4YWKA

Pyrococcus furiosus mcm n-terminal domain with zinc-binding subdomain b deleted
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
199
structure length
184
Chain Sequence
VDREEMIERFANFLREYTDEDGNPVYRGKITDLLTPKRSVAIDWMHLNSFDSELAHEVIENPEEGISAAEDAIQIVLREDFQREDVGKIHARFYNLPETLMVKDIGAEHINKLIQVEGIVTRVGEIKPFQSFRIQDRPETLPRFIDGILLVALPGDRVIVTGILRVVLEKTPIFRKILEVNHIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division control protein 21
publication title MCM ring hexamerization is a prerequisite for DNA-binding.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Cell cycle
total genus 53
structure length 184
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14551 MCM_N MCM N-terminal domain
A PF17207 MCM_OB MCM OB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ywkA02
3.30.1640.10 Alpha Beta 2-Layer Sandwich mini-chromosome maintenance (MCM) complex, chain A, domain 1 mini-chromosome maintenance (MCM) complex, chain A, domain 1 4ywkA01
3HFZB 4JI4L 3I4NG 1MIUA 3JAMi 3BZKA 2B63H 3ICEA 1OXSC 2LXJA 3ULJA 4GOPB 2R92H 1E24A 2YU9H 1V43A 2K5HA 3BU2A 2AMCB 3G4SA 1IBLQ 2HHHQ 3AFPA 3J81c 2VQFL 4C3IH 3M3YH 2Y0SE 3CAMA 5IE8A 5LMUQ 4AH6A 2YV5A 4GOPA 4LF9Q 3EN2A 1Y1VH 4GNXC 3F1ZA 2UXDQ 1JJ2A 1FL0A 2QGQA 1IBKL 3CQZH 2ZM6L 4NPSA 3DLLA 1HR0Q 4DV2L 5IWAQ 3LGJA 1Q12A 2JA6G 1G51A 2E5LL 1C9OA 1B8AA 3AYHB 3KF6B 1TWFH 3I2ZA 4DR2Q 4JI8Q 2D0OA 2AWOA 1N33L 2MNAA 5AJ3Q 3E9HA 3TEHB 1ASYA 5GAGC 1E22A 1Z9FA 3KF6A 4DR3Q 1HR0W 4L5SA 2E8GA 3HOWG 4DV1Q 3M9BA 2UXCQ 1WI5A 2HHHL 2IHEA 1E1OA 1XMQQ 1IBLL 2D0PA 5J3BA 4C3HH 2VW9A 1PYSB 3STBD 4IFDG 5LMNQ 4IFDJ 3F2DA 4LF9L 2KHIA 2R7ZG 2UXDL 2ZTCA 3GO5A 3W5OA 2ZJQA 3RR5A 4JI1L 4GS3A 3WWVA 1NY4A 4BY7H 1AH9A 1LM0A 5IP7G 3A5UA 1XPUA 4PZ8A 3JAMc 3K8AA 5M3MH 4DR2L 2Q2IA 1VQNA 1PFSA 2BH2A 4JI8L 4ALPA 4JV5Q 1VQOA 2YTXA 3TREA 1BVSA 4JYAL 2GVBA 4IOCA 4A3MG 2D62A 3F2CA 3PUWA 4WJ4A 1U0LA 3K7AH 4DNIA 1HNZL 1E3PA 4DR3L 4YCWA 4LFAL 3M4QA 4GLAC 3U4VA 4DV1L 5FLMG 1XMQL 1IL2A 4DKAC 1K9MC 5LMNL 4A76A 4BBSG 3TQYA 1EYGA 5C0XI 3I56A 3OYYA 1XPRA 4B3SQ 4NXNQ 1RIPA 2NN6G 4A3DG 1SN8A 1VQHA 4JBWA 1UEBA 4Y7NH 2UXBQ 1QVCA 3CW2C 4O2DA 1ASZA 1GVPA 3HOXG 1LYLA 4YCVA 1UE1A 3S14H 4BA2I 4JV5L 1VQAA 2AHOB 2WB1E 3B6YA 1I3QH 3L7ZC 5DLQE 4R4IA 1SLJA 5IP9H 3UDXA 1PH7A 4LUVA 4JI2L 3M4OH 3CCJA 1CKOA 1WCMH 5FJ8G 2JJQA 4KI0A 4APVA 2VUMG 1L0WA 3FP9A 2UU9Q 1VQEA 4GLVB 1YIJA 4P75A 5GAEC 2WB1G 4JI0L 1VQ8A 4LF6Q 1K0RA 3CC4A 3KJPA 3J81j 5M5YH 5IT9c 5EAYA 4GNXB 4QL5A 2B63G 3FHWA 3PF5A 4B3SL 2Z6KA 1YBYA 1VQJA 4NXNL 1MJEA 1VQ7A 2R92G 1NBWA 2UXBL 2R7FA 1T9HA 5C3EH 1SE8A 4GNXA 4GKJL 2JA7H 2CCZA 2YYZA 3UDGA 1R9TH 4EQ5A 2OWOA 1Y1VG 2ATWA 1Z47A 1NTGA 2OCEA 4DV4Q 2I5HA 1CSQA 1YVCA 1JB7A 2K14A 3CD6A 1SRUA 4LUOA 2WFWA 4MTNA 1X54A 3I4MH 2LSSA 4LF8L 3S24A 4BBRH 4YY3Q 4LUZA 3SGIA 5C0XG 5C0XJ 3TS0A 1JT8A 3K80C 1PH3A 4DV5Q 1UE7A 4R4OA 1K83H 4HJ7A 1XMOQ 1EUJA 5IYBH 3CCVA 3AEVA 3GTGH 4BY1G 1Q1BA 1BBWA 1AE3A 4DR4L 2UUAQ 1LTLA 4A3CH 1VQ6A 1VQDA 4AQYQ 2UXCL 1G291 4MZ9A 1J6QA 4X64Q 1KXLA 1Q82C 1YI2A 3ZJYC 1KRSA 1X3GA 1MJCA 2JA5G 2BA0A 4DV4L 4PG3A 2VQEL 1I94Q 3NBHB 4JBMA 4BY7G 1WJJA 2PMZE 1HNWQ 2KENA 2C35B 2I5LX 4UP9A 1W2BA 2A1AA 3HOUH 3CMAA 2N78A 3H3VI 3S17H 3PUVA 5M5WH 5M3MG 3JC66 4OONA 4YY3L 1X3EA 2MO1A 1NMGA 3CF5A 2ZTEA 3L2PA 4HIMA 4YHHL 2JK8A 2KBNA 4X66L 1PA6A 4JI3Q 3ULPA 4IO9A 1Q8KA 2ZJRA 2CFMA 2VZAA 1V9PA 1WYDA 4A3FH 3PO3H 1HH2P 2KCMA 2NN6I 5IYDH 4B3RQ 1N34Q 2F52A 1PYBA 4AQYL 3S2HH 1UWVA 1H95A 2K52A 2VS1A 3FKIG 3UE1A 4HIKA 4A75A 1PH1A 3KF8B 1YHQA 3RLOA 4IOAA 1FGUA 2R7DA 1Q46A 1D8LA 4KLKA 4R4QA 3KJOA 1KD1C 3K7UC 4YWLA 4A3KG 1HNWL 2NVTH 3RLNA 3KYHC 1HNXQ 3GTQH 2RHSB 5IYCG 4A3BH 1GKHA 4KHPQ 1EIFA 3ERSX 3KOJA 3CPWA 5LMUL 2AWNA 3PF4A 3D31A 1SR3A 2I0QA 3S1RH 1QZGA 2ASBA 5IP9G 2I5MX 4A3IH 1HR0L 1WCMG 1YEZA 5IWAL 5GADC 1VQIA 4DAMA 3W1GA 1XTDA 3S16H 2EIFA 4B3RL 4X6AH 1N34L 3T1HQ 4LFBQ 1N8RC 3T1YQ 1OXTA 3PIPA 4TVAB 3KDFB 1TXYA 3D0FA 3NENA 4UP7A 1DGSA 1UE6A 5AJ3L 1P8LA 2JEBI 3GD7A 3HKSA 1SFOH 4KHZA 1PH5A 3J80i 2KHJA 1PVOA 4IPGA 4DV7Q 5C3EG 2N3SA 2JA8G 3PUZA 2IX0A 3MXNB 1K3RA 3PCOB 2ES2A 1TWGH 2JA7G 4HJAA 1YHAA 2UUBQ 2GN5A 3PUXA 3CCMA 4JI5Q 4A3JH 1S3OA 3EBEA 2MO0A 4DV3Q 4A3GH 1EIYB 4AYBE 3GTJH 4LFBL 3G48A 3T1YL 2IX1A 1N32Q 1KIXA 2JEAI 3NEMA 4RG1A 3GTKH 3I4OA 1A62A 1YZ6A 2F3IA 5GQOA 4HJ9A 1KQSA 4NXMQ 5IYBG 4NB3A 5H1SE 1VS0A 1VQ9A 1IYJB 1KRTA 4POFA 1OXUA 3RLFA 4A3CG 4IPHA 4GKKQ 1Q81C 1KL9A 1CUKA 4TQUS 2YTYA 3U4ZA 4AYBG 2JE6I 4OWWB 2YTVA 4OXPA 3HOWH 2BA1A 3CCEA 2UUBL 3OW2A 3CC2A 1EWIA 2QA4A 2K75A 1X3FA 4UPAA 4H02A 2H5XA 4HIOA 1IBMQ 3CXCA 3GTLH 4UY8C 5JEAG 4JCVE 4O0AA 5JEAJ 1PHJA 1J5EQ 3HOUG 1S72A 1OTCA 3DM3A 3E9IA 2F4VQ 2R93H 1D7QA 4DUYQ 4R4CA 3S1MH 1N32L 5E7NA 3J80c 1XJVA 4JC0A 1JJCB 4L5QA 5IP7H 1VCIA 4A3EH 5FLXc 1VQGA 4XTCS 4YWKA 4LF4Q 4NXML 1JE5A 4PZ6A 4A3LH 3AFQA 3VDYA 4A3FG 3PO3G 2CQOA 3Q8DA 4K0KQ 2DGYA 1VQBA 1VQKA 1BBUA 4BA1I 2UU9L 4GKKL 2RCNA 2A19A 4A3MH 4HIDA 1C7YA 3H15A 1B7YB 4AIMA 4LF6L 2PQAB 1VQLA 5M5XH 2E2IH 4DK6C 5FLMH 4OO1G 3UDIA 1TWHH 2JA9A 4JI6Q 4BXXH 2CWAA 2HIVA 4QY7A 1YITA 4BBSH 1J5EL 2K5NA 3M7NA 5M3FH 2F4VL 1Y1WH 4A3BG 4DR6Q 5C4XH 4DUYL 1N9WA 4C3JH 5HGQA 4LFCQ 3S15H 4GN3B 1HZCA 1NJIC 2FXQA 2VQFQ 2MQHA 4DR1Q 2NZHA 3CCUA 4LF4L 4JBJA 1WOCA 3UDFA 1EOVA 5JJLA 4OWXB 3PSIA 4IPDA 1IBKQ 4GN5A 1E1TA 1NMFA 1CKMA 3ULLA 2ALYB 4DV2Q 3GTOH 4QGUA 2OTJA 3GTPH 5JJIA 4DV0Q 5C44H 1QZHA 3HOYH 1KAWA 1Y14B 4DV5L 1P16A 4QIWE 1VQCA 3ER0A 3J7ZC 1OXVA 1XMOL 1SROA 1I6HH 1M90C 2OTLA 5BR8Q 1X6OA 4X62Q 4X65Q 2UUAL 2A8VA 1Q1EA 3H0GH 3STBC 3F2BA 1SMXA 2NVXH 5IY0A 4JI6L 2V1CC 1PH9A 1L1OC 2RF4A 2PI2A 4X64L 2HIXA 4YWMA 3G6EA 4HJ8A 4DAYB 1K8GA 2NVQH 4DR6L 2B29A 1UE5A 1YHBA 2JQOA 4JI7Q 4LFCL 2Z6KC 4LW1A 1XNRQ 4P72A 4A3JG 3BJUA 4P71A 1I94L 3PV0A 1K73C 3U58A 4DR1L 3PO2H 1XPOA 3E0EA 4A3GG 2PI2E 4A93H 1KC8C 2WAQE 1PH8A 3A5ZB 2IY5B 4JBKA 3CCLA 4JOIC 1A8VA 4JI1Q 5HY6A 3K0XA 1S40A 4IJHA 4OWTB 2IHFA 4DV0L 2OQ0A 4LNQA 3TRZA 2AKWB 2LXKA 4JI3L 3CMEA 3S2DH 2Y0SG 1FJGQ 5BR8L 4X65L 2N8NA 4X62L 2WAQG 3HOZH 4JYAQ 4RMFA 3PIOA 1XNQQ 2HT1A 1VQFA 1X65A 4DPGA 5GAHC 1HNZQ 4LFAQ 4BY1H 3CP0A 3GTMH 4JI7L 3HOVH 1XNRL 1TWCH 5ELOA 1EQRA 1BKBA 1NE3A 3IRBA 4JG2A 4J15A 2CKZB 2EXDA 1I5FA 4DUZQ 3OTOQ 3I4NH 1HNXL 3KDFA 4IPCA 1GD7A 3RN5A 2JA5H 4P73A 2R93G 4KHPL 3GDEA 1LUZA 1VQMA 4IJLA 2XTIA 2DUDA 2VY3A 3K81C 4YCUA 3RZOH 4QJFA 1VQ4A 4GLXA 4A3EG 2CWPA 3A74A 4B3TQ 1RL2A 4DK3C 2EQSA 1FJGL 4A3LG 4OO1I 4Y52H 1U5KA 1JJGA 5LMNW 2RHQB 1IXRA 3I4MG 4DR5Q 5JJKA 4OX9Q 4BBRG 1XNQL 4GOPC 3T1HL 4JI2Q 2HQLA 2QEXA 4L5RC 1N36Q 2K50A 1VQ5A 3RN2A 3CC7A 1O7IA 1WFQA 2JA6H 5C4JH 1HJPA 3U50C 2KCTA 2PNHA 1PV4A 3FKIH 4JI0Q 1CSPA 2VNUD 3I7FA 4DUZL 4A4IA 3OTOL 4HJ5A 1CKNB 1QVFA 4BXXG 3UE0A 4DV7L 2IT1A 1Q86C 4ME3A 5M3FG 2E2JH 1Y1WG 1TWAH 2E2HH 4P74A 5C4XG 4A3KH 2UUCQ 1M1KC 1X9NA 3MEFA 4JI5L 1X55A 3CCQA 1CKNA 4LWCA 4DV6Q 2OQKA 5IYCH 4B3TL 3F8TA 3J7A5 4GKJQ 3EIVA 4LF5Q 1I50H 4DV3L 1PH4A 1C0AA 3A0JA 2Z0SA 2MFIA 3I55A 4DR5L 2R7ZH 4OX9L 1OXXK 3HKZE 1E7ZA 2ZJPA 3CCRA 1L1OB 1YJWA 4PMWA 1N36L 5ELNA 4POGA 5C44G 4PZ7A 4LF7Q 3AQQA 1A0IA 2WP8J 4LF8Q 3HOYG 3JC63 1W3SA 3BZCA 2NVYH 3RNUA 3CCSA 3M85A 1YJ9A 1G6PA 1IZ6A 4B3MQ 1QVGA 1MKHA 1V1QA 3H0GG 1L1OA 5IYDG 3PGZA 5K36G 3HKZG 3J81i 1PH2A 2Q2TA 3G71A 1HZBA 4XIGS 1PH6A 2N49A 3KFUA 2NZOA 2K4KA 4EX5A 2VL6A 3H3VH 4DR7Q 4DR4Q 3KLWA 2UUCL 1EFWA 4R4TA 1AE2A 2R6GA 4DV6L 2ZTDA 2K5VA 2JA8H 2B3GA 1KHIA 3RZDH 3PUYA 1IBML 1GM5A 3PO2G 4LF5L 4JOIA 4JI4Q 1A63A 4UP8A 2PQAA 3NELA 3S1QH 4C2MH 1YJNA 4A93G 1X56A 3S1NH 4A3DH 2VQEQ 4FDBA 1HZAA 2Q2UA 4LF7L 3W1BA 3HOXH 4L5TA 1FVIA 4A3IG 4WJ3M 1EQQA 1QUQB 2XGTA 3HOZG 4B3ML 4QQBX 4K0KL 3JC62 4YHHQ 2ID0A 4IFDI 4X66Q 1JMCA 2BH8A 2ZM6Q 3M4PA 2GVAA 1HZ9A 1YNXA 1K8AC 5GROA 5FJ8H 1B70B 1L2FA 4GN4B 3TS2A 1VQPA 4R1JA 1Q7YC 1GO3E 4DR7L 2VUMH 2E5LQ 1QUQA 2L15A 3HOVG 2Q2HA 4MNOA 3L0OA 1N33Q 3CPFA
chains in the Genus database with same CATH superfamily
2L4NA 5EKIA 3JAMi 2CW0D 2L55A 2F0IA 5KNCA 3BDCA 3E6ZX 3I91A 1QNKA 1GUTA 2K5HA 2HHHQ 1IBLQ 2KVMA 2N55A 3GTLB 3M7GA 1I50B 4RHSA 5ELCA 4AH6A 3QB3A 4GNXC 3F1ZA 1JJ2A 2QGQA 3CQZH 4CGYB 1D1IA 3A8JE 2A68D 1G51A 3AYHB 1TWFH 2AWOA 1JWSD 1QILA 3VA5A 2XWJB 5I6WA 2K28A 3EQLC 3TEHB 1K8MA 4H13C 4IUNA 1Z9FA 2K03A 2BCOA 3NUCA 3A7AB 1A3UA 4BBSB 3K58A 2VW9A 4IFDG 2F0NA 3S1NB 1C4QA 2KHIA 3V2TA 1BCPD 3RR5A 4GS3A 1NY4A 3LWUA 3QOJA 4L63B 1TR5A 2CH4W 3DM1A 1AH9A 1G2SA 3OWFA 3A5UA 1XPUA 4JV5Q 4JI8L 4RGTA 4ALPA 4KV6A 4JYAL 5ELFA 2D62A 1SXTA 4FO2A 3K7AH 4WJ4A 4GLAC 2EJGC 1A3TA 1XMQL 3EROA 3TQYA 1WTXA 1FYCA 2A69D 2KA7A 3NBIA 2R92B 4A3DG 4NXNQ 1NR2A 1H9JA 4KKSA 5DNFA 2YU9B 1SN8A 1VQHA 4RH6A 3MVVA 4JBWA 1QVCA 3NK9A 2F0VA 1UE1A 3BDLA 4DNRB 3HZXA 3H3VC 4R4IA 1PH7A 4LUVA 2VUMG 4K5VA 4P75A 5GAEC 4JI0L 2PQEA 2RSNA 3DWQA 4IALA 2VXWA 3FHWA 4B3SL 1YBYA 4F8MA 3D3RA 1MJEA 1VQ7A 2UXBL 5A35A 1BQQT 2JA7H 3URYA 1R9TH 2OWOA 2ATWA 1NTGA 3RZOB 1CSQA 4BY7B 3LX0A 2XRSD 1BF4A 5M3MB 4IUUA 1V8QA 2B2VA 5C0XG 3NWTA 1JT8A 4XQQA 4PV1C 2CVRA 2PMZB 4R4OA 1XMOQ 3CCVA 5T1IA 3AEVA 3GTGH 5IIFA 4ZCKA 4LMQD 1VQ6A 1VQDA 4RKBA 3FDTA 4MZ9A 1G91A 4F7XA 1ET6A 1Q82C 1PRTF 4FF1A 3GV6A 2JA5G 2BA0A 2A68C 4FXGC 4WFN3 4A3KB 1EWHA 2RCFA 4DAPA 4JBMA 2IJ0A 1W2BA 3H6MA 3HOUH 1O7ZA 1JCKB 3JC66 1JB3A 4YY3L 1FNWA 4IO9A 1Q8KA 2ZJRA 2N88A 2CFMA 1WYDA 3PO3H 5I2XA 4XDXA 4AQYL 3FKIG 4HIKA 2F0FA 3UE1A 1NSNS 2MGSA 1FGUA 2Z6BA 3K7UC 2QEJC 2NVTH 4IUVA 3FPUB 4KKUA 4A3BH 1PZJD 3O13A 3CPWA 2M00A 3DHQA 1B9MA 3S1RH 1QZGA 2IL8A 1DZ1A 5TSSA 5CC4A 1ET9A 3BYTB 1XTDA 2F0KA 2K04A 2L0CA 4B3RL 5J39A 1N34L 3KBGA 4X6AH 5EKLA 1I4RA 4G7ZC 3T1YQ 1OXTA 3PIPA 1PTOB 1O7YA 1R4PB 1K83B 1TXYA 2AQ3B 1SJED 3D0FA 3NENA 2Z9HA 2CH4A 1PH5A 4V0BA 1SFOH 3NTHA 1DONA 2N3SA 2IX0A 5DM63 3PCOB 2JA7G 4KJOA 4HJAA 2UUBQ 1JC7A 2GN5A 4CJ2C 2X6GA 1S3OA 1SMYD 1PMRA 5M5WB 2IPKD 4RFBA 2IX1A 5KIXA 3I4OA 3SR1A 4HJ9A 4A3FB 1VS0A 2B2UA 4C56C 4POFA 3S2HB 1KL9A 1CUKA 1RCVD 4CJ1B 2YTVA 1L0XB 1KLUD 3ND8A 3OW2A 1D6EC 1X3FA 1X3QA 3Q23A 4HIOA 4ILWA 2F3WA 3OHXC 2KHSA 4O0AA 3HOUG 1NNXA 2F4VQ 5EKKA 4R4CA 5I6YA 3S1MH 1MSGA 2EYMA 4FP5D 1SYEA 1JJCB 3LNNA 1VCIA 4A3EH 1GHKA 4YWKA 1MBYA 4LF4Q 4KN4C 4A3LH 3PO3G 1STBA 2DGYA 1B1ZA 2F0EA 1VQKA 3PMFA 4GKKL 3W3AA 4A3MH 4OL7A 4ZUIA 4KK7A 3AMUA 2KJXA 1VQLA 2SNMA 5ISRA 1LT5D 3UDIA 1TWHH 2XIWA 2EY5A 2PNRC 2CWAA 2HCIA 3QJYA 1TWGB 5AFWA 4C3HG 4A3BG 4ME5A 4QIWB 1QOHA 1KNEA 4C3JH 3S15H 4GN3B 5G3LD 1NJIC 4DR1Q 3BVGA 1KDBA 1E0BA 2ZXRA 1WOCA 4JBJA 3UDFA 1ICFB 2QCPX 3S14B 4RCOA 5JJLA 3GTJB 1STHA 3I3CA 2PPBC 1KDCA 1E1TA 3GTPH 3M4OB 4I65A 1XMOL 1HQRD 2OTLA 4X62Q 2A8VA 4RKLA 2WKCA 1D2BA 5IY0A 2V1CC 5M5YB 1Y8OB 2PI2A 1GXDC 2NVQH 2V4DA 4DAYB 3I73A 1B4OA 2B29A 4JI7Q 3VYUA 4LW1A 4OEMB 3EFXD 1SYGA 1XPOA 3E0EA 5C3EB 2PI2E 2R93B 3R3OA 2MHVA 3FEWX 5KRUA 3CCLA 2IY5B 3K5LA 1A8VA 2WACA 4NDXA 3OW7A 2AKWB 3CMEA 4BBRB 2IX3A 3OPOA 4RA8A 3MHBA 3PIOA 1XNQQ 1E2ZA 5GAHC 3MXGA 1EOTA 2EYJA 2K05A 1PYWD 4BY1H 1SMYC 5EPKA 3GTMH 3T4AC 1GOZA 5CR3A 4JG2A 1K8OA 1F9PA 4BS9A 1LO5D 5M3FB 1Y1WB 1CZGA 2DJFC 1LUZA 2L12A 4QF4A 3K81C 2PW7A 4H44C 1VQ4A 4A3EG 3A74A 4B3TQ 1XYIA 4A3LG 4OO1I 4DR5Q 1XX8A 2LFNA 3GTOB 4JI2Q 3HG9A 5D3DA 3HOYB 1HQMC 1O7IA 2RA4A 1HJPA 2NB0A 1S5ED 1CSPA 1M8AA 4L8JA 4DUZL 5IGBA 2EDGA 1EFID 4C3JG 4DXGA 1BOSA 4HSVA 2E74C 3CCQA 3PO2B 4LWCA 1HFNA 3J7A5 4GKJQ 3R2IA 3EIVA 3VYRA 1PRTD 4LF5Q 2ZXPA 1C0AA 1EQVA 2EYLA 1F9QA 3HKZE 2F0WA 3TP7A 2K6AA 4Z9CB 1A0IA 1STYA 1W3SA 3RNUA 2NVYH 2C9OA 1V1QA 1I4XA 1L1OA 3NQTA 3PGZA 3KFUA 1HZBA 1PH6A 5EGTA 1FNVA 3HOVB 1TWCB 2F0UA 4NKLA 1JQYD 3CRLC 2B3GA 1KHIA 3RZDH 1GHJA 3PUYA 2QF7A 1SAPA 4JOIA 1RDPD 3S1QH 1ONLA 1X56A 2NN6H 1F2LA 2XNAC 4ODGA 4HTHA 4L5TA 2NWGA 4A3IG 1LABA 4WJ3M 3VR3A 1F9SA 2XGTA 4B3ML 4QQBX 4S3SA 4YHHQ 2ID0A 4IFDI 1JOOA 2BH8A 3GTKB 3M4PA 1Q7YC 1GO3E 1IKLA 2Q2HA 3L0OA 1XWEA 1B3AA 1AEXA 1MIUA 1CA5A 1TWAB 2PW5A 2CQAA 3EJIA 5JEAH 1V43A 1LTGD 3G4SA 3DMUA 4C3IH 3CAMA 5IE8A 2YV5A 1ILQA 1II3A 3EN2A 4GOPA 3C2PA 3QWNA 4WRDA 1Q12A 4PQXA 1C9OA 1B8AA 3KF6B 4JI8Q 4N9TA 2B2VC 4RGNA 5GAGC 4G57A 5FLXL 1HR0W 2E8GA 3HOWG 1WI5A 4X3TA 2IHEA 1XMQQ 5NUCA 5J3BA 4C2MB 4IFDJ 4A3DB 1EZ8A 2ZTCA 3WWVA 1UAPA 4QCLA 2EJFC 1IW7D 3QIAA 5IP7G 4PZ8A 3K8AA 4DR2L 1VQNA 2Q2IA 1PFSA 4ZYSA 1D5ZC 1BVSA 5FO8B 2K01A 4IOCA 3F2CA 1U0LA 1VDZA 3AB9A 4DNIA 1E3PA 2VUMB 3W2DA 1VF7A 2EVBA 3HS0C 1U4LA 1EYGA 4TRDA 5C0XI 1O80A 2ZXOA 5JAVA 4B3SQ 2E76C 2NN6G 5FOBB 3KUPA 2UXBQ 1GVPA 3ONAB 4YCVA 5LL6X 2AHOB 2WB1E 1I3QH 3CQZB 2A74C 3L7ZC 3TZDA 1SLJA 3UDXA 4JI2L 3CCJA 1CKOA 1WCMH 3P7JA 1TWFB 4KI0A 3FP9A 3N52A 1VQEA 2EYFA 2B2WA 1FGBD 1NR4A 1K0RA 3CC4A 4GNXB 4QL5A 3DUZA 2O5IC 5KYLA 1SE2A 1NBWA 4IN3A 1T9HA 4O1NA 4GKJL 1BDOA 4C3IG 3UDGA 2JA5B 3DEOA 4K8JA 2H1EA 4CDFC 1YVCA 2XN9C 5CBEE 1JB7A 4NP5A 2WFWA 1DOKA 1SYFA 1PFBA 3I4MH 2LKVA 2LSSA 4YY3Q 3X3MA 4LUZA 1F2ZA 3SGIA 4C1NI 5C0XJ 4N8X1 3L3OC 5C3XA 3K7AB 1ICWA 1SBBB 1HA5A 3A56A 4TKOB 5FKAC 1AE3A 3MAQA 3FKIB 4AQYQ 2B2UC 1G291 1J6QA 2BDOA 1EEID 1MSHA 3ZJYC 1KRSA 1X3GA 1MJCA 1I94Q 2ZT9C 4ZQ3A 1WJJA 2C35B 1JOKA 3HGBA 2A1AA 1TS5A 3CMAA 3H3VI 3S17H 4QB4A 2MO1A 4HIMA 1SNDA 4YHHL 4UAIA 3NP8A 3UI2A 2VZAA 1V9PA 3BG3A 4R8NA 3MWYW 3K57A 2B2YA 1K3BC 4B3RQ 3MFGA 1N34Q 4ID6A 5I9OA 3K59A 3MXUA 4CDDC 1RODA 3J80L 4IOAA 2R7DA 1EY5A 4KLKA 1IW7C 4R4QA 4FYDA 3NSWA 4YWLA 1SNQA 1HNWL 3RLNA 3KYHC 1STAA 3GTQH 3SK8A 2JA7B 2RHSB 4K6LA 1R9TB 4KHPQ 4HMIA 3D31A 5IGGA 1KLGD 1WCMG 1YEZA 2AQ1B 4QMGA 5GADC 1EYAA 1VQIA 2TSSA 1S5DD 3W1GA 4DAMA 1TS2A 2Q8IB 4EGVA 5EBDA 5IOCA 3GTGB 2K5WA 1H9SA 3HKSA 2RDFA 1PVOA 3QG1A 1HUMA 1JR0D 4IPGA 1LTTD 2JA8G 1RHPA 2OEOA 3MXNB 1K3RA 1SE4A 1EY0A 2FMMA 3CCMA 3BDOA 4A3JH 3EBEA 2MO0A 5JJZA 3HOUB 1B2TA 1GJXA 4HN7A 2A6HD 4RCNA 4CHTB 4DAVA 4NW2A 4AYBE 3IL8A 4LFBL 1KIXA 2JEAI 3NEMA 1Q90A 1YNJD 3PO3B 1Q3LA 4FF3A 4NB3A 5H1SE 1VQ9A 4KMUC 1KRTA 1EY7A 1E2VA 4GKKQ 1Q81C 4PNYA 3U4ZA 1B9NA 1Q8IA 3NTIA 4OXPA 3BZDB 2BA1A 3RUZA 3CCEA 1GUOA 2QA4A 2NVTB 2H5XA 1IBMQ 3CXCA 3GTLH 5CYUA 4UY8C 4C3HB 2IWHA 4A3BB 3K5OA 3DM3A 3E9IA 2SEBD 3S1RB 1U9RA 3J80c 1EL0A 4L5QA 1ML0D 1JE5A 4JVZA 3AFQA 1A2UA 2CQOA 4K0KQ 1B50A 4XT1B 1CA6A 2A19A 1I4GA 2CW0C 4MTKA 1C7YA 3H15A 1B7YB 1SSOA 2L11A 2E2IH 3DXJC 5FLMH 1SFOB 2FJ2A 4FNFA 2JA9A 2G5DA 4BXXH 3T56B 4BBSH 1J5EL 3M7NA 4KY5A 1NAPA 2EOTA 3TN2A 2DN8A 4DUYL 1Z6HA 4Y7NB 2VQFQ 5ELDA 2NZHA 3CCUA 2VB3X 1FNUA 1PTOD 1IBKQ 1CKMA 1X32A 1EYCA 2ALYB 2OTJA 5JJIA 5IGDA 1L0YB 1Y14B 3ER0A 1PLFA 3V05A 4TSSA 1M90C 4K2KA 1BXTA 3H0GH 3F2BA 4JI6L 1SMXA 2F0QA 1L1OC 1BCPC 4YWMA 4HJ8A 2JQOA 4LFCL 4A3JG 2WIIB 3BJUA 5CV6A 1I94L 1Y69U 1K73C 4N8FA 3D6WA 5I2YA 2WAQE 3MTSA 3KF8A 1PH8A 4QUFA 4JOIC 5IT9L 3S1MB 4JI1Q 5HY6A 3DEPA 4A3EB 5DAUA 4IJHA 4LNQA 2IHFA 4DV0L 2OQ0A 3TBIB 3K5MA 2E2DC 2LXKA 3E3XA 4R8IA 2Y0SG 5BR8L 4X65L 2HCCA 2DNEA 4HR7B 2R61A 3MFYA 1I4QA 1X65A 2RKSA 3I70A 1HNZQ 2A69C 4LFAQ 2K5QA 2F0MA 1TWHB 4J6HA 5ELOA 2JSOA 1BKBA 1NE3A 2GA4B 3V96A 2CKZB 4DUZQ 3I4NH 3OSOA 5EJWA 4CKEA 4IPCA 4P73A 2Q8TA 3GDEA 4FXKC 3NE5B 4KHPL 1YNJC 2DUDA 2VY3A 3RZOH 3WDNA 4DK3C 1SNOA 1XTCD 4CKCA 1B53A 2F0DA 3OIQA 2EYHA 4LK1C 4GOPC 1WTOA 2IW3A 1MD2D 1VQ5A 3RN2A 3CC7A 1DM0B 1FR3A 2HQEA 2JA6H 5C4JH 1HRJA 1YNND 3HEJA 3J81L 1AFPA 4BXXG 1CKNB 1KABA 1QVFA 3NTKA 5C3WA 2NVQB 1Q86C 1I6VC 5J22A 2RSOA 2E2HH 4HMJA 4A3KH 1M1KC 1X55A 2R3ZA 5DM73 2OQKA 5IYCH 1Z7TA 5E4WC 2KOLA 4DXFA 2Z0SA 2MFIA 2R7ZH 4XQNA 4OX9L 1OXXK 3IKJA 1VMPA 3D8GA 2F0TA 2ZJPA 2D2CC 1YJWA 1N36L 5ELNA 4A3IB 4PZ7A 5CV7A 3A7LA 4KN7C 1G6PA 2PO4A 3IAYA 1IZ6A 4B3MQ 2X69A 3H0GG 3HKZG 2B39A 1HTPA 3OOCA 3G71A 1J8IA 2N49A 1PZID 2K4KA 2NZOA 3GTMB 4EX5A 2NZ1D 3X3NA 4R4TA 2UXCQ 1IBML 5D14A 1GM5A 3VYTA 1YJNA 4XQJA 1C48A 4FDBA 4DGZA 4IQZA 1BNZA 1E2WA 4M1UB 2Q2UA 4PMBA 4ABNA 3W1BA 3HOXH 1BR9A 1GUWA 1QUQB 4K0KL 4K6DA 4G7HC 1QCBD 2M9VA 1PTOH 1SYBA 2OF1A 1HZ9A 5GROA 3TS2A 1L2FA 4GZYC 3TDQA 3MXPA 4OIKA 3QR8A 2L15A 4CJ0B 1A3VA 2KQ3A 3SDZA 2EY6A 5F2DA 1KAAA 2B2WC 3HFZB 4JI4L 2KUMA 3I4NG 1KTKA 1FD7D 3K6OA 2B63H 3ICEA 2LXJA 3ULJA 3HOWB 2I07B 1CHPD 1E24A 2LY7A 5IODA 5E4XA 3BU2A 1TU2B 3AFPA 4F87A 3J81c 3I4LA 2VQFL 3M3YH 2Y0SE 4ZKBB 5LMUQ 1Y1VH 1HFGA 5CORA 1IBKL 3I72A 5IWAQ 3LGJA 2NVYB 1JOQA 2JA6G 2E5LL 4IZ8A 4DR2Q 3I2ZA 2D0OA 1N33L 1CT1D 1H9MA 1O78A 4K8IA 4DF7A 5HURA 2MNAA 5AJ3Q 3E9HA 4B9XA 1ASYA 1XXGA 1E22A 4CKBA 3K5NA 5M5XB 3J80E 3M9BA 2EPBA 3RZDB 2EZVA 3SK6A 2D0PA 3S1QB 4RHRA 3KBXA 1PYSB 3STBD 1LTID 4LF9L 4WORA 4KY7A 1UEAB 2R7ZG 2UXDL 3GO5A 2F03A 2LS01 4JI1L 4K5WA 2B8FA 1LM0A 2K32A 1RTNA 3VR6A 1VQOA 1EIHA 3TREA 3F2UA 2GVBA 1CTMA 5KNBA 3R93A 1HHVA 4A3MG 3PUWA 1HNZL 4DR3L 2HDMA 4YCWA 4LFAL 3J7AF 5KGUA 4DU9A 4DV1L 1I6HB 1H9KA 1IL2A 2B2YC 3GV3A 2F0LA 1K9MC 2K5DA 5LMNL 3I56A 3OYYA 1XPRA 1RIPA 1QG7A 1UEBA 1DJRD 3CW2C 4O2DA 1ASZA 1F77A 4C3IB 3HOXG 1LYLA 4FF4A 3S14H 4EQPA 3B6YA 2SNSA 2SOBA 3Q6SA 3M4OH 1LTAD 1LTRD 1TY2A 2JJQA 4EVOA 3S2DB 1F2YA 1L0WA 4H0LC 4F88A 2MP1A 4L6TB 3FVQA 2WB1G 1VQ8A 1KDAA 4LF6Q 3J81j 5M5YH 5EAYA 1TQOA 2B63G 2ICEC 1BCPF 3TMEA 1VQJA 4B08A 1U4MA 5C3EH 2O4XA 2J4XA 1SE8A 2B2TA 4G4KA 3T13A 4EQ5A 1Y1VG 3SK5A 1Z47A 1I4PA 2I5HA 4I7ZC 3VR2A 3CD6A 1SRUA 4MTNA 1X54A 1ZYRD 3N6RA 3S24A 4BBRH 3TS0A 1SYDA 5D3IB 3HP3A 4X3KA 1PH3A 4DV5Q 1UE7A 1K0SA 1QWYA 1PDQA 5JOBA 4BY1G 1BBWA 2HDLA 2UXCL 4R9WA 4X64Q 1KXLA 1Y8PB 2PZTA 4DA2A 1C8CA 1HCZA 1VF5C 2DY8A 2E2JB 1LACA 1TT2A 4DV4L 1CM9A 1HNWQ 2PMZE 2MPMA 2N78A 3PUVA 4WJWA 3Q24A 2MUYA 1X3EA 3L2PA 1PFNA 1HA6A 3P20A 1WCMB 1PA6A 5A2QL 3ULPA 2KCMA 5IYDH 3OMGA 2F52A 1CFMA 1HPCA 4HCEA 2VS1A 1CHQD 1R4QB 3KF8B 3RLOA 4LJZC 4OO1H 3L9AX 4RGOS 3KJOA 1KD1C 3MEHA 1RJTA 3G6JB 2JA8B 2F3VA 4E6IA 2A73B 3ERSX 3KOJA 5KYIA 5LMUL 2A6ED 2KECA 5CV8A 2ASBA 1STGA 4J8QA 4LAAA 2I5MX 2F1MA 3H91A 5IWAL 1CQVA 1WD0A 3S16H 2EIFA 1G6ZA 2F0JA 4LFBQ 4TVAB 4FXDA 1UE6A 1V1PA 5AJ3L 5BN5A 3GD7A 4KHZA 3J80i 2KHJA 1EZ6A 1PRTC 1ENAA 1RKNA 5C3EG 1ENCA 2NTTA 2ES2A 2KEDA 1TY0A 4XT3B 4A3GH 3S17B 3RD4A 3ND9A 1AP0A 2SDFA 2AQ2B 1EIYB 3NPPA 3G48A 5C4HA 3GTKH 3D4DA 1A62A 1YZ6A 3A8KE 1TIID 1KQSA 5FK9C 1T5XD 2Z4IA 1OXUA 4IPHA 3SXHA 3J81E 4AYBG 4TQUS 1ZEQX 2JE6I 4XYQA 2RDHA 3CC2A 2K75A 2RQXA 1ZYRC 4UPAA 5CGKA 4IFDH 5JEAG 4FVMA 1J5EQ 3SK4A 1OTCA 5JVH3 1CZWA 3SEBA 1D7QA 4U673 4DUYQ 1SE3A 3NWSA 4X3SA 1AZPA 5E7NA 1N32L 1JORA 1XJVA 1LTSD 4JC0A 5FLXc 2NBFA 4XTCS 4NXML 1S5CD 3D4WA 1H95A 3VDYA 3Q8DA 5IGFA 1BBUA 3VA7A 4HIDA 4LF6L 1AN8A 2HD3A 1D5MC 4OHJA 4OO1G 4DK6C 1NUCA 2NYZD 1S5BD 4JI6Q 4QY7A 1YITA 2K5NA 2NTSA 5EPLA 5C4XH 4OIJA 1WD1A 1F2MA 4CBVA 4A3JB 4LFCQ 1PFMA 1HZCA 2MQHA 2JYOA 5LHY1 4DNTB 2DJGC 4UDUC 4GN5A 3IFTA 4DV2Q 3BVMA 3NBHA 4JPBW 1STEA 5C44H 4DV0Q 1QZHA 1KAWA 2Y0SB 2B8GA 1P16A 2PCFB 1VQCA 4QIWE 4DV5L 1OXVA 2PYKA 1W6KA 5BR8Q 1CQFA 4X65Q 1HUNA 1IHZA 4ZUJA 2QW7A 2EYPA 2NVXH 5K36H 4C1NK 2DY7A 2A6EC 2RF4A 4X64L 3G6EA 4DR6L 2HIXA 2Z6KC 2KCNA 2WV6D 2P5ZX 2CHBD 4A3GG 4A93H 1JICA 4DAYA 3A5ZB 4JBKA 1SJHD 3TRZA 2RDGA 4ULLA 2WKDA 3KLSX 5C0XH 3HOZH 2WAQG 5JPMC 2K1BA 2OT2A 2HT1A 2FFKB 1WTQA 2E2IB 2QDBA 1XNRL 3SVMA 2C5CA 1ESFA 1EQRA 4Q5VA 1PXUA 5G3LF 4J15A 4ZRZA 3TP8A 3KLRA 2EXDA 1I5FA 4IUTA 1SNPA 3KDFA 3T53B 5I4DA 1GD7A 3MC0B 2JA5H 1VQMA 4YCUA 5DEHA 2Z1CA 1OO9B 3D4RA 3TZUA 4GLXA 2CWPA 4HSPA 1S5FD 3KLSA 2EQSA 1FJGL 4Y52H 2RVLA 1JJGA 1U5KA 1T5EA 4RWSC 3I4MG 5JJKA 4OX9Q 2HQLA 2EY1A 4L5RC 1N36Q 2PNHA 3FKIH 3H0GB 3HKZB 2VNUD 3I7FA 3OTOL 4HJ5A 3WOFA 4N9PA 3IFDA 2BE5D 5C4XG 1TS4A 5J1ZA 3MEFA 4JK1C 4NMZA 3F8TA 4CDCC 1I50H 4K5XA 3A0JA 3I55A 4IUQA 3CCRA 4XXEA 1L1OB 4PMWA 1BCPB 4POGA 3K0YA 5C44G 3AQQA 2WP8J 4JW0A 4LF8Q 3JC63 1YJ9A 1EIGA 2XRQD 1TKWB 1QVGA 4MHEA 2K7VA 5K36G 3J81i 2Q2TA 1PH2A 5IGEA 1G2TA 1S4ZA 2VL6A 1MGSA 3H3VH 4DR4Q 2UUCL 4KTAA 2R6GA 3JAML 2ZTDA 4DV6L 1DOMA 2PZWA 3I4NB 1A2TA 3D6CA 1ILPA 4JI4Q 1A63A 1RD9D 2PQAA 3NELA 4A93G 2JXMB 3S1NH 1TVXA 2VQEQ 2AUKA 1HZAA 4LF7L 3T16A 1K28A 2FMCA 2K33A 3P75A 5M9OA 1EQQA 3HOZG 3JC62 4X66Q 1JMCA 3CU7A 1YNXA 2JA6B 5FJ8H 1B70B 5C4JB 1VQPA 4DR7L 3J7YW 1A6XA 2E5LQ 4MNOA 1N33Q 2D5DA 1IL8A 3CPFA 3BZKA 2QILA 3GQBA 2E2HB 1OXSC 1DOLA 4GOPB 1EY6A 2R92H 4DFAA 2YU9H 3C46A 2AMCB 4G7OC 2Z4HA 2R7ZB 4LF9Q 1EU4A 3I90A 2UXDQ 2B2TC 1FL0A 5D65A 1QB5D 2XVSA 2WINB 2ZM6L 4NPSA 5EPJA 3DLLA 4DV2L 1HR0Q 3GP7A 5C6AA 5A2QE 1DXMA 4A3MB 3FPPA 1DD2A 4MIUA 4DR3Q 4EQOA 3KF6A 4L5SA 4HAEA 2FHTA 2MJ8A 4DV1Q 2L1BA 5FLXE 2HHHL 1E1OA 5EBCA 1IBLL 4J1MA 4C3HH 2A6HC 5LMNQ 3A8IE 3TSSA 3F2DA 5ELBA 3W5OA 2ZJQA 4C3JB 1F9RA 1UNSA 3S15B 4BY7H 3HOXB 1KNAA 1V1PB 1GUSA 1SDFA 3JAMc 5M3MH 3E5SA 2BH2A 2YTXA 2BE5C 2KCCA 3NHHA 3GTPB 2EYOA 1QE6A 2RBMA 3CKIB 3M4QA 3U4VA 5FLMG 2WB1B 2QKIC 4DKAC 1WVLA 2B63B 5C5LA 5ELEA 4A76A 4BBSG 5E3FA 3DWAA 3U9SA 5BN4A 4Y7NH 3BVZA 3M3YB 4K14A 4BA2I 1GUGA 1Y1VB 4JV5L 1VQAA 3OWEB 5DLQE 5IP9H 4QUCA 2F4IA 5FJ8G 1DCZA 1QNUA 5BN3A 5COYA 4APVA 2UU9Q 3Q0AA 5E1FA 4GLVB 1YIJA 1B44D 2PZUA 3KJPA 5IT9c 4KHVA 1TS3A 4BY1B 3PF5A 1AW7A 2Z6KA 4NXNL 2R92G 2R7FA 1BUVT 2Z8LA 4GNXA 2XSCA 1PTOC 2CCZA 2YYZA 1JWMD 4OELB 1EQTA 2OCEA 4DV4Q 5FO7B 2K14A 4H7BA 4LUOA 4OGQC 4LF8L 1HXYD 2HUGA 2E75C 3FMCA 4PMCA 4BWGB 1ZKOA 4CDEC 3K80C 1RF2D 1K83H 4HJ7A 1EUJA 3MZ5A 5IYBH 1Q1BA 4HEDA 4DR4L 2UUAQ 1LTLA 4A3CH 2H4OA 5KNDA 2G9HD 1YI2A 1JWUD 1CK1A 1WTPA 3NXWA 1DYQA 4PG3A 2VQEL 3A55A 3OIPA 3NBHB 4BY7G 1CI3M 1GUNA 2KENA 2I5LX 4UP9A 5M5WH 5M3MG 4OONA 3VR4A 2FINB 1NMGA 3E0JA 3CF5A 2ZTEA 2JK8A 3A54A 2KBNA 1ENFA 2OXPA 4X66L 4JI3Q 1LT6D 4A3FH 4UHVA 1HH2P 2NN6I 5LL6S 1D5XC 3HRZC 1PYBA 3S2HH 1UWVA 2K52A 4A75A 1PH1A 3R8BA 1YHQA 1Q46A 1D8LA 1HTLD 1SEBD 3EVQA 2XWBB 4X3UA 4A3KG 1HNXQ 5EQ0A 1SNCA 5IYCG 1GKHA 1EIFA 3ZYYX 5KEEA 2AWNA 3PF4A 1SR3A 2I0QA 5IP9G 4DK1A 5JPNC 4A3IH 1YNNC 1HR0L 5CV9A 1H9SB 3T1HQ 5C5MA 1MHWC 1N8RC 2TMPA 4ZK9B 3KDFB 4UP7A 1DGSA 1EEFD 2BDNA 1P8LA 2F0HA 2JEBI 1A15A 4AYBB 3S9WA 4DV7Q 4RGMA 2F0SA 3BS1A 3PUZA 1IKMA 1TWGH 1YHAA 2O2LD 3PUXA 1W6JA 4JI5Q 3EA6A 3MXNA 4DV3Q 3VR5A 1NCVA 3GTJH 3T1YL 1N32Q 4RG1A 2F0GA 4B9WA 5GQOA 2F3IA 1LT4D 4NXMQ 3OMCA 5IYBG 2F0PA 1Y8NB 1IYJB 3M4YA 3RLFA 4A3CG 2YTYA 4OWWB 4K2LA 3HOWH 2UUBL 1RTOA 1EWIA 4H02A 3I8ZA 4ZAIA 1EY9A 1QJOA 4I7AA 4JCVE 1BBXC 5JEAJ 1PHJA 1S72A 5I9PA 2R93H 3SHLA 3WOEA 5T1GA 5IP7H 3C1EA 1SYCA 1VQGA 4PZ6A 3CRKC 3S16B 4A3FG 4ZLTF 2LMCB 1VQBA 5CBAE 4BA1I 2UU9L 4IURA 3QOLA 2RCNA 1I4HA 2QDLA 1U4RA 4AIMA 2PQAB 1EY4A 1O7LA 4ZKCB 1LTBD 1X3PA 5M5XH 3T51B 1J9OA 4RAUC 3R2TA 4KD3A 1MI2A 2HIVA 3JAME 2J0TD 3PIP3 5M3FH 2F4VL 1Y1WH 1SNMA 4DR6Q 1N9WA 3G7LA 5HGQA 2BOSA 1IYVA 5CMDA 4A3GB 2FXQA 4LF4L 1EOVA 4OWXB 3PSIA 4IPDA 3RMHA 1I3QB 1PRTB 1ESRA 1NMFA 3ULLA 2VB2X 4IUPA 3GTOH 4QGUA 3LWEA 3HOYH 3J7ZC 1SROA 2WAQB 5L37A 2J7ZA 1I6HH 1X6OA 2UUAL 1G8ZD 1Q1EA 3STBC 1V1OA 1PH9A 3ITPA 1STNA 2EE1A 1K8GA 3TP6A 1UE5A 1YHBA 1XNRQ 4P72A 1IYUA 2F0OA 4P71A 1EYDA 3PV0A 3U58A 4DR1L 3PO2H 1KC8C 2EXZA 1LV9A 4XYOA 1VMCA 2AUJD 3Q22A 4DN4M 3K0XA 2D9UA 1S40A 5IT9E 4OWTB 2A5HA 5FO9B 4JI3L 3S2DH 1FJGQ 3I4MB 3FRPB 4HCSA 2N8NA 1ZXTA 4KJNA 4X62L 4JYAQ 4RMFA 1VQFA 4DPGA 2ICIA 4EQNA 3CP0A 5CV5A 4JI7L 3HOVH 1TWCH 4O42A 3DWPA 3TP5A 3IRBA 1JE4A 5CV4A 2NUCA 3OTOQ 1HNXL 2EY2A 2ENBA 3RN5A 4FF2A 5C4XB 1PTOF 2R93G 3KK7A 4IJLA 2XTIA 2L5TA 4QJFA 1LT3D 4KKTA 1RL2A 2I46A 3U9OA 5LMNW 2RHQB 1IXRA 1XNQL 4BBRG 3T1HL 5C44B 4DK0A 2QEXA 2K50A 1WFQA 1BO0A 3U50C 2KCTA 1PV4A 2JP1A 3CHBD 4JI0Q 3P1HA 2NVXB 1WTWA 4A4IA 3QO2A 4M8AA 5K5PA 3UE0A 4DV7L 2IT1A 4ME3A 1PZKD 2G9DA 5M3FG 1TWAH 1Y1WG 2E2JH 4P74A 3H09A 2UUCQ 2X6LA 1X9NA 4JI5L 1CKNA 4DV6Q 4B3TL 3GTQB 4YIJA 4A93B 4DV3L 1PH4A 4DR5L 4KD4A 1E7ZA 1H9RA 2L9HA 1D1KA 4LF7Q 3HOYG 3J7AV 3BZCA 3CCSA 3M85A 3HOZB 1AZQA 1MKHA 5IYDG 1EU3A 3PQIA 2DNCA 3AU7A 1UUPA 4XIGS 1EY8A 4DR7Q 3VYSA 3KLWA 1M4VA 1EFWA 1AE2A 2JA8H 2K5VA 2O5JC 3PIO3 3PO2G 3H94A 4LF5L 4UP8A 4V190 2Q8RE 4C2MH 3ERQA 4A3DH 5JVG3 4KY6A 2EJMA 1B3QA 1FVIA 5C4ZA 4U68A 1WTHA 4MN3A 3C1FA 5HGTA 1U4PA 2ZM6Q 2GVAA 1EWCA 2KEEA 1K8AC 1LLRD 4P2CB 4GN4B 5IGCA 2JN4A 1WTRA 3C3LA 4R1JA 2VUMH 1QUQA 1WTVA 3MA2B 3NQIA 3BYYB 3HOVG 3SE0A 4Q0FA 2M2LA
chains in the Genus database with same CATH topology
3HFZB 4JI4L 3I4NG 1MIUA 3JAMi 3BZKA 2B63H 3ICEA 1OXSC 2LXJA 3ULJA 4GOPB 2R92H 1E24A 2YU9H 1V43A 2K5HA 3BU2A 2AMCB 3G4SA 1IBLQ 2HHHQ 3AFPA 3J81c 2VQFL 4C3IH 3M3YH 2Y0SE 3CAMA 5IE8A 5LMUQ 4AH6A 2YV5A 4GOPA 4LF9Q 3EN2A 1Y1VH 4GNXC 3F1ZA 2UXDQ 1JJ2A 1FL0A 2QGQA 1IBKL 3CQZH 2ZM6L 4NPSA 3DLLA 1HR0Q 4DV2L 5IWAQ 3LGJA 1Q12A 2JA6G 1G51A 2E5LL 1C9OA 1B8AA 3AYHB 3KF6B 1TWFH 3I2ZA 4DR2Q 4JI8Q 2D0OA 2AWOA 1N33L 2MNAA 5AJ3Q 3E9HA 3TEHB 1ASYA 5GAGC 1E22A 1Z9FA 3KF6A 4DR3Q 1HR0W 4L5SA 2E8GA 3HOWG 4DV1Q 3M9BA 2UXCQ 1WI5A 2HHHL 2IHEA 1E1OA 1XMQQ 1IBLL 2D0PA 5J3BA 4C3HH 2VW9A 1PYSB 3STBD 4IFDG 5LMNQ 4IFDJ 3F2DA 4LF9L 2KHIA 2R7ZG 2UXDL 2ZTCA 3GO5A 3W5OA 2ZJQA 3RR5A 4JI1L 4GS3A 3WWVA 1NY4A 4BY7H 1AH9A 1LM0A 5IP7G 3A5UA 1XPUA 4PZ8A 3JAMc 3K8AA 5M3MH 4DR2L 2Q2IA 1VQNA 1PFSA 2BH2A 4JI8L 4ALPA 4JV5Q 1VQOA 2YTXA 3TREA 1BVSA 4JYAL 2GVBA 4IOCA 4A3MG 2D62A 3F2CA 3PUWA 4WJ4A 1U0LA 3K7AH 4DNIA 1HNZL 1E3PA 4DR3L 4YCWA 4LFAL 3M4QA 4GLAC 3U4VA 4DV1L 5FLMG 1XMQL 1IL2A 4DKAC 1K9MC 5LMNL 4A76A 4BBSG 3TQYA 1EYGA 5C0XI 3I56A 3OYYA 1XPRA 4B3SQ 4NXNQ 1RIPA 2NN6G 4A3DG 1SN8A 1VQHA 4JBWA 1UEBA 4Y7NH 2UXBQ 1QVCA 3CW2C 4O2DA 1ASZA 1GVPA 3HOXG 1LYLA 4YCVA 1UE1A 3S14H 4BA2I 4JV5L 1VQAA 2AHOB 2WB1E 3B6YA 1I3QH 3L7ZC 5DLQE 4R4IA 1SLJA 5IP9H 3UDXA 1PH7A 4LUVA 4JI2L 3M4OH 3CCJA 1CKOA 1WCMH 5FJ8G 2JJQA 4KI0A 4APVA 2VUMG 1L0WA 3FP9A 2UU9Q 1VQEA 4GLVB 1YIJA 4P75A 5GAEC 2WB1G 4JI0L 1VQ8A 4LF6Q 1K0RA 3CC4A 3KJPA 3J81j 5M5YH 5IT9c 5EAYA 4GNXB 4QL5A 2B63G 3FHWA 3PF5A 4B3SL 2Z6KA 1YBYA 1VQJA 4NXNL 1MJEA 1VQ7A 2R92G 1NBWA 2UXBL 2R7FA 1T9HA 5C3EH 1SE8A 4GNXA 4GKJL 2JA7H 2CCZA 2YYZA 3UDGA 1R9TH 4EQ5A 2OWOA 1Y1VG 2ATWA 1Z47A 1NTGA 2OCEA 4DV4Q 2I5HA 1CSQA 1YVCA 1JB7A 2K14A 3CD6A 1SRUA 4LUOA 2WFWA 4MTNA 1X54A 3I4MH 2LSSA 4LF8L 3S24A 4BBRH 4YY3Q 4LUZA 3SGIA 5C0XG 5C0XJ 3TS0A 1JT8A 3K80C 1PH3A 4DV5Q 1UE7A 4R4OA 1K83H 4HJ7A 1XMOQ 1EUJA 5IYBH 3CCVA 3AEVA 3GTGH 4BY1G 1Q1BA 1BBWA 1AE3A 4DR4L 2UUAQ 1LTLA 4A3CH 1VQ6A 1VQDA 4AQYQ 2UXCL 1G291 4MZ9A 1J6QA 4X64Q 1KXLA 1Q82C 1YI2A 3ZJYC 1KRSA 1X3GA 1MJCA 2JA5G 2BA0A 4DV4L 4PG3A 2VQEL 1I94Q 3NBHB 4JBMA 4BY7G 1WJJA 2PMZE 1HNWQ 2KENA 2C35B 2I5LX 4UP9A 1W2BA 2A1AA 3HOUH 3CMAA 2N78A 3H3VI 3S17H 3PUVA 5M5WH 5M3MG 3JC66 4OONA 4YY3L 1X3EA 2MO1A 1NMGA 3CF5A 2ZTEA 3L2PA 4HIMA 4YHHL 2JK8A 2KBNA 4X66L 1PA6A 4JI3Q 3ULPA 4IO9A 1Q8KA 2ZJRA 2CFMA 2VZAA 1V9PA 1WYDA 4A3FH 3PO3H 1HH2P 2KCMA 2NN6I 5IYDH 4B3RQ 1N34Q 2F52A 1PYBA 4AQYL 3S2HH 1UWVA 1H95A 2K52A 2VS1A 3FKIG 3UE1A 4HIKA 4A75A 1PH1A 3KF8B 1YHQA 3RLOA 4IOAA 1FGUA 2R7DA 1Q46A 1D8LA 4KLKA 4R4QA 3KJOA 1KD1C 3K7UC 4YWLA 4A3KG 1HNWL 2NVTH 3RLNA 3KYHC 1HNXQ 3GTQH 2RHSB 5IYCG 4A3BH 1GKHA 4KHPQ 1EIFA 3ERSX 3KOJA 3CPWA 5LMUL 2AWNA 3PF4A 3D31A 1SR3A 2I0QA 3S1RH 1QZGA 2ASBA 5IP9G 2I5MX 4A3IH 1HR0L 1WCMG 1YEZA 5IWAL 5GADC 1VQIA 4DAMA 3W1GA 1XTDA 3S16H 2EIFA 4B3RL 4X6AH 1N34L 3T1HQ 4LFBQ 1N8RC 3T1YQ 1OXTA 3PIPA 4TVAB 3KDFB 1TXYA 3D0FA 3NENA 4UP7A 1DGSA 1UE6A 5AJ3L 1P8LA 2JEBI 3GD7A 3HKSA 1SFOH 4KHZA 1PH5A 3J80i 2KHJA 1PVOA 4IPGA 4DV7Q 5C3EG 2N3SA 2JA8G 3PUZA 2IX0A 3MXNB 1K3RA 3PCOB 2ES2A 1TWGH 2JA7G 4HJAA 1YHAA 2UUBQ 2GN5A 3PUXA 3CCMA 4JI5Q 4A3JH 1S3OA 3EBEA 2MO0A 4DV3Q 4A3GH 1EIYB 4AYBE 3GTJH 4LFBL 3G48A 3T1YL 2IX1A 1N32Q 1KIXA 2JEAI 3NEMA 4RG1A 3GTKH 3I4OA 1A62A 1YZ6A 2F3IA 5GQOA 4HJ9A 1KQSA 4NXMQ 5IYBG 4NB3A 5H1SE 1VS0A 1VQ9A 1IYJB 1KRTA 4POFA 1OXUA 3RLFA 4A3CG 4IPHA 4GKKQ 1Q81C 1KL9A 1CUKA 4TQUS 2YTYA 3U4ZA 4AYBG 2JE6I 4OWWB 2YTVA 4OXPA 3HOWH 2BA1A 3CCEA 2UUBL 3OW2A 3CC2A 1EWIA 2QA4A 2K75A 1X3FA 4UPAA 4H02A 2H5XA 4HIOA 1IBMQ 3CXCA 3GTLH 4UY8C 5JEAG 4JCVE 4O0AA 5JEAJ 1PHJA 1J5EQ 3HOUG 1S72A 1OTCA 3DM3A 3E9IA 2F4VQ 2R93H 1D7QA 4DUYQ 4R4CA 3S1MH 1N32L 5E7NA 3J80c 1XJVA 4JC0A 1JJCB 4L5QA 5IP7H 1VCIA 4A3EH 5FLXc 1VQGA 4XTCS 4YWKA 4LF4Q 4NXML 1JE5A 4PZ6A 4A3LH 3AFQA 3VDYA 4A3FG 3PO3G 2CQOA 3Q8DA 4K0KQ 2DGYA 1VQBA 1VQKA 1BBUA 4BA1I 2UU9L 4GKKL 2RCNA 2A19A 4A3MH 4HIDA 1C7YA 3H15A 1B7YB 4AIMA 4LF6L 2PQAB 1VQLA 5M5XH 2E2IH 4DK6C 5FLMH 4OO1G 3UDIA 1TWHH 2JA9A 4JI6Q 4BXXH 2CWAA 2HIVA 4QY7A 1YITA 4BBSH 1J5EL 2K5NA 3M7NA 5M3FH 2F4VL 1Y1WH 4A3BG 4DR6Q 5C4XH 4DUYL 1N9WA 4C3JH 5HGQA 4LFCQ 3S15H 4GN3B 1HZCA 1NJIC 2FXQA 2VQFQ 2MQHA 4DR1Q 2NZHA 3CCUA 4LF4L 4JBJA 1WOCA 3UDFA 1EOVA 5JJLA 4OWXB 3PSIA 4IPDA 1IBKQ 4GN5A 1E1TA 1NMFA 1CKMA 3ULLA 2ALYB 4DV2Q 3GTOH 4QGUA 2OTJA 3GTPH 5JJIA 4DV0Q 5C44H 1QZHA 3HOYH 1KAWA 1Y14B 4DV5L 1P16A 4QIWE 1VQCA 3ER0A 3J7ZC 1OXVA 1XMOL 1SROA 1I6HH 1M90C 2OTLA 5BR8Q 1X6OA 4X62Q 4X65Q 2UUAL 2A8VA 1Q1EA 3H0GH 3STBC 3F2BA 1SMXA 2NVXH 5IY0A 4JI6L 2V1CC 1PH9A 1L1OC 2RF4A 2PI2A 4X64L 2HIXA 4YWMA 3G6EA 4HJ8A 4DAYB 1K8GA 2NVQH 4DR6L 2B29A 1UE5A 1YHBA 2JQOA 4JI7Q 4LFCL 2Z6KC 4LW1A 1XNRQ 4P72A 4A3JG 3BJUA 4P71A 1I94L 3PV0A 1K73C 3U58A 4DR1L 3PO2H 1XPOA 3E0EA 4A3GG 2PI2E 4A93H 1KC8C 2WAQE 1PH8A 3A5ZB 2IY5B 4JBKA 3CCLA 4JOIC 1A8VA 4JI1Q 5HY6A 3K0XA 1S40A 4IJHA 4OWTB 2IHFA 4DV0L 2OQ0A 4LNQA 3TRZA 2AKWB 2LXKA 4JI3L 3CMEA 3S2DH 2Y0SG 1FJGQ 5BR8L 4X65L 2N8NA 4X62L 2WAQG 3HOZH 4JYAQ 4RMFA 3PIOA 1XNQQ 2HT1A 1VQFA 1X65A 4DPGA 5GAHC 1HNZQ 4LFAQ 4BY1H 3CP0A 3GTMH 4JI7L 3HOVH 1XNRL 1TWCH 5ELOA 1EQRA 1BKBA 1NE3A 3IRBA 4JG2A 4J15A 2CKZB 2EXDA 1I5FA 4DUZQ 3OTOQ 3I4NH 1HNXL 3KDFA 4IPCA 1GD7A 3RN5A 2JA5H 4P73A 2R93G 4KHPL 3GDEA 1LUZA 1VQMA 4IJLA 2XTIA 2DUDA 2VY3A 3K81C 4YCUA 3RZOH 4QJFA 1VQ4A 4GLXA 4A3EG 2CWPA 3A74A 4B3TQ 1RL2A 4DK3C 2EQSA 1FJGL 4A3LG 4OO1I 4Y52H 1U5KA 1JJGA 5LMNW 2RHQB 1IXRA 3I4MG 4DR5Q 5JJKA 4OX9Q 4BBRG 1XNQL 4GOPC 3T1HL 4JI2Q 2HQLA 2QEXA 4L5RC 1N36Q 2K50A 1VQ5A 3RN2A 3CC7A 1O7IA 1WFQA 2JA6H 5C4JH 1HJPA 3U50C 2KCTA 2PNHA 1PV4A 3FKIH 4JI0Q 1CSPA 2VNUD 3I7FA 4DUZL 4A4IA 3OTOL 4HJ5A 1CKNB 1QVFA 4BXXG 3UE0A 4DV7L 2IT1A 1Q86C 4ME3A 5M3FG 2E2JH 1Y1WG 1TWAH 2E2HH 4P74A 5C4XG 4A3KH 2UUCQ 1M1KC 1X9NA 3MEFA 4JI5L 1X55A 3CCQA 1CKNA 4LWCA 4DV6Q 2OQKA 5IYCH 4B3TL 3F8TA 3J7A5 4GKJQ 3EIVA 4LF5Q 1I50H 4DV3L 1PH4A 1C0AA 3A0JA 2Z0SA 2MFIA 3I55A 4DR5L 2R7ZH 4OX9L 1OXXK 3HKZE 1E7ZA 2ZJPA 3CCRA 1L1OB 1YJWA 4PMWA 1N36L 5ELNA 4POGA 5C44G 4PZ7A 4LF7Q 3AQQA 1A0IA 2WP8J 4LF8Q 3HOYG 3JC63 1W3SA 3BZCA 2NVYH 3RNUA 3CCSA 3M85A 1YJ9A 1G6PA 1IZ6A 4B3MQ 1QVGA 1MKHA 1V1QA 3H0GG 1L1OA 5IYDG 3PGZA 5K36G 3HKZG 3J81i 1PH2A 2Q2TA 3G71A 1HZBA 4XIGS 1PH6A 2N49A 3KFUA 2NZOA 2K4KA 4EX5A 2VL6A 3H3VH 4DR7Q 4DR4Q 3KLWA 2UUCL 1EFWA 4R4TA 1AE2A 2R6GA 4DV6L 2ZTDA 2K5VA 2JA8H 2B3GA 1KHIA 3RZDH 3PUYA 1IBML 1GM5A 3PO2G 4LF5L 4JOIA 4JI4Q 1A63A 4UP8A 2PQAA 3NELA 3S1QH 4C2MH 1YJNA 4A93G 1X56A 3S1NH 4A3DH 2VQEQ 4FDBA 1HZAA 2Q2UA 4LF7L 3W1BA 3HOXH 4L5TA 1FVIA 4A3IG 4WJ3M 1EQQA 1QUQB 2XGTA 3HOZG 4B3ML 4QQBX 4K0KL 3JC62 4YHHQ 2ID0A 4IFDI 4X66Q 1JMCA 2BH8A 2ZM6Q 3M4PA 2GVAA 1HZ9A 1YNXA 1K8AC 5GROA 5FJ8H 1B70B 1L2FA 4GN4B 3TS2A 1VQPA 4R1JA 1Q7YC 1GO3E 4DR7L 2VUMH 2E5LQ 1QUQA 2L15A 3HOVG 2Q2HA 4MNOA 3L0OA 1N33Q 3CPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HFZ B;  4JI4 L;  3I4N G;  1MIU A;  3JAM i;  3BZK A;  2B63 H;  3ICE A;  1OXS C;  2LXJ A;  3ULJ A;  4GOP B;  2R92 H;  1E24 A;  2YU9 H;  1V43 A;  2K5H A;  3BU2 A;  2AMC B;  3G4S A;  1IBL Q;  2HHH Q;  3AFP A;  3J81 c;  2VQF L;  4C3I H;  3M3Y H;  2Y0S E;  3CAM A;  5IE8 A;  5LMU Q;  4AH6 A;  2YV5 A;  4GOP A;  4LF9 Q;  3EN2 A;  1Y1V H;  4GNX C;  3F1Z A;  2UXD Q;  1JJ2 A;  1FL0 A;  2QGQ A;  1IBK L;  3CQZ H;  2ZM6 L;  4NPS A;  3DLL A;  1HR0 Q;  4DV2 L;  5IWA Q;  3LGJ A;  1Q12 A;  2JA6 G;  1G51 A;  2E5L L;  1C9O A;  1B8A A;  3AYH B;  3KF6 B;  1TWF H;  3I2Z A;  4DR2 Q;  4JI8 Q;  2D0O A;  2AWO A;  1N33 L;  2MNA A;  5AJ3 Q;  3E9H A;  3TEH B;  1ASY A;  5GAG C;  1E22 A;  1Z9F A;  3KF6 A;  4DR3 Q;  1HR0 W;  4L5S A;  2E8G A;  3HOW G;  4DV1 Q;  3M9B A;  2UXC Q;  1WI5 A;  2HHH L;  2IHE A;  1E1O A;  1XMQ Q;  1IBL L;  2D0P A;  5J3B A;  4C3H H;  2VW9 A;  1PYS B;  3STB D;  4IFD G;  5LMN Q;  4IFD J;  3F2D A;  4LF9 L;  2KHI A;  2R7Z G;  2UXD L;  2ZTC A;  3GO5 A;  3W5O A;  2ZJQ A;  3RR5 A;  4JI1 L;  4GS3 A;  3WWV A;  1NY4 A;  4BY7 H;  1AH9 A;  1LM0 A;  5IP7 G;  3A5U A;  1XPU A;  4PZ8 A;  3JAM c;  3K8A A;  5M3M H;  4DR2 L;  2Q2I A;  1VQN A;  1PFS A;  2BH2 A;  4JI8 L;  4ALP A;  4JV5 Q;  1VQO A;  2YTX A;  3TRE A;  1BVS A;  4JYA L;  2GVB A;  4IOC A;  4A3M G;  2D62 A;  3F2C A;  3PUW A;  4WJ4 A;  1U0L A;  3K7A H;  4DNI A;  1HNZ L;  1E3P A;  4DR3 L;  4YCW A;  4LFA L;  3M4Q A;  4GLA C;  3U4V A;  4DV1 L;  5FLM G;  1XMQ L;  1IL2 A;  4DKA C;  1K9M C;  5LMN L;  4A76 A;  4BBS G;  3TQY A;  1EYG A;  5C0X I;  3I56 A;  3OYY A;  1XPR A;  4B3S Q;  4NXN Q;  1RIP A;  2NN6 G;  4A3D G;  1SN8 A;  1VQH A;  4JBW A;  1UEB A;  4Y7N H;  2UXB Q;  1QVC A;  3CW2 C;  4O2D A;  1ASZ A;  1GVP A;  3HOX G;  1LYL A;  4YCV A;  1UE1 A;  3S14 H;  4BA2 I;  4JV5 L;  1VQA A;  2AHO B;  2WB1 E;  3B6Y A;  1I3Q H;  3L7Z C;  5DLQ E;  4R4I A;  1SLJ A;  5IP9 H;  3UDX A;  1PH7 A;  4LUV A;  4JI2 L;  3M4O H;  3CCJ A;  1CKO A;  1WCM H;  5FJ8 G;  2JJQ A;  4KI0 A;  4APV A;  2VUM G;  1L0W A;  3FP9 A;  2UU9 Q;  1VQE A;  4GLV B;  1YIJ A;  4P75 A;  5GAE C;  2WB1 G;  4JI0 L;  1VQ8 A;  4LF6 Q;  1K0R A;  3CC4 A;  3KJP A;  3J81 j;  5M5Y H;  5IT9 c;  5EAY A;  4GNX B;  4QL5 A;  2B63 G;  3FHW A;  3PF5 A;  4B3S L;  2Z6K A;  1YBY A;  1VQJ A;  4NXN L;  1MJE A;  1VQ7 A;  2R92 G;  1NBW A;  2UXB L;  2R7F A;  1T9H A;  5C3E H;  1SE8 A;  4GNX A;  4GKJ L;  2JA7 H;  2CCZ A;  2YYZ A;  3UDG A;  1R9T H;  4EQ5 A;  2OWO A;  1Y1V G;  2ATW A;  1Z47 A;  1NTG A;  2OCE A;  4DV4 Q;  2I5H A;  1CSQ A;  1YVC A;  1JB7 A;  2K14 A;  3CD6 A;  1SRU A;  4LUO A;  2WFW A;  4MTN A;  1X54 A;  3I4M H;  2LSS A;  4LF8 L;  3S24 A;  4BBR H;  4YY3 Q;  4LUZ A;  3SGI A;  5C0X G;  5C0X J;  3TS0 A;  1JT8 A;  3K80 C;  1PH3 A;  4DV5 Q;  1UE7 A;  4R4O A;  1K83 H;  4HJ7 A;  1XMO Q;  1EUJ A;  5IYB H;  3CCV A;  3AEV A;  3GTG H;  4BY1 G;  1Q1B A;  1BBW A;  1AE3 A;  4DR4 L;  2UUA Q;  1LTL A;  4A3C H;  1VQ6 A;  1VQD A;  4AQY Q;  2UXC L;  1G29 1;  4MZ9 A;  1J6Q A;  4X64 Q;  1KXL A;  1Q82 C;  1YI2 A;  3ZJY C;  1KRS A;  1X3G A;  1MJC A;  2JA5 G;  2BA0 A;  4DV4 L;  4PG3 A;  2VQE L;  1I94 Q;  3NBH B;  4JBM A;  4BY7 G;  1WJJ A;  2PMZ E;  1HNW Q;  2KEN A;  2C35 B;  2I5L X;  4UP9 A;  1W2B A;  2A1A A;  3HOU H;  3CMA A;  2N78 A;  3H3V I;  3S17 H;  3PUV A;  5M5W H;  5M3M G;  3JC6 6;  4OON A;  4YY3 L;  1X3E A;  2MO1 A;  1NMG A;  3CF5 A;  2ZTE A;  3L2P A;  4HIM A;  4YHH L;  2JK8 A;  2KBN A;  4X66 L;  1PA6 A;  4JI3 Q;  3ULP A;  4IO9 A;  1Q8K A;  2ZJR A;  2CFM A;  2VZA A;  1V9P A;  1WYD A;  4A3F H;  3PO3 H;  1HH2 P;  2KCM A;  2NN6 I;  5IYD H;  4B3R Q;  1N34 Q;  2F52 A;  1PYB A;  4AQY L;  3S2H H;  1UWV A;  1H95 A;  2K52 A;  2VS1 A;  3FKI G;  3UE1 A;  4HIK A;  4A75 A;  1PH1 A;  3KF8 B;  1YHQ A;  3RLO A;  4IOA A;  1FGU A;  2R7D A;  1Q46 A;  1D8L A;  4KLK A;  4R4Q A;  3KJO A;  1KD1 C;  3K7U C;  4YWL A;  4A3K G;  1HNW L;  2NVT H;  3RLN A;  3KYH C;  1HNX Q;  3GTQ H;  2RHS B;  5IYC G;  4A3B H;  1GKH A;  4KHP Q;  1EIF A;  3ERS X;  3KOJ A;  3CPW A;  5LMU L;  2AWN A;  3PF4 A;  3D31 A;  1SR3 A;  2I0Q A;  3S1R H;  1QZG A;  2ASB A;  5IP9 G;  2I5M X;  4A3I H;  1HR0 L;  1WCM G;  1YEZ A;  5IWA L;  5GAD C;  1VQI A;  4DAM A;  3W1G A;  1XTD A;  3S16 H;  2EIF A;  4B3R L;  4X6A H;  1N34 L;  3T1H Q;  4LFB Q;  1N8R C;  3T1Y Q;  1OXT A;  3PIP A;  4TVA B;  3KDF B;  1TXY A;  3D0F A;  3NEN A;  4UP7 A;  1DGS A;  1UE6 A;  5AJ3 L;  1P8L A;  2JEB I;  3GD7 A;  3HKS A;  1SFO H;  4KHZ A;  1PH5 A;  3J80 i;  2KHJ A;  1PVO A;  4IPG A;  4DV7 Q;  5C3E G;  2N3S A;  2JA8 G;  3PUZ A;  2IX0 A;  3MXN B;  1K3R A;  3PCO B;  2ES2 A;  1TWG H;  2JA7 G;  4HJA A;  1YHA A;  2UUB Q;  2GN5 A;  3PUX A;  3CCM A;  4JI5 Q;  4A3J H;  1S3O A;  3EBE A;  2MO0 A;  4DV3 Q;  4A3G H;  1EIY B;  4AYB E;  3GTJ H;  4LFB L;  3G48 A;  3T1Y L;  2IX1 A;  1N32 Q;  1KIX A;  2JEA I;  3NEM A;  4RG1 A;  3GTK H;  3I4O A;  1A62 A;  1YZ6 A;  2F3I A;  5GQO A;  4HJ9 A;  1KQS A;  4NXM Q;  5IYB G;  4NB3 A;  5H1S E;  1VS0 A;  1VQ9 A;  1IYJ B;  1KRT A;  4POF A;  1OXU A;  3RLF A;  4A3C G;  4IPH A;  4GKK Q;  1Q81 C;  1KL9 A;  1CUK A;  4TQU S;  2YTY A;  3U4Z A;  4AYB G;  2JE6 I;  4OWW B;  2YTV A;  4OXP A;  3HOW H;  2BA1 A;  3CCE A;  2UUB L;  3OW2 A;  3CC2 A;  1EWI A;  2QA4 A;  2K75 A;  1X3F A;  4UPA A;  4H02 A;  2H5X A;  4HIO A;  1IBM Q;  3CXC A;  3GTL H;  4UY8 C;  5JEA G;  4JCV E;  4O0A A;  5JEA J;  1PHJ A;  1J5E Q;  3HOU G;  1S72 A;  1OTC A;  3DM3 A;  3E9I A;  2F4V Q;  2R93 H;  1D7Q A;  4DUY Q;  4R4C A;  3S1M H;  1N32 L;  5E7N A;  3J80 c;  1XJV A;  4JC0 A;  1JJC B;  4L5Q A;  5IP7 H;  1VCI A;  4A3E H;  5FLX c;  1VQG A;  4XTC S;  4YWK A;  4LF4 Q;  4NXM L;  1JE5 A;  4PZ6 A;  4A3L H;  3AFQ A;  3VDY A;  4A3F G;  3PO3 G;  2CQO A;  3Q8D A;  4K0K Q;  2DGY A;  1VQB A;  1VQK A;  1BBU A;  4BA1 I;  2UU9 L;  4GKK L;  2RCN A;  2A19 A;  4A3M H;  4HID A;  1C7Y A;  3H15 A;  1B7Y B;  4AIM A;  4LF6 L;  2PQA B;  1VQL A;  5M5X H;  2E2I H;  4DK6 C;  5FLM H;  4OO1 G;  3UDI A;  1TWH H;  2JA9 A;  4JI6 Q;  4BXX H;  2CWA A;  2HIV A;  4QY7 A;  1YIT A;  4BBS H;  1J5E L;  2K5N A;  3M7N A;  5M3F H;  2F4V L;  1Y1W H;  4A3B G;  4DR6 Q;  5C4X H;  4DUY L;  1N9W A;  4C3J H;  5HGQ A;  4LFC Q;  3S15 H;  4GN3 B;  1HZC A;  1NJI C;  2FXQ A;  2VQF Q;  2MQH A;  4DR1 Q;  2NZH A;  3CCU A;  4LF4 L;  4JBJ A;  1WOC A;  3UDF A;  1EOV A;  5JJL A;  4OWX B;  3PSI A;  4IPD A;  1IBK Q;  4GN5 A;  1E1T A;  1NMF A;  1CKM A;  3ULL A;  2ALY B;  4DV2 Q;  3GTO H;  4QGU A;  2OTJ A;  3GTP H;  5JJI A;  4DV0 Q;  5C44 H;  1QZH A;  3HOY H;  1KAW A;  1Y14 B;  4DV5 L;  1P16 A;  4QIW E;  1VQC A;  3ER0 A;  3J7Z C;  1OXV A;  1XMO L;  1SRO A;  1I6H H;  1M90 C;  2OTL A;  5BR8 Q;  1X6O A;  4X62 Q;  4X65 Q;  2UUA L;  2A8V A;  1Q1E A;  3H0G H;  3STB C;  3F2B A;  1SMX A;  2NVX H;  5IY0 A;  4JI6 L;  2V1C C;  1PH9 A;  1L1O C;  2RF4 A;  2PI2 A;  4X64 L;  2HIX A;  4YWM A;  3G6E A;  4HJ8 A;  4DAY B;  1K8G A;  2NVQ H;  4DR6 L;  2B29 A;  1UE5 A;  1YHB A;  2JQO A;  4JI7 Q;  4LFC L;  2Z6K C;  4LW1 A;  1XNR Q;  4P72 A;  4A3J G;  3BJU A;  4P71 A;  1I94 L;  3PV0 A;  1K73 C;  3U58 A;  4DR1 L;  3PO2 H;  1XPO A;  3E0E A;  4A3G G;  2PI2 E;  4A93 H;  1KC8 C;  2WAQ E;  1PH8 A;  3A5Z B;  2IY5 B;  4JBK A;  3CCL A;  4JOI C;  1A8V A;  4JI1 Q;  5HY6 A;  3K0X A;  1S40 A;  4IJH A;  4OWT B;  2IHF A;  4DV0 L;  2OQ0 A;  4LNQ A;  3TRZ A;  2AKW B;  2LXK A;  4JI3 L;  3CME A;  3S2D H;  2Y0S G;  1FJG Q;  5BR8 L;  4X65 L;  2N8N A;  4X62 L;  2WAQ G;  3HOZ H;  4JYA Q;  4RMF A;  3PIO A;  1XNQ Q;  2HT1 A;  1VQF A;  1X65 A;  4DPG A;  5GAH C;  1HNZ Q;  4LFA Q;  4BY1 H;  3CP0 A;  3GTM H;  4JI7 L;  3HOV H;  1XNR L;  1TWC H;  5ELO A;  1EQR A;  1BKB A;  1NE3 A;  3IRB A;  4JG2 A;  4J15 A;  2CKZ B;  2EXD A;  1I5F A;  4DUZ Q;  3OTO Q;  3I4N H;  1HNX L;  3KDF A;  4IPC A;  1GD7 A;  3RN5 A;  2JA5 H;  4P73 A;  2R93 G;  4KHP L;  3GDE A;  1LUZ A;  1VQM A;  4IJL A;  2XTI A;  2DUD A;  2VY3 A;  3K81 C;  4YCU A;  3RZO H;  4QJF A;  1VQ4 A;  4GLX A;  4A3E G;  2CWP A;  3A74 A;  4B3T Q;  1RL2 A;  4DK3 C;  2EQS A;  1FJG L;  4A3L G;  4OO1 I;  4Y52 H;  1U5K A;  1JJG A;  5LMN W;  2RHQ B;  1IXR A;  3I4M G;  4DR5 Q;  5JJK A;  4OX9 Q;  4BBR G;  1XNQ L;  4GOP C;  3T1H L;  4JI2 Q;  2HQL A;  2QEX A;  4L5R C;  1N36 Q;  2K50 A;  1VQ5 A;  3RN2 A;  3CC7 A;  1O7I A;  1WFQ A;  2JA6 H;  5C4J H;  1HJP A;  3U50 C;  2KCT A;  2PNH A;  1PV4 A;  3FKI H;  4JI0 Q;  1CSP A;  2VNU D;  3I7F A;  4DUZ L;  4A4I A;  3OTO L;  4HJ5 A;  1CKN B;  1QVF A;  4BXX G;  3UE0 A;  4DV7 L;  2IT1 A;  1Q86 C;  4ME3 A;  5M3F G;  2E2J H;  1Y1W G;  1TWA H;  2E2H H;  4P74 A;  5C4X G;  4A3K H;  2UUC Q;  1M1K C;  1X9N A;  3MEF A;  4JI5 L;  1X55 A;  3CCQ A;  1CKN A;  4LWC A;  4DV6 Q;  2OQK A;  5IYC H;  4B3T L;  3F8T A;  3J7A 5;  4GKJ Q;  3EIV A;  4LF5 Q;  1I50 H;  4DV3 L;  1PH4 A;  1C0A A;  3A0J A;  2Z0S A;  2MFI A;  3I55 A;  4DR5 L;  2R7Z H;  4OX9 L;  1OXX K;  3HKZ E;  1E7Z A;  2ZJP A;  3CCR A;  1L1O B;  1YJW A;  4PMW A;  1N36 L;  5ELN A;  4POG A;  5C44 G;  4PZ7 A;  4LF7 Q;  3AQQ A;  1A0I A;  2WP8 J;  4LF8 Q;  3HOY G;  3JC6 3;  1W3S A;  3BZC A;  2NVY H;  3RNU A;  3CCS A;  3M85 A;  1YJ9 A;  1G6P A;  1IZ6 A;  4B3M Q;  1QVG A;  1MKH A;  1V1Q A;  3H0G G;  1L1O A;  5IYD G;  3PGZ A;  5K36 G;  3HKZ G;  3J81 i;  1PH2 A;  2Q2T A;  3G71 A;  1HZB A;  4XIG S;  1PH6 A;  2N49 A;  3KFU A;  2NZO A;  2K4K A;  4EX5 A;  2VL6 A;  3H3V H;  4DR7 Q;  4DR4 Q;  3KLW A;  2UUC L;  1EFW A;  4R4T A;  1AE2 A;  2R6G A;  4DV6 L;  2ZTD A;  2K5V A;  2JA8 H;  2B3G A;  1KHI A;  3RZD H;  3PUY A;  1IBM L;  1GM5 A;  3PO2 G;  4LF5 L;  4JOI A;  4JI4 Q;  1A63 A;  4UP8 A;  2PQA A;  3NEL A;  3S1Q H;  4C2M H;  1YJN A;  4A93 G;  1X56 A;  3S1N H;  4A3D H;  2VQE Q;  4FDB A;  1HZA A;  2Q2U A;  4LF7 L;  3W1B A;  3HOX H;  4L5T A;  1FVI A;  4A3I G;  4WJ3 M;  1EQQ A;  1QUQ B;  2XGT A;  3HOZ G;  4B3M L;  4QQB X;  4K0K L;  3JC6 2;  4YHH Q;  2ID0 A;  4IFD I;  4X66 Q;  1JMC A;  2BH8 A;  2ZM6 Q;  3M4P A;  2GVA A;  1HZ9 A;  1YNX A;  1K8A C;  5GRO A;  5FJ8 H;  1B70 B;  1L2F A;  4GN4 B;  3TS2 A;  1VQP A;  4R1J A;  1Q7Y C;  1GO3 E;  4DR7 L;  2VUM H;  2E5L Q;  1QUQ A;  2L15 A;  3HOV G;  2Q2H A;  4MNO A;  3L0O A;  1N33 Q;  3CPF A; 
#chains in the Genus database with same CATH topology
 2L4N A;  5EKI A;  3JAM i;  2CW0 D;  2L55 A;  2F0I A;  5KNC A;  3BDC A;  3E6Z X;  3I91 A;  1QNK A;  1GUT A;  2K5H A;  2HHH Q;  1IBL Q;  2KVM A;  2N55 A;  3GTL B;  3M7G A;  1I50 B;  4RHS A;  5ELC A;  4AH6 A;  3QB3 A;  4GNX C;  3F1Z A;  1JJ2 A;  2QGQ A;  3CQZ H;  4CGY B;  1D1I A;  3A8J E;  2A68 D;  1G51 A;  3AYH B;  1TWF H;  2AWO A;  1JWS D;  1QIL A;  3VA5 A;  2XWJ B;  5I6W A;  2K28 A;  3EQL C;  3TEH B;  1K8M A;  4H13 C;  4IUN A;  1Z9F A;  2K03 A;  2BCO A;  3NUC A;  3A7A B;  1A3U A;  4BBS B;  3K58 A;  2VW9 A;  4IFD G;  2F0N A;  3S1N B;  1C4Q A;  2KHI A;  3V2T A;  1BCP D;  3RR5 A;  4GS3 A;  1NY4 A;  3LWU A;  3QOJ A;  4L63 B;  1TR5 A;  2CH4 W;  3DM1 A;  1AH9 A;  1G2S A;  3OWF A;  3A5U A;  1XPU A;  4JV5 Q;  4JI8 L;  4RGT A;  4ALP A;  4KV6 A;  4JYA L;  5ELF A;  2D62 A;  1SXT A;  4FO2 A;  3K7A H;  4WJ4 A;  4GLA C;  2EJG C;  1A3T A;  1XMQ L;  3ERO A;  3TQY A;  1WTX A;  1FYC A;  2A69 D;  2KA7 A;  3NBI A;  2R92 B;  4A3D G;  4NXN Q;  1NR2 A;  1H9J A;  4KKS A;  5DNF A;  2YU9 B;  1SN8 A;  1VQH A;  4RH6 A;  3MVV A;  4JBW A;  1QVC A;  3NK9 A;  2F0V A;  1UE1 A;  3BDL A;  4DNR B;  3HZX A;  3H3V C;  4R4I A;  1PH7 A;  4LUV A;  2VUM G;  4K5V A;  4P75 A;  5GAE C;  4JI0 L;  2PQE A;  2RSN A;  3DWQ A;  4IAL A;  2VXW A;  3FHW A;  4B3S L;  1YBY A;  4F8M A;  3D3R A;  1MJE A;  1VQ7 A;  2UXB L;  5A35 A;  1BQQ T;  2JA7 H;  3URY A;  1R9T H;  2OWO A;  2ATW A;  1NTG A;  3RZO B;  1CSQ A;  4BY7 B;  3LX0 A;  2XRS D;  1BF4 A;  5M3M B;  4IUU A;  1V8Q A;  2B2V A;  5C0X G;  3NWT A;  1JT8 A;  4XQQ A;  4PV1 C;  2CVR A;  2PMZ B;  4R4O A;  1XMO Q;  3CCV A;  5T1I A;  3AEV A;  3GTG H;  5IIF A;  4ZCK A;  4LMQ D;  1VQ6 A;  1VQD A;  4RKB A;  3FDT A;  4MZ9 A;  1G91 A;  4F7X A;  1ET6 A;  1Q82 C;  1PRT F;  4FF1 A;  3GV6 A;  2JA5 G;  2BA0 A;  2A68 C;  4FXG C;  4WFN 3;  4A3K B;  1EWH A;  2RCF A;  4DAP A;  4JBM A;  2IJ0 A;  1W2B A;  3H6M A;  3HOU H;  1O7Z A;  1JCK B;  3JC6 6;  1JB3 A;  4YY3 L;  1FNW A;  4IO9 A;  1Q8K A;  2ZJR A;  2N88 A;  2CFM A;  1WYD A;  3PO3 H;  5I2X A;  4XDX A;  4AQY L;  3FKI G;  4HIK A;  2F0F A;  3UE1 A;  1NSN S;  2MGS A;  1FGU A;  2Z6B A;  3K7U C;  2QEJ C;  2NVT H;  4IUV A;  3FPU B;  4KKU A;  4A3B H;  1PZJ D;  3O13 A;  3CPW A;  2M00 A;  3DHQ A;  1B9M A;  3S1R H;  1QZG A;  2IL8 A;  1DZ1 A;  5TSS A;  5CC4 A;  1ET9 A;  3BYT B;  1XTD A;  2F0K A;  2K04 A;  2L0C A;  4B3R L;  5J39 A;  1N34 L;  3KBG A;  4X6A H;  5EKL A;  1I4R A;  4G7Z C;  3T1Y Q;  1OXT A;  3PIP A;  1PTO B;  1O7Y A;  1R4P B;  1K83 B;  1TXY A;  2AQ3 B;  1SJE D;  3D0F A;  3NEN A;  2Z9H A;  2CH4 A;  1PH5 A;  4V0B A;  1SFO H;  3NTH A;  1DON A;  2N3S A;  2IX0 A;  5DM6 3;  3PCO B;  2JA7 G;  4KJO A;  4HJA A;  2UUB Q;  1JC7 A;  2GN5 A;  4CJ2 C;  2X6G A;  1S3O A;  1SMY D;  1PMR A;  5M5W B;  2IPK D;  4RFB A;  2IX1 A;  5KIX A;  3I4O A;  3SR1 A;  4HJ9 A;  4A3F B;  1VS0 A;  2B2U A;  4C56 C;  4POF A;  3S2H B;  1KL9 A;  1CUK A;  1RCV D;  4CJ1 B;  2YTV A;  1L0X B;  1KLU D;  3ND8 A;  3OW2 A;  1D6E C;  1X3F A;  1X3Q A;  3Q23 A;  4HIO A;  4ILW A;  2F3W A;  3OHX C;  2KHS A;  4O0A A;  3HOU G;  1NNX A;  2F4V Q;  5EKK A;  4R4C A;  5I6Y A;  3S1M H;  1MSG A;  2EYM A;  4FP5 D;  1SYE A;  1JJC B;  3LNN A;  1VCI A;  4A3E H;  1GHK A;  4YWK A;  1MBY A;  4LF4 Q;  4KN4 C;  4A3L H;  3PO3 G;  1STB A;  2DGY A;  1B1Z A;  2F0E A;  1VQK A;  3PMF A;  4GKK L;  3W3A A;  4A3M H;  4OL7 A;  4ZUI A;  4KK7 A;  3AMU A;  2KJX A;  1VQL A;  2SNM A;  5ISR A;  1LT5 D;  3UDI A;  1TWH H;  2XIW A;  2EY5 A;  2PNR C;  2CWA A;  2HCI A;  3QJY A;  1TWG B;  5AFW A;  4C3H G;  4A3B G;  4ME5 A;  4QIW B;  1QOH A;  1KNE A;  4C3J H;  3S15 H;  4GN3 B;  5G3L D;  1NJI C;  4DR1 Q;  3BVG A;  1KDB A;  1E0B A;  2ZXR A;  1WOC A;  4JBJ A;  3UDF A;  1ICF B;  2QCP X;  3S14 B;  4RCO A;  5JJL A;  3GTJ B;  1STH A;  3I3C A;  2PPB C;  1KDC A;  1E1T A;  3GTP H;  3M4O B;  4I65 A;  1XMO L;  1HQR D;  2OTL A;  4X62 Q;  2A8V A;  4RKL A;  2WKC A;  1D2B A;  5IY0 A;  2V1C C;  5M5Y B;  1Y8O B;  2PI2 A;  1GXD C;  2NVQ H;  2V4D A;  4DAY B;  3I73 A;  1B4O A;  2B29 A;  4JI7 Q;  3VYU A;  4LW1 A;  4OEM B;  3EFX D;  1SYG A;  1XPO A;  3E0E A;  5C3E B;  2PI2 E;  2R93 B;  3R3O A;  2MHV A;  3FEW X;  5KRU A;  3CCL A;  2IY5 B;  3K5L A;  1A8V A;  2WAC A;  4NDX A;  3OW7 A;  2AKW B;  3CME A;  4BBR B;  2IX3 A;  3OPO A;  4RA8 A;  3MHB A;  3PIO A;  1XNQ Q;  1E2Z A;  5GAH C;  3MXG A;  1EOT A;  2EYJ A;  2K05 A;  1PYW D;  4BY1 H;  1SMY C;  5EPK A;  3GTM H;  3T4A C;  1GOZ A;  5CR3 A;  4JG2 A;  1K8O A;  1F9P A;  4BS9 A;  1LO5 D;  5M3F B;  1Y1W B;  1CZG A;  2DJF C;  1LUZ A;  2L12 A;  4QF4 A;  3K81 C;  2PW7 A;  4H44 C;  1VQ4 A;  4A3E G;  3A74 A;  4B3T Q;  1XYI A;  4A3L G;  4OO1 I;  4DR5 Q;  1XX8 A;  2LFN A;  3GTO B;  4JI2 Q;  3HG9 A;  5D3D A;  3HOY B;  1HQM C;  1O7I A;  2RA4 A;  1HJP A;  2NB0 A;  1S5E D;  1CSP A;  1M8A A;  4L8J A;  4DUZ L;  5IGB A;  2EDG A;  1EFI D;  4C3J G;  4DXG A;  1BOS A;  4HSV A;  2E74 C;  3CCQ A;  3PO2 B;  4LWC A;  1HFN A;  3J7A 5;  4GKJ Q;  3R2I A;  3EIV A;  3VYR A;  1PRT D;  4LF5 Q;  2ZXP A;  1C0A A;  1EQV A;  2EYL A;  1F9Q A;  3HKZ E;  2F0W A;  3TP7 A;  2K6A A;  4Z9C B;  1A0I A;  1STY A;  1W3S A;  3RNU A;  2NVY H;  2C9O A;  1V1Q A;  1I4X A;  1L1O A;  3NQT A;  3PGZ A;  3KFU A;  1HZB A;  1PH6 A;  5EGT A;  1FNV A;  3HOV B;  1TWC B;  2F0U A;  4NKL A;  1JQY D;  3CRL C;  2B3G A;  1KHI A;  3RZD H;  1GHJ A;  3PUY A;  2QF7 A;  1SAP A;  4JOI A;  1RDP D;  3S1Q H;  1ONL A;  1X56 A;  2NN6 H;  1F2L A;  2XNA C;  4ODG A;  4HTH A;  4L5T A;  2NWG A;  4A3I G;  1LAB A;  4WJ3 M;  3VR3 A;  1F9S A;  2XGT A;  4B3M L;  4QQB X;  4S3S A;  4YHH Q;  2ID0 A;  4IFD I;  1JOO A;  2BH8 A;  3GTK B;  3M4P A;  1Q7Y C;  1GO3 E;  1IKL A;  2Q2H A;  3L0O A;  1XWE A;  1B3A A;  1AEX A;  1MIU A;  1CA5 A;  1TWA B;  2PW5 A;  2CQA A;  3EJI A;  5JEA H;  1V43 A;  1LTG D;  3G4S A;  3DMU A;  4C3I H;  3CAM A;  5IE8 A;  2YV5 A;  1ILQ A;  1II3 A;  3EN2 A;  4GOP A;  3C2P A;  3QWN A;  4WRD A;  1Q12 A;  4PQX A;  1C9O A;  1B8A A;  3KF6 B;  4JI8 Q;  4N9T A;  2B2V C;  4RGN A;  5GAG C;  4G57 A;  5FLX L;  1HR0 W;  2E8G A;  3HOW G;  1WI5 A;  4X3T A;  2IHE A;  1XMQ Q;  5NUC A;  5J3B A;  4C2M B;  4IFD J;  4A3D B;  1EZ8 A;  2ZTC A;  3WWV A;  1UAP A;  4QCL A;  2EJF C;  1IW7 D;  3QIA A;  5IP7 G;  4PZ8 A;  3K8A A;  4DR2 L;  1VQN A;  2Q2I A;  1PFS A;  4ZYS A;  1D5Z C;  1BVS A;  5FO8 B;  2K01 A;  4IOC A;  3F2C A;  1U0L A;  1VDZ A;  3AB9 A;  4DNI A;  1E3P A;  2VUM B;  3W2D A;  1VF7 A;  2EVB A;  3HS0 C;  1U4L A;  1EYG A;  4TRD A;  5C0X I;  1O80 A;  2ZXO A;  5JAV A;  4B3S Q;  2E76 C;  2NN6 G;  5FOB B;  3KUP A;  2UXB Q;  1GVP A;  3ONA B;  4YCV A;  5LL6 X;  2AHO B;  2WB1 E;  1I3Q H;  3CQZ B;  2A74 C;  3L7Z C;  3TZD A;  1SLJ A;  3UDX A;  4JI2 L;  3CCJ A;  1CKO A;  1WCM H;  3P7J A;  1TWF B;  4KI0 A;  3FP9 A;  3N52 A;  1VQE A;  2EYF A;  2B2W A;  1FGB D;  1NR4 A;  1K0R A;  3CC4 A;  4GNX B;  4QL5 A;  3DUZ A;  2O5I C;  5KYL A;  1SE2 A;  1NBW A;  4IN3 A;  1T9H A;  4O1N A;  4GKJ L;  1BDO A;  4C3I G;  3UDG A;  2JA5 B;  3DEO A;  4K8J A;  2H1E A;  4CDF C;  1YVC A;  2XN9 C;  5CBE E;  1JB7 A;  4NP5 A;  2WFW A;  1DOK A;  1SYF A;  1PFB A;  3I4M H;  2LKV A;  2LSS A;  4YY3 Q;  3X3M A;  4LUZ A;  1F2Z A;  3SGI A;  4C1N I;  5C0X J;  4N8X 1;  3L3O C;  5C3X A;  3K7A B;  1ICW A;  1SBB B;  1HA5 A;  3A56 A;  4TKO B;  5FKA C;  1AE3 A;  3MAQ A;  3FKI B;  4AQY Q;  2B2U C;  1G29 1;  1J6Q A;  2BDO A;  1EEI D;  1MSH A;  3ZJY C;  1KRS A;  1X3G A;  1MJC A;  1I94 Q;  2ZT9 C;  4ZQ3 A;  1WJJ A;  2C35 B;  1JOK A;  3HGB A;  2A1A A;  1TS5 A;  3CMA A;  3H3V I;  3S17 H;  4QB4 A;  2MO1 A;  4HIM A;  1SND A;  4YHH L;  4UAI A;  3NP8 A;  3UI2 A;  2VZA A;  1V9P A;  3BG3 A;  4R8N A;  3MWY W;  3K57 A;  2B2Y A;  1K3B C;  4B3R Q;  3MFG A;  1N34 Q;  4ID6 A;  5I9O A;  3K59 A;  3MXU A;  4CDD C;  1ROD A;  3J80 L;  4IOA A;  2R7D A;  1EY5 A;  4KLK A;  1IW7 C;  4R4Q A;  4FYD A;  3NSW A;  4YWL A;  1SNQ A;  1HNW L;  3RLN A;  3KYH C;  1STA A;  3GTQ H;  3SK8 A;  2JA7 B;  2RHS B;  4K6L A;  1R9T B;  4KHP Q;  4HMI A;  3D31 A;  5IGG A;  1KLG D;  1WCM G;  1YEZ A;  2AQ1 B;  4QMG A;  5GAD C;  1EYA A;  1VQI A;  2TSS A;  1S5D D;  3W1G A;  4DAM A;  1TS2 A;  2Q8I B;  4EGV A;  5EBD A;  5IOC A;  3GTG B;  2K5W A;  1H9S A;  3HKS A;  2RDF A;  1PVO A;  3QG1 A;  1HUM A;  1JR0 D;  4IPG A;  1LTT D;  2JA8 G;  1RHP A;  2OEO A;  3MXN B;  1K3R A;  1SE4 A;  1EY0 A;  2FMM A;  3CCM A;  3BDO A;  4A3J H;  3EBE A;  2MO0 A;  5JJZ A;  3HOU B;  1B2T A;  1GJX A;  4HN7 A;  2A6H D;  4RCN A;  4CHT B;  4DAV A;  4NW2 A;  4AYB E;  3IL8 A;  4LFB L;  1KIX A;  2JEA I;  3NEM A;  1Q90 A;  1YNJ D;  3PO3 B;  1Q3L A;  4FF3 A;  4NB3 A;  5H1S E;  1VQ9 A;  4KMU C;  1KRT A;  1EY7 A;  1E2V A;  4GKK Q;  1Q81 C;  4PNY A;  3U4Z A;  1B9N A;  1Q8I A;  3NTI A;  4OXP A;  3BZD B;  2BA1 A;  3RUZ A;  3CCE A;  1GUO A;  2QA4 A;  2NVT B;  2H5X A;  1IBM Q;  3CXC A;  3GTL H;  5CYU A;  4UY8 C;  4C3H B;  2IWH A;  4A3B B;  3K5O A;  3DM3 A;  3E9I A;  2SEB D;  3S1R B;  1U9R A;  3J80 c;  1EL0 A;  4L5Q A;  1ML0 D;  1JE5 A;  4JVZ A;  3AFQ A;  1A2U A;  2CQO A;  4K0K Q;  1B50 A;  4XT1 B;  1CA6 A;  2A19 A;  1I4G A;  2CW0 C;  4MTK A;  1C7Y A;  3H15 A;  1B7Y B;  1SSO A;  2L11 A;  2E2I H;  3DXJ C;  5FLM H;  1SFO B;  2FJ2 A;  4FNF A;  2JA9 A;  2G5D A;  4BXX H;  3T56 B;  4BBS H;  1J5E L;  3M7N A;  4KY5 A;  1NAP A;  2EOT A;  3TN2 A;  2DN8 A;  4DUY L;  1Z6H A;  4Y7N B;  2VQF Q;  5ELD A;  2NZH A;  3CCU A;  2VB3 X;  1FNU A;  1PTO D;  1IBK Q;  1CKM A;  1X32 A;  1EYC A;  2ALY B;  2OTJ A;  5JJI A;  5IGD A;  1L0Y B;  1Y14 B;  3ER0 A;  1PLF A;  3V05 A;  4TSS A;  1M90 C;  4K2K A;  1BXT A;  3H0G H;  3F2B A;  4JI6 L;  1SMX A;  2F0Q A;  1L1O C;  1BCP C;  4YWM A;  4HJ8 A;  2JQO A;  4LFC L;  4A3J G;  2WII B;  3BJU A;  5CV6 A;  1I94 L;  1Y69 U;  1K73 C;  4N8F A;  3D6W A;  5I2Y A;  2WAQ E;  3MTS A;  3KF8 A;  1PH8 A;  4QUF A;  4JOI C;  5IT9 L;  3S1M B;  4JI1 Q;  5HY6 A;  3DEP A;  4A3E B;  5DAU A;  4IJH A;  4LNQ A;  2IHF A;  4DV0 L;  2OQ0 A;  3TBI B;  3K5M A;  2E2D C;  2LXK A;  3E3X A;  4R8I A;  2Y0S G;  5BR8 L;  4X65 L;  2HCC A;  2DNE A;  4HR7 B;  2R61 A;  3MFY A;  1I4Q A;  1X65 A;  2RKS A;  3I70 A;  1HNZ Q;  2A69 C;  4LFA Q;  2K5Q A;  2F0M A;  1TWH B;  4J6H A;  5ELO A;  2JSO A;  1BKB A;  1NE3 A;  2GA4 B;  3V96 A;  2CKZ B;  4DUZ Q;  3I4N H;  3OSO A;  5EJW A;  4CKE A;  4IPC A;  4P73 A;  2Q8T A;  3GDE A;  4FXK C;  3NE5 B;  4KHP L;  1YNJ C;  2DUD A;  2VY3 A;  3RZO H;  3WDN A;  4DK3 C;  1SNO A;  1XTC D;  4CKC A;  1B53 A;  2F0D A;  3OIQ A;  2EYH A;  4LK1 C;  4GOP C;  1WTO A;  2IW3 A;  1MD2 D;  1VQ5 A;  3RN2 A;  3CC7 A;  1DM0 B;  1FR3 A;  2HQE A;  2JA6 H;  5C4J H;  1HRJ A;  1YNN D;  3HEJ A;  3J81 L;  1AFP A;  4BXX G;  1CKN B;  1KAB A;  1QVF A;  3NTK A;  5C3W A;  2NVQ B;  1Q86 C;  1I6V C;  5J22 A;  2RSO A;  2E2H H;  4HMJ A;  4A3K H;  1M1K C;  1X55 A;  2R3Z A;  5DM7 3;  2OQK A;  5IYC H;  1Z7T A;  5E4W C;  2KOL A;  4DXF A;  2Z0S A;  2MFI A;  2R7Z H;  4XQN A;  4OX9 L;  1OXX K;  3IKJ A;  1VMP A;  3D8G A;  2F0T A;  2ZJP A;  2D2C C;  1YJW A;  1N36 L;  5ELN A;  4A3I B;  4PZ7 A;  5CV7 A;  3A7L A;  4KN7 C;  1G6P A;  2PO4 A;  3IAY A;  1IZ6 A;  4B3M Q;  2X69 A;  3H0G G;  3HKZ G;  2B39 A;  1HTP A;  3OOC A;  3G71 A;  1J8I A;  2N49 A;  1PZI D;  2K4K A;  2NZO A;  3GTM B;  4EX5 A;  2NZ1 D;  3X3N A;  4R4T A;  2UXC Q;  1IBM L;  5D14 A;  1GM5 A;  3VYT A;  1YJN A;  4XQJ A;  1C48 A;  4FDB A;  4DGZ A;  4IQZ A;  1BNZ A;  1E2W A;  4M1U B;  2Q2U A;  4PMB A;  4ABN A;  3W1B A;  3HOX H;  1BR9 A;  1GUW A;  1QUQ B;  4K0K L;  4K6D A;  4G7H C;  1QCB D;  2M9V A;  1PTO H;  1SYB A;  2OF1 A;  1HZ9 A;  5GRO A;  3TS2 A;  1L2F A;  4GZY C;  3TDQ A;  3MXP A;  4OIK A;  3QR8 A;  2L15 A;  4CJ0 B;  1A3V A;  2KQ3 A;  3SDZ A;  2EY6 A;  5F2D A;  1KAA A;  2B2W C;  3HFZ B;  4JI4 L;  2KUM A;  3I4N G;  1KTK A;  1FD7 D;  3K6O A;  2B63 H;  3ICE A;  2LXJ A;  3ULJ A;  3HOW B;  2I07 B;  1CHP D;  1E24 A;  2LY7 A;  5IOD A;  5E4X A;  3BU2 A;  1TU2 B;  3AFP A;  4F87 A;  3J81 c;  3I4L A;  2VQF L;  3M3Y H;  2Y0S E;  4ZKB B;  5LMU Q;  1Y1V H;  1HFG A;  5COR A;  1IBK L;  3I72 A;  5IWA Q;  3LGJ A;  2NVY B;  1JOQ A;  2JA6 G;  2E5L L;  4IZ8 A;  4DR2 Q;  3I2Z A;  2D0O A;  1N33 L;  1CT1 D;  1H9M A;  1O78 A;  4K8I A;  4DF7 A;  5HUR A;  2MNA A;  5AJ3 Q;  3E9H A;  4B9X A;  1ASY A;  1XXG A;  1E22 A;  4CKB A;  3K5N A;  5M5X B;  3J80 E;  3M9B A;  2EPB A;  3RZD B;  2EZV A;  3SK6 A;  2D0P A;  3S1Q B;  4RHR A;  3KBX A;  1PYS B;  3STB D;  1LTI D;  4LF9 L;  4WOR A;  4KY7 A;  1UEA B;  2R7Z G;  2UXD L;  3GO5 A;  2F03 A;  2LS0 1;  4JI1 L;  4K5W A;  2B8F A;  1LM0 A;  2K32 A;  1RTN A;  3VR6 A;  1VQO A;  1EIH A;  3TRE A;  3F2U A;  2GVB A;  1CTM A;  5KNB A;  3R93 A;  1HHV A;  4A3M G;  3PUW A;  1HNZ L;  4DR3 L;  2HDM A;  4YCW A;  4LFA L;  3J7A F;  5KGU A;  4DU9 A;  4DV1 L;  1I6H B;  1H9K A;  1IL2 A;  2B2Y C;  3GV3 A;  2F0L A;  1K9M C;  2K5D A;  5LMN L;  3I56 A;  3OYY A;  1XPR A;  1RIP A;  1QG7 A;  1UEB A;  1DJR D;  3CW2 C;  4O2D A;  1ASZ A;  1F77 A;  4C3I B;  3HOX G;  1LYL A;  4FF4 A;  3S14 H;  4EQP A;  3B6Y A;  2SNS A;  2SOB A;  3Q6S A;  3M4O H;  1LTA D;  1LTR D;  1TY2 A;  2JJQ A;  4EVO A;  3S2D B;  1F2Y A;  1L0W A;  4H0L C;  4F88 A;  2MP1 A;  4L6T B;  3FVQ A;  2WB1 G;  1VQ8 A;  1KDA A;  4LF6 Q;  3J81 j;  5M5Y H;  5EAY A;  1TQO A;  2B63 G;  2ICE C;  1BCP F;  3TME A;  1VQJ A;  4B08 A;  1U4M A;  5C3E H;  2O4X A;  2J4X A;  1SE8 A;  2B2T A;  4G4K A;  3T13 A;  4EQ5 A;  1Y1V G;  3SK5 A;  1Z47 A;  1I4P A;  2I5H A;  4I7Z C;  3VR2 A;  3CD6 A;  1SRU A;  4MTN A;  1X54 A;  1ZYR D;  3N6R A;  3S24 A;  4BBR H;  3TS0 A;  1SYD A;  5D3I B;  3HP3 A;  4X3K A;  1PH3 A;  4DV5 Q;  1UE7 A;  1K0S A;  1QWY A;  1PDQ A;  5JOB A;  4BY1 G;  1BBW A;  2HDL A;  2UXC L;  4R9W A;  4X64 Q;  1KXL A;  1Y8P B;  2PZT A;  4DA2 A;  1C8C A;  1HCZ A;  1VF5 C;  2DY8 A;  2E2J B;  1LAC A;  1TT2 A;  4DV4 L;  1CM9 A;  1HNW Q;  2PMZ E;  2MPM A;  2N78 A;  3PUV A;  4WJW A;  3Q24 A;  2MUY A;  1X3E A;  3L2P A;  1PFN A;  1HA6 A;  3P20 A;  1WCM B;  1PA6 A;  5A2Q L;  3ULP A;  2KCM A;  5IYD H;  3OMG A;  2F52 A;  1CFM A;  1HPC A;  4HCE A;  2VS1 A;  1CHQ D;  1R4Q B;  3KF8 B;  3RLO A;  4LJZ C;  4OO1 H;  3L9A X;  4RGO S;  3KJO A;  1KD1 C;  3MEH A;  1RJT A;  3G6J B;  2JA8 B;  2F3V A;  4E6I A;  2A73 B;  3ERS X;  3KOJ A;  5KYI A;  5LMU L;  2A6E D;  2KEC A;  5CV8 A;  2ASB A;  1STG A;  4J8Q A;  4LAA A;  2I5M X;  2F1M A;  3H91 A;  5IWA L;  1CQV A;  1WD0 A;  3S16 H;  2EIF A;  1G6Z A;  2F0J A;  4LFB Q;  4TVA B;  4FXD A;  1UE6 A;  1V1P A;  5AJ3 L;  5BN5 A;  3GD7 A;  4KHZ A;  3J80 i;  2KHJ A;  1EZ6 A;  1PRT C;  1ENA A;  1RKN A;  5C3E G;  1ENC A;  2NTT A;  2ES2 A;  2KED A;  1TY0 A;  4XT3 B;  4A3G H;  3S17 B;  3RD4 A;  3ND9 A;  1AP0 A;  2SDF A;  2AQ2 B;  1EIY B;  3NPP A;  3G48 A;  5C4H A;  3GTK H;  3D4D A;  1A62 A;  1YZ6 A;  3A8K E;  1TII D;  1KQS A;  5FK9 C;  1T5X D;  2Z4I A;  1OXU A;  4IPH A;  3SXH A;  3J81 E;  4AYB G;  4TQU S;  1ZEQ X;  2JE6 I;  4XYQ A;  2RDH A;  3CC2 A;  2K75 A;  2RQX A;  1ZYR C;  4UPA A;  5CGK A;  4IFD H;  5JEA G;  4FVM A;  1J5E Q;  3SK4 A;  1OTC A;  5JVH 3;  1CZW A;  3SEB A;  1D7Q A;  4U67 3;  4DUY Q;  1SE3 A;  3NWS A;  4X3S A;  1AZP A;  5E7N A;  1N32 L;  1JOR A;  1XJV A;  1LTS D;  4JC0 A;  5FLX c;  2NBF A;  4XTC S;  4NXM L;  1S5C D;  3D4W A;  1H95 A;  3VDY A;  3Q8D A;  5IGF A;  1BBU A;  3VA7 A;  4HID A;  4LF6 L;  1AN8 A;  2HD3 A;  1D5M C;  4OHJ A;  4OO1 G;  4DK6 C;  1NUC A;  2NYZ D;  1S5B D;  4JI6 Q;  4QY7 A;  1YIT A;  2K5N A;  2NTS A;  5EPL A;  5C4X H;  4OIJ A;  1WD1 A;  1F2M A;  4CBV A;  4A3J B;  4LFC Q;  1PFM A;  1HZC A;  2MQH A;  2JYO A;  5LHY 1;  4DNT B;  2DJG C;  4UDU C;  4GN5 A;  3IFT A;  4DV2 Q;  3BVM A;  3NBH A;  4JPB W;  1STE A;  5C44 H;  4DV0 Q;  1QZH A;  1KAW A;  2Y0S B;  2B8G A;  1P16 A;  2PCF B;  1VQC A;  4QIW E;  4DV5 L;  1OXV A;  2PYK A;  1W6K A;  5BR8 Q;  1CQF A;  4X65 Q;  1HUN A;  1IHZ A;  4ZUJ A;  2QW7 A;  2EYP A;  2NVX H;  5K36 H;  4C1N K;  2DY7 A;  2A6E C;  2RF4 A;  4X64 L;  3G6E A;  4DR6 L;  2HIX A;  2Z6K C;  2KCN A;  2WV6 D;  2P5Z X;  2CHB D;  4A3G G;  4A93 H;  1JIC A;  4DAY A;  3A5Z B;  4JBK A;  1SJH D;  3TRZ A;  2RDG A;  4ULL A;  2WKD A;  3KLS X;  5C0X H;  3HOZ H;  2WAQ G;  5JPM C;  2K1B A;  2OT2 A;  2HT1 A;  2FFK B;  1WTQ A;  2E2I B;  2QDB A;  1XNR L;  3SVM A;  2C5C A;  1ESF A;  1EQR A;  4Q5V A;  1PXU A;  5G3L F;  4J15 A;  4ZRZ A;  3TP8 A;  3KLR A;  2EXD A;  1I5F A;  4IUT A;  1SNP A;  3KDF A;  3T53 B;  5I4D A;  1GD7 A;  3MC0 B;  2JA5 H;  1VQM A;  4YCU A;  5DEH A;  2Z1C A;  1OO9 B;  3D4R A;  3TZU A;  4GLX A;  2CWP A;  4HSP A;  1S5F D;  3KLS A;  2EQS A;  1FJG L;  4Y52 H;  2RVL A;  1JJG A;  1U5K A;  1T5E A;  4RWS C;  3I4M G;  5JJK A;  4OX9 Q;  2HQL A;  2EY1 A;  4L5R C;  1N36 Q;  2PNH A;  3FKI H;  3H0G B;  3HKZ B;  2VNU D;  3I7F A;  3OTO L;  4HJ5 A;  3WOF A;  4N9P A;  3IFD A;  2BE5 D;  5C4X G;  1TS4 A;  5J1Z A;  3MEF A;  4JK1 C;  4NMZ A;  3F8T A;  4CDC C;  1I50 H;  4K5X A;  3A0J A;  3I55 A;  4IUQ A;  3CCR A;  4XXE A;  1L1O B;  4PMW A;  1BCP B;  4POG A;  3K0Y A;  5C44 G;  3AQQ A;  2WP8 J;  4JW0 A;  4LF8 Q;  3JC6 3;  1YJ9 A;  1EIG A;  2XRQ D;  1TKW B;  1QVG A;  4MHE A;  2K7V A;  5K36 G;  3J81 i;  2Q2T A;  1PH2 A;  5IGE A;  1G2T A;  1S4Z A;  2VL6 A;  1MGS A;  3H3V H;  4DR4 Q;  2UUC L;  4KTA A;  2R6G A;  3JAM L;  2ZTD A;  4DV6 L;  1DOM A;  2PZW A;  3I4N B;  1A2T A;  3D6C A;  1ILP A;  4JI4 Q;  1A63 A;  1RD9 D;  2PQA A;  3NEL A;  4A93 G;  2JXM B;  3S1N H;  1TVX A;  2VQE Q;  2AUK A;  1HZA A;  4LF7 L;  3T16 A;  1K28 A;  2FMC A;  2K33 A;  3P75 A;  5M9O A;  1EQQ A;  3HOZ G;  3JC6 2;  4X66 Q;  1JMC A;  3CU7 A;  1YNX A;  2JA6 B;  5FJ8 H;  1B70 B;  5C4J B;  1VQP A;  4DR7 L;  3J7Y W;  1A6X A;  2E5L Q;  4MNO A;  1N33 Q;  2D5D A;  1IL8 A;  3CPF A;  3BZK A;  2QIL A;  3GQB A;  2E2H B;  1OXS C;  1DOL A;  4GOP B;  1EY6 A;  2R92 H;  4DFA A;  2YU9 H;  3C46 A;  2AMC B;  4G7O C;  2Z4H A;  2R7Z B;  4LF9 Q;  1EU4 A;  3I90 A;  2UXD Q;  2B2T C;  1FL0 A;  5D65 A;  1QB5 D;  2XVS A;  2WIN B;  2ZM6 L;  4NPS A;  5EPJ A;  3DLL A;  4DV2 L;  1HR0 Q;  3GP7 A;  5C6A A;  5A2Q E;  1DXM A;  4A3M B;  3FPP A;  1DD2 A;  4MIU A;  4DR3 Q;  4EQO A;  3KF6 A;  4L5S A;  4HAE A;  2FHT A;  2MJ8 A;  4DV1 Q;  2L1B A;  5FLX E;  2HHH L;  1E1O A;  5EBC A;  1IBL L;  4J1M A;  4C3H H;  2A6H C;  5LMN Q;  3A8I E;  3TSS A;  3F2D A;  5ELB A;  3W5O A;  2ZJQ A;  4C3J B;  1F9R A;  1UNS A;  3S15 B;  4BY7 H;  3HOX B;  1KNA A;  1V1P B;  1GUS A;  1SDF A;  3JAM c;  5M3M H;  3E5S A;  2BH2 A;  2YTX A;  2BE5 C;  2KCC A;  3NHH A;  3GTP B;  2EYO A;  1QE6 A;  2RBM A;  3CKI B;  3M4Q A;  3U4V A;  5FLM G;  2WB1 B;  2QKI C;  4DKA C;  1WVL A;  2B63 B;  5C5L A;  5ELE A;  4A76 A;  4BBS G;  5E3F A;  3DWA A;  3U9S A;  5BN4 A;  4Y7N H;  3BVZ A;  3M3Y B;  4K14 A;  4BA2 I;  1GUG A;  1Y1V B;  4JV5 L;  1VQA A;  3OWE B;  5DLQ E;  5IP9 H;  4QUC A;  2F4I A;  5FJ8 G;  1DCZ A;  1QNU A;  5BN3 A;  5COY A;  4APV A;  2UU9 Q;  3Q0A A;  5E1F A;  4GLV B;  1YIJ A;  1B44 D;  2PZU A;  3KJP A;  5IT9 c;  4KHV A;  1TS3 A;  4BY1 B;  3PF5 A;  1AW7 A;  2Z6K A;  4NXN L;  2R92 G;  2R7F A;  1BUV T;  2Z8L A;  4GNX A;  2XSC A;  1PTO C;  2CCZ A;  2YYZ A;  1JWM D;  4OEL B;  1EQT A;  2OCE A;  4DV4 Q;  5FO7 B;  2K14 A;  4H7B A;  4LUO A;  4OGQ C;  4LF8 L;  1HXY D;  2HUG A;  2E75 C;  3FMC A;  4PMC A;  4BWG B;  1ZKO A;  4CDE C;  3K80 C;  1RF2 D;  1K83 H;  4HJ7 A;  1EUJ A;  3MZ5 A;  5IYB H;  1Q1B A;  4HED A;  4DR4 L;  2UUA Q;  1LTL A;  4A3C H;  2H4O A;  5KND A;  2G9H D;  1YI2 A;  1JWU D;  1CK1 A;  1WTP A;  3NXW A;  1DYQ A;  4PG3 A;  2VQE L;  3A55 A;  3OIP A;  3NBH B;  4BY7 G;  1CI3 M;  1GUN A;  2KEN A;  2I5L X;  4UP9 A;  5M5W H;  5M3M G;  4OON A;  3VR4 A;  2FIN B;  1NMG A;  3E0J A;  3CF5 A;  2ZTE A;  2JK8 A;  3A54 A;  2KBN A;  1ENF A;  2OXP A;  4X66 L;  4JI3 Q;  1LT6 D;  4A3F H;  4UHV A;  1HH2 P;  2NN6 I;  5LL6 S;  1D5X C;  3HRZ C;  1PYB A;  3S2H H;  1UWV A;  2K52 A;  4A75 A;  1PH1 A;  3R8B A;  1YHQ A;  1Q46 A;  1D8L A;  1HTL D;  1SEB D;  3EVQ A;  2XWB B;  4X3U A;  4A3K G;  1HNX Q;  5EQ0 A;  1SNC A;  5IYC G;  1GKH A;  1EIF A;  3ZYY X;  5KEE A;  2AWN A;  3PF4 A;  1SR3 A;  2I0Q A;  5IP9 G;  4DK1 A;  5JPN C;  4A3I H;  1YNN C;  1HR0 L;  5CV9 A;  1H9S B;  3T1H Q;  5C5M A;  1MHW C;  1N8R C;  2TMP A;  4ZK9 B;  3KDF B;  4UP7 A;  1DGS A;  1EEF D;  2BDN A;  1P8L A;  2F0H A;  2JEB I;  1A15 A;  4AYB B;  3S9W A;  4DV7 Q;  4RGM A;  2F0S A;  3BS1 A;  3PUZ A;  1IKM A;  1TWG H;  1YHA A;  2O2L D;  3PUX A;  1W6J A;  4JI5 Q;  3EA6 A;  3MXN A;  4DV3 Q;  3VR5 A;  1NCV A;  3GTJ H;  3T1Y L;  1N32 Q;  4RG1 A;  2F0G A;  4B9W A;  5GQO A;  2F3I A;  1LT4 D;  4NXM Q;  3OMC A;  5IYB G;  2F0P A;  1Y8N B;  1IYJ B;  3M4Y A;  3RLF A;  4A3C G;  2YTY A;  4OWW B;  4K2L A;  3HOW H;  2UUB L;  1RTO A;  1EWI A;  4H02 A;  3I8Z A;  4ZAI A;  1EY9 A;  1QJO A;  4I7A A;  4JCV E;  1BBX C;  5JEA J;  1PHJ A;  1S72 A;  5I9P A;  2R93 H;  3SHL A;  3WOE A;  5T1G A;  5IP7 H;  3C1E A;  1SYC A;  1VQG A;  4PZ6 A;  3CRK C;  3S16 B;  4A3F G;  4ZLT F;  2LMC B;  1VQB A;  5CBA E;  4BA1 I;  2UU9 L;  4IUR A;  3QOL A;  2RCN A;  1I4H A;  2QDL A;  1U4R A;  4AIM A;  2PQA B;  1EY4 A;  1O7L A;  4ZKC B;  1LTB D;  1X3P A;  5M5X H;  3T51 B;  1J9O A;  4RAU C;  3R2T A;  4KD3 A;  1MI2 A;  2HIV A;  3JAM E;  2J0T D;  3PIP 3;  5M3F H;  2F4V L;  1Y1W H;  1SNM A;  4DR6 Q;  1N9W A;  3G7L A;  5HGQ A;  2BOS A;  1IYV A;  5CMD A;  4A3G B;  2FXQ A;  4LF4 L;  1EOV A;  4OWX B;  3PSI A;  4IPD A;  3RMH A;  1I3Q B;  1PRT B;  1ESR A;  1NMF A;  3ULL A;  2VB2 X;  4IUP A;  3GTO H;  4QGU A;  3LWE A;  3HOY H;  3J7Z C;  1SRO A;  2WAQ B;  5L37 A;  2J7Z A;  1I6H H;  1X6O A;  2UUA L;  1G8Z D;  1Q1E A;  3STB C;  1V1O A;  1PH9 A;  3ITP A;  1STN A;  2EE1 A;  1K8G A;  3TP6 A;  1UE5 A;  1YHB A;  1XNR Q;  4P72 A;  1IYU A;  2F0O A;  4P71 A;  1EYD A;  3PV0 A;  3U58 A;  4DR1 L;  3PO2 H;  1KC8 C;  2EXZ A;  1LV9 A;  4XYO A;  1VMC A;  2AUJ D;  3Q22 A;  4DN4 M;  3K0X A;  2D9U A;  1S40 A;  5IT9 E;  4OWT B;  2A5H A;  5FO9 B;  4JI3 L;  3S2D H;  1FJG Q;  3I4M B;  3FRP B;  4HCS A;  2N8N A;  1ZXT A;  4KJN A;  4X62 L;  4JYA Q;  4RMF A;  1VQF A;  4DPG A;  2ICI A;  4EQN A;  3CP0 A;  5CV5 A;  4JI7 L;  3HOV H;  1TWC H;  4O42 A;  3DWP A;  3TP5 A;  3IRB A;  1JE4 A;  5CV4 A;  2NUC A;  3OTO Q;  1HNX L;  2EY2 A;  2ENB A;  3RN5 A;  4FF2 A;  5C4X B;  1PTO F;  2R93 G;  3KK7 A;  4IJL A;  2XTI A;  2L5T A;  4QJF A;  1LT3 D;  4KKT A;  1RL2 A;  2I46 A;  3U9O A;  5LMN W;  2RHQ B;  1IXR A;  1XNQ L;  4BBR G;  3T1H L;  5C44 B;  4DK0 A;  2QEX A;  2K50 A;  1WFQ A;  1BO0 A;  3U50 C;  2KCT A;  1PV4 A;  2JP1 A;  3CHB D;  4JI0 Q;  3P1H A;  2NVX B;  1WTW A;  4A4I A;  3QO2 A;  4M8A A;  5K5P A;  3UE0 A;  4DV7 L;  2IT1 A;  4ME3 A;  1PZK D;  2G9D A;  5M3F G;  1TWA H;  1Y1W G;  2E2J H;  4P74 A;  3H09 A;  2UUC Q;  2X6L A;  1X9N A;  4JI5 L;  1CKN A;  4DV6 Q;  4B3T L;  3GTQ B;  4YIJ A;  4A93 B;  4DV3 L;  1PH4 A;  4DR5 L;  4KD4 A;  1E7Z A;  1H9R A;  2L9H A;  1D1K A;  4LF7 Q;  3HOY G;  3J7A V;  3BZC A;  3CCS A;  3M85 A;  3HOZ B;  1AZQ A;  1MKH A;  5IYD G;  1EU3 A;  3PQI A;  2DNC A;  3AU7 A;  1UUP A;  4XIG S;  1EY8 A;  4DR7 Q;  3VYS A;  3KLW A;  1M4V A;  1EFW A;  1AE2 A;  2JA8 H;  2K5V A;  2O5J C;  3PIO 3;  3PO2 G;  3H94 A;  4LF5 L;  4UP8 A;  4V19 0;  2Q8R E;  4C2M H;  3ERQ A;  4A3D H;  5JVG 3;  4KY6 A;  2EJM A;  1B3Q A;  1FVI A;  5C4Z A;  4U68 A;  1WTH A;  4MN3 A;  3C1F A;  5HGT A;  1U4P A;  2ZM6 Q;  2GVA A;  1EWC A;  2KEE A;  1K8A C;  1LLR D;  4P2C B;  4GN4 B;  5IGC A;  2JN4 A;  1WTR A;  3C3L A;  4R1J A;  2VUM H;  1QUQ A;  1WTV A;  3MA2 B;  3NQI A;  3BYY B;  3HOV G;  3SE0 A;  4Q0F A;  2M2L A; 
#chains in the Genus database with same CATH homology
 3HFZ B;  4JI4 L;  3I4N G;  1MIU A;  3JAM i;  3BZK A;  2B63 H;  3ICE A;  1OXS C;  2LXJ A;  3ULJ A;  4GOP B;  2R92 H;  1E24 A;  2YU9 H;  1V43 A;  2K5H A;  3BU2 A;  2AMC B;  3G4S A;  1IBL Q;  2HHH Q;  3AFP A;  3J81 c;  2VQF L;  4C3I H;  3M3Y H;  2Y0S E;  3CAM A;  5IE8 A;  5LMU Q;  4AH6 A;  2YV5 A;  4GOP A;  4LF9 Q;  3EN2 A;  1Y1V H;  4GNX C;  3F1Z A;  2UXD Q;  1JJ2 A;  1FL0 A;  2QGQ A;  1IBK L;  3CQZ H;  2ZM6 L;  4NPS A;  3DLL A;  1HR0 Q;  4DV2 L;  5IWA Q;  3LGJ A;  1Q12 A;  2JA6 G;  1G51 A;  2E5L L;  1C9O A;  1B8A A;  3AYH B;  3KF6 B;  1TWF H;  3I2Z A;  4DR2 Q;  4JI8 Q;  2D0O A;  2AWO A;  1N33 L;  2MNA A;  5AJ3 Q;  3E9H A;  3TEH B;  1ASY A;  5GAG C;  1E22 A;  1Z9F A;  3KF6 A;  4DR3 Q;  1HR0 W;  4L5S A;  2E8G A;  3HOW G;  4DV1 Q;  3M9B A;  2UXC Q;  1WI5 A;  2HHH L;  2IHE A;  1E1O A;  1XMQ Q;  1IBL L;  2D0P A;  5J3B A;  4C3H H;  2VW9 A;  1PYS B;  3STB D;  4IFD G;  5LMN Q;  4IFD J;  3F2D A;  4LF9 L;  2KHI A;  2R7Z G;  2UXD L;  2ZTC A;  3GO5 A;  3W5O A;  2ZJQ A;  3RR5 A;  4JI1 L;  4GS3 A;  3WWV A;  1NY4 A;  4BY7 H;  1AH9 A;  1LM0 A;  5IP7 G;  3A5U A;  1XPU A;  4PZ8 A;  3JAM c;  3K8A A;  5M3M H;  4DR2 L;  2Q2I A;  1VQN A;  1PFS A;  2BH2 A;  4JI8 L;  4ALP A;  4JV5 Q;  1VQO A;  2YTX A;  3TRE A;  1BVS A;  4JYA L;  2GVB A;  4IOC A;  4A3M G;  2D62 A;  3F2C A;  3PUW A;  4WJ4 A;  1U0L A;  3K7A H;  4DNI A;  1HNZ L;  1E3P A;  4DR3 L;  4YCW A;  4LFA L;  3M4Q A;  4GLA C;  3U4V A;  4DV1 L;  5FLM G;  1XMQ L;  1IL2 A;  4DKA C;  1K9M C;  5LMN L;  4A76 A;  4BBS G;  3TQY A;  1EYG A;  5C0X I;  3I56 A;  3OYY A;  1XPR A;  4B3S Q;  4NXN Q;  1RIP A;  2NN6 G;  4A3D G;  1SN8 A;  1VQH A;  4JBW A;  1UEB A;  4Y7N H;  2UXB Q;  1QVC A;  3CW2 C;  4O2D A;  1ASZ A;  1GVP A;  3HOX G;  1LYL A;  4YCV A;  1UE1 A;  3S14 H;  4BA2 I;  4JV5 L;  1VQA A;  2AHO B;  2WB1 E;  3B6Y A;  1I3Q H;  3L7Z C;  5DLQ E;  4R4I A;  1SLJ A;  5IP9 H;  3UDX A;  1PH7 A;  4LUV A;  4JI2 L;  3M4O H;  3CCJ A;  1CKO A;  1WCM H;  5FJ8 G;  2JJQ A;  4KI0 A;  4APV A;  2VUM G;  1L0W A;  3FP9 A;  2UU9 Q;  1VQE A;  4GLV B;  1YIJ A;  4P75 A;  5GAE C;  2WB1 G;  4JI0 L;  1VQ8 A;  4LF6 Q;  1K0R A;  3CC4 A;  3KJP A;  3J81 j;  5M5Y H;  5IT9 c;  5EAY A;  4GNX B;  4QL5 A;  2B63 G;  3FHW A;  3PF5 A;  4B3S L;  2Z6K A;  1YBY A;  1VQJ A;  4NXN L;  1MJE A;  1VQ7 A;  2R92 G;  1NBW A;  2UXB L;  2R7F A;  1T9H A;  5C3E H;  1SE8 A;  4GNX A;  4GKJ L;  2JA7 H;  2CCZ A;  2YYZ A;  3UDG A;  1R9T H;  4EQ5 A;  2OWO A;  1Y1V G;  2ATW A;  1Z47 A;  1NTG A;  2OCE A;  4DV4 Q;  2I5H A;  1CSQ A;  1YVC A;  1JB7 A;  2K14 A;  3CD6 A;  1SRU A;  4LUO A;  2WFW A;  4MTN A;  1X54 A;  3I4M H;  2LSS A;  4LF8 L;  3S24 A;  4BBR H;  4YY3 Q;  4LUZ A;  3SGI A;  5C0X G;  5C0X J;  3TS0 A;  1JT8 A;  3K80 C;  1PH3 A;  4DV5 Q;  1UE7 A;  4R4O A;  1K83 H;  4HJ7 A;  1XMO Q;  1EUJ A;  5IYB H;  3CCV A;  3AEV A;  3GTG H;  4BY1 G;  1Q1B A;  1BBW A;  1AE3 A;  4DR4 L;  2UUA Q;  1LTL A;  4A3C H;  1VQ6 A;  1VQD A;  4AQY Q;  2UXC L;  1G29 1;  4MZ9 A;  1J6Q A;  4X64 Q;  1KXL A;  1Q82 C;  1YI2 A;  3ZJY C;  1KRS A;  1X3G A;  1MJC A;  2JA5 G;  2BA0 A;  4DV4 L;  4PG3 A;  2VQE L;  1I94 Q;  3NBH B;  4JBM A;  4BY7 G;  1WJJ A;  2PMZ E;  1HNW Q;  2KEN A;  2C35 B;  2I5L X;  4UP9 A;  1W2B A;  2A1A A;  3HOU H;  3CMA A;  2N78 A;  3H3V I;  3S17 H;  3PUV A;  5M5W H;  5M3M G;  3JC6 6;  4OON A;  4YY3 L;  1X3E A;  2MO1 A;  1NMG A;  3CF5 A;  2ZTE A;  3L2P A;  4HIM A;  4YHH L;  2JK8 A;  2KBN A;  4X66 L;  1PA6 A;  4JI3 Q;  3ULP A;  4IO9 A;  1Q8K A;  2ZJR A;  2CFM A;  2VZA A;  1V9P A;  1WYD A;  4A3F H;  3PO3 H;  1HH2 P;  2KCM A;  2NN6 I;  5IYD H;  4B3R Q;  1N34 Q;  2F52 A;  1PYB A;  4AQY L;  3S2H H;  1UWV A;  1H95 A;  2K52 A;  2VS1 A;  3FKI G;  3UE1 A;  4HIK A;  4A75 A;  1PH1 A;  3KF8 B;  1YHQ A;  3RLO A;  4IOA A;  1FGU A;  2R7D A;  1Q46 A;  1D8L A;  4KLK A;  4R4Q A;  3KJO A;  1KD1 C;  3K7U C;  4YWL A;  4A3K G;  1HNW L;  2NVT H;  3RLN A;  3KYH C;  1HNX Q;  3GTQ H;  2RHS B;  5IYC G;  4A3B H;  1GKH A;  4KHP Q;  1EIF A;  3ERS X;  3KOJ A;  3CPW A;  5LMU L;  2AWN A;  3PF4 A;  3D31 A;  1SR3 A;  2I0Q A;  3S1R H;  1QZG A;  2ASB A;  5IP9 G;  2I5M X;  4A3I H;  1HR0 L;  1WCM G;  1YEZ A;  5IWA L;  5GAD C;  1VQI A;  4DAM A;  3W1G A;  1XTD A;  3S16 H;  2EIF A;  4B3R L;  4X6A H;  1N34 L;  3T1H Q;  4LFB Q;  1N8R C;  3T1Y Q;  1OXT A;  3PIP A;  4TVA B;  3KDF B;  1TXY A;  3D0F A;  3NEN A;  4UP7 A;  1DGS A;  1UE6 A;  5AJ3 L;  1P8L A;  2JEB I;  3GD7 A;  3HKS A;  1SFO H;  4KHZ A;  1PH5 A;  3J80 i;  2KHJ A;  1PVO A;  4IPG A;  4DV7 Q;  5C3E G;  2N3S A;  2JA8 G;  3PUZ A;  2IX0 A;  3MXN B;  1K3R A;  3PCO B;  2ES2 A;  1TWG H;  2JA7 G;  4HJA A;  1YHA A;  2UUB Q;  2GN5 A;  3PUX A;  3CCM A;  4JI5 Q;  4A3J H;  1S3O A;  3EBE A;  2MO0 A;  4DV3 Q;  4A3G H;  1EIY B;  4AYB E;  3GTJ H;  4LFB L;  3G48 A;  3T1Y L;  2IX1 A;  1N32 Q;  1KIX A;  2JEA I;  3NEM A;  4RG1 A;  3GTK H;  3I4O A;  1A62 A;  1YZ6 A;  2F3I A;  5GQO A;  4HJ9 A;  1KQS A;  4NXM Q;  5IYB G;  4NB3 A;  5H1S E;  1VS0 A;  1VQ9 A;  1IYJ B;  1KRT A;  4POF A;  1OXU A;  3RLF A;  4A3C G;  4IPH A;  4GKK Q;  1Q81 C;  1KL9 A;  1CUK A;  4TQU S;  2YTY A;  3U4Z A;  4AYB G;  2JE6 I;  4OWW B;  2YTV A;  4OXP A;  3HOW H;  2BA1 A;  3CCE A;  2UUB L;  3OW2 A;  3CC2 A;  1EWI A;  2QA4 A;  2K75 A;  1X3F A;  4UPA A;  4H02 A;  2H5X A;  4HIO A;  1IBM Q;  3CXC A;  3GTL H;  4UY8 C;  5JEA G;  4JCV E;  4O0A A;  5JEA J;  1PHJ A;  1J5E Q;  3HOU G;  1S72 A;  1OTC A;  3DM3 A;  3E9I A;  2F4V Q;  2R93 H;  1D7Q A;  4DUY Q;  4R4C A;  3S1M H;  1N32 L;  5E7N A;  3J80 c;  1XJV A;  4JC0 A;  1JJC B;  4L5Q A;  5IP7 H;  1VCI A;  4A3E H;  5FLX c;  1VQG A;  4XTC S;  4YWK A;  4LF4 Q;  4NXM L;  1JE5 A;  4PZ6 A;  4A3L H;  3AFQ A;  3VDY A;  4A3F G;  3PO3 G;  2CQO A;  3Q8D A;  4K0K Q;  2DGY A;  1VQB A;  1VQK A;  1BBU A;  4BA1 I;  2UU9 L;  4GKK L;  2RCN A;  2A19 A;  4A3M H;  4HID A;  1C7Y A;  3H15 A;  1B7Y B;  4AIM A;  4LF6 L;  2PQA B;  1VQL A;  5M5X H;  2E2I H;  4DK6 C;  5FLM H;  4OO1 G;  3UDI A;  1TWH H;  2JA9 A;  4JI6 Q;  4BXX H;  2CWA A;  2HIV A;  4QY7 A;  1YIT A;  4BBS H;  1J5E L;  2K5N A;  3M7N A;  5M3F H;  2F4V L;  1Y1W H;  4A3B G;  4DR6 Q;  5C4X H;  4DUY L;  1N9W A;  4C3J H;  5HGQ A;  4LFC Q;  3S15 H;  4GN3 B;  1HZC A;  1NJI C;  2FXQ A;  2VQF Q;  2MQH A;  4DR1 Q;  2NZH A;  3CCU A;  4LF4 L;  4JBJ A;  1WOC A;  3UDF A;  1EOV A;  5JJL A;  4OWX B;  3PSI A;  4IPD A;  1IBK Q;  4GN5 A;  1E1T A;  1NMF A;  1CKM A;  3ULL A;  2ALY B;  4DV2 Q;  3GTO H;  4QGU A;  2OTJ A;  3GTP H;  5JJI A;  4DV0 Q;  5C44 H;  1QZH A;  3HOY H;  1KAW A;  1Y14 B;  4DV5 L;  1P16 A;  4QIW E;  1VQC A;  3ER0 A;  3J7Z C;  1OXV A;  1XMO L;  1SRO A;  1I6H H;  1M90 C;  2OTL A;  5BR8 Q;  1X6O A;  4X62 Q;  4X65 Q;  2UUA L;  2A8V A;  1Q1E A;  3H0G H;  3STB C;  3F2B A;  1SMX A;  2NVX H;  5IY0 A;  4JI6 L;  2V1C C;  1PH9 A;  1L1O C;  2RF4 A;  2PI2 A;  4X64 L;  2HIX A;  4YWM A;  3G6E A;  4HJ8 A;  4DAY B;  1K8G A;  2NVQ H;  4DR6 L;  2B29 A;  1UE5 A;  1YHB A;  2JQO A;  4JI7 Q;  4LFC L;  2Z6K C;  4LW1 A;  1XNR Q;  4P72 A;  4A3J G;  3BJU A;  4P71 A;  1I94 L;  3PV0 A;  1K73 C;  3U58 A;  4DR1 L;  3PO2 H;  1XPO A;  3E0E A;  4A3G G;  2PI2 E;  4A93 H;  1KC8 C;  2WAQ E;  1PH8 A;  3A5Z B;  2IY5 B;  4JBK A;  3CCL A;  4JOI C;  1A8V A;  4JI1 Q;  5HY6 A;  3K0X A;  1S40 A;  4IJH A;  4OWT B;  2IHF A;  4DV0 L;  2OQ0 A;  4LNQ A;  3TRZ A;  2AKW B;  2LXK A;  4JI3 L;  3CME A;  3S2D H;  2Y0S G;  1FJG Q;  5BR8 L;  4X65 L;  2N8N A;  4X62 L;  2WAQ G;  3HOZ H;  4JYA Q;  4RMF A;  3PIO A;  1XNQ Q;  2HT1 A;  1VQF A;  1X65 A;  4DPG A;  5GAH C;  1HNZ Q;  4LFA Q;  4BY1 H;  3CP0 A;  3GTM H;  4JI7 L;  3HOV H;  1XNR L;  1TWC H;  5ELO A;  1EQR A;  1BKB A;  1NE3 A;  3IRB A;  4JG2 A;  4J15 A;  2CKZ B;  2EXD A;  1I5F A;  4DUZ Q;  3OTO Q;  3I4N H;  1HNX L;  3KDF A;  4IPC A;  1GD7 A;  3RN5 A;  2JA5 H;  4P73 A;  2R93 G;  4KHP L;  3GDE A;  1LUZ A;  1VQM A;  4IJL A;  2XTI A;  2DUD A;  2VY3 A;  3K81 C;  4YCU A;  3RZO H;  4QJF A;  1VQ4 A;  4GLX A;  4A3E G;  2CWP A;  3A74 A;  4B3T Q;  1RL2 A;  4DK3 C;  2EQS A;  1FJG L;  4A3L G;  4OO1 I;  4Y52 H;  1U5K A;  1JJG A;  5LMN W;  2RHQ B;  1IXR A;  3I4M G;  4DR5 Q;  5JJK A;  4OX9 Q;  4BBR G;  1XNQ L;  4GOP C;  3T1H L;  4JI2 Q;  2HQL A;  2QEX A;  4L5R C;  1N36 Q;  2K50 A;  1VQ5 A;  3RN2 A;  3CC7 A;  1O7I A;  1WFQ A;  2JA6 H;  5C4J H;  1HJP A;  3U50 C;  2KCT A;  2PNH A;  1PV4 A;  3FKI H;  4JI0 Q;  1CSP A;  2VNU D;  3I7F A;  4DUZ L;  4A4I A;  3OTO L;  4HJ5 A;  1CKN B;  1QVF A;  4BXX G;  3UE0 A;  4DV7 L;  2IT1 A;  1Q86 C;  4ME3 A;  5M3F G;  2E2J H;  1Y1W G;  1TWA H;  2E2H H;  4P74 A;  5C4X G;  4A3K H;  2UUC Q;  1M1K C;  1X9N A;  3MEF A;  4JI5 L;  1X55 A;  3CCQ A;  1CKN A;  4LWC A;  4DV6 Q;  2OQK A;  5IYC H;  4B3T L;  3F8T A;  3J7A 5;  4GKJ Q;  3EIV A;  4LF5 Q;  1I50 H;  4DV3 L;  1PH4 A;  1C0A A;  3A0J A;  2Z0S A;  2MFI A;  3I55 A;  4DR5 L;  2R7Z H;  4OX9 L;  1OXX K;  3HKZ E;  1E7Z A;  2ZJP A;  3CCR A;  1L1O B;  1YJW A;  4PMW A;  1N36 L;  5ELN A;  4POG A;  5C44 G;  4PZ7 A;  4LF7 Q;  3AQQ A;  1A0I A;  2WP8 J;  4LF8 Q;  3HOY G;  3JC6 3;  1W3S A;  3BZC A;  2NVY H;  3RNU A;  3CCS A;  3M85 A;  1YJ9 A;  1G6P A;  1IZ6 A;  4B3M Q;  1QVG A;  1MKH A;  1V1Q A;  3H0G G;  1L1O A;  5IYD G;  3PGZ A;  5K36 G;  3HKZ G;  3J81 i;  1PH2 A;  2Q2T A;  3G71 A;  1HZB A;  4XIG S;  1PH6 A;  2N49 A;  3KFU A;  2NZO A;  2K4K A;  4EX5 A;  2VL6 A;  3H3V H;  4DR7 Q;  4DR4 Q;  3KLW A;  2UUC L;  1EFW A;  4R4T A;  1AE2 A;  2R6G A;  4DV6 L;  2ZTD A;  2K5V A;  2JA8 H;  2B3G A;  1KHI A;  3RZD H;  3PUY A;  1IBM L;  1GM5 A;  3PO2 G;  4LF5 L;  4JOI A;  4JI4 Q;  1A63 A;  4UP8 A;  2PQA A;  3NEL A;  3S1Q H;  4C2M H;  1YJN A;  4A93 G;  1X56 A;  3S1N H;  4A3D H;  2VQE Q;  4FDB A;  1HZA A;  2Q2U A;  4LF7 L;  3W1B A;  3HOX H;  4L5T A;  1FVI A;  4A3I G;  4WJ3 M;  1EQQ A;  1QUQ B;  2XGT A;  3HOZ G;  4B3M L;  4QQB X;  4K0K L;  3JC6 2;  4YHH Q;  2ID0 A;  4IFD I;  4X66 Q;  1JMC A;  2BH8 A;  2ZM6 Q;  3M4P A;  2GVA A;  1HZ9 A;  1YNX A;  1K8A C;  5GRO A;  5FJ8 H;  1B70 B;  1L2F A;  4GN4 B;  3TS2 A;  1VQP A;  4R1J A;  1Q7Y C;  1GO3 E;  4DR7 L;  2VUM H;  2E5L Q;  1QUQ A;  2L15 A;  3HOV G;  2Q2H A;  4MNO A;  3L0O A;  1N33 Q;  3CPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...