1GD7A

Crystal structure of a bifunctional protein (csaa) with export-related chaperone and trna-binding activities.
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
109
structure length
109
Chain Sequence
MTPLEAFQILDLRVGRVLRAEPHEKARKPSYKLWVDLGPLGVKQSSAQITELYRPEDLVGRLVVCAVNLGAKRVAGFLSEVLVLGVPDEAGRVVLLAPDREVPLGGKVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords CSAA PROTEIN
publication title The crystal structure of the ttCsaA protein: an export-related chaperone from Thermus thermophilus.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 22
structure length 109
sequence length 109
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01588 tRNA_bind Putative tRNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1gd7A00
3KJPA 1FVIA 3H0GH 4P75A 3HOXG 4DV4Q 4DV5Q 1GM5A 4HIDA 3E9IA 5FLMH 1HNZL 2UUBQ 1OTCA 1WI5A 3F1ZA 4B3SQ 3I4NG 3CP0A 3S1NH 2LXJA 4PZ8A 2F52A 1NY4A 5IP9H 1PFSA 1FJGQ 2JQOA 3PF5A 2ES2A 2AMCB 4OWXB 4Y52H 1Q1BA 2RHQB 2Q2IA 3T1HL 3J81i 1Q7YC 1IBKQ 4JI8L 1VQEA 4GKJL 4A3BG 1YJNA 4JV5L 4JBJA 3J80c 2QA4A 3E9HA 3HOYG 2CWAA 2DGYA 2I5LX 2UUCL 3RR5A 1EFWA 1A8VA 4IPHA 3UDXA 1G51A 4UY8C 3K0XA 4P71A 2EIFA 2I5HA 4PZ6A 1EWIA 1TWHH 3I2ZA 4JBWA 4LFAQ 1UE5A 4YY3L 3J81c 1K9MC 1JJ2A 1T9HA 5LMNQ 2HT1A 1G6PA 3PSIA 2GVBA 4IPDA 4DV7Q 1HH2P 4LF4L 4YWMA 3OW2A 1I94Q 3ICEA 5IY0A 2VQFQ 3PUVA 3T1YQ 2R7ZH 1N34Q 1VQ4A 1Y1WG 4KLKA 5C0XG 3H3VH 2F4VL 5C3EH 4DR3Q 4BY7G 1CSPA 2GN5A 4BA1I 5AJ3L 3HOXH 5IP7G 1IXRA 5IE8A 3I4NH 3CW2C 1AH9A 4Y7NH 4LF7L 2UXCQ 1L1OA 4X62Q 1TWCH 3BU2A 4H02A 2MNAA 2R92G 1XPUA 2CQOA 2B63G 1HNXL 1GD7A 2DUDA 1SLJA 4AYBE 1HR0L 4GLVB 4A3BH 1JE5A 4QY7A 4AIMA 1EIYB 1IL2A 4A3IH 4YCWA 3HOYH 3S15H 1XPRA 1YZ6A 4UP9A 1KQSA 5M5YH 1XMOL 4C3JH 1SRUA 1C7YA 5JJIA 3GTGH 3I56A 4GKJQ 3ZJYC 4JV5Q 4JI7L 2UUAL 4OX9L 2WAQG 2CWPA 2K52A 4IPCA 3L2PA 3GTQH 3M4PA 1BBUA 5GQOA 2ID0A 2JJQA 4APVA 4HJ5A 4B3TL 4DR7L 4P72A 1LUZA 3CMAA 4BBSG 2HIVA 4A3FG 3TRZA 1R9TH 4YY3Q 1X3GA 2I5MX 3EBEA 3J81j 1UE7A 3I4MG 1IBML 3AYHB 1Y1WH 1OXTA 1YBYA 2JK8A 1GKHA 3RZOH 4BY7H 3EIVA 3U4ZA 1X65A 1LTLA 1M90C 1VQDA 4AH6A 3OYYA 5IP7H 2CFMA 4POGA 2FXQA 1Q46A 4LFBL 2NVQH 2F4VQ 2E5LQ 4TVAB 5FLXc 1J5EQ 2JEBI 4JI4L 3CC4A 3PUYA 2A8VA 1CKMA 2E2JH 5C4JH 2R92H 1LM0A 2KBNA 2B63H 3E0EA 4R4CA 1OXXK 2KHJA 3KFUA 4YWLA 3HOUG 3S14H 1S40A 2UXDL 3A5UA 4J15A 5FJ8G 4AQYQ 4A3DG 3W1BA 2Q2UA 1N32Q 1J6QA 1IBLQ 4FDBA 2RHSB 4C3IH 1C9OA 4IPGA 1XMQQ 4GLXA 4DR6Q 3PGZA 2MO1A 2YV5A 4A3FH 2OTLA 5JEAG 1RL2A 3ULPA 4DK6C 5EAYA 2UUAQ 2VZAA 3I4MH 4JI5L 2ZJPA 4GOPC 5E7NA 4K0KL 2IT1A 1VQKA 4GOPB 2L15A 3NBHB 1VQAA 3LGJA 4JC0A 4JI1L 3ULJA 3GTJH 1YIJA 1OXSC 1VQNA 1IBMQ 2LXKA 2PNHA 3STBC 2D0PA 2WAQE 3KDFB 1XJVA 3PUWA 1PA6A 2B29A 3RZDH 4IFDJ 1SN8A 1NMFA 4PZ7A 5M5WH 5IYDG 4DV6Q 2HHHL 3HOVG 3NELA 4X64L 4JI0L 2QGQA 4NXML 2OCEA 1PVOA 4X65L 4A3EG 1YI2A 4DUZL 1VQPA 1AE2A 1SMXA 2IHFA 2JA8G 4JCVE 3HOUH 3AFQA 4JI6L 1S72A 2XTIA 3TS0A 1VS0A 3OTOQ 1QVFA 1E24A 5DLQE 5IT9c 1JT8A 2KCMA 3B6YA 4DR5Q 5FJ8H 1EQQA 1PH4A 4A3DH 1JJGA 5JJLA 2WP8J 2VUMG 1YHBA 4JYAQ 1MJCA 3SGIA 3PF4A 3J80i 2R7FA 4LF6Q 1XPOA 1YVCA 2A19A 3KLWA 1CUKA 2Y0SG 4DNIA 4X66Q 4IO9A 4DUYQ 1Q81C 1TWGH 2YTVA 3GO5A 1PH6A 2K75A 4X6AH 3KJOA 4GNXC 1N33Q 3IRBA 1K3RA 3HKZG 1W3SA 4GNXB 4DR2Q 3STBD 4GLAC 3F2DA 2JE6I 1K73C 1D8LA 4R4QA 1YJ9A 1NBWA 1B8AA 3RLOA 4OWTB 4K0KQ 1HZAA 4GN3B 5ELOA 4C2MH 2JA9A 1N36Q 2BA1A 3U4VA 2ZM6L 3UDFA 1PYSB 5IYDH 3CC7A 5C44G 3FP9A 3HOVH 2K50A 3CCQA 1X3EA 2PMZE 4YHHQ 2VQEL 1KL9A 4A3EH 5J3BA 4L5SA 2E2IH 2JA8H 1OXUA 1G291 1YEZA 4DAYB 1U5KA 1KD1C 4A3CG 4B3RQ 3CCSA 3PUZA 2CKZB 4A93G 1M1KC 3CF5A 2K5NA 4JI2L 3KF6B 1QUQB 2RF4A 4B3MQ 2VUMH 1VQOA 4A76A 2E2HH 5IYCG 2C35B 5GROA 1Q86C 1JB7A 4GKKL 5H1SE 5HGQA 2YU9H 1P16A 4IJLA 3RNUA 4DR4L 3TQYA 5GADC 1HR0Q 1WOCA 1QZGA 4JI3L 1HNZQ 4A3LG 4LF5L 2Z0SA 2JA5G 1TWAH 4JBKA 3RN5A 5IYBG 1PHJA 2BH2A 3PO2G 2PQAB 2NVYH 2UXBQ 3ER0A 4OWWB 3M3YH 1Y1VG 2IY5B 3T1HQ 4ME3A 4YCUA 1EQRA 3TEHB 2CCZA 4JI8Q 2MFIA 2N78A 5C44H 3L7ZC 4UP7A 3DLLA 4UPAA 4IJHA 2UUCQ 5BR8L 2F3IA 2Y0SE 3M85A 1H95A 5IWAL 2ZM6Q 2OQ0A 3HKZE 3PO3G 5C4XG 4A3CH 1Y14B 3K7UC 4A93H 1HZCA 2D0OA 2VQEQ 1A63A 3PUXA 1Z9FA 4C3HH 3FHWA 4LF4Q 2K5HA 3HOWG 3GTLH 4IFDI 3GTMH 4HIMA 2NVXH 4JOIA 1NTGA 1NE3A 2ZTCA 1N9WA 1Q8KA 1JJCB 4JI2Q 4DR1L 2OWOA 3HOZG 2MQHA 1XNRL 4A3JG 2AHOB 2KCTA 5AJ3Q 4DAMA 4A3LH 2Z6KA 2NZHA 1JMCA 1X6OA 2V1CC 5IYBH 1XNQL 3M7NA 1RIPA 1PYBA 4DR4Q 3A0JA 1VQMA 5C0XJ 4LF7Q 2D62A 3BZCA 4LF9L 2R7DA 1BBWA 1U0LA 1Z47A 1HZ9A 2UU9L 1Y1VH 4QGUA 3A74A 4HJAA 4LF5Q 4LF8L 1A62A 1WCMG 3UE1A 1QVGA 1HNXQ 1VQCA 4R1JA 1KC8C 3HFZB 3U50C 3JAMc 1PH1A 3CC2A 2WB1G 1PH9A 1V9PA 4IOAA 4DV1L 4LUOA 4QJFA 4OXPA 5ELNA 3KOJA 1XMOQ 1E22A 1XTDA 1L1OC 5GAEC 4BBSH 1KAWA 2BA0A 4JI7Q 1L1OB 1EUJA 4A3KG 2JA6G 2XGTA 5C4XH 4DK3C 3PO3H 3AFPA 4O0AA 3CQZH 4NXNL 3RLNA 4DR7Q 4B3TQ 1B70B 4DV3L 3TREA 4EQ5A 4DV4L 4DV5L 3HOWH 1E3PA 4TQUS 4LWCA 2UUBL 2N49A 4B3SL 1ASZA 1W2BA 2JA7G 4LW1A 1FJGL 1VQJA 3HOZH 4A3JH 3Q8DA 1FL0A 3CCMA 3CCUA 4DV0L 2A1AA 3K81C 4R4OA 1Q82C 5K36G 3CPFA 4OO1I 4LFBQ 2HQLA 1KRTA 4POFA 4P73A 5GAGC 3GD7A 1MJEA 1XNRQ 4JI4Q 4LUVA 4HJ7A 4PG3A 2PI2A 3S17H 2QEXA 1WCMH 3I55A 3I7FA 1E1OA 1YHQA 3CCLA 1KRSA 4LFAL 1HNWL 1QVCA 1CKNB 1DGSA 4OO1G 1TXYA 2UXDQ 3M9BA 3ULLA 4MNOA 4EX5A 2IX0A 4WJ4A 2GVAA 4DV7L 2UXBL 1K83H 1I94L 4A3KH 2JA6H 2VQFL 3RLFA 1N8RC 2JEAI 3H3VI 4LNQA 4DV1Q 3K80C 1N34L 2KENA 3G48A 1D7QA 4R4TA 2I0QA 2AWOA 1PV4A 1I5FA 4RMFA 2AWNA 4HJ9A 3S24A 3CCRA 4JI5Q 4QQBX 1QZHA 2HIXA 2WB1E 3J7ZC 2VY3A 3CXCA 5C3EG 3CCEA 4DV2L 2JA7H 4X62L 2Q2TA 4JI1Q 3G6EA 3S2DH 3M4QA 1VQHA 5JEAJ 1K0RA 4P74A 2ZTEA 1WJJA 1YNXA 4GS3A 5M3MG 1TWFH 1VQFA 2E8GA 2PI2E 3F8TA 3K7AH 4YCVA 3PIPA 2R6GA 2YYZA 3PCOB 1X54A 4XTCS 2ATWA 4A3GG 1HNWQ 2OTJA 3DM3A 2YTYA 4BA2I 3FKIG 4DV0Q 2HHHQ 3KYHC 4X64Q 4KI0A 4JI0Q 1MIUA 2Q2HA 4NXMQ 1WFQA 3MEFA 4X65Q 4DUZQ 2ASBA 1PH8A 2VNUD 1Q1EA 4XIGS 2EXDA 3W1GA 4A3IG 4JI6Q 1I3QH 4DPGA 1SFOH 1VQ6A 2ZTDA 4YWKA 1UE6A 1MKHA 4L5RC 3W5OA 2BH8A 5C0XI 1L0WA 2KHIA 1KHIA 4O2DA 1VQ5A 3F2CA 3U58A 4OX9Q 3K8AA 1PH7A 1VQLA 1L2FA 1NMGA 1IZ6A 3GTOH 1NJIC 1PH3A 1KXLA 2IX1A 2E5LL 1J5EL 1KIXA 1UEBA 4A3MG 3CCVA 4DKAC 5GAHC 3ERSX 5M3MH 3H15A 1VQIA 4HIOA 1X55A 1LYLA 1AE3A 4NB3A 4DV2Q 1E7ZA 2N3SA 1YJWA 4KHZA 4A3GH 5LMUL 3D0FA 4MZ9A 4QL5A 3FKIH 4BY1G 1X9NA 2R93G 4IOCA 4GOPA 1GVPA 4AQYL 1V1QA 1N32L 5HY6A 3S1RH 1IBLL 4L5QA 3BZKA 1HJPA 4MTNA 1ASYA 5IYCH 3I4OA 3PV0A 4RG1A 3VDYA 4LFCL 1GO3E 2IHEA 4HJ8A 3KDFA 1XMQL 4DR6L 4BXXG 3PIOA 3KF8B 1OXVA 1X3FA 1UE1A 1S3OA 1YHAA 2VW9A 1I50H 1FGUA 3JAMi 2JA5H 1EIFA 3BJUA 1B7YB 3CMEA 4JBMA 5M3FG 4GKKQ 4LUZA 3PO2H 1PH5A 3J7A5 1P8LA 2ALYB 3AQQA 3L0OA 4IFDG 3UDIA 4JI3Q 3S2HH 1IYJB 4QIWE 2VS1A 5M5XH 4ALPA 2ZJQA 1CKNA 2K14A 3MXNB 3CPWA 4A3MH 3GTPH 4DV6L 1EYGA 4NPSA 4HIKA 2OQKA 1SROA 1C0AA 4KHPL 2WFWA 1PH2A 1E1TA 2VL6A 3EN2A 1YITA 1X56A 4A75A 3OTOL 2K4KA 4BY1H 2MO0A 2NN6I 3RN2A 2R93H 5BR8Q 4DR5L 3M4OH 2YTXA 4GNXA 1K8GA 3TS2A 5IWAQ 2EQSA 4JYAL 5LMUQ 3UE0A 2K5VA 3S1QH 4BBRG 2N8NA 4LF6L 4BXXH 2RCNA 2NN6G 4X66L 4R4IA 4DUYL 4PMWA 3H0GG 1CKOA 1O7IA 3G4SA 3CD6A 3S1MH 5FLMG 4LFCQ 1VQ8A 1VQ7A 1N33L 5M3FH 2NZOA 1VQ9A 4DR2L 1IBKL 4DR1Q 4WJ3M 1VQBA 5IP9G 2H5XA 1CSQA 3A5ZB 1UWVA 1QUQA 3KF6A 1N36L 1XNQQ 1Q12A 4UP8A 4GN5A 3G71A 4A4IA 4LF9Q 4JOIC 2UU9Q 5LMNW 5LMNL 2LSSA 4LF8Q 1BVSA 1WYDA 4GN4B 4YHHL 1VCIA 1SR3A 3WWVA 3GTKH 1VQGA 5JJKA 1K8AC 3NEMA 3F2BA 2Z6KC 3D31A 3T1YL 4B3RL 4JG2A 4L5TA 3AEVA 3S16H 4KHPQ 1EOVA 2PQAA 3JC66 3HKSA 4DR3L 2AKWB 1SE8A 2B3GA 1BKBA 4B3ML 4OONA 2ZJRA 4AYBG 3CCJA 1HZBA 1I6HH 1V43A 3CAMA 1A0IA 2NVTH 3NENA 3GDEA 4BBRH 2R7ZG 4NXNQ 3UDGA 2UXCL 1HR0W 4DV3Q
chains in the Genus database with same CATH superfamily
4EGVA 4QUFA 1U9RA 2V4DA 2UUBQ 3E9IA 3HOWB 3I4NG 4MN3A 2P5ZX 5D3DA 2LXJA 3IAYA 4GZYC 5IP9H 1PFSA 1WTHA 1FJGQ 4Y52H 3N6RA 1Q1BA 2Q2IA 4H0LC 5FK9C 2EZVA 3S1MB 1LT4D 4GKJL 1VQEA 1BO0A 5J22A 2QA4A 1STAA 2CWAA 2UUCL 3RR5A 1EFWA 2QEJC 4ODGA 4UY8C 1WCMB 4PZ6A 2O5IC 4MHEA 3SK6A 5LMNQ 3D4RA 2HT1A 3PSIA 2O2LD 4DV7Q 3OW2A 3A55A 3E6ZX 1L0XB 4N9PA 2JA6B 1IYUA 1PTOF 2E74C 4O1NA 2F4VL 1IKLA 1QJOA 1PRTF 4BA1I 5I6WA 5IP7G 1IXRA 3I4NH 4C1NK 4Q5VA 3OHXC 3WOFA 1XPUA 2F0JA 2B63G 4AYBE 1SLJA 2PCFB 1D5ZC 1XTCD 4AIMA 4DF7A 1EIYB 4A3IH 1SE4A 3S15H 4UP9A 3BVZA 1XMOL 4GKJQ 1PFBA 3M4PA 3QIAA 2JJQA 3NP8A 4F8MA 4HJ5A 3Q22A 1SFOB 1FNUA 3LNNA 2I5MX 2M00A 2EYLA 1IBML 2HCIA 1CHQD 1O7YA 1EOTA 3EIVA 2D9UA 5I4DA 5IP7H 2FXQA 4RA8A 1SSOA 3P75A 4KKUA 2F4VQ 5FLXc 1J5EQ 2EY6A 2JEBI 4JI4L 3CC4A 3X3NA 2KBNA 2JN4A 3NK9A 2B63H 1XX8A 2KHJA 4J1MA 3RUZA 4YWLA 4BS9A 5JVH3 3RD4A 3MTSA 2UXDL 1SBBB 4A3GB 3JAME 4J15A 3A5UA 3TSSA 3OWFA 3HP3A 2RKSA 4FDBA 1QG7A 4QIWB 2RHSB 3VYTA 1CFMA 4A3IB 1XMQQ 3S15B 4GLXA 3BYYB 2MO1A 4Z9CB 5JEAG 3ULPA 1A15A 1STEA 2B8FA 4JI5L 4GOPC 3NUCA 5E7NA 2IT1A 4GOPB 5EJWA 3GTJH 2CQAA 1IBMQ 3A8JE 5KIXA 5IYDG 3E0JA 4KY5A 2QGQA 4A3EG 4EQNA 1GUWA 1RHPA 1SMXA 1D5XC 2IHFA 4JCVE 2NBFA 3AFQA 2XTIA 3TS0A 2KCMA 2R93B 1EQQA 1BUVT 2B63B 5NUCA 1Q8IA 2CVRA 1SDFA 1M4VA 5ISRA 1XPOA 3KLWA 5JEAH 1ZYRC 1PH6A 1TWGH 3KJOA 1STHA 1ZEQX 3HG9A 4DR2Q 2F0NA 1HFNA 3BS1A 2JE6I 2RSOA 1YJ9A 1B8AA 5EPLA 2JA9A 1KNEA 2AQ2B 1PYSB 1B4OA 5IYDH 3CC7A 2K50A 2OF1A 2VQEL 4A3EH 4L5SA 1HA6A 2E2IH 4WJWA 5FLXL 3GTKB 3CRKC 3K5NA 4B3RQ 3CCSA 3PUZA 1QUQB 3MXNA 2RF4A 1LV9A 4CKEA 2A69D 5EPKA 4GKKL 1P16A 4PNYA 4XQQA 2KA7A 2EVBA 5GADC 1HNZQ 4LF5L 2JA5G 4JBKA 1PHJA 3KLRA 3QJYA 1WTQA 1WTOA 1WVLA 2WACA 3NQTA 4FXKC 2IY5B 5C6AA 1TWGB 1U4LA 3T1HQ 1GOZA 2N78A 3DHQA 4UPAA 3DEPA 1H95A 4CGYB 2JP1A 3PO3G 1TWHB 1HTLD 5C4ZA 3BDOA 1HZCA 2VQEQ 1B3QA 1Z9FA 5CBAE 1JWMD 3OMGA 3MAQA 4JOIA 4AYBB 1NE3A 3FMCA 4DR1L 4RGOS 2OWOA 4A3JG 2AHOB 3LX0A 3CKIB 1A2TA 2A5HA 1JMCA 5IGFA 1X6OA 2V1CC 3DEOA 5G3LF 2XN9C 5C0XJ 3D8GA 3BZCA 4LF9L 1BBWA 2UU9L 2BOSA 4QGUA 3A74A 4LF5Q 2Z4IA 3K6OA 2DN8A 3HFZB 2RDGA 1PH1A 1JOOA 3J80L 2WB1G 4DA2A 2FHTA 1JB3A 4QJFA 5ELNA 3HOYB 4K5VA 4BBSH 1PTOD 2BA0A 4CJ2C 3PO3H 2XGTA 2N88A 1PRTD 4O0AA 3I70A 4B3TQ 2FINB 1I4XA 2L55A 4QUCA 1QNKA 4B3SL 1ASZA 1W2BA 1Y1WB 2JA7G 4A3JH 3Q8DA 4OELB 3RZOB 4R4OA 2EJMA 2JSOA 2HQEA 4LFBQ 2HD3A 1MJEA 1B9NA 1AZQA 2LY7A 1ZXTA 2PI2A 4PG3A 4E6IA 2QEXA 2KEEA 2WINB 3Q0AA 2PZUA 1E1OA 2Z8LA 1DM0B 1HNWL 1QVCA 5DNFA 1NAPA 1Z7TA 2Z9HA 3M9BA 4G57A 3ULLA 2IX0A 3TBIB 3H94A 1EWCA 2VQFL 2A68C 3H3VI 1D7QA 2DNCA 4R4TA 2AWOA 4C3IB 1I5FA 2F0HA 5IGGA 4HTHA 4BBSB 1LABA 1V1PA 2AWNA 2NTSA 4HJ9A 1B50A 3CXCA 2JA7H 3CCEA 5C3EG 1DYQA 2EYOA 5CR3A 4X62L 2Q2TA 3G6EA 1LTTD 2NYZD 3M4QA 3I73A 1VF5C 1YNXA 3F8TA 1SNMA 1RDPD 2PI2E 3IFTA 3L2PA 1RJTA 1WTPA 2YYZA 1LTBD 3RZDB 2OTJA 1MIUA 4DUZQ 3A56A 1B44D 1EZ6A 4JI6Q 5FO9B 1BR9A 2KHSA 3BDLA 4L5RC 3W5OA 4I7AA 1V1OA 2K01A 3PQIA 2WB1B 3QB3A 1KHIA 3HS0C 4O2DA 1T5XD 1TKWB 3MFYA 3EQLC 4OX9Q 2EY1A 4ZQ3A 1NJIC 1FNWA 4ZUIA 2E5LL 2F0EA 5D14A 3QOLA 5GAHC 2XRQD 1STBA 4K6LA 2JA7B 1S5BD 4KHZA 5LMUL 4QL5A 4IOCA 3OOCA 1IBLL 3C3LA 3BZKA 5IYCH 4RG1A 1SJHD 4LFCL 1NNXA 4HJ8A 1CI3M 2QDLA 3PIOA 1XXGA 1G8ZD 2QW7A 2K33A 1X3FA 4FNFA 2E2HB 5M3FG 4LUZA 1ESRA 5I9OA 2ALYB 2SOBA 3K5LA 1EEFD 3HGBA 1PLFA 5TSSA 1EL0A 1CKNA 2K14A 2F0UA 3MXNB 3EVQA 2EPBA 4DK0A 5FLXE 3M3YB 2J7ZA 2F1MA 2VL6A 1YITA 4A75A 1SMYD 5D3IB 3OTOL 2K4KA 3RN2A 5C44B 4ZUJA 1TQOA 5ELCA 5BR8Q 4DR5L 5IWAQ 2R61A 5LMUQ 3UE0A 1EIHA 4BBRG 2N8NA 1HQMC 4A93B 1PZID 2AUKA 3CD6A 1O7IA 4KHVA 4CJ0B 3SDZA 4LFCQ 1VQ7A 1N33L 2NVXB 5M3FH 2FMMA 3KLSA 4DAYA 5KEEA 2H5XA 3V05A 1GUSA 3W3AA 1XNQQ 1SYBA 1N36L 1EY5A 2K5WA 2LS01 5JPMC 2F0LA 4JOIC 1GHJA 4GN4B 1VCIA 5I2XA 3D31A 3AEVA 2B3GA 4PMCA 3GQBA 4RCOA 5DEHA 4DNTB 1HZBA 1JR0D 1V43A 2EYPA 2L12A 4BBRH 4G7ZC 4NXNQ 3VR3A 5DM63 5A2QL 2UXCL 5G3LD 4DV3Q 2D5DA 4DV5Q 1GM5A 3F1ZA 3K57A 4H7BA 2FFKB 1PFNA 3CP0A 3S1NH 4PZ8A 1F2ZA 4H13C 4OWXB 2NB0A 1BCPD 2RHQB 4OL7A 4PQXA 3J80E 3J81i 4J6HA 2JYOA 1Q7YC 3NTIA 3MC0B 4CDEC 2O4XA 4C3JG 4IPHA 2G5DA 3K0XA 4P71A 2I5HA 3JAML 1GHKA 1T9HA 3OW7A 1BDOA 4YIJA 3SR1A 4IPDA 2KCNA 1HH2P 2NZ1D 4YWMA 5JPNC 2BE5C 2ENBA 1VQ4A 1VMCA 3HZXA 1EQTA 4BY7G 4RHSA 4M1UB 4LF7L 2UXCQ 2M9VA 1TWCH 2EJFC 4QCLA 2R92G 5CGKA 1ET9A 1GD7A 3OIQA 1AZPA 2B2YA 4FO2A 3X3MA 3S1NB 1JE5A 3VR4A 1V1PB 2IPKD 4C3JH 5JJIA 3GTGH 3ZJYC 4JI7L 2UUAL 2DY8A 2CWPA 2WAQG 3O13A 1BBUA 4APVA 2ID0A 4DR7L 1X3GA 2A6ED 3EBEA 3J81j 2PO4A 1DCZA 1CQVA 1F2MA 1ILPA 4DGZA 1C8CA 4BY7H 2K1BA 3U4ZA 1LTLA 1Q90A 3I90A 1M90C 1NCVA 1L0YB 5JOBA 4EQPA 1F2LA 4NKLA 1SNPA 3PUYA 4TSSA 2R92H 4HMJA 5C4JH 2Q8RE 3E0EA 3TN2A 2IW3A 3A8KE 3P20A 5IODA 5JJZA 3K59A 2DY7A 3HOUG 3S14H 1SNQA 1TWCB 1K8MA 3FKIB 5FJ8G 4AQYQ 4A3DG 1N32Q 1J6QA 4L8JA 3DWQA 1HPCA 1C9OA 4IPGA 2XIWA 4IALA 3G6JB 2UUAQ 5EAYA 2X69A 1LTGD 3E3XA 1VQKA 1VQAA 3ULJA 3QR8A 3EA6A 1YNND 3STBC 4XQNA 4G7HC 1Y69U 3PUWA 5M5XB 4IFDJ 1SN8A 1NMFA 4DV6Q 4N8X1 3NELA 1IW7C 4X64L 4JI0L 4UAIA 4NXML 3ONAB 2JA8G 3HOUH 1AE2A 1S72A 1HHVA 2QCPX 5DLQE 5IT9c 2R92B 5C4JB 4BY1B 5FJ8H 1PH4A 3NTHA 4A3DH 5BN3A 2WP8J 2VUMG 1BF4A 3SGIA 5FOBB 1ML0D 4HAEA 3S14B 2G9HD 4DNIA 1TS4A 3FDTA 4JW0A 2YTVA 4MTKA 2WAQB 1JQYD 1CT1D 3HKZG 3SK8A 1J8IA 4B08A 1QCBD 4Q0FA 1LTRD 5ELOA 2BA1A 3U4VA 2ZM6L 2XNAC 2IX3A 4FF4A 1ESFA 1KL9A 2PZTA 5J3BA 2JA8H 2ZXOA 2DJFC 1G291 4DAYB 3PIP3 3F2UA 1M1KC 2K5NA 1ILQA 4B3MQ 2VUMH 3S16B 4A76A 4WORA 2YU9H 3RNUA 3TQYA 1HR0Q 4A3DB 1WOCA 4JI3L 2Z6BA 2K6AA 3K5MA 4PMBA 1S5DD 2BH2A 5IYBG 3PO2G 3VYRA 3OIPA 3ERQA 3ER0A 2F0OA 3U9OA 1IHZA 2SEBD 3A8IE 4ME3A 1H9JA 4YCUA 3TEHB 4OIJA 3L7ZC 2WIIB 3DLLA 1II3A 2UUCQ 5E4XA 4NP5A 4B9WA 2ZM6Q 1RCVD 5A2QE 3K7UC 3VR2A 1A63A 1LLRD 2K5HA 4HN7A 1NTGA 1DOMA 1N9WA 2XWJB 2CH4W 1CHPD 5CV7A 2MQHA 1H9MA 2KCTA 2VUMB 4DAMA 2DNEA 3RMHA 3AB9A 2Z6KA 1LACA 2KJXA 5IYBH 1DOKA 3I4NB 2F0MA 1VQMA 2D62A 1G6ZA 1TS3A 1F9PA 3URYA 5IGDA 4LF8L 1A62A 3UE1A 1CM9A 4CDDC 5ELBA 4IOAA 3KOJA 1XMOQ 2L11A 1E22A 1XTDA 4CDFC 3WDNA 1CA5A 3CQZH 4ILWA 2B2YC 1B70B 3TREA 4DV4L 4K2KA 4TQUS 1UAPA 2F0TA 3CCMA 2B2VA 3K81C 1Q82C 5K36G 3ND8A 1F2YA 2WV6D 5CC4A 2KQ3A 1KRTA 2B2TA 4JI4Q 4LUVA 4HJ7A 1WTWA 4FP5D 2HCCA 3I55A 3TMEA 3I7FA 3CCLA 4LFAL 4HCSA 1TXYA 2UXDQ 3VA7A 4MNOA 4EX5A 4LK1C 4WJ4A 3CHBD 1J9OA 1K83H 1I94L 3C46A 2F3VA 1N8RC 2QKIC 3K80C 1N34L 2KENA 1RTNA 3QO2A 5KNCA 4HSVA 3FRPB 4JI5Q 2IL8A 4MIUA 2K05A 1QZHA 5CORA 2WB1E 4DV2L 1D5MC 1YNJC 1QOHA 1K0RA 4RGNA 5JEAJ 3V96A 5K36H 3GTJB 2TSSA 1TWFH 3K7AH 2R6GA 2ATWA 4XTCS 2RVLA 3DM3A 1E2WA 3MZ5A 3MEFA 2ASBA 2VNUD 4XIGS 1I3QH 4RHRA 4DPGA 1VQ6A 5CV4A 2ZTDA 4IURA 3R2IA 1ENCA 1MKHA 2BH8A 5C0XI 1PYWD 2CW0C 2Q8TA 2KECA 1B9MA 3A7AB 3MWYW 2A6HC 3F2CA 2NTTA 5I2YA 2F0IA 2EYHA 5J39A 2IX1A 2QILA 4JPBW 1UEBA 3CCVA 3VR5A 1W6KA 2PNRC 5FO7B 4DV2Q 2OXPA 1E7ZA 1YJWA 1MI2A 3D0FA 4K8IA 3ZYYX 5IGCA 5M9OA 2AQ3B 1TY2A 2LMCB 4KD4A 3S1RH 2PYKA 3KUPA 4L5QA 4A3EB 1ASYA 5A35A 2E2IB 3PV0A 3VDYA 1D6EC 1EYCA 3KDFA 1G2SA 4ULLA 4DR6L 1OXVA 1F9QA 1I50H 4DNRB 1FGUA 2JA5H 1E2VA 3CMEA 4GKKQ 1F9RA 3SVMA 1I3QB 1P8LA 2C5CA 3AQQA 3L0OA 3UDIA 1EU4A 3MXPA 3GV6A 4JK1C 3S2HH 3CRLC 2A74C 3DUZA 4I65A 1EYGA 3IFDA 4HIKA 2J4XA 1C0AA 4KHPL 2WFWA 5E4WC 3J7AV 1E1TA 1X56A 2MO0A 2NN6I 3MEHA 2J0TD 4IUNA 4GNXA 4NDXA 3TS2A 1HA5A 2EQSA 2L9HA 3T56B 5T1GA 4JYAL 2K5VA 2ZT9C 1I4PA 3S1QH 2BCOA 5EKLA 3FVQA 4LF6L 2NN6G 3TP8A 1EY8A 4X66L 4DUYL 1X3QA 3H0GG 3S1RB 3G4SA 1HXYD 5BN5A 5FLMG 2RBMA 4DR1Q 5EKKA 4WJ3M 1HTPA 4IUUA 2F0WA 3KF6A 4X3UA 5CYUA 1Q12A 4UP8A 2JA5B 2F0FA 4LF9Q 2VB3X 2UU9Q 5LMNW 5JAVA 4LMQD 1SYCA 4YHHL 4HR7B 1SR3A 5JJKA 1K8AC 3C1EA 2F0PA 3F2BA 2Z6KC 4JG2A 1S5ED 4L5TA 2Q8IB 4KHPQ 3OWEB 1VF7A 4DR3L 1SE8A 3HEJA 2ZJRA 1G2TA 4FXGC 2R7ZG 1JICA 1LT6D 3PO3B 1JORA 2NN6H 1HR0W 1DJRD 1FVIA 2MP1A 3H0GH 3HOXG 3D4WA 5FLMH 1OTCA 4B3SQ 1TIID 2F52A 1NY4A 2JQOA 3PF5A 3VA5A 4A3JB 4JI8L 5I9PA 4A3BG 3NHHA 4JBJA 3E9HA 4X3SA 2I5LX 1ONLA 2DGYA 5C5LA 4KN4C 3UDXA 1SE2A 2B2VC 4FYDA 4JBWA 1HNWQ 3I2ZA 1K9MC 2K7VA 3A54A 1RD9D 1G6PA 1X3PA 2B2TC 1EFID 4LF4L 3ICEA 1JE4A 2VQFQ 3PUVA 2R7ZH 1K28A 4EVOA 2E76C 5ELEA 5LHY1 3H3VH 1AN8A 5C3EH 4DR3Q 1CSPA 1EY4A 2GN5A 5AJ3L 3HOXH 2IJ0A 1KABA 1AH9A 1EY9A 5IGEA 2L4NA 4Y7NH 1L1OA 3KBXA 4X62Q 2EYFA 2MNAA 3EFXD 2L0CA 3H0GB 2EJGC 1HNXL 2H1EA 1HRJA 4GLVB 4A3BH 2HDMA 5KNBA 2EXZA 4QY7A 3TDQA 4J8QA 4YCWA 1XPRA 1KQSA 5M5YH 2EOTA 1SRUA 2JXMB 2MJ8A 1C7YA 3I56A 1GJXA 2K52A 2Z4HA 3GTQH 4DXFA 1U4MA 2F0GA 5EQ0A 4P72A 1B53A 4A3FG 4XYOA 3R2TA 3P7JA 3I4MG 3AYHB 1VQDA 3OYYA 2CFMA 4POGA 3DM1A 1C48A 1Q46A 3H3VC 2NVQH 2E5LQ 4TVAB 1SYEA 5C3EB 1CKMA 2E2JH 3DWPA 3HOXB 1I4HA 4U673 1OXXK 3KFUA 4CHTB 1T5EA 1JOQA 4Y7NB 1S40A 3MHBA 3NWTA 1K8OA 3W1BA 2Q2UA 5C4HA 1IBLQ 4JVZA 1EYDA 3E5SA 5FO8B 5M5YB 2YV5A 4A3FH 1RL2A 4DFAA 4ZAIA 1ICFB 3I4MH 2ZJPA 3BG3A 4K2LA 3GTQB 2L15A 3WOEA 4JI1L 4UHVA 5IOCA 4QB4A 1QWYA 2LXKA 2AQ1B 2WAQE 3KDFB 5KGUA 3T13A 1PA6A 3J7AF 4PZ7A 4HCEA 2HHHL 3HOVG 1I4GA 4X65L 2CHBD 5DM73 1YI2A 1K0SA 2K03A 4RGTA 2B8GA 3OTOQ 1QVFA 2E2JB 4DR5Q 1JJGA 4N9TA 5JJLA 1MJCA 2VXWA 3J80i 4CDCC 1Q81C 1CUKA 2Y0SG 1F77A 2A69C 4F88A 4GNXC 1N33Q 1K3RA 1W3SA 2K5DA 3DWAA 4GNXB 5M3FB 2PW5A 3F2DA 1K73C 1D8LA 5KRUA 5EBDA 3TP7A 2DJGC 3RLOA 5CBEE 3C2PA 4OWTB 4GN3B 4C2MH 1N36Q 3UDFA 1BXTA 2F03A 4TKOB 3HOVH 3CCQA 1SAPA 5ELFA 1PTOH 1ENFA 1YEZA 1U5KA 2KCCA 2CKZB 3CF5A 3KF6B 1NR4A 2RDFA 4C3HG 2C35B 1ZYRD 1Q86C 1JB7A 2EY2A 5KYLA 4BBRB 4DR4L 1WTXA 1NSNS 1U4PA 1QZGA 3P1HA 4A3LG 1TWAH 2RQXA 5C5MA 1H9SA 1QE6A 2NVYH 1W6JA 4OWWB 4H44C 1Y1VG 1DONA 1EZ8A 1EQRA 1XWEA 1O7ZA 1B3AA 2AUJD 2MFIA 4UP7A 1KDAA 4HMIA 4DXGA 4U68A 3V2TA 4C2MB 2OQ0A 3HKZE 5C4XG 3MFGA 3SXHA 3HOVB 2D0OA 3PUXA 2Z1CA 4C3HH 3FHWA 4LJZC 3HOWG 4IFDI 2E2DC 4KN7C 3H09A 3SE0A 2KOLA 3J7YW 1A3VA 2X6GA 4O42A 2CW0D 1JJCB 1MHWC 1XNRL 4R9WA 1PDQA 4IUTA 4A3LH 3PIO3 2NZHA 1RIPA 1PYBA 1S5FD 4DR4Q 3A0JA 3TZUA 4LF7Q 2ICEC 1U0LA 2R7DA 1Z47A 1HZ9A 2Y0SB 1Y1VH 2ICIA 4HJAA 1WCMG 1QVGA 1VQCA 4IQZA 1TWAB 3TP6A 1VMPA 3U50C 1DZ1A 3CC2A 1S5CD 4DV1L 1R4PB 4LUOA 4F87A 1L1OC 5GAEC 1KAWA 4C3JB 2EY5A 4JI7Q 1L1OB 3GTGB 2JA6G 1BNZA 5C4XH 4DK3C 3AFPA 3BVGA 4DR7Q 4RAUC 2E75C 4ME5A 4EQ5A 1A3UA 3HOWH 1E3PA 2UUBL 2N49A 4FXDA 1RF2D 4LW1A 2CH4A 1VQJA 1FJGL 2PW7A 4BY7B 1KDCA 3OSOA 1MGSA 5C3WA 4BWGB 3PMFA 2B2UA 1SE3A 5GAGC 1XNRQ 3UI2A 1QB5D 1WCMH 3Q23A 4PV1C 1KRSA 1CKNB 1DGSA 3K58A 1LTID 4DV7L 2PPBC 1EY6A 1TVXA 2JEAI 2JA6H 1ET6A 3CU7A 4DV1Q 5IIFA 2I0QA 2FJ2A 1U4RA 1PV4A 2MUYA 1STYA 4IUPA 4RMFA 3KBGA 3S24A 1GXDC 1PZJD 4QQBX 5FKAC 2HIXA 3J7ZC 2VY3A 5KYIA 1IKMA 4C56C 4UDUC 1CK1A 3NSWA 4P74A 3M4YA 1WJJA 5M3MG 1LTAD 1VQFA 4YCVA 4A3GG 1SYGA 4BA2I 1CZWA 4ID6A 3KYHC 4X64Q 4KI0A 4JI0Q 1SYFA 2X6LA 4NXMQ 1WFQA 3A7LA 3HOUB 2EXDA 2ZXRA 3FPPA 4A3IG 5C3XA 1SFOH 2A68D 1ENAA 2KUMA 1A3TA 3SK5A 2QDBA 4NW2A 2KHIA 5JVG3 1B2TA 3K8AA 5ELDA 1PH7A 1VQLA 3MA2B 1L2FA 4N8FA 1IZ6A 3GTOH 1PH3A 5D65A 1J5EL 4CJ1B 1AEXA 1EQVA 3T53B 2F3WA 3BZDB 5M3MH 1SJED 1VQIA 5BN4A 4HIOA 1FR3A 4A3GH 4DN4M 1MSGA 4MZ9A 3NBIA 1IL8A 1CA6A 1X9NA 2R93G 3NBHA 1V1QA 3L3OC 4OGQC 1SMYC 2WKDA 2JA8B 4MTNA 5IT9L 1XMQL 1FD7D 1DOLA 4BXXG 1HUMA 3QWNA 3KLSX 5CV5A 5CV8A 1YHAA 4ZYSA 1MD2D 3JAMi 1EIFA 1B7YB 1GUGA 2GA4B 4K8JA 1C4QA 4JBMA 3PO2H 1PH5A 4RH6A 2YU9B 4JI3Q 3T16A 2ZJQA 1KLUD 4TRDA 3HKZB 3H91A 1UEAB 1PZKD 3S9WA 1PH2A 3GTOB 2MHVA 3EN2A 5IGBA 2F0KA 2R93H 2YTXA 1X32A 1K8GA 1H9SB 1JWSD 1Y8NB 5M3MB 3FEWX 4ZCKA 1SNDA 1PXUA 2H4OA 4NMZA 4BXXH 4IUVA 2RCNA 2KEDA 4R4IA 1H9KA 3EROA 1Y8OB 4KY6A 3NPPA 2NZOA 4DR2L 2F4IA 1IBKL 3T51B 1VQBA 3SHLA 1CSQA 3IKJA 3A5ZB 4KJNA 4XT1B 1WD1A 4GN5A 1BCPC 3G71A 3PO2B 1BCPB 2I46A 1A2UA 3QOJA 4FF3A 4LF8Q 4HSPA 1GUOA 3WWVA 3GTKH 1O7LA 3NEMA 3MVVA 2RA4A 3T1YL 4B3RL 3I3CA 3JC66 2PQAA 1BKBA 3LWUA 3TZDA 2L5TA 2FMCA 3CCJA 4AYBG 5I6YA 1I6HH 1A6XA 1STNA 3CAMA 1A0IA 2NWGA 3BDCA 3GDEA 4OIKA 3CQZB 3D4DA 2F0QA 3KJPA 4DV4Q 4P75A 2NVTH 1HNZL 4DK1A 4HIDA 4DAPA 2F0DA 1WI5A 1TT2A 2BDOA 4QMGA 1KDBA 2ES2A 2AMCB 2B39A 5EBCA 4RFBA 3T1HL 1IBKQ 4JV5L 1YJNA 3J80c 1HFGA 3HOYG 4KKTA 1A8VA 1TU2B 1G51A 4LFAQ 2EIFA 4YY3L 1EWIA 1TWHH 3J81c 1JJ2A 1I6VC 1M8AA 1UE5A 2G9DA 4G7OC 2NUCA 1D2BA 3IL8A 2GVBA 2B2UC 5LL6X 1I94Q 5IY0A 3T1YQ 1K83B 1N34Q 1Y1WG 4KLKA 1RTOA 3BVMA 5C0XG 2A6EC 1GUTA 1HQRD 1TY0A 2EYJA 1FNVA 3OMCA 5IE8A 1I6HB 4X3TA 3CW2C 2KVMA 3BU2A 4H02A 1RKNA 2CQOA 2NVTB 1Z6HA 2O5JC 2DUDA 1E0BA 1IL2A 1TWFB 3K7AB 4RKLA 3HOYH 4FVMA 1YZ6A 3HRZC 3K0YA 3R8BA 4JV5Q 4IPCA 1FGBD 4L63B 5GQOA 2BE5D 2MPMA 2N55A 4C3IG 4B3TL 1LUZA 3CMAA 4BBSG 2HIVA 2MGSA 1UNSA 4ABNA 5HGTA 4YY3Q 3K5OA 1R9TH 3TRZA 1UE7A 3EJIA 1Y1WH 1OXTA 2EE1A 5C0XH 1YBYA 5CV9A 2JK8A 1GKHA 1WTVA 3RZOH 2R3ZA 1X65A 3VYUA 4AH6A 4RKBA 4LFBL 2I07B 1AW7A 1YNNC 2A8VA 1KAAA 1LM0A 5E3FA 1NR2A 4R4CA 1JC7A 2WKCA 3NXWA 4L6TB 1BCPF 4ZKCB 1CTMA 1ZKOA 5J1ZA 1BQQT 4C3IH 3NE5B 4DR6Q 3PGZA 3I72A 2OTLA 2XSCA 4DK6C 3J81L 1BBXC 2VZAA 3L9AX 3C1FA 4K5WA 3AU7A 3LWEA 4K0KL 1I50B 3NBHB 1CQFA 3LGJA 4JC0A 1KLGD 1R9TB 1YIJA 1OXSC 1VQNA 2PNHA 2D0PA 5DAUA 4F7XA 3S2HB 1XJVA 1EY0A 2B29A 3RZDH 5EGTA 5M5WH 1NUCA 2K04A 2OCEA 1PVOA 1EIGA 4DUZL 1VQPA 5IT9E 4JI6L 1VS0A 1E24A 2SDFA 1JT8A 3B6YA 1SNCA 1RODA 3ND9A 1YHBA 4K6DA 4M8AA 4JYAQ 1LT3D 3PF4A 2R7FA 1D1KA 4LF6Q 3T4AC 3S1QB 4KTAA 1YVCA 2A19A 4OX9L 2UXBL 4X66Q 4IO9A 4DUYQ 2F0VA 3GO5A 2K75A 4X6AH 1PMRA 3IRBA 1JOKA 5AFWA 1D1IA 4HEDA 1XYIA 3STBD 4GLAC 4R4QA 1NBWA 4K0KQ 1HZAA 3KF8A 4DAVA 3FPUB 1IW7D 2OT2A 5L37A 5LL6S 3SK4A 5C44G 3FP9A 4I7ZC 1X3EA 2PMZE 4YHHQ 4XYQA 1OXUA 4WRDA 4DU9A 1KD1C 4A3CG 5M5WB 2K28A 4A93G 4JI2L 2EYMA 1VQOA 2E2HH 4ZRZA 5IYCG 3Q24A 5GROA 5H1SE 5HGQA 1MBYA 4IJLA 1SNOA 3D6CA 3NWSA 1SXTA 2XRSD 2SNSA 2Z0SA 3RN5A 4LAAA 2PQAB 2UXBQ 3M3YH 2QF7A 2CCZA 3GP7A 4CKBA 2D2CC 1TS5A 4JI8Q 4ZKBB 5C44H 4IJHA 1MSHA 4OEMB 5BR8L 2F3IA 2Y0SE 3M85A 5IWAL 3OPOA 3MXGA 4A3CH 1FYCA 1Y14B 4A93H 3R3OA 2HDLA 4LF4Q 1BOSA 3GTLH 3GTMH 4HIMA 2NVXH 2B2WA 2ZTCA 5CV6A 1Q8KA 4JI2Q 2R7ZB 3VR6A 4KY7A 3HOZG 5AJ3Q 3U9SA 4XXEA 1XNQL 3M7NA 1EWHA 4KMUC 3M7GA 5CMDA 4XQJA 1SEBD 1HNXQ 1EEID 4R1JA 1KC8C 4R8NA 3JAMc 4C1NI 2VB2X 5K5PA 4A3BB 1PH9A 1V9PA 3BYTB 4OXPA 3ITPA 4V0BA 1HUNA 1EUJA 4A3KG 1LTSD 3RLNA 4NXNL 1OO9B 4DV3L 4ZK9B 4KD3A 4DV5L 4LWCA 1ICWA 2OEOA 4XT3B 1SYDA 1QILA 4KJOA 3HOZH 1DXMA 2RDHA 1FL0A 3CCUA 5EPJA 4DV0L 2A1AA 3GTLB 3GTMB 3CPFA 4OO1I 2HQLA 4POFA 4P73A 3GD7A 2NVQB 2RCFA 4WFN3 3S17H 1STGA 1I4QA 4CKCA 1JCKB 1YHQA 4K5XA 3I91A 4OO1G 3N52A 2GVAA 4A3KH 3RLFA 4LNQA 3G48A 3NQIA 2IWHA 1GUNA 3NTKA 5KNDA 4A3FB 4FF1A 1CZGA 3CCRA 4OHJA 3I4MB 2A73B 3D3RA 4JI1Q 3S2DH 1VQHA 4KKSA 1VDZA 2ZTEA 4GS3A 4P2CB 1H9RA 2E8GA 3PIPA 3PCOB 1X54A 3HOZB 2YTYA 3FKIG 4DV0Q 2HHHQ 1HCZA 1S4ZA 2Q2HA 4X65Q 2PZWA 1PH8A 4OO1H 1Q1EA 3W1GA 1WD0A 1KNAA 3J81E 5F2DA 3W2DA 1JWUD 4YWKA 3S17B 1UE6A 2HUGA 1L0WA 1VQ5A 3U58A 4R8IA 2LFNA 4K14A 2PMZB 4A3KB 1YNJD 1NMGA 2F0SA 1KXLA 1Q3LA 2L1BA 2RSNA 2ZXPA 1WTRA 4ZLTF 4IN3A 4S3SA 4XDXA 4A3MG 1KIXA 3AMUA 5COYA 1V8QA 4DKAC 3ERSX 4IUQA 5EKIA 3H15A 1G91A 1X55A 1LYLA 1AE3A 4NB3A 1TR5A 2N3SA 3G7LA 1TS2A 3FKIH 4BY1G 3S2DB 4RGMA 4GOPA 1PTOC 1GVPA 1KTKA 4AQYL 1N32L 1PTOB 5HY6A 1HJPA 1PFMA 1PRTC 1IYVA 3I4OA 3DMUA 1PRTB 2K32A 1GO3E 2IHEA 1UUPA 3KF8B 1Y8PB 2A6HD 1UE1A 1S3OA 2K5QA 2VW9A 4G4KA 3BJUA 4IFDG 3J7A5 4CBVA 3MXUA 2C9OA 2LKVA 4EQOA 1IYJB 1K3BC 2VS1A 4QIWE 5M5XH 2M2LA 1EU3A 4ALPA 4A3MH 3CPWA 3GTPH 4DV6L 1EY7A 2NVYB 3D6WA 4NPSA 4RCNA 2OQKA 1SROA 2XWBB 1F9SA 4FF2A 3Q6SA 4BY1H 2PQEA 3M4OH 5T1IA 5E1FA 4KK7A 2TMPA 3I4LA 1AFPA 1LO5D 2EDGA 3DXJC 4X3KA 1O78A 3H6MA 1E2ZA 1R4QB 4PMWA 1CKOA 4C3HB 3S1MH 1VQ8A 2SNMA 4IFDH 1VQ9A 1DD2A 1B1ZA 5IP9G 3GV3A 2BDNA 4B9XA 3TP5A 1QNUA 1UWVA 1QUQA 3SEBA 4A4IA 2B2WC 5LMNL 2LSSA 1BVSA 1WYDA 1Y1VB 5HURA 4V190 1I4RA 1VQGA 1LT5D 4A3MB 3GTPB 1AP0A 2XVSA 1EYAA 3S16H 1EOVA 3HKSA 2AKWB 4B3ML 4OONA 4RWSC 3VYSA 4IZ8A 4KV6A 3I8ZA 3NENA 3QG1A 5C4XB 4QF4A 3UDGA 3R93A 1O80A 3M4OB 3KK7A 1HR0L
chains in the Genus database with same CATH topology
3KJPA 1FVIA 3H0GH 4P75A 3HOXG 4DV4Q 4DV5Q 1GM5A 4HIDA 3E9IA 5FLMH 1HNZL 2UUBQ 1OTCA 1WI5A 3F1ZA 4B3SQ 3I4NG 3CP0A 3S1NH 2LXJA 4PZ8A 2F52A 1NY4A 5IP9H 1PFSA 1FJGQ 2JQOA 3PF5A 2ES2A 2AMCB 4OWXB 4Y52H 1Q1BA 2RHQB 2Q2IA 3T1HL 3J81i 1Q7YC 1IBKQ 4JI8L 1VQEA 4GKJL 4A3BG 1YJNA 4JV5L 4JBJA 3J80c 2QA4A 3E9HA 3HOYG 2CWAA 2DGYA 2I5LX 2UUCL 3RR5A 1EFWA 1A8VA 4IPHA 3UDXA 1G51A 4UY8C 3K0XA 4P71A 2EIFA 2I5HA 4PZ6A 1EWIA 1TWHH 3I2ZA 4JBWA 4LFAQ 1UE5A 4YY3L 3J81c 1K9MC 1JJ2A 1T9HA 5LMNQ 2HT1A 1G6PA 3PSIA 2GVBA 4IPDA 4DV7Q 1HH2P 4LF4L 4YWMA 3OW2A 1I94Q 3ICEA 5IY0A 2VQFQ 3PUVA 3T1YQ 2R7ZH 1N34Q 1VQ4A 1Y1WG 4KLKA 5C0XG 3H3VH 2F4VL 5C3EH 4DR3Q 4BY7G 1CSPA 2GN5A 4BA1I 5AJ3L 3HOXH 5IP7G 1IXRA 5IE8A 3I4NH 3CW2C 1AH9A 4Y7NH 4LF7L 2UXCQ 1L1OA 4X62Q 1TWCH 3BU2A 4H02A 2MNAA 2R92G 1XPUA 2CQOA 2B63G 1HNXL 1GD7A 2DUDA 1SLJA 4AYBE 1HR0L 4GLVB 4A3BH 1JE5A 4QY7A 4AIMA 1EIYB 1IL2A 4A3IH 4YCWA 3HOYH 3S15H 1XPRA 1YZ6A 4UP9A 1KQSA 5M5YH 1XMOL 4C3JH 1SRUA 1C7YA 5JJIA 3GTGH 3I56A 4GKJQ 3ZJYC 4JV5Q 4JI7L 2UUAL 4OX9L 2WAQG 2CWPA 2K52A 4IPCA 3L2PA 3GTQH 3M4PA 1BBUA 5GQOA 2ID0A 2JJQA 4APVA 4HJ5A 4B3TL 4DR7L 4P72A 1LUZA 3CMAA 4BBSG 2HIVA 4A3FG 3TRZA 1R9TH 4YY3Q 1X3GA 2I5MX 3EBEA 3J81j 1UE7A 3I4MG 1IBML 3AYHB 1Y1WH 1OXTA 1YBYA 2JK8A 1GKHA 3RZOH 4BY7H 3EIVA 3U4ZA 1X65A 1LTLA 1M90C 1VQDA 4AH6A 3OYYA 5IP7H 2CFMA 4POGA 2FXQA 1Q46A 4LFBL 2NVQH 2F4VQ 2E5LQ 4TVAB 5FLXc 1J5EQ 2JEBI 4JI4L 3CC4A 3PUYA 2A8VA 1CKMA 2E2JH 5C4JH 2R92H 1LM0A 2KBNA 2B63H 3E0EA 4R4CA 1OXXK 2KHJA 3KFUA 4YWLA 3HOUG 3S14H 1S40A 2UXDL 3A5UA 4J15A 5FJ8G 4AQYQ 4A3DG 3W1BA 2Q2UA 1N32Q 1J6QA 1IBLQ 4FDBA 2RHSB 4C3IH 1C9OA 4IPGA 1XMQQ 4GLXA 4DR6Q 3PGZA 2MO1A 2YV5A 4A3FH 2OTLA 5JEAG 1RL2A 3ULPA 4DK6C 5EAYA 2UUAQ 2VZAA 3I4MH 4JI5L 2ZJPA 4GOPC 5E7NA 4K0KL 2IT1A 1VQKA 4GOPB 2L15A 3NBHB 1VQAA 3LGJA 4JC0A 4JI1L 3ULJA 3GTJH 1YIJA 1OXSC 1VQNA 1IBMQ 2LXKA 2PNHA 3STBC 2D0PA 2WAQE 3KDFB 1XJVA 3PUWA 1PA6A 2B29A 3RZDH 4IFDJ 1SN8A 1NMFA 4PZ7A 5M5WH 5IYDG 4DV6Q 2HHHL 3HOVG 3NELA 4X64L 4JI0L 2QGQA 4NXML 2OCEA 1PVOA 4X65L 4A3EG 1YI2A 4DUZL 1VQPA 1AE2A 1SMXA 2IHFA 2JA8G 4JCVE 3HOUH 3AFQA 4JI6L 1S72A 2XTIA 3TS0A 1VS0A 3OTOQ 1QVFA 1E24A 5DLQE 5IT9c 1JT8A 2KCMA 3B6YA 4DR5Q 5FJ8H 1EQQA 1PH4A 4A3DH 1JJGA 5JJLA 2WP8J 2VUMG 1YHBA 4JYAQ 1MJCA 3SGIA 3PF4A 3J80i 2R7FA 4LF6Q 1XPOA 1YVCA 2A19A 3KLWA 1CUKA 2Y0SG 4DNIA 4X66Q 4IO9A 4DUYQ 1Q81C 1TWGH 2YTVA 3GO5A 1PH6A 2K75A 4X6AH 3KJOA 4GNXC 1N33Q 3IRBA 1K3RA 3HKZG 1W3SA 4GNXB 4DR2Q 3STBD 4GLAC 3F2DA 2JE6I 1K73C 1D8LA 4R4QA 1YJ9A 1NBWA 1B8AA 3RLOA 4OWTB 4K0KQ 1HZAA 4GN3B 5ELOA 4C2MH 2JA9A 1N36Q 2BA1A 3U4VA 2ZM6L 3UDFA 1PYSB 5IYDH 3CC7A 5C44G 3FP9A 3HOVH 2K50A 3CCQA 1X3EA 2PMZE 4YHHQ 2VQEL 1KL9A 4A3EH 5J3BA 4L5SA 2E2IH 2JA8H 1OXUA 1G291 1YEZA 4DAYB 1U5KA 1KD1C 4A3CG 4B3RQ 3CCSA 3PUZA 2CKZB 4A93G 1M1KC 3CF5A 2K5NA 4JI2L 3KF6B 1QUQB 2RF4A 4B3MQ 2VUMH 1VQOA 4A76A 2E2HH 5IYCG 2C35B 5GROA 1Q86C 1JB7A 4GKKL 5H1SE 5HGQA 2YU9H 1P16A 4IJLA 3RNUA 4DR4L 3TQYA 5GADC 1HR0Q 1WOCA 1QZGA 4JI3L 1HNZQ 4A3LG 4LF5L 2Z0SA 2JA5G 1TWAH 4JBKA 3RN5A 5IYBG 1PHJA 2BH2A 3PO2G 2PQAB 2NVYH 2UXBQ 3ER0A 4OWWB 3M3YH 1Y1VG 2IY5B 3T1HQ 4ME3A 4YCUA 1EQRA 3TEHB 2CCZA 4JI8Q 2MFIA 2N78A 5C44H 3L7ZC 4UP7A 3DLLA 4UPAA 4IJHA 2UUCQ 5BR8L 2F3IA 2Y0SE 3M85A 1H95A 5IWAL 2ZM6Q 2OQ0A 3HKZE 3PO3G 5C4XG 4A3CH 1Y14B 3K7UC 4A93H 1HZCA 2D0OA 2VQEQ 1A63A 3PUXA 1Z9FA 4C3HH 3FHWA 4LF4Q 2K5HA 3HOWG 3GTLH 4IFDI 3GTMH 4HIMA 2NVXH 4JOIA 1NTGA 1NE3A 2ZTCA 1N9WA 1Q8KA 1JJCB 4JI2Q 4DR1L 2OWOA 3HOZG 2MQHA 1XNRL 4A3JG 2AHOB 2KCTA 5AJ3Q 4DAMA 4A3LH 2Z6KA 2NZHA 1JMCA 1X6OA 2V1CC 5IYBH 1XNQL 3M7NA 1RIPA 1PYBA 4DR4Q 3A0JA 1VQMA 5C0XJ 4LF7Q 2D62A 3BZCA 4LF9L 2R7DA 1BBWA 1U0LA 1Z47A 1HZ9A 2UU9L 1Y1VH 4QGUA 3A74A 4HJAA 4LF5Q 4LF8L 1A62A 1WCMG 3UE1A 1QVGA 1HNXQ 1VQCA 4R1JA 1KC8C 3HFZB 3U50C 3JAMc 1PH1A 3CC2A 2WB1G 1PH9A 1V9PA 4IOAA 4DV1L 4LUOA 4QJFA 4OXPA 5ELNA 3KOJA 1XMOQ 1E22A 1XTDA 1L1OC 5GAEC 4BBSH 1KAWA 2BA0A 4JI7Q 1L1OB 1EUJA 4A3KG 2JA6G 2XGTA 5C4XH 4DK3C 3PO3H 3AFPA 4O0AA 3CQZH 4NXNL 3RLNA 4DR7Q 4B3TQ 1B70B 4DV3L 3TREA 4EQ5A 4DV4L 4DV5L 3HOWH 1E3PA 4TQUS 4LWCA 2UUBL 2N49A 4B3SL 1ASZA 1W2BA 2JA7G 4LW1A 1FJGL 1VQJA 3HOZH 4A3JH 3Q8DA 1FL0A 3CCMA 3CCUA 4DV0L 2A1AA 3K81C 4R4OA 1Q82C 5K36G 3CPFA 4OO1I 4LFBQ 2HQLA 1KRTA 4POFA 4P73A 5GAGC 3GD7A 1MJEA 1XNRQ 4JI4Q 4LUVA 4HJ7A 4PG3A 2PI2A 3S17H 2QEXA 1WCMH 3I55A 3I7FA 1E1OA 1YHQA 3CCLA 1KRSA 4LFAL 1HNWL 1QVCA 1CKNB 1DGSA 4OO1G 1TXYA 2UXDQ 3M9BA 3ULLA 4MNOA 4EX5A 2IX0A 4WJ4A 2GVAA 4DV7L 2UXBL 1K83H 1I94L 4A3KH 2JA6H 2VQFL 3RLFA 1N8RC 2JEAI 3H3VI 4LNQA 4DV1Q 3K80C 1N34L 2KENA 3G48A 1D7QA 4R4TA 2I0QA 2AWOA 1PV4A 1I5FA 4RMFA 2AWNA 4HJ9A 3S24A 3CCRA 4JI5Q 4QQBX 1QZHA 2HIXA 2WB1E 3J7ZC 2VY3A 3CXCA 5C3EG 3CCEA 4DV2L 2JA7H 4X62L 2Q2TA 4JI1Q 3G6EA 3S2DH 3M4QA 1VQHA 5JEAJ 1K0RA 4P74A 2ZTEA 1WJJA 1YNXA 4GS3A 5M3MG 1TWFH 1VQFA 2E8GA 2PI2E 3F8TA 3K7AH 4YCVA 3PIPA 2R6GA 2YYZA 3PCOB 1X54A 4XTCS 2ATWA 4A3GG 1HNWQ 2OTJA 3DM3A 2YTYA 4BA2I 3FKIG 4DV0Q 2HHHQ 3KYHC 4X64Q 4KI0A 4JI0Q 1MIUA 2Q2HA 4NXMQ 1WFQA 3MEFA 4X65Q 4DUZQ 2ASBA 1PH8A 2VNUD 1Q1EA 4XIGS 2EXDA 3W1GA 4A3IG 4JI6Q 1I3QH 4DPGA 1SFOH 1VQ6A 2ZTDA 4YWKA 1UE6A 1MKHA 4L5RC 3W5OA 2BH8A 5C0XI 1L0WA 2KHIA 1KHIA 4O2DA 1VQ5A 3F2CA 3U58A 4OX9Q 3K8AA 1PH7A 1VQLA 1L2FA 1NMGA 1IZ6A 3GTOH 1NJIC 1PH3A 1KXLA 2IX1A 2E5LL 1J5EL 1KIXA 1UEBA 4A3MG 3CCVA 4DKAC 5GAHC 3ERSX 5M3MH 3H15A 1VQIA 4HIOA 1X55A 1LYLA 1AE3A 4NB3A 4DV2Q 1E7ZA 2N3SA 1YJWA 4KHZA 4A3GH 5LMUL 3D0FA 4MZ9A 4QL5A 3FKIH 4BY1G 1X9NA 2R93G 4IOCA 4GOPA 1GVPA 4AQYL 1V1QA 1N32L 5HY6A 3S1RH 1IBLL 4L5QA 3BZKA 1HJPA 4MTNA 1ASYA 5IYCH 3I4OA 3PV0A 4RG1A 3VDYA 4LFCL 1GO3E 2IHEA 4HJ8A 3KDFA 1XMQL 4DR6L 4BXXG 3PIOA 3KF8B 1OXVA 1X3FA 1UE1A 1S3OA 1YHAA 2VW9A 1I50H 1FGUA 3JAMi 2JA5H 1EIFA 3BJUA 1B7YB 3CMEA 4JBMA 5M3FG 4GKKQ 4LUZA 3PO2H 1PH5A 3J7A5 1P8LA 2ALYB 3AQQA 3L0OA 4IFDG 3UDIA 4JI3Q 3S2HH 1IYJB 4QIWE 2VS1A 5M5XH 4ALPA 2ZJQA 1CKNA 2K14A 3MXNB 3CPWA 4A3MH 3GTPH 4DV6L 1EYGA 4NPSA 4HIKA 2OQKA 1SROA 1C0AA 4KHPL 2WFWA 1PH2A 1E1TA 2VL6A 3EN2A 1YITA 1X56A 4A75A 3OTOL 2K4KA 4BY1H 2MO0A 2NN6I 3RN2A 2R93H 5BR8Q 4DR5L 3M4OH 2YTXA 4GNXA 1K8GA 3TS2A 5IWAQ 2EQSA 4JYAL 5LMUQ 3UE0A 2K5VA 3S1QH 4BBRG 2N8NA 4LF6L 4BXXH 2RCNA 2NN6G 4X66L 4R4IA 4DUYL 4PMWA 3H0GG 1CKOA 1O7IA 3G4SA 3CD6A 3S1MH 5FLMG 4LFCQ 1VQ8A 1VQ7A 1N33L 5M3FH 2NZOA 1VQ9A 4DR2L 1IBKL 4DR1Q 4WJ3M 1VQBA 5IP9G 2H5XA 1CSQA 3A5ZB 1UWVA 1QUQA 3KF6A 1N36L 1XNQQ 1Q12A 4UP8A 4GN5A 3G71A 4A4IA 4LF9Q 4JOIC 2UU9Q 5LMNW 5LMNL 2LSSA 4LF8Q 1BVSA 1WYDA 4GN4B 4YHHL 1VCIA 1SR3A 3WWVA 3GTKH 1VQGA 5JJKA 1K8AC 3NEMA 3F2BA 2Z6KC 3D31A 3T1YL 4B3RL 4JG2A 4L5TA 3AEVA 3S16H 4KHPQ 1EOVA 2PQAA 3JC66 3HKSA 4DR3L 2AKWB 1SE8A 2B3GA 1BKBA 4B3ML 4OONA 2ZJRA 4AYBG 3CCJA 1HZBA 1I6HH 1V43A 3CAMA 1A0IA 2NVTH 3NENA 3GDEA 4BBRH 2R7ZG 4NXNQ 3UDGA 2UXCL 1HR0W 4DV3Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KJP A;  1FVI A;  3H0G H;  4P75 A;  3HOX G;  4DV4 Q;  4DV5 Q;  1GM5 A;  4HID A;  3E9I A;  5FLM H;  1HNZ L;  2UUB Q;  1OTC A;  1WI5 A;  3F1Z A;  4B3S Q;  3I4N G;  3CP0 A;  3S1N H;  2LXJ A;  4PZ8 A;  2F52 A;  1NY4 A;  5IP9 H;  1PFS A;  1FJG Q;  2JQO A;  3PF5 A;  2ES2 A;  2AMC B;  4OWX B;  4Y52 H;  1Q1B A;  2RHQ B;  2Q2I A;  3T1H L;  3J81 i;  1Q7Y C;  1IBK Q;  4JI8 L;  1VQE A;  4GKJ L;  4A3B G;  1YJN A;  4JV5 L;  4JBJ A;  3J80 c;  2QA4 A;  3E9H A;  3HOY G;  2CWA A;  2DGY A;  2I5L X;  2UUC L;  3RR5 A;  1EFW A;  1A8V A;  4IPH A;  3UDX A;  1G51 A;  4UY8 C;  3K0X A;  4P71 A;  2EIF A;  2I5H A;  4PZ6 A;  1EWI A;  1TWH H;  3I2Z A;  4JBW A;  4LFA Q;  1UE5 A;  4YY3 L;  3J81 c;  1K9M C;  1JJ2 A;  1T9H A;  5LMN Q;  2HT1 A;  1G6P A;  3PSI A;  2GVB A;  4IPD A;  4DV7 Q;  1HH2 P;  4LF4 L;  4YWM A;  3OW2 A;  1I94 Q;  3ICE A;  5IY0 A;  2VQF Q;  3PUV A;  3T1Y Q;  2R7Z H;  1N34 Q;  1VQ4 A;  1Y1W G;  4KLK A;  5C0X G;  3H3V H;  2F4V L;  5C3E H;  4DR3 Q;  4BY7 G;  1CSP A;  2GN5 A;  4BA1 I;  5AJ3 L;  3HOX H;  5IP7 G;  1IXR A;  5IE8 A;  3I4N H;  3CW2 C;  1AH9 A;  4Y7N H;  4LF7 L;  2UXC Q;  1L1O A;  4X62 Q;  1TWC H;  3BU2 A;  4H02 A;  2MNA A;  2R92 G;  1XPU A;  2CQO A;  2B63 G;  1HNX L;  1GD7 A;  2DUD A;  1SLJ A;  4AYB E;  1HR0 L;  4GLV B;  4A3B H;  1JE5 A;  4QY7 A;  4AIM A;  1EIY B;  1IL2 A;  4A3I H;  4YCW A;  3HOY H;  3S15 H;  1XPR A;  1YZ6 A;  4UP9 A;  1KQS A;  5M5Y H;  1XMO L;  4C3J H;  1SRU A;  1C7Y A;  5JJI A;  3GTG H;  3I56 A;  4GKJ Q;  3ZJY C;  4JV5 Q;  4JI7 L;  2UUA L;  4OX9 L;  2WAQ G;  2CWP A;  2K52 A;  4IPC A;  3L2P A;  3GTQ H;  3M4P A;  1BBU A;  5GQO A;  2ID0 A;  2JJQ A;  4APV A;  4HJ5 A;  4B3T L;  4DR7 L;  4P72 A;  1LUZ A;  3CMA A;  4BBS G;  2HIV A;  4A3F G;  3TRZ A;  1R9T H;  4YY3 Q;  1X3G A;  2I5M X;  3EBE A;  3J81 j;  1UE7 A;  3I4M G;  1IBM L;  3AYH B;  1Y1W H;  1OXT A;  1YBY A;  2JK8 A;  1GKH A;  3RZO H;  4BY7 H;  3EIV A;  3U4Z A;  1X65 A;  1LTL A;  1M90 C;  1VQD A;  4AH6 A;  3OYY A;  5IP7 H;  2CFM A;  4POG A;  2FXQ A;  1Q46 A;  4LFB L;  2NVQ H;  2F4V Q;  2E5L Q;  4TVA B;  5FLX c;  1J5E Q;  2JEB I;  4JI4 L;  3CC4 A;  3PUY A;  2A8V A;  1CKM A;  2E2J H;  5C4J H;  2R92 H;  1LM0 A;  2KBN A;  2B63 H;  3E0E A;  4R4C A;  1OXX K;  2KHJ A;  3KFU A;  4YWL A;  3HOU G;  3S14 H;  1S40 A;  2UXD L;  3A5U A;  4J15 A;  5FJ8 G;  4AQY Q;  4A3D G;  3W1B A;  2Q2U A;  1N32 Q;  1J6Q A;  1IBL Q;  4FDB A;  2RHS B;  4C3I H;  1C9O A;  4IPG A;  1XMQ Q;  4GLX A;  4DR6 Q;  3PGZ A;  2MO1 A;  2YV5 A;  4A3F H;  2OTL A;  5JEA G;  1RL2 A;  3ULP A;  4DK6 C;  5EAY A;  2UUA Q;  2VZA A;  3I4M H;  4JI5 L;  2ZJP A;  4GOP C;  5E7N A;  4K0K L;  2IT1 A;  1VQK A;  4GOP B;  2L15 A;  3NBH B;  1VQA A;  3LGJ A;  4JC0 A;  4JI1 L;  3ULJ A;  3GTJ H;  1YIJ A;  1OXS C;  1VQN A;  1IBM Q;  2LXK A;  2PNH A;  3STB C;  2D0P A;  2WAQ E;  3KDF B;  1XJV A;  3PUW A;  1PA6 A;  2B29 A;  3RZD H;  4IFD J;  1SN8 A;  1NMF A;  4PZ7 A;  5M5W H;  5IYD G;  4DV6 Q;  2HHH L;  3HOV G;  3NEL A;  4X64 L;  4JI0 L;  2QGQ A;  4NXM L;  2OCE A;  1PVO A;  4X65 L;  4A3E G;  1YI2 A;  4DUZ L;  1VQP A;  1AE2 A;  1SMX A;  2IHF A;  2JA8 G;  4JCV E;  3HOU H;  3AFQ A;  4JI6 L;  1S72 A;  2XTI A;  3TS0 A;  1VS0 A;  3OTO Q;  1QVF A;  1E24 A;  5DLQ E;  5IT9 c;  1JT8 A;  2KCM A;  3B6Y A;  4DR5 Q;  5FJ8 H;  1EQQ A;  1PH4 A;  4A3D H;  1JJG A;  5JJL A;  2WP8 J;  2VUM G;  1YHB A;  4JYA Q;  1MJC A;  3SGI A;  3PF4 A;  3J80 i;  2R7F A;  4LF6 Q;  1XPO A;  1YVC A;  2A19 A;  3KLW A;  1CUK A;  2Y0S G;  4DNI A;  4X66 Q;  4IO9 A;  4DUY Q;  1Q81 C;  1TWG H;  2YTV A;  3GO5 A;  1PH6 A;  2K75 A;  4X6A H;  3KJO A;  4GNX C;  1N33 Q;  3IRB A;  1K3R A;  3HKZ G;  1W3S A;  4GNX B;  4DR2 Q;  3STB D;  4GLA C;  3F2D A;  2JE6 I;  1K73 C;  1D8L A;  4R4Q A;  1YJ9 A;  1NBW A;  1B8A A;  3RLO A;  4OWT B;  4K0K Q;  1HZA A;  4GN3 B;  5ELO A;  4C2M H;  2JA9 A;  1N36 Q;  2BA1 A;  3U4V A;  2ZM6 L;  3UDF A;  1PYS B;  5IYD H;  3CC7 A;  5C44 G;  3FP9 A;  3HOV H;  2K50 A;  3CCQ A;  1X3E A;  2PMZ E;  4YHH Q;  2VQE L;  1KL9 A;  4A3E H;  5J3B A;  4L5S A;  2E2I H;  2JA8 H;  1OXU A;  1G29 1;  1YEZ A;  4DAY B;  1U5K A;  1KD1 C;  4A3C G;  4B3R Q;  3CCS A;  3PUZ A;  2CKZ B;  4A93 G;  1M1K C;  3CF5 A;  2K5N A;  4JI2 L;  3KF6 B;  1QUQ B;  2RF4 A;  4B3M Q;  2VUM H;  1VQO A;  4A76 A;  2E2H H;  5IYC G;  2C35 B;  5GRO A;  1Q86 C;  1JB7 A;  4GKK L;  5H1S E;  5HGQ A;  2YU9 H;  1P16 A;  4IJL A;  3RNU A;  4DR4 L;  3TQY A;  5GAD C;  1HR0 Q;  1WOC A;  1QZG A;  4JI3 L;  1HNZ Q;  4A3L G;  4LF5 L;  2Z0S A;  2JA5 G;  1TWA H;  4JBK A;  3RN5 A;  5IYB G;  1PHJ A;  2BH2 A;  3PO2 G;  2PQA B;  2NVY H;  2UXB Q;  3ER0 A;  4OWW B;  3M3Y H;  1Y1V G;  2IY5 B;  3T1H Q;  4ME3 A;  4YCU A;  1EQR A;  3TEH B;  2CCZ A;  4JI8 Q;  2MFI A;  2N78 A;  5C44 H;  3L7Z C;  4UP7 A;  3DLL A;  4UPA A;  4IJH A;  2UUC Q;  5BR8 L;  2F3I A;  2Y0S E;  3M85 A;  1H95 A;  5IWA L;  2ZM6 Q;  2OQ0 A;  3HKZ E;  3PO3 G;  5C4X G;  4A3C H;  1Y14 B;  3K7U C;  4A93 H;  1HZC A;  2D0O A;  2VQE Q;  1A63 A;  3PUX A;  1Z9F A;  4C3H H;  3FHW A;  4LF4 Q;  2K5H A;  3HOW G;  3GTL H;  4IFD I;  3GTM H;  4HIM A;  2NVX H;  4JOI A;  1NTG A;  1NE3 A;  2ZTC A;  1N9W A;  1Q8K A;  1JJC B;  4JI2 Q;  4DR1 L;  2OWO A;  3HOZ G;  2MQH A;  1XNR L;  4A3J G;  2AHO B;  2KCT A;  5AJ3 Q;  4DAM A;  4A3L H;  2Z6K A;  2NZH A;  1JMC A;  1X6O A;  2V1C C;  5IYB H;  1XNQ L;  3M7N A;  1RIP A;  1PYB A;  4DR4 Q;  3A0J A;  1VQM A;  5C0X J;  4LF7 Q;  2D62 A;  3BZC A;  4LF9 L;  2R7D A;  1BBW A;  1U0L A;  1Z47 A;  1HZ9 A;  2UU9 L;  1Y1V H;  4QGU A;  3A74 A;  4HJA A;  4LF5 Q;  4LF8 L;  1A62 A;  1WCM G;  3UE1 A;  1QVG A;  1HNX Q;  1VQC A;  4R1J A;  1KC8 C;  3HFZ B;  3U50 C;  3JAM c;  1PH1 A;  3CC2 A;  2WB1 G;  1PH9 A;  1V9P A;  4IOA A;  4DV1 L;  4LUO A;  4QJF A;  4OXP A;  5ELN A;  3KOJ A;  1XMO Q;  1E22 A;  1XTD A;  1L1O C;  5GAE C;  4BBS H;  1KAW A;  2BA0 A;  4JI7 Q;  1L1O B;  1EUJ A;  4A3K G;  2JA6 G;  2XGT A;  5C4X H;  4DK3 C;  3PO3 H;  3AFP A;  4O0A A;  3CQZ H;  4NXN L;  3RLN A;  4DR7 Q;  4B3T Q;  1B70 B;  4DV3 L;  3TRE A;  4EQ5 A;  4DV4 L;  4DV5 L;  3HOW H;  1E3P A;  4TQU S;  4LWC A;  2UUB L;  2N49 A;  4B3S L;  1ASZ A;  1W2B A;  2JA7 G;  4LW1 A;  1FJG L;  1VQJ A;  3HOZ H;  4A3J H;  3Q8D A;  1FL0 A;  3CCM A;  3CCU A;  4DV0 L;  2A1A A;  3K81 C;  4R4O A;  1Q82 C;  5K36 G;  3CPF A;  4OO1 I;  4LFB Q;  2HQL A;  1KRT A;  4POF A;  4P73 A;  5GAG C;  3GD7 A;  1MJE A;  1XNR Q;  4JI4 Q;  4LUV A;  4HJ7 A;  4PG3 A;  2PI2 A;  3S17 H;  2QEX A;  1WCM H;  3I55 A;  3I7F A;  1E1O A;  1YHQ A;  3CCL A;  1KRS A;  4LFA L;  1HNW L;  1QVC A;  1CKN B;  1DGS A;  4OO1 G;  1TXY A;  2UXD Q;  3M9B A;  3ULL A;  4MNO A;  4EX5 A;  2IX0 A;  4WJ4 A;  2GVA A;  4DV7 L;  2UXB L;  1K83 H;  1I94 L;  4A3K H;  2JA6 H;  2VQF L;  3RLF A;  1N8R C;  2JEA I;  3H3V I;  4LNQ A;  4DV1 Q;  3K80 C;  1N34 L;  2KEN A;  3G48 A;  1D7Q A;  4R4T A;  2I0Q A;  2AWO A;  1PV4 A;  1I5F A;  4RMF A;  2AWN A;  4HJ9 A;  3S24 A;  3CCR A;  4JI5 Q;  4QQB X;  1QZH A;  2HIX A;  2WB1 E;  3J7Z C;  2VY3 A;  3CXC A;  5C3E G;  3CCE A;  4DV2 L;  2JA7 H;  4X62 L;  2Q2T A;  4JI1 Q;  3G6E A;  3S2D H;  3M4Q A;  1VQH A;  5JEA J;  1K0R A;  4P74 A;  2ZTE A;  1WJJ A;  1YNX A;  4GS3 A;  5M3M G;  1TWF H;  1VQF A;  2E8G A;  2PI2 E;  3F8T A;  3K7A H;  4YCV A;  3PIP A;  2R6G A;  2YYZ A;  3PCO B;  1X54 A;  4XTC S;  2ATW A;  4A3G G;  1HNW Q;  2OTJ A;  3DM3 A;  2YTY A;  4BA2 I;  3FKI G;  4DV0 Q;  2HHH Q;  3KYH C;  4X64 Q;  4KI0 A;  4JI0 Q;  1MIU A;  2Q2H A;  4NXM Q;  1WFQ A;  3MEF A;  4X65 Q;  4DUZ Q;  2ASB A;  1PH8 A;  2VNU D;  1Q1E A;  4XIG S;  2EXD A;  3W1G A;  4A3I G;  4JI6 Q;  1I3Q H;  4DPG A;  1SFO H;  1VQ6 A;  2ZTD A;  4YWK A;  1UE6 A;  1MKH A;  4L5R C;  3W5O A;  2BH8 A;  5C0X I;  1L0W A;  2KHI A;  1KHI A;  4O2D A;  1VQ5 A;  3F2C A;  3U58 A;  4OX9 Q;  3K8A A;  1PH7 A;  1VQL A;  1L2F A;  1NMG A;  1IZ6 A;  3GTO H;  1NJI C;  1PH3 A;  1KXL A;  2IX1 A;  2E5L L;  1J5E L;  1KIX A;  1UEB A;  4A3M G;  3CCV A;  4DKA C;  5GAH C;  3ERS X;  5M3M H;  3H15 A;  1VQI A;  4HIO A;  1X55 A;  1LYL A;  1AE3 A;  4NB3 A;  4DV2 Q;  1E7Z A;  2N3S A;  1YJW A;  4KHZ A;  4A3G H;  5LMU L;  3D0F A;  4MZ9 A;  4QL5 A;  3FKI H;  4BY1 G;  1X9N A;  2R93 G;  4IOC A;  4GOP A;  1GVP A;  4AQY L;  1V1Q A;  1N32 L;  5HY6 A;  3S1R H;  1IBL L;  4L5Q A;  3BZK A;  1HJP A;  4MTN A;  1ASY A;  5IYC H;  3I4O A;  3PV0 A;  4RG1 A;  3VDY A;  4LFC L;  1GO3 E;  2IHE A;  4HJ8 A;  3KDF A;  1XMQ L;  4DR6 L;  4BXX G;  3PIO A;  3KF8 B;  1OXV A;  1X3F A;  1UE1 A;  1S3O A;  1YHA A;  2VW9 A;  1I50 H;  1FGU A;  3JAM i;  2JA5 H;  1EIF A;  3BJU A;  1B7Y B;  3CME A;  4JBM A;  5M3F G;  4GKK Q;  4LUZ A;  3PO2 H;  1PH5 A;  3J7A 5;  1P8L A;  2ALY B;  3AQQ A;  3L0O A;  4IFD G;  3UDI A;  4JI3 Q;  3S2H H;  1IYJ B;  4QIW E;  2VS1 A;  5M5X H;  4ALP A;  2ZJQ A;  1CKN A;  2K14 A;  3MXN B;  3CPW A;  4A3M H;  3GTP H;  4DV6 L;  1EYG A;  4NPS A;  4HIK A;  2OQK A;  1SRO A;  1C0A A;  4KHP L;  2WFW A;  1PH2 A;  1E1T A;  2VL6 A;  3EN2 A;  1YIT A;  1X56 A;  4A75 A;  3OTO L;  2K4K A;  4BY1 H;  2MO0 A;  2NN6 I;  3RN2 A;  2R93 H;  5BR8 Q;  4DR5 L;  3M4O H;  2YTX A;  4GNX A;  1K8G A;  3TS2 A;  5IWA Q;  2EQS A;  4JYA L;  5LMU Q;  3UE0 A;  2K5V A;  3S1Q H;  4BBR G;  2N8N A;  4LF6 L;  4BXX H;  2RCN A;  2NN6 G;  4X66 L;  4R4I A;  4DUY L;  4PMW A;  3H0G G;  1CKO A;  1O7I A;  3G4S A;  3CD6 A;  3S1M H;  5FLM G;  4LFC Q;  1VQ8 A;  1VQ7 A;  1N33 L;  5M3F H;  2NZO A;  1VQ9 A;  4DR2 L;  1IBK L;  4DR1 Q;  4WJ3 M;  1VQB A;  5IP9 G;  2H5X A;  1CSQ A;  3A5Z B;  1UWV A;  1QUQ A;  3KF6 A;  1N36 L;  1XNQ Q;  1Q12 A;  4UP8 A;  4GN5 A;  3G71 A;  4A4I A;  4LF9 Q;  4JOI C;  2UU9 Q;  5LMN W;  5LMN L;  2LSS A;  4LF8 Q;  1BVS A;  1WYD A;  4GN4 B;  4YHH L;  1VCI A;  1SR3 A;  3WWV A;  3GTK H;  1VQG A;  5JJK A;  1K8A C;  3NEM A;  3F2B A;  2Z6K C;  3D31 A;  3T1Y L;  4B3R L;  4JG2 A;  4L5T A;  3AEV A;  3S16 H;  4KHP Q;  1EOV A;  2PQA A;  3JC6 6;  3HKS A;  4DR3 L;  2AKW B;  1SE8 A;  2B3G A;  1BKB A;  4B3M L;  4OON A;  2ZJR A;  4AYB G;  3CCJ A;  1HZB A;  1I6H H;  1V43 A;  3CAM A;  1A0I A;  2NVT H;  3NEN A;  3GDE A;  4BBR H;  2R7Z G;  4NXN Q;  3UDG A;  2UXC L;  1HR0 W;  4DV3 Q; 
#chains in the Genus database with same CATH topology
 4EGV A;  4QUF A;  1U9R A;  2V4D A;  2UUB Q;  3E9I A;  3HOW B;  3I4N G;  4MN3 A;  2P5Z X;  5D3D A;  2LXJ A;  3IAY A;  4GZY C;  5IP9 H;  1PFS A;  1WTH A;  1FJG Q;  4Y52 H;  3N6R A;  1Q1B A;  2Q2I A;  4H0L C;  5FK9 C;  2EZV A;  3S1M B;  1LT4 D;  4GKJ L;  1VQE A;  1BO0 A;  5J22 A;  2QA4 A;  1STA A;  2CWA A;  2UUC L;  3RR5 A;  1EFW A;  2QEJ C;  4ODG A;  4UY8 C;  1WCM B;  4PZ6 A;  2O5I C;  4MHE A;  3SK6 A;  5LMN Q;  3D4R A;  2HT1 A;  3PSI A;  2O2L D;  4DV7 Q;  3OW2 A;  3A55 A;  3E6Z X;  1L0X B;  4N9P A;  2JA6 B;  1IYU A;  1PTO F;  2E74 C;  4O1N A;  2F4V L;  1IKL A;  1QJO A;  1PRT F;  4BA1 I;  5I6W A;  5IP7 G;  1IXR A;  3I4N H;  4C1N K;  4Q5V A;  3OHX C;  3WOF A;  1XPU A;  2F0J A;  2B63 G;  4AYB E;  1SLJ A;  2PCF B;  1D5Z C;  1XTC D;  4AIM A;  4DF7 A;  1EIY B;  4A3I H;  1SE4 A;  3S15 H;  4UP9 A;  3BVZ A;  1XMO L;  4GKJ Q;  1PFB A;  3M4P A;  3QIA A;  2JJQ A;  3NP8 A;  4F8M A;  4HJ5 A;  3Q22 A;  1SFO B;  1FNU A;  3LNN A;  2I5M X;  2M00 A;  2EYL A;  1IBM L;  2HCI A;  1CHQ D;  1O7Y A;  1EOT A;  3EIV A;  2D9U A;  5I4D A;  5IP7 H;  2FXQ A;  4RA8 A;  1SSO A;  3P75 A;  4KKU A;  2F4V Q;  5FLX c;  1J5E Q;  2EY6 A;  2JEB I;  4JI4 L;  3CC4 A;  3X3N A;  2KBN A;  2JN4 A;  3NK9 A;  2B63 H;  1XX8 A;  2KHJ A;  4J1M A;  3RUZ A;  4YWL A;  4BS9 A;  5JVH 3;  3RD4 A;  3MTS A;  2UXD L;  1SBB B;  4A3G B;  3JAM E;  4J15 A;  3A5U A;  3TSS A;  3OWF A;  3HP3 A;  2RKS A;  4FDB A;  1QG7 A;  4QIW B;  2RHS B;  3VYT A;  1CFM A;  4A3I B;  1XMQ Q;  3S15 B;  4GLX A;  3BYY B;  2MO1 A;  4Z9C B;  5JEA G;  3ULP A;  1A15 A;  1STE A;  2B8F A;  4JI5 L;  4GOP C;  3NUC A;  5E7N A;  2IT1 A;  4GOP B;  5EJW A;  3GTJ H;  2CQA A;  1IBM Q;  3A8J E;  5KIX A;  5IYD G;  3E0J A;  4KY5 A;  2QGQ A;  4A3E G;  4EQN A;  1GUW A;  1RHP A;  1SMX A;  1D5X C;  2IHF A;  4JCV E;  2NBF A;  3AFQ A;  2XTI A;  3TS0 A;  2KCM A;  2R93 B;  1EQQ A;  1BUV T;  2B63 B;  5NUC A;  1Q8I A;  2CVR A;  1SDF A;  1M4V A;  5ISR A;  1XPO A;  3KLW A;  5JEA H;  1ZYR C;  1PH6 A;  1TWG H;  3KJO A;  1STH A;  1ZEQ X;  3HG9 A;  4DR2 Q;  2F0N A;  1HFN A;  3BS1 A;  2JE6 I;  2RSO A;  1YJ9 A;  1B8A A;  5EPL A;  2JA9 A;  1KNE A;  2AQ2 B;  1PYS B;  1B4O A;  5IYD H;  3CC7 A;  2K50 A;  2OF1 A;  2VQE L;  4A3E H;  4L5S A;  1HA6 A;  2E2I H;  4WJW A;  5FLX L;  3GTK B;  3CRK C;  3K5N A;  4B3R Q;  3CCS A;  3PUZ A;  1QUQ B;  3MXN A;  2RF4 A;  1LV9 A;  4CKE A;  2A69 D;  5EPK A;  4GKK L;  1P16 A;  4PNY A;  4XQQ A;  2KA7 A;  2EVB A;  5GAD C;  1HNZ Q;  4LF5 L;  2JA5 G;  4JBK A;  1PHJ A;  3KLR A;  3QJY A;  1WTQ A;  1WTO A;  1WVL A;  2WAC A;  3NQT A;  4FXK C;  2IY5 B;  5C6A A;  1TWG B;  1U4L A;  3T1H Q;  1GOZ A;  2N78 A;  3DHQ A;  4UPA A;  3DEP A;  1H95 A;  4CGY B;  2JP1 A;  3PO3 G;  1TWH B;  1HTL D;  5C4Z A;  3BDO A;  1HZC A;  2VQE Q;  1B3Q A;  1Z9F A;  5CBA E;  1JWM D;  3OMG A;  3MAQ A;  4JOI A;  4AYB B;  1NE3 A;  3FMC A;  4DR1 L;  4RGO S;  2OWO A;  4A3J G;  2AHO B;  3LX0 A;  3CKI B;  1A2T A;  2A5H A;  1JMC A;  5IGF A;  1X6O A;  2V1C C;  3DEO A;  5G3L F;  2XN9 C;  5C0X J;  3D8G A;  3BZC A;  4LF9 L;  1BBW A;  2UU9 L;  2BOS A;  4QGU A;  3A74 A;  4LF5 Q;  2Z4I A;  3K6O A;  2DN8 A;  3HFZ B;  2RDG A;  1PH1 A;  1JOO A;  3J80 L;  2WB1 G;  4DA2 A;  2FHT A;  1JB3 A;  4QJF A;  5ELN A;  3HOY B;  4K5V A;  4BBS H;  1PTO D;  2BA0 A;  4CJ2 C;  3PO3 H;  2XGT A;  2N88 A;  1PRT D;  4O0A A;  3I70 A;  4B3T Q;  2FIN B;  1I4X A;  2L55 A;  4QUC A;  1QNK A;  4B3S L;  1ASZ A;  1W2B A;  1Y1W B;  2JA7 G;  4A3J H;  3Q8D A;  4OEL B;  3RZO B;  4R4O A;  2EJM A;  2JSO A;  2HQE A;  4LFB Q;  2HD3 A;  1MJE A;  1B9N A;  1AZQ A;  2LY7 A;  1ZXT A;  2PI2 A;  4PG3 A;  4E6I A;  2QEX A;  2KEE A;  2WIN B;  3Q0A A;  2PZU A;  1E1O A;  2Z8L A;  1DM0 B;  1HNW L;  1QVC A;  5DNF A;  1NAP A;  1Z7T A;  2Z9H A;  3M9B A;  4G57 A;  3ULL A;  2IX0 A;  3TBI B;  3H94 A;  1EWC A;  2VQF L;  2A68 C;  3H3V I;  1D7Q A;  2DNC A;  4R4T A;  2AWO A;  4C3I B;  1I5F A;  2F0H A;  5IGG A;  4HTH A;  4BBS B;  1LAB A;  1V1P A;  2AWN A;  2NTS A;  4HJ9 A;  1B50 A;  3CXC A;  2JA7 H;  3CCE A;  5C3E G;  1DYQ A;  2EYO A;  5CR3 A;  4X62 L;  2Q2T A;  3G6E A;  1LTT D;  2NYZ D;  3M4Q A;  3I73 A;  1VF5 C;  1YNX A;  3F8T A;  1SNM A;  1RDP D;  2PI2 E;  3IFT A;  3L2P A;  1RJT A;  1WTP A;  2YYZ A;  1LTB D;  3RZD B;  2OTJ A;  1MIU A;  4DUZ Q;  3A56 A;  1B44 D;  1EZ6 A;  4JI6 Q;  5FO9 B;  1BR9 A;  2KHS A;  3BDL A;  4L5R C;  3W5O A;  4I7A A;  1V1O A;  2K01 A;  3PQI A;  2WB1 B;  3QB3 A;  1KHI A;  3HS0 C;  4O2D A;  1T5X D;  1TKW B;  3MFY A;  3EQL C;  4OX9 Q;  2EY1 A;  4ZQ3 A;  1NJI C;  1FNW A;  4ZUI A;  2E5L L;  2F0E A;  5D14 A;  3QOL A;  5GAH C;  2XRQ D;  1STB A;  4K6L A;  2JA7 B;  1S5B D;  4KHZ A;  5LMU L;  4QL5 A;  4IOC A;  3OOC A;  1IBL L;  3C3L A;  3BZK A;  5IYC H;  4RG1 A;  1SJH D;  4LFC L;  1NNX A;  4HJ8 A;  1CI3 M;  2QDL A;  3PIO A;  1XXG A;  1G8Z D;  2QW7 A;  2K33 A;  1X3F A;  4FNF A;  2E2H B;  5M3F G;  4LUZ A;  1ESR A;  5I9O A;  2ALY B;  2SOB A;  3K5L A;  1EEF D;  3HGB A;  1PLF A;  5TSS A;  1EL0 A;  1CKN A;  2K14 A;  2F0U A;  3MXN B;  3EVQ A;  2EPB A;  4DK0 A;  5FLX E;  3M3Y B;  2J7Z A;  2F1M A;  2VL6 A;  1YIT A;  4A75 A;  1SMY D;  5D3I B;  3OTO L;  2K4K A;  3RN2 A;  5C44 B;  4ZUJ A;  1TQO A;  5ELC A;  5BR8 Q;  4DR5 L;  5IWA Q;  2R61 A;  5LMU Q;  3UE0 A;  1EIH A;  4BBR G;  2N8N A;  1HQM C;  4A93 B;  1PZI D;  2AUK A;  3CD6 A;  1O7I A;  4KHV A;  4CJ0 B;  3SDZ A;  4LFC Q;  1VQ7 A;  1N33 L;  2NVX B;  5M3F H;  2FMM A;  3KLS A;  4DAY A;  5KEE A;  2H5X A;  3V05 A;  1GUS A;  3W3A A;  1XNQ Q;  1SYB A;  1N36 L;  1EY5 A;  2K5W A;  2LS0 1;  5JPM C;  2F0L A;  4JOI C;  1GHJ A;  4GN4 B;  1VCI A;  5I2X A;  3D31 A;  3AEV A;  2B3G A;  4PMC A;  3GQB A;  4RCO A;  5DEH A;  4DNT B;  1HZB A;  1JR0 D;  1V43 A;  2EYP A;  2L12 A;  4BBR H;  4G7Z C;  4NXN Q;  3VR3 A;  5DM6 3;  5A2Q L;  2UXC L;  5G3L D;  4DV3 Q;  2D5D A;  4DV5 Q;  1GM5 A;  3F1Z A;  3K57 A;  4H7B A;  2FFK B;  1PFN A;  3CP0 A;  3S1N H;  4PZ8 A;  1F2Z A;  4H13 C;  4OWX B;  2NB0 A;  1BCP D;  2RHQ B;  4OL7 A;  4PQX A;  3J80 E;  3J81 i;  4J6H A;  2JYO A;  1Q7Y C;  3NTI A;  3MC0 B;  4CDE C;  2O4X A;  4C3J G;  4IPH A;  2G5D A;  3K0X A;  4P71 A;  2I5H A;  3JAM L;  1GHK A;  1T9H A;  3OW7 A;  1BDO A;  4YIJ A;  3SR1 A;  4IPD A;  2KCN A;  1HH2 P;  2NZ1 D;  4YWM A;  5JPN C;  2BE5 C;  2ENB A;  1VQ4 A;  1VMC A;  3HZX A;  1EQT A;  4BY7 G;  4RHS A;  4M1U B;  4LF7 L;  2UXC Q;  2M9V A;  1TWC H;  2EJF C;  4QCL A;  2R92 G;  5CGK A;  1ET9 A;  1GD7 A;  3OIQ A;  1AZP A;  2B2Y A;  4FO2 A;  3X3M A;  3S1N B;  1JE5 A;  3VR4 A;  1V1P B;  2IPK D;  4C3J H;  5JJI A;  3GTG H;  3ZJY C;  4JI7 L;  2UUA L;  2DY8 A;  2CWP A;  2WAQ G;  3O13 A;  1BBU A;  4APV A;  2ID0 A;  4DR7 L;  1X3G A;  2A6E D;  3EBE A;  3J81 j;  2PO4 A;  1DCZ A;  1CQV A;  1F2M A;  1ILP A;  4DGZ A;  1C8C A;  4BY7 H;  2K1B A;  3U4Z A;  1LTL A;  1Q90 A;  3I90 A;  1M90 C;  1NCV A;  1L0Y B;  5JOB A;  4EQP A;  1F2L A;  4NKL A;  1SNP A;  3PUY A;  4TSS A;  2R92 H;  4HMJ A;  5C4J H;  2Q8R E;  3E0E A;  3TN2 A;  2IW3 A;  3A8K E;  3P20 A;  5IOD A;  5JJZ A;  3K59 A;  2DY7 A;  3HOU G;  3S14 H;  1SNQ A;  1TWC B;  1K8M A;  3FKI B;  5FJ8 G;  4AQY Q;  4A3D G;  1N32 Q;  1J6Q A;  4L8J A;  3DWQ A;  1HPC A;  1C9O A;  4IPG A;  2XIW A;  4IAL A;  3G6J B;  2UUA Q;  5EAY A;  2X69 A;  1LTG D;  3E3X A;  1VQK A;  1VQA A;  3ULJ A;  3QR8 A;  3EA6 A;  1YNN D;  3STB C;  4XQN A;  4G7H C;  1Y69 U;  3PUW A;  5M5X B;  4IFD J;  1SN8 A;  1NMF A;  4DV6 Q;  4N8X 1;  3NEL A;  1IW7 C;  4X64 L;  4JI0 L;  4UAI A;  4NXM L;  3ONA B;  2JA8 G;  3HOU H;  1AE2 A;  1S72 A;  1HHV A;  2QCP X;  5DLQ E;  5IT9 c;  2R92 B;  5C4J B;  4BY1 B;  5FJ8 H;  1PH4 A;  3NTH A;  4A3D H;  5BN3 A;  2WP8 J;  2VUM G;  1BF4 A;  3SGI A;  5FOB B;  1ML0 D;  4HAE A;  3S14 B;  2G9H D;  4DNI A;  1TS4 A;  3FDT A;  4JW0 A;  2YTV A;  4MTK A;  2WAQ B;  1JQY D;  1CT1 D;  3HKZ G;  3SK8 A;  1J8I A;  4B08 A;  1QCB D;  4Q0F A;  1LTR D;  5ELO A;  2BA1 A;  3U4V A;  2ZM6 L;  2XNA C;  2IX3 A;  4FF4 A;  1ESF A;  1KL9 A;  2PZT A;  5J3B A;  2JA8 H;  2ZXO A;  2DJF C;  1G29 1;  4DAY B;  3PIP 3;  3F2U A;  1M1K C;  2K5N A;  1ILQ A;  4B3M Q;  2VUM H;  3S16 B;  4A76 A;  4WOR A;  2YU9 H;  3RNU A;  3TQY A;  1HR0 Q;  4A3D B;  1WOC A;  4JI3 L;  2Z6B A;  2K6A A;  3K5M A;  4PMB A;  1S5D D;  2BH2 A;  5IYB G;  3PO2 G;  3VYR A;  3OIP A;  3ERQ A;  3ER0 A;  2F0O A;  3U9O A;  1IHZ A;  2SEB D;  3A8I E;  4ME3 A;  1H9J A;  4YCU A;  3TEH B;  4OIJ A;  3L7Z C;  2WII B;  3DLL A;  1II3 A;  2UUC Q;  5E4X A;  4NP5 A;  4B9W A;  2ZM6 Q;  1RCV D;  5A2Q E;  3K7U C;  3VR2 A;  1A63 A;  1LLR D;  2K5H A;  4HN7 A;  1NTG A;  1DOM A;  1N9W A;  2XWJ B;  2CH4 W;  1CHP D;  5CV7 A;  2MQH A;  1H9M A;  2KCT A;  2VUM B;  4DAM A;  2DNE A;  3RMH A;  3AB9 A;  2Z6K A;  1LAC A;  2KJX A;  5IYB H;  1DOK A;  3I4N B;  2F0M A;  1VQM A;  2D62 A;  1G6Z A;  1TS3 A;  1F9P A;  3URY A;  5IGD A;  4LF8 L;  1A62 A;  3UE1 A;  1CM9 A;  4CDD C;  5ELB A;  4IOA A;  3KOJ A;  1XMO Q;  2L11 A;  1E22 A;  1XTD A;  4CDF C;  3WDN A;  1CA5 A;  3CQZ H;  4ILW A;  2B2Y C;  1B70 B;  3TRE A;  4DV4 L;  4K2K A;  4TQU S;  1UAP A;  2F0T A;  3CCM A;  2B2V A;  3K81 C;  1Q82 C;  5K36 G;  3ND8 A;  1F2Y A;  2WV6 D;  5CC4 A;  2KQ3 A;  1KRT A;  2B2T A;  4JI4 Q;  4LUV A;  4HJ7 A;  1WTW A;  4FP5 D;  2HCC A;  3I55 A;  3TME A;  3I7F A;  3CCL A;  4LFA L;  4HCS A;  1TXY A;  2UXD Q;  3VA7 A;  4MNO A;  4EX5 A;  4LK1 C;  4WJ4 A;  3CHB D;  1J9O A;  1K83 H;  1I94 L;  3C46 A;  2F3V A;  1N8R C;  2QKI C;  3K80 C;  1N34 L;  2KEN A;  1RTN A;  3QO2 A;  5KNC A;  4HSV A;  3FRP B;  4JI5 Q;  2IL8 A;  4MIU A;  2K05 A;  1QZH A;  5COR A;  2WB1 E;  4DV2 L;  1D5M C;  1YNJ C;  1QOH A;  1K0R A;  4RGN A;  5JEA J;  3V96 A;  5K36 H;  3GTJ B;  2TSS A;  1TWF H;  3K7A H;  2R6G A;  2ATW A;  4XTC S;  2RVL A;  3DM3 A;  1E2W A;  3MZ5 A;  3MEF A;  2ASB A;  2VNU D;  4XIG S;  1I3Q H;  4RHR A;  4DPG A;  1VQ6 A;  5CV4 A;  2ZTD A;  4IUR A;  3R2I A;  1ENC A;  1MKH A;  2BH8 A;  5C0X I;  1PYW D;  2CW0 C;  2Q8T A;  2KEC A;  1B9M A;  3A7A B;  3MWY W;  2A6H C;  3F2C A;  2NTT A;  5I2Y A;  2F0I A;  2EYH A;  5J39 A;  2IX1 A;  2QIL A;  4JPB W;  1UEB A;  3CCV A;  3VR5 A;  1W6K A;  2PNR C;  5FO7 B;  4DV2 Q;  2OXP A;  1E7Z A;  1YJW A;  1MI2 A;  3D0F A;  4K8I A;  3ZYY X;  5IGC A;  5M9O A;  2AQ3 B;  1TY2 A;  2LMC B;  4KD4 A;  3S1R H;  2PYK A;  3KUP A;  4L5Q A;  4A3E B;  1ASY A;  5A35 A;  2E2I B;  3PV0 A;  3VDY A;  1D6E C;  1EYC A;  3KDF A;  1G2S A;  4ULL A;  4DR6 L;  1OXV A;  1F9Q A;  1I50 H;  4DNR B;  1FGU A;  2JA5 H;  1E2V A;  3CME A;  4GKK Q;  1F9R A;  3SVM A;  1I3Q B;  1P8L A;  2C5C A;  3AQQ A;  3L0O A;  3UDI A;  1EU4 A;  3MXP A;  3GV6 A;  4JK1 C;  3S2H H;  3CRL C;  2A74 C;  3DUZ A;  4I65 A;  1EYG A;  3IFD A;  4HIK A;  2J4X A;  1C0A A;  4KHP L;  2WFW A;  5E4W C;  3J7A V;  1E1T A;  1X56 A;  2MO0 A;  2NN6 I;  3MEH A;  2J0T D;  4IUN A;  4GNX A;  4NDX A;  3TS2 A;  1HA5 A;  2EQS A;  2L9H A;  3T56 B;  5T1G A;  4JYA L;  2K5V A;  2ZT9 C;  1I4P A;  3S1Q H;  2BCO A;  5EKL A;  3FVQ A;  4LF6 L;  2NN6 G;  3TP8 A;  1EY8 A;  4X66 L;  4DUY L;  1X3Q A;  3H0G G;  3S1R B;  3G4S A;  1HXY D;  5BN5 A;  5FLM G;  2RBM A;  4DR1 Q;  5EKK A;  4WJ3 M;  1HTP A;  4IUU A;  2F0W A;  3KF6 A;  4X3U A;  5CYU A;  1Q12 A;  4UP8 A;  2JA5 B;  2F0F A;  4LF9 Q;  2VB3 X;  2UU9 Q;  5LMN W;  5JAV A;  4LMQ D;  1SYC A;  4YHH L;  4HR7 B;  1SR3 A;  5JJK A;  1K8A C;  3C1E A;  2F0P A;  3F2B A;  2Z6K C;  4JG2 A;  1S5E D;  4L5T A;  2Q8I B;  4KHP Q;  3OWE B;  1VF7 A;  4DR3 L;  1SE8 A;  3HEJ A;  2ZJR A;  1G2T A;  4FXG C;  2R7Z G;  1JIC A;  1LT6 D;  3PO3 B;  1JOR A;  2NN6 H;  1HR0 W;  1DJR D;  1FVI A;  2MP1 A;  3H0G H;  3HOX G;  3D4W A;  5FLM H;  1OTC A;  4B3S Q;  1TII D;  2F52 A;  1NY4 A;  2JQO A;  3PF5 A;  3VA5 A;  4A3J B;  4JI8 L;  5I9P A;  4A3B G;  3NHH A;  4JBJ A;  3E9H A;  4X3S A;  2I5L X;  1ONL A;  2DGY A;  5C5L A;  4KN4 C;  3UDX A;  1SE2 A;  2B2V C;  4FYD A;  4JBW A;  1HNW Q;  3I2Z A;  1K9M C;  2K7V A;  3A54 A;  1RD9 D;  1G6P A;  1X3P A;  2B2T C;  1EFI D;  4LF4 L;  3ICE A;  1JE4 A;  2VQF Q;  3PUV A;  2R7Z H;  1K28 A;  4EVO A;  2E76 C;  5ELE A;  5LHY 1;  3H3V H;  1AN8 A;  5C3E H;  4DR3 Q;  1CSP A;  1EY4 A;  2GN5 A;  5AJ3 L;  3HOX H;  2IJ0 A;  1KAB A;  1AH9 A;  1EY9 A;  5IGE A;  2L4N A;  4Y7N H;  1L1O A;  3KBX A;  4X62 Q;  2EYF A;  2MNA A;  3EFX D;  2L0C A;  3H0G B;  2EJG C;  1HNX L;  2H1E A;  1HRJ A;  4GLV B;  4A3B H;  2HDM A;  5KNB A;  2EXZ A;  4QY7 A;  3TDQ A;  4J8Q A;  4YCW A;  1XPR A;  1KQS A;  5M5Y H;  2EOT A;  1SRU A;  2JXM B;  2MJ8 A;  1C7Y A;  3I56 A;  1GJX A;  2K52 A;  2Z4H A;  3GTQ H;  4DXF A;  1U4M A;  2F0G A;  5EQ0 A;  4P72 A;  1B53 A;  4A3F G;  4XYO A;  3R2T A;  3P7J A;  3I4M G;  3AYH B;  1VQD A;  3OYY A;  2CFM A;  4POG A;  3DM1 A;  1C48 A;  1Q46 A;  3H3V C;  2NVQ H;  2E5L Q;  4TVA B;  1SYE A;  5C3E B;  1CKM A;  2E2J H;  3DWP A;  3HOX B;  1I4H A;  4U67 3;  1OXX K;  3KFU A;  4CHT B;  1T5E A;  1JOQ A;  4Y7N B;  1S40 A;  3MHB A;  3NWT A;  1K8O A;  3W1B A;  2Q2U A;  5C4H A;  1IBL Q;  4JVZ A;  1EYD A;  3E5S A;  5FO8 B;  5M5Y B;  2YV5 A;  4A3F H;  1RL2 A;  4DFA A;  4ZAI A;  1ICF B;  3I4M H;  2ZJP A;  3BG3 A;  4K2L A;  3GTQ B;  2L15 A;  3WOE A;  4JI1 L;  4UHV A;  5IOC A;  4QB4 A;  1QWY A;  2LXK A;  2AQ1 B;  2WAQ E;  3KDF B;  5KGU A;  3T13 A;  1PA6 A;  3J7A F;  4PZ7 A;  4HCE A;  2HHH L;  3HOV G;  1I4G A;  4X65 L;  2CHB D;  5DM7 3;  1YI2 A;  1K0S A;  2K03 A;  4RGT A;  2B8G A;  3OTO Q;  1QVF A;  2E2J B;  4DR5 Q;  1JJG A;  4N9T A;  5JJL A;  1MJC A;  2VXW A;  3J80 i;  4CDC C;  1Q81 C;  1CUK A;  2Y0S G;  1F77 A;  2A69 C;  4F88 A;  4GNX C;  1N33 Q;  1K3R A;  1W3S A;  2K5D A;  3DWA A;  4GNX B;  5M3F B;  2PW5 A;  3F2D A;  1K73 C;  1D8L A;  5KRU A;  5EBD A;  3TP7 A;  2DJG C;  3RLO A;  5CBE E;  3C2P A;  4OWT B;  4GN3 B;  4C2M H;  1N36 Q;  3UDF A;  1BXT A;  2F03 A;  4TKO B;  3HOV H;  3CCQ A;  1SAP A;  5ELF A;  1PTO H;  1ENF A;  1YEZ A;  1U5K A;  2KCC A;  2CKZ B;  3CF5 A;  3KF6 B;  1NR4 A;  2RDF A;  4C3H G;  2C35 B;  1ZYR D;  1Q86 C;  1JB7 A;  2EY2 A;  5KYL A;  4BBR B;  4DR4 L;  1WTX A;  1NSN S;  1U4P A;  1QZG A;  3P1H A;  4A3L G;  1TWA H;  2RQX A;  5C5M A;  1H9S A;  1QE6 A;  2NVY H;  1W6J A;  4OWW B;  4H44 C;  1Y1V G;  1DON A;  1EZ8 A;  1EQR A;  1XWE A;  1O7Z A;  1B3A A;  2AUJ D;  2MFI A;  4UP7 A;  1KDA A;  4HMI A;  4DXG A;  4U68 A;  3V2T A;  4C2M B;  2OQ0 A;  3HKZ E;  5C4X G;  3MFG A;  3SXH A;  3HOV B;  2D0O A;  3PUX A;  2Z1C A;  4C3H H;  3FHW A;  4LJZ C;  3HOW G;  4IFD I;  2E2D C;  4KN7 C;  3H09 A;  3SE0 A;  2KOL A;  3J7Y W;  1A3V A;  2X6G A;  4O42 A;  2CW0 D;  1JJC B;  1MHW C;  1XNR L;  4R9W A;  1PDQ A;  4IUT A;  4A3L H;  3PIO 3;  2NZH A;  1RIP A;  1PYB A;  1S5F D;  4DR4 Q;  3A0J A;  3TZU A;  4LF7 Q;  2ICE C;  1U0L A;  2R7D A;  1Z47 A;  1HZ9 A;  2Y0S B;  1Y1V H;  2ICI A;  4HJA A;  1WCM G;  1QVG A;  1VQC A;  4IQZ A;  1TWA B;  3TP6 A;  1VMP A;  3U50 C;  1DZ1 A;  3CC2 A;  1S5C D;  4DV1 L;  1R4P B;  4LUO A;  4F87 A;  1L1O C;  5GAE C;  1KAW A;  4C3J B;  2EY5 A;  4JI7 Q;  1L1O B;  3GTG B;  2JA6 G;  1BNZ A;  5C4X H;  4DK3 C;  3AFP A;  3BVG A;  4DR7 Q;  4RAU C;  2E75 C;  4ME5 A;  4EQ5 A;  1A3U A;  3HOW H;  1E3P A;  2UUB L;  2N49 A;  4FXD A;  1RF2 D;  4LW1 A;  2CH4 A;  1VQJ A;  1FJG L;  2PW7 A;  4BY7 B;  1KDC A;  3OSO A;  1MGS A;  5C3W A;  4BWG B;  3PMF A;  2B2U A;  1SE3 A;  5GAG C;  1XNR Q;  3UI2 A;  1QB5 D;  1WCM H;  3Q23 A;  4PV1 C;  1KRS A;  1CKN B;  1DGS A;  3K58 A;  1LTI D;  4DV7 L;  2PPB C;  1EY6 A;  1TVX A;  2JEA I;  2JA6 H;  1ET6 A;  3CU7 A;  4DV1 Q;  5IIF A;  2I0Q A;  2FJ2 A;  1U4R A;  1PV4 A;  2MUY A;  1STY A;  4IUP A;  4RMF A;  3KBG A;  3S24 A;  1GXD C;  1PZJ D;  4QQB X;  5FKA C;  2HIX A;  3J7Z C;  2VY3 A;  5KYI A;  1IKM A;  4C56 C;  4UDU C;  1CK1 A;  3NSW A;  4P74 A;  3M4Y A;  1WJJ A;  5M3M G;  1LTA D;  1VQF A;  4YCV A;  4A3G G;  1SYG A;  4BA2 I;  1CZW A;  4ID6 A;  3KYH C;  4X64 Q;  4KI0 A;  4JI0 Q;  1SYF A;  2X6L A;  4NXM Q;  1WFQ A;  3A7L A;  3HOU B;  2EXD A;  2ZXR A;  3FPP A;  4A3I G;  5C3X A;  1SFO H;  2A68 D;  1ENA A;  2KUM A;  1A3T A;  3SK5 A;  2QDB A;  4NW2 A;  2KHI A;  5JVG 3;  1B2T A;  3K8A A;  5ELD A;  1PH7 A;  1VQL A;  3MA2 B;  1L2F A;  4N8F A;  1IZ6 A;  3GTO H;  1PH3 A;  5D65 A;  1J5E L;  4CJ1 B;  1AEX A;  1EQV A;  3T53 B;  2F3W A;  3BZD B;  5M3M H;  1SJE D;  1VQI A;  5BN4 A;  4HIO A;  1FR3 A;  4A3G H;  4DN4 M;  1MSG A;  4MZ9 A;  3NBI A;  1IL8 A;  1CA6 A;  1X9N A;  2R93 G;  3NBH A;  1V1Q A;  3L3O C;  4OGQ C;  1SMY C;  2WKD A;  2JA8 B;  4MTN A;  5IT9 L;  1XMQ L;  1FD7 D;  1DOL A;  4BXX G;  1HUM A;  3QWN A;  3KLS X;  5CV5 A;  5CV8 A;  1YHA A;  4ZYS A;  1MD2 D;  3JAM i;  1EIF A;  1B7Y B;  1GUG A;  2GA4 B;  4K8J A;  1C4Q A;  4JBM A;  3PO2 H;  1PH5 A;  4RH6 A;  2YU9 B;  4JI3 Q;  3T16 A;  2ZJQ A;  1KLU D;  4TRD A;  3HKZ B;  3H91 A;  1UEA B;  1PZK D;  3S9W A;  1PH2 A;  3GTO B;  2MHV A;  3EN2 A;  5IGB A;  2F0K A;  2R93 H;  2YTX A;  1X32 A;  1K8G A;  1H9S B;  1JWS D;  1Y8N B;  5M3M B;  3FEW X;  4ZCK A;  1SND A;  1PXU A;  2H4O A;  4NMZ A;  4BXX H;  4IUV A;  2RCN A;  2KED A;  4R4I A;  1H9K A;  3ERO A;  1Y8O B;  4KY6 A;  3NPP A;  2NZO A;  4DR2 L;  2F4I A;  1IBK L;  3T51 B;  1VQB A;  3SHL A;  1CSQ A;  3IKJ A;  3A5Z B;  4KJN A;  4XT1 B;  1WD1 A;  4GN5 A;  1BCP C;  3G71 A;  3PO2 B;  1BCP B;  2I46 A;  1A2U A;  3QOJ A;  4FF3 A;  4LF8 Q;  4HSP A;  1GUO A;  3WWV A;  3GTK H;  1O7L A;  3NEM A;  3MVV A;  2RA4 A;  3T1Y L;  4B3R L;  3I3C A;  3JC6 6;  2PQA A;  1BKB A;  3LWU A;  3TZD A;  2L5T A;  2FMC A;  3CCJ A;  4AYB G;  5I6Y A;  1I6H H;  1A6X A;  1STN A;  3CAM A;  1A0I A;  2NWG A;  3BDC A;  3GDE A;  4OIK A;  3CQZ B;  3D4D A;  2F0Q A;  3KJP A;  4DV4 Q;  4P75 A;  2NVT H;  1HNZ L;  4DK1 A;  4HID A;  4DAP A;  2F0D A;  1WI5 A;  1TT2 A;  2BDO A;  4QMG A;  1KDB A;  2ES2 A;  2AMC B;  2B39 A;  5EBC A;  4RFB A;  3T1H L;  1IBK Q;  4JV5 L;  1YJN A;  3J80 c;  1HFG A;  3HOY G;  4KKT A;  1A8V A;  1TU2 B;  1G51 A;  4LFA Q;  2EIF A;  4YY3 L;  1EWI A;  1TWH H;  3J81 c;  1JJ2 A;  1I6V C;  1M8A A;  1UE5 A;  2G9D A;  4G7O C;  2NUC A;  1D2B A;  3IL8 A;  2GVB A;  2B2U C;  5LL6 X;  1I94 Q;  5IY0 A;  3T1Y Q;  1K83 B;  1N34 Q;  1Y1W G;  4KLK A;  1RTO A;  3BVM A;  5C0X G;  2A6E C;  1GUT A;  1HQR D;  1TY0 A;  2EYJ A;  1FNV A;  3OMC A;  5IE8 A;  1I6H B;  4X3T A;  3CW2 C;  2KVM A;  3BU2 A;  4H02 A;  1RKN A;  2CQO A;  2NVT B;  1Z6H A;  2O5J C;  2DUD A;  1E0B A;  1IL2 A;  1TWF B;  3K7A B;  4RKL A;  3HOY H;  4FVM A;  1YZ6 A;  3HRZ C;  3K0Y A;  3R8B A;  4JV5 Q;  4IPC A;  1FGB D;  4L63 B;  5GQO A;  2BE5 D;  2MPM A;  2N55 A;  4C3I G;  4B3T L;  1LUZ A;  3CMA A;  4BBS G;  2HIV A;  2MGS A;  1UNS A;  4ABN A;  5HGT A;  4YY3 Q;  3K5O A;  1R9T H;  3TRZ A;  1UE7 A;  3EJI A;  1Y1W H;  1OXT A;  2EE1 A;  5C0X H;  1YBY A;  5CV9 A;  2JK8 A;  1GKH A;  1WTV A;  3RZO H;  2R3Z A;  1X65 A;  3VYU A;  4AH6 A;  4RKB A;  4LFB L;  2I07 B;  1AW7 A;  1YNN C;  2A8V A;  1KAA A;  1LM0 A;  5E3F A;  1NR2 A;  4R4C A;  1JC7 A;  2WKC A;  3NXW A;  4L6T B;  1BCP F;  4ZKC B;  1CTM A;  1ZKO A;  5J1Z A;  1BQQ T;  4C3I H;  3NE5 B;  4DR6 Q;  3PGZ A;  3I72 A;  2OTL A;  2XSC A;  4DK6 C;  3J81 L;  1BBX C;  2VZA A;  3L9A X;  3C1F A;  4K5W A;  3AU7 A;  3LWE A;  4K0K L;  1I50 B;  3NBH B;  1CQF A;  3LGJ A;  4JC0 A;  1KLG D;  1R9T B;  1YIJ A;  1OXS C;  1VQN A;  2PNH A;  2D0P A;  5DAU A;  4F7X A;  3S2H B;  1XJV A;  1EY0 A;  2B29 A;  3RZD H;  5EGT A;  5M5W H;  1NUC A;  2K04 A;  2OCE A;  1PVO A;  1EIG A;  4DUZ L;  1VQP A;  5IT9 E;  4JI6 L;  1VS0 A;  1E24 A;  2SDF A;  1JT8 A;  3B6Y A;  1SNC A;  1ROD A;  3ND9 A;  1YHB A;  4K6D A;  4M8A A;  4JYA Q;  1LT3 D;  3PF4 A;  2R7F A;  1D1K A;  4LF6 Q;  3T4A C;  3S1Q B;  4KTA A;  1YVC A;  2A19 A;  4OX9 L;  2UXB L;  4X66 Q;  4IO9 A;  4DUY Q;  2F0V A;  3GO5 A;  2K75 A;  4X6A H;  1PMR A;  3IRB A;  1JOK A;  5AFW A;  1D1I A;  4HED A;  1XYI A;  3STB D;  4GLA C;  4R4Q A;  1NBW A;  4K0K Q;  1HZA A;  3KF8 A;  4DAV A;  3FPU B;  1IW7 D;  2OT2 A;  5L37 A;  5LL6 S;  3SK4 A;  5C44 G;  3FP9 A;  4I7Z C;  1X3E A;  2PMZ E;  4YHH Q;  4XYQ A;  1OXU A;  4WRD A;  4DU9 A;  1KD1 C;  4A3C G;  5M5W B;  2K28 A;  4A93 G;  4JI2 L;  2EYM A;  1VQO A;  2E2H H;  4ZRZ A;  5IYC G;  3Q24 A;  5GRO A;  5H1S E;  5HGQ A;  1MBY A;  4IJL A;  1SNO A;  3D6C A;  3NWS A;  1SXT A;  2XRS D;  2SNS A;  2Z0S A;  3RN5 A;  4LAA A;  2PQA B;  2UXB Q;  3M3Y H;  2QF7 A;  2CCZ A;  3GP7 A;  4CKB A;  2D2C C;  1TS5 A;  4JI8 Q;  4ZKB B;  5C44 H;  4IJH A;  1MSH A;  4OEM B;  5BR8 L;  2F3I A;  2Y0S E;  3M85 A;  5IWA L;  3OPO A;  3MXG A;  4A3C H;  1FYC A;  1Y14 B;  4A93 H;  3R3O A;  2HDL A;  4LF4 Q;  1BOS A;  3GTL H;  3GTM H;  4HIM A;  2NVX H;  2B2W A;  2ZTC A;  5CV6 A;  1Q8K A;  4JI2 Q;  2R7Z B;  3VR6 A;  4KY7 A;  3HOZ G;  5AJ3 Q;  3U9S A;  4XXE A;  1XNQ L;  3M7N A;  1EWH A;  4KMU C;  3M7G A;  5CMD A;  4XQJ A;  1SEB D;  1HNX Q;  1EEI D;  4R1J A;  1KC8 C;  4R8N A;  3JAM c;  4C1N I;  2VB2 X;  5K5P A;  4A3B B;  1PH9 A;  1V9P A;  3BYT B;  4OXP A;  3ITP A;  4V0B A;  1HUN A;  1EUJ A;  4A3K G;  1LTS D;  3RLN A;  4NXN L;  1OO9 B;  4DV3 L;  4ZK9 B;  4KD3 A;  4DV5 L;  4LWC A;  1ICW A;  2OEO A;  4XT3 B;  1SYD A;  1QIL A;  4KJO A;  3HOZ H;  1DXM A;  2RDH A;  1FL0 A;  3CCU A;  5EPJ A;  4DV0 L;  2A1A A;  3GTL B;  3GTM B;  3CPF A;  4OO1 I;  2HQL A;  4POF A;  4P73 A;  3GD7 A;  2NVQ B;  2RCF A;  4WFN 3;  3S17 H;  1STG A;  1I4Q A;  4CKC A;  1JCK B;  1YHQ A;  4K5X A;  3I91 A;  4OO1 G;  3N52 A;  2GVA A;  4A3K H;  3RLF A;  4LNQ A;  3G48 A;  3NQI A;  2IWH A;  1GUN A;  3NTK A;  5KND A;  4A3F B;  4FF1 A;  1CZG A;  3CCR A;  4OHJ A;  3I4M B;  2A73 B;  3D3R A;  4JI1 Q;  3S2D H;  1VQH A;  4KKS A;  1VDZ A;  2ZTE A;  4GS3 A;  4P2C B;  1H9R A;  2E8G A;  3PIP A;  3PCO B;  1X54 A;  3HOZ B;  2YTY A;  3FKI G;  4DV0 Q;  2HHH Q;  1HCZ A;  1S4Z A;  2Q2H A;  4X65 Q;  2PZW A;  1PH8 A;  4OO1 H;  1Q1E A;  3W1G A;  1WD0 A;  1KNA A;  3J81 E;  5F2D A;  3W2D A;  1JWU D;  4YWK A;  3S17 B;  1UE6 A;  2HUG A;  1L0W A;  1VQ5 A;  3U58 A;  4R8I A;  2LFN A;  4K14 A;  2PMZ B;  4A3K B;  1YNJ D;  1NMG A;  2F0S A;  1KXL A;  1Q3L A;  2L1B A;  2RSN A;  2ZXP A;  1WTR A;  4ZLT F;  4IN3 A;  4S3S A;  4XDX A;  4A3M G;  1KIX A;  3AMU A;  5COY A;  1V8Q A;  4DKA C;  3ERS X;  4IUQ A;  5EKI A;  3H15 A;  1G91 A;  1X55 A;  1LYL A;  1AE3 A;  4NB3 A;  1TR5 A;  2N3S A;  3G7L A;  1TS2 A;  3FKI H;  4BY1 G;  3S2D B;  4RGM A;  4GOP A;  1PTO C;  1GVP A;  1KTK A;  4AQY L;  1N32 L;  1PTO B;  5HY6 A;  1HJP A;  1PFM A;  1PRT C;  1IYV A;  3I4O A;  3DMU A;  1PRT B;  2K32 A;  1GO3 E;  2IHE A;  1UUP A;  3KF8 B;  1Y8P B;  2A6H D;  1UE1 A;  1S3O A;  2K5Q A;  2VW9 A;  4G4K A;  3BJU A;  4IFD G;  3J7A 5;  4CBV A;  3MXU A;  2C9O A;  2LKV A;  4EQO A;  1IYJ B;  1K3B C;  2VS1 A;  4QIW E;  5M5X H;  2M2L A;  1EU3 A;  4ALP A;  4A3M H;  3CPW A;  3GTP H;  4DV6 L;  1EY7 A;  2NVY B;  3D6W A;  4NPS A;  4RCN A;  2OQK A;  1SRO A;  2XWB B;  1F9S A;  4FF2 A;  3Q6S A;  4BY1 H;  2PQE A;  3M4O H;  5T1I A;  5E1F A;  4KK7 A;  2TMP A;  3I4L A;  1AFP A;  1LO5 D;  2EDG A;  3DXJ C;  4X3K A;  1O78 A;  3H6M A;  1E2Z A;  1R4Q B;  4PMW A;  1CKO A;  4C3H B;  3S1M H;  1VQ8 A;  2SNM A;  4IFD H;  1VQ9 A;  1DD2 A;  1B1Z A;  5IP9 G;  3GV3 A;  2BDN A;  4B9X A;  3TP5 A;  1QNU A;  1UWV A;  1QUQ A;  3SEB A;  4A4I A;  2B2W C;  5LMN L;  2LSS A;  1BVS A;  1WYD A;  1Y1V B;  5HUR A;  4V19 0;  1I4R A;  1VQG A;  1LT5 D;  4A3M B;  3GTP B;  1AP0 A;  2XVS A;  1EYA A;  3S16 H;  1EOV A;  3HKS A;  2AKW B;  4B3M L;  4OON A;  4RWS C;  3VYS A;  4IZ8 A;  4KV6 A;  3I8Z A;  3NEN A;  3QG1 A;  5C4X B;  4QF4 A;  3UDG A;  3R93 A;  1O80 A;  3M4O B;  3KK7 A;  1HR0 L; 
#chains in the Genus database with same CATH homology
 3KJP A;  1FVI A;  3H0G H;  4P75 A;  3HOX G;  4DV4 Q;  4DV5 Q;  1GM5 A;  4HID A;  3E9I A;  5FLM H;  1HNZ L;  2UUB Q;  1OTC A;  1WI5 A;  3F1Z A;  4B3S Q;  3I4N G;  3CP0 A;  3S1N H;  2LXJ A;  4PZ8 A;  2F52 A;  1NY4 A;  5IP9 H;  1PFS A;  1FJG Q;  2JQO A;  3PF5 A;  2ES2 A;  2AMC B;  4OWX B;  4Y52 H;  1Q1B A;  2RHQ B;  2Q2I A;  3T1H L;  3J81 i;  1Q7Y C;  1IBK Q;  4JI8 L;  1VQE A;  4GKJ L;  4A3B G;  1YJN A;  4JV5 L;  4JBJ A;  3J80 c;  2QA4 A;  3E9H A;  3HOY G;  2CWA A;  2DGY A;  2I5L X;  2UUC L;  3RR5 A;  1EFW A;  1A8V A;  4IPH A;  3UDX A;  1G51 A;  4UY8 C;  3K0X A;  4P71 A;  2EIF A;  2I5H A;  4PZ6 A;  1EWI A;  1TWH H;  3I2Z A;  4JBW A;  4LFA Q;  1UE5 A;  4YY3 L;  3J81 c;  1K9M C;  1JJ2 A;  1T9H A;  5LMN Q;  2HT1 A;  1G6P A;  3PSI A;  2GVB A;  4IPD A;  4DV7 Q;  1HH2 P;  4LF4 L;  4YWM A;  3OW2 A;  1I94 Q;  3ICE A;  5IY0 A;  2VQF Q;  3PUV A;  3T1Y Q;  2R7Z H;  1N34 Q;  1VQ4 A;  1Y1W G;  4KLK A;  5C0X G;  3H3V H;  2F4V L;  5C3E H;  4DR3 Q;  4BY7 G;  1CSP A;  2GN5 A;  4BA1 I;  5AJ3 L;  3HOX H;  5IP7 G;  1IXR A;  5IE8 A;  3I4N H;  3CW2 C;  1AH9 A;  4Y7N H;  4LF7 L;  2UXC Q;  1L1O A;  4X62 Q;  1TWC H;  3BU2 A;  4H02 A;  2MNA A;  2R92 G;  1XPU A;  2CQO A;  2B63 G;  1HNX L;  1GD7 A;  2DUD A;  1SLJ A;  4AYB E;  1HR0 L;  4GLV B;  4A3B H;  1JE5 A;  4QY7 A;  4AIM A;  1EIY B;  1IL2 A;  4A3I H;  4YCW A;  3HOY H;  3S15 H;  1XPR A;  1YZ6 A;  4UP9 A;  1KQS A;  5M5Y H;  1XMO L;  4C3J H;  1SRU A;  1C7Y A;  5JJI A;  3GTG H;  3I56 A;  4GKJ Q;  3ZJY C;  4JV5 Q;  4JI7 L;  2UUA L;  4OX9 L;  2WAQ G;  2CWP A;  2K52 A;  4IPC A;  3L2P A;  3GTQ H;  3M4P A;  1BBU A;  5GQO A;  2ID0 A;  2JJQ A;  4APV A;  4HJ5 A;  4B3T L;  4DR7 L;  4P72 A;  1LUZ A;  3CMA A;  4BBS G;  2HIV A;  4A3F G;  3TRZ A;  1R9T H;  4YY3 Q;  1X3G A;  2I5M X;  3EBE A;  3J81 j;  1UE7 A;  3I4M G;  1IBM L;  3AYH B;  1Y1W H;  1OXT A;  1YBY A;  2JK8 A;  1GKH A;  3RZO H;  4BY7 H;  3EIV A;  3U4Z A;  1X65 A;  1LTL A;  1M90 C;  1VQD A;  4AH6 A;  3OYY A;  5IP7 H;  2CFM A;  4POG A;  2FXQ A;  1Q46 A;  4LFB L;  2NVQ H;  2F4V Q;  2E5L Q;  4TVA B;  5FLX c;  1J5E Q;  2JEB I;  4JI4 L;  3CC4 A;  3PUY A;  2A8V A;  1CKM A;  2E2J H;  5C4J H;  2R92 H;  1LM0 A;  2KBN A;  2B63 H;  3E0E A;  4R4C A;  1OXX K;  2KHJ A;  3KFU A;  4YWL A;  3HOU G;  3S14 H;  1S40 A;  2UXD L;  3A5U A;  4J15 A;  5FJ8 G;  4AQY Q;  4A3D G;  3W1B A;  2Q2U A;  1N32 Q;  1J6Q A;  1IBL Q;  4FDB A;  2RHS B;  4C3I H;  1C9O A;  4IPG A;  1XMQ Q;  4GLX A;  4DR6 Q;  3PGZ A;  2MO1 A;  2YV5 A;  4A3F H;  2OTL A;  5JEA G;  1RL2 A;  3ULP A;  4DK6 C;  5EAY A;  2UUA Q;  2VZA A;  3I4M H;  4JI5 L;  2ZJP A;  4GOP C;  5E7N A;  4K0K L;  2IT1 A;  1VQK A;  4GOP B;  2L15 A;  3NBH B;  1VQA A;  3LGJ A;  4JC0 A;  4JI1 L;  3ULJ A;  3GTJ H;  1YIJ A;  1OXS C;  1VQN A;  1IBM Q;  2LXK A;  2PNH A;  3STB C;  2D0P A;  2WAQ E;  3KDF B;  1XJV A;  3PUW A;  1PA6 A;  2B29 A;  3RZD H;  4IFD J;  1SN8 A;  1NMF A;  4PZ7 A;  5M5W H;  5IYD G;  4DV6 Q;  2HHH L;  3HOV G;  3NEL A;  4X64 L;  4JI0 L;  2QGQ A;  4NXM L;  2OCE A;  1PVO A;  4X65 L;  4A3E G;  1YI2 A;  4DUZ L;  1VQP A;  1AE2 A;  1SMX A;  2IHF A;  2JA8 G;  4JCV E;  3HOU H;  3AFQ A;  4JI6 L;  1S72 A;  2XTI A;  3TS0 A;  1VS0 A;  3OTO Q;  1QVF A;  1E24 A;  5DLQ E;  5IT9 c;  1JT8 A;  2KCM A;  3B6Y A;  4DR5 Q;  5FJ8 H;  1EQQ A;  1PH4 A;  4A3D H;  1JJG A;  5JJL A;  2WP8 J;  2VUM G;  1YHB A;  4JYA Q;  1MJC A;  3SGI A;  3PF4 A;  3J80 i;  2R7F A;  4LF6 Q;  1XPO A;  1YVC A;  2A19 A;  3KLW A;  1CUK A;  2Y0S G;  4DNI A;  4X66 Q;  4IO9 A;  4DUY Q;  1Q81 C;  1TWG H;  2YTV A;  3GO5 A;  1PH6 A;  2K75 A;  4X6A H;  3KJO A;  4GNX C;  1N33 Q;  3IRB A;  1K3R A;  3HKZ G;  1W3S A;  4GNX B;  4DR2 Q;  3STB D;  4GLA C;  3F2D A;  2JE6 I;  1K73 C;  1D8L A;  4R4Q A;  1YJ9 A;  1NBW A;  1B8A A;  3RLO A;  4OWT B;  4K0K Q;  1HZA A;  4GN3 B;  5ELO A;  4C2M H;  2JA9 A;  1N36 Q;  2BA1 A;  3U4V A;  2ZM6 L;  3UDF A;  1PYS B;  5IYD H;  3CC7 A;  5C44 G;  3FP9 A;  3HOV H;  2K50 A;  3CCQ A;  1X3E A;  2PMZ E;  4YHH Q;  2VQE L;  1KL9 A;  4A3E H;  5J3B A;  4L5S A;  2E2I H;  2JA8 H;  1OXU A;  1G29 1;  1YEZ A;  4DAY B;  1U5K A;  1KD1 C;  4A3C G;  4B3R Q;  3CCS A;  3PUZ A;  2CKZ B;  4A93 G;  1M1K C;  3CF5 A;  2K5N A;  4JI2 L;  3KF6 B;  1QUQ B;  2RF4 A;  4B3M Q;  2VUM H;  1VQO A;  4A76 A;  2E2H H;  5IYC G;  2C35 B;  5GRO A;  1Q86 C;  1JB7 A;  4GKK L;  5H1S E;  5HGQ A;  2YU9 H;  1P16 A;  4IJL A;  3RNU A;  4DR4 L;  3TQY A;  5GAD C;  1HR0 Q;  1WOC A;  1QZG A;  4JI3 L;  1HNZ Q;  4A3L G;  4LF5 L;  2Z0S A;  2JA5 G;  1TWA H;  4JBK A;  3RN5 A;  5IYB G;  1PHJ A;  2BH2 A;  3PO2 G;  2PQA B;  2NVY H;  2UXB Q;  3ER0 A;  4OWW B;  3M3Y H;  1Y1V G;  2IY5 B;  3T1H Q;  4ME3 A;  4YCU A;  1EQR A;  3TEH B;  2CCZ A;  4JI8 Q;  2MFI A;  2N78 A;  5C44 H;  3L7Z C;  4UP7 A;  3DLL A;  4UPA A;  4IJH A;  2UUC Q;  5BR8 L;  2F3I A;  2Y0S E;  3M85 A;  1H95 A;  5IWA L;  2ZM6 Q;  2OQ0 A;  3HKZ E;  3PO3 G;  5C4X G;  4A3C H;  1Y14 B;  3K7U C;  4A93 H;  1HZC A;  2D0O A;  2VQE Q;  1A63 A;  3PUX A;  1Z9F A;  4C3H H;  3FHW A;  4LF4 Q;  2K5H A;  3HOW G;  3GTL H;  4IFD I;  3GTM H;  4HIM A;  2NVX H;  4JOI A;  1NTG A;  1NE3 A;  2ZTC A;  1N9W A;  1Q8K A;  1JJC B;  4JI2 Q;  4DR1 L;  2OWO A;  3HOZ G;  2MQH A;  1XNR L;  4A3J G;  2AHO B;  2KCT A;  5AJ3 Q;  4DAM A;  4A3L H;  2Z6K A;  2NZH A;  1JMC A;  1X6O A;  2V1C C;  5IYB H;  1XNQ L;  3M7N A;  1RIP A;  1PYB A;  4DR4 Q;  3A0J A;  1VQM A;  5C0X J;  4LF7 Q;  2D62 A;  3BZC A;  4LF9 L;  2R7D A;  1BBW A;  1U0L A;  1Z47 A;  1HZ9 A;  2UU9 L;  1Y1V H;  4QGU A;  3A74 A;  4HJA A;  4LF5 Q;  4LF8 L;  1A62 A;  1WCM G;  3UE1 A;  1QVG A;  1HNX Q;  1VQC A;  4R1J A;  1KC8 C;  3HFZ B;  3U50 C;  3JAM c;  1PH1 A;  3CC2 A;  2WB1 G;  1PH9 A;  1V9P A;  4IOA A;  4DV1 L;  4LUO A;  4QJF A;  4OXP A;  5ELN A;  3KOJ A;  1XMO Q;  1E22 A;  1XTD A;  1L1O C;  5GAE C;  4BBS H;  1KAW A;  2BA0 A;  4JI7 Q;  1L1O B;  1EUJ A;  4A3K G;  2JA6 G;  2XGT A;  5C4X H;  4DK3 C;  3PO3 H;  3AFP A;  4O0A A;  3CQZ H;  4NXN L;  3RLN A;  4DR7 Q;  4B3T Q;  1B70 B;  4DV3 L;  3TRE A;  4EQ5 A;  4DV4 L;  4DV5 L;  3HOW H;  1E3P A;  4TQU S;  4LWC A;  2UUB L;  2N49 A;  4B3S L;  1ASZ A;  1W2B A;  2JA7 G;  4LW1 A;  1FJG L;  1VQJ A;  3HOZ H;  4A3J H;  3Q8D A;  1FL0 A;  3CCM A;  3CCU A;  4DV0 L;  2A1A A;  3K81 C;  4R4O A;  1Q82 C;  5K36 G;  3CPF A;  4OO1 I;  4LFB Q;  2HQL A;  1KRT A;  4POF A;  4P73 A;  5GAG C;  3GD7 A;  1MJE A;  1XNR Q;  4JI4 Q;  4LUV A;  4HJ7 A;  4PG3 A;  2PI2 A;  3S17 H;  2QEX A;  1WCM H;  3I55 A;  3I7F A;  1E1O A;  1YHQ A;  3CCL A;  1KRS A;  4LFA L;  1HNW L;  1QVC A;  1CKN B;  1DGS A;  4OO1 G;  1TXY A;  2UXD Q;  3M9B A;  3ULL A;  4MNO A;  4EX5 A;  2IX0 A;  4WJ4 A;  2GVA A;  4DV7 L;  2UXB L;  1K83 H;  1I94 L;  4A3K H;  2JA6 H;  2VQF L;  3RLF A;  1N8R C;  2JEA I;  3H3V I;  4LNQ A;  4DV1 Q;  3K80 C;  1N34 L;  2KEN A;  3G48 A;  1D7Q A;  4R4T A;  2I0Q A;  2AWO A;  1PV4 A;  1I5F A;  4RMF A;  2AWN A;  4HJ9 A;  3S24 A;  3CCR A;  4JI5 Q;  4QQB X;  1QZH A;  2HIX A;  2WB1 E;  3J7Z C;  2VY3 A;  3CXC A;  5C3E G;  3CCE A;  4DV2 L;  2JA7 H;  4X62 L;  2Q2T A;  4JI1 Q;  3G6E A;  3S2D H;  3M4Q A;  1VQH A;  5JEA J;  1K0R A;  4P74 A;  2ZTE A;  1WJJ A;  1YNX A;  4GS3 A;  5M3M G;  1TWF H;  1VQF A;  2E8G A;  2PI2 E;  3F8T A;  3K7A H;  4YCV A;  3PIP A;  2R6G A;  2YYZ A;  3PCO B;  1X54 A;  4XTC S;  2ATW A;  4A3G G;  1HNW Q;  2OTJ A;  3DM3 A;  2YTY A;  4BA2 I;  3FKI G;  4DV0 Q;  2HHH Q;  3KYH C;  4X64 Q;  4KI0 A;  4JI0 Q;  1MIU A;  2Q2H A;  4NXM Q;  1WFQ A;  3MEF A;  4X65 Q;  4DUZ Q;  2ASB A;  1PH8 A;  2VNU D;  1Q1E A;  4XIG S;  2EXD A;  3W1G A;  4A3I G;  4JI6 Q;  1I3Q H;  4DPG A;  1SFO H;  1VQ6 A;  2ZTD A;  4YWK A;  1UE6 A;  1MKH A;  4L5R C;  3W5O A;  2BH8 A;  5C0X I;  1L0W A;  2KHI A;  1KHI A;  4O2D A;  1VQ5 A;  3F2C A;  3U58 A;  4OX9 Q;  3K8A A;  1PH7 A;  1VQL A;  1L2F A;  1NMG A;  1IZ6 A;  3GTO H;  1NJI C;  1PH3 A;  1KXL A;  2IX1 A;  2E5L L;  1J5E L;  1KIX A;  1UEB A;  4A3M G;  3CCV A;  4DKA C;  5GAH C;  3ERS X;  5M3M H;  3H15 A;  1VQI A;  4HIO A;  1X55 A;  1LYL A;  1AE3 A;  4NB3 A;  4DV2 Q;  1E7Z A;  2N3S A;  1YJW A;  4KHZ A;  4A3G H;  5LMU L;  3D0F A;  4MZ9 A;  4QL5 A;  3FKI H;  4BY1 G;  1X9N A;  2R93 G;  4IOC A;  4GOP A;  1GVP A;  4AQY L;  1V1Q A;  1N32 L;  5HY6 A;  3S1R H;  1IBL L;  4L5Q A;  3BZK A;  1HJP A;  4MTN A;  1ASY A;  5IYC H;  3I4O A;  3PV0 A;  4RG1 A;  3VDY A;  4LFC L;  1GO3 E;  2IHE A;  4HJ8 A;  3KDF A;  1XMQ L;  4DR6 L;  4BXX G;  3PIO A;  3KF8 B;  1OXV A;  1X3F A;  1UE1 A;  1S3O A;  1YHA A;  2VW9 A;  1I50 H;  1FGU A;  3JAM i;  2JA5 H;  1EIF A;  3BJU A;  1B7Y B;  3CME A;  4JBM A;  5M3F G;  4GKK Q;  4LUZ A;  3PO2 H;  1PH5 A;  3J7A 5;  1P8L A;  2ALY B;  3AQQ A;  3L0O A;  4IFD G;  3UDI A;  4JI3 Q;  3S2H H;  1IYJ B;  4QIW E;  2VS1 A;  5M5X H;  4ALP A;  2ZJQ A;  1CKN A;  2K14 A;  3MXN B;  3CPW A;  4A3M H;  3GTP H;  4DV6 L;  1EYG A;  4NPS A;  4HIK A;  2OQK A;  1SRO A;  1C0A A;  4KHP L;  2WFW A;  1PH2 A;  1E1T A;  2VL6 A;  3EN2 A;  1YIT A;  1X56 A;  4A75 A;  3OTO L;  2K4K A;  4BY1 H;  2MO0 A;  2NN6 I;  3RN2 A;  2R93 H;  5BR8 Q;  4DR5 L;  3M4O H;  2YTX A;  4GNX A;  1K8G A;  3TS2 A;  5IWA Q;  2EQS A;  4JYA L;  5LMU Q;  3UE0 A;  2K5V A;  3S1Q H;  4BBR G;  2N8N A;  4LF6 L;  4BXX H;  2RCN A;  2NN6 G;  4X66 L;  4R4I A;  4DUY L;  4PMW A;  3H0G G;  1CKO A;  1O7I A;  3G4S A;  3CD6 A;  3S1M H;  5FLM G;  4LFC Q;  1VQ8 A;  1VQ7 A;  1N33 L;  5M3F H;  2NZO A;  1VQ9 A;  4DR2 L;  1IBK L;  4DR1 Q;  4WJ3 M;  1VQB A;  5IP9 G;  2H5X A;  1CSQ A;  3A5Z B;  1UWV A;  1QUQ A;  3KF6 A;  1N36 L;  1XNQ Q;  1Q12 A;  4UP8 A;  4GN5 A;  3G71 A;  4A4I A;  4LF9 Q;  4JOI C;  2UU9 Q;  5LMN W;  5LMN L;  2LSS A;  4LF8 Q;  1BVS A;  1WYD A;  4GN4 B;  4YHH L;  1VCI A;  1SR3 A;  3WWV A;  3GTK H;  1VQG A;  5JJK A;  1K8A C;  3NEM A;  3F2B A;  2Z6K C;  3D31 A;  3T1Y L;  4B3R L;  4JG2 A;  4L5T A;  3AEV A;  3S16 H;  4KHP Q;  1EOV A;  2PQA A;  3JC6 6;  3HKS A;  4DR3 L;  2AKW B;  1SE8 A;  2B3G A;  1BKB A;  4B3M L;  4OON A;  2ZJR A;  4AYB G;  3CCJ A;  1HZB A;  1I6H H;  1V43 A;  3CAM A;  1A0I A;  2NVT H;  3NEN A;  3GDE A;  4BBR H;  2R7Z G;  4NXN Q;  3UDG A;  2UXC L;  1HR0 W;  4DV3 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...