3RMHA

Crystal structure of yeast telomere protein cdc13 ob4
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
130
structure length
127
Chain Sequence
b'QYEVVEDHNISQLNHLQHLTPKIYVLNVYIIDVEIVYDQEIRIKVVNELPLVGKYVPPVDILEVYITGKEEVQNFLGDEVLTMDIFTPLLNETSRLRVFQRPDRIIRWSPIECTIQELRLQRMFRLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Yeast Cdc13 OB4
publication title Analyses of Candida Cdc13 Orthologues Revealed a Novel OB Fold Dimer Arrangement, Dimerization-Assisted DNA Binding, and Substantial Structural Differences between Cdc13 and RPA70.
pubmed doi rcsb
source organism Candida glabrata
molecule tags Protein binding
total genus 31
structure length 127
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18233 Cdc13_OB4_dimer Cdc13 OB4 dimerization domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.810 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3rmhA00
3RMHA
chains in the Genus database with same CATH superfamily
1EY4A 1F2LA 1LTLA 1SNMA 1UEBA 1HPCA 3D0FA 4BBSB 4DV0L 2JXMB 3QB3A 1I50B 2AMCB 2KHJA 3DWQA 4O42A 5EKIA 1XJVA 4CJ1B 2UUBQ 3GTLH 2L5TA 4DNRB 2F03A 1XNRQ 4LMQD 4A93G 2BOSA 5IYDH 1VQEA 4KN4C 2DJFC 5C44G 2Y0SB 1LO5D 3B6YA 1RD9D 2BE5D 5GROA 4DK3C 1MHWC 5D3IB 2IHFA 4C56C 3HOXG 3HGBA 1S5DD 1KLUD 5IWAL 4JI2L 3K7AB 2EQSA 5JEAJ 3ICEA 3I4NH 2WB1B 4DAPA 4NMZA 3VR4A 1U4LA 3BZKA 1HNZQ 2A73B 3HOYG 1X3FA 2Z6BA 2VNUD 4A3MH 1EZ8A 1EY8A 1QUQA 1IXRA 1IL8A 1TS3A 1WTHA 1Y1WB 1KQSA 1KHIA 2VL6A 3H0GH 4B3RL 4KHZA 5C4XB 5JJZA 1EIGA 4A3JG 1OO9B 4LUZA 1Y8OB 4ID6A 3H91A 4XXEA 4IOCA 1CSQA 3MVVA 3HOVB 2PQAA 1ML0D 3FKIB 3Q6SA 3G4SA 4A3GH 2Z0SA 2OWOA 4OXPA 1GHKA 5CGKA 2QDBA 2UXDQ 3PO3H 5IGGA 1EQVA 1X9NA 3MHBA 3D3RA 2B8FA 4Q0FA 1WTPA 4RFBA 3BZDB 3D4DA 3GV3A 1QOHA 2F4IA 2RQXA 1EIFA 1L0YB 2PW5A 3MZ5A 4A3LG 4WRDA 3KLSX 2L12A 3BVZA 3TP6A 3BDLA 4XQNA 4YY3Q 3UDFA 2IW3A 4UP9A 1Y1VH 3GD7A 4DXGA 1BBWA 2IX0A 2HQEA 3NHHA 1FR3A 2A69C 3D6WA 5LL6X 3K5NA 4X62L 5M5WB 1I4QA 3IL8A 3MTSA 4NXNQ 1SE2A 1CM9A 1Q46A 1X55A 5EBDA 4QCLA 2DN8A 4RHRA 4JI0Q 2EYMA 3NELA 1TWFH 3K5MA 1AFPA 1SYFA 5IP9H 4AQYL 4DR7L 1V1PB 2JA7G 2HQLA 1O7YA 3STBC 3S14B 1GXDC 3VYUA 3JAMi 4ZCKA 5BR8L 2YU9H 2MO1A 2CCZA 5E7NA 4IQZA 4LW1A 5M5XB 4CDCC 4X66L 1JORA 2HDLA 3A7AB 4NPSA 3S2DB 5E3FA 4BBRG 3GTPB 3S2HB 1J5EQ 1N32Q 2F0SA 1C48A 5IIFA 2EE1A 4WJ4A 5D3DA 1AE3A 1FYCA 1K8MA 5FO9B 4X3UA 4Z9CB 3J7ZC 5G3LD 1ESRA 1LACA 2L11A 3L3OC 1AEXA 4XQQA 2L1BA 3KLRA 4OONA 4QGUA 1K0RA 5T1IA 3S1QB 3QG1A 5H1SE 4QJFA 4A3KG 4QMGA 1WTWA 5D65A 4LFCQ 3OMCA 1QB5D 1PXUA 3E3XA 4C3HG 5I4DA 4PMCA 2EIFA 2OEOA 3UDIA 2MNAA 4OEMB 2IX1A 2B29A 2JA8B 4DAMA 1HZBA 1IW7D 1VQAA 4YWKA 1TS2A 1MKHA 4ME5A 1FJGQ 5DM73 1YEZA 3HKZG 5ELOA 2ALYB 1VQBA 2LXKA 3FHWA 4R4TA 2PI2A 4H13C 4C1NK 3U9SA 1C0AA 2LXJA 4LF6L 3BS1A 3CC2A 3CPFA 4PG3A 4LF4L 4X65Q 2SEBD 1CK1A 3GTGH 1PRTF 2KEEA 5J3BA 1K73C 5EKLA 3HOXH 2UUCQ 1DOKA 1WTQA 1EY7A 1QILA 1ILPA 4UP7A 3M7NA 2KEDA 5COYA 1G291 3RNUA 4QQBX 5K36H 3G6JB 4A3EG 3NP8A 4L5SA 4O2DA 2XSCA 1ZYRD 3ONAB 3PIOA 2VUMB 1TWHH 1I4HA 4M8AA 4KTAA 2K05A 3A8IE 4CKBA 1XX8A 2D0PA 3NE5B 5FJ8H 2PI2E 4JK1C 4WFN3 2WAQB 1CKNA 4HN7A 1JCKB 1BBXC 4BY7G 1QUQB 2JQOA 1R4PB 2B2WA 2CWAA 2KHSA 3KLWA 1XYIA 1N8RC 1LT3D 3U9OA 2DY8A 3BDOA 1L1OA 5J1ZA 4A3DG 3RUZA 2B39A 1YNJC 4P71A 4JVZA 2BA0A 1PH3A 3IKJA 3M4OH 1YHBA 3A5UA 2PQAB 4IUPA 4DR6L 3VR5A 4C2MB 1I3QH 1PFSA 3VYTA 4NXML 1NUCA 4IALA 5IE8A 4QF4A 1RIPA 3NWTA 2KCCA 2AQ2B 1PH2A 4HJ5A 1B8AA 2B63G 4IJHA 1SMYC 1KC8C 3W1BA 3I4OA 4K2KA 1SAPA 3RN2A 2B3GA 4IPHA 2AUKA 1JT8A 5IYBG 1NAPA 2VQFQ 3P1HA 1YITA 2UXBL 2OTLA 3LGJA 2B2WC 3FP9A 4A93B 1HNWL 3K5OA 3SR1A 2K03A 4LF7L 4JCVE 2EJFC 4DXFA 4QL5A 3M3YB 1L1OC 5C44B 1S40A 2F0NA 3DXJC 4Y7NH 1EFWA 2EY6A 4LUVA 4B3TL 2NBFA 3S1RH 4OHJA 3RN5A 2VQEQ 4DV7Q 2LFNA 4CGYB 1N34Q 1I6HB 1IYJB 3A56A 1EZ6A 3DHQA 2MPMA 1LT5D 3HOXB 2BH8A 4L6TB 3TS2A 4V0BA 1XMQL 1STHA 3S1MH 2I5LX 1E1TA 2NN6H 3HOYB 1Q12A 2F0VA 3QJYA 2E2HB 1DCZA 5KIXA 1YZ6A 4IO9A 1EWCA 3HOZH 4FF3A 1R4QB 4JYAQ 1SFOH 3I2ZA 4A3JB 1PZID 1L0XB 3EIVA 4LF5L 1JJGA 4MIUA 1IBMQ 2RCNA 3L2PA 1TS4A 2F0LA 3S9WA 4DV4L 3EVQA 1XTDA 1HQRD 1Q3LA 1JQYD 4OGQC 4UPAA 4RG1A 5CV9A 3MXUA 4R8IA 3KBGA 1LV9A 3OWEB 2E2JB 4IFDG 5EPJA 2R3ZA 1N33Q 5ISRA 1EYDA 3J80L 1QE6A 4CDDC 1NMFA 2F0EA 1V1QA 1XNQQ 3A74A 3SK4A 1NY4A 2C35B 5JPMC 2JEAI 1LTSD 3D6CA 2ZXRA 3J80E 1PH4A 3KUPA 1KXLA 3V2TA 1MJCA 2K52A 3ZYYX 4BA1I 2DNCA 5C3EH 3MEFA 3C1FA 4B9WA 1Q8KA 1C9OA 2SNMA 3EN2A 3TSSA 3KLSA 2WFWA 2F0PA 2A1AA 5FLXL 3T1HQ 1TIID 4KKUA 2JA7B 4O0AA 1G8ZD 1EY9A 4QIWE 4YWMA 4CHTB 5M3FH 1VF5C 1A3TA 5FLXE 1JE4A 4HEDA 3NENA 1F9SA 1BQQT 3PUYA 4DK1A 3ND8A 2LSSA 2A69D 4IFDI 5CMDA 4BBRB 1YI2A 3ERSX 4RH6A 1VQ5A 1DM0B 2EXDA 4NDXA 2Q2IA 3D4WA 2NWGA 3K59A 2F4VL 4K6LA 3MXNB 1CKNB 3TREA 2LMCB 2XRSD 4CDEC 5E4WC 1DOLA 2B2TA 4K0KQ 2NVTB 1CQVA 4YHHQ 3STBD 4OWTB 1M1KC 4YIJA 1L1OB 1JOKA 1TWCH 3CQZH 4X3TA 4A3KB 2MJ8A 4HAEA 4GKJL 3MAQA 3W2DA 3CAMA 3A54A 4ZUJA 1B70B 1PTOH 2PO4A 3KYHC 2CH4A 4DV5Q 4HCSA 2ZXOA 3EFXD 1ZEQX 3ZJYC 3HKZB 1QVGA 1YJWA 1L2FA 1TT2A 3P75A 4U68A 2E2IB 1X3QA 4LFAQ 1CUKA 2EOTA 4KY6A 1SN8A 4LFBQ 2ZTCA 1TWAH 3EA6A 4GS3A 3I4MG 3QR8A 2E75C 2G9HD 3FVQA 4ILWA 5KGUA 3KJPA 1T5EA 1PTOF 2B2TC 4K5XA 2Z4IA 3UE0A 4BS9A 1HR0L 2K5WA 1WVLA 2A6EC 3TZDA 2F52A 5C0XG 1XNRL 1IW7C 1I4RA 1EWHA 1Q86C 3PIPA 2M9VA 3F2BA 4KMUC 4DN4M 4HTHA 4A3EB 4TVAB 3PQIA 4GZYC 4A3FH 3VDYA 2O4XA 2B2VA 5C3WA 1IZ6A 5EAYA 1PA6A 4AYBE 3HKSA 1U4PA 1ONLA 2ATWA 3RZOB 1VQGA 4RCNA 1A0IA 4BBSH 3VA7A 1B50A 4LK1C 4A3IG 2B8GA 2Q8TA 1I50H 2KCMA 3K6OA 1EU3A 4DR5Q 2PMZE 4JI7Q 4FYDA 4BY7B 2BA1A 2Q2HA 3CCVA 2CQOA 1HNZL 3NXWA 3E0EA 4YWLA 2R7ZG 1Y8NB 4IN3A 1YVCA 4C1NI 4KHVA 4A3DB 1DZ1A 3M9BA 3DMUA 2PPBC 1BKBA 1VQ4A 4M1UB 2K5QA 2K33A 1ZYRC 5C0XI 1SJHD 5K5PA 2R93G 2RKSA 4MNOA 1X56A 2VY3A 1NMGA 4L5RC 3H15A 2B2VC 4DUZQ 2B63B 3BZCA 3T53B 2PZTA 3CCJA 3FEWX 1Q8IA 4F7XA 5JVG3 4KI0A 3S24A 1U4RA 4IUTA 3K7AH 1PLFA 2UXDL 4JPBW 5IGBA 5I2XA 4KD3A 1YNJD 5CV4A 3SEBA 1SNPA 3TQYA 1I4XA 2XN9C 2F0TA 5EKKA 5DLQE 1QCBD 1Y1WH 3I7FA 2L4NA 3GV6A 2O5IC 1K9MC 2UXCQ 1U0LA 4JI3Q 2Q8IB 3BVMA 5C4XH 2QCPX 5HY6A 4YY3L 4RAUC 3HOVH 1EUJA 1OXUA 3L9AX 2VS1A 4JI4Q 1A2TA 4NXNL 4R4OA 4I7ZC 3I70A 2Z9HA 4UY8C 4JI0L 3DLLA 2IJ0A 1PH6A 2A8VA 4QY7A 1RTOA 1I6VC 2NVYB 2AUJD 4XYOA 1V9PA 3U4ZA 4CBVA 4A3CG 4JC0A 4OX9Q 4PV1C 2ENBA 3CW2C 1EY0A 4IOAA 4IZ8A 4DV2Q 3X3NA 3NWSA 3JAMc 1G91A 1LUZA 4QUCA 3S17B 1J5EL 5HURA 5M5WH 1K8AC 1N32L 1VQ9A 2HD3A 3H3VH 2K28A 2D5DA 4JI5Q 3J7AF 3R93A 4ZK9B 3WOEA 2A5HA 2R7DA 4K6DA 2XRQD 1TY2A 1QG7A 1HNXQ 5CC4A 4DAYA 1QWYA 3FPPA 2JA5G 1YJ9A 3S14H 1UUPA 3CCEA 1EFID 1DJRD 4LFCL 5J22A 3D31A 5M5XH 4HIOA 1STGA 2PMZB 1PVOA 3S2DH 1FJGL 3S2HH 3GTPH 2K32A 3K5LA 1HHVA 1V43A 4GNXA 5LMNL 4KHPQ 3E6ZX 4JBMA 4A3BG 2RDGA 2X6LA 1MI2A 1STNA 1HZ9A 2QKIC 2RCFA 1GOZA 4X65L 2PYKA 3EROA 2R61A 3NPPA 4DGZA 4UDUC 2O5JC 3S1QH 3KF8A 3TP7A 2UUCL 2PNRC 5F2DA 4DV6L 3ULPA 3ER0A 3NBIA 3CCLA 5IT9L 1WFQA 5GADC 2AHOB 2AQ3B 2JA8H 3TBIB 3Q23A 3S15B 2Z1CA 4GLVB 1AZQA 1JMCA 1E22A 4DR2L 3I91A 4EVOA 1JWSD 5IT9E 3K0XA 4ZLTF 4BA2I 4DK0A 1BVSA 1IYVA 2JA9A 4C3IG 4GLAC 1SNCA 4NB3A 5IY0A 4GNXC 1SNOA 4X64Q 2VB2X 3T1YQ 3RLOA 3J81i 4G57A 1OXXK 2KECA 3OHXC 1X54A 1Y14B 4HR7B 2EY1A 2OXPA 3KDFA 5KNBA 3HOUG 3BYTB 2F3WA 3G48A 2JYOA 3CMAA 3FRPB 1X3EA 5JJKA 2JN4A 1HTPA 1TWGB 1BCPC 4DPGA 4R4IA 2ZTEA 1JB3A 1EEFD 3CCRA 2J7ZA 1IBKQ 1CTMA 1LABA 3MEHA 3C46A 4TQUS 3MC0B 2VUMH 4JI1Q 2K04A 5CV7A 3W5OA 3DM3A 2KVMA 4GLXA 2I5MX 2UU9Q 1PYWD 1D5XC 1RF2D 1C4QA 1WCMG 2IPKD 3L0OA 3PUXA 1A8VA 2YYZA 4RKLA 1X32A 3GTQB 4JW0A 5JAVA 2GVAA 4DKAC 2VQFL 3HOWG 4DU9A 4Q5VA 4DAVA 2UUAQ 5GQOA 3J81j 2KHIA 3S16B 1TU2B 2SOBA 4MHEA 1IKLA 3E9HA 2Q8RE 4XDXA 4Y52H 1XMOL 4C2MH 2VQEL 4DV7L 1N34L 1H9MA 4A3IB 2EY2A 4LNQA 2MUYA 5M3MG 2OF1A 3C1EA 4TRDA 1UE5A 3CXCA 1CQFA 5DAUA 1B53A 2A6ED 5C6AA 1Q81C 2ZT9C 1J9OA 2R7ZB 1IL2A 2H4OA 3CCUA 1BXTA 3V05A 3GTOB 2ZJPA 5TSSA 1EQTA 4A93H 4R9WA 4OO1G 3PUWA 2HUGA 2N8NA 1JR0D 2RBMA 3M3YH 4JYAL 3A0JA 5C44H 5LMUQ 1UE7A 2R93B 1II3A 4LF8Q 1Q7YC 2A19A 1DGSA 2NB0A 2HCIA 2JJQA 1LTRD 4X3SA 4JI2Q 1BO0A 4MZ9A 4F8MA 4DR3Q 1I6HH 2ZM6Q 1Q1BA 4FP5D 4EQNA 3BVGA 5I9PA 3J81L 2ZTDA 4IPGA 1YHQA 2NYZD 4DAYB 2MHVA 3HOYH 2QDLA 4PZ6A 3J81E 3QOJA 2YTVA 2E2HH 4PMBA 1ENCA 2P5ZX 1E1OA 1S72A 1Z47A 4B3RQ 4OELB 4RGOS 5EPLA 4IPDA 1JJ2A 1VQKA 1BDOA 5IGFA 5FOBB 1H9JA 1H9KA 3S1NB 1QNUA 1SYEA 3A8JE 3A55A 4DV3Q 4A3JH 5CV8A 1XNQL 3UDXA 4OO1I 3FDTA 3H94A 1XTCD 3T51B 3K7UC 4GNXB 5JEAG 1OTCA 1MD2D 2F0MA 3AYHB 5BN3A 2WIIB 1B1ZA 4IUNA 2E76C 4K5WA 3GTMB 4BXXG 2F0IA 4PQXA 1D1IA 2RDFA 1VQJA 1L0WA 3I73A 3KF8B 4DUYQ 2KCNA 1GM5A 2H1EA 2K1BA 1VCIA 2K5DA 1SRUA 2WINB 2HHHQ 2NVQB 1EYAA 3J80i 1BCPB 4GOPA 2E2JH 1PFNA 4NW2A 4HJAA 3MFGA 4A3LH 1S5CD 3KF6A 3MXGA 4X62Q 3VR3A 1VQHA 3BJUA 3NTHA 4JI6Q 5AJ3Q 1HH2P 1B2TA 1LTBD 1PFMA 2JEBI 1W3SA 3I3CA 2CFMA 3I90A 5M9OA 1KDCA 4LF9Q 4R1JA 1UNSA 1M4VA 1GUNA 2D62A 3SGIA 4RKBA 4ABNA 3KDFB 4A75A 4K0KL 5CV6A 3U50C 3EBEA 2JA5B 3OSOA 3TEHB 3NBHA 1CA5A 2JA7H 4XIGS 1SYGA 2WP8J 5IGDA 4GOPC 3FPUB 1C7YA 4TSSA 2A68C 4XTCS 1R9TB 1CHQD 1VQ8A 1UEAB 4DV5L 4FDBA 5CBEE 4BY1G 4BBRH 1E7ZA 4FVMA 4JI8Q 5IYCG 5FLMG 4LFAL 1JC7A 3IAYA 4A3BB 1F9PA 4LFBL 4X6AH 2F0QA 5ELEA 3F2CA 3I8ZA 1OXSC 4GKKQ 2NVTH 3TP8A 1KAWA 5BN5A 1HZCA 4JOIA 4C3JG 4A3KH 4K8JA 1PH9A 3J7AV 4DR4L 1EOVA 3PV0A 1FNWA 4C3HH 4EQ5A 1MSHA 4G7ZC 3RZDB 3WOFA 3PO2G 1PMRA 2ZJRA 1Q90A 1FGBD 1PH5A 2E2IH 1WJJA 4C3IB 1BR9A 4NKLA 1ZXTA 1QNKA 4DV1L 1SDFA 3TRZA 1NE3A 1K8OA 4AYBG 1HUMA 1VQCA 2TSSA 3M4PA 1JB7A 1GUSA 4DR5L 1KNAA 2EY5A 1B9NA 2R92G 4P72A 2AKWB 1IHZA 3HOUB 1SNQA 3M7GA 2FFKB 1E0BA 1D5ZC 3K8AA 4JOIC 2JA6G 1HZAA 2EYHA 3J7A5 3O13A 3P20A 1X3GA 4RWSC 3TMEA 1N36L 4A3EH 4ZUIA 1LTAD 3E9IA 4L63B 2K5VA 1ASZA 4FF1A 4N9PA 5A2QL 1P16A 2IY5B 3RZOH 2JE6I 4KKTA 4B3SQ 1SE4A 1CKMA 1SSOA 2AWNA 1RKNA 1AP0A 4B9XA 2I5HA 2Q2TA 1RODA 3ULJA 1WCMB 1ESFA 5I9OA 1RTNA 4BY7H 4J6HA 5GAHC 1E2WA 4I7AA 1KRTA 1A15A 4DR1Q 1EY5A 5IP7G 2HIVA 5JVH3 4H7BA 1SXTA 3CRKC 1YJNA 1FGUA 4L8JA 1NR4A 3HOWB 1KDBA 3CPWA 1BCPD 4A3DH 3MXPA 5FO7B 3GTJB 4F87A 2NVXB 3NQIA 2VXWA 4QB4A 2UXCL 2E5LQ 4JI3L 2FINB 3SK5A 1X65A 3FKIG 3CC7A 1B3QA 5M3MB 2B63H 2FMMA 2RHQB 4CJ0B 1A3VA 1VQNA 2Q2UA 4C3HB 2XWBB 1EEID 1I94Q 2LS01 2NTSA 3Q24A 4LF7Q 5IYBH 4GOPB 1HUNA 4TKOB 2XNAC 1JJCB 4P73A 2EYFA 2PQEA 3KF6B 1P8LA 1TY0A 1PRTD 1F77A 3GDEA 4DK6C 3SDZA 3TS0A 2I0QA 1CZGA 4K2LA 4WJ3M 4R4CA 3H09A 1EL0A 2Z4HA 3Q8DA 4S3SA 1PZJD 5IODA 4OX9L 3KBXA 1CHPD 5IGEA 1RDPD 1XMQQ 4DV2L 5M5YB 2OT2A 2KOLA 3Q22A 1PYBA 3NUCA 1T5XD 2UUBL 1GUWA 5IYDG 4POFA 1X6OA 3M85A 5KYLA 2F1MA 1VQFA 4JI5L 1M90C 3NBHB 3LX0A 3CD6A 3PSIA 4HCEA 5FO8B 1RL2A 2K4KA 3PUZA 3ND9A 3SVMA 4V190 3WWVA 2OTJA 1HNXL 2NVYH 2VB3X 3I4LA 4LF5Q 3GQBA 3T13A 1EWIA 1Z7TA 3AU7A 1J8IA 1WI5A 3I4NG 4K5VA 3UI2A 5KEEA 2F0HA 3K57A 2FHTA 4DV4Q 3PIP3 4PZ8A 4A3MG 2NZOA 1JE5A 1NR2A 1VF7A 2Y0SE 4JV5Q 4RGMA 4HSPA 3S17H 1MSGA 1TKWB 1IKMA 3P7JA 5CYUA 3H0GG 4ALPA 4KHPL 1HFNA 4RGTA 5ELNA 1N9WA 2EYLA 2CVRA 4FF4A 1CZWA 5C5MA 4B3MQ 5G3LF 1I5FA 2F3IA 4IFDH 4A3GG 3HZXA 1B3AA 2PZWA 2R6GA 4QIWB 4HIDA 2HCCA 3ERQA 3PO3G 1E24A 2C5CA 4MTKA 3CF5A 2I46A 3GP7A 3PCOB 1ENAA 2D9UA 3M4YA 5C5LA 1B4OA 1KL9A 2WV6D 1PYSB 3I72A 4E6IA 3OYYA 1S5ED 1QJOA 2F0OA 4P2CB 1Q1EA 3H6MA 2ICIA 1RJTA 1H9SA 5I2YA 1Y1VG 2FXQA 3L7ZC 3AFPA 1IBLQ 2QEJC 1VQLA 2NTTA 1EYGA 1O7IA 1SNDA 3BYYB 1CA6A 1MBYA 3J81c 4BY1B 3PF5A 1C8CA 3X3MA 5IP9G 4UP8A 3N6RA 3S15H 4LUOA 4XT1B 2X69A 1IBKL 1G2SA 1XWEA 1Y69U 2ZJQA 4A76A 3NTIA 2ASBA 2E74C 2IWHA 3EQLC 2XWJB 1SROA 3OWFA 1YHAA 1HCZA 1E3PA 3CRLC 4UAIA 4C3JB 1SR3A 4ZAIA 3GTKB 1WOCA 2A68D 2K6AA 2EZVA 2CWPA 2G5DA 4KJNA 1QZHA 5KRUA 4ULLA 4ODGA 1F2MA 2UUAL 3PO2B 1TWGH 1UE6A 1CSPA 1GUOA 3I56A 4GN5A 3QIAA 1U5KA 1DONA 3I4MH 1HR0Q 5FKAC 4AYBB 5ELBA 5JPNC 4JBWA 1CT1D 5EQ0A 4XT3B 1VQDA 5LHY1 2R92B 2KENA 4OWWB 3AFQA 3R2IA 2YV5A 3GTQH 2MO0A 5D14A 5C0XH 2JA6B 2E2DC 3D8GA 1U4MA 2K01A 1A3UA 4N8FA 3R8BA 3I55A 1D6EC 1SBBB 4P75A 2A74C 5T1GA 2SNSA 1VQOA 4EX5A 3S16H 1NSNS 1STAA 4GN4B 5LMUL 2L55A 4LF8L 4K14A 1WD1A 2K7VA 2WKCA 1BOSA 4A3IH 4DR3L 2LY7A 2ZM6L 1ASYA 3MWYW 3PUVA 5K36G 1VDZA 3CC4A 3URYA 1BF4A 2R7ZH 5JJIA 1PHJA 1YIJA 2K5HA 3GTOH 5C4JB 3OTOQ 3K0YA 3C2PA 2EJMA 5IOCA 4HMJA 3VR2A 3G7LA 2V1CC 1MIUA 5AFWA 4PZ7A 5FJ8G 1STYA 4FNFA 1K83B 1Z9FA 1J6QA 1QVCA 2TMPA 5IGCA 1F9RA 2R93H 4DV3L 4J1MA 5C3XA 2Z8LA 5CR3A 1K8GA 2M2LA 4H44C 2KQ3A 1HXYD 1S5BD 2EYPA 3OPOA 1JWUD 1F2YA 2AWOA 2CKZB 3OIPA 1AN8A 2OCEA 4CKCA 2F0KA 2N3SA 4DUYL 2XVSA 2WAQE 1K3BC 2HHHL 1PTOD 1B44D 2MFIA 1TR5A 1O7LA 3I4MB 3S1NH 1ET6A 1TVXA 3J80c 3GTLB 3E5SA 1D5MC 1ICFB 4I65A 3W3AA 4RGNA 2N49A 1WTVA 4MTNA 3HS0C 4O1NA 4LAAA 5DNFA 5AJ3L 4JI6L 3VYRA 1SEBD 4ZKCB 4PMWA 1K28A 2K50A 1PV4A 3AQQA 1DD2A 5KNCA 3F2UA 4LF9L 3GTMH 1H9SB 2MP1A 2Z6KA 2N55A 2NUCA 1VQMA 3AB9A 4G7HC 1PRTC 2NVQH 4DV0Q 1IYUA 3E0JA 5FLXc 5E4XA 2DNEA 3CMEA 3U58A 2O2LD 3I4NB 3T16A 4A3CH 1NTGA 2IHEA 2NN6G 1YNXA 1EIHA 2DUDA 4XQJA 3PF4A 1EYCA 4A3MB 1LT6D 5JJLA 1RHPA 2BCOA 1H9RA 4IPCA 4JI8L 1G51A 3HOZG 2XIWA 3H0GB 3UE1A 1VMPA 5CV5A 3QWNA 1BCPF 2KBNA 4DNIA 4KN7C 3G6EA 2N88A 1KIXA 2JSOA 4IFDJ 1G6ZA 1QVFA 2D2CC 4KY7A 4GKKL 3F2DA 2Z6KC 1WTXA 1E2VA 2JA5H 2J4XA 3HEJA 4AIMA 2F0DA 4A3GB 5IWAQ 1IBML 4BWGB 1DOMA 1KTKA 4MN3A 3PO3B 1DYQA 3A7LA 3KOJA 1LTGD 1OXVA 1R9TH 2EXZA 2FJ2A 1FL0A 1KAAA 1VS0A 2FMCA 4PNYA 3RLNA 5LMNQ 1K0SA 2PZUA 2VW9A 3G71A 1ENFA 2NN6I 1KNEA 1SJED 1LLRD 2A6HC 4IURA 3BU2A 3KK7A 4ZQ3A 2KA7A 4ZKBB 2F0UA 4A3BH 3CCMA 1AW7A 1Q82C 1N33L 3IRBA 1Y1VB 3GO5A 1SYDA 4DV6Q 2QILA 5KYIA 1WD0A 3M4QA 2MGSA 4F88A 3MFYA 1XXGA 5HGTA 5C3EG 3OW2A 3OIQA 3JC66 1PH7A 2EDGA 1G6PA 1ILQA 1VMCA 3R3OA 1TWFB 1A63A 1GKHA 3CCSA 2E8GA 1STBA 4DR2Q 4KV6A 4EGVA 1KDAA 1VQIA 3PIO3 1T9HA 1STEA 3RZDH 3UDGA 2YU9B 1FNUA 5M3FG 3AEVA 3CP0A 3MXNA 3T1HL 4L5TA 3JAML 4C3IH 4B3SL 1CFMA 2RVLA 3VYSA 1SE8A 4FF2A 3JAME 1GO3E 1MGSA 4N8X1 4DR1L 3AMUA 5GAGC 1HA6A 3HOUH 2CQAA 2PW7A 1LYLA 3Q0AA 3RD4A 2QA4A 4HJ7A 1DXMA 3QO2A 3BG3A 2IX3A 3SHLA 1YNND 2CW0C 5CBAE 1FD7D 1HJPA 4AQYQ 3SXHA 1HR0W 4DR7Q 1H95A 3DEPA 4H02A 1ICWA 1B7YB 4OWXB 3TDQA 1V1OA 5BR8Q 2E5LL 1KRSA 1QZGA 4YHHL 1ET9A 3WDNA 1U9RA 4G4KA 2CH4W 1W6KA 4X66Q 2KUMA 1PRTB 3EJIA 4WJWA 3KJOA 1XPOA 1SMXA 2BDOA 1EY6A 1WCMH 4X3KA 5C0XJ 1I94L 1WYDA 4XYQA 2GA4B 4OIKA 5EJWA 2LKVA 1V8QA 1VQ7A 2BH2A 3DEOA 4EQPA 1HRJA 3HOWH 2RHSB 3K80C 3J7YW 3F1ZA 1S5FD 2J0TD 3ITPA 1XMOQ 3GTJH 3GTGB 2NVXH 1JOQA 4CDFC 2QW7A 2EPBA 1TQOA 3LWUA 1PZKD 4UHVA 3HKZE 4DNTB 2RA4A 1D2BA 2B2YA 5M3MH 2K75A 5J39A 2M00A 3CU7A 4IUQA 1XPRA 4A3FG 1BBUA 3RR5A 1TWHB 1AE2A 1X3PA 5ELDA 1SE3A 1HFGA 4WORA 2BE5C 1S4ZA 3MA2B 4LF6Q 3PGZA 4BBSG 4OO1H 3TN2A 2G9DA 1AZPA 4LF4Q 1KD1C 4RA8A 3IFDA 4HJ9A 2C9OA 4POGA 5DM63 3SE0A 4H0LC 4ZYSA 4JI7L 5M5YH 1EOTA 3SK6A 5A35A 2RSNA 3BDCA 3RMHA 5C4ZA 1TXYA 3M4OB 4JV5L 2IT1A 1NCVA 2DY7A 1LTID 1UE1A 2B2YC 3N52A 1WTOA 4HMIA 4GN3B 4DA2A 4KY5A 2DJGC 2Y0SG 2QEXA 1I3QB 1O7ZA 1YBYA 4B3ML 1SYBA 2GVBA 2NZHA 5CORA 1F9QA 1SLJA 4OL7A 3A8KE 3OW7A 1I4GA 3DM1A 5BN4A 5KNDA 4DUZL 1SYCA 2F0FA 5GAEC 4CJ2C 2WB1G 4KKSA 3VR6A 1MJEA 4HIKA 5A2QE 1FNVA 1FVIA 2D0OA 5JEAH 4JBJA 1E2ZA 4K8IA 3FMCA 4RMFA 4Y7NB 5I6YA 1Y1WG 3C3LA 1HA5A 1WTRA 1S3OA 4B08A 4BXXH 4DR6Q 1D1KA 1OXTA 1GUGA 1GJXA 3S1RB 1EIYB 2XGTA 5C4XG 1PTOC 5NUCA 4NXMQ 4KJOA 5EPKA 2QGQA 3HOVG 1GD7A 1IBLL 3S1MB 2IL8A 1PH8A 4U673 4IUVA 3KFUA 1LT4D 1TS5A 2JK8A 4NP5A 3IFTA 2UXBQ 2L0CA 3NQTA 4JI4L 5E1FA 1HNWQ 3LNNA 5IT9c 2L9HA 3V96A 3HOZB 4YCUA 2F0GA 2KCTA 1NBWA 1SFOB 2GN5A 2OQ0A 1F2ZA 4J15A 5EBCA 3A5ZB 4B3TQ 2JP1A 4KLKA 3K58A 4QUFA 5EGTA 3HFZB 4JG2A 1Y8PB 3PMFA 3NSWA 3W1GA 2AQ1B 2X6GA 2EYOA 2I07B 5LMNW 5ELCA 4KK7A 3K81C 4YCWA 2NZ1D 1CI3M 2R7FA 1VQ6A 5C4HA 3R2TA 2MQHA 4IJLA 4P74A 4BY1H 3VA5A 4R4QA 4FO2A 1I4PA 5IYCH 3CCQA 2WACA 1G2TA 1PFBA 4KD4A 5FLMH 2EYJA 2XTIA 1A6XA 4JBKA 1JWMD 3TZUA 3D4RA 3CKIB 1ZKOA 4DR4Q 3CHBD 5HGQA 4G7OC 1W6JA 5DEHA 2ES2A 5ELFA 5LL6S 5C3EB 4RCOA 2VZAA 4C3JH 2OQKA 2QF7A 1HQMC 3GTKH 1NJIC 3HG9A 3HRZC 4HSVA 4APVA 4CKEA 2CHBD 4L5QA 3NK9A 1XPUA 2HT1A 2ID0A 2A6HD 3H3VI 1EQRA 3PO2H 1HTLD 1AH9A 4DV1Q 4HJ8A 1Z6HA 3LWEA 1LM0A 3HP3A 3NEMA 4EQOA 1LTTD 5M3FB 1BNZA 4RHSA 4LJZC 1EU4A 2RF4A 1VQPA 2WB1E 2YTXA 1GUTA 1JOOA 2F0WA 2WKDA 4FXGC 4IUUA 2B2UA 4R8NA 3ULLA 2JA8G 2KJXA 2H5XA 4HIMA 3RLFA 2R92H 2EJGC 1D7QA 2N78A 3DWPA 4DFAA 1JICA 2SDFA 1N36Q 2JA6H 3OTOL 1D8LA 1K3RA 1NNXA 1M8AA 5FK9C 1TWCB 3CQZB 4N9TA 2YTYA 1GHJA 1B9MA 3TP5A 4X64L 3T1YL 2DGYA 3T4AC 2K5NA 1PTOB 3U4VA 1UAPA 1V1PA 4FXDA 4OIJA 3T56B 1UWVA 1GVPA 2BDNA 3QOLA 2L15A 2ZXPA 1A2UA 2F3VA 4A4IA 2B2UC 5IP7H 2F4VQ 4AH6A 2HDMA 3DUZA 1W2BA 2VUMG 1TWAB 2F0JA 1YNNC 1KABA 2CW0D 3F8TA 5C4JH 2PCFB 4DF7A 4ZRZA 3NTKA 1A62A 3DWAA 1CKOA 1BUVT 2ICEC 4YCVA 1PH1A 3H3VC 1PDQA 1SMYD 4JI1L 1K83H 2WAQG 1EQQA 3SK8A 1RCVD 2RSOA 4GKJQ 3FKIH 2K14A 5JOBA 1KLGD 2UU9L 2PNHA 3OOCA 3OMGA 1O78A 2EVBA 2RDHA 4FXKC 4J8QA 5I6WA 4A3FB 4ME3A 2V4DA 1O80A 5L37A 2HIXA 4LWCA
chains in the Genus database with same CATH topology
1EY4A 1F2LA 1SNMA 1HPCA 4BBSB 2JXMB 3QB3A 1I50B 3DWQA 4O42A 5EKIA 4CJ1B 2L5TA 4DNRB 2F03A 4LMQD 2BOSA 4KN4C 2Y0SB 1LO5D 1RD9D 2BE5D 5D3IB 4C56C 3HGBA 1S5DD 1KLUD 3K7AB 5JEAJ 2WB1B 4DAPA 4NMZA 3VR4A 1U4LA 2A73B 2VNUD 1EZ8A 1EY8A 1TS3A 1IL8A 1Y1WB 4KHZA 5C4XB 5JJZA 1EIGA 1OO9B 1Y8OB 4ID6A 3H91A 4XXEA 3MVVA 3HOVB 1ML0D 3FKIB 3Q6SA 1GHKA 5CGKA 2QDBA 5IGGA 1EQVA 3MHBA 3D3RA 2B8FA 4Q0FA 1WTPA 4RFBA 3BZDB 3D4DA 3GV3A 1QOHA 2F4IA 2RQXA 1L0YB 2PW5A 3MZ5A 4WRDA 3KLSX 2L12A 3BVZA 3TP6A 3BDLA 4XQNA 2IW3A 4DXGA 3GD7A 2IX0A 2HQEA 3NHHA 1FR3A 2A69C 3D6WA 5LL6X 3K5NA 5M5WB 1I4QA 3IL8A 3MTSA 1SE2A 1CM9A 5EBDA 4QCLA 2DN8A 4RHRA 2EYMA 3K5MA 1AFPA 1SYFA 1V1PB 1O7YA 3S14B 1GXDC 3VYUA 4IQZA 5M5XB 1JORA 2HDLA 3A7AB 3S2DB 5E3FA 3S2HB 3GTPB 2F0SA 1C48A 5IIFA 2EE1A 5D3DA 1FYCA 1K8MA 5FO9B 4X3UA 4Z9CB 5G3LD 1ESRA 1LACA 2L11A 3L3OC 1AEXA 4XQQA 2L1BA 3KLRA 5T1IA 3S1QB 3QG1A 4QMGA 1WTWA 5D65A 3OMCA 1QB5D 1PXUA 4C3HG 5I4DA 4PMCA 2OEOA 2IX1A 2JA8B 1IW7D 1TS2A 4ME5A 5DM73 4H13C 4C1NK 3U9SA 3BS1A 2SEBD 1CK1A 1PRTF 2KEEA 5EKLA 1DOKA 1WTQA 1EY7A 1QILA 1ILPA 3M7NA 2KEDA 5COYA 1G291 5K36H 3G6JB 3NP8A 2XSCA 1ZYRD 3ONAB 2VUMB 4M8AA 1I4HA 4KTAA 2K05A 3A8IE 4CKBA 1XX8A 3NE5B 4JK1C 4WFN3 2WAQB 1BBXC 4HN7A 1JCKB 1R4PB 2B2WA 2KHSA 1XYIA 1LT3D 3U9OA 2DY8A 3BDOA 5J1ZA 3RUZA 2B39A 1YNJC 2BA0A 3IKJA 4IUPA 3VR5A 4C2MB 3VYTA 1NUCA 4IALA 4QF4A 3NWTA 2KCCA 2AQ2B 1SMYC 4K2KA 1SAPA 2AUKA 1NAPA 3P1HA 2B2WC 4A93B 3K5OA 3SR1A 2K03A 2EJFC 4DXFA 3M3YB 5C44B 2F0NA 3DXJC 2EY6A 2NBFA 4OHJA 2LFNA 4CGYB 1I6HB 3A56A 1EZ6A 3DHQA 2MPMA 1LT5D 3HOXB 4L6TB 4V0BA 1STHA 2NN6H 3HOYB 1Q12A 2F0VA 3QJYA 2E2HB 1DCZA 5KIXA 1EWCA 4FF3A 1R4QB 4A3JB 1PZID 1L0XB 4MIUA 1TS4A 2F0LA 3S9WA 3EVQA 1HQRD 1Q3LA 1JQYD 4OGQC 5CV9A 3MXUA 4R8IA 3KBGA 1LV9A 3OWEB 2E2JB 4IFDG 5EPJA 2R3ZA 5ISRA 1EYDA 3J80L 1QE6A 2F0EA 3SK4A 5JPMC 2JEAI 1LTSD 3D6CA 2ZXRA 3J80E 3KUPA 3V2TA 3ZYYX 4BA1I 2DNCA 3C1FA 4B9WA 2SNMA 3TSSA 3KLSA 2F0PA 5FLXL 1TIID 4KKUA 2JA7B 1G8ZD 1EY9A 4CHTB 1VF5C 1A3TA 5FLXE 1JE4A 4HEDA 1F9SA 1BQQT 3PUYA 4DK1A 3ND8A 2A69D 4IFDI 5CMDA 4BBRB 4RH6A 1DM0B 4NDXA 3D4WA 2NWGA 3K59A 4K6LA 2LMCB 2XRSD 5E4WC 1DOLA 2B2TA 2NVTB 1CQVA 4YIJA 1JOKA 4X3TA 4A3KB 2MJ8A 4HAEA 3MAQA 3W2DA 3A54A 4ZUJA 1PTOH 2PO4A 4HCSA 2ZXOA 3EFXD 1ZEQX 3HKZB 1TT2A 3P75A 4U68A 2E2IB 1X3QA 2EOTA 4KY6A 3EA6A 2E75C 2G9HD 3FVQA 4ILWA 5KGUA 1T5EA 1PTOF 2B2TC 4K5XA 2Z4IA 4BS9A 2K5WA 1WVLA 2A6EC 3TZDA 5C0XG 1IW7C 1I4RA 1EWHA 2M9VA 4KMUC 4DN4M 4HTHA 4A3EB 4GZYC 2O4XA 2B2VA 5C3WA 1U4PA 1ONLA 3RZOB 4RCNA 3VA7A 1B50A 4LK1C 2B8GA 2Q8TA 3K6OA 4BY7B 1EU3A 4FYDA 2BA1A 3NXWA 1Y8NB 4IN3A 4C1NI 4KHVA 4A3DB 1DZ1A 3DMUA 2PPBC 4M1UB 2K5QA 2K33A 1ZYRC 5C0XI 1SJHD 5K5PA 2RKSA 2B2VC 2B63B 3T53B 2PZTA 3FEWX 1Q8IA 4F7XA 5JVG3 4KI0A 1U4RA 4IUTA 1PLFA 5IGBA 5I2XA 4KD3A 1YNJD 5CV4A 3SEBA 1SNPA 1I4XA 2XN9C 2F0TA 5EKKA 1QCBD 2L4NA 3GV6A 2O5IC 2Q8IB 3BVMA 2QCPX 4RAUC 1OXUA 3L9AX 1A2TA 4I7ZC 3I70A 2IJ0A 1RTOA 1I6VC 2NVYB 2AUJD 4XYOA 4CBVA 4PV1C 2ENBA 1EY0A 4IZ8A 3X3NA 3NWSA 1G91A 4QUCA 3S17B 5HURA 2K28A 2D5DA 3J7AF 3R93A 4ZK9B 3WOEA 2A5HA 4K6DA 2XRQD 1TY2A 1QG7A 5CC4A 4DAYA 1QWYA 3FPPA 1UUPA 1EFID 1DJRD 5J22A 3D31A 1STGA 2PMZB 2K32A 3K5LA 1HHVA 1V43A 3E6ZX 2RDGA 2X6LA 1MI2A 1STNA 2QKIC 1GOZA 2PYKA 3EROA 2R61A 3NPPA 4DGZA 4UDUC 2O5JC 3KF8A 3TP7A 2PNRC 5F2DA 3NBIA 5IT9L 2AQ3B 3TBIB 3Q23A 3S15B 2Z1CA 1AZQA 3I91A 4EVOA 1JWSD 5IT9E 4ZLTF 4BA2I 4DK0A 1IYVA 4C3IG 1SNCA 1SNOA 2VB2X 3OHXC 1OXXK 2KECA 4G57A 4HR7B 2EY1A 2OXPA 5KNBA 3BYTB 2F3WA 2JYOA 3FRPB 1HTPA 1TWGB 1BCPC 1JB3A 1EEFD 2J7ZA 1CTMA 1LABA 3MEHA 3C46A 4TQUS 3MC0B 2K04A 5CV7A 2KVMA 1PYWD 1D5XC 1RF2D 1C4QA 2IPKD 2YYZA 3PUXA 4RKLA 1X32A 3GTQB 5JAVA 4DU9A 4Q5VA 4DAVA 3S16B 1TU2B 2SOBA 4MHEA 1IKLA 2Q8RE 4XDXA 1H9MA 4A3IB 2EY2A 2MUYA 2OF1A 3C1EA 4TRDA 1CQFA 5DAUA 1B53A 2A6ED 5C6AA 2ZT9C 1J9OA 2R7ZB 2H4OA 1BXTA 3V05A 3GTOB 5TSSA 1EQTA 4R9WA 4OO1G 3PUWA 2HUGA 1JR0D 2RBMA 2R93B 1II3A 2NB0A 2HCIA 1LTRD 4X3SA 1BO0A 4F8MA 1Q1BA 4FP5D 4EQNA 3BVGA 5I9PA 3J81L 2NYZD 2MHVA 3J81E 3QOJA 4PMBA 1ENCA 1Z47A 4RGOS 5EPLA 1BDOA 5IGFA 5FOBB 1H9JA 1H9KA 3S1NB 1QNUA 1SYEA 3A8JE 3A55A 5CV8A 4OO1I 3FDTA 3H94A 1XTCD 3T51B 5JEAG 1MD2D 2F0MA 5BN3A 2WIIB 1B1ZA 4IUNA 2E76C 4K5WA 3GTMB 2F0IA 4PQXA 1D1IA 2RDFA 3I73A 2KCNA 2H1EA 2K1BA 1VCIA 2K5DA 2WINB 2NVQB 1EYAA 1BCPB 1PFNA 4NW2A 3MFGA 1S5CD 3MXGA 3VR3A 3NTHA 1B2TA 1LTBD 1PFMA 2JEBI 3I3CA 3I90A 5M9OA 1KDCA 1UNSA 1M4VA 1GUNA 2D62A 4RKBA 4ABNA 5CV6A 2JA5B 3OSOA 3NBHA 1CA5A 4XIGS 1SYGA 2WP8J 5IGDA 3FPUB 4TSSA 2A68C 4XTCS 1R9TB 1CHQD 1UEAB 5CBEE 4FVMA 1JC7A 3IAYA 4A3BB 1F9PA 2F0QA 5ELEA 3I8ZA 1OXSC 3TP8A 5BN5A 4C3JG 4K8JA 3J7AV 3PV0A 1FNWA 1MSHA 4G7ZC 3RZDB 3WOFA 1PMRA 1Q90A 1FGBD 4C3IB 1BR9A 4NKLA 1ZXTA 1QNKA 1SDFA 1K8OA 1HUMA 2TSSA 1GUSA 1KNAA 2EY5A 1B9NA 1IHZA 3HOUB 1SNQA 3M7GA 2FFKB 1E0BA 1D5ZC 2EYHA 3O13A 3P20A 4RWSC 3TMEA 4ZUIA 1LTAD 4L63B 4FF1A 4N9PA 5A2QL 2JE6I 4KKTA 1SE4A 1SSOA 2AWNA 1RKNA 1AP0A 4B9XA 1RODA 1WCMB 1ESFA 5I9OA 1RTNA 4J6HA 1E2WA 1A15A 1EY5A 5JVH3 4H7BA 1SXTA 3CRKC 4L8JA 1NR4A 3HOWB 1KDBA 1BCPD 3MXPA 5FO7B 3GTJB 4F87A 2NVXB 3NQIA 2VXWA 4QB4A 3SK5A 2FINB 5M3MB 2FMMA 4CJ0B 1A3VA 4C3HB 2XWBB 1EEID 2LS01 2NTSA 3Q24A 1HUNA 4TKOB 2XNAC 2EYFA 2PQEA 1TY0A 1PRTD 1F77A 3SDZA 1CZGA 4K2LA 3H09A 1EL0A 2Z4HA 4S3SA 1PZJD 5IODA 3KBXA 1CHPD 5IGEA 1RDPD 5M5YB 2OT2A 2KOLA 3Q22A 3NUCA 1T5XD 1GUWA 3M85A 5KYLA 2F1MA 3LX0A 5FO8B 4HCEA 3PUZA 3ND9A 3SVMA 4V190 2VB3X 3I4LA 3GQBA 3T13A 1Z7TA 3AU7A 1J8IA 4K5VA 3UI2A 5KEEA 2F0HA 3K57A 2FHTA 3PIP3 1NR2A 1VF7A 4RGMA 4HSPA 1MSGA 1TKWB 1IKMA 3P7JA 5CYUA 1HFNA 4RGTA 2EYLA 2CVRA 4FF4A 1CZWA 5C5MA 5G3LF 4IFDH 3HZXA 1B3AA 2PZWA 2R6GA 4QIWB 2HCCA 3ERQA 2C5CA 2I46A 3GP7A 1ENAA 2D9UA 3M4YA 5C5LA 1B4OA 2WV6D 3I72A 4E6IA 1S5ED 1QJOA 2F0OA 4P2CB 1Q1EA 3H6MA 2ICIA 1RJTA 1H9SA 5I2YA 3L7ZC 2QEJC 2NTTA 1SNDA 3BYYB 1CA6A 1MBYA 4BY1B 1C8CA 3X3MA 3N6RA 4XT1B 2X69A 1G2SA 1XWEA 1Y69U 3NTIA 2E74C 2IWHA 3EQLC 2XWJB 3OWFA 1HCZA 3CRLC 4UAIA 4C3JB 4ZAIA 3GTKB 2A68D 2K6AA 2EZVA 4KJNA 5KRUA 4ULLA 4ODGA 1F2MA 3PO2B 1GUOA 3QIAA 1DONA 5FKAC 4AYBB 5ELBA 5JPNC 4JBWA 1CT1D 5EQ0A 4XT3B 5LHY1 2R92B 3R2IA 5D14A 5C0XH 2JA6B 2E2DC 3D8GA 1U4MA 2K01A 1A3UA 3R8BA 1D6EC 1SBBB 2A74C 5T1GA 2SNSA 1NSNS 1STAA 2L55A 4K14A 1WD1A 2K7VA 2WKCA 1BOSA 2LY7A 3MWYW 3PUVA 5K36G 1VDZA 3URYA 1BF4A 5C4JB 3K0YA 3C2PA 2EJMA 5IOCA 4HMJA 3VR2A 3G7LA 5AFWA 1STYA 4FNFA 1K83B 2TMPA 5IGCA 1F9RA 4J1MA 5C3XA 2Z8LA 5CR3A 2M2LA 4H44C 2KQ3A 1HXYD 1S5BD 2EYPA 3OPOA 1JWUD 1F2YA 2AWOA 3OIPA 1AN8A 4CKCA 2F0KA 2XVSA 1PTOD 1B44D 1TR5A 1O7LA 3I4MB 1ET6A 1TVXA 3GTLB 3E5SA 1D5MC 4I65A 3W3AA 4RGNA 1WTVA 3HS0C 4O1NA 4LAAA 5DNFA 3VYRA 1SEBD 4ZKCB 4PMWA 1DD2A 5KNCA 3F2UA 1H9SB 2MP1A 2N55A 2NUCA 3AB9A 4G7HC 1PRTC 1IYUA 3E0JA 5E4XA 2DNEA 2O2LD 3I4NB 3T16A 2NN6G 1EIHA 4XQJA 1EYCA 4A3MB 1LT6D 1RHPA 2BCOA 1H9RA 2XIWA 3H0GB 1VMPA 5CV5A 3QWNA 1BCPF 4KN7C 2N88A 2JSOA 4IFDJ 1G6ZA 2D2CC 4KY7A 1WTXA 1E2VA 2J4XA 3HEJA 2F0DA 4A3GB 4BWGB 1DOMA 1KTKA 4MN3A 3PO3B 1DYQA 3A7LA 1LTGD 1OXVA 2EXZA 2FJ2A 1KAAA 4PNYA 2FMCA 2PZUA 1ENFA 2NN6I 1KNEA 1SJED 1LLRD 2A6HC 4IURA 3KK7A 4ZQ3A 2KA7A 4ZKBB 2F0UA 1AW7A 1Y1VB 3GO5A 1SYDA 2QILA 5KYIA 1WD0A 2MGSA 4F88A 3MFYA 1XXGA 5HGTA 3OIQA 2EDGA 1ILQA 1VMCA 3R3OA 1TWFB 1STBA 4KV6A 4EGVA 1KDAA 3PIO3 1STEA 2YU9B 1FNUA 3MXNA 3JAML 1CFMA 2RVLA 3VYSA 4FF2A 3JAME 1MGSA 3AMUA 1HA6A 2CQAA 2PW7A 3Q0AA 3RD4A 1DXMA 3QO2A 3BG3A 2IX3A 3SHLA 1YNND 2CW0C 5CBAE 1FD7D 3SXHA 3DEPA 1ICWA 3TDQA 1V1OA 1ET9A 3WDNA 1U9RA 4G4KA 1W6KA 2KUMA 1PRTB 3EJIA 4WJWA 2BDOA 1EY6A 4X3KA 5C0XJ 4XYQA 2GA4B 4OIKA 5EJWA 2LKVA 1V8QA 3DEOA 4EQPA 1HRJA 3J7YW 1S5FD 2J0TD 3ITPA 3GTGB 1JOQA 2EPBA 1TQOA 3LWUA 1PZKD 4DNTB 2RA4A 1D2BA 2B2YA 5J39A 2M00A 3CU7A 4IUQA 1TWHB 1X3PA 5ELDA 1SE3A 1HFGA 4WORA 2BE5C 1S4ZA 3MA2B 4OO1H 3TN2A 2G9DA 1AZPA 4RA8A 3IFDA 2C9OA 5DM63 3SE0A 4H0LC 4ZYSA 1EOTA 3SK6A 5A35A 2RSNA 3BDCA 3RMHA 5C4ZA 3M4OB 2IT1A 1NCVA 2DY7A 1LTID 3N52A 2B2YC 1WTOA 4HMIA 4DA2A 4KY5A 1I3QB 1O7ZA 1SYBA 5CORA 1F9QA 4OL7A 3A8KE 3OW7A 1I4GA 3DM1A 5BN4A 5KNDA 1SYCA 2F0FA 4CJ2C 4KKSA 3VR6A 5A2QE 1FNVA 5JEAH 1E2ZA 4K8IA 3FMCA 4Y7NB 5I6YA 3C3LA 1HA5A 1WTRA 4B08A 1D1KA 1OXTA 1GUGA 1GJXA 3S1RB 1PTOC 5NUCA 4KJOA 5EPKA 3S1MB 2IL8A 4U673 4IUVA 1LT4D 1TS5A 4NP5A 3IFTA 2L0CA 3NQTA 5E1FA 3LNNA 2L9HA 3V96A 3HOZB 2F0GA 1SFOB 1F2ZA 5EBCA 2JP1A 3K58A 4QUFA 5EGTA 1Y8PB 3PMFA 3NSWA 2AQ1B 2X6GA 2EYOA 2I07B 5ELCA 4KK7A 2NZ1D 1CI3M 5C4HA 3R2TA 3VA5A 4FO2A 1I4PA 2WACA 1G2TA 1PFBA 4KD4A 2EYJA 1A6XA 1JWMD 3TZUA 3D4RA 3CKIB 1ZKOA 3CHBD 4G7OC 1W6JA 5DEHA 5ELFA 5LL6S 5C3EB 4RCOA 2QF7A 1HQMC 3HG9A 3HRZC 4HSVA 4CKEA 2CHBD 3NK9A 2ID0A 2A6HD 1HTLD 1Z6HA 3LWEA 3HP3A 4EQOA 1LTTD 5M3FB 1BNZA 4RHSA 4LJZC 1EU4A 1GUTA 1JOOA 2F0WA 2WKDA 4FXGC 4IUUA 2B2UA 4R8NA 2KJXA 3RLFA 2EJGC 3DWPA 4DFAA 1JICA 2SDFA 1M8AA 5FK9C 1TWCB 3CQZB 4N9TA 1GHJA 1B9MA 3TP5A 3T4AC 1PTOB 1UAPA 1V1PA 4FXDA 4OIJA 3T56B 2BDNA 3QOLA 2ZXPA 1A2UA 2F3VA 2B2UC 2HDMA 3DUZA 1TWAB 2F0JA 1YNNC 1KABA 2CW0D 2PCFB 4DF7A 4ZRZA 3NTKA 1BUVT 2ICEC 3DWAA 3H3VC 1PDQA 1SMYD 3SK8A 1RCVD 2RSOA 5JOBA 1KLGD 3OOCA 3OMGA 1O78A 2EVBA 2RDHA 4FXKC 4J8QA 5I6WA 4A3FB 2V4DA 1O80A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RMH A; 
#chains in the Genus database with same CATH topology
 1EY4 A;  1F2L A;  1LTL A;  1SNM A;  1UEB A;  1HPC A;  3D0F A;  4BBS B;  4DV0 L;  2JXM B;  3QB3 A;  1I50 B;  2AMC B;  2KHJ A;  3DWQ A;  4O42 A;  5EKI A;  1XJV A;  4CJ1 B;  2UUB Q;  3GTL H;  2L5T A;  4DNR B;  2F03 A;  1XNR Q;  4LMQ D;  4A93 G;  2BOS A;  5IYD H;  1VQE A;  4KN4 C;  2DJF C;  5C44 G;  2Y0S B;  1LO5 D;  3B6Y A;  1RD9 D;  2BE5 D;  5GRO A;  4DK3 C;  1MHW C;  5D3I B;  2IHF A;  4C56 C;  3HOX G;  3HGB A;  1S5D D;  1KLU D;  5IWA L;  4JI2 L;  3K7A B;  2EQS A;  5JEA J;  3ICE A;  3I4N H;  2WB1 B;  4DAP A;  4NMZ A;  3VR4 A;  1U4L A;  3BZK A;  1HNZ Q;  2A73 B;  3HOY G;  1X3F A;  2Z6B A;  2VNU D;  4A3M H;  1EZ8 A;  1EY8 A;  1QUQ A;  1IXR A;  1IL8 A;  1TS3 A;  1WTH A;  1Y1W B;  1KQS A;  1KHI A;  2VL6 A;  3H0G H;  4B3R L;  4KHZ A;  5C4X B;  5JJZ A;  1EIG A;  4A3J G;  1OO9 B;  4LUZ A;  1Y8O B;  4ID6 A;  3H91 A;  4XXE A;  4IOC A;  1CSQ A;  3MVV A;  3HOV B;  2PQA A;  1ML0 D;  3FKI B;  3Q6S A;  3G4S A;  4A3G H;  2Z0S A;  2OWO A;  4OXP A;  1GHK A;  5CGK A;  2QDB A;  2UXD Q;  3PO3 H;  5IGG A;  1EQV A;  1X9N A;  3MHB A;  3D3R A;  2B8F A;  4Q0F A;  1WTP A;  4RFB A;  3BZD B;  3D4D A;  3GV3 A;  1QOH A;  2F4I A;  2RQX A;  1EIF A;  1L0Y B;  2PW5 A;  3MZ5 A;  4A3L G;  4WRD A;  3KLS X;  2L12 A;  3BVZ A;  3TP6 A;  3BDL A;  4XQN A;  4YY3 Q;  3UDF A;  2IW3 A;  4UP9 A;  1Y1V H;  3GD7 A;  4DXG A;  1BBW A;  2IX0 A;  2HQE A;  3NHH A;  1FR3 A;  2A69 C;  3D6W A;  5LL6 X;  3K5N A;  4X62 L;  5M5W B;  1I4Q A;  3IL8 A;  3MTS A;  4NXN Q;  1SE2 A;  1CM9 A;  1Q46 A;  1X55 A;  5EBD A;  4QCL A;  2DN8 A;  4RHR A;  4JI0 Q;  2EYM A;  3NEL A;  1TWF H;  3K5M A;  1AFP A;  1SYF A;  5IP9 H;  4AQY L;  4DR7 L;  1V1P B;  2JA7 G;  2HQL A;  1O7Y A;  3STB C;  3S14 B;  1GXD C;  3VYU A;  3JAM i;  4ZCK A;  5BR8 L;  2YU9 H;  2MO1 A;  2CCZ A;  5E7N A;  4IQZ A;  4LW1 A;  5M5X B;  4CDC C;  4X66 L;  1JOR A;  2HDL A;  3A7A B;  4NPS A;  3S2D B;  5E3F A;  4BBR G;  3GTP B;  3S2H B;  1J5E Q;  1N32 Q;  2F0S A;  1C48 A;  5IIF A;  2EE1 A;  4WJ4 A;  5D3D A;  1AE3 A;  1FYC A;  1K8M A;  5FO9 B;  4X3U A;  4Z9C B;  3J7Z C;  5G3L D;  1ESR A;  1LAC A;  2L11 A;  3L3O C;  1AEX A;  4XQQ A;  2L1B A;  3KLR A;  4OON A;  4QGU A;  1K0R A;  5T1I A;  3S1Q B;  3QG1 A;  5H1S E;  4QJF A;  4A3K G;  4QMG A;  1WTW A;  5D65 A;  4LFC Q;  3OMC A;  1QB5 D;  1PXU A;  3E3X A;  4C3H G;  5I4D A;  4PMC A;  2EIF A;  2OEO A;  3UDI A;  2MNA A;  4OEM B;  2IX1 A;  2B29 A;  2JA8 B;  4DAM A;  1HZB A;  1IW7 D;  1VQA A;  4YWK A;  1TS2 A;  1MKH A;  4ME5 A;  1FJG Q;  5DM7 3;  1YEZ A;  3HKZ G;  5ELO A;  2ALY B;  1VQB A;  2LXK A;  3FHW A;  4R4T A;  2PI2 A;  4H13 C;  4C1N K;  3U9S A;  1C0A A;  2LXJ A;  4LF6 L;  3BS1 A;  3CC2 A;  3CPF A;  4PG3 A;  4LF4 L;  4X65 Q;  2SEB D;  1CK1 A;  3GTG H;  1PRT F;  2KEE A;  5J3B A;  1K73 C;  5EKL A;  3HOX H;  2UUC Q;  1DOK A;  1WTQ A;  1EY7 A;  1QIL A;  1ILP A;  4UP7 A;  3M7N A;  2KED A;  5COY A;  1G29 1;  3RNU A;  4QQB X;  5K36 H;  3G6J B;  4A3E G;  3NP8 A;  4L5S A;  4O2D A;  2XSC A;  1ZYR D;  3ONA B;  3PIO A;  2VUM B;  1TWH H;  1I4H A;  4M8A A;  4KTA A;  2K05 A;  3A8I E;  4CKB A;  1XX8 A;  2D0P A;  3NE5 B;  5FJ8 H;  2PI2 E;  4JK1 C;  4WFN 3;  2WAQ B;  1CKN A;  4HN7 A;  1JCK B;  1BBX C;  4BY7 G;  1QUQ B;  2JQO A;  1R4P B;  2B2W A;  2CWA A;  2KHS A;  3KLW A;  1XYI A;  1N8R C;  1LT3 D;  3U9O A;  2DY8 A;  3BDO A;  1L1O A;  5J1Z A;  4A3D G;  3RUZ A;  2B39 A;  1YNJ C;  4P71 A;  4JVZ A;  2BA0 A;  1PH3 A;  3IKJ A;  3M4O H;  1YHB A;  3A5U A;  2PQA B;  4IUP A;  4DR6 L;  3VR5 A;  4C2M B;  1I3Q H;  1PFS A;  3VYT A;  4NXM L;  1NUC A;  4IAL A;  5IE8 A;  4QF4 A;  1RIP A;  3NWT A;  2KCC A;  2AQ2 B;  1PH2 A;  4HJ5 A;  1B8A A;  2B63 G;  4IJH A;  1SMY C;  1KC8 C;  3W1B A;  3I4O A;  4K2K A;  1SAP A;  3RN2 A;  2B3G A;  4IPH A;  2AUK A;  1JT8 A;  5IYB G;  1NAP A;  2VQF Q;  3P1H A;  1YIT A;  2UXB L;  2OTL A;  3LGJ A;  2B2W C;  3FP9 A;  4A93 B;  1HNW L;  3K5O A;  3SR1 A;  2K03 A;  4LF7 L;  4JCV E;  2EJF C;  4DXF A;  4QL5 A;  3M3Y B;  1L1O C;  5C44 B;  1S40 A;  2F0N A;  3DXJ C;  4Y7N H;  1EFW A;  2EY6 A;  4LUV A;  4B3T L;  2NBF A;  3S1R H;  4OHJ A;  3RN5 A;  2VQE Q;  4DV7 Q;  2LFN A;  4CGY B;  1N34 Q;  1I6H B;  1IYJ B;  3A56 A;  1EZ6 A;  3DHQ A;  2MPM A;  1LT5 D;  3HOX B;  2BH8 A;  4L6T B;  3TS2 A;  4V0B A;  1XMQ L;  1STH A;  3S1M H;  2I5L X;  1E1T A;  2NN6 H;  3HOY B;  1Q12 A;  2F0V A;  3QJY A;  2E2H B;  1DCZ A;  5KIX A;  1YZ6 A;  4IO9 A;  1EWC A;  3HOZ H;  4FF3 A;  1R4Q B;  4JYA Q;  1SFO H;  3I2Z A;  4A3J B;  1PZI D;  1L0X B;  3EIV A;  4LF5 L;  1JJG A;  4MIU A;  1IBM Q;  2RCN A;  3L2P A;  1TS4 A;  2F0L A;  3S9W A;  4DV4 L;  3EVQ A;  1XTD A;  1HQR D;  1Q3L A;  1JQY D;  4OGQ C;  4UPA A;  4RG1 A;  5CV9 A;  3MXU A;  4R8I A;  3KBG A;  1LV9 A;  3OWE B;  2E2J B;  4IFD G;  5EPJ A;  2R3Z A;  1N33 Q;  5ISR A;  1EYD A;  3J80 L;  1QE6 A;  4CDD C;  1NMF A;  2F0E A;  1V1Q A;  1XNQ Q;  3A74 A;  3SK4 A;  1NY4 A;  2C35 B;  5JPM C;  2JEA I;  1LTS D;  3D6C A;  2ZXR A;  3J80 E;  1PH4 A;  3KUP A;  1KXL A;  3V2T A;  1MJC A;  2K52 A;  3ZYY X;  4BA1 I;  2DNC A;  5C3E H;  3MEF A;  3C1F A;  4B9W A;  1Q8K A;  1C9O A;  2SNM A;  3EN2 A;  3TSS A;  3KLS A;  2WFW A;  2F0P A;  2A1A A;  5FLX L;  3T1H Q;  1TII D;  4KKU A;  2JA7 B;  4O0A A;  1G8Z D;  1EY9 A;  4QIW E;  4YWM A;  4CHT B;  5M3F H;  1VF5 C;  1A3T A;  5FLX E;  1JE4 A;  4HED A;  3NEN A;  1F9S A;  1BQQ T;  3PUY A;  4DK1 A;  3ND8 A;  2LSS A;  2A69 D;  4IFD I;  5CMD A;  4BBR B;  1YI2 A;  3ERS X;  4RH6 A;  1VQ5 A;  1DM0 B;  2EXD A;  4NDX A;  2Q2I A;  3D4W A;  2NWG A;  3K59 A;  2F4V L;  4K6L A;  3MXN B;  1CKN B;  3TRE A;  2LMC B;  2XRS D;  4CDE C;  5E4W C;  1DOL A;  2B2T A;  4K0K Q;  2NVT B;  1CQV A;  4YHH Q;  3STB D;  4OWT B;  1M1K C;  4YIJ A;  1L1O B;  1JOK A;  1TWC H;  3CQZ H;  4X3T A;  4A3K B;  2MJ8 A;  4HAE A;  4GKJ L;  3MAQ A;  3W2D A;  3CAM A;  3A54 A;  4ZUJ A;  1B70 B;  1PTO H;  2PO4 A;  3KYH C;  2CH4 A;  4DV5 Q;  4HCS A;  2ZXO A;  3EFX D;  1ZEQ X;  3ZJY C;  3HKZ B;  1QVG A;  1YJW A;  1L2F A;  1TT2 A;  3P75 A;  4U68 A;  2E2I B;  1X3Q A;  4LFA Q;  1CUK A;  2EOT A;  4KY6 A;  1SN8 A;  4LFB Q;  2ZTC A;  1TWA H;  3EA6 A;  4GS3 A;  3I4M G;  3QR8 A;  2E75 C;  2G9H D;  3FVQ A;  4ILW A;  5KGU A;  3KJP A;  1T5E A;  1PTO F;  2B2T C;  4K5X A;  2Z4I A;  3UE0 A;  4BS9 A;  1HR0 L;  2K5W A;  1WVL A;  2A6E C;  3TZD A;  2F52 A;  5C0X G;  1XNR L;  1IW7 C;  1I4R A;  1EWH A;  1Q86 C;  3PIP A;  2M9V A;  3F2B A;  4KMU C;  4DN4 M;  4HTH A;  4A3E B;  4TVA B;  3PQI A;  4GZY C;  4A3F H;  3VDY A;  2O4X A;  2B2V A;  5C3W A;  1IZ6 A;  5EAY A;  1PA6 A;  4AYB E;  3HKS A;  1U4P A;  1ONL A;  2ATW A;  3RZO B;  1VQG A;  4RCN A;  1A0I A;  4BBS H;  3VA7 A;  1B50 A;  4LK1 C;  4A3I G;  2B8G A;  2Q8T A;  1I50 H;  2KCM A;  3K6O A;  1EU3 A;  4DR5 Q;  2PMZ E;  4JI7 Q;  4FYD A;  4BY7 B;  2BA1 A;  2Q2H A;  3CCV A;  2CQO A;  1HNZ L;  3NXW A;  3E0E A;  4YWL A;  2R7Z G;  1Y8N B;  4IN3 A;  1YVC A;  4C1N I;  4KHV A;  4A3D B;  1DZ1 A;  3M9B A;  3DMU A;  2PPB C;  1BKB A;  1VQ4 A;  4M1U B;  2K5Q A;  2K33 A;  1ZYR C;  5C0X I;  1SJH D;  5K5P A;  2R93 G;  2RKS A;  4MNO A;  1X56 A;  2VY3 A;  1NMG A;  4L5R C;  3H15 A;  2B2V C;  4DUZ Q;  2B63 B;  3BZC A;  3T53 B;  2PZT A;  3CCJ A;  3FEW X;  1Q8I A;  4F7X A;  5JVG 3;  4KI0 A;  3S24 A;  1U4R A;  4IUT A;  3K7A H;  1PLF A;  2UXD L;  4JPB W;  5IGB A;  5I2X A;  4KD3 A;  1YNJ D;  5CV4 A;  3SEB A;  1SNP A;  3TQY A;  1I4X A;  2XN9 C;  2F0T A;  5EKK A;  5DLQ E;  1QCB D;  1Y1W H;  3I7F A;  2L4N A;  3GV6 A;  2O5I C;  1K9M C;  2UXC Q;  1U0L A;  4JI3 Q;  2Q8I B;  3BVM A;  5C4X H;  2QCP X;  5HY6 A;  4YY3 L;  4RAU C;  3HOV H;  1EUJ A;  1OXU A;  3L9A X;  2VS1 A;  4JI4 Q;  1A2T A;  4NXN L;  4R4O A;  4I7Z C;  3I70 A;  2Z9H A;  4UY8 C;  4JI0 L;  3DLL A;  2IJ0 A;  1PH6 A;  2A8V A;  4QY7 A;  1RTO A;  1I6V C;  2NVY B;  2AUJ D;  4XYO A;  1V9P A;  3U4Z A;  4CBV A;  4A3C G;  4JC0 A;  4OX9 Q;  4PV1 C;  2ENB A;  3CW2 C;  1EY0 A;  4IOA A;  4IZ8 A;  4DV2 Q;  3X3N A;  3NWS A;  3JAM c;  1G91 A;  1LUZ A;  4QUC A;  3S17 B;  1J5E L;  5HUR A;  5M5W H;  1K8A C;  1N32 L;  1VQ9 A;  2HD3 A;  3H3V H;  2K28 A;  2D5D A;  4JI5 Q;  3J7A F;  3R93 A;  4ZK9 B;  3WOE A;  2A5H A;  2R7D A;  4K6D A;  2XRQ D;  1TY2 A;  1QG7 A;  1HNX Q;  5CC4 A;  4DAY A;  1QWY A;  3FPP A;  2JA5 G;  1YJ9 A;  3S14 H;  1UUP A;  3CCE A;  1EFI D;  1DJR D;  4LFC L;  5J22 A;  3D31 A;  5M5X H;  4HIO A;  1STG A;  2PMZ B;  1PVO A;  3S2D H;  1FJG L;  3S2H H;  3GTP H;  2K32 A;  3K5L A;  1HHV A;  1V43 A;  4GNX A;  5LMN L;  4KHP Q;  3E6Z X;  4JBM A;  4A3B G;  2RDG A;  2X6L A;  1MI2 A;  1STN A;  1HZ9 A;  2QKI C;  2RCF A;  1GOZ A;  4X65 L;  2PYK A;  3ERO A;  2R61 A;  3NPP A;  4DGZ A;  4UDU C;  2O5J C;  3S1Q H;  3KF8 A;  3TP7 A;  2UUC L;  2PNR C;  5F2D A;  4DV6 L;  3ULP A;  3ER0 A;  3NBI A;  3CCL A;  5IT9 L;  1WFQ A;  5GAD C;  2AHO B;  2AQ3 B;  2JA8 H;  3TBI B;  3Q23 A;  3S15 B;  2Z1C A;  4GLV B;  1AZQ A;  1JMC A;  1E22 A;  4DR2 L;  3I91 A;  4EVO A;  1JWS D;  5IT9 E;  3K0X A;  4ZLT F;  4BA2 I;  4DK0 A;  1BVS A;  1IYV A;  2JA9 A;  4C3I G;  4GLA C;  1SNC A;  4NB3 A;  5IY0 A;  4GNX C;  1SNO A;  4X64 Q;  2VB2 X;  3T1Y Q;  3RLO A;  3J81 i;  4G57 A;  1OXX K;  2KEC A;  3OHX C;  1X54 A;  1Y14 B;  4HR7 B;  2EY1 A;  2OXP A;  3KDF A;  5KNB A;  3HOU G;  3BYT B;  2F3W A;  3G48 A;  2JYO A;  3CMA A;  3FRP B;  1X3E A;  5JJK A;  2JN4 A;  1HTP A;  1TWG B;  1BCP C;  4DPG A;  4R4I A;  2ZTE A;  1JB3 A;  1EEF D;  3CCR A;  2J7Z A;  1IBK Q;  1CTM A;  1LAB A;  3MEH A;  3C46 A;  4TQU S;  3MC0 B;  2VUM H;  4JI1 Q;  2K04 A;  5CV7 A;  3W5O A;  3DM3 A;  2KVM A;  4GLX A;  2I5M X;  2UU9 Q;  1PYW D;  1D5X C;  1RF2 D;  1C4Q A;  1WCM G;  2IPK D;  3L0O A;  3PUX A;  1A8V A;  2YYZ A;  4RKL A;  1X32 A;  3GTQ B;  4JW0 A;  5JAV A;  2GVA A;  4DKA C;  2VQF L;  3HOW G;  4DU9 A;  4Q5V A;  4DAV A;  2UUA Q;  5GQO A;  3J81 j;  2KHI A;  3S16 B;  1TU2 B;  2SOB A;  4MHE A;  1IKL A;  3E9H A;  2Q8R E;  4XDX A;  4Y52 H;  1XMO L;  4C2M H;  2VQE L;  4DV7 L;  1N34 L;  1H9M A;  4A3I B;  2EY2 A;  4LNQ A;  2MUY A;  5M3M G;  2OF1 A;  3C1E A;  4TRD A;  1UE5 A;  3CXC A;  1CQF A;  5DAU A;  1B53 A;  2A6E D;  5C6A A;  1Q81 C;  2ZT9 C;  1J9O A;  2R7Z B;  1IL2 A;  2H4O A;  3CCU A;  1BXT A;  3V05 A;  3GTO B;  2ZJP A;  5TSS A;  1EQT A;  4A93 H;  4R9W A;  4OO1 G;  3PUW A;  2HUG A;  2N8N A;  1JR0 D;  2RBM A;  3M3Y H;  4JYA L;  3A0J A;  5C44 H;  5LMU Q;  1UE7 A;  2R93 B;  1II3 A;  4LF8 Q;  1Q7Y C;  2A19 A;  1DGS A;  2NB0 A;  2HCI A;  2JJQ A;  1LTR D;  4X3S A;  4JI2 Q;  1BO0 A;  4MZ9 A;  4F8M A;  4DR3 Q;  1I6H H;  2ZM6 Q;  1Q1B A;  4FP5 D;  4EQN A;  3BVG A;  5I9P A;  3J81 L;  2ZTD A;  4IPG A;  1YHQ A;  2NYZ D;  4DAY B;  2MHV A;  3HOY H;  2QDL A;  4PZ6 A;  3J81 E;  3QOJ A;  2YTV A;  2E2H H;  4PMB A;  1ENC A;  2P5Z X;  1E1O A;  1S72 A;  1Z47 A;  4B3R Q;  4OEL B;  4RGO S;  5EPL A;  4IPD A;  1JJ2 A;  1VQK A;  1BDO A;  5IGF A;  5FOB B;  1H9J A;  1H9K A;  3S1N B;  1QNU A;  1SYE A;  3A8J E;  3A55 A;  4DV3 Q;  4A3J H;  5CV8 A;  1XNQ L;  3UDX A;  4OO1 I;  3FDT A;  3H94 A;  1XTC D;  3T51 B;  3K7U C;  4GNX B;  5JEA G;  1OTC A;  1MD2 D;  2F0M A;  3AYH B;  5BN3 A;  2WII B;  1B1Z A;  4IUN A;  2E76 C;  4K5W A;  3GTM B;  4BXX G;  2F0I A;  4PQX A;  1D1I A;  2RDF A;  1VQJ A;  1L0W A;  3I73 A;  3KF8 B;  4DUY Q;  2KCN A;  1GM5 A;  2H1E A;  2K1B A;  1VCI A;  2K5D A;  1SRU A;  2WIN B;  2HHH Q;  2NVQ B;  1EYA A;  3J80 i;  1BCP B;  4GOP A;  2E2J H;  1PFN A;  4NW2 A;  4HJA A;  3MFG A;  4A3L H;  1S5C D;  3KF6 A;  3MXG A;  4X62 Q;  3VR3 A;  1VQH A;  3BJU A;  3NTH A;  4JI6 Q;  5AJ3 Q;  1HH2 P;  1B2T A;  1LTB D;  1PFM A;  2JEB I;  1W3S A;  3I3C A;  2CFM A;  3I90 A;  5M9O A;  1KDC A;  4LF9 Q;  4R1J A;  1UNS A;  1M4V A;  1GUN A;  2D62 A;  3SGI A;  4RKB A;  4ABN A;  3KDF B;  4A75 A;  4K0K L;  5CV6 A;  3U50 C;  3EBE A;  2JA5 B;  3OSO A;  3TEH B;  3NBH A;  1CA5 A;  2JA7 H;  4XIG S;  1SYG A;  2WP8 J;  5IGD A;  4GOP C;  3FPU B;  1C7Y A;  4TSS A;  2A68 C;  4XTC S;  1R9T B;  1CHQ D;  1VQ8 A;  1UEA B;  4DV5 L;  4FDB A;  5CBE E;  4BY1 G;  4BBR H;  1E7Z A;  4FVM A;  4JI8 Q;  5IYC G;  5FLM G;  4LFA L;  1JC7 A;  3IAY A;  4A3B B;  1F9P A;  4LFB L;  4X6A H;  2F0Q A;  5ELE A;  3F2C A;  3I8Z A;  1OXS C;  4GKK Q;  2NVT H;  3TP8 A;  1KAW A;  5BN5 A;  1HZC A;  4JOI A;  4C3J G;  4A3K H;  4K8J A;  1PH9 A;  3J7A V;  4DR4 L;  1EOV A;  3PV0 A;  1FNW A;  4C3H H;  4EQ5 A;  1MSH A;  4G7Z C;  3RZD B;  3WOF A;  3PO2 G;  1PMR A;  2ZJR A;  1Q90 A;  1FGB D;  1PH5 A;  2E2I H;  1WJJ A;  4C3I B;  1BR9 A;  4NKL A;  1ZXT A;  1QNK A;  4DV1 L;  1SDF A;  3TRZ A;  1NE3 A;  1K8O A;  4AYB G;  1HUM A;  1VQC A;  2TSS A;  3M4P A;  1JB7 A;  1GUS A;  4DR5 L;  1KNA A;  2EY5 A;  1B9N A;  2R92 G;  4P72 A;  2AKW B;  1IHZ A;  3HOU B;  1SNQ A;  3M7G A;  2FFK B;  1E0B A;  1D5Z C;  3K8A A;  4JOI C;  2JA6 G;  1HZA A;  2EYH A;  3J7A 5;  3O13 A;  3P20 A;  1X3G A;  4RWS C;  3TME A;  1N36 L;  4A3E H;  4ZUI A;  1LTA D;  3E9I A;  4L63 B;  2K5V A;  1ASZ A;  4FF1 A;  4N9P A;  5A2Q L;  1P16 A;  2IY5 B;  3RZO H;  2JE6 I;  4KKT A;  4B3S Q;  1SE4 A;  1CKM A;  1SSO A;  2AWN A;  1RKN A;  1AP0 A;  4B9X A;  2I5H A;  2Q2T A;  1ROD A;  3ULJ A;  1WCM B;  1ESF A;  5I9O A;  1RTN A;  4BY7 H;  4J6H A;  5GAH C;  1E2W A;  4I7A A;  1KRT A;  1A15 A;  4DR1 Q;  1EY5 A;  5IP7 G;  2HIV A;  5JVH 3;  4H7B A;  1SXT A;  3CRK C;  1YJN A;  1FGU A;  4L8J A;  1NR4 A;  3HOW B;  1KDB A;  3CPW A;  1BCP D;  4A3D H;  3MXP A;  5FO7 B;  3GTJ B;  4F87 A;  2NVX B;  3NQI A;  2VXW A;  4QB4 A;  2UXC L;  2E5L Q;  4JI3 L;  2FIN B;  3SK5 A;  1X65 A;  3FKI G;  3CC7 A;  1B3Q A;  5M3M B;  2B63 H;  2FMM A;  2RHQ B;  4CJ0 B;  1A3V A;  1VQN A;  2Q2U A;  4C3H B;  2XWB B;  1EEI D;  1I94 Q;  2LS0 1;  2NTS A;  3Q24 A;  4LF7 Q;  5IYB H;  4GOP B;  1HUN A;  4TKO B;  2XNA C;  1JJC B;  4P73 A;  2EYF A;  2PQE A;  3KF6 B;  1P8L A;  1TY0 A;  1PRT D;  1F77 A;  3GDE A;  4DK6 C;  3SDZ A;  3TS0 A;  2I0Q A;  1CZG A;  4K2L A;  4WJ3 M;  4R4C A;  3H09 A;  1EL0 A;  2Z4H A;  3Q8D A;  4S3S A;  1PZJ D;  5IOD A;  4OX9 L;  3KBX A;  1CHP D;  5IGE A;  1RDP D;  1XMQ Q;  4DV2 L;  5M5Y B;  2OT2 A;  2KOL A;  3Q22 A;  1PYB A;  3NUC A;  1T5X D;  2UUB L;  1GUW A;  5IYD G;  4POF A;  1X6O A;  3M85 A;  5KYL A;  2F1M A;  1VQF A;  4JI5 L;  1M90 C;  3NBH B;  3LX0 A;  3CD6 A;  3PSI A;  4HCE A;  5FO8 B;  1RL2 A;  2K4K A;  3PUZ A;  3ND9 A;  3SVM A;  4V19 0;  3WWV A;  2OTJ A;  1HNX L;  2NVY H;  2VB3 X;  3I4L A;  4LF5 Q;  3GQB A;  3T13 A;  1EWI A;  1Z7T A;  3AU7 A;  1J8I A;  1WI5 A;  3I4N G;  4K5V A;  3UI2 A;  5KEE A;  2F0H A;  3K57 A;  2FHT A;  4DV4 Q;  3PIP 3;  4PZ8 A;  4A3M G;  2NZO A;  1JE5 A;  1NR2 A;  1VF7 A;  2Y0S E;  4JV5 Q;  4RGM A;  4HSP A;  3S17 H;  1MSG A;  1TKW B;  1IKM A;  3P7J A;  5CYU A;  3H0G G;  4ALP A;  4KHP L;  1HFN A;  4RGT A;  5ELN A;  1N9W A;  2EYL A;  2CVR A;  4FF4 A;  1CZW A;  5C5M A;  4B3M Q;  5G3L F;  1I5F A;  2F3I A;  4IFD H;  4A3G G;  3HZX A;  1B3A A;  2PZW A;  2R6G A;  4QIW B;  4HID A;  2HCC A;  3ERQ A;  3PO3 G;  1E24 A;  2C5C A;  4MTK A;  3CF5 A;  2I46 A;  3GP7 A;  3PCO B;  1ENA A;  2D9U A;  3M4Y A;  5C5L A;  1B4O A;  1KL9 A;  2WV6 D;  1PYS B;  3I72 A;  4E6I A;  3OYY A;  1S5E D;  1QJO A;  2F0O A;  4P2C B;  1Q1E A;  3H6M A;  2ICI A;  1RJT A;  1H9S A;  5I2Y A;  1Y1V G;  2FXQ A;  3L7Z C;  3AFP A;  1IBL Q;  2QEJ C;  1VQL A;  2NTT A;  1EYG A;  1O7I A;  1SND A;  3BYY B;  1CA6 A;  1MBY A;  3J81 c;  4BY1 B;  3PF5 A;  1C8C A;  3X3M A;  5IP9 G;  4UP8 A;  3N6R A;  3S15 H;  4LUO A;  4XT1 B;  2X69 A;  1IBK L;  1G2S A;  1XWE A;  1Y69 U;  2ZJQ A;  4A76 A;  3NTI A;  2ASB A;  2E74 C;  2IWH A;  3EQL C;  2XWJ B;  1SRO A;  3OWF A;  1YHA A;  1HCZ A;  1E3P A;  3CRL C;  4UAI A;  4C3J B;  1SR3 A;  4ZAI A;  3GTK B;  1WOC A;  2A68 D;  2K6A A;  2EZV A;  2CWP A;  2G5D A;  4KJN A;  1QZH A;  5KRU A;  4ULL A;  4ODG A;  1F2M A;  2UUA L;  3PO2 B;  1TWG H;  1UE6 A;  1CSP A;  1GUO A;  3I56 A;  4GN5 A;  3QIA A;  1U5K A;  1DON A;  3I4M H;  1HR0 Q;  5FKA C;  4AYB B;  5ELB A;  5JPN C;  4JBW A;  1CT1 D;  5EQ0 A;  4XT3 B;  1VQD A;  5LHY 1;  2R92 B;  2KEN A;  4OWW B;  3AFQ A;  3R2I A;  2YV5 A;  3GTQ H;  2MO0 A;  5D14 A;  5C0X H;  2JA6 B;  2E2D C;  3D8G A;  1U4M A;  2K01 A;  1A3U A;  4N8F A;  3R8B A;  3I55 A;  1D6E C;  1SBB B;  4P75 A;  2A74 C;  5T1G A;  2SNS A;  1VQO A;  4EX5 A;  3S16 H;  1NSN S;  1STA A;  4GN4 B;  5LMU L;  2L55 A;  4LF8 L;  4K14 A;  1WD1 A;  2K7V A;  2WKC A;  1BOS A;  4A3I H;  4DR3 L;  2LY7 A;  2ZM6 L;  1ASY A;  3MWY W;  3PUV A;  5K36 G;  1VDZ A;  3CC4 A;  3URY A;  1BF4 A;  2R7Z H;  5JJI A;  1PHJ A;  1YIJ A;  2K5H A;  3GTO H;  5C4J B;  3OTO Q;  3K0Y A;  3C2P A;  2EJM A;  5IOC A;  4HMJ A;  3VR2 A;  3G7L A;  2V1C C;  1MIU A;  5AFW A;  4PZ7 A;  5FJ8 G;  1STY A;  4FNF A;  1K83 B;  1Z9F A;  1J6Q A;  1QVC A;  2TMP A;  5IGC A;  1F9R A;  2R93 H;  4DV3 L;  4J1M A;  5C3X A;  2Z8L A;  5CR3 A;  1K8G A;  2M2L A;  4H44 C;  2KQ3 A;  1HXY D;  1S5B D;  2EYP A;  3OPO A;  1JWU D;  1F2Y A;  2AWO A;  2CKZ B;  3OIP A;  1AN8 A;  2OCE A;  4CKC A;  2F0K A;  2N3S A;  4DUY L;  2XVS A;  2WAQ E;  1K3B C;  2HHH L;  1PTO D;  1B44 D;  2MFI A;  1TR5 A;  1O7L A;  3I4M B;  3S1N H;  1ET6 A;  1TVX A;  3J80 c;  3GTL B;  3E5S A;  1D5M C;  1ICF B;  4I65 A;  3W3A A;  4RGN A;  2N49 A;  1WTV A;  4MTN A;  3HS0 C;  4O1N A;  4LAA A;  5DNF A;  5AJ3 L;  4JI6 L;  3VYR A;  1SEB D;  4ZKC B;  4PMW A;  1K28 A;  2K50 A;  1PV4 A;  3AQQ A;  1DD2 A;  5KNC A;  3F2U A;  4LF9 L;  3GTM H;  1H9S B;  2MP1 A;  2Z6K A;  2N55 A;  2NUC A;  1VQM A;  3AB9 A;  4G7H C;  1PRT C;  2NVQ H;  4DV0 Q;  1IYU A;  3E0J A;  5FLX c;  5E4X A;  2DNE A;  3CME A;  3U58 A;  2O2L D;  3I4N B;  3T16 A;  4A3C H;  1NTG A;  2IHE A;  2NN6 G;  1YNX A;  1EIH A;  2DUD A;  4XQJ A;  3PF4 A;  1EYC A;  4A3M B;  1LT6 D;  5JJL A;  1RHP A;  2BCO A;  1H9R A;  4IPC A;  4JI8 L;  1G51 A;  3HOZ G;  2XIW A;  3H0G B;  3UE1 A;  1VMP A;  5CV5 A;  3QWN A;  1BCP F;  2KBN A;  4DNI A;  4KN7 C;  3G6E A;  2N88 A;  1KIX A;  2JSO A;  4IFD J;  1G6Z A;  1QVF A;  2D2C C;  4KY7 A;  4GKK L;  3F2D A;  2Z6K C;  1WTX A;  1E2V A;  2JA5 H;  2J4X A;  3HEJ A;  4AIM A;  2F0D A;  4A3G B;  5IWA Q;  1IBM L;  4BWG B;  1DOM A;  1KTK A;  4MN3 A;  3PO3 B;  1DYQ A;  3A7L A;  3KOJ A;  1LTG D;  1OXV A;  1R9T H;  2EXZ A;  2FJ2 A;  1FL0 A;  1KAA A;  1VS0 A;  2FMC A;  4PNY A;  3RLN A;  5LMN Q;  1K0S A;  2PZU A;  2VW9 A;  3G71 A;  1ENF A;  2NN6 I;  1KNE A;  1SJE D;  1LLR D;  2A6H C;  4IUR A;  3BU2 A;  3KK7 A;  4ZQ3 A;  2KA7 A;  4ZKB B;  2F0U A;  4A3B H;  3CCM A;  1AW7 A;  1Q82 C;  1N33 L;  3IRB A;  1Y1V B;  3GO5 A;  1SYD A;  4DV6 Q;  2QIL A;  5KYI A;  1WD0 A;  3M4Q A;  2MGS A;  4F88 A;  3MFY A;  1XXG A;  5HGT A;  5C3E G;  3OW2 A;  3OIQ A;  3JC6 6;  1PH7 A;  2EDG A;  1G6P A;  1ILQ A;  1VMC A;  3R3O A;  1TWF B;  1A63 A;  1GKH A;  3CCS A;  2E8G A;  1STB A;  4DR2 Q;  4KV6 A;  4EGV A;  1KDA A;  1VQI A;  3PIO 3;  1T9H A;  1STE A;  3RZD H;  3UDG A;  2YU9 B;  1FNU A;  5M3F G;  3AEV A;  3CP0 A;  3MXN A;  3T1H L;  4L5T A;  3JAM L;  4C3I H;  4B3S L;  1CFM A;  2RVL A;  3VYS A;  1SE8 A;  4FF2 A;  3JAM E;  1GO3 E;  1MGS A;  4N8X 1;  4DR1 L;  3AMU A;  5GAG C;  1HA6 A;  3HOU H;  2CQA A;  2PW7 A;  1LYL A;  3Q0A A;  3RD4 A;  2QA4 A;  4HJ7 A;  1DXM A;  3QO2 A;  3BG3 A;  2IX3 A;  3SHL A;  1YNN D;  2CW0 C;  5CBA E;  1FD7 D;  1HJP A;  4AQY Q;  3SXH A;  1HR0 W;  4DR7 Q;  1H95 A;  3DEP A;  4H02 A;  1ICW A;  1B7Y B;  4OWX B;  3TDQ A;  1V1O A;  5BR8 Q;  2E5L L;  1KRS A;  1QZG A;  4YHH L;  1ET9 A;  3WDN A;  1U9R A;  4G4K A;  2CH4 W;  1W6K A;  4X66 Q;  2KUM A;  1PRT B;  3EJI A;  4WJW A;  3KJO A;  1XPO A;  1SMX A;  2BDO A;  1EY6 A;  1WCM H;  4X3K A;  5C0X J;  1I94 L;  1WYD A;  4XYQ A;  2GA4 B;  4OIK A;  5EJW A;  2LKV A;  1V8Q A;  1VQ7 A;  2BH2 A;  3DEO A;  4EQP A;  1HRJ A;  3HOW H;  2RHS B;  3K80 C;  3J7Y W;  3F1Z A;  1S5F D;  2J0T D;  3ITP A;  1XMO Q;  3GTJ H;  3GTG B;  2NVX H;  1JOQ A;  4CDF C;  2QW7 A;  2EPB A;  1TQO A;  3LWU A;  1PZK D;  4UHV A;  3HKZ E;  4DNT B;  2RA4 A;  1D2B A;  2B2Y A;  5M3M H;  2K75 A;  5J39 A;  2M00 A;  3CU7 A;  4IUQ A;  1XPR A;  4A3F G;  1BBU A;  3RR5 A;  1TWH B;  1AE2 A;  1X3P A;  5ELD A;  1SE3 A;  1HFG A;  4WOR A;  2BE5 C;  1S4Z A;  3MA2 B;  4LF6 Q;  3PGZ A;  4BBS G;  4OO1 H;  3TN2 A;  2G9D A;  1AZP A;  4LF4 Q;  1KD1 C;  4RA8 A;  3IFD A;  4HJ9 A;  2C9O A;  4POG A;  5DM6 3;  3SE0 A;  4H0L C;  4ZYS A;  4JI7 L;  5M5Y H;  1EOT A;  3SK6 A;  5A35 A;  2RSN A;  3BDC A;  3RMH A;  5C4Z A;  1TXY A;  3M4O B;  4JV5 L;  2IT1 A;  1NCV A;  2DY7 A;  1LTI D;  1UE1 A;  2B2Y C;  3N52 A;  1WTO A;  4HMI A;  4GN3 B;  4DA2 A;  4KY5 A;  2DJG C;  2Y0S G;  2QEX A;  1I3Q B;  1O7Z A;  1YBY A;  4B3M L;  1SYB A;  2GVB A;  2NZH A;  5COR A;  1F9Q A;  1SLJ A;  4OL7 A;  3A8K E;  3OW7 A;  1I4G A;  3DM1 A;  5BN4 A;  5KND A;  4DUZ L;  1SYC A;  2F0F A;  5GAE C;  4CJ2 C;  2WB1 G;  4KKS A;  3VR6 A;  1MJE A;  4HIK A;  5A2Q E;  1FNV A;  1FVI A;  2D0O A;  5JEA H;  4JBJ A;  1E2Z A;  4K8I A;  3FMC A;  4RMF A;  4Y7N B;  5I6Y A;  1Y1W G;  3C3L A;  1HA5 A;  1WTR A;  1S3O A;  4B08 A;  4BXX H;  4DR6 Q;  1D1K A;  1OXT A;  1GUG A;  1GJX A;  3S1R B;  1EIY B;  2XGT A;  5C4X G;  1PTO C;  5NUC A;  4NXM Q;  4KJO A;  5EPK A;  2QGQ A;  3HOV G;  1GD7 A;  1IBL L;  3S1M B;  2IL8 A;  1PH8 A;  4U67 3;  4IUV A;  3KFU A;  1LT4 D;  1TS5 A;  2JK8 A;  4NP5 A;  3IFT A;  2UXB Q;  2L0C A;  3NQT A;  4JI4 L;  5E1F A;  1HNW Q;  3LNN A;  5IT9 c;  2L9H A;  3V96 A;  3HOZ B;  4YCU A;  2F0G A;  2KCT A;  1NBW A;  1SFO B;  2GN5 A;  2OQ0 A;  1F2Z A;  4J15 A;  5EBC A;  3A5Z B;  4B3T Q;  2JP1 A;  4KLK A;  3K58 A;  4QUF A;  5EGT A;  3HFZ B;  4JG2 A;  1Y8P B;  3PMF A;  3NSW A;  3W1G A;  2AQ1 B;  2X6G A;  2EYO A;  2I07 B;  5LMN W;  5ELC A;  4KK7 A;  3K81 C;  4YCW A;  2NZ1 D;  1CI3 M;  2R7F A;  1VQ6 A;  5C4H A;  3R2T A;  2MQH A;  4IJL A;  4P74 A;  4BY1 H;  3VA5 A;  4R4Q A;  4FO2 A;  1I4P A;  5IYC H;  3CCQ A;  2WAC A;  1G2T A;  1PFB A;  4KD4 A;  5FLM H;  2EYJ A;  2XTI A;  1A6X A;  4JBK A;  1JWM D;  3TZU A;  3D4R A;  3CKI B;  1ZKO A;  4DR4 Q;  3CHB D;  5HGQ A;  4G7O C;  1W6J A;  5DEH A;  2ES2 A;  5ELF A;  5LL6 S;  5C3E B;  4RCO A;  2VZA A;  4C3J H;  2OQK A;  2QF7 A;  1HQM C;  3GTK H;  1NJI C;  3HG9 A;  3HRZ C;  4HSV A;  4APV A;  4CKE A;  2CHB D;  4L5Q A;  3NK9 A;  1XPU A;  2HT1 A;  2ID0 A;  2A6H D;  3H3V I;  1EQR A;  3PO2 H;  1HTL D;  1AH9 A;  4DV1 Q;  4HJ8 A;  1Z6H A;  3LWE A;  1LM0 A;  3HP3 A;  3NEM A;  4EQO A;  1LTT D;  5M3F B;  1BNZ A;  4RHS A;  4LJZ C;  1EU4 A;  2RF4 A;  1VQP A;  2WB1 E;  2YTX A;  1GUT A;  1JOO A;  2F0W A;  2WKD A;  4FXG C;  4IUU A;  2B2U A;  4R8N A;  3ULL A;  2JA8 G;  2KJX A;  2H5X A;  4HIM A;  3RLF A;  2R92 H;  2EJG C;  1D7Q A;  2N78 A;  3DWP A;  4DFA A;  1JIC A;  2SDF A;  1N36 Q;  2JA6 H;  3OTO L;  1D8L A;  1K3R A;  1NNX A;  1M8A A;  5FK9 C;  1TWC B;  3CQZ B;  4N9T A;  2YTY A;  1GHJ A;  1B9M A;  3TP5 A;  4X64 L;  3T1Y L;  2DGY A;  3T4A C;  2K5N A;  1PTO B;  3U4V A;  1UAP A;  1V1P A;  4FXD A;  4OIJ A;  3T56 B;  1UWV A;  1GVP A;  2BDN A;  3QOL A;  2L15 A;  2ZXP A;  1A2U A;  2F3V A;  4A4I A;  2B2U C;  5IP7 H;  2F4V Q;  4AH6 A;  2HDM A;  3DUZ A;  1W2B A;  2VUM G;  1TWA B;  2F0J A;  1YNN C;  1KAB A;  2CW0 D;  3F8T A;  5C4J H;  2PCF B;  4DF7 A;  4ZRZ A;  3NTK A;  1A62 A;  3DWA A;  1CKO A;  1BUV T;  2ICE C;  4YCV A;  1PH1 A;  3H3V C;  1PDQ A;  1SMY D;  4JI1 L;  1K83 H;  2WAQ G;  1EQQ A;  3SK8 A;  1RCV D;  2RSO A;  4GKJ Q;  3FKI H;  2K14 A;  5JOB A;  1KLG D;  2UU9 L;  2PNH A;  3OOC A;  3OMG A;  1O78 A;  2EVB A;  2RDH A;  4FXK C;  4J8Q A;  5I6W A;  4A3F B;  4ME3 A;  2V4D A;  1O80 A;  5L37 A;  2HIX A;  4LWC A; 
#chains in the Genus database with same CATH homology
 1EY4 A;  1F2L A;  1SNM A;  1HPC A;  4BBS B;  2JXM B;  3QB3 A;  1I50 B;  3DWQ A;  4O42 A;  5EKI A;  4CJ1 B;  2L5T A;  4DNR B;  2F03 A;  4LMQ D;  2BOS A;  4KN4 C;  2Y0S B;  1LO5 D;  1RD9 D;  2BE5 D;  5D3I B;  4C56 C;  3HGB A;  1S5D D;  1KLU D;  3K7A B;  5JEA J;  2WB1 B;  4DAP A;  4NMZ A;  3VR4 A;  1U4L A;  2A73 B;  2VNU D;  1EZ8 A;  1EY8 A;  1TS3 A;  1IL8 A;  1Y1W B;  4KHZ A;  5C4X B;  5JJZ A;  1EIG A;  1OO9 B;  1Y8O B;  4ID6 A;  3H91 A;  4XXE A;  3MVV A;  3HOV B;  1ML0 D;  3FKI B;  3Q6S A;  1GHK A;  5CGK A;  2QDB A;  5IGG A;  1EQV A;  3MHB A;  3D3R A;  2B8F A;  4Q0F A;  1WTP A;  4RFB A;  3BZD B;  3D4D A;  3GV3 A;  1QOH A;  2F4I A;  2RQX A;  1L0Y B;  2PW5 A;  3MZ5 A;  4WRD A;  3KLS X;  2L12 A;  3BVZ A;  3TP6 A;  3BDL A;  4XQN A;  2IW3 A;  4DXG A;  3GD7 A;  2IX0 A;  2HQE A;  3NHH A;  1FR3 A;  2A69 C;  3D6W A;  5LL6 X;  3K5N A;  5M5W B;  1I4Q A;  3IL8 A;  3MTS A;  1SE2 A;  1CM9 A;  5EBD A;  4QCL A;  2DN8 A;  4RHR A;  2EYM A;  3K5M A;  1AFP A;  1SYF A;  1V1P B;  1O7Y A;  3S14 B;  1GXD C;  3VYU A;  4IQZ A;  5M5X B;  1JOR A;  2HDL A;  3A7A B;  3S2D B;  5E3F A;  3S2H B;  3GTP B;  2F0S A;  1C48 A;  5IIF A;  2EE1 A;  5D3D A;  1FYC A;  1K8M A;  5FO9 B;  4X3U A;  4Z9C B;  5G3L D;  1ESR A;  1LAC A;  2L11 A;  3L3O C;  1AEX A;  4XQQ A;  2L1B A;  3KLR A;  5T1I A;  3S1Q B;  3QG1 A;  4QMG A;  1WTW A;  5D65 A;  3OMC A;  1QB5 D;  1PXU A;  4C3H G;  5I4D A;  4PMC A;  2OEO A;  2IX1 A;  2JA8 B;  1IW7 D;  1TS2 A;  4ME5 A;  5DM7 3;  4H13 C;  4C1N K;  3U9S A;  3BS1 A;  2SEB D;  1CK1 A;  1PRT F;  2KEE A;  5EKL A;  1DOK A;  1WTQ A;  1EY7 A;  1QIL A;  1ILP A;  3M7N A;  2KED A;  5COY A;  1G29 1;  5K36 H;  3G6J B;  3NP8 A;  2XSC A;  1ZYR D;  3ONA B;  2VUM B;  4M8A A;  1I4H A;  4KTA A;  2K05 A;  3A8I E;  4CKB A;  1XX8 A;  3NE5 B;  4JK1 C;  4WFN 3;  2WAQ B;  1BBX C;  4HN7 A;  1JCK B;  1R4P B;  2B2W A;  2KHS A;  1XYI A;  1LT3 D;  3U9O A;  2DY8 A;  3BDO A;  5J1Z A;  3RUZ A;  2B39 A;  1YNJ C;  2BA0 A;  3IKJ A;  4IUP A;  3VR5 A;  4C2M B;  3VYT A;  1NUC A;  4IAL A;  4QF4 A;  3NWT A;  2KCC A;  2AQ2 B;  1SMY C;  4K2K A;  1SAP A;  2AUK A;  1NAP A;  3P1H A;  2B2W C;  4A93 B;  3K5O A;  3SR1 A;  2K03 A;  2EJF C;  4DXF A;  3M3Y B;  5C44 B;  2F0N A;  3DXJ C;  2EY6 A;  2NBF A;  4OHJ A;  2LFN A;  4CGY B;  1I6H B;  3A56 A;  1EZ6 A;  3DHQ A;  2MPM A;  1LT5 D;  3HOX B;  4L6T B;  4V0B A;  1STH A;  2NN6 H;  3HOY B;  1Q12 A;  2F0V A;  3QJY A;  2E2H B;  1DCZ A;  5KIX A;  1EWC A;  4FF3 A;  1R4Q B;  4A3J B;  1PZI D;  1L0X B;  4MIU A;  1TS4 A;  2F0L A;  3S9W A;  3EVQ A;  1HQR D;  1Q3L A;  1JQY D;  4OGQ C;  5CV9 A;  3MXU A;  4R8I A;  3KBG A;  1LV9 A;  3OWE B;  2E2J B;  4IFD G;  5EPJ A;  2R3Z A;  5ISR A;  1EYD A;  3J80 L;  1QE6 A;  2F0E A;  3SK4 A;  5JPM C;  2JEA I;  1LTS D;  3D6C A;  2ZXR A;  3J80 E;  3KUP A;  3V2T A;  3ZYY X;  4BA1 I;  2DNC A;  3C1F A;  4B9W A;  2SNM A;  3TSS A;  3KLS A;  2F0P A;  5FLX L;  1TII D;  4KKU A;  2JA7 B;  1G8Z D;  1EY9 A;  4CHT B;  1VF5 C;  1A3T A;  5FLX E;  1JE4 A;  4HED A;  1F9S A;  1BQQ T;  3PUY A;  4DK1 A;  3ND8 A;  2A69 D;  4IFD I;  5CMD A;  4BBR B;  4RH6 A;  1DM0 B;  4NDX A;  3D4W A;  2NWG A;  3K59 A;  4K6L A;  2LMC B;  2XRS D;  5E4W C;  1DOL A;  2B2T A;  2NVT B;  1CQV A;  4YIJ A;  1JOK A;  4X3T A;  4A3K B;  2MJ8 A;  4HAE A;  3MAQ A;  3W2D A;  3A54 A;  4ZUJ A;  1PTO H;  2PO4 A;  4HCS A;  2ZXO A;  3EFX D;  1ZEQ X;  3HKZ B;  1TT2 A;  3P75 A;  4U68 A;  2E2I B;  1X3Q A;  2EOT A;  4KY6 A;  3EA6 A;  2E75 C;  2G9H D;  3FVQ A;  4ILW A;  5KGU A;  1T5E A;  1PTO F;  2B2T C;  4K5X A;  2Z4I A;  4BS9 A;  2K5W A;  1WVL A;  2A6E C;  3TZD A;  5C0X G;  1IW7 C;  1I4R A;  1EWH A;  2M9V A;  4KMU C;  4DN4 M;  4HTH A;  4A3E B;  4GZY C;  2O4X A;  2B2V A;  5C3W A;  1U4P A;  1ONL A;  3RZO B;  4RCN A;  3VA7 A;  1B50 A;  4LK1 C;  2B8G A;  2Q8T A;  3K6O A;  4BY7 B;  1EU3 A;  4FYD A;  2BA1 A;  3NXW A;  1Y8N B;  4IN3 A;  4C1N I;  4KHV A;  4A3D B;  1DZ1 A;  3DMU A;  2PPB C;  4M1U B;  2K5Q A;  2K33 A;  1ZYR C;  5C0X I;  1SJH D;  5K5P A;  2RKS A;  2B2V C;  2B63 B;  3T53 B;  2PZT A;  3FEW X;  1Q8I A;  4F7X A;  5JVG 3;  4KI0 A;  1U4R A;  4IUT A;  1PLF A;  5IGB A;  5I2X A;  4KD3 A;  1YNJ D;  5CV4 A;  3SEB A;  1SNP A;  1I4X A;  2XN9 C;  2F0T A;  5EKK A;  1QCB D;  2L4N A;  3GV6 A;  2O5I C;  2Q8I B;  3BVM A;  2QCP X;  4RAU C;  1OXU A;  3L9A X;  1A2T A;  4I7Z C;  3I70 A;  2IJ0 A;  1RTO A;  1I6V C;  2NVY B;  2AUJ D;  4XYO A;  4CBV A;  4PV1 C;  2ENB A;  1EY0 A;  4IZ8 A;  3X3N A;  3NWS A;  1G91 A;  4QUC A;  3S17 B;  5HUR A;  2K28 A;  2D5D A;  3J7A F;  3R93 A;  4ZK9 B;  3WOE A;  2A5H A;  4K6D A;  2XRQ D;  1TY2 A;  1QG7 A;  5CC4 A;  4DAY A;  1QWY A;  3FPP A;  1UUP A;  1EFI D;  1DJR D;  5J22 A;  3D31 A;  1STG A;  2PMZ B;  2K32 A;  3K5L A;  1HHV A;  1V43 A;  3E6Z X;  2RDG A;  2X6L A;  1MI2 A;  1STN A;  2QKI C;  1GOZ A;  2PYK A;  3ERO A;  2R61 A;  3NPP A;  4DGZ A;  4UDU C;  2O5J C;  3KF8 A;  3TP7 A;  2PNR C;  5F2D A;  3NBI A;  5IT9 L;  2AQ3 B;  3TBI B;  3Q23 A;  3S15 B;  2Z1C A;  1AZQ A;  3I91 A;  4EVO A;  1JWS D;  5IT9 E;  4ZLT F;  4BA2 I;  4DK0 A;  1IYV A;  4C3I G;  1SNC A;  1SNO A;  2VB2 X;  3OHX C;  1OXX K;  2KEC A;  4G57 A;  4HR7 B;  2EY1 A;  2OXP A;  5KNB A;  3BYT B;  2F3W A;  2JYO A;  3FRP B;  1HTP A;  1TWG B;  1BCP C;  1JB3 A;  1EEF D;  2J7Z A;  1CTM A;  1LAB A;  3MEH A;  3C46 A;  4TQU S;  3MC0 B;  2K04 A;  5CV7 A;  2KVM A;  1PYW D;  1D5X C;  1RF2 D;  1C4Q A;  2IPK D;  2YYZ A;  3PUX A;  4RKL A;  1X32 A;  3GTQ B;  5JAV A;  4DU9 A;  4Q5V A;  4DAV A;  3S16 B;  1TU2 B;  2SOB A;  4MHE A;  1IKL A;  2Q8R E;  4XDX A;  1H9M A;  4A3I B;  2EY2 A;  2MUY A;  2OF1 A;  3C1E A;  4TRD A;  1CQF A;  5DAU A;  1B53 A;  2A6E D;  5C6A A;  2ZT9 C;  1J9O A;  2R7Z B;  2H4O A;  1BXT A;  3V05 A;  3GTO B;  5TSS A;  1EQT A;  4R9W A;  4OO1 G;  3PUW A;  2HUG A;  1JR0 D;  2RBM A;  2R93 B;  1II3 A;  2NB0 A;  2HCI A;  1LTR D;  4X3S A;  1BO0 A;  4F8M A;  1Q1B A;  4FP5 D;  4EQN A;  3BVG A;  5I9P A;  3J81 L;  2NYZ D;  2MHV A;  3J81 E;  3QOJ A;  4PMB A;  1ENC A;  1Z47 A;  4RGO S;  5EPL A;  1BDO A;  5IGF A;  5FOB B;  1H9J A;  1H9K A;  3S1N B;  1QNU A;  1SYE A;  3A8J E;  3A55 A;  5CV8 A;  4OO1 I;  3FDT A;  3H94 A;  1XTC D;  3T51 B;  5JEA G;  1MD2 D;  2F0M A;  5BN3 A;  2WII B;  1B1Z A;  4IUN A;  2E76 C;  4K5W A;  3GTM B;  2F0I A;  4PQX A;  1D1I A;  2RDF A;  3I73 A;  2KCN A;  2H1E A;  2K1B A;  1VCI A;  2K5D A;  2WIN B;  2NVQ B;  1EYA A;  1BCP B;  1PFN A;  4NW2 A;  3MFG A;  1S5C D;  3MXG A;  3VR3 A;  3NTH A;  1B2T A;  1LTB D;  1PFM A;  2JEB I;  3I3C A;  3I90 A;  5M9O A;  1KDC A;  1UNS A;  1M4V A;  1GUN A;  2D62 A;  4RKB A;  4ABN A;  5CV6 A;  2JA5 B;  3OSO A;  3NBH A;  1CA5 A;  4XIG S;  1SYG A;  2WP8 J;  5IGD A;  3FPU B;  4TSS A;  2A68 C;  4XTC S;  1R9T B;  1CHQ D;  1UEA B;  5CBE E;  4FVM A;  1JC7 A;  3IAY A;  4A3B B;  1F9P A;  2F0Q A;  5ELE A;  3I8Z A;  1OXS C;  3TP8 A;  5BN5 A;  4C3J G;  4K8J A;  3J7A V;  3PV0 A;  1FNW A;  1MSH A;  4G7Z C;  3RZD B;  3WOF A;  1PMR A;  1Q90 A;  1FGB D;  4C3I B;  1BR9 A;  4NKL A;  1ZXT A;  1QNK A;  1SDF A;  1K8O A;  1HUM A;  2TSS A;  1GUS A;  1KNA A;  2EY5 A;  1B9N A;  1IHZ A;  3HOU B;  1SNQ A;  3M7G A;  2FFK B;  1E0B A;  1D5Z C;  2EYH A;  3O13 A;  3P20 A;  4RWS C;  3TME A;  4ZUI A;  1LTA D;  4L63 B;  4FF1 A;  4N9P A;  5A2Q L;  2JE6 I;  4KKT A;  1SE4 A;  1SSO A;  2AWN A;  1RKN A;  1AP0 A;  4B9X A;  1ROD A;  1WCM B;  1ESF A;  5I9O A;  1RTN A;  4J6H A;  1E2W A;  1A15 A;  1EY5 A;  5JVH 3;  4H7B A;  1SXT A;  3CRK C;  4L8J A;  1NR4 A;  3HOW B;  1KDB A;  1BCP D;  3MXP A;  5FO7 B;  3GTJ B;  4F87 A;  2NVX B;  3NQI A;  2VXW A;  4QB4 A;  3SK5 A;  2FIN B;  5M3M B;  2FMM A;  4CJ0 B;  1A3V A;  4C3H B;  2XWB B;  1EEI D;  2LS0 1;  2NTS A;  3Q24 A;  1HUN A;  4TKO B;  2XNA C;  2EYF A;  2PQE A;  1TY0 A;  1PRT D;  1F77 A;  3SDZ A;  1CZG A;  4K2L A;  3H09 A;  1EL0 A;  2Z4H A;  4S3S A;  1PZJ D;  5IOD A;  3KBX A;  1CHP D;  5IGE A;  1RDP D;  5M5Y B;  2OT2 A;  2KOL A;  3Q22 A;  3NUC A;  1T5X D;  1GUW A;  3M85 A;  5KYL A;  2F1M A;  3LX0 A;  5FO8 B;  4HCE A;  3PUZ A;  3ND9 A;  3SVM A;  4V19 0;  2VB3 X;  3I4L A;  3GQB A;  3T13 A;  1Z7T A;  3AU7 A;  1J8I A;  4K5V A;  3UI2 A;  5KEE A;  2F0H A;  3K57 A;  2FHT A;  3PIP 3;  1NR2 A;  1VF7 A;  4RGM A;  4HSP A;  1MSG A;  1TKW B;  1IKM A;  3P7J A;  5CYU A;  1HFN A;  4RGT A;  2EYL A;  2CVR A;  4FF4 A;  1CZW A;  5C5M A;  5G3L F;  4IFD H;  3HZX A;  1B3A A;  2PZW A;  2R6G A;  4QIW B;  2HCC A;  3ERQ A;  2C5C A;  2I46 A;  3GP7 A;  1ENA A;  2D9U A;  3M4Y A;  5C5L A;  1B4O A;  2WV6 D;  3I72 A;  4E6I A;  1S5E D;  1QJO A;  2F0O A;  4P2C B;  1Q1E A;  3H6M A;  2ICI A;  1RJT A;  1H9S A;  5I2Y A;  3L7Z C;  2QEJ C;  2NTT A;  1SND A;  3BYY B;  1CA6 A;  1MBY A;  4BY1 B;  1C8C A;  3X3M A;  3N6R A;  4XT1 B;  2X69 A;  1G2S A;  1XWE A;  1Y69 U;  3NTI A;  2E74 C;  2IWH A;  3EQL C;  2XWJ B;  3OWF A;  1HCZ A;  3CRL C;  4UAI A;  4C3J B;  4ZAI A;  3GTK B;  2A68 D;  2K6A A;  2EZV A;  4KJN A;  5KRU A;  4ULL A;  4ODG A;  1F2M A;  3PO2 B;  1GUO A;  3QIA A;  1DON A;  5FKA C;  4AYB B;  5ELB A;  5JPN C;  4JBW A;  1CT1 D;  5EQ0 A;  4XT3 B;  5LHY 1;  2R92 B;  3R2I A;  5D14 A;  5C0X H;  2JA6 B;  2E2D C;  3D8G A;  1U4M A;  2K01 A;  1A3U A;  3R8B A;  1D6E C;  1SBB B;  2A74 C;  5T1G A;  2SNS A;  1NSN S;  1STA A;  2L55 A;  4K14 A;  1WD1 A;  2K7V A;  2WKC A;  1BOS A;  2LY7 A;  3MWY W;  3PUV A;  5K36 G;  1VDZ A;  3URY A;  1BF4 A;  5C4J B;  3K0Y A;  3C2P A;  2EJM A;  5IOC A;  4HMJ A;  3VR2 A;  3G7L A;  5AFW A;  1STY A;  4FNF A;  1K83 B;  2TMP A;  5IGC A;  1F9R A;  4J1M A;  5C3X A;  2Z8L A;  5CR3 A;  2M2L A;  4H44 C;  2KQ3 A;  1HXY D;  1S5B D;  2EYP A;  3OPO A;  1JWU D;  1F2Y A;  2AWO A;  3OIP A;  1AN8 A;  4CKC A;  2F0K A;  2XVS A;  1PTO D;  1B44 D;  1TR5 A;  1O7L A;  3I4M B;  1ET6 A;  1TVX A;  3GTL B;  3E5S A;  1D5M C;  4I65 A;  3W3A A;  4RGN A;  1WTV A;  3HS0 C;  4O1N A;  4LAA A;  5DNF A;  3VYR A;  1SEB D;  4ZKC B;  4PMW A;  1DD2 A;  5KNC A;  3F2U A;  1H9S B;  2MP1 A;  2N55 A;  2NUC A;  3AB9 A;  4G7H C;  1PRT C;  1IYU A;  3E0J A;  5E4X A;  2DNE A;  2O2L D;  3I4N B;  3T16 A;  2NN6 G;  1EIH A;  4XQJ A;  1EYC A;  4A3M B;  1LT6 D;  1RHP A;  2BCO A;  1H9R A;  2XIW A;  3H0G B;  1VMP A;  5CV5 A;  3QWN A;  1BCP F;  4KN7 C;  2N88 A;  2JSO A;  4IFD J;  1G6Z A;  2D2C C;  4KY7 A;  1WTX A;  1E2V A;  2J4X A;  3HEJ A;  2F0D A;  4A3G B;  4BWG B;  1DOM A;  1KTK A;  4MN3 A;  3PO3 B;  1DYQ A;  3A7L A;  1LTG D;  1OXV A;  2EXZ A;  2FJ2 A;  1KAA A;  4PNY A;  2FMC A;  2PZU A;  1ENF A;  2NN6 I;  1KNE A;  1SJE D;  1LLR D;  2A6H C;  4IUR A;  3KK7 A;  4ZQ3 A;  2KA7 A;  4ZKB B;  2F0U A;  1AW7 A;  1Y1V B;  3GO5 A;  1SYD A;  2QIL A;  5KYI A;  1WD0 A;  2MGS A;  4F88 A;  3MFY A;  1XXG A;  5HGT A;  3OIQ A;  2EDG A;  1ILQ A;  1VMC A;  3R3O A;  1TWF B;  1STB A;  4KV6 A;  4EGV A;  1KDA A;  3PIO 3;  1STE A;  2YU9 B;  1FNU A;  3MXN A;  3JAM L;  1CFM A;  2RVL A;  3VYS A;  4FF2 A;  3JAM E;  1MGS A;  3AMU A;  1HA6 A;  2CQA A;  2PW7 A;  3Q0A A;  3RD4 A;  1DXM A;  3QO2 A;  3BG3 A;  2IX3 A;  3SHL A;  1YNN D;  2CW0 C;  5CBA E;  1FD7 D;  3SXH A;  3DEP A;  1ICW A;  3TDQ A;  1V1O A;  1ET9 A;  3WDN A;  1U9R A;  4G4K A;  1W6K A;  2KUM A;  1PRT B;  3EJI A;  4WJW A;  2BDO A;  1EY6 A;  4X3K A;  5C0X J;  4XYQ A;  2GA4 B;  4OIK A;  5EJW A;  2LKV A;  1V8Q A;  3DEO A;  4EQP A;  1HRJ A;  3J7Y W;  1S5F D;  2J0T D;  3ITP A;  3GTG B;  1JOQ A;  2EPB A;  1TQO A;  3LWU A;  1PZK D;  4DNT B;  2RA4 A;  1D2B A;  2B2Y A;  5J39 A;  2M00 A;  3CU7 A;  4IUQ A;  1TWH B;  1X3P A;  5ELD A;  1SE3 A;  1HFG A;  4WOR A;  2BE5 C;  1S4Z A;  3MA2 B;  4OO1 H;  3TN2 A;  2G9D A;  1AZP A;  4RA8 A;  3IFD A;  2C9O A;  5DM6 3;  3SE0 A;  4H0L C;  4ZYS A;  1EOT A;  3SK6 A;  5A35 A;  2RSN A;  3BDC A;  3RMH A;  5C4Z A;  3M4O B;  2IT1 A;  1NCV A;  2DY7 A;  1LTI D;  3N52 A;  2B2Y C;  1WTO A;  4HMI A;  4DA2 A;  4KY5 A;  1I3Q B;  1O7Z A;  1SYB A;  5COR A;  1F9Q A;  4OL7 A;  3A8K E;  3OW7 A;  1I4G A;  3DM1 A;  5BN4 A;  5KND A;  1SYC A;  2F0F A;  4CJ2 C;  4KKS A;  3VR6 A;  5A2Q E;  1FNV A;  5JEA H;  1E2Z A;  4K8I A;  3FMC A;  4Y7N B;  5I6Y A;  3C3L A;  1HA5 A;  1WTR A;  4B08 A;  1D1K A;  1OXT A;  1GUG A;  1GJX A;  3S1R B;  1PTO C;  5NUC A;  4KJO A;  5EPK A;  3S1M B;  2IL8 A;  4U67 3;  4IUV A;  1LT4 D;  1TS5 A;  4NP5 A;  3IFT A;  2L0C A;  3NQT A;  5E1F A;  3LNN A;  2L9H A;  3V96 A;  3HOZ B;  2F0G A;  1SFO B;  1F2Z A;  5EBC A;  2JP1 A;  3K58 A;  4QUF A;  5EGT A;  1Y8P B;  3PMF A;  3NSW A;  2AQ1 B;  2X6G A;  2EYO A;  2I07 B;  5ELC A;  4KK7 A;  2NZ1 D;  1CI3 M;  5C4H A;  3R2T A;  3VA5 A;  4FO2 A;  1I4P A;  2WAC A;  1G2T A;  1PFB A;  4KD4 A;  2EYJ A;  1A6X A;  1JWM D;  3TZU A;  3D4R A;  3CKI B;  1ZKO A;  3CHB D;  4G7O C;  1W6J A;  5DEH A;  5ELF A;  5LL6 S;  5C3E B;  4RCO A;  2QF7 A;  1HQM C;  3HG9 A;  3HRZ C;  4HSV A;  4CKE A;  2CHB D;  3NK9 A;  2ID0 A;  2A6H D;  1HTL D;  1Z6H A;  3LWE A;  3HP3 A;  4EQO A;  1LTT D;  5M3F B;  1BNZ A;  4RHS A;  4LJZ C;  1EU4 A;  1GUT A;  1JOO A;  2F0W A;  2WKD A;  4FXG C;  4IUU A;  2B2U A;  4R8N A;  2KJX A;  3RLF A;  2EJG C;  3DWP A;  4DFA A;  1JIC A;  2SDF A;  1M8A A;  5FK9 C;  1TWC B;  3CQZ B;  4N9T A;  1GHJ A;  1B9M A;  3TP5 A;  3T4A C;  1PTO B;  1UAP A;  1V1P A;  4FXD A;  4OIJ A;  3T56 B;  2BDN A;  3QOL A;  2ZXP A;  1A2U A;  2F3V A;  2B2U C;  2HDM A;  3DUZ A;  1TWA B;  2F0J A;  1YNN C;  1KAB A;  2CW0 D;  2PCF B;  4DF7 A;  4ZRZ A;  3NTK A;  1BUV T;  2ICE C;  3DWA A;  3H3V C;  1PDQ A;  1SMY D;  3SK8 A;  1RCV D;  2RSO A;  5JOB A;  1KLG D;  3OOC A;  3OMG A;  1O78 A;  2EVB A;  2RDH A;  4FXK C;  4J8Q A;  5I6W A;  4A3F B;  2V4D A;  1O80 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...