1GD7A

Crystal structure of a bifunctional protein (csaa) with export-related chaperone and trna-binding activities.
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
109
structure length
109
Chain Sequence
MTPLEAFQILDLRVGRVLRAEPHEKARKPSYKLWVDLGPLGVKQSSAQITELYRPEDLVGRLVVCAVNLGAKRVAGFLSEVLVLGVPDEAGRVVLLAPDREVPLGGKVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the ttCsaA protein: an export-related chaperone from Thermus thermophilus.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Rna binding protein
molecule keywords CSAA PROTEIN
total genus 22
structure length 109
sequence length 109
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01588 tRNA_bind Putative tRNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1gd7A00
2K5NA 1K8GA 1JJ2A 3GO5A 4IPHA 4HIDA 4P73A 4A3GG 4DV1L 2HT1A 4DV5Q 1J6QA 1WCMG 3S1NH 2JEAI 3CCJA 1OXTA 5J3BA 3UDFA 3VDYA 4LF8L 2UXCL 3L0OA 3U50C 3KJOA 1QUQA 1GO3E 1QUQB 4A3DG 3I4NH 4JBWA 3EIVA 1G6PA 2V1CC 5C3EG 4DUZL 1ASYA 3G48A 3CMAA 3RLNA 4IJLA 3UDIA 2DGYA 2VQFL 4HIMA 4GN5A 4OWXB 2BA0A 3TRZA 2ZTEA 4IOAA 2WAQG 1MIUA 3CAMA 1NMFA 3UDGA 2GVAA 4LUOA 1YHQA 1IBLQ 4TQUS 2NVQH 1CSQA 1Y1WG 4OXPA 1KAWA 4JI5L 3HOYH 4H02A 4A3LG 4A3IH 4KHPL 5EAYA 1EIFA 1SR3A 4YWKA 4DNIA 4GOPB 1YIJA 1BBWA 3CPFA 4LF8Q 3RZOH 3RLFA 1D7QA 4DV4Q 3CF5A 1EYGA 4X66L 5IP7H 3GD7A 2ID0A 4L5RC 4B3TQ 2HIVA 1VQAA 4LUVA 1B8AA 4LFAQ 1S3OA 4BY1G 1KC8C 1E24A 4EQ5A 3A74A 1E1OA 4JG2A 3S2DH 3KDFA 2DUDA 5IYDH 3UE0A 3OTOL 5C4JH 4DR6L 1HNWQ 2UUCQ 3PV0A 1XNQQ 1Q1EA 3FKIH 4JI4Q 4KHZA 4KI0A 1N8RC 1NMGA 1YJWA 4DV0Q 1Q81C 3CC4A 2VNUD 5JJKA 5IE8A 1O7IA 4XIGS 1VQDA 5GQOA 2CQOA 3CCQA 3UDXA 3A0JA 2ZJPA 3EN2A 4JV5L 2EQSA 3D31A 3PIPA 3TREA 4A3EG 2Z6KA 1GM5A 2ZM6Q 4X64Q 2A8VA 4BBSH 4LFCL 2IY5B 5JJIA 1K83H 3I56A 1SMXA 3KJPA 4AQYL 1N32Q 1L2FA 4X64L 2UUAL 3KLWA 3PSIA 2HIXA 1PVOA 1VQEA 4AIMA 2RHSB 5IYBH 3HOXH 4DUYQ 1N33L 2K14A 3PUWA 2K75A 5GAEC 1J5EL 3HOVH 1VQLA 5GROA 4B3SQ 1HNXQ 2E8GA 1FJGL 5ELNA 1VQ9A 2F4VL 3G6EA 3HKZE 2KENA 1N36L 5JEAG 1E7ZA 1JT8A 4YWLA 3S15H 1XNQL 1VQFA 4A3JH 3HOUH 3ER0A 4GKJQ 5LMUQ 2YYZA 3BU2A 2VQEQ 2WFWA 4JI0L 3NBHB 5AJ3L 2VQFQ 3TS2A 3CW2C 5IT9c 1LYLA 2UUBQ 1V43A 4HJ7A 4JI6L 4B3TL 2HHHQ 2AKWB 1EQRA 5M5YH 1I6HH 3ZJYC 4IOCA 1TWHH 3FP9A 3F2CA 3ULPA 2N8NA 2E2HH 4LF5L 1DGSA 3RNUA 4LFCQ 3KDFB 3M4QA 1UE7A 4OWTB 4JI8L 5IP9G 4B3SL 1EOVA 3CCUA 4DV5L 4WJ3M 1EUJA 4DR2Q 1X3EA 1KHIA 2ATWA 4JI8Q 5JJLA 3FHWA 4BXXH 3U4ZA 3PUZA 3F2DA 4A3BG 1CSPA 3W1GA 5LMNL 4GNXA 1EWIA 4GS3A 3K81C 2JA6G 1QVFA 3I7FA 4IPCA 3J80i 3J81j 2CKZB 2CCZA 2HHHL 1V9PA 3HKSA 4GN4B 2UUCL 3AEVA 2XTIA 4ME3A 3S1QH 2ZM6L 1KXLA 1TWFH 2F3IA 4MTNA 1XPUA 4GKKL 1Z47A 2C35B 1X56A 1CKMA 1X54A 4LF4Q 2E5LL 2NZOA 1XTDA 4GKKQ 4DV3L 2VUMH 4RMFA 1YITA 2CWPA 1XMQQ 2YV5A 3CCVA 2PMZE 2PQAB 3PGZA 4UP8A 4L5TA 1P16A 3S24A 1OXXK 1JMCA 4LF5Q 1S40A 2N3SA 4JI4L 2EIFA 2MO1A 4LF6L 4A93H 1WYDA 3KF6A 1L1OA 2B63H 2VQEL 4DPGA 3T1YL 1I5FA 4GN3B 5LMUL 2ZTDA 2UXDQ 4QY7A 4QIWE 5H1SE 1E3PA 1SRUA 4XTCS 4L5SA 4PMWA 1XPRA 3PO2H 4R4OA 1OXUA 4B3RQ 2NZHA 1CKNA 2R7ZG 3KFUA 2KHJA 3WWVA 1KIXA 3S1MH 1BKBA 1I94Q 1CUKA 2YU9H 1VQIA 2OWOA 4OX9L 3H0GG 3RN2A 4YCVA 3PIOA 4DR2L 1N33Q 1IXRA 2NVYH 1PH6A 1PA6A 3STBC 4AQYQ 2RF4A 1NY4A 2R92H 1GD7A 2KBNA 1LTLA 3KOJA 4DV2L 2AWOA 4LFAL 1Q1BA 4LUZA 1B7YB 2R7DA 2CFMA 3GTPH 1UE6A 1VQOA 1K73C 2K5VA 4X62Q 3T1HL 3PF5A 4JI2L 1Q7YC 1L0WA 3NELA 4X6AH 4AH6A 1FJGQ 4JV5Q 3E9IA 2JE6I 3W1BA 4DR5Q 2BH2A 4A3EH 1YEZA 1TXYA 4GKJL 1AH9A 3PO3G 5FLMG 2E5LQ 4LF4L 4LF7L 3U4VA 1VQMA 1C7YA 1PH9A 2UUAQ 5C4XG 3HOXG 3OW2A 4JOIA 4JI1L 3CMEA 4R4TA 2R93G 4DR3Q 1M1KC 5GADC 4GOPC 2Q2HA 4DR1L 1JE5A 2QEXA 3NEMA 4DR6Q 3I4MG 1YZ6A 3M85A 4DV4L 1PH5A 1A8VA 4B3ML 3ICEA 4JBJA 4BA1I 5C0XJ 5C0XI 4A75A 2E2JH 3S17H 2MQHA 1L1OC 4P72A 5M3FG 2JA5G 3ERSX 3CD6A 2AWNA 4GLAC 1Q82C 2UXBL 2YTXA 4P71A 1IBML 1UE5A 5IWAL 2KCMA 1XMOL 4A3FH 5JEAJ 3HOZG 3T1YQ 2UXDL 3F8TA 2I0QA 1UEBA 3HOWH 4BY7H 3L7ZC 2UU9Q 4LFBQ 1HZAA 1VQJA 2K4KA 3CCRA 1K8AC 2UU9L 3H3VH 3J81c 1SLJA 2K50A 4KLKA 1E22A 4POGA 4OWWB 4DV1Q 2KHIA 5IYCG 2D0OA 4DV3Q 2WB1G 4PZ7A 4DK3C 1SROA 4JI2Q 4DAYB 4X62L 4PZ8A 2WAQE 4Y52H 3A5UA 2F52A 2MNAA 1T9HA 2NVTH 1WCMH 1HR0W 4R1JA 1IBLL 3LGJA 4AYBE 4LFBL 1TWGH 4BBRG 3HKZG 2D62A 4LF7Q 2Z0SA 1S72A 3G71A 4POFA 2Y0SG 4JI1Q 5IWAQ 1XMOQ 1K0RA 4OX9Q 1CKNB 4DR3L 3PUVA 3GTOH 1JJCB 3HFZB 4QQBX 2JA8G 2YTVA 1Q46A 2Z6KC 5C0XG 2YTYA 1EQQA 3RR5A 4NPSA 3CC7A 5K36G 5FJ8H 1AE2A 2EXDA 1RIPA 1PH7A 1BBUA 1EIYB 1Y1VH 2Y0SE 1TWCH 3K80C 1HR0Q 1CKOA 1NTGA 3B6YA 2QGQA 4DV2Q 1AE3A 2L15A 1XNRQ 2R7ZH 4IPGA 1C9OA 4HJ9A 2JA7H 1V1QA 5BR8Q 4AYBG 1N34Q 2LSSA 4BY1H 3GTKH 3PF4A 2UXCQ 2IX0A 1HH2P 1I94L 4IPDA 1RL2A 5HGQA 5IYDG 1UE1A 1SN8A 2AMCB 1JJGA 3IRBA 1SE8A 5M5WH 4LW1A 3FKIG 1W2BA 1VQHA 4IFDI 3UE1A 1UWVA 4DAMA 3K8AA 2IHEA 4A3DH 1YBYA 3I4NG 3S16H 1YNXA 4B3MQ 1FL0A 3H15A 2I5LX 2NN6I 4JI7Q 2R7FA 1OXSC 4A3MH 2MFIA 4BBSG 4IFDG 2BH8A 4K0KQ 2OCEA 3BZKA 1XMQL 3M9BA 4DR4L 4X65L 2PI2E 1Y1WH 4A3LH 3HOYG 4MZ9A 3TQYA 5HY6A 2KCTA 5FLMH 5LMNW 4A3IG 4JYAQ 4JBMA 3CP0A 1E1TA 5C4XH 1GVPA 3CPWA 1Q8KA 4A3KH 3GDEA 2NN6G 2UXBQ 5IP7G 1U5KA 4DV7L 1G291 2FXQA 4YCWA 1K3RA 4HJ8A 4IFDJ 4B3RL 4A3JG 3JC66 1VQ5A 1Z9FA 1P8LA 1L1OB 3AFPA 3KF6B 3MXNB 1X55A 2XGTA 4PZ6A 3CCEA 2OTLA 4P74A 3JAMi 2HQLA 4IO9A 4YY3Q 1X3GA 5M3FH 2JA5H 2D0PA 2GVBA 2VL6A 2JA9A 3JAMc 3GTQH 3HOZH 1HNZL 4DKAC 2AHOB 5DLQE 2Q2TA 3CCMA 4A3CH 1JB7A 2N49A 4QGUA 4DV6L 2IT1A 1KRSA 3OTOQ 4JI6Q 2B29A 4R4CA 1VQNA 2ZTCA 1X3FA 4BXXG 2LXJA 4ALPA 1B70B 2JQOA 5M3MH 4JC0A 2R6GA 2Q2UA 4JCVE 5C44G 4HIOA 4DR1Q 3S1RH 1XPOA 4J15A 1Q86C 1GKHA 3CC2A 1VQBA 1VQ4A 1YI2A 1NBWA 4JI0Q 4LF9Q 2JA6H 3ULLA 1VQGA 3BZCA 3L2PA 3OYYA 1PH4A 2BA1A 2JK8A 4LF6Q 4O2DA 1J5EQ 4YWMA 1KQSA 4FDBA 3I2ZA 3F2BA 3D0FA 3TS0A 5FLXc 1PH3A 3HOUG 4JYAL 2F4VQ 1N36Q 2VS1A 3AYHB 4BBRH 4OO1I 1A62A 1PYSB 4OONA 1PFSA 3DLLA 2N78A 4NXMQ 1OTCA 3S14H 3MEFA 1N9WA 3EBEA 2JA8H 5GAHC 2UUBL 4NXML 3Q8DA 1YJNA 1QVCA 3M4PA 1MJCA 5IY0A 4TVAB 3KYHC 3M3YH 2OQ0A 1QZHA 4R4IA 3SGIA 3K7AH 2E2IH 2H5XA 4JI3Q 3RZDH 4DV7Q 4GOPA 4A3BH 4UP7A 1HJPA 3NENA 1VQPA 1C0AA 4A3GH 2JA7G 4X65Q 3M4OH 3H0GH 1D8LA 4P75A 4UP9A 2QA4A 1IL2A 4NB3A 3J81i 2WB1E 1WFQA 3ULJA 4C3IH 2IX1A 1WJJA 1OXVA 3I4OA 3W5OA 2R92G 2VW9A 1KL9A 1W3SA 5GAGC 1XNRL 3H3VI 2PI2A 5C3EH 4KHPQ 1YVCA 2VUMG 1U0LA 1FVIA 3K0XA 4IJHA 3PUYA 4LWCA 5ELOA 5E7NA 4LNQA 4WJ4A 4RG1A 2Q2IA 4O0AA 4A76A 4A3MG 1KD1C 4JI5Q 3GTLH 1H95A 4A93G 1KRTA 4R4QA 3PO3H 4JBKA 2B63G 4K0KL 3DM3A 1HNXL 4DR4Q 3BJUA 2LXKA 4L5QA 3CXCA 4HJ5A 3AFQA 2PNHA 1QVGA 3RN5A 1N32L 2GN5A 1A0IA 3PO2G 2R93H 4YY3L 4JI7L 4A3KG 4DUYL 1LM0A 1NJIC 4QJFA 4DV6Q 1VQ8A 4GNXC 1YHAA 2JJQA 1G51A 1NE3A 1PH2A 2NVXH 5AJ3Q 2I5HA 1HR0L 2I5MX 1HNZQ 4YCUA 3I4MH 1IZ6A 4MNOA 5LMNQ 4DR7Q 3GTJH 4GLVB 4NXNL 3M7NA 3PCOB 4C3HH 4GLXA 4UPAA 1WOCA 4JI3L 3I55A 3J7ZC 2ZJRA 1TWAH 3F1ZA 1QZGA 2PQAA 4HIKA 1VQ6A 2OTJA 3CCLA 1WI5A 3TEHB 1XJVA 1VQ7A 2ALYB 1PYBA 4HJAA 4LF9L 3GTGH 4DUZQ 1VQKA 4PG3A 2RHQB 4BY7G 4A3CG 2VY3A 3KF8B 4APVA 1LUZA 1IBKQ 4A4IA 4UY8C 5IYBG 4DK6C 4DR5L 1PH1A 1R9TH 1A63A 5M3MG 1YJ9A 3RLOA 1X65A 1HNWL 3E9HA 1HZCA 3PUXA 3HOVG 1EFWA 5C44H 4GNXB 2CWAA 4YHHQ 1SFOH 1I50H 4OO1G 2K5HA 4YHHL 1FGUA 3U58A 2ASBA 1VQCA 4Y7NH 1K9MC 1YHBA 4C2MH 1PV4A 2ES2A 3G4SA 1HZBA 1PHJA 1VCIA 1VS0A 1IYJB 3J7A5 5M5XH 3E0EA 3CCSA 4X66Q 1BVSA 1HZ9A 1ASZA 1Q12A 3K7UC 1Y14B 2RCNA 3CQZH 3STBD 2WP8J 4A3FG 2MO0A 5IP9H 4DV0L 1M90C 4NXNQ 4BA2I 3AQQA 2A19A 5FJ8G 3HOWG 4DR7L 2K52A 1IBKL 1X6OA 2B3GA 4EX5A 4QL5A 1Y1VG 2VZAA 3S2HH 2A1AA 3T1HQ 3A5ZB 2JEBI 1MJEA 1X9NA 4C3JH 2ZJQA 1MKHA 3GTMH 5BR8L 1N34L 1PH8A 2OQKA 3J80c 2IHFA 5IYCH 1IBMQ 1I3QH 4JOIC
chains in the Genus database with same CATH superfamily
2F0PA 1RHPA 1K8GA 3GO5A 5KNDA 1I4HA 2HT1A 2F0SA 4DV5Q 2JEAI 3CCJA 1OXTA 4LF8L 4DAPA 3U50C 3KJOA 1XX8A 4FVMA 1GO3E 1CA6A 2V1CC 4M8AA 3S1RB 3G48A 4IJLA 2DGYA 3S17B 3A7AB 2J7ZA 2NZ1D 3C1FA 3TP8A 4RAUC 3TRZA 1I6VC 1NMFA 3UDGA 2GVAA 5K36H 1YHQA 2ZXOA 4JI5L 1CK1A 5C3WA 4A3LG 4KHPL 4YWKA 4DNIA 2X6LA 3CF5A 2BE5D 3IFTA 2XWBB 1BCPF 1XWEA 1E1OA 3A74A 5M3FB 5IYDH 2KEEA 4G7ZC 2HDMA 1ENAA 3J7YW 1TIID 1XNQQ 1Q1EA 4L63B 5EBCA 4KI0A 3GTGB 1Q81C 2Z8LA 1O7IA 4XIGS 2CQOA 3UDXA 1XXGA 3TREA 4A3EG 1GM5A 2ZM6Q 2A8VA 2IY5B 1G2SA 3N6RA 1RTNA 4DK0A 1SMXA 1N32Q 2GA4B 1L2FA 3SK4A 5C4HA 4XYQA 4IQZA 1VQLA 2DY8A 4B3SQ 3E6ZX 1EIGA 3HKZE 2B2YC 3TP7A 1Z6HA 1JT8A 4DNRB 3S15H 1XNQL 4A3JH 3HOUH 3ER0A 4ULLA 2K05A 4JI0L 3NBHB 3CRKC 5AJ3L 3CW2C 4HJ7A 2HHHQ 1CZGA 1EQRA 2A6EC 5M5YH 2DJFC 4N8X1 3ULPA 5C4XB 5IP9G 4OWTB 4KN4C 1PMRA 3LWEA 4C56C 1KHIA 2ATWA 4AYBB 3OMGA 4BXXH 3U4ZA 4MHEA 3TN2A 1C48A 3PUZA 5LMNL 2TSSA 1FD7D 1TWHB 2CKZB 4GN4B 3HKSA 3AEVA 1UUPA 2XTIA 4ME3A 1KXLA 4C3IG 5IGDA 2B63B 1Z47A 1PZJD 2C35B 1X54A 3HRZC 3BZDB 4LF4Q 1XTDA 4DV3L 4IN3A 3Q24A 1XMQQ 2CWPA 2YV5A 1JMCA 3PGZA 3S24A 4LF5Q 3K58A 1D1KA 1DOLA 2EIFA 2Q8RE 1MBYA 3MVVA 3VR3A 2VQEL 1CQFA 3T1YL 2UXDQ 1PZKD 4KY7A 4QIWE 4XTCS 3AU7A 4PMWA 2EYLA 1PFMA 1CUKA 2MGSA 2YU9H 1D5XC 4OX9L 1DOKA 3V96A 3H0GG 3PIOA 4DR2L 5CV4A 4C3IB 5M5XB 1TY2A 2NVYH 4KJNA 4ZKBB 1EWHA 2R92H 2KVMA 3H91A 3TSSA 2D5DA 1KLGD 2K5VA 1MI2A 3DWPA 4X62Q 4RHSA 3NELA 4X6AH 4JV5Q 1FJGQ 4DR5Q 2BH2A 4A3EH 4CHTB 3P1HA 3OW7A 4QUCA 2L11A 3M4YA 2HQEA 4HSPA 1BOSA 3CMEA 1SAPA 4DAVA 3Q22A 4OO1H 1JOKA 4DR1L 1E2ZA 1EYDA 4BA1I 1B50A 1SNPA 4C3HG 5C0XJ 5C0XI 4A75A 1MD2D 3S17H 2MQHA 4P72A 3ERSX 3I72A 2UXBL 1TS3A 1EY6A 3V2TA 4A3FH 2A73B 1UEBA 4LFBQ 1HZAA 2K4KA 1K8AC 2XN9C 3BG3A 3D4WA 1E2WA 3PO3B 4QCLA 3J81c 1SLJA 1JWSD 1TY0A 2K33A 4OWWB 1ET9A 3IL8A 2D0OA 5IYCG 4PZ7A 4X62L 4Y52H 2MNAA 4RGNA 1BUVT 1HA5A 1DM0B 1SJED 3M4OB 2Z0SA 1S72A 4N9TA 4LMQD 1VF5C 4JI1Q 1K0RA 4ILWA 4DU9A 1SYFA 3OOCA 2YTVA 1Q46A 4ME5A 3NTIA 4NPSA 1AE2A 1PH7A 1SNOA 1RODA 2L4NA 4IPGA 2JA7H 2CH4A 4BY1H 1GUOA 2AMCB 1TU2B 4DA2A 1W2BA 1TWAB 3MA2B 1UWVA 1DOMA 4XQNA 1I4PA 2XWJB 3I4NG 3S16H 1YNXA 4B3MQ 4DGZA 2XVSA 5E4WC 2WKDA 1TWCB 1BCPB 2R7FA 1OXSC 4JK1C 4BBSG 4K0KQ 1XMQL 3M9BA 3TQYA 5HY6A 4JYAQ 2CH4W 1BNZA 1E1TA 3CPWA 1GVPA 1ESFA 1SJHD 4A3KH 5IP7G 4O1NA 1U5KA 2A6HC 4DV7L 2FXQA 4IFDJ 1F2LA 3W2DA 5CYUA 1P8LA 3PQIA 1A6XA 4K8JA 1X55A 3CCEA 4Q0FA 5D3IB 4IO9A 4K5XA 2F03A 5E3FA 2JA9A 4HMIA 1HNZL 2KOLA 3URYA 5DLQE 4A3CH 2N49A 4QF4A 3MWYW 2AUJD 2H1EA 4CDDC 4RHRA 2R6GA 1VMPA 2K5DA 1XPOA 1VQBA 2XRQD 1VQ4A 1NBWA 5KEEA 2EXZA 2F0DA 1YI2A 1QJOA 3BZCA 2X6GA 3K57A 3OYYA 4O2DA 1VF7A 5KYLA 4A3JB 1J5EQ 3F2BA 3MC0B 1GUNA 1N36Q 1SDFA 4OO1I 1PYSB 1PFSA 3DLLA 2R7ZB 4I7AA 1GUWA 3S14H 3K5OA 3VA5A 1N9WA 1JOOA 3D4RA 3T56B 2UUBL 3SK8A 3Q8DA 1YJNA 5M3MB 2PZTA 3VYSA 3VR4A 2KA7A 1QZHA 4R4IA 3TP6A 4MTKA 1X3QA 2EYFA 2NUCA 2H5XA 2IL8A 4UHVA 4JI3Q 4A3BH 3DEPA 1TS5A 4H44C 1I4XA 5C44B 3RD4A 4MIUA 1C0AA 4B9WA 2JA7G 4KHVA 1D8LA 4P75A 4UP9A 3K6OA 3U9OA 1BO0A 5I6WA 1IL2A 2WB1E 5E4XA 1WJJA 1S5DD 3NQTA 1YNND 2IPKD 2SNSA 1KL9A 1W3SA 2M2LA 5GAGC 1XNRL 3H3VI 2K6AA 3BS1A 4IJHA 3PUYA 5ELOA 3FDTA 4RG1A 4IUUA 2Q2IA 5JVG3 4A76A 1NR4A 2Y0SB 1KD1C 3GTLH 1KRTA 1QE6A 2K7VA 4K0KL 2LXKA 4L8JA 4HJ5A 2PNHA 2O5JC 1B53A 1WTXA 2R93H 4YY3L 5D14A 4A3KG 1NJIC 4QJFA 1VQ8A 1W6JA 1NE3A 2EE1A 2NVXH 1IZ6A 1O7LA 1EZ6A 1EY9A 1TS4A 4RGOS 5LMNQ 2PW7A 4HCEA 2EY2A 2NYZD 3WOEA 3I55A 1TWAH 1GUGA 1PLFA 1VQ6A 2NVTB 4I7ZC 3CCLA 4HJAA 4LF9L 3NQIA 4A3CG 3KF8A 2L0CA 1QB5D 5IYBG 3E9HA 1SBBB 3PUXA 1RDPD 1B9MA 1SFOH 1D5MC 4RFBA 3WOFA 1ENCA 2BE5C 3R3OA 2F0WA 1QNKA 4OIKA 1K9MC 4C2MH 4ABNA 1PV4A 3NWSA 1PHJA 1CHPD 5C5MA 2B2TA 3CCSA 1BVSA 1RKNA 1ZXTA 3K7UC 1Y14B 1MSGA 2RDGA 4DV0L 3AQQA 2D9UA 1X6OA 2B3GA 4CKBA 3FKIB 5JAVA 3GTMH 1B9NA 1N34L 1U4MA 3J80c 1Y8PB 4V0BA 1I3QH 4JOIC 1S5BD 1HA6A 3TMEA 3NBIA 1JJ2A 1PXUA 4IPHA 2F1MA 2PZWA 5J3BA 3MEHA 1AW7A 4A3DG 1ILPA 1MGSA 4JBWA 2G9HD 3EIVA 4XXEA 3CMAA 3RLNA 5KNBA 2VQFL 2BA0A 3HS0C 3A54A 3CAMA 2EYOA 1IBLQ 1Y1WG 1JWMD 4H02A 4A3IH 1CZWA 1D7QA 4GOPB 1LTID 3CPFA 4DXFA 1YIJA 1TQOA 4RKLA 4B3TQ 4LUVA 1B8AA 2AQ3B 4EQ5A 2JA5B 3S2DH 5E1FA 5JVH3 1HNWQ 2UUCQ 3PV0A 5G3LF 1HUMA 3BDOA 4KHZA 4S3SA 1IYVA 4DV0Q 5JJKA 4RA8A 5IE8A 3CCQA 2ZJPA 4ODGA 2V4DA 1PZID 3SDZA 4X64Q 3MFYA 3S15B 5JJIA 1K83H 3KJPA 2L5TA 2HIXA 1VQEA 5IYBH 3HOXH 4DUYQ 4KKSA 2QW7A 2K04A 3ERQA 2F0UA 3NXWA 2RSOA 3SHLA 4X3UA 1J5EL 3GTPB 5EPLA 2E75C 5KYIA 5ELNA 2F4VL 3G6EA 2KENA 4YWLA 4GKJQ 1VQFA 5EJWA 5LMUQ 3BU2A 2VQEQ 3TS2A 4FF3A 1H9SA 2L9HA 5DEHA 4KD4A 4CDFC 4FF1A 1HRJA 5EGTA 5FLXL 4FF4A 1I6HH 2F0FA 3ZJYC 1TWHH 3F2CA 2N8NA 3KDFB 1ML0D 4DF7A 4DV5L 2R93B 4LK1C 1EUJA 3J80E 1X3EA 1H9KA 5FO8B 3EFXD 1QVFA 3I7FA 3J81j 2UUCL 1SYDA 3Q0AA 2AQ1B 2RVLA 1TWFH 1EEFD 1K0SA 1H9MA 1CKMA 2E5LL 1TVXA 3DUZA 2NZOA 3EQLC 4GKKQ 2VUMH 4RMFA 2ZXPA 4KD3A 1QOHA 2PQAB 2F0IA 3O13A 4L5TA 1OXXK 1O7YA 3CU7A 1S40A 4JI4L 4A93H 1SE4A 1WYDA 3KF6A 1L1OA 3MXNA 3HOUB 2K01A 2SNMA 2ZTDA 3C2PA 5H1SE 1SRUA 4DK1A 4B3RQ 5CV7A 2NZHA 3WDNA 4XQJA 1I50B 1EFID 4KMUC 1BKBA 3FVQA 3D4DA 2FMMA 1PFBA 2OWOA 4ZCKA 5JOBA 5G3LD 2JA8B 4J6HA 2RF4A 4ID6A 4PQXA 1LTLA 4DV2L 2AWOA 4LUZA 1B7YB 1UE6A 2L55A 1K73C 4JI2L 1L0YB 4N9PA 3E9IA 2JE6I 1B3AA 1TXYA 1TWFB 2F0MA 3PO3G 5FLMG 1AH9A 4CJ2C 4LF7L 2UUAQ 3HOXG 3OW2A 4R4TA 1M1KC 5GADC 4GOPC 5K5PA 4DR6Q 5EPJA 3I4MG 3M85A 4DV4L 1PH5A 3ICEA 2ZT9C 2EYHA 4EGVA 1KABA 3HKZB 3FRPB 3CD6A 2SDFA 1FGBD 5CC4A 4WORA 1IBML 1DCZA 5IWAL 2KCMA 4XDXA 5CV5A 5JEAJ 1AFPA 1HXYD 5BN5A 1Y8NB 4QMGA 2WINB 5BN4A 4DAYA 4XT1B 3HOWH 2UU9Q 4RCOA 2DY7A 3H3VH 2K50A 4POGA 3ND9A 5EKKA 4DV3Q 2WB1G 4X3TA 4DK3C 1SROA 1PFNA 2EY6A 2WAQE 2LFNA 1T9HA 4ZUJA 1BR9A 2VUMB 1HR0W 2DJGC 4R1JA 4U673 1TWGH 4BBRG 3HKZG 4WJWA 2D62A 3NPPA 4GZYC 3VR6A 2CHBD 4POFA 1IYUA 5IWAQ 4OX9Q 4DR3L 3GTOH 3PUVA 3HFZB 1IW7D 5ELFA 5C0XG 2YTYA 2M00A 4BY1B 3V05A 5K36G 3J80L 1BBUA 1Y1VH 1HQRD 1PRTF 1HR0Q 1A2TA 2K03A 1WVLA 1AE3A 2L15A 2WB1B 3T53B 4NDXA 3GTKH 3C1EA 5BR8Q 2UXCQ 2IX0A 1HH2P 3NHHA 4IPDA 1RL2A 5HGQA 5IYDG 3J7AF 1SE8A 4IFDI 3UE1A 3K8AA 4CDEC 1YBYA 4K14A 2WV6D 2NN6I 4JI7Q 5C4ZA 4A3MH 1ESRA 2OCEA 3BZKA 4DR4L 1VDZA 3HOYG 5FLMH 3S1MB 1LTBD 1LO5D 3GDEA 3QOJA 2UXBQ 1J8IA 3Q23A 1G291 2TMPA 4YCWA 1K3RA 1CM9A 4A3JG 1VQ5A 3M7GA 1L1OB 3MXNB 5JPMC 1ZYRD 2OTLA 4P74A 4TRDA 3IKJA 2A69D 3H94A 2SOBA 1A2UA 1STNA 4DKAC 1LV9A 5KRUA 2Q2TA 1JC7A 3JAME 4DV6L 4XT3B 3KBGA 1KRSA 2LMCB 2NVYB 4A3KB 4R4CA 3QJYA 4MN3A 2ICEC 1KDAA 4BXXG 1L0XB 1WTRA 4JC0A 1WTOA 1SSOA 1I3QB 3CHBD 5C44G 4HIOA 2QF7A 4DR1Q 3S1RH 1GKHA 1Q86C 4LF9Q 1ONLA 1DZ1A 2BA1A 4YWMA 3I91A 5FLXc 3A55A 2R92B 1SNQA 4BBRH 1A62A 1F9SA 2QDBA 5NUCA 4G7OC 1E0BA 2N78A 4NXMQ 4CKEA 1II3A 3EBEA 1NSNS 2BDNA 5EQ0A 3FMCA 3TDQA 5GAHC 2G5DA 2HCCA 1QVCA 3M4PA 1MJCA 4TVAB 2EOTA 5FO7B 3M3YH 1QG7A 2OQ0A 3QO2A 1EQVA 4PMCA 2EJGC 2E2IH 3RZDH 1HJPA 1VQPA 1UAPA 3H0GH 3SVMA 4OL7A 1WFQA 3ULJA 1BBXC 3M3YB 1OXVA 1K3BC 2F0EA 2J4XA 2R92G 1G6ZA 2PI2A 5C3EH 1AP0A 4KHPQ 1YVCA 3SK5A 1ZKOA 3BVGA 1FVIA 5EKLA 4LWCA 2VXWA 4WJ4A 4ZK9B 4LNQA 2NWGA 1CI3M 4A3MG 1H95A 1WTPA 1SYGA 1Y8OB 4JBKA 2B63G 3DM3A 5CBAE 1H9RA 1V8QA 4N8FA 3CXCA 1QVGA 3H09A 3RN5A 3PO2G 1K8OA 3FEWX 3VYRA 3HOVB 5CORA 1LM0A 4DUYL 3HZXA 3NTKA 1YHAA 2JJQA 1G51A 1LTSD 3KK7A 3R93A 3TBIB 5AJ3Q 1HR0L 4YCUA 3NTHA 2A68C 4MNOA 1BQQT 1F2YA 1SNDA 3ONAB 4C3HH 4GLXA 4UPAA 4JI3L 2ZJRA 2JP1A 4DN4M 4HIKA 1WTWA 1PTOB 3TEHB 1XJVA 5C6AA 1EY7A 3EJIA 1I6HB 3L9AX 3SR1A 2B39A 2A5HA 4DUZQ 4PG3A 3MAQA 2MPMA 3KF8B 4APVA 2FFKB 1IBKQ 2EY1A 3D3RA 3LX0A 1AZQA 1YJ9A 1V1PA 3RLOA 1HNWL 1HZCA 1PDQA 1RD9D 3HOVG 5C44H 3K5NA 4GNXB 1KNAA 2CWAA 1EQTA 1ET6A 5JJZA 4YHHL 3GTOB 2N55A 1YHBA 4IUQA 1HZBA 2JXMB 4TKOB 3J7A5 2K32A 3E0EA 3C3LA 1MSHA 2EJMA 2K5QA 1ASZA 1KLUD 1D2BA 3FPPA 5TSSA 2RCNA 4BA2I 3OIPA 2UXCL 2NTTA 4NXNQ 1IBKL 2A1AA 2KEDA 1MJEA 2EPBA 1X9NA 2EJFC 2ZJQA 1MKHA 5BR8L 3A7LA 4RH6A 4HEDA 2F0HA 2K5NA 4RWSC 3E0JA 4P73A 4DV1L 3H3VC 1J6QA 1WCMG 3TP5A 3PIP3 3S1NH 4WFN3 3UDFA 3VDYA 4R8NA 1CQVA 4UDUC 4A3IB 4KTAA 1BDOA 3T51B 1QUQB 1G6PA 3I4NH 5C3EG 4DUZL 2Z9HA 3UDIA 2IX3A 3EA6A 4HIMA 4DFAA 2F0KA 4GN5A 4OWXB 4A3FB 2ZTEA 4X3KA 2WAQG 1F77A 1MIUA 4LUOA 4FXGC 2NVQH 1CSQA 1KAWA 5IIFA 5EAYA 1U4PA 4LF8Q 4EVOA 1BBWA 3I4MB 3RZOH 2A74C 3RLFA 1G2TA 4H13C 4JPBW 5IP7H 3GD7A 2ID0A 1VQAA 4LFAQ 3KUPA 1ICWA 4JG2A 3OWEB 1BCPD 3UE0A 4DR6L 1CT1D 3KBXA 3FKIH 4JI4Q 4EQOA 2SEBD 1YJWA 2VNUD 2R3ZA 5GQOA 1S5CD 1EY0A 3A0JA 5LL6X 4JV5L 2EQSA 3PIPA 2ICIA 2Z6KA 4CJ0B 2R61A 4IFDH 4Y7NB 3I56A 1GOZA 4C2MB 4X64L 3GP7A 1GUSA 3KLWA 3PSIA 1PVOA 4AIMA 1AEXA 2RHSB 4F88A 1N33L 2Z4IA 3PUWA 2K75A 5GAEC 2RQXA 4A93B 2D2CC 3HOVH 5GROA 3SK6A 3SE0A 1VQ9A 2O5IC 4XYOA 3A8JE 1E7ZA 4FP5D 1NAPA 1QNUA 3I3CA 4OEMB 1PTOF 4B9XA 1ZEQX 4NKLA 3BVMA 2PO4A 1LYLA 5D3DA 2N88A 3U9SA 4B3TL 4JI6L 2EY5A 2AKWB 4PV1C 3NSWA 4WRDA 1B4OA 1FR3A 2E2HH 4LF5L 3RNUA 1H9JA 3M4QA 4B3SL 1UE7A 4JI8L 2O4XA 3CCUA 2OEOA 5JJLA 3FHWA 3F2DA 3GTQB 4A3BG 3W1GA 4BY7B 4GNXA 1G91A 4GS3A 2IJ0A 2Q8TA 5IODA 2JA6G 1HFGA 1IHZA 2EYJA 2RSNA 3MTSA 2HHHL 1V9PA 1SEBD 1AZPA 2ZM6L 4TSSA 1V1OA 4GKKL 2HCIA 1X56A 4Z9CB 3DEOA 3GTLB 3SEBA 3DHQA 1YITA 3CCVA 1P16A 4HN7A 2RCFA 3VYTA 2N3SA 1STEA 2MO1A 2KHSA 4DPGA 4FXKC 4GN3B 4QY7A 2K28A 1E3PA 4L5SA 4R4OA 1T5XD 3FPUB 2J0TD 2BOSA 2KHJA 3WWVA 1B44D 3S1MH 1I94Q 1STYA 1VQIA 3RN2A 3NE5B 1KAAA 5I6YA 1PA6A 4AQYQ 1GD7A 2F4IA 2KBNA 3L3OC 4LFAL 1Q1BA 3W3AA 2R7DA 2CFMA 1VQOA 3PF5A 1Q7YC 1L0WA 4J8QA 2JA7B 3PMFA 4AH6A 3W1BA 3R2IA 4ZRZA 1DXMA 1JCKB 4K2LA 4GKJL 5HURA 5T1IA 1TS2A 2E5LQ 1F9RA 4LF4L 1VQMA 1C7YA 1PH9A 4JOIA 2A6ED 4JI1L 5HGTA 1U4LA 1S4ZA 4K2KA 2DNEA 1FNUA 2A6HD 2KCNA 3NEMA 2FINB 2JN4A 2NB0A 1YZ6A 3I4NB 3Q6SA 1GXDC 5ELDA 4JBJA 1F2ZA 3VYUA 5EPKA 2OXPA 1L1OC 2E2HB 1ICFB 5M3FG 5CV9A 3ITPA 5LHY1 4P71A 3GTJB 1QCBD 2EVBA 3HOZG 5FLXE 5BN3A 3T1YQ 2UXDL 3F8TA 5KNCA 4BY7H 2WACA 3BDCA 2PCFB 2UU9L 1SNCA 2Q8IB 3ZYYX 5IGCA 4DV1Q 2KHIA 4HR7B 3QWNA 4FF2A 4PZ8A 4K5VA 1R4PB 3A5UA 2F52A 2QKIC 2NVTH 4EQNA 1K8MA 2FJ2A 1GHJA 1Y1WB 4AYBE 4LFBL 1NCVA 1H9SB 4KV6A 2RBMA 3G71A 1M8AA 2RA4A 2PZUA 2Y0SG 5KIXA 4QQBX 2E2JB 4FNFA 1ZYRC 3RR5A 3D6WA 4QUFA 4CDCC 1Q3LA 3PO2B 5FJ8H 2A69C 2EXDA 3JAML 5DNFA 5CV8A 1TWCH 3K80C 1CKOA 3SXHA 1NTGA 3B6YA 2QGQA 5EKIA 4DV2Q 1XNRQ 5M5YB 1C9OA 1V1QA 4AYBG 1N34Q 2LSSA 1EU3A 1R9TB 1I94L 4C3JB 1UE1A 3N52A 1JJGA 5M5WH 4LW1A 1VQHA 1PYWD 2FHTA 4DAMA 2IHEA 3J7AV 1PTOC 1PTOH 3NUCA 3G7LA 4OGQC 1JQYD 1WD0A 2QCPX 5CBEE 2I5LX 3KLRA 3RMHA 3PIO3 4HMJA 2C9OA 2E76C 2PI2E 4JW0A 4MZ9A 4A3LH 5LMNW 1LT3D 4JBMA 3CP0A 1X3PA 1F9PA 1KDCA 2NN6G 2L12A 1WTHA 1TT2A 2X69A 1CFMA 3BDLA 3JC66 1Z9FA 3AFPA 3KF6B 5J1ZA 4BS9A 4CBVA 2HQLA 1X32A 3S1NB 1X3GA 2CQAA 5M3FH 4A3MB 2PW5A 4UAIA 2VL6A 5C5LA 1F2MA 3JAMc 1D6EC 3GTQH 3HOZH 1LT4D 2AHOB 3RZDB 5IOCA 1JB7A 4OELB 1QWYA 2IT1A 1XTCD 5D65A 3OTOQ 2B29A 1D1IA 1VQNA 1NR2A 3F2UA 2QDLA 2PMZB 4ALPA 1B70B 2JQOA 1B1ZA 1E2VA 1C8CA 4K6LA 4J15A 3I8ZA 4JI0Q 4A3DB 1NNXA 1VQGA 1PH4A 2JK8A 4FO2A 4K6DA 4A3EB 1G8ZD 1SNMA 3I2ZA 3TS0A 3D0FA 3K0YA 3R8BA 3T16A 1PH3A 3HOUG 2F4VQ 2XRSD 2VS1A 5DAUA 4KJOA 3P75A 2F3WA 4LJZC 1OTCA 1Q90A 1EY8A 4KY5A 4NXML 5IY0A 5EBDA 5IGGA 3KYHC 1XYIA 3K7AH 4DV7Q 4UP7A 4Q5VA 3NENA 3CRLC 1HHVA 5CMDA 4A3GH 4X65Q 1O78A 2QA4A 1MHWC 1CA5A 3TZDA 4C3IH 1NUCA 2IX1A 3OIQA 1RCVD 4V190 2BCOA 3S2DB 1U0LA 3S1QB 1D5ZC 1YNJC 5E7NA 5LL6S 3LWUA 3DXJC 2KQ3A 3PO3H 3BVZA 1YNNC 3DWAA 3K5MA 1HNXL 3X3MA 3MFGA 3AFQA 1N32L 4IUPA 4KKUA 2FMCA 2NN6H 4DV6Q 4GNXC 1LTGD 1PH2A 2I5MX 3I4MH 3CKIB 5DM63 3RZOB 4DR7Q 5C3EB 4NXNL 3M7NA 3S2HB 3A56A 2A68D 1WOCA 1W6KA 2WAQB 1WI5A 1SMYD 2B2VC 2ALYB 1PYBA 5FO9B 1VQKA 2RHQB 1HTLD 3I70A 3DM1A 1Y1VB 1Q8IA 4A4IA 3C46A 4UY8C 1PH1A 4DK6C 1EZ8A 5L37A 1R9TH 1UNSA 1YNJD 2P5ZX 4BBSB 4YHHQ 1I50H 1LACA 2BDOA 2OF1A 4OO1G 5JEAH 2ENBA 2K5HA 1STAA 1FGUA 3UI2A 1LT6D 2ASBA 3AB9A 3LNNA 2B8FA 3K59A 3IAYA 2ES2A 3G4SA 1IYJB 4IURA 2OT2A 4X66Q 1EL0A 1HZ9A 5C0XH 4A3FG 2WP8J 1OO9B 2F0VA 1C4QA 2A19A 4DR7L 1Y1VG 2VZAA 3DMUA 3I4LA 4C3HB 1DD2A 2HUGA 2JEBI 4C3JH 3GV6A 1PH8A 2IHFA 5IYCH 1IBMQ 3E5SA 2H4OA 4HIDA 4A3GG 2WKCA 1DYQA 1HFNA 4F8MA 2IW3A 5IGBA 3L0OA 3P20A 5CR3A 1QUQA 1K28A 1ASYA 2B2WC 1LTAD 5I9PA 2AUKA 3R2TA 3T13A 2K5WA 4LAAA 4IOAA 4A3BB 4TQUS 1PRTD 4OXPA 4ZYSA 3HOYH 2Z4HA 1STGA 1EIFA 1SR3A 1ENFA 4F7XA 2RKSA 4DV4Q 1JORA 1EYGA 4X66L 4L5RC 2XNAC 2HIVA 2B2TC 1S3OA 4BY1G 1KC8C 1E24A 4H7BA 5AFWA 3KDFA 1LLRD 2DUDA 2B8GA 3OTOL 5C4JH 2IWHA 3HEJA 4QIWB 4BWGB 2KUMA 1N8RC 1NMGA 3MXUA 3CC4A 1HQMC 1VQDA 1EY4A 3KLSX 3EN2A 1GUTA 1T5EA 5J39A 3D31A 4ZUIA 1SYCA 4IALA 1BXTA 5I2XA 3T4AC 2CW0D 4LFCL 4BBSH 4K8IA 2XSCA 1WD1A 4AQYL 2E2IB 2UUAL 2K14A 3J81L 1PRTB 1HNXQ 4BBRB 2E8GA 2LS01 1FJGL 3NP8A 1WTQA 1RJTA 1N36L 5JEAG 1A3TA 1AN8A 2LKVA 2YYZA 3HOYB 2WFWA 2VQFQ 1CTMA 5IT9c 2UUBQ 1V43A 4IUTA 1KDBA 1A3UA 2Z1CA 3MXPA 2NVXB 4IOCA 3FP9A 4G57A 5FKAC 4FXDA 1DGSA 4LFCQ 1FYCA 2F0JA 1EOVA 4ZAIA 4WJ3M 4IUVA 1R4QB 4DR2Q 2DN8A 4JI8Q 4J1MA 2VB3X 4C3JG 1CSPA 1HTPA 1EWIA 1S5FD 3QG1A 3K81C 1O80A 4IPCA 3J80i 2CCZA 5I9OA 1GJXA 3S1QH 2F3IA 4MTNA 1XPUA 5T1GA 1PTOD 2QEJC 3HG9A 2NTSA 3GV3A 3HOZB 4X3SA 1JOQA 2B2VA 1EU4A 2F0NA 1DONA 3K5LA 2DNCA 3QR8A 4PMBA 2PMZE 4UP8A 4NW2A 3GTMB 4LF6L 2C5CA 2CVRA 2B63H 2B2YA 1IKLA 5KGUA 1I5FA 5LMUL 2F0GA 3K7AB 4RKBA 1XPRA 3PO2H 1OXUA 3HOWB 3OSOA 1CKNA 2R7ZG 3KFUA 1S5ED 2VB2X 1KIXA 4H0LC 3VR2A 1IKMA 2EYMA 4YCVA 1N33Q 1FNVA 5IT9L 1IXRA 1PH6A 2MUYA 1JICA 3STBC 1NY4A 5A35A 2B2UA 3KOJA 3GTPH 3S14B 3T1HL 2HDLA 3GTKB 1B3QA 2KECA 1YEZA 1WTVA 2M9VA 3U4VA 5C4XG 2G9DA 3D8GA 2R93G 5ELBA 4DR3Q 2I46A 3S9WA 4F87A 2Q2HA 1JE5A 2QEXA 1TR5A 5IGFA 4B3ML 1A8VA 3I90A 1KTKA 5IT9E 1JB3A 1LT5D 1HPCA 5C4JB 2E2JH 5ISRA 2B2WA 5J22A 3BYTB 2JA5G 2AWNA 4GLAC 1Q82C 2YTXA 1UE5A 1XMOL 2I0QA 4EQPA 3L7ZC 3QB3A 1QILA 1VQJA 4KKTA 3X3NA 3CCRA 4C1NK 5F2DA 3VR5A 1SXTA 2JSOA 4KLKA 4M1UB 1E22A 1STHA 3QIAA 1VMCA 1SYEA 4JI2Q 4DAYB 2PPBC 1WCMH 3P7JA 5C3XA 4OIJA 1K83B 3LGJA 1IBLL 4JVZA 2E2DC 4LF7Q 4KK7A 2PNRC 3H0GB 3GQBA 3MHBA 1XMOQ 1CKNB 1JJCB 1HUNA 2JA8G 2Z6KC 2QILA 1EQQA 3S16B 1LTRD 2JYOA 4CKCA 3CC7A 4HTHA 1LABA 1RIPA 2F0LA 2HD3A 5M5WB 1EIYB 5A2QL 2F3VA 2Y0SE 1JR0D 1RF2D 4P2CB 1EY5A 2R7ZH 3QOLA 3TZUA 1U4RA 4HJ9A 4IUNA 3RUZA 1SFOB 3PF4A 3HOXB 2RDHA 1KNEA 1ILQA 1SN8A 4RCNA 1HCZA 3IRBA 3OHXC 4PNYA 3A8IE 3FKIG 1EOTA 1I4GA 4A3DH 3J81E 3BYYB 1FL0A 3H15A 1TWGB 3IFDA 4DXGA 1GHKA 2MFIA 1IL8A 1I4QA 1WCMB 2BH8A 4IFDG 4X65L 1Y1WH 1TKWB 1Y69U 4A3IG 2KCTA 1M4VA 2RDFA 5C4XH 1Q8KA 1J9OA 2NBFA 3MXGA 2F0OA 3MZ5A 4NP5A 4HJ8A 4R8IA 4B3RL 2KJXA 1O7ZA 4R9WA 3OWFA 4OHJA 2XGTA 4PZ6A 2I07B 3DWQA 3JAMi 1EIHA 1SE3A 4YY3Q 3I73A 3NBHA 1A3VA 2JA5H 2PYKA 2WIIB 1A15A 2D0PA 3HGBA 2GVBA 2JA6B 2EZVA 4NMZA 3CCMA 2CW0C 4QGUA 1EWCA 1UEAB 4RGMA 4JI6Q 3D6CA 2ZTCA 1X3FA 2F0QA 3VA7A 2LXJA 2AQ2B 1FNWA 5M3MH 1IW7C 2Q2UA 4JCVE 3H6MA 1U9RA 3HP3A 3CC2A 2JA6H 5FOBB 3ULLA 1EEID 3AMUA 3E3XA 3L2PA 4LF6Q 1KQSA 4L6TB 4FDBA 3G6JB 2B2UC 4JYAL 1LTTD 3AYHB 4OONA 4U68A 2MP1A 3MEFA 2JA8H 1F9QA 2MHVA 1PRTC 2E74C 4ZKCB 4CGYB 2F0TA 3SGIA 3CQZB 4GOPA 1V1PB 4G4KA 5I2YA 1Z7TA 5CV6A 1SYBA 4QB4A 3OMCA 2EYPA 2MJ8A 3M4OH 3NK9A 5ELEA 4NB3A 3J81i 4O42A 5CGKA 3I4OA 3W5OA 2VW9A 2VUMG 4HSVA 3K0XA 1RTOA 4G7HC 5JPNC 4YIJA 3NWTA 4O0AA 2K1BA 2O2LD 4JI5Q 4A93G 4R4QA 5ELCA 4E6IA 4DR4Q 3BJUA 1SE2A 4L5QA 4A3GB 2GN5A 1A0IA 1JWUD 4IZ8A 4JI7L 3EVQA 2I5HA 3OPOA 1HNZQ 3GTJH 4GLVB 3PCOB 1BCPC 1CHQD 1JE4A 3J7ZC 3F1ZA 1STBA 1B2TA 1QZGA 2PQAA 4HAEA 2OTJA 1VQ7A 4KY6A 3GTGH 4ZQ3A 5M9OA 4BY7G 1I4RA 4FYDA 2VY3A 4ZLTF 1LUZA 1DJRD 3EROA 4DR5L 1A63A 5M3MG 5DM73 1X65A 1EFWA 5COYA 4XQQA 1EYCA 3U58A 3KLSA 1SMYC 4DNTB 1BF4A 1VQCA 2PQEA 4Y7NH 4B08A 2L1BA 2YU9B 2Z6BA 1VCIA 1VS0A 5A2QE 5M5XH 5I4DA 3ND8A 4KN7C 4RGTA 1Q12A 3STBD 3CQZH 2ZXRA 2MO0A 5IP9H 1M90C 5FJ8G 3HOWG 5IGEA 1EYAA 2K52A 2EDGA 4EX5A 4QL5A 2LY7A 3S2HH 3T1HQ 3A5ZB 5FK9C 4K5WA 4HCSA 4I65A 2XIWA 2OQKA 2NVQB 3A8KE 2KCCA 4C1NI 4CJ1B
chains in the Genus database with same CATH topology
2K5NA 1K8GA 1JJ2A 3GO5A 4IPHA 4HIDA 4P73A 4A3GG 4DV1L 2HT1A 4DV5Q 1J6QA 1WCMG 3S1NH 2JEAI 3CCJA 1OXTA 5J3BA 3UDFA 3VDYA 4LF8L 2UXCL 3L0OA 3U50C 3KJOA 1QUQA 1GO3E 1QUQB 4A3DG 3I4NH 4JBWA 3EIVA 1G6PA 2V1CC 5C3EG 4DUZL 1ASYA 3G48A 3CMAA 3RLNA 4IJLA 3UDIA 2DGYA 2VQFL 4HIMA 4GN5A 4OWXB 2BA0A 3TRZA 2ZTEA 4IOAA 2WAQG 1MIUA 3CAMA 1NMFA 3UDGA 2GVAA 4LUOA 1YHQA 1IBLQ 4TQUS 2NVQH 1CSQA 1Y1WG 4OXPA 1KAWA 4JI5L 3HOYH 4H02A 4A3LG 4A3IH 4KHPL 5EAYA 1EIFA 1SR3A 4YWKA 4DNIA 4GOPB 1YIJA 1BBWA 3CPFA 4LF8Q 3RZOH 3RLFA 1D7QA 4DV4Q 3CF5A 1EYGA 4X66L 5IP7H 3GD7A 2ID0A 4L5RC 4B3TQ 2HIVA 1VQAA 4LUVA 1B8AA 4LFAQ 1S3OA 4BY1G 1KC8C 1E24A 4EQ5A 3A74A 1E1OA 4JG2A 3S2DH 3KDFA 2DUDA 5IYDH 3UE0A 3OTOL 5C4JH 4DR6L 1HNWQ 2UUCQ 3PV0A 1XNQQ 1Q1EA 3FKIH 4JI4Q 4KHZA 4KI0A 1N8RC 1NMGA 1YJWA 4DV0Q 1Q81C 3CC4A 2VNUD 5JJKA 5IE8A 1O7IA 4XIGS 1VQDA 5GQOA 2CQOA 3CCQA 3UDXA 3A0JA 2ZJPA 3EN2A 4JV5L 2EQSA 3D31A 3PIPA 3TREA 4A3EG 2Z6KA 1GM5A 2ZM6Q 4X64Q 2A8VA 4BBSH 4LFCL 2IY5B 5JJIA 1K83H 3I56A 1SMXA 3KJPA 4AQYL 1N32Q 1L2FA 4X64L 2UUAL 3KLWA 3PSIA 2HIXA 1PVOA 1VQEA 4AIMA 2RHSB 5IYBH 3HOXH 4DUYQ 1N33L 2K14A 3PUWA 2K75A 5GAEC 1J5EL 3HOVH 1VQLA 5GROA 4B3SQ 1HNXQ 2E8GA 1FJGL 5ELNA 1VQ9A 2F4VL 3G6EA 3HKZE 2KENA 1N36L 5JEAG 1E7ZA 1JT8A 4YWLA 3S15H 1XNQL 1VQFA 4A3JH 3HOUH 3ER0A 4GKJQ 5LMUQ 2YYZA 3BU2A 2VQEQ 2WFWA 4JI0L 3NBHB 5AJ3L 2VQFQ 3TS2A 3CW2C 5IT9c 1LYLA 2UUBQ 1V43A 4HJ7A 4JI6L 4B3TL 2HHHQ 2AKWB 1EQRA 5M5YH 1I6HH 3ZJYC 4IOCA 1TWHH 3FP9A 3F2CA 3ULPA 2N8NA 2E2HH 4LF5L 1DGSA 3RNUA 4LFCQ 3KDFB 3M4QA 1UE7A 4OWTB 4JI8L 5IP9G 4B3SL 1EOVA 3CCUA 4DV5L 4WJ3M 1EUJA 4DR2Q 1X3EA 1KHIA 2ATWA 4JI8Q 5JJLA 3FHWA 4BXXH 3U4ZA 3PUZA 3F2DA 4A3BG 1CSPA 3W1GA 5LMNL 4GNXA 1EWIA 4GS3A 3K81C 2JA6G 1QVFA 3I7FA 4IPCA 3J80i 3J81j 2CKZB 2CCZA 2HHHL 1V9PA 3HKSA 4GN4B 2UUCL 3AEVA 2XTIA 4ME3A 3S1QH 2ZM6L 1KXLA 1TWFH 2F3IA 4MTNA 1XPUA 4GKKL 1Z47A 2C35B 1X56A 1CKMA 1X54A 4LF4Q 2E5LL 2NZOA 1XTDA 4GKKQ 4DV3L 2VUMH 4RMFA 1YITA 2CWPA 1XMQQ 2YV5A 3CCVA 2PMZE 2PQAB 3PGZA 4UP8A 4L5TA 1P16A 3S24A 1OXXK 1JMCA 4LF5Q 1S40A 2N3SA 4JI4L 2EIFA 2MO1A 4LF6L 4A93H 1WYDA 3KF6A 1L1OA 2B63H 2VQEL 4DPGA 3T1YL 1I5FA 4GN3B 5LMUL 2ZTDA 2UXDQ 4QY7A 4QIWE 5H1SE 1E3PA 1SRUA 4XTCS 4L5SA 4PMWA 1XPRA 3PO2H 4R4OA 1OXUA 4B3RQ 2NZHA 1CKNA 2R7ZG 3KFUA 2KHJA 3WWVA 1KIXA 3S1MH 1BKBA 1I94Q 1CUKA 2YU9H 1VQIA 2OWOA 4OX9L 3H0GG 3RN2A 4YCVA 3PIOA 4DR2L 1N33Q 1IXRA 2NVYH 1PH6A 1PA6A 3STBC 4AQYQ 2RF4A 1NY4A 2R92H 1GD7A 2KBNA 1LTLA 3KOJA 4DV2L 2AWOA 4LFAL 1Q1BA 4LUZA 1B7YB 2R7DA 2CFMA 3GTPH 1UE6A 1VQOA 1K73C 2K5VA 4X62Q 3T1HL 3PF5A 4JI2L 1Q7YC 1L0WA 3NELA 4X6AH 4AH6A 1FJGQ 4JV5Q 3E9IA 2JE6I 3W1BA 4DR5Q 2BH2A 4A3EH 1YEZA 1TXYA 4GKJL 1AH9A 3PO3G 5FLMG 2E5LQ 4LF4L 4LF7L 3U4VA 1VQMA 1C7YA 1PH9A 2UUAQ 5C4XG 3HOXG 3OW2A 4JOIA 4JI1L 3CMEA 4R4TA 2R93G 4DR3Q 1M1KC 5GADC 4GOPC 2Q2HA 4DR1L 1JE5A 2QEXA 3NEMA 4DR6Q 3I4MG 1YZ6A 3M85A 4DV4L 1PH5A 1A8VA 4B3ML 3ICEA 4JBJA 4BA1I 5C0XJ 5C0XI 4A75A 2E2JH 3S17H 2MQHA 1L1OC 4P72A 5M3FG 2JA5G 3ERSX 3CD6A 2AWNA 4GLAC 1Q82C 2UXBL 2YTXA 4P71A 1IBML 1UE5A 5IWAL 2KCMA 1XMOL 4A3FH 5JEAJ 3HOZG 3T1YQ 2UXDL 3F8TA 2I0QA 1UEBA 3HOWH 4BY7H 3L7ZC 2UU9Q 4LFBQ 1HZAA 1VQJA 2K4KA 3CCRA 1K8AC 2UU9L 3H3VH 3J81c 1SLJA 2K50A 4KLKA 1E22A 4POGA 4OWWB 4DV1Q 2KHIA 5IYCG 2D0OA 4DV3Q 2WB1G 4PZ7A 4DK3C 1SROA 4JI2Q 4DAYB 4X62L 4PZ8A 2WAQE 4Y52H 3A5UA 2F52A 2MNAA 1T9HA 2NVTH 1WCMH 1HR0W 4R1JA 1IBLL 3LGJA 4AYBE 4LFBL 1TWGH 4BBRG 3HKZG 2D62A 4LF7Q 2Z0SA 1S72A 3G71A 4POFA 2Y0SG 4JI1Q 5IWAQ 1XMOQ 1K0RA 4OX9Q 1CKNB 4DR3L 3PUVA 3GTOH 1JJCB 3HFZB 4QQBX 2JA8G 2YTVA 1Q46A 2Z6KC 5C0XG 2YTYA 1EQQA 3RR5A 4NPSA 3CC7A 5K36G 5FJ8H 1AE2A 2EXDA 1RIPA 1PH7A 1BBUA 1EIYB 1Y1VH 2Y0SE 1TWCH 3K80C 1HR0Q 1CKOA 1NTGA 3B6YA 2QGQA 4DV2Q 1AE3A 2L15A 1XNRQ 2R7ZH 4IPGA 1C9OA 4HJ9A 2JA7H 1V1QA 5BR8Q 4AYBG 1N34Q 2LSSA 4BY1H 3GTKH 3PF4A 2UXCQ 2IX0A 1HH2P 1I94L 4IPDA 1RL2A 5HGQA 5IYDG 1UE1A 1SN8A 2AMCB 1JJGA 3IRBA 1SE8A 5M5WH 4LW1A 3FKIG 1W2BA 1VQHA 4IFDI 3UE1A 1UWVA 4DAMA 3K8AA 2IHEA 4A3DH 1YBYA 3I4NG 3S16H 1YNXA 4B3MQ 1FL0A 3H15A 2I5LX 2NN6I 4JI7Q 2R7FA 1OXSC 4A3MH 2MFIA 4BBSG 4IFDG 2BH8A 4K0KQ 2OCEA 3BZKA 1XMQL 3M9BA 4DR4L 4X65L 2PI2E 1Y1WH 4A3LH 3HOYG 4MZ9A 3TQYA 5HY6A 2KCTA 5FLMH 5LMNW 4A3IG 4JYAQ 4JBMA 3CP0A 1E1TA 5C4XH 1GVPA 3CPWA 1Q8KA 4A3KH 3GDEA 2NN6G 2UXBQ 5IP7G 1U5KA 4DV7L 1G291 2FXQA 4YCWA 1K3RA 4HJ8A 4IFDJ 4B3RL 4A3JG 3JC66 1VQ5A 1Z9FA 1P8LA 1L1OB 3AFPA 3KF6B 3MXNB 1X55A 2XGTA 4PZ6A 3CCEA 2OTLA 4P74A 3JAMi 2HQLA 4IO9A 4YY3Q 1X3GA 5M3FH 2JA5H 2D0PA 2GVBA 2VL6A 2JA9A 3JAMc 3GTQH 3HOZH 1HNZL 4DKAC 2AHOB 5DLQE 2Q2TA 3CCMA 4A3CH 1JB7A 2N49A 4QGUA 4DV6L 2IT1A 1KRSA 3OTOQ 4JI6Q 2B29A 4R4CA 1VQNA 2ZTCA 1X3FA 4BXXG 2LXJA 4ALPA 1B70B 2JQOA 5M3MH 4JC0A 2R6GA 2Q2UA 4JCVE 5C44G 4HIOA 4DR1Q 3S1RH 1XPOA 4J15A 1Q86C 1GKHA 3CC2A 1VQBA 1VQ4A 1YI2A 1NBWA 4JI0Q 4LF9Q 2JA6H 3ULLA 1VQGA 3BZCA 3L2PA 3OYYA 1PH4A 2BA1A 2JK8A 4LF6Q 4O2DA 1J5EQ 4YWMA 1KQSA 4FDBA 3I2ZA 3F2BA 3D0FA 3TS0A 5FLXc 1PH3A 3HOUG 4JYAL 2F4VQ 1N36Q 2VS1A 3AYHB 4BBRH 4OO1I 1A62A 1PYSB 4OONA 1PFSA 3DLLA 2N78A 4NXMQ 1OTCA 3S14H 3MEFA 1N9WA 3EBEA 2JA8H 5GAHC 2UUBL 4NXML 3Q8DA 1YJNA 1QVCA 3M4PA 1MJCA 5IY0A 4TVAB 3KYHC 3M3YH 2OQ0A 1QZHA 4R4IA 3SGIA 3K7AH 2E2IH 2H5XA 4JI3Q 3RZDH 4DV7Q 4GOPA 4A3BH 4UP7A 1HJPA 3NENA 1VQPA 1C0AA 4A3GH 2JA7G 4X65Q 3M4OH 3H0GH 1D8LA 4P75A 4UP9A 2QA4A 1IL2A 4NB3A 3J81i 2WB1E 1WFQA 3ULJA 4C3IH 2IX1A 1WJJA 1OXVA 3I4OA 3W5OA 2R92G 2VW9A 1KL9A 1W3SA 5GAGC 1XNRL 3H3VI 2PI2A 5C3EH 4KHPQ 1YVCA 2VUMG 1U0LA 1FVIA 3K0XA 4IJHA 3PUYA 4LWCA 5ELOA 5E7NA 4LNQA 4WJ4A 4RG1A 2Q2IA 4O0AA 4A76A 4A3MG 1KD1C 4JI5Q 3GTLH 1H95A 4A93G 1KRTA 4R4QA 3PO3H 4JBKA 2B63G 4K0KL 3DM3A 1HNXL 4DR4Q 3BJUA 2LXKA 4L5QA 3CXCA 4HJ5A 3AFQA 2PNHA 1QVGA 3RN5A 1N32L 2GN5A 1A0IA 3PO2G 2R93H 4YY3L 4JI7L 4A3KG 4DUYL 1LM0A 1NJIC 4QJFA 4DV6Q 1VQ8A 4GNXC 1YHAA 2JJQA 1G51A 1NE3A 1PH2A 2NVXH 5AJ3Q 2I5HA 1HR0L 2I5MX 1HNZQ 4YCUA 3I4MH 1IZ6A 4MNOA 5LMNQ 4DR7Q 3GTJH 4GLVB 4NXNL 3M7NA 3PCOB 4C3HH 4GLXA 4UPAA 1WOCA 4JI3L 3I55A 3J7ZC 2ZJRA 1TWAH 3F1ZA 1QZGA 2PQAA 4HIKA 1VQ6A 2OTJA 3CCLA 1WI5A 3TEHB 1XJVA 1VQ7A 2ALYB 1PYBA 4HJAA 4LF9L 3GTGH 4DUZQ 1VQKA 4PG3A 2RHQB 4BY7G 4A3CG 2VY3A 3KF8B 4APVA 1LUZA 1IBKQ 4A4IA 4UY8C 5IYBG 4DK6C 4DR5L 1PH1A 1R9TH 1A63A 5M3MG 1YJ9A 3RLOA 1X65A 1HNWL 3E9HA 1HZCA 3PUXA 3HOVG 1EFWA 5C44H 4GNXB 2CWAA 4YHHQ 1SFOH 1I50H 4OO1G 2K5HA 4YHHL 1FGUA 3U58A 2ASBA 1VQCA 4Y7NH 1K9MC 1YHBA 4C2MH 1PV4A 2ES2A 3G4SA 1HZBA 1PHJA 1VCIA 1VS0A 1IYJB 3J7A5 5M5XH 3E0EA 3CCSA 4X66Q 1BVSA 1HZ9A 1ASZA 1Q12A 3K7UC 1Y14B 2RCNA 3CQZH 3STBD 2WP8J 4A3FG 2MO0A 5IP9H 4DV0L 1M90C 4NXNQ 4BA2I 3AQQA 2A19A 5FJ8G 3HOWG 4DR7L 2K52A 1IBKL 1X6OA 2B3GA 4EX5A 4QL5A 1Y1VG 2VZAA 3S2HH 2A1AA 3T1HQ 3A5ZB 2JEBI 1MJEA 1X9NA 4C3JH 2ZJQA 1MKHA 3GTMH 5BR8L 1N34L 1PH8A 2OQKA 3J80c 2IHFA 5IYCH 1IBMQ 1I3QH 4JOIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K5N A;  1K8G A;  1JJ2 A;  3GO5 A;  4IPH A;  4HID A;  4P73 A;  4A3G G;  4DV1 L;  2HT1 A;  4DV5 Q;  1J6Q A;  1WCM G;  3S1N H;  2JEA I;  3CCJ A;  1OXT A;  5J3B A;  3UDF A;  3VDY A;  4LF8 L;  2UXC L;  3L0O A;  3U50 C;  3KJO A;  1QUQ A;  1GO3 E;  1QUQ B;  4A3D G;  3I4N H;  4JBW A;  3EIV A;  1G6P A;  2V1C C;  5C3E G;  4DUZ L;  1ASY A;  3G48 A;  3CMA A;  3RLN A;  4IJL A;  3UDI A;  2DGY A;  2VQF L;  4HIM A;  4GN5 A;  4OWX B;  2BA0 A;  3TRZ A;  2ZTE A;  4IOA A;  2WAQ G;  1MIU A;  3CAM A;  1NMF A;  3UDG A;  2GVA A;  4LUO A;  1YHQ A;  1IBL Q;  4TQU S;  2NVQ H;  1CSQ A;  1Y1W G;  4OXP A;  1KAW A;  4JI5 L;  3HOY H;  4H02 A;  4A3L G;  4A3I H;  4KHP L;  5EAY A;  1EIF A;  1SR3 A;  4YWK A;  4DNI A;  4GOP B;  1YIJ A;  1BBW A;  3CPF A;  4LF8 Q;  3RZO H;  3RLF A;  1D7Q A;  4DV4 Q;  3CF5 A;  1EYG A;  4X66 L;  5IP7 H;  3GD7 A;  2ID0 A;  4L5R C;  4B3T Q;  2HIV A;  1VQA A;  4LUV A;  1B8A A;  4LFA Q;  1S3O A;  4BY1 G;  1KC8 C;  1E24 A;  4EQ5 A;  3A74 A;  1E1O A;  4JG2 A;  3S2D H;  3KDF A;  2DUD A;  5IYD H;  3UE0 A;  3OTO L;  5C4J H;  4DR6 L;  1HNW Q;  2UUC Q;  3PV0 A;  1XNQ Q;  1Q1E A;  3FKI H;  4JI4 Q;  4KHZ A;  4KI0 A;  1N8R C;  1NMG A;  1YJW A;  4DV0 Q;  1Q81 C;  3CC4 A;  2VNU D;  5JJK A;  5IE8 A;  1O7I A;  4XIG S;  1VQD A;  5GQO A;  2CQO A;  3CCQ A;  3UDX A;  3A0J A;  2ZJP A;  3EN2 A;  4JV5 L;  2EQS A;  3D31 A;  3PIP A;  3TRE A;  4A3E G;  2Z6K A;  1GM5 A;  2ZM6 Q;  4X64 Q;  2A8V A;  4BBS H;  4LFC L;  2IY5 B;  5JJI A;  1K83 H;  3I56 A;  1SMX A;  3KJP A;  4AQY L;  1N32 Q;  1L2F A;  4X64 L;  2UUA L;  3KLW A;  3PSI A;  2HIX A;  1PVO A;  1VQE A;  4AIM A;  2RHS B;  5IYB H;  3HOX H;  4DUY Q;  1N33 L;  2K14 A;  3PUW A;  2K75 A;  5GAE C;  1J5E L;  3HOV H;  1VQL A;  5GRO A;  4B3S Q;  1HNX Q;  2E8G A;  1FJG L;  5ELN A;  1VQ9 A;  2F4V L;  3G6E A;  3HKZ E;  2KEN A;  1N36 L;  5JEA G;  1E7Z A;  1JT8 A;  4YWL A;  3S15 H;  1XNQ L;  1VQF A;  4A3J H;  3HOU H;  3ER0 A;  4GKJ Q;  5LMU Q;  2YYZ A;  3BU2 A;  2VQE Q;  2WFW A;  4JI0 L;  3NBH B;  5AJ3 L;  2VQF Q;  3TS2 A;  3CW2 C;  5IT9 c;  1LYL A;  2UUB Q;  1V43 A;  4HJ7 A;  4JI6 L;  4B3T L;  2HHH Q;  2AKW B;  1EQR A;  5M5Y H;  1I6H H;  3ZJY C;  4IOC A;  1TWH H;  3FP9 A;  3F2C A;  3ULP A;  2N8N A;  2E2H H;  4LF5 L;  1DGS A;  3RNU A;  4LFC Q;  3KDF B;  3M4Q A;  1UE7 A;  4OWT B;  4JI8 L;  5IP9 G;  4B3S L;  1EOV A;  3CCU A;  4DV5 L;  4WJ3 M;  1EUJ A;  4DR2 Q;  1X3E A;  1KHI A;  2ATW A;  4JI8 Q;  5JJL A;  3FHW A;  4BXX H;  3U4Z A;  3PUZ A;  3F2D A;  4A3B G;  1CSP A;  3W1G A;  5LMN L;  4GNX A;  1EWI A;  4GS3 A;  3K81 C;  2JA6 G;  1QVF A;  3I7F A;  4IPC A;  3J80 i;  3J81 j;  2CKZ B;  2CCZ A;  2HHH L;  1V9P A;  3HKS A;  4GN4 B;  2UUC L;  3AEV A;  2XTI A;  4ME3 A;  3S1Q H;  2ZM6 L;  1KXL A;  1TWF H;  2F3I A;  4MTN A;  1XPU A;  4GKK L;  1Z47 A;  2C35 B;  1X56 A;  1CKM A;  1X54 A;  4LF4 Q;  2E5L L;  2NZO A;  1XTD A;  4GKK Q;  4DV3 L;  2VUM H;  4RMF A;  1YIT A;  2CWP A;  1XMQ Q;  2YV5 A;  3CCV A;  2PMZ E;  2PQA B;  3PGZ A;  4UP8 A;  4L5T A;  1P16 A;  3S24 A;  1OXX K;  1JMC A;  4LF5 Q;  1S40 A;  2N3S A;  4JI4 L;  2EIF A;  2MO1 A;  4LF6 L;  4A93 H;  1WYD A;  3KF6 A;  1L1O A;  2B63 H;  2VQE L;  4DPG A;  3T1Y L;  1I5F A;  4GN3 B;  5LMU L;  2ZTD A;  2UXD Q;  4QY7 A;  4QIW E;  5H1S E;  1E3P A;  1SRU A;  4XTC S;  4L5S A;  4PMW A;  1XPR A;  3PO2 H;  4R4O A;  1OXU A;  4B3R Q;  2NZH A;  1CKN A;  2R7Z G;  3KFU A;  2KHJ A;  3WWV A;  1KIX A;  3S1M H;  1BKB A;  1I94 Q;  1CUK A;  2YU9 H;  1VQI A;  2OWO A;  4OX9 L;  3H0G G;  3RN2 A;  4YCV A;  3PIO A;  4DR2 L;  1N33 Q;  1IXR A;  2NVY H;  1PH6 A;  1PA6 A;  3STB C;  4AQY Q;  2RF4 A;  1NY4 A;  2R92 H;  1GD7 A;  2KBN A;  1LTL A;  3KOJ A;  4DV2 L;  2AWO A;  4LFA L;  1Q1B A;  4LUZ A;  1B7Y B;  2R7D A;  2CFM A;  3GTP H;  1UE6 A;  1VQO A;  1K73 C;  2K5V A;  4X62 Q;  3T1H L;  3PF5 A;  4JI2 L;  1Q7Y C;  1L0W A;  3NEL A;  4X6A H;  4AH6 A;  1FJG Q;  4JV5 Q;  3E9I A;  2JE6 I;  3W1B A;  4DR5 Q;  2BH2 A;  4A3E H;  1YEZ A;  1TXY A;  4GKJ L;  1AH9 A;  3PO3 G;  5FLM G;  2E5L Q;  4LF4 L;  4LF7 L;  3U4V A;  1VQM A;  1C7Y A;  1PH9 A;  2UUA Q;  5C4X G;  3HOX G;  3OW2 A;  4JOI A;  4JI1 L;  3CME A;  4R4T A;  2R93 G;  4DR3 Q;  1M1K C;  5GAD C;  4GOP C;  2Q2H A;  4DR1 L;  1JE5 A;  2QEX A;  3NEM A;  4DR6 Q;  3I4M G;  1YZ6 A;  3M85 A;  4DV4 L;  1PH5 A;  1A8V A;  4B3M L;  3ICE A;  4JBJ A;  4BA1 I;  5C0X J;  5C0X I;  4A75 A;  2E2J H;  3S17 H;  2MQH A;  1L1O C;  4P72 A;  5M3F G;  2JA5 G;  3ERS X;  3CD6 A;  2AWN A;  4GLA C;  1Q82 C;  2UXB L;  2YTX A;  4P71 A;  1IBM L;  1UE5 A;  5IWA L;  2KCM A;  1XMO L;  4A3F H;  5JEA J;  3HOZ G;  3T1Y Q;  2UXD L;  3F8T A;  2I0Q A;  1UEB A;  3HOW H;  4BY7 H;  3L7Z C;  2UU9 Q;  4LFB Q;  1HZA A;  1VQJ A;  2K4K A;  3CCR A;  1K8A C;  2UU9 L;  3H3V H;  3J81 c;  1SLJ A;  2K50 A;  4KLK A;  1E22 A;  4POG A;  4OWW B;  4DV1 Q;  2KHI A;  5IYC G;  2D0O A;  4DV3 Q;  2WB1 G;  4PZ7 A;  4DK3 C;  1SRO A;  4JI2 Q;  4DAY B;  4X62 L;  4PZ8 A;  2WAQ E;  4Y52 H;  3A5U A;  2F52 A;  2MNA A;  1T9H A;  2NVT H;  1WCM H;  1HR0 W;  4R1J A;  1IBL L;  3LGJ A;  4AYB E;  4LFB L;  1TWG H;  4BBR G;  3HKZ G;  2D62 A;  4LF7 Q;  2Z0S A;  1S72 A;  3G71 A;  4POF A;  2Y0S G;  4JI1 Q;  5IWA Q;  1XMO Q;  1K0R A;  4OX9 Q;  1CKN B;  4DR3 L;  3PUV A;  3GTO H;  1JJC B;  3HFZ B;  4QQB X;  2JA8 G;  2YTV A;  1Q46 A;  2Z6K C;  5C0X G;  2YTY A;  1EQQ A;  3RR5 A;  4NPS A;  3CC7 A;  5K36 G;  5FJ8 H;  1AE2 A;  2EXD A;  1RIP A;  1PH7 A;  1BBU A;  1EIY B;  1Y1V H;  2Y0S E;  1TWC H;  3K80 C;  1HR0 Q;  1CKO A;  1NTG A;  3B6Y A;  2QGQ A;  4DV2 Q;  1AE3 A;  2L15 A;  1XNR Q;  2R7Z H;  4IPG A;  1C9O A;  4HJ9 A;  2JA7 H;  1V1Q A;  5BR8 Q;  4AYB G;  1N34 Q;  2LSS A;  4BY1 H;  3GTK H;  3PF4 A;  2UXC Q;  2IX0 A;  1HH2 P;  1I94 L;  4IPD A;  1RL2 A;  5HGQ A;  5IYD G;  1UE1 A;  1SN8 A;  2AMC B;  1JJG A;  3IRB A;  1SE8 A;  5M5W H;  4LW1 A;  3FKI G;  1W2B A;  1VQH A;  4IFD I;  3UE1 A;  1UWV A;  4DAM A;  3K8A A;  2IHE A;  4A3D H;  1YBY A;  3I4N G;  3S16 H;  1YNX A;  4B3M Q;  1FL0 A;  3H15 A;  2I5L X;  2NN6 I;  4JI7 Q;  2R7F A;  1OXS C;  4A3M H;  2MFI A;  4BBS G;  4IFD G;  2BH8 A;  4K0K Q;  2OCE A;  3BZK A;  1XMQ L;  3M9B A;  4DR4 L;  4X65 L;  2PI2 E;  1Y1W H;  4A3L H;  3HOY G;  4MZ9 A;  3TQY A;  5HY6 A;  2KCT A;  5FLM H;  5LMN W;  4A3I G;  4JYA Q;  4JBM A;  3CP0 A;  1E1T A;  5C4X H;  1GVP A;  3CPW A;  1Q8K A;  4A3K H;  3GDE A;  2NN6 G;  2UXB Q;  5IP7 G;  1U5K A;  4DV7 L;  1G29 1;  2FXQ A;  4YCW A;  1K3R A;  4HJ8 A;  4IFD J;  4B3R L;  4A3J G;  3JC6 6;  1VQ5 A;  1Z9F A;  1P8L A;  1L1O B;  3AFP A;  3KF6 B;  3MXN B;  1X55 A;  2XGT A;  4PZ6 A;  3CCE A;  2OTL A;  4P74 A;  3JAM i;  2HQL A;  4IO9 A;  4YY3 Q;  1X3G A;  5M3F H;  2JA5 H;  2D0P A;  2GVB A;  2VL6 A;  2JA9 A;  3JAM c;  3GTQ H;  3HOZ H;  1HNZ L;  4DKA C;  2AHO B;  5DLQ E;  2Q2T A;  3CCM A;  4A3C H;  1JB7 A;  2N49 A;  4QGU A;  4DV6 L;  2IT1 A;  1KRS A;  3OTO Q;  4JI6 Q;  2B29 A;  4R4C A;  1VQN A;  2ZTC A;  1X3F A;  4BXX G;  2LXJ A;  4ALP A;  1B70 B;  2JQO A;  5M3M H;  4JC0 A;  2R6G A;  2Q2U A;  4JCV E;  5C44 G;  4HIO A;  4DR1 Q;  3S1R H;  1XPO A;  4J15 A;  1Q86 C;  1GKH A;  3CC2 A;  1VQB A;  1VQ4 A;  1YI2 A;  1NBW A;  4JI0 Q;  4LF9 Q;  2JA6 H;  3ULL A;  1VQG A;  3BZC A;  3L2P A;  3OYY A;  1PH4 A;  2BA1 A;  2JK8 A;  4LF6 Q;  4O2D A;  1J5E Q;  4YWM A;  1KQS A;  4FDB A;  3I2Z A;  3F2B A;  3D0F A;  3TS0 A;  5FLX c;  1PH3 A;  3HOU G;  4JYA L;  2F4V Q;  1N36 Q;  2VS1 A;  3AYH B;  4BBR H;  4OO1 I;  1A62 A;  1PYS B;  4OON A;  1PFS A;  3DLL A;  2N78 A;  4NXM Q;  1OTC A;  3S14 H;  3MEF A;  1N9W A;  3EBE A;  2JA8 H;  5GAH C;  2UUB L;  4NXM L;  3Q8D A;  1YJN A;  1QVC A;  3M4P A;  1MJC A;  5IY0 A;  4TVA B;  3KYH C;  3M3Y H;  2OQ0 A;  1QZH A;  4R4I A;  3SGI A;  3K7A H;  2E2I H;  2H5X A;  4JI3 Q;  3RZD H;  4DV7 Q;  4GOP A;  4A3B H;  4UP7 A;  1HJP A;  3NEN A;  1VQP A;  1C0A A;  4A3G H;  2JA7 G;  4X65 Q;  3M4O H;  3H0G H;  1D8L A;  4P75 A;  4UP9 A;  2QA4 A;  1IL2 A;  4NB3 A;  3J81 i;  2WB1 E;  1WFQ A;  3ULJ A;  4C3I H;  2IX1 A;  1WJJ A;  1OXV A;  3I4O A;  3W5O A;  2R92 G;  2VW9 A;  1KL9 A;  1W3S A;  5GAG C;  1XNR L;  3H3V I;  2PI2 A;  5C3E H;  4KHP Q;  1YVC A;  2VUM G;  1U0L A;  1FVI A;  3K0X A;  4IJH A;  3PUY A;  4LWC A;  5ELO A;  5E7N A;  4LNQ A;  4WJ4 A;  4RG1 A;  2Q2I A;  4O0A A;  4A76 A;  4A3M G;  1KD1 C;  4JI5 Q;  3GTL H;  1H95 A;  4A93 G;  1KRT A;  4R4Q A;  3PO3 H;  4JBK A;  2B63 G;  4K0K L;  3DM3 A;  1HNX L;  4DR4 Q;  3BJU A;  2LXK A;  4L5Q A;  3CXC A;  4HJ5 A;  3AFQ A;  2PNH A;  1QVG A;  3RN5 A;  1N32 L;  2GN5 A;  1A0I A;  3PO2 G;  2R93 H;  4YY3 L;  4JI7 L;  4A3K G;  4DUY L;  1LM0 A;  1NJI C;  4QJF A;  4DV6 Q;  1VQ8 A;  4GNX C;  1YHA A;  2JJQ A;  1G51 A;  1NE3 A;  1PH2 A;  2NVX H;  5AJ3 Q;  2I5H A;  1HR0 L;  2I5M X;  1HNZ Q;  4YCU A;  3I4M H;  1IZ6 A;  4MNO A;  5LMN Q;  4DR7 Q;  3GTJ H;  4GLV B;  4NXN L;  3M7N A;  3PCO B;  4C3H H;  4GLX A;  4UPA A;  1WOC A;  4JI3 L;  3I55 A;  3J7Z C;  2ZJR A;  1TWA H;  3F1Z A;  1QZG A;  2PQA A;  4HIK A;  1VQ6 A;  2OTJ A;  3CCL A;  1WI5 A;  3TEH B;  1XJV A;  1VQ7 A;  2ALY B;  1PYB A;  4HJA A;  4LF9 L;  3GTG H;  4DUZ Q;  1VQK A;  4PG3 A;  2RHQ B;  4BY7 G;  4A3C G;  2VY3 A;  3KF8 B;  4APV A;  1LUZ A;  1IBK Q;  4A4I A;  4UY8 C;  5IYB G;  4DK6 C;  4DR5 L;  1PH1 A;  1R9T H;  1A63 A;  5M3M G;  1YJ9 A;  3RLO A;  1X65 A;  1HNW L;  3E9H A;  1HZC A;  3PUX A;  3HOV G;  1EFW A;  5C44 H;  4GNX B;  2CWA A;  4YHH Q;  1SFO H;  1I50 H;  4OO1 G;  2K5H A;  4YHH L;  1FGU A;  3U58 A;  2ASB A;  1VQC A;  4Y7N H;  1K9M C;  1YHB A;  4C2M H;  1PV4 A;  2ES2 A;  3G4S A;  1HZB A;  1PHJ A;  1VCI A;  1VS0 A;  1IYJ B;  3J7A 5;  5M5X H;  3E0E A;  3CCS A;  4X66 Q;  1BVS A;  1HZ9 A;  1ASZ A;  1Q12 A;  3K7U C;  1Y14 B;  2RCN A;  3CQZ H;  3STB D;  2WP8 J;  4A3F G;  2MO0 A;  5IP9 H;  4DV0 L;  1M90 C;  4NXN Q;  4BA2 I;  3AQQ A;  2A19 A;  5FJ8 G;  3HOW G;  4DR7 L;  2K52 A;  1IBK L;  1X6O A;  2B3G A;  4EX5 A;  4QL5 A;  1Y1V G;  2VZA A;  3S2H H;  2A1A A;  3T1H Q;  3A5Z B;  2JEB I;  1MJE A;  1X9N A;  4C3J H;  2ZJQ A;  1MKH A;  3GTM H;  5BR8 L;  1N34 L;  1PH8 A;  2OQK A;  3J80 c;  2IHF A;  5IYC H;  1IBM Q;  1I3Q H;  4JOI C; 
#chains in the Genus database with same CATH topology
 2F0P A;  1RHP A;  1K8G A;  3GO5 A;  5KND A;  1I4H A;  2HT1 A;  2F0S A;  4DV5 Q;  2JEA I;  3CCJ A;  1OXT A;  4LF8 L;  4DAP A;  3U50 C;  3KJO A;  1XX8 A;  4FVM A;  1GO3 E;  1CA6 A;  2V1C C;  4M8A A;  3S1R B;  3G48 A;  4IJL A;  2DGY A;  3S17 B;  3A7A B;  2J7Z A;  2NZ1 D;  3C1F A;  3TP8 A;  4RAU C;  3TRZ A;  1I6V C;  1NMF A;  3UDG A;  2GVA A;  5K36 H;  1YHQ A;  2ZXO A;  4JI5 L;  1CK1 A;  5C3W A;  4A3L G;  4KHP L;  4YWK A;  4DNI A;  2X6L A;  3CF5 A;  2BE5 D;  3IFT A;  2XWB B;  1BCP F;  1XWE A;  1E1O A;  3A74 A;  5M3F B;  5IYD H;  2KEE A;  4G7Z C;  2HDM A;  1ENA A;  3J7Y W;  1TII D;  1XNQ Q;  1Q1E A;  4L63 B;  5EBC A;  4KI0 A;  3GTG B;  1Q81 C;  2Z8L A;  1O7I A;  4XIG S;  2CQO A;  3UDX A;  1XXG A;  3TRE A;  4A3E G;  1GM5 A;  2ZM6 Q;  2A8V A;  2IY5 B;  1G2S A;  3N6R A;  1RTN A;  4DK0 A;  1SMX A;  1N32 Q;  2GA4 B;  1L2F A;  3SK4 A;  5C4H A;  4XYQ A;  4IQZ A;  1VQL A;  2DY8 A;  4B3S Q;  3E6Z X;  1EIG A;  3HKZ E;  2B2Y C;  3TP7 A;  1Z6H A;  1JT8 A;  4DNR B;  3S15 H;  1XNQ L;  4A3J H;  3HOU H;  3ER0 A;  4ULL A;  2K05 A;  4JI0 L;  3NBH B;  3CRK C;  5AJ3 L;  3CW2 C;  4HJ7 A;  2HHH Q;  1CZG A;  1EQR A;  2A6E C;  5M5Y H;  2DJF C;  4N8X 1;  3ULP A;  5C4X B;  5IP9 G;  4OWT B;  4KN4 C;  1PMR A;  3LWE A;  4C56 C;  1KHI A;  2ATW A;  4AYB B;  3OMG A;  4BXX H;  3U4Z A;  4MHE A;  3TN2 A;  1C48 A;  3PUZ A;  5LMN L;  2TSS A;  1FD7 D;  1TWH B;  2CKZ B;  4GN4 B;  3HKS A;  3AEV A;  1UUP A;  2XTI A;  4ME3 A;  1KXL A;  4C3I G;  5IGD A;  2B63 B;  1Z47 A;  1PZJ D;  2C35 B;  1X54 A;  3HRZ C;  3BZD B;  4LF4 Q;  1XTD A;  4DV3 L;  4IN3 A;  3Q24 A;  1XMQ Q;  2CWP A;  2YV5 A;  1JMC A;  3PGZ A;  3S24 A;  4LF5 Q;  3K58 A;  1D1K A;  1DOL A;  2EIF A;  2Q8R E;  1MBY A;  3MVV A;  3VR3 A;  2VQE L;  1CQF A;  3T1Y L;  2UXD Q;  1PZK D;  4KY7 A;  4QIW E;  4XTC S;  3AU7 A;  4PMW A;  2EYL A;  1PFM A;  1CUK A;  2MGS A;  2YU9 H;  1D5X C;  4OX9 L;  1DOK A;  3V96 A;  3H0G G;  3PIO A;  4DR2 L;  5CV4 A;  4C3I B;  5M5X B;  1TY2 A;  2NVY H;  4KJN A;  4ZKB B;  1EWH A;  2R92 H;  2KVM A;  3H91 A;  3TSS A;  2D5D A;  1KLG D;  2K5V A;  1MI2 A;  3DWP A;  4X62 Q;  4RHS A;  3NEL A;  4X6A H;  4JV5 Q;  1FJG Q;  4DR5 Q;  2BH2 A;  4A3E H;  4CHT B;  3P1H A;  3OW7 A;  4QUC A;  2L11 A;  3M4Y A;  2HQE A;  4HSP A;  1BOS A;  3CME A;  1SAP A;  4DAV A;  3Q22 A;  4OO1 H;  1JOK A;  4DR1 L;  1E2Z A;  1EYD A;  4BA1 I;  1B50 A;  1SNP A;  4C3H G;  5C0X J;  5C0X I;  4A75 A;  1MD2 D;  3S17 H;  2MQH A;  4P72 A;  3ERS X;  3I72 A;  2UXB L;  1TS3 A;  1EY6 A;  3V2T A;  4A3F H;  2A73 B;  1UEB A;  4LFB Q;  1HZA A;  2K4K A;  1K8A C;  2XN9 C;  3BG3 A;  3D4W A;  1E2W A;  3PO3 B;  4QCL A;  3J81 c;  1SLJ A;  1JWS D;  1TY0 A;  2K33 A;  4OWW B;  1ET9 A;  3IL8 A;  2D0O A;  5IYC G;  4PZ7 A;  4X62 L;  4Y52 H;  2MNA A;  4RGN A;  1BUV T;  1HA5 A;  1DM0 B;  1SJE D;  3M4O B;  2Z0S A;  1S72 A;  4N9T A;  4LMQ D;  1VF5 C;  4JI1 Q;  1K0R A;  4ILW A;  4DU9 A;  1SYF A;  3OOC A;  2YTV A;  1Q46 A;  4ME5 A;  3NTI A;  4NPS A;  1AE2 A;  1PH7 A;  1SNO A;  1ROD A;  2L4N A;  4IPG A;  2JA7 H;  2CH4 A;  4BY1 H;  1GUO A;  2AMC B;  1TU2 B;  4DA2 A;  1W2B A;  1TWA B;  3MA2 B;  1UWV A;  1DOM A;  4XQN A;  1I4P A;  2XWJ B;  3I4N G;  3S16 H;  1YNX A;  4B3M Q;  4DGZ A;  2XVS A;  5E4W C;  2WKD A;  1TWC B;  1BCP B;  2R7F A;  1OXS C;  4JK1 C;  4BBS G;  4K0K Q;  1XMQ L;  3M9B A;  3TQY A;  5HY6 A;  4JYA Q;  2CH4 W;  1BNZ A;  1E1T A;  3CPW A;  1GVP A;  1ESF A;  1SJH D;  4A3K H;  5IP7 G;  4O1N A;  1U5K A;  2A6H C;  4DV7 L;  2FXQ A;  4IFD J;  1F2L A;  3W2D A;  5CYU A;  1P8L A;  3PQI A;  1A6X A;  4K8J A;  1X55 A;  3CCE A;  4Q0F A;  5D3I B;  4IO9 A;  4K5X A;  2F03 A;  5E3F A;  2JA9 A;  4HMI A;  1HNZ L;  2KOL A;  3URY A;  5DLQ E;  4A3C H;  2N49 A;  4QF4 A;  3MWY W;  2AUJ D;  2H1E A;  4CDD C;  4RHR A;  2R6G A;  1VMP A;  2K5D A;  1XPO A;  1VQB A;  2XRQ D;  1VQ4 A;  1NBW A;  5KEE A;  2EXZ A;  2F0D A;  1YI2 A;  1QJO A;  3BZC A;  2X6G A;  3K57 A;  3OYY A;  4O2D A;  1VF7 A;  5KYL A;  4A3J B;  1J5E Q;  3F2B A;  3MC0 B;  1GUN A;  1N36 Q;  1SDF A;  4OO1 I;  1PYS B;  1PFS A;  3DLL A;  2R7Z B;  4I7A A;  1GUW A;  3S14 H;  3K5O A;  3VA5 A;  1N9W A;  1JOO A;  3D4R A;  3T56 B;  2UUB L;  3SK8 A;  3Q8D A;  1YJN A;  5M3M B;  2PZT A;  3VYS A;  3VR4 A;  2KA7 A;  1QZH A;  4R4I A;  3TP6 A;  4MTK A;  1X3Q A;  2EYF A;  2NUC A;  2H5X A;  2IL8 A;  4UHV A;  4JI3 Q;  4A3B H;  3DEP A;  1TS5 A;  4H44 C;  1I4X A;  5C44 B;  3RD4 A;  4MIU A;  1C0A A;  4B9W A;  2JA7 G;  4KHV A;  1D8L A;  4P75 A;  4UP9 A;  3K6O A;  3U9O A;  1BO0 A;  5I6W A;  1IL2 A;  2WB1 E;  5E4X A;  1WJJ A;  1S5D D;  3NQT A;  1YNN D;  2IPK D;  2SNS A;  1KL9 A;  1W3S A;  2M2L A;  5GAG C;  1XNR L;  3H3V I;  2K6A A;  3BS1 A;  4IJH A;  3PUY A;  5ELO A;  3FDT A;  4RG1 A;  4IUU A;  2Q2I A;  5JVG 3;  4A76 A;  1NR4 A;  2Y0S B;  1KD1 C;  3GTL H;  1KRT A;  1QE6 A;  2K7V A;  4K0K L;  2LXK A;  4L8J A;  4HJ5 A;  2PNH A;  2O5J C;  1B53 A;  1WTX A;  2R93 H;  4YY3 L;  5D14 A;  4A3K G;  1NJI C;  4QJF A;  1VQ8 A;  1W6J A;  1NE3 A;  2EE1 A;  2NVX H;  1IZ6 A;  1O7L A;  1EZ6 A;  1EY9 A;  1TS4 A;  4RGO S;  5LMN Q;  2PW7 A;  4HCE A;  2EY2 A;  2NYZ D;  3WOE A;  3I55 A;  1TWA H;  1GUG A;  1PLF A;  1VQ6 A;  2NVT B;  4I7Z C;  3CCL A;  4HJA A;  4LF9 L;  3NQI A;  4A3C G;  3KF8 A;  2L0C A;  1QB5 D;  5IYB G;  3E9H A;  1SBB B;  3PUX A;  1RDP D;  1B9M A;  1SFO H;  1D5M C;  4RFB A;  3WOF A;  1ENC A;  2BE5 C;  3R3O A;  2F0W A;  1QNK A;  4OIK A;  1K9M C;  4C2M H;  4ABN A;  1PV4 A;  3NWS A;  1PHJ A;  1CHP D;  5C5M A;  2B2T A;  3CCS A;  1BVS A;  1RKN A;  1ZXT A;  3K7U C;  1Y14 B;  1MSG A;  2RDG A;  4DV0 L;  3AQQ A;  2D9U A;  1X6O A;  2B3G A;  4CKB A;  3FKI B;  5JAV A;  3GTM H;  1B9N A;  1N34 L;  1U4M A;  3J80 c;  1Y8P B;  4V0B A;  1I3Q H;  4JOI C;  1S5B D;  1HA6 A;  3TME A;  3NBI A;  1JJ2 A;  1PXU A;  4IPH A;  2F1M A;  2PZW A;  5J3B A;  3MEH A;  1AW7 A;  4A3D G;  1ILP A;  1MGS A;  4JBW A;  2G9H D;  3EIV A;  4XXE A;  3CMA A;  3RLN A;  5KNB A;  2VQF L;  2BA0 A;  3HS0 C;  3A54 A;  3CAM A;  2EYO A;  1IBL Q;  1Y1W G;  1JWM D;  4H02 A;  4A3I H;  1CZW A;  1D7Q A;  4GOP B;  1LTI D;  3CPF A;  4DXF A;  1YIJ A;  1TQO A;  4RKL A;  4B3T Q;  4LUV A;  1B8A A;  2AQ3 B;  4EQ5 A;  2JA5 B;  3S2D H;  5E1F A;  5JVH 3;  1HNW Q;  2UUC Q;  3PV0 A;  5G3L F;  1HUM A;  3BDO A;  4KHZ A;  4S3S A;  1IYV A;  4DV0 Q;  5JJK A;  4RA8 A;  5IE8 A;  3CCQ A;  2ZJP A;  4ODG A;  2V4D A;  1PZI D;  3SDZ A;  4X64 Q;  3MFY A;  3S15 B;  5JJI A;  1K83 H;  3KJP A;  2L5T A;  2HIX A;  1VQE A;  5IYB H;  3HOX H;  4DUY Q;  4KKS A;  2QW7 A;  2K04 A;  3ERQ A;  2F0U A;  3NXW A;  2RSO A;  3SHL A;  4X3U A;  1J5E L;  3GTP B;  5EPL A;  2E75 C;  5KYI A;  5ELN A;  2F4V L;  3G6E A;  2KEN A;  4YWL A;  4GKJ Q;  1VQF A;  5EJW A;  5LMU Q;  3BU2 A;  2VQE Q;  3TS2 A;  4FF3 A;  1H9S A;  2L9H A;  5DEH A;  4KD4 A;  4CDF C;  4FF1 A;  1HRJ A;  5EGT A;  5FLX L;  4FF4 A;  1I6H H;  2F0F A;  3ZJY C;  1TWH H;  3F2C A;  2N8N A;  3KDF B;  1ML0 D;  4DF7 A;  4DV5 L;  2R93 B;  4LK1 C;  1EUJ A;  3J80 E;  1X3E A;  1H9K A;  5FO8 B;  3EFX D;  1QVF A;  3I7F A;  3J81 j;  2UUC L;  1SYD A;  3Q0A A;  2AQ1 B;  2RVL A;  1TWF H;  1EEF D;  1K0S A;  1H9M A;  1CKM A;  2E5L L;  1TVX A;  3DUZ A;  2NZO A;  3EQL C;  4GKK Q;  2VUM H;  4RMF A;  2ZXP A;  4KD3 A;  1QOH A;  2PQA B;  2F0I A;  3O13 A;  4L5T A;  1OXX K;  1O7Y A;  3CU7 A;  1S40 A;  4JI4 L;  4A93 H;  1SE4 A;  1WYD A;  3KF6 A;  1L1O A;  3MXN A;  3HOU B;  2K01 A;  2SNM A;  2ZTD A;  3C2P A;  5H1S E;  1SRU A;  4DK1 A;  4B3R Q;  5CV7 A;  2NZH A;  3WDN A;  4XQJ A;  1I50 B;  1EFI D;  4KMU C;  1BKB A;  3FVQ A;  3D4D A;  2FMM A;  1PFB A;  2OWO A;  4ZCK A;  5JOB A;  5G3L D;  2JA8 B;  4J6H A;  2RF4 A;  4ID6 A;  4PQX A;  1LTL A;  4DV2 L;  2AWO A;  4LUZ A;  1B7Y B;  1UE6 A;  2L55 A;  1K73 C;  4JI2 L;  1L0Y B;  4N9P A;  3E9I A;  2JE6 I;  1B3A A;  1TXY A;  1TWF B;  2F0M A;  3PO3 G;  5FLM G;  1AH9 A;  4CJ2 C;  4LF7 L;  2UUA Q;  3HOX G;  3OW2 A;  4R4T A;  1M1K C;  5GAD C;  4GOP C;  5K5P A;  4DR6 Q;  5EPJ A;  3I4M G;  3M85 A;  4DV4 L;  1PH5 A;  3ICE A;  2ZT9 C;  2EYH A;  4EGV A;  1KAB A;  3HKZ B;  3FRP B;  3CD6 A;  2SDF A;  1FGB D;  5CC4 A;  4WOR A;  1IBM L;  1DCZ A;  5IWA L;  2KCM A;  4XDX A;  5CV5 A;  5JEA J;  1AFP A;  1HXY D;  5BN5 A;  1Y8N B;  4QMG A;  2WIN B;  5BN4 A;  4DAY A;  4XT1 B;  3HOW H;  2UU9 Q;  4RCO A;  2DY7 A;  3H3V H;  2K50 A;  4POG A;  3ND9 A;  5EKK A;  4DV3 Q;  2WB1 G;  4X3T A;  4DK3 C;  1SRO A;  1PFN A;  2EY6 A;  2WAQ E;  2LFN A;  1T9H A;  4ZUJ A;  1BR9 A;  2VUM B;  1HR0 W;  2DJG C;  4R1J A;  4U67 3;  1TWG H;  4BBR G;  3HKZ G;  4WJW A;  2D62 A;  3NPP A;  4GZY C;  3VR6 A;  2CHB D;  4POF A;  1IYU A;  5IWA Q;  4OX9 Q;  4DR3 L;  3GTO H;  3PUV A;  3HFZ B;  1IW7 D;  5ELF A;  5C0X G;  2YTY A;  2M00 A;  4BY1 B;  3V05 A;  5K36 G;  3J80 L;  1BBU A;  1Y1V H;  1HQR D;  1PRT F;  1HR0 Q;  1A2T A;  2K03 A;  1WVL A;  1AE3 A;  2L15 A;  2WB1 B;  3T53 B;  4NDX A;  3GTK H;  3C1E A;  5BR8 Q;  2UXC Q;  2IX0 A;  1HH2 P;  3NHH A;  4IPD A;  1RL2 A;  5HGQ A;  5IYD G;  3J7A F;  1SE8 A;  4IFD I;  3UE1 A;  3K8A A;  4CDE C;  1YBY A;  4K14 A;  2WV6 D;  2NN6 I;  4JI7 Q;  5C4Z A;  4A3M H;  1ESR A;  2OCE A;  3BZK A;  4DR4 L;  1VDZ A;  3HOY G;  5FLM H;  3S1M B;  1LTB D;  1LO5 D;  3GDE A;  3QOJ A;  2UXB Q;  1J8I A;  3Q23 A;  1G29 1;  2TMP A;  4YCW A;  1K3R A;  1CM9 A;  4A3J G;  1VQ5 A;  3M7G A;  1L1O B;  3MXN B;  5JPM C;  1ZYR D;  2OTL A;  4P74 A;  4TRD A;  3IKJ A;  2A69 D;  3H94 A;  2SOB A;  1A2U A;  1STN A;  4DKA C;  1LV9 A;  5KRU A;  2Q2T A;  1JC7 A;  3JAM E;  4DV6 L;  4XT3 B;  3KBG A;  1KRS A;  2LMC B;  2NVY B;  4A3K B;  4R4C A;  3QJY A;  4MN3 A;  2ICE C;  1KDA A;  4BXX G;  1L0X B;  1WTR A;  4JC0 A;  1WTO A;  1SSO A;  1I3Q B;  3CHB D;  5C44 G;  4HIO A;  2QF7 A;  4DR1 Q;  3S1R H;  1GKH A;  1Q86 C;  4LF9 Q;  1ONL A;  1DZ1 A;  2BA1 A;  4YWM A;  3I91 A;  5FLX c;  3A55 A;  2R92 B;  1SNQ A;  4BBR H;  1A62 A;  1F9S A;  2QDB A;  5NUC A;  4G7O C;  1E0B A;  2N78 A;  4NXM Q;  4CKE A;  1II3 A;  3EBE A;  1NSN S;  2BDN A;  5EQ0 A;  3FMC A;  3TDQ A;  5GAH C;  2G5D A;  2HCC A;  1QVC A;  3M4P A;  1MJC A;  4TVA B;  2EOT A;  5FO7 B;  3M3Y H;  1QG7 A;  2OQ0 A;  3QO2 A;  1EQV A;  4PMC A;  2EJG C;  2E2I H;  3RZD H;  1HJP A;  1VQP A;  1UAP A;  3H0G H;  3SVM A;  4OL7 A;  1WFQ A;  3ULJ A;  1BBX C;  3M3Y B;  1OXV A;  1K3B C;  2F0E A;  2J4X A;  2R92 G;  1G6Z A;  2PI2 A;  5C3E H;  1AP0 A;  4KHP Q;  1YVC A;  3SK5 A;  1ZKO A;  3BVG A;  1FVI A;  5EKL A;  4LWC A;  2VXW A;  4WJ4 A;  4ZK9 B;  4LNQ A;  2NWG A;  1CI3 M;  4A3M G;  1H95 A;  1WTP A;  1SYG A;  1Y8O B;  4JBK A;  2B63 G;  3DM3 A;  5CBA E;  1H9R A;  1V8Q A;  4N8F A;  3CXC A;  1QVG A;  3H09 A;  3RN5 A;  3PO2 G;  1K8O A;  3FEW X;  3VYR A;  3HOV B;  5COR A;  1LM0 A;  4DUY L;  3HZX A;  3NTK A;  1YHA A;  2JJQ A;  1G51 A;  1LTS D;  3KK7 A;  3R93 A;  3TBI B;  5AJ3 Q;  1HR0 L;  4YCU A;  3NTH A;  2A68 C;  4MNO A;  1BQQ T;  1F2Y A;  1SND A;  3ONA B;  4C3H H;  4GLX A;  4UPA A;  4JI3 L;  2ZJR A;  2JP1 A;  4DN4 M;  4HIK A;  1WTW A;  1PTO B;  3TEH B;  1XJV A;  5C6A A;  1EY7 A;  3EJI A;  1I6H B;  3L9A X;  3SR1 A;  2B39 A;  2A5H A;  4DUZ Q;  4PG3 A;  3MAQ A;  2MPM A;  3KF8 B;  4APV A;  2FFK B;  1IBK Q;  2EY1 A;  3D3R A;  3LX0 A;  1AZQ A;  1YJ9 A;  1V1P A;  3RLO A;  1HNW L;  1HZC A;  1PDQ A;  1RD9 D;  3HOV G;  5C44 H;  3K5N A;  4GNX B;  1KNA A;  2CWA A;  1EQT A;  1ET6 A;  5JJZ A;  4YHH L;  3GTO B;  2N55 A;  1YHB A;  4IUQ A;  1HZB A;  2JXM B;  4TKO B;  3J7A 5;  2K32 A;  3E0E A;  3C3L A;  1MSH A;  2EJM A;  2K5Q A;  1ASZ A;  1KLU D;  1D2B A;  3FPP A;  5TSS A;  2RCN A;  4BA2 I;  3OIP A;  2UXC L;  2NTT A;  4NXN Q;  1IBK L;  2A1A A;  2KED A;  1MJE A;  2EPB A;  1X9N A;  2EJF C;  2ZJQ A;  1MKH A;  5BR8 L;  3A7L A;  4RH6 A;  4HED A;  2F0H A;  2K5N A;  4RWS C;  3E0J A;  4P73 A;  4DV1 L;  3H3V C;  1J6Q A;  1WCM G;  3TP5 A;  3PIP 3;  3S1N H;  4WFN 3;  3UDF A;  3VDY A;  4R8N A;  1CQV A;  4UDU C;  4A3I B;  4KTA A;  1BDO A;  3T51 B;  1QUQ B;  1G6P A;  3I4N H;  5C3E G;  4DUZ L;  2Z9H A;  3UDI A;  2IX3 A;  3EA6 A;  4HIM A;  4DFA A;  2F0K A;  4GN5 A;  4OWX B;  4A3F B;  2ZTE A;  4X3K A;  2WAQ G;  1F77 A;  1MIU A;  4LUO A;  4FXG C;  2NVQ H;  1CSQ A;  1KAW A;  5IIF A;  5EAY A;  1U4P A;  4LF8 Q;  4EVO A;  1BBW A;  3I4M B;  3RZO H;  2A74 C;  3RLF A;  1G2T A;  4H13 C;  4JPB W;  5IP7 H;  3GD7 A;  2ID0 A;  1VQA A;  4LFA Q;  3KUP A;  1ICW A;  4JG2 A;  3OWE B;  1BCP D;  3UE0 A;  4DR6 L;  1CT1 D;  3KBX A;  3FKI H;  4JI4 Q;  4EQO A;  2SEB D;  1YJW A;  2VNU D;  2R3Z A;  5GQO A;  1S5C D;  1EY0 A;  3A0J A;  5LL6 X;  4JV5 L;  2EQS A;  3PIP A;  2ICI A;  2Z6K A;  4CJ0 B;  2R61 A;  4IFD H;  4Y7N B;  3I56 A;  1GOZ A;  4C2M B;  4X64 L;  3GP7 A;  1GUS A;  3KLW A;  3PSI A;  1PVO A;  4AIM A;  1AEX A;  2RHS B;  4F88 A;  1N33 L;  2Z4I A;  3PUW A;  2K75 A;  5GAE C;  2RQX A;  4A93 B;  2D2C C;  3HOV H;  5GRO A;  3SK6 A;  3SE0 A;  1VQ9 A;  2O5I C;  4XYO A;  3A8J E;  1E7Z A;  4FP5 D;  1NAP A;  1QNU A;  3I3C A;  4OEM B;  1PTO F;  4B9X A;  1ZEQ X;  4NKL A;  3BVM A;  2PO4 A;  1LYL A;  5D3D A;  2N88 A;  3U9S A;  4B3T L;  4JI6 L;  2EY5 A;  2AKW B;  4PV1 C;  3NSW A;  4WRD A;  1B4O A;  1FR3 A;  2E2H H;  4LF5 L;  3RNU A;  1H9J A;  3M4Q A;  4B3S L;  1UE7 A;  4JI8 L;  2O4X A;  3CCU A;  2OEO A;  5JJL A;  3FHW A;  3F2D A;  3GTQ B;  4A3B G;  3W1G A;  4BY7 B;  4GNX A;  1G91 A;  4GS3 A;  2IJ0 A;  2Q8T A;  5IOD A;  2JA6 G;  1HFG A;  1IHZ A;  2EYJ A;  2RSN A;  3MTS A;  2HHH L;  1V9P A;  1SEB D;  1AZP A;  2ZM6 L;  4TSS A;  1V1O A;  4GKK L;  2HCI A;  1X56 A;  4Z9C B;  3DEO A;  3GTL B;  3SEB A;  3DHQ A;  1YIT A;  3CCV A;  1P16 A;  4HN7 A;  2RCF A;  3VYT A;  2N3S A;  1STE A;  2MO1 A;  2KHS A;  4DPG A;  4FXK C;  4GN3 B;  4QY7 A;  2K28 A;  1E3P A;  4L5S A;  4R4O A;  1T5X D;  3FPU B;  2J0T D;  2BOS A;  2KHJ A;  3WWV A;  1B44 D;  3S1M H;  1I94 Q;  1STY A;  1VQI A;  3RN2 A;  3NE5 B;  1KAA A;  5I6Y A;  1PA6 A;  4AQY Q;  1GD7 A;  2F4I A;  2KBN A;  3L3O C;  4LFA L;  1Q1B A;  3W3A A;  2R7D A;  2CFM A;  1VQO A;  3PF5 A;  1Q7Y C;  1L0W A;  4J8Q A;  2JA7 B;  3PMF A;  4AH6 A;  3W1B A;  3R2I A;  4ZRZ A;  1DXM A;  1JCK B;  4K2L A;  4GKJ L;  5HUR A;  5T1I A;  1TS2 A;  2E5L Q;  1F9R A;  4LF4 L;  1VQM A;  1C7Y A;  1PH9 A;  4JOI A;  2A6E D;  4JI1 L;  5HGT A;  1U4L A;  1S4Z A;  4K2K A;  2DNE A;  1FNU A;  2A6H D;  2KCN A;  3NEM A;  2FIN B;  2JN4 A;  2NB0 A;  1YZ6 A;  3I4N B;  3Q6S A;  1GXD C;  5ELD A;  4JBJ A;  1F2Z A;  3VYU A;  5EPK A;  2OXP A;  1L1O C;  2E2H B;  1ICF B;  5M3F G;  5CV9 A;  3ITP A;  5LHY 1;  4P71 A;  3GTJ B;  1QCB D;  2EVB A;  3HOZ G;  5FLX E;  5BN3 A;  3T1Y Q;  2UXD L;  3F8T A;  5KNC A;  4BY7 H;  2WAC A;  3BDC A;  2PCF B;  2UU9 L;  1SNC A;  2Q8I B;  3ZYY X;  5IGC A;  4DV1 Q;  2KHI A;  4HR7 B;  3QWN A;  4FF2 A;  4PZ8 A;  4K5V A;  1R4P B;  3A5U A;  2F52 A;  2QKI C;  2NVT H;  4EQN A;  1K8M A;  2FJ2 A;  1GHJ A;  1Y1W B;  4AYB E;  4LFB L;  1NCV A;  1H9S B;  4KV6 A;  2RBM A;  3G71 A;  1M8A A;  2RA4 A;  2PZU A;  2Y0S G;  5KIX A;  4QQB X;  2E2J B;  4FNF A;  1ZYR C;  3RR5 A;  3D6W A;  4QUF A;  4CDC C;  1Q3L A;  3PO2 B;  5FJ8 H;  2A69 C;  2EXD A;  3JAM L;  5DNF A;  5CV8 A;  1TWC H;  3K80 C;  1CKO A;  3SXH A;  1NTG A;  3B6Y A;  2QGQ A;  5EKI A;  4DV2 Q;  1XNR Q;  5M5Y B;  1C9O A;  1V1Q A;  4AYB G;  1N34 Q;  2LSS A;  1EU3 A;  1R9T B;  1I94 L;  4C3J B;  1UE1 A;  3N52 A;  1JJG A;  5M5W H;  4LW1 A;  1VQH A;  1PYW D;  2FHT A;  4DAM A;  2IHE A;  3J7A V;  1PTO C;  1PTO H;  3NUC A;  3G7L A;  4OGQ C;  1JQY D;  1WD0 A;  2QCP X;  5CBE E;  2I5L X;  3KLR A;  3RMH A;  3PIO 3;  4HMJ A;  2C9O A;  2E76 C;  2PI2 E;  4JW0 A;  4MZ9 A;  4A3L H;  5LMN W;  1LT3 D;  4JBM A;  3CP0 A;  1X3P A;  1F9P A;  1KDC A;  2NN6 G;  2L12 A;  1WTH A;  1TT2 A;  2X69 A;  1CFM A;  3BDL A;  3JC6 6;  1Z9F A;  3AFP A;  3KF6 B;  5J1Z A;  4BS9 A;  4CBV A;  2HQL A;  1X32 A;  3S1N B;  1X3G A;  2CQA A;  5M3F H;  4A3M B;  2PW5 A;  4UAI A;  2VL6 A;  5C5L A;  1F2M A;  3JAM c;  1D6E C;  3GTQ H;  3HOZ H;  1LT4 D;  2AHO B;  3RZD B;  5IOC A;  1JB7 A;  4OEL B;  1QWY A;  2IT1 A;  1XTC D;  5D65 A;  3OTO Q;  2B29 A;  1D1I A;  1VQN A;  1NR2 A;  3F2U A;  2QDL A;  2PMZ B;  4ALP A;  1B70 B;  2JQO A;  1B1Z A;  1E2V A;  1C8C A;  4K6L A;  4J15 A;  3I8Z A;  4JI0 Q;  4A3D B;  1NNX A;  1VQG A;  1PH4 A;  2JK8 A;  4FO2 A;  4K6D A;  4A3E B;  1G8Z D;  1SNM A;  3I2Z A;  3TS0 A;  3D0F A;  3K0Y A;  3R8B A;  3T16 A;  1PH3 A;  3HOU G;  2F4V Q;  2XRS D;  2VS1 A;  5DAU A;  4KJO A;  3P75 A;  2F3W A;  4LJZ C;  1OTC A;  1Q90 A;  1EY8 A;  4KY5 A;  4NXM L;  5IY0 A;  5EBD A;  5IGG A;  3KYH C;  1XYI A;  3K7A H;  4DV7 Q;  4UP7 A;  4Q5V A;  3NEN A;  3CRL C;  1HHV A;  5CMD A;  4A3G H;  4X65 Q;  1O78 A;  2QA4 A;  1MHW C;  1CA5 A;  3TZD A;  4C3I H;  1NUC A;  2IX1 A;  3OIQ A;  1RCV D;  4V19 0;  2BCO A;  3S2D B;  1U0L A;  3S1Q B;  1D5Z C;  1YNJ C;  5E7N A;  5LL6 S;  3LWU A;  3DXJ C;  2KQ3 A;  3PO3 H;  3BVZ A;  1YNN C;  3DWA A;  3K5M A;  1HNX L;  3X3M A;  3MFG A;  3AFQ A;  1N32 L;  4IUP A;  4KKU A;  2FMC A;  2NN6 H;  4DV6 Q;  4GNX C;  1LTG D;  1PH2 A;  2I5M X;  3I4M H;  3CKI B;  5DM6 3;  3RZO B;  4DR7 Q;  5C3E B;  4NXN L;  3M7N A;  3S2H B;  3A56 A;  2A68 D;  1WOC A;  1W6K A;  2WAQ B;  1WI5 A;  1SMY D;  2B2V C;  2ALY B;  1PYB A;  5FO9 B;  1VQK A;  2RHQ B;  1HTL D;  3I70 A;  3DM1 A;  1Y1V B;  1Q8I A;  4A4I A;  3C46 A;  4UY8 C;  1PH1 A;  4DK6 C;  1EZ8 A;  5L37 A;  1R9T H;  1UNS A;  1YNJ D;  2P5Z X;  4BBS B;  4YHH Q;  1I50 H;  1LAC A;  2BDO A;  2OF1 A;  4OO1 G;  5JEA H;  2ENB A;  2K5H A;  1STA A;  1FGU A;  3UI2 A;  1LT6 D;  2ASB A;  3AB9 A;  3LNN A;  2B8F A;  3K59 A;  3IAY A;  2ES2 A;  3G4S A;  1IYJ B;  4IUR A;  2OT2 A;  4X66 Q;  1EL0 A;  1HZ9 A;  5C0X H;  4A3F G;  2WP8 J;  1OO9 B;  2F0V A;  1C4Q A;  2A19 A;  4DR7 L;  1Y1V G;  2VZA A;  3DMU A;  3I4L A;  4C3H B;  1DD2 A;  2HUG A;  2JEB I;  4C3J H;  3GV6 A;  1PH8 A;  2IHF A;  5IYC H;  1IBM Q;  3E5S A;  2H4O A;  4HID A;  4A3G G;  2WKC A;  1DYQ A;  1HFN A;  4F8M A;  2IW3 A;  5IGB A;  3L0O A;  3P20 A;  5CR3 A;  1QUQ A;  1K28 A;  1ASY A;  2B2W C;  1LTA D;  5I9P A;  2AUK A;  3R2T A;  3T13 A;  2K5W A;  4LAA A;  4IOA A;  4A3B B;  4TQU S;  1PRT D;  4OXP A;  4ZYS A;  3HOY H;  2Z4H A;  1STG A;  1EIF A;  1SR3 A;  1ENF A;  4F7X A;  2RKS A;  4DV4 Q;  1JOR A;  1EYG A;  4X66 L;  4L5R C;  2XNA C;  2HIV A;  2B2T C;  1S3O A;  4BY1 G;  1KC8 C;  1E24 A;  4H7B A;  5AFW A;  3KDF A;  1LLR D;  2DUD A;  2B8G A;  3OTO L;  5C4J H;  2IWH A;  3HEJ A;  4QIW B;  4BWG B;  2KUM A;  1N8R C;  1NMG A;  3MXU A;  3CC4 A;  1HQM C;  1VQD A;  1EY4 A;  3KLS X;  3EN2 A;  1GUT A;  1T5E A;  5J39 A;  3D31 A;  4ZUI A;  1SYC A;  4IAL A;  1BXT A;  5I2X A;  3T4A C;  2CW0 D;  4LFC L;  4BBS H;  4K8I A;  2XSC A;  1WD1 A;  4AQY L;  2E2I B;  2UUA L;  2K14 A;  3J81 L;  1PRT B;  1HNX Q;  4BBR B;  2E8G A;  2LS0 1;  1FJG L;  3NP8 A;  1WTQ A;  1RJT A;  1N36 L;  5JEA G;  1A3T A;  1AN8 A;  2LKV A;  2YYZ A;  3HOY B;  2WFW A;  2VQF Q;  1CTM A;  5IT9 c;  2UUB Q;  1V43 A;  4IUT A;  1KDB A;  1A3U A;  2Z1C A;  3MXP A;  2NVX B;  4IOC A;  3FP9 A;  4G57 A;  5FKA C;  4FXD A;  1DGS A;  4LFC Q;  1FYC A;  2F0J A;  1EOV A;  4ZAI A;  4WJ3 M;  4IUV A;  1R4Q B;  4DR2 Q;  2DN8 A;  4JI8 Q;  4J1M A;  2VB3 X;  4C3J G;  1CSP A;  1HTP A;  1EWI A;  1S5F D;  3QG1 A;  3K81 C;  1O80 A;  4IPC A;  3J80 i;  2CCZ A;  5I9O A;  1GJX A;  3S1Q H;  2F3I A;  4MTN A;  1XPU A;  5T1G A;  1PTO D;  2QEJ C;  3HG9 A;  2NTS A;  3GV3 A;  3HOZ B;  4X3S A;  1JOQ A;  2B2V A;  1EU4 A;  2F0N A;  1DON A;  3K5L A;  2DNC A;  3QR8 A;  4PMB A;  2PMZ E;  4UP8 A;  4NW2 A;  3GTM B;  4LF6 L;  2C5C A;  2CVR A;  2B63 H;  2B2Y A;  1IKL A;  5KGU A;  1I5F A;  5LMU L;  2F0G A;  3K7A B;  4RKB A;  1XPR A;  3PO2 H;  1OXU A;  3HOW B;  3OSO A;  1CKN A;  2R7Z G;  3KFU A;  1S5E D;  2VB2 X;  1KIX A;  4H0L C;  3VR2 A;  1IKM A;  2EYM A;  4YCV A;  1N33 Q;  1FNV A;  5IT9 L;  1IXR A;  1PH6 A;  2MUY A;  1JIC A;  3STB C;  1NY4 A;  5A35 A;  2B2U A;  3KOJ A;  3GTP H;  3S14 B;  3T1H L;  2HDL A;  3GTK B;  1B3Q A;  2KEC A;  1YEZ A;  1WTV A;  2M9V A;  3U4V A;  5C4X G;  2G9D A;  3D8G A;  2R93 G;  5ELB A;  4DR3 Q;  2I46 A;  3S9W A;  4F87 A;  2Q2H A;  1JE5 A;  2QEX A;  1TR5 A;  5IGF A;  4B3M L;  1A8V A;  3I90 A;  1KTK A;  5IT9 E;  1JB3 A;  1LT5 D;  1HPC A;  5C4J B;  2E2J H;  5ISR A;  2B2W A;  5J22 A;  3BYT B;  2JA5 G;  2AWN A;  4GLA C;  1Q82 C;  2YTX A;  1UE5 A;  1XMO L;  2I0Q A;  4EQP A;  3L7Z C;  3QB3 A;  1QIL A;  1VQJ A;  4KKT A;  3X3N A;  3CCR A;  4C1N K;  5F2D A;  3VR5 A;  1SXT A;  2JSO A;  4KLK A;  4M1U B;  1E22 A;  1STH A;  3QIA A;  1VMC A;  1SYE A;  4JI2 Q;  4DAY B;  2PPB C;  1WCM H;  3P7J A;  5C3X A;  4OIJ A;  1K83 B;  3LGJ A;  1IBL L;  4JVZ A;  2E2D C;  4LF7 Q;  4KK7 A;  2PNR C;  3H0G B;  3GQB A;  3MHB A;  1XMO Q;  1CKN B;  1JJC B;  1HUN A;  2JA8 G;  2Z6K C;  2QIL A;  1EQQ A;  3S16 B;  1LTR D;  2JYO A;  4CKC A;  3CC7 A;  4HTH A;  1LAB A;  1RIP A;  2F0L A;  2HD3 A;  5M5W B;  1EIY B;  5A2Q L;  2F3V A;  2Y0S E;  1JR0 D;  1RF2 D;  4P2C B;  1EY5 A;  2R7Z H;  3QOL A;  3TZU A;  1U4R A;  4HJ9 A;  4IUN A;  3RUZ A;  1SFO B;  3PF4 A;  3HOX B;  2RDH A;  1KNE A;  1ILQ A;  1SN8 A;  4RCN A;  1HCZ A;  3IRB A;  3OHX C;  4PNY A;  3A8I E;  3FKI G;  1EOT A;  1I4G A;  4A3D H;  3J81 E;  3BYY B;  1FL0 A;  3H15 A;  1TWG B;  3IFD A;  4DXG A;  1GHK A;  2MFI A;  1IL8 A;  1I4Q A;  1WCM B;  2BH8 A;  4IFD G;  4X65 L;  1Y1W H;  1TKW B;  1Y69 U;  4A3I G;  2KCT A;  1M4V A;  2RDF A;  5C4X H;  1Q8K A;  1J9O A;  2NBF A;  3MXG A;  2F0O A;  3MZ5 A;  4NP5 A;  4HJ8 A;  4R8I A;  4B3R L;  2KJX A;  1O7Z A;  4R9W A;  3OWF A;  4OHJ A;  2XGT A;  4PZ6 A;  2I07 B;  3DWQ A;  3JAM i;  1EIH A;  1SE3 A;  4YY3 Q;  3I73 A;  3NBH A;  1A3V A;  2JA5 H;  2PYK A;  2WII B;  1A15 A;  2D0P A;  3HGB A;  2GVB A;  2JA6 B;  2EZV A;  4NMZ A;  3CCM A;  2CW0 C;  4QGU A;  1EWC A;  1UEA B;  4RGM A;  4JI6 Q;  3D6C A;  2ZTC A;  1X3F A;  2F0Q A;  3VA7 A;  2LXJ A;  2AQ2 B;  1FNW A;  5M3M H;  1IW7 C;  2Q2U A;  4JCV E;  3H6M A;  1U9R A;  3HP3 A;  3CC2 A;  2JA6 H;  5FOB B;  3ULL A;  1EEI D;  3AMU A;  3E3X A;  3L2P A;  4LF6 Q;  1KQS A;  4L6T B;  4FDB A;  3G6J B;  2B2U C;  4JYA L;  1LTT D;  3AYH B;  4OON A;  4U68 A;  2MP1 A;  3MEF A;  2JA8 H;  1F9Q A;  2MHV A;  1PRT C;  2E74 C;  4ZKC B;  4CGY B;  2F0T A;  3SGI A;  3CQZ B;  4GOP A;  1V1P B;  4G4K A;  5I2Y A;  1Z7T A;  5CV6 A;  1SYB A;  4QB4 A;  3OMC A;  2EYP A;  2MJ8 A;  3M4O H;  3NK9 A;  5ELE A;  4NB3 A;  3J81 i;  4O42 A;  5CGK A;  3I4O A;  3W5O A;  2VW9 A;  2VUM G;  4HSV A;  3K0X A;  1RTO A;  4G7H C;  5JPN C;  4YIJ A;  3NWT A;  4O0A A;  2K1B A;  2O2L D;  4JI5 Q;  4A93 G;  4R4Q A;  5ELC A;  4E6I A;  4DR4 Q;  3BJU A;  1SE2 A;  4L5Q A;  4A3G B;  2GN5 A;  1A0I A;  1JWU D;  4IZ8 A;  4JI7 L;  3EVQ A;  2I5H A;  3OPO A;  1HNZ Q;  3GTJ H;  4GLV B;  3PCO B;  1BCP C;  1CHQ D;  1JE4 A;  3J7Z C;  3F1Z A;  1STB A;  1B2T A;  1QZG A;  2PQA A;  4HAE A;  2OTJ A;  1VQ7 A;  4KY6 A;  3GTG H;  4ZQ3 A;  5M9O A;  4BY7 G;  1I4R A;  4FYD A;  2VY3 A;  4ZLT F;  1LUZ A;  1DJR D;  3ERO A;  4DR5 L;  1A63 A;  5M3M G;  5DM7 3;  1X65 A;  1EFW A;  5COY A;  4XQQ A;  1EYC A;  3U58 A;  3KLS A;  1SMY C;  4DNT B;  1BF4 A;  1VQC A;  2PQE A;  4Y7N H;  4B08 A;  2L1B A;  2YU9 B;  2Z6B A;  1VCI A;  1VS0 A;  5A2Q E;  5M5X H;  5I4D A;  3ND8 A;  4KN7 C;  4RGT A;  1Q12 A;  3STB D;  3CQZ H;  2ZXR A;  2MO0 A;  5IP9 H;  1M90 C;  5FJ8 G;  3HOW G;  5IGE A;  1EYA A;  2K52 A;  2EDG A;  4EX5 A;  4QL5 A;  2LY7 A;  3S2H H;  3T1H Q;  3A5Z B;  5FK9 C;  4K5W A;  4HCS A;  4I65 A;  2XIW A;  2OQK A;  2NVQ B;  3A8K E;  2KCC A;  4C1N I;  4CJ1 B; 
#chains in the Genus database with same CATH homology
 2K5N A;  1K8G A;  1JJ2 A;  3GO5 A;  4IPH A;  4HID A;  4P73 A;  4A3G G;  4DV1 L;  2HT1 A;  4DV5 Q;  1J6Q A;  1WCM G;  3S1N H;  2JEA I;  3CCJ A;  1OXT A;  5J3B A;  3UDF A;  3VDY A;  4LF8 L;  2UXC L;  3L0O A;  3U50 C;  3KJO A;  1QUQ A;  1GO3 E;  1QUQ B;  4A3D G;  3I4N H;  4JBW A;  3EIV A;  1G6P A;  2V1C C;  5C3E G;  4DUZ L;  1ASY A;  3G48 A;  3CMA A;  3RLN A;  4IJL A;  3UDI A;  2DGY A;  2VQF L;  4HIM A;  4GN5 A;  4OWX B;  2BA0 A;  3TRZ A;  2ZTE A;  4IOA A;  2WAQ G;  1MIU A;  3CAM A;  1NMF A;  3UDG A;  2GVA A;  4LUO A;  1YHQ A;  1IBL Q;  4TQU S;  2NVQ H;  1CSQ A;  1Y1W G;  4OXP A;  1KAW A;  4JI5 L;  3HOY H;  4H02 A;  4A3L G;  4A3I H;  4KHP L;  5EAY A;  1EIF A;  1SR3 A;  4YWK A;  4DNI A;  4GOP B;  1YIJ A;  1BBW A;  3CPF A;  4LF8 Q;  3RZO H;  3RLF A;  1D7Q A;  4DV4 Q;  3CF5 A;  1EYG A;  4X66 L;  5IP7 H;  3GD7 A;  2ID0 A;  4L5R C;  4B3T Q;  2HIV A;  1VQA A;  4LUV A;  1B8A A;  4LFA Q;  1S3O A;  4BY1 G;  1KC8 C;  1E24 A;  4EQ5 A;  3A74 A;  1E1O A;  4JG2 A;  3S2D H;  3KDF A;  2DUD A;  5IYD H;  3UE0 A;  3OTO L;  5C4J H;  4DR6 L;  1HNW Q;  2UUC Q;  3PV0 A;  1XNQ Q;  1Q1E A;  3FKI H;  4JI4 Q;  4KHZ A;  4KI0 A;  1N8R C;  1NMG A;  1YJW A;  4DV0 Q;  1Q81 C;  3CC4 A;  2VNU D;  5JJK A;  5IE8 A;  1O7I A;  4XIG S;  1VQD A;  5GQO A;  2CQO A;  3CCQ A;  3UDX A;  3A0J A;  2ZJP A;  3EN2 A;  4JV5 L;  2EQS A;  3D31 A;  3PIP A;  3TRE A;  4A3E G;  2Z6K A;  1GM5 A;  2ZM6 Q;  4X64 Q;  2A8V A;  4BBS H;  4LFC L;  2IY5 B;  5JJI A;  1K83 H;  3I56 A;  1SMX A;  3KJP A;  4AQY L;  1N32 Q;  1L2F A;  4X64 L;  2UUA L;  3KLW A;  3PSI A;  2HIX A;  1PVO A;  1VQE A;  4AIM A;  2RHS B;  5IYB H;  3HOX H;  4DUY Q;  1N33 L;  2K14 A;  3PUW A;  2K75 A;  5GAE C;  1J5E L;  3HOV H;  1VQL A;  5GRO A;  4B3S Q;  1HNX Q;  2E8G A;  1FJG L;  5ELN A;  1VQ9 A;  2F4V L;  3G6E A;  3HKZ E;  2KEN A;  1N36 L;  5JEA G;  1E7Z A;  1JT8 A;  4YWL A;  3S15 H;  1XNQ L;  1VQF A;  4A3J H;  3HOU H;  3ER0 A;  4GKJ Q;  5LMU Q;  2YYZ A;  3BU2 A;  2VQE Q;  2WFW A;  4JI0 L;  3NBH B;  5AJ3 L;  2VQF Q;  3TS2 A;  3CW2 C;  5IT9 c;  1LYL A;  2UUB Q;  1V43 A;  4HJ7 A;  4JI6 L;  4B3T L;  2HHH Q;  2AKW B;  1EQR A;  5M5Y H;  1I6H H;  3ZJY C;  4IOC A;  1TWH H;  3FP9 A;  3F2C A;  3ULP A;  2N8N A;  2E2H H;  4LF5 L;  1DGS A;  3RNU A;  4LFC Q;  3KDF B;  3M4Q A;  1UE7 A;  4OWT B;  4JI8 L;  5IP9 G;  4B3S L;  1EOV A;  3CCU A;  4DV5 L;  4WJ3 M;  1EUJ A;  4DR2 Q;  1X3E A;  1KHI A;  2ATW A;  4JI8 Q;  5JJL A;  3FHW A;  4BXX H;  3U4Z A;  3PUZ A;  3F2D A;  4A3B G;  1CSP A;  3W1G A;  5LMN L;  4GNX A;  1EWI A;  4GS3 A;  3K81 C;  2JA6 G;  1QVF A;  3I7F A;  4IPC A;  3J80 i;  3J81 j;  2CKZ B;  2CCZ A;  2HHH L;  1V9P A;  3HKS A;  4GN4 B;  2UUC L;  3AEV A;  2XTI A;  4ME3 A;  3S1Q H;  2ZM6 L;  1KXL A;  1TWF H;  2F3I A;  4MTN A;  1XPU A;  4GKK L;  1Z47 A;  2C35 B;  1X56 A;  1CKM A;  1X54 A;  4LF4 Q;  2E5L L;  2NZO A;  1XTD A;  4GKK Q;  4DV3 L;  2VUM H;  4RMF A;  1YIT A;  2CWP A;  1XMQ Q;  2YV5 A;  3CCV A;  2PMZ E;  2PQA B;  3PGZ A;  4UP8 A;  4L5T A;  1P16 A;  3S24 A;  1OXX K;  1JMC A;  4LF5 Q;  1S40 A;  2N3S A;  4JI4 L;  2EIF A;  2MO1 A;  4LF6 L;  4A93 H;  1WYD A;  3KF6 A;  1L1O A;  2B63 H;  2VQE L;  4DPG A;  3T1Y L;  1I5F A;  4GN3 B;  5LMU L;  2ZTD A;  2UXD Q;  4QY7 A;  4QIW E;  5H1S E;  1E3P A;  1SRU A;  4XTC S;  4L5S A;  4PMW A;  1XPR A;  3PO2 H;  4R4O A;  1OXU A;  4B3R Q;  2NZH A;  1CKN A;  2R7Z G;  3KFU A;  2KHJ A;  3WWV A;  1KIX A;  3S1M H;  1BKB A;  1I94 Q;  1CUK A;  2YU9 H;  1VQI A;  2OWO A;  4OX9 L;  3H0G G;  3RN2 A;  4YCV A;  3PIO A;  4DR2 L;  1N33 Q;  1IXR A;  2NVY H;  1PH6 A;  1PA6 A;  3STB C;  4AQY Q;  2RF4 A;  1NY4 A;  2R92 H;  1GD7 A;  2KBN A;  1LTL A;  3KOJ A;  4DV2 L;  2AWO A;  4LFA L;  1Q1B A;  4LUZ A;  1B7Y B;  2R7D A;  2CFM A;  3GTP H;  1UE6 A;  1VQO A;  1K73 C;  2K5V A;  4X62 Q;  3T1H L;  3PF5 A;  4JI2 L;  1Q7Y C;  1L0W A;  3NEL A;  4X6A H;  4AH6 A;  1FJG Q;  4JV5 Q;  3E9I A;  2JE6 I;  3W1B A;  4DR5 Q;  2BH2 A;  4A3E H;  1YEZ A;  1TXY A;  4GKJ L;  1AH9 A;  3PO3 G;  5FLM G;  2E5L Q;  4LF4 L;  4LF7 L;  3U4V A;  1VQM A;  1C7Y A;  1PH9 A;  2UUA Q;  5C4X G;  3HOX G;  3OW2 A;  4JOI A;  4JI1 L;  3CME A;  4R4T A;  2R93 G;  4DR3 Q;  1M1K C;  5GAD C;  4GOP C;  2Q2H A;  4DR1 L;  1JE5 A;  2QEX A;  3NEM A;  4DR6 Q;  3I4M G;  1YZ6 A;  3M85 A;  4DV4 L;  1PH5 A;  1A8V A;  4B3M L;  3ICE A;  4JBJ A;  4BA1 I;  5C0X J;  5C0X I;  4A75 A;  2E2J H;  3S17 H;  2MQH A;  1L1O C;  4P72 A;  5M3F G;  2JA5 G;  3ERS X;  3CD6 A;  2AWN A;  4GLA C;  1Q82 C;  2UXB L;  2YTX A;  4P71 A;  1IBM L;  1UE5 A;  5IWA L;  2KCM A;  1XMO L;  4A3F H;  5JEA J;  3HOZ G;  3T1Y Q;  2UXD L;  3F8T A;  2I0Q A;  1UEB A;  3HOW H;  4BY7 H;  3L7Z C;  2UU9 Q;  4LFB Q;  1HZA A;  1VQJ A;  2K4K A;  3CCR A;  1K8A C;  2UU9 L;  3H3V H;  3J81 c;  1SLJ A;  2K50 A;  4KLK A;  1E22 A;  4POG A;  4OWW B;  4DV1 Q;  2KHI A;  5IYC G;  2D0O A;  4DV3 Q;  2WB1 G;  4PZ7 A;  4DK3 C;  1SRO A;  4JI2 Q;  4DAY B;  4X62 L;  4PZ8 A;  2WAQ E;  4Y52 H;  3A5U A;  2F52 A;  2MNA A;  1T9H A;  2NVT H;  1WCM H;  1HR0 W;  4R1J A;  1IBL L;  3LGJ A;  4AYB E;  4LFB L;  1TWG H;  4BBR G;  3HKZ G;  2D62 A;  4LF7 Q;  2Z0S A;  1S72 A;  3G71 A;  4POF A;  2Y0S G;  4JI1 Q;  5IWA Q;  1XMO Q;  1K0R A;  4OX9 Q;  1CKN B;  4DR3 L;  3PUV A;  3GTO H;  1JJC B;  3HFZ B;  4QQB X;  2JA8 G;  2YTV A;  1Q46 A;  2Z6K C;  5C0X G;  2YTY A;  1EQQ A;  3RR5 A;  4NPS A;  3CC7 A;  5K36 G;  5FJ8 H;  1AE2 A;  2EXD A;  1RIP A;  1PH7 A;  1BBU A;  1EIY B;  1Y1V H;  2Y0S E;  1TWC H;  3K80 C;  1HR0 Q;  1CKO A;  1NTG A;  3B6Y A;  2QGQ A;  4DV2 Q;  1AE3 A;  2L15 A;  1XNR Q;  2R7Z H;  4IPG A;  1C9O A;  4HJ9 A;  2JA7 H;  1V1Q A;  5BR8 Q;  4AYB G;  1N34 Q;  2LSS A;  4BY1 H;  3GTK H;  3PF4 A;  2UXC Q;  2IX0 A;  1HH2 P;  1I94 L;  4IPD A;  1RL2 A;  5HGQ A;  5IYD G;  1UE1 A;  1SN8 A;  2AMC B;  1JJG A;  3IRB A;  1SE8 A;  5M5W H;  4LW1 A;  3FKI G;  1W2B A;  1VQH A;  4IFD I;  3UE1 A;  1UWV A;  4DAM A;  3K8A A;  2IHE A;  4A3D H;  1YBY A;  3I4N G;  3S16 H;  1YNX A;  4B3M Q;  1FL0 A;  3H15 A;  2I5L X;  2NN6 I;  4JI7 Q;  2R7F A;  1OXS C;  4A3M H;  2MFI A;  4BBS G;  4IFD G;  2BH8 A;  4K0K Q;  2OCE A;  3BZK A;  1XMQ L;  3M9B A;  4DR4 L;  4X65 L;  2PI2 E;  1Y1W H;  4A3L H;  3HOY G;  4MZ9 A;  3TQY A;  5HY6 A;  2KCT A;  5FLM H;  5LMN W;  4A3I G;  4JYA Q;  4JBM A;  3CP0 A;  1E1T A;  5C4X H;  1GVP A;  3CPW A;  1Q8K A;  4A3K H;  3GDE A;  2NN6 G;  2UXB Q;  5IP7 G;  1U5K A;  4DV7 L;  1G29 1;  2FXQ A;  4YCW A;  1K3R A;  4HJ8 A;  4IFD J;  4B3R L;  4A3J G;  3JC6 6;  1VQ5 A;  1Z9F A;  1P8L A;  1L1O B;  3AFP A;  3KF6 B;  3MXN B;  1X55 A;  2XGT A;  4PZ6 A;  3CCE A;  2OTL A;  4P74 A;  3JAM i;  2HQL A;  4IO9 A;  4YY3 Q;  1X3G A;  5M3F H;  2JA5 H;  2D0P A;  2GVB A;  2VL6 A;  2JA9 A;  3JAM c;  3GTQ H;  3HOZ H;  1HNZ L;  4DKA C;  2AHO B;  5DLQ E;  2Q2T A;  3CCM A;  4A3C H;  1JB7 A;  2N49 A;  4QGU A;  4DV6 L;  2IT1 A;  1KRS A;  3OTO Q;  4JI6 Q;  2B29 A;  4R4C A;  1VQN A;  2ZTC A;  1X3F A;  4BXX G;  2LXJ A;  4ALP A;  1B70 B;  2JQO A;  5M3M H;  4JC0 A;  2R6G A;  2Q2U A;  4JCV E;  5C44 G;  4HIO A;  4DR1 Q;  3S1R H;  1XPO A;  4J15 A;  1Q86 C;  1GKH A;  3CC2 A;  1VQB A;  1VQ4 A;  1YI2 A;  1NBW A;  4JI0 Q;  4LF9 Q;  2JA6 H;  3ULL A;  1VQG A;  3BZC A;  3L2P A;  3OYY A;  1PH4 A;  2BA1 A;  2JK8 A;  4LF6 Q;  4O2D A;  1J5E Q;  4YWM A;  1KQS A;  4FDB A;  3I2Z A;  3F2B A;  3D0F A;  3TS0 A;  5FLX c;  1PH3 A;  3HOU G;  4JYA L;  2F4V Q;  1N36 Q;  2VS1 A;  3AYH B;  4BBR H;  4OO1 I;  1A62 A;  1PYS B;  4OON A;  1PFS A;  3DLL A;  2N78 A;  4NXM Q;  1OTC A;  3S14 H;  3MEF A;  1N9W A;  3EBE A;  2JA8 H;  5GAH C;  2UUB L;  4NXM L;  3Q8D A;  1YJN A;  1QVC A;  3M4P A;  1MJC A;  5IY0 A;  4TVA B;  3KYH C;  3M3Y H;  2OQ0 A;  1QZH A;  4R4I A;  3SGI A;  3K7A H;  2E2I H;  2H5X A;  4JI3 Q;  3RZD H;  4DV7 Q;  4GOP A;  4A3B H;  4UP7 A;  1HJP A;  3NEN A;  1VQP A;  1C0A A;  4A3G H;  2JA7 G;  4X65 Q;  3M4O H;  3H0G H;  1D8L A;  4P75 A;  4UP9 A;  2QA4 A;  1IL2 A;  4NB3 A;  3J81 i;  2WB1 E;  1WFQ A;  3ULJ A;  4C3I H;  2IX1 A;  1WJJ A;  1OXV A;  3I4O A;  3W5O A;  2R92 G;  2VW9 A;  1KL9 A;  1W3S A;  5GAG C;  1XNR L;  3H3V I;  2PI2 A;  5C3E H;  4KHP Q;  1YVC A;  2VUM G;  1U0L A;  1FVI A;  3K0X A;  4IJH A;  3PUY A;  4LWC A;  5ELO A;  5E7N A;  4LNQ A;  4WJ4 A;  4RG1 A;  2Q2I A;  4O0A A;  4A76 A;  4A3M G;  1KD1 C;  4JI5 Q;  3GTL H;  1H95 A;  4A93 G;  1KRT A;  4R4Q A;  3PO3 H;  4JBK A;  2B63 G;  4K0K L;  3DM3 A;  1HNX L;  4DR4 Q;  3BJU A;  2LXK A;  4L5Q A;  3CXC A;  4HJ5 A;  3AFQ A;  2PNH A;  1QVG A;  3RN5 A;  1N32 L;  2GN5 A;  1A0I A;  3PO2 G;  2R93 H;  4YY3 L;  4JI7 L;  4A3K G;  4DUY L;  1LM0 A;  1NJI C;  4QJF A;  4DV6 Q;  1VQ8 A;  4GNX C;  1YHA A;  2JJQ A;  1G51 A;  1NE3 A;  1PH2 A;  2NVX H;  5AJ3 Q;  2I5H A;  1HR0 L;  2I5M X;  1HNZ Q;  4YCU A;  3I4M H;  1IZ6 A;  4MNO A;  5LMN Q;  4DR7 Q;  3GTJ H;  4GLV B;  4NXN L;  3M7N A;  3PCO B;  4C3H H;  4GLX A;  4UPA A;  1WOC A;  4JI3 L;  3I55 A;  3J7Z C;  2ZJR A;  1TWA H;  3F1Z A;  1QZG A;  2PQA A;  4HIK A;  1VQ6 A;  2OTJ A;  3CCL A;  1WI5 A;  3TEH B;  1XJV A;  1VQ7 A;  2ALY B;  1PYB A;  4HJA A;  4LF9 L;  3GTG H;  4DUZ Q;  1VQK A;  4PG3 A;  2RHQ B;  4BY7 G;  4A3C G;  2VY3 A;  3KF8 B;  4APV A;  1LUZ A;  1IBK Q;  4A4I A;  4UY8 C;  5IYB G;  4DK6 C;  4DR5 L;  1PH1 A;  1R9T H;  1A63 A;  5M3M G;  1YJ9 A;  3RLO A;  1X65 A;  1HNW L;  3E9H A;  1HZC A;  3PUX A;  3HOV G;  1EFW A;  5C44 H;  4GNX B;  2CWA A;  4YHH Q;  1SFO H;  1I50 H;  4OO1 G;  2K5H A;  4YHH L;  1FGU A;  3U58 A;  2ASB A;  1VQC A;  4Y7N H;  1K9M C;  1YHB A;  4C2M H;  1PV4 A;  2ES2 A;  3G4S A;  1HZB A;  1PHJ A;  1VCI A;  1VS0 A;  1IYJ B;  3J7A 5;  5M5X H;  3E0E A;  3CCS A;  4X66 Q;  1BVS A;  1HZ9 A;  1ASZ A;  1Q12 A;  3K7U C;  1Y14 B;  2RCN A;  3CQZ H;  3STB D;  2WP8 J;  4A3F G;  2MO0 A;  5IP9 H;  4DV0 L;  1M90 C;  4NXN Q;  4BA2 I;  3AQQ A;  2A19 A;  5FJ8 G;  3HOW G;  4DR7 L;  2K52 A;  1IBK L;  1X6O A;  2B3G A;  4EX5 A;  4QL5 A;  1Y1V G;  2VZA A;  3S2H H;  2A1A A;  3T1H Q;  3A5Z B;  2JEB I;  1MJE A;  1X9N A;  4C3J H;  2ZJQ A;  1MKH A;  3GTM H;  5BR8 L;  1N34 L;  1PH8 A;  2OQK A;  3J80 c;  2IHF A;  5IYC H;  1IBM Q;  1I3Q H;  4JOI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...