1GD7A

Crystal structure of a bifunctional protein (csaa) with export-related chaperone and trna-binding activities.
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
109
structure length
109
Chain Sequence
MTPLEAFQILDLRVGRVLRAEPHEKARKPSYKLWVDLGPLGVKQSSAQITELYRPEDLVGRLVVCAVNLGAKRVAGFLSEVLVLGVPDEAGRVVLLAPDREVPLGGKVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CSAA PROTEIN
publication title The crystal structure of the ttCsaA protein: an export-related chaperone from Thermus thermophilus.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Rna binding protein
total genus 22
structure length 109
sequence length 109
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01588 tRNA_bind Putative tRNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1gd7A00
4AYBE 3OW2A 1VCIA 3RZDH 4EX5A 2Q2HA 4DR1Q 2ZJQA 1U5KA 2NVXH 4HIKA 1P16A 4UPAA 4OX9Q 1JJCB 2LXJA 1FGUA 1V1QA 3SGIA 3J81j 2QA4A 1VQMA 1Q7YC 1PH1A 3GTQH 1PH2A 2GVAA 3NENA 4WJ3M 1HNZL 4LWCA 1VQBA 3L0OA 5BR8L 3RN5A 2VQEL 4BY7H 3E9HA 1X3GA 1N32L 1JJ2A 1YNXA 2KHIA 1HR0Q 3CCLA 4O2DA 4R1JA 1C7YA 4A3LG 1EUJA 1WCMG 1LTLA 2OCEA 3PF4A 3U4ZA 4OO1I 3CXCA 2JA5G 2MQHA 1O7IA 3KDFA 3STBC 4BA1I 4A3BG 4GKKQ 2Z6KC 1V43A 1YHBA 3PCOB 1M90C 1MKHA 2OTLA 3S16H 4QJFA 5JJKA 1VQDA 4NXML 2NN6G 2YTVA 4LFAQ 4OWTB 1L1OA 1GM5A 4XIGS 5E7NA 5C4XG 2E5LL 1KC8C 3J7A5 4BXXG 1HR0W 1PH7A 2BH8A 3CC4A 4IFDG 2E2JH 3I55A 4NXNQ 3PUVA 3G6EA 1B70B 5JJLA 2UUBL 3S2DH 3PUXA 4DV7L 5IYCG 4JI6L 4LUVA 4GN4B 3CCQA 1BKBA 1VQ4A 4BBSG 4DV3Q 4DR2L 5IP9G 1KRTA 2VQEQ 5C44G 1M1KC 4JI8L 4A3KH 5C3EG 2VUMG 3PO2G 3ERSX 1GKHA 1NJIC 1JE5A 1T9HA 4GNXA 4YCWA 5C0XG 1FJGL 5M5WH 4KHPQ 1K0RA 2CFMA 1HJPA 3M4PA 1E1TA 1E3PA 1XMQL 3ULLA 4IJHA 2WAQE 4YCUA 3UDFA 1PH5A 2IX0A 3A0JA 3S1RH 4IOCA 4JI4L 5IYBG 1OTCA 2OWOA 4B3TQ 4DR7Q 4MZ9A 4JOIC 3ER0A 3F2CA 4FDBA 1NMFA 1PH4A 2E2HH 2JA5H 5AJ3Q 2JA7G 4A3JG 4NXMQ 4A3BH 1PH6A 1QVCA 4GN5A 2R7ZG 1VQ9A 3I56A 4APVA 5C4XH 5FLXc 4QGUA 4BXXH 4LF9L 3S17H 3FKIG 3W5OA 2WAQG 1MJCA 1OXVA 1SLJA 1LYLA 1EIYB 2B63H 5IYCH 4JV5L 1YZ6A 4UP8A 4JI8Q 1EYGA 3U50C 1NE3A 4R4OA 5M5YH 3CW2C 2ZM6L 1D8LA 5C44H 1IBLL 2PQAB 5GAGC 4IPGA 4A3FG 3HKZE 2EQSA 2VUMH 3GTMH 3EIVA 2AHOB 2UXDL 1NY4A 3PGZA 4NPSA 1ASYA 4HJ5A 2PI2E 4AH6A 1X65A 4JI4Q 3TS2A 4DR4Q 1KQSA 4WJ4A 5IP7H 4DR3L 1WYDA 1VQHA 4JI0Q 3KFUA 3UDXA 4X65Q 1CUKA 1EQQA 1Q1EA 5IT9c 4L5SA 1A8VA 2HT1A 2JA8H 4POFA 4A3CH 4L5TA 4PZ8A 2D0OA 3D31A 4JI1Q 4X62Q 5C4JH 4A3JH 3HOUG 2R7ZH 1PH8A 3D0FA 2K75A 1HZBA 1CSPA 5LMNQ 4PMWA 4DUYL 3J80c 4A3DG 1X6OA 4IFDI 1NMGA 1TWHH 3CPWA 1XTDA 3CCJA 4X66L 1XPUA 1GO3E 4B3ML 1X3EA 1IYJB 2D62A 4JI7L 1SN8A 2NZOA 1LM0A 2ZM6Q 4DR6Q 1IBLQ 5IWAL 4A93H 3GTGH 5M3FG 1VQAA 2B29A 2IHFA 5GROA 2F4VL 2IHEA 4JI5L 4O0AA 4DAMA 4LW1A 4RMFA 3BU2A 2LXKA 5LMNW 1IBML 3I4NG 3ICEA 4LF6Q 2QGQA 3OTOL 1A63A 2JA6G 2UUCQ 3EN2A 3KJOA 2VW9A 1XNQL 3Q8DA 2V1CC 3I4OA 3S15H 1ASZA 4YY3Q 3LGJA 4AIMA 3GTKH 3AQQA 1YJ9A 3I2ZA 5GAHC 1Y1WG 1J5EQ 4QQBX 2JE6I 2UXCQ 1UE1A 2PNHA 4GLVB 3CMEA 1N33Q 2IT1A 3PIOA 1K3RA 1TWFH 4AQYL 1YI2A 4JG2A 1N34Q 4YWMA 3E9IA 2FXQA 2L15A 3J81c 4IO9A 2ASBA 3I7FA 1MIUA 4X66Q 3U58A 3T1YL 4A3DH 4GLXA 2JJQA 1VQKA 1PH9A 3EBEA 5IWAQ 2RHQB 1A0IA 4UP7A 1V9PA 1XMOL 1E24A 4R4TA 3MXNB 3HOWG 2N78A 3CF5A 4JI5Q 3HOXG 3S24A 2Q2IA 3TRZA 4PZ7A 1IBMQ 2UXBL 2OQ0A 1WFQA 4C2MH 3I4NH 1YITA 2JQOA 1EQRA 5HY6A 5H1SE 4ALPA 2CCZA 1FVIA 1PYBA 3GO5A 2NVQH 1L2FA 4DR5Q 2VQFL 3TQYA 4DUZL 2F52A 5J3BA 3J81i 1VQ6A 5IYDH 2YTXA 2KCMA 3CP0A 5M3MG 2AKWB 3M85A 4DV5L 3OYYA 4A3EG 3AFQA 3FP9A 1PA6A 1X56A 1CKMA 1IBKL 3M9BA 4LF7L 1W2BA 4LF4L 1YEZA 4YWLA 1QUQB 2AWOA 3E0EA 4NB3A 4C3HH 3T1YQ 1SFOH 1KIXA 2A8VA 3VDYA 2DGYA 1S72A 1HH2P 1HNXL 1PHJA 5FLMG 1HNZQ 1RL2A 5BR8Q 4DK3C 3PIPA 1JMCA 2DUDA 1N32Q 3PUYA 3CCRA 2WB1E 2Q2TA 1VQNA 2I0QA 5GAEC 4YWKA 3HOWH 4X64L 1VQFA 2E8GA 3HOXH 4A3LH 4QL5A 1U0LA 1Z9FA 2KCTA 4A76A 2BH2A 4XTCS 1WCMH 4C3IH 4Y7NH 3G4SA 4LF8L 3M4OH 2UU9L 4JI2L 1H95A 1A62A 1VQPA 4DV4L 1KRSA 1XNRL 2VQFQ 2VL6A 4K0KL 1GVPA 2HQLA 1G291 3GD7A 4BBRG 1E22A 2CWPA 3KF6B 2WB1G 4H02A 4DV5Q 4B3RL 4B3SL 3TEHB 2E5LQ 1I3QH 5JEAJ 1IBKQ 4LF7Q 1EFWA 2C35B 4GLAC 2UUBQ 4YCVA 1CKNB 4DV7Q 2R93G 4JI6Q 2JEAI 2F3IA 1K83H 4LFBL 3KF8B 3S1MH 3AEVA 4DR2Q 3A74A 3RLNA 1OXSC 3CPFA 1UE6A 3JC66 1VQ5A 1S40A 3GTOH 4BBSH 4DAYB 2D0PA 5IP9H 3BJUA 4DV2L 1PYSB 2N3SA 4LF5L 5C3EH 1FJGQ 3PO2H 1PVOA 1XMQQ 1HZCA 1BVSA 2GN5A 2K5HA 4QY7A 3RN2A 4JBMA 2VNUD 2R92G 4LF8Q 2I5LX 1K73C 1Q46A 1XNRQ 2YYZA 1LUZA 2IX1A 2Y0SE 5LMUL 2XGTA 5IYBH 2CWAA 2R6GA 3I4MG 1AH9A 4B3RQ 4YHHL 2JA7H 2YTYA 2I5MX 2NZHA 3PUZA 1YJNA 1CKNA 2B3GA 2NN6I 1VQGA 1P8LA 2HIXA 4GOPB 3B6YA 4LF9Q 4A3MG 4JYAL 2N8NA 3GDEA 3RNUA 3G48A 3FKIH 1UWVA 4JV5Q 1I6HH 3L7ZC 2PQAA 2Y0SG 1KXLA 4JI3L 3WWVA 1X54A 2VY3A 4DV1L 1N8RC 4DV2Q 4LNQA 1C0AA 1N36L 3T1HL 3CC2A 3S2HH 3MEFA 3S1NH 1UE5A 4HJ8A 4A3GG 1K9MC 2UXDQ 2HIVA 4LUOA 4OXPA 3L2PA 1E7ZA 5C0XI 4A3FH 1AE2A 3IRBA 3K81C 2NVTH 4DNIA 2ALYB 3W1GA 4DR3Q 2R92H 4P74A 4QIWE 5LMUQ 1UE7A 4DR1L 2ZTCA 3HFZB 4MTNA 1G6PA 4IPCA 3RLFA 1S3OA 2MO0A 3JAMc 4RG1A 5M5XH 3FHWA 3G71A 3H0GG 5IYDG 1PH3A 4OX9L 2NVYH 1EIFA 4BY7G 3HOUH 2JEBI 3CCMA 1X3FA 4R4QA 4DUYQ 1PV4A 4JBKA 1EOVA 1QVFA 3S1QH 1X9NA 4IOAA 4JCVE 4B3MQ 4DV6L 2ID0A 3CMAA 4DV1Q 4JI3Q 4JI7Q 2ZJPA 2MFIA 3J7ZC 2RHSB 3K7UC 5EAYA 4HIOA 2F4VQ 1BBWA 4PZ6A 4DKAC 5FJ8G 2XTIA 4C3JH 5M3FH 2A1AA 1Y1VG 3A5ZB 3KYHC 4LUZA 4A3GH 3OTOQ 3KDFB 1CKOA 2MNAA 5JEAG 3GTJH 4LFAL 1XNQQ 1OXUA 2RF4A 1XPRA 3JAMi 3ULPA 2KHJA 2JA6H 3HOYG 2N49A 1Q86C 4UP9A 3UDGA 1VQCA 5DLQE 1E1OA 1VQIA 1YJWA 1L1OB 4NXNL 1UEBA 2ATWA 3K80C 1KHIA 1KAWA 2OQKA 2AMCB 4AQYQ 2K5VA 1Y1WH 4A3KG 3H0GH 3S14H 4DV3L 1IXRA 4PG3A 3TREA 3DLLA 3PV0A 2Z0SA 1NBWA 4HIMA 2K52A 3GTLH 3CCUA 4P72A 3U4VA 2LSSA 3PUWA 4AYBG 4DV6Q 1Q12A 2EXDA 1JB7A 1I50H 3M3YH 4A4IA 4KHPL 4MNOA 1QZHA 1IZ6A 4GNXB 2GVBA 1EWIA 3CQZH 1OXTA 1DGSA 3UDIA 1XMOQ 1Q82C 1G51A 4L5RC 1AE3A 4B3TL 3F1ZA 1X55A 4DR7L 2K4KA 5AJ3L 5FJ8H 2UXBQ 3UE0A 2K50A 3AFPA 1Y1VH 2R7FA 4Y52H 1CSQA 4J15A 2QEXA 5GADC 1MJEA 3CD6A 4ME3A 4IPDA 4POGA 2CQOA 2A19A 2RCNA 4OWWB 1Z47A 4DUZQ 3HOYH 4DPGA 1VQEA 3ULJA 1FL0A 3RZOH 2KENA 3F8TA 2B63G 4EQ5A 5K36G 4P75A 1HZ9A 3NBHB 3NELA 1QUQA 4P73A 3CCEA 1K8AC 1TWAH 2JK8A 1WJJA 4KLKA 1SMXA 4A3EH 5M3MH 4LF4Q 4GOPC 5HGQA 2WP8J 2R7DA 2PI2A 2ZJRA 1OXXK 1HNXQ 5GQOA 3PF5A 4LFCL 3HOZG 3CC7A 1TWGH 1B8AA 5IP7G 2UUAL 1JJGA 5FLMH 5ELOA 3BZCA 4DR4L 3RLOA 2JA8G 1QVGA 4TQUS 4X64Q 1Q1BA 2WFWA 4X65L 4JI0L 3PO3G 3F2DA 4A3CG 1SR3A 1IL2A 2VS1A 1Q81C 2K5NA 4X62L 4GKJL 4JI1L 2YU9H 2UU9Q 4JI2Q 3KF6A 2ZTEA 4DV4Q 4UY8C 4K0KQ 5LMNL 1YIJA 5IY0A 3HOVG 5JJIA 4BY1G 3BZKA 4DV0L 4B3SQ 1XPOA 4BBRH 3ZJYC 1VQ7A 2OTJA 1TWCH 1VS0A 1QZGA 1VQ8A 4BA2I 4GS3A 4A93G 4X6AH 4DR6L 4JC0A 1HZAA 3CCSA 3CCVA 1KL9A 2ES2A 1L0WA 1I94L 4IFDJ 1HNWL 3STBD 4LFBQ 3K7AH 2K14A 4OONA 2JA9A 2R93H 2Z6KA 3UE1A 1YHQA 2AWNA 4DK6C 3A5UA 1XJVA 4LFCQ 4JBJA 1SROA 4OO1G 2UUAQ 1GD7A 2HHHL 2PMZE 2YV5A 4LF6L 2E2IH 3HOZH 3KLWA 1WOCA 2H5XA 3H15A 2UUCL 4LF5Q 1SRUA 3F2BA 1D7QA 1VQOA 3H3VH 4L5QA 4YY3L 3GTPH 1C9OA 5C0XJ 4TVAB 3PO3H 4A3IG 4GKJQ 1J5EL 3W1BA 3DM3A 2I5HA 3K0XA 4R4CA 5IE8A 4HIDA 1YBYA 3RR5A 3HKSA 4A75A 1WI5A 2EIFA 3HKZG 1N33L 2UXCL 2IY5B 1N9WA 1N34L 3PSIA 5ELNA 1JT8A 1VQJA 2KBNA 4GN3B 3K8AA 4KHZA 4KI0A 2VZAA 4YHHQ 1R9TH 4DV0Q 1L1OC 1RIPA 2BA1A 4GOPA 2CKZB 1KD1C 3HOVH 3AYHB 3CAMA 3I4MH 2BA0A 4P71A 4BY1H 4JBWA 4HJ9A 3M4QA 4HJ7A 4JYAQ 2MO1A 1HNWQ 1I94Q 1Y14B 1YVCA 4A3MH 3NEMA 1NTGA 1Q8KA 1YHAA 4JOIA 1HR0L 2HHHQ 4HJAA 1K8GA 1VQLA 1N36Q 3KOJA 3T1HQ 1B7YB 4GNXC 2ZTDA 1TXYA 4IJLA 1BBUA 3KJPA 1PFSA 1I5FA 4R4IA 3H3VI 4GKKL 4DR5L 1J6QA 2Q2UA 1W3SA 1SE8A 4IPHA 4OWXB 3J80i 3M7NA 3TS0A 4A3IH
chains in the Genus database with same CATH superfamily
3GTPB 1DD2A 1EL0A 4DR1Q 4B08A 1P16A 4OX9Q 1FGUA 4K5XA 3J81j 1VQMA 1Q7YC 1PH1A 3GTQH 2GVAA 3NENA 2MGSA 4FF4A 1BCPC 1EIHA 1HUNA 3CRKC 3E9HA 1HXYD 4BY1B 1N32L 1E2ZA 2KHIA 4KK7A 1HR0Q 4A3LG 1G8ZD 4R1JA 1C7YA 1ESFA 1WCMG 2OCEA 3U4ZA 2WKCA 3VR3A 2I46A 3STBC 3KDFA 5COYA 3PCOB 1YHBA 3I73A 5JJKA 5FLXL 1VQDA 4NXML 1W6KA 5IGEA 4XIGS 3J7A5 3GV3A 5JEAH 1PH7A 3A7LA 3MXGA 3K5OA 3RZDB 1B70B 5IIFA 5JJLA 5J1ZA 4DV7L 1QILA 4JI6L 4FF1A 1VQ4A 1BKBA 1STYA 5HGTA 4DV3Q 5IP9G 4NDXA 1M1KC 4JI8L 4A3KH 1ENCA 1I6VC 2K04A 1NJIC 4GNXA 4YCWA 4KHPQ 1K0RA 2CFMA 3M4PA 1FD7D 3VR4A 1HHVA 5E3FA 2DNCA 4YCUA 1PH5A 2IX0A 4B3TQ 4MZ9A 2E2HH 3F2CA 1FNWA 2N88A 5AJ3Q 1K3BC 4GN5A 2R7ZG 1G2TA 1NUCA 3S16B 3NSWA 5FLXc 3ONAB 4BXXH 5I9PA 3FKIG 1LYLA 1YZ6A 2FHTA 4DK1A 1D8LA 5C44H 3X3NA 1S5FD 5GAGC 4V190 4L63B 2VUMH 2EQSA 3NP8A 1ASYA 4NPSA 4HJ5A 1X65A 2ICEC 1KABA 3BYYB 2EPBA 4M8AA 2F03A 3J81L 4A3CH 1PH8A 1FYCA 1PRTF 1JORA 4H44C 5LMNQ 3Q0AA 1X6OA 1NMGA 1O7ZA 1WVLA 5C4XB 4X3TA 4B3ML 1IYJB 1SYCA 4JI7L 4IZ8A 1LTSD 5IWAL 3GTGH 1EY9A 5M3FG 2A69D 2B29A 1ET6A 4OL7A 4JI5L 4O0AA 4TKOB 3BU2A 2B2TC 2F0HA 1Y8PB 1STHA 2QGQA 3GTMB 1A63A 2UUCQ 2B2WC 3KJOA 1XNQL 3Q8DA 2V1CC 2RDGA 3I4OA 2PPBC 1EEID 3LGJA 1DCZA 3GTKH 1RKNA 1Y1WG 4QQBX 5E1FA 2RVLA 5LL6S 2PNHA 1N33Q 2IT1A 1TWFH 1YI2A 1RTNA 2JXMB 4C3HG 3J81c 1Q8IA 4X66Q 4A3DH 1TWHB 2DNEA 1A3VA 1ICFB 1I6HB 2RHQB 1V9PA 1XMOL 3HOWG 4OIJA 4FXGC 2N78A 1LT3D 2QKIC 3S2HB 1IBMQ 5T1GA 2OQ0A 4CHTB 4QCLA 2R3ZA 1S5ED 2KQ3A 1L2FA 4YIJA 1GUOA 4DUZL 1Q90A 2QDLA 2F52A 5J3BA 2YTXA 4A3EG 2AKWB 3OYYA 3AFQA 3FP9A 3J80E 1X56A 4V0BA 3G6JB 1YEZA 4YWLA 1CQVA 5I6WA 3HKZB 1O78A 1TS3A 1PHJA 1RL2A 2A6HD 3QR8A 1B9MA 3P7JA 1VQNA 2WB1E 5BN4A 2DY7A 2WINB 4K8JA 4RH6A 2I0QA 4OGQC 3HOXH 4A3LH 1U0LA 1WCMH 4C3IH 3M4OH 2UU9L 2M00A 3NTHA 3KLSA 1G291 3LX0A 2O4XA 4EQPA 4BBRG 2WB1G 1SJED 3NPPA 2F3VA 5D65A 2E5LQ 3MWYW 2MP1A 4LF7Q 1V8QA 1JR0D 2C35B 4IUTA 4GLAC 5JAVA 2A73B 2R93G 3GTLB 1JB3A 5CGKA 4DR2Q 3A74A 3A7AB 3JC66 4OIKA 3GTOH 1I50B 3VA5A 5IP9H 1LTBD 2LS01 1M4VA 5T1IA 1BVSA 1LT4D 2K5HA 4QY7A 1KNAA 4HSPA 4LF8Q 2I5LX 2KA7A 3DUZA 1K73C 1WTXA 4RFBA 4L6TB 3P20A 4Y7NB 5LMUL 4K5WA 1F2YA 2I5MX 2NZHA 1H9MA 1PTOH 1F2LA 2NN6I 3TBIB 1JC7A 1D2BA 1V1PB 5IGGA 2AUKA 5CMDA 4HR7B 3FKIH 4FF2A 3L3OC 1KXLA 2VB3X 1ENFA 3T1HL 1H9RA 5CV7A 3V2TA 1K9MC 1KDBA 1E7ZA 3IRBA 3K81C 4ID6A 2KVMA 3PO2B 4DNIA 4DR3Q 2R92H 4P74A 3NQIA 1QJOA 2ZTCA 4DR1L 1B53A 1G6PA 3RLFA 4QUFA 1TS2A 5M5XH 1T5XD 4OX9L 2NVYH 1WTOA 5FLXE 1EIFA 4BY7G 2JEBI 4DUYQ 3KLSX 1PV4A 5A35A 3QJYA 1I4RA 4N9PA 4ZLTF 2D9UA 3CMAA 4WJWA 1U4PA 2MFIA 2A6ED 3OIPA 2XSCA 5FJ8G 2XTIA 4WRDA 5M3FH 2BOSA 1BR9A 3I8ZA 3K57A 3ULPA 4A3FB 1CHPD 1QOHA 2NUCA 1E1OA 1YJWA 1L1OB 5CV9A 1UEBA 1BNZA 5LL6X 2RDFA 1KHIA 2OQKA 1R9TB 2AMCB 4S3SA 4AQYQ 1Y1WH 3H0GH 4DV3L 1IXRA 3DLLA 2F1MA 2BE5D 3R8BA 2HUGA 1STNA 3HOUB 1VF5C 1BCPF 1AN8A 1JB7A 2EXDA 1BXTA 4XT1B 4KHPL 3CQZH 3K5MA 4L5RC 4KY7A 2RQXA 3GP7A 3NTIA 1AE3A 4B3TL 4FP5D 1X55A 2Y0SB 4WORA 5KRUA 1XX8A 5AJ3L 3AFPA 4C3JB 2OT2A 2QEXA 2EZVA 4A3GB 4POGA 3EROA 3A55A 4DN4M 3ULJA 1DOMA 2L55A 3GV6A 1K8AC 3HGBA 1EY6A 1TWAH 2PZWA 1WJJA 4KLKA 4A3EH 3SR1A 3TMEA 1PLFA 5HGQA 1F2ZA 2R7DA 2PI2A 2ZJRA 1OXXK 1UAPA 2K1BA 1HNXQ 5C5MA 5GQOA 3I90A 4LFCL 3HOZG 5EPKA 1B8AA 4K2LA 3M3YB 1JJGA 3OWFA 2F0PA 3BZCA 4QIWB 3IAYA 4TQUS 2Z4HA 3F2DA 1SR3A 4XDXA 1IL2A 1Q81C 4GKJL 1DZ1A 5IGFA 4ZYSA 5IODA 1Y1VB 4K0KQ 4LJZC 3FDTA 5LMNL 3VR2A 2CH4A 5IY0A 1PRTC 4BBRH 1A3TA 3QO2A 5I2XA 1LTID 3RZOB 1MI2A 1VQ8A 4GS3A 2KECA 4IFDJ 2ES2A 1I94L 3STBD 4KJNA 4A3KB 4OONA 2R93H 2OEOA 1XJVA 4JBJA 4OO1G 2YV5A 2AQ3B 2UUCL 2KHSA 3TN2A 1CZGA 3F2BA 3SHLA 4PQXA 1VQOA 1D7QA 5IGDA 1C9OA 4DGZA 4A3IG 1B2TA 3DM3A 5JPMC 4HIDA 2EIFA 1N33L 4MIUA 1VQJA 4GN3B 4KHZA 1FNUA 3T51B 2VZAA 4YHHQ 4DV0Q 2BA1A 1V1PA 3HOVH 4XYOA 4ULLA 1RHPA 4HJ9A 1HNWQ 2MO1A 5HURA 2XVSA 4IUNA 1FNVA 3NEMA 1Q8KA 1SYGA 4JOIA 1H9SB 1TQOA 2EY2A 4H13C 4PNYA 4JPBW 1VQLA 1SBBB 1DOKA 2NZ1D 4GNXC 2ZXRA 4IN3A 3RMHA 2Z6BA 1I5FA 2E2IB 4GKKL 1SE4A 1GJXA 1SE8A 4IPHA 4RGOS 4U673 5FO8B 4AYBE 2H4OA 1B44D 1CZWA 3RUZA 3PO3B 2Q2HA 1AP0A 2J0TD 4RKLA 4KHVA 2NVXH 1CK1A 4UPAA 5DNFA 5KYIA 2QA4A 1PH2A 1U9RA 2R61A 3I4MB 4BY7H 4FYDA 1X3GA 3WOEA 1E2VA 1JJ2A 1YNXA 3CCLA 4C1NK 1MBYA 3VYRA 4IUVA 3C46A 3NWSA 5KYLA 3KLRA 2Z6KC 3DWAA 2KCNA 1MKHA 1HFNA 4QJFA 1EY0A 4ZUIA 3WDNA 1LT5D 2YTVA 1L1OA 2IL8A 4IURA 3Q23A 2E5LL 1KC8C 4BXXG 2X69A 2BH8A 3CC4A 3K5LA 4IFDG 1DJRD 3I55A 4NXNQ 2B2YC 1TWFB 4BWGB 3QOLA 1ICWA 5FKAC 4LUVA 4GN4B 2EY6A 3CCQA 2L11A 4DR2L 1GUNA 2PMZB 2VQEQ 5C44G 3OIQA 1ENAA 5C3EG 2VUMG 3ERSX 1GKHA 3CKIB 1JE5A 1T9HA 5EBDA 5IGBA 1HJPA 3C2PA 1SNPA 1E1TA 2DJGC 3ULLA 4IJHA 3UDFA 2PQEA 3A0JA 4ZK9B 5IYBG 1HTPA 2OWOA 2JA5H 1PH4A 2JA7G 4A3BH 4ZUJA 5DAUA 1QVCA 4O1NA 3K58A 1SYEA 3D3RA 3HRZC 3HS0C 5D14A 1SNCA 3BZDB 1MJCA 2E2JB 2IW3A 1SLJA 5EBCA 4XQJA 1AZPA 5IYCH 2L9HA 4IUQA 1NE3A 3CW2C 2F0EA 2NTSA 1IBLL 4IPGA 1WTPA 3A56A 5M5WB 4JI4Q 3TS2A 4DR3L 1WYDA 1VQHA 2XWJB 1AW7A 1C4QA 3UDXA 4X65Q 1EQQA 1Q1EA 3N6RA 5FK9C 1SAPA 2HT1A 3S1RB 1BF4A 4POFA 4L5TA 4PZ8A 5C4JH 4A3JH 3E3XA 3SK5A 5ISRA 3H3VC 2EYMA 1HZBA 1KAAA 4ME5A 1JQYD 1QWYA 3PMFA 1IKLA 4FO2A 4DUYL 3J80c 4A3DG 5M9OA 1SMYC 1XTDA 4RHSA 3CCJA 3S17B 2D62A 4IALA 2ZM6Q 2B63B 5M5YB 2CHBD 4LW1A 4RMFA 4NKLA 3EN2A 2DJFC 2VW9A 2F0QA 3BG3A 2K5QA 3D8GA 1YJ9A 3I2ZA 3ND8A 2JE6I 4GLVB 3PIOA 2PCFB 3CRLC 1K3RA 4AQYL 3E9IA 5EPLA 2FXQA 2R7ZB 4KKTA 3U58A 3T1YL 4UP7A 1H9SA 1E24A 3HOXG 1NR2A 3S24A 2Q2IA 3TRZA 4PZ7A 4A93B 4C3IG 2LY7A 2RSNA 1WFQA 3I4NH 2KCCA 1YITA 5HY6A 4F7XA 2CCZA 1FVIA 1PYBA 3GO5A 5CC4A 2NVQH 3VYSA 2VQFL 3TQYA 5A2QE 3C1FA 3S15B 4CKEA 3CP0A 5M3MG 4RWSC 2M9VA 5D3DA 4DV5L 5ELBA 1CKMA 1KDAA 2Z9HA 1W2BA 1KLUD 3E0EA 4NB3A 4UAIA 1KIXA 1SFOH 1SXTA 3VDYA 1S72A 1SSOA 3J7AF 1HNXL 1EOTA 5FLMG 3TP5A 5BR8Q 2F0KA 1AZQA 2DUDA 2Q2TA 3I3CA 5GAEC 4Q0FA 4FVMA 4YWKA 4KY6A 2B8FA 4QL5A 1Z9FA 4A76A 2G9DA 5M3FB 4XTCS 3G4SA 2KOLA 3FPUB 1D5ZC 2VL6A 4K0KL 1GVPA 2HQLA 4C2MB 1Y8OB 5D3IB 3EQLC 2HD3A 1E22A 3KF6B 4KKUA 4QF4A 5NUCA 2A68D 1IBKQ 3E0JA 1EFWA 1GOZA 3V05A 3SEBA 1Y1WB 1I4GA 4IFDH 2JEAI 2F3IA 4UDUC 4C3HB 1OXSC 1UE6A 1YNNC 4DAYB 2D0PA 1MHWC 1PZJD 3ERQA 1PYSB 1FJGQ 5C3EH 3R3OA 1Y8NB 4G7HC 1XMQQ 2IJ0A 1R4QB 2EYFA 3HOWB 2R92G 2K03A 5JPNC 1Q46A 1XNRQ 2YYZA 2LMCB 3A8JE 4ILWA 5BN5A 3G7LA 5IYBH 3O13A 1B1ZA 2CWAA 4B3RQ 4YHHL 2JA7H 3DHQA 1CKNA 2B3GA 1WD0A 1EYAA 1QB5D 5IGCA 3B6YA 4LF9Q 5EJWA 1PFBA 1I3QB 3SK6A 1BO0A 3RNUA 2F0GA 5JOBA 5JJZA 4JV5Q 2O2LD 1A6XA 4JI3L 3WWVA 1N8RC 3C1EA 4DV2Q 1K83B 2EDGA 3A8IE 3MEFA 4BBSB 1UE5A 4F87A 3SXHA 2UXDQ 1F9QA 3Q6SA 4Z9CB 5C0XI 3SVMA 3KBGA 4P2CB 2NVTH 1D1IA 1FGBD 2ALYB 2BDNA 2XN9C 1F77A 3HFZB 2A5HA 1JWMD 4IPCA 3FHWA 3H0GG 2DY8A 1G2SA 3R2IA 4CBVA 3BVZA 4R4QA 4CJ0B 1WD1A 2WB1B 5G3LD 1X9NA 5EKIA 1STBA 4DV6L 4DV1Q 3BVGA 2B2UA 5EAYA 2F4VQ 1BBWA 4PZ6A 2G5DA 5CBAE 3DM1A 3KYHC 3HG9A 3OTOQ 3FPPA 1CKOA 1PRTD 1OXUA 3NE5B 3JAMi 2WACA 2WV6D 1Q86C 1DXMA 2AUJD 1VQCA 2IPKD 1VQIA 4NXNL 3K80C 1D5XC 1KAWA 1JCKB 4LMQD 2K5DA 4DNRB 3OSOA 3TREA 3PV0A 4X3UA 4HIMA 1IYVA 2K52A 3D4RA 3U4VA 1Q12A 2L5TA 4KD3A 4A4IA 3S1QB 1XTCD 2GVBA 3J7YW 1OXTA 1LO5D 3EJIA 1G51A 2HQEA 4CDFC 3F1ZA 1NR4A 1PFMA 2K4KA 3LWUA 2UXBQ 2K50A 2L0CA 1Z7TA 2R7FA 4Y52H 1D5MC 2K32A 4JVZA 4ME3A 4IPDA 2CW0C 4OWWB 3GTJB 1S5BD 3HOYH 4DPGA 2RDHA 1RDPD 1STAA 2OF1A 1ONLA 5K36G 4TRDA 1HZ9A 5M3MH 4LF4Q 3MEHA 3S14B 5CBEE 4BY7B 3NBIA 3PF5A 2C9OA 5IP7G 2UUAL 5FLMH 5ELOA 1NNXA 2K33A 2JA8G 2G9HD 2ICIA 1Q1BA 2WFWA 4X64Q 4X65L 4K5VA 3TP7A 2YU9H 4RHRA 4JI2Q 3KF6A 5CORA 4UY8C 3HOVG 3NTKA 4B3SQ 1HUMA 1XPOA 1EZ6A 4MHEA 3OMGA 1TWCH 1F2MA 1A2TA 1HZAA 1L0WA 4DAYA 4HMIA 4DK6C 3A5UA 3TP6A 1SROA 5C6AA 5ELFA 1HCZA 1WOCA 2H5XA 4I65A 1GUGA 4LF5Q 4X3KA 3MZ5A 1SRUA 1SE2A 1TWGB 3H3VH 3GTPH 2PW7A 4TVAB 3HKZG 4LK1C 2IY5B 2Z4IA 4DNTB 3OMCA 1SE3A 3R2TA 1JT8A 2KBNA 3TDQA 1AEXA 1L1OC 2HDLA 3OOCA 5I9OA 3AYHB 4BY1H 3TZDA 3MTSA 1PZID 1X3PA 1Y14B 1YVCA 2JP1A 3HEJA 4K6LA 2F0UA 3OW7A 5C3XA 2MJ8A 1HR0L 2HHHQ 2EJGC 3K7AB 1N36Q 3KOJA 2RSOA 4E6IA 3KJPA 1PFSA 3HOZB 1J6QA 1TU2B 4LAAA 4OWXB 3J80i 1GUWA 2SNMA 2EY1A 2SNSA 3OW2A 1VCIA 5C4JB 3RZDH 2ZJQA 4N9TA 1U5KA 1PTOD 2LXJA 1V1QA 3SGIA 1D6EC 4DF7A 4WJ3M 1VQBA 5BR8L 3RN5A 1LABA 4GZYC 1C8CA 4O2DA 1EUJA 1WTRA 1LTLA 2EOTA 4A3MB 3PF4A 5E4WC 4OO1I 2NWGA 2I07B 2JA5G 1O7IA 5JVG3 4A3BG 1HFGA 4KJOA 1V43A 3H09A 3MVVA 5BN3A 3I91A 1M90C 2OTLA 3S16H 2NN6G 1EU4A 5CV4A 4LFAQ 2J7ZA 4OWTB 2RA4A 1HR0W 2FINB 2NB0A 3H6MA 4A3IB 3PUVA 3G6EA 1VMPA 3S2DH 3NHHA 3PUXA 4R8NA 5IYCG 3I4LA 2E76C 1EQTA 1FR3A 3GTQB 3PO2G 2B2WA 4HEDA 1FJGL 2E74C 2KEEA 1XMQL 4IQZA 1DYQA 4QMGA 1QNUA 2WAQE 2A69C 1EU3A 5A2QL 4DR7Q 3ER0A 4FDBA 4A3JG 3H91A 4NXMQ 1PH6A 1NCVA 1LLRD 1ZYRC 3RD4A 5C4XH 3T53B 3MC0B 4LF9L 1AFPA 3W5OA 1BCPD 2WAQG 2ZT9C 4M1UB 1OXVA 1EIYB 4JV5L 1UNSA 5K36H 1CTMA 4UP8A 4JI8Q 2BDOA 2RKSA 4R4OA 3U50C 5EPJA 3VR6A 3LNNA 4A3FG 3GTMH 2AHOB 2UXDL 1NY4A 4KMUC 4AYBB 5AFWA 4DR4Q 5IP7H 3KFUA 4JI0Q 3K0YA 1CUKA 3E6ZX 4DU9A 2JA8H 5IOCA 4JI1Q 2E2HB 4DXGA 2QW7A 3HOUG 2F0JA 3D0FA 2K75A 4ZQ3A 4H0LC 4PMWA 4IFDI 1TWHH 1SDFA 4X66L 3MXUA 1GO3E 1XPUA 1X3EA 2J4XA 1G6ZA 2NZOA 2EE1A 1DOLA 4ABNA 3BDOA 4HCEA 1VQAA 2IHFA 2XIWA 1PZKD 2F4VL 2IHEA 4DAMA 1STGA 3URYA 3Q22A 1HQRD 2LXKA 3FVQA 5C44B 5LMNW 1IBML 3I4NG 2FJ2A 2XRQD 4LF6Q 3ICEA 3OTOL 2VUMB 2JA6G 2PYKA 3IFTA 1ASZA 4B9WA 4HMJA 1PRTB 4OHJA 3AQQA 4DXFA 5GAHC 1J9OA 3VYTA 1UE1A 3CMEA 5EKLA 3ZYYX 1II3A 4JG2A 4YWMA 1YNND 3D6WA 4N8X1 2ASBA 2JJQA 1PH9A 2ZXOA 3EBEA 5IWAQ 1W6JA 2V4DA 4JI5Q 3PIO3 4OEMB 3GTGB 2UXBL 1EIGA 1CA6A 5IT9E 3V96A 2JQOA 1JOOA 3TSSA 4ALPA 4KN4C 1S4ZA 4DR5Q 2H1EA 2SOBA 5ELCA 3J81i 1VQ6A 2KCMA 3M85A 3BS1A 3GTKB 4F8MA 4LF7L 4LF4L 4U68A 1QUQB 2EYJA 5C3WA 1RODA 3M7GA 4FF3A 2B2VA 1HH2P 1HNZQ 4A3DB 2F0LA 4DK3C 1MSGA 2B39A 3PUYA 3CCRA 3NXWA 2D5DA 2F3WA 4X64L 2E8GA 2GA4B 1PFNA 1YNJC 1IW7C 4Y7NH 4LF8L 4JI2L 1VQPA 1KRSA 2D2CC 4FNFA 2TSSA 2CWPA 4H02A 4RGMA 4B3SL 3TEHB 1EY8A 2NN6H 3J7AV 4DAVA 1RTOA 2UUBQ 1CKNB 4DFAA 1IHZA 3KF8B 3S1MH 3AEVA 3RLNA 1S40A 1H9JA 2E75C 2N3SA 2PNRC 5KNBA 4LF5L 2ZXPA 3PO2H 1JOKA 4WFN3 3NWTA 1PVOA 2B2UC 2GN5A 3NK9A 4CJ2C 3HOXB 5C5LA 1LUZA 1C48A 1B9NA 2IX1A 2QCPX 1WCMB 4C3IB 4QUCA 3M4OB 2R6GA 3I4MG 2DN8A 4R8IA 2YTYA 5L37A 1EFID 1VQGA 1P8LA 2HIXA 2B8GA 1I4QA 1F9PA 4GOPB 3T56B 1SEBD 3A54A 2KEDA 3C3LA 5DEHA 3GDEA 3G48A 2F0OA 4K2KA 3L7ZC 3TZUA 4LNQA 2VY3A 1B3AA 2O5JC 1N36L 3CC2A 2NBFA 3S1NH 5K5PA 1GHKA 2QF7A 3GTOB 1EZ8A 1PXUA 2HIVA 4OXPA 3L2PA 1B3QA 4A3FH 1AE2A 2F0VA 3QG1A 3W1GA 4XXEA 3AMUA 2QDBA 5LMUQ 4ZRZA 1S3OA 2MO0A 1B4OA 1PH3A 2VXWA 4HTHA 5EGTA 4HAEA 3HOUH 1CQFA 2PZTA 1HA5A 2MHVA 4JW0A 1PTOB 4JBKA 1QG7A 1EOVA 1QVFA 5CV6A 4PMBA 2EXZA 2ID0A 2AQ1B 3OHXC 5KIXA 3FKIB 2PW5A 1SNOA 2EY5A 2SDFA 2RHSB 4HSVA 3K6OA 1EY4A 4C3JH 1B50A 1RJTA 2A1AA 1SNMA 4A3GH 3LWEA 4LFAL 2WIIB 2KHJA 3SE0A 2JA6H 3HOYG 2N49A 4UP9A 3UDGA 2F0NA 2R92B 2HCIA 2ATWA 3DEPA 4KN7C 2K5VA 5JVH3 5IYDH 4PG3A 5M5XB 2Z0SA 2NVYB 3CCUA 3M3YH 2F0FA 4MNOA 1QZHA 1TIID 1IZ6A 1H9KA 1LTAD 1EWIA 3UDIA 1J8IA 1U4MA 4CGYB 2XWBB 3AB9A 4DR7L 5C4HA 4CKBA 1Q3LA 1LV9A 4RKBA 1Y1VH 3FMCA 4KY5A 3CD6A 1IYUA 1RF2D 5KNCA 4MN3A 4X3SA 1GXDC 1LTGD 2RCNA 1Z47A 1LACA 2EJMA 2F0SA 3JAME 1VQEA 1T5EA 2BCOA 3RZOH 2KENA 3CU7A 2B63G 4EQ5A 5CV8A 3NBHB 4CDCC 1QUQA 4P73A 3CCEA 1CA5A 2JK8A 3S9WA 1UEAB 1BCPB 4KD4A 3H0GB 3HP3A 4PV1C 3NUCA 3CC7A 2CH4W 4KKSA 3X3MA 4NP5A 3MAQA 2XRSD 4DR4L 1QVGA 4JI0L 3CQZB 3WOFA 2VS1A 2K5NA 1JWUD 4JI1L 1CHQD 1I4XA 4DV4Q 2ZTEA 4C56C 2FMMA 1YIJA 1E2WA 4CJ1B 1QNKA 5JJIA 3SK8A 4BY1G 4DV0L 5ELDA 3UI2A 3ZJYC 3S2DB 1QZGA 4A93G 4BA2I 3KF8A 3GQBA 3CCVA 1TWAB 1HNWL 4EQNA 5G3LF 4A3EB 1HRJA 4ZCKA 4LFBQ 5KEEA 2K14A 3QWNA 1ML0D 2JA9A 2Z6KA 3UE1A 4LFCQ 1XYIA 4LF6L 2E2IH 3R93A 1O7LA 3KBXA 4L5QA 1S5CD 5C0XJ 3PO3H 2B2YA 4GKJQ 3W1BA 2I5HA 3K0XA 4R4CA 1L0XB 2SEBD 1YBYA 1SJHD 1SYDA 2Q8TA 4HN7A 1I4HA 3K8AA 2CVRA 4GOPA 1RIPA 3U9SA 4J1MA 3I4MH 4R9WA 2BA0A 5ELEA 4P71A 1CT1D 4JBWA 4ZAIA 1A15A 1WTQA 4JYAQ 4BBRB 1I94Q 3DEOA 1X3QA 1BQQT 1WTHA 1QCBD 5EQ0A 3F2UA 1ESRA 3A8KE 2R93B 1B7YB 3OWEB 4Q5VA 1ZYRD 4R4IA 4DR5L 2K7VA 2F0DA 1JE4A 3TS0A 2JA8B 4EX5A 3HZXA 4HIKA 2KUMA 1JJCB 3IKJA 4RGNA 4G4KA 1ZKOA 1HNZL 1EQVA 3HOVB 4LWCA 3L0OA 2VQEL 2NTTA 4RA8A 1A3UA 1K28A 1PMRA 1EY5A 4RAUC 3CXCA 1ZXTA 1IL8A 1M8AA 2MQHA 4BA1I 1GUSA 4GKKQ 1TS4A 4G7ZC 2O5IC 1R4PB 1MD2D 1GM5A 5C4XG 5E7NA 1SYFA 2EYLA 5F2DA 2E2JH 3DWQA 2UUBL 3IL8A 4KV6A 5CR3A 4BBSG 2F0MA 2NVXB 1BDOA 1XWEA 1KRTA 1TKWB 1D1KA 1PDQA 1SYBA 1JICA 3L9AX 5J22A 5I4DA 5C0XG 5M5WH 3D4DA 5IT9L 1E3PA 1ILQA 3BDCA 1CFMA 3S1RH 1U4LA 4IOCA 4JI4L 1EWCA 4N8FA 1OTCA 4JOIC 1NMFA 3PIP3 1VQ9A 3I56A 2Z1CA 4APVA 1LTTD 4ODGA 2MUYA 3NBHA 4QGUA 1F9SA 3S17H 4F88A 1IKMA 3AU7A 3QB3A 4K8IA 3P75A 2B63H 1LTRD 2EYOA 1EYGA 5M5YH 2EJFC 2ZM6L 5KNDA 2PQAB 3HKZE 3EIVA 3PGZA 1RCVD 4O42A 2PI2E 4AH6A 4HCSA 4RCNA 1KDCA 1NSNS 4WJ4A 1KQSA 4G57A 1TY2A 1ZEQX 3QIAA 5IT9c 4L5SA 1A8VA 1KTKA 1DM0B 4X62Q 2D0OA 3D31A 2JA5B 2R7ZH 4A3BB 1CSPA 2XNAC 4RGTA 4G7OC 3KUPA 3CPWA 1PTOF 4KTAA 1SN8A 1YNJD 1LM0A 3S1MB 4DR6Q 1V1OA 1IBLQ 1IW7D 4A93H 2VB2X 1EY7A 2B2VC 5GROA 5DM63 2N55A 3NQTA 2K01A 1RD9D 1Z6HA 1UUPA 3S15H 4YY3Q 4AIMA 4FXDA 1J5EQ 4NMZA 2K05A 2UXCQ 1X32A 5DM73 4CDEC 1N34Q 4A3JB 1U4RA 2L4NA 2L15A 5J39A 4IO9A 1O80A 1MGSA 3I7FA 1MIUA 2A68C 4GLXA 4FXKC 1VQKA 2WAQB 2QILA 1A0IA 3W2DA 3I70A 4XQNA 2L1BA 4R4TA 3MXNB 3CF5A 3IFDA 3S1NB 4C1NI 2A74C 4PMCA 5CV5A 4C2MH 3FRPB 4JK1C 4I7ZC 1EQRA 1SNDA 2F0IA 5H1SE 4I7AA 3MA2B 4J8QA 1SMYD 4UHVA 1MSHA 1Y69U 1PA6A 4TSSA 3BDLA 1IBKL 1VF7A 3M9BA 5EKKA 1BUVT 2AWOA 4C3HH 3T1YQ 1ILPA 2A8VA 2DGYA 1QE6A 2JN4A 3PIPA 2B2TA 2E2DC 1JMCA 1N32Q 3VYUA 1L0YB 3HOWH 2X6LA 1VQFA 2Q8RE 2BH2A 2KCTA 4K14A 1H95A 3K5NA 1A62A 3N52A 4DV4L 1XNRL 2VQFQ 3ITPA 3I4NB 3GD7A 2JA6B 4B3RL 4DV5Q 2NVQB 1I3QH 3J81E 5JEAJ 2EVBA 3D6CA 3BVMA 1GHJA 4YCVA 1JOQA 4DV7Q 2EYHA 4L8JA 2IX3A 4JI6Q 1K83H 4LFBL 2QEJC 1K8OA 1SFOB 3CPFA 1VQ5A 4BBSH 1VDZA 4DV2L 3BJUA 1K0SA 1K8MA 2JSOA 1WTVA 3T13A 5C0XH 1HZCA 2VNUD 3RN2A 4JBMA 3FEWX 3JAML 3MHBA 1EYCA 1E0BA 1NAPA 2X6GA 2PO4A 2Y0SE 2XGTA 4RCOA 1AH9A 4DK0A 3PUZA 1YJNA 3I72A 1KNEA 4A3MG 4JYAL 1TR5A 2N8NA 5FO7B 3T4AC 1UWVA 2M2LA 1I6HH 2PQAA 2Y0SG 4DV1L 1X54A 3MFGA 1C0AA 4XT3B 3S2HH 3OPOA 4C3JG 4HJ8A 4A3GG 5I6YA 2EYPA 3EVQA 4LUOA 3DMUA 5FO9B 2A6HC 5C3EB 4MTKA 1ET9A 3QOJA 4QIWE 1UE7A 4MTNA 4J6HA 2CQAA 3JAMc 4RG1A 3G71A 5IYDG 2JA7B 4CDDC 3CCMA 1X3FA 1S5DD 2K6AA 1BOSA 2Q8IB 2C5CA 2OXPA 3S1QH 4IOAA 1TT2A 1SNQA 2Z8LA 4JCVE 2WKDA 4B3MQ 4JI7Q 4JI3Q 4ZKBB 2ZJPA 4CKCA 5LHY1 3J7ZC 2RCFA 4HIOA 3K7UC 4QB4A 1HA6A 4DKAC 1HPCA 1Y1VG 3A5ZB 1BBXC 4LUZA 3KDFB 2MNAA 5JEAG 3GTJH 1XNQQ 2RF4A 1XPRA 1G91A 2NVTB 5DLQE 1PYWD 1WTWA 2FMCA 5TSSA 2LKVA 4A3KG 3S14H 1EWHA 3GTLH 1NBWA 4P72A 3MXPA 2LSSA 3PUWA 4AYBG 4DV6Q 2LFNA 1I50H 2PZUA 3MXNA 3EA6A 1A2UA 1O7YA 4GNXB 4DAPA 1DGSA 1XMOQ 1Q82C 3DXJC 2ENBA 1OO9B 4OELB 5FJ8H 3UE0A 3SK4A 4EVOA 1CSQA 4J15A 1DONA 5GADC 5FOBB 4BS9A 1MJEA 2JYOA 2CQOA 5CYUA 2A19A 4DUZQ 1VMCA 1FL0A 2MPMA 2AQ2B 3VR5A 3F8TA 1KLGD 2TMPA 1TVXA 4P75A 1STEA 3NELA 1SMXA 2NYZD 1LT6D 4GOPC 2KJXA 2WP8J 1TY0A 1I4PA 3T16A 2F0TA 2P5ZX 3MFYA 5C4ZA 3U9OA 1TWGH 1TS5A 3RLOA 3TP8A 4A3CG 1GUTA 3VA7A 3PO3G 4EGVA 4H7BA 2A6EC 3J80L 1EYDA 4X62L 1HQMC 2RBMA 2UU9Q 4XYQA 3D4WA 3BYTB 3BZKA 3HOYB 1EEFD 3H94A 1VQ7A 2OTJA 5I2YA 3E5SA 1VS0A 4X6AH 4DR6L 4JC0A 1PTOC 3CCSA 1KL9A 3M4YA 5M3MB 4IUUA 3EFXD 3K7AH 3P1HA 2IWHA 1YHQA 2AWNA 3ND9A 2UUAQ 1GD7A 2HHHL 2BE5C 2PMZE 3HOZH 3KLWA 3H15A 3W3AA 2K5WA 4DA2A 4ZKCB 2CW0D 4YY3L 1JWSD 1J5EL 4A75A 1CI3M 5IE8A 3RR5A 3HKSA 1WI5A 2UXCL 4EQOA 1N9WA 2HDMA 1N34L 2F4IA 2K28A 3PSIA 5ELNA 2YU9B 4KI0A 4K6DA 1R9TH 3KK7A 4IUPA 1KD1C 2CKZB 3CAMA 2FFKB 1CM9A 2L12A 4NW2A 2HCCA 3M4QA 5E4XA 4HJ7A 1F9RA 3CHBD 4XQQA 1TWCB 2F0WA 4A3MH 1NTGA 1YHAA 3Q24A 5KGUA 4HJAA 1XXGA 1K8GA 3DWPA 3T1HQ 4OO1H 2ZTDA 3K59A 1HTLD 1TXYA 4IJLA 1BBUA 3PQIA 3SDZA 4B9XA 3H3VI 2Q2UA 1W3SA 3M7NA 4A3IH
chains in the Genus database with same CATH topology
4AYBE 3OW2A 1VCIA 3RZDH 4EX5A 2Q2HA 4DR1Q 2ZJQA 1U5KA 2NVXH 4HIKA 1P16A 4UPAA 4OX9Q 1JJCB 2LXJA 1FGUA 1V1QA 3SGIA 3J81j 2QA4A 1VQMA 1Q7YC 1PH1A 3GTQH 1PH2A 2GVAA 3NENA 4WJ3M 1HNZL 4LWCA 1VQBA 3L0OA 5BR8L 3RN5A 2VQEL 4BY7H 3E9HA 1X3GA 1N32L 1JJ2A 1YNXA 2KHIA 1HR0Q 3CCLA 4O2DA 4R1JA 1C7YA 4A3LG 1EUJA 1WCMG 1LTLA 2OCEA 3PF4A 3U4ZA 4OO1I 3CXCA 2JA5G 2MQHA 1O7IA 3KDFA 3STBC 4BA1I 4A3BG 4GKKQ 2Z6KC 1V43A 1YHBA 3PCOB 1M90C 1MKHA 2OTLA 3S16H 4QJFA 5JJKA 1VQDA 4NXML 2NN6G 2YTVA 4LFAQ 4OWTB 1L1OA 1GM5A 4XIGS 5E7NA 5C4XG 2E5LL 1KC8C 3J7A5 4BXXG 1HR0W 1PH7A 2BH8A 3CC4A 4IFDG 2E2JH 3I55A 4NXNQ 3PUVA 3G6EA 1B70B 5JJLA 2UUBL 3S2DH 3PUXA 4DV7L 5IYCG 4JI6L 4LUVA 4GN4B 3CCQA 1BKBA 1VQ4A 4BBSG 4DV3Q 4DR2L 5IP9G 1KRTA 2VQEQ 5C44G 1M1KC 4JI8L 4A3KH 5C3EG 2VUMG 3PO2G 3ERSX 1GKHA 1NJIC 1JE5A 1T9HA 4GNXA 4YCWA 5C0XG 1FJGL 5M5WH 4KHPQ 1K0RA 2CFMA 1HJPA 3M4PA 1E1TA 1E3PA 1XMQL 3ULLA 4IJHA 2WAQE 4YCUA 3UDFA 1PH5A 2IX0A 3A0JA 3S1RH 4IOCA 4JI4L 5IYBG 1OTCA 2OWOA 4B3TQ 4DR7Q 4MZ9A 4JOIC 3ER0A 3F2CA 4FDBA 1NMFA 1PH4A 2E2HH 2JA5H 5AJ3Q 2JA7G 4A3JG 4NXMQ 4A3BH 1PH6A 1QVCA 4GN5A 2R7ZG 1VQ9A 3I56A 4APVA 5C4XH 5FLXc 4QGUA 4BXXH 4LF9L 3S17H 3FKIG 3W5OA 2WAQG 1MJCA 1OXVA 1SLJA 1LYLA 1EIYB 2B63H 5IYCH 4JV5L 1YZ6A 4UP8A 4JI8Q 1EYGA 3U50C 1NE3A 4R4OA 5M5YH 3CW2C 2ZM6L 1D8LA 5C44H 1IBLL 2PQAB 5GAGC 4IPGA 4A3FG 3HKZE 2EQSA 2VUMH 3GTMH 3EIVA 2AHOB 2UXDL 1NY4A 3PGZA 4NPSA 1ASYA 4HJ5A 2PI2E 4AH6A 1X65A 4JI4Q 3TS2A 4DR4Q 1KQSA 4WJ4A 5IP7H 4DR3L 1WYDA 1VQHA 4JI0Q 3KFUA 3UDXA 4X65Q 1CUKA 1EQQA 1Q1EA 5IT9c 4L5SA 1A8VA 2HT1A 2JA8H 4POFA 4A3CH 4L5TA 4PZ8A 2D0OA 3D31A 4JI1Q 4X62Q 5C4JH 4A3JH 3HOUG 2R7ZH 1PH8A 3D0FA 2K75A 1HZBA 1CSPA 5LMNQ 4PMWA 4DUYL 3J80c 4A3DG 1X6OA 4IFDI 1NMGA 1TWHH 3CPWA 1XTDA 3CCJA 4X66L 1XPUA 1GO3E 4B3ML 1X3EA 1IYJB 2D62A 4JI7L 1SN8A 2NZOA 1LM0A 2ZM6Q 4DR6Q 1IBLQ 5IWAL 4A93H 3GTGH 5M3FG 1VQAA 2B29A 2IHFA 5GROA 2F4VL 2IHEA 4JI5L 4O0AA 4DAMA 4LW1A 4RMFA 3BU2A 2LXKA 5LMNW 1IBML 3I4NG 3ICEA 4LF6Q 2QGQA 3OTOL 1A63A 2JA6G 2UUCQ 3EN2A 3KJOA 2VW9A 1XNQL 3Q8DA 2V1CC 3I4OA 3S15H 1ASZA 4YY3Q 3LGJA 4AIMA 3GTKH 3AQQA 1YJ9A 3I2ZA 5GAHC 1Y1WG 1J5EQ 4QQBX 2JE6I 2UXCQ 1UE1A 2PNHA 4GLVB 3CMEA 1N33Q 2IT1A 3PIOA 1K3RA 1TWFH 4AQYL 1YI2A 4JG2A 1N34Q 4YWMA 3E9IA 2FXQA 2L15A 3J81c 4IO9A 2ASBA 3I7FA 1MIUA 4X66Q 3U58A 3T1YL 4A3DH 4GLXA 2JJQA 1VQKA 1PH9A 3EBEA 5IWAQ 2RHQB 1A0IA 4UP7A 1V9PA 1XMOL 1E24A 4R4TA 3MXNB 3HOWG 2N78A 3CF5A 4JI5Q 3HOXG 3S24A 2Q2IA 3TRZA 4PZ7A 1IBMQ 2UXBL 2OQ0A 1WFQA 4C2MH 3I4NH 1YITA 2JQOA 1EQRA 5HY6A 5H1SE 4ALPA 2CCZA 1FVIA 1PYBA 3GO5A 2NVQH 1L2FA 4DR5Q 2VQFL 3TQYA 4DUZL 2F52A 5J3BA 3J81i 1VQ6A 5IYDH 2YTXA 2KCMA 3CP0A 5M3MG 2AKWB 3M85A 4DV5L 3OYYA 4A3EG 3AFQA 3FP9A 1PA6A 1X56A 1CKMA 1IBKL 3M9BA 4LF7L 1W2BA 4LF4L 1YEZA 4YWLA 1QUQB 2AWOA 3E0EA 4NB3A 4C3HH 3T1YQ 1SFOH 1KIXA 2A8VA 3VDYA 2DGYA 1S72A 1HH2P 1HNXL 1PHJA 5FLMG 1HNZQ 1RL2A 5BR8Q 4DK3C 3PIPA 1JMCA 2DUDA 1N32Q 3PUYA 3CCRA 2WB1E 2Q2TA 1VQNA 2I0QA 5GAEC 4YWKA 3HOWH 4X64L 1VQFA 2E8GA 3HOXH 4A3LH 4QL5A 1U0LA 1Z9FA 2KCTA 4A76A 2BH2A 4XTCS 1WCMH 4C3IH 4Y7NH 3G4SA 4LF8L 3M4OH 2UU9L 4JI2L 1H95A 1A62A 1VQPA 4DV4L 1KRSA 1XNRL 2VQFQ 2VL6A 4K0KL 1GVPA 2HQLA 1G291 3GD7A 4BBRG 1E22A 2CWPA 3KF6B 2WB1G 4H02A 4DV5Q 4B3RL 4B3SL 3TEHB 2E5LQ 1I3QH 5JEAJ 1IBKQ 4LF7Q 1EFWA 2C35B 4GLAC 2UUBQ 4YCVA 1CKNB 4DV7Q 2R93G 4JI6Q 2JEAI 2F3IA 1K83H 4LFBL 3KF8B 3S1MH 3AEVA 4DR2Q 3A74A 3RLNA 1OXSC 3CPFA 1UE6A 3JC66 1VQ5A 1S40A 3GTOH 4BBSH 4DAYB 2D0PA 5IP9H 3BJUA 4DV2L 1PYSB 2N3SA 4LF5L 5C3EH 1FJGQ 3PO2H 1PVOA 1XMQQ 1HZCA 1BVSA 2GN5A 2K5HA 4QY7A 3RN2A 4JBMA 2VNUD 2R92G 4LF8Q 2I5LX 1K73C 1Q46A 1XNRQ 2YYZA 1LUZA 2IX1A 2Y0SE 5LMUL 2XGTA 5IYBH 2CWAA 2R6GA 3I4MG 1AH9A 4B3RQ 4YHHL 2JA7H 2YTYA 2I5MX 2NZHA 3PUZA 1YJNA 1CKNA 2B3GA 2NN6I 1VQGA 1P8LA 2HIXA 4GOPB 3B6YA 4LF9Q 4A3MG 4JYAL 2N8NA 3GDEA 3RNUA 3G48A 3FKIH 1UWVA 4JV5Q 1I6HH 3L7ZC 2PQAA 2Y0SG 1KXLA 4JI3L 3WWVA 1X54A 2VY3A 4DV1L 1N8RC 4DV2Q 4LNQA 1C0AA 1N36L 3T1HL 3CC2A 3S2HH 3MEFA 3S1NH 1UE5A 4HJ8A 4A3GG 1K9MC 2UXDQ 2HIVA 4LUOA 4OXPA 3L2PA 1E7ZA 5C0XI 4A3FH 1AE2A 3IRBA 3K81C 2NVTH 4DNIA 2ALYB 3W1GA 4DR3Q 2R92H 4P74A 4QIWE 5LMUQ 1UE7A 4DR1L 2ZTCA 3HFZB 4MTNA 1G6PA 4IPCA 3RLFA 1S3OA 2MO0A 3JAMc 4RG1A 5M5XH 3FHWA 3G71A 3H0GG 5IYDG 1PH3A 4OX9L 2NVYH 1EIFA 4BY7G 3HOUH 2JEBI 3CCMA 1X3FA 4R4QA 4DUYQ 1PV4A 4JBKA 1EOVA 1QVFA 3S1QH 1X9NA 4IOAA 4JCVE 4B3MQ 4DV6L 2ID0A 3CMAA 4DV1Q 4JI3Q 4JI7Q 2ZJPA 2MFIA 3J7ZC 2RHSB 3K7UC 5EAYA 4HIOA 2F4VQ 1BBWA 4PZ6A 4DKAC 5FJ8G 2XTIA 4C3JH 5M3FH 2A1AA 1Y1VG 3A5ZB 3KYHC 4LUZA 4A3GH 3OTOQ 3KDFB 1CKOA 2MNAA 5JEAG 3GTJH 4LFAL 1XNQQ 1OXUA 2RF4A 1XPRA 3JAMi 3ULPA 2KHJA 2JA6H 3HOYG 2N49A 1Q86C 4UP9A 3UDGA 1VQCA 5DLQE 1E1OA 1VQIA 1YJWA 1L1OB 4NXNL 1UEBA 2ATWA 3K80C 1KHIA 1KAWA 2OQKA 2AMCB 4AQYQ 2K5VA 1Y1WH 4A3KG 3H0GH 3S14H 4DV3L 1IXRA 4PG3A 3TREA 3DLLA 3PV0A 2Z0SA 1NBWA 4HIMA 2K52A 3GTLH 3CCUA 4P72A 3U4VA 2LSSA 3PUWA 4AYBG 4DV6Q 1Q12A 2EXDA 1JB7A 1I50H 3M3YH 4A4IA 4KHPL 4MNOA 1QZHA 1IZ6A 4GNXB 2GVBA 1EWIA 3CQZH 1OXTA 1DGSA 3UDIA 1XMOQ 1Q82C 1G51A 4L5RC 1AE3A 4B3TL 3F1ZA 1X55A 4DR7L 2K4KA 5AJ3L 5FJ8H 2UXBQ 3UE0A 2K50A 3AFPA 1Y1VH 2R7FA 4Y52H 1CSQA 4J15A 2QEXA 5GADC 1MJEA 3CD6A 4ME3A 4IPDA 4POGA 2CQOA 2A19A 2RCNA 4OWWB 1Z47A 4DUZQ 3HOYH 4DPGA 1VQEA 3ULJA 1FL0A 3RZOH 2KENA 3F8TA 2B63G 4EQ5A 5K36G 4P75A 1HZ9A 3NBHB 3NELA 1QUQA 4P73A 3CCEA 1K8AC 1TWAH 2JK8A 1WJJA 4KLKA 1SMXA 4A3EH 5M3MH 4LF4Q 4GOPC 5HGQA 2WP8J 2R7DA 2PI2A 2ZJRA 1OXXK 1HNXQ 5GQOA 3PF5A 4LFCL 3HOZG 3CC7A 1TWGH 1B8AA 5IP7G 2UUAL 1JJGA 5FLMH 5ELOA 3BZCA 4DR4L 3RLOA 2JA8G 1QVGA 4TQUS 4X64Q 1Q1BA 2WFWA 4X65L 4JI0L 3PO3G 3F2DA 4A3CG 1SR3A 1IL2A 2VS1A 1Q81C 2K5NA 4X62L 4GKJL 4JI1L 2YU9H 2UU9Q 4JI2Q 3KF6A 2ZTEA 4DV4Q 4UY8C 4K0KQ 5LMNL 1YIJA 5IY0A 3HOVG 5JJIA 4BY1G 3BZKA 4DV0L 4B3SQ 1XPOA 4BBRH 3ZJYC 1VQ7A 2OTJA 1TWCH 1VS0A 1QZGA 1VQ8A 4BA2I 4GS3A 4A93G 4X6AH 4DR6L 4JC0A 1HZAA 3CCSA 3CCVA 1KL9A 2ES2A 1L0WA 1I94L 4IFDJ 1HNWL 3STBD 4LFBQ 3K7AH 2K14A 4OONA 2JA9A 2R93H 2Z6KA 3UE1A 1YHQA 2AWNA 4DK6C 3A5UA 1XJVA 4LFCQ 4JBJA 1SROA 4OO1G 2UUAQ 1GD7A 2HHHL 2PMZE 2YV5A 4LF6L 2E2IH 3HOZH 3KLWA 1WOCA 2H5XA 3H15A 2UUCL 4LF5Q 1SRUA 3F2BA 1D7QA 1VQOA 3H3VH 4L5QA 4YY3L 3GTPH 1C9OA 5C0XJ 4TVAB 3PO3H 4A3IG 4GKJQ 1J5EL 3W1BA 3DM3A 2I5HA 3K0XA 4R4CA 5IE8A 4HIDA 1YBYA 3RR5A 3HKSA 4A75A 1WI5A 2EIFA 3HKZG 1N33L 2UXCL 2IY5B 1N9WA 1N34L 3PSIA 5ELNA 1JT8A 1VQJA 2KBNA 4GN3B 3K8AA 4KHZA 4KI0A 2VZAA 4YHHQ 1R9TH 4DV0Q 1L1OC 1RIPA 2BA1A 4GOPA 2CKZB 1KD1C 3HOVH 3AYHB 3CAMA 3I4MH 2BA0A 4P71A 4BY1H 4JBWA 4HJ9A 3M4QA 4HJ7A 4JYAQ 2MO1A 1HNWQ 1I94Q 1Y14B 1YVCA 4A3MH 3NEMA 1NTGA 1Q8KA 1YHAA 4JOIA 1HR0L 2HHHQ 4HJAA 1K8GA 1VQLA 1N36Q 3KOJA 3T1HQ 1B7YB 4GNXC 2ZTDA 1TXYA 4IJLA 1BBUA 3KJPA 1PFSA 1I5FA 4R4IA 3H3VI 4GKKL 4DR5L 1J6QA 2Q2UA 1W3SA 1SE8A 4IPHA 4OWXB 3J80i 3M7NA 3TS0A 4A3IH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AYB E;  3OW2 A;  1VCI A;  3RZD H;  4EX5 A;  2Q2H A;  4DR1 Q;  2ZJQ A;  1U5K A;  2NVX H;  4HIK A;  1P16 A;  4UPA A;  4OX9 Q;  1JJC B;  2LXJ A;  1FGU A;  1V1Q A;  3SGI A;  3J81 j;  2QA4 A;  1VQM A;  1Q7Y C;  1PH1 A;  3GTQ H;  1PH2 A;  2GVA A;  3NEN A;  4WJ3 M;  1HNZ L;  4LWC A;  1VQB A;  3L0O A;  5BR8 L;  3RN5 A;  2VQE L;  4BY7 H;  3E9H A;  1X3G A;  1N32 L;  1JJ2 A;  1YNX A;  2KHI A;  1HR0 Q;  3CCL A;  4O2D A;  4R1J A;  1C7Y A;  4A3L G;  1EUJ A;  1WCM G;  1LTL A;  2OCE A;  3PF4 A;  3U4Z A;  4OO1 I;  3CXC A;  2JA5 G;  2MQH A;  1O7I A;  3KDF A;  3STB C;  4BA1 I;  4A3B G;  4GKK Q;  2Z6K C;  1V43 A;  1YHB A;  3PCO B;  1M90 C;  1MKH A;  2OTL A;  3S16 H;  4QJF A;  5JJK A;  1VQD A;  4NXM L;  2NN6 G;  2YTV A;  4LFA Q;  4OWT B;  1L1O A;  1GM5 A;  4XIG S;  5E7N A;  5C4X G;  2E5L L;  1KC8 C;  3J7A 5;  4BXX G;  1HR0 W;  1PH7 A;  2BH8 A;  3CC4 A;  4IFD G;  2E2J H;  3I55 A;  4NXN Q;  3PUV A;  3G6E A;  1B70 B;  5JJL A;  2UUB L;  3S2D H;  3PUX A;  4DV7 L;  5IYC G;  4JI6 L;  4LUV A;  4GN4 B;  3CCQ A;  1BKB A;  1VQ4 A;  4BBS G;  4DV3 Q;  4DR2 L;  5IP9 G;  1KRT A;  2VQE Q;  5C44 G;  1M1K C;  4JI8 L;  4A3K H;  5C3E G;  2VUM G;  3PO2 G;  3ERS X;  1GKH A;  1NJI C;  1JE5 A;  1T9H A;  4GNX A;  4YCW A;  5C0X G;  1FJG L;  5M5W H;  4KHP Q;  1K0R A;  2CFM A;  1HJP A;  3M4P A;  1E1T A;  1E3P A;  1XMQ L;  3ULL A;  4IJH A;  2WAQ E;  4YCU A;  3UDF A;  1PH5 A;  2IX0 A;  3A0J A;  3S1R H;  4IOC A;  4JI4 L;  5IYB G;  1OTC A;  2OWO A;  4B3T Q;  4DR7 Q;  4MZ9 A;  4JOI C;  3ER0 A;  3F2C A;  4FDB A;  1NMF A;  1PH4 A;  2E2H H;  2JA5 H;  5AJ3 Q;  2JA7 G;  4A3J G;  4NXM Q;  4A3B H;  1PH6 A;  1QVC A;  4GN5 A;  2R7Z G;  1VQ9 A;  3I56 A;  4APV A;  5C4X H;  5FLX c;  4QGU A;  4BXX H;  4LF9 L;  3S17 H;  3FKI G;  3W5O A;  2WAQ G;  1MJC A;  1OXV A;  1SLJ A;  1LYL A;  1EIY B;  2B63 H;  5IYC H;  4JV5 L;  1YZ6 A;  4UP8 A;  4JI8 Q;  1EYG A;  3U50 C;  1NE3 A;  4R4O A;  5M5Y H;  3CW2 C;  2ZM6 L;  1D8L A;  5C44 H;  1IBL L;  2PQA B;  5GAG C;  4IPG A;  4A3F G;  3HKZ E;  2EQS A;  2VUM H;  3GTM H;  3EIV A;  2AHO B;  2UXD L;  1NY4 A;  3PGZ A;  4NPS A;  1ASY A;  4HJ5 A;  2PI2 E;  4AH6 A;  1X65 A;  4JI4 Q;  3TS2 A;  4DR4 Q;  1KQS A;  4WJ4 A;  5IP7 H;  4DR3 L;  1WYD A;  1VQH A;  4JI0 Q;  3KFU A;  3UDX A;  4X65 Q;  1CUK A;  1EQQ A;  1Q1E A;  5IT9 c;  4L5S A;  1A8V A;  2HT1 A;  2JA8 H;  4POF A;  4A3C H;  4L5T A;  4PZ8 A;  2D0O A;  3D31 A;  4JI1 Q;  4X62 Q;  5C4J H;  4A3J H;  3HOU G;  2R7Z H;  1PH8 A;  3D0F A;  2K75 A;  1HZB A;  1CSP A;  5LMN Q;  4PMW A;  4DUY L;  3J80 c;  4A3D G;  1X6O A;  4IFD I;  1NMG A;  1TWH H;  3CPW A;  1XTD A;  3CCJ A;  4X66 L;  1XPU A;  1GO3 E;  4B3M L;  1X3E A;  1IYJ B;  2D62 A;  4JI7 L;  1SN8 A;  2NZO A;  1LM0 A;  2ZM6 Q;  4DR6 Q;  1IBL Q;  5IWA L;  4A93 H;  3GTG H;  5M3F G;  1VQA A;  2B29 A;  2IHF A;  5GRO A;  2F4V L;  2IHE A;  4JI5 L;  4O0A A;  4DAM A;  4LW1 A;  4RMF A;  3BU2 A;  2LXK A;  5LMN W;  1IBM L;  3I4N G;  3ICE A;  4LF6 Q;  2QGQ A;  3OTO L;  1A63 A;  2JA6 G;  2UUC Q;  3EN2 A;  3KJO A;  2VW9 A;  1XNQ L;  3Q8D A;  2V1C C;  3I4O A;  3S15 H;  1ASZ A;  4YY3 Q;  3LGJ A;  4AIM A;  3GTK H;  3AQQ A;  1YJ9 A;  3I2Z A;  5GAH C;  1Y1W G;  1J5E Q;  4QQB X;  2JE6 I;  2UXC Q;  1UE1 A;  2PNH A;  4GLV B;  3CME A;  1N33 Q;  2IT1 A;  3PIO A;  1K3R A;  1TWF H;  4AQY L;  1YI2 A;  4JG2 A;  1N34 Q;  4YWM A;  3E9I A;  2FXQ A;  2L15 A;  3J81 c;  4IO9 A;  2ASB A;  3I7F A;  1MIU A;  4X66 Q;  3U58 A;  3T1Y L;  4A3D H;  4GLX A;  2JJQ A;  1VQK A;  1PH9 A;  3EBE A;  5IWA Q;  2RHQ B;  1A0I A;  4UP7 A;  1V9P A;  1XMO L;  1E24 A;  4R4T A;  3MXN B;  3HOW G;  2N78 A;  3CF5 A;  4JI5 Q;  3HOX G;  3S24 A;  2Q2I A;  3TRZ A;  4PZ7 A;  1IBM Q;  2UXB L;  2OQ0 A;  1WFQ A;  4C2M H;  3I4N H;  1YIT A;  2JQO A;  1EQR A;  5HY6 A;  5H1S E;  4ALP A;  2CCZ A;  1FVI A;  1PYB A;  3GO5 A;  2NVQ H;  1L2F A;  4DR5 Q;  2VQF L;  3TQY A;  4DUZ L;  2F52 A;  5J3B A;  3J81 i;  1VQ6 A;  5IYD H;  2YTX A;  2KCM A;  3CP0 A;  5M3M G;  2AKW B;  3M85 A;  4DV5 L;  3OYY A;  4A3E G;  3AFQ A;  3FP9 A;  1PA6 A;  1X56 A;  1CKM A;  1IBK L;  3M9B A;  4LF7 L;  1W2B A;  4LF4 L;  1YEZ A;  4YWL A;  1QUQ B;  2AWO A;  3E0E A;  4NB3 A;  4C3H H;  3T1Y Q;  1SFO H;  1KIX A;  2A8V A;  3VDY A;  2DGY A;  1S72 A;  1HH2 P;  1HNX L;  1PHJ A;  5FLM G;  1HNZ Q;  1RL2 A;  5BR8 Q;  4DK3 C;  3PIP A;  1JMC A;  2DUD A;  1N32 Q;  3PUY A;  3CCR A;  2WB1 E;  2Q2T A;  1VQN A;  2I0Q A;  5GAE C;  4YWK A;  3HOW H;  4X64 L;  1VQF A;  2E8G A;  3HOX H;  4A3L H;  4QL5 A;  1U0L A;  1Z9F A;  2KCT A;  4A76 A;  2BH2 A;  4XTC S;  1WCM H;  4C3I H;  4Y7N H;  3G4S A;  4LF8 L;  3M4O H;  2UU9 L;  4JI2 L;  1H95 A;  1A62 A;  1VQP A;  4DV4 L;  1KRS A;  1XNR L;  2VQF Q;  2VL6 A;  4K0K L;  1GVP A;  2HQL A;  1G29 1;  3GD7 A;  4BBR G;  1E22 A;  2CWP A;  3KF6 B;  2WB1 G;  4H02 A;  4DV5 Q;  4B3R L;  4B3S L;  3TEH B;  2E5L Q;  1I3Q H;  5JEA J;  1IBK Q;  4LF7 Q;  1EFW A;  2C35 B;  4GLA C;  2UUB Q;  4YCV A;  1CKN B;  4DV7 Q;  2R93 G;  4JI6 Q;  2JEA I;  2F3I A;  1K83 H;  4LFB L;  3KF8 B;  3S1M H;  3AEV A;  4DR2 Q;  3A74 A;  3RLN A;  1OXS C;  3CPF A;  1UE6 A;  3JC6 6;  1VQ5 A;  1S40 A;  3GTO H;  4BBS H;  4DAY B;  2D0P A;  5IP9 H;  3BJU A;  4DV2 L;  1PYS B;  2N3S A;  4LF5 L;  5C3E H;  1FJG Q;  3PO2 H;  1PVO A;  1XMQ Q;  1HZC A;  1BVS A;  2GN5 A;  2K5H A;  4QY7 A;  3RN2 A;  4JBM A;  2VNU D;  2R92 G;  4LF8 Q;  2I5L X;  1K73 C;  1Q46 A;  1XNR Q;  2YYZ A;  1LUZ A;  2IX1 A;  2Y0S E;  5LMU L;  2XGT A;  5IYB H;  2CWA A;  2R6G A;  3I4M G;  1AH9 A;  4B3R Q;  4YHH L;  2JA7 H;  2YTY A;  2I5M X;  2NZH A;  3PUZ A;  1YJN A;  1CKN A;  2B3G A;  2NN6 I;  1VQG A;  1P8L A;  2HIX A;  4GOP B;  3B6Y A;  4LF9 Q;  4A3M G;  4JYA L;  2N8N A;  3GDE A;  3RNU A;  3G48 A;  3FKI H;  1UWV A;  4JV5 Q;  1I6H H;  3L7Z C;  2PQA A;  2Y0S G;  1KXL A;  4JI3 L;  3WWV A;  1X54 A;  2VY3 A;  4DV1 L;  1N8R C;  4DV2 Q;  4LNQ A;  1C0A A;  1N36 L;  3T1H L;  3CC2 A;  3S2H H;  3MEF A;  3S1N H;  1UE5 A;  4HJ8 A;  4A3G G;  1K9M C;  2UXD Q;  2HIV A;  4LUO A;  4OXP A;  3L2P A;  1E7Z A;  5C0X I;  4A3F H;  1AE2 A;  3IRB A;  3K81 C;  2NVT H;  4DNI A;  2ALY B;  3W1G A;  4DR3 Q;  2R92 H;  4P74 A;  4QIW E;  5LMU Q;  1UE7 A;  4DR1 L;  2ZTC A;  3HFZ B;  4MTN A;  1G6P A;  4IPC A;  3RLF A;  1S3O A;  2MO0 A;  3JAM c;  4RG1 A;  5M5X H;  3FHW A;  3G71 A;  3H0G G;  5IYD G;  1PH3 A;  4OX9 L;  2NVY H;  1EIF A;  4BY7 G;  3HOU H;  2JEB I;  3CCM A;  1X3F A;  4R4Q A;  4DUY Q;  1PV4 A;  4JBK A;  1EOV A;  1QVF A;  3S1Q H;  1X9N A;  4IOA A;  4JCV E;  4B3M Q;  4DV6 L;  2ID0 A;  3CMA A;  4DV1 Q;  4JI3 Q;  4JI7 Q;  2ZJP A;  2MFI A;  3J7Z C;  2RHS B;  3K7U C;  5EAY A;  4HIO A;  2F4V Q;  1BBW A;  4PZ6 A;  4DKA C;  5FJ8 G;  2XTI A;  4C3J H;  5M3F H;  2A1A A;  1Y1V G;  3A5Z B;  3KYH C;  4LUZ A;  4A3G H;  3OTO Q;  3KDF B;  1CKO A;  2MNA A;  5JEA G;  3GTJ H;  4LFA L;  1XNQ Q;  1OXU A;  2RF4 A;  1XPR A;  3JAM i;  3ULP A;  2KHJ A;  2JA6 H;  3HOY G;  2N49 A;  1Q86 C;  4UP9 A;  3UDG A;  1VQC A;  5DLQ E;  1E1O A;  1VQI A;  1YJW A;  1L1O B;  4NXN L;  1UEB A;  2ATW A;  3K80 C;  1KHI A;  1KAW A;  2OQK A;  2AMC B;  4AQY Q;  2K5V A;  1Y1W H;  4A3K G;  3H0G H;  3S14 H;  4DV3 L;  1IXR A;  4PG3 A;  3TRE A;  3DLL A;  3PV0 A;  2Z0S A;  1NBW A;  4HIM A;  2K52 A;  3GTL H;  3CCU A;  4P72 A;  3U4V A;  2LSS A;  3PUW A;  4AYB G;  4DV6 Q;  1Q12 A;  2EXD A;  1JB7 A;  1I50 H;  3M3Y H;  4A4I A;  4KHP L;  4MNO A;  1QZH A;  1IZ6 A;  4GNX B;  2GVB A;  1EWI A;  3CQZ H;  1OXT A;  1DGS A;  3UDI A;  1XMO Q;  1Q82 C;  1G51 A;  4L5R C;  1AE3 A;  4B3T L;  3F1Z A;  1X55 A;  4DR7 L;  2K4K A;  5AJ3 L;  5FJ8 H;  2UXB Q;  3UE0 A;  2K50 A;  3AFP A;  1Y1V H;  2R7F A;  4Y52 H;  1CSQ A;  4J15 A;  2QEX A;  5GAD C;  1MJE A;  3CD6 A;  4ME3 A;  4IPD A;  4POG A;  2CQO A;  2A19 A;  2RCN A;  4OWW B;  1Z47 A;  4DUZ Q;  3HOY H;  4DPG A;  1VQE A;  3ULJ A;  1FL0 A;  3RZO H;  2KEN A;  3F8T A;  2B63 G;  4EQ5 A;  5K36 G;  4P75 A;  1HZ9 A;  3NBH B;  3NEL A;  1QUQ A;  4P73 A;  3CCE A;  1K8A C;  1TWA H;  2JK8 A;  1WJJ A;  4KLK A;  1SMX A;  4A3E H;  5M3M H;  4LF4 Q;  4GOP C;  5HGQ A;  2WP8 J;  2R7D A;  2PI2 A;  2ZJR A;  1OXX K;  1HNX Q;  5GQO A;  3PF5 A;  4LFC L;  3HOZ G;  3CC7 A;  1TWG H;  1B8A A;  5IP7 G;  2UUA L;  1JJG A;  5FLM H;  5ELO A;  3BZC A;  4DR4 L;  3RLO A;  2JA8 G;  1QVG A;  4TQU S;  4X64 Q;  1Q1B A;  2WFW A;  4X65 L;  4JI0 L;  3PO3 G;  3F2D A;  4A3C G;  1SR3 A;  1IL2 A;  2VS1 A;  1Q81 C;  2K5N A;  4X62 L;  4GKJ L;  4JI1 L;  2YU9 H;  2UU9 Q;  4JI2 Q;  3KF6 A;  2ZTE A;  4DV4 Q;  4UY8 C;  4K0K Q;  5LMN L;  1YIJ A;  5IY0 A;  3HOV G;  5JJI A;  4BY1 G;  3BZK A;  4DV0 L;  4B3S Q;  1XPO A;  4BBR H;  3ZJY C;  1VQ7 A;  2OTJ A;  1TWC H;  1VS0 A;  1QZG A;  1VQ8 A;  4BA2 I;  4GS3 A;  4A93 G;  4X6A H;  4DR6 L;  4JC0 A;  1HZA A;  3CCS A;  3CCV A;  1KL9 A;  2ES2 A;  1L0W A;  1I94 L;  4IFD J;  1HNW L;  3STB D;  4LFB Q;  3K7A H;  2K14 A;  4OON A;  2JA9 A;  2R93 H;  2Z6K A;  3UE1 A;  1YHQ A;  2AWN A;  4DK6 C;  3A5U A;  1XJV A;  4LFC Q;  4JBJ A;  1SRO A;  4OO1 G;  2UUA Q;  1GD7 A;  2HHH L;  2PMZ E;  2YV5 A;  4LF6 L;  2E2I H;  3HOZ H;  3KLW A;  1WOC A;  2H5X A;  3H15 A;  2UUC L;  4LF5 Q;  1SRU A;  3F2B A;  1D7Q A;  1VQO A;  3H3V H;  4L5Q A;  4YY3 L;  3GTP H;  1C9O A;  5C0X J;  4TVA B;  3PO3 H;  4A3I G;  4GKJ Q;  1J5E L;  3W1B A;  3DM3 A;  2I5H A;  3K0X A;  4R4C A;  5IE8 A;  4HID A;  1YBY A;  3RR5 A;  3HKS A;  4A75 A;  1WI5 A;  2EIF A;  3HKZ G;  1N33 L;  2UXC L;  2IY5 B;  1N9W A;  1N34 L;  3PSI A;  5ELN A;  1JT8 A;  1VQJ A;  2KBN A;  4GN3 B;  3K8A A;  4KHZ A;  4KI0 A;  2VZA A;  4YHH Q;  1R9T H;  4DV0 Q;  1L1O C;  1RIP A;  2BA1 A;  4GOP A;  2CKZ B;  1KD1 C;  3HOV H;  3AYH B;  3CAM A;  3I4M H;  2BA0 A;  4P71 A;  4BY1 H;  4JBW A;  4HJ9 A;  3M4Q A;  4HJ7 A;  4JYA Q;  2MO1 A;  1HNW Q;  1I94 Q;  1Y14 B;  1YVC A;  4A3M H;  3NEM A;  1NTG A;  1Q8K A;  1YHA A;  4JOI A;  1HR0 L;  2HHH Q;  4HJA A;  1K8G A;  1VQL A;  1N36 Q;  3KOJ A;  3T1H Q;  1B7Y B;  4GNX C;  2ZTD A;  1TXY A;  4IJL A;  1BBU A;  3KJP A;  1PFS A;  1I5F A;  4R4I A;  3H3V I;  4GKK L;  4DR5 L;  1J6Q A;  2Q2U A;  1W3S A;  1SE8 A;  4IPH A;  4OWX B;  3J80 i;  3M7N A;  3TS0 A;  4A3I H; 
#chains in the Genus database with same CATH topology
 3GTP B;  1DD2 A;  1EL0 A;  4DR1 Q;  4B08 A;  1P16 A;  4OX9 Q;  1FGU A;  4K5X A;  3J81 j;  1VQM A;  1Q7Y C;  1PH1 A;  3GTQ H;  2GVA A;  3NEN A;  2MGS A;  4FF4 A;  1BCP C;  1EIH A;  1HUN A;  3CRK C;  3E9H A;  1HXY D;  4BY1 B;  1N32 L;  1E2Z A;  2KHI A;  4KK7 A;  1HR0 Q;  4A3L G;  1G8Z D;  4R1J A;  1C7Y A;  1ESF A;  1WCM G;  2OCE A;  3U4Z A;  2WKC A;  3VR3 A;  2I46 A;  3STB C;  3KDF A;  5COY A;  3PCO B;  1YHB A;  3I73 A;  5JJK A;  5FLX L;  1VQD A;  4NXM L;  1W6K A;  5IGE A;  4XIG S;  3J7A 5;  3GV3 A;  5JEA H;  1PH7 A;  3A7L A;  3MXG A;  3K5O A;  3RZD B;  1B70 B;  5IIF A;  5JJL A;  5J1Z A;  4DV7 L;  1QIL A;  4JI6 L;  4FF1 A;  1VQ4 A;  1BKB A;  1STY A;  5HGT A;  4DV3 Q;  5IP9 G;  4NDX A;  1M1K C;  4JI8 L;  4A3K H;  1ENC A;  1I6V C;  2K04 A;  1NJI C;  4GNX A;  4YCW A;  4KHP Q;  1K0R A;  2CFM A;  3M4P A;  1FD7 D;  3VR4 A;  1HHV A;  5E3F A;  2DNC A;  4YCU A;  1PH5 A;  2IX0 A;  4B3T Q;  4MZ9 A;  2E2H H;  3F2C A;  1FNW A;  2N88 A;  5AJ3 Q;  1K3B C;  4GN5 A;  2R7Z G;  1G2T A;  1NUC A;  3S16 B;  3NSW A;  5FLX c;  3ONA B;  4BXX H;  5I9P A;  3FKI G;  1LYL A;  1YZ6 A;  2FHT A;  4DK1 A;  1D8L A;  5C44 H;  3X3N A;  1S5F D;  5GAG C;  4V19 0;  4L63 B;  2VUM H;  2EQS A;  3NP8 A;  1ASY A;  4NPS A;  4HJ5 A;  1X65 A;  2ICE C;  1KAB A;  3BYY B;  2EPB A;  4M8A A;  2F03 A;  3J81 L;  4A3C H;  1PH8 A;  1FYC A;  1PRT F;  1JOR A;  4H44 C;  5LMN Q;  3Q0A A;  1X6O A;  1NMG A;  1O7Z A;  1WVL A;  5C4X B;  4X3T A;  4B3M L;  1IYJ B;  1SYC A;  4JI7 L;  4IZ8 A;  1LTS D;  5IWA L;  3GTG H;  1EY9 A;  5M3F G;  2A69 D;  2B29 A;  1ET6 A;  4OL7 A;  4JI5 L;  4O0A A;  4TKO B;  3BU2 A;  2B2T C;  2F0H A;  1Y8P B;  1STH A;  2QGQ A;  3GTM B;  1A63 A;  2UUC Q;  2B2W C;  3KJO A;  1XNQ L;  3Q8D A;  2V1C C;  2RDG A;  3I4O A;  2PPB C;  1EEI D;  3LGJ A;  1DCZ A;  3GTK H;  1RKN A;  1Y1W G;  4QQB X;  5E1F A;  2RVL A;  5LL6 S;  2PNH A;  1N33 Q;  2IT1 A;  1TWF H;  1YI2 A;  1RTN A;  2JXM B;  4C3H G;  3J81 c;  1Q8I A;  4X66 Q;  4A3D H;  1TWH B;  2DNE A;  1A3V A;  1ICF B;  1I6H B;  2RHQ B;  1V9P A;  1XMO L;  3HOW G;  4OIJ A;  4FXG C;  2N78 A;  1LT3 D;  2QKI C;  3S2H B;  1IBM Q;  5T1G A;  2OQ0 A;  4CHT B;  4QCL A;  2R3Z A;  1S5E D;  2KQ3 A;  1L2F A;  4YIJ A;  1GUO A;  4DUZ L;  1Q90 A;  2QDL A;  2F52 A;  5J3B A;  2YTX A;  4A3E G;  2AKW B;  3OYY A;  3AFQ A;  3FP9 A;  3J80 E;  1X56 A;  4V0B A;  3G6J B;  1YEZ A;  4YWL A;  1CQV A;  5I6W A;  3HKZ B;  1O78 A;  1TS3 A;  1PHJ A;  1RL2 A;  2A6H D;  3QR8 A;  1B9M A;  3P7J A;  1VQN A;  2WB1 E;  5BN4 A;  2DY7 A;  2WIN B;  4K8J A;  4RH6 A;  2I0Q A;  4OGQ C;  3HOX H;  4A3L H;  1U0L A;  1WCM H;  4C3I H;  3M4O H;  2UU9 L;  2M00 A;  3NTH A;  3KLS A;  1G29 1;  3LX0 A;  2O4X A;  4EQP A;  4BBR G;  2WB1 G;  1SJE D;  3NPP A;  2F3V A;  5D65 A;  2E5L Q;  3MWY W;  2MP1 A;  4LF7 Q;  1V8Q A;  1JR0 D;  2C35 B;  4IUT A;  4GLA C;  5JAV A;  2A73 B;  2R93 G;  3GTL B;  1JB3 A;  5CGK A;  4DR2 Q;  3A74 A;  3A7A B;  3JC6 6;  4OIK A;  3GTO H;  1I50 B;  3VA5 A;  5IP9 H;  1LTB D;  2LS0 1;  1M4V A;  5T1I A;  1BVS A;  1LT4 D;  2K5H A;  4QY7 A;  1KNA A;  4HSP A;  4LF8 Q;  2I5L X;  2KA7 A;  3DUZ A;  1K73 C;  1WTX A;  4RFB A;  4L6T B;  3P20 A;  4Y7N B;  5LMU L;  4K5W A;  1F2Y A;  2I5M X;  2NZH A;  1H9M A;  1PTO H;  1F2L A;  2NN6 I;  3TBI B;  1JC7 A;  1D2B A;  1V1P B;  5IGG A;  2AUK A;  5CMD A;  4HR7 B;  3FKI H;  4FF2 A;  3L3O C;  1KXL A;  2VB3 X;  1ENF A;  3T1H L;  1H9R A;  5CV7 A;  3V2T A;  1K9M C;  1KDB A;  1E7Z A;  3IRB A;  3K81 C;  4ID6 A;  2KVM A;  3PO2 B;  4DNI A;  4DR3 Q;  2R92 H;  4P74 A;  3NQI A;  1QJO A;  2ZTC A;  4DR1 L;  1B53 A;  1G6P A;  3RLF A;  4QUF A;  1TS2 A;  5M5X H;  1T5X D;  4OX9 L;  2NVY H;  1WTO A;  5FLX E;  1EIF A;  4BY7 G;  2JEB I;  4DUY Q;  3KLS X;  1PV4 A;  5A35 A;  3QJY A;  1I4R A;  4N9P A;  4ZLT F;  2D9U A;  3CMA A;  4WJW A;  1U4P A;  2MFI A;  2A6E D;  3OIP A;  2XSC A;  5FJ8 G;  2XTI A;  4WRD A;  5M3F H;  2BOS A;  1BR9 A;  3I8Z A;  3K57 A;  3ULP A;  4A3F B;  1CHP D;  1QOH A;  2NUC A;  1E1O A;  1YJW A;  1L1O B;  5CV9 A;  1UEB A;  1BNZ A;  5LL6 X;  2RDF A;  1KHI A;  2OQK A;  1R9T B;  2AMC B;  4S3S A;  4AQY Q;  1Y1W H;  3H0G H;  4DV3 L;  1IXR A;  3DLL A;  2F1M A;  2BE5 D;  3R8B A;  2HUG A;  1STN A;  3HOU B;  1VF5 C;  1BCP F;  1AN8 A;  1JB7 A;  2EXD A;  1BXT A;  4XT1 B;  4KHP L;  3CQZ H;  3K5M A;  4L5R C;  4KY7 A;  2RQX A;  3GP7 A;  3NTI A;  1AE3 A;  4B3T L;  4FP5 D;  1X55 A;  2Y0S B;  4WOR A;  5KRU A;  1XX8 A;  5AJ3 L;  3AFP A;  4C3J B;  2OT2 A;  2QEX A;  2EZV A;  4A3G B;  4POG A;  3ERO A;  3A55 A;  4DN4 M;  3ULJ A;  1DOM A;  2L55 A;  3GV6 A;  1K8A C;  3HGB A;  1EY6 A;  1TWA H;  2PZW A;  1WJJ A;  4KLK A;  4A3E H;  3SR1 A;  3TME A;  1PLF A;  5HGQ A;  1F2Z A;  2R7D A;  2PI2 A;  2ZJR A;  1OXX K;  1UAP A;  2K1B A;  1HNX Q;  5C5M A;  5GQO A;  3I90 A;  4LFC L;  3HOZ G;  5EPK A;  1B8A A;  4K2L A;  3M3Y B;  1JJG A;  3OWF A;  2F0P A;  3BZC A;  4QIW B;  3IAY A;  4TQU S;  2Z4H A;  3F2D A;  1SR3 A;  4XDX A;  1IL2 A;  1Q81 C;  4GKJ L;  1DZ1 A;  5IGF A;  4ZYS A;  5IOD A;  1Y1V B;  4K0K Q;  4LJZ C;  3FDT A;  5LMN L;  3VR2 A;  2CH4 A;  5IY0 A;  1PRT C;  4BBR H;  1A3T A;  3QO2 A;  5I2X A;  1LTI D;  3RZO B;  1MI2 A;  1VQ8 A;  4GS3 A;  2KEC A;  4IFD J;  2ES2 A;  1I94 L;  3STB D;  4KJN A;  4A3K B;  4OON A;  2R93 H;  2OEO A;  1XJV A;  4JBJ A;  4OO1 G;  2YV5 A;  2AQ3 B;  2UUC L;  2KHS A;  3TN2 A;  1CZG A;  3F2B A;  3SHL A;  4PQX A;  1VQO A;  1D7Q A;  5IGD A;  1C9O A;  4DGZ A;  4A3I G;  1B2T A;  3DM3 A;  5JPM C;  4HID A;  2EIF A;  1N33 L;  4MIU A;  1VQJ A;  4GN3 B;  4KHZ A;  1FNU A;  3T51 B;  2VZA A;  4YHH Q;  4DV0 Q;  2BA1 A;  1V1P A;  3HOV H;  4XYO A;  4ULL A;  1RHP A;  4HJ9 A;  1HNW Q;  2MO1 A;  5HUR A;  2XVS A;  4IUN A;  1FNV A;  3NEM A;  1Q8K A;  1SYG A;  4JOI A;  1H9S B;  1TQO A;  2EY2 A;  4H13 C;  4PNY A;  4JPB W;  1VQL A;  1SBB B;  1DOK A;  2NZ1 D;  4GNX C;  2ZXR A;  4IN3 A;  3RMH A;  2Z6B A;  1I5F A;  2E2I B;  4GKK L;  1SE4 A;  1GJX A;  1SE8 A;  4IPH A;  4RGO S;  4U67 3;  5FO8 B;  4AYB E;  2H4O A;  1B44 D;  1CZW A;  3RUZ A;  3PO3 B;  2Q2H A;  1AP0 A;  2J0T D;  4RKL A;  4KHV A;  2NVX H;  1CK1 A;  4UPA A;  5DNF A;  5KYI A;  2QA4 A;  1PH2 A;  1U9R A;  2R61 A;  3I4M B;  4BY7 H;  4FYD A;  1X3G A;  3WOE A;  1E2V A;  1JJ2 A;  1YNX A;  3CCL A;  4C1N K;  1MBY A;  3VYR A;  4IUV A;  3C46 A;  3NWS A;  5KYL A;  3KLR A;  2Z6K C;  3DWA A;  2KCN A;  1MKH A;  1HFN A;  4QJF A;  1EY0 A;  4ZUI A;  3WDN A;  1LT5 D;  2YTV A;  1L1O A;  2IL8 A;  4IUR A;  3Q23 A;  2E5L L;  1KC8 C;  4BXX G;  2X69 A;  2BH8 A;  3CC4 A;  3K5L A;  4IFD G;  1DJR D;  3I55 A;  4NXN Q;  2B2Y C;  1TWF B;  4BWG B;  3QOL A;  1ICW A;  5FKA C;  4LUV A;  4GN4 B;  2EY6 A;  3CCQ A;  2L11 A;  4DR2 L;  1GUN A;  2PMZ B;  2VQE Q;  5C44 G;  3OIQ A;  1ENA A;  5C3E G;  2VUM G;  3ERS X;  1GKH A;  3CKI B;  1JE5 A;  1T9H A;  5EBD A;  5IGB A;  1HJP A;  3C2P A;  1SNP A;  1E1T A;  2DJG C;  3ULL A;  4IJH A;  3UDF A;  2PQE A;  3A0J A;  4ZK9 B;  5IYB G;  1HTP A;  2OWO A;  2JA5 H;  1PH4 A;  2JA7 G;  4A3B H;  4ZUJ A;  5DAU A;  1QVC A;  4O1N A;  3K58 A;  1SYE A;  3D3R A;  3HRZ C;  3HS0 C;  5D14 A;  1SNC A;  3BZD B;  1MJC A;  2E2J B;  2IW3 A;  1SLJ A;  5EBC A;  4XQJ A;  1AZP A;  5IYC H;  2L9H A;  4IUQ A;  1NE3 A;  3CW2 C;  2F0E A;  2NTS A;  1IBL L;  4IPG A;  1WTP A;  3A56 A;  5M5W B;  4JI4 Q;  3TS2 A;  4DR3 L;  1WYD A;  1VQH A;  2XWJ B;  1AW7 A;  1C4Q A;  3UDX A;  4X65 Q;  1EQQ A;  1Q1E A;  3N6R A;  5FK9 C;  1SAP A;  2HT1 A;  3S1R B;  1BF4 A;  4POF A;  4L5T A;  4PZ8 A;  5C4J H;  4A3J H;  3E3X A;  3SK5 A;  5ISR A;  3H3V C;  2EYM A;  1HZB A;  1KAA A;  4ME5 A;  1JQY D;  1QWY A;  3PMF A;  1IKL A;  4FO2 A;  4DUY L;  3J80 c;  4A3D G;  5M9O A;  1SMY C;  1XTD A;  4RHS A;  3CCJ A;  3S17 B;  2D62 A;  4IAL A;  2ZM6 Q;  2B63 B;  5M5Y B;  2CHB D;  4LW1 A;  4RMF A;  4NKL A;  3EN2 A;  2DJF C;  2VW9 A;  2F0Q A;  3BG3 A;  2K5Q A;  3D8G A;  1YJ9 A;  3I2Z A;  3ND8 A;  2JE6 I;  4GLV B;  3PIO A;  2PCF B;  3CRL C;  1K3R A;  4AQY L;  3E9I A;  5EPL A;  2FXQ A;  2R7Z B;  4KKT A;  3U58 A;  3T1Y L;  4UP7 A;  1H9S A;  1E24 A;  3HOX G;  1NR2 A;  3S24 A;  2Q2I A;  3TRZ A;  4PZ7 A;  4A93 B;  4C3I G;  2LY7 A;  2RSN A;  1WFQ A;  3I4N H;  2KCC A;  1YIT A;  5HY6 A;  4F7X A;  2CCZ A;  1FVI A;  1PYB A;  3GO5 A;  5CC4 A;  2NVQ H;  3VYS A;  2VQF L;  3TQY A;  5A2Q E;  3C1F A;  3S15 B;  4CKE A;  3CP0 A;  5M3M G;  4RWS C;  2M9V A;  5D3D A;  4DV5 L;  5ELB A;  1CKM A;  1KDA A;  2Z9H A;  1W2B A;  1KLU D;  3E0E A;  4NB3 A;  4UAI A;  1KIX A;  1SFO H;  1SXT A;  3VDY A;  1S72 A;  1SSO A;  3J7A F;  1HNX L;  1EOT A;  5FLM G;  3TP5 A;  5BR8 Q;  2F0K A;  1AZQ A;  2DUD A;  2Q2T A;  3I3C A;  5GAE C;  4Q0F A;  4FVM A;  4YWK A;  4KY6 A;  2B8F A;  4QL5 A;  1Z9F A;  4A76 A;  2G9D A;  5M3F B;  4XTC S;  3G4S A;  2KOL A;  3FPU B;  1D5Z C;  2VL6 A;  4K0K L;  1GVP A;  2HQL A;  4C2M B;  1Y8O B;  5D3I B;  3EQL C;  2HD3 A;  1E22 A;  3KF6 B;  4KKU A;  4QF4 A;  5NUC A;  2A68 D;  1IBK Q;  3E0J A;  1EFW A;  1GOZ A;  3V05 A;  3SEB A;  1Y1W B;  1I4G A;  4IFD H;  2JEA I;  2F3I A;  4UDU C;  4C3H B;  1OXS C;  1UE6 A;  1YNN C;  4DAY B;  2D0P A;  1MHW C;  1PZJ D;  3ERQ A;  1PYS B;  1FJG Q;  5C3E H;  3R3O A;  1Y8N B;  4G7H C;  1XMQ Q;  2IJ0 A;  1R4Q B;  2EYF A;  3HOW B;  2R92 G;  2K03 A;  5JPN C;  1Q46 A;  1XNR Q;  2YYZ A;  2LMC B;  3A8J E;  4ILW A;  5BN5 A;  3G7L A;  5IYB H;  3O13 A;  1B1Z A;  2CWA A;  4B3R Q;  4YHH L;  2JA7 H;  3DHQ A;  1CKN A;  2B3G A;  1WD0 A;  1EYA A;  1QB5 D;  5IGC A;  3B6Y A;  4LF9 Q;  5EJW A;  1PFB A;  1I3Q B;  3SK6 A;  1BO0 A;  3RNU A;  2F0G A;  5JOB A;  5JJZ A;  4JV5 Q;  2O2L D;  1A6X A;  4JI3 L;  3WWV A;  1N8R C;  3C1E A;  4DV2 Q;  1K83 B;  2EDG A;  3A8I E;  3MEF A;  4BBS B;  1UE5 A;  4F87 A;  3SXH A;  2UXD Q;  1F9Q A;  3Q6S A;  4Z9C B;  5C0X I;  3SVM A;  3KBG A;  4P2C B;  2NVT H;  1D1I A;  1FGB D;  2ALY B;  2BDN A;  2XN9 C;  1F77 A;  3HFZ B;  2A5H A;  1JWM D;  4IPC A;  3FHW A;  3H0G G;  2DY8 A;  1G2S A;  3R2I A;  4CBV A;  3BVZ A;  4R4Q A;  4CJ0 B;  1WD1 A;  2WB1 B;  5G3L D;  1X9N A;  5EKI A;  1STB A;  4DV6 L;  4DV1 Q;  3BVG A;  2B2U A;  5EAY A;  2F4V Q;  1BBW A;  4PZ6 A;  2G5D A;  5CBA E;  3DM1 A;  3KYH C;  3HG9 A;  3OTO Q;  3FPP A;  1CKO A;  1PRT D;  1OXU A;  3NE5 B;  3JAM i;  2WAC A;  2WV6 D;  1Q86 C;  1DXM A;  2AUJ D;  1VQC A;  2IPK D;  1VQI A;  4NXN L;  3K80 C;  1D5X C;  1KAW A;  1JCK B;  4LMQ D;  2K5D A;  4DNR B;  3OSO A;  3TRE A;  3PV0 A;  4X3U A;  4HIM A;  1IYV A;  2K52 A;  3D4R A;  3U4V A;  1Q12 A;  2L5T A;  4KD3 A;  4A4I A;  3S1Q B;  1XTC D;  2GVB A;  3J7Y W;  1OXT A;  1LO5 D;  3EJI A;  1G51 A;  2HQE A;  4CDF C;  3F1Z A;  1NR4 A;  1PFM A;  2K4K A;  3LWU A;  2UXB Q;  2K50 A;  2L0C A;  1Z7T A;  2R7F A;  4Y52 H;  1D5M C;  2K32 A;  4JVZ A;  4ME3 A;  4IPD A;  2CW0 C;  4OWW B;  3GTJ B;  1S5B D;  3HOY H;  4DPG A;  2RDH A;  1RDP D;  1STA A;  2OF1 A;  1ONL A;  5K36 G;  4TRD A;  1HZ9 A;  5M3M H;  4LF4 Q;  3MEH A;  3S14 B;  5CBE E;  4BY7 B;  3NBI A;  3PF5 A;  2C9O A;  5IP7 G;  2UUA L;  5FLM H;  5ELO A;  1NNX A;  2K33 A;  2JA8 G;  2G9H D;  2ICI A;  1Q1B A;  2WFW A;  4X64 Q;  4X65 L;  4K5V A;  3TP7 A;  2YU9 H;  4RHR A;  4JI2 Q;  3KF6 A;  5COR A;  4UY8 C;  3HOV G;  3NTK A;  4B3S Q;  1HUM A;  1XPO A;  1EZ6 A;  4MHE A;  3OMG A;  1TWC H;  1F2M A;  1A2T A;  1HZA A;  1L0W A;  4DAY A;  4HMI A;  4DK6 C;  3A5U A;  3TP6 A;  1SRO A;  5C6A A;  5ELF A;  1HCZ A;  1WOC A;  2H5X A;  4I65 A;  1GUG A;  4LF5 Q;  4X3K A;  3MZ5 A;  1SRU A;  1SE2 A;  1TWG B;  3H3V H;  3GTP H;  2PW7 A;  4TVA B;  3HKZ G;  4LK1 C;  2IY5 B;  2Z4I A;  4DNT B;  3OMC A;  1SE3 A;  3R2T A;  1JT8 A;  2KBN A;  3TDQ A;  1AEX A;  1L1O C;  2HDL A;  3OOC A;  5I9O A;  3AYH B;  4BY1 H;  3TZD A;  3MTS A;  1PZI D;  1X3P A;  1Y14 B;  1YVC A;  2JP1 A;  3HEJ A;  4K6L A;  2F0U A;  3OW7 A;  5C3X A;  2MJ8 A;  1HR0 L;  2HHH Q;  2EJG C;  3K7A B;  1N36 Q;  3KOJ A;  2RSO A;  4E6I A;  3KJP A;  1PFS A;  3HOZ B;  1J6Q A;  1TU2 B;  4LAA A;  4OWX B;  3J80 i;  1GUW A;  2SNM A;  2EY1 A;  2SNS A;  3OW2 A;  1VCI A;  5C4J B;  3RZD H;  2ZJQ A;  4N9T A;  1U5K A;  1PTO D;  2LXJ A;  1V1Q A;  3SGI A;  1D6E C;  4DF7 A;  4WJ3 M;  1VQB A;  5BR8 L;  3RN5 A;  1LAB A;  4GZY C;  1C8C A;  4O2D A;  1EUJ A;  1WTR A;  1LTL A;  2EOT A;  4A3M B;  3PF4 A;  5E4W C;  4OO1 I;  2NWG A;  2I07 B;  2JA5 G;  1O7I A;  5JVG 3;  4A3B G;  1HFG A;  4KJO A;  1V43 A;  3H09 A;  3MVV A;  5BN3 A;  3I91 A;  1M90 C;  2OTL A;  3S16 H;  2NN6 G;  1EU4 A;  5CV4 A;  4LFA Q;  2J7Z A;  4OWT B;  2RA4 A;  1HR0 W;  2FIN B;  2NB0 A;  3H6M A;  4A3I B;  3PUV A;  3G6E A;  1VMP A;  3S2D H;  3NHH A;  3PUX A;  4R8N A;  5IYC G;  3I4L A;  2E76 C;  1EQT A;  1FR3 A;  3GTQ B;  3PO2 G;  2B2W A;  4HED A;  1FJG L;  2E74 C;  2KEE A;  1XMQ L;  4IQZ A;  1DYQ A;  4QMG A;  1QNU A;  2WAQ E;  2A69 C;  1EU3 A;  5A2Q L;  4DR7 Q;  3ER0 A;  4FDB A;  4A3J G;  3H91 A;  4NXM Q;  1PH6 A;  1NCV A;  1LLR D;  1ZYR C;  3RD4 A;  5C4X H;  3T53 B;  3MC0 B;  4LF9 L;  1AFP A;  3W5O A;  1BCP D;  2WAQ G;  2ZT9 C;  4M1U B;  1OXV A;  1EIY B;  4JV5 L;  1UNS A;  5K36 H;  1CTM A;  4UP8 A;  4JI8 Q;  2BDO A;  2RKS A;  4R4O A;  3U50 C;  5EPJ A;  3VR6 A;  3LNN A;  4A3F G;  3GTM H;  2AHO B;  2UXD L;  1NY4 A;  4KMU C;  4AYB B;  5AFW A;  4DR4 Q;  5IP7 H;  3KFU A;  4JI0 Q;  3K0Y A;  1CUK A;  3E6Z X;  4DU9 A;  2JA8 H;  5IOC A;  4JI1 Q;  2E2H B;  4DXG A;  2QW7 A;  3HOU G;  2F0J A;  3D0F A;  2K75 A;  4ZQ3 A;  4H0L C;  4PMW A;  4IFD I;  1TWH H;  1SDF A;  4X66 L;  3MXU A;  1GO3 E;  1XPU A;  1X3E A;  2J4X A;  1G6Z A;  2NZO A;  2EE1 A;  1DOL A;  4ABN A;  3BDO A;  4HCE A;  1VQA A;  2IHF A;  2XIW A;  1PZK D;  2F4V L;  2IHE A;  4DAM A;  1STG A;  3URY A;  3Q22 A;  1HQR D;  2LXK A;  3FVQ A;  5C44 B;  5LMN W;  1IBM L;  3I4N G;  2FJ2 A;  2XRQ D;  4LF6 Q;  3ICE A;  3OTO L;  2VUM B;  2JA6 G;  2PYK A;  3IFT A;  1ASZ A;  4B9W A;  4HMJ A;  1PRT B;  4OHJ A;  3AQQ A;  4DXF A;  5GAH C;  1J9O A;  3VYT A;  1UE1 A;  3CME A;  5EKL A;  3ZYY X;  1II3 A;  4JG2 A;  4YWM A;  1YNN D;  3D6W A;  4N8X 1;  2ASB A;  2JJQ A;  1PH9 A;  2ZXO A;  3EBE A;  5IWA Q;  1W6J A;  2V4D A;  4JI5 Q;  3PIO 3;  4OEM B;  3GTG B;  2UXB L;  1EIG A;  1CA6 A;  5IT9 E;  3V96 A;  2JQO A;  1JOO A;  3TSS A;  4ALP A;  4KN4 C;  1S4Z A;  4DR5 Q;  2H1E A;  2SOB A;  5ELC A;  3J81 i;  1VQ6 A;  2KCM A;  3M85 A;  3BS1 A;  3GTK B;  4F8M A;  4LF7 L;  4LF4 L;  4U68 A;  1QUQ B;  2EYJ A;  5C3W A;  1ROD A;  3M7G A;  4FF3 A;  2B2V A;  1HH2 P;  1HNZ Q;  4A3D B;  2F0L A;  4DK3 C;  1MSG A;  2B39 A;  3PUY A;  3CCR A;  3NXW A;  2D5D A;  2F3W A;  4X64 L;  2E8G A;  2GA4 B;  1PFN A;  1YNJ C;  1IW7 C;  4Y7N H;  4LF8 L;  4JI2 L;  1VQP A;  1KRS A;  2D2C C;  4FNF A;  2TSS A;  2CWP A;  4H02 A;  4RGM A;  4B3S L;  3TEH B;  1EY8 A;  2NN6 H;  3J7A V;  4DAV A;  1RTO A;  2UUB Q;  1CKN B;  4DFA A;  1IHZ A;  3KF8 B;  3S1M H;  3AEV A;  3RLN A;  1S40 A;  1H9J A;  2E75 C;  2N3S A;  2PNR C;  5KNB A;  4LF5 L;  2ZXP A;  3PO2 H;  1JOK A;  4WFN 3;  3NWT A;  1PVO A;  2B2U C;  2GN5 A;  3NK9 A;  4CJ2 C;  3HOX B;  5C5L A;  1LUZ A;  1C48 A;  1B9N A;  2IX1 A;  2QCP X;  1WCM B;  4C3I B;  4QUC A;  3M4O B;  2R6G A;  3I4M G;  2DN8 A;  4R8I A;  2YTY A;  5L37 A;  1EFI D;  1VQG A;  1P8L A;  2HIX A;  2B8G A;  1I4Q A;  1F9P A;  4GOP B;  3T56 B;  1SEB D;  3A54 A;  2KED A;  3C3L A;  5DEH A;  3GDE A;  3G48 A;  2F0O A;  4K2K A;  3L7Z C;  3TZU A;  4LNQ A;  2VY3 A;  1B3A A;  2O5J C;  1N36 L;  3CC2 A;  2NBF A;  3S1N H;  5K5P A;  1GHK A;  2QF7 A;  3GTO B;  1EZ8 A;  1PXU A;  2HIV A;  4OXP A;  3L2P A;  1B3Q A;  4A3F H;  1AE2 A;  2F0V A;  3QG1 A;  3W1G A;  4XXE A;  3AMU A;  2QDB A;  5LMU Q;  4ZRZ A;  1S3O A;  2MO0 A;  1B4O A;  1PH3 A;  2VXW A;  4HTH A;  5EGT A;  4HAE A;  3HOU H;  1CQF A;  2PZT A;  1HA5 A;  2MHV A;  4JW0 A;  1PTO B;  4JBK A;  1QG7 A;  1EOV A;  1QVF A;  5CV6 A;  4PMB A;  2EXZ A;  2ID0 A;  2AQ1 B;  3OHX C;  5KIX A;  3FKI B;  2PW5 A;  1SNO A;  2EY5 A;  2SDF A;  2RHS B;  4HSV A;  3K6O A;  1EY4 A;  4C3J H;  1B50 A;  1RJT A;  2A1A A;  1SNM A;  4A3G H;  3LWE A;  4LFA L;  2WII B;  2KHJ A;  3SE0 A;  2JA6 H;  3HOY G;  2N49 A;  4UP9 A;  3UDG A;  2F0N A;  2R92 B;  2HCI A;  2ATW A;  3DEP A;  4KN7 C;  2K5V A;  5JVH 3;  5IYD H;  4PG3 A;  5M5X B;  2Z0S A;  2NVY B;  3CCU A;  3M3Y H;  2F0F A;  4MNO A;  1QZH A;  1TII D;  1IZ6 A;  1H9K A;  1LTA D;  1EWI A;  3UDI A;  1J8I A;  1U4M A;  4CGY B;  2XWB B;  3AB9 A;  4DR7 L;  5C4H A;  4CKB A;  1Q3L A;  1LV9 A;  4RKB A;  1Y1V H;  3FMC A;  4KY5 A;  3CD6 A;  1IYU A;  1RF2 D;  5KNC A;  4MN3 A;  4X3S A;  1GXD C;  1LTG D;  2RCN A;  1Z47 A;  1LAC A;  2EJM A;  2F0S A;  3JAM E;  1VQE A;  1T5E A;  2BCO A;  3RZO H;  2KEN A;  3CU7 A;  2B63 G;  4EQ5 A;  5CV8 A;  3NBH B;  4CDC C;  1QUQ A;  4P73 A;  3CCE A;  1CA5 A;  2JK8 A;  3S9W A;  1UEA B;  1BCP B;  4KD4 A;  3H0G B;  3HP3 A;  4PV1 C;  3NUC A;  3CC7 A;  2CH4 W;  4KKS A;  3X3M A;  4NP5 A;  3MAQ A;  2XRS D;  4DR4 L;  1QVG A;  4JI0 L;  3CQZ B;  3WOF A;  2VS1 A;  2K5N A;  1JWU D;  4JI1 L;  1CHQ D;  1I4X A;  4DV4 Q;  2ZTE A;  4C56 C;  2FMM A;  1YIJ A;  1E2W A;  4CJ1 B;  1QNK A;  5JJI A;  3SK8 A;  4BY1 G;  4DV0 L;  5ELD A;  3UI2 A;  3ZJY C;  3S2D B;  1QZG A;  4A93 G;  4BA2 I;  3KF8 A;  3GQB A;  3CCV A;  1TWA B;  1HNW L;  4EQN A;  5G3L F;  4A3E B;  1HRJ A;  4ZCK A;  4LFB Q;  5KEE A;  2K14 A;  3QWN A;  1ML0 D;  2JA9 A;  2Z6K A;  3UE1 A;  4LFC Q;  1XYI A;  4LF6 L;  2E2I H;  3R93 A;  1O7L A;  3KBX A;  4L5Q A;  1S5C D;  5C0X J;  3PO3 H;  2B2Y A;  4GKJ Q;  3W1B A;  2I5H A;  3K0X A;  4R4C A;  1L0X B;  2SEB D;  1YBY A;  1SJH D;  1SYD A;  2Q8T A;  4HN7 A;  1I4H A;  3K8A A;  2CVR A;  4GOP A;  1RIP A;  3U9S A;  4J1M A;  3I4M H;  4R9W A;  2BA0 A;  5ELE A;  4P71 A;  1CT1 D;  4JBW A;  4ZAI A;  1A15 A;  1WTQ A;  4JYA Q;  4BBR B;  1I94 Q;  3DEO A;  1X3Q A;  1BQQ T;  1WTH A;  1QCB D;  5EQ0 A;  3F2U A;  1ESR A;  3A8K E;  2R93 B;  1B7Y B;  3OWE B;  4Q5V A;  1ZYR D;  4R4I A;  4DR5 L;  2K7V A;  2F0D A;  1JE4 A;  3TS0 A;  2JA8 B;  4EX5 A;  3HZX A;  4HIK A;  2KUM A;  1JJC B;  3IKJ A;  4RGN A;  4G4K A;  1ZKO A;  1HNZ L;  1EQV A;  3HOV B;  4LWC A;  3L0O A;  2VQE L;  2NTT A;  4RA8 A;  1A3U A;  1K28 A;  1PMR A;  1EY5 A;  4RAU C;  3CXC A;  1ZXT A;  1IL8 A;  1M8A A;  2MQH A;  4BA1 I;  1GUS A;  4GKK Q;  1TS4 A;  4G7Z C;  2O5I C;  1R4P B;  1MD2 D;  1GM5 A;  5C4X G;  5E7N A;  1SYF A;  2EYL A;  5F2D A;  2E2J H;  3DWQ A;  2UUB L;  3IL8 A;  4KV6 A;  5CR3 A;  4BBS G;  2F0M A;  2NVX B;  1BDO A;  1XWE A;  1KRT A;  1TKW B;  1D1K A;  1PDQ A;  1SYB A;  1JIC A;  3L9A X;  5J22 A;  5I4D A;  5C0X G;  5M5W H;  3D4D A;  5IT9 L;  1E3P A;  1ILQ A;  3BDC A;  1CFM A;  3S1R H;  1U4L A;  4IOC A;  4JI4 L;  1EWC A;  4N8F A;  1OTC A;  4JOI C;  1NMF A;  3PIP 3;  1VQ9 A;  3I56 A;  2Z1C A;  4APV A;  1LTT D;  4ODG A;  2MUY A;  3NBH A;  4QGU A;  1F9S A;  3S17 H;  4F88 A;  1IKM A;  3AU7 A;  3QB3 A;  4K8I A;  3P75 A;  2B63 H;  1LTR D;  2EYO A;  1EYG A;  5M5Y H;  2EJF C;  2ZM6 L;  5KND A;  2PQA B;  3HKZ E;  3EIV A;  3PGZ A;  1RCV D;  4O42 A;  2PI2 E;  4AH6 A;  4HCS A;  4RCN A;  1KDC A;  1NSN S;  4WJ4 A;  1KQS A;  4G57 A;  1TY2 A;  1ZEQ X;  3QIA A;  5IT9 c;  4L5S A;  1A8V A;  1KTK A;  1DM0 B;  4X62 Q;  2D0O A;  3D31 A;  2JA5 B;  2R7Z H;  4A3B B;  1CSP A;  2XNA C;  4RGT A;  4G7O C;  3KUP A;  3CPW A;  1PTO F;  4KTA A;  1SN8 A;  1YNJ D;  1LM0 A;  3S1M B;  4DR6 Q;  1V1O A;  1IBL Q;  1IW7 D;  4A93 H;  2VB2 X;  1EY7 A;  2B2V C;  5GRO A;  5DM6 3;  2N55 A;  3NQT A;  2K01 A;  1RD9 D;  1Z6H A;  1UUP A;  3S15 H;  4YY3 Q;  4AIM A;  4FXD A;  1J5E Q;  4NMZ A;  2K05 A;  2UXC Q;  1X32 A;  5DM7 3;  4CDE C;  1N34 Q;  4A3J B;  1U4R A;  2L4N A;  2L15 A;  5J39 A;  4IO9 A;  1O80 A;  1MGS A;  3I7F A;  1MIU A;  2A68 C;  4GLX A;  4FXK C;  1VQK A;  2WAQ B;  2QIL A;  1A0I A;  3W2D A;  3I70 A;  4XQN A;  2L1B A;  4R4T A;  3MXN B;  3CF5 A;  3IFD A;  3S1N B;  4C1N I;  2A74 C;  4PMC A;  5CV5 A;  4C2M H;  3FRP B;  4JK1 C;  4I7Z C;  1EQR A;  1SND A;  2F0I A;  5H1S E;  4I7A A;  3MA2 B;  4J8Q A;  1SMY D;  4UHV A;  1MSH A;  1Y69 U;  1PA6 A;  4TSS A;  3BDL A;  1IBK L;  1VF7 A;  3M9B A;  5EKK A;  1BUV T;  2AWO A;  4C3H H;  3T1Y Q;  1ILP A;  2A8V A;  2DGY A;  1QE6 A;  2JN4 A;  3PIP A;  2B2T A;  2E2D C;  1JMC A;  1N32 Q;  3VYU A;  1L0Y B;  3HOW H;  2X6L A;  1VQF A;  2Q8R E;  2BH2 A;  2KCT A;  4K14 A;  1H95 A;  3K5N A;  1A62 A;  3N52 A;  4DV4 L;  1XNR L;  2VQF Q;  3ITP A;  3I4N B;  3GD7 A;  2JA6 B;  4B3R L;  4DV5 Q;  2NVQ B;  1I3Q H;  3J81 E;  5JEA J;  2EVB A;  3D6C A;  3BVM A;  1GHJ A;  4YCV A;  1JOQ A;  4DV7 Q;  2EYH A;  4L8J A;  2IX3 A;  4JI6 Q;  1K83 H;  4LFB L;  2QEJ C;  1K8O A;  1SFO B;  3CPF A;  1VQ5 A;  4BBS H;  1VDZ A;  4DV2 L;  3BJU A;  1K0S A;  1K8M A;  2JSO A;  1WTV A;  3T13 A;  5C0X H;  1HZC A;  2VNU D;  3RN2 A;  4JBM A;  3FEW X;  3JAM L;  3MHB A;  1EYC A;  1E0B A;  1NAP A;  2X6G A;  2PO4 A;  2Y0S E;  2XGT A;  4RCO A;  1AH9 A;  4DK0 A;  3PUZ A;  1YJN A;  3I72 A;  1KNE A;  4A3M G;  4JYA L;  1TR5 A;  2N8N A;  5FO7 B;  3T4A C;  1UWV A;  2M2L A;  1I6H H;  2PQA A;  2Y0S G;  4DV1 L;  1X54 A;  3MFG A;  1C0A A;  4XT3 B;  3S2H H;  3OPO A;  4C3J G;  4HJ8 A;  4A3G G;  5I6Y A;  2EYP A;  3EVQ A;  4LUO A;  3DMU A;  5FO9 B;  2A6H C;  5C3E B;  4MTK A;  1ET9 A;  3QOJ A;  4QIW E;  1UE7 A;  4MTN A;  4J6H A;  2CQA A;  3JAM c;  4RG1 A;  3G71 A;  5IYD G;  2JA7 B;  4CDD C;  3CCM A;  1X3F A;  1S5D D;  2K6A A;  1BOS A;  2Q8I B;  2C5C A;  2OXP A;  3S1Q H;  4IOA A;  1TT2 A;  1SNQ A;  2Z8L A;  4JCV E;  2WKD A;  4B3M Q;  4JI7 Q;  4JI3 Q;  4ZKB B;  2ZJP A;  4CKC A;  5LHY 1;  3J7Z C;  2RCF A;  4HIO A;  3K7U C;  4QB4 A;  1HA6 A;  4DKA C;  1HPC A;  1Y1V G;  3A5Z B;  1BBX C;  4LUZ A;  3KDF B;  2MNA A;  5JEA G;  3GTJ H;  1XNQ Q;  2RF4 A;  1XPR A;  1G91 A;  2NVT B;  5DLQ E;  1PYW D;  1WTW A;  2FMC A;  5TSS A;  2LKV A;  4A3K G;  3S14 H;  1EWH A;  3GTL H;  1NBW A;  4P72 A;  3MXP A;  2LSS A;  3PUW A;  4AYB G;  4DV6 Q;  2LFN A;  1I50 H;  2PZU A;  3MXN A;  3EA6 A;  1A2U A;  1O7Y A;  4GNX B;  4DAP A;  1DGS A;  1XMO Q;  1Q82 C;  3DXJ C;  2ENB A;  1OO9 B;  4OEL B;  5FJ8 H;  3UE0 A;  3SK4 A;  4EVO A;  1CSQ A;  4J15 A;  1DON A;  5GAD C;  5FOB B;  4BS9 A;  1MJE A;  2JYO A;  2CQO A;  5CYU A;  2A19 A;  4DUZ Q;  1VMC A;  1FL0 A;  2MPM A;  2AQ2 B;  3VR5 A;  3F8T A;  1KLG D;  2TMP A;  1TVX A;  4P75 A;  1STE A;  3NEL A;  1SMX A;  2NYZ D;  1LT6 D;  4GOP C;  2KJX A;  2WP8 J;  1TY0 A;  1I4P A;  3T16 A;  2F0T A;  2P5Z X;  3MFY A;  5C4Z A;  3U9O A;  1TWG H;  1TS5 A;  3RLO A;  3TP8 A;  4A3C G;  1GUT A;  3VA7 A;  3PO3 G;  4EGV A;  4H7B A;  2A6E C;  3J80 L;  1EYD A;  4X62 L;  1HQM C;  2RBM A;  2UU9 Q;  4XYQ A;  3D4W A;  3BYT B;  3BZK A;  3HOY B;  1EEF D;  3H94 A;  1VQ7 A;  2OTJ A;  5I2Y A;  3E5S A;  1VS0 A;  4X6A H;  4DR6 L;  4JC0 A;  1PTO C;  3CCS A;  1KL9 A;  3M4Y A;  5M3M B;  4IUU A;  3EFX D;  3K7A H;  3P1H A;  2IWH A;  1YHQ A;  2AWN A;  3ND9 A;  2UUA Q;  1GD7 A;  2HHH L;  2BE5 C;  2PMZ E;  3HOZ H;  3KLW A;  3H15 A;  3W3A A;  2K5W A;  4DA2 A;  4ZKC B;  2CW0 D;  4YY3 L;  1JWS D;  1J5E L;  4A75 A;  1CI3 M;  5IE8 A;  3RR5 A;  3HKS A;  1WI5 A;  2UXC L;  4EQO A;  1N9W A;  2HDM A;  1N34 L;  2F4I A;  2K28 A;  3PSI A;  5ELN A;  2YU9 B;  4KI0 A;  4K6D A;  1R9T H;  3KK7 A;  4IUP A;  1KD1 C;  2CKZ B;  3CAM A;  2FFK B;  1CM9 A;  2L12 A;  4NW2 A;  2HCC A;  3M4Q A;  5E4X A;  4HJ7 A;  1F9R A;  3CHB D;  4XQQ A;  1TWC B;  2F0W A;  4A3M H;  1NTG A;  1YHA A;  3Q24 A;  5KGU A;  4HJA A;  1XXG A;  1K8G A;  3DWP A;  3T1H Q;  4OO1 H;  2ZTD A;  3K59 A;  1HTL D;  1TXY A;  4IJL A;  1BBU A;  3PQI A;  3SDZ A;  4B9X A;  3H3V I;  2Q2U A;  1W3S A;  3M7N A;  4A3I H; 
#chains in the Genus database with same CATH homology
 4AYB E;  3OW2 A;  1VCI A;  3RZD H;  4EX5 A;  2Q2H A;  4DR1 Q;  2ZJQ A;  1U5K A;  2NVX H;  4HIK A;  1P16 A;  4UPA A;  4OX9 Q;  1JJC B;  2LXJ A;  1FGU A;  1V1Q A;  3SGI A;  3J81 j;  2QA4 A;  1VQM A;  1Q7Y C;  1PH1 A;  3GTQ H;  1PH2 A;  2GVA A;  3NEN A;  4WJ3 M;  1HNZ L;  4LWC A;  1VQB A;  3L0O A;  5BR8 L;  3RN5 A;  2VQE L;  4BY7 H;  3E9H A;  1X3G A;  1N32 L;  1JJ2 A;  1YNX A;  2KHI A;  1HR0 Q;  3CCL A;  4O2D A;  4R1J A;  1C7Y A;  4A3L G;  1EUJ A;  1WCM G;  1LTL A;  2OCE A;  3PF4 A;  3U4Z A;  4OO1 I;  3CXC A;  2JA5 G;  2MQH A;  1O7I A;  3KDF A;  3STB C;  4BA1 I;  4A3B G;  4GKK Q;  2Z6K C;  1V43 A;  1YHB A;  3PCO B;  1M90 C;  1MKH A;  2OTL A;  3S16 H;  4QJF A;  5JJK A;  1VQD A;  4NXM L;  2NN6 G;  2YTV A;  4LFA Q;  4OWT B;  1L1O A;  1GM5 A;  4XIG S;  5E7N A;  5C4X G;  2E5L L;  1KC8 C;  3J7A 5;  4BXX G;  1HR0 W;  1PH7 A;  2BH8 A;  3CC4 A;  4IFD G;  2E2J H;  3I55 A;  4NXN Q;  3PUV A;  3G6E A;  1B70 B;  5JJL A;  2UUB L;  3S2D H;  3PUX A;  4DV7 L;  5IYC G;  4JI6 L;  4LUV A;  4GN4 B;  3CCQ A;  1BKB A;  1VQ4 A;  4BBS G;  4DV3 Q;  4DR2 L;  5IP9 G;  1KRT A;  2VQE Q;  5C44 G;  1M1K C;  4JI8 L;  4A3K H;  5C3E G;  2VUM G;  3PO2 G;  3ERS X;  1GKH A;  1NJI C;  1JE5 A;  1T9H A;  4GNX A;  4YCW A;  5C0X G;  1FJG L;  5M5W H;  4KHP Q;  1K0R A;  2CFM A;  1HJP A;  3M4P A;  1E1T A;  1E3P A;  1XMQ L;  3ULL A;  4IJH A;  2WAQ E;  4YCU A;  3UDF A;  1PH5 A;  2IX0 A;  3A0J A;  3S1R H;  4IOC A;  4JI4 L;  5IYB G;  1OTC A;  2OWO A;  4B3T Q;  4DR7 Q;  4MZ9 A;  4JOI C;  3ER0 A;  3F2C A;  4FDB A;  1NMF A;  1PH4 A;  2E2H H;  2JA5 H;  5AJ3 Q;  2JA7 G;  4A3J G;  4NXM Q;  4A3B H;  1PH6 A;  1QVC A;  4GN5 A;  2R7Z G;  1VQ9 A;  3I56 A;  4APV A;  5C4X H;  5FLX c;  4QGU A;  4BXX H;  4LF9 L;  3S17 H;  3FKI G;  3W5O A;  2WAQ G;  1MJC A;  1OXV A;  1SLJ A;  1LYL A;  1EIY B;  2B63 H;  5IYC H;  4JV5 L;  1YZ6 A;  4UP8 A;  4JI8 Q;  1EYG A;  3U50 C;  1NE3 A;  4R4O A;  5M5Y H;  3CW2 C;  2ZM6 L;  1D8L A;  5C44 H;  1IBL L;  2PQA B;  5GAG C;  4IPG A;  4A3F G;  3HKZ E;  2EQS A;  2VUM H;  3GTM H;  3EIV A;  2AHO B;  2UXD L;  1NY4 A;  3PGZ A;  4NPS A;  1ASY A;  4HJ5 A;  2PI2 E;  4AH6 A;  1X65 A;  4JI4 Q;  3TS2 A;  4DR4 Q;  1KQS A;  4WJ4 A;  5IP7 H;  4DR3 L;  1WYD A;  1VQH A;  4JI0 Q;  3KFU A;  3UDX A;  4X65 Q;  1CUK A;  1EQQ A;  1Q1E A;  5IT9 c;  4L5S A;  1A8V A;  2HT1 A;  2JA8 H;  4POF A;  4A3C H;  4L5T A;  4PZ8 A;  2D0O A;  3D31 A;  4JI1 Q;  4X62 Q;  5C4J H;  4A3J H;  3HOU G;  2R7Z H;  1PH8 A;  3D0F A;  2K75 A;  1HZB A;  1CSP A;  5LMN Q;  4PMW A;  4DUY L;  3J80 c;  4A3D G;  1X6O A;  4IFD I;  1NMG A;  1TWH H;  3CPW A;  1XTD A;  3CCJ A;  4X66 L;  1XPU A;  1GO3 E;  4B3M L;  1X3E A;  1IYJ B;  2D62 A;  4JI7 L;  1SN8 A;  2NZO A;  1LM0 A;  2ZM6 Q;  4DR6 Q;  1IBL Q;  5IWA L;  4A93 H;  3GTG H;  5M3F G;  1VQA A;  2B29 A;  2IHF A;  5GRO A;  2F4V L;  2IHE A;  4JI5 L;  4O0A A;  4DAM A;  4LW1 A;  4RMF A;  3BU2 A;  2LXK A;  5LMN W;  1IBM L;  3I4N G;  3ICE A;  4LF6 Q;  2QGQ A;  3OTO L;  1A63 A;  2JA6 G;  2UUC Q;  3EN2 A;  3KJO A;  2VW9 A;  1XNQ L;  3Q8D A;  2V1C C;  3I4O A;  3S15 H;  1ASZ A;  4YY3 Q;  3LGJ A;  4AIM A;  3GTK H;  3AQQ A;  1YJ9 A;  3I2Z A;  5GAH C;  1Y1W G;  1J5E Q;  4QQB X;  2JE6 I;  2UXC Q;  1UE1 A;  2PNH A;  4GLV B;  3CME A;  1N33 Q;  2IT1 A;  3PIO A;  1K3R A;  1TWF H;  4AQY L;  1YI2 A;  4JG2 A;  1N34 Q;  4YWM A;  3E9I A;  2FXQ A;  2L15 A;  3J81 c;  4IO9 A;  2ASB A;  3I7F A;  1MIU A;  4X66 Q;  3U58 A;  3T1Y L;  4A3D H;  4GLX A;  2JJQ A;  1VQK A;  1PH9 A;  3EBE A;  5IWA Q;  2RHQ B;  1A0I A;  4UP7 A;  1V9P A;  1XMO L;  1E24 A;  4R4T A;  3MXN B;  3HOW G;  2N78 A;  3CF5 A;  4JI5 Q;  3HOX G;  3S24 A;  2Q2I A;  3TRZ A;  4PZ7 A;  1IBM Q;  2UXB L;  2OQ0 A;  1WFQ A;  4C2M H;  3I4N H;  1YIT A;  2JQO A;  1EQR A;  5HY6 A;  5H1S E;  4ALP A;  2CCZ A;  1FVI A;  1PYB A;  3GO5 A;  2NVQ H;  1L2F A;  4DR5 Q;  2VQF L;  3TQY A;  4DUZ L;  2F52 A;  5J3B A;  3J81 i;  1VQ6 A;  5IYD H;  2YTX A;  2KCM A;  3CP0 A;  5M3M G;  2AKW B;  3M85 A;  4DV5 L;  3OYY A;  4A3E G;  3AFQ A;  3FP9 A;  1PA6 A;  1X56 A;  1CKM A;  1IBK L;  3M9B A;  4LF7 L;  1W2B A;  4LF4 L;  1YEZ A;  4YWL A;  1QUQ B;  2AWO A;  3E0E A;  4NB3 A;  4C3H H;  3T1Y Q;  1SFO H;  1KIX A;  2A8V A;  3VDY A;  2DGY A;  1S72 A;  1HH2 P;  1HNX L;  1PHJ A;  5FLM G;  1HNZ Q;  1RL2 A;  5BR8 Q;  4DK3 C;  3PIP A;  1JMC A;  2DUD A;  1N32 Q;  3PUY A;  3CCR A;  2WB1 E;  2Q2T A;  1VQN A;  2I0Q A;  5GAE C;  4YWK A;  3HOW H;  4X64 L;  1VQF A;  2E8G A;  3HOX H;  4A3L H;  4QL5 A;  1U0L A;  1Z9F A;  2KCT A;  4A76 A;  2BH2 A;  4XTC S;  1WCM H;  4C3I H;  4Y7N H;  3G4S A;  4LF8 L;  3M4O H;  2UU9 L;  4JI2 L;  1H95 A;  1A62 A;  1VQP A;  4DV4 L;  1KRS A;  1XNR L;  2VQF Q;  2VL6 A;  4K0K L;  1GVP A;  2HQL A;  1G29 1;  3GD7 A;  4BBR G;  1E22 A;  2CWP A;  3KF6 B;  2WB1 G;  4H02 A;  4DV5 Q;  4B3R L;  4B3S L;  3TEH B;  2E5L Q;  1I3Q H;  5JEA J;  1IBK Q;  4LF7 Q;  1EFW A;  2C35 B;  4GLA C;  2UUB Q;  4YCV A;  1CKN B;  4DV7 Q;  2R93 G;  4JI6 Q;  2JEA I;  2F3I A;  1K83 H;  4LFB L;  3KF8 B;  3S1M H;  3AEV A;  4DR2 Q;  3A74 A;  3RLN A;  1OXS C;  3CPF A;  1UE6 A;  3JC6 6;  1VQ5 A;  1S40 A;  3GTO H;  4BBS H;  4DAY B;  2D0P A;  5IP9 H;  3BJU A;  4DV2 L;  1PYS B;  2N3S A;  4LF5 L;  5C3E H;  1FJG Q;  3PO2 H;  1PVO A;  1XMQ Q;  1HZC A;  1BVS A;  2GN5 A;  2K5H A;  4QY7 A;  3RN2 A;  4JBM A;  2VNU D;  2R92 G;  4LF8 Q;  2I5L X;  1K73 C;  1Q46 A;  1XNR Q;  2YYZ A;  1LUZ A;  2IX1 A;  2Y0S E;  5LMU L;  2XGT A;  5IYB H;  2CWA A;  2R6G A;  3I4M G;  1AH9 A;  4B3R Q;  4YHH L;  2JA7 H;  2YTY A;  2I5M X;  2NZH A;  3PUZ A;  1YJN A;  1CKN A;  2B3G A;  2NN6 I;  1VQG A;  1P8L A;  2HIX A;  4GOP B;  3B6Y A;  4LF9 Q;  4A3M G;  4JYA L;  2N8N A;  3GDE A;  3RNU A;  3G48 A;  3FKI H;  1UWV A;  4JV5 Q;  1I6H H;  3L7Z C;  2PQA A;  2Y0S G;  1KXL A;  4JI3 L;  3WWV A;  1X54 A;  2VY3 A;  4DV1 L;  1N8R C;  4DV2 Q;  4LNQ A;  1C0A A;  1N36 L;  3T1H L;  3CC2 A;  3S2H H;  3MEF A;  3S1N H;  1UE5 A;  4HJ8 A;  4A3G G;  1K9M C;  2UXD Q;  2HIV A;  4LUO A;  4OXP A;  3L2P A;  1E7Z A;  5C0X I;  4A3F H;  1AE2 A;  3IRB A;  3K81 C;  2NVT H;  4DNI A;  2ALY B;  3W1G A;  4DR3 Q;  2R92 H;  4P74 A;  4QIW E;  5LMU Q;  1UE7 A;  4DR1 L;  2ZTC A;  3HFZ B;  4MTN A;  1G6P A;  4IPC A;  3RLF A;  1S3O A;  2MO0 A;  3JAM c;  4RG1 A;  5M5X H;  3FHW A;  3G71 A;  3H0G G;  5IYD G;  1PH3 A;  4OX9 L;  2NVY H;  1EIF A;  4BY7 G;  3HOU H;  2JEB I;  3CCM A;  1X3F A;  4R4Q A;  4DUY Q;  1PV4 A;  4JBK A;  1EOV A;  1QVF A;  3S1Q H;  1X9N A;  4IOA A;  4JCV E;  4B3M Q;  4DV6 L;  2ID0 A;  3CMA A;  4DV1 Q;  4JI3 Q;  4JI7 Q;  2ZJP A;  2MFI A;  3J7Z C;  2RHS B;  3K7U C;  5EAY A;  4HIO A;  2F4V Q;  1BBW A;  4PZ6 A;  4DKA C;  5FJ8 G;  2XTI A;  4C3J H;  5M3F H;  2A1A A;  1Y1V G;  3A5Z B;  3KYH C;  4LUZ A;  4A3G H;  3OTO Q;  3KDF B;  1CKO A;  2MNA A;  5JEA G;  3GTJ H;  4LFA L;  1XNQ Q;  1OXU A;  2RF4 A;  1XPR A;  3JAM i;  3ULP A;  2KHJ A;  2JA6 H;  3HOY G;  2N49 A;  1Q86 C;  4UP9 A;  3UDG A;  1VQC A;  5DLQ E;  1E1O A;  1VQI A;  1YJW A;  1L1O B;  4NXN L;  1UEB A;  2ATW A;  3K80 C;  1KHI A;  1KAW A;  2OQK A;  2AMC B;  4AQY Q;  2K5V A;  1Y1W H;  4A3K G;  3H0G H;  3S14 H;  4DV3 L;  1IXR A;  4PG3 A;  3TRE A;  3DLL A;  3PV0 A;  2Z0S A;  1NBW A;  4HIM A;  2K52 A;  3GTL H;  3CCU A;  4P72 A;  3U4V A;  2LSS A;  3PUW A;  4AYB G;  4DV6 Q;  1Q12 A;  2EXD A;  1JB7 A;  1I50 H;  3M3Y H;  4A4I A;  4KHP L;  4MNO A;  1QZH A;  1IZ6 A;  4GNX B;  2GVB A;  1EWI A;  3CQZ H;  1OXT A;  1DGS A;  3UDI A;  1XMO Q;  1Q82 C;  1G51 A;  4L5R C;  1AE3 A;  4B3T L;  3F1Z A;  1X55 A;  4DR7 L;  2K4K A;  5AJ3 L;  5FJ8 H;  2UXB Q;  3UE0 A;  2K50 A;  3AFP A;  1Y1V H;  2R7F A;  4Y52 H;  1CSQ A;  4J15 A;  2QEX A;  5GAD C;  1MJE A;  3CD6 A;  4ME3 A;  4IPD A;  4POG A;  2CQO A;  2A19 A;  2RCN A;  4OWW B;  1Z47 A;  4DUZ Q;  3HOY H;  4DPG A;  1VQE A;  3ULJ A;  1FL0 A;  3RZO H;  2KEN A;  3F8T A;  2B63 G;  4EQ5 A;  5K36 G;  4P75 A;  1HZ9 A;  3NBH B;  3NEL A;  1QUQ A;  4P73 A;  3CCE A;  1K8A C;  1TWA H;  2JK8 A;  1WJJ A;  4KLK A;  1SMX A;  4A3E H;  5M3M H;  4LF4 Q;  4GOP C;  5HGQ A;  2WP8 J;  2R7D A;  2PI2 A;  2ZJR A;  1OXX K;  1HNX Q;  5GQO A;  3PF5 A;  4LFC L;  3HOZ G;  3CC7 A;  1TWG H;  1B8A A;  5IP7 G;  2UUA L;  1JJG A;  5FLM H;  5ELO A;  3BZC A;  4DR4 L;  3RLO A;  2JA8 G;  1QVG A;  4TQU S;  4X64 Q;  1Q1B A;  2WFW A;  4X65 L;  4JI0 L;  3PO3 G;  3F2D A;  4A3C G;  1SR3 A;  1IL2 A;  2VS1 A;  1Q81 C;  2K5N A;  4X62 L;  4GKJ L;  4JI1 L;  2YU9 H;  2UU9 Q;  4JI2 Q;  3KF6 A;  2ZTE A;  4DV4 Q;  4UY8 C;  4K0K Q;  5LMN L;  1YIJ A;  5IY0 A;  3HOV G;  5JJI A;  4BY1 G;  3BZK A;  4DV0 L;  4B3S Q;  1XPO A;  4BBR H;  3ZJY C;  1VQ7 A;  2OTJ A;  1TWC H;  1VS0 A;  1QZG A;  1VQ8 A;  4BA2 I;  4GS3 A;  4A93 G;  4X6A H;  4DR6 L;  4JC0 A;  1HZA A;  3CCS A;  3CCV A;  1KL9 A;  2ES2 A;  1L0W A;  1I94 L;  4IFD J;  1HNW L;  3STB D;  4LFB Q;  3K7A H;  2K14 A;  4OON A;  2JA9 A;  2R93 H;  2Z6K A;  3UE1 A;  1YHQ A;  2AWN A;  4DK6 C;  3A5U A;  1XJV A;  4LFC Q;  4JBJ A;  1SRO A;  4OO1 G;  2UUA Q;  1GD7 A;  2HHH L;  2PMZ E;  2YV5 A;  4LF6 L;  2E2I H;  3HOZ H;  3KLW A;  1WOC A;  2H5X A;  3H15 A;  2UUC L;  4LF5 Q;  1SRU A;  3F2B A;  1D7Q A;  1VQO A;  3H3V H;  4L5Q A;  4YY3 L;  3GTP H;  1C9O A;  5C0X J;  4TVA B;  3PO3 H;  4A3I G;  4GKJ Q;  1J5E L;  3W1B A;  3DM3 A;  2I5H A;  3K0X A;  4R4C A;  5IE8 A;  4HID A;  1YBY A;  3RR5 A;  3HKS A;  4A75 A;  1WI5 A;  2EIF A;  3HKZ G;  1N33 L;  2UXC L;  2IY5 B;  1N9W A;  1N34 L;  3PSI A;  5ELN A;  1JT8 A;  1VQJ A;  2KBN A;  4GN3 B;  3K8A A;  4KHZ A;  4KI0 A;  2VZA A;  4YHH Q;  1R9T H;  4DV0 Q;  1L1O C;  1RIP A;  2BA1 A;  4GOP A;  2CKZ B;  1KD1 C;  3HOV H;  3AYH B;  3CAM A;  3I4M H;  2BA0 A;  4P71 A;  4BY1 H;  4JBW A;  4HJ9 A;  3M4Q A;  4HJ7 A;  4JYA Q;  2MO1 A;  1HNW Q;  1I94 Q;  1Y14 B;  1YVC A;  4A3M H;  3NEM A;  1NTG A;  1Q8K A;  1YHA A;  4JOI A;  1HR0 L;  2HHH Q;  4HJA A;  1K8G A;  1VQL A;  1N36 Q;  3KOJ A;  3T1H Q;  1B7Y B;  4GNX C;  2ZTD A;  1TXY A;  4IJL A;  1BBU A;  3KJP A;  1PFS A;  1I5F A;  4R4I A;  3H3V I;  4GKK L;  4DR5 L;  1J6Q A;  2Q2U A;  1W3S A;  1SE8 A;  4IPH A;  4OWX B;  3J80 i;  3M7N A;  3TS0 A;  4A3I H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...