1GD7A

Crystal structure of a bifunctional protein (csaa) with export-related chaperone and trna-binding activities.
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
109
structure length
109
Chain Sequence
b'MTPLEAFQILDLRVGRVLRAEPHEKARKPSYKLWVDLGPLGVKQSSAQITELYRPEDLVGRLVVCAVNLGAKRVAGFLSEVLVLGVPDEAGRVVLLAPDREVPLGGKVF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CSAA PROTEIN
publication title The crystal structure of the ttCsaA protein: an export-related chaperone from Thermus thermophilus.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Rna binding protein
total genus 22
structure length 109
sequence length 109
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01588 tRNA_bind Putative tRNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1gd7A00
2DUDA 1HZAA 1D7QA 1A0IA 4GLAC 4DPGA 3NBHB 5GAGC 3OTOQ 3PUWA 1PH2A 3J81i 1GKHA 2JA9A 4LF5L 1Q1EA 1QUQB 1IBLQ 4AYBG 3S2DH 4OWTB 3W1BA 2IX0A 1XMOQ 1K8AC 4JBWA 4A3JG 1YEZA 4UY8C 4UPAA 1TXYA 2VY3A 5HY6A 1YITA 4A3KH 4A3EH 3I2ZA 4HJAA 4NXML 4POFA 4DNIA 4DV2Q 4B3TL 1QVFA 2Z6KC 3M3YH 4LFBL 1YVCA 4LUVA 4YY3L 4DR2Q 1I5FA 3M85A 4HJ7A 3HOZG 2DGYA 1Q8KA 1CUKA 4B3RQ 4JOIC 2NZOA 4DUYL 5LMNW 3I7FA 4LUOA 1TWCH 2R7FA 2R7ZH 1AE3A 1NMGA 1E7ZA 1RIPA 4LWCA 3RN5A 1SR3A 4BY1H 2AWOA 1Q82C 2NVYH 1WJJA 4GNXC 2XGTA 3D0FA 1QZGA 4B3ML 2B63G 4KI0A 3F2DA 3MEFA 1M1KC 1TWGH 2WAQE 1X55A 1N9WA 3KFUA 3PUXA 3T1YL 4ME3A 5IYCH 2PQAB 4EQ5A 2JJQA 3E0EA 4O2DA 2UXCL 2VS1A 4JG2A 4DKAC 4Y7NH 1IBMQ 4A3LH 3A74A 1VQGA 2QA4A 4X65Q 3CXCA 1K3RA 4XIGS 5C0XI 4P71A 4HJ5A 2MNAA 3RN2A 1TWFH 1U5KA 2UU9L 2A8VA 4LF5Q 3CCMA 4BBRG 1SRUA 1VQ6A 2R92G 4DV6L 4A3BG 3H15A 2VQFL 1K0RA 4MZ9A 4NB3A 3RNUA 1MJCA 1BKBA 4HJ8A 4DR6Q 3GO5A 1IXRA 4NXMQ 1PH9A 3CPWA 4KHPL 4DAYB 4C2MH 1PYBA 4LFBQ 1L1OA 5GROA 4GOPC 1VQKA 3I4NG 3HOUG 4K0KL 4DV1L 2ALYB 5C4XH 5M5YH 2QEXA 3RLFA 4DV3L 4AIMA 3D31A 1HR0L 4X6AH 1HNXL 5C3EG 4DUYQ 2BH8A 4P74A 2H5XA 4A3MG 3PO3H 3RZDH 4UP8A 4UP9A 3TREA 2ZJPA 4DUZL 2HQLA 1RL2A 3LGJA 3JC66 2A1AA 3F1ZA 3CQZH 4KHZA 1WFQA 2K5NA 3PSIA 5BR8Q 4B3MQ 4GNXB 1CKNA 4LF9Q 4EX5A 5M3MG 3KF6B 3T1HL 3U58A 2Q2TA 4JI4L 2E2IH 2K52A 3A0JA 4PMWA 1X56A 3GTJH 1Q81C 3I56A 3CCUA 3EN2A 1T9HA 4RG1A 3U4VA 1X3FA 3H0GH 4A3IH 1KQSA 4YCUA 1XNQL 5IP7H 1TWAH 1X6OA 2R6GA 5JJIA 2UU9Q 1EOVA 2EQSA 3S24A 2L15A 1YI2A 4A3JH 2B3GA 4LF4Q 2LXJA 2F3IA 4YHHL 3K7AH 1OXSC 2UUBL 5LMUQ 4IPDA 3AEVA 2I5HA 3AFQA 1JJGA 1JMCA 4JI2Q 2NVXH 2PMZE 1P8LA 1FL0A 2JA7H 1UWVA 4P72A 1MKHA 1UE5A 4JI0L 4GOPB 3GTKH 3RZOH 3S1NH 1B70B 4LFCL 1EQRA 4DV3Q 3IRBA 1OTCA 1QUQA 1Q12A 4DR4Q 3BJUA 4TVAB 5FJ8H 3J81c 2EIFA 1OXUA 4DR3L 1BBUA 2JA6G 1IL2A 1HH2P 1QVCA 1D8LA 4X66Q 4GKKL 2JA8G 1BVSA 1HZCA 2E8GA 2PI2A 3CD6A 3KYHC 5K36G 3M4PA 3S14H 5FLXc 4JC0A 3CCVA 2JA5G 4FDBA 1LUZA 1VQHA 2YTVA 1Y1WH 1JJ2A 1N33Q 2VUMH 3GTMH 3A5UA 1LYLA 2E5LL 2UUAQ 2HHHL 5JEAJ 4DV4Q 3PCOB 2K4KA 4DV0Q 2Q2HA 1XNRQ 2CQOA 2E2JH 4YWLA 1XPOA 4OWWB 4LW1A 2D0OA 4Y52H 1MJEA 2F4VL 1HNZL 2PQAA 1JJCB 1G6PA 5GQOA 1WCMG 3M4QA 2R93G 2KHJA 4R4TA 4LF6L 5M5XH 1XMQL 5E7NA 3RLOA 2I0QA 4JYAL 2WB1G 3RR5A 1S40A 3HOUH 1E3PA 3UE0A 5IY0A 5FLMH 4L5SA 4LFAL 1X3EA 3PF4A 5IWAQ 2BH2A 3S1QH 1NY4A 3CAMA 2JK8A 3TEHB 3CCEA 2UXDL 4A3MH 1SROA 5IYBH 1C7YA 1EUJA 3PO2G 4HJ9A 4KLKA 1YHBA 2KCTA 4JBKA 1E1TA 4X64Q 1VQNA 4IJLA 4GN4B 2Y0SG 3A5ZB 1N32L 2YTYA 1W2BA 3HOVG 4JI3L 4QQBX 4QL5A 1HNWQ 1Y1VH 4PZ6A 2VQEL 3ULJA 2Z6KA 4IPHA 4JI6Q 4BXXH 4OWXB 3PV0A 1I6HH 4AYBE 1JE5A 2UUCL 4JOIA 3U4ZA 3AFPA 3CF5A 3TS0A 4A3DG 1A8VA 3L0OA 5ELOA 4HIMA 4XTCS 1PH1A 1VQDA 2I5MX 2LXKA 5GAHC 4A3CG 4GNXA 4A3GG 3KF6A 1HR0W 1OXTA 4A3FH 3M9BA 1UE6A 5IP9G 1VQMA 4BA2I 1HJPA 1J5EQ 2MO0A 2QGQA 1PH4A 3ULLA 2HT1A 1SLJA 3PIPA 4HIDA 1N34Q 4JV5L 1JB7A 2CKZB 2IX1A 2Z0SA 1A63A 3NEMA 4X62L 2UXBL 4LFAQ 4IJHA 3FKIG 1S72A 1NE3A 2IY5B 4JI1L 4IFDJ 4BBSG 3J80i 4NXNL 4DR7L 4BY7G 4R4IA 2N78A 2GVAA 4IPCA 4JI5L 3I4OA 5C44H 3UDGA 4LF7L 1X3GA 5AJ3L 3I4MG 2OTJA 1NBWA 3EBEA 4B3TQ 3ULPA 2JA8H 1MIUA 4LF8L 4YY3Q 4JI3Q 3K0XA 3GTPH 4GKJL 2ZM6L 3PGZA 4C3HH 3OYYA 3BZCA 3HKZG 3K81C 4BA1I 5C4JH 4GOPA 4A93H 5JJLA 3HOWG 1AH9A 1FGUA 2GVBA 4AQYL 3PIOA 2UUCQ 1CKOA 2OTLA 4APVA 1GM5A 3GTGH 4P75A 2OCEA 4A76A 1VQIA 4YWKA 3K7UC 1HZ9A 2CCZA 3HOXG 3T1YQ 4NPSA 5GADC 3HOYH 2N8NA 4GS3A 1WCMH 4B3SL 2UXCQ 3DM3A 3CC7A 2ZTCA 1VQEA 4YWMA 1XTDA 1L2FA 2BA0A 1GVPA 4JI7L 2B29A 1JT8A 3L2PA 4DV6Q 4A3KG 2YV5A 1IYJB 4A3EG 1E24A 2VQFQ 4JI1Q 1U0LA 1Q7YC 4AH6A 3SGIA 3F2BA 2AHOB 3BU2A 1C9OA 2D62A 4JBJA 5AJ3Q 3E9IA 1YJWA 1B7YB 1KRSA 4KHPQ 1XPRA 1I3QH 3G6EA 2NVTH 4K0KQ 4DR5L 3BZKA 4GKJQ 2HIVA 3KDFA 1O7IA 1V1QA 2ID0A 2ZM6Q 1K83H 4JI8L 1E1OA 4DV1Q 1HR0Q 2R7ZG 4DR1L 3S17H 4BY1G 4OX9L 1HNXQ 3AQQA 1VQCA 1AE2A 1H95A 4DUZQ 4MTNA 1Q46A 5C0XJ 1N36L 2K14A 4DV7L 2WFWA 1QZHA 2B63H 1WOCA 4IOAA 1VQPA 1PH3A 1EQQA 3GTOH 5ELNA 5IYCG 1FJGL 3T1HQ 4JI4Q 1V9PA 4A4IA 3PUZA 3J7ZC 4J15A 4DK3C 4OO1G 1N8RC 1WI5A 1UE7A 1VS0A 2BA1A 3OTOL 1UEBA 4P73A 4DV5L 3CC2A 5M5WH 4B3SQ 4DAMA 5H1SE 4LUZA 4R4CA 1IBLL 5C0XG 1XNQQ 1XMOL 1V43A 2EXDA 1PH7A 3J81j 4JI7Q 5JJKA 2GN5A 4BBRH 2R92H 3CCQA 3S1RH 1X54A 3CCRA 2OWOA 4A3BH 3JAMi 1X65A 1E22A 4DV2L 2Q2IA 4YHHQ 3H3VI 4IPGA 1L0WA 4DR2L 2PNHA 1PHJA 1P16A 2UUBQ 1NMFA 1EIYB 4TQUS 2Q2UA 4L5TA 3KDFB 5C4XG 4B3RL 3I4NH 2AKWB 5JEAG 2K5HA 4QJFA 4JI0Q 3L7ZC 2V1CC 3W1GA 3PO3G 4LFCQ 3ER0A 5C3EH 3G4SA 2VL6A 4DK6C 3PF5A 2E2HH 4DR3Q 1ASZA 4OONA 4UP7A 2CFMA 2ASBA 1VQ8A 1KHIA 1SE8A 1ASYA 3J80c 4GKKQ 5M3MH 1PV4A 2JEBI 2N49A 3FP9A 3HOXH 4HIOA 2WB1E 2F52A 1IBML 3KJOA 1EFWA 2AWNA 1WYDA 3H0GG 5DLQE 3ZJYC 4X65L 4A3IG 1YBYA 3K8AA 1KL9A 5HGQA 2HIXA 4DV5Q 5IP7G 4OXPA 3TS2A 4WJ4A 3CCJA 2E5LQ 1EWIA 4L5RC 2HHHQ 3CMAA 2CWAA 3PUVA 2Y0SE 1GO3E 1VCIA 4MNOA 1YJ9A 4DR6L 3CP0A 4R1JA 2NN6G 3TRZA 2MQHA 1PFSA 2F4VQ 1HNZQ 2WAQG 4GN5A 3GDEA 3NENA 4PG3A 5IYDG 1VQAA 2JA7G 2RCNA 1S3OA 3KOJA 1CSQA 4R4OA 4LF6Q 1XMQQ 1G51A 2ZTDA 1LTLA 1W3SA 4JYAQ 1QVGA 2XTIA 3CC4A 3PUYA 2OQ0A 3DLLA 1YHQA 1EIFA 1VQJA 5FJ8G 1CSPA 2UXDQ 3U50C 2JA6H 3G48A 2N3SA 3GD7A 2IT1A 2MO1A 5BR8L 4LF9L 4LNQA 5GAEC 3Q8DA 2ZTEA 1PVOA 1N32Q 2A19A 2MFIA 3S15H 1PYSB 1Z47A 2RF4A 3TQYA 2KCMA 1YHAA 4QGUA 2VQEQ 4OO1I 2JA5H 1Y1WG 2VUMG 1DGSA 1VQFA 2K5VA 1CKMA 3FHWA 5EAYA 4GN3B 4A75A 2IHEA 4IFDG 2I5LX 1PH8A 3CCSA 2KHIA 5M3FG 1NJIC 4QIWE 5LMNL 3W5OA 4LF4L 3UE1A 1VQ7A 4IOCA 3VDYA 1YJNA 5LMUL 1L1OC 2VNUD 4C3IH 2CWPA 2ZJRA 3EIVA 2D0PA 1FVIA 5J3BA 2R7DA 4JI2L 2RHSB 3HKZE 2R93H 2KENA 1Y14B 1NTGA 1VQ9A 2IHFA 3B6YA 5FLMG 3STBC 1KC8C 4JV5Q 1X9NA 4QY7A 3CW2C 1A62A 1KD1C 4DR4L 4H02A 2K75A 1Q1BA 4X62Q 2UXBQ 3CPFA 4YCWA 5IYBG 3GTLH 1IZ6A 3MXNB 2YTXA 1GD7A 4X66L 3CCLA 1VQ5A 4NXNQ 2PI2E 1BBWA 1R9TH 3PO2H 4DR7Q 4LF7Q 4JI5Q 3JAMc 2KBNA 1C0AA 1Y1VG 1YZ6A 1K73C 3HOVH 3UDIA 3S16H 2VW9A 3CMEA 2LSSA 1VQOA 1YIJA 4LF8Q 3UDXA 4BXXG 5IT9c 1N33L 3S2HH 1I94L 3UDFA 2FXQA 2UUAL 1IBKL 4DV4L 1KXLA 3E9HA 1SN8A 4PZ7A 4AQYQ 1KIXA 4DV0L 1XNRL 4A3DH 3KF8B 2RHQB 3HKSA 1SFOH 4HIKA 1VQ4A 2NVQH 5LMNQ 4R4QA 2JQOA 3ICEA 4A3CH 3KLWA 2NN6I 4A3FG 4A3GH 1I50H 1PH5A 1Z9FA 3NELA 1VQBA 1Q86C 5IP9H 1PA6A 1L1OB 1PH6A 3M4OH 4A3LG 3S1MH 5IYDH 4RMFA 1YNXA 2JE6I 3F8TA 4GLXA 1M90C 5IWAL 2YYZA 4PZ8A 5IE8A 3OW2A 1KAWA 1XJVA 2ZJQA 4C3JH 3I55A 3FKIH 4IO9A 3RLNA 2OQKA 5C44G 4X64L 2WP8J 4O0AA 4YCVA 3J7A5 4BBSH 1CKNB 4BY7H 1HZBA 3KJPA 3I4MH 1HNWL 3HOZH 3ERSX 1LM0A 1OXVA 4GLVB 4L5QA 1K9MC 3H3VH 3STBD 2ATWA 4JI6L 3M7NA 1OXXK 3K80C 2NZHA 3HFZB 4ALPA 4A93G 4DR5Q 1I94Q 4JI8Q 1B8AA 2C35B 4DR1Q 1K8GA 4IFDI 4OX9Q 3HOWH 1IBKQ 3AYHB 3WWVA 2ES2A 2YU9H 1J6QA 3GTQH 4POGA 5M3FH 1N36Q 4JCVE 4DV7Q 2K50A 2JEAI 1TWHH 1UE1A 3F2CA 1G291 4WJ3M 1VQLA 4JBMA 1SMXA 2VZAA 3G71A 1XPUA 1EYGA 1KRTA 1FJGQ 1J5EL 3HOYG 2AMCB 1N34L
chains in the Genus database with same CATH superfamily
1D7QA 3NBHB 3J81i 4WJWA 1IBLQ 4OWTB 1XMOQ 1G91A 5KYLA 4JBWA 4ODGA 4U68A 5EKKA 1YITA 1IW7C 5FO9B 2Z6KC 4YY3L 4EQOA 5A2QL 4HJ7A 4RCOA 1Q8KA 4B3RQ 3DMUA 1TWCH 4BY1H 3AU7A 4N8X1 4QMGA 3K5LA 4GNXC 2X69A 4RGTA 1Y69U 2B63G 4K5XA 4KI0A 3F2DA 1I4XA 3T1YL 5KEEA 5C4ZA 5IGEA 2PQAB 5IYCH 3EJIA 4O2DA 2UXCL 2QCPX 4UAIA 3A74A 1JWSD 4XIGS 4HJ5A 2VB2X 4GZYC 1U5KA 3I3CA 4LF5Q 2JA6B 1SRUA 1VQ6A 1TR5A 1K0RA 4MZ9A 1BKBA 5CYUA 4DR6Q 2EYJA 3MA2B 3GO5A 4NXMQ 4C1NK 5E3FA 4LFBQ 1L1OA 4GOPC 2E75C 1I4QA 4DV1L 5M5YH 4ZKCB 4DV3L 1KNAA 1DOKA 3EVQA 5C3EG 4DUYQ 1LTSD 3RZDH 3TREA 2ZJPA 4DUZL 2KA7A 3LGJA 1IW7D 2A1AA 4FXGC 4KHZA 4B3MQ 5BR8Q 2IW3A 3ZYYX 4EX5A 5M3MG 3KF6B 4JI4L 2QILA 1JE4A 2E2IH 2RVLA 2K52A 3RMHA 1X56A 5T1GA 3CCUA 1XYIA 2L0CA 2WB1B 1UAPA 3Q22A 1X6OA 1EQVA 1SYGA 1KDAA 4PMCA 3BVGA 3S24A 3J7YW 1F9QA 4IUNA 4LAAA 4A3JH 3V96A 3M4YA 2B3GA 1A3VA 2LXJA 2F3IA 3K7AH 2UUBL 3AEVA 3S16B 1JICA 2B2TC 1O7LA 1JQYD 1T5EA 3DUZA 1P8LA 1PFMA 2PMZE 3S1NH 1UWVA 4JI0L 3IRBA 1GHKA 1QUQA 1Q12A 4DR4Q 3BJUA 4TVAB 4A3DB 2XRSD 4DR3L 1IL2A 1QVCA 1D8LA 3VYSA 2NWGA 2HUGA 3K57A 3CD6A 4IUQA 3M4PA 4KK7A 1JOQA 4JC0A 2JA5G 4HEDA 3SK8A 1VQHA 2K28A 3OWFA 3A5UA 1LO5D 1LYLA 4X3UA 2ICIA 4C3JB 3ND9A 4IQZA 3I72A 1DYQA 2HHHL 3NP8A 1JORA 3PCOB 3D4DA 2CQOA 4YWLA 3I4MB 4C3IG 2D0OA 3KBGA 3T56B 3MFGA 4Y52H 5CV6A 1JJCB 4TSSA 4F8MA 2F0IA 1G6PA 2R93G 1WTOA 3BVZA 1RDPD 4LF6L 1B3AA 4JYAL 1S40A 5FLMH 4UDUC 1X3EA 3PF4A 2F0HA 2BH2A 2F0GA 2JN4A 3CAMA 1V1PA 5CV5A 3HG9A 2M9VA 1VMCA 3E6ZX 2E76C 3J81L 4EQPA 5FLXE 1MD2D 2P5ZX 1Y1VH 1Y8OB 4IPHA 3NPPA 1KLGD 3PV0A 5HURA 1JE5A 1NR4A 3AB9A 3S2DB 2UUCL 1OO9B 1VMPA 4HIMA 3DEOA 5GAHC 5IGBA 2Z6BA 1BR9A 1U4LA 2JXMB 4A3GG 4A3CG 2TMPA 3M3YB 3X3MA 1OXTA 3M9BA 5I2XA 1U4MA 2MO0A 2QGQA 1PH4A 3ULLA 1SLJA 1N34Q 4V0BA 3N6RA 3DWAA 1A63A 2NVYB 1S72A 3WOEA 1BCPC 3OMCA 4BBSG 3H94A 4NXNL 4DF7A 4DR7L 2GVAA 4JI5L 3I4OA 3UDGA 5AJ3L 3T51B 2RQXA 1NBWA 2F3VA 4JI3Q 1EFID 3K0XA 1EOTA 4OIKA 4Y7NB 5K36H 3PGZA 4C3HH 3K81C 5C4JH 1TWFB 3HOWG 1AH9A 2QEJC 2KOLA 1Q8IA 4CJ2C 3C46A 4K8JA 1GM5A 3P7JA 2OCEA 1VQIA 2EYPA 2IX3A 1HUNA 1CI3M 3NUCA 4NPSA 1CZWA 5IIFA 4X3TA 2EE1A 1WCMH 5IGCA 1SYCA 3DM3A 3TBIB 2B2VA 4O42A 4JW0A 1DCZA 3CQZB 3L2PA 4DV6Q 3IKJA 1D1KA 2XWJB 3EFXD 3SGIA 1G6ZA 3BDCA 5CBAE 1C9OA 1TY0A 1TU2B 1I3QH 1H9JA 3SHLA 3BZKA 4GKJQ 3KDFA 1V1QA 3X3NA 1TWAB 3S17H 1BCPD 1XX8A 4BY1G 4ZQ3A 3AQQA 3URYA 2KJXA 1VQCA 2K32A 5C0XJ 1Q46A 1N36L 2QW7A 1I50B 2RCFA 5IYCG 3T1HQ 2EJGC 1BO0A 2KHSA 3S1MB 4R8NA 1K8OA 3J7ZC 2MGSA 5C3XA 1N8RC 4DV5L 1UEBA 4P73A 4B3SQ 4DAMA 4G4KA 1SBBB 4R4CA 1IBLL 1PLFA 3Q23A 1XMOL 1V43A 2EXDA 4JI7Q 4BBRH 4A3BH 2OWOA 4JK1C 4KHVA 2EYFA 4YHHQ 1I4GA 1EY7A 1PHJA 1RD9D 4B3RL 4QJFA 2SNMA 2FMMA 4LFCQ 3G4SA 1ZYRC 2FFKB 2VL6A 4CDFC 3D8GA 3PF5A 2ZT9C 1KHIA 5EJWA 1ASYA 3NWSA 1CK1A 5CMDA 1AZQA 3FP9A 2WB1E 3W2DA 3BDOA 3GP7A 1VDZA 1EFWA 3MTSA 1S5FD 5BN5A 5HGQA 3K8AA 1DOMA 5LL6S 1ICFB 3ERQA 3F2UA 2CWAA 2TSSA 1YJ9A 4DR6L 2NN6G 5I9PA 2A6HC 1HNZQ 2WAQG 2IPKD 1S3OA 4NDXA 1XMQQ 2ZTDA 5EGTA 1K0SA 1YHQA 3H91A 2PZWA 3NXWA 2F0FA 3SDZA 3MXNA 2NYZD 3GD7A 1F2ZA 2RDFA 2CHBD 1IL8A 1K28A 1PTOH 2MO1A 5BR8L 5GAEC 1AEXA 4G7ZC 4A3FB 1PYWD 1PMRA 1PVOA 2NTSA 5KGUA 1W6JA 3LNNA 4QGUA 4B9XA 1KNEA 5ELDA 3TMEA 1KDBA 1Y8NB 4KJOA 1CKMA 1SMYC 1ZYRD 3FHWA 3K6OA 5M3FG 1ET6A 1HCZA 5FKAC 2PW5A 3VYTA 1NJIC 5LMNL 3KF8A 1VQ7A 1SE4A 2SEBD 3T13A 2VNUD 1L1OC 2CWPA 2G9HD 3D6WA 1FVIA 3A8KE 5J3BA 2RHSB 1Y14B 1SYBA 5FLMG 4JV5Q 1X9NA 3CW2C 4DR4L 1PZID 4H02A 4PMBA 4F88A 1JOOA 1C48A 3CPFA 3GTLH 1IZ6A 5D14A 1CM9A 3PO2H 2PI2E 1BBWA 1R9TH 4LF7Q 1RKNA 3JAMc 3GTJB 1Y1VG 5IODA 3HOYB 4LF8Q 3CKIB 1RJTA 1SYDA 1M4VA 1CQFA 3VR2A 3FMCA 5EKLA 4HIKA 5T1IA 3K59A 1VQ4A 2NVQH 5EBCA 1RTOA 4ABNA 2O4XA 1Z9FA 1SAPA 2GA4B 5ELEA 5G3LF 3M4OH 1PH6A 4M8AA 4RMFA 2JE6I 4GLXA 4PZ8A 3SEBA 2I07B 1NUCA 4KN7C 4WRDA 3FKIH 1PRTF 4Z9CB 2B63B 2PCFB 3KJPA 3S14B 1NSNS 3ERSX 4FF2A 1GUOA 4XDXA 3M7NA 4DNRB 1OXXK 4C3HG 1JOKA 4DR5Q 2KCCA 4JI8Q 1B8AA 4DR1Q 4CDDC 1IBKQ 2E2JB 1J6QA 3GTQH 2B39A 5JVG3 2K50A 1UE1A 4WJ3M 1KRTA 2RA4A 3SK4A 2AMCB 1N34L 1HZAA 2CQAA 4DPGA 5GAGC 3OTOQ 3PUWA 1PH2A 3I90A 4FP5D 5C3EB 1GKHA 2J0TD 5C5MA 1Q1EA 1MHWC 1PTOC 3W1BA 2F0LA 2Q8IB 4UPAA 2VY3A 2A69C 4A3KH 1IKLA 4A3EH 5M3MB 1PFBA 4KY6A 4IUUA 1HRJA 4DR2Q 1EY4A 5DM73 1I5FA 3E0JA 1CUKA 5D3IB 2F0EA 2NZOA 3U9OA 5LMNW 4KY7A 2R7FA 4LUOA 1AE3A 3RN5A 2FJ2A 2XGTA 3D0FA 3TZUA 1SXTA 2NTTA 2Z9HA 1M1KC 1PZJD 1A2UA 1X55A 3KFUA 3PUXA 4ME3A 4EQ5A 3V05A 3FRPB 4C56C 1BDOA 1S5ED 4JG2A 1IBMQ 4OO1H 2QA4A 1IYUA 1KDCA 2OEOA 4KD4A 1K3RA 5C0XI 4KKSA 2A8VA 3CCMA 4BBRG 4DV6L 4A3BG 4OGQC 3H15A 1DONA 3DM1A 3S15B 3GTPB 1QNKA 1PYBA 2JA5B 5GROA 1VQKA 5KNBA 4DAPA 3LX0A 1PTOD 5JEAH 2BH8A 4P74A 5IOCA 2F0SA 2A69D 4A3MG 4UP8A 1RL2A 4N8FA 3JC66 3F1ZA 3PSIA 1LT6D 4C3IB 4GNXB 3D4WA 3G6JB 2FINB 3T1HL 1A15A 3U58A 5C6AA 3BZDB 2R93B 3L3OC 4K2KA 2EY1A 2B2VC 1B9NA 2HCIA 3BS1A 3NQIA 2UU9Q 2Q8TA 4MTKA 4DK1A 4H7BA 1SDFA 4LF4Q 2K01A 4YHHL 3SK6A 1H9MA 5LMUQ 3C1EA 2O2LD 3S2HB 2ENBA 2JA7H 1UE5A 4GOPB 1LABA 3RZOH 1OTCA 4LFCL 1EQRA 1K3BC 3J81c 1SFOB 1B50A 1HH2P 2O5JC 4X66Q 1C4QA 1HA5A 4A3GB 4HTHA 1R4QB 2JA8G 1BVSA 1WTVA 4J1MA 2PI2A 5IT9E 3KYHC 3SR1A 3OPOA 3L9AX 3T16A 1Y1WH 1N33Q 4R9WA 2VUMH 2UUAQ 1STGA 4RCNA 1QNUA 4ZUIA 2K4KA 1XNRQ 4BBSB 3ITPA 2XWBB 4LW1A 1HNZL 3K0YA 1AFPA 1HA6A 3M4QA 1GHJA 4RAUC 5M5XH 1XMQL 3RR5A 3HOUH 3I73A 1WTPA 1Q90A 4LFAL 3HOWB 1JWUD 2A68C 4O1NA 5IWAQ 2YU9B 2E2HB 1E0BA 2JYOA 1SROA 3QOJA 1ZKOA 1EUJA 3PO2G 1YHBA 1E2WA 2KCTA 2NBFA 4JBKA 4IJLA 2Y0SG 2WV6D 2YTYA 5J39A 4K5VA 1WTRA 4DAYA 4YIJA 3ULJA 4JI6Q 1F2YA 4OWXB 2AQ3B 4J6HA 2EYLA 4JOIA 3AFPA 1O7ZA 3TS0A 1PH1A 1EY9A 3TP7A 3SVMA 4BS9A 2XVSA 3TP6A 1VQMA 1UE6A 4IALA 5CR3A 1LT3D 2OF1A 2BE5C 4WFN3 4H0LC 3VR3A 2HT1A 2MJ8A 3J7AV 3PIPA 4DK0A 2LFNA 4JV5L 1JB7A 1SNMA 2IX1A 2Z0SA 3R3OA 4BY1B 1EY0A 3FKIG 1NE3A 3J80i 1LTBD 1JB3A 4IPCA 4LF7L 5KRUA 2OTJA 3EBEA 4B3TQ 3BVMA 1KABA 2QDBA 4LF8L 1NAPA 2ZM6L 2A68D 4A93H 3MEHA 2O5IC 2GVBA 2HD3A 3ND8A 3PIOA 1STAA 4FVMA 1U9RA 4P75A 3DXJC 2R3ZA 1G2TA 4YWKA 3K5OA 3HOXG 5M5YB 2N8NA 4GS3A 1EYAA 2EY2A 3QR8A 3RZDB 1H9KA 1GVPA 1LTID 2B29A 1JT8A 4ILWA 4A3KG 2YV5A 4A3EG 1TY2A 4JI1Q 3FPUB 2NUCA 2E2IB 2BE5D 3BU2A 4KMUC 2RKSA 1YJWA 3G6EA 4K0KQ 4DR5L 1O7IA 1K83H 3BG3A 4JI8L 1HR0Q 4DR1L 3A7AB 1HNXQ 4ZK9B 1AE2A 2KQ3A 3W3AA 4RA8A 2XSCA 5ELFA 3K7AB 4I7AA 4DN4M 1EWCA 2WAQB 2L5TA 1V9PA 5CBEE 3VA7A 3PUZA 5C5LA 1PZKD 4J15A 1W6KA 3S1NB 4OO1G 3FPPA 3D4RA 5CC4A 3OTOL 3CC2A 3VR4A 5M5WH 2A6EC 1PFNA 4LUZA 5H1SE 1MSGA 1YNNC 1XNQQ 3J81j 4CDEC 2R92H 3CCRA 1Z7TA 1QCBD 1X65A 2Q2IA 1CZGA 4CJ0B 2D2CC 4DR2L 1PXUA 1P16A 1S5CD 1SSOA 4OELB 3I4NH 5JEAG 1G2SA 4K5WA 4RKBA 3I70A 2EXZA 4K6LA 5M3FB 3OW7A 1ASZA 1UUPA 4RGMA 4CKCA 2ASBA 1WD0A 2N49A 4HIOA 4XXEA 4CKBA 1IBML 1NCVA 3DEPA 5DLQE 3ZJYC 5JPNC 4IUVA 4OIJA 3MC0B 3TS2A 2PQEA 4OXPA 2E5LQ 3CMAA 2A5HA 1ENAA 1FNUA 1E2VA 4R1JA 1H9RA 2L11A 1Y1VB 2MQHA 2F4VQ 4RH6A 1GOZA 4GN5A 1SJED 3NENA 1VQAA 2JA7G 2RCNA 2A6ED 2FHTA 1CSQA 1RODA 4R4OA 2F0QA 1G51A 2WKCA 1LACA 1W3SA 2XTIA 2KVMA 4LJZC 2UXDQ 4HCEA 5FO7B 3Q24A 4RGOS 4LNQA 3Q8DA 1TIID 2ZTEA 5E1FA 2MFIA 4CHTB 3TQYA 1YHAA 2VQEQ 2F0DA 4HR7B 1Y1WG 1FR3A 3J80L 2VUMG 1DGSA 2Z4IA 1F9SA 2JSOA 4A75A 3CCSA 4ZYSA 5C3WA 4LF4L 3UE1A 3A8JE 2K5DA 5LMUL 3EIVA 2D0PA 1WTHA 2R7DA 4C3HB 4DXFA 1NTGA 2F0UA 4RHSA 5C4JB 3B6YA 1A62A 1GUNA 1KD1C 2K75A 1Q1BA 4X62Q 2UXBQ 1EIHA 4X66L 1A3TA 1VQ5A 3HP3A 2HCCA 3KBXA 4DU9A 1YZ6A 3HOVH 4DNTB 3UDIA 4ZAIA 2VW9A 3CMEA 1VQOA 3TZDA 3UDXA 1N33L 1I94L 1H9SB 1TKWB 1LTGD 1SJHD 2V4DA 2EOTA 2UUAL 2LMCB 2ICEC 2F0TA 4N9TA 1KXLA 1SNPA 4PZ7A 4AQYQ 4KKUA 1XNRL 2RHQB 2DNCA 1K8MA 2IJ0A 1AP0A 3ICEA 1FNWA 2NN6I 1I50H 1PH5A 3OHXC 1I3QB 1Q86C 5IP9H 1L1OB 2B2UA 5ELCA 3EA6A 1YNJC 4DA2A 2DY8A 3S1MH 1YNXA 3F8TA 5IYDH 1D2BA 3S17B 1DD2A 1M90C 2FMCA 5JPMC 5IWAL 2YYZA 5CGKA 3HZXA 1KAWA 4P2CB 4XQQA 2ZJQA 3N52A 1A2TA 3JAME 3J7A5 4BY7H 1XWEA 3GV6A 1HZBA 3IFTA 4GLVB 1K9MC 3H3VH 2CVRA 1A3UA 4JI6L 3K80C 3GTMB 3NK9A 4ALPA 4A93G 3BYYB 2C35B 1ENFA 1K8GA 4ULLA 4RFBA 1ILPA 5IT9L 4BBRB 2ES2A 1Y8PB 4A3BB 4POGA 1TWHH 1DXMA 1F77A 4JBMA 1SMXA 2VZAA 1EIGA 3G71A 1XPUA 1FJGQ 2PZUA 4L6TB 3KLSX 3SK5A 3FDTA 2DUDA 1UNSA 1PTOF 2AUJD 4GLAC 3S1QB 1EY5A 2JA9A 4LF5L 1QUQB 4A3MB 4AYBG 1K8AC 4A3JG 1YEZA 4UY8C 2EYOA 1TXYA 5HY6A 2RDHA 1M8AA 3I2ZA 4HJAA 4NXML 4POFA 4B3TL 4LFBL 1YVCA 1S5BD 1YNJD 3QWNA 1HTPA 2C5CA 3GQBA 2DGYA 1HUMA 4JOIC 1IHZA 1EZ8A 1V8QA 4DUYL 1CQVA 3I7FA 2R7ZH 1NMGA 1E7ZA 1RIPA 3D6CA 1SR3A 1JWMD 1Q82C 4XQJA 1WJJA 4B9WA 4B3ML 1B3QA 2XIWA 1PDQA 1TWGH 2WAQE 1N9WA 5M9OA 4ZLTF 4G7OC 1BNZA 4ZRZA 2JJQA 3E0EA 5BN4A 1DZ1A 2VS1A 3G7LA 2F0VA 3P1HA 4DKAC 4A3LH 1VQGA 3CXCA 3RN2A 4P71A 3K58A 1AW7A 5C0XH 4PNYA 2SDFA 5EKIA 2R92G 4U673 1PTOB 2R61A 3NE5B 3M7GA 2JA8B 1MJCA 3CRLC 4HJ8A 1IXRA 1PH9A 2B2YA 4C2MH 3E3XA 4HN7A 4K0KL 3I4NG 2BOSA 3CU7A 5JOBA 5C4XH 1HR0L 1QE6A 2A74C 4X6AH 1I6VC 1HNXL 1F2LA 3PO3H 2H5XA 3I4LA 1MSHA 4UP9A 1CTMA 2Z8LA 2A6HD 2EJMA 1CKNA 1ZEQX 2DN8A 3NTKA 4G57A 1STBA 4ZCKA 1BUVT 1L0YB 1SYEA 3GTJH 3I56A 3EN2A 1T9HA 4RG1A 3U4VA 3HS0C 3H0GH 2ZXPA 4A3IH 1KQSA 4YCUA 5DM63 4FXDA 1XNQL 5IP7H 3GTLB 2F0KA 4CBVA 2EQSA 2L15A 1YI2A 1R9TB 3H3VC 4XT1B 3PO2B 5KYIA 4ZUJA 2Y0SB 3VR5A 3AFQA 2Z1CA 1JMCA 1SMYD 2ZXOA 2H1EA 2L9HA 2NVXH 1FL0A 4P72A 1MKHA 3GTKH 3NBHA 4FF1A 4M1UB 4DV3Q 1QG7A 1OXUA 2NVQB 5I6WA 4S3SA 4HSPA 3K5MA 2F0JA 1HZCA 2E8GA 3M4OB 5K36G 2QKIC 3S14H 2HDMA 2YTVA 2QDLA 2VXWA 4DGZA 2E5LL 1EWHA 2K05A 5A35A 3FKIB 5JEAJ 4IFDH 3P20A 2HDLA 5FOBB 4PQXA 1HQRD 2E2JH 1WVLA 4QIWB 1MJEA 2F4VL 5CORA 1D6EC 2PQAA 1G8ZD 1WCMG 1D1IA 3SXHA 4R4TA 5I2YA 1I4PA 1E3PA 3UE0A 5IY0A 1QILA 2UXDL 1NY4A 3CCEA 2JK8A 1JC7A 3VR6A 4L8JA 2M2LA 1GJXA 4HJ9A 1E1TA 1S4ZA 4HCSA 4X64Q 2K03A 3A5ZB 2F0OA 2N55A 3HOXB 1W2BA 3HOVG 4JI3L 4QQBX 1FGBD 4QL5A 1HNWQ 2VQEL 1I6HH 4ME5A 1QJOA 5FLXL 3U4ZA 4IURA 3NTHA 4A3KB 4A3EB 1VQDA 2I5MX 3BDLA 2EPBA 4I7ZC 3KF6A 1HR0W 4BA2I 1TT2A 4JVZA 5IP9G 2ZXRA 5LHY1 3IAYA 2F4IA 5L37A 3TN2A 2CKZB 4L63B 3GV3A 3NEMA 4X62L 2UXBL 4IJHA 1ESFA 3KLSA 4DAVA 2IY5B 4X3SA 4BY7G 4R4IA 2N78A 2CH4A 5C44H 4KN4C 4NP5A 1X3GA 1MIUA 3I91A 3GTPH 4GKJL 2LKVA 3OYYA 3BZCA 3HKZG 4BA1I 4KKTA 3TDQA 1FGUA 3DWPA 1HQMC 3OSOA 4AQYL 2K04A 2UUCQ 2OTLA 3GTGH 4APVA 1B53A 2G9DA 1EYCA 1STHA 1BOSA 2G5DA 4B3SL 1O78A 1D5XC 3H6MA 3CC7A 2ZTCA 1T5XD 4YWMA 1XTDA 1L2FA 3O13A 4JI7L 4FYDA 1SNOA 1IYJB 2VQFQ 1U0LA 4AH6A 2AHOB 4K6DA 2X6GA 5E4WC 4JBJA 5AJ3Q 3E9IA 4XT3B 4KHPQ 1KRSA 1XPRA 3MVVA 2NVTH 3CRKC 3HOZH 2R7ZG 1H95A 1ESRA 1SNCA 2WFWA 2PNRC 1VQPA 3GTOH 1EQQA 4IOAA 3WOFA 2B2UC 1FJGL 1GUSA 1WTXA 2JA7B 1UE7A 1VS0A 2A73B 5E4XA 5IGGA 5C0XG 4CGYB 2E2DC 1ILQA 1F9RA 1SNQA 1GUGA 2BCOA 1QWYA 3S1RH 1X54A 1E22A 4RGNA 1PRTC 2DY7A 2RSNA 2PNHA 1B9MA 1UEAB 3R93A 1NMFA 2B8FA 4TQUS 1EIYB 2Q2UA 3OIPA 1Y1WB 5C4XG 2VUMB 2AKWB 3EQLC 3PO3G 3E5SA 3ER0A 4DK6C 2E2HH 4UP7A 1VF7A 1VQ8A 1SE8A 1BBXC 3J80c 4GKKQ 5I4DA 5D3DA 4MHEA 1PV4A 2JEBI 4IZ8A 2RDGA 3KJOA 3WDNA 3H0GG 4V190 4A3IG 1KL9A 4DV5Q 5IP7G 4WJ4A 3CCJA 3I8ZA 2EY6A 1HFGA 2M00A 2Y0SE 4MNOA 1ICWA 3CP0A 4X3KA 3TRZA 3T4AC 4PG3A 3GDEA 1VF5C 5G3LD 3OMGA 3R2IA 1LTRD 3KOJA 1TWCB 1L0XB 3A8IE 1BCPF 2OQ0A 3DLLA 1EIFA 1VQJA 1CSPA 1GUWA 2PYKA 1CT1D 3QG1A 2JA6H 1PRTD 3G48A 2N3SA 1XXGA 3VA5A 1N32Q 1PYSB 1Z47A 3QJYA 2LS01 2RF4A 4QB4A 4OO1I 1U4PA 1B1ZA 1VQFA 2K5VA 1H9SA 4GN3B 2IHEA 4IFDG 4QCLA 2H4OA 3TP8A 4QIWE 1XTCD 2B2YC 3BYTB 4IOCA 1IYVA 1DM0B 3VDYA 1TQOA 2HQEA 2ZJRA 2L12A 5K5PA 1SE2A 4OEMB 1VQ9A 4A93B 3LWEA 1F2MA 4LK1C 3STBC 1KC8C 1B44D 4QY7A 4J8QA 4YCWA 1GD7A 1J9OA 4KV6A 4MIUA 1BCPB 4FO2A 2LY7A 4LMQD 2KBNA 1C0AA 1K73C 3S16H 1STEA 3Q0AA 1YIJA 2LSSA 3MXGA 5IT9c 3RD4A 1CFMA 3UDFA 2WACA 3MXUA 1IBKL 4AYBB 3E9HA 4A3JB 1KIXA 3IL8A 4A3DH 3C2PA 4EVOA 5C4HA 5LMNQ 4R4QA 2K33A 3S9WA 3KLWA 2XNAC 3FVQA 2NN6H 3NELA 4TRDA 2WINB 1PA6A 2L1BA 1ET9A 1K83B 3MFYA 1XJVA 4C3JH 3I55A 1EEFD 3MHBA 2OQKA 2F0PA 4X64L 2WP8J 4O0AA 5C44G 5ISRA 3I4MH 2PPBC 1HNWL 1LLRD 3STBD 2NZHA 2MUYA 5M5WB 1RCVD 1LTTD 1IKMA 4WORA 4OX9Q 5EPKA 3AYHB 3WWVA 2R92B 4G7HC 5M3FH 3NHHA 4DV7Q 2CH4W 1VQLA 2K6AA 3I4NB 5JVH3 5KIXA 1D5ZC 2CW0C 2RBMA 1A0IA 4QUCA 4DXGA 2MPMA 3PQIA 3NQTA 3S2DH 1NR2A 1HHVA 2IX0A 2F0WA 1STYA 1MI2A 1AZPA 3QIAA 1QVFA 2PO4A 4DNIA 4DV2Q 3M3YH 4LUVA 4KJNA 3M85A 3HOZG 1YNND 4E6IA 3K5NA 1RTNA 2XN9C 3HGBA 4LWCA 5EQ0A 4EGVA 1X3QA 1QB5D 2AWOA 2NVYH 3DHQA 3QOLA 5FK9C 1QZGA 3MXPA 3MEFA 1FD7D 2D9UA 1CHQD 1ONLA 1EY8A 3MWYW 4Y7NH 1EZ6A 4X65Q 1B2TA 2MNAA 1EY6A 1TWFH 1B4OA 2UU9L 1EQTA 1O80A 1ML0D 1II3A 2VQFL 1TVXA 1C8CA 4NB3A 1X3PA 4K8IA 1KAAA 5CV7A 3RNUA 4C1NI 3HRZC 5CV4A 1J8IA 2CW0D 3CPWA 1R4PB 2PW7A 4DAYB 4KHPL 5FO8B 3HOUG 1WTWA 2ALYB 4HMJA 2QEXA 3DWQA 3RLFA 4AIMA 3D31A 4ZKBB 1ZXTA 4UHVA 2HQLA 3CQZH 1WFQA 2K5NA 5COYA 5NUCA 4LF9Q 1EEID 2Q2TA 4IN3A 3A0JA 4PMWA 1WCMB 2K7VA 3OIQA 1Q81C 4CJ1B 1X3FA 3A7LA 3T53B 1LTAD 4QUFA 3MZ5A 5EPJA 1TWAH 2R6GA 2E74C 5JJIA 1X32A 4ID6A 1EOVA 3OOCA 3J7AF 2B8GA 4MN3A 2AQ2B 4RKLA 1WTQA 1OXSC 3HOVB 4IPDA 2I5HA 4F87A 2EYHA 1JJGA 1F9PA 4JI2Q 1JR0D 2X6LA 3C1FA 1HPCA 1B70B 1JCKB 2IWHA 5FJ8H 2EIFA 2K5QA 1BBUA 2JA6G 1LT4D 4GKKL 5EPLA 1EL0A 4HAEA 2BDOA 4Q5VA 2J7ZA 5FLXc 3CCVA 4FDBA 1KTKA 1LUZA 1JJ2A 3GTMH 1GXDC 1FYCA 4K14A 2KCNA 2DNEA 2L4NA 4DV4Q 3U9SA 4DV0Q 2Q2HA 4BY7B 1TS3A 1CA5A 1XPOA 4OWWB 4IUPA 5GQOA 2EJFC 2KHJA 2OT2A 3RUZA 2NB0A 5E7NA 3RLOA 2I0QA 1ENCA 2B2WA 2WB1G 3HKZB 4L5SA 3S1QH 1FNVA 3TEHB 5A2QE 4A3MH 1RF2D 5IYBH 1C7YA 4BWGB 2MHVA 1TWHB 4KLKA 1VQNA 1I4RA 5KNCA 4GN4B 1N32L 2SOBA 1E2ZA 4PZ6A 2Z6KA 2AQ1B 1TS5A 4BXXH 4KY5A 1RHPA 2EY5A 4HMIA 4AYBE 4F7XA 1A6XA 5ELBA 3CF5A 4A3DG 1A8VA 3L0OA 5ELOA 3UI2A 4XTCS 3C3LA 2MP1A 2LXKA 1HFNA 4GNXA 4A3FH 2SNSA 1HJPA 1J5EQ 1EU3A 4HIDA 3TP5A 4I65A 1BF4A 2R7ZB 4LFAQ 1V1PB 3NTIA 4C3JG 3KK7A 2OXPA 4JI1L 4IFDJ 1TWGB 4JPBW 5F2DA 3I4MG 1NNXA 4HSVA 1MBYA 2JA8H 4IUTA 3ULPA 3ONAB 4YY3Q 1SYFA 3D3RA 2D5DA 2K5WA 5JJLA 4GOPA 5TSSA 3V2TA 5DEHA 2Z4HA 1CKOA 2KEDA 4A76A 1Q3LA 5I9OA 4H44C 2I46A 3K7UC 4NW2A 1HZ9A 2KECA 4NKLA 2CCZA 3T1YQ 4C2MB 2IL8A 1LV9A 5GADC 3HOYH 2J4XA 2UXCQ 5C4XB 1DJRD 3TSSA 4B08A 1HTLD 1VQEA 3PO3B 3QO2A 2BA0A 3P75A 3SE0A 1E24A 1Q7YC 3F2BA 4DFAA 2D62A 1EU4A 1B7YB 1CHPD 3H0GB 2HIVA 2ZM6Q 4A3IB 2ID0A 2B2TA 4DV1Q 4KD3A 1E1OA 2BDNA 4OX9L 5KNDA 4XYOA 4DUZQ 4MTNA 4R8IA 2N88A 2K14A 4CKEA 4DV7L 4FF3A 1QZHA 2B63H 1WOCA 2F0MA 1PH3A 2EDGA 5ELNA 4JI4Q 4A4IA 5J22A 3VYUA 5DNFA 5IGDA 2NVXB 4DK3C 2L55A 1WI5A 3GTKB 1SNDA 2BA1A 1HXYD 3NBIA 3NWTA 3MAQA 1PH7A 2F03A 1MGSA 5JJKA 2GN5A 3CCQA 3JAMi 5HGTA 4DV2L 5IGFA 3QB3A 3H3VI 4IPGA 1L0WA 2UUBQ 4K2LA 4L5TA 2WIIB 3KDFB 1SEBD 2K5HA 4JI0Q 3L7ZC 2V1CC 5CV9A 3J81E 3W1GA 1STNA 5AFWA 5C3EH 3GTQB 1AN8A 4DR3Q 1TS2A 4OONA 2CFMA 2EZVA 3KUPA 1U4RA 3PMFA 3LWUA 5M3MH 2WKDA 3KLRA 3A55A 3HOXH 2F52A 4RHRA 2AWNA 1WYDA 4X65L 1YBYA 2HIXA 1O7YA 1EWIA 4L5RC 2HHHQ 3AMUA 2RSOA 3PUVA 3VYRA 5D65A 4N9PA 1GO3E 1VCIA 4FXKC 3Q6SA 2JP1A 1QOHA 1LT5D 5I6YA 1PFSA 1I4HA 1V1OA 5IYDG 1PRTB 1I6HB 4LF6Q 3CHBD 1LTLA 4JYAQ 2PMZB 1QVGA 3EROA 3PUYA 3CC4A 5FJ8G 4NMZA 3U50C 3J80E 2IT1A 4LF9L 2F0NA 2KUMA 2A19A 3S15H 4CDCC 2KCMA 2PZTA 2DJFC 2JA5H 4H13C 4RWSC 5EAYA 1SE3A 2I5LX 1PH8A 2F1MA 2KHIA 3R8BA 4OHJA 1BXTA 5LL6X 3W5OA 5C44B 4KTAA 1YJNA 4C3IH 3FEWX 2XRQD 2DJGC 4JI2L 3HKZE 2AUKA 2KENA 2NZ1D 2R93H 2IHFA 2KEEA 3PIP3 4EQNA 3GTGB 5IYBG 3MXNB 2YTXA 3CCLA 4NXNQ 4DR7Q 1EYDA 1CA6A 4XYQA 4JI5Q 5BN3A 2EYMA 3HEJA 4BXXG 1KLUD 3S2HH 5JJZA 5CV8A 2FXQA 1Z6HA 4DV4L 1SN8A 4DV0L 4Q0FA 3KF8B 3HKSA 1SFOH 3PIO3 4OL7A 1DOLA 4FF4A 2VB3X 2JQOA 4A3CH 2QF7A 4A3FG 4A3GH 2NVTB 1VQBA 4XQNA 4A3LG 3HOZB 4QF4A 3RZOB 2C9OA 2F3WA 1D5MC 3A54A 5IE8A 3OW2A 1BQQT 1GUTA 3H09A 1WD1A 4IO9A 3RLNA 2Q8RE 5J1ZA 3GTOB 4BBSH 2K1BA 4FNFA 4YCVA 1CKNB 3A56A 1OXVA 1LM0A 4L5QA 2ATWA 2EVBA 3HFZB 1S5DD 3JAML 3OWEB 1I94Q 4TKOB 4IFDI 3HOWH 5DAUA 3NSWA 4PV1C 2YU9H 3IFDA 5JAVA 1TS4A 3S1RB 1N36Q 5EBDA 4JCVE 2JEAI 3F2CA 1G291 1EYGA 1J5EL 5M5XB 2B2WC 3HOYG 3R2TA 3HOUB
chains in the Genus database with same CATH topology
2DUDA 1HZAA 1D7QA 1A0IA 4GLAC 4DPGA 3NBHB 5GAGC 3OTOQ 3PUWA 1PH2A 3J81i 1GKHA 2JA9A 4LF5L 1Q1EA 1QUQB 1IBLQ 4AYBG 3S2DH 4OWTB 3W1BA 2IX0A 1XMOQ 1K8AC 4JBWA 4A3JG 1YEZA 4UY8C 4UPAA 1TXYA 2VY3A 5HY6A 1YITA 4A3KH 4A3EH 3I2ZA 4HJAA 4NXML 4POFA 4DNIA 4DV2Q 4B3TL 1QVFA 2Z6KC 3M3YH 4LFBL 1YVCA 4LUVA 4YY3L 4DR2Q 1I5FA 3M85A 4HJ7A 3HOZG 2DGYA 1Q8KA 1CUKA 4B3RQ 4JOIC 2NZOA 4DUYL 5LMNW 3I7FA 4LUOA 1TWCH 2R7FA 2R7ZH 1AE3A 1NMGA 1E7ZA 1RIPA 4LWCA 3RN5A 1SR3A 4BY1H 2AWOA 1Q82C 2NVYH 1WJJA 4GNXC 2XGTA 3D0FA 1QZGA 4B3ML 2B63G 4KI0A 3F2DA 3MEFA 1M1KC 1TWGH 2WAQE 1X55A 1N9WA 3KFUA 3PUXA 3T1YL 4ME3A 5IYCH 2PQAB 4EQ5A 2JJQA 3E0EA 4O2DA 2UXCL 2VS1A 4JG2A 4DKAC 4Y7NH 1IBMQ 4A3LH 3A74A 1VQGA 2QA4A 4X65Q 3CXCA 1K3RA 4XIGS 5C0XI 4P71A 4HJ5A 2MNAA 3RN2A 1TWFH 1U5KA 2UU9L 2A8VA 4LF5Q 3CCMA 4BBRG 1SRUA 1VQ6A 2R92G 4DV6L 4A3BG 3H15A 2VQFL 1K0RA 4MZ9A 4NB3A 3RNUA 1MJCA 1BKBA 4HJ8A 4DR6Q 3GO5A 1IXRA 4NXMQ 1PH9A 3CPWA 4KHPL 4DAYB 4C2MH 1PYBA 4LFBQ 1L1OA 5GROA 4GOPC 1VQKA 3I4NG 3HOUG 4K0KL 4DV1L 2ALYB 5C4XH 5M5YH 2QEXA 3RLFA 4DV3L 4AIMA 3D31A 1HR0L 4X6AH 1HNXL 5C3EG 4DUYQ 2BH8A 4P74A 2H5XA 4A3MG 3PO3H 3RZDH 4UP8A 4UP9A 3TREA 2ZJPA 4DUZL 2HQLA 1RL2A 3LGJA 3JC66 2A1AA 3F1ZA 3CQZH 4KHZA 1WFQA 2K5NA 3PSIA 5BR8Q 4B3MQ 4GNXB 1CKNA 4LF9Q 4EX5A 5M3MG 3KF6B 3T1HL 3U58A 2Q2TA 4JI4L 2E2IH 2K52A 3A0JA 4PMWA 1X56A 3GTJH 1Q81C 3I56A 3CCUA 3EN2A 1T9HA 4RG1A 3U4VA 1X3FA 3H0GH 4A3IH 1KQSA 4YCUA 1XNQL 5IP7H 1TWAH 1X6OA 2R6GA 5JJIA 2UU9Q 1EOVA 2EQSA 3S24A 2L15A 1YI2A 4A3JH 2B3GA 4LF4Q 2LXJA 2F3IA 4YHHL 3K7AH 1OXSC 2UUBL 5LMUQ 4IPDA 3AEVA 2I5HA 3AFQA 1JJGA 1JMCA 4JI2Q 2NVXH 2PMZE 1P8LA 1FL0A 2JA7H 1UWVA 4P72A 1MKHA 1UE5A 4JI0L 4GOPB 3GTKH 3RZOH 3S1NH 1B70B 4LFCL 1EQRA 4DV3Q 3IRBA 1OTCA 1QUQA 1Q12A 4DR4Q 3BJUA 4TVAB 5FJ8H 3J81c 2EIFA 1OXUA 4DR3L 1BBUA 2JA6G 1IL2A 1HH2P 1QVCA 1D8LA 4X66Q 4GKKL 2JA8G 1BVSA 1HZCA 2E8GA 2PI2A 3CD6A 3KYHC 5K36G 3M4PA 3S14H 5FLXc 4JC0A 3CCVA 2JA5G 4FDBA 1LUZA 1VQHA 2YTVA 1Y1WH 1JJ2A 1N33Q 2VUMH 3GTMH 3A5UA 1LYLA 2E5LL 2UUAQ 2HHHL 5JEAJ 4DV4Q 3PCOB 2K4KA 4DV0Q 2Q2HA 1XNRQ 2CQOA 2E2JH 4YWLA 1XPOA 4OWWB 4LW1A 2D0OA 4Y52H 1MJEA 2F4VL 1HNZL 2PQAA 1JJCB 1G6PA 5GQOA 1WCMG 3M4QA 2R93G 2KHJA 4R4TA 4LF6L 5M5XH 1XMQL 5E7NA 3RLOA 2I0QA 4JYAL 2WB1G 3RR5A 1S40A 3HOUH 1E3PA 3UE0A 5IY0A 5FLMH 4L5SA 4LFAL 1X3EA 3PF4A 5IWAQ 2BH2A 3S1QH 1NY4A 3CAMA 2JK8A 3TEHB 3CCEA 2UXDL 4A3MH 1SROA 5IYBH 1C7YA 1EUJA 3PO2G 4HJ9A 4KLKA 1YHBA 2KCTA 4JBKA 1E1TA 4X64Q 1VQNA 4IJLA 4GN4B 2Y0SG 3A5ZB 1N32L 2YTYA 1W2BA 3HOVG 4JI3L 4QQBX 4QL5A 1HNWQ 1Y1VH 4PZ6A 2VQEL 3ULJA 2Z6KA 4IPHA 4JI6Q 4BXXH 4OWXB 3PV0A 1I6HH 4AYBE 1JE5A 2UUCL 4JOIA 3U4ZA 3AFPA 3CF5A 3TS0A 4A3DG 1A8VA 3L0OA 5ELOA 4HIMA 4XTCS 1PH1A 1VQDA 2I5MX 2LXKA 5GAHC 4A3CG 4GNXA 4A3GG 3KF6A 1HR0W 1OXTA 4A3FH 3M9BA 1UE6A 5IP9G 1VQMA 4BA2I 1HJPA 1J5EQ 2MO0A 2QGQA 1PH4A 3ULLA 2HT1A 1SLJA 3PIPA 4HIDA 1N34Q 4JV5L 1JB7A 2CKZB 2IX1A 2Z0SA 1A63A 3NEMA 4X62L 2UXBL 4LFAQ 4IJHA 3FKIG 1S72A 1NE3A 2IY5B 4JI1L 4IFDJ 4BBSG 3J80i 4NXNL 4DR7L 4BY7G 4R4IA 2N78A 2GVAA 4IPCA 4JI5L 3I4OA 5C44H 3UDGA 4LF7L 1X3GA 5AJ3L 3I4MG 2OTJA 1NBWA 3EBEA 4B3TQ 3ULPA 2JA8H 1MIUA 4LF8L 4YY3Q 4JI3Q 3K0XA 3GTPH 4GKJL 2ZM6L 3PGZA 4C3HH 3OYYA 3BZCA 3HKZG 3K81C 4BA1I 5C4JH 4GOPA 4A93H 5JJLA 3HOWG 1AH9A 1FGUA 2GVBA 4AQYL 3PIOA 2UUCQ 1CKOA 2OTLA 4APVA 1GM5A 3GTGH 4P75A 2OCEA 4A76A 1VQIA 4YWKA 3K7UC 1HZ9A 2CCZA 3HOXG 3T1YQ 4NPSA 5GADC 3HOYH 2N8NA 4GS3A 1WCMH 4B3SL 2UXCQ 3DM3A 3CC7A 2ZTCA 1VQEA 4YWMA 1XTDA 1L2FA 2BA0A 1GVPA 4JI7L 2B29A 1JT8A 3L2PA 4DV6Q 4A3KG 2YV5A 1IYJB 4A3EG 1E24A 2VQFQ 4JI1Q 1U0LA 1Q7YC 4AH6A 3SGIA 3F2BA 2AHOB 3BU2A 1C9OA 2D62A 4JBJA 5AJ3Q 3E9IA 1YJWA 1B7YB 1KRSA 4KHPQ 1XPRA 1I3QH 3G6EA 2NVTH 4K0KQ 4DR5L 3BZKA 4GKJQ 2HIVA 3KDFA 1O7IA 1V1QA 2ID0A 2ZM6Q 1K83H 4JI8L 1E1OA 4DV1Q 1HR0Q 2R7ZG 4DR1L 3S17H 4BY1G 4OX9L 1HNXQ 3AQQA 1VQCA 1AE2A 1H95A 4DUZQ 4MTNA 1Q46A 5C0XJ 1N36L 2K14A 4DV7L 2WFWA 1QZHA 2B63H 1WOCA 4IOAA 1VQPA 1PH3A 1EQQA 3GTOH 5ELNA 5IYCG 1FJGL 3T1HQ 4JI4Q 1V9PA 4A4IA 3PUZA 3J7ZC 4J15A 4DK3C 4OO1G 1N8RC 1WI5A 1UE7A 1VS0A 2BA1A 3OTOL 1UEBA 4P73A 4DV5L 3CC2A 5M5WH 4B3SQ 4DAMA 5H1SE 4LUZA 4R4CA 1IBLL 5C0XG 1XNQQ 1XMOL 1V43A 2EXDA 1PH7A 3J81j 4JI7Q 5JJKA 2GN5A 4BBRH 2R92H 3CCQA 3S1RH 1X54A 3CCRA 2OWOA 4A3BH 3JAMi 1X65A 1E22A 4DV2L 2Q2IA 4YHHQ 3H3VI 4IPGA 1L0WA 4DR2L 2PNHA 1PHJA 1P16A 2UUBQ 1NMFA 1EIYB 4TQUS 2Q2UA 4L5TA 3KDFB 5C4XG 4B3RL 3I4NH 2AKWB 5JEAG 2K5HA 4QJFA 4JI0Q 3L7ZC 2V1CC 3W1GA 3PO3G 4LFCQ 3ER0A 5C3EH 3G4SA 2VL6A 4DK6C 3PF5A 2E2HH 4DR3Q 1ASZA 4OONA 4UP7A 2CFMA 2ASBA 1VQ8A 1KHIA 1SE8A 1ASYA 3J80c 4GKKQ 5M3MH 1PV4A 2JEBI 2N49A 3FP9A 3HOXH 4HIOA 2WB1E 2F52A 1IBML 3KJOA 1EFWA 2AWNA 1WYDA 3H0GG 5DLQE 3ZJYC 4X65L 4A3IG 1YBYA 3K8AA 1KL9A 5HGQA 2HIXA 4DV5Q 5IP7G 4OXPA 3TS2A 4WJ4A 3CCJA 2E5LQ 1EWIA 4L5RC 2HHHQ 3CMAA 2CWAA 3PUVA 2Y0SE 1GO3E 1VCIA 4MNOA 1YJ9A 4DR6L 3CP0A 4R1JA 2NN6G 3TRZA 2MQHA 1PFSA 2F4VQ 1HNZQ 2WAQG 4GN5A 3GDEA 3NENA 4PG3A 5IYDG 1VQAA 2JA7G 2RCNA 1S3OA 3KOJA 1CSQA 4R4OA 4LF6Q 1XMQQ 1G51A 2ZTDA 1LTLA 1W3SA 4JYAQ 1QVGA 2XTIA 3CC4A 3PUYA 2OQ0A 3DLLA 1YHQA 1EIFA 1VQJA 5FJ8G 1CSPA 2UXDQ 3U50C 2JA6H 3G48A 2N3SA 3GD7A 2IT1A 2MO1A 5BR8L 4LF9L 4LNQA 5GAEC 3Q8DA 2ZTEA 1PVOA 1N32Q 2A19A 2MFIA 3S15H 1PYSB 1Z47A 2RF4A 3TQYA 2KCMA 1YHAA 4QGUA 2VQEQ 4OO1I 2JA5H 1Y1WG 2VUMG 1DGSA 1VQFA 2K5VA 1CKMA 3FHWA 5EAYA 4GN3B 4A75A 2IHEA 4IFDG 2I5LX 1PH8A 3CCSA 2KHIA 5M3FG 1NJIC 4QIWE 5LMNL 3W5OA 4LF4L 3UE1A 1VQ7A 4IOCA 3VDYA 1YJNA 5LMUL 1L1OC 2VNUD 4C3IH 2CWPA 2ZJRA 3EIVA 2D0PA 1FVIA 5J3BA 2R7DA 4JI2L 2RHSB 3HKZE 2R93H 2KENA 1Y14B 1NTGA 1VQ9A 2IHFA 3B6YA 5FLMG 3STBC 1KC8C 4JV5Q 1X9NA 4QY7A 3CW2C 1A62A 1KD1C 4DR4L 4H02A 2K75A 1Q1BA 4X62Q 2UXBQ 3CPFA 4YCWA 5IYBG 3GTLH 1IZ6A 3MXNB 2YTXA 1GD7A 4X66L 3CCLA 1VQ5A 4NXNQ 2PI2E 1BBWA 1R9TH 3PO2H 4DR7Q 4LF7Q 4JI5Q 3JAMc 2KBNA 1C0AA 1Y1VG 1YZ6A 1K73C 3HOVH 3UDIA 3S16H 2VW9A 3CMEA 2LSSA 1VQOA 1YIJA 4LF8Q 3UDXA 4BXXG 5IT9c 1N33L 3S2HH 1I94L 3UDFA 2FXQA 2UUAL 1IBKL 4DV4L 1KXLA 3E9HA 1SN8A 4PZ7A 4AQYQ 1KIXA 4DV0L 1XNRL 4A3DH 3KF8B 2RHQB 3HKSA 1SFOH 4HIKA 1VQ4A 2NVQH 5LMNQ 4R4QA 2JQOA 3ICEA 4A3CH 3KLWA 2NN6I 4A3FG 4A3GH 1I50H 1PH5A 1Z9FA 3NELA 1VQBA 1Q86C 5IP9H 1PA6A 1L1OB 1PH6A 3M4OH 4A3LG 3S1MH 5IYDH 4RMFA 1YNXA 2JE6I 3F8TA 4GLXA 1M90C 5IWAL 2YYZA 4PZ8A 5IE8A 3OW2A 1KAWA 1XJVA 2ZJQA 4C3JH 3I55A 3FKIH 4IO9A 3RLNA 2OQKA 5C44G 4X64L 2WP8J 4O0AA 4YCVA 3J7A5 4BBSH 1CKNB 4BY7H 1HZBA 3KJPA 3I4MH 1HNWL 3HOZH 3ERSX 1LM0A 1OXVA 4GLVB 4L5QA 1K9MC 3H3VH 3STBD 2ATWA 4JI6L 3M7NA 1OXXK 3K80C 2NZHA 3HFZB 4ALPA 4A93G 4DR5Q 1I94Q 4JI8Q 1B8AA 2C35B 4DR1Q 1K8GA 4IFDI 4OX9Q 3HOWH 1IBKQ 3AYHB 3WWVA 2ES2A 2YU9H 1J6QA 3GTQH 4POGA 5M3FH 1N36Q 4JCVE 4DV7Q 2K50A 2JEAI 1TWHH 1UE1A 3F2CA 1G291 4WJ3M 1VQLA 4JBMA 1SMXA 2VZAA 3G71A 1XPUA 1EYGA 1KRTA 1FJGQ 1J5EL 3HOYG 2AMCB 1N34L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DUD A;  1HZA A;  1D7Q A;  1A0I A;  4GLA C;  4DPG A;  3NBH B;  5GAG C;  3OTO Q;  3PUW A;  1PH2 A;  3J81 i;  1GKH A;  2JA9 A;  4LF5 L;  1Q1E A;  1QUQ B;  1IBL Q;  4AYB G;  3S2D H;  4OWT B;  3W1B A;  2IX0 A;  1XMO Q;  1K8A C;  4JBW A;  4A3J G;  1YEZ A;  4UY8 C;  4UPA A;  1TXY A;  2VY3 A;  5HY6 A;  1YIT A;  4A3K H;  4A3E H;  3I2Z A;  4HJA A;  4NXM L;  4POF A;  4DNI A;  4DV2 Q;  4B3T L;  1QVF A;  2Z6K C;  3M3Y H;  4LFB L;  1YVC A;  4LUV A;  4YY3 L;  4DR2 Q;  1I5F A;  3M85 A;  4HJ7 A;  3HOZ G;  2DGY A;  1Q8K A;  1CUK A;  4B3R Q;  4JOI C;  2NZO A;  4DUY L;  5LMN W;  3I7F A;  4LUO A;  1TWC H;  2R7F A;  2R7Z H;  1AE3 A;  1NMG A;  1E7Z A;  1RIP A;  4LWC A;  3RN5 A;  1SR3 A;  4BY1 H;  2AWO A;  1Q82 C;  2NVY H;  1WJJ A;  4GNX C;  2XGT A;  3D0F A;  1QZG A;  4B3M L;  2B63 G;  4KI0 A;  3F2D A;  3MEF A;  1M1K C;  1TWG H;  2WAQ E;  1X55 A;  1N9W A;  3KFU A;  3PUX A;  3T1Y L;  4ME3 A;  5IYC H;  2PQA B;  4EQ5 A;  2JJQ A;  3E0E A;  4O2D A;  2UXC L;  2VS1 A;  4JG2 A;  4DKA C;  4Y7N H;  1IBM Q;  4A3L H;  3A74 A;  1VQG A;  2QA4 A;  4X65 Q;  3CXC A;  1K3R A;  4XIG S;  5C0X I;  4P71 A;  4HJ5 A;  2MNA A;  3RN2 A;  1TWF H;  1U5K A;  2UU9 L;  2A8V A;  4LF5 Q;  3CCM A;  4BBR G;  1SRU A;  1VQ6 A;  2R92 G;  4DV6 L;  4A3B G;  3H15 A;  2VQF L;  1K0R A;  4MZ9 A;  4NB3 A;  3RNU A;  1MJC A;  1BKB A;  4HJ8 A;  4DR6 Q;  3GO5 A;  1IXR A;  4NXM Q;  1PH9 A;  3CPW A;  4KHP L;  4DAY B;  4C2M H;  1PYB A;  4LFB Q;  1L1O A;  5GRO A;  4GOP C;  1VQK A;  3I4N G;  3HOU G;  4K0K L;  4DV1 L;  2ALY B;  5C4X H;  5M5Y H;  2QEX A;  3RLF A;  4DV3 L;  4AIM A;  3D31 A;  1HR0 L;  4X6A H;  1HNX L;  5C3E G;  4DUY Q;  2BH8 A;  4P74 A;  2H5X A;  4A3M G;  3PO3 H;  3RZD H;  4UP8 A;  4UP9 A;  3TRE A;  2ZJP A;  4DUZ L;  2HQL A;  1RL2 A;  3LGJ A;  3JC6 6;  2A1A A;  3F1Z A;  3CQZ H;  4KHZ A;  1WFQ A;  2K5N A;  3PSI A;  5BR8 Q;  4B3M Q;  4GNX B;  1CKN A;  4LF9 Q;  4EX5 A;  5M3M G;  3KF6 B;  3T1H L;  3U58 A;  2Q2T A;  4JI4 L;  2E2I H;  2K52 A;  3A0J A;  4PMW A;  1X56 A;  3GTJ H;  1Q81 C;  3I56 A;  3CCU A;  3EN2 A;  1T9H A;  4RG1 A;  3U4V A;  1X3F A;  3H0G H;  4A3I H;  1KQS A;  4YCU A;  1XNQ L;  5IP7 H;  1TWA H;  1X6O A;  2R6G A;  5JJI A;  2UU9 Q;  1EOV A;  2EQS A;  3S24 A;  2L15 A;  1YI2 A;  4A3J H;  2B3G A;  4LF4 Q;  2LXJ A;  2F3I A;  4YHH L;  3K7A H;  1OXS C;  2UUB L;  5LMU Q;  4IPD A;  3AEV A;  2I5H A;  3AFQ A;  1JJG A;  1JMC A;  4JI2 Q;  2NVX H;  2PMZ E;  1P8L A;  1FL0 A;  2JA7 H;  1UWV A;  4P72 A;  1MKH A;  1UE5 A;  4JI0 L;  4GOP B;  3GTK H;  3RZO H;  3S1N H;  1B70 B;  4LFC L;  1EQR A;  4DV3 Q;  3IRB A;  1OTC A;  1QUQ A;  1Q12 A;  4DR4 Q;  3BJU A;  4TVA B;  5FJ8 H;  3J81 c;  2EIF A;  1OXU A;  4DR3 L;  1BBU A;  2JA6 G;  1IL2 A;  1HH2 P;  1QVC A;  1D8L A;  4X66 Q;  4GKK L;  2JA8 G;  1BVS A;  1HZC A;  2E8G A;  2PI2 A;  3CD6 A;  3KYH C;  5K36 G;  3M4P A;  3S14 H;  5FLX c;  4JC0 A;  3CCV A;  2JA5 G;  4FDB A;  1LUZ A;  1VQH A;  2YTV A;  1Y1W H;  1JJ2 A;  1N33 Q;  2VUM H;  3GTM H;  3A5U A;  1LYL A;  2E5L L;  2UUA Q;  2HHH L;  5JEA J;  4DV4 Q;  3PCO B;  2K4K A;  4DV0 Q;  2Q2H A;  1XNR Q;  2CQO A;  2E2J H;  4YWL A;  1XPO A;  4OWW B;  4LW1 A;  2D0O A;  4Y52 H;  1MJE A;  2F4V L;  1HNZ L;  2PQA A;  1JJC B;  1G6P A;  5GQO A;  1WCM G;  3M4Q A;  2R93 G;  2KHJ A;  4R4T A;  4LF6 L;  5M5X H;  1XMQ L;  5E7N A;  3RLO A;  2I0Q A;  4JYA L;  2WB1 G;  3RR5 A;  1S40 A;  3HOU H;  1E3P A;  3UE0 A;  5IY0 A;  5FLM H;  4L5S A;  4LFA L;  1X3E A;  3PF4 A;  5IWA Q;  2BH2 A;  3S1Q H;  1NY4 A;  3CAM A;  2JK8 A;  3TEH B;  3CCE A;  2UXD L;  4A3M H;  1SRO A;  5IYB H;  1C7Y A;  1EUJ A;  3PO2 G;  4HJ9 A;  4KLK A;  1YHB A;  2KCT A;  4JBK A;  1E1T A;  4X64 Q;  1VQN A;  4IJL A;  4GN4 B;  2Y0S G;  3A5Z B;  1N32 L;  2YTY A;  1W2B A;  3HOV G;  4JI3 L;  4QQB X;  4QL5 A;  1HNW Q;  1Y1V H;  4PZ6 A;  2VQE L;  3ULJ A;  2Z6K A;  4IPH A;  4JI6 Q;  4BXX H;  4OWX B;  3PV0 A;  1I6H H;  4AYB E;  1JE5 A;  2UUC L;  4JOI A;  3U4Z A;  3AFP A;  3CF5 A;  3TS0 A;  4A3D G;  1A8V A;  3L0O A;  5ELO A;  4HIM A;  4XTC S;  1PH1 A;  1VQD A;  2I5M X;  2LXK A;  5GAH C;  4A3C G;  4GNX A;  4A3G G;  3KF6 A;  1HR0 W;  1OXT A;  4A3F H;  3M9B A;  1UE6 A;  5IP9 G;  1VQM A;  4BA2 I;  1HJP A;  1J5E Q;  2MO0 A;  2QGQ A;  1PH4 A;  3ULL A;  2HT1 A;  1SLJ A;  3PIP A;  4HID A;  1N34 Q;  4JV5 L;  1JB7 A;  2CKZ B;  2IX1 A;  2Z0S A;  1A63 A;  3NEM A;  4X62 L;  2UXB L;  4LFA Q;  4IJH A;  3FKI G;  1S72 A;  1NE3 A;  2IY5 B;  4JI1 L;  4IFD J;  4BBS G;  3J80 i;  4NXN L;  4DR7 L;  4BY7 G;  4R4I A;  2N78 A;  2GVA A;  4IPC A;  4JI5 L;  3I4O A;  5C44 H;  3UDG A;  4LF7 L;  1X3G A;  5AJ3 L;  3I4M G;  2OTJ A;  1NBW A;  3EBE A;  4B3T Q;  3ULP A;  2JA8 H;  1MIU A;  4LF8 L;  4YY3 Q;  4JI3 Q;  3K0X A;  3GTP H;  4GKJ L;  2ZM6 L;  3PGZ A;  4C3H H;  3OYY A;  3BZC A;  3HKZ G;  3K81 C;  4BA1 I;  5C4J H;  4GOP A;  4A93 H;  5JJL A;  3HOW G;  1AH9 A;  1FGU A;  2GVB A;  4AQY L;  3PIO A;  2UUC Q;  1CKO A;  2OTL A;  4APV A;  1GM5 A;  3GTG H;  4P75 A;  2OCE A;  4A76 A;  1VQI A;  4YWK A;  3K7U C;  1HZ9 A;  2CCZ A;  3HOX G;  3T1Y Q;  4NPS A;  5GAD C;  3HOY H;  2N8N A;  4GS3 A;  1WCM H;  4B3S L;  2UXC Q;  3DM3 A;  3CC7 A;  2ZTC A;  1VQE A;  4YWM A;  1XTD A;  1L2F A;  2BA0 A;  1GVP A;  4JI7 L;  2B29 A;  1JT8 A;  3L2P A;  4DV6 Q;  4A3K G;  2YV5 A;  1IYJ B;  4A3E G;  1E24 A;  2VQF Q;  4JI1 Q;  1U0L A;  1Q7Y C;  4AH6 A;  3SGI A;  3F2B A;  2AHO B;  3BU2 A;  1C9O A;  2D62 A;  4JBJ A;  5AJ3 Q;  3E9I A;  1YJW A;  1B7Y B;  1KRS A;  4KHP Q;  1XPR A;  1I3Q H;  3G6E A;  2NVT H;  4K0K Q;  4DR5 L;  3BZK A;  4GKJ Q;  2HIV A;  3KDF A;  1O7I A;  1V1Q A;  2ID0 A;  2ZM6 Q;  1K83 H;  4JI8 L;  1E1O A;  4DV1 Q;  1HR0 Q;  2R7Z G;  4DR1 L;  3S17 H;  4BY1 G;  4OX9 L;  1HNX Q;  3AQQ A;  1VQC A;  1AE2 A;  1H95 A;  4DUZ Q;  4MTN A;  1Q46 A;  5C0X J;  1N36 L;  2K14 A;  4DV7 L;  2WFW A;  1QZH A;  2B63 H;  1WOC A;  4IOA A;  1VQP A;  1PH3 A;  1EQQ A;  3GTO H;  5ELN A;  5IYC G;  1FJG L;  3T1H Q;  4JI4 Q;  1V9P A;  4A4I A;  3PUZ A;  3J7Z C;  4J15 A;  4DK3 C;  4OO1 G;  1N8R C;  1WI5 A;  1UE7 A;  1VS0 A;  2BA1 A;  3OTO L;  1UEB A;  4P73 A;  4DV5 L;  3CC2 A;  5M5W H;  4B3S Q;  4DAM A;  5H1S E;  4LUZ A;  4R4C A;  1IBL L;  5C0X G;  1XNQ Q;  1XMO L;  1V43 A;  2EXD A;  1PH7 A;  3J81 j;  4JI7 Q;  5JJK A;  2GN5 A;  4BBR H;  2R92 H;  3CCQ A;  3S1R H;  1X54 A;  3CCR A;  2OWO A;  4A3B H;  3JAM i;  1X65 A;  1E22 A;  4DV2 L;  2Q2I A;  4YHH Q;  3H3V I;  4IPG A;  1L0W A;  4DR2 L;  2PNH A;  1PHJ A;  1P16 A;  2UUB Q;  1NMF A;  1EIY B;  4TQU S;  2Q2U A;  4L5T A;  3KDF B;  5C4X G;  4B3R L;  3I4N H;  2AKW B;  5JEA G;  2K5H A;  4QJF A;  4JI0 Q;  3L7Z C;  2V1C C;  3W1G A;  3PO3 G;  4LFC Q;  3ER0 A;  5C3E H;  3G4S A;  2VL6 A;  4DK6 C;  3PF5 A;  2E2H H;  4DR3 Q;  1ASZ A;  4OON A;  4UP7 A;  2CFM A;  2ASB A;  1VQ8 A;  1KHI A;  1SE8 A;  1ASY A;  3J80 c;  4GKK Q;  5M3M H;  1PV4 A;  2JEB I;  2N49 A;  3FP9 A;  3HOX H;  4HIO A;  2WB1 E;  2F52 A;  1IBM L;  3KJO A;  1EFW A;  2AWN A;  1WYD A;  3H0G G;  5DLQ E;  3ZJY C;  4X65 L;  4A3I G;  1YBY A;  3K8A A;  1KL9 A;  5HGQ A;  2HIX A;  4DV5 Q;  5IP7 G;  4OXP A;  3TS2 A;  4WJ4 A;  3CCJ A;  2E5L Q;  1EWI A;  4L5R C;  2HHH Q;  3CMA A;  2CWA A;  3PUV A;  2Y0S E;  1GO3 E;  1VCI A;  4MNO A;  1YJ9 A;  4DR6 L;  3CP0 A;  4R1J A;  2NN6 G;  3TRZ A;  2MQH A;  1PFS A;  2F4V Q;  1HNZ Q;  2WAQ G;  4GN5 A;  3GDE A;  3NEN A;  4PG3 A;  5IYD G;  1VQA A;  2JA7 G;  2RCN A;  1S3O A;  3KOJ A;  1CSQ A;  4R4O A;  4LF6 Q;  1XMQ Q;  1G51 A;  2ZTD A;  1LTL A;  1W3S A;  4JYA Q;  1QVG A;  2XTI A;  3CC4 A;  3PUY A;  2OQ0 A;  3DLL A;  1YHQ A;  1EIF A;  1VQJ A;  5FJ8 G;  1CSP A;  2UXD Q;  3U50 C;  2JA6 H;  3G48 A;  2N3S A;  3GD7 A;  2IT1 A;  2MO1 A;  5BR8 L;  4LF9 L;  4LNQ A;  5GAE C;  3Q8D A;  2ZTE A;  1PVO A;  1N32 Q;  2A19 A;  2MFI A;  3S15 H;  1PYS B;  1Z47 A;  2RF4 A;  3TQY A;  2KCM A;  1YHA A;  4QGU A;  2VQE Q;  4OO1 I;  2JA5 H;  1Y1W G;  2VUM G;  1DGS A;  1VQF A;  2K5V A;  1CKM A;  3FHW A;  5EAY A;  4GN3 B;  4A75 A;  2IHE A;  4IFD G;  2I5L X;  1PH8 A;  3CCS A;  2KHI A;  5M3F G;  1NJI C;  4QIW E;  5LMN L;  3W5O A;  4LF4 L;  3UE1 A;  1VQ7 A;  4IOC A;  3VDY A;  1YJN A;  5LMU L;  1L1O C;  2VNU D;  4C3I H;  2CWP A;  2ZJR A;  3EIV A;  2D0P A;  1FVI A;  5J3B A;  2R7D A;  4JI2 L;  2RHS B;  3HKZ E;  2R93 H;  2KEN A;  1Y14 B;  1NTG A;  1VQ9 A;  2IHF A;  3B6Y A;  5FLM G;  3STB C;  1KC8 C;  4JV5 Q;  1X9N A;  4QY7 A;  3CW2 C;  1A62 A;  1KD1 C;  4DR4 L;  4H02 A;  2K75 A;  1Q1B A;  4X62 Q;  2UXB Q;  3CPF A;  4YCW A;  5IYB G;  3GTL H;  1IZ6 A;  3MXN B;  2YTX A;  1GD7 A;  4X66 L;  3CCL A;  1VQ5 A;  4NXN Q;  2PI2 E;  1BBW A;  1R9T H;  3PO2 H;  4DR7 Q;  4LF7 Q;  4JI5 Q;  3JAM c;  2KBN A;  1C0A A;  1Y1V G;  1YZ6 A;  1K73 C;  3HOV H;  3UDI A;  3S16 H;  2VW9 A;  3CME A;  2LSS A;  1VQO A;  1YIJ A;  4LF8 Q;  3UDX A;  4BXX G;  5IT9 c;  1N33 L;  3S2H H;  1I94 L;  3UDF A;  2FXQ A;  2UUA L;  1IBK L;  4DV4 L;  1KXL A;  3E9H A;  1SN8 A;  4PZ7 A;  4AQY Q;  1KIX A;  4DV0 L;  1XNR L;  4A3D H;  3KF8 B;  2RHQ B;  3HKS A;  1SFO H;  4HIK A;  1VQ4 A;  2NVQ H;  5LMN Q;  4R4Q A;  2JQO A;  3ICE A;  4A3C H;  3KLW A;  2NN6 I;  4A3F G;  4A3G H;  1I50 H;  1PH5 A;  1Z9F A;  3NEL A;  1VQB A;  1Q86 C;  5IP9 H;  1PA6 A;  1L1O B;  1PH6 A;  3M4O H;  4A3L G;  3S1M H;  5IYD H;  4RMF A;  1YNX A;  2JE6 I;  3F8T A;  4GLX A;  1M90 C;  5IWA L;  2YYZ A;  4PZ8 A;  5IE8 A;  3OW2 A;  1KAW A;  1XJV A;  2ZJQ A;  4C3J H;  3I55 A;  3FKI H;  4IO9 A;  3RLN A;  2OQK A;  5C44 G;  4X64 L;  2WP8 J;  4O0A A;  4YCV A;  3J7A 5;  4BBS H;  1CKN B;  4BY7 H;  1HZB A;  3KJP A;  3I4M H;  1HNW L;  3HOZ H;  3ERS X;  1LM0 A;  1OXV A;  4GLV B;  4L5Q A;  1K9M C;  3H3V H;  3STB D;  2ATW A;  4JI6 L;  3M7N A;  1OXX K;  3K80 C;  2NZH A;  3HFZ B;  4ALP A;  4A93 G;  4DR5 Q;  1I94 Q;  4JI8 Q;  1B8A A;  2C35 B;  4DR1 Q;  1K8G A;  4IFD I;  4OX9 Q;  3HOW H;  1IBK Q;  3AYH B;  3WWV A;  2ES2 A;  2YU9 H;  1J6Q A;  3GTQ H;  4POG A;  5M3F H;  1N36 Q;  4JCV E;  4DV7 Q;  2K50 A;  2JEA I;  1TWH H;  1UE1 A;  3F2C A;  1G29 1;  4WJ3 M;  1VQL A;  4JBM A;  1SMX A;  2VZA A;  3G71 A;  1XPU A;  1EYG A;  1KRT A;  1FJG Q;  1J5E L;  3HOY G;  2AMC B;  1N34 L; 
#chains in the Genus database with same CATH topology
 1D7Q A;  3NBH B;  3J81 i;  4WJW A;  1IBL Q;  4OWT B;  1XMO Q;  1G91 A;  5KYL A;  4JBW A;  4ODG A;  4U68 A;  5EKK A;  1YIT A;  1IW7 C;  5FO9 B;  2Z6K C;  4YY3 L;  4EQO A;  5A2Q L;  4HJ7 A;  4RCO A;  1Q8K A;  4B3R Q;  3DMU A;  1TWC H;  4BY1 H;  3AU7 A;  4N8X 1;  4QMG A;  3K5L A;  4GNX C;  2X69 A;  4RGT A;  1Y69 U;  2B63 G;  4K5X A;  4KI0 A;  3F2D A;  1I4X A;  3T1Y L;  5KEE A;  5C4Z A;  5IGE A;  2PQA B;  5IYC H;  3EJI A;  4O2D A;  2UXC L;  2QCP X;  4UAI A;  3A74 A;  1JWS D;  4XIG S;  4HJ5 A;  2VB2 X;  4GZY C;  1U5K A;  3I3C A;  4LF5 Q;  2JA6 B;  1SRU A;  1VQ6 A;  1TR5 A;  1K0R A;  4MZ9 A;  1BKB A;  5CYU A;  4DR6 Q;  2EYJ A;  3MA2 B;  3GO5 A;  4NXM Q;  4C1N K;  5E3F A;  4LFB Q;  1L1O A;  4GOP C;  2E75 C;  1I4Q A;  4DV1 L;  5M5Y H;  4ZKC B;  4DV3 L;  1KNA A;  1DOK A;  3EVQ A;  5C3E G;  4DUY Q;  1LTS D;  3RZD H;  3TRE A;  2ZJP A;  4DUZ L;  2KA7 A;  3LGJ A;  1IW7 D;  2A1A A;  4FXG C;  4KHZ A;  4B3M Q;  5BR8 Q;  2IW3 A;  3ZYY X;  4EX5 A;  5M3M G;  3KF6 B;  4JI4 L;  2QIL A;  1JE4 A;  2E2I H;  2RVL A;  2K52 A;  3RMH A;  1X56 A;  5T1G A;  3CCU A;  1XYI A;  2L0C A;  2WB1 B;  1UAP A;  3Q22 A;  1X6O A;  1EQV A;  1SYG A;  1KDA A;  4PMC A;  3BVG A;  3S24 A;  3J7Y W;  1F9Q A;  4IUN A;  4LAA A;  4A3J H;  3V96 A;  3M4Y A;  2B3G A;  1A3V A;  2LXJ A;  2F3I A;  3K7A H;  2UUB L;  3AEV A;  3S16 B;  1JIC A;  2B2T C;  1O7L A;  1JQY D;  1T5E A;  3DUZ A;  1P8L A;  1PFM A;  2PMZ E;  3S1N H;  1UWV A;  4JI0 L;  3IRB A;  1GHK A;  1QUQ A;  1Q12 A;  4DR4 Q;  3BJU A;  4TVA B;  4A3D B;  2XRS D;  4DR3 L;  1IL2 A;  1QVC A;  1D8L A;  3VYS A;  2NWG A;  2HUG A;  3K57 A;  3CD6 A;  4IUQ A;  3M4P A;  4KK7 A;  1JOQ A;  4JC0 A;  2JA5 G;  4HED A;  3SK8 A;  1VQH A;  2K28 A;  3OWF A;  3A5U A;  1LO5 D;  1LYL A;  4X3U A;  2ICI A;  4C3J B;  3ND9 A;  4IQZ A;  3I72 A;  1DYQ A;  2HHH L;  3NP8 A;  1JOR A;  3PCO B;  3D4D A;  2CQO A;  4YWL A;  3I4M B;  4C3I G;  2D0O A;  3KBG A;  3T56 B;  3MFG A;  4Y52 H;  5CV6 A;  1JJC B;  4TSS A;  4F8M A;  2F0I A;  1G6P A;  2R93 G;  1WTO A;  3BVZ A;  1RDP D;  4LF6 L;  1B3A A;  4JYA L;  1S40 A;  5FLM H;  4UDU C;  1X3E A;  3PF4 A;  2F0H A;  2BH2 A;  2F0G A;  2JN4 A;  3CAM A;  1V1P A;  5CV5 A;  3HG9 A;  2M9V A;  1VMC A;  3E6Z X;  2E76 C;  3J81 L;  4EQP A;  5FLX E;  1MD2 D;  2P5Z X;  1Y1V H;  1Y8O B;  4IPH A;  3NPP A;  1KLG D;  3PV0 A;  5HUR A;  1JE5 A;  1NR4 A;  3AB9 A;  3S2D B;  2UUC L;  1OO9 B;  1VMP A;  4HIM A;  3DEO A;  5GAH C;  5IGB A;  2Z6B A;  1BR9 A;  1U4L A;  2JXM B;  4A3G G;  4A3C G;  2TMP A;  3M3Y B;  3X3M A;  1OXT A;  3M9B A;  5I2X A;  1U4M A;  2MO0 A;  2QGQ A;  1PH4 A;  3ULL A;  1SLJ A;  1N34 Q;  4V0B A;  3N6R A;  3DWA A;  1A63 A;  2NVY B;  1S72 A;  3WOE A;  1BCP C;  3OMC A;  4BBS G;  3H94 A;  4NXN L;  4DF7 A;  4DR7 L;  2GVA A;  4JI5 L;  3I4O A;  3UDG A;  5AJ3 L;  3T51 B;  2RQX A;  1NBW A;  2F3V A;  4JI3 Q;  1EFI D;  3K0X A;  1EOT A;  4OIK A;  4Y7N B;  5K36 H;  3PGZ A;  4C3H H;  3K81 C;  5C4J H;  1TWF B;  3HOW G;  1AH9 A;  2QEJ C;  2KOL A;  1Q8I A;  4CJ2 C;  3C46 A;  4K8J A;  1GM5 A;  3P7J A;  2OCE A;  1VQI A;  2EYP A;  2IX3 A;  1HUN A;  1CI3 M;  3NUC A;  4NPS A;  1CZW A;  5IIF A;  4X3T A;  2EE1 A;  1WCM H;  5IGC A;  1SYC A;  3DM3 A;  3TBI B;  2B2V A;  4O42 A;  4JW0 A;  1DCZ A;  3CQZ B;  3L2P A;  4DV6 Q;  3IKJ A;  1D1K A;  2XWJ B;  3EFX D;  3SGI A;  1G6Z A;  3BDC A;  5CBA E;  1C9O A;  1TY0 A;  1TU2 B;  1I3Q H;  1H9J A;  3SHL A;  3BZK A;  4GKJ Q;  3KDF A;  1V1Q A;  3X3N A;  1TWA B;  3S17 H;  1BCP D;  1XX8 A;  4BY1 G;  4ZQ3 A;  3AQQ A;  3URY A;  2KJX A;  1VQC A;  2K32 A;  5C0X J;  1Q46 A;  1N36 L;  2QW7 A;  1I50 B;  2RCF A;  5IYC G;  3T1H Q;  2EJG C;  1BO0 A;  2KHS A;  3S1M B;  4R8N A;  1K8O A;  3J7Z C;  2MGS A;  5C3X A;  1N8R C;  4DV5 L;  1UEB A;  4P73 A;  4B3S Q;  4DAM A;  4G4K A;  1SBB B;  4R4C A;  1IBL L;  1PLF A;  3Q23 A;  1XMO L;  1V43 A;  2EXD A;  4JI7 Q;  4BBR H;  4A3B H;  2OWO A;  4JK1 C;  4KHV A;  2EYF A;  4YHH Q;  1I4G A;  1EY7 A;  1PHJ A;  1RD9 D;  4B3R L;  4QJF A;  2SNM A;  2FMM A;  4LFC Q;  3G4S A;  1ZYR C;  2FFK B;  2VL6 A;  4CDF C;  3D8G A;  3PF5 A;  2ZT9 C;  1KHI A;  5EJW A;  1ASY A;  3NWS A;  1CK1 A;  5CMD A;  1AZQ A;  3FP9 A;  2WB1 E;  3W2D A;  3BDO A;  3GP7 A;  1VDZ A;  1EFW A;  3MTS A;  1S5F D;  5BN5 A;  5HGQ A;  3K8A A;  1DOM A;  5LL6 S;  1ICF B;  3ERQ A;  3F2U A;  2CWA A;  2TSS A;  1YJ9 A;  4DR6 L;  2NN6 G;  5I9P A;  2A6H C;  1HNZ Q;  2WAQ G;  2IPK D;  1S3O A;  4NDX A;  1XMQ Q;  2ZTD A;  5EGT A;  1K0S A;  1YHQ A;  3H91 A;  2PZW A;  3NXW A;  2F0F A;  3SDZ A;  3MXN A;  2NYZ D;  3GD7 A;  1F2Z A;  2RDF A;  2CHB D;  1IL8 A;  1K28 A;  1PTO H;  2MO1 A;  5BR8 L;  5GAE C;  1AEX A;  4G7Z C;  4A3F B;  1PYW D;  1PMR A;  1PVO A;  2NTS A;  5KGU A;  1W6J A;  3LNN A;  4QGU A;  4B9X A;  1KNE A;  5ELD A;  3TME A;  1KDB A;  1Y8N B;  4KJO A;  1CKM A;  1SMY C;  1ZYR D;  3FHW A;  3K6O A;  5M3F G;  1ET6 A;  1HCZ A;  5FKA C;  2PW5 A;  3VYT A;  1NJI C;  5LMN L;  3KF8 A;  1VQ7 A;  1SE4 A;  2SEB D;  3T13 A;  2VNU D;  1L1O C;  2CWP A;  2G9H D;  3D6W A;  1FVI A;  3A8K E;  5J3B A;  2RHS B;  1Y14 B;  1SYB A;  5FLM G;  4JV5 Q;  1X9N A;  3CW2 C;  4DR4 L;  1PZI D;  4H02 A;  4PMB A;  4F88 A;  1JOO A;  1C48 A;  3CPF A;  3GTL H;  1IZ6 A;  5D14 A;  1CM9 A;  3PO2 H;  2PI2 E;  1BBW A;  1R9T H;  4LF7 Q;  1RKN A;  3JAM c;  3GTJ B;  1Y1V G;  5IOD A;  3HOY B;  4LF8 Q;  3CKI B;  1RJT A;  1SYD A;  1M4V A;  1CQF A;  3VR2 A;  3FMC A;  5EKL A;  4HIK A;  5T1I A;  3K59 A;  1VQ4 A;  2NVQ H;  5EBC A;  1RTO A;  4ABN A;  2O4X A;  1Z9F A;  1SAP A;  2GA4 B;  5ELE A;  5G3L F;  3M4O H;  1PH6 A;  4M8A A;  4RMF A;  2JE6 I;  4GLX A;  4PZ8 A;  3SEB A;  2I07 B;  1NUC A;  4KN7 C;  4WRD A;  3FKI H;  1PRT F;  4Z9C B;  2B63 B;  2PCF B;  3KJP A;  3S14 B;  1NSN S;  3ERS X;  4FF2 A;  1GUO A;  4XDX A;  3M7N A;  4DNR B;  1OXX K;  4C3H G;  1JOK A;  4DR5 Q;  2KCC A;  4JI8 Q;  1B8A A;  4DR1 Q;  4CDD C;  1IBK Q;  2E2J B;  1J6Q A;  3GTQ H;  2B39 A;  5JVG 3;  2K50 A;  1UE1 A;  4WJ3 M;  1KRT A;  2RA4 A;  3SK4 A;  2AMC B;  1N34 L;  1HZA A;  2CQA A;  4DPG A;  5GAG C;  3OTO Q;  3PUW A;  1PH2 A;  3I90 A;  4FP5 D;  5C3E B;  1GKH A;  2J0T D;  5C5M A;  1Q1E A;  1MHW C;  1PTO C;  3W1B A;  2F0L A;  2Q8I B;  4UPA A;  2VY3 A;  2A69 C;  4A3K H;  1IKL A;  4A3E H;  5M3M B;  1PFB A;  4KY6 A;  4IUU A;  1HRJ A;  4DR2 Q;  1EY4 A;  5DM7 3;  1I5F A;  3E0J A;  1CUK A;  5D3I B;  2F0E A;  2NZO A;  3U9O A;  5LMN W;  4KY7 A;  2R7F A;  4LUO A;  1AE3 A;  3RN5 A;  2FJ2 A;  2XGT A;  3D0F A;  3TZU A;  1SXT A;  2NTT A;  2Z9H A;  1M1K C;  1PZJ D;  1A2U A;  1X55 A;  3KFU A;  3PUX A;  4ME3 A;  4EQ5 A;  3V05 A;  3FRP B;  4C56 C;  1BDO A;  1S5E D;  4JG2 A;  1IBM Q;  4OO1 H;  2QA4 A;  1IYU A;  1KDC A;  2OEO A;  4KD4 A;  1K3R A;  5C0X I;  4KKS A;  2A8V A;  3CCM A;  4BBR G;  4DV6 L;  4A3B G;  4OGQ C;  3H15 A;  1DON A;  3DM1 A;  3S15 B;  3GTP B;  1QNK A;  1PYB A;  2JA5 B;  5GRO A;  1VQK A;  5KNB A;  4DAP A;  3LX0 A;  1PTO D;  5JEA H;  2BH8 A;  4P74 A;  5IOC A;  2F0S A;  2A69 D;  4A3M G;  4UP8 A;  1RL2 A;  4N8F A;  3JC6 6;  3F1Z A;  3PSI A;  1LT6 D;  4C3I B;  4GNX B;  3D4W A;  3G6J B;  2FIN B;  3T1H L;  1A15 A;  3U58 A;  5C6A A;  3BZD B;  2R93 B;  3L3O C;  4K2K A;  2EY1 A;  2B2V C;  1B9N A;  2HCI A;  3BS1 A;  3NQI A;  2UU9 Q;  2Q8T A;  4MTK A;  4DK1 A;  4H7B A;  1SDF A;  4LF4 Q;  2K01 A;  4YHH L;  3SK6 A;  1H9M A;  5LMU Q;  3C1E A;  2O2L D;  3S2H B;  2ENB A;  2JA7 H;  1UE5 A;  4GOP B;  1LAB A;  3RZO H;  1OTC A;  4LFC L;  1EQR A;  1K3B C;  3J81 c;  1SFO B;  1B50 A;  1HH2 P;  2O5J C;  4X66 Q;  1C4Q A;  1HA5 A;  4A3G B;  4HTH A;  1R4Q B;  2JA8 G;  1BVS A;  1WTV A;  4J1M A;  2PI2 A;  5IT9 E;  3KYH C;  3SR1 A;  3OPO A;  3L9A X;  3T16 A;  1Y1W H;  1N33 Q;  4R9W A;  2VUM H;  2UUA Q;  1STG A;  4RCN A;  1QNU A;  4ZUI A;  2K4K A;  1XNR Q;  4BBS B;  3ITP A;  2XWB B;  4LW1 A;  1HNZ L;  3K0Y A;  1AFP A;  1HA6 A;  3M4Q A;  1GHJ A;  4RAU C;  5M5X H;  1XMQ L;  3RR5 A;  3HOU H;  3I73 A;  1WTP A;  1Q90 A;  4LFA L;  3HOW B;  1JWU D;  2A68 C;  4O1N A;  5IWA Q;  2YU9 B;  2E2H B;  1E0B A;  2JYO A;  1SRO A;  3QOJ A;  1ZKO A;  1EUJ A;  3PO2 G;  1YHB A;  1E2W A;  2KCT A;  2NBF A;  4JBK A;  4IJL A;  2Y0S G;  2WV6 D;  2YTY A;  5J39 A;  4K5V A;  1WTR A;  4DAY A;  4YIJ A;  3ULJ A;  4JI6 Q;  1F2Y A;  4OWX B;  2AQ3 B;  4J6H A;  2EYL A;  4JOI A;  3AFP A;  1O7Z A;  3TS0 A;  1PH1 A;  1EY9 A;  3TP7 A;  3SVM A;  4BS9 A;  2XVS A;  3TP6 A;  1VQM A;  1UE6 A;  4IAL A;  5CR3 A;  1LT3 D;  2OF1 A;  2BE5 C;  4WFN 3;  4H0L C;  3VR3 A;  2HT1 A;  2MJ8 A;  3J7A V;  3PIP A;  4DK0 A;  2LFN A;  4JV5 L;  1JB7 A;  1SNM A;  2IX1 A;  2Z0S A;  3R3O A;  4BY1 B;  1EY0 A;  3FKI G;  1NE3 A;  3J80 i;  1LTB D;  1JB3 A;  4IPC A;  4LF7 L;  5KRU A;  2OTJ A;  3EBE A;  4B3T Q;  3BVM A;  1KAB A;  2QDB A;  4LF8 L;  1NAP A;  2ZM6 L;  2A68 D;  4A93 H;  3MEH A;  2O5I C;  2GVB A;  2HD3 A;  3ND8 A;  3PIO A;  1STA A;  4FVM A;  1U9R A;  4P75 A;  3DXJ C;  2R3Z A;  1G2T A;  4YWK A;  3K5O A;  3HOX G;  5M5Y B;  2N8N A;  4GS3 A;  1EYA A;  2EY2 A;  3QR8 A;  3RZD B;  1H9K A;  1GVP A;  1LTI D;  2B29 A;  1JT8 A;  4ILW A;  4A3K G;  2YV5 A;  4A3E G;  1TY2 A;  4JI1 Q;  3FPU B;  2NUC A;  2E2I B;  2BE5 D;  3BU2 A;  4KMU C;  2RKS A;  1YJW A;  3G6E A;  4K0K Q;  4DR5 L;  1O7I A;  1K83 H;  3BG3 A;  4JI8 L;  1HR0 Q;  4DR1 L;  3A7A B;  1HNX Q;  4ZK9 B;  1AE2 A;  2KQ3 A;  3W3A A;  4RA8 A;  2XSC A;  5ELF A;  3K7A B;  4I7A A;  4DN4 M;  1EWC A;  2WAQ B;  2L5T A;  1V9P A;  5CBE E;  3VA7 A;  3PUZ A;  5C5L A;  1PZK D;  4J15 A;  1W6K A;  3S1N B;  4OO1 G;  3FPP A;  3D4R A;  5CC4 A;  3OTO L;  3CC2 A;  3VR4 A;  5M5W H;  2A6E C;  1PFN A;  4LUZ A;  5H1S E;  1MSG A;  1YNN C;  1XNQ Q;  3J81 j;  4CDE C;  2R92 H;  3CCR A;  1Z7T A;  1QCB D;  1X65 A;  2Q2I A;  1CZG A;  4CJ0 B;  2D2C C;  4DR2 L;  1PXU A;  1P16 A;  1S5C D;  1SSO A;  4OEL B;  3I4N H;  5JEA G;  1G2S A;  4K5W A;  4RKB A;  3I70 A;  2EXZ A;  4K6L A;  5M3F B;  3OW7 A;  1ASZ A;  1UUP A;  4RGM A;  4CKC A;  2ASB A;  1WD0 A;  2N49 A;  4HIO A;  4XXE A;  4CKB A;  1IBM L;  1NCV A;  3DEP A;  5DLQ E;  3ZJY C;  5JPN C;  4IUV A;  4OIJ A;  3MC0 B;  3TS2 A;  2PQE A;  4OXP A;  2E5L Q;  3CMA A;  2A5H A;  1ENA A;  1FNU A;  1E2V A;  4R1J A;  1H9R A;  2L11 A;  1Y1V B;  2MQH A;  2F4V Q;  4RH6 A;  1GOZ A;  4GN5 A;  1SJE D;  3NEN A;  1VQA A;  2JA7 G;  2RCN A;  2A6E D;  2FHT A;  1CSQ A;  1ROD A;  4R4O A;  2F0Q A;  1G51 A;  2WKC A;  1LAC A;  1W3S A;  2XTI A;  2KVM A;  4LJZ C;  2UXD Q;  4HCE A;  5FO7 B;  3Q24 A;  4RGO S;  4LNQ A;  3Q8D A;  1TII D;  2ZTE A;  5E1F A;  2MFI A;  4CHT B;  3TQY A;  1YHA A;  2VQE Q;  2F0D A;  4HR7 B;  1Y1W G;  1FR3 A;  3J80 L;  2VUM G;  1DGS A;  2Z4I A;  1F9S A;  2JSO A;  4A75 A;  3CCS A;  4ZYS A;  5C3W A;  4LF4 L;  3UE1 A;  3A8J E;  2K5D A;  5LMU L;  3EIV A;  2D0P A;  1WTH A;  2R7D A;  4C3H B;  4DXF A;  1NTG A;  2F0U A;  4RHS A;  5C4J B;  3B6Y A;  1A62 A;  1GUN A;  1KD1 C;  2K75 A;  1Q1B A;  4X62 Q;  2UXB Q;  1EIH A;  4X66 L;  1A3T A;  1VQ5 A;  3HP3 A;  2HCC A;  3KBX A;  4DU9 A;  1YZ6 A;  3HOV H;  4DNT B;  3UDI A;  4ZAI A;  2VW9 A;  3CME A;  1VQO A;  3TZD A;  3UDX A;  1N33 L;  1I94 L;  1H9S B;  1TKW B;  1LTG D;  1SJH D;  2V4D A;  2EOT A;  2UUA L;  2LMC B;  2ICE C;  2F0T A;  4N9T A;  1KXL A;  1SNP A;  4PZ7 A;  4AQY Q;  4KKU A;  1XNR L;  2RHQ B;  2DNC A;  1K8M A;  2IJ0 A;  1AP0 A;  3ICE A;  1FNW A;  2NN6 I;  1I50 H;  1PH5 A;  3OHX C;  1I3Q B;  1Q86 C;  5IP9 H;  1L1O B;  2B2U A;  5ELC A;  3EA6 A;  1YNJ C;  4DA2 A;  2DY8 A;  3S1M H;  1YNX A;  3F8T A;  5IYD H;  1D2B A;  3S17 B;  1DD2 A;  1M90 C;  2FMC A;  5JPM C;  5IWA L;  2YYZ A;  5CGK A;  3HZX A;  1KAW A;  4P2C B;  4XQQ A;  2ZJQ A;  3N52 A;  1A2T A;  3JAM E;  3J7A 5;  4BY7 H;  1XWE A;  3GV6 A;  1HZB A;  3IFT A;  4GLV B;  1K9M C;  3H3V H;  2CVR A;  1A3U A;  4JI6 L;  3K80 C;  3GTM B;  3NK9 A;  4ALP A;  4A93 G;  3BYY B;  2C35 B;  1ENF A;  1K8G A;  4ULL A;  4RFB A;  1ILP A;  5IT9 L;  4BBR B;  2ES2 A;  1Y8P B;  4A3B B;  4POG A;  1TWH H;  1DXM A;  1F77 A;  4JBM A;  1SMX A;  2VZA A;  1EIG A;  3G71 A;  1XPU A;  1FJG Q;  2PZU A;  4L6T B;  3KLS X;  3SK5 A;  3FDT A;  2DUD A;  1UNS A;  1PTO F;  2AUJ D;  4GLA C;  3S1Q B;  1EY5 A;  2JA9 A;  4LF5 L;  1QUQ B;  4A3M B;  4AYB G;  1K8A C;  4A3J G;  1YEZ A;  4UY8 C;  2EYO A;  1TXY A;  5HY6 A;  2RDH A;  1M8A A;  3I2Z A;  4HJA A;  4NXM L;  4POF A;  4B3T L;  4LFB L;  1YVC A;  1S5B D;  1YNJ D;  3QWN A;  1HTP A;  2C5C A;  3GQB A;  2DGY A;  1HUM A;  4JOI C;  1IHZ A;  1EZ8 A;  1V8Q A;  4DUY L;  1CQV A;  3I7F A;  2R7Z H;  1NMG A;  1E7Z A;  1RIP A;  3D6C A;  1SR3 A;  1JWM D;  1Q82 C;  4XQJ A;  1WJJ A;  4B9W A;  4B3M L;  1B3Q A;  2XIW A;  1PDQ A;  1TWG H;  2WAQ E;  1N9W A;  5M9O A;  4ZLT F;  4G7O C;  1BNZ A;  4ZRZ A;  2JJQ A;  3E0E A;  5BN4 A;  1DZ1 A;  2VS1 A;  3G7L A;  2F0V A;  3P1H A;  4DKA C;  4A3L H;  1VQG A;  3CXC A;  3RN2 A;  4P71 A;  3K58 A;  1AW7 A;  5C0X H;  4PNY A;  2SDF A;  5EKI A;  2R92 G;  4U67 3;  1PTO B;  2R61 A;  3NE5 B;  3M7G A;  2JA8 B;  1MJC A;  3CRL C;  4HJ8 A;  1IXR A;  1PH9 A;  2B2Y A;  4C2M H;  3E3X A;  4HN7 A;  4K0K L;  3I4N G;  2BOS A;  3CU7 A;  5JOB A;  5C4X H;  1HR0 L;  1QE6 A;  2A74 C;  4X6A H;  1I6V C;  1HNX L;  1F2L A;  3PO3 H;  2H5X A;  3I4L A;  1MSH A;  4UP9 A;  1CTM A;  2Z8L A;  2A6H D;  2EJM A;  1CKN A;  1ZEQ X;  2DN8 A;  3NTK A;  4G57 A;  1STB A;  4ZCK A;  1BUV T;  1L0Y B;  1SYE A;  3GTJ H;  3I56 A;  3EN2 A;  1T9H A;  4RG1 A;  3U4V A;  3HS0 C;  3H0G H;  2ZXP A;  4A3I H;  1KQS A;  4YCU A;  5DM6 3;  4FXD A;  1XNQ L;  5IP7 H;  3GTL B;  2F0K A;  4CBV A;  2EQS A;  2L15 A;  1YI2 A;  1R9T B;  3H3V C;  4XT1 B;  3PO2 B;  5KYI A;  4ZUJ A;  2Y0S B;  3VR5 A;  3AFQ A;  2Z1C A;  1JMC A;  1SMY D;  2ZXO A;  2H1E A;  2L9H A;  2NVX H;  1FL0 A;  4P72 A;  1MKH A;  3GTK H;  3NBH A;  4FF1 A;  4M1U B;  4DV3 Q;  1QG7 A;  1OXU A;  2NVQ B;  5I6W A;  4S3S A;  4HSP A;  3K5M A;  2F0J A;  1HZC A;  2E8G A;  3M4O B;  5K36 G;  2QKI C;  3S14 H;  2HDM A;  2YTV A;  2QDL A;  2VXW A;  4DGZ A;  2E5L L;  1EWH A;  2K05 A;  5A35 A;  3FKI B;  5JEA J;  4IFD H;  3P20 A;  2HDL A;  5FOB B;  4PQX A;  1HQR D;  2E2J H;  1WVL A;  4QIW B;  1MJE A;  2F4V L;  5COR A;  1D6E C;  2PQA A;  1G8Z D;  1WCM G;  1D1I A;  3SXH A;  4R4T A;  5I2Y A;  1I4P A;  1E3P A;  3UE0 A;  5IY0 A;  1QIL A;  2UXD L;  1NY4 A;  3CCE A;  2JK8 A;  1JC7 A;  3VR6 A;  4L8J A;  2M2L A;  1GJX A;  4HJ9 A;  1E1T A;  1S4Z A;  4HCS A;  4X64 Q;  2K03 A;  3A5Z B;  2F0O A;  2N55 A;  3HOX B;  1W2B A;  3HOV G;  4JI3 L;  4QQB X;  1FGB D;  4QL5 A;  1HNW Q;  2VQE L;  1I6H H;  4ME5 A;  1QJO A;  5FLX L;  3U4Z A;  4IUR A;  3NTH A;  4A3K B;  4A3E B;  1VQD A;  2I5M X;  3BDL A;  2EPB A;  4I7Z C;  3KF6 A;  1HR0 W;  4BA2 I;  1TT2 A;  4JVZ A;  5IP9 G;  2ZXR A;  5LHY 1;  3IAY A;  2F4I A;  5L37 A;  3TN2 A;  2CKZ B;  4L63 B;  3GV3 A;  3NEM A;  4X62 L;  2UXB L;  4IJH A;  1ESF A;  3KLS A;  4DAV A;  2IY5 B;  4X3S A;  4BY7 G;  4R4I A;  2N78 A;  2CH4 A;  5C44 H;  4KN4 C;  4NP5 A;  1X3G A;  1MIU A;  3I91 A;  3GTP H;  4GKJ L;  2LKV A;  3OYY A;  3BZC A;  3HKZ G;  4BA1 I;  4KKT A;  3TDQ A;  1FGU A;  3DWP A;  1HQM C;  3OSO A;  4AQY L;  2K04 A;  2UUC Q;  2OTL A;  3GTG H;  4APV A;  1B53 A;  2G9D A;  1EYC A;  1STH A;  1BOS A;  2G5D A;  4B3S L;  1O78 A;  1D5X C;  3H6M A;  3CC7 A;  2ZTC A;  1T5X D;  4YWM A;  1XTD A;  1L2F A;  3O13 A;  4JI7 L;  4FYD A;  1SNO A;  1IYJ B;  2VQF Q;  1U0L A;  4AH6 A;  2AHO B;  4K6D A;  2X6G A;  5E4W C;  4JBJ A;  5AJ3 Q;  3E9I A;  4XT3 B;  4KHP Q;  1KRS A;  1XPR A;  3MVV A;  2NVT H;  3CRK C;  3HOZ H;  2R7Z G;  1H95 A;  1ESR A;  1SNC A;  2WFW A;  2PNR C;  1VQP A;  3GTO H;  1EQQ A;  4IOA A;  3WOF A;  2B2U C;  1FJG L;  1GUS A;  1WTX A;  2JA7 B;  1UE7 A;  1VS0 A;  2A73 B;  5E4X A;  5IGG A;  5C0X G;  4CGY B;  2E2D C;  1ILQ A;  1F9R A;  1SNQ A;  1GUG A;  2BCO A;  1QWY A;  3S1R H;  1X54 A;  1E22 A;  4RGN A;  1PRT C;  2DY7 A;  2RSN A;  2PNH A;  1B9M A;  1UEA B;  3R93 A;  1NMF A;  2B8F A;  4TQU S;  1EIY B;  2Q2U A;  3OIP A;  1Y1W B;  5C4X G;  2VUM B;  2AKW B;  3EQL C;  3PO3 G;  3E5S A;  3ER0 A;  4DK6 C;  2E2H H;  4UP7 A;  1VF7 A;  1VQ8 A;  1SE8 A;  1BBX C;  3J80 c;  4GKK Q;  5I4D A;  5D3D A;  4MHE A;  1PV4 A;  2JEB I;  4IZ8 A;  2RDG A;  3KJO A;  3WDN A;  3H0G G;  4V19 0;  4A3I G;  1KL9 A;  4DV5 Q;  5IP7 G;  4WJ4 A;  3CCJ A;  3I8Z A;  2EY6 A;  1HFG A;  2M00 A;  2Y0S E;  4MNO A;  1ICW A;  3CP0 A;  4X3K A;  3TRZ A;  3T4A C;  4PG3 A;  3GDE A;  1VF5 C;  5G3L D;  3OMG A;  3R2I A;  1LTR D;  3KOJ A;  1TWC B;  1L0X B;  3A8I E;  1BCP F;  2OQ0 A;  3DLL A;  1EIF A;  1VQJ A;  1CSP A;  1GUW A;  2PYK A;  1CT1 D;  3QG1 A;  2JA6 H;  1PRT D;  3G48 A;  2N3S A;  1XXG A;  3VA5 A;  1N32 Q;  1PYS B;  1Z47 A;  3QJY A;  2LS0 1;  2RF4 A;  4QB4 A;  4OO1 I;  1U4P A;  1B1Z A;  1VQF A;  2K5V A;  1H9S A;  4GN3 B;  2IHE A;  4IFD G;  4QCL A;  2H4O A;  3TP8 A;  4QIW E;  1XTC D;  2B2Y C;  3BYT B;  4IOC A;  1IYV A;  1DM0 B;  3VDY A;  1TQO A;  2HQE A;  2ZJR A;  2L12 A;  5K5P A;  1SE2 A;  4OEM B;  1VQ9 A;  4A93 B;  3LWE A;  1F2M A;  4LK1 C;  3STB C;  1KC8 C;  1B44 D;  4QY7 A;  4J8Q A;  4YCW A;  1GD7 A;  1J9O A;  4KV6 A;  4MIU A;  1BCP B;  4FO2 A;  2LY7 A;  4LMQ D;  2KBN A;  1C0A A;  1K73 C;  3S16 H;  1STE A;  3Q0A A;  1YIJ A;  2LSS A;  3MXG A;  5IT9 c;  3RD4 A;  1CFM A;  3UDF A;  2WAC A;  3MXU A;  1IBK L;  4AYB B;  3E9H A;  4A3J B;  1KIX A;  3IL8 A;  4A3D H;  3C2P A;  4EVO A;  5C4H A;  5LMN Q;  4R4Q A;  2K33 A;  3S9W A;  3KLW A;  2XNA C;  3FVQ A;  2NN6 H;  3NEL A;  4TRD A;  2WIN B;  1PA6 A;  2L1B A;  1ET9 A;  1K83 B;  3MFY A;  1XJV A;  4C3J H;  3I55 A;  1EEF D;  3MHB A;  2OQK A;  2F0P A;  4X64 L;  2WP8 J;  4O0A A;  5C44 G;  5ISR A;  3I4M H;  2PPB C;  1HNW L;  1LLR D;  3STB D;  2NZH A;  2MUY A;  5M5W B;  1RCV D;  1LTT D;  1IKM A;  4WOR A;  4OX9 Q;  5EPK A;  3AYH B;  3WWV A;  2R92 B;  4G7H C;  5M3F H;  3NHH A;  4DV7 Q;  2CH4 W;  1VQL A;  2K6A A;  3I4N B;  5JVH 3;  5KIX A;  1D5Z C;  2CW0 C;  2RBM A;  1A0I A;  4QUC A;  4DXG A;  2MPM A;  3PQI A;  3NQT A;  3S2D H;  1NR2 A;  1HHV A;  2IX0 A;  2F0W A;  1STY A;  1MI2 A;  1AZP A;  3QIA A;  1QVF A;  2PO4 A;  4DNI A;  4DV2 Q;  3M3Y H;  4LUV A;  4KJN A;  3M85 A;  3HOZ G;  1YNN D;  4E6I A;  3K5N A;  1RTN A;  2XN9 C;  3HGB A;  4LWC A;  5EQ0 A;  4EGV A;  1X3Q A;  1QB5 D;  2AWO A;  2NVY H;  3DHQ A;  3QOL A;  5FK9 C;  1QZG A;  3MXP A;  3MEF A;  1FD7 D;  2D9U A;  1CHQ D;  1ONL A;  1EY8 A;  3MWY W;  4Y7N H;  1EZ6 A;  4X65 Q;  1B2T A;  2MNA A;  1EY6 A;  1TWF H;  1B4O A;  2UU9 L;  1EQT A;  1O80 A;  1ML0 D;  1II3 A;  2VQF L;  1TVX A;  1C8C A;  4NB3 A;  1X3P A;  4K8I A;  1KAA A;  5CV7 A;  3RNU A;  4C1N I;  3HRZ C;  5CV4 A;  1J8I A;  2CW0 D;  3CPW A;  1R4P B;  2PW7 A;  4DAY B;  4KHP L;  5FO8 B;  3HOU G;  1WTW A;  2ALY B;  4HMJ A;  2QEX A;  3DWQ A;  3RLF A;  4AIM A;  3D31 A;  4ZKB B;  1ZXT A;  4UHV A;  2HQL A;  3CQZ H;  1WFQ A;  2K5N A;  5COY A;  5NUC A;  4LF9 Q;  1EEI D;  2Q2T A;  4IN3 A;  3A0J A;  4PMW A;  1WCM B;  2K7V A;  3OIQ A;  1Q81 C;  4CJ1 B;  1X3F A;  3A7L A;  3T53 B;  1LTA D;  4QUF A;  3MZ5 A;  5EPJ A;  1TWA H;  2R6G A;  2E74 C;  5JJI A;  1X32 A;  4ID6 A;  1EOV A;  3OOC A;  3J7A F;  2B8G A;  4MN3 A;  2AQ2 B;  4RKL A;  1WTQ A;  1OXS C;  3HOV B;  4IPD A;  2I5H A;  4F87 A;  2EYH A;  1JJG A;  1F9P A;  4JI2 Q;  1JR0 D;  2X6L A;  3C1F A;  1HPC A;  1B70 B;  1JCK B;  2IWH A;  5FJ8 H;  2EIF A;  2K5Q A;  1BBU A;  2JA6 G;  1LT4 D;  4GKK L;  5EPL A;  1EL0 A;  4HAE A;  2BDO A;  4Q5V A;  2J7Z A;  5FLX c;  3CCV A;  4FDB A;  1KTK A;  1LUZ A;  1JJ2 A;  3GTM H;  1GXD C;  1FYC A;  4K14 A;  2KCN A;  2DNE A;  2L4N A;  4DV4 Q;  3U9S A;  4DV0 Q;  2Q2H A;  4BY7 B;  1TS3 A;  1CA5 A;  1XPO A;  4OWW B;  4IUP A;  5GQO A;  2EJF C;  2KHJ A;  2OT2 A;  3RUZ A;  2NB0 A;  5E7N A;  3RLO A;  2I0Q A;  1ENC A;  2B2W A;  2WB1 G;  3HKZ B;  4L5S A;  3S1Q H;  1FNV A;  3TEH B;  5A2Q E;  4A3M H;  1RF2 D;  5IYB H;  1C7Y A;  4BWG B;  2MHV A;  1TWH B;  4KLK A;  1VQN A;  1I4R A;  5KNC A;  4GN4 B;  1N32 L;  2SOB A;  1E2Z A;  4PZ6 A;  2Z6K A;  2AQ1 B;  1TS5 A;  4BXX H;  4KY5 A;  1RHP A;  2EY5 A;  4HMI A;  4AYB E;  4F7X A;  1A6X A;  5ELB A;  3CF5 A;  4A3D G;  1A8V A;  3L0O A;  5ELO A;  3UI2 A;  4XTC S;  3C3L A;  2MP1 A;  2LXK A;  1HFN A;  4GNX A;  4A3F H;  2SNS A;  1HJP A;  1J5E Q;  1EU3 A;  4HID A;  3TP5 A;  4I65 A;  1BF4 A;  2R7Z B;  4LFA Q;  1V1P B;  3NTI A;  4C3J G;  3KK7 A;  2OXP A;  4JI1 L;  4IFD J;  1TWG B;  4JPB W;  5F2D A;  3I4M G;  1NNX A;  4HSV A;  1MBY A;  2JA8 H;  4IUT A;  3ULP A;  3ONA B;  4YY3 Q;  1SYF A;  3D3R A;  2D5D A;  2K5W A;  5JJL A;  4GOP A;  5TSS A;  3V2T A;  5DEH A;  2Z4H A;  1CKO A;  2KED A;  4A76 A;  1Q3L A;  5I9O A;  4H44 C;  2I46 A;  3K7U C;  4NW2 A;  1HZ9 A;  2KEC A;  4NKL A;  2CCZ A;  3T1Y Q;  4C2M B;  2IL8 A;  1LV9 A;  5GAD C;  3HOY H;  2J4X A;  2UXC Q;  5C4X B;  1DJR D;  3TSS A;  4B08 A;  1HTL D;  1VQE A;  3PO3 B;  3QO2 A;  2BA0 A;  3P75 A;  3SE0 A;  1E24 A;  1Q7Y C;  3F2B A;  4DFA A;  2D62 A;  1EU4 A;  1B7Y B;  1CHP D;  3H0G B;  2HIV A;  2ZM6 Q;  4A3I B;  2ID0 A;  2B2T A;  4DV1 Q;  4KD3 A;  1E1O A;  2BDN A;  4OX9 L;  5KND A;  4XYO A;  4DUZ Q;  4MTN A;  4R8I A;  2N88 A;  2K14 A;  4CKE A;  4DV7 L;  4FF3 A;  1QZH A;  2B63 H;  1WOC A;  2F0M A;  1PH3 A;  2EDG A;  5ELN A;  4JI4 Q;  4A4I A;  5J22 A;  3VYU A;  5DNF A;  5IGD A;  2NVX B;  4DK3 C;  2L55 A;  1WI5 A;  3GTK B;  1SND A;  2BA1 A;  1HXY D;  3NBI A;  3NWT A;  3MAQ A;  1PH7 A;  2F03 A;  1MGS A;  5JJK A;  2GN5 A;  3CCQ A;  3JAM i;  5HGT A;  4DV2 L;  5IGF A;  3QB3 A;  3H3V I;  4IPG A;  1L0W A;  2UUB Q;  4K2L A;  4L5T A;  2WII B;  3KDF B;  1SEB D;  2K5H A;  4JI0 Q;  3L7Z C;  2V1C C;  5CV9 A;  3J81 E;  3W1G A;  1STN A;  5AFW A;  5C3E H;  3GTQ B;  1AN8 A;  4DR3 Q;  1TS2 A;  4OON A;  2CFM A;  2EZV A;  3KUP A;  1U4R A;  3PMF A;  3LWU A;  5M3M H;  2WKD A;  3KLR A;  3A55 A;  3HOX H;  2F52 A;  4RHR A;  2AWN A;  1WYD A;  4X65 L;  1YBY A;  2HIX A;  1O7Y A;  1EWI A;  4L5R C;  2HHH Q;  3AMU A;  2RSO A;  3PUV A;  3VYR A;  5D65 A;  4N9P A;  1GO3 E;  1VCI A;  4FXK C;  3Q6S A;  2JP1 A;  1QOH A;  1LT5 D;  5I6Y A;  1PFS A;  1I4H A;  1V1O A;  5IYD G;  1PRT B;  1I6H B;  4LF6 Q;  3CHB D;  1LTL A;  4JYA Q;  2PMZ B;  1QVG A;  3ERO A;  3PUY A;  3CC4 A;  5FJ8 G;  4NMZ A;  3U50 C;  3J80 E;  2IT1 A;  4LF9 L;  2F0N A;  2KUM A;  2A19 A;  3S15 H;  4CDC C;  2KCM A;  2PZT A;  2DJF C;  2JA5 H;  4H13 C;  4RWS C;  5EAY A;  1SE3 A;  2I5L X;  1PH8 A;  2F1M A;  2KHI A;  3R8B A;  4OHJ A;  1BXT A;  5LL6 X;  3W5O A;  5C44 B;  4KTA A;  1YJN A;  4C3I H;  3FEW X;  2XRQ D;  2DJG C;  4JI2 L;  3HKZ E;  2AUK A;  2KEN A;  2NZ1 D;  2R93 H;  2IHF A;  2KEE A;  3PIP 3;  4EQN A;  3GTG B;  5IYB G;  3MXN B;  2YTX A;  3CCL A;  4NXN Q;  4DR7 Q;  1EYD A;  1CA6 A;  4XYQ A;  4JI5 Q;  5BN3 A;  2EYM A;  3HEJ A;  4BXX G;  1KLU D;  3S2H H;  5JJZ A;  5CV8 A;  2FXQ A;  1Z6H A;  4DV4 L;  1SN8 A;  4DV0 L;  4Q0F A;  3KF8 B;  3HKS A;  1SFO H;  3PIO 3;  4OL7 A;  1DOL A;  4FF4 A;  2VB3 X;  2JQO A;  4A3C H;  2QF7 A;  4A3F G;  4A3G H;  2NVT B;  1VQB A;  4XQN A;  4A3L G;  3HOZ B;  4QF4 A;  3RZO B;  2C9O A;  2F3W A;  1D5M C;  3A54 A;  5IE8 A;  3OW2 A;  1BQQ T;  1GUT A;  3H09 A;  1WD1 A;  4IO9 A;  3RLN A;  2Q8R E;  5J1Z A;  3GTO B;  4BBS H;  2K1B A;  4FNF A;  4YCV A;  1CKN B;  3A56 A;  1OXV A;  1LM0 A;  4L5Q A;  2ATW A;  2EVB A;  3HFZ B;  1S5D D;  3JAM L;  3OWE B;  1I94 Q;  4TKO B;  4IFD I;  3HOW H;  5DAU A;  3NSW A;  4PV1 C;  2YU9 H;  3IFD A;  5JAV A;  1TS4 A;  3S1R B;  1N36 Q;  5EBD A;  4JCV E;  2JEA I;  3F2C A;  1G29 1;  1EYG A;  1J5E L;  5M5X B;  2B2W C;  3HOY G;  3R2T A;  3HOU B; 
#chains in the Genus database with same CATH homology
 2DUD A;  1HZA A;  1D7Q A;  1A0I A;  4GLA C;  4DPG A;  3NBH B;  5GAG C;  3OTO Q;  3PUW A;  1PH2 A;  3J81 i;  1GKH A;  2JA9 A;  4LF5 L;  1Q1E A;  1QUQ B;  1IBL Q;  4AYB G;  3S2D H;  4OWT B;  3W1B A;  2IX0 A;  1XMO Q;  1K8A C;  4JBW A;  4A3J G;  1YEZ A;  4UY8 C;  4UPA A;  1TXY A;  2VY3 A;  5HY6 A;  1YIT A;  4A3K H;  4A3E H;  3I2Z A;  4HJA A;  4NXM L;  4POF A;  4DNI A;  4DV2 Q;  4B3T L;  1QVF A;  2Z6K C;  3M3Y H;  4LFB L;  1YVC A;  4LUV A;  4YY3 L;  4DR2 Q;  1I5F A;  3M85 A;  4HJ7 A;  3HOZ G;  2DGY A;  1Q8K A;  1CUK A;  4B3R Q;  4JOI C;  2NZO A;  4DUY L;  5LMN W;  3I7F A;  4LUO A;  1TWC H;  2R7F A;  2R7Z H;  1AE3 A;  1NMG A;  1E7Z A;  1RIP A;  4LWC A;  3RN5 A;  1SR3 A;  4BY1 H;  2AWO A;  1Q82 C;  2NVY H;  1WJJ A;  4GNX C;  2XGT A;  3D0F A;  1QZG A;  4B3M L;  2B63 G;  4KI0 A;  3F2D A;  3MEF A;  1M1K C;  1TWG H;  2WAQ E;  1X55 A;  1N9W A;  3KFU A;  3PUX A;  3T1Y L;  4ME3 A;  5IYC H;  2PQA B;  4EQ5 A;  2JJQ A;  3E0E A;  4O2D A;  2UXC L;  2VS1 A;  4JG2 A;  4DKA C;  4Y7N H;  1IBM Q;  4A3L H;  3A74 A;  1VQG A;  2QA4 A;  4X65 Q;  3CXC A;  1K3R A;  4XIG S;  5C0X I;  4P71 A;  4HJ5 A;  2MNA A;  3RN2 A;  1TWF H;  1U5K A;  2UU9 L;  2A8V A;  4LF5 Q;  3CCM A;  4BBR G;  1SRU A;  1VQ6 A;  2R92 G;  4DV6 L;  4A3B G;  3H15 A;  2VQF L;  1K0R A;  4MZ9 A;  4NB3 A;  3RNU A;  1MJC A;  1BKB A;  4HJ8 A;  4DR6 Q;  3GO5 A;  1IXR A;  4NXM Q;  1PH9 A;  3CPW A;  4KHP L;  4DAY B;  4C2M H;  1PYB A;  4LFB Q;  1L1O A;  5GRO A;  4GOP C;  1VQK A;  3I4N G;  3HOU G;  4K0K L;  4DV1 L;  2ALY B;  5C4X H;  5M5Y H;  2QEX A;  3RLF A;  4DV3 L;  4AIM A;  3D31 A;  1HR0 L;  4X6A H;  1HNX L;  5C3E G;  4DUY Q;  2BH8 A;  4P74 A;  2H5X A;  4A3M G;  3PO3 H;  3RZD H;  4UP8 A;  4UP9 A;  3TRE A;  2ZJP A;  4DUZ L;  2HQL A;  1RL2 A;  3LGJ A;  3JC6 6;  2A1A A;  3F1Z A;  3CQZ H;  4KHZ A;  1WFQ A;  2K5N A;  3PSI A;  5BR8 Q;  4B3M Q;  4GNX B;  1CKN A;  4LF9 Q;  4EX5 A;  5M3M G;  3KF6 B;  3T1H L;  3U58 A;  2Q2T A;  4JI4 L;  2E2I H;  2K52 A;  3A0J A;  4PMW A;  1X56 A;  3GTJ H;  1Q81 C;  3I56 A;  3CCU A;  3EN2 A;  1T9H A;  4RG1 A;  3U4V A;  1X3F A;  3H0G H;  4A3I H;  1KQS A;  4YCU A;  1XNQ L;  5IP7 H;  1TWA H;  1X6O A;  2R6G A;  5JJI A;  2UU9 Q;  1EOV A;  2EQS A;  3S24 A;  2L15 A;  1YI2 A;  4A3J H;  2B3G A;  4LF4 Q;  2LXJ A;  2F3I A;  4YHH L;  3K7A H;  1OXS C;  2UUB L;  5LMU Q;  4IPD A;  3AEV A;  2I5H A;  3AFQ A;  1JJG A;  1JMC A;  4JI2 Q;  2NVX H;  2PMZ E;  1P8L A;  1FL0 A;  2JA7 H;  1UWV A;  4P72 A;  1MKH A;  1UE5 A;  4JI0 L;  4GOP B;  3GTK H;  3RZO H;  3S1N H;  1B70 B;  4LFC L;  1EQR A;  4DV3 Q;  3IRB A;  1OTC A;  1QUQ A;  1Q12 A;  4DR4 Q;  3BJU A;  4TVA B;  5FJ8 H;  3J81 c;  2EIF A;  1OXU A;  4DR3 L;  1BBU A;  2JA6 G;  1IL2 A;  1HH2 P;  1QVC A;  1D8L A;  4X66 Q;  4GKK L;  2JA8 G;  1BVS A;  1HZC A;  2E8G A;  2PI2 A;  3CD6 A;  3KYH C;  5K36 G;  3M4P A;  3S14 H;  5FLX c;  4JC0 A;  3CCV A;  2JA5 G;  4FDB A;  1LUZ A;  1VQH A;  2YTV A;  1Y1W H;  1JJ2 A;  1N33 Q;  2VUM H;  3GTM H;  3A5U A;  1LYL A;  2E5L L;  2UUA Q;  2HHH L;  5JEA J;  4DV4 Q;  3PCO B;  2K4K A;  4DV0 Q;  2Q2H A;  1XNR Q;  2CQO A;  2E2J H;  4YWL A;  1XPO A;  4OWW B;  4LW1 A;  2D0O A;  4Y52 H;  1MJE A;  2F4V L;  1HNZ L;  2PQA A;  1JJC B;  1G6P A;  5GQO A;  1WCM G;  3M4Q A;  2R93 G;  2KHJ A;  4R4T A;  4LF6 L;  5M5X H;  1XMQ L;  5E7N A;  3RLO A;  2I0Q A;  4JYA L;  2WB1 G;  3RR5 A;  1S40 A;  3HOU H;  1E3P A;  3UE0 A;  5IY0 A;  5FLM H;  4L5S A;  4LFA L;  1X3E A;  3PF4 A;  5IWA Q;  2BH2 A;  3S1Q H;  1NY4 A;  3CAM A;  2JK8 A;  3TEH B;  3CCE A;  2UXD L;  4A3M H;  1SRO A;  5IYB H;  1C7Y A;  1EUJ A;  3PO2 G;  4HJ9 A;  4KLK A;  1YHB A;  2KCT A;  4JBK A;  1E1T A;  4X64 Q;  1VQN A;  4IJL A;  4GN4 B;  2Y0S G;  3A5Z B;  1N32 L;  2YTY A;  1W2B A;  3HOV G;  4JI3 L;  4QQB X;  4QL5 A;  1HNW Q;  1Y1V H;  4PZ6 A;  2VQE L;  3ULJ A;  2Z6K A;  4IPH A;  4JI6 Q;  4BXX H;  4OWX B;  3PV0 A;  1I6H H;  4AYB E;  1JE5 A;  2UUC L;  4JOI A;  3U4Z A;  3AFP A;  3CF5 A;  3TS0 A;  4A3D G;  1A8V A;  3L0O A;  5ELO A;  4HIM A;  4XTC S;  1PH1 A;  1VQD A;  2I5M X;  2LXK A;  5GAH C;  4A3C G;  4GNX A;  4A3G G;  3KF6 A;  1HR0 W;  1OXT A;  4A3F H;  3M9B A;  1UE6 A;  5IP9 G;  1VQM A;  4BA2 I;  1HJP A;  1J5E Q;  2MO0 A;  2QGQ A;  1PH4 A;  3ULL A;  2HT1 A;  1SLJ A;  3PIP A;  4HID A;  1N34 Q;  4JV5 L;  1JB7 A;  2CKZ B;  2IX1 A;  2Z0S A;  1A63 A;  3NEM A;  4X62 L;  2UXB L;  4LFA Q;  4IJH A;  3FKI G;  1S72 A;  1NE3 A;  2IY5 B;  4JI1 L;  4IFD J;  4BBS G;  3J80 i;  4NXN L;  4DR7 L;  4BY7 G;  4R4I A;  2N78 A;  2GVA A;  4IPC A;  4JI5 L;  3I4O A;  5C44 H;  3UDG A;  4LF7 L;  1X3G A;  5AJ3 L;  3I4M G;  2OTJ A;  1NBW A;  3EBE A;  4B3T Q;  3ULP A;  2JA8 H;  1MIU A;  4LF8 L;  4YY3 Q;  4JI3 Q;  3K0X A;  3GTP H;  4GKJ L;  2ZM6 L;  3PGZ A;  4C3H H;  3OYY A;  3BZC A;  3HKZ G;  3K81 C;  4BA1 I;  5C4J H;  4GOP A;  4A93 H;  5JJL A;  3HOW G;  1AH9 A;  1FGU A;  2GVB A;  4AQY L;  3PIO A;  2UUC Q;  1CKO A;  2OTL A;  4APV A;  1GM5 A;  3GTG H;  4P75 A;  2OCE A;  4A76 A;  1VQI A;  4YWK A;  3K7U C;  1HZ9 A;  2CCZ A;  3HOX G;  3T1Y Q;  4NPS A;  5GAD C;  3HOY H;  2N8N A;  4GS3 A;  1WCM H;  4B3S L;  2UXC Q;  3DM3 A;  3CC7 A;  2ZTC A;  1VQE A;  4YWM A;  1XTD A;  1L2F A;  2BA0 A;  1GVP A;  4JI7 L;  2B29 A;  1JT8 A;  3L2P A;  4DV6 Q;  4A3K G;  2YV5 A;  1IYJ B;  4A3E G;  1E24 A;  2VQF Q;  4JI1 Q;  1U0L A;  1Q7Y C;  4AH6 A;  3SGI A;  3F2B A;  2AHO B;  3BU2 A;  1C9O A;  2D62 A;  4JBJ A;  5AJ3 Q;  3E9I A;  1YJW A;  1B7Y B;  1KRS A;  4KHP Q;  1XPR A;  1I3Q H;  3G6E A;  2NVT H;  4K0K Q;  4DR5 L;  3BZK A;  4GKJ Q;  2HIV A;  3KDF A;  1O7I A;  1V1Q A;  2ID0 A;  2ZM6 Q;  1K83 H;  4JI8 L;  1E1O A;  4DV1 Q;  1HR0 Q;  2R7Z G;  4DR1 L;  3S17 H;  4BY1 G;  4OX9 L;  1HNX Q;  3AQQ A;  1VQC A;  1AE2 A;  1H95 A;  4DUZ Q;  4MTN A;  1Q46 A;  5C0X J;  1N36 L;  2K14 A;  4DV7 L;  2WFW A;  1QZH A;  2B63 H;  1WOC A;  4IOA A;  1VQP A;  1PH3 A;  1EQQ A;  3GTO H;  5ELN A;  5IYC G;  1FJG L;  3T1H Q;  4JI4 Q;  1V9P A;  4A4I A;  3PUZ A;  3J7Z C;  4J15 A;  4DK3 C;  4OO1 G;  1N8R C;  1WI5 A;  1UE7 A;  1VS0 A;  2BA1 A;  3OTO L;  1UEB A;  4P73 A;  4DV5 L;  3CC2 A;  5M5W H;  4B3S Q;  4DAM A;  5H1S E;  4LUZ A;  4R4C A;  1IBL L;  5C0X G;  1XNQ Q;  1XMO L;  1V43 A;  2EXD A;  1PH7 A;  3J81 j;  4JI7 Q;  5JJK A;  2GN5 A;  4BBR H;  2R92 H;  3CCQ A;  3S1R H;  1X54 A;  3CCR A;  2OWO A;  4A3B H;  3JAM i;  1X65 A;  1E22 A;  4DV2 L;  2Q2I A;  4YHH Q;  3H3V I;  4IPG A;  1L0W A;  4DR2 L;  2PNH A;  1PHJ A;  1P16 A;  2UUB Q;  1NMF A;  1EIY B;  4TQU S;  2Q2U A;  4L5T A;  3KDF B;  5C4X G;  4B3R L;  3I4N H;  2AKW B;  5JEA G;  2K5H A;  4QJF A;  4JI0 Q;  3L7Z C;  2V1C C;  3W1G A;  3PO3 G;  4LFC Q;  3ER0 A;  5C3E H;  3G4S A;  2VL6 A;  4DK6 C;  3PF5 A;  2E2H H;  4DR3 Q;  1ASZ A;  4OON A;  4UP7 A;  2CFM A;  2ASB A;  1VQ8 A;  1KHI A;  1SE8 A;  1ASY A;  3J80 c;  4GKK Q;  5M3M H;  1PV4 A;  2JEB I;  2N49 A;  3FP9 A;  3HOX H;  4HIO A;  2WB1 E;  2F52 A;  1IBM L;  3KJO A;  1EFW A;  2AWN A;  1WYD A;  3H0G G;  5DLQ E;  3ZJY C;  4X65 L;  4A3I G;  1YBY A;  3K8A A;  1KL9 A;  5HGQ A;  2HIX A;  4DV5 Q;  5IP7 G;  4OXP A;  3TS2 A;  4WJ4 A;  3CCJ A;  2E5L Q;  1EWI A;  4L5R C;  2HHH Q;  3CMA A;  2CWA A;  3PUV A;  2Y0S E;  1GO3 E;  1VCI A;  4MNO A;  1YJ9 A;  4DR6 L;  3CP0 A;  4R1J A;  2NN6 G;  3TRZ A;  2MQH A;  1PFS A;  2F4V Q;  1HNZ Q;  2WAQ G;  4GN5 A;  3GDE A;  3NEN A;  4PG3 A;  5IYD G;  1VQA A;  2JA7 G;  2RCN A;  1S3O A;  3KOJ A;  1CSQ A;  4R4O A;  4LF6 Q;  1XMQ Q;  1G51 A;  2ZTD A;  1LTL A;  1W3S A;  4JYA Q;  1QVG A;  2XTI A;  3CC4 A;  3PUY A;  2OQ0 A;  3DLL A;  1YHQ A;  1EIF A;  1VQJ A;  5FJ8 G;  1CSP A;  2UXD Q;  3U50 C;  2JA6 H;  3G48 A;  2N3S A;  3GD7 A;  2IT1 A;  2MO1 A;  5BR8 L;  4LF9 L;  4LNQ A;  5GAE C;  3Q8D A;  2ZTE A;  1PVO A;  1N32 Q;  2A19 A;  2MFI A;  3S15 H;  1PYS B;  1Z47 A;  2RF4 A;  3TQY A;  2KCM A;  1YHA A;  4QGU A;  2VQE Q;  4OO1 I;  2JA5 H;  1Y1W G;  2VUM G;  1DGS A;  1VQF A;  2K5V A;  1CKM A;  3FHW A;  5EAY A;  4GN3 B;  4A75 A;  2IHE A;  4IFD G;  2I5L X;  1PH8 A;  3CCS A;  2KHI A;  5M3F G;  1NJI C;  4QIW E;  5LMN L;  3W5O A;  4LF4 L;  3UE1 A;  1VQ7 A;  4IOC A;  3VDY A;  1YJN A;  5LMU L;  1L1O C;  2VNU D;  4C3I H;  2CWP A;  2ZJR A;  3EIV A;  2D0P A;  1FVI A;  5J3B A;  2R7D A;  4JI2 L;  2RHS B;  3HKZ E;  2R93 H;  2KEN A;  1Y14 B;  1NTG A;  1VQ9 A;  2IHF A;  3B6Y A;  5FLM G;  3STB C;  1KC8 C;  4JV5 Q;  1X9N A;  4QY7 A;  3CW2 C;  1A62 A;  1KD1 C;  4DR4 L;  4H02 A;  2K75 A;  1Q1B A;  4X62 Q;  2UXB Q;  3CPF A;  4YCW A;  5IYB G;  3GTL H;  1IZ6 A;  3MXN B;  2YTX A;  1GD7 A;  4X66 L;  3CCL A;  1VQ5 A;  4NXN Q;  2PI2 E;  1BBW A;  1R9T H;  3PO2 H;  4DR7 Q;  4LF7 Q;  4JI5 Q;  3JAM c;  2KBN A;  1C0A A;  1Y1V G;  1YZ6 A;  1K73 C;  3HOV H;  3UDI A;  3S16 H;  2VW9 A;  3CME A;  2LSS A;  1VQO A;  1YIJ A;  4LF8 Q;  3UDX A;  4BXX G;  5IT9 c;  1N33 L;  3S2H H;  1I94 L;  3UDF A;  2FXQ A;  2UUA L;  1IBK L;  4DV4 L;  1KXL A;  3E9H A;  1SN8 A;  4PZ7 A;  4AQY Q;  1KIX A;  4DV0 L;  1XNR L;  4A3D H;  3KF8 B;  2RHQ B;  3HKS A;  1SFO H;  4HIK A;  1VQ4 A;  2NVQ H;  5LMN Q;  4R4Q A;  2JQO A;  3ICE A;  4A3C H;  3KLW A;  2NN6 I;  4A3F G;  4A3G H;  1I50 H;  1PH5 A;  1Z9F A;  3NEL A;  1VQB A;  1Q86 C;  5IP9 H;  1PA6 A;  1L1O B;  1PH6 A;  3M4O H;  4A3L G;  3S1M H;  5IYD H;  4RMF A;  1YNX A;  2JE6 I;  3F8T A;  4GLX A;  1M90 C;  5IWA L;  2YYZ A;  4PZ8 A;  5IE8 A;  3OW2 A;  1KAW A;  1XJV A;  2ZJQ A;  4C3J H;  3I55 A;  3FKI H;  4IO9 A;  3RLN A;  2OQK A;  5C44 G;  4X64 L;  2WP8 J;  4O0A A;  4YCV A;  3J7A 5;  4BBS H;  1CKN B;  4BY7 H;  1HZB A;  3KJP A;  3I4M H;  1HNW L;  3HOZ H;  3ERS X;  1LM0 A;  1OXV A;  4GLV B;  4L5Q A;  1K9M C;  3H3V H;  3STB D;  2ATW A;  4JI6 L;  3M7N A;  1OXX K;  3K80 C;  2NZH A;  3HFZ B;  4ALP A;  4A93 G;  4DR5 Q;  1I94 Q;  4JI8 Q;  1B8A A;  2C35 B;  4DR1 Q;  1K8G A;  4IFD I;  4OX9 Q;  3HOW H;  1IBK Q;  3AYH B;  3WWV A;  2ES2 A;  2YU9 H;  1J6Q A;  3GTQ H;  4POG A;  5M3F H;  1N36 Q;  4JCV E;  4DV7 Q;  2K50 A;  2JEA I;  1TWH H;  1UE1 A;  3F2C A;  1G29 1;  4WJ3 M;  1VQL A;  4JBM A;  1SMX A;  2VZA A;  3G71 A;  1XPU A;  1EYG A;  1KRT A;  1FJG Q;  1J5E L;  3HOY G;  2AMC B;  1N34 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...