1C4QA

Mutated shiga-like toxin b subunit (f30a/w34a) complexed with receptor gb3 analogue
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
69
structure length
69
Chain Sequence
TPDCVTGKVEYTKYNDDDTFTVKVGDKELATNRANLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Identification of the Primary Receptor Binding Site of Shiga-Like Toxin B Subunits: Structures of Mutated Shiga-Like Toxin I B-Pentamer with and without Bound Carbohydrate
rcsb
source organism Escherichia coli
molecule tags Toxin
molecule keywords PROTEIN (SHIGA-LIKE TOXIN I SUBUNIT B)
total genus 16
structure length 69
sequence length 69
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 1999-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1c4qA00
1CZWA 1D1KA 1C48A 1C4QA 1DM0B 2BOSA 4P2CB 3MXGA 1BOSA 1D1IA 1R4QB 1CQFA 2C5CA 2GA4B 4M1UB 1R4PB 1QOHA 2XSCA 1QNUA 4ULLA 1CZGA
chains in the Genus database with same CATH superfamily
1L0WA 4UDUC 1VQPA 4QY7A 1B1ZA 5IP9G 1XYIA 3A5ZB 3M3YB 4JK1C 1SJED 4DR6Q 1ONLA 1VQ5A 2QEJC 4OELB 1KL9A 2RF4A 4OONA 4CKEA 4A3KG 4IFDI 1JOKA 1SNOA 2QDBA 2JEAI 4LF6Q 2MGSA 4IUPA 3CCEA 1TY0A 1MBYA 3A8KE 3JAME 4ODGA 3VR2A 2A6ED 2Z9HA 1WCMG 2R93G 4DK1A 4A3GH 2OCEA 3SR1A 5IODA 1EZ6A 2OTJA 4YWLA 2F0UA 2DGYA 1B8AA 4POFA 5FKAC 2BH2A 3RN2A 2JA6G 5K5PA 1SNQA 1GUOA 3O13A 5I9PA 1XMOQ 1NBWA 2PCFB 2ID0A 2OXPA 2ICIA 4JI1L 3Q22A 2B63B 3UDIA 1VQHA 1HTLD 3NBIA 1EIHA 4OL7A 5COYA 3G4SA 4BWGB 1CZWA 1EIYB 2DNEA 4OHJA 4JW0A 2RHQB 4DXFA 4GNXC 1XNRQ 4A3BH 4HCSA 2OEOA 3SDZA 1HZBA 3H94A 1VQMA 5IGCA 3GTGB 1WCMH 1U4PA 1VQEA 4LUOA 3K7AB 1V9PA 1O78A 1PRTF 1NTGA 1O80A 3WWVA 4K8IA 1H95A 4R8NA 4DAYB 1X3GA 5JJIA 4LFCL 4NXNL 2RBMA 1STEA 4N9TA 3KJPA 3LGJA 4GLAC 3C2PA 2LKVA 4JI2L 1H9RA 4TVAB 1SJHD 2PI2E 5ELFA 4P73A 3TP5A 2XRQD 5JOBA 1PYWD 3UI2A 2BCOA 1SBBB 3KF6A 2CH4A 2UXBQ 5ELNA 4LUZA 2OQ0A 2CH4W 1EZ8A 3MXGA 2BDNA 4HN7A 2DNCA 4A3CH 5K36H 4V0BA 5CMDA 1W2BA 1N36Q 1QZGA 1TT2A 3GTOB 2VY3A 1BDOA 3H15A 1KQSA 4NB3A 4ID6A 4IJLA 4B3SL 2YV5A 2BH8A 2TSSA 2KVMA 1K8OA 2K01A 3D31A 3CC4A 1SFOB 2NVXH 2F0GA 3CC2A 2E2DC 2B3GA 1EQRA 1QUQA 2Z8LA 1E7ZA 2EDGA 1FVIA 3J81L 1RL2A 1U4RA 4H44C 3I55A 2OTLA 2DY8A 2NN6I 3KBXA 5EPLA 1VQ8A 1IYUA 3U4VA 5C4JB 2NVTB 4DK3C 4UPAA 4EQ5A 1JWMD 2NTTA 4J15A 3R3OA 5DM63 2Y0SE 1AE3A 2E74C 1HUMA 2HIXA 4MN3A 1NCVA 4A3MH 4A76A 2E2HH 3HS0C 3U9OA 2VB3X 1GUWA 4LW1A 4DV1Q 1PH3A 4LF8L 1A3VA 3RLFA 2KENA 4NKLA 2L12A 1EYDA 1JWSD 3H91A 1CKNB 3TSSA 3U9SA 1IBKQ 2OQKA 3BDLA 4YCWA 4RH6A 5EAYA 5BR8Q 5CBEE 4LJZC 5DLQE 5EPKA 3SK4A 4TSSA 4FF2A 2NZHA 2EY6A 4G57A 4DKAC 1MGSA 5M5WB 2WP8J 1XNQL 2RDGA 4WJ4A 1JQYD 4RMFA 1L2FA 1CKOA 1S5DD 4PMCA 3NTKA 3PUXA 3FPPA 3NELA 2NB0A 4HSPA 4XYOA 1PZKD 3V05A 4IFDJ 2ZT9C 5CV8A 1PFNA 3HOYH 4DNRB 5M5XH 1CT1D 1X3PA 5DEHA 2KHJA 3IRBA 1VDZA 4DN4M 4YHHQ 4BY7G 3S15B 3CW2C 1CA6A 3CRKC 1G51A 1ZEQX 3SK5A 1JB7A 4KKUA 1U0LA 4MIUA 1PH7A 2PNRC 3V2TA 1VMPA 2HQEA 3J80i 4YWKA 1EEID 4IUNA 2ZXPA 1HR0L 2F0JA 3AFQA 1LT6D 4XQQA 4ZQ3A 1DGSA 4IO9A 1ZXTA 4ZYSA 2HD3A 4GS3A 1YIJA 2F0PA 2EYFA 1G2SA 2JA5B 3PV0A 5HURA 1C7YA 1AN8A 2LY7A 3BVGA 2JE6I 1X54A 3CCQA 1Y1WH 1XTDA 3RZOB 4MTKA 3Q6SA 4FF1A 5KNCA 5JEAJ 5C0XG 3X3NA 1VQ9A 5LMNQ 4FF3A 2JA7B 4NMZA 1VQFA 3AMUA 2O5JC 5IOCA 2KCTA 2PPBC 1NSNS 1UE6A 4LF7Q 3W1BA 4CDDC 2L4NA 1YJNA 2XRSD 5AJ3L 4JOIA 2E75C 4CGYB 4X3TA 5CV4A 2WAQB 1ET9A 2SNMA 3OSOA 1NMGA 1BBXC 1SYGA 2D0PA 3K81C 5IE8A 4C1NK 1TXYA 3IKJA 5H1SE 3K5MA 3I4LA 4OX9Q 2RSNA 1TWFB 2AQ1B 4DNIA 1TWHB 3K7AH 5IYDH 3GTLH 1KC8C 2F0IA 2IY5B 1D2BA 1IYJB 1DXMA 3E0EA 2KHIA 5C0XH 1PYBA 1QE6A 4DAYA 3S17B 1FNWA 1T5XD 2N3SA 4BBSB 3HKZE 3AEVA 3S15H 1K0RA 5CGKA 1LM0A 3KUPA 4X64L 2WACA 4IJHA 3W5OA 3U58A 2WFWA 1V43A 3OWEB 1LT5D 3HP3A 4UP7A 4DV6Q 1HNWQ 2BE5D 3W1GA 1TWHH 5GROA 2JA7H 2HHHQ 4R4QA 1EY7A 1B2TA 2CVRA 3J81E 3DWAA 2I5MX 4L6TB 4K2KA 4GLVB 5FO9B 4JI2Q 3TP6A 2K6AA 4LFAL 5F2DA 1LLRD 4RG1A 2EJGC 3I70A 1Z9FA 3KDFB 3TBIB 3M4OB 4JI6Q 2TMPA 2UXDQ 2B2WA 2XGTA 2B8GA 3NTHA 5D14A 4I7ZC 3FRPB 1S4ZA 1TY2A 2UU9Q 1Y14B 2JA5H 2PYKA 4BXXH 4IFDG 4LF8Q 4KHPQ 4R8IA 1JE5A 3OHXC 5EJWA 3BZKA 5C4XB 1PFMA 2JJQA 4YCVA 4JBJA 2EYLA 2C9OA 2I5LX 1MJCA 1JJCB 3DM3A 5I2XA 2O2LD 4DV3L 1FJGQ 1EWIA 1ZYRD 4IN3A 4ULLA 2YU9B 4APVA 2VB2X 1EYAA 1UUPA 2IHFA 5D3IB 4JI4Q 4PZ6A 3VA5A 2UXCQ 4HEDA 2Q2TA 1CK1A 1WTOA 1STHA 3RUZA 5J22A 1G291 1Q7YC 5E1FA 1CSPA 3S24A 1KNEA 3J7AF 5FK9C 4K2LA 2QGQA 4DAMA 1PH8A 1V1OA 1LACA 5DAUA 3CU7A 3E3XA 1D5MC 1EY5A 4IUVA 1NUCA 1VQ7A 4RA8A 3E6ZX 1K8MA 3HKZB 1VQKA 5G3LF 4QQBX 3OPOA 4J8QA 4JI5L 2HHHL 4RWSC 4DV5Q 1F2YA 4MTNA 4Q0FA 5ELOA 3KJOA 2KCCA 2VZAA 3BDCA 4P2CB 5M5WH 3C1FA 3E9IA 1BOSA 2RSOA 1HZCA 5CV5A 2EYJA 2K75A 4DR5L 2A1AA 2AWOA 2WAQG 3HOWH 1YVCA 1NR4A 3UDXA 2KCNA 3ER0A 2ENBA 5GADC 4A3IB 1LABA 3S2HH 1DOKA 2LMCB 4R4OA 3ZYYX 1PZJD 4JVZA 3T1HL 3L0OA 1IBML 1AW7A 4ME5A 1S5FD 1TQOA 1V8QA 2EJMA 5CV7A 3VDYA 1VQBA 2JA7G 1HA6A 2EYMA 1SROA 3GTPH 1Y1WB 1PDQA 4XQNA 1HQRD 4A3BG 1K83B 2E2HB 1KXLA 3I56A 4HJ8A 4ZRZA 1M90C 2RKSA 1VQCA 3GTKH 4XYQA 3C1EA 2MHVA 4QCLA 1ILQA 2F0VA 3KLRA 4LF4L 3UDFA 1SNPA 1GJXA 5E4XA 5IWAL 2Z4IA 5KNBA 4BY1B 2XIWA 4DGZA 5A35A 1UWVA 3M7GA 5J1ZA 3A8JE 1YEZA 2ZTCA 4K8JA 3NQIA 3JC66 1T5EA 2YTVA 2EE1A 2ZXRA 4GNXB 1RD9D 1I94Q 5IT9c 3MFGA 1YNXA 1E2WA 4O2DA 2AQ3B 2Z0SA 4IUTA 5FLXc 3RN5A 2NZOA 4S3SA 1DJRD 4DR1L 1I94L 2NVTH 2VQFQ 1KHIA 5J39A 2VQEL 5IGEA 2BA0A 2R3ZA 3OOCA 3S2HB 3NE5B 1L1OC 5C5LA 3EA6A 1TS3A 5M5YB 2ZM6Q 4BY1H 4OO1I 1KDCA 3G6EA 1LTID 4PV1C 2F0DA 1BF4A 4N9PA 3T1YL 2A69D 2KEEA 4Y7NB 2HCCA 1JC7A 3H09A 3NBHB 4U68A 3P1HA 4X66Q 3CCLA 1D7QA 2VW9A 2BA1A 3ICEA 1K83H 3TREA 3I91A 1L1OA 2SEBD 2UUBL 2BDOA 3OWFA 1FYCA 3QWNA 1Q1BA 1OXVA 3H3VH 3N6RA 4JI8L 1HUNA 1J9OA 4A3JB 2EJFC 2Q2IA 5A2QL 1A15A 3E5SA 1IL2A 1JJGA 4GZYC 5KEEA 4YY3Q 3PUYA 2QEXA 2A69C 5DM73 1JWUD 1HR0W 5KGUA 1PRTB 3TS2A 4JBKA 3OIQA 4CDFC 1Y69U 1H9MA 4KKTA 3MC0B 5E4WC 4LMQD 3M4PA 4EQNA 5L37A 2MFIA 1K8GA 4A3KH 1ILPA 4UHVA 2K5WA 2N8NA 3IL8A 5EKLA 4EQOA 2L11A 1MJEA 5C44B 4C3HB 4DV2Q 5I6YA 4BY7H 3S1QB 5ISRA 3OMGA 2ALYB 3DXJC 3MXNB 4JI3Q 1QOHA 1HNZL 5ELBA 1I3QB 1CSQA 4F8MA 4JI4L 1JOOA 3J7AV 3SXHA 1JCKB 5GAEC 4HIMA 4NP5A 5M3FB 1L0XB 1BUVT 1W3SA 5I9OA 1V1PA 1SFOH 1YJWA 1EY8A 5IGBA 5IYBH 4I7AA 2UXCL 4GOPC 3TP8A 3DMUA 3H3VI 2FXQA 2UUBQ 1ZKOA 5TSSA 2VUMH 1U4LA 2B39A 3BZDB 1VQOA 4OWWB 2Z6KA 1PH5A 1KNAA 2ZTDA 4C2MB 4DV5L 2PI2A 3GP7A 5HGTA 3M3YH 4IPDA 1XPUA 4B3TQ 2FJ2A 3DM1A 1Y8PB 2B2YA 4QB4A 2UUCL 2R7ZH 1HJPA 3RZDB 1TIID 1IYVA 3GTQB 3LNNA 3HRZC 3JAMc 4G4KA 3ITPA 1SMYD 3OW2A 2NBFA 4FYDA 1X3QA 2CW0C 4YIJA 5EBDA 2R6GA 2D62A 3P20A 1I6HH 1QUQB 4POGA 4DR2Q 3J7YW 3H0GG 2WKCA 1UEBA 2F0FA 5FJ8H 3EROA 4FXGC 4IPCA 2WAQE 3I72A 2PMZB 2HDMA 1HR0Q 1VQIA 4KJOA 1JOQA 1LUZA 5KYLA 1DZ1A 3NXWA 1D6EC 2CW0D 4Y52H 4R4TA 2QW7A 4JBWA 4DV3Q 1STNA 3EVQA 3SHLA 2JSOA 2G9HD 1D1KA 1LTGD 3QIAA 5IP7H 4X3KA 1AZQA 3PIPA 5I6WA 1XNRL 3ERSX 4KD4A 2CQAA 3T56B 1CKMA 1QVFA 1YJ9A 1XNQQ 3GO5A 3S1NH 3GTQH 2K04A 2IWHA 1TWGB 2NVYH 1WTVA 4RKLA 4V190 3UDGA 4L8JA 2Q2HA 1SAPA 3F2CA 1X65A 5LMUL 3NBHA 3HOUB 2A74C 2R7ZG 1Y8NB 1KDAA 1F2ZA 2RHSB 3CQZH 2B8FA 3CXCA 4GN5A 3S2DH 3WOFA 3A7AB 3PGZA 3S1RH 4QMGA 1FL0A 4XXEA 2Z1CA 4DV2L 1WD1A 1SR3A 3J80L 1S3OA 4XIGS 2H1EA 2K33A 3D4RA 4H02A 2M00A 1K3BC 3BU2A 3I4NB 2R61A 1IBLL 4PMBA 5C3EB 1ESRA 1I4PA 4KMUC 3VYUA 2K4KA 3EIVA 1M8AA 3CMAA 2IL8A 1I4HA 2IX0A 4KTAA 1HRJA 3S1NB 3T1HQ 3CCSA 1YZ6A 2JXMB 1EFID 4HTHA 1ET6A 4H7BA 3PUVA 2R93H 1WOCA 4DV0L 3M4YA 3MXNA 4EQPA 4CKBA 1GOZA 4ZCKA 2Y0SG 3M4QA 3J7A5 4KKSA 2B2UA 2XSCA 5EGTA 2K5DA 1I4QA 1U9RA 4IPHA 4A3EB 1EU3A 3H0GH 2KBNA 1P16A 4IPGA 5A2QE 3T51B 5M3FG 4GKJQ 3GV3A 2F52A 2MUYA 4DR7Q 2F4IA 5JJLA 2V1CC 4DR5Q 1MD2D 4A3JH 1SE2A 2JEBI 1GXDC 1LTBD 3RNUA 3HZXA 2J7ZA 4KN4C 1DOLA 2EYOA 2DN8A 4GLXA 1HNXL 2JA5G 4IFDH 3BDOA 3CD6A 2A6HC 3G71A 3S1MH 1L1OB 3HOUG 1KAWA 4A93G 3DWQA 3F2UA 4C3HG 1PVOA 1VQ4A 2K32A 3PO3G 2VXWA 2EVBA 5C3WA 4RCNA 1Y1VH 2F0OA 4QL5A 4BBRH 5M5YH 2A5HA 2QILA 4R1JA 2EZVA 3CAMA 1F9PA 1O7YA 4B08A 1GVPA 4BS9A 3S1QH 4BY7B 3MFYA 5BN5A 2VNUD 3D6CA 2L1BA 4C2MH 4A3IH 4EX5A 3PQIA 1B70B 3FHWA 3I4MG 4X66L 3FEWX 2O4XA 4OO1G 2PNHA 3MTSA 4A3JG 1NNXA 1VS0A 2L55A 2X6LA 4B3TL 4K5WA 4FF4A 4BA1I 1MHWC 3K5NA 1BQQT 3E0JA 2PO4A 2BOSA 3T16A 2KEDA 4I65A 3SVMA 1W6KA 3I73A 3NEMA 4AIMA 1TWAH 2K7VA 1CHQD 2HUGA 2R92G 3CC7A 3TN2A 3D4WA 2B29A 2KECA 2RCNA 4YHHL 5IT9L 1F9QA 1S5BD 4PQXA 3SEBA 4DV1L 1NAPA 1SE4A 1SSOA 4KD3A 1A8VA 4LF5Q 2F0SA 2CCZA 1VQ6A 1X3EA 4AYBE 3K59A 1X55A 2UU9L 3PSIA 4Y7NH 4KI0A 5IP9H 4KHVA 4JI0Q 1DONA 4J6HA 4BBRG 3BVZA 3CCVA 1PLFA 2I07B 1PV4A 1EY9A 3BYTB 4BBRB 1PXUA 1X56A 2PZTA 2WIIB 3RMHA 3D6WA 4DK6C 1II3A 1PTOB 4DF7A 1GUNA 1PHJA 3PMFA 5GAHC 4IUQA 1DCZA 4JYAL 4F88A 3T13A 4B3SQ 2DJFC 2Q8TA 4CJ2C 5BN4A 1CA5A 3ONAB 1SN8A 2G9DA 1XPRA 3I4NG 1K28A 1NR2A 4O1NA 2ASBA 3SE0A 4RAUC 1KD1C 3L9AX 1PYSB 5IWAQ 1G6PA 3QOLA 1F2MA 1WTHA 4JI5Q 1QZHA 3GTJH 2NVQH 4RGNA 1Y1VG 4HCEA 4UAIA 4PG3A 3VR3A 2K5HA 3BS1A 4IQZA 2Y0SB 3F2DA 1EWCA 1H9SA 5LMNW 2IPKD 3S16B 2NN6G 4FO2A 4IURA 3PIOA 2RDFA 1TVXA 1SE3A 2ZJQA 1GHKA 1Q8KA 2EY5A 1JJ2A 2E2JH 3J80E 3FPUB 2JA6B 3I4OA 3QB3A 5M9OA 3A55A 2Z4HA 4C3IH 1EY4A 2E2IB 3MXUA 2R92B 5C4JH 2JA8H 4IALA 4JI0L 1MSGA 3D4DA 1BNZA 4L5RC 1F9SA 1O7LA 1U4MA 2IT1A 3KF6B 5ELCA 3MEFA 1Q12A 1WVLA 2GA4B 1SXTA 4A3EH 1WTRA 1XMOL 3F2BA 1KDBA 4OEMB 1N34L 4A3GG 2EPBA 3OYYA 4X64Q 1VQJA 4JI1Q 3WOEA 3S14B 3URYA 1K73C 5IGFA 1J6QA 2F3IA 1STAA 2F0WA 2P5ZX 4RFBA 2CFMA 5CYUA 4JC0A 4UP9A 1J8IA 1ENCA 4LNQA 2N55A 4A93H 2DY7A 3HOZG 3NHHA 2SDFA 2AUJD 4E6IA 4B3MQ 3K0YA 4L5SA 5JJKA 2E8GA 1KTKA 2IJ0A 2UUAL 4PZ7A 2VUMB 5JPMC 5C4XG 2MJ8A 2L9HA 1Z7TA 1H9KA 4XQJA 4B3ML 1GHJA 3PO2H 2XWJB 1JICA 2A8VA 4LF6L 3OW7A 5J3BA 2CQOA 1B9MA 3KF8A 1M4VA 1SNCA 2RDHA 1BO0A 5M3FH 1G2TA 2XN9C 2GN5A 2RVLA 2GVAA 4Z9CB 1BBWA 2IX3A 2L15A 4PZ8A 1VQGA 2CKZB 1JMCA 1DD2A 1JB3A 1S5ED 2G5DA 3QO2A 3H0GB 5G3LD 1AH9A 4DNTB 5T1GA 1RHPA 1WCMB 3A54A 4MZ9A 3HOZH 1I6VC 1WTQA 1X32A 2LS01 2N78A 3DUZA 1EQVA 1XWEA 1S5CD 4OGQC 4K0KL 3S2DB 4NW2A 1VMCA 3LWEA 4ZLTF 5BN3A 1PH9A 4LF9L 5K36G 1YHQA 1A0IA 4RHRA 3R2TA 3K6OA 1R9TB 1KRSA 2A73B 1K9MC 2JYOA 1FGBD 1SEBD 2X6GA 4FP5D 2I46A 1LTRD 4C3IG 3HOYB 2UUCQ 1IW7D 2RQXA 3LX0A 2JA8G 4LFCQ 2A68D 3JAML 4LFBL 4GOPB 4WFN3 2MQHA 1K8AC 5IGGA 4DAPA 1Q46A 4DA2A 1XTCD 3QR8A 1OXXK 1O7IA 4FVMA 1EYGA 2F03A 1GD7A 1NMFA 1I6HB 3CF5A 3PUWA 5IT9E 2K5QA 5C0XI 1JORA 4DR3Q 5FLMH 1E3PA 1BCPC 3S17H 1C0AA 4Q5VA 1XJVA 4XT1B 5E3FA 4AYBG 3FDTA 1IZ6A 3A5UA 1H9SB 1N32Q 3A7LA 5JVG3 1WD0A 2KOLA 2E2JB 5JVH3 2NYZD 1SYFA 4A3EG 1E24A 4HMIA 4K14A 5IP7G 1JE4A 2DUDA 1G6ZA 3VR4A 2WINB 2PW7A 2NUCA 3GDEA 4C3IB 3S14H 4JBMA 1NJIC 1BCPD 2KJXA 1AFPA 3KYHC 1HZAA 2RCFA 3GTJB 3T1YQ 2NVQB 1FGUA 4KY6A 1DOMA 3EFXD 4UY8C 1G8ZD 4JCVE 5KNDA 4BBSG 4RGTA 3PIO3 1QVCA 2B2VA 3STBC 1PRTC 1A2UA 3DWPA 1TWCH 4OIKA 4IOCA 1A3UA 2PQEA 2QF7A 1XMQL 2J4XA 2KCMA 4A3GB 5IIFA 3BG3A 5AJ3Q 2A6EC 5HY6A 4ZAIA 1EWHA 4QUCA 4BA2I 5T1IA 1XMQQ 4P71A 4DV7Q 2WB1B 1EL0A 3I7FA 4NPSA 3FKIG 3G48A 3VR5A 2NZ1D 2NVXB 3GTPB 1YHBA 4LAAA 5FO8B 3FMCA 4X3UA 1OTCA 2SNSA 2QA4A 1R9TH 1HFGA 2Q8IB 4A3DB 2A68C 1QWYA 2K28A 4TKOB 3FP9A 1I3QH 3BYYB 1ENFA 4DK0A 3L3OC 3AYHB 2K1BA 1L0YB 2QCPX 3ZJYC 3M85A 1SMXA 4JI7Q 2IW3A 4AQYQ 2MO0A 2JA9A 4DV4L 1C4QA 4A3IG 1VF7A 4HJAA 1WI5A 5LMNL 1EY6A 4DV6L 5ELDA 4OO1H 5E7NA 2K5NA 1PTOD 5JEAH 1AZPA 2VS1A 1VCIA 3ULPA 4HMJA 1WYDA 2PQAA 1F2LA 3TZUA 1WTWA 3HOVH 4HSVA 5CV9A 3KBGA 2XVSA 3DHQA 3P7JA 5HGQA 2FFKB 2I5HA 4G7ZC 4A3FH 1TWAB 5M3MG 4JI6L 2ATWA 3OTOL 1PTOF 3PIP3 3MAQA 1RTNA 1R4QB 1IKMA 3NUCA 1XX8A 3VYSA 2ZJPA 3TS0A 2ES2A 2VUMG 1V1QA 4A75A 3PO3H 1RDPD 4KHZA 1IHZA 4X3SA 4G7OC 1B50A 4LK1C 3AFPA 3RZDH 1TS2A 4GOPA 1BXTA 1AE2A 1DYQA 1STBA 3C3LA 4HJ5A 1XPOA 4A3DH 5D65A 4OX9L 4C56C 5GQOA 5KIXA 4K0KQ 2F0QA 5FJ8G 4RGOS 1D8LA 2EY1A 2J0TD 4CDCC 3HOWB 3ULLA 1F9RA 4F7XA 5EQ0A 3FKIB 2L0CA 3NWTA 3PF4A 2LXKA 1QJOA 3OIPA 1SYEA 3NK9A 4FDBA 2LXJA 1YI2A 1Q86C 3TQYA 1BVSA 3LWUA 2Z6BA 3SGIA 1ICFB 4QUFA 3KOJA 3E9HA 3HOXH 2QKIC 4GN4B 2E2IH 4CJ0B 1CHPD 1PZID 4HR7B 1S72A 1N33L 2K5VA 4JI8Q 1RODA 4LF4Q 2F1MA 3IFDA 2JQOA 3VYRA 1GM5A 5EPJA 2UUAQ 4RHSA 4PMWA 1N33Q 4N8FA 3J80c 1GUSA 3CHBD 3FKIH 2B2TC 5C44G 1WJJA 3HOYG 1UNSA 1I4GA 1PFSA 3I2ZA 1YNNC 4F87A 4ZKCB 5JEAG 5C0XJ 1IBKL 1LT4D 4LFAQ 4ABNA 4MNOA 2B63H 2AHOB 4JI3L 1C8CA 5BR8L 2KHSA 1QVGA 3MWYW 2K14A 3F1ZA 1TS4A 3MEHA 4P72A 3K5LA 3GTOH 3RLOA 4B9WA 2VQFL 1N34Q 2VQEQ 4JOIC 2F0MA 5JJZA 2AQ2B 3HOXB 4KK7A 4XTCS 5FO7B 5IGDA 1B7YB 2ZJRA 1XXGA 1UEAB 1IKLA 3G7LA 1HXYD 5GAGC 2WV6D 3T53B 1E22A 3HOVB 3HG9A 1FJGL 1IW7C 5C3EG 1BBUA 3S9WA 4OWXB 2JK8A 4C3JH 3R93A 3I4NH 2EYHA 5AFWA 4LWCA 2QDLA 2Z6KC 3EN2A 4NXNQ 4DR4Q 1FNUA 3K80C 3NP8A 3KDFA 3QOJA 4FNFA 4HJ7A 2MPMA 1GUTA 3A56A 1N8RC 2MNAA 1SNDA 1Q8IA 2M2LA 1PH1A 1SDFA 3D3RA 4ALPA 3J81c 3OTOQ 3D0FA 2FMCA 3CQZB 2CWAA 4A3DG 1STYA 4A3MG 1GO3E 3C46A 2JN4A 2N49A 3W2DA 3M9BA 1I4RA 2PQAB 5FLXE 3M7NA 3PUZA 4BBSH 1N36L 1YHAA 2C5CA 1B3QA 4R4IA 3V96A 1S40A 1JR0D 1IBMQ 1T9HA 1TWCB 4QF4A 1X9NA 1KRTA 4GNXA 1KIXA 1TKWB 1J5EQ 4JI7L 3HOUH 1FR3A 1GUGA 1NE3A 3CMEA 1KLGD 1PH4A 2ZTEA 4AYBB 3H6MA 1B44D 2FMMA 4R9WA 1YNND 4JPBW 1I50H 5IYBG 1X6OA 4MHEA 3M4OH 4PNYA 2IX1A 2OWOA 1YITA 1FNVA 2Q8RE 3SK8A 1X3FA 1SNMA 2B2VC 2A6HD 3N52A 3VA7A 4AQYL 2R7ZB 4A3BB 1CZGA 3TMEA 1U5KA 1ASZA 4KN7C 1Q81C 3NENA 1SE8A 4CHTB 3K57A 3A74A 5C4XH 5LL6S 4A93B 4CJ1B 1LTTD 3B6YA 2NN6H 1Y8OB 4J1MA 2F0EA 1P8LA 3K0XA 2CHBD 1PH2A 1TWFH 2HIVA 4O42A 1HNXQ 1GKHA 3J7ZC 1OXUA 1IBLQ 2O5IC 1BCPF 5DNFA 4CDEC 5EBCA 2XNAC 1QCBD 1WTXA 2WB1G 2R93B 4LUVA 3CCJA 1E2VA 4A3FB 1H9JA 4YWMA 4C3JG 2MO1A 1PRTD 3CCMA 4A3FG 1ZYRC 3W3AA 1PTOC 3NPPA 4DUZQ 2VL6A 2YTYA 2E5LL 1QG7A 1WFQA 1EUJA 3AQQA 1I5FA 3EQLC 4DPGA 1HZ9A 2JA6H 5C3EH 1UE1A 2E5LQ 1CKNA 1BR9A 3H3VC 1MSHA 1QNKA 3MA2B 5ELEA 1C48A 1EY0A 3HGBA 1EOVA 1LTSD 4OWTB 5EKKA 5C44H 2D9UA 2D2CC 2EYPA 1CQFA 3SK6A 4M8AA 3GTMH 2R7FA 1HFNA 5C5MA 2AWNA 1W6JA 3I8ZA 4TRDA 4EGVA 1ASYA 1A63A 1HNWL 1RTOA 3BZCA 5C4ZA 2GVBA 4DFAA 1LO5D 1MKHA 3VR6A 4BY1G 4YY3L 2DJGC 2NVYB 5CV6A 2I0QA 4AH6A 3STBD 1IL8A 1Q1EA 2MP1A 4KHPL 1JT8A 2PMZE 3UE1A 3HOXG 4DR2L 1TR5A 5I2YA 1N9WA 3NQTA 3A0JA 1A2TA 4KY7A 5D3DA 3BJUA 3ND9A 2F4VL 3GTMB 2A19A 1PH6A 2K50A 4B9XA 1RIPA 1SRUA 4O0AA 3R8BA 1HHVA 3I4MB 3A8IE 2B2TA 2F0LA 2F0KA 2HT1A 2F0TA 2F4VQ 2E76C 1EQQA 5EKIA 3KK7A 4GKKQ 4X65Q 3ND8A 3CRLC 4DR4L 2AMCB 4UP8A 2XTIA 5LHY1 3K5OA 2R7DA 4XDXA 4A3MB 1KLUD 5IYDG 4GKKL 3CKIB 2IHEA 3DEPA 1B9NA 3KLSA 4RGMA 3RR5A 1I50B 1UAPA 1QNUA 2K03A 2YTXA 3K8AA 3PF5A 1QILA 4NXML 2V4DA 2L5TA 3L7ZC 2X69A 3Q23A 1VQAA 3TZDA 4B3RQ 1Q90A 3WDNA 3QJYA 5M3MH 3HOVG 4ILWA 3TRZA 4WJ3M 3GTGH 3HKZG 1LTLA 2PZUA 4ZKBB 1SYCA 4N8X1 4DUYQ 3MXPA 3S16H 4TQUS 2LSSA 3AU7A 1OXSC 5FLMG 1YBYA 2EIFA 3DLLA 1CFMA 4A3KB 3OMCA 1HCZA 2M9VA 1VQNA 4WORA 5FLXL 3PO2B 3EJIA 1RF2D 3TP7A 1SLJA 1V1PB 3I90A 2K52A 4WJWA 2R92H 2F3VA 2HCIA 2N88A 3BVMA 1D5ZC 1HTPA 4A3CG 1D1IA 3PO3B 1HPCA 4A3LH 4HJ9A 3I4MH 4L63B 5C6AA 4KV6A 1AP0A 2K05A 3PCOB 3Q8DA 3CPWA 3RZOH 3ERQA 3L2PA 3Q24A 3GTKB 4P75A 1E1TA 1SYBA 3X3MA 1ENAA 4RCOA 2NTSA 4X65L 4X62Q 3HKSA 3FVQA 5CORA 3T4AC 1QB5D 2XWBB 1NY4A 5IYCH 1LT3D 4DV4Q 3KF8B 3AB9A 4ZUJA 4X6AH 1EEFD 5CR3A 3G6JB 1HA5A 2H4OA 4FXKC 1LYLA 1E2ZA 5JAVA 2EQSA 5FOBB 4GKJL 5JPNC 2FHTA 3R2IA 1AEXA 5C4HA 1K0SA 1E0BA 4L5QA 1A62A 2JA8B 1EYCA 3KFUA 4C3HH 2UXDL 2Q2UA 3Q0AA 4KLKA 4ME3A 4LF7L 1UE7A 1LV9A 1G91A 4DR6L 3UE0A 2D5DA 4DUYL 3HOWG 2B63G 1BCPB 1VQDA 4EVOA 2ZM6L 3NWSA 4HIKA 2EXDA 3GV6A 4JG2A 1EOTA 4IZ8A 1KABA 5M5XB 4HAEA 3K58A 2KUMA 1YNJC 4L5TA 4LF5L 1MI2A 1Z6HA 2WB1E 1FD7D 1Y1VB 3MHBA 1J5EL 3MZ5A 1LTAD 4R4CA 4C3JB 1EIGA 3CP0A 2LFNA 3F8TA 2B2YC 4JV5Q 2F3WA 4XT3B 1EQTA 1B53A 3RLNA 1CM9A 1A3TA 3J81i 2H5XA 2F0HA 5KYIA 2PW5A 3P75A 4JV5L 1HH2P 1I4XA 3S1RB 1K3RA 4JYAQ 1CTMA 4H0LC 2HQLA 4DAVA 1VQLA 2B2UC 1RKNA 1F77A 4A3LG 3JAMi 1E1OA 2B2WC 3RD4A 4ZK9B 2ICEC 5KRUA 3S1MB 4A4IA 1ML0D 5LL6X 3TDQA 1SMYC 2KA7A 1PFBA 2F0NA 2JP1A 3EBEA 4CKCA 1WTPA 4HIOA 4U673 3VYTA 1ICWA 2EXZA 4QJFA 3U4ZA 5M3MB 1EU4A 4GN3B 4C1NI 5IY0A 3KLWA 1IXRA 2YU9H 4DV7L 4OXPA 4WRDA 1PA6A 3GTLB 2YYZA 3GQBA 2UXBL 1DM0B 4K6DA 4IUUA 3CPFA 1RJTA 2SOBA 4KJNA 4DUZL 1O7ZA 2CWPA 5CC4A 5NUCA 2BE5C 1UE5A 4LF9Q 1Y1WG 1KAAA 1VF5C 1YNJD 3IAYA 4ZUIA 1EIFA 1SYDA 1M1KC 1EFWA 4B3RL 2RA4A 4YCUA 3ULJA 1PTOH 1C9OA 1OXTA 1CUKA 2HDLA 3PO2G 4NXMQ 1HQMC 1MIUA 1ESFA 2EY2A 4IOAA 4G7HC 4OIJA 4QGUA 4LFBQ 1RCVD 4DR1Q 4DU9A 1TWGH 1A6XA 4DR7L 5C3XA 2OT2A 4DXGA 1STGA 2AKWB 2OF1A 4CBVA 3HEJA 3QG1A 2C35B 4DR3L 1PMRA 1OO9B 1Q3LA 4KY5A 2FINB 3K7UC 5IYCG 3CCUA 1CI3M 3U50C 1B3AA 5I4DA 2ZXOA 3DEOA 3IFTA 4M1UB 4NDXA 1HNZQ 3KLSX 1R4PB 3HFZB 1CQVA 4BXXG 1TS5A 1BKBA 2KQ3A 4P74A 4DV0Q 4H13C 1TU2B 4K5VA 3MVVA 3NTIA 4RKBA 3TEHB 2WKDA 1N32L 1B4OA 3J81j 4HIDA 2AUKA 3GD7A 3I3CA 3D8GA 1Z47A 2NWGA 5CBAE 2EOTA 1D5XC 3NSWA 5LMUQ 4K5XA 4K6LA 4X62L 2D0OA 3CCRA 4FXDA 3HOZB 1Q82C 4QIWE 4QIWB 2PZWA
chains in the Genus database with same CATH topology
4UDUC 1B1ZA 1XYIA 3M3YB 4JK1C 1SJED 1ONLA 2QEJC 4CKEA 4IFDI 1JOKA 1SNOA 2QDBA 2JEAI 2MGSA 4IUPA 1TY0A 1MBYA 3A8KE 3JAME 4ODGA 3VR2A 2A6ED 4DK1A 3SR1A 5IODA 1EZ6A 2F0UA 5FKAC 5K5PA 1SNQA 1GUOA 3O13A 5I9PA 2PCFB 2ID0A 2OXPA 2ICIA 3Q22A 2B63B 1HTLD 3NBIA 1EIHA 4OL7A 5COYA 4BWGB 1CZWA 2DNEA 4OHJA 4DXFA 4HCSA 2OEOA 3SDZA 3H94A 5IGCA 3GTGB 1U4PA 3K7AB 1O78A 1PRTF 1O80A 4K8IA 4R8NA 2RBMA 1STEA 4N9TA 3C2PA 2LKVA 1H9RA 1SJHD 5ELFA 3TP5A 5JOBA 2XRQD 1PYWD 3UI2A 2BCOA 1SBBB 1EZ8A 3MXGA 2BDNA 4HN7A 2DNCA 5K36H 4V0BA 5CMDA 1TT2A 3GTOB 1BDOA 4ID6A 2TSSA 2KVMA 1K8OA 2K01A 3D31A 1SFOB 2F0GA 2E2DC 2Z8LA 2EDGA 3J81L 4H44C 1U4RA 2DY8A 2NN6I 3KBXA 5EPLA 1IYUA 5C4JB 2NVTB 1JWMD 2NTTA 3R3OA 5DM63 2E74C 1HUMA 4MN3A 1NCVA 3HS0C 3U9OA 2VB3X 1GUWA 1A3VA 3RLFA 4NKLA 2L12A 1EYDA 1JWSD 3H91A 3TSSA 3U9SA 3BDLA 4RH6A 5CBEE 4LJZC 5EPKA 3SK4A 4TSSA 4FF2A 2EY6A 4G57A 1MGSA 5M5WB 2WP8J 2RDGA 1JQYD 1S5DD 4PMCA 3NTKA 3PUXA 3FPPA 2NB0A 4HSPA 4XYOA 1PZKD 3V05A 4IFDJ 2ZT9C 5CV8A 1PFNA 4DNRB 1CT1D 1X3PA 5DEHA 1VDZA 4DN4M 3S15B 1CA6A 3CRKC 1ZEQX 3SK5A 4KKUA 4MIUA 2PNRC 3V2TA 1VMPA 2HQEA 1EEID 4IUNA 2ZXPA 2F0JA 1LT6D 4XQQA 4ZQ3A 1ZXTA 4ZYSA 2F0PA 2EYFA 1G2SA 2JA5B 3PV0A 5HURA 1AN8A 2LY7A 3BVGA 2JE6I 3RZOB 3Q6SA 4FF1A 5KNCA 5JEAJ 5C0XG 3X3NA 4FF3A 2JA7B 4NMZA 3AMUA 2O5JC 5IOCA 2PPBC 1NSNS 2L4NA 2XRSD 2E75C 4CGYB 4X3TA 5CV4A 2WAQB 1ET9A 2SNMA 3OSOA 1BBXC 1SYGA 4C1NK 3IKJA 3K5MA 3I4LA 2RSNA 1TWFB 2AQ1B 1TWHB 2F0IA 1D2BA 1DXMA 5C0XH 1QE6A 4DAYA 3S17B 1FNWA 1T5XD 4BBSB 5CGKA 3KUPA 2WACA 1V43A 3OWEB 1LT5D 3HP3A 2BE5D 1EY7A 1B2TA 2CVRA 3J81E 3DWAA 4L6TB 4K2KA 5FO9B 3TP6A 2K6AA 5F2DA 1LLRD 2EJGC 3I70A 3TBIB 3M4OB 2TMPA 2B2WA 2B8GA 3NTHA 5D14A 4I7ZC 3FRPB 1S4ZA 1TY2A 4IFDG 2PYKA 4R8IA 3OHXC 5EJWA 5C4XB 1PFMA 2EYLA 2C9OA 5I2XA 2O2LD 1ZYRD 4IN3A 4ULLA 2YU9B 2VB2X 1EYAA 1UUPA 5D3IB 3VA5A 4HEDA 1CK1A 1WTOA 1STHA 3RUZA 5J22A 1G291 5E1FA 1KNEA 3J7AF 5FK9C 4K2LA 5DAUA 1V1OA 1LACA 3CU7A 1D5MC 1EY5A 4IUVA 1NUCA 4RA8A 3E6ZX 1K8MA 3HKZB 5G3LF 3OPOA 4J8QA 4RWSC 1F2YA 4Q0FA 2KCCA 3BDCA 4P2CB 3C1FA 1BOSA 2RSOA 5CV5A 2EYJA 2AWOA 1NR4A 2KCNA 2ENBA 4A3IB 1LABA 1DOKA 2LMCB 3ZYYX 1PZJD 1AW7A 4ME5A 1S5FD 1TQOA 1V8QA 2EJMA 5CV7A 1HA6A 2EYMA 1Y1WB 1PDQA 4XQNA 1HQRD 1K83B 2E2HB 4ZRZA 2RKSA 4XYQA 3C1EA 2MHVA 4QCLA 1ILQA 2F0VA 3KLRA 1SNPA 1GJXA 5E4XA 2Z4IA 5KNBA 4BY1B 2XIWA 4DGZA 5A35A 3M7GA 5J1ZA 3A8JE 4K8JA 3NQIA 1T5EA 2EE1A 2ZXRA 1RD9D 3MFGA 1E2WA 2AQ3B 4IUTA 4S3SA 1DJRD 5J39A 5IGEA 2BA0A 2R3ZA 3OOCA 3S2HB 3NE5B 5C5LA 3EA6A 1TS3A 5M5YB 4OO1I 1KDCA 1LTID 4PV1C 2F0DA 1BF4A 4N9PA 2A69D 2KEEA 4Y7NB 2HCCA 1JC7A 3H09A 4U68A 3P1HA 2BA1A 3I91A 2SEBD 2BDOA 3OWFA 1FYCA 3QWNA 1Q1BA 1OXVA 3N6RA 1HUNA 1J9OA 4A3JB 2EJFC 5A2QL 1A15A 3E5SA 4GZYC 5KEEA 3PUYA 2A69C 5DM73 1JWUD 5KGUA 1PRTB 3OIQA 1Y69U 1H9MA 4KKTA 3MC0B 5E4WC 4LMQD 4EQNA 1ILPA 2K5WA 3IL8A 5EKLA 4EQOA 2L11A 5C44B 4C3HB 5I6YA 3S1QB 5ISRA 3OMGA 3DXJC 1QOHA 5ELBA 1I3QB 4F8MA 1JOOA 3J7AV 3SXHA 1JCKB 4NP5A 5M3FB 1L0XB 1BUVT 5I9OA 1V1PA 1EY8A 5IGBA 3TP8A 3DMUA 1ZKOA 5TSSA 1U4LA 2B39A 3BZDB 1KNAA 4C2MB 3GP7A 5HGTA 2FJ2A 3DM1A 1Y8PB 2B2YA 4QB4A 3RZDB 1TIID 1IYVA 3GTQB 3LNNA 3HRZC 4G4KA 3ITPA 1SMYD 2NBFA 4FYDA 1X3QA 2CW0C 4YIJA 5EBDA 2R6GA 2D62A 3P20A 3J7YW 2WKCA 2F0FA 3EROA 4FXGC 3I72A 2PMZB 2HDMA 4KJOA 1JOQA 5KYLA 1DZ1A 3NXWA 1D6EC 2CW0D 4JBWA 1STNA 3EVQA 3SHLA 2JSOA 2G9HD 1D1KA 1LTGD 3QIAA 4X3KA 1AZQA 5I6WA 3T56B 2CQAA 4KD4A 3GO5A 2K04A 2IWHA 1WTVA 1TWGB 4RKLA 4V190 4L8JA 1SAPA 3NBHA 3HOUB 2A74C 1Y8NB 1KDAA 1F2ZA 2B8FA 3WOFA 3A7AB 4QMGA 4XXEA 2Z1CA 1WD1A 3J80L 4XIGS 2H1EA 2K33A 3D4RA 2M00A 3I4NB 2R61A 4PMBA 5C3EB 1ESRA 1I4PA 4KMUC 3VYUA 1M8AA 2IL8A 1I4HA 2IX0A 4KTAA 1HRJA 3S1NB 2JXMB 1EFID 4HTHA 1ET6A 4H7BA 3PUVA 3M4YA 3MXNA 4EQPA 4CKBA 1GOZA 4KKSA 2B2UA 2XSCA 5EGTA 2K5DA 1I4QA 1U9RA 4A3EB 1EU3A 5A2QE 3T51B 3GV3A 2MUYA 2F4IA 1MD2D 1SE2A 2JEBI 1GXDC 1LTBD 3HZXA 2J7ZA 4KN4C 1DOLA 2EYOA 2DN8A 4IFDH 3BDOA 2A6HC 3DWQA 3F2UA 4C3HG 2K32A 2VXWA 2EVBA 5C3WA 4RCNA 2F0OA 2A5HA 2QILA 2EZVA 1F9PA 1O7YA 4B08A 4BS9A 4BY7B 3MFYA 5BN5A 2VNUD 3D6CA 2L1BA 3FEWX 2O4XA 4OO1G 3MTSA 2L55A 2X6LA 4K5WA 4FF4A 4BA1I 3K5NA 1BQQT 3E0JA 2PO4A 2BOSA 3T16A 2KEDA 4I65A 3SVMA 1W6KA 3I73A 2K7VA 1CHQD 2HUGA 3TN2A 3D4WA 2KECA 5IT9L 1F9QA 1S5BD 4PQXA 3SEBA 1NAPA 1SE4A 1SSOA 4KD3A 2F0SA 3K59A 4KI0A 4KHVA 1DONA 4J6HA 3BVZA 1PLFA 2I07B 1EY9A 3BYTB 4BBRB 1PXUA 2PZTA 2WIIB 3RMHA 3D6WA 1II3A 1PTOB 4DF7A 1GUNA 3PMFA 4IUQA 1DCZA 4F88A 3T13A 2Q8TA 4CJ2C 5BN4A 1CA5A 3ONAB 2G9DA 1NR2A 4O1NA 3SE0A 4RAUC 3L9AX 3QOLA 1F2MA 4RGNA 4HCEA 4UAIA 3VR3A 3BS1A 4IQZA 2Y0SB 1EWCA 1H9SA 2IPKD 3S16B 2NN6G 4FO2A 4IURA 2RDFA 1TVXA 1SE3A 1GHKA 2EY5A 3J80E 3FPUB 2JA6B 3QB3A 5M9OA 3A55A 2Z4HA 1EY4A 2E2IB 3MXUA 2R92B 4IALA 1MSGA 3D4DA 1BNZA 1F9SA 1O7LA 1U4MA 2IT1A 5ELCA 1Q12A 1WVLA 2GA4B 1SXTA 1WTRA 1KDBA 2EPBA 3WOEA 3S14B 3URYA 5IGFA 1STAA 2F0WA 4RFBA 5CYUA 1J8IA 1ENCA 2N55A 2DY7A 3NHHA 2SDFA 2AUJD 4E6IA 3K0YA 1KTKA 2IJ0A 2VUMB 5JPMC 2MJ8A 2L9HA 1Z7TA 1H9KA 4XQJA 1GHJA 2XWJB 1JICA 3OW7A 1B9MA 3KF8A 1M4VA 1SNCA 2RDHA 1BO0A 1G2TA 2XN9C 2RVLA 4Z9CB 2IX3A 1DD2A 1JB3A 1S5ED 3QO2A 3H0GB 5G3LD 4DNTB 5T1GA 1RHPA 1WCMB 3A54A 1I6VC 1WTQA 1X32A 2LS01 3DUZA 1EQVA 1XWEA 1S5CD 4OGQC 3S2DB 4NW2A 1VMCA 3LWEA 4ZLTF 5BN3A 5K36G 4RHRA 3R2TA 3K6OA 1R9TB 2A73B 2JYOA 1FGBD 1SEBD 2X6GA 4FP5D 4C3IG 2I46A 1LTRD 3HOYB 1IW7D 2RQXA 3LX0A 2A68D 3JAML 4WFN3 5IGGA 4DAPA 4DA2A 1XTCD 1OXXK 4FVMA 2F03A 1I6HB 3PUWA 5IT9E 2K5QA 5C0XI 1JORA 1BCPC 4Q5VA 4XT1B 5E3FA 3FDTA 1H9SB 3A7LA 5JVG3 1WD0A 2KOLA 2E2JB 5JVH3 2NYZD 1SYFA 4HMIA 4K14A 1JE4A 1G6ZA 3VR4A 2WINB 2PW7A 2NUCA 4C3IB 1BCPD 2KJXA 1AFPA 3GTJB 2NVQB 4KY6A 1DOMA 3EFXD 1G8ZD 5KNDA 4RGTA 3PIO3 2B2VA 1PRTC 1A2UA 3DWPA 4OIKA 1A3UA 2PQEA 2QF7A 2J4XA 4A3GB 5IIFA 3BG3A 2A6EC 4ZAIA 1EWHA 4QUCA 4BA2I 5T1IA 2WB1B 1EL0A 3VR5A 2NZ1D 2NVXB 3GTPB 4LAAA 5FO8B 3FMCA 4X3UA 2SNSA 1HFGA 2Q8IB 4A3DB 2A68C 1QWYA 2K28A 4TKOB 3BYYB 1ENFA 4DK0A 3L3OC 2K1BA 1L0YB 2QCPX 3M85A 2IW3A 1C4QA 1VF7A 1EY6A 5ELDA 4OO1H 1PTOD 5JEAH 1AZPA 1VCIA 4HMJA 1F2LA 3TZUA 1WTWA 4HSVA 5CV9A 3KBGA 2XVSA 3DHQA 3P7JA 2FFKB 4G7ZC 1TWAB 1PTOF 3PIP3 3MAQA 1RTNA 1R4QB 1IKMA 3NUCA 1XX8A 3VYSA 1RDPD 4KHZA 1IHZA 4X3SA 4G7OC 1B50A 4LK1C 1TS2A 1BXTA 1DYQA 1STBA 3C3LA 5D65A 4C56C 5KIXA 2F0QA 4RGOS 2EY1A 2J0TD 3HOWB 1F9RA 4F7XA 5EQ0A 3FKIB 2L0CA 3NWTA 1QJOA 3OIPA 1SYEA 3NK9A 3LWUA 4QUFA 2QKIC 4CJ0B 1CHPD 1PZID 4HR7B 1RODA 2F1MA 3IFDA 3VYRA 5EPJA 4RHSA 4PMWA 1GUSA 3CHBD 2B2TC 1UNSA 1I4GA 1YNNC 4F87A 4ZKCB 5JEAG 5C0XJ 1LT4D 4ABNA 1C8CA 2KHSA 3MWYW 1TS4A 3MEHA 3K5LA 4B9WA 2F0MA 5JJZA 2AQ2B 3HOXB 4KK7A 4XTCS 5FO7B 5IGDA 1XXGA 1UEAB 1IKLA 3G7LA 3HOVB 1HXYD 2WV6D 3T53B 3HG9A 1IW7C 3S9WA 3R93A 2EYHA 5AFWA 1FNUA 3NP8A 3QOJA 4FNFA 2MPMA 1GUTA 3A56A 1SNDA 1Q8IA 2M2LA 1SDFA 3D3RA 2FMCA 3CQZB 1STYA 3C46A 3W2DA 1I4RA 5FLXE 3M7NA 3PUZA 2C5CA 3V96A 1JR0D 1TWCB 4QF4A 1TKWB 1FR3A 1GUGA 1KLGD 4AYBB 3H6MA 1B44D 2FMMA 4R9WA 1YNND 4MHEA 4PNYA 2IX1A 1FNVA 2Q8RE 3SK8A 2B2VC 1SNMA 3VA7A 2A6HD 3N52A 2R7ZB 4A3BB 1CZGA 3TMEA 4KN7C 4CHTB 3K57A 5LL6S 4A93B 4CJ1B 1LTTD 2NN6H 1Y8OB 4J1MA 2F0EA 2CHBD 4O42A 1OXUA 2O5IC 1BCPF 5DNFA 5EBCA 2XNAC 1QCBD 1WTXA 2R93B 1E2VA 4A3FB 1H9JA 4C3JG 1PRTD 1ZYRC 3W3AA 1PTOC 3NPPA 1QG7A 3EQLC 1BR9A 3H3VC 1MSHA 1QNKA 3MA2B 5ELEA 1C48A 1EY0A 3HGBA 1LTSD 5EKKA 2D9UA 2D2CC 2EYPA 1CQFA 3SK6A 4M8AA 1HFNA 5C5MA 2AWNA 1W6JA 3I8ZA 4TRDA 4EGVA 1RTOA 5C4ZA 4DFAA 1LO5D 3VR6A 2NVYB 5CV6A 1IL8A 1Q1EA 2MP1A 1TR5A 5I2YA 3NQTA 1A2TA 4KY7A 5D3DA 3ND9A 3GTMB 4B9XA 1HHVA 3R8BA 3I4MB 3A8IE 2B2TA 2F0LA 2F0KA 2F0TA 2E76C 5EKIA 3KK7A 3ND8A 3CRLC 5LHY1 3K5OA 4XDXA 4A3MB 1KLUD 3CKIB 3DEPA 1B9NA 3KLSA 4RGMA 1I50B 1UAPA 1QNUA 2K03A 1QILA 2V4DA 2L5TA 3L7ZC 2X69A 3Q23A 3TZDA 1Q90A 3WDNA 3QJYA 4ILWA 2PZUA 4ZKBB 1SYCA 3MXPA 4TQUS 3AU7A 1OXSC 1CFMA 4A3KB 3OMCA 1HCZA 2M9VA 4WORA 5FLXL 3PO2B 3EJIA 1RF2D 3TP7A 1V1PB 3I90A 4WJWA 2F3VA 2HCIA 2N88A 3BVMA 1D5ZC 1HTPA 1D1IA 3PO3B 1HPCA 4L63B 5C6AA 4KV6A 1AP0A 2K05A 3ERQA 3Q24A 3GTKB 1SYBA 3X3MA 1ENAA 4RCOA 2NTSA 3FVQA 5CORA 3T4AC 1QB5D 2XWBB 1LT3D 4ZUJA 3AB9A 1EEFD 5CR3A 3G6JB 1HA5A 2H4OA 4FXKC 1E2ZA 5JAVA 5FOBB 5JPNC 2FHTA 3R2IA 1AEXA 5C4HA 1E0BA 2JA8B 1EYCA 3Q0AA 1LV9A 1G91A 2D5DA 1BCPB 4EVOA 3NWSA 3GV6A 1EOTA 4IZ8A 1KABA 5M5XB 4HAEA 3K58A 2KUMA 1YNJC 1MI2A 1Z6HA 1FD7D 1Y1VB 3MHBA 3MZ5A 1LTAD 4C3JB 1EIGA 2LFNA 2B2YC 2F3WA 4XT3B 1EQTA 1B53A 1CM9A 1A3TA 2F0HA 5KYIA 2PW5A 3P75A 3S1RB 1I4XA 1CTMA 4H0LC 4DAVA 2B2UC 1RKNA 1F77A 2B2WC 3RD4A 4ZK9B 2ICEC 5KRUA 3S1MB 1ML0D 5LL6X 3TDQA 1SMYC 2KA7A 1PFBA 2F0NA 2JP1A 4CKCA 1WTPA 4U673 3VYTA 1ICWA 2EXZA 5M3MB 1EU4A 4C1NI 4WRDA 3GTLB 2YYZA 3GQBA 1DM0B 4K6DA 4IUUA 1RJTA 2SOBA 4KJNA 1O7ZA 5CC4A 5NUCA 2BE5C 1KAAA 1VF5C 1YNJD 3IAYA 4ZUIA 1SYDA 2RA4A 1PTOH 1OXTA 2HDLA 1HQMC 1ESFA 2EY2A 4G7HC 4OIJA 1RCVD 4DU9A 1A6XA 5C3XA 2OT2A 4DXGA 1STGA 2OF1A 4CBVA 3HEJA 3QG1A 1PMRA 1OO9B 1Q3LA 4KY5A 2FINB 1CI3M 1B3AA 5I4DA 2ZXOA 3DEOA 3IFTA 4M1UB 4NDXA 3KLSX 1R4PB 1CQVA 1TS5A 2KQ3A 4H13C 1TU2B 4K5VA 3MVVA 3NTIA 4RKBA 2WKDA 1B4OA 2AUKA 3GD7A 3I3CA 3D8GA 1Z47A 2NWGA 5CBAE 2EOTA 1D5XC 3NSWA 4K5XA 4K6LA 4FXDA 3HOZB 4QIWB 2PZWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CZW A;  1D1K A;  1C48 A;  1C4Q A;  1DM0 B;  2BOS A;  4P2C B;  3MXG A;  1BOS A;  1D1I A;  1R4Q B;  1CQF A;  2C5C A;  2GA4 B;  4M1U B;  1R4P B;  1QOH A;  2XSC A;  1QNU A;  4ULL A;  1CZG A; 
#chains in the Genus database with same CATH topology
 1L0W A;  4UDU C;  1VQP A;  4QY7 A;  1B1Z A;  5IP9 G;  1XYI A;  3A5Z B;  3M3Y B;  4JK1 C;  1SJE D;  4DR6 Q;  1ONL A;  1VQ5 A;  2QEJ C;  4OEL B;  1KL9 A;  2RF4 A;  4OON A;  4CKE A;  4A3K G;  4IFD I;  1JOK A;  1SNO A;  2QDB A;  2JEA I;  4LF6 Q;  2MGS A;  4IUP A;  3CCE A;  1TY0 A;  1MBY A;  3A8K E;  3JAM E;  4ODG A;  3VR2 A;  2A6E D;  2Z9H A;  1WCM G;  2R93 G;  4DK1 A;  4A3G H;  2OCE A;  3SR1 A;  5IOD A;  1EZ6 A;  2OTJ A;  4YWL A;  2F0U A;  2DGY A;  1B8A A;  4POF A;  5FKA C;  2BH2 A;  3RN2 A;  2JA6 G;  5K5P A;  1SNQ A;  1GUO A;  3O13 A;  5I9P A;  1XMO Q;  1NBW A;  2PCF B;  2ID0 A;  2OXP A;  2ICI A;  4JI1 L;  3Q22 A;  2B63 B;  3UDI A;  1VQH A;  1HTL D;  3NBI A;  1EIH A;  4OL7 A;  5COY A;  3G4S A;  4BWG B;  1CZW A;  1EIY B;  2DNE A;  4OHJ A;  4JW0 A;  2RHQ B;  4DXF A;  4GNX C;  1XNR Q;  4A3B H;  4HCS A;  2OEO A;  3SDZ A;  1HZB A;  3H94 A;  1VQM A;  5IGC A;  3GTG B;  1WCM H;  1U4P A;  1VQE A;  4LUO A;  3K7A B;  1V9P A;  1O78 A;  1PRT F;  1NTG A;  1O80 A;  3WWV A;  4K8I A;  1H95 A;  4R8N A;  4DAY B;  1X3G A;  5JJI A;  4LFC L;  4NXN L;  2RBM A;  1STE A;  4N9T A;  3KJP A;  3LGJ A;  4GLA C;  3C2P A;  2LKV A;  4JI2 L;  1H9R A;  4TVA B;  1SJH D;  2PI2 E;  5ELF A;  4P73 A;  3TP5 A;  2XRQ D;  5JOB A;  1PYW D;  3UI2 A;  2BCO A;  1SBB B;  3KF6 A;  2CH4 A;  2UXB Q;  5ELN A;  4LUZ A;  2OQ0 A;  2CH4 W;  1EZ8 A;  3MXG A;  2BDN A;  4HN7 A;  2DNC A;  4A3C H;  5K36 H;  4V0B A;  5CMD A;  1W2B A;  1N36 Q;  1QZG A;  1TT2 A;  3GTO B;  2VY3 A;  1BDO A;  3H15 A;  1KQS A;  4NB3 A;  4ID6 A;  4IJL A;  4B3S L;  2YV5 A;  2BH8 A;  2TSS A;  2KVM A;  1K8O A;  2K01 A;  3D31 A;  3CC4 A;  1SFO B;  2NVX H;  2F0G A;  3CC2 A;  2E2D C;  2B3G A;  1EQR A;  1QUQ A;  2Z8L A;  1E7Z A;  2EDG A;  1FVI A;  3J81 L;  1RL2 A;  1U4R A;  4H44 C;  3I55 A;  2OTL A;  2DY8 A;  2NN6 I;  3KBX A;  5EPL A;  1VQ8 A;  1IYU A;  3U4V A;  5C4J B;  2NVT B;  4DK3 C;  4UPA A;  4EQ5 A;  1JWM D;  2NTT A;  4J15 A;  3R3O A;  5DM6 3;  2Y0S E;  1AE3 A;  2E74 C;  1HUM A;  2HIX A;  4MN3 A;  1NCV A;  4A3M H;  4A76 A;  2E2H H;  3HS0 C;  3U9O A;  2VB3 X;  1GUW A;  4LW1 A;  4DV1 Q;  1PH3 A;  4LF8 L;  1A3V A;  3RLF A;  2KEN A;  4NKL A;  2L12 A;  1EYD A;  1JWS D;  3H91 A;  1CKN B;  3TSS A;  3U9S A;  1IBK Q;  2OQK A;  3BDL A;  4YCW A;  4RH6 A;  5EAY A;  5BR8 Q;  5CBE E;  4LJZ C;  5DLQ E;  5EPK A;  3SK4 A;  4TSS A;  4FF2 A;  2NZH A;  2EY6 A;  4G57 A;  4DKA C;  1MGS A;  5M5W B;  2WP8 J;  1XNQ L;  2RDG A;  4WJ4 A;  1JQY D;  4RMF A;  1L2F A;  1CKO A;  1S5D D;  4PMC A;  3NTK A;  3PUX A;  3FPP A;  3NEL A;  2NB0 A;  4HSP A;  4XYO A;  1PZK D;  3V05 A;  4IFD J;  2ZT9 C;  5CV8 A;  1PFN A;  3HOY H;  4DNR B;  5M5X H;  1CT1 D;  1X3P A;  5DEH A;  2KHJ A;  3IRB A;  1VDZ A;  4DN4 M;  4YHH Q;  4BY7 G;  3S15 B;  3CW2 C;  1CA6 A;  3CRK C;  1G51 A;  1ZEQ X;  3SK5 A;  1JB7 A;  4KKU A;  1U0L A;  4MIU A;  1PH7 A;  2PNR C;  3V2T A;  1VMP A;  2HQE A;  3J80 i;  4YWK A;  1EEI D;  4IUN A;  2ZXP A;  1HR0 L;  2F0J A;  3AFQ A;  1LT6 D;  4XQQ A;  4ZQ3 A;  1DGS A;  4IO9 A;  1ZXT A;  4ZYS A;  2HD3 A;  4GS3 A;  1YIJ A;  2F0P A;  2EYF A;  1G2S A;  2JA5 B;  3PV0 A;  5HUR A;  1C7Y A;  1AN8 A;  2LY7 A;  3BVG A;  2JE6 I;  1X54 A;  3CCQ A;  1Y1W H;  1XTD A;  3RZO B;  4MTK A;  3Q6S A;  4FF1 A;  5KNC A;  5JEA J;  5C0X G;  3X3N A;  1VQ9 A;  5LMN Q;  4FF3 A;  2JA7 B;  4NMZ A;  1VQF A;  3AMU A;  2O5J C;  5IOC A;  2KCT A;  2PPB C;  1NSN S;  1UE6 A;  4LF7 Q;  3W1B A;  4CDD C;  2L4N A;  1YJN A;  2XRS D;  5AJ3 L;  4JOI A;  2E75 C;  4CGY B;  4X3T A;  5CV4 A;  2WAQ B;  1ET9 A;  2SNM A;  3OSO A;  1NMG A;  1BBX C;  1SYG A;  2D0P A;  3K81 C;  5IE8 A;  4C1N K;  1TXY A;  3IKJ A;  5H1S E;  3K5M A;  3I4L A;  4OX9 Q;  2RSN A;  1TWF B;  2AQ1 B;  4DNI A;  1TWH B;  3K7A H;  5IYD H;  3GTL H;  1KC8 C;  2F0I A;  2IY5 B;  1D2B A;  1IYJ B;  1DXM A;  3E0E A;  2KHI A;  5C0X H;  1PYB A;  1QE6 A;  4DAY A;  3S17 B;  1FNW A;  1T5X D;  2N3S A;  4BBS B;  3HKZ E;  3AEV A;  3S15 H;  1K0R A;  5CGK A;  1LM0 A;  3KUP A;  4X64 L;  2WAC A;  4IJH A;  3W5O A;  3U58 A;  2WFW A;  1V43 A;  3OWE B;  1LT5 D;  3HP3 A;  4UP7 A;  4DV6 Q;  1HNW Q;  2BE5 D;  3W1G A;  1TWH H;  5GRO A;  2JA7 H;  2HHH Q;  4R4Q A;  1EY7 A;  1B2T A;  2CVR A;  3J81 E;  3DWA A;  2I5M X;  4L6T B;  4K2K A;  4GLV B;  5FO9 B;  4JI2 Q;  3TP6 A;  2K6A A;  4LFA L;  5F2D A;  1LLR D;  4RG1 A;  2EJG C;  3I70 A;  1Z9F A;  3KDF B;  3TBI B;  3M4O B;  4JI6 Q;  2TMP A;  2UXD Q;  2B2W A;  2XGT A;  2B8G A;  3NTH A;  5D14 A;  4I7Z C;  3FRP B;  1S4Z A;  1TY2 A;  2UU9 Q;  1Y14 B;  2JA5 H;  2PYK A;  4BXX H;  4IFD G;  4LF8 Q;  4KHP Q;  4R8I A;  1JE5 A;  3OHX C;  5EJW A;  3BZK A;  5C4X B;  1PFM A;  2JJQ A;  4YCV A;  4JBJ A;  2EYL A;  2C9O A;  2I5L X;  1MJC A;  1JJC B;  3DM3 A;  5I2X A;  2O2L D;  4DV3 L;  1FJG Q;  1EWI A;  1ZYR D;  4IN3 A;  4ULL A;  2YU9 B;  4APV A;  2VB2 X;  1EYA A;  1UUP A;  2IHF A;  5D3I B;  4JI4 Q;  4PZ6 A;  3VA5 A;  2UXC Q;  4HED A;  2Q2T A;  1CK1 A;  1WTO A;  1STH A;  3RUZ A;  5J22 A;  1G29 1;  1Q7Y C;  5E1F A;  1CSP A;  3S24 A;  1KNE A;  3J7A F;  5FK9 C;  4K2L A;  2QGQ A;  4DAM A;  1PH8 A;  1V1O A;  1LAC A;  5DAU A;  3CU7 A;  3E3X A;  1D5M C;  1EY5 A;  4IUV A;  1NUC A;  1VQ7 A;  4RA8 A;  3E6Z X;  1K8M A;  3HKZ B;  1VQK A;  5G3L F;  4QQB X;  3OPO A;  4J8Q A;  4JI5 L;  2HHH L;  4RWS C;  4DV5 Q;  1F2Y A;  4MTN A;  4Q0F A;  5ELO A;  3KJO A;  2KCC A;  2VZA A;  3BDC A;  4P2C B;  5M5W H;  3C1F A;  3E9I A;  1BOS A;  2RSO A;  1HZC A;  5CV5 A;  2EYJ A;  2K75 A;  4DR5 L;  2A1A A;  2AWO A;  2WAQ G;  3HOW H;  1YVC A;  1NR4 A;  3UDX A;  2KCN A;  3ER0 A;  2ENB A;  5GAD C;  4A3I B;  1LAB A;  3S2H H;  1DOK A;  2LMC B;  4R4O A;  3ZYY X;  1PZJ D;  4JVZ A;  3T1H L;  3L0O A;  1IBM L;  1AW7 A;  4ME5 A;  1S5F D;  1TQO A;  1V8Q A;  2EJM A;  5CV7 A;  3VDY A;  1VQB A;  2JA7 G;  1HA6 A;  2EYM A;  1SRO A;  3GTP H;  1Y1W B;  1PDQ A;  4XQN A;  1HQR D;  4A3B G;  1K83 B;  2E2H B;  1KXL A;  3I56 A;  4HJ8 A;  4ZRZ A;  1M90 C;  2RKS A;  1VQC A;  3GTK H;  4XYQ A;  3C1E A;  2MHV A;  4QCL A;  1ILQ A;  2F0V A;  3KLR A;  4LF4 L;  3UDF A;  1SNP A;  1GJX A;  5E4X A;  5IWA L;  2Z4I A;  5KNB A;  4BY1 B;  2XIW A;  4DGZ A;  5A35 A;  1UWV A;  3M7G A;  5J1Z A;  3A8J E;  1YEZ A;  2ZTC A;  4K8J A;  3NQI A;  3JC6 6;  1T5E A;  2YTV A;  2EE1 A;  2ZXR A;  4GNX B;  1RD9 D;  1I94 Q;  5IT9 c;  3MFG A;  1YNX A;  1E2W A;  4O2D A;  2AQ3 B;  2Z0S A;  4IUT A;  5FLX c;  3RN5 A;  2NZO A;  4S3S A;  1DJR D;  4DR1 L;  1I94 L;  2NVT H;  2VQF Q;  1KHI A;  5J39 A;  2VQE L;  5IGE A;  2BA0 A;  2R3Z A;  3OOC A;  3S2H B;  3NE5 B;  1L1O C;  5C5L A;  3EA6 A;  1TS3 A;  5M5Y B;  2ZM6 Q;  4BY1 H;  4OO1 I;  1KDC A;  3G6E A;  1LTI D;  4PV1 C;  2F0D A;  1BF4 A;  4N9P A;  3T1Y L;  2A69 D;  2KEE A;  4Y7N B;  2HCC A;  1JC7 A;  3H09 A;  3NBH B;  4U68 A;  3P1H A;  4X66 Q;  3CCL A;  1D7Q A;  2VW9 A;  2BA1 A;  3ICE A;  1K83 H;  3TRE A;  3I91 A;  1L1O A;  2SEB D;  2UUB L;  2BDO A;  3OWF A;  1FYC A;  3QWN A;  1Q1B A;  1OXV A;  3H3V H;  3N6R A;  4JI8 L;  1HUN A;  1J9O A;  4A3J B;  2EJF C;  2Q2I A;  5A2Q L;  1A15 A;  3E5S A;  1IL2 A;  1JJG A;  4GZY C;  5KEE A;  4YY3 Q;  3PUY A;  2QEX A;  2A69 C;  5DM7 3;  1JWU D;  1HR0 W;  5KGU A;  1PRT B;  3TS2 A;  4JBK A;  3OIQ A;  4CDF C;  1Y69 U;  1H9M A;  4KKT A;  3MC0 B;  5E4W C;  4LMQ D;  3M4P A;  4EQN A;  5L37 A;  2MFI A;  1K8G A;  4A3K H;  1ILP A;  4UHV A;  2K5W A;  2N8N A;  3IL8 A;  5EKL A;  4EQO A;  2L11 A;  1MJE A;  5C44 B;  4C3H B;  4DV2 Q;  5I6Y A;  4BY7 H;  3S1Q B;  5ISR A;  3OMG A;  2ALY B;  3DXJ C;  3MXN B;  4JI3 Q;  1QOH A;  1HNZ L;  5ELB A;  1I3Q B;  1CSQ A;  4F8M A;  4JI4 L;  1JOO A;  3J7A V;  3SXH A;  1JCK B;  5GAE C;  4HIM A;  4NP5 A;  5M3F B;  1L0X B;  1BUV T;  1W3S A;  5I9O A;  1V1P A;  1SFO H;  1YJW A;  1EY8 A;  5IGB A;  5IYB H;  4I7A A;  2UXC L;  4GOP C;  3TP8 A;  3DMU A;  3H3V I;  2FXQ A;  2UUB Q;  1ZKO A;  5TSS A;  2VUM H;  1U4L A;  2B39 A;  3BZD B;  1VQO A;  4OWW B;  2Z6K A;  1PH5 A;  1KNA A;  2ZTD A;  4C2M B;  4DV5 L;  2PI2 A;  3GP7 A;  5HGT A;  3M3Y H;  4IPD A;  1XPU A;  4B3T Q;  2FJ2 A;  3DM1 A;  1Y8P B;  2B2Y A;  4QB4 A;  2UUC L;  2R7Z H;  1HJP A;  3RZD B;  1TII D;  1IYV A;  3GTQ B;  3LNN A;  3HRZ C;  3JAM c;  4G4K A;  3ITP A;  1SMY D;  3OW2 A;  2NBF A;  4FYD A;  1X3Q A;  2CW0 C;  4YIJ A;  5EBD A;  2R6G A;  2D62 A;  3P20 A;  1I6H H;  1QUQ B;  4POG A;  4DR2 Q;  3J7Y W;  3H0G G;  2WKC A;  1UEB A;  2F0F A;  5FJ8 H;  3ERO A;  4FXG C;  4IPC A;  2WAQ E;  3I72 A;  2PMZ B;  2HDM A;  1HR0 Q;  1VQI A;  4KJO A;  1JOQ A;  1LUZ A;  5KYL A;  1DZ1 A;  3NXW A;  1D6E C;  2CW0 D;  4Y52 H;  4R4T A;  2QW7 A;  4JBW A;  4DV3 Q;  1STN A;  3EVQ A;  3SHL A;  2JSO A;  2G9H D;  1D1K A;  1LTG D;  3QIA A;  5IP7 H;  4X3K A;  1AZQ A;  3PIP A;  5I6W A;  1XNR L;  3ERS X;  4KD4 A;  2CQA A;  3T56 B;  1CKM A;  1QVF A;  1YJ9 A;  1XNQ Q;  3GO5 A;  3S1N H;  3GTQ H;  2K04 A;  2IWH A;  1TWG B;  2NVY H;  1WTV A;  4RKL A;  4V19 0;  3UDG A;  4L8J A;  2Q2H A;  1SAP A;  3F2C A;  1X65 A;  5LMU L;  3NBH A;  3HOU B;  2A74 C;  2R7Z G;  1Y8N B;  1KDA A;  1F2Z A;  2RHS B;  3CQZ H;  2B8F A;  3CXC A;  4GN5 A;  3S2D H;  3WOF A;  3A7A B;  3PGZ A;  3S1R H;  4QMG A;  1FL0 A;  4XXE A;  2Z1C A;  4DV2 L;  1WD1 A;  1SR3 A;  3J80 L;  1S3O A;  4XIG S;  2H1E A;  2K33 A;  3D4R A;  4H02 A;  2M00 A;  1K3B C;  3BU2 A;  3I4N B;  2R61 A;  1IBL L;  4PMB A;  5C3E B;  1ESR A;  1I4P A;  4KMU C;  3VYU A;  2K4K A;  3EIV A;  1M8A A;  3CMA A;  2IL8 A;  1I4H A;  2IX0 A;  4KTA A;  1HRJ A;  3S1N B;  3T1H Q;  3CCS A;  1YZ6 A;  2JXM B;  1EFI D;  4HTH A;  1ET6 A;  4H7B A;  3PUV A;  2R93 H;  1WOC A;  4DV0 L;  3M4Y A;  3MXN A;  4EQP A;  4CKB A;  1GOZ A;  4ZCK A;  2Y0S G;  3M4Q A;  3J7A 5;  4KKS A;  2B2U A;  2XSC A;  5EGT A;  2K5D A;  1I4Q A;  1U9R A;  4IPH A;  4A3E B;  1EU3 A;  3H0G H;  2KBN A;  1P16 A;  4IPG A;  5A2Q E;  3T51 B;  5M3F G;  4GKJ Q;  3GV3 A;  2F52 A;  2MUY A;  4DR7 Q;  2F4I A;  5JJL A;  2V1C C;  4DR5 Q;  1MD2 D;  4A3J H;  1SE2 A;  2JEB I;  1GXD C;  1LTB D;  3RNU A;  3HZX A;  2J7Z A;  4KN4 C;  1DOL A;  2EYO A;  2DN8 A;  4GLX A;  1HNX L;  2JA5 G;  4IFD H;  3BDO A;  3CD6 A;  2A6H C;  3G71 A;  3S1M H;  1L1O B;  3HOU G;  1KAW A;  4A93 G;  3DWQ A;  3F2U A;  4C3H G;  1PVO A;  1VQ4 A;  2K32 A;  3PO3 G;  2VXW A;  2EVB A;  5C3W A;  4RCN A;  1Y1V H;  2F0O A;  4QL5 A;  4BBR H;  5M5Y H;  2A5H A;  2QIL A;  4R1J A;  2EZV A;  3CAM A;  1F9P A;  1O7Y A;  4B08 A;  1GVP A;  4BS9 A;  3S1Q H;  4BY7 B;  3MFY A;  5BN5 A;  2VNU D;  3D6C A;  2L1B A;  4C2M H;  4A3I H;  4EX5 A;  3PQI A;  1B70 B;  3FHW A;  3I4M G;  4X66 L;  3FEW X;  2O4X A;  4OO1 G;  2PNH A;  3MTS A;  4A3J G;  1NNX A;  1VS0 A;  2L55 A;  2X6L A;  4B3T L;  4K5W A;  4FF4 A;  4BA1 I;  1MHW C;  3K5N A;  1BQQ T;  3E0J A;  2PO4 A;  2BOS A;  3T16 A;  2KED A;  4I65 A;  3SVM A;  1W6K A;  3I73 A;  3NEM A;  4AIM A;  1TWA H;  2K7V A;  1CHQ D;  2HUG A;  2R92 G;  3CC7 A;  3TN2 A;  3D4W A;  2B29 A;  2KEC A;  2RCN A;  4YHH L;  5IT9 L;  1F9Q A;  1S5B D;  4PQX A;  3SEB A;  4DV1 L;  1NAP A;  1SE4 A;  1SSO A;  4KD3 A;  1A8V A;  4LF5 Q;  2F0S A;  2CCZ A;  1VQ6 A;  1X3E A;  4AYB E;  3K59 A;  1X55 A;  2UU9 L;  3PSI A;  4Y7N H;  4KI0 A;  5IP9 H;  4KHV A;  4JI0 Q;  1DON A;  4J6H A;  4BBR G;  3BVZ A;  3CCV A;  1PLF A;  2I07 B;  1PV4 A;  1EY9 A;  3BYT B;  4BBR B;  1PXU A;  1X56 A;  2PZT A;  2WII B;  3RMH A;  3D6W A;  4DK6 C;  1II3 A;  1PTO B;  4DF7 A;  1GUN A;  1PHJ A;  3PMF A;  5GAH C;  4IUQ A;  1DCZ A;  4JYA L;  4F88 A;  3T13 A;  4B3S Q;  2DJF C;  2Q8T A;  4CJ2 C;  5BN4 A;  1CA5 A;  3ONA B;  1SN8 A;  2G9D A;  1XPR A;  3I4N G;  1K28 A;  1NR2 A;  4O1N A;  2ASB A;  3SE0 A;  4RAU C;  1KD1 C;  3L9A X;  1PYS B;  5IWA Q;  1G6P A;  3QOL A;  1F2M A;  1WTH A;  4JI5 Q;  1QZH A;  3GTJ H;  2NVQ H;  4RGN A;  1Y1V G;  4HCE A;  4UAI A;  4PG3 A;  3VR3 A;  2K5H A;  3BS1 A;  4IQZ A;  2Y0S B;  3F2D A;  1EWC A;  1H9S A;  5LMN W;  2IPK D;  3S16 B;  2NN6 G;  4FO2 A;  4IUR A;  3PIO A;  2RDF A;  1TVX A;  1SE3 A;  2ZJQ A;  1GHK A;  1Q8K A;  2EY5 A;  1JJ2 A;  2E2J H;  3J80 E;  3FPU B;  2JA6 B;  3I4O A;  3QB3 A;  5M9O A;  3A55 A;  2Z4H A;  4C3I H;  1EY4 A;  2E2I B;  3MXU A;  2R92 B;  5C4J H;  2JA8 H;  4IAL A;  4JI0 L;  1MSG A;  3D4D A;  1BNZ A;  4L5R C;  1F9S A;  1O7L A;  1U4M A;  2IT1 A;  3KF6 B;  5ELC A;  3MEF A;  1Q12 A;  1WVL A;  2GA4 B;  1SXT A;  4A3E H;  1WTR A;  1XMO L;  3F2B A;  1KDB A;  4OEM B;  1N34 L;  4A3G G;  2EPB A;  3OYY A;  4X64 Q;  1VQJ A;  4JI1 Q;  3WOE A;  3S14 B;  3URY A;  1K73 C;  5IGF A;  1J6Q A;  2F3I A;  1STA A;  2F0W A;  2P5Z X;  4RFB A;  2CFM A;  5CYU A;  4JC0 A;  4UP9 A;  1J8I A;  1ENC A;  4LNQ A;  2N55 A;  4A93 H;  2DY7 A;  3HOZ G;  3NHH A;  2SDF A;  2AUJ D;  4E6I A;  4B3M Q;  3K0Y A;  4L5S A;  5JJK A;  2E8G A;  1KTK A;  2IJ0 A;  2UUA L;  4PZ7 A;  2VUM B;  5JPM C;  5C4X G;  2MJ8 A;  2L9H A;  1Z7T A;  1H9K A;  4XQJ A;  4B3M L;  1GHJ A;  3PO2 H;  2XWJ B;  1JIC A;  2A8V A;  4LF6 L;  3OW7 A;  5J3B A;  2CQO A;  1B9M A;  3KF8 A;  1M4V A;  1SNC A;  2RDH A;  1BO0 A;  5M3F H;  1G2T A;  2XN9 C;  2GN5 A;  2RVL A;  2GVA A;  4Z9C B;  1BBW A;  2IX3 A;  2L15 A;  4PZ8 A;  1VQG A;  2CKZ B;  1JMC A;  1DD2 A;  1JB3 A;  1S5E D;  2G5D A;  3QO2 A;  3H0G B;  5G3L D;  1AH9 A;  4DNT B;  5T1G A;  1RHP A;  1WCM B;  3A54 A;  4MZ9 A;  3HOZ H;  1I6V C;  1WTQ A;  1X32 A;  2LS0 1;  2N78 A;  3DUZ A;  1EQV A;  1XWE A;  1S5C D;  4OGQ C;  4K0K L;  3S2D B;  4NW2 A;  1VMC A;  3LWE A;  4ZLT F;  5BN3 A;  1PH9 A;  4LF9 L;  5K36 G;  1YHQ A;  1A0I A;  4RHR A;  3R2T A;  3K6O A;  1R9T B;  1KRS A;  2A73 B;  1K9M C;  2JYO A;  1FGB D;  1SEB D;  2X6G A;  4FP5 D;  2I46 A;  1LTR D;  4C3I G;  3HOY B;  2UUC Q;  1IW7 D;  2RQX A;  3LX0 A;  2JA8 G;  4LFC Q;  2A68 D;  3JAM L;  4LFB L;  4GOP B;  4WFN 3;  2MQH A;  1K8A C;  5IGG A;  4DAP A;  1Q46 A;  4DA2 A;  1XTC D;  3QR8 A;  1OXX K;  1O7I A;  4FVM A;  1EYG A;  2F03 A;  1GD7 A;  1NMF A;  1I6H B;  3CF5 A;  3PUW A;  5IT9 E;  2K5Q A;  5C0X I;  1JOR A;  4DR3 Q;  5FLM H;  1E3P A;  1BCP C;  3S17 H;  1C0A A;  4Q5V A;  1XJV A;  4XT1 B;  5E3F A;  4AYB G;  3FDT A;  1IZ6 A;  3A5U A;  1H9S B;  1N32 Q;  3A7L A;  5JVG 3;  1WD0 A;  2KOL A;  2E2J B;  5JVH 3;  2NYZ D;  1SYF A;  4A3E G;  1E24 A;  4HMI A;  4K14 A;  5IP7 G;  1JE4 A;  2DUD A;  1G6Z A;  3VR4 A;  2WIN B;  2PW7 A;  2NUC A;  3GDE A;  4C3I B;  3S14 H;  4JBM A;  1NJI C;  1BCP D;  2KJX A;  1AFP A;  3KYH C;  1HZA A;  2RCF A;  3GTJ B;  3T1Y Q;  2NVQ B;  1FGU A;  4KY6 A;  1DOM A;  3EFX D;  4UY8 C;  1G8Z D;  4JCV E;  5KND A;  4BBS G;  4RGT A;  3PIO 3;  1QVC A;  2B2V A;  3STB C;  1PRT C;  1A2U A;  3DWP A;  1TWC H;  4OIK A;  4IOC A;  1A3U A;  2PQE A;  2QF7 A;  1XMQ L;  2J4X A;  2KCM A;  4A3G B;  5IIF A;  3BG3 A;  5AJ3 Q;  2A6E C;  5HY6 A;  4ZAI A;  1EWH A;  4QUC A;  4BA2 I;  5T1I A;  1XMQ Q;  4P71 A;  4DV7 Q;  2WB1 B;  1EL0 A;  3I7F A;  4NPS A;  3FKI G;  3G48 A;  3VR5 A;  2NZ1 D;  2NVX B;  3GTP B;  1YHB A;  4LAA A;  5FO8 B;  3FMC A;  4X3U A;  1OTC A;  2SNS A;  2QA4 A;  1R9T H;  1HFG A;  2Q8I B;  4A3D B;  2A68 C;  1QWY A;  2K28 A;  4TKO B;  3FP9 A;  1I3Q H;  3BYY B;  1ENF A;  4DK0 A;  3L3O C;  3AYH B;  2K1B A;  1L0Y B;  2QCP X;  3ZJY C;  3M85 A;  1SMX A;  4JI7 Q;  2IW3 A;  4AQY Q;  2MO0 A;  2JA9 A;  4DV4 L;  1C4Q A;  4A3I G;  1VF7 A;  4HJA A;  1WI5 A;  5LMN L;  1EY6 A;  4DV6 L;  5ELD A;  4OO1 H;  5E7N A;  2K5N A;  1PTO D;  5JEA H;  1AZP A;  2VS1 A;  1VCI A;  3ULP A;  4HMJ A;  1WYD A;  2PQA A;  1F2L A;  3TZU A;  1WTW A;  3HOV H;  4HSV A;  5CV9 A;  3KBG A;  2XVS A;  3DHQ A;  3P7J A;  5HGQ A;  2FFK B;  2I5H A;  4G7Z C;  4A3F H;  1TWA B;  5M3M G;  4JI6 L;  2ATW A;  3OTO L;  1PTO F;  3PIP 3;  3MAQ A;  1RTN A;  1R4Q B;  1IKM A;  3NUC A;  1XX8 A;  3VYS A;  2ZJP A;  3TS0 A;  2ES2 A;  2VUM G;  1V1Q A;  4A75 A;  3PO3 H;  1RDP D;  4KHZ A;  1IHZ A;  4X3S A;  4G7O C;  1B50 A;  4LK1 C;  3AFP A;  3RZD H;  1TS2 A;  4GOP A;  1BXT A;  1AE2 A;  1DYQ A;  1STB A;  3C3L A;  4HJ5 A;  1XPO A;  4A3D H;  5D65 A;  4OX9 L;  4C56 C;  5GQO A;  5KIX A;  4K0K Q;  2F0Q A;  5FJ8 G;  4RGO S;  1D8L A;  2EY1 A;  2J0T D;  4CDC C;  3HOW B;  3ULL A;  1F9R A;  4F7X A;  5EQ0 A;  3FKI B;  2L0C A;  3NWT A;  3PF4 A;  2LXK A;  1QJO A;  3OIP A;  1SYE A;  3NK9 A;  4FDB A;  2LXJ A;  1YI2 A;  1Q86 C;  3TQY A;  1BVS A;  3LWU A;  2Z6B A;  3SGI A;  1ICF B;  4QUF A;  3KOJ A;  3E9H A;  3HOX H;  2QKI C;  4GN4 B;  2E2I H;  4CJ0 B;  1CHP D;  1PZI D;  4HR7 B;  1S72 A;  1N33 L;  2K5V A;  4JI8 Q;  1ROD A;  4LF4 Q;  2F1M A;  3IFD A;  2JQO A;  3VYR A;  1GM5 A;  5EPJ A;  2UUA Q;  4RHS A;  4PMW A;  1N33 Q;  4N8F A;  3J80 c;  1GUS A;  3CHB D;  3FKI H;  2B2T C;  5C44 G;  1WJJ A;  3HOY G;  1UNS A;  1I4G A;  1PFS A;  3I2Z A;  1YNN C;  4F87 A;  4ZKC B;  5JEA G;  5C0X J;  1IBK L;  1LT4 D;  4LFA Q;  4ABN A;  4MNO A;  2B63 H;  2AHO B;  4JI3 L;  1C8C A;  5BR8 L;  2KHS A;  1QVG A;  3MWY W;  2K14 A;  3F1Z A;  1TS4 A;  3MEH A;  4P72 A;  3K5L A;  3GTO H;  3RLO A;  4B9W A;  2VQF L;  1N34 Q;  2VQE Q;  4JOI C;  2F0M A;  5JJZ A;  2AQ2 B;  3HOX B;  4KK7 A;  4XTC S;  5FO7 B;  5IGD A;  1B7Y B;  2ZJR A;  1XXG A;  1UEA B;  1IKL A;  3G7L A;  1HXY D;  5GAG C;  2WV6 D;  3T53 B;  1E22 A;  3HOV B;  3HG9 A;  1FJG L;  1IW7 C;  5C3E G;  1BBU A;  3S9W A;  4OWX B;  2JK8 A;  4C3J H;  3R93 A;  3I4N H;  2EYH A;  5AFW A;  4LWC A;  2QDL A;  2Z6K C;  3EN2 A;  4NXN Q;  4DR4 Q;  1FNU A;  3K80 C;  3NP8 A;  3KDF A;  3QOJ A;  4FNF A;  4HJ7 A;  2MPM A;  1GUT A;  3A56 A;  1N8R C;  2MNA A;  1SND A;  1Q8I A;  2M2L A;  1PH1 A;  1SDF A;  3D3R A;  4ALP A;  3J81 c;  3OTO Q;  3D0F A;  2FMC A;  3CQZ B;  2CWA A;  4A3D G;  1STY A;  4A3M G;  1GO3 E;  3C46 A;  2JN4 A;  2N49 A;  3W2D A;  3M9B A;  1I4R A;  2PQA B;  5FLX E;  3M7N A;  3PUZ A;  4BBS H;  1N36 L;  1YHA A;  2C5C A;  1B3Q A;  4R4I A;  3V96 A;  1S40 A;  1JR0 D;  1IBM Q;  1T9H A;  1TWC B;  4QF4 A;  1X9N A;  1KRT A;  4GNX A;  1KIX A;  1TKW B;  1J5E Q;  4JI7 L;  3HOU H;  1FR3 A;  1GUG A;  1NE3 A;  3CME A;  1KLG D;  1PH4 A;  2ZTE A;  4AYB B;  3H6M A;  1B44 D;  2FMM A;  4R9W A;  1YNN D;  4JPB W;  1I50 H;  5IYB G;  1X6O A;  4MHE A;  3M4O H;  4PNY A;  2IX1 A;  2OWO A;  1YIT A;  1FNV A;  2Q8R E;  3SK8 A;  1X3F A;  1SNM A;  2B2V C;  2A6H D;  3N52 A;  3VA7 A;  4AQY L;  2R7Z B;  4A3B B;  1CZG A;  3TME A;  1U5K A;  1ASZ A;  4KN7 C;  1Q81 C;  3NEN A;  1SE8 A;  4CHT B;  3K57 A;  3A74 A;  5C4X H;  5LL6 S;  4A93 B;  4CJ1 B;  1LTT D;  3B6Y A;  2NN6 H;  1Y8O B;  4J1M A;  2F0E A;  1P8L A;  3K0X A;  2CHB D;  1PH2 A;  1TWF H;  2HIV A;  4O42 A;  1HNX Q;  1GKH A;  3J7Z C;  1OXU A;  1IBL Q;  2O5I C;  1BCP F;  5DNF A;  4CDE C;  5EBC A;  2XNA C;  1QCB D;  1WTX A;  2WB1 G;  2R93 B;  4LUV A;  3CCJ A;  1E2V A;  4A3F B;  1H9J A;  4YWM A;  4C3J G;  2MO1 A;  1PRT D;  3CCM A;  4A3F G;  1ZYR C;  3W3A A;  1PTO C;  3NPP A;  4DUZ Q;  2VL6 A;  2YTY A;  2E5L L;  1QG7 A;  1WFQ A;  1EUJ A;  3AQQ A;  1I5F A;  3EQL C;  4DPG A;  1HZ9 A;  2JA6 H;  5C3E H;  1UE1 A;  2E5L Q;  1CKN A;  1BR9 A;  3H3V C;  1MSH A;  1QNK A;  3MA2 B;  5ELE A;  1C48 A;  1EY0 A;  3HGB A;  1EOV A;  1LTS D;  4OWT B;  5EKK A;  5C44 H;  2D9U A;  2D2C C;  2EYP A;  1CQF A;  3SK6 A;  4M8A A;  3GTM H;  2R7F A;  1HFN A;  5C5M A;  2AWN A;  1W6J A;  3I8Z A;  4TRD A;  4EGV A;  1ASY A;  1A63 A;  1HNW L;  1RTO A;  3BZC A;  5C4Z A;  2GVB A;  4DFA A;  1LO5 D;  1MKH A;  3VR6 A;  4BY1 G;  4YY3 L;  2DJG C;  2NVY B;  5CV6 A;  2I0Q A;  4AH6 A;  3STB D;  1IL8 A;  1Q1E A;  2MP1 A;  4KHP L;  1JT8 A;  2PMZ E;  3UE1 A;  3HOX G;  4DR2 L;  1TR5 A;  5I2Y A;  1N9W A;  3NQT A;  3A0J A;  1A2T A;  4KY7 A;  5D3D A;  3BJU A;  3ND9 A;  2F4V L;  3GTM B;  2A19 A;  1PH6 A;  2K50 A;  4B9X A;  1RIP A;  1SRU A;  4O0A A;  3R8B A;  1HHV A;  3I4M B;  3A8I E;  2B2T A;  2F0L A;  2F0K A;  2HT1 A;  2F0T A;  2F4V Q;  2E76 C;  1EQQ A;  5EKI A;  3KK7 A;  4GKK Q;  4X65 Q;  3ND8 A;  3CRL C;  4DR4 L;  2AMC B;  4UP8 A;  2XTI A;  5LHY 1;  3K5O A;  2R7D A;  4XDX A;  4A3M B;  1KLU D;  5IYD G;  4GKK L;  3CKI B;  2IHE A;  3DEP A;  1B9N A;  3KLS A;  4RGM A;  3RR5 A;  1I50 B;  1UAP A;  1QNU A;  2K03 A;  2YTX A;  3K8A A;  3PF5 A;  1QIL A;  4NXM L;  2V4D A;  2L5T A;  3L7Z C;  2X69 A;  3Q23 A;  1VQA A;  3TZD A;  4B3R Q;  1Q90 A;  3WDN A;  3QJY A;  5M3M H;  3HOV G;  4ILW A;  3TRZ A;  4WJ3 M;  3GTG H;  3HKZ G;  1LTL A;  2PZU A;  4ZKB B;  1SYC A;  4N8X 1;  4DUY Q;  3MXP A;  3S16 H;  4TQU S;  2LSS A;  3AU7 A;  1OXS C;  5FLM G;  1YBY A;  2EIF A;  3DLL A;  1CFM A;  4A3K B;  3OMC A;  1HCZ A;  2M9V A;  1VQN A;  4WOR A;  5FLX L;  3PO2 B;  3EJI A;  1RF2 D;  3TP7 A;  1SLJ A;  1V1P B;  3I90 A;  2K52 A;  4WJW A;  2R92 H;  2F3V A;  2HCI A;  2N88 A;  3BVM A;  1D5Z C;  1HTP A;  4A3C G;  1D1I A;  3PO3 B;  1HPC A;  4A3L H;  4HJ9 A;  3I4M H;  4L63 B;  5C6A A;  4KV6 A;  1AP0 A;  2K05 A;  3PCO B;  3Q8D A;  3CPW A;  3RZO H;  3ERQ A;  3L2P A;  3Q24 A;  3GTK B;  4P75 A;  1E1T A;  1SYB A;  3X3M A;  1ENA A;  4RCO A;  2NTS A;  4X65 L;  4X62 Q;  3HKS A;  3FVQ A;  5COR A;  3T4A C;  1QB5 D;  2XWB B;  1NY4 A;  5IYC H;  1LT3 D;  4DV4 Q;  3KF8 B;  3AB9 A;  4ZUJ A;  4X6A H;  1EEF D;  5CR3 A;  3G6J B;  1HA5 A;  2H4O A;  4FXK C;  1LYL A;  1E2Z A;  5JAV A;  2EQS A;  5FOB B;  4GKJ L;  5JPN C;  2FHT A;  3R2I A;  1AEX A;  5C4H A;  1K0S A;  1E0B A;  4L5Q A;  1A62 A;  2JA8 B;  1EYC A;  3KFU A;  4C3H H;  2UXD L;  2Q2U A;  3Q0A A;  4KLK A;  4ME3 A;  4LF7 L;  1UE7 A;  1LV9 A;  1G91 A;  4DR6 L;  3UE0 A;  2D5D A;  4DUY L;  3HOW G;  2B63 G;  1BCP B;  1VQD A;  4EVO A;  2ZM6 L;  3NWS A;  4HIK A;  2EXD A;  3GV6 A;  4JG2 A;  1EOT A;  4IZ8 A;  1KAB A;  5M5X B;  4HAE A;  3K58 A;  2KUM A;  1YNJ C;  4L5T A;  4LF5 L;  1MI2 A;  1Z6H A;  2WB1 E;  1FD7 D;  1Y1V B;  3MHB A;  1J5E L;  3MZ5 A;  1LTA D;  4R4C A;  4C3J B;  1EIG A;  3CP0 A;  2LFN A;  3F8T A;  2B2Y C;  4JV5 Q;  2F3W A;  4XT3 B;  1EQT A;  1B53 A;  3RLN A;  1CM9 A;  1A3T A;  3J81 i;  2H5X A;  2F0H A;  5KYI A;  2PW5 A;  3P75 A;  4JV5 L;  1HH2 P;  1I4X A;  3S1R B;  1K3R A;  4JYA Q;  1CTM A;  4H0L C;  2HQL A;  4DAV A;  1VQL A;  2B2U C;  1RKN A;  1F77 A;  4A3L G;  3JAM i;  1E1O A;  2B2W C;  3RD4 A;  4ZK9 B;  2ICE C;  5KRU A;  3S1M B;  4A4I A;  1ML0 D;  5LL6 X;  3TDQ A;  1SMY C;  2KA7 A;  1PFB A;  2F0N A;  2JP1 A;  3EBE A;  4CKC A;  1WTP A;  4HIO A;  4U67 3;  3VYT A;  1ICW A;  2EXZ A;  4QJF A;  3U4Z A;  5M3M B;  1EU4 A;  4GN3 B;  4C1N I;  5IY0 A;  3KLW A;  1IXR A;  2YU9 H;  4DV7 L;  4OXP A;  4WRD A;  1PA6 A;  3GTL B;  2YYZ A;  3GQB A;  2UXB L;  1DM0 B;  4K6D A;  4IUU A;  3CPF A;  1RJT A;  2SOB A;  4KJN A;  4DUZ L;  1O7Z A;  2CWP A;  5CC4 A;  5NUC A;  2BE5 C;  1UE5 A;  4LF9 Q;  1Y1W G;  1KAA A;  1VF5 C;  1YNJ D;  3IAY A;  4ZUI A;  1EIF A;  1SYD A;  1M1K C;  1EFW A;  4B3R L;  2RA4 A;  4YCU A;  3ULJ A;  1PTO H;  1C9O A;  1OXT A;  1CUK A;  2HDL A;  3PO2 G;  4NXM Q;  1HQM C;  1MIU A;  1ESF A;  2EY2 A;  4IOA A;  4G7H C;  4OIJ A;  4QGU A;  4LFB Q;  1RCV D;  4DR1 Q;  4DU9 A;  1TWG H;  1A6X A;  4DR7 L;  5C3X A;  2OT2 A;  4DXG A;  1STG A;  2AKW B;  2OF1 A;  4CBV A;  3HEJ A;  3QG1 A;  2C35 B;  4DR3 L;  1PMR A;  1OO9 B;  1Q3L A;  4KY5 A;  2FIN B;  3K7U C;  5IYC G;  3CCU A;  1CI3 M;  3U50 C;  1B3A A;  5I4D A;  2ZXO A;  3DEO A;  3IFT A;  4M1U B;  4NDX A;  1HNZ Q;  3KLS X;  1R4P B;  3HFZ B;  1CQV A;  4BXX G;  1TS5 A;  1BKB A;  2KQ3 A;  4P74 A;  4DV0 Q;  4H13 C;  1TU2 B;  4K5V A;  3MVV A;  3NTI A;  4RKB A;  3TEH B;  2WKD A;  1N32 L;  1B4O A;  3J81 j;  4HID A;  2AUK A;  3GD7 A;  3I3C A;  3D8G A;  1Z47 A;  2NWG A;  5CBA E;  2EOT A;  1D5X C;  3NSW A;  5LMU Q;  4K5X A;  4K6L A;  4X62 L;  2D0O A;  3CCR A;  4FXD A;  3HOZ B;  1Q82 C;  4QIW E;  4QIW B;  2PZW A; 
#chains in the Genus database with same CATH homology
 4UDU C;  1B1Z A;  1XYI A;  3M3Y B;  4JK1 C;  1SJE D;  1ONL A;  2QEJ C;  4CKE A;  4IFD I;  1JOK A;  1SNO A;  2QDB A;  2JEA I;  2MGS A;  4IUP A;  1TY0 A;  1MBY A;  3A8K E;  3JAM E;  4ODG A;  3VR2 A;  2A6E D;  4DK1 A;  3SR1 A;  5IOD A;  1EZ6 A;  2F0U A;  5FKA C;  5K5P A;  1SNQ A;  1GUO A;  3O13 A;  5I9P A;  2PCF B;  2ID0 A;  2OXP A;  2ICI A;  3Q22 A;  2B63 B;  1HTL D;  3NBI A;  1EIH A;  4OL7 A;  5COY A;  4BWG B;  1CZW A;  2DNE A;  4OHJ A;  4DXF A;  4HCS A;  2OEO A;  3SDZ A;  3H94 A;  5IGC A;  3GTG B;  1U4P A;  3K7A B;  1O78 A;  1PRT F;  1O80 A;  4K8I A;  4R8N A;  2RBM A;  1STE A;  4N9T A;  3C2P A;  2LKV A;  1H9R A;  1SJH D;  5ELF A;  3TP5 A;  5JOB A;  2XRQ D;  1PYW D;  3UI2 A;  2BCO A;  1SBB B;  1EZ8 A;  3MXG A;  2BDN A;  4HN7 A;  2DNC A;  5K36 H;  4V0B A;  5CMD A;  1TT2 A;  3GTO B;  1BDO A;  4ID6 A;  2TSS A;  2KVM A;  1K8O A;  2K01 A;  3D31 A;  1SFO B;  2F0G A;  2E2D C;  2Z8L A;  2EDG A;  3J81 L;  4H44 C;  1U4R A;  2DY8 A;  2NN6 I;  3KBX A;  5EPL A;  1IYU A;  5C4J B;  2NVT B;  1JWM D;  2NTT A;  3R3O A;  5DM6 3;  2E74 C;  1HUM A;  4MN3 A;  1NCV A;  3HS0 C;  3U9O A;  2VB3 X;  1GUW A;  1A3V A;  3RLF A;  4NKL A;  2L12 A;  1EYD A;  1JWS D;  3H91 A;  3TSS A;  3U9S A;  3BDL A;  4RH6 A;  5CBE E;  4LJZ C;  5EPK A;  3SK4 A;  4TSS A;  4FF2 A;  2EY6 A;  4G57 A;  1MGS A;  5M5W B;  2WP8 J;  2RDG A;  1JQY D;  1S5D D;  4PMC A;  3NTK A;  3PUX A;  3FPP A;  2NB0 A;  4HSP A;  4XYO A;  1PZK D;  3V05 A;  4IFD J;  2ZT9 C;  5CV8 A;  1PFN A;  4DNR B;  1CT1 D;  1X3P A;  5DEH A;  1VDZ A;  4DN4 M;  3S15 B;  1CA6 A;  3CRK C;  1ZEQ X;  3SK5 A;  4KKU A;  4MIU A;  2PNR C;  3V2T A;  1VMP A;  2HQE A;  1EEI D;  4IUN A;  2ZXP A;  2F0J A;  1LT6 D;  4XQQ A;  4ZQ3 A;  1ZXT A;  4ZYS A;  2F0P A;  2EYF A;  1G2S A;  2JA5 B;  3PV0 A;  5HUR A;  1AN8 A;  2LY7 A;  3BVG A;  2JE6 I;  3RZO B;  3Q6S A;  4FF1 A;  5KNC A;  5JEA J;  5C0X G;  3X3N A;  4FF3 A;  2JA7 B;  4NMZ A;  3AMU A;  2O5J C;  5IOC A;  2PPB C;  1NSN S;  2L4N A;  2XRS D;  2E75 C;  4CGY B;  4X3T A;  5CV4 A;  2WAQ B;  1ET9 A;  2SNM A;  3OSO A;  1BBX C;  1SYG A;  4C1N K;  3IKJ A;  3K5M A;  3I4L A;  2RSN A;  1TWF B;  2AQ1 B;  1TWH B;  2F0I A;  1D2B A;  1DXM A;  5C0X H;  1QE6 A;  4DAY A;  3S17 B;  1FNW A;  1T5X D;  4BBS B;  5CGK A;  3KUP A;  2WAC A;  1V43 A;  3OWE B;  1LT5 D;  3HP3 A;  2BE5 D;  1EY7 A;  1B2T A;  2CVR A;  3J81 E;  3DWA A;  4L6T B;  4K2K A;  5FO9 B;  3TP6 A;  2K6A A;  5F2D A;  1LLR D;  2EJG C;  3I70 A;  3TBI B;  3M4O B;  2TMP A;  2B2W A;  2B8G A;  3NTH A;  5D14 A;  4I7Z C;  3FRP B;  1S4Z A;  1TY2 A;  4IFD G;  2PYK A;  4R8I A;  3OHX C;  5EJW A;  5C4X B;  1PFM A;  2EYL A;  2C9O A;  5I2X A;  2O2L D;  1ZYR D;  4IN3 A;  4ULL A;  2YU9 B;  2VB2 X;  1EYA A;  1UUP A;  5D3I B;  3VA5 A;  4HED A;  1CK1 A;  1WTO A;  1STH A;  3RUZ A;  5J22 A;  1G29 1;  5E1F A;  1KNE A;  3J7A F;  5FK9 C;  4K2L A;  5DAU A;  1V1O A;  1LAC A;  3CU7 A;  1D5M C;  1EY5 A;  4IUV A;  1NUC A;  4RA8 A;  3E6Z X;  1K8M A;  3HKZ B;  5G3L F;  3OPO A;  4J8Q A;  4RWS C;  1F2Y A;  4Q0F A;  2KCC A;  3BDC A;  4P2C B;  3C1F A;  1BOS A;  2RSO A;  5CV5 A;  2EYJ A;  2AWO A;  1NR4 A;  2KCN A;  2ENB A;  4A3I B;  1LAB A;  1DOK A;  2LMC B;  3ZYY X;  1PZJ D;  1AW7 A;  4ME5 A;  1S5F D;  1TQO A;  1V8Q A;  2EJM A;  5CV7 A;  1HA6 A;  2EYM A;  1Y1W B;  1PDQ A;  4XQN A;  1HQR D;  1K83 B;  2E2H B;  4ZRZ A;  2RKS A;  4XYQ A;  3C1E A;  2MHV A;  4QCL A;  1ILQ A;  2F0V A;  3KLR A;  1SNP A;  1GJX A;  5E4X A;  2Z4I A;  5KNB A;  4BY1 B;  2XIW A;  4DGZ A;  5A35 A;  3M7G A;  5J1Z A;  3A8J E;  4K8J A;  3NQI A;  1T5E A;  2EE1 A;  2ZXR A;  1RD9 D;  3MFG A;  1E2W A;  2AQ3 B;  4IUT A;  4S3S A;  1DJR D;  5J39 A;  5IGE A;  2BA0 A;  2R3Z A;  3OOC A;  3S2H B;  3NE5 B;  5C5L A;  3EA6 A;  1TS3 A;  5M5Y B;  4OO1 I;  1KDC A;  1LTI D;  4PV1 C;  2F0D A;  1BF4 A;  4N9P A;  2A69 D;  2KEE A;  4Y7N B;  2HCC A;  1JC7 A;  3H09 A;  4U68 A;  3P1H A;  2BA1 A;  3I91 A;  2SEB D;  2BDO A;  3OWF A;  1FYC A;  3QWN A;  1Q1B A;  1OXV A;  3N6R A;  1HUN A;  1J9O A;  4A3J B;  2EJF C;  5A2Q L;  1A15 A;  3E5S A;  4GZY C;  5KEE A;  3PUY A;  2A69 C;  5DM7 3;  1JWU D;  5KGU A;  1PRT B;  3OIQ A;  1Y69 U;  1H9M A;  4KKT A;  3MC0 B;  5E4W C;  4LMQ D;  4EQN A;  1ILP A;  2K5W A;  3IL8 A;  5EKL A;  4EQO A;  2L11 A;  5C44 B;  4C3H B;  5I6Y A;  3S1Q B;  5ISR A;  3OMG A;  3DXJ C;  1QOH A;  5ELB A;  1I3Q B;  4F8M A;  1JOO A;  3J7A V;  3SXH A;  1JCK B;  4NP5 A;  5M3F B;  1L0X B;  1BUV T;  5I9O A;  1V1P A;  1EY8 A;  5IGB A;  3TP8 A;  3DMU A;  1ZKO A;  5TSS A;  1U4L A;  2B39 A;  3BZD B;  1KNA A;  4C2M B;  3GP7 A;  5HGT A;  2FJ2 A;  3DM1 A;  1Y8P B;  2B2Y A;  4QB4 A;  3RZD B;  1TII D;  1IYV A;  3GTQ B;  3LNN A;  3HRZ C;  4G4K A;  3ITP A;  1SMY D;  2NBF A;  4FYD A;  1X3Q A;  2CW0 C;  4YIJ A;  5EBD A;  2R6G A;  2D62 A;  3P20 A;  3J7Y W;  2WKC A;  2F0F A;  3ERO A;  4FXG C;  3I72 A;  2PMZ B;  2HDM A;  4KJO A;  1JOQ A;  5KYL A;  1DZ1 A;  3NXW A;  1D6E C;  2CW0 D;  4JBW A;  1STN A;  3EVQ A;  3SHL A;  2JSO A;  2G9H D;  1D1K A;  1LTG D;  3QIA A;  4X3K A;  1AZQ A;  5I6W A;  3T56 B;  2CQA A;  4KD4 A;  3GO5 A;  2K04 A;  2IWH A;  1WTV A;  1TWG B;  4RKL A;  4V19 0;  4L8J A;  1SAP A;  3NBH A;  3HOU B;  2A74 C;  1Y8N B;  1KDA A;  1F2Z A;  2B8F A;  3WOF A;  3A7A B;  4QMG A;  4XXE A;  2Z1C A;  1WD1 A;  3J80 L;  4XIG S;  2H1E A;  2K33 A;  3D4R A;  2M00 A;  3I4N B;  2R61 A;  4PMB A;  5C3E B;  1ESR A;  1I4P A;  4KMU C;  3VYU A;  1M8A A;  2IL8 A;  1I4H A;  2IX0 A;  4KTA A;  1HRJ A;  3S1N B;  2JXM B;  1EFI D;  4HTH A;  1ET6 A;  4H7B A;  3PUV A;  3M4Y A;  3MXN A;  4EQP A;  4CKB A;  1GOZ A;  4KKS A;  2B2U A;  2XSC A;  5EGT A;  2K5D A;  1I4Q A;  1U9R A;  4A3E B;  1EU3 A;  5A2Q E;  3T51 B;  3GV3 A;  2MUY A;  2F4I A;  1MD2 D;  1SE2 A;  2JEB I;  1GXD C;  1LTB D;  3HZX A;  2J7Z A;  4KN4 C;  1DOL A;  2EYO A;  2DN8 A;  4IFD H;  3BDO A;  2A6H C;  3DWQ A;  3F2U A;  4C3H G;  2K32 A;  2VXW A;  2EVB A;  5C3W A;  4RCN A;  2F0O A;  2A5H A;  2QIL A;  2EZV A;  1F9P A;  1O7Y A;  4B08 A;  4BS9 A;  4BY7 B;  3MFY A;  5BN5 A;  2VNU D;  3D6C A;  2L1B A;  3FEW X;  2O4X A;  4OO1 G;  3MTS A;  2L55 A;  2X6L A;  4K5W A;  4FF4 A;  4BA1 I;  3K5N A;  1BQQ T;  3E0J A;  2PO4 A;  2BOS A;  3T16 A;  2KED A;  4I65 A;  3SVM A;  1W6K A;  3I73 A;  2K7V A;  1CHQ D;  2HUG A;  3TN2 A;  3D4W A;  2KEC A;  5IT9 L;  1F9Q A;  1S5B D;  4PQX A;  3SEB A;  1NAP A;  1SE4 A;  1SSO A;  4KD3 A;  2F0S A;  3K59 A;  4KI0 A;  4KHV A;  1DON A;  4J6H A;  3BVZ A;  1PLF A;  2I07 B;  1EY9 A;  3BYT B;  4BBR B;  1PXU A;  2PZT A;  2WII B;  3RMH A;  3D6W A;  1II3 A;  1PTO B;  4DF7 A;  1GUN A;  3PMF A;  4IUQ A;  1DCZ A;  4F88 A;  3T13 A;  2Q8T A;  4CJ2 C;  5BN4 A;  1CA5 A;  3ONA B;  2G9D A;  1NR2 A;  4O1N A;  3SE0 A;  4RAU C;  3L9A X;  3QOL A;  1F2M A;  4RGN A;  4HCE A;  4UAI A;  3VR3 A;  3BS1 A;  4IQZ A;  2Y0S B;  1EWC A;  1H9S A;  2IPK D;  3S16 B;  2NN6 G;  4FO2 A;  4IUR A;  2RDF A;  1TVX A;  1SE3 A;  1GHK A;  2EY5 A;  3J80 E;  3FPU B;  2JA6 B;  3QB3 A;  5M9O A;  3A55 A;  2Z4H A;  1EY4 A;  2E2I B;  3MXU A;  2R92 B;  4IAL A;  1MSG A;  3D4D A;  1BNZ A;  1F9S A;  1O7L A;  1U4M A;  2IT1 A;  5ELC A;  1Q12 A;  1WVL A;  2GA4 B;  1SXT A;  1WTR A;  1KDB A;  2EPB A;  3WOE A;  3S14 B;  3URY A;  5IGF A;  1STA A;  2F0W A;  4RFB A;  5CYU A;  1J8I A;  1ENC A;  2N55 A;  2DY7 A;  3NHH A;  2SDF A;  2AUJ D;  4E6I A;  3K0Y A;  1KTK A;  2IJ0 A;  2VUM B;  5JPM C;  2MJ8 A;  2L9H A;  1Z7T A;  1H9K A;  4XQJ A;  1GHJ A;  2XWJ B;  1JIC A;  3OW7 A;  1B9M A;  3KF8 A;  1M4V A;  1SNC A;  2RDH A;  1BO0 A;  1G2T A;  2XN9 C;  2RVL A;  4Z9C B;  2IX3 A;  1DD2 A;  1JB3 A;  1S5E D;  3QO2 A;  3H0G B;  5G3L D;  4DNT B;  5T1G A;  1RHP A;  1WCM B;  3A54 A;  1I6V C;  1WTQ A;  1X32 A;  2LS0 1;  3DUZ A;  1EQV A;  1XWE A;  1S5C D;  4OGQ C;  3S2D B;  4NW2 A;  1VMC A;  3LWE A;  4ZLT F;  5BN3 A;  5K36 G;  4RHR A;  3R2T A;  3K6O A;  1R9T B;  2A73 B;  2JYO A;  1FGB D;  1SEB D;  2X6G A;  4FP5 D;  4C3I G;  2I46 A;  1LTR D;  3HOY B;  1IW7 D;  2RQX A;  3LX0 A;  2A68 D;  3JAM L;  4WFN 3;  5IGG A;  4DAP A;  4DA2 A;  1XTC D;  1OXX K;  4FVM A;  2F03 A;  1I6H B;  3PUW A;  5IT9 E;  2K5Q A;  5C0X I;  1JOR A;  1BCP C;  4Q5V A;  4XT1 B;  5E3F A;  3FDT A;  1H9S B;  3A7L A;  5JVG 3;  1WD0 A;  2KOL A;  2E2J B;  5JVH 3;  2NYZ D;  1SYF A;  4HMI A;  4K14 A;  1JE4 A;  1G6Z A;  3VR4 A;  2WIN B;  2PW7 A;  2NUC A;  4C3I B;  1BCP D;  2KJX A;  1AFP A;  3GTJ B;  2NVQ B;  4KY6 A;  1DOM A;  3EFX D;  1G8Z D;  5KND A;  4RGT A;  3PIO 3;  2B2V A;  1PRT C;  1A2U A;  3DWP A;  4OIK A;  1A3U A;  2PQE A;  2QF7 A;  2J4X A;  4A3G B;  5IIF A;  3BG3 A;  2A6E C;  4ZAI A;  1EWH A;  4QUC A;  4BA2 I;  5T1I A;  2WB1 B;  1EL0 A;  3VR5 A;  2NZ1 D;  2NVX B;  3GTP B;  4LAA A;  5FO8 B;  3FMC A;  4X3U A;  2SNS A;  1HFG A;  2Q8I B;  4A3D B;  2A68 C;  1QWY A;  2K28 A;  4TKO B;  3BYY B;  1ENF A;  4DK0 A;  3L3O C;  2K1B A;  1L0Y B;  2QCP X;  3M85 A;  2IW3 A;  1C4Q A;  1VF7 A;  1EY6 A;  5ELD A;  4OO1 H;  1PTO D;  5JEA H;  1AZP A;  1VCI A;  4HMJ A;  1F2L A;  3TZU A;  1WTW A;  4HSV A;  5CV9 A;  3KBG A;  2XVS A;  3DHQ A;  3P7J A;  2FFK B;  4G7Z C;  1TWA B;  1PTO F;  3PIP 3;  3MAQ A;  1RTN A;  1R4Q B;  1IKM A;  3NUC A;  1XX8 A;  3VYS A;  1RDP D;  4KHZ A;  1IHZ A;  4X3S A;  4G7O C;  1B50 A;  4LK1 C;  1TS2 A;  1BXT A;  1DYQ A;  1STB A;  3C3L A;  5D65 A;  4C56 C;  5KIX A;  2F0Q A;  4RGO S;  2EY1 A;  2J0T D;  3HOW B;  1F9R A;  4F7X A;  5EQ0 A;  3FKI B;  2L0C A;  3NWT A;  1QJO A;  3OIP A;  1SYE A;  3NK9 A;  3LWU A;  4QUF A;  2QKI C;  4CJ0 B;  1CHP D;  1PZI D;  4HR7 B;  1ROD A;  2F1M A;  3IFD A;  3VYR A;  5EPJ A;  4RHS A;  4PMW A;  1GUS A;  3CHB D;  2B2T C;  1UNS A;  1I4G A;  1YNN C;  4F87 A;  4ZKC B;  5JEA G;  5C0X J;  1LT4 D;  4ABN A;  1C8C A;  2KHS A;  3MWY W;  1TS4 A;  3MEH A;  3K5L A;  4B9W A;  2F0M A;  5JJZ A;  2AQ2 B;  3HOX B;  4KK7 A;  4XTC S;  5FO7 B;  5IGD A;  1XXG A;  1UEA B;  1IKL A;  3G7L A;  3HOV B;  1HXY D;  2WV6 D;  3T53 B;  3HG9 A;  1IW7 C;  3S9W A;  3R93 A;  2EYH A;  5AFW A;  1FNU A;  3NP8 A;  3QOJ A;  4FNF A;  2MPM A;  1GUT A;  3A56 A;  1SND A;  1Q8I A;  2M2L A;  1SDF A;  3D3R A;  2FMC A;  3CQZ B;  1STY A;  3C46 A;  3W2D A;  1I4R A;  5FLX E;  3M7N A;  3PUZ A;  2C5C A;  3V96 A;  1JR0 D;  1TWC B;  4QF4 A;  1TKW B;  1FR3 A;  1GUG A;  1KLG D;  4AYB B;  3H6M A;  1B44 D;  2FMM A;  4R9W A;  1YNN D;  4MHE A;  4PNY A;  2IX1 A;  1FNV A;  2Q8R E;  3SK8 A;  2B2V C;  1SNM A;  3VA7 A;  2A6H D;  3N52 A;  2R7Z B;  4A3B B;  1CZG A;  3TME A;  4KN7 C;  4CHT B;  3K57 A;  5LL6 S;  4A93 B;  4CJ1 B;  1LTT D;  2NN6 H;  1Y8O B;  4J1M A;  2F0E A;  2CHB D;  4O42 A;  1OXU A;  2O5I C;  1BCP F;  5DNF A;  5EBC A;  2XNA C;  1QCB D;  1WTX A;  2R93 B;  1E2V A;  4A3F B;  1H9J A;  4C3J G;  1PRT D;  1ZYR C;  3W3A A;  1PTO C;  3NPP A;  1QG7 A;  3EQL C;  1BR9 A;  3H3V C;  1MSH A;  1QNK A;  3MA2 B;  5ELE A;  1C48 A;  1EY0 A;  3HGB A;  1LTS D;  5EKK A;  2D9U A;  2D2C C;  2EYP A;  1CQF A;  3SK6 A;  4M8A A;  1HFN A;  5C5M A;  2AWN A;  1W6J A;  3I8Z A;  4TRD A;  4EGV A;  1RTO A;  5C4Z A;  4DFA A;  1LO5 D;  3VR6 A;  2NVY B;  5CV6 A;  1IL8 A;  1Q1E A;  2MP1 A;  1TR5 A;  5I2Y A;  3NQT A;  1A2T A;  4KY7 A;  5D3D A;  3ND9 A;  3GTM B;  4B9X A;  1HHV A;  3R8B A;  3I4M B;  3A8I E;  2B2T A;  2F0L A;  2F0K A;  2F0T A;  2E76 C;  5EKI A;  3KK7 A;  3ND8 A;  3CRL C;  5LHY 1;  3K5O A;  4XDX A;  4A3M B;  1KLU D;  3CKI B;  3DEP A;  1B9N A;  3KLS A;  4RGM A;  1I50 B;  1UAP A;  1QNU A;  2K03 A;  1QIL A;  2V4D A;  2L5T A;  3L7Z C;  2X69 A;  3Q23 A;  3TZD A;  1Q90 A;  3WDN A;  3QJY A;  4ILW A;  2PZU A;  4ZKB B;  1SYC A;  3MXP A;  4TQU S;  3AU7 A;  1OXS C;  1CFM A;  4A3K B;  3OMC A;  1HCZ A;  2M9V A;  4WOR A;  5FLX L;  3PO2 B;  3EJI A;  1RF2 D;  3TP7 A;  1V1P B;  3I90 A;  4WJW A;  2F3V A;  2HCI A;  2N88 A;  3BVM A;  1D5Z C;  1HTP A;  1D1I A;  3PO3 B;  1HPC A;  4L63 B;  5C6A A;  4KV6 A;  1AP0 A;  2K05 A;  3ERQ A;  3Q24 A;  3GTK B;  1SYB A;  3X3M A;  1ENA A;  4RCO A;  2NTS A;  3FVQ A;  5COR A;  3T4A C;  1QB5 D;  2XWB B;  1LT3 D;  4ZUJ A;  3AB9 A;  1EEF D;  5CR3 A;  3G6J B;  1HA5 A;  2H4O A;  4FXK C;  1E2Z A;  5JAV A;  5FOB B;  5JPN C;  2FHT A;  3R2I A;  1AEX A;  5C4H A;  1E0B A;  2JA8 B;  1EYC A;  3Q0A A;  1LV9 A;  1G91 A;  2D5D A;  1BCP B;  4EVO A;  3NWS A;  3GV6 A;  1EOT A;  4IZ8 A;  1KAB A;  5M5X B;  4HAE A;  3K58 A;  2KUM A;  1YNJ C;  1MI2 A;  1Z6H A;  1FD7 D;  1Y1V B;  3MHB A;  3MZ5 A;  1LTA D;  4C3J B;  1EIG A;  2LFN A;  2B2Y C;  2F3W A;  4XT3 B;  1EQT A;  1B53 A;  1CM9 A;  1A3T A;  2F0H A;  5KYI A;  2PW5 A;  3P75 A;  3S1R B;  1I4X A;  1CTM A;  4H0L C;  4DAV A;  2B2U C;  1RKN A;  1F77 A;  2B2W C;  3RD4 A;  4ZK9 B;  2ICE C;  5KRU A;  3S1M B;  1ML0 D;  5LL6 X;  3TDQ A;  1SMY C;  2KA7 A;  1PFB A;  2F0N A;  2JP1 A;  4CKC A;  1WTP A;  4U67 3;  3VYT A;  1ICW A;  2EXZ A;  5M3M B;  1EU4 A;  4C1N I;  4WRD A;  3GTL B;  2YYZ A;  3GQB A;  1DM0 B;  4K6D A;  4IUU A;  1RJT A;  2SOB A;  4KJN A;  1O7Z A;  5CC4 A;  5NUC A;  2BE5 C;  1KAA A;  1VF5 C;  1YNJ D;  3IAY A;  4ZUI A;  1SYD A;  2RA4 A;  1PTO H;  1OXT A;  2HDL A;  1HQM C;  1ESF A;  2EY2 A;  4G7H C;  4OIJ A;  1RCV D;  4DU9 A;  1A6X A;  5C3X A;  2OT2 A;  4DXG A;  1STG A;  2OF1 A;  4CBV A;  3HEJ A;  3QG1 A;  1PMR A;  1OO9 B;  1Q3L A;  4KY5 A;  2FIN B;  1CI3 M;  1B3A A;  5I4D A;  2ZXO A;  3DEO A;  3IFT A;  4M1U B;  4NDX A;  3KLS X;  1R4P B;  1CQV A;  1TS5 A;  2KQ3 A;  4H13 C;  1TU2 B;  4K5V A;  3MVV A;  3NTI A;  4RKB A;  2WKD A;  1B4O A;  2AUK A;  3GD7 A;  3I3C A;  3D8G A;  1Z47 A;  2NWG A;  5CBA E;  2EOT A;  1D5X C;  3NSW A;  4K5X A;  4K6L A;  4FXD A;  3HOZ B;  4QIW B;  2PZW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...