1YHBA

Crystal structures of y41h and y41f mutants of gene v protein from ff phage suggest possible protein-protein interactions in gvp-ssdna complex
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
87
structure length
87
Chain Sequence
MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEFPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords GENE V PROTEIN
publication title Crystal structures of Y41H and Y41F mutants of gene V protein from Ff phage suggest possible protein-protein interactions in the GVP-ssDNA complex.
pubmed doi rcsb
source organism Enterobacteria phage f1
total genus 9
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 1994-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1yhbA00
3JC66 5IP9H 3S16H 4IJHA 2A1AA 2PI2E 1N36Q 4KLKA 2QGQA 1VQAA 4X64Q 1XNQQ 5IYDH 3BJUA 1SE8A 4PZ7A 1KAWA 4A3LG 1J5EQ 4LFAQ 4KHZA 5JJIA 2UUBQ 1NBWA 5IWAL 4QIWE 1MJEA 3H0GH 4LF7L 1L0WA 3UDXA 1G51A 1YZ6A 2JEBI 1YJWA 1CSQA 1EUJA 2KCMA 4A3KG 1VQLA 2CCZA 2HHHL 5FLMH 4ALPA 3J81c 1U0LA 3D31A 3EN2A 5FLXc 1YI2A 1GKHA 5IWAQ 1LTLA 1KRTA 4LF7Q 3S1MH 1NE3A 1I3QH 1PYSB 2N49A 4HIDA 1PH2A 1MIUA 2NZOA 4R4CA 1EOVA 3JAMi 4DR7L 1Q8KA 2YU9H 1VCIA 2OQKA 3L7ZC 1TWCH 2HHHQ 2UUBL 3S14H 1SMXA 3H3VI 1VQPA 1E3PA 3RZOH 3CQZH 5C4XH 2RF4A 4GOPC 4GLXA 1GVPA 2BH8A 3PCOB 2N78A 2NN6I 1QUQB 5FJ8G 4X65L 4L5QA 4LUOA 4A75A 2MNAA 3UDGA 4YWLA 1IBMQ 2EXDA 4R4OA 4A3FG 1Y1WH 3PO2H 1VQIA 3CCQA 4DR7Q 2AWOA 5GADC 3K7AH 3PUVA 3HOVG 3W1BA 5ELOA 5GQOA 1CUKA 2E2IH 3CD6A 4WJ3M 4JI3L 3CW2C 1YNXA 1D7QA 3CMAA 3U4ZA 4DV7L 4X65Q 4POGA 1I50H 1FGUA 4DV6L 3KYHC 4JI4L 3S17H 2VZAA 2WP8J 4AIMA 4EQ5A 5IY0A 3KJOA 3STBD 2A19A 2OQ0A 1X6OA 1YJNA 2R7ZH 5IP7G 1XJVA 2OTJA 4KHPL 1OXSC 4DR3L 4AQYL 1VQDA 3AQQA 4LW1A 2K5NA 3GTJH 2JA8G 3K7UC 1HNZQ 2RHQB 4DV7Q 4OWTB 3SGIA 1SRUA 4DV6Q 4C3JH 3KF6A 1S3OA 1VQJA 4NPSA 1X55A 3GD7A 1E1TA 4X66Q 3J81i 2CKZB 1VS0A 4KHPQ 4AQYQ 3TQYA 1OTCA 2ZTEA 2MO0A 2Q2IA 4YCWA 4DV1L 3WWVA 2R93G 1XMQL 2E2HH 5M3FG 2PQAA 1JT8A 4LF4L 2B29A 4WJ4A 1Q1EA 4DR2Q 1K8GA 1Y1VH 3OYYA 1TWFH 1C9OA 4QJFA 4BBRG 1XMOQ 1WJJA 3U50C 2JA7G 2DGYA 2KHJA 4JI2Q 4DV1Q 2N8NA 3RZDH 1BBWA 5M3MG 2Z6KA 2AMCB 4UPAA 5C4JH 1XMQQ 1N8RC 2NVXH 2ZJQA 4LF8L 4JI1Q 1JJGA 2VL6A 4HIMA 4LF4Q 1Q82C 4GKKL 3G48A 3A5UA 4BA2I 1FL0A 3IRBA 3RLNA 1L1OC 1VQGA 1WFQA 1V9PA 3GTGH 2JE6I 2I5LX 1VQ7A 1G291 5BR8L 3U58A 3HKZG 1Y14B 2CWAA 5M5XH 4LF8Q 4LFBL 3M4QA 1EQQA 2BA1A 1PFSA 1IZ6A 3B6YA 4A3EH 4GNXC 4GKKQ 2WAQG 4BY1H 3H15A 3HOXH 2CWPA 2VQEL 4IO9A 4MNOA 3ICEA 1HNWL 1PVOA 5BR8Q 5GAHC 4BXXG 4JOIC 1V1QA 1PH1A 4LFBQ 3EIVA 5GROA 4GLVB 3KF8B 4DAYB 4K0KL 1Q1BA 2VNUD 4A3JH 1A63A 4Y52H 3TEHB 3K0XA 4LF9L 2QEXA 3KF6B 3PV0A 4X62L 2PMZE 4UP8A 2VQEQ 4NB3A 1HNWQ 2JA6H 1X65A 4GN3B 2I0QA 1GM5A 1WCMG 3CCVA 1Q81C 3NBHB 1X3EA 4NXMQ 3HOYG 4X64L 1XNQL 5C0XJ 4K0KQ 3I2ZA 3HOZH 3OTOQ 2JA5H 2GVBA 4LF9Q 1PH4A 3T1HL 2PQAB 1CKNA 4TVAB 4X62Q 3OW2A 4YWMA 4P72A 2B63G 1UE7A 4DV3L 4GS3A 1NTGA 1YHAA 1G6PA 4A3CH 1DGSA 1FVIA 4P75A 4C3HH 2NN6G 2YYZA 3M9BA 4ME3A 4A3IH 1NJIC 4HIKA 1X3GA 1M1KC 2KENA 5C0XI 2HIVA 3T1HQ 4JBKA 3S1RH 3EBEA 3GDEA 2K4KA 4IPGA 1IL2A 3J7A5 1HZ9A 1KXLA 1UE6A 1UWVA 2K52A 2KBNA 1Z9FA 3F1ZA 4AYBE 2UXBL 2I5MX 4DV3Q 3ER0A 3I7FA 3M3YH 1OXVA 5IYDG 1N33L 2N3SA 4HJ9A 1K73C 3CCLA 1BVSA 4GNXA 5EAYA 3PGZA 4A3LH 5LMNL 4B3ML 2WB1G 3GTMH 1HJPA 4DR5Q 2NVYH 1MJCA 2UXBQ 3U4VA 2AHOB 3D0FA 3DM3A 2OTLA 1MKHA 3S1NH 3S24A 3PF5A 1N33Q 4A3KH 3I4MG 4B3SQ 2R6GA 5C3EG 4X6AH 5LMNQ 1WOCA 4B3MQ 4LFCL 4YHHL 3HKZE 1PH8A 3BZCA 4JBWA 5IYBH 4APVA 3KJPA 2R92H 3PUZA 3NENA 4DPGA 5M5YH 1IBKL 2E5LL 4LUVA 2ES2A 1SN8A 1XPUA 1J6QA 3AFPA 2CQOA 2WAQE 4A3MH 1E1OA 4YCUA 2VUMH 2UXCL 1VQMA 2Q2UA 3PF4A 3S15H 2B3GA 3FHWA 4LFCQ 4YHHQ 2GVAA 3G4SA 4JI6L 3UE0A 2VW9A 1HNZL 5FJ8H 3L2PA 1IBKQ 4A93G 3PUYA 1CKNB 4HJ5A 3RNUA 1KRSA 2E5LQ 1VQNA 1GD7A 4A3FH 1Q7YC 2HT1A 1TWAH 2KCTA 3HOUG 2KHIA 3GTQH 3M4PA 4YCVA 3HOVH 2UXCQ 1H95A 3PIPA 1B70B 4X66L 1KL9A 1IYJB 4KI0A 2JK8A 2BA0A 4L5TA 4YWKA 1JB7A 4JI6Q 3I4NG 4JBJA 1VQOA 2F3IA 3I4OA 3CMEA 1OXXK 1HZBA 4OONA 1K83H 1LYLA 2K75A 5GAGC 2F4VL 2IX1A 3RR5A 4IPHA 3J80c 2R7ZG 4DR2L 2K14A 5JJLA 1XMOL 5E7NA 5LMNW 3W5OA 1PH9A 2JA8H 4GNXB 4J15A 4JI2L 3FP9A 1UE1A 2A8VA 3CCEA 1PHJA 1YIJA 4AYBG 4R4TA 4JI1L 2F4VQ 1RIPA 4A3BG 4DR4L 4OO1I 1JE5A 3A0JA 3PUWA 2E2JH 4DV0L 2D62A 1YITA 5C44G 1T9HA 4BY7H 1EWIA 1D8LA 4GOPA 3LGJA 2DUDA 1SR3A 3DLLA 4JI7L 3K80C 4PMWA 2R93H 3CCSA 2JJQA 4LWCA 1Q86C 5M3FH 3KOJA 4DR4Q 3PSIA 1Y1VG 2WB1E 4IPDA 1EFWA 3ULJA 3CF5A 3FKIG 4DV0Q 5JJKA 1VQCA 5IE8A 2JA7H 3J81j 3CCMA 1QVFA 4IPCA 1LM0A 4JI7Q 4MTNA 4PZ8A 1VQBA 2LXJA 2Y0SE 2YV5A 1HNXL 4IOCA 4A3GG 4GN5A 5JEAJ 3UE1A 3M85A 4A76A 4JI0L 3AFQA 1Q46A 4R1JA 1R9TH 1PH7A 3RLFA 2EIFA 3PO3G 5C0XG 4PZ6A 1K9MC 2ZTCA 3M4OH 4A3DG 3L0OA 4C2MH 5IT9c 4UP9A 1XNRL 4OX9L 1E7ZA 5DLQE 3F8TA 1HNXQ 1PYBA 1A62A 4NXML 3J80i 1ASZA 4BY1G 1VQ4A 1PH5A 5IYCG 3HOXG 4JI0Q 3OTOL 1W3SA 1YHQA 4QGUA 3AEVA 2R7DA 3GTPH 3CC7A 1KC8C 2UXDQ 4L5RC 5M5WH 1WYDA 1EQRA 1HZCA 1XNRQ 4OX9Q 3NELA 2IY5B 5K36G 3MXNB 2JQOA 4HJ8A 1K0RA 3KLWA 1P16A 2JEAI 2ZJRA 2JA6G 5AJ3L 1UE5A 1QVCA 4UY8C 4BBSG 3CPWA 3W1GA 2UXDL 3ZJYC 1I5FA 2Q2HA 2ZTDA 4GN4B 1N34Q 4B3RL 2LXKA 1VQ8A 2ZM6L 4GOPB 4JG2A 2IX0A 4DUZQ 2JA5G 3RN2A 1LUZA 1PV4A 4DR5L 5AJ3Q 1I94L 5IP9G 1L1OA 3CCUA 4R4QA 4IFDJ 1BBUA 1QZGA 3MEFA 3H3VH 4GLAC 3F2BA 3ULPA 2B63H 4XTCS 1VQEA 4A3CG 1VQ5A 4B3RQ 1O7IA 1NY4A 2ZM6Q 3CPFA 3G71A 4LF5L 4DR1L 1E22A 3HOWH 3TS0A 4JCVE 3RN5A 4JBMA 4B3SL 1X54A 1HH2P 1A0IA 1FJGL 4DK6C 5ELNA 1WI5A 2V1CC 1S40A 4DV4L 1I94Q 3H0GG 1B8AA 2OWOA 1SFOH 1QZHA 1HR0L 2H5XA 4IFDI 4OWWB 3BU2A 1EIFA 1YEZA 3TREA 4YY3L 4JOIA 1QVGA 5H1SE 3CC2A 4LF5Q 4DR1Q 2WFWA 1JMCA 4O0AA 1PA6A 2Y0SG 1TWHH 3AYHB 5FLMG 2ZJPA 1FJGQ 3GTOH 4FDBA 3KFUA 4A4IA 1TXYA 2EQSA 2MQHA 4DV2L 1K8AC 4DV5Q 4DV4Q 3S2HH 1HR0Q 3BZKA 1N32L 1KHIA 1EIYB 2FXQA 4YY3Q 2R7FA 2GN5A 2JA9A 4MZ9A 3KDFA 4DAMA 1S72A 3TRZA 1E24A 2E8GA 1HZAA 3I4MH 3GO5A 3T1YL 5C3EH 4OO1G 4LUZA 5C4XG 2IHEA 4DV2Q 2C35B 5IYBG 2R92G 2AKWB 3HOWG 3RLOA 2PNHA 3VDYA 1N32Q 4RG1A 1Y1WG 3CCJA 3PO2G 2VUMG 1CKMA 2IT1A 4HJ7A 4A3MG 1W2BA 2RCNA 2VQFL 1OXTA 1VQHA 4O2DA 4OWXB 3T1YQ 1EYGA 3K8AA 3A5ZB 2BH2A 1U5KA 1V43A 2IHFA 2Z6KC 5J3BA 4A93H 4QY7A 3S2DH 3HOUH 4JYAL 1L1OB 3CCRA 3PUXA 4JI8L 1SROA 2VQFQ 1VQKA 2VY3A 1A8VA 2K5HA 4QQBX 5IP7H 1VQ6A 2I5HA 2D0PA 3I4NH 1YVCA 1X9NA 4NXNL 1VQFA 2MFIA 1HR0W 4C3IH 4JYAQ 4QL5A 2K50A 4PG3A 3UDFA 4LNQA 4JI8Q 3CC4A 2YTVA 4B3TL 1PH3A 3HKSA 4JV5L 4JI3Q 4JC0A 3CP0A 1IBLL 1N9WA 2Q2TA 1C0AA 1K3RA 2D0OA 4DR6L 1TWGH 1JJ2A 2MO1A 5JEAG 3ERSX 4NXNQ 1B7YB 1X56A 4JI4Q 2AWNA 1JJCB 2F52A 4A3BH 1AE3A 3I55A 2OCEA 1KIXA 4BA1I 4B3TQ 4JV5Q 1AH9A 3F2CA 4DR3Q 4BY7G 5GAEC 4BBRH 3CAMA 1AE2A 3KDFB 4DUYL 5C44H 1IBLQ 4H02A 1KD1C 2UUAL 2ASBA 2VS1A 3HFZB 4DR6Q 1OXUA 4RMFA 2UUCL 4OXPA 5M3MH 5HY6A 2ID0A 4JI5L 4P71A 4Y7NH 1XTDA 1YJ9A 1RL2A 5LMUL 3E9HA 1YBYA 3FKIH 2NVTH 4GKJL 2ALYB 2UUAQ 4DUYQ 4IOAA 1UEBA 2HIXA 3PIOA 2UUCQ 2L15A 2UU9L 3NEMA 2Z0SA 1YHBA 3I56A 4JI5Q 4LF6L 4A3EG 1ASYA 1KQSA 1L2FA 4A3GH 5LMUQ 4UP7A 4DK3C 4GKJQ 3STBC 4TQUS 3PO3H 1XPRA 1GO3E 2RHSB 4A3DH 1XPOA 1N34L 1BKBA 2QA4A 2YTXA 1VQ9A 2UU9Q 2ATWA 2NVQH 1NMGA 3K81C 3CXCA 3J7ZC 4BXXH 1P8LA 4IFDG 2K5VA 1M90C 4DUZL 4A3JG 4LF6Q 1IXRA 5IYCH 2XTIA 2YTYA 2CFMA 3F2DA 3ULLA 4IJLA 1PH6A 1Q12A 4AH6A 3GTKH 2XGTA 1Z47A 4P73A 3JAMc 4L5SA 4R4IA 5HGQA 3TS2A 1WCMH 4XIGS 4DNIA 3HOZG 3HOYH 3GTLH 1QUQA 3E9IA 3S1QH 4P74A 1NMFA 3A74A 4HIOA 2HQLA 1IBML 3M7NA 1X3FA 3E0EA 4DKAC 4BBSH 2LSSA 4HJAA 1I6HH 3Q8DA 1C7YA 2PI2A 4EX5A 4A3IG 1N36L 2NZHA 3UDIA 1CSPA 1CKOA 1J5EL 4LFAL 4POFA 1SLJA 3G6EA 4DV5L
chains in the Genus database with same CATH superfamily
3JC66 5IP9H 2BDOA 5M5YB 1Y1WB 4N9TA 1ZXTA 1QJOA 1VQAA 4X64Q 2KCCA 2KUMA 2SOBA 3BJUA 4PZ7A 4A3MB 4A3LG 1J5EQ 4LFAQ 4CHTB 4DFAA 5JJIA 1TIID 2JN4A 1BCPF 1CHPD 4LJZC 3H0GH 3QR8A 1L0WA 4IUUA 4L8JA 4L6TB 1YJWA 1CSQA 1TWAB 4A3KG 2Z9HA 1S5FD 3GTJB 2EJMA 1PYSB 4KKSA 3Q23A 2CH4W 1RD9D 3JAMi 1TY0A 4FNFA 3L7ZC 3S14H 2B2YC 1SMXA 3J81L 4KV6A 3H3VI 4TSSA 5FLXL 5C4XH 2RF4A 5D14A 2BH8A 2N78A 3MC0B 4A75A 4LUOA 5E4WC 1Y1WH 5GADC 3K7AH 3Q22A 3NK9A 2K5DA 1HRJA 1CUKA 3JAME 4WJ3M 3DMUA 1D7QA 1ENFA 1IHZA 4DV7L 1C48A 1FGUA 4QIWB 1EU4A 3S17H 4JPBW 1PTOC 1YJNA 1XJVA 2PZWA 1B53A 2JA8G 3GTJH 1HNZQ 4G4KA 3KF8A 4DV7Q 5AFWA 3SGIA 3KF6A 1S3OA 3A7LA 2L4NA 4CJ0B 2K5QA 1K28A 3K5MA 2Q2IA 4TRDA 4IN3A 2MJ8A 3K5OA 4LF4L 4WJ4A 1K8GA 4DR2Q 1LTAD 1Y1VH 4J1MA 5C5LA 1XMOQ 4QUCA 4J6HA 3GTPB 2KHJA 4KMUC 2N8NA 3W3AA 5M3MG 3SK6A 1N8RC 3P20A 4LF4Q 2LY7A 1Q82C 3IRBA 5KNBA 1V9PA 5BR8L 3HKZG 1ZYRC 2RA4A 2O5JC 1ET6A 2F0OA 4RKLA 5M5XH 1EQQA 1O7ZA 4A3EH 1J9OA 4GNXC 4BY1H 2CHBD 3H15A 3FPPA 1ET9A 1PVOA 5EBDA 2E76C 5BR8Q 3KLSA 4JOIC 1V1QA 1PH1A 1EEFD 2B2UA 3K0YA 3V96A 4K0KL 1Q1BA 4A3JH 3K0XA 4UP8A 1CZWA 1X65A 2M00A 1PRTC 4HEDA 1O78A 1Q81C 4NXMQ 4K0KQ 1TWHB 2Z8LA 2GVBA 4TVAB 1EOTA 1BNZA 4YWMA 4P72A 4PMCA 3CRKC 4DNTB 4NDXA 1G6PA 5I6WA 1DGSA 1FVIA 4LAAA 4A3CH 2NN6G 2WINB 4LK1C 1NNXA 1LV9A 2HIVA 4JBKA 4XDXA 1ESFA 3GDEA 1HZ9A 1UE6A 1UWVA 2KBNA 1PTOD 5IGFA 2K04A 4HJ9A 3K5NA 1BVSA 5EAYA 3A8KE 4ZLTF 2WB1G 1GUWA 3BYTB 2NVYH 3EA6A 4DXGA 5D3IB 3S24A 3HOUB 2K7VA 1ENCA 4RCOA 4ZUIA 2F0NA 2EY6A 3D3RA 4FF2A 2R92H 1IBKL 4ZCKA 4LUVA 3E6ZX 5IT9E 3AFPA 2CQOA 4IUTA 2UXCL 1E1OA 1T5XD 2E2JB 2B3GA 3E5SA 1HA5A 1A3TA 1PTOF 3UE0A 1HA6A 2OEOA 1TWGB 2EYPA 3L2PA 1ONLA 1IBKQ 3LX0A 3PUYA 1KRSA 1EQVA 5I9OA 2KCTA 3Q24A 4AYBB 3M4PA 2UXCQ 3HOVH 4BBRB 1ZYRD 4JBJA 2F3IA 1PLFA 3CMEA 1HZBA 1K83H 2QKIC 2K75A 2F4VL 2K14A 3W5OA 1DOMA 4BS9A 2O4XA 3KBXA 1JR0D 1UE1A 3Q6SA 2WIIB 4JI1L 2F4VQ 4DR4L 4OO1I 3J80L 2E2JH 2B2YA 5HGTA 1PRTD 4BY7H 3NWTA 3CRLC 3LGJA 3C3LA 3K80C 4PMWA 2R93H 2JJQA 4K14A 5E4XA 4DR4Q 1Y1VG 2RBMA 4IPDA 3CF5A 4E6IA 5CYUA 5JJKA 4J8QA 3EVQA 1LTTD 1LM0A 4IPCA 5DM73 5IOCA 2AUJD 1VQBA 2AQ1B 1DOLA 1LLRD 1WCMB 1CI3M 4Q5VA 3M85A 3AFQA 1R9TH 1PH7A 5ISRA 4PZ6A 1K9MC 3M4OH 4BBSB 2XRQD 4UP9A 5G3LD 5T1IA 1FGBD 1RDPD 4BY1G 2F3VA 3OTOL 1YHQA 4H7BA 2N55A 5KNDA 1UUPA 3MXGA 1SFOB 3OWFA 3MXNB 4HJ8A 1K0RA 3A7AB 4PV1C 1HQRD 3PMFA 1RTNA 1UE5A 1MI2A 4K5WA 4OEMB 4DF7A 4CJ1B 5ELBA 1AZPA 4GN4B 2EVBA 2LXKA 2MHVA 2ZM6L 1LTBD 3I4MB 4HTHA 3MEHA 3OW7A 5G3LF 2EYFA 1QB5D 1XYIA 1BBUA 1QNKA 4A3CG 3VR6A 1NR2A 2JSOA 1G6ZA 1O7IA 2ZM6Q 5EQ0A 4JBMA 4C1NK 3PQIA 1XTCD 1FJGL 1A0IA 1TWCB 3RMHA 4F87A 3CQZB 4BWGB 4PQXA 2V1CC 1S40A 4DGZA 1SFOH 1IW7C 2H5XA 4A93B 4JOIA 1I6VC 1RJTA 4O0AA 4K2LA 1FJGQ 3H3VC 4A4IA 4DV2L 1K8AC 2A73B 3D8GA 4IUVA 1N32L 1TQOA 2R7FA 2JA9A 4MZ9A 1E24A 1HZAA 3I4MH 2E2DC 3VR3A 1SDFA 1ZKOA 5HURA 1UEAB 4DV2Q 2R92G 3HOWG 3VDYA 1N32Q 4G7HC 3PO2G 4G7OC 3T4AC 4QMGA 5EJWA 1W2BA 1VQHA 4KHVA 4OWXB 3IKJA 1EYGA 1L0YB 3A5ZB 1PMRA 1V43A 1DONA 2KQ3A 2Z6KC 4A93H 2DNCA 1U4LA 3MTSA 3PUXA 1TWFB 2K5HA 4FO2A 5IP7H 3P75A 1VQ6A 2I5HA 1JQYD 3RZDB 1YVCA 2MFIA 4C3JG 1LTRD 3OHXC 2EY5A 4FP5D 1LTGD 2ENBA 3DUZA 3HKSA 2BDNA 4DR6L 2D0OA 3FPUB 3GTGB 5JEAG 2PPBC 3PO3B 4A3DB 1TT2A 5I2XA 1X56A 2K6AA 2AWNA 2GA4B 3FMCA 3I72A 3LWEA 1AE3A 2HUGA 2OCEA 1AH9A 2Q8TA 3HOXB 4BY7G 1LACA 1SYDA 5C44H 5C5MA 4H02A 4CKBA 4RGMA 1KD1C 3GQBA 3HFZB 4DR6Q 1OXUA 4RMFA 5HY6A 3MA2B 1YJ9A 1KLUD 5LMUL 1HFNA 4GKJL 2ALYB 1UEBA 4QF4A 3P1HA 3IFTA 5EBCA 5C6AA 1WTRA 2F0EA 1WTPA 5LMUQ 1IW7D 3KBGA 4DK3C 4GKJQ 3STBC 5CR3A 3PO3H 1GO3E 5C0XH 4A3DH 4CDFC 1N34L 1VQ9A 2YTXA 1NMGA 3QB3A 4C3HB 2KVMA 4A3IB 1CQVA 4ABNA 1CZGA 1WTOA 2XTIA 3ULLA 3BVZA 2ZT9C 3GTKH 2XGTA 4IUQA 4R4IA 4YIJA 2KEEA 5K36H 1CTMA 1TS4A 3VYRA 3HOYH 3S1QH 2EYLA 2LFNA 3A74A 2HQEA 1M8AA 4ODGA 1VMPA 4ZUJA 3JAML 2PI2A 3S1NB 4EX5A 4A3KB 1CSPA 5I6YA 2R3ZA 3RZOB 3N6RA 1BQQT 2F0KA 4X3SA 1AN8A 5FK9C 1XNQQ 1MSGA 1SE8A 2Z4IA 1SMYC 1Q3LA 3V2TA 3S15B 5IWAL 1HTPA 1EU3A 1JC7A 2JEBI 5CC4A 2KCMA 4IURA 1VQLA 5FLMH 1U0LA 5IWAQ 1LTLA 1S5BD 1KRTA 5EPLA 1NE3A 2N49A 2PCFB 1Q8KA 4Q0FA 2IPKD 4RFBA 1ILQA 1B9MA 1VQPA 3RZOH 3I8ZA 3DWQA 2A69C 3I73A 4O1NA 1GVPA 1PTOH 3PCOB 2NN6I 1QUQB 2Q8RE 5JPMC 4K5XA 5A35A 4A3FG 1YNNC 1SE3A 5ELOA 2E2IH 4JI3L 3TP5A 1AW7A 1I50H 5C4JB 5EKIA 3KJOA 1B1ZA 3STBD 2OQ0A 5C4HA 1X6OA 1QCBD 5IP7G 4KN4C 1DZ1A 2SDFA 2EJFC 1VQDA 2RHQB 1VQJA 3OSOA 3GD7A 3Q0AA 5DM63 2CKZB 2D5DA 2OXPA 2M2LA 3VA5A 2MO0A 4YCWA 4DV1L 3WWVA 1EEID 2E2HH 2FJ2A 2AUKA 1LO5D 2CQAA 1RHPA 1CM9A 5IIFA 3P7JA 5ELDA 3BZDB 2PZUA 1PFBA 4JI2Q 4DV1Q 4LMQD 5BN5A 2Z6KA 5C4JH 5M5WB 1KDAA 2ZJQA 2NVXH 4LF8L 5J1ZA 4GKKL 1IKLA 3G48A 1BXTA 1FL0A 3RLNA 2ICEC 3R3OA 4QCLA 3A8JE 1VQGA 1VQ7A 4GZYC 1OO9B 2FINB 4LF8Q 1PZID 1IYUA 1AFPA 4GKKQ 2WAQG 5E1FA 2EYMA 4CKCA 3ICEA 2C5CA 4ZKBB 2KJXA 1SAPA 3M3YB 2WV6D 4GLVB 4IFDH 1A63A 5BN4A 1KLGD 4X62L 3EROA 3GTMB 3BVGA 4H0LC 2NB0A 1I4GA 1GM5A 1JWSD 2EYHA 1NCVA 5A2QE 1EY8A 1S5CD 3HOYG 4X64L 2A69D 1IL8A 3I2ZA 4HCSA 4X62Q 1Z6HA 4RH6A 4HMJA 1UE7A 4DV3L 1YHAA 1NJIC 4X3TA 4FXGC 1M1KC 2AQ2B 2KENA 1JWUD 2EYOA 3BG3A 3L9AX 3S1RH 4IPGA 2UXBL 1Z9FA 3F1ZA 4DV3Q 1X32A 3M3YH 2QW7A 4IQZA 1N33L 4B3ML 1O80A 5D3DA 3GTMH 1HJPA 1WVLA 1Z7TA 1MJCA 1Y8OB 2UXBQ 1B4OA 3S2DB 2HD3A 3D6WA 3NHHA 1N33Q 4KTAA 5C3EG 4B3MQ 1WOCA 4LFCL 3WOEA 3HKZE 4JBWA 5IYBH 3PUZA 3NENA 1EYDA 5BN3A 5M5YH 2FMMA 3HP3A 1XPUA 2RDHA 3E0JA 4A3MH 3VYTA 1VQMA 3FHWA 4LFCQ 5DNFA 4JI6L 3R8BA 1LT6D 1HNZL 5FJ8H 1D1IA 5ELCA 1CKNB 3VR5A 1VQNA 1GD7A 1Q7YC 1TWAH 5M3FB 2KHIA 4EGVA 2B2WC 2QEJC 4H44C 3PIPA 1IYJB 2JK8A 4JI6Q 2JA7B 3I4NG 2G9HD 4DXFA 1CK1A 1K8MA 5JAVA 1LYLA 3NUCA 5GAGC 2IX1A 1LT4D 4DR2L 1RODA 2F0TA 4KJOA 1XMOL 1WTVA 5E7NA 5LMNW 1E0BA 5JOBA 4J15A 3MXNA 3IAYA 4R4TA 1FYCA 4A3BG 1RIPA 3PUWA 2XIWA 4DV0L 4ZAIA 2F0GA 1EWIA 1D6EC 3TZDA 2F0WA 4KY5A 5M3FH 3PSIA 2DY7A 2WB1E 2D2CC 1SNQA 3OIQA 3ULJA 1EFWA 4DV0Q 1VQCA 2JA7H 1QVFA 4MTNA 2LXJA 2Y0SE 4C1NI 1HNXL 5JEAJ 3GTLB 2FMCA 1LABA 3L0OA 5IT9c 1HXYD 1I6HB 1F9QA 2RCFA 4OX9L 2B63B 1E7ZA 5DLQE 3F8TA 2K28A 1HNXQ 3KLRA 1PYBA 3HGBA 4NXML 1LTID 2KCNA 4K8JA 2R7DA 3SE0A 3GTPH 3CC7A 2QDBA 4L5RC 3WDNA 4N8X1 1EQRA 1K0SA 4OX9Q 3QWNA 3U9SA 1K8OA 4KJNA 3GV6A 1QVCA 4UY8C 2UXDL 3ZJYC 3SDZA 3S2HB 2ZTDA 4I7ZC 4IUPA 5JVH3 1VQ8A 1EQTA 1KNAA 1LUZA 4IUNA 2FHTA 5IP9G 4R4QA 1QZGA 3H3VH 2UXDQ 3AB9A 3F2BA 4DNRB 2B63H 4XTCS 3S1MB 5CV5A 2X69A 4HAEA 3G71A 4LF5L 1E22A 2YU9B 1X54A 1FD7D 4EQNA 5ELNA 3OIPA 1F77A 3H0GG 1B8AA 2RDFA 1JE4A 1STNA 3HOWB 1SNOA 2MP1A 4IZ8A 4YY3L 3PO2B 3T13A 5H1SE 4FVMA 4LF5Q 2ZXRA 1JMCA 1PA6A 2Y0SG 1TWHH 3AYHB 2ZXPA 1TXYA 4KK7A 4DV5Q 3S2HH 4ID6A 2OT2A 5I2YA 1EIYB 4YY3Q 1HCZA 1K3BC 2GN5A 1S72A 4C3IB 4K5VA 1D1KA 3GO5A 5ELEA 1WD1A 2R7ZB 5C4XG 5IYBG 1GUSA 2EZVA 5CGKA 2L11A 3HZXA 1SNDA 2PNHA 4RG1A 1Y1WG 2PZTA 4HJ7A 4C3JB 4A3MG 3UI2A 1OXTA 1GUOA 2JXMB 1QILA 1SNCA 2J7ZA 3GV3A 1H9JA 3I91A 1EWHA 1V1PB 3W2DA 5C3XA 1RTOA 4XT1B 2PYKA 3HOUH 4JYAL 4RGTA 1VQKA 1SROA 4FF1A 4Y7NB 1SJHD 3FKIB 4K6DA 4OL7A 1RF2D 2D0PA 1X9NA 1VQFA 4C3IH 2TMPA 4JYAQ 4PG3A 4LNQA 3MWYW 3CC4A 1DD2A 2YTVA 2BOSA 2EOTA 3EQLC 4B3TL 5FO9B 4A3GB 4JC0A 3MFGA 2WKCA 1K3RA 1TWGH 4WORA 3I4LA 3HS0C 1B3AA 2KECA 4JI4Q 2NVQB 4H13C 2F52A 1KIXA 4B3TQ 5KNCA 4DR3Q 5GAEC 4BBRH 3CAMA 3KDFB 2UUAL 2VS1A 4XQQA 1A2UA 3FRPB 1A15A 4OXPA 5KEEA 5CV8A 4JI5L 4Y7NH 1RL2A 2B2WA 1PZKD 1YBYA 3A55A 3FKIH 1G2SA 2UUAQ 4IOAA 2JA6B 3BDLA 1HTLD 3PIOA 4UAIA 3LNNA 2PW5A 2A68C 1ZEQX 5EKLA 2L15A 3NEMA 2Z0SA 1YHBA 5J22A 4JI5Q 3MXPA 4A3EG 1PRTF 1WTXA 1L2FA 4A3GH 2JA5B 1X3QA 5IGDA 4V190 3KUPA 1EY0A 2V4DA 2RHSB 3R93A 3S16B 1WTHA 1CQFA 1XPOA 2NVQH 4HSVA 3CXCA 4BXXH 2B39A 2K5VA 1M90C 4A3JG 1IXRA 5IYCH 3TDQA 1Y69U 3DWPA 4L5SA 3TS2A 5HGQA 1A6XA 1WCMH 4XIGS 3E3XA 3DWAA 1QUQA 3E9IA 4PMBA 1NMFA 4HIOA 1BCPB 2E75C 1KNEA 4DKAC 4BBSH 2LSSA 3V05A 2E74C 1FNUA 4RA8A 1H9KA 1G2TA 4X3KA 2O2LD 4HCEA 3C2PA 4ZKCB 1CKOA 4POFA 1L0XB 3G6EA 3S16H 4IJHA 4G7ZC 4KLKA 2QGQA 2VUMB 5IYDH 1Y8NB 3A8IE 1HHVA 1I4QA 3CHBD 4FF3A 4K8IA 4LF7L 1V8QA 1G51A 5CV6A 1YZ6A 2CH4A 3D4DA 2EY1A 4RHRA 4A3FB 4QB4A 1DYQA 2CCZA 3WOFA 2HHHL 1JOKA 3D31A 3G7LA 5F2DA 1YI2A 1GKHA 4LF7Q 4HR7B 1LT3D 1MIUA 4R4CA 3C1FA 4DN4M 1BUVT 1TS3A 2OQKA 1TWCH 2HHHQ 3CQZH 3NQIA 4OO1H 2XWJB 4GLXA 1AP0A 2G9DA 2WKDA 1EYAA 3UDGA 4L5QA 2EXDA 4R4OA 2SNSA 3CCQA 4JK1C 5K5PA 3HOVG 3RD4A 4JW0A 3SR1A 1NUCA 2A68D 1UAPA 2F0DA 5E3FA 1I4RA 3U4ZA 3EJIA 1GOZA 3KYHC 1MSHA 2VZAA 3C46A 4R8NA 4AIMA 1HQMC 1AEXA 2F1MA 2A19A 3HEJA 2OTJA 2TSSA 4KHPL 4AQYL 4LW1A 5DEHA 1IYVA 4U68A 3URYA 4OWTB 3BS1A 3PIP3 1E1TA 2EYJA 4X66Q 1VS0A 4B9WA 2IW3A 4KHPQ 4AQYQ 3TMEA 3TQYA 1OTCA 2ZTEA 1SEBD 1T5EA 2FFKB 2R93G 4RCNA 4I65A 1TWFH 2B2TC 4QJFA 4BBRG 2LKVA 3U50C 2L0CA 1YNJC 3ND9A 3RZDH 1U9RA 2A74C 4FYDA 4UPAA 2VL6A 3A5UA 3HOZB 4BA2I 3GTGH 1SBBB 3U58A 2XNAC 3O13A 4LFBL 2XVSA 2HCCA 1PFSA 1IZ6A 3B6YA 2XSCA 2EE1A 3HOXH 2VQEL 4IO9A 1S5DD 1R4PB 1TS5A 1MBYA 4BXXG 3M7GA 4LFBQ 1QOHA 2QILA 5GROA 4DAYB 2BE5C 2QEXA 3PV0A 5IGEA 2VQEQ 2PMZE 4B08A 4GN3B 2HDMA 2I0QA 1EZ6A 4F88A 4CDCC 2QCPX 1WCMG 3G6JB 3NBHB 1X3EA 1XNQL 3HOZH 3GTOB 1PH4A 3T1HL 2PQAB 1CKNA 1PXUA 1S5ED 1SNPA 3FEWX 3NXWA 4GS3A 4P75A 5LHY1 4C3HH 1JOOA 3M9BA 5I4DA 4A3IH 4HIKA 1F2YA 5FO7B 1H9MA 2K03A 2L55A 3T1HQ 1KTKA 3I90A 3J7A5 2K4KA 4KY7A 1IL2A 1KXLA 2K52A 2I5MX 3A54A 3U9OA 1OXVA 5IYDG 2K05A 2N3SA 3D4WA 3GTQB 1E2WA 4A3LH 5LMNL 2F0MA 1DJRD 4DR5Q 3QOLA 1RKNA 1PFMA 1SSOA 4KKTA 1ENAA 5FKAC 2AHOB 2LS01 3D0FA 3NTIA 3SXHA 3S1NH 3PF5A 4A3KH 3I4MG 3IFDA 4B3SQ 2R6GA 5LMNQ 1KABA 3TSSA 3BZCA 3KJPA 2JA8B 4DPGA 2ES2A 1SN8A 1TVXA 2WAQE 1BCPC 3RUZA 2Q2UA 1YNJD 1STGA 1NSNS 3S15H 4CJ2C 1LTSD 2GVAA 5EPKA 2VW9A 1B9NA 4A93G 1LT5D 2NUCA 2P5ZX 3RNUA 1EY7A 1BBXC 2DN8A 3GTQH 1H95A 4YCVA 4K2KA 4KI0A 4L5TA 1JB7A 3OMCA 5CBAE 1VQOA 3I4OA 2IJ0A 1OXXK 2OF1A 4OONA 5M3MB 5EKKA 5JPNC 4C56C 1STHA 5JJLA 3MXUA 2NVTB 1SJED 2XN9C 1PH9A 2JA8H 4GNXB 4JI2L 2AQ3B 4C2MB 3CCEA 3HKZB 3NE5B 2BE5D 2K01A 4XT3B 3A0JA 1AZQA 4F7XA 3NWSA 1SE2A 1YITA 5C44G 1STBA 3DLLA 3K57A 3NP8A 1GUTA 4LWCA 5FOBB 1Q86C 1A3UA 2ZXOA 4L63B 1JB3A 3TP6A 3K6OA 1EWCA 1G8ZD 3TZUA 3J81j 3CCMA 1SNMA 2KOLA 3N52A 2B2VC 4PZ8A 2YV5A 4IOCA 1VMCA 4EQPA 4MHEA 4JI0L 4X6AH 4R1JA 1I4PA 4P2CB 2KHSA 3RLFA 3PO3G 2MGSA 5C0XG 4A3DG 2ZTCA 4C2MH 2F0IA 1O7YA 1A62A 4DAVA 1ASZA 3DXJC 4DK0A 3HOXG 4JI0Q 1WTWA 1W3SA 3I3CA 1SYGA 4MN3A 3ZYYX 1BDOA 1KC8C 5IT9L 3J7YW 5M5WH 1WYDA 1HZCA 5K36G 5KGUA 2JQOA 3KLWA 4XQJA 2B2TA 1ICWA 5AJ3L 2WB1B 2CW0C 4ZK9B 3CPWA 3H0GB 3EFXD 1BCPD 1NR4A 4GOPB 1GUNA 1HPCA 4DUZQ 1HUNA 2Y0SB 1V1PA 1PV4A 4KN7C 5AJ3Q 2DNEA 1F9SA 3R2TA 1D5XC 1ML0D 1NY4A 3CPFA 2NN6H 1Q90A 2F0LA 3TS0A 3RN5A 1QNUA 1HH2P 1SYEA 2F0SA 3S14B 3DHQA 3SEBA 1WI5A 2J0TD 5CMDA 4OWWB 3J7AV 1EIFA 1YEZA 5FO8B 3CC2A 1CHQD 3K7AB 4G57A 5FLMG 3KFUA 1JWMD 2EQSA 2MQHA 2VB3X 3BZKA 4PNYA 1KHIA 5CBEE 2FXQA 2Q8IB 3S17B 4DAMA 3KDFA 4RHSA 2E8GA 1H9SB 4MTKA 2IHEA 3MFYA 1G91A 2F0HA 2L12A 2RCNA 2VQFL 4XQNA 1EY4A 4O2DA 5IGGA 3K8AA 3SK4A 2BH2A 1U5KA 3VR4A 4QY7A 1UNSA 3S2DH 1L1OB 2C9OA 3H94A 4NW2A 2VQFQ 2SNMA 2VY3A 5IGBA 1Y1VB 5KYLA 4QQBX 1GJXA 4NXNL 1HR0W 2K50A 3UDFA 4ZQ3A 2DJFC 2HCIA 1F2LA 2RKSA 1PH3A 5EGTA 1XXGA 3CP0A 4ZRZA 1C4QA 2Q2TA 1C0AA 1JJ2A 2F0QA 2EPBA 2MO1A 4M8AA 3ERSX 4NXNQ 1B7YB 1DXMA 1JJCB 5M5XB 3I55A 1MHWC 2CW0D 3VYUA 4A3EB 1BO0A 4BY1B 4ULLA 3QO2A 4DUYL 4FF4A 2IL8A 3R2IA 2UUCL 1Y8PB 5TSSA 1F2ZA 2ID0A 4A3JB 3NPPA 3E9HA 2IX3A 4DUYQ 5KIXA 1F2MA 2HIXA 2NZ1D 1CT1D 1O7LA 2UUCQ 2L5TA 5LL6S 1XWEA 4LF6L 3L3OC 1KQSA 3AMUA 4UP7A 1CFMA 4TQUS 1BKBA 2RDGA 3K81C 5D65A 3J7ZC 2I07B 2RSNA 3QJYA 4ME5A 4IFDG 4LF6Q 3NTHA 1TKWB 4N9PA 4NKLA 2YTYA 3SK8A 3F2DA 1PH6A 3CU7A 1EZ8A 2BCOA 3BDOA 1Z47A 3FDTA 4P73A 3TP8A 4M1UB 4DNIA 3GTLH 2HQLA 5KRUA 1IBML 2NVYB 1X3FA 1FNVA 5COYA 1I6HH 2B2VA 1I3QB 1C7YA 4MIUA 1N36L 3DEPA 2NZHA 1SYCA 5KYIA 1JCKB 2UUBL 4DV5L 1IBMQ 1B2TA 2B8FA 1GHKA 2R92B 2A1AA 1I4XA 2PI2E 1BR9A 5JVG3 1N36Q 3KK7A 1KAWA 4EQOA 4KHZA 4OHJA 2K32A 2UUBQ 1NBWA 4QIWE 1MJEA 2A6HC 3UDXA 5CV9A 1EUJA 2Z1CA 2I46A 3HOVB 2X6LA 5LL6X 4ALPA 3J81c 3EN2A 5FLXc 1BF4A 3FVQA 3S1MH 1I3QH 1PH2A 4HIDA 1F9RA 2NZOA 1EOVA 1K83B 4DR7L 1EYCA 2CVRA 2R61A 1GUGA 1HUMA 1S4ZA 2YU9H 1VCIA 4Z9CB 3DEOA 1E3PA 4DAPA 4GOPC 3LWUA 5FJ8G 4X65L 1EY6A 3HOWH 2MNAA 4YWLA 5CV4A 3PO2H 1VQIA 4DR7Q 2ICIA 2AWOA 3PUVA 3W1BA 5GQOA 1F9PA 3CD6A 1D5ZC 2XWBB 2J4XA 3CW2C 1YNXA 4BY7B 3CMAA 4X65Q 4POGA 4DV6L 1Q8IA 2LMCB 4EVOA 4JI4L 2R93B 1C8CA 2WP8J 5IY0A 4EQ5A 3T16A 2R7ZH 1B44D 1OXSC 4NP5A 4DR3L 2NBFA 3AQQA 1GHJA 2F0JA 2K5NA 3VYSA 3K7UC 1STEA 4DAYA 1D5MC 4N8FA 4X3UA 4DV6Q 1SRUA 2JP1A 4C3JH 5CV7A 3SHLA 4NPSA 1X55A 3X3MA 3J81i 2EY2A 1NAPA 1R9TB 3H6MA 2N88A 3NBHA 3M4OB 5C4ZA 5JEAH 1XMQL 1TS2A 4KKUA 5M3FG 2PQAA 1JT8A 1KDBA 2B29A 1Q1EA 1PZJD 3OYYA 1C9OA 1WJJA 2JA7G 2DGYA 3J81E 1BBWA 3DM1A 3BDCA 5FLXE 2AMCB 1XMQQ 1JJGA 1W6KA 4JI1Q 4HIMA 1U4RA 1L1OC 1WFQA 2JE6I 2I5LX 1G291 1Y14B 2CWAA 1RCVD 3M4QA 2BA1A 2A6HD 1JICA 3MVVA 2CWPA 4MNOA 1HNWL 1IKMA 4RWSC 2HDLA 4KD4A 4HSPA 5GAHC 3I70A 3QIAA 3EIVA 1II3A 4JVZA 1U4MA 3KF8B 2VNUD 1TY2A 4Y52H 3TEHB 4LF9L 3KF6B 2XRSD 1VF7A 4NB3A 2JA6H 1HNWQ 1FR3A 3QG1A 3OOCA 2KA7A 3VR2A 1TR5A 3CCVA 5NUCA 4HMIA 5C0XJ 3OTOQ 2JA5H 4LF9Q 3T53B 3OW2A 4CBVA 2B63G 1NTGA 2F4IA 3KLSX 2YYZA 4ME3A 3AU7A 2RSOA 1X3GA 1EIGA 5C0XI 4HN7A 1EFID 3EBEA 3H91A 2NTSA 1GXDC 4XYQA 4AYBE 4RGNA 3ER0A 3I7FA 3F2UA 1K73C 3CCLA 2EDGA 3D6CA 4GNXA 2F0FA 3PGZA 3ITPA 3CKIB 1CA6A 1KAAA 2A6EC 1JOQA 2WACA 3U4VA 2PMZB 4S3SA 3DM3A 2OTLA 1MKHA 3A56A 3ND8A 4XXEA 3NTKA 4YHHL 4UDUC 1PH8A 4APVA 2PW7A 2E5LL 2NTTA 1J6QA 2VUMH 4YCUA 3VA7A 2IWHA 1ICFB 3MZ5A 4YHHQ 3G4SA 1KDCA 4HJ5A 2E5LQ 2HT1A 3HOUG 3PF4A 4A3FH 4U673 1MGSA 1B70B 2JYOA 4X66L 1KL9A 1A3VA 4FXDA 4YWKA 2BA0A 2L1BA 5C44B 2F0UA 3X3NA 2NYZD 3NSWA 4C3IG 4OIJA 1TU2B 3RR5A 5M9OA 4IPHA 3J80c 2R7ZG 3K59A 1I4HA 4ILWA 2MPMA 2B8GA 4ZYSA 3D4RA 1WD0A 2Z4HA 3T56B 5A2QL 5IODA 3FP9A 2DJGC 2A8VA 1EIHA 1PHJA 1YIJA 4AYBG 1JE5A 2D62A 2WAQB 1STAA 1T9HA 1D8LA 4GOPA 2DUDA 1SR3A 4JI7L 2RQXA 3TN2A 3CCSA 3KOJA 1H9RA 4RAUC 2Z6BA 1FNWA 3FKIG 5IE8A 3GTKB 3GP7A 4JI7Q 2X6GA 3J7AF 4A3GG 5I9PA 4GN5A 3UE1A 4A76A 3HOYB 1Q46A 3S1QB 1CA5A 2EIFA 1EY5A 4WRDA 4CDEC 1DOKA 1XNRL 1VDZA 3SK5A 3J80i 1VQ4A 1PH5A 5IYCG 5J39A 4WFN3 2A6ED 1DCZA 2M9VA 4QGUA 3AEVA 4CGYB 3NBIA 2DY8A 2EXZA 1H9SA 1XNRQ 3NELA 2IY5B 2PQEA 4CDDC 2NWGA 1D2BA 4I7AA 5C3WA 1P16A 2JEAI 2ZJRA 1VF5C 2JA6G 2QF7A 3J80E 3IL8A 4BBSG 3W1GA 1R4QB 1I5FA 2D9UA 2Q2HA 2RVLA 2A5HA 1N34Q 4B3RL 1ILPA 4O42A 4JG2A 2IX0A 3HG9A 2JA5G 3RN2A 1V1OA 2QDLA 3ONAB 3T51B 5C3EB 4F8MA 4DR5L 1I94L 1L1OA 3CCUA 3S9WA 4IFDJ 3MHBA 3MEFA 4GLAC 4OGQC 3ULPA 4B3RQ 1VQEA 1VQ5A 4DA2A 4DU9A 4DR1L 1U4PA 4JCVE 4KY6A 4B3SL 4OELB 4DK6C 3HRZC 4DV4L 1I94Q 2OWOA 1QZHA 1PTOB 1HR0L 3BVMA 2PNRC 4IFDI 2G5DA 3OWEB 3BU2A 3TREA 1QVGA 4DR1Q 2WFWA 3TBIB 2ZJPA 3GTOH 2E2IB 4FDBA 4R9WA 4DV4Q 2L9HA 2K5WA 1HR0Q 4V0BA 4UHVA 4XYOA 1PFNA 3I4NB 1I50B 1E2ZA 3TP7A 3TRZA 2H1EA 5CORA 1STYA 3OPOA 5C3EH 3T1YL 2VB2X 4OO1G 2KEDA 4LUZA 3C1EA 2C35B 2AKWB 4QUFA 3RLOA 2SEBD 1WTQA 3CCJA 5EPJA 2VUMG 1CKMA 2IT1A 3H09A 3K5LA 4A3BB 1W6JA 3T1YQ 1J8IA 2F0PA 1EY9A 2IHFA 4NMZA 5J3BA 2E2HB 3CCRA 4JI8L 1A8VA 4OIKA 2MUYA 3NQTA 3I4NH 2NVXB 2K1BA 4QL5A 4JI8Q 1JORA 1B3QA 5L37A 4JV5L 4JI3Q 1SXTA 5DAUA 1N9WA 1IBLL 1SE4A 4DK1A 2B2UC 2H4OA 4A3BH 1PRTB 1PDQA 4BA1I 5T1GA 4JV5Q 3F2CA 1QG7A 1QWYA 1SYFA 1AE2A 2ASBA 1IBLQ 1QE6A 3QOJA 4K6LA 3ERQA 5M3MH 5C4XB 3MAQA 1PYWD 4P71A 2F3WA 2VXWA 1XTDA 3SVMA 1SYBA 3M4YA 3K58A 1BOSA 2NVTH 4B9XA 1MD2D 4IALA 5ELFA 5IGCA 5JJZA 2UU9L 4RGOS 3I56A 1ASYA 1HFGA 1B50A 4R8IA 1EL0A 4FXKC 3PIO3 2F0VA 1XPRA 2QA4A 2ATWA 1SMYD 2UU9Q 1DM0B 1M4VA 1P8LA 1E2VA 4DUZL 1ESRA 2O5IC 1XX8A 2K33A 2CFMA 4CKEA 4IJLA 1Q12A 3S1RB 4AH6A 4WJWA 3JAMc 2PO4A 3HOZG 2F03A 1X3PA 4P74A 2EJGC 4TKOB 3M7NA 3OMGA 3E0EA 1A2TA 3BYYB 4HJAA 3Q8DA 4C3HG 4A3IG 3UDIA 1J5EL 4LFAL 4KD3A 1SLJA 1YNND 4RKBA
chains in the Genus database with same CATH topology
3JC66 5IP9H 3S16H 4IJHA 2A1AA 2PI2E 1N36Q 4KLKA 2QGQA 1VQAA 4X64Q 1XNQQ 5IYDH 3BJUA 1SE8A 4PZ7A 1KAWA 4A3LG 1J5EQ 4LFAQ 4KHZA 5JJIA 2UUBQ 1NBWA 5IWAL 4QIWE 1MJEA 3H0GH 4LF7L 1L0WA 3UDXA 1G51A 1YZ6A 2JEBI 1YJWA 1CSQA 1EUJA 2KCMA 4A3KG 1VQLA 2CCZA 2HHHL 5FLMH 4ALPA 3J81c 1U0LA 3D31A 3EN2A 5FLXc 1YI2A 1GKHA 5IWAQ 1LTLA 1KRTA 4LF7Q 3S1MH 1NE3A 1I3QH 1PYSB 2N49A 4HIDA 1PH2A 1MIUA 2NZOA 4R4CA 1EOVA 3JAMi 4DR7L 1Q8KA 2YU9H 1VCIA 2OQKA 3L7ZC 1TWCH 2HHHQ 2UUBL 3S14H 1SMXA 3H3VI 1VQPA 1E3PA 3RZOH 3CQZH 5C4XH 2RF4A 4GOPC 4GLXA 1GVPA 2BH8A 3PCOB 2N78A 2NN6I 1QUQB 5FJ8G 4X65L 4L5QA 4LUOA 4A75A 2MNAA 3UDGA 4YWLA 1IBMQ 2EXDA 4R4OA 4A3FG 1Y1WH 3PO2H 1VQIA 3CCQA 4DR7Q 2AWOA 5GADC 3K7AH 3PUVA 3HOVG 3W1BA 5ELOA 5GQOA 1CUKA 2E2IH 3CD6A 4WJ3M 4JI3L 3CW2C 1YNXA 1D7QA 3CMAA 3U4ZA 4DV7L 4X65Q 4POGA 1I50H 1FGUA 4DV6L 3KYHC 4JI4L 3S17H 2VZAA 2WP8J 4AIMA 4EQ5A 5IY0A 3KJOA 3STBD 2A19A 2OQ0A 1X6OA 1YJNA 2R7ZH 5IP7G 1XJVA 2OTJA 4KHPL 1OXSC 4DR3L 4AQYL 1VQDA 3AQQA 4LW1A 2K5NA 3GTJH 2JA8G 3K7UC 1HNZQ 2RHQB 4DV7Q 4OWTB 3SGIA 1SRUA 4DV6Q 4C3JH 3KF6A 1S3OA 1VQJA 4NPSA 1X55A 3GD7A 1E1TA 4X66Q 3J81i 2CKZB 1VS0A 4KHPQ 4AQYQ 3TQYA 1OTCA 2ZTEA 2MO0A 2Q2IA 4YCWA 4DV1L 3WWVA 2R93G 1XMQL 2E2HH 5M3FG 2PQAA 1JT8A 4LF4L 2B29A 4WJ4A 1Q1EA 4DR2Q 1K8GA 1Y1VH 3OYYA 1TWFH 1C9OA 4QJFA 4BBRG 1XMOQ 1WJJA 3U50C 2JA7G 2DGYA 2KHJA 4JI2Q 4DV1Q 2N8NA 3RZDH 1BBWA 5M3MG 2Z6KA 2AMCB 4UPAA 5C4JH 1XMQQ 1N8RC 2NVXH 2ZJQA 4LF8L 4JI1Q 1JJGA 2VL6A 4HIMA 4LF4Q 1Q82C 4GKKL 3G48A 3A5UA 4BA2I 1FL0A 3IRBA 3RLNA 1L1OC 1VQGA 1WFQA 1V9PA 3GTGH 2JE6I 2I5LX 1VQ7A 1G291 5BR8L 3U58A 3HKZG 1Y14B 2CWAA 5M5XH 4LF8Q 4LFBL 3M4QA 1EQQA 2BA1A 1PFSA 1IZ6A 3B6YA 4A3EH 4GNXC 4GKKQ 2WAQG 4BY1H 3H15A 3HOXH 2CWPA 2VQEL 4IO9A 4MNOA 3ICEA 1HNWL 1PVOA 5BR8Q 5GAHC 4BXXG 4JOIC 1V1QA 1PH1A 4LFBQ 3EIVA 5GROA 4GLVB 3KF8B 4DAYB 4K0KL 1Q1BA 2VNUD 4A3JH 1A63A 4Y52H 3TEHB 3K0XA 4LF9L 2QEXA 3KF6B 3PV0A 4X62L 2PMZE 4UP8A 2VQEQ 4NB3A 1HNWQ 2JA6H 1X65A 4GN3B 2I0QA 1GM5A 1WCMG 3CCVA 1Q81C 3NBHB 1X3EA 4NXMQ 3HOYG 4X64L 1XNQL 5C0XJ 4K0KQ 3I2ZA 3HOZH 3OTOQ 2JA5H 2GVBA 4LF9Q 1PH4A 3T1HL 2PQAB 1CKNA 4TVAB 4X62Q 3OW2A 4YWMA 4P72A 2B63G 1UE7A 4DV3L 4GS3A 1NTGA 1YHAA 1G6PA 4A3CH 1DGSA 1FVIA 4P75A 4C3HH 2NN6G 2YYZA 3M9BA 4ME3A 4A3IH 1NJIC 4HIKA 1X3GA 1M1KC 2KENA 5C0XI 2HIVA 3T1HQ 4JBKA 3S1RH 3EBEA 3GDEA 2K4KA 4IPGA 1IL2A 3J7A5 1HZ9A 1KXLA 1UE6A 1UWVA 2K52A 2KBNA 1Z9FA 3F1ZA 4AYBE 2UXBL 2I5MX 4DV3Q 3ER0A 3I7FA 3M3YH 1OXVA 5IYDG 1N33L 2N3SA 4HJ9A 1K73C 3CCLA 1BVSA 4GNXA 5EAYA 3PGZA 4A3LH 5LMNL 4B3ML 2WB1G 3GTMH 1HJPA 4DR5Q 2NVYH 1MJCA 2UXBQ 3U4VA 2AHOB 3D0FA 3DM3A 2OTLA 1MKHA 3S1NH 3S24A 3PF5A 1N33Q 4A3KH 3I4MG 4B3SQ 2R6GA 5C3EG 4X6AH 5LMNQ 1WOCA 4B3MQ 4LFCL 4YHHL 3HKZE 1PH8A 3BZCA 4JBWA 5IYBH 4APVA 3KJPA 2R92H 3PUZA 3NENA 4DPGA 5M5YH 1IBKL 2E5LL 4LUVA 2ES2A 1SN8A 1XPUA 1J6QA 3AFPA 2CQOA 2WAQE 4A3MH 1E1OA 4YCUA 2VUMH 2UXCL 1VQMA 2Q2UA 3PF4A 3S15H 2B3GA 3FHWA 4LFCQ 4YHHQ 2GVAA 3G4SA 4JI6L 3UE0A 2VW9A 1HNZL 5FJ8H 3L2PA 1IBKQ 4A93G 3PUYA 1CKNB 4HJ5A 3RNUA 1KRSA 2E5LQ 1VQNA 1GD7A 4A3FH 1Q7YC 2HT1A 1TWAH 2KCTA 3HOUG 2KHIA 3GTQH 3M4PA 4YCVA 3HOVH 2UXCQ 1H95A 3PIPA 1B70B 4X66L 1KL9A 1IYJB 4KI0A 2JK8A 2BA0A 4L5TA 4YWKA 1JB7A 4JI6Q 3I4NG 4JBJA 1VQOA 2F3IA 3I4OA 3CMEA 1OXXK 1HZBA 4OONA 1K83H 1LYLA 2K75A 5GAGC 2F4VL 2IX1A 3RR5A 4IPHA 3J80c 2R7ZG 4DR2L 2K14A 5JJLA 1XMOL 5E7NA 5LMNW 3W5OA 1PH9A 2JA8H 4GNXB 4J15A 4JI2L 3FP9A 1UE1A 2A8VA 3CCEA 1PHJA 1YIJA 4AYBG 4R4TA 4JI1L 2F4VQ 1RIPA 4A3BG 4DR4L 4OO1I 1JE5A 3A0JA 3PUWA 2E2JH 4DV0L 2D62A 1YITA 5C44G 1T9HA 4BY7H 1EWIA 1D8LA 4GOPA 3LGJA 2DUDA 1SR3A 3DLLA 4JI7L 3K80C 4PMWA 2R93H 3CCSA 2JJQA 4LWCA 1Q86C 5M3FH 3KOJA 4DR4Q 3PSIA 1Y1VG 2WB1E 4IPDA 1EFWA 3ULJA 3CF5A 3FKIG 4DV0Q 5JJKA 1VQCA 5IE8A 2JA7H 3J81j 3CCMA 1QVFA 4IPCA 1LM0A 4JI7Q 4MTNA 4PZ8A 1VQBA 2LXJA 2Y0SE 2YV5A 1HNXL 4IOCA 4A3GG 4GN5A 5JEAJ 3UE1A 3M85A 4A76A 4JI0L 3AFQA 1Q46A 4R1JA 1R9TH 1PH7A 3RLFA 2EIFA 3PO3G 5C0XG 4PZ6A 1K9MC 2ZTCA 3M4OH 4A3DG 3L0OA 4C2MH 5IT9c 4UP9A 1XNRL 4OX9L 1E7ZA 5DLQE 3F8TA 1HNXQ 1PYBA 1A62A 4NXML 3J80i 1ASZA 4BY1G 1VQ4A 1PH5A 5IYCG 3HOXG 4JI0Q 3OTOL 1W3SA 1YHQA 4QGUA 3AEVA 2R7DA 3GTPH 3CC7A 1KC8C 2UXDQ 4L5RC 5M5WH 1WYDA 1EQRA 1HZCA 1XNRQ 4OX9Q 3NELA 2IY5B 5K36G 3MXNB 2JQOA 4HJ8A 1K0RA 3KLWA 1P16A 2JEAI 2ZJRA 2JA6G 5AJ3L 1UE5A 1QVCA 4UY8C 4BBSG 3CPWA 3W1GA 2UXDL 3ZJYC 1I5FA 2Q2HA 2ZTDA 4GN4B 1N34Q 4B3RL 2LXKA 1VQ8A 2ZM6L 4GOPB 4JG2A 2IX0A 4DUZQ 2JA5G 3RN2A 1LUZA 1PV4A 4DR5L 5AJ3Q 1I94L 5IP9G 1L1OA 3CCUA 4R4QA 4IFDJ 1BBUA 1QZGA 3MEFA 3H3VH 4GLAC 3F2BA 3ULPA 2B63H 4XTCS 1VQEA 4A3CG 1VQ5A 4B3RQ 1O7IA 1NY4A 2ZM6Q 3CPFA 3G71A 4LF5L 4DR1L 1E22A 3HOWH 3TS0A 4JCVE 3RN5A 4JBMA 4B3SL 1X54A 1HH2P 1A0IA 1FJGL 4DK6C 5ELNA 1WI5A 2V1CC 1S40A 4DV4L 1I94Q 3H0GG 1B8AA 2OWOA 1SFOH 1QZHA 1HR0L 2H5XA 4IFDI 4OWWB 3BU2A 1EIFA 1YEZA 3TREA 4YY3L 4JOIA 1QVGA 5H1SE 3CC2A 4LF5Q 4DR1Q 2WFWA 1JMCA 4O0AA 1PA6A 2Y0SG 1TWHH 3AYHB 5FLMG 2ZJPA 1FJGQ 3GTOH 4FDBA 3KFUA 4A4IA 1TXYA 2EQSA 2MQHA 4DV2L 1K8AC 4DV5Q 4DV4Q 3S2HH 1HR0Q 3BZKA 1N32L 1KHIA 1EIYB 2FXQA 4YY3Q 2R7FA 2GN5A 2JA9A 4MZ9A 3KDFA 4DAMA 1S72A 3TRZA 1E24A 2E8GA 1HZAA 3I4MH 3GO5A 3T1YL 5C3EH 4OO1G 4LUZA 5C4XG 2IHEA 4DV2Q 2C35B 5IYBG 2R92G 2AKWB 3HOWG 3RLOA 2PNHA 3VDYA 1N32Q 4RG1A 1Y1WG 3CCJA 3PO2G 2VUMG 1CKMA 2IT1A 4HJ7A 4A3MG 1W2BA 2RCNA 2VQFL 1OXTA 1VQHA 4O2DA 4OWXB 3T1YQ 1EYGA 3K8AA 3A5ZB 2BH2A 1U5KA 1V43A 2IHFA 2Z6KC 5J3BA 4A93H 4QY7A 3S2DH 3HOUH 4JYAL 1L1OB 3CCRA 3PUXA 4JI8L 1SROA 2VQFQ 1VQKA 2VY3A 1A8VA 2K5HA 4QQBX 5IP7H 1VQ6A 2I5HA 2D0PA 3I4NH 1YVCA 1X9NA 4NXNL 1VQFA 2MFIA 1HR0W 4C3IH 4JYAQ 4QL5A 2K50A 4PG3A 3UDFA 4LNQA 4JI8Q 3CC4A 2YTVA 4B3TL 1PH3A 3HKSA 4JV5L 4JI3Q 4JC0A 3CP0A 1IBLL 1N9WA 2Q2TA 1C0AA 1K3RA 2D0OA 4DR6L 1TWGH 1JJ2A 2MO1A 5JEAG 3ERSX 4NXNQ 1B7YB 1X56A 4JI4Q 2AWNA 1JJCB 2F52A 4A3BH 1AE3A 3I55A 2OCEA 1KIXA 4BA1I 4B3TQ 4JV5Q 1AH9A 3F2CA 4DR3Q 4BY7G 5GAEC 4BBRH 3CAMA 1AE2A 3KDFB 4DUYL 5C44H 1IBLQ 4H02A 1KD1C 2UUAL 2ASBA 2VS1A 3HFZB 4DR6Q 1OXUA 4RMFA 2UUCL 4OXPA 5M3MH 5HY6A 2ID0A 4JI5L 4P71A 4Y7NH 1XTDA 1YJ9A 1RL2A 5LMUL 3E9HA 1YBYA 3FKIH 2NVTH 4GKJL 2ALYB 2UUAQ 4DUYQ 4IOAA 1UEBA 2HIXA 3PIOA 2UUCQ 2L15A 2UU9L 3NEMA 2Z0SA 1YHBA 3I56A 4JI5Q 4LF6L 4A3EG 1ASYA 1KQSA 1L2FA 4A3GH 5LMUQ 4UP7A 4DK3C 4GKJQ 3STBC 4TQUS 3PO3H 1XPRA 1GO3E 2RHSB 4A3DH 1XPOA 1N34L 1BKBA 2QA4A 2YTXA 1VQ9A 2UU9Q 2ATWA 2NVQH 1NMGA 3K81C 3CXCA 3J7ZC 4BXXH 1P8LA 4IFDG 2K5VA 1M90C 4DUZL 4A3JG 4LF6Q 1IXRA 5IYCH 2XTIA 2YTYA 2CFMA 3F2DA 3ULLA 4IJLA 1PH6A 1Q12A 4AH6A 3GTKH 2XGTA 1Z47A 4P73A 3JAMc 4L5SA 4R4IA 5HGQA 3TS2A 1WCMH 4XIGS 4DNIA 3HOZG 3HOYH 3GTLH 1QUQA 3E9IA 3S1QH 4P74A 1NMFA 3A74A 4HIOA 2HQLA 1IBML 3M7NA 1X3FA 3E0EA 4DKAC 4BBSH 2LSSA 4HJAA 1I6HH 3Q8DA 1C7YA 2PI2A 4EX5A 4A3IG 1N36L 2NZHA 3UDIA 1CSPA 1CKOA 1J5EL 4LFAL 4POFA 1SLJA 3G6EA 4DV5L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JC6 6;  5IP9 H;  3S16 H;  4IJH A;  2A1A A;  2PI2 E;  1N36 Q;  4KLK A;  2QGQ A;  1VQA A;  4X64 Q;  1XNQ Q;  5IYD H;  3BJU A;  1SE8 A;  4PZ7 A;  1KAW A;  4A3L G;  1J5E Q;  4LFA Q;  4KHZ A;  5JJI A;  2UUB Q;  1NBW A;  5IWA L;  4QIW E;  1MJE A;  3H0G H;  4LF7 L;  1L0W A;  3UDX A;  1G51 A;  1YZ6 A;  2JEB I;  1YJW A;  1CSQ A;  1EUJ A;  2KCM A;  4A3K G;  1VQL A;  2CCZ A;  2HHH L;  5FLM H;  4ALP A;  3J81 c;  1U0L A;  3D31 A;  3EN2 A;  5FLX c;  1YI2 A;  1GKH A;  5IWA Q;  1LTL A;  1KRT A;  4LF7 Q;  3S1M H;  1NE3 A;  1I3Q H;  1PYS B;  2N49 A;  4HID A;  1PH2 A;  1MIU A;  2NZO A;  4R4C A;  1EOV A;  3JAM i;  4DR7 L;  1Q8K A;  2YU9 H;  1VCI A;  2OQK A;  3L7Z C;  1TWC H;  2HHH Q;  2UUB L;  3S14 H;  1SMX A;  3H3V I;  1VQP A;  1E3P A;  3RZO H;  3CQZ H;  5C4X H;  2RF4 A;  4GOP C;  4GLX A;  1GVP A;  2BH8 A;  3PCO B;  2N78 A;  2NN6 I;  1QUQ B;  5FJ8 G;  4X65 L;  4L5Q A;  4LUO A;  4A75 A;  2MNA A;  3UDG A;  4YWL A;  1IBM Q;  2EXD A;  4R4O A;  4A3F G;  1Y1W H;  3PO2 H;  1VQI A;  3CCQ A;  4DR7 Q;  2AWO A;  5GAD C;  3K7A H;  3PUV A;  3HOV G;  3W1B A;  5ELO A;  5GQO A;  1CUK A;  2E2I H;  3CD6 A;  4WJ3 M;  4JI3 L;  3CW2 C;  1YNX A;  1D7Q A;  3CMA A;  3U4Z A;  4DV7 L;  4X65 Q;  4POG A;  1I50 H;  1FGU A;  4DV6 L;  3KYH C;  4JI4 L;  3S17 H;  2VZA A;  2WP8 J;  4AIM A;  4EQ5 A;  5IY0 A;  3KJO A;  3STB D;  2A19 A;  2OQ0 A;  1X6O A;  1YJN A;  2R7Z H;  5IP7 G;  1XJV A;  2OTJ A;  4KHP L;  1OXS C;  4DR3 L;  4AQY L;  1VQD A;  3AQQ A;  4LW1 A;  2K5N A;  3GTJ H;  2JA8 G;  3K7U C;  1HNZ Q;  2RHQ B;  4DV7 Q;  4OWT B;  3SGI A;  1SRU A;  4DV6 Q;  4C3J H;  3KF6 A;  1S3O A;  1VQJ A;  4NPS A;  1X55 A;  3GD7 A;  1E1T A;  4X66 Q;  3J81 i;  2CKZ B;  1VS0 A;  4KHP Q;  4AQY Q;  3TQY A;  1OTC A;  2ZTE A;  2MO0 A;  2Q2I A;  4YCW A;  4DV1 L;  3WWV A;  2R93 G;  1XMQ L;  2E2H H;  5M3F G;  2PQA A;  1JT8 A;  4LF4 L;  2B29 A;  4WJ4 A;  1Q1E A;  4DR2 Q;  1K8G A;  1Y1V H;  3OYY A;  1TWF H;  1C9O A;  4QJF A;  4BBR G;  1XMO Q;  1WJJ A;  3U50 C;  2JA7 G;  2DGY A;  2KHJ A;  4JI2 Q;  4DV1 Q;  2N8N A;  3RZD H;  1BBW A;  5M3M G;  2Z6K A;  2AMC B;  4UPA A;  5C4J H;  1XMQ Q;  1N8R C;  2NVX H;  2ZJQ A;  4LF8 L;  4JI1 Q;  1JJG A;  2VL6 A;  4HIM A;  4LF4 Q;  1Q82 C;  4GKK L;  3G48 A;  3A5U A;  4BA2 I;  1FL0 A;  3IRB A;  3RLN A;  1L1O C;  1VQG A;  1WFQ A;  1V9P A;  3GTG H;  2JE6 I;  2I5L X;  1VQ7 A;  1G29 1;  5BR8 L;  3U58 A;  3HKZ G;  1Y14 B;  2CWA A;  5M5X H;  4LF8 Q;  4LFB L;  3M4Q A;  1EQQ A;  2BA1 A;  1PFS A;  1IZ6 A;  3B6Y A;  4A3E H;  4GNX C;  4GKK Q;  2WAQ G;  4BY1 H;  3H15 A;  3HOX H;  2CWP A;  2VQE L;  4IO9 A;  4MNO A;  3ICE A;  1HNW L;  1PVO A;  5BR8 Q;  5GAH C;  4BXX G;  4JOI C;  1V1Q A;  1PH1 A;  4LFB Q;  3EIV A;  5GRO A;  4GLV B;  3KF8 B;  4DAY B;  4K0K L;  1Q1B A;  2VNU D;  4A3J H;  1A63 A;  4Y52 H;  3TEH B;  3K0X A;  4LF9 L;  2QEX A;  3KF6 B;  3PV0 A;  4X62 L;  2PMZ E;  4UP8 A;  2VQE Q;  4NB3 A;  1HNW Q;  2JA6 H;  1X65 A;  4GN3 B;  2I0Q A;  1GM5 A;  1WCM G;  3CCV A;  1Q81 C;  3NBH B;  1X3E A;  4NXM Q;  3HOY G;  4X64 L;  1XNQ L;  5C0X J;  4K0K Q;  3I2Z A;  3HOZ H;  3OTO Q;  2JA5 H;  2GVB A;  4LF9 Q;  1PH4 A;  3T1H L;  2PQA B;  1CKN A;  4TVA B;  4X62 Q;  3OW2 A;  4YWM A;  4P72 A;  2B63 G;  1UE7 A;  4DV3 L;  4GS3 A;  1NTG A;  1YHA A;  1G6P A;  4A3C H;  1DGS A;  1FVI A;  4P75 A;  4C3H H;  2NN6 G;  2YYZ A;  3M9B A;  4ME3 A;  4A3I H;  1NJI C;  4HIK A;  1X3G A;  1M1K C;  2KEN A;  5C0X I;  2HIV A;  3T1H Q;  4JBK A;  3S1R H;  3EBE A;  3GDE A;  2K4K A;  4IPG A;  1IL2 A;  3J7A 5;  1HZ9 A;  1KXL A;  1UE6 A;  1UWV A;  2K52 A;  2KBN A;  1Z9F A;  3F1Z A;  4AYB E;  2UXB L;  2I5M X;  4DV3 Q;  3ER0 A;  3I7F A;  3M3Y H;  1OXV A;  5IYD G;  1N33 L;  2N3S A;  4HJ9 A;  1K73 C;  3CCL A;  1BVS A;  4GNX A;  5EAY A;  3PGZ A;  4A3L H;  5LMN L;  4B3M L;  2WB1 G;  3GTM H;  1HJP A;  4DR5 Q;  2NVY H;  1MJC A;  2UXB Q;  3U4V A;  2AHO B;  3D0F A;  3DM3 A;  2OTL A;  1MKH A;  3S1N H;  3S24 A;  3PF5 A;  1N33 Q;  4A3K H;  3I4M G;  4B3S Q;  2R6G A;  5C3E G;  4X6A H;  5LMN Q;  1WOC A;  4B3M Q;  4LFC L;  4YHH L;  3HKZ E;  1PH8 A;  3BZC A;  4JBW A;  5IYB H;  4APV A;  3KJP A;  2R92 H;  3PUZ A;  3NEN A;  4DPG A;  5M5Y H;  1IBK L;  2E5L L;  4LUV A;  2ES2 A;  1SN8 A;  1XPU A;  1J6Q A;  3AFP A;  2CQO A;  2WAQ E;  4A3M H;  1E1O A;  4YCU A;  2VUM H;  2UXC L;  1VQM A;  2Q2U A;  3PF4 A;  3S15 H;  2B3G A;  3FHW A;  4LFC Q;  4YHH Q;  2GVA A;  3G4S A;  4JI6 L;  3UE0 A;  2VW9 A;  1HNZ L;  5FJ8 H;  3L2P A;  1IBK Q;  4A93 G;  3PUY A;  1CKN B;  4HJ5 A;  3RNU A;  1KRS A;  2E5L Q;  1VQN A;  1GD7 A;  4A3F H;  1Q7Y C;  2HT1 A;  1TWA H;  2KCT A;  3HOU G;  2KHI A;  3GTQ H;  3M4P A;  4YCV A;  3HOV H;  2UXC Q;  1H95 A;  3PIP A;  1B70 B;  4X66 L;  1KL9 A;  1IYJ B;  4KI0 A;  2JK8 A;  2BA0 A;  4L5T A;  4YWK A;  1JB7 A;  4JI6 Q;  3I4N G;  4JBJ A;  1VQO A;  2F3I A;  3I4O A;  3CME A;  1OXX K;  1HZB A;  4OON A;  1K83 H;  1LYL A;  2K75 A;  5GAG C;  2F4V L;  2IX1 A;  3RR5 A;  4IPH A;  3J80 c;  2R7Z G;  4DR2 L;  2K14 A;  5JJL A;  1XMO L;  5E7N A;  5LMN W;  3W5O A;  1PH9 A;  2JA8 H;  4GNX B;  4J15 A;  4JI2 L;  3FP9 A;  1UE1 A;  2A8V A;  3CCE A;  1PHJ A;  1YIJ A;  4AYB G;  4R4T A;  4JI1 L;  2F4V Q;  1RIP A;  4A3B G;  4DR4 L;  4OO1 I;  1JE5 A;  3A0J A;  3PUW A;  2E2J H;  4DV0 L;  2D62 A;  1YIT A;  5C44 G;  1T9H A;  4BY7 H;  1EWI A;  1D8L A;  4GOP A;  3LGJ A;  2DUD A;  1SR3 A;  3DLL A;  4JI7 L;  3K80 C;  4PMW A;  2R93 H;  3CCS A;  2JJQ A;  4LWC A;  1Q86 C;  5M3F H;  3KOJ A;  4DR4 Q;  3PSI A;  1Y1V G;  2WB1 E;  4IPD A;  1EFW A;  3ULJ A;  3CF5 A;  3FKI G;  4DV0 Q;  5JJK A;  1VQC A;  5IE8 A;  2JA7 H;  3J81 j;  3CCM A;  1QVF A;  4IPC A;  1LM0 A;  4JI7 Q;  4MTN A;  4PZ8 A;  1VQB A;  2LXJ A;  2Y0S E;  2YV5 A;  1HNX L;  4IOC A;  4A3G G;  4GN5 A;  5JEA J;  3UE1 A;  3M85 A;  4A76 A;  4JI0 L;  3AFQ A;  1Q46 A;  4R1J A;  1R9T H;  1PH7 A;  3RLF A;  2EIF A;  3PO3 G;  5C0X G;  4PZ6 A;  1K9M C;  2ZTC A;  3M4O H;  4A3D G;  3L0O A;  4C2M H;  5IT9 c;  4UP9 A;  1XNR L;  4OX9 L;  1E7Z A;  5DLQ E;  3F8T A;  1HNX Q;  1PYB A;  1A62 A;  4NXM L;  3J80 i;  1ASZ A;  4BY1 G;  1VQ4 A;  1PH5 A;  5IYC G;  3HOX G;  4JI0 Q;  3OTO L;  1W3S A;  1YHQ A;  4QGU A;  3AEV A;  2R7D A;  3GTP H;  3CC7 A;  1KC8 C;  2UXD Q;  4L5R C;  5M5W H;  1WYD A;  1EQR A;  1HZC A;  1XNR Q;  4OX9 Q;  3NEL A;  2IY5 B;  5K36 G;  3MXN B;  2JQO A;  4HJ8 A;  1K0R A;  3KLW A;  1P16 A;  2JEA I;  2ZJR A;  2JA6 G;  5AJ3 L;  1UE5 A;  1QVC A;  4UY8 C;  4BBS G;  3CPW A;  3W1G A;  2UXD L;  3ZJY C;  1I5F A;  2Q2H A;  2ZTD A;  4GN4 B;  1N34 Q;  4B3R L;  2LXK A;  1VQ8 A;  2ZM6 L;  4GOP B;  4JG2 A;  2IX0 A;  4DUZ Q;  2JA5 G;  3RN2 A;  1LUZ A;  1PV4 A;  4DR5 L;  5AJ3 Q;  1I94 L;  5IP9 G;  1L1O A;  3CCU A;  4R4Q A;  4IFD J;  1BBU A;  1QZG A;  3MEF A;  3H3V H;  4GLA C;  3F2B A;  3ULP A;  2B63 H;  4XTC S;  1VQE A;  4A3C G;  1VQ5 A;  4B3R Q;  1O7I A;  1NY4 A;  2ZM6 Q;  3CPF A;  3G71 A;  4LF5 L;  4DR1 L;  1E22 A;  3HOW H;  3TS0 A;  4JCV E;  3RN5 A;  4JBM A;  4B3S L;  1X54 A;  1HH2 P;  1A0I A;  1FJG L;  4DK6 C;  5ELN A;  1WI5 A;  2V1C C;  1S40 A;  4DV4 L;  1I94 Q;  3H0G G;  1B8A A;  2OWO A;  1SFO H;  1QZH A;  1HR0 L;  2H5X A;  4IFD I;  4OWW B;  3BU2 A;  1EIF A;  1YEZ A;  3TRE A;  4YY3 L;  4JOI A;  1QVG A;  5H1S E;  3CC2 A;  4LF5 Q;  4DR1 Q;  2WFW A;  1JMC A;  4O0A A;  1PA6 A;  2Y0S G;  1TWH H;  3AYH B;  5FLM G;  2ZJP A;  1FJG Q;  3GTO H;  4FDB A;  3KFU A;  4A4I A;  1TXY A;  2EQS A;  2MQH A;  4DV2 L;  1K8A C;  4DV5 Q;  4DV4 Q;  3S2H H;  1HR0 Q;  3BZK A;  1N32 L;  1KHI A;  1EIY B;  2FXQ A;  4YY3 Q;  2R7F A;  2GN5 A;  2JA9 A;  4MZ9 A;  3KDF A;  4DAM A;  1S72 A;  3TRZ A;  1E24 A;  2E8G A;  1HZA A;  3I4M H;  3GO5 A;  3T1Y L;  5C3E H;  4OO1 G;  4LUZ A;  5C4X G;  2IHE A;  4DV2 Q;  2C35 B;  5IYB G;  2R92 G;  2AKW B;  3HOW G;  3RLO A;  2PNH A;  3VDY A;  1N32 Q;  4RG1 A;  1Y1W G;  3CCJ A;  3PO2 G;  2VUM G;  1CKM A;  2IT1 A;  4HJ7 A;  4A3M G;  1W2B A;  2RCN A;  2VQF L;  1OXT A;  1VQH A;  4O2D A;  4OWX B;  3T1Y Q;  1EYG A;  3K8A A;  3A5Z B;  2BH2 A;  1U5K A;  1V43 A;  2IHF A;  2Z6K C;  5J3B A;  4A93 H;  4QY7 A;  3S2D H;  3HOU H;  4JYA L;  1L1O B;  3CCR A;  3PUX A;  4JI8 L;  1SRO A;  2VQF Q;  1VQK A;  2VY3 A;  1A8V A;  2K5H A;  4QQB X;  5IP7 H;  1VQ6 A;  2I5H A;  2D0P A;  3I4N H;  1YVC A;  1X9N A;  4NXN L;  1VQF A;  2MFI A;  1HR0 W;  4C3I H;  4JYA Q;  4QL5 A;  2K50 A;  4PG3 A;  3UDF A;  4LNQ A;  4JI8 Q;  3CC4 A;  2YTV A;  4B3T L;  1PH3 A;  3HKS A;  4JV5 L;  4JI3 Q;  4JC0 A;  3CP0 A;  1IBL L;  1N9W A;  2Q2T A;  1C0A A;  1K3R A;  2D0O A;  4DR6 L;  1TWG H;  1JJ2 A;  2MO1 A;  5JEA G;  3ERS X;  4NXN Q;  1B7Y B;  1X56 A;  4JI4 Q;  2AWN A;  1JJC B;  2F52 A;  4A3B H;  1AE3 A;  3I55 A;  2OCE A;  1KIX A;  4BA1 I;  4B3T Q;  4JV5 Q;  1AH9 A;  3F2C A;  4DR3 Q;  4BY7 G;  5GAE C;  4BBR H;  3CAM A;  1AE2 A;  3KDF B;  4DUY L;  5C44 H;  1IBL Q;  4H02 A;  1KD1 C;  2UUA L;  2ASB A;  2VS1 A;  3HFZ B;  4DR6 Q;  1OXU A;  4RMF A;  2UUC L;  4OXP A;  5M3M H;  5HY6 A;  2ID0 A;  4JI5 L;  4P71 A;  4Y7N H;  1XTD A;  1YJ9 A;  1RL2 A;  5LMU L;  3E9H A;  1YBY A;  3FKI H;  2NVT H;  4GKJ L;  2ALY B;  2UUA Q;  4DUY Q;  4IOA A;  1UEB A;  2HIX A;  3PIO A;  2UUC Q;  2L15 A;  2UU9 L;  3NEM A;  2Z0S A;  1YHB A;  3I56 A;  4JI5 Q;  4LF6 L;  4A3E G;  1ASY A;  1KQS A;  1L2F A;  4A3G H;  5LMU Q;  4UP7 A;  4DK3 C;  4GKJ Q;  3STB C;  4TQU S;  3PO3 H;  1XPR A;  1GO3 E;  2RHS B;  4A3D H;  1XPO A;  1N34 L;  1BKB A;  2QA4 A;  2YTX A;  1VQ9 A;  2UU9 Q;  2ATW A;  2NVQ H;  1NMG A;  3K81 C;  3CXC A;  3J7Z C;  4BXX H;  1P8L A;  4IFD G;  2K5V A;  1M90 C;  4DUZ L;  4A3J G;  4LF6 Q;  1IXR A;  5IYC H;  2XTI A;  2YTY A;  2CFM A;  3F2D A;  3ULL A;  4IJL A;  1PH6 A;  1Q12 A;  4AH6 A;  3GTK H;  2XGT A;  1Z47 A;  4P73 A;  3JAM c;  4L5S A;  4R4I A;  5HGQ A;  3TS2 A;  1WCM H;  4XIG S;  4DNI A;  3HOZ G;  3HOY H;  3GTL H;  1QUQ A;  3E9I A;  3S1Q H;  4P74 A;  1NMF A;  3A74 A;  4HIO A;  2HQL A;  1IBM L;  3M7N A;  1X3F A;  3E0E A;  4DKA C;  4BBS H;  2LSS A;  4HJA A;  1I6H H;  3Q8D A;  1C7Y A;  2PI2 A;  4EX5 A;  4A3I G;  1N36 L;  2NZH A;  3UDI A;  1CSP A;  1CKO A;  1J5E L;  4LFA L;  4POF A;  1SLJ A;  3G6E A;  4DV5 L; 
#chains in the Genus database with same CATH topology
 3JC6 6;  5IP9 H;  2BDO A;  5M5Y B;  1Y1W B;  4N9T A;  1ZXT A;  1QJO A;  1VQA A;  4X64 Q;  2KCC A;  2KUM A;  2SOB A;  3BJU A;  4PZ7 A;  4A3M B;  4A3L G;  1J5E Q;  4LFA Q;  4CHT B;  4DFA A;  5JJI A;  1TII D;  2JN4 A;  1BCP F;  1CHP D;  4LJZ C;  3H0G H;  3QR8 A;  1L0W A;  4IUU A;  4L8J A;  4L6T B;  1YJW A;  1CSQ A;  1TWA B;  4A3K G;  2Z9H A;  1S5F D;  3GTJ B;  2EJM A;  1PYS B;  4KKS A;  3Q23 A;  2CH4 W;  1RD9 D;  3JAM i;  1TY0 A;  4FNF A;  3L7Z C;  3S14 H;  2B2Y C;  1SMX A;  3J81 L;  4KV6 A;  3H3V I;  4TSS A;  5FLX L;  5C4X H;  2RF4 A;  5D14 A;  2BH8 A;  2N78 A;  3MC0 B;  4A75 A;  4LUO A;  5E4W C;  1Y1W H;  5GAD C;  3K7A H;  3Q22 A;  3NK9 A;  2K5D A;  1HRJ A;  1CUK A;  3JAM E;  4WJ3 M;  3DMU A;  1D7Q A;  1ENF A;  1IHZ A;  4DV7 L;  1C48 A;  1FGU A;  4QIW B;  1EU4 A;  3S17 H;  4JPB W;  1PTO C;  1YJN A;  1XJV A;  2PZW A;  1B53 A;  2JA8 G;  3GTJ H;  1HNZ Q;  4G4K A;  3KF8 A;  4DV7 Q;  5AFW A;  3SGI A;  3KF6 A;  1S3O A;  3A7L A;  2L4N A;  4CJ0 B;  2K5Q A;  1K28 A;  3K5M A;  2Q2I A;  4TRD A;  4IN3 A;  2MJ8 A;  3K5O A;  4LF4 L;  4WJ4 A;  1K8G A;  4DR2 Q;  1LTA D;  1Y1V H;  4J1M A;  5C5L A;  1XMO Q;  4QUC A;  4J6H A;  3GTP B;  2KHJ A;  4KMU C;  2N8N A;  3W3A A;  5M3M G;  3SK6 A;  1N8R C;  3P20 A;  4LF4 Q;  2LY7 A;  1Q82 C;  3IRB A;  5KNB A;  1V9P A;  5BR8 L;  3HKZ G;  1ZYR C;  2RA4 A;  2O5J C;  1ET6 A;  2F0O A;  4RKL A;  5M5X H;  1EQQ A;  1O7Z A;  4A3E H;  1J9O A;  4GNX C;  4BY1 H;  2CHB D;  3H15 A;  3FPP A;  1ET9 A;  1PVO A;  5EBD A;  2E76 C;  5BR8 Q;  3KLS A;  4JOI C;  1V1Q A;  1PH1 A;  1EEF D;  2B2U A;  3K0Y A;  3V96 A;  4K0K L;  1Q1B A;  4A3J H;  3K0X A;  4UP8 A;  1CZW A;  1X65 A;  2M00 A;  1PRT C;  4HED A;  1O78 A;  1Q81 C;  4NXM Q;  4K0K Q;  1TWH B;  2Z8L A;  2GVB A;  4TVA B;  1EOT A;  1BNZ A;  4YWM A;  4P72 A;  4PMC A;  3CRK C;  4DNT B;  4NDX A;  1G6P A;  5I6W A;  1DGS A;  1FVI A;  4LAA A;  4A3C H;  2NN6 G;  2WIN B;  4LK1 C;  1NNX A;  1LV9 A;  2HIV A;  4JBK A;  4XDX A;  1ESF A;  3GDE A;  1HZ9 A;  1UE6 A;  1UWV A;  2KBN A;  1PTO D;  5IGF A;  2K04 A;  4HJ9 A;  3K5N A;  1BVS A;  5EAY A;  3A8K E;  4ZLT F;  2WB1 G;  1GUW A;  3BYT B;  2NVY H;  3EA6 A;  4DXG A;  5D3I B;  3S24 A;  3HOU B;  2K7V A;  1ENC A;  4RCO A;  4ZUI A;  2F0N A;  2EY6 A;  3D3R A;  4FF2 A;  2R92 H;  1IBK L;  4ZCK A;  4LUV A;  3E6Z X;  5IT9 E;  3AFP A;  2CQO A;  4IUT A;  2UXC L;  1E1O A;  1T5X D;  2E2J B;  2B3G A;  3E5S A;  1HA5 A;  1A3T A;  1PTO F;  3UE0 A;  1HA6 A;  2OEO A;  1TWG B;  2EYP A;  3L2P A;  1ONL A;  1IBK Q;  3LX0 A;  3PUY A;  1KRS A;  1EQV A;  5I9O A;  2KCT A;  3Q24 A;  4AYB B;  3M4P A;  2UXC Q;  3HOV H;  4BBR B;  1ZYR D;  4JBJ A;  2F3I A;  1PLF A;  3CME A;  1HZB A;  1K83 H;  2QKI C;  2K75 A;  2F4V L;  2K14 A;  3W5O A;  1DOM A;  4BS9 A;  2O4X A;  3KBX A;  1JR0 D;  1UE1 A;  3Q6S A;  2WII B;  4JI1 L;  2F4V Q;  4DR4 L;  4OO1 I;  3J80 L;  2E2J H;  2B2Y A;  5HGT A;  1PRT D;  4BY7 H;  3NWT A;  3CRL C;  3LGJ A;  3C3L A;  3K80 C;  4PMW A;  2R93 H;  2JJQ A;  4K14 A;  5E4X A;  4DR4 Q;  1Y1V G;  2RBM A;  4IPD A;  3CF5 A;  4E6I A;  5CYU A;  5JJK A;  4J8Q A;  3EVQ A;  1LTT D;  1LM0 A;  4IPC A;  5DM7 3;  5IOC A;  2AUJ D;  1VQB A;  2AQ1 B;  1DOL A;  1LLR D;  1WCM B;  1CI3 M;  4Q5V A;  3M85 A;  3AFQ A;  1R9T H;  1PH7 A;  5ISR A;  4PZ6 A;  1K9M C;  3M4O H;  4BBS B;  2XRQ D;  4UP9 A;  5G3L D;  5T1I A;  1FGB D;  1RDP D;  4BY1 G;  2F3V A;  3OTO L;  1YHQ A;  4H7B A;  2N55 A;  5KND A;  1UUP A;  3MXG A;  1SFO B;  3OWF A;  3MXN B;  4HJ8 A;  1K0R A;  3A7A B;  4PV1 C;  1HQR D;  3PMF A;  1RTN A;  1UE5 A;  1MI2 A;  4K5W A;  4OEM B;  4DF7 A;  4CJ1 B;  5ELB A;  1AZP A;  4GN4 B;  2EVB A;  2LXK A;  2MHV A;  2ZM6 L;  1LTB D;  3I4M B;  4HTH A;  3MEH A;  3OW7 A;  5G3L F;  2EYF A;  1QB5 D;  1XYI A;  1BBU A;  1QNK A;  4A3C G;  3VR6 A;  1NR2 A;  2JSO A;  1G6Z A;  1O7I A;  2ZM6 Q;  5EQ0 A;  4JBM A;  4C1N K;  3PQI A;  1XTC D;  1FJG L;  1A0I A;  1TWC B;  3RMH A;  4F87 A;  3CQZ B;  4BWG B;  4PQX A;  2V1C C;  1S40 A;  4DGZ A;  1SFO H;  1IW7 C;  2H5X A;  4A93 B;  4JOI A;  1I6V C;  1RJT A;  4O0A A;  4K2L A;  1FJG Q;  3H3V C;  4A4I A;  4DV2 L;  1K8A C;  2A73 B;  3D8G A;  4IUV A;  1N32 L;  1TQO A;  2R7F A;  2JA9 A;  4MZ9 A;  1E24 A;  1HZA A;  3I4M H;  2E2D C;  3VR3 A;  1SDF A;  1ZKO A;  5HUR A;  1UEA B;  4DV2 Q;  2R92 G;  3HOW G;  3VDY A;  1N32 Q;  4G7H C;  3PO2 G;  4G7O C;  3T4A C;  4QMG A;  5EJW A;  1W2B A;  1VQH A;  4KHV A;  4OWX B;  3IKJ A;  1EYG A;  1L0Y B;  3A5Z B;  1PMR A;  1V43 A;  1DON A;  2KQ3 A;  2Z6K C;  4A93 H;  2DNC A;  1U4L A;  3MTS A;  3PUX A;  1TWF B;  2K5H A;  4FO2 A;  5IP7 H;  3P75 A;  1VQ6 A;  2I5H A;  1JQY D;  3RZD B;  1YVC A;  2MFI A;  4C3J G;  1LTR D;  3OHX C;  2EY5 A;  4FP5 D;  1LTG D;  2ENB A;  3DUZ A;  3HKS A;  2BDN A;  4DR6 L;  2D0O A;  3FPU B;  3GTG B;  5JEA G;  2PPB C;  3PO3 B;  4A3D B;  1TT2 A;  5I2X A;  1X56 A;  2K6A A;  2AWN A;  2GA4 B;  3FMC A;  3I72 A;  3LWE A;  1AE3 A;  2HUG A;  2OCE A;  1AH9 A;  2Q8T A;  3HOX B;  4BY7 G;  1LAC A;  1SYD A;  5C44 H;  5C5M A;  4H02 A;  4CKB A;  4RGM A;  1KD1 C;  3GQB A;  3HFZ B;  4DR6 Q;  1OXU A;  4RMF A;  5HY6 A;  3MA2 B;  1YJ9 A;  1KLU D;  5LMU L;  1HFN A;  4GKJ L;  2ALY B;  1UEB A;  4QF4 A;  3P1H A;  3IFT A;  5EBC A;  5C6A A;  1WTR A;  2F0E A;  1WTP A;  5LMU Q;  1IW7 D;  3KBG A;  4DK3 C;  4GKJ Q;  3STB C;  5CR3 A;  3PO3 H;  1GO3 E;  5C0X H;  4A3D H;  4CDF C;  1N34 L;  1VQ9 A;  2YTX A;  1NMG A;  3QB3 A;  4C3H B;  2KVM A;  4A3I B;  1CQV A;  4ABN A;  1CZG A;  1WTO A;  2XTI A;  3ULL A;  3BVZ A;  2ZT9 C;  3GTK H;  2XGT A;  4IUQ A;  4R4I A;  4YIJ A;  2KEE A;  5K36 H;  1CTM A;  1TS4 A;  3VYR A;  3HOY H;  3S1Q H;  2EYL A;  2LFN A;  3A74 A;  2HQE A;  1M8A A;  4ODG A;  1VMP A;  4ZUJ A;  3JAM L;  2PI2 A;  3S1N B;  4EX5 A;  4A3K B;  1CSP A;  5I6Y A;  2R3Z A;  3RZO B;  3N6R A;  1BQQ T;  2F0K A;  4X3S A;  1AN8 A;  5FK9 C;  1XNQ Q;  1MSG A;  1SE8 A;  2Z4I A;  1SMY C;  1Q3L A;  3V2T A;  3S15 B;  5IWA L;  1HTP A;  1EU3 A;  1JC7 A;  2JEB I;  5CC4 A;  2KCM A;  4IUR A;  1VQL A;  5FLM H;  1U0L A;  5IWA Q;  1LTL A;  1S5B D;  1KRT A;  5EPL A;  1NE3 A;  2N49 A;  2PCF B;  1Q8K A;  4Q0F A;  2IPK D;  4RFB A;  1ILQ A;  1B9M A;  1VQP A;  3RZO H;  3I8Z A;  3DWQ A;  2A69 C;  3I73 A;  4O1N A;  1GVP A;  1PTO H;  3PCO B;  2NN6 I;  1QUQ B;  2Q8R E;  5JPM C;  4K5X A;  5A35 A;  4A3F G;  1YNN C;  1SE3 A;  5ELO A;  2E2I H;  4JI3 L;  3TP5 A;  1AW7 A;  1I50 H;  5C4J B;  5EKI A;  3KJO A;  1B1Z A;  3STB D;  2OQ0 A;  5C4H A;  1X6O A;  1QCB D;  5IP7 G;  4KN4 C;  1DZ1 A;  2SDF A;  2EJF C;  1VQD A;  2RHQ B;  1VQJ A;  3OSO A;  3GD7 A;  3Q0A A;  5DM6 3;  2CKZ B;  2D5D A;  2OXP A;  2M2L A;  3VA5 A;  2MO0 A;  4YCW A;  4DV1 L;  3WWV A;  1EEI D;  2E2H H;  2FJ2 A;  2AUK A;  1LO5 D;  2CQA A;  1RHP A;  1CM9 A;  5IIF A;  3P7J A;  5ELD A;  3BZD B;  2PZU A;  1PFB A;  4JI2 Q;  4DV1 Q;  4LMQ D;  5BN5 A;  2Z6K A;  5C4J H;  5M5W B;  1KDA A;  2ZJQ A;  2NVX H;  4LF8 L;  5J1Z A;  4GKK L;  1IKL A;  3G48 A;  1BXT A;  1FL0 A;  3RLN A;  2ICE C;  3R3O A;  4QCL A;  3A8J E;  1VQG A;  1VQ7 A;  4GZY C;  1OO9 B;  2FIN B;  4LF8 Q;  1PZI D;  1IYU A;  1AFP A;  4GKK Q;  2WAQ G;  5E1F A;  2EYM A;  4CKC A;  3ICE A;  2C5C A;  4ZKB B;  2KJX A;  1SAP A;  3M3Y B;  2WV6 D;  4GLV B;  4IFD H;  1A63 A;  5BN4 A;  1KLG D;  4X62 L;  3ERO A;  3GTM B;  3BVG A;  4H0L C;  2NB0 A;  1I4G A;  1GM5 A;  1JWS D;  2EYH A;  1NCV A;  5A2Q E;  1EY8 A;  1S5C D;  3HOY G;  4X64 L;  2A69 D;  1IL8 A;  3I2Z A;  4HCS A;  4X62 Q;  1Z6H A;  4RH6 A;  4HMJ A;  1UE7 A;  4DV3 L;  1YHA A;  1NJI C;  4X3T A;  4FXG C;  1M1K C;  2AQ2 B;  2KEN A;  1JWU D;  2EYO A;  3BG3 A;  3L9A X;  3S1R H;  4IPG A;  2UXB L;  1Z9F A;  3F1Z A;  4DV3 Q;  1X32 A;  3M3Y H;  2QW7 A;  4IQZ A;  1N33 L;  4B3M L;  1O80 A;  5D3D A;  3GTM H;  1HJP A;  1WVL A;  1Z7T A;  1MJC A;  1Y8O B;  2UXB Q;  1B4O A;  3S2D B;  2HD3 A;  3D6W A;  3NHH A;  1N33 Q;  4KTA A;  5C3E G;  4B3M Q;  1WOC A;  4LFC L;  3WOE A;  3HKZ E;  4JBW A;  5IYB H;  3PUZ A;  3NEN A;  1EYD A;  5BN3 A;  5M5Y H;  2FMM A;  3HP3 A;  1XPU A;  2RDH A;  3E0J A;  4A3M H;  3VYT A;  1VQM A;  3FHW A;  4LFC Q;  5DNF A;  4JI6 L;  3R8B A;  1LT6 D;  1HNZ L;  5FJ8 H;  1D1I A;  5ELC A;  1CKN B;  3VR5 A;  1VQN A;  1GD7 A;  1Q7Y C;  1TWA H;  5M3F B;  2KHI A;  4EGV A;  2B2W C;  2QEJ C;  4H44 C;  3PIP A;  1IYJ B;  2JK8 A;  4JI6 Q;  2JA7 B;  3I4N G;  2G9H D;  4DXF A;  1CK1 A;  1K8M A;  5JAV A;  1LYL A;  3NUC A;  5GAG C;  2IX1 A;  1LT4 D;  4DR2 L;  1ROD A;  2F0T A;  4KJO A;  1XMO L;  1WTV A;  5E7N A;  5LMN W;  1E0B A;  5JOB A;  4J15 A;  3MXN A;  3IAY A;  4R4T A;  1FYC A;  4A3B G;  1RIP A;  3PUW A;  2XIW A;  4DV0 L;  4ZAI A;  2F0G A;  1EWI A;  1D6E C;  3TZD A;  2F0W A;  4KY5 A;  5M3F H;  3PSI A;  2DY7 A;  2WB1 E;  2D2C C;  1SNQ A;  3OIQ A;  3ULJ A;  1EFW A;  4DV0 Q;  1VQC A;  2JA7 H;  1QVF A;  4MTN A;  2LXJ A;  2Y0S E;  4C1N I;  1HNX L;  5JEA J;  3GTL B;  2FMC A;  1LAB A;  3L0O A;  5IT9 c;  1HXY D;  1I6H B;  1F9Q A;  2RCF A;  4OX9 L;  2B63 B;  1E7Z A;  5DLQ E;  3F8T A;  2K28 A;  1HNX Q;  3KLR A;  1PYB A;  3HGB A;  4NXM L;  1LTI D;  2KCN A;  4K8J A;  2R7D A;  3SE0 A;  3GTP H;  3CC7 A;  2QDB A;  4L5R C;  3WDN A;  4N8X 1;  1EQR A;  1K0S A;  4OX9 Q;  3QWN A;  3U9S A;  1K8O A;  4KJN A;  3GV6 A;  1QVC A;  4UY8 C;  2UXD L;  3ZJY C;  3SDZ A;  3S2H B;  2ZTD A;  4I7Z C;  4IUP A;  5JVH 3;  1VQ8 A;  1EQT A;  1KNA A;  1LUZ A;  4IUN A;  2FHT A;  5IP9 G;  4R4Q A;  1QZG A;  3H3V H;  2UXD Q;  3AB9 A;  3F2B A;  4DNR B;  2B63 H;  4XTC S;  3S1M B;  5CV5 A;  2X69 A;  4HAE A;  3G71 A;  4LF5 L;  1E22 A;  2YU9 B;  1X54 A;  1FD7 D;  4EQN A;  5ELN A;  3OIP A;  1F77 A;  3H0G G;  1B8A A;  2RDF A;  1JE4 A;  1STN A;  3HOW B;  1SNO A;  2MP1 A;  4IZ8 A;  4YY3 L;  3PO2 B;  3T13 A;  5H1S E;  4FVM A;  4LF5 Q;  2ZXR A;  1JMC A;  1PA6 A;  2Y0S G;  1TWH H;  3AYH B;  2ZXP A;  1TXY A;  4KK7 A;  4DV5 Q;  3S2H H;  4ID6 A;  2OT2 A;  5I2Y A;  1EIY B;  4YY3 Q;  1HCZ A;  1K3B C;  2GN5 A;  1S72 A;  4C3I B;  4K5V A;  1D1K A;  3GO5 A;  5ELE A;  1WD1 A;  2R7Z B;  5C4X G;  5IYB G;  1GUS A;  2EZV A;  5CGK A;  2L11 A;  3HZX A;  1SND A;  2PNH A;  4RG1 A;  1Y1W G;  2PZT A;  4HJ7 A;  4C3J B;  4A3M G;  3UI2 A;  1OXT A;  1GUO A;  2JXM B;  1QIL A;  1SNC A;  2J7Z A;  3GV3 A;  1H9J A;  3I91 A;  1EWH A;  1V1P B;  3W2D A;  5C3X A;  1RTO A;  4XT1 B;  2PYK A;  3HOU H;  4JYA L;  4RGT A;  1VQK A;  1SRO A;  4FF1 A;  4Y7N B;  1SJH D;  3FKI B;  4K6D A;  4OL7 A;  1RF2 D;  2D0P A;  1X9N A;  1VQF A;  4C3I H;  2TMP A;  4JYA Q;  4PG3 A;  4LNQ A;  3MWY W;  3CC4 A;  1DD2 A;  2YTV A;  2BOS A;  2EOT A;  3EQL C;  4B3T L;  5FO9 B;  4A3G B;  4JC0 A;  3MFG A;  2WKC A;  1K3R A;  1TWG H;  4WOR A;  3I4L A;  3HS0 C;  1B3A A;  2KEC A;  4JI4 Q;  2NVQ B;  4H13 C;  2F52 A;  1KIX A;  4B3T Q;  5KNC A;  4DR3 Q;  5GAE C;  4BBR H;  3CAM A;  3KDF B;  2UUA L;  2VS1 A;  4XQQ A;  1A2U A;  3FRP B;  1A15 A;  4OXP A;  5KEE A;  5CV8 A;  4JI5 L;  4Y7N H;  1RL2 A;  2B2W A;  1PZK D;  1YBY A;  3A55 A;  3FKI H;  1G2S A;  2UUA Q;  4IOA A;  2JA6 B;  3BDL A;  1HTL D;  3PIO A;  4UAI A;  3LNN A;  2PW5 A;  2A68 C;  1ZEQ X;  5EKL A;  2L15 A;  3NEM A;  2Z0S A;  1YHB A;  5J22 A;  4JI5 Q;  3MXP A;  4A3E G;  1PRT F;  1WTX A;  1L2F A;  4A3G H;  2JA5 B;  1X3Q A;  5IGD A;  4V19 0;  3KUP A;  1EY0 A;  2V4D A;  2RHS B;  3R93 A;  3S16 B;  1WTH A;  1CQF A;  1XPO A;  2NVQ H;  4HSV A;  3CXC A;  4BXX H;  2B39 A;  2K5V A;  1M90 C;  4A3J G;  1IXR A;  5IYC H;  3TDQ A;  1Y69 U;  3DWP A;  4L5S A;  3TS2 A;  5HGQ A;  1A6X A;  1WCM H;  4XIG S;  3E3X A;  3DWA A;  1QUQ A;  3E9I A;  4PMB A;  1NMF A;  4HIO A;  1BCP B;  2E75 C;  1KNE A;  4DKA C;  4BBS H;  2LSS A;  3V05 A;  2E74 C;  1FNU A;  4RA8 A;  1H9K A;  1G2T A;  4X3K A;  2O2L D;  4HCE A;  3C2P A;  4ZKC B;  1CKO A;  4POF A;  1L0X B;  3G6E A;  3S16 H;  4IJH A;  4G7Z C;  4KLK A;  2QGQ A;  2VUM B;  5IYD H;  1Y8N B;  3A8I E;  1HHV A;  1I4Q A;  3CHB D;  4FF3 A;  4K8I A;  4LF7 L;  1V8Q A;  1G51 A;  5CV6 A;  1YZ6 A;  2CH4 A;  3D4D A;  2EY1 A;  4RHR A;  4A3F B;  4QB4 A;  1DYQ A;  2CCZ A;  3WOF A;  2HHH L;  1JOK A;  3D31 A;  3G7L A;  5F2D A;  1YI2 A;  1GKH A;  4LF7 Q;  4HR7 B;  1LT3 D;  1MIU A;  4R4C A;  3C1F A;  4DN4 M;  1BUV T;  1TS3 A;  2OQK A;  1TWC H;  2HHH Q;  3CQZ H;  3NQI A;  4OO1 H;  2XWJ B;  4GLX A;  1AP0 A;  2G9D A;  2WKD A;  1EYA A;  3UDG A;  4L5Q A;  2EXD A;  4R4O A;  2SNS A;  3CCQ A;  4JK1 C;  5K5P A;  3HOV G;  3RD4 A;  4JW0 A;  3SR1 A;  1NUC A;  2A68 D;  1UAP A;  2F0D A;  5E3F A;  1I4R A;  3U4Z A;  3EJI A;  1GOZ A;  3KYH C;  1MSH A;  2VZA A;  3C46 A;  4R8N A;  4AIM A;  1HQM C;  1AEX A;  2F1M A;  2A19 A;  3HEJ A;  2OTJ A;  2TSS A;  4KHP L;  4AQY L;  4LW1 A;  5DEH A;  1IYV A;  4U68 A;  3URY A;  4OWT B;  3BS1 A;  3PIP 3;  1E1T A;  2EYJ A;  4X66 Q;  1VS0 A;  4B9W A;  2IW3 A;  4KHP Q;  4AQY Q;  3TME A;  3TQY A;  1OTC A;  2ZTE A;  1SEB D;  1T5E A;  2FFK B;  2R93 G;  4RCN A;  4I65 A;  1TWF H;  2B2T C;  4QJF A;  4BBR G;  2LKV A;  3U50 C;  2L0C A;  1YNJ C;  3ND9 A;  3RZD H;  1U9R A;  2A74 C;  4FYD A;  4UPA A;  2VL6 A;  3A5U A;  3HOZ B;  4BA2 I;  3GTG H;  1SBB B;  3U58 A;  2XNA C;  3O13 A;  4LFB L;  2XVS A;  2HCC A;  1PFS A;  1IZ6 A;  3B6Y A;  2XSC A;  2EE1 A;  3HOX H;  2VQE L;  4IO9 A;  1S5D D;  1R4P B;  1TS5 A;  1MBY A;  4BXX G;  3M7G A;  4LFB Q;  1QOH A;  2QIL A;  5GRO A;  4DAY B;  2BE5 C;  2QEX A;  3PV0 A;  5IGE A;  2VQE Q;  2PMZ E;  4B08 A;  4GN3 B;  2HDM A;  2I0Q A;  1EZ6 A;  4F88 A;  4CDC C;  2QCP X;  1WCM G;  3G6J B;  3NBH B;  1X3E A;  1XNQ L;  3HOZ H;  3GTO B;  1PH4 A;  3T1H L;  2PQA B;  1CKN A;  1PXU A;  1S5E D;  1SNP A;  3FEW X;  3NXW A;  4GS3 A;  4P75 A;  5LHY 1;  4C3H H;  1JOO A;  3M9B A;  5I4D A;  4A3I H;  4HIK A;  1F2Y A;  5FO7 B;  1H9M A;  2K03 A;  2L55 A;  3T1H Q;  1KTK A;  3I90 A;  3J7A 5;  2K4K A;  4KY7 A;  1IL2 A;  1KXL A;  2K52 A;  2I5M X;  3A54 A;  3U9O A;  1OXV A;  5IYD G;  2K05 A;  2N3S A;  3D4W A;  3GTQ B;  1E2W A;  4A3L H;  5LMN L;  2F0M A;  1DJR D;  4DR5 Q;  3QOL A;  1RKN A;  1PFM A;  1SSO A;  4KKT A;  1ENA A;  5FKA C;  2AHO B;  2LS0 1;  3D0F A;  3NTI A;  3SXH A;  3S1N H;  3PF5 A;  4A3K H;  3I4M G;  3IFD A;  4B3S Q;  2R6G A;  5LMN Q;  1KAB A;  3TSS A;  3BZC A;  3KJP A;  2JA8 B;  4DPG A;  2ES2 A;  1SN8 A;  1TVX A;  2WAQ E;  1BCP C;  3RUZ A;  2Q2U A;  1YNJ D;  1STG A;  1NSN S;  3S15 H;  4CJ2 C;  1LTS D;  2GVA A;  5EPK A;  2VW9 A;  1B9N A;  4A93 G;  1LT5 D;  2NUC A;  2P5Z X;  3RNU A;  1EY7 A;  1BBX C;  2DN8 A;  3GTQ H;  1H95 A;  4YCV A;  4K2K A;  4KI0 A;  4L5T A;  1JB7 A;  3OMC A;  5CBA E;  1VQO A;  3I4O A;  2IJ0 A;  1OXX K;  2OF1 A;  4OON A;  5M3M B;  5EKK A;  5JPN C;  4C56 C;  1STH A;  5JJL A;  3MXU A;  2NVT B;  1SJE D;  2XN9 C;  1PH9 A;  2JA8 H;  4GNX B;  4JI2 L;  2AQ3 B;  4C2M B;  3CCE A;  3HKZ B;  3NE5 B;  2BE5 D;  2K01 A;  4XT3 B;  3A0J A;  1AZQ A;  4F7X A;  3NWS A;  1SE2 A;  1YIT A;  5C44 G;  1STB A;  3DLL A;  3K57 A;  3NP8 A;  1GUT A;  4LWC A;  5FOB B;  1Q86 C;  1A3U A;  2ZXO A;  4L63 B;  1JB3 A;  3TP6 A;  3K6O A;  1EWC A;  1G8Z D;  3TZU A;  3J81 j;  3CCM A;  1SNM A;  2KOL A;  3N52 A;  2B2V C;  4PZ8 A;  2YV5 A;  4IOC A;  1VMC A;  4EQP A;  4MHE A;  4JI0 L;  4X6A H;  4R1J A;  1I4P A;  4P2C B;  2KHS A;  3RLF A;  3PO3 G;  2MGS A;  5C0X G;  4A3D G;  2ZTC A;  4C2M H;  2F0I A;  1O7Y A;  1A62 A;  4DAV A;  1ASZ A;  3DXJ C;  4DK0 A;  3HOX G;  4JI0 Q;  1WTW A;  1W3S A;  3I3C A;  1SYG A;  4MN3 A;  3ZYY X;  1BDO A;  1KC8 C;  5IT9 L;  3J7Y W;  5M5W H;  1WYD A;  1HZC A;  5K36 G;  5KGU A;  2JQO A;  3KLW A;  4XQJ A;  2B2T A;  1ICW A;  5AJ3 L;  2WB1 B;  2CW0 C;  4ZK9 B;  3CPW A;  3H0G B;  3EFX D;  1BCP D;  1NR4 A;  4GOP B;  1GUN A;  1HPC A;  4DUZ Q;  1HUN A;  2Y0S B;  1V1P A;  1PV4 A;  4KN7 C;  5AJ3 Q;  2DNE A;  1F9S A;  3R2T A;  1D5X C;  1ML0 D;  1NY4 A;  3CPF A;  2NN6 H;  1Q90 A;  2F0L A;  3TS0 A;  3RN5 A;  1QNU A;  1HH2 P;  1SYE A;  2F0S A;  3S14 B;  3DHQ A;  3SEB A;  1WI5 A;  2J0T D;  5CMD A;  4OWW B;  3J7A V;  1EIF A;  1YEZ A;  5FO8 B;  3CC2 A;  1CHQ D;  3K7A B;  4G57 A;  5FLM G;  3KFU A;  1JWM D;  2EQS A;  2MQH A;  2VB3 X;  3BZK A;  4PNY A;  1KHI A;  5CBE E;  2FXQ A;  2Q8I B;  3S17 B;  4DAM A;  3KDF A;  4RHS A;  2E8G A;  1H9S B;  4MTK A;  2IHE A;  3MFY A;  1G91 A;  2F0H A;  2L12 A;  2RCN A;  2VQF L;  4XQN A;  1EY4 A;  4O2D A;  5IGG A;  3K8A A;  3SK4 A;  2BH2 A;  1U5K A;  3VR4 A;  4QY7 A;  1UNS A;  3S2D H;  1L1O B;  2C9O A;  3H94 A;  4NW2 A;  2VQF Q;  2SNM A;  2VY3 A;  5IGB A;  1Y1V B;  5KYL A;  4QQB X;  1GJX A;  4NXN L;  1HR0 W;  2K50 A;  3UDF A;  4ZQ3 A;  2DJF C;  2HCI A;  1F2L A;  2RKS A;  1PH3 A;  5EGT A;  1XXG A;  3CP0 A;  4ZRZ A;  1C4Q A;  2Q2T A;  1C0A A;  1JJ2 A;  2F0Q A;  2EPB A;  2MO1 A;  4M8A A;  3ERS X;  4NXN Q;  1B7Y B;  1DXM A;  1JJC B;  5M5X B;  3I55 A;  1MHW C;  2CW0 D;  3VYU A;  4A3E B;  1BO0 A;  4BY1 B;  4ULL A;  3QO2 A;  4DUY L;  4FF4 A;  2IL8 A;  3R2I A;  2UUC L;  1Y8P B;  5TSS A;  1F2Z A;  2ID0 A;  4A3J B;  3NPP A;  3E9H A;  2IX3 A;  4DUY Q;  5KIX A;  1F2M A;  2HIX A;  2NZ1 D;  1CT1 D;  1O7L A;  2UUC Q;  2L5T A;  5LL6 S;  1XWE A;  4LF6 L;  3L3O C;  1KQS A;  3AMU A;  4UP7 A;  1CFM A;  4TQU S;  1BKB A;  2RDG A;  3K81 C;  5D65 A;  3J7Z C;  2I07 B;  2RSN A;  3QJY A;  4ME5 A;  4IFD G;  4LF6 Q;  3NTH A;  1TKW B;  4N9P A;  4NKL A;  2YTY A;  3SK8 A;  3F2D A;  1PH6 A;  3CU7 A;  1EZ8 A;  2BCO A;  3BDO A;  1Z47 A;  3FDT A;  4P73 A;  3TP8 A;  4M1U B;  4DNI A;  3GTL H;  2HQL A;  5KRU A;  1IBM L;  2NVY B;  1X3F A;  1FNV A;  5COY A;  1I6H H;  2B2V A;  1I3Q B;  1C7Y A;  4MIU A;  1N36 L;  3DEP A;  2NZH A;  1SYC A;  5KYI A;  1JCK B;  2UUB L;  4DV5 L;  1IBM Q;  1B2T A;  2B8F A;  1GHK A;  2R92 B;  2A1A A;  1I4X A;  2PI2 E;  1BR9 A;  5JVG 3;  1N36 Q;  3KK7 A;  1KAW A;  4EQO A;  4KHZ A;  4OHJ A;  2K32 A;  2UUB Q;  1NBW A;  4QIW E;  1MJE A;  2A6H C;  3UDX A;  5CV9 A;  1EUJ A;  2Z1C A;  2I46 A;  3HOV B;  2X6L A;  5LL6 X;  4ALP A;  3J81 c;  3EN2 A;  5FLX c;  1BF4 A;  3FVQ A;  3S1M H;  1I3Q H;  1PH2 A;  4HID A;  1F9R A;  2NZO A;  1EOV A;  1K83 B;  4DR7 L;  1EYC A;  2CVR A;  2R61 A;  1GUG A;  1HUM A;  1S4Z A;  2YU9 H;  1VCI A;  4Z9C B;  3DEO A;  1E3P A;  4DAP A;  4GOP C;  3LWU A;  5FJ8 G;  4X65 L;  1EY6 A;  3HOW H;  2MNA A;  4YWL A;  5CV4 A;  3PO2 H;  1VQI A;  4DR7 Q;  2ICI A;  2AWO A;  3PUV A;  3W1B A;  5GQO A;  1F9P A;  3CD6 A;  1D5Z C;  2XWB B;  2J4X A;  3CW2 C;  1YNX A;  4BY7 B;  3CMA A;  4X65 Q;  4POG A;  4DV6 L;  1Q8I A;  2LMC B;  4EVO A;  4JI4 L;  2R93 B;  1C8C A;  2WP8 J;  5IY0 A;  4EQ5 A;  3T16 A;  2R7Z H;  1B44 D;  1OXS C;  4NP5 A;  4DR3 L;  2NBF A;  3AQQ A;  1GHJ A;  2F0J A;  2K5N A;  3VYS A;  3K7U C;  1STE A;  4DAY A;  1D5M C;  4N8F A;  4X3U A;  4DV6 Q;  1SRU A;  2JP1 A;  4C3J H;  5CV7 A;  3SHL A;  4NPS A;  1X55 A;  3X3M A;  3J81 i;  2EY2 A;  1NAP A;  1R9T B;  3H6M A;  2N88 A;  3NBH A;  3M4O B;  5C4Z A;  5JEA H;  1XMQ L;  1TS2 A;  4KKU A;  5M3F G;  2PQA A;  1JT8 A;  1KDB A;  2B29 A;  1Q1E A;  1PZJ D;  3OYY A;  1C9O A;  1WJJ A;  2JA7 G;  2DGY A;  3J81 E;  1BBW A;  3DM1 A;  3BDC A;  5FLX E;  2AMC B;  1XMQ Q;  1JJG A;  1W6K A;  4JI1 Q;  4HIM A;  1U4R A;  1L1O C;  1WFQ A;  2JE6 I;  2I5L X;  1G29 1;  1Y14 B;  2CWA A;  1RCV D;  3M4Q A;  2BA1 A;  2A6H D;  1JIC A;  3MVV A;  2CWP A;  4MNO A;  1HNW L;  1IKM A;  4RWS C;  2HDL A;  4KD4 A;  4HSP A;  5GAH C;  3I70 A;  3QIA A;  3EIV A;  1II3 A;  4JVZ A;  1U4M A;  3KF8 B;  2VNU D;  1TY2 A;  4Y52 H;  3TEH B;  4LF9 L;  3KF6 B;  2XRS D;  1VF7 A;  4NB3 A;  2JA6 H;  1HNW Q;  1FR3 A;  3QG1 A;  3OOC A;  2KA7 A;  3VR2 A;  1TR5 A;  3CCV A;  5NUC A;  4HMI A;  5C0X J;  3OTO Q;  2JA5 H;  4LF9 Q;  3T53 B;  3OW2 A;  4CBV A;  2B63 G;  1NTG A;  2F4I A;  3KLS X;  2YYZ A;  4ME3 A;  3AU7 A;  2RSO A;  1X3G A;  1EIG A;  5C0X I;  4HN7 A;  1EFI D;  3EBE A;  3H91 A;  2NTS A;  1GXD C;  4XYQ A;  4AYB E;  4RGN A;  3ER0 A;  3I7F A;  3F2U A;  1K73 C;  3CCL A;  2EDG A;  3D6C A;  4GNX A;  2F0F A;  3PGZ A;  3ITP A;  3CKI B;  1CA6 A;  1KAA A;  2A6E C;  1JOQ A;  2WAC A;  3U4V A;  2PMZ B;  4S3S A;  3DM3 A;  2OTL A;  1MKH A;  3A56 A;  3ND8 A;  4XXE A;  3NTK A;  4YHH L;  4UDU C;  1PH8 A;  4APV A;  2PW7 A;  2E5L L;  2NTT A;  1J6Q A;  2VUM H;  4YCU A;  3VA7 A;  2IWH A;  1ICF B;  3MZ5 A;  4YHH Q;  3G4S A;  1KDC A;  4HJ5 A;  2E5L Q;  2HT1 A;  3HOU G;  3PF4 A;  4A3F H;  4U67 3;  1MGS A;  1B70 B;  2JYO A;  4X66 L;  1KL9 A;  1A3V A;  4FXD A;  4YWK A;  2BA0 A;  2L1B A;  5C44 B;  2F0U A;  3X3N A;  2NYZ D;  3NSW A;  4C3I G;  4OIJ A;  1TU2 B;  3RR5 A;  5M9O A;  4IPH A;  3J80 c;  2R7Z G;  3K59 A;  1I4H A;  4ILW A;  2MPM A;  2B8G A;  4ZYS A;  3D4R A;  1WD0 A;  2Z4H A;  3T56 B;  5A2Q L;  5IOD A;  3FP9 A;  2DJG C;  2A8V A;  1EIH A;  1PHJ A;  1YIJ A;  4AYB G;  1JE5 A;  2D62 A;  2WAQ B;  1STA A;  1T9H A;  1D8L A;  4GOP A;  2DUD A;  1SR3 A;  4JI7 L;  2RQX A;  3TN2 A;  3CCS A;  3KOJ A;  1H9R A;  4RAU C;  2Z6B A;  1FNW A;  3FKI G;  5IE8 A;  3GTK B;  3GP7 A;  4JI7 Q;  2X6G A;  3J7A F;  4A3G G;  5I9P A;  4GN5 A;  3UE1 A;  4A76 A;  3HOY B;  1Q46 A;  3S1Q B;  1CA5 A;  2EIF A;  1EY5 A;  4WRD A;  4CDE C;  1DOK A;  1XNR L;  1VDZ A;  3SK5 A;  3J80 i;  1VQ4 A;  1PH5 A;  5IYC G;  5J39 A;  4WFN 3;  2A6E D;  1DCZ A;  2M9V A;  4QGU A;  3AEV A;  4CGY B;  3NBI A;  2DY8 A;  2EXZ A;  1H9S A;  1XNR Q;  3NEL A;  2IY5 B;  2PQE A;  4CDD C;  2NWG A;  1D2B A;  4I7A A;  5C3W A;  1P16 A;  2JEA I;  2ZJR A;  1VF5 C;  2JA6 G;  2QF7 A;  3J80 E;  3IL8 A;  4BBS G;  3W1G A;  1R4Q B;  1I5F A;  2D9U A;  2Q2H A;  2RVL A;  2A5H A;  1N34 Q;  4B3R L;  1ILP A;  4O42 A;  4JG2 A;  2IX0 A;  3HG9 A;  2JA5 G;  3RN2 A;  1V1O A;  2QDL A;  3ONA B;  3T51 B;  5C3E B;  4F8M A;  4DR5 L;  1I94 L;  1L1O A;  3CCU A;  3S9W A;  4IFD J;  3MHB A;  3MEF A;  4GLA C;  4OGQ C;  3ULP A;  4B3R Q;  1VQE A;  1VQ5 A;  4DA2 A;  4DU9 A;  4DR1 L;  1U4P A;  4JCV E;  4KY6 A;  4B3S L;  4OEL B;  4DK6 C;  3HRZ C;  4DV4 L;  1I94 Q;  2OWO A;  1QZH A;  1PTO B;  1HR0 L;  3BVM A;  2PNR C;  4IFD I;  2G5D A;  3OWE B;  3BU2 A;  3TRE A;  1QVG A;  4DR1 Q;  2WFW A;  3TBI B;  2ZJP A;  3GTO H;  2E2I B;  4FDB A;  4R9W A;  4DV4 Q;  2L9H A;  2K5W A;  1HR0 Q;  4V0B A;  4UHV A;  4XYO A;  1PFN A;  3I4N B;  1I50 B;  1E2Z A;  3TP7 A;  3TRZ A;  2H1E A;  5COR A;  1STY A;  3OPO A;  5C3E H;  3T1Y L;  2VB2 X;  4OO1 G;  2KED A;  4LUZ A;  3C1E A;  2C35 B;  2AKW B;  4QUF A;  3RLO A;  2SEB D;  1WTQ A;  3CCJ A;  5EPJ A;  2VUM G;  1CKM A;  2IT1 A;  3H09 A;  3K5L A;  4A3B B;  1W6J A;  3T1Y Q;  1J8I A;  2F0P A;  1EY9 A;  2IHF A;  4NMZ A;  5J3B A;  2E2H B;  3CCR A;  4JI8 L;  1A8V A;  4OIK A;  2MUY A;  3NQT A;  3I4N H;  2NVX B;  2K1B A;  4QL5 A;  4JI8 Q;  1JOR A;  1B3Q A;  5L37 A;  4JV5 L;  4JI3 Q;  1SXT A;  5DAU A;  1N9W A;  1IBL L;  1SE4 A;  4DK1 A;  2B2U C;  2H4O A;  4A3B H;  1PRT B;  1PDQ A;  4BA1 I;  5T1G A;  4JV5 Q;  3F2C A;  1QG7 A;  1QWY A;  1SYF A;  1AE2 A;  2ASB A;  1IBL Q;  1QE6 A;  3QOJ A;  4K6L A;  3ERQ A;  5M3M H;  5C4X B;  3MAQ A;  1PYW D;  4P71 A;  2F3W A;  2VXW A;  1XTD A;  3SVM A;  1SYB A;  3M4Y A;  3K58 A;  1BOS A;  2NVT H;  4B9X A;  1MD2 D;  4IAL A;  5ELF A;  5IGC A;  5JJZ A;  2UU9 L;  4RGO S;  3I56 A;  1ASY A;  1HFG A;  1B50 A;  4R8I A;  1EL0 A;  4FXK C;  3PIO 3;  2F0V A;  1XPR A;  2QA4 A;  2ATW A;  1SMY D;  2UU9 Q;  1DM0 B;  1M4V A;  1P8L A;  1E2V A;  4DUZ L;  1ESR A;  2O5I C;  1XX8 A;  2K33 A;  2CFM A;  4CKE A;  4IJL A;  1Q12 A;  3S1R B;  4AH6 A;  4WJW A;  3JAM c;  2PO4 A;  3HOZ G;  2F03 A;  1X3P A;  4P74 A;  2EJG C;  4TKO B;  3M7N A;  3OMG A;  3E0E A;  1A2T A;  3BYY B;  4HJA A;  3Q8D A;  4C3H G;  4A3I G;  3UDI A;  1J5E L;  4LFA L;  4KD3 A;  1SLJ A;  1YNN D;  4RKB A; 
#chains in the Genus database with same CATH homology
 3JC6 6;  5IP9 H;  3S16 H;  4IJH A;  2A1A A;  2PI2 E;  1N36 Q;  4KLK A;  2QGQ A;  1VQA A;  4X64 Q;  1XNQ Q;  5IYD H;  3BJU A;  1SE8 A;  4PZ7 A;  1KAW A;  4A3L G;  1J5E Q;  4LFA Q;  4KHZ A;  5JJI A;  2UUB Q;  1NBW A;  5IWA L;  4QIW E;  1MJE A;  3H0G H;  4LF7 L;  1L0W A;  3UDX A;  1G51 A;  1YZ6 A;  2JEB I;  1YJW A;  1CSQ A;  1EUJ A;  2KCM A;  4A3K G;  1VQL A;  2CCZ A;  2HHH L;  5FLM H;  4ALP A;  3J81 c;  1U0L A;  3D31 A;  3EN2 A;  5FLX c;  1YI2 A;  1GKH A;  5IWA Q;  1LTL A;  1KRT A;  4LF7 Q;  3S1M H;  1NE3 A;  1I3Q H;  1PYS B;  2N49 A;  4HID A;  1PH2 A;  1MIU A;  2NZO A;  4R4C A;  1EOV A;  3JAM i;  4DR7 L;  1Q8K A;  2YU9 H;  1VCI A;  2OQK A;  3L7Z C;  1TWC H;  2HHH Q;  2UUB L;  3S14 H;  1SMX A;  3H3V I;  1VQP A;  1E3P A;  3RZO H;  3CQZ H;  5C4X H;  2RF4 A;  4GOP C;  4GLX A;  1GVP A;  2BH8 A;  3PCO B;  2N78 A;  2NN6 I;  1QUQ B;  5FJ8 G;  4X65 L;  4L5Q A;  4LUO A;  4A75 A;  2MNA A;  3UDG A;  4YWL A;  1IBM Q;  2EXD A;  4R4O A;  4A3F G;  1Y1W H;  3PO2 H;  1VQI A;  3CCQ A;  4DR7 Q;  2AWO A;  5GAD C;  3K7A H;  3PUV A;  3HOV G;  3W1B A;  5ELO A;  5GQO A;  1CUK A;  2E2I H;  3CD6 A;  4WJ3 M;  4JI3 L;  3CW2 C;  1YNX A;  1D7Q A;  3CMA A;  3U4Z A;  4DV7 L;  4X65 Q;  4POG A;  1I50 H;  1FGU A;  4DV6 L;  3KYH C;  4JI4 L;  3S17 H;  2VZA A;  2WP8 J;  4AIM A;  4EQ5 A;  5IY0 A;  3KJO A;  3STB D;  2A19 A;  2OQ0 A;  1X6O A;  1YJN A;  2R7Z H;  5IP7 G;  1XJV A;  2OTJ A;  4KHP L;  1OXS C;  4DR3 L;  4AQY L;  1VQD A;  3AQQ A;  4LW1 A;  2K5N A;  3GTJ H;  2JA8 G;  3K7U C;  1HNZ Q;  2RHQ B;  4DV7 Q;  4OWT B;  3SGI A;  1SRU A;  4DV6 Q;  4C3J H;  3KF6 A;  1S3O A;  1VQJ A;  4NPS A;  1X55 A;  3GD7 A;  1E1T A;  4X66 Q;  3J81 i;  2CKZ B;  1VS0 A;  4KHP Q;  4AQY Q;  3TQY A;  1OTC A;  2ZTE A;  2MO0 A;  2Q2I A;  4YCW A;  4DV1 L;  3WWV A;  2R93 G;  1XMQ L;  2E2H H;  5M3F G;  2PQA A;  1JT8 A;  4LF4 L;  2B29 A;  4WJ4 A;  1Q1E A;  4DR2 Q;  1K8G A;  1Y1V H;  3OYY A;  1TWF H;  1C9O A;  4QJF A;  4BBR G;  1XMO Q;  1WJJ A;  3U50 C;  2JA7 G;  2DGY A;  2KHJ A;  4JI2 Q;  4DV1 Q;  2N8N A;  3RZD H;  1BBW A;  5M3M G;  2Z6K A;  2AMC B;  4UPA A;  5C4J H;  1XMQ Q;  1N8R C;  2NVX H;  2ZJQ A;  4LF8 L;  4JI1 Q;  1JJG A;  2VL6 A;  4HIM A;  4LF4 Q;  1Q82 C;  4GKK L;  3G48 A;  3A5U A;  4BA2 I;  1FL0 A;  3IRB A;  3RLN A;  1L1O C;  1VQG A;  1WFQ A;  1V9P A;  3GTG H;  2JE6 I;  2I5L X;  1VQ7 A;  1G29 1;  5BR8 L;  3U58 A;  3HKZ G;  1Y14 B;  2CWA A;  5M5X H;  4LF8 Q;  4LFB L;  3M4Q A;  1EQQ A;  2BA1 A;  1PFS A;  1IZ6 A;  3B6Y A;  4A3E H;  4GNX C;  4GKK Q;  2WAQ G;  4BY1 H;  3H15 A;  3HOX H;  2CWP A;  2VQE L;  4IO9 A;  4MNO A;  3ICE A;  1HNW L;  1PVO A;  5BR8 Q;  5GAH C;  4BXX G;  4JOI C;  1V1Q A;  1PH1 A;  4LFB Q;  3EIV A;  5GRO A;  4GLV B;  3KF8 B;  4DAY B;  4K0K L;  1Q1B A;  2VNU D;  4A3J H;  1A63 A;  4Y52 H;  3TEH B;  3K0X A;  4LF9 L;  2QEX A;  3KF6 B;  3PV0 A;  4X62 L;  2PMZ E;  4UP8 A;  2VQE Q;  4NB3 A;  1HNW Q;  2JA6 H;  1X65 A;  4GN3 B;  2I0Q A;  1GM5 A;  1WCM G;  3CCV A;  1Q81 C;  3NBH B;  1X3E A;  4NXM Q;  3HOY G;  4X64 L;  1XNQ L;  5C0X J;  4K0K Q;  3I2Z A;  3HOZ H;  3OTO Q;  2JA5 H;  2GVB A;  4LF9 Q;  1PH4 A;  3T1H L;  2PQA B;  1CKN A;  4TVA B;  4X62 Q;  3OW2 A;  4YWM A;  4P72 A;  2B63 G;  1UE7 A;  4DV3 L;  4GS3 A;  1NTG A;  1YHA A;  1G6P A;  4A3C H;  1DGS A;  1FVI A;  4P75 A;  4C3H H;  2NN6 G;  2YYZ A;  3M9B A;  4ME3 A;  4A3I H;  1NJI C;  4HIK A;  1X3G A;  1M1K C;  2KEN A;  5C0X I;  2HIV A;  3T1H Q;  4JBK A;  3S1R H;  3EBE A;  3GDE A;  2K4K A;  4IPG A;  1IL2 A;  3J7A 5;  1HZ9 A;  1KXL A;  1UE6 A;  1UWV A;  2K52 A;  2KBN A;  1Z9F A;  3F1Z A;  4AYB E;  2UXB L;  2I5M X;  4DV3 Q;  3ER0 A;  3I7F A;  3M3Y H;  1OXV A;  5IYD G;  1N33 L;  2N3S A;  4HJ9 A;  1K73 C;  3CCL A;  1BVS A;  4GNX A;  5EAY A;  3PGZ A;  4A3L H;  5LMN L;  4B3M L;  2WB1 G;  3GTM H;  1HJP A;  4DR5 Q;  2NVY H;  1MJC A;  2UXB Q;  3U4V A;  2AHO B;  3D0F A;  3DM3 A;  2OTL A;  1MKH A;  3S1N H;  3S24 A;  3PF5 A;  1N33 Q;  4A3K H;  3I4M G;  4B3S Q;  2R6G A;  5C3E G;  4X6A H;  5LMN Q;  1WOC A;  4B3M Q;  4LFC L;  4YHH L;  3HKZ E;  1PH8 A;  3BZC A;  4JBW A;  5IYB H;  4APV A;  3KJP A;  2R92 H;  3PUZ A;  3NEN A;  4DPG A;  5M5Y H;  1IBK L;  2E5L L;  4LUV A;  2ES2 A;  1SN8 A;  1XPU A;  1J6Q A;  3AFP A;  2CQO A;  2WAQ E;  4A3M H;  1E1O A;  4YCU A;  2VUM H;  2UXC L;  1VQM A;  2Q2U A;  3PF4 A;  3S15 H;  2B3G A;  3FHW A;  4LFC Q;  4YHH Q;  2GVA A;  3G4S A;  4JI6 L;  3UE0 A;  2VW9 A;  1HNZ L;  5FJ8 H;  3L2P A;  1IBK Q;  4A93 G;  3PUY A;  1CKN B;  4HJ5 A;  3RNU A;  1KRS A;  2E5L Q;  1VQN A;  1GD7 A;  4A3F H;  1Q7Y C;  2HT1 A;  1TWA H;  2KCT A;  3HOU G;  2KHI A;  3GTQ H;  3M4P A;  4YCV A;  3HOV H;  2UXC Q;  1H95 A;  3PIP A;  1B70 B;  4X66 L;  1KL9 A;  1IYJ B;  4KI0 A;  2JK8 A;  2BA0 A;  4L5T A;  4YWK A;  1JB7 A;  4JI6 Q;  3I4N G;  4JBJ A;  1VQO A;  2F3I A;  3I4O A;  3CME A;  1OXX K;  1HZB A;  4OON A;  1K83 H;  1LYL A;  2K75 A;  5GAG C;  2F4V L;  2IX1 A;  3RR5 A;  4IPH A;  3J80 c;  2R7Z G;  4DR2 L;  2K14 A;  5JJL A;  1XMO L;  5E7N A;  5LMN W;  3W5O A;  1PH9 A;  2JA8 H;  4GNX B;  4J15 A;  4JI2 L;  3FP9 A;  1UE1 A;  2A8V A;  3CCE A;  1PHJ A;  1YIJ A;  4AYB G;  4R4T A;  4JI1 L;  2F4V Q;  1RIP A;  4A3B G;  4DR4 L;  4OO1 I;  1JE5 A;  3A0J A;  3PUW A;  2E2J H;  4DV0 L;  2D62 A;  1YIT A;  5C44 G;  1T9H A;  4BY7 H;  1EWI A;  1D8L A;  4GOP A;  3LGJ A;  2DUD A;  1SR3 A;  3DLL A;  4JI7 L;  3K80 C;  4PMW A;  2R93 H;  3CCS A;  2JJQ A;  4LWC A;  1Q86 C;  5M3F H;  3KOJ A;  4DR4 Q;  3PSI A;  1Y1V G;  2WB1 E;  4IPD A;  1EFW A;  3ULJ A;  3CF5 A;  3FKI G;  4DV0 Q;  5JJK A;  1VQC A;  5IE8 A;  2JA7 H;  3J81 j;  3CCM A;  1QVF A;  4IPC A;  1LM0 A;  4JI7 Q;  4MTN A;  4PZ8 A;  1VQB A;  2LXJ A;  2Y0S E;  2YV5 A;  1HNX L;  4IOC A;  4A3G G;  4GN5 A;  5JEA J;  3UE1 A;  3M85 A;  4A76 A;  4JI0 L;  3AFQ A;  1Q46 A;  4R1J A;  1R9T H;  1PH7 A;  3RLF A;  2EIF A;  3PO3 G;  5C0X G;  4PZ6 A;  1K9M C;  2ZTC A;  3M4O H;  4A3D G;  3L0O A;  4C2M H;  5IT9 c;  4UP9 A;  1XNR L;  4OX9 L;  1E7Z A;  5DLQ E;  3F8T A;  1HNX Q;  1PYB A;  1A62 A;  4NXM L;  3J80 i;  1ASZ A;  4BY1 G;  1VQ4 A;  1PH5 A;  5IYC G;  3HOX G;  4JI0 Q;  3OTO L;  1W3S A;  1YHQ A;  4QGU A;  3AEV A;  2R7D A;  3GTP H;  3CC7 A;  1KC8 C;  2UXD Q;  4L5R C;  5M5W H;  1WYD A;  1EQR A;  1HZC A;  1XNR Q;  4OX9 Q;  3NEL A;  2IY5 B;  5K36 G;  3MXN B;  2JQO A;  4HJ8 A;  1K0R A;  3KLW A;  1P16 A;  2JEA I;  2ZJR A;  2JA6 G;  5AJ3 L;  1UE5 A;  1QVC A;  4UY8 C;  4BBS G;  3CPW A;  3W1G A;  2UXD L;  3ZJY C;  1I5F A;  2Q2H A;  2ZTD A;  4GN4 B;  1N34 Q;  4B3R L;  2LXK A;  1VQ8 A;  2ZM6 L;  4GOP B;  4JG2 A;  2IX0 A;  4DUZ Q;  2JA5 G;  3RN2 A;  1LUZ A;  1PV4 A;  4DR5 L;  5AJ3 Q;  1I94 L;  5IP9 G;  1L1O A;  3CCU A;  4R4Q A;  4IFD J;  1BBU A;  1QZG A;  3MEF A;  3H3V H;  4GLA C;  3F2B A;  3ULP A;  2B63 H;  4XTC S;  1VQE A;  4A3C G;  1VQ5 A;  4B3R Q;  1O7I A;  1NY4 A;  2ZM6 Q;  3CPF A;  3G71 A;  4LF5 L;  4DR1 L;  1E22 A;  3HOW H;  3TS0 A;  4JCV E;  3RN5 A;  4JBM A;  4B3S L;  1X54 A;  1HH2 P;  1A0I A;  1FJG L;  4DK6 C;  5ELN A;  1WI5 A;  2V1C C;  1S40 A;  4DV4 L;  1I94 Q;  3H0G G;  1B8A A;  2OWO A;  1SFO H;  1QZH A;  1HR0 L;  2H5X A;  4IFD I;  4OWW B;  3BU2 A;  1EIF A;  1YEZ A;  3TRE A;  4YY3 L;  4JOI A;  1QVG A;  5H1S E;  3CC2 A;  4LF5 Q;  4DR1 Q;  2WFW A;  1JMC A;  4O0A A;  1PA6 A;  2Y0S G;  1TWH H;  3AYH B;  5FLM G;  2ZJP A;  1FJG Q;  3GTO H;  4FDB A;  3KFU A;  4A4I A;  1TXY A;  2EQS A;  2MQH A;  4DV2 L;  1K8A C;  4DV5 Q;  4DV4 Q;  3S2H H;  1HR0 Q;  3BZK A;  1N32 L;  1KHI A;  1EIY B;  2FXQ A;  4YY3 Q;  2R7F A;  2GN5 A;  2JA9 A;  4MZ9 A;  3KDF A;  4DAM A;  1S72 A;  3TRZ A;  1E24 A;  2E8G A;  1HZA A;  3I4M H;  3GO5 A;  3T1Y L;  5C3E H;  4OO1 G;  4LUZ A;  5C4X G;  2IHE A;  4DV2 Q;  2C35 B;  5IYB G;  2R92 G;  2AKW B;  3HOW G;  3RLO A;  2PNH A;  3VDY A;  1N32 Q;  4RG1 A;  1Y1W G;  3CCJ A;  3PO2 G;  2VUM G;  1CKM A;  2IT1 A;  4HJ7 A;  4A3M G;  1W2B A;  2RCN A;  2VQF L;  1OXT A;  1VQH A;  4O2D A;  4OWX B;  3T1Y Q;  1EYG A;  3K8A A;  3A5Z B;  2BH2 A;  1U5K A;  1V43 A;  2IHF A;  2Z6K C;  5J3B A;  4A93 H;  4QY7 A;  3S2D H;  3HOU H;  4JYA L;  1L1O B;  3CCR A;  3PUX A;  4JI8 L;  1SRO A;  2VQF Q;  1VQK A;  2VY3 A;  1A8V A;  2K5H A;  4QQB X;  5IP7 H;  1VQ6 A;  2I5H A;  2D0P A;  3I4N H;  1YVC A;  1X9N A;  4NXN L;  1VQF A;  2MFI A;  1HR0 W;  4C3I H;  4JYA Q;  4QL5 A;  2K50 A;  4PG3 A;  3UDF A;  4LNQ A;  4JI8 Q;  3CC4 A;  2YTV A;  4B3T L;  1PH3 A;  3HKS A;  4JV5 L;  4JI3 Q;  4JC0 A;  3CP0 A;  1IBL L;  1N9W A;  2Q2T A;  1C0A A;  1K3R A;  2D0O A;  4DR6 L;  1TWG H;  1JJ2 A;  2MO1 A;  5JEA G;  3ERS X;  4NXN Q;  1B7Y B;  1X56 A;  4JI4 Q;  2AWN A;  1JJC B;  2F52 A;  4A3B H;  1AE3 A;  3I55 A;  2OCE A;  1KIX A;  4BA1 I;  4B3T Q;  4JV5 Q;  1AH9 A;  3F2C A;  4DR3 Q;  4BY7 G;  5GAE C;  4BBR H;  3CAM A;  1AE2 A;  3KDF B;  4DUY L;  5C44 H;  1IBL Q;  4H02 A;  1KD1 C;  2UUA L;  2ASB A;  2VS1 A;  3HFZ B;  4DR6 Q;  1OXU A;  4RMF A;  2UUC L;  4OXP A;  5M3M H;  5HY6 A;  2ID0 A;  4JI5 L;  4P71 A;  4Y7N H;  1XTD A;  1YJ9 A;  1RL2 A;  5LMU L;  3E9H A;  1YBY A;  3FKI H;  2NVT H;  4GKJ L;  2ALY B;  2UUA Q;  4DUY Q;  4IOA A;  1UEB A;  2HIX A;  3PIO A;  2UUC Q;  2L15 A;  2UU9 L;  3NEM A;  2Z0S A;  1YHB A;  3I56 A;  4JI5 Q;  4LF6 L;  4A3E G;  1ASY A;  1KQS A;  1L2F A;  4A3G H;  5LMU Q;  4UP7 A;  4DK3 C;  4GKJ Q;  3STB C;  4TQU S;  3PO3 H;  1XPR A;  1GO3 E;  2RHS B;  4A3D H;  1XPO A;  1N34 L;  1BKB A;  2QA4 A;  2YTX A;  1VQ9 A;  2UU9 Q;  2ATW A;  2NVQ H;  1NMG A;  3K81 C;  3CXC A;  3J7Z C;  4BXX H;  1P8L A;  4IFD G;  2K5V A;  1M90 C;  4DUZ L;  4A3J G;  4LF6 Q;  1IXR A;  5IYC H;  2XTI A;  2YTY A;  2CFM A;  3F2D A;  3ULL A;  4IJL A;  1PH6 A;  1Q12 A;  4AH6 A;  3GTK H;  2XGT A;  1Z47 A;  4P73 A;  3JAM c;  4L5S A;  4R4I A;  5HGQ A;  3TS2 A;  1WCM H;  4XIG S;  4DNI A;  3HOZ G;  3HOY H;  3GTL H;  1QUQ A;  3E9I A;  3S1Q H;  4P74 A;  1NMF A;  3A74 A;  4HIO A;  2HQL A;  1IBM L;  3M7N A;  1X3F A;  3E0E A;  4DKA C;  4BBS H;  2LSS A;  4HJA A;  1I6H H;  3Q8D A;  1C7Y A;  2PI2 A;  4EX5 A;  4A3I G;  1N36 L;  2NZH A;  3UDI A;  1CSP A;  1CKO A;  1J5E L;  4LFA L;  4POF A;  1SLJ A;  3G6E A;  4DV5 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...