1C4QA

Mutated shiga-like toxin b subunit (f30a/w34a) complexed with receptor gb3 analogue
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
69
structure length
69
Chain Sequence
TPDCVTGKVEYTKYNDDDTFTVKVGDKELATNRANLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Toxin
molecule keywords PROTEIN (SHIGA-LIKE TOXIN I SUBUNIT B)
publication title Identification of the Primary Receptor Binding Site of Shiga-Like Toxin B Subunits: Structures of Mutated Shiga-Like Toxin I B-Pentamer with and without Bound Carbohydrate
rcsb
source organism Escherichia coli
total genus 16
structure length 69
sequence length 69
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 1999-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1c4qA00
2GA4B 1CZWA 1CZGA 2C5CA 1R4QB 1D1IA 1C48A 1DM0B 1CQFA 4ULLA 1C4QA 4M1UB 1D1KA 2XSCA 1QNUA 1QOHA 3MXGA 1BOSA 2BOSA 4P2CB 1R4PB
chains in the Genus database with same CATH superfamily
2AHOB 1SRUA 3NWSA 2A68C 3D4WA 1W2BA 1XX8A 3CMAA 4JBJA 4KHZA 2R93H 3D6WA 3HS0C 1SYBA 1B70B 4B3RQ 4F88A 1BDOA 1VQEA 2QEJC 3G71A 1SXTA 2PYKA 1I3QB 3HKZG 4LF6Q 2UUBL 2PZUA 2X69A 4JK1C 2V1CC 4H44C 4HJAA 1PDQA 2K5WA 5LMUL 2YV5A 4JV5Q 1PTOD 3PGZA 5IP9G 1DXMA 3S1RB 4LF5Q 2QW7A 3RZDB 3FHWA 3HOYB 5FLMH 1EYAA 4QMGA 3WDNA 4NXMQ 1YNJD 3MFYA 2HCCA 2PNRC 4O1NA 4B3RL 5C0XI 3I7FA 3MEHA 3F2CA 5CV4A 2F0WA 4G7ZC 3VYSA 4C2MH 2F0DA 3K5MA 1LACA 4LF6L 4EGVA 3D6CA 2LXKA 4KKTA 5C3WA 4A3KB 1KHIA 1RL2A 1TQOA 5AJ3Q 2UU9Q 3MAQA 3OHXC 2VUMB 3I3CA 2DY7A 2IHFA 3M7NA 5IYCG 4LF5L 1ICFB 4LF8Q 3FKIB 3NSWA 1WFQA 2CQOA 3M4QA 1HFGA 4AH6A 5KYLA 2I07B 1XPOA 3HOWH 2IX0A 2JSOA 1H9SB 4LF4Q 4R9WA 2O4XA 1EZ8A 5C44H 1PH6A 4OHJA 4AYBG 1R4QB 1I4PA 2SEBD 1MI2A 2JP1A 5AJ3L 2LMCB 1TS5A 1ZXTA 2UU9L 1LYLA 2PPBC 1SE8A 4ZCKA 5LL6S 4Y7NB 2B2UA 3ZJYC 1FNWA 1JOKA 4DU9A 1PZID 4LMQD 3VR4A 2BE5D 1W3SA 4LF8L 3HP3A 5JEAJ 3V2TA 2JA7G 3V96A 1MHWC 2R6GA 2Z8LA 1U0LA 1ML0D 4C3IG 1IBKQ 1F2YA 1V1QA 4LF4L 2CH4W 4LJZC 5KGUA 1B2TA 1PFBA 2KCNA 4A75A 1ESRA 1K73C 1A3UA 1PRTC 2R93B 2LXJA 4A93H 3A5ZB 3QOJA 5J39A 4ZQ3A 1KLUD 2LS01 2UXBL 4GOPB 4HJ5A 2N55A 2E2IH 4B3SQ 5IGGA 3N52A 4EX5A 1CKMA 4C3HH 1TWCB 1T9HA 3GTQH 1IBKL 3J81j 4L5SA 4DV3Q 5I4DA 1FL0A 1Y1VB 3MEFA 3K7AH 1Y8NB 1QVCA 1JWUD 2NVXH 1J8IA 1QB5D 3PO2G 3RD4A 3TQYA 3W1GA 4A3BH 4PMWA 4JI7Q 2NB0A 1KDBA 5L37A 1WTOA 2L55A 1EY5A 1HZCA 2EYJA 1SNPA 4C2MB 2K6AA 2GN5A 1A2TA 3RLNA 4B3SL 4DF7A 4A3LG 1GKHA 4LUOA 2EIFA 4LK1C 3HOZH 2HQLA 2RA4A 2A6EC 3KJPA 2SDFA 1GOZA 1LT5D 4M8AA 1Y8OB 4DV3L 3GTGH 1RHPA 3NE5B 1Q3LA 3JAMi 4RCNA 4DV7Q 2O5IC 3C2PA 2Q2HA 4JI7L 4R4QA 1LTID 1PHJA 5GAHC 3BDOA 2IT1A 2MNAA 1K8AC 1D7QA 3K57A 5C44B 3H3VI 3LWEA 2MQHA 1HA6A 3P1HA 4Q0FA 1EY9A 5C0XG 2WINB 2JEAI 2B8FA 5T1IA 4KKSA 3PUXA 3VYUA 4IPDA 1R4PB 2H5XA 2MO0A 1V1OA 1GUOA 1DYQA 5I6WA 5CV6A 3SE0A 1BNZA 2IPKD 1E1OA 2FFKB 4DV7L 4DR7Q 2E75C 3L9AX 4TQUS 1LTGD 3KFUA 5IT9c 1M8AA 1MJCA 1Q81C 1B3QA 3STBC 1JORA 2UXDQ 2IHEA 4DAVA 4X6AH 1GUWA 2EYPA 4BBSG 4A93B 1QG7A 5FJ8G 3S1QH 1LTRD 3ER0A 4RKBA 4DKAC 4A3CH 2FINB 1I4HA 1ASZA 3FVQA 5IGFA 2L0CA 4JC0A 5AFWA 1S3OA 2PI2E 1DGSA 2A68D 2FXQA 3LGJA 2E2IB 4GOPA 3A7AB 4DR7L 1IL2A 2OTJA 1Q1BA 2EYMA 3BYYB 3GTQB 2BA0A 3KBXA 1HUNA 2WV6D 1U4MA 1M1KC 2DJGC 4IFDI 3LNNA 1NNXA 1EWCA 3DWQA 1XNQQ 2UXDL 5CR3A 1STAA 2NVXB 4DAMA 1VQIA 5NUCA 2YYZA 2WKDA 4MIUA 1F2MA 4A3BB 1KTKA 1YHQA 4BA1I 3I4OA 5GAEC 1YITA 1KABA 5IP7G 1QCBD 2DGYA 3BVGA 4DV4L 2EXZA 4IUUA 3PO3G 3J7YW 1N9WA 1PZJD 3NP8A 1ICWA 2PO4A 1X65A 2EY6A 1BOSA 4J15A 1LV9A 3HOZB 1SYEA 2FMCA 2XGTA 3U58A 5EKLA 1TWAB 3GTGB 1WTXA 1RTNA 4RHSA 1SNCA 1XNQL 1F2LA 4P71A 1Q7YC 3NTHA 4X64Q 5LHY1 5IYDH 1STBA 2WAQE 5ELNA 2N88A 4A3EH 2WACA 2AUJD 3UE0A 4X3TA 1FGBD 1MSGA 4N9PA 1JOQA 2LSSA 3CP0A 3AMUA 3SR1A 4L5QA 1V1PB 4BY1G 3K7UC 4DV1L 1IHZA 1KAAA 4KKUA 2OEOA 1G51A 1SNMA 5FLXL 3R8BA 2XIWA 1NCVA 1MKHA 1YNNC 3JAML 1YHBA 1E3PA 5FK9C 1B44D 2NBFA 4WFN3 4JI5Q 2B2YA 3R93A 1YNXA 2F0SA 1BQQT 1WCMG 4X64L 3MWYW 4DR5Q 3Q23A 1YJ9A 4DFAA 3NBIA 5IE8A 5G3LF 2YU9H 3D4DA 2KENA 5FO7B 4FNFA 1WTVA 3H3VC 2Q8IB 1TWFH 1CK1A 3OIQA 1U9RA 3G6JB 1B9NA 4DUZL 2M9VA 1PYSB 3NBHB 4A76A 3S1QB 1BF4A 1JMCA 5BR8Q 3RN5A 5IYBH 3DWPA 4H7BA 2NZHA 2NZ1D 1BCPC 4NKLA 2K14A 4JYAL 2EQSA 4UP9A 3RLOA 2JA5H 3NTIA 4ZUIA 1VQ5A 2KUMA 1KIXA 3SK6A 2SNSA 1PRTD 2VZAA 4DR5L 4OELB 1FR3A 2Z6KA 2L9HA 2EJFC 3H0GG 4RAUC 2XWJB 4LF7Q 2RKSA 2TMPA 4RCOA 2A1AA 5I9PA 1OXUA 1N36Q 4LFBQ 2IL8A 1YVCA 2JA6H 5BR8L 1B4OA 1XNRQ 3A7LA 4RGMA 3F2BA 1EIYB 1VDZA 1VQ6A 1WYDA 1LT3D 3ZYYX 5FOBB 1EUJA 1B53A 2OTLA 1GO3E 1ILPA 1H9KA 3ITPA 4EQNA 1RODA 4ZKCB 4A3DB 3KLWA 4C3JG 4KY5A 2MFIA 5C3XA 1ZYRD 1I94Q 3WWVA 2B2UC 1STYA 4ID6A 1FVIA 3TS0A 3PIO3 1N36L 1L0YB 4LFBL 4CDCC 4L8JA 3IAYA 5IWAQ 3KLRA 3IFTA 4A3EB 1AZQA 1XNRL 4IFDG 1SNDA 1HRJA 4GN4B 2BH2A 2A6ED 4ME3A 5M9OA 3CCLA 3HOVB 1G6ZA 1Q12A 1EOTA 1PH9A 4YWLA 4OWWB 3ERQA 4NXNQ 4CHTB 4DPGA 2K1BA 3E9IA 1ET9A 4NMZA 3VYRA 1TIID 1GUGA 1I94L 3C1EA 3S2DH 2EYOA 1PH8A 3J7ZC 2NZOA 4JOIA 1Y1WG 2ATWA 3S1NH 1TT2A 4IUVA 4A4IA 3CC4A 3L7ZC 1SEBD 5EPLA 3Q8DA 3EN2A 5IWAL 2YU9B 3E0JA 1UEAB 1PH1A 5JJLA 2KCCA 3T13A 2HHHQ 1TWFB 1JQYD 3GTLH 5KYIA 2UXCQ 3HOUB 4CGYB 2WB1B 2E8GA 1LTTD 2K01A 2Z6BA 3NUCA 4IUQA 4UHVA 1PYBA 2JK8A 3Q24A 1GUSA 3W1BA 4O0AA 3C46A 2Q8TA 3GQBA 3I2ZA 2NVYB 4BY7G 3NBHA 5BN5A 1XPRA 2JA5B 1PFMA 5BN4A 4WJWA 2DJFC 1TY2A 3NELA 3E3XA 1SSOA 2VXWA 3HG9A 4L63B 2CW0D 5ELOA 5FLXE 3Q22A 3JAME 1EYDA 3HOYG 4ABNA 3PUZA 2SOBA 3OW2A 2E2DC 3A55A 4HMIA 1NAPA 5I2YA 2E76C 5EKKA 4L5TA 3EQLC 3BS1A 1IW7D 1TS3A 1KD1C 3PMFA 2AKWB 3PIPA 2L1BA 2RDHA 4A3GH 2WAQB 1RIPA 5J3BA 1VQHA 4FXGC 4XYQA 5GADC 3W5OA 2VUMG 1WTQA 1QZGA 5C5MA 3RN2A 5D14A 4A3JB 1EYGA 2OT2A 1PA6A 3FKIG 2QDBA 4RGNA 1MGSA 3I4LA 1CSQA 3HFZB 2PMZE 2K50A 3FEWX 2L11A 2A19A 3M4YA 3VR3A 3NWTA 1VQKA 3M4OH 1HR0Q 5CYUA 5C3EH 5IY0A 2ZJQA 2OF1A 3S14H 1HHVA 3ND8A 3EFXD 3QG1A 2KCTA 5LL6X 1X3GA 4JI1Q 4LUZA 4O42A 1IYJB 1P8LA 4YWMA 3TZDA 5FO9B 2QKIC 4HCSA 4IJHA 1QJOA 1UE5A 4PZ6A 3SK5A 1QOHA 2ZXOA 3S2DB 5LMNQ 3D3RA 4F87A 4A3MB 2BDOA 4X3SA 3TP6A 1HR0L 3S1NB 1IBMQ 3T53B 1LM0A 2I46A 4DK0A 1EU4A 4GOPC 2EXDA 1CA5A 1VQ8A 1DOLA 3I55A 3GTPH 4DR2Q 1X55A 3KYHC 4H13C 1HQRD 4LFCQ 2R93G 4K5WA 2Z4HA 1GHJA 2PI2A 4JI1L 1YNND 3GTJH 3U4VA 5IT9E 4DK1A 3HOXH 1CA6A 5C4JB 1OXXK 3I70A 3SDZA 1C8CA 3GO5A 4JI2Q 2PQEA 5LMNL 2F0JA 1HH2P 4OIJA 3O13A 2XWBB 1L1OA 1CSPA 1IBML 4QJFA 5JJKA 1Y1VG 3M7GA 3ONAB 3RMHA 5ELFA 1EEFD 4DR2L 4LFCL 4AIMA 1EQQA 1TWHB 5IGEA 3MHBA 1F77A 1BCPD 2F0MA 2O2LD 3NQTA 3VR2A 1TS2A 3T1YL 4YCUA 4ILWA 1VQCA 2EYLA 1K8MA 1S4ZA 2NTTA 3TEHB 3I4MH 5JAVA 3V05A 1PH4A 4DV5Q 4A3GB 1NMGA 1STGA 4JI2L 2OCEA 4CJ0B 2RHSB 2L12A 2NN6H 1Q46A 1DZ1A 3A8KE 3OSOA 2YTYA 1NSNS 3J81c 4YWKA 4RG1A 4G4KA 1PFSA 3SVMA 1YEZA 3KF6B 3G48A 1OXVA 1SFOH 1I4GA 2GVBA 2B2WA 2KA7A 3U4ZA 2NVTH 4PV1C 3M4OB 3AQQA 2YTXA 1RKNA 4XQJA 2B2YC 1WTPA 3TN2A 4FF2A 4HMJA 5C44G 3S14B 2XRSD 3MXNB 2EPBA 4WJ4A 1D1IA 3BU2A 5IOCA 5ELDA 4DV5L 3CCRA 4OO1I 2DY8A 4BBRH 4DK6C 4PMBA 5K5PA 2PW5A 3R2IA 5JEAH 3QOLA 4H02A 3K81C 2UXBQ 2CH4A 5M3MH 2RHQB 3AEVA 4DNRB 4POGA 5CGKA 2NVQH 2FHTA 2Q2IA 2F0FA 3GTOH 1HNWL 2JYOA 1VQLA 4DV0L 1G2SA 4CDFC 3GTPB 2Z6KC 1QILA 2ZXRA 1JWMD 3X3MA 4WJ3M 4I7ZC 4RMFA 4A93G 1K83H 2D5DA 4FF4A 2F52A 5EBDA 5K36H 1E7ZA 3I72A 5ELBA 2N3SA 2WIIB 4JI0Q 3L3OC 2C35B 2JA7H 4XQNA 2ZTCA 1DCZA 2ZTDA 1AE2A 3CCSA 3GV6A 4R4OA 2R7ZH 1SNQA 4GLAC 1JB3A 1S40A 2EOTA 3HEJA 3FPUB 4PMCA 1DOKA 1UE1A 1PFNA 2Q8RE 3G7LA 1SYGA 3PF5A 4K5XA 2QF7A 1OXTA 1ZYRC 4A3BG 4C56C 5EAYA 3NTKA 1A0IA 3FDTA 4N8X1 2PMZB 3OTOQ 5J1ZA 4JI0L 3TBIB 1LTSD 1JB7A 1QVFA 3I4MB 1LTBD 3A0JA 1A8VA 1Q82C 3UDXA 1DM0B 2F0OA 4IPHA 3HOZG 4FXKC 4JW0A 2AQ2B 4XQQA 1PH7A 4ZAIA 1G2TA 2F0KA 3F2DA 4JPBW 1VCIA 4H0LC 1KDAA 2KHIA 3QB3A 1MBYA 4UP8A 4WRDA 4L5RC 2JEBI 1S5ED 1HXYD 4UY8C 2CVRA 5EQ0A 1SFOB 3PV0A 3DHQA 3SXHA 3J80c 1MD2D 3AB9A 3HOWB 1HNXQ 1PLFA 1G8ZD 2NVTB 3QWNA 3KF6A 3OTOL 4JOIC 1D2BA 4GKJQ 4HIOA 2G5DA 3NEMA 4BXXG 4MZ9A 5IIFA 4DV6Q 1ONLA 5CC4A 2MPMA 1PTOF 3F1ZA 3MXNA 4BBRB 3Q6SA 2Z9HA 1JE4A 1PV4A 4FF3A 2R92H 1P16A 5DM63 2VQFQ 3K5NA 3M3YH 3F2UA 1YJWA 4IPCA 5M3MB 1O7ZA 4LNQA 3MVVA 1SMYC 2NVQB 5EPKA 4K6LA 1HNXL 3GTOB 1L0WA 2YTVA 2N49A 4NPSA 4GKJL 3H09A 2CW0C 1BR9A 4DV6L 4DNTB 3NENA 4C1NI 1L0XB 4OXPA 1K83B 4BA2I 2I0QA 3W2DA 1D5MC 3PUWA 5C4XH 1CHQD 1VQDA 1VQJA 4CDDC 4ODGA 1SYDA 2K03A 3EA6A 4DV4Q 1SYCA 1X9NA 2VQFL 3KDFB 1O7IA 4PQXA 4YY3Q 1SYFA 4OO1G 1IW7C 5GROA 2KQ3A 2R7ZB 4K5VA 1HTLD 3NQIA 4C3HB 3T1HQ 4KY6A 1B3AA 4TSSA 2I5HA 5COYA 3PCOB 4HN7A 4LFAQ 4FP5D 4IUPA 4KTAA 2WB1E 5EPJA 1EQVA 2XNAC 5FJ8H 3K7AB 4XYOA 2L4NA 4CKEA 1Q8KA 3C1FA 3TS2A 2A8VA 1DOMA 2R7DA 1AFPA 3DXJC 3TMEA 2QGQA 3L2PA 2D62A 1QUQB 2F0LA 3QR8A 4YY3L 4DV1Q 4GNXC 3L0OA 1RD9D 1KRTA 1XPUA 4A3DG 4OL7A 1JC7A 3T1HL 3CCJA 4EQOA 2VS1A 1N33Q 1F2ZA 2HCIA 1W6JA 4LFAL 1CQVA 3A8JE 4YHHQ 2CWAA 1A3VA 2WFWA 2XN9C 3URYA 2M00A 4QF4A 2KJXA 5F2DA 4CJ1B 5IYDG 1U4RA 4A3EG 1CQFA 5JPMC 2ID0A 3BZDB 1IKMA 1H9RA 1QNKA 3HOVG 1M4VA 4NP5A 4XIGS 4ZLTF 3A8IE 4DUZQ 5DEHA 1SAPA 2PQAB 2NWGA 2K04A 4P73A 2JE6I 1N33L 3OOCA 3S2HH 2R92B 2K28A 3QJYA 4JYAQ 3P20A 1D5ZC 4LF9Q 3M3YB 3OYYA 3RNUA 4YHHL 1Y8PB 3MC0B 1KQSA 3IKJA 3UDIA 4BY1H 1SDFA 4QY7A 3MXUA 4R1JA 2CHBD 1N34Q 4ME5A 2VNUD 4UDUC 2X6LA 1G91A 3M85A 3HOUG 2WB1G 1EY6A 3K80C 3BVZA 3OWEB 1VF5C 3NK9A 1CI3M 2HUGA 1GD7A 1LO5D 2QILA 4TRDA 2PZTA 3TZUA 4LW1A 5C4XB 4HJ8A 1VQNA 4B9WA 1V8QA 4GLXA 1F9SA 1WCMH 1XTDA 3T56B 5E4XA 5GQOA 2JA5G 4JBWA 1KL9A 4LF9L 2EE1A 2RSOA 1OTCA 4A3KG 4FXDA 4KLKA 1Z9FA 3CRLC 3KBGA 2AQ1B 1FYCA 3KDFA 4DUYL 5KNBA 1WOCA 2DNCA 1XTCD 1SE2A 2JQOA 1B50A 1N34L 3DM1A 1U4LA 3EBEA 2IX1A 4P75A 2HT1A 5JJIA 1TS4A 2F0NA 1G291 4K8IA 1FJGQ 2EJGC 1PTOH 5BN3A 5M5YH 5HURA 4FO2A 2KVMA 1VMPA 4M1UB 2WAQG 3U9SA 2K5QA 4OIKA 1S5CD 1BBXC 5KNCA 3WOEA 4KHPQ 1EYCA 4YCWA 1ESFA 4A3IH 1X3EA 1K3BC 4DGZA 3NXWA 4X3KA 4A3JG 4G7HC 2ENBA 4K14A 1LTLA 1QUQA 2KCMA 4EQPA 1I6HH 3I90A 4YCVA 5A35A 5JVG3 1KNAA 4NW2A 1S72A 3GD7A 1X3FA 4N9TA 3PUVA 4TVAB 3BJUA 1XMOL 4CKBA 1U4PA 3ERSX 3GV3A 2J4XA 2K5VA 1FJGL 5EBCA 3AYHB 4R8IA 4QB4A 5IT9L 5CORA 3I4NG 2B63H 2H4OA 1BVSA 2RCNA 3FMCA 5KEEA 1HZ9A 1NBWA 4MN3A 4RGTA 4X65Q 3CCQA 4KHPL 2UUCQ 1CZWA 4MTNA 4OEMB 3CPFA 1ENCA 2B2VA 2ICIA 4IPGA 3OIPA 1IXRA 4QCLA 3KUPA 4PG3A 5TSSA 1A2UA 2F0QA 2PQAA 3CHBD 1EEID 4A3MG 4GKKQ 1VMCA 2JXMB 1FNVA 3CKIB 3DM3A 4V190 1EIGA 4DAYB 1PH2A 4HJ9A 3KF8A 5IGBA 5M3FH 4DR3Q 4O2DA 1YIJA 4KN7C 4BWGB 5D65A 3K8AA 2K5NA 4KJNA 3H15A 3K5LA 3CXCA 3CCEA 3P7JA 2LY7A 1SBBB 4X65L 1JJGA 2UUCL 4B3MQ 2E2HH 2F0HA 2EZVA 3VA7A 3KK7A 1Y14B 2NN6I 1GM5A 3P75A 1G6PA 5HY6A 1SMYD 5CV7A 1D1KA 1SJHD 4DK3C 4S3SA 3S17H 1L1OB 4YIJA 1VQMA 4GKKL 3BG3A 4QUFA 1XJVA 3U50C 3MA2B 3C3LA 5EJWA 1L2FA 4DR3L 1I4XA 4I65A 2RBMA 3RR5A 1JT8A 2C9OA 2HIVA 4P72A 4B3ML 5I2XA 2UUAQ 1HQMC 3M9BA 4GN5A 2JA8H 1RTOA 4BY7H 1PTOB 4GLVB 5M5YB 2JA6B 1S5DD 4IN3A 2Y0SB 1UEBA 1IKLA 5C6AA 4A3GG 2EVBA 1ENAA 4RWSC 1NE3A 3K59A 1R9TH 1DD2A 2I5LX 2PNHA 3BDLA 3D4RA 3PUYA 1K8OA 4A3IB 2AWOA 4DNIA 1SN8A 3AU7A 4A3FH 4LWCA 2XTIA 1IYUA 3CC2A 2DN8A 5ISRA 1I6HB 1ET6A 4X62Q 4JI3Q 3HKZE 3PF4A 1J9OA 3OPOA 1C4QA 3OW7A 2P5ZX 4HAEA 1HUMA 2UUAL 5E3FA 2RDFA 2PCFB 2PZWA 3A74A 2E2JH 1GHKA 1JOOA 4HSPA 4J6HA 2B63B 5CV8A 3J7AF 4DR4Q 1TKWB 3CCMA 1I4QA 1Y69U 4LUVA 1TY0A 1C48A 1O7LA 1PRTF 1EIFA 3GTMH 5LMNW 4ZRZA 4CBVA 3E6ZX 2L5TA 2O5JC 3PIP3 1KRSA 4X62L 4F7XA 4JI3L 5KIXA 1PMRA 1WVLA 1F9QA 4HIDA 4K0KQ 1MIUA 1T5EA 1S5FD 3KJOA 2B29A 2K7VA 2B39A 1PH5A 2IJ0A 4X3UA 5M3FB 1CKOA 3GTKH 4DAYA 1Z7TA 4DR4L 5T1GA 4E6IA 1AW7A 4ZK9B 2Z4IA 3GTLB 3VR6A 2E2HB 4C1NK 3T1YQ 2XSCA 3I73A 3KLSA 2ZJPA 4IURA 1LTAD 1KLGD 1SLJA 1VQBA 3HRZC 2F0VA 3AFQA 4UP7A 5A2QL 4AYBE 3S17B 4K0KL 1N32Q 1NY4A 2AWNA 3WOFA 1EL0A 1NMFA 2SNMA 5D3DA 2K05A 3DUZA 1UE6A 4U68A 4IJLA 1TXYA 5C4ZA 1EY8A 1W6KA 2VB3X 1NR4A 3BDCA 1JE5A 5FLMG 3VA5A 1VQ7A 1ENFA 3I8ZA 1JJ2A 2V4DA 1CFMA 4CJ2C 4KJOA 2JA8B 4BY7B 1BKBA 2N8NA 1UE7A 2GA4B 1TWCH 1UWVA 4DR1Q 3I4MG 2A73B 2OWOA 5H1SE 1STEA 2C5CA 4RH6A 5IP9H 1Y1VH 1R9TB 1N32L 2B2TA 2HDMA 2NN6G 3U9OA 1KDCA 1K8GA 3DLLA 1SE3A 1T5XD 2L15A 4A3FB 3FP9A 1ZKOA 2IX3A 3W3AA 4UAIA 2RF4A 1V9PA 4QGUA 3HOWG 1HNWQ 2K5HA 2LKVA 3PQIA 3OMCA 1J5EQ 1CZGA 4DV0Q 5C3EB 2E2JB 3DEPA 1JICA 2EY5A 4DR1L 4IOAA 3UI2A 4JV5L 3TDQA 1GJXA 1V43A 3Q0AA 4OWXB 4BBRG 5GAGC 2NYZD 5IYCH 1UUPA 2OXPA 2OQKA 2GVAA 3X3NA 5JEAG 5JVH3 3GTMB 2KHJA 4KD4A 4NXML 5FO8B 4JBMA 5J22A 5M3MG 1Q1EA 3CF5A 2QA4A 4IQZA 1DONA 2ASBA 4JBKA 4KV6A 4DXGA 2CWPA 1EFID 1GUNA 1U5KA 3EJIA 1MSHA 1AEXA 2AMCB 2D0PA 3ND9A 1J5EL 2ALYB 3TP5A 2E5LQ 5CBEE 1E1TA 3PSIA 3GTKB 1EQTA 1I6VC 3J81i 3MXPA 3G4SA 1BBWA 3HGBA 3CMEA 2FMMA 2KBNA 3T51B 4GS3A 5K36G 3S16H 3S1MH 2MJ8A 3UDFA 3GTJB 1E2ZA 3CCUA 4JI8Q 5M5WH 4L6TB 4HIMA 4CDEC 3HOXB 4C3IH 1CT1D 1Q86C 1HJPA 4U673 2R7ZG 5EKIA 4C3HG 5IODA 3LX0A 2VL6A 3J7A5 1C0AA 1EQRA 1A62A 3EVQA 3SGIA 4Q5VA 1X3PA 1VQ9A 4K6DA 4QIWB 2ZTEA 3E9HA 1LUZA 5FLXc 2E5LL 1JR0D 2F0GA 4HCEA 3CRKC 3JAMc 2Z0SA 4DR6Q 1AH9A 2A69D 2HD3A 1XMQQ 3HKZB 4AQYQ 2XVSA 2ZM6Q 2BA1A 2G9HD 1S5BD 4NB3A 2A74C 4XTCS 4JI8L 1I4RA 3E0EA 2H1EA 1JCKB 3G6EA 1TU2B 1TR5A 2F0UA 2NUCA 2RCFA 3OWFA 4ALPA 3PO2H 4P2CB 5A2QE 3ULPA 1WD0A 1WTRA 1A63A 2B2VC 1HCZA 2OQ0A 1WI5A 3AFPA 2JJQA 5G3LD 3CD6A 1HFNA 4DR6L 3D31A 4TKOB 3T4AC 1XMQL 4IALA 4X66Q 4AQYL 3QO2A 2ZM6L 3R3OA 5JPNC 4HJ7A 5CBAE 1EIHA 4A3LH 5C4HA 1SE4A 3CW2C 1TWAH 2DUDA 2F3IA 4QUCA 2DNEA 3N6RA 1X54A 2R92G 4LAAA 1O78A 4JI6Q 1F9RA 2ES2A 1XWEA 1K0RA 2A6HD 4XXEA 2Q2UA 1TWGH 2IW3A 4RFBA 5E7NA 1BCPF 2K5DA 3D0FA 2D9UA 4BXXH 1VF7A 1H9SA 2XRQD 4V0BA 4AYBB 4X66L 2VW9A 1UNSA 5C0XH 2JA9A 1B9MA 3IFDA 4RGOS 3UE1A 2KEEA 1FD7D 5C0XJ 5DLQE 3CU7A 3S16B 5C4XG 3S1MB 2BCOA 5CV5A 1EY7A 4K8JA 3J80i 4A3CG 3H94A 3SEBA 5M5WB 4JG2A 2JN4A 2F3WA 2B3GA 4KK7A 5CV9A 2JA7B 3OMGA 1H9JA 4JI6L 4EVOA 4C3IB 2I5MX 4FYDA 4DN4M 1XXGA 4HR7B 2A5HA 1QVGA 5E4WC 3BZKA 4Y52H 1EWIA 4BBSH 3J81L 1IZ6A 2QEXA 1JJCB 3H6MA 1IL8A 4MTKA 3T16A 1Q90A 1RF2D 3GDEA 2CCZA 2J7ZA 1PRTB 3CPWA 5HGTA 4OO1H 5E1FA 4MNOA 4XT1B 3FPPA 3TP8A 4R4TA 1PZKD 2PW7A 5IGDA 2R61A 3MXGA 2LFNA 3RZOH 1E24A 5HGQA 3TRZA 3A56A 4KD3A 1B1ZA 2BDNA 1XYIA 2K32A 3PO2B 2J0TD 3IL8A 1Z47A 4G7OC 2B8GA 4KHVA 2Y0SE 3HKSA 1SROA 5IP7H 1STHA 3PO3H 3KOJA 1E22A 2AQ3B 1WTHA 1SMXA 3J7AV 4APVA 4A3DH 4RA8A 2RSNA 1JWSD 2EJMA 1YZ6A 2R7FA 2RQXA 1H9MA 4JI4Q 2QDLA 3K0XA 5KNDA 3VDYA 3MZ5A 1OO9B 3EIVA 1HNZQ 3BYTB 4B08A 1C9OA 4R4CA 3KF8B 2F4IA 4IZ8A 3S24A 1VQPA 1TWGB 3K0YA 4HIKA 1QE6A 4ZYSA 3HOVH 1NR2A 4GN3B 4DUYQ 1D5XC 1L1OC 5ELCA 2F0IA 1SR3A 2K4KA 4CKCA 1BUVT 1EY4A 1PYWD 4ZKBB 2G9DA 3H91A 3ICEA 1GXDC 4JI4L 4R4IA 1PH3A 4B3TQ 5IYBG 4BS9A 4K2LA 4DA2A 3SK4A 1HNZL 1BO0A 2CFMA 3B6YA 3R2TA 5EGTA 4J8QA 1A6XA 4OWTB 3BVMA 4JVZA 4OX9Q 1PTOC 2FJ2A 4JCVE 3QIAA 1ASYA 2CQAA 3CC7A 1X3QA 3HOUH 3TP7A 1HA5A 2VY3A 2B2TC 1GVPA 3UDGA 1J6QA 3CQZH 4BBSB 2ZXPA 1HZBA 1IBLQ 4QL5A 1XMOQ 1YNJC 2F03A 3RUZA 1K3RA 2NVYH 4K2KA 3J80L 2ICEC 3H3VH 2JA6G 2B2WC 2Y0SG 2EYHA 4OONA 4B3TL 4A3KH 3PIOA 4JI5L 4I7AA 2CKZB 5DM73 1LLRD 4FDBA 1EOVA 4A3IG 1KC8C 1NJIC 1B7YB 3S15H 4QQBX 4FVMA 3H0GH 3K5OA 1E2WA 1CKNB 1HTPA 3RZOB 1DJRD 4OX9L 2K33A 2X6GA 1KXLA 1X32A 2Z1CA 5JJZA 2F1MA 1D8LA 4HEDA 2K52A 2RDGA 2KEDA 2QCPX 5C5LA 5CMDA 3EROA 1IBLL 1CUKA 3VYTA 1AZPA 4RHRA 1NUCA 4F8MA 3VR5A 1O7YA 2F3VA 3PO3B 3HZXA 2B63G 3DMUA 3J81E 1MJEA 1WJJA 4B9XA 4KY7A 4A3JH 2HDLA 4KI0A 1PVOA 1QZHA 4C3JH 3FRPB 4LF7L 1X56A 1LT4D 1E2VA 1E0BA 1RCVD 3SHLA 1PXUA 3A54A 4XDXA 1A15A 4J1MA 4GNXB 3S2HB 3S9WA 2VQEQ 1YI2A 2BE5C 2ZJRA 1NTGA 1N8RC 2F0TA 1AE3A 2K75A 3I4NH 1ZEQX 5I9OA 2EDGA 4IFDH 1I50H 1KAWA 2F4VQ 4DAPA 5M3FG 1C7YA 3D8GA 2KOLA 1CM9A 4BY1B 2RVLA 5M5XH 5FKAC 2TSSA 4IFDJ 2MP1A 3E5SA 1V1PA 3GP7A 4EQ5A 1O80A 3ULLA 4RKLA 2EYFA 1EY0A 2BH8A 2MO1A 3I91A 3TSSA 4UPAA 2WKCA 4IOCA 3NHHA 1VQFA 1OXSC 1AN8A 4OGQC 3F8TA 4A3MH 1BBUA 2A69C 1Y1WH 1QWYA 2NTSA 2VQEL 3DWAA 1WCMB 2KECA 4WORA 5JOBA 5ELEA 1CHPD 1FGUA 2KHSA 4KN4C 1K28A 4PZ7A 1LABA 1X6OA 1M90C 3IRBA 1RDPD 4HSVA 2N78A 3I56A 2F4VL 3MFGA 1Q8IA 2WP8J 1YHAA 4NDXA 3CQZB 4DV2Q 3DEOA 4NXNL 4KMUC 1I3QH 1STNA 5C4JH 4IUNA 2HQEA 1UAPA 2JA8G 1QNUA 4R8NA 1K0SA 2BOSA 2E74C 5KRUA 1F9PA 3STBD 1D6EC 1VQ4A 4FF1A 1BXTA 2MUYA 1VQOA 1EWHA 3JC66 1AP0A 2D2CC 1YJNA 3S1RH 1H95A 1EZ6A 3RZDH 3CCVA 2MHVA 3S15B 4QIWE 3HOYH 1HPCA 5IGCA 3H0GB 1I5FA 1TVXA 3NPPA 4A3FG 1BCPB 1TWHH 3A5UA 2HHHL 2D0OA 3RLFA 2Q2TA 1HR0W 1A3TA 2F0EA 2UXCL 2ZT9C 4P74A 1VQAA 4ULLA 1CKNA 1SNOA 1VS0A 4DV2L 1WTWA 2AUKA 5DAUA 4POFA 2F0PA 3MTSA 4GZYC 3M4PA 1K9MC 1ILQA 5C3EG 2A6HC 3TREA 5DNFA 1Z6HA 1FNUA 3LWUA 3K6OA 4N8FA 2VUMH 2VB2X 1SJED 1IYVA 4IO9A 4XT3B 2IWHA 3J80E 2EY1A 2R3ZA 3FKIH 5D3IB 4C3JB 1KNEA 4IUTA 4ZUJA 4MHEA 1EU3A 4PNYA 3CAMA 3KLSX 3K58A 2M2LA 4GNXA 3I4NB 5I6YA 4G57A 1RJTA 1EFWA 2EY2A 1I50B 1CTMA 1HZAA 1II3A 1WD1A 4DXFA 5M5XB 3ULJA 4Y7NH 3SK8A 1LT6D 2IY5B 2HIXA 2UUBQ 1GUTA 1B8AA 4PZ8A 1YBYA 4HTHA 3HOXG 3BZCA 1VQGA 5LMUQ 2MGSA 4Z9CB 1Y1WB
chains in the Genus database with same CATH topology
3NWSA 2A68C 3D4WA 1XX8A 4KHZA 3D6WA 3HS0C 1SYBA 4F88A 1BDOA 2QEJC 1SXTA 2PYKA 1I3QB 2PZUA 2X69A 4JK1C 4H44C 1PDQA 2K5WA 1PTOD 1DXMA 3S1RB 3RZDB 3HOYB 1EYAA 4QMGA 3WDNA 1YNJD 3MFYA 2HCCA 2PNRC 4O1NA 5C0XI 3MEHA 5CV4A 2F0WA 4G7ZC 3VYSA 2F0DA 3K5MA 1LACA 4EGVA 3D6CA 4KKTA 5C3WA 1TQOA 3MAQA 3OHXC 2VUMB 3I3CA 2DY7A 3M7NA 3FKIB 3NSWA 1HFGA 5KYLA 2I07B 2IX0A 2JSOA 1H9SB 4R9WA 2O4XA 1EZ8A 4OHJA 1R4QB 1I4PA 2SEBD 1MI2A 2JP1A 2LMCB 1TS5A 1ZXTA 2PPBC 5LL6S 4Y7NB 2B2UA 1FNWA 1JOKA 4DU9A 1PZID 4LMQD 3VR4A 2BE5D 3HP3A 5JEAJ 3V2TA 3V96A 2R6GA 2Z8LA 1ML0D 4C3IG 1F2YA 5KGUA 4LJZC 1B2TA 1PFBA 2KCNA 1ESRA 1A3UA 1PRTC 2R93B 3QOJA 5J39A 4ZQ3A 1KLUD 2LS01 2N55A 5IGGA 3N52A 1TWCB 5I4DA 1Y1VB 1Y8NB 1JWUD 1J8IA 1QB5D 3RD4A 4PMWA 2NB0A 1KDBA 1WTOA 2L55A 1EY5A 2EYJA 1SNPA 4C2MB 2K6AA 1A2TA 4DF7A 4LK1C 2RA4A 2A6EC 2SDFA 1GOZA 1LT5D 4M8AA 1Y8OB 1RHPA 3NE5B 1Q3LA 4RCNA 2O5IC 3C2PA 1LTID 3BDOA 2IT1A 3K57A 5C44B 3LWEA 1HA6A 3P1HA 4Q0FA 1EY9A 5C0XG 2WINB 2JEAI 2B8FA 5T1IA 4KKSA 3PUXA 3VYUA 1R4PB 1V1OA 1GUOA 1DYQA 5I6WA 5CV6A 3SE0A 1BNZA 2IPKD 2FFKB 2E75C 3L9AX 4TQUS 1LTGD 1M8AA 1JORA 4DAVA 1GUWA 2EYPA 4A93B 1QG7A 1LTRD 4RKBA 2FINB 1I4HA 3FVQA 5IGFA 2L0CA 5AFWA 2A68D 2E2IB 3A7AB 1Q1BA 2EYMA 3BYYB 3GTQB 2BA0A 3KBXA 1HUNA 2WV6D 1U4MA 4IFDI 3LNNA 1EWCA 3DWQA 5CR3A 1STAA 2NVXB 5NUCA 2YYZA 2WKDA 4MIUA 1F2MA 4A3BB 1KTKA 4BA1I 1KABA 1QCBD 3BVGA 2EXZA 4IUUA 3J7YW 1PZJD 3NP8A 1ICWA 2PO4A 2EY6A 1BOSA 1LV9A 3HOZB 1SYEA 2FMCA 5EKLA 1TWAB 3GTGB 1WTXA 1RTNA 4RHSA 1SNCA 1F2LA 3NTHA 5LHY1 1STBA 2N88A 2WACA 2AUJD 4X3TA 1FGBD 1MSGA 4N9PA 1JOQA 3AMUA 3SR1A 1V1PB 1IHZA 1KAAA 4KKUA 2OEOA 1SNMA 5FLXL 3R8BA 2XIWA 1NCVA 1YNNC 3JAML 5FK9C 1B44D 2NBFA 4WFN3 2B2YA 3R93A 2F0SA 1BQQT 3MWYW 3Q23A 4DFAA 3NBIA 5G3LF 3D4DA 5FO7B 4FNFA 1WTVA 3H3VC 2Q8IB 1CK1A 3OIQA 1U9RA 3G6JB 1B9NA 2M9VA 3S1QB 1BF4A 3DWPA 4H7BA 2NZ1D 1BCPC 4NKLA 3NTIA 4ZUIA 2KUMA 3SK6A 2SNSA 1PRTD 1FR3A 2L9HA 2EJFC 4RAUC 2XWJB 2RKSA 2TMPA 4RCOA 5I9PA 1OXUA 2IL8A 1B4OA 3A7LA 4RGMA 1VDZA 1LT3D 3ZYYX 5FOBB 1B53A 1ILPA 1H9KA 3ITPA 4EQNA 1RODA 4ZKCB 4A3DB 4C3JG 4KY5A 5C3XA 1ZYRD 2B2UC 1STYA 4ID6A 3PIO3 1L0YB 4L8JA 3IAYA 3KLRA 3IFTA 4A3EB 1AZQA 4IFDG 1SNDA 1HRJA 2A6ED 5M9OA 3HOVB 1G6ZA 1Q12A 1EOTA 3ERQA 4CHTB 2K1BA 1ET9A 4NMZA 3VYRA 1TIID 1GUGA 3C1EA 2EYOA 1TT2A 4IUVA 3L7ZC 1SEBD 5EPLA 2YU9B 3E0JA 1UEAB 2KCCA 3T13A 1TWFB 1JQYD 5KYIA 3HOUB 4CGYB 2WB1B 1LTTD 2K01A 3NUCA 4IUQA 3Q24A 1GUSA 3C46A 2Q8TA 3GQBA 2NVYB 3NBHA 5BN5A 2JA5B 1PFMA 5BN4A 4WJWA 4A3KB 1TY2A 5FLXE 4L63B 1SSOA 2VXWA 3HG9A 2CW0D 3Q22A 3JAME 1EYDA 4ABNA 3PUZA 2SOBA 2E2DC 3A55A 4HMIA 1NAPA 5I2YA 2E76C 5EKKA 3EQLC 3BS1A 1IW7D 1TS3A 3PMFA 2L1BA 2RDHA 2WAQB 4FXGC 4XYQA 1WTQA 5C5MA 5D14A 4A3JB 2OT2A 2QDBA 4RGNA 1MGSA 3I4LA 3FEWX 2L11A 3M4YA 3VR3A 3NWTA 5CYUA 2OF1A 1HHVA 3ND8A 3EFXD 3QG1A 5LL6X 4O42A 3TZDA 5FO9B 2QKIC 4HCSA 1QJOA 3SK5A 1QOHA 2ZXOA 3S2DB 3D3RA 4F87A 4A3MB 2BDOA 4X3SA 3TP6A 3S1NB 3T53B 2I46A 4DK0A 1EU4A 1CA5A 1DOLA 4H13C 1HQRD 4K5WA 2Z4HA 1GHJA 1YNND 5IT9E 4DK1A 1CA6A 5C4JB 1OXXK 3I70A 3SDZA 1C8CA 3GO5A 2PQEA 2F0JA 4OIJA 3O13A 2XWBB 3M7GA 3ONAB 3RMHA 5ELFA 1EEFD 1TWHB 5IGEA 3MHBA 1F77A 1BCPD 2F0MA 2O2LD 3NQTA 3VR2A 1TS2A 4ILWA 2EYLA 1K8MA 1S4ZA 2NTTA 5JAVA 3V05A 4A3GB 1STGA 4CJ0B 2L12A 2NN6H 1DZ1A 3A8KE 3OSOA 1NSNS 4G4KA 3SVMA 1OXVA 1I4GA 2B2WA 2KA7A 4PV1C 3M4OB 1RKNA 4XQJA 2B2YC 1WTPA 3TN2A 4FF2A 4HMJA 3S14B 2XRSD 2EPBA 1D1IA 5IOCA 5ELDA 4OO1I 2DY8A 4PMBA 5K5PA 2PW5A 3R2IA 5JEAH 3QOLA 4DNRB 5CGKA 2FHTA 2F0FA 2JYOA 1G2SA 3GTPB 1QILA 2ZXRA 1JWMD 3X3MA 4I7ZC 2D5DA 4FF4A 5EBDA 5K36H 3I72A 5ELBA 2WIIB 3L3OC 4XQNA 1DCZA 3GV6A 1SNQA 1JB3A 2EOTA 3HEJA 3FPUB 4PMCA 1DOKA 1PFNA 2Q8RE 3G7LA 1SYGA 4K5XA 2QF7A 1OXTA 1ZYRC 4C56C 3NTKA 3FDTA 2PMZB 5J1ZA 3TBIB 1LTSD 3I4MB 1LTBD 1DM0B 2F0OA 4FXKC 2AQ2B 4XQQA 4ZAIA 1G2TA 2F0KA 1VCIA 4H0LC 1KDAA 3QB3A 1MBYA 4WRDA 2JEBI 1S5ED 1HXYD 2CVRA 5EQ0A 1SFOB 3PV0A 3DHQA 3SXHA 1MD2D 3AB9A 3HOWB 1PLFA 1G8ZD 2NVTB 3QWNA 1D2BA 5IIFA 1ONLA 5CC4A 2MPMA 1PTOF 3MXNA 4BBRB 3Q6SA 1JE4A 4FF3A 5DM63 3K5NA 3F2UA 5M3MB 1O7ZA 3MVVA 1SMYC 2NVQB 5EPKA 4K6LA 3GTOB 3H09A 2CW0C 1BR9A 4DNTB 4C1NI 1L0XB 1K83B 4BA2I 3W2DA 1D5MC 3PUWA 1CHQD 4ODGA 1SYDA 2K03A 3EA6A 1SYCA 4PQXA 1SYFA 4OO1G 1IW7C 2KQ3A 2R7ZB 4K5VA 1HTLD 3NQIA 4C3HB 4KY6A 1B3AA 4TSSA 5COYA 4HN7A 4FP5D 4IUPA 4KTAA 5EPJA 1EQVA 2XNAC 3K7AB 4XYOA 2L4NA 4CKEA 3C1FA 1DOMA 1AFPA 3DXJC 3TMEA 2D62A 2F0LA 1RD9D 4OL7A 1JC7A 4EQOA 1F2ZA 2HCIA 1W6JA 1CQVA 3A8JE 1A3VA 2XN9C 3URYA 2M00A 4QF4A 2KJXA 4CJ1B 5F2DA 1U4RA 1CQFA 5JPMC 2ID0A 3BZDB 1IKMA 1H9RA 1QNKA 1M4VA 4NP5A 4XIGS 4ZLTF 3A8IE 5DEHA 1SAPA 2NWGA 2K04A 2JE6I 3OOCA 2R92B 2K28A 3QJYA 3P20A 1D5ZC 3M3YB 1Y8PB 3MC0B 3IKJA 1SDFA 3MXUA 2CHBD 4ME5A 2VNUD 4UDUC 2X6LA 1G91A 3M85A 1EY6A 3BVZA 3OWEB 1VF5C 3NK9A 1CI3M 2HUGA 1LO5D 2QILA 4TRDA 2PZTA 3TZUA 5C4XB 4B9WA 1V8QA 1F9SA 3T56B 5E4XA 4JBWA 2EE1A 2RSOA 4FXDA 3KBGA 3CRLC 2AQ1B 1FYCA 5KNBA 2DNCA 1XTCD 1SE2A 1B50A 3DM1A 1U4LA 2IX1A 1TS4A 2F0NA 1G291 4K8IA 2EJGC 1PTOH 5BN3A 5HURA 4FO2A 2KVMA 1VMPA 4M1UB 3U9SA 2K5QA 4OIKA 1S5CD 1BBXC 5KNCA 3WOEA 1EYCA 1ESFA 4DGZA 3NXWA 4X3KA 4G7HC 2ENBA 4K14A 4EQPA 3I90A 5A35A 5JVG3 1KNAA 4NW2A 3GD7A 4N9TA 3PUVA 4CKBA 1U4PA 3GV3A 2J4XA 5EBCA 4R8IA 4QB4A 5IT9L 5CORA 2H4OA 3FMCA 5KEEA 4MN3A 4RGTA 1CZWA 1ENCA 2B2VA 2ICIA 3OIPA 4QCLA 3KUPA 5TSSA 1A2UA 2F0QA 3CHBD 1EEID 1VMCA 2JXMB 1FNVA 3CKIB 4V190 1EIGA 3KF8A 5IGBA 4KN7C 4BWGB 5D65A 4KJNA 3K5LA 3P7JA 2LY7A 1SBBB 2F0HA 2EZVA 3VA7A 3KK7A 2NN6I 3P75A 1SMYD 5CV7A 1D1KA 1SJHD 4S3SA 4YIJA 3BG3A 4QUFA 3MA2B 3C3LA 5EJWA 1I4XA 4I65A 2RBMA 2C9OA 5I2XA 1HQMC 1RTOA 1PTOB 5M5YB 2JA6B 1S5DD 4IN3A 2Y0SB 1IKLA 5C6AA 2EVBA 1ENAA 4RWSC 3K59A 1DD2A 3BDLA 3D4RA 3PUYA 1K8OA 4A3IB 2AWOA 3AU7A 1IYUA 2DN8A 5ISRA 1I6HB 1ET6A 1J9OA 3OPOA 1C4QA 3OW7A 4HAEA 1HUMA 5E3FA 2RDFA 2PCFB 2PZWA 1GHKA 1JOOA 4HSPA 4J6HA 2B63B 5CV8A 3J7AF 1TKWB 1I4QA 1Y69U 1TY0A 1C48A 1O7LA 1PRTF 4ZRZA 4CBVA 3E6ZX 2L5TA 2O5JC 3PIP3 4F7XA 5KIXA 1PMRA 1WVLA 1F9QA 1T5EA 1S5FD 2K7VA 2B39A 2IJ0A 4X3UA 5M3FB 4DAYA 1Z7TA 5T1GA 4E6IA 1AW7A 4ZK9B 2Z4IA 3GTLB 3VR6A 2E2HB 4C1NK 2XSCA 3I73A 3KLSA 4IURA 1LTAD 1KLGD 3HRZC 2F0VA 5A2QL 3S17B 2AWNA 3WOFA 1EL0A 2SNMA 5D3DA 2K05A 3DUZA 4U68A 5C4ZA 1EY8A 1W6KA 2VB3X 1NR4A 3BDCA 3VA5A 1ENFA 3I8ZA 2V4DA 1CFMA 4CJ2C 4KJOA 2JA8B 4BY7B 2GA4B 2A73B 1STEA 2C5CA 4RH6A 1R9TB 2B2TA 2HDMA 2NN6G 3U9OA 1KDCA 1SE3A 1T5XD 4A3FB 1ZKOA 2IX3A 3W3AA 4UAIA 2LKVA 3OMCA 1CZGA 5C3EB 2E2JB 3DEPA 1JICA 2EY5A 3UI2A 3TDQA 1GJXA 1V43A 3Q0AA 2NYZD 1UUPA 2OXPA 3X3NA 5JEAG 5JVH3 3GTMB 4KD4A 5FO8B 5J22A 1Q1EA 4IQZA 1DONA 4KV6A 4DXGA 1EFID 1GUNA 3EJIA 1MSHA 1AEXA 3ND9A 3TP5A 5CBEE 3GTKB 1EQTA 1I6VC 3MXPA 3HGBA 2FMMA 3T51B 5K36G 2MJ8A 3GTJB 1E2ZA 4L6TB 3HOXB 1CT1D 4U673 5EKIA 4C3HG 5IODA 3LX0A 3EVQA 4Q5VA 1X3PA 4K6DA 4QIWB 1JR0D 2F0GA 4HCEA 3CRKC 2A69D 3HKZB 2XVSA 2BA1A 2G9HD 1S5BD 2A74C 4XTCS 1I4RA 2H1EA 1JCKB 1TU2B 1TR5A 2F0UA 2NUCA 3OWFA 4P2CB 5A2QE 1WD0A 1WTRA 2B2VC 1HCZA 5G3LD 1HFNA 3D31A 4TKOB 3T4AC 4IALA 3QO2A 3R3OA 5JPNC 5CBAE 1EIHA 5C4HA 1SE4A 4QUCA 2DNEA 3N6RA 4LAAA 1O78A 1F9RA 1XWEA 2A6HD 4XXEA 2IW3A 4RFBA 1BCPF 2K5DA 2D9UA 1VF7A 1H9SA 2XRQD 4V0BA 4AYBB 1UNSA 5C0XH 1B9MA 3IFDA 4RGOS 2KEEA 1FD7D 5C0XJ 3S16B 3CU7A 3S1MB 2BCOA 5CV5A 1EY7A 4K8JA 3H94A 3SEBA 5M5WB 2F3WA 5CV9A 4KK7A 2JA7B 3OMGA 1H9JA 4EVOA 4C3IB 4FYDA 4DN4M 1XXGA 4HR7B 2A5HA 5E4WC 3J81L 3H6MA 1IL8A 3T16A 1Q90A 1RF2D 2J7ZA 1PRTB 5HGTA 4OO1H 5E1FA 4XT1B 3FPPA 3TP8A 1PZKD 2PW7A 5IGDA 2R61A 3MXGA 2LFNA 3A56A 4KD3A 1B1ZA 2BDNA 1XYIA 2K32A 3PO2B 2J0TD 3IL8A 1Z47A 4G7OC 2B8GA 4KHVA 1STHA 2AQ3B 3J7AV 4RA8A 2RSNA 1JWSD 2EJMA 2RQXA 1H9MA 5KNDA 3MZ5A 1OO9B 3BYTB 4B08A 4IZ8A 2F4IA 1TWGB 3K0YA 1QE6A 4ZYSA 1NR2A 1D5XC 5ELCA 2F0IA 4CKCA 1BUVT 1EY4A 1PYWD 4ZKBB 2G9DA 3H91A 1GXDC 4BS9A 4K2LA 4DA2A 3SK4A 1BO0A 3R2TA 5EGTA 4J8QA 1A6XA 3BVMA 1PTOC 2FJ2A 3QIAA 2CQAA 1X3QA 3TP7A 1HA5A 2B2TC 4BBSB 2ZXPA 1YNJC 2F03A 3RUZA 4K2KA 3J80L 2ICEC 2B2WC 2EYHA 5DM73 1LLRD 4FVMA 3K5OA 1E2WA 1HTPA 3RZOB 1DJRD 2K33A 2X6GA 1X32A 2Z1CA 5JJZA 2F1MA 4HEDA 2RDGA 2KEDA 2QCPX 5C5LA 5CMDA 3EROA 3VYTA 1AZPA 4RHRA 1NUCA 4F8MA 3VR5A 1O7YA 2F3VA 3PO3B 3HZXA 3DMUA 3J81E 4B9XA 4KY7A 2HDLA 4KI0A 3FRPB 1LT4D 1E2VA 1E0BA 1RCVD 3SHLA 1PXUA 3A54A 4XDXA 1A15A 4J1MA 3S2HB 3S9WA 2BE5C 2F0TA 1ZEQX 5I9OA 2EDGA 4IFDH 4DAPA 3D8GA 2KOLA 1CM9A 4BY1B 2RVLA 5FKAC 2TSSA 4IFDJ 2MP1A 3E5SA 1V1PA 3GP7A 1O80A 4RKLA 2EYFA 1EY0A 3TSSA 3I91A 2WKCA 3NHHA 1OXSC 1AN8A 4OGQC 2A69C 1QWYA 2NTSA 3DWAA 1WCMB 2KECA 4WORA 5JOBA 5ELEA 1CHPD 2KHSA 4KN4C 1LABA 1RDPD 4HSVA 3MFGA 1Q8IA 2WP8J 4NDXA 3CQZB 3DEOA 4KMUC 1STNA 4IUNA 2HQEA 1UAPA 1QNUA 4R8NA 2BOSA 2E74C 5KRUA 1F9PA 1D6EC 4FF1A 1BXTA 2MUYA 1AP0A 1EWHA 2D2CC 1EZ6A 2MHVA 3S15B 1HPCA 5IGCA 3H0GB 1TVXA 3NPPA 1BCPB 3RLFA 1A3TA 2F0EA 2ZT9C 4ULLA 1SNOA 1WTWA 2AUKA 5DAUA 2F0PA 3MTSA 4GZYC 1ILQA 2A6HC 5DNFA 1Z6HA 1FNUA 3K6OA 3LWUA 2VB2X 1SJED 1IYVA 4XT3B 2IWHA 3J80E 2EY1A 2R3ZA 4C3JB 5D3IB 1KNEA 4IUTA 4ZUJA 4MHEA 1EU3A 4PNYA 3KLSX 3K58A 2M2LA 3I4NB 5I6YA 4G57A 1RJTA 2EY2A 1I50B 1CTMA 1II3A 1WD1A 4DXFA 5M5XB 3SK8A 1LT6D 1GUTA 4HTHA 2MGSA 4Z9CB 1Y1WB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GA4 B;  1CZW A;  1CZG A;  2C5C A;  1R4Q B;  1D1I A;  1C48 A;  1DM0 B;  1CQF A;  4ULL A;  1C4Q A;  4M1U B;  1D1K A;  2XSC A;  1QNU A;  1QOH A;  3MXG A;  1BOS A;  2BOS A;  4P2C B;  1R4P B; 
#chains in the Genus database with same CATH topology
 2AHO B;  1SRU A;  3NWS A;  2A68 C;  3D4W A;  1W2B A;  1XX8 A;  3CMA A;  4JBJ A;  4KHZ A;  2R93 H;  3D6W A;  3HS0 C;  1SYB A;  1B70 B;  4B3R Q;  4F88 A;  1BDO A;  1VQE A;  2QEJ C;  3G71 A;  1SXT A;  2PYK A;  1I3Q B;  3HKZ G;  4LF6 Q;  2UUB L;  2PZU A;  2X69 A;  4JK1 C;  2V1C C;  4H44 C;  4HJA A;  1PDQ A;  2K5W A;  5LMU L;  2YV5 A;  4JV5 Q;  1PTO D;  3PGZ A;  5IP9 G;  1DXM A;  3S1R B;  4LF5 Q;  2QW7 A;  3RZD B;  3FHW A;  3HOY B;  5FLM H;  1EYA A;  4QMG A;  3WDN A;  4NXM Q;  1YNJ D;  3MFY A;  2HCC A;  2PNR C;  4O1N A;  4B3R L;  5C0X I;  3I7F A;  3MEH A;  3F2C A;  5CV4 A;  2F0W A;  4G7Z C;  3VYS A;  4C2M H;  2F0D A;  3K5M A;  1LAC A;  4LF6 L;  4EGV A;  3D6C A;  2LXK A;  4KKT A;  5C3W A;  4A3K B;  1KHI A;  1RL2 A;  1TQO A;  5AJ3 Q;  2UU9 Q;  3MAQ A;  3OHX C;  2VUM B;  3I3C A;  2DY7 A;  2IHF A;  3M7N A;  5IYC G;  4LF5 L;  1ICF B;  4LF8 Q;  3FKI B;  3NSW A;  1WFQ A;  2CQO A;  3M4Q A;  1HFG A;  4AH6 A;  5KYL A;  2I07 B;  1XPO A;  3HOW H;  2IX0 A;  2JSO A;  1H9S B;  4LF4 Q;  4R9W A;  2O4X A;  1EZ8 A;  5C44 H;  1PH6 A;  4OHJ A;  4AYB G;  1R4Q B;  1I4P A;  2SEB D;  1MI2 A;  2JP1 A;  5AJ3 L;  2LMC B;  1TS5 A;  1ZXT A;  2UU9 L;  1LYL A;  2PPB C;  1SE8 A;  4ZCK A;  5LL6 S;  4Y7N B;  2B2U A;  3ZJY C;  1FNW A;  1JOK A;  4DU9 A;  1PZI D;  4LMQ D;  3VR4 A;  2BE5 D;  1W3S A;  4LF8 L;  3HP3 A;  5JEA J;  3V2T A;  2JA7 G;  3V96 A;  1MHW C;  2R6G A;  2Z8L A;  1U0L A;  1ML0 D;  4C3I G;  1IBK Q;  1F2Y A;  1V1Q A;  4LF4 L;  2CH4 W;  4LJZ C;  5KGU A;  1B2T A;  1PFB A;  2KCN A;  4A75 A;  1ESR A;  1K73 C;  1A3U A;  1PRT C;  2R93 B;  2LXJ A;  4A93 H;  3A5Z B;  3QOJ A;  5J39 A;  4ZQ3 A;  1KLU D;  2LS0 1;  2UXB L;  4GOP B;  4HJ5 A;  2N55 A;  2E2I H;  4B3S Q;  5IGG A;  3N52 A;  4EX5 A;  1CKM A;  4C3H H;  1TWC B;  1T9H A;  3GTQ H;  1IBK L;  3J81 j;  4L5S A;  4DV3 Q;  5I4D A;  1FL0 A;  1Y1V B;  3MEF A;  3K7A H;  1Y8N B;  1QVC A;  1JWU D;  2NVX H;  1J8I A;  1QB5 D;  3PO2 G;  3RD4 A;  3TQY A;  3W1G A;  4A3B H;  4PMW A;  4JI7 Q;  2NB0 A;  1KDB A;  5L37 A;  1WTO A;  2L55 A;  1EY5 A;  1HZC A;  2EYJ A;  1SNP A;  4C2M B;  2K6A A;  2GN5 A;  1A2T A;  3RLN A;  4B3S L;  4DF7 A;  4A3L G;  1GKH A;  4LUO A;  2EIF A;  4LK1 C;  3HOZ H;  2HQL A;  2RA4 A;  2A6E C;  3KJP A;  2SDF A;  1GOZ A;  1LT5 D;  4M8A A;  1Y8O B;  4DV3 L;  3GTG H;  1RHP A;  3NE5 B;  1Q3L A;  3JAM i;  4RCN A;  4DV7 Q;  2O5I C;  3C2P A;  2Q2H A;  4JI7 L;  4R4Q A;  1LTI D;  1PHJ A;  5GAH C;  3BDO A;  2IT1 A;  2MNA A;  1K8A C;  1D7Q A;  3K57 A;  5C44 B;  3H3V I;  3LWE A;  2MQH A;  1HA6 A;  3P1H A;  4Q0F A;  1EY9 A;  5C0X G;  2WIN B;  2JEA I;  2B8F A;  5T1I A;  4KKS A;  3PUX A;  3VYU A;  4IPD A;  1R4P B;  2H5X A;  2MO0 A;  1V1O A;  1GUO A;  1DYQ A;  5I6W A;  5CV6 A;  3SE0 A;  1BNZ A;  2IPK D;  1E1O A;  2FFK B;  4DV7 L;  4DR7 Q;  2E75 C;  3L9A X;  4TQU S;  1LTG D;  3KFU A;  5IT9 c;  1M8A A;  1MJC A;  1Q81 C;  1B3Q A;  3STB C;  1JOR A;  2UXD Q;  2IHE A;  4DAV A;  4X6A H;  1GUW A;  2EYP A;  4BBS G;  4A93 B;  1QG7 A;  5FJ8 G;  3S1Q H;  1LTR D;  3ER0 A;  4RKB A;  4DKA C;  4A3C H;  2FIN B;  1I4H A;  1ASZ A;  3FVQ A;  5IGF A;  2L0C A;  4JC0 A;  5AFW A;  1S3O A;  2PI2 E;  1DGS A;  2A68 D;  2FXQ A;  3LGJ A;  2E2I B;  4GOP A;  3A7A B;  4DR7 L;  1IL2 A;  2OTJ A;  1Q1B A;  2EYM A;  3BYY B;  3GTQ B;  2BA0 A;  3KBX A;  1HUN A;  2WV6 D;  1U4M A;  1M1K C;  2DJG C;  4IFD I;  3LNN A;  1NNX A;  1EWC A;  3DWQ A;  1XNQ Q;  2UXD L;  5CR3 A;  1STA A;  2NVX B;  4DAM A;  1VQI A;  5NUC A;  2YYZ A;  2WKD A;  4MIU A;  1F2M A;  4A3B B;  1KTK A;  1YHQ A;  4BA1 I;  3I4O A;  5GAE C;  1YIT A;  1KAB A;  5IP7 G;  1QCB D;  2DGY A;  3BVG A;  4DV4 L;  2EXZ A;  4IUU A;  3PO3 G;  3J7Y W;  1N9W A;  1PZJ D;  3NP8 A;  1ICW A;  2PO4 A;  1X65 A;  2EY6 A;  1BOS A;  4J15 A;  1LV9 A;  3HOZ B;  1SYE A;  2FMC A;  2XGT A;  3U58 A;  5EKL A;  1TWA B;  3GTG B;  1WTX A;  1RTN A;  4RHS A;  1SNC A;  1XNQ L;  1F2L A;  4P71 A;  1Q7Y C;  3NTH A;  4X64 Q;  5LHY 1;  5IYD H;  1STB A;  2WAQ E;  5ELN A;  2N88 A;  4A3E H;  2WAC A;  2AUJ D;  3UE0 A;  4X3T A;  1FGB D;  1MSG A;  4N9P A;  1JOQ A;  2LSS A;  3CP0 A;  3AMU A;  3SR1 A;  4L5Q A;  1V1P B;  4BY1 G;  3K7U C;  4DV1 L;  1IHZ A;  1KAA A;  4KKU A;  2OEO A;  1G51 A;  1SNM A;  5FLX L;  3R8B A;  2XIW A;  1NCV A;  1MKH A;  1YNN C;  3JAM L;  1YHB A;  1E3P A;  5FK9 C;  1B44 D;  2NBF A;  4WFN 3;  4JI5 Q;  2B2Y A;  3R93 A;  1YNX A;  2F0S A;  1BQQ T;  1WCM G;  4X64 L;  3MWY W;  4DR5 Q;  3Q23 A;  1YJ9 A;  4DFA A;  3NBI A;  5IE8 A;  5G3L F;  2YU9 H;  3D4D A;  2KEN A;  5FO7 B;  4FNF A;  1WTV A;  3H3V C;  2Q8I B;  1TWF H;  1CK1 A;  3OIQ A;  1U9R A;  3G6J B;  1B9N A;  4DUZ L;  2M9V A;  1PYS B;  3NBH B;  4A76 A;  3S1Q B;  1BF4 A;  1JMC A;  5BR8 Q;  3RN5 A;  5IYB H;  3DWP A;  4H7B A;  2NZH A;  2NZ1 D;  1BCP C;  4NKL A;  2K14 A;  4JYA L;  2EQS A;  4UP9 A;  3RLO A;  2JA5 H;  3NTI A;  4ZUI A;  1VQ5 A;  2KUM A;  1KIX A;  3SK6 A;  2SNS A;  1PRT D;  2VZA A;  4DR5 L;  4OEL B;  1FR3 A;  2Z6K A;  2L9H A;  2EJF C;  3H0G G;  4RAU C;  2XWJ B;  4LF7 Q;  2RKS A;  2TMP A;  4RCO A;  2A1A A;  5I9P A;  1OXU A;  1N36 Q;  4LFB Q;  2IL8 A;  1YVC A;  2JA6 H;  5BR8 L;  1B4O A;  1XNR Q;  3A7L A;  4RGM A;  3F2B A;  1EIY B;  1VDZ A;  1VQ6 A;  1WYD A;  1LT3 D;  3ZYY X;  5FOB B;  1EUJ A;  1B53 A;  2OTL A;  1GO3 E;  1ILP A;  1H9K A;  3ITP A;  4EQN A;  1ROD A;  4ZKC B;  4A3D B;  3KLW A;  4C3J G;  4KY5 A;  2MFI A;  5C3X A;  1ZYR D;  1I94 Q;  3WWV A;  2B2U C;  1STY A;  4ID6 A;  1FVI A;  3TS0 A;  3PIO 3;  1N36 L;  1L0Y B;  4LFB L;  4CDC C;  4L8J A;  3IAY A;  5IWA Q;  3KLR A;  3IFT A;  4A3E B;  1AZQ A;  1XNR L;  4IFD G;  1SND A;  1HRJ A;  4GN4 B;  2BH2 A;  2A6E D;  4ME3 A;  5M9O A;  3CCL A;  3HOV B;  1G6Z A;  1Q12 A;  1EOT A;  1PH9 A;  4YWL A;  4OWW B;  3ERQ A;  4NXN Q;  4CHT B;  4DPG A;  2K1B A;  3E9I A;  1ET9 A;  4NMZ A;  3VYR A;  1TII D;  1GUG A;  1I94 L;  3C1E A;  3S2D H;  2EYO A;  1PH8 A;  3J7Z C;  2NZO A;  4JOI A;  1Y1W G;  2ATW A;  3S1N H;  1TT2 A;  4IUV A;  4A4I A;  3CC4 A;  3L7Z C;  1SEB D;  5EPL A;  3Q8D A;  3EN2 A;  5IWA L;  2YU9 B;  3E0J A;  1UEA B;  1PH1 A;  5JJL A;  2KCC A;  3T13 A;  2HHH Q;  1TWF B;  1JQY D;  3GTL H;  5KYI A;  2UXC Q;  3HOU B;  4CGY B;  2WB1 B;  2E8G A;  1LTT D;  2K01 A;  2Z6B A;  3NUC A;  4IUQ A;  4UHV A;  1PYB A;  2JK8 A;  3Q24 A;  1GUS A;  3W1B A;  4O0A A;  3C46 A;  2Q8T A;  3GQB A;  3I2Z A;  2NVY B;  4BY7 G;  3NBH A;  5BN5 A;  1XPR A;  2JA5 B;  1PFM A;  5BN4 A;  4WJW A;  2DJF C;  1TY2 A;  3NEL A;  3E3X A;  1SSO A;  2VXW A;  3HG9 A;  4L63 B;  2CW0 D;  5ELO A;  5FLX E;  3Q22 A;  3JAM E;  1EYD A;  3HOY G;  4ABN A;  3PUZ A;  2SOB A;  3OW2 A;  2E2D C;  3A55 A;  4HMI A;  1NAP A;  5I2Y A;  2E76 C;  5EKK A;  4L5T A;  3EQL C;  3BS1 A;  1IW7 D;  1TS3 A;  1KD1 C;  3PMF A;  2AKW B;  3PIP A;  2L1B A;  2RDH A;  4A3G H;  2WAQ B;  1RIP A;  5J3B A;  1VQH A;  4FXG C;  4XYQ A;  5GAD C;  3W5O A;  2VUM G;  1WTQ A;  1QZG A;  5C5M A;  3RN2 A;  5D14 A;  4A3J B;  1EYG A;  2OT2 A;  1PA6 A;  3FKI G;  2QDB A;  4RGN A;  1MGS A;  3I4L A;  1CSQ A;  3HFZ B;  2PMZ E;  2K50 A;  3FEW X;  2L11 A;  2A19 A;  3M4Y A;  3VR3 A;  3NWT A;  1VQK A;  3M4O H;  1HR0 Q;  5CYU A;  5C3E H;  5IY0 A;  2ZJQ A;  2OF1 A;  3S14 H;  1HHV A;  3ND8 A;  3EFX D;  3QG1 A;  2KCT A;  5LL6 X;  1X3G A;  4JI1 Q;  4LUZ A;  4O42 A;  1IYJ B;  1P8L A;  4YWM A;  3TZD A;  5FO9 B;  2QKI C;  4HCS A;  4IJH A;  1QJO A;  1UE5 A;  4PZ6 A;  3SK5 A;  1QOH A;  2ZXO A;  3S2D B;  5LMN Q;  3D3R A;  4F87 A;  4A3M B;  2BDO A;  4X3S A;  3TP6 A;  1HR0 L;  3S1N B;  1IBM Q;  3T53 B;  1LM0 A;  2I46 A;  4DK0 A;  1EU4 A;  4GOP C;  2EXD A;  1CA5 A;  1VQ8 A;  1DOL A;  3I55 A;  3GTP H;  4DR2 Q;  1X55 A;  3KYH C;  4H13 C;  1HQR D;  4LFC Q;  2R93 G;  4K5W A;  2Z4H A;  1GHJ A;  2PI2 A;  4JI1 L;  1YNN D;  3GTJ H;  3U4V A;  5IT9 E;  4DK1 A;  3HOX H;  1CA6 A;  5C4J B;  1OXX K;  3I70 A;  3SDZ A;  1C8C A;  3GO5 A;  4JI2 Q;  2PQE A;  5LMN L;  2F0J A;  1HH2 P;  4OIJ A;  3O13 A;  2XWB B;  1L1O A;  1CSP A;  1IBM L;  4QJF A;  5JJK A;  1Y1V G;  3M7G A;  3ONA B;  3RMH A;  5ELF A;  1EEF D;  4DR2 L;  4LFC L;  4AIM A;  1EQQ A;  1TWH B;  5IGE A;  3MHB A;  1F77 A;  1BCP D;  2F0M A;  2O2L D;  3NQT A;  3VR2 A;  1TS2 A;  3T1Y L;  4YCU A;  4ILW A;  1VQC A;  2EYL A;  1K8M A;  1S4Z A;  2NTT A;  3TEH B;  3I4M H;  5JAV A;  3V05 A;  1PH4 A;  4DV5 Q;  4A3G B;  1NMG A;  1STG A;  4JI2 L;  2OCE A;  4CJ0 B;  2RHS B;  2L12 A;  2NN6 H;  1Q46 A;  1DZ1 A;  3A8K E;  3OSO A;  2YTY A;  1NSN S;  3J81 c;  4YWK A;  4RG1 A;  4G4K A;  1PFS A;  3SVM A;  1YEZ A;  3KF6 B;  3G48 A;  1OXV A;  1SFO H;  1I4G A;  2GVB A;  2B2W A;  2KA7 A;  3U4Z A;  2NVT H;  4PV1 C;  3M4O B;  3AQQ A;  2YTX A;  1RKN A;  4XQJ A;  2B2Y C;  1WTP A;  3TN2 A;  4FF2 A;  4HMJ A;  5C44 G;  3S14 B;  2XRS D;  3MXN B;  2EPB A;  4WJ4 A;  1D1I A;  3BU2 A;  5IOC A;  5ELD A;  4DV5 L;  3CCR A;  4OO1 I;  2DY8 A;  4BBR H;  4DK6 C;  4PMB A;  5K5P A;  2PW5 A;  3R2I A;  5JEA H;  3QOL A;  4H02 A;  3K81 C;  2UXB Q;  2CH4 A;  5M3M H;  2RHQ B;  3AEV A;  4DNR B;  4POG A;  5CGK A;  2NVQ H;  2FHT A;  2Q2I A;  2F0F A;  3GTO H;  1HNW L;  2JYO A;  1VQL A;  4DV0 L;  1G2S A;  4CDF C;  3GTP B;  2Z6K C;  1QIL A;  2ZXR A;  1JWM D;  3X3M A;  4WJ3 M;  4I7Z C;  4RMF A;  4A93 G;  1K83 H;  2D5D A;  4FF4 A;  2F52 A;  5EBD A;  5K36 H;  1E7Z A;  3I72 A;  5ELB A;  2N3S A;  2WII B;  4JI0 Q;  3L3O C;  2C35 B;  2JA7 H;  4XQN A;  2ZTC A;  1DCZ A;  2ZTD A;  1AE2 A;  3CCS A;  3GV6 A;  4R4O A;  2R7Z H;  1SNQ A;  4GLA C;  1JB3 A;  1S40 A;  2EOT A;  3HEJ A;  3FPU B;  4PMC A;  1DOK A;  1UE1 A;  1PFN A;  2Q8R E;  3G7L A;  1SYG A;  3PF5 A;  4K5X A;  2QF7 A;  1OXT A;  1ZYR C;  4A3B G;  4C56 C;  5EAY A;  3NTK A;  1A0I A;  3FDT A;  4N8X 1;  2PMZ B;  3OTO Q;  5J1Z A;  4JI0 L;  3TBI B;  1LTS D;  1JB7 A;  1QVF A;  3I4M B;  1LTB D;  3A0J A;  1A8V A;  1Q82 C;  3UDX A;  1DM0 B;  2F0O A;  4IPH A;  3HOZ G;  4FXK C;  4JW0 A;  2AQ2 B;  4XQQ A;  1PH7 A;  4ZAI A;  1G2T A;  2F0K A;  3F2D A;  4JPB W;  1VCI A;  4H0L C;  1KDA A;  2KHI A;  3QB3 A;  1MBY A;  4UP8 A;  4WRD A;  4L5R C;  2JEB I;  1S5E D;  1HXY D;  4UY8 C;  2CVR A;  5EQ0 A;  1SFO B;  3PV0 A;  3DHQ A;  3SXH A;  3J80 c;  1MD2 D;  3AB9 A;  3HOW B;  1HNX Q;  1PLF A;  1G8Z D;  2NVT B;  3QWN A;  3KF6 A;  3OTO L;  4JOI C;  1D2B A;  4GKJ Q;  4HIO A;  2G5D A;  3NEM A;  4BXX G;  4MZ9 A;  5IIF A;  4DV6 Q;  1ONL A;  5CC4 A;  2MPM A;  1PTO F;  3F1Z A;  3MXN A;  4BBR B;  3Q6S A;  2Z9H A;  1JE4 A;  1PV4 A;  4FF3 A;  2R92 H;  1P16 A;  5DM6 3;  2VQF Q;  3K5N A;  3M3Y H;  3F2U A;  1YJW A;  4IPC A;  5M3M B;  1O7Z A;  4LNQ A;  3MVV A;  1SMY C;  2NVQ B;  5EPK A;  4K6L A;  1HNX L;  3GTO B;  1L0W A;  2YTV A;  2N49 A;  4NPS A;  4GKJ L;  3H09 A;  2CW0 C;  1BR9 A;  4DV6 L;  4DNT B;  3NEN A;  4C1N I;  1L0X B;  4OXP A;  1K83 B;  4BA2 I;  2I0Q A;  3W2D A;  1D5M C;  3PUW A;  5C4X H;  1CHQ D;  1VQD A;  1VQJ A;  4CDD C;  4ODG A;  1SYD A;  2K03 A;  3EA6 A;  4DV4 Q;  1SYC A;  1X9N A;  2VQF L;  3KDF B;  1O7I A;  4PQX A;  4YY3 Q;  1SYF A;  4OO1 G;  1IW7 C;  5GRO A;  2KQ3 A;  2R7Z B;  4K5V A;  1HTL D;  3NQI A;  4C3H B;  3T1H Q;  4KY6 A;  1B3A A;  4TSS A;  2I5H A;  5COY A;  3PCO B;  4HN7 A;  4LFA Q;  4FP5 D;  4IUP A;  4KTA A;  2WB1 E;  5EPJ A;  1EQV A;  2XNA C;  5FJ8 H;  3K7A B;  4XYO A;  2L4N A;  4CKE A;  1Q8K A;  3C1F A;  3TS2 A;  2A8V A;  1DOM A;  2R7D A;  1AFP A;  3DXJ C;  3TME A;  2QGQ A;  3L2P A;  2D62 A;  1QUQ B;  2F0L A;  3QR8 A;  4YY3 L;  4DV1 Q;  4GNX C;  3L0O A;  1RD9 D;  1KRT A;  1XPU A;  4A3D G;  4OL7 A;  1JC7 A;  3T1H L;  3CCJ A;  4EQO A;  2VS1 A;  1N33 Q;  1F2Z A;  2HCI A;  1W6J A;  4LFA L;  1CQV A;  3A8J E;  4YHH Q;  2CWA A;  1A3V A;  2WFW A;  2XN9 C;  3URY A;  2M00 A;  4QF4 A;  2KJX A;  5F2D A;  4CJ1 B;  5IYD G;  1U4R A;  4A3E G;  1CQF A;  5JPM C;  2ID0 A;  3BZD B;  1IKM A;  1H9R A;  1QNK A;  3HOV G;  1M4V A;  4NP5 A;  4XIG S;  4ZLT F;  3A8I E;  4DUZ Q;  5DEH A;  1SAP A;  2PQA B;  2NWG A;  2K04 A;  4P73 A;  2JE6 I;  1N33 L;  3OOC A;  3S2H H;  2R92 B;  2K28 A;  3QJY A;  4JYA Q;  3P20 A;  1D5Z C;  4LF9 Q;  3M3Y B;  3OYY A;  3RNU A;  4YHH L;  1Y8P B;  3MC0 B;  1KQS A;  3IKJ A;  3UDI A;  4BY1 H;  1SDF A;  4QY7 A;  3MXU A;  4R1J A;  2CHB D;  1N34 Q;  4ME5 A;  2VNU D;  4UDU C;  2X6L A;  1G91 A;  3M85 A;  3HOU G;  2WB1 G;  1EY6 A;  3K80 C;  3BVZ A;  3OWE B;  1VF5 C;  3NK9 A;  1CI3 M;  2HUG A;  1GD7 A;  1LO5 D;  2QIL A;  4TRD A;  2PZT A;  3TZU A;  4LW1 A;  5C4X B;  4HJ8 A;  1VQN A;  4B9W A;  1V8Q A;  4GLX A;  1F9S A;  1WCM H;  1XTD A;  3T56 B;  5E4X A;  5GQO A;  2JA5 G;  4JBW A;  1KL9 A;  4LF9 L;  2EE1 A;  2RSO A;  1OTC A;  4A3K G;  4FXD A;  4KLK A;  1Z9F A;  3CRL C;  3KBG A;  2AQ1 B;  1FYC A;  3KDF A;  4DUY L;  5KNB A;  1WOC A;  2DNC A;  1XTC D;  1SE2 A;  2JQO A;  1B50 A;  1N34 L;  3DM1 A;  1U4L A;  3EBE A;  2IX1 A;  4P75 A;  2HT1 A;  5JJI A;  1TS4 A;  2F0N A;  1G29 1;  4K8I A;  1FJG Q;  2EJG C;  1PTO H;  5BN3 A;  5M5Y H;  5HUR A;  4FO2 A;  2KVM A;  1VMP A;  4M1U B;  2WAQ G;  3U9S A;  2K5Q A;  4OIK A;  1S5C D;  1BBX C;  5KNC A;  3WOE A;  4KHP Q;  1EYC A;  4YCW A;  1ESF A;  4A3I H;  1X3E A;  1K3B C;  4DGZ A;  3NXW A;  4X3K A;  4A3J G;  4G7H C;  2ENB A;  4K14 A;  1LTL A;  1QUQ A;  2KCM A;  4EQP A;  1I6H H;  3I90 A;  4YCV A;  5A35 A;  5JVG 3;  1KNA A;  4NW2 A;  1S72 A;  3GD7 A;  1X3F A;  4N9T A;  3PUV A;  4TVA B;  3BJU A;  1XMO L;  4CKB A;  1U4P A;  3ERS X;  3GV3 A;  2J4X A;  2K5V A;  1FJG L;  5EBC A;  3AYH B;  4R8I A;  4QB4 A;  5IT9 L;  5COR A;  3I4N G;  2B63 H;  2H4O A;  1BVS A;  2RCN A;  3FMC A;  5KEE A;  1HZ9 A;  1NBW A;  4MN3 A;  4RGT A;  4X65 Q;  3CCQ A;  4KHP L;  2UUC Q;  1CZW A;  4MTN A;  4OEM B;  3CPF A;  1ENC A;  2B2V A;  2ICI A;  4IPG A;  3OIP A;  1IXR A;  4QCL A;  3KUP A;  4PG3 A;  5TSS A;  1A2U A;  2F0Q A;  2PQA A;  3CHB D;  1EEI D;  4A3M G;  4GKK Q;  1VMC A;  2JXM B;  1FNV A;  3CKI B;  3DM3 A;  4V19 0;  1EIG A;  4DAY B;  1PH2 A;  4HJ9 A;  3KF8 A;  5IGB A;  5M3F H;  4DR3 Q;  4O2D A;  1YIJ A;  4KN7 C;  4BWG B;  5D65 A;  3K8A A;  2K5N A;  4KJN A;  3H15 A;  3K5L A;  3CXC A;  3CCE A;  3P7J A;  2LY7 A;  1SBB B;  4X65 L;  1JJG A;  2UUC L;  4B3M Q;  2E2H H;  2F0H A;  2EZV A;  3VA7 A;  3KK7 A;  1Y14 B;  2NN6 I;  1GM5 A;  3P75 A;  1G6P A;  5HY6 A;  1SMY D;  5CV7 A;  1D1K A;  1SJH D;  4DK3 C;  4S3S A;  3S17 H;  1L1O B;  4YIJ A;  1VQM A;  4GKK L;  3BG3 A;  4QUF A;  1XJV A;  3U50 C;  3MA2 B;  3C3L A;  5EJW A;  1L2F A;  4DR3 L;  1I4X A;  4I65 A;  2RBM A;  3RR5 A;  1JT8 A;  2C9O A;  2HIV A;  4P72 A;  4B3M L;  5I2X A;  2UUA Q;  1HQM C;  3M9B A;  4GN5 A;  2JA8 H;  1RTO A;  4BY7 H;  1PTO B;  4GLV B;  5M5Y B;  2JA6 B;  1S5D D;  4IN3 A;  2Y0S B;  1UEB A;  1IKL A;  5C6A A;  4A3G G;  2EVB A;  1ENA A;  4RWS C;  1NE3 A;  3K59 A;  1R9T H;  1DD2 A;  2I5L X;  2PNH A;  3BDL A;  3D4R A;  3PUY A;  1K8O A;  4A3I B;  2AWO A;  4DNI A;  1SN8 A;  3AU7 A;  4A3F H;  4LWC A;  2XTI A;  1IYU A;  3CC2 A;  2DN8 A;  5ISR A;  1I6H B;  1ET6 A;  4X62 Q;  4JI3 Q;  3HKZ E;  3PF4 A;  1J9O A;  3OPO A;  1C4Q A;  3OW7 A;  2P5Z X;  4HAE A;  1HUM A;  2UUA L;  5E3F A;  2RDF A;  2PCF B;  2PZW A;  3A74 A;  2E2J H;  1GHK A;  1JOO A;  4HSP A;  4J6H A;  2B63 B;  5CV8 A;  3J7A F;  4DR4 Q;  1TKW B;  3CCM A;  1I4Q A;  1Y69 U;  4LUV A;  1TY0 A;  1C48 A;  1O7L A;  1PRT F;  1EIF A;  3GTM H;  5LMN W;  4ZRZ A;  4CBV A;  3E6Z X;  2L5T A;  2O5J C;  3PIP 3;  1KRS A;  4X62 L;  4F7X A;  4JI3 L;  5KIX A;  1PMR A;  1WVL A;  1F9Q A;  4HID A;  4K0K Q;  1MIU A;  1T5E A;  1S5F D;  3KJO A;  2B29 A;  2K7V A;  2B39 A;  1PH5 A;  2IJ0 A;  4X3U A;  5M3F B;  1CKO A;  3GTK H;  4DAY A;  1Z7T A;  4DR4 L;  5T1G A;  4E6I A;  1AW7 A;  4ZK9 B;  2Z4I A;  3GTL B;  3VR6 A;  2E2H B;  4C1N K;  3T1Y Q;  2XSC A;  3I73 A;  3KLS A;  2ZJP A;  4IUR A;  1LTA D;  1KLG D;  1SLJ A;  1VQB A;  3HRZ C;  2F0V A;  3AFQ A;  4UP7 A;  5A2Q L;  4AYB E;  3S17 B;  4K0K L;  1N32 Q;  1NY4 A;  2AWN A;  3WOF A;  1EL0 A;  1NMF A;  2SNM A;  5D3D A;  2K05 A;  3DUZ A;  1UE6 A;  4U68 A;  4IJL A;  1TXY A;  5C4Z A;  1EY8 A;  1W6K A;  2VB3 X;  1NR4 A;  3BDC A;  1JE5 A;  5FLM G;  3VA5 A;  1VQ7 A;  1ENF A;  3I8Z A;  1JJ2 A;  2V4D A;  1CFM A;  4CJ2 C;  4KJO A;  2JA8 B;  4BY7 B;  1BKB A;  2N8N A;  1UE7 A;  2GA4 B;  1TWC H;  1UWV A;  4DR1 Q;  3I4M G;  2A73 B;  2OWO A;  5H1S E;  1STE A;  2C5C A;  4RH6 A;  5IP9 H;  1Y1V H;  1R9T B;  1N32 L;  2B2T A;  2HDM A;  2NN6 G;  3U9O A;  1KDC A;  1K8G A;  3DLL A;  1SE3 A;  1T5X D;  2L15 A;  4A3F B;  3FP9 A;  1ZKO A;  2IX3 A;  3W3A A;  4UAI A;  2RF4 A;  1V9P A;  4QGU A;  3HOW G;  1HNW Q;  2K5H A;  2LKV A;  3PQI A;  3OMC A;  1J5E Q;  1CZG A;  4DV0 Q;  5C3E B;  2E2J B;  3DEP A;  1JIC A;  2EY5 A;  4DR1 L;  4IOA A;  3UI2 A;  4JV5 L;  3TDQ A;  1GJX A;  1V43 A;  3Q0A A;  4OWX B;  4BBR G;  5GAG C;  2NYZ D;  5IYC H;  1UUP A;  2OXP A;  2OQK A;  2GVA A;  3X3N A;  5JEA G;  5JVH 3;  3GTM B;  2KHJ A;  4KD4 A;  4NXM L;  5FO8 B;  4JBM A;  5J22 A;  5M3M G;  1Q1E A;  3CF5 A;  2QA4 A;  4IQZ A;  1DON A;  2ASB A;  4JBK A;  4KV6 A;  4DXG A;  2CWP A;  1EFI D;  1GUN A;  1U5K A;  3EJI A;  1MSH A;  1AEX A;  2AMC B;  2D0P A;  3ND9 A;  1J5E L;  2ALY B;  3TP5 A;  2E5L Q;  5CBE E;  1E1T A;  3PSI A;  3GTK B;  1EQT A;  1I6V C;  3J81 i;  3MXP A;  3G4S A;  1BBW A;  3HGB A;  3CME A;  2FMM A;  2KBN A;  3T51 B;  4GS3 A;  5K36 G;  3S16 H;  3S1M H;  2MJ8 A;  3UDF A;  3GTJ B;  1E2Z A;  3CCU A;  4JI8 Q;  5M5W H;  4L6T B;  4HIM A;  4CDE C;  3HOX B;  4C3I H;  1CT1 D;  1Q86 C;  1HJP A;  4U67 3;  2R7Z G;  5EKI A;  4C3H G;  5IOD A;  3LX0 A;  2VL6 A;  3J7A 5;  1C0A A;  1EQR A;  1A62 A;  3EVQ A;  3SGI A;  4Q5V A;  1X3P A;  1VQ9 A;  4K6D A;  4QIW B;  2ZTE A;  3E9H A;  1LUZ A;  5FLX c;  2E5L L;  1JR0 D;  2F0G A;  4HCE A;  3CRK C;  3JAM c;  2Z0S A;  4DR6 Q;  1AH9 A;  2A69 D;  2HD3 A;  1XMQ Q;  3HKZ B;  4AQY Q;  2XVS A;  2ZM6 Q;  2BA1 A;  2G9H D;  1S5B D;  4NB3 A;  2A74 C;  4XTC S;  4JI8 L;  1I4R A;  3E0E A;  2H1E A;  1JCK B;  3G6E A;  1TU2 B;  1TR5 A;  2F0U A;  2NUC A;  2RCF A;  3OWF A;  4ALP A;  3PO2 H;  4P2C B;  5A2Q E;  3ULP A;  1WD0 A;  1WTR A;  1A63 A;  2B2V C;  1HCZ A;  2OQ0 A;  1WI5 A;  3AFP A;  2JJQ A;  5G3L D;  3CD6 A;  1HFN A;  4DR6 L;  3D31 A;  4TKO B;  3T4A C;  1XMQ L;  4IAL A;  4X66 Q;  4AQY L;  3QO2 A;  2ZM6 L;  3R3O A;  5JPN C;  4HJ7 A;  5CBA E;  1EIH A;  4A3L H;  5C4H A;  1SE4 A;  3CW2 C;  1TWA H;  2DUD A;  2F3I A;  4QUC A;  2DNE A;  3N6R A;  1X54 A;  2R92 G;  4LAA A;  1O78 A;  4JI6 Q;  1F9R A;  2ES2 A;  1XWE A;  1K0R A;  2A6H D;  4XXE A;  2Q2U A;  1TWG H;  2IW3 A;  4RFB A;  5E7N A;  1BCP F;  2K5D A;  3D0F A;  2D9U A;  4BXX H;  1VF7 A;  1H9S A;  2XRQ D;  4V0B A;  4AYB B;  4X66 L;  2VW9 A;  1UNS A;  5C0X H;  2JA9 A;  1B9M A;  3IFD A;  4RGO S;  3UE1 A;  2KEE A;  1FD7 D;  5C0X J;  5DLQ E;  3CU7 A;  3S16 B;  5C4X G;  3S1M B;  2BCO A;  5CV5 A;  1EY7 A;  4K8J A;  3J80 i;  4A3C G;  3H94 A;  3SEB A;  5M5W B;  4JG2 A;  2JN4 A;  2F3W A;  2B3G A;  4KK7 A;  5CV9 A;  2JA7 B;  3OMG A;  1H9J A;  4JI6 L;  4EVO A;  4C3I B;  2I5M X;  4FYD A;  4DN4 M;  1XXG A;  4HR7 B;  2A5H A;  1QVG A;  5E4W C;  3BZK A;  4Y52 H;  1EWI A;  4BBS H;  3J81 L;  1IZ6 A;  2QEX A;  1JJC B;  3H6M A;  1IL8 A;  4MTK A;  3T16 A;  1Q90 A;  1RF2 D;  3GDE A;  2CCZ A;  2J7Z A;  1PRT B;  3CPW A;  5HGT A;  4OO1 H;  5E1F A;  4MNO A;  4XT1 B;  3FPP A;  3TP8 A;  4R4T A;  1PZK D;  2PW7 A;  5IGD A;  2R61 A;  3MXG A;  2LFN A;  3RZO H;  1E24 A;  5HGQ A;  3TRZ A;  3A56 A;  4KD3 A;  1B1Z A;  2BDN A;  1XYI A;  2K32 A;  3PO2 B;  2J0T D;  3IL8 A;  1Z47 A;  4G7O C;  2B8G A;  4KHV A;  2Y0S E;  3HKS A;  1SRO A;  5IP7 H;  1STH A;  3PO3 H;  3KOJ A;  1E22 A;  2AQ3 B;  1WTH A;  1SMX A;  3J7A V;  4APV A;  4A3D H;  4RA8 A;  2RSN A;  1JWS D;  2EJM A;  1YZ6 A;  2R7F A;  2RQX A;  1H9M A;  4JI4 Q;  2QDL A;  3K0X A;  5KND A;  3VDY A;  3MZ5 A;  1OO9 B;  3EIV A;  1HNZ Q;  3BYT B;  4B08 A;  1C9O A;  4R4C A;  3KF8 B;  2F4I A;  4IZ8 A;  3S24 A;  1VQP A;  1TWG B;  3K0Y A;  4HIK A;  1QE6 A;  4ZYS A;  3HOV H;  1NR2 A;  4GN3 B;  4DUY Q;  1D5X C;  1L1O C;  5ELC A;  2F0I A;  1SR3 A;  2K4K A;  4CKC A;  1BUV T;  1EY4 A;  1PYW D;  4ZKB B;  2G9D A;  3H91 A;  3ICE A;  1GXD C;  4JI4 L;  4R4I A;  1PH3 A;  4B3T Q;  5IYB G;  4BS9 A;  4K2L A;  4DA2 A;  3SK4 A;  1HNZ L;  1BO0 A;  2CFM A;  3B6Y A;  3R2T A;  5EGT A;  4J8Q A;  1A6X A;  4OWT B;  3BVM A;  4JVZ A;  4OX9 Q;  1PTO C;  2FJ2 A;  4JCV E;  3QIA A;  1ASY A;  2CQA A;  3CC7 A;  1X3Q A;  3HOU H;  3TP7 A;  1HA5 A;  2VY3 A;  2B2T C;  1GVP A;  3UDG A;  1J6Q A;  3CQZ H;  4BBS B;  2ZXP A;  1HZB A;  1IBL Q;  4QL5 A;  1XMO Q;  1YNJ C;  2F03 A;  3RUZ A;  1K3R A;  2NVY H;  4K2K A;  3J80 L;  2ICE C;  3H3V H;  2JA6 G;  2B2W C;  2Y0S G;  2EYH A;  4OON A;  4B3T L;  4A3K H;  3PIO A;  4JI5 L;  4I7A A;  2CKZ B;  5DM7 3;  1LLR D;  4FDB A;  1EOV A;  4A3I G;  1KC8 C;  1NJI C;  1B7Y B;  3S15 H;  4QQB X;  4FVM A;  3H0G H;  3K5O A;  1E2W A;  1CKN B;  1HTP A;  3RZO B;  1DJR D;  4OX9 L;  2K33 A;  2X6G A;  1KXL A;  1X32 A;  2Z1C A;  5JJZ A;  2F1M A;  1D8L A;  4HED A;  2K52 A;  2RDG A;  2KED A;  2QCP X;  5C5L A;  5CMD A;  3ERO A;  1IBL L;  1CUK A;  3VYT A;  1AZP A;  4RHR A;  1NUC A;  4F8M A;  3VR5 A;  1O7Y A;  2F3V A;  3PO3 B;  3HZX A;  2B63 G;  3DMU A;  3J81 E;  1MJE A;  1WJJ A;  4B9X A;  4KY7 A;  4A3J H;  2HDL A;  4KI0 A;  1PVO A;  1QZH A;  4C3J H;  3FRP B;  4LF7 L;  1X56 A;  1LT4 D;  1E2V A;  1E0B A;  1RCV D;  3SHL A;  1PXU A;  3A54 A;  4XDX A;  1A15 A;  4J1M A;  4GNX B;  3S2H B;  3S9W A;  2VQE Q;  1YI2 A;  2BE5 C;  2ZJR A;  1NTG A;  1N8R C;  2F0T A;  1AE3 A;  2K75 A;  3I4N H;  1ZEQ X;  5I9O A;  2EDG A;  4IFD H;  1I50 H;  1KAW A;  2F4V Q;  4DAP A;  5M3F G;  1C7Y A;  3D8G A;  2KOL A;  1CM9 A;  4BY1 B;  2RVL A;  5M5X H;  5FKA C;  2TSS A;  4IFD J;  2MP1 A;  3E5S A;  1V1P A;  3GP7 A;  4EQ5 A;  1O80 A;  3ULL A;  4RKL A;  2EYF A;  1EY0 A;  2BH8 A;  2MO1 A;  3I91 A;  3TSS A;  4UPA A;  2WKC A;  4IOC A;  3NHH A;  1VQF A;  1OXS C;  1AN8 A;  4OGQ C;  3F8T A;  4A3M H;  1BBU A;  2A69 C;  1Y1W H;  1QWY A;  2NTS A;  2VQE L;  3DWA A;  1WCM B;  2KEC A;  4WOR A;  5JOB A;  5ELE A;  1CHP D;  1FGU A;  2KHS A;  4KN4 C;  1K28 A;  4PZ7 A;  1LAB A;  1X6O A;  1M90 C;  3IRB A;  1RDP D;  4HSV A;  2N78 A;  3I56 A;  2F4V L;  3MFG A;  1Q8I A;  2WP8 J;  1YHA A;  4NDX A;  3CQZ B;  4DV2 Q;  3DEO A;  4NXN L;  4KMU C;  1I3Q H;  1STN A;  5C4J H;  4IUN A;  2HQE A;  1UAP A;  2JA8 G;  1QNU A;  4R8N A;  1K0S A;  2BOS A;  2E74 C;  5KRU A;  1F9P A;  3STB D;  1D6E C;  1VQ4 A;  4FF1 A;  1BXT A;  2MUY A;  1VQO A;  1EWH A;  3JC6 6;  1AP0 A;  2D2C C;  1YJN A;  3S1R H;  1H95 A;  1EZ6 A;  3RZD H;  3CCV A;  2MHV A;  3S15 B;  4QIW E;  3HOY H;  1HPC A;  5IGC A;  3H0G B;  1I5F A;  1TVX A;  3NPP A;  4A3F G;  1BCP B;  1TWH H;  3A5U A;  2HHH L;  2D0O A;  3RLF A;  2Q2T A;  1HR0 W;  1A3T A;  2F0E A;  2UXC L;  2ZT9 C;  4P74 A;  1VQA A;  4ULL A;  1CKN A;  1SNO A;  1VS0 A;  4DV2 L;  1WTW A;  2AUK A;  5DAU A;  4POF A;  2F0P A;  3MTS A;  4GZY C;  3M4P A;  1K9M C;  1ILQ A;  5C3E G;  2A6H C;  3TRE A;  5DNF A;  1Z6H A;  1FNU A;  3LWU A;  3K6O A;  4N8F A;  2VUM H;  2VB2 X;  1SJE D;  1IYV A;  4IO9 A;  4XT3 B;  2IWH A;  3J80 E;  2EY1 A;  2R3Z A;  3FKI H;  5D3I B;  4C3J B;  1KNE A;  4IUT A;  4ZUJ A;  4MHE A;  1EU3 A;  4PNY A;  3CAM A;  3KLS X;  3K58 A;  2M2L A;  4GNX A;  3I4N B;  5I6Y A;  4G57 A;  1RJT A;  1EFW A;  2EY2 A;  1I50 B;  1CTM A;  1HZA A;  1II3 A;  1WD1 A;  4DXF A;  5M5X B;  3ULJ A;  4Y7N H;  3SK8 A;  1LT6 D;  2IY5 B;  2HIX A;  2UUB Q;  1GUT A;  1B8A A;  4PZ8 A;  1YBY A;  4HTH A;  3HOX G;  3BZC A;  1VQG A;  5LMU Q;  2MGS A;  4Z9C B;  1Y1W B; 
#chains in the Genus database with same CATH homology
 3NWS A;  2A68 C;  3D4W A;  1XX8 A;  4KHZ A;  3D6W A;  3HS0 C;  1SYB A;  4F88 A;  1BDO A;  2QEJ C;  1SXT A;  2PYK A;  1I3Q B;  2PZU A;  2X69 A;  4JK1 C;  4H44 C;  1PDQ A;  2K5W A;  1PTO D;  1DXM A;  3S1R B;  3RZD B;  3HOY B;  1EYA A;  4QMG A;  3WDN A;  1YNJ D;  3MFY A;  2HCC A;  2PNR C;  4O1N A;  5C0X I;  3MEH A;  5CV4 A;  2F0W A;  4G7Z C;  3VYS A;  2F0D A;  3K5M A;  1LAC A;  4EGV A;  3D6C A;  4KKT A;  5C3W A;  1TQO A;  3MAQ A;  3OHX C;  2VUM B;  3I3C A;  2DY7 A;  3M7N A;  3FKI B;  3NSW A;  1HFG A;  5KYL A;  2I07 B;  2IX0 A;  2JSO A;  1H9S B;  4R9W A;  2O4X A;  1EZ8 A;  4OHJ A;  1R4Q B;  1I4P A;  2SEB D;  1MI2 A;  2JP1 A;  2LMC B;  1TS5 A;  1ZXT A;  2PPB C;  5LL6 S;  4Y7N B;  2B2U A;  1FNW A;  1JOK A;  4DU9 A;  1PZI D;  4LMQ D;  3VR4 A;  2BE5 D;  3HP3 A;  5JEA J;  3V2T A;  3V96 A;  2R6G A;  2Z8L A;  1ML0 D;  4C3I G;  1F2Y A;  5KGU A;  4LJZ C;  1B2T A;  1PFB A;  2KCN A;  1ESR A;  1A3U A;  1PRT C;  2R93 B;  3QOJ A;  5J39 A;  4ZQ3 A;  1KLU D;  2LS0 1;  2N55 A;  5IGG A;  3N52 A;  1TWC B;  5I4D A;  1Y1V B;  1Y8N B;  1JWU D;  1J8I A;  1QB5 D;  3RD4 A;  4PMW A;  2NB0 A;  1KDB A;  1WTO A;  2L55 A;  1EY5 A;  2EYJ A;  1SNP A;  4C2M B;  2K6A A;  1A2T A;  4DF7 A;  4LK1 C;  2RA4 A;  2A6E C;  2SDF A;  1GOZ A;  1LT5 D;  4M8A A;  1Y8O B;  1RHP A;  3NE5 B;  1Q3L A;  4RCN A;  2O5I C;  3C2P A;  1LTI D;  3BDO A;  2IT1 A;  3K57 A;  5C44 B;  3LWE A;  1HA6 A;  3P1H A;  4Q0F A;  1EY9 A;  5C0X G;  2WIN B;  2JEA I;  2B8F A;  5T1I A;  4KKS A;  3PUX A;  3VYU A;  1R4P B;  1V1O A;  1GUO A;  1DYQ A;  5I6W A;  5CV6 A;  3SE0 A;  1BNZ A;  2IPK D;  2FFK B;  2E75 C;  3L9A X;  4TQU S;  1LTG D;  1M8A A;  1JOR A;  4DAV A;  1GUW A;  2EYP A;  4A93 B;  1QG7 A;  1LTR D;  4RKB A;  2FIN B;  1I4H A;  3FVQ A;  5IGF A;  2L0C A;  5AFW A;  2A68 D;  2E2I B;  3A7A B;  1Q1B A;  2EYM A;  3BYY B;  3GTQ B;  2BA0 A;  3KBX A;  1HUN A;  2WV6 D;  1U4M A;  4IFD I;  3LNN A;  1EWC A;  3DWQ A;  5CR3 A;  1STA A;  2NVX B;  5NUC A;  2YYZ A;  2WKD A;  4MIU A;  1F2M A;  4A3B B;  1KTK A;  4BA1 I;  1KAB A;  1QCB D;  3BVG A;  2EXZ A;  4IUU A;  3J7Y W;  1PZJ D;  3NP8 A;  1ICW A;  2PO4 A;  2EY6 A;  1BOS A;  1LV9 A;  3HOZ B;  1SYE A;  2FMC A;  5EKL A;  1TWA B;  3GTG B;  1WTX A;  1RTN A;  4RHS A;  1SNC A;  1F2L A;  3NTH A;  5LHY 1;  1STB A;  2N88 A;  2WAC A;  2AUJ D;  4X3T A;  1FGB D;  1MSG A;  4N9P A;  1JOQ A;  3AMU A;  3SR1 A;  1V1P B;  1IHZ A;  1KAA A;  4KKU A;  2OEO A;  1SNM A;  5FLX L;  3R8B A;  2XIW A;  1NCV A;  1YNN C;  3JAM L;  5FK9 C;  1B44 D;  2NBF A;  4WFN 3;  2B2Y A;  3R93 A;  2F0S A;  1BQQ T;  3MWY W;  3Q23 A;  4DFA A;  3NBI A;  5G3L F;  3D4D A;  5FO7 B;  4FNF A;  1WTV A;  3H3V C;  2Q8I B;  1CK1 A;  3OIQ A;  1U9R A;  3G6J B;  1B9N A;  2M9V A;  3S1Q B;  1BF4 A;  3DWP A;  4H7B A;  2NZ1 D;  1BCP C;  4NKL A;  3NTI A;  4ZUI A;  2KUM A;  3SK6 A;  2SNS A;  1PRT D;  1FR3 A;  2L9H A;  2EJF C;  4RAU C;  2XWJ B;  2RKS A;  2TMP A;  4RCO A;  5I9P A;  1OXU A;  2IL8 A;  1B4O A;  3A7L A;  4RGM A;  1VDZ A;  1LT3 D;  3ZYY X;  5FOB B;  1B53 A;  1ILP A;  1H9K A;  3ITP A;  4EQN A;  1ROD A;  4ZKC B;  4A3D B;  4C3J G;  4KY5 A;  5C3X A;  1ZYR D;  2B2U C;  1STY A;  4ID6 A;  3PIO 3;  1L0Y B;  4L8J A;  3IAY A;  3KLR A;  3IFT A;  4A3E B;  1AZQ A;  4IFD G;  1SND A;  1HRJ A;  2A6E D;  5M9O A;  3HOV B;  1G6Z A;  1Q12 A;  1EOT A;  3ERQ A;  4CHT B;  2K1B A;  1ET9 A;  4NMZ A;  3VYR A;  1TII D;  1GUG A;  3C1E A;  2EYO A;  1TT2 A;  4IUV A;  3L7Z C;  1SEB D;  5EPL A;  2YU9 B;  3E0J A;  1UEA B;  2KCC A;  3T13 A;  1TWF B;  1JQY D;  5KYI A;  3HOU B;  4CGY B;  2WB1 B;  1LTT D;  2K01 A;  3NUC A;  4IUQ A;  3Q24 A;  1GUS A;  3C46 A;  2Q8T A;  3GQB A;  2NVY B;  3NBH A;  5BN5 A;  2JA5 B;  1PFM A;  5BN4 A;  4WJW A;  4A3K B;  1TY2 A;  5FLX E;  4L63 B;  1SSO A;  2VXW A;  3HG9 A;  2CW0 D;  3Q22 A;  3JAM E;  1EYD A;  4ABN A;  3PUZ A;  2SOB A;  2E2D C;  3A55 A;  4HMI A;  1NAP A;  5I2Y A;  2E76 C;  5EKK A;  3EQL C;  3BS1 A;  1IW7 D;  1TS3 A;  3PMF A;  2L1B A;  2RDH A;  2WAQ B;  4FXG C;  4XYQ A;  1WTQ A;  5C5M A;  5D14 A;  4A3J B;  2OT2 A;  2QDB A;  4RGN A;  1MGS A;  3I4L A;  3FEW X;  2L11 A;  3M4Y A;  3VR3 A;  3NWT A;  5CYU A;  2OF1 A;  1HHV A;  3ND8 A;  3EFX D;  3QG1 A;  5LL6 X;  4O42 A;  3TZD A;  5FO9 B;  2QKI C;  4HCS A;  1QJO A;  3SK5 A;  1QOH A;  2ZXO A;  3S2D B;  3D3R A;  4F87 A;  4A3M B;  2BDO A;  4X3S A;  3TP6 A;  3S1N B;  3T53 B;  2I46 A;  4DK0 A;  1EU4 A;  1CA5 A;  1DOL A;  4H13 C;  1HQR D;  4K5W A;  2Z4H A;  1GHJ A;  1YNN D;  5IT9 E;  4DK1 A;  1CA6 A;  5C4J B;  1OXX K;  3I70 A;  3SDZ A;  1C8C A;  3GO5 A;  2PQE A;  2F0J A;  4OIJ A;  3O13 A;  2XWB B;  3M7G A;  3ONA B;  3RMH A;  5ELF A;  1EEF D;  1TWH B;  5IGE A;  3MHB A;  1F77 A;  1BCP D;  2F0M A;  2O2L D;  3NQT A;  3VR2 A;  1TS2 A;  4ILW A;  2EYL A;  1K8M A;  1S4Z A;  2NTT A;  5JAV A;  3V05 A;  4A3G B;  1STG A;  4CJ0 B;  2L12 A;  2NN6 H;  1DZ1 A;  3A8K E;  3OSO A;  1NSN S;  4G4K A;  3SVM A;  1OXV A;  1I4G A;  2B2W A;  2KA7 A;  4PV1 C;  3M4O B;  1RKN A;  4XQJ A;  2B2Y C;  1WTP A;  3TN2 A;  4FF2 A;  4HMJ A;  3S14 B;  2XRS D;  2EPB A;  1D1I A;  5IOC A;  5ELD A;  4OO1 I;  2DY8 A;  4PMB A;  5K5P A;  2PW5 A;  3R2I A;  5JEA H;  3QOL A;  4DNR B;  5CGK A;  2FHT A;  2F0F A;  2JYO A;  1G2S A;  3GTP B;  1QIL A;  2ZXR A;  1JWM D;  3X3M A;  4I7Z C;  2D5D A;  4FF4 A;  5EBD A;  5K36 H;  3I72 A;  5ELB A;  2WII B;  3L3O C;  4XQN A;  1DCZ A;  3GV6 A;  1SNQ A;  1JB3 A;  2EOT A;  3HEJ A;  3FPU B;  4PMC A;  1DOK A;  1PFN A;  2Q8R E;  3G7L A;  1SYG A;  4K5X A;  2QF7 A;  1OXT A;  1ZYR C;  4C56 C;  3NTK A;  3FDT A;  2PMZ B;  5J1Z A;  3TBI B;  1LTS D;  3I4M B;  1LTB D;  1DM0 B;  2F0O A;  4FXK C;  2AQ2 B;  4XQQ A;  4ZAI A;  1G2T A;  2F0K A;  1VCI A;  4H0L C;  1KDA A;  3QB3 A;  1MBY A;  4WRD A;  2JEB I;  1S5E D;  1HXY D;  2CVR A;  5EQ0 A;  1SFO B;  3PV0 A;  3DHQ A;  3SXH A;  1MD2 D;  3AB9 A;  3HOW B;  1PLF A;  1G8Z D;  2NVT B;  3QWN A;  1D2B A;  5IIF A;  1ONL A;  5CC4 A;  2MPM A;  1PTO F;  3MXN A;  4BBR B;  3Q6S A;  1JE4 A;  4FF3 A;  5DM6 3;  3K5N A;  3F2U A;  5M3M B;  1O7Z A;  3MVV A;  1SMY C;  2NVQ B;  5EPK A;  4K6L A;  3GTO B;  3H09 A;  2CW0 C;  1BR9 A;  4DNT B;  4C1N I;  1L0X B;  1K83 B;  4BA2 I;  3W2D A;  1D5M C;  3PUW A;  1CHQ D;  4ODG A;  1SYD A;  2K03 A;  3EA6 A;  1SYC A;  4PQX A;  1SYF A;  4OO1 G;  1IW7 C;  2KQ3 A;  2R7Z B;  4K5V A;  1HTL D;  3NQI A;  4C3H B;  4KY6 A;  1B3A A;  4TSS A;  5COY A;  4HN7 A;  4FP5 D;  4IUP A;  4KTA A;  5EPJ A;  1EQV A;  2XNA C;  3K7A B;  4XYO A;  2L4N A;  4CKE A;  3C1F A;  1DOM A;  1AFP A;  3DXJ C;  3TME A;  2D62 A;  2F0L A;  1RD9 D;  4OL7 A;  1JC7 A;  4EQO A;  1F2Z A;  2HCI A;  1W6J A;  1CQV A;  3A8J E;  1A3V A;  2XN9 C;  3URY A;  2M00 A;  4QF4 A;  2KJX A;  4CJ1 B;  5F2D A;  1U4R A;  1CQF A;  5JPM C;  2ID0 A;  3BZD B;  1IKM A;  1H9R A;  1QNK A;  1M4V A;  4NP5 A;  4XIG S;  4ZLT F;  3A8I E;  5DEH A;  1SAP A;  2NWG A;  2K04 A;  2JE6 I;  3OOC A;  2R92 B;  2K28 A;  3QJY A;  3P20 A;  1D5Z C;  3M3Y B;  1Y8P B;  3MC0 B;  3IKJ A;  1SDF A;  3MXU A;  2CHB D;  4ME5 A;  2VNU D;  4UDU C;  2X6L A;  1G91 A;  3M85 A;  1EY6 A;  3BVZ A;  3OWE B;  1VF5 C;  3NK9 A;  1CI3 M;  2HUG A;  1LO5 D;  2QIL A;  4TRD A;  2PZT A;  3TZU A;  5C4X B;  4B9W A;  1V8Q A;  1F9S A;  3T56 B;  5E4X A;  4JBW A;  2EE1 A;  2RSO A;  4FXD A;  3KBG A;  3CRL C;  2AQ1 B;  1FYC A;  5KNB A;  2DNC A;  1XTC D;  1SE2 A;  1B50 A;  3DM1 A;  1U4L A;  2IX1 A;  1TS4 A;  2F0N A;  1G29 1;  4K8I A;  2EJG C;  1PTO H;  5BN3 A;  5HUR A;  4FO2 A;  2KVM A;  1VMP A;  4M1U B;  3U9S A;  2K5Q A;  4OIK A;  1S5C D;  1BBX C;  5KNC A;  3WOE A;  1EYC A;  1ESF A;  4DGZ A;  3NXW A;  4X3K A;  4G7H C;  2ENB A;  4K14 A;  4EQP A;  3I90 A;  5A35 A;  5JVG 3;  1KNA A;  4NW2 A;  3GD7 A;  4N9T A;  3PUV A;  4CKB A;  1U4P A;  3GV3 A;  2J4X A;  5EBC A;  4R8I A;  4QB4 A;  5IT9 L;  5COR A;  2H4O A;  3FMC A;  5KEE A;  4MN3 A;  4RGT A;  1CZW A;  1ENC A;  2B2V A;  2ICI A;  3OIP A;  4QCL A;  3KUP A;  5TSS A;  1A2U A;  2F0Q A;  3CHB D;  1EEI D;  1VMC A;  2JXM B;  1FNV A;  3CKI B;  4V19 0;  1EIG A;  3KF8 A;  5IGB A;  4KN7 C;  4BWG B;  5D65 A;  4KJN A;  3K5L A;  3P7J A;  2LY7 A;  1SBB B;  2F0H A;  2EZV A;  3VA7 A;  3KK7 A;  2NN6 I;  3P75 A;  1SMY D;  5CV7 A;  1D1K A;  1SJH D;  4S3S A;  4YIJ A;  3BG3 A;  4QUF A;  3MA2 B;  3C3L A;  5EJW A;  1I4X A;  4I65 A;  2RBM A;  2C9O A;  5I2X A;  1HQM C;  1RTO A;  1PTO B;  5M5Y B;  2JA6 B;  1S5D D;  4IN3 A;  2Y0S B;  1IKL A;  5C6A A;  2EVB A;  1ENA A;  4RWS C;  3K59 A;  1DD2 A;  3BDL A;  3D4R A;  3PUY A;  1K8O A;  4A3I B;  2AWO A;  3AU7 A;  1IYU A;  2DN8 A;  5ISR A;  1I6H B;  1ET6 A;  1J9O A;  3OPO A;  1C4Q A;  3OW7 A;  4HAE A;  1HUM A;  5E3F A;  2RDF A;  2PCF B;  2PZW A;  1GHK A;  1JOO A;  4HSP A;  4J6H A;  2B63 B;  5CV8 A;  3J7A F;  1TKW B;  1I4Q A;  1Y69 U;  1TY0 A;  1C48 A;  1O7L A;  1PRT F;  4ZRZ A;  4CBV A;  3E6Z X;  2L5T A;  2O5J C;  3PIP 3;  4F7X A;  5KIX A;  1PMR A;  1WVL A;  1F9Q A;  1T5E A;  1S5F D;  2K7V A;  2B39 A;  2IJ0 A;  4X3U A;  5M3F B;  4DAY A;  1Z7T A;  5T1G A;  4E6I A;  1AW7 A;  4ZK9 B;  2Z4I A;  3GTL B;  3VR6 A;  2E2H B;  4C1N K;  2XSC A;  3I73 A;  3KLS A;  4IUR A;  1LTA D;  1KLG D;  3HRZ C;  2F0V A;  5A2Q L;  3S17 B;  2AWN A;  3WOF A;  1EL0 A;  2SNM A;  5D3D A;  2K05 A;  3DUZ A;  4U68 A;  5C4Z A;  1EY8 A;  1W6K A;  2VB3 X;  1NR4 A;  3BDC A;  3VA5 A;  1ENF A;  3I8Z A;  2V4D A;  1CFM A;  4CJ2 C;  4KJO A;  2JA8 B;  4BY7 B;  2GA4 B;  2A73 B;  1STE A;  2C5C A;  4RH6 A;  1R9T B;  2B2T A;  2HDM A;  2NN6 G;  3U9O A;  1KDC A;  1SE3 A;  1T5X D;  4A3F B;  1ZKO A;  2IX3 A;  3W3A A;  4UAI A;  2LKV A;  3OMC A;  1CZG A;  5C3E B;  2E2J B;  3DEP A;  1JIC A;  2EY5 A;  3UI2 A;  3TDQ A;  1GJX A;  1V43 A;  3Q0A A;  2NYZ D;  1UUP A;  2OXP A;  3X3N A;  5JEA G;  5JVH 3;  3GTM B;  4KD4 A;  5FO8 B;  5J22 A;  1Q1E A;  4IQZ A;  1DON A;  4KV6 A;  4DXG A;  1EFI D;  1GUN A;  3EJI A;  1MSH A;  1AEX A;  3ND9 A;  3TP5 A;  5CBE E;  3GTK B;  1EQT A;  1I6V C;  3MXP A;  3HGB A;  2FMM A;  3T51 B;  5K36 G;  2MJ8 A;  3GTJ B;  1E2Z A;  4L6T B;  3HOX B;  1CT1 D;  4U67 3;  5EKI A;  4C3H G;  5IOD A;  3LX0 A;  3EVQ A;  4Q5V A;  1X3P A;  4K6D A;  4QIW B;  1JR0 D;  2F0G A;  4HCE A;  3CRK C;  2A69 D;  3HKZ B;  2XVS A;  2BA1 A;  2G9H D;  1S5B D;  2A74 C;  4XTC S;  1I4R A;  2H1E A;  1JCK B;  1TU2 B;  1TR5 A;  2F0U A;  2NUC A;  3OWF A;  4P2C B;  5A2Q E;  1WD0 A;  1WTR A;  2B2V C;  1HCZ A;  5G3L D;  1HFN A;  3D31 A;  4TKO B;  3T4A C;  4IAL A;  3QO2 A;  3R3O A;  5JPN C;  5CBA E;  1EIH A;  5C4H A;  1SE4 A;  4QUC A;  2DNE A;  3N6R A;  4LAA A;  1O78 A;  1F9R A;  1XWE A;  2A6H D;  4XXE A;  2IW3 A;  4RFB A;  1BCP F;  2K5D A;  2D9U A;  1VF7 A;  1H9S A;  2XRQ D;  4V0B A;  4AYB B;  1UNS A;  5C0X H;  1B9M A;  3IFD A;  4RGO S;  2KEE A;  1FD7 D;  5C0X J;  3S16 B;  3CU7 A;  3S1M B;  2BCO A;  5CV5 A;  1EY7 A;  4K8J A;  3H94 A;  3SEB A;  5M5W B;  2F3W A;  5CV9 A;  4KK7 A;  2JA7 B;  3OMG A;  1H9J A;  4EVO A;  4C3I B;  4FYD A;  4DN4 M;  1XXG A;  4HR7 B;  2A5H A;  5E4W C;  3J81 L;  3H6M A;  1IL8 A;  3T16 A;  1Q90 A;  1RF2 D;  2J7Z A;  1PRT B;  5HGT A;  4OO1 H;  5E1F A;  4XT1 B;  3FPP A;  3TP8 A;  1PZK D;  2PW7 A;  5IGD A;  2R61 A;  3MXG A;  2LFN A;  3A56 A;  4KD3 A;  1B1Z A;  2BDN A;  1XYI A;  2K32 A;  3PO2 B;  2J0T D;  3IL8 A;  1Z47 A;  4G7O C;  2B8G A;  4KHV A;  1STH A;  2AQ3 B;  3J7A V;  4RA8 A;  2RSN A;  1JWS D;  2EJM A;  2RQX A;  1H9M A;  5KND A;  3MZ5 A;  1OO9 B;  3BYT B;  4B08 A;  4IZ8 A;  2F4I A;  1TWG B;  3K0Y A;  1QE6 A;  4ZYS A;  1NR2 A;  1D5X C;  5ELC A;  2F0I A;  4CKC A;  1BUV T;  1EY4 A;  1PYW D;  4ZKB B;  2G9D A;  3H91 A;  1GXD C;  4BS9 A;  4K2L A;  4DA2 A;  3SK4 A;  1BO0 A;  3R2T A;  5EGT A;  4J8Q A;  1A6X A;  3BVM A;  1PTO C;  2FJ2 A;  3QIA A;  2CQA A;  1X3Q A;  3TP7 A;  1HA5 A;  2B2T C;  4BBS B;  2ZXP A;  1YNJ C;  2F03 A;  3RUZ A;  4K2K A;  3J80 L;  2ICE C;  2B2W C;  2EYH A;  5DM7 3;  1LLR D;  4FVM A;  3K5O A;  1E2W A;  1HTP A;  3RZO B;  1DJR D;  2K33 A;  2X6G A;  1X32 A;  2Z1C A;  5JJZ A;  2F1M A;  4HED A;  2RDG A;  2KED A;  2QCP X;  5C5L A;  5CMD A;  3ERO A;  3VYT A;  1AZP A;  4RHR A;  1NUC A;  4F8M A;  3VR5 A;  1O7Y A;  2F3V A;  3PO3 B;  3HZX A;  3DMU A;  3J81 E;  4B9X A;  4KY7 A;  2HDL A;  4KI0 A;  3FRP B;  1LT4 D;  1E2V A;  1E0B A;  1RCV D;  3SHL A;  1PXU A;  3A54 A;  4XDX A;  1A15 A;  4J1M A;  3S2H B;  3S9W A;  2BE5 C;  2F0T A;  1ZEQ X;  5I9O A;  2EDG A;  4IFD H;  4DAP A;  3D8G A;  2KOL A;  1CM9 A;  4BY1 B;  2RVL A;  5FKA C;  2TSS A;  4IFD J;  2MP1 A;  3E5S A;  1V1P A;  3GP7 A;  1O80 A;  4RKL A;  2EYF A;  1EY0 A;  3TSS A;  3I91 A;  2WKC A;  3NHH A;  1OXS C;  1AN8 A;  4OGQ C;  2A69 C;  1QWY A;  2NTS A;  3DWA A;  1WCM B;  2KEC A;  4WOR A;  5JOB A;  5ELE A;  1CHP D;  2KHS A;  4KN4 C;  1LAB A;  1RDP D;  4HSV A;  3MFG A;  1Q8I A;  2WP8 J;  4NDX A;  3CQZ B;  3DEO A;  4KMU C;  1STN A;  4IUN A;  2HQE A;  1UAP A;  1QNU A;  4R8N A;  2BOS A;  2E74 C;  5KRU A;  1F9P A;  1D6E C;  4FF1 A;  1BXT A;  2MUY A;  1AP0 A;  1EWH A;  2D2C C;  1EZ6 A;  2MHV A;  3S15 B;  1HPC A;  5IGC A;  3H0G B;  1TVX A;  3NPP A;  1BCP B;  3RLF A;  1A3T A;  2F0E A;  2ZT9 C;  4ULL A;  1SNO A;  1WTW A;  2AUK A;  5DAU A;  2F0P A;  3MTS A;  4GZY C;  1ILQ A;  2A6H C;  5DNF A;  1Z6H A;  1FNU A;  3K6O A;  3LWU A;  2VB2 X;  1SJE D;  1IYV A;  4XT3 B;  2IWH A;  3J80 E;  2EY1 A;  2R3Z A;  4C3J B;  5D3I B;  1KNE A;  4IUT A;  4ZUJ A;  4MHE A;  1EU3 A;  4PNY A;  3KLS X;  3K58 A;  2M2L A;  3I4N B;  5I6Y A;  4G57 A;  1RJT A;  2EY2 A;  1I50 B;  1CTM A;  1II3 A;  1WD1 A;  4DXF A;  5M5X B;  3SK8 A;  1LT6 D;  1GUT A;  4HTH A;  2MGS A;  4Z9C B;  1Y1W B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...