1C4QA

Mutated shiga-like toxin b subunit (f30a/w34a) complexed with receptor gb3 analogue
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
69
structure length
69
Chain Sequence
TPDCVTGKVEYTKYNDDDTFTVKVGDKELATNRANLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (SHIGA-LIKE TOXIN I SUBUNIT B)
publication title Identification of the Primary Receptor Binding Site of Shiga-Like Toxin B Subunits: Structures of Mutated Shiga-Like Toxin I B-Pentamer with and without Bound Carbohydrate
rcsb
source organism Escherichia coli
molecule tags Toxin
total genus 16
structure length 69
sequence length 69
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 1999-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1c4qA00
1D1KA 1R4PB 1QNUA 4ULLA 2C5CA 1C48A 1QOHA 1DM0B 1BOSA 4M1UB 2XSCA 1R4QB 2BOSA 1D1IA 1CZWA 2GA4B 3MXGA 1C4QA 4P2CB 1CZGA 1CQFA
chains in the Genus database with same CATH superfamily
3X3MA 5CV9A 2H5XA 4IUVA 2XGTA 2EPBA 4F8MA 1ET6A 1LACA 1G291 4JI3L 4IFDG 2RSOA 1SNOA 4LUOA 4CBVA 1K8AC 3CC2A 1XNQQ 4OELB 2K05A 3J7A5 3N52A 1UUPA 5BR8Q 1RHPA 4WFN3 3TSSA 5I6WA 1F2MA 1EIFA 4JI1Q 2QCPX 5M5YH 1NMGA 2IL8A 3A0JA 4WJWA 4BA2I 4NXML 3KFUA 4KHPQ 1I3QH 4DN4M 2Q8IB 3S2DH 1VCIA 4KD4A 4JYAL 2D2CC 1D5XC 1I4QA 1XTCD 3M4YA 5EBCA 3GTGH 4IJHA 5BN5A 1YEZA 2F0HA 2VQFL 4JI8Q 2F0UA 3UDGA 5M3FB 3OWFA 4C3IB 5COYA 1SDFA 3DWAA 4KMUC 3HGBA 2E5LQ 4LF6Q 3SGIA 4Q0FA 2OTLA 1ONLA 2WV6D 3K5OA 3KLSX 2K01A 1IW7D 3STBC 1LLRD 3KF8B 2E74C 3NWTA 4LF4Q 1Y8NB 1DYQA 4HIKA 4LNQA 1D1KA 1P8LA 3A56A 4A3KB 2PQAB 3PF4A 4JV5Q 5IT9c 4KY7A 5KNBA 1YNND 4GLVB 1DCZA 4A3LG 1GD7A 1JR0D 2NVQB 4G7ZC 4DR4Q 2R93H 2KHIA 1LABA 1RKNA 2EYFA 2A74C 2JA8H 2FINB 4ZUJA 1XNQL 3PO2H 4G57A 4A3MG 4NMZA 4K0KL 1C7YA 4FF4A 1CFMA 4JI1L 2F52A 1Y8OB 1SBBB 2YTXA 4QIWE 1TT2A 4QCLA 4KHPL 4P73A 4XT3B 2A19A 1RL2A 2I5LX 2CQOA 3J81E 4YIJA 4JI8L 3A8JE 2K33A 2KUMA 4DV4Q 1STAA 1CHQD 2K75A 3J80i 4LF9Q 1MBYA 3BVZA 4L5SA 2E5LL 4LF6L 1JOQA 1KDCA 2LY7A 1VQJA 1BBUA 2R61A 4O2DA 4RH6A 1Z9FA 3I4LA 4N8FA 4DR5Q 5LL6S 2UUBQ 1TIID 1ILQA 1OTCA 4DNTB 1B3QA 2Y0SE 1BQQT 4C3HB 3NP8A 4ILWA 4F7XA 3NTKA 3D6WA 4LF8Q 3BZDB 4Z9CB 1FJGQ 3PUZA 1SFOH 3KF6A 2RDGA 2HCCA 3L3OC 3S1QB 4DR6L 3R3OA 2QGQA 3OWEB 1T9HA 1TS3A 2G9DA 4FP5D 5JEAG 3OOCA 1QZHA 3HOYB 1FD7D 4B9WA 1JWUD 2PZUA 2WACA 4EQNA 5GROA 1SNPA 4GLAC 4X64Q 1TWFB 3CCQA 2R6GA 2XNAC 1B9NA 2H1EA 3M4PA 2RF4A 3LWEA 1LT5D 3K81C 1EIGA 4N9TA 3S15B 1SROA 1FNVA 4XQQA 1LUZA 2AWOA 4OO1I 1BO0A 4DK1A 4DV4L 1VQCA 2JA9A 3ULLA 3H0GB 4LF9L 3W5OA 4HCEA 4FF2A 5M5XB 4X3TA 3T1HQ 4DR5L 1ZYRC 2B2UA 2KECA 1J8IA 3PUWA 1SNMA 5J39A 4OIJA 2NVXH 4LF8L 2EIFA 4C2MB 3S1MB 1F9PA 1S72A 1KAAA 4K8JA 3S14H 4K5VA 4JW0A 2F1MA 3QOJA 1Q86C 2F0NA 4YWMA 2A73B 5C4JH 3CHBD 5D14A 1HFGA 2HQEA 3OTOL 2MO0A 2LMCB 1KLGD 3UDIA 3PSIA 4X64L 1CTMA 3FKIG 1LO5D 4DA2A 1B4OA 4A3EH 3EBEA 2VL6A 2JA7B 4U673 4HJAA 1FGBD 1Y1WB 1KIXA 4PMWA 3GTKB 2F0LA 1SYGA 3KK7A 1UAPA 1BBWA 1CA6A 2K5WA 1VQNA 2MHVA 2EYJA 4BBRB 1IBLQ 1KL9A 3T1HL 2D0PA 1I4XA 3TMEA 5IWAQ 1N33Q 4TQUS 2F3IA 5G3LF 5CMDA 2WIIB 1I94Q 1B50A 1HA6A 1QILA 2E76C 3WDNA 4H7BA 5EBDA 2L0CA 2JYOA 1N32Q 2OTJA 2SOBA 1Z7TA 4ZK9B 1DONA 1H9KA 4OHJA 4O0AA 1O7IA 5C4XB 3FEWX 1Q8IA 2HIXA 2O4XA 4JC0A 3IKJA 1H9SA 3HOWG 5CYUA 1E2ZA 1Y69U 2FMCA 2DUDA 4GZYC 1TVXA 5KYLA 5C0XI 4DV3Q 4IOAA 4FVMA 1K8MA 4C3JG 4IURA 4DUYL 4CHTB 2IHEA 5CV4A 4BBSB 3O13A 3RNUA 1S5ED 2N88A 3F2UA 3A8IE 3LX0A 2KHSA 4ZRZA 3KUPA 3I4MG 3KJPA 3I4NG 4FNFA 1B3AA 2D5DA 1EY7A 3S1RH 3S17H 3RUZA 4UDUC 3BG3A 1TWCH 2XRQD 3I91A 2WKCA 3PO3G 3PIPA 3P7JA 1E3PA 3KLSA 5J3BA 2XVSA 3CKIB 1RODA 2MO1A 2KBNA 1N33L 1QE6A 4IFDJ 1X9NA 1KNEA 2AUKA 1F9QA 2R92H 1W2BA 4JG2A 4DPGA 2RHSB 3J80E 2Q8RE 1N32L 1X3QA 4H0LC 3DHQA 3I55A 3FDTA 2L4NA 3VYSA 4PMCA 2A69D 1O7ZA 4Y7NH 3T4AC 4XYQA 3BVGA 2KEDA 3I2ZA 3K6OA 2E75C 3NTHA 3GTMH 3HOXB 1CKMA 2JA8G 1V1PA 2WB1B 4RHRA 4B3SQ 2B63H 3EFXD 4OX9Q 1MHWC 5JJIA 3Q0AA 3NBIA 1QVFA 2IY5B 1AN8A 2KQ3A 3GTOB 4B08A 2OWOA 5I9OA 4LK1C 1ICFB 1G6PA 1HFNA 5J1ZA 4A3GH 1QOHA 2CVRA 3HP3A 1QNKA 4H44C 1ICWA 1VQHA 2P5ZX 1EYAA 1EY8A 1SAPA 1E24A 1HPCA 1YJWA 3Q24A 3D31A 3MFGA 2B2VA 4J8QA 4X65Q 1J6QA 4A3DB 3GP7A 3I73A 2RDFA 4CKBA 2QKIC 4KHZA 4ME3A 1MSHA 3QJYA 1LTLA 3F2DA 4IUPA 1JWSD 1YZ6A 3R8BA 2JN4A 1Y8PB 3OMCA 3E9IA 2B2YA 2BCOA 1R4QB 1I4HA 3E9HA 4QMGA 4K5WA 4AQYQ 3K5MA 2F4IA 4PNYA 3RMHA 1MKHA 5LMNL 3S16B 4CJ2C 4JBJA 1NMFA 2NTSA 2EYHA 1P16A 2XWBB 1AFPA 2I5MX 3BDCA 4DR1Q 2TMPA 1EU3A 1A3TA 1WOCA 3GQBA 3CP0A 2XIWA 1HNZQ 1NTGA 1KDAA 1Q8KA 1DD2A 3NK9A 2OF1A 1A62A 4M1UB 1VQ7A 3HOZH 5HGQA 1IW7C 1O78A 2ZJRA 2O5JC 3AU7A 3D4WA 2NVYB 3NQIA 1CUKA 1EYDA 1PH9A 1KLUD 4A3FG 4BXXH 3PF5A 1STNA 2NVTB 2A6HD 2Z1CA 1YNNC 3HOVG 1D5ZC 2AMCB 4NDXA 4FF1A 2F0EA 2BA1A 2R3ZA 4G4KA 2FJ2A 4B3RQ 1D5MC 4A3IH 4Y52H 1PYWD 1S5CD 3PQIA 1JE4A 3KLRA 5JEAJ 2E2DC 1WCMH 1FGUA 3CQZH 3TEHB 1D7QA 1NE3A 3NEMA 2HQLA 4AQYL 1U4PA 1LTGD 3H3VI 2K14A 5KYIA 3RLOA 1SYBA 1CM9A 1PLFA 5NUCA 1T5XD 2Q2HA 5TSSA 1SEBD 1F2YA 3EJIA 4P74A 5ELOA 4DR1L 1DOLA 4BY7B 2F0FA 1X3GA 3PCOB 1HH2P 4YWKA 4DR7Q 2B2TC 4CDDC 4DR3Q 1IHZA 5IIFA 5C44H 1XPOA 3ULPA 4NKLA 1GM5A 2VY3A 1UWVA 2QDLA 1CKNB 4QGUA 3UDFA 1X3FA 2JEBI 3I8ZA 3NBHB 1YITA 2AWNA 3OPOA 3QOLA 1QUQB 4XDXA 1KHIA 2K5QA 4BA1I 2ZXOA 2JJQA 1AP0A 1XMQL 4YCWA 1GOZA 5T1IA 1XMOQ 1NJIC 2RHQB 4GOPC 1XJVA 4CKEA 5DAUA 4B3RL 3E6ZX 2XSCA 5LMUQ 1TXYA 2ZTCA 4JI2Q 1LV9A 1A3VA 1K0RA 4RWSC 4JI5L 4PZ7A 2JA6G 3AEVA 3U9OA 3I4OA 1B1ZA 4QQBX 5GADC 1EYCA 4LF7L 1QB5D 4KD3A 3CMEA 5M3FH 4C3IH 2ZTEA 4IUNA 3ICEA 2RCNA 1X6OA 3I7FA 4GN5A 4R8IA 3VR2A 2UXCL 2Z6KC 2WAQE 1I50B 2F0IA 3CPFA 2UU9Q 1WFQA 2VB3X 2BA0A 3PV0A 1PZKD 2F0PA 2XRSD 4A3KH 1GUWA 4IPDA 3MHBA 1V8QA 4OL7A 2NUCA 4G7HC 3HRZC 2L15A 1W6JA 1L2FA 4A3CH 2Z0SA 3MFYA 5FO7B 3CCRA 1XX8A 2NVQH 1I6VC 3SK4A 4LWCA 4DR2L 5I2XA 1BKBA 1MI2A 4KN4C 5EPKA 2R7DA 2K04A 1VQOA 4XIGS 3HKSA 4R4TA 3Q22A 5C0XH 1VS0A 1B53A 4ZCKA 1BVSA 3I56A 1R9TH 2NB0A 5LMUL 4N9PA 3R2TA 4OONA 4RHSA 1JICA 4JI2L 4DK3C 2RCFA 1IBMQ 5KNDA 5CR3A 4DAMA 1NR2A 4NB3A 4YWLA 4HJ5A 2A68D 4ZAIA 1V43A 4A3MB 5DEHA 1Z47A 5DNFA 4EVOA 2FFKB 3C1EA 1Q1BA 2EVBA 3TS2A 2QEJC 2Y0SG 4DK0A 2UXDL 4A75A 1HZ9A 1XTDA 4YCVA 2FHTA 2MNAA 1UNSA 1F77A 1II3A 2EQSA 2CH4A 1D2BA 4L5QA 5ELFA 1HXYD 2NZOA 5ELEA 5EKKA 3VR5A 3PGZA 4LF5L 1WTOA 1UE5A 4GNXC 2QW7A 4AYBG 1IL8A 4C3HH 5IT9L 5IP7H 3CPWA 4CDFC 3FRPB 5A2QL 3GD7A 2N3SA 4CJ1B 1JOKA 2EY2A 1LT4D 4PV1C 3T16A 1BCPD 5IGBA 2JA5G 1LTID 2B3GA 4M8AA 2KCCA 5GAHC 2ZM6L 3S1QH 4R1JA 2EY5A 3RN2A 4K0KQ 4I65A 4NW2A 1KXLA 1E1OA 1F9RA 5ELBA 3HOYH 3EROA 1GHKA 1EWCA 3FHWA 4HMJA 4PZ6A 4J1MA 2A6ED 2CW0D 1GXDC 4MNOA 1X54A 3SVMA 4KLKA 4QUFA 1Y1VG 4RG1A 1IBML 1DXMA 1TWFH 3KBGA 1RJTA 5M3MG 4JVZA 1WTPA 2N49A 4KJOA 1A6XA 4EX5A 5JVG3 3S15H 5IT9E 4XYOA 4NXNL 5A2QE 1RDPD 1X65A 2I46A 4EGVA 2R7ZG 1JJCB 4C56C 4ID6A 3H0GH 1Q3LA 4POFA 1SNDA 5DLQE 4DKAC 1HUNA 1TS4A 1SYFA 2F0TA 3CCVA 5M5XH 3TN2A 1PH6A 4DV2Q 3CCMA 2KCTA 3D3RA 4MN3A 2CWPA 3F2BA 2F0DA 4V0BA 1TY2A 3A7LA 2DGYA 2RBMA 4C2MH 3S1MH 2HHHL 1EIYB 4DR6Q 2JEAI 3UDXA 5C3EH 3CRLC 2K5HA 1TS5A 3V05A 1H9JA 2BE5D 1L1OA 2N78A 3IFTA 3WOEA 2B39A 2NWGA 2ZXRA 2A69C 1STYA 2IX3A 4A3BG 3D4RA 4JCVE 1SSOA 3CU7A 2O5IC 3ULJA 4MTKA 1F2ZA 4GOPB 1VQGA 1LYLA 4HSPA 4K5XA 5KGUA 4OO1G 1A63A 3HOUG 1K28A 3NXWA 4RMFA 2JA7H 2NBFA 2PNHA 4NPSA 4KY5A 1O7YA 1GKHA 1EFWA 4RCOA 4U68A 3SHLA 5H1SE 3CCSA 4LFCQ 1C8CA 3FKIB 1UE1A 3HKZE 5IYDH 1L0YB 3A55A 2DN8A 3AFQA 4BBRH 1Q46A 5I2YA 4DV2L 1PXUA 1WTWA 3GTPB 2LXJA 1PFBA 1X3PA 2DY8A 1MD2D 2N55A 3N6RA 1CSQA 1E0BA 3BU2A 4A93G 4B3MQ 1VQEA 4BY1G 1KABA 3D8GA 4P72A 3H3VH 1QCBD 1SE2A 5C4XH 3K7UC 4L5RC 1JJGA 5FJ8H 4DV1L 5M5WB 1PZJD 2HDMA 3VA7A 5IYBG 3OTOQ 4AYBE 1EWIA 2NZ1D 4ODGA 2PPBC 3J81c 3TRZA 1G2TA 3NSWA 1BF4A 3I3CA 4BBSH 1U5KA 4A3JG 1CZWA 5KIXA 1PTOD 1SN8A 5ELNA 4DXFA 1XPRA 3HOWB 4KKSA 1VQ4A 1QWYA 3OIQA 1VQ6A 3MZ5A 4DAYB 3A7AB 3KDFA 3QWNA 3G48A 5M3FG 4ULLA 4C3JB 3OSOA 4I7AA 2ZJPA 4LFCL 2L11A 4UP8A 1PDQA 3EN2A 2YTVA 3I4MB 1UEBA 3I4NB 5C5MA 2A6HC 1NBWA 3U9SA 1CQVA 3VA5A 3MWYW 4NP5A 1D8LA 3G6EA 1VMPA 1PH7A 5D3IB 4B3ML 3PO3B 1PZID 4ALPA 3CCLA 3SK5A 3AB9A 1WJJA 1DOMA 4GNXB 1RCVD 1HUMA 4QB4A 4HJ8A 1AEXA 2SNMA 3P75A 2VUMG 3IRBA 2NN6H 3CCJA 3HOXH 3M4OB 1CI3M 5KRUA 1OXUA 5IYCH 5IP9G 4OGQC 3AYHB 2DY7A 4DUYQ 5IGDA 3GTOH 4R4OA 1F9SA 1L0WA 1I4RA 1JJ2A 4DV5L 1M90C 2JA8B 1KDBA 4JI0Q 1N9WA 1ESFA 3QB3A 1MJEA 4HCSA 1K0SA 2CCZA 4DV6Q 2ENBA 2EY1A 3NHHA 4DNIA 4APVA 3QG1A 3TDQA 1MIUA 1QUQA 1K8GA 1A2TA 4J6HA 3C3LA 4C1NI 4A3DH 5EGTA 5FLXc 1BBXC 4GLXA 2B2UC 1OXXK 4IZ8A 1FNUA 3T1YQ 3GTJB 2LKVA 4MIUA 3TS0A 5FK9C 3CCEA 5IP7G 1AW7A 1SR3A 4GN4B 1HHVA 1IBKL 3URYA 2B29A 3GTQB 1A15A 1B7YB 3G7LA 5CV7A 3F8TA 1UE6A 3S16H 3RLFA 1XPUA 1WI5A 3OMGA 2EJFC 1LTBD 1JOOA 1PYBA 3MXGA 3TP7A 2PI2E 2L12A 5JVH3 3NENA 1N8RC 1Q7YC 1ENFA 4KKUA 1R4PB 1BCPF 1EZ6A 4IOCA 4JI0L 2AHOB 4OWXB 5JAVA 5IGCA 2YU9B 2K28A 4L63B 4CDEC 2H4OA 4F87A 4DV6L 5K36H 1DJRD 2NVYH 4HJ9A 2BH2A 1XYIA 2F3VA 2D9UA 2NVTH 1F2LA 1TQOA 1N34Q 3CC7A 3SDZA 4HIOA 1NR4A 4KKTA 5KEEA 1SE3A 2MQHA 3KBXA 2X6LA 1TKWB 2AQ2B 3ONAB 4DXGA 2ES2A 3MXUA 1NSNS 3STBD 4POGA 3T1YL 3SXHA 2JK8A 4A3FB 4KY6A 1EQRA 2F0VA 4JI7L 4H02A 2IPKD 5IE8A 5L37A 3HOVB 5C6AA 2R93G 3MA2B 5LMNQ 4OWWB 5C3EG 3TBIB 1WYDA 3PO2G 1RD9D 2UUAL 3S2HB 2ZJQA 2NVXB 3DMUA 1HQMC 1W3SA 5FLMH 2A68C 3EIVA 1EY0A 1VQAA 4BY7H 3S14B 2E2HB 2B8GA 3TZUA 1I5FA 3W2DA 1DOKA 4DV7L 4HN7A 1JC7A 1G6ZA 4S3SA 2O2LD 1J9OA 2Z4IA 3EA6A 4JK1C 3J7AV 1FVIA 3HZXA 2EYMA 5E4XA 4LUZA 3J80c 4N8X1 2BDNA 1N34L 5FKAC 2PI2A 4DV0L 1ENCA 5LMNW 2PMZE 2C35B 3K59A 1HZAA 4JPBW 1E1TA 2B2WA 4ZKBB 1BCPC 1Q1EA 5CBEE 1C9OA 2ALYB 1MGSA 5I9PA 1E22A 4PZ8A 5JJLA 1XWEA 4IFDH 1QVCA 3ERQA 2WAQG 3DUZA 4IPGA 3EVQA 4UP7A 2A6EC 2CW0C 1Y14B 2IHFA 3OYYA 3PUYA 4UP9A 4FYDA 4DUZL 3K5NA 1O7LA 1HA5A 1TWHB 3KF6B 2JA6B 2SDFA 1YHQA 1E2WA 3L9AX 3KF8A 4RCNA 4XQJA 3SEBA 3M7NA 4V190 3GTLB 2PQAA 3CXCA 1JMCA 3CF5A 3PUXA 4X3KA 1SYEA 2M2LA 1AZQA 1JCKB 4RGOS 3OW2A 4TVAB 1ML0D 1XMQQ 2BDOA 4CKCA 1LTAD 4UY8C 4DFAA 2Z8LA 3SR1A 2B2VC 2PYKA 4EQPA 2LXKA 2J4XA 1KRTA 1CKOA 4L6TB 1AH9A 4A3LH 1A2UA 2Q2IA 4QIWB 1W6KA 4ZLTF 5I6YA 3BS1A 1K73C 5BN4A 2EXZA 3BVMA 5AJ3Q 4JI5Q 3A5ZB 2BE5C 3Q6SA 4JBKA 1RTOA 4H13C 4R8NA 4RGNA 1K3RA 3D6CA 3UI2A 3R93A 2B2YC 2CH4W 2IX0A 2HIVA 3DEPA 1HNWQ 4LF7Q 2GVAA 4HTHA 4IALA 2Q8TA 3VR4A 5D65A 1U4MA 3FPUB 4HR7B 1G51A 5BN3A 5JPNC 4KN7C 3MAQA 3RZDB 2UXCQ 3M3YB 1K9MC 2HUGA 1TU2B 3MTSA 3MC0B 5C5LA 1SMXA 1HR0L 4A3EG 3ER0A 4O1NA 2Y0SB 2N8NA 1WTQA 4JOIC 1OO9B 3BJUA 5C4ZA 4FO2A 3TZDA 4GS3A 2ID0A 3PUVA 3R2IA 3C2PA 1IKLA 3H09A 4FDBA 4DR2Q 1STBA 3TP5A 4G7OC 5C3XA 4DU9A 2WFWA 4ME5A 1PFNA 4AYBB 1YNJD 4GKJL 1BDOA 3P1HA 5J22A 1SRUA 3FP9A 2UXBQ 2JA5B 5AJ3L 3H94A 2F0GA 1IYUA 5E3FA 3NPPA 2KA7A 4LW1A 3E0EA 1CSPA 3M9BA 3OHXC 5JEAH 4IPHA 4UHVA 1HNWL 3SK8A 3JAML 1A3UA 5FO8B 2NN6I 2UXDQ 3VYRA 5K5PA 3DLLA 1PTOC 5GQOA 1Y1VB 2MP1A 3VYUA 5M3MB 3BDOA 3D0FA 5HURA 3BZKA 1T5EA 4LF5Q 4DGZA 3AQQA 3MXPA 3U50C 2F4VQ 3ZYYX 4R4QA 1EQTA 1ASZA 2R7ZB 3U4VA 4PQXA 2QDBA 1ZXTA 5JOBA 1LTTD 3CRKC 4KJNA 1I4PA 3NTIA 3JC66 1PH2A 3VDYA 2ZM6Q 1B8AA 1LM0A 3JAME 1JT8A 4GNXA 1EYGA 4RFBA 2R92G 1SNCA 3GV3A 4JI4Q 4HIDA 2UXBL 2F0MA 3IL8A 1V1QA 4JI6Q 4ZQ3A 3HKZG 2ATWA 1Q90A 1VQMA 2F0JA 1BCPB 4RAUC 4NXNQ 1I6HB 2F0SA 3RLNA 2JP1A 3DWPA 3DWQA 4A76A 3CW2C 3S1NB 4A3BB 2B63G 3QR8A 4K2LA 2ICEC 1XNRQ 1JORA 2GA4B 3B6YA 2VQEL 4I7ZC 3FKIH 1M4VA 1TWAB 2ICIA 1WTRA 5CV8A 3HOUB 5G3LD 5EQ0A 1M8AA 1V1PB 4WORA 4LAAA 2F4VL 1U9RA 5EKLA 1PH8A 4ZYSA 3GTPH 2JQOA 1TY0A 3DXJC 4DF7A 4X66Q 4A3GG 2MGSA 2A5HA 2WB1E 2QEXA 1B70B 1VQ5A 3KOJA 2HHHQ 1EY6A 4QUCA 1N36Q 1FNWA 3K57A 3ERSX 1V1OA 4FXDA 2Q2TA 5M5WH 4JBMA 1X56A 1SYCA 1QZGA 2RVLA 1EY4A 4JI4L 4A93B 4LUVA 1PRTD 2KOLA 4BY1B 2F0WA 4JI6L 1A0IA 3K0YA 1TWGB 2Z9HA 4IO9A 4L5TA 1IZ6A 3HOWH 5E1FA 1PH5A 3W1BA 3NUCA 1XNRL 3Q8DA 4MHEA 1VQ9A 4FXGC 4C3JH 2KJXA 4X62L 1EIHA 2A1AA 2BH8A 2LSSA 2DJGC 4A3JB 1A8VA 3I4MH 2ZT9C 4CGYB 3I4NH 4X66L 2K03A 3HOZG 3T51B 1SMYD 4BXXG 2R7FA 4UPAA 2AKWB 3PO3H 3T53B 3F1ZA 1N36L 3V2TA 5ELCA 2G9HD 4DV1Q 3RZOB 3RD4A 4FXKC 3LGJA 2E2IB 5D3DA 3M4OH 3UE0A 1BXTA 3H3VC 1HZBA 4K6LA 4DK6C 3K58A 4A3IG 4X6AH 3J81L 3NELA 1WCMG 3J7ZC 1ESRA 4OIKA 4RGMA 1JB7A 3BYYB 1YJNA 3H15A 4YY3Q 1QJOA 2VUMB 4IFDI 1D1IA 3TREA 4EQOA 3FVQA 3A5UA 3NE5B 4DAVA 1Y1WH 2EDGA 1K83B 3TQYA 5BR8L 1X3EA 1R9TB 2AUJD 2NZHA 3GTKH 2EJMA 3GV6A 5CV6A 1STGA 4IJLA 2KHJA 1GUTA 4FF3A 4F88A 3CCUA 1B44D 2J0TD 2OQ0A 4IUUA 5C44G 2PMZB 2OT2A 1VQKA 2RA4A 1Q82C 1PMRA 1PTOB 1SE4A 1JQYD 4E6IA 3KYHC 3GTJH 3K5LA 1ENAA 1YI2A 1CK1A 3K7AB 1YBYA 1YHBA 2K7VA 2EXDA 3M7GA 4XQNA 3GTQH 4LF4L 2E2JB 2I5HA 3DEOA 1XXGA 3WOFA 2MUYA 1NNXA 5AFWA 4JV5L 2VZAA 2SNSA 3J81j 2K50A 1L1OC 4QF4A 1VQ8A 4DV5Q 4DR4L 4YY3L 2LFNA 2XWJB 5IGGA 1PFSA 5C4HA 3LNNA 2YU9H 1STEA 2MFIA 1B9MA 3MXNB 5M5YB 2PZWA 1S4ZA 4TRDA 1VQIA 3I90A 4C3IG 3MVVA 3NQTA 5E4WC 2K32A 1UEAB 1I3QB 5CGKA 4GN3B 1BR9A 1BUVT 1OXVA 1E7ZA 4QY7A 3S2DB 1WTHA 1VQPA 3GO5A 3G71A 3GTGB 1ET9A 5FLXL 4A3KG 4HIMA 4PMBA 1EOTA 1Z6HA 4A3FH 1EEFD 4A3CG 4RA8A 1IBKQ 4XTCS 2J7ZA 3HOVH 2YTYA 1GUGA 1S5FD 1KRSA 2UUBL 2I0QA 3LWUA 1EWHA 1EEID 3S2HH 5C0XG 1NAPA 2PQEA 1E2VA 5HGTA 4HJ7A 4X3UA 1PH4A 4B3TQ 1C0AA 1FYCA 3V96A 2G5DA 1M1KC 1X32A 2K1BA 1FJGL 2R93B 5IY0A 4KI0A 5JJKA 2IW3A 5FLXE 2E2HH 1S5BD 3W1GA 1FL0A 5C3EB 3D4DA 1LTRD 3PO2B 1CKNA 1C48A 3NBHA 1K3BC 1NUCA 2FMMA 5LHY1 2EYOA 1EUJA 2PNRC 1U4LA 4KV6A 2CFMA 3CAMA 3BZCA 1HQRD 3E3XA 1G2SA 5DM73 5EKIA 1ZEQX 4R4IA 3H6MA 1VF5C 2KCNA 3K8AA 4HMIA 1V9PA 5LL6X 2F0KA 4C3HG 1Q81C 1KNAA 4JI7Q 3QIAA 2PCFB 3K80C 1JWMD 2C5CA 1GUNA 4BWGB 1YNJC 2L1BA 3RN5A 1PFMA 1FR3A 1VF7A 1H95A 5EAYA 3I72A 2UUAQ 1Q12A 1H9MA 4LJZC 4EQ5A 1ASYA 5FOBB 3L2PA 2EJGC 3IAYA 5FO9B 3HOYG 4B3TL 2LS01 3S9WA 1RTNA 1TWHH 1SFOB 1CZGA 1CQFA 1L0XB 2EY6A 3A54A 2WAQB 4YCUA 2JA6H 2GVBA 1KAWA 2CHBD 4DV7Q 4CDCC 1SJED 2VXWA 3GTLH 4XT1B 3H0GG 1EY9A 2PZTA 4Q5VA 2IJ0A 3J80L 1NCVA 3WWVA 4DV0Q 1PRTF 5F2DA 2L55A 1CA5A 5IODA 5JPMC 2D62A 1WVLA 2RKSA 1I4GA 5C3WA 3VR6A 2CKZB 1VQFA 3DM1A 3VR3A 1VQBA 3U4ZA 2K5NA 4UAIA 3A74A 3PMFA 2QILA 1O80A 1SNQA 1EQVA 1S5DD 1IBLL 4DUZQ 3AFPA 5IWAL 4R9WA 1SLJA 1NY4A 1EZ8A 2I07B 1LT6D 2KENA 4P2CB 1VMCA 1I94L 2DJFC 3HFZB 2XN9C 4RKBA 5GAEC 4WRDA 3PIP3 1EOVA 2MJ8A 3OIPA 1CT1D 3C46A 1PH3A 3RZDH 2K4KA 3M3YH 1GUSA 3F2CA 3JAMi 2B8FA 1DM0B 1EU4A 4YHHQ 4KK7A 1G91A 1L1OB 2IT1A 2L5TA 4LMQD 2F3WA 5C4JB 2JA7G 1IYVA 3M4QA 1MJCA 1Y1WG 4QL5A 4XXEA 1K8OA 1RF2D 1X55A 2AQ1B 4DV3L 3C1FA 4J15A 5EJWA 1PV4A 3HEJA 1WTVA 4KTAA 5IYDG 3NWSA 5ISRA 4A3EB 2VB2X 4BBRG 3L0OA 4MZ9A 4TSSA 4CJ0B 3I70A 2K6AA 3G4SA 1VQLA 4QJFA 1BOSA 2OXPA 3K0XA 2RQXA 5JJZA 2EYLA 2PW7A 4IPCA 4ZKCB 2JA5H 2UUCQ 4PG3A 1HNXQ 2EYPA 3KJOA 1HJPA 3HS0C 4B9XA 5C4XG 1HTLD 5FJ8G 2E8GA 1HCZA 1PRTC 1AE2A 3BYTB 4OXPA 2NTTA 3KLWA 1RIPA 3X3NA 2WINB 2SEBD 1KC8C 2EE1A 5CORA 2F03A 1B2TA 3P20A 1OXTA 1Y1VH 1YIJA 1SE8A 4AH6A 5M3MH 4O42A 1I50H 2IX1A 1VDZA 4LFBQ 1ILPA 1PYSB 4BBSG 4YHHL 1HR0Q 2F0QA 3PIOA 2KEEA 2VW9A 2R7ZH 5IOCA 1WD0A 3L7ZC 2VS1A 1IYJB 4B3SL 4OX9L 2XTIA 1LTSD 2B2TA 1D6EC 2CQAA 2DNCA 3PIO3 1DGSA 4LFAQ 2HD3A 3FMCA 1KD1C 1SMYC 2CWAA 4JOIA 4X3SA 2M00A 3QO2A 2OCEA 2PO4A 1PTOF 3KDFB 4IUQA 4K14A 3S1RB 4GKKQ 4GKJQ 2B2WC 3S17B 3FPPA 2TSSA 1SJHD 5M9OA 1ZYRD 1TWCB 4DNRB 5A35A 3E0JA 3ND9A 2UUCL 5IGEA 1HNXL 4X65L 4GOPA 1HR0W 1EY5A 1SXTA 3BDLA 4OWTB 4A3MH 1S40A 1I6HH 2PW5A 2HT1A 2NN6G 3HOXG 2R92B 4BS9A 3UE1A 2WB1G 3S1NH 4A3BH 5IYCG 2F0OA 1GHJA 5CC4A 3W3AA 2ZTDA 1IKMA 3HKZB 1J5EQ 4Y7NB 4JBWA 4OO1H 3CC4A 1TWAH 2OQKA 3HOUH 4OEMB 4LFBL 2RSNA 4DAPA 1IL2A 3GTMB 2JSOA 4RKLA 2V4DA 2JE6I 2VNUD 1S3OA 4ABNA 3Q23A 3CD6A 2K5VA 2B63B 4IUTA 5DM63 1GJXA 1U0LA 3H91A 2Q2UA 1QNUA 2Z6KA 3MEHA 1AZPA 1PVOA 1AE3A 1H9RA 2M9VA 4R4CA 1SYDA 3U58A 1PA6A 2HDLA 2K52A 4LFAL 3T13A 1HRJA 3IFDA 4A3DG 2KVMA 2JXMB 1HNZL 1DZ1A 3T56B 4A3GB 1WD1A 2QA4A 3S24A 4GKKL 3GDEA 5ELDA 5GAGC 4A93H 2X69A 5C0XJ 3CMAA 2WP8J 4BY1H 1EL0A 3M85A 1TWGH 2MPMA 3EQLC 4A4IA 2X6GA 3DM3A 5I4DA 5KNCA 1VQDA 5IYBH 3J81i 2DNEA 2YYZA 4DAYA 3MXNA 2A8VA 1KQSA 2C9OA 2QF7A 2VQEQ 1BNZA 4KHVA 1J5EL 1QG7A 4A3JH 2D0OA 4WJ4A 1H9SB 2ASBA 4TKOB 1YJ9A 2FXQA 3G6JB 2Z6BA 2NYZD 1KTKA 3SK6A 4P75A 1LT3D 5K36G 1OXSC 3TP8A 2EOTA 2EZVA 2V1CC 4ZUIA 1YVCA 4K8IA 4RGTA 4P71A 5IGFA 1JE5A 4DR7L 4WJ3M 4DR3L 1GVPA 1EFID 4C1NK 4HEDA 5EPJA 1EQQA 1GUOA 3RZOH 2L9HA 2E2IH 2YV5A 3HOZB 5T1GA 3ZJYC 1C4QA 1IXRA 1TS2A 4K6DA 2GN5A 3J7YW 1ZKOA 4HAEA 1GO3E 5CV5A 1WTXA 4JI3Q 4MTNA 1QVGA 3J7AF 1XMOL 2VUMH 1MSGA 5HY6A 1YHAA 1PH1A 1JB3A 4HSVA 2IWHA 2OEOA 4AIMA 3ND8A 1K83H 2HCIA 4IN3A 4K2KA 4A3IB 1YNXA 5IP9H 5FLMG 3OW7A 3TP6A 3HG9A 3E5SA 1WCMB 3SE0A 3CQZB 5CBAE 4X62Q 4NXMQ 1HTPA 1STHA 2Z4HA 2WKDA 1PRTB 4BY7G 1PHJA 4L8JA 2KCMA 4JYAQ 3MEFA 3JAMc 2VQFQ 1PTOH 5EPLA 2AQ3B 5E7NA 2ZXPA 1CHPD 1HZCA 3AMUA 1U4RA 2BOSA 3K7AH 4IQZA 5C44B 2RDHA 3ITPA 2E2JH 1G8ZD 1UE7A 2UU9L 3RR5A 2K5DA 3VYTA 3A8KE 1TR5A
chains in the Genus database with same CATH topology
3X3MA 5CV9A 4IUVA 2EPBA 4F8MA 1ET6A 1LACA 1G291 4IFDG 2RSOA 1SNOA 4CBVA 2K05A 3N52A 1UUPA 1RHPA 4WFN3 3TSSA 5I6WA 1F2MA 2QCPX 2IL8A 4WJWA 4BA2I 4DN4M 2Q8IB 1VCIA 4KD4A 2D2CC 1D5XC 1I4QA 1XTCD 3M4YA 5EBCA 5BN5A 2F0HA 2F0UA 5M3FB 3OWFA 4C3IB 5COYA 1SDFA 3DWAA 4KMUC 3HGBA 4Q0FA 1ONLA 2WV6D 3K5OA 3KLSX 2K01A 1IW7D 1LLRD 2E74C 3NWTA 1Y8NB 1DYQA 1D1KA 3A56A 4A3KB 4KY7A 5KNBA 1YNND 1DCZA 1JR0D 2NVQB 4G7ZC 1LABA 1RKNA 2EYFA 2A74C 2FINB 4ZUJA 4G57A 4NMZA 4FF4A 1CFMA 1Y8OB 1SBBB 1TT2A 4QCLA 4XT3B 3J81E 4YIJA 3A8JE 2K33A 2KUMA 1STAA 1CHQD 1MBYA 3BVZA 1JOQA 1KDCA 2LY7A 2R61A 4RH6A 3I4LA 5LL6S 1TIID 1ILQA 4DNTB 1BQQT 4C3HB 3NP8A 4ILWA 4F7XA 3NTKA 3D6WA 3BZDB 4Z9CB 3PUZA 3L3OC 2RDGA 2HCCA 3S1QB 3R3OA 3OWEB 1TS3A 2G9DA 4FP5D 5JEAG 3OOCA 3HOYB 1FD7D 4B9WA 1JWUD 2PZUA 2WACA 4EQNA 1SNPA 1TWFB 2R6GA 2XNAC 1B9NA 2H1EA 3LWEA 1LT5D 1EIGA 4N9TA 3S15B 1FNVA 4XQQA 2AWOA 4OO1I 1BO0A 4DK1A 3H0GB 4HCEA 4FF2A 5M5XB 4X3TA 1ZYRC 2B2UA 2KECA 1J8IA 3PUWA 1SNMA 5J39A 4OIJA 4C2MB 3S1MB 1F9PA 1KAAA 4K8JA 4K5VA 2F1MA 3QOJA 2F0NA 2A73B 3CHBD 5D14A 1HFGA 2HQEA 2LMCB 1KLGD 1CTMA 1LO5D 4DA2A 1B4OA 2JA7B 4U673 1FGBD 1Y1WB 4PMWA 3GTKB 2F0LA 1SYGA 3KK7A 1UAPA 1CA6A 2K5WA 2MHVA 2EYJA 4BBRB 1I4XA 3TMEA 4TQUS 5G3LF 5CMDA 2WIIB 1B50A 1HA6A 1QILA 2E76C 3WDNA 4H7BA 5EBDA 2L0CA 2JYOA 2SOBA 1Z7TA 4ZK9B 1DONA 1H9KA 4OHJA 5C4XB 3FEWX 1Q8IA 2O4XA 3IKJA 1H9SA 5CYUA 1E2ZA 1Y69U 2FMCA 4GZYC 1TVXA 5KYLA 5C0XI 4FVMA 1K8MA 4C3JG 4IURA 4CHTB 5CV4A 4BBSB 3O13A 1S5ED 2N88A 3F2UA 3A8IE 3LX0A 2KHSA 4ZRZA 3KUPA 4FNFA 1B3AA 2D5DA 1EY7A 3RUZA 4UDUC 3BG3A 2XRQD 3I91A 2WKCA 3P7JA 3KLSA 2XVSA 3CKIB 1RODA 1QE6A 4IFDJ 1KNEA 2AUKA 1F9QA 3J80E 2Q8RE 1X3QA 4H0LC 3DHQA 3FDTA 2L4NA 3VYSA 4PMCA 2A69D 1O7ZA 3T4AC 4XYQA 3BVGA 2KEDA 3K6OA 2E75C 3NTHA 3HOXB 1V1PA 2WB1B 4RHRA 3EFXD 3Q0AA 3NBIA 1AN8A 2KQ3A 3GTOB 4B08A 5I9OA 4LK1C 1HFNA 5J1ZA 1QOHA 2CVRA 3HP3A 1QNKA 4H44C 1ICWA 1EYAA 1EY8A 1SAPA 1HPCA 3Q24A 3D31A 3MFGA 2B2VA 4J8QA 4A3DB 3GP7A 3I73A 2RDFA 4CKBA 2QKIC 4KHZA 1MSHA 3QJYA 4IUPA 1JWSD 3R8BA 1Y8PB 3OMCA 2B2YA 2BCOA 1R4QB 1I4HA 4QMGA 4K5WA 3K5MA 2F4IA 4PNYA 3RMHA 3S16B 4CJ2C 2NTSA 2EYHA 2XWBB 1AFPA 3BDCA 2TMPA 1EU3A 1A3TA 3GQBA 2XIWA 1KDAA 1DD2A 3NK9A 2OF1A 4M1UB 1IW7C 1O78A 2O5JC 3AU7A 3D4WA 2NVYB 3NQIA 1EYDA 1KLUD 1STNA 2NVTB 2A6HD 2Z1CA 1YNNC 1D5ZC 4NDXA 4FF1A 2F0EA 2BA1A 2R3ZA 4G4KA 2FJ2A 1D5MC 1PYWD 1S5CD 1JE4A 3KLRA 5JEAJ 2E2DC 1U4PA 1LTGD 5KYIA 1SYBA 1CM9A 1PLFA 5NUCA 1T5XD 5TSSA 1SEBD 1F2YA 3EJIA 1DOLA 4BY7B 2F0FA 2B2TC 1IHZA 5IIFA 4NKLA 2JEBI 3I8ZA 2AWNA 3OPOA 3QOLA 4XDXA 2K5QA 4BA1I 2ZXOA 1AP0A 1GOZA 5T1IA 4CKEA 5DAUA 3E6ZX 2XSCA 1LV9A 1A3VA 4RWSC 3U9OA 1B1ZA 1EYCA 1QB5D 4KD3A 4IUNA 4R8IA 3VR2A 1I50B 2F0IA 2VB3X 2BA0A 3PV0A 1PZKD 2F0PA 2XRSD 1GUWA 3MHBA 1V8QA 4OL7A 2NUCA 4G7HC 3HRZC 1W6JA 3MFYA 5FO7B 1XX8A 1I6VC 3SK4A 5I2XA 1MI2A 4KN4C 5EPKA 2K04A 4XIGS 3Q22A 5C0XH 1B53A 2NB0A 4N9PA 3R2TA 4RHSA 1JICA 5KNDA 5CR3A 1NR2A 2A68D 4ZAIA 1V43A 4A3MB 5DEHA 1Z47A 5DNFA 4EVOA 2FFKB 3C1EA 1Q1BA 2EVBA 2QEJC 4DK0A 2FHTA 1UNSA 1F77A 1II3A 1D2BA 5ELFA 1HXYD 5ELEA 5EKKA 3VR5A 1WTOA 1IL8A 5IT9L 3FRPB 5A2QL 3GD7A 4CJ1B 1JOKA 2EY2A 1LT4D 4PV1C 3T16A 1BCPD 5IGBA 1LTID 4M8AA 2KCCA 2EY5A 4I65A 4NW2A 1F9RA 5ELBA 3EROA 1GHKA 1EWCA 4HMJA 4J1MA 2A6ED 2CW0D 1GXDC 3SVMA 4QUFA 1DXMA 3KBGA 1RJTA 1WTPA 4KJOA 1A6XA 5JVG3 5IT9E 4XYOA 5A2QE 1RDPD 2I46A 4EGVA 4C56C 4ID6A 1Q3LA 1SNDA 1HUNA 1TS4A 1SYFA 2F0TA 3TN2A 3D3RA 4MN3A 2F0DA 4V0BA 1TY2A 3A7LA 2RBMA 2JEAI 3CRLC 1TS5A 3V05A 1H9JA 2BE5D 3IFTA 3WOEA 2B39A 2NWGA 2ZXRA 2A69C 1STYA 2IX3A 3D4RA 1SSOA 3CU7A 2O5IC 1F2ZA 4K5XA 4HSPA 5KGUA 4OO1G 3NXWA 2NBFA 4KY5A 1O7YA 4RCOA 4U68A 3SHLA 1C8CA 3FKIB 1L0YB 3A55A 2DN8A 5I2YA 1PXUA 1WTWA 3GTPB 1PFBA 1X3PA 2DY8A 1MD2D 2N55A 3N6RA 1E0BA 1KABA 3D8GA 1QCBD 1SE2A 5M5WB 1PZJD 2HDMA 3VA7A 2NZ1D 4ODGA 2PPBC 1G2TA 3NSWA 1BF4A 3I3CA 1CZWA 5KIXA 1PTOD 4DXFA 3HOWB 4KKSA 1QWYA 3OIQA 3MZ5A 3A7AB 3QWNA 4ULLA 4C3JB 3OSOA 2L11A 1PDQA 3I4MB 3I4NB 5C5MA 2A6HC 3U9SA 1CQVA 3VA5A 3MWYW 4NP5A 1VMPA 5D3IB 3PO3B 1PZID 3SK5A 3AB9A 1DOMA 1RCVD 1HUMA 4QB4A 1AEXA 2SNMA 3P75A 2NN6H 3M4OB 1CI3M 5KRUA 1OXUA 4OGQC 2DY7A 5IGDA 1F9SA 1I4RA 2JA8B 1KDBA 3QB3A 1ESFA 4HCSA 2ENBA 2EY1A 3NHHA 3QG1A 3TDQA 1A2TA 4J6HA 3C3LA 4C1NI 5EGTA 1BBXC 2B2UC 1OXXK 4IZ8A 1FNUA 3GTJB 2LKVA 4MIUA 5FK9C 1AW7A 1HHVA 3URYA 3GTQB 1A15A 3G7LA 5CV7A 3RLFA 3OMGA 2EJFC 1LTBD 1JOOA 3MXGA 3TP7A 2L12A 5JVH3 1ENFA 4KKUA 1R4PB 1BCPF 1EZ6A 5JAVA 5IGCA 2YU9B 2K28A 4L63B 4F87A 2H4OA 5K36H 1DJRD 1XYIA 2F3VA 2D9UA 1F2LA 1TQOA 3SDZA 1NR4A 4KKTA 5KEEA 1SE3A 3KBXA 2X6LA 1TKWB 2AQ2B 3ONAB 4DXGA 3MXUA 1NSNS 3SXHA 4A3FB 4KY6A 2F0VA 2IPKD 3HOVB 5C6AA 3MA2B 3TBIB 1RD9D 3S2HB 2NVXB 3DMUA 1HQMC 2A68C 1EY0A 3S14B 2E2HB 2B8GA 3TZUA 3W2DA 1DOKA 4HN7A 1JC7A 1G6ZA 4S3SA 2O2LD 1J9OA 2Z4IA 3EA6A 4JK1C 3J7AV 3HZXA 2EYMA 5E4XA 2BDNA 5FKAC 1ENCA 3K59A 2B2WA 4ZKBB 1BCPC 1Q1EA 5CBEE 1MGSA 5I9PA 1XWEA 4IFDH 3ERQA 3DUZA 3EVQA 2A6EC 2CW0C 3PUYA 4FYDA 3K5NA 1O7LA 1HA5A 1TWHB 2JA6B 2SDFA 1E2WA 3L9AX 3KF8A 4RCNA 4XQJA 3SEBA 3M7NA 4V190 3GTLB 3PUXA 4X3KA 1SYEA 2M2LA 1AZQA 1JCKB 4RGOS 1ML0D 2BDOA 4CKCA 1LTAD 4DFAA 2Z8LA 3SR1A 2B2VC 2PYKA 4EQPA 2J4XA 4L6TB 1A2UA 4QIWB 1W6KA 4ZLTF 5I6YA 3BS1A 5BN4A 2EXZA 3BVMA 2BE5C 3Q6SA 1RTOA 4H13C 4R8NA 4RGNA 3UI2A 3D6CA 3R93A 2B2YC 2IX0A 3DEPA 4HTHA 4IALA 2Q8TA 3VR4A 5D65A 1U4MA 3FPUB 4HR7B 5BN3A 5JPNC 4KN7C 3MAQA 3RZDB 3M3YB 2HUGA 1TU2B 3MTSA 3MC0B 5C5LA 4O1NA 2Y0SB 1WTQA 1OO9B 5C4ZA 4FO2A 3TZDA 2ID0A 3PUVA 3R2IA 3C2PA 1IKLA 3H09A 1STBA 3TP5A 4G7OC 5C3XA 4DU9A 4ME5A 1PFNA 4AYBB 1YNJD 1BDOA 3P1HA 5J22A 2JA5B 3H94A 2F0GA 1IYUA 5E3FA 3NPPA 2KA7A 3OHXC 5JEAH 3SK8A 3JAML 1A3UA 5FO8B 2NN6I 3VYRA 5K5PA 1PTOC 1Y1VB 2MP1A 3VYUA 5M3MB 3BDOA 5HURA 1T5EA 4DGZA 3MXPA 3ZYYX 1EQTA 2R7ZB 4PQXA 2QDBA 1ZXTA 5JOBA 1LTTD 3CRKC 4KJNA 1I4PA 3NTIA 3JAME 4RFBA 1SNCA 3GV3A 2F0MA 3IL8A 4ZQ3A 1Q90A 2F0JA 1BCPB 4RAUC 1I6HB 2F0SA 2JP1A 3DWPA 3DWQA 3S1NB 4A3BB 4K2LA 2ICEC 1JORA 2GA4B 4I7ZC 1M4VA 1TWAB 2ICIA 1WTRA 5CV8A 3HOUB 5G3LD 5EQ0A 1M8AA 1V1PB 4WORA 4LAAA 1U9RA 5EKLA 4ZYSA 1TY0A 3DXJC 4DF7A 2MGSA 2A5HA 1EY6A 4QUCA 1FNWA 3K57A 1V1OA 4FXDA 1SYCA 2RVLA 1EY4A 4A93B 1PRTD 2KOLA 4BY1B 2F0WA 3K0YA 1TWGB 5E1FA 3NUCA 4MHEA 4FXGC 2KJXA 1EIHA 4A3JB 2ZT9C 4CGYB 2K03A 3T51B 1SMYD 3T53B 3V2TA 5ELCA 2G9HD 3RZOB 3RD4A 4FXKC 2E2IB 5D3DA 1BXTA 3H3VC 4K6LA 3K58A 3J81L 1ESRA 4OIKA 4RGMA 3BYYB 1QJOA 2VUMB 4IFDI 1D1IA 4EQOA 3FVQA 3NE5B 4DAVA 2EDGA 1K83B 1R9TB 2AUJD 2EJMA 3GV6A 5CV6A 1STGA 1GUTA 4FF3A 4F88A 1B44D 2J0TD 4IUUA 2PMZB 2OT2A 2RA4A 1PMRA 1PTOB 1SE4A 1JQYD 4E6IA 3K5LA 1ENAA 1CK1A 3K7AB 2K7VA 3M7GA 4XQNA 2E2JB 3DEOA 1XXGA 3WOFA 2MUYA 5AFWA 2SNSA 4QF4A 2LFNA 2XWJB 5IGGA 5C4HA 3LNNA 1STEA 1B9MA 5M5YB 2PZWA 1S4ZA 4TRDA 4C3IG 3I90A 3MVVA 3NQTA 5E4WC 2K32A 1UEAB 1I3QB 5CGKA 1BR9A 1BUVT 1OXVA 3S2DB 3GO5A 3GTGB 1ET9A 5FLXL 4PMBA 1EOTA 1Z6HA 1EEFD 4RA8A 4XTCS 2J7ZA 1GUGA 1S5FD 3LWUA 1EWHA 1EEID 5C0XG 1NAPA 2PQEA 1E2VA 5HGTA 4X3UA 1FYCA 3V96A 1X32A 2K1BA 2R93B 4KI0A 2IW3A 5FLXE 1S5BD 5C3EB 3D4DA 1LTRD 3PO2B 1C48A 3NBHA 2FMMA 1NUCA 5LHY1 2EYOA 2PNRC 1U4LA 4KV6A 1HQRD 1G2SA 5DM73 5EKIA 1ZEQX 3H6MA 1VF5C 2KCNA 4HMIA 5LL6X 2F0KA 4C3HG 1KNAA 3QIAA 2PCFB 1JWMD 2C5CA 1GUNA 4BWGB 1YNJC 2L1BA 1PFMA 1FR3A 1VF7A 3I72A 1Q12A 1H9MA 4LJZC 3IAYA 5FOBB 2EJGC 5FO9B 2LS01 3S9WA 1RTNA 1SFOB 1CZGA 1CQFA 1L0XB 2EY6A 3A54A 2WAQB 2CHBD 1SJED 2VXWA 4XT1B 1EY9A 2PZTA 4Q5VA 2IJ0A 3J80L 1NCVA 1PRTF 5F2DA 2L55A 1CA5A 5IODA 5JPMC 2D62A 1WVLA 2RKSA 1I4GA 5C3WA 3VR6A 3DM1A 3VR3A 4UAIA 3PMFA 2QILA 1O80A 1SNQA 1EQVA 1S5DD 4R9WA 1EZ8A 2I07B 1LT6D 4P2CB 1VMCA 4RKBA 2XN9C 4WRDA 3PIP3 2MJ8A 3OIPA 1CT1D 3C46A 1GUSA 2B8FA 1DM0B 1EU4A 4KK7A 1G91A 2IT1A 2L5TA 4LMQD 2F3WA 5C4JB 1IYVA 4XXEA 1K8OA 1RF2D 2AQ1B 3C1FA 5EJWA 3HEJA 1WTVA 4KTAA 3NWSA 5ISRA 4A3EB 2VB2X 4TSSA 4CJ0B 3I70A 2K6AA 1BOSA 2OXPA 2RQXA 5JJZA 2EYLA 2PW7A 4ZKCB 2EYPA 3HS0C 4B9XA 1HTLD 1HCZA 1PRTC 3BYTB 2NTTA 3X3NA 2WINB 2SEBD 2EE1A 5CORA 2F03A 1B2TA 3P20A 1OXTA 4O42A 2IX1A 1VDZA 1ILPA 2F0QA 2KEEA 5IOCA 1WD0A 3L7ZC 1LTSD 2B2TA 1D6EC 2CQAA 2DNCA 3PIO3 3FMCA 1SMYC 4X3SA 2M00A 2PO4A 3QO2A 1PTOF 4IUQA 4K14A 3S1RB 2B2WC 3S17B 3FPPA 2TSSA 1SJHD 5M9OA 1ZYRD 1TWCB 4DNRB 5A35A 3E0JA 3ND9A 5IGEA 1EY5A 1SXTA 3BDLA 2PW5A 2NN6G 2R92B 4BS9A 2F0OA 1GHJA 5CC4A 3W3AA 1IKMA 3HKZB 4Y7NB 4JBWA 4OO1H 2RSNA 4DAPA 3GTMB 2JSOA 4RKLA 2V4DA 2JE6I 2VNUD 3Q23A 4ABNA 2B63B 4IUTA 5DM63 1GJXA 3H91A 1QNUA 3MEHA 1AZPA 1H9RA 2M9VA 1SYDA 2HDLA 3T13A 1HRJA 3IFDA 2KVMA 2JXMB 1DZ1A 3T56B 4A3GB 1WD1A 5ELDA 2X69A 5C0XJ 2WP8J 1EL0A 3M85A 2MPMA 3EQLC 2X6GA 5I4DA 5KNCA 2DNEA 2YYZA 4DAYA 3MXNA 2C9OA 2QF7A 1BNZA 4KHVA 1QG7A 1H9SB 4TKOB 3G6JB 2NYZD 1KTKA 3SK6A 1LT3D 5K36G 1OXSC 3TP8A 2EOTA 2EZVA 4ZUIA 4K8IA 4RGTA 5IGFA 1EFID 4C1NK 4HEDA 5EPJA 1GUOA 2L9HA 3HOZB 5T1GA 1C4QA 1TS2A 4K6DA 3J7YW 1ZKOA 4HAEA 5CV5A 1WTXA 3J7AF 1MSGA 1JB3A 4HSVA 2IWHA 2OEOA 3ND8A 4IN3A 2HCIA 4K2KA 4A3IB 3OW7A 3TP6A 3HG9A 3E5SA 1WCMB 3SE0A 3CQZB 5CBAE 1HTPA 1STHA 2Z4HA 2WKDA 1PRTB 4L8JA 1PTOH 5EPLA 2AQ3B 2ZXPA 1CHPD 3AMUA 1U4RA 2BOSA 4IQZA 5C44B 2RDHA 3ITPA 1G8ZD 2K5DA 3VYTA 3A8KE 1TR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D1K A;  1R4P B;  1QNU A;  4ULL A;  2C5C A;  1C48 A;  1QOH A;  1DM0 B;  1BOS A;  4M1U B;  2XSC A;  1R4Q B;  2BOS A;  1D1I A;  1CZW A;  2GA4 B;  3MXG A;  1C4Q A;  4P2C B;  1CZG A;  1CQF A; 
#chains in the Genus database with same CATH topology
 3X3M A;  5CV9 A;  2H5X A;  4IUV A;  2XGT A;  2EPB A;  4F8M A;  1ET6 A;  1LAC A;  1G29 1;  4JI3 L;  4IFD G;  2RSO A;  1SNO A;  4LUO A;  4CBV A;  1K8A C;  3CC2 A;  1XNQ Q;  4OEL B;  2K05 A;  3J7A 5;  3N52 A;  1UUP A;  5BR8 Q;  1RHP A;  4WFN 3;  3TSS A;  5I6W A;  1F2M A;  1EIF A;  4JI1 Q;  2QCP X;  5M5Y H;  1NMG A;  2IL8 A;  3A0J A;  4WJW A;  4BA2 I;  4NXM L;  3KFU A;  4KHP Q;  1I3Q H;  4DN4 M;  2Q8I B;  3S2D H;  1VCI A;  4KD4 A;  4JYA L;  2D2C C;  1D5X C;  1I4Q A;  1XTC D;  3M4Y A;  5EBC A;  3GTG H;  4IJH A;  5BN5 A;  1YEZ A;  2F0H A;  2VQF L;  4JI8 Q;  2F0U A;  3UDG A;  5M3F B;  3OWF A;  4C3I B;  5COY A;  1SDF A;  3DWA A;  4KMU C;  3HGB A;  2E5L Q;  4LF6 Q;  3SGI A;  4Q0F A;  2OTL A;  1ONL A;  2WV6 D;  3K5O A;  3KLS X;  2K01 A;  1IW7 D;  3STB C;  1LLR D;  3KF8 B;  2E74 C;  3NWT A;  4LF4 Q;  1Y8N B;  1DYQ A;  4HIK A;  4LNQ A;  1D1K A;  1P8L A;  3A56 A;  4A3K B;  2PQA B;  3PF4 A;  4JV5 Q;  5IT9 c;  4KY7 A;  5KNB A;  1YNN D;  4GLV B;  1DCZ A;  4A3L G;  1GD7 A;  1JR0 D;  2NVQ B;  4G7Z C;  4DR4 Q;  2R93 H;  2KHI A;  1LAB A;  1RKN A;  2EYF A;  2A74 C;  2JA8 H;  2FIN B;  4ZUJ A;  1XNQ L;  3PO2 H;  4G57 A;  4A3M G;  4NMZ A;  4K0K L;  1C7Y A;  4FF4 A;  1CFM A;  4JI1 L;  2F52 A;  1Y8O B;  1SBB B;  2YTX A;  4QIW E;  1TT2 A;  4QCL A;  4KHP L;  4P73 A;  4XT3 B;  2A19 A;  1RL2 A;  2I5L X;  2CQO A;  3J81 E;  4YIJ A;  4JI8 L;  3A8J E;  2K33 A;  2KUM A;  4DV4 Q;  1STA A;  1CHQ D;  2K75 A;  3J80 i;  4LF9 Q;  1MBY A;  3BVZ A;  4L5S A;  2E5L L;  4LF6 L;  1JOQ A;  1KDC A;  2LY7 A;  1VQJ A;  1BBU A;  2R61 A;  4O2D A;  4RH6 A;  1Z9F A;  3I4L A;  4N8F A;  4DR5 Q;  5LL6 S;  2UUB Q;  1TII D;  1ILQ A;  1OTC A;  4DNT B;  1B3Q A;  2Y0S E;  1BQQ T;  4C3H B;  3NP8 A;  4ILW A;  4F7X A;  3NTK A;  3D6W A;  4LF8 Q;  3BZD B;  4Z9C B;  1FJG Q;  3PUZ A;  1SFO H;  3KF6 A;  2RDG A;  2HCC A;  3L3O C;  3S1Q B;  4DR6 L;  3R3O A;  2QGQ A;  3OWE B;  1T9H A;  1TS3 A;  2G9D A;  4FP5 D;  5JEA G;  3OOC A;  1QZH A;  3HOY B;  1FD7 D;  4B9W A;  1JWU D;  2PZU A;  2WAC A;  4EQN A;  5GRO A;  1SNP A;  4GLA C;  4X64 Q;  1TWF B;  3CCQ A;  2R6G A;  2XNA C;  1B9N A;  2H1E A;  3M4P A;  2RF4 A;  3LWE A;  1LT5 D;  3K81 C;  1EIG A;  4N9T A;  3S15 B;  1SRO A;  1FNV A;  4XQQ A;  1LUZ A;  2AWO A;  4OO1 I;  1BO0 A;  4DK1 A;  4DV4 L;  1VQC A;  2JA9 A;  3ULL A;  3H0G B;  4LF9 L;  3W5O A;  4HCE A;  4FF2 A;  5M5X B;  4X3T A;  3T1H Q;  4DR5 L;  1ZYR C;  2B2U A;  2KEC A;  1J8I A;  3PUW A;  1SNM A;  5J39 A;  4OIJ A;  2NVX H;  4LF8 L;  2EIF A;  4C2M B;  3S1M B;  1F9P A;  1S72 A;  1KAA A;  4K8J A;  3S14 H;  4K5V A;  4JW0 A;  2F1M A;  3QOJ A;  1Q86 C;  2F0N A;  4YWM A;  2A73 B;  5C4J H;  3CHB D;  5D14 A;  1HFG A;  2HQE A;  3OTO L;  2MO0 A;  2LMC B;  1KLG D;  3UDI A;  3PSI A;  4X64 L;  1CTM A;  3FKI G;  1LO5 D;  4DA2 A;  1B4O A;  4A3E H;  3EBE A;  2VL6 A;  2JA7 B;  4U67 3;  4HJA A;  1FGB D;  1Y1W B;  1KIX A;  4PMW A;  3GTK B;  2F0L A;  1SYG A;  3KK7 A;  1UAP A;  1BBW A;  1CA6 A;  2K5W A;  1VQN A;  2MHV A;  2EYJ A;  4BBR B;  1IBL Q;  1KL9 A;  3T1H L;  2D0P A;  1I4X A;  3TME A;  5IWA Q;  1N33 Q;  4TQU S;  2F3I A;  5G3L F;  5CMD A;  2WII B;  1I94 Q;  1B50 A;  1HA6 A;  1QIL A;  2E76 C;  3WDN A;  4H7B A;  5EBD A;  2L0C A;  2JYO A;  1N32 Q;  2OTJ A;  2SOB A;  1Z7T A;  4ZK9 B;  1DON A;  1H9K A;  4OHJ A;  4O0A A;  1O7I A;  5C4X B;  3FEW X;  1Q8I A;  2HIX A;  2O4X A;  4JC0 A;  3IKJ A;  1H9S A;  3HOW G;  5CYU A;  1E2Z A;  1Y69 U;  2FMC A;  2DUD A;  4GZY C;  1TVX A;  5KYL A;  5C0X I;  4DV3 Q;  4IOA A;  4FVM A;  1K8M A;  4C3J G;  4IUR A;  4DUY L;  4CHT B;  2IHE A;  5CV4 A;  4BBS B;  3O13 A;  3RNU A;  1S5E D;  2N88 A;  3F2U A;  3A8I E;  3LX0 A;  2KHS A;  4ZRZ A;  3KUP A;  3I4M G;  3KJP A;  3I4N G;  4FNF A;  1B3A A;  2D5D A;  1EY7 A;  3S1R H;  3S17 H;  3RUZ A;  4UDU C;  3BG3 A;  1TWC H;  2XRQ D;  3I91 A;  2WKC A;  3PO3 G;  3PIP A;  3P7J A;  1E3P A;  3KLS A;  5J3B A;  2XVS A;  3CKI B;  1ROD A;  2MO1 A;  2KBN A;  1N33 L;  1QE6 A;  4IFD J;  1X9N A;  1KNE A;  2AUK A;  1F9Q A;  2R92 H;  1W2B A;  4JG2 A;  4DPG A;  2RHS B;  3J80 E;  2Q8R E;  1N32 L;  1X3Q A;  4H0L C;  3DHQ A;  3I55 A;  3FDT A;  2L4N A;  3VYS A;  4PMC A;  2A69 D;  1O7Z A;  4Y7N H;  3T4A C;  4XYQ A;  3BVG A;  2KED A;  3I2Z A;  3K6O A;  2E75 C;  3NTH A;  3GTM H;  3HOX B;  1CKM A;  2JA8 G;  1V1P A;  2WB1 B;  4RHR A;  4B3S Q;  2B63 H;  3EFX D;  4OX9 Q;  1MHW C;  5JJI A;  3Q0A A;  3NBI A;  1QVF A;  2IY5 B;  1AN8 A;  2KQ3 A;  3GTO B;  4B08 A;  2OWO A;  5I9O A;  4LK1 C;  1ICF B;  1G6P A;  1HFN A;  5J1Z A;  4A3G H;  1QOH A;  2CVR A;  3HP3 A;  1QNK A;  4H44 C;  1ICW A;  1VQH A;  2P5Z X;  1EYA A;  1EY8 A;  1SAP A;  1E24 A;  1HPC A;  1YJW A;  3Q24 A;  3D31 A;  3MFG A;  2B2V A;  4J8Q A;  4X65 Q;  1J6Q A;  4A3D B;  3GP7 A;  3I73 A;  2RDF A;  4CKB A;  2QKI C;  4KHZ A;  4ME3 A;  1MSH A;  3QJY A;  1LTL A;  3F2D A;  4IUP A;  1JWS D;  1YZ6 A;  3R8B A;  2JN4 A;  1Y8P B;  3OMC A;  3E9I A;  2B2Y A;  2BCO A;  1R4Q B;  1I4H A;  3E9H A;  4QMG A;  4K5W A;  4AQY Q;  3K5M A;  2F4I A;  4PNY A;  3RMH A;  1MKH A;  5LMN L;  3S16 B;  4CJ2 C;  4JBJ A;  1NMF A;  2NTS A;  2EYH A;  1P16 A;  2XWB B;  1AFP A;  2I5M X;  3BDC A;  4DR1 Q;  2TMP A;  1EU3 A;  1A3T A;  1WOC A;  3GQB A;  3CP0 A;  2XIW A;  1HNZ Q;  1NTG A;  1KDA A;  1Q8K A;  1DD2 A;  3NK9 A;  2OF1 A;  1A62 A;  4M1U B;  1VQ7 A;  3HOZ H;  5HGQ A;  1IW7 C;  1O78 A;  2ZJR A;  2O5J C;  3AU7 A;  3D4W A;  2NVY B;  3NQI A;  1CUK A;  1EYD A;  1PH9 A;  1KLU D;  4A3F G;  4BXX H;  3PF5 A;  1STN A;  2NVT B;  2A6H D;  2Z1C A;  1YNN C;  3HOV G;  1D5Z C;  2AMC B;  4NDX A;  4FF1 A;  2F0E A;  2BA1 A;  2R3Z A;  4G4K A;  2FJ2 A;  4B3R Q;  1D5M C;  4A3I H;  4Y52 H;  1PYW D;  1S5C D;  3PQI A;  1JE4 A;  3KLR A;  5JEA J;  2E2D C;  1WCM H;  1FGU A;  3CQZ H;  3TEH B;  1D7Q A;  1NE3 A;  3NEM A;  2HQL A;  4AQY L;  1U4P A;  1LTG D;  3H3V I;  2K14 A;  5KYI A;  3RLO A;  1SYB A;  1CM9 A;  1PLF A;  5NUC A;  1T5X D;  2Q2H A;  5TSS A;  1SEB D;  1F2Y A;  3EJI A;  4P74 A;  5ELO A;  4DR1 L;  1DOL A;  4BY7 B;  2F0F A;  1X3G A;  3PCO B;  1HH2 P;  4YWK A;  4DR7 Q;  2B2T C;  4CDD C;  4DR3 Q;  1IHZ A;  5IIF A;  5C44 H;  1XPO A;  3ULP A;  4NKL A;  1GM5 A;  2VY3 A;  1UWV A;  2QDL A;  1CKN B;  4QGU A;  3UDF A;  1X3F A;  2JEB I;  3I8Z A;  3NBH B;  1YIT A;  2AWN A;  3OPO A;  3QOL A;  1QUQ B;  4XDX A;  1KHI A;  2K5Q A;  4BA1 I;  2ZXO A;  2JJQ A;  1AP0 A;  1XMQ L;  4YCW A;  1GOZ A;  5T1I A;  1XMO Q;  1NJI C;  2RHQ B;  4GOP C;  1XJV A;  4CKE A;  5DAU A;  4B3R L;  3E6Z X;  2XSC A;  5LMU Q;  1TXY A;  2ZTC A;  4JI2 Q;  1LV9 A;  1A3V A;  1K0R A;  4RWS C;  4JI5 L;  4PZ7 A;  2JA6 G;  3AEV A;  3U9O A;  3I4O A;  1B1Z A;  4QQB X;  5GAD C;  1EYC A;  4LF7 L;  1QB5 D;  4KD3 A;  3CME A;  5M3F H;  4C3I H;  2ZTE A;  4IUN A;  3ICE A;  2RCN A;  1X6O A;  3I7F A;  4GN5 A;  4R8I A;  3VR2 A;  2UXC L;  2Z6K C;  2WAQ E;  1I50 B;  2F0I A;  3CPF A;  2UU9 Q;  1WFQ A;  2VB3 X;  2BA0 A;  3PV0 A;  1PZK D;  2F0P A;  2XRS D;  4A3K H;  1GUW A;  4IPD A;  3MHB A;  1V8Q A;  4OL7 A;  2NUC A;  4G7H C;  3HRZ C;  2L15 A;  1W6J A;  1L2F A;  4A3C H;  2Z0S A;  3MFY A;  5FO7 B;  3CCR A;  1XX8 A;  2NVQ H;  1I6V C;  3SK4 A;  4LWC A;  4DR2 L;  5I2X A;  1BKB A;  1MI2 A;  4KN4 C;  5EPK A;  2R7D A;  2K04 A;  1VQO A;  4XIG S;  3HKS A;  4R4T A;  3Q22 A;  5C0X H;  1VS0 A;  1B53 A;  4ZCK A;  1BVS A;  3I56 A;  1R9T H;  2NB0 A;  5LMU L;  4N9P A;  3R2T A;  4OON A;  4RHS A;  1JIC A;  4JI2 L;  4DK3 C;  2RCF A;  1IBM Q;  5KND A;  5CR3 A;  4DAM A;  1NR2 A;  4NB3 A;  4YWL A;  4HJ5 A;  2A68 D;  4ZAI A;  1V43 A;  4A3M B;  5DEH A;  1Z47 A;  5DNF A;  4EVO A;  2FFK B;  3C1E A;  1Q1B A;  2EVB A;  3TS2 A;  2QEJ C;  2Y0S G;  4DK0 A;  2UXD L;  4A75 A;  1HZ9 A;  1XTD A;  4YCV A;  2FHT A;  2MNA A;  1UNS A;  1F77 A;  1II3 A;  2EQS A;  2CH4 A;  1D2B A;  4L5Q A;  5ELF A;  1HXY D;  2NZO A;  5ELE A;  5EKK A;  3VR5 A;  3PGZ A;  4LF5 L;  1WTO A;  1UE5 A;  4GNX C;  2QW7 A;  4AYB G;  1IL8 A;  4C3H H;  5IT9 L;  5IP7 H;  3CPW A;  4CDF C;  3FRP B;  5A2Q L;  3GD7 A;  2N3S A;  4CJ1 B;  1JOK A;  2EY2 A;  1LT4 D;  4PV1 C;  3T16 A;  1BCP D;  5IGB A;  2JA5 G;  1LTI D;  2B3G A;  4M8A A;  2KCC A;  5GAH C;  2ZM6 L;  3S1Q H;  4R1J A;  2EY5 A;  3RN2 A;  4K0K Q;  4I65 A;  4NW2 A;  1KXL A;  1E1O A;  1F9R A;  5ELB A;  3HOY H;  3ERO A;  1GHK A;  1EWC A;  3FHW A;  4HMJ A;  4PZ6 A;  4J1M A;  2A6E D;  2CW0 D;  1GXD C;  4MNO A;  1X54 A;  3SVM A;  4KLK A;  4QUF A;  1Y1V G;  4RG1 A;  1IBM L;  1DXM A;  1TWF H;  3KBG A;  1RJT A;  5M3M G;  4JVZ A;  1WTP A;  2N49 A;  4KJO A;  1A6X A;  4EX5 A;  5JVG 3;  3S15 H;  5IT9 E;  4XYO A;  4NXN L;  5A2Q E;  1RDP D;  1X65 A;  2I46 A;  4EGV A;  2R7Z G;  1JJC B;  4C56 C;  4ID6 A;  3H0G H;  1Q3L A;  4POF A;  1SND A;  5DLQ E;  4DKA C;  1HUN A;  1TS4 A;  1SYF A;  2F0T A;  3CCV A;  5M5X H;  3TN2 A;  1PH6 A;  4DV2 Q;  3CCM A;  2KCT A;  3D3R A;  4MN3 A;  2CWP A;  3F2B A;  2F0D A;  4V0B A;  1TY2 A;  3A7L A;  2DGY A;  2RBM A;  4C2M H;  3S1M H;  2HHH L;  1EIY B;  4DR6 Q;  2JEA I;  3UDX A;  5C3E H;  3CRL C;  2K5H A;  1TS5 A;  3V05 A;  1H9J A;  2BE5 D;  1L1O A;  2N78 A;  3IFT A;  3WOE A;  2B39 A;  2NWG A;  2ZXR A;  2A69 C;  1STY A;  2IX3 A;  4A3B G;  3D4R A;  4JCV E;  1SSO A;  3CU7 A;  2O5I C;  3ULJ A;  4MTK A;  1F2Z A;  4GOP B;  1VQG A;  1LYL A;  4HSP A;  4K5X A;  5KGU A;  4OO1 G;  1A63 A;  3HOU G;  1K28 A;  3NXW A;  4RMF A;  2JA7 H;  2NBF A;  2PNH A;  4NPS A;  4KY5 A;  1O7Y A;  1GKH A;  1EFW A;  4RCO A;  4U68 A;  3SHL A;  5H1S E;  3CCS A;  4LFC Q;  1C8C A;  3FKI B;  1UE1 A;  3HKZ E;  5IYD H;  1L0Y B;  3A55 A;  2DN8 A;  3AFQ A;  4BBR H;  1Q46 A;  5I2Y A;  4DV2 L;  1PXU A;  1WTW A;  3GTP B;  2LXJ A;  1PFB A;  1X3P A;  2DY8 A;  1MD2 D;  2N55 A;  3N6R A;  1CSQ A;  1E0B A;  3BU2 A;  4A93 G;  4B3M Q;  1VQE A;  4BY1 G;  1KAB A;  3D8G A;  4P72 A;  3H3V H;  1QCB D;  1SE2 A;  5C4X H;  3K7U C;  4L5R C;  1JJG A;  5FJ8 H;  4DV1 L;  5M5W B;  1PZJ D;  2HDM A;  3VA7 A;  5IYB G;  3OTO Q;  4AYB E;  1EWI A;  2NZ1 D;  4ODG A;  2PPB C;  3J81 c;  3TRZ A;  1G2T A;  3NSW A;  1BF4 A;  3I3C A;  4BBS H;  1U5K A;  4A3J G;  1CZW A;  5KIX A;  1PTO D;  1SN8 A;  5ELN A;  4DXF A;  1XPR A;  3HOW B;  4KKS A;  1VQ4 A;  1QWY A;  3OIQ A;  1VQ6 A;  3MZ5 A;  4DAY B;  3A7A B;  3KDF A;  3QWN A;  3G48 A;  5M3F G;  4ULL A;  4C3J B;  3OSO A;  4I7A A;  2ZJP A;  4LFC L;  2L11 A;  4UP8 A;  1PDQ A;  3EN2 A;  2YTV A;  3I4M B;  1UEB A;  3I4N B;  5C5M A;  2A6H C;  1NBW A;  3U9S A;  1CQV A;  3VA5 A;  3MWY W;  4NP5 A;  1D8L A;  3G6E A;  1VMP A;  1PH7 A;  5D3I B;  4B3M L;  3PO3 B;  1PZI D;  4ALP A;  3CCL A;  3SK5 A;  3AB9 A;  1WJJ A;  1DOM A;  4GNX B;  1RCV D;  1HUM A;  4QB4 A;  4HJ8 A;  1AEX A;  2SNM A;  3P75 A;  2VUM G;  3IRB A;  2NN6 H;  3CCJ A;  3HOX H;  3M4O B;  1CI3 M;  5KRU A;  1OXU A;  5IYC H;  5IP9 G;  4OGQ C;  3AYH B;  2DY7 A;  4DUY Q;  5IGD A;  3GTO H;  4R4O A;  1F9S A;  1L0W A;  1I4R A;  1JJ2 A;  4DV5 L;  1M90 C;  2JA8 B;  1KDB A;  4JI0 Q;  1N9W A;  1ESF A;  3QB3 A;  1MJE A;  4HCS A;  1K0S A;  2CCZ A;  4DV6 Q;  2ENB A;  2EY1 A;  3NHH A;  4DNI A;  4APV A;  3QG1 A;  3TDQ A;  1MIU A;  1QUQ A;  1K8G A;  1A2T A;  4J6H A;  3C3L A;  4C1N I;  4A3D H;  5EGT A;  5FLX c;  1BBX C;  4GLX A;  2B2U C;  1OXX K;  4IZ8 A;  1FNU A;  3T1Y Q;  3GTJ B;  2LKV A;  4MIU A;  3TS0 A;  5FK9 C;  3CCE A;  5IP7 G;  1AW7 A;  1SR3 A;  4GN4 B;  1HHV A;  1IBK L;  3URY A;  2B29 A;  3GTQ B;  1A15 A;  1B7Y B;  3G7L A;  5CV7 A;  3F8T A;  1UE6 A;  3S16 H;  3RLF A;  1XPU A;  1WI5 A;  3OMG A;  2EJF C;  1LTB D;  1JOO A;  1PYB A;  3MXG A;  3TP7 A;  2PI2 E;  2L12 A;  5JVH 3;  3NEN A;  1N8R C;  1Q7Y C;  1ENF A;  4KKU A;  1R4P B;  1BCP F;  1EZ6 A;  4IOC A;  4JI0 L;  2AHO B;  4OWX B;  5JAV A;  5IGC A;  2YU9 B;  2K28 A;  4L63 B;  4CDE C;  2H4O A;  4F87 A;  4DV6 L;  5K36 H;  1DJR D;  2NVY H;  4HJ9 A;  2BH2 A;  1XYI A;  2F3V A;  2D9U A;  2NVT H;  1F2L A;  1TQO A;  1N34 Q;  3CC7 A;  3SDZ A;  4HIO A;  1NR4 A;  4KKT A;  5KEE A;  1SE3 A;  2MQH A;  3KBX A;  2X6L A;  1TKW B;  2AQ2 B;  3ONA B;  4DXG A;  2ES2 A;  3MXU A;  1NSN S;  3STB D;  4POG A;  3T1Y L;  3SXH A;  2JK8 A;  4A3F B;  4KY6 A;  1EQR A;  2F0V A;  4JI7 L;  4H02 A;  2IPK D;  5IE8 A;  5L37 A;  3HOV B;  5C6A A;  2R93 G;  3MA2 B;  5LMN Q;  4OWW B;  5C3E G;  3TBI B;  1WYD A;  3PO2 G;  1RD9 D;  2UUA L;  3S2H B;  2ZJQ A;  2NVX B;  3DMU A;  1HQM C;  1W3S A;  5FLM H;  2A68 C;  3EIV A;  1EY0 A;  1VQA A;  4BY7 H;  3S14 B;  2E2H B;  2B8G A;  3TZU A;  1I5F A;  3W2D A;  1DOK A;  4DV7 L;  4HN7 A;  1JC7 A;  1G6Z A;  4S3S A;  2O2L D;  1J9O A;  2Z4I A;  3EA6 A;  4JK1 C;  3J7A V;  1FVI A;  3HZX A;  2EYM A;  5E4X A;  4LUZ A;  3J80 c;  4N8X 1;  2BDN A;  1N34 L;  5FKA C;  2PI2 A;  4DV0 L;  1ENC A;  5LMN W;  2PMZ E;  2C35 B;  3K59 A;  1HZA A;  4JPB W;  1E1T A;  2B2W A;  4ZKB B;  1BCP C;  1Q1E A;  5CBE E;  1C9O A;  2ALY B;  1MGS A;  5I9P A;  1E22 A;  4PZ8 A;  5JJL A;  1XWE A;  4IFD H;  1QVC A;  3ERQ A;  2WAQ G;  3DUZ A;  4IPG A;  3EVQ A;  4UP7 A;  2A6E C;  2CW0 C;  1Y14 B;  2IHF A;  3OYY A;  3PUY A;  4UP9 A;  4FYD A;  4DUZ L;  3K5N A;  1O7L A;  1HA5 A;  1TWH B;  3KF6 B;  2JA6 B;  2SDF A;  1YHQ A;  1E2W A;  3L9A X;  3KF8 A;  4RCN A;  4XQJ A;  3SEB A;  3M7N A;  4V19 0;  3GTL B;  2PQA A;  3CXC A;  1JMC A;  3CF5 A;  3PUX A;  4X3K A;  1SYE A;  2M2L A;  1AZQ A;  1JCK B;  4RGO S;  3OW2 A;  4TVA B;  1ML0 D;  1XMQ Q;  2BDO A;  4CKC A;  1LTA D;  4UY8 C;  4DFA A;  2Z8L A;  3SR1 A;  2B2V C;  2PYK A;  4EQP A;  2LXK A;  2J4X A;  1KRT A;  1CKO A;  4L6T B;  1AH9 A;  4A3L H;  1A2U A;  2Q2I A;  4QIW B;  1W6K A;  4ZLT F;  5I6Y A;  3BS1 A;  1K73 C;  5BN4 A;  2EXZ A;  3BVM A;  5AJ3 Q;  4JI5 Q;  3A5Z B;  2BE5 C;  3Q6S A;  4JBK A;  1RTO A;  4H13 C;  4R8N A;  4RGN A;  1K3R A;  3D6C A;  3UI2 A;  3R93 A;  2B2Y C;  2CH4 W;  2IX0 A;  2HIV A;  3DEP A;  1HNW Q;  4LF7 Q;  2GVA A;  4HTH A;  4IAL A;  2Q8T A;  3VR4 A;  5D65 A;  1U4M A;  3FPU B;  4HR7 B;  1G51 A;  5BN3 A;  5JPN C;  4KN7 C;  3MAQ A;  3RZD B;  2UXC Q;  3M3Y B;  1K9M C;  2HUG A;  1TU2 B;  3MTS A;  3MC0 B;  5C5L A;  1SMX A;  1HR0 L;  4A3E G;  3ER0 A;  4O1N A;  2Y0S B;  2N8N A;  1WTQ A;  4JOI C;  1OO9 B;  3BJU A;  5C4Z A;  4FO2 A;  3TZD A;  4GS3 A;  2ID0 A;  3PUV A;  3R2I A;  3C2P A;  1IKL A;  3H09 A;  4FDB A;  4DR2 Q;  1STB A;  3TP5 A;  4G7O C;  5C3X A;  4DU9 A;  2WFW A;  4ME5 A;  1PFN A;  4AYB B;  1YNJ D;  4GKJ L;  1BDO A;  3P1H A;  5J22 A;  1SRU A;  3FP9 A;  2UXB Q;  2JA5 B;  5AJ3 L;  3H94 A;  2F0G A;  1IYU A;  5E3F A;  3NPP A;  2KA7 A;  4LW1 A;  3E0E A;  1CSP A;  3M9B A;  3OHX C;  5JEA H;  4IPH A;  4UHV A;  1HNW L;  3SK8 A;  3JAM L;  1A3U A;  5FO8 B;  2NN6 I;  2UXD Q;  3VYR A;  5K5P A;  3DLL A;  1PTO C;  5GQO A;  1Y1V B;  2MP1 A;  3VYU A;  5M3M B;  3BDO A;  3D0F A;  5HUR A;  3BZK A;  1T5E A;  4LF5 Q;  4DGZ A;  3AQQ A;  3MXP A;  3U50 C;  2F4V Q;  3ZYY X;  4R4Q A;  1EQT A;  1ASZ A;  2R7Z B;  3U4V A;  4PQX A;  2QDB A;  1ZXT A;  5JOB A;  1LTT D;  3CRK C;  4KJN A;  1I4P A;  3NTI A;  3JC6 6;  1PH2 A;  3VDY A;  2ZM6 Q;  1B8A A;  1LM0 A;  3JAM E;  1JT8 A;  4GNX A;  1EYG A;  4RFB A;  2R92 G;  1SNC A;  3GV3 A;  4JI4 Q;  4HID A;  2UXB L;  2F0M A;  3IL8 A;  1V1Q A;  4JI6 Q;  4ZQ3 A;  3HKZ G;  2ATW A;  1Q90 A;  1VQM A;  2F0J A;  1BCP B;  4RAU C;  4NXN Q;  1I6H B;  2F0S A;  3RLN A;  2JP1 A;  3DWP A;  3DWQ A;  4A76 A;  3CW2 C;  3S1N B;  4A3B B;  2B63 G;  3QR8 A;  4K2L A;  2ICE C;  1XNR Q;  1JOR A;  2GA4 B;  3B6Y A;  2VQE L;  4I7Z C;  3FKI H;  1M4V A;  1TWA B;  2ICI A;  1WTR A;  5CV8 A;  3HOU B;  5G3L D;  5EQ0 A;  1M8A A;  1V1P B;  4WOR A;  4LAA A;  2F4V L;  1U9R A;  5EKL A;  1PH8 A;  4ZYS A;  3GTP H;  2JQO A;  1TY0 A;  3DXJ C;  4DF7 A;  4X66 Q;  4A3G G;  2MGS A;  2A5H A;  2WB1 E;  2QEX A;  1B70 B;  1VQ5 A;  3KOJ A;  2HHH Q;  1EY6 A;  4QUC A;  1N36 Q;  1FNW A;  3K57 A;  3ERS X;  1V1O A;  4FXD A;  2Q2T A;  5M5W H;  4JBM A;  1X56 A;  1SYC A;  1QZG A;  2RVL A;  1EY4 A;  4JI4 L;  4A93 B;  4LUV A;  1PRT D;  2KOL A;  4BY1 B;  2F0W A;  4JI6 L;  1A0I A;  3K0Y A;  1TWG B;  2Z9H A;  4IO9 A;  4L5T A;  1IZ6 A;  3HOW H;  5E1F A;  1PH5 A;  3W1B A;  3NUC A;  1XNR L;  3Q8D A;  4MHE A;  1VQ9 A;  4FXG C;  4C3J H;  2KJX A;  4X62 L;  1EIH A;  2A1A A;  2BH8 A;  2LSS A;  2DJG C;  4A3J B;  1A8V A;  3I4M H;  2ZT9 C;  4CGY B;  3I4N H;  4X66 L;  2K03 A;  3HOZ G;  3T51 B;  1SMY D;  4BXX G;  2R7F A;  4UPA A;  2AKW B;  3PO3 H;  3T53 B;  3F1Z A;  1N36 L;  3V2T A;  5ELC A;  2G9H D;  4DV1 Q;  3RZO B;  3RD4 A;  4FXK C;  3LGJ A;  2E2I B;  5D3D A;  3M4O H;  3UE0 A;  1BXT A;  3H3V C;  1HZB A;  4K6L A;  4DK6 C;  3K58 A;  4A3I G;  4X6A H;  3J81 L;  3NEL A;  1WCM G;  3J7Z C;  1ESR A;  4OIK A;  4RGM A;  1JB7 A;  3BYY B;  1YJN A;  3H15 A;  4YY3 Q;  1QJO A;  2VUM B;  4IFD I;  1D1I A;  3TRE A;  4EQO A;  3FVQ A;  3A5U A;  3NE5 B;  4DAV A;  1Y1W H;  2EDG A;  1K83 B;  3TQY A;  5BR8 L;  1X3E A;  1R9T B;  2AUJ D;  2NZH A;  3GTK H;  2EJM A;  3GV6 A;  5CV6 A;  1STG A;  4IJL A;  2KHJ A;  1GUT A;  4FF3 A;  4F88 A;  3CCU A;  1B44 D;  2J0T D;  2OQ0 A;  4IUU A;  5C44 G;  2PMZ B;  2OT2 A;  1VQK A;  2RA4 A;  1Q82 C;  1PMR A;  1PTO B;  1SE4 A;  1JQY D;  4E6I A;  3KYH C;  3GTJ H;  3K5L A;  1ENA A;  1YI2 A;  1CK1 A;  3K7A B;  1YBY A;  1YHB A;  2K7V A;  2EXD A;  3M7G A;  4XQN A;  3GTQ H;  4LF4 L;  2E2J B;  2I5H A;  3DEO A;  1XXG A;  3WOF A;  2MUY A;  1NNX A;  5AFW A;  4JV5 L;  2VZA A;  2SNS A;  3J81 j;  2K50 A;  1L1O C;  4QF4 A;  1VQ8 A;  4DV5 Q;  4DR4 L;  4YY3 L;  2LFN A;  2XWJ B;  5IGG A;  1PFS A;  5C4H A;  3LNN A;  2YU9 H;  1STE A;  2MFI A;  1B9M A;  3MXN B;  5M5Y B;  2PZW A;  1S4Z A;  4TRD A;  1VQI A;  3I90 A;  4C3I G;  3MVV A;  3NQT A;  5E4W C;  2K32 A;  1UEA B;  1I3Q B;  5CGK A;  4GN3 B;  1BR9 A;  1BUV T;  1OXV A;  1E7Z A;  4QY7 A;  3S2D B;  1WTH A;  1VQP A;  3GO5 A;  3G71 A;  3GTG B;  1ET9 A;  5FLX L;  4A3K G;  4HIM A;  4PMB A;  1EOT A;  1Z6H A;  4A3F H;  1EEF D;  4A3C G;  4RA8 A;  1IBK Q;  4XTC S;  2J7Z A;  3HOV H;  2YTY A;  1GUG A;  1S5F D;  1KRS A;  2UUB L;  2I0Q A;  3LWU A;  1EWH A;  1EEI D;  3S2H H;  5C0X G;  1NAP A;  2PQE A;  1E2V A;  5HGT A;  4HJ7 A;  4X3U A;  1PH4 A;  4B3T Q;  1C0A A;  1FYC A;  3V96 A;  2G5D A;  1M1K C;  1X32 A;  2K1B A;  1FJG L;  2R93 B;  5IY0 A;  4KI0 A;  5JJK A;  2IW3 A;  5FLX E;  2E2H H;  1S5B D;  3W1G A;  1FL0 A;  5C3E B;  3D4D A;  1LTR D;  3PO2 B;  1CKN A;  1C48 A;  3NBH A;  1K3B C;  1NUC A;  2FMM A;  5LHY 1;  2EYO A;  1EUJ A;  2PNR C;  1U4L A;  4KV6 A;  2CFM A;  3CAM A;  3BZC A;  1HQR D;  3E3X A;  1G2S A;  5DM7 3;  5EKI A;  1ZEQ X;  4R4I A;  3H6M A;  1VF5 C;  2KCN A;  3K8A A;  4HMI A;  1V9P A;  5LL6 X;  2F0K A;  4C3H G;  1Q81 C;  1KNA A;  4JI7 Q;  3QIA A;  2PCF B;  3K80 C;  1JWM D;  2C5C A;  1GUN A;  4BWG B;  1YNJ C;  2L1B A;  3RN5 A;  1PFM A;  1FR3 A;  1VF7 A;  1H95 A;  5EAY A;  3I72 A;  2UUA Q;  1Q12 A;  1H9M A;  4LJZ C;  4EQ5 A;  1ASY A;  5FOB B;  3L2P A;  2EJG C;  3IAY A;  5FO9 B;  3HOY G;  4B3T L;  2LS0 1;  3S9W A;  1RTN A;  1TWH H;  1SFO B;  1CZG A;  1CQF A;  1L0X B;  2EY6 A;  3A54 A;  2WAQ B;  4YCU A;  2JA6 H;  2GVB A;  1KAW A;  2CHB D;  4DV7 Q;  4CDC C;  1SJE D;  2VXW A;  3GTL H;  4XT1 B;  3H0G G;  1EY9 A;  2PZT A;  4Q5V A;  2IJ0 A;  3J80 L;  1NCV A;  3WWV A;  4DV0 Q;  1PRT F;  5F2D A;  2L55 A;  1CA5 A;  5IOD A;  5JPM C;  2D62 A;  1WVL A;  2RKS A;  1I4G A;  5C3W A;  3VR6 A;  2CKZ B;  1VQF A;  3DM1 A;  3VR3 A;  1VQB A;  3U4Z A;  2K5N A;  4UAI A;  3A74 A;  3PMF A;  2QIL A;  1O80 A;  1SNQ A;  1EQV A;  1S5D D;  1IBL L;  4DUZ Q;  3AFP A;  5IWA L;  4R9W A;  1SLJ A;  1NY4 A;  1EZ8 A;  2I07 B;  1LT6 D;  2KEN A;  4P2C B;  1VMC A;  1I94 L;  2DJF C;  3HFZ B;  2XN9 C;  4RKB A;  5GAE C;  4WRD A;  3PIP 3;  1EOV A;  2MJ8 A;  3OIP A;  1CT1 D;  3C46 A;  1PH3 A;  3RZD H;  2K4K A;  3M3Y H;  1GUS A;  3F2C A;  3JAM i;  2B8F A;  1DM0 B;  1EU4 A;  4YHH Q;  4KK7 A;  1G91 A;  1L1O B;  2IT1 A;  2L5T A;  4LMQ D;  2F3W A;  5C4J B;  2JA7 G;  1IYV A;  3M4Q A;  1MJC A;  1Y1W G;  4QL5 A;  4XXE A;  1K8O A;  1RF2 D;  1X55 A;  2AQ1 B;  4DV3 L;  3C1F A;  4J15 A;  5EJW A;  1PV4 A;  3HEJ A;  1WTV A;  4KTA A;  5IYD G;  3NWS A;  5ISR A;  4A3E B;  2VB2 X;  4BBR G;  3L0O A;  4MZ9 A;  4TSS A;  4CJ0 B;  3I70 A;  2K6A A;  3G4S A;  1VQL A;  4QJF A;  1BOS A;  2OXP A;  3K0X A;  2RQX A;  5JJZ A;  2EYL A;  2PW7 A;  4IPC A;  4ZKC B;  2JA5 H;  2UUC Q;  4PG3 A;  1HNX Q;  2EYP A;  3KJO A;  1HJP A;  3HS0 C;  4B9X A;  5C4X G;  1HTL D;  5FJ8 G;  2E8G A;  1HCZ A;  1PRT C;  1AE2 A;  3BYT B;  4OXP A;  2NTT A;  3KLW A;  1RIP A;  3X3N A;  2WIN B;  2SEB D;  1KC8 C;  2EE1 A;  5COR A;  2F03 A;  1B2T A;  3P20 A;  1OXT A;  1Y1V H;  1YIJ A;  1SE8 A;  4AH6 A;  5M3M H;  4O42 A;  1I50 H;  2IX1 A;  1VDZ A;  4LFB Q;  1ILP A;  1PYS B;  4BBS G;  4YHH L;  1HR0 Q;  2F0Q A;  3PIO A;  2KEE A;  2VW9 A;  2R7Z H;  5IOC A;  1WD0 A;  3L7Z C;  2VS1 A;  1IYJ B;  4B3S L;  4OX9 L;  2XTI A;  1LTS D;  2B2T A;  1D6E C;  2CQA A;  2DNC A;  3PIO 3;  1DGS A;  4LFA Q;  2HD3 A;  3FMC A;  1KD1 C;  1SMY C;  2CWA A;  4JOI A;  4X3S A;  2M00 A;  3QO2 A;  2OCE A;  2PO4 A;  1PTO F;  3KDF B;  4IUQ A;  4K14 A;  3S1R B;  4GKK Q;  4GKJ Q;  2B2W C;  3S17 B;  3FPP A;  2TSS A;  1SJH D;  5M9O A;  1ZYR D;  1TWC B;  4DNR B;  5A35 A;  3E0J A;  3ND9 A;  2UUC L;  5IGE A;  1HNX L;  4X65 L;  4GOP A;  1HR0 W;  1EY5 A;  1SXT A;  3BDL A;  4OWT B;  4A3M H;  1S40 A;  1I6H H;  2PW5 A;  2HT1 A;  2NN6 G;  3HOX G;  2R92 B;  4BS9 A;  3UE1 A;  2WB1 G;  3S1N H;  4A3B H;  5IYC G;  2F0O A;  1GHJ A;  5CC4 A;  3W3A A;  2ZTD A;  1IKM A;  3HKZ B;  1J5E Q;  4Y7N B;  4JBW A;  4OO1 H;  3CC4 A;  1TWA H;  2OQK A;  3HOU H;  4OEM B;  4LFB L;  2RSN A;  4DAP A;  1IL2 A;  3GTM B;  2JSO A;  4RKL A;  2V4D A;  2JE6 I;  2VNU D;  1S3O A;  4ABN A;  3Q23 A;  3CD6 A;  2K5V A;  2B63 B;  4IUT A;  5DM6 3;  1GJX A;  1U0L A;  3H91 A;  2Q2U A;  1QNU A;  2Z6K A;  3MEH A;  1AZP A;  1PVO A;  1AE3 A;  1H9R A;  2M9V A;  4R4C A;  1SYD A;  3U58 A;  1PA6 A;  2HDL A;  2K52 A;  4LFA L;  3T13 A;  1HRJ A;  3IFD A;  4A3D G;  2KVM A;  2JXM B;  1HNZ L;  1DZ1 A;  3T56 B;  4A3G B;  1WD1 A;  2QA4 A;  3S24 A;  4GKK L;  3GDE A;  5ELD A;  5GAG C;  4A93 H;  2X69 A;  5C0X J;  3CMA A;  2WP8 J;  4BY1 H;  1EL0 A;  3M85 A;  1TWG H;  2MPM A;  3EQL C;  4A4I A;  2X6G A;  3DM3 A;  5I4D A;  5KNC A;  1VQD A;  5IYB H;  3J81 i;  2DNE A;  2YYZ A;  4DAY A;  3MXN A;  2A8V A;  1KQS A;  2C9O A;  2QF7 A;  2VQE Q;  1BNZ A;  4KHV A;  1J5E L;  1QG7 A;  4A3J H;  2D0O A;  4WJ4 A;  1H9S B;  2ASB A;  4TKO B;  1YJ9 A;  2FXQ A;  3G6J B;  2Z6B A;  2NYZ D;  1KTK A;  3SK6 A;  4P75 A;  1LT3 D;  5K36 G;  1OXS C;  3TP8 A;  2EOT A;  2EZV A;  2V1C C;  4ZUI A;  1YVC A;  4K8I A;  4RGT A;  4P71 A;  5IGF A;  1JE5 A;  4DR7 L;  4WJ3 M;  4DR3 L;  1GVP A;  1EFI D;  4C1N K;  4HED A;  5EPJ A;  1EQQ A;  1GUO A;  3RZO H;  2L9H A;  2E2I H;  2YV5 A;  3HOZ B;  5T1G A;  3ZJY C;  1C4Q A;  1IXR A;  1TS2 A;  4K6D A;  2GN5 A;  3J7Y W;  1ZKO A;  4HAE A;  1GO3 E;  5CV5 A;  1WTX A;  4JI3 Q;  4MTN A;  1QVG A;  3J7A F;  1XMO L;  2VUM H;  1MSG A;  5HY6 A;  1YHA A;  1PH1 A;  1JB3 A;  4HSV A;  2IWH A;  2OEO A;  4AIM A;  3ND8 A;  1K83 H;  2HCI A;  4IN3 A;  4K2K A;  4A3I B;  1YNX A;  5IP9 H;  5FLM G;  3OW7 A;  3TP6 A;  3HG9 A;  3E5S A;  1WCM B;  3SE0 A;  3CQZ B;  5CBA E;  4X62 Q;  4NXM Q;  1HTP A;  1STH A;  2Z4H A;  2WKD A;  1PRT B;  4BY7 G;  1PHJ A;  4L8J A;  2KCM A;  4JYA Q;  3MEF A;  3JAM c;  2VQF Q;  1PTO H;  5EPL A;  2AQ3 B;  5E7N A;  2ZXP A;  1CHP D;  1HZC A;  3AMU A;  1U4R A;  2BOS A;  3K7A H;  4IQZ A;  5C44 B;  2RDH A;  3ITP A;  2E2J H;  1G8Z D;  1UE7 A;  2UU9 L;  3RR5 A;  2K5D A;  3VYT A;  3A8K E;  1TR5 A; 
#chains in the Genus database with same CATH homology
 3X3M A;  5CV9 A;  4IUV A;  2EPB A;  4F8M A;  1ET6 A;  1LAC A;  1G29 1;  4IFD G;  2RSO A;  1SNO A;  4CBV A;  2K05 A;  3N52 A;  1UUP A;  1RHP A;  4WFN 3;  3TSS A;  5I6W A;  1F2M A;  2QCP X;  2IL8 A;  4WJW A;  4BA2 I;  4DN4 M;  2Q8I B;  1VCI A;  4KD4 A;  2D2C C;  1D5X C;  1I4Q A;  1XTC D;  3M4Y A;  5EBC A;  5BN5 A;  2F0H A;  2F0U A;  5M3F B;  3OWF A;  4C3I B;  5COY A;  1SDF A;  3DWA A;  4KMU C;  3HGB A;  4Q0F A;  1ONL A;  2WV6 D;  3K5O A;  3KLS X;  2K01 A;  1IW7 D;  1LLR D;  2E74 C;  3NWT A;  1Y8N B;  1DYQ A;  1D1K A;  3A56 A;  4A3K B;  4KY7 A;  5KNB A;  1YNN D;  1DCZ A;  1JR0 D;  2NVQ B;  4G7Z C;  1LAB A;  1RKN A;  2EYF A;  2A74 C;  2FIN B;  4ZUJ A;  4G57 A;  4NMZ A;  4FF4 A;  1CFM A;  1Y8O B;  1SBB B;  1TT2 A;  4QCL A;  4XT3 B;  3J81 E;  4YIJ A;  3A8J E;  2K33 A;  2KUM A;  1STA A;  1CHQ D;  1MBY A;  3BVZ A;  1JOQ A;  1KDC A;  2LY7 A;  2R61 A;  4RH6 A;  3I4L A;  5LL6 S;  1TII D;  1ILQ A;  4DNT B;  1BQQ T;  4C3H B;  3NP8 A;  4ILW A;  4F7X A;  3NTK A;  3D6W A;  3BZD B;  4Z9C B;  3PUZ A;  3L3O C;  2RDG A;  2HCC A;  3S1Q B;  3R3O A;  3OWE B;  1TS3 A;  2G9D A;  4FP5 D;  5JEA G;  3OOC A;  3HOY B;  1FD7 D;  4B9W A;  1JWU D;  2PZU A;  2WAC A;  4EQN A;  1SNP A;  1TWF B;  2R6G A;  2XNA C;  1B9N A;  2H1E A;  3LWE A;  1LT5 D;  1EIG A;  4N9T A;  3S15 B;  1FNV A;  4XQQ A;  2AWO A;  4OO1 I;  1BO0 A;  4DK1 A;  3H0G B;  4HCE A;  4FF2 A;  5M5X B;  4X3T A;  1ZYR C;  2B2U A;  2KEC A;  1J8I A;  3PUW A;  1SNM A;  5J39 A;  4OIJ A;  4C2M B;  3S1M B;  1F9P A;  1KAA A;  4K8J A;  4K5V A;  2F1M A;  3QOJ A;  2F0N A;  2A73 B;  3CHB D;  5D14 A;  1HFG A;  2HQE A;  2LMC B;  1KLG D;  1CTM A;  1LO5 D;  4DA2 A;  1B4O A;  2JA7 B;  4U67 3;  1FGB D;  1Y1W B;  4PMW A;  3GTK B;  2F0L A;  1SYG A;  3KK7 A;  1UAP A;  1CA6 A;  2K5W A;  2MHV A;  2EYJ A;  4BBR B;  1I4X A;  3TME A;  4TQU S;  5G3L F;  5CMD A;  2WII B;  1B50 A;  1HA6 A;  1QIL A;  2E76 C;  3WDN A;  4H7B A;  5EBD A;  2L0C A;  2JYO A;  2SOB A;  1Z7T A;  4ZK9 B;  1DON A;  1H9K A;  4OHJ A;  5C4X B;  3FEW X;  1Q8I A;  2O4X A;  3IKJ A;  1H9S A;  5CYU A;  1E2Z A;  1Y69 U;  2FMC A;  4GZY C;  1TVX A;  5KYL A;  5C0X I;  4FVM A;  1K8M A;  4C3J G;  4IUR A;  4CHT B;  5CV4 A;  4BBS B;  3O13 A;  1S5E D;  2N88 A;  3F2U A;  3A8I E;  3LX0 A;  2KHS A;  4ZRZ A;  3KUP A;  4FNF A;  1B3A A;  2D5D A;  1EY7 A;  3RUZ A;  4UDU C;  3BG3 A;  2XRQ D;  3I91 A;  2WKC A;  3P7J A;  3KLS A;  2XVS A;  3CKI B;  1ROD A;  1QE6 A;  4IFD J;  1KNE A;  2AUK A;  1F9Q A;  3J80 E;  2Q8R E;  1X3Q A;  4H0L C;  3DHQ A;  3FDT A;  2L4N A;  3VYS A;  4PMC A;  2A69 D;  1O7Z A;  3T4A C;  4XYQ A;  3BVG A;  2KED A;  3K6O A;  2E75 C;  3NTH A;  3HOX B;  1V1P A;  2WB1 B;  4RHR A;  3EFX D;  3Q0A A;  3NBI A;  1AN8 A;  2KQ3 A;  3GTO B;  4B08 A;  5I9O A;  4LK1 C;  1HFN A;  5J1Z A;  1QOH A;  2CVR A;  3HP3 A;  1QNK A;  4H44 C;  1ICW A;  1EYA A;  1EY8 A;  1SAP A;  1HPC A;  3Q24 A;  3D31 A;  3MFG A;  2B2V A;  4J8Q A;  4A3D B;  3GP7 A;  3I73 A;  2RDF A;  4CKB A;  2QKI C;  4KHZ A;  1MSH A;  3QJY A;  4IUP A;  1JWS D;  3R8B A;  1Y8P B;  3OMC A;  2B2Y A;  2BCO A;  1R4Q B;  1I4H A;  4QMG A;  4K5W A;  3K5M A;  2F4I A;  4PNY A;  3RMH A;  3S16 B;  4CJ2 C;  2NTS A;  2EYH A;  2XWB B;  1AFP A;  3BDC A;  2TMP A;  1EU3 A;  1A3T A;  3GQB A;  2XIW A;  1KDA A;  1DD2 A;  3NK9 A;  2OF1 A;  4M1U B;  1IW7 C;  1O78 A;  2O5J C;  3AU7 A;  3D4W A;  2NVY B;  3NQI A;  1EYD A;  1KLU D;  1STN A;  2NVT B;  2A6H D;  2Z1C A;  1YNN C;  1D5Z C;  4NDX A;  4FF1 A;  2F0E A;  2BA1 A;  2R3Z A;  4G4K A;  2FJ2 A;  1D5M C;  1PYW D;  1S5C D;  1JE4 A;  3KLR A;  5JEA J;  2E2D C;  1U4P A;  1LTG D;  5KYI A;  1SYB A;  1CM9 A;  1PLF A;  5NUC A;  1T5X D;  5TSS A;  1SEB D;  1F2Y A;  3EJI A;  1DOL A;  4BY7 B;  2F0F A;  2B2T C;  1IHZ A;  5IIF A;  4NKL A;  2JEB I;  3I8Z A;  2AWN A;  3OPO A;  3QOL A;  4XDX A;  2K5Q A;  4BA1 I;  2ZXO A;  1AP0 A;  1GOZ A;  5T1I A;  4CKE A;  5DAU A;  3E6Z X;  2XSC A;  1LV9 A;  1A3V A;  4RWS C;  3U9O A;  1B1Z A;  1EYC A;  1QB5 D;  4KD3 A;  4IUN A;  4R8I A;  3VR2 A;  1I50 B;  2F0I A;  2VB3 X;  2BA0 A;  3PV0 A;  1PZK D;  2F0P A;  2XRS D;  1GUW A;  3MHB A;  1V8Q A;  4OL7 A;  2NUC A;  4G7H C;  3HRZ C;  1W6J A;  3MFY A;  5FO7 B;  1XX8 A;  1I6V C;  3SK4 A;  5I2X A;  1MI2 A;  4KN4 C;  5EPK A;  2K04 A;  4XIG S;  3Q22 A;  5C0X H;  1B53 A;  2NB0 A;  4N9P A;  3R2T A;  4RHS A;  1JIC A;  5KND A;  5CR3 A;  1NR2 A;  2A68 D;  4ZAI A;  1V43 A;  4A3M B;  5DEH A;  1Z47 A;  5DNF A;  4EVO A;  2FFK B;  3C1E A;  1Q1B A;  2EVB A;  2QEJ C;  4DK0 A;  2FHT A;  1UNS A;  1F77 A;  1II3 A;  1D2B A;  5ELF A;  1HXY D;  5ELE A;  5EKK A;  3VR5 A;  1WTO A;  1IL8 A;  5IT9 L;  3FRP B;  5A2Q L;  3GD7 A;  4CJ1 B;  1JOK A;  2EY2 A;  1LT4 D;  4PV1 C;  3T16 A;  1BCP D;  5IGB A;  1LTI D;  4M8A A;  2KCC A;  2EY5 A;  4I65 A;  4NW2 A;  1F9R A;  5ELB A;  3ERO A;  1GHK A;  1EWC A;  4HMJ A;  4J1M A;  2A6E D;  2CW0 D;  1GXD C;  3SVM A;  4QUF A;  1DXM A;  3KBG A;  1RJT A;  1WTP A;  4KJO A;  1A6X A;  5JVG 3;  5IT9 E;  4XYO A;  5A2Q E;  1RDP D;  2I46 A;  4EGV A;  4C56 C;  4ID6 A;  1Q3L A;  1SND A;  1HUN A;  1TS4 A;  1SYF A;  2F0T A;  3TN2 A;  3D3R A;  4MN3 A;  2F0D A;  4V0B A;  1TY2 A;  3A7L A;  2RBM A;  2JEA I;  3CRL C;  1TS5 A;  3V05 A;  1H9J A;  2BE5 D;  3IFT A;  3WOE A;  2B39 A;  2NWG A;  2ZXR A;  2A69 C;  1STY A;  2IX3 A;  3D4R A;  1SSO A;  3CU7 A;  2O5I C;  1F2Z A;  4K5X A;  4HSP A;  5KGU A;  4OO1 G;  3NXW A;  2NBF A;  4KY5 A;  1O7Y A;  4RCO A;  4U68 A;  3SHL A;  1C8C A;  3FKI B;  1L0Y B;  3A55 A;  2DN8 A;  5I2Y A;  1PXU A;  1WTW A;  3GTP B;  1PFB A;  1X3P A;  2DY8 A;  1MD2 D;  2N55 A;  3N6R A;  1E0B A;  1KAB A;  3D8G A;  1QCB D;  1SE2 A;  5M5W B;  1PZJ D;  2HDM A;  3VA7 A;  2NZ1 D;  4ODG A;  2PPB C;  1G2T A;  3NSW A;  1BF4 A;  3I3C A;  1CZW A;  5KIX A;  1PTO D;  4DXF A;  3HOW B;  4KKS A;  1QWY A;  3OIQ A;  3MZ5 A;  3A7A B;  3QWN A;  4ULL A;  4C3J B;  3OSO A;  2L11 A;  1PDQ A;  3I4M B;  3I4N B;  5C5M A;  2A6H C;  3U9S A;  1CQV A;  3VA5 A;  3MWY W;  4NP5 A;  1VMP A;  5D3I B;  3PO3 B;  1PZI D;  3SK5 A;  3AB9 A;  1DOM A;  1RCV D;  1HUM A;  4QB4 A;  1AEX A;  2SNM A;  3P75 A;  2NN6 H;  3M4O B;  1CI3 M;  5KRU A;  1OXU A;  4OGQ C;  2DY7 A;  5IGD A;  1F9S A;  1I4R A;  2JA8 B;  1KDB A;  3QB3 A;  1ESF A;  4HCS A;  2ENB A;  2EY1 A;  3NHH A;  3QG1 A;  3TDQ A;  1A2T A;  4J6H A;  3C3L A;  4C1N I;  5EGT A;  1BBX C;  2B2U C;  1OXX K;  4IZ8 A;  1FNU A;  3GTJ B;  2LKV A;  4MIU A;  5FK9 C;  1AW7 A;  1HHV A;  3URY A;  3GTQ B;  1A15 A;  3G7L A;  5CV7 A;  3RLF A;  3OMG A;  2EJF C;  1LTB D;  1JOO A;  3MXG A;  3TP7 A;  2L12 A;  5JVH 3;  1ENF A;  4KKU A;  1R4P B;  1BCP F;  1EZ6 A;  5JAV A;  5IGC A;  2YU9 B;  2K28 A;  4L63 B;  4F87 A;  2H4O A;  5K36 H;  1DJR D;  1XYI A;  2F3V A;  2D9U A;  1F2L A;  1TQO A;  3SDZ A;  1NR4 A;  4KKT A;  5KEE A;  1SE3 A;  3KBX A;  2X6L A;  1TKW B;  2AQ2 B;  3ONA B;  4DXG A;  3MXU A;  1NSN S;  3SXH A;  4A3F B;  4KY6 A;  2F0V A;  2IPK D;  3HOV B;  5C6A A;  3MA2 B;  3TBI B;  1RD9 D;  3S2H B;  2NVX B;  3DMU A;  1HQM C;  2A68 C;  1EY0 A;  3S14 B;  2E2H B;  2B8G A;  3TZU A;  3W2D A;  1DOK A;  4HN7 A;  1JC7 A;  1G6Z A;  4S3S A;  2O2L D;  1J9O A;  2Z4I A;  3EA6 A;  4JK1 C;  3J7A V;  3HZX A;  2EYM A;  5E4X A;  2BDN A;  5FKA C;  1ENC A;  3K59 A;  2B2W A;  4ZKB B;  1BCP C;  1Q1E A;  5CBE E;  1MGS A;  5I9P A;  1XWE A;  4IFD H;  3ERQ A;  3DUZ A;  3EVQ A;  2A6E C;  2CW0 C;  3PUY A;  4FYD A;  3K5N A;  1O7L A;  1HA5 A;  1TWH B;  2JA6 B;  2SDF A;  1E2W A;  3L9A X;  3KF8 A;  4RCN A;  4XQJ A;  3SEB A;  3M7N A;  4V19 0;  3GTL B;  3PUX A;  4X3K A;  1SYE A;  2M2L A;  1AZQ A;  1JCK B;  4RGO S;  1ML0 D;  2BDO A;  4CKC A;  1LTA D;  4DFA A;  2Z8L A;  3SR1 A;  2B2V C;  2PYK A;  4EQP A;  2J4X A;  4L6T B;  1A2U A;  4QIW B;  1W6K A;  4ZLT F;  5I6Y A;  3BS1 A;  5BN4 A;  2EXZ A;  3BVM A;  2BE5 C;  3Q6S A;  1RTO A;  4H13 C;  4R8N A;  4RGN A;  3UI2 A;  3D6C A;  3R93 A;  2B2Y C;  2IX0 A;  3DEP A;  4HTH A;  4IAL A;  2Q8T A;  3VR4 A;  5D65 A;  1U4M A;  3FPU B;  4HR7 B;  5BN3 A;  5JPN C;  4KN7 C;  3MAQ A;  3RZD B;  3M3Y B;  2HUG A;  1TU2 B;  3MTS A;  3MC0 B;  5C5L A;  4O1N A;  2Y0S B;  1WTQ A;  1OO9 B;  5C4Z A;  4FO2 A;  3TZD A;  2ID0 A;  3PUV A;  3R2I A;  3C2P A;  1IKL A;  3H09 A;  1STB A;  3TP5 A;  4G7O C;  5C3X A;  4DU9 A;  4ME5 A;  1PFN A;  4AYB B;  1YNJ D;  1BDO A;  3P1H A;  5J22 A;  2JA5 B;  3H94 A;  2F0G A;  1IYU A;  5E3F A;  3NPP A;  2KA7 A;  3OHX C;  5JEA H;  3SK8 A;  3JAM L;  1A3U A;  5FO8 B;  2NN6 I;  3VYR A;  5K5P A;  1PTO C;  1Y1V B;  2MP1 A;  3VYU A;  5M3M B;  3BDO A;  5HUR A;  1T5E A;  4DGZ A;  3MXP A;  3ZYY X;  1EQT A;  2R7Z B;  4PQX A;  2QDB A;  1ZXT A;  5JOB A;  1LTT D;  3CRK C;  4KJN A;  1I4P A;  3NTI A;  3JAM E;  4RFB A;  1SNC A;  3GV3 A;  2F0M A;  3IL8 A;  4ZQ3 A;  1Q90 A;  2F0J A;  1BCP B;  4RAU C;  1I6H B;  2F0S A;  2JP1 A;  3DWP A;  3DWQ A;  3S1N B;  4A3B B;  4K2L A;  2ICE C;  1JOR A;  2GA4 B;  4I7Z C;  1M4V A;  1TWA B;  2ICI A;  1WTR A;  5CV8 A;  3HOU B;  5G3L D;  5EQ0 A;  1M8A A;  1V1P B;  4WOR A;  4LAA A;  1U9R A;  5EKL A;  4ZYS A;  1TY0 A;  3DXJ C;  4DF7 A;  2MGS A;  2A5H A;  1EY6 A;  4QUC A;  1FNW A;  3K57 A;  1V1O A;  4FXD A;  1SYC A;  2RVL A;  1EY4 A;  4A93 B;  1PRT D;  2KOL A;  4BY1 B;  2F0W A;  3K0Y A;  1TWG B;  5E1F A;  3NUC A;  4MHE A;  4FXG C;  2KJX A;  1EIH A;  4A3J B;  2ZT9 C;  4CGY B;  2K03 A;  3T51 B;  1SMY D;  3T53 B;  3V2T A;  5ELC A;  2G9H D;  3RZO B;  3RD4 A;  4FXK C;  2E2I B;  5D3D A;  1BXT A;  3H3V C;  4K6L A;  3K58 A;  3J81 L;  1ESR A;  4OIK A;  4RGM A;  3BYY B;  1QJO A;  2VUM B;  4IFD I;  1D1I A;  4EQO A;  3FVQ A;  3NE5 B;  4DAV A;  2EDG A;  1K83 B;  1R9T B;  2AUJ D;  2EJM A;  3GV6 A;  5CV6 A;  1STG A;  1GUT A;  4FF3 A;  4F88 A;  1B44 D;  2J0T D;  4IUU A;  2PMZ B;  2OT2 A;  2RA4 A;  1PMR A;  1PTO B;  1SE4 A;  1JQY D;  4E6I A;  3K5L A;  1ENA A;  1CK1 A;  3K7A B;  2K7V A;  3M7G A;  4XQN A;  2E2J B;  3DEO A;  1XXG A;  3WOF A;  2MUY A;  5AFW A;  2SNS A;  4QF4 A;  2LFN A;  2XWJ B;  5IGG A;  5C4H A;  3LNN A;  1STE A;  1B9M A;  5M5Y B;  2PZW A;  1S4Z A;  4TRD A;  4C3I G;  3I90 A;  3MVV A;  3NQT A;  5E4W C;  2K32 A;  1UEA B;  1I3Q B;  5CGK A;  1BR9 A;  1BUV T;  1OXV A;  3S2D B;  3GO5 A;  3GTG B;  1ET9 A;  5FLX L;  4PMB A;  1EOT A;  1Z6H A;  1EEF D;  4RA8 A;  4XTC S;  2J7Z A;  1GUG A;  1S5F D;  3LWU A;  1EWH A;  1EEI D;  5C0X G;  1NAP A;  2PQE A;  1E2V A;  5HGT A;  4X3U A;  1FYC A;  3V96 A;  1X32 A;  2K1B A;  2R93 B;  4KI0 A;  2IW3 A;  5FLX E;  1S5B D;  5C3E B;  3D4D A;  1LTR D;  3PO2 B;  1C48 A;  3NBH A;  2FMM A;  1NUC A;  5LHY 1;  2EYO A;  2PNR C;  1U4L A;  4KV6 A;  1HQR D;  1G2S A;  5DM7 3;  5EKI A;  1ZEQ X;  3H6M A;  1VF5 C;  2KCN A;  4HMI A;  5LL6 X;  2F0K A;  4C3H G;  1KNA A;  3QIA A;  2PCF B;  1JWM D;  2C5C A;  1GUN A;  4BWG B;  1YNJ C;  2L1B A;  1PFM A;  1FR3 A;  1VF7 A;  3I72 A;  1Q12 A;  1H9M A;  4LJZ C;  3IAY A;  5FOB B;  2EJG C;  5FO9 B;  2LS0 1;  3S9W A;  1RTN A;  1SFO B;  1CZG A;  1CQF A;  1L0X B;  2EY6 A;  3A54 A;  2WAQ B;  2CHB D;  1SJE D;  2VXW A;  4XT1 B;  1EY9 A;  2PZT A;  4Q5V A;  2IJ0 A;  3J80 L;  1NCV A;  1PRT F;  5F2D A;  2L55 A;  1CA5 A;  5IOD A;  5JPM C;  2D62 A;  1WVL A;  2RKS A;  1I4G A;  5C3W A;  3VR6 A;  3DM1 A;  3VR3 A;  4UAI A;  3PMF A;  2QIL A;  1O80 A;  1SNQ A;  1EQV A;  1S5D D;  4R9W A;  1EZ8 A;  2I07 B;  1LT6 D;  4P2C B;  1VMC A;  4RKB A;  2XN9 C;  4WRD A;  3PIP 3;  2MJ8 A;  3OIP A;  1CT1 D;  3C46 A;  1GUS A;  2B8F A;  1DM0 B;  1EU4 A;  4KK7 A;  1G91 A;  2IT1 A;  2L5T A;  4LMQ D;  2F3W A;  5C4J B;  1IYV A;  4XXE A;  1K8O A;  1RF2 D;  2AQ1 B;  3C1F A;  5EJW A;  3HEJ A;  1WTV A;  4KTA A;  3NWS A;  5ISR A;  4A3E B;  2VB2 X;  4TSS A;  4CJ0 B;  3I70 A;  2K6A A;  1BOS A;  2OXP A;  2RQX A;  5JJZ A;  2EYL A;  2PW7 A;  4ZKC B;  2EYP A;  3HS0 C;  4B9X A;  1HTL D;  1HCZ A;  1PRT C;  3BYT B;  2NTT A;  3X3N A;  2WIN B;  2SEB D;  2EE1 A;  5COR A;  2F03 A;  1B2T A;  3P20 A;  1OXT A;  4O42 A;  2IX1 A;  1VDZ A;  1ILP A;  2F0Q A;  2KEE A;  5IOC A;  1WD0 A;  3L7Z C;  1LTS D;  2B2T A;  1D6E C;  2CQA A;  2DNC A;  3PIO 3;  3FMC A;  1SMY C;  4X3S A;  2M00 A;  2PO4 A;  3QO2 A;  1PTO F;  4IUQ A;  4K14 A;  3S1R B;  2B2W C;  3S17 B;  3FPP A;  2TSS A;  1SJH D;  5M9O A;  1ZYR D;  1TWC B;  4DNR B;  5A35 A;  3E0J A;  3ND9 A;  5IGE A;  1EY5 A;  1SXT A;  3BDL A;  2PW5 A;  2NN6 G;  2R92 B;  4BS9 A;  2F0O A;  1GHJ A;  5CC4 A;  3W3A A;  1IKM A;  3HKZ B;  4Y7N B;  4JBW A;  4OO1 H;  2RSN A;  4DAP A;  3GTM B;  2JSO A;  4RKL A;  2V4D A;  2JE6 I;  2VNU D;  3Q23 A;  4ABN A;  2B63 B;  4IUT A;  5DM6 3;  1GJX A;  3H91 A;  1QNU A;  3MEH A;  1AZP A;  1H9R A;  2M9V A;  1SYD A;  2HDL A;  3T13 A;  1HRJ A;  3IFD A;  2KVM A;  2JXM B;  1DZ1 A;  3T56 B;  4A3G B;  1WD1 A;  5ELD A;  2X69 A;  5C0X J;  2WP8 J;  1EL0 A;  3M85 A;  2MPM A;  3EQL C;  2X6G A;  5I4D A;  5KNC A;  2DNE A;  2YYZ A;  4DAY A;  3MXN A;  2C9O A;  2QF7 A;  1BNZ A;  4KHV A;  1QG7 A;  1H9S B;  4TKO B;  3G6J B;  2NYZ D;  1KTK A;  3SK6 A;  1LT3 D;  5K36 G;  1OXS C;  3TP8 A;  2EOT A;  2EZV A;  4ZUI A;  4K8I A;  4RGT A;  5IGF A;  1EFI D;  4C1N K;  4HED A;  5EPJ A;  1GUO A;  2L9H A;  3HOZ B;  5T1G A;  1C4Q A;  1TS2 A;  4K6D A;  3J7Y W;  1ZKO A;  4HAE A;  5CV5 A;  1WTX A;  3J7A F;  1MSG A;  1JB3 A;  4HSV A;  2IWH A;  2OEO A;  3ND8 A;  4IN3 A;  2HCI A;  4K2K A;  4A3I B;  3OW7 A;  3TP6 A;  3HG9 A;  3E5S A;  1WCM B;  3SE0 A;  3CQZ B;  5CBA E;  1HTP A;  1STH A;  2Z4H A;  2WKD A;  1PRT B;  4L8J A;  1PTO H;  5EPL A;  2AQ3 B;  2ZXP A;  1CHP D;  3AMU A;  1U4R A;  2BOS A;  4IQZ A;  5C44 B;  2RDH A;  3ITP A;  1G8Z D;  2K5D A;  3VYT A;  3A8K E;  1TR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...