J4XA 2D62A 4POFA 1P16A 5FOBB 5CV4A 1EEFD 2D0OA 4R4QA 1SJHD 3L3OC 3URYA 3VR3A 2DGYA 4N9TA 3W5OA 1IZ6A 1CT1D 1PYWD 4IUNA 2B2YC 2C9OA 2RBMA 1T5EA 3G7LA 1I3QB 3BVZA 1C9OA 1GUWA 3FRPB 2VQEQ 3TZDA 4C3IB 5EQ0A 3KLWA 1B4OA 1H9MA 1FJGL 3GTOH 2LS01 4PNYA 4AYBG 1OXSC 1TU2B 5JJIA 4EQ5A 2R6GA 2R92B 4BBRB 1SRUA 2DUDA 1C4QA 3E6ZX 5C3EG 3EROA 1EIHA 1YNND 5E3FA 3MA2B 2D9UA 4B3TQ 1BBXC 3A7AB 5E1FA 1PRTD 4RGNA 5EGTA 2J7ZA 1STBA 3GTKH 2KHIA 5DM73 1PFBA 4WRDA 4A3MH 4KTAA 1ESFA 1C0AA 4XT3B 3QOLA 4DV2Q 4KHVA 4K6LA 1XMOQ 1M1KC 3M3YH 5M5XH 3ITPA 1IW7D 5C4XH 1O80A 2K5NA 3T4AC 2KECA 3M4QA 1SAPA 4KD4A 4QUFA 1EU4A 2VQEL 1ICFB 3U58A 1X9NA 1B9MA 1LUZA 2QF7A 1LV9A 4GNXC 2CQAA 4K14A 3NEMA 3VR2A 4C3HH 1EY5A 1UUPA 1YVCA 1QJOA 3HZXA 3KOJA 1EY7A 1FR3A 1BO0A 1RF2D 3S1NH 4O42A 3J7YW 2E2JH 3ND9A 4ZK9B 1H9RA 1WOCA 1Y69U 3JAMi 3NENA 3TS2A 4HIKA 4B3TL 2UUCL 3HOYB 2NN6G 3PO2H 2A1AA 2B63H 2NZOA 2F3WA 3VDYA 3S2HH 2F0FA 1I4PA 2X6GA 4TSSA 3H0GG 1I6HB 3E0JA 2XTIA 4OWTB 2R7DA 2AMCB 5E7NA 3HS0C 4DV2L 2L9HA 3X3MA 1KD1C 1PH3A 4P72A 1EOTA 5C3XA 1PTOB 4HTHA 2G9HD 1F2LA 4YIJA 5ELEA 1NY4A 1RKNA 2PMZB 4DR2Q 1WVLA 1GD7A 1BKBA 5JOBA 1PH6A 3IL8A 4LMQD 3GTGB 4XYOA 2RA4A 3T53B 3IRBA 4ME3A 1WD0A 1OXTA 5A2QE 2MUYA 1DZ1A 3NTIA 3CCJA 4AYBB 3E5SA 1L1OB 3H6MA 1HQMC 3DEOA 3K5OA 2DN8A 5KGUA 4CHTB 3TMEA 2HQLA 5C3EB 3NBHB 3PQIA 3HKSA 1IYVA 3EJIA 3CU7A 5J1ZA 5IYDH 5IT9L 1WTWA 1JWSD 2YTYA 4A3GG 1VQEA 4UY8C 1Q46A 1PA6A 3DMUA 1S3OA 4BY7G 2NVQB 4JI5L 5KEEA 2IX1A 3DHQA 3TREA 4LF8Q 4UAIA 4A93G 1P8LA 1GHJA 2QGQA 3U4ZA 1ZXTA 4ZUJA 1EY6A 4DK6C 4OGQC 2WP8J 1KTKA 4ZKCB 1VQPA 4DR2L 5CV5A 1RODA 1A3TA 4CGYB 2BDOA 2HIXA 1HCZA 4LFCQ 3TS0A 4GOPA 3S16H 4NDXA 2IPKD 1A8VA 1S5DD 2E75C 2UXCQ 4HSPA 3VA5A 4PMCA 1L1OA 4R1JA 4A3EH 4KN4C 3C3LA 3K5NA 1WCMG 4CDFC 4DV1Q 1DOKA 3NWTA 5FLXc 3BZKA 3MVVA 1FNUA 3T1YQ 2O5JC 2EYOA 1EU3A 2EDGA 1WD1A 3G71A 3WOFA 4CDDC 3PF5A 4XDXA 1HFNA 4IUQA 1VMCA 1FNWA 5FK9C 5G3LF 2A19A 4ZAIA 1WTHA 4UPAA 2JYOA 1FVIA 2O5IC 1D1IA 1CKNB 4K5VA 1AN8A 3H0GB 4RHRA 1G51A 1HPCA 1AZPA 4P71A 4X3UA 4C1NK 4X3SA 3CD6A 1G2TA 1A0IA 5IP7G 3RNUA 3R3OA 4QIWE 1BCPF 1N34Q 1KQSA 4B3RQ 1RCVD 5IYBG 4HJ8A 5C0XH 4QB4A 2XN9C 4F87A 3RN5A 3SXHA 2JA5H 1X3PA 2NVQH 4A3CG 1PTOC 2CH4W 3ERQA 2F0QA 1R9TB 3NE5B 5FLXE 3ONAB 1XNRQ 1E7ZA 1TS5A 3CQZH 3GV6A 1TS4A 1HZBA 1VCIA 2PI2E 2LKVA 3T1YL 3M9BA 1JC7A 4FF4A 2Q8RE 3JAML 1T9HA 1NR4A 4X64L 1RTOA 2E2IB 2XNAC 3I91A 3LGJA 2QDLA 1KAWA 4A3IG 2FMMA 1JJGA 2I5MX 2K50A 3PSIA 1GKHA 1A15A 1PH4A 2CCZA 1RDPD 2EYMA 3V2TA 1L1OC 1Q82C 2F0VA 3CCRA 1OXXK 1TWCB 4JYAL 2F0MA 4X3KA 2EZVA 3S24A 2XVSA 1D1KA 1IHZA 4C2MB 1JWUD 3GTMB 3VA7A 4OO1G 1HTLD 3R2TA 3IFTA 1TWGH 1JJCB 1KAAA 5TSSA 4A3GB 2MNAA 1JQYD 1JORA 4BY7B 4WJ3M 3CP0A 2VUMH 1FGBD 2FXQA 4B3RL 1LT5D 3CCSA 4DV6Q 1PH7A 3I2ZA 1JOKA 4GKJL 4ALPA 2E5LL 5M3MG 4A93B 1B50A 2PNRC 1QVCA 2EE1A 2RHQB 1CHPD 3TP5A 3SK8A 1GO3E 1LYLA 1TWHB 1N36Q 3VYUA 1PZID 5DNFA 3I4MH 3K6OA 1YJ9A 2DJFC 3K7UC 2MO1A 4CDEC 1ICWA 2VZAA 2EIFA 3W1GA 4C3JH 4C56C 1WCMB 1R9TH 2VNUD 1STEA 2PQAB 3TP6A 3D8GA 3RZOB 2R61A 3OPOA 5C4HA 1LTAD 3RUZA 5I2XA 3PF4A 3MXPA 1VF5C 2K6AA 3I8ZA 2JA6H 2CWAA 2OEOA 1EFID 1AP0A 5J22A 3OOCA 5IGDA 2EPBA 2JP1A 1SNQA 1TVXA 3NWSA 2A6EC 4HN7A 3DXJC 3QR8A 3F2BA 4IFDJ 4C2MH 4RA8A 1A62A 3T16A 2K4KA 1N36L 1STGA 4IFDG 1MI2A 2JSOA 3SK5A 5D3IB 1EY0A 1HR0W 4BY7H 3A74A 3G6EA 2CQOA 1F9RA 4A93H 5NUCA 3T1HL 3KFUA 1EQQA 1DOMA 3RLOA 5HURA 1E2ZA 2PQAA 1NR2A 3HOZH 4DAMA 2AQ3B 4JI8L 1A2TA 4AH6A 5EPLA 3J80E 5CORA 1UEBA 1EQVA 1EYAA 5FKAC 4K6DA 1FGUA 4V0BA 1EYCA 3TZUA 3SEBA 3I56A 2YV5A 4A3IB 3QO2A 5CBEE 5JVG3 1IKLA 4JI1L 1SYGA 3CRKC 1A2UA 4IALA 1PHJA 2A68C 4R8NA 1T5XD 1STNA 3OWFA 1BDOA 1HUNA 4X65Q 5CGKA 4RG1A 3L2PA 1B3AA 2F0WA 2B2TA 1IKMA 5ELDA 1K0RA 2ZJRA 1R4QB 1D5XC 4JPBW 1KXLA 4CJ0B 1K8AC 1NSNS 2K03A 3N6RA 2MHVA 3S15B 3CCMA 3DEPA 2BCOA 2PPBC 1TIID 4BXXH 1KDBA 2B2VA 1O7YA 3GTPH 2OF1A 5M3MB 4ABNA 3OWEB 1WFQA 2GA4B 3SVMA 2VQFQ 1C48A 1UE1A 2ZTEA 3D6CA 1UE5A 4BA1I 4DV4Q 4OO1I 4WFN3 2ES2A 5GAEC 2ZTCA 3NBIA 3U9OA 3UE0A 4NW2A 1E2WA 4S3SA 3A56A 2B2WC 3GTJB 1YNJD 5F2DA 2DY8A 2EY1A 2MQHA 3PIO3 4JC0A 4JI0Q 1SDFA 4K8IA 4N8X1 4CKEA 4A3CH 3MXNB 1GUTA 2IL8A 3WOEA 5ELCA 3ERSX 1ASZA 4A76A 5I6YA 1HHVA 2AQ1B 4X65L 5K36G 2PMZE 3FEWX 3UDFA 2BH8A 2I5HA 3KYHC 2JJQA 4AIMA 3DWQA 3DM3A 5LHY1 2EYJA 1AH9A 5JJZA 4DV7Q 5IIFA 3MWYW 1A3UA 1EZ6A 5EAYA 4NXMQ 1LABA 4XQNA 5ELOA 5KNDA 2ASBA 5IYCH 3S2DB 1U0LA 1V1PB 1E3PA 2SNSA 3L9AX 5IP9G 3PUWA 4MTKA 1LTBD 2WIIB 1B44D 4PZ8A 4DV4L 1A3VA 4DA2A 1VQIA 3PUZA 4EQPA 2PCFB 1LM0A 2CW0C 5ISRA 4I7AA 4ILWA 1SNCA 1DCZA 5M5YH 3S15H 4HCSA 2B2VC 1ILQA 1ZKOA 1S5ED 2B3GA 5M3MH 3ICEA 3A7LA 2K75A 3OYYA 5EPJA 5KRUA 1VQBA 5C4JB 3VR6A 4FYDA 3MZ5A 4OL7A 1BCPC 1Y8NB 1ZEQX 4Y7NH 1K3RA 2F4IA 4R4IA 3P1HA 3A8KE 4IFDI 3K8AA 4OWWB 4FO2A 3TP8A 1M90C 1Q8KA 4UP7A 4PZ7A 1W3SA 5LMNW 2BA1A 1ZYRC 1GXDC 1EZ8A 2JEBI 4J8QA 4XQQA 1G91A 4J6HA 2K05A 5IE8A 4DV7L 2L55A 3M4YA 3BVGA 4R4CA 4NXML 1HNXL 1Y1WG 2YYZA 4DK0A 4TKOB 5IT9c 4A3JG 4A3LG 3U9SA 1EIGA 3BU2A 1HXYD 1ENCA 2Q2IA 1GOZA 3J81i 1WTRA 3K7AB 4B3ML 1JCKB 1QG7A 4IPDA 5COYA 1PMRA 1PH8A 3AFPA 1Y14B 4A3FH 3AU7A 3NP8A 1PH9A 1Y1VH 3CPWA 5JJLA 4GN3B 5C3WA 3S2DH 2N8NA 1DJRD 3RMHA 3HOVH 3R2IA 1YIJA 1HTPA 2ZXPA 5HGQA 1SFOH 3LNNA 1VS0A 2DY7A 1O7LA 1YHAA 2PI2A 5IGBA 3HGBA 2HHHL 1TWAH 3CC2A 2UU9L 4A3KH 4IO9A 3P7JA 1B70B 1M4VA 3CRLC 3MEHA 2MGSA 1Q7YC 1EFWA 4A3DG 5IT9E 4LF6L 3I4NG 5C4JH 1EYGA 3RZDB 4JW0A 5BN3A 1BBUA 4LFBQ 1JMCA 3MEFA 1K83B 4MN3A 1QVFA 2EY6A 3A8IE 1K0SA 5AFWA 1CHQD 2IX0A 1U5KA 2RDGA 2PNHA 4ID6A 3NHHA 4P75A 4RKBA 1S5CD 1XNQL 3HOXG 2HCCA 2AWOA 3E9HA 3LWUA 2LY7A 2UUCQ 3E0EA 1W2BA 1LTRD 4KY7A 3H3VC 1JE4A 1X3QA 3QJYA 1I6VC 4WJWA 3SGIA 2YTXA 1QB5D 2VS1A 1E24A 4BWGB 3GV3A 3K7AH 1K8OA 1GUOA 2F3VA 2VB3X 2C5CA 4DAYB 2CVRA 1CZWA 1Z7TA 4UHVA 3JAMc 5D14A 4RH6A 4L6TB 5JEAH 1FNVA 3PIOA 3T51B 2TMPA 3CF5A 3BS1A 5M3FG 2EYFA 3OTOL 2BOSA 2F0GA 1PFNA 1QNUA 4NB3A 3TEHB 4LFBL 1PLFA 4GLAC 2NVYB 1XTCD 4FDBA 3OW2A 1XYIA 1MJCA 4MZ9A 1Y1WB 2O4XA 4DPGA 1I3QH 2K52A 4A3JB 4PG3A 3KF8B 5I2YA 4RHSA 3RZDH 4C3IH 3D4RA 2RDFA 1SYCA 3N52A 4DR6Q 5EKLA 3ZJYC 4P74A 2RKSA 2R92H 4BBRH 4DAYA 4QL5A 4A3BG 1IYUA 2UXBQ 3NELA 3UE1A 3JAME 2L5TA 5BN5A 2YU9B 1JB7A 1VQ9A 4PV1C 5IP9H 5D3DA 3H91A 3M85A 1I50B 5IY0A 3L7ZC 1LTTD 2IW3A 4JI5Q 2AUJD 1TS3A 2WAQE 2K33A 1KDAA 2Q2HA 3CAMA 4IPGA 3MXGA 4UP8A 2A73B 2VB2X 1Q90A 4IJHA 1Q86C 4OXPA 5CR3A 4KKTA 2VY3A 5EBCA 1XPRA 1ASYA 4CDCC 3KUPA 1Q8IA 1XTDA 1BVSA 4A3DB 4GZYC 3A8JE 3ND8A 3I4NB 1QCBD 4L5QA 4GOPB 2EXZA 1VF7A 2CFMA 3KF8A 3KLRA 2NYZD 5EKKA 3J81L 5CYUA 4FXKC 2F0HA 4LF7Q 4WORA 3NK9A 1SEBD 2KEEA 1KIXA 4DR6L 1FD7D 1SJED 3A55A 5DAUA 3J7A5 3HOXB 1O7IA 1JB3A 3LWEA 5LMUL 2F0LA 2UXBL 5ELFA 4XYQA 4KI0A 3UDGA 1U4PA 3HOYH 3OMCA 1RIPA 3WWVA 1WYDA 1MD2D 1BR9A 3K59A 1Z9FA 3L0OA 4DR3Q 3OMGA 1STHA 1TQOA 2XIWA 1I6HH 2NUCA 2TSSA 1VQNA 1G8ZD 1YBYA 3BZCA 4ZYSA 1VQFA 3H94A 3CCEA 2NTTA 5M3FB 1X32A 1YHQA 4DK3C 1X56A 1PTOH 2HQEA 1CZGA 3Q22A 5C6AA 4LF7L 1CSPA 1GUNA 1I94L 3TBIB 2D0PA 4LW1A 4FP5D 4X64Q 3NPPA 1QZGA 2C35B 2KCCA 3K0YA 2WV6D 3RR5A 3GTGH 4IUVA 1IL2A 3KDFA 1EY8A 4X3TA 1V8QA 1FYCA 2E8GA 3HOWG 4JYAQ 3TSSA 4BBSG 4A4IA 1DD2A 2MP1A 5E4WC 1NMGA 1YI2A 4A3BB 1PH5A 1L0XB 1KNAA 4ZKBB 3HOXH 5C3EH 4HJ9A 4DR3L 2NVTB 3HP3A 1HUMA 1STAA 4YWKA 1EOVA 1SMYC 1JT8A 4OHJA 1H9KA 2NN6I 2RVLA 3KJOA 2ZM6Q 2E5LQ 3T56B 4GKJQ 4L8JA 2OWOA 1A63A 4KY5A 1BNZA 1EY9A 4TQUS 2XWBB 2HDLA 2EY2A 4KV6A 2F0UA 5GADC 1K8GA 4JI3L 2FHTA 1DXMA 1EQTA 1VQ4A 2WB1G 3FMCA 5BR8L 1OO9B 5CV6A 4DR5Q 1YZ6A 2JN4A 3GTLB 1NJIC 3CC4A 3SE0A 4GOPC 2GVAA 1TT2A 1LT4D 2F0TA 4DNRB 3CMEA 5M3FH 4B9XA 2ALYB 2D2CC 2R93G 1EEID 2H4OA 1SNMA 5ELBA 2A8VA 4QUCA 3VR4A 3I4LA 3VR5A 5I9OA 2JXMB 2WINB 1VQHA 1X3GA 5AJ3L 4X66Q 3MC0B 4G57A 1ET9A 4HMJA 4M8AA 1KC8C 1CUKA 2K5WA 1E0BA 2I46A 3SDZA 1U9RA 4XXEA 2NN6H 3NSWA 1V9PA 2XRSD 3IAYA 2A74C 3BZDB 3D0FA 3PV0A 2ZM6L 3M7NA 1Z6HA 2R7ZG 3AB9A 2KHJA 3E9IA 1PTOD 1J9OA 5A35A 5FLMG 2D5DA 4XT1B 4TRDA 3H0GH 1PRTF 2EOTA 2RDHA 3S1RB 4IQZA 3OIPA 3U50C 4DAVA 4DK1A 2BA0A 4EVOA 4DR5L 1NMFA 1D8LA 3T1HQ 1SMXA 1VQ5A 1TWFB 3D31A 4RGTA 2B2UA 2GVBA 4ZCKA 3GTQB 2FFKB 2XSCA 3S17B 4JI8Q 4GLXA 2N3SA 3J7AV 4LAAA 2HDMA 3A0JA 4JI1Q 4X66L 3GTLH 3F2CA 2E2IH 1V1OA 4RMFA 3HOWB 1LTID 3BYYB 4R8IA 5J3BA 1QVGA 2IT1A 2SNMA 4BBSB 3FDTA 1NNXA 4H7BA 1TWCH 1DM0B 4YWLA 1UAPA 1KNEA 2A6HC 3PO3G 3GTMH 1PZKD 2Z4IA 5C44G 4X6AH 3SK4A 1RTNA 2KQ3A 4EQOA 2ZXOA 4IJLA 4A3GH 1MHWC 1V1QA 1HH2P 4BY1G 5C4ZA 2B8FA 5H1SE 2F0KA 3S14B 1PVOA 3H15A 3K80C 1VQ7A 1CFMA 1Q81C 3J80i 4JI2Q 5HY6A 1BCPB 5JVH3 2WB1B 3MHBA 1R4PB 1TWHH 1SE4A 4H44C 2F0NA 2Z6KA 3I73A 4O0AA 4OX9Q 5CV7A 1I4XA 3DUZA 2WKCA 2R7FA 3MFYA 4LFAL 2R93B 2B2UC 2ENBA 3ER0A 4UDUC 5FO9B 4MTNA 1RHPA 1F9QA 2PZWA 1SE8A 3HKZG 3TN2A 1WCMH 4RGOS 5M5WB 4OIKA 4K0KL 4MHEA 2KA7A 2I5LX 1VQDA 1F2YA 4YCVA 2A6ED 2CKZB 1VQAA 3G4SA 3RZOH 2N78A 3P75A 2OTJA 5E4XA 5JPNC 1GUSA 1H9SA 3LX0A 1Z47A 2A69D 3HOWH 4JBKA 4KJOA 1XPUA 2R7ZB 2OXPA 1GM5A 1A6XA 2F0EA 1TS2A 1I4GA
chains in the Genus database with same CATH topology
4Z9CB 1S5FD 1B1ZA 3IFDA 3MAQA 2ICIA 2N55A 1TKWB 5IOCA 4RWSC 3BDLA 3W3AA 1XWEA 4ZQ3A 2A68D 4P2CB 1EL0A 4DXGA 1NAPA 1PRTB 2BE5C 3FPUB 3GO5A 5JPMC 4NMZA 1SSOA 3Q0AA 5EJWA 1BOSA 4HSVA 2NVXB 4C3HG 4IURA 4KY6A 4JK1C 4FVMA 5CBAE 4V190 2VXWA 2K7VA 4KKUA 4K5XA 4HAEA 4QCLA 4ODGA 2B2TC 2V4DA 4CJ2C 4I7ZC 2ZXRA 3PO3B 4PQXA 4OO1H 2XRQD 5C44B 3MXUA 4DFAA 2M2LA 2L1BA 4H13C 2L4NA 2RSNA 2Z8LA 3T13A 3AMUA 1HRJA 4MIUA 4BY1B 2NBFA 4B08A 4CJ1B 5D65A 4QIWB 5CMDA 1U4MA 1SYDA 3HG9A 4B9WA 1LO5D 3RLFA 4ULLA 5EKIA 4DU9A 2B2YA 2Q8IB 2Z1CA 3HKZB 1KLGD 5KYLA 2EVBA 4K8JA 3I72A 3MTSA 1LACA 2ZT9C 2PZUA 5CC4A 4E6IA 1WTVA 3BDOA 1GHKA 1LTSD 1TY0A 4DAPA 4NKLA 2CW0D 1CQVA 1QWYA 3K57A 4G7ZC 1CK1A 3PUYA 1Q1BA 3J80L 5LL6S 5CV9A 3GTKB 4NP5A 3J81E 4IFDH 4A3MB 4RGMA 4CBVA 1G2SA 4Q0FA 1YNNC 3M3YB 2KEDA 3I3CA 1ZYRD 1C8CA 3OSOA 1UEAB 1WTPA 4RKLA 1F2MA 5C4XB 2F0PA 1PRTC 5CV8A 2EJFC 3QIAA 2Q8TA 1V43A 2XWJB 2I07B 1AZQA 4C1NI 1I4HA 5KYIA 1AEXA 2K1BA 4C3HB 2M00A 1O7ZA 1HA5A 1IW7C 2L0CA 3S1NB 2E2JB 3C1EA 3BVMA 5DEHA 3ZYYX 1HQRD 2E74C 3S9WA 1B53A 3PO2B 2B63B 3MFGA 5LL6X 3RD4A 1STYA 3C46A 3S2HB 3VYRA 1WTXA 2KOLA 4F88A 2EJMA 4ZUIA 3BYTB 5C0XJ 3GP7A 2F1MA 1VDZA 2K04A 3NTKA 3HEJA 5C0XG 1K8MA 3NQTA 2KJXA 1KDCA 2IWHA 1TR5A 4IN3A 3EQLC 1F2ZA 4EGVA 1ENAA 5EBDA 3S1MB 1ONLA 3V96A 1JOOA 5K36H 5DM63 3P20A 1RD9D 2ID0A 3J7AF 2F0JA 2NTSA 1G291 3HOUB 2PQEA 2L11A 4DXFA 2E2HB 1J8IA 1SNOA 4KHZA 4IUUA 4BA2I 3SR1A 5I9PA 2JA7B 3GQBA 3EVQA 3S16B 4OIJA 3FPPA 3PMFA 1GJXA 4C3JG 4A3EB 2PO4A 1VMPA 3S1QB 4CKCA 1BXTA 5T1GA 4FF2A 3SHLA 4DF7A 4KD3A 1EWCA 3X3NA 1Y8OB 1QOHA 2HCIA 3QB3A 4KKSA 4DGZA 1CA6A 4LK1C 3C2PA 4FXGC 1ESRA 1W6KA 2CHBD 2RQXA 3I70A 2F0IA 5FO7B 2JA5B 3QWNA 4M1UB 2WKDA 4R9WA 4IUTA 3CQZB 1SE2A 4K5WA 1AFPA 2JEAI 4EQNA 1SNDA 3Q23A 1D2BA 2EYLA 1AW7A 5C0XI 1PZJD 3A54A 2EYPA 2F0SA 4J1MA 2DNEA 1CA5A 4KK7A 3F2UA 1LTGD 1BQQT 3NUCA 5IGCA 1JICA 4QF4A 2FJ2A 1TWGB 3NBHA 1H9JA 2Y0SB 4RAUC 3DWAA 5IGGA 3R93A 5IODA 1EYDA 2VUMB 2JA8B 3CHBD 2EY5A 4ZLTF 4U68A 5KIXA 4G7HC 3I4MB 1DONA 2WACA 5IGFA 4CKBA 3TP7A 3PUVA 3NTHA 3OIQA 2A5HA 4K2LA 5FO8B 4C3JB 1IL8A 1TY2A 3OHXC 4PMWA 1SBBB 2PZTA 4HEDA 1XXGA 3KK7A 2OT2A 2SEBD 5K5PA 5EPKA 1Y8PB 2SDFA 4L63B 2JA6B 2PW7A 1SMYD 1SE3A 1RJTA 1WTQA 1II3A 3D4DA 4F8MA 4O1NA 3PIP3 3TDQA 1D5ZC 2IJ0A 3M7GA 5C5LA 3HRZC 3DM1A 5C5MA 2B39A 5J39A 5A2QL 4FF3A 1M8AA 5HGTA 1JR0D 4G7OC 3SK6A 2H1EA 3WDNA 5JAVA 3IKJA 3QG1A 3HOZB 3R8BA 2K28A 1DOLA 3M4OB 1HFGA 1SYFA 2F03A 1OXVA 3DWPA 2HUGA 1I4RA 2K01A 3W2DA 4XQJA 2QDBA 5KNCA 4RCNA 2F0DA 3KLSA 1U4LA 3KBGA 4KJNA 2KVMA 1W6JA 1MSHA 1S4ZA 1EWHA 1LT3D 1QILA 2EYHA 3C1FA 4F7XA 3GTPB 1H9SB 1PDQA 1NCVA 3QOJA 4Q5VA 1Q3LA 2J0TD 2FMCA 5T1IA 1U4RA 2B8GA 2E76C 2G9DA 2EJGC 1JWMD 1QE6A 1PXUA 4HCEA 2WAQB 4H0LC 1MBYA 4FNFA 2B2WA 2A69C 2PYKA 1GUGA 2DNCA 4IUPA 2KHSA 2NB0A 2QCPX 1B2TA 4HMIA 1YNJC 5I4DA 2E2DC 2M9VA 5I6WA 2A6HD 3KLSX 3UI2A 2R3ZA 5BN4A 3D3RA 2ICEC 1ENFA 3K5LA 1Q1EA 2K5QA 2BDNA 3I90A 5IGEA 5FLXL 2KUMA 1NUCA 2AQ2B 4HR7B 2MPMA 4PMBA 1D6EC 5M5YB 1B9NA 4RCOA 3Q24A 4DN4M 5M9OA 4KN7C 3KBXA 1LT6D 2K5DA 4FF1A 2KCNA 5JEAJ 2NZ1D 1CM9A 1SXTA 4K2KA 1WTOA 1E2VA 3K58A 3K5MA 2O2LD 4Y7NB 4U673 5JEAG 1F77A 3H09A 2X69A 4N9PA 2F0OA 3VYTA 1CQFA 1XX8A 1OXUA 3NQIA 3D4WA 1BUVT 4IZ8A 4ZRZA 1ML0D 1MGSA 2NWGA 1F9SA 4I65A 2QEJC 3GD7A 2PW5A 4C3IG 4QMGA 1CI3M 1CTMA 3O13A 1PFMA 4BS9A 4XTCS 4A3FB 1KABA 3FKIB 1F9PA 1Y1VB 1HA6A 4RFBA 1JOQA 4DNTB 3BDCA 2JE6I 1I4QA 4XIGS 3HOVB 1SFOB 2BE5D 2LMCB 2N88A 3G6JB 3EA6A 5KNBA 1O78A 1TWAB 4KMUC 3CKIB 3BG3A 4A3KB 4FXDA 1L0YB 3MXNA 3OW7A 1S5BD 2Z4HA 1ILPA 2X6LA 2K32A 3NXWA 1UNSA 2FINB 1DYQA 1LLRD 2RSOA 4ME5A 3FVQA 3GTOB 3V05A 4JBWA 5G3LD 1KLUD 1SYBA 2MJ8A 1Q12A 3D6WA 2QKIC 1D5MC 1MSGA 1ET6A 1G6ZA 1EY4A 1V1PA 2AUKA 1SYEA 2QILA 4LJZC 1BF4A 2SOBA 2AWNA 1QNKA 1SNPA 3EFXD 1BCPD 2LFNA 1PTOF 4G4KA 3Q6SA 3PUXA 5M5XB 2IX3A 3VYSA 2L12A 2J4XA 2D62A 5FOBB 5CV4A 1EEFD 1SJHD 3L3OC 3URYA 3VR3A 4N9TA 1CT1D 1PYWD 4IUNA 2B2YC 2C9OA 2RBMA 1T5EA 3G7LA 1I3QB 3BVZA 1GUWA 3FRPB 3TZDA 4C3IB 5EQ0A 1B4OA 1H9MA 2LS01 4PNYA 1OXSC 1TU2B 2R6GA 2R92B 4BBRB 1C4QA 3E6ZX 3EROA 1EIHA 1YNND 5E3FA 3MA2B 2D9UA 1BBXC 3A7AB 5E1FA 1PRTD 4RGNA 5EGTA 2J7ZA 1STBA 5DM73 1PFBA 4WRDA 4KTAA 1ESFA 4XT3B 3QOLA 4KHVA 4K6LA 3ITPA 1IW7D 1O80A 3T4AC 2KECA 1SAPA 4KD4A 4QUFA 1EU4A 1B9MA 2QF7A 1LV9A 2CQAA 4K14A 3VR2A 1EY5A 1UUPA 1QJOA 3HZXA 1EY7A 1FR3A 1BO0A 1RF2D 4O42A 3J7YW 3ND9A 4ZK9B 1H9RA 1Y69U 3HOYB 2NN6G 2F3WA 2F0FA 1I4PA 2X6GA 4TSSA 1I6HB 3E0JA 3HS0C 2L9HA 3X3MA 1EOTA 5C3XA 1PTOB 4HTHA 2G9HD 1F2LA 4YIJA 5ELEA 1RKNA 2PMZB 1WVLA 5JOBA 3IL8A 4LMQD 3GTGB 4XYOA 2RA4A 3T53B 1WD0A 1OXTA 5A2QE 2MUYA 1DZ1A 3NTIA 4AYBB 3E5SA 3H6MA 1HQMC 3DEOA 3K5OA 2DN8A 5KGUA 4CHTB 3TMEA 5C3EB 1IYVA 3EJIA 3CU7A 5J1ZA 5IT9L 1WTWA 1JWSD 2NVQB 3DMUA 5KEEA 2IX1A 3DHQA 4UAIA 1GHJA 1ZXTA 4ZUJA 1EY6A 4OGQC 2WP8J 1KTKA 4ZKCB 5CV5A 1RODA 1A3TA 4CGYB 2BDOA 1HCZA 4NDXA 2IPKD 1S5DD 2E75C 4HSPA 3VA5A 4PMCA 4KN4C 3C3LA 3K5NA 1DOKA 3NWTA 3MVVA 1FNUA 2O5JC 2EYOA 1EU3A 2EDGA 1WD1A 3WOFA 4XDXA 1HFNA 4IUQA 1VMCA 1FNWA 5FK9C 5G3LF 4ZAIA 2JYOA 2O5IC 1D1IA 4K5VA 1AN8A 3H0GB 4RHRA 1HPCA 1AZPA 4X3UA 4C1NK 4X3SA 1G2TA 3R3OA 1BCPF 1RCVD 5C0XH 4QB4A 2XN9C 4F87A 3SXHA 1X3PA 1PTOC 3ERQA 2F0QA 1R9TB 3NE5B 5FLXE 3ONAB 1TS5A 3GV6A 1TS4A 1VCIA 2LKVA 1JC7A 4FF4A 2Q8RE 3JAML 1NR4A 1RTOA 2E2IB 2XNAC 3I91A 2FMMA 1A15A 1RDPD 2EYMA 3V2TA 2F0VA 1OXXK 1TWCB 2F0MA 4X3KA 2EZVA 2XVSA 1D1KA 1IHZA 4C2MB 1JWUD 3GTMB 3VA7A 4OO1G 1HTLD 3R2TA 3IFTA 1KAAA 5TSSA 4A3GB 1JQYD 1JORA 4BY7B 1FGBD 1LT5D 1B50A 1JOKA 4A93B 2PNRC 2EE1A 1CHPD 3TP5A 3SK8A 1TWHB 3VYUA 1PZID 5DNFA 3K6OA 1ICWA 4C56C 1WCMB 2VNUD 1STEA 3TP6A 3D8GA 3RZOB 2R61A 3OPOA 5C4HA 1LTAD 3RUZA 5I2XA 3MXPA 1VF5C 2K6AA 3I8ZA 2OEOA 1EFID 1AP0A 5J22A 3OOCA 5IGDA 2EPBA 2JP1A 1SNQA 1TVXA 3NWSA 2A6EC 4HN7A 3DXJC 4IFDJ 4RA8A 3T16A 4IFDG 1STGA 1MI2A 2JSOA 3SK5A 5D3IB 1EY0A 1F9RA 5NUCA 1DOMA 5HURA 1E2ZA 1NR2A 2AQ3B 1A2TA 5EPLA 3J80E 5CORA 1EQVA 1EYAA 5FKAC 4K6DA 4V0BA 1EYCA 3TZUA 3SEBA 4A3IB 3QO2A 5CBEE 5JVG3 1IKLA 1SYGA 3CRKC 1A2UA 4IALA 2A68C 4R8NA 1T5XD 1STNA 3OWFA 1BDOA 1HUNA 5CGKA 1B3AA 2F0WA 2B2TA 1IKMA 5ELDA 1R4QB 1D5XC 4CJ0B 1NSNS 2K03A 3N6RA 2MHVA 3S15B 2BCOA 3DEPA 2PPBC 1TIID 1KDBA 2B2VA 1O7YA 2OF1A 5M3MB 4ABNA 3OWEB 2GA4B 3SVMA 1C48A 3D6CA 4BA1I 4OO1I 4WFN3 3NBIA 3U9OA 4NW2A 1E2WA 4S3SA 3A56A 2B2WC 3GTJB 1YNJD 5F2DA 2DY8A 2EY1A 3PIO3 1SDFA 4K8IA 4CKEA 1GUTA 2IL8A 3WOEA 5ELCA 5I6YA 1HHVA 2AQ1B 5K36G 3FEWX 3DWQA 5LHY1 2EYJA 5JJZA 5IIFA 3MWYW 1A3UA 1EZ6A 1LABA 4XQNA 5KNDA 3S2DB 1V1PB 3L9AX 2SNSA 3PUWA 1LTBD 2WIIB 1B44D 1A3VA 4DA2A 3PUZA 5ISRA 4EQPA 2PCFB 2CW0C 4ILWA 1SNCA 1DCZA 4HCSA 2B2VC 1ILQA 1ZKOA 1S5ED 3A7LA 5EPJA 5KRUA 5C4JB 3VR6A 4FYDA 3MZ5A 4OL7A 1BCPC 1Y8NB 1ZEQX 2F4IA 3P1HA 3A8KE 4IFDI 4FO2A 3TP8A 2BA1A 1ZYRC 1GXDC 1EZ8A 2JEBI 4J8QA 4XQQA 1G91A 4J6HA 2K05A 2L55A 3M4YA 3BVGA 2YYZA 4DK0A 4TKOB 3U9SA 1EIGA 1HXYD 1ENCA 1GOZA 1WTRA 3K7AB 1JCKB 1QG7A 5COYA 1PMRA 3AU7A 3NP8A 5C3WA 1DJRD 3RMHA 3R2IA 1HTPA 2ZXPA 3LNNA 2DY7A 1O7LA 5IGBA 3HGBA 3P7JA 3CRLC 1M4VA 3MEHA 2MGSA 5IT9E 3RZDB 5BN3A 1K83B 4MN3A 2EY6A 3A8IE 5AFWA 1CHQD 2IX0A 2RDGA 4ID6A 3NHHA 4RKBA 1S5CD 2HCCA 2AWOA 3LWUA 2LY7A 1LTRD 4KY7A 3H3VC 1JE4A 1X3QA 3QJYA 1I6VC 4WJWA 1QB5D 4BWGB 3GV3A 1K8OA 1GUOA 2F3VA 2VB3X 2C5CA 2CVRA 1CZWA 1Z7TA 5D14A 4RH6A 4L6TB 5JEAH 1FNVA 3T51B 2TMPA 3BS1A 2EYFA 2BOSA 2F0GA 1PFNA 1QNUA 1PLFA 2NVYB 1XTCD 1XYIA 1Y1WB 2O4XA 4A3JB 5I2YA 4RHSA 3D4RA 2RDFA 1SYCA 3N52A 5EKLA 2RKSA 4DAYA 1IYUA 3JAME 2L5TA 5BN5A 2YU9B 4PV1C 5D3DA 3H91A 3M85A 1I50B 3L7ZC 1LTTD 2IW3A 2AUJD 1TS3A 2K33A 1KDAA 3MXGA 2A73B 2VB2X 1Q90A 5CR3A 4KKTA 5EBCA 3KUPA 1Q8IA 4A3DB 4GZYC 3A8JE 3ND8A 3I4NB 1QCBD 2EXZA 1VF7A 3KF8A 3KLRA 2NYZD 5EKKA 3J81L 5CYUA 4FXKC 2F0HA 4WORA 3NK9A 1SEBD 2KEEA 1FD7D 1SJED 3A55A 5DAUA 3HOXB 1JB3A 3LWEA 2F0LA 5ELFA 4XYQA 4KI0A 1U4PA 3OMCA 1MD2D 1BR9A 3K59A 3OMGA 1STHA 1TQOA 2XIWA 2NUCA 2TSSA 1G8ZD 4ZYSA 3H94A 2NTTA 5M3FB 1X32A 1PTOH 2HQEA 1CZGA 3Q22A 5C6AA 1GUNA 3TBIB 4FP5D 3NPPA 2KCCA 3K0YA 2WV6D 4IUVA 1EY8A 4X3TA 1V8QA 1FYCA 3TSSA 1DD2A 2MP1A 5E4WC 4A3BB 1L0XB 1KNAA 4ZKBB 2NVTB 3HP3A 1HUMA 1STAA 1SMYC 4OHJA 1H9KA 2NN6I 2RVLA 3T56B 4L8JA 4KY5A 1BNZA 1EY9A 4TQUS 2XWBB 2HDLA 2EY2A 4KV6A 2F0UA 2FHTA 1DXMA 1EQTA 3FMCA 1OO9B 5CV6A 3GTLB 3SE0A 1TT2A 1LT4D 2F0TA 4DNRB 4B9XA 2D2CC 1EEID 2H4OA 1SNMA 5ELBA 4QUCA 3VR4A 3I4LA 3VR5A 5I9OA 2JXMB 2WINB 3MC0B 4G57A 1ET9A 4HMJA 4M8AA 2K5WA 1E0BA 2I46A 3SDZA 1U9RA 4XXEA 2NN6H 3NSWA 2XRSD 3IAYA 2A74C 3BZDB 3PV0A 3M7NA 1Z6HA 3AB9A 1PTOD 1J9OA 5A35A 2D5DA 4XT1B 4TRDA 1PRTF 2EOTA 2RDHA 3S1RB 4IQZA 3OIPA 4DAVA 4DK1A 2BA0A 4EVOA 1TWFB 3D31A 4RGTA 2B2UA 3GTQB 2FFKB 2XSCA 3S17B 3J7AV 4LAAA 2HDMA 1V1OA 3HOWB 1LTID 3BYYB 4R8IA 2IT1A 2SNMA 4BBSB 3FDTA 4H7BA 1DM0B 1UAPA 1KNEA 2A6HC 1PZKD 2Z4IA 3SK4A 1RTNA 2KQ3A 4EQOA 2ZXOA 5C4ZA 2B8FA 2F0KA 3S14B 1CFMA 5JVH3 1BCPB 2WB1B 3MHBA 1R4PB 1SE4A 4H44C 2F0NA 3I73A 5CV7A 1I4XA 3DUZA 2WKCA 3MFYA 2R93B 2B2UC 5FO9B 2ENBA 4UDUC 1RHPA 1F9QA 2PZWA 3TN2A 4RGOS 5M5WB 4OIKA 4MHEA 2KA7A 1F2YA 2A6ED 3P75A 5E4XA 5JPNC 1GUSA 1H9SA 3LX0A 1Z47A 2A69D 4KJOA 2R7ZB 2OXPA 1A6XA 2F0EA 1TS2A 1I4GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C5C A;  1R4Q B;  2XSC A;  1C4Q A;  1CZW A;  4ULL A;  1DM0 B;  1BOS A;  4M1U B;  1CQF A;  1R4P B;  1QOH A;  1D1I A;  1D1K A;  1CZG A;  2BOS A;  3MXG A;  4P2C B;  1QNU A;  2GA4 B;  1C48 A; 
#chains in the Genus database with same CATH topology
 4Z9C B;  1N33 Q;  5IP7 H;  3CCL A;  1S5F D;  1B1Z A;  4JI2 L;  2K14 A;  3IFD A;  3MAQ A;  2ICI A;  2N55 A;  1TKW B;  4JG2 A;  1AE2 A;  5IOC A;  4A3M G;  5IYB H;  4RWS C;  4NXN Q;  3BDL A;  4OX9 L;  3W3A A;  1XWE A;  3STB C;  3I55 A;  4GN4 B;  4ZQ3 A;  1L2F A;  2A68 D;  4P2C B;  1EL0 A;  5C4X G;  1SN8 A;  4DXG A;  1NAP A;  1PRT B;  4L5R C;  4DR7 Q;  3B6Y A;  2BE5 C;  3FPU B;  1XPO A;  3GO5 A;  1PYS B;  1KRS A;  5JPM C;  2WFW A;  4NMZ A;  2Z6K C;  4YY3 L;  1NE3 A;  1SSO A;  3Q0A A;  5EJW A;  1BOS A;  4LUO A;  4HSV A;  2NVX B;  4C3H G;  4A3I H;  4JI4 Q;  4IUR A;  4KY6 A;  4JK1 C;  4FVM A;  5CBA E;  4V19 0;  2VXW A;  2K7V A;  2P5Z X;  4DUY L;  4KKU A;  2Q2U A;  1HNX Q;  4K5X A;  4HAE A;  4AYB E;  4KLK A;  4QCL A;  4ODG A;  2B2T C;  2V4D A;  4CJ2 C;  4I7Z C;  2ZXR A;  3PO3 B;  3AYH B;  3F8T A;  3PO2 G;  4PQX A;  4OO1 H;  4LNQ A;  4JOI A;  2B63 G;  2IY5 B;  2XRQ D;  5C44 B;  3MXU A;  4B3M Q;  1N33 L;  4DFA A;  2N49 A;  1PH1 A;  2M2L A;  2L1B A;  4H13 C;  2L4N A;  2RSN A;  2Z8L A;  3T13 A;  3TQY A;  3AMU A;  1HRJ A;  1VQO A;  4MIU A;  1K3B C;  4BY1 B;  4NXN L;  2NBF A;  4B08 A;  4CJ1 B;  5D65 A;  4QIW B;  1VQC A;  5CMD A;  4QJF A;  1HR0 L;  3H3V I;  2VL6 A;  1U4M A;  4DR7 L;  1SYD A;  3HG9 A;  4B9W A;  5GQO A;  1UWV A;  3J81 c;  1LO5 D;  3RLF A;  4ULL A;  3GTJ H;  2HHH Q;  5EKI A;  1HJP A;  4DU9 A;  1CSQ A;  1E1O A;  2UU9 Q;  2B2Y A;  2Q8I B;  2CH4 A;  2Z1C A;  4JI4 L;  3HKZ B;  1KLG D;  5KYL A;  2EVB A;  1YIT A;  3RN2 A;  3ULL A;  4J15 A;  4LF6 Q;  4K8J A;  2ZTD A;  1VQJ A;  3I72 A;  3MTS A;  4JBJ A;  2RHS B;  1LAC A;  3UDI A;  2ZT9 C;  2PZU A;  5CC4 A;  4E6I A;  1WTV A;  2LSS A;  3BDO A;  1GHK A;  1LTS D;  1TY0 A;  4DAP A;  4X62 L;  2B29 A;  4NKL A;  1XNQ Q;  1VQ8 A;  2CW0 D;  4DV3 L;  1G6P A;  1CQV A;  2KEN A;  3AEV A;  1DGS A;  3I4O A;  1IBM Q;  5IYD G;  1QWY A;  3K57 A;  3HOU G;  4G7Z C;  1CK1 A;  3PUY A;  1Q1B A;  3PGZ A;  3J80 L;  5ELN A;  4OON A;  5CV9 A;  5LL6 S;  3GTK B;  3PO3 H;  3H3V H;  4NP5 A;  2G5D A;  3J81 E;  3K81 C;  4IFD H;  4A3M B;  4JV5 Q;  1K73 C;  4RGM A;  4CBV A;  1G2S A;  4N8F A;  4Q0F A;  1PV4 A;  1YNN C;  2K5H A;  2KED A;  3M3Y B;  3I3C A;  1ZYR D;  3I7F A;  1C8C A;  3OSO A;  2JA7 G;  1SR3 A;  1UEA B;  1WTP A;  4RKL A;  1F2M A;  5C4X B;  4IOA A;  2F0P A;  1PRT C;  5CV8 A;  2EJF C;  1UE7 A;  1K28 A;  5GAG C;  3QIA A;  1EQR A;  2Q8T A;  1V43 A;  2XWJ B;  2I07 B;  2HD3 A;  3OTO Q;  1MIU A;  1AZQ A;  4C1N I;  4A3E G;  4DV0 L;  1I4H A;  5KYI A;  2CWP A;  1AEX A;  4GNX A;  2K1B A;  4C3H B;  2XGT A;  1UE6 A;  2M00 A;  1O7Z A;  1HA5 A;  1IXR A;  1IW7 C;  2L0C A;  1S40 A;  3S1N B;  4Y52 H;  1EWI A;  2E2J B;  5LMN Q;  3C1E A;  3BVM A;  1C7Y A;  5DEH A;  3ZYY X;  1JE5 A;  1HQR D;  2E74 C;  3S9W A;  3F1Z A;  1B53 A;  1IBM L;  3K0X A;  3PO2 B;  4H02 A;  2B63 B;  3MFG A;  4HJA A;  1J5E Q;  5LL6 X;  3RD4 A;  1STY A;  3C46 A;  3S2H B;  3VYR A;  1WTX A;  2KOL A;  4F88 A;  2EJM A;  4ZUI A;  4HIM A;  4JV5 L;  2IHF A;  3AQQ A;  1IYJ B;  3BYT B;  2RCN A;  5C0X J;  3GP7 A;  2F1M A;  1VDZ A;  2K04 A;  2Q2T A;  3CCU A;  3NTK A;  3HEJ A;  5L37 A;  5C0X G;  2KCT A;  1K8M A;  3NQT A;  3HFZ B;  2KJX A;  2JA5 G;  1KDC A;  2IWH A;  2BH2 A;  1TR5 A;  4IN3 A;  3EQL C;  1F2Z A;  4EGV A;  1ENA A;  1MKH A;  1YJW A;  5JJK A;  4JI6 Q;  5EBD A;  3S1M B;  3EIV A;  1ONL A;  3V96 A;  1JOO A;  5LMN L;  4LWC A;  5K36 H;  4OWX B;  1SRO A;  5DM6 3;  3P20 A;  1RD9 D;  2ID0 A;  2HT1 A;  4TVA B;  1J5E L;  1QUQ B;  3J7A F;  2F0J A;  2NTS A;  1K83 H;  4YCU A;  2OQK A;  3G48 A;  4R4O A;  5LMU Q;  1G29 1;  2Y0S G;  3HOU B;  1XJV A;  1CKM A;  2PQE A;  2L11 A;  4DXF A;  2E2H B;  1J8I A;  2VUM G;  5FJ8 G;  2JA8 G;  2VW9 A;  2JK8 A;  1SNO A;  4KHZ A;  4IUU A;  4BA2 I;  3SR1 A;  4HIO A;  5I9P A;  2JA7 B;  2F52 A;  3GQB A;  3I4M G;  1QZH A;  3CW2 C;  4JI6 L;  4IOC A;  1XMO L;  3EVQ A;  3S16 B;  3E3X A;  1L0W A;  4OIJ A;  5GAH C;  2WB1 E;  3FPP A;  3PMF A;  1GJX A;  4C3J G;  4A3E B;  1QUQ A;  3U4V A;  3W1B A;  4LF4 Q;  4QQB X;  2PO4 A;  4YHH Q;  1I94 Q;  1E1T A;  1VMP A;  3S1Q B;  2YTV A;  3ULJ A;  4CKC A;  2NVY H;  4JBM A;  3S1M H;  1BXT A;  1I5F A;  4DNI A;  5T1G A;  4FF2 A;  2Z0S A;  1RL2 A;  1Y1W H;  2MO0 A;  2JA6 G;  4LF5 Q;  3SHL A;  3KDF B;  4DF7 A;  4KD3 A;  1EWC A;  3X3N A;  1Y8O B;  1QOH A;  2HCI A;  3QB3 A;  4KKS A;  4A3J H;  4A3L H;  1PH2 A;  2AKW B;  4DGZ A;  1CA6 A;  4LUZ A;  4LK1 C;  3C2P A;  2L15 A;  1HZC A;  4JVZ A;  4FXG C;  1ESR A;  1W6K A;  2CHB D;  2QW7 A;  2RQX A;  3RLN A;  3I70 A;  2F0I A;  3HOU H;  2UUA Q;  1X3F A;  5FO7 B;  2YU9 H;  1X55 A;  3CCQ A;  4YCW A;  2JA5 B;  1I50 H;  3QWN A;  2DJG C;  2E2H H;  1WI5 A;  4M1U B;  2WKD A;  1VQL A;  4APV A;  4R9W A;  4IUT A;  1KRT A;  3CQZ B;  1SE2 A;  3M4P A;  4K5W A;  3HOZ G;  1AFP A;  4NPS A;  4JI3 Q;  4LF4 L;  4YHH L;  2JEA I;  4EQN A;  2QEX A;  1SND A;  5BR8 Q;  2JA7 H;  3Q23 A;  1D2B A;  2EYL A;  1PYB A;  2QA4 A;  1AW7 A;  5C0X I;  1PZJ D;  4A3D H;  4GLV B;  3A54 A;  2EYP A;  2F0S A;  3I4N H;  4J1M A;  4LF5 L;  2DNE A;  2OQ0 A;  2RF4 A;  1CA5 A;  4KK7 A;  3F2U A;  5IWA Q;  4L5T A;  1LTG D;  1BQQ T;  3NUC A;  2GN5 A;  2K5V A;  1HZA A;  5IGC A;  1JIC A;  3S1Q H;  5AJ3 Q;  4QF4 A;  2FJ2 A;  1TWG B;  3NBH A;  1H9J A;  2Y0S B;  4RAU C;  3DWA A;  5IGG A;  4DR4 Q;  3R93 A;  5IOD A;  1EYD A;  2VUM B;  4BXX G;  1BBW A;  2UUA L;  2JA8 B;  3CHB D;  4WJ4 A;  2EY5 A;  4ZLT F;  1VQ6 A;  4DKA C;  4LF8 L;  2OCE A;  1EUJ A;  4U68 A;  2LXK A;  1N8R C;  1K9M C;  4DR1 Q;  5KIX A;  1GVP A;  4G7H C;  3BJU A;  2Z6B A;  3KJP A;  3I4M B;  1DON A;  2WAC A;  4PZ6 A;  5IGF A;  2WAQ G;  4CKB A;  3TP7 A;  1CKO A;  3PUV A;  3NTH A;  1IBL Q;  3OIQ A;  4OEM B;  1D7Q A;  2A5H A;  4K2L A;  4LFC L;  1B3Q A;  5FO8 B;  4C3J B;  1IL8 A;  1TY2 A;  3CXC A;  2UXC L;  3OHX C;  4PMW A;  3PCO B;  1SBB B;  2PZT A;  4HED A;  5IWA L;  1XXG A;  4DV1 L;  3KK7 A;  2OT2 A;  3HKZ E;  2SEB D;  5K5P A;  5EPK A;  1Y8P B;  2SDF A;  4L63 B;  2JA6 B;  4DR4 L;  3F2D A;  2PW7 A;  1X6O A;  3KF6 B;  1SMY D;  1SE3 A;  4DV5 Q;  1RJT A;  4UP9 A;  1WTQ A;  3EN2 A;  4LUV A;  1II3 A;  1CKN A;  3D4D A;  5IYC G;  4F8M A;  4O1N A;  2UXD Q;  3PIP 3;  3TDQ A;  1VQK A;  1D5Z C;  2ZJP A;  2IJ0 A;  3M7G A;  5C5L A;  2HIV A;  3HRZ C;  4DR1 L;  4A3B H;  3DM1 A;  4B3S Q;  5C5M A;  4JCV E;  2B39 A;  2NVT H;  1N9W A;  1IBK Q;  5J39 A;  1IBL L;  1N34 L;  5A2Q L;  4FF3 A;  5FJ8 H;  4IPH A;  1M8A A;  5HGT A;  1JR0 D;  2JA8 H;  4G7O C;  3SK6 A;  2H1E A;  3WDN A;  5JAV A;  1X3E A;  3IKJ A;  3QG1 A;  3HOZ B;  1XNR L;  3R8B A;  2AHO B;  2K28 A;  1DOL A;  4DUZ Q;  4GKK Q;  3M4O B;  1HNZ Q;  1HFG A;  1SYF A;  5GRO A;  3KF6 A;  2F03 A;  4LFA Q;  1OXV A;  3DWP A;  1YJN A;  2HUG A;  2NZH A;  1B7Y B;  1I4R A;  4K0K Q;  4JI7 Q;  2K01 A;  3W2D A;  4XQJ A;  4DV5 L;  2QDB A;  4KHP Q;  2IHE A;  3JC6 6;  5KNC A;  4RCN A;  2F0D A;  3KLS A;  1U4L A;  2UUB Q;  3KBG A;  4KJN A;  3J80 c;  2UXD L;  2KVM A;  1W6J A;  1YHB A;  3J81 j;  1MSH A;  1S4Z A;  4O2D A;  1EWH A;  1X54 A;  1LT3 D;  1QIL A;  4B3S L;  2EYH A;  3C1F A;  5DLQ E;  4F7X A;  2H5X A;  2KCM A;  3GTP B;  1H9S B;  1PDQ A;  1NCV A;  3QOJ A;  4Q5V A;  3CMA A;  1Q3L A;  1IBK L;  2J0T D;  2FMC A;  5T1I A;  3FP9 A;  4A3F G;  1U4R A;  3FKI G;  1Y1V G;  4DV6 L;  2B8G A;  2E76 C;  3ULP A;  2G9D A;  2EJG C;  1JWM D;  1QE6 A;  1PXU A;  4HCE A;  1H95 A;  1NTG A;  2WAQ B;  4DUZ L;  3HOV G;  3CCV A;  4GKK L;  4H0L C;  1MBY A;  4FNF A;  2B2W A;  1HNZ L;  2A69 C;  3S1R H;  1HNW Q;  1VQG A;  4LF9 Q;  1AE3 A;  2PYK A;  4A3K G;  1OTC A;  1GUG A;  2DNC A;  4IUP A;  3DLL A;  1TWF H;  2KHS A;  2NB0 A;  3GTQ H;  2RCF A;  3S17 H;  2JQO A;  4JI7 L;  4KHP L;  2QCP X;  3J7Z C;  3M4O H;  1B2T A;  4HMI A;  1YNJ C;  4YY3 Q;  2UUB L;  5I4D A;  2E2D C;  2M9V A;  5I6W A;  2A6H D;  3KLS X;  3UI2 A;  1N32 Q;  2R3Z A;  5BN4 A;  3D3R A;  2ICE C;  1ENF A;  4DUY Q;  3K5L A;  4L5S A;  1Q1E A;  2K5Q A;  1S72 A;  1MJE A;  2BDN A;  3I90 A;  5IGE A;  5FLX L;  1FL0 A;  3Q8D A;  2KUM A;  4EX5 A;  4BBS H;  4HJ7 A;  3EBE A;  1NUC A;  2AQ2 B;  2F4V Q;  4HR7 B;  2MPM A;  3GDE A;  4PMB A;  1X65 A;  3A5U A;  4IPC A;  1D6E C;  5M5Y B;  1B9N A;  4RCO A;  3Q24 A;  4AQY Q;  4DN4 M;  5M9O A;  1LTL A;  4KN7 C;  3KBX A;  1LT6 D;  2K5D A;  4FF1 A;  1HNW L;  2KCN A;  4LF9 L;  5JEA J;  2NZ1 D;  1CM9 A;  1HR0 Q;  1SXT A;  4K2K A;  4HID A;  1E2V A;  1WTO A;  3S14 H;  3K58 A;  3K5M A;  1PFS A;  1E22 A;  2O2L D;  4Y7N B;  2EQS A;  1YNX A;  5JEA G;  4U67 3;  1F77 A;  1HZ9 A;  3H09 A;  4GS3 A;  2X69 A;  4N9P A;  2F0O A;  3VYT A;  1JJ2 A;  1CQF A;  1XX8 A;  3TRZ A;  1OXU A;  3AFQ A;  1N32 L;  3NQI A;  3D4W A;  1BUV T;  2V1C C;  2I0Q A;  4IZ8 A;  4ZRZ A;  1ML0 D;  1WJJ A;  1MGS A;  2R93 H;  2F3I A;  2KBN A;  2NWG A;  1TXY A;  1YEZ A;  3A5Z B;  1F9S A;  2JA9 A;  4I65 A;  4GN5 A;  2QEJ C;  5M5W H;  3UDX A;  1SLJ A;  3GD7 A;  2PW5 A;  4C3I G;  2F4V L;  4QMG A;  1CI3 M;  4X62 Q;  1CTM A;  1J6Q A;  3O13 A;  1PFM A;  4DV3 Q;  4BS9 A;  4XTC S;  2R92 G;  4BBR G;  4A3F B;  1KAB A;  4AQY L;  3FKI B;  1F9P A;  1Y1V B;  3PIP A;  1HA6 A;  4YWM A;  2R7Z H;  4RFB A;  1JOQ A;  3STB D;  4A75 A;  2ZJQ A;  4DNT B;  3BDC A;  5FLM H;  2VQF L;  2JE6 I;  1I4Q A;  4XIG S;  3HOV B;  3CPF A;  1SFO B;  4MNO A;  2BE5 D;  2LMC B;  2N88 A;  3G6J B;  3EA6 A;  5KNB A;  1O78 A;  1XMQ Q;  1TWA B;  3CC7 A;  1KHI A;  4KMU C;  3CKI B;  4R4T A;  3BG3 A;  1EIY B;  4A3K B;  4JI0 L;  2MFI A;  4FXD A;  1L0Y B;  3MXN A;  4QY7 A;  4QGU A;  3OW7 A;  1S5B D;  2OTL A;  2Z4H A;  1ILP A;  3NXW A;  2X6L A;  2K32 A;  1UNS A;  2FIN B;  1DYQ A;  4OEL B;  1LLR D;  2RSO A;  4ME5 A;  4DV0 Q;  3FVQ A;  3GTO B;  2EXD A;  3V05 A;  4JBW A;  5G3L D;  1KLU D;  1SYB A;  2LXJ A;  4GNX B;  2MJ8 A;  2Z9H A;  1Q12 A;  3D6W A;  2NVX H;  2QKI C;  1D5M C;  1MSG A;  1ET6 A;  4P73 A;  1G6Z A;  1EY4 A;  1V1P A;  2AUK A;  1SYE A;  2QIL A;  4LJZ C;  1VQM A;  1BF4 A;  1EIF A;  1B8A A;  1FJG Q;  2SOB A;  3HOY G;  2Y0S E;  1KL9 A;  2AWN A;  4JOI C;  4HJ5 A;  2ATW A;  1QNK A;  1SNP A;  4POG A;  3EFX D;  5C44 H;  1BCP D;  2LFN A;  1NBW A;  1PTO F;  4G4K A;  3Q6S A;  1XMQ L;  3PUX A;  5M5X B;  2IX3 A;  4BY1 H;  3FKI H;  3FHW A;  3VYS A;  2L12 A;  2J4X A;  2D62 A;  4POF A;  1P16 A;  5FOB B;  5CV4 A;  1EEF D;  2D0O A;  4R4Q A;  1SJH D;  3L3O C;  3URY A;  3VR3 A;  2DGY A;  4N9T A;  3W5O A;  1IZ6 A;  1CT1 D;  1PYW D;  4IUN A;  2B2Y C;  2C9O A;  2RBM A;  1T5E A;  3G7L A;  1I3Q B;  3BVZ A;  1C9O A;  1GUW A;  3FRP B;  2VQE Q;  3TZD A;  4C3I B;  5EQ0 A;  3KLW A;  1B4O A;  1H9M A;  1FJG L;  3GTO H;  2LS0 1;  4PNY A;  4AYB G;  1OXS C;  1TU2 B;  5JJI A;  4EQ5 A;  2R6G A;  2R92 B;  4BBR B;  1SRU A;  2DUD A;  1C4Q A;  3E6Z X;  5C3E G;  3ERO A;  1EIH A;  1YNN D;  5E3F A;  3MA2 B;  2D9U A;  4B3T Q;  1BBX C;  3A7A B;  5E1F A;  1PRT D;  4RGN A;  5EGT A;  2J7Z A;  1STB A;  3GTK H;  2KHI A;  5DM7 3;  1PFB A;  4WRD A;  4A3M H;  4KTA A;  1ESF A;  1C0A A;  4XT3 B;  3QOL A;  4DV2 Q;  4KHV A;  4K6L A;  1XMO Q;  1M1K C;  3M3Y H;  5M5X H;  3ITP A;  1IW7 D;  5C4X H;  1O80 A;  2K5N A;  3T4A C;  2KEC A;  3M4Q A;  1SAP A;  4KD4 A;  4QUF A;  1EU4 A;  2VQE L;  1ICF B;  3U58 A;  1X9N A;  1B9M A;  1LUZ A;  2QF7 A;  1LV9 A;  4GNX C;  2CQA A;  4K14 A;  3NEM A;  3VR2 A;  4C3H H;  1EY5 A;  1UUP A;  1YVC A;  1QJO A;  3HZX A;  3KOJ A;  1EY7 A;  1FR3 A;  1BO0 A;  1RF2 D;  3S1N H;  4O42 A;  3J7Y W;  2E2J H;  3ND9 A;  4ZK9 B;  1H9R A;  1WOC A;  1Y69 U;  3JAM i;  3NEN A;  3TS2 A;  4HIK A;  4B3T L;  2UUC L;  3HOY B;  2NN6 G;  3PO2 H;  2A1A A;  2B63 H;  2NZO A;  2F3W A;  3VDY A;  3S2H H;  2F0F A;  1I4P A;  2X6G A;  4TSS A;  3H0G G;  1I6H B;  3E0J A;  2XTI A;  4OWT B;  2R7D A;  2AMC B;  5E7N A;  3HS0 C;  4DV2 L;  2L9H A;  3X3M A;  1KD1 C;  1PH3 A;  4P72 A;  1EOT A;  5C3X A;  1PTO B;  4HTH A;  2G9H D;  1F2L A;  4YIJ A;  5ELE A;  1NY4 A;  1RKN A;  2PMZ B;  4DR2 Q;  1WVL A;  1GD7 A;  1BKB A;  5JOB A;  1PH6 A;  3IL8 A;  4LMQ D;  3GTG B;  4XYO A;  2RA4 A;  3T53 B;  3IRB A;  4ME3 A;  1WD0 A;  1OXT A;  5A2Q E;  2MUY A;  1DZ1 A;  3NTI A;  3CCJ A;  4AYB B;  3E5S A;  1L1O B;  3H6M A;  1HQM C;  3DEO A;  3K5O A;  2DN8 A;  5KGU A;  4CHT B;  3TME A;  2HQL A;  5C3E B;  3NBH B;  3PQI A;  3HKS A;  1IYV A;  3EJI A;  3CU7 A;  5J1Z A;  5IYD H;  5IT9 L;  1WTW A;  1JWS D;  2YTY A;  4A3G G;  1VQE A;  4UY8 C;  1Q46 A;  1PA6 A;  3DMU A;  1S3O A;  4BY7 G;  2NVQ B;  4JI5 L;  5KEE A;  2IX1 A;  3DHQ A;  3TRE A;  4LF8 Q;  4UAI A;  4A93 G;  1P8L A;  1GHJ A;  2QGQ A;  3U4Z A;  1ZXT A;  4ZUJ A;  1EY6 A;  4DK6 C;  4OGQ C;  2WP8 J;  1KTK A;  4ZKC B;  1VQP A;  4DR2 L;  5CV5 A;  1ROD A;  1A3T A;  4CGY B;  2BDO A;  2HIX A;  1HCZ A;  4LFC Q;  3TS0 A;  4GOP A;  3S16 H;  4NDX A;  2IPK D;  1A8V A;  1S5D D;  2E75 C;  2UXC Q;  4HSP A;  3VA5 A;  4PMC A;  1L1O A;  4R1J A;  4A3E H;  4KN4 C;  3C3L A;  3K5N A;  1WCM G;  4CDF C;  4DV1 Q;  1DOK A;  3NWT A;  5FLX c;  3BZK A;  3MVV A;  1FNU A;  3T1Y Q;  2O5J C;  2EYO A;  1EU3 A;  2EDG A;  1WD1 A;  3G71 A;  3WOF A;  4CDD C;  3PF5 A;  4XDX A;  1HFN A;  4IUQ A;  1VMC A;  1FNW A;  5FK9 C;  5G3L F;  2A19 A;  4ZAI A;  1WTH A;  4UPA A;  2JYO A;  1FVI A;  2O5I C;  1D1I A;  1CKN B;  4K5V A;  1AN8 A;  3H0G B;  4RHR A;  1G51 A;  1HPC A;  1AZP A;  4P71 A;  4X3U A;  4C1N K;  4X3S A;  3CD6 A;  1G2T A;  1A0I A;  5IP7 G;  3RNU A;  3R3O A;  4QIW E;  1BCP F;  1N34 Q;  1KQS A;  4B3R Q;  1RCV D;  5IYB G;  4HJ8 A;  5C0X H;  4QB4 A;  2XN9 C;  4F87 A;  3RN5 A;  3SXH A;  2JA5 H;  1X3P A;  2NVQ H;  4A3C G;  1PTO C;  2CH4 W;  3ERQ A;  2F0Q A;  1R9T B;  3NE5 B;  5FLX E;  3ONA B;  1XNR Q;  1E7Z A;  1TS5 A;  3CQZ H;  3GV6 A;  1TS4 A;  1HZB A;  1VCI A;  2PI2 E;  2LKV A;  3T1Y L;  3M9B A;  1JC7 A;  4FF4 A;  2Q8R E;  3JAM L;  1T9H A;  1NR4 A;  4X64 L;  1RTO A;  2E2I B;  2XNA C;  3I91 A;  3LGJ A;  2QDL A;  1KAW A;  4A3I G;  2FMM A;  1JJG A;  2I5M X;  2K50 A;  3PSI A;  1GKH A;  1A15 A;  1PH4 A;  2CCZ A;  1RDP D;  2EYM A;  3V2T A;  1L1O C;  1Q82 C;  2F0V A;  3CCR A;  1OXX K;  1TWC B;  4JYA L;  2F0M A;  4X3K A;  2EZV A;  3S24 A;  2XVS A;  1D1K A;  1IHZ A;  4C2M B;  1JWU D;  3GTM B;  3VA7 A;  4OO1 G;  1HTL D;  3R2T A;  3IFT A;  1TWG H;  1JJC B;  1KAA A;  5TSS A;  4A3G B;  2MNA A;  1JQY D;  1JOR A;  4BY7 B;  4WJ3 M;  3CP0 A;  2VUM H;  1FGB D;  2FXQ A;  4B3R L;  1LT5 D;  3CCS A;  4DV6 Q;  1PH7 A;  3I2Z A;  1JOK A;  4GKJ L;  4ALP A;  2E5L L;  5M3M G;  4A93 B;  1B50 A;  2PNR C;  1QVC A;  2EE1 A;  2RHQ B;  1CHP D;  3TP5 A;  3SK8 A;  1GO3 E;  1LYL A;  1TWH B;  1N36 Q;  3VYU A;  1PZI D;  5DNF A;  3I4M H;  3K6O A;  1YJ9 A;  2DJF C;  3K7U C;  2MO1 A;  4CDE C;  1ICW A;  2VZA A;  2EIF A;  3W1G A;  4C3J H;  4C56 C;  1WCM B;  1R9T H;  2VNU D;  1STE A;  2PQA B;  3TP6 A;  3D8G A;  3RZO B;  2R61 A;  3OPO A;  5C4H A;  1LTA D;  3RUZ A;  5I2X A;  3PF4 A;  3MXP A;  1VF5 C;  2K6A A;  3I8Z A;  2JA6 H;  2CWA A;  2OEO A;  1EFI D;  1AP0 A;  5J22 A;  3OOC A;  5IGD A;  2EPB A;  2JP1 A;  1SNQ A;  1TVX A;  3NWS A;  2A6E C;  4HN7 A;  3DXJ C;  3QR8 A;  3F2B A;  4IFD J;  4C2M H;  4RA8 A;  1A62 A;  3T16 A;  2K4K A;  1N36 L;  1STG A;  4IFD G;  1MI2 A;  2JSO A;  3SK5 A;  5D3I B;  1EY0 A;  1HR0 W;  4BY7 H;  3A74 A;  3G6E A;  2CQO A;  1F9R A;  4A93 H;  5NUC A;  3T1H L;  3KFU A;  1EQQ A;  1DOM A;  3RLO A;  5HUR A;  1E2Z A;  2PQA A;  1NR2 A;  3HOZ H;  4DAM A;  2AQ3 B;  4JI8 L;  1A2T A;  4AH6 A;  5EPL A;  3J80 E;  5COR A;  1UEB A;  1EQV A;  1EYA A;  5FKA C;  4K6D A;  1FGU A;  4V0B A;  1EYC A;  3TZU A;  3SEB A;  3I56 A;  2YV5 A;  4A3I B;  3QO2 A;  5CBE E;  5JVG 3;  1IKL A;  4JI1 L;  1SYG A;  3CRK C;  1A2U A;  4IAL A;  1PHJ A;  2A68 C;  4R8N A;  1T5X D;  1STN A;  3OWF A;  1BDO A;  1HUN A;  4X65 Q;  5CGK A;  4RG1 A;  3L2P A;  1B3A A;  2F0W A;  2B2T A;  1IKM A;  5ELD A;  1K0R A;  2ZJR A;  1R4Q B;  1D5X C;  4JPB W;  1KXL A;  4CJ0 B;  1K8A C;  1NSN S;  2K03 A;  3N6R A;  2MHV A;  3S15 B;  3CCM A;  3DEP A;  2BCO A;  2PPB C;  1TII D;  4BXX H;  1KDB A;  2B2V A;  1O7Y A;  3GTP H;  2OF1 A;  5M3M B;  4ABN A;  3OWE B;  1WFQ A;  2GA4 B;  3SVM A;  2VQF Q;  1C48 A;  1UE1 A;  2ZTE A;  3D6C A;  1UE5 A;  4BA1 I;  4DV4 Q;  4OO1 I;  4WFN 3;  2ES2 A;  5GAE C;  2ZTC A;  3NBI A;  3U9O A;  3UE0 A;  4NW2 A;  1E2W A;  4S3S A;  3A56 A;  2B2W C;  3GTJ B;  1YNJ D;  5F2D A;  2DY8 A;  2EY1 A;  2MQH A;  3PIO 3;  4JC0 A;  4JI0 Q;  1SDF A;  4K8I A;  4N8X 1;  4CKE A;  4A3C H;  3MXN B;  1GUT A;  2IL8 A;  3WOE A;  5ELC A;  3ERS X;  1ASZ A;  4A76 A;  5I6Y A;  1HHV A;  2AQ1 B;  4X65 L;  5K36 G;  2PMZ E;  3FEW X;  3UDF A;  2BH8 A;  2I5H A;  3KYH C;  2JJQ A;  4AIM A;  3DWQ A;  3DM3 A;  5LHY 1;  2EYJ A;  1AH9 A;  5JJZ A;  4DV7 Q;  5IIF A;  3MWY W;  1A3U A;  1EZ6 A;  5EAY A;  4NXM Q;  1LAB A;  4XQN A;  5ELO A;  5KND A;  2ASB A;  5IYC H;  3S2D B;  1U0L A;  1V1P B;  1E3P A;  2SNS A;  3L9A X;  5IP9 G;  3PUW A;  4MTK A;  1LTB D;  2WII B;  1B44 D;  4PZ8 A;  4DV4 L;  1A3V A;  4DA2 A;  1VQI A;  3PUZ A;  4EQP A;  2PCF B;  1LM0 A;  2CW0 C;  5ISR A;  4I7A A;  4ILW A;  1SNC A;  1DCZ A;  5M5Y H;  3S15 H;  4HCS A;  2B2V C;  1ILQ A;  1ZKO A;  1S5E D;  2B3G A;  5M3M H;  3ICE A;  3A7L A;  2K75 A;  3OYY A;  5EPJ A;  5KRU A;  1VQB A;  5C4J B;  3VR6 A;  4FYD A;  3MZ5 A;  4OL7 A;  1BCP C;  1Y8N B;  1ZEQ X;  4Y7N H;  1K3R A;  2F4I A;  4R4I A;  3P1H A;  3A8K E;  4IFD I;  3K8A A;  4OWW B;  4FO2 A;  3TP8 A;  1M90 C;  1Q8K A;  4UP7 A;  4PZ7 A;  1W3S A;  5LMN W;  2BA1 A;  1ZYR C;  1GXD C;  1EZ8 A;  2JEB I;  4J8Q A;  4XQQ A;  1G91 A;  4J6H A;  2K05 A;  5IE8 A;  4DV7 L;  2L55 A;  3M4Y A;  3BVG A;  4R4C A;  4NXM L;  1HNX L;  1Y1W G;  2YYZ A;  4DK0 A;  4TKO B;  5IT9 c;  4A3J G;  4A3L G;  3U9S A;  1EIG A;  3BU2 A;  1HXY D;  1ENC A;  2Q2I A;  1GOZ A;  3J81 i;  1WTR A;  3K7A B;  4B3M L;  1JCK B;  1QG7 A;  4IPD A;  5COY A;  1PMR A;  1PH8 A;  3AFP A;  1Y14 B;  4A3F H;  3AU7 A;  3NP8 A;  1PH9 A;  1Y1V H;  3CPW A;  5JJL A;  4GN3 B;  5C3W A;  3S2D H;  2N8N A;  1DJR D;  3RMH A;  3HOV H;  3R2I A;  1YIJ A;  1HTP A;  2ZXP A;  5HGQ A;  1SFO H;  3LNN A;  1VS0 A;  2DY7 A;  1O7L A;  1YHA A;  2PI2 A;  5IGB A;  3HGB A;  2HHH L;  1TWA H;  3CC2 A;  2UU9 L;  4A3K H;  4IO9 A;  3P7J A;  1B70 B;  1M4V A;  3CRL C;  3MEH A;  2MGS A;  1Q7Y C;  1EFW A;  4A3D G;  5IT9 E;  4LF6 L;  3I4N G;  5C4J H;  1EYG A;  3RZD B;  4JW0 A;  5BN3 A;  1BBU A;  4LFB Q;  1JMC A;  3MEF A;  1K83 B;  4MN3 A;  1QVF A;  2EY6 A;  3A8I E;  1K0S A;  5AFW A;  1CHQ D;  2IX0 A;  1U5K A;  2RDG A;  2PNH A;  4ID6 A;  3NHH A;  4P75 A;  4RKB A;  1S5C D;  1XNQ L;  3HOX G;  2HCC A;  2AWO A;  3E9H A;  3LWU A;  2LY7 A;  2UUC Q;  3E0E A;  1W2B A;  1LTR D;  4KY7 A;  3H3V C;  1JE4 A;  1X3Q A;  3QJY A;  1I6V C;  4WJW A;  3SGI A;  2YTX A;  1QB5 D;  2VS1 A;  1E24 A;  4BWG B;  3GV3 A;  3K7A H;  1K8O A;  1GUO A;  2F3V A;  2VB3 X;  2C5C A;  4DAY B;  2CVR A;  1CZW A;  1Z7T A;  4UHV A;  3JAM c;  5D14 A;  4RH6 A;  4L6T B;  5JEA H;  1FNV A;  3PIO A;  3T51 B;  2TMP A;  3CF5 A;  3BS1 A;  5M3F G;  2EYF A;  3OTO L;  2BOS A;  2F0G A;  1PFN A;  1QNU A;  4NB3 A;  3TEH B;  4LFB L;  1PLF A;  4GLA C;  2NVY B;  1XTC D;  4FDB A;  3OW2 A;  1XYI A;  1MJC A;  4MZ9 A;  1Y1W B;  2O4X A;  4DPG A;  1I3Q H;  2K52 A;  4A3J B;  4PG3 A;  3KF8 B;  5I2Y A;  4RHS A;  3RZD H;  4C3I H;  3D4R A;  2RDF A;  1SYC A;  3N52 A;  4DR6 Q;  5EKL A;  3ZJY C;  4P74 A;  2RKS A;  2R92 H;  4BBR H;  4DAY A;  4QL5 A;  4A3B G;  1IYU A;  2UXB Q;  3NEL A;  3UE1 A;  3JAM E;  2L5T A;  5BN5 A;  2YU9 B;  1JB7 A;  1VQ9 A;  4PV1 C;  5IP9 H;  5D3D A;  3H91 A;  3M85 A;  1I50 B;  5IY0 A;  3L7Z C;  1LTT D;  2IW3 A;  4JI5 Q;  2AUJ D;  1TS3 A;  2WAQ E;  2K33 A;  1KDA A;  2Q2H A;  3CAM A;  4IPG A;  3MXG A;  4UP8 A;  2A73 B;  2VB2 X;  1Q90 A;  4IJH A;  1Q86 C;  4OXP A;  5CR3 A;  4KKT A;  2VY3 A;  5EBC A;  1XPR A;  1ASY A;  4CDC C;  3KUP A;  1Q8I A;  1XTD A;  1BVS A;  4A3D B;  4GZY C;  3A8J E;  3ND8 A;  3I4N B;  1QCB D;  4L5Q A;  4GOP B;  2EXZ A;  1VF7 A;  2CFM A;  3KF8 A;  3KLR A;  2NYZ D;  5EKK A;  3J81 L;  5CYU A;  4FXK C;  2F0H A;  4LF7 Q;  4WOR A;  3NK9 A;  1SEB D;  2KEE A;  1KIX A;  4DR6 L;  1FD7 D;  1SJE D;  3A55 A;  5DAU A;  3J7A 5;  3HOX B;  1O7I A;  1JB3 A;  3LWE A;  5LMU L;  2F0L A;  2UXB L;  5ELF A;  4XYQ A;  4KI0 A;  3UDG A;  1U4P A;  3HOY H;  3OMC A;  1RIP A;  3WWV A;  1WYD A;  1MD2 D;  1BR9 A;  3K59 A;  1Z9F A;  3L0O A;  4DR3 Q;  3OMG A;  1STH A;  1TQO A;  2XIW A;  1I6H H;  2NUC A;  2TSS A;  1VQN A;  1G8Z D;  1YBY A;  3BZC A;  4ZYS A;  1VQF A;  3H94 A;  3CCE A;  2NTT A;  5M3F B;  1X32 A;  1YHQ A;  4DK3 C;  1X56 A;  1PTO H;  2HQE A;  1CZG A;  3Q22 A;  5C6A A;  4LF7 L;  1CSP A;  1GUN A;  1I94 L;  3TBI B;  2D0P A;  4LW1 A;  4FP5 D;  4X64 Q;  3NPP A;  1QZG A;  2C35 B;  2KCC A;  3K0Y A;  2WV6 D;  3RR5 A;  3GTG H;  4IUV A;  1IL2 A;  3KDF A;  1EY8 A;  4X3T A;  1V8Q A;  1FYC A;  2E8G A;  3HOW G;  4JYA Q;  3TSS A;  4BBS G;  4A4I A;  1DD2 A;  2MP1 A;  5E4W C;  1NMG A;  1YI2 A;  4A3B B;  1PH5 A;  1L0X B;  1KNA A;  4ZKB B;  3HOX H;  5C3E H;  4HJ9 A;  4DR3 L;  2NVT B;  3HP3 A;  1HUM A;  1STA A;  4YWK A;  1EOV A;  1SMY C;  1JT8 A;  4OHJ A;  1H9K A;  2NN6 I;  2RVL A;  3KJO A;  2ZM6 Q;  2E5L Q;  3T56 B;  4GKJ Q;  4L8J A;  2OWO A;  1A63 A;  4KY5 A;  1BNZ A;  1EY9 A;  4TQU S;  2XWB B;  2HDL A;  2EY2 A;  4KV6 A;  2F0U A;  5GAD C;  1K8G A;  4JI3 L;  2FHT A;  1DXM A;  1EQT A;  1VQ4 A;  2WB1 G;  3FMC A;  5BR8 L;  1OO9 B;  5CV6 A;  4DR5 Q;  1YZ6 A;  2JN4 A;  3GTL B;  1NJI C;  3CC4 A;  3SE0 A;  4GOP C;  2GVA A;  1TT2 A;  1LT4 D;  2F0T A;  4DNR B;  3CME A;  5M3F H;  4B9X A;  2ALY B;  2D2C C;  2R93 G;  1EEI D;  2H4O A;  1SNM A;  5ELB A;  2A8V A;  4QUC A;  3VR4 A;  3I4L A;  3VR5 A;  5I9O A;  2JXM B;  2WIN B;  1VQH A;  1X3G A;  5AJ3 L;  4X66 Q;  3MC0 B;  4G57 A;  1ET9 A;  4HMJ A;  4M8A A;  1KC8 C;  1CUK A;  2K5W A;  1E0B A;  2I46 A;  3SDZ A;  1U9R A;  4XXE A;  2NN6 H;  3NSW A;  1V9P A;  2XRS D;  3IAY A;  2A74 C;  3BZD B;  3D0F A;  3PV0 A;  2ZM6 L;  3M7N A;  1Z6H A;  2R7Z G;  3AB9 A;  2KHJ A;  3E9I A;  1PTO D;  1J9O A;  5A35 A;  5FLM G;  2D5D A;  4XT1 B;  4TRD A;  3H0G H;  1PRT F;  2EOT A;  2RDH A;  3S1R B;  4IQZ A;  3OIP A;  3U50 C;  4DAV A;  4DK1 A;  2BA0 A;  4EVO A;  4DR5 L;  1NMF A;  1D8L A;  3T1H Q;  1SMX A;  1VQ5 A;  1TWF B;  3D31 A;  4RGT A;  2B2U A;  2GVB A;  4ZCK A;  3GTQ B;  2FFK B;  2XSC A;  3S17 B;  4JI8 Q;  4GLX A;  2N3S A;  3J7A V;  4LAA A;  2HDM A;  3A0J A;  4JI1 Q;  4X66 L;  3GTL H;  3F2C A;  2E2I H;  1V1O A;  4RMF A;  3HOW B;  1LTI D;  3BYY B;  4R8I A;  5J3B A;  1QVG A;  2IT1 A;  2SNM A;  4BBS B;  3FDT A;  1NNX A;  4H7B A;  1TWC H;  1DM0 B;  4YWL A;  1UAP A;  1KNE A;  2A6H C;  3PO3 G;  3GTM H;  1PZK D;  2Z4I A;  5C44 G;  4X6A H;  3SK4 A;  1RTN A;  2KQ3 A;  4EQO A;  2ZXO A;  4IJL A;  4A3G H;  1MHW C;  1V1Q A;  1HH2 P;  4BY1 G;  5C4Z A;  2B8F A;  5H1S E;  2F0K A;  3S14 B;  1PVO A;  3H15 A;  3K80 C;  1VQ7 A;  1CFM A;  1Q81 C;  3J80 i;  4JI2 Q;  5HY6 A;  1BCP B;  5JVH 3;  2WB1 B;  3MHB A;  1R4P B;  1TWH H;  1SE4 A;  4H44 C;  2F0N A;  2Z6K A;  3I73 A;  4O0A A;  4OX9 Q;  5CV7 A;  1I4X A;  3DUZ A;  2WKC A;  2R7F A;  3MFY A;  4LFA L;  2R93 B;  2B2U C;  2ENB A;  3ER0 A;  4UDU C;  5FO9 B;  4MTN A;  1RHP A;  1F9Q A;  2PZW A;  1SE8 A;  3HKZ G;  3TN2 A;  1WCM H;  4RGO S;  5M5W B;  4OIK A;  4K0K L;  4MHE A;  2KA7 A;  2I5L X;  1VQD A;  1F2Y A;  4YCV A;  2A6E D;  2CKZ B;  1VQA A;  3G4S A;  3RZO H;  2N78 A;  3P75 A;  2OTJ A;  5E4X A;  5JPN C;  1GUS A;  1H9S A;  3LX0 A;  1Z47 A;  2A69 D;  3HOW H;  4JBK A;  4KJO A;  1XPU A;  2R7Z B;  2OXP A;  1GM5 A;  1A6X A;  2F0E A;  1TS2 A;  1I4G A; 
#chains in the Genus database with same CATH homology
 4Z9C B;  1S5F D;  1B1Z A;  3IFD A;  3MAQ A;  2ICI A;  2N55 A;  1TKW B;  5IOC A;  4RWS C;  3BDL A;  3W3A A;  1XWE A;  4ZQ3 A;  2A68 D;  4P2C B;  1EL0 A;  4DXG A;  1NAP A;  1PRT B;  2BE5 C;  3FPU B;  3GO5 A;  5JPM C;  4NMZ A;  1SSO A;  3Q0A A;  5EJW A;  1BOS A;  4HSV A;  2NVX B;  4C3H G;  4IUR A;  4KY6 A;  4JK1 C;  4FVM A;  5CBA E;  4V19 0;  2VXW A;  2K7V A;  4KKU A;  4K5X A;  4HAE A;  4QCL A;  4ODG A;  2B2T C;  2V4D A;  4CJ2 C;  4I7Z C;  2ZXR A;  3PO3 B;  4PQX A;  4OO1 H;  2XRQ D;  5C44 B;  3MXU A;  4DFA A;  2M2L A;  2L1B A;  4H13 C;  2L4N A;  2RSN A;  2Z8L A;  3T13 A;  3AMU A;  1HRJ A;  4MIU A;  4BY1 B;  2NBF A;  4B08 A;  4CJ1 B;  5D65 A;  4QIW B;  5CMD A;  1U4M A;  1SYD A;  3HG9 A;  4B9W A;  1LO5 D;  3RLF A;  4ULL A;  5EKI A;  4DU9 A;  2B2Y A;  2Q8I B;  2Z1C A;  3HKZ B;  1KLG D;  5KYL A;  2EVB A;  4K8J A;  3I72 A;  3MTS A;  1LAC A;  2ZT9 C;  2PZU A;  5CC4 A;  4E6I A;  1WTV A;  3BDO A;  1GHK A;  1LTS D;  1TY0 A;  4DAP A;  4NKL A;  2CW0 D;  1CQV A;  1QWY A;  3K57 A;  4G7Z C;  1CK1 A;  3PUY A;  1Q1B A;  3J80 L;  5LL6 S;  5CV9 A;  3GTK B;  4NP5 A;  3J81 E;  4IFD H;  4A3M B;  4RGM A;  4CBV A;  1G2S A;  4Q0F A;  1YNN C;  3M3Y B;  2KED A;  3I3C A;  1ZYR D;  1C8C A;  3OSO A;  1UEA B;  1WTP A;  4RKL A;  1F2M A;  5C4X B;  2F0P A;  1PRT C;  5CV8 A;  2EJF C;  3QIA A;  2Q8T A;  1V43 A;  2XWJ B;  2I07 B;  1AZQ A;  4C1N I;  1I4H A;  5KYI A;  1AEX A;  2K1B A;  4C3H B;  2M00 A;  1O7Z A;  1HA5 A;  1IW7 C;  2L0C A;  3S1N B;  2E2J B;  3C1E A;  3BVM A;  5DEH A;  3ZYY X;  1HQR D;  2E74 C;  3S9W A;  1B53 A;  3PO2 B;  2B63 B;  3MFG A;  5LL6 X;  3RD4 A;  1STY A;  3C46 A;  3S2H B;  3VYR A;  1WTX A;  2KOL A;  4F88 A;  2EJM A;  4ZUI A;  3BYT B;  5C0X J;  3GP7 A;  2F1M A;  1VDZ A;  2K04 A;  3NTK A;  3HEJ A;  5C0X G;  1K8M A;  3NQT A;  2KJX A;  1KDC A;  2IWH A;  1TR5 A;  4IN3 A;  3EQL C;  1F2Z A;  4EGV A;  1ENA A;  5EBD A;  3S1M B;  1ONL A;  3V96 A;  1JOO A;  5K36 H;  5DM6 3;  3P20 A;  1RD9 D;  2ID0 A;  3J7A F;  2F0J A;  2NTS A;  1G29 1;  3HOU B;  2PQE A;  2L11 A;  4DXF A;  2E2H B;  1J8I A;  1SNO A;  4KHZ A;  4IUU A;  4BA2 I;  3SR1 A;  5I9P A;  2JA7 B;  3GQB A;  3EVQ A;  3S16 B;  4OIJ A;  3FPP A;  3PMF A;  1GJX A;  4C3J G;  4A3E B;  2PO4 A;  1VMP A;  3S1Q B;  4CKC A;  1BXT A;  5T1G A;  4FF2 A;  3SHL A;  4DF7 A;  4KD3 A;  1EWC A;  3X3N A;  1Y8O B;  1QOH A;  2HCI A;  3QB3 A;  4KKS A;  4DGZ A;  1CA6 A;  4LK1 C;  3C2P A;  4FXG C;  1ESR A;  1W6K A;  2CHB D;  2RQX A;  3I70 A;  2F0I A;  5FO7 B;  2JA5 B;  3QWN A;  4M1U B;  2WKD A;  4R9W A;  4IUT A;  3CQZ B;  1SE2 A;  4K5W A;  1AFP A;  2JEA I;  4EQN A;  1SND A;  3Q23 A;  1D2B A;  2EYL A;  1AW7 A;  5C0X I;  1PZJ D;  3A54 A;  2EYP A;  2F0S A;  4J1M A;  2DNE A;  1CA5 A;  4KK7 A;  3F2U A;  1LTG D;  1BQQ T;  3NUC A;  5IGC A;  1JIC A;  4QF4 A;  2FJ2 A;  1TWG B;  3NBH A;  1H9J A;  2Y0S B;  4RAU C;  3DWA A;  5IGG A;  3R93 A;  5IOD A;  1EYD A;  2VUM B;  2JA8 B;  3CHB D;  2EY5 A;  4ZLT F;  4U68 A;  5KIX A;  4G7H C;  3I4M B;  1DON A;  2WAC A;  5IGF A;  4CKB A;  3TP7 A;  3PUV A;  3NTH A;  3OIQ A;  2A5H A;  4K2L A;  5FO8 B;  4C3J B;  1IL8 A;  1TY2 A;  3OHX C;  4PMW A;  1SBB B;  2PZT A;  4HED A;  1XXG A;  3KK7 A;  2OT2 A;  2SEB D;  5K5P A;  5EPK A;  1Y8P B;  2SDF A;  4L63 B;  2JA6 B;  2PW7 A;  1SMY D;  1SE3 A;  1RJT A;  1WTQ A;  1II3 A;  3D4D A;  4F8M A;  4O1N A;  3PIP 3;  3TDQ A;  1D5Z C;  2IJ0 A;  3M7G A;  5C5L A;  3HRZ C;  3DM1 A;  5C5M A;  2B39 A;  5J39 A;  5A2Q L;  4FF3 A;  1M8A A;  5HGT A;  1JR0 D;  4G7O C;  3SK6 A;  2H1E A;  3WDN A;  5JAV A;  3IKJ A;  3QG1 A;  3HOZ B;  3R8B A;  2K28 A;  1DOL A;  3M4O B;  1HFG A;  1SYF A;  2F03 A;  1OXV A;  3DWP A;  2HUG A;  1I4R A;  2K01 A;  3W2D A;  4XQJ A;  2QDB A;  5KNC A;  4RCN A;  2F0D A;  3KLS A;  1U4L A;  3KBG A;  4KJN A;  2KVM A;  1W6J A;  1MSH A;  1S4Z A;  1EWH A;  1LT3 D;  1QIL A;  2EYH A;  3C1F A;  4F7X A;  3GTP B;  1H9S B;  1PDQ A;  1NCV A;  3QOJ A;  4Q5V A;  1Q3L A;  2J0T D;  2FMC A;  5T1I A;  1U4R A;  2B8G A;  2E76 C;  2G9D A;  2EJG C;  1JWM D;  1QE6 A;  1PXU A;  4HCE A;  2WAQ B;  4H0L C;  1MBY A;  4FNF A;  2B2W A;  2A69 C;  2PYK A;  1GUG A;  2DNC A;  4IUP A;  2KHS A;  2NB0 A;  2QCP X;  1B2T A;  4HMI A;  1YNJ C;  5I4D A;  2E2D C;  2M9V A;  5I6W A;  2A6H D;  3KLS X;  3UI2 A;  2R3Z A;  5BN4 A;  3D3R A;  2ICE C;  1ENF A;  3K5L A;  1Q1E A;  2K5Q A;  2BDN A;  3I90 A;  5IGE A;  5FLX L;  2KUM A;  1NUC A;  2AQ2 B;  4HR7 B;  2MPM A;  4PMB A;  1D6E C;  5M5Y B;  1B9N A;  4RCO A;  3Q24 A;  4DN4 M;  5M9O A;  4KN7 C;  3KBX A;  1LT6 D;  2K5D A;  4FF1 A;  2KCN A;  5JEA J;  2NZ1 D;  1CM9 A;  1SXT A;  4K2K A;  1WTO A;  1E2V A;  3K58 A;  3K5M A;  2O2L D;  4Y7N B;  4U67 3;  5JEA G;  1F77 A;  3H09 A;  2X69 A;  4N9P A;  2F0O A;  3VYT A;  1CQF A;  1XX8 A;  1OXU A;  3NQI A;  3D4W A;  1BUV T;  4IZ8 A;  4ZRZ A;  1ML0 D;  1MGS A;  2NWG A;  1F9S A;  4I65 A;  2QEJ C;  3GD7 A;  2PW5 A;  4C3I G;  4QMG A;  1CI3 M;  1CTM A;  3O13 A;  1PFM A;  4BS9 A;  4XTC S;  4A3F B;  1KAB A;  3FKI B;  1F9P A;  1Y1V B;  1HA6 A;  4RFB A;  1JOQ A;  4DNT B;  3BDC A;  2JE6 I;  1I4Q A;  4XIG S;  3HOV B;  1SFO B;  2BE5 D;  2LMC B;  2N88 A;  3G6J B;  3EA6 A;  5KNB A;  1O78 A;  1TWA B;  4KMU C;  3CKI B;  3BG3 A;  4A3K B;  4FXD A;  1L0Y B;  3MXN A;  3OW7 A;  1S5B D;  2Z4H A;  1ILP A;  2X6L A;  2K32 A;  3NXW A;  1UNS A;  2FIN B;  1DYQ A;  1LLR D;  2RSO A;  4ME5 A;  3FVQ A;  3GTO B;  3V05 A;  4JBW A;  5G3L D;  1KLU D;  1SYB A;  2MJ8 A;  1Q12 A;  3D6W A;  2QKI C;  1D5M C;  1MSG A;  1ET6 A;  1G6Z A;  1EY4 A;  1V1P A;  2AUK A;  1SYE A;  2QIL A;  4LJZ C;  1BF4 A;  2SOB A;  2AWN A;  1QNK A;  1SNP A;  3EFX D;  1BCP D;  2LFN A;  1PTO F;  4G4K A;  3Q6S A;  3PUX A;  5M5X B;  2IX3 A;  3VYS A;  2L12 A;  2J4X A;  2D62 A;  5FOB B;  5CV4 A;  1EEF D;  1SJH D;  3L3O C;  3URY A;  3VR3 A;  4N9T A;  1CT1 D;  1PYW D;  4IUN A;  2B2Y C;  2C9O A;  2RBM A;  1T5E A;  3G7L A;  1I3Q B;  3BVZ A;  1GUW A;  3FRP B;  3TZD A;  4C3I B;  5EQ0 A;  1B4O A;  1H9M A;  2LS0 1;  4PNY A;  1OXS C;  1TU2 B;  2R6G A;  2R92 B;  4BBR B;  1C4Q A;  3E6Z X;  3ERO A;  1EIH A;  1YNN D;  5E3F A;  3MA2 B;  2D9U A;  1BBX C;  3A7A B;  5E1F A;  1PRT D;  4RGN A;  5EGT A;  2J7Z A;  1STB A;  5DM7 3;  1PFB A;  4WRD A;  4KTA A;  1ESF A;  4XT3 B;  3QOL A;  4KHV A;  4K6L A;  3ITP A;  1IW7 D;  1O80 A;  3T4A C;  2KEC A;  1SAP A;  4KD4 A;  4QUF A;  1EU4 A;  1B9M A;  2QF7 A;  1LV9 A;  2CQA A;  4K14 A;  3VR2 A;  1EY5 A;  1UUP A;  1QJO A;  3HZX A;  1EY7 A;  1FR3 A;  1BO0 A;  1RF2 D;  4O42 A;  3J7Y W;  3ND9 A;  4ZK9 B;  1H9R A;  1Y69 U;  3HOY B;  2NN6 G;  2F3W A;  2F0F A;  1I4P A;  2X6G A;  4TSS A;  1I6H B;  3E0J A;  3HS0 C;  2L9H A;  3X3M A;  1EOT A;  5C3X A;  1PTO B;  4HTH A;  2G9H D;  1F2L A;  4YIJ A;  5ELE A;  1RKN A;  2PMZ B;  1WVL A;  5JOB A;  3IL8 A;  4LMQ D;  3GTG B;  4XYO A;  2RA4 A;  3T53 B;  1WD0 A;  1OXT A;  5A2Q E;  2MUY A;  1DZ1 A;  3NTI A;  4AYB B;  3E5S A;  3H6M A;  1HQM C;  3DEO A;  3K5O A;  2DN8 A;  5KGU A;  4CHT B;  3TME A;  5C3E B;  1IYV A;  3EJI A;  3CU7 A;  5J1Z A;  5IT9 L;  1WTW A;  1JWS D;  2NVQ B;  3DMU A;  5KEE A;  2IX1 A;  3DHQ A;  4UAI A;  1GHJ A;  1ZXT A;  4ZUJ A;  1EY6 A;  4OGQ C;  2WP8 J;  1KTK A;  4ZKC B;  5CV5 A;  1ROD A;  1A3T A;  4CGY B;  2BDO A;  1HCZ A;  4NDX A;  2IPK D;  1S5D D;  2E75 C;  4HSP A;  3VA5 A;  4PMC A;  4KN4 C;  3C3L A;  3K5N A;  1DOK A;  3NWT A;  3MVV A;  1FNU A;  2O5J C;  2EYO A;  1EU3 A;  2EDG A;  1WD1 A;  3WOF A;  4XDX A;  1HFN A;  4IUQ A;  1VMC A;  1FNW A;  5FK9 C;  5G3L F;  4ZAI A;  2JYO A;  2O5I C;  1D1I A;  4K5V A;  1AN8 A;  3H0G B;  4RHR A;  1HPC A;  1AZP A;  4X3U A;  4C1N K;  4X3S A;  1G2T A;  3R3O A;  1BCP F;  1RCV D;  5C0X H;  4QB4 A;  2XN9 C;  4F87 A;  3SXH A;  1X3P A;  1PTO C;  3ERQ A;  2F0Q A;  1R9T B;  3NE5 B;  5FLX E;  3ONA B;  1TS5 A;  3GV6 A;  1TS4 A;  1VCI A;  2LKV A;  1JC7 A;  4FF4 A;  2Q8R E;  3JAM L;  1NR4 A;  1RTO A;  2E2I B;  2XNA C;  3I91 A;  2FMM A;  1A15 A;  1RDP D;  2EYM A;  3V2T A;  2F0V A;  1OXX K;  1TWC B;  2F0M A;  4X3K A;  2EZV A;  2XVS A;  1D1K A;  1IHZ A;  4C2M B;  1JWU D;  3GTM B;  3VA7 A;  4OO1 G;  1HTL D;  3R2T A;  3IFT A;  1KAA A;  5TSS A;  4A3G B;  1JQY D;  1JOR A;  4BY7 B;  1FGB D;  1LT5 D;  1B50 A;  1JOK A;  4A93 B;  2PNR C;  2EE1 A;  1CHP D;  3TP5 A;  3SK8 A;  1TWH B;  3VYU A;  1PZI D;  5DNF A;  3K6O A;  1ICW A;  4C56 C;  1WCM B;  2VNU D;  1STE A;  3TP6 A;  3D8G A;  3RZO B;  2R61 A;  3OPO A;  5C4H A;  1LTA D;  3RUZ A;  5I2X A;  3MXP A;  1VF5 C;  2K6A A;  3I8Z A;  2OEO A;  1EFI D;  1AP0 A;  5J22 A;  3OOC A;  5IGD A;  2EPB A;  2JP1 A;  1SNQ A;  1TVX A;  3NWS A;  2A6E C;  4HN7 A;  3DXJ C;  4IFD J;  4RA8 A;  3T16 A;  4IFD G;  1STG A;  1MI2 A;  2JSO A;  3SK5 A;  5D3I B;  1EY0 A;  1F9R A;  5NUC A;  1DOM A;  5HUR A;  1E2Z A;  1NR2 A;  2AQ3 B;  1A2T A;  5EPL A;  3J80 E;  5COR A;  1EQV A;  1EYA A;  5FKA C;  4K6D A;  4V0B A;  1EYC A;  3TZU A;  3SEB A;  4A3I B;  3QO2 A;  5CBE E;  5JVG 3;  1IKL A;  1SYG A;  3CRK C;  1A2U A;  4IAL A;  2A68 C;  4R8N A;  1T5X D;  1STN A;  3OWF A;  1BDO A;  1HUN A;  5CGK A;  1B3A A;  2F0W A;  2B2T A;  1IKM A;  5ELD A;  1R4Q B;  1D5X C;  4CJ0 B;  1NSN S;  2K03 A;  3N6R A;  2MHV A;  3S15 B;  2BCO A;  3DEP A;  2PPB C;  1TII D;  1KDB A;  2B2V A;  1O7Y A;  2OF1 A;  5M3M B;  4ABN A;  3OWE B;  2GA4 B;  3SVM A;  1C48 A;  3D6C A;  4BA1 I;  4OO1 I;  4WFN 3;  3NBI A;  3U9O A;  4NW2 A;  1E2W A;  4S3S A;  3A56 A;  2B2W C;  3GTJ B;  1YNJ D;  5F2D A;  2DY8 A;  2EY1 A;  3PIO 3;  1SDF A;  4K8I A;  4CKE A;  1GUT A;  2IL8 A;  3WOE A;  5ELC A;  5I6Y A;  1HHV A;  2AQ1 B;  5K36 G;  3FEW X;  3DWQ A;  5LHY 1;  2EYJ A;  5JJZ A;  5IIF A;  3MWY W;  1A3U A;  1EZ6 A;  1LAB A;  4XQN A;  5KND A;  3S2D B;  1V1P B;  3L9A X;  2SNS A;  3PUW A;  1LTB D;  2WII B;  1B44 D;  1A3V A;  4DA2 A;  3PUZ A;  5ISR A;  4EQP A;  2PCF B;  2CW0 C;  4ILW A;  1SNC A;  1DCZ A;  4HCS A;  2B2V C;  1ILQ A;  1ZKO A;  1S5E D;  3A7L A;  5EPJ A;  5KRU A;  5C4J B;  3VR6 A;  4FYD A;  3MZ5 A;  4OL7 A;  1BCP C;  1Y8N B;  1ZEQ X;  2F4I A;  3P1H A;  3A8K E;  4IFD I;  4FO2 A;  3TP8 A;  2BA1 A;  1ZYR C;  1GXD C;  1EZ8 A;  2JEB I;  4J8Q A;  4XQQ A;  1G91 A;  4J6H A;  2K05 A;  2L55 A;  3M4Y A;  3BVG A;  2YYZ A;  4DK0 A;  4TKO B;  3U9S A;  1EIG A;  1HXY D;  1ENC A;  1GOZ A;  1WTR A;  3K7A B;  1JCK B;  1QG7 A;  5COY A;  1PMR A;  3AU7 A;  3NP8 A;  5C3W A;  1DJR D;  3RMH A;  3R2I A;  1HTP A;  2ZXP A;  3LNN A;  2DY7 A;  1O7L A;  5IGB A;  3HGB A;  3P7J A;  3CRL C;  1M4V A;  3MEH A;  2MGS A;  5IT9 E;  3RZD B;  5BN3 A;  1K83 B;  4MN3 A;  2EY6 A;  3A8I E;  5AFW A;  1CHQ D;  2IX0 A;  2RDG A;  4ID6 A;  3NHH A;  4RKB A;  1S5C D;  2HCC A;  2AWO A;  3LWU A;  2LY7 A;  1LTR D;  4KY7 A;  3H3V C;  1JE4 A;  1X3Q A;  3QJY A;  1I6V C;  4WJW A;  1QB5 D;  4BWG B;  3GV3 A;  1K8O A;  1GUO A;  2F3V A;  2VB3 X;  2C5C A;  2CVR A;  1CZW A;  1Z7T A;  5D14 A;  4RH6 A;  4L6T B;  5JEA H;  1FNV A;  3T51 B;  2TMP A;  3BS1 A;  2EYF A;  2BOS A;  2F0G A;  1PFN A;  1QNU A;  1PLF A;  2NVY B;  1XTC D;  1XYI A;  1Y1W B;  2O4X A;  4A3J B;  5I2Y A;  4RHS A;  3D4R A;  2RDF A;  1SYC A;  3N52 A;  5EKL A;  2RKS A;  4DAY A;  1IYU A;  3JAM E;  2L5T A;  5BN5 A;  2YU9 B;  4PV1 C;  5D3D A;  3H91 A;  3M85 A;  1I50 B;  3L7Z C;  1LTT D;  2IW3 A;  2AUJ D;  1TS3 A;  2K33 A;  1KDA A;  3MXG A;  2A73 B;  2VB2 X;  1Q90 A;  5CR3 A;  4KKT A;  5EBC A;  3KUP A;  1Q8I A;  4A3D B;  4GZY C;  3A8J E;  3ND8 A;  3I4N B;  1QCB D;  2EXZ A;  1VF7 A;  3KF8 A;  3KLR A;  2NYZ D;  5EKK A;  3J81 L;  5CYU A;  4FXK C;  2F0H A;  4WOR A;  3NK9 A;  1SEB D;  2KEE A;  1FD7 D;  1SJE D;  3A55 A;  5DAU A;  3HOX B;  1JB3 A;  3LWE A;  2F0L A;  5ELF A;  4XYQ A;  4KI0 A;  1U4P A;  3OMC A;  1MD2 D;  1BR9 A;  3K59 A;  3OMG A;  1STH A;  1TQO A;  2XIW A;  2NUC A;  2TSS A;  1G8Z D;  4ZYS A;  3H94 A;  2NTT A;  5M3F B;  1X32 A;  1PTO H;  2HQE A;  1CZG A;  3Q22 A;  5C6A A;  1GUN A;  3TBI B;  4FP5 D;  3NPP A;  2KCC A;  3K0Y A;  2WV6 D;  4IUV A;  1EY8 A;  4X3T A;  1V8Q A;  1FYC A;  3TSS A;  1DD2 A;  2MP1 A;  5E4W C;  4A3B B;  1L0X B;  1KNA A;  4ZKB B;  2NVT B;  3HP3 A;  1HUM A;  1STA A;  1SMY C;  4OHJ A;  1H9K A;  2NN6 I;  2RVL A;  3T56 B;  4L8J A;  4KY5 A;  1BNZ A;  1EY9 A;  4TQU S;  2XWB B;  2HDL A;  2EY2 A;  4KV6 A;  2F0U A;  2FHT A;  1DXM A;  1EQT A;  3FMC A;  1OO9 B;  5CV6 A;  3GTL B;  3SE0 A;  1TT2 A;  1LT4 D;  2F0T A;  4DNR B;  4B9X A;  2D2C C;  1EEI D;  2H4O A;  1SNM A;  5ELB A;  4QUC A;  3VR4 A;  3I4L A;  3VR5 A;  5I9O A;  2JXM B;  2WIN B;  3MC0 B;  4G57 A;  1ET9 A;  4HMJ A;  4M8A A;  2K5W A;  1E0B A;  2I46 A;  3SDZ A;  1U9R A;  4XXE A;  2NN6 H;  3NSW A;  2XRS D;  3IAY A;  2A74 C;  3BZD B;  3PV0 A;  3M7N A;  1Z6H A;  3AB9 A;  1PTO D;  1J9O A;  5A35 A;  2D5D A;  4XT1 B;  4TRD A;  1PRT F;  2EOT A;  2RDH A;  3S1R B;  4IQZ A;  3OIP A;  4DAV A;  4DK1 A;  2BA0 A;  4EVO A;  1TWF B;  3D31 A;  4RGT A;  2B2U A;  3GTQ B;  2FFK B;  2XSC A;  3S17 B;  3J7A V;  4LAA A;  2HDM A;  1V1O A;  3HOW B;  1LTI D;  3BYY B;  4R8I A;  2IT1 A;  2SNM A;  4BBS B;  3FDT A;  4H7B A;  1DM0 B;  1UAP A;  1KNE A;  2A6H C;  1PZK D;  2Z4I A;  3SK4 A;  1RTN A;  2KQ3 A;  4EQO A;  2ZXO A;  5C4Z A;  2B8F A;  2F0K A;  3S14 B;  1CFM A;  5JVH 3;  1BCP B;  2WB1 B;  3MHB A;  1R4P B;  1SE4 A;  4H44 C;  2F0N A;  3I73 A;  5CV7 A;  1I4X A;  3DUZ A;  2WKC A;  3MFY A;  2R93 B;  2B2U C;  5FO9 B;  2ENB A;  4UDU C;  1RHP A;  1F9Q A;  2PZW A;  3TN2 A;  4RGO S;  5M5W B;  4OIK A;  4MHE A;  2KA7 A;  1F2Y A;  2A6E D;  3P75 A;  5E4X A;  5JPN C;  1GUS A;  1H9S A;  3LX0 A;  1Z47 A;  2A69 D;  4KJO A;  2R7Z B;  2OXP A;  1A6X A;  2F0E A;  1TS2 A;  1I4G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...