3RMHA

Crystal structure of yeast telomere protein cdc13 ob4
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
130
structure length
127
Chain Sequence
QYEVVEDHNISQLNHLQHLTPKIYVLNVYIIDVEIVYDQEIRIKVVNELPLVGKYVPPVDILEVYITGKEEVQNFLGDEVLTMDIFTPLLNETSRLRVFQRPDRIIRWSPIECTIQELRLQRMFRLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Yeast Cdc13 OB4
publication title Analyses of Candida Cdc13 Orthologues Revealed a Novel OB Fold Dimer Arrangement, Dimerization-Assisted DNA Binding, and Substantial Structural Differences between Cdc13 and RPA70.
pubmed doi rcsb
source organism Candida glabrata
molecule tags Protein binding
total genus 31
structure length 127
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18233 Cdc13_OB4_dimer Cdc13 OB4 dimerization domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.810 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3rmhA00
3RMHA
chains in the Genus database with same CATH superfamily
5M3FG 1X56A 3RZDH 2MFIA 2DN8A 3HOVG 4RAUC 1QZHA 1PV4A 2B39A 4GKJL 5CV7A 2O4XA 2HIXA 4X62Q 1PYSB 4J8QA 4NP5A 4PNYA 5DEHA 1IBKL 5ELOA 3PUZA 4A3KG 1NAPA 5KRUA 4BXXH 1F9SA 3Q23A 3MZ5A 1TY0A 3KDFA 5KNCA 2JA7H 4OX9L 1XPUA 5IWAL 1AH9A 4JI4Q 3M4YA 3EROA 2LFNA 1NR4A 2IHEA 4K5VA 4LF4Q 1R9TH 1IHZA 5EKKA 2JA6H 1VQEA 1N34Q 1XNQQ 3K59A 1YHAA 4LAAA 1IZ6A 1TWAH 2J4XA 2K50A 2EDGA 3NELA 4JBJA 2KHIA 1JJ2A 5EPKA 1XTDA 2ZXRA 4KHVA 2K14A 3J7AV 2B8FA 2F0MA 1LT6D 3BDCA 3G6JB 1TS5A 1DGSA 1VQFA 1EOTA 1Q12A 5M3FB 4JI7Q 1HA6A 4LF9Q 1SRUA 1JE4A 4IN3A 1F9RA 1WTPA 4WORA 3HOVB 3LNNA 3GV6A 2E2IH 1FD7D 1ESRA 3KF6B 3FHWA 4DK6C 5LMNL 1FJGL 1YJ9A 1GUWA 3K6OA 1YNNC 4A3KB 2JJQA 4JI1L 1YI2A 4TKOB 1ILPA 2RSNA 3ERQA 3VYSA 1V1PB 3RNUA 2NVYH 3J7YW 1I4GA 1EIFA 5IGBA 1YVCA 4DV3L 1H9JA 1MBYA 1Y69U 5C0XJ 4FF2A 2K5WA 3A8IE 2ATWA 1I6HH 1ONLA 1MJEA 4BXXG 2EJGC 3NBHA 2QA4A 2R93H 1AN8A 4QCLA 2NVXB 4ZK9B 2CHBD 4HIMA 3CPWA 1EIYB 4WJWA 3K81C 1ZKOA 4F88A 2NVTB 1GVPA 2Y0SB 4DV0Q 4ZQ3A 3CF5A 1QUQA 3ONAB 4TRDA 2MJ8A 2E2DC 2F0HA 4B9WA 3E9HA 1G291 2HQEA 3HKZG 5DM73 4C3IH 2JA6G 5C6AA 4DV6Q 3J7ZC 1HFNA 4ILWA 4AQYL 1K83H 3EQLC 4OXPA 3PMFA 1LTAD 4NPSA 2RQXA 5TSSA 5J1ZA 2R7ZH 3G6EA 5C4HA 1MSGA 2HD3A 4RGMA 2OT2A 2UU9L 1GO3E 1C8CA 3GTKB 1I6VC 2B2YA 1K73C 3S2HB 2QEXA 3D4WA 1L2FA 3GTLH 1GOZA 5C0XI 2EZVA 1QCBD 3H15A 3RZDB 1SLJA 4WJ4A 2ZTEA 2A68C 5I6YA 5D3DA 4AH6A 2K33A 4KJNA 4DNRB 4ZKCB 2A73B 3A56A 4IUUA 1CKMA 1IW7C 5EGTA 3V05A 4LFBL 1B4OA 5C5MA 4BY7H 3I56A 2JA7B 1CQVA 4XT3B 5BN5A 4O1NA 4Q0FA 1U4LA 3IFDA 4QUCA 3CMAA 4I7ZC 1SNOA 2R7DA 4DU9A 5L37A 4LF7L 1D2BA 4UHVA 4BS9A 1H95A 1S5FD 4QB4A 4OONA 1BCPC 4Y7NH 1LM0A 3DWAA 3KFUA 4YY3L 4K8IA 4MN3A 4Q5VA 3HKZB 4NB3A 3E9IA 1R9TB 4GKKL 2JA6B 2GN5A 3PIO3 2A8VA 4A3BH 4YCWA 3HS0C 1R4QB 4DK0A 1YJNA 2E75C 1O7LA 3NP8A 1CI3M 4C1NI 4C3IG 1Y8OB 5HY6A 1L1OB 1P8LA 3OSOA 1EWHA 4H44C 4C3JH 5M3MH 4X62L 4DUYQ 3C1EA 2O5JC 1M1KC 4CKBA 1M4VA 2WAQG 1YNXA 4ZLTF 2R7ZG 2YV5A 1BBWA 4DV2L 2R3ZA 3FKIH 3A55A 5BR8Q 4DV5Q 1L0YB 3PF4A 1SYGA 4LF6Q 1JWUD 3WOFA 2E2IB 1PYBA 3PUYA 5IODA 4JV5L 3J81j 3TS2A 1K8MA 4JI4L 2E76C 2WAQE 3U4VA 1BO0A 2ZJQA 3BS1A 1NJIC 4ZKBB 1UAPA 3FDTA 4XTCS 2F3IA 1O78A 1PRTF 3I72A 1XNQL 2WFWA 1CK1A 1R4PB 2G9HD 2MO0A 3D6CA 3OMCA 3TS0A 4EVOA 1I6HB 3QJYA 2F0SA 3N52A 1I3QH 1YITA 4J15A 5D14A 2AHOB 4BY7G 4JI3L 3V2TA 3IRBA 1STYA 1SNCA 5JEAG 1BCPF 1TWHH 1EQRA 2E2JB 1I4XA 1SMYC 2CW0D 3MFYA 4L5TA 5EPJA 5IT9c 2QEJC 1SNQA 2F1MA 3HFZB 1PH7A 4C3IB 2I5LX 2L5TA 3CCMA 4A3BG 3SHLA 2K28A 3IL8A 4JI7L 4LF9L 1C7YA 4DR1Q 2D9UA 1K83B 3T16A 1EYDA 1X3EA 2F03A 1GUGA 2EYPA 2KOLA 4KY7A 1VQPA 1SJHD 2HCCA 4UAIA 1GUSA 2WAQB 2OCEA 2R7ZB 2Z6KA 1EY8A 3C3LA 1L1OA 4WJ3M 5I4DA 2RBMA 2WKDA 4LW1A 5M3MG 4C3JG 4AIMA 1EQVA 4A3CH 3W1BA 2WV6D 2RHSB 3D4DA 4HCEA 1II3A 2DY8A 3X3MA 3FKIG 4IQZA 1VQ8A 3K57A 4L5SA 2LSSA 1TS2A 4LK1C 4IUNA 3ER0A 2R92H 1V1OA 3VR4A 3STBD 4PMCA 4DV0L 1F77A 1Q8IA 1KLGD 3NPPA 4HTHA 5IOCA 1LT5D 4YWLA 1I4QA 5A2QL 4BY7B 1WI5A 4DV6L 4BA2I 3T4AC 3MXNA 1B9MA 3TP8A 4A3LH 3DMUA 1PTOD 4P75A 4PZ8A 2V4DA 1XPRA 2BA1A 4Y7NB 2Q2UA 3BVGA 2BH2A 1WTHA 5T1IA 1AP0A 4KKTA 2XVSA 4A3BB 5EBCA 2D0PA 3PUWA 3KLRA 1BVSA 3PCOB 1SNMA 4UP8A 1BXTA 1IKMA 1G8ZD 3A8JE 1Z6HA 1WVLA 1KAAA 3I73A 3GTJH 4JI2Q 3NE5B 4C3JB 5M3MB 1WTQA 1VF5C 2F0NA 4JOIA 4KK7A 2D2CC 1BOSA 3FKIB 1IL8A 2D5DA 3B6YA 3FP9A 1IYVA 2FMMA 1VQKA 2E2HH 5A2QE 1KC8C 4ZYSA 1GUOA 2K5NA 4CGYB 2XN9C 3FPPA 2DUDA 1PA6A 4JPBW 4LFCQ 3L9AX 1VQBA 1QNKA 1TIID 1HNXQ 2R92G 3CC4A 3BDLA 3HGBA 1C4QA 4KHZA 4P72A 1DYQA 1KXLA 1ENFA 4LNQA 3QG1A 2NN6I 5JAVA 3CCEA 2F0GA 1DXMA 3G7LA 2RDGA 4JI8Q 1XYIA 1N33Q 4IPGA 1TWHB 4A3LG 1JCKB 1YJWA 5FJ8H 4HAEA 4U673 4DUYL 1YNJC 1EY9A 4RGTA 2CVRA 4L6TB 1HJPA 2KCTA 5IYDH 3RUZA 4DV5L 5BR8L 3LGJA 4J1MA 4A3FH 1E2VA 3BZCA 1ET6A 1PFSA 1TT2A 1Q82C 1DONA 2XSCA 2NUCA 5HGQA 4IOAA 3CC7A 4LWCA 5ELCA 2A6EC 1I5FA 1SE4A 4TQUS 4IJLA 4DNIA 1A0IA 2FXQA 3E6ZX 4AYBE 2D0OA 4GOPC 3QR8A 2JYOA 1BUVT 1LV9A 1K0SA 2BE5D 2VUMH 4R8NA 1V1QA 3U9OA 1STEA 4DK3C 2MGSA 2R92B 1C9OA 3J81L 5NUCA 2PW5A 3VR3A 3DWQA 2SEBD 4ABNA 1K8OA 1T5EA 1XJVA 4KD4A 3CCRA 1PH4A 3E0JA 2NVQH 3I4LA 2H4OA 2F0OA 1PYWD 3J80c 3NHHA 4B3MQ 2NTSA 1X65A 2NZHA 1RHPA 2MQHA 4DR1L 2DNEA 5CBAE 5J39A 4IFDJ 5HGTA 2WACA 4JI6Q 2XWBB 5CORA 4DXFA 3PSIA 3TRZA 1BR9A 2IX0A 4KN7C 1AZQA 4KLKA 2HIVA 1GHKA 2BH8A 1SMXA 3LWUA 5FJ8G 3MXPA 4QIWB 4IUVA 3OHXC 2P5ZX 3S1RH 1A3TA 4HIOA 1VQ9A 4A75A 3F2CA 1EWCA 3OW7A 3H3VH 1D1KA 4F7XA 4A3FG 4L63B 1KABA 3GTJB 3ITPA 3H09A 3KLSX 3G4SA 2F4IA 4OIKA 4LUVA 2F0VA 2HUGA 1WD1A 4HJ9A 2ES2A 4EX5A 4B3SQ 1NR2A 1L0WA 2C5CA 2K1BA 1FNVA 3HKSA 2ALYB 5FLXc 3JC66 2F3VA 1S40A 3VYRA 4OHJA 4EQ5A 3V96A 1ZYRD 2EYHA 2E2HB 4ZRZA 1JWMD 3KDFB 1MKHA 4F87A 3BYYB 3LWEA 3BG3A 1XNRQ 1BBUA 1BF4A 2VUMG 1PH1A 3PGZA 4IURA 3HG9A 1B53A 4IFDI 3CRKC 3A8KE 4RMFA 1TS3A 3C46A 3BYTB 1DJRD 2L0CA 3LX0A 4DR5Q 1G6ZA 1A3VA 1FNWA 3P75A 2ENBA 2L11A 3U9SA 1Z7TA 3N6RA 2RVLA 2ZM6Q 2SDFA 4H7BA 1BBXC 3CCVA 2CW0C 4K2LA 4HSPA 1NUCA 3J7A5 2JA8H 4DR6Q 4JI2L 1AZPA 2NTTA 2PMZE 4XYQA 5FLMH 3RLFA 1O7YA 3ULPA 5EQ0A 5IP7H 1GUNA 1ICFB 1RL2A 4IJHA 1FVIA 4JK1C 4DN4M 1HQMC 1LLRD 4A3FB 3U50C 2VZAA 1NTGA 1B9NA 4X3TA 2CWPA 5I9OA 2AUJD 3S9WA 1KNEA 4LFCL 1UWVA 1SYCA 5I2YA 4GLXA 2B63H 3KUPA 4R4IA 3TREA 4GN4B 2NB0A 1N36L 4ME5A 3KYHC 1Q1EA 2K01A 4FYDA 2WP8J 2KVMA 2CCZA 2XRQD 5BN4A 2YU9H 1AW7A 4RHRA 3STBC 5JVH3 1Y8NB 1FL0A 2VUMB 3NBHB 2F0QA 4JI8L 2JP1A 3L2PA 1UE7A 1N33L 1VQCA 1PFNA 1IKLA 2K75A 3M4OH 1JQYD 2A19A 5CV8A 2MP1A 1X32A 2HDLA 5LL6X 2NVQB 5C4XH 1QUQB 2JE6I 2K5VA 1IBLQ 4LF8Q 4FF4A 1PXUA 2MUYA 1JB3A 1UUPA 3T1HQ 2DJGC 4YIJA 1A63A 5CV9A 3KLWA 3J81c 4FXGC 5CC4A 3S1MH 4APVA 4X65Q 2BOSA 1HTLD 4DV7Q 1ESFA 2K5QA 4BBRH 3CC2A 1OXVA 2JA8G 4PG3A 2L15A 3TEHB 1IYJB 2YTXA 2RDHA 2KEEA 1VQDA 1E24A 2F0TA 2A69D 3AFQA 4RGOS 5FLMG 5IP7G 2K05A 4HSVA 3GTMH 3S1RB 1D1IA 1K3BC 3QOLA 3UDFA 1KIXA 4JI5Q 2F0FA 3K7AH 1H9KA 3GQBA 2Q2TA 4XXEA 1GUTA 4OWWB 1F2YA 3F2UA 5GAHC 3K5LA 3SK8A 3KF8A 4LUZA 2PPBC 2B63G 3K8AA 3HEJA 3I8ZA 4B3ML 2NZOA 1IYUA 3OWFA 1VQ7A 1QOHA 2A6HC 1HUMA 2PI2E 4YWKA 4DR2Q 3A7LA 4JG2A 1SEBD 1ASZA 4ME3A 4JI6L 3A5ZB 1CHQD 1GD7A 2EYOA 1W2BA 5IT9L 2IHFA 2VB3X 4IUTA 1Y14B 1E7ZA 1HNWL 4DXGA 1CFMA 1JMCA 3SGIA 1G2TA 2RF4A 1E0BA 3F2BA 5E4WC 3H0GH 1AEXA 1EZ8A 1TQOA 2SNSA 5C4XG 1CZWA 1PLFA 2Z9HA 4K2KA 2E2JH 4G7OC 3SK4A 4MZ9A 3NK9A 4BA1I 4RHSA 2EJFC 2LS01 3CXCA 1E3PA 3GP7A 1PDQA 4FXKC 2JA8B 5E4XA 2VW9A 3BU2A 2E74C 3R2TA 3HOZH 4A3IH 3CQZH 2AMCB 2M9VA 3KOJA 4B3SL 1XPOA 2QCPX 4BBRG 1HQRD 3AMUA 3VA7A 1MGSA 1HCZA 4B3TL 2JXMB 3M7NA 4N8FA 3ULJA 2PZTA 2DY7A 1QVGA 1GJXA 3NQTA 4KHPQ 2NWGA 4GN3B 4PZ7A 4DGZA 2B63B 1VMCA 3F8TA 1CKNA 1FYCA 4U68A 4DR5L 1NMFA 4ZCKA 3P1HA 3VA5A 2NZ1D 2HHHQ 2Q2HA 3ERSX 3PUXA 1N9WA 1WCMG 2YU9B 2ZM6L 2JA9A 1UEAB 2PZWA 3M4QA 2K4KA 3M85A 2BDNA 2VL6A 2UXCQ 3SK6A 5CMDA 3VR2A 3M4OB 1PRTC 2QW7A 3PV0A 1A8VA 5JEAH 5IIFA 1EY0A 1I4PA 5C4XB 1PTOH 4A93H 1RIPA 1KL9A 1RF2D 3R2IA 3DM3A 5JJZA 5C44G 1B3AA 4ID6A 1EWIA 3CHBD 1SXTA 5AFWA 3H0GG 4L5RC 5FO7B 3WDNA 4JBMA 3S1MB 3NBIA 1KNAA 4BBRB 4EQNA 1STGA 1J6QA 2B2TC 4OELB 1JJCB 4KJOA 4OO1H 3D8GA 3KBGA 3HOZG 4A3IG 3GD7A 1AE2A 1I4RA 2JQOA 1K8GA 3GTGH 1PZKD 4M8AA 3GTMB 4R8IA 1L0XB 2KHSA 3PF5A 5KNBA 2LXKA 3MC0B 4YHHQ 1VS0A 2EE1A 3MVVA 3K7AB 1EQTA 2J0TD 2RA4A 3EJIA 1F2ZA 3CKIB 2PNRC 2PW7A 4GLVB 3SEBA 1NBWA 3FEWX 3G71A 4RKBA 1LT3D 2PI2A 3I91A 1EFWA 4NW2A 3HOUH 1D8LA 4MNOA 1HZAA 1V9PA 1IBLL 4LF8L 3PIP3 2VQFQ 1LYLA 2MHVA 3OW2A 5M5YH 3T1HL 4LUOA 4LF4L 1Q90A 2TMPA 5KGUA 3MXNB 3TP6A 1F2LA 1N34L 4X65L 4DV7L 1RODA 2EVBA 1GKHA 1RD9D 1DD2A 1Y8PB 1EY7A 5CV6A 1EY6A 1K0RA 4P74A 3RD4A 1ENAA 1HXYD 4YCVA 3HOWH 1NY4A 1LTLA 1JE5A 1TKWB 2BCOA 2PQEA 3TZUA 3RN5A 1HZCA 1YHBA 3L3OC 4P2CB 3H0GB 1VQ4A 2PO4A 3JAML 4A93G 4H02A 3IFTA 4V0BA 1SYEA 2IW3A 1PFBA 4JI5L 1RDPD 5IGEA 1EU4A 2E5LQ 1QJOA 4RG1A 4C3HG 4GOPA 1J8IA 3HOZB 4A3IB 3CQZB 4XT1B 3PIOA 2K5DA 1UEBA 5EAYA 2UUBQ 4CBVA 4ODGA 1S5DD 4HIDA 4OO1G 3PO2H 1NSNS 1HNZQ 3WOEA 3SK5A 1E1TA 4HR7B 3EVQA 5IYBH 4DR2L 3UE0A 1JJGA 1SJED 1SE2A 4JW0A 4NXMQ 3MA2B 1LTRD 3J80L 3RZOH 1PH5A 1ZXTA 5KEEA 2KENA 3I4OA 1ENCA 1G2SA 4DUZQ 3A54A 1Q1BA 1SYFA 2EXDA 4L8JA 3HOUG 1A2UA 4N9TA 2XTIA 2JK8A 2PQAA 5D65A 3EIVA 3CD6A 4CJ1B 4XQNA 2VNUD 3RN2A 4M1UB 2Q8IB 1JB7A 1PTOB 1TU2B 3QO2A 4A93B 1RKNA 2K5HA 3CRLC 3HOWG 2QGQA 5M5XB 2Q8RE 4GNXA 4TVAB 1X54A 5G3LF 5CV5A 2KHJA 4IPHA 4E6IA 2LMCB 4X64Q 1LUZA 4KHPL 1HR0Q 5FLXL 2L12A 3CCSA 1Q81C 2M2LA 3GTGB 3J80E 3NXWA 2ZT9C 1U0LA 4UDUC 2HHHL 4K14A 5FOBB 3D3RA 4Z9CB 2QF7A 5T1GA 3TBIB 2AUKA 4IOCA 3PO2G 1UNSA 1HHVA 3MTSA 3A5UA 4C2MH 1JWSD 3TP5A 1PVOA 2JSOA 2B2WC 2CH4W 1W3SA 2UXCL 2K6AA 3TN2A 1JORA 5IYBG 1DOLA 4C1NK 4CDDC 5JJLA 1B3QA 3RLNA 3HOUB 1G91A 4DAPA 5IY0A 1BNZA 3I4NH 4DV1Q 3M9BA 2ZXPA 1F9PA 5M5YB 1B70B 2N8NA 1A15A 2ZXOA 4BWGB 1SROA 2G5DA 1WTWA 4QL5A 1BQQT 1VCIA 4O2DA 4CDEC 4HMIA 3HOWB 5FLXE 1LT4D 5J3BA 1DOKA 2JA5G 5DM63 4HJAA 4K0KQ 1YNND 1SNPA 1ILQA 4NXNQ 3MXGA 1M90C 1J5EQ 1V8QA 4K6DA 3HOXH 2IJ0A 1K3RA 1B8AA 2G9DA 1P16A 4P73A 1I50H 2QDBA 1Q46A 1IBKQ 2JN4A 3DHQA 4XQQA 4LF6L 4G7ZC 4Y52H 4AYBG 3UE1A 4C56C 3JAMc 1IBMQ 3PO2B 1U4MA 4JBKA 5FO9B 2LKVA 4IUQA 2F0JA 3OYYA 2FINB 4ULLA 2X6LA 4UY8C 4J6HA 4X6AH 2R61A 1KRSA 2CWAA 2I0QA 3RR5A 1QE6A 1ML0D 1KQSA 4FF3A 4OL7A 3RZOB 4RCNA 1EFID 1HR0W 3AB9A 4G4KA 3H6MA 5ISRA 3K5MA 4GN5A 1Z47A 1EIGA 4F8MA 4RH6A 3FRPB 4OEMB 4JYAQ 1XTCD 2BDOA 4XIGS 3I4NG 3Q24A 1HUNA 1N32Q 2D62A 2V1CC 3CU7A 4I65A 3TQYA 2E5LL 3HOYH 4XDXA 5BN3A 1NNXA 5I9PA 3M4PA 2OEOA 2H1EA 3W5OA 2UUBL 1U4PA 1QNUA 2EPBA 5I2XA 2B2UC 3R3OA 4DR3Q 4XQJA 2IL8A 1QB5D 3A74A 3AU7A 3H3VI 1SNDA 2A68D 1HNZL 3D6WA 3GTPH 3QIAA 3I4MH 2WINB 1VQJA 1PH8A 5CBEE 2X6GA 1L1OC 4RWSC 5ELFA 3UDGA 4HIKA 3VYTA 2B8GA 1QILA 1X3FA 3HOXG 2Z0SA 4AYBB 3Q8DA 1D5MC 4NXML 3ULLA 3PO3H 3R93A 4IPCA 1D7QA 3M3YH 2AWNA 3P7JA 4DV3Q 3VDYA 5K36H 3EFXD 3S1QH 4PQXA 3W1GA 4DUZL 4DV4Q 3S17H 2Z4IA 2EIFA 5HURA 1TS4A 4CKEA 3J81E 3J7AF 3W3AA 4C2MB 1WOCA 4DAYA 1S5BD 1O7ZA 2EY5A 2PCFB 1HH2P 1T5XD 2R7FA 3MEFA 1SN8A 2NN6G 4FP5D 2IPKD 1BDOA 1LTID 1U9RA 3I4NB 1QG7A 2IX1A 3G48A 4ALPA 4FNFA 4A3JH 2H5XA 3VYUA 4IALA 5CYUA 2FFKB 1VMPA 4X64L 4WRDA 5EKLA 1EYAA 1VQIA 3TMEA 1HR0L 4FO2A 2I46A 3BVZA 4YCUA 3TSSA 4LJZC 4LFAQ 4DAMA 3URYA 3HOYG 2UU9Q 1PH2A 4I7AA 5LL6S 3UI2A 1VQOA 2HDMA 1CZGA 4QF4A 4NKLA 4DR4Q 5J22A 3HOXB 2EOTA 1QWYA 2XIWA 4GS3A 2VS1A 1SBBB 4R4QA 2UUCQ 3CAMA 3C1FA 3SVMA 3I4MG 1MJCA 3Q6SA 2KJXA 4KY6A 1I50B 4JC0A 1WTOA 2NYZD 2CKZB 4JBWA 3PO3G 2F0IA 4XYOA 3I3CA 2KUMA 3BVMA 4IFDH 3FMCA 4QGUA 1EEID 3KF8B 4RCOA 5DAUA 5K36G 4IPDA 4X3UA 4DV1L 3UDIA 1HRJA 3RMHA 4H13C 1SMYD 1HNXL 1H9MA 1TWCH 3QB3A 5IGDA 4LF7Q 2EYJA 1IL2A 3RLOA 2UUAQ 2FMCA 3J80i 4KD3A 4ZAIA 5GAGC 2YYZA 4K5XA 4FDBA 4GKKQ 1TWFH 4K8JA 1KDCA 2UXDQ 4FVMA 1K9MC 1Q8KA 4A3GH 2B2TA 3U58A 3Q0AA 1PZID 4K0KL 4A3EH 2PMZB 1VQHA 3PUVA 4IUPA 4HJ7A 4OWXB 3W2DA 2HQLA 4RA8A 4NXNL 1J5EL 2MO1A 5CR3A 1PTOC 3T56B 1LO5D 2WB1G 2F52A 2L55A 4A3JG 3BJUA 3HOYB 2IY5B 4NDXA 4RFBA 3MHBA 2OWOA 4DV2Q 4A3MH 1MSHA 1STBA 4PV1C 4UP7A 3T53B 5AJ3Q 1O80A 1CKOA 4B9XA 1IBML 5M5WB 3GTPB 2WB1E 2XNAC 4JVZA 3I4MB 4JV5Q 1MIUA 1SR3A 1O7IA 2ICEC 1WFQA 1I4HA 1XMOQ 1C48A 2VQEQ 3PO3B 1A62A 3OWEB 4UPAA 2O2LD 3M3YB 1NE3A 5GQOA 4HJ8A 2CH4A 1CKNB 3S1QB 2Y0SG 3NENA 1TY2A 5C4JH 3PQIA 3S17B 1VQNA 4KMUC 3T51B 4JI0Q 4IFDG 1DCZA 1X55A 2B2VC 4JI3Q 4JYAL 3QWNA 3GTQB 1A3UA 1WCMH 4X3KA 1N32L 4N9PA 1NCVA 5F2DA 1DOMA 1LTGD 3FPUB 3L0OA 2RSOA 1YEZA 4K5WA 3S2DH 1PH3A 1JOOA 4YWMA 2DJFC 2Y0SE 1JOKA 1H9SA 3DUZA 4DR3L 4KY5A 5JVG3 4DAVA 2NBFA 1EY4A 4EGVA 2OF1A 2GVAA 4KN4C 5JEAJ 5H1SE 2WB1B 4A3GG 4A3JB 3NEMA 3EBEA 1D5XC 1PTOF 5C44H 4A3EG 1CQFA 1UE5A 1E1OA 4H0LC 3KLSA 4FXDA 1UE6A 3CCLA 5C3WA 1VQMA 3H91A 4DA2A 3NWSA 2RDFA 2K04A 1TXYA 5E7NA 4ZUJA 1EY5A 1WD0A 1DZ1A 1A2TA 2EXZA 1M8AA 2SNMA 3SDZA 2ICIA 2CQAA 4DV4L 4A3MG 2ID0A 3OIPA 3K80C 1SAPA 2N49A 5CV4A 3BDOA 2JA7G 1G6PA 1PH6A 5GADC 4TSSA 3P20A 2GVBA 2TSSA 2XWJB 1RCVD 2F0DA 4CJ0B 5EBDA 1U4RA 2FJ2A 4A3DH 1XNRL 2RHQB 4POFA 1BKBA 1YNJD 4FF1A 2EY2A 5IT9E 1XWEA 1TWCB 1VQGA 5IGGA 2BE5C 2OQ0A 3CMEA 2OQKA 3OTOQ 1E22A 1STHA 3GV3A 1ICWA 2EJMA 2PZUA 2KBNA 1TWFB 2IX3A 4LFAL 3HKZE 1CM9A 1Q7YC 1KDAA 3CP0A 3EA6A 2QILA 3J81i 4HJ5A 4A3GB 1FGUA 4QQBX 4B3RQ 2EYLA 1E2WA 2MNAA 4DR6L 5A35A 4A3EB 1JICA 2A6ED 5KNDA 2MPMA 2EQSA 4DR4L 4OO1I 5D3IB 5GROA 2UUCL 3ND8A 4HEDA 1EOVA 1I94Q 1HA5A 4GOPB 2AQ3B 1FGBD 5M5XH 2WIIB 1X3PA 3KF6A 2F0WA 4C3HH 4R9WA 1CA6A 2B2WA 1B50A 4A3MB 3KJPA 3S24A 1E2ZA 1OO9B 2HCIA 2QDLA 3S15H 2CFMA 5C0XH 1V1PA 1PZJD 3BZKA 1K8AC 4HMJA 3F2DA 4PMWA 4LMQD 1SYDA 3I70A 5C3XA 1VQ5A 2R93G 2UUAL 2B3GA 1EIHA 2L1BA 3R8BA 4MIUA 1EYGA 5DNFA 2UXBQ 3HZXA 2UXDL 2ZJPA 1K28A 2IWHA 1JT8A 2A5HA 1Y1VH 1QZGA 1ZYRC 5C4JB 2F0UA 4UP9A 1TWAB 3ZYYX 4A3DG 2AQ2B 1KRTA 1SE3A 4KTAA 2VB2X 3A7AB 1SSOA 1WCMB 2KQ3A 1F9QA 4P71A 1VQAA 2PQAB 3S2DB 3CCQA 3NTHA 3NTKA 2EYMA 2XRSD 5AJ3L 1SDFA 3I2ZA 4GNXB 1JR0D 4BY1H 4CKCA 5C44B 5LHY1 4QJFA 3X3NA 1KAWA 1W6JA 1S5CD 3M7GA 3O13A 2F4VQ 1XMOL 1CSQA 4POGA 2VQEL 2PNHA 2LY7A 2YTYA 2Q8TA 1T9HA 2HT1A 2NVYB 4OGQC 4R4CA 4V190 5ELEA 1JC7A 2JEAI 1EL0A 1IXRA 1V43A 1LTBD 3MEHA 4G7HC 4JI0L 2R93B 1KTKA 5EJWA 2IT1A 5C0XG 2X69A 3VR6A 3ICEA 1VQLA 2E8GA 2ZJRA 1XMQQ 1DM0B 3IKJA 1AE3A 4MTKA 2ASBA 1CHPD 4R4TA 1ZEQX 4A3DB 1TWGH 1Y1VG 3DWPA 2B2UA 4K6LA 1Q86C 1KD1C 3MXUA 4WFN3 1WTRA 2SOBA 1N8RC 1S72A 3K7UC 1PFMA 4MHEA 3IAYA 2L9HA 2PYKA 1OTCA 3CW2C 4HCSA 3T1YQ 4PZ6A 1MHWC 3JAME 3NWTA 3PIPA 1RTNA 4DR7Q 1OXTA 3E5SA 4LF5Q 3OIQA 5I6WA 1X9NA 2JA5H 3GTLB 1VQ6A 4EQOA 3SR1A 2KEDA 2F0KA 4BY1G 3NSWA 1B1ZA 3I7FA 4C3HB 1VF7A 2JEBI 1GM5A 2A69C 5C3EH 1CTMA 2A74C 3S15B 2AWOA 3OPOA 3MFGA 2B2YC 4DFAA 2ZTDA 3S14H 1SYBA 4X66Q 3H3VC 3MAQA 1GHJA 2F0PA 3OTOL 5C5LA 2EY1A 1SE8A 3K5NA 1OXUA 3NUCA 4OIJA 4CHTB 1Q3LA 1NMGA 2A1AA 1X3GA 3NQIA 4MTNA 1VDZA 5JPMC 4KKUA 1CUKA 1LACA 4G57A 1Y1WH 1Y1VB 5LMUQ 2RKSA 4CDFC 5KIXA 5IGFA 4B3RL 1EU3A 2R6GA 1SFOH 5IYCH 1OXXK 2K7VA 1WJJA 4PMBA 3U4ZA 4S3SA 3E3XA 2DNCA 1I94L 1TR5A 1X6OA 1WYDA 1HFGA 3K0YA 4CDCC 3KJOA 4KV6A 2AKWB 1CSPA 2Q2IA 5IP9H 4OWTB 4A3CG 1B7YB 1HZ9A 1RTOA 4BY1B 3DEOA 1MD2D 5FK9C 1KLUD 2Z6BA 1H9RA 1MI2A 2DGYA 2N3SA 1W6KA 3S16H 4BBSH 2I5HA 1YHQA 2A6HD 1D6EC 4YHHL 2UXBL 1N36Q 4GKJQ 1PMRA 2M00A 3QOJA 5DLQE 5ELBA 5C4ZA 1CA5A 3DM1A 5C3EG 1I3QB 4O42A 4RKLA 3K0XA 4DAYB 5KYLA 4OX9Q 2VQFL 3ND9A 5IWAQ 4DKAC 4DK1A 1HPCA 5KYIA 2ZTCA 3KBXA 2NN6H 3S1NH 4DNTB 3K5OA 3AYHB 1Y1WG 2KCMA 1WTVA 1TWGB 1A6XA 4X3SA 5JPNC 3CCUA 4A76A 1KDBA 1FR3A 2KA7A 1FNUA 2K52A 1U5KA 3GTOH 3KK7A 5IYCG 3Q22A 2F4VL 4ZUIA 5IE8A 3D31A 2GA4B 1J9OA 3C2PA 1HTPA 2C9OA 4GLAC 2VXWA 4QIWE 2XGTA 2OTJA 1EZ6A 2F0EA 1KHIA 3E0EA 1X3QA 4IZ8A 5EPLA 2JA5B 4R4OA 4N8X1 5IP9G 3D4RA 4QMGA 5K5PA 1QVFA 2LXJA 1ASYA 2N78A 3I90A 4B08A 1EUJA 2B2VA 5M5WH 2RCNA 5CGKA 2Z6KC 1XMQL 2KCCA 5LMNQ 4BBSG 1FJGQ 3T13A 1C0AA 1IW7D 3CPFA 5JOBA 5C3EB 2J7ZA 3EN2A 1PRTB 1XXGA 2KECA 1PRTD 4JI1Q 1UE1A 3AFPA 1Z9FA 1CT1D 2BA0A 3S14B 4A4IA 3VR5A 4GZYC 3TDQA 1QVCA 2N55A 1LABA 1BCPB 1TVXA 3SXHA 1BCPD 1HNWQ 5M9OA 3CCJA 3T1YL 5JJIA 2RCFA 1Y1WB 4R1JA 4IO9A 3GTQH 2Z8LA 1S5ED 4DR7L 2OXPA 1F2MA 1B44D 3ZJYC 1XX8A 3AEVA 1D5ZC 2OTLA 4LF5L 1JOQA 4RGNA 1OXSC 3NTIA 2Z1CA 1SFOB 3I55A 5IYDG 1S3OA 5E3FA 1STAA 4O0AA 3HRZC 1AFPA 5FO8B 4CJ2C 2QKIC 3OOCA 5M3FH 2B29A 1B2TA 4KI0A 3F1ZA 4AQYQ 3DXJC 3HOVH 4DPGA 5FKAC 4EQPA 4QY7A 5IGCA 2AQ1B 4GNXC 2FHTA 1EQQA 2EYFA 4B3TQ 2F3WA 2Z4HA 1S4ZA 4A3KH 1LTSD 5COYA 3WWVA 5ELDA 4X66L 2KCNA 2O5IC 3JAMi 4DF7A 3UDXA 3HP3A 2YTVA 3TP7A 3BZDB 3S16B 4BBSB 2F0LA 2K03A 2L4NA 3OMGA 5E1FA 3GDEA 2NVXH 3TZDA 2K32A 4JOIC 2C35B 5LMUL 1RJTA 3DEPA 2VY3A 2EY6A 2CQOA 1WTXA 2NVTH 5JJKA 1YZ6A 4KKSA 5GAEC 4JCVE 4LFBQ 2I07B 4QUFA 4HN7A 2WKCA 1LTTD 5EKIA 1YIJA 3SE0A 5G3LD 1YBYA 3GO5A 3H94A 1H9SB 3S1NB 3D0FA 1HZBA 4NMZA 3K58A 3FVQA 4YY3Q 5LMNW 3MWYW 3A0JA 1ET9A 1PHJA 1GXDC 2I5MX 5ELNA 1EEFD 3GTOB 3GTKH 1EYCA 1PH9A 3S2HH 1STNA 4L5QA 3AQQA 3L7ZC 1G51A 2N88A 3DLLA
chains in the Genus database with same CATH topology
2DN8A 4RAUC 2B39A 5CV7A 2O4XA 4J8QA 4NP5A 4PNYA 5DEHA 3PUZA 1NAPA 5KRUA 1F9SA 3Q23A 3MZ5A 1TY0A 5KNCA 3M4YA 3EROA 2LFNA 1NR4A 4K5VA 1IHZA 5EKKA 3K59A 4LAAA 2J4XA 2EDGA 5EPKA 2ZXRA 4KHVA 3J7AV 2B8FA 2F0MA 1LT6D 3BDCA 3G6JB 1TS5A 1EOTA 1Q12A 5M3FB 1HA6A 1JE4A 4IN3A 1F9RA 1WTPA 4WORA 3HOVB 3LNNA 3GV6A 1FD7D 1ESRA 1GUWA 3K6OA 1YNNC 4A3KB 4TKOB 1ILPA 2RSNA 3ERQA 3VYSA 1V1PB 3J7YW 1I4GA 5IGBA 1H9JA 1MBYA 1Y69U 5C0XJ 4FF2A 2K5WA 3A8IE 1ONLA 2EJGC 3NBHA 1AN8A 4QCLA 2NVXB 4ZK9B 2CHBD 4WJWA 1ZKOA 4F88A 2NVTB 2Y0SB 4ZQ3A 3ONAB 4TRDA 2MJ8A 2E2DC 2F0HA 4B9WA 1G291 2HQEA 5DM73 5C6AA 1HFNA 4ILWA 3EQLC 3PMFA 1LTAD 2RQXA 5TSSA 5J1ZA 5C4HA 1MSGA 4RGMA 2OT2A 1C8CA 3GTKB 1I6VC 2B2YA 3S2HB 3D4WA 1GOZA 5C0XI 2EZVA 1QCBD 3RZDB 2A68C 5I6YA 5D3DA 2K33A 4KJNA 4DNRB 4ZKCB 2A73B 3A56A 4IUUA 1IW7C 5EGTA 3V05A 1B4OA 5C5MA 2JA7B 1CQVA 4XT3B 5BN5A 4O1NA 4Q0FA 1U4LA 3IFDA 4QUCA 4I7ZC 1SNOA 4DU9A 1D2BA 4BS9A 1S5FD 4QB4A 1BCPC 3DWAA 4K8IA 4MN3A 4Q5VA 3HKZB 1R9TB 2JA6B 3PIO3 3HS0C 1R4QB 4DK0A 2E75C 1O7LA 3NP8A 1CI3M 4C1NI 4C3IG 1Y8OB 3OSOA 1EWHA 4H44C 3C1EA 2O5JC 4CKBA 1M4VA 4ZLTF 2R3ZA 3A55A 1L0YB 1SYGA 1JWUD 3WOFA 2E2IB 3PUYA 5IODA 1K8MA 2E76C 1BO0A 3BS1A 4ZKBB 1UAPA 3FDTA 4XTCS 1O78A 1PRTF 3I72A 1CK1A 1R4PB 2G9HD 3D6CA 3OMCA 1I6HB 4EVOA 3QJYA 2F0SA 3N52A 5D14A 3V2TA 1STYA 1SNCA 5JEAG 1BCPF 2E2JB 1I4XA 1SMYC 2CW0D 3MFYA 5EPJA 2QEJC 1SNQA 2F1MA 4C3IB 2L5TA 3SHLA 2K28A 3IL8A 2D9UA 1K83B 3T16A 1EYDA 2F03A 1GUGA 2EYPA 2KOLA 4KY7A 1SJHD 2HCCA 4UAIA 1GUSA 2WAQB 2R7ZB 1EY8A 3C3LA 5I4DA 2RBMA 2WKDA 4C3JG 1EQVA 2WV6D 3D4DA 4HCEA 1II3A 2DY8A 3X3MA 4IQZA 3K57A 1TS2A 4LK1C 4IUNA 1V1OA 3VR4A 4PMCA 1F77A 1Q8IA 1KLGD 3NPPA 4HTHA 5IOCA 1LT5D 1I4QA 5A2QL 4BY7B 4BA2I 3T4AC 3MXNA 1B9MA 3TP8A 3DMUA 1PTOD 2V4DA 2BA1A 4Y7NB 3BVGA 5T1IA 1AP0A 4KKTA 2XVSA 4A3BB 5EBCA 3PUWA 3KLRA 1SNMA 1BXTA 1IKMA 1G8ZD 3A8JE 1Z6HA 1WVLA 1KAAA 3I73A 3NE5B 4C3JB 5M3MB 1WTQA 1VF5C 2F0NA 4KK7A 2D2CC 1BOSA 3FKIB 1IL8A 2D5DA 1IYVA 2FMMA 5A2QE 4ZYSA 1GUOA 4CGYB 2XN9C 3FPPA 3L9AX 1QNKA 1TIID 3BDLA 3HGBA 1C4QA 4KHZA 1DYQA 1ENFA 3QG1A 2NN6I 5JAVA 2F0GA 1DXMA 3G7LA 2RDGA 1XYIA 1TWHB 1JCKB 4U673 4HAEA 1YNJC 1EY9A 4RGTA 2CVRA 4L6TB 3RUZA 4J1MA 1E2VA 1ET6A 1TT2A 1DONA 2XSCA 2NUCA 5ELCA 2A6EC 4TQUS 1SE4A 3E6ZX 2JYOA 1BUVT 1LV9A 2BE5D 4R8NA 3U9OA 1STEA 2MGSA 2R92B 3J81L 5NUCA 2PW5A 3VR3A 3DWQA 2SEBD 4ABNA 1K8OA 1T5EA 4KD4A 3E0JA 3I4LA 2H4OA 2F0OA 1PYWD 3NHHA 2NTSA 1RHPA 2DNEA 5CBAE 5J39A 4IFDJ 5HGTA 2WACA 2XWBB 5CORA 4DXFA 1BR9A 2IX0A 4KN7C 1AZQA 1GHKA 3LWUA 3MXPA 4QIWB 4IUVA 3OHXC 1A3TA 1EWCA 3OW7A 1D1KA 4F7XA 4L63B 1KABA 3GTJB 3ITPA 3H09A 3KLSX 2F4IA 4OIKA 2F0VA 2HUGA 1WD1A 1NR2A 2C5CA 2K1BA 1FNVA 2F3VA 3VYRA 4OHJA 3V96A 1ZYRD 2EYHA 2E2HB 4ZRZA 1JWMD 4F87A 3BYYB 3LWEA 3BG3A 1BF4A 4IURA 3HG9A 1B53A 4IFDI 3CRKC 3A8KE 1TS3A 3C46A 3BYTB 1DJRD 2L0CA 3LX0A 1G6ZA 1A3VA 1FNWA 3P75A 2ENBA 2L11A 3U9SA 1Z7TA 3N6RA 2RVLA 2SDFA 4H7BA 1BBXC 2CW0C 4K2LA 4HSPA 1NUCA 1AZPA 2NTTA 4XYQA 3RLFA 1O7YA 5EQ0A 1GUNA 4JK1C 4DN4M 1HQMC 1LLRD 4A3FB 1B9NA 4X3TA 5I9OA 2AUJD 3S9WA 1KNEA 1SYCA 5I2YA 3KUPA 2NB0A 4ME5A 1Q1EA 2K01A 4FYDA 2WP8J 2KVMA 2XRQD 5BN4A 1AW7A 4RHRA 5JVH3 1Y8NB 2VUMB 2F0QA 2JP1A 1PFNA 1IKLA 1JQYD 5CV8A 2MP1A 1X32A 2HDLA 5LL6X 2NVQB 2JE6I 4FF4A 1PXUA 2MUYA 1JB3A 1UUPA 4YIJA 5CV9A 4FXGC 5CC4A 2BOSA 1HTLD 1ESFA 2K5QA 1OXVA 2RDHA 2KEEA 2F0TA 2A69D 4RGOS 2K05A 4HSVA 3S1RB 1D1IA 3QOLA 2F0FA 1H9KA 3GQBA 4XXEA 1GUTA 1F2YA 3F2UA 3K5LA 3SK8A 3KF8A 2PPBC 3HEJA 3I8ZA 1IYUA 3OWFA 1QOHA 2A6HC 1HUMA 3A7LA 1SEBD 1CHQD 2EYOA 5IT9L 2VB3X 4IUTA 4DXGA 1CFMA 1G2TA 1E0BA 5E4WC 1AEXA 1EZ8A 1TQOA 2SNSA 1CZWA 1PLFA 4K2KA 4G7OC 3SK4A 3NK9A 4BA1I 4RHSA 2EJFC 2LS01 3GP7A 1PDQA 4FXKC 2JA8B 5E4XA 2E74C 3R2TA 2M9VA 2QCPX 1HQRD 3AMUA 3VA7A 1MGSA 1HCZA 2JXMB 3M7NA 2PZTA 2DY7A 1GJXA 3NQTA 2NWGA 4DGZA 2B63B 1VMCA 1FYCA 4U68A 3P1HA 3VA5A 2NZ1D 3PUXA 2YU9B 1UEAB 2PZWA 3M85A 2BDNA 3SK6A 5CMDA 3VR2A 3M4OB 1PRTC 3PV0A 5JEAH 5IIFA 1EY0A 1I4PA 5C4XB 1PTOH 1RF2D 3R2IA 5JJZA 1B3AA 4ID6A 3CHBD 1SXTA 5AFWA 5FO7B 3WDNA 3S1MB 3NBIA 1KNAA 4BBRB 4EQNA 1STGA 2B2TC 4OO1H 4KJOA 3D8GA 3KBGA 3GD7A 1I4RA 1PZKD 4M8AA 3GTMB 4R8IA 1L0XB 2KHSA 5KNBA 3MC0B 2EE1A 3MVVA 3K7AB 1EQTA 2J0TD 2RA4A 3EJIA 1F2ZA 3CKIB 2PNRC 2PW7A 3SEBA 3FEWX 4RKBA 1LT3D 3I91A 4NW2A 3PIP3 2MHVA 1Q90A 2TMPA 5KGUA 3TP6A 1F2LA 1RODA 2EVBA 1DD2A 1RD9D 1Y8PB 1EY7A 5CV6A 1EY6A 3RD4A 1ENAA 1HXYD 2PQEA 3TZUA 1TKWB 2BCOA 3L3OC 4P2CB 3H0GB 2PO4A 3JAML 3IFTA 4V0BA 1SYEA 2IW3A 1PFBA 1RDPD 5IGEA 1EU4A 1QJOA 4C3HG 1J8IA 3HOZB 4A3IB 3CQZB 4XT1B 2K5DA 4CBVA 4ODGA 1S5DD 4OO1G 1NSNS 3WOEA 3SK5A 4HR7B 3EVQA 1SJED 1SE2A 3MA2B 1LTRD 3J80L 1ZXTA 5KEEA 1ENCA 1G2SA 3A54A 1Q1BA 1SYFA 4L8JA 1A2UA 4N9TA 5D65A 4CJ1B 4XQNA 2VNUD 4M1UB 2Q8IB 1PTOB 1TU2B 3QO2A 4A93B 1RKNA 3CRLC 5M5XB 2Q8RE 5G3LF 5CV5A 4E6IA 2LMCB 5FLXL 2L12A 2M2LA 3GTGB 3J80E 3NXWA 2ZT9C 4UDUC 4K14A 5FOBB 3D3RA 4Z9CB 2QF7A 5T1GA 3TBIB 2AUKA 1UNSA 1HHVA 3MTSA 1JWSD 3TP5A 2JSOA 2B2WC 2K6AA 3TN2A 1JORA 1DOLA 4C1NK 3HOUB 1G91A 4DAPA 1BNZA 2ZXPA 1F9PA 5M5YB 1A15A 2ZXOA 4BWGB 1WTWA 1BQQT 1VCIA 4HMIA 3HOWB 5FLXE 1LT4D 1DOKA 5DM63 1YNND 1SNPA 1ILQA 3MXGA 1V8QA 4K6DA 2IJ0A 2G9DA 2QDBA 3DHQA 4XQQA 4G7ZC 4C56C 3PO2B 1U4MA 5FO9B 2LKVA 4IUQA 2F0JA 2FINB 4ULLA 2X6LA 4J6HA 2R61A 1QE6A 1ML0D 4FF3A 4OL7A 3RZOB 4RCNA 1EFID 3AB9A 4G4KA 3H6MA 5ISRA 3K5MA 1Z47A 1EIGA 4F8MA 4RH6A 3FRPB 1XTCD 2BDOA 4XIGS 3Q24A 1HUNA 2D62A 3CU7A 4I65A 4XDXA 5BN3A 5I9PA 2OEOA 2H1EA 1U4PA 1QNUA 2EPBA 5I2XA 2B2UC 3R3OA 4XQJA 2IL8A 1QB5D 3AU7A 1SNDA 2A68D 3D6WA 3QIAA 2WINB 5CBEE 2X6GA 4RWSC 5ELFA 3VYTA 2B8GA 1QILA 4AYBB 1D5MC 3R93A 2AWNA 3P7JA 5K36H 3EFXD 4PQXA 2Z4IA 5HURA 1TS4A 4CKEA 3J81E 3J7AF 3W3AA 4C2MB 4DAYA 1S5BD 1O7ZA 2EY5A 2PCFB 1T5XD 2NN6G 4FP5D 2IPKD 1BDOA 1LTID 1U9RA 3I4NB 1QG7A 2IX1A 4FNFA 3VYUA 4IALA 5CYUA 2FFKB 1VMPA 4WRDA 5EKLA 1EYAA 3TMEA 4FO2A 2I46A 3BVZA 3TSSA 4LJZC 3URYA 5LL6S 3UI2A 2HDMA 1CZGA 4QF4A 4NKLA 5J22A 3HOXB 2EOTA 1QWYA 2XIWA 1SBBB 3C1FA 3SVMA 3Q6SA 2KJXA 4KY6A 1I50B 1WTOA 2NYZD 4JBWA 2F0IA 4XYOA 3I3CA 2KUMA 3BVMA 4IFDH 3FMCA 1EEID 4RCOA 5DAUA 5K36G 4X3UA 1HRJA 3RMHA 4H13C 1SMYD 1H9MA 3QB3A 5IGDA 2EYJA 2FMCA 4KD3A 4ZAIA 2YYZA 4K5XA 4K8JA 1KDCA 4FVMA 2B2TA 3Q0AA 1PZID 2PMZB 3PUVA 4IUPA 3W2DA 4RA8A 3T56B 5CR3A 1PTOC 1LO5D 2L55A 3HOYB 4NDXA 4RFBA 3MHBA 1MSHA 3T53B 1STBA 4PV1C 4B9XA 1O80A 5M5WB 3GTPB 2XNAC 3I4MB 2ICEC 1I4HA 1C48A 3PO3B 3OWEB 2O2LD 3M3YB 3S1QB 1TY2A 3S17B 4KMUC 3T51B 4IFDG 1DCZA 2B2VC 3QWNA 3GTQB 1A3UA 4X3KA 4N9PA 1NCVA 5F2DA 1DOMA 1LTGD 3FPUB 2RSOA 4K5WA 1JOOA 1JOKA 1H9SA 3DUZA 4KY5A 5JVG3 4DAVA 2NBFA 1EY4A 4EGVA 2OF1A 4KN4C 5JEAJ 2WB1B 4A3JB 1D5XC 1PTOF 1CQFA 4H0LC 3KLSA 4FXDA 5C3WA 3H91A 4DA2A 3NWSA 2RDFA 2K04A 4ZUJA 1EY5A 1WD0A 1DZ1A 1A2TA 2EXZA 1M8AA 2SNMA 3SDZA 2ICIA 2CQAA 2ID0A 3OIPA 1SAPA 5CV4A 3BDOA 4TSSA 3P20A 2TSSA 2XWJB 1RCVD 2F0DA 4CJ0B 5EBDA 1U4RA 2FJ2A 1YNJD 4FF1A 2EY2A 5IT9E 1XWEA 1TWCB 5IGGA 2BE5C 1STHA 3GV3A 1ICWA 2EJMA 2PZUA 1TWFB 2IX3A 1CM9A 1KDAA 3EA6A 2QILA 4A3GB 2EYLA 1E2WA 5A35A 4A3EB 1JICA 2A6ED 5KNDA 2MPMA 4OO1I 5D3IB 3ND8A 4HEDA 1HA5A 2AQ3B 1FGBD 2WIIB 1X3PA 2F0WA 4R9WA 1CA6A 2B2WA 1B50A 4A3MB 1E2ZA 1OO9B 2HCIA 5C0XH 1V1PA 1PZJD 4HMJA 4PMWA 4LMQD 1SYDA 3I70A 5C3XA 1EIHA 2L1BA 3R8BA 4MIUA 5DNFA 3HZXA 2IWHA 2A5HA 1ZYRC 5C4JB 2F0UA 1TWAB 3ZYYX 2AQ2B 1SE3A 4KTAA 2VB2X 3A7AB 1SSOA 1WCMB 2KQ3A 1F9QA 3S2DB 3NTHA 3NTKA 2EYMA 2XRSD 1SDFA 1JR0D 4CKCA 5C44B 5LHY1 3X3NA 1W6JA 1S5CD 3M7GA 3O13A 2LY7A 2Q8TA 2NVYB 4OGQC 4V190 5ELEA 1JC7A 2JEAI 1EL0A 1V43A 1LTBD 3MEHA 4G7HC 2R93B 1KTKA 5EJWA 2IT1A 5C0XG 2X69A 3VR6A 1DM0B 3IKJA 1CHPD 1ZEQX 4A3DB 3DWPA 2B2UA 4K6LA 3MXUA 4WFN3 1WTRA 2SOBA 1PFMA 4MHEA 3IAYA 2L9HA 2PYKA 4HCSA 3JAME 3NWTA 1RTNA 1OXTA 3E5SA 3OIQA 5I6WA 3GTLB 4EQOA 3SR1A 2KEDA 2F0KA 3NSWA 1B1ZA 4C3HB 1VF7A 2JEBI 2A69C 1CTMA 2A74C 3S15B 2AWOA 3OPOA 3MFGA 2B2YC 4DFAA 1SYBA 3H3VC 3MAQA 1GHJA 2F0PA 5C5LA 2EY1A 3K5NA 1OXUA 3NUCA 4OIJA 4CHTB 1Q3LA 3NQIA 1VDZA 5JPMC 4KKUA 1LACA 4G57A 1Y1VB 2RKSA 5KIXA 5IGFA 1EU3A 2R6GA 1OXXK 2K7VA 4PMBA 4S3SA 2DNCA 1TR5A 1HFGA 3K0YA 4KV6A 1RTOA 4BY1B 3DEOA 1MD2D 5FK9C 1KLUD 1H9RA 1MI2A 1W6KA 2A6HD 1D6EC 1PMRA 2M00A 3QOJA 5ELBA 5C4ZA 1CA5A 3DM1A 1I3QB 4O42A 4RKLA 5KYLA 3ND9A 4DK1A 1HPCA 5KYIA 3KBXA 2NN6H 4DNTB 3K5OA 1WTVA 1TWGB 1A6XA 4X3SA 5JPNC 1KDBA 1FR3A 2KA7A 1FNUA 3KK7A 3Q22A 4ZUIA 3D31A 2GA4B 1J9OA 3C2PA 1HTPA 2C9OA 2VXWA 1EZ6A 2F0EA 1X3QA 4IZ8A 5EPLA 2JA5B 3D4RA 4QMGA 5K5PA 4B08A 3I90A 2B2VA 5CGKA 2KCCA 3T13A 1IW7D 5JOBA 5C3EB 2J7ZA 1PRTB 1XXGA 2KECA 1PRTD 1CT1D 2BA0A 3S14B 3VR5A 4GZYC 3TDQA 2N55A 1LABA 1BCPB 1TVXA 3SXHA 1BCPD 5M9OA 1Y1WB 2Z8LA 1S5ED 2OXPA 1F2MA 1B44D 1XX8A 1D5ZC 1JOQA 4RGNA 1OXSC 3NTIA 2Z1CA 1SFOB 5E3FA 1STAA 3HRZC 1AFPA 5FO8B 4CJ2C 2QKIC 3OOCA 1B2TA 4KI0A 3DXJC 5FKAC 4EQPA 5IGCA 2AQ1B 2FHTA 2EYFA 2F3WA 2Z4HA 1S4ZA 1LTSD 5COYA 5ELDA 2KCNA 2O5IC 4DF7A 3HP3A 3TP7A 3BZDB 3S16B 4BBSB 2F0LA 2K03A 2L4NA 3OMGA 5E1FA 3TZDA 2K32A 1RJTA 3DEPA 2EY6A 1WTXA 4KKSA 2I07B 4QUFA 4HN7A 2WKCA 1LTTD 5EKIA 3SE0A 5G3LD 3GO5A 3H94A 1H9SB 3S1NB 4NMZA 3K58A 3FVQA 3MWYW 1ET9A 1GXDC 1EEFD 3GTOB 1EYCA 1STNA 3L7ZC 2N88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RMH A; 
#chains in the Genus database with same CATH topology
 5M3F G;  1X56 A;  3RZD H;  2MFI A;  2DN8 A;  3HOV G;  4RAU C;  1QZH A;  1PV4 A;  2B39 A;  4GKJ L;  5CV7 A;  2O4X A;  2HIX A;  4X62 Q;  1PYS B;  4J8Q A;  4NP5 A;  4PNY A;  5DEH A;  1IBK L;  5ELO A;  3PUZ A;  4A3K G;  1NAP A;  5KRU A;  4BXX H;  1F9S A;  3Q23 A;  3MZ5 A;  1TY0 A;  3KDF A;  5KNC A;  2JA7 H;  4OX9 L;  1XPU A;  5IWA L;  1AH9 A;  4JI4 Q;  3M4Y A;  3ERO A;  2LFN A;  1NR4 A;  2IHE A;  4K5V A;  4LF4 Q;  1R9T H;  1IHZ A;  5EKK A;  2JA6 H;  1VQE A;  1N34 Q;  1XNQ Q;  3K59 A;  1YHA A;  4LAA A;  1IZ6 A;  1TWA H;  2J4X A;  2K50 A;  2EDG A;  3NEL A;  4JBJ A;  2KHI A;  1JJ2 A;  5EPK A;  1XTD A;  2ZXR A;  4KHV A;  2K14 A;  3J7A V;  2B8F A;  2F0M A;  1LT6 D;  3BDC A;  3G6J B;  1TS5 A;  1DGS A;  1VQF A;  1EOT A;  1Q12 A;  5M3F B;  4JI7 Q;  1HA6 A;  4LF9 Q;  1SRU A;  1JE4 A;  4IN3 A;  1F9R A;  1WTP A;  4WOR A;  3HOV B;  3LNN A;  3GV6 A;  2E2I H;  1FD7 D;  1ESR A;  3KF6 B;  3FHW A;  4DK6 C;  5LMN L;  1FJG L;  1YJ9 A;  1GUW A;  3K6O A;  1YNN C;  4A3K B;  2JJQ A;  4JI1 L;  1YI2 A;  4TKO B;  1ILP A;  2RSN A;  3ERQ A;  3VYS A;  1V1P B;  3RNU A;  2NVY H;  3J7Y W;  1I4G A;  1EIF A;  5IGB A;  1YVC A;  4DV3 L;  1H9J A;  1MBY A;  1Y69 U;  5C0X J;  4FF2 A;  2K5W A;  3A8I E;  2ATW A;  1I6H H;  1ONL A;  1MJE A;  4BXX G;  2EJG C;  3NBH A;  2QA4 A;  2R93 H;  1AN8 A;  4QCL A;  2NVX B;  4ZK9 B;  2CHB D;  4HIM A;  3CPW A;  1EIY B;  4WJW A;  3K81 C;  1ZKO A;  4F88 A;  2NVT B;  1GVP A;  2Y0S B;  4DV0 Q;  4ZQ3 A;  3CF5 A;  1QUQ A;  3ONA B;  4TRD A;  2MJ8 A;  2E2D C;  2F0H A;  4B9W A;  3E9H A;  1G29 1;  2HQE A;  3HKZ G;  5DM7 3;  4C3I H;  2JA6 G;  5C6A A;  4DV6 Q;  3J7Z C;  1HFN A;  4ILW A;  4AQY L;  1K83 H;  3EQL C;  4OXP A;  3PMF A;  1LTA D;  4NPS A;  2RQX A;  5TSS A;  5J1Z A;  2R7Z H;  3G6E A;  5C4H A;  1MSG A;  2HD3 A;  4RGM A;  2OT2 A;  2UU9 L;  1GO3 E;  1C8C A;  3GTK B;  1I6V C;  2B2Y A;  1K73 C;  3S2H B;  2QEX A;  3D4W A;  1L2F A;  3GTL H;  1GOZ A;  5C0X I;  2EZV A;  1QCB D;  3H15 A;  3RZD B;  1SLJ A;  4WJ4 A;  2ZTE A;  2A68 C;  5I6Y A;  5D3D A;  4AH6 A;  2K33 A;  4KJN A;  4DNR B;  4ZKC B;  2A73 B;  3A56 A;  4IUU A;  1CKM A;  1IW7 C;  5EGT A;  3V05 A;  4LFB L;  1B4O A;  5C5M A;  4BY7 H;  3I56 A;  2JA7 B;  1CQV A;  4XT3 B;  5BN5 A;  4O1N A;  4Q0F A;  1U4L A;  3IFD A;  4QUC A;  3CMA A;  4I7Z C;  1SNO A;  2R7D A;  4DU9 A;  5L37 A;  4LF7 L;  1D2B A;  4UHV A;  4BS9 A;  1H95 A;  1S5F D;  4QB4 A;  4OON A;  1BCP C;  4Y7N H;  1LM0 A;  3DWA A;  3KFU A;  4YY3 L;  4K8I A;  4MN3 A;  4Q5V A;  3HKZ B;  4NB3 A;  3E9I A;  1R9T B;  4GKK L;  2JA6 B;  2GN5 A;  3PIO 3;  2A8V A;  4A3B H;  4YCW A;  3HS0 C;  1R4Q B;  4DK0 A;  1YJN A;  2E75 C;  1O7L A;  3NP8 A;  1CI3 M;  4C1N I;  4C3I G;  1Y8O B;  5HY6 A;  1L1O B;  1P8L A;  3OSO A;  1EWH A;  4H44 C;  4C3J H;  5M3M H;  4X62 L;  4DUY Q;  3C1E A;  2O5J C;  1M1K C;  4CKB A;  1M4V A;  2WAQ G;  1YNX A;  4ZLT F;  2R7Z G;  2YV5 A;  1BBW A;  4DV2 L;  2R3Z A;  3FKI H;  3A55 A;  5BR8 Q;  4DV5 Q;  1L0Y B;  3PF4 A;  1SYG A;  4LF6 Q;  1JWU D;  3WOF A;  2E2I B;  1PYB A;  3PUY A;  5IOD A;  4JV5 L;  3J81 j;  3TS2 A;  1K8M A;  4JI4 L;  2E76 C;  2WAQ E;  3U4V A;  1BO0 A;  2ZJQ A;  3BS1 A;  1NJI C;  4ZKB B;  1UAP A;  3FDT A;  4XTC S;  2F3I A;  1O78 A;  1PRT F;  3I72 A;  1XNQ L;  2WFW A;  1CK1 A;  1R4P B;  2G9H D;  2MO0 A;  3D6C A;  3OMC A;  3TS0 A;  4EVO A;  1I6H B;  3QJY A;  2F0S A;  3N52 A;  1I3Q H;  1YIT A;  4J15 A;  5D14 A;  2AHO B;  4BY7 G;  4JI3 L;  3V2T A;  3IRB A;  1STY A;  1SNC A;  5JEA G;  1BCP F;  1TWH H;  1EQR A;  2E2J B;  1I4X A;  1SMY C;  2CW0 D;  3MFY A;  4L5T A;  5EPJ A;  5IT9 c;  2QEJ C;  1SNQ A;  2F1M A;  3HFZ B;  1PH7 A;  4C3I B;  2I5L X;  2L5T A;  3CCM A;  4A3B G;  3SHL A;  2K28 A;  3IL8 A;  4JI7 L;  4LF9 L;  1C7Y A;  4DR1 Q;  2D9U A;  1K83 B;  3T16 A;  1EYD A;  1X3E A;  2F03 A;  1GUG A;  2EYP A;  2KOL A;  4KY7 A;  1VQP A;  1SJH D;  2HCC A;  4UAI A;  1GUS A;  2WAQ B;  2OCE A;  2R7Z B;  2Z6K A;  1EY8 A;  3C3L A;  1L1O A;  4WJ3 M;  5I4D A;  2RBM A;  2WKD A;  4LW1 A;  5M3M G;  4C3J G;  4AIM A;  1EQV A;  4A3C H;  3W1B A;  2WV6 D;  2RHS B;  3D4D A;  4HCE A;  1II3 A;  2DY8 A;  3X3M A;  3FKI G;  4IQZ A;  1VQ8 A;  3K57 A;  4L5S A;  2LSS A;  1TS2 A;  4LK1 C;  4IUN A;  3ER0 A;  2R92 H;  1V1O A;  3VR4 A;  3STB D;  4PMC A;  4DV0 L;  1F77 A;  1Q8I A;  1KLG D;  3NPP A;  4HTH A;  5IOC A;  1LT5 D;  4YWL A;  1I4Q A;  5A2Q L;  4BY7 B;  1WI5 A;  4DV6 L;  4BA2 I;  3T4A C;  3MXN A;  1B9M A;  3TP8 A;  4A3L H;  3DMU A;  1PTO D;  4P75 A;  4PZ8 A;  2V4D A;  1XPR A;  2BA1 A;  4Y7N B;  2Q2U A;  3BVG A;  2BH2 A;  1WTH A;  5T1I A;  1AP0 A;  4KKT A;  2XVS A;  4A3B B;  5EBC A;  2D0P A;  3PUW A;  3KLR A;  1BVS A;  3PCO B;  1SNM A;  4UP8 A;  1BXT A;  1IKM A;  1G8Z D;  3A8J E;  1Z6H A;  1WVL A;  1KAA A;  3I73 A;  3GTJ H;  4JI2 Q;  3NE5 B;  4C3J B;  5M3M B;  1WTQ A;  1VF5 C;  2F0N A;  4JOI A;  4KK7 A;  2D2C C;  1BOS A;  3FKI B;  1IL8 A;  2D5D A;  3B6Y A;  3FP9 A;  1IYV A;  2FMM A;  1VQK A;  2E2H H;  5A2Q E;  1KC8 C;  4ZYS A;  1GUO A;  2K5N A;  4CGY B;  2XN9 C;  3FPP A;  2DUD A;  1PA6 A;  4JPB W;  4LFC Q;  3L9A X;  1VQB A;  1QNK A;  1TII D;  1HNX Q;  2R92 G;  3CC4 A;  3BDL A;  3HGB A;  1C4Q A;  4KHZ A;  4P72 A;  1DYQ A;  1KXL A;  1ENF A;  4LNQ A;  3QG1 A;  2NN6 I;  5JAV A;  3CCE A;  2F0G A;  1DXM A;  3G7L A;  2RDG A;  4JI8 Q;  1XYI A;  1N33 Q;  4IPG A;  1TWH B;  4A3L G;  1JCK B;  1YJW A;  5FJ8 H;  4HAE A;  4U67 3;  4DUY L;  1YNJ C;  1EY9 A;  4RGT A;  2CVR A;  4L6T B;  1HJP A;  2KCT A;  5IYD H;  3RUZ A;  4DV5 L;  5BR8 L;  3LGJ A;  4J1M A;  4A3F H;  1E2V A;  3BZC A;  1ET6 A;  1PFS A;  1TT2 A;  1Q82 C;  1DON A;  2XSC A;  2NUC A;  5HGQ A;  4IOA A;  3CC7 A;  4LWC A;  5ELC A;  2A6E C;  1I5F A;  1SE4 A;  4TQU S;  4IJL A;  4DNI A;  1A0I A;  2FXQ A;  3E6Z X;  4AYB E;  2D0O A;  4GOP C;  3QR8 A;  2JYO A;  1BUV T;  1LV9 A;  1K0S A;  2BE5 D;  2VUM H;  4R8N A;  1V1Q A;  3U9O A;  1STE A;  4DK3 C;  2MGS A;  2R92 B;  1C9O A;  3J81 L;  5NUC A;  2PW5 A;  3VR3 A;  3DWQ A;  2SEB D;  4ABN A;  1K8O A;  1T5E A;  1XJV A;  4KD4 A;  3CCR A;  1PH4 A;  3E0J A;  2NVQ H;  3I4L A;  2H4O A;  2F0O A;  1PYW D;  3J80 c;  3NHH A;  4B3M Q;  2NTS A;  1X65 A;  2NZH A;  1RHP A;  2MQH A;  4DR1 L;  2DNE A;  5CBA E;  5J39 A;  4IFD J;  5HGT A;  2WAC A;  4JI6 Q;  2XWB B;  5COR A;  4DXF A;  3PSI A;  3TRZ A;  1BR9 A;  2IX0 A;  4KN7 C;  1AZQ A;  4KLK A;  2HIV A;  1GHK A;  2BH8 A;  1SMX A;  3LWU A;  5FJ8 G;  3MXP A;  4QIW B;  4IUV A;  3OHX C;  2P5Z X;  3S1R H;  1A3T A;  4HIO A;  1VQ9 A;  4A75 A;  3F2C A;  1EWC A;  3OW7 A;  3H3V H;  1D1K A;  4F7X A;  4A3F G;  4L63 B;  1KAB A;  3GTJ B;  3ITP A;  3H09 A;  3KLS X;  3G4S A;  2F4I A;  4OIK A;  4LUV A;  2F0V A;  2HUG A;  1WD1 A;  4HJ9 A;  2ES2 A;  4EX5 A;  4B3S Q;  1NR2 A;  1L0W A;  2C5C A;  2K1B A;  1FNV A;  3HKS A;  2ALY B;  5FLX c;  3JC6 6;  2F3V A;  1S40 A;  3VYR A;  4OHJ A;  4EQ5 A;  3V96 A;  1ZYR D;  2EYH A;  2E2H B;  4ZRZ A;  1JWM D;  3KDF B;  1MKH A;  4F87 A;  3BYY B;  3LWE A;  3BG3 A;  1XNR Q;  1BBU A;  1BF4 A;  2VUM G;  1PH1 A;  3PGZ A;  4IUR A;  3HG9 A;  1B53 A;  4IFD I;  3CRK C;  3A8K E;  4RMF A;  1TS3 A;  3C46 A;  3BYT B;  1DJR D;  2L0C A;  3LX0 A;  4DR5 Q;  1G6Z A;  1A3V A;  1FNW A;  3P75 A;  2ENB A;  2L11 A;  3U9S A;  1Z7T A;  3N6R A;  2RVL A;  2ZM6 Q;  2SDF A;  4H7B A;  1BBX C;  3CCV A;  2CW0 C;  4K2L A;  4HSP A;  1NUC A;  3J7A 5;  2JA8 H;  4DR6 Q;  4JI2 L;  1AZP A;  2NTT A;  2PMZ E;  4XYQ A;  5FLM H;  3RLF A;  1O7Y A;  3ULP A;  5EQ0 A;  5IP7 H;  1GUN A;  1ICF B;  1RL2 A;  4IJH A;  1FVI A;  4JK1 C;  4DN4 M;  1HQM C;  1LLR D;  4A3F B;  3U50 C;  2VZA A;  1NTG A;  1B9N A;  4X3T A;  2CWP A;  5I9O A;  2AUJ D;  3S9W A;  1KNE A;  4LFC L;  1UWV A;  1SYC A;  5I2Y A;  4GLX A;  2B63 H;  3KUP A;  4R4I A;  3TRE A;  4GN4 B;  2NB0 A;  1N36 L;  4ME5 A;  3KYH C;  1Q1E A;  2K01 A;  4FYD A;  2WP8 J;  2KVM A;  2CCZ A;  2XRQ D;  5BN4 A;  2YU9 H;  1AW7 A;  4RHR A;  3STB C;  5JVH 3;  1Y8N B;  1FL0 A;  2VUM B;  3NBH B;  2F0Q A;  4JI8 L;  2JP1 A;  3L2P A;  1UE7 A;  1N33 L;  1VQC A;  1PFN A;  1IKL A;  2K75 A;  3M4O H;  1JQY D;  2A19 A;  5CV8 A;  2MP1 A;  1X32 A;  2HDL A;  5LL6 X;  2NVQ B;  5C4X H;  1QUQ B;  2JE6 I;  2K5V A;  1IBL Q;  4LF8 Q;  4FF4 A;  1PXU A;  2MUY A;  1JB3 A;  1UUP A;  3T1H Q;  2DJG C;  4YIJ A;  1A63 A;  5CV9 A;  3KLW A;  3J81 c;  4FXG C;  5CC4 A;  3S1M H;  4APV A;  4X65 Q;  2BOS A;  1HTL D;  4DV7 Q;  1ESF A;  2K5Q A;  4BBR H;  3CC2 A;  1OXV A;  2JA8 G;  4PG3 A;  2L15 A;  3TEH B;  1IYJ B;  2YTX A;  2RDH A;  2KEE A;  1VQD A;  1E24 A;  2F0T A;  2A69 D;  3AFQ A;  4RGO S;  5FLM G;  5IP7 G;  2K05 A;  4HSV A;  3GTM H;  3S1R B;  1D1I A;  1K3B C;  3QOL A;  3UDF A;  1KIX A;  4JI5 Q;  2F0F A;  3K7A H;  1H9K A;  3GQB A;  2Q2T A;  4XXE A;  1GUT A;  4OWW B;  1F2Y A;  3F2U A;  5GAH C;  3K5L A;  3SK8 A;  3KF8 A;  4LUZ A;  2PPB C;  2B63 G;  3K8A A;  3HEJ A;  3I8Z A;  4B3M L;  2NZO A;  1IYU A;  3OWF A;  1VQ7 A;  1QOH A;  2A6H C;  1HUM A;  2PI2 E;  4YWK A;  4DR2 Q;  3A7L A;  4JG2 A;  1SEB D;  1ASZ A;  4ME3 A;  4JI6 L;  3A5Z B;  1CHQ D;  1GD7 A;  2EYO A;  1W2B A;  5IT9 L;  2IHF A;  2VB3 X;  4IUT A;  1Y14 B;  1E7Z A;  1HNW L;  4DXG A;  1CFM A;  1JMC A;  3SGI A;  1G2T A;  2RF4 A;  1E0B A;  3F2B A;  5E4W C;  3H0G H;  1AEX A;  1EZ8 A;  1TQO A;  2SNS A;  5C4X G;  1CZW A;  1PLF A;  2Z9H A;  4K2K A;  2E2J H;  4G7O C;  3SK4 A;  4MZ9 A;  3NK9 A;  4BA1 I;  4RHS A;  2EJF C;  2LS0 1;  3CXC A;  1E3P A;  3GP7 A;  1PDQ A;  4FXK C;  2JA8 B;  5E4X A;  2VW9 A;  3BU2 A;  2E74 C;  3R2T A;  3HOZ H;  4A3I H;  3CQZ H;  2AMC B;  2M9V A;  3KOJ A;  4B3S L;  1XPO A;  2QCP X;  4BBR G;  1HQR D;  3AMU A;  3VA7 A;  1MGS A;  1HCZ A;  4B3T L;  2JXM B;  3M7N A;  4N8F A;  3ULJ A;  2PZT A;  2DY7 A;  1QVG A;  1GJX A;  3NQT A;  4KHP Q;  2NWG A;  4GN3 B;  4PZ7 A;  4DGZ A;  2B63 B;  1VMC A;  3F8T A;  1CKN A;  1FYC A;  4U68 A;  4DR5 L;  1NMF A;  4ZCK A;  3P1H A;  3VA5 A;  2NZ1 D;  2HHH Q;  2Q2H A;  3ERS X;  3PUX A;  1N9W A;  1WCM G;  2YU9 B;  2ZM6 L;  2JA9 A;  1UEA B;  2PZW A;  3M4Q A;  2K4K A;  3M85 A;  2BDN A;  2VL6 A;  2UXC Q;  3SK6 A;  5CMD A;  3VR2 A;  3M4O B;  1PRT C;  2QW7 A;  3PV0 A;  1A8V A;  5JEA H;  5IIF A;  1EY0 A;  1I4P A;  5C4X B;  1PTO H;  4A93 H;  1RIP A;  1KL9 A;  1RF2 D;  3R2I A;  3DM3 A;  5JJZ A;  5C44 G;  1B3A A;  4ID6 A;  1EWI A;  3CHB D;  1SXT A;  5AFW A;  3H0G G;  4L5R C;  5FO7 B;  3WDN A;  4JBM A;  3S1M B;  3NBI A;  1KNA A;  4BBR B;  4EQN A;  1STG A;  1J6Q A;  2B2T C;  4OEL B;  1JJC B;  4KJO A;  4OO1 H;  3D8G A;  3KBG A;  3HOZ G;  4A3I G;  3GD7 A;  1AE2 A;  1I4R A;  2JQO A;  1K8G A;  3GTG H;  1PZK D;  4M8A A;  3GTM B;  4R8I A;  1L0X B;  2KHS A;  3PF5 A;  5KNB A;  2LXK A;  3MC0 B;  4YHH Q;  1VS0 A;  2EE1 A;  3MVV A;  3K7A B;  1EQT A;  2J0T D;  2RA4 A;  3EJI A;  1F2Z A;  3CKI B;  2PNR C;  2PW7 A;  4GLV B;  3SEB A;  1NBW A;  3FEW X;  3G71 A;  4RKB A;  1LT3 D;  2PI2 A;  3I91 A;  1EFW A;  4NW2 A;  3HOU H;  1D8L A;  4MNO A;  1HZA A;  1V9P A;  1IBL L;  4LF8 L;  3PIP 3;  2VQF Q;  1LYL A;  2MHV A;  3OW2 A;  5M5Y H;  3T1H L;  4LUO A;  4LF4 L;  1Q90 A;  2TMP A;  5KGU A;  3MXN B;  3TP6 A;  1F2L A;  1N34 L;  4X65 L;  4DV7 L;  1ROD A;  2EVB A;  1GKH A;  1RD9 D;  1DD2 A;  1Y8P B;  1EY7 A;  5CV6 A;  1EY6 A;  1K0R A;  4P74 A;  3RD4 A;  1ENA A;  1HXY D;  4YCV A;  3HOW H;  1NY4 A;  1LTL A;  1JE5 A;  1TKW B;  2BCO A;  2PQE A;  3TZU A;  3RN5 A;  1HZC A;  1YHB A;  3L3O C;  4P2C B;  3H0G B;  1VQ4 A;  2PO4 A;  3JAM L;  4A93 G;  4H02 A;  3IFT A;  4V0B A;  1SYE A;  2IW3 A;  1PFB A;  4JI5 L;  1RDP D;  5IGE A;  1EU4 A;  2E5L Q;  1QJO A;  4RG1 A;  4C3H G;  4GOP A;  1J8I A;  3HOZ B;  4A3I B;  3CQZ B;  4XT1 B;  3PIO A;  2K5D A;  1UEB A;  5EAY A;  2UUB Q;  4CBV A;  4ODG A;  1S5D D;  4HID A;  4OO1 G;  3PO2 H;  1NSN S;  1HNZ Q;  3WOE A;  3SK5 A;  1E1T A;  4HR7 B;  3EVQ A;  5IYB H;  4DR2 L;  3UE0 A;  1JJG A;  1SJE D;  1SE2 A;  4JW0 A;  4NXM Q;  3MA2 B;  1LTR D;  3J80 L;  3RZO H;  1PH5 A;  1ZXT A;  5KEE A;  2KEN A;  3I4O A;  1ENC A;  1G2S A;  4DUZ Q;  3A54 A;  1Q1B A;  1SYF A;  2EXD A;  4L8J A;  3HOU G;  1A2U A;  4N9T A;  2XTI A;  2JK8 A;  2PQA A;  5D65 A;  3EIV A;  3CD6 A;  4CJ1 B;  4XQN A;  2VNU D;  3RN2 A;  4M1U B;  2Q8I B;  1JB7 A;  1PTO B;  1TU2 B;  3QO2 A;  4A93 B;  1RKN A;  2K5H A;  3CRL C;  3HOW G;  2QGQ A;  5M5X B;  2Q8R E;  4GNX A;  4TVA B;  1X54 A;  5G3L F;  5CV5 A;  2KHJ A;  4IPH A;  4E6I A;  2LMC B;  4X64 Q;  1LUZ A;  4KHP L;  1HR0 Q;  5FLX L;  2L12 A;  3CCS A;  1Q81 C;  2M2L A;  3GTG B;  3J80 E;  3NXW A;  2ZT9 C;  1U0L A;  4UDU C;  2HHH L;  4K14 A;  5FOB B;  3D3R A;  4Z9C B;  2QF7 A;  5T1G A;  3TBI B;  2AUK A;  4IOC A;  3PO2 G;  1UNS A;  1HHV A;  3MTS A;  3A5U A;  4C2M H;  1JWS D;  3TP5 A;  1PVO A;  2JSO A;  2B2W C;  2CH4 W;  1W3S A;  2UXC L;  2K6A A;  3TN2 A;  1JOR A;  5IYB G;  1DOL A;  4C1N K;  4CDD C;  5JJL A;  1B3Q A;  3RLN A;  3HOU B;  1G91 A;  4DAP A;  5IY0 A;  1BNZ A;  3I4N H;  4DV1 Q;  3M9B A;  2ZXP A;  1F9P A;  5M5Y B;  1B70 B;  2N8N A;  1A15 A;  2ZXO A;  4BWG B;  1SRO A;  2G5D A;  1WTW A;  4QL5 A;  1BQQ T;  1VCI A;  4O2D A;  4CDE C;  4HMI A;  3HOW B;  5FLX E;  1LT4 D;  5J3B A;  1DOK A;  2JA5 G;  5DM6 3;  4HJA A;  4K0K Q;  1YNN D;  1SNP A;  1ILQ A;  4NXN Q;  3MXG A;  1M90 C;  1J5E Q;  1V8Q A;  4K6D A;  3HOX H;  2IJ0 A;  1K3R A;  1B8A A;  2G9D A;  1P16 A;  4P73 A;  1I50 H;  2QDB A;  1Q46 A;  1IBK Q;  2JN4 A;  3DHQ A;  4XQQ A;  4LF6 L;  4G7Z C;  4Y52 H;  4AYB G;  3UE1 A;  4C56 C;  3JAM c;  1IBM Q;  3PO2 B;  1U4M A;  4JBK A;  5FO9 B;  2LKV A;  4IUQ A;  2F0J A;  3OYY A;  2FIN B;  4ULL A;  2X6L A;  4UY8 C;  4J6H A;  4X6A H;  2R61 A;  1KRS A;  2CWA A;  2I0Q A;  3RR5 A;  1QE6 A;  1ML0 D;  1KQS A;  4FF3 A;  4OL7 A;  3RZO B;  4RCN A;  1EFI D;  1HR0 W;  3AB9 A;  4G4K A;  3H6M A;  5ISR A;  3K5M A;  4GN5 A;  1Z47 A;  1EIG A;  4F8M A;  4RH6 A;  3FRP B;  4OEM B;  4JYA Q;  1XTC D;  2BDO A;  4XIG S;  3I4N G;  3Q24 A;  1HUN A;  1N32 Q;  2D62 A;  2V1C C;  3CU7 A;  4I65 A;  3TQY A;  2E5L L;  3HOY H;  4XDX A;  5BN3 A;  1NNX A;  5I9P A;  3M4P A;  2OEO A;  2H1E A;  3W5O A;  2UUB L;  1U4P A;  1QNU A;  2EPB A;  5I2X A;  2B2U C;  3R3O A;  4DR3 Q;  4XQJ A;  2IL8 A;  1QB5 D;  3A74 A;  3AU7 A;  3H3V I;  1SND A;  2A68 D;  1HNZ L;  3D6W A;  3GTP H;  3QIA A;  3I4M H;  2WIN B;  1VQJ A;  1PH8 A;  5CBE E;  2X6G A;  1L1O C;  4RWS C;  5ELF A;  3UDG A;  4HIK A;  3VYT A;  2B8G A;  1QIL A;  1X3F A;  3HOX G;  2Z0S A;  4AYB B;  3Q8D A;  1D5M C;  4NXM L;  3ULL A;  3PO3 H;  3R93 A;  4IPC A;  1D7Q A;  3M3Y H;  2AWN A;  3P7J A;  4DV3 Q;  3VDY A;  5K36 H;  3EFX D;  3S1Q H;  4PQX A;  3W1G A;  4DUZ L;  4DV4 Q;  3S17 H;  2Z4I A;  2EIF A;  5HUR A;  1TS4 A;  4CKE A;  3J81 E;  3J7A F;  3W3A A;  4C2M B;  1WOC A;  4DAY A;  1S5B D;  1O7Z A;  2EY5 A;  2PCF B;  1HH2 P;  1T5X D;  2R7F A;  3MEF A;  1SN8 A;  2NN6 G;  4FP5 D;  2IPK D;  1BDO A;  1LTI D;  1U9R A;  3I4N B;  1QG7 A;  2IX1 A;  3G48 A;  4ALP A;  4FNF A;  4A3J H;  2H5X A;  3VYU A;  4IAL A;  5CYU A;  2FFK B;  1VMP A;  4X64 L;  4WRD A;  5EKL A;  1EYA A;  1VQI A;  3TME A;  1HR0 L;  4FO2 A;  2I46 A;  3BVZ A;  4YCU A;  3TSS A;  4LJZ C;  4LFA Q;  4DAM A;  3URY A;  3HOY G;  2UU9 Q;  1PH2 A;  4I7A A;  5LL6 S;  3UI2 A;  1VQO A;  2HDM A;  1CZG A;  4QF4 A;  4NKL A;  4DR4 Q;  5J22 A;  3HOX B;  2EOT A;  1QWY A;  2XIW A;  4GS3 A;  2VS1 A;  1SBB B;  4R4Q A;  2UUC Q;  3CAM A;  3C1F A;  3SVM A;  3I4M G;  1MJC A;  3Q6S A;  2KJX A;  4KY6 A;  1I50 B;  4JC0 A;  1WTO A;  2NYZ D;  2CKZ B;  4JBW A;  3PO3 G;  2F0I A;  4XYO A;  3I3C A;  2KUM A;  3BVM A;  4IFD H;  3FMC A;  4QGU A;  1EEI D;  3KF8 B;  4RCO A;  5DAU A;  5K36 G;  4IPD A;  4X3U A;  4DV1 L;  3UDI A;  1HRJ A;  3RMH A;  4H13 C;  1SMY D;  1HNX L;  1H9M A;  1TWC H;  3QB3 A;  5IGD A;  4LF7 Q;  2EYJ A;  1IL2 A;  3RLO A;  2UUA Q;  2FMC A;  3J80 i;  4KD3 A;  4ZAI A;  5GAG C;  2YYZ A;  4K5X A;  4FDB A;  4GKK Q;  1TWF H;  4K8J A;  1KDC A;  2UXD Q;  4FVM A;  1K9M C;  1Q8K A;  4A3G H;  2B2T A;  3U58 A;  3Q0A A;  1PZI D;  4K0K L;  4A3E H;  2PMZ B;  1VQH A;  3PUV A;  4IUP A;  4HJ7 A;  4OWX B;  3W2D A;  2HQL A;  4RA8 A;  4NXN L;  1J5E L;  2MO1 A;  5CR3 A;  1PTO C;  3T56 B;  1LO5 D;  2WB1 G;  2F52 A;  2L55 A;  4A3J G;  3BJU A;  3HOY B;  2IY5 B;  4NDX A;  4RFB A;  3MHB A;  2OWO A;  4DV2 Q;  4A3M H;  1MSH A;  1STB A;  4PV1 C;  4UP7 A;  3T53 B;  5AJ3 Q;  1O80 A;  1CKO A;  4B9X A;  1IBM L;  5M5W B;  3GTP B;  2WB1 E;  2XNA C;  4JVZ A;  3I4M B;  4JV5 Q;  1MIU A;  1SR3 A;  1O7I A;  2ICE C;  1WFQ A;  1I4H A;  1XMO Q;  1C48 A;  2VQE Q;  3PO3 B;  1A62 A;  3OWE B;  4UPA A;  2O2L D;  3M3Y B;  1NE3 A;  5GQO A;  4HJ8 A;  2CH4 A;  1CKN B;  3S1Q B;  2Y0S G;  3NEN A;  1TY2 A;  5C4J H;  3PQI A;  3S17 B;  1VQN A;  4KMU C;  3T51 B;  4JI0 Q;  4IFD G;  1DCZ A;  1X55 A;  2B2V C;  4JI3 Q;  4JYA L;  3QWN A;  3GTQ B;  1A3U A;  1WCM H;  4X3K A;  1N32 L;  4N9P A;  1NCV A;  5F2D A;  1DOM A;  1LTG D;  3FPU B;  3L0O A;  2RSO A;  1YEZ A;  4K5W A;  3S2D H;  1PH3 A;  1JOO A;  4YWM A;  2DJF C;  2Y0S E;  1JOK A;  1H9S A;  3DUZ A;  4DR3 L;  4KY5 A;  5JVG 3;  4DAV A;  2NBF A;  1EY4 A;  4EGV A;  2OF1 A;  2GVA A;  4KN4 C;  5JEA J;  5H1S E;  2WB1 B;  4A3G G;  4A3J B;  3NEM A;  3EBE A;  1D5X C;  1PTO F;  5C44 H;  4A3E G;  1CQF A;  1UE5 A;  1E1O A;  4H0L C;  3KLS A;  4FXD A;  1UE6 A;  3CCL A;  5C3W A;  1VQM A;  3H91 A;  4DA2 A;  3NWS A;  2RDF A;  2K04 A;  1TXY A;  5E7N A;  4ZUJ A;  1EY5 A;  1WD0 A;  1DZ1 A;  1A2T A;  2EXZ A;  1M8A A;  2SNM A;  3SDZ A;  2ICI A;  2CQA A;  4DV4 L;  4A3M G;  2ID0 A;  3OIP A;  3K80 C;  1SAP A;  2N49 A;  5CV4 A;  3BDO A;  2JA7 G;  1G6P A;  1PH6 A;  5GAD C;  4TSS A;  3P20 A;  2GVB A;  2TSS A;  2XWJ B;  1RCV D;  2F0D A;  4CJ0 B;  5EBD A;  1U4R A;  2FJ2 A;  4A3D H;  1XNR L;  2RHQ B;  4POF A;  1BKB A;  1YNJ D;  4FF1 A;  2EY2 A;  5IT9 E;  1XWE A;  1TWC B;  1VQG A;  5IGG A;  2BE5 C;  2OQ0 A;  3CME A;  2OQK A;  3OTO Q;  1E22 A;  1STH A;  3GV3 A;  1ICW A;  2EJM A;  2PZU A;  2KBN A;  1TWF B;  2IX3 A;  4LFA L;  3HKZ E;  1CM9 A;  1Q7Y C;  1KDA A;  3CP0 A;  3EA6 A;  2QIL A;  3J81 i;  4HJ5 A;  4A3G B;  1FGU A;  4QQB X;  4B3R Q;  2EYL A;  1E2W A;  2MNA A;  4DR6 L;  5A35 A;  4A3E B;  1JIC A;  2A6E D;  5KND A;  2MPM A;  2EQS A;  4DR4 L;  4OO1 I;  5D3I B;  5GRO A;  2UUC L;  3ND8 A;  4HED A;  1EOV A;  1I94 Q;  1HA5 A;  4GOP B;  2AQ3 B;  1FGB D;  5M5X H;  2WII B;  1X3P A;  3KF6 A;  2F0W A;  4C3H H;  4R9W A;  1CA6 A;  2B2W A;  1B50 A;  4A3M B;  3KJP A;  3S24 A;  1E2Z A;  1OO9 B;  2HCI A;  2QDL A;  3S15 H;  2CFM A;  5C0X H;  1V1P A;  1PZJ D;  3BZK A;  1K8A C;  4HMJ A;  3F2D A;  4PMW A;  4LMQ D;  1SYD A;  3I70 A;  5C3X A;  1VQ5 A;  2R93 G;  2UUA L;  2B3G A;  1EIH A;  2L1B A;  3R8B A;  4MIU A;  1EYG A;  5DNF A;  2UXB Q;  3HZX A;  2UXD L;  2ZJP A;  1K28 A;  2IWH A;  1JT8 A;  2A5H A;  1Y1V H;  1QZG A;  1ZYR C;  5C4J B;  2F0U A;  4UP9 A;  1TWA B;  3ZYY X;  4A3D G;  2AQ2 B;  1KRT A;  1SE3 A;  4KTA A;  2VB2 X;  3A7A B;  1SSO A;  1WCM B;  2KQ3 A;  1F9Q A;  4P71 A;  1VQA A;  2PQA B;  3S2D B;  3CCQ A;  3NTH A;  3NTK A;  2EYM A;  2XRS D;  5AJ3 L;  1SDF A;  3I2Z A;  4GNX B;  1JR0 D;  4BY1 H;  4CKC A;  5C44 B;  5LHY 1;  4QJF A;  3X3N A;  1KAW A;  1W6J A;  1S5C D;  3M7G A;  3O13 A;  2F4V Q;  1XMO L;  1CSQ A;  4POG A;  2VQE L;  2PNH A;  2LY7 A;  2YTY A;  2Q8T A;  1T9H A;  2HT1 A;  2NVY B;  4OGQ C;  4R4C A;  4V19 0;  5ELE A;  1JC7 A;  2JEA I;  1EL0 A;  1IXR A;  1V43 A;  1LTB D;  3MEH A;  4G7H C;  4JI0 L;  2R93 B;  1KTK A;  5EJW A;  2IT1 A;  5C0X G;  2X69 A;  3VR6 A;  3ICE A;  1VQL A;  2E8G A;  2ZJR A;  1XMQ Q;  1DM0 B;  3IKJ A;  1AE3 A;  4MTK A;  2ASB A;  1CHP D;  4R4T A;  1ZEQ X;  4A3D B;  1TWG H;  1Y1V G;  3DWP A;  2B2U A;  4K6L A;  1Q86 C;  1KD1 C;  3MXU A;  4WFN 3;  1WTR A;  2SOB A;  1N8R C;  1S72 A;  3K7U C;  1PFM A;  4MHE A;  3IAY A;  2L9H A;  2PYK A;  1OTC A;  3CW2 C;  4HCS A;  3T1Y Q;  4PZ6 A;  1MHW C;  3JAM E;  3NWT A;  3PIP A;  1RTN A;  4DR7 Q;  1OXT A;  3E5S A;  4LF5 Q;  3OIQ A;  5I6W A;  1X9N A;  2JA5 H;  3GTL B;  1VQ6 A;  4EQO A;  3SR1 A;  2KED A;  2F0K A;  4BY1 G;  3NSW A;  1B1Z A;  3I7F A;  4C3H B;  1VF7 A;  2JEB I;  1GM5 A;  2A69 C;  5C3E H;  1CTM A;  2A74 C;  3S15 B;  2AWO A;  3OPO A;  3MFG A;  2B2Y C;  4DFA A;  2ZTD A;  3S14 H;  1SYB A;  4X66 Q;  3H3V C;  3MAQ A;  1GHJ A;  2F0P A;  3OTO L;  5C5L A;  2EY1 A;  1SE8 A;  3K5N A;  1OXU A;  3NUC A;  4OIJ A;  4CHT B;  1Q3L A;  1NMG A;  2A1A A;  1X3G A;  3NQI A;  4MTN A;  1VDZ A;  5JPM C;  4KKU A;  1CUK A;  1LAC A;  4G57 A;  1Y1W H;  1Y1V B;  5LMU Q;  2RKS A;  4CDF C;  5KIX A;  5IGF A;  4B3R L;  1EU3 A;  2R6G A;  1SFO H;  5IYC H;  1OXX K;  2K7V A;  1WJJ A;  4PMB A;  3U4Z A;  4S3S A;  3E3X A;  2DNC A;  1I94 L;  1TR5 A;  1X6O A;  1WYD A;  1HFG A;  3K0Y A;  4CDC C;  3KJO A;  4KV6 A;  2AKW B;  1CSP A;  2Q2I A;  5IP9 H;  4OWT B;  4A3C G;  1B7Y B;  1HZ9 A;  1RTO A;  4BY1 B;  3DEO A;  1MD2 D;  5FK9 C;  1KLU D;  2Z6B A;  1H9R A;  1MI2 A;  2DGY A;  2N3S A;  1W6K A;  3S16 H;  4BBS H;  2I5H A;  1YHQ A;  2A6H D;  1D6E C;  4YHH L;  2UXB L;  1N36 Q;  4GKJ Q;  1PMR A;  2M00 A;  3QOJ A;  5DLQ E;  5ELB A;  5C4Z A;  1CA5 A;  3DM1 A;  5C3E G;  1I3Q B;  4O42 A;  4RKL A;  3K0X A;  4DAY B;  5KYL A;  4OX9 Q;  2VQF L;  3ND9 A;  5IWA Q;  4DKA C;  4DK1 A;  1HPC A;  5KYI A;  2ZTC A;  3KBX A;  2NN6 H;  3S1N H;  4DNT B;  3K5O A;  3AYH B;  1Y1W G;  2KCM A;  1WTV A;  1TWG B;  1A6X A;  4X3S A;  5JPN C;  3CCU A;  4A76 A;  1KDB A;  1FR3 A;  2KA7 A;  1FNU A;  2K52 A;  1U5K A;  3GTO H;  3KK7 A;  5IYC G;  3Q22 A;  2F4V L;  4ZUI A;  5IE8 A;  3D31 A;  2GA4 B;  1J9O A;  3C2P A;  1HTP A;  2C9O A;  4GLA C;  2VXW A;  4QIW E;  2XGT A;  2OTJ A;  1EZ6 A;  2F0E A;  1KHI A;  3E0E A;  1X3Q A;  4IZ8 A;  5EPL A;  2JA5 B;  4R4O A;  4N8X 1;  5IP9 G;  3D4R A;  4QMG A;  5K5P A;  1QVF A;  2LXJ A;  1ASY A;  2N78 A;  3I90 A;  4B08 A;  1EUJ A;  2B2V A;  5M5W H;  2RCN A;  5CGK A;  2Z6K C;  1XMQ L;  2KCC A;  5LMN Q;  4BBS G;  1FJG Q;  3T13 A;  1C0A A;  1IW7 D;  3CPF A;  5JOB A;  5C3E B;  2J7Z A;  3EN2 A;  1PRT B;  1XXG A;  2KEC A;  1PRT D;  4JI1 Q;  1UE1 A;  3AFP A;  1Z9F A;  1CT1 D;  2BA0 A;  3S14 B;  4A4I A;  3VR5 A;  4GZY C;  3TDQ A;  1QVC A;  2N55 A;  1LAB A;  1BCP B;  1TVX A;  3SXH A;  1BCP D;  1HNW Q;  5M9O A;  3CCJ A;  3T1Y L;  5JJI A;  2RCF A;  1Y1W B;  4R1J A;  4IO9 A;  3GTQ H;  2Z8L A;  1S5E D;  4DR7 L;  2OXP A;  1F2M A;  1B44 D;  3ZJY C;  1XX8 A;  3AEV A;  1D5Z C;  2OTL A;  4LF5 L;  1JOQ A;  4RGN A;  1OXS C;  3NTI A;  2Z1C A;  1SFO B;  3I55 A;  5IYD G;  1S3O A;  5E3F A;  1STA A;  4O0A A;  3HRZ C;  1AFP A;  5FO8 B;  4CJ2 C;  2QKI C;  3OOC A;  5M3F H;  2B29 A;  1B2T A;  4KI0 A;  3F1Z A;  4AQY Q;  3DXJ C;  3HOV H;  4DPG A;  5FKA C;  4EQP A;  4QY7 A;  5IGC A;  2AQ1 B;  4GNX C;  2FHT A;  1EQQ A;  2EYF A;  4B3T Q;  2F3W A;  2Z4H A;  1S4Z A;  4A3K H;  1LTS D;  5COY A;  3WWV A;  5ELD A;  4X66 L;  2KCN A;  2O5I C;  3JAM i;  4DF7 A;  3UDX A;  3HP3 A;  2YTV A;  3TP7 A;  3BZD B;  3S16 B;  4BBS B;  2F0L A;  2K03 A;  2L4N A;  3OMG A;  5E1F A;  3GDE A;  2NVX H;  3TZD A;  2K32 A;  4JOI C;  2C35 B;  5LMU L;  1RJT A;  3DEP A;  2VY3 A;  2EY6 A;  2CQO A;  1WTX A;  2NVT H;  5JJK A;  1YZ6 A;  4KKS A;  5GAE C;  4JCV E;  4LFB Q;  2I07 B;  4QUF A;  4HN7 A;  2WKC A;  1LTT D;  5EKI A;  1YIJ A;  3SE0 A;  5G3L D;  1YBY A;  3GO5 A;  3H94 A;  1H9S B;  3S1N B;  3D0F A;  1HZB A;  4NMZ A;  3K58 A;  3FVQ A;  4YY3 Q;  5LMN W;  3MWY W;  3A0J A;  1ET9 A;  1PHJ A;  1GXD C;  2I5M X;  5ELN A;  1EEF D;  3GTO B;  3GTK H;  1EYC A;  1PH9 A;  3S2H H;  1STN A;  4L5Q A;  3AQQ A;  3L7Z C;  1G51 A;  2N88 A;  3DLL A; 
#chains in the Genus database with same CATH homology
 2DN8 A;  4RAU C;  2B39 A;  5CV7 A;  2O4X A;  4J8Q A;  4NP5 A;  4PNY A;  5DEH A;  3PUZ A;  1NAP A;  5KRU A;  1F9S A;  3Q23 A;  3MZ5 A;  1TY0 A;  5KNC A;  3M4Y A;  3ERO A;  2LFN A;  1NR4 A;  4K5V A;  1IHZ A;  5EKK A;  3K59 A;  4LAA A;  2J4X A;  2EDG A;  5EPK A;  2ZXR A;  4KHV A;  3J7A V;  2B8F A;  2F0M A;  1LT6 D;  3BDC A;  3G6J B;  1TS5 A;  1EOT A;  1Q12 A;  5M3F B;  1HA6 A;  1JE4 A;  4IN3 A;  1F9R A;  1WTP A;  4WOR A;  3HOV B;  3LNN A;  3GV6 A;  1FD7 D;  1ESR A;  1GUW A;  3K6O A;  1YNN C;  4A3K B;  4TKO B;  1ILP A;  2RSN A;  3ERQ A;  3VYS A;  1V1P B;  3J7Y W;  1I4G A;  5IGB A;  1H9J A;  1MBY A;  1Y69 U;  5C0X J;  4FF2 A;  2K5W A;  3A8I E;  1ONL A;  2EJG C;  3NBH A;  1AN8 A;  4QCL A;  2NVX B;  4ZK9 B;  2CHB D;  4WJW A;  1ZKO A;  4F88 A;  2NVT B;  2Y0S B;  4ZQ3 A;  3ONA B;  4TRD A;  2MJ8 A;  2E2D C;  2F0H A;  4B9W A;  1G29 1;  2HQE A;  5DM7 3;  5C6A A;  1HFN A;  4ILW A;  3EQL C;  3PMF A;  1LTA D;  2RQX A;  5TSS A;  5J1Z A;  5C4H A;  1MSG A;  4RGM A;  2OT2 A;  1C8C A;  3GTK B;  1I6V C;  2B2Y A;  3S2H B;  3D4W A;  1GOZ A;  5C0X I;  2EZV A;  1QCB D;  3RZD B;  2A68 C;  5I6Y A;  5D3D A;  2K33 A;  4KJN A;  4DNR B;  4ZKC B;  2A73 B;  3A56 A;  4IUU A;  1IW7 C;  5EGT A;  3V05 A;  1B4O A;  5C5M A;  2JA7 B;  1CQV A;  4XT3 B;  5BN5 A;  4O1N A;  4Q0F A;  1U4L A;  3IFD A;  4QUC A;  4I7Z C;  1SNO A;  4DU9 A;  1D2B A;  4BS9 A;  1S5F D;  4QB4 A;  1BCP C;  3DWA A;  4K8I A;  4MN3 A;  4Q5V A;  3HKZ B;  1R9T B;  2JA6 B;  3PIO 3;  3HS0 C;  1R4Q B;  4DK0 A;  2E75 C;  1O7L A;  3NP8 A;  1CI3 M;  4C1N I;  4C3I G;  1Y8O B;  3OSO A;  1EWH A;  4H44 C;  3C1E A;  2O5J C;  4CKB A;  1M4V A;  4ZLT F;  2R3Z A;  3A55 A;  1L0Y B;  1SYG A;  1JWU D;  3WOF A;  2E2I B;  3PUY A;  5IOD A;  1K8M A;  2E76 C;  1BO0 A;  3BS1 A;  4ZKB B;  1UAP A;  3FDT A;  4XTC S;  1O78 A;  1PRT F;  3I72 A;  1CK1 A;  1R4P B;  2G9H D;  3D6C A;  3OMC A;  1I6H B;  4EVO A;  3QJY A;  2F0S A;  3N52 A;  5D14 A;  3V2T A;  1STY A;  1SNC A;  5JEA G;  1BCP F;  2E2J B;  1I4X A;  1SMY C;  2CW0 D;  3MFY A;  5EPJ A;  2QEJ C;  1SNQ A;  2F1M A;  4C3I B;  2L5T A;  3SHL A;  2K28 A;  3IL8 A;  2D9U A;  1K83 B;  3T16 A;  1EYD A;  2F03 A;  1GUG A;  2EYP A;  2KOL A;  4KY7 A;  1SJH D;  2HCC A;  4UAI A;  1GUS A;  2WAQ B;  2R7Z B;  1EY8 A;  3C3L A;  5I4D A;  2RBM A;  2WKD A;  4C3J G;  1EQV A;  2WV6 D;  3D4D A;  4HCE A;  1II3 A;  2DY8 A;  3X3M A;  4IQZ A;  3K57 A;  1TS2 A;  4LK1 C;  4IUN A;  1V1O A;  3VR4 A;  4PMC A;  1F77 A;  1Q8I A;  1KLG D;  3NPP A;  4HTH A;  5IOC A;  1LT5 D;  1I4Q A;  5A2Q L;  4BY7 B;  4BA2 I;  3T4A C;  3MXN A;  1B9M A;  3TP8 A;  3DMU A;  1PTO D;  2V4D A;  2BA1 A;  4Y7N B;  3BVG A;  5T1I A;  1AP0 A;  4KKT A;  2XVS A;  4A3B B;  5EBC A;  3PUW A;  3KLR A;  1SNM A;  1BXT A;  1IKM A;  1G8Z D;  3A8J E;  1Z6H A;  1WVL A;  1KAA A;  3I73 A;  3NE5 B;  4C3J B;  5M3M B;  1WTQ A;  1VF5 C;  2F0N A;  4KK7 A;  2D2C C;  1BOS A;  3FKI B;  1IL8 A;  2D5D A;  1IYV A;  2FMM A;  5A2Q E;  4ZYS A;  1GUO A;  4CGY B;  2XN9 C;  3FPP A;  3L9A X;  1QNK A;  1TII D;  3BDL A;  3HGB A;  1C4Q A;  4KHZ A;  1DYQ A;  1ENF A;  3QG1 A;  2NN6 I;  5JAV A;  2F0G A;  1DXM A;  3G7L A;  2RDG A;  1XYI A;  1TWH B;  1JCK B;  4U67 3;  4HAE A;  1YNJ C;  1EY9 A;  4RGT A;  2CVR A;  4L6T B;  3RUZ A;  4J1M A;  1E2V A;  1ET6 A;  1TT2 A;  1DON A;  2XSC A;  2NUC A;  5ELC A;  2A6E C;  4TQU S;  1SE4 A;  3E6Z X;  2JYO A;  1BUV T;  1LV9 A;  2BE5 D;  4R8N A;  3U9O A;  1STE A;  2MGS A;  2R92 B;  3J81 L;  5NUC A;  2PW5 A;  3VR3 A;  3DWQ A;  2SEB D;  4ABN A;  1K8O A;  1T5E A;  4KD4 A;  3E0J A;  3I4L A;  2H4O A;  2F0O A;  1PYW D;  3NHH A;  2NTS A;  1RHP A;  2DNE A;  5CBA E;  5J39 A;  4IFD J;  5HGT A;  2WAC A;  2XWB B;  5COR A;  4DXF A;  1BR9 A;  2IX0 A;  4KN7 C;  1AZQ A;  1GHK A;  3LWU A;  3MXP A;  4QIW B;  4IUV A;  3OHX C;  1A3T A;  1EWC A;  3OW7 A;  1D1K A;  4F7X A;  4L63 B;  1KAB A;  3GTJ B;  3ITP A;  3H09 A;  3KLS X;  2F4I A;  4OIK A;  2F0V A;  2HUG A;  1WD1 A;  1NR2 A;  2C5C A;  2K1B A;  1FNV A;  2F3V A;  3VYR A;  4OHJ A;  3V96 A;  1ZYR D;  2EYH A;  2E2H B;  4ZRZ A;  1JWM D;  4F87 A;  3BYY B;  3LWE A;  3BG3 A;  1BF4 A;  4IUR A;  3HG9 A;  1B53 A;  4IFD I;  3CRK C;  3A8K E;  1TS3 A;  3C46 A;  3BYT B;  1DJR D;  2L0C A;  3LX0 A;  1G6Z A;  1A3V A;  1FNW A;  3P75 A;  2ENB A;  2L11 A;  3U9S A;  1Z7T A;  3N6R A;  2RVL A;  2SDF A;  4H7B A;  1BBX C;  2CW0 C;  4K2L A;  4HSP A;  1NUC A;  1AZP A;  2NTT A;  4XYQ A;  3RLF A;  1O7Y A;  5EQ0 A;  1GUN A;  4JK1 C;  4DN4 M;  1HQM C;  1LLR D;  4A3F B;  1B9N A;  4X3T A;  5I9O A;  2AUJ D;  3S9W A;  1KNE A;  1SYC A;  5I2Y A;  3KUP A;  2NB0 A;  4ME5 A;  1Q1E A;  2K01 A;  4FYD A;  2WP8 J;  2KVM A;  2XRQ D;  5BN4 A;  1AW7 A;  4RHR A;  5JVH 3;  1Y8N B;  2VUM B;  2F0Q A;  2JP1 A;  1PFN A;  1IKL A;  1JQY D;  5CV8 A;  2MP1 A;  1X32 A;  2HDL A;  5LL6 X;  2NVQ B;  2JE6 I;  4FF4 A;  1PXU A;  2MUY A;  1JB3 A;  1UUP A;  4YIJ A;  5CV9 A;  4FXG C;  5CC4 A;  2BOS A;  1HTL D;  1ESF A;  2K5Q A;  1OXV A;  2RDH A;  2KEE A;  2F0T A;  2A69 D;  4RGO S;  2K05 A;  4HSV A;  3S1R B;  1D1I A;  3QOL A;  2F0F A;  1H9K A;  3GQB A;  4XXE A;  1GUT A;  1F2Y A;  3F2U A;  3K5L A;  3SK8 A;  3KF8 A;  2PPB C;  3HEJ A;  3I8Z A;  1IYU A;  3OWF A;  1QOH A;  2A6H C;  1HUM A;  3A7L A;  1SEB D;  1CHQ D;  2EYO A;  5IT9 L;  2VB3 X;  4IUT A;  4DXG A;  1CFM A;  1G2T A;  1E0B A;  5E4W C;  1AEX A;  1EZ8 A;  1TQO A;  2SNS A;  1CZW A;  1PLF A;  4K2K A;  4G7O C;  3SK4 A;  3NK9 A;  4BA1 I;  4RHS A;  2EJF C;  2LS0 1;  3GP7 A;  1PDQ A;  4FXK C;  2JA8 B;  5E4X A;  2E74 C;  3R2T A;  2M9V A;  2QCP X;  1HQR D;  3AMU A;  3VA7 A;  1MGS A;  1HCZ A;  2JXM B;  3M7N A;  2PZT A;  2DY7 A;  1GJX A;  3NQT A;  2NWG A;  4DGZ A;  2B63 B;  1VMC A;  1FYC A;  4U68 A;  3P1H A;  3VA5 A;  2NZ1 D;  3PUX A;  2YU9 B;  1UEA B;  2PZW A;  3M85 A;  2BDN A;  3SK6 A;  5CMD A;  3VR2 A;  3M4O B;  1PRT C;  3PV0 A;  5JEA H;  5IIF A;  1EY0 A;  1I4P A;  5C4X B;  1PTO H;  1RF2 D;  3R2I A;  5JJZ A;  1B3A A;  4ID6 A;  3CHB D;  1SXT A;  5AFW A;  5FO7 B;  3WDN A;  3S1M B;  3NBI A;  1KNA A;  4BBR B;  4EQN A;  1STG A;  2B2T C;  4OO1 H;  4KJO A;  3D8G A;  3KBG A;  3GD7 A;  1I4R A;  1PZK D;  4M8A A;  3GTM B;  4R8I A;  1L0X B;  2KHS A;  5KNB A;  3MC0 B;  2EE1 A;  3MVV A;  3K7A B;  1EQT A;  2J0T D;  2RA4 A;  3EJI A;  1F2Z A;  3CKI B;  2PNR C;  2PW7 A;  3SEB A;  3FEW X;  4RKB A;  1LT3 D;  3I91 A;  4NW2 A;  3PIP 3;  2MHV A;  1Q90 A;  2TMP A;  5KGU A;  3TP6 A;  1F2L A;  1ROD A;  2EVB A;  1DD2 A;  1RD9 D;  1Y8P B;  1EY7 A;  5CV6 A;  1EY6 A;  3RD4 A;  1ENA A;  1HXY D;  2PQE A;  3TZU A;  1TKW B;  2BCO A;  3L3O C;  4P2C B;  3H0G B;  2PO4 A;  3JAM L;  3IFT A;  4V0B A;  1SYE A;  2IW3 A;  1PFB A;  1RDP D;  5IGE A;  1EU4 A;  1QJO A;  4C3H G;  1J8I A;  3HOZ B;  4A3I B;  3CQZ B;  4XT1 B;  2K5D A;  4CBV A;  4ODG A;  1S5D D;  4OO1 G;  1NSN S;  3WOE A;  3SK5 A;  4HR7 B;  3EVQ A;  1SJE D;  1SE2 A;  3MA2 B;  1LTR D;  3J80 L;  1ZXT A;  5KEE A;  1ENC A;  1G2S A;  3A54 A;  1Q1B A;  1SYF A;  4L8J A;  1A2U A;  4N9T A;  5D65 A;  4CJ1 B;  4XQN A;  2VNU D;  4M1U B;  2Q8I B;  1PTO B;  1TU2 B;  3QO2 A;  4A93 B;  1RKN A;  3CRL C;  5M5X B;  2Q8R E;  5G3L F;  5CV5 A;  4E6I A;  2LMC B;  5FLX L;  2L12 A;  2M2L A;  3GTG B;  3J80 E;  3NXW A;  2ZT9 C;  4UDU C;  4K14 A;  5FOB B;  3D3R A;  4Z9C B;  2QF7 A;  5T1G A;  3TBI B;  2AUK A;  1UNS A;  1HHV A;  3MTS A;  1JWS D;  3TP5 A;  2JSO A;  2B2W C;  2K6A A;  3TN2 A;  1JOR A;  1DOL A;  4C1N K;  3HOU B;  1G91 A;  4DAP A;  1BNZ A;  2ZXP A;  1F9P A;  5M5Y B;  1A15 A;  2ZXO A;  4BWG B;  1WTW A;  1BQQ T;  1VCI A;  4HMI A;  3HOW B;  5FLX E;  1LT4 D;  1DOK A;  5DM6 3;  1YNN D;  1SNP A;  1ILQ A;  3MXG A;  1V8Q A;  4K6D A;  2IJ0 A;  2G9D A;  2QDB A;  3DHQ A;  4XQQ A;  4G7Z C;  4C56 C;  3PO2 B;  1U4M A;  5FO9 B;  2LKV A;  4IUQ A;  2F0J A;  2FIN B;  4ULL A;  2X6L A;  4J6H A;  2R61 A;  1QE6 A;  1ML0 D;  4FF3 A;  4OL7 A;  3RZO B;  4RCN A;  1EFI D;  3AB9 A;  4G4K A;  3H6M A;  5ISR A;  3K5M A;  1Z47 A;  1EIG A;  4F8M A;  4RH6 A;  3FRP B;  1XTC D;  2BDO A;  4XIG S;  3Q24 A;  1HUN A;  2D62 A;  3CU7 A;  4I65 A;  4XDX A;  5BN3 A;  5I9P A;  2OEO A;  2H1E A;  1U4P A;  1QNU A;  2EPB A;  5I2X A;  2B2U C;  3R3O A;  4XQJ A;  2IL8 A;  1QB5 D;  3AU7 A;  1SND A;  2A68 D;  3D6W A;  3QIA A;  2WIN B;  5CBE E;  2X6G A;  4RWS C;  5ELF A;  3VYT A;  2B8G A;  1QIL A;  4AYB B;  1D5M C;  3R93 A;  2AWN A;  3P7J A;  5K36 H;  3EFX D;  4PQX A;  2Z4I A;  5HUR A;  1TS4 A;  4CKE A;  3J81 E;  3J7A F;  3W3A A;  4C2M B;  4DAY A;  1S5B D;  1O7Z A;  2EY5 A;  2PCF B;  1T5X D;  2NN6 G;  4FP5 D;  2IPK D;  1BDO A;  1LTI D;  1U9R A;  3I4N B;  1QG7 A;  2IX1 A;  4FNF A;  3VYU A;  4IAL A;  5CYU A;  2FFK B;  1VMP A;  4WRD A;  5EKL A;  1EYA A;  3TME A;  4FO2 A;  2I46 A;  3BVZ A;  3TSS A;  4LJZ C;  3URY A;  5LL6 S;  3UI2 A;  2HDM A;  1CZG A;  4QF4 A;  4NKL A;  5J22 A;  3HOX B;  2EOT A;  1QWY A;  2XIW A;  1SBB B;  3C1F A;  3SVM A;  3Q6S A;  2KJX A;  4KY6 A;  1I50 B;  1WTO A;  2NYZ D;  4JBW A;  2F0I A;  4XYO A;  3I3C A;  2KUM A;  3BVM A;  4IFD H;  3FMC A;  1EEI D;  4RCO A;  5DAU A;  5K36 G;  4X3U A;  1HRJ A;  3RMH A;  4H13 C;  1SMY D;  1H9M A;  3QB3 A;  5IGD A;  2EYJ A;  2FMC A;  4KD3 A;  4ZAI A;  2YYZ A;  4K5X A;  4K8J A;  1KDC A;  4FVM A;  2B2T A;  3Q0A A;  1PZI D;  2PMZ B;  3PUV A;  4IUP A;  3W2D A;  4RA8 A;  3T56 B;  5CR3 A;  1PTO C;  1LO5 D;  2L55 A;  3HOY B;  4NDX A;  4RFB A;  3MHB A;  1MSH A;  3T53 B;  1STB A;  4PV1 C;  4B9X A;  1O80 A;  5M5W B;  3GTP B;  2XNA C;  3I4M B;  2ICE C;  1I4H A;  1C48 A;  3PO3 B;  3OWE B;  2O2L D;  3M3Y B;  3S1Q B;  1TY2 A;  3S17 B;  4KMU C;  3T51 B;  4IFD G;  1DCZ A;  2B2V C;  3QWN A;  3GTQ B;  1A3U A;  4X3K A;  4N9P A;  1NCV A;  5F2D A;  1DOM A;  1LTG D;  3FPU B;  2RSO A;  4K5W A;  1JOO A;  1JOK A;  1H9S A;  3DUZ A;  4KY5 A;  5JVG 3;  4DAV A;  2NBF A;  1EY4 A;  4EGV A;  2OF1 A;  4KN4 C;  5JEA J;  2WB1 B;  4A3J B;  1D5X C;  1PTO F;  1CQF A;  4H0L C;  3KLS A;  4FXD A;  5C3W A;  3H91 A;  4DA2 A;  3NWS A;  2RDF A;  2K04 A;  4ZUJ A;  1EY5 A;  1WD0 A;  1DZ1 A;  1A2T A;  2EXZ A;  1M8A A;  2SNM A;  3SDZ A;  2ICI A;  2CQA A;  2ID0 A;  3OIP A;  1SAP A;  5CV4 A;  3BDO A;  4TSS A;  3P20 A;  2TSS A;  2XWJ B;  1RCV D;  2F0D A;  4CJ0 B;  5EBD A;  1U4R A;  2FJ2 A;  1YNJ D;  4FF1 A;  2EY2 A;  5IT9 E;  1XWE A;  1TWC B;  5IGG A;  2BE5 C;  1STH A;  3GV3 A;  1ICW A;  2EJM A;  2PZU A;  1TWF B;  2IX3 A;  1CM9 A;  1KDA A;  3EA6 A;  2QIL A;  4A3G B;  2EYL A;  1E2W A;  5A35 A;  4A3E B;  1JIC A;  2A6E D;  5KND A;  2MPM A;  4OO1 I;  5D3I B;  3ND8 A;  4HED A;  1HA5 A;  2AQ3 B;  1FGB D;  2WII B;  1X3P A;  2F0W A;  4R9W A;  1CA6 A;  2B2W A;  1B50 A;  4A3M B;  1E2Z A;  1OO9 B;  2HCI A;  5C0X H;  1V1P A;  1PZJ D;  4HMJ A;  4PMW A;  4LMQ D;  1SYD A;  3I70 A;  5C3X A;  1EIH A;  2L1B A;  3R8B A;  4MIU A;  5DNF A;  3HZX A;  2IWH A;  2A5H A;  1ZYR C;  5C4J B;  2F0U A;  1TWA B;  3ZYY X;  2AQ2 B;  1SE3 A;  4KTA A;  2VB2 X;  3A7A B;  1SSO A;  1WCM B;  2KQ3 A;  1F9Q A;  3S2D B;  3NTH A;  3NTK A;  2EYM A;  2XRS D;  1SDF A;  1JR0 D;  4CKC A;  5C44 B;  5LHY 1;  3X3N A;  1W6J A;  1S5C D;  3M7G A;  3O13 A;  2LY7 A;  2Q8T A;  2NVY B;  4OGQ C;  4V19 0;  5ELE A;  1JC7 A;  2JEA I;  1EL0 A;  1V43 A;  1LTB D;  3MEH A;  4G7H C;  2R93 B;  1KTK A;  5EJW A;  2IT1 A;  5C0X G;  2X69 A;  3VR6 A;  1DM0 B;  3IKJ A;  1CHP D;  1ZEQ X;  4A3D B;  3DWP A;  2B2U A;  4K6L A;  3MXU A;  4WFN 3;  1WTR A;  2SOB A;  1PFM A;  4MHE A;  3IAY A;  2L9H A;  2PYK A;  4HCS A;  3JAM E;  3NWT A;  1RTN A;  1OXT A;  3E5S A;  3OIQ A;  5I6W A;  3GTL B;  4EQO A;  3SR1 A;  2KED A;  2F0K A;  3NSW A;  1B1Z A;  4C3H B;  1VF7 A;  2JEB I;  2A69 C;  1CTM A;  2A74 C;  3S15 B;  2AWO A;  3OPO A;  3MFG A;  2B2Y C;  4DFA A;  1SYB A;  3H3V C;  3MAQ A;  1GHJ A;  2F0P A;  5C5L A;  2EY1 A;  3K5N A;  1OXU A;  3NUC A;  4OIJ A;  4CHT B;  1Q3L A;  3NQI A;  1VDZ A;  5JPM C;  4KKU A;  1LAC A;  4G57 A;  1Y1V B;  2RKS A;  5KIX A;  5IGF A;  1EU3 A;  2R6G A;  1OXX K;  2K7V A;  4PMB A;  4S3S A;  2DNC A;  1TR5 A;  1HFG A;  3K0Y A;  4KV6 A;  1RTO A;  4BY1 B;  3DEO A;  1MD2 D;  5FK9 C;  1KLU D;  1H9R A;  1MI2 A;  1W6K A;  2A6H D;  1D6E C;  1PMR A;  2M00 A;  3QOJ A;  5ELB A;  5C4Z A;  1CA5 A;  3DM1 A;  1I3Q B;  4O42 A;  4RKL A;  5KYL A;  3ND9 A;  4DK1 A;  1HPC A;  5KYI A;  3KBX A;  2NN6 H;  4DNT B;  3K5O A;  1WTV A;  1TWG B;  1A6X A;  4X3S A;  5JPN C;  1KDB A;  1FR3 A;  2KA7 A;  1FNU A;  3KK7 A;  3Q22 A;  4ZUI A;  3D31 A;  2GA4 B;  1J9O A;  3C2P A;  1HTP A;  2C9O A;  2VXW A;  1EZ6 A;  2F0E A;  1X3Q A;  4IZ8 A;  5EPL A;  2JA5 B;  3D4R A;  4QMG A;  5K5P A;  4B08 A;  3I90 A;  2B2V A;  5CGK A;  2KCC A;  3T13 A;  1IW7 D;  5JOB A;  5C3E B;  2J7Z A;  1PRT B;  1XXG A;  2KEC A;  1PRT D;  1CT1 D;  2BA0 A;  3S14 B;  3VR5 A;  4GZY C;  3TDQ A;  2N55 A;  1LAB A;  1BCP B;  1TVX A;  3SXH A;  1BCP D;  5M9O A;  1Y1W B;  2Z8L A;  1S5E D;  2OXP A;  1F2M A;  1B44 D;  1XX8 A;  1D5Z C;  1JOQ A;  4RGN A;  1OXS C;  3NTI A;  2Z1C A;  1SFO B;  5E3F A;  1STA A;  3HRZ C;  1AFP A;  5FO8 B;  4CJ2 C;  2QKI C;  3OOC A;  1B2T A;  4KI0 A;  3DXJ C;  5FKA C;  4EQP A;  5IGC A;  2AQ1 B;  2FHT A;  2EYF A;  2F3W A;  2Z4H A;  1S4Z A;  1LTS D;  5COY A;  5ELD A;  2KCN A;  2O5I C;  4DF7 A;  3HP3 A;  3TP7 A;  3BZD B;  3S16 B;  4BBS B;  2F0L A;  2K03 A;  2L4N A;  3OMG A;  5E1F A;  3TZD A;  2K32 A;  1RJT A;  3DEP A;  2EY6 A;  1WTX A;  4KKS A;  2I07 B;  4QUF A;  4HN7 A;  2WKC A;  1LTT D;  5EKI A;  3SE0 A;  5G3L D;  3GO5 A;  3H94 A;  1H9S B;  3S1N B;  4NMZ A;  3K58 A;  3FVQ A;  3MWY W;  1ET9 A;  1GXD C;  1EEF D;  3GTO B;  1EYC A;  1STN A;  3L7Z C;  2N88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...