3RMHA

Crystal structure of yeast telomere protein cdc13 ob4
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
130
structure length
127
Chain Sequence
QYEVVEDHNISQLNHLQHLTPKIYVLNVYIIDVEIVYDQEIRIKVVNELPLVGKYVPPVDILEVYITGKEEVQNFLGDEVLTMDIFTPLLNETSRLRVFQRPDRIIRWSPIECTIQELRLQRMFRLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Yeast Cdc13 OB4
publication title Analyses of Candida Cdc13 Orthologues Revealed a Novel OB Fold Dimer Arrangement, Dimerization-Assisted DNA Binding, and Substantial Structural Differences between Cdc13 and RPA70.
pubmed doi rcsb
source organism Candida glabrata
total genus 31
structure length 127
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18233 Cdc13_OB4_dimer Cdc13 OB4 dimerization domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.810 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3rmhA00
3RMHA
chains in the Genus database with same CATH superfamily
1EQRA 3C3LA 2A74C 4ZK9B 3TP5A 3R2TA 1ZYRC 3P1HA 3MXNA 3S1RB 4RWSC 4NDXA 2ZJPA 4K2KA 1MIUA 3GP7A 2NVYB 1Q82C 1SYDA 1S5DD 1ILQA 1CQVA 1M1KC 2L4NA 4G4KA 4QF4A 4BY7G 5GAEC 1X9NA 3S24A 1QG7A 4B08A 3ULPA 1YVCA 3HOXH 1NJIC 3I4MH 1LTRD 2KBNA 1QWYA 2H5XA 1F9SA 1FL0A 1IHZA 3KBXA 1U4LA 2UUBL 1GO3E 1LT3D 1DOKA 4QMGA 4YCUA 2E2JH 1KIXA 1V9PA 4GLVB 5CV7A 1FJGQ 4Y52H 1GM5A 3CMEA 1VQAA 5EKIA 1BO0A 1EQQA 2I5HA 4MTKA 3JC66 2RA4A 3G71A 5CORA 4B9WA 3H6MA 4X66L 3BZDB 4RGNA 3EROA 3M4QA 1RF2D 4DGZA 2QGQA 2K5HA 5FO7B 2N49A 1HXYD 1WD0A 1O78A 4AIMA 1WYDA 2WP8J 3CCSA 4DR1L 5C4JH 2EYLA 2JXMB 3D6WA 4N9TA 3HOZB 4PG3A 1IBKL 1GUGA 4NXML 3J81j 1JOQA 4RGMA 3CC4A 3CQZH 3NE5B 2L0CA 5IGGA 1VQ7A 2JA8H 4KJOA 1BCPB 1PH1A 3RNUA 2FXQA 1B9NA 2WV6D 1UE7A 5DAUA 4JI1Q 1SAPA 4AH6A 3CPFA 4IUTA 2PQEA 4LF4Q 1YEZA 3MVVA 5IODA 1KAAA 4Z9CB 1A0IA 2QCPX 3VYRA 3UI2A 3NTHA 1O7ZA 2HIXA 4A3IH 2B3GA 1J8IA 2NTTA 1HZBA 2B29A 4Q5VA 3D4RA 1EIYB 3CMAA 1HPCA 1HQRD 5G3LD 2FMCA 1Q81C 1LTTD 4POGA 3KF6B 1TS5A 4QB4A 5ELFA 4DNTB 1D5ZC 3WWVA 5M5XH 2PPBC 1AEXA 2D62A 2KHSA 2HIVA 3RZOB 1B70B 3DM3A 5BN5A 4K0KL 2ZTCA 2D2CC 2F0GA 5F2DA 1XNRQ 3PUYA 1OXXK 3TZUA 1N33Q 2XN9C 1TU2B 1JJGA 4C3JG 4DN4M 3I56A 2NB0A 1W3SA 3K58A 3H09A 3U50C 1EEFD 3FHWA 1VQEA 3TQYA 3I72A 1QNUA 3F8TA 4OO1H 4OEMB 1DXMA 1LT5D 4PQXA 3IAYA 3D3RA 1O7LA 3PQIA 4G7HC 2ICIA 3V2TA 3J81L 3OTOQ 2BOSA 3VR5A 3QIAA 1ENCA 3I7FA 4BBSG 1A3UA 1HQMC 3H0GB 3I55A 4IUQA 4JBKA 1F2LA 2IHEA 2BH2A 1Q86C 4GKKL 4XQJA 3A7LA 3P7JA 4AYBE 1RJTA 2K04A 4GN5A 5NUCA 1NCVA 5K5PA 1HNZQ 4NP5A 1AFPA 2Q2UA 4J6HA 4GZYC 1HNWL 5IT9E 4A3BG 2K5WA 4RA8A 2F0EA 4DV3Q 1BBWA 4RMFA 3KJOA 2PZTA 4QUFA 3V96A 2HT1A 3EFXD 4PNYA 2YU9B 3TBIB 4LFCQ 1B2TA 1VQ8A 4FF2A 1X56A 1ZXTA 5DLQE 5JPMC 3U9SA 3UDGA 1SDFA 1Q1EA 3ERSX 2SNSA 3A0JA 4A93H 4KY6A 4DXFA 1I50H 1LT6D 2HCCA 1ZYRD 3HOYB 2BCOA 5M5WB 4HJ9A 4KK7A 5IYBH 4PZ6A 2XNAC 4M8AA 5IIFA 2KVMA 2Y0SB 1VQMA 1MD2D 4IPCA 1B1ZA 3HOVG 4V190 3AB9A 1F9RA 3S16B 1CSQA 4HIDA 1S5BD 3FPUB 3PIOA 1SNPA 4K8JA 2WINB 3GTGB 3BVZA 3S1QB 1STYA 4DV2Q 5C44G 4DV0L 4GLXA 2UUCL 4ME3A 3CCQA 4HJ5A 2UU9L 1PTOC 2MGSA 5CV6A 4J15A 2GVAA 4P74A 1BXTA 4FXGC 4FP5D 4F87A 5CBAE 2NVXB 1HR0L 2L55A 3NBHA 2K75A 1KL9A 2AQ2B 3DEOA 2HHHL 4ZLTF 4MZ9A 1VS0A 1IYUA 4BY7B 4A3KB 1H9SA 1WD1A 4JI5L 5DM73 4X64L 3HOWH 5M5YB 4X3TA 2F4VL 1NMFA 2IL8A 1P16A 1J5EL 4JG2A 2EZVA 2L11A 1ENFA 1AP0A 4HJ7A 4HEDA 4R4TA 1CK1A 4X65Q 4A3DG 1XX8A 4HCSA 1NUCA 3HZXA 4JBMA 3H15A 1CI3M 2RCFA 1YHBA 4PZ7A 3CCVA 3A55A 4OWTB 4LFAL 5KYIA 1IW7D 2PMZB 1TR5A 1QUQB 4BWGB 4GOPB 4GKJQ 3UDXA 4DR1Q 2K28A 4MIUA 1V43A 1CSPA 1X3FA 3HOYH 3L0OA 3OW2A 5JVH3 5D3DA 4ZAIA 1IKLA 5M5WH 4GS3A 4DR3Q 2N55A 1XXGA 1WOCA 3OMCA 2ALYB 3GV3A 3TDQA 4DR2Q 3EBEA 1ONLA 1KABA 4CJ0B 2EVBA 1R4PB 4C1NI 1J6QA 1DGSA 3I4NH 2E2HB 2JE6I 4A3MH 4UDUC 1Y8NB 4ZUJA 4IUVA 1KDAA 4OIJA 1ICFB 2RDGA 4IN3A 4JPBW 3GTGH 1YHQA 3S1QH 1Q8IA 3CRLC 2JA8G 3U58A 4G7OC 3K0XA 2E2DC 3DLLA 2RSOA 1JE5A 4JI6L 1TWGH 3TZDA 2NVXH 1VQIA 1BKBA 2YTYA 4K5XA 1LT4D 2D0OA 2F0WA 2ZM6Q 2HUGA 3BZKA 1FR3A 1I94L 1AW7A 4A3KH 2JP1A 3D31A 1K83B 2YTVA 2N78A 5KGUA 1VF5C 5I4DA 2KHIA 1EY4A 1Y1WH 2ICEC 1RD9D 5IP9H 4C3JB 3CXCA 2WFWA 1JORA 2NZ1D 2R93B 1CA5A 3PUXA 1PLFA 2LXKA 3S17B 1IXRA 3CP0A 3M7GA 4EX5A 1X3EA 2A8VA 1AE2A 4X3UA 1NAPA 3OWFA 2B8GA 3S2DH 3OPOA 5ELBA 1PZID 4DAPA 1I5FA 4OO1G 4RFBA 3NSWA 1A2UA 4LW1A 1D8LA 1JOOA 3X3MA 4Q0FA 5EAYA 2M9VA 3PO3H 1Y1VH 4YWMA 4H13C 4XTCS 5CYUA 3C2PA 1TWCH 2EE1A 4G57A 2EYHA 4XYQA 5C0XH 3NXWA 5HURA 1PYWD 5KNCA 3RN2A 2E5LL 3HEJA 4LUOA 3M4YA 4KI0A 1E2ZA 1TWHB 1MHWC 3A5ZB 3M3YH 5FLXc 4IPHA 3HOZG 1VQOA 2ZJRA 2A6EC 1ASYA 1VQFA 3KOJA 1B8AA 2VB3X 1I4GA 3RLFA 1NBWA 1TWFH 3TP8A 3BU2A 5CV5A 1HZ9A 3VR4A 2NVTH 1YNXA 3PO2H 4O2DA 3J7AV 3O13A 1JWUD 5KRUA 1CKNB 4R4QA 3A8JE 2E8GA 1PTOD 1PH6A 2OQ0A 4A93G 1EFID 1U4MA 2JA5H 3M4OH 3OMGA 4E6IA 2NN6G 4XXEA 4A3GB 1GJXA 4JI1L 1AH9A 2B2TA 1YJWA 1PFSA 2F0PA 1H9RA 4XT1B 5M3MH 1WTQA 3HOVB 4C3HB 4A3FB 4AQYQ 5AFWA 3VA7A 5IYBG 3DUZA 2MQHA 5IP7G 1EY5A 1WTHA 2Z1CA 2WAQE 1QOHA 4C3IH 4YY3Q 5EBDA 1NTGA 2VQFQ 3HRZC 3PIO3 2CWAA 2NYZD 3CCMA 2F4VQ 1XNRL 3K7AB 1N33L 2L12A 5E4WC 1ZKOA 1UEAB 4X3SA 3P20A 3E9IA 2J4XA 3R2IA 2F3IA 3L7ZC 1HRJA 4UY8C 3F2DA 3H0GG 1B50A 2CQAA 3KFUA 4ZKCB 1N32Q 4LFAQ 2F0NA 2EY6A 3OTOL 2Z6KA 3C1FA 3HOWG 1HUNA 1PZJD 3HOXB 1ASZA 3I4MB 4HSVA 1OO9B 3AMUA 1Q46A 1TVXA 2WIIB 4HSPA 2PO4A 1TWHH 1GUNA 2DJGC 3S15B 2JSOA 2C35B 2JA7B 1B53A 1BF4A 3KLRA 2L15A 2E2JB 2N88A 4LUZA 2Z9HA 2XIWA 4WJ4A 1PMRA 3BDCA 3I70A 1PXUA 3MXUA 4A3LH 2EIFA 1HNZL 2Z0SA 1VDZA 3HG9A 1P8LA 3CU7A 2BE5C 3KBGA 1WTOA 2MFIA 1L1OB 4DV3L 4IFDJ 1PRTF 2FFKB 4DV1Q 1F9QA 4YIJA 5JJLA 4I65A 1K8OA 4LFCL 4MTNA 1ET6A 1KDBA 4ZKBB 1T5EA 5I2XA 4A3GH 2F1MA 2XVSA 3HOYG 5IYCH 5E1FA 3TS0A 5FLXE 3G7LA 1S40A 1IBML 3EVQA 4A3FH 2SDFA 2RHSB 3A7AB 4IJHA 1CHPD 3PIPA 1WVLA 2Y0SG 1S5FD 2IJ0A 3SK8A 1UUPA 1SNCA 4HIMA 4RHRA 3I4NG 4WJWA 3W5OA 3DWPA 3QWNA 1S5CD 3T1HQ 3SK6A 3HKZE 1PFBA 1BR9A 2JA8B 1I94Q 2VXWA 4KLKA 1I6HB 2QEJC 3SR1A 2R7FA 1XJVA 2EYPA 3K7AH 1SNQA 2F3WA 4A3IB 4QL5A 5GAGC 5LMNQ 5LMNW 4DR7L 4Y7NH 3JAML 3X3NA 1GUWA 4DV2L 1XPRA 1QVGA 5C3WA 3TN2A 5M5XB 1DYQA 2VB2X 5BR8Q 2CH4W 1SYBA 3WDNA 4A3KG 5K36H 2I5LX 2MNAA 3STBC 1O80A 1LUZA 4B3ML 1OXVA 3MEHA 3ULJA 1JB7A 3S15H 4N8FA 5L37A 5IP9G 2JA7H 3K0YA 2WACA 1A8VA 2K01A 2D5DA 4RGTA 2HDMA 1LTGD 1CUKA 5IT9c 2F4IA 2CH4A 2EPBA 4JI8Q 2A6ED 4U68A 2AUKA 1F2ZA 1LTID 1HNXL 5ELOA 2XTIA 2ZT9C 4IO9A 3K7UC 2N3SA 1V1OA 5IWAQ 2G5DA 4X65L 1KAWA 2E5LQ 2TMPA 2EJMA 4B3TQ 1WCMH 4IFDI 1YHAA 2EYJA 4CBVA 3DHQA 3J80L 1D6EC 3I90A 1VQJA 4JI2Q 1VQLA 4RHSA 3PO3G 1Y1VG 4U673 2ES2A 3E5SA 1RODA 3D8GA 5EPKA 4GKJL 3E6ZX 5LMUL 2PI2A 1EIHA 2DNCA 3NELA 4KHZA 4FYDA 3G4SA 2KQ3A 1PV4A 1CHQD 4HJ8A 1PH8A 2IW3A 4ABNA 2VS1A 2IX1A 4OXPA 4DR3L 1IYVA 2HQEA 1ET9A 5ELEA 1QCBD 2LY7A 1I3QH 1I6HH 4XT3B 4DR2L 2Z4IA 4AYBB 5EBCA 2B2YC 3UE1A 5G3LF 4A93B 4A3JB 2TSSA 1EZ6A 2B2YA 1F9PA 1K9MC 1I50B 4TSSA 2LMCB 1JWSD 2QEXA 1L0XB 1MI2A 1SYCA 1SE4A 5KYLA 2JA5G 2A68C 4BBRH 3GV6A 1BOSA 4LF7L 1EZ8A 3J7AF 2KJXA 2HD3A 1GD7A 4UAIA 2IT1A 5C5MA 3I73A 3T16A 4F7XA 2J7ZA 2R6GA 5M3MG 3T51B 4OO1I 3MXGA 3MFYA 1SMYC 2KA7A 1BVSA 3S2HH 3NTKA 2AUJD 4KV6A 2ZM6L 1O7YA 3S1MB 2R93G 1SE3A 1FVIA 4BXXH 4C3IG 4KKSA 1KLGD 1F2YA 5FK9C 2O5JC 3TMEA 3KUPA 2YTXA 1FNVA 3A8KE 1BCPC 5JVG3 2EXZA 2K52A 2BE5D 3G48A 2KCNA 1JQYD 5M9OA 3MTSA 2UXDQ 3UE0A 5C3EH 4L63B 2QF7A 2WAQG 4HJAA 4LF6Q 1YBYA 2OCEA 3HOWB 1Z9FA 1A2TA 1Q3LA 2F0IA 2Z8LA 3F2CA 4DR5Q 1G91A 5EPJA 4KHVA 3AEVA 1LO5D 1SR3A 2AKWB 3NTIA 2MO1A 3KF6A 1EYGA 4P75A 5IYDH 3Q23A 1PH9A 1VCIA 2B2UA 4DR6Q 1D2BA 1RDPD 2KUMA 2NN6I 3GTOB 5J39A 1C9OA 3GO5A 4K6LA 3VYUA 2R92H 4MHEA 2XWJB 4IUPA 3GTMH 4HTHA 3SDZA 3VR2A 5JJIA 1IBMQ 2IPKD 3J80c 4YHHQ 4A3JH 1G51A 4CDDC 5IGEA 3GTJH 2RHQB 1JT8A 5KEEA 3FRPB 3LX0A 1EOVA 4IPDA 4DA2A 3M9BA 3BVMA 4LF5Q 1IYJB 4X6AH 2KCMA 1JJ2A 1DOMA 2JEAI 3UDIA 4KN7C 4PZ8A 4A3GG 1AZPA 4DK0A 3K5OA 5E3FA 1S3OA 5IYCG 1K0RA 4GN3B 3PMFA 2QDBA 4C3HG 4A3FG 4KKUA 1EWHA 1N9WA 4A3EB 3STBD 3T1YQ 3I4NB 4JI4Q 1HTPA 2RVLA 4LK1C 3J7A5 2F0KA 4QGUA 4A3MB 5GADC 3S1MH 2K5VA 4DR7Q 3NP8A 3PIP3 1G6PA 1S72A 3ZJYC 4DUZQ 2ASBA 1VQDA 3CCLA 4DNRB 2E76C 2QA4A 4H7BA 4KJNA 1PVOA 4AQYL 1EIGA 4OWWB 4KY7A 4B3MQ 3TSSA 4K2LA 4LAAA 1TWGB 2FMMA 5HGTA 3A74A 4J8QA 4YY3L 3E0EA 2VQFL 1VMPA 4QCLA 5CR3A 3MFGA 3RN5A 4LJZC 3HKZG 2GVBA 2KECA 1H9MA 1LYLA 1B3QA 3ICEA 1HNXQ 1QVCA 3N6RA 5K36G 1Y1WB 1CZWA 1LTLA 3ND8A 1SLJA 2LXJA 2EYOA 1UAPA 2MJ8A 3WOEA 4K8IA 2ENBA 4L5SA 4OONA 1F2MA 3HOXG 1N34Q 3I4MG 4JYAQ 2R7DA 2PNHA 4FF1A 4CDFC 3H3VC 4FXDA 2JA7G 3GTOH 3J81c 1DJRD 2V1CC 1KLUD 4K5WA 3QG1A 1N32L 1VQNA 1X6OA 1QNKA 1SROA 1TIID 1EY7A 4IQZA 3S2DB 1C4QA 5ELDA 2A6HC 5BN3A 1XMOQ 1EOTA 5LMUQ 3H3VI 1PTOH 3B6YA 4YWLA 3R93A 1F77A 3BDLA 1HFNA 5T1GA 1STBA 1VQHA 4NB3A 2N8NA 5GQOA 4M1UB 2F0UA 2EOTA 1I4RA 3OHXC 4LNQA 2DY7A 1C7YA 3PO3B 1Y1VB 2OT2A 1PRTB 3BG3A 5EPLA 1TWCB 1LV9A 2F0FA 2JA6H 2K1BA 5JPNC 2G9HD 4FF4A 2F0QA 4A3EH 3LWUA 1SYFA 1AZQA 4F88A 4DV1L 5COYA 3V05A 1EU3A 2JJQA 4KHPQ 4O1NA 3M3YB 2F0LA 1I4PA 4B3SQ 3CKIB 2EQSA 1R4QB 4FF3A 1SMYD 3GTKH 1PH7A 3J80E 1SE2A 2BDOA 3FP9A 1HA6A 1AE3A 1SNMA 1SJED 1TWFB 4R4CA 5ELCA 1Q1BA 2NVTB 4LF7Q 1WTPA 3PO2B 1GKHA 1C8CA 3IFTA 1LTSD 2AQ1B 1I4QA 2Z4HA 3VR3A 1DD2A 2MO0A 4NXNQ 2EY1A 3T1HL 4CKCA 4A3IG 4EQNA 4OELB 3KYHC 5JEAH 2VUMH 1SMXA 1VF7A 1U9RA 4ZYSA 2CVRA 2JA5B 1K0SA 3M4OB 4L5QA 3MA2B 4LF8Q 2BDNA 4GOPC 3FKIB 4CKBA 2EYFA 1KRTA 1SYEA 2JN4A 1PHJA 4XIGS 3S1NB 1A6XA 3RUZA 5M3MB 1QUQA 4BBRG 4GOPA 3OSOA 1MBYA 4HAEA 2WKCA 4KKTA 5J1ZA 1CFMA 4DFAA 4O42A 5IGCA 5LMNL 1Q7YC 5C4HA 1STGA 2X69A 1EYDA 5DNFA 1SFOB 2YYZA 4B3RL 3KF8B 4P72A 5CBEE 1A62A 2AQ3B 4C3IB 1Z47A 5DM63 1ICWA 5BR8L 3K5MA 1BNZA 1NMGA 1SN8A 4IZ8A 4BXXG 1MJCA 1V8QA 1BUVT 1W2BA 3OOCA 1LTAD 5DEHA 1TQOA 3I2ZA 1FGBD 1R9TB 3E0JA 2QDLA 1WTVA 1RIPA 3A5UA 2WAQB 4L5TA 4JI8L 5E7NA 1Y8OB 3BVGA 4H44C 3HFZB 2Q8TA 1SNDA 3PCOB 4XQNA 5C3EG 5IWAL 4OX9Q 4B9XA 1QZGA 1QZHA 3J81E 4C56C 3VA5A 1CKMA 4B3TL 4TQUS 1N36L 4HCEA 1CQFA 3AQQA 5D14A 1BBXC 1ESFA 2B2WA 3E9HA 1E0BA 3FPPA 3ERQA 3FVQA 5IGBA 4JK1C 2VQEL 3AYHB 2IWHA 4K6DA 3GTQH 3IRBA 4QIWE 4JI2L 5IYDG 5I2YA 5I9OA 2SNMA 1PTOF 2I0QA 2Q2HA 2DY8A 3I4OA 1XMQQ 4JOIC 2A69C 4AYBG 3QB3A 2WB1E 4R4OA 5T1IA 4IURA 2OWOA 3A8IE 4DUYQ 3KF8A 3RLNA 3CC2A 1SNOA 4A3JG 2ZTDA 2B2TC 2NUCA 4JOIA 1SBBB 1V1PB 4BY1B 1G6ZA 4OWXB 1XPUA 2EJFC 3FKIH 1VQ4A 3ER0A 2L1BA 2BH8A 2UXCL 2QILA 3S1NH 4CJ1B 4JI0Q 1KNEA 4GNXB 4MNOA 1WI5A 2F0HA 4WRDA 4WJ3M 3NENA 3W2DA 3OW7A 2VY3A 4H02A 1SRUA 3BDOA 1SFOH 2LKVA 4UP7A 2VL6A 4UPAA 2XWBB 3TRZA 3R3OA 5HGQA 2VNUD 2A19A 2OTJA 3CC7A 3J7YW 1YJ9A 4ME5A 1LACA 4RAUC 3BYTB 3T4AC 3KLSX 5H1SE 1E1OA 2K7VA 2R7ZB 2FINB 4R9WA 1GVPA 3D6CA 3W1GA 3GD7A 3MEFA 1I4HA 3LNNA 4JV5Q 3HKSA 3PGZA 1KTKA 2K03A 1U4PA 3VR6A 1X3QA 2A6HD 4Y7NB 3BS1A 1R9TH 2AWNA 2LFNA 2K5QA 3HKZB 4C1NK 5BN4A 5FOBB 2F0VA 2Z6KC 3L3OC 4L6TB 4IJLA 3KDFB 1CKNA 4HN7A 3SVMA 2EXDA 2K5DA 1EEID 5C4ZA 2WKDA 3UDFA 4QJFA 3GTPB 4BA2I 4ALPA 2CW0C 4DAYB 2PQAB 5LHY1 2UXDL 5JJZA 2UXBL 3Q8DA 5CMDA 4LF6L 5IY0A 3VYSA 1IKMA 1PA6A 2NWGA 3VYTA 4GNXA 1VQ6A 5E4XA 2F0DA 4GLAC 1XNQQ 1KRSA 1HZCA 4DR5L 3M7NA 4K5VA 3K5LA 4LFBL 1HCZA 2XRQD 1E2WA 2AMCB 1QJOA 4KTAA 1JB3A 3MXNB 1XYIA 1FD7D 3NQTA 1WCMB 4QUCA 3RZDH 4BY1H 4RG1A 3L9AX 1HH2P 1RKNA 4NW2A 4IPGA 3RMHA 4DR6L 3U9OA 2MUYA 2MHVA 3EJIA 1NR4A 2QW7A 1TS4A 2PW7A 2JA9A 4YHHL 3DEPA 3HGBA 2JA6G 2MP1A 3DWAA 1M8AA 1CKOA 1A15A 5C6AA 4A3EG 4LF5L 3CF5A 1UWVA 4A3MG 4R1JA 4OL7A 1B7YB 1B3AA 1E7ZA 1I3QB 4HMJA 5IGDA 5J3BA 3IL8A 4FNFA 1JR0D 1WTRA 2R7ZH 4HR7B 4JI7Q 3K8AA 1EQTA 1XTDA 2NZOA 3T1YL 4JI4L 5A35A 1SJHD 1GXDC 1Z7TA 5C44H 5CV8A 4B3RQ 4RCNA 1TS2A 2NBFA 1E3PA 4DUZL 5HY6A 4PMWA 5IE8A 5JEAG 1L1OC 2VUMG 4BBRB 1E1TA 1Q90A 4BA1I 1E24A 1L1OA 4X62Q 1PH5A 3GTPH 1UEBA 1Y1WG 3D4DA 3CHBD 1G291 2CQOA 1L2FA 4DK6C 4QY7A 3S2HB 1H9KA 1VQCA 4XDXA 4CDEC 1EIFA 2IX0A 5CC4A 1JCKB 2CWPA 2SEBD 2NZHA 4BS9A 5C4XH 2FJ2A 2Q8IB 3J80i 2G9DA 2HQLA 3D0FA 4TKOB 1HJPA 1PH3A 2B63B 1EY9A 3DXJC 4CKEA 4A3DH 2PZWA 3NQIA 1HTLD 2P5ZX 1N34L 4JYAL 1N36Q 4L8JA 3KLWA 3CAMA 1VMCA 2A69D 1SXTA 3SK5A 1D1KA 2LSSA 2OF1A 3EN2A 2BA1A 1PYSB 1UE1A 4DV6Q 2EY5A 3W3AA 2VQEQ 1MJEA 5C3EB 1FNWA 2CKZB 5JOBA 4ZUIA 4A76A 2L5TA 3RR5A 4LMQD 3TS2A 4IUNA 1XMOL 1E22A 5C0XG 5M3FH 1O7IA 3SGIA 2L9HA 3CW2C 1KQSA 1ESRA 4RKLA 4DU9A 3NUCA 1ZEQX 4DK3C 1YITA 1HHVA 1K73C 4MN3A 4JI3L 1LTBD 5GROA 1N8RC 3PV0A 3OIPA 3I4LA 1HZAA 4R8IA 1K3BC 1DOLA 3FEWX 2R92B 2F0JA 5FO8B 1NR2A 3K57A 2UXCQ 1V1QA 2OQKA 1IL8A 5J22A 3GTMB 4K14A 4IFDH 1TY0A 2CFMA 2IHFA 3PO2G 1RL2A 1T5XD 2PI2E 4O0AA 4NKLA 1IL2A 4KHPL 3GTJB 1PH2A 4B3SL 2E75C 1MGSA 1IW7C 1G2SA 1M4VA 1TS3A 1SEBD 3OYYA 1M90C 4I7AA 3FKIG 5IOCA 1X54A 1VQBA 1B4OA 2DNEA 2EDGA 4LF9Q 3M85A 1YJNA 1YI2A 3R8BA 1MKHA 4NXNL 5FJ8H 3S1RH 2JEBI 1SYGA 3J81i 3EIVA 1II3A 2WB1G 4ULLA 1UNSA 4GN4B 1ML0D 2NVYH 3MXPA 4LF8L 2E74C 4JBWA 3PUZA 4TVAB 3NWTA 2CW0D 3D4WA 3P75A 4S3SA 1ENAA 4DR4L 4APVA 2B63H 4DKAC 1L0YB 3JAMc 3VDYA 1IBLQ 1C0AA 5FO9B 1Y69U 4LUVA 1BQQT 2F03A 2ZTEA 1C48A 2Q2TA 2JQOA 5ISRA 3TP6A 2OEOA 2C9OA 2DGYA 2YV5A 1LLRD 2UXBQ 2F0MA 2H4OA 2RSNA 3LGJA 1Q8KA 3GTLB 1JOKA 2PZUA 2DN8A 5A2QL 4RKBA 3DMUA 3KLSA 4A3CH 1EU4A 5JAVA 2AHOB 4LFBQ 3CCUA 2ID0A 2B2UC 2J0TD 5LL6S 3WOFA 1EWIA 3SEBA 1DM0B 1YNNC 5I9PA 2F0SA 2AWOA 2NTSA 3SXHA 4UHVA 4ID6A 4DV7Q 1EFWA 4OX9L 4IALA 1K8GA 1GUSA 3PUVA 4A3LG 3HOZH 3EA6A 4XQQA 2MPMA 2PNRC 1LM0A 3Q6SA 2RDHA 3S14B 4OHJA 4DAVA 1QB5D 2O4XA 2ZXPA 1PTOB 1S5ED 1A3VA 2RCNA 4DPGA 2I5MX 3NBHB 4DV4Q 3BZCA 4F8MA 1TY2A 1H95A 4BY1G 5CGKA 1H9SB 3HOUB 2BA0A 1XMQL 4DV5L 1K8MA 2JA6B 1H9JA 1UE6A 1EWCA 4DUYL 1ILPA 3ND9A 4PMBA 5AJ3Q 4IOCA 2NN6H 2A1AA 1FGUA 1PFMA 4ZRZA 1KNAA 3A56A 3GTKB 5JEAJ 3J7ZC 3RZOH 1EY0A 2F52A 2KCTA 2HCIA 4JI0L 1FYCA 2V4DA 1QVFA 1D7QA 1OXUA 5IP7H 2FHTA 5GAHC 2R7ZG 3H94A 5I6WA 3G6EA 3PUWA 4HIKA 1G8ZD 2VUMB 3M4PA 1PH4A 2D9UA 5KNDA 1OXSC 1WFQA 3GTLH 4TRDA 1TT2A 4ZQ3A 5CV4A 2K14A 5FLMH 2IY5B 3F2BA 4JV5L 3K80C 1EL0A 3H0GH 3U4VA 1PYBA 2UUBQ 1TKWB 4NPSA 3JAME 3CCRA 1K8AC 2SOBA 4JCVE 3QJYA 1IZ6A 1GUTA 4EQPA 2ZXOA 3CPWA 1K28A 1KDCA 3KJPA 5LL6X 4LWCA 2RBMA 1VQ5A 2ZJQA 1CZGA 5C4XG 1T9HA 4DAMA 5C0XJ 4NMZA 3S14H 2XSCA 3NEMA 2EYMA 4A75A 2Q8RE 1E2VA 2JYOA 4X66Q 3F2UA 3CRKC 4RCOA 2K32A 1NNXA 3CCEA 2YU9H 3T56B 1WCMG 4JI3Q 5FLXL 2F3VA 4RH6A 4EQOA 5D3IB 3HOUH 1XNQL 1I4XA 1Y14B 2Y0SE 1Y8PB 1JICA 4WFN3 1KC8C 2A68D 2UUAL 4EVOA 4POFA 4H0LC 1IBKQ 4NXMQ 1D5XC 1GUOA 5M3FG 5CV9A 4C2MB 1X32A 1A3TA 3MZ5A 1RTOA 4CHTB 2O5IC 3GTQB 2KENA 4PV1C 2B8FA 4FVMA 3FDTA 3H3VH 4P2CB 1QILA 3ULLA 4DXGA 3CD6A 2X6GA 4JW0A 5EGTA 3S16H 1BCPF 3K5NA 3URYA 2JK8A 4IFDG 2RF4A 1CA6A 2EY2A 1J9OA 4A4IA 1MSGA 4I7ZC 1BCPD 1JWMD 4ILWA 1YNJC 2A73B 4EGVA 3MWYW 4QIWB 4L5RC 4JI7L 4DR4Q 3RLOA 2KOLA 3NHHA 4YCVA 4K0KQ 1CM9A 4HIOA 3F1ZA 3MHBA 1D5MC 1KD1C 1PRTC 2WB1B 5C5LA 5KIXA 2ATWA 1X65A 1RCVD 5FJ8G 1EY6A 5ELNA 5FKAC 1Z6HA 4BY7H 1JE4A 4P73A 2A5HA 1STEA 1STHA 5M5YH 2PCFB 2XGTA 4XYOA 1YNND 2PMZE 1EYCA 4WORA 4X62L 3GDEA 3G6JB 1S4ZA 4ODGA 1PDQA 3DWQA 3NK9A 2B63G 1K3RA 5C0XI 3BYYB 1WTWA 1NY4A 5C3XA 1KHIA 2M00A 4QQBX 4ZCKA 1EYAA 4GKKQ 2RQXA 2VW9A 1SSOA 2VZAA 1TWAB 2RDFA 3QOLA 3Q22A 2IX3A 2GN5A 1A63A 2B2WC 1JJCB 3SE0A 2PYKA 4BBSB 2B39A 1HNWQ 3I8ZA 3K81C 1DONA 2CCZA 1YZ6A 4A3CG 3AU7A 4YCWA 1LABA 2M2LA 2K5NA 4DV6L 4OIKA 4C2MH 1FJGL 1DCZA 1VQKA 1NSNS 3QR8A 1SE8A 3TREA 3Q0AA 4UP9A 1DZ1A 1BDOA 5EKKA 4RGOS 3HP3A 3NPPA 4A3BB 1QE6A 4JC0A 3T53B 2KEDA 1G2TA 4DV5Q 1CT1D 5A2QE 3Q24A 2R92G 4IOAA 2E2HH 1RTNA 2F0TA 3MAQA 1AN8A 1PFNA 4CJ2C 1BBUA 3RZDB 4JBJA 3RD4A 1XPOA 2K33A 1NE3A 1X3GA 1B44D 1UE5A 4EQ5A 1PZKD 1B9MA 4IUUA 1W6KA 2PW5A 1KXLA 1EQVA 2DUDA 3AFPA 3ITPA 4P71A 1U5KA 1TXYA 3OIQA 3C46A 4OGQC 4PMCA 3W1BA 2LS01 2I07B 2B2VC 2NVQB 5JJKA 3EQLC 4JVZA 1K83H 1WJJA 5EKLA 3U4ZA 4R4IA 4LF4L 4DV0Q 2UUCQ 1Q12A 2B2VA 2UU9Q 3HS0C 2I46A 4LF9L 3I91A 2E2IB 4C3JH 3K6OA 2C5CA 3A54A 3FMCA 2R93H 4YWKA 1RHPA 2K50A 3S17H 1JC7A 1HR0W 3SK4A 1HR0Q 3KK7A 3LWEA 5C44B 3AFQA 2Q2IA 1OXTA 2HHHQ 3H91A 3K59A 1X3PA 2F0OA 4KY5A 4JI5Q 1TWAH 4X64Q 1X55A 2Z6BA 3E3XA 3MC0B 1IBLL 4V0BA 1J5EQ 5IT9L 4BBSH 2HDLA 5IGFA 3SHLA 3L2PA 1XWEA 2ZXRA 1XTCD 5FLMG 3PF5A 2OXPA 1V1PA 1VQ9A 3C1EA 1GOZA 3QOJA 4KD4A 4GNXC 2OTLA 4N8X1 4FO2A 3N52A 3ONAB 3NWSA 5TSSA 5C4XB 4A3BH 2GA4B 4DF7A 1D1IA 3TP7A 2H1EA 4A3DB 2UUAQ 1CTMA 3BJUA 1GHKA 2X6LA 1VQGA 3QO2A 4J1MA 5D65A 1W6JA 4FXKC 2R3ZA 4N9PA 1VQPA 2DJFC 1I6VC 3TEHB 4DV7L 2KCCA 3IKJA 1HFGA 1U4RA 4KMUC 4KD3A 1OTCA 4DK1A 2K6AA 1YNJD 3HOUG 1L0WA 1U0LA 2R61A 2D0PA 4G7ZC 2KEEA 3GQBA 5M3FB 2K05A 2QKIC 5I6YA 1EUJA 2CHBD 3T13A 4DV4L 1STAA 3PF4A 1PRTD 3IFDA 4X3KA 2NVQH 4R8NA 1MSHA 3JAMi 5EJWA 3KDFA 2KHJA 3DM1A 4KN4C 1JMCA 2XRSD 4FDBA 2O2LD 4CDCC 3HOVH 4C3HH 3NBIA 3S9WA 3CCJA 1EY8A 2E2IH 4UP8A 1GHJA 5KNBA 5C4JB 2K4KA 3OWEB 5AJ3L 1HUMA 4DAYA 4DNIA 4JI6Q 5EQ0A 2PQAA 4CGYB 3CQZB 1STNA 1HA5A 3PSIA 3I3CA 4HMIA 3ZYYX 2RKSA 1WTXA 1FNUA 2EJGC 1YIJA
chains in the Genus database with same CATH topology
3C3LA 2A74C 4ZK9B 3TP5A 3R2TA 1ZYRC 3P1HA 3MXNA 3S1RB 4RWSC 4NDXA 4K2KA 3GP7A 2NVYB 1SYDA 1S5DD 1ILQA 1CQVA 2L4NA 4G4KA 4QF4A 1QG7A 4B08A 1LTRD 1QWYA 1F9SA 1IHZA 3KBXA 1U4LA 1LT3D 1DOKA 4QMGA 5CV7A 5EKIA 1BO0A 2RA4A 5CORA 4B9WA 3H6MA 3BZDB 4RGNA 3EROA 1RF2D 4DGZA 5FO7B 1HXYD 1WD0A 1O78A 2WP8J 2EYLA 2JXMB 3D6WA 4N9TA 3HOZB 1GUGA 1JOQA 4RGMA 3NE5B 2L0CA 5IGGA 4KJOA 1BCPB 1B9NA 2WV6D 5DAUA 1SAPA 4IUTA 2PQEA 3MVVA 5IODA 1KAAA 4Z9CB 2QCPX 3VYRA 3UI2A 3NTHA 1O7ZA 1J8IA 2NTTA 4Q5VA 3D4RA 1HQRD 1HPCA 5G3LD 2FMCA 1LTTD 1TS5A 4QB4A 5ELFA 4DNTB 1D5ZC 2PPBC 1AEXA 2D62A 2KHSA 3RZOB 5BN5A 2D2CC 2F0GA 5F2DA 3PUYA 1OXXK 3TZUA 2XN9C 1TU2B 4C3JG 4DN4M 2NB0A 3K58A 3H09A 1EEFD 3I72A 1QNUA 4OO1H 1DXMA 1LT5D 4PQXA 3IAYA 3D3RA 1O7LA 4G7HC 2ICIA 3V2TA 3J81L 2BOSA 3VR5A 3QIAA 1ENCA 1A3UA 1HQMC 3H0GB 4IUQA 1F2LA 4XQJA 3A7LA 3P7JA 1RJTA 2K04A 5NUCA 1NCVA 5K5PA 4NP5A 1AFPA 4GZYC 4J6HA 5IT9E 2K5WA 4RA8A 2F0EA 2PZTA 4QUFA 3V96A 3EFXD 4PNYA 2YU9B 3TBIB 1B2TA 4FF2A 1ZXTA 5JPMC 3U9SA 1SDFA 1Q1EA 2SNSA 4KY6A 4DXFA 1LT6D 2HCCA 1ZYRD 3HOYB 2BCOA 5M5WB 4KK7A 2XNAC 4M8AA 5IIFA 2KVMA 2Y0SB 1MD2D 1B1ZA 4V190 3AB9A 1F9RA 3S16B 1S5BD 3FPUB 1SNPA 4K8JA 2WINB 3GTGB 3BVZA 3S1QB 1STYA 1PTOC 2MGSA 5CV6A 1BXTA 4FP5D 4FXGC 4F87A 5CBAE 2NVXB 2L55A 3NBHA 2AQ2B 3DEOA 4ZLTF 1IYUA 4BY7B 4A3KB 1H9SA 1WD1A 5DM73 5M5YB 4X3TA 2IL8A 2EZVA 2L11A 1ENFA 1AP0A 4HEDA 1CK1A 1XX8A 4HCSA 1NUCA 3HZXA 1CI3M 3A55A 5KYIA 1IW7D 2PMZB 1TR5A 4BWGB 2K28A 4MIUA 1V43A 5JVH3 5D3DA 4ZAIA 1IKLA 2N55A 1XXGA 3OMCA 3GV3A 3TDQA 1ONLA 1KABA 4CJ0B 2EVBA 1R4PB 4C1NI 2E2HB 2JE6I 4UDUC 1Y8NB 4ZUJA 4IUVA 1KDAA 4OIJA 2RDGA 4IN3A 1Q8IA 3CRLC 4G7OC 2E2DC 2RSOA 3TZDA 4K5XA 1LT4D 2F0WA 2HUGA 1FR3A 1AW7A 2JP1A 3D31A 1K83B 5KGUA 1VF5C 5I4DA 1EY4A 2ICEC 1RD9D 4C3JB 1JORA 2NZ1D 2R93B 1CA5A 3PUXA 1PLFA 3S17B 3M7GA 4X3UA 1NAPA 3OWFA 2B8GA 3OPOA 5ELBA 1PZID 4DAPA 4OO1G 4RFBA 3NSWA 1A2UA 1JOOA 3X3MA 4Q0FA 2M9VA 4H13C 4XTCS 5CYUA 3C2PA 2EE1A 4G57A 2EYHA 4XYQA 5C0XH 5HURA 3NXWA 1PYWD 5KNCA 3HEJA 3M4YA 4KI0A 1E2ZA 1TWHB 2A6EC 2VB3X 1I4GA 3RLFA 3TP8A 5CV5A 3VR4A 3J7AV 3O13A 1JWUD 5KRUA 3A8JE 1PTOD 1EFID 1U4MA 3OMGA 4E6IA 2NN6G 4XXEA 4A3GB 1GJXA 2B2TA 2F0PA 1H9RA 4XT1B 1WTQA 3HOVB 4C3HB 4A3FB 5AFWA 3VA7A 3DUZA 1EY5A 2Z1CA 1QOHA 5EBDA 3HRZC 3PIO3 2NYZD 3K7AB 2L12A 5E4WC 1ZKOA 1UEAB 4X3SA 3P20A 2J4XA 3R2IA 3L7ZC 1HRJA 1B50A 2CQAA 4ZKCB 2F0NA 2EY6A 3C1FA 1HUNA 1PZJD 3HOXB 3I4MB 4HSVA 1OO9B 3AMUA 1TVXA 2WIIB 4HSPA 2PO4A 1GUNA 3S15B 2JSOA 2JA7B 1B53A 1BF4A 3KLRA 2E2JB 2N88A 2XIWA 1PMRA 3BDCA 3I70A 1PXUA 3MXUA 1VDZA 3HG9A 3CU7A 2BE5C 3KBGA 1WTOA 4IFDJ 1PRTF 2FFKB 1F9QA 4YIJA 4I65A 1K8OA 1ET6A 1KDBA 4ZKBB 1T5EA 5I2XA 2F1MA 2XVSA 5E1FA 5FLXE 3G7LA 3EVQA 2SDFA 3A7AB 1CHPD 1WVLA 1S5FD 2IJ0A 3SK8A 1UUPA 1SNCA 4RHRA 4WJWA 3DWPA 3QWNA 1S5CD 3SK6A 1PFBA 1BR9A 2JA8B 2VXWA 1I6HB 2QEJC 3SR1A 2EYPA 1SNQA 2F3WA 4A3IB 3JAML 3X3NA 1GUWA 5C3WA 3TN2A 5M5XB 1DYQA 2VB2X 1SYBA 3WDNA 5K36H 1O80A 1OXVA 3MEHA 3K0YA 2WACA 2K01A 2D5DA 4RGTA 2HDMA 1LTGD 2F4IA 2EPBA 2A6ED 4U68A 2AUKA 1F2ZA 1LTID 2ZT9C 1V1OA 2TMPA 2EJMA 4IFDI 2EYJA 4CBVA 3DHQA 3J80L 1D6EC 3I90A 4RHSA 4U673 3E5SA 1RODA 3D8GA 5EPKA 3E6ZX 1EIHA 2DNCA 4KHZA 4FYDA 2KQ3A 1CHQD 2IW3A 4ABNA 2IX1A 1IYVA 2HQEA 1ET9A 5ELEA 1QCBD 2LY7A 4XT3B 2Z4IA 4AYBB 5EBCA 2B2YC 5G3LF 4A93B 4A3JB 2TSSA 1EZ6A 2B2YA 1F9PA 1I50B 4TSSA 2LMCB 1JWSD 1L0XB 1MI2A 1SYCA 1SE4A 5KYLA 2A68C 3GV6A 1BOSA 3J7AF 1EZ8A 2KJXA 4UAIA 2IT1A 5C5MA 3I73A 3T16A 4F7XA 2J7ZA 2R6GA 3T51B 4OO1I 3MXGA 3MFYA 1SMYC 2KA7A 3NTKA 2AUJD 4KV6A 1O7YA 3S1MB 1SE3A 4C3IG 4KKSA 1KLGD 1F2YA 5FK9C 2O5JC 3TMEA 3KUPA 1FNVA 3A8KE 1BCPC 5JVG3 2EXZA 2BE5D 2KCNA 1JQYD 5M9OA 3MTSA 4L63B 2QF7A 3HOWB 1A2TA 1Q3LA 2F0IA 2Z8LA 1G91A 5EPJA 4KHVA 1LO5D 3NTIA 3Q23A 1VCIA 2B2UA 1D2BA 1RDPD 2KUMA 2NN6I 3GTOB 5J39A 3GO5A 4K6LA 3VYUA 4MHEA 2XWJB 4IUPA 4HTHA 3SDZA 3VR2A 2IPKD 5IGEA 5KEEA 3FRPB 3LX0A 4DA2A 3BVMA 1DOMA 2JEAI 4KN7C 1AZPA 4DK0A 3K5OA 5E3FA 3PMFA 2QDBA 4C3HG 4A3EB 4KKUA 1EWHA 3I4NB 1HTPA 2RVLA 4LK1C 2F0KA 4A3MB 3NP8A 3PIP3 4DNRB 2E76C 4H7BA 4KJNA 1EIGA 4KY7A 3TSSA 4K2LA 4LAAA 1TWGB 2FMMA 5HGTA 4J8QA 1VMPA 4QCLA 5CR3A 3MFGA 4LJZC 2KECA 1H9MA 3N6RA 5K36G 1Y1WB 1CZWA 3ND8A 2EYOA 1UAPA 2MJ8A 3WOEA 4K8IA 2ENBA 1F2MA 4FF1A 3H3VC 4FXDA 1DJRD 1KLUD 4K5WA 3QG1A 1QNKA 1TIID 1EY7A 4IQZA 3S2DB 1C4QA 5ELDA 2A6HC 5BN3A 1EOTA 1PTOH 3R93A 1F77A 3BDLA 1HFNA 5T1GA 1STBA 4M1UB 2F0UA 2EOTA 1I4RA 3OHXC 2DY7A 3PO3B 1Y1VB 2OT2A 1PRTB 3BG3A 5EPLA 1TWCB 1LV9A 2F0FA 2K1BA 5JPNC 2G9HD 4FF4A 2F0QA 3LWUA 1SYFA 1AZQA 4F88A 5COYA 3V05A 1EU3A 4O1NA 3M3YB 2F0LA 1I4PA 3CKIB 1R4QB 4FF3A 1SMYD 3J80E 1SE2A 2BDOA 1HA6A 1SNMA 1SJED 1TWFB 5ELCA 1Q1BA 2NVTB 1WTPA 3PO2B 1C8CA 3IFTA 1LTSD 2AQ1B 1I4QA 2Z4HA 3VR3A 1DD2A 2EY1A 4CKCA 4EQNA 5JEAH 1VF7A 1U9RA 4ZYSA 2CVRA 2JA5B 3M4OB 3MA2B 2BDNA 3FKIB 4CKBA 2EYFA 1SYEA 4XIGS 3S1NB 1A6XA 3RUZA 5M3MB 3OSOA 1MBYA 4HAEA 2WKCA 4KKTA 5J1ZA 1CFMA 4DFAA 4O42A 5IGCA 5C4HA 1STGA 2X69A 1EYDA 5DNFA 1SFOB 2YYZA 5CBEE 2AQ3B 4C3IB 1Z47A 5DM63 1ICWA 3K5MA 1BNZA 4IZ8A 1V8QA 1BUVT 3OOCA 1LTAD 5DEHA 1TQOA 1FGBD 1R9TB 3E0JA 1WTVA 2WAQB 1Y8OB 3BVGA 4H44C 2Q8TA 1SNDA 4XQNA 4B9XA 3J81E 4C56C 3VA5A 4TQUS 4HCEA 1CQFA 5D14A 1BBXC 1ESFA 2B2WA 1E0BA 3FPPA 3ERQA 3FVQA 5IGBA 4JK1C 2IWHA 4K6DA 5I2YA 5I9OA 2SNMA 1PTOF 2DY8A 2A69C 3QB3A 5T1IA 4IURA 3A8IE 3KF8A 1SNOA 2B2TC 2NUCA 1SBBB 1V1PB 4BY1B 1G6ZA 2EJFC 2L1BA 2QILA 4CJ1B 1KNEA 2F0HA 4WRDA 3W2DA 3OW7A 3BDOA 2LKVA 2XWBB 3R3OA 2VNUD 3J7YW 4ME5A 1LACA 4RAUC 3BYTB 3T4AC 3KLSX 2K7VA 2R7ZB 2FINB 4R9WA 3D6CA 3GD7A 1I4HA 3LNNA 1KTKA 2K03A 1U4PA 3VR6A 1X3QA 2A6HD 4Y7NB 3BS1A 2AWNA 2LFNA 2K5QA 3HKZB 4C1NK 5BN4A 5FOBB 2F0VA 3L3OC 4L6TB 4HN7A 3SVMA 2K5DA 1EEID 5C4ZA 2WKDA 3GTPB 4BA2I 2CW0C 5LHY1 5JJZA 5CMDA 3VYSA 1IKMA 2NWGA 3VYTA 5E4XA 2F0DA 3M7NA 4K5VA 3K5LA 1HCZA 2XRQD 1E2WA 1QJOA 4KTAA 1JB3A 1XYIA 1FD7D 3NQTA 1WCMB 4QUCA 3L9AX 1RKNA 4NW2A 3RMHA 3U9OA 2MUYA 2MHVA 3EJIA 1NR4A 1TS4A 2PW7A 3DEPA 3HGBA 2MP1A 3DWAA 1M8AA 1A15A 5C6AA 4OL7A 1B3AA 1I3QB 4HMJA 5IGDA 3IL8A 4FNFA 1JR0D 1WTRA 4HR7B 1EQTA 5A35A 1SJHD 1GXDC 1Z7TA 5CV8A 4RCNA 1TS2A 2NBFA 4PMWA 5JEAG 4BBRB 1Q90A 4BA1I 3D4DA 3CHBD 1G291 3S2HB 1H9KA 4XDXA 2IX0A 5CC4A 1JCKB 2SEBD 4BS9A 2FJ2A 2Q8IB 2G9DA 4TKOB 2B63B 1EY9A 3DXJC 4CKEA 2PZWA 3NQIA 1HTLD 4L8JA 1VMCA 2A69D 1SXTA 3SK5A 1D1KA 2OF1A 2BA1A 2EY5A 3W3AA 5C3EB 1FNWA 5JOBA 4ZUIA 2L5TA 4LMQD 4IUNA 5C0XG 2L9HA 1ESRA 4RKLA 4DU9A 3NUCA 1ZEQX 1HHVA 4MN3A 1LTBD 3PV0A 3OIPA 3I4LA 4R8IA 1DOLA 3FEWX 2R92B 2F0JA 5FO8B 1NR2A 3K57A 1IL8A 5J22A 3GTMB 4K14A 4IFDH 1TY0A 1T5XD 4NKLA 3GTJB 2E75C 1MGSA 1IW7C 1G2SA 1M4VA 1TS3A 1SEBD 5IOCA 1B4OA 2DNEA 2EDGA 3M85A 3R8BA 2JEBI 1SYGA 1II3A 4ULLA 1UNSA 1ML0D 3MXPA 2E74C 4JBWA 3PUZA 3NWTA 2CW0D 3D4WA 3P75A 4S3SA 1ENAA 1L0YB 5FO9B 1Y69U 1BQQT 2F03A 1C48A 5ISRA 3TP6A 2OEOA 2C9OA 1LLRD 2F0MA 2H4OA 2RSNA 3GTLB 1JOKA 2PZUA 2DN8A 5A2QL 4RKBA 3DMUA 3KLSA 1EU4A 5JAVA 2ID0A 2B2UC 2J0TD 5LL6S 3WOFA 3SEBA 1DM0B 1YNNC 5I9PA 2F0SA 2AWOA 2NTSA 3SXHA 4ID6A 4IALA 1GUSA 3PUVA 3EA6A 4XQQA 2MPMA 2PNRC 3Q6SA 2RDHA 3S14B 4OHJA 4DAVA 1QB5D 2O4XA 2ZXPA 1PTOB 1S5ED 1A3VA 4F8MA 1TY2A 5CGKA 1H9SB 3HOUB 2BA0A 1K8MA 2JA6B 1H9JA 1EWCA 1ILPA 3ND9A 4PMBA 2NN6H 1PFMA 4ZRZA 1KNAA 3A56A 3GTKB 5JEAJ 1EY0A 2HCIA 1FYCA 2V4DA 1OXUA 2FHTA 3H94A 5I6WA 3PUWA 1G8ZD 2VUMB 2D9UA 5KNDA 1OXSC 4TRDA 1TT2A 4ZQ3A 5CV4A 1EL0A 1TKWB 3JAME 2SOBA 3QJYA 1GUTA 4EQPA 2ZXOA 1KDCA 5LL6X 2RBMA 1CZGA 5C0XJ 4NMZA 2XSCA 2EYMA 2Q8RE 1E2VA 2JYOA 3F2UA 3CRKC 4RCOA 2K32A 3T56B 5FLXL 2F3VA 4RH6A 4EQOA 5D3IB 1I4XA 1Y8PB 1JICA 4WFN3 2A68D 4EVOA 4H0LC 1D5XC 1GUOA 5CV9A 4C2MB 1X32A 1A3TA 3MZ5A 1RTOA 4CHTB 2O5IC 3GTQB 4PV1C 2B8FA 4FVMA 3FDTA 4P2CB 1QILA 4DXGA 2X6GA 5EGTA 1BCPF 3K5NA 3URYA 4IFDG 1CA6A 2EY2A 1J9OA 1MSGA 4I7ZC 1BCPD 1JWMD 4ILWA 1YNJC 2A73B 4EGVA 3MWYW 4QIWB 2KOLA 3NHHA 1CM9A 3MHBA 1D5MC 1PRTC 2WB1B 5C5LA 5KIXA 1RCVD 1EY6A 5FKAC 1Z6HA 1JE4A 2A5HA 1STHA 1STEA 2PCFB 4XYOA 1YNND 1EYCA 4WORA 3G6JB 1S4ZA 4ODGA 1PDQA 3DWQA 3NK9A 5C0XI 3BYYB 1WTWA 5C3XA 2M00A 1EYAA 2RQXA 1SSOA 1TWAB 2RDFA 3QOLA 3Q22A 2IX3A 2B2WC 3SE0A 2PYKA 4BBSB 2B39A 3I8ZA 1DONA 3AU7A 1LABA 2M2LA 4OIKA 1DCZA 1NSNS 3Q0AA 1DZ1A 1BDOA 5EKKA 4RGOS 3HP3A 3NPPA 4A3BB 1QE6A 3T53B 2KEDA 1G2TA 1CT1D 5A2QE 3Q24A 1RTNA 2F0TA 3MAQA 1AN8A 1PFNA 4CJ2C 3RZDB 3RD4A 2K33A 1B44D 1PZKD 1B9MA 4IUUA 1W6KA 2PW5A 1EQVA 3ITPA 3OIQA 3C46A 4OGQC 4PMCA 2LS01 2I07B 2B2VC 2NVQB 3EQLC 5EKLA 1Q12A 2B2VA 3HS0C 2I46A 3I91A 2E2IB 3K6OA 2C5CA 3A54A 3FMCA 1RHPA 1JC7A 3SK4A 3KK7A 3LWEA 5C44B 1OXTA 3H91A 3K59A 1X3PA 2F0OA 4KY5A 3MC0B 4V0BA 5IT9L 2HDLA 5IGFA 3SHLA 1XWEA 2ZXRA 1XTCD 2OXPA 1V1PA 3C1EA 1GOZA 3QOJA 4KD4A 4FO2A 3N52A 3ONAB 3NWSA 5TSSA 5C4XB 2GA4B 4DF7A 1D1IA 3TP7A 2H1EA 4A3DB 1CTMA 1GHKA 2X6LA 3QO2A 4J1MA 5D65A 1W6JA 4FXKC 2R3ZA 4N9PA 1I6VC 2KCCA 3IKJA 1HFGA 1U4RA 4KMUC 4KD3A 4DK1A 2K6AA 1YNJD 2R61A 4G7ZC 2KEEA 3GQBA 5M3FB 2K05A 2QKIC 5I6YA 2CHBD 3T13A 1STAA 1PRTD 3IFDA 4X3KA 4R8NA 1MSHA 5EJWA 4KN4C 3DM1A 2XRSD 2O2LD 3NBIA 3S9WA 1EY8A 1GHJA 5KNBA 5C4JB 3OWEB 1HUMA 4DAYA 5EQ0A 4CGYB 3CQZB 1STNA 1HA5A 3I3CA 4HMIA 3ZYYX 2RKSA 1WTXA 1FNUA 2EJGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RMH A; 
#chains in the Genus database with same CATH topology
 1EQR A;  3C3L A;  2A74 C;  4ZK9 B;  3TP5 A;  3R2T A;  1ZYR C;  3P1H A;  3MXN A;  3S1R B;  4RWS C;  4NDX A;  2ZJP A;  4K2K A;  1MIU A;  3GP7 A;  2NVY B;  1Q82 C;  1SYD A;  1S5D D;  1ILQ A;  1CQV A;  1M1K C;  2L4N A;  4G4K A;  4QF4 A;  4BY7 G;  5GAE C;  1X9N A;  3S24 A;  1QG7 A;  4B08 A;  3ULP A;  1YVC A;  3HOX H;  1NJI C;  3I4M H;  1LTR D;  2KBN A;  1QWY A;  2H5X A;  1F9S A;  1FL0 A;  1IHZ A;  3KBX A;  1U4L A;  2UUB L;  1GO3 E;  1LT3 D;  1DOK A;  4QMG A;  4YCU A;  2E2J H;  1KIX A;  1V9P A;  4GLV B;  5CV7 A;  1FJG Q;  4Y52 H;  1GM5 A;  3CME A;  1VQA A;  5EKI A;  1BO0 A;  1EQQ A;  2I5H A;  4MTK A;  3JC6 6;  2RA4 A;  3G71 A;  5COR A;  4B9W A;  3H6M A;  4X66 L;  3BZD B;  4RGN A;  3ERO A;  3M4Q A;  1RF2 D;  4DGZ A;  2QGQ A;  2K5H A;  5FO7 B;  2N49 A;  1HXY D;  1WD0 A;  1O78 A;  4AIM A;  1WYD A;  2WP8 J;  3CCS A;  4DR1 L;  5C4J H;  2EYL A;  2JXM B;  3D6W A;  4N9T A;  3HOZ B;  4PG3 A;  1IBK L;  1GUG A;  4NXM L;  3J81 j;  1JOQ A;  4RGM A;  3CC4 A;  3CQZ H;  3NE5 B;  2L0C A;  5IGG A;  1VQ7 A;  2JA8 H;  4KJO A;  1BCP B;  1PH1 A;  3RNU A;  2FXQ A;  1B9N A;  2WV6 D;  1UE7 A;  5DAU A;  4JI1 Q;  1SAP A;  4AH6 A;  3CPF A;  4IUT A;  2PQE A;  4LF4 Q;  1YEZ A;  3MVV A;  5IOD A;  1KAA A;  4Z9C B;  1A0I A;  2QCP X;  3VYR A;  3UI2 A;  3NTH A;  1O7Z A;  2HIX A;  4A3I H;  2B3G A;  1J8I A;  2NTT A;  1HZB A;  2B29 A;  4Q5V A;  3D4R A;  1EIY B;  3CMA A;  1HPC A;  1HQR D;  5G3L D;  2FMC A;  1Q81 C;  1LTT D;  4POG A;  3KF6 B;  1TS5 A;  4QB4 A;  5ELF A;  4DNT B;  1D5Z C;  3WWV A;  5M5X H;  2PPB C;  1AEX A;  2D62 A;  2KHS A;  2HIV A;  3RZO B;  1B70 B;  3DM3 A;  5BN5 A;  4K0K L;  2ZTC A;  2D2C C;  2F0G A;  5F2D A;  1XNR Q;  3PUY A;  1OXX K;  3TZU A;  1N33 Q;  2XN9 C;  1TU2 B;  1JJG A;  4C3J G;  4DN4 M;  3I56 A;  2NB0 A;  1W3S A;  3K58 A;  3H09 A;  3U50 C;  1EEF D;  3FHW A;  1VQE A;  3TQY A;  3I72 A;  1QNU A;  3F8T A;  4OO1 H;  4OEM B;  1DXM A;  1LT5 D;  4PQX A;  3IAY A;  3D3R A;  1O7L A;  3PQI A;  4G7H C;  2ICI A;  3V2T A;  3J81 L;  3OTO Q;  2BOS A;  3VR5 A;  3QIA A;  1ENC A;  3I7F A;  4BBS G;  1A3U A;  1HQM C;  3H0G B;  3I55 A;  4IUQ A;  4JBK A;  1F2L A;  2IHE A;  2BH2 A;  1Q86 C;  4GKK L;  4XQJ A;  3A7L A;  3P7J A;  4AYB E;  1RJT A;  2K04 A;  4GN5 A;  5NUC A;  1NCV A;  5K5P A;  1HNZ Q;  4NP5 A;  1AFP A;  2Q2U A;  4J6H A;  4GZY C;  1HNW L;  5IT9 E;  4A3B G;  2K5W A;  4RA8 A;  2F0E A;  4DV3 Q;  1BBW A;  4RMF A;  3KJO A;  2PZT A;  4QUF A;  3V96 A;  2HT1 A;  3EFX D;  4PNY A;  2YU9 B;  3TBI B;  4LFC Q;  1B2T A;  1VQ8 A;  4FF2 A;  1X56 A;  1ZXT A;  5DLQ E;  5JPM C;  3U9S A;  3UDG A;  1SDF A;  1Q1E A;  3ERS X;  2SNS A;  3A0J A;  4A93 H;  4KY6 A;  4DXF A;  1I50 H;  1LT6 D;  2HCC A;  1ZYR D;  3HOY B;  2BCO A;  5M5W B;  4HJ9 A;  4KK7 A;  5IYB H;  4PZ6 A;  2XNA C;  4M8A A;  5IIF A;  2KVM A;  2Y0S B;  1VQM A;  1MD2 D;  4IPC A;  1B1Z A;  3HOV G;  4V19 0;  3AB9 A;  1F9R A;  3S16 B;  1CSQ A;  4HID A;  1S5B D;  3FPU B;  3PIO A;  1SNP A;  4K8J A;  2WIN B;  3GTG B;  3BVZ A;  3S1Q B;  1STY A;  4DV2 Q;  5C44 G;  4DV0 L;  4GLX A;  2UUC L;  4ME3 A;  3CCQ A;  4HJ5 A;  2UU9 L;  1PTO C;  2MGS A;  5CV6 A;  4J15 A;  2GVA A;  4P74 A;  1BXT A;  4FXG C;  4FP5 D;  4F87 A;  5CBA E;  2NVX B;  1HR0 L;  2L55 A;  3NBH A;  2K75 A;  1KL9 A;  2AQ2 B;  3DEO A;  2HHH L;  4ZLT F;  4MZ9 A;  1VS0 A;  1IYU A;  4BY7 B;  4A3K B;  1H9S A;  1WD1 A;  4JI5 L;  5DM7 3;  4X64 L;  3HOW H;  5M5Y B;  4X3T A;  2F4V L;  1NMF A;  2IL8 A;  1P16 A;  1J5E L;  4JG2 A;  2EZV A;  2L11 A;  1ENF A;  1AP0 A;  4HJ7 A;  4HED A;  4R4T A;  1CK1 A;  4X65 Q;  4A3D G;  1XX8 A;  4HCS A;  1NUC A;  3HZX A;  4JBM A;  3H15 A;  1CI3 M;  2RCF A;  1YHB A;  4PZ7 A;  3CCV A;  3A55 A;  4OWT B;  4LFA L;  5KYI A;  1IW7 D;  2PMZ B;  1TR5 A;  1QUQ B;  4BWG B;  4GOP B;  4GKJ Q;  3UDX A;  4DR1 Q;  2K28 A;  4MIU A;  1V43 A;  1CSP A;  1X3F A;  3HOY H;  3L0O A;  3OW2 A;  5JVH 3;  5D3D A;  4ZAI A;  1IKL A;  5M5W H;  4GS3 A;  4DR3 Q;  2N55 A;  1XXG A;  1WOC A;  3OMC A;  2ALY B;  3GV3 A;  3TDQ A;  4DR2 Q;  3EBE A;  1ONL A;  1KAB A;  4CJ0 B;  2EVB A;  1R4P B;  4C1N I;  1J6Q A;  1DGS A;  3I4N H;  2E2H B;  2JE6 I;  4A3M H;  4UDU C;  1Y8N B;  4ZUJ A;  4IUV A;  1KDA A;  4OIJ A;  1ICF B;  2RDG A;  4IN3 A;  4JPB W;  3GTG H;  1YHQ A;  3S1Q H;  1Q8I A;  3CRL C;  2JA8 G;  3U58 A;  4G7O C;  3K0X A;  2E2D C;  3DLL A;  2RSO A;  1JE5 A;  4JI6 L;  1TWG H;  3TZD A;  2NVX H;  1VQI A;  1BKB A;  2YTY A;  4K5X A;  1LT4 D;  2D0O A;  2F0W A;  2ZM6 Q;  2HUG A;  3BZK A;  1FR3 A;  1I94 L;  1AW7 A;  4A3K H;  2JP1 A;  3D31 A;  1K83 B;  2YTV A;  2N78 A;  5KGU A;  1VF5 C;  5I4D A;  2KHI A;  1EY4 A;  1Y1W H;  2ICE C;  1RD9 D;  5IP9 H;  4C3J B;  3CXC A;  2WFW A;  1JOR A;  2NZ1 D;  2R93 B;  1CA5 A;  3PUX A;  1PLF A;  2LXK A;  3S17 B;  1IXR A;  3CP0 A;  3M7G A;  4EX5 A;  1X3E A;  2A8V A;  1AE2 A;  4X3U A;  1NAP A;  3OWF A;  2B8G A;  3S2D H;  3OPO A;  5ELB A;  1PZI D;  4DAP A;  1I5F A;  4OO1 G;  4RFB A;  3NSW A;  1A2U A;  4LW1 A;  1D8L A;  1JOO A;  3X3M A;  4Q0F A;  5EAY A;  2M9V A;  3PO3 H;  1Y1V H;  4YWM A;  4H13 C;  4XTC S;  5CYU A;  3C2P A;  1TWC H;  2EE1 A;  4G57 A;  2EYH A;  4XYQ A;  5C0X H;  3NXW A;  5HUR A;  1PYW D;  5KNC A;  3RN2 A;  2E5L L;  3HEJ A;  4LUO A;  3M4Y A;  4KI0 A;  1E2Z A;  1TWH B;  1MHW C;  3A5Z B;  3M3Y H;  5FLX c;  4IPH A;  3HOZ G;  1VQO A;  2ZJR A;  2A6E C;  1ASY A;  1VQF A;  3KOJ A;  1B8A A;  2VB3 X;  1I4G A;  3RLF A;  1NBW A;  1TWF H;  3TP8 A;  3BU2 A;  5CV5 A;  1HZ9 A;  3VR4 A;  2NVT H;  1YNX A;  3PO2 H;  4O2D A;  3J7A V;  3O13 A;  1JWU D;  5KRU A;  1CKN B;  4R4Q A;  3A8J E;  2E8G A;  1PTO D;  1PH6 A;  2OQ0 A;  4A93 G;  1EFI D;  1U4M A;  2JA5 H;  3M4O H;  3OMG A;  4E6I A;  2NN6 G;  4XXE A;  4A3G B;  1GJX A;  4JI1 L;  1AH9 A;  2B2T A;  1YJW A;  1PFS A;  2F0P A;  1H9R A;  4XT1 B;  5M3M H;  1WTQ A;  3HOV B;  4C3H B;  4A3F B;  4AQY Q;  5AFW A;  3VA7 A;  5IYB G;  3DUZ A;  2MQH A;  5IP7 G;  1EY5 A;  1WTH A;  2Z1C A;  2WAQ E;  1QOH A;  4C3I H;  4YY3 Q;  5EBD A;  1NTG A;  2VQF Q;  3HRZ C;  3PIO 3;  2CWA A;  2NYZ D;  3CCM A;  2F4V Q;  1XNR L;  3K7A B;  1N33 L;  2L12 A;  5E4W C;  1ZKO A;  1UEA B;  4X3S A;  3P20 A;  3E9I A;  2J4X A;  3R2I A;  2F3I A;  3L7Z C;  1HRJ A;  4UY8 C;  3F2D A;  3H0G G;  1B50 A;  2CQA A;  3KFU A;  4ZKC B;  1N32 Q;  4LFA Q;  2F0N A;  2EY6 A;  3OTO L;  2Z6K A;  3C1F A;  3HOW G;  1HUN A;  1PZJ D;  3HOX B;  1ASZ A;  3I4M B;  4HSV A;  1OO9 B;  3AMU A;  1Q46 A;  1TVX A;  2WII B;  4HSP A;  2PO4 A;  1TWH H;  1GUN A;  2DJG C;  3S15 B;  2JSO A;  2C35 B;  2JA7 B;  1B53 A;  1BF4 A;  3KLR A;  2L15 A;  2E2J B;  2N88 A;  4LUZ A;  2Z9H A;  2XIW A;  4WJ4 A;  1PMR A;  3BDC A;  3I70 A;  1PXU A;  3MXU A;  4A3L H;  2EIF A;  1HNZ L;  2Z0S A;  1VDZ A;  3HG9 A;  1P8L A;  3CU7 A;  2BE5 C;  3KBG A;  1WTO A;  2MFI A;  1L1O B;  4DV3 L;  4IFD J;  1PRT F;  2FFK B;  4DV1 Q;  1F9Q A;  4YIJ A;  5JJL A;  4I65 A;  1K8O A;  4LFC L;  4MTN A;  1ET6 A;  1KDB A;  4ZKB B;  1T5E A;  5I2X A;  4A3G H;  2F1M A;  2XVS A;  3HOY G;  5IYC H;  5E1F A;  3TS0 A;  5FLX E;  3G7L A;  1S40 A;  1IBM L;  3EVQ A;  4A3F H;  2SDF A;  2RHS B;  3A7A B;  4IJH A;  1CHP D;  3PIP A;  1WVL A;  2Y0S G;  1S5F D;  2IJ0 A;  3SK8 A;  1UUP A;  1SNC A;  4HIM A;  4RHR A;  3I4N G;  4WJW A;  3W5O A;  3DWP A;  3QWN A;  1S5C D;  3T1H Q;  3SK6 A;  3HKZ E;  1PFB A;  1BR9 A;  2JA8 B;  1I94 Q;  2VXW A;  4KLK A;  1I6H B;  2QEJ C;  3SR1 A;  2R7F A;  1XJV A;  2EYP A;  3K7A H;  1SNQ A;  2F3W A;  4A3I B;  4QL5 A;  5GAG C;  5LMN Q;  5LMN W;  4DR7 L;  4Y7N H;  3JAM L;  3X3N A;  1GUW A;  4DV2 L;  1XPR A;  1QVG A;  5C3W A;  3TN2 A;  5M5X B;  1DYQ A;  2VB2 X;  5BR8 Q;  2CH4 W;  1SYB A;  3WDN A;  4A3K G;  5K36 H;  2I5L X;  2MNA A;  3STB C;  1O80 A;  1LUZ A;  4B3M L;  1OXV A;  3MEH A;  3ULJ A;  1JB7 A;  3S15 H;  4N8F A;  5L37 A;  5IP9 G;  2JA7 H;  3K0Y A;  2WAC A;  1A8V A;  2K01 A;  2D5D A;  4RGT A;  2HDM A;  1LTG D;  1CUK A;  5IT9 c;  2F4I A;  2CH4 A;  2EPB A;  4JI8 Q;  2A6E D;  4U68 A;  2AUK A;  1F2Z A;  1LTI D;  1HNX L;  5ELO A;  2XTI A;  2ZT9 C;  4IO9 A;  3K7U C;  2N3S A;  1V1O A;  5IWA Q;  2G5D A;  4X65 L;  1KAW A;  2E5L Q;  2TMP A;  2EJM A;  4B3T Q;  1WCM H;  4IFD I;  1YHA A;  2EYJ A;  4CBV A;  3DHQ A;  3J80 L;  1D6E C;  3I90 A;  1VQJ A;  4JI2 Q;  1VQL A;  4RHS A;  3PO3 G;  1Y1V G;  4U67 3;  2ES2 A;  3E5S A;  1ROD A;  3D8G A;  5EPK A;  4GKJ L;  3E6Z X;  5LMU L;  2PI2 A;  1EIH A;  2DNC A;  3NEL A;  4KHZ A;  4FYD A;  3G4S A;  2KQ3 A;  1PV4 A;  1CHQ D;  4HJ8 A;  1PH8 A;  2IW3 A;  4ABN A;  2VS1 A;  2IX1 A;  4OXP A;  4DR3 L;  1IYV A;  2HQE A;  1ET9 A;  5ELE A;  1QCB D;  2LY7 A;  1I3Q H;  1I6H H;  4XT3 B;  4DR2 L;  2Z4I A;  4AYB B;  5EBC A;  2B2Y C;  3UE1 A;  5G3L F;  4A93 B;  4A3J B;  2TSS A;  1EZ6 A;  2B2Y A;  1F9P A;  1K9M C;  1I50 B;  4TSS A;  2LMC B;  1JWS D;  2QEX A;  1L0X B;  1MI2 A;  1SYC A;  1SE4 A;  5KYL A;  2JA5 G;  2A68 C;  4BBR H;  3GV6 A;  1BOS A;  4LF7 L;  1EZ8 A;  3J7A F;  2KJX A;  2HD3 A;  1GD7 A;  4UAI A;  2IT1 A;  5C5M A;  3I73 A;  3T16 A;  4F7X A;  2J7Z A;  2R6G A;  5M3M G;  3T51 B;  4OO1 I;  3MXG A;  3MFY A;  1SMY C;  2KA7 A;  1BVS A;  3S2H H;  3NTK A;  2AUJ D;  4KV6 A;  2ZM6 L;  1O7Y A;  3S1M B;  2R93 G;  1SE3 A;  1FVI A;  4BXX H;  4C3I G;  4KKS A;  1KLG D;  1F2Y A;  5FK9 C;  2O5J C;  3TME A;  3KUP A;  2YTX A;  1FNV A;  3A8K E;  1BCP C;  5JVG 3;  2EXZ A;  2K52 A;  2BE5 D;  3G48 A;  2KCN A;  1JQY D;  5M9O A;  3MTS A;  2UXD Q;  3UE0 A;  5C3E H;  4L63 B;  2QF7 A;  2WAQ G;  4HJA A;  4LF6 Q;  1YBY A;  2OCE A;  3HOW B;  1Z9F A;  1A2T A;  1Q3L A;  2F0I A;  2Z8L A;  3F2C A;  4DR5 Q;  1G91 A;  5EPJ A;  4KHV A;  3AEV A;  1LO5 D;  1SR3 A;  2AKW B;  3NTI A;  2MO1 A;  3KF6 A;  1EYG A;  4P75 A;  5IYD H;  3Q23 A;  1PH9 A;  1VCI A;  2B2U A;  4DR6 Q;  1D2B A;  1RDP D;  2KUM A;  2NN6 I;  3GTO B;  5J39 A;  1C9O A;  3GO5 A;  4K6L A;  3VYU A;  2R92 H;  4MHE A;  2XWJ B;  4IUP A;  3GTM H;  4HTH A;  3SDZ A;  3VR2 A;  5JJI A;  1IBM Q;  2IPK D;  3J80 c;  4YHH Q;  4A3J H;  1G51 A;  4CDD C;  5IGE A;  3GTJ H;  2RHQ B;  1JT8 A;  5KEE A;  3FRP B;  3LX0 A;  1EOV A;  4IPD A;  4DA2 A;  3M9B A;  3BVM A;  4LF5 Q;  1IYJ B;  4X6A H;  2KCM A;  1JJ2 A;  1DOM A;  2JEA I;  3UDI A;  4KN7 C;  4PZ8 A;  4A3G G;  1AZP A;  4DK0 A;  3K5O A;  5E3F A;  1S3O A;  5IYC G;  1K0R A;  4GN3 B;  3PMF A;  2QDB A;  4C3H G;  4A3F G;  4KKU A;  1EWH A;  1N9W A;  4A3E B;  3STB D;  3T1Y Q;  3I4N B;  4JI4 Q;  1HTP A;  2RVL A;  4LK1 C;  3J7A 5;  2F0K A;  4QGU A;  4A3M B;  5GAD C;  3S1M H;  2K5V A;  4DR7 Q;  3NP8 A;  3PIP 3;  1G6P A;  1S72 A;  3ZJY C;  4DUZ Q;  2ASB A;  1VQD A;  3CCL A;  4DNR B;  2E76 C;  2QA4 A;  4H7B A;  4KJN A;  1PVO A;  4AQY L;  1EIG A;  4OWW B;  4KY7 A;  4B3M Q;  3TSS A;  4K2L A;  4LAA A;  1TWG B;  2FMM A;  5HGT A;  3A74 A;  4J8Q A;  4YY3 L;  3E0E A;  2VQF L;  1VMP A;  4QCL A;  5CR3 A;  3MFG A;  3RN5 A;  4LJZ C;  3HKZ G;  2GVB A;  2KEC A;  1H9M A;  1LYL A;  1B3Q A;  3ICE A;  1HNX Q;  1QVC A;  3N6R A;  5K36 G;  1Y1W B;  1CZW A;  1LTL A;  3ND8 A;  1SLJ A;  2LXJ A;  2EYO A;  1UAP A;  2MJ8 A;  3WOE A;  4K8I A;  2ENB A;  4L5S A;  4OON A;  1F2M A;  3HOX G;  1N34 Q;  3I4M G;  4JYA Q;  2R7D A;  2PNH A;  4FF1 A;  4CDF C;  3H3V C;  4FXD A;  2JA7 G;  3GTO H;  3J81 c;  1DJR D;  2V1C C;  1KLU D;  4K5W A;  3QG1 A;  1N32 L;  1VQN A;  1X6O A;  1QNK A;  1SRO A;  1TII D;  1EY7 A;  4IQZ A;  3S2D B;  1C4Q A;  5ELD A;  2A6H C;  5BN3 A;  1XMO Q;  1EOT A;  5LMU Q;  3H3V I;  1PTO H;  3B6Y A;  4YWL A;  3R93 A;  1F77 A;  3BDL A;  1HFN A;  5T1G A;  1STB A;  1VQH A;  4NB3 A;  2N8N A;  5GQO A;  4M1U B;  2F0U A;  2EOT A;  1I4R A;  3OHX C;  4LNQ A;  2DY7 A;  1C7Y A;  3PO3 B;  1Y1V B;  2OT2 A;  1PRT B;  3BG3 A;  5EPL A;  1TWC B;  1LV9 A;  2F0F A;  2JA6 H;  2K1B A;  5JPN C;  2G9H D;  4FF4 A;  2F0Q A;  4A3E H;  3LWU A;  1SYF A;  1AZQ A;  4F88 A;  4DV1 L;  5COY A;  3V05 A;  1EU3 A;  2JJQ A;  4KHP Q;  4O1N A;  3M3Y B;  2F0L A;  1I4P A;  4B3S Q;  3CKI B;  2EQS A;  1R4Q B;  4FF3 A;  1SMY D;  3GTK H;  1PH7 A;  3J80 E;  1SE2 A;  2BDO A;  3FP9 A;  1HA6 A;  1AE3 A;  1SNM A;  1SJE D;  1TWF B;  4R4C A;  5ELC A;  1Q1B A;  2NVT B;  4LF7 Q;  1WTP A;  3PO2 B;  1GKH A;  1C8C A;  3IFT A;  1LTS D;  2AQ1 B;  1I4Q A;  2Z4H A;  3VR3 A;  1DD2 A;  2MO0 A;  4NXN Q;  2EY1 A;  3T1H L;  4CKC A;  4A3I G;  4EQN A;  4OEL B;  3KYH C;  5JEA H;  2VUM H;  1SMX A;  1VF7 A;  1U9R A;  4ZYS A;  2CVR A;  2JA5 B;  1K0S A;  3M4O B;  4L5Q A;  3MA2 B;  4LF8 Q;  2BDN A;  4GOP C;  3FKI B;  4CKB A;  2EYF A;  1KRT A;  1SYE A;  2JN4 A;  1PHJ A;  4XIG S;  3S1N B;  1A6X A;  3RUZ A;  5M3M B;  1QUQ A;  4BBR G;  4GOP A;  3OSO A;  1MBY A;  4HAE A;  2WKC A;  4KKT A;  5J1Z A;  1CFM A;  4DFA A;  4O42 A;  5IGC A;  5LMN L;  1Q7Y C;  5C4H A;  1STG A;  2X69 A;  1EYD A;  5DNF A;  1SFO B;  2YYZ A;  4B3R L;  3KF8 B;  4P72 A;  5CBE E;  1A62 A;  2AQ3 B;  4C3I B;  1Z47 A;  5DM6 3;  1ICW A;  5BR8 L;  3K5M A;  1BNZ A;  1NMG A;  1SN8 A;  4IZ8 A;  4BXX G;  1MJC A;  1V8Q A;  1BUV T;  1W2B A;  3OOC A;  1LTA D;  5DEH A;  1TQO A;  3I2Z A;  1FGB D;  1R9T B;  3E0J A;  2QDL A;  1WTV A;  1RIP A;  3A5U A;  2WAQ B;  4L5T A;  4JI8 L;  5E7N A;  1Y8O B;  3BVG A;  4H44 C;  3HFZ B;  2Q8T A;  1SND A;  3PCO B;  4XQN A;  5C3E G;  5IWA L;  4OX9 Q;  4B9X A;  1QZG A;  1QZH A;  3J81 E;  4C56 C;  3VA5 A;  1CKM A;  4B3T L;  4TQU S;  1N36 L;  4HCE A;  1CQF A;  3AQQ A;  5D14 A;  1BBX C;  1ESF A;  2B2W A;  3E9H A;  1E0B A;  3FPP A;  3ERQ A;  3FVQ A;  5IGB A;  4JK1 C;  2VQE L;  3AYH B;  2IWH A;  4K6D A;  3GTQ H;  3IRB A;  4QIW E;  4JI2 L;  5IYD G;  5I2Y A;  5I9O A;  2SNM A;  1PTO F;  2I0Q A;  2Q2H A;  2DY8 A;  3I4O A;  1XMQ Q;  4JOI C;  2A69 C;  4AYB G;  3QB3 A;  2WB1 E;  4R4O A;  5T1I A;  4IUR A;  2OWO A;  3A8I E;  4DUY Q;  3KF8 A;  3RLN A;  3CC2 A;  1SNO A;  4A3J G;  2ZTD A;  2B2T C;  2NUC A;  4JOI A;  1SBB B;  1V1P B;  4BY1 B;  1G6Z A;  4OWX B;  1XPU A;  2EJF C;  3FKI H;  1VQ4 A;  3ER0 A;  2L1B A;  2BH8 A;  2UXC L;  2QIL A;  3S1N H;  4CJ1 B;  4JI0 Q;  1KNE A;  4GNX B;  4MNO A;  1WI5 A;  2F0H A;  4WRD A;  4WJ3 M;  3NEN A;  3W2D A;  3OW7 A;  2VY3 A;  4H02 A;  1SRU A;  3BDO A;  1SFO H;  2LKV A;  4UP7 A;  2VL6 A;  4UPA A;  2XWB B;  3TRZ A;  3R3O A;  5HGQ A;  2VNU D;  2A19 A;  2OTJ A;  3CC7 A;  3J7Y W;  1YJ9 A;  4ME5 A;  1LAC A;  4RAU C;  3BYT B;  3T4A C;  3KLS X;  5H1S E;  1E1O A;  2K7V A;  2R7Z B;  2FIN B;  4R9W A;  1GVP A;  3D6C A;  3W1G A;  3GD7 A;  3MEF A;  1I4H A;  3LNN A;  4JV5 Q;  3HKS A;  3PGZ A;  1KTK A;  2K03 A;  1U4P A;  3VR6 A;  1X3Q A;  2A6H D;  4Y7N B;  3BS1 A;  1R9T H;  2AWN A;  2LFN A;  2K5Q A;  3HKZ B;  4C1N K;  5BN4 A;  5FOB B;  2F0V A;  2Z6K C;  3L3O C;  4L6T B;  4IJL A;  3KDF B;  1CKN A;  4HN7 A;  3SVM A;  2EXD A;  2K5D A;  1EEI D;  5C4Z A;  2WKD A;  3UDF A;  4QJF A;  3GTP B;  4BA2 I;  4ALP A;  2CW0 C;  4DAY B;  2PQA B;  5LHY 1;  2UXD L;  5JJZ A;  2UXB L;  3Q8D A;  5CMD A;  4LF6 L;  5IY0 A;  3VYS A;  1IKM A;  1PA6 A;  2NWG A;  3VYT A;  4GNX A;  1VQ6 A;  5E4X A;  2F0D A;  4GLA C;  1XNQ Q;  1KRS A;  1HZC A;  4DR5 L;  3M7N A;  4K5V A;  3K5L A;  4LFB L;  1HCZ A;  2XRQ D;  1E2W A;  2AMC B;  1QJO A;  4KTA A;  1JB3 A;  3MXN B;  1XYI A;  1FD7 D;  3NQT A;  1WCM B;  4QUC A;  3RZD H;  4BY1 H;  4RG1 A;  3L9A X;  1HH2 P;  1RKN A;  4NW2 A;  4IPG A;  3RMH A;  4DR6 L;  3U9O A;  2MUY A;  2MHV A;  3EJI A;  1NR4 A;  2QW7 A;  1TS4 A;  2PW7 A;  2JA9 A;  4YHH L;  3DEP A;  3HGB A;  2JA6 G;  2MP1 A;  3DWA A;  1M8A A;  1CKO A;  1A15 A;  5C6A A;  4A3E G;  4LF5 L;  3CF5 A;  1UWV A;  4A3M G;  4R1J A;  4OL7 A;  1B7Y B;  1B3A A;  1E7Z A;  1I3Q B;  4HMJ A;  5IGD A;  5J3B A;  3IL8 A;  4FNF A;  1JR0 D;  1WTR A;  2R7Z H;  4HR7 B;  4JI7 Q;  3K8A A;  1EQT A;  1XTD A;  2NZO A;  3T1Y L;  4JI4 L;  5A35 A;  1SJH D;  1GXD C;  1Z7T A;  5C44 H;  5CV8 A;  4B3R Q;  4RCN A;  1TS2 A;  2NBF A;  1E3P A;  4DUZ L;  5HY6 A;  4PMW A;  5IE8 A;  5JEA G;  1L1O C;  2VUM G;  4BBR B;  1E1T A;  1Q90 A;  4BA1 I;  1E24 A;  1L1O A;  4X62 Q;  1PH5 A;  3GTP H;  1UEB A;  1Y1W G;  3D4D A;  3CHB D;  1G29 1;  2CQO A;  1L2F A;  4DK6 C;  4QY7 A;  3S2H B;  1H9K A;  1VQC A;  4XDX A;  4CDE C;  1EIF A;  2IX0 A;  5CC4 A;  1JCK B;  2CWP A;  2SEB D;  2NZH A;  4BS9 A;  5C4X H;  2FJ2 A;  2Q8I B;  3J80 i;  2G9D A;  2HQL A;  3D0F A;  4TKO B;  1HJP A;  1PH3 A;  2B63 B;  1EY9 A;  3DXJ C;  4CKE A;  4A3D H;  2PZW A;  3NQI A;  1HTL D;  2P5Z X;  1N34 L;  4JYA L;  1N36 Q;  4L8J A;  3KLW A;  3CAM A;  1VMC A;  2A69 D;  1SXT A;  3SK5 A;  1D1K A;  2LSS A;  2OF1 A;  3EN2 A;  2BA1 A;  1PYS B;  1UE1 A;  4DV6 Q;  2EY5 A;  3W3A A;  2VQE Q;  1MJE A;  5C3E B;  1FNW A;  2CKZ B;  5JOB A;  4ZUI A;  4A76 A;  2L5T A;  3RR5 A;  4LMQ D;  3TS2 A;  4IUN A;  1XMO L;  1E22 A;  5C0X G;  5M3F H;  1O7I A;  3SGI A;  2L9H A;  3CW2 C;  1KQS A;  1ESR A;  4RKL A;  4DU9 A;  3NUC A;  1ZEQ X;  4DK3 C;  1YIT A;  1HHV A;  1K73 C;  4MN3 A;  4JI3 L;  1LTB D;  5GRO A;  1N8R C;  3PV0 A;  3OIP A;  3I4L A;  1HZA A;  4R8I A;  1K3B C;  1DOL A;  3FEW X;  2R92 B;  2F0J A;  5FO8 B;  1NR2 A;  3K57 A;  2UXC Q;  1V1Q A;  2OQK A;  1IL8 A;  5J22 A;  3GTM B;  4K14 A;  4IFD H;  1TY0 A;  2CFM A;  2IHF A;  3PO2 G;  1RL2 A;  1T5X D;  2PI2 E;  4O0A A;  4NKL A;  1IL2 A;  4KHP L;  3GTJ B;  1PH2 A;  4B3S L;  2E75 C;  1MGS A;  1IW7 C;  1G2S A;  1M4V A;  1TS3 A;  1SEB D;  3OYY A;  1M90 C;  4I7A A;  3FKI G;  5IOC A;  1X54 A;  1VQB A;  1B4O A;  2DNE A;  2EDG A;  4LF9 Q;  3M85 A;  1YJN A;  1YI2 A;  3R8B A;  1MKH A;  4NXN L;  5FJ8 H;  3S1R H;  2JEB I;  1SYG A;  3J81 i;  3EIV A;  1II3 A;  2WB1 G;  4ULL A;  1UNS A;  4GN4 B;  1ML0 D;  2NVY H;  3MXP A;  4LF8 L;  2E74 C;  4JBW A;  3PUZ A;  4TVA B;  3NWT A;  2CW0 D;  3D4W A;  3P75 A;  4S3S A;  1ENA A;  4DR4 L;  4APV A;  2B63 H;  4DKA C;  1L0Y B;  3JAM c;  3VDY A;  1IBL Q;  1C0A A;  5FO9 B;  1Y69 U;  4LUV A;  1BQQ T;  2F03 A;  2ZTE A;  1C48 A;  2Q2T A;  2JQO A;  5ISR A;  3TP6 A;  2OEO A;  2C9O A;  2DGY A;  2YV5 A;  1LLR D;  2UXB Q;  2F0M A;  2H4O A;  2RSN A;  3LGJ A;  1Q8K A;  3GTL B;  1JOK A;  2PZU A;  2DN8 A;  5A2Q L;  4RKB A;  3DMU A;  3KLS A;  4A3C H;  1EU4 A;  5JAV A;  2AHO B;  4LFB Q;  3CCU A;  2ID0 A;  2B2U C;  2J0T D;  5LL6 S;  3WOF A;  1EWI A;  3SEB A;  1DM0 B;  1YNN C;  5I9P A;  2F0S A;  2AWO A;  2NTS A;  3SXH A;  4UHV A;  4ID6 A;  4DV7 Q;  1EFW A;  4OX9 L;  4IAL A;  1K8G A;  1GUS A;  3PUV A;  4A3L G;  3HOZ H;  3EA6 A;  4XQQ A;  2MPM A;  2PNR C;  1LM0 A;  3Q6S A;  2RDH A;  3S14 B;  4OHJ A;  4DAV A;  1QB5 D;  2O4X A;  2ZXP A;  1PTO B;  1S5E D;  1A3V A;  2RCN A;  4DPG A;  2I5M X;  3NBH B;  4DV4 Q;  3BZC A;  4F8M A;  1TY2 A;  1H95 A;  4BY1 G;  5CGK A;  1H9S B;  3HOU B;  2BA0 A;  1XMQ L;  4DV5 L;  1K8M A;  2JA6 B;  1H9J A;  1UE6 A;  1EWC A;  4DUY L;  1ILP A;  3ND9 A;  4PMB A;  5AJ3 Q;  4IOC A;  2NN6 H;  2A1A A;  1FGU A;  1PFM A;  4ZRZ A;  1KNA A;  3A56 A;  3GTK B;  5JEA J;  3J7Z C;  3RZO H;  1EY0 A;  2F52 A;  2KCT A;  2HCI A;  4JI0 L;  1FYC A;  2V4D A;  1QVF A;  1D7Q A;  1OXU A;  5IP7 H;  2FHT A;  5GAH C;  2R7Z G;  3H94 A;  5I6W A;  3G6E A;  3PUW A;  4HIK A;  1G8Z D;  2VUM B;  3M4P A;  1PH4 A;  2D9U A;  5KND A;  1OXS C;  1WFQ A;  3GTL H;  4TRD A;  1TT2 A;  4ZQ3 A;  5CV4 A;  2K14 A;  5FLM H;  2IY5 B;  3F2B A;  4JV5 L;  3K80 C;  1EL0 A;  3H0G H;  3U4V A;  1PYB A;  2UUB Q;  1TKW B;  4NPS A;  3JAM E;  3CCR A;  1K8A C;  2SOB A;  4JCV E;  3QJY A;  1IZ6 A;  1GUT A;  4EQP A;  2ZXO A;  3CPW A;  1K28 A;  1KDC A;  3KJP A;  5LL6 X;  4LWC A;  2RBM A;  1VQ5 A;  2ZJQ A;  1CZG A;  5C4X G;  1T9H A;  4DAM A;  5C0X J;  4NMZ A;  3S14 H;  2XSC A;  3NEM A;  2EYM A;  4A75 A;  2Q8R E;  1E2V A;  2JYO A;  4X66 Q;  3F2U A;  3CRK C;  4RCO A;  2K32 A;  1NNX A;  3CCE A;  2YU9 H;  3T56 B;  1WCM G;  4JI3 Q;  5FLX L;  2F3V A;  4RH6 A;  4EQO A;  5D3I B;  3HOU H;  1XNQ L;  1I4X A;  1Y14 B;  2Y0S E;  1Y8P B;  1JIC A;  4WFN 3;  1KC8 C;  2A68 D;  2UUA L;  4EVO A;  4POF A;  4H0L C;  1IBK Q;  4NXM Q;  1D5X C;  1GUO A;  5M3F G;  5CV9 A;  4C2M B;  1X32 A;  1A3T A;  3MZ5 A;  1RTO A;  4CHT B;  2O5I C;  3GTQ B;  2KEN A;  4PV1 C;  2B8F A;  4FVM A;  3FDT A;  3H3V H;  4P2C B;  1QIL A;  3ULL A;  4DXG A;  3CD6 A;  2X6G A;  4JW0 A;  5EGT A;  3S16 H;  1BCP F;  3K5N A;  3URY A;  2JK8 A;  4IFD G;  2RF4 A;  1CA6 A;  2EY2 A;  1J9O A;  4A4I A;  1MSG A;  4I7Z C;  1BCP D;  1JWM D;  4ILW A;  1YNJ C;  2A73 B;  4EGV A;  3MWY W;  4QIW B;  4L5R C;  4JI7 L;  4DR4 Q;  3RLO A;  2KOL A;  3NHH A;  4YCV A;  4K0K Q;  1CM9 A;  4HIO A;  3F1Z A;  3MHB A;  1D5M C;  1KD1 C;  1PRT C;  2WB1 B;  5C5L A;  5KIX A;  2ATW A;  1X65 A;  1RCV D;  5FJ8 G;  1EY6 A;  5ELN A;  5FKA C;  1Z6H A;  4BY7 H;  1JE4 A;  4P73 A;  2A5H A;  1STE A;  1STH A;  5M5Y H;  2PCF B;  2XGT A;  4XYO A;  1YNN D;  2PMZ E;  1EYC A;  4WOR A;  4X62 L;  3GDE A;  3G6J B;  1S4Z A;  4ODG A;  1PDQ A;  3DWQ A;  3NK9 A;  2B63 G;  1K3R A;  5C0X I;  3BYY B;  1WTW A;  1NY4 A;  5C3X A;  1KHI A;  2M00 A;  4QQB X;  4ZCK A;  1EYA A;  4GKK Q;  2RQX A;  2VW9 A;  1SSO A;  2VZA A;  1TWA B;  2RDF A;  3QOL A;  3Q22 A;  2IX3 A;  2GN5 A;  1A63 A;  2B2W C;  1JJC B;  3SE0 A;  2PYK A;  4BBS B;  2B39 A;  1HNW Q;  3I8Z A;  3K81 C;  1DON A;  2CCZ A;  1YZ6 A;  4A3C G;  3AU7 A;  4YCW A;  1LAB A;  2M2L A;  2K5N A;  4DV6 L;  4OIK A;  4C2M H;  1FJG L;  1DCZ A;  1VQK A;  1NSN S;  3QR8 A;  1SE8 A;  3TRE A;  3Q0A A;  4UP9 A;  1DZ1 A;  1BDO A;  5EKK A;  4RGO S;  3HP3 A;  3NPP A;  4A3B B;  1QE6 A;  4JC0 A;  3T53 B;  2KED A;  1G2T A;  4DV5 Q;  1CT1 D;  5A2Q E;  3Q24 A;  2R92 G;  4IOA A;  2E2H H;  1RTN A;  2F0T A;  3MAQ A;  1AN8 A;  1PFN A;  4CJ2 C;  1BBU A;  3RZD B;  4JBJ A;  3RD4 A;  1XPO A;  2K33 A;  1NE3 A;  1X3G A;  1B44 D;  1UE5 A;  4EQ5 A;  1PZK D;  1B9M A;  4IUU A;  1W6K A;  2PW5 A;  1KXL A;  1EQV A;  2DUD A;  3AFP A;  3ITP A;  4P71 A;  1U5K A;  1TXY A;  3OIQ A;  3C46 A;  4OGQ C;  4PMC A;  3W1B A;  2LS0 1;  2I07 B;  2B2V C;  2NVQ B;  5JJK A;  3EQL C;  4JVZ A;  1K83 H;  1WJJ A;  5EKL A;  3U4Z A;  4R4I A;  4LF4 L;  4DV0 Q;  2UUC Q;  1Q12 A;  2B2V A;  2UU9 Q;  3HS0 C;  2I46 A;  4LF9 L;  3I91 A;  2E2I B;  4C3J H;  3K6O A;  2C5C A;  3A54 A;  3FMC A;  2R93 H;  4YWK A;  1RHP A;  2K50 A;  3S17 H;  1JC7 A;  1HR0 W;  3SK4 A;  1HR0 Q;  3KK7 A;  3LWE A;  5C44 B;  3AFQ A;  2Q2I A;  1OXT A;  2HHH Q;  3H91 A;  3K59 A;  1X3P A;  2F0O A;  4KY5 A;  4JI5 Q;  1TWA H;  4X64 Q;  1X55 A;  2Z6B A;  3E3X A;  3MC0 B;  1IBL L;  4V0B A;  1J5E Q;  5IT9 L;  4BBS H;  2HDL A;  5IGF A;  3SHL A;  3L2P A;  1XWE A;  2ZXR A;  1XTC D;  5FLM G;  3PF5 A;  2OXP A;  1V1P A;  1VQ9 A;  3C1E A;  1GOZ A;  3QOJ A;  4KD4 A;  4GNX C;  2OTL A;  4N8X 1;  4FO2 A;  3N52 A;  3ONA B;  3NWS A;  5TSS A;  5C4X B;  4A3B H;  2GA4 B;  4DF7 A;  1D1I A;  3TP7 A;  2H1E A;  4A3D B;  2UUA Q;  1CTM A;  3BJU A;  1GHK A;  2X6L A;  1VQG A;  3QO2 A;  4J1M A;  5D65 A;  1W6J A;  4FXK C;  2R3Z A;  4N9P A;  1VQP A;  2DJF C;  1I6V C;  3TEH B;  4DV7 L;  2KCC A;  3IKJ A;  1HFG A;  1U4R A;  4KMU C;  4KD3 A;  1OTC A;  4DK1 A;  2K6A A;  1YNJ D;  3HOU G;  1L0W A;  1U0L A;  2R61 A;  2D0P A;  4G7Z C;  2KEE A;  3GQB A;  5M3F B;  2K05 A;  2QKI C;  5I6Y A;  1EUJ A;  2CHB D;  3T13 A;  4DV4 L;  1STA A;  3PF4 A;  1PRT D;  3IFD A;  4X3K A;  2NVQ H;  4R8N A;  1MSH A;  3JAM i;  5EJW A;  3KDF A;  2KHJ A;  3DM1 A;  4KN4 C;  1JMC A;  2XRS D;  4FDB A;  2O2L D;  4CDC C;  3HOV H;  4C3H H;  3NBI A;  3S9W A;  3CCJ A;  1EY8 A;  2E2I H;  4UP8 A;  1GHJ A;  5KNB A;  5C4J B;  2K4K A;  3OWE B;  5AJ3 L;  1HUM A;  4DAY A;  4DNI A;  4JI6 Q;  5EQ0 A;  2PQA A;  4CGY B;  3CQZ B;  1STN A;  1HA5 A;  3PSI A;  3I3C A;  4HMI A;  3ZYY X;  2RKS A;  1WTX A;  1FNU A;  2EJG C;  1YIJ A; 
#chains in the Genus database with same CATH homology
 3C3L A;  2A74 C;  4ZK9 B;  3TP5 A;  3R2T A;  1ZYR C;  3P1H A;  3MXN A;  3S1R B;  4RWS C;  4NDX A;  4K2K A;  3GP7 A;  2NVY B;  1SYD A;  1S5D D;  1ILQ A;  1CQV A;  2L4N A;  4G4K A;  4QF4 A;  1QG7 A;  4B08 A;  1LTR D;  1QWY A;  1F9S A;  1IHZ A;  3KBX A;  1U4L A;  1LT3 D;  1DOK A;  4QMG A;  5CV7 A;  5EKI A;  1BO0 A;  2RA4 A;  5COR A;  4B9W A;  3H6M A;  3BZD B;  4RGN A;  3ERO A;  1RF2 D;  4DGZ A;  5FO7 B;  1HXY D;  1WD0 A;  1O78 A;  2WP8 J;  2EYL A;  2JXM B;  3D6W A;  4N9T A;  3HOZ B;  1GUG A;  1JOQ A;  4RGM A;  3NE5 B;  2L0C A;  5IGG A;  4KJO A;  1BCP B;  1B9N A;  2WV6 D;  5DAU A;  1SAP A;  4IUT A;  2PQE A;  3MVV A;  5IOD A;  1KAA A;  4Z9C B;  2QCP X;  3VYR A;  3UI2 A;  3NTH A;  1O7Z A;  1J8I A;  2NTT A;  4Q5V A;  3D4R A;  1HQR D;  1HPC A;  5G3L D;  2FMC A;  1LTT D;  1TS5 A;  4QB4 A;  5ELF A;  4DNT B;  1D5Z C;  2PPB C;  1AEX A;  2D62 A;  2KHS A;  3RZO B;  5BN5 A;  2D2C C;  2F0G A;  5F2D A;  3PUY A;  1OXX K;  3TZU A;  2XN9 C;  1TU2 B;  4C3J G;  4DN4 M;  2NB0 A;  3K58 A;  3H09 A;  1EEF D;  3I72 A;  1QNU A;  4OO1 H;  1DXM A;  1LT5 D;  4PQX A;  3IAY A;  3D3R A;  1O7L A;  4G7H C;  2ICI A;  3V2T A;  3J81 L;  2BOS A;  3VR5 A;  3QIA A;  1ENC A;  1A3U A;  1HQM C;  3H0G B;  4IUQ A;  1F2L A;  4XQJ A;  3A7L A;  3P7J A;  1RJT A;  2K04 A;  5NUC A;  1NCV A;  5K5P A;  4NP5 A;  1AFP A;  4GZY C;  4J6H A;  5IT9 E;  2K5W A;  4RA8 A;  2F0E A;  2PZT A;  4QUF A;  3V96 A;  3EFX D;  4PNY A;  2YU9 B;  3TBI B;  1B2T A;  4FF2 A;  1ZXT A;  5JPM C;  3U9S A;  1SDF A;  1Q1E A;  2SNS A;  4KY6 A;  4DXF A;  1LT6 D;  2HCC A;  1ZYR D;  3HOY B;  2BCO A;  5M5W B;  4KK7 A;  2XNA C;  4M8A A;  5IIF A;  2KVM A;  2Y0S B;  1MD2 D;  1B1Z A;  4V19 0;  3AB9 A;  1F9R A;  3S16 B;  1S5B D;  3FPU B;  1SNP A;  4K8J A;  2WIN B;  3GTG B;  3BVZ A;  3S1Q B;  1STY A;  1PTO C;  2MGS A;  5CV6 A;  1BXT A;  4FP5 D;  4FXG C;  4F87 A;  5CBA E;  2NVX B;  2L55 A;  3NBH A;  2AQ2 B;  3DEO A;  4ZLT F;  1IYU A;  4BY7 B;  4A3K B;  1H9S A;  1WD1 A;  5DM7 3;  5M5Y B;  4X3T A;  2IL8 A;  2EZV A;  2L11 A;  1ENF A;  1AP0 A;  4HED A;  1CK1 A;  1XX8 A;  4HCS A;  1NUC A;  3HZX A;  1CI3 M;  3A55 A;  5KYI A;  1IW7 D;  2PMZ B;  1TR5 A;  4BWG B;  2K28 A;  4MIU A;  1V43 A;  5JVH 3;  5D3D A;  4ZAI A;  1IKL A;  2N55 A;  1XXG A;  3OMC A;  3GV3 A;  3TDQ A;  1ONL A;  1KAB A;  4CJ0 B;  2EVB A;  1R4P B;  4C1N I;  2E2H B;  2JE6 I;  4UDU C;  1Y8N B;  4ZUJ A;  4IUV A;  1KDA A;  4OIJ A;  2RDG A;  4IN3 A;  1Q8I A;  3CRL C;  4G7O C;  2E2D C;  2RSO A;  3TZD A;  4K5X A;  1LT4 D;  2F0W A;  2HUG A;  1FR3 A;  1AW7 A;  2JP1 A;  3D31 A;  1K83 B;  5KGU A;  1VF5 C;  5I4D A;  1EY4 A;  2ICE C;  1RD9 D;  4C3J B;  1JOR A;  2NZ1 D;  2R93 B;  1CA5 A;  3PUX A;  1PLF A;  3S17 B;  3M7G A;  4X3U A;  1NAP A;  3OWF A;  2B8G A;  3OPO A;  5ELB A;  1PZI D;  4DAP A;  4OO1 G;  4RFB A;  3NSW A;  1A2U A;  1JOO A;  3X3M A;  4Q0F A;  2M9V A;  4H13 C;  4XTC S;  5CYU A;  3C2P A;  2EE1 A;  4G57 A;  2EYH A;  4XYQ A;  5C0X H;  5HUR A;  3NXW A;  1PYW D;  5KNC A;  3HEJ A;  3M4Y A;  4KI0 A;  1E2Z A;  1TWH B;  2A6E C;  2VB3 X;  1I4G A;  3RLF A;  3TP8 A;  5CV5 A;  3VR4 A;  3J7A V;  3O13 A;  1JWU D;  5KRU A;  3A8J E;  1PTO D;  1EFI D;  1U4M A;  3OMG A;  4E6I A;  2NN6 G;  4XXE A;  4A3G B;  1GJX A;  2B2T A;  2F0P A;  1H9R A;  4XT1 B;  1WTQ A;  3HOV B;  4C3H B;  4A3F B;  5AFW A;  3VA7 A;  3DUZ A;  1EY5 A;  2Z1C A;  1QOH A;  5EBD A;  3HRZ C;  3PIO 3;  2NYZ D;  3K7A B;  2L12 A;  5E4W C;  1ZKO A;  1UEA B;  4X3S A;  3P20 A;  2J4X A;  3R2I A;  3L7Z C;  1HRJ A;  1B50 A;  2CQA A;  4ZKC B;  2F0N A;  2EY6 A;  3C1F A;  1HUN A;  1PZJ D;  3HOX B;  3I4M B;  4HSV A;  1OO9 B;  3AMU A;  1TVX A;  2WII B;  4HSP A;  2PO4 A;  1GUN A;  3S15 B;  2JSO A;  2JA7 B;  1B53 A;  1BF4 A;  3KLR A;  2E2J B;  2N88 A;  2XIW A;  1PMR A;  3BDC A;  3I70 A;  1PXU A;  3MXU A;  1VDZ A;  3HG9 A;  3CU7 A;  2BE5 C;  3KBG A;  1WTO A;  4IFD J;  1PRT F;  2FFK B;  1F9Q A;  4YIJ A;  4I65 A;  1K8O A;  1ET6 A;  1KDB A;  4ZKB B;  1T5E A;  5I2X A;  2F1M A;  2XVS A;  5E1F A;  5FLX E;  3G7L A;  3EVQ A;  2SDF A;  3A7A B;  1CHP D;  1WVL A;  1S5F D;  2IJ0 A;  3SK8 A;  1UUP A;  1SNC A;  4RHR A;  4WJW A;  3DWP A;  3QWN A;  1S5C D;  3SK6 A;  1PFB A;  1BR9 A;  2JA8 B;  2VXW A;  1I6H B;  2QEJ C;  3SR1 A;  2EYP A;  1SNQ A;  2F3W A;  4A3I B;  3JAM L;  3X3N A;  1GUW A;  5C3W A;  3TN2 A;  5M5X B;  1DYQ A;  2VB2 X;  1SYB A;  3WDN A;  5K36 H;  1O80 A;  1OXV A;  3MEH A;  3K0Y A;  2WAC A;  2K01 A;  2D5D A;  4RGT A;  2HDM A;  1LTG D;  2F4I A;  2EPB A;  2A6E D;  4U68 A;  2AUK A;  1F2Z A;  1LTI D;  2ZT9 C;  1V1O A;  2TMP A;  2EJM A;  4IFD I;  2EYJ A;  4CBV A;  3DHQ A;  3J80 L;  1D6E C;  3I90 A;  4RHS A;  4U67 3;  3E5S A;  1ROD A;  3D8G A;  5EPK A;  3E6Z X;  1EIH A;  2DNC A;  4KHZ A;  4FYD A;  2KQ3 A;  1CHQ D;  2IW3 A;  4ABN A;  2IX1 A;  1IYV A;  2HQE A;  1ET9 A;  5ELE A;  1QCB D;  2LY7 A;  4XT3 B;  2Z4I A;  4AYB B;  5EBC A;  2B2Y C;  5G3L F;  4A93 B;  4A3J B;  2TSS A;  1EZ6 A;  2B2Y A;  1F9P A;  1I50 B;  4TSS A;  2LMC B;  1JWS D;  1L0X B;  1MI2 A;  1SYC A;  1SE4 A;  5KYL A;  2A68 C;  3GV6 A;  1BOS A;  3J7A F;  1EZ8 A;  2KJX A;  4UAI A;  2IT1 A;  5C5M A;  3I73 A;  3T16 A;  4F7X A;  2J7Z A;  2R6G A;  3T51 B;  4OO1 I;  3MXG A;  3MFY A;  1SMY C;  2KA7 A;  3NTK A;  2AUJ D;  4KV6 A;  1O7Y A;  3S1M B;  1SE3 A;  4C3I G;  4KKS A;  1KLG D;  1F2Y A;  5FK9 C;  2O5J C;  3TME A;  3KUP A;  1FNV A;  3A8K E;  1BCP C;  5JVG 3;  2EXZ A;  2BE5 D;  2KCN A;  1JQY D;  5M9O A;  3MTS A;  4L63 B;  2QF7 A;  3HOW B;  1A2T A;  1Q3L A;  2F0I A;  2Z8L A;  1G91 A;  5EPJ A;  4KHV A;  1LO5 D;  3NTI A;  3Q23 A;  1VCI A;  2B2U A;  1D2B A;  1RDP D;  2KUM A;  2NN6 I;  3GTO B;  5J39 A;  3GO5 A;  4K6L A;  3VYU A;  4MHE A;  2XWJ B;  4IUP A;  4HTH A;  3SDZ A;  3VR2 A;  2IPK D;  5IGE A;  5KEE A;  3FRP B;  3LX0 A;  4DA2 A;  3BVM A;  1DOM A;  2JEA I;  4KN7 C;  1AZP A;  4DK0 A;  3K5O A;  5E3F A;  3PMF A;  2QDB A;  4C3H G;  4A3E B;  4KKU A;  1EWH A;  3I4N B;  1HTP A;  2RVL A;  4LK1 C;  2F0K A;  4A3M B;  3NP8 A;  3PIP 3;  4DNR B;  2E76 C;  4H7B A;  4KJN A;  1EIG A;  4KY7 A;  3TSS A;  4K2L A;  4LAA A;  1TWG B;  2FMM A;  5HGT A;  4J8Q A;  1VMP A;  4QCL A;  5CR3 A;  3MFG A;  4LJZ C;  2KEC A;  1H9M A;  3N6R A;  5K36 G;  1Y1W B;  1CZW A;  3ND8 A;  2EYO A;  1UAP A;  2MJ8 A;  3WOE A;  4K8I A;  2ENB A;  1F2M A;  4FF1 A;  3H3V C;  4FXD A;  1DJR D;  1KLU D;  4K5W A;  3QG1 A;  1QNK A;  1TII D;  1EY7 A;  4IQZ A;  3S2D B;  1C4Q A;  5ELD A;  2A6H C;  5BN3 A;  1EOT A;  1PTO H;  3R93 A;  1F77 A;  3BDL A;  1HFN A;  5T1G A;  1STB A;  4M1U B;  2F0U A;  2EOT A;  1I4R A;  3OHX C;  2DY7 A;  3PO3 B;  1Y1V B;  2OT2 A;  1PRT B;  3BG3 A;  5EPL A;  1TWC B;  1LV9 A;  2F0F A;  2K1B A;  5JPN C;  2G9H D;  4FF4 A;  2F0Q A;  3LWU A;  1SYF A;  1AZQ A;  4F88 A;  5COY A;  3V05 A;  1EU3 A;  4O1N A;  3M3Y B;  2F0L A;  1I4P A;  3CKI B;  1R4Q B;  4FF3 A;  1SMY D;  3J80 E;  1SE2 A;  2BDO A;  1HA6 A;  1SNM A;  1SJE D;  1TWF B;  5ELC A;  1Q1B A;  2NVT B;  1WTP A;  3PO2 B;  1C8C A;  3IFT A;  1LTS D;  2AQ1 B;  1I4Q A;  2Z4H A;  3VR3 A;  1DD2 A;  2EY1 A;  4CKC A;  4EQN A;  5JEA H;  1VF7 A;  1U9R A;  4ZYS A;  2CVR A;  2JA5 B;  3M4O B;  3MA2 B;  2BDN A;  3FKI B;  4CKB A;  2EYF A;  1SYE A;  4XIG S;  3S1N B;  1A6X A;  3RUZ A;  5M3M B;  3OSO A;  1MBY A;  4HAE A;  2WKC A;  4KKT A;  5J1Z A;  1CFM A;  4DFA A;  4O42 A;  5IGC A;  5C4H A;  1STG A;  2X69 A;  1EYD A;  5DNF A;  1SFO B;  2YYZ A;  5CBE E;  2AQ3 B;  4C3I B;  1Z47 A;  5DM6 3;  1ICW A;  3K5M A;  1BNZ A;  4IZ8 A;  1V8Q A;  1BUV T;  3OOC A;  1LTA D;  5DEH A;  1TQO A;  1FGB D;  1R9T B;  3E0J A;  1WTV A;  2WAQ B;  1Y8O B;  3BVG A;  4H44 C;  2Q8T A;  1SND A;  4XQN A;  4B9X A;  3J81 E;  4C56 C;  3VA5 A;  4TQU S;  4HCE A;  1CQF A;  5D14 A;  1BBX C;  1ESF A;  2B2W A;  1E0B A;  3FPP A;  3ERQ A;  3FVQ A;  5IGB A;  4JK1 C;  2IWH A;  4K6D A;  5I2Y A;  5I9O A;  2SNM A;  1PTO F;  2DY8 A;  2A69 C;  3QB3 A;  5T1I A;  4IUR A;  3A8I E;  3KF8 A;  1SNO A;  2B2T C;  2NUC A;  1SBB B;  1V1P B;  4BY1 B;  1G6Z A;  2EJF C;  2L1B A;  2QIL A;  4CJ1 B;  1KNE A;  2F0H A;  4WRD A;  3W2D A;  3OW7 A;  3BDO A;  2LKV A;  2XWB B;  3R3O A;  2VNU D;  3J7Y W;  4ME5 A;  1LAC A;  4RAU C;  3BYT B;  3T4A C;  3KLS X;  2K7V A;  2R7Z B;  2FIN B;  4R9W A;  3D6C A;  3GD7 A;  1I4H A;  3LNN A;  1KTK A;  2K03 A;  1U4P A;  3VR6 A;  1X3Q A;  2A6H D;  4Y7N B;  3BS1 A;  2AWN A;  2LFN A;  2K5Q A;  3HKZ B;  4C1N K;  5BN4 A;  5FOB B;  2F0V A;  3L3O C;  4L6T B;  4HN7 A;  3SVM A;  2K5D A;  1EEI D;  5C4Z A;  2WKD A;  3GTP B;  4BA2 I;  2CW0 C;  5LHY 1;  5JJZ A;  5CMD A;  3VYS A;  1IKM A;  2NWG A;  3VYT A;  5E4X A;  2F0D A;  3M7N A;  4K5V A;  3K5L A;  1HCZ A;  2XRQ D;  1E2W A;  1QJO A;  4KTA A;  1JB3 A;  1XYI A;  1FD7 D;  3NQT A;  1WCM B;  4QUC A;  3L9A X;  1RKN A;  4NW2 A;  3RMH A;  3U9O A;  2MUY A;  2MHV A;  3EJI A;  1NR4 A;  1TS4 A;  2PW7 A;  3DEP A;  3HGB A;  2MP1 A;  3DWA A;  1M8A A;  1A15 A;  5C6A A;  4OL7 A;  1B3A A;  1I3Q B;  4HMJ A;  5IGD A;  3IL8 A;  4FNF A;  1JR0 D;  1WTR A;  4HR7 B;  1EQT A;  5A35 A;  1SJH D;  1GXD C;  1Z7T A;  5CV8 A;  4RCN A;  1TS2 A;  2NBF A;  4PMW A;  5JEA G;  4BBR B;  1Q90 A;  4BA1 I;  3D4D A;  3CHB D;  1G29 1;  3S2H B;  1H9K A;  4XDX A;  2IX0 A;  5CC4 A;  1JCK B;  2SEB D;  4BS9 A;  2FJ2 A;  2Q8I B;  2G9D A;  4TKO B;  2B63 B;  1EY9 A;  3DXJ C;  4CKE A;  2PZW A;  3NQI A;  1HTL D;  4L8J A;  1VMC A;  2A69 D;  1SXT A;  3SK5 A;  1D1K A;  2OF1 A;  2BA1 A;  2EY5 A;  3W3A A;  5C3E B;  1FNW A;  5JOB A;  4ZUI A;  2L5T A;  4LMQ D;  4IUN A;  5C0X G;  2L9H A;  1ESR A;  4RKL A;  4DU9 A;  3NUC A;  1ZEQ X;  1HHV A;  4MN3 A;  1LTB D;  3PV0 A;  3OIP A;  3I4L A;  4R8I A;  1DOL A;  3FEW X;  2R92 B;  2F0J A;  5FO8 B;  1NR2 A;  3K57 A;  1IL8 A;  5J22 A;  3GTM B;  4K14 A;  4IFD H;  1TY0 A;  1T5X D;  4NKL A;  3GTJ B;  2E75 C;  1MGS A;  1IW7 C;  1G2S A;  1M4V A;  1TS3 A;  1SEB D;  5IOC A;  1B4O A;  2DNE A;  2EDG A;  3M85 A;  3R8B A;  2JEB I;  1SYG A;  1II3 A;  4ULL A;  1UNS A;  1ML0 D;  3MXP A;  2E74 C;  4JBW A;  3PUZ A;  3NWT A;  2CW0 D;  3D4W A;  3P75 A;  4S3S A;  1ENA A;  1L0Y B;  5FO9 B;  1Y69 U;  1BQQ T;  2F03 A;  1C48 A;  5ISR A;  3TP6 A;  2OEO A;  2C9O A;  1LLR D;  2F0M A;  2H4O A;  2RSN A;  3GTL B;  1JOK A;  2PZU A;  2DN8 A;  5A2Q L;  4RKB A;  3DMU A;  3KLS A;  1EU4 A;  5JAV A;  2ID0 A;  2B2U C;  2J0T D;  5LL6 S;  3WOF A;  3SEB A;  1DM0 B;  1YNN C;  5I9P A;  2F0S A;  2AWO A;  2NTS A;  3SXH A;  4ID6 A;  4IAL A;  1GUS A;  3PUV A;  3EA6 A;  4XQQ A;  2MPM A;  2PNR C;  3Q6S A;  2RDH A;  3S14 B;  4OHJ A;  4DAV A;  1QB5 D;  2O4X A;  2ZXP A;  1PTO B;  1S5E D;  1A3V A;  4F8M A;  1TY2 A;  5CGK A;  1H9S B;  3HOU B;  2BA0 A;  1K8M A;  2JA6 B;  1H9J A;  1EWC A;  1ILP A;  3ND9 A;  4PMB A;  2NN6 H;  1PFM A;  4ZRZ A;  1KNA A;  3A56 A;  3GTK B;  5JEA J;  1EY0 A;  2HCI A;  1FYC A;  2V4D A;  1OXU A;  2FHT A;  3H94 A;  5I6W A;  3PUW A;  1G8Z D;  2VUM B;  2D9U A;  5KND A;  1OXS C;  4TRD A;  1TT2 A;  4ZQ3 A;  5CV4 A;  1EL0 A;  1TKW B;  3JAM E;  2SOB A;  3QJY A;  1GUT A;  4EQP A;  2ZXO A;  1KDC A;  5LL6 X;  2RBM A;  1CZG A;  5C0X J;  4NMZ A;  2XSC A;  2EYM A;  2Q8R E;  1E2V A;  2JYO A;  3F2U A;  3CRK C;  4RCO A;  2K32 A;  3T56 B;  5FLX L;  2F3V A;  4RH6 A;  4EQO A;  5D3I B;  1I4X A;  1Y8P B;  1JIC A;  4WFN 3;  2A68 D;  4EVO A;  4H0L C;  1D5X C;  1GUO A;  5CV9 A;  4C2M B;  1X32 A;  1A3T A;  3MZ5 A;  1RTO A;  4CHT B;  2O5I C;  3GTQ B;  4PV1 C;  2B8F A;  4FVM A;  3FDT A;  4P2C B;  1QIL A;  4DXG A;  2X6G A;  5EGT A;  1BCP F;  3K5N A;  3URY A;  4IFD G;  1CA6 A;  2EY2 A;  1J9O A;  1MSG A;  4I7Z C;  1BCP D;  1JWM D;  4ILW A;  1YNJ C;  2A73 B;  4EGV A;  3MWY W;  4QIW B;  2KOL A;  3NHH A;  1CM9 A;  3MHB A;  1D5M C;  1PRT C;  2WB1 B;  5C5L A;  5KIX A;  1RCV D;  1EY6 A;  5FKA C;  1Z6H A;  1JE4 A;  2A5H A;  1STH A;  1STE A;  2PCF B;  4XYO A;  1YNN D;  1EYC A;  4WOR A;  3G6J B;  1S4Z A;  4ODG A;  1PDQ A;  3DWQ A;  3NK9 A;  5C0X I;  3BYY B;  1WTW A;  5C3X A;  2M00 A;  1EYA A;  2RQX A;  1SSO A;  1TWA B;  2RDF A;  3QOL A;  3Q22 A;  2IX3 A;  2B2W C;  3SE0 A;  2PYK A;  4BBS B;  2B39 A;  3I8Z A;  1DON A;  3AU7 A;  1LAB A;  2M2L A;  4OIK A;  1DCZ A;  1NSN S;  3Q0A A;  1DZ1 A;  1BDO A;  5EKK A;  4RGO S;  3HP3 A;  3NPP A;  4A3B B;  1QE6 A;  3T53 B;  2KED A;  1G2T A;  1CT1 D;  5A2Q E;  3Q24 A;  1RTN A;  2F0T A;  3MAQ A;  1AN8 A;  1PFN A;  4CJ2 C;  3RZD B;  3RD4 A;  2K33 A;  1B44 D;  1PZK D;  1B9M A;  4IUU A;  1W6K A;  2PW5 A;  1EQV A;  3ITP A;  3OIQ A;  3C46 A;  4OGQ C;  4PMC A;  2LS0 1;  2I07 B;  2B2V C;  2NVQ B;  3EQL C;  5EKL A;  1Q12 A;  2B2V A;  3HS0 C;  2I46 A;  3I91 A;  2E2I B;  3K6O A;  2C5C A;  3A54 A;  3FMC A;  1RHP A;  1JC7 A;  3SK4 A;  3KK7 A;  3LWE A;  5C44 B;  1OXT A;  3H91 A;  3K59 A;  1X3P A;  2F0O A;  4KY5 A;  3MC0 B;  4V0B A;  5IT9 L;  2HDL A;  5IGF A;  3SHL A;  1XWE A;  2ZXR A;  1XTC D;  2OXP A;  1V1P A;  3C1E A;  1GOZ A;  3QOJ A;  4KD4 A;  4FO2 A;  3N52 A;  3ONA B;  3NWS A;  5TSS A;  5C4X B;  2GA4 B;  4DF7 A;  1D1I A;  3TP7 A;  2H1E A;  4A3D B;  1CTM A;  1GHK A;  2X6L A;  3QO2 A;  4J1M A;  5D65 A;  1W6J A;  4FXK C;  2R3Z A;  4N9P A;  1I6V C;  2KCC A;  3IKJ A;  1HFG A;  1U4R A;  4KMU C;  4KD3 A;  4DK1 A;  2K6A A;  1YNJ D;  2R61 A;  4G7Z C;  2KEE A;  3GQB A;  5M3F B;  2K05 A;  2QKI C;  5I6Y A;  2CHB D;  3T13 A;  1STA A;  1PRT D;  3IFD A;  4X3K A;  4R8N A;  1MSH A;  5EJW A;  4KN4 C;  3DM1 A;  2XRS D;  2O2L D;  3NBI A;  3S9W A;  1EY8 A;  1GHJ A;  5KNB A;  5C4J B;  3OWE B;  1HUM A;  4DAY A;  5EQ0 A;  4CGY B;  3CQZ B;  1STN A;  1HA5 A;  3I3C A;  4HMI A;  3ZYY X;  2RKS A;  1WTX A;  1FNU A;  2EJG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...