2OEOA

Cryogenic crystal structure of staphylococcal nuclease variant truncated delta+phs i92d
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
130
structure length
130
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKAMVENAKKIEVEFDKGQRTDKYGRGLAYDYADGAMVNEALVRQGLAAVAYVYSGNNTHEQLLRAAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Staphylococcal thermonuclease
publication title Buried Charges and Water in the Protein Interior: Reality or Fiction?
rcsb
source organism Staphylococcus aureus
total genus 33
structure length 130
sequence length 130
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2006-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2oeoA00
4EQPA 5F2DA 1SYBA 1F2MA 2ENBA 5K5PA 1STBA 2F0EA 3SK8A 3TMEA 1EYCA 1A3VA 1STAA 2EY2A 3DMUA 3NQTA 4J6HA 5IOCA 2EY6A 4K2LA 4K5VA 5HGTA 4K6DA 3D4DA 4ME5A 2HQEA 5CV5A 5DEHA 1AEXA 1EYAA 2F0HA 4K5XA 4ZUIA 5DAUA 5CGKA 5I6YA 4HTHA 2F0QA 4LAAA 1EY8A 5IODA 5CV9A 3U9OA 4NKLA 5KYLA 4KY5A 4E6IA 1JOKA 5CV7A 4IUNA 4OL7A 5J22A 1JOOA 2EYMA 5IGCA 2WACA 1TR5A 4PMCA 2PZWA 4ODGA 1JORA 2EY5A 1F2YA 4H7BA 4NMZA 2F0UA 4EQNA 3SHLA 4HMIA 5C4ZA 5I6WA 5ISRA 3SXHA 2PZUA 1IHZA 2O4XA 4R8NA 1SNCA 5C5LA 2OF1A 3TP7A 4YIJA 3TP8A 5KIXA 3C1FA 3R3OA 3MXPA 2SOBA 4KJOA 2F0IA 2M00A 3DHQA 4B9XA 5CC4A 5EKKA 3C1EA 1KABA 4MIUA 5C3WA 5IGEA 2F3WA 1SNQA 1SYFA 5CV6A 4WRDA 2EYPA 4ID6A 3P75A 1EQVA 3P1HA 5EKLA 4K8JA 4WORA 5EGTA 2SNSA 3T13A 5IIFA 3OWFA 4K2KA 2PW5A 4QB4A 4ZQ3A 3MVVA 3HEJA 1NUCA 2F0GA 2OEOA 3OSOA 4S3SA 4K5WA 4N9TA 2F0VA 4RKBA 3TP5A 3VA5A 4EVOA 1ENCA 4F8MA 3ERQA 4HMJA 4PNYA 1A2TA 1SNDA 3QB3A 4RKLA 2F0TA 3MHBA 3ITPA 2F3VA 3NHHA 3NXWA 4I65A 2F0DA 2RKSA 5IGFA 5KRUA 1SYGA 3SR1A 3OMCA 4DFAA 5C6AA 5JAVA 1KAAA 1II3A 1SNOA 3QOJA 4KD3A 1A3TA 1STYA 4DU9A 1EY7A 3EROA 1EYDA 2F0SA 2PZTA 2PYKA 3H6MA 1EY0A 3TP6A 4F7XA 2OXPA 4G57A 1EZ6A 1A3UA 4KJNA 4TRDA 2F0OA 5C4HA 1F2ZA 2KQ3A 1SNMA 3OMGA 1EY9A 3D6CA 4B9WA 2EYOA 3MEHA 2QDBA 3V2TA 5M9OA 2EYFA 1U9RA 1A2UA 3MZ5A 3E5SA 1KDBA 3NUCA 5J1ZA 2NUCA 4PMBA 1JOQA 3PMFA 3SK6A 3SK5A 2EYJA 3BDLA 3LX0A 4EQOA 1SYEA 3D8GA 3QOLA 3S9WA 2F0PA 4KD4A 4NP5A 1SYCA 3BDCA 2EYHA 2F0WA 1KDAA 4QF4A 2F0FA 3EJIA 5NUCA 1TQOA 2EY1A 5CV4A 5KEEA 1NSNS 3D4WA 4KHVA 2PQEA 4KV6A 5IGGA 5I9OA 2F0NA 1SNPA 4NDXA 3RUZA 3HZXA 5C3XA 5J39A 1EY5A 1STNA 1EY6A 5KYIA 1RKNA 5HURA 4KTAA 1SYDA 2SNMA 2F0MA 2F0LA 5I9PA 5KGUA 4IZ8A 2EYLA 4DGZA 3EVQA 4KY6A 5JOBA 3T16A 2F0JA 5E1FA 4N9PA 1TT2A 4KY7A 5E3FA 1EZ8A 1ENAA 2PW7A 3NP8A 1KDCA 1STGA 4DF7A 3SK4A 4K8IA 5C5MA 1STHA 5IGDA 5IGBA 4IALA 4K14A 4QMGA 5CV8A 1EY4A 2KHSA 2RBMA 2RDFA 2F0KA 3NK9A 4J1MA 5CR3A 2LKVA 4ZUJA 2EXZA
chains in the Genus database with same CATH superfamily
2IX0A 4BBRB 4CBVA 5BN5A 3VA7A 4A3CG 4WJ4A 4LF7Q 4X64L 4JI6L 3SK8A 1V9PA 2RHSB 1S3OA 2XNAC 1A3VA 1STAA 2HHHQ 2IWHA 1NTGA 3EA6A 4UP7A 4ZUIA 1KAWA 1N34L 2E2JB 3J80c 4OWXB 1W3SA 3PGZA 4X66Q 1X9NA 3BZKA 4A3BB 4XQJA 2K14A 1DOLA 1JORA 1EIFA 2NB0A 3H3VC 3TEHB 5KNDA 5ISRA 4LF9Q 2KENA 4IPHA 2OQKA 4DV7Q 3D4RA 4NXNL 3S1NB 4O1NA 5CBAE 1EU3A 2Z4HA 5IYBH 2ICIA 3FKIG 5M3MG 4UAIA 1SYFA 3PUYA 3GTGB 3J7AF 3I4NB 4POFA 3STBC 4K0KQ 4IO9A 2NVTH 2WAQG 1PYSB 1XPRA 3B6YA 2N49A 3OSOA 3TP5A 3W3AA 4FYDA 3P20A 1RJTA 4JI8L 4GLAC 3ITPA 3NHHA 2WB1B 4L5RC 3S2DB 5C3EG 2PI2E 1GD7A 1JICA 1WCMB 1GUSA 1I3QB 3T53B 4ZRZA 4C56C 4IURA 1FYCA 1Z7TA 4JI0Q 4C1NK 1B7YB 3J80L 2G5DA 3G7LA 4QGUA 4HEDA 3V2TA 2RHQB 3GTOH 1U9RA 1A2UA 4C3JB 2I07B 3PUZA 3KFUA 4G7HC 1ICFB 4ZCKA 2KUMA 1XMQL 3CCJA 4LF6Q 3DWAA 1WTHA 1VQBA 1CQFA 1QVGA 3PUWA 1A63A 2WKDA 2AUKA 2R93G 1U5KA 2YU9B 1EY5A 5E4XA 2I5LX 1SYDA 2ICEC 4ZYSA 5KGUA 2NVYH 1JC7A 5ELDA 1BQQT 4GZYC 5E3FA 4A3BG 1IBKL 2UXCL 4HCEA 1PRTF 5EPJA 2A73B 1STHA 2A68C 4V190 3T56B 3HOWG 3PO2H 2KHSA 1WOCA 2KBNA 3OYYA 3W1BA 4AYBE 1UEBA 3VYUA 4A3DG 2K03A 1Y14B 4LFCL 3CKIB 1WTQA 4EGVA 4POGA 1D7QA 3E6ZX 3J7ZC 3RN5A 3BVGA 1EYAA 1Y69U 3KK7A 5C4XB 1H9KA 4HTHA 4KKTA 4DN4M 1TWFH 2ZXPA 4PZ8A 3OTOQ 3S15B 4H44C 2WACA 4ODGA 2FFKB 4CDEC 2OWOA 1BCPC 3KLSX 3SXHA 2L55A 2ZT9C 5IWAQ 3A54A 3D3RA 3C1FA 2DUDA 1M4VA 2JA7H 2K5WA 5IP7G 4JV5L 3RLFA 1X3QA 2L9HA 4JVZA 1K8GA 1TWAB 2UXDL 2N78A 4WORA 4C3JG 3S14H 2KCMA 1R9TB 1E7ZA 1DXMA 4HMJA 4A4IA 2A74C 2Z6KC 2DNCA 2M2LA 3CCRA 3M7NA 3DXJC 4I7ZC 1PZKD 2JYOA 2XWJB 4P71A 4KD3A 4LF5Q 4NB3A 4B3MQ 2PZTA 1CA6A 3GTKH 3A5UA 3DM3A 4ZLTF 4TRDA 4YHHL 2KQ3A 3OMGA 5LL6S 4KHPQ 3PV0A 2B2YC 3DWQA 3K5NA 1GUGA 4CKCA 2D9UA 1KDBA 2R3ZA 4R4QA 4FXGC 1NR4A 1T5XD 4OO1I 4EQOA 1PRTD 3S9WA 4L63B 3HOYB 2PMZE 5FO7B 1KDAA 2CKZB 4FF3A 4U68A 1YEZA 3K7UC 3ZJYC 1AE3A 1GUWA 3Q22A 1F9SA 1Q12A 3HZXA 5C3XA 5C4XG 1DOKA 1JWUD 4JCVE 1PH6A 4IZ8A 4DXGA 5FOBB 1QUQB 2NN6G 2VUMB 3HOXG 3DEPA 5EAYA 3MWYW 1NNXA 2K5QA 1TWGH 5CV8A 2LKVA 3ND8A 5ELBA 3W5OA 1EYCA 1BR9A 1VQAA 3OW2A 4DR6L 2AQ1B 3RZDB 5M5XH 3U9OA 4DV6Q 3LGJA 2PNRC 1SN8A 1HA5A 4A93H 1O7YA 4DUZQ 1TVXA 4EX5A 3DUZA 4CJ0B 1PRTB 2O4XA 1XXGA 4CKBA 1CKNA 1ILQA 4L5TA 1N36Q 5EBCA 2B2UA 1U4MA 4WJ3M 2VNUD 1U4LA 1X6OA 1B50A 4IN3A 1L0YB 2RVLA 4FO2A 4O42A 3DEOA 3S2HB 1NAPA 3RD4A 3KDFA 4RMFA 4X3TA 4GN5A 2XRQD 5E4WC 1B70B 4R1JA 3HEJA 3K0YA 4XIGS 4PG3A 4FDBA 1Q1BA 4H13C 2F0TA 4X65L 4PV1C 2JN4A 2EDGA 1DYQA 3STBD 4KHZA 5C6AA 5JAVA 1BCPF 1JWSD 2B2TC 2EQSA 3PIP3 2R93H 1V1PB 3J7A5 3K80C 3ND9A 5DNFA 1A3UA 1QG7A 3CPFA 5COYA 1F2ZA 1LYLA 4LFBQ 1ENFA 1T9HA 3URYA 1XPUA 4XYQA 4RGNA 1IKLA 2H4OA 2NTSA 1QWYA 3HOWH 1AW7A 4JBWA 2F0PA 5CORA 1D5ZC 2VQEL 5LMUQ 2NVQB 1QZHA 2F3IA 1IZ6A 4QF4A 3EJIA 1B4OA 1VQ9A 1F2LA 4R4CA 1G291 3E0JA 3BJUA 5AJ3Q 4IPCA 1YHQA 2UUCQ 2O5JC 1N32L 3EVQA 2PQAA 2Y0SE 1F9RA 5T1GA 5JVG3 1HXYD 2ZXRA 2L5TA 1CM9A 3KF6B 4MNOA 2DJGC 3VDYA 2YTVA 1EFWA 1EQRA 4CDCC 4A3MB 1AZQA 4CHTB 3TMEA 1PZID 4A3JB 1T5EA 3ER0A 1FVIA 5CBEE 4DR1L 3GTJH 2A68D 3NE5B 1N33Q 2E5LQ 3HOUH 5IYDG 3J80E 1XYIA 3CRLC 5CGKA 5KYLA 2VY3A 3BZCA 3BS1A 1TU2B 4JBKA 5EPLA 1YIJA 1B3QA 2NWGA 2B3GA 1SE8A 3E3XA 5FLMG 4LF4L 1LTID 4IUUA 2CW0C 3SGIA 1WTXA 1ET6A 1WD1A 2M9VA 4ZKBB 1BBUA 1X3EA 4FF2A 2X6GA 3HP3A 3M4QA 2Q2IA 2QDLA 4KKUA 3CPWA 2JA5H 1DCZA 1BCPD 3IRBA 1SFOB 4TSSA 2ZJQA 3ERSX 1HCZA 1UE7A 3FHWA 1GUOA 2F0GA 1M8AA 4RFBA 3VA5A 2UU9L 1HTLD 3ERQA 1CUKA 2X69A 1NR2A 3K0XA 2L15A 1VF5C 4BXXH 3FP9A 1VQLA 2F4VQ 1FD7D 1XNQL 4JI5L 4CDFC 3VR6A 4QIWE 1PH8A 2R92G 4ZKCB 3HOVB 1MIUA 1UE6A 4IFDI 1FGBD 1PFBA 5HGQA 3HRZC 4ALPA 1QNKA 2AWNA 4DV0L 2NN6H 4DR3Q 2EIFA 4A3MG 3N6RA 4C3IB 2B2VC 4NP5A 4A3JG 1VS0A 4PQXA 1E0BA 2KECA 1AFPA 1L1OA 5IP9G 2R6GA 4JC0A 2XN9C 2N3SA 1SNPA 1BCPB 4QQBX 2K4KA 3CQZH 1PZJD 1QNUA 3MFGA 4HIMA 3TS2A 1GHKA 3KYHC 2LFNA 2I5MX 3PCOB 1KRTA 2CQAA 3J7YW 3J80i 1ILPA 3QR8A 3AMUA 3D0FA 5IGBA 3RLNA 4NXML 4V0BA 3S24A 4LW1A 1LLRD 5CR3A 2RDFA 1UNSA 5DLQE 1P16A 3TZDA 5K36H 2EXZA 2F1MA 1GVPA 1L0WA 3TSSA 4B3TQ 1OTCA 4K5VA 5CV5A 1Q3LA 4B3RQ 4IOAA 4K5XA 3TN2A 3CCQA 4DR2L 1OXTA 3UDFA 4KY5A 4GOPA 1TWHH 2K32A 3NBHA 3Q6SA 1KXLA 3TZUA 3J81j 3I3CA 5C0XJ 1F9QA 4EQNA 3RMHA 2Z1CA 3R3OA 2EJMA 1G8ZD 2VQFL 4DK3C 3HOVG 3JAMc 4KMUC 2CQOA 2E74C 1HUNA 4DK1A 5GAHC 3MXUA 4MIUA 2K75A 1IL8A 5IE8A 1JT8A 3GP7A 2JA8G 1VDZA 2SNSA 1KQSA 2PCFB 1X56A 1TWCB 3MVVA 3VR4A 2RA4A 1S5ED 1NUCA 5GQOA 1PH9A 1VQ7A 1I94L 1EWIA 3PIPA 4C3IG 2UXBQ 1LTAD 1A15A 4R4IA 2F0DA 1SMYC 5DM63 3F2UA 1D1IA 1Y8OB 4YWLA 1PFSA 1OO9B 2L1BA 3DM1A 5KNCA 3AEVA 4DV4L 4KJNA 3M3YB 2R7ZB 1UUPA 4JYAQ 3D6CA 3IAYA 1PDQA 4DXFA 1Y1WH 3X3NA 2UUBL 3MZ5A 3GD7A 5D3DA 3KJPA 1CHPD 5C0XG 3RZOB 1JOQA 1DM0B 2XGTA 1Q46A 2C9OA 2K04A 3K7AB 4DR5Q 3PF4A 1VQ6A 4HCSA 4IJLA 4Y52H 3JAML 2K05A 1RTNA 3S16H 1LT4D 1GM5A 3RUZA 1WTRA 1E2WA 1QOHA 1SE4A 1HQRD 2MFIA 1LO5D 5JPMC 3GTLB 3GTQB 5ELEA 1RF2D 3T4AC 4C3HG 4WFN3 4DV2Q 2D2CC 4DR7Q 2D0OA 2IJ0A 3UI2A 3CC2A 4LF8L 5KNBA 5IOCA 2EY6A 2NBFA 5BR8Q 2HD3A 1S40A 2ID0A 1B9MA 4A3IB 3S17H 1JOOA 2E2HB 2PZWA 2FXQA 1GUNA 1EYGA 3CP0A 3WDNA 1IHZA 4DUYQ 2MO0A 4X64Q 3I8ZA 1IBMQ 4JI6Q 1H9MA 2R92H 3S1MB 2E8GA 1PYBA 3NEMA 1S5DD 3W2DA 3J81E 1W2BA 1O7IA 4OX9L 2R7ZG 2CW0D 1EQVA 4RGTA 1H9SA 4GKKQ 4OWWB 2E2IB 4K6LA 1Y1VG 4JI3L 4A3GG 1O7ZA 4H02A 1EOVA 3FPUB 3QIAA 4KKSA 1L1OC 2JK8A 1OXXK 1SROA 2RSOA 1D6EC 4DFAA 3TS0A 4JBMA 1UEAB 2FHTA 5IP9H 1MI2A 2HHHL 2CH4W 2JA6B 5C4JH 1A3TA 2IHEA 4UP9A 3EROA 4XXEA 5LMNL 1X65A 3M4YA 1K8OA 1LTSD 1IYJB 1EZ6A 4X66L 1SNMA 3JC66 4C1NI 1HTPA 4JI4L 4HJ8A 4JI8Q 3BDLA 3GTPB 2F03A 2HDMA 1EIHA 1S5BD 1M1KC 4X62L 1YVCA 1WD0A 3AYHB 2BA0A 3Q0AA 1TQOA 3HKZB 4JG2A 4LUZA 1RDPD 4K0KL 3I4MG 1HNXL 4A3IG 1VQEA 1NMGA 2L0CA 5HY6A 4N9PA 5IYCH 1A0IA 1G6ZA 3A55A 1M90C 4J1MA 4QL5A 4BBRG 5JJKA 1LTBD 1BUVT 2AQ3B 5M9OA 1XMQQ 1KTKA 1SYBA 3H09A 4LJZC 3DWPA 3DMUA 4MZ9A 1J8IA 2LSSA 3IKJA 4UHVA 1NBWA 2LS01 2ZTCA 5BN3A 1EY8A 4NKLA 3U4VA 2ZJPA 1LT3D 1Q1EA 4GN3B 1VQIA 3J81i 5CV7A 1IXRA 1IBKQ 2UXCQ 4YCUA 1ZEQX 2EY5A 4A3LH 4Z9CB 1CQVA 1ET9A 2PZUA 3NWTA 4LF6L 1IKMA 1HFNA 1LV9A 2KVMA 5C44B 1G2SA 4G7ZC 2JA6G 1WTWA 1GKHA 1UE5A 4L6TB 1HZAA 4GNXA 3TREA 3S1RB 3SVMA 3H0GH 4X3UA 1Q7YC 5CMDA 2JA5B 3MXNB 1JE5A 1PTOH 1WYDA 1E1TA 1KHIA 3I4NG 5CV6A 5M3FB 1VQ8A 4WRDA 3LWEA 3P75A 1IYUA 3VYTA 4M1UB 1GUTA 1HNWL 4C2MB 3QJYA 2EJFC 5ELFA 1D1KA 1MBYA 4HIKA 3ULPA 1WTOA 4FXKC 1SSOA 2WB1G 1EQTA 5I2XA 2NVXB 2F4IA 3HKZG 2FINB 3OMCA 3CCEA 4BY7H 1WCMG 1SNOA 1VQGA 5EBDA 4JV5Q 4ZK9B 1KD1C 4APVA 4DK0A 2RCFA 1YJWA 1SMYD 2UXDQ 3D6WA 2TSSA 4RG1A 3MEFA 3GTMB 1O80A 1XTDA 1VQDA 1BXTA 3ULLA 4BY1H 4JK1C 4JI7L 5JJLA 2D0PA 5IWAL 4IPDA 1EWCA 1RHPA 4DNTB 4XT3B 1LTGD 3BDCA 3CF5A 4DV3Q 4O2DA 1H9JA 2A1AA 1JCKB 3D4WA 1DD2A 1Q8KA 1SBBB 4AYBB 2F0LA 4DAYB 1AZPA 4ULLA 4YHHQ 4UDUC 4DA2A 2R61A 1G2TA 2C5CA 1I4XA 5FJ8G 1H9RA 3M85A 1STGA 5EKIA 2LMCB 2PNHA 3RN2A 5JVH3 5C44G 3PO3H 4BBSH 4OO1G 2WP8J 2QKIC 4A3CH 1SE2A 4LF5L 1I50H 4J8QA 1FR3A 4JI2Q 1CKOA 4LUVA 4ABNA 5M3FG 4A3EB 4X3SA 1HZBA 1JJCB 5DAUA 3HOZB 5A35A 1CT1D 4OL7A 1TWHB 2K28A 1Y1VH 3L2PA 4DNRB 4A3GH 3PF5A 4LWCA 2PQAB 5C5LA 1UAPA 5KIXA 1U4PA 3JAME 2ES2A 4A3KB 3CU7A 3PSIA 2L11A 2M00A 3KBGA 2A8VA 4HIOA 5CC4A 3C1EA 2MPMA 5M5WH 3GV6A 3S1QB 3FKIH 5M3MH 2NN6I 4PZ7A 3AB9A 2JEBI 3GO5A 5LMNW 4KI0A 3AU7A 2HT1A 4M8AA 3OPOA 2OEOA 1C48A 4A3FB 3MXGA 4PNYA 1FNVA 1C0AA 5H1SE 5IGFA 1XMOL 1SYGA 2Z0SA 1S4ZA 5C3EH 1KRSA 2MP1A 3HGBA 3A5ZB 1EY7A 5JEAJ 1EYDA 4HSPA 2PYKA 4Y7NH 2EVBA 3UDXA 2QILA 3I4MH 2PMZB 4G57A 1ZXTA 4CDDC 3J81c 1FGUA 5M5YH 1Y1WB 2TMPA 4DUZL 1XNRL 4RGOS 5J1ZA 3E5SA 4IQZA 1ASYA 4PMBA 4B08A 3SEBA 3D8GA 1MSGA 1UE1A 3WOFA 3TQYA 1PV4A 3HOYG 3MA2B 1IBLQ 3NQIA 1K0RA 2NYZD 2Z9HA 5IGGA 4OONA 1P8LA 1HJPA 3I56A 4A3EG 2E2JH 4IUVA 2SNMA 2ZM6L 2B8GA 2EYLA 2HQLA 5JOBA 1ONLA 2VUMG 3BYYB 5GROA 4R4OA 4A3BH 3I70A 1WTVA 3NP8A 1KC8C 4DF7A 3SK4A 3BYTB 4P75A 4A3KG 4QY7A 4EQPA 3ONAB 2ENBA 5K5PA 2J0TD 4OIJA 3U9SA 2IHFA 3S1NH 4A3DH 1KLUD 2BDNA 5JEAG 3JAMi 3D4DA 3GTGH 3I4NH 1L1OB 4GLVB 4IPGA 3E0EA 3J81L 1QILA 4LFBL 4LFAQ 3WWVA 4A3FG 1Q90A 4JI1L 2J7ZA 1QJOA 3I4OA 5FK9C 1R4PB 4NMZA 1MSHA 5C4ZA 3R93A 1LM0A 2OF1A 2B63B 4DR4Q 1TS2A 4L5QA 3A7AB 1WCMH 1I3QH 5IP7H 1K3RA 2JEAI 1B44D 3KLWA 3A56A 1FJGL 1YNJC 4IFDJ 4CKEA 4FNFA 1TIID 5EKLA 3CCMA 1PVOA 1MHWC 1A62A 2PW5A 5FKAC 4B3SQ 4C3JH 4ZAIA 3L7ZC 3WOEA 4F8MA 1BVSA 1GJXA 1BDOA 1HR0L 4FXDA 3QB3A 2CWAA 3I4LA 3NXWA 3A7LA 4LF4Q 4KK7A 3FVQA 2QW7A 3L0OA 4CJ1B 4KHPL 5TSSA 4BS9A 3W1GA 1S72A 5D14A 1OXUA 4BWGB 1STYA 5C4JB 2VXWA 2ZTEA 3PQIA 2QF7A 2E5LL 1MJEA 4AQYQ 2YU9H 3OW7A 2WKCA 1EIYB 3Q23A 5I4DA 4B9WA 2NVTB 1RL2A 5EPKA 5FJ8H 1R4QB 2C35B 5ELCA 4N8X1 3SK5A 4UY8C 3CD6A 4U673 4OO1H 1EUJA 4HJ9A 2Y0SB 1HHVA 1XNQQ 4YWKA 5GADC 5IY0A 2ZJRA 5IT9E 4IFDG 3NENA 5C4XH 3S15H 1B2TA 1CI3M 4Q5VA 1KIXA 4YCWA 4HIDA 3HOXH 3GTOB 2L4NA 5GAGC 3NTKA 3T51B 2EE1A 2LXJA 1V1PA 2RBMA 4ZUJA 2NTTA 5F2DA 1JJGA 4DK6C 2HIXA 2QCPX 1PHJA 4K2LA 5HGTA 4ME5A 4O0AA 1KL9A 5EJWA 1LT6D 1TWAH 4BA1I 3VR2A 4DR3L 2IX1A 2R7FA 2B8FA 2NVYB 2B2WA 1R9TH 3OHXC 1JOKA 3IFTA 4L5SA 3HKSA 5G3LF 4HN7A 3UDGA 2MNAA 1YNXA 1B8AA 2AMCB 3SHLA 4TQUS 4R8NA 1TXYA 1MKHA 3EQLC 1XTCD 2B2UC 4DV1Q 3PO2B 2YYZA 2UUAQ 3M9BA 5IYBG 2WIIB 3PIO3 1K73C 4DV5Q 2MQHA 2F3WA 1PH7A 3K5OA 3V05A 2MJ8A 3G4SA 4DR2Q 3NPPA 4IOCA 2BDOA 4K8JA 1SRUA 1TY2A 2HDLA 4QIWB 4K2KA 1PFMA 1TWFB 1D5XC 2V1CC 3CMEA 2ZXOA 4EVOA 2K33A 2JQOA 3A8JE 3G6JB 4RKLA 4P74A 3HOYH 2Y0SG 5LHY1 1CSPA 1EWHA 1G51A 3H15A 1B53A 4LK1C 2JA7B 2YTXA 3H6MA 2OXPA 2DY7A 2JXMB 1SLJA 2VUMH 3S14B 1C4QA 1CKMA 3UE0A 1I94Q 4A75A 1GO3E 2QEXA 1YJNA 4XTCS 3GDEA 2WAQE 1WTPA 3RZDH 4RA8A 1FNUA 1EY6A 3GTKB 1RKNA 1EOTA 3T1YL 4F88A 4KY6A 1YITA 3O13A 4IUTA 4FF1A 2UUBQ 2K5NA 1JB7A 4FVMA 3U50C 3OIQA 3M4OH 5ELOA 5G3LD 2DN8A 4MTKA 4GKJL 2BCOA 1LT5D 1PXUA 4HSVA 3NTIA 2NZHA 1STBA 2IT1A 3I90A 3FDTA 5I2YA 4R8IA 2J4XA 4K6DA 3S2HH 5DEHA 2XRSD 4QUCA 5IYDH 1XPOA 1S5CD 4J15A 3VYSA 1SAPA 1N8RC 2KEDA 4IUNA 3G48A 1QB5D 5IGCA 2Q8TA 4PMCA 3SE0A 3BDOA 4H7BA 5FLMH 2N8NA 3TP7A 1TWGB 2OTLA 4PMWA 2K7VA 2JA7G 2E2DC 3MXPA 1HNZL 4KJOA 1HR0W 3MC0B 3I72A 4YY3Q 5EKKA 2XVSA 1QE6A 4X6AH 2OTJA 1PRTC 1J5EQ 4QJFA 5M5XB 5EGTA 5DM73 1VF7A 3OWFA 1I6HH 3EBEA 4DV2L 1HH2P 5JJIA 4A93B 4HJAA 2VW9A 3Q24A 4DR7L 3MHBA 4MN3A 4BA2I 2KCCA 3T1HQ 2NVQH 2Z6KA 4G7OC 4OGQC 4GS3A 4NPSA 3F1ZA 1CZGA 2F52A 3CC7A 1FL0A 2GVAA 1XX8A 3H3VH 4DNIA 5BR8L 3J7AV 1JE4A 3CCLA 1JMCA 4Y7NB 2PPBC 1S5FD 4OX9Q 5E7NA 4DPGA 1EY9A 1N34Q 1E3PA 1NMFA 2RQXA 1IW7C 2FMCA 2EYFA 3AQQA 5AFWA 2B2YA 3NUCA 4UP8A 5FLXE 4HJ5A 4JI3Q 4A3MH 1SYEA 3K5LA 3H94A 3CCSA 4A3JH 1G6PA 2EYHA 1PA6A 1IBML 4LF7L 2HCIA 2PQEA 1L2FA 4NXNQ 5I9OA 3FMCA 2R93B 4G4KA 5LMNQ 1K83H 5HURA 2B2WC 4GKKL 3FRPB 2A69C 4QUFA 4KY7A 4RH6A 3NELA 2OT2A 4JI4Q 4XT1B 4LF9L 1SDFA 1YI2A 2JP1A 1LTRD 3NK9A 2QA4A 3HOWB 4X62Q 3I73A 4DV7L 4A3DB 1V8QA 2EY2A 2EXDA 1TS3A 3PUXA 3KF8A 4XDXA 2O5IC 1TS5A 1SFOH 1HNXQ 2F0QA 2JE6I 4GOPC 5IT9c 1SEBD 2RF4A 5J22A 2EYMA 3P7JA 1I4RA 3KJOA 4A93G 1X3FA 3PIOA 1F2YA 5I6WA 4KN4C 2RDGA 4FP5D 4RCOA 3KLSA 2SOBA 1RCVD 2F0IA 4CGYB 3HOVH 2AWOA 3RLOA 2Q2TA 4AIMA 3VR3A 3LWUA 4JI0L 3GTJB 1EIGA 1Z9FA 1SNQA 1MGSA 5J3BA 3HOUB 1W6KA 1RIPA 4OELB 3Q8DA 2KEEA 1Q82C 2JA8H 1XWEA 4ZQ3A 1PH2A 4A76A 1Z6HA 3GV3A 2AQ2B 4RKBA 2FJ2A 1YJ9A 3DLLA 1I6VC 1J9OA 1YHBA 1ZKOA 2A5HA 2QEJC 1KNAA 1TY0A 4C3IH 1RD9D 3AFQA 1VQHA 2XWBB 2SDFA 2WV6D 2Z6BA 3K5MA 1BF4A 1II3A 3QOJA 3F2DA 2KOLA 3I7FA 3IFDA 3BZDB 2CFMA 4LFCQ 2F0SA 1RTOA 2B2TA 5FO9B 3R8BA 1SJED 4EQ5A 4DAMA 4QCLA 3K8AA 5IT9L 4XQNA 1VMCA 1HNWQ 2QDBA 2IPKD 2NUCA 2DJFC 5C0XH 1KLGD 1K28A 4DAVA 3QOLA 1PYWD 2K6AA 4IJHA 2LY7A 2N88A 1D5MC 1H95A 2G9DA 4JW0A 1DJRD 4P72A 5J39A 1CKNB 2AHOB 5KYIA 1NY4A 1MD2D 1PH4A 2D62A 3OTOL 5E1FA 3U58A 1ENAA 3F2CA 1SE3A 3HOXB 1EEFD 1Y8PB 2PW7A 4C3HH 4IALA 2P5ZX 3KDFB 4JI7Q 4RWSC 1PTOC 1E1OA 2KA7A 2XSCA 4JOIA 1X54A 1JJ2A 3K57A 3C3LA 4DAPA 1DZ1A 3CW2C 3HOUG 1HZCA 1CTMA 3CQZB 3CAMA 5CV9A 3IL8A 1TWCH 1F9PA 2MO1A 4RGMA 1VQNA 2A6HC 3EN2A 4IUQA 1ML0D 2HIVA 1JB3A 2XIWA 4GN4B 4DV3L 1IL2A 3D31A 3OIPA 4L8JA 1DGSA 1WFQA 4CJ2C 4B3ML 1V1QA 2JA5G 3NBIA 1BKBA 1NJIC 3M3YH 2R7ZH 1I4GA 3AFPA 2VB3X 4JBJA 4N8FA 1PH3A 4S3SA 1GHJA 3RZOH 3CC4A 3QO2A 1SNDA 1X32A 3K7AH 1AN8A 4BXXG 4I65A 1O78A 1V1OA 1E22A 1FNWA 1KAAA 4AH6A 1PMRA 1YNNC 3M7GA 4JI2L 1F77A 1X3PA 4OXPA 4XYOA 2CWPA 4DR6Q 2H5XA 1KNEA 2Q2HA 1B1ZA 3GTLH 2DY8A 3GTQH 1N9WA 3MEHA 1IYVA 1SMXA 1B9NA 2K1BA 1U4RA 4R9WA 1JR0D 3MXNA 4FF4A 1XMOQ 2B2VA 1EL0A 4R4TA 2PI2A 1IW7D 1K0SA 5KEEA 1K8AC 1NSNS 1I4PA 2WFWA 1C7YA 1VQ4A 3I2ZA 4AYBG 3RNUA 4KTAA 1TKWB 5FO8B 3TRZA 4A3IH 4DV6L 2E2HH 3V96A 1VQCA 1XNRQ 1PH5A 3C46A 2L12A 2EPBA 3M4OB 1EY4A 1DONA 5K36G 2YV5A 5FLXc 4X65Q 3CCUA 1N36L 2A69D 4QB4A 4BBRH 1XJVA 2ATWA 3PUVA 3S1MH 5A2QE 3NQTA 4J6HA 3S16B 4TKOB 4WJWA 1I4QA 4IUPA 3HOZG 5I6YA 2BA1A 2K5DA 1C8CA 2ZM6Q 2E2IH 2NZOA 1VMPA 2AUJD 2CH4A 3CCVA 2F0UA 2FMMA 1IBLL 1HRJA 2KJXA 1YHAA 2R7DA 5L37A 4B9XA 4DAYA 2VQEQ 4GNXC 2JA6H 4YWMA 1EEID 1U0LA 1PTOF 1QCBD 5GAEC 2I46A 2V4DA 3KLRA 2A6EC 1SJHD 2OQ0A 2DGYA 1LTLA 1STEA 2EYPA 4ID6A 1OXVA 3P1HA 4RHSA 3T13A 2Z4IA 1SR3A 1N32Q 1I6HB 4JI1Q 4NW2A 1YZ6A 3S17B 4K5WA 1HA6A 1BOSA 2KCNA 3GTPH 2E75C 3NSWA 5FLXL 4F87A 5KRUA 5LMUL 3S2DH 3SR1A 3L9AX 1ESFA 4DU9A 1CFMA 2R92B 3FPPA 1QUQA 3HG9A 5T1IA 5AJ3L 1B3AA 1CK1A 4DR1Q 1OXSC 2LXKA 4HAEA 4F7XA 1FJGQ 2UUCL 2GN5A 4LFAL 1Y1WG 1LTTD 1LACA 1C9OA 3BU2A 2KHJA 3BVMA 2MGSA 3VYRA 1CA5A 1VCIA 3LX0A 1HR0Q 3CHBD 3HS0C 2H1EA 3HFZB 4GOPB 3K6OA 1SYCA 4JOIC 3NWSA 3X3MA 4DR4L 1E2VA 2F0WA 3NBHB 1ASZA 2GVBA 2F0FA 4H0LC 2EY1A 1K9MC 1ZYRC 4KV6A 3G71A 1BBXC 2K01A 1N33L 2BE5C 1K83B 1CSQA 2Z8LA 3K81C 5I9PA 4B3SL 3G6EA 4DGZA 1WJJA 2IX3A 3U4ZA 1I5FA 1EZ8A 1G91A 1KDCA 2XTIA 2UU9Q 5IGDA 2G9HD 2QGQA 1O7LA 4K14A 4QMGA 1QVCA 2BH2A 2VB2X 5C44H 1K3BC 4N9TA 1F2MA 2F0EA 4ILWA 1HUMA 3S1RH 4JI5Q 4AQYL 4RCNA 5EQ0A 3K58A 2IL8A 2JSOA 1AEXA 3FEWX 3N52A 5M3FH 1EFID 2F0HA 1Q81C 1PTOD 2IY5B 4C2MH 2VZAA 1VQKA 4E6IA 4DV0Q 2B39A 2ZTDA 2EOTA 2EJGC 3KOJA 1GOZA 2ALYB 3GQBA 2MUYA 3KBXA 3CRKC 1NCVA 1LABA 4HMIA 2NVXH 2B63G 1SNCA 2F4VL 3MAQA 3H3VI 3DHQA 2JJQA 2Q8IB 4LMQD 2A6HD 3I91A 2JA9A 1KABA 4OIKA 5C3WA 3ICEA 1TS4A 4JPBW 1L0XB 2K50A 3GTMH 2JA8B 3CMAA 2SEBD 4OHJA 3F2BA 3MFYA 1BNZA 1PLFA 4X3KA 1ESRA 3UDIA 2F0VA 3H91A 4P2CB 3ULJA 2RDHA 1X55A 2RKSA 1Q8IA 3BVZA 4NXMQ 3QG1A 1J6QA 2AKWB 1EQQA 1HZ9A 1E2ZA 2KCTA 1VQPA 1WVLA 3H0GB 3KF6A 1PTOB 1Z47A 3BG3A 2IW3A 2PO4A 2EYOA 2WINB 1HQMC 4MHEA 2RSNA 1SXTA 1YNND 3EFXD 1BO0A 3SK6A 3MTSA 2EYJA 4DV1L 4KD4A 2BOSA 2UUAL 4YCVA 4B3TL 4LUOA 2VQFQ 4BY7B 4DV5L 2HUGA 4NDXA 4B3RL 4A3EH 3L3OC 2CHBD 2B29A 1STNA 1V43A 4KN7C 3HOZH 5LL6X 2F0MA 2K5HA 4I7AA 2F0JA 5IYCG 1TT2A 2BH8A 4UPAA 2A19A 4C3HB 5JPNC 4K8IA 3OOCA 3TBIB 4GLXA 4BY1B 1H9SB 4TVAB 3CXCA 4A3KH 1NE3A 3R2TA 4RAUC 1D8LA 2MHVA 5JEAH 4HJ7A 2CVRA 2HQEA 3S1QH 1VQJA 4DV4Q 4ME3A 1JWMD 2DNEA 1HPCA 5IODA 4LAAA 1VQMA 3LNNA 3T1YQ 2K5VA 5D65A 2O2LD 3SDZA 3ZYYX 4A3FH 1PH1A 1TR5A 4RHRA 4A3LG 3K59A 2UXBL 4OWTB 2CCZA 2RCNA 1AH9A 5BN4A 2KHIA 3PO2G 5D3IB 4P73A 4YIJA 3TP8A 1W6JA 2EZVA 3PO3B 4GKJQ 4BBSB 1X3GA 3E9IA 3VR5A 3H0GG 1ICWA 3E9HA 1I50B 5IGEA 1K8MA 1Q86C 2I0QA 1DOMA 4JYAL 2X6LA 1VQ5A 4DKAC 5IIFA 3KF8B 4Q0FA 5C0XI 1Y8NB 2NZ1D 2YTYA 1ENCA 1CHQD 1Y1VB 1A2TA 2GA4B 3KUPA 3OWEB 4OEMB 2A6ED 2F3VA 4DR5L 4A3GB 2ASBA 1MJCA 3NTHA 3A74A 1JQYD 1E24A 4LNQA 4BY7G 2K52A 1HNZQ 1RODA 1HFGA 1A6XA 1YBYA 4HR7B 1AP0A 3R2IA 2N55A 4LF8Q 1A8VA 2VS1A 2VL6A 3TP6A 1EY0A 5M5WB 3M4PA 3A0JA 2E76C 3FKIB 5M3MB 2F0OA 5C4HA 1VQFA 2HCCA 3C2PA 2WAQB 1I4HA 5ELNA 4XQQA 3QWNA 4BY1G 1UWVA 3PMFA 4MTNA 3A8IE 3F8TA 1YNJD 2OCEA 1AE2A 5JJZA 4YY3L 1QZGA 2D5DA 3RR5A 1VQOA 1GXDC 3EIVA 1D2BA 2Q8RE 5NUCA 3TDQA 5C3EB 5CV4A 3UE1A 1LUZA 1BBWA 4KHVA 2F0NA 5A2QL 1QVFA 1J5EL 1WI5A 4IFDH 3I4MB 3I55A 4PZ6A 3T16A 4GNXB 2WB1E 5M5YB 1CZWA 1ZYRD 1PFNA 3HKZE 3A8KE 5C5MA 2Q2UA 5CYUA 2BE5D 4KLKA 1EU4A 2I5HA 3T1HL 2B63H 3PO3G 4BBSG 2F0KA 4DUYL
chains in the Genus database with same CATH topology
2IX0A 4BBRB 4CBVA 5BN5A 3VA7A 3SK8A 2XNAC 1A3VA 1STAA 2IWHA 3EA6A 4ZUIA 2E2JB 4A3BB 4XQJA 1JORA 1DOLA 2NB0A 3H3VC 5KNDA 5ISRA 3D4RA 3S1NB 4O1NA 5CBAE 1EU3A 2Z4HA 2ICIA 4UAIA 1SYFA 3PUYA 3GTGB 3J7AF 3I4NB 3OSOA 3TP5A 3W3AA 4FYDA 3P20A 1RJTA 3ITPA 3NHHA 2WB1B 3S2DB 1JICA 1WCMB 1GUSA 1I3QB 3T53B 4ZRZA 4C56C 4IURA 1FYCA 1Z7TA 4C1NK 3J80L 3G7LA 4HEDA 3V2TA 1U9RA 1A2UA 4C3JB 2I07B 3PUZA 4G7HC 2KUMA 3DWAA 1CQFA 3PUWA 2WKDA 2AUKA 2YU9B 1EY5A 5E4XA 1SYDA 2ICEC 4ZYSA 5KGUA 1JC7A 5ELDA 1BQQT 4GZYC 5E3FA 4HCEA 1PRTF 5EPJA 2A73B 1STHA 2A68C 4V190 3T56B 2KHSA 3VYUA 2K03A 1WTQA 3CKIB 4EGVA 3E6ZX 3BVGA 1EYAA 1Y69U 3KK7A 5C4XB 1H9KA 4HTHA 4KKTA 4DN4M 2ZXPA 3S15B 4H44C 2WACA 4ODGA 2FFKB 1BCPC 3KLSX 3SXHA 2L55A 2ZT9C 3A54A 3D3RA 3C1FA 1M4VA 2K5WA 3RLFA 1X3QA 2L9HA 1TWAB 4WORA 4C3JG 1R9TB 1DXMA 4HMJA 2A74C 2DNCA 2M2LA 3M7NA 3DXJC 4I7ZC 1PZKD 2JYOA 2XWJB 4KD3A 2PZTA 1CA6A 4ZLTF 4TRDA 2KQ3A 3OMGA 5LL6S 3PV0A 2B2YC 3DWQA 3K5NA 1GUGA 4CKCA 2D9UA 1KDBA 2R3ZA 4FXGC 1NR4A 1T5XD 4OO1I 4EQOA 1PRTD 3S9WA 4L63B 3HOYB 5FO7B 1KDAA 4FF3A 4U68A 1GUWA 3Q22A 1F9SA 1Q12A 3HZXA 5C3XA 1DOKA 1JWUD 4IZ8A 4DXGA 5FOBB 2NN6G 2VUMB 3DEPA 3MWYW 2K5QA 5CV8A 2LKVA 3ND8A 5ELBA 1EYCA 1BR9A 2AQ1B 3RZDB 3U9OA 2PNRC 1HA5A 1O7YA 1TVXA 4CJ0B 3DUZA 1PRTB 2O4XA 1XXGA 4CKBA 1ILQA 5EBCA 2B2UA 1U4MA 2VNUD 1U4LA 1B50A 4IN3A 1L0YB 2RVLA 4FO2A 4O42A 3DEOA 3S2HB 1NAPA 3RD4A 4X3TA 2XRQD 5E4WC 3HEJA 3K0YA 4XIGS 1Q1BA 4H13C 2F0TA 4PV1C 2EDGA 1DYQA 4KHZA 5C6AA 5JAVA 1BCPF 1JWSD 2B2TC 3PIP3 1V1PB 3ND9A 5DNFA 1A3UA 1QG7A 5COYA 1F2ZA 1ENFA 3URYA 4XYQA 4RGNA 1IKLA 2H4OA 2NTSA 1QWYA 1AW7A 4JBWA 2F0PA 5CORA 1D5ZC 2NVQB 4QF4A 3EJIA 1B4OA 1F2LA 1G291 3E0JA 2O5JC 3EVQA 5T1GA 1F9RA 5JVG3 1HXYD 2ZXRA 2L5TA 1CM9A 4A3MB 1AZQA 4CHTB 3TMEA 1PZID 4A3JB 1T5EA 5CBEE 2A68D 3NE5B 3J80E 1XYIA 3CRLC 5CGKA 5KYLA 3BS1A 1TU2B 5EPLA 2NWGA 1LTID 4IUUA 2CW0C 1WTXA 1ET6A 1WD1A 2M9VA 4ZKBB 4FF2A 2X6GA 3HP3A 4KKUA 1DCZA 1BCPD 1SFOB 4TSSA 1HCZA 1GUOA 2F0GA 1M8AA 3VA5A 4RFBA 1HTLD 3ERQA 2X69A 1NR2A 1VF5C 1FD7D 3VR6A 4ZKCB 3HOVB 4IFDI 1FGBD 1PFBA 3HRZC 1QNKA 2AWNA 2NN6H 3N6RA 4C3IB 2B2VC 4NP5A 4PQXA 1E0BA 2KECA 1AFPA 2R6GA 2XN9C 1SNPA 1BCPB 1PZJD 1QNUA 3MFGA 1GHKA 2LFNA 2CQAA 3J7YW 1ILPA 3AMUA 5IGBA 4V0BA 5CR3A 1LLRD 3TZDA 2RDFA 1UNSA 5K36H 2EXZA 2F1MA 3TSSA 4K5VA 5CV5A 1Q3LA 4K5XA 3TN2A 1OXTA 4KY5A 2K32A 3Q6SA 3NBHA 3TZUA 3I3CA 5C0XJ 1F9QA 4EQNA 3RMHA 2Z1CA 3R3OA 2EJMA 1G8ZD 4KMUC 2E74C 1HUNA 4DK1A 3MXUA 4MIUA 1IL8A 3GP7A 1VDZA 2SNSA 2PCFB 1TWCB 3MVVA 3VR4A 2RA4A 1S5ED 1NUCA 4C3IG 1LTAD 1A15A 2F0DA 1SMYC 5DM63 3F2UA 1D1IA 1Y8OB 1OO9B 2L1BA 3DM1A 5KNCA 4KJNA 3M3YB 2R7ZB 1UUPA 3D6CA 3IAYA 1PDQA 4DXFA 3X3NA 3MZ5A 3GD7A 5D3DA 1JOQA 1CHPD 5C0XG 3RZOB 1DM0B 2C9OA 2K04A 3K7AB 4HCSA 3JAML 2K05A 1RTNA 1LT4D 3RUZA 1WTRA 1E2WA 1QOHA 1SE4A 1HQRD 1LO5D 5JPMC 3GTLB 3GTQB 5ELEA 1RF2D 3T4AC 4C3HG 4WFN3 2D2CC 2IJ0A 3UI2A 5KNBA 5IOCA 2EY6A 2NBFA 2ID0A 1B9MA 4A3IB 1JOOA 2E2HB 2PZWA 1GUNA 3WDNA 1IHZA 3I8ZA 1H9MA 3S1MB 3J81E 1S5DD 3W2DA 2CW0D 1EQVA 4RGTA 1H9SA 2E2IB 4K6LA 1O7ZA 3FPUB 3QIAA 4KKSA 1OXXK 2RSOA 1D6EC 4DFAA 1UEAB 2FHTA 1MI2A 2JA6B 1A3TA 3EROA 4XXEA 3M4YA 1K8OA 1LTSD 1EZ6A 1SNMA 4C1NI 1HTPA 3BDLA 3GTPB 2F03A 2HDMA 1EIHA 1S5BD 1WD0A 2BA0A 3Q0AA 1TQOA 3HKZB 1RDPD 2L0CA 4N9PA 1G6ZA 3A55A 4J1MA 1LTBD 1BUVT 2AQ3B 5M9OA 1KTKA 4LJZC 1SYBA 3H09A 3DWPA 3DMUA 1J8IA 3IKJA 2LS01 5BN3A 1EY8A 4NKLA 1LT3D 1Q1EA 5CV7A 1ZEQX 2EY5A 4Z9CB 1CQVA 1ET9A 2PZUA 3NWTA 1IKMA 1HFNA 1LV9A 2KVMA 5C44B 1G2SA 4G7ZC 1WTWA 4L6TB 3S1RB 3SVMA 4X3UA 5CMDA 2JA5B 1PTOH 5CV6A 5M3FB 4WRDA 3LWEA 3P75A 1IYUA 3VYTA 4M1UB 1GUTA 4C2MB 3QJYA 2EJFC 5ELFA 1D1KA 1MBYA 1WTOA 4FXKC 1SSOA 1EQTA 5I2XA 2NVXB 2F4IA 3OMCA 2FINB 1SNOA 5EBDA 4ZK9B 4DK0A 1SMYD 3D6WA 2TSSA 3GTMB 1O80A 1BXTA 4JK1C 1EWCA 1RHPA 4DNTB 4XT3B 1LTGD 3BDCA 1H9JA 1JCKB 3D4WA 1DD2A 1SBBB 4AYBB 2F0LA 1AZPA 4ULLA 4UDUC 4DA2A 2R61A 1G2TA 2C5CA 1I4XA 1H9RA 3M85A 1STGA 5EKIA 2LMCB 5JVH3 4OO1G 2WP8J 2QKIC 1SE2A 4J8QA 1FR3A 4ABNA 4A3EB 4X3SA 5DAUA 3HOZB 5A35A 1CT1D 4OL7A 1TWHB 2K28A 4DNRB 5C5LA 1UAPA 5KIXA 1U4PA 3JAME 4A3KB 3CU7A 2L11A 2M00A 3KBGA 5CC4A 3C1EA 2MPMA 3GV6A 3S1QB 2NN6I 3AB9A 2JEBI 3GO5A 4KI0A 3AU7A 4M8AA 2OEOA 3OPOA 1C48A 4A3FB 3MXGA 4PNYA 1FNVA 5IGFA 1SYGA 1S4ZA 2MP1A 3HGBA 1EY7A 5JEAJ 1EYDA 4HSPA 2PYKA 2EVBA 2QILA 2PMZB 4G57A 1ZXTA 1Y1WB 2TMPA 4RGOS 5J1ZA 3E5SA 4IQZA 4PMBA 4B08A 3SEBA 3D8GA 1MSGA 3WOFA 3MA2B 3NQIA 2NYZD 5IGGA 4IUVA 2SNMA 2B8GA 2EYLA 5JOBA 1ONLA 3BYYB 3I70A 1WTVA 3NP8A 4DF7A 3SK4A 3BYTB 4EQPA 3ONAB 2ENBA 5K5PA 2J0TD 4OIJA 3U9SA 1KLUD 2BDNA 5JEAG 3D4DA 3J81L 1QILA 1Q90A 2J7ZA 1QJOA 5FK9C 1R4PB 4NMZA 1MSHA 5C4ZA 3R93A 2OF1A 2B63B 1TS2A 3A7AB 2JEAI 1B44D 3A56A 1YNJC 4IFDJ 4CKEA 4FNFA 1TIID 5EKLA 2PW5A 5FKAC 4ZAIA 3L7ZC 3WOEA 4F8MA 1GJXA 1BDOA 4FXDA 3QB3A 3I4LA 3NXWA 3A7LA 4KK7A 3FVQA 4CJ1B 5TSSA 4BS9A 5D14A 1OXUA 4BWGB 1STYA 5C4JB 2VXWA 2QF7A 3OW7A 2WKCA 3Q23A 5I4DA 4B9WA 2NVTB 5EPKA 1R4QB 5ELCA 3SK5A 4U673 4OO1H 2Y0SB 1HHVA 5IT9E 4IFDG 1B2TA 1CI3M 4Q5VA 3GTOB 2L4NA 3NTKA 3T51B 2EE1A 1V1PA 2RBMA 4ZUJA 2NTTA 5F2DA 2QCPX 4K2LA 5HGTA 4ME5A 5EJWA 1LT6D 4BA1I 3VR2A 2IX1A 2B8FA 2NVYB 2B2WA 3OHXC 1JOKA 3IFTA 5G3LF 4HN7A 3SHLA 4TQUS 4R8NA 3EQLC 3PO2B 1XTCD 2B2UC 2YYZA 2WIIB 3PIO3 2F3WA 3K5OA 3V05A 2MJ8A 3NPPA 2BDOA 4K8JA 2HDLA 1TY2A 4QIWB 4K2KA 1PFMA 1TWFB 1D5XC 2ZXOA 4EVOA 2K33A 3G6JB 3A8JE 4RKLA 5LHY1 1EWHA 1B53A 4LK1C 2JA7B 3H6MA 2OXPA 2DY7A 2JXMB 3S14B 1C4QA 4XTCS 1WTPA 4RA8A 1FNUA 1EY6A 3GTKB 1RKNA 1EOTA 4F88A 4KY6A 3O13A 4IUTA 4FF1A 4FVMA 3OIQA 5G3LD 2DN8A 4HSVA 2BCOA 1LT5D 1PXUA 3NTIA 1STBA 2IT1A 3I90A 3FDTA 5I2YA 4R8IA 2J4XA 4K6DA 5DEHA 2XRSD 4QUCA 1S5CD 3VYSA 1SAPA 2KEDA 4IUNA 1QB5D 5IGCA 2Q8TA 4PMCA 3SE0A 3BDOA 4H7BA 3TP7A 1TWGB 4PMWA 2K7VA 2E2DC 3MXPA 4KJOA 3MC0B 3I72A 5EKKA 2XVSA 1QE6A 1PRTC 5M5XB 5EGTA 5DM73 1VF7A 3OWFA 4A93B 3Q24A 3MHBA 4MN3A 4BA2I 2KCCA 4G7OC 4OGQC 1CZGA 1XX8A 3J7AV 1JE4A 4Y7NB 2PPBC 1S5FD 1EY9A 2RQXA 1IW7C 2FMCA 2EYFA 5AFWA 2B2YA 3NUCA 5FLXE 1SYEA 3K5LA 3H94A 2EYHA 2HCIA 2PQEA 5I9OA 3FMCA 2R93B 4G4KA 5HURA 2B2WC 3FRPB 2A69C 4QUFA 4KY7A 4RH6A 2OT2A 4XT1B 1SDFA 2JP1A 1LTRD 3NK9A 3HOWB 3I73A 4A3DB 1V8QA 2EY2A 1TS3A 3PUXA 3KF8A 4XDXA 2O5IC 1TS5A 2F0QA 2JE6I 1SEBD 5J22A 2EYMA 3P7JA 1I4RA 1F2YA 5I6WA 4KN4C 2RDGA 4FP5D 4RCOA 3KLSA 2SOBA 1RCVD 2F0IA 4CGYB 2AWOA 3VR3A 3LWUA 3GTJB 1EIGA 1SNQA 1MGSA 3HOUB 1W6KA 2KEEA 1XWEA 4ZQ3A 1Z6HA 3GV3A 2AQ2B 4RKBA 2FJ2A 1I6VC 1J9OA 2A5HA 1ZKOA 2QEJC 1KNAA 1TY0A 1RD9D 2XWBB 2SDFA 2WV6D 3K5MA 1BF4A 1II3A 3QOJA 2KOLA 3IFDA 3BZDB 2F0SA 1RTOA 2B2TA 5FO9B 3R8BA 1SJED 4QCLA 5IT9L 4XQNA 1VMCA 2QDBA 2IPKD 2NUCA 5C0XH 1KLGD 4DAVA 3QOLA 1PYWD 2K6AA 2LY7A 2N88A 1D5MC 2G9DA 1DJRD 5J39A 5KYIA 1MD2D 2D62A 5E1FA 1ENAA 1SE3A 3HOXB 1EEFD 1Y8PB 2PW7A 4IALA 4RWSC 1PTOC 2KA7A 2XSCA 3K57A 3C3LA 4DAPA 1DZ1A 1CTMA 3CQZB 5CV9A 3IL8A 1F9PA 4RGMA 2A6HC 4IUQA 1ML0D 1JB3A 2XIWA 3D31A 3OIPA 4L8JA 4CJ2C 3NBIA 1I4GA 2VB3X 4S3SA 1GHJA 3QO2A 1SNDA 1X32A 1AN8A 4I65A 1O78A 1V1OA 1FNWA 1KAAA 1PMRA 1YNNC 3M7GA 1F77A 1X3PA 4XYOA 1KNEA 1B1ZA 2DY8A 3MEHA 1IYVA 1B9NA 2K1BA 1U4RA 4R9WA 1JR0D 3MXNA 4FF4A 2B2VA 1EL0A 1IW7D 5KEEA 1NSNS 1I4PA 4KTAA 1TKWB 5FO8B 3V96A 3C46A 2L12A 2EPBA 3M4OB 1EY4A 1DONA 5K36G 2A69D 4QB4A 3PUVA 5A2QE 3NQTA 4J6HA 3S16B 4TKOB 4WJWA 1I4QA 4IUPA 5I6YA 2BA1A 2K5DA 1C8CA 1VMPA 2AUJD 2F0UA 2FMMA 1HRJA 2KJXA 4B9XA 4DAYA 1EEID 1PTOF 1QCBD 2I46A 2V4DA 3KLRA 2A6EC 1SJHD 1STEA 2EYPA 4ID6A 1OXVA 3P1HA 4RHSA 3T13A 2Z4IA 1I6HB 4NW2A 3S17B 4K5WA 1HA6A 1BOSA 2KCNA 2E75C 3NSWA 5FLXL 4F87A 5KRUA 3SR1A 3L9AX 1ESFA 4DU9A 1CFMA 2R92B 3FPPA 5T1IA 3HG9A 1B3AA 1CK1A 1OXSC 4HAEA 4F7XA 1LTTD 1LACA 3BVMA 2MGSA 3VYRA 1CA5A 1VCIA 3LX0A 3CHBD 3HS0C 2H1EA 3K6OA 1SYCA 3X3MA 3NWSA 1E2VA 2F0WA 2F0FA 4H0LC 2EY1A 1ZYRC 4KV6A 1BBXC 2K01A 2BE5C 1K83B 2Z8LA 5I9PA 4DGZA 2IX3A 1EZ8A 1G91A 1KDCA 5IGDA 2G9HD 1O7LA 4K14A 4QMGA 2VB2X 4N9TA 1F2MA 2F0EA 4ILWA 1HUMA 4RCNA 5EQ0A 3K58A 2IL8A 2JSOA 1AEXA 3FEWX 3N52A 1EFID 2F0HA 1PTOD 4E6IA 2B39A 2EOTA 2EJGC 1GOZA 3GQBA 2MUYA 4HMIA 3KBXA 3CRKC 1NCVA 1LABA 1SNCA 3MAQA 3DHQA 2Q8IB 4LMQD 2A6HD 3I91A 1KABA 4OIKA 5C3WA 1TS4A 1L0XB 2JA8B 2SEBD 4OHJA 3MFYA 1BNZA 1PLFA 4X3KA 1ESRA 2F0VA 3H91A 4P2CB 2RDHA 2RKSA 1Q8IA 3BVZA 3QG1A 1E2ZA 1WVLA 3H0GB 1PTOB 1Z47A 3BG3A 2IW3A 2PO4A 2EYOA 2WINB 1HQMC 4MHEA 2RSNA 1SXTA 1YNND 3EFXD 1BO0A 3SK6A 3MTSA 2EYJA 4KD4A 2BOSA 4BY7B 2HUGA 4NDXA 3L3OC 2CHBD 1STNA 1V43A 4KN7C 5LL6X 2F0MA 2F0JA 1TT2A 4C3HB 5JPNC 4K8IA 3OOCA 3TBIB 4BY1B 1H9SB 3R2TA 4RAUC 2MHVA 5JEAH 2CVRA 2HQEA 1JWMD 2DNEA 1HPCA 5IODA 4LAAA 3LNNA 5D65A 2O2LD 3SDZA 3ZYYX 1TR5A 4RHRA 3K59A 5BN4A 5D3IB 4YIJA 3TP8A 1W6JA 2EZVA 3PO3B 4BBSB 3VR5A 1ICWA 1I50B 5IGEA 1K8MA 1DOMA 2X6LA 5IIFA 4Q0FA 5C0XI 1Y8NB 2NZ1D 1ENCA 1CHQD 1Y1VB 1A2TA 2GA4B 3KUPA 3OWEB 2A6ED 2F3VA 4A3GB 3NTHA 1JQYD 1RODA 1HFGA 1A6XA 1AP0A 4HR7B 3R2IA 2N55A 3TP6A 1EY0A 5M5WB 2E76C 3FKIB 5M3MB 2F0OA 5C4HA 2HCCA 3C2PA 2WAQB 1I4HA 4XQQA 3QWNA 3PMFA 3A8IE 1YNJD 5JJZA 1D2BA 2D5DA 1GXDC 2Q8RE 5NUCA 3TDQA 5C3EB 5CV4A 4KHVA 2F0NA 5A2QL 4IFDH 3I4MB 3T16A 5M5YB 1CZWA 1ZYRD 1PFNA 3A8KE 5C5MA 5CYUA 2BE5D 1EU4A 2F0KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EQP A;  5F2D A;  1SYB A;  1F2M A;  2ENB A;  5K5P A;  1STB A;  2F0E A;  3SK8 A;  3TME A;  1EYC A;  1A3V A;  1STA A;  2EY2 A;  3DMU A;  3NQT A;  4J6H A;  5IOC A;  2EY6 A;  4K2L A;  4K5V A;  5HGT A;  4K6D A;  3D4D A;  4ME5 A;  2HQE A;  5CV5 A;  5DEH A;  1AEX A;  1EYA A;  2F0H A;  4K5X A;  4ZUI A;  5DAU A;  5CGK A;  5I6Y A;  4HTH A;  2F0Q A;  4LAA A;  1EY8 A;  5IOD A;  5CV9 A;  3U9O A;  4NKL A;  5KYL A;  4KY5 A;  4E6I A;  1JOK A;  5CV7 A;  4IUN A;  4OL7 A;  5J22 A;  1JOO A;  2EYM A;  5IGC A;  2WAC A;  1TR5 A;  4PMC A;  2PZW A;  4ODG A;  1JOR A;  2EY5 A;  1F2Y A;  4H7B A;  4NMZ A;  2F0U A;  4EQN A;  3SHL A;  4HMI A;  5C4Z A;  5I6W A;  5ISR A;  3SXH A;  2PZU A;  1IHZ A;  2O4X A;  4R8N A;  1SNC A;  5C5L A;  2OF1 A;  3TP7 A;  4YIJ A;  3TP8 A;  5KIX A;  3C1F A;  3R3O A;  3MXP A;  2SOB A;  4KJO A;  2F0I A;  2M00 A;  3DHQ A;  4B9X A;  5CC4 A;  5EKK A;  3C1E A;  1KAB A;  4MIU A;  5C3W A;  5IGE A;  2F3W A;  1SNQ A;  1SYF A;  5CV6 A;  4WRD A;  2EYP A;  4ID6 A;  3P75 A;  1EQV A;  3P1H A;  5EKL A;  4K8J A;  4WOR A;  5EGT A;  2SNS A;  3T13 A;  5IIF A;  3OWF A;  4K2K A;  2PW5 A;  4QB4 A;  4ZQ3 A;  3MVV A;  3HEJ A;  1NUC A;  2F0G A;  2OEO A;  3OSO A;  4S3S A;  4K5W A;  4N9T A;  2F0V A;  4RKB A;  3TP5 A;  3VA5 A;  4EVO A;  1ENC A;  4F8M A;  3ERQ A;  4HMJ A;  4PNY A;  1A2T A;  1SND A;  3QB3 A;  4RKL A;  2F0T A;  3MHB A;  3ITP A;  2F3V A;  3NHH A;  3NXW A;  4I65 A;  2F0D A;  2RKS A;  5IGF A;  5KRU A;  1SYG A;  3SR1 A;  3OMC A;  4DFA A;  5C6A A;  5JAV A;  1KAA A;  1II3 A;  1SNO A;  3QOJ A;  4KD3 A;  1A3T A;  1STY A;  4DU9 A;  1EY7 A;  3ERO A;  1EYD A;  2F0S A;  2PZT A;  2PYK A;  3H6M A;  1EY0 A;  3TP6 A;  4F7X A;  2OXP A;  4G57 A;  1EZ6 A;  1A3U A;  4KJN A;  4TRD A;  2F0O A;  5C4H A;  1F2Z A;  2KQ3 A;  1SNM A;  3OMG A;  1EY9 A;  3D6C A;  4B9W A;  2EYO A;  3MEH A;  2QDB A;  3V2T A;  5M9O A;  2EYF A;  1U9R A;  1A2U A;  3MZ5 A;  3E5S A;  1KDB A;  3NUC A;  5J1Z A;  2NUC A;  4PMB A;  1JOQ A;  3PMF A;  3SK6 A;  3SK5 A;  2EYJ A;  3BDL A;  3LX0 A;  4EQO A;  1SYE A;  3D8G A;  3QOL A;  3S9W A;  2F0P A;  4KD4 A;  4NP5 A;  1SYC A;  3BDC A;  2EYH A;  2F0W A;  1KDA A;  4QF4 A;  2F0F A;  3EJI A;  5NUC A;  1TQO A;  2EY1 A;  5CV4 A;  5KEE A;  1NSN S;  3D4W A;  4KHV A;  2PQE A;  4KV6 A;  5IGG A;  5I9O A;  2F0N A;  1SNP A;  4NDX A;  3RUZ A;  3HZX A;  5C3X A;  5J39 A;  1EY5 A;  1STN A;  1EY6 A;  5KYI A;  1RKN A;  5HUR A;  4KTA A;  1SYD A;  2SNM A;  2F0M A;  2F0L A;  5I9P A;  5KGU A;  4IZ8 A;  2EYL A;  4DGZ A;  3EVQ A;  4KY6 A;  5JOB A;  3T16 A;  2F0J A;  5E1F A;  4N9P A;  1TT2 A;  4KY7 A;  5E3F A;  1EZ8 A;  1ENA A;  2PW7 A;  3NP8 A;  1KDC A;  1STG A;  4DF7 A;  3SK4 A;  4K8I A;  5C5M A;  1STH A;  5IGD A;  5IGB A;  4IAL A;  4K14 A;  4QMG A;  5CV8 A;  1EY4 A;  2KHS A;  2RBM A;  2RDF A;  2F0K A;  3NK9 A;  4J1M A;  5CR3 A;  2LKV A;  4ZUJ A;  2EXZ A; 
#chains in the Genus database with same CATH topology
 2IX0 A;  4BBR B;  4CBV A;  5BN5 A;  3VA7 A;  4A3C G;  4WJ4 A;  4LF7 Q;  4X64 L;  4JI6 L;  3SK8 A;  1V9P A;  2RHS B;  1S3O A;  2XNA C;  1A3V A;  1STA A;  2HHH Q;  2IWH A;  1NTG A;  3EA6 A;  4UP7 A;  4ZUI A;  1KAW A;  1N34 L;  2E2J B;  3J80 c;  4OWX B;  1W3S A;  3PGZ A;  4X66 Q;  1X9N A;  3BZK A;  4A3B B;  4XQJ A;  2K14 A;  1DOL A;  1JOR A;  1EIF A;  2NB0 A;  3H3V C;  3TEH B;  5KND A;  5ISR A;  4LF9 Q;  2KEN A;  4IPH A;  2OQK A;  4DV7 Q;  3D4R A;  4NXN L;  3S1N B;  4O1N A;  5CBA E;  1EU3 A;  2Z4H A;  5IYB H;  2ICI A;  3FKI G;  5M3M G;  4UAI A;  1SYF A;  3PUY A;  3GTG B;  3J7A F;  3I4N B;  4POF A;  3STB C;  4K0K Q;  4IO9 A;  2NVT H;  2WAQ G;  1PYS B;  1XPR A;  3B6Y A;  2N49 A;  3OSO A;  3TP5 A;  3W3A A;  4FYD A;  3P20 A;  1RJT A;  4JI8 L;  4GLA C;  3ITP A;  3NHH A;  2WB1 B;  4L5R C;  3S2D B;  5C3E G;  2PI2 E;  1GD7 A;  1JIC A;  1WCM B;  1GUS A;  1I3Q B;  3T53 B;  4ZRZ A;  4C56 C;  4IUR A;  1FYC A;  1Z7T A;  4JI0 Q;  4C1N K;  1B7Y B;  3J80 L;  2G5D A;  3G7L A;  4QGU A;  4HED A;  3V2T A;  2RHQ B;  3GTO H;  1U9R A;  1A2U A;  4C3J B;  2I07 B;  3PUZ A;  3KFU A;  4G7H C;  1ICF B;  4ZCK A;  2KUM A;  1XMQ L;  3CCJ A;  4LF6 Q;  3DWA A;  1WTH A;  1VQB A;  1CQF A;  1QVG A;  3PUW A;  1A63 A;  2WKD A;  2AUK A;  2R93 G;  1U5K A;  2YU9 B;  1EY5 A;  5E4X A;  2I5L X;  1SYD A;  2ICE C;  4ZYS A;  5KGU A;  2NVY H;  1JC7 A;  5ELD A;  1BQQ T;  4GZY C;  5E3F A;  4A3B G;  1IBK L;  2UXC L;  4HCE A;  1PRT F;  5EPJ A;  2A73 B;  1STH A;  2A68 C;  4V19 0;  3T56 B;  3HOW G;  3PO2 H;  2KHS A;  1WOC A;  2KBN A;  3OYY A;  3W1B A;  4AYB E;  1UEB A;  3VYU A;  4A3D G;  2K03 A;  1Y14 B;  4LFC L;  3CKI B;  1WTQ A;  4EGV A;  4POG A;  1D7Q A;  3E6Z X;  3J7Z C;  3RN5 A;  3BVG A;  1EYA A;  1Y69 U;  3KK7 A;  5C4X B;  1H9K A;  4HTH A;  4KKT A;  4DN4 M;  1TWF H;  2ZXP A;  4PZ8 A;  3OTO Q;  3S15 B;  4H44 C;  2WAC A;  4ODG A;  2FFK B;  4CDE C;  2OWO A;  1BCP C;  3KLS X;  3SXH A;  2L55 A;  2ZT9 C;  5IWA Q;  3A54 A;  3D3R A;  3C1F A;  2DUD A;  1M4V A;  2JA7 H;  2K5W A;  5IP7 G;  4JV5 L;  3RLF A;  1X3Q A;  2L9H A;  4JVZ A;  1K8G A;  1TWA B;  2UXD L;  2N78 A;  4WOR A;  4C3J G;  3S14 H;  2KCM A;  1R9T B;  1E7Z A;  1DXM A;  4HMJ A;  4A4I A;  2A74 C;  2Z6K C;  2DNC A;  2M2L A;  3CCR A;  3M7N A;  3DXJ C;  4I7Z C;  1PZK D;  2JYO A;  2XWJ B;  4P71 A;  4KD3 A;  4LF5 Q;  4NB3 A;  4B3M Q;  2PZT A;  1CA6 A;  3GTK H;  3A5U A;  3DM3 A;  4ZLT F;  4TRD A;  4YHH L;  2KQ3 A;  3OMG A;  5LL6 S;  4KHP Q;  3PV0 A;  2B2Y C;  3DWQ A;  3K5N A;  1GUG A;  4CKC A;  2D9U A;  1KDB A;  2R3Z A;  4R4Q A;  4FXG C;  1NR4 A;  1T5X D;  4OO1 I;  4EQO A;  1PRT D;  3S9W A;  4L63 B;  3HOY B;  2PMZ E;  5FO7 B;  1KDA A;  2CKZ B;  4FF3 A;  4U68 A;  1YEZ A;  3K7U C;  3ZJY C;  1AE3 A;  1GUW A;  3Q22 A;  1F9S A;  1Q12 A;  3HZX A;  5C3X A;  5C4X G;  1DOK A;  1JWU D;  4JCV E;  1PH6 A;  4IZ8 A;  4DXG A;  5FOB B;  1QUQ B;  2NN6 G;  2VUM B;  3HOX G;  3DEP A;  5EAY A;  3MWY W;  1NNX A;  2K5Q A;  1TWG H;  5CV8 A;  2LKV A;  3ND8 A;  5ELB A;  3W5O A;  1EYC A;  1BR9 A;  1VQA A;  3OW2 A;  4DR6 L;  2AQ1 B;  3RZD B;  5M5X H;  3U9O A;  4DV6 Q;  3LGJ A;  2PNR C;  1SN8 A;  1HA5 A;  4A93 H;  1O7Y A;  4DUZ Q;  1TVX A;  4EX5 A;  3DUZ A;  4CJ0 B;  1PRT B;  2O4X A;  1XXG A;  4CKB A;  1CKN A;  1ILQ A;  4L5T A;  1N36 Q;  5EBC A;  2B2U A;  1U4M A;  4WJ3 M;  2VNU D;  1U4L A;  1X6O A;  1B50 A;  4IN3 A;  1L0Y B;  2RVL A;  4FO2 A;  4O42 A;  3DEO A;  3S2H B;  1NAP A;  3RD4 A;  3KDF A;  4RMF A;  4X3T A;  4GN5 A;  2XRQ D;  5E4W C;  1B70 B;  4R1J A;  3HEJ A;  3K0Y A;  4XIG S;  4PG3 A;  4FDB A;  1Q1B A;  4H13 C;  2F0T A;  4X65 L;  4PV1 C;  2JN4 A;  2EDG A;  1DYQ A;  3STB D;  4KHZ A;  5C6A A;  5JAV A;  1BCP F;  1JWS D;  2B2T C;  2EQS A;  3PIP 3;  2R93 H;  1V1P B;  3J7A 5;  3K80 C;  3ND9 A;  5DNF A;  1A3U A;  1QG7 A;  3CPF A;  5COY A;  1F2Z A;  1LYL A;  4LFB Q;  1ENF A;  1T9H A;  3URY A;  1XPU A;  4XYQ A;  4RGN A;  1IKL A;  2H4O A;  2NTS A;  1QWY A;  3HOW H;  1AW7 A;  4JBW A;  2F0P A;  5COR A;  1D5Z C;  2VQE L;  5LMU Q;  2NVQ B;  1QZH A;  2F3I A;  1IZ6 A;  4QF4 A;  3EJI A;  1B4O A;  1VQ9 A;  1F2L A;  4R4C A;  1G29 1;  3E0J A;  3BJU A;  5AJ3 Q;  4IPC A;  1YHQ A;  2UUC Q;  2O5J C;  1N32 L;  3EVQ A;  2PQA A;  2Y0S E;  1F9R A;  5T1G A;  5JVG 3;  1HXY D;  2ZXR A;  2L5T A;  1CM9 A;  3KF6 B;  4MNO A;  2DJG C;  3VDY A;  2YTV A;  1EFW A;  1EQR A;  4CDC C;  4A3M B;  1AZQ A;  4CHT B;  3TME A;  1PZI D;  4A3J B;  1T5E A;  3ER0 A;  1FVI A;  5CBE E;  4DR1 L;  3GTJ H;  2A68 D;  3NE5 B;  1N33 Q;  2E5L Q;  3HOU H;  5IYD G;  3J80 E;  1XYI A;  3CRL C;  5CGK A;  5KYL A;  2VY3 A;  3BZC A;  3BS1 A;  1TU2 B;  4JBK A;  5EPL A;  1YIJ A;  1B3Q A;  2NWG A;  2B3G A;  1SE8 A;  3E3X A;  5FLM G;  4LF4 L;  1LTI D;  4IUU A;  2CW0 C;  3SGI A;  1WTX A;  1ET6 A;  1WD1 A;  2M9V A;  4ZKB B;  1BBU A;  1X3E A;  4FF2 A;  2X6G A;  3HP3 A;  3M4Q A;  2Q2I A;  2QDL A;  4KKU A;  3CPW A;  2JA5 H;  1DCZ A;  1BCP D;  3IRB A;  1SFO B;  4TSS A;  2ZJQ A;  3ERS X;  1HCZ A;  1UE7 A;  3FHW A;  1GUO A;  2F0G A;  1M8A A;  4RFB A;  3VA5 A;  2UU9 L;  1HTL D;  3ERQ A;  1CUK A;  2X69 A;  1NR2 A;  3K0X A;  2L15 A;  1VF5 C;  4BXX H;  3FP9 A;  1VQL A;  2F4V Q;  1FD7 D;  1XNQ L;  4JI5 L;  4CDF C;  3VR6 A;  4QIW E;  1PH8 A;  2R92 G;  4ZKC B;  3HOV B;  1MIU A;  1UE6 A;  4IFD I;  1FGB D;  1PFB A;  5HGQ A;  3HRZ C;  4ALP A;  1QNK A;  2AWN A;  4DV0 L;  2NN6 H;  4DR3 Q;  2EIF A;  4A3M G;  3N6R A;  4C3I B;  2B2V C;  4NP5 A;  4A3J G;  1VS0 A;  4PQX A;  1E0B A;  2KEC A;  1AFP A;  1L1O A;  5IP9 G;  2R6G A;  4JC0 A;  2XN9 C;  2N3S A;  1SNP A;  1BCP B;  4QQB X;  2K4K A;  3CQZ H;  1PZJ D;  1QNU A;  3MFG A;  4HIM A;  3TS2 A;  1GHK A;  3KYH C;  2LFN A;  2I5M X;  3PCO B;  1KRT A;  2CQA A;  3J7Y W;  3J80 i;  1ILP A;  3QR8 A;  3AMU A;  3D0F A;  5IGB A;  3RLN A;  4NXM L;  4V0B A;  3S24 A;  4LW1 A;  1LLR D;  5CR3 A;  2RDF A;  1UNS A;  5DLQ E;  1P16 A;  3TZD A;  5K36 H;  2EXZ A;  2F1M A;  1GVP A;  1L0W A;  3TSS A;  4B3T Q;  1OTC A;  4K5V A;  5CV5 A;  1Q3L A;  4B3R Q;  4IOA A;  4K5X A;  3TN2 A;  3CCQ A;  4DR2 L;  1OXT A;  3UDF A;  4KY5 A;  4GOP A;  1TWH H;  2K32 A;  3NBH A;  3Q6S A;  1KXL A;  3TZU A;  3J81 j;  3I3C A;  5C0X J;  1F9Q A;  4EQN A;  3RMH A;  2Z1C A;  3R3O A;  2EJM A;  1G8Z D;  2VQF L;  4DK3 C;  3HOV G;  3JAM c;  4KMU C;  2CQO A;  2E74 C;  1HUN A;  4DK1 A;  5GAH C;  3MXU A;  4MIU A;  2K75 A;  1IL8 A;  5IE8 A;  1JT8 A;  3GP7 A;  2JA8 G;  1VDZ A;  2SNS A;  1KQS A;  2PCF B;  1X56 A;  1TWC B;  3MVV A;  3VR4 A;  2RA4 A;  1S5E D;  1NUC A;  5GQO A;  1PH9 A;  1VQ7 A;  1I94 L;  1EWI A;  3PIP A;  4C3I G;  2UXB Q;  1LTA D;  1A15 A;  4R4I A;  2F0D A;  1SMY C;  5DM6 3;  3F2U A;  1D1I A;  1Y8O B;  4YWL A;  1PFS A;  1OO9 B;  2L1B A;  3DM1 A;  5KNC A;  3AEV A;  4DV4 L;  4KJN A;  3M3Y B;  2R7Z B;  1UUP A;  4JYA Q;  3D6C A;  3IAY A;  1PDQ A;  4DXF A;  1Y1W H;  3X3N A;  2UUB L;  3MZ5 A;  3GD7 A;  5D3D A;  3KJP A;  1CHP D;  5C0X G;  3RZO B;  1JOQ A;  1DM0 B;  2XGT A;  1Q46 A;  2C9O A;  2K04 A;  3K7A B;  4DR5 Q;  3PF4 A;  1VQ6 A;  4HCS A;  4IJL A;  4Y52 H;  3JAM L;  2K05 A;  1RTN A;  3S16 H;  1LT4 D;  1GM5 A;  3RUZ A;  1WTR A;  1E2W A;  1QOH A;  1SE4 A;  1HQR D;  2MFI A;  1LO5 D;  5JPM C;  3GTL B;  3GTQ B;  5ELE A;  1RF2 D;  3T4A C;  4C3H G;  4WFN 3;  4DV2 Q;  2D2C C;  4DR7 Q;  2D0O A;  2IJ0 A;  3UI2 A;  3CC2 A;  4LF8 L;  5KNB A;  5IOC A;  2EY6 A;  2NBF A;  5BR8 Q;  2HD3 A;  1S40 A;  2ID0 A;  1B9M A;  4A3I B;  3S17 H;  1JOO A;  2E2H B;  2PZW A;  2FXQ A;  1GUN A;  1EYG A;  3CP0 A;  3WDN A;  1IHZ A;  4DUY Q;  2MO0 A;  4X64 Q;  3I8Z A;  1IBM Q;  4JI6 Q;  1H9M A;  2R92 H;  3S1M B;  2E8G A;  1PYB A;  3NEM A;  1S5D D;  3W2D A;  3J81 E;  1W2B A;  1O7I A;  4OX9 L;  2R7Z G;  2CW0 D;  1EQV A;  4RGT A;  1H9S A;  4GKK Q;  4OWW B;  2E2I B;  4K6L A;  1Y1V G;  4JI3 L;  4A3G G;  1O7Z A;  4H02 A;  1EOV A;  3FPU B;  3QIA A;  4KKS A;  1L1O C;  2JK8 A;  1OXX K;  1SRO A;  2RSO A;  1D6E C;  4DFA A;  3TS0 A;  4JBM A;  1UEA B;  2FHT A;  5IP9 H;  1MI2 A;  2HHH L;  2CH4 W;  2JA6 B;  5C4J H;  1A3T A;  2IHE A;  4UP9 A;  3ERO A;  4XXE A;  5LMN L;  1X65 A;  3M4Y A;  1K8O A;  1LTS D;  1IYJ B;  1EZ6 A;  4X66 L;  1SNM A;  3JC6 6;  4C1N I;  1HTP A;  4JI4 L;  4HJ8 A;  4JI8 Q;  3BDL A;  3GTP B;  2F03 A;  2HDM A;  1EIH A;  1S5B D;  1M1K C;  4X62 L;  1YVC A;  1WD0 A;  3AYH B;  2BA0 A;  3Q0A A;  1TQO A;  3HKZ B;  4JG2 A;  4LUZ A;  1RDP D;  4K0K L;  3I4M G;  1HNX L;  4A3I G;  1VQE A;  1NMG A;  2L0C A;  5HY6 A;  4N9P A;  5IYC H;  1A0I A;  1G6Z A;  3A55 A;  1M90 C;  4J1M A;  4QL5 A;  4BBR G;  5JJK A;  1LTB D;  1BUV T;  2AQ3 B;  5M9O A;  1XMQ Q;  1KTK A;  1SYB A;  3H09 A;  4LJZ C;  3DWP A;  3DMU A;  4MZ9 A;  1J8I A;  2LSS A;  3IKJ A;  4UHV A;  1NBW A;  2LS0 1;  2ZTC A;  5BN3 A;  1EY8 A;  4NKL A;  3U4V A;  2ZJP A;  1LT3 D;  1Q1E A;  4GN3 B;  1VQI A;  3J81 i;  5CV7 A;  1IXR A;  1IBK Q;  2UXC Q;  4YCU A;  1ZEQ X;  2EY5 A;  4A3L H;  4Z9C B;  1CQV A;  1ET9 A;  2PZU A;  3NWT A;  4LF6 L;  1IKM A;  1HFN A;  1LV9 A;  2KVM A;  5C44 B;  1G2S A;  4G7Z C;  2JA6 G;  1WTW A;  1GKH A;  1UE5 A;  4L6T B;  1HZA A;  4GNX A;  3TRE A;  3S1R B;  3SVM A;  3H0G H;  4X3U A;  1Q7Y C;  5CMD A;  2JA5 B;  3MXN B;  1JE5 A;  1PTO H;  1WYD A;  1E1T A;  1KHI A;  3I4N G;  5CV6 A;  5M3F B;  1VQ8 A;  4WRD A;  3LWE A;  3P75 A;  1IYU A;  3VYT A;  4M1U B;  1GUT A;  1HNW L;  4C2M B;  3QJY A;  2EJF C;  5ELF A;  1D1K A;  1MBY A;  4HIK A;  3ULP A;  1WTO A;  4FXK C;  1SSO A;  2WB1 G;  1EQT A;  5I2X A;  2NVX B;  2F4I A;  3HKZ G;  2FIN B;  3OMC A;  3CCE A;  4BY7 H;  1WCM G;  1SNO A;  1VQG A;  5EBD A;  4JV5 Q;  4ZK9 B;  1KD1 C;  4APV A;  4DK0 A;  2RCF A;  1YJW A;  1SMY D;  2UXD Q;  3D6W A;  2TSS A;  4RG1 A;  3MEF A;  3GTM B;  1O80 A;  1XTD A;  1VQD A;  1BXT A;  3ULL A;  4BY1 H;  4JK1 C;  4JI7 L;  5JJL A;  2D0P A;  5IWA L;  4IPD A;  1EWC A;  1RHP A;  4DNT B;  4XT3 B;  1LTG D;  3BDC A;  3CF5 A;  4DV3 Q;  4O2D A;  1H9J A;  2A1A A;  1JCK B;  3D4W A;  1DD2 A;  1Q8K A;  1SBB B;  4AYB B;  2F0L A;  4DAY B;  1AZP A;  4ULL A;  4YHH Q;  4UDU C;  4DA2 A;  2R61 A;  1G2T A;  2C5C A;  1I4X A;  5FJ8 G;  1H9R A;  3M85 A;  1STG A;  5EKI A;  2LMC B;  2PNH A;  3RN2 A;  5JVH 3;  5C44 G;  3PO3 H;  4BBS H;  4OO1 G;  2WP8 J;  2QKI C;  4A3C H;  1SE2 A;  4LF5 L;  1I50 H;  4J8Q A;  1FR3 A;  4JI2 Q;  1CKO A;  4LUV A;  4ABN A;  5M3F G;  4A3E B;  4X3S A;  1HZB A;  1JJC B;  5DAU A;  3HOZ B;  5A35 A;  1CT1 D;  4OL7 A;  1TWH B;  2K28 A;  1Y1V H;  3L2P A;  4DNR B;  4A3G H;  3PF5 A;  4LWC A;  2PQA B;  5C5L A;  1UAP A;  5KIX A;  1U4P A;  3JAM E;  2ES2 A;  4A3K B;  3CU7 A;  3PSI A;  2L11 A;  2M00 A;  3KBG A;  2A8V A;  4HIO A;  5CC4 A;  3C1E A;  2MPM A;  5M5W H;  3GV6 A;  3S1Q B;  3FKI H;  5M3M H;  2NN6 I;  4PZ7 A;  3AB9 A;  2JEB I;  3GO5 A;  5LMN W;  4KI0 A;  3AU7 A;  2HT1 A;  4M8A A;  3OPO A;  2OEO A;  1C48 A;  4A3F B;  3MXG A;  4PNY A;  1FNV A;  1C0A A;  5H1S E;  5IGF A;  1XMO L;  1SYG A;  2Z0S A;  1S4Z A;  5C3E H;  1KRS A;  2MP1 A;  3HGB A;  3A5Z B;  1EY7 A;  5JEA J;  1EYD A;  4HSP A;  2PYK A;  4Y7N H;  2EVB A;  3UDX A;  2QIL A;  3I4M H;  2PMZ B;  4G57 A;  1ZXT A;  4CDD C;  3J81 c;  1FGU A;  5M5Y H;  1Y1W B;  2TMP A;  4DUZ L;  1XNR L;  4RGO S;  5J1Z A;  3E5S A;  4IQZ A;  1ASY A;  4PMB A;  4B08 A;  3SEB A;  3D8G A;  1MSG A;  1UE1 A;  3WOF A;  3TQY A;  1PV4 A;  3HOY G;  3MA2 B;  1IBL Q;  3NQI A;  1K0R A;  2NYZ D;  2Z9H A;  5IGG A;  4OON A;  1P8L A;  1HJP A;  3I56 A;  4A3E G;  2E2J H;  4IUV A;  2SNM A;  2ZM6 L;  2B8G A;  2EYL A;  2HQL A;  5JOB A;  1ONL A;  2VUM G;  3BYY B;  5GRO A;  4R4O A;  4A3B H;  3I70 A;  1WTV A;  3NP8 A;  1KC8 C;  4DF7 A;  3SK4 A;  3BYT B;  4P75 A;  4A3K G;  4QY7 A;  4EQP A;  3ONA B;  2ENB A;  5K5P A;  2J0T D;  4OIJ A;  3U9S A;  2IHF A;  3S1N H;  4A3D H;  1KLU D;  2BDN A;  5JEA G;  3JAM i;  3D4D A;  3GTG H;  3I4N H;  1L1O B;  4GLV B;  4IPG A;  3E0E A;  3J81 L;  1QIL A;  4LFB L;  4LFA Q;  3WWV A;  4A3F G;  1Q90 A;  4JI1 L;  2J7Z A;  1QJO A;  3I4O A;  5FK9 C;  1R4P B;  4NMZ A;  1MSH A;  5C4Z A;  3R93 A;  1LM0 A;  2OF1 A;  2B63 B;  4DR4 Q;  1TS2 A;  4L5Q A;  3A7A B;  1WCM H;  1I3Q H;  5IP7 H;  1K3R A;  2JEA I;  1B44 D;  3KLW A;  3A56 A;  1FJG L;  1YNJ C;  4IFD J;  4CKE A;  4FNF A;  1TII D;  5EKL A;  3CCM A;  1PVO A;  1MHW C;  1A62 A;  2PW5 A;  5FKA C;  4B3S Q;  4C3J H;  4ZAI A;  3L7Z C;  3WOE A;  4F8M A;  1BVS A;  1GJX A;  1BDO A;  1HR0 L;  4FXD A;  3QB3 A;  2CWA A;  3I4L A;  3NXW A;  3A7L A;  4LF4 Q;  4KK7 A;  3FVQ A;  2QW7 A;  3L0O A;  4CJ1 B;  4KHP L;  5TSS A;  4BS9 A;  3W1G A;  1S72 A;  5D14 A;  1OXU A;  4BWG B;  1STY A;  5C4J B;  2VXW A;  2ZTE A;  3PQI A;  2QF7 A;  2E5L L;  1MJE A;  4AQY Q;  2YU9 H;  3OW7 A;  2WKC A;  1EIY B;  3Q23 A;  5I4D A;  4B9W A;  2NVT B;  1RL2 A;  5EPK A;  5FJ8 H;  1R4Q B;  2C35 B;  5ELC A;  4N8X 1;  3SK5 A;  4UY8 C;  3CD6 A;  4U67 3;  4OO1 H;  1EUJ A;  4HJ9 A;  2Y0S B;  1HHV A;  1XNQ Q;  4YWK A;  5GAD C;  5IY0 A;  2ZJR A;  5IT9 E;  4IFD G;  3NEN A;  5C4X H;  3S15 H;  1B2T A;  1CI3 M;  4Q5V A;  1KIX A;  4YCW A;  4HID A;  3HOX H;  3GTO B;  2L4N A;  5GAG C;  3NTK A;  3T51 B;  2EE1 A;  2LXJ A;  1V1P A;  2RBM A;  4ZUJ A;  2NTT A;  5F2D A;  1JJG A;  4DK6 C;  2HIX A;  2QCP X;  1PHJ A;  4K2L A;  5HGT A;  4ME5 A;  4O0A A;  1KL9 A;  5EJW A;  1LT6 D;  1TWA H;  4BA1 I;  3VR2 A;  4DR3 L;  2IX1 A;  2R7F A;  2B8F A;  2NVY B;  2B2W A;  1R9T H;  3OHX C;  1JOK A;  3IFT A;  4L5S A;  3HKS A;  5G3L F;  4HN7 A;  3UDG A;  2MNA A;  1YNX A;  1B8A A;  2AMC B;  3SHL A;  4TQU S;  4R8N A;  1TXY A;  1MKH A;  3EQL C;  1XTC D;  2B2U C;  4DV1 Q;  3PO2 B;  2YYZ A;  2UUA Q;  3M9B A;  5IYB G;  2WII B;  3PIO 3;  1K73 C;  4DV5 Q;  2MQH A;  2F3W A;  1PH7 A;  3K5O A;  3V05 A;  2MJ8 A;  3G4S A;  4DR2 Q;  3NPP A;  4IOC A;  2BDO A;  4K8J A;  1SRU A;  1TY2 A;  2HDL A;  4QIW B;  4K2K A;  1PFM A;  1TWF B;  1D5X C;  2V1C C;  3CME A;  2ZXO A;  4EVO A;  2K33 A;  2JQO A;  3A8J E;  3G6J B;  4RKL A;  4P74 A;  3HOY H;  2Y0S G;  5LHY 1;  1CSP A;  1EWH A;  1G51 A;  3H15 A;  1B53 A;  4LK1 C;  2JA7 B;  2YTX A;  3H6M A;  2OXP A;  2DY7 A;  2JXM B;  1SLJ A;  2VUM H;  3S14 B;  1C4Q A;  1CKM A;  3UE0 A;  1I94 Q;  4A75 A;  1GO3 E;  2QEX A;  1YJN A;  4XTC S;  3GDE A;  2WAQ E;  1WTP A;  3RZD H;  4RA8 A;  1FNU A;  1EY6 A;  3GTK B;  1RKN A;  1EOT A;  3T1Y L;  4F88 A;  4KY6 A;  1YIT A;  3O13 A;  4IUT A;  4FF1 A;  2UUB Q;  2K5N A;  1JB7 A;  4FVM A;  3U50 C;  3OIQ A;  3M4O H;  5ELO A;  5G3L D;  2DN8 A;  4MTK A;  4GKJ L;  2BCO A;  1LT5 D;  1PXU A;  4HSV A;  3NTI A;  2NZH A;  1STB A;  2IT1 A;  3I90 A;  3FDT A;  5I2Y A;  4R8I A;  2J4X A;  4K6D A;  3S2H H;  5DEH A;  2XRS D;  4QUC A;  5IYD H;  1XPO A;  1S5C D;  4J15 A;  3VYS A;  1SAP A;  1N8R C;  2KED A;  4IUN A;  3G48 A;  1QB5 D;  5IGC A;  2Q8T A;  4PMC A;  3SE0 A;  3BDO A;  4H7B A;  5FLM H;  2N8N A;  3TP7 A;  1TWG B;  2OTL A;  4PMW A;  2K7V A;  2JA7 G;  2E2D C;  3MXP A;  1HNZ L;  4KJO A;  1HR0 W;  3MC0 B;  3I72 A;  4YY3 Q;  5EKK A;  2XVS A;  1QE6 A;  4X6A H;  2OTJ A;  1PRT C;  1J5E Q;  4QJF A;  5M5X B;  5EGT A;  5DM7 3;  1VF7 A;  3OWF A;  1I6H H;  3EBE A;  4DV2 L;  1HH2 P;  5JJI A;  4A93 B;  4HJA A;  2VW9 A;  3Q24 A;  4DR7 L;  3MHB A;  4MN3 A;  4BA2 I;  2KCC A;  3T1H Q;  2NVQ H;  2Z6K A;  4G7O C;  4OGQ C;  4GS3 A;  4NPS A;  3F1Z A;  1CZG A;  2F52 A;  3CC7 A;  1FL0 A;  2GVA A;  1XX8 A;  3H3V H;  4DNI A;  5BR8 L;  3J7A V;  1JE4 A;  3CCL A;  1JMC A;  4Y7N B;  2PPB C;  1S5F D;  4OX9 Q;  5E7N A;  4DPG A;  1EY9 A;  1N34 Q;  1E3P A;  1NMF A;  2RQX A;  1IW7 C;  2FMC A;  2EYF A;  3AQQ A;  5AFW A;  2B2Y A;  3NUC A;  4UP8 A;  5FLX E;  4HJ5 A;  4JI3 Q;  4A3M H;  1SYE A;  3K5L A;  3H94 A;  3CCS A;  4A3J H;  1G6P A;  2EYH A;  1PA6 A;  1IBM L;  4LF7 L;  2HCI A;  2PQE A;  1L2F A;  4NXN Q;  5I9O A;  3FMC A;  2R93 B;  4G4K A;  5LMN Q;  1K83 H;  5HUR A;  2B2W C;  4GKK L;  3FRP B;  2A69 C;  4QUF A;  4KY7 A;  4RH6 A;  3NEL A;  2OT2 A;  4JI4 Q;  4XT1 B;  4LF9 L;  1SDF A;  1YI2 A;  2JP1 A;  1LTR D;  3NK9 A;  2QA4 A;  3HOW B;  4X62 Q;  3I73 A;  4DV7 L;  4A3D B;  1V8Q A;  2EY2 A;  2EXD A;  1TS3 A;  3PUX A;  3KF8 A;  4XDX A;  2O5I C;  1TS5 A;  1SFO H;  1HNX Q;  2F0Q A;  2JE6 I;  4GOP C;  5IT9 c;  1SEB D;  2RF4 A;  5J22 A;  2EYM A;  3P7J A;  1I4R A;  3KJO A;  4A93 G;  1X3F A;  3PIO A;  1F2Y A;  5I6W A;  4KN4 C;  2RDG A;  4FP5 D;  4RCO A;  3KLS A;  2SOB A;  1RCV D;  2F0I A;  4CGY B;  3HOV H;  2AWO A;  3RLO A;  2Q2T A;  4AIM A;  3VR3 A;  3LWU A;  4JI0 L;  3GTJ B;  1EIG A;  1Z9F A;  1SNQ A;  1MGS A;  5J3B A;  3HOU B;  1W6K A;  1RIP A;  4OEL B;  3Q8D A;  2KEE A;  1Q82 C;  2JA8 H;  1XWE A;  4ZQ3 A;  1PH2 A;  4A76 A;  1Z6H A;  3GV3 A;  2AQ2 B;  4RKB A;  2FJ2 A;  1YJ9 A;  3DLL A;  1I6V C;  1J9O A;  1YHB A;  1ZKO A;  2A5H A;  2QEJ C;  1KNA A;  1TY0 A;  4C3I H;  1RD9 D;  3AFQ A;  1VQH A;  2XWB B;  2SDF A;  2WV6 D;  2Z6B A;  3K5M A;  1BF4 A;  1II3 A;  3QOJ A;  3F2D A;  2KOL A;  3I7F A;  3IFD A;  3BZD B;  2CFM A;  4LFC Q;  2F0S A;  1RTO A;  2B2T A;  5FO9 B;  3R8B A;  1SJE D;  4EQ5 A;  4DAM A;  4QCL A;  3K8A A;  5IT9 L;  4XQN A;  1VMC A;  1HNW Q;  2QDB A;  2IPK D;  2NUC A;  2DJF C;  5C0X H;  1KLG D;  1K28 A;  4DAV A;  3QOL A;  1PYW D;  2K6A A;  4IJH A;  2LY7 A;  2N88 A;  1D5M C;  1H95 A;  2G9D A;  4JW0 A;  1DJR D;  4P72 A;  5J39 A;  1CKN B;  2AHO B;  5KYI A;  1NY4 A;  1MD2 D;  1PH4 A;  2D62 A;  3OTO L;  5E1F A;  3U58 A;  1ENA A;  3F2C A;  1SE3 A;  3HOX B;  1EEF D;  1Y8P B;  2PW7 A;  4C3H H;  4IAL A;  2P5Z X;  3KDF B;  4JI7 Q;  4RWS C;  1PTO C;  1E1O A;  2KA7 A;  2XSC A;  4JOI A;  1X54 A;  1JJ2 A;  3K57 A;  3C3L A;  4DAP A;  1DZ1 A;  3CW2 C;  3HOU G;  1HZC A;  1CTM A;  3CQZ B;  3CAM A;  5CV9 A;  3IL8 A;  1TWC H;  1F9P A;  2MO1 A;  4RGM A;  1VQN A;  2A6H C;  3EN2 A;  4IUQ A;  1ML0 D;  2HIV A;  1JB3 A;  2XIW A;  4GN4 B;  4DV3 L;  1IL2 A;  3D31 A;  3OIP A;  4L8J A;  1DGS A;  1WFQ A;  4CJ2 C;  4B3M L;  1V1Q A;  2JA5 G;  3NBI A;  1BKB A;  1NJI C;  3M3Y H;  2R7Z H;  1I4G A;  3AFP A;  2VB3 X;  4JBJ A;  4N8F A;  1PH3 A;  4S3S A;  1GHJ A;  3RZO H;  3CC4 A;  3QO2 A;  1SND A;  1X32 A;  3K7A H;  1AN8 A;  4BXX G;  4I65 A;  1O78 A;  1V1O A;  1E22 A;  1FNW A;  1KAA A;  4AH6 A;  1PMR A;  1YNN C;  3M7G A;  4JI2 L;  1F77 A;  1X3P A;  4OXP A;  4XYO A;  2CWP A;  4DR6 Q;  2H5X A;  1KNE A;  2Q2H A;  1B1Z A;  3GTL H;  2DY8 A;  3GTQ H;  1N9W A;  3MEH A;  1IYV A;  1SMX A;  1B9N A;  2K1B A;  1U4R A;  4R9W A;  1JR0 D;  3MXN A;  4FF4 A;  1XMO Q;  2B2V A;  1EL0 A;  4R4T A;  2PI2 A;  1IW7 D;  1K0S A;  5KEE A;  1K8A C;  1NSN S;  1I4P A;  2WFW A;  1C7Y A;  1VQ4 A;  3I2Z A;  4AYB G;  3RNU A;  4KTA A;  1TKW B;  5FO8 B;  3TRZ A;  4A3I H;  4DV6 L;  2E2H H;  3V96 A;  1VQC A;  1XNR Q;  1PH5 A;  3C46 A;  2L12 A;  2EPB A;  3M4O B;  1EY4 A;  1DON A;  5K36 G;  2YV5 A;  5FLX c;  4X65 Q;  3CCU A;  1N36 L;  2A69 D;  4QB4 A;  4BBR H;  1XJV A;  2ATW A;  3PUV A;  3S1M H;  5A2Q E;  3NQT A;  4J6H A;  3S16 B;  4TKO B;  4WJW A;  1I4Q A;  4IUP A;  3HOZ G;  5I6Y A;  2BA1 A;  2K5D A;  1C8C A;  2ZM6 Q;  2E2I H;  2NZO A;  1VMP A;  2AUJ D;  2CH4 A;  3CCV A;  2F0U A;  2FMM A;  1IBL L;  1HRJ A;  2KJX A;  1YHA A;  2R7D A;  5L37 A;  4B9X A;  4DAY A;  2VQE Q;  4GNX C;  2JA6 H;  4YWM A;  1EEI D;  1U0L A;  1PTO F;  1QCB D;  5GAE C;  2I46 A;  2V4D A;  3KLR A;  2A6E C;  1SJH D;  2OQ0 A;  2DGY A;  1LTL A;  1STE A;  2EYP A;  4ID6 A;  1OXV A;  3P1H A;  4RHS A;  3T13 A;  2Z4I A;  1SR3 A;  1N32 Q;  1I6H B;  4JI1 Q;  4NW2 A;  1YZ6 A;  3S17 B;  4K5W A;  1HA6 A;  1BOS A;  2KCN A;  3GTP H;  2E75 C;  3NSW A;  5FLX L;  4F87 A;  5KRU A;  5LMU L;  3S2D H;  3SR1 A;  3L9A X;  1ESF A;  4DU9 A;  1CFM A;  2R92 B;  3FPP A;  1QUQ A;  3HG9 A;  5T1I A;  5AJ3 L;  1B3A A;  1CK1 A;  4DR1 Q;  1OXS C;  2LXK A;  4HAE A;  4F7X A;  1FJG Q;  2UUC L;  2GN5 A;  4LFA L;  1Y1W G;  1LTT D;  1LAC A;  1C9O A;  3BU2 A;  2KHJ A;  3BVM A;  2MGS A;  3VYR A;  1CA5 A;  1VCI A;  3LX0 A;  1HR0 Q;  3CHB D;  3HS0 C;  2H1E A;  3HFZ B;  4GOP B;  3K6O A;  1SYC A;  4JOI C;  3NWS A;  3X3M A;  4DR4 L;  1E2V A;  2F0W A;  3NBH B;  1ASZ A;  2GVB A;  2F0F A;  4H0L C;  2EY1 A;  1K9M C;  1ZYR C;  4KV6 A;  3G71 A;  1BBX C;  2K01 A;  1N33 L;  2BE5 C;  1K83 B;  1CSQ A;  2Z8L A;  3K81 C;  5I9P A;  4B3S L;  3G6E A;  4DGZ A;  1WJJ A;  2IX3 A;  3U4Z A;  1I5F A;  1EZ8 A;  1G91 A;  1KDC A;  2XTI A;  2UU9 Q;  5IGD A;  2G9H D;  2QGQ A;  1O7L A;  4K14 A;  4QMG A;  1QVC A;  2BH2 A;  2VB2 X;  5C44 H;  1K3B C;  4N9T A;  1F2M A;  2F0E A;  4ILW A;  1HUM A;  3S1R H;  4JI5 Q;  4AQY L;  4RCN A;  5EQ0 A;  3K58 A;  2IL8 A;  2JSO A;  1AEX A;  3FEW X;  3N52 A;  5M3F H;  1EFI D;  2F0H A;  1Q81 C;  1PTO D;  2IY5 B;  4C2M H;  2VZA A;  1VQK A;  4E6I A;  4DV0 Q;  2B39 A;  2ZTD A;  2EOT A;  2EJG C;  3KOJ A;  1GOZ A;  2ALY B;  3GQB A;  2MUY A;  3KBX A;  3CRK C;  1NCV A;  1LAB A;  4HMI A;  2NVX H;  2B63 G;  1SNC A;  2F4V L;  3MAQ A;  3H3V I;  3DHQ A;  2JJQ A;  2Q8I B;  4LMQ D;  2A6H D;  3I91 A;  2JA9 A;  1KAB A;  4OIK A;  5C3W A;  3ICE A;  1TS4 A;  4JPB W;  1L0X B;  2K50 A;  3GTM H;  2JA8 B;  3CMA A;  2SEB D;  4OHJ A;  3F2B A;  3MFY A;  1BNZ A;  1PLF A;  4X3K A;  1ESR A;  3UDI A;  2F0V A;  3H91 A;  4P2C B;  3ULJ A;  2RDH A;  1X55 A;  2RKS A;  1Q8I A;  3BVZ A;  4NXM Q;  3QG1 A;  1J6Q A;  2AKW B;  1EQQ A;  1HZ9 A;  1E2Z A;  2KCT A;  1VQP A;  1WVL A;  3H0G B;  3KF6 A;  1PTO B;  1Z47 A;  3BG3 A;  2IW3 A;  2PO4 A;  2EYO A;  2WIN B;  1HQM C;  4MHE A;  2RSN A;  1SXT A;  1YNN D;  3EFX D;  1BO0 A;  3SK6 A;  3MTS A;  2EYJ A;  4DV1 L;  4KD4 A;  2BOS A;  2UUA L;  4YCV A;  4B3T L;  4LUO A;  2VQF Q;  4BY7 B;  4DV5 L;  2HUG A;  4NDX A;  4B3R L;  4A3E H;  3L3O C;  2CHB D;  2B29 A;  1STN A;  1V43 A;  4KN7 C;  3HOZ H;  5LL6 X;  2F0M A;  2K5H A;  4I7A A;  2F0J A;  5IYC G;  1TT2 A;  2BH8 A;  4UPA A;  2A19 A;  4C3H B;  5JPN C;  4K8I A;  3OOC A;  3TBI B;  4GLX A;  4BY1 B;  1H9S B;  4TVA B;  3CXC A;  4A3K H;  1NE3 A;  3R2T A;  4RAU C;  1D8L A;  2MHV A;  5JEA H;  4HJ7 A;  2CVR A;  2HQE A;  3S1Q H;  1VQJ A;  4DV4 Q;  4ME3 A;  1JWM D;  2DNE A;  1HPC A;  5IOD A;  4LAA A;  1VQM A;  3LNN A;  3T1Y Q;  2K5V A;  5D65 A;  2O2L D;  3SDZ A;  3ZYY X;  4A3F H;  1PH1 A;  1TR5 A;  4RHR A;  4A3L G;  3K59 A;  2UXB L;  4OWT B;  2CCZ A;  2RCN A;  1AH9 A;  5BN4 A;  2KHI A;  3PO2 G;  5D3I B;  4P73 A;  4YIJ A;  3TP8 A;  1W6J A;  2EZV A;  3PO3 B;  4GKJ Q;  4BBS B;  1X3G A;  3E9I A;  3VR5 A;  3H0G G;  1ICW A;  3E9H A;  1I50 B;  5IGE A;  1K8M A;  1Q86 C;  2I0Q A;  1DOM A;  4JYA L;  2X6L A;  1VQ5 A;  4DKA C;  5IIF A;  3KF8 B;  4Q0F A;  5C0X I;  1Y8N B;  2NZ1 D;  2YTY A;  1ENC A;  1CHQ D;  1Y1V B;  1A2T A;  2GA4 B;  3KUP A;  3OWE B;  4OEM B;  2A6E D;  2F3V A;  4DR5 L;  4A3G B;  2ASB A;  1MJC A;  3NTH A;  3A74 A;  1JQY D;  1E24 A;  4LNQ A;  4BY7 G;  2K52 A;  1HNZ Q;  1ROD A;  1HFG A;  1A6X A;  1YBY A;  4HR7 B;  1AP0 A;  3R2I A;  2N55 A;  4LF8 Q;  1A8V A;  2VS1 A;  2VL6 A;  3TP6 A;  1EY0 A;  5M5W B;  3M4P A;  3A0J A;  2E76 C;  3FKI B;  5M3M B;  2F0O A;  5C4H A;  1VQF A;  2HCC A;  3C2P A;  2WAQ B;  1I4H A;  5ELN A;  4XQQ A;  3QWN A;  4BY1 G;  1UWV A;  3PMF A;  4MTN A;  3A8I E;  3F8T A;  1YNJ D;  2OCE A;  1AE2 A;  5JJZ A;  4YY3 L;  1QZG A;  2D5D A;  3RR5 A;  1VQO A;  1GXD C;  3EIV A;  1D2B A;  2Q8R E;  5NUC A;  3TDQ A;  5C3E B;  5CV4 A;  3UE1 A;  1LUZ A;  1BBW A;  4KHV A;  2F0N A;  5A2Q L;  1QVF A;  1J5E L;  1WI5 A;  4IFD H;  3I4M B;  3I55 A;  4PZ6 A;  3T16 A;  4GNX B;  2WB1 E;  5M5Y B;  1CZW A;  1ZYR D;  1PFN A;  3HKZ E;  3A8K E;  5C5M A;  2Q2U A;  5CYU A;  2BE5 D;  4KLK A;  1EU4 A;  2I5H A;  3T1H L;  2B63 H;  3PO3 G;  4BBS G;  2F0K A;  4DUY L; 
#chains in the Genus database with same CATH homology
 2IX0 A;  4BBR B;  4CBV A;  5BN5 A;  3VA7 A;  3SK8 A;  2XNA C;  1A3V A;  1STA A;  2IWH A;  3EA6 A;  4ZUI A;  2E2J B;  4A3B B;  4XQJ A;  1JOR A;  1DOL A;  2NB0 A;  3H3V C;  5KND A;  5ISR A;  3D4R A;  3S1N B;  4O1N A;  5CBA E;  1EU3 A;  2Z4H A;  2ICI A;  4UAI A;  1SYF A;  3PUY A;  3GTG B;  3J7A F;  3I4N B;  3OSO A;  3TP5 A;  3W3A A;  4FYD A;  3P20 A;  1RJT A;  3ITP A;  3NHH A;  2WB1 B;  3S2D B;  1JIC A;  1WCM B;  1GUS A;  1I3Q B;  3T53 B;  4ZRZ A;  4C56 C;  4IUR A;  1FYC A;  1Z7T A;  4C1N K;  3J80 L;  3G7L A;  4HED A;  3V2T A;  1U9R A;  1A2U A;  4C3J B;  2I07 B;  3PUZ A;  4G7H C;  2KUM A;  3DWA A;  1CQF A;  3PUW A;  2WKD A;  2AUK A;  2YU9 B;  1EY5 A;  5E4X A;  1SYD A;  2ICE C;  4ZYS A;  5KGU A;  1JC7 A;  5ELD A;  1BQQ T;  4GZY C;  5E3F A;  4HCE A;  1PRT F;  5EPJ A;  2A73 B;  1STH A;  2A68 C;  4V19 0;  3T56 B;  2KHS A;  3VYU A;  2K03 A;  1WTQ A;  3CKI B;  4EGV A;  3E6Z X;  3BVG A;  1EYA A;  1Y69 U;  3KK7 A;  5C4X B;  1H9K A;  4HTH A;  4KKT A;  4DN4 M;  2ZXP A;  3S15 B;  4H44 C;  2WAC A;  4ODG A;  2FFK B;  1BCP C;  3KLS X;  3SXH A;  2L55 A;  2ZT9 C;  3A54 A;  3D3R A;  3C1F A;  1M4V A;  2K5W A;  3RLF A;  1X3Q A;  2L9H A;  1TWA B;  4WOR A;  4C3J G;  1R9T B;  1DXM A;  4HMJ A;  2A74 C;  2DNC A;  2M2L A;  3M7N A;  3DXJ C;  4I7Z C;  1PZK D;  2JYO A;  2XWJ B;  4KD3 A;  2PZT A;  1CA6 A;  4ZLT F;  4TRD A;  2KQ3 A;  3OMG A;  5LL6 S;  3PV0 A;  2B2Y C;  3DWQ A;  3K5N A;  1GUG A;  4CKC A;  2D9U A;  1KDB A;  2R3Z A;  4FXG C;  1NR4 A;  1T5X D;  4OO1 I;  4EQO A;  1PRT D;  3S9W A;  4L63 B;  3HOY B;  5FO7 B;  1KDA A;  4FF3 A;  4U68 A;  1GUW A;  3Q22 A;  1F9S A;  1Q12 A;  3HZX A;  5C3X A;  1DOK A;  1JWU D;  4IZ8 A;  4DXG A;  5FOB B;  2NN6 G;  2VUM B;  3DEP A;  3MWY W;  2K5Q A;  5CV8 A;  2LKV A;  3ND8 A;  5ELB A;  1EYC A;  1BR9 A;  2AQ1 B;  3RZD B;  3U9O A;  2PNR C;  1HA5 A;  1O7Y A;  1TVX A;  4CJ0 B;  3DUZ A;  1PRT B;  2O4X A;  1XXG A;  4CKB A;  1ILQ A;  5EBC A;  2B2U A;  1U4M A;  2VNU D;  1U4L A;  1B50 A;  4IN3 A;  1L0Y B;  2RVL A;  4FO2 A;  4O42 A;  3DEO A;  3S2H B;  1NAP A;  3RD4 A;  4X3T A;  2XRQ D;  5E4W C;  3HEJ A;  3K0Y A;  4XIG S;  1Q1B A;  4H13 C;  2F0T A;  4PV1 C;  2EDG A;  1DYQ A;  4KHZ A;  5C6A A;  5JAV A;  1BCP F;  1JWS D;  2B2T C;  3PIP 3;  1V1P B;  3ND9 A;  5DNF A;  1A3U A;  1QG7 A;  5COY A;  1F2Z A;  1ENF A;  3URY A;  4XYQ A;  4RGN A;  1IKL A;  2H4O A;  2NTS A;  1QWY A;  1AW7 A;  4JBW A;  2F0P A;  5COR A;  1D5Z C;  2NVQ B;  4QF4 A;  3EJI A;  1B4O A;  1F2L A;  1G29 1;  3E0J A;  2O5J C;  3EVQ A;  5T1G A;  1F9R A;  5JVG 3;  1HXY D;  2ZXR A;  2L5T A;  1CM9 A;  4A3M B;  1AZQ A;  4CHT B;  3TME A;  1PZI D;  4A3J B;  1T5E A;  5CBE E;  2A68 D;  3NE5 B;  3J80 E;  1XYI A;  3CRL C;  5CGK A;  5KYL A;  3BS1 A;  1TU2 B;  5EPL A;  2NWG A;  1LTI D;  4IUU A;  2CW0 C;  1WTX A;  1ET6 A;  1WD1 A;  2M9V A;  4ZKB B;  4FF2 A;  2X6G A;  3HP3 A;  4KKU A;  1DCZ A;  1BCP D;  1SFO B;  4TSS A;  1HCZ A;  1GUO A;  2F0G A;  1M8A A;  3VA5 A;  4RFB A;  1HTL D;  3ERQ A;  2X69 A;  1NR2 A;  1VF5 C;  1FD7 D;  3VR6 A;  4ZKC B;  3HOV B;  4IFD I;  1FGB D;  1PFB A;  3HRZ C;  1QNK A;  2AWN A;  2NN6 H;  3N6R A;  4C3I B;  2B2V C;  4NP5 A;  4PQX A;  1E0B A;  2KEC A;  1AFP A;  2R6G A;  2XN9 C;  1SNP A;  1BCP B;  1PZJ D;  1QNU A;  3MFG A;  1GHK A;  2LFN A;  2CQA A;  3J7Y W;  1ILP A;  3AMU A;  5IGB A;  4V0B A;  5CR3 A;  1LLR D;  3TZD A;  2RDF A;  1UNS A;  5K36 H;  2EXZ A;  2F1M A;  3TSS A;  4K5V A;  5CV5 A;  1Q3L A;  4K5X A;  3TN2 A;  1OXT A;  4KY5 A;  2K32 A;  3Q6S A;  3NBH A;  3TZU A;  3I3C A;  5C0X J;  1F9Q A;  4EQN A;  3RMH A;  2Z1C A;  3R3O A;  2EJM A;  1G8Z D;  4KMU C;  2E74 C;  1HUN A;  4DK1 A;  3MXU A;  4MIU A;  1IL8 A;  3GP7 A;  1VDZ A;  2SNS A;  2PCF B;  1TWC B;  3MVV A;  3VR4 A;  2RA4 A;  1S5E D;  1NUC A;  4C3I G;  1LTA D;  1A15 A;  2F0D A;  1SMY C;  5DM6 3;  3F2U A;  1D1I A;  1Y8O B;  1OO9 B;  2L1B A;  3DM1 A;  5KNC A;  4KJN A;  3M3Y B;  2R7Z B;  1UUP A;  3D6C A;  3IAY A;  1PDQ A;  4DXF A;  3X3N A;  3MZ5 A;  3GD7 A;  5D3D A;  1JOQ A;  1CHP D;  5C0X G;  3RZO B;  1DM0 B;  2C9O A;  2K04 A;  3K7A B;  4HCS A;  3JAM L;  2K05 A;  1RTN A;  1LT4 D;  3RUZ A;  1WTR A;  1E2W A;  1QOH A;  1SE4 A;  1HQR D;  1LO5 D;  5JPM C;  3GTL B;  3GTQ B;  5ELE A;  1RF2 D;  3T4A C;  4C3H G;  4WFN 3;  2D2C C;  2IJ0 A;  3UI2 A;  5KNB A;  5IOC A;  2EY6 A;  2NBF A;  2ID0 A;  1B9M A;  4A3I B;  1JOO A;  2E2H B;  2PZW A;  1GUN A;  3WDN A;  1IHZ A;  3I8Z A;  1H9M A;  3S1M B;  3J81 E;  1S5D D;  3W2D A;  2CW0 D;  1EQV A;  4RGT A;  1H9S A;  2E2I B;  4K6L A;  1O7Z A;  3FPU B;  3QIA A;  4KKS A;  1OXX K;  2RSO A;  1D6E C;  4DFA A;  1UEA B;  2FHT A;  1MI2 A;  2JA6 B;  1A3T A;  3ERO A;  4XXE A;  3M4Y A;  1K8O A;  1LTS D;  1EZ6 A;  1SNM A;  4C1N I;  1HTP A;  3BDL A;  3GTP B;  2F03 A;  2HDM A;  1EIH A;  1S5B D;  1WD0 A;  2BA0 A;  3Q0A A;  1TQO A;  3HKZ B;  1RDP D;  2L0C A;  4N9P A;  1G6Z A;  3A55 A;  4J1M A;  1LTB D;  1BUV T;  2AQ3 B;  5M9O A;  1KTK A;  4LJZ C;  1SYB A;  3H09 A;  3DWP A;  3DMU A;  1J8I A;  3IKJ A;  2LS0 1;  5BN3 A;  1EY8 A;  4NKL A;  1LT3 D;  1Q1E A;  5CV7 A;  1ZEQ X;  2EY5 A;  4Z9C B;  1CQV A;  1ET9 A;  2PZU A;  3NWT A;  1IKM A;  1HFN A;  1LV9 A;  2KVM A;  5C44 B;  1G2S A;  4G7Z C;  1WTW A;  4L6T B;  3S1R B;  3SVM A;  4X3U A;  5CMD A;  2JA5 B;  1PTO H;  5CV6 A;  5M3F B;  4WRD A;  3LWE A;  3P75 A;  1IYU A;  3VYT A;  4M1U B;  1GUT A;  4C2M B;  3QJY A;  2EJF C;  5ELF A;  1D1K A;  1MBY A;  1WTO A;  4FXK C;  1SSO A;  1EQT A;  5I2X A;  2NVX B;  2F4I A;  3OMC A;  2FIN B;  1SNO A;  5EBD A;  4ZK9 B;  4DK0 A;  1SMY D;  3D6W A;  2TSS A;  3GTM B;  1O80 A;  1BXT A;  4JK1 C;  1EWC A;  1RHP A;  4DNT B;  4XT3 B;  1LTG D;  3BDC A;  1H9J A;  1JCK B;  3D4W A;  1DD2 A;  1SBB B;  4AYB B;  2F0L A;  1AZP A;  4ULL A;  4UDU C;  4DA2 A;  2R61 A;  1G2T A;  2C5C A;  1I4X A;  1H9R A;  3M85 A;  1STG A;  5EKI A;  2LMC B;  5JVH 3;  4OO1 G;  2WP8 J;  2QKI C;  1SE2 A;  4J8Q A;  1FR3 A;  4ABN A;  4A3E B;  4X3S A;  5DAU A;  3HOZ B;  5A35 A;  1CT1 D;  4OL7 A;  1TWH B;  2K28 A;  4DNR B;  5C5L A;  1UAP A;  5KIX A;  1U4P A;  3JAM E;  4A3K B;  3CU7 A;  2L11 A;  2M00 A;  3KBG A;  5CC4 A;  3C1E A;  2MPM A;  3GV6 A;  3S1Q B;  2NN6 I;  3AB9 A;  2JEB I;  3GO5 A;  4KI0 A;  3AU7 A;  4M8A A;  2OEO A;  3OPO A;  1C48 A;  4A3F B;  3MXG A;  4PNY A;  1FNV A;  5IGF A;  1SYG A;  1S4Z A;  2MP1 A;  3HGB A;  1EY7 A;  5JEA J;  1EYD A;  4HSP A;  2PYK A;  2EVB A;  2QIL A;  2PMZ B;  4G57 A;  1ZXT A;  1Y1W B;  2TMP A;  4RGO S;  5J1Z A;  3E5S A;  4IQZ A;  4PMB A;  4B08 A;  3SEB A;  3D8G A;  1MSG A;  3WOF A;  3MA2 B;  3NQI A;  2NYZ D;  5IGG A;  4IUV A;  2SNM A;  2B8G A;  2EYL A;  5JOB A;  1ONL A;  3BYY B;  3I70 A;  1WTV A;  3NP8 A;  4DF7 A;  3SK4 A;  3BYT B;  4EQP A;  3ONA B;  2ENB A;  5K5P A;  2J0T D;  4OIJ A;  3U9S A;  1KLU D;  2BDN A;  5JEA G;  3D4D A;  3J81 L;  1QIL A;  1Q90 A;  2J7Z A;  1QJO A;  5FK9 C;  1R4P B;  4NMZ A;  1MSH A;  5C4Z A;  3R93 A;  2OF1 A;  2B63 B;  1TS2 A;  3A7A B;  2JEA I;  1B44 D;  3A56 A;  1YNJ C;  4IFD J;  4CKE A;  4FNF A;  1TII D;  5EKL A;  2PW5 A;  5FKA C;  4ZAI A;  3L7Z C;  3WOE A;  4F8M A;  1GJX A;  1BDO A;  4FXD A;  3QB3 A;  3I4L A;  3NXW A;  3A7L A;  4KK7 A;  3FVQ A;  4CJ1 B;  5TSS A;  4BS9 A;  5D14 A;  1OXU A;  4BWG B;  1STY A;  5C4J B;  2VXW A;  2QF7 A;  3OW7 A;  2WKC A;  3Q23 A;  5I4D A;  4B9W A;  2NVT B;  5EPK A;  1R4Q B;  5ELC A;  3SK5 A;  4U67 3;  4OO1 H;  2Y0S B;  1HHV A;  5IT9 E;  4IFD G;  1B2T A;  1CI3 M;  4Q5V A;  3GTO B;  2L4N A;  3NTK A;  3T51 B;  2EE1 A;  1V1P A;  2RBM A;  4ZUJ A;  2NTT A;  5F2D A;  2QCP X;  4K2L A;  5HGT A;  4ME5 A;  5EJW A;  1LT6 D;  4BA1 I;  3VR2 A;  2IX1 A;  2B8F A;  2NVY B;  2B2W A;  3OHX C;  1JOK A;  3IFT A;  5G3L F;  4HN7 A;  3SHL A;  4TQU S;  4R8N A;  3EQL C;  3PO2 B;  1XTC D;  2B2U C;  2YYZ A;  2WII B;  3PIO 3;  2F3W A;  3K5O A;  3V05 A;  2MJ8 A;  3NPP A;  2BDO A;  4K8J A;  2HDL A;  1TY2 A;  4QIW B;  4K2K A;  1PFM A;  1TWF B;  1D5X C;  2ZXO A;  4EVO A;  2K33 A;  3G6J B;  3A8J E;  4RKL A;  5LHY 1;  1EWH A;  1B53 A;  4LK1 C;  2JA7 B;  3H6M A;  2OXP A;  2DY7 A;  2JXM B;  3S14 B;  1C4Q A;  4XTC S;  1WTP A;  4RA8 A;  1FNU A;  1EY6 A;  3GTK B;  1RKN A;  1EOT A;  4F88 A;  4KY6 A;  3O13 A;  4IUT A;  4FF1 A;  4FVM A;  3OIQ A;  5G3L D;  2DN8 A;  4HSV A;  2BCO A;  1LT5 D;  1PXU A;  3NTI A;  1STB A;  2IT1 A;  3I90 A;  3FDT A;  5I2Y A;  4R8I A;  2J4X A;  4K6D A;  5DEH A;  2XRS D;  4QUC A;  1S5C D;  3VYS A;  1SAP A;  2KED A;  4IUN A;  1QB5 D;  5IGC A;  2Q8T A;  4PMC A;  3SE0 A;  3BDO A;  4H7B A;  3TP7 A;  1TWG B;  4PMW A;  2K7V A;  2E2D C;  3MXP A;  4KJO A;  3MC0 B;  3I72 A;  5EKK A;  2XVS A;  1QE6 A;  1PRT C;  5M5X B;  5EGT A;  5DM7 3;  1VF7 A;  3OWF A;  4A93 B;  3Q24 A;  3MHB A;  4MN3 A;  4BA2 I;  2KCC A;  4G7O C;  4OGQ C;  1CZG A;  1XX8 A;  3J7A V;  1JE4 A;  4Y7N B;  2PPB C;  1S5F D;  1EY9 A;  2RQX A;  1IW7 C;  2FMC A;  2EYF A;  5AFW A;  2B2Y A;  3NUC A;  5FLX E;  1SYE A;  3K5L A;  3H94 A;  2EYH A;  2HCI A;  2PQE A;  5I9O A;  3FMC A;  2R93 B;  4G4K A;  5HUR A;  2B2W C;  3FRP B;  2A69 C;  4QUF A;  4KY7 A;  4RH6 A;  2OT2 A;  4XT1 B;  1SDF A;  2JP1 A;  1LTR D;  3NK9 A;  3HOW B;  3I73 A;  4A3D B;  1V8Q A;  2EY2 A;  1TS3 A;  3PUX A;  3KF8 A;  4XDX A;  2O5I C;  1TS5 A;  2F0Q A;  2JE6 I;  1SEB D;  5J22 A;  2EYM A;  3P7J A;  1I4R A;  1F2Y A;  5I6W A;  4KN4 C;  2RDG A;  4FP5 D;  4RCO A;  3KLS A;  2SOB A;  1RCV D;  2F0I A;  4CGY B;  2AWO A;  3VR3 A;  3LWU A;  3GTJ B;  1EIG A;  1SNQ A;  1MGS A;  3HOU B;  1W6K A;  2KEE A;  1XWE A;  4ZQ3 A;  1Z6H A;  3GV3 A;  2AQ2 B;  4RKB A;  2FJ2 A;  1I6V C;  1J9O A;  2A5H A;  1ZKO A;  2QEJ C;  1KNA A;  1TY0 A;  1RD9 D;  2XWB B;  2SDF A;  2WV6 D;  3K5M A;  1BF4 A;  1II3 A;  3QOJ A;  2KOL A;  3IFD A;  3BZD B;  2F0S A;  1RTO A;  2B2T A;  5FO9 B;  3R8B A;  1SJE D;  4QCL A;  5IT9 L;  4XQN A;  1VMC A;  2QDB A;  2IPK D;  2NUC A;  5C0X H;  1KLG D;  4DAV A;  3QOL A;  1PYW D;  2K6A A;  2LY7 A;  2N88 A;  1D5M C;  2G9D A;  1DJR D;  5J39 A;  5KYI A;  1MD2 D;  2D62 A;  5E1F A;  1ENA A;  1SE3 A;  3HOX B;  1EEF D;  1Y8P B;  2PW7 A;  4IAL A;  4RWS C;  1PTO C;  2KA7 A;  2XSC A;  3K57 A;  3C3L A;  4DAP A;  1DZ1 A;  1CTM A;  3CQZ B;  5CV9 A;  3IL8 A;  1F9P A;  4RGM A;  2A6H C;  4IUQ A;  1ML0 D;  1JB3 A;  2XIW A;  3D31 A;  3OIP A;  4L8J A;  4CJ2 C;  3NBI A;  1I4G A;  2VB3 X;  4S3S A;  1GHJ A;  3QO2 A;  1SND A;  1X32 A;  1AN8 A;  4I65 A;  1O78 A;  1V1O A;  1FNW A;  1KAA A;  1PMR A;  1YNN C;  3M7G A;  1F77 A;  1X3P A;  4XYO A;  1KNE A;  1B1Z A;  2DY8 A;  3MEH A;  1IYV A;  1B9N A;  2K1B A;  1U4R A;  4R9W A;  1JR0 D;  3MXN A;  4FF4 A;  2B2V A;  1EL0 A;  1IW7 D;  5KEE A;  1NSN S;  1I4P A;  4KTA A;  1TKW B;  5FO8 B;  3V96 A;  3C46 A;  2L12 A;  2EPB A;  3M4O B;  1EY4 A;  1DON A;  5K36 G;  2A69 D;  4QB4 A;  3PUV A;  5A2Q E;  3NQT A;  4J6H A;  3S16 B;  4TKO B;  4WJW A;  1I4Q A;  4IUP A;  5I6Y A;  2BA1 A;  2K5D A;  1C8C A;  1VMP A;  2AUJ D;  2F0U A;  2FMM A;  1HRJ A;  2KJX A;  4B9X A;  4DAY A;  1EEI D;  1PTO F;  1QCB D;  2I46 A;  2V4D A;  3KLR A;  2A6E C;  1SJH D;  1STE A;  2EYP A;  4ID6 A;  1OXV A;  3P1H A;  4RHS A;  3T13 A;  2Z4I A;  1I6H B;  4NW2 A;  3S17 B;  4K5W A;  1HA6 A;  1BOS A;  2KCN A;  2E75 C;  3NSW A;  5FLX L;  4F87 A;  5KRU A;  3SR1 A;  3L9A X;  1ESF A;  4DU9 A;  1CFM A;  2R92 B;  3FPP A;  5T1I A;  3HG9 A;  1B3A A;  1CK1 A;  1OXS C;  4HAE A;  4F7X A;  1LTT D;  1LAC A;  3BVM A;  2MGS A;  3VYR A;  1CA5 A;  1VCI A;  3LX0 A;  3CHB D;  3HS0 C;  2H1E A;  3K6O A;  1SYC A;  3X3M A;  3NWS A;  1E2V A;  2F0W A;  2F0F A;  4H0L C;  2EY1 A;  1ZYR C;  4KV6 A;  1BBX C;  2K01 A;  2BE5 C;  1K83 B;  2Z8L A;  5I9P A;  4DGZ A;  2IX3 A;  1EZ8 A;  1G91 A;  1KDC A;  5IGD A;  2G9H D;  1O7L A;  4K14 A;  4QMG A;  2VB2 X;  4N9T A;  1F2M A;  2F0E A;  4ILW A;  1HUM A;  4RCN A;  5EQ0 A;  3K58 A;  2IL8 A;  2JSO A;  1AEX A;  3FEW X;  3N52 A;  1EFI D;  2F0H A;  1PTO D;  4E6I A;  2B39 A;  2EOT A;  2EJG C;  1GOZ A;  3GQB A;  2MUY A;  4HMI A;  3KBX A;  3CRK C;  1NCV A;  1LAB A;  1SNC A;  3MAQ A;  3DHQ A;  2Q8I B;  4LMQ D;  2A6H D;  3I91 A;  1KAB A;  4OIK A;  5C3W A;  1TS4 A;  1L0X B;  2JA8 B;  2SEB D;  4OHJ A;  3MFY A;  1BNZ A;  1PLF A;  4X3K A;  1ESR A;  2F0V A;  3H91 A;  4P2C B;  2RDH A;  2RKS A;  1Q8I A;  3BVZ A;  3QG1 A;  1E2Z A;  1WVL A;  3H0G B;  1PTO B;  1Z47 A;  3BG3 A;  2IW3 A;  2PO4 A;  2EYO A;  2WIN B;  1HQM C;  4MHE A;  2RSN A;  1SXT A;  1YNN D;  3EFX D;  1BO0 A;  3SK6 A;  3MTS A;  2EYJ A;  4KD4 A;  2BOS A;  4BY7 B;  2HUG A;  4NDX A;  3L3O C;  2CHB D;  1STN A;  1V43 A;  4KN7 C;  5LL6 X;  2F0M A;  2F0J A;  1TT2 A;  4C3H B;  5JPN C;  4K8I A;  3OOC A;  3TBI B;  4BY1 B;  1H9S B;  3R2T A;  4RAU C;  2MHV A;  5JEA H;  2CVR A;  2HQE A;  1JWM D;  2DNE A;  1HPC A;  5IOD A;  4LAA A;  3LNN A;  5D65 A;  2O2L D;  3SDZ A;  3ZYY X;  1TR5 A;  4RHR A;  3K59 A;  5BN4 A;  5D3I B;  4YIJ A;  3TP8 A;  1W6J A;  2EZV A;  3PO3 B;  4BBS B;  3VR5 A;  1ICW A;  1I50 B;  5IGE A;  1K8M A;  1DOM A;  2X6L A;  5IIF A;  4Q0F A;  5C0X I;  1Y8N B;  2NZ1 D;  1ENC A;  1CHQ D;  1Y1V B;  1A2T A;  2GA4 B;  3KUP A;  3OWE B;  2A6E D;  2F3V A;  4A3G B;  3NTH A;  1JQY D;  1ROD A;  1HFG A;  1A6X A;  1AP0 A;  4HR7 B;  3R2I A;  2N55 A;  3TP6 A;  1EY0 A;  5M5W B;  2E76 C;  3FKI B;  5M3M B;  2F0O A;  5C4H A;  2HCC A;  3C2P A;  2WAQ B;  1I4H A;  4XQQ A;  3QWN A;  3PMF A;  3A8I E;  1YNJ D;  5JJZ A;  1D2B A;  2D5D A;  1GXD C;  2Q8R E;  5NUC A;  3TDQ A;  5C3E B;  5CV4 A;  4KHV A;  2F0N A;  5A2Q L;  4IFD H;  3I4M B;  3T16 A;  5M5Y B;  1CZW A;  1ZYR D;  1PFN A;  3A8K E;  5C5M A;  5CYU A;  2BE5 D;  1EU4 A;  2F0K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...