4YWKA

Pyrococcus furiosus mcm n-terminal domain with zinc-binding subdomain b deleted
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
199
structure length
184
Chain Sequence
b'VDREEMIERFANFLREYTDEDGNPVYRGKITDLLTPKRSVAIDWMHLNSFDSELAHEVIENPEEGISAAEDAIQIVLREDFQREDVGKIHARFYNLPETLMVKDIGAEHINKLIQVEGIVTRVGEIKPFQSFRIQDRPETLPRFIDGILLVALPGDRVIVTGILRVVLEKTPIFRKILEVNHIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division control protein 21
publication title MCM ring hexamerization is a prerequisite for DNA-binding.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Cell cycle
total genus 53
structure length 184
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14551 MCM_N MCM N-terminal domain
A PF17207 MCM_OB MCM OB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ywkA02
3.30.1640.10 Alpha Beta 2-Layer Sandwich mini-chromosome maintenance (MCM) complex, chain A, domain 1 mini-chromosome maintenance (MCM) complex, chain A, domain 1 4ywkA01
3PO3G 2EIFA 1Z9FA 2E2IH 2NVYH 3HOZH 4DV1L 2VQEQ 1CKNA 1BBUA 1RIPA 4YCUA 4X66L 2ATWA 4QL5A 4GN4B 3IRBA 4PZ7A 4R4QA 2XGTA 2ZTDA 5AJ3Q 3JC66 4QGUA 1D8LA 2F4VL 4JI2Q 4JV5Q 4ME3A 3A5UA 4ALPA 4LF4Q 4DUYQ 3CCMA 1VQOA 3CPWA 1Y14B 1M90C 4UP9A 3F2BA 1EFWA 2I0QA 4DR7Q 2CKZB 3H0GH 4KHZA 1W2BA 5M3FH 1N36Q 2F3IA 1IBMQ 1SLJA 4HJ5A 2K5HA 1CSQA 1XNQL 4LF8Q 4PZ8A 1KIXA 1QUQB 1VQ6A 1YHBA 3FKIH 2MO1A 3HOUH 4P74A 1YJWA 1V9PA 4BBRH 2ZJRA 1PFSA 1E1OA 3TS0A 3G6EA 4DV2Q 3FHWA 5LMNQ 2N8NA 2BA1A 4A3JG 5M5YH 3S1MH 4A3EH 1HNZL 3OW2A 3CCSA 3J7A5 1VQIA 1SR3A 2YV5A 1J5EQ 2NVXH 3TRZA 2UXCQ 1YIJA 1E7ZA 3KF6B 3L7ZC 4IJLA 4O0AA 2R93G 3K0XA 1IBLL 1PA6A 4A3CH 4DK3C 2R92G 1YHQA 1CUKA 4AQYL 4P75A 1P8LA 2JA8G 1V43A 1KQSA 3CC2A 2ZTCA 3HOVH 2HIXA 4R4OA 2VY3A 4GLXA 4A3KH 1B7YB 1XPUA 2WAQE 1P16A 2V1CC 1EIYB 4BBSG 5C44G 2JA9A 4HIMA 2LXJA 4DV4L 2PNHA 1JB7A 4GKKL 1X54A 4YCVA 4EX5A 4IOCA 1Y1WG 3ER0A 4JI1Q 3W5OA 5LMUQ 4C2MH 1VQ7A 4JI4L 4YHHQ 1PH8A 3I4MH 4YWLA 4DV5Q 1FVIA 1XTDA 3CD6A 2HQLA 2VQFQ 4DV6L 1TWCH 2ZM6Q 1L2FA 2ZTEA 4DR6Q 4A3MG 4JOIC 2E2HH 5BR8Q 4IPGA 1I50H 4BA2I 1N33L 3TQYA 3CCJA 4R4TA 2UXBQ 3I4NG 1VQKA 4DR1L 2MNAA 4YWMA 4X65Q 3CXCA 3S15H 4DV0L 1IBKQ 4A3FG 4DR2L 4C3JH 4JYAQ 4UPAA 4HIKA 4JI3Q 4OX9L 2NZHA 3RN5A 1I3QH 3GTPH 4GN5A 5JJKA 2YYZA 1YI2A 2BH8A 3UDGA 2YU9H 3U4ZA 5JJLA 3NENA 3M4OH 3LGJA 1EOVA 2OTJA 2CQOA 2UXDQ 1UE1A 1D7QA 1K0RA 1KRTA 1N32L 3M9BA 4JI7Q 3MEFA 1YHAA 4YY3Q 5FLXc 2VW9A 1SN8A 3K8AA 3K7UC 4X6AH 4OWXB 3FP9A 5M3MG 2ZJQA 3K80C 1Y1VH 1LUZA 1HH2P 4RMFA 1FL0A 2OQ0A 4LUVA 5ELNA 3STBC 4C3HH 5IE8A 3CC7A 4GOPC 1OTCA 4A93G 2D62A 3PV0A 1VQ4A 1B8AA 1UE7A 2DGYA 4B3RL 2MFIA 1SE8A 1HZCA 1CKMA 1WOCA 2A19A 2K14A 3AQQA 3KLWA 4QIWE 3OTOL 5GAGC 2B63G 2IHEA 3I4OA 4DUZL 2JJQA 1WJJA 3ERSX 1XMOQ 4POGA 1XMQL 3HKSA 4JC0A 1PH9A 3HOZG 4GN3B 1H95A 3VDYA 4LFCL 4QY7A 2UUCL 1BVSA 4IFDJ 3M4PA 2HHHL 3CCQA 2IX1A 1S3OA 2Q2UA 5IWAQ 3M3YH 2E5LL 1IZ6A 1UE6A 3T1HQ 4AYBG 5H1SE 3J81j 2VUMH 2VNUD 4LW1A 4XIGS 4DNIA 1GKHA 4FDBA 1C7YA 4NXMQ 1HJPA 4LF5Q 3T1YQ 4DV3L 1K73C 3H0GG 3WWVA 2NN6I 2WB1G 2Z6KC 1L1OC 1Q81C 1HNXL 2GVAA 1A63A 1VQFA 2IHFA 3CF5A 5J3BA 4BXXH 4DR3Q 1G51A 3FKIG 1KL9A 1HNZQ 3HOUG 4X64Q 4BBRG 1PH4A 2R7ZH 5FLMH 4HJ9A 1WCMH 4R1JA 1SROA 1UE5A 1W3SA 4IPDA 5M5XH 3RZOH 4JI0L 4HJ7A 1Z47A 4JG2A 4A3EG 1L1OB 4HIDA 3BU2A 1AE2A 1HR0L 3GTOH 5JEAG 2ES2A 2YTYA 4LF9L 1QVFA 4KHPQ 2RHSB 4UP8A 2CFMA 4YCWA 4L5SA 2CWAA 2MQHA 4NXNL 4JBMA 4A3CG 2JA7H 3F8TA 4DV7L 2UUAQ 4JI6Q 2GN5A 1VQCA 3HOVG 5C3EH 3KYHC 2Y0SE 4A3KG 3S1RH 3KF8B 1VQPA 4L5QA 5ELOA 2I5MX 4B3TQ 3E9IA 1G6PA 1U5KA 2PQAA 4A4IA 3OYYA 1QVGA 1OXVA 1PH5A 1K8GA 1VQLA 1NMGA 2JQOA 4X62Q 3L2PA 2OTLA 1KXLA 3I4MG 4DR4Q 1SRUA 2IT1A 4LUOA 2A8VA 4BY7H 4LFAL 3S17H 1UEBA 3J80c 2OCEA 1I94Q 3Q8DA 1YVCA 2PI2A 4IPHA 3S1NH 2RHQB 4GKJL 1XNRQ 4NPSA 4A3DH 3M7NA 4DPGA 3I55A 1VQ5A 1OXXK 4RG1A 2AHOB 1CKOA 3KJOA 3KFUA 4K0KL 3U50C 2EXDA 4QJFA 5C0XI 3PUYA 4GNXA 4OXPA 2K75A 1VQMA 5IYCH 4B3ML 4LF7L 1FJGL 2R7FA 1JJGA 3G71A 2JA6H 1CSPA 4AYBE 4DR5Q 1YNXA 4Y7NH 3JC62 2DUDA 1WFQA 1J6QA 1Q46A 5FJ8H 1TWHH 1E3PA 4HJAA 2VL6A 4GLVB 1Y1VG 1G291 3BZCA 4POFA 1MIUA 3I56A 1SMXA 2UUBQ 2UU9Q 3JC63 1LM0A 1VCIA 4LUZA 3OTOQ 4PZ6A 4OO1I 1K3RA 3H15A 4R4IA 1X55A 1BBWA 4B3SQ 4JI8Q 5IYDH 1EWIA 2ZM6L 3DLLA 4A76A 4LFBQ 3GTLH 4IJHA 3CQZH 5IP9H 3HKZG 1XJVA 2VQEL 4A3GH 1BKBA 4A75A 2Z6KA 4OWTB 3PF5A 1YBYA 3GO5A 4DK6C 2OQKA 3J81c 5AJ3L 3BJUA 2KCTA 1JJ2A 3JAMi 1N34Q 4JI2L 4JV5L 2VZAA 3S2HH 4LF4L 2HT1A 2I5LX 4O2DA 2RCNA 3W1GA 4DUYL 3EBEA 2QA4A 1Q7YC 3KDFB 4A3IH 1PHJA 4JI5Q 1RL2A 5DLQE 2VUMG 5JJIA 1JE5A 1NTGA 2XTIA 1GO3E 2EQSA 4PMWA 2BH2A 5GQOA 4HJ8A 4DR7L 1N36L 1GD7A 1VQAA 1IBML 1NMFA 1HNWQ 3CCVA 5E7NA 1PVOA 1UWVA 2PMZE 4LF8L 2WFWA 3W1BA 4LF6Q 3PF4A 2GVBA 3NBHB 1KRSA 2R6GA 1VS0A 1I6HH 2JK8A 3RR5A 4BXXG 4DV2L 1CKNB 5LMNL 3S2DH 2AWOA 4HIOA 2R7ZG 5FLMG 3M85A 1WCMG 4YWKA 1C9OA 1MKHA 4DV1Q 1ASYA 4APVA 3GTQH 4IPCA 5IP7H 1J5EL 1E24A 2QGQA 3HOXH 4GLAC 4X66Q 1YEZA 2KHJA 1VQNA 2UXCL 2F4VQ 4XTCS 5LMNW 3GDEA 3EN2A 3J80i 3KF6A 3K81C 3PIOA 3ULPA 2JA7G 2NVTH 3NELA 1FGUA 3PUZA 2KCMA 5C3EG 3HOYH 2RF4A 3AYHB 4BA1I 1LTLA 2CCZA 1VQEA 1XNQQ 3U58A 4JI1L 1PYSB 1LYLA 3RLNA 5LMUL 1S40A 4UY8C 4AIMA 2K50A 2YTXA 2Z0SA 4DV5L 2LXKA 1KC8C 3A0JA 4A3BH 2VQFL 3PO2H 4DR6L 4MNOA 4BY7G 1KAWA 1E1TA 3A74A 5BR8L 2N78A 1PH2A 1PV4A 2UXBL 2ID0A 1Q1BA 3B6YA 2JEAI 3D31A 2WAQG 4GNXB 3UE1A 3F2CA 5K36G 1IBLQ 4X65L 3H3VI 2BA0A 1A8VA 4AQYQ 1IBKL 3TREA 3HKZE 4A3DG 3AFPA 4JYAL 1B70B 3S24A 3SGIA 1QZHA 4JBJA 4MZ9A 1WI5A 3UDXA 3HOWH 1O7IA 1VQGA 2UXDL 1X56A 1HR0W 4JOIA 1V1QA 1K83H 5IYCG 1A0IA 1OXTA 4DV4Q 4YY3L 4NB3A 5C4XH 1PH6A 4JI7L 3CC4A 4LWCA 4JI4Q 1DGSA 2JA6G 4GKKQ 4A3LH 3UDFA 5IYBH 3PGZA 5FJ8G 5IT9c 1HZ9A 1VQHA 3I7FA 1NE3A 1X3FA 1EIFA 4KI0A 1GM5A 1VQ9A 4DV6Q 2JE6I 1TWAH 2KBNA 2JA5H 2MO0A 2HIVA 2Q2TA 1C0AA 1WYDA 5IYDG 1IXRA 1N33Q 2ZJPA 1MJCA 5IY0A 1TXYA 5IP9G 1NY4A 1XMOL 2KHIA 4DR1Q 3CP0A 4IFDG 1R9TH 1YZ6A 5C4JH 4A3GG 3RZDH 4DV0Q 2E8GA 1VQJA 3F2DA 4DR2Q 1Q8KA 4OX9Q 3ICEA 4GOPA 4PG3A 5IWAL 2I5HA 3PSIA 3T1HL 1VQ8A 3GTMH 3CCRA 1A62A 4GS3A 3DM3A 1QZGA 1YITA 4A3IG 3D0FA 4NXML 4LF5L 1N32Q 3ULJA 3T1YL 3UE0A 1L0WA 2IY5B 1YJNA 1PH7A 2JEBI 3RLFA 1TWFH 4BY1H 4B3RQ 1IL2A 1U0LA 3GTKH 3EIVA 3RNUA 1X65A 4DR3L 4TQUS 3G48A 4X64L 3PO3H 2A1AA 2AWNA 2WB1E 4DAYB 1EUJA 3I2ZA 4DUZQ 2N3SA 3PO2G 1OXUA 3S1QH 3F1ZA 3E0EA 1ASZA 2L15A 1XMQQ 3CCEA 1N9WA 2N49A 1YJ9A 4LFCQ 1QVCA 5IP7G 1EYGA 2UUCQ 1JJCB 1HZAA 3HOXG 1I5FA 1NBWA 1MJEA 2HHHQ 3S14H 1OXSC 4KHPL 1L1OA 1PH1A 2AMCB 2H5XA 1M1KC 2ALYB 2CWPA 2E5LQ 4IOAA 4IO9A 4WJ3M 1GVPA 2UUAL 2AKWB 3KJPA 4DKAC 1NJIC 5M5WH 4JI6L 1EQRA 1X6OA 3GTGH 2F52A 3BZKA 1S72A 3GTJH 1K9MC 4MTNA 1Q86C 2YTVA 3KOJA 4DV3Q 4B3TL 3HOYG 4J15A 5C0XJ 1HNXQ 3NEMA 2NN6G 1Q12A 1Q1EA 3UDIA 2OWOA 3PUVA 4KLKA 4X62L 1N8RC 3TS2A 2C35B 4A3JH 4DR4L 3CAMA 3GD7A 3RLOA 4P72A 4A3BG 4IFDI 4UP7A 3MXNB 3AFQA 3L0OA 5EAYA 3U4VA 3ZJYC 1QUQA 1TWGH 3CPFA 4JI0Q 3AEVA 1HR0Q 1I94L 4OWWB 2Q2IA 4AH6A 2WP8J 2R93H 2K52A 1K8AC 4LF9Q 2Y0SG 2R92H 1XNRL 3HFZB 5JEAJ 2JA8H 1PH3A 5GAEC 2K5VA 1XPOA 4NXNQ 4WJ4A 1PYBA 3CCLA 2QEXA 4DV7Q 1IYJB 3CMEA 4DAMA 2K5NA 2VS1A 4BBSH 3PUXA 5C44H 1SFOH 4JBKA 2PQAB 3ULLA 1HZBA 3HOWG 1XPRA 2ASBA 1EQQA 5HY6A 4DR5L 1X3EA 4P73A 1Y1WH 2B29A 2NZOA 5C4XG 1X9NA 4A3LG 2E2JH 1T9HA 4R4CA 3STBD 2PI2E 5IYBG 2UUBL 3S16H 4C3IH 2B3GA 5GAHC 2UU9L 4JCVE 4YHHL 4A3MH 4GNXC 4LFAQ 4H02A 5GADC 2D0PA 3A5ZB 4JI8L 4B3SL 2FXQA 4LFBL 2JA5G 5HGQA 4GOPB 3TEHB 1Q82C 3I4NH 4Y52H 1X3GA 2LSSA 2Q2HA 3CMAA 1KHIA 2IX0A 1E22A 4GKJQ 4A3FH 3H3VH 1AE3A 3J7ZC 1KD1C 1N34L 3M4QA 3PIPA 4K0KQ 4JBWA 2NVQH 4LNQA 2D0OA 4JI3L 4JI5L 4L5RC 3E9HA 5C0XG 4B3MQ 4LF7Q 1FJGQ 3G4SA 3RN2A 5M3FG 4EQ5A 1VQDA 5M3MH 3KDFA 3J81i 1HNWL 2KENA 4P71A 4A93H 4OONA 1JMCA 3K7AH 4LF6L 5GROA 1VQBA 4QQBX 3CCUA 3CW2C 4BY1G 3PUWA 3JAMc 4TVAB 3PCOB 2R7DA 4OO1G 1AH9A 1JT8A 2B63H 2K4KA 4L5TA
chains in the Genus database with same CATH superfamily
3PO3G 2NVYH 3HOZH 4DV1L 5IOCA 4PMCA 1CKNA 1JOOA 4GN4B 1G91A 2XGTA 5AJ3Q 3DMUA 4KN4C 4JI2Q 4ALPA 5IT9L 4KJOA 1RODA 4DUYQ 1ZYRD 3CCMA 1VQOA 2L9HA 3TMEA 2Y0SB 3A8KE 3NTIA 1EFWA 1NSNS 4DR7Q 1GHKA 3HP3A 4RHSA 5M3FH 1SLJA 3IL8A 5C3XA 1XNQL 4KKSA 1VQ6A 1KDBA 3FKIH 1EQTA 1V9PA 4BBRH 3G6EA 4DV2Q 3I8ZA 5LMNQ 1IL8A 1B1ZA 3S1MH 3QOLA 3U9SA 3CCSA 5DEHA 1J5EQ 2UXCQ 4MN3A 5DNFA 1T5EA 1CM9A 3I72A 2KCNA 4DK3C 1YHQA 1CUKA 4AQYL 3R2IA 1TWAB 2F3WA 3V05A 1QJOA 3CC2A 1AZPA 4RHRA 2WAQE 4OHJA 2DY8A 1R9TB 4L6TB 2LXJA 4KK7A 5JPMC 4DV4L 2O4XA 4DK1A 1X54A 1O7ZA 4YCVA 4IOCA 1VQ7A 3W5OA 3J7AF 1CT1D 3I4MH 5M3FB 1LTAD 3EQLC 2HQLA 1KDCA 4C3IG 3J81L 2XN9C 1H9MA 4A3MG 2EE1A 2E2HH 4IPGA 2P5ZX 2XIWA 1N33L 4WFN3 2UXBQ 3I4NG 2KOLA 4YWMA 1EEID 1HRJA 3F2UA 1SNOA 1IBKQ 5HGTA 1I3QH 4GN5A 2YYZA 3TZUA 5BN4A 2BH8A 4IQZA 3UDGA 3QJYA 3S1QB 5JJLA 2EY1A 3LGJA 1EOVA 5EKIA 3R93A 1ML0D 2XNAC 1SN8A 4RKBA 3ZYYX 5HURA 4HMJA 3GP7A 4HAEA 4RMFA 1PTOD 3ONAB 3CC7A 2Q2TA 3OIPA 2KEEA 4K8IA 1STEA 3PV0A 1A15A 5M5WB 1UE7A 3W2DA 2MFIA 3NHHA 3GTJB 1WOCA 2K7VA 4QIWE 3AQQA 4U673 3KLWA 2B63G 2IHEA 2HCCA 4DUZL 2JJQA 3ERSX 2EOTA 4CHTB 1XMOQ 4GN3B 4QY7A 1BVSA 3LWEA 1TY2A 3CCQA 2Q2UA 4A3JB 5IWAQ 2B2VC 2KUMA 3M3YH 2VUMH 2VB2X 4FDBA 5KNDA 3KLRA 1HQRD 4JPBW 3T1YQ 3P7JA 1K73C 3H0GG 2WB1G 3NK9A 2Z6KC 1L1OC 4RAUC 1G51A 1SFOB 1HNZQ 4X64Q 3DWQA 2NTSA 5FLMH 4HJ9A 1WCMH 1Y1WB 4IPDA 2E75C 1VDZA 4A3EG 3BU2A 4LF9L 2YTYA 3S16B 4UP8A 4YCWA 4L5SA 3DWPA 1EL0A 2B8FA 1NCVA 4JI6Q 2GN5A 5C3EH 2Y0SE 3S1RH 3KF8B 1ILPA 1VQPA 4A3FB 4R9WA 1U5KA 4A4IA 1OXVA 1PH5A 2JQOA 1IW7C 2A73B 2A8VA 4ZK9B 2Q8RE 5M3MB 4NP5A 4CJ2C 1NNXA 1PXUA 3SR1A 4FF2A 2F0SA 1F9SA 3M7NA 4DPGA 2CH4W 2VXWA 1OXXK 1CKOA 4K0KL 2E2IB 4GNXA 1FJGL 1JJGA 2K6AA 2O5IC 1YNXA 2JP1A 5E4WC 1WTPA 1J6QA 1Q46A 5FJ8H 1TWHH 1E3PA 4HJAA 4AYBB 1Y1VG 1G291 3CRLC 1LM0A 1XWEA 4PZ6A 1BBWA 4B3SQ 4KKUA 4LFBQ 4IJHA 3CQZH 1F77A 2EYFA 4IFDH 1GUGA 1XJVA 2VQEL 2QKIC 1BKBA 3EJIA 5G3LD 4A3GH 3GO5A 4DK6C 2IX3A 2OQKA 3I90A 2FHTA 4FXGC 5CYUA 3VYUA 3J81c 3KLSX 2KCTA 1JJ2A 1QOHA 4JV5L 4LF4L 2HT1A 3W1GA 2QA4A 1JR0D 3KDFB 3D6CA 1JE5A 5CBAE 4L63B 5I6WA 1GO3E 1VQAA 4O1NA 1PVOA 1II3A 1MSHA 1UWVA 2PZWA 3KBGA 1Y8PB 2BCOA 2ZT9C 1VS0A 2PMZB 4LAAA 5EPKA 3U9OA 3NTKA 2XSCA 3S2DH 3J80E 1WTWA 4KTAA 4YWKA 3NE5B 1PTOB 1ASYA 4RGNA 3MA2B 2KHJA 2B2WA 4KHVA 5FO8B 2F4VQ 4HN7A 4XTCS 3VYRA 2CW0C 3H09A 3PIOA 1B4OA 4G7ZC 2JA7G 2EYLA 2NVTH 3Q24A 1BNZA 5CV4A 2RF4A 4K6DA 2CCZA 2NN6H 3TBIB 2K50A 4DV5L 5KYIA 3A0JA 2VQFL 5C4ZA 5NUCA 4BY7G 1QB5D 1PH2A 4HMIA 2JEAI 2ICEC 4V0BA 3UE1A 1IBLQ 4X65L 3H3VI 3WDNA 3TREA 4HSVA 3HKZE 3AFPA 2CQAA 1EY0A 3H3VC 3SGIA 4MZ9A 1WI5A 1VQGA 2XRQD 2ICIA 4OIJA 2Q8IB 3JAML 5IYCG 1PH6A 1LTBD 2MUYA 4LWCA 4GKKQ 5FLXE 3QG1A 4XQJA 1VQHA 4KI0A 1VQ9A 3C46A 3OW7A 5D14A 3T4AC 1SBBB 1HUNA 2DJFC 4K5VA 5IY0A 4OGQC 5C3WA 2KHIA 4DR1Q 2LY7A 5C4JH 3K5MA 1B44D 4DV0Q 3EROA 1QILA 1VQJA 5EPJA 4DR2Q 1IYVA 4QF4A 4CJ0B 4PG3A 4GOPA 2R7ZB 2MJ8A 3RUZA 1ET9A 5M5XB 5C0XH 3RZOB 1AP0A 3CCRA 3DM3A 3GTOB 4NXML 3J80L 2QILA 1PDQA 3UE0A 2F03A 1L0WA 1KDAA 1PH7A 2JEBI 1TWFH 2EVBA 3Q6SA 4B3RQ 1U0LA 3GTKH 1U4MA 1G6ZA 2J7ZA 3G48A 3C1FA 2XRSD 3PO3H 5T1GA 1OXUA 1DOMA 3E0EA 3VR4A 5IIFA 4ID6A 1HZAA 1MJEA 1CA6A 4KJNA 2E5LQ 3BVGA 4F8MA 1GVPA 2NBFA 2AKWB 3KJPA 3S1NB 4MTNA 3TP5A 4DV3Q 2F0VA 4A3DB 3D6WA 2EY6A 3KF8A 4K8JA 1SAPA 3URYA 3E0JA 3PUVA 1CI3M 2ZXOA 4IUPA 1N8RC 3TS2A 4DR4L 1CZGA 3CAMA 4WRDA 3AFQA 3U4VA 4JI0Q 3PO2G 1TWGH 4XT3B 3BVZA 3EVQA 1I94L 4OWWB 4AH6A 2WP8J 2K52A 4IN3A 1XNRL 4OEMB 3HFZB 4BWGB 4C1NK 4QUFA 5FLXL 4WJ4A 3CCLA 1IYJB 4DXGA 2SNMA 1R4QB 3PUXA 1LTGD 2F0GA 2PQAB 2NWGA 1HZBA 3ULLA 2ASBA 1X3EA 4O42A 1X9NA 5CMDA 5EJWA 5IYBG 3STBD 2PI2E 4A3IB 4C3IH 4F88A 1DJRD 2F0LA 4A3MH 4CDDC 3G6JB 5GADC 2D0PA 2JA5G 1XXGA 3TEHB 1Q82C 3I4NH 3A7LA 1SE4A 2Q2HA 1KHIA 2IX0A 4GKJQ 2K04A 2O5JC 3J7ZC 4IALA 1F2ZA 4IUTA 4JBWA 5LHY1 1K8MA 5C6AA 3V96A 4JI5L 5M9OA 4CDCC 1VF7A 3HOXB 3KDFA 1HNWL 1GXDC 4TKOB 3K7AH 4LF6L 1VQBA 1HUMA 2L1BA 3CW2C 3L9AX 3JAMc 3PUWA 1AN8A 4TVAB 4OO1G 2RQXA 2B63H 4L5TA 2ZM6Q 2EIFA 3ERQA 1DD2A 2L11A 2J0TD 4YCUA 2Z4IA 4X66L 2ZTDA 1D8LA 1PZJD 4XT1B 4A3BB 3J7YW 1XYIA 3OHXC 2KHSA 2B2YA 1YNNC 2B2UC 3FDTA 4UP9A 2CKZB 3H0GH 4KHZA 5JPNC 1IBMQ 1XX8A 2J4XA 4F7XA 1M8AA 5DM73 1GOZA 2K5HA 1ZEQX 4LF8Q 1RD9D 5IGGA 3HOWB 2A69C 4P74A 1EZ6A 1PFSA 4CDEC 2KVMA 3TS0A 3MVVA 3FHWA 3MXUA 2BA1A 4A3EH 5C4XB 3OW2A 1SR3A 1LT6D 2YV5A 3BZDB 1E7ZA 3L7ZC 4EVOA 1QNKA 5I2YA 2D9UA 2FFKB 3K0XA 2R93G 4HTHA 1V8QA 3NP8A 2JA8G 1EIGA 3BDOA 3TDQA 2PPBC 5CR3A 1P16A 5EGTA 2V1CC 4B9XA 1VF5C 5C44G 4HIMA 3RZDB 4JI4L 4JI1Q 1LACA 2KJXA 4X3SA 3CD6A 3A8IE 5L37A 2RSNA 1F9PA 1TWCH 1ONLA 3FPPA 2ZTEA 3RMHA 4DR6Q 4JOIC 2PZUA 5BR8Q 4RCNA 4XYQA 2F1MA 3TZDA 2M2LA 1NUCA 4BY1B 1FYCA 3QWNA 3CXCA 3H94A 3S15H 4ME5A 4HIKA 4JI3Q 3GTPH 2NZHA 3RN5A 1DOKA 1T5XD 2DY7A 3R8BA 2OTJA 5ISRA 3K0YA 1KRTA 3M9BA 4JI7Q 4YY3Q 1YHAA 5FLXc 4OWXB 2ZJQA 1LT4D 1Y1VH 5LL6S 1HH2P 4LUVA 1LTSD 4A93G 4MTKA 3GTGB 2LMCB 1SNQA 1SJED 4FXDA 3WOFA 5JJZA 4N8X1 1WJJA 1KTKA 1XMQL 4DGZA 1MSGA 2LKVA 3OOCA 4LFCL 1C8CA 2UUCL 4IFDJ 3M4PA 2HHHL 2F0DA 2F0EA 2BE5D 2B2TC 1IZ6A 1F2MA 2F0MA 3T1HQ 5H1SE 2VNUD 1FNWA 1RHPA 4DAVA 4DNIA 2HUGA 1GKHA 1KLGD 5FO7B 1C7YA 1EY9A 4LF5Q 2R92B 2L0CA 1LABA 3W3AA 2NN6I 3K5OA 1A63A 2AUJD 2KCCA 3CF5A 1HA6A 2WKCA 2K01A 4X3TA 4BBSB 4DR3Q 3HOUG 3X3NA 1UEAB 5BN5A 1CHQD 4R1JA 4RKLA 1K28A 4JG2A 3NBHA 3SK5A 5KEEA 2ES2A 4HR7B 2RHSB 2CFMA 2CWAA 2HDLA 4A3CG 3I91A 2JA7H 4DV7L 1TT2A 4IUUA 2UUAQ 2SDFA 3HOVG 3DXJC 4A3KG 1L0XB 3FRPB 3MXGA 5ELOA 4B3TQ 3E9IA 2PQAA 1A2UA 2AQ3B 4V190 2HD3A 4DFAA 3GV3A 1SRUA 4LUOA 4BY7H 5FO9B 4LFAL 2ENBA 3S17H 4QCLA 4XYOA 3Q8DA 1YVCA 4IPHA 1G8ZD 4KV6A 4NPSA 3I55A 1D1KA 4RG1A 4C3JG 3KFUA 1YNJD 2F0WA 3U50C 5CV7A 2X6LA 4ABNA 1WD1A 5C0XI 1X32A 2EYMA 2NVYB 3PUYA 4OXPA 2XVSA 3HOZB 2K75A 2NTTA 5IYCH 4B3ML 4LF7L 4NMZA 1CSPA 4DR5Q 2DUDA 1DXMA 2A6ED 3BZCA 2B2VA 2UUBQ 2OF1A 2UU9Q 3JC63 4C3HG 4ULLA 1E2VA 1LTRD 3H15A 1X55A 4JI8Q 3DLLA 3GTLH 2DJGC 2PW5A 3VYTA 2Z6KA 3H91A 2KA7A 3FKIB 1U4LA 2IWHA 4BBRB 5AJ3L 3BJUA 2HQEA 1LT5D 4JI2L 3NWTA 2VZAA 2N88A 4ZKBB 1Y69U 3S1MB 3S2HH 4DUYL 2MHVA 1GUSA 1Q7YC 1HTLD 1RL2A 3MFYA 3ITPA 4UAIA 5JJIA 4K6LA 3PIO3 1NTGA 1SNPA 2EQSA 2BH2A 4DR7L 5GQOA 1EOTA 3GV6A 2F0JA 2DNEA 1NMFA 5E7NA 1EZ8A 2WFWA 1KRSA 2R6GA 1I6HH 2JK8A 3RR5A 4BXXG 4KMUC 4DV2L 5LMNL 2RCFA 2IW3A 2AWOA 3N52A 3M85A 3GTQH 1S5BD 4APVA 1J5EL 1E24A 1VQNA 2UXCL 1B3QA 1VMCA 3I4MB 4C1NI 5A2QE 2E2HB 3K81C 3QIAA 3NELA 3PUZA 4KD3A 4DA2A 3BDCA 1LTLA 4CJ1B 3DHQA 4FXKC 3U58A 1PYSB 1I3QB 1LYLA 3RLNA 1Z7TA 5E4XA 4UY8C 1GJXA 3QOJA 5G3LF 1DM0B 3PO2H 3HGBA 1SSOA 2PNRC 4MNOA 4TRDA 1KAWA 3A74A 1DONA 1SMYC 2KECA 2N78A 3K58A 2UXBL 2K33A 1JWSD 4C56C 2WAQG 5C4HA 5CBEE 3NPPA 1BUVT 5IGEA 2EZVA 1IBKL 1WTHA 2G5DA 4JBJA 2NZ1D 3CU7A 2PCFB 3HKZB 4WJWA 4FYDA 5CC4A 1EEFD 2OXPA 1HR0W 1V1QA 1K83H 2JA6G 3SK6A 1DGSA 2AUKA 2K5DA 5IYBH 3PGZA 3M3YB 3NUCA 5IT9c 2VUMB 2F0OA 4JW0A 1RTOA 1GM5A 3DEOA 3MC0B 4QMGA 4DV6Q 3VYSA 2X69A 2KBNA 2JA5H 1C0AA 1WYDA 5IYDG 1IXRA 3QO2A 5ELDA 5IP9G 1EIHA 3C2PA 1XMOL 1YZ6A 1O7YA 2E8GA 2A5HA 1FD7D 1UNSA 4OX9Q 2QDBA 5IWAL 1WCMB 2F0KA 4E6IA 2I5HA 3GTMH 3VR3A 3SEBA 1N32Q 4OIKA 2EDGA 3T1YL 1U4PA 2K28A 3OMCA 4G57A 3RLFA 1IL2A 4OO1H 5C3EB 3S1RB 2EJFC 1D1IA 4X64L 4PQXA 4DAYB 4DNRB 3OIQA 3K5LA 3F1ZA 1ASZA 1N9WA 2N49A 1YJ9A 1R4PB 1EYGA 1A3VA 1JJCB 4J1MA 2SNSA 1I5FA 1NBWA 3GQBA 5IGDA 3S14H 1PH1A 2H5XA 2ALYB 2CWPA 4H7BA 5ELEA 4IOAA 2BOSA 4U68A 4JI6L 4DKAC 1JE4A 4KY5A 2F52A 1S72A 2A68C 1Q86C 1K9MC 3KOJA 1G2SA 5IGCA 3HOYG 1L0YB 5JVG3 3V2TA 1HNXQ 4IUNA 3HZXA 1Q1EA 1SNDA 3UDIA 2C35B 3BYTB 3GD7A 3PQIA 5J1ZA 4UP7A 3MXNB 3L0OA 5JJKA 3ZJYC 1LTTD 2SOBA 1TWHB 1HR0Q 2X6GA 1WTOA 2Q2IA 3H6MA 2R93H 1K8AC 2Y0SG 2JA8H 5GAEC 1XPOA 4NXNQ 3BDLA 2QEXA 1ESRA 5A35A 3CMEA 1CHPD 1PMRA 3CQZB 2VS1A 2L4NA 5C44H 4JBKA 4A3GB 1PRTC 1STBA 1SYCA 5HY6A 5KIXA 2N55A 2NZOA 1C4QA 1ENAA 3OPOA 2E2JH 2A6HC 1TQOA 2B3GA 4N9PA 4YHHL 4GNXC 2R3ZA 5IGFA 5ELCA 1EY5A 4LK1C 4B3SL 2FXQA 4LFBL 4ZAIA 4CKEA 1A2TA 1IKMA 2LSSA 3CMAA 4ILWA 4OELB 3ND9A 3KBXA 1LV9A 3TSSA 1UAPA 3M4QA 1HTPA 3S2DB 2NVQH 4LNQA 4I7AA 2H1EA 3T51B 1ILQA 5D65A 3G4SA 5M3FG 4EQ5A 1VQDA 4XDXA 2XWBB 1GUNA 2E76C 4A93H 1I4XA 3OMGA 2NVTB 2L5TA 3PCOB 2R7DA 1VQFA 3NWSA 2K4KA 3MHBA 1Z9FA 1PLFA 5F2DA 4HEDA 2KEDA 1RIPA 5I9PA 4QL5A 1S5DD 3IRBA 4PZ7A 4R4QA 3JC66 3OWEB 4QGUA 2F4VL 4ME3A 3A5UA 1HPCA 3CPWA 2EPBA 1PRTF 4PV1C 2JYOA 1W2BA 3I73A 1N36Q 2F3IA 4IURA 2Z8LA 1UUPA 1PYWD 2WV6D 1IHZA 1QUQB 1DZ1A 3HOUH 1YJWA 2ZJRA 1H9KA 2JXMB 1IW7D 5DM63 1G2TA 4QB4A 4A3JG 5M5YH 1TIID 3J7A5 1VQIA 2NVXH 3TRZA 1YIJA 3KF6B 4O0AA 1IBLL 4A3CH 2EY5A 2RSOA 4P75A 1A3UA 1S4ZA 3HOVH 5KYLA 2HIXA 2K03A 4R4OA 3TP6A 4A3KH 1XPUA 4H13C 2WINB 5C4JB 3TP8A 2PNHA 4GKKL 1Y1WG 2QW7A 5LMUQ 4C2MH 2EYJA 1PH8A 1FVIA 1BCPC 1I6VC 1J8IA 2HCIA 4K2LA 4FP5D 1L2FA 3T56B 1I50H 3TQYA 1LTID 3HEJA 4DR1L 1TWFB 4TSSA 3GTKB 4DV0L 3VR6A 4DNTB 4A3FG 1BR9A 4C3JH 4DR2L 4UPAA 4JYAQ 3PO3B 2LFNA 3P1HA 3SK8A 1K8OA 2TMPA 2Z9HA 2YU9H 3BS1A 3IKJA 3NENA 1H9SB 3M4OH 2UXDQ 2CQOA 1D7QA 1UE1A 3TP7A 1K0RA 2MP1A 1BDOA 2KQ3A 5EPLA 1W6JA 2VW9A 3K8AA 3K7UC 3HG9A 5M3MG 3K80C 3AMUA 1EU4A 4C3HH 4GOPC 2D62A 3M4YA 1VQ4A 4B3RL 2DGYA 4CGYB 2H4OA 2WACA 3I70A 3M7GA 2E74C 2B2UA 2NUCA 1HZCA 1CKMA 3OTOL 1AFPA 5GAGC 1LO5D 4POGA 4FO2A 3HKSA 4JC0A 1PH9A 4DAYA 1QCBD 2I46A 2E5LL 2CW0D 1UE6A 4AYBG 5KNBA 3J81j 4LW1A 1TWGB 5E3FA 1DYQA 2K5QA 3A7AB 1E2ZA 4DV3L 1JQYD 3QB3A 1SXTA 1D5MC 1S5CD 1Q81C 1BCPF 1EU3A 5J3BA 4BXXH 4L8JA 1KL9A 2L12A 4K2KA 5EBDA 3Q23A 1SROA 1W3SA 4JI0L 1Z47A 4HCSA 1L1OB 4HIDA 1ZXTA 5JEAG 3MXNA 4KHPQ 2Q8TA 4C3IB 4A3MB 2MQHA 5KNCA 4JBMA 2RDHA 1ZYRC 3I4NB 3E6ZX 3HS0C 5JOBA 4L5QA 1BBXC 3E3XA 3OYYA 2EJGC 3DWAA 4IZ8A 1K8GA 1HA5A 4X62Q 3N6RA 1EY8A 3EFXD 2OTLA 3MFGA 1KXLA 3D4RA 1UEBA 3J80c 2OCEA 1LLRD 2PI2A 3S9WA 3K7AB 4GKJL 1STHA 4H0LC 1Q8IA 2B63B 2AHOB 4QJFA 3MXPA 3LWUA 2R7FA 4KN7C 3NXWA 2JA6H 1I4PA 4Y7NH 3JC62 2PQEA 1O7LA 1U9RA 4GLVB 3SXHA 2NB0A 2FMMA 4POFA 1SMXA 2B2TA 4OO1I 3H0GB 5IYDH 4RA8A 2ZM6L 1S5FD 2WB1B 2M9VA 5IP9H 4A75A 1A3TA 1N34Q 5K5PA 3VR5A 4O2DA 4A3EB 1QG7A 2LS01 3EBEA 1PHJA 4N8FA 2PO4A 3J7AV 3KUPA 2XTIA 3WOEA 1IYUA 1IBML 2IPKD 4R8IA 3MEHA 4LF8L 5FKAC 4CBVA 3W1BA 1OO9B 4RGOS 2B2YC 1FNUA 4HIOA 2K5WA 2R7ZG 4G7HC 5CORA 1C9OA 4DV1Q 4KY7A 1WTRA 2QGQA 1K3BC 4IUVA 1HFGA 2RDGA 5LMNW 1KLUD 1TWCB 3PIP3 3KF6A 4RCOA 4UDUC 5IODA 3ULPA 3NQTA 1F9RA 1STGA 4DK0A 3HOYH 3AYHB 4BA1I 3S15B 1VQEA 1XNQQ 4NW2A 3GTPB 4JI1L 1S40A 4DU9A 4AIMA 1PRTB 2YTXA 2Z0SA 1RF2D 4XQQA 2LXKA 1BOSA 3CHBD 4M1UB 4DR6L 2QDLA 2G9HD 5BR8L 1BXTA 1Y1VB 2ID0A 3B6YA 1EFID 2QCPX 3D31A 4GNXB 4MHEA 1EY4A 5K36G 1SE3A 4Z9CB 1JOKA 2BA0A 5EQ0A 4AQYQ 4A3DG 1Z6HA 1B70B 2EYHA 2FMCA 3S24A 1QZHA 4ZLTF 2Z1CA 1M4VA 2L55A 2CHBD 1X56A 2K32A 3BG3A 1PTOF 3PF4A 4DV4Q 4JI7L 4YY3L 4NB3A 3CC4A 1H9SA 3UDFA 1X3FA 1EIFA 1TWAH 1U4RA 2MO0A 1AW7A 1CK1A 3RD4A 1N33Q 2F0HA 2ZJPA 1MJCA 5ELFA 5FK9C 1NY4A 3CP0A 3OSOA 1R9TH 4KY6A 2E2DC 3ICEA 1I4QA 5CV9A 1RJTA 3PSIA 3T1HL 3SK4A 2FJ2A 1MD2D 1VQ8A 4G4KA 1KNEA 1YNND 1C48A 1QZGA 1YITA 4A3IG 1I4HA 1PZKD 5IGBA 4LF5L 3R2TA 5EKLA 4JVZA 2IY5B 2JA7B 2CVRA 4HCEA 1JOQA 2TSSA 3EIVA 2A69D 1X65A 4DR3L 4TQUS 1STAA 4X3UA 3E5SA 2A1AA 2AWNA 2WB1E 5J22A 2K05A 1EUJA 3I2ZA 4DUZQ 2N3SA 3S1QH 3P20A 4K5XA 2L15A 1TVXA 4ZQ3A 1QVCA 1QE6A 5IP7G 3NBIA 3HOXG 1QNUA 1OXSC 1SNCA 1L1OA 1Y8OB 3CRKC 1M1KC 4FF1A 1B9MA 3MTSA 4BY7B 1CTMA 1QWYA 1NAPA 1STYA 3S17B 3ND8A 2UUAL 1NJIC 1ZKOA 5M5WH 1EQRA 1I4RA 3GTJH 3KK7A 4CKBA 4ZUIA 4B3TL 4J15A 1Q90A 5C0XJ 3NEMA 4ZCKA 2OWOA 4KLKA 1TY0A 2F0IA 4A3JH 1TS3A 1D5ZC 4P72A 4A3BG 1EWCA 5EAYA 3AEVA 1BCPB 5I2XA 2O2LD 4LF9Q 1K0SA 1PZID 5J39A 1TR5A 4ZRZA 2K5VA 1PYBA 4DXFA 4I7ZC 1FGBD 2I07B 4PNYA 4DAMA 3GTLB 2K5NA 1B3AA 1SFOH 4P2CB 3HOWG 1EYAA 4DR5L 4P73A 1Y1WH 1TS2A 2B29A 5C4XG 3D4DA 1MHWC 3S2HB 4A3LG 4R4CA 2UUBL 2VB3X 3S16H 2UU9L 5GAHC 2MGSA 1DCZA 3A8JE 4JI8L 4XQNA 5HGQA 1RTNA 4GOPB 4Y52H 2ZXPA 4A3FH 1JORA 1AE3A 3BVMA 1I6HB 2XWJB 1KD1C 3PIPA 4K0KQ 3O13A 3GTQB 3E9HA 2FINB 1FJGQ 3FPUB 3RN2A 3FVQA 3K59A 1VMPA 3D3RA 5M3MH 3J81i 2KENA 1CQVA 4P71A 1JMCA 1KNAA 3IFDA 4LMQD 4BY1G 5EKKA 1WTVA 2E2IH 5CV6A 2EYPA 2VQEQ 5I4DA 1BBUA 1TS4A 3LNNA 2ATWA 3KLSA 1HQMC 4JV5Q 1CFMA 3PO2B 4M8AA 4LF4Q 1Y14B 1M90C 2Z4HA 3F2BA 2I0QA 1ET6A 5E1FA 2F0NA 4HJ5A 1CSQA 4PZ8A 1KIXA 3P75A 1V1PB 1YHBA 4B9WA 2MO1A 4JK1C 1E1OA 3K5NA 4WORA 3A54A 1D5XC 2N8NA 1K83B 5A2QL 1HNZL 2OEOA 1SYEA 1KAAA 3X3MA 5JEAH 1SE2A 4IJLA 1PA6A 3Q22A 2R92G 3I4LA 3VR2A 1P8LA 1B9NA 1V43A 3MAQA 2JA5B 1KQSA 2ZTCA 4GLXA 2VY3A 4PMBA 5T1IA 1B7YB 3D8GA 4CDFC 1EIYB 1BO0A 4BBSG 2JA9A 1HHVA 4K5WA 1JB7A 1PTOH 4EX5A 3ER0A 3G7LA 4RGMA 4YHHQ 1SYFA 5AFWA 4YWLA 4DV5Q 3GTMB 3NTHA 1XTDA 3JAME 2AQ2B 2VQFQ 4DV6L 1MGSA 1H9RA 3PMFA 2QEJC 1B2TA 1X3QA 4BA2I 1E0BA 3CCJA 4R4TA 4ZKCB 2RVLA 4UHVA 1VQKA 4KKTA 1Q3LA 3K6OA 2MNAA 4X65Q 2WIIB 4EQPA 4OX9L 2RDFA 2RKSA 3AB9A 1YI2A 3CKIB 4NDXA 3U4ZA 2F0QA 1TS5A 2OT2A 1SJHD 1N32L 2EY2A 2ZXRA 5FOBB 3MEFA 3S14B 4X6AH 3FP9A 1LUZA 1SYBA 1FL0A 2OQ0A 5ELNA 4ZUJA 3STBC 2IL8A 5IE8A 3SVMA 1OTCA 1PFMA 4EGVA 1B8AA 1SE8A 2DNCA 2A19A 2K14A 1JB3A 2RA4A 1NR2A 1ENCA 3I4OA 5KGUA 3HOZG 1H95A 3VDYA 4KD4A 2D2CC 1GHJA 4J6HA 2IX1A 1S3OA 3MZ5A 1SYGA 4XIGS 4MIUA 2DN8A 4FF3A 2R93B 3T53B 4NXMQ 1HJPA 1S5ED 3AU7A 3WWVA 2JA8B 4DAPA 5BN3A 1HNXL 2GVAA 1H9JA 2IHFA 1BQQT 5C44B 3R3OA 2AQ1B 2EJMA 3FKIG 2A74C 3D4WA 4BBRG 1PH4A 2R7ZH 5JAVA 1UE5A 5M5XH 3RZOH 1F2YA 4HJ7A 1SMYD 1JWUD 1HR0L 1AE2A 1EYCA 3GTOH 2E2JB 1QVFA 2G9DA 3DUZA 1HFNA 1PFNA 4NXNL 1ICWA 3K57A 1V1OA 3F8TA 2BDNA 1VQCA 1SNMA 3KYHC 5I9OA 5D3DA 1CZWA 2CH4A 2I5MX 2PW7A 1O78A 1G6PA 2F3VA 1GUWA 4I65A 2V4DA 1QVGA 2B2WC 2NVQB 5CV8A 1VQLA 1NMGA 3L2PA 2F0UA 3I4MG 4DR4Q 2IT1A 3DM1A 4G7OC 1WVLA 1I94Q 5K36H 3S1NH 4A93B 5LL6X 1SDFA 2RHQB 1XNRQ 2Z6BA 1W6KA 4A3DH 1AEXA 2D5DA 4RH6A 5D3IB 1XTCD 1VQ5A 1KABA 3OWFA 3T16A 1JWMD 3KJOA 5COYA 2EXDA 2BDOA 1VQMA 3G71A 3IFTA 4AYBE 3SE0A 1WFQA 2VL6A 1BF4A 3I56A 1MIUA 3MWYW 1VCIA 4LUZA 3OTOQ 1D2BA 1K3RA 4R4IA 3T13A 3IAYA 1EWIA 1TU2B 4A76A 3HKZG 2JSOA 3PF5A 4OWTB 1YBYA 1RCVD 3HOUB 1JCKB 1CQFA 3JAMi 3VA7A 2MPMA 2F0FA 4N9TA 5M5YB 2I5LX 2RCNA 4A3IH 4JI5Q 2VUMG 5DLQE 3SDZA 2NVXB 4PMWA 1JC7A 2A68D 4HJ8A 1N36L 1GD7A 1HNWQ 3CCVA 1DOLA 3C3LA 3C1EA 2PMZE 4LF6Q 3HOVB 2GVBA 3NBHB 4A3KB 1WTQA 1AZQA 5JVH3 1SYDA 3EA6A 5C5MA 1CKNB 1V1PA 1B50A 5EBCA 5FLMG 1WCMG 1MKHA 2R61A 4FNFA 4IPCA 2F4IA 5IP7H 4C2MB 3FMCA 5CGKA 3HOXH 4GLAC 4X66Q 1YEZA 3GDEA 3EN2A 3L3OC 2BE5C 2EYOA 3J80i 1EQVA 5C5LA 1I50B 1CA5A 5CV5A 5ELBA 1PFBA 1FGUA 4QUCA 2KCMA 5C3EG 1PRTD 4C3JB 3TN2A 4FVMA 5LMUL 4CKCA 2A6HD 2YU9B 3M4OB 1F2LA 1KC8C 4XXEA 4A3BH 1EY6A 4S3SA 1E1TA 2C9OA 2QF7A 2K1BA 1PV4A 4IUQA 4EQOA 1Q1BA 4C3HB 3F2CA 1ESFA 1A8VA 4JYAL 4RGTA 3UDXA 3HOWH 1O7IA 2UXDL 5DAUA 2IJ0A 4JOIA 1A0IA 1OXTA 4FF4A 5C4XH 4JI4Q 4A3LH 5FJ8G 1HZ9A 3I7FA 1NE3A 2JE6I 4BS9A 5KRUA 1E2WA 2HIVA 4F87A 1TXYA 3A56A 4IFDG 4A3GG 3RZDH 4K14A 3F2DA 1JICA 1Q8KA 1YNJC 4NKLA 3SHLA 2WKDA 1A62A 4GS3A 3D0FA 1X3PA 1WTXA 4X3KA 3ULJA 3I3CA 1NR4A 2A6EC 1B53A 1YJNA 1STNA 1MI2A 4BY1H 3RNUA 4J8QA 1HCZA 4OL7A 4EQNA 2F0PA 1GUTA 1GUOA 4RFBA 2EXZA 1XMQQ 4LJZC 1TKWB 3CCEA 1SEBD 4LFCQ 2B8GA 2UUCQ 4KHPL 2HHHQ 1O80A 2AMCB 3DEPA 3NSWA 4IO9A 1EY7A 4WJ3M 1ICFB 3GTGH 1RDPD 1X6OA 2GA4B 2JN4A 2WAQB 3BZKA 2PZTA 2YTVA 1FR3A 4GZYC 4H44C 3LX0A 3BYYB 4ODGA 1HXYD 2NN6G 5IT9E 4Q0FA 1Q12A 2C5CA 1PTOC 3FEWX 5TSSA 4X62L 1EWHA 1BCPD 5I6YA 3UI2A 1Y8NB 2JA6B 3RLOA 2NYZD 4Y7NB 4IFDI 1QUQA 3CPFA 1ENFA 1EYDA 3Q0AA 2R92H 5JEAJ 1PH3A 4DV7Q 2RBMA 4BBSH 1J9OA 3VA5A 1RKNA 1XPRA 1EQQA 2M00A 4HSPA 1IKLA 1T9HA 4JCVE 4LFAQ 4H02A 3A5ZB 4RWSC 4QIWB 2SEBD 1X3GA 4ZYSA 2PYKA 1E22A 1I4GA 3H3VH 3QR8A 2F0TA 4DF7A 1WD0A 3J81E 1N34L 1F9QA 4DN4M 3NQIA 2D0OA 4JI3L 2HDMA 4L5RC 5C0XG 4B3MQ 4LF7Q 1A6XA 4B08A 4Q5VA 1FNVA 3A55A 1D6EC 1LT3D 3HRZC 4OONA 4YIJA 5GROA 1MBYA 2B39A 4QQBX 3CCUA 4R8NA 1AH9A 1JT8A 3HOYB
chains in the Genus database with same CATH topology
3PO3G 2EIFA 1Z9FA 2E2IH 2NVYH 3HOZH 4DV1L 2VQEQ 1CKNA 1BBUA 1RIPA 4YCUA 4X66L 2ATWA 4QL5A 4GN4B 3IRBA 4PZ7A 4R4QA 2XGTA 2ZTDA 5AJ3Q 3JC66 4QGUA 1D8LA 2F4VL 4JI2Q 4JV5Q 4ME3A 3A5UA 4ALPA 4LF4Q 4DUYQ 3CCMA 1VQOA 3CPWA 1Y14B 1M90C 4UP9A 3F2BA 1EFWA 2I0QA 4DR7Q 2CKZB 3H0GH 4KHZA 1W2BA 5M3FH 1N36Q 2F3IA 1IBMQ 1SLJA 4HJ5A 2K5HA 1CSQA 1XNQL 4LF8Q 4PZ8A 1KIXA 1QUQB 1VQ6A 1YHBA 3FKIH 2MO1A 3HOUH 4P74A 1YJWA 1V9PA 4BBRH 2ZJRA 1PFSA 1E1OA 3TS0A 3G6EA 4DV2Q 3FHWA 5LMNQ 2N8NA 2BA1A 4A3JG 5M5YH 3S1MH 4A3EH 1HNZL 3OW2A 3CCSA 3J7A5 1VQIA 1SR3A 2YV5A 1J5EQ 2NVXH 3TRZA 2UXCQ 1YIJA 1E7ZA 3KF6B 3L7ZC 4IJLA 4O0AA 2R93G 3K0XA 1IBLL 1PA6A 4A3CH 4DK3C 2R92G 1YHQA 1CUKA 4AQYL 4P75A 1P8LA 2JA8G 1V43A 1KQSA 3CC2A 2ZTCA 3HOVH 2HIXA 4R4OA 2VY3A 4GLXA 4A3KH 1B7YB 1XPUA 2WAQE 1P16A 2V1CC 1EIYB 4BBSG 5C44G 2JA9A 4HIMA 2LXJA 4DV4L 2PNHA 1JB7A 4GKKL 1X54A 4YCVA 4EX5A 4IOCA 1Y1WG 3ER0A 4JI1Q 3W5OA 5LMUQ 4C2MH 1VQ7A 4JI4L 4YHHQ 1PH8A 3I4MH 4YWLA 4DV5Q 1FVIA 1XTDA 3CD6A 2HQLA 2VQFQ 4DV6L 1TWCH 2ZM6Q 1L2FA 2ZTEA 4DR6Q 4A3MG 4JOIC 2E2HH 5BR8Q 4IPGA 1I50H 4BA2I 1N33L 3TQYA 3CCJA 4R4TA 2UXBQ 3I4NG 1VQKA 4DR1L 2MNAA 4YWMA 4X65Q 3CXCA 3S15H 4DV0L 1IBKQ 4A3FG 4DR2L 4C3JH 4JYAQ 4UPAA 4HIKA 4JI3Q 4OX9L 2NZHA 3RN5A 1I3QH 3GTPH 4GN5A 5JJKA 2YYZA 1YI2A 2BH8A 3UDGA 2YU9H 3U4ZA 5JJLA 3NENA 3M4OH 3LGJA 1EOVA 2OTJA 2CQOA 2UXDQ 1UE1A 1D7QA 1K0RA 1KRTA 1N32L 3M9BA 4JI7Q 3MEFA 1YHAA 4YY3Q 5FLXc 2VW9A 1SN8A 3K8AA 3K7UC 4X6AH 4OWXB 3FP9A 5M3MG 2ZJQA 3K80C 1Y1VH 1LUZA 1HH2P 4RMFA 1FL0A 2OQ0A 4LUVA 5ELNA 3STBC 4C3HH 5IE8A 3CC7A 4GOPC 1OTCA 4A93G 2D62A 3PV0A 1VQ4A 1B8AA 1UE7A 2DGYA 4B3RL 2MFIA 1SE8A 1HZCA 1CKMA 1WOCA 2A19A 2K14A 3AQQA 3KLWA 4QIWE 3OTOL 5GAGC 2B63G 2IHEA 3I4OA 4DUZL 2JJQA 1WJJA 3ERSX 1XMOQ 4POGA 1XMQL 3HKSA 4JC0A 1PH9A 3HOZG 4GN3B 1H95A 3VDYA 4LFCL 4QY7A 2UUCL 1BVSA 4IFDJ 3M4PA 2HHHL 3CCQA 2IX1A 1S3OA 2Q2UA 5IWAQ 3M3YH 2E5LL 1IZ6A 1UE6A 3T1HQ 4AYBG 5H1SE 3J81j 2VUMH 2VNUD 4LW1A 4XIGS 4DNIA 1GKHA 4FDBA 1C7YA 4NXMQ 1HJPA 4LF5Q 3T1YQ 4DV3L 1K73C 3H0GG 3WWVA 2NN6I 2WB1G 2Z6KC 1L1OC 1Q81C 1HNXL 2GVAA 1A63A 1VQFA 2IHFA 3CF5A 5J3BA 4BXXH 4DR3Q 1G51A 3FKIG 1KL9A 1HNZQ 3HOUG 4X64Q 4BBRG 1PH4A 2R7ZH 5FLMH 4HJ9A 1WCMH 4R1JA 1SROA 1UE5A 1W3SA 4IPDA 5M5XH 3RZOH 4JI0L 4HJ7A 1Z47A 4JG2A 4A3EG 1L1OB 4HIDA 3BU2A 1AE2A 1HR0L 3GTOH 5JEAG 2ES2A 2YTYA 4LF9L 1QVFA 4KHPQ 2RHSB 4UP8A 2CFMA 4YCWA 4L5SA 2CWAA 2MQHA 4NXNL 4JBMA 4A3CG 2JA7H 3F8TA 4DV7L 2UUAQ 4JI6Q 2GN5A 1VQCA 3HOVG 5C3EH 3KYHC 2Y0SE 4A3KG 3S1RH 3KF8B 1VQPA 4L5QA 5ELOA 2I5MX 4B3TQ 3E9IA 1G6PA 1U5KA 2PQAA 4A4IA 3OYYA 1QVGA 1OXVA 1PH5A 1K8GA 1VQLA 1NMGA 2JQOA 4X62Q 3L2PA 2OTLA 1KXLA 3I4MG 4DR4Q 1SRUA 2IT1A 4LUOA 2A8VA 4BY7H 4LFAL 3S17H 1UEBA 3J80c 2OCEA 1I94Q 3Q8DA 1YVCA 2PI2A 4IPHA 3S1NH 2RHQB 4GKJL 1XNRQ 4NPSA 4A3DH 3M7NA 4DPGA 3I55A 1VQ5A 1OXXK 4RG1A 2AHOB 1CKOA 3KJOA 3KFUA 4K0KL 3U50C 2EXDA 4QJFA 5C0XI 3PUYA 4GNXA 4OXPA 2K75A 1VQMA 5IYCH 4B3ML 4LF7L 1FJGL 2R7FA 1JJGA 3G71A 2JA6H 1CSPA 4AYBE 4DR5Q 1YNXA 4Y7NH 3JC62 2DUDA 1WFQA 1J6QA 1Q46A 5FJ8H 1TWHH 1E3PA 4HJAA 2VL6A 4GLVB 1Y1VG 1G291 3BZCA 4POFA 1MIUA 3I56A 1SMXA 2UUBQ 2UU9Q 3JC63 1LM0A 1VCIA 4LUZA 3OTOQ 4PZ6A 4OO1I 1K3RA 3H15A 4R4IA 1X55A 1BBWA 4B3SQ 4JI8Q 5IYDH 1EWIA 2ZM6L 3DLLA 4A76A 4LFBQ 3GTLH 4IJHA 3CQZH 5IP9H 3HKZG 1XJVA 2VQEL 4A3GH 1BKBA 4A75A 2Z6KA 4OWTB 3PF5A 1YBYA 3GO5A 4DK6C 2OQKA 3J81c 5AJ3L 3BJUA 2KCTA 1JJ2A 3JAMi 1N34Q 4JI2L 4JV5L 2VZAA 3S2HH 4LF4L 2HT1A 2I5LX 4O2DA 2RCNA 3W1GA 4DUYL 3EBEA 2QA4A 1Q7YC 3KDFB 4A3IH 1PHJA 4JI5Q 1RL2A 5DLQE 2VUMG 5JJIA 1JE5A 1NTGA 2XTIA 1GO3E 2EQSA 4PMWA 2BH2A 5GQOA 4HJ8A 4DR7L 1N36L 1GD7A 1VQAA 1IBML 1NMFA 1HNWQ 3CCVA 5E7NA 1PVOA 1UWVA 2PMZE 4LF8L 2WFWA 3W1BA 4LF6Q 3PF4A 2GVBA 3NBHB 1KRSA 2R6GA 1VS0A 1I6HH 2JK8A 3RR5A 4BXXG 4DV2L 1CKNB 5LMNL 3S2DH 2AWOA 4HIOA 2R7ZG 5FLMG 3M85A 1WCMG 4YWKA 1C9OA 1MKHA 4DV1Q 1ASYA 4APVA 3GTQH 4IPCA 5IP7H 1J5EL 1E24A 2QGQA 3HOXH 4GLAC 4X66Q 1YEZA 2KHJA 1VQNA 2UXCL 2F4VQ 4XTCS 5LMNW 3GDEA 3EN2A 3J80i 3KF6A 3K81C 3PIOA 3ULPA 2JA7G 2NVTH 3NELA 1FGUA 3PUZA 2KCMA 5C3EG 3HOYH 2RF4A 3AYHB 4BA1I 1LTLA 2CCZA 1VQEA 1XNQQ 3U58A 4JI1L 1PYSB 1LYLA 3RLNA 5LMUL 1S40A 4UY8C 4AIMA 2K50A 2YTXA 2Z0SA 4DV5L 2LXKA 1KC8C 3A0JA 4A3BH 2VQFL 3PO2H 4DR6L 4MNOA 4BY7G 1KAWA 1E1TA 3A74A 5BR8L 2N78A 1PH2A 1PV4A 2UXBL 2ID0A 1Q1BA 3B6YA 2JEAI 3D31A 2WAQG 4GNXB 3UE1A 3F2CA 5K36G 1IBLQ 4X65L 3H3VI 2BA0A 1A8VA 4AQYQ 1IBKL 3TREA 3HKZE 4A3DG 3AFPA 4JYAL 1B70B 3S24A 3SGIA 1QZHA 4JBJA 4MZ9A 1WI5A 3UDXA 3HOWH 1O7IA 1VQGA 2UXDL 1X56A 1HR0W 4JOIA 1V1QA 1K83H 5IYCG 1A0IA 1OXTA 4DV4Q 4YY3L 4NB3A 5C4XH 1PH6A 4JI7L 3CC4A 4LWCA 4JI4Q 1DGSA 2JA6G 4GKKQ 4A3LH 3UDFA 5IYBH 3PGZA 5FJ8G 5IT9c 1HZ9A 1VQHA 3I7FA 1NE3A 1X3FA 1EIFA 4KI0A 1GM5A 1VQ9A 4DV6Q 2JE6I 1TWAH 2KBNA 2JA5H 2MO0A 2HIVA 2Q2TA 1C0AA 1WYDA 5IYDG 1IXRA 1N33Q 2ZJPA 1MJCA 5IY0A 1TXYA 5IP9G 1NY4A 1XMOL 2KHIA 4DR1Q 3CP0A 4IFDG 1R9TH 1YZ6A 5C4JH 4A3GG 3RZDH 4DV0Q 2E8GA 1VQJA 3F2DA 4DR2Q 1Q8KA 4OX9Q 3ICEA 4GOPA 4PG3A 5IWAL 2I5HA 3PSIA 3T1HL 1VQ8A 3GTMH 3CCRA 1A62A 4GS3A 3DM3A 1QZGA 1YITA 4A3IG 3D0FA 4NXML 4LF5L 1N32Q 3ULJA 3T1YL 3UE0A 1L0WA 2IY5B 1YJNA 1PH7A 2JEBI 3RLFA 1TWFH 4BY1H 4B3RQ 1IL2A 1U0LA 3GTKH 3EIVA 3RNUA 1X65A 4DR3L 4TQUS 3G48A 4X64L 3PO3H 2A1AA 2AWNA 2WB1E 4DAYB 1EUJA 3I2ZA 4DUZQ 2N3SA 3PO2G 1OXUA 3S1QH 3F1ZA 3E0EA 1ASZA 2L15A 1XMQQ 3CCEA 1N9WA 2N49A 1YJ9A 4LFCQ 1QVCA 5IP7G 1EYGA 2UUCQ 1JJCB 1HZAA 3HOXG 1I5FA 1NBWA 1MJEA 2HHHQ 3S14H 1OXSC 4KHPL 1L1OA 1PH1A 2AMCB 2H5XA 1M1KC 2ALYB 2CWPA 2E5LQ 4IOAA 4IO9A 4WJ3M 1GVPA 2UUAL 2AKWB 3KJPA 4DKAC 1NJIC 5M5WH 4JI6L 1EQRA 1X6OA 3GTGH 2F52A 3BZKA 1S72A 3GTJH 1K9MC 4MTNA 1Q86C 2YTVA 3KOJA 4DV3Q 4B3TL 3HOYG 4J15A 5C0XJ 1HNXQ 3NEMA 2NN6G 1Q12A 1Q1EA 3UDIA 2OWOA 3PUVA 4KLKA 4X62L 1N8RC 3TS2A 2C35B 4A3JH 4DR4L 3CAMA 3GD7A 3RLOA 4P72A 4A3BG 4IFDI 4UP7A 3MXNB 3AFQA 3L0OA 5EAYA 3U4VA 3ZJYC 1QUQA 1TWGH 3CPFA 4JI0Q 3AEVA 1HR0Q 1I94L 4OWWB 2Q2IA 4AH6A 2WP8J 2R93H 2K52A 1K8AC 4LF9Q 2Y0SG 2R92H 1XNRL 3HFZB 5JEAJ 2JA8H 1PH3A 5GAEC 2K5VA 1XPOA 4NXNQ 4WJ4A 1PYBA 3CCLA 2QEXA 4DV7Q 1IYJB 3CMEA 4DAMA 2K5NA 2VS1A 4BBSH 3PUXA 5C44H 1SFOH 4JBKA 2PQAB 3ULLA 1HZBA 3HOWG 1XPRA 2ASBA 1EQQA 5HY6A 4DR5L 1X3EA 4P73A 1Y1WH 2B29A 2NZOA 5C4XG 1X9NA 4A3LG 2E2JH 1T9HA 4R4CA 3STBD 2PI2E 5IYBG 2UUBL 3S16H 4C3IH 2B3GA 5GAHC 2UU9L 4JCVE 4YHHL 4A3MH 4GNXC 4LFAQ 4H02A 5GADC 2D0PA 3A5ZB 4JI8L 4B3SL 2FXQA 4LFBL 2JA5G 5HGQA 4GOPB 3TEHB 1Q82C 3I4NH 4Y52H 1X3GA 2LSSA 2Q2HA 3CMAA 1KHIA 2IX0A 1E22A 4GKJQ 4A3FH 3H3VH 1AE3A 3J7ZC 1KD1C 1N34L 3M4QA 3PIPA 4K0KQ 4JBWA 2NVQH 4LNQA 2D0OA 4JI3L 4JI5L 4L5RC 3E9HA 5C0XG 4B3MQ 4LF7Q 1FJGQ 3G4SA 3RN2A 5M3FG 4EQ5A 1VQDA 5M3MH 3KDFA 3J81i 1HNWL 2KENA 4P71A 4A93H 4OONA 1JMCA 3K7AH 4LF6L 5GROA 1VQBA 4QQBX 3CCUA 3CW2C 4BY1G 3PUWA 3JAMc 4TVAB 3PCOB 2R7DA 4OO1G 1AH9A 1JT8A 2B63H 2K4KA 4L5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PO3 G;  2EIF A;  1Z9F A;  2E2I H;  2NVY H;  3HOZ H;  4DV1 L;  2VQE Q;  1CKN A;  1BBU A;  1RIP A;  4YCU A;  4X66 L;  2ATW A;  4QL5 A;  4GN4 B;  3IRB A;  4PZ7 A;  4R4Q A;  2XGT A;  2ZTD A;  5AJ3 Q;  3JC6 6;  4QGU A;  1D8L A;  2F4V L;  4JI2 Q;  4JV5 Q;  4ME3 A;  3A5U A;  4ALP A;  4LF4 Q;  4DUY Q;  3CCM A;  1VQO A;  3CPW A;  1Y14 B;  1M90 C;  4UP9 A;  3F2B A;  1EFW A;  2I0Q A;  4DR7 Q;  2CKZ B;  3H0G H;  4KHZ A;  1W2B A;  5M3F H;  1N36 Q;  2F3I A;  1IBM Q;  1SLJ A;  4HJ5 A;  2K5H A;  1CSQ A;  1XNQ L;  4LF8 Q;  4PZ8 A;  1KIX A;  1QUQ B;  1VQ6 A;  1YHB A;  3FKI H;  2MO1 A;  3HOU H;  4P74 A;  1YJW A;  1V9P A;  4BBR H;  2ZJR A;  1PFS A;  1E1O A;  3TS0 A;  3G6E A;  4DV2 Q;  3FHW A;  5LMN Q;  2N8N A;  2BA1 A;  4A3J G;  5M5Y H;  3S1M H;  4A3E H;  1HNZ L;  3OW2 A;  3CCS A;  3J7A 5;  1VQI A;  1SR3 A;  2YV5 A;  1J5E Q;  2NVX H;  3TRZ A;  2UXC Q;  1YIJ A;  1E7Z A;  3KF6 B;  3L7Z C;  4IJL A;  4O0A A;  2R93 G;  3K0X A;  1IBL L;  1PA6 A;  4A3C H;  4DK3 C;  2R92 G;  1YHQ A;  1CUK A;  4AQY L;  4P75 A;  1P8L A;  2JA8 G;  1V43 A;  1KQS A;  3CC2 A;  2ZTC A;  3HOV H;  2HIX A;  4R4O A;  2VY3 A;  4GLX A;  4A3K H;  1B7Y B;  1XPU A;  2WAQ E;  1P16 A;  2V1C C;  1EIY B;  4BBS G;  5C44 G;  2JA9 A;  4HIM A;  2LXJ A;  4DV4 L;  2PNH A;  1JB7 A;  4GKK L;  1X54 A;  4YCV A;  4EX5 A;  4IOC A;  1Y1W G;  3ER0 A;  4JI1 Q;  3W5O A;  5LMU Q;  4C2M H;  1VQ7 A;  4JI4 L;  4YHH Q;  1PH8 A;  3I4M H;  4YWL A;  4DV5 Q;  1FVI A;  1XTD A;  3CD6 A;  2HQL A;  2VQF Q;  4DV6 L;  1TWC H;  2ZM6 Q;  1L2F A;  2ZTE A;  4DR6 Q;  4A3M G;  4JOI C;  2E2H H;  5BR8 Q;  4IPG A;  1I50 H;  4BA2 I;  1N33 L;  3TQY A;  3CCJ A;  4R4T A;  2UXB Q;  3I4N G;  1VQK A;  4DR1 L;  2MNA A;  4YWM A;  4X65 Q;  3CXC A;  3S15 H;  4DV0 L;  1IBK Q;  4A3F G;  4DR2 L;  4C3J H;  4JYA Q;  4UPA A;  4HIK A;  4JI3 Q;  4OX9 L;  2NZH A;  3RN5 A;  1I3Q H;  3GTP H;  4GN5 A;  5JJK A;  2YYZ A;  1YI2 A;  2BH8 A;  3UDG A;  2YU9 H;  3U4Z A;  5JJL A;  3NEN A;  3M4O H;  3LGJ A;  1EOV A;  2OTJ A;  2CQO A;  2UXD Q;  1UE1 A;  1D7Q A;  1K0R A;  1KRT A;  1N32 L;  3M9B A;  4JI7 Q;  3MEF A;  1YHA A;  4YY3 Q;  5FLX c;  2VW9 A;  1SN8 A;  3K8A A;  3K7U C;  4X6A H;  4OWX B;  3FP9 A;  5M3M G;  2ZJQ A;  3K80 C;  1Y1V H;  1LUZ A;  1HH2 P;  4RMF A;  1FL0 A;  2OQ0 A;  4LUV A;  5ELN A;  3STB C;  4C3H H;  5IE8 A;  3CC7 A;  4GOP C;  1OTC A;  4A93 G;  2D62 A;  3PV0 A;  1VQ4 A;  1B8A A;  1UE7 A;  2DGY A;  4B3R L;  2MFI A;  1SE8 A;  1HZC A;  1CKM A;  1WOC A;  2A19 A;  2K14 A;  3AQQ A;  3KLW A;  4QIW E;  3OTO L;  5GAG C;  2B63 G;  2IHE A;  3I4O A;  4DUZ L;  2JJQ A;  1WJJ A;  3ERS X;  1XMO Q;  4POG A;  1XMQ L;  3HKS A;  4JC0 A;  1PH9 A;  3HOZ G;  4GN3 B;  1H95 A;  3VDY A;  4LFC L;  4QY7 A;  2UUC L;  1BVS A;  4IFD J;  3M4P A;  2HHH L;  3CCQ A;  2IX1 A;  1S3O A;  2Q2U A;  5IWA Q;  3M3Y H;  2E5L L;  1IZ6 A;  1UE6 A;  3T1H Q;  4AYB G;  5H1S E;  3J81 j;  2VUM H;  2VNU D;  4LW1 A;  4XIG S;  4DNI A;  1GKH A;  4FDB A;  1C7Y A;  4NXM Q;  1HJP A;  4LF5 Q;  3T1Y Q;  4DV3 L;  1K73 C;  3H0G G;  3WWV A;  2NN6 I;  2WB1 G;  2Z6K C;  1L1O C;  1Q81 C;  1HNX L;  2GVA A;  1A63 A;  1VQF A;  2IHF A;  3CF5 A;  5J3B A;  4BXX H;  4DR3 Q;  1G51 A;  3FKI G;  1KL9 A;  1HNZ Q;  3HOU G;  4X64 Q;  4BBR G;  1PH4 A;  2R7Z H;  5FLM H;  4HJ9 A;  1WCM H;  4R1J A;  1SRO A;  1UE5 A;  1W3S A;  4IPD A;  5M5X H;  3RZO H;  4JI0 L;  4HJ7 A;  1Z47 A;  4JG2 A;  4A3E G;  1L1O B;  4HID A;  3BU2 A;  1AE2 A;  1HR0 L;  3GTO H;  5JEA G;  2ES2 A;  2YTY A;  4LF9 L;  1QVF A;  4KHP Q;  2RHS B;  4UP8 A;  2CFM A;  4YCW A;  4L5S A;  2CWA A;  2MQH A;  4NXN L;  4JBM A;  4A3C G;  2JA7 H;  3F8T A;  4DV7 L;  2UUA Q;  4JI6 Q;  2GN5 A;  1VQC A;  3HOV G;  5C3E H;  3KYH C;  2Y0S E;  4A3K G;  3S1R H;  3KF8 B;  1VQP A;  4L5Q A;  5ELO A;  2I5M X;  4B3T Q;  3E9I A;  1G6P A;  1U5K A;  2PQA A;  4A4I A;  3OYY A;  1QVG A;  1OXV A;  1PH5 A;  1K8G A;  1VQL A;  1NMG A;  2JQO A;  4X62 Q;  3L2P A;  2OTL A;  1KXL A;  3I4M G;  4DR4 Q;  1SRU A;  2IT1 A;  4LUO A;  2A8V A;  4BY7 H;  4LFA L;  3S17 H;  1UEB A;  3J80 c;  2OCE A;  1I94 Q;  3Q8D A;  1YVC A;  2PI2 A;  4IPH A;  3S1N H;  2RHQ B;  4GKJ L;  1XNR Q;  4NPS A;  4A3D H;  3M7N A;  4DPG A;  3I55 A;  1VQ5 A;  1OXX K;  4RG1 A;  2AHO B;  1CKO A;  3KJO A;  3KFU A;  4K0K L;  3U50 C;  2EXD A;  4QJF A;  5C0X I;  3PUY A;  4GNX A;  4OXP A;  2K75 A;  1VQM A;  5IYC H;  4B3M L;  4LF7 L;  1FJG L;  2R7F A;  1JJG A;  3G71 A;  2JA6 H;  1CSP A;  4AYB E;  4DR5 Q;  1YNX A;  4Y7N H;  3JC6 2;  2DUD A;  1WFQ A;  1J6Q A;  1Q46 A;  5FJ8 H;  1TWH H;  1E3P A;  4HJA A;  2VL6 A;  4GLV B;  1Y1V G;  1G29 1;  3BZC A;  4POF A;  1MIU A;  3I56 A;  1SMX A;  2UUB Q;  2UU9 Q;  3JC6 3;  1LM0 A;  1VCI A;  4LUZ A;  3OTO Q;  4PZ6 A;  4OO1 I;  1K3R A;  3H15 A;  4R4I A;  1X55 A;  1BBW A;  4B3S Q;  4JI8 Q;  5IYD H;  1EWI A;  2ZM6 L;  3DLL A;  4A76 A;  4LFB Q;  3GTL H;  4IJH A;  3CQZ H;  5IP9 H;  3HKZ G;  1XJV A;  2VQE L;  4A3G H;  1BKB A;  4A75 A;  2Z6K A;  4OWT B;  3PF5 A;  1YBY A;  3GO5 A;  4DK6 C;  2OQK A;  3J81 c;  5AJ3 L;  3BJU A;  2KCT A;  1JJ2 A;  3JAM i;  1N34 Q;  4JI2 L;  4JV5 L;  2VZA A;  3S2H H;  4LF4 L;  2HT1 A;  2I5L X;  4O2D A;  2RCN A;  3W1G A;  4DUY L;  3EBE A;  2QA4 A;  1Q7Y C;  3KDF B;  4A3I H;  1PHJ A;  4JI5 Q;  1RL2 A;  5DLQ E;  2VUM G;  5JJI A;  1JE5 A;  1NTG A;  2XTI A;  1GO3 E;  2EQS A;  4PMW A;  2BH2 A;  5GQO A;  4HJ8 A;  4DR7 L;  1N36 L;  1GD7 A;  1VQA A;  1IBM L;  1NMF A;  1HNW Q;  3CCV A;  5E7N A;  1PVO A;  1UWV A;  2PMZ E;  4LF8 L;  2WFW A;  3W1B A;  4LF6 Q;  3PF4 A;  2GVB A;  3NBH B;  1KRS A;  2R6G A;  1VS0 A;  1I6H H;  2JK8 A;  3RR5 A;  4BXX G;  4DV2 L;  1CKN B;  5LMN L;  3S2D H;  2AWO A;  4HIO A;  2R7Z G;  5FLM G;  3M85 A;  1WCM G;  4YWK A;  1C9O A;  1MKH A;  4DV1 Q;  1ASY A;  4APV A;  3GTQ H;  4IPC A;  5IP7 H;  1J5E L;  1E24 A;  2QGQ A;  3HOX H;  4GLA C;  4X66 Q;  1YEZ A;  2KHJ A;  1VQN A;  2UXC L;  2F4V Q;  4XTC S;  5LMN W;  3GDE A;  3EN2 A;  3J80 i;  3KF6 A;  3K81 C;  3PIO A;  3ULP A;  2JA7 G;  2NVT H;  3NEL A;  1FGU A;  3PUZ A;  2KCM A;  5C3E G;  3HOY H;  2RF4 A;  3AYH B;  4BA1 I;  1LTL A;  2CCZ A;  1VQE A;  1XNQ Q;  3U58 A;  4JI1 L;  1PYS B;  1LYL A;  3RLN A;  5LMU L;  1S40 A;  4UY8 C;  4AIM A;  2K50 A;  2YTX A;  2Z0S A;  4DV5 L;  2LXK A;  1KC8 C;  3A0J A;  4A3B H;  2VQF L;  3PO2 H;  4DR6 L;  4MNO A;  4BY7 G;  1KAW A;  1E1T A;  3A74 A;  5BR8 L;  2N78 A;  1PH2 A;  1PV4 A;  2UXB L;  2ID0 A;  1Q1B A;  3B6Y A;  2JEA I;  3D31 A;  2WAQ G;  4GNX B;  3UE1 A;  3F2C A;  5K36 G;  1IBL Q;  4X65 L;  3H3V I;  2BA0 A;  1A8V A;  4AQY Q;  1IBK L;  3TRE A;  3HKZ E;  4A3D G;  3AFP A;  4JYA L;  1B70 B;  3S24 A;  3SGI A;  1QZH A;  4JBJ A;  4MZ9 A;  1WI5 A;  3UDX A;  3HOW H;  1O7I A;  1VQG A;  2UXD L;  1X56 A;  1HR0 W;  4JOI A;  1V1Q A;  1K83 H;  5IYC G;  1A0I A;  1OXT A;  4DV4 Q;  4YY3 L;  4NB3 A;  5C4X H;  1PH6 A;  4JI7 L;  3CC4 A;  4LWC A;  4JI4 Q;  1DGS A;  2JA6 G;  4GKK Q;  4A3L H;  3UDF A;  5IYB H;  3PGZ A;  5FJ8 G;  5IT9 c;  1HZ9 A;  1VQH A;  3I7F A;  1NE3 A;  1X3F A;  1EIF A;  4KI0 A;  1GM5 A;  1VQ9 A;  4DV6 Q;  2JE6 I;  1TWA H;  2KBN A;  2JA5 H;  2MO0 A;  2HIV A;  2Q2T A;  1C0A A;  1WYD A;  5IYD G;  1IXR A;  1N33 Q;  2ZJP A;  1MJC A;  5IY0 A;  1TXY A;  5IP9 G;  1NY4 A;  1XMO L;  2KHI A;  4DR1 Q;  3CP0 A;  4IFD G;  1R9T H;  1YZ6 A;  5C4J H;  4A3G G;  3RZD H;  4DV0 Q;  2E8G A;  1VQJ A;  3F2D A;  4DR2 Q;  1Q8K A;  4OX9 Q;  3ICE A;  4GOP A;  4PG3 A;  5IWA L;  2I5H A;  3PSI A;  3T1H L;  1VQ8 A;  3GTM H;  3CCR A;  1A62 A;  4GS3 A;  3DM3 A;  1QZG A;  1YIT A;  4A3I G;  3D0F A;  4NXM L;  4LF5 L;  1N32 Q;  3ULJ A;  3T1Y L;  3UE0 A;  1L0W A;  2IY5 B;  1YJN A;  1PH7 A;  2JEB I;  3RLF A;  1TWF H;  4BY1 H;  4B3R Q;  1IL2 A;  1U0L A;  3GTK H;  3EIV A;  3RNU A;  1X65 A;  4DR3 L;  4TQU S;  3G48 A;  4X64 L;  3PO3 H;  2A1A A;  2AWN A;  2WB1 E;  4DAY B;  1EUJ A;  3I2Z A;  4DUZ Q;  2N3S A;  3PO2 G;  1OXU A;  3S1Q H;  3F1Z A;  3E0E A;  1ASZ A;  2L15 A;  1XMQ Q;  3CCE A;  1N9W A;  2N49 A;  1YJ9 A;  4LFC Q;  1QVC A;  5IP7 G;  1EYG A;  2UUC Q;  1JJC B;  1HZA A;  3HOX G;  1I5F A;  1NBW A;  1MJE A;  2HHH Q;  3S14 H;  1OXS C;  4KHP L;  1L1O A;  1PH1 A;  2AMC B;  2H5X A;  1M1K C;  2ALY B;  2CWP A;  2E5L Q;  4IOA A;  4IO9 A;  4WJ3 M;  1GVP A;  2UUA L;  2AKW B;  3KJP A;  4DKA C;  1NJI C;  5M5W H;  4JI6 L;  1EQR A;  1X6O A;  3GTG H;  2F52 A;  3BZK A;  1S72 A;  3GTJ H;  1K9M C;  4MTN A;  1Q86 C;  2YTV A;  3KOJ A;  4DV3 Q;  4B3T L;  3HOY G;  4J15 A;  5C0X J;  1HNX Q;  3NEM A;  2NN6 G;  1Q12 A;  1Q1E A;  3UDI A;  2OWO A;  3PUV A;  4KLK A;  4X62 L;  1N8R C;  3TS2 A;  2C35 B;  4A3J H;  4DR4 L;  3CAM A;  3GD7 A;  3RLO A;  4P72 A;  4A3B G;  4IFD I;  4UP7 A;  3MXN B;  3AFQ A;  3L0O A;  5EAY A;  3U4V A;  3ZJY C;  1QUQ A;  1TWG H;  3CPF A;  4JI0 Q;  3AEV A;  1HR0 Q;  1I94 L;  4OWW B;  2Q2I A;  4AH6 A;  2WP8 J;  2R93 H;  2K52 A;  1K8A C;  4LF9 Q;  2Y0S G;  2R92 H;  1XNR L;  3HFZ B;  5JEA J;  2JA8 H;  1PH3 A;  5GAE C;  2K5V A;  1XPO A;  4NXN Q;  4WJ4 A;  1PYB A;  3CCL A;  2QEX A;  4DV7 Q;  1IYJ B;  3CME A;  4DAM A;  2K5N A;  2VS1 A;  4BBS H;  3PUX A;  5C44 H;  1SFO H;  4JBK A;  2PQA B;  3ULL A;  1HZB A;  3HOW G;  1XPR A;  2ASB A;  1EQQ A;  5HY6 A;  4DR5 L;  1X3E A;  4P73 A;  1Y1W H;  2B29 A;  2NZO A;  5C4X G;  1X9N A;  4A3L G;  2E2J H;  1T9H A;  4R4C A;  3STB D;  2PI2 E;  5IYB G;  2UUB L;  3S16 H;  4C3I H;  2B3G A;  5GAH C;  2UU9 L;  4JCV E;  4YHH L;  4A3M H;  4GNX C;  4LFA Q;  4H02 A;  5GAD C;  2D0P A;  3A5Z B;  4JI8 L;  4B3S L;  2FXQ A;  4LFB L;  2JA5 G;  5HGQ A;  4GOP B;  3TEH B;  1Q82 C;  3I4N H;  4Y52 H;  1X3G A;  2LSS A;  2Q2H A;  3CMA A;  1KHI A;  2IX0 A;  1E22 A;  4GKJ Q;  4A3F H;  3H3V H;  1AE3 A;  3J7Z C;  1KD1 C;  1N34 L;  3M4Q A;  3PIP A;  4K0K Q;  4JBW A;  2NVQ H;  4LNQ A;  2D0O A;  4JI3 L;  4JI5 L;  4L5R C;  3E9H A;  5C0X G;  4B3M Q;  4LF7 Q;  1FJG Q;  3G4S A;  3RN2 A;  5M3F G;  4EQ5 A;  1VQD A;  5M3M H;  3KDF A;  3J81 i;  1HNW L;  2KEN A;  4P71 A;  4A93 H;  4OON A;  1JMC A;  3K7A H;  4LF6 L;  5GRO A;  1VQB A;  4QQB X;  3CCU A;  3CW2 C;  4BY1 G;  3PUW A;  3JAM c;  4TVA B;  3PCO B;  2R7D A;  4OO1 G;  1AH9 A;  1JT8 A;  2B63 H;  2K4K A;  4L5T A; 
#chains in the Genus database with same CATH topology
 3PO3 G;  2NVY H;  3HOZ H;  4DV1 L;  5IOC A;  4PMC A;  1CKN A;  1JOO A;  4GN4 B;  1G91 A;  2XGT A;  5AJ3 Q;  3DMU A;  4KN4 C;  4JI2 Q;  4ALP A;  5IT9 L;  4KJO A;  1ROD A;  4DUY Q;  1ZYR D;  3CCM A;  1VQO A;  2L9H A;  3TME A;  2Y0S B;  3A8K E;  3NTI A;  1EFW A;  1NSN S;  4DR7 Q;  1GHK A;  3HP3 A;  4RHS A;  5M3F H;  1SLJ A;  3IL8 A;  5C3X A;  1XNQ L;  4KKS A;  1VQ6 A;  1KDB A;  3FKI H;  1EQT A;  1V9P A;  4BBR H;  3G6E A;  4DV2 Q;  3I8Z A;  5LMN Q;  1IL8 A;  1B1Z A;  3S1M H;  3QOL A;  3U9S A;  3CCS A;  5DEH A;  1J5E Q;  2UXC Q;  4MN3 A;  5DNF A;  1T5E A;  1CM9 A;  3I72 A;  2KCN A;  4DK3 C;  1YHQ A;  1CUK A;  4AQY L;  3R2I A;  1TWA B;  2F3W A;  3V05 A;  1QJO A;  3CC2 A;  1AZP A;  4RHR A;  2WAQ E;  4OHJ A;  2DY8 A;  1R9T B;  4L6T B;  2LXJ A;  4KK7 A;  5JPM C;  4DV4 L;  2O4X A;  4DK1 A;  1X54 A;  1O7Z A;  4YCV A;  4IOC A;  1VQ7 A;  3W5O A;  3J7A F;  1CT1 D;  3I4M H;  5M3F B;  1LTA D;  3EQL C;  2HQL A;  1KDC A;  4C3I G;  3J81 L;  2XN9 C;  1H9M A;  4A3M G;  2EE1 A;  2E2H H;  4IPG A;  2P5Z X;  2XIW A;  1N33 L;  4WFN 3;  2UXB Q;  3I4N G;  2KOL A;  4YWM A;  1EEI D;  1HRJ A;  3F2U A;  1SNO A;  1IBK Q;  5HGT A;  1I3Q H;  4GN5 A;  2YYZ A;  3TZU A;  5BN4 A;  2BH8 A;  4IQZ A;  3UDG A;  3QJY A;  3S1Q B;  5JJL A;  2EY1 A;  3LGJ A;  1EOV A;  5EKI A;  3R93 A;  1ML0 D;  2XNA C;  1SN8 A;  4RKB A;  3ZYY X;  5HUR A;  4HMJ A;  3GP7 A;  4HAE A;  4RMF A;  1PTO D;  3ONA B;  3CC7 A;  2Q2T A;  3OIP A;  2KEE A;  4K8I A;  1STE A;  3PV0 A;  1A15 A;  5M5W B;  1UE7 A;  3W2D A;  2MFI A;  3NHH A;  3GTJ B;  1WOC A;  2K7V A;  4QIW E;  3AQQ A;  4U67 3;  3KLW A;  2B63 G;  2IHE A;  2HCC A;  4DUZ L;  2JJQ A;  3ERS X;  2EOT A;  4CHT B;  1XMO Q;  4GN3 B;  4QY7 A;  1BVS A;  3LWE A;  1TY2 A;  3CCQ A;  2Q2U A;  4A3J B;  5IWA Q;  2B2V C;  2KUM A;  3M3Y H;  2VUM H;  2VB2 X;  4FDB A;  5KND A;  3KLR A;  1HQR D;  4JPB W;  3T1Y Q;  3P7J A;  1K73 C;  3H0G G;  2WB1 G;  3NK9 A;  2Z6K C;  1L1O C;  4RAU C;  1G51 A;  1SFO B;  1HNZ Q;  4X64 Q;  3DWQ A;  2NTS A;  5FLM H;  4HJ9 A;  1WCM H;  1Y1W B;  4IPD A;  2E75 C;  1VDZ A;  4A3E G;  3BU2 A;  4LF9 L;  2YTY A;  3S16 B;  4UP8 A;  4YCW A;  4L5S A;  3DWP A;  1EL0 A;  2B8F A;  1NCV A;  4JI6 Q;  2GN5 A;  5C3E H;  2Y0S E;  3S1R H;  3KF8 B;  1ILP A;  1VQP A;  4A3F B;  4R9W A;  1U5K A;  4A4I A;  1OXV A;  1PH5 A;  2JQO A;  1IW7 C;  2A73 B;  2A8V A;  4ZK9 B;  2Q8R E;  5M3M B;  4NP5 A;  4CJ2 C;  1NNX A;  1PXU A;  3SR1 A;  4FF2 A;  2F0S A;  1F9S A;  3M7N A;  4DPG A;  2CH4 W;  2VXW A;  1OXX K;  1CKO A;  4K0K L;  2E2I B;  4GNX A;  1FJG L;  1JJG A;  2K6A A;  2O5I C;  1YNX A;  2JP1 A;  5E4W C;  1WTP A;  1J6Q A;  1Q46 A;  5FJ8 H;  1TWH H;  1E3P A;  4HJA A;  4AYB B;  1Y1V G;  1G29 1;  3CRL C;  1LM0 A;  1XWE A;  4PZ6 A;  1BBW A;  4B3S Q;  4KKU A;  4LFB Q;  4IJH A;  3CQZ H;  1F77 A;  2EYF A;  4IFD H;  1GUG A;  1XJV A;  2VQE L;  2QKI C;  1BKB A;  3EJI A;  5G3L D;  4A3G H;  3GO5 A;  4DK6 C;  2IX3 A;  2OQK A;  3I90 A;  2FHT A;  4FXG C;  5CYU A;  3VYU A;  3J81 c;  3KLS X;  2KCT A;  1JJ2 A;  1QOH A;  4JV5 L;  4LF4 L;  2HT1 A;  3W1G A;  2QA4 A;  1JR0 D;  3KDF B;  3D6C A;  1JE5 A;  5CBA E;  4L63 B;  5I6W A;  1GO3 E;  1VQA A;  4O1N A;  1PVO A;  1II3 A;  1MSH A;  1UWV A;  2PZW A;  3KBG A;  1Y8P B;  2BCO A;  2ZT9 C;  1VS0 A;  2PMZ B;  4LAA A;  5EPK A;  3U9O A;  3NTK A;  2XSC A;  3S2D H;  3J80 E;  1WTW A;  4KTA A;  4YWK A;  3NE5 B;  1PTO B;  1ASY A;  4RGN A;  3MA2 B;  2KHJ A;  2B2W A;  4KHV A;  5FO8 B;  2F4V Q;  4HN7 A;  4XTC S;  3VYR A;  2CW0 C;  3H09 A;  3PIO A;  1B4O A;  4G7Z C;  2JA7 G;  2EYL A;  2NVT H;  3Q24 A;  1BNZ A;  5CV4 A;  2RF4 A;  4K6D A;  2CCZ A;  2NN6 H;  3TBI B;  2K50 A;  4DV5 L;  5KYI A;  3A0J A;  2VQF L;  5C4Z A;  5NUC A;  4BY7 G;  1QB5 D;  1PH2 A;  4HMI A;  2JEA I;  2ICE C;  4V0B A;  3UE1 A;  1IBL Q;  4X65 L;  3H3V I;  3WDN A;  3TRE A;  4HSV A;  3HKZ E;  3AFP A;  2CQA A;  1EY0 A;  3H3V C;  3SGI A;  4MZ9 A;  1WI5 A;  1VQG A;  2XRQ D;  2ICI A;  4OIJ A;  2Q8I B;  3JAM L;  5IYC G;  1PH6 A;  1LTB D;  2MUY A;  4LWC A;  4GKK Q;  5FLX E;  3QG1 A;  4XQJ A;  1VQH A;  4KI0 A;  1VQ9 A;  3C46 A;  3OW7 A;  5D14 A;  3T4A C;  1SBB B;  1HUN A;  2DJF C;  4K5V A;  5IY0 A;  4OGQ C;  5C3W A;  2KHI A;  4DR1 Q;  2LY7 A;  5C4J H;  3K5M A;  1B44 D;  4DV0 Q;  3ERO A;  1QIL A;  1VQJ A;  5EPJ A;  4DR2 Q;  1IYV A;  4QF4 A;  4CJ0 B;  4PG3 A;  4GOP A;  2R7Z B;  2MJ8 A;  3RUZ A;  1ET9 A;  5M5X B;  5C0X H;  3RZO B;  1AP0 A;  3CCR A;  3DM3 A;  3GTO B;  4NXM L;  3J80 L;  2QIL A;  1PDQ A;  3UE0 A;  2F03 A;  1L0W A;  1KDA A;  1PH7 A;  2JEB I;  1TWF H;  2EVB A;  3Q6S A;  4B3R Q;  1U0L A;  3GTK H;  1U4M A;  1G6Z A;  2J7Z A;  3G48 A;  3C1F A;  2XRS D;  3PO3 H;  5T1G A;  1OXU A;  1DOM A;  3E0E A;  3VR4 A;  5IIF A;  4ID6 A;  1HZA A;  1MJE A;  1CA6 A;  4KJN A;  2E5L Q;  3BVG A;  4F8M A;  1GVP A;  2NBF A;  2AKW B;  3KJP A;  3S1N B;  4MTN A;  3TP5 A;  4DV3 Q;  2F0V A;  4A3D B;  3D6W A;  2EY6 A;  3KF8 A;  4K8J A;  1SAP A;  3URY A;  3E0J A;  3PUV A;  1CI3 M;  2ZXO A;  4IUP A;  1N8R C;  3TS2 A;  4DR4 L;  1CZG A;  3CAM A;  4WRD A;  3AFQ A;  3U4V A;  4JI0 Q;  3PO2 G;  1TWG H;  4XT3 B;  3BVZ A;  3EVQ A;  1I94 L;  4OWW B;  4AH6 A;  2WP8 J;  2K52 A;  4IN3 A;  1XNR L;  4OEM B;  3HFZ B;  4BWG B;  4C1N K;  4QUF A;  5FLX L;  4WJ4 A;  3CCL A;  1IYJ B;  4DXG A;  2SNM A;  1R4Q B;  3PUX A;  1LTG D;  2F0G A;  2PQA B;  2NWG A;  1HZB A;  3ULL A;  2ASB A;  1X3E A;  4O42 A;  1X9N A;  5CMD A;  5EJW A;  5IYB G;  3STB D;  2PI2 E;  4A3I B;  4C3I H;  4F88 A;  1DJR D;  2F0L A;  4A3M H;  4CDD C;  3G6J B;  5GAD C;  2D0P A;  2JA5 G;  1XXG A;  3TEH B;  1Q82 C;  3I4N H;  3A7L A;  1SE4 A;  2Q2H A;  1KHI A;  2IX0 A;  4GKJ Q;  2K04 A;  2O5J C;  3J7Z C;  4IAL A;  1F2Z A;  4IUT A;  4JBW A;  5LHY 1;  1K8M A;  5C6A A;  3V96 A;  4JI5 L;  5M9O A;  4CDC C;  1VF7 A;  3HOX B;  3KDF A;  1HNW L;  1GXD C;  4TKO B;  3K7A H;  4LF6 L;  1VQB A;  1HUM A;  2L1B A;  3CW2 C;  3L9A X;  3JAM c;  3PUW A;  1AN8 A;  4TVA B;  4OO1 G;  2RQX A;  2B63 H;  4L5T A;  2ZM6 Q;  2EIF A;  3ERQ A;  1DD2 A;  2L11 A;  2J0T D;  4YCU A;  2Z4I A;  4X66 L;  2ZTD A;  1D8L A;  1PZJ D;  4XT1 B;  4A3B B;  3J7Y W;  1XYI A;  3OHX C;  2KHS A;  2B2Y A;  1YNN C;  2B2U C;  3FDT A;  4UP9 A;  2CKZ B;  3H0G H;  4KHZ A;  5JPN C;  1IBM Q;  1XX8 A;  2J4X A;  4F7X A;  1M8A A;  5DM7 3;  1GOZ A;  2K5H A;  1ZEQ X;  4LF8 Q;  1RD9 D;  5IGG A;  3HOW B;  2A69 C;  4P74 A;  1EZ6 A;  1PFS A;  4CDE C;  2KVM A;  3TS0 A;  3MVV A;  3FHW A;  3MXU A;  2BA1 A;  4A3E H;  5C4X B;  3OW2 A;  1SR3 A;  1LT6 D;  2YV5 A;  3BZD B;  1E7Z A;  3L7Z C;  4EVO A;  1QNK A;  5I2Y A;  2D9U A;  2FFK B;  3K0X A;  2R93 G;  4HTH A;  1V8Q A;  3NP8 A;  2JA8 G;  1EIG A;  3BDO A;  3TDQ A;  2PPB C;  5CR3 A;  1P16 A;  5EGT A;  2V1C C;  4B9X A;  1VF5 C;  5C44 G;  4HIM A;  3RZD B;  4JI4 L;  4JI1 Q;  1LAC A;  2KJX A;  4X3S A;  3CD6 A;  3A8I E;  5L37 A;  2RSN A;  1F9P A;  1TWC H;  1ONL A;  3FPP A;  2ZTE A;  3RMH A;  4DR6 Q;  4JOI C;  2PZU A;  5BR8 Q;  4RCN A;  4XYQ A;  2F1M A;  3TZD A;  2M2L A;  1NUC A;  4BY1 B;  1FYC A;  3QWN A;  3CXC A;  3H94 A;  3S15 H;  4ME5 A;  4HIK A;  4JI3 Q;  3GTP H;  2NZH A;  3RN5 A;  1DOK A;  1T5X D;  2DY7 A;  3R8B A;  2OTJ A;  5ISR A;  3K0Y A;  1KRT A;  3M9B A;  4JI7 Q;  4YY3 Q;  1YHA A;  5FLX c;  4OWX B;  2ZJQ A;  1LT4 D;  1Y1V H;  5LL6 S;  1HH2 P;  4LUV A;  1LTS D;  4A93 G;  4MTK A;  3GTG B;  2LMC B;  1SNQ A;  1SJE D;  4FXD A;  3WOF A;  5JJZ A;  4N8X 1;  1WJJ A;  1KTK A;  1XMQ L;  4DGZ A;  1MSG A;  2LKV A;  3OOC A;  4LFC L;  1C8C A;  2UUC L;  4IFD J;  3M4P A;  2HHH L;  2F0D A;  2F0E A;  2BE5 D;  2B2T C;  1IZ6 A;  1F2M A;  2F0M A;  3T1H Q;  5H1S E;  2VNU D;  1FNW A;  1RHP A;  4DAV A;  4DNI A;  2HUG A;  1GKH A;  1KLG D;  5FO7 B;  1C7Y A;  1EY9 A;  4LF5 Q;  2R92 B;  2L0C A;  1LAB A;  3W3A A;  2NN6 I;  3K5O A;  1A63 A;  2AUJ D;  2KCC A;  3CF5 A;  1HA6 A;  2WKC A;  2K01 A;  4X3T A;  4BBS B;  4DR3 Q;  3HOU G;  3X3N A;  1UEA B;  5BN5 A;  1CHQ D;  4R1J A;  4RKL A;  1K28 A;  4JG2 A;  3NBH A;  3SK5 A;  5KEE A;  2ES2 A;  4HR7 B;  2RHS B;  2CFM A;  2CWA A;  2HDL A;  4A3C G;  3I91 A;  2JA7 H;  4DV7 L;  1TT2 A;  4IUU A;  2UUA Q;  2SDF A;  3HOV G;  3DXJ C;  4A3K G;  1L0X B;  3FRP B;  3MXG A;  5ELO A;  4B3T Q;  3E9I A;  2PQA A;  1A2U A;  2AQ3 B;  4V19 0;  2HD3 A;  4DFA A;  3GV3 A;  1SRU A;  4LUO A;  4BY7 H;  5FO9 B;  4LFA L;  2ENB A;  3S17 H;  4QCL A;  4XYO A;  3Q8D A;  1YVC A;  4IPH A;  1G8Z D;  4KV6 A;  4NPS A;  3I55 A;  1D1K A;  4RG1 A;  4C3J G;  3KFU A;  1YNJ D;  2F0W A;  3U50 C;  5CV7 A;  2X6L A;  4ABN A;  1WD1 A;  5C0X I;  1X32 A;  2EYM A;  2NVY B;  3PUY A;  4OXP A;  2XVS A;  3HOZ B;  2K75 A;  2NTT A;  5IYC H;  4B3M L;  4LF7 L;  4NMZ A;  1CSP A;  4DR5 Q;  2DUD A;  1DXM A;  2A6E D;  3BZC A;  2B2V A;  2UUB Q;  2OF1 A;  2UU9 Q;  3JC6 3;  4C3H G;  4ULL A;  1E2V A;  1LTR D;  3H15 A;  1X55 A;  4JI8 Q;  3DLL A;  3GTL H;  2DJG C;  2PW5 A;  3VYT A;  2Z6K A;  3H91 A;  2KA7 A;  3FKI B;  1U4L A;  2IWH A;  4BBR B;  5AJ3 L;  3BJU A;  2HQE A;  1LT5 D;  4JI2 L;  3NWT A;  2VZA A;  2N88 A;  4ZKB B;  1Y69 U;  3S1M B;  3S2H H;  4DUY L;  2MHV A;  1GUS A;  1Q7Y C;  1HTL D;  1RL2 A;  3MFY A;  3ITP A;  4UAI A;  5JJI A;  4K6L A;  3PIO 3;  1NTG A;  1SNP A;  2EQS A;  2BH2 A;  4DR7 L;  5GQO A;  1EOT A;  3GV6 A;  2F0J A;  2DNE A;  1NMF A;  5E7N A;  1EZ8 A;  2WFW A;  1KRS A;  2R6G A;  1I6H H;  2JK8 A;  3RR5 A;  4BXX G;  4KMU C;  4DV2 L;  5LMN L;  2RCF A;  2IW3 A;  2AWO A;  3N52 A;  3M85 A;  3GTQ H;  1S5B D;  4APV A;  1J5E L;  1E24 A;  1VQN A;  2UXC L;  1B3Q A;  1VMC A;  3I4M B;  4C1N I;  5A2Q E;  2E2H B;  3K81 C;  3QIA A;  3NEL A;  3PUZ A;  4KD3 A;  4DA2 A;  3BDC A;  1LTL A;  4CJ1 B;  3DHQ A;  4FXK C;  3U58 A;  1PYS B;  1I3Q B;  1LYL A;  3RLN A;  1Z7T A;  5E4X A;  4UY8 C;  1GJX A;  3QOJ A;  5G3L F;  1DM0 B;  3PO2 H;  3HGB A;  1SSO A;  2PNR C;  4MNO A;  4TRD A;  1KAW A;  3A74 A;  1DON A;  1SMY C;  2KEC A;  2N78 A;  3K58 A;  2UXB L;  2K33 A;  1JWS D;  4C56 C;  2WAQ G;  5C4H A;  5CBE E;  3NPP A;  1BUV T;  5IGE A;  2EZV A;  1IBK L;  1WTH A;  2G5D A;  4JBJ A;  2NZ1 D;  3CU7 A;  2PCF B;  3HKZ B;  4WJW A;  4FYD A;  5CC4 A;  1EEF D;  2OXP A;  1HR0 W;  1V1Q A;  1K83 H;  2JA6 G;  3SK6 A;  1DGS A;  2AUK A;  2K5D A;  5IYB H;  3PGZ A;  3M3Y B;  3NUC A;  5IT9 c;  2VUM B;  2F0O A;  4JW0 A;  1RTO A;  1GM5 A;  3DEO A;  3MC0 B;  4QMG A;  4DV6 Q;  3VYS A;  2X69 A;  2KBN A;  2JA5 H;  1C0A A;  1WYD A;  5IYD G;  1IXR A;  3QO2 A;  5ELD A;  5IP9 G;  1EIH A;  3C2P A;  1XMO L;  1YZ6 A;  1O7Y A;  2E8G A;  2A5H A;  1FD7 D;  1UNS A;  4OX9 Q;  2QDB A;  5IWA L;  1WCM B;  2F0K A;  4E6I A;  2I5H A;  3GTM H;  3VR3 A;  3SEB A;  1N32 Q;  4OIK A;  2EDG A;  3T1Y L;  1U4P A;  2K28 A;  3OMC A;  4G57 A;  3RLF A;  1IL2 A;  4OO1 H;  5C3E B;  3S1R B;  2EJF C;  1D1I A;  4X64 L;  4PQX A;  4DAY B;  4DNR B;  3OIQ A;  3K5L A;  3F1Z A;  1ASZ A;  1N9W A;  2N49 A;  1YJ9 A;  1R4P B;  1EYG A;  1A3V A;  1JJC B;  4J1M A;  2SNS A;  1I5F A;  1NBW A;  3GQB A;  5IGD A;  3S14 H;  1PH1 A;  2H5X A;  2ALY B;  2CWP A;  4H7B A;  5ELE A;  4IOA A;  2BOS A;  4U68 A;  4JI6 L;  4DKA C;  1JE4 A;  4KY5 A;  2F52 A;  1S72 A;  2A68 C;  1Q86 C;  1K9M C;  3KOJ A;  1G2S A;  5IGC A;  3HOY G;  1L0Y B;  5JVG 3;  3V2T A;  1HNX Q;  4IUN A;  3HZX A;  1Q1E A;  1SND A;  3UDI A;  2C35 B;  3BYT B;  3GD7 A;  3PQI A;  5J1Z A;  4UP7 A;  3MXN B;  3L0O A;  5JJK A;  3ZJY C;  1LTT D;  2SOB A;  1TWH B;  1HR0 Q;  2X6G A;  1WTO A;  2Q2I A;  3H6M A;  2R93 H;  1K8A C;  2Y0S G;  2JA8 H;  5GAE C;  1XPO A;  4NXN Q;  3BDL A;  2QEX A;  1ESR A;  5A35 A;  3CME A;  1CHP D;  1PMR A;  3CQZ B;  2VS1 A;  2L4N A;  5C44 H;  4JBK A;  4A3G B;  1PRT C;  1STB A;  1SYC A;  5HY6 A;  5KIX A;  2N55 A;  2NZO A;  1C4Q A;  1ENA A;  3OPO A;  2E2J H;  2A6H C;  1TQO A;  2B3G A;  4N9P A;  4YHH L;  4GNX C;  2R3Z A;  5IGF A;  5ELC A;  1EY5 A;  4LK1 C;  4B3S L;  2FXQ A;  4LFB L;  4ZAI A;  4CKE A;  1A2T A;  1IKM A;  2LSS A;  3CMA A;  4ILW A;  4OEL B;  3ND9 A;  3KBX A;  1LV9 A;  3TSS A;  1UAP A;  3M4Q A;  1HTP A;  3S2D B;  2NVQ H;  4LNQ A;  4I7A A;  2H1E A;  3T51 B;  1ILQ A;  5D65 A;  3G4S A;  5M3F G;  4EQ5 A;  1VQD A;  4XDX A;  2XWB B;  1GUN A;  2E76 C;  4A93 H;  1I4X A;  3OMG A;  2NVT B;  2L5T A;  3PCO B;  2R7D A;  1VQF A;  3NWS A;  2K4K A;  3MHB A;  1Z9F A;  1PLF A;  5F2D A;  4HED A;  2KED A;  1RIP A;  5I9P A;  4QL5 A;  1S5D D;  3IRB A;  4PZ7 A;  4R4Q A;  3JC6 6;  3OWE B;  4QGU A;  2F4V L;  4ME3 A;  3A5U A;  1HPC A;  3CPW A;  2EPB A;  1PRT F;  4PV1 C;  2JYO A;  1W2B A;  3I73 A;  1N36 Q;  2F3I A;  4IUR A;  2Z8L A;  1UUP A;  1PYW D;  2WV6 D;  1IHZ A;  1QUQ B;  1DZ1 A;  3HOU H;  1YJW A;  2ZJR A;  1H9K A;  2JXM B;  1IW7 D;  5DM6 3;  1G2T A;  4QB4 A;  4A3J G;  5M5Y H;  1TII D;  3J7A 5;  1VQI A;  2NVX H;  3TRZ A;  1YIJ A;  3KF6 B;  4O0A A;  1IBL L;  4A3C H;  2EY5 A;  2RSO A;  4P75 A;  1A3U A;  1S4Z A;  3HOV H;  5KYL A;  2HIX A;  2K03 A;  4R4O A;  3TP6 A;  4A3K H;  1XPU A;  4H13 C;  2WIN B;  5C4J B;  3TP8 A;  2PNH A;  4GKK L;  1Y1W G;  2QW7 A;  5LMU Q;  4C2M H;  2EYJ A;  1PH8 A;  1FVI A;  1BCP C;  1I6V C;  1J8I A;  2HCI A;  4K2L A;  4FP5 D;  1L2F A;  3T56 B;  1I50 H;  3TQY A;  1LTI D;  3HEJ A;  4DR1 L;  1TWF B;  4TSS A;  3GTK B;  4DV0 L;  3VR6 A;  4DNT B;  4A3F G;  1BR9 A;  4C3J H;  4DR2 L;  4UPA A;  4JYA Q;  3PO3 B;  2LFN A;  3P1H A;  3SK8 A;  1K8O A;  2TMP A;  2Z9H A;  2YU9 H;  3BS1 A;  3IKJ A;  3NEN A;  1H9S B;  3M4O H;  2UXD Q;  2CQO A;  1D7Q A;  1UE1 A;  3TP7 A;  1K0R A;  2MP1 A;  1BDO A;  2KQ3 A;  5EPL A;  1W6J A;  2VW9 A;  3K8A A;  3K7U C;  3HG9 A;  5M3M G;  3K80 C;  3AMU A;  1EU4 A;  4C3H H;  4GOP C;  2D62 A;  3M4Y A;  1VQ4 A;  4B3R L;  2DGY A;  4CGY B;  2H4O A;  2WAC A;  3I70 A;  3M7G A;  2E74 C;  2B2U A;  2NUC A;  1HZC A;  1CKM A;  3OTO L;  1AFP A;  5GAG C;  1LO5 D;  4POG A;  4FO2 A;  3HKS A;  4JC0 A;  1PH9 A;  4DAY A;  1QCB D;  2I46 A;  2E5L L;  2CW0 D;  1UE6 A;  4AYB G;  5KNB A;  3J81 j;  4LW1 A;  1TWG B;  5E3F A;  1DYQ A;  2K5Q A;  3A7A B;  1E2Z A;  4DV3 L;  1JQY D;  3QB3 A;  1SXT A;  1D5M C;  1S5C D;  1Q81 C;  1BCP F;  1EU3 A;  5J3B A;  4BXX H;  4L8J A;  1KL9 A;  2L12 A;  4K2K A;  5EBD A;  3Q23 A;  1SRO A;  1W3S A;  4JI0 L;  1Z47 A;  4HCS A;  1L1O B;  4HID A;  1ZXT A;  5JEA G;  3MXN A;  4KHP Q;  2Q8T A;  4C3I B;  4A3M B;  2MQH A;  5KNC A;  4JBM A;  2RDH A;  1ZYR C;  3I4N B;  3E6Z X;  3HS0 C;  5JOB A;  4L5Q A;  1BBX C;  3E3X A;  3OYY A;  2EJG C;  3DWA A;  4IZ8 A;  1K8G A;  1HA5 A;  4X62 Q;  3N6R A;  1EY8 A;  3EFX D;  2OTL A;  3MFG A;  1KXL A;  3D4R A;  1UEB A;  3J80 c;  2OCE A;  1LLR D;  2PI2 A;  3S9W A;  3K7A B;  4GKJ L;  1STH A;  4H0L C;  1Q8I A;  2B63 B;  2AHO B;  4QJF A;  3MXP A;  3LWU A;  2R7F A;  4KN7 C;  3NXW A;  2JA6 H;  1I4P A;  4Y7N H;  3JC6 2;  2PQE A;  1O7L A;  1U9R A;  4GLV B;  3SXH A;  2NB0 A;  2FMM A;  4POF A;  1SMX A;  2B2T A;  4OO1 I;  3H0G B;  5IYD H;  4RA8 A;  2ZM6 L;  1S5F D;  2WB1 B;  2M9V A;  5IP9 H;  4A75 A;  1A3T A;  1N34 Q;  5K5P A;  3VR5 A;  4O2D A;  4A3E B;  1QG7 A;  2LS0 1;  3EBE A;  1PHJ A;  4N8F A;  2PO4 A;  3J7A V;  3KUP A;  2XTI A;  3WOE A;  1IYU A;  1IBM L;  2IPK D;  4R8I A;  3MEH A;  4LF8 L;  5FKA C;  4CBV A;  3W1B A;  1OO9 B;  4RGO S;  2B2Y C;  1FNU A;  4HIO A;  2K5W A;  2R7Z G;  4G7H C;  5COR A;  1C9O A;  4DV1 Q;  4KY7 A;  1WTR A;  2QGQ A;  1K3B C;  4IUV A;  1HFG A;  2RDG A;  5LMN W;  1KLU D;  1TWC B;  3PIP 3;  3KF6 A;  4RCO A;  4UDU C;  5IOD A;  3ULP A;  3NQT A;  1F9R A;  1STG A;  4DK0 A;  3HOY H;  3AYH B;  4BA1 I;  3S15 B;  1VQE A;  1XNQ Q;  4NW2 A;  3GTP B;  4JI1 L;  1S40 A;  4DU9 A;  4AIM A;  1PRT B;  2YTX A;  2Z0S A;  1RF2 D;  4XQQ A;  2LXK A;  1BOS A;  3CHB D;  4M1U B;  4DR6 L;  2QDL A;  2G9H D;  5BR8 L;  1BXT A;  1Y1V B;  2ID0 A;  3B6Y A;  1EFI D;  2QCP X;  3D31 A;  4GNX B;  4MHE A;  1EY4 A;  5K36 G;  1SE3 A;  4Z9C B;  1JOK A;  2BA0 A;  5EQ0 A;  4AQY Q;  4A3D G;  1Z6H A;  1B70 B;  2EYH A;  2FMC A;  3S24 A;  1QZH A;  4ZLT F;  2Z1C A;  1M4V A;  2L55 A;  2CHB D;  1X56 A;  2K32 A;  3BG3 A;  1PTO F;  3PF4 A;  4DV4 Q;  4JI7 L;  4YY3 L;  4NB3 A;  3CC4 A;  1H9S A;  3UDF A;  1X3F A;  1EIF A;  1TWA H;  1U4R A;  2MO0 A;  1AW7 A;  1CK1 A;  3RD4 A;  1N33 Q;  2F0H A;  2ZJP A;  1MJC A;  5ELF A;  5FK9 C;  1NY4 A;  3CP0 A;  3OSO A;  1R9T H;  4KY6 A;  2E2D C;  3ICE A;  1I4Q A;  5CV9 A;  1RJT A;  3PSI A;  3T1H L;  3SK4 A;  2FJ2 A;  1MD2 D;  1VQ8 A;  4G4K A;  1KNE A;  1YNN D;  1C48 A;  1QZG A;  1YIT A;  4A3I G;  1I4H A;  1PZK D;  5IGB A;  4LF5 L;  3R2T A;  5EKL A;  4JVZ A;  2IY5 B;  2JA7 B;  2CVR A;  4HCE A;  1JOQ A;  2TSS A;  3EIV A;  2A69 D;  1X65 A;  4DR3 L;  4TQU S;  1STA A;  4X3U A;  3E5S A;  2A1A A;  2AWN A;  2WB1 E;  5J22 A;  2K05 A;  1EUJ A;  3I2Z A;  4DUZ Q;  2N3S A;  3S1Q H;  3P20 A;  4K5X A;  2L15 A;  1TVX A;  4ZQ3 A;  1QVC A;  1QE6 A;  5IP7 G;  3NBI A;  3HOX G;  1QNU A;  1OXS C;  1SNC A;  1L1O A;  1Y8O B;  3CRK C;  1M1K C;  4FF1 A;  1B9M A;  3MTS A;  4BY7 B;  1CTM A;  1QWY A;  1NAP A;  1STY A;  3S17 B;  3ND8 A;  2UUA L;  1NJI C;  1ZKO A;  5M5W H;  1EQR A;  1I4R A;  3GTJ H;  3KK7 A;  4CKB A;  4ZUI A;  4B3T L;  4J15 A;  1Q90 A;  5C0X J;  3NEM A;  4ZCK A;  2OWO A;  4KLK A;  1TY0 A;  2F0I A;  4A3J H;  1TS3 A;  1D5Z C;  4P72 A;  4A3B G;  1EWC A;  5EAY A;  3AEV A;  1BCP B;  5I2X A;  2O2L D;  4LF9 Q;  1K0S A;  1PZI D;  5J39 A;  1TR5 A;  4ZRZ A;  2K5V A;  1PYB A;  4DXF A;  4I7Z C;  1FGB D;  2I07 B;  4PNY A;  4DAM A;  3GTL B;  2K5N A;  1B3A A;  1SFO H;  4P2C B;  3HOW G;  1EYA A;  4DR5 L;  4P73 A;  1Y1W H;  1TS2 A;  2B29 A;  5C4X G;  3D4D A;  1MHW C;  3S2H B;  4A3L G;  4R4C A;  2UUB L;  2VB3 X;  3S16 H;  2UU9 L;  5GAH C;  2MGS A;  1DCZ A;  3A8J E;  4JI8 L;  4XQN A;  5HGQ A;  1RTN A;  4GOP B;  4Y52 H;  2ZXP A;  4A3F H;  1JOR A;  1AE3 A;  3BVM A;  1I6H B;  2XWJ B;  1KD1 C;  3PIP A;  4K0K Q;  3O13 A;  3GTQ B;  3E9H A;  2FIN B;  1FJG Q;  3FPU B;  3RN2 A;  3FVQ A;  3K59 A;  1VMP A;  3D3R A;  5M3M H;  3J81 i;  2KEN A;  1CQV A;  4P71 A;  1JMC A;  1KNA A;  3IFD A;  4LMQ D;  4BY1 G;  5EKK A;  1WTV A;  2E2I H;  5CV6 A;  2EYP A;  2VQE Q;  5I4D A;  1BBU A;  1TS4 A;  3LNN A;  2ATW A;  3KLS A;  1HQM C;  4JV5 Q;  1CFM A;  3PO2 B;  4M8A A;  4LF4 Q;  1Y14 B;  1M90 C;  2Z4H A;  3F2B A;  2I0Q A;  1ET6 A;  5E1F A;  2F0N A;  4HJ5 A;  1CSQ A;  4PZ8 A;  1KIX A;  3P75 A;  1V1P B;  1YHB A;  4B9W A;  2MO1 A;  4JK1 C;  1E1O A;  3K5N A;  4WOR A;  3A54 A;  1D5X C;  2N8N A;  1K83 B;  5A2Q L;  1HNZ L;  2OEO A;  1SYE A;  1KAA A;  3X3M A;  5JEA H;  1SE2 A;  4IJL A;  1PA6 A;  3Q22 A;  2R92 G;  3I4L A;  3VR2 A;  1P8L A;  1B9N A;  1V43 A;  3MAQ A;  2JA5 B;  1KQS A;  2ZTC A;  4GLX A;  2VY3 A;  4PMB A;  5T1I A;  1B7Y B;  3D8G A;  4CDF C;  1EIY B;  1BO0 A;  4BBS G;  2JA9 A;  1HHV A;  4K5W A;  1JB7 A;  1PTO H;  4EX5 A;  3ER0 A;  3G7L A;  4RGM A;  4YHH Q;  1SYF A;  5AFW A;  4YWL A;  4DV5 Q;  3GTM B;  3NTH A;  1XTD A;  3JAM E;  2AQ2 B;  2VQF Q;  4DV6 L;  1MGS A;  1H9R A;  3PMF A;  2QEJ C;  1B2T A;  1X3Q A;  4BA2 I;  1E0B A;  3CCJ A;  4R4T A;  4ZKC B;  2RVL A;  4UHV A;  1VQK A;  4KKT A;  1Q3L A;  3K6O A;  2MNA A;  4X65 Q;  2WII B;  4EQP A;  4OX9 L;  2RDF A;  2RKS A;  3AB9 A;  1YI2 A;  3CKI B;  4NDX A;  3U4Z A;  2F0Q A;  1TS5 A;  2OT2 A;  1SJH D;  1N32 L;  2EY2 A;  2ZXR A;  5FOB B;  3MEF A;  3S14 B;  4X6A H;  3FP9 A;  1LUZ A;  1SYB A;  1FL0 A;  2OQ0 A;  5ELN A;  4ZUJ A;  3STB C;  2IL8 A;  5IE8 A;  3SVM A;  1OTC A;  1PFM A;  4EGV A;  1B8A A;  1SE8 A;  2DNC A;  2A19 A;  2K14 A;  1JB3 A;  2RA4 A;  1NR2 A;  1ENC A;  3I4O A;  5KGU A;  3HOZ G;  1H95 A;  3VDY A;  4KD4 A;  2D2C C;  1GHJ A;  4J6H A;  2IX1 A;  1S3O A;  3MZ5 A;  1SYG A;  4XIG S;  4MIU A;  2DN8 A;  4FF3 A;  2R93 B;  3T53 B;  4NXM Q;  1HJP A;  1S5E D;  3AU7 A;  3WWV A;  2JA8 B;  4DAP A;  5BN3 A;  1HNX L;  2GVA A;  1H9J A;  2IHF A;  1BQQ T;  5C44 B;  3R3O A;  2AQ1 B;  2EJM A;  3FKI G;  2A74 C;  3D4W A;  4BBR G;  1PH4 A;  2R7Z H;  5JAV A;  1UE5 A;  5M5X H;  3RZO H;  1F2Y A;  4HJ7 A;  1SMY D;  1JWU D;  1HR0 L;  1AE2 A;  1EYC A;  3GTO H;  2E2J B;  1QVF A;  2G9D A;  3DUZ A;  1HFN A;  1PFN A;  4NXN L;  1ICW A;  3K57 A;  1V1O A;  3F8T A;  2BDN A;  1VQC A;  1SNM A;  3KYH C;  5I9O A;  5D3D A;  1CZW A;  2CH4 A;  2I5M X;  2PW7 A;  1O78 A;  1G6P A;  2F3V A;  1GUW A;  4I65 A;  2V4D A;  1QVG A;  2B2W C;  2NVQ B;  5CV8 A;  1VQL A;  1NMG A;  3L2P A;  2F0U A;  3I4M G;  4DR4 Q;  2IT1 A;  3DM1 A;  4G7O C;  1WVL A;  1I94 Q;  5K36 H;  3S1N H;  4A93 B;  5LL6 X;  1SDF A;  2RHQ B;  1XNR Q;  2Z6B A;  1W6K A;  4A3D H;  1AEX A;  2D5D A;  4RH6 A;  5D3I B;  1XTC D;  1VQ5 A;  1KAB A;  3OWF A;  3T16 A;  1JWM D;  3KJO A;  5COY A;  2EXD A;  2BDO A;  1VQM A;  3G71 A;  3IFT A;  4AYB E;  3SE0 A;  1WFQ A;  2VL6 A;  1BF4 A;  3I56 A;  1MIU A;  3MWY W;  1VCI A;  4LUZ A;  3OTO Q;  1D2B A;  1K3R A;  4R4I A;  3T13 A;  3IAY A;  1EWI A;  1TU2 B;  4A76 A;  3HKZ G;  2JSO A;  3PF5 A;  4OWT B;  1YBY A;  1RCV D;  3HOU B;  1JCK B;  1CQF A;  3JAM i;  3VA7 A;  2MPM A;  2F0F A;  4N9T A;  5M5Y B;  2I5L X;  2RCN A;  4A3I H;  4JI5 Q;  2VUM G;  5DLQ E;  3SDZ A;  2NVX B;  4PMW A;  1JC7 A;  2A68 D;  4HJ8 A;  1N36 L;  1GD7 A;  1HNW Q;  3CCV A;  1DOL A;  3C3L A;  3C1E A;  2PMZ E;  4LF6 Q;  3HOV B;  2GVB A;  3NBH B;  4A3K B;  1WTQ A;  1AZQ A;  5JVH 3;  1SYD A;  3EA6 A;  5C5M A;  1CKN B;  1V1P A;  1B50 A;  5EBC A;  5FLM G;  1WCM G;  1MKH A;  2R61 A;  4FNF A;  4IPC A;  2F4I A;  5IP7 H;  4C2M B;  3FMC A;  5CGK A;  3HOX H;  4GLA C;  4X66 Q;  1YEZ A;  3GDE A;  3EN2 A;  3L3O C;  2BE5 C;  2EYO A;  3J80 i;  1EQV A;  5C5L A;  1I50 B;  1CA5 A;  5CV5 A;  5ELB A;  1PFB A;  1FGU A;  4QUC A;  2KCM A;  5C3E G;  1PRT D;  4C3J B;  3TN2 A;  4FVM A;  5LMU L;  4CKC A;  2A6H D;  2YU9 B;  3M4O B;  1F2L A;  1KC8 C;  4XXE A;  4A3B H;  1EY6 A;  4S3S A;  1E1T A;  2C9O A;  2QF7 A;  2K1B A;  1PV4 A;  4IUQ A;  4EQO A;  1Q1B A;  4C3H B;  3F2C A;  1ESF A;  1A8V A;  4JYA L;  4RGT A;  3UDX A;  3HOW H;  1O7I A;  2UXD L;  5DAU A;  2IJ0 A;  4JOI A;  1A0I A;  1OXT A;  4FF4 A;  5C4X H;  4JI4 Q;  4A3L H;  5FJ8 G;  1HZ9 A;  3I7F A;  1NE3 A;  2JE6 I;  4BS9 A;  5KRU A;  1E2W A;  2HIV A;  4F87 A;  1TXY A;  3A56 A;  4IFD G;  4A3G G;  3RZD H;  4K14 A;  3F2D A;  1JIC A;  1Q8K A;  1YNJ C;  4NKL A;  3SHL A;  2WKD A;  1A62 A;  4GS3 A;  3D0F A;  1X3P A;  1WTX A;  4X3K A;  3ULJ A;  3I3C A;  1NR4 A;  2A6E C;  1B53 A;  1YJN A;  1STN A;  1MI2 A;  4BY1 H;  3RNU A;  4J8Q A;  1HCZ A;  4OL7 A;  4EQN A;  2F0P A;  1GUT A;  1GUO A;  4RFB A;  2EXZ A;  1XMQ Q;  4LJZ C;  1TKW B;  3CCE A;  1SEB D;  4LFC Q;  2B8G A;  2UUC Q;  4KHP L;  2HHH Q;  1O80 A;  2AMC B;  3DEP A;  3NSW A;  4IO9 A;  1EY7 A;  4WJ3 M;  1ICF B;  3GTG H;  1RDP D;  1X6O A;  2GA4 B;  2JN4 A;  2WAQ B;  3BZK A;  2PZT A;  2YTV A;  1FR3 A;  4GZY C;  4H44 C;  3LX0 A;  3BYY B;  4ODG A;  1HXY D;  2NN6 G;  5IT9 E;  4Q0F A;  1Q12 A;  2C5C A;  1PTO C;  3FEW X;  5TSS A;  4X62 L;  1EWH A;  1BCP D;  5I6Y A;  3UI2 A;  1Y8N B;  2JA6 B;  3RLO A;  2NYZ D;  4Y7N B;  4IFD I;  1QUQ A;  3CPF A;  1ENF A;  1EYD A;  3Q0A A;  2R92 H;  5JEA J;  1PH3 A;  4DV7 Q;  2RBM A;  4BBS H;  1J9O A;  3VA5 A;  1RKN A;  1XPR A;  1EQQ A;  2M00 A;  4HSP A;  1IKL A;  1T9H A;  4JCV E;  4LFA Q;  4H02 A;  3A5Z B;  4RWS C;  4QIW B;  2SEB D;  1X3G A;  4ZYS A;  2PYK A;  1E22 A;  1I4G A;  3H3V H;  3QR8 A;  2F0T A;  4DF7 A;  1WD0 A;  3J81 E;  1N34 L;  1F9Q A;  4DN4 M;  3NQI A;  2D0O A;  4JI3 L;  2HDM A;  4L5R C;  5C0X G;  4B3M Q;  4LF7 Q;  1A6X A;  4B08 A;  4Q5V A;  1FNV A;  3A55 A;  1D6E C;  1LT3 D;  3HRZ C;  4OON A;  4YIJ A;  5GRO A;  1MBY A;  2B39 A;  4QQB X;  3CCU A;  4R8N A;  1AH9 A;  1JT8 A;  3HOY B; 
#chains in the Genus database with same CATH homology
 3PO3 G;  2EIF A;  1Z9F A;  2E2I H;  2NVY H;  3HOZ H;  4DV1 L;  2VQE Q;  1CKN A;  1BBU A;  1RIP A;  4YCU A;  4X66 L;  2ATW A;  4QL5 A;  4GN4 B;  3IRB A;  4PZ7 A;  4R4Q A;  2XGT A;  2ZTD A;  5AJ3 Q;  3JC6 6;  4QGU A;  1D8L A;  2F4V L;  4JI2 Q;  4JV5 Q;  4ME3 A;  3A5U A;  4ALP A;  4LF4 Q;  4DUY Q;  3CCM A;  1VQO A;  3CPW A;  1Y14 B;  1M90 C;  4UP9 A;  3F2B A;  1EFW A;  2I0Q A;  4DR7 Q;  2CKZ B;  3H0G H;  4KHZ A;  1W2B A;  5M3F H;  1N36 Q;  2F3I A;  1IBM Q;  1SLJ A;  4HJ5 A;  2K5H A;  1CSQ A;  1XNQ L;  4LF8 Q;  4PZ8 A;  1KIX A;  1QUQ B;  1VQ6 A;  1YHB A;  3FKI H;  2MO1 A;  3HOU H;  4P74 A;  1YJW A;  1V9P A;  4BBR H;  2ZJR A;  1PFS A;  1E1O A;  3TS0 A;  3G6E A;  4DV2 Q;  3FHW A;  5LMN Q;  2N8N A;  2BA1 A;  4A3J G;  5M5Y H;  3S1M H;  4A3E H;  1HNZ L;  3OW2 A;  3CCS A;  3J7A 5;  1VQI A;  1SR3 A;  2YV5 A;  1J5E Q;  2NVX H;  3TRZ A;  2UXC Q;  1YIJ A;  1E7Z A;  3KF6 B;  3L7Z C;  4IJL A;  4O0A A;  2R93 G;  3K0X A;  1IBL L;  1PA6 A;  4A3C H;  4DK3 C;  2R92 G;  1YHQ A;  1CUK A;  4AQY L;  4P75 A;  1P8L A;  2JA8 G;  1V43 A;  1KQS A;  3CC2 A;  2ZTC A;  3HOV H;  2HIX A;  4R4O A;  2VY3 A;  4GLX A;  4A3K H;  1B7Y B;  1XPU A;  2WAQ E;  1P16 A;  2V1C C;  1EIY B;  4BBS G;  5C44 G;  2JA9 A;  4HIM A;  2LXJ A;  4DV4 L;  2PNH A;  1JB7 A;  4GKK L;  1X54 A;  4YCV A;  4EX5 A;  4IOC A;  1Y1W G;  3ER0 A;  4JI1 Q;  3W5O A;  5LMU Q;  4C2M H;  1VQ7 A;  4JI4 L;  4YHH Q;  1PH8 A;  3I4M H;  4YWL A;  4DV5 Q;  1FVI A;  1XTD A;  3CD6 A;  2HQL A;  2VQF Q;  4DV6 L;  1TWC H;  2ZM6 Q;  1L2F A;  2ZTE A;  4DR6 Q;  4A3M G;  4JOI C;  2E2H H;  5BR8 Q;  4IPG A;  1I50 H;  4BA2 I;  1N33 L;  3TQY A;  3CCJ A;  4R4T A;  2UXB Q;  3I4N G;  1VQK A;  4DR1 L;  2MNA A;  4YWM A;  4X65 Q;  3CXC A;  3S15 H;  4DV0 L;  1IBK Q;  4A3F G;  4DR2 L;  4C3J H;  4JYA Q;  4UPA A;  4HIK A;  4JI3 Q;  4OX9 L;  2NZH A;  3RN5 A;  1I3Q H;  3GTP H;  4GN5 A;  5JJK A;  2YYZ A;  1YI2 A;  2BH8 A;  3UDG A;  2YU9 H;  3U4Z A;  5JJL A;  3NEN A;  3M4O H;  3LGJ A;  1EOV A;  2OTJ A;  2CQO A;  2UXD Q;  1UE1 A;  1D7Q A;  1K0R A;  1KRT A;  1N32 L;  3M9B A;  4JI7 Q;  3MEF A;  1YHA A;  4YY3 Q;  5FLX c;  2VW9 A;  1SN8 A;  3K8A A;  3K7U C;  4X6A H;  4OWX B;  3FP9 A;  5M3M G;  2ZJQ A;  3K80 C;  1Y1V H;  1LUZ A;  1HH2 P;  4RMF A;  1FL0 A;  2OQ0 A;  4LUV A;  5ELN A;  3STB C;  4C3H H;  5IE8 A;  3CC7 A;  4GOP C;  1OTC A;  4A93 G;  2D62 A;  3PV0 A;  1VQ4 A;  1B8A A;  1UE7 A;  2DGY A;  4B3R L;  2MFI A;  1SE8 A;  1HZC A;  1CKM A;  1WOC A;  2A19 A;  2K14 A;  3AQQ A;  3KLW A;  4QIW E;  3OTO L;  5GAG C;  2B63 G;  2IHE A;  3I4O A;  4DUZ L;  2JJQ A;  1WJJ A;  3ERS X;  1XMO Q;  4POG A;  1XMQ L;  3HKS A;  4JC0 A;  1PH9 A;  3HOZ G;  4GN3 B;  1H95 A;  3VDY A;  4LFC L;  4QY7 A;  2UUC L;  1BVS A;  4IFD J;  3M4P A;  2HHH L;  3CCQ A;  2IX1 A;  1S3O A;  2Q2U A;  5IWA Q;  3M3Y H;  2E5L L;  1IZ6 A;  1UE6 A;  3T1H Q;  4AYB G;  5H1S E;  3J81 j;  2VUM H;  2VNU D;  4LW1 A;  4XIG S;  4DNI A;  1GKH A;  4FDB A;  1C7Y A;  4NXM Q;  1HJP A;  4LF5 Q;  3T1Y Q;  4DV3 L;  1K73 C;  3H0G G;  3WWV A;  2NN6 I;  2WB1 G;  2Z6K C;  1L1O C;  1Q81 C;  1HNX L;  2GVA A;  1A63 A;  1VQF A;  2IHF A;  3CF5 A;  5J3B A;  4BXX H;  4DR3 Q;  1G51 A;  3FKI G;  1KL9 A;  1HNZ Q;  3HOU G;  4X64 Q;  4BBR G;  1PH4 A;  2R7Z H;  5FLM H;  4HJ9 A;  1WCM H;  4R1J A;  1SRO A;  1UE5 A;  1W3S A;  4IPD A;  5M5X H;  3RZO H;  4JI0 L;  4HJ7 A;  1Z47 A;  4JG2 A;  4A3E G;  1L1O B;  4HID A;  3BU2 A;  1AE2 A;  1HR0 L;  3GTO H;  5JEA G;  2ES2 A;  2YTY A;  4LF9 L;  1QVF A;  4KHP Q;  2RHS B;  4UP8 A;  2CFM A;  4YCW A;  4L5S A;  2CWA A;  2MQH A;  4NXN L;  4JBM A;  4A3C G;  2JA7 H;  3F8T A;  4DV7 L;  2UUA Q;  4JI6 Q;  2GN5 A;  1VQC A;  3HOV G;  5C3E H;  3KYH C;  2Y0S E;  4A3K G;  3S1R H;  3KF8 B;  1VQP A;  4L5Q A;  5ELO A;  2I5M X;  4B3T Q;  3E9I A;  1G6P A;  1U5K A;  2PQA A;  4A4I A;  3OYY A;  1QVG A;  1OXV A;  1PH5 A;  1K8G A;  1VQL A;  1NMG A;  2JQO A;  4X62 Q;  3L2P A;  2OTL A;  1KXL A;  3I4M G;  4DR4 Q;  1SRU A;  2IT1 A;  4LUO A;  2A8V A;  4BY7 H;  4LFA L;  3S17 H;  1UEB A;  3J80 c;  2OCE A;  1I94 Q;  3Q8D A;  1YVC A;  2PI2 A;  4IPH A;  3S1N H;  2RHQ B;  4GKJ L;  1XNR Q;  4NPS A;  4A3D H;  3M7N A;  4DPG A;  3I55 A;  1VQ5 A;  1OXX K;  4RG1 A;  2AHO B;  1CKO A;  3KJO A;  3KFU A;  4K0K L;  3U50 C;  2EXD A;  4QJF A;  5C0X I;  3PUY A;  4GNX A;  4OXP A;  2K75 A;  1VQM A;  5IYC H;  4B3M L;  4LF7 L;  1FJG L;  2R7F A;  1JJG A;  3G71 A;  2JA6 H;  1CSP A;  4AYB E;  4DR5 Q;  1YNX A;  4Y7N H;  3JC6 2;  2DUD A;  1WFQ A;  1J6Q A;  1Q46 A;  5FJ8 H;  1TWH H;  1E3P A;  4HJA A;  2VL6 A;  4GLV B;  1Y1V G;  1G29 1;  3BZC A;  4POF A;  1MIU A;  3I56 A;  1SMX A;  2UUB Q;  2UU9 Q;  3JC6 3;  1LM0 A;  1VCI A;  4LUZ A;  3OTO Q;  4PZ6 A;  4OO1 I;  1K3R A;  3H15 A;  4R4I A;  1X55 A;  1BBW A;  4B3S Q;  4JI8 Q;  5IYD H;  1EWI A;  2ZM6 L;  3DLL A;  4A76 A;  4LFB Q;  3GTL H;  4IJH A;  3CQZ H;  5IP9 H;  3HKZ G;  1XJV A;  2VQE L;  4A3G H;  1BKB A;  4A75 A;  2Z6K A;  4OWT B;  3PF5 A;  1YBY A;  3GO5 A;  4DK6 C;  2OQK A;  3J81 c;  5AJ3 L;  3BJU A;  2KCT A;  1JJ2 A;  3JAM i;  1N34 Q;  4JI2 L;  4JV5 L;  2VZA A;  3S2H H;  4LF4 L;  2HT1 A;  2I5L X;  4O2D A;  2RCN A;  3W1G A;  4DUY L;  3EBE A;  2QA4 A;  1Q7Y C;  3KDF B;  4A3I H;  1PHJ A;  4JI5 Q;  1RL2 A;  5DLQ E;  2VUM G;  5JJI A;  1JE5 A;  1NTG A;  2XTI A;  1GO3 E;  2EQS A;  4PMW A;  2BH2 A;  5GQO A;  4HJ8 A;  4DR7 L;  1N36 L;  1GD7 A;  1VQA A;  1IBM L;  1NMF A;  1HNW Q;  3CCV A;  5E7N A;  1PVO A;  1UWV A;  2PMZ E;  4LF8 L;  2WFW A;  3W1B A;  4LF6 Q;  3PF4 A;  2GVB A;  3NBH B;  1KRS A;  2R6G A;  1VS0 A;  1I6H H;  2JK8 A;  3RR5 A;  4BXX G;  4DV2 L;  1CKN B;  5LMN L;  3S2D H;  2AWO A;  4HIO A;  2R7Z G;  5FLM G;  3M85 A;  1WCM G;  4YWK A;  1C9O A;  1MKH A;  4DV1 Q;  1ASY A;  4APV A;  3GTQ H;  4IPC A;  5IP7 H;  1J5E L;  1E24 A;  2QGQ A;  3HOX H;  4GLA C;  4X66 Q;  1YEZ A;  2KHJ A;  1VQN A;  2UXC L;  2F4V Q;  4XTC S;  5LMN W;  3GDE A;  3EN2 A;  3J80 i;  3KF6 A;  3K81 C;  3PIO A;  3ULP A;  2JA7 G;  2NVT H;  3NEL A;  1FGU A;  3PUZ A;  2KCM A;  5C3E G;  3HOY H;  2RF4 A;  3AYH B;  4BA1 I;  1LTL A;  2CCZ A;  1VQE A;  1XNQ Q;  3U58 A;  4JI1 L;  1PYS B;  1LYL A;  3RLN A;  5LMU L;  1S40 A;  4UY8 C;  4AIM A;  2K50 A;  2YTX A;  2Z0S A;  4DV5 L;  2LXK A;  1KC8 C;  3A0J A;  4A3B H;  2VQF L;  3PO2 H;  4DR6 L;  4MNO A;  4BY7 G;  1KAW A;  1E1T A;  3A74 A;  5BR8 L;  2N78 A;  1PH2 A;  1PV4 A;  2UXB L;  2ID0 A;  1Q1B A;  3B6Y A;  2JEA I;  3D31 A;  2WAQ G;  4GNX B;  3UE1 A;  3F2C A;  5K36 G;  1IBL Q;  4X65 L;  3H3V I;  2BA0 A;  1A8V A;  4AQY Q;  1IBK L;  3TRE A;  3HKZ E;  4A3D G;  3AFP A;  4JYA L;  1B70 B;  3S24 A;  3SGI A;  1QZH A;  4JBJ A;  4MZ9 A;  1WI5 A;  3UDX A;  3HOW H;  1O7I A;  1VQG A;  2UXD L;  1X56 A;  1HR0 W;  4JOI A;  1V1Q A;  1K83 H;  5IYC G;  1A0I A;  1OXT A;  4DV4 Q;  4YY3 L;  4NB3 A;  5C4X H;  1PH6 A;  4JI7 L;  3CC4 A;  4LWC A;  4JI4 Q;  1DGS A;  2JA6 G;  4GKK Q;  4A3L H;  3UDF A;  5IYB H;  3PGZ A;  5FJ8 G;  5IT9 c;  1HZ9 A;  1VQH A;  3I7F A;  1NE3 A;  1X3F A;  1EIF A;  4KI0 A;  1GM5 A;  1VQ9 A;  4DV6 Q;  2JE6 I;  1TWA H;  2KBN A;  2JA5 H;  2MO0 A;  2HIV A;  2Q2T A;  1C0A A;  1WYD A;  5IYD G;  1IXR A;  1N33 Q;  2ZJP A;  1MJC A;  5IY0 A;  1TXY A;  5IP9 G;  1NY4 A;  1XMO L;  2KHI A;  4DR1 Q;  3CP0 A;  4IFD G;  1R9T H;  1YZ6 A;  5C4J H;  4A3G G;  3RZD H;  4DV0 Q;  2E8G A;  1VQJ A;  3F2D A;  4DR2 Q;  1Q8K A;  4OX9 Q;  3ICE A;  4GOP A;  4PG3 A;  5IWA L;  2I5H A;  3PSI A;  3T1H L;  1VQ8 A;  3GTM H;  3CCR A;  1A62 A;  4GS3 A;  3DM3 A;  1QZG A;  1YIT A;  4A3I G;  3D0F A;  4NXM L;  4LF5 L;  1N32 Q;  3ULJ A;  3T1Y L;  3UE0 A;  1L0W A;  2IY5 B;  1YJN A;  1PH7 A;  2JEB I;  3RLF A;  1TWF H;  4BY1 H;  4B3R Q;  1IL2 A;  1U0L A;  3GTK H;  3EIV A;  3RNU A;  1X65 A;  4DR3 L;  4TQU S;  3G48 A;  4X64 L;  3PO3 H;  2A1A A;  2AWN A;  2WB1 E;  4DAY B;  1EUJ A;  3I2Z A;  4DUZ Q;  2N3S A;  3PO2 G;  1OXU A;  3S1Q H;  3F1Z A;  3E0E A;  1ASZ A;  2L15 A;  1XMQ Q;  3CCE A;  1N9W A;  2N49 A;  1YJ9 A;  4LFC Q;  1QVC A;  5IP7 G;  1EYG A;  2UUC Q;  1JJC B;  1HZA A;  3HOX G;  1I5F A;  1NBW A;  1MJE A;  2HHH Q;  3S14 H;  1OXS C;  4KHP L;  1L1O A;  1PH1 A;  2AMC B;  2H5X A;  1M1K C;  2ALY B;  2CWP A;  2E5L Q;  4IOA A;  4IO9 A;  4WJ3 M;  1GVP A;  2UUA L;  2AKW B;  3KJP A;  4DKA C;  1NJI C;  5M5W H;  4JI6 L;  1EQR A;  1X6O A;  3GTG H;  2F52 A;  3BZK A;  1S72 A;  3GTJ H;  1K9M C;  4MTN A;  1Q86 C;  2YTV A;  3KOJ A;  4DV3 Q;  4B3T L;  3HOY G;  4J15 A;  5C0X J;  1HNX Q;  3NEM A;  2NN6 G;  1Q12 A;  1Q1E A;  3UDI A;  2OWO A;  3PUV A;  4KLK A;  4X62 L;  1N8R C;  3TS2 A;  2C35 B;  4A3J H;  4DR4 L;  3CAM A;  3GD7 A;  3RLO A;  4P72 A;  4A3B G;  4IFD I;  4UP7 A;  3MXN B;  3AFQ A;  3L0O A;  5EAY A;  3U4V A;  3ZJY C;  1QUQ A;  1TWG H;  3CPF A;  4JI0 Q;  3AEV A;  1HR0 Q;  1I94 L;  4OWW B;  2Q2I A;  4AH6 A;  2WP8 J;  2R93 H;  2K52 A;  1K8A C;  4LF9 Q;  2Y0S G;  2R92 H;  1XNR L;  3HFZ B;  5JEA J;  2JA8 H;  1PH3 A;  5GAE C;  2K5V A;  1XPO A;  4NXN Q;  4WJ4 A;  1PYB A;  3CCL A;  2QEX A;  4DV7 Q;  1IYJ B;  3CME A;  4DAM A;  2K5N A;  2VS1 A;  4BBS H;  3PUX A;  5C44 H;  1SFO H;  4JBK A;  2PQA B;  3ULL A;  1HZB A;  3HOW G;  1XPR A;  2ASB A;  1EQQ A;  5HY6 A;  4DR5 L;  1X3E A;  4P73 A;  1Y1W H;  2B29 A;  2NZO A;  5C4X G;  1X9N A;  4A3L G;  2E2J H;  1T9H A;  4R4C A;  3STB D;  2PI2 E;  5IYB G;  2UUB L;  3S16 H;  4C3I H;  2B3G A;  5GAH C;  2UU9 L;  4JCV E;  4YHH L;  4A3M H;  4GNX C;  4LFA Q;  4H02 A;  5GAD C;  2D0P A;  3A5Z B;  4JI8 L;  4B3S L;  2FXQ A;  4LFB L;  2JA5 G;  5HGQ A;  4GOP B;  3TEH B;  1Q82 C;  3I4N H;  4Y52 H;  1X3G A;  2LSS A;  2Q2H A;  3CMA A;  1KHI A;  2IX0 A;  1E22 A;  4GKJ Q;  4A3F H;  3H3V H;  1AE3 A;  3J7Z C;  1KD1 C;  1N34 L;  3M4Q A;  3PIP A;  4K0K Q;  4JBW A;  2NVQ H;  4LNQ A;  2D0O A;  4JI3 L;  4JI5 L;  4L5R C;  3E9H A;  5C0X G;  4B3M Q;  4LF7 Q;  1FJG Q;  3G4S A;  3RN2 A;  5M3F G;  4EQ5 A;  1VQD A;  5M3M H;  3KDF A;  3J81 i;  1HNW L;  2KEN A;  4P71 A;  4A93 H;  4OON A;  1JMC A;  3K7A H;  4LF6 L;  5GRO A;  1VQB A;  4QQB X;  3CCU A;  3CW2 C;  4BY1 G;  3PUW A;  3JAM c;  4TVA B;  3PCO B;  2R7D A;  4OO1 G;  1AH9 A;  1JT8 A;  2B63 H;  2K4K A;  4L5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...