2OEOA

Cryogenic crystal structure of staphylococcal nuclease variant truncated delta+phs i92d
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
130
structure length
130
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKAMVENAKKIEVEFDKGQRTDKYGRGLAYDYADGAMVNEALVRQGLAAVAYVYSGNNTHEQLLRAAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal thermonuclease
publication title Buried Charges and Water in the Protein Interior: Reality or Fiction?
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 33
structure length 130
sequence length 130
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2006-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2oeoA00
2PQEA 3T13A 2F0TA 3R3OA 3T16A 4ID6A 2EY6A 1A3UA 1EZ8A 3HZXA 5C3XA 5IOCA 2OEOA 4KV6A 4NP5A 4ZUJA 1EY7A 2M00A 3DMUA 1SNPA 3VA5A 3TMEA 3P75A 2F0UA 4ZUIA 2PZUA 1IHZA 1EY6A 4YIJA 4WRDA 1A3VA 1STNA 3D4WA 3TP5A 1JOQA 1TQOA 1KAAA 4KD3A 2EYFA 3LX0A 2F0MA 5C5MA 1A2UA 2EY1A 2SOBA 4NKLA 1SNQA 4K5WA 1JOOA 3DHQA 4K2KA 5F2DA 1TR5A 3V2TA 4EQOA 5I6WA 2F0LA 1EY4A 1AEXA 5IGDA 5CV8A 3HEJA 2F0VA 3NK9A 5E1FA 4G57A 4QB4A 5NUCA 4IALA 2EYOA 3SK8A 3MZ5A 5C4ZA 5I6YA 3BDLA 5KGUA 4E6IA 4K8IA 5EGTA 4DFAA 3MVVA 4PNYA 2SNSA 1NSNS 1JOKA 3C1EA 1F2ZA 5M9OA 2EYHA 4KJOA 3TP7A 2F0WA 2F3WA 2LKVA 1SNOA 4RKBA 3QOLA 4K5XA 4H7BA 5C6AA 4KD4A 1U9RA 2EYJA 3TP6A 5CC4A 2ENBA 4PMBA 2EYLA 2RBMA 4K14A 5CV4A 4K8JA 2KHSA 4EQNA 1STHA 1RKNA 4K2LA 5JOBA 2OXPA 1JORA 3OMCA 2HQEA 4NMZA 1ENAA 1EZ6A 3S9WA 2F0NA 1EY8A 5K5PA 4KY5A 3RUZA 2EYMA 2WACA 3EVQA 3PMFA 4IUNA 5J39A 4N9PA 2EY5A 1II3A 4F8MA 2F0PA 5IGCA 4B9XA 5KRUA 2EYPA 4HMIA 1EQVA 3D8GA 1SNMA 2F0KA 1A2TA 2F3VA 3U9OA 5CGKA 3OWFA 1A3TA 1EY9A 2KQ3A 2PYKA 4ZQ3A 4EVOA 3SXHA 4DGZA 1NUCA 3OMGA 4R8NA 4K5VA 2EY2A 2QDBA 4K6DA 2F0FA 2F0IA 3ERQA 4KJNA 4RKLA 4ME5A 3OSOA 4DU9A 3NP8A 3P1HA 4QMGA 5KYIA 4B9WA 4LAAA 4OL7A 5CV7A 4I65A 1SYEA 5EKKA 2F0HA 3MEHA 5I9OA 5DAUA 2F0JA 4TRDA 4EQPA 1SYDA 2F0SA 3EROA 4QF4A 1F2MA 3E5SA 4HTHA 4KTAA 5C5LA 5HURA 1KABA 1STBA 1SNCA 5CV9A 5CV5A 1SYCA 5JAVA 5C4HA 5EKLA 3NHHA 1EY0A 2F0QA 2RKSA 4N9TA 2O4XA 3MXPA 4PMCA 1TT2A 5IODA 3D4DA 5DEHA 2RDFA 3NXWA 1SYGA 3C1FA 5I9PA 2NUCA 2F0GA 4HMJA 5HGTA 1KDAA 4J6HA 1STYA 5E3FA 5IIFA 4F7XA 5IGGA 1ENCA 4KY6A 3SR1A 5IGBA 3SK4A 5IGEA 1SYFA 3NUCA 2F0DA 3QB3A 5CR3A 4S3SA 4J1MA 4KY7A 5C3WA 3TP8A 1EY5A 4ODGA 3D6CA 1EYDA 3EJIA 3H6MA 3ITPA 4IZ8A 5ISRA 3MHBA 3SK5A 1STGA 1SYBA 5KYLA 4MIUA 4WORA 4DF7A 2PZTA 2F0OA 5CV6A 2PW7A 2PZWA 1KDBA 2EXZA 2F0EA 1EYCA 1EYAA 2SNMA 3BDCA 3NQTA 4KHVA 3SHLA 5IGFA 5KEEA 1STAA 4NDXA 5J1ZA 1SNDA 2PW5A 3SK6A 1KDCA 5KIXA 5J22A 3QOJA 2OF1A 1F2YA
chains in the Genus database with same CATH superfamily
2BOSA 1L0WA 1J5EQ 1NR4A 3ERSX 2ICEC 1E2VA 1M4VA 2E2IB 1U5KA 1MIUA 2B2VC 4JI3Q 1OTCA 4JK1C 4L5SA 2YYZA 5M5YH 1STNA 3I4NH 4M1UB 4C3JG 3F2BA 3QIAA 4HIMA 2VQEQ 2KCTA 4HSVA 1EY4A 2TMPA 4LFAL 3D0FA 2F4VQ 1E2ZA 1R4QB 3MZ5A 2VUMB 3FEWX 3VR6A 4JI8L 4CJ2C 2WB1E 4XXEA 3M4QA 1DOMA 3BYTB 5C3EH 2UU9L 5COYA 2EYJA 3HOVH 2WP8J 2ENBA 3PO2B 4A3EH 4DV1L 2K7VA 4IUPA 1F9RA 2X6GA 4LFBL 4HSPA 4ZLTF 2J0TD 4R4CA 1XMQL 3QJYA 2G9DA 4RCOA 3UDXA 3M3YH 4N9PA 2F0PA 1LABA 1K3BC 4JW0A 1IW7C 3RN2A 3A8JE 3U9OA 1H9JA 4DGZA 2HD3A 4DR6L 1W6KA 2R7ZG 3NP8A 4MTKA 1EU3A 4JI0L 3MXNB 1V1QA 2GA4B 4MZ9A 1T9HA 4A3FG 3T53B 1STBA 1VF5C 1ONLA 2KOLA 2IL8A 3NELA 4N9TA 1XPOA 3M4PA 4A3IB 3LNNA 3S14H 2QF7A 4J6HA 2JA6B 5C44G 1YVCA 1VMCA 4FF4A 1PMRA 2JA8H 1HJPA 2VQFQ 3CCEA 3BVGA 1PH1A 1HQRD 1STGA 3TREA 4YWMA 4BY1H 4KHVA 3TRZA 5K36G 4G4KA 1HRJA 3NENA 3CCLA 1NJIC 4OWTB 2F0TA 1K8AC 1W6JA 3K59A 3J7A5 4UPAA 4ILWA 4JBJA 3AYHB 1HNXL 3UE0A 4H44C 3DMUA 2ZT9C 1SNPA 4Z9CB 1VF7A 4YIJA 4CHTB 2VB2X 3W1GA 1BXTA 1MSGA 4ZAIA 2JA7H 1S72A 1JE5A 3KUPA 4YCWA 2HQLA 2L4NA 3A7LA 3VR4A 5C0XJ 1SXTA 1KLUD 2JA5H 1O7ZA 4DNRB 2OCEA 5NUCA 2JN4A 5KGUA 3I4MH 3KDFB 4WJ4A 1I5FA 2I5LX 2IWHA 2EYHA 3FPPA 1U9RA 1S40A 3TP6A 1Y1VH 4IUQA 4FYDA 1M90C 4JI3L 1X3EA 1X3GA 1STHA 2OXPA 4RAUC 2WINB 4OIKA 1R4PB 2F1MA 3IFDA 4JVZA 4KHZA 1D5MC 3J80c 3NBHB 1PH2A 4GZYC 2RHQB 4IJHA 3ICEA 5IGCA 1KQSA 2R93B 4XQNA 1A2TA 4DV4Q 1H95A 5FLXc 2CH4W 1JWMD 4OO1G 1R9TH 2A6EC 2KBNA 4V0BA 3ERQA 2NYZD 1A62A 1UE1A 4IPCA 1C8CA 4A3GB 4JG2A 3H91A 4Q0FA 3CQZB 1SNCA 2RDGA 1EYGA 3K80C 4DV5Q 2AQ2B 2D62A 3K7AB 1TWFH 4I7ZC 2K5HA 2KECA 2EZVA 3MXPA 5J3BA 2VY3A 3HOYG 1WTRA 5IP7H 4C3IB 4MNOA 4PQXA 3OYYA 2A73B 4HEDA 2NZ1D 1HH2P 4JBMA 2EQSA 1VQMA 3I4OA 1BKBA 3I72A 1AN8A 3GTLB 1KDBA 1YNNC 1K9MC 1YIJA 1IL2A 1SNDA 1EWCA 1CKNA 3VR2A 5LL6S 1N36Q 1ASYA 2OTLA 2AWNA 4POGA 1PXUA 3AFPA 4RCNA 2PPBC 2K33A 1WTXA 1EEID 4ZUJA 3PUYA 2XIWA 1DONA 3WOEA 1SBBB 4DUZQ 3CPWA 2F0UA 1PZKD 2XNAC 2E2HB 3HG9A 4DAYA 1VQAA 2A8VA 4LF8L 1KAAA 4LW1A 2R7FA 2R92H 3M7NA 2ZM6L 5C5MA 4DV0L 1H9MA 2EY1A 2SOBA 4DR3L 1DGSA 4UP8A 3T4AC 1KC8C 1TR5A 4IPDA 1JCKB 5IGDA 2EJFC 4CBVA 5C4XG 3K5MA 4PMWA 3PUWA 1K0RA 2IW3A 5EGTA 3G4SA 3W5OA 1EFID 1K8OA 3TP7A 4A3LG 2EVBA 4H7BA 5EPLA 3HKZG 2UUBQ 2ZXPA 1EOVA 4A3DH 2EYLA 2A6HD 4OELB 5CYUA 1JORA 4C3HB 4KK7A 5L37A 3S9WA 3BZKA 5JPMC 3I73A 1PH8A 3GTKB 3H0GB 1JE4A 4DR7Q 1AH9A 4DR4L 3FKIB 5JEAH 1HR0W 3P7JA 4JI7L 1SE3A 1C9OA 5FLXL 1QCBD 4K5VA 2GVAA 3CAMA 3F1ZA 3PQIA 4RHSA 3OW7A 3WOFA 1P16A 3S2DH 1OXUA 2KA7A 1PTOH 3MEHA 1ET9A 5I9OA 3BDOA 1F2MA 1WI5A 1CHPD 3A56A 1VQNA 3PO3H 1IYUA 1SE8A 4H02A 1QUQA 4BY7G 2UXBQ 1TT2A 4J8QA 4ZYSA 1N34Q 3L3OC 5BN5A 5DLQE 2IY5B 5HGTA 1BCPF 3HGBA 1N33Q 4CJ0B 2XGTA 1PFNA 1KL9A 3NUCA 4A93B 5AJ3Q 1IBML 5EJWA 4DV4L 3EJIA 5IWAL 2L15A 4BS9A 2ASBA 4DF7A 5GAEC 1SJED 4B3MQ 1I4XA 4UP9A 1ENFA 4GLXA 4JI4Q 4DR2L 2PW5A 3CMEA 1Q1EA 4ZCKA 5GQOA 4UAIA 1E1TA 1RDPD 5M3MB 2OTJA 5IYCH 4HJAA 2WV6D 4ID6A 1IBKQ 1GXDC 2GVBA 3GTJH 1Q3LA 3HOXH 4X64Q 3K81C 4WRDA 3UDFA 2RSNA 4LF9Q 1EL0A 1TQOA 4HCSA 1I50B 2A19A 2DN8A 2MFIA 1LTGD 2NVYH 3UE1A 3SVMA 3I55A 1M1KC 4BXXG 2BA1A 1CI3M 2F4IA 3ND9A 4AYBE 2HIXA 1IBLQ 1EIYB 4QB4A 1V1OA 1PHJA 3SK8A 1YBYA 1OXTA 3URYA 4HIKA 4BBRH 2XWBB 1VQFA 1NNXA 3A7AB 5C6AA 1N36L 3RZOB 1GUTA 5CC4A 3F2DA 4APVA 1AFPA 1SN8A 4K8JA 4ZRZA 4B3SL 5FO7B 1T5XD 3U58A 2YU9B 1HZBA 4A3CH 3KLSA 2L1BA 1KHIA 5M5WH 1CKNB 1GHJA 2AUKA 4OIJA 2EYPA 3S1RB 3Q24A 4GNXC 1DCZA 2IX3A 1NCVA 1F9PA 4G7ZC 3HOWB 4X3UA 2EY2A 4BA2I 2F0FA 4DAYB 4I7AA 4B9WA 4OL7A 1SYEA 1WTHA 1VQDA 5GROA 5A2QL 4P72A 2K5QA 3E5SA 1Y1WH 3ZJYC 4YWKA 2Y0SG 3GTQH 5JAVA 3K5LA 1RF2D 3STBD 4C3JB 4DV7Q 4QUCA 5IODA 1XMOL 1VQ8A 2K03A 2Z9HA 3GTOH 1WJJA 1V43A 1S3OA 1JICA 1NMGA 2JA6H 2QKIC 2IX1A 3S15H 2L55A 1LTID 1NMFA 2K32A 3GO5A 3SR1A 3SK4A 3X3NA 1SYFA 3KF6A 4YHHQ 2K50A 3J80i 5C3WA 3AMUA 4WJ3M 1CZGA 1J8IA 2CW0C 2CQAA 3NQTA 3NBIA 1EYCA 3GTGH 4HCEA 2D9UA 2MNAA 4DK6C 3DXJC 5C0XH 1S4ZA 2IJ0A 1X6OA 5M3FH 2K5NA 3K6OA 1JJGA 5ELDA 3CCUA 1LV9A 1G2TA 2WAQB 5IY0A 1KIXA 2B2YA 1BOSA 3A5ZB 1AE2A 2D0OA 5EAYA 4ZUIA 4BWGB 1WCMH 5EPKA 1PTOD 1X56A 2EYFA 4RWSC 3CP0A 1O7IA 4LFAQ 1FJGQ 2A5HA 3M4OB 5C3XA 4K5WA 4K2KA 3VYTA 2R7ZB 4JI8Q 1QUQB 4C1NI 4IFDJ 5E4WC 3HFZB 2UU9Q 1JWUD 1TWCB 2BDNA 4B3ML 1Q90A 2DJFC 2DY8A 4P74A 4JI2L 2PCFB 1F2LA 3I4NG 4DV1Q 3DEPA 3M4YA 4LFBQ 4K5XA 3KF8B 1QVGA 4A3JB 1XMQQ 4WFN3 1HQMC 2AHOB 5HGQA 2JK8A 1QE6A 4IUNA 4AIMA 5C3EG 2RA4A 3BZCA 4XT3B 4DR6Q 1VQBA 4OO1I 5BN3A 3HOVG 4U68A 4A3EG 1YNND 1J6QA 2M2LA 1VMPA 5M5XH 1IBLL 4ZQ3A 1F9QA 2F0IA 4A3MB 5ELFA 4PG3A 3MA2B 4DV6L 5EKKA 1PRTF 1FL0A 5HURA 4L8JA 1VQIA 1QWYA 2D0PA 3T51B 5C4HA 1LYLA 3V96A 2JA9A 5EQ0A 2VW9A 1XTCD 4C3IH 3VA7A 3I2ZA 3L7ZC 1ML0D 5I9PA 3ONAB 1CFMA 4HJ9A 2Z4HA 1SDFA 1E24A 3S17B 1STYA 2JP1A 4KI0A 2NWGA 3VYSA 3VYUA 2FJ2A 3Q6SA 1PH5A 4DK1A 3D6CA 3MXUA 3PGZA 5IE8A 4L5RC 2NVQB 4DK3C 1C4QA 3GTMB 1K83H 2MP1A 3KLWA 1HNXQ 2N78A 5D14A 5ELOA 3RLFA 3JC66 3UDGA 2JA8G 1D1KA 3KBXA 1Q82C 2E2HH 4BY1G 1PV4A 1TWHB 2JEBI 2PZUA 5EBCA 1QVCA 1U4PA 2I07B 5GADC 3HOZH 2XRQD 4JBKA 3AEVA 4A3BH 4DKAC 1B3QA 3RN5A 2VS1A 4EX5A 3CXCA 2EJMA 1KAWA 1HA5A 3U4ZA 3MVVA 2HCCA 2EXDA 1O78A 2JA7G 4RFBA 2UUCL 1TXYA 3KF6B 4GLAC 3T1YL 1YI2A 3HOYB 2FMMA 2WIIB 1ESRA 1K0SA 2JA5G 2KEEA 2KHSA 1SJHD 4Y52H 1E7ZA 3I4MG 4KY5A 1H9KA 4GNXA 3FKIH 3RR5A 4YCVA 1PH6A 3D6WA 1FJGL 3TN2A 4B9XA 4Y7NB 1CKOA 1TWGH 2CH4A 5KRUA 1Y1VG 2L9HA 5CGKA 3M85A 4RA8A 3KOJA 1OXXK 3E6ZX 1JJCB 4CDFC 2WB1G 1HNZL 1ZXTA 4CDEC 5KYIA 3FVQA 4G7OC 4B3TL 1GD7A 3PUZA 1DM0B 1V8QA 1HTLD 3Q23A 2QDLA 3IKJA 3HOUB 2Q2TA 3NHHA 3NE5B 5FLMH 4JPBW 1SFOB 2K1BA 2K5DA 1BQQT 1EWHA 2ZJRA 2RDFA 3S2HB 2F03A 1HZCA 2NB0A 1PTOF 2K6AA 3ZYYX 2E74C 4LK1C 5C4XB 2C5CA 4LMQD 1XX8A 4KY7A 4XDXA 1Y14B 3OTOQ 5LMNQ 1HZ9A 4IZ8A 2WAQE 2K05A 4CKCA 2P5ZX 1SLJA 5IP7G 1E3PA 2F3IA 5IGFA 3HKZB 3WDNA 3SK6A 5KIXA 2MO0A 1F2YA 1XNRL 1QVFA 1Q46A 2O5JC 4YY3Q 3R3OA 1DXMA 4R1JA 4QCLA 1QZGA 4LF8Q 3OWEB 2ZM6Q 4DV0Q 3QWNA 4DR3Q 3LGJA 2I46A 3J80E 2HUGA 3FRPB 3LX0A 3H3VH 1ASZA 3A8KE 3OIPA 3WWVA 2NVXB 3J81j 3BVZA 4LFCL 1SSOA 5FLXE 5G3LD 1QILA 3CRLC 5C4ZA 1FGUA 4JYAL 4C56C 4LF5L 5M9OA 1KLGD 1I3QH 2R92G 4QIWB 3J7YW 4JI6L 3RZOH 4BY7B 2WKCA 3QOLA 1SMYD 4IOAA 3CPFA 2EPBA 1U0LA 1NY4A 1MJEA 5LMUL 3F2UA 2JE6I 1UE7A 2DGYA 2YU9H 2B2UC 3OMCA 4HJ8A 4DR4Q 1EZ6A 2NZOA 4C2MB 1FNVA 2HT1A 3RUZA 2WACA 1LT3D 1II3A 1UWVA 4JI7Q 3S1RH 1TS3A 4FF3A 4XYQA 4HMIA 3KK7A 1MBYA 1SNMA 4A4IA 4A3DG 1ZYRD 2EDGA 2RHSB 5I4DA 5JVG3 1HUNA 2PYKA 2B63H 1U4MA 1X65A 3RNUA 3K0YA 2N8NA 3NTIA 1WTOA 4LF7L 2PNHA 1MD2D 5IYBH 1HTPA 1EIHA 1B2TA 4EQPA 4FO2A 1VQ9A 1Z9FA 4HTHA 4X65Q 1RTNA 2ID0A 1C7YA 4GN5A 2HIVA 1TVXA 1TS4A 5JEAG 2ZTCA 3KYHC 3NPPA 4A3KH 4BBSH 1C0AA 3ER0A 3CCVA 3S1MB 5JJKA 4HMJA 2K4KA 1IBMQ 2FXQA 4JCVE 1T5EA 5IWAQ 4KY6A 1EFWA 1L2FA 1LTRD 1SR3A 3P20A 3PO3G 2BH8A 4DR2Q 1SYBA 4WORA 2PW7A 2PZWA 5ELBA 2VXWA 3PUVA 4GNXB 4DR1Q 1F77A 1HNWL 3DEOA 4IFDH 2B8GA 4X62L 1A3UA 1OXVA 5CMDA 4FNFA 3VA5A 1AE3A 2I5MX 2JJQA 4HIDA 1DOKA 1C48A 1EQTA 3LWEA 1JC7A 1EU4A 1YHAA 4IURA 2ES2A 1E2WA 1A2UA 4GKJL 5IYCG 2NVTH 3BG3A 1Z47A 1I4QA 3OTOL 3W1BA 3I56A 5LMNL 4N8X1 4TSSA 3S16B 5CV8A 1F9SA 1TWCH 4TQUS 3I70A 2C35B 2V4DA 2LMCB 3HOXG 4IALA 3PV0A 1B44D 1Q12A 5I6YA 1NSNS 1YNJD 4A3JH 1LUZA 4N8FA 2LKVA 4B3SQ 3C3LA 4DN4M 5KNDA 4YY3L 4JV5L 2JEAI 1IXRA 4K14A 4B3RL 3CKIB 5ELCA 1EQRA 1I6HB 1BCPB 1PDQA 1A6XA 4IPGA 1K8GA 2B2YC 1I4HA 1EY8A 4BBRG 2NN6H 4UY8C 2MJ8A 3HRZC 1TS2A 5GAGC 4WJWA 3D8GA 1JR0D 4A3MH 2Q2HA 2RVLA 2RDHA 4K6DA 4A3CG 1B53A 3LWUA 3BVMA 3MAQA 1G51A 5BR8L 1WTVA 1Q8KA 4IOCA 2KHIA 3R8BA 3CCQA 1TWAB 1XNQL 1XMOQ 4LF6L 1KRSA 4GN3B 5C4JH 2O4XA 4FXDA 1UEAB 1L1OC 1N32L 4RGMA 2OT2A 2HHHL 2UXDL 4X6AH 4YCUA 5IIFA 1Y1WG 3IRBA 4NPSA 2WKDA 1GOZA 1D5XC 3ITPA 5M5YB 2AWOA 2UUAL 5A35A 5KYLA 2PZTA 1NTGA 4A3IG 1EYAA 1B70B 2JA6G 3L2PA 1KDCA 5J22A 4DK0A 4RMFA 3T13A 4X65L 1EQQA 1FNUA 2L5TA 3RZDH 2E2JH 4CDCC 1TWHH 1EY7A 2M00A 1QNUA 3CRKC 1KXLA 1I6VC 5C3EB 2Q2UA 3KF8A 1DOLA 3HOVB 1KNEA 1JOQA 3HP3A 5C0XG 4G7HC 1LT6D 2A1AA 4A3EB 1O7YA 3S1NB 5M3FG 1CSPA 4NKLA 1FD7D 3T56B 1AEXA 1LTBD 2F0VA 3CW2C 4JI2Q 3M3YB 4AH6A 3D31A 3BDLA 3EA6A 2B2TA 2E2IH 1IKMA 3PIPA 1WCMG 4DR1L 2B2UA 1F2ZA 5IYDH 4FDBA 3R2IA 1UAPA 1CZWA 1WVLA 5CV4A 1IW7D 1FNWA 1B8AA 1STEA 2B8FA 4O2DA 5IT9c 5K5PA 2IPKD 5J39A 4AYBG 3GQBA 2VUMH 1MSHA 1EWIA 2A74C 1WTPA 2N3SA 4K6LA 4DV6Q 3S14B 3FDTA 1BR9A 3PO2H 4DA2A 1PFMA 3KJPA 2R93G 3K7UC 3HOUH 4X3KA 4KTAA 4TKOB 2ATWA 4BY1B 1KNAA 2XRSD 1EEFD 4FP5D 5JPNC 3TEHB 1LTTD 1S5DD 1TY2A 3K5NA 3SE0A 3FPUB 3C1FA 2NUCA 1CQVA 1GUNA 4LNQA 2OQ0A 1JB3A 1HHVA 1LT4D 2EE1A 2JSOA 3H6MA 4IPHA 2JXMB 2BDOA 1V1PA 4C3IG 1Q8IA 5CV6A 2F0EA 1MI2A 3BDCA 1GHKA 1PFSA 4FVMA 1X55A 2BA0A 4NXNL 4F87A 1VQEA 1CT1D 1M8AA 1MGSA 1FGBD 4A3IH 4CGYB 4HR7B 3I4MB 2SDFA 1L0YB 4OWXB 4HN7A 4XT1B 4OX9L 4L63B 3S24A 5D65A 3EIVA 3TZUA 2NVXH 1ZEQX 3K58A 2WB1B 1X9NA 2F0LA 1TS5A 3JAMc 3G6EA 1PRTB 1SROA 2FMCA 2Z6KC 3MWYW 1BCPC 2UUCQ 4E6IA 3T1YQ 1TY0A 4GOPA 3HOZG 4QQBX 3CCMA 1H9SB 3L9AX 2IX0A 4JC0A 1BBWA 3J81c 2HCIA 3AU7A 4A3BG 1GKHA 3TQYA 3MFGA 4K2LA 2AKWB 5FJ8G 2HQEA 2A6ED 2EYMA 5IT9L 2DUDA 1TWFB 3OPOA 1SEBD 4A3FB 4DV2Q 1WFQA 1RCVD 3GV3A 1HNZQ 1EIGA 3OWFA 1JB7A 4B3TQ 3SXHA 1B9NA 4R9WA 2MGSA 2K28A 4LAAA 2MQHA 2PNRC 3FKIG 5T1GA 5DAUA 2F0JA 4TRDA 1SYDA 3U9SA 3W2DA 3CC7A 1L1OA 2ZTEA 2KEDA 4M8AA 5C44B 4ULLA 2E8GA 1RD9D 1EY0A 2E75C 2Q8IB 2R93H 4R4OA 1B7YB 2NZHA 4HJ5A 2YTXA 1GM5A 5DM73 3T1HL 5DNFA 4RGNA 2K01A 2ALYB 2D2CC 1G291 1XTDA 1JWSD 5E3FA 5FK9C 4A3GH 3GDEA 1EY5A 3I3CA 4RG1A 5FLMG 3J7AF 3CQZH 1J9OA 4P71A 4NMZA 3U50C 2R92B 4ZK9B 1XNRQ 3K7AH 3H15A 3I4LA 3E3XA 4KLKA 3KJOA 1D1IA 4A76A 4NW2A 1Y8OB 2ICIA 3G7LA 2MUYA 2RF4A 4ALPA 4CJ1B 2QA4A 2QW7A 2ZJQA 1JMCA 2R3ZA 1Q81C 4GKKL 4RHRA 2N49A 3DUZA 3GTLH 1UNSA 3F8TA 4LFCQ 3V2TA 5JJIA 1SNQA 3S16H 1RJTA 5GAHC 5I6WA 1DD2A 4R4QA 2A68C 4JYAQ 3SEBA 4LF5Q 1CKMA 3JAML 1WYDA 1U4LA 4NXML 2EYOA 4JI6Q 4X66L 1BO0A 4DFAA 4AQYL 1JOKA 3FMCA 5LMUQ 2F0WA 1B3AA 1B9MA 1Q1BA 4RKBA 5LHY1 3J81L 1I6HH 2RCNA 1I94L 4GN4B 4P73A 1QZHA 3S2DB 1V1PB 2LFNA 2KHJA 1PTOB 1KTKA 5JOBA 1OXSC 1BVSA 1YJWA 1BUVT 1PYSB 3GTPB 4L6TB 2MHVA 3PMFA 1X54A 1BDOA 1I4RA 3PO3B 1RHPA 4F8MA 3E9HA 5FJ8H 4NB3A 2A6HC 2DNCA 1GUSA 3G48A 4LF7Q 1HXYD 4K0KL 1EY9A 2KQ3A 1FYCA 3AFQA 3OHXC 1NUCA 1WD1A 2QDBA 3DM3A 1SRUA 4OONA 3OSOA 3DWPA 2KVMA 1TWAH 1XPRA 4C3HH 3SGIA 5FO9B 1AW7A 1XYIA 4DUYL 3GD7A 3ULJA 3GTKH 1FVIA 3V05A 5LL6X 5CV5A 3H0GH 2IHFA 1PLFA 2EJGC 1LACA 3MEFA 3TS2A 2B63G 3QR8A 3CF5A 2CKZB 4ME3A 2B29A 4GOPB 1G6PA 5IYBG 4QUFA 5ELEA 4DPGA 1QNKA 1G2SA 1NR2A 1W3SA 1CA5A 2CQOA 3GTJB 3HOXB 4S3SA 4DV2L 3K57A 4BBSG 4KHPL 3X3MA 4A3KG 1LLRD 4CKBA 1HNWQ 1KRTA 2YV5A 4C1NK 2HDMA 2NVYB 4IUVA 4X62Q 2CCZA 2J7ZA 2NBFA 2KENA 2FFKB 2OF1A 2E76C 2PQEA 2XVSA 2N88A 3T16A 2EY6A 4JOIC 1QG7A 4MN3A 4BBRB 5C0XI 1XXGA 4LF4Q 1CK1A 2ZXOA 4A93H 3J7ZC 2PQAA 2MO1A 3P75A 1VQ6A 4GKJQ 1PRTC 2B2WC 1WOCA 3S1NH 3TP5A 4KD3A 2D5DA 1VQ7A 1L1OB 2Z6KA 3BS1A 4JI1L 4IFDG 1ILQA 2WAQG 1SMXA 3I90A 1AP0A 1S5BD 5D3IB 5M3MH 1Q86C 2Z8LA 1U4RA 4PZ6A 5M5WB 3FP9A 4K8IA 4JV5Q 3PUXA 1L0XB 4B3RQ 4KJOA 1PVOA 4HAEA 3GV6A 2RBMA 1I50H 1RTOA 3C2PA 1HR0L 3J7AV 4DV3L 1Y1WB 4HJ7A 3EQLC 1RL2A 4XQQA 3GTQB 3EVQA 1S5ED 3O13A 1ICFB 4A3JG 4DAVA 1K8MA 3E9IA 2JYOA 3CCSA 2OWOA 3GTOB 1AZQA 1A3TA 2Z0SA 3N52A 5BR8Q 4RGTA 1X32A 3PIOA 4R8NA 3Q8DA 3S15B 3PSIA 4O42A 1G6ZA 1XNQQ 4KJNA 4DU9A 4H13C 4CDDC 5H1SE 2WFWA 2B2TC 2NN6G 5IP9H 4LF6Q 3JAMi 1PZJD 2F0SA 4DXGA 4QF4A 5C5LA 1N32Q 1SYCA 1VQCA 1YHBA 3G6JB 3GTGB 2UXCL 2HHHQ 2UXDQ 2RKSA 5KNBA 4A3MG 1WTWA 4DAMA 3D4DA 5M3FB 3K5OA 3J81i 2E2DC 2AMCB 1ET6A 4FF1A 2CW0D 2H1EA 1GO3E 3NWTA 1KDAA 3C46A 3HOWH 5IGGA 2UUAQ 2E5LQ 2AUJD 4JI5Q 2F0DA 2YTVA 3STBC 2R7DA 1BCPD 3TP8A 4ODGA 4R8IA 5ISRA 3EFXD 1WCMB 2B3GA 3A55A 4MIUA 2I0QA 1X3QA 3SHLA 3NEMA 4DNTB 1YJ9A 1N9WA 4C3JH 3U4VA 1Q7YC 1AZPA 2I5HA 1UE5A 1ICWA 2N55A 4XIGS 4U673 1EZ8A 4R4TA 2DY7A 2OEOA 4KV6A 4NP5A 4ZKBB 1J5EL 1I4GA 3VR3A 2H4OA 4AYBB 3D4RA 3VDYA 3G71A 2CHBD 3CHBD 3TBIB 2F0MA 4UDUC 1QJOA 5F2DA 2RCFA 1JOOA 2V1CC 4F88A 1HFGA 4PV1C 5BN4A 1SE2A 1W2BA 1B50A 2QILA 1PYWD 2MPMA 2QEJC 3KLSX 3QG1A 2VQEL 1VQGA 1YJNA 4V190 1PTOC 2DNEA 2ZJPA 4PNYA 3C1EA 1GUWA 2F4VL 5M5XB 2KJXA 1YNXA 1VQHA 4KD4A 4TVAB 1UE6A 4RGOS 5I2YA 5E7NA 4OWWB 4EQNA 4LF4L 3M4OH 1ENAA 5D3DA 4FXKC 2R7ZH 4IUUA 4CKEA 1TKWB 5IYDG 4A3FH 2LXJA 2PI2A 2C9OA 2BE5C 2F0KA 4UHVA 2Y0SB 4IO9A 4EGVA 1TU2B 1EOTA 1I4PA 5EKIA 5A2QE 2PQAB 3D3RA 5I2XA 1HUMA 3A54A 4QMGA 1VQOA 1LTLA 2L12A 5JJZA 5C44H 3EROA 4GOPC 2VUMG 2Q2IA 2LY7A 4O1NA 1KABA 4OEMB 2B2VA 5FO8B 3MXGA 3EBEA 1K83B 2CFMA 1G8ZD 4PMCA 3PO2G 2R61A 1SYGA 5K36H 4KMUC 3MFYA 1EUJA 1FR3A 2A68D 3HOUG 2RQXA 3UDIA 2QCPX 3QB3A 4L5QA 1UUPA 3PIO3 1E22A 3NTKA 1EYDA 3NSWA 1SE4A 5CBEE 3S1QB 4NXNQ 3HOZB 1P8LA 3OOCA 2EXZA 2VQFL 3BZDB 2A69C 4ZKCB 4XTCS 4JOIA 2PMZB 4A3BB 1MHWC 4LUOA 2L0CA 3QOJA 4PZ8A 1LT5D 4OX9Q 2B2WA 3HZXA 3S17H 5IOCA 1D5ZC 3HKZE 4XYOA 1S5CD 4FF2A 1H9SA 2QEXA 3EN2A 1IHZA 1PA6A 1PH4A 1X3PA 3D4WA 1CM9A 2EIFA 2CWPA 2F52A 2KCCA 4LUVA 5DM63 5IT9E 4OGQC 3I4NB 2FHTA 4P75A 4JI5L 2E5LL 5G3LF 4R4IA 2NVQH 3GTMH 3J80L 4EQOA 1A0IA 1YZ6A 3HEJA 2J4XA 5E1FA 3BJUA 1IYVA 3H3VI 2VNUD 1TWGB 2SNSA 2CWAA 2XN9C 3ULLA 3PF5A 4POFA 3CC4A 4B08A 1IKLA 2CVRA 1VQPA 3A8IE 1CA6A 3GTPH 4OO1H 1HFNA 5FOBB 4QIWE 1K28A 1SAPA 2IHEA 5TSSA 1VQKA 1ILPA 1Z7TA 1BNZA 3CMAA 2F3VA 2O2LD 2VB3X 4EVOA 1D2BA 3OMGA 3TZDA 3HOYH 1PYBA 2EOTA 1Y8PB 4YWLA 3DWAA 3RD4A 5AFWA 1B1ZA 4QY7A 1LO5D 1Y8NB 3R2TA 2XSCA 4OXPA 5CV9A 4P2CB 1HPCA 3T1HQ 2QGQA 1PRTD 4PZ7A 2F0QA 2SEBD 2K04A 4Y7NH 5DEHA 2M9VA 3NXWA 4DV5L 4FXGC 3QO2A 4GS3A 4F7XA 1IZ6A 1A15A 5CR3A 2NTTA 1A8VA 2JA8B 5FKAC 2ZTDA 3AB9A 4X3SA 3R93A 2F0OA 3JAME 1BF4A 1XWEA 1ZKOA 1QB5D 1VCIA 1E0BA 1STAA 1SFOH 2G5DA 2ZXRA 4JBWA 1YHQA 3IAYA 3F2CA 3S2HH 4A3GG 4GKKQ 1PH9A 4LWCA 3J81E 5C4XH 4OHJA 2O5IC 1CUKA 1I3QB 3TMEA 1GVPA 4IQZA 1G91A 1EY6A 3I91A 4IFDI 4KKUA 1CQFA 2Q8RE 2AQ3B 2VZAA 4IN3A 4A3LH 4DUZL 5IGEA 4NXMQ 2JA7B 1A63A 3DHQA 1PH3A 4X66Q 2LSSA 1XJVA 1VQ5A 4AQYQ 4QGUA 1H9RA 1YEZA 2K52A 3NK9A 4G57A 3CU7A 2JA5B 3K0XA 3CCRA 3TS0A 4QL5A 2Q8TA 3RLOA 2KCMA 1I94Q 3K8AA 5JJLA 4DXFA 2F3WA 5LMNW 4IUTA 3ULPA 1Z6HA 2IT1A 2B63B 1DZ1A 4DNIA 1DJRD 3I7FA 3KLRA 1D8LA 5T1IA 4IJLA 5HY6A 1RIPA 1Y1VB 2K5VA 2Y0SE 1VQ4A 1RKNA 1MKHA 2UUBL 2F0NA 3AQQA 5ELNA 4A75A 4DR5Q 2KCNA 2LXKA 4BBSB 3BU2A 4K0KQ 1SMYC 4J15A 4A3KB 3M7GA 1B4OA 1N8RC 3W3AA 1EIFA 1RODA 4DR7L 3A74A 4BA1I 3PF4A 4BY7H 2NN6I 2XWJB 4DUYQ 1GUOA 1QOHA 2OQKA 1R9TB 3P1HA 1LM0A 4O0AA 4I65A 2F0HA 3I8ZA 3MC0B 3KFUA 2K5WA 4C2MH 4HIOA 3HKSA 1ZYRC 4QJFA 3NTHA 2LS01 1WTQA 1IL8A 1X3FA 3ND8A 2B39A 1WD0A 3B6YA 2RSOA 1MJCA 4H0LC 2DJGC 1LTAD 4KHPQ 2PMZE 4C3HG 2UXBL 1N34L 1VS0A 1GUGA 5IGBA 3FHWA 5CORA 3PIP3 1BBUA 3IFTA 3DM1A 3H0GG 4J1MA 1NAPA 1N33L 1NBWA 1PH7A 3MHBA 3SK5A 5AJ3L 1TIID 4DAPA 5EBDA 2NVTB 1S5FD 2VL6A 1CHQD 2JQOA 4NDXA 5J1ZA 3DLLA 3S1MH 2SNMA 3N6RA 4BXXH 1O80A 2PO4A 3CCJA 4JI4L 4L5TA 2Z1CA 1GJXA 1PZID 4EQ5A 2K14A 3TDQA 2Z4IA 3L0OA 4JI1Q 1IBKL 1A3VA 3MXNA 2BE5D 1NE3A 2K75A 1XPUA 4RH6A 4X64L 1Y69U 1HZAA 1K3RA 1JT8A 2NTSA 4LF9L 3OW2A 1OO9B 2GN5A 2YTYA 3VR5A 2H5XA 4A93G 3GP7A 2AQ1B 1E1OA 4JI0Q 4Q5VA 2XTIA 4LUZA 4MTNA 5EPJA 1SNOA 4KKTA 3OIQA 4KKSA 1HR0Q 3BYYB 4DV3Q 1HA6A 4PMBA 3H94A 1O7LA 3UI2A 5M3MG 1ESFA 4A3DB 2BCOA 2KUMA 3E0EA 1CSQA 3RMHA 1YNJC 1LTSD 1UEBA 2EY5A 4KN4C 5C4JB 3Q0AA 4MHEA 3SDZA 3CC2A 1EQVA 5E4XA 1V9PA 3TSSA 4XQJA 2A69D 3NWSA 2X6LA 3DWQA 1CTMA 4LJZC 1KD1C 4RKLA 4ME5A 1VDZA 1PFBA 3A5UA 5CV7A 2UXCQ 1D7QA 5JVH3 1HCZA 4KN7C 3RLNA 3IL8A 2X69A 3M9BA 2L11A 3NQIA 3H09A 5EKLA 1YITA 2FINB 1VQJA 5JEAJ 2R6GA 1IYJB 2F0GA 1K73C 3H3VC 1VQLA 3KDFA 4DR5L 5IP9G 3RZDB 2BH2A 3E0JA 4GLVB 4X3TA 4DV7L 2Z6BA 2E2JB 1ENCA 3KBGA 2G9HD 1JJ2A 3VYRA 1D6EC 2PI2E 3CD6A 3S1QH 3Q22A 1JQYD 2HDLA 5KNCA 3A0JA 1BBXC 2TSSA 1DYQA 3PCOB 4YHHL 3HS0C 4UP7A 3NBHA 5KEEA 4ABNA 3HOWG 5CBAE 3MTSA
chains in the Genus database with same CATH topology
2BOSA 1NR4A 2ICEC 1E2VA 1M4VA 2E2IB 2B2VC 4JK1C 2YYZA 1STNA 4M1UB 4C3JG 3QIAA 4HSVA 1EY4A 2TMPA 1E2ZA 1R4QB 3MZ5A 2VUMB 3FEWX 3VR6A 4CJ2C 4XXEA 1DOMA 3BYTB 5COYA 2EYJA 2WP8J 2ENBA 3PO2B 2K7VA 4IUPA 1F9RA 2X6GA 4HSPA 4ZLTF 2J0TD 3QJYA 2G9DA 4RCOA 4N9PA 2F0PA 1LABA 1IW7C 3A8JE 3U9OA 1H9JA 4DGZA 1W6KA 3NP8A 1EU3A 2GA4B 3T53B 1STBA 1VF5C 1ONLA 2KOLA 2IL8A 4N9TA 4A3IB 3LNNA 2QF7A 4J6HA 2JA6B 1VMCA 4FF4A 1PMRA 3BVGA 1HQRD 1STGA 4KHVA 5K36G 4G4KA 1HRJA 2F0TA 1W6JA 3K59A 4ILWA 4H44C 3DMUA 2ZT9C 1SNPA 4Z9CB 1VF7A 4YIJA 4CHTB 2VB2X 1BXTA 1MSGA 4ZAIA 3KUPA 2L4NA 3A7LA 3VR4A 5C0XJ 1SXTA 1KLUD 1O7ZA 4DNRB 5NUCA 5KGUA 2IWHA 2EYHA 3FPPA 1U9RA 3TP6A 4IUQA 4FYDA 1STHA 2OXPA 4RAUC 2WINB 4OIKA 1R4PB 2F1MA 3IFDA 4KHZA 4GZYC 1D5MC 5IGCA 2R93B 4XQNA 1A2TA 1JWMD 4OO1G 2A6EC 4V0BA 3ERQA 2NYZD 1C8CA 4A3GB 3H91A 4Q0FA 3CQZB 1SNCA 2RDGA 2AQ2B 2D62A 3K7AB 4I7ZC 2EZVA 2KECA 3MXPA 1WTRA 4C3IB 4PQXA 2A73B 4HEDA 2NZ1D 3I72A 1AN8A 3GTLB 1KDBA 1YNNC 1SNDA 1EWCA 3VR2A 5LL6S 2AWNA 1PXUA 4RCNA 2PPBC 2K33A 1WTXA 1EEID 4ZUJA 3PUYA 2XIWA 1DONA 3WOEA 1SBBB 2F0UA 1PZKD 2XNAC 2E2HB 3HG9A 4DAYA 1KAAA 3M7NA 5C5MA 1H9MA 2EY1A 2SOBA 3T4AC 1TR5A 1JCKB 5IGDA 2EJFC 4CBVA 3K5MA 4PMWA 3PUWA 2IW3A 5EGTA 1EFID 1K8OA 3TP7A 2EVBA 4H7BA 5EPLA 2ZXPA 2EYLA 2A6HD 5CYUA 1JORA 4C3HB 4KK7A 3S9WA 5JPMC 3I73A 3GTKB 3H0GB 1JE4A 3FKIB 5JEAH 3P7JA 1SE3A 5FLXL 1QCBD 4K5VA 4RHSA 3OW7A 3WOFA 1OXUA 2KA7A 5I9OA 1PTOH 1ET9A 3MEHA 3BDOA 1F2MA 1CHPD 3A56A 1IYUA 1TT2A 4J8QA 4ZYSA 3L3OC 5BN5A 5HGTA 1BCPF 3HGBA 4CJ0B 1PFNA 3NUCA 4A93B 5EJWA 3EJIA 4BS9A 4DF7A 1SJED 1I4XA 1ENFA 2PW5A 1Q1EA 4UAIA 1RDPD 5M3MB 2WV6D 4ID6A 1GXDC 1Q3LA 4WRDA 2RSNA 1EL0A 1TQOA 4HCSA 1I50B 2DN8A 1LTGD 3SVMA 2BA1A 1CI3M 2F4IA 3ND9A 4QB4A 1V1OA 3SK8A 3URYA 1OXTA 2XWBB 3A7AB 5C6AA 3RZOB 1GUTA 5CC4A 1AFPA 4K8JA 4ZRZA 5FO7B 1T5XD 2YU9B 3KLSA 2L1BA 1GHJA 2AUKA 4OIJA 2EYPA 3S1RB 3Q24A 1DCZA 2IX3A 1NCVA 1F9PA 4G7ZC 3HOWB 4X3UA 2EY2A 4BA2I 2F0FA 4B9WA 4OL7A 1SYEA 5A2QL 2K5QA 3E5SA 5JAVA 3K5LA 1RF2D 4C3JB 4QUCA 5IODA 2K03A 1V43A 1JICA 2QKIC 2IX1A 2L55A 1LTID 2K32A 3GO5A 3SR1A 3SK4A 3X3NA 1SYFA 5C3WA 3AMUA 1CZGA 1J8IA 2CW0C 2CQAA 3NQTA 3NBIA 1EYCA 4HCEA 2D9UA 3DXJC 5C0XH 1S4ZA 2IJ0A 3K6OA 5ELDA 1LV9A 1G2TA 2WAQB 2B2YA 1BOSA 4ZUIA 4BWGB 5EPKA 1PTOD 2EYFA 4RWSC 2A5HA 3M4OB 5C3XA 4K5WA 4K2KA 3VYTA 2R7ZB 4C1NI 4IFDJ 5E4WC 1JWUD 1TWCB 2BDNA 1Q90A 2DY8A 2PCFB 1F2LA 3DEPA 3M4YA 4K5XA 4A3JB 4WFN3 1HQMC 1QE6A 4IUNA 2RA4A 4XT3B 4OO1I 5BN3A 4U68A 1YNND 2M2LA 1VMPA 4ZQ3A 1F9QA 2F0IA 4A3MB 5ELFA 3MA2B 5EKKA 1PRTF 5HURA 4L8JA 1QWYA 3T51B 5C4HA 3V96A 5EQ0A 1XTCD 3VA7A 3L7ZC 1ML0D 5I9PA 3ONAB 1CFMA 2Z4HA 1SDFA 3S17B 1STYA 2JP1A 4KI0A 2NWGA 3VYSA 3VYUA 2FJ2A 3Q6SA 4DK1A 3D6CA 3MXUA 2NVQB 3GTMB 1C4QA 2MP1A 5D14A 3RLFA 1D1KA 3KBXA 1TWHB 2JEBI 2PZUA 5EBCA 1U4PA 2I07B 2XRQD 2EJMA 1HA5A 3MVVA 2HCCA 1O78A 4RFBA 3HOYB 2FMMA 2WIIB 1ESRA 2KEEA 2KHSA 1SJHD 4KY5A 1H9KA 3D6WA 3TN2A 4B9XA 4Y7NB 5KRUA 2L9HA 5CGKA 3M85A 4RA8A 1OXXK 3E6ZX 1ZXTA 4G7OC 5KYIA 3FVQA 3PUZA 1DM0B 1V8QA 1HTLD 3Q23A 3IKJA 3HOUB 3NHHA 3NE5B 1SFOB 2K1BA 2K5DA 1BQQT 1EWHA 2RDFA 3S2HB 2F03A 2NB0A 1PTOF 2K6AA 3ZYYX 2E74C 4LK1C 5C4XB 2C5CA 4LMQD 1XX8A 4KY7A 4XDXA 4IZ8A 2K05A 4CKCA 5IGFA 3HKZB 3WDNA 3SK6A 5KIXA 1F2YA 2O5JC 3R3OA 1DXMA 4QCLA 3OWEB 3QWNA 2I46A 3J80E 2HUGA 3FRPB 3LX0A 3A8KE 3OIPA 2NVXB 3BVZA 1SSOA 5FLXE 5G3LD 1QILA 3CRLC 5C4ZA 4C56C 5M9OA 1KLGD 4QIWB 3J7YW 4BY7B 2WKCA 3QOLA 1SMYD 2EPBA 3F2UA 2JE6I 2B2UC 3OMCA 1EZ6A 4C2MB 1FNVA 3RUZA 2WACA 1LT3D 1II3A 1TS3A 4FF3A 4XYQA 4HMIA 3KK7A 1MBYA 1SNMA 1ZYRD 2EDGA 5I4DA 5JVG3 1HUNA 2PYKA 1U4MA 3K0YA 3NTIA 1WTOA 1MD2D 1HTPA 1EIHA 1B2TA 4EQPA 4FO2A 4HTHA 1RTNA 2ID0A 1TVXA 1TS4A 5JEAG 3NPPA 3S1MB 4HMJA 1T5EA 4KY6A 1LTRD 3P20A 1SYBA 4WORA 2PW7A 2PZWA 5ELBA 2VXWA 3PUVA 1F77A 3DEOA 4IFDH 2B8GA 1A3UA 1OXVA 5CMDA 4FNFA 3VA5A 1DOKA 1C48A 1EQTA 3LWEA 1JC7A 1EU4A 4IURA 1E2WA 1A2UA 3BG3A 1Z47A 1I4QA 4TSSA 3S16B 5CV8A 1F9SA 4TQUS 3I70A 2V4DA 2LMCB 4IALA 3PV0A 1B44D 1Q12A 5I6YA 1NSNS 1YNJD 2LKVA 3C3LA 4DN4M 5KNDA 2JEAI 4K14A 3CKIB 5ELCA 1I6HB 1BCPB 1PDQA 1A6XA 2B2YC 1I4HA 1EY8A 2NN6H 2MJ8A 3HRZC 1TS2A 4WJWA 3D8GA 1JR0D 2RVLA 2RDHA 4K6DA 1B53A 3LWUA 3BVMA 3MAQA 1WTVA 3R8BA 1TWAB 2O4XA 4FXDA 1UEAB 4RGMA 2OT2A 5IIFA 2WKDA 1GOZA 1D5XC 3ITPA 5M5YB 2AWOA 5A35A 5KYLA 2PZTA 1EYAA 1KDCA 5J22A 4DK0A 3T13A 1FNUA 2L5TA 1EY7A 2M00A 1QNUA 3CRKC 1I6VC 5C3EB 3KF8A 1DOLA 3HOVB 1KNEA 1JOQA 3HP3A 5C0XG 4G7HC 1LT6D 4A3EB 1O7YA 3S1NB 4NKLA 1FD7D 3T56B 1AEXA 1LTBD 2F0VA 3M3YB 3D31A 3BDLA 3EA6A 2B2TA 1IKMA 2B2UA 1F2ZA 3R2IA 1UAPA 1CZWA 1WVLA 5CV4A 1IW7D 1FNWA 1STEA 2B8FA 5K5PA 2IPKD 5J39A 3GQBA 1MSHA 2A74C 1WTPA 4K6LA 3S14B 3FDTA 1BR9A 4DA2A 1PFMA 4X3KA 4KTAA 4TKOB 4BY1B 1KNAA 2XRSD 1EEFD 4FP5D 5JPNC 1LTTD 1S5DD 1TY2A 3K5NA 3SE0A 3FPUB 3C1FA 2NUCA 1CQVA 1GUNA 1JB3A 1HHVA 1LT4D 2EE1A 2JSOA 3H6MA 2JXMB 2BDOA 1V1PA 4C3IG 1Q8IA 5CV6A 2F0EA 1MI2A 3BDCA 1GHKA 4FVMA 2BA0A 4F87A 1CT1D 1M8AA 1MGSA 1FGBD 4CGYB 4HR7B 3I4MB 2SDFA 1L0YB 4HN7A 4XT1B 4L63B 5D65A 3TZUA 1ZEQX 3K58A 2WB1B 2F0LA 1TS5A 1PRTB 2FMCA 3MWYW 1BCPC 4E6IA 1TY0A 1H9SB 3L9AX 2IX0A 2HCIA 3AU7A 3MFGA 4K2LA 2HQEA 2A6ED 2EYMA 5IT9L 1TWFB 3OPOA 1SEBD 4A3FB 1RCVD 3GV3A 1EIGA 3OWFA 3SXHA 1B9NA 4R9WA 2MGSA 2K28A 4LAAA 2PNRC 5T1GA 5DAUA 2F0JA 4TRDA 1SYDA 3U9SA 3W2DA 2KEDA 4M8AA 5C44B 4ULLA 1RD9D 1EY0A 2E75C 2Q8IB 5DM73 5DNFA 4RGNA 2K01A 2D2CC 1G291 1JWSD 5E3FA 5FK9C 1EY5A 3I3CA 3J7AF 1J9OA 2R92B 4NMZA 4ZK9B 3I4LA 1D1IA 4NW2A 1Y8OB 2ICIA 3G7LA 2MUYA 4CJ1B 2R3ZA 4RHRA 3DUZA 1UNSA 3V2TA 1SNQA 1RJTA 1DD2A 5I6WA 2A68C 3SEBA 3JAML 1U4LA 2EYOA 1BO0A 4DFAA 1JOKA 3FMCA 2F0WA 1B3AA 4RKBA 1B9MA 1Q1BA 5LHY1 3J81L 3S2DB 1V1PB 2LFNA 1PTOB 1KTKA 5JOBA 1OXSC 1BUVT 3GTPB 4L6TB 2MHVA 3PMFA 1BDOA 1I4RA 3PO3B 1RHPA 4F8MA 2A6HC 2DNCA 1GUSA 1HXYD 1EY9A 2KQ3A 1FYCA 3OHXC 1NUCA 1WD1A 2QDBA 3OSOA 3DWPA 2KVMA 5FO9B 1AW7A 1XYIA 3GD7A 3V05A 5LL6X 5CV5A 1PLFA 2EJGC 1LACA 4QUFA 5ELEA 1CA5A 1QNKA 1G2SA 1NR2A 3GTJB 3HOXB 4S3SA 3K57A 3X3MA 1LLRD 4CKBA 4C1NK 2HDMA 2NVYB 4IUVA 2J7ZA 2NBFA 2FFKB 2OF1A 2E76C 2PQEA 2XVSA 2N88A 3T16A 2EY6A 1QG7A 4MN3A 4BBRB 5C0XI 1XXGA 1CK1A 2ZXOA 3P75A 1PRTC 2B2WC 3TP5A 4KD3A 2D5DA 3BS1A 4IFDG 1ILQA 3I90A 1AP0A 1S5BD 5D3IB 2Z8LA 1U4RA 5M5WB 4K8IA 3PUXA 1L0XB 4KJOA 4HAEA 3GV6A 2RBMA 1RTOA 3C2PA 3J7AV 1Y1WB 3EQLC 4XQQA 3GTQB 3EVQA 1S5ED 3O13A 4DAVA 1K8MA 2JYOA 3GTOB 1AZQA 1A3TA 3N52A 4RGTA 1X32A 4R8NA 3S15B 4O42A 1G6ZA 4KJNA 4DU9A 4H13C 2B2TC 2NN6G 1PZJD 2F0SA 4DXGA 4QF4A 5C5LA 1SYCA 3G6JB 3GTGB 2RKSA 5KNBA 1WTWA 3D4DA 5M3FB 3K5OA 2E2DC 1ET6A 4FF1A 2CW0D 2H1EA 3NWTA 1KDAA 3C46A 5IGGA 2AUJD 2F0DA 3TP8A 1BCPD 4R8IA 4ODGA 5ISRA 3EFXD 1WCMB 3A55A 4MIUA 1X3QA 3SHLA 4DNTB 1AZPA 2N55A 4U673 1ICWA 4XIGS 1EZ8A 2DY7A 2OEOA 4KV6A 4NP5A 4ZKBB 1I4GA 3VR3A 2H4OA 4AYBB 3D4RA 2CHBD 3CHBD 3TBIB 2F0MA 4UDUC 1QJOA 5F2DA 1JOOA 4F88A 1HFGA 4PV1C 5BN4A 1SE2A 1B50A 2QILA 1PYWD 2MPMA 2QEJC 3KLSX 3QG1A 4V190 1PTOC 2DNEA 4PNYA 3C1EA 1GUWA 5M5XB 2KJXA 4KD4A 5I2YA 4RGOS 4EQNA 1ENAA 5D3DA 4FXKC 4IUUA 4CKEA 1TKWB 2C9OA 2BE5C 2F0KA 2Y0SB 4EGVA 1TU2B 1EOTA 1I4PA 5EKIA 5A2QE 3D3RA 5I2XA 1HUMA 3A54A 4QMGA 2L12A 5JJZA 3EROA 4O1NA 2LY7A 1KABA 2B2VA 5FO8B 3MXGA 1K83B 1G8ZD 4PMCA 2R61A 1SYGA 5K36H 4KMUC 3MFYA 1FR3A 2A68D 2RQXA 2QCPX 3QB3A 3PIO3 1UUPA 3NTKA 1EYDA 3NSWA 1SE4A 5CBEE 3S1QB 3HOZB 3OOCA 2EXZA 3BZDB 2A69C 4ZKCB 4XTCS 2PMZB 4A3BB 2L0CA 3QOJA 1LT5D 2B2WA 3HZXA 5IOCA 1D5ZC 4XYOA 1S5CD 4FF2A 1H9SA 1IHZA 1X3PA 3D4WA 1CM9A 2KCCA 5DM63 5IT9E 4OGQC 3I4NB 2FHTA 5G3LF 3J80L 4EQOA 3HEJA 2J4XA 5E1FA 1IYVA 2VNUD 1TWGB 2SNSA 2XN9C 4B08A 1IKLA 2CVRA 3A8IE 1CA6A 4OO1H 1HFNA 5FOBB 1SAPA 5TSSA 1ILPA 1Z7TA 1BNZA 2F3VA 2O2LD 2VB3X 4EVOA 1D2BA 3OMGA 3TZDA 2EOTA 1Y8PB 3DWAA 3RD4A 5AFWA 1B1ZA 1LO5D 1Y8NB 3R2TA 2XSCA 5CV9A 4P2CB 1HPCA 1PRTD 2F0QA 2SEBD 2K04A 5DEHA 2M9VA 3NXWA 4FXGC 3QO2A 4F7XA 1A15A 5CR3A 2NTTA 2JA8B 5FKAC 3AB9A 4X3SA 3R93A 2F0OA 3JAME 1BF4A 1XWEA 1ZKOA 1QB5D 1VCIA 1E0BA 1STAA 2ZXRA 4JBWA 3IAYA 3J81E 4OHJA 2O5IC 1I3QB 3TMEA 4IQZA 1G91A 1EY6A 3I91A 4IFDI 4KKUA 1CQFA 2Q8RE 2AQ3B 4IN3A 5IGEA 2JA7B 3DHQA 1H9RA 3NK9A 4G57A 3CU7A 2JA5B 2Q8TA 4DXFA 2F3WA 4IUTA 1Z6HA 2IT1A 2B63B 1DZ1A 1DJRD 3KLRA 5T1IA 1Y1VB 1RKNA 2F0NA 2KCNA 4BBSB 1SMYC 4A3KB 3M7GA 1B4OA 3W3AA 1RODA 4BA1I 2NN6I 2XWJB 1GUOA 1QOHA 1R9TB 3P1HA 4I65A 2F0HA 3I8ZA 3MC0B 2K5WA 1WTQA 1ZYRC 3NTHA 2LS01 1IL8A 3ND8A 2B39A 1WD0A 2RSOA 4H0LC 1LTAD 4C3HG 5IGBA 1GUGA 5CORA 3PIP3 3IFTA 3DM1A 4J1MA 1NAPA 3MHBA 3SK5A 1TIID 4DAPA 5EBDA 2NVTB 1S5FD 1CHQD 4NDXA 5J1ZA 2SNMA 3N6RA 1O80A 2PO4A 2Z1CA 1GJXA 1PZID 3TDQA 2Z4IA 1A3VA 3MXNA 2BE5D 4RH6A 1Y69U 2NTSA 1OO9B 3VR5A 3GP7A 2AQ1B 4Q5VA 5EPJA 1SNOA 4KKTA 3OIQA 4KKSA 3BYYB 1HA6A 4PMBA 3H94A 1O7LA 3UI2A 1ESFA 4A3DB 2BCOA 2KUMA 3RMHA 1YNJC 1LTSD 2EY5A 4KN4C 5C4JB 3Q0AA 4MHEA 3SDZA 1EQVA 5E4XA 3TSSA 4XQJA 2A69D 3NWSA 2X6LA 3DWQA 1CTMA 4LJZC 4RKLA 4ME5A 1VDZA 1PFBA 5CV7A 5JVH3 1HCZA 4KN7C 3IL8A 2X69A 2L11A 3NQIA 3H09A 5EKLA 2FINB 5JEAJ 2R6GA 2F0GA 3H3VC 3RZDB 3E0JA 4X3TA 2E2JB 1ENCA 3KBGA 2G9HD 3VYRA 1D6EC 3Q22A 1JQYD 2HDLA 5KNCA 1BBXC 2TSSA 1DYQA 3HS0C 3NBHA 5KEEA 4ABNA 5CBAE 3MTSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PQE A;  3T13 A;  2F0T A;  3R3O A;  3T16 A;  4ID6 A;  2EY6 A;  1A3U A;  1EZ8 A;  3HZX A;  5C3X A;  5IOC A;  2OEO A;  4KV6 A;  4NP5 A;  4ZUJ A;  1EY7 A;  2M00 A;  3DMU A;  1SNP A;  3VA5 A;  3TME A;  3P75 A;  2F0U A;  4ZUI A;  2PZU A;  1IHZ A;  1EY6 A;  4YIJ A;  4WRD A;  1A3V A;  1STN A;  3D4W A;  3TP5 A;  1JOQ A;  1TQO A;  1KAA A;  4KD3 A;  2EYF A;  3LX0 A;  2F0M A;  5C5M A;  1A2U A;  2EY1 A;  2SOB A;  4NKL A;  1SNQ A;  4K5W A;  1JOO A;  3DHQ A;  4K2K A;  5F2D A;  1TR5 A;  3V2T A;  4EQO A;  5I6W A;  2F0L A;  1EY4 A;  1AEX A;  5IGD A;  5CV8 A;  3HEJ A;  2F0V A;  3NK9 A;  5E1F A;  4G57 A;  4QB4 A;  5NUC A;  4IAL A;  2EYO A;  3SK8 A;  3MZ5 A;  5C4Z A;  5I6Y A;  3BDL A;  5KGU A;  4E6I A;  4K8I A;  5EGT A;  4DFA A;  3MVV A;  4PNY A;  2SNS A;  1NSN S;  1JOK A;  3C1E A;  1F2Z A;  5M9O A;  2EYH A;  4KJO A;  3TP7 A;  2F0W A;  2F3W A;  2LKV A;  1SNO A;  4RKB A;  3QOL A;  4K5X A;  4H7B A;  5C6A A;  4KD4 A;  1U9R A;  2EYJ A;  3TP6 A;  5CC4 A;  2ENB A;  4PMB A;  2EYL A;  2RBM A;  4K14 A;  5CV4 A;  4K8J A;  2KHS A;  4EQN A;  1STH A;  1RKN A;  4K2L A;  5JOB A;  2OXP A;  1JOR A;  3OMC A;  2HQE A;  4NMZ A;  1ENA A;  1EZ6 A;  3S9W A;  2F0N A;  1EY8 A;  5K5P A;  4KY5 A;  3RUZ A;  2EYM A;  2WAC A;  3EVQ A;  3PMF A;  4IUN A;  5J39 A;  4N9P A;  2EY5 A;  1II3 A;  4F8M A;  2F0P A;  5IGC A;  4B9X A;  5KRU A;  2EYP A;  4HMI A;  1EQV A;  3D8G A;  1SNM A;  2F0K A;  1A2T A;  2F3V A;  3U9O A;  5CGK A;  3OWF A;  1A3T A;  1EY9 A;  2KQ3 A;  2PYK A;  4ZQ3 A;  4EVO A;  3SXH A;  4DGZ A;  1NUC A;  3OMG A;  4R8N A;  4K5V A;  2EY2 A;  2QDB A;  4K6D A;  2F0F A;  2F0I A;  3ERQ A;  4KJN A;  4RKL A;  4ME5 A;  3OSO A;  4DU9 A;  3NP8 A;  3P1H A;  4QMG A;  5KYI A;  4B9W A;  4LAA A;  4OL7 A;  5CV7 A;  4I65 A;  1SYE A;  5EKK A;  2F0H A;  3MEH A;  5I9O A;  5DAU A;  2F0J A;  4TRD A;  4EQP A;  1SYD A;  2F0S A;  3ERO A;  4QF4 A;  1F2M A;  3E5S A;  4HTH A;  4KTA A;  5C5L A;  5HUR A;  1KAB A;  1STB A;  1SNC A;  5CV9 A;  5CV5 A;  1SYC A;  5JAV A;  5C4H A;  5EKL A;  3NHH A;  1EY0 A;  2F0Q A;  2RKS A;  4N9T A;  2O4X A;  3MXP A;  4PMC A;  1TT2 A;  5IOD A;  3D4D A;  5DEH A;  2RDF A;  3NXW A;  1SYG A;  3C1F A;  5I9P A;  2NUC A;  2F0G A;  4HMJ A;  5HGT A;  1KDA A;  4J6H A;  1STY A;  5E3F A;  5IIF A;  4F7X A;  5IGG A;  1ENC A;  4KY6 A;  3SR1 A;  5IGB A;  3SK4 A;  5IGE A;  1SYF A;  3NUC A;  2F0D A;  3QB3 A;  5CR3 A;  4S3S A;  4J1M A;  4KY7 A;  5C3W A;  3TP8 A;  1EY5 A;  4ODG A;  3D6C A;  1EYD A;  3EJI A;  3H6M A;  3ITP A;  4IZ8 A;  5ISR A;  3MHB A;  3SK5 A;  1STG A;  1SYB A;  5KYL A;  4MIU A;  4WOR A;  4DF7 A;  2PZT A;  2F0O A;  5CV6 A;  2PW7 A;  2PZW A;  1KDB A;  2EXZ A;  2F0E A;  1EYC A;  1EYA A;  2SNM A;  3BDC A;  3NQT A;  4KHV A;  3SHL A;  5IGF A;  5KEE A;  1STA A;  4NDX A;  5J1Z A;  1SND A;  2PW5 A;  3SK6 A;  1KDC A;  5KIX A;  5J22 A;  3QOJ A;  2OF1 A;  1F2Y A; 
#chains in the Genus database with same CATH topology
 2BOS A;  1L0W A;  1J5E Q;  1NR4 A;  3ERS X;  2ICE C;  1E2V A;  1M4V A;  2E2I B;  1U5K A;  1MIU A;  2B2V C;  4JI3 Q;  1OTC A;  4JK1 C;  4L5S A;  2YYZ A;  5M5Y H;  1STN A;  3I4N H;  4M1U B;  4C3J G;  3F2B A;  3QIA A;  4HIM A;  2VQE Q;  2KCT A;  4HSV A;  1EY4 A;  2TMP A;  4LFA L;  3D0F A;  2F4V Q;  1E2Z A;  1R4Q B;  3MZ5 A;  2VUM B;  3FEW X;  3VR6 A;  4JI8 L;  4CJ2 C;  2WB1 E;  4XXE A;  3M4Q A;  1DOM A;  3BYT B;  5C3E H;  2UU9 L;  5COY A;  2EYJ A;  3HOV H;  2WP8 J;  2ENB A;  3PO2 B;  4A3E H;  4DV1 L;  2K7V A;  4IUP A;  1F9R A;  2X6G A;  4LFB L;  4HSP A;  4ZLT F;  2J0T D;  4R4C A;  1XMQ L;  3QJY A;  2G9D A;  4RCO A;  3UDX A;  3M3Y H;  4N9P A;  2F0P A;  1LAB A;  1K3B C;  4JW0 A;  1IW7 C;  3RN2 A;  3A8J E;  3U9O A;  1H9J A;  4DGZ A;  2HD3 A;  4DR6 L;  1W6K A;  2R7Z G;  3NP8 A;  4MTK A;  1EU3 A;  4JI0 L;  3MXN B;  1V1Q A;  2GA4 B;  4MZ9 A;  1T9H A;  4A3F G;  3T53 B;  1STB A;  1VF5 C;  1ONL A;  2KOL A;  2IL8 A;  3NEL A;  4N9T A;  1XPO A;  3M4P A;  4A3I B;  3LNN A;  3S14 H;  2QF7 A;  4J6H A;  2JA6 B;  5C44 G;  1YVC A;  1VMC A;  4FF4 A;  1PMR A;  2JA8 H;  1HJP A;  2VQF Q;  3CCE A;  3BVG A;  1PH1 A;  1HQR D;  1STG A;  3TRE A;  4YWM A;  4BY1 H;  4KHV A;  3TRZ A;  5K36 G;  4G4K A;  1HRJ A;  3NEN A;  3CCL A;  1NJI C;  4OWT B;  2F0T A;  1K8A C;  1W6J A;  3K59 A;  3J7A 5;  4UPA A;  4ILW A;  4JBJ A;  3AYH B;  1HNX L;  3UE0 A;  4H44 C;  3DMU A;  2ZT9 C;  1SNP A;  4Z9C B;  1VF7 A;  4YIJ A;  4CHT B;  2VB2 X;  3W1G A;  1BXT A;  1MSG A;  4ZAI A;  2JA7 H;  1S72 A;  1JE5 A;  3KUP A;  4YCW A;  2HQL A;  2L4N A;  3A7L A;  3VR4 A;  5C0X J;  1SXT A;  1KLU D;  2JA5 H;  1O7Z A;  4DNR B;  2OCE A;  5NUC A;  2JN4 A;  5KGU A;  3I4M H;  3KDF B;  4WJ4 A;  1I5F A;  2I5L X;  2IWH A;  2EYH A;  3FPP A;  1U9R A;  1S40 A;  3TP6 A;  1Y1V H;  4IUQ A;  4FYD A;  1M90 C;  4JI3 L;  1X3E A;  1X3G A;  1STH A;  2OXP A;  4RAU C;  2WIN B;  4OIK A;  1R4P B;  2F1M A;  3IFD A;  4JVZ A;  4KHZ A;  1D5M C;  3J80 c;  3NBH B;  1PH2 A;  4GZY C;  2RHQ B;  4IJH A;  3ICE A;  5IGC A;  1KQS A;  2R93 B;  4XQN A;  1A2T A;  4DV4 Q;  1H95 A;  5FLX c;  2CH4 W;  1JWM D;  4OO1 G;  1R9T H;  2A6E C;  2KBN A;  4V0B A;  3ERQ A;  2NYZ D;  1A62 A;  1UE1 A;  4IPC A;  1C8C A;  4A3G B;  4JG2 A;  3H91 A;  4Q0F A;  3CQZ B;  1SNC A;  2RDG A;  1EYG A;  3K80 C;  4DV5 Q;  2AQ2 B;  2D62 A;  3K7A B;  1TWF H;  4I7Z C;  2K5H A;  2KEC A;  2EZV A;  3MXP A;  5J3B A;  2VY3 A;  3HOY G;  1WTR A;  5IP7 H;  4C3I B;  4MNO A;  4PQX A;  3OYY A;  2A73 B;  4HED A;  2NZ1 D;  1HH2 P;  4JBM A;  2EQS A;  1VQM A;  3I4O A;  1BKB A;  3I72 A;  1AN8 A;  3GTL B;  1KDB A;  1YNN C;  1K9M C;  1YIJ A;  1IL2 A;  1SND A;  1EWC A;  1CKN A;  3VR2 A;  5LL6 S;  1N36 Q;  1ASY A;  2OTL A;  2AWN A;  4POG A;  1PXU A;  3AFP A;  4RCN A;  2PPB C;  2K33 A;  1WTX A;  1EEI D;  4ZUJ A;  3PUY A;  2XIW A;  1DON A;  3WOE A;  1SBB B;  4DUZ Q;  3CPW A;  2F0U A;  1PZK D;  2XNA C;  2E2H B;  3HG9 A;  4DAY A;  1VQA A;  2A8V A;  4LF8 L;  1KAA A;  4LW1 A;  2R7F A;  2R92 H;  3M7N A;  2ZM6 L;  5C5M A;  4DV0 L;  1H9M A;  2EY1 A;  2SOB A;  4DR3 L;  1DGS A;  4UP8 A;  3T4A C;  1KC8 C;  1TR5 A;  4IPD A;  1JCK B;  5IGD A;  2EJF C;  4CBV A;  5C4X G;  3K5M A;  4PMW A;  3PUW A;  1K0R A;  2IW3 A;  5EGT A;  3G4S A;  3W5O A;  1EFI D;  1K8O A;  3TP7 A;  4A3L G;  2EVB A;  4H7B A;  5EPL A;  3HKZ G;  2UUB Q;  2ZXP A;  1EOV A;  4A3D H;  2EYL A;  2A6H D;  4OEL B;  5CYU A;  1JOR A;  4C3H B;  4KK7 A;  5L37 A;  3S9W A;  3BZK A;  5JPM C;  3I73 A;  1PH8 A;  3GTK B;  3H0G B;  1JE4 A;  4DR7 Q;  1AH9 A;  4DR4 L;  3FKI B;  5JEA H;  1HR0 W;  3P7J A;  4JI7 L;  1SE3 A;  1C9O A;  5FLX L;  1QCB D;  4K5V A;  2GVA A;  3CAM A;  3F1Z A;  3PQI A;  4RHS A;  3OW7 A;  3WOF A;  1P16 A;  3S2D H;  1OXU A;  2KA7 A;  1PTO H;  3MEH A;  1ET9 A;  5I9O A;  3BDO A;  1F2M A;  1WI5 A;  1CHP D;  3A56 A;  1VQN A;  3PO3 H;  1IYU A;  1SE8 A;  4H02 A;  1QUQ A;  4BY7 G;  2UXB Q;  1TT2 A;  4J8Q A;  4ZYS A;  1N34 Q;  3L3O C;  5BN5 A;  5DLQ E;  2IY5 B;  5HGT A;  1BCP F;  3HGB A;  1N33 Q;  4CJ0 B;  2XGT A;  1PFN A;  1KL9 A;  3NUC A;  4A93 B;  5AJ3 Q;  1IBM L;  5EJW A;  4DV4 L;  3EJI A;  5IWA L;  2L15 A;  4BS9 A;  2ASB A;  4DF7 A;  5GAE C;  1SJE D;  4B3M Q;  1I4X A;  4UP9 A;  1ENF A;  4GLX A;  4JI4 Q;  4DR2 L;  2PW5 A;  3CME A;  1Q1E A;  4ZCK A;  5GQO A;  4UAI A;  1E1T A;  1RDP D;  5M3M B;  2OTJ A;  5IYC H;  4HJA A;  2WV6 D;  4ID6 A;  1IBK Q;  1GXD C;  2GVB A;  3GTJ H;  1Q3L A;  3HOX H;  4X64 Q;  3K81 C;  4WRD A;  3UDF A;  2RSN A;  4LF9 Q;  1EL0 A;  1TQO A;  4HCS A;  1I50 B;  2A19 A;  2DN8 A;  2MFI A;  1LTG D;  2NVY H;  3UE1 A;  3SVM A;  3I55 A;  1M1K C;  4BXX G;  2BA1 A;  1CI3 M;  2F4I A;  3ND9 A;  4AYB E;  2HIX A;  1IBL Q;  1EIY B;  4QB4 A;  1V1O A;  1PHJ A;  3SK8 A;  1YBY A;  1OXT A;  3URY A;  4HIK A;  4BBR H;  2XWB B;  1VQF A;  1NNX A;  3A7A B;  5C6A A;  1N36 L;  3RZO B;  1GUT A;  5CC4 A;  3F2D A;  4APV A;  1AFP A;  1SN8 A;  4K8J A;  4ZRZ A;  4B3S L;  5FO7 B;  1T5X D;  3U58 A;  2YU9 B;  1HZB A;  4A3C H;  3KLS A;  2L1B A;  1KHI A;  5M5W H;  1CKN B;  1GHJ A;  2AUK A;  4OIJ A;  2EYP A;  3S1R B;  3Q24 A;  4GNX C;  1DCZ A;  2IX3 A;  1NCV A;  1F9P A;  4G7Z C;  3HOW B;  4X3U A;  2EY2 A;  4BA2 I;  2F0F A;  4DAY B;  4I7A A;  4B9W A;  4OL7 A;  1SYE A;  1WTH A;  1VQD A;  5GRO A;  5A2Q L;  4P72 A;  2K5Q A;  3E5S A;  1Y1W H;  3ZJY C;  4YWK A;  2Y0S G;  3GTQ H;  5JAV A;  3K5L A;  1RF2 D;  3STB D;  4C3J B;  4DV7 Q;  4QUC A;  5IOD A;  1XMO L;  1VQ8 A;  2K03 A;  2Z9H A;  3GTO H;  1WJJ A;  1V43 A;  1S3O A;  1JIC A;  1NMG A;  2JA6 H;  2QKI C;  2IX1 A;  3S15 H;  2L55 A;  1LTI D;  1NMF A;  2K32 A;  3GO5 A;  3SR1 A;  3SK4 A;  3X3N A;  1SYF A;  3KF6 A;  4YHH Q;  2K50 A;  3J80 i;  5C3W A;  3AMU A;  4WJ3 M;  1CZG A;  1J8I A;  2CW0 C;  2CQA A;  3NQT A;  3NBI A;  1EYC A;  3GTG H;  4HCE A;  2D9U A;  2MNA A;  4DK6 C;  3DXJ C;  5C0X H;  1S4Z A;  2IJ0 A;  1X6O A;  5M3F H;  2K5N A;  3K6O A;  1JJG A;  5ELD A;  3CCU A;  1LV9 A;  1G2T A;  2WAQ B;  5IY0 A;  1KIX A;  2B2Y A;  1BOS A;  3A5Z B;  1AE2 A;  2D0O A;  5EAY A;  4ZUI A;  4BWG B;  1WCM H;  5EPK A;  1PTO D;  1X56 A;  2EYF A;  4RWS C;  3CP0 A;  1O7I A;  4LFA Q;  1FJG Q;  2A5H A;  3M4O B;  5C3X A;  4K5W A;  4K2K A;  3VYT A;  2R7Z B;  4JI8 Q;  1QUQ B;  4C1N I;  4IFD J;  5E4W C;  3HFZ B;  2UU9 Q;  1JWU D;  1TWC B;  2BDN A;  4B3M L;  1Q90 A;  2DJF C;  2DY8 A;  4P74 A;  4JI2 L;  2PCF B;  1F2L A;  3I4N G;  4DV1 Q;  3DEP A;  3M4Y A;  4LFB Q;  4K5X A;  3KF8 B;  1QVG A;  4A3J B;  1XMQ Q;  4WFN 3;  1HQM C;  2AHO B;  5HGQ A;  2JK8 A;  1QE6 A;  4IUN A;  4AIM A;  5C3E G;  2RA4 A;  3BZC A;  4XT3 B;  4DR6 Q;  1VQB A;  4OO1 I;  5BN3 A;  3HOV G;  4U68 A;  4A3E G;  1YNN D;  1J6Q A;  2M2L A;  1VMP A;  5M5X H;  1IBL L;  4ZQ3 A;  1F9Q A;  2F0I A;  4A3M B;  5ELF A;  4PG3 A;  3MA2 B;  4DV6 L;  5EKK A;  1PRT F;  1FL0 A;  5HUR A;  4L8J A;  1VQI A;  1QWY A;  2D0P A;  3T51 B;  5C4H A;  1LYL A;  3V96 A;  2JA9 A;  5EQ0 A;  2VW9 A;  1XTC D;  4C3I H;  3VA7 A;  3I2Z A;  3L7Z C;  1ML0 D;  5I9P A;  3ONA B;  1CFM A;  4HJ9 A;  2Z4H A;  1SDF A;  1E24 A;  3S17 B;  1STY A;  2JP1 A;  4KI0 A;  2NWG A;  3VYS A;  3VYU A;  2FJ2 A;  3Q6S A;  1PH5 A;  4DK1 A;  3D6C A;  3MXU A;  3PGZ A;  5IE8 A;  4L5R C;  2NVQ B;  4DK3 C;  1C4Q A;  3GTM B;  1K83 H;  2MP1 A;  3KLW A;  1HNX Q;  2N78 A;  5D14 A;  5ELO A;  3RLF A;  3JC6 6;  3UDG A;  2JA8 G;  1D1K A;  3KBX A;  1Q82 C;  2E2H H;  4BY1 G;  1PV4 A;  1TWH B;  2JEB I;  2PZU A;  5EBC A;  1QVC A;  1U4P A;  2I07 B;  5GAD C;  3HOZ H;  2XRQ D;  4JBK A;  3AEV A;  4A3B H;  4DKA C;  1B3Q A;  3RN5 A;  2VS1 A;  4EX5 A;  3CXC A;  2EJM A;  1KAW A;  1HA5 A;  3U4Z A;  3MVV A;  2HCC A;  2EXD A;  1O78 A;  2JA7 G;  4RFB A;  2UUC L;  1TXY A;  3KF6 B;  4GLA C;  3T1Y L;  1YI2 A;  3HOY B;  2FMM A;  2WII B;  1ESR A;  1K0S A;  2JA5 G;  2KEE A;  2KHS A;  1SJH D;  4Y52 H;  1E7Z A;  3I4M G;  4KY5 A;  1H9K A;  4GNX A;  3FKI H;  3RR5 A;  4YCV A;  1PH6 A;  3D6W A;  1FJG L;  3TN2 A;  4B9X A;  4Y7N B;  1CKO A;  1TWG H;  2CH4 A;  5KRU A;  1Y1V G;  2L9H A;  5CGK A;  3M85 A;  4RA8 A;  3KOJ A;  1OXX K;  3E6Z X;  1JJC B;  4CDF C;  2WB1 G;  1HNZ L;  1ZXT A;  4CDE C;  5KYI A;  3FVQ A;  4G7O C;  4B3T L;  1GD7 A;  3PUZ A;  1DM0 B;  1V8Q A;  1HTL D;  3Q23 A;  2QDL A;  3IKJ A;  3HOU B;  2Q2T A;  3NHH A;  3NE5 B;  5FLM H;  4JPB W;  1SFO B;  2K1B A;  2K5D A;  1BQQ T;  1EWH A;  2ZJR A;  2RDF A;  3S2H B;  2F03 A;  1HZC A;  2NB0 A;  1PTO F;  2K6A A;  3ZYY X;  2E74 C;  4LK1 C;  5C4X B;  2C5C A;  4LMQ D;  1XX8 A;  4KY7 A;  4XDX A;  1Y14 B;  3OTO Q;  5LMN Q;  1HZ9 A;  4IZ8 A;  2WAQ E;  2K05 A;  4CKC A;  2P5Z X;  1SLJ A;  5IP7 G;  1E3P A;  2F3I A;  5IGF A;  3HKZ B;  3WDN A;  3SK6 A;  5KIX A;  2MO0 A;  1F2Y A;  1XNR L;  1QVF A;  1Q46 A;  2O5J C;  4YY3 Q;  3R3O A;  1DXM A;  4R1J A;  4QCL A;  1QZG A;  4LF8 Q;  3OWE B;  2ZM6 Q;  4DV0 Q;  3QWN A;  4DR3 Q;  3LGJ A;  2I46 A;  3J80 E;  2HUG A;  3FRP B;  3LX0 A;  3H3V H;  1ASZ A;  3A8K E;  3OIP A;  3WWV A;  2NVX B;  3J81 j;  3BVZ A;  4LFC L;  1SSO A;  5FLX E;  5G3L D;  1QIL A;  3CRL C;  5C4Z A;  1FGU A;  4JYA L;  4C56 C;  4LF5 L;  5M9O A;  1KLG D;  1I3Q H;  2R92 G;  4QIW B;  3J7Y W;  4JI6 L;  3RZO H;  4BY7 B;  2WKC A;  3QOL A;  1SMY D;  4IOA A;  3CPF A;  2EPB A;  1U0L A;  1NY4 A;  1MJE A;  5LMU L;  3F2U A;  2JE6 I;  1UE7 A;  2DGY A;  2YU9 H;  2B2U C;  3OMC A;  4HJ8 A;  4DR4 Q;  1EZ6 A;  2NZO A;  4C2M B;  1FNV A;  2HT1 A;  3RUZ A;  2WAC A;  1LT3 D;  1II3 A;  1UWV A;  4JI7 Q;  3S1R H;  1TS3 A;  4FF3 A;  4XYQ A;  4HMI A;  3KK7 A;  1MBY A;  1SNM A;  4A4I A;  4A3D G;  1ZYR D;  2EDG A;  2RHS B;  5I4D A;  5JVG 3;  1HUN A;  2PYK A;  2B63 H;  1U4M A;  1X65 A;  3RNU A;  3K0Y A;  2N8N A;  3NTI A;  1WTO A;  4LF7 L;  2PNH A;  1MD2 D;  5IYB H;  1HTP A;  1EIH A;  1B2T A;  4EQP A;  4FO2 A;  1VQ9 A;  1Z9F A;  4HTH A;  4X65 Q;  1RTN A;  2ID0 A;  1C7Y A;  4GN5 A;  2HIV A;  1TVX A;  1TS4 A;  5JEA G;  2ZTC A;  3KYH C;  3NPP A;  4A3K H;  4BBS H;  1C0A A;  3ER0 A;  3CCV A;  3S1M B;  5JJK A;  4HMJ A;  2K4K A;  1IBM Q;  2FXQ A;  4JCV E;  1T5E A;  5IWA Q;  4KY6 A;  1EFW A;  1L2F A;  1LTR D;  1SR3 A;  3P20 A;  3PO3 G;  2BH8 A;  4DR2 Q;  1SYB A;  4WOR A;  2PW7 A;  2PZW A;  5ELB A;  2VXW A;  3PUV A;  4GNX B;  4DR1 Q;  1F77 A;  1HNW L;  3DEO A;  4IFD H;  2B8G A;  4X62 L;  1A3U A;  1OXV A;  5CMD A;  4FNF A;  3VA5 A;  1AE3 A;  2I5M X;  2JJQ A;  4HID A;  1DOK A;  1C48 A;  1EQT A;  3LWE A;  1JC7 A;  1EU4 A;  1YHA A;  4IUR A;  2ES2 A;  1E2W A;  1A2U A;  4GKJ L;  5IYC G;  2NVT H;  3BG3 A;  1Z47 A;  1I4Q A;  3OTO L;  3W1B A;  3I56 A;  5LMN L;  4N8X 1;  4TSS A;  3S16 B;  5CV8 A;  1F9S A;  1TWC H;  4TQU S;  3I70 A;  2C35 B;  2V4D A;  2LMC B;  3HOX G;  4IAL A;  3PV0 A;  1B44 D;  1Q12 A;  5I6Y A;  1NSN S;  1YNJ D;  4A3J H;  1LUZ A;  4N8F A;  2LKV A;  4B3S Q;  3C3L A;  4DN4 M;  5KND A;  4YY3 L;  4JV5 L;  2JEA I;  1IXR A;  4K14 A;  4B3R L;  3CKI B;  5ELC A;  1EQR A;  1I6H B;  1BCP B;  1PDQ A;  1A6X A;  4IPG A;  1K8G A;  2B2Y C;  1I4H A;  1EY8 A;  4BBR G;  2NN6 H;  4UY8 C;  2MJ8 A;  3HRZ C;  1TS2 A;  5GAG C;  4WJW A;  3D8G A;  1JR0 D;  4A3M H;  2Q2H A;  2RVL A;  2RDH A;  4K6D A;  4A3C G;  1B53 A;  3LWU A;  3BVM A;  3MAQ A;  1G51 A;  5BR8 L;  1WTV A;  1Q8K A;  4IOC A;  2KHI A;  3R8B A;  3CCQ A;  1TWA B;  1XNQ L;  1XMO Q;  4LF6 L;  1KRS A;  4GN3 B;  5C4J H;  2O4X A;  4FXD A;  1UEA B;  1L1O C;  1N32 L;  4RGM A;  2OT2 A;  2HHH L;  2UXD L;  4X6A H;  4YCU A;  5IIF A;  1Y1W G;  3IRB A;  4NPS A;  2WKD A;  1GOZ A;  1D5X C;  3ITP A;  5M5Y B;  2AWO A;  2UUA L;  5A35 A;  5KYL A;  2PZT A;  1NTG A;  4A3I G;  1EYA A;  1B70 B;  2JA6 G;  3L2P A;  1KDC A;  5J22 A;  4DK0 A;  4RMF A;  3T13 A;  4X65 L;  1EQQ A;  1FNU A;  2L5T A;  3RZD H;  2E2J H;  4CDC C;  1TWH H;  1EY7 A;  2M00 A;  1QNU A;  3CRK C;  1KXL A;  1I6V C;  5C3E B;  2Q2U A;  3KF8 A;  1DOL A;  3HOV B;  1KNE A;  1JOQ A;  3HP3 A;  5C0X G;  4G7H C;  1LT6 D;  2A1A A;  4A3E B;  1O7Y A;  3S1N B;  5M3F G;  1CSP A;  4NKL A;  1FD7 D;  3T56 B;  1AEX A;  1LTB D;  2F0V A;  3CW2 C;  4JI2 Q;  3M3Y B;  4AH6 A;  3D31 A;  3BDL A;  3EA6 A;  2B2T A;  2E2I H;  1IKM A;  3PIP A;  1WCM G;  4DR1 L;  2B2U A;  1F2Z A;  5IYD H;  4FDB A;  3R2I A;  1UAP A;  1CZW A;  1WVL A;  5CV4 A;  1IW7 D;  1FNW A;  1B8A A;  1STE A;  2B8F A;  4O2D A;  5IT9 c;  5K5P A;  2IPK D;  5J39 A;  4AYB G;  3GQB A;  2VUM H;  1MSH A;  1EWI A;  2A74 C;  1WTP A;  2N3S A;  4K6L A;  4DV6 Q;  3S14 B;  3FDT A;  1BR9 A;  3PO2 H;  4DA2 A;  1PFM A;  3KJP A;  2R93 G;  3K7U C;  3HOU H;  4X3K A;  4KTA A;  4TKO B;  2ATW A;  4BY1 B;  1KNA A;  2XRS D;  1EEF D;  4FP5 D;  5JPN C;  3TEH B;  1LTT D;  1S5D D;  1TY2 A;  3K5N A;  3SE0 A;  3FPU B;  3C1F A;  2NUC A;  1CQV A;  1GUN A;  4LNQ A;  2OQ0 A;  1JB3 A;  1HHV A;  1LT4 D;  2EE1 A;  2JSO A;  3H6M A;  4IPH A;  2JXM B;  2BDO A;  1V1P A;  4C3I G;  1Q8I A;  5CV6 A;  2F0E A;  1MI2 A;  3BDC A;  1GHK A;  1PFS A;  4FVM A;  1X55 A;  2BA0 A;  4NXN L;  4F87 A;  1VQE A;  1CT1 D;  1M8A A;  1MGS A;  1FGB D;  4A3I H;  4CGY B;  4HR7 B;  3I4M B;  2SDF A;  1L0Y B;  4OWX B;  4HN7 A;  4XT1 B;  4OX9 L;  4L63 B;  3S24 A;  5D65 A;  3EIV A;  3TZU A;  2NVX H;  1ZEQ X;  3K58 A;  2WB1 B;  1X9N A;  2F0L A;  1TS5 A;  3JAM c;  3G6E A;  1PRT B;  1SRO A;  2FMC A;  2Z6K C;  3MWY W;  1BCP C;  2UUC Q;  4E6I A;  3T1Y Q;  1TY0 A;  4GOP A;  3HOZ G;  4QQB X;  3CCM A;  1H9S B;  3L9A X;  2IX0 A;  4JC0 A;  1BBW A;  3J81 c;  2HCI A;  3AU7 A;  4A3B G;  1GKH A;  3TQY A;  3MFG A;  4K2L A;  2AKW B;  5FJ8 G;  2HQE A;  2A6E D;  2EYM A;  5IT9 L;  2DUD A;  1TWF B;  3OPO A;  1SEB D;  4A3F B;  4DV2 Q;  1WFQ A;  1RCV D;  3GV3 A;  1HNZ Q;  1EIG A;  3OWF A;  1JB7 A;  4B3T Q;  3SXH A;  1B9N A;  4R9W A;  2MGS A;  2K28 A;  4LAA A;  2MQH A;  2PNR C;  3FKI G;  5T1G A;  5DAU A;  2F0J A;  4TRD A;  1SYD A;  3U9S A;  3W2D A;  3CC7 A;  1L1O A;  2ZTE A;  2KED A;  4M8A A;  5C44 B;  4ULL A;  2E8G A;  1RD9 D;  1EY0 A;  2E75 C;  2Q8I B;  2R93 H;  4R4O A;  1B7Y B;  2NZH A;  4HJ5 A;  2YTX A;  1GM5 A;  5DM7 3;  3T1H L;  5DNF A;  4RGN A;  2K01 A;  2ALY B;  2D2C C;  1G29 1;  1XTD A;  1JWS D;  5E3F A;  5FK9 C;  4A3G H;  3GDE A;  1EY5 A;  3I3C A;  4RG1 A;  5FLM G;  3J7A F;  3CQZ H;  1J9O A;  4P71 A;  4NMZ A;  3U50 C;  2R92 B;  4ZK9 B;  1XNR Q;  3K7A H;  3H15 A;  3I4L A;  3E3X A;  4KLK A;  3KJO A;  1D1I A;  4A76 A;  4NW2 A;  1Y8O B;  2ICI A;  3G7L A;  2MUY A;  2RF4 A;  4ALP A;  4CJ1 B;  2QA4 A;  2QW7 A;  2ZJQ A;  1JMC A;  2R3Z A;  1Q81 C;  4GKK L;  4RHR A;  2N49 A;  3DUZ A;  3GTL H;  1UNS A;  3F8T A;  4LFC Q;  3V2T A;  5JJI A;  1SNQ A;  3S16 H;  1RJT A;  5GAH C;  5I6W A;  1DD2 A;  4R4Q A;  2A68 C;  4JYA Q;  3SEB A;  4LF5 Q;  1CKM A;  3JAM L;  1WYD A;  1U4L A;  4NXM L;  2EYO A;  4JI6 Q;  4X66 L;  1BO0 A;  4DFA A;  4AQY L;  1JOK A;  3FMC A;  5LMU Q;  2F0W A;  1B3A A;  1B9M A;  1Q1B A;  4RKB A;  5LHY 1;  3J81 L;  1I6H H;  2RCN A;  1I94 L;  4GN4 B;  4P73 A;  1QZH A;  3S2D B;  1V1P B;  2LFN A;  2KHJ A;  1PTO B;  1KTK A;  5JOB A;  1OXS C;  1BVS A;  1YJW A;  1BUV T;  1PYS B;  3GTP B;  4L6T B;  2MHV A;  3PMF A;  1X54 A;  1BDO A;  1I4R A;  3PO3 B;  1RHP A;  4F8M A;  3E9H A;  5FJ8 H;  4NB3 A;  2A6H C;  2DNC A;  1GUS A;  3G48 A;  4LF7 Q;  1HXY D;  4K0K L;  1EY9 A;  2KQ3 A;  1FYC A;  3AFQ A;  3OHX C;  1NUC A;  1WD1 A;  2QDB A;  3DM3 A;  1SRU A;  4OON A;  3OSO A;  3DWP A;  2KVM A;  1TWA H;  1XPR A;  4C3H H;  3SGI A;  5FO9 B;  1AW7 A;  1XYI A;  4DUY L;  3GD7 A;  3ULJ A;  3GTK H;  1FVI A;  3V05 A;  5LL6 X;  5CV5 A;  3H0G H;  2IHF A;  1PLF A;  2EJG C;  1LAC A;  3MEF A;  3TS2 A;  2B63 G;  3QR8 A;  3CF5 A;  2CKZ B;  4ME3 A;  2B29 A;  4GOP B;  1G6P A;  5IYB G;  4QUF A;  5ELE A;  4DPG A;  1QNK A;  1G2S A;  1NR2 A;  1W3S A;  1CA5 A;  2CQO A;  3GTJ B;  3HOX B;  4S3S A;  4DV2 L;  3K57 A;  4BBS G;  4KHP L;  3X3M A;  4A3K G;  1LLR D;  4CKB A;  1HNW Q;  1KRT A;  2YV5 A;  4C1N K;  2HDM A;  2NVY B;  4IUV A;  4X62 Q;  2CCZ A;  2J7Z A;  2NBF A;  2KEN A;  2FFK B;  2OF1 A;  2E76 C;  2PQE A;  2XVS A;  2N88 A;  3T16 A;  2EY6 A;  4JOI C;  1QG7 A;  4MN3 A;  4BBR B;  5C0X I;  1XXG A;  4LF4 Q;  1CK1 A;  2ZXO A;  4A93 H;  3J7Z C;  2PQA A;  2MO1 A;  3P75 A;  1VQ6 A;  4GKJ Q;  1PRT C;  2B2W C;  1WOC A;  3S1N H;  3TP5 A;  4KD3 A;  2D5D A;  1VQ7 A;  1L1O B;  2Z6K A;  3BS1 A;  4JI1 L;  4IFD G;  1ILQ A;  2WAQ G;  1SMX A;  3I90 A;  1AP0 A;  1S5B D;  5D3I B;  5M3M H;  1Q86 C;  2Z8L A;  1U4R A;  4PZ6 A;  5M5W B;  3FP9 A;  4K8I A;  4JV5 Q;  3PUX A;  1L0X B;  4B3R Q;  4KJO A;  1PVO A;  4HAE A;  3GV6 A;  2RBM A;  1I50 H;  1RTO A;  3C2P A;  1HR0 L;  3J7A V;  4DV3 L;  1Y1W B;  4HJ7 A;  3EQL C;  1RL2 A;  4XQQ A;  3GTQ B;  3EVQ A;  1S5E D;  3O13 A;  1ICF B;  4A3J G;  4DAV A;  1K8M A;  3E9I A;  2JYO A;  3CCS A;  2OWO A;  3GTO B;  1AZQ A;  1A3T A;  2Z0S A;  3N52 A;  5BR8 Q;  4RGT A;  1X32 A;  3PIO A;  4R8N A;  3Q8D A;  3S15 B;  3PSI A;  4O42 A;  1G6Z A;  1XNQ Q;  4KJN A;  4DU9 A;  4H13 C;  4CDD C;  5H1S E;  2WFW A;  2B2T C;  2NN6 G;  5IP9 H;  4LF6 Q;  3JAM i;  1PZJ D;  2F0S A;  4DXG A;  4QF4 A;  5C5L A;  1N32 Q;  1SYC A;  1VQC A;  1YHB A;  3G6J B;  3GTG B;  2UXC L;  2HHH Q;  2UXD Q;  2RKS A;  5KNB A;  4A3M G;  1WTW A;  4DAM A;  3D4D A;  5M3F B;  3K5O A;  3J81 i;  2E2D C;  2AMC B;  1ET6 A;  4FF1 A;  2CW0 D;  2H1E A;  1GO3 E;  3NWT A;  1KDA A;  3C46 A;  3HOW H;  5IGG A;  2UUA Q;  2E5L Q;  2AUJ D;  4JI5 Q;  2F0D A;  2YTV A;  3STB C;  2R7D A;  1BCP D;  3TP8 A;  4ODG A;  4R8I A;  5ISR A;  3EFX D;  1WCM B;  2B3G A;  3A55 A;  4MIU A;  2I0Q A;  1X3Q A;  3SHL A;  3NEM A;  4DNT B;  1YJ9 A;  1N9W A;  4C3J H;  3U4V A;  1Q7Y C;  1AZP A;  2I5H A;  1UE5 A;  1ICW A;  2N55 A;  4XIG S;  4U67 3;  1EZ8 A;  4R4T A;  2DY7 A;  2OEO A;  4KV6 A;  4NP5 A;  4ZKB B;  1J5E L;  1I4G A;  3VR3 A;  2H4O A;  4AYB B;  3D4R A;  3VDY A;  3G71 A;  2CHB D;  3CHB D;  3TBI B;  2F0M A;  4UDU C;  1QJO A;  5F2D A;  2RCF A;  1JOO A;  2V1C C;  4F88 A;  1HFG A;  4PV1 C;  5BN4 A;  1SE2 A;  1W2B A;  1B50 A;  2QIL A;  1PYW D;  2MPM A;  2QEJ C;  3KLS X;  3QG1 A;  2VQE L;  1VQG A;  1YJN A;  4V19 0;  1PTO C;  2DNE A;  2ZJP A;  4PNY A;  3C1E A;  1GUW A;  2F4V L;  5M5X B;  2KJX A;  1YNX A;  1VQH A;  4KD4 A;  4TVA B;  1UE6 A;  4RGO S;  5I2Y A;  5E7N A;  4OWW B;  4EQN A;  4LF4 L;  3M4O H;  1ENA A;  5D3D A;  4FXK C;  2R7Z H;  4IUU A;  4CKE A;  1TKW B;  5IYD G;  4A3F H;  2LXJ A;  2PI2 A;  2C9O A;  2BE5 C;  2F0K A;  4UHV A;  2Y0S B;  4IO9 A;  4EGV A;  1TU2 B;  1EOT A;  1I4P A;  5EKI A;  5A2Q E;  2PQA B;  3D3R A;  5I2X A;  1HUM A;  3A54 A;  4QMG A;  1VQO A;  1LTL A;  2L12 A;  5JJZ A;  5C44 H;  3ERO A;  4GOP C;  2VUM G;  2Q2I A;  2LY7 A;  4O1N A;  1KAB A;  4OEM B;  2B2V A;  5FO8 B;  3MXG A;  3EBE A;  1K83 B;  2CFM A;  1G8Z D;  4PMC A;  3PO2 G;  2R61 A;  1SYG A;  5K36 H;  4KMU C;  3MFY A;  1EUJ A;  1FR3 A;  2A68 D;  3HOU G;  2RQX A;  3UDI A;  2QCP X;  3QB3 A;  4L5Q A;  1UUP A;  3PIO 3;  1E22 A;  3NTK A;  1EYD A;  3NSW A;  1SE4 A;  5CBE E;  3S1Q B;  4NXN Q;  3HOZ B;  1P8L A;  3OOC A;  2EXZ A;  2VQF L;  3BZD B;  2A69 C;  4ZKC B;  4XTC S;  4JOI A;  2PMZ B;  4A3B B;  1MHW C;  4LUO A;  2L0C A;  3QOJ A;  4PZ8 A;  1LT5 D;  4OX9 Q;  2B2W A;  3HZX A;  3S17 H;  5IOC A;  1D5Z C;  3HKZ E;  4XYO A;  1S5C D;  4FF2 A;  1H9S A;  2QEX A;  3EN2 A;  1IHZ A;  1PA6 A;  1PH4 A;  1X3P A;  3D4W A;  1CM9 A;  2EIF A;  2CWP A;  2F52 A;  2KCC A;  4LUV A;  5DM6 3;  5IT9 E;  4OGQ C;  3I4N B;  2FHT A;  4P75 A;  4JI5 L;  2E5L L;  5G3L F;  4R4I A;  2NVQ H;  3GTM H;  3J80 L;  4EQO A;  1A0I A;  1YZ6 A;  3HEJ A;  2J4X A;  5E1F A;  3BJU A;  1IYV A;  3H3V I;  2VNU D;  1TWG B;  2SNS A;  2CWA A;  2XN9 C;  3ULL A;  3PF5 A;  4POF A;  3CC4 A;  4B08 A;  1IKL A;  2CVR A;  1VQP A;  3A8I E;  1CA6 A;  3GTP H;  4OO1 H;  1HFN A;  5FOB B;  4QIW E;  1K28 A;  1SAP A;  2IHE A;  5TSS A;  1VQK A;  1ILP A;  1Z7T A;  1BNZ A;  3CMA A;  2F3V A;  2O2L D;  2VB3 X;  4EVO A;  1D2B A;  3OMG A;  3TZD A;  3HOY H;  1PYB A;  2EOT A;  1Y8P B;  4YWL A;  3DWA A;  3RD4 A;  5AFW A;  1B1Z A;  4QY7 A;  1LO5 D;  1Y8N B;  3R2T A;  2XSC A;  4OXP A;  5CV9 A;  4P2C B;  1HPC A;  3T1H Q;  2QGQ A;  1PRT D;  4PZ7 A;  2F0Q A;  2SEB D;  2K04 A;  4Y7N H;  5DEH A;  2M9V A;  3NXW A;  4DV5 L;  4FXG C;  3QO2 A;  4GS3 A;  4F7X A;  1IZ6 A;  1A15 A;  5CR3 A;  2NTT A;  1A8V A;  2JA8 B;  5FKA C;  2ZTD A;  3AB9 A;  4X3S A;  3R93 A;  2F0O A;  3JAM E;  1BF4 A;  1XWE A;  1ZKO A;  1QB5 D;  1VCI A;  1E0B A;  1STA A;  1SFO H;  2G5D A;  2ZXR A;  4JBW A;  1YHQ A;  3IAY A;  3F2C A;  3S2H H;  4A3G G;  4GKK Q;  1PH9 A;  4LWC A;  3J81 E;  5C4X H;  4OHJ A;  2O5I C;  1CUK A;  1I3Q B;  3TME A;  1GVP A;  4IQZ A;  1G91 A;  1EY6 A;  3I91 A;  4IFD I;  4KKU A;  1CQF A;  2Q8R E;  2AQ3 B;  2VZA A;  4IN3 A;  4A3L H;  4DUZ L;  5IGE A;  4NXM Q;  2JA7 B;  1A63 A;  3DHQ A;  1PH3 A;  4X66 Q;  2LSS A;  1XJV A;  1VQ5 A;  4AQY Q;  4QGU A;  1H9R A;  1YEZ A;  2K52 A;  3NK9 A;  4G57 A;  3CU7 A;  2JA5 B;  3K0X A;  3CCR A;  3TS0 A;  4QL5 A;  2Q8T A;  3RLO A;  2KCM A;  1I94 Q;  3K8A A;  5JJL A;  4DXF A;  2F3W A;  5LMN W;  4IUT A;  3ULP A;  1Z6H A;  2IT1 A;  2B63 B;  1DZ1 A;  4DNI A;  1DJR D;  3I7F A;  3KLR A;  1D8L A;  5T1I A;  4IJL A;  5HY6 A;  1RIP A;  1Y1V B;  2K5V A;  2Y0S E;  1VQ4 A;  1RKN A;  1MKH A;  2UUB L;  2F0N A;  3AQQ A;  5ELN A;  4A75 A;  4DR5 Q;  2KCN A;  2LXK A;  4BBS B;  3BU2 A;  4K0K Q;  1SMY C;  4J15 A;  4A3K B;  3M7G A;  1B4O A;  1N8R C;  3W3A A;  1EIF A;  1ROD A;  4DR7 L;  3A74 A;  4BA1 I;  3PF4 A;  4BY7 H;  2NN6 I;  2XWJ B;  4DUY Q;  1GUO A;  1QOH A;  2OQK A;  1R9T B;  3P1H A;  1LM0 A;  4O0A A;  4I65 A;  2F0H A;  3I8Z A;  3MC0 B;  3KFU A;  2K5W A;  4C2M H;  4HIO A;  3HKS A;  1ZYR C;  4QJF A;  3NTH A;  2LS0 1;  1WTQ A;  1IL8 A;  1X3F A;  3ND8 A;  2B39 A;  1WD0 A;  3B6Y A;  2RSO A;  1MJC A;  4H0L C;  2DJG C;  1LTA D;  4KHP Q;  2PMZ E;  4C3H G;  2UXB L;  1N34 L;  1VS0 A;  1GUG A;  5IGB A;  3FHW A;  5COR A;  3PIP 3;  1BBU A;  3IFT A;  3DM1 A;  3H0G G;  4J1M A;  1NAP A;  1N33 L;  1NBW A;  1PH7 A;  3MHB A;  3SK5 A;  5AJ3 L;  1TII D;  4DAP A;  5EBD A;  2NVT B;  1S5F D;  2VL6 A;  1CHQ D;  2JQO A;  4NDX A;  5J1Z A;  3DLL A;  3S1M H;  2SNM A;  3N6R A;  4BXX H;  1O80 A;  2PO4 A;  3CCJ A;  4JI4 L;  4L5T A;  2Z1C A;  1GJX A;  1PZI D;  4EQ5 A;  2K14 A;  3TDQ A;  2Z4I A;  3L0O A;  4JI1 Q;  1IBK L;  1A3V A;  3MXN A;  2BE5 D;  1NE3 A;  2K75 A;  1XPU A;  4RH6 A;  4X64 L;  1Y69 U;  1HZA A;  1K3R A;  1JT8 A;  2NTS A;  4LF9 L;  3OW2 A;  1OO9 B;  2GN5 A;  2YTY A;  3VR5 A;  2H5X A;  4A93 G;  3GP7 A;  2AQ1 B;  1E1O A;  4JI0 Q;  4Q5V A;  2XTI A;  4LUZ A;  4MTN A;  5EPJ A;  1SNO A;  4KKT A;  3OIQ A;  4KKS A;  1HR0 Q;  3BYY B;  4DV3 Q;  1HA6 A;  4PMB A;  3H94 A;  1O7L A;  3UI2 A;  5M3M G;  1ESF A;  4A3D B;  2BCO A;  2KUM A;  3E0E A;  1CSQ A;  3RMH A;  1YNJ C;  1LTS D;  1UEB A;  2EY5 A;  4KN4 C;  5C4J B;  3Q0A A;  4MHE A;  3SDZ A;  3CC2 A;  1EQV A;  5E4X A;  1V9P A;  3TSS A;  4XQJ A;  2A69 D;  3NWS A;  2X6L A;  3DWQ A;  1CTM A;  4LJZ C;  1KD1 C;  4RKL A;  4ME5 A;  1VDZ A;  1PFB A;  3A5U A;  5CV7 A;  2UXC Q;  1D7Q A;  5JVH 3;  1HCZ A;  4KN7 C;  3RLN A;  3IL8 A;  2X69 A;  3M9B A;  2L11 A;  3NQI A;  3H09 A;  5EKL A;  1YIT A;  2FIN B;  1VQJ A;  5JEA J;  2R6G A;  1IYJ B;  2F0G A;  1K73 C;  3H3V C;  1VQL A;  3KDF A;  4DR5 L;  5IP9 G;  3RZD B;  2BH2 A;  3E0J A;  4GLV B;  4X3T A;  4DV7 L;  2Z6B A;  2E2J B;  1ENC A;  3KBG A;  2G9H D;  1JJ2 A;  3VYR A;  1D6E C;  2PI2 E;  3CD6 A;  3S1Q H;  3Q22 A;  1JQY D;  2HDL A;  5KNC A;  3A0J A;  1BBX C;  2TSS A;  1DYQ A;  3PCO B;  4YHH L;  3HS0 C;  4UP7 A;  3NBH A;  5KEE A;  4ABN A;  3HOW G;  5CBA E;  3MTS A; 
#chains in the Genus database with same CATH homology
 2BOS A;  1NR4 A;  2ICE C;  1E2V A;  1M4V A;  2E2I B;  2B2V C;  4JK1 C;  2YYZ A;  1STN A;  4M1U B;  4C3J G;  3QIA A;  4HSV A;  1EY4 A;  2TMP A;  1E2Z A;  1R4Q B;  3MZ5 A;  2VUM B;  3FEW X;  3VR6 A;  4CJ2 C;  4XXE A;  1DOM A;  3BYT B;  5COY A;  2EYJ A;  2WP8 J;  2ENB A;  3PO2 B;  2K7V A;  4IUP A;  1F9R A;  2X6G A;  4HSP A;  4ZLT F;  2J0T D;  3QJY A;  2G9D A;  4RCO A;  4N9P A;  2F0P A;  1LAB A;  1IW7 C;  3A8J E;  3U9O A;  1H9J A;  4DGZ A;  1W6K A;  3NP8 A;  1EU3 A;  2GA4 B;  3T53 B;  1STB A;  1VF5 C;  1ONL A;  2KOL A;  2IL8 A;  4N9T A;  4A3I B;  3LNN A;  2QF7 A;  4J6H A;  2JA6 B;  1VMC A;  4FF4 A;  1PMR A;  3BVG A;  1HQR D;  1STG A;  4KHV A;  5K36 G;  4G4K A;  1HRJ A;  2F0T A;  1W6J A;  3K59 A;  4ILW A;  4H44 C;  3DMU A;  2ZT9 C;  1SNP A;  4Z9C B;  1VF7 A;  4YIJ A;  4CHT B;  2VB2 X;  1BXT A;  1MSG A;  4ZAI A;  3KUP A;  2L4N A;  3A7L A;  3VR4 A;  5C0X J;  1SXT A;  1KLU D;  1O7Z A;  4DNR B;  5NUC A;  5KGU A;  2IWH A;  2EYH A;  3FPP A;  1U9R A;  3TP6 A;  4IUQ A;  4FYD A;  1STH A;  2OXP A;  4RAU C;  2WIN B;  4OIK A;  1R4P B;  2F1M A;  3IFD A;  4KHZ A;  4GZY C;  1D5M C;  5IGC A;  2R93 B;  4XQN A;  1A2T A;  1JWM D;  4OO1 G;  2A6E C;  4V0B A;  3ERQ A;  2NYZ D;  1C8C A;  4A3G B;  3H91 A;  4Q0F A;  3CQZ B;  1SNC A;  2RDG A;  2AQ2 B;  2D62 A;  3K7A B;  4I7Z C;  2EZV A;  2KEC A;  3MXP A;  1WTR A;  4C3I B;  4PQX A;  2A73 B;  4HED A;  2NZ1 D;  3I72 A;  1AN8 A;  3GTL B;  1KDB A;  1YNN C;  1SND A;  1EWC A;  3VR2 A;  5LL6 S;  2AWN A;  1PXU A;  4RCN A;  2PPB C;  2K33 A;  1WTX A;  1EEI D;  4ZUJ A;  3PUY A;  2XIW A;  1DON A;  3WOE A;  1SBB B;  2F0U A;  1PZK D;  2XNA C;  2E2H B;  3HG9 A;  4DAY A;  1KAA A;  3M7N A;  5C5M A;  1H9M A;  2EY1 A;  2SOB A;  3T4A C;  1TR5 A;  1JCK B;  5IGD A;  2EJF C;  4CBV A;  3K5M A;  4PMW A;  3PUW A;  2IW3 A;  5EGT A;  1EFI D;  1K8O A;  3TP7 A;  2EVB A;  4H7B A;  5EPL A;  2ZXP A;  2EYL A;  2A6H D;  5CYU A;  1JOR A;  4C3H B;  4KK7 A;  3S9W A;  5JPM C;  3I73 A;  3GTK B;  3H0G B;  1JE4 A;  3FKI B;  5JEA H;  3P7J A;  1SE3 A;  5FLX L;  1QCB D;  4K5V A;  4RHS A;  3OW7 A;  3WOF A;  1OXU A;  2KA7 A;  5I9O A;  1PTO H;  1ET9 A;  3MEH A;  3BDO A;  1F2M A;  1CHP D;  3A56 A;  1IYU A;  1TT2 A;  4J8Q A;  4ZYS A;  3L3O C;  5BN5 A;  5HGT A;  1BCP F;  3HGB A;  4CJ0 B;  1PFN A;  3NUC A;  4A93 B;  5EJW A;  3EJI A;  4BS9 A;  4DF7 A;  1SJE D;  1I4X A;  1ENF A;  2PW5 A;  1Q1E A;  4UAI A;  1RDP D;  5M3M B;  2WV6 D;  4ID6 A;  1GXD C;  1Q3L A;  4WRD A;  2RSN A;  1EL0 A;  1TQO A;  4HCS A;  1I50 B;  2DN8 A;  1LTG D;  3SVM A;  2BA1 A;  1CI3 M;  2F4I A;  3ND9 A;  4QB4 A;  1V1O A;  3SK8 A;  3URY A;  1OXT A;  2XWB B;  3A7A B;  5C6A A;  3RZO B;  1GUT A;  5CC4 A;  1AFP A;  4K8J A;  4ZRZ A;  5FO7 B;  1T5X D;  2YU9 B;  3KLS A;  2L1B A;  1GHJ A;  2AUK A;  4OIJ A;  2EYP A;  3S1R B;  3Q24 A;  1DCZ A;  2IX3 A;  1NCV A;  1F9P A;  4G7Z C;  3HOW B;  4X3U A;  2EY2 A;  4BA2 I;  2F0F A;  4B9W A;  4OL7 A;  1SYE A;  5A2Q L;  2K5Q A;  3E5S A;  5JAV A;  3K5L A;  1RF2 D;  4C3J B;  4QUC A;  5IOD A;  2K03 A;  1V43 A;  1JIC A;  2QKI C;  2IX1 A;  2L55 A;  1LTI D;  2K32 A;  3GO5 A;  3SR1 A;  3SK4 A;  3X3N A;  1SYF A;  5C3W A;  3AMU A;  1CZG A;  1J8I A;  2CW0 C;  2CQA A;  3NQT A;  3NBI A;  1EYC A;  4HCE A;  2D9U A;  3DXJ C;  5C0X H;  1S4Z A;  2IJ0 A;  3K6O A;  5ELD A;  1LV9 A;  1G2T A;  2WAQ B;  2B2Y A;  1BOS A;  4ZUI A;  4BWG B;  5EPK A;  1PTO D;  2EYF A;  4RWS C;  2A5H A;  3M4O B;  5C3X A;  4K5W A;  4K2K A;  3VYT A;  2R7Z B;  4C1N I;  4IFD J;  5E4W C;  1JWU D;  1TWC B;  2BDN A;  1Q90 A;  2DY8 A;  2PCF B;  1F2L A;  3DEP A;  3M4Y A;  4K5X A;  4A3J B;  4WFN 3;  1HQM C;  1QE6 A;  4IUN A;  2RA4 A;  4XT3 B;  4OO1 I;  5BN3 A;  4U68 A;  1YNN D;  2M2L A;  1VMP A;  4ZQ3 A;  1F9Q A;  2F0I A;  4A3M B;  5ELF A;  3MA2 B;  5EKK A;  1PRT F;  5HUR A;  4L8J A;  1QWY A;  3T51 B;  5C4H A;  3V96 A;  5EQ0 A;  1XTC D;  3VA7 A;  3L7Z C;  1ML0 D;  5I9P A;  3ONA B;  1CFM A;  2Z4H A;  1SDF A;  3S17 B;  1STY A;  2JP1 A;  4KI0 A;  2NWG A;  3VYS A;  3VYU A;  2FJ2 A;  3Q6S A;  4DK1 A;  3D6C A;  3MXU A;  2NVQ B;  3GTM B;  1C4Q A;  2MP1 A;  5D14 A;  3RLF A;  1D1K A;  3KBX A;  1TWH B;  2JEB I;  2PZU A;  5EBC A;  1U4P A;  2I07 B;  2XRQ D;  2EJM A;  1HA5 A;  3MVV A;  2HCC A;  1O78 A;  4RFB A;  3HOY B;  2FMM A;  2WII B;  1ESR A;  2KEE A;  2KHS A;  1SJH D;  4KY5 A;  1H9K A;  3D6W A;  3TN2 A;  4B9X A;  4Y7N B;  5KRU A;  2L9H A;  5CGK A;  3M85 A;  4RA8 A;  1OXX K;  3E6Z X;  1ZXT A;  4G7O C;  5KYI A;  3FVQ A;  3PUZ A;  1DM0 B;  1V8Q A;  1HTL D;  3Q23 A;  3IKJ A;  3HOU B;  3NHH A;  3NE5 B;  1SFO B;  2K1B A;  2K5D A;  1BQQ T;  1EWH A;  2RDF A;  3S2H B;  2F03 A;  2NB0 A;  1PTO F;  2K6A A;  3ZYY X;  2E74 C;  4LK1 C;  5C4X B;  2C5C A;  4LMQ D;  1XX8 A;  4KY7 A;  4XDX A;  4IZ8 A;  2K05 A;  4CKC A;  5IGF A;  3HKZ B;  3WDN A;  3SK6 A;  5KIX A;  1F2Y A;  2O5J C;  3R3O A;  1DXM A;  4QCL A;  3OWE B;  3QWN A;  2I46 A;  3J80 E;  2HUG A;  3FRP B;  3LX0 A;  3A8K E;  3OIP A;  2NVX B;  3BVZ A;  1SSO A;  5FLX E;  5G3L D;  1QIL A;  3CRL C;  5C4Z A;  4C56 C;  5M9O A;  1KLG D;  4QIW B;  3J7Y W;  4BY7 B;  2WKC A;  3QOL A;  1SMY D;  2EPB A;  3F2U A;  2JE6 I;  2B2U C;  3OMC A;  1EZ6 A;  4C2M B;  1FNV A;  3RUZ A;  2WAC A;  1LT3 D;  1II3 A;  1TS3 A;  4FF3 A;  4XYQ A;  4HMI A;  3KK7 A;  1MBY A;  1SNM A;  1ZYR D;  2EDG A;  5I4D A;  5JVG 3;  1HUN A;  2PYK A;  1U4M A;  3K0Y A;  3NTI A;  1WTO A;  1MD2 D;  1HTP A;  1EIH A;  1B2T A;  4EQP A;  4FO2 A;  4HTH A;  1RTN A;  2ID0 A;  1TVX A;  1TS4 A;  5JEA G;  3NPP A;  3S1M B;  4HMJ A;  1T5E A;  4KY6 A;  1LTR D;  3P20 A;  1SYB A;  4WOR A;  2PW7 A;  2PZW A;  5ELB A;  2VXW A;  3PUV A;  1F77 A;  3DEO A;  4IFD H;  2B8G A;  1A3U A;  1OXV A;  5CMD A;  4FNF A;  3VA5 A;  1DOK A;  1C48 A;  1EQT A;  3LWE A;  1JC7 A;  1EU4 A;  4IUR A;  1E2W A;  1A2U A;  3BG3 A;  1Z47 A;  1I4Q A;  4TSS A;  3S16 B;  5CV8 A;  1F9S A;  4TQU S;  3I70 A;  2V4D A;  2LMC B;  4IAL A;  3PV0 A;  1B44 D;  1Q12 A;  5I6Y A;  1NSN S;  1YNJ D;  2LKV A;  3C3L A;  4DN4 M;  5KND A;  2JEA I;  4K14 A;  3CKI B;  5ELC A;  1I6H B;  1BCP B;  1PDQ A;  1A6X A;  2B2Y C;  1I4H A;  1EY8 A;  2NN6 H;  2MJ8 A;  3HRZ C;  1TS2 A;  4WJW A;  3D8G A;  1JR0 D;  2RVL A;  2RDH A;  4K6D A;  1B53 A;  3LWU A;  3BVM A;  3MAQ A;  1WTV A;  3R8B A;  1TWA B;  2O4X A;  4FXD A;  1UEA B;  4RGM A;  2OT2 A;  5IIF A;  2WKD A;  1GOZ A;  1D5X C;  3ITP A;  5M5Y B;  2AWO A;  5A35 A;  5KYL A;  2PZT A;  1EYA A;  1KDC A;  5J22 A;  4DK0 A;  3T13 A;  1FNU A;  2L5T A;  1EY7 A;  2M00 A;  1QNU A;  3CRK C;  1I6V C;  5C3E B;  3KF8 A;  1DOL A;  3HOV B;  1KNE A;  1JOQ A;  3HP3 A;  5C0X G;  4G7H C;  1LT6 D;  4A3E B;  1O7Y A;  3S1N B;  4NKL A;  1FD7 D;  3T56 B;  1AEX A;  1LTB D;  2F0V A;  3M3Y B;  3D31 A;  3BDL A;  3EA6 A;  2B2T A;  1IKM A;  2B2U A;  1F2Z A;  3R2I A;  1UAP A;  1CZW A;  1WVL A;  5CV4 A;  1IW7 D;  1FNW A;  1STE A;  2B8F A;  5K5P A;  2IPK D;  5J39 A;  3GQB A;  1MSH A;  2A74 C;  1WTP A;  4K6L A;  3S14 B;  3FDT A;  1BR9 A;  4DA2 A;  1PFM A;  4X3K A;  4KTA A;  4TKO B;  4BY1 B;  1KNA A;  2XRS D;  1EEF D;  4FP5 D;  5JPN C;  1LTT D;  1S5D D;  1TY2 A;  3K5N A;  3SE0 A;  3FPU B;  3C1F A;  2NUC A;  1CQV A;  1GUN A;  1JB3 A;  1HHV A;  1LT4 D;  2EE1 A;  2JSO A;  3H6M A;  2JXM B;  2BDO A;  1V1P A;  4C3I G;  1Q8I A;  5CV6 A;  2F0E A;  1MI2 A;  3BDC A;  1GHK A;  4FVM A;  2BA0 A;  4F87 A;  1CT1 D;  1M8A A;  1MGS A;  1FGB D;  4CGY B;  4HR7 B;  3I4M B;  2SDF A;  1L0Y B;  4HN7 A;  4XT1 B;  4L63 B;  5D65 A;  3TZU A;  1ZEQ X;  3K58 A;  2WB1 B;  2F0L A;  1TS5 A;  1PRT B;  2FMC A;  3MWY W;  1BCP C;  4E6I A;  1TY0 A;  1H9S B;  3L9A X;  2IX0 A;  2HCI A;  3AU7 A;  3MFG A;  4K2L A;  2HQE A;  2A6E D;  2EYM A;  5IT9 L;  1TWF B;  3OPO A;  1SEB D;  4A3F B;  1RCV D;  3GV3 A;  1EIG A;  3OWF A;  3SXH A;  1B9N A;  4R9W A;  2MGS A;  2K28 A;  4LAA A;  2PNR C;  5T1G A;  5DAU A;  2F0J A;  4TRD A;  1SYD A;  3U9S A;  3W2D A;  2KED A;  4M8A A;  5C44 B;  4ULL A;  1RD9 D;  1EY0 A;  2E75 C;  2Q8I B;  5DM7 3;  5DNF A;  4RGN A;  2K01 A;  2D2C C;  1G29 1;  1JWS D;  5E3F A;  5FK9 C;  1EY5 A;  3I3C A;  3J7A F;  1J9O A;  2R92 B;  4NMZ A;  4ZK9 B;  3I4L A;  1D1I A;  4NW2 A;  1Y8O B;  2ICI A;  3G7L A;  2MUY A;  4CJ1 B;  2R3Z A;  4RHR A;  3DUZ A;  1UNS A;  3V2T A;  1SNQ A;  1RJT A;  1DD2 A;  5I6W A;  2A68 C;  3SEB A;  3JAM L;  1U4L A;  2EYO A;  1BO0 A;  4DFA A;  1JOK A;  3FMC A;  2F0W A;  1B3A A;  4RKB A;  1B9M A;  1Q1B A;  5LHY 1;  3J81 L;  3S2D B;  1V1P B;  2LFN A;  1PTO B;  1KTK A;  5JOB A;  1OXS C;  1BUV T;  3GTP B;  4L6T B;  2MHV A;  3PMF A;  1BDO A;  1I4R A;  3PO3 B;  1RHP A;  4F8M A;  2A6H C;  2DNC A;  1GUS A;  1HXY D;  1EY9 A;  2KQ3 A;  1FYC A;  3OHX C;  1NUC A;  1WD1 A;  2QDB A;  3OSO A;  3DWP A;  2KVM A;  5FO9 B;  1AW7 A;  1XYI A;  3GD7 A;  3V05 A;  5LL6 X;  5CV5 A;  1PLF A;  2EJG C;  1LAC A;  4QUF A;  5ELE A;  1CA5 A;  1QNK A;  1G2S A;  1NR2 A;  3GTJ B;  3HOX B;  4S3S A;  3K57 A;  3X3M A;  1LLR D;  4CKB A;  4C1N K;  2HDM A;  2NVY B;  4IUV A;  2J7Z A;  2NBF A;  2FFK B;  2OF1 A;  2E76 C;  2PQE A;  2XVS A;  2N88 A;  3T16 A;  2EY6 A;  1QG7 A;  4MN3 A;  4BBR B;  5C0X I;  1XXG A;  1CK1 A;  2ZXO A;  3P75 A;  1PRT C;  2B2W C;  3TP5 A;  4KD3 A;  2D5D A;  3BS1 A;  4IFD G;  1ILQ A;  3I90 A;  1AP0 A;  1S5B D;  5D3I B;  2Z8L A;  1U4R A;  5M5W B;  4K8I A;  3PUX A;  1L0X B;  4KJO A;  4HAE A;  3GV6 A;  2RBM A;  1RTO A;  3C2P A;  3J7A V;  1Y1W B;  3EQL C;  4XQQ A;  3GTQ B;  3EVQ A;  1S5E D;  3O13 A;  4DAV A;  1K8M A;  2JYO A;  3GTO B;  1AZQ A;  1A3T A;  3N52 A;  4RGT A;  1X32 A;  4R8N A;  3S15 B;  4O42 A;  1G6Z A;  4KJN A;  4DU9 A;  4H13 C;  2B2T C;  2NN6 G;  1PZJ D;  2F0S A;  4DXG A;  4QF4 A;  5C5L A;  1SYC A;  3G6J B;  3GTG B;  2RKS A;  5KNB A;  1WTW A;  3D4D A;  5M3F B;  3K5O A;  2E2D C;  1ET6 A;  4FF1 A;  2CW0 D;  2H1E A;  3NWT A;  1KDA A;  3C46 A;  5IGG A;  2AUJ D;  2F0D A;  3TP8 A;  1BCP D;  4R8I A;  4ODG A;  5ISR A;  3EFX D;  1WCM B;  3A55 A;  4MIU A;  1X3Q A;  3SHL A;  4DNT B;  1AZP A;  2N55 A;  4U67 3;  1ICW A;  4XIG S;  1EZ8 A;  2DY7 A;  2OEO A;  4KV6 A;  4NP5 A;  4ZKB B;  1I4G A;  3VR3 A;  2H4O A;  4AYB B;  3D4R A;  2CHB D;  3CHB D;  3TBI B;  2F0M A;  4UDU C;  1QJO A;  5F2D A;  1JOO A;  4F88 A;  1HFG A;  4PV1 C;  5BN4 A;  1SE2 A;  1B50 A;  2QIL A;  1PYW D;  2MPM A;  2QEJ C;  3KLS X;  3QG1 A;  4V19 0;  1PTO C;  2DNE A;  4PNY A;  3C1E A;  1GUW A;  5M5X B;  2KJX A;  4KD4 A;  5I2Y A;  4RGO S;  4EQN A;  1ENA A;  5D3D A;  4FXK C;  4IUU A;  4CKE A;  1TKW B;  2C9O A;  2BE5 C;  2F0K A;  2Y0S B;  4EGV A;  1TU2 B;  1EOT A;  1I4P A;  5EKI A;  5A2Q E;  3D3R A;  5I2X A;  1HUM A;  3A54 A;  4QMG A;  2L12 A;  5JJZ A;  3ERO A;  4O1N A;  2LY7 A;  1KAB A;  2B2V A;  5FO8 B;  3MXG A;  1K83 B;  1G8Z D;  4PMC A;  2R61 A;  1SYG A;  5K36 H;  4KMU C;  3MFY A;  1FR3 A;  2A68 D;  2RQX A;  2QCP X;  3QB3 A;  3PIO 3;  1UUP A;  3NTK A;  1EYD A;  3NSW A;  1SE4 A;  5CBE E;  3S1Q B;  3HOZ B;  3OOC A;  2EXZ A;  3BZD B;  2A69 C;  4ZKC B;  4XTC S;  2PMZ B;  4A3B B;  2L0C A;  3QOJ A;  1LT5 D;  2B2W A;  3HZX A;  5IOC A;  1D5Z C;  4XYO A;  1S5C D;  4FF2 A;  1H9S A;  1IHZ A;  1X3P A;  3D4W A;  1CM9 A;  2KCC A;  5DM6 3;  5IT9 E;  4OGQ C;  3I4N B;  2FHT A;  5G3L F;  3J80 L;  4EQO A;  3HEJ A;  2J4X A;  5E1F A;  1IYV A;  2VNU D;  1TWG B;  2SNS A;  2XN9 C;  4B08 A;  1IKL A;  2CVR A;  3A8I E;  1CA6 A;  4OO1 H;  1HFN A;  5FOB B;  1SAP A;  5TSS A;  1ILP A;  1Z7T A;  1BNZ A;  2F3V A;  2O2L D;  2VB3 X;  4EVO A;  1D2B A;  3OMG A;  3TZD A;  2EOT A;  1Y8P B;  3DWA A;  3RD4 A;  5AFW A;  1B1Z A;  1LO5 D;  1Y8N B;  3R2T A;  2XSC A;  5CV9 A;  4P2C B;  1HPC A;  1PRT D;  2F0Q A;  2SEB D;  2K04 A;  5DEH A;  2M9V A;  3NXW A;  4FXG C;  3QO2 A;  4F7X A;  1A15 A;  5CR3 A;  2NTT A;  2JA8 B;  5FKA C;  3AB9 A;  4X3S A;  3R93 A;  2F0O A;  3JAM E;  1BF4 A;  1XWE A;  1ZKO A;  1QB5 D;  1VCI A;  1E0B A;  1STA A;  2ZXR A;  4JBW A;  3IAY A;  3J81 E;  4OHJ A;  2O5I C;  1I3Q B;  3TME A;  4IQZ A;  1G91 A;  1EY6 A;  3I91 A;  4IFD I;  4KKU A;  1CQF A;  2Q8R E;  2AQ3 B;  4IN3 A;  5IGE A;  2JA7 B;  3DHQ A;  1H9R A;  3NK9 A;  4G57 A;  3CU7 A;  2JA5 B;  2Q8T A;  4DXF A;  2F3W A;  4IUT A;  1Z6H A;  2IT1 A;  2B63 B;  1DZ1 A;  1DJR D;  3KLR A;  5T1I A;  1Y1V B;  1RKN A;  2F0N A;  2KCN A;  4BBS B;  1SMY C;  4A3K B;  3M7G A;  1B4O A;  3W3A A;  1ROD A;  4BA1 I;  2NN6 I;  2XWJ B;  1GUO A;  1QOH A;  1R9T B;  3P1H A;  4I65 A;  2F0H A;  3I8Z A;  3MC0 B;  2K5W A;  1WTQ A;  1ZYR C;  3NTH A;  2LS0 1;  1IL8 A;  3ND8 A;  2B39 A;  1WD0 A;  2RSO A;  4H0L C;  1LTA D;  4C3H G;  5IGB A;  1GUG A;  5COR A;  3PIP 3;  3IFT A;  3DM1 A;  4J1M A;  1NAP A;  3MHB A;  3SK5 A;  1TII D;  4DAP A;  5EBD A;  2NVT B;  1S5F D;  1CHQ D;  4NDX A;  5J1Z A;  2SNM A;  3N6R A;  1O80 A;  2PO4 A;  2Z1C A;  1GJX A;  1PZI D;  3TDQ A;  2Z4I A;  1A3V A;  3MXN A;  2BE5 D;  4RH6 A;  1Y69 U;  2NTS A;  1OO9 B;  3VR5 A;  3GP7 A;  2AQ1 B;  4Q5V A;  5EPJ A;  1SNO A;  4KKT A;  3OIQ A;  4KKS A;  3BYY B;  1HA6 A;  4PMB A;  3H94 A;  1O7L A;  3UI2 A;  1ESF A;  4A3D B;  2BCO A;  2KUM A;  3RMH A;  1YNJ C;  1LTS D;  2EY5 A;  4KN4 C;  5C4J B;  3Q0A A;  4MHE A;  3SDZ A;  1EQV A;  5E4X A;  3TSS A;  4XQJ A;  2A69 D;  3NWS A;  2X6L A;  3DWQ A;  1CTM A;  4LJZ C;  4RKL A;  4ME5 A;  1VDZ A;  1PFB A;  5CV7 A;  5JVH 3;  1HCZ A;  4KN7 C;  3IL8 A;  2X69 A;  2L11 A;  3NQI A;  3H09 A;  5EKL A;  2FIN B;  5JEA J;  2R6G A;  2F0G A;  3H3V C;  3RZD B;  3E0J A;  4X3T A;  2E2J B;  1ENC A;  3KBG A;  2G9H D;  3VYR A;  1D6E C;  3Q22 A;  1JQY D;  2HDL A;  5KNC A;  1BBX C;  2TSS A;  1DYQ A;  3HS0 C;  3NBH A;  5KEE A;  4ABN A;  5CBA E;  3MTS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...