4YWKA

Pyrococcus furiosus mcm n-terminal domain with zinc-binding subdomain b deleted
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
199
structure length
184
Chain Sequence
VDREEMIERFANFLREYTDEDGNPVYRGKITDLLTPKRSVAIDWMHLNSFDSELAHEVIENPEEGISAAEDAIQIVLREDFQREDVGKIHARFYNLPETLMVKDIGAEHINKLIQVEGIVTRVGEIKPFQSFRIQDRPETLPRFIDGILLVALPGDRVIVTGILRVVLEKTPIFRKILEVNHIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Cell division control protein 21
publication title MCM ring hexamerization is a prerequisite for DNA-binding.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 53
structure length 184
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14551 MCM_N MCM N-terminal domain
A PF17207 MCM_OB MCM OB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ywkA02
3.30.1640.10 Alpha Beta 2-Layer Sandwich mini-chromosome maintenance (MCM) complex, chain A, domain 1 mini-chromosome maintenance (MCM) complex, chain A, domain 1 4ywkA01
1PH7A 1VQ4A 2WFWA 4DKAC 3H0GG 2QA4A 4A3FG 3PO3G 2A1AA 1GD7A 5C3EG 4IO9A 3I4MG 4HIMA 1BBUA 1OXSC 3JC63 2KCTA 1TWAH 2KHIA 4UP7A 3H15A 2VNUD 3W5OA 3KFUA 1HZAA 2CQOA 1L0WA 4AIMA 1XPUA 4B3TQ 1VQDA 1WJJA 2I5HA 1K3RA 4PZ7A 2GVAA 1VQIA 1SMXA 5IYCH 5FLMG 3UDIA 3EN2A 4DR1Q 5H1SE 3CMEA 2NVXH 2JE6I 2IY5B 1TWGH 3TREA 1E1OA 4YWLA 4B3TL 4BY7H 4HJ7A 4YWKA 2R92H 4JI3Q 4HIOA 1TWFH 1SR3A 3U4ZA 4DR1L 2K75A 2F52A 1SLJA 1MIUA 1YI2A 4IOAA 2YYZA 2R93H 3W1GA 2Q2TA 1Q1EA 4A3EG 3AQQA 2D62A 4A93G 3J7ZC 1XPRA 3PGZA 4Y52H 2K52A 2CWPA 2I5LX 1C0AA 2F4VL 3NBHB 2ZTDA 3CCUA 4JYAQ 1B7YB 1EIFA 2IX1A 4L5QA 4DV7L 2QGQA 4P74A 1DGSA 2UUBQ 1ASYA 3GTLH 3UE0A 1QVGA 2DGYA 5IWAQ 4JYAL 4A76A 2ZTEA 2B29A 5GROA 4BY1G 4Y7NH 3S2DH 1NBWA 4A3JH 2UUBL 4B3MQ 3VDYA 1CUKA 2YTVA 2GVBA 2HQLA 3KDFB 1VQ9A 1JE5A 5IWAL 4DV5Q 1RIPA 1UE7A 2K5HA 1UE1A 2NN6G 3K80C 4DR4Q 2K14A 1K9MC 2Z6KA 4B3ML 1C9OA 3NELA 3PUZA 3CMAA 4JI5Q 1PYSB 1Q46A 2UXBQ 2YU9H 3L0OA 4UPAA 1CKNB 5DLQE 5IY0A 2VW9A 4DV5L 2H5XA 3RNUA 3CD6A 1JJGA 1WYDA 2MNAA 4DR4L 3GTPH 2WAQG 1SROA 2AMCB 3ULJA 2JK8A 4JI5L 4GOPC 4LF7Q 2VY3A 2UXBL 4C3IH 3PUWA 2HIXA 1G6PA 3GO5A 1I6HH 1XTDA 2MO0A 1VQHA 4KHZA 3PIOA 2HIVA 2VUMG 1L1OC 2JQOA 4LF7L 4A3GG 4KLKA 4B3RQ 3BZCA 4JBJA 2JA9A 1PHJA 4OWWB 3S1QH 2K50A 2AWNA 3FKIG 3OYYA 1VQ7A 5J3BA 2IT1A 2ZJRA 1J5EQ 2B63G 4R4IA 3SGIA 2Y0SG 3RR5A 2K4KA 4UP8A 4B3RL 3CCLA 1VQPA 1UWVA 1K83H 1YEZA 1JJCB 3GDEA 4LUZA 3JAMi 1R9TH 4DAMA 4HJ8A 5LMNW 1J5EL 2R7DA 1WI5A 4A3CH 5LMNQ 4P72A 4GOPB 1YJ9A 1MKHA 4XIGS 5IP7G 1OXVA 3KF6A 1SN8A 4NXMQ 1YBYA 3RLFA 1GM5A 2CKZB 1L1OB 5LMNL 4LFAL 4PMWA 1YHAA 3M4PA 1Z9FA 5IYBG 1X56A 4O0AA 1GVPA 5LMUQ 2OTJA 1YJWA 1GKHA 4LFAQ 1YHQA 4NXML 4NXNQ 3JC62 5M3MG 3GTJH 3I4OA 3M3YH 2I0QA 3FKIH 2JA7G 1YVCA 1PH5A 3STBD 4RMFA 4PZ6A 5LMUL 4NPSA 1HZBA 1W3SA 2NVYH 4O2DA 4QL5A 4X65Q 1Y14B 2ALYB 2N3SA 2A19A 4NXNL 3U50C 2L15A 2E2HH 3AFQA 2MQHA 5FJ8G 1KL9A 3I4NH 2VS1A 2N49A 1RL2A 3J81c 3G6EA 3A5UA 1Q7YC 3M9BA 2F3IA 4LWCA 2EIFA 4X66Q 1QUQA 4X65L 3F2DA 2E2IH 1EQQA 3K81C 1KQSA 2AKWB 2HT1A 1PVOA 1QZGA 2OWOA 3HOUG 3CXCA 1XNRQ 2KENA 4A3BH 1OXUA 4YHHQ 3Q8DA 4GS3A 4R1JA 3L7ZC 2MO1A 2PQAB 1JJ2A 1OTCA 1EYGA 2GN5A 1XNRL 1K73C 2Q2HA 4JOIC 4YHHL 1WOCA 3DLLA 1BKBA 2E2JH 2IHFA 4HJAA 4GNXC 4EQ5A 4DNIA 2UUCL 2HHHQ 4A3LH 5IP9H 1VCIA 4KHPQ 1MJCA 3UE1A 3TS2A 5C4JH 4LNQA 2RF4A 3MXNB 5C44H 1G291 1X65A 4RG1A 3HOWG 2HHHL 1PYBA 1E22A 4C2MH 1PV4A 4JI0Q 1EOVA 2E8GA 3BU2A 3D31A 3HKZE 4KHPL 4HJ5A 2JA5H 1QZHA 1B70B 4BXXG 3RN2A 3KLWA 1KAWA 1HNWQ 4JI2L 4UP9A 4JI0L 1FGUA 4BBRH 1E7ZA 1Y1WH 1K8GA 2UXDQ 4JBWA 3EIVA 4XTCS 4DAYB 3PIPA 3J80c 2N8NA 3ICEA 1LTLA 4B3SQ 1HNWL 4GNXB 1X9NA 1Y1VH 2UXDL 2F4VQ 2WP8J 2NN6I 3OW2A 1HNXQ 3H0GH 3CC7A 4A3FH 4HIDA 1IL2A 3PO3H 4IFDJ 4DV7Q 4B3SL 4H02A 1V1QA 3HOVG 2NZHA 5C3EH 3I4MH 2OTLA 4IOCA 3PO2G 1NMFA 5E7NA 2YV5A 2C35B 4PZ8A 5BR8Q 1HNXL 2JA6G 5GQOA 1Q8KA 2Q2IA 4X62Q 3CQZH 4JI7Q 4JI8Q 2IHEA 5FLMH 1A0IA 4R4QA 2VQFQ 4OONA 1D8LA 1LYLA 3RZOH 4R4OA 3G71A 4A3MG 5BR8L 1C7YA 4QQBX 3BJUA 1M90C 4L5SA 4IFDG 3GTKH 4TVAB 3D0FA 4X62L 1VQKA 4JI7L 4JI8L 4AH6A 3AEVA 1KRSA 2VQFL 3J7A5 3KJPA 1JT8A 2XTIA 2RHQB 3HOZG 2LXKA 3G4SA 4A3EH 1WCMG 3K0XA 4A93H 2ZTCA 3PUXA 1HR0W 4OX9Q 3U58A 1SE8A 1N33Q 5JJKA 1HR0Q 1YJNA 1N34Q 1OXTA 3KYHC 2NVQH 3GTOH 4BBSG 3CF5A 3CAMA 3I7FA 4JCVE 4YCUA 1XJVA 3M85A 1VS0A 4OX9L 4LF5Q 1N33L 4JV5L 1HR0L 1N34L 3FP9A 1O7IA 1VQAA 2RCNA 3PUVA 4X64Q 5M3FG 1QVFA 2K5NA 4BY1H 1E24A 1PFSA 3ER0A 4LF5L 1S3OA 2YTXA 3ERSX 3OTOQ 4A3IG 4DR6Q 5C4XG 4X64L 4JBMA 4TQUS 4GN4B 1EWIA 4DV1Q 1VQBA 1NTGA 5M5XH 1PH1A 3OTOL 3TRZA 4DR6L 3TQYA 3I56A 4DV1L 3CP0A 2PQAA 5IYDG 2UUAQ 2WB1E 4DV6Q 1S40A 2A8VA 1IBML 3K8AA 1K0RA 4MTNA 4IPHA 1EQRA 4P75A 5AJ3Q 1Q82C 1N8RC 2Z6KC 2UUAL 4DV6L 4GN5A 1H95A 4JI4Q 4WJ3M 4OXPA 3A0JA 1HH2P 4A3DG 2K5VA 5AJ3L 2VUMH 2D0OA 4LF8Q 3F2CA 1B8AA 1FVIA 1GO3E 2Z0SA 4A75A 1KC8C 4A3GH 1X54A 3NENA 1XPOA 3F1ZA 4JI1Q 4GLXA 4JI4L 3H3VI 4OO1G 3JC66 5IT9c 3HOYG 3S17H 2EQSA 2Q2UA 1PH6A 2B63H 1K8AC 4LF8L 3PF4A 2MFIA 1XNQQ 2E5LQ 4LF6Q 3UDFA 2PI2A 2OQKA 5ELNA 4JI1L 1HZ9A 4DV0Q 3A5ZB 1T9HA 4K0KQ 3KJOA 4JOIA 1AH9A 4GKJL 1CKOA 1N9WA 3AYHB 4P73A 1KRTA 2E5LL 4LF6L 1FJGQ 1XNQL 4DV0L 4EX5A 5IP7H 4AYBE 4MNOA 5HGQA 1VQ6A 4K0KL 1VQEA 1LM0A 2JEBI 4ME3A 4DV4L 4ALPA 3PCOB 1FJGL 4A3KG 2JA8G 1OXXK 4A3DH 1TWCH 5IYBH 5GADC 2UUCQ 1NE3A 3J81j 1NJIC 5JJIA 5M3MH 4DR7Q 1CSQA 1L2FA 1KD1C 3W1BA 4L5TA 2JA7H 4IJHA 2BH2A 3CPWA 1ASZA 1A62A 3CC4A 1YITA 4DR7L 2KCMA 1NMGA 5FJ8H 1MJEA 1IBKQ 1N32Q 1KXLA 4AQYQ 3ULPA 3I2ZA 4POGA 1UE5A 1FL0A 1I50H 1I3QH 4YCWA 2V1CC 4JI2Q 3TEHB 3U4VA 5IYCG 4GKKQ 1HNZQ 2N78A 3KDFA 1IBKL 4L5RC 5EAYA 1N32L 3HOUH 4QGUA 3NEMA 4C3HH 3CW2C 3UDXA 4AQYL 3AFPA 3J81i 2R92G 4YY3Q 4IJLA 3RLOA 4GKKL 4POFA 1HNZL 4A3KH 4HJ9A 1CKMA 4NB3A 3CCSA 2ASBA 3GTQH 3KF6B 1CKNA 4IFDI 3S1MH 2R93G 4LUOA 3RLNA 4QJFA 1JB7A 4YY3L 3H3VH 1PA6A 4DR2Q 1KHIA 2PNHA 2JJQA 5M5WH 4IPCA 4OWTB 4OWXB 4IPDA 4DUZQ 3S1RH 4X6AH 4QIWE 3M4QA 1NY4A 3S24A 4LW1A 1I5FA 1VQFA 1Q12A 1Z47A 2YTYA 4DR2L 1VQLA 4DUZL 3HOWH 1IBLQ 1X3EA 2KBNA 1E1TA 1P8LA 1UE6A 3L2PA 1AE3A 2B3GA 3HKZG 2ZJPA 1EIYB 1Q1BA 4A3JG 1JMCA 4BXXH 3T1HQ 3CCJA 1QUQB 1IZ6A 5GAEC 3WWVA 1IBLL 1VQ8A 1P16A 1X3FA 1VQOA 1PH9A 3CCMA 4JI3L 3T1HL 4GOPA 1D7QA 4YCVA 3ULLA 3B6YA 3KOJA 5ELOA 3CCVA 1IYJB 2QEXA 2IX0A 3E9IA 4DV2Q 1S72A 1HZCA 2WAQE 3J80i 3KF8B 4C3JH 1L1OA 3GTGH 1CSPA 4JV5Q 3HOVH 1X6OA 1M1KC 2PI2E 3LGJA 3PO2H 2AWOA 1SRUA 1X55A 4MZ9A 1A8VA 4DV2L 2JEAI 3K7AH 3MEFA 4PG3A 3CCRA 4BA1I 2JA6H 5C0XI 4LUVA 4A4IA 5JJLA 2LXJA 1E3PA 3PV0A 4GLAC 3S1NH 2BA0A 3CCQA 3RN5A 4A3MH 4DK6C 3JAMc 2UU9Q 4JBKA 1QVCA 4QY7A 5GAHC 1KIXA 2CFMA 2BA1A 5C0XJ 2Y0SE 3IRBA 4BA2I 4OO1I 2VL6A 4DV3Q 2UU9L 3E9HA 3PF5A 1IBMQ 2R7FA 3CC2A 1EUJA 1IXRA 1U0LA 1YHBA 2I5MX 1TXYA 1YZ6A 1PH3A 1VQCA 1WCMH 3HOZH 2OQ0A 5GAGC 4A3CG 5IE8A 4UY8C 1AE2A 1Q81C 4DV3L 3I55A 1XMQQ 4HIKA 4GLVB 1VQMA 2XGTA 4BBSH 1Q86C 5C0XG 1I94Q 2R7ZG 3GTMH 2LSSA 3DM3A 1N36Q 5JEAJ 1V43A 3UDGA 1XMQL 5M3FH 4R4CA 1LUZA 1HJPA 3HFZB 4DR3Q 1I94L 3PUYA 2ATWA 1TWHH 3K7UC 3EBEA 3CCEA 3S14H 4A3IH 1PH4A 5C4XH 2PMZE 1N36L 4KI0A 4R4TA 4LFCQ 3M7NA 3I4NG 3GD7A 4DR3L 4GKJQ 2D0PA 3E0EA 4J15A 5JEAG 2NZOA 4LFCL 1YIJA 5K36G 1VQGA 4DR5Q 5IYDH 3HOXG 4DV4Q 2CCZA 2CWAA 4A3BG 2EXDA 2WB1G 4JC0A 2R6GA 2ZM6Q 3T1YQ 2UXCQ 5HY6A 1UEBA 3G48A 4GNXA 2R7ZH 1BVSA 4JG2A 4DPGA 2ES2A 4DR5L 1W2BA 2ZJQA 2KHJA 2UXCL 2FXQA 4DK3C 2ZM6L 3T1YL 2VQEQ 1G51A 2ID0A 3TS0A 3M4OH 3F2BA 4GN3B 1XMOQ 3S16H 1VQJA 5IP9G 4A3LG 1EFWA 1VQNA 4WJ4A 2VQEL 3HOYH 2BH8A 1BBWA 2DUDA 3BZKA 4YWMA 5C44G 4JI6Q 3HKSA 3S2HH 1XMOL 4P71A 1SFOH 4LFBQ 3S15H 1A63A 2NVTH 3FHWA 1U5KA 5FLXc 4LF9Q 3A74A 1J6QA 1PH2A 1X3GA 3HOXH 2JA5G 3PSIA 4LF4Q 4JI6L 1WFQA 3STBC 4X66L 3ZJYC 4LFBL 4DUYQ 2AHOB 2RHSB 4BBRG 5M5YH 1VQ5A 3RZDH 1Y1WG 4LF9L 4BY7G 2VZAA 3CPFA 4AYBG 1YNXA 4IPGA 1V9PA 4LF4L 4FDBA 3F8TA 2JA8H 2OCEA 4DUYL 1Y1VG 1PH8A 4APVA
chains in the Genus database with same CATH superfamily
4HMIA 2WFWA 4DKAC 5CV7A 3Q6SA 3PO3G 1F9PA 1QWYA 3I4MG 4HIMA 1BBUA 1FNUA 1OXSC 1BCPD 2CQOA 2G5DA 4CKCA 1S4ZA 1PZJD 1WJJA 4M1UB 2WAQB 3BS1A 3UDIA 2FINB 3CMEA 2IY5B 4OHJA 1KDAA 4YWLA 4K2KA 4B3TL 1SYDA 2EYHA 2RBMA 4HIOA 1U4RA 3MXPA 4DR1L 2F52A 1SLJA 4DXGA 1YI2A 1Q1EA 4A3EG 1C48A 3PGZA 2NVYB 2Y0SB 1HXYD 2JN4A 3TP6A 1IYUA 3NBHB 3TP8A 3I4NB 1B7YB 4KJOA 3QIAA 4P74A 1ASYA 1KLGD 3HGBA 5CV4A 4XT1B 1SNOA 3GTLH 3UE0A 3DMUA 3BG3A 4C1NK 3S2DH 5GROA 2PNRC 2PPBC 5C4ZA 2K05A 1EY9A 2GVBA 3KDFB 3VR3A 1VQ9A 1Y8OB 2RDGA 3NSWA 2K14A 1K9MC 1C9OA 4JI5Q 4CBVA 3V96A 5DLQE 5IY0A 1CKNB 4DV5L 3RNUA 2H5XA 1JJGA 2F0EA 5IGDA 2WAQG 5JOBA 2JK8A 2A6EC 2BE5D 2VY3A 2UXBL 4C3IH 1G6PA 1WTQA 2K5DA 4H44C 3PIOA 2N88A 1D1KA 4LF7L 2ZXRA 4JBJA 4KY7A 5J22A 4IUUA 2AWNA 4CJ0B 4R4IA 4CGYB 2Y0SG 1GUTA 1V8QA 3RD4A 1VQPA 2EYFA 1JJCB 1SYEA 1R9TH 4HJ8A 1LV9A 5LMNW 5LMNQ 5I2XA 1YJ9A 2KEDA 3A8JE 3DWAA 2FMMA 4XIGS 4MIUA 1CM9A 3CQZB 4PMWA 1SE3A 3P20A 5IYBG 1GVPA 2OTJA 1YJWA 1FNWA 4NXNQ 3GTJH 3I4OA 2PZWA 2HCIA 3FKIH 2JA7G 2Z9HA 3D4RA 3P1HA 3STBD 4PZ6A 5LMUL 4NPSA 3EROA 1W3SA 3CXCA 1Y14B 3VA5A 3VYTA 3ERQA 1WTRA 5IGEA 2KJXA 4X65L 5JEAH 5HGTA 3HOUG 1XNRQ 4A3BH 2KENA 3K7AB 2K5WA 4YHHQ 1TY2A 2LY7A 4GS3A 3L7ZC 2L5TA 3IFTA 1EYGA 3S1NB 4JOIC 2B2UC 1WOCA 3NBHA 3KF8A 3DLLA 3KLRA 3U9OA 4J1MA 4PNYA 2TSSA 3UE1A 5IP9H 4KHPQ 3E5SA 5C44H 1FR3A 1WCMB 4N8X1 3DHQA 1X65A 2FJ2A 2QF7A 1PYBA 3C46A 4JI0Q 1EOVA 3HKZE 3D31A 1A6XA 3OOCA 4HJ5A 4DAVA 4OIJA 2EY1A 5CV5A 1KAWA 3FRPB 1E7ZA 2D5DA 2OEOA 3PIPA 2E74C 2F0DA 1H9RA 4K5WA 3SK5A 2EYMA 4KKUA 1HA5A 1LTLA 2OT2A 1HNWL 2LKVA 3ZYYX 4A3IB 3A54A 2UXDL 1YNJC 1B50A 2IW3A 4HSPA 4QB4A 2RSNA 4B3SL 2NZHA 5C3EH 4I7ZC 1CQVA 2C35B 2A68D 5BR8Q 1LTSD 4RAUC 5ELFA 3T51B 2PQEA 1A0IA 4R4QA 4EVOA 1LYLA 1WTHA 1K8MA 3BJUA 1R4QB 2XWBB 1G2SA 4TVAB 3D0FA 1VQKA 3H91A 1HFNA 1HQRD 2XTIA 2LXKA 1WCMG 3H6MA 3QR8A 1N33Q 2JP1A 4ID6A 3S2HB 3Q24A 1OXTA 3IKJA 1TT2A 2NVQH 1L0YB 2SOBA 4DNRB 1EY5A 2Z4HA 3QG1A 5C3XA 4X3TA 1TY0A 1WD1A 2K7VA 2M9VA 4C3HB 1QVFA 2K5NA 1PDQA 4FXDA 1AN8A 1LT5D 3ERSX 4A3IG 4DR6Q 4J8QA 4LJZC 2ZXPA 1EWIA 2IJ0A 2SNMA 3Q23A 3R8BA 1PH1A 3OTOL 3TRZA 3TQYA 4Z9CB 5T1GA 4DV6Q 1SJHD 3V2TA 3GV3A 4IPHA 3HOWB 2XSCA 2A6HC 1EQTA 2EE1A 2UUAL 3A0JA 2B2TA 5AJ3L 2D0OA 3F2CA 1BNZA 1B8AA 1GO3E 1KC8C 2Z0SA 3J80L 4A3GH 2SNSA 1SXTA 3H3VI 4JI1Q 2R93B 2XIWA 3S17H 2Q2UA 1SE4A 3HG9A 2B2YA 2MFIA 1XNQQ 2F0FA 3C1EA 2PI2A 4XDXA 5ELNA 4IURA 3KJOA 5EGTA 3NTKA 1CKOA 4CHTB 4ZQ3A 4C3HG 2L55A 4MNOA 4AYBE 1LM0A 4ALPA 3PCOB 2B2VA 3OIPA 1TWCH 3CU7A 5M3MH 5E1FA 1L2FA 3UI2A 3W1BA 1ASZA 1A62A 4DR7L 1IBKQ 1NMGA 5L37A 1X3QA 3I2ZA 4GKKQ 2C5CA 5EAYA 2F4IA 5G3LD 3NEMA 5DEHA 1YNND 4YY3Q 1ET9A 4S3SA 4KJNA 4HJ9A 4NB3A 1EY8A 1RF2D 4A3KH 4H7BA 3GTQH 3KF6B 2R93G 3S1MH 1LT3D 4IUNA 2A69D 1JB7A 3H3VH 3FVQA 1A3TA 5DNFA 1KHIA 2PNHA 5M5WH 4IPCA 4IPDA 1ENFA 4ODGA 4LK1C 5M9OA 1NY4A 1VQLA 1HUMA 1Q12A 2YTYA 4XYOA 4IUTA 4EGVA 2B3GA 3HKZG 1NSNS 4G7HC 3T1HQ 3P75A 3N6RA 3TBIB 1BCPC 1X3FA 5JAVA 3A8KE 3P7JA 3FEWX 5CBEE 1LO5D 5DM63 1Z6HA 3B6YA 3CCVA 2ENBA 2IX0A 4CJ2C 3E9IA 4DV2Q 2G9HD 1L1OA 1I4QA 2ZT9C 2CH4A 2XRSD 3TP7A 3HOXB 5C0XI 2M00A 4RH6A 1E3PA 5IODA 5CV6A 5M5YB 3PV0A 3G7LA 5KEEA 2UU9Q 2O5IC 5J39A 1QVCA 4QY7A 2MUYA 5GAHC 2BA1A 5D3DA 3G6JB 2VL6A 1DM0B 1VF5C 3CC2A 1IXRA 1U0LA 3TZDA 1YHBA 3HOZH 1I4PA 1PFMA 2OQ0A 4UY8C 4O1NA 2F0TA 1XMQQ 4HIKA 1ESFA 1A3VA 4BBSH 2EPBA 4RGNA 5AFWA 1V43A 2GA4B 4BBRB 5M3FH 2R92B 3K7UC 1KTKA 1ML0D 2K1BA 1PH4A 1F77A 2BE5C 4FVMA 1A15A 5KYIA 4A3FB 3BDLA 3NQTA 4J15A 4K6LA 2EYPA 2NZOA 4LFCL 4XQNA 5K36G 5IYDH 1Y8NB 2VB2X 3HOXG 3K5MA 2EXDA 5EKIA 2R6GA 4CDFC 4ZCKA 3SE0A 3KK7A 3VR4A 1UEBA 1UUPA 5KIXA 3MFYA 2R7ZH 1BVSA 1W2BA 1Y8PB 2FXQA 2ZM6L 3T1YL 3BVZA 2EVBA 3F2BA 1XMOQ 4KHVA 4FP5D 1VQJA 3OSOA 1F9SA 3HOYH 2BH8A 1BBWA 4YWMA 4P71A 2F0UA 5FK9C 1E2WA 1A63A 2NVTH 3FHWA 4LF9Q 5FLXc 3A74A 2KCCA 1J6QA 4BWGB 1HUNA 4LF4Q 3STBC 1H9MA 4BBRG 1PRTB 2FFKB 4AYBG 4IPGA 3PIP3 1ONLA 2JA8H 4DUYL 4PMCA 1E2ZA 3H0GG 2H1EA 4A3FG 2OXPA 4EQOA 1GD7A 4IO9A 4UP7A 2KHIA 5JPMC 5C5MA 1AZQA 5CV9A 4AIMA 1XPUA 3HS0C 5IYCH 3EN2A 5K5PA 3SK8A 1NAPA 2HQEA 2KUMA 1EU4A 1TWFH 3K59A 1SR3A 3NQIA 3U4ZA 2VUMB 1MIUA 5DAUA 1DJRD 2Q2TA 2DNEA 1RCVD 1XPRA 2B63B 1B4OA 3D4DA 3R3OA 3KBGA 4L5QA 2UUBQ 5EPLA 1QVGA 1I4XA 2B29A 4MTKA 3D4WA 4A3JH 4B3MQ 1J9OA 2YTVA 2A68C 1QCBD 1RIPA 2NN6G 3H3VC 4DK0A 3NELA 3PUZA 1Q46A 1T5XD 1H9KA 2YU9H 2AUKA 3ONAB 4FF1A 3GTPH 1SROA 1SYBA 3JAME 1STNA 4JI5L 4GOPC 1CHQD 2X6GA 3FPPA 2HIXA 3R93A 1JICA 2X69A 2HIVA 2VUMG 2KCNA 4KN7C 4KLKA 1Y1WB 3BZCA 4OWWB 1PYWD 3S1QH 4R8IA 5J3BA 2A73B 2B63G 3RR5A 2K4KA 1D5XC 1UWVA 3GDEA 4DF7A 3QOLA 1K0SA 4DAMA 2X6LA 2R7DA 1MKHA 5IP7G 1OXVA 1SN8A 4NXMQ 1YBYA 3RLFA 3L9AX 5LMNL 5IT9E 1JOKA 2L0CA 3RZOB 2F0JA 3MVVA 4LFAQ 4G7OC 2EJGC 1LTID 3GTKB 4N9TA 4RMFA 4IALA 2IPKD 2NVYH 4NXNL 2PO4A 2E2HH 3K5LA 3LWUA 2MQHA 3I4NH 2VS1A 2N49A 1RL2A 2K28A 3M9BA 5BN5A 1SNPA 2CW0D 2F3IA 3HOVB 3F2DA 1QUQA 1EQQA 3PO2B 5A35A 2I07B 1KQSA 2HT1A 2OWOA 3A55A 3DWPA 4RFBA 1F2LA 1OXUA 1C4QA 5E4WC 5FO7B 2MO1A 1JJ2A 1XNRL 2Q2HA 2HDMA 4YHHL 4R8NA 3F2UA 2E2JH 1Z7TA 4GNXC 4DNIA 2XWJB 2HHHQ 5M5XB 1I4HA 1VCIA 4NDXA 1AW7A 1NUCA 1EL0A 3MXNB 3EA6A 3K6OA 3W2DA 4ULLA 1MSGA 3MWYW 4C2MH 4KHPL 4X3KA 1PRTF 1W6KA 2L11A 3QB3A 4K5VA 1QZHA 4JI0L 1Y69U 4DAYB 4FXKC 4IN3A 1TWHB 3S14B 5CR3A 4IZ8A 2EZVA 1SMYD 1HNXQ 3D6WA 1IW7D 1YNNC 4NW2A 3HOVG 4H02A 3PO2G 4IOCA 1A3UA 2YV5A 2JA6G 3HP3A 2A69C 2F0OA 1Q8KA 4DAPA 1MI2A 3BDCA 3L3OC 3CQZH 5FLMH 2VQFQ 4OONA 3OHXC 4QQBX 4DN4M 1D2BA 5BR8L 1W6JA 5I4DA 1EWCA 4R9WA 1V1OA 3AEVA 3S16B 4L6TB 1QNUA 1JT8A 2RHQB 2PW7A 4HR7B 2JA7B 1ET6A 4A93H 2ZTCA 4H0LC 1SE8A 1HCZA 1YJNA 1N34Q 1Q3LA 3CF5A 3NXWA 3I7FA 3M85A 3K58A 2D2CC 5FO9B 4CDEC 1N33L 5A2QE 5KRUA 1HHVA 3FP9A 4ZLTF 4X64Q 4N9PA 3HOUB 1DONA 3IFDA 4PV1C 4BY1H 1E24A 5J1ZA 1PFSA 3C1FA 4KKSA 4GN4B 4DV1Q 4K8IA 2RCFA 3X3MA 1SDFA 1ICFB 4DR6L 3VYSA 4C56C 4G57A 3I56A 3CP0A 1ILPA 1IBML 5EBCA 2KHSA 1V1PB 2DN8A 1K0RA 4MTNA 4P75A 1N8RC 5JVH3 4DV6L 1H95A 3DXJC 2K32A 4UHVA 2F03A 1O7LA 1HH2P 5IGCA 4LF8Q 1LTTD 1X54A 1XPOA 4GLXA 1ESRA 4OO1G 5EKLA 2EQSA 3PF4A 4LF6Q 3UDFA 2LFNA 4JI1L 4DV0Q 1HZ9A 3A5ZB 1T9HA 4K0KQ 4JOIA 1H9JA 3J7YW 2O4XA 5JJZA 3MXUA 1FJGQ 1XNQL 4DXFA 4I7AA 2G9DA 1SJED 2MP1A 2CHBD 1VQ6A 3URYA 5HGQA 2RDFA 3GTLB 2DY8A 4ME3A 1TR5A 4PQXA 4RGTA 3S2DB 1OXXK 4L63B 1NJIC 1CSQA 1STBA 1DZ1A 1KD1C 1GUOA 2L1BA 4L5TA 3NUCA 1CFMA 5HURA 1SBBB 5FJ8H 1N32Q 2HUGA 1TS5A 4AQYQ 3WOEA 3C2PA 1I3QH 2CVRA 1HNZQ 4KY5A 3KDFA 4C3IB 1IBKL 4L5RC 4C3HH 3UDXA 2QKIC 4GKKL 1CKMA 2ASBA 1CKNA 4IFDI 2CQAA 1F2ZA 1E2VA 4QJFA 4YY3L 1RD9D 1PA6A 1XWEA 2JYOA 4OWTB 1T5EA 4DUZQ 1ZYRD 3MEHA 1F2YA 1BXTA 2BCOA 3CKIB 1R9TB 3M4QA 2B2WA 1CK1A 1OO9B 3HOWH 1IBLQ 2K01A 1JCKB 4ZUJA 2L12A 1E1TA 1P8LA 1UE6A 3L2PA 1AE3A 4WORA 4BXXH 4CJ1B 3M4YA 3WWVA 5GAEC 1P16A 3GTJB 4EQPA 2MGSA 3M4OB 3T1HL 1V1PA 1D7QA 2N55A 3KOJA 1JC7A 5ELOA 1K28A 1S72A 3J80i 4C3JH 1E0BA 1EYCA 1X6OA 4TKOB 1I4RA 3S15B 1CZWA 4C3IG 1A8VA 1PFBA 4DV2L 3MEFA 4PG3A 4A3BB 2EYLA 2J4XA 1EY4A 1BCPB 2BA0A 3CCQA 4A3MH 1D6EC 5CGKA 1KIXA 4IFDH 3ND8A 1D5MC 2FMCA 1WTVA 4FF4A 1VMPA 1I4GA 4QMGA 1CQFA 3SR1A 4RWSC 2UU9L 3QOJA 1IBMQ 1PH3A 1O78A 5C44B 2AQ3B 1G8ZD 1GOZA 1Q81C 3I55A 5COYA 5TSSA 3GTMH 4JW0A 2LSSA 3WDNA 1N36Q 5JEAJ 3UDGA 1XX8A 1XMQL 2F0KA 1EWHA 4R4CA 2PCFB 3VR2A 4BY7B 3HFZB 1SYGA 3HZXA 3PUYA 2R61A 5C4XH 2PMZE 1S5DD 4KI0A 2WACA 1D5ZC 2NYZD 2ICEC 1JWSD 1UAPA 2TMPA 3E0EA 3QO2A 5I6WA 5JEAG 5C3EB 1ZXTA 5FOBB 1SE2A 1JWUD 4DR5Q 4A3BG 5T1IA 1EZ6A 4JC0A 3T13A 5I9PA 1G2TA 4L8JA 3DEPA 2EY2A 4DU9A 4DPGA 2SEBD 2ZJQA 3HKZB 4Y7NB 2VQEQ 4KD4A 2QEJC 1JE4A 3J81E 1BOSA 3MTSA 2QW7A 1STAA 5IP9G 3IAYA 3VR6A 4B9XA 1STGA 5C44G 4JI6Q 3HKSA 1XMOL 1SFOH 1U5KA 4OGQC 4RCOA 5K36H 2NVQB 3HOXH 1LT6D 4X66L 3ZJYC 2AHOB 2RHSB 3LX0A 5M5YH 3RZDH 1VQ5A 4LF9L 4BY7G 1I6HB 3CPFA 1V9PA 4LF4L 2CW0C 3JAML 1B53A 4APVA 1PH7A 1VQ4A 2QA4A 1KNAA 1ZKOA 4HMJA 2BDNA 2A1AA 5C3EG 2B2VC 1HQMC 3JC63 1K83B 1TWAH 2KCTA 3H15A 2VNUD 3I73A 1O80A 4K5XA 1CT1D 1K3RA 3GP7A 2GVAA 1VQIA 3OWEB 4PZ7A 2JXMB 3NPPA 2NVXH 1GUNA 1TWGH 3TREA 1U4LA 2R3ZA 4ZUIA 5IGFA 3MA2B 2R92H 4C1NI 3K5NA 5KNBA 2K75A 1PTOH 4A3GB 3TDQA 4IOAA 2YYZA 3W1GA 5EPKA 2D62A 5EJWA 3S17B 3J7ZC 5IT9L 2WKDA 3E6ZX 2K52A 1EFID 1C0AA 2ZTDA 3CCUA 4JYAQ 1EIFA 3TP5A 1LABA 1AEXA 3SVMA 4DV7L 1BQQT 1MD2D 2EJMA 1SMYC 1TS2A 3I90A 5C4HA 5IWAQ 4A76A 2C9OA 1IW7C 1CZGA 2EYOA 3PIO3 2UUBL 1CUKA 2HQLA 1JE5A 1UE7A 2K5HA 1EQVA 4DR4Q 1EYDA 5ELEA 4HTHA 4O42A 2Z6KA 4HCEA 3ND9A 4B3ML 1PYSB 2PMZB 3L0OA 2ZXOA 1EY0A 2VW9A 4LMQD 2MNAA 4ABNA 5DM73 2AMCB 5C6AA 1C8CA 3PUWA 1BCPF 1XTDA 2MO0A 4KHZA 4JPBW 4HCSA 1L1OC 1B3AA 1LTGD 2JQOA 4V190 4A3GG 3I70A 3KBXA 4B3RQ 4CDDC 2JA9A 4AYBB 1PHJA 3S1MB 3I8ZA 2IT1A 1JWMD 1SSOA 1J5EQ 5C3WA 2MHVA 3SGIA 4UP8A 3CCLA 5M5WB 4OEMB 2ICIA 4FO2A 3H0GB 4X3UA 1U9RA 4F7XA 1Q90A 2QILA 4A3CH 4GOPB 4RGOS 1IL8A 5JVG3 3KF6A 2CKZB 5C0XH 1WTOA 3C3LA 3NBIA 1YHAA 2F0PA 3M4PA 1Z9FA 2NBFA 4NP5A 1GKHA 1YHQA 4NXML 3JC62 5M3MG 2NZ1D 3M3YH 4WFN3 1QILA 2I0QA 2J7ZA 1YVCA 1PH5A 4M8AA 4LFAL 2O5JC 3U50C 2N3SA 4FF3A 3AFQA 1KL9A 1JOQA 4X66Q 4LWCA 4XQJA 5ELDA 2E2IH 1WVLA 3FPUB 1JB3A 1TQOA 1QZGA 3GTOB 1F9QA 2AQ1B 1Q8IA 3Q8DA 4R1JA 4XQQA 1F2MA 2F0WA 2PQAB 3D3RA 2GN5A 3OPOA 1SNDA 2EXZA 2VB3X 1K73C 3DEOA 1BKBA 2IHFA 5FLXE 1PFNA 4HJAA 1BDOA 5I2YA 5A2QL 2UUCL 2Q8TA 4A3LH 1FGBD 3TS2A 4HN7A 5C4JH 4LNQA 3HOZB 3DWQA 4RG1A 3CRKC 2HHHL 1PV4A 1E22A 3TMEA 2E8GA 3BU2A 2JA5H 3PMFA 5C5LA 3LWEA 3KLWA 4KTAA 3CHBD 1Y1WH 4JBWA 3E0JA 3J80c 3ICEA 4XXEA 4JVZA 4CDCC 4GNXB 1Y1VH 2L4NA 2EJFC 2IX3A 2WP8J 1K8OA 4HIDA 3SDZA 1IL2A 3PO3H 4DV7Q 1V1QA 2KOLA 5CMDA 3I4MH 2OTLA 5E7NA 2HCCA 4PZ8A 1HNXL 5GQOA 1QOHA 4X62Q 4JI7Q 4JI8Q 4DA2A 3RZOH 4R4OA 3G71A 1ZYRC 1C7YA 2A5HA 3VA7A 5LL6S 4ZRZA 2J0TD 3GTKH 4A3DB 1KRSA 2VQFL 3KJPA 3TN2A 3GV6A 3HOZG 2EY5A 1STHA 3HOYB 4A3EH 1HR0W 3PUXA 4OX9Q 3U58A 5JJKA 2F0QA 1HR0Q 3FMCA 3KYHC 2NVTB 1I6VC 4KD3A 4BBSG 3CAMA 4YCUA 1I50B 4LF5Q 1N34L 1O7IA 1VQAA 2Z1CA 3PUVA 5M3FG 1BO0A 3I4LA 1S3OA 2YTXA 2JA8B 4X64L 4JBMA 3BVGA 1PTOC 1VQBA 1NTGA 5M5XH 2K5QA 4KY6A 3LNNA 4IUVA 3S1RB 4DV1L 2PQAA 5IYDG 2WB1E 3NWTA 2EY6A 1S40A 2A8VA 3K8AA 5F2DA 2Q8RE 4GN5A 4JI4Q 4WJ3M 4OXPA 4A3DG 5KNCA 2K5VA 2MPMA 4XYQA 1FVIA 3V05A 4A75A 1G6ZA 3EJIA 5IT9c 3HOYG 4LF8L 2AQ2B 4E6IA 2E5LQ 2OQKA 3GTGB 3TSSA 3DUZA 4GKJL 1DD2A 4QUCA 4LF6L 4DV0L 4RKLA 1CHPD 3NE5B 2JA6B 1VQEA 4K0KL 1GHJA 2JEBI 4DV4L 4FNFA 5E3FA 3Q22A 2JA8G 1FJGL 2F0HA 4A3JB 1ZEQX 5IYBH 5GADC 1NE3A 3J81j 2UUCQ 5JJIA 5EBDA 2H4OA 2JA7H 2I46A 5D14A 4IJHA 3NHHA 4RA8A 3CPWA 1EU3A 3CC4A 2XVSA 2YU9B 1MJEA 1HA6A 1MGSA 1KXLA 3MZ5A 3ULPA 1FNVA 2LMCB 2QDBA 4POGA 3GTPB 1AFPA 1FL0A 5IYCG 2F0VA 2N78A 1H9SB 1U4PA 1GUWA 1N32L 3HOUH 4QGUA 4AQYL 3AFPA 3J81i 4IJLA 3RLOA 3K0YA 4POFA 2Q8IB 1HNZL 1BUVT 3CCSA 1VF7A 1GUSA 3J7AV 1B9NA 4LUOA 3S1QB 2QDLA 1A2TA 4DR2Q 2F0MA 2FHTA 2JJQA 4H13C 2E2DC 3H09A 3S24A 4LW1A 1Z47A 4DUZL 3SEBA 2KBNA 2PZTA 4Q5VA 3A7AB 2ZJPA 1PZID 1QG7A 1EIYB 4A3JG 1JMCA 3CCJA 1IBLL 5CORA 3R2TA 2RVLA 3TZUA 3VYUA 5BN3A 3BDOA 5CBAE 3IL8A 3CCMA 4JI3L 4WRDA 1ENAA 2F0GA 3ULLA 1IYJB 2QEXA 2E2HB 3X3NA 3KF8B 1TS4A 1CSPA 1M4VA 2PI2E 3J81L 3LGJA 1SRUA 4MZ9A 1L0XB 5KGUA 2JEAI 3K7AH 2CH4W 1JQYD 2WB1B 4A4IA 5JJLA 4P2CB 1BBXC 1RHPA 3S1NH 4RKBA 3RN5A 4JBKA 4DK6C 5G3LF 4IUPA 1SNQA 4FXGC 1GUGA 1RDPD 1RTOA 2CFMA 2RSOA 2E2JB 3OMCA 2B8GA 2E76C 2F0IA 2NTSA 4DV3Q 3E9HA 2R7FA 1NR2A 1EUJA 2QCPX 3BYYB 4OELB 5CYUA 4F87A 2I5MX 1TXYA 1VQCA 1WCMH 1CA5A 5IE8A 1AE2A 4C2MB 2XGTA 1GHKA 2XNAC 1I94Q 4RHRA 5CC4A 1A2UA 4KN4C 1LTAD 1HJPA 4DR3Q 3MXNA 2ATWA 3CCEA 1KABA 4A3IH 1N36L 1ENCA 3VYRA 2Z6BA 3M7NA 3I4NG 1H9SA 3GD7A 4GKJQ 2D0PA 2Z4IA 5EKKA 1KDBA 3A7LA 3SXHA 1YIJA 5KYLA 2B2UA 2Z8LA 2SDFA 3T4AC 2AUJD 2WB1G 4DAYA 4DV4Q 2UXCQ 5FO8B 2E75C 3G48A 4JG2A 4K2LA 4DR5L 2KHJA 4MHEA 1CA6A 1O7YA 1G51A 3BVMA 2MJ8A 3M4OH 1CTMA 1EYAA 3PQIA 2VQEL 2O2LD 3BZKA 1AP0A 3OMGA 2P5ZX 4A93B 4ZK9B 3S2HH 1IYVA 4LFBQ 4K6DA 1BR9A 3S15H 4NMZA 1X3GA 1PLFA 4K14A 4JI6L 4FF2A 1O7ZA 4X3SA 2VZAA 3OIQA 3I72A 4BY1B 1QB5D 4FDBA 4TRDA 3F8TA 2OCEA 1TKWB 1M8AA 5LL6X 1UNSA 1PH8A 1MHWC 3SHLA 1NR4A 2PW5A 1GJXA 5IIFA 1JR0D 3W5OA 3Q0AA 3KFUA 1HZAA 1L0WA 4B3TQ 1VQDA 2I5HA 2XRQD 1RKNA 2V4DA 1SMXA 5FLMG 4DR1Q 5H1SE 2JE6I 1RODA 2K6AA 1E1OA 3W3AA 4OL7A 4BY7H 4I65A 4HJ7A 4YWKA 4JI3Q 1PZKD 5ISRA 1EZ8A 4PMBA 2R93H 4QF4A 3FKIB 3AQQA 4KV6A 4A93G 5BN4A 3BZDB 4Y52H 2CWPA 2I5LX 2F4VL 1TVXA 5IOCA 1DOKA 2IX1A 2QGQA 1DGSA 1PTOD 1CI3M 2DGYA 2NB0A 4JYAL 2ZTEA 4BY1G 1HRJA 1S5FD 4Y7NH 1NBWA 4B08A 2B2WC 4U673 4J6HA 2DJGC 2KVMA 3KLSA 3VDYA 5IWAL 1SYFA 4DV5Q 1UE1A 3K80C 3CMAA 3EQLC 2UXBQ 4UPAA 3CD6A 1LTBD 1WYDA 4DR4L 3ULJA 5FLXL 1I3QB 1LLRD 4LF7Q 1BF4A 3GO5A 1I6HH 1VQHA 3MC0B 4V0BA 3E3XA 2HD3A 1XYIA 1EEFD 1KNEA 4UAIA 3VR5A 2K50A 1HTLD 3FKIG 3OYYA 1VQ7A 2ZJRA 1DOLA 1IHZA 4BS9A 4B3RL 1K83H 1PRTD 1YEZA 3AB9A 4LUZA 3JAMi 4FYDA 3I91A 4RHSA 1J5EL 3A56A 1WI5A 4P72A 1WD0A 1GM5A 1L1OB 2RDHA 4KK7A 1IKMA 1X56A 4O0AA 5LMUQ 2EYJA 5NUCA 1VDZA 2WKCA 4O2DA 1HZBA 2EDGA 4QL5A 4X65Q 2ALYB 4HSVA 2A19A 2L15A 5D3IB 5FJ8G 1S5ED 3HEJA 3J81c 4C3JB 3A5UA 2BOSA 2B2TC 3G6EA 1Q7YC 2EIFA 4RCNA 4G4KA 3K81C 2AKWB 1PVOA 1LTRD 4IQZA 4K8JA 4EQNA 4ZYSA 2B2YC 3HRZC 1S5CD 1OTCA 2PZUA 1MBYA 2NUCA 4A3MB 5FKAC 4EQ5A 1QE6A 1MJCA 2RF4A 1G291 2PYKA 3HOWG 3A8IE 4CKBA 1TIID 1EOTA 1B70B 4BXXG 3RN2A 4DFAA 3GTMB 1HNWQ 4JI2L 4UP9A 3MFGA 1FGUA 4BBRH 1K8GA 2UXDQ 5ELCA 1S5BD 3EIVA 4TSSA 4XTCS 4DGZA 2N8NA 4B3SQ 1X9NA 1RTNA 5C4XB 3MAQA 3NWSA 2OF1A 2F4VQ 1U4MA 2NN6I 3OW2A 3H0GH 4C3JG 3CC7A 4A3FH 4IFDJ 3NK9A 3KUPA 1TU2B 1K3BC 1NMFA 3I3CA 2VXWA 2B39A 2IL8A 2Q2IA 5I6YA 2IHEA 1D8LA 4ZAIA 4A3MG 2NTTA 5I9OA 1M90C 1XXGA 4L5SA 1EEID 4IFDG 3SK6A 4X62L 1TWCB 4JI7L 4JI8L 2A6ED 4AH6A 3J7A5 1SNCA 2XN9C 5M3MB 4ZKCB 2RKSA 3G4SA 1PXUA 1RJTA 3K0XA 2A74C 4WJWA 1UEAB 3ITPA 1SFOB 2M2LA 2EOTA 2F0NA 3GTOH 3U9SA 3RUZA 4JCVE 1XJVA 1VS0A 4OX9L 4JV5L 1II3A 5CV8A 1HR0L 1QNKA 2RCNA 1AZPA 3RZDB 4QCLA 1FD7D 3WOFA 3ER0A 4LF5L 1X3PA 3OTOQ 4A3KB 1NCVA 3GTQB 5C4XG 4TQUS 1D1IA 2F3WA 1KAAA 2BDOA 1ILQA 3R2IA 3QWNA 3QJYA 4JK1C 2KEEA 2NN6H 1WTXA 1HFGA 2F0LA 1HTPA 3D8GA 4RGMA 1TWAB 1G91A 2UUAQ 4IUQA 1LACA 1EQRA 4Q0FA 5AJ3Q 1Q82C 2Z6KC 2NVXB 1JOOA 3NP8A 1TWGB 2KA7A 1DOMA 2VUMH 4U68A 3AU7A 3NTHA 1PTOB 3NENA 4JI4L 3F1ZA 3MHBA 3JC66 1PH6A 2B63H 1K8AC 2HDLA 4NKLA 1AH9A 1STYA 1N9WA 3AYHB 4P73A 1KRTA 1F9RA 4DNTB 3DM1A 2E5LL 4MN3A 4EX5A 5IP7H 4QUFA 5JPNC 2D9UA 3KLSX 1R4PB 4A3KG 4DK1A 4A3DH 1B2TA 5E4XA 4DR7Q 5IGGA 2BH2A 4ZKBB 4G7ZC 2F0SA 1YITA 1HPCA 2KCMA 3S9WA 2WV6D 1EY7A 1UE5A 1I50H 4YCWA 3K57A 3OW7A 2V1CC 4YIJA 4JI2Q 3TEHB 3U4VA 4HEDA 1STEA 1YNJD 1PMRA 1ICWA 4BBSB 3CW2C 2R92G 3T53B 3AMUA 2WIIB 1EIGA 3T56B 5M3FB 2NWGA 3RLNA 2RA4A 2F1MA 2LS01 2K33A 1JORA 3S1RH 2DY7A 4OWXB 2B8FA 4X6AH 1SAPA 3GQBA 4QIWE 1SYCA 4DR2L 1I5FA 1VQFA 4KMUC 5EPJA 3J80E 1DCZA 1DYQA 1X3EA 2RQXA 3NTIA 3CRLC 3OWFA 2JSOA 4LAAA 1Q1BA 4B9WA 1B3QA 2R7ZB 1QUQB 1IZ6A 3EFXD 3M7GA 1VQ8A 1DXMA 3T16A 1VQOA 3RMHA 1PH9A 3M3YB 4GOPA 4F8MA 1TS3A 4YCVA 3SK4A 1X32A 2KECA 1HZCA 2WAQE 3GTGH 4JV5Q 3HOVH 1M1KC 5EQ0A 3PO2H 2AWOA 1X55A 2E2IB 1J8IA 1EIHA 3CCRA 2KQ3A 4BA1I 2JA6H 4LUVA 2LXJA 1VMCA 4GLAC 5D65A 3JAMc 5KNDA 2F3VA 5C0XJ 3D6CA 2Y0SE 3IRBA 4BA2I 1FYCA 4F88A 2A6HD 1WTPA 4OO1I 4ME5A 2IWHA 3PF5A 5C4JB 1WTWA 1YZ6A 4XT3B 2L9HA 4HAEA 4A3CG 5GAGC 4N8FA 4DV3L 1LT4D 4GLVB 1VQMA 1Q86C 5C0XG 2JA5B 2R7ZG 3FDTA 3DM3A 1GXDC 1LUZA 3BYTB 1TWFB 1I94L 1TWHH 3S14H 3EBEA 4R4TA 4LFCQ 1Y1VB 4OIKA 1KDCA 1SNMA 4DR3L 1B44D 3N52A 3PO3B 1NNXA 3I4MB 1VQGA 1QJOA 4GZYC 2CCZA 2CWAA 3O13A 4KKTA 2ZM6Q 5LHY1 3T1YQ 4CKEA 5HY6A 1SEBD 4GNXA 2ES2A 3H94A 1PTOF 1PRTC 1XTCD 3MXGA 2UXCL 4DK3C 2ID0A 1EY6A 3TS0A 4GN3B 3S16H 3K5OA 5ELBA 4A3LG 1EFWA 1VQNA 4OO1H 4WJ4A 2DUDA 3EVQA 4A3EB 4UDUC 1MSHA 1B1ZA 2WINB 1PH2A 2JA5G 4QIWB 3PSIA 2K03A 2K04A 5IGBA 1IKLA 1WFQA 1KLUD 4LFBL 4DUYQ 1B9MA 2DJFC 1Y1WG 2DNCA 3J7AF 1YNXA 1Y1VG 4ILWA
chains in the Genus database with same CATH topology
1PH7A 1VQ4A 2WFWA 4DKAC 3H0GG 2QA4A 4A3FG 3PO3G 2A1AA 1GD7A 5C3EG 4IO9A 3I4MG 4HIMA 1BBUA 1OXSC 3JC63 2KCTA 1TWAH 2KHIA 4UP7A 3H15A 2VNUD 3W5OA 3KFUA 1HZAA 2CQOA 1L0WA 4AIMA 1XPUA 4B3TQ 1VQDA 1WJJA 2I5HA 1K3RA 4PZ7A 2GVAA 1VQIA 1SMXA 5IYCH 5FLMG 3UDIA 3EN2A 4DR1Q 5H1SE 3CMEA 2NVXH 2JE6I 2IY5B 1TWGH 3TREA 1E1OA 4YWLA 4B3TL 4BY7H 4HJ7A 4YWKA 2R92H 4JI3Q 4HIOA 1TWFH 1SR3A 3U4ZA 4DR1L 2K75A 2F52A 1SLJA 1MIUA 1YI2A 4IOAA 2YYZA 2R93H 3W1GA 2Q2TA 1Q1EA 4A3EG 3AQQA 2D62A 4A93G 3J7ZC 1XPRA 3PGZA 4Y52H 2K52A 2CWPA 2I5LX 1C0AA 2F4VL 3NBHB 2ZTDA 3CCUA 4JYAQ 1B7YB 1EIFA 2IX1A 4L5QA 4DV7L 2QGQA 4P74A 1DGSA 2UUBQ 1ASYA 3GTLH 3UE0A 1QVGA 2DGYA 5IWAQ 4JYAL 4A76A 2ZTEA 2B29A 5GROA 4BY1G 4Y7NH 3S2DH 1NBWA 4A3JH 2UUBL 4B3MQ 3VDYA 1CUKA 2YTVA 2GVBA 2HQLA 3KDFB 1VQ9A 1JE5A 5IWAL 4DV5Q 1RIPA 1UE7A 2K5HA 1UE1A 2NN6G 3K80C 4DR4Q 2K14A 1K9MC 2Z6KA 4B3ML 1C9OA 3NELA 3PUZA 3CMAA 4JI5Q 1PYSB 1Q46A 2UXBQ 2YU9H 3L0OA 4UPAA 1CKNB 5DLQE 5IY0A 2VW9A 4DV5L 2H5XA 3RNUA 3CD6A 1JJGA 1WYDA 2MNAA 4DR4L 3GTPH 2WAQG 1SROA 2AMCB 3ULJA 2JK8A 4JI5L 4GOPC 4LF7Q 2VY3A 2UXBL 4C3IH 3PUWA 2HIXA 1G6PA 3GO5A 1I6HH 1XTDA 2MO0A 1VQHA 4KHZA 3PIOA 2HIVA 2VUMG 1L1OC 2JQOA 4LF7L 4A3GG 4KLKA 4B3RQ 3BZCA 4JBJA 2JA9A 1PHJA 4OWWB 3S1QH 2K50A 2AWNA 3FKIG 3OYYA 1VQ7A 5J3BA 2IT1A 2ZJRA 1J5EQ 2B63G 4R4IA 3SGIA 2Y0SG 3RR5A 2K4KA 4UP8A 4B3RL 3CCLA 1VQPA 1UWVA 1K83H 1YEZA 1JJCB 3GDEA 4LUZA 3JAMi 1R9TH 4DAMA 4HJ8A 5LMNW 1J5EL 2R7DA 1WI5A 4A3CH 5LMNQ 4P72A 4GOPB 1YJ9A 1MKHA 4XIGS 5IP7G 1OXVA 3KF6A 1SN8A 4NXMQ 1YBYA 3RLFA 1GM5A 2CKZB 1L1OB 5LMNL 4LFAL 4PMWA 1YHAA 3M4PA 1Z9FA 5IYBG 1X56A 4O0AA 1GVPA 5LMUQ 2OTJA 1YJWA 1GKHA 4LFAQ 1YHQA 4NXML 4NXNQ 3JC62 5M3MG 3GTJH 3I4OA 3M3YH 2I0QA 3FKIH 2JA7G 1YVCA 1PH5A 3STBD 4RMFA 4PZ6A 5LMUL 4NPSA 1HZBA 1W3SA 2NVYH 4O2DA 4QL5A 4X65Q 1Y14B 2ALYB 2N3SA 2A19A 4NXNL 3U50C 2L15A 2E2HH 3AFQA 2MQHA 5FJ8G 1KL9A 3I4NH 2VS1A 2N49A 1RL2A 3J81c 3G6EA 3A5UA 1Q7YC 3M9BA 2F3IA 4LWCA 2EIFA 4X66Q 1QUQA 4X65L 3F2DA 2E2IH 1EQQA 3K81C 1KQSA 2AKWB 2HT1A 1PVOA 1QZGA 2OWOA 3HOUG 3CXCA 1XNRQ 2KENA 4A3BH 1OXUA 4YHHQ 3Q8DA 4GS3A 4R1JA 3L7ZC 2MO1A 2PQAB 1JJ2A 1OTCA 1EYGA 2GN5A 1XNRL 1K73C 2Q2HA 4JOIC 4YHHL 1WOCA 3DLLA 1BKBA 2E2JH 2IHFA 4HJAA 4GNXC 4EQ5A 4DNIA 2UUCL 2HHHQ 4A3LH 5IP9H 1VCIA 4KHPQ 1MJCA 3UE1A 3TS2A 5C4JH 4LNQA 2RF4A 3MXNB 5C44H 1G291 1X65A 4RG1A 3HOWG 2HHHL 1PYBA 1E22A 4C2MH 1PV4A 4JI0Q 1EOVA 2E8GA 3BU2A 3D31A 3HKZE 4KHPL 4HJ5A 2JA5H 1QZHA 1B70B 4BXXG 3RN2A 3KLWA 1KAWA 1HNWQ 4JI2L 4UP9A 4JI0L 1FGUA 4BBRH 1E7ZA 1Y1WH 1K8GA 2UXDQ 4JBWA 3EIVA 4XTCS 4DAYB 3PIPA 3J80c 2N8NA 3ICEA 1LTLA 4B3SQ 1HNWL 4GNXB 1X9NA 1Y1VH 2UXDL 2F4VQ 2WP8J 2NN6I 3OW2A 1HNXQ 3H0GH 3CC7A 4A3FH 4HIDA 1IL2A 3PO3H 4IFDJ 4DV7Q 4B3SL 4H02A 1V1QA 3HOVG 2NZHA 5C3EH 3I4MH 2OTLA 4IOCA 3PO2G 1NMFA 5E7NA 2YV5A 2C35B 4PZ8A 5BR8Q 1HNXL 2JA6G 5GQOA 1Q8KA 2Q2IA 4X62Q 3CQZH 4JI7Q 4JI8Q 2IHEA 5FLMH 1A0IA 4R4QA 2VQFQ 4OONA 1D8LA 1LYLA 3RZOH 4R4OA 3G71A 4A3MG 5BR8L 1C7YA 4QQBX 3BJUA 1M90C 4L5SA 4IFDG 3GTKH 4TVAB 3D0FA 4X62L 1VQKA 4JI7L 4JI8L 4AH6A 3AEVA 1KRSA 2VQFL 3J7A5 3KJPA 1JT8A 2XTIA 2RHQB 3HOZG 2LXKA 3G4SA 4A3EH 1WCMG 3K0XA 4A93H 2ZTCA 3PUXA 1HR0W 4OX9Q 3U58A 1SE8A 1N33Q 5JJKA 1HR0Q 1YJNA 1N34Q 1OXTA 3KYHC 2NVQH 3GTOH 4BBSG 3CF5A 3CAMA 3I7FA 4JCVE 4YCUA 1XJVA 3M85A 1VS0A 4OX9L 4LF5Q 1N33L 4JV5L 1HR0L 1N34L 3FP9A 1O7IA 1VQAA 2RCNA 3PUVA 4X64Q 5M3FG 1QVFA 2K5NA 4BY1H 1E24A 1PFSA 3ER0A 4LF5L 1S3OA 2YTXA 3ERSX 3OTOQ 4A3IG 4DR6Q 5C4XG 4X64L 4JBMA 4TQUS 4GN4B 1EWIA 4DV1Q 1VQBA 1NTGA 5M5XH 1PH1A 3OTOL 3TRZA 4DR6L 3TQYA 3I56A 4DV1L 3CP0A 2PQAA 5IYDG 2UUAQ 2WB1E 4DV6Q 1S40A 2A8VA 1IBML 3K8AA 1K0RA 4MTNA 4IPHA 1EQRA 4P75A 5AJ3Q 1Q82C 1N8RC 2Z6KC 2UUAL 4DV6L 4GN5A 1H95A 4JI4Q 4WJ3M 4OXPA 3A0JA 1HH2P 4A3DG 2K5VA 5AJ3L 2VUMH 2D0OA 4LF8Q 3F2CA 1B8AA 1FVIA 1GO3E 2Z0SA 4A75A 1KC8C 4A3GH 1X54A 3NENA 1XPOA 3F1ZA 4JI1Q 4GLXA 4JI4L 3H3VI 4OO1G 3JC66 5IT9c 3HOYG 3S17H 2EQSA 2Q2UA 1PH6A 2B63H 1K8AC 4LF8L 3PF4A 2MFIA 1XNQQ 2E5LQ 4LF6Q 3UDFA 2PI2A 2OQKA 5ELNA 4JI1L 1HZ9A 4DV0Q 3A5ZB 1T9HA 4K0KQ 3KJOA 4JOIA 1AH9A 4GKJL 1CKOA 1N9WA 3AYHB 4P73A 1KRTA 2E5LL 4LF6L 1FJGQ 1XNQL 4DV0L 4EX5A 5IP7H 4AYBE 4MNOA 5HGQA 1VQ6A 4K0KL 1VQEA 1LM0A 2JEBI 4ME3A 4DV4L 4ALPA 3PCOB 1FJGL 4A3KG 2JA8G 1OXXK 4A3DH 1TWCH 5IYBH 5GADC 2UUCQ 1NE3A 3J81j 1NJIC 5JJIA 5M3MH 4DR7Q 1CSQA 1L2FA 1KD1C 3W1BA 4L5TA 2JA7H 4IJHA 2BH2A 3CPWA 1ASZA 1A62A 3CC4A 1YITA 4DR7L 2KCMA 1NMGA 5FJ8H 1MJEA 1IBKQ 1N32Q 1KXLA 4AQYQ 3ULPA 3I2ZA 4POGA 1UE5A 1FL0A 1I50H 1I3QH 4YCWA 2V1CC 4JI2Q 3TEHB 3U4VA 5IYCG 4GKKQ 1HNZQ 2N78A 3KDFA 1IBKL 4L5RC 5EAYA 1N32L 3HOUH 4QGUA 3NEMA 4C3HH 3CW2C 3UDXA 4AQYL 3AFPA 3J81i 2R92G 4YY3Q 4IJLA 3RLOA 4GKKL 4POFA 1HNZL 4A3KH 4HJ9A 1CKMA 4NB3A 3CCSA 2ASBA 3GTQH 3KF6B 1CKNA 4IFDI 3S1MH 2R93G 4LUOA 3RLNA 4QJFA 1JB7A 4YY3L 3H3VH 1PA6A 4DR2Q 1KHIA 2PNHA 2JJQA 5M5WH 4IPCA 4OWTB 4OWXB 4IPDA 4DUZQ 3S1RH 4X6AH 4QIWE 3M4QA 1NY4A 3S24A 4LW1A 1I5FA 1VQFA 1Q12A 1Z47A 2YTYA 4DR2L 1VQLA 4DUZL 3HOWH 1IBLQ 1X3EA 2KBNA 1E1TA 1P8LA 1UE6A 3L2PA 1AE3A 2B3GA 3HKZG 2ZJPA 1EIYB 1Q1BA 4A3JG 1JMCA 4BXXH 3T1HQ 3CCJA 1QUQB 1IZ6A 5GAEC 3WWVA 1IBLL 1VQ8A 1P16A 1X3FA 1VQOA 1PH9A 3CCMA 4JI3L 3T1HL 4GOPA 1D7QA 4YCVA 3ULLA 3B6YA 3KOJA 5ELOA 3CCVA 1IYJB 2QEXA 2IX0A 3E9IA 4DV2Q 1S72A 1HZCA 2WAQE 3J80i 3KF8B 4C3JH 1L1OA 3GTGH 1CSPA 4JV5Q 3HOVH 1X6OA 1M1KC 2PI2E 3LGJA 3PO2H 2AWOA 1SRUA 1X55A 4MZ9A 1A8VA 4DV2L 2JEAI 3K7AH 3MEFA 4PG3A 3CCRA 4BA1I 2JA6H 5C0XI 4LUVA 4A4IA 5JJLA 2LXJA 1E3PA 3PV0A 4GLAC 3S1NH 2BA0A 3CCQA 3RN5A 4A3MH 4DK6C 3JAMc 2UU9Q 4JBKA 1QVCA 4QY7A 5GAHC 1KIXA 2CFMA 2BA1A 5C0XJ 2Y0SE 3IRBA 4BA2I 4OO1I 2VL6A 4DV3Q 2UU9L 3E9HA 3PF5A 1IBMQ 2R7FA 3CC2A 1EUJA 1IXRA 1U0LA 1YHBA 2I5MX 1TXYA 1YZ6A 1PH3A 1VQCA 1WCMH 3HOZH 2OQ0A 5GAGC 4A3CG 5IE8A 4UY8C 1AE2A 1Q81C 4DV3L 3I55A 1XMQQ 4HIKA 4GLVB 1VQMA 2XGTA 4BBSH 1Q86C 5C0XG 1I94Q 2R7ZG 3GTMH 2LSSA 3DM3A 1N36Q 5JEAJ 1V43A 3UDGA 1XMQL 5M3FH 4R4CA 1LUZA 1HJPA 3HFZB 4DR3Q 1I94L 3PUYA 2ATWA 1TWHH 3K7UC 3EBEA 3CCEA 3S14H 4A3IH 1PH4A 5C4XH 2PMZE 1N36L 4KI0A 4R4TA 4LFCQ 3M7NA 3I4NG 3GD7A 4DR3L 4GKJQ 2D0PA 3E0EA 4J15A 5JEAG 2NZOA 4LFCL 1YIJA 5K36G 1VQGA 4DR5Q 5IYDH 3HOXG 4DV4Q 2CCZA 2CWAA 4A3BG 2EXDA 2WB1G 4JC0A 2R6GA 2ZM6Q 3T1YQ 2UXCQ 5HY6A 1UEBA 3G48A 4GNXA 2R7ZH 1BVSA 4JG2A 4DPGA 2ES2A 4DR5L 1W2BA 2ZJQA 2KHJA 2UXCL 2FXQA 4DK3C 2ZM6L 3T1YL 2VQEQ 1G51A 2ID0A 3TS0A 3M4OH 3F2BA 4GN3B 1XMOQ 3S16H 1VQJA 5IP9G 4A3LG 1EFWA 1VQNA 4WJ4A 2VQEL 3HOYH 2BH8A 1BBWA 2DUDA 3BZKA 4YWMA 5C44G 4JI6Q 3HKSA 3S2HH 1XMOL 4P71A 1SFOH 4LFBQ 3S15H 1A63A 2NVTH 3FHWA 1U5KA 5FLXc 4LF9Q 3A74A 1J6QA 1PH2A 1X3GA 3HOXH 2JA5G 3PSIA 4LF4Q 4JI6L 1WFQA 3STBC 4X66L 3ZJYC 4LFBL 4DUYQ 2AHOB 2RHSB 4BBRG 5M5YH 1VQ5A 3RZDH 1Y1WG 4LF9L 4BY7G 2VZAA 3CPFA 4AYBG 1YNXA 4IPGA 1V9PA 4LF4L 4FDBA 3F8TA 2JA8H 2OCEA 4DUYL 1Y1VG 1PH8A 4APVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PH7 A;  1VQ4 A;  2WFW A;  4DKA C;  3H0G G;  2QA4 A;  4A3F G;  3PO3 G;  2A1A A;  1GD7 A;  5C3E G;  4IO9 A;  3I4M G;  4HIM A;  1BBU A;  1OXS C;  3JC6 3;  2KCT A;  1TWA H;  2KHI A;  4UP7 A;  3H15 A;  2VNU D;  3W5O A;  3KFU A;  1HZA A;  2CQO A;  1L0W A;  4AIM A;  1XPU A;  4B3T Q;  1VQD A;  1WJJ A;  2I5H A;  1K3R A;  4PZ7 A;  2GVA A;  1VQI A;  1SMX A;  5IYC H;  5FLM G;  3UDI A;  3EN2 A;  4DR1 Q;  5H1S E;  3CME A;  2NVX H;  2JE6 I;  2IY5 B;  1TWG H;  3TRE A;  1E1O A;  4YWL A;  4B3T L;  4BY7 H;  4HJ7 A;  4YWK A;  2R92 H;  4JI3 Q;  4HIO A;  1TWF H;  1SR3 A;  3U4Z A;  4DR1 L;  2K75 A;  2F52 A;  1SLJ A;  1MIU A;  1YI2 A;  4IOA A;  2YYZ A;  2R93 H;  3W1G A;  2Q2T A;  1Q1E A;  4A3E G;  3AQQ A;  2D62 A;  4A93 G;  3J7Z C;  1XPR A;  3PGZ A;  4Y52 H;  2K52 A;  2CWP A;  2I5L X;  1C0A A;  2F4V L;  3NBH B;  2ZTD A;  3CCU A;  4JYA Q;  1B7Y B;  1EIF A;  2IX1 A;  4L5Q A;  4DV7 L;  2QGQ A;  4P74 A;  1DGS A;  2UUB Q;  1ASY A;  3GTL H;  3UE0 A;  1QVG A;  2DGY A;  5IWA Q;  4JYA L;  4A76 A;  2ZTE A;  2B29 A;  5GRO A;  4BY1 G;  4Y7N H;  3S2D H;  1NBW A;  4A3J H;  2UUB L;  4B3M Q;  3VDY A;  1CUK A;  2YTV A;  2GVB A;  2HQL A;  3KDF B;  1VQ9 A;  1JE5 A;  5IWA L;  4DV5 Q;  1RIP A;  1UE7 A;  2K5H A;  1UE1 A;  2NN6 G;  3K80 C;  4DR4 Q;  2K14 A;  1K9M C;  2Z6K A;  4B3M L;  1C9O A;  3NEL A;  3PUZ A;  3CMA A;  4JI5 Q;  1PYS B;  1Q46 A;  2UXB Q;  2YU9 H;  3L0O A;  4UPA A;  1CKN B;  5DLQ E;  5IY0 A;  2VW9 A;  4DV5 L;  2H5X A;  3RNU A;  3CD6 A;  1JJG A;  1WYD A;  2MNA A;  4DR4 L;  3GTP H;  2WAQ G;  1SRO A;  2AMC B;  3ULJ A;  2JK8 A;  4JI5 L;  4GOP C;  4LF7 Q;  2VY3 A;  2UXB L;  4C3I H;  3PUW A;  2HIX A;  1G6P A;  3GO5 A;  1I6H H;  1XTD A;  2MO0 A;  1VQH A;  4KHZ A;  3PIO A;  2HIV A;  2VUM G;  1L1O C;  2JQO A;  4LF7 L;  4A3G G;  4KLK A;  4B3R Q;  3BZC A;  4JBJ A;  2JA9 A;  1PHJ A;  4OWW B;  3S1Q H;  2K50 A;  2AWN A;  3FKI G;  3OYY A;  1VQ7 A;  5J3B A;  2IT1 A;  2ZJR A;  1J5E Q;  2B63 G;  4R4I A;  3SGI A;  2Y0S G;  3RR5 A;  2K4K A;  4UP8 A;  4B3R L;  3CCL A;  1VQP A;  1UWV A;  1K83 H;  1YEZ A;  1JJC B;  3GDE A;  4LUZ A;  3JAM i;  1R9T H;  4DAM A;  4HJ8 A;  5LMN W;  1J5E L;  2R7D A;  1WI5 A;  4A3C H;  5LMN Q;  4P72 A;  4GOP B;  1YJ9 A;  1MKH A;  4XIG S;  5IP7 G;  1OXV A;  3KF6 A;  1SN8 A;  4NXM Q;  1YBY A;  3RLF A;  1GM5 A;  2CKZ B;  1L1O B;  5LMN L;  4LFA L;  4PMW A;  1YHA A;  3M4P A;  1Z9F A;  5IYB G;  1X56 A;  4O0A A;  1GVP A;  5LMU Q;  2OTJ A;  1YJW A;  1GKH A;  4LFA Q;  1YHQ A;  4NXM L;  4NXN Q;  3JC6 2;  5M3M G;  3GTJ H;  3I4O A;  3M3Y H;  2I0Q A;  3FKI H;  2JA7 G;  1YVC A;  1PH5 A;  3STB D;  4RMF A;  4PZ6 A;  5LMU L;  4NPS A;  1HZB A;  1W3S A;  2NVY H;  4O2D A;  4QL5 A;  4X65 Q;  1Y14 B;  2ALY B;  2N3S A;  2A19 A;  4NXN L;  3U50 C;  2L15 A;  2E2H H;  3AFQ A;  2MQH A;  5FJ8 G;  1KL9 A;  3I4N H;  2VS1 A;  2N49 A;  1RL2 A;  3J81 c;  3G6E A;  3A5U A;  1Q7Y C;  3M9B A;  2F3I A;  4LWC A;  2EIF A;  4X66 Q;  1QUQ A;  4X65 L;  3F2D A;  2E2I H;  1EQQ A;  3K81 C;  1KQS A;  2AKW B;  2HT1 A;  1PVO A;  1QZG A;  2OWO A;  3HOU G;  3CXC A;  1XNR Q;  2KEN A;  4A3B H;  1OXU A;  4YHH Q;  3Q8D A;  4GS3 A;  4R1J A;  3L7Z C;  2MO1 A;  2PQA B;  1JJ2 A;  1OTC A;  1EYG A;  2GN5 A;  1XNR L;  1K73 C;  2Q2H A;  4JOI C;  4YHH L;  1WOC A;  3DLL A;  1BKB A;  2E2J H;  2IHF A;  4HJA A;  4GNX C;  4EQ5 A;  4DNI A;  2UUC L;  2HHH Q;  4A3L H;  5IP9 H;  1VCI A;  4KHP Q;  1MJC A;  3UE1 A;  3TS2 A;  5C4J H;  4LNQ A;  2RF4 A;  3MXN B;  5C44 H;  1G29 1;  1X65 A;  4RG1 A;  3HOW G;  2HHH L;  1PYB A;  1E22 A;  4C2M H;  1PV4 A;  4JI0 Q;  1EOV A;  2E8G A;  3BU2 A;  3D31 A;  3HKZ E;  4KHP L;  4HJ5 A;  2JA5 H;  1QZH A;  1B70 B;  4BXX G;  3RN2 A;  3KLW A;  1KAW A;  1HNW Q;  4JI2 L;  4UP9 A;  4JI0 L;  1FGU A;  4BBR H;  1E7Z A;  1Y1W H;  1K8G A;  2UXD Q;  4JBW A;  3EIV A;  4XTC S;  4DAY B;  3PIP A;  3J80 c;  2N8N A;  3ICE A;  1LTL A;  4B3S Q;  1HNW L;  4GNX B;  1X9N A;  1Y1V H;  2UXD L;  2F4V Q;  2WP8 J;  2NN6 I;  3OW2 A;  1HNX Q;  3H0G H;  3CC7 A;  4A3F H;  4HID A;  1IL2 A;  3PO3 H;  4IFD J;  4DV7 Q;  4B3S L;  4H02 A;  1V1Q A;  3HOV G;  2NZH A;  5C3E H;  3I4M H;  2OTL A;  4IOC A;  3PO2 G;  1NMF A;  5E7N A;  2YV5 A;  2C35 B;  4PZ8 A;  5BR8 Q;  1HNX L;  2JA6 G;  5GQO A;  1Q8K A;  2Q2I A;  4X62 Q;  3CQZ H;  4JI7 Q;  4JI8 Q;  2IHE A;  5FLM H;  1A0I A;  4R4Q A;  2VQF Q;  4OON A;  1D8L A;  1LYL A;  3RZO H;  4R4O A;  3G71 A;  4A3M G;  5BR8 L;  1C7Y A;  4QQB X;  3BJU A;  1M90 C;  4L5S A;  4IFD G;  3GTK H;  4TVA B;  3D0F A;  4X62 L;  1VQK A;  4JI7 L;  4JI8 L;  4AH6 A;  3AEV A;  1KRS A;  2VQF L;  3J7A 5;  3KJP A;  1JT8 A;  2XTI A;  2RHQ B;  3HOZ G;  2LXK A;  3G4S A;  4A3E H;  1WCM G;  3K0X A;  4A93 H;  2ZTC A;  3PUX A;  1HR0 W;  4OX9 Q;  3U58 A;  1SE8 A;  1N33 Q;  5JJK A;  1HR0 Q;  1YJN A;  1N34 Q;  1OXT A;  3KYH C;  2NVQ H;  3GTO H;  4BBS G;  3CF5 A;  3CAM A;  3I7F A;  4JCV E;  4YCU A;  1XJV A;  3M85 A;  1VS0 A;  4OX9 L;  4LF5 Q;  1N33 L;  4JV5 L;  1HR0 L;  1N34 L;  3FP9 A;  1O7I A;  1VQA A;  2RCN A;  3PUV A;  4X64 Q;  5M3F G;  1QVF A;  2K5N A;  4BY1 H;  1E24 A;  1PFS A;  3ER0 A;  4LF5 L;  1S3O A;  2YTX A;  3ERS X;  3OTO Q;  4A3I G;  4DR6 Q;  5C4X G;  4X64 L;  4JBM A;  4TQU S;  4GN4 B;  1EWI A;  4DV1 Q;  1VQB A;  1NTG A;  5M5X H;  1PH1 A;  3OTO L;  3TRZ A;  4DR6 L;  3TQY A;  3I56 A;  4DV1 L;  3CP0 A;  2PQA A;  5IYD G;  2UUA Q;  2WB1 E;  4DV6 Q;  1S40 A;  2A8V A;  1IBM L;  3K8A A;  1K0R A;  4MTN A;  4IPH A;  1EQR A;  4P75 A;  5AJ3 Q;  1Q82 C;  1N8R C;  2Z6K C;  2UUA L;  4DV6 L;  4GN5 A;  1H95 A;  4JI4 Q;  4WJ3 M;  4OXP A;  3A0J A;  1HH2 P;  4A3D G;  2K5V A;  5AJ3 L;  2VUM H;  2D0O A;  4LF8 Q;  3F2C A;  1B8A A;  1FVI A;  1GO3 E;  2Z0S A;  4A75 A;  1KC8 C;  4A3G H;  1X54 A;  3NEN A;  1XPO A;  3F1Z A;  4JI1 Q;  4GLX A;  4JI4 L;  3H3V I;  4OO1 G;  3JC6 6;  5IT9 c;  3HOY G;  3S17 H;  2EQS A;  2Q2U A;  1PH6 A;  2B63 H;  1K8A C;  4LF8 L;  3PF4 A;  2MFI A;  1XNQ Q;  2E5L Q;  4LF6 Q;  3UDF A;  2PI2 A;  2OQK A;  5ELN A;  4JI1 L;  1HZ9 A;  4DV0 Q;  3A5Z B;  1T9H A;  4K0K Q;  3KJO A;  4JOI A;  1AH9 A;  4GKJ L;  1CKO A;  1N9W A;  3AYH B;  4P73 A;  1KRT A;  2E5L L;  4LF6 L;  1FJG Q;  1XNQ L;  4DV0 L;  4EX5 A;  5IP7 H;  4AYB E;  4MNO A;  5HGQ A;  1VQ6 A;  4K0K L;  1VQE A;  1LM0 A;  2JEB I;  4ME3 A;  4DV4 L;  4ALP A;  3PCO B;  1FJG L;  4A3K G;  2JA8 G;  1OXX K;  4A3D H;  1TWC H;  5IYB H;  5GAD C;  2UUC Q;  1NE3 A;  3J81 j;  1NJI C;  5JJI A;  5M3M H;  4DR7 Q;  1CSQ A;  1L2F A;  1KD1 C;  3W1B A;  4L5T A;  2JA7 H;  4IJH A;  2BH2 A;  3CPW A;  1ASZ A;  1A62 A;  3CC4 A;  1YIT A;  4DR7 L;  2KCM A;  1NMG A;  5FJ8 H;  1MJE A;  1IBK Q;  1N32 Q;  1KXL A;  4AQY Q;  3ULP A;  3I2Z A;  4POG A;  1UE5 A;  1FL0 A;  1I50 H;  1I3Q H;  4YCW A;  2V1C C;  4JI2 Q;  3TEH B;  3U4V A;  5IYC G;  4GKK Q;  1HNZ Q;  2N78 A;  3KDF A;  1IBK L;  4L5R C;  5EAY A;  1N32 L;  3HOU H;  4QGU A;  3NEM A;  4C3H H;  3CW2 C;  3UDX A;  4AQY L;  3AFP A;  3J81 i;  2R92 G;  4YY3 Q;  4IJL A;  3RLO A;  4GKK L;  4POF A;  1HNZ L;  4A3K H;  4HJ9 A;  1CKM A;  4NB3 A;  3CCS A;  2ASB A;  3GTQ H;  3KF6 B;  1CKN A;  4IFD I;  3S1M H;  2R93 G;  4LUO A;  3RLN A;  4QJF A;  1JB7 A;  4YY3 L;  3H3V H;  1PA6 A;  4DR2 Q;  1KHI A;  2PNH A;  2JJQ A;  5M5W H;  4IPC A;  4OWT B;  4OWX B;  4IPD A;  4DUZ Q;  3S1R H;  4X6A H;  4QIW E;  3M4Q A;  1NY4 A;  3S24 A;  4LW1 A;  1I5F A;  1VQF A;  1Q12 A;  1Z47 A;  2YTY A;  4DR2 L;  1VQL A;  4DUZ L;  3HOW H;  1IBL Q;  1X3E A;  2KBN A;  1E1T A;  1P8L A;  1UE6 A;  3L2P A;  1AE3 A;  2B3G A;  3HKZ G;  2ZJP A;  1EIY B;  1Q1B A;  4A3J G;  1JMC A;  4BXX H;  3T1H Q;  3CCJ A;  1QUQ B;  1IZ6 A;  5GAE C;  3WWV A;  1IBL L;  1VQ8 A;  1P16 A;  1X3F A;  1VQO A;  1PH9 A;  3CCM A;  4JI3 L;  3T1H L;  4GOP A;  1D7Q A;  4YCV A;  3ULL A;  3B6Y A;  3KOJ A;  5ELO A;  3CCV A;  1IYJ B;  2QEX A;  2IX0 A;  3E9I A;  4DV2 Q;  1S72 A;  1HZC A;  2WAQ E;  3J80 i;  3KF8 B;  4C3J H;  1L1O A;  3GTG H;  1CSP A;  4JV5 Q;  3HOV H;  1X6O A;  1M1K C;  2PI2 E;  3LGJ A;  3PO2 H;  2AWO A;  1SRU A;  1X55 A;  4MZ9 A;  1A8V A;  4DV2 L;  2JEA I;  3K7A H;  3MEF A;  4PG3 A;  3CCR A;  4BA1 I;  2JA6 H;  5C0X I;  4LUV A;  4A4I A;  5JJL A;  2LXJ A;  1E3P A;  3PV0 A;  4GLA C;  3S1N H;  2BA0 A;  3CCQ A;  3RN5 A;  4A3M H;  4DK6 C;  3JAM c;  2UU9 Q;  4JBK A;  1QVC A;  4QY7 A;  5GAH C;  1KIX A;  2CFM A;  2BA1 A;  5C0X J;  2Y0S E;  3IRB A;  4BA2 I;  4OO1 I;  2VL6 A;  4DV3 Q;  2UU9 L;  3E9H A;  3PF5 A;  1IBM Q;  2R7F A;  3CC2 A;  1EUJ A;  1IXR A;  1U0L A;  1YHB A;  2I5M X;  1TXY A;  1YZ6 A;  1PH3 A;  1VQC A;  1WCM H;  3HOZ H;  2OQ0 A;  5GAG C;  4A3C G;  5IE8 A;  4UY8 C;  1AE2 A;  1Q81 C;  4DV3 L;  3I55 A;  1XMQ Q;  4HIK A;  4GLV B;  1VQM A;  2XGT A;  4BBS H;  1Q86 C;  5C0X G;  1I94 Q;  2R7Z G;  3GTM H;  2LSS A;  3DM3 A;  1N36 Q;  5JEA J;  1V43 A;  3UDG A;  1XMQ L;  5M3F H;  4R4C A;  1LUZ A;  1HJP A;  3HFZ B;  4DR3 Q;  1I94 L;  3PUY A;  2ATW A;  1TWH H;  3K7U C;  3EBE A;  3CCE A;  3S14 H;  4A3I H;  1PH4 A;  5C4X H;  2PMZ E;  1N36 L;  4KI0 A;  4R4T A;  4LFC Q;  3M7N A;  3I4N G;  3GD7 A;  4DR3 L;  4GKJ Q;  2D0P A;  3E0E A;  4J15 A;  5JEA G;  2NZO A;  4LFC L;  1YIJ A;  5K36 G;  1VQG A;  4DR5 Q;  5IYD H;  3HOX G;  4DV4 Q;  2CCZ A;  2CWA A;  4A3B G;  2EXD A;  2WB1 G;  4JC0 A;  2R6G A;  2ZM6 Q;  3T1Y Q;  2UXC Q;  5HY6 A;  1UEB A;  3G48 A;  4GNX A;  2R7Z H;  1BVS A;  4JG2 A;  4DPG A;  2ES2 A;  4DR5 L;  1W2B A;  2ZJQ A;  2KHJ A;  2UXC L;  2FXQ A;  4DK3 C;  2ZM6 L;  3T1Y L;  2VQE Q;  1G51 A;  2ID0 A;  3TS0 A;  3M4O H;  3F2B A;  4GN3 B;  1XMO Q;  3S16 H;  1VQJ A;  5IP9 G;  4A3L G;  1EFW A;  1VQN A;  4WJ4 A;  2VQE L;  3HOY H;  2BH8 A;  1BBW A;  2DUD A;  3BZK A;  4YWM A;  5C44 G;  4JI6 Q;  3HKS A;  3S2H H;  1XMO L;  4P71 A;  1SFO H;  4LFB Q;  3S15 H;  1A63 A;  2NVT H;  3FHW A;  1U5K A;  5FLX c;  4LF9 Q;  3A74 A;  1J6Q A;  1PH2 A;  1X3G A;  3HOX H;  2JA5 G;  3PSI A;  4LF4 Q;  4JI6 L;  1WFQ A;  3STB C;  4X66 L;  3ZJY C;  4LFB L;  4DUY Q;  2AHO B;  2RHS B;  4BBR G;  5M5Y H;  1VQ5 A;  3RZD H;  1Y1W G;  4LF9 L;  4BY7 G;  2VZA A;  3CPF A;  4AYB G;  1YNX A;  4IPG A;  1V9P A;  4LF4 L;  4FDB A;  3F8T A;  2JA8 H;  2OCE A;  4DUY L;  1Y1V G;  1PH8 A;  4APV A; 
#chains in the Genus database with same CATH topology
 4HMI A;  2WFW A;  4DKA C;  5CV7 A;  3Q6S A;  3PO3 G;  1F9P A;  1QWY A;  3I4M G;  4HIM A;  1BBU A;  1FNU A;  1OXS C;  1BCP D;  2CQO A;  2G5D A;  4CKC A;  1S4Z A;  1PZJ D;  1WJJ A;  4M1U B;  2WAQ B;  3BS1 A;  3UDI A;  2FIN B;  3CME A;  2IY5 B;  4OHJ A;  1KDA A;  4YWL A;  4K2K A;  4B3T L;  1SYD A;  2EYH A;  2RBM A;  4HIO A;  1U4R A;  3MXP A;  4DR1 L;  2F52 A;  1SLJ A;  4DXG A;  1YI2 A;  1Q1E A;  4A3E G;  1C48 A;  3PGZ A;  2NVY B;  2Y0S B;  1HXY D;  2JN4 A;  3TP6 A;  1IYU A;  3NBH B;  3TP8 A;  3I4N B;  1B7Y B;  4KJO A;  3QIA A;  4P74 A;  1ASY A;  1KLG D;  3HGB A;  5CV4 A;  4XT1 B;  1SNO A;  3GTL H;  3UE0 A;  3DMU A;  3BG3 A;  4C1N K;  3S2D H;  5GRO A;  2PNR C;  2PPB C;  5C4Z A;  2K05 A;  1EY9 A;  2GVB A;  3KDF B;  3VR3 A;  1VQ9 A;  1Y8O B;  2RDG A;  3NSW A;  2K14 A;  1K9M C;  1C9O A;  4JI5 Q;  4CBV A;  3V96 A;  5DLQ E;  5IY0 A;  1CKN B;  4DV5 L;  3RNU A;  2H5X A;  1JJG A;  2F0E A;  5IGD A;  2WAQ G;  5JOB A;  2JK8 A;  2A6E C;  2BE5 D;  2VY3 A;  2UXB L;  4C3I H;  1G6P A;  1WTQ A;  2K5D A;  4H44 C;  3PIO A;  2N88 A;  1D1K A;  4LF7 L;  2ZXR A;  4JBJ A;  4KY7 A;  5J22 A;  4IUU A;  2AWN A;  4CJ0 B;  4R4I A;  4CGY B;  2Y0S G;  1GUT A;  1V8Q A;  3RD4 A;  1VQP A;  2EYF A;  1JJC B;  1SYE A;  1R9T H;  4HJ8 A;  1LV9 A;  5LMN W;  5LMN Q;  5I2X A;  1YJ9 A;  2KED A;  3A8J E;  3DWA A;  2FMM A;  4XIG S;  4MIU A;  1CM9 A;  3CQZ B;  4PMW A;  1SE3 A;  3P20 A;  5IYB G;  1GVP A;  2OTJ A;  1YJW A;  1FNW A;  4NXN Q;  3GTJ H;  3I4O A;  2PZW A;  2HCI A;  3FKI H;  2JA7 G;  2Z9H A;  3D4R A;  3P1H A;  3STB D;  4PZ6 A;  5LMU L;  4NPS A;  3ERO A;  1W3S A;  3CXC A;  1Y14 B;  3VA5 A;  3VYT A;  3ERQ A;  1WTR A;  5IGE A;  2KJX A;  4X65 L;  5JEA H;  5HGT A;  3HOU G;  1XNR Q;  4A3B H;  2KEN A;  3K7A B;  2K5W A;  4YHH Q;  1TY2 A;  2LY7 A;  4GS3 A;  3L7Z C;  2L5T A;  3IFT A;  1EYG A;  3S1N B;  4JOI C;  2B2U C;  1WOC A;  3NBH A;  3KF8 A;  3DLL A;  3KLR A;  3U9O A;  4J1M A;  4PNY A;  2TSS A;  3UE1 A;  5IP9 H;  4KHP Q;  3E5S A;  5C44 H;  1FR3 A;  1WCM B;  4N8X 1;  3DHQ A;  1X65 A;  2FJ2 A;  2QF7 A;  1PYB A;  3C46 A;  4JI0 Q;  1EOV A;  3HKZ E;  3D31 A;  1A6X A;  3OOC A;  4HJ5 A;  4DAV A;  4OIJ A;  2EY1 A;  5CV5 A;  1KAW A;  3FRP B;  1E7Z A;  2D5D A;  2OEO A;  3PIP A;  2E74 C;  2F0D A;  1H9R A;  4K5W A;  3SK5 A;  2EYM A;  4KKU A;  1HA5 A;  1LTL A;  2OT2 A;  1HNW L;  2LKV A;  3ZYY X;  4A3I B;  3A54 A;  2UXD L;  1YNJ C;  1B50 A;  2IW3 A;  4HSP A;  4QB4 A;  2RSN A;  4B3S L;  2NZH A;  5C3E H;  4I7Z C;  1CQV A;  2C35 B;  2A68 D;  5BR8 Q;  1LTS D;  4RAU C;  5ELF A;  3T51 B;  2PQE A;  1A0I A;  4R4Q A;  4EVO A;  1LYL A;  1WTH A;  1K8M A;  3BJU A;  1R4Q B;  2XWB B;  1G2S A;  4TVA B;  3D0F A;  1VQK A;  3H91 A;  1HFN A;  1HQR D;  2XTI A;  2LXK A;  1WCM G;  3H6M A;  3QR8 A;  1N33 Q;  2JP1 A;  4ID6 A;  3S2H B;  3Q24 A;  1OXT A;  3IKJ A;  1TT2 A;  2NVQ H;  1L0Y B;  2SOB A;  4DNR B;  1EY5 A;  2Z4H A;  3QG1 A;  5C3X A;  4X3T A;  1TY0 A;  1WD1 A;  2K7V A;  2M9V A;  4C3H B;  1QVF A;  2K5N A;  1PDQ A;  4FXD A;  1AN8 A;  1LT5 D;  3ERS X;  4A3I G;  4DR6 Q;  4J8Q A;  4LJZ C;  2ZXP A;  1EWI A;  2IJ0 A;  2SNM A;  3Q23 A;  3R8B A;  1PH1 A;  3OTO L;  3TRZ A;  3TQY A;  4Z9C B;  5T1G A;  4DV6 Q;  1SJH D;  3V2T A;  3GV3 A;  4IPH A;  3HOW B;  2XSC A;  2A6H C;  1EQT A;  2EE1 A;  2UUA L;  3A0J A;  2B2T A;  5AJ3 L;  2D0O A;  3F2C A;  1BNZ A;  1B8A A;  1GO3 E;  1KC8 C;  2Z0S A;  3J80 L;  4A3G H;  2SNS A;  1SXT A;  3H3V I;  4JI1 Q;  2R93 B;  2XIW A;  3S17 H;  2Q2U A;  1SE4 A;  3HG9 A;  2B2Y A;  2MFI A;  1XNQ Q;  2F0F A;  3C1E A;  2PI2 A;  4XDX A;  5ELN A;  4IUR A;  3KJO A;  5EGT A;  3NTK A;  1CKO A;  4CHT B;  4ZQ3 A;  4C3H G;  2L55 A;  4MNO A;  4AYB E;  1LM0 A;  4ALP A;  3PCO B;  2B2V A;  3OIP A;  1TWC H;  3CU7 A;  5M3M H;  5E1F A;  1L2F A;  3UI2 A;  3W1B A;  1ASZ A;  1A62 A;  4DR7 L;  1IBK Q;  1NMG A;  5L37 A;  1X3Q A;  3I2Z A;  4GKK Q;  2C5C A;  5EAY A;  2F4I A;  5G3L D;  3NEM A;  5DEH A;  1YNN D;  4YY3 Q;  1ET9 A;  4S3S A;  4KJN A;  4HJ9 A;  4NB3 A;  1EY8 A;  1RF2 D;  4A3K H;  4H7B A;  3GTQ H;  3KF6 B;  2R93 G;  3S1M H;  1LT3 D;  4IUN A;  2A69 D;  1JB7 A;  3H3V H;  3FVQ A;  1A3T A;  5DNF A;  1KHI A;  2PNH A;  5M5W H;  4IPC A;  4IPD A;  1ENF A;  4ODG A;  4LK1 C;  5M9O A;  1NY4 A;  1VQL A;  1HUM A;  1Q12 A;  2YTY A;  4XYO A;  4IUT A;  4EGV A;  2B3G A;  3HKZ G;  1NSN S;  4G7H C;  3T1H Q;  3P75 A;  3N6R A;  3TBI B;  1BCP C;  1X3F A;  5JAV A;  3A8K E;  3P7J A;  3FEW X;  5CBE E;  1LO5 D;  5DM6 3;  1Z6H A;  3B6Y A;  3CCV A;  2ENB A;  2IX0 A;  4CJ2 C;  3E9I A;  4DV2 Q;  2G9H D;  1L1O A;  1I4Q A;  2ZT9 C;  2CH4 A;  2XRS D;  3TP7 A;  3HOX B;  5C0X I;  2M00 A;  4RH6 A;  1E3P A;  5IOD A;  5CV6 A;  5M5Y B;  3PV0 A;  3G7L A;  5KEE A;  2UU9 Q;  2O5I C;  5J39 A;  1QVC A;  4QY7 A;  2MUY A;  5GAH C;  2BA1 A;  5D3D A;  3G6J B;  2VL6 A;  1DM0 B;  1VF5 C;  3CC2 A;  1IXR A;  1U0L A;  3TZD A;  1YHB A;  3HOZ H;  1I4P A;  1PFM A;  2OQ0 A;  4UY8 C;  4O1N A;  2F0T A;  1XMQ Q;  4HIK A;  1ESF A;  1A3V A;  4BBS H;  2EPB A;  4RGN A;  5AFW A;  1V43 A;  2GA4 B;  4BBR B;  5M3F H;  2R92 B;  3K7U C;  1KTK A;  1ML0 D;  2K1B A;  1PH4 A;  1F77 A;  2BE5 C;  4FVM A;  1A15 A;  5KYI A;  4A3F B;  3BDL A;  3NQT A;  4J15 A;  4K6L A;  2EYP A;  2NZO A;  4LFC L;  4XQN A;  5K36 G;  5IYD H;  1Y8N B;  2VB2 X;  3HOX G;  3K5M A;  2EXD A;  5EKI A;  2R6G A;  4CDF C;  4ZCK A;  3SE0 A;  3KK7 A;  3VR4 A;  1UEB A;  1UUP A;  5KIX A;  3MFY A;  2R7Z H;  1BVS A;  1W2B A;  1Y8P B;  2FXQ A;  2ZM6 L;  3T1Y L;  3BVZ A;  2EVB A;  3F2B A;  1XMO Q;  4KHV A;  4FP5 D;  1VQJ A;  3OSO A;  1F9S A;  3HOY H;  2BH8 A;  1BBW A;  4YWM A;  4P71 A;  2F0U A;  5FK9 C;  1E2W A;  1A63 A;  2NVT H;  3FHW A;  4LF9 Q;  5FLX c;  3A74 A;  2KCC A;  1J6Q A;  4BWG B;  1HUN A;  4LF4 Q;  3STB C;  1H9M A;  4BBR G;  1PRT B;  2FFK B;  4AYB G;  4IPG A;  3PIP 3;  1ONL A;  2JA8 H;  4DUY L;  4PMC A;  1E2Z A;  3H0G G;  2H1E A;  4A3F G;  2OXP A;  4EQO A;  1GD7 A;  4IO9 A;  4UP7 A;  2KHI A;  5JPM C;  5C5M A;  1AZQ A;  5CV9 A;  4AIM A;  1XPU A;  3HS0 C;  5IYC H;  3EN2 A;  5K5P A;  3SK8 A;  1NAP A;  2HQE A;  2KUM A;  1EU4 A;  1TWF H;  3K59 A;  1SR3 A;  3NQI A;  3U4Z A;  2VUM B;  1MIU A;  5DAU A;  1DJR D;  2Q2T A;  2DNE A;  1RCV D;  1XPR A;  2B63 B;  1B4O A;  3D4D A;  3R3O A;  3KBG A;  4L5Q A;  2UUB Q;  5EPL A;  1QVG A;  1I4X A;  2B29 A;  4MTK A;  3D4W A;  4A3J H;  4B3M Q;  1J9O A;  2YTV A;  2A68 C;  1QCB D;  1RIP A;  2NN6 G;  3H3V C;  4DK0 A;  3NEL A;  3PUZ A;  1Q46 A;  1T5X D;  1H9K A;  2YU9 H;  2AUK A;  3ONA B;  4FF1 A;  3GTP H;  1SRO A;  1SYB A;  3JAM E;  1STN A;  4JI5 L;  4GOP C;  1CHQ D;  2X6G A;  3FPP A;  2HIX A;  3R93 A;  1JIC A;  2X69 A;  2HIV A;  2VUM G;  2KCN A;  4KN7 C;  4KLK A;  1Y1W B;  3BZC A;  4OWW B;  1PYW D;  3S1Q H;  4R8I A;  5J3B A;  2A73 B;  2B63 G;  3RR5 A;  2K4K A;  1D5X C;  1UWV A;  3GDE A;  4DF7 A;  3QOL A;  1K0S A;  4DAM A;  2X6L A;  2R7D A;  1MKH A;  5IP7 G;  1OXV A;  1SN8 A;  4NXM Q;  1YBY A;  3RLF A;  3L9A X;  5LMN L;  5IT9 E;  1JOK A;  2L0C A;  3RZO B;  2F0J A;  3MVV A;  4LFA Q;  4G7O C;  2EJG C;  1LTI D;  3GTK B;  4N9T A;  4RMF A;  4IAL A;  2IPK D;  2NVY H;  4NXN L;  2PO4 A;  2E2H H;  3K5L A;  3LWU A;  2MQH A;  3I4N H;  2VS1 A;  2N49 A;  1RL2 A;  2K28 A;  3M9B A;  5BN5 A;  1SNP A;  2CW0 D;  2F3I A;  3HOV B;  3F2D A;  1QUQ A;  1EQQ A;  3PO2 B;  5A35 A;  2I07 B;  1KQS A;  2HT1 A;  2OWO A;  3A55 A;  3DWP A;  4RFB A;  1F2L A;  1OXU A;  1C4Q A;  5E4W C;  5FO7 B;  2MO1 A;  1JJ2 A;  1XNR L;  2Q2H A;  2HDM A;  4YHH L;  4R8N A;  3F2U A;  2E2J H;  1Z7T A;  4GNX C;  4DNI A;  2XWJ B;  2HHH Q;  5M5X B;  1I4H A;  1VCI A;  4NDX A;  1AW7 A;  1NUC A;  1EL0 A;  3MXN B;  3EA6 A;  3K6O A;  3W2D A;  4ULL A;  1MSG A;  3MWY W;  4C2M H;  4KHP L;  4X3K A;  1PRT F;  1W6K A;  2L11 A;  3QB3 A;  4K5V A;  1QZH A;  4JI0 L;  1Y69 U;  4DAY B;  4FXK C;  4IN3 A;  1TWH B;  3S14 B;  5CR3 A;  4IZ8 A;  2EZV A;  1SMY D;  1HNX Q;  3D6W A;  1IW7 D;  1YNN C;  4NW2 A;  3HOV G;  4H02 A;  3PO2 G;  4IOC A;  1A3U A;  2YV5 A;  2JA6 G;  3HP3 A;  2A69 C;  2F0O A;  1Q8K A;  4DAP A;  1MI2 A;  3BDC A;  3L3O C;  3CQZ H;  5FLM H;  2VQF Q;  4OON A;  3OHX C;  4QQB X;  4DN4 M;  1D2B A;  5BR8 L;  1W6J A;  5I4D A;  1EWC A;  4R9W A;  1V1O A;  3AEV A;  3S16 B;  4L6T B;  1QNU A;  1JT8 A;  2RHQ B;  2PW7 A;  4HR7 B;  2JA7 B;  1ET6 A;  4A93 H;  2ZTC A;  4H0L C;  1SE8 A;  1HCZ A;  1YJN A;  1N34 Q;  1Q3L A;  3CF5 A;  3NXW A;  3I7F A;  3M85 A;  3K58 A;  2D2C C;  5FO9 B;  4CDE C;  1N33 L;  5A2Q E;  5KRU A;  1HHV A;  3FP9 A;  4ZLT F;  4X64 Q;  4N9P A;  3HOU B;  1DON A;  3IFD A;  4PV1 C;  4BY1 H;  1E24 A;  5J1Z A;  1PFS A;  3C1F A;  4KKS A;  4GN4 B;  4DV1 Q;  4K8I A;  2RCF A;  3X3M A;  1SDF A;  1ICF B;  4DR6 L;  3VYS A;  4C56 C;  4G57 A;  3I56 A;  3CP0 A;  1ILP A;  1IBM L;  5EBC A;  2KHS A;  1V1P B;  2DN8 A;  1K0R A;  4MTN A;  4P75 A;  1N8R C;  5JVH 3;  4DV6 L;  1H95 A;  3DXJ C;  2K32 A;  4UHV A;  2F03 A;  1O7L A;  1HH2 P;  5IGC A;  4LF8 Q;  1LTT D;  1X54 A;  1XPO A;  4GLX A;  1ESR A;  4OO1 G;  5EKL A;  2EQS A;  3PF4 A;  4LF6 Q;  3UDF A;  2LFN A;  4JI1 L;  4DV0 Q;  1HZ9 A;  3A5Z B;  1T9H A;  4K0K Q;  4JOI A;  1H9J A;  3J7Y W;  2O4X A;  5JJZ A;  3MXU A;  1FJG Q;  1XNQ L;  4DXF A;  4I7A A;  2G9D A;  1SJE D;  2MP1 A;  2CHB D;  1VQ6 A;  3URY A;  5HGQ A;  2RDF A;  3GTL B;  2DY8 A;  4ME3 A;  1TR5 A;  4PQX A;  4RGT A;  3S2D B;  1OXX K;  4L63 B;  1NJI C;  1CSQ A;  1STB A;  1DZ1 A;  1KD1 C;  1GUO A;  2L1B A;  4L5T A;  3NUC A;  1CFM A;  5HUR A;  1SBB B;  5FJ8 H;  1N32 Q;  2HUG A;  1TS5 A;  4AQY Q;  3WOE A;  3C2P A;  1I3Q H;  2CVR A;  1HNZ Q;  4KY5 A;  3KDF A;  4C3I B;  1IBK L;  4L5R C;  4C3H H;  3UDX A;  2QKI C;  4GKK L;  1CKM A;  2ASB A;  1CKN A;  4IFD I;  2CQA A;  1F2Z A;  1E2V A;  4QJF A;  4YY3 L;  1RD9 D;  1PA6 A;  1XWE A;  2JYO A;  4OWT B;  1T5E A;  4DUZ Q;  1ZYR D;  3MEH A;  1F2Y A;  1BXT A;  2BCO A;  3CKI B;  1R9T B;  3M4Q A;  2B2W A;  1CK1 A;  1OO9 B;  3HOW H;  1IBL Q;  2K01 A;  1JCK B;  4ZUJ A;  2L12 A;  1E1T A;  1P8L A;  1UE6 A;  3L2P A;  1AE3 A;  4WOR A;  4BXX H;  4CJ1 B;  3M4Y A;  3WWV A;  5GAE C;  1P16 A;  3GTJ B;  4EQP A;  2MGS A;  3M4O B;  3T1H L;  1V1P A;  1D7Q A;  2N55 A;  3KOJ A;  1JC7 A;  5ELO A;  1K28 A;  1S72 A;  3J80 i;  4C3J H;  1E0B A;  1EYC A;  1X6O A;  4TKO B;  1I4R A;  3S15 B;  1CZW A;  4C3I G;  1A8V A;  1PFB A;  4DV2 L;  3MEF A;  4PG3 A;  4A3B B;  2EYL A;  2J4X A;  1EY4 A;  1BCP B;  2BA0 A;  3CCQ A;  4A3M H;  1D6E C;  5CGK A;  1KIX A;  4IFD H;  3ND8 A;  1D5M C;  2FMC A;  1WTV A;  4FF4 A;  1VMP A;  1I4G A;  4QMG A;  1CQF A;  3SR1 A;  4RWS C;  2UU9 L;  3QOJ A;  1IBM Q;  1PH3 A;  1O78 A;  5C44 B;  2AQ3 B;  1G8Z D;  1GOZ A;  1Q81 C;  3I55 A;  5COY A;  5TSS A;  3GTM H;  4JW0 A;  2LSS A;  3WDN A;  1N36 Q;  5JEA J;  3UDG A;  1XX8 A;  1XMQ L;  2F0K A;  1EWH A;  4R4C A;  2PCF B;  3VR2 A;  4BY7 B;  3HFZ B;  1SYG A;  3HZX A;  3PUY A;  2R61 A;  5C4X H;  2PMZ E;  1S5D D;  4KI0 A;  2WAC A;  1D5Z C;  2NYZ D;  2ICE C;  1JWS D;  1UAP A;  2TMP A;  3E0E A;  3QO2 A;  5I6W A;  5JEA G;  5C3E B;  1ZXT A;  5FOB B;  1SE2 A;  1JWU D;  4DR5 Q;  4A3B G;  5T1I A;  1EZ6 A;  4JC0 A;  3T13 A;  5I9P A;  1G2T A;  4L8J A;  3DEP A;  2EY2 A;  4DU9 A;  4DPG A;  2SEB D;  2ZJQ A;  3HKZ B;  4Y7N B;  2VQE Q;  4KD4 A;  2QEJ C;  1JE4 A;  3J81 E;  1BOS A;  3MTS A;  2QW7 A;  1STA A;  5IP9 G;  3IAY A;  3VR6 A;  4B9X A;  1STG A;  5C44 G;  4JI6 Q;  3HKS A;  1XMO L;  1SFO H;  1U5K A;  4OGQ C;  4RCO A;  5K36 H;  2NVQ B;  3HOX H;  1LT6 D;  4X66 L;  3ZJY C;  2AHO B;  2RHS B;  3LX0 A;  5M5Y H;  3RZD H;  1VQ5 A;  4LF9 L;  4BY7 G;  1I6H B;  3CPF A;  1V9P A;  4LF4 L;  2CW0 C;  3JAM L;  1B53 A;  4APV A;  1PH7 A;  1VQ4 A;  2QA4 A;  1KNA A;  1ZKO A;  4HMJ A;  2BDN A;  2A1A A;  5C3E G;  2B2V C;  1HQM C;  3JC6 3;  1K83 B;  1TWA H;  2KCT A;  3H15 A;  2VNU D;  3I73 A;  1O80 A;  4K5X A;  1CT1 D;  1K3R A;  3GP7 A;  2GVA A;  1VQI A;  3OWE B;  4PZ7 A;  2JXM B;  3NPP A;  2NVX H;  1GUN A;  1TWG H;  3TRE A;  1U4L A;  2R3Z A;  4ZUI A;  5IGF A;  3MA2 B;  2R92 H;  4C1N I;  3K5N A;  5KNB A;  2K75 A;  1PTO H;  4A3G B;  3TDQ A;  4IOA A;  2YYZ A;  3W1G A;  5EPK A;  2D62 A;  5EJW A;  3S17 B;  3J7Z C;  5IT9 L;  2WKD A;  3E6Z X;  2K52 A;  1EFI D;  1C0A A;  2ZTD A;  3CCU A;  4JYA Q;  1EIF A;  3TP5 A;  1LAB A;  1AEX A;  3SVM A;  4DV7 L;  1BQQ T;  1MD2 D;  2EJM A;  1SMY C;  1TS2 A;  3I90 A;  5C4H A;  5IWA Q;  4A76 A;  2C9O A;  1IW7 C;  1CZG A;  2EYO A;  3PIO 3;  2UUB L;  1CUK A;  2HQL A;  1JE5 A;  1UE7 A;  2K5H A;  1EQV A;  4DR4 Q;  1EYD A;  5ELE A;  4HTH A;  4O42 A;  2Z6K A;  4HCE A;  3ND9 A;  4B3M L;  1PYS B;  2PMZ B;  3L0O A;  2ZXO A;  1EY0 A;  2VW9 A;  4LMQ D;  2MNA A;  4ABN A;  5DM7 3;  2AMC B;  5C6A A;  1C8C A;  3PUW A;  1BCP F;  1XTD A;  2MO0 A;  4KHZ A;  4JPB W;  4HCS A;  1L1O C;  1B3A A;  1LTG D;  2JQO A;  4V19 0;  4A3G G;  3I70 A;  3KBX A;  4B3R Q;  4CDD C;  2JA9 A;  4AYB B;  1PHJ A;  3S1M B;  3I8Z A;  2IT1 A;  1JWM D;  1SSO A;  1J5E Q;  5C3W A;  2MHV A;  3SGI A;  4UP8 A;  3CCL A;  5M5W B;  4OEM B;  2ICI A;  4FO2 A;  3H0G B;  4X3U A;  1U9R A;  4F7X A;  1Q90 A;  2QIL A;  4A3C H;  4GOP B;  4RGO S;  1IL8 A;  5JVG 3;  3KF6 A;  2CKZ B;  5C0X H;  1WTO A;  3C3L A;  3NBI A;  1YHA A;  2F0P A;  3M4P A;  1Z9F A;  2NBF A;  4NP5 A;  1GKH A;  1YHQ A;  4NXM L;  3JC6 2;  5M3M G;  2NZ1 D;  3M3Y H;  4WFN 3;  1QIL A;  2I0Q A;  2J7Z A;  1YVC A;  1PH5 A;  4M8A A;  4LFA L;  2O5J C;  3U50 C;  2N3S A;  4FF3 A;  3AFQ A;  1KL9 A;  1JOQ A;  4X66 Q;  4LWC A;  4XQJ A;  5ELD A;  2E2I H;  1WVL A;  3FPU B;  1JB3 A;  1TQO A;  1QZG A;  3GTO B;  1F9Q A;  2AQ1 B;  1Q8I A;  3Q8D A;  4R1J A;  4XQQ A;  1F2M A;  2F0W A;  2PQA B;  3D3R A;  2GN5 A;  3OPO A;  1SND A;  2EXZ A;  2VB3 X;  1K73 C;  3DEO A;  1BKB A;  2IHF A;  5FLX E;  1PFN A;  4HJA A;  1BDO A;  5I2Y A;  5A2Q L;  2UUC L;  2Q8T A;  4A3L H;  1FGB D;  3TS2 A;  4HN7 A;  5C4J H;  4LNQ A;  3HOZ B;  3DWQ A;  4RG1 A;  3CRK C;  2HHH L;  1PV4 A;  1E22 A;  3TME A;  2E8G A;  3BU2 A;  2JA5 H;  3PMF A;  5C5L A;  3LWE A;  3KLW A;  4KTA A;  3CHB D;  1Y1W H;  4JBW A;  3E0J A;  3J80 c;  3ICE A;  4XXE A;  4JVZ A;  4CDC C;  4GNX B;  1Y1V H;  2L4N A;  2EJF C;  2IX3 A;  2WP8 J;  1K8O A;  4HID A;  3SDZ A;  1IL2 A;  3PO3 H;  4DV7 Q;  1V1Q A;  2KOL A;  5CMD A;  3I4M H;  2OTL A;  5E7N A;  2HCC A;  4PZ8 A;  1HNX L;  5GQO A;  1QOH A;  4X62 Q;  4JI7 Q;  4JI8 Q;  4DA2 A;  3RZO H;  4R4O A;  3G71 A;  1ZYR C;  1C7Y A;  2A5H A;  3VA7 A;  5LL6 S;  4ZRZ A;  2J0T D;  3GTK H;  4A3D B;  1KRS A;  2VQF L;  3KJP A;  3TN2 A;  3GV6 A;  3HOZ G;  2EY5 A;  1STH A;  3HOY B;  4A3E H;  1HR0 W;  3PUX A;  4OX9 Q;  3U58 A;  5JJK A;  2F0Q A;  1HR0 Q;  3FMC A;  3KYH C;  2NVT B;  1I6V C;  4KD3 A;  4BBS G;  3CAM A;  4YCU A;  1I50 B;  4LF5 Q;  1N34 L;  1O7I A;  1VQA A;  2Z1C A;  3PUV A;  5M3F G;  1BO0 A;  3I4L A;  1S3O A;  2YTX A;  2JA8 B;  4X64 L;  4JBM A;  3BVG A;  1PTO C;  1VQB A;  1NTG A;  5M5X H;  2K5Q A;  4KY6 A;  3LNN A;  4IUV A;  3S1R B;  4DV1 L;  2PQA A;  5IYD G;  2WB1 E;  3NWT A;  2EY6 A;  1S40 A;  2A8V A;  3K8A A;  5F2D A;  2Q8R E;  4GN5 A;  4JI4 Q;  4WJ3 M;  4OXP A;  4A3D G;  5KNC A;  2K5V A;  2MPM A;  4XYQ A;  1FVI A;  3V05 A;  4A75 A;  1G6Z A;  3EJI A;  5IT9 c;  3HOY G;  4LF8 L;  2AQ2 B;  4E6I A;  2E5L Q;  2OQK A;  3GTG B;  3TSS A;  3DUZ A;  4GKJ L;  1DD2 A;  4QUC A;  4LF6 L;  4DV0 L;  4RKL A;  1CHP D;  3NE5 B;  2JA6 B;  1VQE A;  4K0K L;  1GHJ A;  2JEB I;  4DV4 L;  4FNF A;  5E3F A;  3Q22 A;  2JA8 G;  1FJG L;  2F0H A;  4A3J B;  1ZEQ X;  5IYB H;  5GAD C;  1NE3 A;  3J81 j;  2UUC Q;  5JJI A;  5EBD A;  2H4O A;  2JA7 H;  2I46 A;  5D14 A;  4IJH A;  3NHH A;  4RA8 A;  3CPW A;  1EU3 A;  3CC4 A;  2XVS A;  2YU9 B;  1MJE A;  1HA6 A;  1MGS A;  1KXL A;  3MZ5 A;  3ULP A;  1FNV A;  2LMC B;  2QDB A;  4POG A;  3GTP B;  1AFP A;  1FL0 A;  5IYC G;  2F0V A;  2N78 A;  1H9S B;  1U4P A;  1GUW A;  1N32 L;  3HOU H;  4QGU A;  4AQY L;  3AFP A;  3J81 i;  4IJL A;  3RLO A;  3K0Y A;  4POF A;  2Q8I B;  1HNZ L;  1BUV T;  3CCS A;  1VF7 A;  1GUS A;  3J7A V;  1B9N A;  4LUO A;  3S1Q B;  2QDL A;  1A2T A;  4DR2 Q;  2F0M A;  2FHT A;  2JJQ A;  4H13 C;  2E2D C;  3H09 A;  3S24 A;  4LW1 A;  1Z47 A;  4DUZ L;  3SEB A;  2KBN A;  2PZT A;  4Q5V A;  3A7A B;  2ZJP A;  1PZI D;  1QG7 A;  1EIY B;  4A3J G;  1JMC A;  3CCJ A;  1IBL L;  5COR A;  3R2T A;  2RVL A;  3TZU A;  3VYU A;  5BN3 A;  3BDO A;  5CBA E;  3IL8 A;  3CCM A;  4JI3 L;  4WRD A;  1ENA A;  2F0G A;  3ULL A;  1IYJ B;  2QEX A;  2E2H B;  3X3N A;  3KF8 B;  1TS4 A;  1CSP A;  1M4V A;  2PI2 E;  3J81 L;  3LGJ A;  1SRU A;  4MZ9 A;  1L0X B;  5KGU A;  2JEA I;  3K7A H;  2CH4 W;  1JQY D;  2WB1 B;  4A4I A;  5JJL A;  4P2C B;  1BBX C;  1RHP A;  3S1N H;  4RKB A;  3RN5 A;  4JBK A;  4DK6 C;  5G3L F;  4IUP A;  1SNQ A;  4FXG C;  1GUG A;  1RDP D;  1RTO A;  2CFM A;  2RSO A;  2E2J B;  3OMC A;  2B8G A;  2E76 C;  2F0I A;  2NTS A;  4DV3 Q;  3E9H A;  2R7F A;  1NR2 A;  1EUJ A;  2QCP X;  3BYY B;  4OEL B;  5CYU A;  4F87 A;  2I5M X;  1TXY A;  1VQC A;  1WCM H;  1CA5 A;  5IE8 A;  1AE2 A;  4C2M B;  2XGT A;  1GHK A;  2XNA C;  1I94 Q;  4RHR A;  5CC4 A;  1A2U A;  4KN4 C;  1LTA D;  1HJP A;  4DR3 Q;  3MXN A;  2ATW A;  3CCE A;  1KAB A;  4A3I H;  1N36 L;  1ENC A;  3VYR A;  2Z6B A;  3M7N A;  3I4N G;  1H9S A;  3GD7 A;  4GKJ Q;  2D0P A;  2Z4I A;  5EKK A;  1KDB A;  3A7L A;  3SXH A;  1YIJ A;  5KYL A;  2B2U A;  2Z8L A;  2SDF A;  3T4A C;  2AUJ D;  2WB1 G;  4DAY A;  4DV4 Q;  2UXC Q;  5FO8 B;  2E75 C;  3G48 A;  4JG2 A;  4K2L A;  4DR5 L;  2KHJ A;  4MHE A;  1CA6 A;  1O7Y A;  1G51 A;  3BVM A;  2MJ8 A;  3M4O H;  1CTM A;  1EYA A;  3PQI A;  2VQE L;  2O2L D;  3BZK A;  1AP0 A;  3OMG A;  2P5Z X;  4A93 B;  4ZK9 B;  3S2H H;  1IYV A;  4LFB Q;  4K6D A;  1BR9 A;  3S15 H;  4NMZ A;  1X3G A;  1PLF A;  4K14 A;  4JI6 L;  4FF2 A;  1O7Z A;  4X3S A;  2VZA A;  3OIQ A;  3I72 A;  4BY1 B;  1QB5 D;  4FDB A;  4TRD A;  3F8T A;  2OCE A;  1TKW B;  1M8A A;  5LL6 X;  1UNS A;  1PH8 A;  1MHW C;  3SHL A;  1NR4 A;  2PW5 A;  1GJX A;  5IIF A;  1JR0 D;  3W5O A;  3Q0A A;  3KFU A;  1HZA A;  1L0W A;  4B3T Q;  1VQD A;  2I5H A;  2XRQ D;  1RKN A;  2V4D A;  1SMX A;  5FLM G;  4DR1 Q;  5H1S E;  2JE6 I;  1ROD A;  2K6A A;  1E1O A;  3W3A A;  4OL7 A;  4BY7 H;  4I65 A;  4HJ7 A;  4YWK A;  4JI3 Q;  1PZK D;  5ISR A;  1EZ8 A;  4PMB A;  2R93 H;  4QF4 A;  3FKI B;  3AQQ A;  4KV6 A;  4A93 G;  5BN4 A;  3BZD B;  4Y52 H;  2CWP A;  2I5L X;  2F4V L;  1TVX A;  5IOC A;  1DOK A;  2IX1 A;  2QGQ A;  1DGS A;  1PTO D;  1CI3 M;  2DGY A;  2NB0 A;  4JYA L;  2ZTE A;  4BY1 G;  1HRJ A;  1S5F D;  4Y7N H;  1NBW A;  4B08 A;  2B2W C;  4U67 3;  4J6H A;  2DJG C;  2KVM A;  3KLS A;  3VDY A;  5IWA L;  1SYF A;  4DV5 Q;  1UE1 A;  3K80 C;  3CMA A;  3EQL C;  2UXB Q;  4UPA A;  3CD6 A;  1LTB D;  1WYD A;  4DR4 L;  3ULJ A;  5FLX L;  1I3Q B;  1LLR D;  4LF7 Q;  1BF4 A;  3GO5 A;  1I6H H;  1VQH A;  3MC0 B;  4V0B A;  3E3X A;  2HD3 A;  1XYI A;  1EEF D;  1KNE A;  4UAI A;  3VR5 A;  2K50 A;  1HTL D;  3FKI G;  3OYY A;  1VQ7 A;  2ZJR A;  1DOL A;  1IHZ A;  4BS9 A;  4B3R L;  1K83 H;  1PRT D;  1YEZ A;  3AB9 A;  4LUZ A;  3JAM i;  4FYD A;  3I91 A;  4RHS A;  1J5E L;  3A56 A;  1WI5 A;  4P72 A;  1WD0 A;  1GM5 A;  1L1O B;  2RDH A;  4KK7 A;  1IKM A;  1X56 A;  4O0A A;  5LMU Q;  2EYJ A;  5NUC A;  1VDZ A;  2WKC A;  4O2D A;  1HZB A;  2EDG A;  4QL5 A;  4X65 Q;  2ALY B;  4HSV A;  2A19 A;  2L15 A;  5D3I B;  5FJ8 G;  1S5E D;  3HEJ A;  3J81 c;  4C3J B;  3A5U A;  2BOS A;  2B2T C;  3G6E A;  1Q7Y C;  2EIF A;  4RCN A;  4G4K A;  3K81 C;  2AKW B;  1PVO A;  1LTR D;  4IQZ A;  4K8J A;  4EQN A;  4ZYS A;  2B2Y C;  3HRZ C;  1S5C D;  1OTC A;  2PZU A;  1MBY A;  2NUC A;  4A3M B;  5FKA C;  4EQ5 A;  1QE6 A;  1MJC A;  2RF4 A;  1G29 1;  2PYK A;  3HOW G;  3A8I E;  4CKB A;  1TII D;  1EOT A;  1B70 B;  4BXX G;  3RN2 A;  4DFA A;  3GTM B;  1HNW Q;  4JI2 L;  4UP9 A;  3MFG A;  1FGU A;  4BBR H;  1K8G A;  2UXD Q;  5ELC A;  1S5B D;  3EIV A;  4TSS A;  4XTC S;  4DGZ A;  2N8N A;  4B3S Q;  1X9N A;  1RTN A;  5C4X B;  3MAQ A;  3NWS A;  2OF1 A;  2F4V Q;  1U4M A;  2NN6 I;  3OW2 A;  3H0G H;  4C3J G;  3CC7 A;  4A3F H;  4IFD J;  3NK9 A;  3KUP A;  1TU2 B;  1K3B C;  1NMF A;  3I3C A;  2VXW A;  2B39 A;  2IL8 A;  2Q2I A;  5I6Y A;  2IHE A;  1D8L A;  4ZAI A;  4A3M G;  2NTT A;  5I9O A;  1M90 C;  1XXG A;  4L5S A;  1EEI D;  4IFD G;  3SK6 A;  4X62 L;  1TWC B;  4JI7 L;  4JI8 L;  2A6E D;  4AH6 A;  3J7A 5;  1SNC A;  2XN9 C;  5M3M B;  4ZKC B;  2RKS A;  3G4S A;  1PXU A;  1RJT A;  3K0X A;  2A74 C;  4WJW A;  1UEA B;  3ITP A;  1SFO B;  2M2L A;  2EOT A;  2F0N A;  3GTO H;  3U9S A;  3RUZ A;  4JCV E;  1XJV A;  1VS0 A;  4OX9 L;  4JV5 L;  1II3 A;  5CV8 A;  1HR0 L;  1QNK A;  2RCN A;  1AZP A;  3RZD B;  4QCL A;  1FD7 D;  3WOF A;  3ER0 A;  4LF5 L;  1X3P A;  3OTO Q;  4A3K B;  1NCV A;  3GTQ B;  5C4X G;  4TQU S;  1D1I A;  2F3W A;  1KAA A;  2BDO A;  1ILQ A;  3R2I A;  3QWN A;  3QJY A;  4JK1 C;  2KEE A;  2NN6 H;  1WTX A;  1HFG A;  2F0L A;  1HTP A;  3D8G A;  4RGM A;  1TWA B;  1G91 A;  2UUA Q;  4IUQ A;  1LAC A;  1EQR A;  4Q0F A;  5AJ3 Q;  1Q82 C;  2Z6K C;  2NVX B;  1JOO A;  3NP8 A;  1TWG B;  2KA7 A;  1DOM A;  2VUM H;  4U68 A;  3AU7 A;  3NTH A;  1PTO B;  3NEN A;  4JI4 L;  3F1Z A;  3MHB A;  3JC6 6;  1PH6 A;  2B63 H;  1K8A C;  2HDL A;  4NKL A;  1AH9 A;  1STY A;  1N9W A;  3AYH B;  4P73 A;  1KRT A;  1F9R A;  4DNT B;  3DM1 A;  2E5L L;  4MN3 A;  4EX5 A;  5IP7 H;  4QUF A;  5JPN C;  2D9U A;  3KLS X;  1R4P B;  4A3K G;  4DK1 A;  4A3D H;  1B2T A;  5E4X A;  4DR7 Q;  5IGG A;  2BH2 A;  4ZKB B;  4G7Z C;  2F0S A;  1YIT A;  1HPC A;  2KCM A;  3S9W A;  2WV6 D;  1EY7 A;  1UE5 A;  1I50 H;  4YCW A;  3K57 A;  3OW7 A;  2V1C C;  4YIJ A;  4JI2 Q;  3TEH B;  3U4V A;  4HED A;  1STE A;  1YNJ D;  1PMR A;  1ICW A;  4BBS B;  3CW2 C;  2R92 G;  3T53 B;  3AMU A;  2WII B;  1EIG A;  3T56 B;  5M3F B;  2NWG A;  3RLN A;  2RA4 A;  2F1M A;  2LS0 1;  2K33 A;  1JOR A;  3S1R H;  2DY7 A;  4OWX B;  2B8F A;  4X6A H;  1SAP A;  3GQB A;  4QIW E;  1SYC A;  4DR2 L;  1I5F A;  1VQF A;  4KMU C;  5EPJ A;  3J80 E;  1DCZ A;  1DYQ A;  1X3E A;  2RQX A;  3NTI A;  3CRL C;  3OWF A;  2JSO A;  4LAA A;  1Q1B A;  4B9W A;  1B3Q A;  2R7Z B;  1QUQ B;  1IZ6 A;  3EFX D;  3M7G A;  1VQ8 A;  1DXM A;  3T16 A;  1VQO A;  3RMH A;  1PH9 A;  3M3Y B;  4GOP A;  4F8M A;  1TS3 A;  4YCV A;  3SK4 A;  1X32 A;  2KEC A;  1HZC A;  2WAQ E;  3GTG H;  4JV5 Q;  3HOV H;  1M1K C;  5EQ0 A;  3PO2 H;  2AWO A;  1X55 A;  2E2I B;  1J8I A;  1EIH A;  3CCR A;  2KQ3 A;  4BA1 I;  2JA6 H;  4LUV A;  2LXJ A;  1VMC A;  4GLA C;  5D65 A;  3JAM c;  5KND A;  2F3V A;  5C0X J;  3D6C A;  2Y0S E;  3IRB A;  4BA2 I;  1FYC A;  4F88 A;  2A6H D;  1WTP A;  4OO1 I;  4ME5 A;  2IWH A;  3PF5 A;  5C4J B;  1WTW A;  1YZ6 A;  4XT3 B;  2L9H A;  4HAE A;  4A3C G;  5GAG C;  4N8F A;  4DV3 L;  1LT4 D;  4GLV B;  1VQM A;  1Q86 C;  5C0X G;  2JA5 B;  2R7Z G;  3FDT A;  3DM3 A;  1GXD C;  1LUZ A;  3BYT B;  1TWF B;  1I94 L;  1TWH H;  3S14 H;  3EBE A;  4R4T A;  4LFC Q;  1Y1V B;  4OIK A;  1KDC A;  1SNM A;  4DR3 L;  1B44 D;  3N52 A;  3PO3 B;  1NNX A;  3I4M B;  1VQG A;  1QJO A;  4GZY C;  2CCZ A;  2CWA A;  3O13 A;  4KKT A;  2ZM6 Q;  5LHY 1;  3T1Y Q;  4CKE A;  5HY6 A;  1SEB D;  4GNX A;  2ES2 A;  3H94 A;  1PTO F;  1PRT C;  1XTC D;  3MXG A;  2UXC L;  4DK3 C;  2ID0 A;  1EY6 A;  3TS0 A;  4GN3 B;  3S16 H;  3K5O A;  5ELB A;  4A3L G;  1EFW A;  1VQN A;  4OO1 H;  4WJ4 A;  2DUD A;  3EVQ A;  4A3E B;  4UDU C;  1MSH A;  1B1Z A;  2WIN B;  1PH2 A;  2JA5 G;  4QIW B;  3PSI A;  2K03 A;  2K04 A;  5IGB A;  1IKL A;  1WFQ A;  1KLU D;  4LFB L;  4DUY Q;  1B9M A;  2DJF C;  1Y1W G;  2DNC A;  3J7A F;  1YNX A;  1Y1V G;  4ILW A; 
#chains in the Genus database with same CATH homology
 1PH7 A;  1VQ4 A;  2WFW A;  4DKA C;  3H0G G;  2QA4 A;  4A3F G;  3PO3 G;  2A1A A;  1GD7 A;  5C3E G;  4IO9 A;  3I4M G;  4HIM A;  1BBU A;  1OXS C;  3JC6 3;  2KCT A;  1TWA H;  2KHI A;  4UP7 A;  3H15 A;  2VNU D;  3W5O A;  3KFU A;  1HZA A;  2CQO A;  1L0W A;  4AIM A;  1XPU A;  4B3T Q;  1VQD A;  1WJJ A;  2I5H A;  1K3R A;  4PZ7 A;  2GVA A;  1VQI A;  1SMX A;  5IYC H;  5FLM G;  3UDI A;  3EN2 A;  4DR1 Q;  5H1S E;  3CME A;  2NVX H;  2JE6 I;  2IY5 B;  1TWG H;  3TRE A;  1E1O A;  4YWL A;  4B3T L;  4BY7 H;  4HJ7 A;  4YWK A;  2R92 H;  4JI3 Q;  4HIO A;  1TWF H;  1SR3 A;  3U4Z A;  4DR1 L;  2K75 A;  2F52 A;  1SLJ A;  1MIU A;  1YI2 A;  4IOA A;  2YYZ A;  2R93 H;  3W1G A;  2Q2T A;  1Q1E A;  4A3E G;  3AQQ A;  2D62 A;  4A93 G;  3J7Z C;  1XPR A;  3PGZ A;  4Y52 H;  2K52 A;  2CWP A;  2I5L X;  1C0A A;  2F4V L;  3NBH B;  2ZTD A;  3CCU A;  4JYA Q;  1B7Y B;  1EIF A;  2IX1 A;  4L5Q A;  4DV7 L;  2QGQ A;  4P74 A;  1DGS A;  2UUB Q;  1ASY A;  3GTL H;  3UE0 A;  1QVG A;  2DGY A;  5IWA Q;  4JYA L;  4A76 A;  2ZTE A;  2B29 A;  5GRO A;  4BY1 G;  4Y7N H;  3S2D H;  1NBW A;  4A3J H;  2UUB L;  4B3M Q;  3VDY A;  1CUK A;  2YTV A;  2GVB A;  2HQL A;  3KDF B;  1VQ9 A;  1JE5 A;  5IWA L;  4DV5 Q;  1RIP A;  1UE7 A;  2K5H A;  1UE1 A;  2NN6 G;  3K80 C;  4DR4 Q;  2K14 A;  1K9M C;  2Z6K A;  4B3M L;  1C9O A;  3NEL A;  3PUZ A;  3CMA A;  4JI5 Q;  1PYS B;  1Q46 A;  2UXB Q;  2YU9 H;  3L0O A;  4UPA A;  1CKN B;  5DLQ E;  5IY0 A;  2VW9 A;  4DV5 L;  2H5X A;  3RNU A;  3CD6 A;  1JJG A;  1WYD A;  2MNA A;  4DR4 L;  3GTP H;  2WAQ G;  1SRO A;  2AMC B;  3ULJ A;  2JK8 A;  4JI5 L;  4GOP C;  4LF7 Q;  2VY3 A;  2UXB L;  4C3I H;  3PUW A;  2HIX A;  1G6P A;  3GO5 A;  1I6H H;  1XTD A;  2MO0 A;  1VQH A;  4KHZ A;  3PIO A;  2HIV A;  2VUM G;  1L1O C;  2JQO A;  4LF7 L;  4A3G G;  4KLK A;  4B3R Q;  3BZC A;  4JBJ A;  2JA9 A;  1PHJ A;  4OWW B;  3S1Q H;  2K50 A;  2AWN A;  3FKI G;  3OYY A;  1VQ7 A;  5J3B A;  2IT1 A;  2ZJR A;  1J5E Q;  2B63 G;  4R4I A;  3SGI A;  2Y0S G;  3RR5 A;  2K4K A;  4UP8 A;  4B3R L;  3CCL A;  1VQP A;  1UWV A;  1K83 H;  1YEZ A;  1JJC B;  3GDE A;  4LUZ A;  3JAM i;  1R9T H;  4DAM A;  4HJ8 A;  5LMN W;  1J5E L;  2R7D A;  1WI5 A;  4A3C H;  5LMN Q;  4P72 A;  4GOP B;  1YJ9 A;  1MKH A;  4XIG S;  5IP7 G;  1OXV A;  3KF6 A;  1SN8 A;  4NXM Q;  1YBY A;  3RLF A;  1GM5 A;  2CKZ B;  1L1O B;  5LMN L;  4LFA L;  4PMW A;  1YHA A;  3M4P A;  1Z9F A;  5IYB G;  1X56 A;  4O0A A;  1GVP A;  5LMU Q;  2OTJ A;  1YJW A;  1GKH A;  4LFA Q;  1YHQ A;  4NXM L;  4NXN Q;  3JC6 2;  5M3M G;  3GTJ H;  3I4O A;  3M3Y H;  2I0Q A;  3FKI H;  2JA7 G;  1YVC A;  1PH5 A;  3STB D;  4RMF A;  4PZ6 A;  5LMU L;  4NPS A;  1HZB A;  1W3S A;  2NVY H;  4O2D A;  4QL5 A;  4X65 Q;  1Y14 B;  2ALY B;  2N3S A;  2A19 A;  4NXN L;  3U50 C;  2L15 A;  2E2H H;  3AFQ A;  2MQH A;  5FJ8 G;  1KL9 A;  3I4N H;  2VS1 A;  2N49 A;  1RL2 A;  3J81 c;  3G6E A;  3A5U A;  1Q7Y C;  3M9B A;  2F3I A;  4LWC A;  2EIF A;  4X66 Q;  1QUQ A;  4X65 L;  3F2D A;  2E2I H;  1EQQ A;  3K81 C;  1KQS A;  2AKW B;  2HT1 A;  1PVO A;  1QZG A;  2OWO A;  3HOU G;  3CXC A;  1XNR Q;  2KEN A;  4A3B H;  1OXU A;  4YHH Q;  3Q8D A;  4GS3 A;  4R1J A;  3L7Z C;  2MO1 A;  2PQA B;  1JJ2 A;  1OTC A;  1EYG A;  2GN5 A;  1XNR L;  1K73 C;  2Q2H A;  4JOI C;  4YHH L;  1WOC A;  3DLL A;  1BKB A;  2E2J H;  2IHF A;  4HJA A;  4GNX C;  4EQ5 A;  4DNI A;  2UUC L;  2HHH Q;  4A3L H;  5IP9 H;  1VCI A;  4KHP Q;  1MJC A;  3UE1 A;  3TS2 A;  5C4J H;  4LNQ A;  2RF4 A;  3MXN B;  5C44 H;  1G29 1;  1X65 A;  4RG1 A;  3HOW G;  2HHH L;  1PYB A;  1E22 A;  4C2M H;  1PV4 A;  4JI0 Q;  1EOV A;  2E8G A;  3BU2 A;  3D31 A;  3HKZ E;  4KHP L;  4HJ5 A;  2JA5 H;  1QZH A;  1B70 B;  4BXX G;  3RN2 A;  3KLW A;  1KAW A;  1HNW Q;  4JI2 L;  4UP9 A;  4JI0 L;  1FGU A;  4BBR H;  1E7Z A;  1Y1W H;  1K8G A;  2UXD Q;  4JBW A;  3EIV A;  4XTC S;  4DAY B;  3PIP A;  3J80 c;  2N8N A;  3ICE A;  1LTL A;  4B3S Q;  1HNW L;  4GNX B;  1X9N A;  1Y1V H;  2UXD L;  2F4V Q;  2WP8 J;  2NN6 I;  3OW2 A;  1HNX Q;  3H0G H;  3CC7 A;  4A3F H;  4HID A;  1IL2 A;  3PO3 H;  4IFD J;  4DV7 Q;  4B3S L;  4H02 A;  1V1Q A;  3HOV G;  2NZH A;  5C3E H;  3I4M H;  2OTL A;  4IOC A;  3PO2 G;  1NMF A;  5E7N A;  2YV5 A;  2C35 B;  4PZ8 A;  5BR8 Q;  1HNX L;  2JA6 G;  5GQO A;  1Q8K A;  2Q2I A;  4X62 Q;  3CQZ H;  4JI7 Q;  4JI8 Q;  2IHE A;  5FLM H;  1A0I A;  4R4Q A;  2VQF Q;  4OON A;  1D8L A;  1LYL A;  3RZO H;  4R4O A;  3G71 A;  4A3M G;  5BR8 L;  1C7Y A;  4QQB X;  3BJU A;  1M90 C;  4L5S A;  4IFD G;  3GTK H;  4TVA B;  3D0F A;  4X62 L;  1VQK A;  4JI7 L;  4JI8 L;  4AH6 A;  3AEV A;  1KRS A;  2VQF L;  3J7A 5;  3KJP A;  1JT8 A;  2XTI A;  2RHQ B;  3HOZ G;  2LXK A;  3G4S A;  4A3E H;  1WCM G;  3K0X A;  4A93 H;  2ZTC A;  3PUX A;  1HR0 W;  4OX9 Q;  3U58 A;  1SE8 A;  1N33 Q;  5JJK A;  1HR0 Q;  1YJN A;  1N34 Q;  1OXT A;  3KYH C;  2NVQ H;  3GTO H;  4BBS G;  3CF5 A;  3CAM A;  3I7F A;  4JCV E;  4YCU A;  1XJV A;  3M85 A;  1VS0 A;  4OX9 L;  4LF5 Q;  1N33 L;  4JV5 L;  1HR0 L;  1N34 L;  3FP9 A;  1O7I A;  1VQA A;  2RCN A;  3PUV A;  4X64 Q;  5M3F G;  1QVF A;  2K5N A;  4BY1 H;  1E24 A;  1PFS A;  3ER0 A;  4LF5 L;  1S3O A;  2YTX A;  3ERS X;  3OTO Q;  4A3I G;  4DR6 Q;  5C4X G;  4X64 L;  4JBM A;  4TQU S;  4GN4 B;  1EWI A;  4DV1 Q;  1VQB A;  1NTG A;  5M5X H;  1PH1 A;  3OTO L;  3TRZ A;  4DR6 L;  3TQY A;  3I56 A;  4DV1 L;  3CP0 A;  2PQA A;  5IYD G;  2UUA Q;  2WB1 E;  4DV6 Q;  1S40 A;  2A8V A;  1IBM L;  3K8A A;  1K0R A;  4MTN A;  4IPH A;  1EQR A;  4P75 A;  5AJ3 Q;  1Q82 C;  1N8R C;  2Z6K C;  2UUA L;  4DV6 L;  4GN5 A;  1H95 A;  4JI4 Q;  4WJ3 M;  4OXP A;  3A0J A;  1HH2 P;  4A3D G;  2K5V A;  5AJ3 L;  2VUM H;  2D0O A;  4LF8 Q;  3F2C A;  1B8A A;  1FVI A;  1GO3 E;  2Z0S A;  4A75 A;  1KC8 C;  4A3G H;  1X54 A;  3NEN A;  1XPO A;  3F1Z A;  4JI1 Q;  4GLX A;  4JI4 L;  3H3V I;  4OO1 G;  3JC6 6;  5IT9 c;  3HOY G;  3S17 H;  2EQS A;  2Q2U A;  1PH6 A;  2B63 H;  1K8A C;  4LF8 L;  3PF4 A;  2MFI A;  1XNQ Q;  2E5L Q;  4LF6 Q;  3UDF A;  2PI2 A;  2OQK A;  5ELN A;  4JI1 L;  1HZ9 A;  4DV0 Q;  3A5Z B;  1T9H A;  4K0K Q;  3KJO A;  4JOI A;  1AH9 A;  4GKJ L;  1CKO A;  1N9W A;  3AYH B;  4P73 A;  1KRT A;  2E5L L;  4LF6 L;  1FJG Q;  1XNQ L;  4DV0 L;  4EX5 A;  5IP7 H;  4AYB E;  4MNO A;  5HGQ A;  1VQ6 A;  4K0K L;  1VQE A;  1LM0 A;  2JEB I;  4ME3 A;  4DV4 L;  4ALP A;  3PCO B;  1FJG L;  4A3K G;  2JA8 G;  1OXX K;  4A3D H;  1TWC H;  5IYB H;  5GAD C;  2UUC Q;  1NE3 A;  3J81 j;  1NJI C;  5JJI A;  5M3M H;  4DR7 Q;  1CSQ A;  1L2F A;  1KD1 C;  3W1B A;  4L5T A;  2JA7 H;  4IJH A;  2BH2 A;  3CPW A;  1ASZ A;  1A62 A;  3CC4 A;  1YIT A;  4DR7 L;  2KCM A;  1NMG A;  5FJ8 H;  1MJE A;  1IBK Q;  1N32 Q;  1KXL A;  4AQY Q;  3ULP A;  3I2Z A;  4POG A;  1UE5 A;  1FL0 A;  1I50 H;  1I3Q H;  4YCW A;  2V1C C;  4JI2 Q;  3TEH B;  3U4V A;  5IYC G;  4GKK Q;  1HNZ Q;  2N78 A;  3KDF A;  1IBK L;  4L5R C;  5EAY A;  1N32 L;  3HOU H;  4QGU A;  3NEM A;  4C3H H;  3CW2 C;  3UDX A;  4AQY L;  3AFP A;  3J81 i;  2R92 G;  4YY3 Q;  4IJL A;  3RLO A;  4GKK L;  4POF A;  1HNZ L;  4A3K H;  4HJ9 A;  1CKM A;  4NB3 A;  3CCS A;  2ASB A;  3GTQ H;  3KF6 B;  1CKN A;  4IFD I;  3S1M H;  2R93 G;  4LUO A;  3RLN A;  4QJF A;  1JB7 A;  4YY3 L;  3H3V H;  1PA6 A;  4DR2 Q;  1KHI A;  2PNH A;  2JJQ A;  5M5W H;  4IPC A;  4OWT B;  4OWX B;  4IPD A;  4DUZ Q;  3S1R H;  4X6A H;  4QIW E;  3M4Q A;  1NY4 A;  3S24 A;  4LW1 A;  1I5F A;  1VQF A;  1Q12 A;  1Z47 A;  2YTY A;  4DR2 L;  1VQL A;  4DUZ L;  3HOW H;  1IBL Q;  1X3E A;  2KBN A;  1E1T A;  1P8L A;  1UE6 A;  3L2P A;  1AE3 A;  2B3G A;  3HKZ G;  2ZJP A;  1EIY B;  1Q1B A;  4A3J G;  1JMC A;  4BXX H;  3T1H Q;  3CCJ A;  1QUQ B;  1IZ6 A;  5GAE C;  3WWV A;  1IBL L;  1VQ8 A;  1P16 A;  1X3F A;  1VQO A;  1PH9 A;  3CCM A;  4JI3 L;  3T1H L;  4GOP A;  1D7Q A;  4YCV A;  3ULL A;  3B6Y A;  3KOJ A;  5ELO A;  3CCV A;  1IYJ B;  2QEX A;  2IX0 A;  3E9I A;  4DV2 Q;  1S72 A;  1HZC A;  2WAQ E;  3J80 i;  3KF8 B;  4C3J H;  1L1O A;  3GTG H;  1CSP A;  4JV5 Q;  3HOV H;  1X6O A;  1M1K C;  2PI2 E;  3LGJ A;  3PO2 H;  2AWO A;  1SRU A;  1X55 A;  4MZ9 A;  1A8V A;  4DV2 L;  2JEA I;  3K7A H;  3MEF A;  4PG3 A;  3CCR A;  4BA1 I;  2JA6 H;  5C0X I;  4LUV A;  4A4I A;  5JJL A;  2LXJ A;  1E3P A;  3PV0 A;  4GLA C;  3S1N H;  2BA0 A;  3CCQ A;  3RN5 A;  4A3M H;  4DK6 C;  3JAM c;  2UU9 Q;  4JBK A;  1QVC A;  4QY7 A;  5GAH C;  1KIX A;  2CFM A;  2BA1 A;  5C0X J;  2Y0S E;  3IRB A;  4BA2 I;  4OO1 I;  2VL6 A;  4DV3 Q;  2UU9 L;  3E9H A;  3PF5 A;  1IBM Q;  2R7F A;  3CC2 A;  1EUJ A;  1IXR A;  1U0L A;  1YHB A;  2I5M X;  1TXY A;  1YZ6 A;  1PH3 A;  1VQC A;  1WCM H;  3HOZ H;  2OQ0 A;  5GAG C;  4A3C G;  5IE8 A;  4UY8 C;  1AE2 A;  1Q81 C;  4DV3 L;  3I55 A;  1XMQ Q;  4HIK A;  4GLV B;  1VQM A;  2XGT A;  4BBS H;  1Q86 C;  5C0X G;  1I94 Q;  2R7Z G;  3GTM H;  2LSS A;  3DM3 A;  1N36 Q;  5JEA J;  1V43 A;  3UDG A;  1XMQ L;  5M3F H;  4R4C A;  1LUZ A;  1HJP A;  3HFZ B;  4DR3 Q;  1I94 L;  3PUY A;  2ATW A;  1TWH H;  3K7U C;  3EBE A;  3CCE A;  3S14 H;  4A3I H;  1PH4 A;  5C4X H;  2PMZ E;  1N36 L;  4KI0 A;  4R4T A;  4LFC Q;  3M7N A;  3I4N G;  3GD7 A;  4DR3 L;  4GKJ Q;  2D0P A;  3E0E A;  4J15 A;  5JEA G;  2NZO A;  4LFC L;  1YIJ A;  5K36 G;  1VQG A;  4DR5 Q;  5IYD H;  3HOX G;  4DV4 Q;  2CCZ A;  2CWA A;  4A3B G;  2EXD A;  2WB1 G;  4JC0 A;  2R6G A;  2ZM6 Q;  3T1Y Q;  2UXC Q;  5HY6 A;  1UEB A;  3G48 A;  4GNX A;  2R7Z H;  1BVS A;  4JG2 A;  4DPG A;  2ES2 A;  4DR5 L;  1W2B A;  2ZJQ A;  2KHJ A;  2UXC L;  2FXQ A;  4DK3 C;  2ZM6 L;  3T1Y L;  2VQE Q;  1G51 A;  2ID0 A;  3TS0 A;  3M4O H;  3F2B A;  4GN3 B;  1XMO Q;  3S16 H;  1VQJ A;  5IP9 G;  4A3L G;  1EFW A;  1VQN A;  4WJ4 A;  2VQE L;  3HOY H;  2BH8 A;  1BBW A;  2DUD A;  3BZK A;  4YWM A;  5C44 G;  4JI6 Q;  3HKS A;  3S2H H;  1XMO L;  4P71 A;  1SFO H;  4LFB Q;  3S15 H;  1A63 A;  2NVT H;  3FHW A;  1U5K A;  5FLX c;  4LF9 Q;  3A74 A;  1J6Q A;  1PH2 A;  1X3G A;  3HOX H;  2JA5 G;  3PSI A;  4LF4 Q;  4JI6 L;  1WFQ A;  3STB C;  4X66 L;  3ZJY C;  4LFB L;  4DUY Q;  2AHO B;  2RHS B;  4BBR G;  5M5Y H;  1VQ5 A;  3RZD H;  1Y1W G;  4LF9 L;  4BY7 G;  2VZA A;  3CPF A;  4AYB G;  1YNX A;  4IPG A;  1V9P A;  4LF4 L;  4FDB A;  3F8T A;  2JA8 H;  2OCE A;  4DUY L;  1Y1V G;  1PH8 A;  4APV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...