1YHBA

Crystal structures of y41h and y41f mutants of gene v protein from ff phage suggest possible protein-protein interactions in gvp-ssdna complex
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
87
structure length
87
Chain Sequence
MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEFPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENE V PROTEIN
publication title Crystal structures of Y41H and Y41F mutants of gene V protein from Ff phage suggest possible protein-protein interactions in the GVP-ssDNA complex.
pubmed doi rcsb
source organism Enterobacteria phage f1
molecule tags Dna binding protein
total genus 9
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 1994-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1yhbA00
2IX0A 3CC4A 2BH2A 1B8AA 1CKMA 5EAYA 4LF4Q 5J3BA 1UWVA 2JJQA 1XNQQ 1QZHA 4R4TA 2UUBQ 2RCNA 3J80c 1VQBA 4UP9A 2Q2TA 1HJPA 1OXTA 5FLXc 4GLAC 2VQEL 1PYSB 4DV1Q 4YHHL 1PH6A 2VQFQ 4JI8L 1N33Q 1G291 3K7AH 4IJHA 3GTJH 4GOPC 1S3OA 3TQYA 3ZJYC 4DV0L 4GKJQ 1J6QA 1WI5A 2JA8H 2N78A 3TS0A 1IZ6A 4L5QA 4HIKA 3A0JA 4IPCA 1XPUA 3PUYA 4L5SA 2VS1A 3F2CA 4FDBA 1E24A 4OO1G 2IY5B 3NELA 2F52A 4BBRH 4A93H 2YTVA 4X64L 3HOUH 1PH4A 1X6OA 2BA1A 2PI2E 2V1CC 1OXSC 2ZJQA 3J80i 1N34L 4A3FG 3GTMH 2IT1A 2AWOA 4O0AA 3I56A 1N32Q 4B3TL 4DV5Q 5IP7G 1VQ4A 1KD1C 1EWIA 2GVAA 3GTPH 5GQOA 1VQNA 4JI1L 1EFWA 3GTKH 3PSIA 1WYDA 2JQOA 5LMUQ 4DK6C 3I4MH 4P72A 4B3SL 4R1JA 4HJ5A 1PHJA 1GD7A 1Q1BA 1VQEA 1K83H 5M5WH 5IWAL 4X62L 3VDYA 1JMCA 1VQ8A 1VQKA 2EXDA 3HOZH 4IPDA 4X6AH 1S40A 4LF8L 2K52A 2VQEQ 1MJCA 4JI6L 2N8NA 3BZCA 4JI8Q 3S2DH 2UXDQ 4QY7A 2DUDA 1SE8A 4EQ5A 4DV0Q 2YTXA 1VQLA 4DR7Q 2K5HA 5IP7H 4DV2Q 1YHAA 3RLNA 4Y7NH 3GDEA 1UEBA 5IYBG 2VL6A 1I94Q 4LF5L 1IYJB 1K8AC 4LF9L 1W2BA 1XMQL 3S1NH 1N34Q 1VQIA 1RL2A 2MFIA 3HOXG 4B3TQ 4BA2I 4BY1G 3G6EA 2Z6KC 4JI1Q 4HJ7A 2ASBA 2C35B 1ASZA 5JJIA 3CPFA 2JA7H 1WOCA 1OXVA 1KAWA 5IT9c 5C3EG 4B3SQ 1I50H 3IRBA 1PA6A 3GTOH 1FVIA 4X65L 3RZOH 4X62Q 3UE0A 2N3SA 2KHJA 4YY3L 3CCEA 3CCSA 1VQ5A 4IFDJ 1FL0A 1OXUA 3PUXA 1VQPA 1CSQA 1EIYB 3M3YH 4LF8Q 1VQCA 4PZ8A 4JI6Q 4A3BG 1VQ9A 1VQHA 1NBWA 1WFQA 5GAGC 2AWNA 2JA5H 1SRUA 2CWPA 4JV5L 4GNXA 3HOXH 1KL9A 2UUAL 4KHZA 4QGUA 1A8VA 4IPGA 2HT1A 4DR3L 4BY1H 3KF8B 5C0XI 3GO5A 2QGQA 2VUMG 3TS2A 1PH1A 2EIFA 5C3EH 5K36G 3S1RH 3M7NA 4A3CH 1XMQQ 3NBHB 1CKOA 2OWOA 2K14A 5IYCG 5C44G 1MJEA 2YU9H 1VQ6A 4DR6L 1NJIC 4NXML 3EBEA 4LUVA 5FJ8G 1K0RA 4BXXH 3H3VI 2E2HH 1SFOH 1JE5A 3KFUA 3BZKA 1KHIA 1OXXK 5E7NA 4GNXB 4HJ9A 4JYAL 1LM0A 1Z47A 2RF4A 3DLLA 4BBSG 1VQMA 3M4QA 1EYGA 2UUCL 1I5FA 5GROA 2RHQB 5HY6A 4YY3Q 3L0OA 2QA4A 3UDIA 1Q86C 4L5TA 2NZHA 3W1BA 4JBMA 3HOYH 1JT8A 4JC0A 3W1GA 4IOAA 1JJCB 3UE1A 1DGSA 3CCQA 4DUZL 3OW2A 4A3EG 3RLOA 4YWMA 5FJ8H 4JV5Q 1BVSA 5HGQA 1YBYA 2VZAA 2Q2UA 2UUAQ 3E0EA 4DR3Q 1ASYA 4DR1L 3ICEA 1VCIA 1OTCA 2IHEA 5FLMG 1PH7A 3L2PA 3M4OH 4BBSH 3FKIH 3F8TA 1V43A 4JBKA 3HOWG 1BBWA 4DR6Q 2K50A 3T1YL 4NXMQ 2CWAA 3I55A 3KJPA 2AMCB 1Q8KA 4PG3A 5C4JH 1GVPA 5C4XH 4JI0L 5JJLA 3G48A 1YI2A 4JYAQ 1N9WA 1RIPA 3U58A 2WP8J 4RG1A 4POGA 1K73C 4PZ6A 1UE6A 4TVAB 4C2MH 2UUCQ 2UXCQ 1J5EL 2L15A 4K0KL 2D62A 5FLMH 2KCMA 3ERSX 3U4ZA 1UE1A 4AQYL 4GLVB 3HOWH 3FHWA 4HJ8A 1R9TH 1EQQA 1TWFH 4PZ7A 1X3FA 1NMGA 1HR0W 4DR5L 4DR1Q 4DR4L 3KYHC 2I5LX 1WJJA 4IJLA 3S15H 2GVBA 3T1YQ 1NMFA 4Y52H 1XNRQ 1NTGA 2ZTEA 3OTOL 5M3MG 2VNUD 2JEBI 5M3FG 2HIVA 4DUYQ 3CCLA 1BBUA 4HJAA 4LFBQ 1Z9FA 4JI0Q 4GKKL 4A76A 1L1OB 3TEHB 3CCMA 1D8LA 4YWLA 4IO9A 2N49A 4H02A 1YHQA 4DV3L 1JJGA 1VQ7A 1IBLL 4UP7A 2RHSB 4DKAC 2UXDL 2E2JH 1J5EQ 4YHHQ 1O7IA 3K7UC 3HKZG 4TQUS 4OWWB 2NVQH 4AQYQ 4A3FH 4KI0A 2HQLA 2JK8A 4A3LG 5LMNL 2D0PA 1EIFA 4LW1A 2B63G 2WB1G 4A3IG 2ZM6L 3CC2A 2XTIA 5M3MH 1PVOA 1UE7A 1IBML 4OXPA 5M3FH 1VQGA 1XTDA 1YITA 3HFZB 4R4QA 4DR5Q 1PH8A 1YZ6A 4DR4Q 4R4OA 2Y0SG 4X66L 4DPGA 2YYZA 4X64Q 4LF7L 2R92G 4OWTB 4B3RL 1G6PA 4A93G 3E9HA 3STBD 3CCJA 1SN8A 1KXLA 3GTQH 3OTOQ 1NE3A 2Z0SA 3NENA 5AJ3L 4UY8C 3K80C 3E9IA 4YWKA 2YTYA 1EQRA 3ULLA 1HNWL 4GKKQ 1I6HH 4A3LH 2MO0A 2AHOB 5IWAQ 1GM5A 4DV6L 4UP8A 4A3IH 2CCZA 1W3SA 2B63H 3RLFA 3GTGH 3K81C 3I4OA 5H1SE 1E3PA 5IYBH 4DV3Q 3LGJA 5GAHC 2XGTA 3G4SA 3F2DA 4HIOA 2PNHA 3W5OA 4DAMA 1C7YA 1IBLQ 2NVXH 1EOVA 4IFDI 2GN5A 1C9OA 2R92H 2EQSA 2PMZE 3L7ZC 2UXCL 3PF4A 5LMNQ 3S16H 2ZJRA 3H0GG 1AE2A 3ULJA 1IBMQ 4QL5A 4EX5A 5BR8L 1Q81C 2A1AA 4A3BH 3M4PA 4LF5Q 3KJOA 3U50C 4LF9Q 4X66Q 2F4VL 1Q1EA 4LF7Q 4GOPB 3RN2A 1QUQB 4B3RQ 4QQBX 1YVCA 3KF6B 2R93G 4DK3C 2UU9L 1Q82C 2K5NA 3HKSA 4GLXA 3KDFB 3CCUA 3D31A 5AJ3Q 3I4NG 2ATWA 1VQDA 2ZTCA 1NY4A 2KCTA 1HNWQ 2JE6I 3HKZE 4X65Q 2KHIA 3MEFA 1KIXA 2JEAI 2VUMH 4DV6Q 1YJ9A 4P75A 4P71A 2E2IH 4A3MG 2ES2A 4JI4Q 1KRTA 4WJ3M 3CF5A 1UE5A 2K4KA 1JB7A 4POFA 3TREA 4UPAA 5C44H 5IYCH 2WAQG 4HIDA 1Q46A 4OO1I 2Y0SE 3A5ZB 2R93H 4LWCA 4OX9L 4JI2L 4A75A 4IOCA 1Y1WG 4A3GG 3AEVA 3I4NH 2A8VA 3K8AA 3I2ZA 1E1OA 2H5XA 5BR8Q 4A4IA 3CC7A 1K9MC 1IL2A 2F4VQ 1I3QH 4C3JH 1XNQL 2NN6I 5IP9G 2K75A 3CPWA 1PH3A 1KRSA 4XTCS 3PO2G 1VQJA 4A3DG 1L0WA 1XMOL 4LFCL 4A3MH 3WWVA 4A3KG 2UU9Q 2KBNA 3M9BA 1QVGA 1TWGH 3HOVG 4MNOA 4NB3A 4A3EH 2OTLA 1VQFA 2BH8A 5GAEC 1HZBA 4IFDG 4DR2L 3PIOA 3KLWA 5M5XH 3S17H 2VY3A 2MQHA 1CKNB 1HNXL 4A3GH 1XPOA 1X65A 3FP9A 2HIXA 3AYHB 2B29A 5C0XG 1B70B 1YJNA 4DUZQ 1N32L 1HZAA 1Y14B 2I5HA 2NZOA 5IP9H 3G71A 4A3JG 2JA8G 1WCMG 2BA0A 3PO2H 4A3DH 4P73A 1HZCA 3AQQA 3D0FA 4JI2Q 3RN5A 1L1OA 1HH2P 2K5VA 1P16A 4BBRG 2NVYH 3HOVH 5IYDG 3EIVA 1A62A 3OYYA 3Q8DA 3CXCA 3CD6A 1YHBA 4JCVE 4LF6L 1VQAA 2ZTDA 4DV7L 2VW9A 2R7ZG 2Q2IA 3RR5A 5ELNA 3PF5A 1A0IA 1H95A 1TWHH 2E8GA 2UXBL 1BKBA 1XMOQ 4LFCQ 4JOIA 4YCUA 2IX1A 4OONA 2PQAB 2D0OA 3I4MG 3GTLH 4DR7L 3J7ZC 4BA1I 3STBC 3U4VA 3J7A5 1X3GA 4A3JH 5JJKA 1WCMH 4P74A 1LTLA 4APVA 4DV2L 4DR2Q 4DNIA 2MNAA 3M85A 2WAQE 4GNXC 3HOZG 1I94L 1TWAH 1HNZL 1HNXQ 4AH6A 1PH2A 3H3VH 3S1MH 4K0KQ 4R4IA 5IYDH 1X3EA 2CFMA 3J81c 4JBWA 4R4CA 1T9HA 3PUWA 4QIWE 2R7ZH 3H15A 4AYBG 4ALPA 1XPRA 1X9NA 5JEAG 1JJ2A 4GN5A 1IXRA 3T1HL 1XJVA 2JA6G 2KENA 1E1TA 1V9PA 1SR3A 1X54A 2NN6G 2R6GA 1SROA 4GN4B 2R7DA 3PUVA 1B7YB 4XIGS 4DV4L 2LXKA 1MKHA 2LSSA 2YV5A 3BU2A 1S72A 4LF6Q 4DV7Q 1U0LA 3TRZA 4JI3L 1G51A 3F2BA 5DLQE 3UDFA 3CCRA 3CQZH 1YJWA 2HHHL 3J81i 4LUZA 2I0QA 1P8LA 3S14H 4QJFA 1Y1VG 2UXBQ 1AH9A 2JA7G 2WFWA 1TWCH 3CMEA 2OCEA 3PIPA 1N36L 4WJ4A 4GN3B 2A19A 3J81j 2Q2HA 4NXNL 1AE3A 3JAMc 4J15A 3CCVA 1KC8C 1QVCA 2JA6H 1PFSA 1A63A 1C0AA 4GOPA 1QUQA 3AFQA 1HNZQ 4JI4L 1Q12A 3PCOB 3KOJA 3S2HH 3NEMA 3KF6A 2OQ0A 1N8RC 2OQKA 4KHPL 3PV0A 4DAYB 3JC66 2DGYA 3RNUA 4IPHA 2JA5G 3KDFA 4RMFA 1MIUA 3B6YA 3PGZA 3S1QH 2ZM6Q 3T1HQ 1Y1VH 3K0XA 2CKZB 2OTJA 1V1QA 3CP0A 1YIJA 4LNQA 2F3IA 3JAMi 4B3ML 4YCVA 1FJGL 2NVTH 4DV4Q 4HIMA 4A3CG 1E22A 1PH5A 3EN2A 4MZ9A 4BXXG 3A74A 3MXNB 4JI3Q 2HHHQ 2ZJPA 4KLKA 4MTNA 2JA9A 4JBJA 1HR0L 1U5KA 3UDXA 5GADC 2QEXA 4LFAL 3CAMA 2CQOA 3I7FA 1N36Q 5C0XJ 1CUKA 3UDGA 4NXNQ 1KQSA 3H0GH 2PI2A 2R7FA 4AYBE 3PUZA 3HOYG 4YCWA 4JI5L 2WB1E 3A5UA 1L1OC 4ME3A 3SGIA 2E5LL 3S24A 4LUOA 4L5RC 1YNXA 4KHPQ 1QVFA 1QZGA 4PMWA 4BY7G 2ALYB 1IBKL 3ULPA 4NPSA 1PYBA 4O2DA 1LUZA 3CW2C 4JI7L 4JOIC 1CKNA 5LMNW 1FGUA 4B3MQ 1X55A 4LF4L 3FKIG 1FJGQ 5ELOA 4OWXB 3PO3G 1E7ZA 4JG2A 2UUBL 2MO1A 1YEZA 1PV4A 2I5MX 3F1ZA 1M90C 2Z6KA 4DV1L 5IY0A 1VQOA 2VQFL 1N33L 5C4XG 4GKJL 1HR0Q 4AIMA 3BJUA 2FXQA 4LFAQ 3ER0A 1VS0A 3DM3A 1SMXA 4BY7H 1X56A 1K8GA 1LYLA 1Y1WH 3CMAA 1SLJA 3AFPA 1Q7YC 5JEAJ 4JI5Q 1PH9A 2LXJA 3PO3H 1GO3E 1HZ9A 1L2FA 4GS3A 2E5LQ 1K3RA 1TXYA 1M1KC 4DV5L 4C3HH 3RZDH 1XNRL 2B3GA 2PQAA 1EUJA 1CSPA 1GKHA 5M5YH 4OX9Q 5LMUL 3GD7A 2IHFA 4A3KH 1IBKQ 1D7QA 4DUYL 4C3IH 5IE8A 4LFBL 2AKWB 3HOUG 2ID0A 4JI7Q
chains in the Genus database with same CATH superfamily
2K04A 5FLXL 4LF4Q 4LAAA 4KKTA 1QZHA 2JXMB 4R4TA 4UP9A 1HJPA 4EQOA 4I65A 3NBIA 1PH6A 3GTMB 4JI8L 3T51B 2I46A 3GTJH 1S5CD 2F0TA 1JC7A 2N78A 2L4NA 4NKLA 4HIKA 1BBXC 1G2SA 5M5WB 4BBRH 4A93H 4X64L 3HOUH 2BA1A 2ZJQA 3HOZB 1N34L 4A3FG 2IT1A 3MWYW 3QJYA 4DNTB 5IP7G 2GVAA 2D9UA 2SNSA 5KYLA 1S5DD 5EBDA 1CQVA 4R1JA 4HJ5A 1FGBD 4Y7NB 1VQEA 1JMCA 3VDYA 5EKIA 2BE5D 4X6AH 3I91A 5ELFA 2VQEQ 3S1NB 2UXDQ 2DUDA 4EQ5A 1VQLA 3GTQB 4DV2Q 4PQXA 3RLNA 3GDEA 1UEBA 3QO2A 1VF7A 2EPBA 4HCEA 4LF9L 1NUCA 1PTOD 2HD3A 1A3TA 3P7JA 2L11A 5CBAE 3VA7A 1F9SA 3AMUA 2Z6KC 2JA5B 2C35B 1ASZA 2KCCA 1C8CA 1WOCA 5IT9c 4B3SQ 3IRBA 1D5MC 1FVIA 1GXDC 3RZOH 1TY0A 5C5MA 4X62Q 2KHJA 4YY3L 3CCEA 4JW0A 1VQ5A 1FL0A 4LK1C 3PUXA 5LL6S 4UDUC 3T56B 3SE0A 1VQHA 4KHZA 4DAVA 4DR3L 3GO5A 2Z4IA 4J6HA 4TRDA 2F0VA 2EIFA 5C3EH 3S1RH 1XMQQ 3VR4A 3HOYB 2K14A 1ENCA 3LWUA 5IYCG 4DR6L 1XXGA 2RQXA 1I6VC 4RH6A 3BZKA 1OXXK 4HJ9A 4GNXB 3M4YA 3QOLA 1IW7C 3DLLA 2UUCL 1I4RA 2B2VA 5HY6A 2QA4A 2RHQB 2UXCL 3FKIB 3W1BA 4JC0A 2EYOA 1V1OA 3CCQA 3SK4A 4YWMA 1BVSA 3DWQA 2UUAQ 2G9HD 2CW0D 1SNMA 3M4OH 1Y8OB 4C2MB 4BBSH 1WTXA 4ZUJA 4KJNA 5FK9C 1BBWA 2F0PA 3I55A 1PDQA 1STBA 3E3XA 5FO8B 3NK9A 4KTAA 3FMCA 4N8FA 4K0KL 2EOTA 3S15B 2KCMA 3TZDA 3U4ZA 1UE1A 4AQYL 5FO7B 1WTWA 3HOWH 4WORA 3FHWA 1SE2A 4HJ8A 1R9TH 1A6XA 4PZ7A 4XT1B 1YNJC 5AFWA 2SOBA 1EYDA 1UEAB 1WJJA 2PMZB 3OIPA 4ZYSA 1FR3A 1NMFA 3QG1A 3A56A 3NWTA 4DAPA 3VR5A 1VDZA 2X6LA 4K14A 3MFYA 1LACA 4HJAA 1SSOA 2N49A 2MHVA 1IL8A 1VQ7A 2RHSB 4DKAC 5IIFA 4TQUS 2PNRC 2JK8A 1DD2A 1EIFA 2B63G 2HCCA 5HURA 4OXPA 5M3FH 1VQGA 2FFKB 1I6HB 4ME5A 3HFZB 4DR5Q 2B63B 1YZ6A 2EDGA 4R4OA 4X66L 1S5FD 5I4DA 2R92G 4B3RL 4H0LC 3TSSA 3STBD 2NVXB 2M00A 3CCJA 2R92B 1KXLA 3OTOQ 2Z0SA 5AJ3L 1PFBA 1BCPC 3A8KE 3KF8A 4WJ4A 1BOSA 4UP8A 3MA2B 1W3SA 3GTGH 3K81C 2RKSA 3TP8A 3NBHA 4HIOA 1C7YA 1IBLQ 3X3MA 1O78A 5I2YA 4A3BB 5LMNQ 2SNMA 1MSHA 2CH4W 1GUNA 1BR9A 3H0GG 4GZYC 1IKLA 1PYWD 1WD1A 1UAPA 1Q1EA 1TS2A 3H0GB 4LF7Q 3KF6B 4DK3C 3BDCA 3MHBA 4ULLA 3D31A 5J1ZA 2ATWA 1VQDA 2N88A 4LJZC 3KLRA 2ICIA 4FF3A 4DV6Q 1YJ9A 1J8IA 3CF5A 1EZ8A 3MZ5A 5C44H 2KOLA 1Q46A 2NTTA 4XDXA 2ZXOA 4OX9L 4JI2L 4A3EB 3I4NH 1F9RA 1E1OA 5M5XB 3S17B 2F0JA 1IL2A 1M4VA 4BS9A 2NN6I 1TIID 1PH3A 1EY0A 1KRSA 1LTID 4LFCL 4KKSA 4A3KG 2KBNA 3M9BA 2A68D 2KEDA 1EY8A 1VQFA 3GV3A 1HZBA 4DR2L 4OIKA 2HIXA 3V05A 2B29A 1GJXA 1B70B 1ZEQX 1Y14B 3G71A 4IALA 4A3JG 2KEEA 4K6LA 3AQQA 4A3JB 5FKAC 5BN5A 2NVYH 3EIVA 3Q8DA 4XXEA 1YHBA 4JCVE 1RHPA 4DV7L 2R7ZG 3SXHA 1E0BA 4OGQC 5DM73 5I9OA 3S1MB 1AW7A 4K5XA 2R7ZB 4TKOB 4YCUA 4ZKBB 5DAUA 4R8NA 3I4MG 3GTLH 2OT2A 3J7ZC 3J7A5 5JJKA 4DV2L 4EVOA 3NTKA 1AZPA 3J81E 1HNXQ 1PH2A 1X3EA 2CFMA 2LY7A 1HXYD 1EYCA 4JBWA 4R4CA 4NDXA 3H15A 1X9NA 3R93A 1IXRA 3T1HL 1E1TA 1SR3A 1ESRA 1X54A 4I7AA 5IGCA 2B2UA 1B7YB 1RCVD 2L12A 1ZYRD 2A73B 1G51A 1YJWA 3S2HB 3Q24A 3CCRA 3CQZH 3J81i 2MP1A 2O5JC 1EWHA 1HRJA 1FD7D 3CMEA 3RUZA 1N36L 4GN3B 3J81j 4NXNL 1H9KA 4OHJA 1KC8C 2JA6H 3J7AV 1A63A 1D6EC 2O2LD 2Z1CA 2OQ0A 1N8RC 4KHPL 5A35A 4DAYB 4IPHA 2F0NA 1H9RA 3A8IE 2K03A 5IT9L 2ZM6Q 2OTJA 4LNQA 2BDNA 2K1BA 4YCVA 2NVTH 4A3CG 1E22A 2B2WA 4QCLA 3A74A 1ZKOA 2HHHQ 2ZJPA 4KLKA 1HR0L 1V8QA 2MGSA 4K2KA 5GADC 4JVZA 2CQOA 2L1BA 1CUKA 2R3ZA 1NAPA 1D5ZC 3PUZA 4YCWA 3S24A 1BCPD 2FMCA 1QVFA 4E6IA 1QZGA 1SBBB 4PMWA 3Q0AA 4O1NA 4ZLTF 4NPSA 3KBXA 1GHKA 3QB3A 1H9SA 3NPPA 1E7ZA 1PV4A 3F1ZA 1M90C 4DV1L 1GHJA 5C4XG 4GKJL 2K5DA 2IWHA 5M5YB 3FEWX 1I4QA 1LT3D 1ML0D 1VS0A 1LYLA 1QG7A 2Q8TA 1Y1WH 2DNCA 2EJMA 3CMAA 1ENFA 3NTIA 1PH9A 2B2UC 3PO3H 3EQLC 2KJXA 4EQPA 1TXYA 1LV9A 1PLFA 4C3HH 4DV5L 3K7AB 2B3GA 2QEJC 4RHRA 5LMUL 1IBKQ 1AP0A 1EIGA 5IE8A 4G7OC 2Q8IB 2AKWB 3J80E 2IX0A 3SHLA 5FLXE 1UWVA 3NSWA 1BCPF 2JJQA 4RGNA 1K0SA 1MD2D 1PYSB 2RBMA 3MXPA 2BCOA 4HEDA 2JA8H 5CV4A 1XTCD 4IPCA 3F2CA 2IY5B 1E24A 4OO1G 1F2ZA 2IX3A 1G91A 1S5ED 1PH4A 3J80i 1K8OA 3EVQA 3SEBA 4DFAA 3GTMH 2AQ1B 3I56A 1N32Q 3Q22A 4B3TL 1VQ4A 1KD1C 2B2WC 4RAUC 1VQNA 4JI1L 2CQAA 3PSIA 1WYDA 2JQOA 3URYA 4ZCKA 3MEHA 1W6JA 2BOSA 1J9OA 4JK1C 1VQ8A 3K5NA 4IUNA 5M5WH 1VQKA 4J1MA 5CV5A 5C3WA 2EXDA 3HOZH 4CDEC 4LF8L 3PIO3 4JI6L 3K5MA 1EY7A 2N8NA 3BZCA 4QF4A 4QY7A 4DV0Q 4DR7Q 1EQTA 1A3UA 2F0LA 4KD4A 2EY5A 2K5HA 5IP7H 2IW3A 2JA7B 1YHAA 1LT6D 4Y7NH 2NN6H 5JVG3 2B2TA 1D2BA 5KNCA 1WTHA 3S1NH 3I72A 1EQVA 3S9WA 3HOXG 3KK7A 1HA6A 5G3LF 3IL8A 4BY1G 1HCZA 2FHTA 1X32A 4HJ7A 5JJIA 3HOXB 5FOBB 4BY1B 1PA6A 3UE0A 2N3SA 5IGFA 2CH4A 3CCSA 1OXUA 1EIYB 5D3IB 1NBWA 1WFQA 3SDZA 3BVZA 4P2CB 1SFOB 2JA5H 2K01A 4JV5L 3OHXC 4GNXA 1CHPD 4X3TA 2VUMG 2J0TD 1BUVT 3TS2A 1PH1A 2EY2A 4Q0FA 5K36G 3A54A 1TR5A 1SNQA 1CKOA 1PTOB 2OWOA 1VQ6A 5EPLA 3AB9A 4NXML 2HDMA 3H3VI 1MI2A 3VYSA 2A6HD 2BDOA 4JYAL 1LM0A 4CDCC 3T53B 1Z47A 5EKLA 4ILWA 3PIP3 3L0OA 3UDIA 3HOYH 4L5TA 3W1GA 5FO9B 1SYGA 4G4KA 1LABA 1DGSA 3T13A 2LMCB 3BZDB 5KEEA 3RLOA 1SDFA 3DM1A 1YBYA 2VZAA 1II3A 1JB3A 1CZWA 1F77A 2JYOA 1PH7A 5IGBA 3FKIH 1HHVA 1PZID 2K50A 2IPKD 4JI0L 4KJOA 5JJLA 1Z7TA 1N9WA 5COYA 1AEXA 4PZ6A 4C2MH 4FNFA 5CGKA 2D62A 4CKEA 2B2TC 3G6JB 3SK5A 1G8ZD 3DHQA 2K7VA 1EQQA 1LTBD 1TWFH 1X3FA 1HR0W 4DR1Q 4DR4L 3DWAA 2NYZD 5C3XA 1TVXA 3S15H 3T1YQ 1SNDA 4Y52H 1XNRQ 2NVQB 1NTGA 2PPBC 4A3FB 3BDLA 2O4XA 5M3MG 2VNUD 2JEBI 4DUYQ 4LFBQ 4GKKL 4I7ZC 1QILA 1O7LA 5M3MB 1AN8A 5IGGA 1FNUA 5D65A 1YHQA 4DV3L 1JJGA 1J5EQ 4K8JA 1CQFA 2HQLA 4IURA 2D0PA 4LW1A 4NW2A 4A3IG 3LWEA 2ZM6L 1IBML 1YITA 1XTDA 5EBCA 4R4QA 4A3IB 2Y0SG 2WKDA 2F3WA 1O7ZA 1TU2B 4OWTB 1KLUD 3RMHA 4XYQA 1HPCA 3GP7A 1S4ZA 2Y0SB 3CU7A 1FNVA 2E2DC 1F9PA 3S16B 1EQRA 1HNWL 2KECA 1I6HH 4DGZA 1GM5A 4L63B 1CA6A 2B63H 2CCZA 3RLFA 3D4RA 3I4OA 3VA5A 5IYBH 3LGJA 3G4SA 2PNHA 1PZKD 3W5OA 4DAMA 2NVXH 2GN5A 2R92H 2EQSA 1ILQA 3L7ZC 3PF4A 2MJ8A 4RCOA 3ULJA 1Q81C 4EX5A 3M4PA 3FPPA 2F4VL 2DY7A 4PMBA 3RN2A 5CV8A 2E2IB 5KNDA 4QQBX 3X3NA 2R93G 4H13C 4J8QA 3QOJA 1K8MA 1KNAA 2UU9L 1Q82C 2K5NA 4GLXA 1HQRD 3KDFB 3CCUA 4A3BH 2R93B 3LX0A 2G9DA 3A7AB 2JE6I 3HKZE 1TS5A 3MEFA 4KY5A 4C3JG 4G7HC 1KIXA 2JEAI 5KNBA 1HTLD 1EY5A 3NXWA 2X69A 2XIWA 1PRTC 4C3JB 2ES2A 4JI4Q 2K4KA 3T16A 4UPAA 5I9PA 4HIDA 2WAQG 3DWPA 1JWUD 2A74C 4OO1I 4ODGA 1T5EA 4A75A 2WAQB 4IOCA 1Q3LA 4A3GG 5CV9A 2A8VA 3K8AA 5BR8Q 3OMCA 4A4IA 1K9MC 2EE1A 4A3GB 4QIWB 2P5ZX 2K75A 3PO2G 4XTCS 1L0WA 3CKIB 3EJIA 3PO2B 1DM0B 3D6CA 1D1IA 2A5HA 4A3EH 2OTLA 4IFDG 1EYAA 2BH8A 3O13A 3PIOA 5M5XH 3S17H 1CKNB 4R9WA 1E2VA 3D8GA 2EYPA 3AYHB 4DUZQ 1N32L 1HZAA 1TWHB 2I5HA 1CM9A 3V2TA 4IUQA 1Q8IA 1L1OA 3OPOA 1HH2P 1JOOA 2JP1A 4BBRG 1A62A 3CD6A 2EYMA 2ZTDA 1KABA 1VF5C 1BDOA 2A6ED 4HAEA 2E8GA 1BKBA 1XMOQ 4FF2A 2IX1A 4OONA 1CHQD 4DR7L 4PNYA 4A3JH 2HCIA 3N52A 4APVA 2QW7A 1LTSD 3D6WA 4FF4A 1WD0A 2DJGC 3FRPB 1MGSA 4ZRZA 3H3VH 3S1MH 4R4IA 2TMPA 1JOKA 3J81c 2R7ZH 3S14B 4ALPA 1XPRA 4RGTA 4IFDH 3CRLC 1TWCB 2QKIC 2RCFA 3WDNA 1XJVA 2R6GA 1CK1A 4X3SA 4LMQD 1SROA 5IGEA 3L9AX 2R7DA 1BQQT 1LTAD 4O42A 2LXKA 1GUTA 2LSSA 2XWJB 4JPBW 1QNKA 3R8BA 4LF6Q 1U0LA 1JE4A 3BVGA 4JI3L 3TRZA 2F1MA 4DAYA 2B2VC 4KV6A 1Q90A 5BN3A 2UXBQ 1AH9A 1VMCA 4KY6A 3JAML 2OCEA 1QWYA 5E3FA 1F2LA 3PIPA 3S1QB 4EQNA 2A19A 1FYCA 3CCVA 1QVCA 1STGA 4GOPA 1QUQA 1HNZQ 1SYEA 3KOJA 3S2HH 3NEMA 2F0QA 1B53A 3JC66 1RKNA 2VB2X 5IT9E 1SNOA 1KDCA 3F2UA 5KGUA 2F4IA 1FJGL 4DV4Q 4HIMA 2OEOA 2Z6BA 3MXNB 1JQYD 4MTNA 3MC0B 1STYA 2E74C 1U5KA 3H3VC 4QMGA 5C0XJ 3UDGA 1V1PA 3R2TA 2PI2A 1XWEA 3KLSX 4AYBE 2WB1E 1L1OC 2E5LL 2PQEA 4L5RC 1RODA 3D3RA 1B2TA 4H44C 3DXJC 2ALYB 1YNNC 4WFN3 2VB3X 4DF7A 3K5LA 4O2DA 5A2QL 1LUZA 1JICA 1FGUA 3ERQA 4B3MQ 4LF4L 1JORA 1STNA 3GQBA 4DNRB 2F0UA 1YEZA 1EIHA 5CR3A 1F2YA 1VQOA 1DYQA 4C3IG 3RZDB 4FF1A 4MN3A 4LFAQ 4A3KB 1U9RA 3DM3A 4C3IB 1K8GA 2TSSA 3AFPA 1STEA 1Q7YC 3J7YW 5JEAJ 4JI5Q 1GO3E 4GS3A 4N8X1 1K3RA 1BCPB 1IW7D 1M1KC 2E76C 2PQAA 1XNRL 5NUCA 1RDPD 5M5YH 1D7QA 2NBFA 4DUYL 2F0GA 4LFBL 4JI7Q 2BH2A 1B8AA 1KDAA 4OELB 3J80c 1SXTA 1VQBA 2UUBQ 2Q2TA 5FLXc 2VQEL 1NSNS 2VQFQ 1N33Q 1G291 3K7AH 1C48A 4OL7A 4GOPC 2UXDL 3GTPB 1AZQA 2PCFB 3GTKB 3TS0A 3I4MB 2C5CA 2XRQD 3A0JA 2VS1A 4C56C 2K05A 3NELA 2F52A 5IOCA 1ILPA 2K5QA 1DZ1A 2AWOA 2B2YA 3S2DB 1EWIA 1R4QB 5GQOA 1EFWA 4B3SL 1PHJA 1GUOA 2HQEA 4X62L 3EROA 1K83H 4IUVA 2RSOA 1SEBD 2CVRA 2D2CC 4IPDA 1AFPA 5J22A 1S40A 4OO1H 1EU3A 1EOTA 4JI8Q 1YNJD 1SE8A 2YTXA 1PRTF 3VR3A 2MPMA 4Q5VA 2F0IA 3TZUA 1WTQA 4KK7A 2Z8LA 4IN3A 3GTOB 1I50B 2B8GA 4ABNA 5ELCA 1I94Q 1K8AC 4ZAIA 1W2BA 1XMQL 1K28A 1WVLA 2K6AA 1N34Q 1VQIA 1X3PA 1RL2A 4BA2I 3A7LA 3CPFA 2JA7H 1KAWA 1B9MA 1B4OA 3QIAA 2QDLA 3OIQA 4IFDJ 1CSQA 5T1IA 2YU9B 3SK6A 4PZ8A 2E2HB 3VYUA 5D14A 3HOXH 4K5WA 2UUAL 4BY1H 3KF8B 4X3KA 4FXDA 5C4HA 2XSCA 4HCSA 4DU9A 3M7NA 3NBHB 5C44G 1NJIC 3C3LA 4BXXH 3UI2A 5FJ8G 1IHZA 3TP6A 1B1ZA 1SFOH 1JE5A 4C1NK 1KHIA 5E7NA 2RF4A 1VQMA 4HSVA 2RDFA 1LT5D 4B08A 1EYGA 3VR2A 1I5FA 2DJFC 4MIUA 5GROA 4YY3Q 1Q86C 1PTOH 4JBMA 1OO9B 1JT8A 5K36H 1JJCB 2KHSA 1PZJD 3UE1A 4DUZL 1STHA 2DNEA 1RJTA 3TDQA 5C4JB 5C4XB 2B2YC 2Q2UA 2H1EA 3SVMA 4DR3Q 1VCIA 2IHEA 5FLMG 2AQ3B 3OMGA 3F8TA 5DM63 5E4WC 4JBKA 4DR6Q 1F2MA 1JWMD 2GA4B 3KJPA 1ESFA 3I90A 5JPMC 1XYIA 1EFID 1RIPA 1PXUA 2V4DA 2QDBA 2WP8J 4POGA 1K73C 1UE6A 2PW7A 2ZT9C 4TVAB 2UUCQ 1U4MA 2DN8A 3DEOA 2UXCQ 3P1HA 2KA7A 1BO0A 2K32A 2K28A 4IUUA 4GLVB 2K33A 5G3LD 1DOMA 2BE5C 1NMGA 2IJ0A 4DR5L 1EY4A 2ENBA 3KYHC 5EPJA 2ICEC 2XRSD 4IJLA 2E2JB 2ZTEA 3OTOL 4QUCA 2WV6D 1HUMA 1PTOC 2LFNA 1Z9FA 4K8IA 1G6ZA 4IO9A 4YWLA 4KN7C 1IBLL 4UP7A 4NP5A 4YHHQ 1O7IA 3K7UC 2F0MA 2NVQH 4AQYQ 4A3FH 2QILA 4KI0A 1GUSA 3HG9A 5T1GA 5LMNL 4A3LG 2WB1G 3CC2A 5M3MH 1PVOA 1UE7A 4K2LA 3H6MA 2J7ZA 4H7BA 3C1FA 4LF7L 4Z9CB 3PMFA 3M3YB 2F03A 1G6PA 1NNXA 4IQZA 4U68A 3Q23A 1B44D 1SN8A 3GTQH 1TS3A 4UY8C 3NENA 1PMRA 3K80C 2JN4A 2R61A 1I4HA 3ULLA 2AHOB 5IWAQ 4DV6L 4A3IH 3QR8A 3TMEA 1E3PA 3F2DA 4OIJA 4RGOS 1C9OA 4ID6A 2PMZE 1NCVA 2KQ3A 3TP7A 3S16H 1DOLA 2ZJRA 5M9OA 3KLSA 1AE2A 4LF5Q 3KJOA 2VUMB 4X66Q 1JR0D 4B3RQ 3M7GA 2RDHA 3HKSA 4RFBA 4CDDC 5AJ3Q 2ZTCA 2KCTA 1HFGA 2WACA 4X65Q 3IFDA 3GV6A 4V0BA 2PO4A 4M8AA 1BNZA 2EJGC 4P71A 2E2IH 1I3QB 4A3MG 4WJ3M 1UE5A 4POFA 1LLRD 5IYCH 4A3MB 3E6ZX 2I07B 1Z6HA 3A5ZB 2R93H 1FNWA 4LWCA 3SR1A 1TWGB 3ONAB 1EEID 1Y1WG 1CTMA 3DMUA 3C2PA 4DA2A 3OSOA 1EWCA 1Y1WB 1TQOA 4C3JH 2KUMA 5IP9G 5EQ0A 1PFMA 3CPWA 4A3DG 4C3HG 4A3DB 3HOVG 4MNOA 2NUCA 5GAEC 3VYRA 3IFTA 3KLWA 3HOVB 2EXZA 2MQHA 2VY3A 2EJFC 1U4LA 5C5LA 1HNXL 4A3GH 1XPOA 1X65A 3E0JA 2M2LA 4FO2A 5C0XG 5C6AA 1YJNA 1GOZA 5JJZA 2NZOA 3PO2H 1MHWC 2JA8G 1WCMG 2BA0A 3G7LA 4P73A 1H9MA 5E1FA 4MHEA 1JWSD 3D0FA 2SDFA 4HSPA 4JI2Q 3RN5A 2SEBD 2JA8B 1EEFD 1WCMB 2K5VA 4IUPA 5IYDG 4WRDA 1SYCA 4DXFA 1ONLA 1LTTD 1TWAB 4QB4A 2VW9A 1KAAA 2L9HA 3RR5A 3EFXD 2H4OA 5ELNA 1A0IA 4KHVA 3PF5A 1TWHH 4KY7A 1H95A 4LFCQ 2JSOA 3W2DA 4KKUA 3HZXA 3STBC 3U4VA 1X3GA 2RA4A 1QCBD 3HRZC 4P74A 1TY2A 1KLGD 4DR2Q 4DNIA 4GNXC 3HOZG 2F0KA 1I94L 1T5XD 4AH6A 4CHTB 1ENAA 3K59A 1WTRA 3PUWA 5KIXA 1JJ2A 1O7YA 1MSGA 1A2UA 4GN5A 5JEAG 1TS4A 2PZTA 1V9PA 2NN6G 3PUVA 2N55A 1D5XC 1MKHA 2YV5A 5I6YA 3BU2A 1DJRD 2D5DA 4R8IA 4DV7Q 1B50A 3F2BA 2HHHL 4LUZA 2RSNA 3S14H 1Y8PB 1Y1VG 4F7XA 3U9SA 1IYVA 2WFWA 1TWCH 3JAME 4RGMA 4B9XA 1Y1VB 1AE3A 1DCZA 4J15A 3DUZA 3I4LA 5EPKA 1C0AA 1Y69U 5E4XA 3PCOB 3KF6A 3MXNA 2OQKA 3PV0A 1RF2D 1BXTA 2F0WA 2JA5G 3DEPA 3BVMA 1MIUA 3B6YA 3PGZA 3S1QH 3T1HQ 2CKZB 3CP0A 4OEMB 3MFGA 1RTNA 1YIJA 3JAMi 2DY8A 3EN2A 1WTOA 4XT3B 1WTPA 4L8JA 2OF1A 3CHBD 4U673 2PW5A 4CDFC 1TT2A 1N36Q 3I7FA 2KCNA 4NXNQ 3H0GH 1LTGD 2NZ1D 5CYUA 1X3QA 3P75A 3HOYG 3BYYB 2A68C 5ELBA 1ICWA 4KHPQ 1GUWA 1KDBA 1BF4A 1ICFB 2QF7A 4G7ZC 2B39A 4BY7G 4TSSA 5JPNC 3SK8A 1IBKL 2B8FA 5A2QE 4BY7B 3CW2C 3H91A 5LMNW 4KN4C 4G57A 3FKIG 5ELOA 1PTOF 1STAA 5C4ZA 2MO1A 1CA5A 2I5MX 2WINB 3MTSA 5IY0A 1HR0Q 4AIMA 3BJUA 4MTKA 2FXQA 2L55A 2EYHA 2RVLA 5JVH3 1SMXA 1X56A 2XN9C 3U9OA 1IKMA 1SMYC 2EYFA 4CJ1B 1DOKA 3RZDH 3C46A 3GTJB 1EUJA 1CSPA 1GKHA 3K58A 2IHFA 3FVQA 4A3KH 3D4DA 4C3IH 4A93G 1TWFB 1F9QA 5LHY1 3HOUG 3OWEB 3CC4A 1CKMA 5EAYA 5J3BA 1XNQQ 4BBRB 4A93B 2RCNA 3HOUB 1OXTA 4GLAC 4DV1Q 4YHHL 3J7AF 1LO5D 4IJHA 4XQNA 1S3OA 2ZXRA 3TQYA 1ZYRC 3WOFA 3ZJYC 4DV0L 4GKJQ 1J6QA 1WI5A 2E75C 4CBVA 1IZ6A 4L5QA 2PYKA 1XPUA 3PUYA 4QUFA 4L5SA 4FYDA 4FDBA 2LS01 2M9VA 2X6GA 4IZ8A 2YTVA 1X6OA 2PI2E 2V1CC 1OXSC 4ZKCB 1KTKA 3P20A 4O0AA 3GTPH 4DV5Q 1DXMA 2EVBA 3K6OA 3GTKH 1NR4A 5LMUQ 4UHVA 4DK6C 3I4MH 4P72A 2L5TA 1PRTB 1H9JA 1GD7A 1Q1BA 5IWAL 4RHSA 1G2TA 5DNFA 4F8MA 2K52A 2VXWA 2C9OA 1MJCA 3IAYA 5CMDA 5L37A 3AU7A 3S2DH 4EGVA 5KRUA 4ZK9B 4DN4M 3ZYYX 1SNCA 2HUGA 5IYBG 2VL6A 4CGYB 2PZWA 3RZOB 4LF5L 1IYJB 4HN7A 4XQJA 1HFNA 2CHBD 2MFIA 4B3TQ 3G6EA 4FXGC 1ZXTA 5DEHA 2ASBA 4JI1Q 1JOQA 4WJWA 4CKBA 1OXVA 5C3EG 5BN4A 1I50H 3GTOH 4X65L 2NB0A 1A2TA 1UUPA 2XVSA 3I73A 2PZUA 2F0HA 5C3EB 3S1RB 1QOHA 3TN2A 1VQPA 4LF8Q 4C1NI 1EZ6A 1VQCA 4JI6Q 4A3BG 3LNNA 1CFMA 1D1KA 1TKWB 1VQ9A 5GAGC 4FP5D 2AWNA 1SRUA 2CWPA 3NHHA 1W6KA 1KL9A 4QGUA 1A8VA 4IPGA 2HT1A 5C0XI 2QGQA 4X3UA 1CI3M 3NP8A 2EYLA 1I4XA 3I8ZA 4A3CH 3C1EA 1MJEA 1QNUA 2YU9H 3EBEA 4LUVA 1K0RA 2E2HH 3KFUA 5I6WA 1HQMC 4BBSG 5LL6X 5EJWA 4M1UB 2G5DA 3M4QA 3M4OB 4BBSB 3NE5B 1ET6A 1HTPA 2NZHA 4CJ0B 4IOAA 2F0OA 3OW2A 5KYIA 4A3EG 3TBIB 1R4PB 5FJ8H 4JV5Q 5HGQA 3E0EA 1ASYA 4DR1L 3BG3A 3K0YA 5F2DA 1OTCA 3ICEA 4B9WA 5HGTA 4DXGA 3L2PA 2AUKA 3R3OA 1V43A 3HOWG 1EY6A 3K5OA 1RTOA 4RCNA 3T1YL 4NXMQ 5IODA 2CWAA 3BDOA 2AMCB 3R2IA 1Q8KA 1VMPA 4PG3A 5CC4A 1GVPA 5C4XH 5C4JH 3HOWB 1R9TB 1LT4D 2XNAC 1PRTD 3G48A 1YI2A 4JYAQ 3U58A 4N9PA 4FVMA 4RG1A 3NQIA 2F0DA 3NWSA 2QCPX 3IKJA 1J5EL 2L15A 4CKCA 3NQTA 1I4GA 4PMCA 5FLMH 1EY9A 1EL0A 3ERSX 1Y8NB 2O5IC 3NTHA 1SNPA 1XX8A 4V190 4N9TA 4S3SA 5CORA 1SE3A 2I5LX 5D3DA 5K5PA 2GVBA 3A55A 5M3FG 2HIVA 3CCLA 1BBUA 5ELDA 1NR2A 4KMUC 4JI0Q 3Q6SA 4A76A 1SMYD 1L1OB 4HMJA 3TEHB 3CCMA 1D8LA 4RKLA 5M3FB 4H02A 5ELEA 3KBGA 2E2JH 3HKZG 4OWWB 1I4PA 3PQIA 2ZXPA 3A8JE 3HKZB 4XYOA 3E5SA 2XTIA 4RWSC 1JCKB 1PH8A 1KNEA 4DR4Q 1SYDA 4DPGA 1U4PA 2YYZA 4X64Q 3MXUA 3GTGB 3E9HA 2AUJD 2MUYA 3D4WA 4NMZA 1K3BC 1CZGA 1NE3A 1HA5A 3E9IA 4YWKA 2YTYA 4GKKQ 4A3LH 2MO0A 4PV1C 2A6HC 1M8AA 5H1SE 4DV3Q 3M3YH 5GAHC 2XGTA 4JI4L 4IFDI 1EOVA 1ET9A 2WKCA 4K5VA 5JAVA 2L0CA 1IBMQ 4QL5A 5BR8L 2A1AA 1MBYA 3NUCA 3U50C 4LF9Q 4GOPB 1QUQB 3N6RA 1YVCA 3TP5A 3V96A 5C44B 3I4NG 1A3VA 3OOCA 1SYFA 1NY4A 4FXKC 1HNWQ 2KHIA 3I4NB 2VUMH 1SJED 3H94A 2A69C 4P75A 4F88A 1KRTA 3HEJA 4RKBA 1JB7A 3TREA 1EU4A 2HDLA 4CJ2C 2Y0SE 3ND8A 5ISRA 1CT1D 4HTHA 1E2ZA 4HR7B 3AEVA 3I2ZA 2WIIB 3VR6A 2H5XA 1V1PB 3CC7A 5JOBA 2F4VQ 4L6TB 1WTVA 1I3QH 1XNQL 1UNSA 2NWGA 1VQJA 1XMOL 4A3MH 3WWVA 2LKVA 4ZUIA 2UU9Q 1QVGA 1TWGH 4NB3A 1A15A 2NVYB 1YNND 3FP9A 5CV7A 2OXPA 3BYTB 5IP9H 4A3DH 4YIJA 2F0EA 3GTLB 1HZCA 1P16A 2KVMA 4HMIA 3HOVH 3OYYA 1O80A 3CXCA 3ND9A 4LF6L 1SYBA 1VQAA 3WOEA 2Q2IA 2F0FA 2UXBL 2Z4HA 4JOIA 1L0YB 4KD3A 5C0XH 2PQAB 2D0OA 1PFNA 4BA1I 1WCMH 1LTLA 3EA6A 2MNAA 3M85A 2WAQE 1DONA 3J81L 1TWAH 1HNZL 3L3OC 1K83B 4K0KQ 2F3VA 5IYDH 1SJHD 3CQZB 1T9HA 4QIWE 4AYBG 3FPUB 2Q8RE 1B3AA 2JA6G 2KENA 2FINB 4K6DA 4AYBB 4GN4B 2WB1B 4XIGS 4DV4L 2JA6B 1QJOA 2XWBB 1S72A 5DLQE 3UDFA 1QE6A 2I0QA 1P8LA 4QJFA 3QWNA 2JA7G 5JEAH 2Q2HA 3JAMc 1PFSA 3MXGA 2EZVA 2NVTB 3RD4A 3MVVA 3AFQA 4UAIA 1Q12A 1C4QA 3HS0C 2DGYA 4RA8A 3RNUA 3KDFA 4RMFA 1Y1VH 5I2XA 3BS1A 3K0XA 1V1QA 1QB5D 2AQ2B 2F3IA 3H09A 4B3ML 4XQQA 1S5BD 3K57A 1PH5A 4MZ9A 1E2WA 2CW0C 1IYUA 3T4AC 4JI3Q 4BXXG 2JA9A 4JBJA 5IGDA 1RD9D 5J39A 5EGTA 3UDXA 1GUGA 2QEXA 4F87A 4LFAL 5EKKA 3CAMA 2J4XA 3OW7A 1KQSA 3OWFA 2R7FA 4JI5L 2IL8A 4ZQ3A 2FJ2A 3A5UA 4ME3A 1L0XB 3KUPA 3SGIA 4LUOA 1YNXA 4DK0A 3W3AA 1HUNA 4IUTA 3ITPA 2RDGA 2EYJA 3ULPA 2EY1A 1LTRD 2F0SA 1PYBA 4JI7L 4JOIC 1CKNA 3FDTA 3PO3G 1X55A 1FJGQ 4OWXB 4JG2A 2UUBL 2Z6KA 3PO3B 2Z9HA 2VQFL 1N33L 2NTSA 4C3HB 2FMMA 3HGBA 5TSSA 3ER0A 4BWGB 4BY7H 2A6EC 3VYTA 1H9SB 1B3QA 3MAQA 1SLJA 1B9NA 5CBEE 5CV6A 1SE4A 2LXJA 1SAPA 3I70A 1HZ9A 1L2FA 2E5LQ 3CRKC 2EY6A 2K5WA 4DK1A 4OX9Q 1U4RA 3I3CA 3GD7A 2A69D 3HP3A 2ID0A 3J80L
chains in the Genus database with same CATH topology
2IX0A 3CC4A 2BH2A 1B8AA 1CKMA 5EAYA 4LF4Q 5J3BA 1UWVA 2JJQA 1XNQQ 1QZHA 4R4TA 2UUBQ 2RCNA 3J80c 1VQBA 4UP9A 2Q2TA 1HJPA 1OXTA 5FLXc 4GLAC 2VQEL 1PYSB 4DV1Q 4YHHL 1PH6A 2VQFQ 4JI8L 1N33Q 1G291 3K7AH 4IJHA 3GTJH 4GOPC 1S3OA 3TQYA 3ZJYC 4DV0L 4GKJQ 1J6QA 1WI5A 2JA8H 2N78A 3TS0A 1IZ6A 4L5QA 4HIKA 3A0JA 4IPCA 1XPUA 3PUYA 4L5SA 2VS1A 3F2CA 4FDBA 1E24A 4OO1G 2IY5B 3NELA 2F52A 4BBRH 4A93H 2YTVA 4X64L 3HOUH 1PH4A 1X6OA 2BA1A 2PI2E 2V1CC 1OXSC 2ZJQA 3J80i 1N34L 4A3FG 3GTMH 2IT1A 2AWOA 4O0AA 3I56A 1N32Q 4B3TL 4DV5Q 5IP7G 1VQ4A 1KD1C 1EWIA 2GVAA 3GTPH 5GQOA 1VQNA 4JI1L 1EFWA 3GTKH 3PSIA 1WYDA 2JQOA 5LMUQ 4DK6C 3I4MH 4P72A 4B3SL 4R1JA 4HJ5A 1PHJA 1GD7A 1Q1BA 1VQEA 1K83H 5M5WH 5IWAL 4X62L 3VDYA 1JMCA 1VQ8A 1VQKA 2EXDA 3HOZH 4IPDA 4X6AH 1S40A 4LF8L 2K52A 2VQEQ 1MJCA 4JI6L 2N8NA 3BZCA 4JI8Q 3S2DH 2UXDQ 4QY7A 2DUDA 1SE8A 4EQ5A 4DV0Q 2YTXA 1VQLA 4DR7Q 2K5HA 5IP7H 4DV2Q 1YHAA 3RLNA 4Y7NH 3GDEA 1UEBA 5IYBG 2VL6A 1I94Q 4LF5L 1IYJB 1K8AC 4LF9L 1W2BA 1XMQL 3S1NH 1N34Q 1VQIA 1RL2A 2MFIA 3HOXG 4B3TQ 4BA2I 4BY1G 3G6EA 2Z6KC 4JI1Q 4HJ7A 2ASBA 2C35B 1ASZA 5JJIA 3CPFA 2JA7H 1WOCA 1OXVA 1KAWA 5IT9c 5C3EG 4B3SQ 1I50H 3IRBA 1PA6A 3GTOH 1FVIA 4X65L 3RZOH 4X62Q 3UE0A 2N3SA 2KHJA 4YY3L 3CCEA 3CCSA 1VQ5A 4IFDJ 1FL0A 1OXUA 3PUXA 1VQPA 1CSQA 1EIYB 3M3YH 4LF8Q 1VQCA 4PZ8A 4JI6Q 4A3BG 1VQ9A 1VQHA 1NBWA 1WFQA 5GAGC 2AWNA 2JA5H 1SRUA 2CWPA 4JV5L 4GNXA 3HOXH 1KL9A 2UUAL 4KHZA 4QGUA 1A8VA 4IPGA 2HT1A 4DR3L 4BY1H 3KF8B 5C0XI 3GO5A 2QGQA 2VUMG 3TS2A 1PH1A 2EIFA 5C3EH 5K36G 3S1RH 3M7NA 4A3CH 1XMQQ 3NBHB 1CKOA 2OWOA 2K14A 5IYCG 5C44G 1MJEA 2YU9H 1VQ6A 4DR6L 1NJIC 4NXML 3EBEA 4LUVA 5FJ8G 1K0RA 4BXXH 3H3VI 2E2HH 1SFOH 1JE5A 3KFUA 3BZKA 1KHIA 1OXXK 5E7NA 4GNXB 4HJ9A 4JYAL 1LM0A 1Z47A 2RF4A 3DLLA 4BBSG 1VQMA 3M4QA 1EYGA 2UUCL 1I5FA 5GROA 2RHQB 5HY6A 4YY3Q 3L0OA 2QA4A 3UDIA 1Q86C 4L5TA 2NZHA 3W1BA 4JBMA 3HOYH 1JT8A 4JC0A 3W1GA 4IOAA 1JJCB 3UE1A 1DGSA 3CCQA 4DUZL 3OW2A 4A3EG 3RLOA 4YWMA 5FJ8H 4JV5Q 1BVSA 5HGQA 1YBYA 2VZAA 2Q2UA 2UUAQ 3E0EA 4DR3Q 1ASYA 4DR1L 3ICEA 1VCIA 1OTCA 2IHEA 5FLMG 1PH7A 3L2PA 3M4OH 4BBSH 3FKIH 3F8TA 1V43A 4JBKA 3HOWG 1BBWA 4DR6Q 2K50A 3T1YL 4NXMQ 2CWAA 3I55A 3KJPA 2AMCB 1Q8KA 4PG3A 5C4JH 1GVPA 5C4XH 4JI0L 5JJLA 3G48A 1YI2A 4JYAQ 1N9WA 1RIPA 3U58A 2WP8J 4RG1A 4POGA 1K73C 4PZ6A 1UE6A 4TVAB 4C2MH 2UUCQ 2UXCQ 1J5EL 2L15A 4K0KL 2D62A 5FLMH 2KCMA 3ERSX 3U4ZA 1UE1A 4AQYL 4GLVB 3HOWH 3FHWA 4HJ8A 1R9TH 1EQQA 1TWFH 4PZ7A 1X3FA 1NMGA 1HR0W 4DR5L 4DR1Q 4DR4L 3KYHC 2I5LX 1WJJA 4IJLA 3S15H 2GVBA 3T1YQ 1NMFA 4Y52H 1XNRQ 1NTGA 2ZTEA 3OTOL 5M3MG 2VNUD 2JEBI 5M3FG 2HIVA 4DUYQ 3CCLA 1BBUA 4HJAA 4LFBQ 1Z9FA 4JI0Q 4GKKL 4A76A 1L1OB 3TEHB 3CCMA 1D8LA 4YWLA 4IO9A 2N49A 4H02A 1YHQA 4DV3L 1JJGA 1VQ7A 1IBLL 4UP7A 2RHSB 4DKAC 2UXDL 2E2JH 1J5EQ 4YHHQ 1O7IA 3K7UC 3HKZG 4TQUS 4OWWB 2NVQH 4AQYQ 4A3FH 4KI0A 2HQLA 2JK8A 4A3LG 5LMNL 2D0PA 1EIFA 4LW1A 2B63G 2WB1G 4A3IG 2ZM6L 3CC2A 2XTIA 5M3MH 1PVOA 1UE7A 1IBML 4OXPA 5M3FH 1VQGA 1XTDA 1YITA 3HFZB 4R4QA 4DR5Q 1PH8A 1YZ6A 4DR4Q 4R4OA 2Y0SG 4X66L 4DPGA 2YYZA 4X64Q 4LF7L 2R92G 4OWTB 4B3RL 1G6PA 4A93G 3E9HA 3STBD 3CCJA 1SN8A 1KXLA 3GTQH 3OTOQ 1NE3A 2Z0SA 3NENA 5AJ3L 4UY8C 3K80C 3E9IA 4YWKA 2YTYA 1EQRA 3ULLA 1HNWL 4GKKQ 1I6HH 4A3LH 2MO0A 2AHOB 5IWAQ 1GM5A 4DV6L 4UP8A 4A3IH 2CCZA 1W3SA 2B63H 3RLFA 3GTGH 3K81C 3I4OA 5H1SE 1E3PA 5IYBH 4DV3Q 3LGJA 5GAHC 2XGTA 3G4SA 3F2DA 4HIOA 2PNHA 3W5OA 4DAMA 1C7YA 1IBLQ 2NVXH 1EOVA 4IFDI 2GN5A 1C9OA 2R92H 2EQSA 2PMZE 3L7ZC 2UXCL 3PF4A 5LMNQ 3S16H 2ZJRA 3H0GG 1AE2A 3ULJA 1IBMQ 4QL5A 4EX5A 5BR8L 1Q81C 2A1AA 4A3BH 3M4PA 4LF5Q 3KJOA 3U50C 4LF9Q 4X66Q 2F4VL 1Q1EA 4LF7Q 4GOPB 3RN2A 1QUQB 4B3RQ 4QQBX 1YVCA 3KF6B 2R93G 4DK3C 2UU9L 1Q82C 2K5NA 3HKSA 4GLXA 3KDFB 3CCUA 3D31A 5AJ3Q 3I4NG 2ATWA 1VQDA 2ZTCA 1NY4A 2KCTA 1HNWQ 2JE6I 3HKZE 4X65Q 2KHIA 3MEFA 1KIXA 2JEAI 2VUMH 4DV6Q 1YJ9A 4P75A 4P71A 2E2IH 4A3MG 2ES2A 4JI4Q 1KRTA 4WJ3M 3CF5A 1UE5A 2K4KA 1JB7A 4POFA 3TREA 4UPAA 5C44H 5IYCH 2WAQG 4HIDA 1Q46A 4OO1I 2Y0SE 3A5ZB 2R93H 4LWCA 4OX9L 4JI2L 4A75A 4IOCA 1Y1WG 4A3GG 3AEVA 3I4NH 2A8VA 3K8AA 3I2ZA 1E1OA 2H5XA 5BR8Q 4A4IA 3CC7A 1K9MC 1IL2A 2F4VQ 1I3QH 4C3JH 1XNQL 2NN6I 5IP9G 2K75A 3CPWA 1PH3A 1KRSA 4XTCS 3PO2G 1VQJA 4A3DG 1L0WA 1XMOL 4LFCL 4A3MH 3WWVA 4A3KG 2UU9Q 2KBNA 3M9BA 1QVGA 1TWGH 3HOVG 4MNOA 4NB3A 4A3EH 2OTLA 1VQFA 2BH8A 5GAEC 1HZBA 4IFDG 4DR2L 3PIOA 3KLWA 5M5XH 3S17H 2VY3A 2MQHA 1CKNB 1HNXL 4A3GH 1XPOA 1X65A 3FP9A 2HIXA 3AYHB 2B29A 5C0XG 1B70B 1YJNA 4DUZQ 1N32L 1HZAA 1Y14B 2I5HA 2NZOA 5IP9H 3G71A 4A3JG 2JA8G 1WCMG 2BA0A 3PO2H 4A3DH 4P73A 1HZCA 3AQQA 3D0FA 4JI2Q 3RN5A 1L1OA 1HH2P 2K5VA 1P16A 4BBRG 2NVYH 3HOVH 5IYDG 3EIVA 1A62A 3OYYA 3Q8DA 3CXCA 3CD6A 1YHBA 4JCVE 4LF6L 1VQAA 2ZTDA 4DV7L 2VW9A 2R7ZG 2Q2IA 3RR5A 5ELNA 3PF5A 1A0IA 1H95A 1TWHH 2E8GA 2UXBL 1BKBA 1XMOQ 4LFCQ 4JOIA 4YCUA 2IX1A 4OONA 2PQAB 2D0OA 3I4MG 3GTLH 4DR7L 3J7ZC 4BA1I 3STBC 3U4VA 3J7A5 1X3GA 4A3JH 5JJKA 1WCMH 4P74A 1LTLA 4APVA 4DV2L 4DR2Q 4DNIA 2MNAA 3M85A 2WAQE 4GNXC 3HOZG 1I94L 1TWAH 1HNZL 1HNXQ 4AH6A 1PH2A 3H3VH 3S1MH 4K0KQ 4R4IA 5IYDH 1X3EA 2CFMA 3J81c 4JBWA 4R4CA 1T9HA 3PUWA 4QIWE 2R7ZH 3H15A 4AYBG 4ALPA 1XPRA 1X9NA 5JEAG 1JJ2A 4GN5A 1IXRA 3T1HL 1XJVA 2JA6G 2KENA 1E1TA 1V9PA 1SR3A 1X54A 2NN6G 2R6GA 1SROA 4GN4B 2R7DA 3PUVA 1B7YB 4XIGS 4DV4L 2LXKA 1MKHA 2LSSA 2YV5A 3BU2A 1S72A 4LF6Q 4DV7Q 1U0LA 3TRZA 4JI3L 1G51A 3F2BA 5DLQE 3UDFA 3CCRA 3CQZH 1YJWA 2HHHL 3J81i 4LUZA 2I0QA 1P8LA 3S14H 4QJFA 1Y1VG 2UXBQ 1AH9A 2JA7G 2WFWA 1TWCH 3CMEA 2OCEA 3PIPA 1N36L 4WJ4A 4GN3B 2A19A 3J81j 2Q2HA 4NXNL 1AE3A 3JAMc 4J15A 3CCVA 1KC8C 1QVCA 2JA6H 1PFSA 1A63A 1C0AA 4GOPA 1QUQA 3AFQA 1HNZQ 4JI4L 1Q12A 3PCOB 3KOJA 3S2HH 3NEMA 3KF6A 2OQ0A 1N8RC 2OQKA 4KHPL 3PV0A 4DAYB 3JC66 2DGYA 3RNUA 4IPHA 2JA5G 3KDFA 4RMFA 1MIUA 3B6YA 3PGZA 3S1QH 2ZM6Q 3T1HQ 1Y1VH 3K0XA 2CKZB 2OTJA 1V1QA 3CP0A 1YIJA 4LNQA 2F3IA 3JAMi 4B3ML 4YCVA 1FJGL 2NVTH 4DV4Q 4HIMA 4A3CG 1E22A 1PH5A 3EN2A 4MZ9A 4BXXG 3A74A 3MXNB 4JI3Q 2HHHQ 2ZJPA 4KLKA 4MTNA 2JA9A 4JBJA 1HR0L 1U5KA 3UDXA 5GADC 2QEXA 4LFAL 3CAMA 2CQOA 3I7FA 1N36Q 5C0XJ 1CUKA 3UDGA 4NXNQ 1KQSA 3H0GH 2PI2A 2R7FA 4AYBE 3PUZA 3HOYG 4YCWA 4JI5L 2WB1E 3A5UA 1L1OC 4ME3A 3SGIA 2E5LL 3S24A 4LUOA 4L5RC 1YNXA 4KHPQ 1QVFA 1QZGA 4PMWA 4BY7G 2ALYB 1IBKL 3ULPA 4NPSA 1PYBA 4O2DA 1LUZA 3CW2C 4JI7L 4JOIC 1CKNA 5LMNW 1FGUA 4B3MQ 1X55A 4LF4L 3FKIG 1FJGQ 5ELOA 4OWXB 3PO3G 1E7ZA 4JG2A 2UUBL 2MO1A 1YEZA 1PV4A 2I5MX 3F1ZA 1M90C 2Z6KA 4DV1L 5IY0A 1VQOA 2VQFL 1N33L 5C4XG 4GKJL 1HR0Q 4AIMA 3BJUA 2FXQA 4LFAQ 3ER0A 1VS0A 3DM3A 1SMXA 4BY7H 1X56A 1K8GA 1LYLA 1Y1WH 3CMAA 1SLJA 3AFPA 1Q7YC 5JEAJ 4JI5Q 1PH9A 2LXJA 3PO3H 1GO3E 1HZ9A 1L2FA 4GS3A 2E5LQ 1K3RA 1TXYA 1M1KC 4DV5L 4C3HH 3RZDH 1XNRL 2B3GA 2PQAA 1EUJA 1CSPA 1GKHA 5M5YH 4OX9Q 5LMUL 3GD7A 2IHFA 4A3KH 1IBKQ 1D7QA 4DUYL 4C3IH 5IE8A 4LFBL 2AKWB 3HOUG 2ID0A 4JI7Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IX0 A;  3CC4 A;  2BH2 A;  1B8A A;  1CKM A;  5EAY A;  4LF4 Q;  5J3B A;  1UWV A;  2JJQ A;  1XNQ Q;  1QZH A;  4R4T A;  2UUB Q;  2RCN A;  3J80 c;  1VQB A;  4UP9 A;  2Q2T A;  1HJP A;  1OXT A;  5FLX c;  4GLA C;  2VQE L;  1PYS B;  4DV1 Q;  4YHH L;  1PH6 A;  2VQF Q;  4JI8 L;  1N33 Q;  1G29 1;  3K7A H;  4IJH A;  3GTJ H;  4GOP C;  1S3O A;  3TQY A;  3ZJY C;  4DV0 L;  4GKJ Q;  1J6Q A;  1WI5 A;  2JA8 H;  2N78 A;  3TS0 A;  1IZ6 A;  4L5Q A;  4HIK A;  3A0J A;  4IPC A;  1XPU A;  3PUY A;  4L5S A;  2VS1 A;  3F2C A;  4FDB A;  1E24 A;  4OO1 G;  2IY5 B;  3NEL A;  2F52 A;  4BBR H;  4A93 H;  2YTV A;  4X64 L;  3HOU H;  1PH4 A;  1X6O A;  2BA1 A;  2PI2 E;  2V1C C;  1OXS C;  2ZJQ A;  3J80 i;  1N34 L;  4A3F G;  3GTM H;  2IT1 A;  2AWO A;  4O0A A;  3I56 A;  1N32 Q;  4B3T L;  4DV5 Q;  5IP7 G;  1VQ4 A;  1KD1 C;  1EWI A;  2GVA A;  3GTP H;  5GQO A;  1VQN A;  4JI1 L;  1EFW A;  3GTK H;  3PSI A;  1WYD A;  2JQO A;  5LMU Q;  4DK6 C;  3I4M H;  4P72 A;  4B3S L;  4R1J A;  4HJ5 A;  1PHJ A;  1GD7 A;  1Q1B A;  1VQE A;  1K83 H;  5M5W H;  5IWA L;  4X62 L;  3VDY A;  1JMC A;  1VQ8 A;  1VQK A;  2EXD A;  3HOZ H;  4IPD A;  4X6A H;  1S40 A;  4LF8 L;  2K52 A;  2VQE Q;  1MJC A;  4JI6 L;  2N8N A;  3BZC A;  4JI8 Q;  3S2D H;  2UXD Q;  4QY7 A;  2DUD A;  1SE8 A;  4EQ5 A;  4DV0 Q;  2YTX A;  1VQL A;  4DR7 Q;  2K5H A;  5IP7 H;  4DV2 Q;  1YHA A;  3RLN A;  4Y7N H;  3GDE A;  1UEB A;  5IYB G;  2VL6 A;  1I94 Q;  4LF5 L;  1IYJ B;  1K8A C;  4LF9 L;  1W2B A;  1XMQ L;  3S1N H;  1N34 Q;  1VQI A;  1RL2 A;  2MFI A;  3HOX G;  4B3T Q;  4BA2 I;  4BY1 G;  3G6E A;  2Z6K C;  4JI1 Q;  4HJ7 A;  2ASB A;  2C35 B;  1ASZ A;  5JJI A;  3CPF A;  2JA7 H;  1WOC A;  1OXV A;  1KAW A;  5IT9 c;  5C3E G;  4B3S Q;  1I50 H;  3IRB A;  1PA6 A;  3GTO H;  1FVI A;  4X65 L;  3RZO H;  4X62 Q;  3UE0 A;  2N3S A;  2KHJ A;  4YY3 L;  3CCE A;  3CCS A;  1VQ5 A;  4IFD J;  1FL0 A;  1OXU A;  3PUX A;  1VQP A;  1CSQ A;  1EIY B;  3M3Y H;  4LF8 Q;  1VQC A;  4PZ8 A;  4JI6 Q;  4A3B G;  1VQ9 A;  1VQH A;  1NBW A;  1WFQ A;  5GAG C;  2AWN A;  2JA5 H;  1SRU A;  2CWP A;  4JV5 L;  4GNX A;  3HOX H;  1KL9 A;  2UUA L;  4KHZ A;  4QGU A;  1A8V A;  4IPG A;  2HT1 A;  4DR3 L;  4BY1 H;  3KF8 B;  5C0X I;  3GO5 A;  2QGQ A;  2VUM G;  3TS2 A;  1PH1 A;  2EIF A;  5C3E H;  5K36 G;  3S1R H;  3M7N A;  4A3C H;  1XMQ Q;  3NBH B;  1CKO A;  2OWO A;  2K14 A;  5IYC G;  5C44 G;  1MJE A;  2YU9 H;  1VQ6 A;  4DR6 L;  1NJI C;  4NXM L;  3EBE A;  4LUV A;  5FJ8 G;  1K0R A;  4BXX H;  3H3V I;  2E2H H;  1SFO H;  1JE5 A;  3KFU A;  3BZK A;  1KHI A;  1OXX K;  5E7N A;  4GNX B;  4HJ9 A;  4JYA L;  1LM0 A;  1Z47 A;  2RF4 A;  3DLL A;  4BBS G;  1VQM A;  3M4Q A;  1EYG A;  2UUC L;  1I5F A;  5GRO A;  2RHQ B;  5HY6 A;  4YY3 Q;  3L0O A;  2QA4 A;  3UDI A;  1Q86 C;  4L5T A;  2NZH A;  3W1B A;  4JBM A;  3HOY H;  1JT8 A;  4JC0 A;  3W1G A;  4IOA A;  1JJC B;  3UE1 A;  1DGS A;  3CCQ A;  4DUZ L;  3OW2 A;  4A3E G;  3RLO A;  4YWM A;  5FJ8 H;  4JV5 Q;  1BVS A;  5HGQ A;  1YBY A;  2VZA A;  2Q2U A;  2UUA Q;  3E0E A;  4DR3 Q;  1ASY A;  4DR1 L;  3ICE A;  1VCI A;  1OTC A;  2IHE A;  5FLM G;  1PH7 A;  3L2P A;  3M4O H;  4BBS H;  3FKI H;  3F8T A;  1V43 A;  4JBK A;  3HOW G;  1BBW A;  4DR6 Q;  2K50 A;  3T1Y L;  4NXM Q;  2CWA A;  3I55 A;  3KJP A;  2AMC B;  1Q8K A;  4PG3 A;  5C4J H;  1GVP A;  5C4X H;  4JI0 L;  5JJL A;  3G48 A;  1YI2 A;  4JYA Q;  1N9W A;  1RIP A;  3U58 A;  2WP8 J;  4RG1 A;  4POG A;  1K73 C;  4PZ6 A;  1UE6 A;  4TVA B;  4C2M H;  2UUC Q;  2UXC Q;  1J5E L;  2L15 A;  4K0K L;  2D62 A;  5FLM H;  2KCM A;  3ERS X;  3U4Z A;  1UE1 A;  4AQY L;  4GLV B;  3HOW H;  3FHW A;  4HJ8 A;  1R9T H;  1EQQ A;  1TWF H;  4PZ7 A;  1X3F A;  1NMG A;  1HR0 W;  4DR5 L;  4DR1 Q;  4DR4 L;  3KYH C;  2I5L X;  1WJJ A;  4IJL A;  3S15 H;  2GVB A;  3T1Y Q;  1NMF A;  4Y52 H;  1XNR Q;  1NTG A;  2ZTE A;  3OTO L;  5M3M G;  2VNU D;  2JEB I;  5M3F G;  2HIV A;  4DUY Q;  3CCL A;  1BBU A;  4HJA A;  4LFB Q;  1Z9F A;  4JI0 Q;  4GKK L;  4A76 A;  1L1O B;  3TEH B;  3CCM A;  1D8L A;  4YWL A;  4IO9 A;  2N49 A;  4H02 A;  1YHQ A;  4DV3 L;  1JJG A;  1VQ7 A;  1IBL L;  4UP7 A;  2RHS B;  4DKA C;  2UXD L;  2E2J H;  1J5E Q;  4YHH Q;  1O7I A;  3K7U C;  3HKZ G;  4TQU S;  4OWW B;  2NVQ H;  4AQY Q;  4A3F H;  4KI0 A;  2HQL A;  2JK8 A;  4A3L G;  5LMN L;  2D0P A;  1EIF A;  4LW1 A;  2B63 G;  2WB1 G;  4A3I G;  2ZM6 L;  3CC2 A;  2XTI A;  5M3M H;  1PVO A;  1UE7 A;  1IBM L;  4OXP A;  5M3F H;  1VQG A;  1XTD A;  1YIT A;  3HFZ B;  4R4Q A;  4DR5 Q;  1PH8 A;  1YZ6 A;  4DR4 Q;  4R4O A;  2Y0S G;  4X66 L;  4DPG A;  2YYZ A;  4X64 Q;  4LF7 L;  2R92 G;  4OWT B;  4B3R L;  1G6P A;  4A93 G;  3E9H A;  3STB D;  3CCJ A;  1SN8 A;  1KXL A;  3GTQ H;  3OTO Q;  1NE3 A;  2Z0S A;  3NEN A;  5AJ3 L;  4UY8 C;  3K80 C;  3E9I A;  4YWK A;  2YTY A;  1EQR A;  3ULL A;  1HNW L;  4GKK Q;  1I6H H;  4A3L H;  2MO0 A;  2AHO B;  5IWA Q;  1GM5 A;  4DV6 L;  4UP8 A;  4A3I H;  2CCZ A;  1W3S A;  2B63 H;  3RLF A;  3GTG H;  3K81 C;  3I4O A;  5H1S E;  1E3P A;  5IYB H;  4DV3 Q;  3LGJ A;  5GAH C;  2XGT A;  3G4S A;  3F2D A;  4HIO A;  2PNH A;  3W5O A;  4DAM A;  1C7Y A;  1IBL Q;  2NVX H;  1EOV A;  4IFD I;  2GN5 A;  1C9O A;  2R92 H;  2EQS A;  2PMZ E;  3L7Z C;  2UXC L;  3PF4 A;  5LMN Q;  3S16 H;  2ZJR A;  3H0G G;  1AE2 A;  3ULJ A;  1IBM Q;  4QL5 A;  4EX5 A;  5BR8 L;  1Q81 C;  2A1A A;  4A3B H;  3M4P A;  4LF5 Q;  3KJO A;  3U50 C;  4LF9 Q;  4X66 Q;  2F4V L;  1Q1E A;  4LF7 Q;  4GOP B;  3RN2 A;  1QUQ B;  4B3R Q;  4QQB X;  1YVC A;  3KF6 B;  2R93 G;  4DK3 C;  2UU9 L;  1Q82 C;  2K5N A;  3HKS A;  4GLX A;  3KDF B;  3CCU A;  3D31 A;  5AJ3 Q;  3I4N G;  2ATW A;  1VQD A;  2ZTC A;  1NY4 A;  2KCT A;  1HNW Q;  2JE6 I;  3HKZ E;  4X65 Q;  2KHI A;  3MEF A;  1KIX A;  2JEA I;  2VUM H;  4DV6 Q;  1YJ9 A;  4P75 A;  4P71 A;  2E2I H;  4A3M G;  2ES2 A;  4JI4 Q;  1KRT A;  4WJ3 M;  3CF5 A;  1UE5 A;  2K4K A;  1JB7 A;  4POF A;  3TRE A;  4UPA A;  5C44 H;  5IYC H;  2WAQ G;  4HID A;  1Q46 A;  4OO1 I;  2Y0S E;  3A5Z B;  2R93 H;  4LWC A;  4OX9 L;  4JI2 L;  4A75 A;  4IOC A;  1Y1W G;  4A3G G;  3AEV A;  3I4N H;  2A8V A;  3K8A A;  3I2Z A;  1E1O A;  2H5X A;  5BR8 Q;  4A4I A;  3CC7 A;  1K9M C;  1IL2 A;  2F4V Q;  1I3Q H;  4C3J H;  1XNQ L;  2NN6 I;  5IP9 G;  2K75 A;  3CPW A;  1PH3 A;  1KRS A;  4XTC S;  3PO2 G;  1VQJ A;  4A3D G;  1L0W A;  1XMO L;  4LFC L;  4A3M H;  3WWV A;  4A3K G;  2UU9 Q;  2KBN A;  3M9B A;  1QVG A;  1TWG H;  3HOV G;  4MNO A;  4NB3 A;  4A3E H;  2OTL A;  1VQF A;  2BH8 A;  5GAE C;  1HZB A;  4IFD G;  4DR2 L;  3PIO A;  3KLW A;  5M5X H;  3S17 H;  2VY3 A;  2MQH A;  1CKN B;  1HNX L;  4A3G H;  1XPO A;  1X65 A;  3FP9 A;  2HIX A;  3AYH B;  2B29 A;  5C0X G;  1B70 B;  1YJN A;  4DUZ Q;  1N32 L;  1HZA A;  1Y14 B;  2I5H A;  2NZO A;  5IP9 H;  3G71 A;  4A3J G;  2JA8 G;  1WCM G;  2BA0 A;  3PO2 H;  4A3D H;  4P73 A;  1HZC A;  3AQQ A;  3D0F A;  4JI2 Q;  3RN5 A;  1L1O A;  1HH2 P;  2K5V A;  1P16 A;  4BBR G;  2NVY H;  3HOV H;  5IYD G;  3EIV A;  1A62 A;  3OYY A;  3Q8D A;  3CXC A;  3CD6 A;  1YHB A;  4JCV E;  4LF6 L;  1VQA A;  2ZTD A;  4DV7 L;  2VW9 A;  2R7Z G;  2Q2I A;  3RR5 A;  5ELN A;  3PF5 A;  1A0I A;  1H95 A;  1TWH H;  2E8G A;  2UXB L;  1BKB A;  1XMO Q;  4LFC Q;  4JOI A;  4YCU A;  2IX1 A;  4OON A;  2PQA B;  2D0O A;  3I4M G;  3GTL H;  4DR7 L;  3J7Z C;  4BA1 I;  3STB C;  3U4V A;  3J7A 5;  1X3G A;  4A3J H;  5JJK A;  1WCM H;  4P74 A;  1LTL A;  4APV A;  4DV2 L;  4DR2 Q;  4DNI A;  2MNA A;  3M85 A;  2WAQ E;  4GNX C;  3HOZ G;  1I94 L;  1TWA H;  1HNZ L;  1HNX Q;  4AH6 A;  1PH2 A;  3H3V H;  3S1M H;  4K0K Q;  4R4I A;  5IYD H;  1X3E A;  2CFM A;  3J81 c;  4JBW A;  4R4C A;  1T9H A;  3PUW A;  4QIW E;  2R7Z H;  3H15 A;  4AYB G;  4ALP A;  1XPR A;  1X9N A;  5JEA G;  1JJ2 A;  4GN5 A;  1IXR A;  3T1H L;  1XJV A;  2JA6 G;  2KEN A;  1E1T A;  1V9P A;  1SR3 A;  1X54 A;  2NN6 G;  2R6G A;  1SRO A;  4GN4 B;  2R7D A;  3PUV A;  1B7Y B;  4XIG S;  4DV4 L;  2LXK A;  1MKH A;  2LSS A;  2YV5 A;  3BU2 A;  1S72 A;  4LF6 Q;  4DV7 Q;  1U0L A;  3TRZ A;  4JI3 L;  1G51 A;  3F2B A;  5DLQ E;  3UDF A;  3CCR A;  3CQZ H;  1YJW A;  2HHH L;  3J81 i;  4LUZ A;  2I0Q A;  1P8L A;  3S14 H;  4QJF A;  1Y1V G;  2UXB Q;  1AH9 A;  2JA7 G;  2WFW A;  1TWC H;  3CME A;  2OCE A;  3PIP A;  1N36 L;  4WJ4 A;  4GN3 B;  2A19 A;  3J81 j;  2Q2H A;  4NXN L;  1AE3 A;  3JAM c;  4J15 A;  3CCV A;  1KC8 C;  1QVC A;  2JA6 H;  1PFS A;  1A63 A;  1C0A A;  4GOP A;  1QUQ A;  3AFQ A;  1HNZ Q;  4JI4 L;  1Q12 A;  3PCO B;  3KOJ A;  3S2H H;  3NEM A;  3KF6 A;  2OQ0 A;  1N8R C;  2OQK A;  4KHP L;  3PV0 A;  4DAY B;  3JC6 6;  2DGY A;  3RNU A;  4IPH A;  2JA5 G;  3KDF A;  4RMF A;  1MIU A;  3B6Y A;  3PGZ A;  3S1Q H;  2ZM6 Q;  3T1H Q;  1Y1V H;  3K0X A;  2CKZ B;  2OTJ A;  1V1Q A;  3CP0 A;  1YIJ A;  4LNQ A;  2F3I A;  3JAM i;  4B3M L;  4YCV A;  1FJG L;  2NVT H;  4DV4 Q;  4HIM A;  4A3C G;  1E22 A;  1PH5 A;  3EN2 A;  4MZ9 A;  4BXX G;  3A74 A;  3MXN B;  4JI3 Q;  2HHH Q;  2ZJP A;  4KLK A;  4MTN A;  2JA9 A;  4JBJ A;  1HR0 L;  1U5K A;  3UDX A;  5GAD C;  2QEX A;  4LFA L;  3CAM A;  2CQO A;  3I7F A;  1N36 Q;  5C0X J;  1CUK A;  3UDG A;  4NXN Q;  1KQS A;  3H0G H;  2PI2 A;  2R7F A;  4AYB E;  3PUZ A;  3HOY G;  4YCW A;  4JI5 L;  2WB1 E;  3A5U A;  1L1O C;  4ME3 A;  3SGI A;  2E5L L;  3S24 A;  4LUO A;  4L5R C;  1YNX A;  4KHP Q;  1QVF A;  1QZG A;  4PMW A;  4BY7 G;  2ALY B;  1IBK L;  3ULP A;  4NPS A;  1PYB A;  4O2D A;  1LUZ A;  3CW2 C;  4JI7 L;  4JOI C;  1CKN A;  5LMN W;  1FGU A;  4B3M Q;  1X55 A;  4LF4 L;  3FKI G;  1FJG Q;  5ELO A;  4OWX B;  3PO3 G;  1E7Z A;  4JG2 A;  2UUB L;  2MO1 A;  1YEZ A;  1PV4 A;  2I5M X;  3F1Z A;  1M90 C;  2Z6K A;  4DV1 L;  5IY0 A;  1VQO A;  2VQF L;  1N33 L;  5C4X G;  4GKJ L;  1HR0 Q;  4AIM A;  3BJU A;  2FXQ A;  4LFA Q;  3ER0 A;  1VS0 A;  3DM3 A;  1SMX A;  4BY7 H;  1X56 A;  1K8G A;  1LYL A;  1Y1W H;  3CMA A;  1SLJ A;  3AFP A;  1Q7Y C;  5JEA J;  4JI5 Q;  1PH9 A;  2LXJ A;  3PO3 H;  1GO3 E;  1HZ9 A;  1L2F A;  4GS3 A;  2E5L Q;  1K3R A;  1TXY A;  1M1K C;  4DV5 L;  4C3H H;  3RZD H;  1XNR L;  2B3G A;  2PQA A;  1EUJ A;  1CSP A;  1GKH A;  5M5Y H;  4OX9 Q;  5LMU L;  3GD7 A;  2IHF A;  4A3K H;  1IBK Q;  1D7Q A;  4DUY L;  4C3I H;  5IE8 A;  4LFB L;  2AKW B;  3HOU G;  2ID0 A;  4JI7 Q; 
#chains in the Genus database with same CATH topology
 2K04 A;  5FLX L;  4LF4 Q;  4LAA A;  4KKT A;  1QZH A;  2JXM B;  4R4T A;  4UP9 A;  1HJP A;  4EQO A;  4I65 A;  3NBI A;  1PH6 A;  3GTM B;  4JI8 L;  3T51 B;  2I46 A;  3GTJ H;  1S5C D;  2F0T A;  1JC7 A;  2N78 A;  2L4N A;  4NKL A;  4HIK A;  1BBX C;  1G2S A;  5M5W B;  4BBR H;  4A93 H;  4X64 L;  3HOU H;  2BA1 A;  2ZJQ A;  3HOZ B;  1N34 L;  4A3F G;  2IT1 A;  3MWY W;  3QJY A;  4DNT B;  5IP7 G;  2GVA A;  2D9U A;  2SNS A;  5KYL A;  1S5D D;  5EBD A;  1CQV A;  4R1J A;  4HJ5 A;  1FGB D;  4Y7N B;  1VQE A;  1JMC A;  3VDY A;  5EKI A;  2BE5 D;  4X6A H;  3I91 A;  5ELF A;  2VQE Q;  3S1N B;  2UXD Q;  2DUD A;  4EQ5 A;  1VQL A;  3GTQ B;  4DV2 Q;  4PQX A;  3RLN A;  3GDE A;  1UEB A;  3QO2 A;  1VF7 A;  2EPB A;  4HCE A;  4LF9 L;  1NUC A;  1PTO D;  2HD3 A;  1A3T A;  3P7J A;  2L11 A;  5CBA E;  3VA7 A;  1F9S A;  3AMU A;  2Z6K C;  2JA5 B;  2C35 B;  1ASZ A;  2KCC A;  1C8C A;  1WOC A;  5IT9 c;  4B3S Q;  3IRB A;  1D5M C;  1FVI A;  1GXD C;  3RZO H;  1TY0 A;  5C5M A;  4X62 Q;  2KHJ A;  4YY3 L;  3CCE A;  4JW0 A;  1VQ5 A;  1FL0 A;  4LK1 C;  3PUX A;  5LL6 S;  4UDU C;  3T56 B;  3SE0 A;  1VQH A;  4KHZ A;  4DAV A;  4DR3 L;  3GO5 A;  2Z4I A;  4J6H A;  4TRD A;  2F0V A;  2EIF A;  5C3E H;  3S1R H;  1XMQ Q;  3VR4 A;  3HOY B;  2K14 A;  1ENC A;  3LWU A;  5IYC G;  4DR6 L;  1XXG A;  2RQX A;  1I6V C;  4RH6 A;  3BZK A;  1OXX K;  4HJ9 A;  4GNX B;  3M4Y A;  3QOL A;  1IW7 C;  3DLL A;  2UUC L;  1I4R A;  2B2V A;  5HY6 A;  2QA4 A;  2RHQ B;  2UXC L;  3FKI B;  3W1B A;  4JC0 A;  2EYO A;  1V1O A;  3CCQ A;  3SK4 A;  4YWM A;  1BVS A;  3DWQ A;  2UUA Q;  2G9H D;  2CW0 D;  1SNM A;  3M4O H;  1Y8O B;  4C2M B;  4BBS H;  1WTX A;  4ZUJ A;  4KJN A;  5FK9 C;  1BBW A;  2F0P A;  3I55 A;  1PDQ A;  1STB A;  3E3X A;  5FO8 B;  3NK9 A;  4KTA A;  3FMC A;  4N8F A;  4K0K L;  2EOT A;  3S15 B;  2KCM A;  3TZD A;  3U4Z A;  1UE1 A;  4AQY L;  5FO7 B;  1WTW A;  3HOW H;  4WOR A;  3FHW A;  1SE2 A;  4HJ8 A;  1R9T H;  1A6X A;  4PZ7 A;  4XT1 B;  1YNJ C;  5AFW A;  2SOB A;  1EYD A;  1UEA B;  1WJJ A;  2PMZ B;  3OIP A;  4ZYS A;  1FR3 A;  1NMF A;  3QG1 A;  3A56 A;  3NWT A;  4DAP A;  3VR5 A;  1VDZ A;  2X6L A;  4K14 A;  3MFY A;  1LAC A;  4HJA A;  1SSO A;  2N49 A;  2MHV A;  1IL8 A;  1VQ7 A;  2RHS B;  4DKA C;  5IIF A;  4TQU S;  2PNR C;  2JK8 A;  1DD2 A;  1EIF A;  2B63 G;  2HCC A;  5HUR A;  4OXP A;  5M3F H;  1VQG A;  2FFK B;  1I6H B;  4ME5 A;  3HFZ B;  4DR5 Q;  2B63 B;  1YZ6 A;  2EDG A;  4R4O A;  4X66 L;  1S5F D;  5I4D A;  2R92 G;  4B3R L;  4H0L C;  3TSS A;  3STB D;  2NVX B;  2M00 A;  3CCJ A;  2R92 B;  1KXL A;  3OTO Q;  2Z0S A;  5AJ3 L;  1PFB A;  1BCP C;  3A8K E;  3KF8 A;  4WJ4 A;  1BOS A;  4UP8 A;  3MA2 B;  1W3S A;  3GTG H;  3K81 C;  2RKS A;  3TP8 A;  3NBH A;  4HIO A;  1C7Y A;  1IBL Q;  3X3M A;  1O78 A;  5I2Y A;  4A3B B;  5LMN Q;  2SNM A;  1MSH A;  2CH4 W;  1GUN A;  1BR9 A;  3H0G G;  4GZY C;  1IKL A;  1PYW D;  1WD1 A;  1UAP A;  1Q1E A;  1TS2 A;  3H0G B;  4LF7 Q;  3KF6 B;  4DK3 C;  3BDC A;  3MHB A;  4ULL A;  3D31 A;  5J1Z A;  2ATW A;  1VQD A;  2N88 A;  4LJZ C;  3KLR A;  2ICI A;  4FF3 A;  4DV6 Q;  1YJ9 A;  1J8I A;  3CF5 A;  1EZ8 A;  3MZ5 A;  5C44 H;  2KOL A;  1Q46 A;  2NTT A;  4XDX A;  2ZXO A;  4OX9 L;  4JI2 L;  4A3E B;  3I4N H;  1F9R A;  1E1O A;  5M5X B;  3S17 B;  2F0J A;  1IL2 A;  1M4V A;  4BS9 A;  2NN6 I;  1TII D;  1PH3 A;  1EY0 A;  1KRS A;  1LTI D;  4LFC L;  4KKS A;  4A3K G;  2KBN A;  3M9B A;  2A68 D;  2KED A;  1EY8 A;  1VQF A;  3GV3 A;  1HZB A;  4DR2 L;  4OIK A;  2HIX A;  3V05 A;  2B29 A;  1GJX A;  1B70 B;  1ZEQ X;  1Y14 B;  3G71 A;  4IAL A;  4A3J G;  2KEE A;  4K6L A;  3AQQ A;  4A3J B;  5FKA C;  5BN5 A;  2NVY H;  3EIV A;  3Q8D A;  4XXE A;  1YHB A;  4JCV E;  1RHP A;  4DV7 L;  2R7Z G;  3SXH A;  1E0B A;  4OGQ C;  5DM7 3;  5I9O A;  3S1M B;  1AW7 A;  4K5X A;  2R7Z B;  4TKO B;  4YCU A;  4ZKB B;  5DAU A;  4R8N A;  3I4M G;  3GTL H;  2OT2 A;  3J7Z C;  3J7A 5;  5JJK A;  4DV2 L;  4EVO A;  3NTK A;  1AZP A;  3J81 E;  1HNX Q;  1PH2 A;  1X3E A;  2CFM A;  2LY7 A;  1HXY D;  1EYC A;  4JBW A;  4R4C A;  4NDX A;  3H15 A;  1X9N A;  3R93 A;  1IXR A;  3T1H L;  1E1T A;  1SR3 A;  1ESR A;  1X54 A;  4I7A A;  5IGC A;  2B2U A;  1B7Y B;  1RCV D;  2L12 A;  1ZYR D;  2A73 B;  1G51 A;  1YJW A;  3S2H B;  3Q24 A;  3CCR A;  3CQZ H;  3J81 i;  2MP1 A;  2O5J C;  1EWH A;  1HRJ A;  1FD7 D;  3CME A;  3RUZ A;  1N36 L;  4GN3 B;  3J81 j;  4NXN L;  1H9K A;  4OHJ A;  1KC8 C;  2JA6 H;  3J7A V;  1A63 A;  1D6E C;  2O2L D;  2Z1C A;  2OQ0 A;  1N8R C;  4KHP L;  5A35 A;  4DAY B;  4IPH A;  2F0N A;  1H9R A;  3A8I E;  2K03 A;  5IT9 L;  2ZM6 Q;  2OTJ A;  4LNQ A;  2BDN A;  2K1B A;  4YCV A;  2NVT H;  4A3C G;  1E22 A;  2B2W A;  4QCL A;  3A74 A;  1ZKO A;  2HHH Q;  2ZJP A;  4KLK A;  1HR0 L;  1V8Q A;  2MGS A;  4K2K A;  5GAD C;  4JVZ A;  2CQO A;  2L1B A;  1CUK A;  2R3Z A;  1NAP A;  1D5Z C;  3PUZ A;  4YCW A;  3S24 A;  1BCP D;  2FMC A;  1QVF A;  4E6I A;  1QZG A;  1SBB B;  4PMW A;  3Q0A A;  4O1N A;  4ZLT F;  4NPS A;  3KBX A;  1GHK A;  3QB3 A;  1H9S A;  3NPP A;  1E7Z A;  1PV4 A;  3F1Z A;  1M90 C;  4DV1 L;  1GHJ A;  5C4X G;  4GKJ L;  2K5D A;  2IWH A;  5M5Y B;  3FEW X;  1I4Q A;  1LT3 D;  1ML0 D;  1VS0 A;  1LYL A;  1QG7 A;  2Q8T A;  1Y1W H;  2DNC A;  2EJM A;  3CMA A;  1ENF A;  3NTI A;  1PH9 A;  2B2U C;  3PO3 H;  3EQL C;  2KJX A;  4EQP A;  1TXY A;  1LV9 A;  1PLF A;  4C3H H;  4DV5 L;  3K7A B;  2B3G A;  2QEJ C;  4RHR A;  5LMU L;  1IBK Q;  1AP0 A;  1EIG A;  5IE8 A;  4G7O C;  2Q8I B;  2AKW B;  3J80 E;  2IX0 A;  3SHL A;  5FLX E;  1UWV A;  3NSW A;  1BCP F;  2JJQ A;  4RGN A;  1K0S A;  1MD2 D;  1PYS B;  2RBM A;  3MXP A;  2BCO A;  4HED A;  2JA8 H;  5CV4 A;  1XTC D;  4IPC A;  3F2C A;  2IY5 B;  1E24 A;  4OO1 G;  1F2Z A;  2IX3 A;  1G91 A;  1S5E D;  1PH4 A;  3J80 i;  1K8O A;  3EVQ A;  3SEB A;  4DFA A;  3GTM H;  2AQ1 B;  3I56 A;  1N32 Q;  3Q22 A;  4B3T L;  1VQ4 A;  1KD1 C;  2B2W C;  4RAU C;  1VQN A;  4JI1 L;  2CQA A;  3PSI A;  1WYD A;  2JQO A;  3URY A;  4ZCK A;  3MEH A;  1W6J A;  2BOS A;  1J9O A;  4JK1 C;  1VQ8 A;  3K5N A;  4IUN A;  5M5W H;  1VQK A;  4J1M A;  5CV5 A;  5C3W A;  2EXD A;  3HOZ H;  4CDE C;  4LF8 L;  3PIO 3;  4JI6 L;  3K5M A;  1EY7 A;  2N8N A;  3BZC A;  4QF4 A;  4QY7 A;  4DV0 Q;  4DR7 Q;  1EQT A;  1A3U A;  2F0L A;  4KD4 A;  2EY5 A;  2K5H A;  5IP7 H;  2IW3 A;  2JA7 B;  1YHA A;  1LT6 D;  4Y7N H;  2NN6 H;  5JVG 3;  2B2T A;  1D2B A;  5KNC A;  1WTH A;  3S1N H;  3I72 A;  1EQV A;  3S9W A;  3HOX G;  3KK7 A;  1HA6 A;  5G3L F;  3IL8 A;  4BY1 G;  1HCZ A;  2FHT A;  1X32 A;  4HJ7 A;  5JJI A;  3HOX B;  5FOB B;  4BY1 B;  1PA6 A;  3UE0 A;  2N3S A;  5IGF A;  2CH4 A;  3CCS A;  1OXU A;  1EIY B;  5D3I B;  1NBW A;  1WFQ A;  3SDZ A;  3BVZ A;  4P2C B;  1SFO B;  2JA5 H;  2K01 A;  4JV5 L;  3OHX C;  4GNX A;  1CHP D;  4X3T A;  2VUM G;  2J0T D;  1BUV T;  3TS2 A;  1PH1 A;  2EY2 A;  4Q0F A;  5K36 G;  3A54 A;  1TR5 A;  1SNQ A;  1CKO A;  1PTO B;  2OWO A;  1VQ6 A;  5EPL A;  3AB9 A;  4NXM L;  2HDM A;  3H3V I;  1MI2 A;  3VYS A;  2A6H D;  2BDO A;  4JYA L;  1LM0 A;  4CDC C;  3T53 B;  1Z47 A;  5EKL A;  4ILW A;  3PIP 3;  3L0O A;  3UDI A;  3HOY H;  4L5T A;  3W1G A;  5FO9 B;  1SYG A;  4G4K A;  1LAB A;  1DGS A;  3T13 A;  2LMC B;  3BZD B;  5KEE A;  3RLO A;  1SDF A;  3DM1 A;  1YBY A;  2VZA A;  1II3 A;  1JB3 A;  1CZW A;  1F77 A;  2JYO A;  1PH7 A;  5IGB A;  3FKI H;  1HHV A;  1PZI D;  2K50 A;  2IPK D;  4JI0 L;  4KJO A;  5JJL A;  1Z7T A;  1N9W A;  5COY A;  1AEX A;  4PZ6 A;  4C2M H;  4FNF A;  5CGK A;  2D62 A;  4CKE A;  2B2T C;  3G6J B;  3SK5 A;  1G8Z D;  3DHQ A;  2K7V A;  1EQQ A;  1LTB D;  1TWF H;  1X3F A;  1HR0 W;  4DR1 Q;  4DR4 L;  3DWA A;  2NYZ D;  5C3X A;  1TVX A;  3S15 H;  3T1Y Q;  1SND A;  4Y52 H;  1XNR Q;  2NVQ B;  1NTG A;  2PPB C;  4A3F B;  3BDL A;  2O4X A;  5M3M G;  2VNU D;  2JEB I;  4DUY Q;  4LFB Q;  4GKK L;  4I7Z C;  1QIL A;  1O7L A;  5M3M B;  1AN8 A;  5IGG A;  1FNU A;  5D65 A;  1YHQ A;  4DV3 L;  1JJG A;  1J5E Q;  4K8J A;  1CQF A;  2HQL A;  4IUR A;  2D0P A;  4LW1 A;  4NW2 A;  4A3I G;  3LWE A;  2ZM6 L;  1IBM L;  1YIT A;  1XTD A;  5EBC A;  4R4Q A;  4A3I B;  2Y0S G;  2WKD A;  2F3W A;  1O7Z A;  1TU2 B;  4OWT B;  1KLU D;  3RMH A;  4XYQ A;  1HPC A;  3GP7 A;  1S4Z A;  2Y0S B;  3CU7 A;  1FNV A;  2E2D C;  1F9P A;  3S16 B;  1EQR A;  1HNW L;  2KEC A;  1I6H H;  4DGZ A;  1GM5 A;  4L63 B;  1CA6 A;  2B63 H;  2CCZ A;  3RLF A;  3D4R A;  3I4O A;  3VA5 A;  5IYB H;  3LGJ A;  3G4S A;  2PNH A;  1PZK D;  3W5O A;  4DAM A;  2NVX H;  2GN5 A;  2R92 H;  2EQS A;  1ILQ A;  3L7Z C;  3PF4 A;  2MJ8 A;  4RCO A;  3ULJ A;  1Q81 C;  4EX5 A;  3M4P A;  3FPP A;  2F4V L;  2DY7 A;  4PMB A;  3RN2 A;  5CV8 A;  2E2I B;  5KND A;  4QQB X;  3X3N A;  2R93 G;  4H13 C;  4J8Q A;  3QOJ A;  1K8M A;  1KNA A;  2UU9 L;  1Q82 C;  2K5N A;  4GLX A;  1HQR D;  3KDF B;  3CCU A;  4A3B H;  2R93 B;  3LX0 A;  2G9D A;  3A7A B;  2JE6 I;  3HKZ E;  1TS5 A;  3MEF A;  4KY5 A;  4C3J G;  4G7H C;  1KIX A;  2JEA I;  5KNB A;  1HTL D;  1EY5 A;  3NXW A;  2X69 A;  2XIW A;  1PRT C;  4C3J B;  2ES2 A;  4JI4 Q;  2K4K A;  3T16 A;  4UPA A;  5I9P A;  4HID A;  2WAQ G;  3DWP A;  1JWU D;  2A74 C;  4OO1 I;  4ODG A;  1T5E A;  4A75 A;  2WAQ B;  4IOC A;  1Q3L A;  4A3G G;  5CV9 A;  2A8V A;  3K8A A;  5BR8 Q;  3OMC A;  4A4I A;  1K9M C;  2EE1 A;  4A3G B;  4QIW B;  2P5Z X;  2K75 A;  3PO2 G;  4XTC S;  1L0W A;  3CKI B;  3EJI A;  3PO2 B;  1DM0 B;  3D6C A;  1D1I A;  2A5H A;  4A3E H;  2OTL A;  4IFD G;  1EYA A;  2BH8 A;  3O13 A;  3PIO A;  5M5X H;  3S17 H;  1CKN B;  4R9W A;  1E2V A;  3D8G A;  2EYP A;  3AYH B;  4DUZ Q;  1N32 L;  1HZA A;  1TWH B;  2I5H A;  1CM9 A;  3V2T A;  4IUQ A;  1Q8I A;  1L1O A;  3OPO A;  1HH2 P;  1JOO A;  2JP1 A;  4BBR G;  1A62 A;  3CD6 A;  2EYM A;  2ZTD A;  1KAB A;  1VF5 C;  1BDO A;  2A6E D;  4HAE A;  2E8G A;  1BKB A;  1XMO Q;  4FF2 A;  2IX1 A;  4OON A;  1CHQ D;  4DR7 L;  4PNY A;  4A3J H;  2HCI A;  3N52 A;  4APV A;  2QW7 A;  1LTS D;  3D6W A;  4FF4 A;  1WD0 A;  2DJG C;  3FRP B;  1MGS A;  4ZRZ A;  3H3V H;  3S1M H;  4R4I A;  2TMP A;  1JOK A;  3J81 c;  2R7Z H;  3S14 B;  4ALP A;  1XPR A;  4RGT A;  4IFD H;  3CRL C;  1TWC B;  2QKI C;  2RCF A;  3WDN A;  1XJV A;  2R6G A;  1CK1 A;  4X3S A;  4LMQ D;  1SRO A;  5IGE A;  3L9A X;  2R7D A;  1BQQ T;  1LTA D;  4O42 A;  2LXK A;  1GUT A;  2LSS A;  2XWJ B;  4JPB W;  1QNK A;  3R8B A;  4LF6 Q;  1U0L A;  1JE4 A;  3BVG A;  4JI3 L;  3TRZ A;  2F1M A;  4DAY A;  2B2V C;  4KV6 A;  1Q90 A;  5BN3 A;  2UXB Q;  1AH9 A;  1VMC A;  4KY6 A;  3JAM L;  2OCE A;  1QWY A;  5E3F A;  1F2L A;  3PIP A;  3S1Q B;  4EQN A;  2A19 A;  1FYC A;  3CCV A;  1QVC A;  1STG A;  4GOP A;  1QUQ A;  1HNZ Q;  1SYE A;  3KOJ A;  3S2H H;  3NEM A;  2F0Q A;  1B53 A;  3JC6 6;  1RKN A;  2VB2 X;  5IT9 E;  1SNO A;  1KDC A;  3F2U A;  5KGU A;  2F4I A;  1FJG L;  4DV4 Q;  4HIM A;  2OEO A;  2Z6B A;  3MXN B;  1JQY D;  4MTN A;  3MC0 B;  1STY A;  2E74 C;  1U5K A;  3H3V C;  4QMG A;  5C0X J;  3UDG A;  1V1P A;  3R2T A;  2PI2 A;  1XWE A;  3KLS X;  4AYB E;  2WB1 E;  1L1O C;  2E5L L;  2PQE A;  4L5R C;  1ROD A;  3D3R A;  1B2T A;  4H44 C;  3DXJ C;  2ALY B;  1YNN C;  4WFN 3;  2VB3 X;  4DF7 A;  3K5L A;  4O2D A;  5A2Q L;  1LUZ A;  1JIC A;  1FGU A;  3ERQ A;  4B3M Q;  4LF4 L;  1JOR A;  1STN A;  3GQB A;  4DNR B;  2F0U A;  1YEZ A;  1EIH A;  5CR3 A;  1F2Y A;  1VQO A;  1DYQ A;  4C3I G;  3RZD B;  4FF1 A;  4MN3 A;  4LFA Q;  4A3K B;  1U9R A;  3DM3 A;  4C3I B;  1K8G A;  2TSS A;  3AFP A;  1STE A;  1Q7Y C;  3J7Y W;  5JEA J;  4JI5 Q;  1GO3 E;  4GS3 A;  4N8X 1;  1K3R A;  1BCP B;  1IW7 D;  1M1K C;  2E76 C;  2PQA A;  1XNR L;  5NUC A;  1RDP D;  5M5Y H;  1D7Q A;  2NBF A;  4DUY L;  2F0G A;  4LFB L;  4JI7 Q;  2BH2 A;  1B8A A;  1KDA A;  4OEL B;  3J80 c;  1SXT A;  1VQB A;  2UUB Q;  2Q2T A;  5FLX c;  2VQE L;  1NSN S;  2VQF Q;  1N33 Q;  1G29 1;  3K7A H;  1C48 A;  4OL7 A;  4GOP C;  2UXD L;  3GTP B;  1AZQ A;  2PCF B;  3GTK B;  3TS0 A;  3I4M B;  2C5C A;  2XRQ D;  3A0J A;  2VS1 A;  4C56 C;  2K05 A;  3NEL A;  2F52 A;  5IOC A;  1ILP A;  2K5Q A;  1DZ1 A;  2AWO A;  2B2Y A;  3S2D B;  1EWI A;  1R4Q B;  5GQO A;  1EFW A;  4B3S L;  1PHJ A;  1GUO A;  2HQE A;  4X62 L;  3ERO A;  1K83 H;  4IUV A;  2RSO A;  1SEB D;  2CVR A;  2D2C C;  4IPD A;  1AFP A;  5J22 A;  1S40 A;  4OO1 H;  1EU3 A;  1EOT A;  4JI8 Q;  1YNJ D;  1SE8 A;  2YTX A;  1PRT F;  3VR3 A;  2MPM A;  4Q5V A;  2F0I A;  3TZU A;  1WTQ A;  4KK7 A;  2Z8L A;  4IN3 A;  3GTO B;  1I50 B;  2B8G A;  4ABN A;  5ELC A;  1I94 Q;  1K8A C;  4ZAI A;  1W2B A;  1XMQ L;  1K28 A;  1WVL A;  2K6A A;  1N34 Q;  1VQI A;  1X3P A;  1RL2 A;  4BA2 I;  3A7L A;  3CPF A;  2JA7 H;  1KAW A;  1B9M A;  1B4O A;  3QIA A;  2QDL A;  3OIQ A;  4IFD J;  1CSQ A;  5T1I A;  2YU9 B;  3SK6 A;  4PZ8 A;  2E2H B;  3VYU A;  5D14 A;  3HOX H;  4K5W A;  2UUA L;  4BY1 H;  3KF8 B;  4X3K A;  4FXD A;  5C4H A;  2XSC A;  4HCS A;  4DU9 A;  3M7N A;  3NBH B;  5C44 G;  1NJI C;  3C3L A;  4BXX H;  3UI2 A;  5FJ8 G;  1IHZ A;  3TP6 A;  1B1Z A;  1SFO H;  1JE5 A;  4C1N K;  1KHI A;  5E7N A;  2RF4 A;  1VQM A;  4HSV A;  2RDF A;  1LT5 D;  4B08 A;  1EYG A;  3VR2 A;  1I5F A;  2DJF C;  4MIU A;  5GRO A;  4YY3 Q;  1Q86 C;  1PTO H;  4JBM A;  1OO9 B;  1JT8 A;  5K36 H;  1JJC B;  2KHS A;  1PZJ D;  3UE1 A;  4DUZ L;  1STH A;  2DNE A;  1RJT A;  3TDQ A;  5C4J B;  5C4X B;  2B2Y C;  2Q2U A;  2H1E A;  3SVM A;  4DR3 Q;  1VCI A;  2IHE A;  5FLM G;  2AQ3 B;  3OMG A;  3F8T A;  5DM6 3;  5E4W C;  4JBK A;  4DR6 Q;  1F2M A;  1JWM D;  2GA4 B;  3KJP A;  1ESF A;  3I90 A;  5JPM C;  1XYI A;  1EFI D;  1RIP A;  1PXU A;  2V4D A;  2QDB A;  2WP8 J;  4POG A;  1K73 C;  1UE6 A;  2PW7 A;  2ZT9 C;  4TVA B;  2UUC Q;  1U4M A;  2DN8 A;  3DEO A;  2UXC Q;  3P1H A;  2KA7 A;  1BO0 A;  2K32 A;  2K28 A;  4IUU A;  4GLV B;  2K33 A;  5G3L D;  1DOM A;  2BE5 C;  1NMG A;  2IJ0 A;  4DR5 L;  1EY4 A;  2ENB A;  3KYH C;  5EPJ A;  2ICE C;  2XRS D;  4IJL A;  2E2J B;  2ZTE A;  3OTO L;  4QUC A;  2WV6 D;  1HUM A;  1PTO C;  2LFN A;  1Z9F A;  4K8I A;  1G6Z A;  4IO9 A;  4YWL A;  4KN7 C;  1IBL L;  4UP7 A;  4NP5 A;  4YHH Q;  1O7I A;  3K7U C;  2F0M A;  2NVQ H;  4AQY Q;  4A3F H;  2QIL A;  4KI0 A;  1GUS A;  3HG9 A;  5T1G A;  5LMN L;  4A3L G;  2WB1 G;  3CC2 A;  5M3M H;  1PVO A;  1UE7 A;  4K2L A;  3H6M A;  2J7Z A;  4H7B A;  3C1F A;  4LF7 L;  4Z9C B;  3PMF A;  3M3Y B;  2F03 A;  1G6P A;  1NNX A;  4IQZ A;  4U68 A;  3Q23 A;  1B44 D;  1SN8 A;  3GTQ H;  1TS3 A;  4UY8 C;  3NEN A;  1PMR A;  3K80 C;  2JN4 A;  2R61 A;  1I4H A;  3ULL A;  2AHO B;  5IWA Q;  4DV6 L;  4A3I H;  3QR8 A;  3TME A;  1E3P A;  3F2D A;  4OIJ A;  4RGO S;  1C9O A;  4ID6 A;  2PMZ E;  1NCV A;  2KQ3 A;  3TP7 A;  3S16 H;  1DOL A;  2ZJR A;  5M9O A;  3KLS A;  1AE2 A;  4LF5 Q;  3KJO A;  2VUM B;  4X66 Q;  1JR0 D;  4B3R Q;  3M7G A;  2RDH A;  3HKS A;  4RFB A;  4CDD C;  5AJ3 Q;  2ZTC A;  2KCT A;  1HFG A;  2WAC A;  4X65 Q;  3IFD A;  3GV6 A;  4V0B A;  2PO4 A;  4M8A A;  1BNZ A;  2EJG C;  4P71 A;  2E2I H;  1I3Q B;  4A3M G;  4WJ3 M;  1UE5 A;  4POF A;  1LLR D;  5IYC H;  4A3M B;  3E6Z X;  2I07 B;  1Z6H A;  3A5Z B;  2R93 H;  1FNW A;  4LWC A;  3SR1 A;  1TWG B;  3ONA B;  1EEI D;  1Y1W G;  1CTM A;  3DMU A;  3C2P A;  4DA2 A;  3OSO A;  1EWC A;  1Y1W B;  1TQO A;  4C3J H;  2KUM A;  5IP9 G;  5EQ0 A;  1PFM A;  3CPW A;  4A3D G;  4C3H G;  4A3D B;  3HOV G;  4MNO A;  2NUC A;  5GAE C;  3VYR A;  3IFT A;  3KLW A;  3HOV B;  2EXZ A;  2MQH A;  2VY3 A;  2EJF C;  1U4L A;  5C5L A;  1HNX L;  4A3G H;  1XPO A;  1X65 A;  3E0J A;  2M2L A;  4FO2 A;  5C0X G;  5C6A A;  1YJN A;  1GOZ A;  5JJZ A;  2NZO A;  3PO2 H;  1MHW C;  2JA8 G;  1WCM G;  2BA0 A;  3G7L A;  4P73 A;  1H9M A;  5E1F A;  4MHE A;  1JWS D;  3D0F A;  2SDF A;  4HSP A;  4JI2 Q;  3RN5 A;  2SEB D;  2JA8 B;  1EEF D;  1WCM B;  2K5V A;  4IUP A;  5IYD G;  4WRD A;  1SYC A;  4DXF A;  1ONL A;  1LTT D;  1TWA B;  4QB4 A;  2VW9 A;  1KAA A;  2L9H A;  3RR5 A;  3EFX D;  2H4O A;  5ELN A;  1A0I A;  4KHV A;  3PF5 A;  1TWH H;  4KY7 A;  1H95 A;  4LFC Q;  2JSO A;  3W2D A;  4KKU A;  3HZX A;  3STB C;  3U4V A;  1X3G A;  2RA4 A;  1QCB D;  3HRZ C;  4P74 A;  1TY2 A;  1KLG D;  4DR2 Q;  4DNI A;  4GNX C;  3HOZ G;  2F0K A;  1I94 L;  1T5X D;  4AH6 A;  4CHT B;  1ENA A;  3K59 A;  1WTR A;  3PUW A;  5KIX A;  1JJ2 A;  1O7Y A;  1MSG A;  1A2U A;  4GN5 A;  5JEA G;  1TS4 A;  2PZT A;  1V9P A;  2NN6 G;  3PUV A;  2N55 A;  1D5X C;  1MKH A;  2YV5 A;  5I6Y A;  3BU2 A;  1DJR D;  2D5D A;  4R8I A;  4DV7 Q;  1B50 A;  3F2B A;  2HHH L;  4LUZ A;  2RSN A;  3S14 H;  1Y8P B;  1Y1V G;  4F7X A;  3U9S A;  1IYV A;  2WFW A;  1TWC H;  3JAM E;  4RGM A;  4B9X A;  1Y1V B;  1AE3 A;  1DCZ A;  4J15 A;  3DUZ A;  3I4L A;  5EPK A;  1C0A A;  1Y69 U;  5E4X A;  3PCO B;  3KF6 A;  3MXN A;  2OQK A;  3PV0 A;  1RF2 D;  1BXT A;  2F0W A;  2JA5 G;  3DEP A;  3BVM A;  1MIU A;  3B6Y A;  3PGZ A;  3S1Q H;  3T1H Q;  2CKZ B;  3CP0 A;  4OEM B;  3MFG A;  1RTN A;  1YIJ A;  3JAM i;  2DY8 A;  3EN2 A;  1WTO A;  4XT3 B;  1WTP A;  4L8J A;  2OF1 A;  3CHB D;  4U67 3;  2PW5 A;  4CDF C;  1TT2 A;  1N36 Q;  3I7F A;  2KCN A;  4NXN Q;  3H0G H;  1LTG D;  2NZ1 D;  5CYU A;  1X3Q A;  3P75 A;  3HOY G;  3BYY B;  2A68 C;  5ELB A;  1ICW A;  4KHP Q;  1GUW A;  1KDB A;  1BF4 A;  1ICF B;  2QF7 A;  4G7Z C;  2B39 A;  4BY7 G;  4TSS A;  5JPN C;  3SK8 A;  1IBK L;  2B8F A;  5A2Q E;  4BY7 B;  3CW2 C;  3H91 A;  5LMN W;  4KN4 C;  4G57 A;  3FKI G;  5ELO A;  1PTO F;  1STA A;  5C4Z A;  2MO1 A;  1CA5 A;  2I5M X;  2WIN B;  3MTS A;  5IY0 A;  1HR0 Q;  4AIM A;  3BJU A;  4MTK A;  2FXQ A;  2L55 A;  2EYH A;  2RVL A;  5JVH 3;  1SMX A;  1X56 A;  2XN9 C;  3U9O A;  1IKM A;  1SMY C;  2EYF A;  4CJ1 B;  1DOK A;  3RZD H;  3C46 A;  3GTJ B;  1EUJ A;  1CSP A;  1GKH A;  3K58 A;  2IHF A;  3FVQ A;  4A3K H;  3D4D A;  4C3I H;  4A93 G;  1TWF B;  1F9Q A;  5LHY 1;  3HOU G;  3OWE B;  3CC4 A;  1CKM A;  5EAY A;  5J3B A;  1XNQ Q;  4BBR B;  4A93 B;  2RCN A;  3HOU B;  1OXT A;  4GLA C;  4DV1 Q;  4YHH L;  3J7A F;  1LO5 D;  4IJH A;  4XQN A;  1S3O A;  2ZXR A;  3TQY A;  1ZYR C;  3WOF A;  3ZJY C;  4DV0 L;  4GKJ Q;  1J6Q A;  1WI5 A;  2E75 C;  4CBV A;  1IZ6 A;  4L5Q A;  2PYK A;  1XPU A;  3PUY A;  4QUF A;  4L5S A;  4FYD A;  4FDB A;  2LS0 1;  2M9V A;  2X6G A;  4IZ8 A;  2YTV A;  1X6O A;  2PI2 E;  2V1C C;  1OXS C;  4ZKC B;  1KTK A;  3P20 A;  4O0A A;  3GTP H;  4DV5 Q;  1DXM A;  2EVB A;  3K6O A;  3GTK H;  1NR4 A;  5LMU Q;  4UHV A;  4DK6 C;  3I4M H;  4P72 A;  2L5T A;  1PRT B;  1H9J A;  1GD7 A;  1Q1B A;  5IWA L;  4RHS A;  1G2T A;  5DNF A;  4F8M A;  2K52 A;  2VXW A;  2C9O A;  1MJC A;  3IAY A;  5CMD A;  5L37 A;  3AU7 A;  3S2D H;  4EGV A;  5KRU A;  4ZK9 B;  4DN4 M;  3ZYY X;  1SNC A;  2HUG A;  5IYB G;  2VL6 A;  4CGY B;  2PZW A;  3RZO B;  4LF5 L;  1IYJ B;  4HN7 A;  4XQJ A;  1HFN A;  2CHB D;  2MFI A;  4B3T Q;  3G6E A;  4FXG C;  1ZXT A;  5DEH A;  2ASB A;  4JI1 Q;  1JOQ A;  4WJW A;  4CKB A;  1OXV A;  5C3E G;  5BN4 A;  1I50 H;  3GTO H;  4X65 L;  2NB0 A;  1A2T A;  1UUP A;  2XVS A;  3I73 A;  2PZU A;  2F0H A;  5C3E B;  3S1R B;  1QOH A;  3TN2 A;  1VQP A;  4LF8 Q;  4C1N I;  1EZ6 A;  1VQC A;  4JI6 Q;  4A3B G;  3LNN A;  1CFM A;  1D1K A;  1TKW B;  1VQ9 A;  5GAG C;  4FP5 D;  2AWN A;  1SRU A;  2CWP A;  3NHH A;  1W6K A;  1KL9 A;  4QGU A;  1A8V A;  4IPG A;  2HT1 A;  5C0X I;  2QGQ A;  4X3U A;  1CI3 M;  3NP8 A;  2EYL A;  1I4X A;  3I8Z A;  4A3C H;  3C1E A;  1MJE A;  1QNU A;  2YU9 H;  3EBE A;  4LUV A;  1K0R A;  2E2H H;  3KFU A;  5I6W A;  1HQM C;  4BBS G;  5LL6 X;  5EJW A;  4M1U B;  2G5D A;  3M4Q A;  3M4O B;  4BBS B;  3NE5 B;  1ET6 A;  1HTP A;  2NZH A;  4CJ0 B;  4IOA A;  2F0O A;  3OW2 A;  5KYI A;  4A3E G;  3TBI B;  1R4P B;  5FJ8 H;  4JV5 Q;  5HGQ A;  3E0E A;  1ASY A;  4DR1 L;  3BG3 A;  3K0Y A;  5F2D A;  1OTC A;  3ICE A;  4B9W A;  5HGT A;  4DXG A;  3L2P A;  2AUK A;  3R3O A;  1V43 A;  3HOW G;  1EY6 A;  3K5O A;  1RTO A;  4RCN A;  3T1Y L;  4NXM Q;  5IOD A;  2CWA A;  3BDO A;  2AMC B;  3R2I A;  1Q8K A;  1VMP A;  4PG3 A;  5CC4 A;  1GVP A;  5C4X H;  5C4J H;  3HOW B;  1R9T B;  1LT4 D;  2XNA C;  1PRT D;  3G48 A;  1YI2 A;  4JYA Q;  3U58 A;  4N9P A;  4FVM A;  4RG1 A;  3NQI A;  2F0D A;  3NWS A;  2QCP X;  3IKJ A;  1J5E L;  2L15 A;  4CKC A;  3NQT A;  1I4G A;  4PMC A;  5FLM H;  1EY9 A;  1EL0 A;  3ERS X;  1Y8N B;  2O5I C;  3NTH A;  1SNP A;  1XX8 A;  4V19 0;  4N9T A;  4S3S A;  5COR A;  1SE3 A;  2I5L X;  5D3D A;  5K5P A;  2GVB A;  3A55 A;  5M3F G;  2HIV A;  3CCL A;  1BBU A;  5ELD A;  1NR2 A;  4KMU C;  4JI0 Q;  3Q6S A;  4A76 A;  1SMY D;  1L1O B;  4HMJ A;  3TEH B;  3CCM A;  1D8L A;  4RKL A;  5M3F B;  4H02 A;  5ELE A;  3KBG A;  2E2J H;  3HKZ G;  4OWW B;  1I4P A;  3PQI A;  2ZXP A;  3A8J E;  3HKZ B;  4XYO A;  3E5S A;  2XTI A;  4RWS C;  1JCK B;  1PH8 A;  1KNE A;  4DR4 Q;  1SYD A;  4DPG A;  1U4P A;  2YYZ A;  4X64 Q;  3MXU A;  3GTG B;  3E9H A;  2AUJ D;  2MUY A;  3D4W A;  4NMZ A;  1K3B C;  1CZG A;  1NE3 A;  1HA5 A;  3E9I A;  4YWK A;  2YTY A;  4GKK Q;  4A3L H;  2MO0 A;  4PV1 C;  2A6H C;  1M8A A;  5H1S E;  4DV3 Q;  3M3Y H;  5GAH C;  2XGT A;  4JI4 L;  4IFD I;  1EOV A;  1ET9 A;  2WKC A;  4K5V A;  5JAV A;  2L0C A;  1IBM Q;  4QL5 A;  5BR8 L;  2A1A A;  1MBY A;  3NUC A;  3U50 C;  4LF9 Q;  4GOP B;  1QUQ B;  3N6R A;  1YVC A;  3TP5 A;  3V96 A;  5C44 B;  3I4N G;  1A3V A;  3OOC A;  1SYF A;  1NY4 A;  4FXK C;  1HNW Q;  2KHI A;  3I4N B;  2VUM H;  1SJE D;  3H94 A;  2A69 C;  4P75 A;  4F88 A;  1KRT A;  3HEJ A;  4RKB A;  1JB7 A;  3TRE A;  1EU4 A;  2HDL A;  4CJ2 C;  2Y0S E;  3ND8 A;  5ISR A;  1CT1 D;  4HTH A;  1E2Z A;  4HR7 B;  3AEV A;  3I2Z A;  2WII B;  3VR6 A;  2H5X A;  1V1P B;  3CC7 A;  5JOB A;  2F4V Q;  4L6T B;  1WTV A;  1I3Q H;  1XNQ L;  1UNS A;  2NWG A;  1VQJ A;  1XMO L;  4A3M H;  3WWV A;  2LKV A;  4ZUI A;  2UU9 Q;  1QVG A;  1TWG H;  4NB3 A;  1A15 A;  2NVY B;  1YNN D;  3FP9 A;  5CV7 A;  2OXP A;  3BYT B;  5IP9 H;  4A3D H;  4YIJ A;  2F0E A;  3GTL B;  1HZC A;  1P16 A;  2KVM A;  4HMI A;  3HOV H;  3OYY A;  1O80 A;  3CXC A;  3ND9 A;  4LF6 L;  1SYB A;  1VQA A;  3WOE A;  2Q2I A;  2F0F A;  2UXB L;  2Z4H A;  4JOI A;  1L0Y B;  4KD3 A;  5C0X H;  2PQA B;  2D0O A;  1PFN A;  4BA1 I;  1WCM H;  1LTL A;  3EA6 A;  2MNA A;  3M85 A;  2WAQ E;  1DON A;  3J81 L;  1TWA H;  1HNZ L;  3L3O C;  1K83 B;  4K0K Q;  2F3V A;  5IYD H;  1SJH D;  3CQZ B;  1T9H A;  4QIW E;  4AYB G;  3FPU B;  2Q8R E;  1B3A A;  2JA6 G;  2KEN A;  2FIN B;  4K6D A;  4AYB B;  4GN4 B;  2WB1 B;  4XIG S;  4DV4 L;  2JA6 B;  1QJO A;  2XWB B;  1S72 A;  5DLQ E;  3UDF A;  1QE6 A;  2I0Q A;  1P8L A;  4QJF A;  3QWN A;  2JA7 G;  5JEA H;  2Q2H A;  3JAM c;  1PFS A;  3MXG A;  2EZV A;  2NVT B;  3RD4 A;  3MVV A;  3AFQ A;  4UAI A;  1Q12 A;  1C4Q A;  3HS0 C;  2DGY A;  4RA8 A;  3RNU A;  3KDF A;  4RMF A;  1Y1V H;  5I2X A;  3BS1 A;  3K0X A;  1V1Q A;  1QB5 D;  2AQ2 B;  2F3I A;  3H09 A;  4B3M L;  4XQQ A;  1S5B D;  3K57 A;  1PH5 A;  4MZ9 A;  1E2W A;  2CW0 C;  1IYU A;  3T4A C;  4JI3 Q;  4BXX G;  2JA9 A;  4JBJ A;  5IGD A;  1RD9 D;  5J39 A;  5EGT A;  3UDX A;  1GUG A;  2QEX A;  4F87 A;  4LFA L;  5EKK A;  3CAM A;  2J4X A;  3OW7 A;  1KQS A;  3OWF A;  2R7F A;  4JI5 L;  2IL8 A;  4ZQ3 A;  2FJ2 A;  3A5U A;  4ME3 A;  1L0X B;  3KUP A;  3SGI A;  4LUO A;  1YNX A;  4DK0 A;  3W3A A;  1HUN A;  4IUT A;  3ITP A;  2RDG A;  2EYJ A;  3ULP A;  2EY1 A;  1LTR D;  2F0S A;  1PYB A;  4JI7 L;  4JOI C;  1CKN A;  3FDT A;  3PO3 G;  1X55 A;  1FJG Q;  4OWX B;  4JG2 A;  2UUB L;  2Z6K A;  3PO3 B;  2Z9H A;  2VQF L;  1N33 L;  2NTS A;  4C3H B;  2FMM A;  3HGB A;  5TSS A;  3ER0 A;  4BWG B;  4BY7 H;  2A6E C;  3VYT A;  1H9S B;  1B3Q A;  3MAQ A;  1SLJ A;  1B9N A;  5CBE E;  5CV6 A;  1SE4 A;  2LXJ A;  1SAP A;  3I70 A;  1HZ9 A;  1L2F A;  2E5L Q;  3CRK C;  2EY6 A;  2K5W A;  4DK1 A;  4OX9 Q;  1U4R A;  3I3C A;  3GD7 A;  2A69 D;  3HP3 A;  2ID0 A;  3J80 L; 
#chains in the Genus database with same CATH homology
 2IX0 A;  3CC4 A;  2BH2 A;  1B8A A;  1CKM A;  5EAY A;  4LF4 Q;  5J3B A;  1UWV A;  2JJQ A;  1XNQ Q;  1QZH A;  4R4T A;  2UUB Q;  2RCN A;  3J80 c;  1VQB A;  4UP9 A;  2Q2T A;  1HJP A;  1OXT A;  5FLX c;  4GLA C;  2VQE L;  1PYS B;  4DV1 Q;  4YHH L;  1PH6 A;  2VQF Q;  4JI8 L;  1N33 Q;  1G29 1;  3K7A H;  4IJH A;  3GTJ H;  4GOP C;  1S3O A;  3TQY A;  3ZJY C;  4DV0 L;  4GKJ Q;  1J6Q A;  1WI5 A;  2JA8 H;  2N78 A;  3TS0 A;  1IZ6 A;  4L5Q A;  4HIK A;  3A0J A;  4IPC A;  1XPU A;  3PUY A;  4L5S A;  2VS1 A;  3F2C A;  4FDB A;  1E24 A;  4OO1 G;  2IY5 B;  3NEL A;  2F52 A;  4BBR H;  4A93 H;  2YTV A;  4X64 L;  3HOU H;  1PH4 A;  1X6O A;  2BA1 A;  2PI2 E;  2V1C C;  1OXS C;  2ZJQ A;  3J80 i;  1N34 L;  4A3F G;  3GTM H;  2IT1 A;  2AWO A;  4O0A A;  3I56 A;  1N32 Q;  4B3T L;  4DV5 Q;  5IP7 G;  1VQ4 A;  1KD1 C;  1EWI A;  2GVA A;  3GTP H;  5GQO A;  1VQN A;  4JI1 L;  1EFW A;  3GTK H;  3PSI A;  1WYD A;  2JQO A;  5LMU Q;  4DK6 C;  3I4M H;  4P72 A;  4B3S L;  4R1J A;  4HJ5 A;  1PHJ A;  1GD7 A;  1Q1B A;  1VQE A;  1K83 H;  5M5W H;  5IWA L;  4X62 L;  3VDY A;  1JMC A;  1VQ8 A;  1VQK A;  2EXD A;  3HOZ H;  4IPD A;  4X6A H;  1S40 A;  4LF8 L;  2K52 A;  2VQE Q;  1MJC A;  4JI6 L;  2N8N A;  3BZC A;  4JI8 Q;  3S2D H;  2UXD Q;  4QY7 A;  2DUD A;  1SE8 A;  4EQ5 A;  4DV0 Q;  2YTX A;  1VQL A;  4DR7 Q;  2K5H A;  5IP7 H;  4DV2 Q;  1YHA A;  3RLN A;  4Y7N H;  3GDE A;  1UEB A;  5IYB G;  2VL6 A;  1I94 Q;  4LF5 L;  1IYJ B;  1K8A C;  4LF9 L;  1W2B A;  1XMQ L;  3S1N H;  1N34 Q;  1VQI A;  1RL2 A;  2MFI A;  3HOX G;  4B3T Q;  4BA2 I;  4BY1 G;  3G6E A;  2Z6K C;  4JI1 Q;  4HJ7 A;  2ASB A;  2C35 B;  1ASZ A;  5JJI A;  3CPF A;  2JA7 H;  1WOC A;  1OXV A;  1KAW A;  5IT9 c;  5C3E G;  4B3S Q;  1I50 H;  3IRB A;  1PA6 A;  3GTO H;  1FVI A;  4X65 L;  3RZO H;  4X62 Q;  3UE0 A;  2N3S A;  2KHJ A;  4YY3 L;  3CCE A;  3CCS A;  1VQ5 A;  4IFD J;  1FL0 A;  1OXU A;  3PUX A;  1VQP A;  1CSQ A;  1EIY B;  3M3Y H;  4LF8 Q;  1VQC A;  4PZ8 A;  4JI6 Q;  4A3B G;  1VQ9 A;  1VQH A;  1NBW A;  1WFQ A;  5GAG C;  2AWN A;  2JA5 H;  1SRU A;  2CWP A;  4JV5 L;  4GNX A;  3HOX H;  1KL9 A;  2UUA L;  4KHZ A;  4QGU A;  1A8V A;  4IPG A;  2HT1 A;  4DR3 L;  4BY1 H;  3KF8 B;  5C0X I;  3GO5 A;  2QGQ A;  2VUM G;  3TS2 A;  1PH1 A;  2EIF A;  5C3E H;  5K36 G;  3S1R H;  3M7N A;  4A3C H;  1XMQ Q;  3NBH B;  1CKO A;  2OWO A;  2K14 A;  5IYC G;  5C44 G;  1MJE A;  2YU9 H;  1VQ6 A;  4DR6 L;  1NJI C;  4NXM L;  3EBE A;  4LUV A;  5FJ8 G;  1K0R A;  4BXX H;  3H3V I;  2E2H H;  1SFO H;  1JE5 A;  3KFU A;  3BZK A;  1KHI A;  1OXX K;  5E7N A;  4GNX B;  4HJ9 A;  4JYA L;  1LM0 A;  1Z47 A;  2RF4 A;  3DLL A;  4BBS G;  1VQM A;  3M4Q A;  1EYG A;  2UUC L;  1I5F A;  5GRO A;  2RHQ B;  5HY6 A;  4YY3 Q;  3L0O A;  2QA4 A;  3UDI A;  1Q86 C;  4L5T A;  2NZH A;  3W1B A;  4JBM A;  3HOY H;  1JT8 A;  4JC0 A;  3W1G A;  4IOA A;  1JJC B;  3UE1 A;  1DGS A;  3CCQ A;  4DUZ L;  3OW2 A;  4A3E G;  3RLO A;  4YWM A;  5FJ8 H;  4JV5 Q;  1BVS A;  5HGQ A;  1YBY A;  2VZA A;  2Q2U A;  2UUA Q;  3E0E A;  4DR3 Q;  1ASY A;  4DR1 L;  3ICE A;  1VCI A;  1OTC A;  2IHE A;  5FLM G;  1PH7 A;  3L2P A;  3M4O H;  4BBS H;  3FKI H;  3F8T A;  1V43 A;  4JBK A;  3HOW G;  1BBW A;  4DR6 Q;  2K50 A;  3T1Y L;  4NXM Q;  2CWA A;  3I55 A;  3KJP A;  2AMC B;  1Q8K A;  4PG3 A;  5C4J H;  1GVP A;  5C4X H;  4JI0 L;  5JJL A;  3G48 A;  1YI2 A;  4JYA Q;  1N9W A;  1RIP A;  3U58 A;  2WP8 J;  4RG1 A;  4POG A;  1K73 C;  4PZ6 A;  1UE6 A;  4TVA B;  4C2M H;  2UUC Q;  2UXC Q;  1J5E L;  2L15 A;  4K0K L;  2D62 A;  5FLM H;  2KCM A;  3ERS X;  3U4Z A;  1UE1 A;  4AQY L;  4GLV B;  3HOW H;  3FHW A;  4HJ8 A;  1R9T H;  1EQQ A;  1TWF H;  4PZ7 A;  1X3F A;  1NMG A;  1HR0 W;  4DR5 L;  4DR1 Q;  4DR4 L;  3KYH C;  2I5L X;  1WJJ A;  4IJL A;  3S15 H;  2GVB A;  3T1Y Q;  1NMF A;  4Y52 H;  1XNR Q;  1NTG A;  2ZTE A;  3OTO L;  5M3M G;  2VNU D;  2JEB I;  5M3F G;  2HIV A;  4DUY Q;  3CCL A;  1BBU A;  4HJA A;  4LFB Q;  1Z9F A;  4JI0 Q;  4GKK L;  4A76 A;  1L1O B;  3TEH B;  3CCM A;  1D8L A;  4YWL A;  4IO9 A;  2N49 A;  4H02 A;  1YHQ A;  4DV3 L;  1JJG A;  1VQ7 A;  1IBL L;  4UP7 A;  2RHS B;  4DKA C;  2UXD L;  2E2J H;  1J5E Q;  4YHH Q;  1O7I A;  3K7U C;  3HKZ G;  4TQU S;  4OWW B;  2NVQ H;  4AQY Q;  4A3F H;  4KI0 A;  2HQL A;  2JK8 A;  4A3L G;  5LMN L;  2D0P A;  1EIF A;  4LW1 A;  2B63 G;  2WB1 G;  4A3I G;  2ZM6 L;  3CC2 A;  2XTI A;  5M3M H;  1PVO A;  1UE7 A;  1IBM L;  4OXP A;  5M3F H;  1VQG A;  1XTD A;  1YIT A;  3HFZ B;  4R4Q A;  4DR5 Q;  1PH8 A;  1YZ6 A;  4DR4 Q;  4R4O A;  2Y0S G;  4X66 L;  4DPG A;  2YYZ A;  4X64 Q;  4LF7 L;  2R92 G;  4OWT B;  4B3R L;  1G6P A;  4A93 G;  3E9H A;  3STB D;  3CCJ A;  1SN8 A;  1KXL A;  3GTQ H;  3OTO Q;  1NE3 A;  2Z0S A;  3NEN A;  5AJ3 L;  4UY8 C;  3K80 C;  3E9I A;  4YWK A;  2YTY A;  1EQR A;  3ULL A;  1HNW L;  4GKK Q;  1I6H H;  4A3L H;  2MO0 A;  2AHO B;  5IWA Q;  1GM5 A;  4DV6 L;  4UP8 A;  4A3I H;  2CCZ A;  1W3S A;  2B63 H;  3RLF A;  3GTG H;  3K81 C;  3I4O A;  5H1S E;  1E3P A;  5IYB H;  4DV3 Q;  3LGJ A;  5GAH C;  2XGT A;  3G4S A;  3F2D A;  4HIO A;  2PNH A;  3W5O A;  4DAM A;  1C7Y A;  1IBL Q;  2NVX H;  1EOV A;  4IFD I;  2GN5 A;  1C9O A;  2R92 H;  2EQS A;  2PMZ E;  3L7Z C;  2UXC L;  3PF4 A;  5LMN Q;  3S16 H;  2ZJR A;  3H0G G;  1AE2 A;  3ULJ A;  1IBM Q;  4QL5 A;  4EX5 A;  5BR8 L;  1Q81 C;  2A1A A;  4A3B H;  3M4P A;  4LF5 Q;  3KJO A;  3U50 C;  4LF9 Q;  4X66 Q;  2F4V L;  1Q1E A;  4LF7 Q;  4GOP B;  3RN2 A;  1QUQ B;  4B3R Q;  4QQB X;  1YVC A;  3KF6 B;  2R93 G;  4DK3 C;  2UU9 L;  1Q82 C;  2K5N A;  3HKS A;  4GLX A;  3KDF B;  3CCU A;  3D31 A;  5AJ3 Q;  3I4N G;  2ATW A;  1VQD A;  2ZTC A;  1NY4 A;  2KCT A;  1HNW Q;  2JE6 I;  3HKZ E;  4X65 Q;  2KHI A;  3MEF A;  1KIX A;  2JEA I;  2VUM H;  4DV6 Q;  1YJ9 A;  4P75 A;  4P71 A;  2E2I H;  4A3M G;  2ES2 A;  4JI4 Q;  1KRT A;  4WJ3 M;  3CF5 A;  1UE5 A;  2K4K A;  1JB7 A;  4POF A;  3TRE A;  4UPA A;  5C44 H;  5IYC H;  2WAQ G;  4HID A;  1Q46 A;  4OO1 I;  2Y0S E;  3A5Z B;  2R93 H;  4LWC A;  4OX9 L;  4JI2 L;  4A75 A;  4IOC A;  1Y1W G;  4A3G G;  3AEV A;  3I4N H;  2A8V A;  3K8A A;  3I2Z A;  1E1O A;  2H5X A;  5BR8 Q;  4A4I A;  3CC7 A;  1K9M C;  1IL2 A;  2F4V Q;  1I3Q H;  4C3J H;  1XNQ L;  2NN6 I;  5IP9 G;  2K75 A;  3CPW A;  1PH3 A;  1KRS A;  4XTC S;  3PO2 G;  1VQJ A;  4A3D G;  1L0W A;  1XMO L;  4LFC L;  4A3M H;  3WWV A;  4A3K G;  2UU9 Q;  2KBN A;  3M9B A;  1QVG A;  1TWG H;  3HOV G;  4MNO A;  4NB3 A;  4A3E H;  2OTL A;  1VQF A;  2BH8 A;  5GAE C;  1HZB A;  4IFD G;  4DR2 L;  3PIO A;  3KLW A;  5M5X H;  3S17 H;  2VY3 A;  2MQH A;  1CKN B;  1HNX L;  4A3G H;  1XPO A;  1X65 A;  3FP9 A;  2HIX A;  3AYH B;  2B29 A;  5C0X G;  1B70 B;  1YJN A;  4DUZ Q;  1N32 L;  1HZA A;  1Y14 B;  2I5H A;  2NZO A;  5IP9 H;  3G71 A;  4A3J G;  2JA8 G;  1WCM G;  2BA0 A;  3PO2 H;  4A3D H;  4P73 A;  1HZC A;  3AQQ A;  3D0F A;  4JI2 Q;  3RN5 A;  1L1O A;  1HH2 P;  2K5V A;  1P16 A;  4BBR G;  2NVY H;  3HOV H;  5IYD G;  3EIV A;  1A62 A;  3OYY A;  3Q8D A;  3CXC A;  3CD6 A;  1YHB A;  4JCV E;  4LF6 L;  1VQA A;  2ZTD A;  4DV7 L;  2VW9 A;  2R7Z G;  2Q2I A;  3RR5 A;  5ELN A;  3PF5 A;  1A0I A;  1H95 A;  1TWH H;  2E8G A;  2UXB L;  1BKB A;  1XMO Q;  4LFC Q;  4JOI A;  4YCU A;  2IX1 A;  4OON A;  2PQA B;  2D0O A;  3I4M G;  3GTL H;  4DR7 L;  3J7Z C;  4BA1 I;  3STB C;  3U4V A;  3J7A 5;  1X3G A;  4A3J H;  5JJK A;  1WCM H;  4P74 A;  1LTL A;  4APV A;  4DV2 L;  4DR2 Q;  4DNI A;  2MNA A;  3M85 A;  2WAQ E;  4GNX C;  3HOZ G;  1I94 L;  1TWA H;  1HNZ L;  1HNX Q;  4AH6 A;  1PH2 A;  3H3V H;  3S1M H;  4K0K Q;  4R4I A;  5IYD H;  1X3E A;  2CFM A;  3J81 c;  4JBW A;  4R4C A;  1T9H A;  3PUW A;  4QIW E;  2R7Z H;  3H15 A;  4AYB G;  4ALP A;  1XPR A;  1X9N A;  5JEA G;  1JJ2 A;  4GN5 A;  1IXR A;  3T1H L;  1XJV A;  2JA6 G;  2KEN A;  1E1T A;  1V9P A;  1SR3 A;  1X54 A;  2NN6 G;  2R6G A;  1SRO A;  4GN4 B;  2R7D A;  3PUV A;  1B7Y B;  4XIG S;  4DV4 L;  2LXK A;  1MKH A;  2LSS A;  2YV5 A;  3BU2 A;  1S72 A;  4LF6 Q;  4DV7 Q;  1U0L A;  3TRZ A;  4JI3 L;  1G51 A;  3F2B A;  5DLQ E;  3UDF A;  3CCR A;  3CQZ H;  1YJW A;  2HHH L;  3J81 i;  4LUZ A;  2I0Q A;  1P8L A;  3S14 H;  4QJF A;  1Y1V G;  2UXB Q;  1AH9 A;  2JA7 G;  2WFW A;  1TWC H;  3CME A;  2OCE A;  3PIP A;  1N36 L;  4WJ4 A;  4GN3 B;  2A19 A;  3J81 j;  2Q2H A;  4NXN L;  1AE3 A;  3JAM c;  4J15 A;  3CCV A;  1KC8 C;  1QVC A;  2JA6 H;  1PFS A;  1A63 A;  1C0A A;  4GOP A;  1QUQ A;  3AFQ A;  1HNZ Q;  4JI4 L;  1Q12 A;  3PCO B;  3KOJ A;  3S2H H;  3NEM A;  3KF6 A;  2OQ0 A;  1N8R C;  2OQK A;  4KHP L;  3PV0 A;  4DAY B;  3JC6 6;  2DGY A;  3RNU A;  4IPH A;  2JA5 G;  3KDF A;  4RMF A;  1MIU A;  3B6Y A;  3PGZ A;  3S1Q H;  2ZM6 Q;  3T1H Q;  1Y1V H;  3K0X A;  2CKZ B;  2OTJ A;  1V1Q A;  3CP0 A;  1YIJ A;  4LNQ A;  2F3I A;  3JAM i;  4B3M L;  4YCV A;  1FJG L;  2NVT H;  4DV4 Q;  4HIM A;  4A3C G;  1E22 A;  1PH5 A;  3EN2 A;  4MZ9 A;  4BXX G;  3A74 A;  3MXN B;  4JI3 Q;  2HHH Q;  2ZJP A;  4KLK A;  4MTN A;  2JA9 A;  4JBJ A;  1HR0 L;  1U5K A;  3UDX A;  5GAD C;  2QEX A;  4LFA L;  3CAM A;  2CQO A;  3I7F A;  1N36 Q;  5C0X J;  1CUK A;  3UDG A;  4NXN Q;  1KQS A;  3H0G H;  2PI2 A;  2R7F A;  4AYB E;  3PUZ A;  3HOY G;  4YCW A;  4JI5 L;  2WB1 E;  3A5U A;  1L1O C;  4ME3 A;  3SGI A;  2E5L L;  3S24 A;  4LUO A;  4L5R C;  1YNX A;  4KHP Q;  1QVF A;  1QZG A;  4PMW A;  4BY7 G;  2ALY B;  1IBK L;  3ULP A;  4NPS A;  1PYB A;  4O2D A;  1LUZ A;  3CW2 C;  4JI7 L;  4JOI C;  1CKN A;  5LMN W;  1FGU A;  4B3M Q;  1X55 A;  4LF4 L;  3FKI G;  1FJG Q;  5ELO A;  4OWX B;  3PO3 G;  1E7Z A;  4JG2 A;  2UUB L;  2MO1 A;  1YEZ A;  1PV4 A;  2I5M X;  3F1Z A;  1M90 C;  2Z6K A;  4DV1 L;  5IY0 A;  1VQO A;  2VQF L;  1N33 L;  5C4X G;  4GKJ L;  1HR0 Q;  4AIM A;  3BJU A;  2FXQ A;  4LFA Q;  3ER0 A;  1VS0 A;  3DM3 A;  1SMX A;  4BY7 H;  1X56 A;  1K8G A;  1LYL A;  1Y1W H;  3CMA A;  1SLJ A;  3AFP A;  1Q7Y C;  5JEA J;  4JI5 Q;  1PH9 A;  2LXJ A;  3PO3 H;  1GO3 E;  1HZ9 A;  1L2F A;  4GS3 A;  2E5L Q;  1K3R A;  1TXY A;  1M1K C;  4DV5 L;  4C3H H;  3RZD H;  1XNR L;  2B3G A;  2PQA A;  1EUJ A;  1CSP A;  1GKH A;  5M5Y H;  4OX9 Q;  5LMU L;  3GD7 A;  2IHF A;  4A3K H;  1IBK Q;  1D7Q A;  4DUY L;  4C3I H;  5IE8 A;  4LFB L;  2AKW B;  3HOU G;  2ID0 A;  4JI7 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...