1C4QA

Mutated shiga-like toxin b subunit (f30a/w34a) complexed with receptor gb3 analogue
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
69
structure length
69
Chain Sequence
TPDCVTGKVEYTKYNDDDTFTVKVGDKELATNRANLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Identification of the Primary Receptor Binding Site of Shiga-Like Toxin B Subunits: Structures of Mutated Shiga-Like Toxin I B-Pentamer with and without Bound Carbohydrate
rcsb
source organism Escherichia coli
molecule tags Toxin
molecule keywords PROTEIN (SHIGA-LIKE TOXIN I SUBUNIT B)
total genus 16
structure length 69
sequence length 69
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 1999-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1c4qA00
1BOSA 1D1IA 1CQFA 1DM0B 1R4QB 4P2CB 2C5CA 1CZWA 1CZGA 3MXGA 4ULLA 2XSCA 1D1KA 1C48A 1QOHA 1R4PB 2GA4B 1QNUA 2BOSA 1C4QA 4M1UB
chains in the Genus database with same CATH superfamily
2RA4A 4FXKC 1JR0D 4LK1C 1WOCA 5EKLA 1I4RA 3RLFA 5C4JB 4A3FB 2WAQB 4KN4C 2C5CA 1H9MA 3TREA 4RG1A 4J15A 3I4OA 5IGGA 4DV3L 2OQKA 3KJPA 4DR2L 1B9NA 1YJNA 4DXFA 1SNMA 4JG2A 2P5ZX 3H15A 4BY7H 4A3GB 2R7FA 1Y8PB 5CBAE 3PO2H 1R4PB 1BBWA 1OXUA 1AE2A 4JK1C 2JA7G 2XRQD 1K8GA 2D0PA 2ICIA 1VQBA 3QG1A 1KAAA 1CKNB 2L9HA 4K5VA 1F2ZA 1AZQA 3PF4A 3PV0A 1PZID 2Y0SB 3GQBA 4HJ5A 2Z6KC 5JVG3 4TSSA 4DAYA 4QIWE 2UXCQ 5ELBA 1PH1A 2JA9A 2KUMA 3S15B 1RL2A 2OT2A 2PZUA 3PUVA 3H0GH 2KEDA 2KBNA 1SJHD 2F0TA 4DV4L 1F9PA 1R4QB 4GN5A 2I5HA 1S40A 3J80c 1VQPA 2BA1A 5CYUA 5FO7B 4GLXA 2YTXA 2JA5B 2ICEC 2NB0A 2MHVA 1L0XB 4LFCL 1A3TA 1STAA 1SRUA 3BZKA 1BQQT 2FMCA 2KCCA 3G6EA 1VQ4A 4A93G 3OTOL 5JEAH 5HURA 3CU7A 2F0DA 1X9NA 4DAPA 1KHIA 1HTPA 4IFDG 2HDLA 2PI2E 1FGBD 1MSGA 3TP8A 3J81i 4XDXA 3CPWA 1ENCA 4FNFA 4C1NK 3G48A 1LUZA 1MKHA 5COYA 5CC4A 3T1HQ 2JYOA 3H0GB 1Q90A 2BDOA 1NE3A 5EPJA 5IE8A 3A55A 4KHZA 3U9OA 2EYFA 2NN6H 1PH4A 4A93H 4LFCQ 1PV4A 4HIOA 1O80A 4JI7L 2LXJA 4ME5A 5KEEA 4GKKL 5I6YA 4XQJA 5C3EG 4L63B 4XQNA 3CCLA 4JOIC 1ENFA 2ZTDA 4IFDH 4ZLTF 3F1ZA 2BCOA 3VR4A 2M9VA 4A3BB 2HCCA 2EVBA 4GKJQ 2Z6KA 3GTLH 1EQTA 4YWKA 5CGKA 3B6YA 4QIWB 1LM0A 2L5TA 1XXGA 1N36Q 1EY4A 2A69C 4S3SA 3TS0A 1IW7D 4H7BA 4JI6Q 3C1EA 1SXTA 1PRTC 5E4WC 3TS2A 1CKNA 3MWYW 3K6OA 4I7AA 5M5WB 1E1TA 1V9PA 3LGJA 1RHPA 1DONA 5CR3A 5C44B 2RDGA 3ULJA 4X65L 3KLSX 4X3SA 2IJ0A 2B3GA 2VB3X 1F77A 2E2HB 1Z6HA 4A3GG 1YNNC 5E7NA 1HZAA 1FR3A 2H4OA 4R8NA 2A68D 4CKBA 4LF6L 2PPBC 2F3WA 3ITPA 4X66Q 4GNXB 2UXBQ 1DXMA 2YV5A 2N8NA 3HOYB 3STBC 4PZ6A 1F2YA 2K52A 3PUWA 2RKSA 2R7ZB 2RCFA 1JOQA 2E2JH 3A8JE 1R9TH 1KNEA 2B2VA 3QR8A 2K5HA 4ZK9B 4HEDA 5FO9B 2K03A 3HOXH 1GUTA 1NBWA 2WAQE 4DUZL 2L15A 5EPKA 4AYBB 2IWHA 2JSOA 2O4XA 4BA2I 1CI3M 2RDHA 4IUPA 1LABA 1U4PA 4CGYB 3AB9A 1KAWA 4QCLA 1EUJA 3GV3A 2E2DC 1ET6A 1W6JA 1W3SA 2SNSA 1XMOQ 4X3TA 1LT3D 3URYA 4DUZQ 3M85A 2VNUD 3HOUH 2CW0C 3OWEB 3D6WA 1D5ZC 4UP8A 2UU9L 4LUZA 4UHVA 2OTJA 3RLOA 1S72A 2YTYA 4R9WA 4A93B 3A74A 4RWSC 4DV7L 3IFTA 1I4PA 2NUCA 3J81c 3NQIA 2GA4B 1EU3A 2Z6BA 2PZWA 1STNA 2WFWA 2KOLA 4DV0Q 4KHPL 2NVYH 1N32L 4N8FA 4LF6Q 5C0XH 5H1SE 1IBKL 4TVAB 1ILPA 4C56C 5FLXE 1WI5A 1IZ6A 2RCNA 2L55A 3HOUG 3DXJC 5J39A 2A68C 1SDFA 3CCUA 1RD9D 3FKIG 1QZGA 5BN3A 3MXNA 2FJ2A 2JXMB 1K8MA 1YI2A 5GQOA 1RKNA 4JV5L 1AE3A 2I07B 1A3UA 1BKBA 1ZKOA 3S1QH 4BBSG 1PFMA 4ID6A 4LAAA 3E9IA 3A5UA 2TSSA 2HIVA 1PXUA 1KIXA 2EQSA 3OHXC 4XYOA 2CW0D 1VS0A 3NXWA 2FFKB 4HJ9A 3GTJB 3CD6A 4JI1L 3I3CA 3MXGA 1NJIC 4ABNA 4H02A 3KF6B 2ASBA 5C4HA 4G7ZC 5C4ZA 3FKIH 4DR6L 1TWHH 4L5SA 1W6KA 1E1OA 3OW2A 1JOKA 2YU9H 2EZVA 2K32A 3K5NA 1J9OA 3T1YQ 2OTLA 2B63G 2NVXH 1UE1A 5CMDA 5IYCH 1CUKA 1Y1WB 1XNRL 1H95A 5C3EB 4AYBG 1HR0Q 2OCEA 4LF9L 3EA6A 4NMZA 1KD1C 2F0IA 4KY5A 3PIPA 2NZ1D 5CV7A 3J7AV 1EU4A 4R4OA 4A3JH 2BH2A 4BY7B 3S1QB 3M7GA 4CJ2C 1BOSA 1HZBA 1PRTD 1S5BD 4BWGB 3I4MB 3PIO3 2C9OA 4ZYSA 4IOAA 4B3RQ 3A0JA 4NDXA 3NHHA 4A3FH 4M8AA 2E5LL 3CKIB 2K5QA 3RN2A 5AJ3L 1LT4D 1UE5A 5IYCG 3RLNA 2HD3A 3HGBA 2B2WC 2CWPA 3S16H 2IPKD 3W5OA 1K28A 1D7QA 5M3MB 2DNCA 4IFDJ 3VDYA 1K83H 1K0RA 3TMEA 2ZM6Q 2M00A 3H09A 3PCOB 1PVOA 2IHEA 1IXRA 1D1IA 2E5LQ 2N49A 4A3JG 5AJ3Q 1CM9A 5ELEA 3ND9A 1PH9A 5M5XH 3AFQA 1JJ2A 1M4VA 4ZUJA 3AU7A 1S5ED 3BDCA 4OO1I 1KC8C 1FNVA 4G7OC 2R92G 1FVIA 1A62A 3GV6A 1AH9A 1PTOF 2KENA 3LNNA 3KFUA 1CKOA 1QG7A 3W3AA 4I7ZC 5FO8B 4EX5A 5K36G 1JWSD 3QJYA 4LFBQ 4WJ3M 1SYFA 4JI8Q 5DAUA 1EY6A 2F1MA 3KOJA 1GUNA 3TP5A 2WACA 1I6HB 1Q8KA 3G6JB 2EY1A 2R93B 1HFNA 3TSSA 4KMUC 3TRZA 5D3IB 2UXCL 2E76C 5CV5A 3PMFA 5K5PA 3HOXB 1A6XA 1X6OA 3S2HH 1D5XC 2HHHL 1VQHA 1E0BA 4FVMA 4HMIA 2PNRC 2R92H 2XTIA 3L0OA 4FXGC 5KRUA 2WINB 1BXTA 4F87A 3HOYH 5K36H 1IKLA 2MO0A 1TWFH 3S1NH 4K8IA 1SSOA 1HTLD 4C1NI 1H9SA 3GTQB 1UE7A 2F0OA 4RCNA 3DM3A 1VQOA 3A7LA 3S14B 3PO3H 5LMNL 5E4XA 4KJNA 2BDNA 4QJFA 3M4PA 3NK9A 1S3OA 3UDIA 4JV5Q 5FJ8H 2HQLA 2K75A 1DD2A 3K5LA 4AQYL 1K9MC 2VB2X 2D9UA 1TR5A 4B3ML 5C4JH 3I4MG 2Y0SG 5IP7H 1XNQQ 1I6VC 1MSHA 2Q2HA 2RSNA 2Q8IB 4LUVA 1B44D 4JBJA 2F0MA 3I73A 5FKAC 2E75C 1PRTB 3L7ZC 1PH8A 4MNOA 5I9OA 4OO1H 3CP0A 4MZ9A 5ELOA 3JAMc 1AZPA 1U5KA 1HCZA 5F2DA 1NY4A 4C3IB 5M3MG 3VR5A 4A3EB 2KHIA 2N78A 1WTPA 4Y52H 2VUMB 1GUSA 1PYSB 2RHSB 2IX3A 1C8CA 1CSQA 5EGTA 4ZKBB 2JA8B 4FO2A 1HFGA 3EROA 3I4MH 2RQXA 1RIPA 3S1NB 1IBML 1GHJA 1UE6A 3J80L 5M9OA 2E2IB 3CF5A 1XJVA 2F4IA 3TDQA 3KLWA 3KF8B 5T1IA 4BY7G 1NR4A 2PMZB 1S5DD 4QUFA 2XRSD 1YHBA 2X6GA 3PO2G 2JA6B 4C2MH 1L0YB 3KBXA 3NBHB 4KD4A 3BU2A 4Z9CB 4X62Q 4JI4Q 3HOVB 1BUVT 3M4OH 5E1FA 1BBXC 1KDAA 4BY1H 3K7AB 4PZ8A 1RTNA 2PO4A 3GTGB 2DY7A 5M5WH 4GLAC 5D65A 4WORA 2QKIC 1GKHA 1VQMA 1EQRA 3M4QA 4HMJA 2LKVA 4JC0A 1OTCA 2XGTA 2I0QA 3P20A 1IBMQ 2FMMA 3BJUA 3EN2A 4DNRB 4FF1A 3DUZA 4IALA 4P75A 3H0GG 1A0IA 3A7AB 3E0JA 1TU2B 4FDBA 1S5CD 1YHAA 4DF7A 3ICEA 2CWAA 1BCPD 1PTOH 3H3VH 3T13A 1EWIA 2V1CC 4BS9A 2F0EA 1UWVA 3KJOA 3TZUA 1EY9A 3MZ5A 4GNXA 4BY1G 3OMGA 1X3FA 5JOBA 1P8LA 3J81E 3KLSA 1T5EA 2CH4W 5I6WA 3HFZB 1TWAH 4R4CA 3UDFA 2KHSA 3MA2B 2IY5B 4XYQA 2QEJC 5JEAG 4JI2L 4BBSB 1QB5D 3D4WA 4DV0L 1N32Q 4DV6L 4V0BA 2F0QA 1SJED 2PNHA 1EZ8A 2DJGC 5KIXA 1M90C 4Q5VA 4HN7A 4UP9A 3GD7A 3T1YL 1Q81C 1HPCA 4RHSA 2VQFQ 4K6DA 4DV2L 4JI5Q 3GTQH 5KNDA 3ULLA 1PA6A 1F9SA 2R6GA 2JJQA 3NSWA 2KCTA 2CFMA 4ODGA 4PMCA 3I2ZA 3M9BA 4A3KB 1STHA 3K58A 4LF8Q 3FEWX 3SK4A 4OX9L 1NMGA 3U4ZA 1TWAB 5C3EH 3O13A 1VQNA 1HNXQ 1Q1EA 4JI5L 1KRTA 1Q86C 4RGOS 2EYJA 4A3IG 3IAYA 4PMWA 2Z0SA 3DMUA 1LTBD 4OGQC 3I4NB 5A2QE 1TWFB 1A3VA 1L2FA 4PV1C 1VQFA 2BH8A 3NBIA 4A3MG 3A54A 2K5VA 3NBHA 1EY5A 4U673 2JA6H 3OIQA 3HKZB 1GXDC 1WTHA 5J1ZA 5LMUQ 4DV1L 1DCZA 4Y7NB 1EOTA 4DPGA 2FXQA 4JYAQ 3BG3A 1HUMA 1EYAA 3GTMB 2AHOB 4KV6A 4WJWA 3Q8DA 5C4XB 1XPUA 5LL6X 1O7YA 2XIWA 3GO5A 3BZDB 4KY6A 1KLGD 3FVQA 3CCVA 2QEXA 1RJTA 5IGCA 4JBMA 4X3UA 1SMXA 3HKZE 4A3GH 1IL2A 1EQQA 1QVFA 4OWXB 4KKUA 1JWMD 3CRKC 5C0XJ 1GUGA 2PMZE 1HR0L 1BCPB 3PO2B 1VQ9A 2O5JC 5I4DA 2JA6G 4DR7L 1SNCA 5CV9A 3SGIA 3TP7A 1KTKA 4QGUA 1Y8NB 2VXWA 1VF5C 3I55A 1YJWA 3WOFA 1CSPA 3DWAA 2YYZA 3ULPA 1QE6A 4JOIA 2LY7A 4HAEA 5C5LA 4QQBX 3I4LA 4UDUC 3T16A 2L4NA 2KCMA 4KHVA 2VS1A 5C3XA 3GDEA 3JAMi 5C5MA 3UDGA 4FXDA 1SYGA 4GOPB 1T9HA 3CCEA 2EJMA 2B2YC 4OELB 4M1UB 2K4KA 4GNXC 5DEHA 3E5SA 2KQ3A 3ND8A 1BBUA 3F2UA 1QNKA 4HCSA 2K04A 2BA0A 3MTSA 3P1HA 1IL8A 4UY8C 2A6HC 4PNYA 1ET9A 3S2DH 1PFBA 5CV8A 1GHKA 1QOHA 1NSNS 4X64L 2F0SA 1X3GA 3HP3A 5C3WA 3J81j 1SE8A 5KNBA 1GM5A 1I3QH 5FOBB 4DUYL 4RKBA 3I91A 5GROA 5L37A 1I6HH 5C0XG 4HJ8A 1A63A 1X56A 1PMRA 4MTNA 1CQVA 1JC7A 2NBFA 1I4HA 3FKIB 1T5XD 2EPBA 4KTAA 1LTAD 4R1JA 4LUOA 1V1OA 1EY8A 3CC4A 1TY0A 2NVTH 1I4QA 4YCVA 1N33Q 1K8AC 3S2HB 3KK7A 3PQIA 1NR2A 3H94A 4IPDA 5IT9E 4CHTB 1QUQA 1DM0B 4G7HC 1KXLA 3GTPB 4FF4A 3CMAA 5JAVA 3NTHA 4QB4A 2D5DA 2BE5D 3F2BA 3K8AA 1JWUD 2B2TA 5C6AA 3DWPA 4AIMA 3E9HA 4JI3Q 1U0LA 3HOUB 1EFID 3K0XA 2B2WA 3CCMA 2XNAC 3FPUB 1SNDA 2RHQB 5FLMG 4DV5Q 2XWBB 3L9AX 3P75A 2B63H 1NMFA 3CC7A 3OYYA 4CDDC 3G71A 3AFPA 2RVLA 2RBMA 3RD4A 1N34L 3UDXA 2Q8RE 2R61A 1C48A 3H91A 1XMOL 1VQ6A 4C3JH 1PZKD 5G3LD 2JA7B 1SFOH 1AN8A 1WFQA 1NTGA 3NE5B 1SROA 3A8IE 2F52A 4AYBE 1GUWA 2HCIA 2N3SA 4LF8L 2FINB 1IBLL 2PW5A 3CQZB 4DK0A 1PFNA 2ZXOA 1B1ZA 3DWQA 5LHY1 3GTJH 4LF9Q 1QJOA 1Z9FA 4NPSA 1H9SB 1XPRA 3M7NA 1Q1BA 1I94Q 4A3FG 1LYLA 1K0SA 3D8GA 2XN9C 3QOJA 5KGUA 2OF1A 2E2HH 1WTRA 1ASYA 1BNZA 4C3JG 1VCIA 2K5NA 2R92B 2EY5A 4IUTA 4OIJA 4J1MA 1B4OA 3PUZA 1TKWB 1Y1WH 2IHFA 1XYIA 1O7IA 2UUCL 2E2JB 4EQNA 3MXPA 3CXCA 3CC2A 2A74C 1UEAB 4DAYB 3A5ZB 3K7AH 2H5XA 2IW3A 2JA8G 1JT8A 1Q7YC 3CQZH 2JE6I 5ELDA 4A3CG 4H44C 2B2YA 4LJZC 5GAHC 2A6EC 1B3QA 1Y1VB 5GADC 1KL9A 4E6IA 2R3ZA 3EBEA 1PH2A 1HUNA 4ZKCB 3CCSA 2D2CC 4EQPA 1AFPA 3I4NH 4PQXA 5IYBH 1N9WA 3P7JA 4HTHA 2ZJQA 5A2QL 2MO1A 3ER0A 4P72A 2B8GA 4LNQA 1JB3A 1VMCA 2K5DA 2B39A 3VR6A 1II3A 1U4LA 4PZ7A 2DN8A 1XTCD 5FK9C 4A3CH 1GOZA 3JAML 3I8ZA 4IJLA 4LF4L 3OTOQ 2OXPA 2K5WA 3PUYA 2QA4A 5ELNA 4LF7L 2PYKA 3I4NG 2JP1A 5IYBG 1PRTF 3NPPA 3SK5A 1TWCH 1TWGH 1ZEQX 4WJ4A 3F8TA 3J7ZC 1MIUA 2B63B 4MN3A 2L0CA 3T51B 2B2TC 3R8BA 1TT2A 3F2DA 2UUCQ 1VQKA 1IYJB 5IGFA 3GTMH 2K33A 2LMCB 4DR3Q 3PO3G 1U9RA 2EYMA 2QW7A 3IL8A 1FL0A 2A1AA 1HRJA 3NP8A 1MJCA 1YVCA 3S24A 1OXSC 1SLJA 4ME3A 1G8ZD 3I7FA 4JVZA 4EGVA 3CCJA 2X69A 3K0YA 1V1PB 5IP7G 3KBGA 4DK6C 4RA8A 4AQYQ 1D1KA 1Q3LA 4A3IB 4YHHQ 1V43A 1Q82C 2F0LA 1MGSA 2MUYA 1JE4A 2B2VC 4LFAQ 3BDOA 3RUZA 4APVA 1QVGA 3SHLA 2G9HD 1EYDA 4A3DG 5JJKA 1SNOA 4DKAC 2F0WA 2F4VL 1SE3A 2GVBA 2O2LD 1Y8OB 5T1GA 4B3SQ 1KNAA 1EY7A 3BDLA 4A3DB 1E2WA 2B8FA 1PDQA 5ELFA 1FJGL 4IFDI 4ZUIA 3IFDA 4TRDA 1EWCA 3SXHA 1I5FA 1I50B 3EIVA 3K5OA 4BBRG 4DV3Q 1W2BA 1Q8IA 1YNJC 3S1MH 2K28A 2LFNA 1K8OA 3NTIA 4PG3A 1CFMA 2EXDA 1SBBB 2KJXA 1WCMG 1EWHA 1HNZL 2NVQH 4YCUA 2DUDA 3S1RH 3KF8A 1V1QA 3W1GA 1KDBA 1EIHA 4ZRZA 2B29A 3K5MA 2MGSA 2CH4A 2VZAA 5GAGC 4JCVE 1EQVA 2F4VQ 3S2DB 4DXGA 2SEBD 1H9JA 2F0HA 1BR9A 3FRPB 5FLXL 2WV6D 1CA5A 1O7LA 4ALPA 4BBRH 1NNXA 4F7XA 1IKMA 1B2TA 4DV6Q 1F2MA 1CQFA 1F9RA 3LX0A 4DAVA 4DR1Q 4R8IA 1N33L 4FYDA 2ZTCA 3D3RA 5JVH3 4KKTA 1UNSA 2WB1E 2AWNA 1YZ6A 3NENA 1S4ZA 4LF5L 2Q2TA 1XX8A 1IW7C 4X66L 3HKSA 1KABA 5KYIA 1WYDA 3X3NA 3RNUA 1J5EL 1TWHB 1HJPA 1BF4A 4KK7A 4H13C 4CBVA 1HNXL 1XMQL 4DV5L 3U58A 2ES2A 1A15A 2WKCA 4JI7Q 1TIID 3S1RB 5EBCA 3UI2A 3LWEA 4WRDA 3RZDH 4O42A 2J7ZA 2F0PA 3AQQA 4XT3B 1HA6A 1N34Q 2K7VA 4K5WA 5IGBA 1EYCA 5KYLA 3H6MA 4DR4Q 4ZAIA 4OEMB 2EY2A 2OWOA 5M5XB 1FNWA 3BVGA 5DNFA 4DAMA 4GN3B 3KDFA 2B2UA 3S17H 4YWMA 3HZXA 1FYCA 2F0KA 1IYVA 2QILA 3HOZH 4C3IG 4GOPC 3OW7A 3IRBA 3M3YB 3ERSX 1C0AA 1SYBA 1PH6A 3OPOA 2X6LA 3T4AC 1UUPA 4HJAA 1GJXA 2N55A 2JK8A 4B3TL 2NN6I 1PH3A 1TS2A 3D0FA 3J80i 4A3IH 4IPHA 2KEEA 1DZ1A 4B08A 4DA2A 1V1PA 4V190 2UUAL 3MC0B 3Q23A 2JQOA 1AW7A 4A3MH 2KCNA 4HIDA 1VQ7A 1DOMA 4HSPA 2F0UA 2IL8A 1I4GA 4C3IH 4JPBW 1YNND 3DEPA 1HH2P 3U50C 1IYUA 4JI1Q 5FLXc 2WP8J 1A2TA 1DOLA 3J7YW 5JEAJ 3VYUA 1IBKQ 4K2KA 3SK6A 2HHHQ 3HRZC 5JPNC 4B3SL 1EOVA 1MI2A 1WJJA 3D6CA 2BOSA 5EKIA 2NZHA 3RR5A 1SFOB 1BVSA 3FMCA 4RGTA 4A3MB 1KLUD 4ZQ3A 1TXYA 4G4KA 1DGSA 3N6RA 4O2DA 3G4SA 2CVRA 1E7ZA 3NTKA 5GAEC 3KLRA 1BDOA 3FPPA 1WD0A 3OWFA 4RCOA 2YU9B 2NVXB 1B7YB 1ML0D 3NWSA 3SDZA 4O1NA 3HOVG 2HT1A 1I50H 4IPGA 1QZHA 3U4VA 3OMCA 2PW7A 4CJ1B 2A8VA 2NWGA 1STGA 4HSVA 4L6TB 1SNPA 4XXEA 3QWNA 4BXXH 3I90A 3SVMA 1VQAA 1Y14B 3V2TA 4JI0L 5C44H 3QO2A 4DUYQ 1K73C 3HOWG 3GTGH 2UXDQ 4IUVA 1DYQA 1EIFA 1JJCB 2ZM6L 4DV1Q 1EZ6A 5IYDH 4JBKA 4ULLA 4I65A 2EYLA 1LTSD 4L5QA 1XNQL 5BN5A 4C2MB 1EY0A 2VQEL 5IT9L 2D0OA 4YIJA 2ZXPA 2MJ8A 4JW0A 3HOVH 1LT5D 1F9QA 1PZJD 1G91A 1FNUA 4X62L 2A73B 1NAPA 1X32A 4MHEA 1CT1D 4POGA 3V05A 1YBYA 4BXXG 1VQ8A 5LMNW 4CKEA 3W1BA 3TBIB 5C44G 3HOWH 2F0VA 3HG9A 3K57A 1B53A 4X3KA 4OWWB 1HQMC 3VR2A 1G291 2VUMH 2QCPX 4RFBA 3J7AF 3SR1A 3DEOA 1TWCB 1VQDA 2H1EA 4PMBA 3GTLB 2AUKA 1SMYC 1D2BA 5IT9c 1YNXA 1YNJD 2B2UC 3NELA 2AKWB 3MHBA 1MJEA 2R7ZG 4MIUA 1SYCA 3VA7A 2DJFC 3CHBD 4KLKA 2K01A 4DR2Q 4R4QA 3GTOB 1TWGB 4DGZA 5C4XG 2DGYA 3SK8A 2OEOA 3S1MB 2A19A 4FF3A 3HOWB 2SNMA 4IN3A 5HGQA 4JBWA 3JAME 2EYOA 2VUMG 4BBRB 4DFAA 4IO9A 4P2CB 2VQEQ 5FLMH 4RGNA 2ZJPA 1XMQQ 3R3OA 2CCZA 1OXVA 1SE4A 2R7DA 2UUBQ 3OIPA 1C9OA 2ZT9C 4HJ7A 5C0XI 1I3QB 2WIIB 4HIMA 4NXNL 2FHTA 3M3YH 4IPCA 2EXZA 1EIYB 3KUPA 1PTOD 3X3MA 4J6HA 5I2YA 4A4IA 1G6PA 4JI2Q 1EEFD 1X55A 1O78A 2JN4A 1JOOA 4RMFA 2F0FA 1U4RA 4A3EH 4A3BG 1TS3A 1K3BC 4B3RL 1NCVA 3MEHA 3AYHB 4GKKQ 3S9WA 1RF2D 1VMPA 4L5TA 4UAIA 3WWVA 2L12A 1D5MC 2L11A 4IUQA 2VW9A 2Q2UA 5LL6S 4OX9Q 2AQ2B 4KI0A 4OHJA 3F2CA 3OSOA 4DR3L 1YITA 1WVLA 1SR3A 4POFA 4QY7A 4OIKA 5LMUL 1VQJA 5ISRA 4A3KG 1OXXK 2M2LA 3EJIA 1G6ZA 2EIFA 1LTRD 1Y1WG 2IT1A 2PQEA 2XWJB 4J8QA 5NUCA 1Z7TA 1TQOA 1A8VA 2JA7H 1EEID 1HQRD 3ERQA 5TSSA 4CDEC 5IGDA 3PUXA 4A3BH 1GO3E 2CKZB 2JA8H 3E6ZX 1HNWQ 4O0AA 3BYTB 2GVAA 1WTVA 1ASZA 2DY8A 4K0KQ 1SNQA 3G7LA 3VR3A 3MFYA 4DNIA 1CZWA 1STYA 2RSOA 3A8KE 1A2UA 4K5XA 5J22A 2PI2A 4X64Q 4YWLA 3NUCA 3WOEA 1PYWD 2QDLA 1LTLA 4EQOA 4NXNQ 4A3KH 2EJGC 3I72A 4K14A 3V96A 1WTOA 1GUOA 2I46A 3CCQA 5IIFA 5D14A 3AMUA 2O5IC 4R4IA 4BA1I 4DR1L 2PQAA 1XNRQ 4BY1B 5IWAQ 1EFWA 3GTPH 2WKDA 3ZJYC 3RMHA 1JICA 4LMQD 3KYHC 3HEJA 3VA5A 5EKKA 1ESFA 1HZ9A 2E8GA 1LACA 5CORA 5IY0A 3T56B 3EVQA 3MAQA 1MHWC 2MQHA 5I9PA 5JJIA 1QVCA 4R4TA 2Z8LA 1BCPC 2ALYB 2MPMA 3K80C 3HOZB 2IX0A 2KHJA 3NWTA 5M3FB 4DV2Q 4JI6L 1PTOB 1HNWL 2HIXA 4IURA 4OL7A 1TVXA 1Z47A 1G2SA 1SEBD 1VF7A 2NTSA 3QIAA 5CV6A 2A6HD 3H3VI 1CHPD 3C46A 4RAUC 4ZCKA 4CJ0B 2EE1A 1L1OA 1F2LA 4QUCA 2NN6G 1L0WA 1VQ5A 2ZTEA 1HXYD 1VDZA 1STEA 3Q0AA 5EPLA 1G51A 4N9TA 2E2IH 4AH6A 1V8QA 3PGZA 4U68A 4DV7Q 4A3DH 3E0EA 3CAMA 1QUQB 4KHPQ 4TQUS 1J5EQ 2J0TD 1PYBA 3JC66 1M8AA 2J4XA 4DU9A 3K7UC 2UXDL 4YY3Q 5JJZA 5ELCA 1CKMA 1IBLQ 2MP1A 3VYTA 3RZOB 1QILA 5EAYA 1BCPF 5BR8Q 1C7YA 3S14H 4FF2A 1JMCA 3GTOH 1SE2A 4NW2A 1TY2A 4LF7Q 1RODA 3TZDA 1WCMH 1ZXTA 5IGEA 2NVYB 3FDTA 4H0LC 2HUGA 2CQOA 2PCFB 5BN4A 1E22A 1DOKA 2Y0SE 4CKCA 4IJHA 4NKLA 1YJ9A 3H3VC 1TS4A 2QDBA 4DR5Q 1J8IA 1TS5A 3ZYYX 2NVTB 1Q12A 5BR8L 1HNZQ 3W2DA 2VL6A 1PH5A 4F8MA 3UE0A 4LF4Q 3NQTA 2JA5G 2AMCB 4YY3L 3RN5A 2C35B 3MVVA 2NYZD 3GTKB 5CBEE 1QCBD 4TKOB 2R93G 1UEBA 2TMPA 1LV9A 1Q46A 2L1BA 2MFIA 4XIGS 4LW1A 4NXMQ 2UUAQ 2PZTA 3QB3A 5IODA 1EYGA 1C4QA 3FP9A 2AWOA 4L8JA 1JB7A 3HOXG 1YIJA 1CA6A 3C3LA 4GOPA 1HA5A 1PH7A 1L1OB 4N8X1 1O7ZA 2ID0A 4OWTB 2HDMA 4DV4Q 4OONA 2ATWA 3D4DA 3K81C 3CCRA 1I94L 3TN2A 1CTMA 2JA5H 3PIOA 1FJGQ 1WTWA 4EQ5A 1B70B 5M3FH 1X3PA 4B3MQ 4XTCS 2R93H 4IUUA 1LLRD 1E3PA 3GTKH 4DK1A 3EFXD 1P16A 5IWAL 1CHQD 2EDGA 4YCWA 4X6AH 1MBYA 4C3HB 2VQFL 4QL5A 1UAPA 4GLVB 1H9KA 5D3DA 2Z4IA 3L2PA 4KY7A 3T1HL 2GN5A 3QOLA 1JE5A 1JQYD 2WAQG 1VQIA 3Q6SA 3MXNB 4HIKA 2DNEA 3GP7A 1ICFB 2NZOA 5M3FG 2KECA 3HS0C 1AP0A 4JI3L 3HOZG 1SAPA 4XT1B 4GKJL 3UE1A 2D62A 4P71A 4RGMA 4GS3A 1S5FD 1U4MA 3DLLA 2WB1G 4NP5A 4IQZA 4MTKA 4LF5Q 2A5HA 2KVMA 2KA7A 1ESRA 3D31A 3RZOH 2JEBI 3BVMA 5IP9H 1N36L 1OO9B 1EL0A 5DM63 2A69D 1E24A 4BBSH 1H9RA 5KNCA 1QWYA 4JI4L 4JI8L 4F88A 2YTVA 4QF4A 1QNUA 2AUJD 3BS1A 1X65A 4K2LA 4EVOA 3EQLC 1XWEA 4KN7C 2Q2IA 3MEFA 3PF5A 1PFSA 3HKZG 4P73A 3IKJA 1LTGD 2F0JA 4RHRA 5HGTA 4DR4L 4B9WA 1LT6D 1VQCA 1XPOA 5EQ0A 5IP9G 1BO0A 1WTQA 3PIP3 3E3XA 4K0KL 4ILWA 1WD1A 1PTOC 2Z9HA 4DN4M 1FGUA 2F03A 2RF4A 3KDFB 1STBA 4A3LH 4K8JA 3M4OB 1XTDA 3VYRA 4A75A 1HZCA 5JPMC 2K1BA 4Q0FA 2K05A 2IX1A 2F3IA 3R2IA 1VQEA 2LS01 4DNTB 3C2PA 2EYHA 2K6AA 1IHZA 4WFN3 1E2ZA 1YHQA 3S17B 5CV4A 2AQ1B 5AFWA 1M1KC 2UUBL 2Z1CA 2N88A 4DR6Q 4GZYC 1B50A 3CPFA 2XSCA 1RDPD 1JJGA 4B9XA 1LO5D 2NTTA 4X65Q 4UPAA 3C1FA 1B9MA 3S15H 4K6LA 3BZCA 2G5DA 2QGQA 3TQYA 1X3QA 3NEMA 5EJWA 4Y7NH 4RH6A 4A3LG 5JJLA 2CHBD 2RDFA 1E2VA 1EIGA 3A56A 1GVPA 2EY6A 4C3JB 2ENBA 1X54A 2XVSA 1ONLA 4YHHL 3CW2C 3J80E 2I5LX 1OXTA 2F0GA 3R2TA 2Q8TA 4XQQA 1SMYD 5IYDG 3J81L 2HQEA 3I70A 1WCMB 1ZYRD 3MFGA 2EYPA 5E3FA 2ZXRA 3Q22A 4DR7Q 1D6EC 1LTID 1HR0W 1MD2D 4DR5L 2Z4HA 4HR7B 4KD3A 1K83B 1LTTD 2A6ED 5EBDA 1G2TA 1CK1A 4LFAL 2AQ3B 2F0NA 1I4XA 4NB3A 1KDCA 3ONAB 4L5RC 4OXPA 3M4YA 2SOBA 1RTOA 2OQ0A 4KKSA 1X3EA 1VQLA 3N52A 3PO3B 1B3AA 3FHWA 1R9TB 1JORA 3MXUA 4A3JB 4RKLA 1J6QA 3CMEA 1DJRD 1SN8A 1RCVD 3PSIA 1AEXA 2UU9Q 1B8AA 3DHQA 2SDFA 1PHJA 3OOCA 5G3LF 1HHVA 4DK3C 4HCEA 2CQAA 4UP7A 4C3HH 3Q24A 3AEVA 2LXKA 1Y1VH 1FD7D 4CDFC 4NXML 2LSSA 2K14A 1PLFA 4B3TQ 2PQAB 2EOTA 2R7ZH 3DM1A 1ENAA 5M5YH 2WB1B 2QF7A 1KQSA 1ZYRC 2NVQB 3HOYG 4GN4B 4LFBL 4JYAL 4CDCC 3SEBA 3U9SA 3TEHB 5C4XH 4P74A 2I5MX 1GD7A 4JI0Q 2F3VA 3KF6A 4IZ8A 1JCKB 5J3BA 1SYEA 5DM73 1CZGA 4IOCA 4IUNA 5IOCA 3CRLC 4C3HG 2V4DA 1Y1VG 3R93A 5FJ8G 2UXBL 4G57A 3RZDB 1VQGA 4KJOA 3STBD 4LWCA 1D8LA 2JEAI 5DLQE 4N9PA 1K3RA 3K59A 5M5YB 1ICWA 2VY3A 3L3OC 4A76A 5I2XA 1N8RC 4QMGA 3WDNA 1Y69U 1NUCA 3T53B 1WTXA 3D4RA 1SYDA 2BE5C 2G9DA 4OO1G 1KRSA 3LWUA 5A35A 2ZJRA 3I56A 1ILQA 3BVZA 3S16B 3TP6A 2EJFC 5M3MH 3J7A5 1YEZA 3SE0A 2E74C 5LMNQ 4A3EG 4FP5D 2K50A 3BYYB 3VYSA 2MNAA 1L1OC 5HY6A
chains in the Genus database with same CATH topology
2RA4A 4FXKC 1JR0D 4LK1C 5EKLA 1I4RA 3RLFA 5C4JB 4A3FB 2WAQB 4KN4C 2C5CA 1H9MA 5IGGA 1B9NA 4DXFA 1SNMA 4A3GB 1Y8PB 5CBAE 1R4PB 1OXUA 4JK1C 2XRQD 2ICIA 3QG1A 1KAAA 2L9HA 4K5VA 1F2ZA 1AZQA 3PV0A 1PZID 2Y0SB 3GQBA 5JVG3 4TSSA 4DAYA 5ELBA 2KUMA 3S15B 2OT2A 2PZUA 3PUVA 2KEDA 1SJHD 2F0TA 1F9PA 1R4QB 2BA1A 5CYUA 5FO7B 2JA5B 2ICEC 2NB0A 2MHVA 1L0XB 1A3TA 1STAA 1BQQT 2FMCA 2KCCA 5JEAH 5HURA 3CU7A 2F0DA 4DAPA 1HTPA 4IFDG 2HDLA 1FGBD 1MSGA 3TP8A 4XDXA 1ENCA 4FNFA 4C1NK 5COYA 5CC4A 2JYOA 3H0GB 1Q90A 2BDOA 5EPJA 3A55A 4KHZA 3U9OA 2EYFA 2NN6H 1O80A 4ME5A 5KEEA 5I6YA 4XQJA 4L63B 4XQNA 1ENFA 4IFDH 4ZLTF 2BCOA 3VR4A 2M9VA 4A3BB 2HCCA 2EVBA 1EQTA 5CGKA 4QIWB 2L5TA 1XXGA 1EY4A 2A69C 4S3SA 1IW7D 4H7BA 3C1EA 1SXTA 1PRTC 5E4WC 3MWYW 3K6OA 5M5WB 1RHPA 1DONA 5CR3A 5C44B 2RDGA 3KLSX 4X3SA 2IJ0A 2VB3X 1F77A 2E2HB 1Z6HA 1YNNC 1FR3A 2H4OA 4CKBA 2A68D 4R8NA 2PPBC 2F3WA 3ITPA 1DXMA 3HOYB 1F2YA 3PUWA 2RKSA 2R7ZB 1JOQA 3A8JE 1KNEA 2B2VA 4ZK9B 4HEDA 5FO9B 2K03A 1GUTA 5EPKA 4AYBB 2IWHA 2JSOA 2O4XA 4BA2I 1CI3M 2RDHA 4IUPA 1LABA 1U4PA 4CGYB 3AB9A 4QCLA 3GV3A 2E2DC 1ET6A 1W6JA 2SNSA 4X3TA 1LT3D 3URYA 3M85A 2VNUD 2CW0C 3OWEB 3D6WA 1D5ZC 4R9WA 4A93B 4RWSC 3IFTA 1I4PA 2NUCA 3NQIA 2GA4B 1EU3A 2PZWA 1STNA 2KOLA 5C0XH 1ILPA 4C56C 5FLXE 2L55A 3DXJC 5J39A 2A68C 1SDFA 1RD9D 5BN3A 3MXNA 2FJ2A 2JXMB 1K8MA 1RKNA 2I07B 1A3UA 1ZKOA 1PFMA 4ID6A 4LAAA 2TSSA 1PXUA 3OHXC 4XYOA 2CW0D 3NXWA 2FFKB 3GTJB 3I3CA 3MXGA 4ABNA 5C4HA 4G7ZC 5C4ZA 1W6KA 1JOKA 2EZVA 2K32A 3K5NA 1J9OA 5CMDA 1Y1WB 5C3EB 3EA6A 4NMZA 2F0IA 4KY5A 2NZ1D 5CV7A 3J7AV 1EU4A 4BY7B 3S1QB 4CJ2C 3M7GA 1BOSA 1PRTD 1S5BD 4BWGB 3I4MB 3PIO3 2C9OA 4ZYSA 4NDXA 3NHHA 4M8AA 3CKIB 2K5QA 1LT4D 3HGBA 2B2WC 2IPKD 5M3MB 2DNCA 4IFDJ 3TMEA 2M00A 3H09A 1D1IA 1CM9A 5ELEA 3ND9A 1M4VA 4ZUJA 3AU7A 1S5ED 3BDCA 4OO1I 1FNVA 4G7OC 3GV6A 1PTOF 3LNNA 1QG7A 4I7ZC 3W3AA 5FO8B 5K36G 1JWSD 3QJYA 1SYFA 5DAUA 1EY6A 2F1MA 3TP5A 1GUNA 2WACA 1I6HB 3G6JB 2EY1A 2R93B 1HFNA 3TSSA 4KMUC 5D3IB 2E76C 5CV5A 3PMFA 5K5PA 3HOXB 1A6XA 1D5XC 1E0BA 4FVMA 4HMIA 2PNRC 4FXGC 5KRUA 2WINB 1BXTA 4F87A 5K36H 1IKLA 4K8IA 1SSOA 1HTLD 4C1NI 1H9SA 3GTQB 2F0OA 4RCNA 3A7LA 3S14B 5E4XA 4KJNA 2BDNA 3NK9A 1DD2A 3K5LA 2VB2X 2D9UA 1TR5A 1I6VC 1MSHA 2RSNA 2Q8IB 1B44D 2F0MA 3I73A 5FKAC 2E75C 1PRTB 3L7ZC 5I9OA 4OO1H 1AZPA 1HCZA 5F2DA 4C3IB 3VR5A 4A3EB 1WTPA 2VUMB 1GUSA 2IX3A 1C8CA 5EGTA 4ZKBB 2JA8B 4FO2A 1HFGA 3EROA 2RQXA 3S1NB 1GHJA 3J80L 5M9OA 2E2IB 2F4IA 3TDQA 5T1IA 1NR4A 2PMZB 1S5DD 4QUFA 2XRSD 2X6GA 2JA6B 1L0YB 3KBXA 4KD4A 4Z9CB 3HOVB 1BUVT 5E1FA 1BBXC 1KDAA 3K7AB 1RTNA 2PO4A 3GTGB 2DY7A 5D65A 4WORA 2QKIC 4HMJA 2LKVA 3P20A 2FMMA 4DNRB 4FF1A 3DUZA 4IALA 3A7AB 3E0JA 1TU2B 1S5CD 4DF7A 1BCPD 1PTOH 3T13A 4BS9A 2F0EA 3TZUA 1EY9A 3MZ5A 3OMGA 5JOBA 3J81E 3KLSA 1T5EA 5I6WA 2KHSA 3MA2B 4XYQA 2QEJC 5JEAG 4BBSB 1QB5D 3D4WA 4V0BA 2F0QA 1SJED 5KIXA 1EZ8A 4Q5VA 4HN7A 3GD7A 1HPCA 4RHSA 4K6DA 5KNDA 1F9SA 2R6GA 3NSWA 4ODGA 4PMCA 4A3KB 1STHA 3K58A 3FEWX 3SK4A 1TWAB 3O13A 1Q1EA 4RGOS 2EYJA 3IAYA 4PMWA 3DMUA 1LTBD 4OGQC 3I4NB 5A2QE 1TWFB 1A3VA 4PV1C 3NBIA 3A54A 3NBHA 1EY5A 4U673 3OIQA 3HKZB 1GXDC 5J1ZA 1DCZA 4Y7NB 1EOTA 3BG3A 1HUMA 1EYAA 3GTMB 4KV6A 4WJWA 5C4XB 5LL6X 1O7YA 2XIWA 3GO5A 3BZDB 4KY6A 1KLGD 3FVQA 1RJTA 5IGCA 4X3UA 1JWMD 4KKUA 3CRKC 5C0XJ 1GUGA 2O5JC 1BCPB 3PO2B 5I4DA 5CV9A 1SNCA 3TP7A 1KTKA 1Y8NB 2VXWA 1VF5C 3WOFA 3DWAA 2YYZA 1QE6A 2LY7A 4HAEA 5C5LA 3I4LA 4UDUC 3T16A 2L4NA 4KHVA 5C3XA 5C5MA 4FXDA 1SYGA 2EJMA 2B2YC 4M1UB 5DEHA 3E5SA 2KQ3A 3ND8A 3F2UA 1QNKA 4HCSA 2K04A 2BA0A 3MTSA 3P1HA 1IL8A 2A6HC 4PNYA 1ET9A 1PFBA 5CV8A 1GHKA 1QOHA 1NSNS 2F0SA 3HP3A 5C3WA 5KNBA 5FOBB 4RKBA 3I91A 5C0XG 1PMRA 1CQVA 1JC7A 2NBFA 1I4HA 3FKIB 1T5XD 2EPBA 4KTAA 1LTAD 1V1OA 1EY8A 1TY0A 1I4QA 3S2HB 3KK7A 1NR2A 3H94A 5IT9E 4CHTB 1DM0B 4G7HC 3GTPB 4FF4A 5JAVA 3NTHA 4QB4A 2D5DA 2BE5D 1JWUD 2B2TA 5C6AA 3DWPA 3HOUB 1EFID 2B2WA 2XNAC 1SNDA 3FPUB 2XWBB 3L9AX 3P75A 2RVLA 2RBMA 3RD4A 2Q8RE 2R61A 1C48A 3H91A 1PZKD 5G3LD 2JA7B 1AN8A 3NE5B 3A8IE 1GUWA 2HCIA 2FINB 2PW5A 3CQZB 4DK0A 1PFNA 2ZXOA 1B1ZA 3DWQA 5LHY1 1QJOA 1H9SB 3M7NA 1Q1BA 3D8GA 2XN9C 3QOJA 5KGUA 2OF1A 1WTRA 1BNZA 4C3JG 1VCIA 2R92B 2EY5A 4IUTA 4OIJA 4J1MA 1B4OA 3PUZA 1TKWB 1XYIA 2E2JB 4EQNA 3MXPA 2A74C 1UEAB 2IW3A 2JE6I 5ELDA 4H44C 2B2YA 4LJZC 2A6EC 1Y1VB 4E6IA 2R3ZA 1HUNA 4ZKCB 2D2CC 4EQPA 1AFPA 4PQXA 3P7JA 4HTHA 5A2QL 2B8GA 1JB3A 1VMCA 2K5DA 2B39A 3VR6A 1II3A 1U4LA 2DN8A 1XTCD 5FK9C 1GOZA 3JAML 3I8ZA 2OXPA 2K5WA 3PUYA 2PYKA 2JP1A 1PRTF 3NPPA 3SK5A 1ZEQX 2B63B 4MN3A 2L0CA 3T51B 2B2TC 3R8BA 1TT2A 5IGFA 2K33A 2LMCB 1U9RA 2EYMA 3IL8A 1HRJA 3NP8A 1OXSC 1G8ZD 4EGVA 2X69A 3K0YA 1V1PB 3KBGA 4RA8A 1D1KA 1Q3LA 4A3IB 1V43A 2F0LA 1MGSA 2MUYA 1JE4A 2B2VC 3RUZA 3BDOA 3SHLA 2G9HD 1EYDA 1SNOA 2F0WA 1SE3A 2O2LD 1Y8OB 5T1GA 1KNAA 1EY7A 3BDLA 4A3DB 1E2WA 2B8FA 1PDQA 5ELFA 4IFDI 4ZUIA 3IFDA 4TRDA 1EWCA 3SXHA 1I50B 3K5OA 1Q8IA 1YNJC 2K28A 2LFNA 1K8OA 3NTIA 1CFMA 1SBBB 2KJXA 1EWHA 3KF8A 1KDBA 1EIHA 4ZRZA 3K5MA 2MGSA 1EQVA 3S2DB 4DXGA 2SEBD 1H9JA 2F0HA 1BR9A 3FRPB 5FLXL 2WV6D 1CA5A 1O7LA 4F7XA 1IKMA 1B2TA 1F2MA 1CQFA 1F9RA 3LX0A 4DAVA 4R8IA 4FYDA 3D3RA 5JVH3 4KKTA 1UNSA 2AWNA 1S4ZA 1XX8A 1IW7C 1KABA 5KYIA 3X3NA 1TWHB 1BF4A 4KK7A 4H13C 4CBVA 1A15A 2WKCA 1TIID 3S1RB 5EBCA 3UI2A 3LWEA 4WRDA 4O42A 2J7ZA 2F0PA 4XT3B 1HA6A 2K7VA 4K5WA 5IGBA 1EYCA 5KYLA 3H6MA 4ZAIA 2EY2A 5M5XB 1FNWA 3BVGA 5DNFA 2B2UA 3HZXA 1FYCA 2F0KA 1IYVA 2QILA 4C3IG 3OW7A 3M3YB 1SYBA 3OPOA 2X6LA 3T4AC 1UUPA 1GJXA 2N55A 2NN6I 1TS2A 2KEEA 1DZ1A 4B08A 4DA2A 1V1PA 4V190 3MC0B 3Q23A 1AW7A 2KCNA 1DOMA 4HSPA 2F0UA 2IL8A 1I4GA 1YNND 3DEPA 1IYUA 2WP8J 1A2TA 1DOLA 3J7YW 5JEAJ 3VYUA 4K2KA 3SK6A 3HRZC 5JPNC 1MI2A 3D6CA 2BOSA 5EKIA 1SFOB 3FMCA 4RGTA 4A3MB 1KLUD 4ZQ3A 4G4KA 3N6RA 2CVRA 3NTKA 3KLRA 1BDOA 3FPPA 1WD0A 3OWFA 4RCOA 2YU9B 2NVXB 1ML0D 3NWSA 3SDZA 4O1NA 3OMCA 2PW7A 4CJ1B 2NWGA 1STGA 4HSVA 4L6TB 1SNPA 4XXEA 3QWNA 3I90A 3SVMA 3V2TA 3QO2A 4IUVA 1DYQA 1EZ6A 4ULLA 4I65A 2EYLA 1LTSD 5BN5A 4C2MB 1EY0A 5IT9L 4YIJA 2ZXPA 2MJ8A 1LT5D 1F9QA 1PZJD 1G91A 1FNUA 2A73B 1NAPA 1X32A 4MHEA 1CT1D 3V05A 4CKEA 3TBIB 2F0VA 3HG9A 3K57A 1B53A 4X3KA 1HQMC 3VR2A 1G291 2QCPX 4RFBA 3J7AF 3SR1A 3DEOA 1TWCB 2H1EA 4PMBA 3GTLB 2AUKA 1SMYC 1D2BA 1YNJD 2B2UC 3MHBA 4MIUA 1SYCA 3VA7A 3CHBD 2K01A 3GTOB 1TWGB 4DGZA 3SK8A 2OEOA 3S1MB 4FF3A 3HOWB 2SNMA 4IN3A 3JAME 4JBWA 2EYOA 4BBRB 4DFAA 4P2CB 4RGNA 3R3OA 1OXVA 1SE4A 3OIPA 2ZT9C 5C0XI 1I3QB 2WIIB 2FHTA 2EXZA 3KUPA 1PTOD 3X3MA 4J6HA 5I2YA 1EEFD 1O78A 1JOOA 2F0FA 1U4RA 1TS3A 1NCVA 3MEHA 3S9WA 1RF2D 1VMPA 4UAIA 2L12A 1D5MC 2L11A 4IUQA 5LL6S 2AQ2B 4KI0A 4OHJA 3OSOA 1WVLA 4OIKA 5ISRA 1OXXK 2M2LA 3EJIA 1G6ZA 1LTRD 2IT1A 2PQEA 2XWJB 4J8QA 5NUCA 1Z7TA 1TQOA 1EEID 1HQRD 3ERQA 5TSSA 5IGDA 3PUXA 3E6ZX 3BYTB 1WTVA 2DY8A 1SNQA 3G7LA 3VR3A 3MFYA 1CZWA 1STYA 2RSOA 3A8KE 1A2UA 4K5XA 5J22A 3NUCA 3WOEA 1PYWD 4EQOA 2EJGC 3I72A 4K14A 3V96A 1WTOA 1GUOA 2I46A 5IIFA 5D14A 3AMUA 2O5IC 4BA1I 4BY1B 2WKDA 3RMHA 1JICA 4LMQD 3HEJA 3VA5A 5EKKA 1ESFA 1LACA 5CORA 3T56B 3EVQA 3MAQA 5I9PA 2Z8LA 1BCPC 2MPMA 3HOZB 2IX0A 3NWTA 5M3FB 1PTOB 4IURA 4OL7A 1TVXA 1Z47A 1G2SA 1SEBD 1VF7A 2NTSA 3QIAA 5CV6A 2A6HD 1CHPD 3C46A 4RAUC 4CJ0B 2EE1A 1F2LA 4QUCA 2NN6G 1HXYD 1VDZA 1STEA 3Q0AA 5EPLA 4N9TA 1V8QA 4U68A 4TQUS 2J0TD 1M8AA 2J4XA 4DU9A 5JJZA 5ELCA 2MP1A 3VYTA 3RZOB 1QILA 1BCPF 4FF2A 1SE2A 4NW2A 1TY2A 1RODA 3TZDA 1ZXTA 5IGEA 2NVYB 3FDTA 4H0LC 2HUGA 2PCFB 5BN4A 1DOKA 4CKCA 4NKLA 3H3VC 1TS4A 2QDBA 1J8IA 1TS5A 3ZYYX 2NVTB 1Q12A 3W2DA 4F8MA 3NQTA 3MVVA 2NYZD 3GTKB 5CBEE 1QCBD 4TKOB 2TMPA 1LV9A 2L1BA 4XIGS 2PZTA 3QB3A 5IODA 1C4QA 2AWOA 4L8JA 1CA6A 3C3LA 1HA5A 1O7ZA 2ID0A 2HDMA 3D4DA 3TN2A 1CTMA 1WTWA 1X3PA 4XTCS 4IUUA 1LLRD 4DK1A 3EFXD 1CHQD 2EDGA 1MBYA 4C3HB 1UAPA 1H9KA 5D3DA 2Z4IA 4KY7A 3QOLA 1JQYD 3Q6SA 2DNEA 3GP7A 2KECA 3HS0C 1AP0A 1SAPA 4XT1B 2D62A 4RGMA 1S5FD 1U4MA 4NP5A 4IQZA 2A5HA 2KVMA 2KA7A 1ESRA 3D31A 2JEBI 3BVMA 1OO9B 1EL0A 5DM63 2A69D 1H9RA 5KNCA 1QWYA 4F88A 4QF4A 1QNUA 2AUJD 3BS1A 4K2LA 4EVOA 3EQLC 1XWEA 4KN7C 3IKJA 1LTGD 2F0JA 4RHRA 5HGTA 4B9WA 1LT6D 5EQ0A 1BO0A 1WTQA 3PIP3 4ILWA 1WD1A 1PTOC 4DN4M 2F03A 1STBA 4K8JA 3M4OB 3VYRA 5JPMC 2K1BA 4Q0FA 2K05A 2IX1A 3R2IA 2LS01 4DNTB 3C2PA 2EYHA 2K6AA 1IHZA 4WFN3 1E2ZA 3S17B 5CV4A 2AQ1B 5AFWA 2Z1CA 2N88A 4GZYC 1B50A 2XSCA 1RDPD 4B9XA 1LO5D 2NTTA 3C1FA 1B9MA 4K6LA 1X3QA 5EJWA 4RH6A 2CHBD 2RDFA 1E2VA 1EIGA 3A56A 2EY6A 4C3JB 2ENBA 2XVSA 1ONLA 3J80E 1OXTA 2F0GA 3R2TA 2Q8TA 4XQQA 1SMYD 3J81L 2HQEA 3I70A 1WCMB 1ZYRD 3MFGA 2EYPA 5E3FA 2ZXRA 3Q22A 1D6EC 1LTID 1MD2D 2Z4HA 4HR7B 4KD3A 1K83B 1LTTD 2A6ED 5EBDA 1G2TA 1CK1A 2AQ3B 2F0NA 1I4XA 1KDCA 3ONAB 3M4YA 2SOBA 1RTOA 4KKSA 3N52A 3PO3B 1B3AA 1R9TB 1JORA 3MXUA 4A3JB 4RKLA 1DJRD 1RCVD 1AEXA 3DHQA 2SDFA 3OOCA 5G3LF 1HHVA 4HCEA 2CQAA 3Q24A 1FD7D 1PLFA 2EOTA 3DM1A 1ENAA 2WB1B 2QF7A 1ZYRC 2NVQB 3SEBA 3U9SA 2F3VA 4IZ8A 1JCKB 1SYEA 5DM73 1CZGA 4IUNA 5IOCA 3CRLC 4C3HG 2V4DA 3R93A 4G57A 3RZDB 4KJOA 2JEAI 4N9PA 3K59A 5M5YB 1ICWA 3L3OC 5I2XA 4QMGA 3WDNA 1Y69U 1NUCA 3T53B 1WTXA 3D4RA 1SYDA 2BE5C 2G9DA 4OO1G 3LWUA 5A35A 1ILQA 3BVZA 3S16B 3TP6A 2EJFC 3SE0A 2E74C 4FP5D 3VYSA 3BYYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BOS A;  1D1I A;  1CQF A;  1DM0 B;  1R4Q B;  4P2C B;  2C5C A;  1CZW A;  1CZG A;  3MXG A;  4ULL A;  2XSC A;  1D1K A;  1C48 A;  1QOH A;  1R4P B;  2GA4 B;  1QNU A;  2BOS A;  1C4Q A;  4M1U B; 
#chains in the Genus database with same CATH topology
 2RA4 A;  4FXK C;  1JR0 D;  4LK1 C;  1WOC A;  5EKL A;  1I4R A;  3RLF A;  5C4J B;  4A3F B;  2WAQ B;  4KN4 C;  2C5C A;  1H9M A;  3TRE A;  4RG1 A;  4J15 A;  3I4O A;  5IGG A;  4DV3 L;  2OQK A;  3KJP A;  4DR2 L;  1B9N A;  1YJN A;  4DXF A;  1SNM A;  4JG2 A;  2P5Z X;  3H15 A;  4BY7 H;  4A3G B;  2R7F A;  1Y8P B;  5CBA E;  3PO2 H;  1R4P B;  1BBW A;  1OXU A;  1AE2 A;  4JK1 C;  2JA7 G;  2XRQ D;  1K8G A;  2D0P A;  2ICI A;  1VQB A;  3QG1 A;  1KAA A;  1CKN B;  2L9H A;  4K5V A;  1F2Z A;  1AZQ A;  3PF4 A;  3PV0 A;  1PZI D;  2Y0S B;  3GQB A;  4HJ5 A;  2Z6K C;  5JVG 3;  4TSS A;  4DAY A;  4QIW E;  2UXC Q;  5ELB A;  1PH1 A;  2JA9 A;  2KUM A;  3S15 B;  1RL2 A;  2OT2 A;  2PZU A;  3PUV A;  3H0G H;  2KED A;  2KBN A;  1SJH D;  2F0T A;  4DV4 L;  1F9P A;  1R4Q B;  4GN5 A;  2I5H A;  1S40 A;  3J80 c;  1VQP A;  2BA1 A;  5CYU A;  5FO7 B;  4GLX A;  2YTX A;  2JA5 B;  2ICE C;  2NB0 A;  2MHV A;  1L0X B;  4LFC L;  1A3T A;  1STA A;  1SRU A;  3BZK A;  1BQQ T;  2FMC A;  2KCC A;  3G6E A;  1VQ4 A;  4A93 G;  3OTO L;  5JEA H;  5HUR A;  3CU7 A;  2F0D A;  1X9N A;  4DAP A;  1KHI A;  1HTP A;  4IFD G;  2HDL A;  2PI2 E;  1FGB D;  1MSG A;  3TP8 A;  3J81 i;  4XDX A;  3CPW A;  1ENC A;  4FNF A;  4C1N K;  3G48 A;  1LUZ A;  1MKH A;  5COY A;  5CC4 A;  3T1H Q;  2JYO A;  3H0G B;  1Q90 A;  2BDO A;  1NE3 A;  5EPJ A;  5IE8 A;  3A55 A;  4KHZ A;  3U9O A;  2EYF A;  2NN6 H;  1PH4 A;  4A93 H;  4LFC Q;  1PV4 A;  4HIO A;  1O80 A;  4JI7 L;  2LXJ A;  4ME5 A;  5KEE A;  4GKK L;  5I6Y A;  4XQJ A;  5C3E G;  4L63 B;  4XQN A;  3CCL A;  4JOI C;  1ENF A;  2ZTD A;  4IFD H;  4ZLT F;  3F1Z A;  2BCO A;  3VR4 A;  2M9V A;  4A3B B;  2HCC A;  2EVB A;  4GKJ Q;  2Z6K A;  3GTL H;  1EQT A;  4YWK A;  5CGK A;  3B6Y A;  4QIW B;  1LM0 A;  2L5T A;  1XXG A;  1N36 Q;  1EY4 A;  2A69 C;  4S3S A;  3TS0 A;  1IW7 D;  4H7B A;  4JI6 Q;  3C1E A;  1SXT A;  1PRT C;  5E4W C;  3TS2 A;  1CKN A;  3MWY W;  3K6O A;  4I7A A;  5M5W B;  1E1T A;  1V9P A;  3LGJ A;  1RHP A;  1DON A;  5CR3 A;  5C44 B;  2RDG A;  3ULJ A;  4X65 L;  3KLS X;  4X3S A;  2IJ0 A;  2B3G A;  2VB3 X;  1F77 A;  2E2H B;  1Z6H A;  4A3G G;  1YNN C;  5E7N A;  1HZA A;  1FR3 A;  2H4O A;  4R8N A;  2A68 D;  4CKB A;  4LF6 L;  2PPB C;  2F3W A;  3ITP A;  4X66 Q;  4GNX B;  2UXB Q;  1DXM A;  2YV5 A;  2N8N A;  3HOY B;  3STB C;  4PZ6 A;  1F2Y A;  2K52 A;  3PUW A;  2RKS A;  2R7Z B;  2RCF A;  1JOQ A;  2E2J H;  3A8J E;  1R9T H;  1KNE A;  2B2V A;  3QR8 A;  2K5H A;  4ZK9 B;  4HED A;  5FO9 B;  2K03 A;  3HOX H;  1GUT A;  1NBW A;  2WAQ E;  4DUZ L;  2L15 A;  5EPK A;  4AYB B;  2IWH A;  2JSO A;  2O4X A;  4BA2 I;  1CI3 M;  2RDH A;  4IUP A;  1LAB A;  1U4P A;  4CGY B;  3AB9 A;  1KAW A;  4QCL A;  1EUJ A;  3GV3 A;  2E2D C;  1ET6 A;  1W6J A;  1W3S A;  2SNS A;  1XMO Q;  4X3T A;  1LT3 D;  3URY A;  4DUZ Q;  3M85 A;  2VNU D;  3HOU H;  2CW0 C;  3OWE B;  3D6W A;  1D5Z C;  4UP8 A;  2UU9 L;  4LUZ A;  4UHV A;  2OTJ A;  3RLO A;  1S72 A;  2YTY A;  4R9W A;  4A93 B;  3A74 A;  4RWS C;  4DV7 L;  3IFT A;  1I4P A;  2NUC A;  3J81 c;  3NQI A;  2GA4 B;  1EU3 A;  2Z6B A;  2PZW A;  1STN A;  2WFW A;  2KOL A;  4DV0 Q;  4KHP L;  2NVY H;  1N32 L;  4N8F A;  4LF6 Q;  5C0X H;  5H1S E;  1IBK L;  4TVA B;  1ILP A;  4C56 C;  5FLX E;  1WI5 A;  1IZ6 A;  2RCN A;  2L55 A;  3HOU G;  3DXJ C;  5J39 A;  2A68 C;  1SDF A;  3CCU A;  1RD9 D;  3FKI G;  1QZG A;  5BN3 A;  3MXN A;  2FJ2 A;  2JXM B;  1K8M A;  1YI2 A;  5GQO A;  1RKN A;  4JV5 L;  1AE3 A;  2I07 B;  1A3U A;  1BKB A;  1ZKO A;  3S1Q H;  4BBS G;  1PFM A;  4ID6 A;  4LAA A;  3E9I A;  3A5U A;  2TSS A;  2HIV A;  1PXU A;  1KIX A;  2EQS A;  3OHX C;  4XYO A;  2CW0 D;  1VS0 A;  3NXW A;  2FFK B;  4HJ9 A;  3GTJ B;  3CD6 A;  4JI1 L;  3I3C A;  3MXG A;  1NJI C;  4ABN A;  4H02 A;  3KF6 B;  2ASB A;  5C4H A;  4G7Z C;  5C4Z A;  3FKI H;  4DR6 L;  1TWH H;  4L5S A;  1W6K A;  1E1O A;  3OW2 A;  1JOK A;  2YU9 H;  2EZV A;  2K32 A;  3K5N A;  1J9O A;  3T1Y Q;  2OTL A;  2B63 G;  2NVX H;  1UE1 A;  5CMD A;  5IYC H;  1CUK A;  1Y1W B;  1XNR L;  1H95 A;  5C3E B;  4AYB G;  1HR0 Q;  2OCE A;  4LF9 L;  3EA6 A;  4NMZ A;  1KD1 C;  2F0I A;  4KY5 A;  3PIP A;  2NZ1 D;  5CV7 A;  3J7A V;  1EU4 A;  4R4O A;  4A3J H;  2BH2 A;  4BY7 B;  3S1Q B;  3M7G A;  4CJ2 C;  1BOS A;  1HZB A;  1PRT D;  1S5B D;  4BWG B;  3I4M B;  3PIO 3;  2C9O A;  4ZYS A;  4IOA A;  4B3R Q;  3A0J A;  4NDX A;  3NHH A;  4A3F H;  4M8A A;  2E5L L;  3CKI B;  2K5Q A;  3RN2 A;  5AJ3 L;  1LT4 D;  1UE5 A;  5IYC G;  3RLN A;  2HD3 A;  3HGB A;  2B2W C;  2CWP A;  3S16 H;  2IPK D;  3W5O A;  1K28 A;  1D7Q A;  5M3M B;  2DNC A;  4IFD J;  3VDY A;  1K83 H;  1K0R A;  3TME A;  2ZM6 Q;  2M00 A;  3H09 A;  3PCO B;  1PVO A;  2IHE A;  1IXR A;  1D1I A;  2E5L Q;  2N49 A;  4A3J G;  5AJ3 Q;  1CM9 A;  5ELE A;  3ND9 A;  1PH9 A;  5M5X H;  3AFQ A;  1JJ2 A;  1M4V A;  4ZUJ A;  3AU7 A;  1S5E D;  3BDC A;  4OO1 I;  1KC8 C;  1FNV A;  4G7O C;  2R92 G;  1FVI A;  1A62 A;  3GV6 A;  1AH9 A;  1PTO F;  2KEN A;  3LNN A;  3KFU A;  1CKO A;  1QG7 A;  3W3A A;  4I7Z C;  5FO8 B;  4EX5 A;  5K36 G;  1JWS D;  3QJY A;  4LFB Q;  4WJ3 M;  1SYF A;  4JI8 Q;  5DAU A;  1EY6 A;  2F1M A;  3KOJ A;  1GUN A;  3TP5 A;  2WAC A;  1I6H B;  1Q8K A;  3G6J B;  2EY1 A;  2R93 B;  1HFN A;  3TSS A;  4KMU C;  3TRZ A;  5D3I B;  2UXC L;  2E76 C;  5CV5 A;  3PMF A;  5K5P A;  3HOX B;  1A6X A;  1X6O A;  3S2H H;  1D5X C;  2HHH L;  1VQH A;  1E0B A;  4FVM A;  4HMI A;  2PNR C;  2R92 H;  2XTI A;  3L0O A;  4FXG C;  5KRU A;  2WIN B;  1BXT A;  4F87 A;  3HOY H;  5K36 H;  1IKL A;  2MO0 A;  1TWF H;  3S1N H;  4K8I A;  1SSO A;  1HTL D;  4C1N I;  1H9S A;  3GTQ B;  1UE7 A;  2F0O A;  4RCN A;  3DM3 A;  1VQO A;  3A7L A;  3S14 B;  3PO3 H;  5LMN L;  5E4X A;  4KJN A;  2BDN A;  4QJF A;  3M4P A;  3NK9 A;  1S3O A;  3UDI A;  4JV5 Q;  5FJ8 H;  2HQL A;  2K75 A;  1DD2 A;  3K5L A;  4AQY L;  1K9M C;  2VB2 X;  2D9U A;  1TR5 A;  4B3M L;  5C4J H;  3I4M G;  2Y0S G;  5IP7 H;  1XNQ Q;  1I6V C;  1MSH A;  2Q2H A;  2RSN A;  2Q8I B;  4LUV A;  1B44 D;  4JBJ A;  2F0M A;  3I73 A;  5FKA C;  2E75 C;  1PRT B;  3L7Z C;  1PH8 A;  4MNO A;  5I9O A;  4OO1 H;  3CP0 A;  4MZ9 A;  5ELO A;  3JAM c;  1AZP A;  1U5K A;  1HCZ A;  5F2D A;  1NY4 A;  4C3I B;  5M3M G;  3VR5 A;  4A3E B;  2KHI A;  2N78 A;  1WTP A;  4Y52 H;  2VUM B;  1GUS A;  1PYS B;  2RHS B;  2IX3 A;  1C8C A;  1CSQ A;  5EGT A;  4ZKB B;  2JA8 B;  4FO2 A;  1HFG A;  3ERO A;  3I4M H;  2RQX A;  1RIP A;  3S1N B;  1IBM L;  1GHJ A;  1UE6 A;  3J80 L;  5M9O A;  2E2I B;  3CF5 A;  1XJV A;  2F4I A;  3TDQ A;  3KLW A;  3KF8 B;  5T1I A;  4BY7 G;  1NR4 A;  2PMZ B;  1S5D D;  4QUF A;  2XRS D;  1YHB A;  2X6G A;  3PO2 G;  2JA6 B;  4C2M H;  1L0Y B;  3KBX A;  3NBH B;  4KD4 A;  3BU2 A;  4Z9C B;  4X62 Q;  4JI4 Q;  3HOV B;  1BUV T;  3M4O H;  5E1F A;  1BBX C;  1KDA A;  4BY1 H;  3K7A B;  4PZ8 A;  1RTN A;  2PO4 A;  3GTG B;  2DY7 A;  5M5W H;  4GLA C;  5D65 A;  4WOR A;  2QKI C;  1GKH A;  1VQM A;  1EQR A;  3M4Q A;  4HMJ A;  2LKV A;  4JC0 A;  1OTC A;  2XGT A;  2I0Q A;  3P20 A;  1IBM Q;  2FMM A;  3BJU A;  3EN2 A;  4DNR B;  4FF1 A;  3DUZ A;  4IAL A;  4P75 A;  3H0G G;  1A0I A;  3A7A B;  3E0J A;  1TU2 B;  4FDB A;  1S5C D;  1YHA A;  4DF7 A;  3ICE A;  2CWA A;  1BCP D;  1PTO H;  3H3V H;  3T13 A;  1EWI A;  2V1C C;  4BS9 A;  2F0E A;  1UWV A;  3KJO A;  3TZU A;  1EY9 A;  3MZ5 A;  4GNX A;  4BY1 G;  3OMG A;  1X3F A;  5JOB A;  1P8L A;  3J81 E;  3KLS A;  1T5E A;  2CH4 W;  5I6W A;  3HFZ B;  1TWA H;  4R4C A;  3UDF A;  2KHS A;  3MA2 B;  2IY5 B;  4XYQ A;  2QEJ C;  5JEA G;  4JI2 L;  4BBS B;  1QB5 D;  3D4W A;  4DV0 L;  1N32 Q;  4DV6 L;  4V0B A;  2F0Q A;  1SJE D;  2PNH A;  1EZ8 A;  2DJG C;  5KIX A;  1M90 C;  4Q5V A;  4HN7 A;  4UP9 A;  3GD7 A;  3T1Y L;  1Q81 C;  1HPC A;  4RHS A;  2VQF Q;  4K6D A;  4DV2 L;  4JI5 Q;  3GTQ H;  5KND A;  3ULL A;  1PA6 A;  1F9S A;  2R6G A;  2JJQ A;  3NSW A;  2KCT A;  2CFM A;  4ODG A;  4PMC A;  3I2Z A;  3M9B A;  4A3K B;  1STH A;  3K58 A;  4LF8 Q;  3FEW X;  3SK4 A;  4OX9 L;  1NMG A;  3U4Z A;  1TWA B;  5C3E H;  3O13 A;  1VQN A;  1HNX Q;  1Q1E A;  4JI5 L;  1KRT A;  1Q86 C;  4RGO S;  2EYJ A;  4A3I G;  3IAY A;  4PMW A;  2Z0S A;  3DMU A;  1LTB D;  4OGQ C;  3I4N B;  5A2Q E;  1TWF B;  1A3V A;  1L2F A;  4PV1 C;  1VQF A;  2BH8 A;  3NBI A;  4A3M G;  3A54 A;  2K5V A;  3NBH A;  1EY5 A;  4U67 3;  2JA6 H;  3OIQ A;  3HKZ B;  1GXD C;  1WTH A;  5J1Z A;  5LMU Q;  4DV1 L;  1DCZ A;  4Y7N B;  1EOT A;  4DPG A;  2FXQ A;  4JYA Q;  3BG3 A;  1HUM A;  1EYA A;  3GTM B;  2AHO B;  4KV6 A;  4WJW A;  3Q8D A;  5C4X B;  1XPU A;  5LL6 X;  1O7Y A;  2XIW A;  3GO5 A;  3BZD B;  4KY6 A;  1KLG D;  3FVQ A;  3CCV A;  2QEX A;  1RJT A;  5IGC A;  4JBM A;  4X3U A;  1SMX A;  3HKZ E;  4A3G H;  1IL2 A;  1EQQ A;  1QVF A;  4OWX B;  4KKU A;  1JWM D;  3CRK C;  5C0X J;  1GUG A;  2PMZ E;  1HR0 L;  1BCP B;  3PO2 B;  1VQ9 A;  2O5J C;  5I4D A;  2JA6 G;  4DR7 L;  1SNC A;  5CV9 A;  3SGI A;  3TP7 A;  1KTK A;  4QGU A;  1Y8N B;  2VXW A;  1VF5 C;  3I55 A;  1YJW A;  3WOF A;  1CSP A;  3DWA A;  2YYZ A;  3ULP A;  1QE6 A;  4JOI A;  2LY7 A;  4HAE A;  5C5L A;  4QQB X;  3I4L A;  4UDU C;  3T16 A;  2L4N A;  2KCM A;  4KHV A;  2VS1 A;  5C3X A;  3GDE A;  3JAM i;  5C5M A;  3UDG A;  4FXD A;  1SYG A;  4GOP B;  1T9H A;  3CCE A;  2EJM A;  2B2Y C;  4OEL B;  4M1U B;  2K4K A;  4GNX C;  5DEH A;  3E5S A;  2KQ3 A;  3ND8 A;  1BBU A;  3F2U A;  1QNK A;  4HCS A;  2K04 A;  2BA0 A;  3MTS A;  3P1H A;  1IL8 A;  4UY8 C;  2A6H C;  4PNY A;  1ET9 A;  3S2D H;  1PFB A;  5CV8 A;  1GHK A;  1QOH A;  1NSN S;  4X64 L;  2F0S A;  1X3G A;  3HP3 A;  5C3W A;  3J81 j;  1SE8 A;  5KNB A;  1GM5 A;  1I3Q H;  5FOB B;  4DUY L;  4RKB A;  3I91 A;  5GRO A;  5L37 A;  1I6H H;  5C0X G;  4HJ8 A;  1A63 A;  1X56 A;  1PMR A;  4MTN A;  1CQV A;  1JC7 A;  2NBF A;  1I4H A;  3FKI B;  1T5X D;  2EPB A;  4KTA A;  1LTA D;  4R1J A;  4LUO A;  1V1O A;  1EY8 A;  3CC4 A;  1TY0 A;  2NVT H;  1I4Q A;  4YCV A;  1N33 Q;  1K8A C;  3S2H B;  3KK7 A;  3PQI A;  1NR2 A;  3H94 A;  4IPD A;  5IT9 E;  4CHT B;  1QUQ A;  1DM0 B;  4G7H C;  1KXL A;  3GTP B;  4FF4 A;  3CMA A;  5JAV A;  3NTH A;  4QB4 A;  2D5D A;  2BE5 D;  3F2B A;  3K8A A;  1JWU D;  2B2T A;  5C6A A;  3DWP A;  4AIM A;  3E9H A;  4JI3 Q;  1U0L A;  3HOU B;  1EFI D;  3K0X A;  2B2W A;  3CCM A;  2XNA C;  3FPU B;  1SND A;  2RHQ B;  5FLM G;  4DV5 Q;  2XWB B;  3L9A X;  3P75 A;  2B63 H;  1NMF A;  3CC7 A;  3OYY A;  4CDD C;  3G71 A;  3AFP A;  2RVL A;  2RBM A;  3RD4 A;  1N34 L;  3UDX A;  2Q8R E;  2R61 A;  1C48 A;  3H91 A;  1XMO L;  1VQ6 A;  4C3J H;  1PZK D;  5G3L D;  2JA7 B;  1SFO H;  1AN8 A;  1WFQ A;  1NTG A;  3NE5 B;  1SRO A;  3A8I E;  2F52 A;  4AYB E;  1GUW A;  2HCI A;  2N3S A;  4LF8 L;  2FIN B;  1IBL L;  2PW5 A;  3CQZ B;  4DK0 A;  1PFN A;  2ZXO A;  1B1Z A;  3DWQ A;  5LHY 1;  3GTJ H;  4LF9 Q;  1QJO A;  1Z9F A;  4NPS A;  1H9S B;  1XPR A;  3M7N A;  1Q1B A;  1I94 Q;  4A3F G;  1LYL A;  1K0S A;  3D8G A;  2XN9 C;  3QOJ A;  5KGU A;  2OF1 A;  2E2H H;  1WTR A;  1ASY A;  1BNZ A;  4C3J G;  1VCI A;  2K5N A;  2R92 B;  2EY5 A;  4IUT A;  4OIJ A;  4J1M A;  1B4O A;  3PUZ A;  1TKW B;  1Y1W H;  2IHF A;  1XYI A;  1O7I A;  2UUC L;  2E2J B;  4EQN A;  3MXP A;  3CXC A;  3CC2 A;  2A74 C;  1UEA B;  4DAY B;  3A5Z B;  3K7A H;  2H5X A;  2IW3 A;  2JA8 G;  1JT8 A;  1Q7Y C;  3CQZ H;  2JE6 I;  5ELD A;  4A3C G;  4H44 C;  2B2Y A;  4LJZ C;  5GAH C;  2A6E C;  1B3Q A;  1Y1V B;  5GAD C;  1KL9 A;  4E6I A;  2R3Z A;  3EBE A;  1PH2 A;  1HUN A;  4ZKC B;  3CCS A;  2D2C C;  4EQP A;  1AFP A;  3I4N H;  4PQX A;  5IYB H;  1N9W A;  3P7J A;  4HTH A;  2ZJQ A;  5A2Q L;  2MO1 A;  3ER0 A;  4P72 A;  2B8G A;  4LNQ A;  1JB3 A;  1VMC A;  2K5D A;  2B39 A;  3VR6 A;  1II3 A;  1U4L A;  4PZ7 A;  2DN8 A;  1XTC D;  5FK9 C;  4A3C H;  1GOZ A;  3JAM L;  3I8Z A;  4IJL A;  4LF4 L;  3OTO Q;  2OXP A;  2K5W A;  3PUY A;  2QA4 A;  5ELN A;  4LF7 L;  2PYK A;  3I4N G;  2JP1 A;  5IYB G;  1PRT F;  3NPP A;  3SK5 A;  1TWC H;  1TWG H;  1ZEQ X;  4WJ4 A;  3F8T A;  3J7Z C;  1MIU A;  2B63 B;  4MN3 A;  2L0C A;  3T51 B;  2B2T C;  3R8B A;  1TT2 A;  3F2D A;  2UUC Q;  1VQK A;  1IYJ B;  5IGF A;  3GTM H;  2K33 A;  2LMC B;  4DR3 Q;  3PO3 G;  1U9R A;  2EYM A;  2QW7 A;  3IL8 A;  1FL0 A;  2A1A A;  1HRJ A;  3NP8 A;  1MJC A;  1YVC A;  3S24 A;  1OXS C;  1SLJ A;  4ME3 A;  1G8Z D;  3I7F A;  4JVZ A;  4EGV A;  3CCJ A;  2X69 A;  3K0Y A;  1V1P B;  5IP7 G;  3KBG A;  4DK6 C;  4RA8 A;  4AQY Q;  1D1K A;  1Q3L A;  4A3I B;  4YHH Q;  1V43 A;  1Q82 C;  2F0L A;  1MGS A;  2MUY A;  1JE4 A;  2B2V C;  4LFA Q;  3BDO A;  3RUZ A;  4APV A;  1QVG A;  3SHL A;  2G9H D;  1EYD A;  4A3D G;  5JJK A;  1SNO A;  4DKA C;  2F0W A;  2F4V L;  1SE3 A;  2GVB A;  2O2L D;  1Y8O B;  5T1G A;  4B3S Q;  1KNA A;  1EY7 A;  3BDL A;  4A3D B;  1E2W A;  2B8F A;  1PDQ A;  5ELF A;  1FJG L;  4IFD I;  4ZUI A;  3IFD A;  4TRD A;  1EWC A;  3SXH A;  1I5F A;  1I50 B;  3EIV A;  3K5O A;  4BBR G;  4DV3 Q;  1W2B A;  1Q8I A;  1YNJ C;  3S1M H;  2K28 A;  2LFN A;  1K8O A;  3NTI A;  4PG3 A;  1CFM A;  2EXD A;  1SBB B;  2KJX A;  1WCM G;  1EWH A;  1HNZ L;  2NVQ H;  4YCU A;  2DUD A;  3S1R H;  3KF8 A;  1V1Q A;  3W1G A;  1KDB A;  1EIH A;  4ZRZ A;  2B29 A;  3K5M A;  2MGS A;  2CH4 A;  2VZA A;  5GAG C;  4JCV E;  1EQV A;  2F4V Q;  3S2D B;  4DXG A;  2SEB D;  1H9J A;  2F0H A;  1BR9 A;  3FRP B;  5FLX L;  2WV6 D;  1CA5 A;  1O7L A;  4ALP A;  4BBR H;  1NNX A;  4F7X A;  1IKM A;  1B2T A;  4DV6 Q;  1F2M A;  1CQF A;  1F9R A;  3LX0 A;  4DAV A;  4DR1 Q;  4R8I A;  1N33 L;  4FYD A;  2ZTC A;  3D3R A;  5JVH 3;  4KKT A;  1UNS A;  2WB1 E;  2AWN A;  1YZ6 A;  3NEN A;  1S4Z A;  4LF5 L;  2Q2T A;  1XX8 A;  1IW7 C;  4X66 L;  3HKS A;  1KAB A;  5KYI A;  1WYD A;  3X3N A;  3RNU A;  1J5E L;  1TWH B;  1HJP A;  1BF4 A;  4KK7 A;  4H13 C;  4CBV A;  1HNX L;  1XMQ L;  4DV5 L;  3U58 A;  2ES2 A;  1A15 A;  2WKC A;  4JI7 Q;  1TII D;  3S1R B;  5EBC A;  3UI2 A;  3LWE A;  4WRD A;  3RZD H;  4O42 A;  2J7Z A;  2F0P A;  3AQQ A;  4XT3 B;  1HA6 A;  1N34 Q;  2K7V A;  4K5W A;  5IGB A;  1EYC A;  5KYL A;  3H6M A;  4DR4 Q;  4ZAI A;  4OEM B;  2EY2 A;  2OWO A;  5M5X B;  1FNW A;  3BVG A;  5DNF A;  4DAM A;  4GN3 B;  3KDF A;  2B2U A;  3S17 H;  4YWM A;  3HZX A;  1FYC A;  2F0K A;  1IYV A;  2QIL A;  3HOZ H;  4C3I G;  4GOP C;  3OW7 A;  3IRB A;  3M3Y B;  3ERS X;  1C0A A;  1SYB A;  1PH6 A;  3OPO A;  2X6L A;  3T4A C;  1UUP A;  4HJA A;  1GJX A;  2N55 A;  2JK8 A;  4B3T L;  2NN6 I;  1PH3 A;  1TS2 A;  3D0F A;  3J80 i;  4A3I H;  4IPH A;  2KEE A;  1DZ1 A;  4B08 A;  4DA2 A;  1V1P A;  4V19 0;  2UUA L;  3MC0 B;  3Q23 A;  2JQO A;  1AW7 A;  4A3M H;  2KCN A;  4HID A;  1VQ7 A;  1DOM A;  4HSP A;  2F0U A;  2IL8 A;  1I4G A;  4C3I H;  4JPB W;  1YNN D;  3DEP A;  1HH2 P;  3U50 C;  1IYU A;  4JI1 Q;  5FLX c;  2WP8 J;  1A2T A;  1DOL A;  3J7Y W;  5JEA J;  3VYU A;  1IBK Q;  4K2K A;  3SK6 A;  2HHH Q;  3HRZ C;  5JPN C;  4B3S L;  1EOV A;  1MI2 A;  1WJJ A;  3D6C A;  2BOS A;  5EKI A;  2NZH A;  3RR5 A;  1SFO B;  1BVS A;  3FMC A;  4RGT A;  4A3M B;  1KLU D;  4ZQ3 A;  1TXY A;  4G4K A;  1DGS A;  3N6R A;  4O2D A;  3G4S A;  2CVR A;  1E7Z A;  3NTK A;  5GAE C;  3KLR A;  1BDO A;  3FPP A;  1WD0 A;  3OWF A;  4RCO A;  2YU9 B;  2NVX B;  1B7Y B;  1ML0 D;  3NWS A;  3SDZ A;  4O1N A;  3HOV G;  2HT1 A;  1I50 H;  4IPG A;  1QZH A;  3U4V A;  3OMC A;  2PW7 A;  4CJ1 B;  2A8V A;  2NWG A;  1STG A;  4HSV A;  4L6T B;  1SNP A;  4XXE A;  3QWN A;  4BXX H;  3I90 A;  3SVM A;  1VQA A;  1Y14 B;  3V2T A;  4JI0 L;  5C44 H;  3QO2 A;  4DUY Q;  1K73 C;  3HOW G;  3GTG H;  2UXD Q;  4IUV A;  1DYQ A;  1EIF A;  1JJC B;  2ZM6 L;  4DV1 Q;  1EZ6 A;  5IYD H;  4JBK A;  4ULL A;  4I65 A;  2EYL A;  1LTS D;  4L5Q A;  1XNQ L;  5BN5 A;  4C2M B;  1EY0 A;  2VQE L;  5IT9 L;  2D0O A;  4YIJ A;  2ZXP A;  2MJ8 A;  4JW0 A;  3HOV H;  1LT5 D;  1F9Q A;  1PZJ D;  1G91 A;  1FNU A;  4X62 L;  2A73 B;  1NAP A;  1X32 A;  4MHE A;  1CT1 D;  4POG A;  3V05 A;  1YBY A;  4BXX G;  1VQ8 A;  5LMN W;  4CKE A;  3W1B A;  3TBI B;  5C44 G;  3HOW H;  2F0V A;  3HG9 A;  3K57 A;  1B53 A;  4X3K A;  4OWW B;  1HQM C;  3VR2 A;  1G29 1;  2VUM H;  2QCP X;  4RFB A;  3J7A F;  3SR1 A;  3DEO A;  1TWC B;  1VQD A;  2H1E A;  4PMB A;  3GTL B;  2AUK A;  1SMY C;  1D2B A;  5IT9 c;  1YNX A;  1YNJ D;  2B2U C;  3NEL A;  2AKW B;  3MHB A;  1MJE A;  2R7Z G;  4MIU A;  1SYC A;  3VA7 A;  2DJF C;  3CHB D;  4KLK A;  2K01 A;  4DR2 Q;  4R4Q A;  3GTO B;  1TWG B;  4DGZ A;  5C4X G;  2DGY A;  3SK8 A;  2OEO A;  3S1M B;  2A19 A;  4FF3 A;  3HOW B;  2SNM A;  4IN3 A;  5HGQ A;  4JBW A;  3JAM E;  2EYO A;  2VUM G;  4BBR B;  4DFA A;  4IO9 A;  4P2C B;  2VQE Q;  5FLM H;  4RGN A;  2ZJP A;  1XMQ Q;  3R3O A;  2CCZ A;  1OXV A;  1SE4 A;  2R7D A;  2UUB Q;  3OIP A;  1C9O A;  2ZT9 C;  4HJ7 A;  5C0X I;  1I3Q B;  2WII B;  4HIM A;  4NXN L;  2FHT A;  3M3Y H;  4IPC A;  2EXZ A;  1EIY B;  3KUP A;  1PTO D;  3X3M A;  4J6H A;  5I2Y A;  4A4I A;  1G6P A;  4JI2 Q;  1EEF D;  1X55 A;  1O78 A;  2JN4 A;  1JOO A;  4RMF A;  2F0F A;  1U4R A;  4A3E H;  4A3B G;  1TS3 A;  1K3B C;  4B3R L;  1NCV A;  3MEH A;  3AYH B;  4GKK Q;  3S9W A;  1RF2 D;  1VMP A;  4L5T A;  4UAI A;  3WWV A;  2L12 A;  1D5M C;  2L11 A;  4IUQ A;  2VW9 A;  2Q2U A;  5LL6 S;  4OX9 Q;  2AQ2 B;  4KI0 A;  4OHJ A;  3F2C A;  3OSO A;  4DR3 L;  1YIT A;  1WVL A;  1SR3 A;  4POF A;  4QY7 A;  4OIK A;  5LMU L;  1VQJ A;  5ISR A;  4A3K G;  1OXX K;  2M2L A;  3EJI A;  1G6Z A;  2EIF A;  1LTR D;  1Y1W G;  2IT1 A;  2PQE A;  2XWJ B;  4J8Q A;  5NUC A;  1Z7T A;  1TQO A;  1A8V A;  2JA7 H;  1EEI D;  1HQR D;  3ERQ A;  5TSS A;  4CDE C;  5IGD A;  3PUX A;  4A3B H;  1GO3 E;  2CKZ B;  2JA8 H;  3E6Z X;  1HNW Q;  4O0A A;  3BYT B;  2GVA A;  1WTV A;  1ASZ A;  2DY8 A;  4K0K Q;  1SNQ A;  3G7L A;  3VR3 A;  3MFY A;  4DNI A;  1CZW A;  1STY A;  2RSO A;  3A8K E;  1A2U A;  4K5X A;  5J22 A;  2PI2 A;  4X64 Q;  4YWL A;  3NUC A;  3WOE A;  1PYW D;  2QDL A;  1LTL A;  4EQO A;  4NXN Q;  4A3K H;  2EJG C;  3I72 A;  4K14 A;  3V96 A;  1WTO A;  1GUO A;  2I46 A;  3CCQ A;  5IIF A;  5D14 A;  3AMU A;  2O5I C;  4R4I A;  4BA1 I;  4DR1 L;  2PQA A;  1XNR Q;  4BY1 B;  5IWA Q;  1EFW A;  3GTP H;  2WKD A;  3ZJY C;  3RMH A;  1JIC A;  4LMQ D;  3KYH C;  3HEJ A;  3VA5 A;  5EKK A;  1ESF A;  1HZ9 A;  2E8G A;  1LAC A;  5COR A;  5IY0 A;  3T56 B;  3EVQ A;  3MAQ A;  1MHW C;  2MQH A;  5I9P A;  5JJI A;  1QVC A;  4R4T A;  2Z8L A;  1BCP C;  2ALY B;  2MPM A;  3K80 C;  3HOZ B;  2IX0 A;  2KHJ A;  3NWT A;  5M3F B;  4DV2 Q;  4JI6 L;  1PTO B;  1HNW L;  2HIX A;  4IUR A;  4OL7 A;  1TVX A;  1Z47 A;  1G2S A;  1SEB D;  1VF7 A;  2NTS A;  3QIA A;  5CV6 A;  2A6H D;  3H3V I;  1CHP D;  3C46 A;  4RAU C;  4ZCK A;  4CJ0 B;  2EE1 A;  1L1O A;  1F2L A;  4QUC A;  2NN6 G;  1L0W A;  1VQ5 A;  2ZTE A;  1HXY D;  1VDZ A;  1STE A;  3Q0A A;  5EPL A;  1G51 A;  4N9T A;  2E2I H;  4AH6 A;  1V8Q A;  3PGZ A;  4U68 A;  4DV7 Q;  4A3D H;  3E0E A;  3CAM A;  1QUQ B;  4KHP Q;  4TQU S;  1J5E Q;  2J0T D;  1PYB A;  3JC6 6;  1M8A A;  2J4X A;  4DU9 A;  3K7U C;  2UXD L;  4YY3 Q;  5JJZ A;  5ELC A;  1CKM A;  1IBL Q;  2MP1 A;  3VYT A;  3RZO B;  1QIL A;  5EAY A;  1BCP F;  5BR8 Q;  1C7Y A;  3S14 H;  4FF2 A;  1JMC A;  3GTO H;  1SE2 A;  4NW2 A;  1TY2 A;  4LF7 Q;  1ROD A;  3TZD A;  1WCM H;  1ZXT A;  5IGE A;  2NVY B;  3FDT A;  4H0L C;  2HUG A;  2CQO A;  2PCF B;  5BN4 A;  1E22 A;  1DOK A;  2Y0S E;  4CKC A;  4IJH A;  4NKL A;  1YJ9 A;  3H3V C;  1TS4 A;  2QDB A;  4DR5 Q;  1J8I A;  1TS5 A;  3ZYY X;  2NVT B;  1Q12 A;  5BR8 L;  1HNZ Q;  3W2D A;  2VL6 A;  1PH5 A;  4F8M A;  3UE0 A;  4LF4 Q;  3NQT A;  2JA5 G;  2AMC B;  4YY3 L;  3RN5 A;  2C35 B;  3MVV A;  2NYZ D;  3GTK B;  5CBE E;  1QCB D;  4TKO B;  2R93 G;  1UEB A;  2TMP A;  1LV9 A;  1Q46 A;  2L1B A;  2MFI A;  4XIG S;  4LW1 A;  4NXM Q;  2UUA Q;  2PZT A;  3QB3 A;  5IOD A;  1EYG A;  1C4Q A;  3FP9 A;  2AWO A;  4L8J A;  1JB7 A;  3HOX G;  1YIJ A;  1CA6 A;  3C3L A;  4GOP A;  1HA5 A;  1PH7 A;  1L1O B;  4N8X 1;  1O7Z A;  2ID0 A;  4OWT B;  2HDM A;  4DV4 Q;  4OON A;  2ATW A;  3D4D A;  3K81 C;  3CCR A;  1I94 L;  3TN2 A;  1CTM A;  2JA5 H;  3PIO A;  1FJG Q;  1WTW A;  4EQ5 A;  1B70 B;  5M3F H;  1X3P A;  4B3M Q;  4XTC S;  2R93 H;  4IUU A;  1LLR D;  1E3P A;  3GTK H;  4DK1 A;  3EFX D;  1P16 A;  5IWA L;  1CHQ D;  2EDG A;  4YCW A;  4X6A H;  1MBY A;  4C3H B;  2VQF L;  4QL5 A;  1UAP A;  4GLV B;  1H9K A;  5D3D A;  2Z4I A;  3L2P A;  4KY7 A;  3T1H L;  2GN5 A;  3QOL A;  1JE5 A;  1JQY D;  2WAQ G;  1VQI A;  3Q6S A;  3MXN B;  4HIK A;  2DNE A;  3GP7 A;  1ICF B;  2NZO A;  5M3F G;  2KEC A;  3HS0 C;  1AP0 A;  4JI3 L;  3HOZ G;  1SAP A;  4XT1 B;  4GKJ L;  3UE1 A;  2D62 A;  4P71 A;  4RGM A;  4GS3 A;  1S5F D;  1U4M A;  3DLL A;  2WB1 G;  4NP5 A;  4IQZ A;  4MTK A;  4LF5 Q;  2A5H A;  2KVM A;  2KA7 A;  1ESR A;  3D31 A;  3RZO H;  2JEB I;  3BVM A;  5IP9 H;  1N36 L;  1OO9 B;  1EL0 A;  5DM6 3;  2A69 D;  1E24 A;  4BBS H;  1H9R A;  5KNC A;  1QWY A;  4JI4 L;  4JI8 L;  4F88 A;  2YTV A;  4QF4 A;  1QNU A;  2AUJ D;  3BS1 A;  1X65 A;  4K2L A;  4EVO A;  3EQL C;  1XWE A;  4KN7 C;  2Q2I A;  3MEF A;  3PF5 A;  1PFS A;  3HKZ G;  4P73 A;  3IKJ A;  1LTG D;  2F0J A;  4RHR A;  5HGT A;  4DR4 L;  4B9W A;  1LT6 D;  1VQC A;  1XPO A;  5EQ0 A;  5IP9 G;  1BO0 A;  1WTQ A;  3PIP 3;  3E3X A;  4K0K L;  4ILW A;  1WD1 A;  1PTO C;  2Z9H A;  4DN4 M;  1FGU A;  2F03 A;  2RF4 A;  3KDF B;  1STB A;  4A3L H;  4K8J A;  3M4O B;  1XTD A;  3VYR A;  4A75 A;  1HZC A;  5JPM C;  2K1B A;  4Q0F A;  2K05 A;  2IX1 A;  2F3I A;  3R2I A;  1VQE A;  2LS0 1;  4DNT B;  3C2P A;  2EYH A;  2K6A A;  1IHZ A;  4WFN 3;  1E2Z A;  1YHQ A;  3S17 B;  5CV4 A;  2AQ1 B;  5AFW A;  1M1K C;  2UUB L;  2Z1C A;  2N88 A;  4DR6 Q;  4GZY C;  1B50 A;  3CPF A;  2XSC A;  1RDP D;  1JJG A;  4B9X A;  1LO5 D;  2NTT A;  4X65 Q;  4UPA A;  3C1F A;  1B9M A;  3S15 H;  4K6L A;  3BZC A;  2G5D A;  2QGQ A;  3TQY A;  1X3Q A;  3NEM A;  5EJW A;  4Y7N H;  4RH6 A;  4A3L G;  5JJL A;  2CHB D;  2RDF A;  1E2V A;  1EIG A;  3A56 A;  1GVP A;  2EY6 A;  4C3J B;  2ENB A;  1X54 A;  2XVS A;  1ONL A;  4YHH L;  3CW2 C;  3J80 E;  2I5L X;  1OXT A;  2F0G A;  3R2T A;  2Q8T A;  4XQQ A;  1SMY D;  5IYD G;  3J81 L;  2HQE A;  3I70 A;  1WCM B;  1ZYR D;  3MFG A;  2EYP A;  5E3F A;  2ZXR A;  3Q22 A;  4DR7 Q;  1D6E C;  1LTI D;  1HR0 W;  1MD2 D;  4DR5 L;  2Z4H A;  4HR7 B;  4KD3 A;  1K83 B;  1LTT D;  2A6E D;  5EBD A;  1G2T A;  1CK1 A;  4LFA L;  2AQ3 B;  2F0N A;  1I4X A;  4NB3 A;  1KDC A;  3ONA B;  4L5R C;  4OXP A;  3M4Y A;  2SOB A;  1RTO A;  2OQ0 A;  4KKS A;  1X3E A;  1VQL A;  3N52 A;  3PO3 B;  1B3A A;  3FHW A;  1R9T B;  1JOR A;  3MXU A;  4A3J B;  4RKL A;  1J6Q A;  3CME A;  1DJR D;  1SN8 A;  1RCV D;  3PSI A;  1AEX A;  2UU9 Q;  1B8A A;  3DHQ A;  2SDF A;  1PHJ A;  3OOC A;  5G3L F;  1HHV A;  4DK3 C;  4HCE A;  2CQA A;  4UP7 A;  4C3H H;  3Q24 A;  3AEV A;  2LXK A;  1Y1V H;  1FD7 D;  4CDF C;  4NXM L;  2LSS A;  2K14 A;  1PLF A;  4B3T Q;  2PQA B;  2EOT A;  2R7Z H;  3DM1 A;  1ENA A;  5M5Y H;  2WB1 B;  2QF7 A;  1KQS A;  1ZYR C;  2NVQ B;  3HOY G;  4GN4 B;  4LFB L;  4JYA L;  4CDC C;  3SEB A;  3U9S A;  3TEH B;  5C4X H;  4P74 A;  2I5M X;  1GD7 A;  4JI0 Q;  2F3V A;  3KF6 A;  4IZ8 A;  1JCK B;  5J3B A;  1SYE A;  5DM7 3;  1CZG A;  4IOC A;  4IUN A;  5IOC A;  3CRL C;  4C3H G;  2V4D A;  1Y1V G;  3R93 A;  5FJ8 G;  2UXB L;  4G57 A;  3RZD B;  1VQG A;  4KJO A;  3STB D;  4LWC A;  1D8L A;  2JEA I;  5DLQ E;  4N9P A;  1K3R A;  3K59 A;  5M5Y B;  1ICW A;  2VY3 A;  3L3O C;  4A76 A;  5I2X A;  1N8R C;  4QMG A;  3WDN A;  1Y69 U;  1NUC A;  3T53 B;  1WTX A;  3D4R A;  1SYD A;  2BE5 C;  2G9D A;  4OO1 G;  1KRS A;  3LWU A;  5A35 A;  2ZJR A;  3I56 A;  1ILQ A;  3BVZ A;  3S16 B;  3TP6 A;  2EJF C;  5M3M H;  3J7A 5;  1YEZ A;  3SE0 A;  2E74 C;  5LMN Q;  4A3E G;  4FP5 D;  2K50 A;  3BYY B;  3VYS A;  2MNA A;  1L1O C;  5HY6 A; 
#chains in the Genus database with same CATH homology
 2RA4 A;  4FXK C;  1JR0 D;  4LK1 C;  5EKL A;  1I4R A;  3RLF A;  5C4J B;  4A3F B;  2WAQ B;  4KN4 C;  2C5C A;  1H9M A;  5IGG A;  1B9N A;  4DXF A;  1SNM A;  4A3G B;  1Y8P B;  5CBA E;  1R4P B;  1OXU A;  4JK1 C;  2XRQ D;  2ICI A;  3QG1 A;  1KAA A;  2L9H A;  4K5V A;  1F2Z A;  1AZQ A;  3PV0 A;  1PZI D;  2Y0S B;  3GQB A;  5JVG 3;  4TSS A;  4DAY A;  5ELB A;  2KUM A;  3S15 B;  2OT2 A;  2PZU A;  3PUV A;  2KED A;  1SJH D;  2F0T A;  1F9P A;  1R4Q B;  2BA1 A;  5CYU A;  5FO7 B;  2JA5 B;  2ICE C;  2NB0 A;  2MHV A;  1L0X B;  1A3T A;  1STA A;  1BQQ T;  2FMC A;  2KCC A;  5JEA H;  5HUR A;  3CU7 A;  2F0D A;  4DAP A;  1HTP A;  4IFD G;  2HDL A;  1FGB D;  1MSG A;  3TP8 A;  4XDX A;  1ENC A;  4FNF A;  4C1N K;  5COY A;  5CC4 A;  2JYO A;  3H0G B;  1Q90 A;  2BDO A;  5EPJ A;  3A55 A;  4KHZ A;  3U9O A;  2EYF A;  2NN6 H;  1O80 A;  4ME5 A;  5KEE A;  5I6Y A;  4XQJ A;  4L63 B;  4XQN A;  1ENF A;  4IFD H;  4ZLT F;  2BCO A;  3VR4 A;  2M9V A;  4A3B B;  2HCC A;  2EVB A;  1EQT A;  5CGK A;  4QIW B;  2L5T A;  1XXG A;  1EY4 A;  2A69 C;  4S3S A;  1IW7 D;  4H7B A;  3C1E A;  1SXT A;  1PRT C;  5E4W C;  3MWY W;  3K6O A;  5M5W B;  1RHP A;  1DON A;  5CR3 A;  5C44 B;  2RDG A;  3KLS X;  4X3S A;  2IJ0 A;  2VB3 X;  1F77 A;  2E2H B;  1Z6H A;  1YNN C;  1FR3 A;  2H4O A;  4CKB A;  2A68 D;  4R8N A;  2PPB C;  2F3W A;  3ITP A;  1DXM A;  3HOY B;  1F2Y A;  3PUW A;  2RKS A;  2R7Z B;  1JOQ A;  3A8J E;  1KNE A;  2B2V A;  4ZK9 B;  4HED A;  5FO9 B;  2K03 A;  1GUT A;  5EPK A;  4AYB B;  2IWH A;  2JSO A;  2O4X A;  4BA2 I;  1CI3 M;  2RDH A;  4IUP A;  1LAB A;  1U4P A;  4CGY B;  3AB9 A;  4QCL A;  3GV3 A;  2E2D C;  1ET6 A;  1W6J A;  2SNS A;  4X3T A;  1LT3 D;  3URY A;  3M85 A;  2VNU D;  2CW0 C;  3OWE B;  3D6W A;  1D5Z C;  4R9W A;  4A93 B;  4RWS C;  3IFT A;  1I4P A;  2NUC A;  3NQI A;  2GA4 B;  1EU3 A;  2PZW A;  1STN A;  2KOL A;  5C0X H;  1ILP A;  4C56 C;  5FLX E;  2L55 A;  3DXJ C;  5J39 A;  2A68 C;  1SDF A;  1RD9 D;  5BN3 A;  3MXN A;  2FJ2 A;  2JXM B;  1K8M A;  1RKN A;  2I07 B;  1A3U A;  1ZKO A;  1PFM A;  4ID6 A;  4LAA A;  2TSS A;  1PXU A;  3OHX C;  4XYO A;  2CW0 D;  3NXW A;  2FFK B;  3GTJ B;  3I3C A;  3MXG A;  4ABN A;  5C4H A;  4G7Z C;  5C4Z A;  1W6K A;  1JOK A;  2EZV A;  2K32 A;  3K5N A;  1J9O A;  5CMD A;  1Y1W B;  5C3E B;  3EA6 A;  4NMZ A;  2F0I A;  4KY5 A;  2NZ1 D;  5CV7 A;  3J7A V;  1EU4 A;  4BY7 B;  3S1Q B;  4CJ2 C;  3M7G A;  1BOS A;  1PRT D;  1S5B D;  4BWG B;  3I4M B;  3PIO 3;  2C9O A;  4ZYS A;  4NDX A;  3NHH A;  4M8A A;  3CKI B;  2K5Q A;  1LT4 D;  3HGB A;  2B2W C;  2IPK D;  5M3M B;  2DNC A;  4IFD J;  3TME A;  2M00 A;  3H09 A;  1D1I A;  1CM9 A;  5ELE A;  3ND9 A;  1M4V A;  4ZUJ A;  3AU7 A;  1S5E D;  3BDC A;  4OO1 I;  1FNV A;  4G7O C;  3GV6 A;  1PTO F;  3LNN A;  1QG7 A;  4I7Z C;  3W3A A;  5FO8 B;  5K36 G;  1JWS D;  3QJY A;  1SYF A;  5DAU A;  1EY6 A;  2F1M A;  3TP5 A;  1GUN A;  2WAC A;  1I6H B;  3G6J B;  2EY1 A;  2R93 B;  1HFN A;  3TSS A;  4KMU C;  5D3I B;  2E76 C;  5CV5 A;  3PMF A;  5K5P A;  3HOX B;  1A6X A;  1D5X C;  1E0B A;  4FVM A;  4HMI A;  2PNR C;  4FXG C;  5KRU A;  2WIN B;  1BXT A;  4F87 A;  5K36 H;  1IKL A;  4K8I A;  1SSO A;  1HTL D;  4C1N I;  1H9S A;  3GTQ B;  2F0O A;  4RCN A;  3A7L A;  3S14 B;  5E4X A;  4KJN A;  2BDN A;  3NK9 A;  1DD2 A;  3K5L A;  2VB2 X;  2D9U A;  1TR5 A;  1I6V C;  1MSH A;  2RSN A;  2Q8I B;  1B44 D;  2F0M A;  3I73 A;  5FKA C;  2E75 C;  1PRT B;  3L7Z C;  5I9O A;  4OO1 H;  1AZP A;  1HCZ A;  5F2D A;  4C3I B;  3VR5 A;  4A3E B;  1WTP A;  2VUM B;  1GUS A;  2IX3 A;  1C8C A;  5EGT A;  4ZKB B;  2JA8 B;  4FO2 A;  1HFG A;  3ERO A;  2RQX A;  3S1N B;  1GHJ A;  3J80 L;  5M9O A;  2E2I B;  2F4I A;  3TDQ A;  5T1I A;  1NR4 A;  2PMZ B;  1S5D D;  4QUF A;  2XRS D;  2X6G A;  2JA6 B;  1L0Y B;  3KBX A;  4KD4 A;  4Z9C B;  3HOV B;  1BUV T;  5E1F A;  1BBX C;  1KDA A;  3K7A B;  1RTN A;  2PO4 A;  3GTG B;  2DY7 A;  5D65 A;  4WOR A;  2QKI C;  4HMJ A;  2LKV A;  3P20 A;  2FMM A;  4DNR B;  4FF1 A;  3DUZ A;  4IAL A;  3A7A B;  3E0J A;  1TU2 B;  1S5C D;  4DF7 A;  1BCP D;  1PTO H;  3T13 A;  4BS9 A;  2F0E A;  3TZU A;  1EY9 A;  3MZ5 A;  3OMG A;  5JOB A;  3J81 E;  3KLS A;  1T5E A;  5I6W A;  2KHS A;  3MA2 B;  4XYQ A;  2QEJ C;  5JEA G;  4BBS B;  1QB5 D;  3D4W A;  4V0B A;  2F0Q A;  1SJE D;  5KIX A;  1EZ8 A;  4Q5V A;  4HN7 A;  3GD7 A;  1HPC A;  4RHS A;  4K6D A;  5KND A;  1F9S A;  2R6G A;  3NSW A;  4ODG A;  4PMC A;  4A3K B;  1STH A;  3K58 A;  3FEW X;  3SK4 A;  1TWA B;  3O13 A;  1Q1E A;  4RGO S;  2EYJ A;  3IAY A;  4PMW A;  3DMU A;  1LTB D;  4OGQ C;  3I4N B;  5A2Q E;  1TWF B;  1A3V A;  4PV1 C;  3NBI A;  3A54 A;  3NBH A;  1EY5 A;  4U67 3;  3OIQ A;  3HKZ B;  1GXD C;  5J1Z A;  1DCZ A;  4Y7N B;  1EOT A;  3BG3 A;  1HUM A;  1EYA A;  3GTM B;  4KV6 A;  4WJW A;  5C4X B;  5LL6 X;  1O7Y A;  2XIW A;  3GO5 A;  3BZD B;  4KY6 A;  1KLG D;  3FVQ A;  1RJT A;  5IGC A;  4X3U A;  1JWM D;  4KKU A;  3CRK C;  5C0X J;  1GUG A;  2O5J C;  1BCP B;  3PO2 B;  5I4D A;  5CV9 A;  1SNC A;  3TP7 A;  1KTK A;  1Y8N B;  2VXW A;  1VF5 C;  3WOF A;  3DWA A;  2YYZ A;  1QE6 A;  2LY7 A;  4HAE A;  5C5L A;  3I4L A;  4UDU C;  3T16 A;  2L4N A;  4KHV A;  5C3X A;  5C5M A;  4FXD A;  1SYG A;  2EJM A;  2B2Y C;  4M1U B;  5DEH A;  3E5S A;  2KQ3 A;  3ND8 A;  3F2U A;  1QNK A;  4HCS A;  2K04 A;  2BA0 A;  3MTS A;  3P1H A;  1IL8 A;  2A6H C;  4PNY A;  1ET9 A;  1PFB A;  5CV8 A;  1GHK A;  1QOH A;  1NSN S;  2F0S A;  3HP3 A;  5C3W A;  5KNB A;  5FOB B;  4RKB A;  3I91 A;  5C0X G;  1PMR A;  1CQV A;  1JC7 A;  2NBF A;  1I4H A;  3FKI B;  1T5X D;  2EPB A;  4KTA A;  1LTA D;  1V1O A;  1EY8 A;  1TY0 A;  1I4Q A;  3S2H B;  3KK7 A;  1NR2 A;  3H94 A;  5IT9 E;  4CHT B;  1DM0 B;  4G7H C;  3GTP B;  4FF4 A;  5JAV A;  3NTH A;  4QB4 A;  2D5D A;  2BE5 D;  1JWU D;  2B2T A;  5C6A A;  3DWP A;  3HOU B;  1EFI D;  2B2W A;  2XNA C;  1SND A;  3FPU B;  2XWB B;  3L9A X;  3P75 A;  2RVL A;  2RBM A;  3RD4 A;  2Q8R E;  2R61 A;  1C48 A;  3H91 A;  1PZK D;  5G3L D;  2JA7 B;  1AN8 A;  3NE5 B;  3A8I E;  1GUW A;  2HCI A;  2FIN B;  2PW5 A;  3CQZ B;  4DK0 A;  1PFN A;  2ZXO A;  1B1Z A;  3DWQ A;  5LHY 1;  1QJO A;  1H9S B;  3M7N A;  1Q1B A;  3D8G A;  2XN9 C;  3QOJ A;  5KGU A;  2OF1 A;  1WTR A;  1BNZ A;  4C3J G;  1VCI A;  2R92 B;  2EY5 A;  4IUT A;  4OIJ A;  4J1M A;  1B4O A;  3PUZ A;  1TKW B;  1XYI A;  2E2J B;  4EQN A;  3MXP A;  2A74 C;  1UEA B;  2IW3 A;  2JE6 I;  5ELD A;  4H44 C;  2B2Y A;  4LJZ C;  2A6E C;  1Y1V B;  4E6I A;  2R3Z A;  1HUN A;  4ZKC B;  2D2C C;  4EQP A;  1AFP A;  4PQX A;  3P7J A;  4HTH A;  5A2Q L;  2B8G A;  1JB3 A;  1VMC A;  2K5D A;  2B39 A;  3VR6 A;  1II3 A;  1U4L A;  2DN8 A;  1XTC D;  5FK9 C;  1GOZ A;  3JAM L;  3I8Z A;  2OXP A;  2K5W A;  3PUY A;  2PYK A;  2JP1 A;  1PRT F;  3NPP A;  3SK5 A;  1ZEQ X;  2B63 B;  4MN3 A;  2L0C A;  3T51 B;  2B2T C;  3R8B A;  1TT2 A;  5IGF A;  2K33 A;  2LMC B;  1U9R A;  2EYM A;  3IL8 A;  1HRJ A;  3NP8 A;  1OXS C;  1G8Z D;  4EGV A;  2X69 A;  3K0Y A;  1V1P B;  3KBG A;  4RA8 A;  1D1K A;  1Q3L A;  4A3I B;  1V43 A;  2F0L A;  1MGS A;  2MUY A;  1JE4 A;  2B2V C;  3RUZ A;  3BDO A;  3SHL A;  2G9H D;  1EYD A;  1SNO A;  2F0W A;  1SE3 A;  2O2L D;  1Y8O B;  5T1G A;  1KNA A;  1EY7 A;  3BDL A;  4A3D B;  1E2W A;  2B8F A;  1PDQ A;  5ELF A;  4IFD I;  4ZUI A;  3IFD A;  4TRD A;  1EWC A;  3SXH A;  1I50 B;  3K5O A;  1Q8I A;  1YNJ C;  2K28 A;  2LFN A;  1K8O A;  3NTI A;  1CFM A;  1SBB B;  2KJX A;  1EWH A;  3KF8 A;  1KDB A;  1EIH A;  4ZRZ A;  3K5M A;  2MGS A;  1EQV A;  3S2D B;  4DXG A;  2SEB D;  1H9J A;  2F0H A;  1BR9 A;  3FRP B;  5FLX L;  2WV6 D;  1CA5 A;  1O7L A;  4F7X A;  1IKM A;  1B2T A;  1F2M A;  1CQF A;  1F9R A;  3LX0 A;  4DAV A;  4R8I A;  4FYD A;  3D3R A;  5JVH 3;  4KKT A;  1UNS A;  2AWN A;  1S4Z A;  1XX8 A;  1IW7 C;  1KAB A;  5KYI A;  3X3N A;  1TWH B;  1BF4 A;  4KK7 A;  4H13 C;  4CBV A;  1A15 A;  2WKC A;  1TII D;  3S1R B;  5EBC A;  3UI2 A;  3LWE A;  4WRD A;  4O42 A;  2J7Z A;  2F0P A;  4XT3 B;  1HA6 A;  2K7V A;  4K5W A;  5IGB A;  1EYC A;  5KYL A;  3H6M A;  4ZAI A;  2EY2 A;  5M5X B;  1FNW A;  3BVG A;  5DNF A;  2B2U A;  3HZX A;  1FYC A;  2F0K A;  1IYV A;  2QIL A;  4C3I G;  3OW7 A;  3M3Y B;  1SYB A;  3OPO A;  2X6L A;  3T4A C;  1UUP A;  1GJX A;  2N55 A;  2NN6 I;  1TS2 A;  2KEE A;  1DZ1 A;  4B08 A;  4DA2 A;  1V1P A;  4V19 0;  3MC0 B;  3Q23 A;  1AW7 A;  2KCN A;  1DOM A;  4HSP A;  2F0U A;  2IL8 A;  1I4G A;  1YNN D;  3DEP A;  1IYU A;  2WP8 J;  1A2T A;  1DOL A;  3J7Y W;  5JEA J;  3VYU A;  4K2K A;  3SK6 A;  3HRZ C;  5JPN C;  1MI2 A;  3D6C A;  2BOS A;  5EKI A;  1SFO B;  3FMC A;  4RGT A;  4A3M B;  1KLU D;  4ZQ3 A;  4G4K A;  3N6R A;  2CVR A;  3NTK A;  3KLR A;  1BDO A;  3FPP A;  1WD0 A;  3OWF A;  4RCO A;  2YU9 B;  2NVX B;  1ML0 D;  3NWS A;  3SDZ A;  4O1N A;  3OMC A;  2PW7 A;  4CJ1 B;  2NWG A;  1STG A;  4HSV A;  4L6T B;  1SNP A;  4XXE A;  3QWN A;  3I90 A;  3SVM A;  3V2T A;  3QO2 A;  4IUV A;  1DYQ A;  1EZ6 A;  4ULL A;  4I65 A;  2EYL A;  1LTS D;  5BN5 A;  4C2M B;  1EY0 A;  5IT9 L;  4YIJ A;  2ZXP A;  2MJ8 A;  1LT5 D;  1F9Q A;  1PZJ D;  1G91 A;  1FNU A;  2A73 B;  1NAP A;  1X32 A;  4MHE A;  1CT1 D;  3V05 A;  4CKE A;  3TBI B;  2F0V A;  3HG9 A;  3K57 A;  1B53 A;  4X3K A;  1HQM C;  3VR2 A;  1G29 1;  2QCP X;  4RFB A;  3J7A F;  3SR1 A;  3DEO A;  1TWC B;  2H1E A;  4PMB A;  3GTL B;  2AUK A;  1SMY C;  1D2B A;  1YNJ D;  2B2U C;  3MHB A;  4MIU A;  1SYC A;  3VA7 A;  3CHB D;  2K01 A;  3GTO B;  1TWG B;  4DGZ A;  3SK8 A;  2OEO A;  3S1M B;  4FF3 A;  3HOW B;  2SNM A;  4IN3 A;  3JAM E;  4JBW A;  2EYO A;  4BBR B;  4DFA A;  4P2C B;  4RGN A;  3R3O A;  1OXV A;  1SE4 A;  3OIP A;  2ZT9 C;  5C0X I;  1I3Q B;  2WII B;  2FHT A;  2EXZ A;  3KUP A;  1PTO D;  3X3M A;  4J6H A;  5I2Y A;  1EEF D;  1O78 A;  1JOO A;  2F0F A;  1U4R A;  1TS3 A;  1NCV A;  3MEH A;  3S9W A;  1RF2 D;  1VMP A;  4UAI A;  2L12 A;  1D5M C;  2L11 A;  4IUQ A;  5LL6 S;  2AQ2 B;  4KI0 A;  4OHJ A;  3OSO A;  1WVL A;  4OIK A;  5ISR A;  1OXX K;  2M2L A;  3EJI A;  1G6Z A;  1LTR D;  2IT1 A;  2PQE A;  2XWJ B;  4J8Q A;  5NUC A;  1Z7T A;  1TQO A;  1EEI D;  1HQR D;  3ERQ A;  5TSS A;  5IGD A;  3PUX A;  3E6Z X;  3BYT B;  1WTV A;  2DY8 A;  1SNQ A;  3G7L A;  3VR3 A;  3MFY A;  1CZW A;  1STY A;  2RSO A;  3A8K E;  1A2U A;  4K5X A;  5J22 A;  3NUC A;  3WOE A;  1PYW D;  4EQO A;  2EJG C;  3I72 A;  4K14 A;  3V96 A;  1WTO A;  1GUO A;  2I46 A;  5IIF A;  5D14 A;  3AMU A;  2O5I C;  4BA1 I;  4BY1 B;  2WKD A;  3RMH A;  1JIC A;  4LMQ D;  3HEJ A;  3VA5 A;  5EKK A;  1ESF A;  1LAC A;  5COR A;  3T56 B;  3EVQ A;  3MAQ A;  5I9P A;  2Z8L A;  1BCP C;  2MPM A;  3HOZ B;  2IX0 A;  3NWT A;  5M3F B;  1PTO B;  4IUR A;  4OL7 A;  1TVX A;  1Z47 A;  1G2S A;  1SEB D;  1VF7 A;  2NTS A;  3QIA A;  5CV6 A;  2A6H D;  1CHP D;  3C46 A;  4RAU C;  4CJ0 B;  2EE1 A;  1F2L A;  4QUC A;  2NN6 G;  1HXY D;  1VDZ A;  1STE A;  3Q0A A;  5EPL A;  4N9T A;  1V8Q A;  4U68 A;  4TQU S;  2J0T D;  1M8A A;  2J4X A;  4DU9 A;  5JJZ A;  5ELC A;  2MP1 A;  3VYT A;  3RZO B;  1QIL A;  1BCP F;  4FF2 A;  1SE2 A;  4NW2 A;  1TY2 A;  1ROD A;  3TZD A;  1ZXT A;  5IGE A;  2NVY B;  3FDT A;  4H0L C;  2HUG A;  2PCF B;  5BN4 A;  1DOK A;  4CKC A;  4NKL A;  3H3V C;  1TS4 A;  2QDB A;  1J8I A;  1TS5 A;  3ZYY X;  2NVT B;  1Q12 A;  3W2D A;  4F8M A;  3NQT A;  3MVV A;  2NYZ D;  3GTK B;  5CBE E;  1QCB D;  4TKO B;  2TMP A;  1LV9 A;  2L1B A;  4XIG S;  2PZT A;  3QB3 A;  5IOD A;  1C4Q A;  2AWO A;  4L8J A;  1CA6 A;  3C3L A;  1HA5 A;  1O7Z A;  2ID0 A;  2HDM A;  3D4D A;  3TN2 A;  1CTM A;  1WTW A;  1X3P A;  4XTC S;  4IUU A;  1LLR D;  4DK1 A;  3EFX D;  1CHQ D;  2EDG A;  1MBY A;  4C3H B;  1UAP A;  1H9K A;  5D3D A;  2Z4I A;  4KY7 A;  3QOL A;  1JQY D;  3Q6S A;  2DNE A;  3GP7 A;  2KEC A;  3HS0 C;  1AP0 A;  1SAP A;  4XT1 B;  2D62 A;  4RGM A;  1S5F D;  1U4M A;  4NP5 A;  4IQZ A;  2A5H A;  2KVM A;  2KA7 A;  1ESR A;  3D31 A;  2JEB I;  3BVM A;  1OO9 B;  1EL0 A;  5DM6 3;  2A69 D;  1H9R A;  5KNC A;  1QWY A;  4F88 A;  4QF4 A;  1QNU A;  2AUJ D;  3BS1 A;  4K2L A;  4EVO A;  3EQL C;  1XWE A;  4KN7 C;  3IKJ A;  1LTG D;  2F0J A;  4RHR A;  5HGT A;  4B9W A;  1LT6 D;  5EQ0 A;  1BO0 A;  1WTQ A;  3PIP 3;  4ILW A;  1WD1 A;  1PTO C;  4DN4 M;  2F03 A;  1STB A;  4K8J A;  3M4O B;  3VYR A;  5JPM C;  2K1B A;  4Q0F A;  2K05 A;  2IX1 A;  3R2I A;  2LS0 1;  4DNT B;  3C2P A;  2EYH A;  2K6A A;  1IHZ A;  4WFN 3;  1E2Z A;  3S17 B;  5CV4 A;  2AQ1 B;  5AFW A;  2Z1C A;  2N88 A;  4GZY C;  1B50 A;  2XSC A;  1RDP D;  4B9X A;  1LO5 D;  2NTT A;  3C1F A;  1B9M A;  4K6L A;  1X3Q A;  5EJW A;  4RH6 A;  2CHB D;  2RDF A;  1E2V A;  1EIG A;  3A56 A;  2EY6 A;  4C3J B;  2ENB A;  2XVS A;  1ONL A;  3J80 E;  1OXT A;  2F0G A;  3R2T A;  2Q8T A;  4XQQ A;  1SMY D;  3J81 L;  2HQE A;  3I70 A;  1WCM B;  1ZYR D;  3MFG A;  2EYP A;  5E3F A;  2ZXR A;  3Q22 A;  1D6E C;  1LTI D;  1MD2 D;  2Z4H A;  4HR7 B;  4KD3 A;  1K83 B;  1LTT D;  2A6E D;  5EBD A;  1G2T A;  1CK1 A;  2AQ3 B;  2F0N A;  1I4X A;  1KDC A;  3ONA B;  3M4Y A;  2SOB A;  1RTO A;  4KKS A;  3N52 A;  3PO3 B;  1B3A A;  1R9T B;  1JOR A;  3MXU A;  4A3J B;  4RKL A;  1DJR D;  1RCV D;  1AEX A;  3DHQ A;  2SDF A;  3OOC A;  5G3L F;  1HHV A;  4HCE A;  2CQA A;  3Q24 A;  1FD7 D;  1PLF A;  2EOT A;  3DM1 A;  1ENA A;  2WB1 B;  2QF7 A;  1ZYR C;  2NVQ B;  3SEB A;  3U9S A;  2F3V A;  4IZ8 A;  1JCK B;  1SYE A;  5DM7 3;  1CZG A;  4IUN A;  5IOC A;  3CRL C;  4C3H G;  2V4D A;  3R93 A;  4G57 A;  3RZD B;  4KJO A;  2JEA I;  4N9P A;  3K59 A;  5M5Y B;  1ICW A;  3L3O C;  5I2X A;  4QMG A;  3WDN A;  1Y69 U;  1NUC A;  3T53 B;  1WTX A;  3D4R A;  1SYD A;  2BE5 C;  2G9D A;  4OO1 G;  3LWU A;  5A35 A;  1ILQ A;  3BVZ A;  3S16 B;  3TP6 A;  2EJF C;  3SE0 A;  2E74 C;  4FP5 D;  3VYS A;  3BYY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...