2OEOA

Cryogenic crystal structure of staphylococcal nuclease variant truncated delta+phs i92d
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
130
structure length
130
Chain Sequence
b'KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKAMVENAKKIEVEFDKGQRTDKYGRGLAYDYADGAMVNEALVRQGLAAVAYVYSGNNTHEQLLRAAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal thermonuclease
publication title Buried Charges and Water in the Protein Interior: Reality or Fiction?
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 33
structure length 130
sequence length 130
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2006-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2oeoA00
3SXHA 1EYDA 4ID6A 2M00A 3SK5A 4QB4A 2KQ3A 3S9WA 2F0NA 1SYGA 3MHBA 3OSOA 4DU9A 1SNDA 3D6CA 2F0EA 2F0UA 3DMUA 1STGA 4K2KA 4NDXA 2PYKA 4KJOA 4PMCA 3QOLA 5E1FA 2EY6A 1STBA 5J1ZA 1F2MA 5CV6A 1STNA 4WORA 4KV6A 4N9TA 2F0LA 1F2ZA 4ZUJA 3SK8A 5IGEA 1IHZA 3HZXA 5CV9A 3P75A 5KGUA 4NP5A 2F0FA 1A3TA 1SYFA 4PMBA 3OMCA 2EYLA 1KDCA 2LKVA 2PW7A 5ISRA 1EZ8A 3E5SA 1A3VA 3MXPA 3OMGA 2F0IA 4KD3A 4OL7A 4F7XA 3T16A 5HURA 2SNMA 4I65A 4EQOA 2EYPA 1A3UA 5I9OA 1RKNA 4QMGA 1SNOA 3MEHA 1EQVA 4IALA 4KJNA 5C5LA 5I6YA 2F0OA 4R8NA 4J1MA 2RBMA 2HQEA 1EY8A 3HEJA 5IGGA 4K5XA 4K6DA 2EY5A 1EZ6A 1EY4A 3NHHA 1EYAA 5CC4A 4KTAA 2RKSA 5IGCA 3BDLA 4N9PA 5C4HA 5IODA 5NUCA 1SNCA 4S3SA 3QB3A 4DGZA 3SR1A 3C1FA 4MIUA 2F0DA 4E6IA 3TP7A 1KABA 5CV8A 2EXZA 4ZQ3A 3TP8A 5C6AA 5EKKA 2EYJA 5C5MA 3RUZA 4EQPA 3OWFA 5KRUA 5KEEA 4G57A 3SK6A 5J39A 4TRDA 2F0TA 2RDFA 4ODGA 4KY7A 5DEHA 4RKLA 5IGDA 4QF4A 4RKBA 2F0MA 5CV5A 1EYCA 1STHA 2SNSA 3DHQA 3H6MA 4K2LA 5JOBA 3SK4A 1TR5A 3P1HA 4ME5A 2F3VA 2OF1A 3ITPA 2ENBA 5DAUA 4DFAA 5I6WA 1JORA 2F3WA 2QDBA 2F0HA 3BDCA 3TMEA 3VA5A 1TQOA 3EROA 5KYLA 3D8GA 3MZ5A 5IIFA 5M9OA 1EY6A 5IGBA 3NK9A 1EY5A 3U9OA 2EY2A 4K5WA 1II3A 2PZWA 3D4WA 4HMIA 1SYBA 1KDBA 1ENAA 4B9WA 5KYIA 1SYCA 2KHSA 3MVVA 1U9RA 4KY6A 2SOBA 3SHLA 4IUNA 4K14A 3EJIA 1SNQA 2EYOA 4F8MA 2NUCA 4DF7A 5F2DA 3V2TA 1JOQA 2EYHA 2F0GA 3NQTA 5J22A 5EGTA 4IZ8A 5CV7A 2PQEA 3LX0A 5CV4A 4PNYA 2O4XA 5CGKA 4EVOA 4ZUIA 4B9XA 3NUCA 2EY1A 3PMFA 1A2TA 1AEXA 5C3WA 5I9PA 1KDAA 1SYEA 2F0KA 4HTHA 5CR3A 4LAAA 5C4ZA 3ERQA 2EYMA 5E3FA 2PZTA 3QOJA 1TT2A 1JOKA 2EYFA 1NUCA 4WRDA 1F2YA 3NP8A 2WACA 3NXWA 1SYDA 4K5VA 3T13A 5IGFA 4KHVA 2F0SA 4K8IA 4EQNA 2F0QA 2F0JA 4KY5A 1EY0A 2OXPA 4J6HA 5C3XA 5IOCA 4KD4A 1A2UA 5KIXA 1EY7A 1SNPA 5EKLA 5HGTA 2PW5A 1STAA 2F0VA 4NKLA 2OEOA 2F0PA 3D4DA 1EY9A 1SNMA 1ENCA 1JOOA 3C1EA 3R3OA 4K8JA 4YIJA 2F0WA 3TP6A 4H7BA 5K5PA 1NSNS 4NMZA 4HMJA 2PZUA 1KAAA 5JAVA 1STYA 3EVQA 3TP5A
chains in the Genus database with same CATH superfamily
4DR5L 2Q8IB 1PYBA 3U58A 2F0NA 3BU2A 4Y7NH 5EQ0A 2JE6I 1YNXA 3BYTB 4RGOS 3IKJA 1B70B 3CRLC 3I7FA 4JOIA 3HG9A 1Y1VH 4GKJL 1PFNA 2N78A 2L11A 2VQEL 3K7AH 5GADC 4HJ7A 1N8RC 4TKOB 1IYJB 4O42A 2L15A 1GO3E 5C0XI 3MAQA 1EEID 3T16A 2NZ1D 5IT9L 1VF7A 3F2BA 1YIJA 5I6YA 4IFDI 4XYOA 1VQCA 3VYUA 4WFN3 1HH2P 1FD7D 4IQZA 1Q81C 2IJ0A 1V1PA 1EY4A 1EYAA 1JWMD 5LMNQ 2A74C 3FEWX 5C4HA 1PYWD 4DV1Q 3CPFA 1RDPD 1EWIA 5EPLA 4XT3B 4UY8C 3FKIH 5A2QL 4DR2Q 4G7HC 5IP7G 1SMYD 3H91A 3H3VI 4A3MH 1OXVA 5DEHA 4DR3Q 1PH6A 2EJMA 1ZYRD 3DHQA 1NY4A 1QUQA 3L3OC 4B3SQ 5IT9c 1TWHB 4JI5Q 2F0HA 1R4QB 3NENA 5T1GA 1TQOA 5JJIA 3CKIB 1CA6A 2F1MA 4JI4Q 2B2UC 1LO5D 2HIVA 1QILA 2L4NA 5ELOA 1D5ZC 1N32L 3K0YA 4FYDA 1TY0A 4R4QA 1VQAA 1JC7A 1YI2A 1SYCA 1B9NA 2SEBD 1I5FA 3CC7A 4F8MA 1Q7YC 5F2DA 1G2SA 2CCZA 1ESRA 3S1MH 2R6GA 1LTSD 2EVBA 4PNYA 2O4XA 3TN2A 5FO9B 3IL8A 5HGQA 3TS2A 2MP1A 1XXGA 4CKBA 2PZTA 1KTKA 1TT2A 2UUCQ 2KOLA 3T13A 3GTPB 1JJGA 4OGQC 1MJEA 3GTOB 1U5KA 3I73A 5IP7H 3D4RA 4A3LH 2EDGA 1EY9A 3R3OA 3PUVA 4P73A 2F0WA 3L7ZC 1EIYB 2GA4B 1UE6A 3HFZB 1AN8A 2Q2UA 5FLXE 1HTPA 2M9VA 1XMOQ 3FRPB 1V43A 3MHBA 3D6CA 2RSOA 2D5DA 2HHHQ 1RF2D 4JVZA 4PQXA 4B3TQ 2M2LA 5C3EH 2QA4A 4YWKA 2VQFL 1TVXA 5KNDA 2EYLA 1KDCA 4X64L 2A68D 2VZAA 2E5LL 2RBMA 1ICFB 1BXTA 4MTNA 5BN4A 2YTVA 3Q22A 3I2ZA 2UXDQ 3MXNA 1MKHA 2LS01 4DAYB 3VR2A 1E2ZA 1HNZL 4B3MQ 3M3YH 3J81j 4LF5Q 2MHVA 3VA7A 5M5WH 3K5LA 2E2JB 4JI6Q 4HCEA 2KCCA 4V0BA 2I5LX 2LXKA 4YWMA 2NN6G 1MD2D 1BCPF 3AMUA 1WCMH 4WJ4A 1PFMA 3G48A 1EQTA 4L63B 1WTWA 5IWAQ 3RNUA 3S1NB 5JJKA 5A35A 4HJAA 1UE1A 3BZDB 2DJGC 3Q6SA 2Q2HA 4IJLA 1KLGD 1TWAB 5LMUQ 3K8AA 2EY2A 2A6EC 3D4WA 4BBRG 1ENAA 3S1RB 3PCOB 4R9WA 5K36G 1K28A 3UE0A 1JOQA 1XMQQ 1Y1WG 3I4MB 3J80i 4DR4L 4O1NA 4BY1B 1BVSA 5LL6X 4X6AH 1X65A 4GN4B 4EVOA 4AQYL 4B9XA 1QZGA 1K8OA 4LFAL 1A2TA 2MQHA 2F4VQ 4IOCA 2B2TA 3AEVA 1HHVA 4A3GG 3ZYYX 2UU9L 3W2DA 5C4XG 4DUYQ 2C35B 1TS3A 2WACA 1SYDA 3J81E 1Y8NB 4A4IA 2C5CA 1TIID 1HZBA 5IOCA 3M9BA 4BBSB 1YNND 4OELB 4ZRZA 5C44H 3I4NB 1SNPA 1ML0D 1QZHA 3Q24A 1PRTD 3J7ZC 4DV6L 2F0PA 2FXQA 2H5XA 1JE5A 3ER0A 4P74A 1VQFA 3S1QB 2B2WC 3T53B 3TP5A 3NTIA 3UI2A 4OO1G 2BA0A 4ZYSA 1JMCA 3CHBD 1G51A 5DM63 2ZXPA 1IBLQ 1QNKA 3H94A 1TU2B 1VQ5A 3PUXA 1S3OA 3PO2G 4RGTA 5CV6A 3A0JA 2MUYA 1X3GA 2F0LA 2K50A 2WB1E 2XN9C 4XQQA 2WKDA 4BBRH 4FF2A 2B2VC 3M7NA 1PMRA 5K36H 5M3FG 1CFMA 1ET9A 3GTLB 4C56C 1G6ZA 3PF5A 4KHPQ 4I65A 1I50B 4EQOA 5KNBA 4EX5A 2N8NA 2G5DA 1PH8A 3K5MA 1E2WA 4LF6Q 2HQEA 4A3KG 3W1GA 1UWVA 3I90A 4J8QA 4A3GH 1I4XA 2B8FA 5C4XH 3HKZG 1D8LA 2PNHA 4KTAA 5ELCA 4IPGA 3FDTA 3QB3A 2A19A 2MNAA 4DV7Q 4MIUA 1HTLD 4FNFA 1C48A 5IT9E 2EPBA 3I70A 4Y7NB 3RUZA 1EYGA 2IWHA 5JPNC 1WI5A 1VMCA 1Y1VB 2R3ZA 4OO1H 2Z6BA 4DV4L 3CPWA 1WVLA 3K7AB 4DV3Q 4CBVA 2KUMA 2IPKD 5I6WA 4DAVA 3KFUA 1WTVA 2KECA 1YJ9A 5IGBA 5A2QE 5E4WC 3CMEA 1CQVA 1H9JA 4C2MH 5M3FH 4AIMA 4H0LC 2Z6KA 4K14A 5J3BA 4DR1Q 3KOJA 1GHKA 1UNSA 5CV7A 1AW7A 1T5XD 3DXJC 3I56A 1NAPA 2JA7G 4GNXA 3GP7A 2B3GA 4A3KH 3PMFA 1K0RA 1BF4A 4GKKQ 3PIP3 4B3RQ 4M1UB 1NE3A 3FKIB 1GUGA 4GLAC 1SN8A 1LTBD 3K6OA 3PIOA 2CKZB 3K57A 5IE8A 2VB2X 3CXCA 3VR4A 1K0SA 2R92G 3H09A 1YNJC 1GKHA 3A8IE 1HA5A 1BCPB 4RH6A 3RZOH 2UUAL 5C0XJ 3EVQA 4C1NK 1BR9A 3SXHA 3HOZG 2PMZE 1KQSA 5L37A 3TZDA 2L0CA 4YCVA 4IFDJ 4HIMA 4KJOA 2K7VA 3F8TA 3H0GG 5CYUA 4ABNA 4LK1C 4FF4A 3S1MB 2F3IA 1CTMA 4WORA 1I6VC 1O78A 1BUVT 3E9IA 5CV9A 4NP5A 1SYFA 4IPCA 3Q8DA 1PTOH 3KLWA 3M4YA 4JV5L 3CP0A 1VQJA 2JA7H 3OW2A 3GTQB 2N55A 3M4OB 4PG3A 4AH6A 3L9AX 3A54A 3T1YQ 1RJTA 2B2YC 1E7ZA 4N9PA 3VR3A 4Q0FA 2BH2A 2R92H 4H44C 3T51B 1XTCD 3SK6A 4YCWA 1HR0Q 3HOZH 2G9HD 5C3EB 1C4QA 2VS1A 3A74A 4DFAA 1YHAA 4JYAQ 1GUTA 3H0GH 4DXFA 3HOUH 4HN7A 3S2DH 1LV9A 4POFA 1LACA 4UAIA 2R7ZG 2F0GA 1Q1BA 1D5XC 1Z7TA 4A3DB 4OHJA 3M3YB 1SJHD 1JR0D 3NPPA 5M5WB 4YHHL 1Z9FA 1BBWA 4JI1Q 5E3FA 3E0EA 1LTLA 4CKEA 4I7ZC 3UDXA 4H02A 1LYLA 1WCMB 1JT8A 4LFBL 5C3XA 4Z9CB 2C9OA 3L2PA 5GQOA 1EFID 1PV4A 1E24A 1DOMA 4DUZL 2L55A 1SNMA 2KHJA 1EFWA 4JI3Q 1PYSB 1KAAA 5M5YH 4RCOA 1IKMA 4OIJA 3STBD 2FMCA 4ID6A 1SMXA 3DEOA 4FP5D 4QB4A 5I2XA 4KK7A 1UEAB 5AJ3Q 5JPMC 2PYKA 1S4ZA 2WIIB 2WB1B 3KF8B 1S72A 1GXDC 1STNA 2EJFC 1PFSA 1VQGA 1TS5A 2R7ZH 3HOYG 2DNCA 5ISRA 4BS9A 2WKCA 3MFYA 2XGTA 4QL5A 2LY7A 2JA6H 3BVMA 2AQ2B 2SNMA 1I6HH 3AB9A 3GV3A 3RLNA 4FXKC 1E3PA 2EQSA 5ELNA 5C44B 5CMDA 1YJWA 2NVTH 1LT6D 5E4XA 3VR5A 4DR5Q 1H95A 2NVYB 1QNUA 3W1BA 4LF8L 4JI2L 1T5EA 3GTKB 1W6JA 4XDXA 1OTCA 3SR1A 3JC66 4DK1A 2A5HA 3M4PA 4CDFC 2VQEQ 1I3QH 3K5OA 2LSSA 5C5MA 3P20A 1S5DD 1Z47A 1KD1C 2KJXA 4G57A 1C9OA 2MO1A 4QIWB 4RKBA 4DV5L 2MO0A 2NYZD 1STHA 3QWNA 4K2LA 3SK4A 4GOPB 4ME5A 3P1HA 4C3HG 3GO5A 3D0FA 4CKCA 2F3WA 4HJ9A 5M5XH 2ES2A 1W2BA 3HOWG 1Q12A 1TWGH 3VA5A 1YEZA 3K7UC 5IIFA 3MZ5A 1CKOA 3HOYH 4JI0Q 4QGUA 2RDHA 1SE4A 2ZJPA 1FR3A 4A3GB 3CCUA 5C4XB 1QE6A 1B2TA 1LLRD 2FMMA 1CKNA 5CV4A 1VCIA 1EWHA 1JCKB 1A15A 1MSGA 2F0KA 1KNEA 4DK6C 3RR5A 4GOPC 3FMCA 2O2LD 3NXWA 1KNAA 2CHBD 1HNXL 2JA9A 4KMUC 4CHTB 2B63G 4GN5A 3N6RA 3R93A 1HUMA 1N32Q 2VY3A 3PO3H 5LL6S 1N33Q 4K8JA 4AYBG 1Q3LA 4YIJA 3NQIA 3PIO3 1JWSD 3U9SA 1WTHA 4C3HH 4C2MB 3S9WA 4A3IG 3HOWH 2BCOA 2I5HA 3G6EA 3NWSA 1FL0A 1YVCA 2K01A 2WAQB 1I94L 2QF7A 1FJGL 3HZXA 5JJZA 2R61A 4A3KB 2F0FA 3A56A 2G9DA 1X32A 2I07B 3A7AB 2CH4A 1SE3A 2K32A 3MFGA 2UXCL 1IKLA 1A3UA 1SJED 5I9OA 1RKNA 5C5LA 1TWFH 1KAWA 4R8NA 1FYCA 1IBKL 1BNZA 2N88A 1PVOA 4X66L 2AUJD 3S2HH 1QCBD 5GAHC 3BDOA 1U4RA 1I4HA 1SEBD 2J4XA 3RZOB 3HOXG 1VQDA 3PQIA 2F52A 3PGZA 1XNQL 4LF7L 1GOZA 1KABA 1HQRD 2XVSA 4FXGC 3KDFB 1EOVA 2QEXA 3NBHB 3NSWA 5KEEA 5J39A 3OHXC 2F0TA 2VNUD 4X64Q 2X69A 4RKLA 4QF4A 5EKIA 1WJJA 4L8JA 3NEMA 2ZJRA 2YU9H 1R4PB 3TMEA 2K1BA 3S17H 5G3LD 2JQOA 2JA7B 4JK1C 1AE2A 2ATWA 3A8JE 4B9WA 2Q8RE 2EJGC 1HNZQ 1QWYA 5EBDA 4DA2A 1DM0B 1PXUA 2Q8TA 5EGTA 4IUQA 1B8AA 1P16A 2EIFA 3E9HA 1Q90A 1AFPA 2R92B 1ZKOA 2X6GA 4DK3C 2PQAB 1IL8A 2NZHA 2Z1CA 2QKIC 4RA8A 5KNCA 4HIKA 4K0KL 4LAAA 2A1AA 4CDEC 2CW0D 2ZTEA 2HD3A 4WRDA 1YITA 1PTOC 1OXXK 2K75A 4NPSA 2F0SA 3LNNA 1DOLA 3HOZB 2UXBL 2E74C 4R4TA 4CDCC 3I4OA 2RCFA 3H0GB 3HOUB 1VQHA 3S15H 1STYA 2ID0A 3R2IA 3B6YA 2VL6A 3U50C 4DR4Q 1NCVA 4AQYQ 3AFPA 1TWCH 3Q23A 4LFAQ 4K2KA 4R4OA 2ASBA 3OIQA 2F03A 4RG1A 1X3QA 1A62A 5D3DA 2UU9Q 1L0XB 4PMBA 2JEAI 3OMCA 3SGIA 3PUWA 3GTGH 3K81C 1EZ8A 2EOTA 1LT4D 1CHQD 4A3EG 1HJPA 4NXNQ 3I72A 2K5WA 2R93G 4DNTB 4DV6Q 4KJNA 4CJ0B 1B7YB 1UAPA 4X3UA 3C3LA 2WV6D 3S16H 4XTCS 2RSNA 1SNCA 1L1OA 2WFWA 5LMNW 2K5HA 1HNWL 1PRTF 3CCEA 3TP7A 2ZJQA 3D31A 3FPPA 1YBYA 1HFGA 3DWAA 1A8VA 3CCQA 1X54A 1M8AA 3DLLA 1B50A 5CBAE 1PH4A 5COYA 4RMFA 4JG2A 1DOKA 1TR5A 2OF1A 2R7ZB 5FOBB 2QGQA 1JWUD 1VF5C 4UP7A 1K3BC 3BYYB 4B08A 2K14A 2QDBA 3CCRA 1RL2A 3LWUA 4Y52H 2FFKB 2JA6B 1ZXTA 5KYLA 3QIAA 3NK9A 4DKAC 2QCPX 3U9OA 4UHVA 1N36Q 2JP1A 4K5WA 2R7FA 1N9WA 4HMIA 2HCCA 3A7LA 1SMYC 4GNXB 1B53A 2NVTB 2B39A 2EYHA 3VYTA 4APVA 4G7OC 1F9SA 1ZYRC 4LUZA 3QG1A 4CGYB 3J7A5 1A63A 1IBMQ 1H9SA 2EY1A 3ERSX 5LMNL 4CJ2C 5C3WA 4DV4Q 1CKMA 2TMPA 3EA6A 4GS3A 1A0IA 2Z6KC 1EWCA 1ONLA 3I4LA 4H13C 1A2UA 1Q1EA 4DR3L 5M5XB 3I55A 3D4DA 1W6KA 4POGA 1TWGB 4GNXC 1IYVA 3CRKC 4YWLA 1PHJA 5JAVA 3WDNA 3AU7A 1S40A 4LF9L 5DNFA 3HOYB 1O7LA 1SNDA 1BKBA 4NDXA 4O2DA 5E7NA 4FF3A 4BWGB 1ILQA 2B2UA 5ELFA 3KK7A 3I91A 1A3TA 1NR4A 3UDIA 1GM5A 4X65Q 2IX1A 1IW7D 2F0IA 1EIHA 2QILA 2HUGA 1PH3A 2NN6H 4LF4Q 2YV5A 3FP9A 4QMGA 1SNOA 3OIPA 5FO7B 1VQNA 5BN3A 2WP8J 1ENFA 4C3IB 1MSHA 1WTPA 4K6DA 3PO3B 1FNVA 3EBEA 3CW2C 4YY3L 2CVRA 4G7ZC 3SDZA 1HZCA 1ZEQX 4C3HB 1WD0A 2YYZA 4X3SA 1SE2A 2A68C 1F77A 2E75C 3HOWB 2AQ1B 3DWPA 5C6AA 1I4GA 4EQPA 1Y1WH 3OWFA 2L12A 3OTOL 4F88A 1E1OA 1Y14B 1EYCA 2ZXOA 1F9RA 3O13A 3T56B 2K5DA 4QUCA 1SAPA 4CDDC 1LT3D 1TS2A 4JCVE 4ALPA 1SXTA 1SDFA 3J80L 4OWTB 4JBMA 2Q2TA 1TWFB 1MHWC 4KY6A 2ICIA 2SOBA 3SHLA 2V4DA 1PZID 1KIXA 1K83H 3S2HB 2YTYA 4HJ8A 4OONA 1YJNA 1E22A 2K5VA 3NUCA 4QIWE 1VMPA 1QVGA 3PF4A 2OT2A 3ZJYC 1AEXA 3TRZA 4O0AA 1XPOA 3K5NA 4DV0L 2AWOA 2Z0SA 2JA8G 3PO2H 1PRTB 3GV6A 3NP8A 4XXEA 1K73C 5CORA 4JI6L 1XPRA 1ILPA 2KCTA 3J80c 2BH8A 4JW0A 2BA1A 3KLRA 1G8ZD 2PW5A 3F1ZA 3IRBA 2YU9B 3HOVG 3C1EA 2K28A 3TP6A 1NTGA 5K5PA 1KC8C 4NMZA 1LTAD 1NMFA 1EU3A 3TEHB 2H4OA 2JJQA 4DPGA 4G4KA 1IXRA 4XT1B 4RGNA 5E1FA 1STBA 4OIKA 4A3MB 1YNNC 1PRTC 2UUBL 4DAYA 4DV2L 1U4MA 4ZKCB 4KKSA 2F4VL 4IALA 2CQOA 4DUYL 3TSSA 2JA8H 1EU4A 2FHTA 4DAMA 1S5CD 2RF4A 3EN2A 3VR6A 2A8VA 1XTDA 2WAQE 2A73B 2LXJA 1ET6A 3HOVH 2K52A 2KHIA 3K58A 3HKZE 4LW1A 1CQFA 3NE5B 1IBLL 5IGDA 1NR2A 3H6MA 3C2PA 1PDQA 4BY7G 3WOFA 1QOHA 2ENBA 1J6QA 4OO1I 1NNXA 1PH1A 1PA6A 1CSPA 2BOSA 2A6HD 4ZCKA 3KF6B 3VDYA 1PZKD 5ELBA 2OWOA 1C7YA 1GUNA 3RD4A 3H15A 4JI2Q 3ICEA 2A69D 3CCMA 2NUCA 1SRUA 3PV0A 4LF6L 3S16B 1WOCA 1NJIC 3ULPA 4ZUIA 1AZQA 2RDGA 4V190 3AQQA 5JEAJ 4DV5Q 2AHOB 4OWWB 4JI7Q 1AP0A 3T1HL 3QR8A 4HEDA 5IP9G 1TWHH 1CM9A 1JJ2A 2Y0SG 1FVIA 1X56A 4NKLA 4P71A 4PV1C 1JOOA 1XPUA 3CC2A 4IJHA 3V05A 1B4OA 1JICA 4BY7H 5BR8L 2M00A 3IFTA 2XSCA 2BE5D 2IX3A 3QOLA 2AQ3B 2O5IC 3P75A 4Q5VA 1KHIA 2V1CC 2DGYA 4A3FG 5FJ8G 2L5TA 1HNXQ 1CHPD 1DYQA 4DR7L 4KD3A 1L2FA 3CD6A 3GTPH 3ULJA 1UE7A 3U4VA 3GTOH 1TS4A 4MNOA 2KA7A 2VXWA 1PLFA 4GN3B 3ND8A 4NB3A 3CMAA 1KRTA 2Q2IA 1PTOF 4XQNA 2Z4HA 3C1FA 5DM73 3CCSA 2K6AA 3X3MA 1PFBA 1J5EQ 5CBEE 1I94Q 1FJGQ 4A3JG 1LTID 4TQUS 1EIFA 4OX9L 1S5BD 2RDFA 4IUPA 4KY7A 1B3QA 3A8KE 1E1TA 1V1PB 2F0MA 5CV5A 4NXML 4DXGA 2UXCQ 1X55A 3SE0A 1W3SA 4A3BG 1HR0W 2ZM6L 4PMWA 4JOIC 1IBKQ 1EQQA 4A3CG 1X9NA 1EIGA 1Q82C 1HXYD 3R2TA 3I4MG 1SSOA 2D0PA 1VQIA 4A3FH 2A69C 1LUZA 5C0XG 1XNRL 1II3A 4QQBX 4GKJQ 3MEFA 5M3MG 3QJYA 4L5RC 4DF7A 1WD1A 1QUQB 4IFDG 4LF7Q 5J22A 3K0XA 1JE4A 4IO9A 2K05A 3AFQA 3J80E 4LNQA 4DR6L 4RCNA 4BBRB 1GUOA 4BBSG 4WJWA 4ZAIA 2CH4W 2E2DC 2NWGA 4FDBA 5FLMG 1BQQT 3J81i 1Y1WB 1JOKA 3NTKA 1NBWA 2K04A 2B2YA 2CWAA 1VDZA 5EJWA 2ICEC 5GAGC 1PH9A 4A3JH 1GHJA 4TVAB 4OWXB 1VQOA 3GTJH 2OTJA 4LFCL 1BDOA 1S5FD 5T1IA 4A3BH 1V1OA 3S1RH 2HIXA 4LJZC 3OSOA 5G3LF 1SLJA 2F0UA 1K83B 5DLQE 2R7DA 4GLXA 5C0XH 3SK8A 4KV6A 1X6OA 3M7GA 5M3MH 1SBBB 1J8IA 1DCZA 1N34L 1VQMA 1D5MC 1TXYA 3MXPA 3OMGA 4IFDH 4IN3A 2UXBQ 1AH9A 1MBYA 4R4CA 2I46A 3ULLA 3PO2B 2EYPA 3STBC 3HP3A 1FGUA 1YHBA 1EQVA 4MZ9A 2JA5G 2E8GA 3KLSX 4BA1I 1G91A 3EFXD 5IGGA 2IHEA 5M3FB 2DNEA 2XTIA 4JC0A 3NHHA 2EXDA 4JI8L 1OXUA 3GQBA 3BDLA 4U673 2FJ2A 1UE5A 2MPMA 2L9HA 3UDFA 3G71A 3H3VH 2N3SA 1R9TH 1WTQA 3TP8A 2YTXA 3HKZB 2JSOA 3G7LA 3E3XA 2QW7A 4ODGA 2AMCB 3DUZA 4IUVA 2D9UA 2OTLA 3UDGA 2SNSA 3MXNB 2PI2E 5H1SE 3ITPA 1IYUA 2E76C 1JQYD 3PUZA 1STEA 2NVQH 1BOSA 1LABA 3K59A 1C0AA 3CU7A 4IPDA 1BBUA 2B63H 5KYIA 1G6PA 4XQJA 1K9MC 1MIUA 2KCMA 2JXMB 3FKIG 3OYYA 2VQFQ 1F9QA 1JB7A 4UDUC 1BBXC 1K3RA 3BVGA 1X3FA 3JAMi 2JA5H 3J81c 1VQPA 1D1IA 1FNUA 4A3IH 4I7AA 2E5LQ 2IY5B 1VQ7A 1SYEA 2J7ZA 5CR3A 4X62L 4R8IA 4LWCA 3CF5A 5TSSA 3HOVB 1PTOB 1VS0A 1CUKA 3QOJA 1B3AA 1CZWA 1G291 4ZLTF 5IGFA 3E0JA 4KY5A 4KD4A 4P72A 4HSVA 2JYOA 3KF8A 2F0VA 1SROA 1H9KA 2I5MX 3KBGA 1I4RA 1O7ZA 1RTNA 1D6EC 1I4PA 1HFNA 1NMGA 1O7YA 3BVZA 2E2HH 4EQ5A 1SYGA 3DM3A 2D2CC 2F0EA 3D3RA 4JI0L 2EY6A 4AYBE 5J1ZA 3HOXH 1CZGA 2CQAA 3OPOA 1CA5A 3RN2A 5D14A 1IHZA 1VQBA 4NW2A 4L5QA 3G4SA 3CC4A 2PW7A 2AWNA 3BG3A 4A3LG 4HCSA 1WTRA 4F7XA 5IY0A 4JBKA 1H9RA 5AFWA 4A93G 1Q86C 3V96A 2F0OA 4J1MA 1WYDA 2B2TC 4RGMA 3S2DB 5EPJA 2EY5A 1VQKA 1KL9A 4LF9Q 3JAML 2XWBB 2HDLA 2KEEA 5IGCA 5IODA 1A6XA 4GOPA 2ZXRA 4S3SA 2MFIA 1L0WA 1N33L 3CQZH 3PIPA 5C3EG 4BY7B 2KCNA 2A6ED 2EXZA 1Z6HA 5EKKA 2EYJA 5KRUA 2XNAC 3NWTA 4X3KA 1DZ1A 1P8LA 3SVMA 4ILWA 3BZKA 1CT1D 1CK1A 4RHRA 5JJLA 5JVG3 2NBFA 3EROA 2J0TD 4RFBA 4UPAA 5M9OA 4A3DG 3IFDA 1EY5A 3GTQH 4KKUA 3A55A 1D1KA 4YY3Q 1QVCA 1O7IA 1SYBA 1IZ6A 5BN5A 5M5YB 3M4OH 3G6JB 3JAMc 1U9RA 3S24A 4IUNA 2GN5A 4A93H 3WOEA 3V2TA 4IZ8A 4L5TA 4PZ7A 3CAMA 3GTMH 3OTOQ 1WCMG 2Y0SB 1F9PA 1Q8IA 4TSSA 3ERQA 2HDMA 1NUCA 2N49A 1I6HB 4KHVA 3KYHC 2MJ8A 2CWPA 2CFMA 1FGBD 1EY7A 4MTKA 3MC0B 1MJCA 1V1QA 3MA2B 4A3EH 2KENA 4DAPA 1Q8KA 1RIPA 1V8QA 2R93H 2WB1G 4A3FB 4C1NI 1I4QA 4FXDA 1HZAA 2CW0C 3CCJA 4DU9A 4DV1L 1I3QB 2BDOA 4A3DH 2HQLA 4OXPA 4KLKA 3HRZC 3RLOA 4DV0Q 1V9PA 3DWQA 1WTOA 4L6TB 4KN7C 5KGUA 4DR2L 2GVBA 2LKVA 5C44G 4MHEA 1A3VA 1D2BA 2I0QA 4C3JG 2DY7A 2KVMA 5HURA 4BA2I 4B3SL 3OWEB 4XIGS 2VUMG 3MEHA 3KDFA 4JI5L 1RD9D 3BZCA 3NBHA 2Z4IA 4QJFA 4A3JB 2RCNA 4K5XA 1K8AC 4JI4L 4IPHA 4IUUA 5IYCG 3UE1A 5EPKA 2ALYB 2MGSA 3TREA 5CC4A 3GTJB 3OW7A 4DNIA 5NUCA 3F2CA 3WWVA 2ZT9C 4A3BB 4JPBW 5LHY1 2DN8A 3N52A 5CV8A 1VQEA 2UUBQ 1OXTA 4HJ5A 1Y8PB 4DV2Q 1RTOA 3RZDH 1KRSA 4KKTA 1OO9B 1GUSA 3NBIA 5M3MB 3FHWA 2E2IH 2UUAQ 2UUCL 2RHSB 4RAUC 3MXUA 1TY2A 1VQ6A 3I3CA 4F87A 2EE1A 2PQAA 2WINB 1RHPA 4KHZA 4NXNL 3I8ZA 1KDBA 5HY6A 4C3JH 3EJIA 1SNQA 2NVYH 3OOCA 4ME3A 1IL2A 3NQTA 3GTKH 4ULLA 2VUMH 1YNJD 4P2CB 4IOAA 1EL0A 1XMOL 1XWEA 2X6LA 1OXSC 1DJRD 2K5QA 3C46A 3HKSA 4JV5Q 4K6LA 5IYCH 1SFOH 2HHHL 1PH5A 1R9TB 4RWSC 2QDLA 4B3TL 1VQ4A 4A76A 2EYFA 3J7YW 1SR3A 3VYSA 1AE3A 4K8IA 1Y69U 3TZUA 2F0QA 2F0JA 4HSPA 1K8GA 1HPCA 3URYA 2NVQB 4HR7B 2F4IA 2Z9HA 1B1ZA 4H7BA 4HMJA 2WAQG 3BS1A 2B63B 1K8MA 3TQYA 2UXDL 3SK5A 5FKAC 5D3IB 1BCPD 2NVXH 4B3ML 2L1BA 1N36L 3H3VC 2XRSD 4UP9A 4AYBB 4LF5L 4PMCA 1DXMA 2VW9A 1DD2A 1RODA 4ZUJA 2JA5B 4JBWA 3A5ZB 4FF1A 3T1HQ 4DN4M 5IYDG 4A3IB 2DJFC 3MTSA 1GUWA 3X3NA 1IBML 1U4PA 2IW3A 3KJOA 1RCVD 5ELDA 3M85A 3S17B 1VQLA 5IWAL 2K03A 1EY8A 5D65A 3FPUB 3RLFA 2NN6I 5LMUL 1QVFA 3CCVA 5BR8Q 5GROA 1XJVA 1BO0A 2RKSA 1LTTD 4OEMB 4YHHQ 4DGZA 3P7JA 1YZ6A 3KBXA 5C4JH 1IW7C 2B8GA 1KXLA 2F0DA 4E6IA 1XMQL 3S14H 2E2HB 1Y8OB 3E6ZX 1HRJA 4LFBQ 2TSSA 4QCLA 1T9HA 4DR7Q 3HOXB 2PNRC 2K33A 1HCZA 4DUZQ 1EOTA 4R4IA 3JAME 3W3AA 5JOBA 4UP8A 2KBNA 1JORA 3F2UA 3BDCA 1B9MA 1EEFD 2B29A 2NB0A 4GLVB 4X65L 5IYDH 2ZTDA 3S15B 4LF4L 1S5ED 4A75A 1TWCB 4M8AA 1U0LA 3NELA 2PQEA 1U4LA 3CQZB 2Z8LA 4OX9Q 2B2WA 2DUDA 5I9PA 3NTHA 4NXMQ 1LTGD 3LGJA 4R1JA 3GTGB 3LWEA 4P75A 2JEBI 1LTRD 4ZKBB 3HOUG 1F2YA 3EQLC 4LUOA 2ZM6Q 4HIOA 2O5JC 4EQNA 2AKWB 2OXPA 5ELEA 1GVPA 4KHPL 1CKNB 4LF8Q 1X3PA 5I4DA 2B2VA 1STAA 3KJPA 1XNRQ 1ESFA 3RMHA 4J15A 4RHSA 3FVQA 2LFNA 1NSNS 2PZUA 1BCPC 3EIVA 2IX0A 2QEJC 4DR6Q 2PI2A 1PH2A 1AZPA 4A93B 1STGA 4DV7L 1D7QA 3PSIA 1DONA 3CCLA 4N9TA 5IGEA 3L0OA 3QO2A 4GZYC 3GTMB 3HS0C 3AYHB 4N8X1 3A5UA 3RN5A 2KEDA 4IURA 4DV3L 2NZOA 1DGSA 3D6WA 1VQ8A 3R8BA 4LFCQ 4LMQD 1HQMC 4ZK9B 5FO8B 3W5OA 2SDFA 5JVH3 2OCEA 4A3EB 1C8CA 2R93B 3U4ZA 1QB5D 1KLUD 4DR1L 4ZQ3A 2HT1A 2RA4A 3M4QA 2JA6G 1N34Q 5FK9C 4QY7A 4BXXG 4GKKL 4B3RL 5GAEC 1E2VA 2H1EA 2OQKA 5EBCA 2F3VA 5DAUA 4KI0A 3D8GA 3VYRA 3MWYW 4N8FA 1EY6A 4JI8Q 5IP9H 2PZWA 4JBJA 2RVLA 3MVVA 2KHSA 2D62A 1TKWB 4U68A 4WJ3M 2FINB 1MI2A 1X3EA 3LX0A 2GVAA 1CI3M 1SE8A 2JK8A 2P5ZX 1HUNA 1B44D 2K4KA 3ONAB 4HTHA 2A6HC 1WTXA 5FLXL 1FNWA 1VQ9A 4K5VA 4PZ8A 3RZDB 3J7AF 4X66Q 4BY1G 1EY0A 4J6HA 5FJ8H 3SEBA 1J9OA 5IYBG 5KIXA 4X3TA 2DY8A 5EKLA 5HGTA 1M90C 2E2IB 1XX8A 2OEOA 3TS0A 1ENCA 1GD7A 1XNQQ 4BXXH 1Q46A 2D0OA 1L0YB 2OQ0A 1M4VA 2RHQB 3GD7A 4LUVA 2E2JH 3KUPA 1ICWA 1EYDA 2ZTCA 3T1YL 2KQ3A 4C3JB 3I4NG 2Y0SE 3DMUA 2IL8A 4HAEA 2XWJB 2VUMB 4X62Q 1F2MA 4L5SA 1F2ZA 3J7AV 2XRQD 2PCFB 1O80A 1H9MA 5FLXc 1SFOB 4C3IG 1GJXA 3S1NH 3PO3G 3E5SA 4OL7A 1HR0L 1ASZA 1TWAH 4PZ6A 2BDNA 3IAYA 1QJOA 4JYAL 1LM0A 2BE5C 4JI7L 1E0BA 1PH7A 3HEJA 1EZ6A 4A3CH 2AUKA 3I4MH 2HCIA 4DNRB 1G2TA 4YCUA 4BY1H 2IHFA 4K0KQ 4XYQA 5IYBH 2JN4A 1JJCB 1YHQA 5JEAG 1WFQA 1F2LA 2NVXB 1CSQA 3DM1A 3Q0AA 3KF6A 4EGVA 4TRDA 2NTSA 1M1KC 2LMCB 3MXGA 4JI1L 4BBSH 2PPBC 3I4NH 4DK0A 1L1OB 4QUFA 1HA6A 5FLMH 2NTTA 3HGBA 2RQXA 3S1QH 2IT1A 3K80C 1Y1VG 3F2DA 4C3IH 1PTOD 3PUYA 3KLSA 4MN3A 1ASYA 1UEBA 1EUJA 4JI3L 2EYOA 3J81L 1MGSA 2XIWA 5EAYA 2PMZB 5CGKA 3TBIB 5AJ3L 2K5NA 3BJUA 5C4JB 1HZ9A 4KN4C 3S14B 1KDAA 5C4ZA 3TDQA 5I2YA 3GTLH 2EYMA 1UUPA 1I50H 1L1OC 3T4AC 4CJ1B 2EZVA 1J5EL 1EQRA 2VB3X 1LT5D 5JEAH 3DEPA 4FO2A 1H9SB 3ND9A 1HNWQ 1XYIA 2JA8B 1JB3A 1PZJD 4HIDA 4FVMA 4IUTA 4A3MG 2PO4A 3GDEA 1QG7A
chains in the Genus database with same CATH topology
2Q8IB 2F0NA 5EQ0A 2JE6I 4RGOS 3BYTB 3IKJA 3CRLC 3HG9A 1PFNA 2L11A 4TKOB 4O42A 5C0XI 3MAQA 1EEID 3T16A 2NZ1D 5IT9L 1VF7A 5I6YA 4IFDI 4XYOA 3VYUA 4WFN3 1FD7D 4IQZA 2IJ0A 1V1PA 1EY4A 1EYAA 1JWMD 2A74C 3FEWX 5C4HA 1PYWD 1RDPD 5EPLA 4XT3B 5A2QL 4G7HC 1SMYD 3H91A 1OXVA 5DEHA 2EJMA 1ZYRD 3DHQA 3L3OC 1TWHB 2F0HA 1R4QB 5T1GA 1TQOA 3CKIB 1CA6A 2F1MA 2B2UC 1LO5D 1QILA 2L4NA 1D5ZC 3K0YA 4FYDA 1TY0A 1JC7A 1SYCA 1B9NA 2SEBD 4F8MA 5F2DA 1G2SA 1ESRA 2R6GA 1LTSD 2EVBA 4PNYA 2O4XA 3TN2A 5FO9B 3IL8A 2MP1A 1XXGA 4CKBA 2PZTA 1KTKA 1TT2A 2KOLA 3T13A 3GTPB 4OGQC 3GTOB 3I73A 3D4RA 2EDGA 1EY9A 3R3OA 3PUVA 2F0WA 3L7ZC 2GA4B 1AN8A 5FLXE 1HTPA 2M9VA 3FRPB 1V43A 3MHBA 3D6CA 2RSOA 2D5DA 1RF2D 4PQXA 2M2LA 1TVXA 5KNDA 2EYLA 1KDCA 2A68D 2RBMA 1BXTA 5BN4A 3Q22A 3MXNA 2LS01 3VR2A 1E2ZA 2MHVA 3VA7A 3K5LA 2E2JB 4HCEA 2KCCA 4V0BA 2NN6G 1MD2D 1BCPF 3AMUA 1PFMA 1EQTA 4L63B 1WTWA 3S1NB 5A35A 3BZDB 3Q6SA 1KLGD 1TWAB 2EY2A 2A6EC 3D4WA 1ENAA 3S1RB 4R9WA 5K36G 1JOQA 3I4MB 4O1NA 4BY1B 5LL6X 4EVOA 4B9XA 1K8OA 1A2TA 2B2TA 1HHVA 3ZYYX 3W2DA 1TS3A 2WACA 1SYDA 3J81E 1Y8NB 2C5CA 1TIID 5IOCA 4BBSB 1YNND 4ZRZA 3I4NB 1SNPA 1ML0D 3Q24A 1PRTD 2F0PA 3S1QB 2B2WC 3T53B 3TP5A 3NTIA 3UI2A 4OO1G 2BA0A 4ZYSA 3CHBD 5DM63 2ZXPA 1QNKA 3H94A 1TU2B 3PUXA 4RGTA 5CV6A 2MUYA 2F0LA 2XN9C 3M7NA 4XQQA 2WKDA 4FF2A 2B2VC 1PMRA 5K36H 1CFMA 1ET9A 3GTLB 4C56C 1G6ZA 4I65A 1I50B 4EQOA 5KNBA 3K5MA 1E2WA 2HQEA 3I90A 4J8QA 1I4XA 2B8FA 4KTAA 5ELCA 3FDTA 3QB3A 4MIUA 1HTLD 4FNFA 1C48A 5IT9E 2EPBA 3I70A 4Y7NB 3RUZA 2IWHA 5JPNC 1VMCA 1Y1VB 2R3ZA 4OO1H 1WVLA 3K7AB 4CBVA 2KUMA 2IPKD 5I6WA 4DAVA 1WTVA 2KECA 5IGBA 5A2QE 5E4WC 1CQVA 1H9JA 4H0LC 4K14A 1GHKA 1UNSA 5CV7A 1AW7A 1T5XD 3DXJC 1NAPA 3GP7A 3PMFA 1BF4A 3PIP3 4M1UB 3FKIB 1GUGA 1LTBD 3K6OA 3K57A 2VB2X 3VR4A 3H09A 1YNJC 3A8IE 1HA5A 1BCPB 4RH6A 5C0XJ 3EVQA 4C1NK 1BR9A 3SXHA 3TZDA 2L0CA 4IFDJ 4KJOA 2K7VA 4ABNA 5CYUA 4LK1C 4FF4A 3S1MB 1CTMA 4WORA 1I6VC 1O78A 1BUVT 5CV9A 4NP5A 1SYFA 1PTOH 3M4YA 3GTQB 2N55A 3M4OB 3L9AX 3A54A 1RJTA 2B2YC 4N9PA 3VR3A 4Q0FA 4H44C 3T51B 1XTCD 3SK6A 2G9HD 5C3EB 1C4QA 4DFAA 1GUTA 4DXFA 4HN7A 1LV9A 1LACA 4UAIA 2F0GA 1Q1BA 1D5XC 1Z7TA 4A3DB 4OHJA 3M3YB 1SJHD 1JR0D 3NPPA 5M5WB 5E3FA 4CKEA 4I7ZC 1WCMB 5C3XA 4Z9CB 2C9OA 1EFID 1DOMA 2L55A 1SNMA 1KAAA 4RCOA 1IKMA 4OIJA 2FMCA 4ID6A 3DEOA 4FP5D 4QB4A 5I2XA 4KK7A 1UEAB 5JPMC 2PYKA 1S4ZA 2WIIB 2WB1B 1GXDC 1STNA 2EJFC 1TS5A 2DNCA 5ISRA 4BS9A 2WKCA 3MFYA 2LY7A 3BVMA 2AQ2B 2SNMA 3AB9A 3GV3A 4FXKC 5C44B 5CMDA 1LT6D 5E4XA 3VR5A 2NVYB 1QNUA 3GTKB 1T5EA 1W6JA 4XDXA 3SR1A 4DK1A 2A5HA 3K5OA 5C5MA 3P20A 1S5DD 1Z47A 2KJXA 4G57A 4QIWB 4RKBA 2NYZD 1STHA 3QWNA 4K2LA 3SK4A 4ME5A 3P1HA 4C3HG 3GO5A 4CKCA 2F3WA 1Q12A 3VA5A 5IIFA 3MZ5A 2RDHA 1SE4A 1FR3A 4A3GB 5C4XB 1QE6A 1B2TA 1LLRD 2FMMA 5CV4A 1VCIA 1EWHA 1JCKB 1A15A 1MSGA 2F0KA 1KNEA 3FMCA 2O2LD 3NXWA 1KNAA 2CHBD 4KMUC 4CHTB 3N6RA 3R93A 1HUMA 5LL6S 4K8JA 1Q3LA 4YIJA 3NQIA 3PIO3 1JWSD 3U9SA 4C2MB 3S9WA 2BCOA 3NWSA 2K01A 2WAQB 2QF7A 3HZXA 5JJZA 2R61A 4A3KB 2F0FA 3A56A 2G9DA 1X32A 2I07B 3A7AB 1SE3A 2K32A 3MFGA 1IKLA 1A3UA 1SJED 5I9OA 1RKNA 5C5LA 4R8NA 1FYCA 1BNZA 2N88A 2AUJD 1QCBD 3BDOA 1U4RA 1I4HA 1SEBD 2J4XA 3RZOB 1GOZA 1KABA 1HQRD 2XVSA 4FXGC 3NSWA 5KEEA 5J39A 3OHXC 2F0TA 2VNUD 2X69A 4RKLA 4QF4A 5EKIA 4L8JA 1R4PB 3TMEA 2K1BA 5G3LD 2JA7B 4JK1C 3A8JE 4B9WA 2Q8RE 2EJGC 1QWYA 5EBDA 4DA2A 1DM0B 1PXUA 2Q8TA 5EGTA 4IUQA 1Q90A 1AFPA 2R92B 1ZKOA 2X6GA 1IL8A 2Z1CA 2QKIC 4RA8A 5KNCA 4LAAA 2CW0D 4WRDA 1PTOC 1OXXK 2F0SA 3LNNA 1DOLA 3HOZB 2E74C 3H0GB 3HOUB 1STYA 2ID0A 3R2IA 1NCVA 3Q23A 4K2KA 3OIQA 2F03A 1X3QA 5D3DA 1L0XB 4PMBA 2JEAI 3OMCA 3PUWA 1EZ8A 2EOTA 1LT4D 1CHQD 3I72A 2K5WA 4DNTB 4KJNA 4CJ0B 1UAPA 4X3UA 3C3LA 2WV6D 4XTCS 2RSNA 1SNCA 1PRTF 3TP7A 3D31A 3FPPA 1HFGA 3DWAA 1M8AA 1B50A 5CBAE 5COYA 1DOKA 1TR5A 2OF1A 2R7ZB 5FOBB 1JWUD 1VF5C 4B08A 3BYYB 2QDBA 3LWUA 2FFKB 2JA6B 1ZXTA 5KYLA 3QIAA 3NK9A 2QCPX 3U9OA 2JP1A 4K5WA 4HMIA 2HCCA 3A7LA 1SMYC 1B53A 2NVTB 2B39A 2EYHA 3VYTA 4G7OC 1F9SA 1ZYRC 3QG1A 4CGYB 1H9SA 2EY1A 4CJ2C 5C3WA 2TMPA 3EA6A 1EWCA 1ONLA 3I4LA 4H13C 1A2UA 1Q1EA 5M5XB 3D4DA 1W6KA 1TWGB 1IYVA 3CRKC 5JAVA 3WDNA 3AU7A 5DNFA 3HOYB 1O7LA 1SNDA 4NDXA 4FF3A 4BWGB 1ILQA 2B2UA 5ELFA 3KK7A 3I91A 1A3TA 1NR4A 2IX1A 1IW7D 2F0IA 1EIHA 2QILA 2HUGA 2NN6H 4QMGA 1SNOA 3OIPA 5FO7B 5BN3A 2WP8J 1ENFA 4C3IB 1MSHA 1WTPA 4K6DA 3PO3B 1FNVA 2CVRA 4G7ZC 3SDZA 1ZEQX 4C3HB 1WD0A 2YYZA 4X3SA 1SE2A 2A68C 1F77A 2E75C 3HOWB 2AQ1B 3DWPA 5C6AA 1I4GA 4EQPA 3OWFA 2L12A 4F88A 1EYCA 2ZXOA 1F9RA 3O13A 3T56B 2K5DA 4QUCA 1SAPA 1LT3D 1TS2A 1SXTA 1SDFA 3J80L 1TWFB 4KY6A 2ICIA 2SOBA 3SHLA 2V4DA 1PZID 3S2HB 3NUCA 1VMPA 2OT2A 1AEXA 3K5NA 2AWOA 1PRTB 3GV6A 3NP8A 4XXEA 5CORA 1ILPA 2BA1A 3KLRA 1G8ZD 2PW5A 2YU9B 3C1EA 2K28A 3TP6A 5K5PA 4NMZA 1LTAD 1EU3A 2H4OA 4G4KA 4XT1B 4RGNA 5E1FA 1STBA 4OIKA 4A3MB 1YNNC 1PRTC 4DAYA 1U4MA 4ZKCB 4KKSA 4IALA 3TSSA 1EU4A 2FHTA 1S5CD 3VR6A 2A73B 1ET6A 3K58A 1CQFA 3NE5B 5IGDA 1NR2A 3H6MA 3C2PA 1PDQA 3WOFA 1QOHA 2ENBA 4OO1I 2BOSA 2A6HD 1PZKD 5ELBA 1GUNA 3RD4A 2A69D 2NUCA 3PV0A 3S16B 1AZQA 4ZUIA 2RDGA 4V190 5JEAJ 1AP0A 4HEDA 1CM9A 4NKLA 4PV1C 1JOOA 3V05A 1B4OA 1JICA 2M00A 3IFTA 2XSCA 2BE5D 2IX3A 3QOLA 2AQ3B 2O5IC 3P75A 4Q5VA 2L5TA 1CHPD 1DYQA 4KD3A 1TS4A 2KA7A 2VXWA 1PLFA 3ND8A 1PTOF 4XQNA 2Z4HA 3C1FA 5DM73 2K6AA 3X3MA 1PFBA 5CBEE 1LTID 4TQUS 1S5BD 2RDFA 4IUPA 4KY7A 1V1PB 3A8KE 2F0MA 5CV5A 4DXGA 3SE0A 4PMWA 1EIGA 1HXYD 3R2TA 1SSOA 2A69C 5C0XG 1II3A 3QJYA 4DF7A 1WD1A 4IFDG 5J22A 1JE4A 2K05A 3J80E 4RCNA 4BBRB 1GUOA 4WJWA 4ZAIA 2E2DC 2NWGA 1BQQT 1Y1WB 1JOKA 3NTKA 2K04A 2B2YA 1VDZA 5EJWA 2ICEC 1GHJA 1BDOA 1S5FD 5T1IA 1V1OA 4LJZC 3OSOA 5G3LF 2F0UA 1K83B 5C0XH 3SK8A 4KV6A 3M7GA 1J8IA 1SBBB 1DCZA 1D5MC 3MXPA 3OMGA 4IFDH 4IN3A 1MBYA 2I46A 3PO2B 2EYPA 3HP3A 1EQVA 3KLSX 4BA1I 1G91A 3EFXD 5IGGA 5M3FB 2DNEA 3NHHA 1OXUA 3GQBA 3BDLA 4U673 2FJ2A 2MPMA 2L9HA 1WTQA 3TP8A 3HKZB 2JSOA 3G7LA 4ODGA 3DUZA 4IUVA 2D9UA 2SNSA 3ITPA 1IYUA 2E76C 1JQYD 3PUZA 1STEA 1BOSA 1LABA 3K59A 3CU7A 5KYIA 4XQJA 2JXMB 1F9QA 4UDUC 1BBXC 3BVGA 1D1IA 1FNUA 1SYEA 2J7ZA 5CR3A 4R8IA 3HOVB 5TSSA 1PTOB 3QOJA 1B3AA 1CZWA 1G291 4ZLTF 5IGFA 3E0JA 4KY5A 4KD4A 4HSVA 2JYOA 3KF8A 2F0VA 1H9KA 3KBGA 1I4RA 1O7ZA 1RTNA 1D6EC 1I4PA 1HFNA 1O7YA 3BVZA 1SYGA 2D2CC 2F0EA 3D3RA 2EY6A 5J1ZA 1CZGA 2CQAA 3OPOA 1CA5A 5D14A 1IHZA 4NW2A 2PW7A 2AWNA 3BG3A 4HCSA 1WTRA 4F7XA 1H9RA 5AFWA 3V96A 2F0OA 4J1MA 2B2TC 4RGMA 3S2DB 5EPJA 2EY5A 3JAML 2XWBB 2HDLA 2KEEA 5IGCA 5IODA 1A6XA 2ZXRA 4S3SA 4BY7B 2KCNA 2A6ED 2EXZA 1Z6HA 5EKKA 2EYJA 5KRUA 2XNAC 3NWTA 4X3KA 1DZ1A 3SVMA 4ILWA 1CT1D 1CK1A 4RHRA 5JVG3 2NBFA 3EROA 2J0TD 4RFBA 5M9OA 3IFDA 1EY5A 4KKUA 3A55A 1D1KA 5M5YB 1SYBA 5BN5A 3G6JB 1U9RA 4IUNA 3WOEA 3V2TA 4IZ8A 2Y0SB 1F9PA 1Q8IA 4TSSA 3ERQA 2HDMA 1NUCA 1I6HB 4KHVA 2MJ8A 1FGBD 1EY7A 3MC0B 3MA2B 4DAPA 1V8QA 4A3FB 4C1NI 1I4QA 4FXDA 2CW0C 4DU9A 1I3QB 2BDOA 3HRZC 3DWQA 1WTOA 4L6TB 4KN7C 5KGUA 2LKVA 4MHEA 1A3VA 1D2BA 4C3JG 2DY7A 2KVMA 5HURA 4BA2I 3OWEB 4XIGS 3MEHA 1RD9D 3NBHA 2Z4IA 4A3JB 4K5XA 4IUUA 5EPKA 5CC4A 2MGSA 3GTJB 3OW7A 5NUCA 2ZT9C 4A3BB 5LHY1 2DN8A 3N52A 5CV8A 1OXTA 1Y8PB 1RTOA 4KKTA 1OO9B 1GUSA 3NBIA 5M3MB 4RAUC 3MXUA 1TY2A 3I3CA 4F87A 2EE1A 2WINB 1RHPA 4KHZA 3I8ZA 1KDBA 3EJIA 1SNQA 3OOCA 3NQTA 4ULLA 1YNJD 4P2CB 1EL0A 1XWEA 2X6LA 1OXSC 1DJRD 2K5QA 3C46A 4K6LA 1R9TB 4RWSC 2EYFA 3J7YW 3VYSA 4K8IA 1Y69U 3TZUA 2F0QA 2F0JA 4HSPA 1HPCA 3URYA 2NVQB 4HR7B 2F4IA 1B1ZA 4H7BA 4HMJA 3BS1A 2B63B 1K8MA 3SK5A 5FKAC 5D3IB 1BCPD 2L1BA 3H3VC 2XRSD 4AYBB 4PMCA 1DXMA 1DD2A 1RODA 4ZUJA 2JA5B 4JBWA 4FF1A 4DN4M 4A3IB 3MTSA 1GUWA 3X3NA 1U4PA 2IW3A 1RCVD 5ELDA 3M85A 3S17B 2K03A 1EY8A 5D65A 3FPUB 3RLFA 2NN6I 1BO0A 2RKSA 1LTTD 4DGZA 3P7JA 3KBXA 1IW7C 2B8GA 2F0DA 4E6IA 2E2HB 1Y8OB 3E6ZX 1HRJA 2TSSA 4QCLA 3HOXB 2PNRC 2K33A 1HCZA 1EOTA 3JAME 3W3AA 5JOBA 1JORA 3F2UA 3BDCA 1B9MA 1EEFD 2NB0A 3S15B 1S5ED 1TWCB 4M8AA 2PQEA 1U4LA 3CQZB 2Z8LA 2B2WA 5I9PA 3NTHA 1LTGD 3GTGB 3LWEA 2JEBI 1LTRD 4ZKBB 1F2YA 3EQLC 2O5JC 4EQNA 2OXPA 5ELEA 1X3PA 5I4DA 2B2VA 1STAA 1ESFA 3RMHA 4RHSA 3FVQA 2LFNA 1NSNS 2PZUA 1BCPC 2IX0A 2QEJC 1AZPA 4A93B 1STGA 1DONA 4N9TA 5IGEA 3QO2A 4GZYC 3GTMB 3HS0C 2KEDA 4IURA 3D6WA 3R8BA 4LMQD 1HQMC 4ZK9B 5FO8B 2SDFA 5JVH3 4A3EB 1C8CA 2R93B 1QB5D 1KLUD 4ZQ3A 2RA4A 5FK9C 1E2VA 2H1EA 5EBCA 2F3VA 5DAUA 4KI0A 3D8GA 3VYRA 3MWYW 1EY6A 2PZWA 2RVLA 3MVVA 2KHSA 2D62A 1TKWB 4U68A 2FINB 1MI2A 3LX0A 1CI3M 1HUNA 1B44D 3ONAB 4HTHA 2A6HC 1WTXA 5FLXL 1FNWA 4K5VA 3RZDB 3J7AF 1EY0A 4J6HA 3SEBA 1J9OA 5KIXA 4X3TA 2DY8A 5EKLA 5HGTA 2E2IB 1XX8A 2OEOA 1ENCA 1L0YB 1M4VA 3GD7A 3KUPA 1ICWA 1EYDA 2KQ3A 4C3JB 3DMUA 2IL8A 4HAEA 2XWJB 2VUMB 1F2MA 1F2ZA 3J7AV 2XRQD 2PCFB 1O80A 1H9MA 1SFOB 4C3IG 1GJXA 3E5SA 4OL7A 2BDNA 3IAYA 1QJOA 2BE5C 1E0BA 3HEJA 1EZ6A 2AUKA 2HCIA 4DNRB 1G2TA 4XYQA 5JEAG 1F2LA 2NVXB 3DM1A 3Q0AA 4EGVA 4TRDA 2NTSA 2LMCB 3MXGA 2PPBC 4DK0A 4QUFA 1HA6A 2NTTA 3HGBA 2RQXA 2IT1A 1PTOD 3PUYA 3KLSA 4MN3A 2EYOA 3J81L 1MGSA 2XIWA 2PMZB 5CGKA 3TBIB 5C4JB 4KN4C 3S14B 1KDAA 5C4ZA 3TDQA 5I2YA 2EYMA 1UUPA 3T4AC 4CJ1B 2EZVA 2VB3X 1LT5D 5JEAH 3DEPA 4FO2A 1H9SB 3ND9A 1XYIA 2JA8B 1JB3A 1PZJD 4FVMA 4IUTA 2PO4A 1QG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SXH A;  1EYD A;  4ID6 A;  2M00 A;  3SK5 A;  4QB4 A;  2KQ3 A;  3S9W A;  2F0N A;  1SYG A;  3MHB A;  3OSO A;  4DU9 A;  1SND A;  3D6C A;  2F0E A;  2F0U A;  3DMU A;  1STG A;  4K2K A;  4NDX A;  2PYK A;  4KJO A;  4PMC A;  3QOL A;  5E1F A;  2EY6 A;  1STB A;  5J1Z A;  1F2M A;  5CV6 A;  1STN A;  4WOR A;  4KV6 A;  4N9T A;  2F0L A;  1F2Z A;  4ZUJ A;  3SK8 A;  5IGE A;  1IHZ A;  3HZX A;  5CV9 A;  3P75 A;  5KGU A;  4NP5 A;  2F0F A;  1A3T A;  1SYF A;  4PMB A;  3OMC A;  2EYL A;  1KDC A;  2LKV A;  2PW7 A;  5ISR A;  1EZ8 A;  3E5S A;  1A3V A;  3MXP A;  3OMG A;  2F0I A;  4KD3 A;  4OL7 A;  4F7X A;  3T16 A;  5HUR A;  2SNM A;  4I65 A;  4EQO A;  2EYP A;  1A3U A;  5I9O A;  1RKN A;  4QMG A;  1SNO A;  3MEH A;  1EQV A;  4IAL A;  4KJN A;  5C5L A;  5I6Y A;  2F0O A;  4R8N A;  4J1M A;  2RBM A;  2HQE A;  1EY8 A;  3HEJ A;  5IGG A;  4K5X A;  4K6D A;  2EY5 A;  1EZ6 A;  1EY4 A;  3NHH A;  1EYA A;  5CC4 A;  4KTA A;  2RKS A;  5IGC A;  3BDL A;  4N9P A;  5C4H A;  5IOD A;  5NUC A;  1SNC A;  4S3S A;  3QB3 A;  4DGZ A;  3SR1 A;  3C1F A;  4MIU A;  2F0D A;  4E6I A;  3TP7 A;  1KAB A;  5CV8 A;  2EXZ A;  4ZQ3 A;  3TP8 A;  5C6A A;  5EKK A;  2EYJ A;  5C5M A;  3RUZ A;  4EQP A;  3OWF A;  5KRU A;  5KEE A;  4G57 A;  3SK6 A;  5J39 A;  4TRD A;  2F0T A;  2RDF A;  4ODG A;  4KY7 A;  5DEH A;  4RKL A;  5IGD A;  4QF4 A;  4RKB A;  2F0M A;  5CV5 A;  1EYC A;  1STH A;  2SNS A;  3DHQ A;  3H6M A;  4K2L A;  5JOB A;  3SK4 A;  1TR5 A;  3P1H A;  4ME5 A;  2F3V A;  2OF1 A;  3ITP A;  2ENB A;  5DAU A;  4DFA A;  5I6W A;  1JOR A;  2F3W A;  2QDB A;  2F0H A;  3BDC A;  3TME A;  3VA5 A;  1TQO A;  3ERO A;  5KYL A;  3D8G A;  3MZ5 A;  5IIF A;  5M9O A;  1EY6 A;  5IGB A;  3NK9 A;  1EY5 A;  3U9O A;  2EY2 A;  4K5W A;  1II3 A;  2PZW A;  3D4W A;  4HMI A;  1SYB A;  1KDB A;  1ENA A;  4B9W A;  5KYI A;  1SYC A;  2KHS A;  3MVV A;  1U9R A;  4KY6 A;  2SOB A;  3SHL A;  4IUN A;  4K14 A;  3EJI A;  1SNQ A;  2EYO A;  4F8M A;  2NUC A;  4DF7 A;  5F2D A;  3V2T A;  1JOQ A;  2EYH A;  2F0G A;  3NQT A;  5J22 A;  5EGT A;  4IZ8 A;  5CV7 A;  2PQE A;  3LX0 A;  5CV4 A;  4PNY A;  2O4X A;  5CGK A;  4EVO A;  4ZUI A;  4B9X A;  3NUC A;  2EY1 A;  3PMF A;  1A2T A;  1AEX A;  5C3W A;  5I9P A;  1KDA A;  1SYE A;  2F0K A;  4HTH A;  5CR3 A;  4LAA A;  5C4Z A;  3ERQ A;  2EYM A;  5E3F A;  2PZT A;  3QOJ A;  1TT2 A;  1JOK A;  2EYF A;  1NUC A;  4WRD A;  1F2Y A;  3NP8 A;  2WAC A;  3NXW A;  1SYD A;  4K5V A;  3T13 A;  5IGF A;  4KHV A;  2F0S A;  4K8I A;  4EQN A;  2F0Q A;  2F0J A;  4KY5 A;  1EY0 A;  2OXP A;  4J6H A;  5C3X A;  5IOC A;  4KD4 A;  1A2U A;  5KIX A;  1EY7 A;  1SNP A;  5EKL A;  5HGT A;  2PW5 A;  1STA A;  2F0V A;  4NKL A;  2OEO A;  2F0P A;  3D4D A;  1EY9 A;  1SNM A;  1ENC A;  1JOO A;  3C1E A;  3R3O A;  4K8J A;  4YIJ A;  2F0W A;  3TP6 A;  4H7B A;  5K5P A;  1NSN S;  4NMZ A;  4HMJ A;  2PZU A;  1KAA A;  5JAV A;  1STY A;  3EVQ A;  3TP5 A; 
#chains in the Genus database with same CATH topology
 4DR5 L;  2Q8I B;  1PYB A;  3U58 A;  2F0N A;  3BU2 A;  4Y7N H;  5EQ0 A;  2JE6 I;  1YNX A;  3BYT B;  4RGO S;  3IKJ A;  1B70 B;  3CRL C;  3I7F A;  4JOI A;  3HG9 A;  1Y1V H;  4GKJ L;  1PFN A;  2N78 A;  2L11 A;  2VQE L;  3K7A H;  5GAD C;  4HJ7 A;  1N8R C;  4TKO B;  1IYJ B;  4O42 A;  2L15 A;  1GO3 E;  5C0X I;  3MAQ A;  1EEI D;  3T16 A;  2NZ1 D;  5IT9 L;  1VF7 A;  3F2B A;  1YIJ A;  5I6Y A;  4IFD I;  4XYO A;  1VQC A;  3VYU A;  4WFN 3;  1HH2 P;  1FD7 D;  4IQZ A;  1Q81 C;  2IJ0 A;  1V1P A;  1EY4 A;  1EYA A;  1JWM D;  5LMN Q;  2A74 C;  3FEW X;  5C4H A;  1PYW D;  4DV1 Q;  3CPF A;  1RDP D;  1EWI A;  5EPL A;  4XT3 B;  4UY8 C;  3FKI H;  5A2Q L;  4DR2 Q;  4G7H C;  5IP7 G;  1SMY D;  3H91 A;  3H3V I;  4A3M H;  1OXV A;  5DEH A;  4DR3 Q;  1PH6 A;  2EJM A;  1ZYR D;  3DHQ A;  1NY4 A;  1QUQ A;  3L3O C;  4B3S Q;  5IT9 c;  1TWH B;  4JI5 Q;  2F0H A;  1R4Q B;  3NEN A;  5T1G A;  1TQO A;  5JJI A;  3CKI B;  1CA6 A;  2F1M A;  4JI4 Q;  2B2U C;  1LO5 D;  2HIV A;  1QIL A;  2L4N A;  5ELO A;  1D5Z C;  1N32 L;  3K0Y A;  4FYD A;  1TY0 A;  4R4Q A;  1VQA A;  1JC7 A;  1YI2 A;  1SYC A;  1B9N A;  2SEB D;  1I5F A;  3CC7 A;  4F8M A;  1Q7Y C;  5F2D A;  1G2S A;  2CCZ A;  1ESR A;  3S1M H;  2R6G A;  1LTS D;  2EVB A;  4PNY A;  2O4X A;  3TN2 A;  5FO9 B;  3IL8 A;  5HGQ A;  3TS2 A;  2MP1 A;  1XXG A;  4CKB A;  2PZT A;  1KTK A;  1TT2 A;  2UUC Q;  2KOL A;  3T13 A;  3GTP B;  1JJG A;  4OGQ C;  1MJE A;  3GTO B;  1U5K A;  3I73 A;  5IP7 H;  3D4R A;  4A3L H;  2EDG A;  1EY9 A;  3R3O A;  3PUV A;  4P73 A;  2F0W A;  3L7Z C;  1EIY B;  2GA4 B;  1UE6 A;  3HFZ B;  1AN8 A;  2Q2U A;  5FLX E;  1HTP A;  2M9V A;  1XMO Q;  3FRP B;  1V43 A;  3MHB A;  3D6C A;  2RSO A;  2D5D A;  2HHH Q;  1RF2 D;  4JVZ A;  4PQX A;  4B3T Q;  2M2L A;  5C3E H;  2QA4 A;  4YWK A;  2VQF L;  1TVX A;  5KND A;  2EYL A;  1KDC A;  4X64 L;  2A68 D;  2VZA A;  2E5L L;  2RBM A;  1ICF B;  1BXT A;  4MTN A;  5BN4 A;  2YTV A;  3Q22 A;  3I2Z A;  2UXD Q;  3MXN A;  1MKH A;  2LS0 1;  4DAY B;  3VR2 A;  1E2Z A;  1HNZ L;  4B3M Q;  3M3Y H;  3J81 j;  4LF5 Q;  2MHV A;  3VA7 A;  5M5W H;  3K5L A;  2E2J B;  4JI6 Q;  4HCE A;  2KCC A;  4V0B A;  2I5L X;  2LXK A;  4YWM A;  2NN6 G;  1MD2 D;  1BCP F;  3AMU A;  1WCM H;  4WJ4 A;  1PFM A;  3G48 A;  1EQT A;  4L63 B;  1WTW A;  5IWA Q;  3RNU A;  3S1N B;  5JJK A;  5A35 A;  4HJA A;  1UE1 A;  3BZD B;  2DJG C;  3Q6S A;  2Q2H A;  4IJL A;  1KLG D;  1TWA B;  5LMU Q;  3K8A A;  2EY2 A;  2A6E C;  3D4W A;  4BBR G;  1ENA A;  3S1R B;  3PCO B;  4R9W A;  5K36 G;  1K28 A;  3UE0 A;  1JOQ A;  1XMQ Q;  1Y1W G;  3I4M B;  3J80 i;  4DR4 L;  4O1N A;  4BY1 B;  1BVS A;  5LL6 X;  4X6A H;  1X65 A;  4GN4 B;  4EVO A;  4AQY L;  4B9X A;  1QZG A;  1K8O A;  4LFA L;  1A2T A;  2MQH A;  2F4V Q;  4IOC A;  2B2T A;  3AEV A;  1HHV A;  4A3G G;  3ZYY X;  2UU9 L;  3W2D A;  5C4X G;  4DUY Q;  2C35 B;  1TS3 A;  2WAC A;  1SYD A;  3J81 E;  1Y8N B;  4A4I A;  2C5C A;  1TII D;  1HZB A;  5IOC A;  3M9B A;  4BBS B;  1YNN D;  4OEL B;  4ZRZ A;  5C44 H;  3I4N B;  1SNP A;  1ML0 D;  1QZH A;  3Q24 A;  1PRT D;  3J7Z C;  4DV6 L;  2F0P A;  2FXQ A;  2H5X A;  1JE5 A;  3ER0 A;  4P74 A;  1VQF A;  3S1Q B;  2B2W C;  3T53 B;  3TP5 A;  3NTI A;  3UI2 A;  4OO1 G;  2BA0 A;  4ZYS A;  1JMC A;  3CHB D;  1G51 A;  5DM6 3;  2ZXP A;  1IBL Q;  1QNK A;  3H94 A;  1TU2 B;  1VQ5 A;  3PUX A;  1S3O A;  3PO2 G;  4RGT A;  5CV6 A;  3A0J A;  2MUY A;  1X3G A;  2F0L A;  2K50 A;  2WB1 E;  2XN9 C;  4XQQ A;  2WKD A;  4BBR H;  4FF2 A;  2B2V C;  3M7N A;  1PMR A;  5K36 H;  5M3F G;  1CFM A;  1ET9 A;  3GTL B;  4C56 C;  1G6Z A;  3PF5 A;  4KHP Q;  4I65 A;  1I50 B;  4EQO A;  5KNB A;  4EX5 A;  2N8N A;  2G5D A;  1PH8 A;  3K5M A;  1E2W A;  4LF6 Q;  2HQE A;  4A3K G;  3W1G A;  1UWV A;  3I90 A;  4J8Q A;  4A3G H;  1I4X A;  2B8F A;  5C4X H;  3HKZ G;  1D8L A;  2PNH A;  4KTA A;  5ELC A;  4IPG A;  3FDT A;  3QB3 A;  2A19 A;  2MNA A;  4DV7 Q;  4MIU A;  1HTL D;  4FNF A;  1C48 A;  5IT9 E;  2EPB A;  3I70 A;  4Y7N B;  3RUZ A;  1EYG A;  2IWH A;  5JPN C;  1WI5 A;  1VMC A;  1Y1V B;  2R3Z A;  4OO1 H;  2Z6B A;  4DV4 L;  3CPW A;  1WVL A;  3K7A B;  4DV3 Q;  4CBV A;  2KUM A;  2IPK D;  5I6W A;  4DAV A;  3KFU A;  1WTV A;  2KEC A;  1YJ9 A;  5IGB A;  5A2Q E;  5E4W C;  3CME A;  1CQV A;  1H9J A;  4C2M H;  5M3F H;  4AIM A;  4H0L C;  2Z6K A;  4K14 A;  5J3B A;  4DR1 Q;  3KOJ A;  1GHK A;  1UNS A;  5CV7 A;  1AW7 A;  1T5X D;  3DXJ C;  3I56 A;  1NAP A;  2JA7 G;  4GNX A;  3GP7 A;  2B3G A;  4A3K H;  3PMF A;  1K0R A;  1BF4 A;  4GKK Q;  3PIP 3;  4B3R Q;  4M1U B;  1NE3 A;  3FKI B;  1GUG A;  4GLA C;  1SN8 A;  1LTB D;  3K6O A;  3PIO A;  2CKZ B;  3K57 A;  5IE8 A;  2VB2 X;  3CXC A;  3VR4 A;  1K0S A;  2R92 G;  3H09 A;  1YNJ C;  1GKH A;  3A8I E;  1HA5 A;  1BCP B;  4RH6 A;  3RZO H;  2UUA L;  5C0X J;  3EVQ A;  4C1N K;  1BR9 A;  3SXH A;  3HOZ G;  2PMZ E;  1KQS A;  5L37 A;  3TZD A;  2L0C A;  4YCV A;  4IFD J;  4HIM A;  4KJO A;  2K7V A;  3F8T A;  3H0G G;  5CYU A;  4ABN A;  4LK1 C;  4FF4 A;  3S1M B;  2F3I A;  1CTM A;  4WOR A;  1I6V C;  1O78 A;  1BUV T;  3E9I A;  5CV9 A;  4NP5 A;  1SYF A;  4IPC A;  3Q8D A;  1PTO H;  3KLW A;  3M4Y A;  4JV5 L;  3CP0 A;  1VQJ A;  2JA7 H;  3OW2 A;  3GTQ B;  2N55 A;  3M4O B;  4PG3 A;  4AH6 A;  3L9A X;  3A54 A;  3T1Y Q;  1RJT A;  2B2Y C;  1E7Z A;  4N9P A;  3VR3 A;  4Q0F A;  2BH2 A;  2R92 H;  4H44 C;  3T51 B;  1XTC D;  3SK6 A;  4YCW A;  1HR0 Q;  3HOZ H;  2G9H D;  5C3E B;  1C4Q A;  2VS1 A;  3A74 A;  4DFA A;  1YHA A;  4JYA Q;  1GUT A;  3H0G H;  4DXF A;  3HOU H;  4HN7 A;  3S2D H;  1LV9 A;  4POF A;  1LAC A;  4UAI A;  2R7Z G;  2F0G A;  1Q1B A;  1D5X C;  1Z7T A;  4A3D B;  4OHJ A;  3M3Y B;  1SJH D;  1JR0 D;  3NPP A;  5M5W B;  4YHH L;  1Z9F A;  1BBW A;  4JI1 Q;  5E3F A;  3E0E A;  1LTL A;  4CKE A;  4I7Z C;  3UDX A;  4H02 A;  1LYL A;  1WCM B;  1JT8 A;  4LFB L;  5C3X A;  4Z9C B;  2C9O A;  3L2P A;  5GQO A;  1EFI D;  1PV4 A;  1E24 A;  1DOM A;  4DUZ L;  2L55 A;  1SNM A;  2KHJ A;  1EFW A;  4JI3 Q;  1PYS B;  1KAA A;  5M5Y H;  4RCO A;  1IKM A;  4OIJ A;  3STB D;  2FMC A;  4ID6 A;  1SMX A;  3DEO A;  4FP5 D;  4QB4 A;  5I2X A;  4KK7 A;  1UEA B;  5AJ3 Q;  5JPM C;  2PYK A;  1S4Z A;  2WII B;  2WB1 B;  3KF8 B;  1S72 A;  1GXD C;  1STN A;  2EJF C;  1PFS A;  1VQG A;  1TS5 A;  2R7Z H;  3HOY G;  2DNC A;  5ISR A;  4BS9 A;  2WKC A;  3MFY A;  2XGT A;  4QL5 A;  2LY7 A;  2JA6 H;  3BVM A;  2AQ2 B;  2SNM A;  1I6H H;  3AB9 A;  3GV3 A;  3RLN A;  4FXK C;  1E3P A;  2EQS A;  5ELN A;  5C44 B;  5CMD A;  1YJW A;  2NVT H;  1LT6 D;  5E4X A;  3VR5 A;  4DR5 Q;  1H95 A;  2NVY B;  1QNU A;  3W1B A;  4LF8 L;  4JI2 L;  1T5E A;  3GTK B;  1W6J A;  4XDX A;  1OTC A;  3SR1 A;  3JC6 6;  4DK1 A;  2A5H A;  3M4P A;  4CDF C;  2VQE Q;  1I3Q H;  3K5O A;  2LSS A;  5C5M A;  3P20 A;  1S5D D;  1Z47 A;  1KD1 C;  2KJX A;  4G57 A;  1C9O A;  2MO1 A;  4QIW B;  4RKB A;  4DV5 L;  2MO0 A;  2NYZ D;  1STH A;  3QWN A;  4K2L A;  3SK4 A;  4GOP B;  4ME5 A;  3P1H A;  4C3H G;  3GO5 A;  3D0F A;  4CKC A;  2F3W A;  4HJ9 A;  5M5X H;  2ES2 A;  1W2B A;  3HOW G;  1Q12 A;  1TWG H;  3VA5 A;  1YEZ A;  3K7U C;  5IIF A;  3MZ5 A;  1CKO A;  3HOY H;  4JI0 Q;  4QGU A;  2RDH A;  1SE4 A;  2ZJP A;  1FR3 A;  4A3G B;  3CCU A;  5C4X B;  1QE6 A;  1B2T A;  1LLR D;  2FMM A;  1CKN A;  5CV4 A;  1VCI A;  1EWH A;  1JCK B;  1A15 A;  1MSG A;  2F0K A;  1KNE A;  4DK6 C;  3RR5 A;  4GOP C;  3FMC A;  2O2L D;  3NXW A;  1KNA A;  2CHB D;  1HNX L;  2JA9 A;  4KMU C;  4CHT B;  2B63 G;  4GN5 A;  3N6R A;  3R93 A;  1HUM A;  1N32 Q;  2VY3 A;  3PO3 H;  5LL6 S;  1N33 Q;  4K8J A;  4AYB G;  1Q3L A;  4YIJ A;  3NQI A;  3PIO 3;  1JWS D;  3U9S A;  1WTH A;  4C3H H;  4C2M B;  3S9W A;  4A3I G;  3HOW H;  2BCO A;  2I5H A;  3G6E A;  3NWS A;  1FL0 A;  1YVC A;  2K01 A;  2WAQ B;  1I94 L;  2QF7 A;  1FJG L;  3HZX A;  5JJZ A;  2R61 A;  4A3K B;  2F0F A;  3A56 A;  2G9D A;  1X32 A;  2I07 B;  3A7A B;  2CH4 A;  1SE3 A;  2K32 A;  3MFG A;  2UXC L;  1IKL A;  1A3U A;  1SJE D;  5I9O A;  1RKN A;  5C5L A;  1TWF H;  1KAW A;  4R8N A;  1FYC A;  1IBK L;  1BNZ A;  2N88 A;  1PVO A;  4X66 L;  2AUJ D;  3S2H H;  1QCB D;  5GAH C;  3BDO A;  1U4R A;  1I4H A;  1SEB D;  2J4X A;  3RZO B;  3HOX G;  1VQD A;  3PQI A;  2F52 A;  3PGZ A;  1XNQ L;  4LF7 L;  1GOZ A;  1KAB A;  1HQR D;  2XVS A;  4FXG C;  3KDF B;  1EOV A;  2QEX A;  3NBH B;  3NSW A;  5KEE A;  5J39 A;  3OHX C;  2F0T A;  2VNU D;  4X64 Q;  2X69 A;  4RKL A;  4QF4 A;  5EKI A;  1WJJ A;  4L8J A;  3NEM A;  2ZJR A;  2YU9 H;  1R4P B;  3TME A;  2K1B A;  3S17 H;  5G3L D;  2JQO A;  2JA7 B;  4JK1 C;  1AE2 A;  2ATW A;  3A8J E;  4B9W A;  2Q8R E;  2EJG C;  1HNZ Q;  1QWY A;  5EBD A;  4DA2 A;  1DM0 B;  1PXU A;  2Q8T A;  5EGT A;  4IUQ A;  1B8A A;  1P16 A;  2EIF A;  3E9H A;  1Q90 A;  1AFP A;  2R92 B;  1ZKO A;  2X6G A;  4DK3 C;  2PQA B;  1IL8 A;  2NZH A;  2Z1C A;  2QKI C;  4RA8 A;  5KNC A;  4HIK A;  4K0K L;  4LAA A;  2A1A A;  4CDE C;  2CW0 D;  2ZTE A;  2HD3 A;  4WRD A;  1YIT A;  1PTO C;  1OXX K;  2K75 A;  4NPS A;  2F0S A;  3LNN A;  1DOL A;  3HOZ B;  2UXB L;  2E74 C;  4R4T A;  4CDC C;  3I4O A;  2RCF A;  3H0G B;  3HOU B;  1VQH A;  3S15 H;  1STY A;  2ID0 A;  3R2I A;  3B6Y A;  2VL6 A;  3U50 C;  4DR4 Q;  1NCV A;  4AQY Q;  3AFP A;  1TWC H;  3Q23 A;  4LFA Q;  4K2K A;  4R4O A;  2ASB A;  3OIQ A;  2F03 A;  4RG1 A;  1X3Q A;  1A62 A;  5D3D A;  2UU9 Q;  1L0X B;  4PMB A;  2JEA I;  3OMC A;  3SGI A;  3PUW A;  3GTG H;  3K81 C;  1EZ8 A;  2EOT A;  1LT4 D;  1CHQ D;  4A3E G;  1HJP A;  4NXN Q;  3I72 A;  2K5W A;  2R93 G;  4DNT B;  4DV6 Q;  4KJN A;  4CJ0 B;  1B7Y B;  1UAP A;  4X3U A;  3C3L A;  2WV6 D;  3S16 H;  4XTC S;  2RSN A;  1SNC A;  1L1O A;  2WFW A;  5LMN W;  2K5H A;  1HNW L;  1PRT F;  3CCE A;  3TP7 A;  2ZJQ A;  3D31 A;  3FPP A;  1YBY A;  1HFG A;  3DWA A;  1A8V A;  3CCQ A;  1X54 A;  1M8A A;  3DLL A;  1B50 A;  5CBA E;  1PH4 A;  5COY A;  4RMF A;  4JG2 A;  1DOK A;  1TR5 A;  2OF1 A;  2R7Z B;  5FOB B;  2QGQ A;  1JWU D;  1VF5 C;  4UP7 A;  1K3B C;  3BYY B;  4B08 A;  2K14 A;  2QDB A;  3CCR A;  1RL2 A;  3LWU A;  4Y52 H;  2FFK B;  2JA6 B;  1ZXT A;  5KYL A;  3QIA A;  3NK9 A;  4DKA C;  2QCP X;  3U9O A;  4UHV A;  1N36 Q;  2JP1 A;  4K5W A;  2R7F A;  1N9W A;  4HMI A;  2HCC A;  3A7L A;  1SMY C;  4GNX B;  1B53 A;  2NVT B;  2B39 A;  2EYH A;  3VYT A;  4APV A;  4G7O C;  1F9S A;  1ZYR C;  4LUZ A;  3QG1 A;  4CGY B;  3J7A 5;  1A63 A;  1IBM Q;  1H9S A;  2EY1 A;  3ERS X;  5LMN L;  4CJ2 C;  5C3W A;  4DV4 Q;  1CKM A;  2TMP A;  3EA6 A;  4GS3 A;  1A0I A;  2Z6K C;  1EWC A;  1ONL A;  3I4L A;  4H13 C;  1A2U A;  1Q1E A;  4DR3 L;  5M5X B;  3I55 A;  3D4D A;  1W6K A;  4POG A;  1TWG B;  4GNX C;  1IYV A;  3CRK C;  4YWL A;  1PHJ A;  5JAV A;  3WDN A;  3AU7 A;  1S40 A;  4LF9 L;  5DNF A;  3HOY B;  1O7L A;  1SND A;  1BKB A;  4NDX A;  4O2D A;  5E7N A;  4FF3 A;  4BWG B;  1ILQ A;  2B2U A;  5ELF A;  3KK7 A;  3I91 A;  1A3T A;  1NR4 A;  3UDI A;  1GM5 A;  4X65 Q;  2IX1 A;  1IW7 D;  2F0I A;  1EIH A;  2QIL A;  2HUG A;  1PH3 A;  2NN6 H;  4LF4 Q;  2YV5 A;  3FP9 A;  4QMG A;  1SNO A;  3OIP A;  5FO7 B;  1VQN A;  5BN3 A;  2WP8 J;  1ENF A;  4C3I B;  1MSH A;  1WTP A;  4K6D A;  3PO3 B;  1FNV A;  3EBE A;  3CW2 C;  4YY3 L;  2CVR A;  4G7Z C;  3SDZ A;  1HZC A;  1ZEQ X;  4C3H B;  1WD0 A;  2YYZ A;  4X3S A;  1SE2 A;  2A68 C;  1F77 A;  2E75 C;  3HOW B;  2AQ1 B;  3DWP A;  5C6A A;  1I4G A;  4EQP A;  1Y1W H;  3OWF A;  2L12 A;  3OTO L;  4F88 A;  1E1O A;  1Y14 B;  1EYC A;  2ZXO A;  1F9R A;  3O13 A;  3T56 B;  2K5D A;  4QUC A;  1SAP A;  4CDD C;  1LT3 D;  1TS2 A;  4JCV E;  4ALP A;  1SXT A;  1SDF A;  3J80 L;  4OWT B;  4JBM A;  2Q2T A;  1TWF B;  1MHW C;  4KY6 A;  2ICI A;  2SOB A;  3SHL A;  2V4D A;  1PZI D;  1KIX A;  1K83 H;  3S2H B;  2YTY A;  4HJ8 A;  4OON A;  1YJN A;  1E22 A;  2K5V A;  3NUC A;  4QIW E;  1VMP A;  1QVG A;  3PF4 A;  2OT2 A;  3ZJY C;  1AEX A;  3TRZ A;  4O0A A;  1XPO A;  3K5N A;  4DV0 L;  2AWO A;  2Z0S A;  2JA8 G;  3PO2 H;  1PRT B;  3GV6 A;  3NP8 A;  4XXE A;  1K73 C;  5COR A;  4JI6 L;  1XPR A;  1ILP A;  2KCT A;  3J80 c;  2BH8 A;  4JW0 A;  2BA1 A;  3KLR A;  1G8Z D;  2PW5 A;  3F1Z A;  3IRB A;  2YU9 B;  3HOV G;  3C1E A;  2K28 A;  3TP6 A;  1NTG A;  5K5P A;  1KC8 C;  4NMZ A;  1LTA D;  1NMF A;  1EU3 A;  3TEH B;  2H4O A;  2JJQ A;  4DPG A;  4G4K A;  1IXR A;  4XT1 B;  4RGN A;  5E1F A;  1STB A;  4OIK A;  4A3M B;  1YNN C;  1PRT C;  2UUB L;  4DAY A;  4DV2 L;  1U4M A;  4ZKC B;  4KKS A;  2F4V L;  4IAL A;  2CQO A;  4DUY L;  3TSS A;  2JA8 H;  1EU4 A;  2FHT A;  4DAM A;  1S5C D;  2RF4 A;  3EN2 A;  3VR6 A;  2A8V A;  1XTD A;  2WAQ E;  2A73 B;  2LXJ A;  1ET6 A;  3HOV H;  2K52 A;  2KHI A;  3K58 A;  3HKZ E;  4LW1 A;  1CQF A;  3NE5 B;  1IBL L;  5IGD A;  1NR2 A;  3H6M A;  3C2P A;  1PDQ A;  4BY7 G;  3WOF A;  1QOH A;  2ENB A;  1J6Q A;  4OO1 I;  1NNX A;  1PH1 A;  1PA6 A;  1CSP A;  2BOS A;  2A6H D;  4ZCK A;  3KF6 B;  3VDY A;  1PZK D;  5ELB A;  2OWO A;  1C7Y A;  1GUN A;  3RD4 A;  3H15 A;  4JI2 Q;  3ICE A;  2A69 D;  3CCM A;  2NUC A;  1SRU A;  3PV0 A;  4LF6 L;  3S16 B;  1WOC A;  1NJI C;  3ULP A;  4ZUI A;  1AZQ A;  2RDG A;  4V19 0;  3AQQ A;  5JEA J;  4DV5 Q;  2AHO B;  4OWW B;  4JI7 Q;  1AP0 A;  3T1H L;  3QR8 A;  4HED A;  5IP9 G;  1TWH H;  1CM9 A;  1JJ2 A;  2Y0S G;  1FVI A;  1X56 A;  4NKL A;  4P71 A;  4PV1 C;  1JOO A;  1XPU A;  3CC2 A;  4IJH A;  3V05 A;  1B4O A;  1JIC A;  4BY7 H;  5BR8 L;  2M00 A;  3IFT A;  2XSC A;  2BE5 D;  2IX3 A;  3QOL A;  2AQ3 B;  2O5I C;  3P75 A;  4Q5V A;  1KHI A;  2V1C C;  2DGY A;  4A3F G;  5FJ8 G;  2L5T A;  1HNX Q;  1CHP D;  1DYQ A;  4DR7 L;  4KD3 A;  1L2F A;  3CD6 A;  3GTP H;  3ULJ A;  1UE7 A;  3U4V A;  3GTO H;  1TS4 A;  4MNO A;  2KA7 A;  2VXW A;  1PLF A;  4GN3 B;  3ND8 A;  4NB3 A;  3CMA A;  1KRT A;  2Q2I A;  1PTO F;  4XQN A;  2Z4H A;  3C1F A;  5DM7 3;  3CCS A;  2K6A A;  3X3M A;  1PFB A;  1J5E Q;  5CBE E;  1I94 Q;  1FJG Q;  4A3J G;  1LTI D;  4TQU S;  1EIF A;  4OX9 L;  1S5B D;  2RDF A;  4IUP A;  4KY7 A;  1B3Q A;  3A8K E;  1E1T A;  1V1P B;  2F0M A;  5CV5 A;  4NXM L;  4DXG A;  2UXC Q;  1X55 A;  3SE0 A;  1W3S A;  4A3B G;  1HR0 W;  2ZM6 L;  4PMW A;  4JOI C;  1IBK Q;  1EQQ A;  4A3C G;  1X9N A;  1EIG A;  1Q82 C;  1HXY D;  3R2T A;  3I4M G;  1SSO A;  2D0P A;  1VQI A;  4A3F H;  2A69 C;  1LUZ A;  5C0X G;  1XNR L;  1II3 A;  4QQB X;  4GKJ Q;  3MEF A;  5M3M G;  3QJY A;  4L5R C;  4DF7 A;  1WD1 A;  1QUQ B;  4IFD G;  4LF7 Q;  5J22 A;  3K0X A;  1JE4 A;  4IO9 A;  2K05 A;  3AFQ A;  3J80 E;  4LNQ A;  4DR6 L;  4RCN A;  4BBR B;  1GUO A;  4BBS G;  4WJW A;  4ZAI A;  2CH4 W;  2E2D C;  2NWG A;  4FDB A;  5FLM G;  1BQQ T;  3J81 i;  1Y1W B;  1JOK A;  3NTK A;  1NBW A;  2K04 A;  2B2Y A;  2CWA A;  1VDZ A;  5EJW A;  2ICE C;  5GAG C;  1PH9 A;  4A3J H;  1GHJ A;  4TVA B;  4OWX B;  1VQO A;  3GTJ H;  2OTJ A;  4LFC L;  1BDO A;  1S5F D;  5T1I A;  4A3B H;  1V1O A;  3S1R H;  2HIX A;  4LJZ C;  3OSO A;  5G3L F;  1SLJ A;  2F0U A;  1K83 B;  5DLQ E;  2R7D A;  4GLX A;  5C0X H;  3SK8 A;  4KV6 A;  1X6O A;  3M7G A;  5M3M H;  1SBB B;  1J8I A;  1DCZ A;  1N34 L;  1VQM A;  1D5M C;  1TXY A;  3MXP A;  3OMG A;  4IFD H;  4IN3 A;  2UXB Q;  1AH9 A;  1MBY A;  4R4C A;  2I46 A;  3ULL A;  3PO2 B;  2EYP A;  3STB C;  3HP3 A;  1FGU A;  1YHB A;  1EQV A;  4MZ9 A;  2JA5 G;  2E8G A;  3KLS X;  4BA1 I;  1G91 A;  3EFX D;  5IGG A;  2IHE A;  5M3F B;  2DNE A;  2XTI A;  4JC0 A;  3NHH A;  2EXD A;  4JI8 L;  1OXU A;  3GQB A;  3BDL A;  4U67 3;  2FJ2 A;  1UE5 A;  2MPM A;  2L9H A;  3UDF A;  3G71 A;  3H3V H;  2N3S A;  1R9T H;  1WTQ A;  3TP8 A;  2YTX A;  3HKZ B;  2JSO A;  3G7L A;  3E3X A;  2QW7 A;  4ODG A;  2AMC B;  3DUZ A;  4IUV A;  2D9U A;  2OTL A;  3UDG A;  2SNS A;  3MXN B;  2PI2 E;  5H1S E;  3ITP A;  1IYU A;  2E76 C;  1JQY D;  3PUZ A;  1STE A;  2NVQ H;  1BOS A;  1LAB A;  3K59 A;  1C0A A;  3CU7 A;  4IPD A;  1BBU A;  2B63 H;  5KYI A;  1G6P A;  4XQJ A;  1K9M C;  1MIU A;  2KCM A;  2JXM B;  3FKI G;  3OYY A;  2VQF Q;  1F9Q A;  1JB7 A;  4UDU C;  1BBX C;  1K3R A;  3BVG A;  1X3F A;  3JAM i;  2JA5 H;  3J81 c;  1VQP A;  1D1I A;  1FNU A;  4A3I H;  4I7A A;  2E5L Q;  2IY5 B;  1VQ7 A;  1SYE A;  2J7Z A;  5CR3 A;  4X62 L;  4R8I A;  4LWC A;  3CF5 A;  5TSS A;  3HOV B;  1PTO B;  1VS0 A;  1CUK A;  3QOJ A;  1B3A A;  1CZW A;  1G29 1;  4ZLT F;  5IGF A;  3E0J A;  4KY5 A;  4KD4 A;  4P72 A;  4HSV A;  2JYO A;  3KF8 A;  2F0V A;  1SRO A;  1H9K A;  2I5M X;  3KBG A;  1I4R A;  1O7Z A;  1RTN A;  1D6E C;  1I4P A;  1HFN A;  1NMG A;  1O7Y A;  3BVZ A;  2E2H H;  4EQ5 A;  1SYG A;  3DM3 A;  2D2C C;  2F0E A;  3D3R A;  4JI0 L;  2EY6 A;  4AYB E;  5J1Z A;  3HOX H;  1CZG A;  2CQA A;  3OPO A;  1CA5 A;  3RN2 A;  5D14 A;  1IHZ A;  1VQB A;  4NW2 A;  4L5Q A;  3G4S A;  3CC4 A;  2PW7 A;  2AWN A;  3BG3 A;  4A3L G;  4HCS A;  1WTR A;  4F7X A;  5IY0 A;  4JBK A;  1H9R A;  5AFW A;  4A93 G;  1Q86 C;  3V96 A;  2F0O A;  4J1M A;  1WYD A;  2B2T C;  4RGM A;  3S2D B;  5EPJ A;  2EY5 A;  1VQK A;  1KL9 A;  4LF9 Q;  3JAM L;  2XWB B;  2HDL A;  2KEE A;  5IGC A;  5IOD A;  1A6X A;  4GOP A;  2ZXR A;  4S3S A;  2MFI A;  1L0W A;  1N33 L;  3CQZ H;  3PIP A;  5C3E G;  4BY7 B;  2KCN A;  2A6E D;  2EXZ A;  1Z6H A;  5EKK A;  2EYJ A;  5KRU A;  2XNA C;  3NWT A;  4X3K A;  1DZ1 A;  1P8L A;  3SVM A;  4ILW A;  3BZK A;  1CT1 D;  1CK1 A;  4RHR A;  5JJL A;  5JVG 3;  2NBF A;  3ERO A;  2J0T D;  4RFB A;  4UPA A;  5M9O A;  4A3D G;  3IFD A;  1EY5 A;  3GTQ H;  4KKU A;  3A55 A;  1D1K A;  4YY3 Q;  1QVC A;  1O7I A;  1SYB A;  1IZ6 A;  5BN5 A;  5M5Y B;  3M4O H;  3G6J B;  3JAM c;  1U9R A;  3S24 A;  4IUN A;  2GN5 A;  4A93 H;  3WOE A;  3V2T A;  4IZ8 A;  4L5T A;  4PZ7 A;  3CAM A;  3GTM H;  3OTO Q;  1WCM G;  2Y0S B;  1F9P A;  1Q8I A;  4TSS A;  3ERQ A;  2HDM A;  1NUC A;  2N49 A;  1I6H B;  4KHV A;  3KYH C;  2MJ8 A;  2CWP A;  2CFM A;  1FGB D;  1EY7 A;  4MTK A;  3MC0 B;  1MJC A;  1V1Q A;  3MA2 B;  4A3E H;  2KEN A;  4DAP A;  1Q8K A;  1RIP A;  1V8Q A;  2R93 H;  2WB1 G;  4A3F B;  4C1N I;  1I4Q A;  4FXD A;  1HZA A;  2CW0 C;  3CCJ A;  4DU9 A;  4DV1 L;  1I3Q B;  2BDO A;  4A3D H;  2HQL A;  4OXP A;  4KLK A;  3HRZ C;  3RLO A;  4DV0 Q;  1V9P A;  3DWQ A;  1WTO A;  4L6T B;  4KN7 C;  5KGU A;  4DR2 L;  2GVB A;  2LKV A;  5C44 G;  4MHE A;  1A3V A;  1D2B A;  2I0Q A;  4C3J G;  2DY7 A;  2KVM A;  5HUR A;  4BA2 I;  4B3S L;  3OWE B;  4XIG S;  2VUM G;  3MEH A;  3KDF A;  4JI5 L;  1RD9 D;  3BZC A;  3NBH A;  2Z4I A;  4QJF A;  4A3J B;  2RCN A;  4K5X A;  1K8A C;  4JI4 L;  4IPH A;  4IUU A;  5IYC G;  3UE1 A;  5EPK A;  2ALY B;  2MGS A;  3TRE A;  5CC4 A;  3GTJ B;  3OW7 A;  4DNI A;  5NUC A;  3F2C A;  3WWV A;  2ZT9 C;  4A3B B;  4JPB W;  5LHY 1;  2DN8 A;  3N52 A;  5CV8 A;  1VQE A;  2UUB Q;  1OXT A;  4HJ5 A;  1Y8P B;  4DV2 Q;  1RTO A;  3RZD H;  1KRS A;  4KKT A;  1OO9 B;  1GUS A;  3NBI A;  5M3M B;  3FHW A;  2E2I H;  2UUA Q;  2UUC L;  2RHS B;  4RAU C;  3MXU A;  1TY2 A;  1VQ6 A;  3I3C A;  4F87 A;  2EE1 A;  2PQA A;  2WIN B;  1RHP A;  4KHZ A;  4NXN L;  3I8Z A;  1KDB A;  5HY6 A;  4C3J H;  3EJI A;  1SNQ A;  2NVY H;  3OOC A;  4ME3 A;  1IL2 A;  3NQT A;  3GTK H;  4ULL A;  2VUM H;  1YNJ D;  4P2C B;  4IOA A;  1EL0 A;  1XMO L;  1XWE A;  2X6L A;  1OXS C;  1DJR D;  2K5Q A;  3C46 A;  3HKS A;  4JV5 Q;  4K6L A;  5IYC H;  1SFO H;  2HHH L;  1PH5 A;  1R9T B;  4RWS C;  2QDL A;  4B3T L;  1VQ4 A;  4A76 A;  2EYF A;  3J7Y W;  1SR3 A;  3VYS A;  1AE3 A;  4K8I A;  1Y69 U;  3TZU A;  2F0Q A;  2F0J A;  4HSP A;  1K8G A;  1HPC A;  3URY A;  2NVQ B;  4HR7 B;  2F4I A;  2Z9H A;  1B1Z A;  4H7B A;  4HMJ A;  2WAQ G;  3BS1 A;  2B63 B;  1K8M A;  3TQY A;  2UXD L;  3SK5 A;  5FKA C;  5D3I B;  1BCP D;  2NVX H;  4B3M L;  2L1B A;  1N36 L;  3H3V C;  2XRS D;  4UP9 A;  4AYB B;  4LF5 L;  4PMC A;  1DXM A;  2VW9 A;  1DD2 A;  1ROD A;  4ZUJ A;  2JA5 B;  4JBW A;  3A5Z B;  4FF1 A;  3T1H Q;  4DN4 M;  5IYD G;  4A3I B;  2DJF C;  3MTS A;  1GUW A;  3X3N A;  1IBM L;  1U4P A;  2IW3 A;  3KJO A;  1RCV D;  5ELD A;  3M85 A;  3S17 B;  1VQL A;  5IWA L;  2K03 A;  1EY8 A;  5D65 A;  3FPU B;  3RLF A;  2NN6 I;  5LMU L;  1QVF A;  3CCV A;  5BR8 Q;  5GRO A;  1XJV A;  1BO0 A;  2RKS A;  1LTT D;  4OEM B;  4YHH Q;  4DGZ A;  3P7J A;  1YZ6 A;  3KBX A;  5C4J H;  1IW7 C;  2B8G A;  1KXL A;  2F0D A;  4E6I A;  1XMQ L;  3S14 H;  2E2H B;  1Y8O B;  3E6Z X;  1HRJ A;  4LFB Q;  2TSS A;  4QCL A;  1T9H A;  4DR7 Q;  3HOX B;  2PNR C;  2K33 A;  1HCZ A;  4DUZ Q;  1EOT A;  4R4I A;  3JAM E;  3W3A A;  5JOB A;  4UP8 A;  2KBN A;  1JOR A;  3F2U A;  3BDC A;  1B9M A;  1EEF D;  2B29 A;  2NB0 A;  4GLV B;  4X65 L;  5IYD H;  2ZTD A;  3S15 B;  4LF4 L;  1S5E D;  4A75 A;  1TWC B;  4M8A A;  1U0L A;  3NEL A;  2PQE A;  1U4L A;  3CQZ B;  2Z8L A;  4OX9 Q;  2B2W A;  2DUD A;  5I9P A;  3NTH A;  4NXM Q;  1LTG D;  3LGJ A;  4R1J A;  3GTG B;  3LWE A;  4P75 A;  2JEB I;  1LTR D;  4ZKB B;  3HOU G;  1F2Y A;  3EQL C;  4LUO A;  2ZM6 Q;  4HIO A;  2O5J C;  4EQN A;  2AKW B;  2OXP A;  5ELE A;  1GVP A;  4KHP L;  1CKN B;  4LF8 Q;  1X3P A;  5I4D A;  2B2V A;  1STA A;  3KJP A;  1XNR Q;  1ESF A;  3RMH A;  4J15 A;  4RHS A;  3FVQ A;  2LFN A;  1NSN S;  2PZU A;  1BCP C;  3EIV A;  2IX0 A;  2QEJ C;  4DR6 Q;  2PI2 A;  1PH2 A;  1AZP A;  4A93 B;  1STG A;  4DV7 L;  1D7Q A;  3PSI A;  1DON A;  3CCL A;  4N9T A;  5IGE A;  3L0O A;  3QO2 A;  4GZY C;  3GTM B;  3HS0 C;  3AYH B;  4N8X 1;  3A5U A;  3RN5 A;  2KED A;  4IUR A;  4DV3 L;  2NZO A;  1DGS A;  3D6W A;  1VQ8 A;  3R8B A;  4LFC Q;  4LMQ D;  1HQM C;  4ZK9 B;  5FO8 B;  3W5O A;  2SDF A;  5JVH 3;  2OCE A;  4A3E B;  1C8C A;  2R93 B;  3U4Z A;  1QB5 D;  1KLU D;  4DR1 L;  4ZQ3 A;  2HT1 A;  2RA4 A;  3M4Q A;  2JA6 G;  1N34 Q;  5FK9 C;  4QY7 A;  4BXX G;  4GKK L;  4B3R L;  5GAE C;  1E2V A;  2H1E A;  2OQK A;  5EBC A;  2F3V A;  5DAU A;  4KI0 A;  3D8G A;  3VYR A;  3MWY W;  4N8F A;  1EY6 A;  4JI8 Q;  5IP9 H;  2PZW A;  4JBJ A;  2RVL A;  3MVV A;  2KHS A;  2D62 A;  1TKW B;  4U68 A;  4WJ3 M;  2FIN B;  1MI2 A;  1X3E A;  3LX0 A;  2GVA A;  1CI3 M;  1SE8 A;  2JK8 A;  2P5Z X;  1HUN A;  1B44 D;  2K4K A;  3ONA B;  4HTH A;  2A6H C;  1WTX A;  5FLX L;  1FNW A;  1VQ9 A;  4K5V A;  4PZ8 A;  3RZD B;  3J7A F;  4X66 Q;  4BY1 G;  1EY0 A;  4J6H A;  5FJ8 H;  3SEB A;  1J9O A;  5IYB G;  5KIX A;  4X3T A;  2DY8 A;  5EKL A;  5HGT A;  1M90 C;  2E2I B;  1XX8 A;  2OEO A;  3TS0 A;  1ENC A;  1GD7 A;  1XNQ Q;  4BXX H;  1Q46 A;  2D0O A;  1L0Y B;  2OQ0 A;  1M4V A;  2RHQ B;  3GD7 A;  4LUV A;  2E2J H;  3KUP A;  1ICW A;  1EYD A;  2ZTC A;  3T1Y L;  2KQ3 A;  4C3J B;  3I4N G;  2Y0S E;  3DMU A;  2IL8 A;  4HAE A;  2XWJ B;  2VUM B;  4X62 Q;  1F2M A;  4L5S A;  1F2Z A;  3J7A V;  2XRQ D;  2PCF B;  1O80 A;  1H9M A;  5FLX c;  1SFO B;  4C3I G;  1GJX A;  3S1N H;  3PO3 G;  3E5S A;  4OL7 A;  1HR0 L;  1ASZ A;  1TWA H;  4PZ6 A;  2BDN A;  3IAY A;  1QJO A;  4JYA L;  1LM0 A;  2BE5 C;  4JI7 L;  1E0B A;  1PH7 A;  3HEJ A;  1EZ6 A;  4A3C H;  2AUK A;  3I4M H;  2HCI A;  4DNR B;  1G2T A;  4YCU A;  4BY1 H;  2IHF A;  4K0K Q;  4XYQ A;  5IYB H;  2JN4 A;  1JJC B;  1YHQ A;  5JEA G;  1WFQ A;  1F2L A;  2NVX B;  1CSQ A;  3DM1 A;  3Q0A A;  3KF6 A;  4EGV A;  4TRD A;  2NTS A;  1M1K C;  2LMC B;  3MXG A;  4JI1 L;  4BBS H;  2PPB C;  3I4N H;  4DK0 A;  1L1O B;  4QUF A;  1HA6 A;  5FLM H;  2NTT A;  3HGB A;  2RQX A;  3S1Q H;  2IT1 A;  3K80 C;  1Y1V G;  3F2D A;  4C3I H;  1PTO D;  3PUY A;  3KLS A;  4MN3 A;  1ASY A;  1UEB A;  1EUJ A;  4JI3 L;  2EYO A;  3J81 L;  1MGS A;  2XIW A;  5EAY A;  2PMZ B;  5CGK A;  3TBI B;  5AJ3 L;  2K5N A;  3BJU A;  5C4J B;  1HZ9 A;  4KN4 C;  3S14 B;  1KDA A;  5C4Z A;  3TDQ A;  5I2Y A;  3GTL H;  2EYM A;  1UUP A;  1I50 H;  1L1O C;  3T4A C;  4CJ1 B;  2EZV A;  1J5E L;  1EQR A;  2VB3 X;  1LT5 D;  5JEA H;  3DEP A;  4FO2 A;  1H9S B;  3ND9 A;  1HNW Q;  1XYI A;  2JA8 B;  1JB3 A;  1PZJ D;  4HID A;  4FVM A;  4IUT A;  4A3M G;  2PO4 A;  3GDE A;  1QG7 A; 
#chains in the Genus database with same CATH homology
 2Q8I B;  2F0N A;  5EQ0 A;  2JE6 I;  4RGO S;  3BYT B;  3IKJ A;  3CRL C;  3HG9 A;  1PFN A;  2L11 A;  4TKO B;  4O42 A;  5C0X I;  3MAQ A;  1EEI D;  3T16 A;  2NZ1 D;  5IT9 L;  1VF7 A;  5I6Y A;  4IFD I;  4XYO A;  3VYU A;  4WFN 3;  1FD7 D;  4IQZ A;  2IJ0 A;  1V1P A;  1EY4 A;  1EYA A;  1JWM D;  2A74 C;  3FEW X;  5C4H A;  1PYW D;  1RDP D;  5EPL A;  4XT3 B;  5A2Q L;  4G7H C;  1SMY D;  3H91 A;  1OXV A;  5DEH A;  2EJM A;  1ZYR D;  3DHQ A;  3L3O C;  1TWH B;  2F0H A;  1R4Q B;  5T1G A;  1TQO A;  3CKI B;  1CA6 A;  2F1M A;  2B2U C;  1LO5 D;  1QIL A;  2L4N A;  1D5Z C;  3K0Y A;  4FYD A;  1TY0 A;  1JC7 A;  1SYC A;  1B9N A;  2SEB D;  4F8M A;  5F2D A;  1G2S A;  1ESR A;  2R6G A;  1LTS D;  2EVB A;  4PNY A;  2O4X A;  3TN2 A;  5FO9 B;  3IL8 A;  2MP1 A;  1XXG A;  4CKB A;  2PZT A;  1KTK A;  1TT2 A;  2KOL A;  3T13 A;  3GTP B;  4OGQ C;  3GTO B;  3I73 A;  3D4R A;  2EDG A;  1EY9 A;  3R3O A;  3PUV A;  2F0W A;  3L7Z C;  2GA4 B;  1AN8 A;  5FLX E;  1HTP A;  2M9V A;  3FRP B;  1V43 A;  3MHB A;  3D6C A;  2RSO A;  2D5D A;  1RF2 D;  4PQX A;  2M2L A;  1TVX A;  5KND A;  2EYL A;  1KDC A;  2A68 D;  2RBM A;  1BXT A;  5BN4 A;  3Q22 A;  3MXN A;  2LS0 1;  3VR2 A;  1E2Z A;  2MHV A;  3VA7 A;  3K5L A;  2E2J B;  4HCE A;  2KCC A;  4V0B A;  2NN6 G;  1MD2 D;  1BCP F;  3AMU A;  1PFM A;  1EQT A;  4L63 B;  1WTW A;  3S1N B;  5A35 A;  3BZD B;  3Q6S A;  1KLG D;  1TWA B;  2EY2 A;  2A6E C;  3D4W A;  1ENA A;  3S1R B;  4R9W A;  5K36 G;  1JOQ A;  3I4M B;  4O1N A;  4BY1 B;  5LL6 X;  4EVO A;  4B9X A;  1K8O A;  1A2T A;  2B2T A;  1HHV A;  3ZYY X;  3W2D A;  1TS3 A;  2WAC A;  1SYD A;  3J81 E;  1Y8N B;  2C5C A;  1TII D;  5IOC A;  4BBS B;  1YNN D;  4ZRZ A;  3I4N B;  1SNP A;  1ML0 D;  3Q24 A;  1PRT D;  2F0P A;  3S1Q B;  2B2W C;  3T53 B;  3TP5 A;  3NTI A;  3UI2 A;  4OO1 G;  2BA0 A;  4ZYS A;  3CHB D;  5DM6 3;  2ZXP A;  1QNK A;  3H94 A;  1TU2 B;  3PUX A;  4RGT A;  5CV6 A;  2MUY A;  2F0L A;  2XN9 C;  3M7N A;  4XQQ A;  2WKD A;  4FF2 A;  2B2V C;  1PMR A;  5K36 H;  1CFM A;  1ET9 A;  3GTL B;  4C56 C;  1G6Z A;  4I65 A;  1I50 B;  4EQO A;  5KNB A;  3K5M A;  1E2W A;  2HQE A;  3I90 A;  4J8Q A;  1I4X A;  2B8F A;  4KTA A;  5ELC A;  3FDT A;  3QB3 A;  4MIU A;  1HTL D;  4FNF A;  1C48 A;  5IT9 E;  2EPB A;  3I70 A;  4Y7N B;  3RUZ A;  2IWH A;  5JPN C;  1VMC A;  1Y1V B;  2R3Z A;  4OO1 H;  1WVL A;  3K7A B;  4CBV A;  2KUM A;  2IPK D;  5I6W A;  4DAV A;  1WTV A;  2KEC A;  5IGB A;  5A2Q E;  5E4W C;  1CQV A;  1H9J A;  4H0L C;  4K14 A;  1GHK A;  1UNS A;  5CV7 A;  1AW7 A;  1T5X D;  3DXJ C;  1NAP A;  3GP7 A;  3PMF A;  1BF4 A;  3PIP 3;  4M1U B;  3FKI B;  1GUG A;  1LTB D;  3K6O A;  3K57 A;  2VB2 X;  3VR4 A;  3H09 A;  1YNJ C;  3A8I E;  1HA5 A;  1BCP B;  4RH6 A;  5C0X J;  3EVQ A;  4C1N K;  1BR9 A;  3SXH A;  3TZD A;  2L0C A;  4IFD J;  4KJO A;  2K7V A;  4ABN A;  5CYU A;  4LK1 C;  4FF4 A;  3S1M B;  1CTM A;  4WOR A;  1I6V C;  1O78 A;  1BUV T;  5CV9 A;  4NP5 A;  1SYF A;  1PTO H;  3M4Y A;  3GTQ B;  2N55 A;  3M4O B;  3L9A X;  3A54 A;  1RJT A;  2B2Y C;  4N9P A;  3VR3 A;  4Q0F A;  4H44 C;  3T51 B;  1XTC D;  3SK6 A;  2G9H D;  5C3E B;  1C4Q A;  4DFA A;  1GUT A;  4DXF A;  4HN7 A;  1LV9 A;  1LAC A;  4UAI A;  2F0G A;  1Q1B A;  1D5X C;  1Z7T A;  4A3D B;  4OHJ A;  3M3Y B;  1SJH D;  1JR0 D;  3NPP A;  5M5W B;  5E3F A;  4CKE A;  4I7Z C;  1WCM B;  5C3X A;  4Z9C B;  2C9O A;  1EFI D;  1DOM A;  2L55 A;  1SNM A;  1KAA A;  4RCO A;  1IKM A;  4OIJ A;  2FMC A;  4ID6 A;  3DEO A;  4FP5 D;  4QB4 A;  5I2X A;  4KK7 A;  1UEA B;  5JPM C;  2PYK A;  1S4Z A;  2WII B;  2WB1 B;  1GXD C;  1STN A;  2EJF C;  1TS5 A;  2DNC A;  5ISR A;  4BS9 A;  2WKC A;  3MFY A;  2LY7 A;  3BVM A;  2AQ2 B;  2SNM A;  3AB9 A;  3GV3 A;  4FXK C;  5C44 B;  5CMD A;  1LT6 D;  5E4X A;  3VR5 A;  2NVY B;  1QNU A;  3GTK B;  1T5E A;  1W6J A;  4XDX A;  3SR1 A;  4DK1 A;  2A5H A;  3K5O A;  5C5M A;  3P20 A;  1S5D D;  1Z47 A;  2KJX A;  4G57 A;  4QIW B;  4RKB A;  2NYZ D;  1STH A;  3QWN A;  4K2L A;  3SK4 A;  4ME5 A;  3P1H A;  4C3H G;  3GO5 A;  4CKC A;  2F3W A;  1Q12 A;  3VA5 A;  5IIF A;  3MZ5 A;  2RDH A;  1SE4 A;  1FR3 A;  4A3G B;  5C4X B;  1QE6 A;  1B2T A;  1LLR D;  2FMM A;  5CV4 A;  1VCI A;  1EWH A;  1JCK B;  1A15 A;  1MSG A;  2F0K A;  1KNE A;  3FMC A;  2O2L D;  3NXW A;  1KNA A;  2CHB D;  4KMU C;  4CHT B;  3N6R A;  3R93 A;  1HUM A;  5LL6 S;  4K8J A;  1Q3L A;  4YIJ A;  3NQI A;  3PIO 3;  1JWS D;  3U9S A;  4C2M B;  3S9W A;  2BCO A;  3NWS A;  2K01 A;  2WAQ B;  2QF7 A;  3HZX A;  5JJZ A;  2R61 A;  4A3K B;  2F0F A;  3A56 A;  2G9D A;  1X32 A;  2I07 B;  3A7A B;  1SE3 A;  2K32 A;  3MFG A;  1IKL A;  1A3U A;  1SJE D;  5I9O A;  1RKN A;  5C5L A;  4R8N A;  1FYC A;  1BNZ A;  2N88 A;  2AUJ D;  1QCB D;  3BDO A;  1U4R A;  1I4H A;  1SEB D;  2J4X A;  3RZO B;  1GOZ A;  1KAB A;  1HQR D;  2XVS A;  4FXG C;  3NSW A;  5KEE A;  5J39 A;  3OHX C;  2F0T A;  2VNU D;  2X69 A;  4RKL A;  4QF4 A;  5EKI A;  4L8J A;  1R4P B;  3TME A;  2K1B A;  5G3L D;  2JA7 B;  4JK1 C;  3A8J E;  4B9W A;  2Q8R E;  2EJG C;  1QWY A;  5EBD A;  4DA2 A;  1DM0 B;  1PXU A;  2Q8T A;  5EGT A;  4IUQ A;  1Q90 A;  1AFP A;  2R92 B;  1ZKO A;  2X6G A;  1IL8 A;  2Z1C A;  2QKI C;  4RA8 A;  5KNC A;  4LAA A;  2CW0 D;  4WRD A;  1PTO C;  1OXX K;  2F0S A;  3LNN A;  1DOL A;  3HOZ B;  2E74 C;  3H0G B;  3HOU B;  1STY A;  2ID0 A;  3R2I A;  1NCV A;  3Q23 A;  4K2K A;  3OIQ A;  2F03 A;  1X3Q A;  5D3D A;  1L0X B;  4PMB A;  2JEA I;  3OMC A;  3PUW A;  1EZ8 A;  2EOT A;  1LT4 D;  1CHQ D;  3I72 A;  2K5W A;  4DNT B;  4KJN A;  4CJ0 B;  1UAP A;  4X3U A;  3C3L A;  2WV6 D;  4XTC S;  2RSN A;  1SNC A;  1PRT F;  3TP7 A;  3D31 A;  3FPP A;  1HFG A;  3DWA A;  1M8A A;  1B50 A;  5CBA E;  5COY A;  1DOK A;  1TR5 A;  2OF1 A;  2R7Z B;  5FOB B;  1JWU D;  1VF5 C;  4B08 A;  3BYY B;  2QDB A;  3LWU A;  2FFK B;  2JA6 B;  1ZXT A;  5KYL A;  3QIA A;  3NK9 A;  2QCP X;  3U9O A;  2JP1 A;  4K5W A;  4HMI A;  2HCC A;  3A7L A;  1SMY C;  1B53 A;  2NVT B;  2B39 A;  2EYH A;  3VYT A;  4G7O C;  1F9S A;  1ZYR C;  3QG1 A;  4CGY B;  1H9S A;  2EY1 A;  4CJ2 C;  5C3W A;  2TMP A;  3EA6 A;  1EWC A;  1ONL A;  3I4L A;  4H13 C;  1A2U A;  1Q1E A;  5M5X B;  3D4D A;  1W6K A;  1TWG B;  1IYV A;  3CRK C;  5JAV A;  3WDN A;  3AU7 A;  5DNF A;  3HOY B;  1O7L A;  1SND A;  4NDX A;  4FF3 A;  4BWG B;  1ILQ A;  2B2U A;  5ELF A;  3KK7 A;  3I91 A;  1A3T A;  1NR4 A;  2IX1 A;  1IW7 D;  2F0I A;  1EIH A;  2QIL A;  2HUG A;  2NN6 H;  4QMG A;  1SNO A;  3OIP A;  5FO7 B;  5BN3 A;  2WP8 J;  1ENF A;  4C3I B;  1MSH A;  1WTP A;  4K6D A;  3PO3 B;  1FNV A;  2CVR A;  4G7Z C;  3SDZ A;  1ZEQ X;  4C3H B;  1WD0 A;  2YYZ A;  4X3S A;  1SE2 A;  2A68 C;  1F77 A;  2E75 C;  3HOW B;  2AQ1 B;  3DWP A;  5C6A A;  1I4G A;  4EQP A;  3OWF A;  2L12 A;  4F88 A;  1EYC A;  2ZXO A;  1F9R A;  3O13 A;  3T56 B;  2K5D A;  4QUC A;  1SAP A;  1LT3 D;  1TS2 A;  1SXT A;  1SDF A;  3J80 L;  1TWF B;  4KY6 A;  2ICI A;  2SOB A;  3SHL A;  2V4D A;  1PZI D;  3S2H B;  3NUC A;  1VMP A;  2OT2 A;  1AEX A;  3K5N A;  2AWO A;  1PRT B;  3GV6 A;  3NP8 A;  4XXE A;  5COR A;  1ILP A;  2BA1 A;  3KLR A;  1G8Z D;  2PW5 A;  2YU9 B;  3C1E A;  2K28 A;  3TP6 A;  5K5P A;  4NMZ A;  1LTA D;  1EU3 A;  2H4O A;  4G4K A;  4XT1 B;  4RGN A;  5E1F A;  1STB A;  4OIK A;  4A3M B;  1YNN C;  1PRT C;  4DAY A;  1U4M A;  4ZKC B;  4KKS A;  4IAL A;  3TSS A;  1EU4 A;  2FHT A;  1S5C D;  3VR6 A;  2A73 B;  1ET6 A;  3K58 A;  1CQF A;  3NE5 B;  5IGD A;  1NR2 A;  3H6M A;  3C2P A;  1PDQ A;  3WOF A;  1QOH A;  2ENB A;  4OO1 I;  2BOS A;  2A6H D;  1PZK D;  5ELB A;  1GUN A;  3RD4 A;  2A69 D;  2NUC A;  3PV0 A;  3S16 B;  1AZQ A;  4ZUI A;  2RDG A;  4V19 0;  5JEA J;  1AP0 A;  4HED A;  1CM9 A;  4NKL A;  4PV1 C;  1JOO A;  3V05 A;  1B4O A;  1JIC A;  2M00 A;  3IFT A;  2XSC A;  2BE5 D;  2IX3 A;  3QOL A;  2AQ3 B;  2O5I C;  3P75 A;  4Q5V A;  2L5T A;  1CHP D;  1DYQ A;  4KD3 A;  1TS4 A;  2KA7 A;  2VXW A;  1PLF A;  3ND8 A;  1PTO F;  4XQN A;  2Z4H A;  3C1F A;  5DM7 3;  2K6A A;  3X3M A;  1PFB A;  5CBE E;  1LTI D;  4TQU S;  1S5B D;  2RDF A;  4IUP A;  4KY7 A;  1V1P B;  3A8K E;  2F0M A;  5CV5 A;  4DXG A;  3SE0 A;  4PMW A;  1EIG A;  1HXY D;  3R2T A;  1SSO A;  2A69 C;  5C0X G;  1II3 A;  3QJY A;  4DF7 A;  1WD1 A;  4IFD G;  5J22 A;  1JE4 A;  2K05 A;  3J80 E;  4RCN A;  4BBR B;  1GUO A;  4WJW A;  4ZAI A;  2E2D C;  2NWG A;  1BQQ T;  1Y1W B;  1JOK A;  3NTK A;  2K04 A;  2B2Y A;  1VDZ A;  5EJW A;  2ICE C;  1GHJ A;  1BDO A;  1S5F D;  5T1I A;  1V1O A;  4LJZ C;  3OSO A;  5G3L F;  2F0U A;  1K83 B;  5C0X H;  3SK8 A;  4KV6 A;  3M7G A;  1J8I A;  1SBB B;  1DCZ A;  1D5M C;  3MXP A;  3OMG A;  4IFD H;  4IN3 A;  1MBY A;  2I46 A;  3PO2 B;  2EYP A;  3HP3 A;  1EQV A;  3KLS X;  4BA1 I;  1G91 A;  3EFX D;  5IGG A;  5M3F B;  2DNE A;  3NHH A;  1OXU A;  3GQB A;  3BDL A;  4U67 3;  2FJ2 A;  2MPM A;  2L9H A;  1WTQ A;  3TP8 A;  3HKZ B;  2JSO A;  3G7L A;  4ODG A;  3DUZ A;  4IUV A;  2D9U A;  2SNS A;  3ITP A;  1IYU A;  2E76 C;  1JQY D;  3PUZ A;  1STE A;  1BOS A;  1LAB A;  3K59 A;  3CU7 A;  5KYI A;  4XQJ A;  2JXM B;  1F9Q A;  4UDU C;  1BBX C;  3BVG A;  1D1I A;  1FNU A;  1SYE A;  2J7Z A;  5CR3 A;  4R8I A;  3HOV B;  5TSS A;  1PTO B;  3QOJ A;  1B3A A;  1CZW A;  1G29 1;  4ZLT F;  5IGF A;  3E0J A;  4KY5 A;  4KD4 A;  4HSV A;  2JYO A;  3KF8 A;  2F0V A;  1H9K A;  3KBG A;  1I4R A;  1O7Z A;  1RTN A;  1D6E C;  1I4P A;  1HFN A;  1O7Y A;  3BVZ A;  1SYG A;  2D2C C;  2F0E A;  3D3R A;  2EY6 A;  5J1Z A;  1CZG A;  2CQA A;  3OPO A;  1CA5 A;  5D14 A;  1IHZ A;  4NW2 A;  2PW7 A;  2AWN A;  3BG3 A;  4HCS A;  1WTR A;  4F7X A;  1H9R A;  5AFW A;  3V96 A;  2F0O A;  4J1M A;  2B2T C;  4RGM A;  3S2D B;  5EPJ A;  2EY5 A;  3JAM L;  2XWB B;  2HDL A;  2KEE A;  5IGC A;  5IOD A;  1A6X A;  2ZXR A;  4S3S A;  4BY7 B;  2KCN A;  2A6E D;  2EXZ A;  1Z6H A;  5EKK A;  2EYJ A;  5KRU A;  2XNA C;  3NWT A;  4X3K A;  1DZ1 A;  3SVM A;  4ILW A;  1CT1 D;  1CK1 A;  4RHR A;  5JVG 3;  2NBF A;  3ERO A;  2J0T D;  4RFB A;  5M9O A;  3IFD A;  1EY5 A;  4KKU A;  3A55 A;  1D1K A;  5M5Y B;  1SYB A;  5BN5 A;  3G6J B;  1U9R A;  4IUN A;  3WOE A;  3V2T A;  4IZ8 A;  2Y0S B;  1F9P A;  1Q8I A;  4TSS A;  3ERQ A;  2HDM A;  1NUC A;  1I6H B;  4KHV A;  2MJ8 A;  1FGB D;  1EY7 A;  3MC0 B;  3MA2 B;  4DAP A;  1V8Q A;  4A3F B;  4C1N I;  1I4Q A;  4FXD A;  2CW0 C;  4DU9 A;  1I3Q B;  2BDO A;  3HRZ C;  3DWQ A;  1WTO A;  4L6T B;  4KN7 C;  5KGU A;  2LKV A;  4MHE A;  1A3V A;  1D2B A;  4C3J G;  2DY7 A;  2KVM A;  5HUR A;  4BA2 I;  3OWE B;  4XIG S;  3MEH A;  1RD9 D;  3NBH A;  2Z4I A;  4A3J B;  4K5X A;  4IUU A;  5EPK A;  5CC4 A;  2MGS A;  3GTJ B;  3OW7 A;  5NUC A;  2ZT9 C;  4A3B B;  5LHY 1;  2DN8 A;  3N52 A;  5CV8 A;  1OXT A;  1Y8P B;  1RTO A;  4KKT A;  1OO9 B;  1GUS A;  3NBI A;  5M3M B;  4RAU C;  3MXU A;  1TY2 A;  3I3C A;  4F87 A;  2EE1 A;  2WIN B;  1RHP A;  4KHZ A;  3I8Z A;  1KDB A;  3EJI A;  1SNQ A;  3OOC A;  3NQT A;  4ULL A;  1YNJ D;  4P2C B;  1EL0 A;  1XWE A;  2X6L A;  1OXS C;  1DJR D;  2K5Q A;  3C46 A;  4K6L A;  1R9T B;  4RWS C;  2EYF A;  3J7Y W;  3VYS A;  4K8I A;  1Y69 U;  3TZU A;  2F0Q A;  2F0J A;  4HSP A;  1HPC A;  3URY A;  2NVQ B;  4HR7 B;  2F4I A;  1B1Z A;  4H7B A;  4HMJ A;  3BS1 A;  2B63 B;  1K8M A;  3SK5 A;  5FKA C;  5D3I B;  1BCP D;  2L1B A;  3H3V C;  2XRS D;  4AYB B;  4PMC A;  1DXM A;  1DD2 A;  1ROD A;  4ZUJ A;  2JA5 B;  4JBW A;  4FF1 A;  4DN4 M;  4A3I B;  3MTS A;  1GUW A;  3X3N A;  1U4P A;  2IW3 A;  1RCV D;  5ELD A;  3M85 A;  3S17 B;  2K03 A;  1EY8 A;  5D65 A;  3FPU B;  3RLF A;  2NN6 I;  1BO0 A;  2RKS A;  1LTT D;  4DGZ A;  3P7J A;  3KBX A;  1IW7 C;  2B8G A;  2F0D A;  4E6I A;  2E2H B;  1Y8O B;  3E6Z X;  1HRJ A;  2TSS A;  4QCL A;  3HOX B;  2PNR C;  2K33 A;  1HCZ A;  1EOT A;  3JAM E;  3W3A A;  5JOB A;  1JOR A;  3F2U A;  3BDC A;  1B9M A;  1EEF D;  2NB0 A;  3S15 B;  1S5E D;  1TWC B;  4M8A A;  2PQE A;  1U4L A;  3CQZ B;  2Z8L A;  2B2W A;  5I9P A;  3NTH A;  1LTG D;  3GTG B;  3LWE A;  2JEB I;  1LTR D;  4ZKB B;  1F2Y A;  3EQL C;  2O5J C;  4EQN A;  2OXP A;  5ELE A;  1X3P A;  5I4D A;  2B2V A;  1STA A;  1ESF A;  3RMH A;  4RHS A;  3FVQ A;  2LFN A;  1NSN S;  2PZU A;  1BCP C;  2IX0 A;  2QEJ C;  1AZP A;  4A93 B;  1STG A;  1DON A;  4N9T A;  5IGE A;  3QO2 A;  4GZY C;  3GTM B;  3HS0 C;  2KED A;  4IUR A;  3D6W A;  3R8B A;  4LMQ D;  1HQM C;  4ZK9 B;  5FO8 B;  2SDF A;  5JVH 3;  4A3E B;  1C8C A;  2R93 B;  1QB5 D;  1KLU D;  4ZQ3 A;  2RA4 A;  5FK9 C;  1E2V A;  2H1E A;  5EBC A;  2F3V A;  5DAU A;  4KI0 A;  3D8G A;  3VYR A;  3MWY W;  1EY6 A;  2PZW A;  2RVL A;  3MVV A;  2KHS A;  2D62 A;  1TKW B;  4U68 A;  2FIN B;  1MI2 A;  3LX0 A;  1CI3 M;  1HUN A;  1B44 D;  3ONA B;  4HTH A;  2A6H C;  1WTX A;  5FLX L;  1FNW A;  4K5V A;  3RZD B;  3J7A F;  1EY0 A;  4J6H A;  3SEB A;  1J9O A;  5KIX A;  4X3T A;  2DY8 A;  5EKL A;  5HGT A;  2E2I B;  1XX8 A;  2OEO A;  1ENC A;  1L0Y B;  1M4V A;  3GD7 A;  3KUP A;  1ICW A;  1EYD A;  2KQ3 A;  4C3J B;  3DMU A;  2IL8 A;  4HAE A;  2XWJ B;  2VUM B;  1F2M A;  1F2Z A;  3J7A V;  2XRQ D;  2PCF B;  1O80 A;  1H9M A;  1SFO B;  4C3I G;  1GJX A;  3E5S A;  4OL7 A;  2BDN A;  3IAY A;  1QJO A;  2BE5 C;  1E0B A;  3HEJ A;  1EZ6 A;  2AUK A;  2HCI A;  4DNR B;  1G2T A;  4XYQ A;  5JEA G;  1F2L A;  2NVX B;  3DM1 A;  3Q0A A;  4EGV A;  4TRD A;  2NTS A;  2LMC B;  3MXG A;  2PPB C;  4DK0 A;  4QUF A;  1HA6 A;  2NTT A;  3HGB A;  2RQX A;  2IT1 A;  1PTO D;  3PUY A;  3KLS A;  4MN3 A;  2EYO A;  3J81 L;  1MGS A;  2XIW A;  2PMZ B;  5CGK A;  3TBI B;  5C4J B;  4KN4 C;  3S14 B;  1KDA A;  5C4Z A;  3TDQ A;  5I2Y A;  2EYM A;  1UUP A;  3T4A C;  4CJ1 B;  2EZV A;  2VB3 X;  1LT5 D;  5JEA H;  3DEP A;  4FO2 A;  1H9S B;  3ND9 A;  1XYI A;  2JA8 B;  1JB3 A;  1PZJ D;  4FVM A;  4IUT A;  2PO4 A;  1QG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...