1SE8A

Structure of single-stranded dna-binding protein (ssb) from d. radiodurans
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
231
structure length
213
Chain Sequence
RGMNHVYLIGALARDPELRYTGNGMAVFEATVAGEDRVRNLPWYHRVSILGKPAEWQAERNLKGGDAVVVEGTLEYRQWEKRSAVNVKALRMEQLGTQPELIQDAGGGVRMSGAMNEVLVLGNVTRDPEIRYTPAGDAVLSLSIAVNENYQDRQGQRQEKVHYIDATLWRDLAENMKELRKGDPVMIMGRLVNEGWTRNSTRVEATRVEALAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single-strand binding protein
publication title Crystal structure of the Deinococcus radiodurans single-stranded DNA-binding protein suggests a mechanism for coping with DNA damage.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Dna binding protein
total genus 40
structure length 213
sequence length 231
ec nomenclature
pdb deposition date 2004-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1se8A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1se8A02
4QIWE 1YHAA 3TEHB 1Y1VG 3BZCA 1K0RA 2R7ZH 3GTOH 3I4NG 2JA6H 3H3VI 3CCSA 3KDFA 2GVAA 5IYCG 5ELNA 3PV0A 4B3MQ 3ICEA 2CCZA 3T1HL 4MNOA 3NEMA 4DV2Q 1N34Q 3F1ZA 2UXBL 1VQFA 4DKAC 1KC8C 1K8GA 2KBNA 4PG3A 4YCUA 3U4ZA 4DR3Q 1EWIA 2UU9Q 3HKZG 4DR5L 1FGUA 3HOWH 1EOVA 4K0KL 3KOJA 1YJ9A 3GO5A 4YHHL 4R1JA 4HJAA 2IY5B 2Z6KA 1B70B 2PMZE 3H0GH 4LF4Q 4LF8L 1VQKA 2JA7H 3GTLH 4QJFA 1JJCB 5IE8A 1MJCA 3W1GA 4PZ8A 1L0WA 1X6OA 5IYDG 4JI1Q 1Q46A 5C4XH 4JI3L 1E7ZA 1MIUA 4OWTB 3F8TA 4R4OA 1IBKQ 1IBLL 2E5LL 4YWKA 1KD1C 4IPGA 1LUZA 5C4JH 1QVFA 3CC4A 1OTCA 3K7UC 1JB7A 2N3SA 4JI8L 3TRZA 2JEBI 4DV1Q 4DV4Q 4YY3L 2MFIA 1QZHA 5C44G 1EFWA 3I4MH 3DM3A 2UXDL 1VQDA 3I7FA 2R6GA 1IYJB 3PO2H 1RL2A 3ULJA 4A3JG 3S1MH 5EAYA 4WJ3M 4HIDA 3OYYA 2NN6G 4X66Q 2GN5A 3K81C 4DNIA 4GKJL 2XGTA 1WFQA 3UDFA 2FXQA 4A76A 3MXNB 3HOVH 3PF5A 1UE5A 4YWMA 1VQ7A 2VQEQ 2Z0SA 1P8LA 2Q2HA 2AWOA 4DR2Q 3HKZE 3E9HA 1V9PA 4MZ9A 1XMOL 5H1SE 2WB1E 3CCLA 3AFQA 3RZOH 1PH3A 2JA5H 2IX1A 2WAQG 3CCUA 4OWWB 2CKZB 3HFZB 4LF9L 2VUMH 2IX0A 2JK8A 4A3MG 2BH8A 4RG1A 1VQ6A 1GM5A 1Z47A 3CC2A 2N8NA 1N33L 1K3RA 3PGZA 3U58A 2R92G 2RCNA 2OTJA 4A3KG 3M3YH 1O7IA 4DR6L 4A3BH 1Q8KA 4HJ5A 4BA1I 1ASYA 4DAYB 4DV3Q 1XNRQ 2GVBA 2KHJA 3HOXH 4B3ML 1EIYB 2RF4A 3H15A 1X56A 4A3GG 4OO1G 1L1OB 1OXSC 2IHFA 3KDFB 2R7ZG 3K7AH 1FVIA 4HJ9A 1DGSA 2JJQA 4HJ8A 2JA6G 1PYBA 2UU9L 1GVPA 2HT1A 3B6YA 4BBRH 4GLXA 4IOCA 1GO3E 1XPOA 4QQBX 3W1BA 3J81i 2VY3A 3G71A 4NXMQ 2JEAI 4TQUS 1V43A 3F2CA 2QEXA 4GOPB 2L15A 4DR7Q 1N9WA 4DK3C 1VQJA 1NE3A 1E1OA 3SGIA 4B3SQ 5E7NA 4A75A 2MQHA 4JI1L 5M3FH 4KI0A 2ES2A 1UEBA 3GD7A 1PH2A 4NXNQ 3KJPA 2ZJPA 4GKKQ 1IBKL 3H0GG 5IYBH 4PMWA 2JA7G 2K50A 4KHPQ 1CKMA 3KYHC 4GNXB 2YTVA 4A3IH 2ZTCA 5FLXc 3TS2A 1VQHA 3OTOQ 4DV4L 2UUAQ 5C4XG 2AHOB 3UDXA 4Y7NH 2I5MX 2YTXA 4LUOA 2OWOA 4JI4Q 2XTIA 3CPFA 1HH2P 1X3GA 2VS1A 3AYHB 4PZ7A 5IT9c 4LF7Q 2I5LX 5GAGC 1PVOA 4X64Q 3I4MG 1HR0Q 5HY6A 3GTMH 1EIFA 1LYLA 3CF5A 2BH2A 4DV0L 1V1QA 3PO2G 4UP7A 1XTDA 3AFPA 3F2BA 4LFAL 4DR2L 4YWLA 1YJWA 4IFDJ 4IFDG 4GN5A 2HIXA 4GN4B 3JAMc 4X65Q 1YBYA 1J5EQ 3CC7A 1EYGA 4DV6Q 1MJEA 1JE5A 2OTLA 3HOVG 4P73A 1Y14B 2Y0SG 2PQAA 1E3PA 2RHSB 4P75A 4LW1A 2E2IH 3PO3H 4NB3A 2VZAA 1AE3A 3JC66 3STBC 5M5WH 2JA5G 2NVQH 3PCOB 2LXKA 3M85A 1BVSA 4AYBG 2VL6A 2VUMG 3ULLA 1GD7A 4UY8C 1L1OA 1QVCA 2E2HH 1XNRL 5FLMH 3E9IA 2B63H 4DUZL 2Z6KC 3VDYA 1YITA 2NVXH 5DLQE 2ATWA 1N36L 4A3DH 1XPUA 4AQYQ 4A3BG 3TQYA 1HZBA 3M4OH 4UP9A 3GTPH 3HOXG 4GOPA 3FP9A 3EIVA 4A3CH 1NJIC 1C9OA 4IOAA 3GTKH 2MO0A 4DR7L 1K83H 1I50H 1WOCA 4YCVA 4DUYQ 1KAWA 1VQMA 3RN2A 4BBRG 1PA6A 1HR0W 1PH6A 1LM0A 3BJUA 3H3VH 1UE7A 3PSIA 2K4KA 1L2FA 4JV5L 2UXCL 4GNXA 4C3IH 1JJ2A 2HHHQ 3NBHB 1KRTA 3AEVA 3PIPA 3OTOL 5M3FG 2Y0SE 1NMGA 1Q7YC 3RR5A 2UUAL 4A93H 3HOZH 1T9HA 3F2DA 1R9TH 1K73C 5IYBG 4R4CA 2BA1A 3G6EA 4LF6L 4JI4L 1W3SA 3EN2A 4A3IG 3CAMA 1N32Q 1Q82C 3M9BA 1HNWQ 1Q12A 4X64L 1HR0L 1SFOH 1SLJA 5IWAL 3G4SA 1XJVA 3RN5A 4DV5Q 1PH5A 4DR1Q 1MKHA 3NENA 4JOIA 2PI2E 3STBD 3KF6B 3I56A 4DAMA 4DK6C 4BA2I 2R93G 3EBEA 2VQFL 4Y52H 1PV4A 3KLWA 1WJJA 1CUKA 2H5XA 4DV6L 3T1YQ 3ULPA 4JI6Q 1YVCA 1CSPA 4X62Q 1PH9A 1WCMH 2OQ0A 1X9NA 4BBSH 2UUCQ 4JYAQ 1HZAA 3PUWA 2D62A 1OXTA 4IPHA 4TVAB 5JJKA 2KENA 4LUVA 4OWXB 4P72A 2PQAB 4R4IA 4UP8A 1HJPA 4C3JH 4BY1H 3S16H 3HOUH 4AIMA 4POFA 3J81j 1Q1EA 1Q1BA 1PHJA 1XPRA 1X3EA 4LFCQ 1VQ8A 3PO3G 1VQ9A 3CCVA 1K9MC 1Y1WH 2F52A 4BY7H 4DV2L 1M90C 2Q2TA 1N34L 3G48A 1VQNA 3NELA 2JA9A 4DR3L 1I94Q 5FLMG 4DPGA 1J6QA 2B63G 3JAMi 2F4VQ 3S17H 4P71A 1HNZQ 3I4NH 4A3DG 1SN8A 2CFMA 4LF4L 1FL0A 4A3CG 3HOWG 1N8RC 2K14A 2KCTA 2IHEA 4NPSA 1KQSA 4QGUA 4B3RQ 2B29A 1XMQQ 3J80c 3DLLA 1BBUA 2WAQE 1X3FA 1AH9A 2NVTH 4JI7Q 3TREA 4DV1L 2K5NA 2NZOA 5FJ8H 2ZJQA 1JMCA 1TWFH 3HOYH 5GAEC 2NN6I 4DR5Q 1ASZA 1H95A 1G51A 1HNXQ 1D8LA 3J7A5 1N32L 1HNWL 4A93G 1NTGA 4X66L 3HOZG 1QVGA 4DV7Q 2YU9H 3K80C 1VS0A 1YZ6A 1NMFA 3KF6A 4DV5L 1UE6A 2MNAA 4DR1L 2ZTEA 4JBMA 4JI5Q 1VQAA 4J15A 2VQEL 4IJHA 4IPCA 3CCRA 3KFUA 4IO9A 2BA0A 1I3QH 2E5LQ 1IBLQ 3S2HH 5JJIA 2DUDA 3PUYA 3T1YL 2LXJA 2R7FA 1L1OC 1PFSA 3RLNA 4JI6L 4X62L 2VW9A 1TWCH 3BU2A 2UXDQ 1UWVA 1AE2A 1C7YA 2UUCL 1WI5A 2AWNA 1TWGH 4JI2Q 4KHZA 4EX5A 3S1RH 4OX9Q 2ZJRA 4LFBQ 1BBWA 1PH8A 1B8AA 3CD6A 2AMCB 4DR4Q 1YIJA 1VQPA 4ME3A 4QY7A 5LMUQ 5J3BA 1PH7A 5IP7H 4GOPC 1WCMG 4L5RC 4BBSG 4OO1I 3A5ZB 1SE8A 1RIPA 4ALPA 3FKIH 4IPDA 5BR8Q 4DV3L 2JE6I 1YI2A 2Q2UA 3UE1A 1VQIA 3W5OA 4RMFA 5C0XI 4BY1G 4A3FH 1OXXK 1Q81C 1IL2A 4BXXH 2CWPA 2EXDA 2E2JH 3AQQA 4L5QA 3RLOA 1CSQA 3J81c 1K8AC 5IY0A 1Y1WG 4GNXC 4C2MH 1VQLA 4NXML 4BY7G 1KHIA 1HNZL 1NY4A 2B3GA 1VQEA 2K5HA 2WP8J 1QZGA 1QUQB 2KHIA 5M5XH 4FDBA 1S3OA 3E0EA 1S40A 1SR3A 1OXVA 4B3SL 2PNHA 4R4QA 4DR6Q 3GDEA 2HQLA 4NXNL 1PH1A 3S14H 4GKKL 1YHBA 4B3RL 2N78A 1XMQL 4KHPL 1JT8A 1KL9A 3GTQH 4OXPA 4XTCS 1I6HH 2I5HA 2C35B 3D31A 2A1AA 2AKWB 4JI0Q 4JI7L 3I4OA 1BKBA 1X54A 4GS3A 3RLFA 4JOIC 1M1KC 2JA8H 1KXLA 4UPAA 3PIOA 2WB1G 4LUZA 4A3EH 1KRSA 1HNXL 4YCWA 1FJGQ 4LF7L 1C0AA 4AYBE 1NBWA 4JC0A 3UE0A 5LMNQ 1VQ5A 2WFWA 5FJ8G 4DV7L 4B3TQ 1SRUA 1W2BA 3IRBA 3CCEA 3HOYG 4GLVB 5GADC 2OQKA 4JI5L 1KIXA 4IFDI 2D0PA 3D0FA 3PUXA 1CKNB 1EQRA 5M3MH 1SROA 1VQBA 3J80i 5ELOA 4X65L 1J5EL 1WYDA 2QA4A 3PF4A 3L2PA 3ER0A 5M5YH 5GQOA 4H02A 2ZM6Q 4JI2L 2CWAA 3PUVA 1G6PA 4OX9L 4LFBL 2A8VA 4OONA 4KLKA 4DR4L 3S24A 5AJ3Q 5LMUL 1P16A 4JBWA 3RZDH 1CKOA 1SMXA 1B7YB 5BR8L 3UDGA 2UUBQ 2ASBA 4DV0Q 3LGJA 2VNUD 4LFAQ 4A3LH 4GN3B 5IP9H 5IP7G 4O2DA 2F3IA 2E8GA 4AQYL 4LF5Q 3OW2A 2R7DA 3A74A 3FKIG 3A5UA 2K5VA 2N49A 1S72A 1U0LA 5C3EH 1Q86C 1QUQA 4HIKA 4JBKA 2K75A 2NZHA 4A3FG 4HJ7A 1Y1VH 1UE1A 4JCVE 1XNQQ 4BXXG 1PYSB 4HIMA 1I5FA 1D7QA 4GLAC 4DUYL 1X65A 5LMNW 5IYCH 1JJGA 1A8VA 5GAHC 1IBMQ 3L0OA 4HIOA 4P74A 4L5SA 4LWCA 3CXCA 3GTGH 2HHHL 1HZ9A 2A19A 2JQOA 1U5KA 1VQGA 3UDIA 4A4IA 3KJOA 3L7ZC 4DUZQ 1YNXA 1TXYA 4JI0L 3T1HQ 4C3HH 1N36Q 3M4QA 3BZKA 2HIVA 2UXBQ 2ALYB 5C0XJ 5JEAJ 4EQ5A 1E24A 5JEAG 5C0XG 4X6AH 3GTJH 4POGA 2MO1A 1A63A 4JBJA 3CCQA 1YJNA 1TWHH 2QGQA 1FJGL 1EQQA 4K0KQ 2NVYH 3I2ZA 5IYDH 4YHHQ 3TS0A 4APVA 5LMNL 4B3TL 3S15H 4PZ6A 3HKSA 4LF8Q 2JA8G 1Z9FA 1E22A 4A3EG 1GKHA 3CP0A 5GROA 2YYZA 1YEZA 1YHQA 1CKNA 2K52A 2KCMA 2V1CC 3A0JA 4JV5Q 5C44H 2UXCQ 2D0OA 4JI3Q 2IT1A 4IJLA 1TWAH 2ID0A 4AH6A 3CCMA 1VQ4A 4A3JH 2I0QA 1A62A 1PH4A 4JI8Q 1IZ6A 2ZM6L 4L5TA 4YY3Q 3PUZA 1A0IA 4XIGS 2ZTDA 4QL5A 5HGQA 5M3MG 4JYAL 2EQSA 4R4TA 3RNUA 4LF6Q 2PI2A 1VCIA 5AJ3L 4MTNA 3S2DH 2R93H 3ZJYC 1G291 4JG2A 1IXRA 2UUBL 4LFCL 5IWAQ 2RHQB 1E1TA 4GKJQ 3K8AA 3KF8B 1HZCA 3U4VA 3U50C 3S1QH 3ERSX 2Q2IA 4LNQA 3M7NA 1EUJA 2OCEA 3CMAA 3J7ZC 3HOUG 4LF5L 4A3MH 2EIFA 3CMEA 3MEFA 2VQFQ 1VQOA 1I94L 1XMOQ 3M4PA 3CQZH 2LSSA 2R92H 3Q8DA 2F4VL 3CPWA 1VQCA 2YTYA 3CW2C 3CCJA 3FHWA 1LTLA 4O0AA 5IP9G 2DGYA 3I55A 4A3KH 1XNQL 4A3LG 4LF9Q 2CQOA 3WWVA 4WJ4A 3S1NH 5JJLA 4A3GH 1X55A 2YV5A 1N33Q 5K36G 5C3EG 1OXUA 1IBML 3K0XA
chains in the Genus database with same CATH superfamily
4QIWE 3U9SA 4EQPA 1WVLA 2GVAA 5IYCG 5ELNA 3PV0A 1WTQA 4B3MQ 2CCZA 2EE1A 3T1HL 4MNOA 2N55A 2KBNA 5M5YB 4DR3Q 1EYDA 4YCUA 4CJ1B 3HKZG 2XNAC 3HOWH 4K0KL 1A15A 3KOJA 3NQIA 4R9WA 2B2TC 3FEWX 2PMZE 5IE8A 5LL6X 1SYBA 1IYUA 1X6OA 5IYDG 1SYDA 2XN9C 2DNCA 1E7ZA 1Q8IA 1RTOA 1CHQD 2EYPA 2L5TA 1LUZA 4IPGA 3U9OA 3P7JA 3R3OA 4DV1Q 1NR4A 4YY3L 1LT5D 1EFWA 2B2VA 2UXDL 3I4MH 3DM3A 1VQDA 2R6GA 1HA6A 1RL2A 3ULJA 5KNDA 4HIDA 2GN5A 4DNIA 3HKZB 3HOVH 1BO0A 4CGYB 1IW7C 1VQ7A 3J81L 4JW0A 1XMOL 4MZ9A 2EXZA 4ZUIA 2LMCB 1PH3A 4OWWB 4K2KA 4LF9L 2IX0A 3TP5A 1VQ6A 1GM5A 4FYDA 4L63B 4K5XA 2RCNA 3HS0C 1O7IA 2RCFA 2VB3X 1EQVA 1X56A 1NNXA 4FXGC 3KDFB 3K7AH 3MWYW 2G9DA 3C3LA 4QQBX 4BBRH 4IOCA 5C4ZA 1WTVA 3J81i 1KNEA 2QEXA 1PFNA 4ZKBB 3S2DB 1E2VA 1N9WA 4DK3C 3ONAB 1E1OA 4B3SQ 2XWJB 2F0LA 3E6ZX 1UEBA 3KJPA 2ZJPA 3WOFA 4PNYA 5COYA 2RBMA 4CDCC 3NSWA 3I4LA 1EY5A 3CQZB 2ZTCA 4CDEC 1MI2A 3TP8A 5C4XG 2YTXA 4H0LC 3AYHB 4PZ7A 3K5LA 5GAGC 1PVOA 4DNTB 3LWUA 1EY4A 3GTMH 2NTTA 2BH2A 1EWHA 4DV0L 4UP7A 3BDOA 5CV6A 4LFAL 5CC4A 4HSVA 2B39A 4DR2L 4IFDG 4ZCKA 1ET9A 3I8ZA 3CC7A 2OTLA 3I91A 3OPOA 3QR8A 1E3PA 4LW1A 2FMCA 2C9OA 2Z4HA 1AE3A 3JC66 3DUZA 2E74C 3SK6A 2LXKA 3TP7A 1M8AA 2VUMG 1HUNA 2K04A 1F2ZA 3ULLA 5C4XB 1L1OA 2L55A 2E2HH 1A2TA 1JOOA 2B63H 2ATWA 4O42A 5DLQE 3SDZA 5C4JB 1NR2A 5D3IB 1F2LA 1HZBA 3GTPH 3FP9A 3KBXA 1L0XB 3CRKC 3FDTA 3S1MB 1HQMC 2MO0A 1K83H 1GUSA 4XQNA 3RZDB 5LL6S 1STNA 2B2VC 1HR0W 1NUCA 3PSIA 1L2FA 3H6MA 4JV5L 2UXCL 4GNXA 1JJ2A 2HHHQ 1NSNS 2OF1A 1CA5A 1KDBA 3DM1A 3RR5A 1T9HA 2EZVA 2VUMB 2BA1A 2HCIA 2O5IC 2B2WA 3D4WA 1FNUA 5I6YA 4A3IG 5KNCA 4X64L 1HR0L 1SFOH 1SLJA 4K6LA 4MTKA 2WINB 1TKWB 3S9WA 1UUPA 4JOIA 2K5QA 2O4XA 3E3XA 2VQFL 2PZUA 2L9HA 4DV6L 3ULPA 2K05A 1YVCA 1X9NA 1EFID 3S15B 5C6AA 4LUVA 2PQAB 3MXUA 4BY1H 3T53B 1XPRA 1X3EA 4LFCQ 1VQ8A 1K9MC 4KN4C 5EGTA 4ZKCB 1Y1WH 1SXTA 5ELCA 1M90C 4A3IB 4QMGA 3NELA 5C4HA 3DXJC 1EEID 2ZXPA 5FLMG 3I73A 1J6QA 2B2UA 1LLRD 4J1MA 1HNZQ 3VA7A 3R8BA 5K5PA 4M1UB 1O7YA 4LF4L 5JVH3 1FL0A 5EKKA 4PMCA 3V96A 4ME5A 2CVRA 2ZXOA 1JOKA 4HEDA 1X3FA 1AH9A 3PIO3 1EY0A 1I4RA 2NZOA 4O1NA 4C3IG 1BOSA 1TWFH 4HN7A 4HCSA 3HOYH 4Q5VA 1QG7A 1PLFA 3J7A5 5M5WB 1LT3D 2NVQB 3AB9A 4A93G 4X66L 2YU9H 3K80C 1VS0A 4DR1L 4UAIA 1AP0A 1R4PB 4JI5Q 4J15A 2VQEL 4IPCA 1B53A 3RMHA 2BA0A 4EQNA 3M4OB 1SYGA 2LXJA 1L1OC 2R7FA 4X62L 2RDFA 2UXDQ 2UUCL 1WI5A 3GTKB 4QF4A 4JI2Q 1I50B 2BDNA 3CD6A 2AMCB 4RHSA 1SJHD 3R93A 3HEJA 5J3BA 3NWSA 1WCMG 4BBSG 1EZ6A 1SE8A 3NBIA 3FKIH 4DV3L 1TU2B 4C3IB 2Q2UA 5IGGA 4RMFA 5C0XI 4C3JG 1OXXK 1IL2A 2CWPA 4A93B 3AQQA 1CSQA 1K8AC 5IY0A 3FRPB 4XT3B 4GNXC 1F2YA 4K5VA 4BY7G 1VQEA 3ZYYX 4RH6A 1HTPA 3D6CA 3DWQA 4KY6A 1PRTF 1EIHA 2B2WC 2EY5A 2OXPA 4KMUC 5CR3A 4NXNL 4B3RL 4KHPL 1JT8A 4OXPA 4XTCS 2I5HA 4G7HC 3PQIA 2NYZD 4JI7L 1G6ZA 1EIGA 4GS3A 1II3A 1BKBA 1WCMB 4JOIC 3RLFA 3A54A 4BBSB 4A3EH 1SE2A 3R2IA 5IT9L 1KRSA 3IL8A 4C3JB 4JC0A 5FJ8G 2O2LD 3CCEA 4E6IA 4ZAIA 4BY7B 5ISRA 4XQJA 3D0FA 4N9TA 2A73B 1VQBA 4X65L 3S17B 3J7YW 4H02A 1S5DD 3A8JE 2Z1CA 3PUVA 1G6PA 4LFBL 2A8VA 4OONA 1ML0D 2EOTA 3KF8A 3RZDH 2B2UC 3UDGA 5BR8L 1YNJD 4DV0Q 3LGJA 2F3VA 1PTOD 4LFAQ 4A3LH 5IP7G 1ZYRC 5FO8B 2F3IA 4LF5Q 5AFWA 1PFMA 1B9MA 2K5VA 1U0LA 5C3EH 1LT6D 1Q86C 4JBKA 4HJ7A 4JCVE 1I5FA 1D7QA 4DUYL 1LTTD 4CKBA 1A3VA 4KK7A 5GAHC 4L5SA 2F0SA 3CXCA 3GTGH 2A19A 3VR6A 1TVXA 3DMUA 3L7ZC 4K2LA 2F1MA 4TRDA 5C0XJ 5JEAJ 1E24A 1A63A 2MO1A 1TWGB 2JP1A 4JBJA 3S1RB 1D2BA 3EQLC 3I2ZA 3T13A 3TS0A 1EZ8A 5CV7A 3A55A 3S15H 4LF8Q 1STHA 5FK9C 2DNEA 4JV5Q 5C44H 1O7ZA 2D0OA 4JI3Q 2UXCQ 2IT1A 1TWAH 3K0YA 2HDLA 1VQ4A 3BDCA 4A3JH 2I0QA 1PH4A 1IW7D 2CH4W 4JI8Q 2AQ3B 3PUZA 1A0IA 5HGQA 2ZTDA 4JYAL 3DWPA 2EQSA 4WJWA 5M5XB 3C46A 1STAA 2DJGC 2PI2A 3V05A 2NB0A 1C4QA 5BN4A 4BS9A 3MXNA 4JG2A 1IXRA 3S14B 1E1TA 2EY2A 5IGDA 2OCEA 3IFDA 3J7ZC 2CH4A 2VQFQ 1VQOA 3CW2C 2CQOA 4ULLA 4X3TA 4WJ4A 5EBCA 1PTOH 1EY6A 1XXGA 1N33Q 4KY7A 4NP5A 3K0XA 1IBML 1Y1VG 3BZCA 1K0RA 1WTXA 3I4NG 1DONA 3ICEA 3OMCA 4OIJA 5FLXL 3NEMA 2Z8LA 4DKAC 5IGCA 1KC8C 2ZXRA 2UU9Q 1A3UA 4DR5L 1YJ9A 1PRTC 4C3HG 1B70B 3H0GH 4LF4Q 3NE5B 4RGNA 1VQKA 2JA7H 1JJCB 1D1KA 1MJCA 3CRLC 2HQEA 4PZ8A 2DY7A 4JI1Q 1Q46A 1BCPB 5E1FA 1IKLA 1MIUA 1S5FD 4OWTB 4R4OA 1KD1C 1QVFA 4I65A 3CC4A 1OTCA 3IFTA 3K7UC 1JB7A 1F9PA 2N3SA 4DK1A 1L0YB 1IL8A 1Y1VB 3TN2A 3I4NB 1F9SA 5EAYA 4WJ3M 3OYYA 2NN6G 4X66Q 3G7LA 2F0HA 4IUNA 1EQTA 4GKJL 1WFQA 4DXGA 1LTRD 2VQEQ 4C3HB 2Q2HA 2AWOA 2SOBA 2E2DC 3FPPA 3HKZE 1F2MA 3OSOA 3MHBA 5H1SE 2B2YA 2WB1E 3VYTA 3AFQA 3CCLA 3GTJB 4RA8A 4V190 3RZOH 5E4WC 1TWHB 1JCKB 1V1PA 2CKZB 4IUUA 2NVYB 3HFZB 1A3TA 2BH8A 1R4QB 3CC2A 2OTJA 3DHQA 4A3KG 4A3BH 1Q8KA 4HJ5A 4BA1I 1Z6HA 5DNFA 4DAYB 4DV3Q 5KYIA 1XNRQ 2GVBA 3HOXH 4OO1G 1EIYB 1L1OB 2RSNA 2R7ZG 1QE6A 1FVIA 4HJ8A 2JA6G 1PYBA 4ZK9B 2HT1A 1X32A 5EKLA 2VY3A 4IUTA 4TQUS 1VQJA 4RKLA 2SEBD 1EY9A 1HUMA 1C48A 1CM9A 4A75A 2MQHA 3D8GA 4NXNQ 3PIP3 1IBKL 5IYBH 4KHPQ 1CKMA 4GNXB 2YTVA 3TS2A 1VQHA 4DV4L 4C2MB 2NWGA 2AHOB 4A3KB 2F0MA 3UDXA 3CKIB 2A6HC 3LX0A 3EA6A 4KKUA 2OWOA 4JI4Q 1KABA 1HH2P 1X3GA 2AQ2B 1RCVD 3T56B 3GTOB 2R7ZB 5IGFA 4F7XA 1EIFA 1LYLA 1GUOA 2JA6B 3PO2G 1MSHA 1XTDA 1HHVA 1IHZA 4YWLA 3OOCA 4GN5A 3JAMc 3PMFA 4X65Q 1YBYA 3FMCA 4UDUC 1EEFD 2CW0C 1JE5A 3VYSA 4NW2A 2XRQD 2Y0SG 1BCPD 4P75A 3LWEA 1AZQA 5IODA 2VZAA 3GTLB 1LABA 3STBC 2JA5G 1W6KA 3M85A 3C1EA 2VL6A 4UY8C 2CQAA 1S4ZA 3ITPA 4CJ0B 1VMCA 3VDYA 2NVXH 4I7ZC 4OIKA 5DM63 1DOKA 4A3DH 1WTHA 4ZYSA 1XPUA 4CHTB 4UP9A 1SNMA 3QIAA 4QCLA 3PO2B 3MA2B 1ZKOA 3TSSA 4DR7L 4DUYQ 2K7VA 3D3RA 1SYFA 3BJUA 4IQZA 5CBEE 2B8GA 3MZ5A 2Y0SB 5G3LD 3NBHB 4K6DA 1X3PA 2PYKA 3AEVA 1E2ZA 4HCEA 3OTOL 2JA5B 5M3FG 2UUAL 3HOZH 5KYLA 3G6EA 4LF6L 2MUYA 3EN2A 1G2SA 3I90A 2B2YC 1N32Q 5A35A 1GUWA 3M9BA 1PH5A 2WKDA 4DV5Q 3NENA 2PI2E 4DAMA 4DK6C 4WRDA 3E0JA 1BQQT 1SNDA 1TQOA 3T1YQ 5IOCA 4UHVA 1QCBD 4JI6Q 2DN8A 3KLRA 2F0NA 4JYAQ 5DAUA 1OXTA 2GA4B 3CHBD 4OWXB 5ELEA 1ENAA 3S16H 4AIMA 2EYLA 1QWYA 1RHPA 2JXMB 4POFA 3J81j 2MP1A 1Q1EA 2V4DA 5M3FB 1PHJA 4RGMA 3PO3G 4KY5A 3CCVA 1QJOA 4DV2L 2Q2TA 2FHTA 3G48A 1SNQA 5J1ZA 1ONLA 1GUGA 4Y7NB 3OWEB 3JAMi 1HTLD 1JR0D 4F87A 2QF7A 3I4NH 1S5CD 1RDPD 1EOTA 2QEJC 1Y8OB 3I70A 2QW7A 1GUNA 1V1OA 4A3CG 1N8RC 2NBFA 4Z9CB 4NPSA 4N8FA 1I4QA 4QGUA 4ZQ3A 3J80c 1Y8NB 2WAQE 2RVLA 4H7BA 1BDOA 3TREA 2K5NA 4X3UA 4FF4A 4C56C 2ZJQA 1LTBD 1NAPA 4DR5Q 1ASZA 2E2IB 3PO3B 2A68C 1HNWL 4OL7A 1QVGA 4C1NI 2SNMA 3KF6A 1NMFA 4ZRZA 2ZTEA 1VQAA 1EL0A 4Q0FA 3FPUB 5LHY1 1PRTB 2L0CA 2B8FA 2AWNA 1PH8A 1B8AA 4DFAA 1SE4A 4ME3A 4QY7A 5LMUQ 3TZUA 3A5ZB 1YI2A 2Q8TA 2JE6I 4A3FH 1Q81C 3KK7A 4BXXH 5M9OA 1R9TB 4C2MH 4NXML 3UI2A 3BVMA 1NY4A 2B3GA 1XTCD 2WP8J 2KVMA 4L6TB 4QIWB 1QZGA 3A8IE 3E0EA 2WIIB 5FO9B 1OXVA 3SK4A 2EYOA 4DGZA 4KJOA 3SK5A 3GDEA 1C8CA 1PH1A 1YHBA 4HR7B 2N78A 1XMQL 1KL9A 1FYCA 2C35B 3D31A 1WTRA 3C1FA 3TZDA 3I4OA 2HD3A 5E4XA 1RJTA 1M1KC 2JA8H 2PMZB 4G4KA 1HNXL 2Z4IA 2HUGA 1AEXA 1C0AA 4AYBE 1NBWA 5LMNQ 1VQ5A 4B3TQ 2E75C 4DV7L 3M3YB 5FKAC 1CTMA 4GLVB 4KKSA 1EYCA 2OQKA 4IFDI 2EJFC 4FXDA 1D5ZC 3Q22A 1SROA 3J80i 5ELOA 4DNRB 3MC0B 5M5YH 3L2PA 1TY2A 2CWAA 2MPMA 4OX9L 4JVZA 4KLKA 1GHJA 4DR4L 3BVZA 5AJ3Q 1P16A 2KQ3A 4JBWA 5CV5A 3VA5A 1CKOA 1B7YB 2UUBQ 2DJFC 5ELBA 3H09A 5JOBA 3SK8A 3LNNA 3T4AC 5F2DA 2NVTB 4AQYL 3A74A 1XWEA 1I4XA 5K36H 2F0VA 1H9KA 1JE4A 2K75A 1XNQQ 3K5NA 4CJ2C 1X65A 2F0OA 5IYCH 1SNPA 4XYOA 3L9AX 1BXTA 1PRTD 2P5ZX 2Z6BA 1QNKA 1MGSA 1I3QB 3S2HB 4JI0L 1TXYA 3T1HQ 3M4QA 3BZKA 2A69D 5C5MA 2HIVA 5I6WA 1TWCB 5C0XG 5JEAG 4X6AH 4POGA 1DCZA 2J7ZA 1EY7A 2PO4A 4I7AA 4RAUC 5JAVA 1FJGL 1LT4D 2A74C 4K0KQ 5IYDH 4APVA 1Q3LA 4PZ6A 3KBGA 2ICIA 1B9NA 1Z9FA 3BZDB 4ID6A 1GKHA 5GROA 4CDDC 2YYZA 1YEZA 3NP8A 1CKNA 2V1CC 1TS5A 3A0JA 2IX3A 3QG1A 2HDMA 2E2JB 1H9SB 1TY0A 2RSOA 5KEEA 3CCMA 2OEOA 1GXDC 2KECA 4IALA 3JAME 2ZM6L 3IAYA 4YY3Q 3BYTB 1K0SA 5M3MG 4R4TA 4LF6Q 3VR5A 1FNWA 2R3ZA 4MTNA 3VR3A 2WV6D 2ENBA 3S2DH 3AMUA 3ZJYC 1G291 2K32A 1CA6A 3GTQB 1K3BC 4H44C 1I6HB 2A6ED 2Q2IA 3M7NA 3CMAA 2G5DA 4K14A 3MEFA 2PW7A 1XMOQ 3CQZH 2F0PA 4RGTA 3Q8DA 2F4VL 1B1ZA 1KDCA 3A7AB 3CCJA 5IP9G 2DGYA 4LF9Q 1D5XC 2K01A 1LTSD 3WWVA 4GZYC 1V1PB 4K8JA 4IUQA 3GV6A 5JJLA 1X55A 1GUTA 4DAPA 4RWSC 1OXUA 5BN3A 3H3VI 1QILA 2TSSA 3KDFA 5M3MB 5HGTA 3O13A 4DV2Q 5EPLA 3F1ZA 2UXBL 1VQFA 1EU4A 3U4ZA 1KNAA 1LTGD 1FGUA 5JPMC 3QWNA 4YHHL 4R1JA 2IY5B 3AU7A 5EBDA 5C3XA 4QJFA 1ESFA 4P2CB 5C4XH 3F8TA 2E5LL 1PZJD 5C4JH 2PQEA 3MFGA 3TRZA 2JEBI 2MFIA 1QZHA 2EDGA 3I7FA 1IYJB 2Q8RE 3S1MH 2RQXA 2F0FA 4IFDH 1AFPA 3OMGA 3MXPA 4DF7A 3BG3A 1UE5A 3EJIA 1SBBB 4YWMA 5C3WA 5FO7B 1P8LA 3VR4A 1HFGA 2LKVA 1XYIA 4DR2Q 1JQYD 3E9HA 1HA5A 2MGSA 2TMPA 3WOEA 4FNFA 2WKCA 4FP5D 4J6HA 3FVQA 3D4DA 2JK8A 2VUMH 4A3MG 2EYMA 4RG1A 1Z47A 1STGA 3PGZA 2R92G 2EVBA 3M3YH 1WD1A 1DZ1A 1EWCA 3BYYB 3W3AA 4FXKC 3NTIA 4B3ML 4A3GG 2RF4A 3H15A 3J80E 4HJ9A 1DGSA 2JJQA 2PW5A 4GLXA 1XPOA 4NXMQ 2JEAI 2BE5C 1V43A 1EU3A 2L15A 2NZ1D 1NE3A 3SGIA 2BDOA 5T1GA 1D6EC 2ES2A 3GD7A 1PH2A 5EPKA 2K50A 1SMYC 4A3MB 1CT1D 3KYHC 2R92B 4A3IH 5FLXc 5CMDA 3S1NB 1FGBD 2F4IA 4LUOA 4A3GB 2XTIA 2DY8A 1MD2D 1LV9A 2WACA 4X64Q 3I4MG 1HR0Q 5HY6A 4QUCA 2XIWA 3AFPA 3F2BA 1LACA 5KGUA 1YJWA 1OO9B 4GN4B 3HOVG 2K6AA 4DV6Q 1EYGA 3MEHA 2PQAA 1WTWA 4NB3A 5M5WH 2NVQH 1STYA 1DJRD 1TT2A 2LS01 3PCOB 5DEHA 3GP7A 3SE0A 5CBAE 5JPNC 5FLMH 3E9IA 2EYFA 1G91A 1PTOF 1YITA 1HFNA 5J39A 3VYRA 4AQYQ 3TMEA 3M4OH 3I4MB 4GOPA 3EIVA 2F0IA 4IOAA 3GTKH 1I50H 2QILA 1VQMA 2KCNA 4BBRG 3MTSA 1PH6A 3H3VH 3HOVB 1CI3M 4C3IH 1FD7D 4PV1C 1ESRA 3EVQA 2QDLA 4S3SA 1HRJA 1VDZA 2VB2X 1Q7YC 2Y0SE 1NMGA 1ZEQX 4A93H 1TR5A 2LFNA 4OEMB 4R4CA 4XDXA 1W3SA 2K1BA 1U4PA 3CAMA 4HSPA 1PZID 1Q12A 4K5WA 1U4RA 3RN5A 5EJWA 4DR1Q 3KF6B 2K5WA 1JWUD 1ZXTA 4BA2I 3EBEA 3K7AB 1B2TA 4QUFA 3KLWA 1CQVA 5TSSA 4BBRB 1CUKA 2H5XA 1CSPA 4X62Q 1H9RA 1WCMH 2OQ0A 4BBSH 2UUCQ 2KEEA 1HZAA 3PUWA 4IPHA 4TVAB 5JJKA 4X3KA 2Q8IB 4UP8A 1HJPA 4C3JH 5IGBA 2QKIC 1VQ9A 2F52A 4BY7H 2KUMA 5J22A 1N34L 4ZUJA 3QOLA 5CV8A 5E3FA 4DPGA 3TBIB 4EVOA 2B63G 2F4VQ 3S17H 1HCZA 1JB3A 3GV3A 3Q6SA 2RKSA 3GTMB 3NHHA 3K5OA 2D9UA 1T5EA 5CGKA 2K14A 1W6JA 2KCTA 4EGVA 1KQSA 4B3RQ 2KCCA 1ICWA 1E0BA 2D5DA 2K33A 3DLLA 3M4YA 1KLGD 4JI7Q 2J4XA 5FJ8H 4NKLA 1H95A 5GAEC 2NN6I 1Y69U 4KD4A 2FMMA 1NTGA 1SNOA 2AUKA 2E2HB 4IJHA 3CCRA 4F88A 3T16A 2FINB 2E5LQ 1SNCA 5JJIA 5I2XA 3NWTA 3GTPB 3PUYA 3RLNA 2VW9A 3BU2A 1UWVA 1AE2A 1C7YA 1U4MA 1TWGH 1K83B 5T1IA 3NPPA 4CKEA 3S1RH 4LFBQ 2ZJRA 1BBWA 1QNUA 2Z9HA 2KEDA 1VQPA 5IP7H 4GOPC 4OO1I 2RA4A 1XX8A 3V2TA 1JORA 1RIPA 4ALPA 4IPDA 5BR8Q 3KLSX 2L12A 4ABNA 4BY1G 4L5QA 3ERQA 4ILWA 3J81c 1Y1WG 1VQLA 2LY7A 1HNZL 2F0TA 3DEPA 2K5HA 3J7AV 1YNJC 1U9RA 3HZXA 4FDBA 5M5XH 1SFOB 1S3OA 1S40A 1PTOC 3L3OC 3Q0AA 3NTHA 4R4QA 1PDQA 3K6OA 1VMPA 2HQLA 4CDFC 3S14H 4GKKL 1JC7A 1TIID 2AKWB 2FJ2A 1CHPD 1F9QA 1CZGA 1X54A 2KOLA 3PIOA 2WB1G 4LUZA 1PFBA 4LF7L 5I2YA 4BY1B 3UE0A 4DA2A 1SRUA 1W2BA 3HOYG 5GADC 2F0KA 3MAQA 4JI5L 1Y1WB 3H3VC 1BNZA 1ILPA 4DN4M 3JAML 1CKNB 2O5JC 1SEBD 1J5EL 1WYDA 3PF4A 1PYWD 2JN4A 5GQOA 5JJZA 1CQFA 2J0TD 3OIPA 4JI2L 1YNNC 3S24A 4IUVA 3VYUA 2F0DA 1JOQA 2WB1B 4O2DA 3QO2A 3OW2A 3FKIG 3A5UA 1LTID 4QB4A 4XT1B 1TWFB 1S72A 3HOYB 1A2UA 1QUQA 2BOSA 1BCPF 1Y1VH 1UE1A 1PYSB 4HIMA 2I46A 3ND9A 4EQOA 2M9VA 2YU9B 3HRZC 1A8VA 1IBMQ 2QDBA 1H9JA 3X3NA 5FOBB 4R8IA 4HMIA 1U5KA 1VQGA 3UDIA 3KJOA 2L1BA 2K5DA 4JK1C 5DM73 4C3HH 2ALYB 2EY6A 3GTJH 5IIFA 5FLXE 3D6WA 1BUVT 1TWHH 2K03A 1TS3A 2NVYH 2IW3A 1E22A 2PNRC 3FKIB 1UAPA 3CP0A 4A3EG 5EPJA 1YHQA 2KCMA 4FF2A 5G3LF 5CYUA 1BR9A 4RKBA 4IJLA 2ID0A 2CHBD 1HXYD 1A62A 1EY8A 1I4HA 1SYEA 2KJXA 1ICFB 3K5MA 2NN6H 4L5TA 1ZYRD 4XIGS 3RNUA 3F2UA 1CZWA 3I3CA 4FF1A 3SEBA 1AZPA 4DXFA 3HG9A 4GKJQ 3KF8B 1HZCA 3U4VA 4HMJA 4KKTA 3R2TA 1EUJA 1RD9D 4CKCA 1B4OA 3HOUG 1GOZA 3X3MA 4LF5L 2EIFA 3CMEA 1I94L 4MN3A 2LSSA 1HPCA 4A3EB 3CPWA 1VQCA 4N8X1 4A3LG 4O0AA 3K59A 4A3KH 2JYOA 4ZLTF 2YV5A 4OO1H 1ILQA 2KHSA 5C3EG 2BE5D 4DAYA 1Z7TA 1YHAA 3TEHB 2R7ZH 3GTOH 1SDFA 1T5XD 2JA6H 3J80L 2NUCA 3CCSA 4DU9A 5A2QE 3GQBA 5CV4A 1N34Q 1KLUD 1RTNA 4PG3A 4K8IA 1EWIA 3P20A 1FNVA 1QB5D 1SMYD 4IZ8A 2F0JA 1EOVA 1ENCA 3GO5A 3P75A 3URYA 4HJAA 3M7GA 2Z6KA 1STBA 4LF8L 3HOUB 5D14A 3GTLH 1UNSA 2EYJA 1K8OA 1O7LA 3W1GA 1L0WA 5JVG3 4JI3L 2E76C 3K57A 1IBKQ 1IBLL 4YWKA 4KN7C 1VF5C 5C3EB 4JI8L 2L4NA 4DV4Q 1B3QA 5C44G 3MFYA 3PO2H 3EROA 4A3JG 4LK1C 5CORA 2RDGA 3CU7A 1B44D 5C5LA 3K81C 4IURA 2XGTA 3UDFA 2AQ1B 3GTGB 2ICEC 2FXQA 4A76A 3MXNB 4RCNA 3PF5A 2Z0SA 1TS2A 1V9PA 5EKIA 2JA5H 2IX1A 2WAQG 3CCUA 3ND8A 2M2LA 1DOLA 3VR2A 2N8NA 3MXGA 1K3RA 3U58A 1N33L 2MJ8A 4DR6L 5C44B 1ASYA 2MHVA 2KHJA 3A7LA 1TWAB 2QCPX 4KTAA 4A3JB 1OXSC 2IHFA 1BCPC 1NCVA 2BCOA 3SR1A 4U68A 1SJED 1GVPA 2UU9L 3B6YA 1SYCA 1GO3E 1PMRA 2NTSA 4B08A 3SHLA 3W1BA 3G71A 3F2CA 4GOPB 1I4PA 4DR7Q 1J9OA 5KIXA 2D2CC 5E7NA 5M3FH 4JI1L 3NBHA 2WAQB 4KI0A 5NUCA 2K28A 4GKKQ 3H0GG 4PMWA 2JA7G 4H13C 1I4GA 1DXMA 3OTOQ 2UUAQ 4Y7NH 2I5MX 3SVMA 2C5CA 1PTOB 4NMZA 2X69A 3CPFA 1JICA 2VS1A 2IPKD 5IT9c 4LF7Q 2I5LX 1FR3A 3CF5A 1V1QA 1Y8PB 1A6XA 3HP3A 4IFDJ 4IN3A 1SAPA 4KD3A 2HIXA 3TP6A 3K58A 1J5EQ 1MJEA 2XSCA 4P73A 2F0GA 1MSGA 1RF2D 1Y14B 2RHSB 3J81E 2E2IH 3PO3H 1JWMD 3H0GB 2JA7B 1BVSA 4AYBG 1TS4A 4JPBW 1GD7A 3A56A 1QVCA 1XNRL 4C1NK 2PPBC 4DUZL 2Z6KC 2H1EA 1N36L 3I72A 4F8MA 1K28A 4A3BG 1DOMA 1RKNA 3QB3A 3TQYA 3HOXG 4A3CH 4B9XA 3H94A 1NJIC 1C9OA 3TDQA 1WOCA 4YCVA 1KAWA 3N52A 1WTOA 5IGEA 3RN2A 1PA6A 2A6HD 1LM0A 2PCFB 4LJZC 1U4LA 1UE7A 1X3QA 2K4KA 2RDHA 1STEA 4HTHA 1KRTA 2L11A 3RZOB 3PIPA 3J7AF 2IJ0A 1R9TH 5D65A 4AYBB 3F2DA 1H9MA 1K73C 5IYBG 3IKJA 2H4OA 4U673 4JI4L 3Q24A 3W2DA 1PZKD 3RD4A 1V8QA 1LTAD 2CW0D 1Q82C 1O78A 1HNWQ 3KUPA 4A3BB 5IWAL 3G4SA 1XJVA 3HOXB 1MKHA 1G2TA 3STBD 3I56A 1DM0B 2R61A 4RHRA 2R93G 1KDAA 1S5ED 5HURA 4Y52H 1PV4A 3NK9A 1WJJA 1HQRD 1PH9A 1K8MA 2D62A 1KTKA 2KENA 4P72A 1MBYA 4R4IA 3HOUH 2F0QA 1Q1BA 2F0UA 5L37A 1ET6A 3NTKA 1VQNA 1SE3A 3NQTA 2JA9A 4DR3L 1I94Q 2IWHA 2HCCA 3MVVA 3QOJA 4P71A 4A3DG 1SN8A 1QOHA 2CFMA 2R93B 3HOWG 4FVMA 3S1QB 2IHEA 3BS1A 2B29A 3BVGA 1XMQQ 2SDFA 4TKOB 1BBUA 2F03A 2NVTH 1PXUA 4DV1L 4M8AA 1JMCA 1G51A 4N9PA 1HNXQ 1D8LA 1ENFA 1N32L 3HOZG 3OW7A 1CFMA 3OIQA 2F3WA 4DV7Q 1YZ6A 4DV5L 1UE6A 1YNND 1D5MC 2MNAA 4JBMA 2X6GA 3DWAA 3BDLA 3NUCA 2NVXB 4R8NA 3KFUA 4IO9A 4A3DB 1I3QH 1IBLQ 3S2HH 2DUDA 3T1YL 4JI6L 1PFSA 3P1HA 3HOWB 1TWCH 4ODGA 2F0WA 2ZT9C 2IL8A 4KHZA 4EX5A 4OX9Q 4DR4Q 1YIJA 1PH7A 2F0EA 4L5RC 1WTPA 1DYQA 4L8JA 3QJYA 4DAVA 3UE1A 1VQIA 3W5OA 5KRUA 4XYQA 2EXDA 2E2JH 3HOZB 1AW7A 3RLOA 5I9PA 4OHJA 1B3AA 1KHIA 5I9OA 2OT2A 2X6LA 1F9RA 1QUQB 4DK0A 2KHIA 5ELDA 1SR3A 1JWSD 4B3SL 2PNHA 4DR6Q 4IUPA 1IKMA 3Q23A 5BN5A 2A68D 2XWBB 5C0XH 5JEAH 1GHKA 3GTQH 4J8QA 1I6HH 2A1AA 4JI0Q 2EJMA 2N88A 1DD2A 1KXLA 4UPAA 1M4VA 4YCWA 1FJGQ 1RODA 3S16B 2WFWA 1CK1A 3H91A 3HGBA 3IRBA 3T51B 1KIXA 2A69C 1VF7A 1H9SA 4KJNA 4RGOS 2D0PA 3PUXA 4B9WA 2KA7A 5EQ0A 1EQRA 5M3MH 2B2TA 1KAAA 4WFN3 4X3SA 3WDNA 3N6RA 2QA4A 4WORA 2M00A 3ER0A 2SNSA 1J8IA 2XRSD 2ZM6Q 1UEAB 3SXHA 4OELB 5LMUL 2I07B 1SMXA 2ASBA 3RUZA 5CV9A 2VNUD 2G9HD 4GN3B 5IP9H 2EYHA 2E8GA 2R7DA 1GJXA 2N49A 3DEOA 4HIKA 3OWFA 4A3FG 2NZHA 4CBVA 4MHEA 4KV6A 4OGQC 4BXXG 4GLAC 3NXWA 4XQQA 5LMNW 1SSOA 1JJGA 1Q90A 2A6EC 4RFBA 5A2QL 3L0OA 4HIOA 1LO5D 4P74A 4LWCA 2XVSA 4G7OC 2EPBA 1HZ9A 4PMBA 4DUZQ 2JQOA 4A4IA 1K8GA 2HHHL 1I6VC 1YNXA 1N36Q 4V0BA 3A8KE 4HAEA 2UXBQ 3E5SA 4EQ5A 5I4DA 1S5BD 4YIJA 3CCQA 1BBXC 1YJNA 2QGQA 1EQQA 5D3DA 4G57A 4YHHQ 2A5HA 2PZTA 2VXWA 1MHWC 5LMNL 4B3TL 3D4RA 1B50A 3HKSA 4FO2A 2JA8G 5IT9E 4BWGB 3OHXC 2AUJD 2EJGC 2K52A 2B63B 3KLSA 4A3FB 1AN8A 4FF3A 4LMQD 1F77A 4AH6A 1BF4A 4NDXA 1O80A 3EFXD 1IZ6A 4QL5A 1E2WA 1VCIA 5AJ3L 4G7ZC 2R93H 1WD0A 4MIUA 2UUBL 4LFCL 5IWAQ 2RHQB 4KHVA 3K8AA 1IYVA 1D1IA 3U50C 3S1QH 3ERSX 2FFKB 4LNQA 1G8ZD 2EY1A 1EYAA 4TSSA 4A3MH 2JSOA 5ELFA 3M4PA 2R92H 2JA8B 2YTYA 3FHWA 1LTLA 3I55A 2PZWA 4LAAA 1XNQL 5KNBA 4PQXA 3G6JB 3C2PA 3S1NH 4A3GH 4RCOA 5K36G 4XXEA
chains in the Genus database with same CATH topology
4QIWE 1YHAA 3TEHB 1Y1VG 3BZCA 1K0RA 2R7ZH 3GTOH 3I4NG 2JA6H 3H3VI 3CCSA 3KDFA 2GVAA 5IYCG 5ELNA 3PV0A 4B3MQ 3ICEA 2CCZA 3T1HL 4MNOA 3NEMA 4DV2Q 1N34Q 3F1ZA 2UXBL 1VQFA 4DKAC 1KC8C 1K8GA 2KBNA 4PG3A 4YCUA 3U4ZA 4DR3Q 1EWIA 2UU9Q 3HKZG 4DR5L 1FGUA 3HOWH 1EOVA 4K0KL 3KOJA 1YJ9A 3GO5A 4YHHL 4R1JA 4HJAA 2IY5B 2Z6KA 1B70B 2PMZE 3H0GH 4LF4Q 4LF8L 1VQKA 2JA7H 3GTLH 4QJFA 1JJCB 5IE8A 1MJCA 3W1GA 4PZ8A 1L0WA 1X6OA 5IYDG 4JI1Q 1Q46A 5C4XH 4JI3L 1E7ZA 1MIUA 4OWTB 3F8TA 4R4OA 1IBKQ 1IBLL 2E5LL 4YWKA 1KD1C 4IPGA 1LUZA 5C4JH 1QVFA 3CC4A 1OTCA 3K7UC 1JB7A 2N3SA 4JI8L 3TRZA 2JEBI 4DV1Q 4DV4Q 4YY3L 2MFIA 1QZHA 5C44G 1EFWA 3I4MH 3DM3A 2UXDL 1VQDA 3I7FA 2R6GA 1IYJB 3PO2H 1RL2A 3ULJA 4A3JG 3S1MH 5EAYA 4WJ3M 4HIDA 3OYYA 2NN6G 4X66Q 2GN5A 3K81C 4DNIA 4GKJL 2XGTA 1WFQA 3UDFA 2FXQA 4A76A 3MXNB 3HOVH 3PF5A 1UE5A 4YWMA 1VQ7A 2VQEQ 2Z0SA 1P8LA 2Q2HA 2AWOA 4DR2Q 3HKZE 3E9HA 1V9PA 4MZ9A 1XMOL 5H1SE 2WB1E 3CCLA 3AFQA 3RZOH 1PH3A 2JA5H 2IX1A 2WAQG 3CCUA 4OWWB 2CKZB 3HFZB 4LF9L 2VUMH 2IX0A 2JK8A 4A3MG 2BH8A 4RG1A 1VQ6A 1GM5A 1Z47A 3CC2A 2N8NA 1N33L 1K3RA 3PGZA 3U58A 2R92G 2RCNA 2OTJA 4A3KG 3M3YH 1O7IA 4DR6L 4A3BH 1Q8KA 4HJ5A 4BA1I 1ASYA 4DAYB 4DV3Q 1XNRQ 2GVBA 2KHJA 3HOXH 4B3ML 1EIYB 2RF4A 3H15A 1X56A 4A3GG 4OO1G 1L1OB 1OXSC 2IHFA 3KDFB 2R7ZG 3K7AH 1FVIA 4HJ9A 1DGSA 2JJQA 4HJ8A 2JA6G 1PYBA 2UU9L 1GVPA 2HT1A 3B6YA 4BBRH 4GLXA 4IOCA 1GO3E 1XPOA 4QQBX 3W1BA 3J81i 2VY3A 3G71A 4NXMQ 2JEAI 4TQUS 1V43A 3F2CA 2QEXA 4GOPB 2L15A 4DR7Q 1N9WA 4DK3C 1VQJA 1NE3A 1E1OA 3SGIA 4B3SQ 5E7NA 4A75A 2MQHA 4JI1L 5M3FH 4KI0A 2ES2A 1UEBA 3GD7A 1PH2A 4NXNQ 3KJPA 2ZJPA 4GKKQ 1IBKL 3H0GG 5IYBH 4PMWA 2JA7G 2K50A 4KHPQ 1CKMA 3KYHC 4GNXB 2YTVA 4A3IH 2ZTCA 5FLXc 3TS2A 1VQHA 3OTOQ 4DV4L 2UUAQ 5C4XG 2AHOB 3UDXA 4Y7NH 2I5MX 2YTXA 4LUOA 2OWOA 4JI4Q 2XTIA 3CPFA 1HH2P 1X3GA 2VS1A 3AYHB 4PZ7A 5IT9c 4LF7Q 2I5LX 5GAGC 1PVOA 4X64Q 3I4MG 1HR0Q 5HY6A 3GTMH 1EIFA 1LYLA 3CF5A 2BH2A 4DV0L 1V1QA 3PO2G 4UP7A 1XTDA 3AFPA 3F2BA 4LFAL 4DR2L 4YWLA 1YJWA 4IFDJ 4IFDG 4GN5A 2HIXA 4GN4B 3JAMc 4X65Q 1YBYA 1J5EQ 3CC7A 1EYGA 4DV6Q 1MJEA 1JE5A 2OTLA 3HOVG 4P73A 1Y14B 2Y0SG 2PQAA 1E3PA 2RHSB 4P75A 4LW1A 2E2IH 3PO3H 4NB3A 2VZAA 1AE3A 3JC66 3STBC 5M5WH 2JA5G 2NVQH 3PCOB 2LXKA 3M85A 1BVSA 4AYBG 2VL6A 2VUMG 3ULLA 1GD7A 4UY8C 1L1OA 1QVCA 2E2HH 1XNRL 5FLMH 3E9IA 2B63H 4DUZL 2Z6KC 3VDYA 1YITA 2NVXH 5DLQE 2ATWA 1N36L 4A3DH 1XPUA 4AQYQ 4A3BG 3TQYA 1HZBA 3M4OH 4UP9A 3GTPH 3HOXG 4GOPA 3FP9A 3EIVA 4A3CH 1NJIC 1C9OA 4IOAA 3GTKH 2MO0A 4DR7L 1K83H 1I50H 1WOCA 4YCVA 4DUYQ 1KAWA 1VQMA 3RN2A 4BBRG 1PA6A 1HR0W 1PH6A 1LM0A 3BJUA 3H3VH 1UE7A 3PSIA 2K4KA 1L2FA 4JV5L 2UXCL 4GNXA 4C3IH 1JJ2A 2HHHQ 3NBHB 1KRTA 3AEVA 3PIPA 3OTOL 5M3FG 2Y0SE 1NMGA 1Q7YC 3RR5A 2UUAL 4A93H 3HOZH 1T9HA 3F2DA 1R9TH 1K73C 5IYBG 4R4CA 2BA1A 3G6EA 4LF6L 4JI4L 1W3SA 3EN2A 4A3IG 3CAMA 1N32Q 1Q82C 3M9BA 1HNWQ 1Q12A 4X64L 1HR0L 1SFOH 1SLJA 5IWAL 3G4SA 1XJVA 3RN5A 4DV5Q 1PH5A 4DR1Q 1MKHA 3NENA 4JOIA 2PI2E 3STBD 3KF6B 3I56A 4DAMA 4DK6C 4BA2I 2R93G 3EBEA 2VQFL 4Y52H 1PV4A 3KLWA 1WJJA 1CUKA 2H5XA 4DV6L 3T1YQ 3ULPA 4JI6Q 1YVCA 1CSPA 4X62Q 1PH9A 1WCMH 2OQ0A 1X9NA 4BBSH 2UUCQ 4JYAQ 1HZAA 3PUWA 2D62A 1OXTA 4IPHA 4TVAB 5JJKA 2KENA 4LUVA 4OWXB 4P72A 2PQAB 4R4IA 4UP8A 1HJPA 4C3JH 4BY1H 3S16H 3HOUH 4AIMA 4POFA 3J81j 1Q1EA 1Q1BA 1PHJA 1XPRA 1X3EA 4LFCQ 1VQ8A 3PO3G 1VQ9A 3CCVA 1K9MC 1Y1WH 2F52A 4BY7H 4DV2L 1M90C 2Q2TA 1N34L 3G48A 1VQNA 3NELA 2JA9A 4DR3L 1I94Q 5FLMG 4DPGA 1J6QA 2B63G 3JAMi 2F4VQ 3S17H 4P71A 1HNZQ 3I4NH 4A3DG 1SN8A 2CFMA 4LF4L 1FL0A 4A3CG 3HOWG 1N8RC 2K14A 2KCTA 2IHEA 4NPSA 1KQSA 4QGUA 4B3RQ 2B29A 1XMQQ 3J80c 3DLLA 1BBUA 2WAQE 1X3FA 1AH9A 2NVTH 4JI7Q 3TREA 4DV1L 2K5NA 2NZOA 5FJ8H 2ZJQA 1JMCA 1TWFH 3HOYH 5GAEC 2NN6I 4DR5Q 1ASZA 1H95A 1G51A 1HNXQ 1D8LA 3J7A5 1N32L 1HNWL 4A93G 1NTGA 4X66L 3HOZG 1QVGA 4DV7Q 2YU9H 3K80C 1VS0A 1YZ6A 1NMFA 3KF6A 4DV5L 1UE6A 2MNAA 4DR1L 2ZTEA 4JBMA 4JI5Q 1VQAA 4J15A 2VQEL 4IJHA 4IPCA 3CCRA 3KFUA 4IO9A 2BA0A 1I3QH 2E5LQ 1IBLQ 3S2HH 5JJIA 2DUDA 3PUYA 3T1YL 2LXJA 2R7FA 1L1OC 1PFSA 3RLNA 4JI6L 4X62L 2VW9A 1TWCH 3BU2A 2UXDQ 1UWVA 1AE2A 1C7YA 2UUCL 1WI5A 2AWNA 1TWGH 4JI2Q 4KHZA 4EX5A 3S1RH 4OX9Q 2ZJRA 4LFBQ 1BBWA 1PH8A 1B8AA 3CD6A 2AMCB 4DR4Q 1YIJA 1VQPA 4ME3A 4QY7A 5LMUQ 5J3BA 1PH7A 5IP7H 4GOPC 1WCMG 4L5RC 4BBSG 4OO1I 3A5ZB 1SE8A 1RIPA 4ALPA 3FKIH 4IPDA 5BR8Q 4DV3L 2JE6I 1YI2A 2Q2UA 3UE1A 1VQIA 3W5OA 4RMFA 5C0XI 4BY1G 4A3FH 1OXXK 1Q81C 1IL2A 4BXXH 2CWPA 2EXDA 2E2JH 3AQQA 4L5QA 3RLOA 1CSQA 3J81c 1K8AC 5IY0A 1Y1WG 4GNXC 4C2MH 1VQLA 4NXML 4BY7G 1KHIA 1HNZL 1NY4A 2B3GA 1VQEA 2K5HA 2WP8J 1QZGA 1QUQB 2KHIA 5M5XH 4FDBA 1S3OA 3E0EA 1S40A 1SR3A 1OXVA 4B3SL 2PNHA 4R4QA 4DR6Q 3GDEA 2HQLA 4NXNL 1PH1A 3S14H 4GKKL 1YHBA 4B3RL 2N78A 1XMQL 4KHPL 1JT8A 1KL9A 3GTQH 4OXPA 4XTCS 1I6HH 2I5HA 2C35B 3D31A 2A1AA 2AKWB 4JI0Q 4JI7L 3I4OA 1BKBA 1X54A 4GS3A 3RLFA 4JOIC 1M1KC 2JA8H 1KXLA 4UPAA 3PIOA 2WB1G 4LUZA 4A3EH 1KRSA 1HNXL 4YCWA 1FJGQ 4LF7L 1C0AA 4AYBE 1NBWA 4JC0A 3UE0A 5LMNQ 1VQ5A 2WFWA 5FJ8G 4DV7L 4B3TQ 1SRUA 1W2BA 3IRBA 3CCEA 3HOYG 4GLVB 5GADC 2OQKA 4JI5L 1KIXA 4IFDI 2D0PA 3D0FA 3PUXA 1CKNB 1EQRA 5M3MH 1SROA 1VQBA 3J80i 5ELOA 4X65L 1J5EL 1WYDA 2QA4A 3PF4A 3L2PA 3ER0A 5M5YH 5GQOA 4H02A 2ZM6Q 4JI2L 2CWAA 3PUVA 1G6PA 4OX9L 4LFBL 2A8VA 4OONA 4KLKA 4DR4L 3S24A 5AJ3Q 5LMUL 1P16A 4JBWA 3RZDH 1CKOA 1SMXA 1B7YB 5BR8L 3UDGA 2UUBQ 2ASBA 4DV0Q 3LGJA 2VNUD 4LFAQ 4A3LH 4GN3B 5IP9H 5IP7G 4O2DA 2F3IA 2E8GA 4AQYL 4LF5Q 3OW2A 2R7DA 3A74A 3FKIG 3A5UA 2K5VA 2N49A 1S72A 1U0LA 5C3EH 1Q86C 1QUQA 4HIKA 4JBKA 2K75A 2NZHA 4A3FG 4HJ7A 1Y1VH 1UE1A 4JCVE 1XNQQ 4BXXG 1PYSB 4HIMA 1I5FA 1D7QA 4GLAC 4DUYL 1X65A 5LMNW 5IYCH 1JJGA 1A8VA 5GAHC 1IBMQ 3L0OA 4HIOA 4P74A 4L5SA 4LWCA 3CXCA 3GTGH 2HHHL 1HZ9A 2A19A 2JQOA 1U5KA 1VQGA 3UDIA 4A4IA 3KJOA 3L7ZC 4DUZQ 1YNXA 1TXYA 4JI0L 3T1HQ 4C3HH 1N36Q 3M4QA 3BZKA 2HIVA 2UXBQ 2ALYB 5C0XJ 5JEAJ 4EQ5A 1E24A 5JEAG 5C0XG 4X6AH 3GTJH 4POGA 2MO1A 1A63A 4JBJA 3CCQA 1YJNA 1TWHH 2QGQA 1FJGL 1EQQA 4K0KQ 2NVYH 3I2ZA 5IYDH 4YHHQ 3TS0A 4APVA 5LMNL 4B3TL 3S15H 4PZ6A 3HKSA 4LF8Q 2JA8G 1Z9FA 1E22A 4A3EG 1GKHA 3CP0A 5GROA 2YYZA 1YEZA 1YHQA 1CKNA 2K52A 2KCMA 2V1CC 3A0JA 4JV5Q 5C44H 2UXCQ 2D0OA 4JI3Q 2IT1A 4IJLA 1TWAH 2ID0A 4AH6A 3CCMA 1VQ4A 4A3JH 2I0QA 1A62A 1PH4A 4JI8Q 1IZ6A 2ZM6L 4L5TA 4YY3Q 3PUZA 1A0IA 4XIGS 2ZTDA 4QL5A 5HGQA 5M3MG 4JYAL 2EQSA 4R4TA 3RNUA 4LF6Q 2PI2A 1VCIA 5AJ3L 4MTNA 3S2DH 2R93H 3ZJYC 1G291 4JG2A 1IXRA 2UUBL 4LFCL 5IWAQ 2RHQB 1E1TA 4GKJQ 3K8AA 3KF8B 1HZCA 3U4VA 3U50C 3S1QH 3ERSX 2Q2IA 4LNQA 3M7NA 1EUJA 2OCEA 3CMAA 3J7ZC 3HOUG 4LF5L 4A3MH 2EIFA 3CMEA 3MEFA 2VQFQ 1VQOA 1I94L 1XMOQ 3M4PA 3CQZH 2LSSA 2R92H 3Q8DA 2F4VL 3CPWA 1VQCA 2YTYA 3CW2C 3CCJA 3FHWA 1LTLA 4O0AA 5IP9G 2DGYA 3I55A 4A3KH 1XNQL 4A3LG 4LF9Q 2CQOA 3WWVA 4WJ4A 3S1NH 5JJLA 4A3GH 1X55A 2YV5A 1N33Q 5K36G 5C3EG 1OXUA 1IBML 3K0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QIW E;  1YHA A;  3TEH B;  1Y1V G;  3BZC A;  1K0R A;  2R7Z H;  3GTO H;  3I4N G;  2JA6 H;  3H3V I;  3CCS A;  3KDF A;  2GVA A;  5IYC G;  5ELN A;  3PV0 A;  4B3M Q;  3ICE A;  2CCZ A;  3T1H L;  4MNO A;  3NEM A;  4DV2 Q;  1N34 Q;  3F1Z A;  2UXB L;  1VQF A;  4DKA C;  1KC8 C;  1K8G A;  2KBN A;  4PG3 A;  4YCU A;  3U4Z A;  4DR3 Q;  1EWI A;  2UU9 Q;  3HKZ G;  4DR5 L;  1FGU A;  3HOW H;  1EOV A;  4K0K L;  3KOJ A;  1YJ9 A;  3GO5 A;  4YHH L;  4R1J A;  4HJA A;  2IY5 B;  2Z6K A;  1B70 B;  2PMZ E;  3H0G H;  4LF4 Q;  4LF8 L;  1VQK A;  2JA7 H;  3GTL H;  4QJF A;  1JJC B;  5IE8 A;  1MJC A;  3W1G A;  4PZ8 A;  1L0W A;  1X6O A;  5IYD G;  4JI1 Q;  1Q46 A;  5C4X H;  4JI3 L;  1E7Z A;  1MIU A;  4OWT B;  3F8T A;  4R4O A;  1IBK Q;  1IBL L;  2E5L L;  4YWK A;  1KD1 C;  4IPG A;  1LUZ A;  5C4J H;  1QVF A;  3CC4 A;  1OTC A;  3K7U C;  1JB7 A;  2N3S A;  4JI8 L;  3TRZ A;  2JEB I;  4DV1 Q;  4DV4 Q;  4YY3 L;  2MFI A;  1QZH A;  5C44 G;  1EFW A;  3I4M H;  3DM3 A;  2UXD L;  1VQD A;  3I7F A;  2R6G A;  1IYJ B;  3PO2 H;  1RL2 A;  3ULJ A;  4A3J G;  3S1M H;  5EAY A;  4WJ3 M;  4HID A;  3OYY A;  2NN6 G;  4X66 Q;  2GN5 A;  3K81 C;  4DNI A;  4GKJ L;  2XGT A;  1WFQ A;  3UDF A;  2FXQ A;  4A76 A;  3MXN B;  3HOV H;  3PF5 A;  1UE5 A;  4YWM A;  1VQ7 A;  2VQE Q;  2Z0S A;  1P8L A;  2Q2H A;  2AWO A;  4DR2 Q;  3HKZ E;  3E9H A;  1V9P A;  4MZ9 A;  1XMO L;  5H1S E;  2WB1 E;  3CCL A;  3AFQ A;  3RZO H;  1PH3 A;  2JA5 H;  2IX1 A;  2WAQ G;  3CCU A;  4OWW B;  2CKZ B;  3HFZ B;  4LF9 L;  2VUM H;  2IX0 A;  2JK8 A;  4A3M G;  2BH8 A;  4RG1 A;  1VQ6 A;  1GM5 A;  1Z47 A;  3CC2 A;  2N8N A;  1N33 L;  1K3R A;  3PGZ A;  3U58 A;  2R92 G;  2RCN A;  2OTJ A;  4A3K G;  3M3Y H;  1O7I A;  4DR6 L;  4A3B H;  1Q8K A;  4HJ5 A;  4BA1 I;  1ASY A;  4DAY B;  4DV3 Q;  1XNR Q;  2GVB A;  2KHJ A;  3HOX H;  4B3M L;  1EIY B;  2RF4 A;  3H15 A;  1X56 A;  4A3G G;  4OO1 G;  1L1O B;  1OXS C;  2IHF A;  3KDF B;  2R7Z G;  3K7A H;  1FVI A;  4HJ9 A;  1DGS A;  2JJQ A;  4HJ8 A;  2JA6 G;  1PYB A;  2UU9 L;  1GVP A;  2HT1 A;  3B6Y A;  4BBR H;  4GLX A;  4IOC A;  1GO3 E;  1XPO A;  4QQB X;  3W1B A;  3J81 i;  2VY3 A;  3G71 A;  4NXM Q;  2JEA I;  4TQU S;  1V43 A;  3F2C A;  2QEX A;  4GOP B;  2L15 A;  4DR7 Q;  1N9W A;  4DK3 C;  1VQJ A;  1NE3 A;  1E1O A;  3SGI A;  4B3S Q;  5E7N A;  4A75 A;  2MQH A;  4JI1 L;  5M3F H;  4KI0 A;  2ES2 A;  1UEB A;  3GD7 A;  1PH2 A;  4NXN Q;  3KJP A;  2ZJP A;  4GKK Q;  1IBK L;  3H0G G;  5IYB H;  4PMW A;  2JA7 G;  2K50 A;  4KHP Q;  1CKM A;  3KYH C;  4GNX B;  2YTV A;  4A3I H;  2ZTC A;  5FLX c;  3TS2 A;  1VQH A;  3OTO Q;  4DV4 L;  2UUA Q;  5C4X G;  2AHO B;  3UDX A;  4Y7N H;  2I5M X;  2YTX A;  4LUO A;  2OWO A;  4JI4 Q;  2XTI A;  3CPF A;  1HH2 P;  1X3G A;  2VS1 A;  3AYH B;  4PZ7 A;  5IT9 c;  4LF7 Q;  2I5L X;  5GAG C;  1PVO A;  4X64 Q;  3I4M G;  1HR0 Q;  5HY6 A;  3GTM H;  1EIF A;  1LYL A;  3CF5 A;  2BH2 A;  4DV0 L;  1V1Q A;  3PO2 G;  4UP7 A;  1XTD A;  3AFP A;  3F2B A;  4LFA L;  4DR2 L;  4YWL A;  1YJW A;  4IFD J;  4IFD G;  4GN5 A;  2HIX A;  4GN4 B;  3JAM c;  4X65 Q;  1YBY A;  1J5E Q;  3CC7 A;  1EYG A;  4DV6 Q;  1MJE A;  1JE5 A;  2OTL A;  3HOV G;  4P73 A;  1Y14 B;  2Y0S G;  2PQA A;  1E3P A;  2RHS B;  4P75 A;  4LW1 A;  2E2I H;  3PO3 H;  4NB3 A;  2VZA A;  1AE3 A;  3JC6 6;  3STB C;  5M5W H;  2JA5 G;  2NVQ H;  3PCO B;  2LXK A;  3M85 A;  1BVS A;  4AYB G;  2VL6 A;  2VUM G;  3ULL A;  1GD7 A;  4UY8 C;  1L1O A;  1QVC A;  2E2H H;  1XNR L;  5FLM H;  3E9I A;  2B63 H;  4DUZ L;  2Z6K C;  3VDY A;  1YIT A;  2NVX H;  5DLQ E;  2ATW A;  1N36 L;  4A3D H;  1XPU A;  4AQY Q;  4A3B G;  3TQY A;  1HZB A;  3M4O H;  4UP9 A;  3GTP H;  3HOX G;  4GOP A;  3FP9 A;  3EIV A;  4A3C H;  1NJI C;  1C9O A;  4IOA A;  3GTK H;  2MO0 A;  4DR7 L;  1K83 H;  1I50 H;  1WOC A;  4YCV A;  4DUY Q;  1KAW A;  1VQM A;  3RN2 A;  4BBR G;  1PA6 A;  1HR0 W;  1PH6 A;  1LM0 A;  3BJU A;  3H3V H;  1UE7 A;  3PSI A;  2K4K A;  1L2F A;  4JV5 L;  2UXC L;  4GNX A;  4C3I H;  1JJ2 A;  2HHH Q;  3NBH B;  1KRT A;  3AEV A;  3PIP A;  3OTO L;  5M3F G;  2Y0S E;  1NMG A;  1Q7Y C;  3RR5 A;  2UUA L;  4A93 H;  3HOZ H;  1T9H A;  3F2D A;  1R9T H;  1K73 C;  5IYB G;  4R4C A;  2BA1 A;  3G6E A;  4LF6 L;  4JI4 L;  1W3S A;  3EN2 A;  4A3I G;  3CAM A;  1N32 Q;  1Q82 C;  3M9B A;  1HNW Q;  1Q12 A;  4X64 L;  1HR0 L;  1SFO H;  1SLJ A;  5IWA L;  3G4S A;  1XJV A;  3RN5 A;  4DV5 Q;  1PH5 A;  4DR1 Q;  1MKH A;  3NEN A;  4JOI A;  2PI2 E;  3STB D;  3KF6 B;  3I56 A;  4DAM A;  4DK6 C;  4BA2 I;  2R93 G;  3EBE A;  2VQF L;  4Y52 H;  1PV4 A;  3KLW A;  1WJJ A;  1CUK A;  2H5X A;  4DV6 L;  3T1Y Q;  3ULP A;  4JI6 Q;  1YVC A;  1CSP A;  4X62 Q;  1PH9 A;  1WCM H;  2OQ0 A;  1X9N A;  4BBS H;  2UUC Q;  4JYA Q;  1HZA A;  3PUW A;  2D62 A;  1OXT A;  4IPH A;  4TVA B;  5JJK A;  2KEN A;  4LUV A;  4OWX B;  4P72 A;  2PQA B;  4R4I A;  4UP8 A;  1HJP A;  4C3J H;  4BY1 H;  3S16 H;  3HOU H;  4AIM A;  4POF A;  3J81 j;  1Q1E A;  1Q1B A;  1PHJ A;  1XPR A;  1X3E A;  4LFC Q;  1VQ8 A;  3PO3 G;  1VQ9 A;  3CCV A;  1K9M C;  1Y1W H;  2F52 A;  4BY7 H;  4DV2 L;  1M90 C;  2Q2T A;  1N34 L;  3G48 A;  1VQN A;  3NEL A;  2JA9 A;  4DR3 L;  1I94 Q;  5FLM G;  4DPG A;  1J6Q A;  2B63 G;  3JAM i;  2F4V Q;  3S17 H;  4P71 A;  1HNZ Q;  3I4N H;  4A3D G;  1SN8 A;  2CFM A;  4LF4 L;  1FL0 A;  4A3C G;  3HOW G;  1N8R C;  2K14 A;  2KCT A;  2IHE A;  4NPS A;  1KQS A;  4QGU A;  4B3R Q;  2B29 A;  1XMQ Q;  3J80 c;  3DLL A;  1BBU A;  2WAQ E;  1X3F A;  1AH9 A;  2NVT H;  4JI7 Q;  3TRE A;  4DV1 L;  2K5N A;  2NZO A;  5FJ8 H;  2ZJQ A;  1JMC A;  1TWF H;  3HOY H;  5GAE C;  2NN6 I;  4DR5 Q;  1ASZ A;  1H95 A;  1G51 A;  1HNX Q;  1D8L A;  3J7A 5;  1N32 L;  1HNW L;  4A93 G;  1NTG A;  4X66 L;  3HOZ G;  1QVG A;  4DV7 Q;  2YU9 H;  3K80 C;  1VS0 A;  1YZ6 A;  1NMF A;  3KF6 A;  4DV5 L;  1UE6 A;  2MNA A;  4DR1 L;  2ZTE A;  4JBM A;  4JI5 Q;  1VQA A;  4J15 A;  2VQE L;  4IJH A;  4IPC A;  3CCR A;  3KFU A;  4IO9 A;  2BA0 A;  1I3Q H;  2E5L Q;  1IBL Q;  3S2H H;  5JJI A;  2DUD A;  3PUY A;  3T1Y L;  2LXJ A;  2R7F A;  1L1O C;  1PFS A;  3RLN A;  4JI6 L;  4X62 L;  2VW9 A;  1TWC H;  3BU2 A;  2UXD Q;  1UWV A;  1AE2 A;  1C7Y A;  2UUC L;  1WI5 A;  2AWN A;  1TWG H;  4JI2 Q;  4KHZ A;  4EX5 A;  3S1R H;  4OX9 Q;  2ZJR A;  4LFB Q;  1BBW A;  1PH8 A;  1B8A A;  3CD6 A;  2AMC B;  4DR4 Q;  1YIJ A;  1VQP A;  4ME3 A;  4QY7 A;  5LMU Q;  5J3B A;  1PH7 A;  5IP7 H;  4GOP C;  1WCM G;  4L5R C;  4BBS G;  4OO1 I;  3A5Z B;  1SE8 A;  1RIP A;  4ALP A;  3FKI H;  4IPD A;  5BR8 Q;  4DV3 L;  2JE6 I;  1YI2 A;  2Q2U A;  3UE1 A;  1VQI A;  3W5O A;  4RMF A;  5C0X I;  4BY1 G;  4A3F H;  1OXX K;  1Q81 C;  1IL2 A;  4BXX H;  2CWP A;  2EXD A;  2E2J H;  3AQQ A;  4L5Q A;  3RLO A;  1CSQ A;  3J81 c;  1K8A C;  5IY0 A;  1Y1W G;  4GNX C;  4C2M H;  1VQL A;  4NXM L;  4BY7 G;  1KHI A;  1HNZ L;  1NY4 A;  2B3G A;  1VQE A;  2K5H A;  2WP8 J;  1QZG A;  1QUQ B;  2KHI A;  5M5X H;  4FDB A;  1S3O A;  3E0E A;  1S40 A;  1SR3 A;  1OXV A;  4B3S L;  2PNH A;  4R4Q A;  4DR6 Q;  3GDE A;  2HQL A;  4NXN L;  1PH1 A;  3S14 H;  4GKK L;  1YHB A;  4B3R L;  2N78 A;  1XMQ L;  4KHP L;  1JT8 A;  1KL9 A;  3GTQ H;  4OXP A;  4XTC S;  1I6H H;  2I5H A;  2C35 B;  3D31 A;  2A1A A;  2AKW B;  4JI0 Q;  4JI7 L;  3I4O A;  1BKB A;  1X54 A;  4GS3 A;  3RLF A;  4JOI C;  1M1K C;  2JA8 H;  1KXL A;  4UPA A;  3PIO A;  2WB1 G;  4LUZ A;  4A3E H;  1KRS A;  1HNX L;  4YCW A;  1FJG Q;  4LF7 L;  1C0A A;  4AYB E;  1NBW A;  4JC0 A;  3UE0 A;  5LMN Q;  1VQ5 A;  2WFW A;  5FJ8 G;  4DV7 L;  4B3T Q;  1SRU A;  1W2B A;  3IRB A;  3CCE A;  3HOY G;  4GLV B;  5GAD C;  2OQK A;  4JI5 L;  1KIX A;  4IFD I;  2D0P A;  3D0F A;  3PUX A;  1CKN B;  1EQR A;  5M3M H;  1SRO A;  1VQB A;  3J80 i;  5ELO A;  4X65 L;  1J5E L;  1WYD A;  2QA4 A;  3PF4 A;  3L2P A;  3ER0 A;  5M5Y H;  5GQO A;  4H02 A;  2ZM6 Q;  4JI2 L;  2CWA A;  3PUV A;  1G6P A;  4OX9 L;  4LFB L;  2A8V A;  4OON A;  4KLK A;  4DR4 L;  3S24 A;  5AJ3 Q;  5LMU L;  1P16 A;  4JBW A;  3RZD H;  1CKO A;  1SMX A;  1B7Y B;  5BR8 L;  3UDG A;  2UUB Q;  2ASB A;  4DV0 Q;  3LGJ A;  2VNU D;  4LFA Q;  4A3L H;  4GN3 B;  5IP9 H;  5IP7 G;  4O2D A;  2F3I A;  2E8G A;  4AQY L;  4LF5 Q;  3OW2 A;  2R7D A;  3A74 A;  3FKI G;  3A5U A;  2K5V A;  2N49 A;  1S72 A;  1U0L A;  5C3E H;  1Q86 C;  1QUQ A;  4HIK A;  4JBK A;  2K75 A;  2NZH A;  4A3F G;  4HJ7 A;  1Y1V H;  1UE1 A;  4JCV E;  1XNQ Q;  4BXX G;  1PYS B;  4HIM A;  1I5F A;  1D7Q A;  4GLA C;  4DUY L;  1X65 A;  5LMN W;  5IYC H;  1JJG A;  1A8V A;  5GAH C;  1IBM Q;  3L0O A;  4HIO A;  4P74 A;  4L5S A;  4LWC A;  3CXC A;  3GTG H;  2HHH L;  1HZ9 A;  2A19 A;  2JQO A;  1U5K A;  1VQG A;  3UDI A;  4A4I A;  3KJO A;  3L7Z C;  4DUZ Q;  1YNX A;  1TXY A;  4JI0 L;  3T1H Q;  4C3H H;  1N36 Q;  3M4Q A;  3BZK A;  2HIV A;  2UXB Q;  2ALY B;  5C0X J;  5JEA J;  4EQ5 A;  1E24 A;  5JEA G;  5C0X G;  4X6A H;  3GTJ H;  4POG A;  2MO1 A;  1A63 A;  4JBJ A;  3CCQ A;  1YJN A;  1TWH H;  2QGQ A;  1FJG L;  1EQQ A;  4K0K Q;  2NVY H;  3I2Z A;  5IYD H;  4YHH Q;  3TS0 A;  4APV A;  5LMN L;  4B3T L;  3S15 H;  4PZ6 A;  3HKS A;  4LF8 Q;  2JA8 G;  1Z9F A;  1E22 A;  4A3E G;  1GKH A;  3CP0 A;  5GRO A;  2YYZ A;  1YEZ A;  1YHQ A;  1CKN A;  2K52 A;  2KCM A;  2V1C C;  3A0J A;  4JV5 Q;  5C44 H;  2UXC Q;  2D0O A;  4JI3 Q;  2IT1 A;  4IJL A;  1TWA H;  2ID0 A;  4AH6 A;  3CCM A;  1VQ4 A;  4A3J H;  2I0Q A;  1A62 A;  1PH4 A;  4JI8 Q;  1IZ6 A;  2ZM6 L;  4L5T A;  4YY3 Q;  3PUZ A;  1A0I A;  4XIG S;  2ZTD A;  4QL5 A;  5HGQ A;  5M3M G;  4JYA L;  2EQS A;  4R4T A;  3RNU A;  4LF6 Q;  2PI2 A;  1VCI A;  5AJ3 L;  4MTN A;  3S2D H;  2R93 H;  3ZJY C;  1G29 1;  4JG2 A;  1IXR A;  2UUB L;  4LFC L;  5IWA Q;  2RHQ B;  1E1T A;  4GKJ Q;  3K8A A;  3KF8 B;  1HZC A;  3U4V A;  3U50 C;  3S1Q H;  3ERS X;  2Q2I A;  4LNQ A;  3M7N A;  1EUJ A;  2OCE A;  3CMA A;  3J7Z C;  3HOU G;  4LF5 L;  4A3M H;  2EIF A;  3CME A;  3MEF A;  2VQF Q;  1VQO A;  1I94 L;  1XMO Q;  3M4P A;  3CQZ H;  2LSS A;  2R92 H;  3Q8D A;  2F4V L;  3CPW A;  1VQC A;  2YTY A;  3CW2 C;  3CCJ A;  3FHW A;  1LTL A;  4O0A A;  5IP9 G;  2DGY A;  3I55 A;  4A3K H;  1XNQ L;  4A3L G;  4LF9 Q;  2CQO A;  3WWV A;  4WJ4 A;  3S1N H;  5JJL A;  4A3G H;  1X55 A;  2YV5 A;  1N33 Q;  5K36 G;  5C3E G;  1OXU A;  1IBM L;  3K0X A; 
#chains in the Genus database with same CATH topology
 4QIW E;  3U9S A;  4EQP A;  1WVL A;  2GVA A;  5IYC G;  5ELN A;  3PV0 A;  1WTQ A;  4B3M Q;  2CCZ A;  2EE1 A;  3T1H L;  4MNO A;  2N55 A;  2KBN A;  5M5Y B;  4DR3 Q;  1EYD A;  4YCU A;  4CJ1 B;  3HKZ G;  2XNA C;  3HOW H;  4K0K L;  1A15 A;  3KOJ A;  3NQI A;  4R9W A;  2B2T C;  3FEW X;  2PMZ E;  5IE8 A;  5LL6 X;  1SYB A;  1IYU A;  1X6O A;  5IYD G;  1SYD A;  2XN9 C;  2DNC A;  1E7Z A;  1Q8I A;  1RTO A;  1CHQ D;  2EYP A;  2L5T A;  1LUZ A;  4IPG A;  3U9O A;  3P7J A;  3R3O A;  4DV1 Q;  1NR4 A;  4YY3 L;  1LT5 D;  1EFW A;  2B2V A;  2UXD L;  3I4M H;  3DM3 A;  1VQD A;  2R6G A;  1HA6 A;  1RL2 A;  3ULJ A;  5KND A;  4HID A;  2GN5 A;  4DNI A;  3HKZ B;  3HOV H;  1BO0 A;  4CGY B;  1IW7 C;  1VQ7 A;  3J81 L;  4JW0 A;  1XMO L;  4MZ9 A;  2EXZ A;  4ZUI A;  2LMC B;  1PH3 A;  4OWW B;  4K2K A;  4LF9 L;  2IX0 A;  3TP5 A;  1VQ6 A;  1GM5 A;  4FYD A;  4L63 B;  4K5X A;  2RCN A;  3HS0 C;  1O7I A;  2RCF A;  2VB3 X;  1EQV A;  1X56 A;  1NNX A;  4FXG C;  3KDF B;  3K7A H;  3MWY W;  2G9D A;  3C3L A;  4QQB X;  4BBR H;  4IOC A;  5C4Z A;  1WTV A;  3J81 i;  1KNE A;  2QEX A;  1PFN A;  4ZKB B;  3S2D B;  1E2V A;  1N9W A;  4DK3 C;  3ONA B;  1E1O A;  4B3S Q;  2XWJ B;  2F0L A;  3E6Z X;  1UEB A;  3KJP A;  2ZJP A;  3WOF A;  4PNY A;  5COY A;  2RBM A;  4CDC C;  3NSW A;  3I4L A;  1EY5 A;  3CQZ B;  2ZTC A;  4CDE C;  1MI2 A;  3TP8 A;  5C4X G;  2YTX A;  4H0L C;  3AYH B;  4PZ7 A;  3K5L A;  5GAG C;  1PVO A;  4DNT B;  3LWU A;  1EY4 A;  3GTM H;  2NTT A;  2BH2 A;  1EWH A;  4DV0 L;  4UP7 A;  3BDO A;  5CV6 A;  4LFA L;  5CC4 A;  4HSV A;  2B39 A;  4DR2 L;  4IFD G;  4ZCK A;  1ET9 A;  3I8Z A;  3CC7 A;  2OTL A;  3I91 A;  3OPO A;  3QR8 A;  1E3P A;  4LW1 A;  2FMC A;  2C9O A;  2Z4H A;  1AE3 A;  3JC6 6;  3DUZ A;  2E74 C;  3SK6 A;  2LXK A;  3TP7 A;  1M8A A;  2VUM G;  1HUN A;  2K04 A;  1F2Z A;  3ULL A;  5C4X B;  1L1O A;  2L55 A;  2E2H H;  1A2T A;  1JOO A;  2B63 H;  2ATW A;  4O42 A;  5DLQ E;  3SDZ A;  5C4J B;  1NR2 A;  5D3I B;  1F2L A;  1HZB A;  3GTP H;  3FP9 A;  3KBX A;  1L0X B;  3CRK C;  3FDT A;  3S1M B;  1HQM C;  2MO0 A;  1K83 H;  1GUS A;  4XQN A;  3RZD B;  5LL6 S;  1STN A;  2B2V C;  1HR0 W;  1NUC A;  3PSI A;  1L2F A;  3H6M A;  4JV5 L;  2UXC L;  4GNX A;  1JJ2 A;  2HHH Q;  1NSN S;  2OF1 A;  1CA5 A;  1KDB A;  3DM1 A;  3RR5 A;  1T9H A;  2EZV A;  2VUM B;  2BA1 A;  2HCI A;  2O5I C;  2B2W A;  3D4W A;  1FNU A;  5I6Y A;  4A3I G;  5KNC A;  4X64 L;  1HR0 L;  1SFO H;  1SLJ A;  4K6L A;  4MTK A;  2WIN B;  1TKW B;  3S9W A;  1UUP A;  4JOI A;  2K5Q A;  2O4X A;  3E3X A;  2VQF L;  2PZU A;  2L9H A;  4DV6 L;  3ULP A;  2K05 A;  1YVC A;  1X9N A;  1EFI D;  3S15 B;  5C6A A;  4LUV A;  2PQA B;  3MXU A;  4BY1 H;  3T53 B;  1XPR A;  1X3E A;  4LFC Q;  1VQ8 A;  1K9M C;  4KN4 C;  5EGT A;  4ZKC B;  1Y1W H;  1SXT A;  5ELC A;  1M90 C;  4A3I B;  4QMG A;  3NEL A;  5C4H A;  3DXJ C;  1EEI D;  2ZXP A;  5FLM G;  3I73 A;  1J6Q A;  2B2U A;  1LLR D;  4J1M A;  1HNZ Q;  3VA7 A;  3R8B A;  5K5P A;  4M1U B;  1O7Y A;  4LF4 L;  5JVH 3;  1FL0 A;  5EKK A;  4PMC A;  3V96 A;  4ME5 A;  2CVR A;  2ZXO A;  1JOK A;  4HED A;  1X3F A;  1AH9 A;  3PIO 3;  1EY0 A;  1I4R A;  2NZO A;  4O1N A;  4C3I G;  1BOS A;  1TWF H;  4HN7 A;  4HCS A;  3HOY H;  4Q5V A;  1QG7 A;  1PLF A;  3J7A 5;  5M5W B;  1LT3 D;  2NVQ B;  3AB9 A;  4A93 G;  4X66 L;  2YU9 H;  3K80 C;  1VS0 A;  4DR1 L;  4UAI A;  1AP0 A;  1R4P B;  4JI5 Q;  4J15 A;  2VQE L;  4IPC A;  1B53 A;  3RMH A;  2BA0 A;  4EQN A;  3M4O B;  1SYG A;  2LXJ A;  1L1O C;  2R7F A;  4X62 L;  2RDF A;  2UXD Q;  2UUC L;  1WI5 A;  3GTK B;  4QF4 A;  4JI2 Q;  1I50 B;  2BDN A;  3CD6 A;  2AMC B;  4RHS A;  1SJH D;  3R93 A;  3HEJ A;  5J3B A;  3NWS A;  1WCM G;  4BBS G;  1EZ6 A;  1SE8 A;  3NBI A;  3FKI H;  4DV3 L;  1TU2 B;  4C3I B;  2Q2U A;  5IGG A;  4RMF A;  5C0X I;  4C3J G;  1OXX K;  1IL2 A;  2CWP A;  4A93 B;  3AQQ A;  1CSQ A;  1K8A C;  5IY0 A;  3FRP B;  4XT3 B;  4GNX C;  1F2Y A;  4K5V A;  4BY7 G;  1VQE A;  3ZYY X;  4RH6 A;  1HTP A;  3D6C A;  3DWQ A;  4KY6 A;  1PRT F;  1EIH A;  2B2W C;  2EY5 A;  2OXP A;  4KMU C;  5CR3 A;  4NXN L;  4B3R L;  4KHP L;  1JT8 A;  4OXP A;  4XTC S;  2I5H A;  4G7H C;  3PQI A;  2NYZ D;  4JI7 L;  1G6Z A;  1EIG A;  4GS3 A;  1II3 A;  1BKB A;  1WCM B;  4JOI C;  3RLF A;  3A54 A;  4BBS B;  4A3E H;  1SE2 A;  3R2I A;  5IT9 L;  1KRS A;  3IL8 A;  4C3J B;  4JC0 A;  5FJ8 G;  2O2L D;  3CCE A;  4E6I A;  4ZAI A;  4BY7 B;  5ISR A;  4XQJ A;  3D0F A;  4N9T A;  2A73 B;  1VQB A;  4X65 L;  3S17 B;  3J7Y W;  4H02 A;  1S5D D;  3A8J E;  2Z1C A;  3PUV A;  1G6P A;  4LFB L;  2A8V A;  4OON A;  1ML0 D;  2EOT A;  3KF8 A;  3RZD H;  2B2U C;  3UDG A;  5BR8 L;  1YNJ D;  4DV0 Q;  3LGJ A;  2F3V A;  1PTO D;  4LFA Q;  4A3L H;  5IP7 G;  1ZYR C;  5FO8 B;  2F3I A;  4LF5 Q;  5AFW A;  1PFM A;  1B9M A;  2K5V A;  1U0L A;  5C3E H;  1LT6 D;  1Q86 C;  4JBK A;  4HJ7 A;  4JCV E;  1I5F A;  1D7Q A;  4DUY L;  1LTT D;  4CKB A;  1A3V A;  4KK7 A;  5GAH C;  4L5S A;  2F0S A;  3CXC A;  3GTG H;  2A19 A;  3VR6 A;  1TVX A;  3DMU A;  3L7Z C;  4K2L A;  2F1M A;  4TRD A;  5C0X J;  5JEA J;  1E24 A;  1A63 A;  2MO1 A;  1TWG B;  2JP1 A;  4JBJ A;  3S1R B;  1D2B A;  3EQL C;  3I2Z A;  3T13 A;  3TS0 A;  1EZ8 A;  5CV7 A;  3A55 A;  3S15 H;  4LF8 Q;  1STH A;  5FK9 C;  2DNE A;  4JV5 Q;  5C44 H;  1O7Z A;  2D0O A;  4JI3 Q;  2UXC Q;  2IT1 A;  1TWA H;  3K0Y A;  2HDL A;  1VQ4 A;  3BDC A;  4A3J H;  2I0Q A;  1PH4 A;  1IW7 D;  2CH4 W;  4JI8 Q;  2AQ3 B;  3PUZ A;  1A0I A;  5HGQ A;  2ZTD A;  4JYA L;  3DWP A;  2EQS A;  4WJW A;  5M5X B;  3C46 A;  1STA A;  2DJG C;  2PI2 A;  3V05 A;  2NB0 A;  1C4Q A;  5BN4 A;  4BS9 A;  3MXN A;  4JG2 A;  1IXR A;  3S14 B;  1E1T A;  2EY2 A;  5IGD A;  2OCE A;  3IFD A;  3J7Z C;  2CH4 A;  2VQF Q;  1VQO A;  3CW2 C;  2CQO A;  4ULL A;  4X3T A;  4WJ4 A;  5EBC A;  1PTO H;  1EY6 A;  1XXG A;  1N33 Q;  4KY7 A;  4NP5 A;  3K0X A;  1IBM L;  1Y1V G;  3BZC A;  1K0R A;  1WTX A;  3I4N G;  1DON A;  3ICE A;  3OMC A;  4OIJ A;  5FLX L;  3NEM A;  2Z8L A;  4DKA C;  5IGC A;  1KC8 C;  2ZXR A;  2UU9 Q;  1A3U A;  4DR5 L;  1YJ9 A;  1PRT C;  4C3H G;  1B70 B;  3H0G H;  4LF4 Q;  3NE5 B;  4RGN A;  1VQK A;  2JA7 H;  1JJC B;  1D1K A;  1MJC A;  3CRL C;  2HQE A;  4PZ8 A;  2DY7 A;  4JI1 Q;  1Q46 A;  1BCP B;  5E1F A;  1IKL A;  1MIU A;  1S5F D;  4OWT B;  4R4O A;  1KD1 C;  1QVF A;  4I65 A;  3CC4 A;  1OTC A;  3IFT A;  3K7U C;  1JB7 A;  1F9P A;  2N3S A;  4DK1 A;  1L0Y B;  1IL8 A;  1Y1V B;  3TN2 A;  3I4N B;  1F9S A;  5EAY A;  4WJ3 M;  3OYY A;  2NN6 G;  4X66 Q;  3G7L A;  2F0H A;  4IUN A;  1EQT A;  4GKJ L;  1WFQ A;  4DXG A;  1LTR D;  2VQE Q;  4C3H B;  2Q2H A;  2AWO A;  2SOB A;  2E2D C;  3FPP A;  3HKZ E;  1F2M A;  3OSO A;  3MHB A;  5H1S E;  2B2Y A;  2WB1 E;  3VYT A;  3AFQ A;  3CCL A;  3GTJ B;  4RA8 A;  4V19 0;  3RZO H;  5E4W C;  1TWH B;  1JCK B;  1V1P A;  2CKZ B;  4IUU A;  2NVY B;  3HFZ B;  1A3T A;  2BH8 A;  1R4Q B;  3CC2 A;  2OTJ A;  3DHQ A;  4A3K G;  4A3B H;  1Q8K A;  4HJ5 A;  4BA1 I;  1Z6H A;  5DNF A;  4DAY B;  4DV3 Q;  5KYI A;  1XNR Q;  2GVB A;  3HOX H;  4OO1 G;  1EIY B;  1L1O B;  2RSN A;  2R7Z G;  1QE6 A;  1FVI A;  4HJ8 A;  2JA6 G;  1PYB A;  4ZK9 B;  2HT1 A;  1X32 A;  5EKL A;  2VY3 A;  4IUT A;  4TQU S;  1VQJ A;  4RKL A;  2SEB D;  1EY9 A;  1HUM A;  1C48 A;  1CM9 A;  4A75 A;  2MQH A;  3D8G A;  4NXN Q;  3PIP 3;  1IBK L;  5IYB H;  4KHP Q;  1CKM A;  4GNX B;  2YTV A;  3TS2 A;  1VQH A;  4DV4 L;  4C2M B;  2NWG A;  2AHO B;  4A3K B;  2F0M A;  3UDX A;  3CKI B;  2A6H C;  3LX0 A;  3EA6 A;  4KKU A;  2OWO A;  4JI4 Q;  1KAB A;  1HH2 P;  1X3G A;  2AQ2 B;  1RCV D;  3T56 B;  3GTO B;  2R7Z B;  5IGF A;  4F7X A;  1EIF A;  1LYL A;  1GUO A;  2JA6 B;  3PO2 G;  1MSH A;  1XTD A;  1HHV A;  1IHZ A;  4YWL A;  3OOC A;  4GN5 A;  3JAM c;  3PMF A;  4X65 Q;  1YBY A;  3FMC A;  4UDU C;  1EEF D;  2CW0 C;  1JE5 A;  3VYS A;  4NW2 A;  2XRQ D;  2Y0S G;  1BCP D;  4P75 A;  3LWE A;  1AZQ A;  5IOD A;  2VZA A;  3GTL B;  1LAB A;  3STB C;  2JA5 G;  1W6K A;  3M85 A;  3C1E A;  2VL6 A;  4UY8 C;  2CQA A;  1S4Z A;  3ITP A;  4CJ0 B;  1VMC A;  3VDY A;  2NVX H;  4I7Z C;  4OIK A;  5DM6 3;  1DOK A;  4A3D H;  1WTH A;  4ZYS A;  1XPU A;  4CHT B;  4UP9 A;  1SNM A;  3QIA A;  4QCL A;  3PO2 B;  3MA2 B;  1ZKO A;  3TSS A;  4DR7 L;  4DUY Q;  2K7V A;  3D3R A;  1SYF A;  3BJU A;  4IQZ A;  5CBE E;  2B8G A;  3MZ5 A;  2Y0S B;  5G3L D;  3NBH B;  4K6D A;  1X3P A;  2PYK A;  3AEV A;  1E2Z A;  4HCE A;  3OTO L;  2JA5 B;  5M3F G;  2UUA L;  3HOZ H;  5KYL A;  3G6E A;  4LF6 L;  2MUY A;  3EN2 A;  1G2S A;  3I90 A;  2B2Y C;  1N32 Q;  5A35 A;  1GUW A;  3M9B A;  1PH5 A;  2WKD A;  4DV5 Q;  3NEN A;  2PI2 E;  4DAM A;  4DK6 C;  4WRD A;  3E0J A;  1BQQ T;  1SND A;  1TQO A;  3T1Y Q;  5IOC A;  4UHV A;  1QCB D;  4JI6 Q;  2DN8 A;  3KLR A;  2F0N A;  4JYA Q;  5DAU A;  1OXT A;  2GA4 B;  3CHB D;  4OWX B;  5ELE A;  1ENA A;  3S16 H;  4AIM A;  2EYL A;  1QWY A;  1RHP A;  2JXM B;  4POF A;  3J81 j;  2MP1 A;  1Q1E A;  2V4D A;  5M3F B;  1PHJ A;  4RGM A;  3PO3 G;  4KY5 A;  3CCV A;  1QJO A;  4DV2 L;  2Q2T A;  2FHT A;  3G48 A;  1SNQ A;  5J1Z A;  1ONL A;  1GUG A;  4Y7N B;  3OWE B;  3JAM i;  1HTL D;  1JR0 D;  4F87 A;  2QF7 A;  3I4N H;  1S5C D;  1RDP D;  1EOT A;  2QEJ C;  1Y8O B;  3I70 A;  2QW7 A;  1GUN A;  1V1O A;  4A3C G;  1N8R C;  2NBF A;  4Z9C B;  4NPS A;  4N8F A;  1I4Q A;  4QGU A;  4ZQ3 A;  3J80 c;  1Y8N B;  2WAQ E;  2RVL A;  4H7B A;  1BDO A;  3TRE A;  2K5N A;  4X3U A;  4FF4 A;  4C56 C;  2ZJQ A;  1LTB D;  1NAP A;  4DR5 Q;  1ASZ A;  2E2I B;  3PO3 B;  2A68 C;  1HNW L;  4OL7 A;  1QVG A;  4C1N I;  2SNM A;  3KF6 A;  1NMF A;  4ZRZ A;  2ZTE A;  1VQA A;  1EL0 A;  4Q0F A;  3FPU B;  5LHY 1;  1PRT B;  2L0C A;  2B8F A;  2AWN A;  1PH8 A;  1B8A A;  4DFA A;  1SE4 A;  4ME3 A;  4QY7 A;  5LMU Q;  3TZU A;  3A5Z B;  1YI2 A;  2Q8T A;  2JE6 I;  4A3F H;  1Q81 C;  3KK7 A;  4BXX H;  5M9O A;  1R9T B;  4C2M H;  4NXM L;  3UI2 A;  3BVM A;  1NY4 A;  2B3G A;  1XTC D;  2WP8 J;  2KVM A;  4L6T B;  4QIW B;  1QZG A;  3A8I E;  3E0E A;  2WII B;  5FO9 B;  1OXV A;  3SK4 A;  2EYO A;  4DGZ A;  4KJO A;  3SK5 A;  3GDE A;  1C8C A;  1PH1 A;  1YHB A;  4HR7 B;  2N78 A;  1XMQ L;  1KL9 A;  1FYC A;  2C35 B;  3D31 A;  1WTR A;  3C1F A;  3TZD A;  3I4O A;  2HD3 A;  5E4X A;  1RJT A;  1M1K C;  2JA8 H;  2PMZ B;  4G4K A;  1HNX L;  2Z4I A;  2HUG A;  1AEX A;  1C0A A;  4AYB E;  1NBW A;  5LMN Q;  1VQ5 A;  4B3T Q;  2E75 C;  4DV7 L;  3M3Y B;  5FKA C;  1CTM A;  4GLV B;  4KKS A;  1EYC A;  2OQK A;  4IFD I;  2EJF C;  4FXD A;  1D5Z C;  3Q22 A;  1SRO A;  3J80 i;  5ELO A;  4DNR B;  3MC0 B;  5M5Y H;  3L2P A;  1TY2 A;  2CWA A;  2MPM A;  4OX9 L;  4JVZ A;  4KLK A;  1GHJ A;  4DR4 L;  3BVZ A;  5AJ3 Q;  1P16 A;  2KQ3 A;  4JBW A;  5CV5 A;  3VA5 A;  1CKO A;  1B7Y B;  2UUB Q;  2DJF C;  5ELB A;  3H09 A;  5JOB A;  3SK8 A;  3LNN A;  3T4A C;  5F2D A;  2NVT B;  4AQY L;  3A74 A;  1XWE A;  1I4X A;  5K36 H;  2F0V A;  1H9K A;  1JE4 A;  2K75 A;  1XNQ Q;  3K5N A;  4CJ2 C;  1X65 A;  2F0O A;  5IYC H;  1SNP A;  4XYO A;  3L9A X;  1BXT A;  1PRT D;  2P5Z X;  2Z6B A;  1QNK A;  1MGS A;  1I3Q B;  3S2H B;  4JI0 L;  1TXY A;  3T1H Q;  3M4Q A;  3BZK A;  2A69 D;  5C5M A;  2HIV A;  5I6W A;  1TWC B;  5C0X G;  5JEA G;  4X6A H;  4POG A;  1DCZ A;  2J7Z A;  1EY7 A;  2PO4 A;  4I7A A;  4RAU C;  5JAV A;  1FJG L;  1LT4 D;  2A74 C;  4K0K Q;  5IYD H;  4APV A;  1Q3L A;  4PZ6 A;  3KBG A;  2ICI A;  1B9N A;  1Z9F A;  3BZD B;  4ID6 A;  1GKH A;  5GRO A;  4CDD C;  2YYZ A;  1YEZ A;  3NP8 A;  1CKN A;  2V1C C;  1TS5 A;  3A0J A;  2IX3 A;  3QG1 A;  2HDM A;  2E2J B;  1H9S B;  1TY0 A;  2RSO A;  5KEE A;  3CCM A;  2OEO A;  1GXD C;  2KEC A;  4IAL A;  3JAM E;  2ZM6 L;  3IAY A;  4YY3 Q;  3BYT B;  1K0S A;  5M3M G;  4R4T A;  4LF6 Q;  3VR5 A;  1FNW A;  2R3Z A;  4MTN A;  3VR3 A;  2WV6 D;  2ENB A;  3S2D H;  3AMU A;  3ZJY C;  1G29 1;  2K32 A;  1CA6 A;  3GTQ B;  1K3B C;  4H44 C;  1I6H B;  2A6E D;  2Q2I A;  3M7N A;  3CMA A;  2G5D A;  4K14 A;  3MEF A;  2PW7 A;  1XMO Q;  3CQZ H;  2F0P A;  4RGT A;  3Q8D A;  2F4V L;  1B1Z A;  1KDC A;  3A7A B;  3CCJ A;  5IP9 G;  2DGY A;  4LF9 Q;  1D5X C;  2K01 A;  1LTS D;  3WWV A;  4GZY C;  1V1P B;  4K8J A;  4IUQ A;  3GV6 A;  5JJL A;  1X55 A;  1GUT A;  4DAP A;  4RWS C;  1OXU A;  5BN3 A;  3H3V I;  1QIL A;  2TSS A;  3KDF A;  5M3M B;  5HGT A;  3O13 A;  4DV2 Q;  5EPL A;  3F1Z A;  2UXB L;  1VQF A;  1EU4 A;  3U4Z A;  1KNA A;  1LTG D;  1FGU A;  5JPM C;  3QWN A;  4YHH L;  4R1J A;  2IY5 B;  3AU7 A;  5EBD A;  5C3X A;  4QJF A;  1ESF A;  4P2C B;  5C4X H;  3F8T A;  2E5L L;  1PZJ D;  5C4J H;  2PQE A;  3MFG A;  3TRZ A;  2JEB I;  2MFI A;  1QZH A;  2EDG A;  3I7F A;  1IYJ B;  2Q8R E;  3S1M H;  2RQX A;  2F0F A;  4IFD H;  1AFP A;  3OMG A;  3MXP A;  4DF7 A;  3BG3 A;  1UE5 A;  3EJI A;  1SBB B;  4YWM A;  5C3W A;  5FO7 B;  1P8L A;  3VR4 A;  1HFG A;  2LKV A;  1XYI A;  4DR2 Q;  1JQY D;  3E9H A;  1HA5 A;  2MGS A;  2TMP A;  3WOE A;  4FNF A;  2WKC A;  4FP5 D;  4J6H A;  3FVQ A;  3D4D A;  2JK8 A;  2VUM H;  4A3M G;  2EYM A;  4RG1 A;  1Z47 A;  1STG A;  3PGZ A;  2R92 G;  2EVB A;  3M3Y H;  1WD1 A;  1DZ1 A;  1EWC A;  3BYY B;  3W3A A;  4FXK C;  3NTI A;  4B3M L;  4A3G G;  2RF4 A;  3H15 A;  3J80 E;  4HJ9 A;  1DGS A;  2JJQ A;  2PW5 A;  4GLX A;  1XPO A;  4NXM Q;  2JEA I;  2BE5 C;  1V43 A;  1EU3 A;  2L15 A;  2NZ1 D;  1NE3 A;  3SGI A;  2BDO A;  5T1G A;  1D6E C;  2ES2 A;  3GD7 A;  1PH2 A;  5EPK A;  2K50 A;  1SMY C;  4A3M B;  1CT1 D;  3KYH C;  2R92 B;  4A3I H;  5FLX c;  5CMD A;  3S1N B;  1FGB D;  2F4I A;  4LUO A;  4A3G B;  2XTI A;  2DY8 A;  1MD2 D;  1LV9 A;  2WAC A;  4X64 Q;  3I4M G;  1HR0 Q;  5HY6 A;  4QUC A;  2XIW A;  3AFP A;  3F2B A;  1LAC A;  5KGU A;  1YJW A;  1OO9 B;  4GN4 B;  3HOV G;  2K6A A;  4DV6 Q;  1EYG A;  3MEH A;  2PQA A;  1WTW A;  4NB3 A;  5M5W H;  2NVQ H;  1STY A;  1DJR D;  1TT2 A;  2LS0 1;  3PCO B;  5DEH A;  3GP7 A;  3SE0 A;  5CBA E;  5JPN C;  5FLM H;  3E9I A;  2EYF A;  1G91 A;  1PTO F;  1YIT A;  1HFN A;  5J39 A;  3VYR A;  4AQY Q;  3TME A;  3M4O H;  3I4M B;  4GOP A;  3EIV A;  2F0I A;  4IOA A;  3GTK H;  1I50 H;  2QIL A;  1VQM A;  2KCN A;  4BBR G;  3MTS A;  1PH6 A;  3H3V H;  3HOV B;  1CI3 M;  4C3I H;  1FD7 D;  4PV1 C;  1ESR A;  3EVQ A;  2QDL A;  4S3S A;  1HRJ A;  1VDZ A;  2VB2 X;  1Q7Y C;  2Y0S E;  1NMG A;  1ZEQ X;  4A93 H;  1TR5 A;  2LFN A;  4OEM B;  4R4C A;  4XDX A;  1W3S A;  2K1B A;  1U4P A;  3CAM A;  4HSP A;  1PZI D;  1Q12 A;  4K5W A;  1U4R A;  3RN5 A;  5EJW A;  4DR1 Q;  3KF6 B;  2K5W A;  1JWU D;  1ZXT A;  4BA2 I;  3EBE A;  3K7A B;  1B2T A;  4QUF A;  3KLW A;  1CQV A;  5TSS A;  4BBR B;  1CUK A;  2H5X A;  1CSP A;  4X62 Q;  1H9R A;  1WCM H;  2OQ0 A;  4BBS H;  2UUC Q;  2KEE A;  1HZA A;  3PUW A;  4IPH A;  4TVA B;  5JJK A;  4X3K A;  2Q8I B;  4UP8 A;  1HJP A;  4C3J H;  5IGB A;  2QKI C;  1VQ9 A;  2F52 A;  4BY7 H;  2KUM A;  5J22 A;  1N34 L;  4ZUJ A;  3QOL A;  5CV8 A;  5E3F A;  4DPG A;  3TBI B;  4EVO A;  2B63 G;  2F4V Q;  3S17 H;  1HCZ A;  1JB3 A;  3GV3 A;  3Q6S A;  2RKS A;  3GTM B;  3NHH A;  3K5O A;  2D9U A;  1T5E A;  5CGK A;  2K14 A;  1W6J A;  2KCT A;  4EGV A;  1KQS A;  4B3R Q;  2KCC A;  1ICW A;  1E0B A;  2D5D A;  2K33 A;  3DLL A;  3M4Y A;  1KLG D;  4JI7 Q;  2J4X A;  5FJ8 H;  4NKL A;  1H95 A;  5GAE C;  2NN6 I;  1Y69 U;  4KD4 A;  2FMM A;  1NTG A;  1SNO A;  2AUK A;  2E2H B;  4IJH A;  3CCR A;  4F88 A;  3T16 A;  2FIN B;  2E5L Q;  1SNC A;  5JJI A;  5I2X A;  3NWT A;  3GTP B;  3PUY A;  3RLN A;  2VW9 A;  3BU2 A;  1UWV A;  1AE2 A;  1C7Y A;  1U4M A;  1TWG H;  1K83 B;  5T1I A;  3NPP A;  4CKE A;  3S1R H;  4LFB Q;  2ZJR A;  1BBW A;  1QNU A;  2Z9H A;  2KED A;  1VQP A;  5IP7 H;  4GOP C;  4OO1 I;  2RA4 A;  1XX8 A;  3V2T A;  1JOR A;  1RIP A;  4ALP A;  4IPD A;  5BR8 Q;  3KLS X;  2L12 A;  4ABN A;  4BY1 G;  4L5Q A;  3ERQ A;  4ILW A;  3J81 c;  1Y1W G;  1VQL A;  2LY7 A;  1HNZ L;  2F0T A;  3DEP A;  2K5H A;  3J7A V;  1YNJ C;  1U9R A;  3HZX A;  4FDB A;  5M5X H;  1SFO B;  1S3O A;  1S40 A;  1PTO C;  3L3O C;  3Q0A A;  3NTH A;  4R4Q A;  1PDQ A;  3K6O A;  1VMP A;  2HQL A;  4CDF C;  3S14 H;  4GKK L;  1JC7 A;  1TII D;  2AKW B;  2FJ2 A;  1CHP D;  1F9Q A;  1CZG A;  1X54 A;  2KOL A;  3PIO A;  2WB1 G;  4LUZ A;  1PFB A;  4LF7 L;  5I2Y A;  4BY1 B;  3UE0 A;  4DA2 A;  1SRU A;  1W2B A;  3HOY G;  5GAD C;  2F0K A;  3MAQ A;  4JI5 L;  1Y1W B;  3H3V C;  1BNZ A;  1ILP A;  4DN4 M;  3JAM L;  1CKN B;  2O5J C;  1SEB D;  1J5E L;  1WYD A;  3PF4 A;  1PYW D;  2JN4 A;  5GQO A;  5JJZ A;  1CQF A;  2J0T D;  3OIP A;  4JI2 L;  1YNN C;  3S24 A;  4IUV A;  3VYU A;  2F0D A;  1JOQ A;  2WB1 B;  4O2D A;  3QO2 A;  3OW2 A;  3FKI G;  3A5U A;  1LTI D;  4QB4 A;  4XT1 B;  1TWF B;  1S72 A;  3HOY B;  1A2U A;  1QUQ A;  2BOS A;  1BCP F;  1Y1V H;  1UE1 A;  1PYS B;  4HIM A;  2I46 A;  3ND9 A;  4EQO A;  2M9V A;  2YU9 B;  3HRZ C;  1A8V A;  1IBM Q;  2QDB A;  1H9J A;  3X3N A;  5FOB B;  4R8I A;  4HMI A;  1U5K A;  1VQG A;  3UDI A;  3KJO A;  2L1B A;  2K5D A;  4JK1 C;  5DM7 3;  4C3H H;  2ALY B;  2EY6 A;  3GTJ H;  5IIF A;  5FLX E;  3D6W A;  1BUV T;  1TWH H;  2K03 A;  1TS3 A;  2NVY H;  2IW3 A;  1E22 A;  2PNR C;  3FKI B;  1UAP A;  3CP0 A;  4A3E G;  5EPJ A;  1YHQ A;  2KCM A;  4FF2 A;  5G3L F;  5CYU A;  1BR9 A;  4RKB A;  4IJL A;  2ID0 A;  2CHB D;  1HXY D;  1A62 A;  1EY8 A;  1I4H A;  1SYE A;  2KJX A;  1ICF B;  3K5M A;  2NN6 H;  4L5T A;  1ZYR D;  4XIG S;  3RNU A;  3F2U A;  1CZW A;  3I3C A;  4FF1 A;  3SEB A;  1AZP A;  4DXF A;  3HG9 A;  4GKJ Q;  3KF8 B;  1HZC A;  3U4V A;  4HMJ A;  4KKT A;  3R2T A;  1EUJ A;  1RD9 D;  4CKC A;  1B4O A;  3HOU G;  1GOZ A;  3X3M A;  4LF5 L;  2EIF A;  3CME A;  1I94 L;  4MN3 A;  2LSS A;  1HPC A;  4A3E B;  3CPW A;  1VQC A;  4N8X 1;  4A3L G;  4O0A A;  3K59 A;  4A3K H;  2JYO A;  4ZLT F;  2YV5 A;  4OO1 H;  1ILQ A;  2KHS A;  5C3E G;  2BE5 D;  4DAY A;  1Z7T A;  1YHA A;  3TEH B;  2R7Z H;  3GTO H;  1SDF A;  1T5X D;  2JA6 H;  3J80 L;  2NUC A;  3CCS A;  4DU9 A;  5A2Q E;  3GQB A;  5CV4 A;  1N34 Q;  1KLU D;  1RTN A;  4PG3 A;  4K8I A;  1EWI A;  3P20 A;  1FNV A;  1QB5 D;  1SMY D;  4IZ8 A;  2F0J A;  1EOV A;  1ENC A;  3GO5 A;  3P75 A;  3URY A;  4HJA A;  3M7G A;  2Z6K A;  1STB A;  4LF8 L;  3HOU B;  5D14 A;  3GTL H;  1UNS A;  2EYJ A;  1K8O A;  1O7L A;  3W1G A;  1L0W A;  5JVG 3;  4JI3 L;  2E76 C;  3K57 A;  1IBK Q;  1IBL L;  4YWK A;  4KN7 C;  1VF5 C;  5C3E B;  4JI8 L;  2L4N A;  4DV4 Q;  1B3Q A;  5C44 G;  3MFY A;  3PO2 H;  3ERO A;  4A3J G;  4LK1 C;  5COR A;  2RDG A;  3CU7 A;  1B44 D;  5C5L A;  3K81 C;  4IUR A;  2XGT A;  3UDF A;  2AQ1 B;  3GTG B;  2ICE C;  2FXQ A;  4A76 A;  3MXN B;  4RCN A;  3PF5 A;  2Z0S A;  1TS2 A;  1V9P A;  5EKI A;  2JA5 H;  2IX1 A;  2WAQ G;  3CCU A;  3ND8 A;  2M2L A;  1DOL A;  3VR2 A;  2N8N A;  3MXG A;  1K3R A;  3U58 A;  1N33 L;  2MJ8 A;  4DR6 L;  5C44 B;  1ASY A;  2MHV A;  2KHJ A;  3A7L A;  1TWA B;  2QCP X;  4KTA A;  4A3J B;  1OXS C;  2IHF A;  1BCP C;  1NCV A;  2BCO A;  3SR1 A;  4U68 A;  1SJE D;  1GVP A;  2UU9 L;  3B6Y A;  1SYC A;  1GO3 E;  1PMR A;  2NTS A;  4B08 A;  3SHL A;  3W1B A;  3G71 A;  3F2C A;  4GOP B;  1I4P A;  4DR7 Q;  1J9O A;  5KIX A;  2D2C C;  5E7N A;  5M3F H;  4JI1 L;  3NBH A;  2WAQ B;  4KI0 A;  5NUC A;  2K28 A;  4GKK Q;  3H0G G;  4PMW A;  2JA7 G;  4H13 C;  1I4G A;  1DXM A;  3OTO Q;  2UUA Q;  4Y7N H;  2I5M X;  3SVM A;  2C5C A;  1PTO B;  4NMZ A;  2X69 A;  3CPF A;  1JIC A;  2VS1 A;  2IPK D;  5IT9 c;  4LF7 Q;  2I5L X;  1FR3 A;  3CF5 A;  1V1Q A;  1Y8P B;  1A6X A;  3HP3 A;  4IFD J;  4IN3 A;  1SAP A;  4KD3 A;  2HIX A;  3TP6 A;  3K58 A;  1J5E Q;  1MJE A;  2XSC A;  4P73 A;  2F0G A;  1MSG A;  1RF2 D;  1Y14 B;  2RHS B;  3J81 E;  2E2I H;  3PO3 H;  1JWM D;  3H0G B;  2JA7 B;  1BVS A;  4AYB G;  1TS4 A;  4JPB W;  1GD7 A;  3A56 A;  1QVC A;  1XNR L;  4C1N K;  2PPB C;  4DUZ L;  2Z6K C;  2H1E A;  1N36 L;  3I72 A;  4F8M A;  1K28 A;  4A3B G;  1DOM A;  1RKN A;  3QB3 A;  3TQY A;  3HOX G;  4A3C H;  4B9X A;  3H94 A;  1NJI C;  1C9O A;  3TDQ A;  1WOC A;  4YCV A;  1KAW A;  3N52 A;  1WTO A;  5IGE A;  3RN2 A;  1PA6 A;  2A6H D;  1LM0 A;  2PCF B;  4LJZ C;  1U4L A;  1UE7 A;  1X3Q A;  2K4K A;  2RDH A;  1STE A;  4HTH A;  1KRT A;  2L11 A;  3RZO B;  3PIP A;  3J7A F;  2IJ0 A;  1R9T H;  5D65 A;  4AYB B;  3F2D A;  1H9M A;  1K73 C;  5IYB G;  3IKJ A;  2H4O A;  4U67 3;  4JI4 L;  3Q24 A;  3W2D A;  1PZK D;  3RD4 A;  1V8Q A;  1LTA D;  2CW0 D;  1Q82 C;  1O78 A;  1HNW Q;  3KUP A;  4A3B B;  5IWA L;  3G4S A;  1XJV A;  3HOX B;  1MKH A;  1G2T A;  3STB D;  3I56 A;  1DM0 B;  2R61 A;  4RHR A;  2R93 G;  1KDA A;  1S5E D;  5HUR A;  4Y52 H;  1PV4 A;  3NK9 A;  1WJJ A;  1HQR D;  1PH9 A;  1K8M A;  2D62 A;  1KTK A;  2KEN A;  4P72 A;  1MBY A;  4R4I A;  3HOU H;  2F0Q A;  1Q1B A;  2F0U A;  5L37 A;  1ET6 A;  3NTK A;  1VQN A;  1SE3 A;  3NQT A;  2JA9 A;  4DR3 L;  1I94 Q;  2IWH A;  2HCC A;  3MVV A;  3QOJ A;  4P71 A;  4A3D G;  1SN8 A;  1QOH A;  2CFM A;  2R93 B;  3HOW G;  4FVM A;  3S1Q B;  2IHE A;  3BS1 A;  2B29 A;  3BVG A;  1XMQ Q;  2SDF A;  4TKO B;  1BBU A;  2F03 A;  2NVT H;  1PXU A;  4DV1 L;  4M8A A;  1JMC A;  1G51 A;  4N9P A;  1HNX Q;  1D8L A;  1ENF A;  1N32 L;  3HOZ G;  3OW7 A;  1CFM A;  3OIQ A;  2F3W A;  4DV7 Q;  1YZ6 A;  4DV5 L;  1UE6 A;  1YNN D;  1D5M C;  2MNA A;  4JBM A;  2X6G A;  3DWA A;  3BDL A;  3NUC A;  2NVX B;  4R8N A;  3KFU A;  4IO9 A;  4A3D B;  1I3Q H;  1IBL Q;  3S2H H;  2DUD A;  3T1Y L;  4JI6 L;  1PFS A;  3P1H A;  3HOW B;  1TWC H;  4ODG A;  2F0W A;  2ZT9 C;  2IL8 A;  4KHZ A;  4EX5 A;  4OX9 Q;  4DR4 Q;  1YIJ A;  1PH7 A;  2F0E A;  4L5R C;  1WTP A;  1DYQ A;  4L8J A;  3QJY A;  4DAV A;  3UE1 A;  1VQI A;  3W5O A;  5KRU A;  4XYQ A;  2EXD A;  2E2J H;  3HOZ B;  1AW7 A;  3RLO A;  5I9P A;  4OHJ A;  1B3A A;  1KHI A;  5I9O A;  2OT2 A;  2X6L A;  1F9R A;  1QUQ B;  4DK0 A;  2KHI A;  5ELD A;  1SR3 A;  1JWS D;  4B3S L;  2PNH A;  4DR6 Q;  4IUP A;  1IKM A;  3Q23 A;  5BN5 A;  2A68 D;  2XWB B;  5C0X H;  5JEA H;  1GHK A;  3GTQ H;  4J8Q A;  1I6H H;  2A1A A;  4JI0 Q;  2EJM A;  2N88 A;  1DD2 A;  1KXL A;  4UPA A;  1M4V A;  4YCW A;  1FJG Q;  1ROD A;  3S16 B;  2WFW A;  1CK1 A;  3H91 A;  3HGB A;  3IRB A;  3T51 B;  1KIX A;  2A69 C;  1VF7 A;  1H9S A;  4KJN A;  4RGO S;  2D0P A;  3PUX A;  4B9W A;  2KA7 A;  5EQ0 A;  1EQR A;  5M3M H;  2B2T A;  1KAA A;  4WFN 3;  4X3S A;  3WDN A;  3N6R A;  2QA4 A;  4WOR A;  2M00 A;  3ER0 A;  2SNS A;  1J8I A;  2XRS D;  2ZM6 Q;  1UEA B;  3SXH A;  4OEL B;  5LMU L;  2I07 B;  1SMX A;  2ASB A;  3RUZ A;  5CV9 A;  2VNU D;  2G9H D;  4GN3 B;  5IP9 H;  2EYH A;  2E8G A;  2R7D A;  1GJX A;  2N49 A;  3DEO A;  4HIK A;  3OWF A;  4A3F G;  2NZH A;  4CBV A;  4MHE A;  4KV6 A;  4OGQ C;  4BXX G;  4GLA C;  3NXW A;  4XQQ A;  5LMN W;  1SSO A;  1JJG A;  1Q90 A;  2A6E C;  4RFB A;  5A2Q L;  3L0O A;  4HIO A;  1LO5 D;  4P74 A;  4LWC A;  2XVS A;  4G7O C;  2EPB A;  1HZ9 A;  4PMB A;  4DUZ Q;  2JQO A;  4A4I A;  1K8G A;  2HHH L;  1I6V C;  1YNX A;  1N36 Q;  4V0B A;  3A8K E;  4HAE A;  2UXB Q;  3E5S A;  4EQ5 A;  5I4D A;  1S5B D;  4YIJ A;  3CCQ A;  1BBX C;  1YJN A;  2QGQ A;  1EQQ A;  5D3D A;  4G57 A;  4YHH Q;  2A5H A;  2PZT A;  2VXW A;  1MHW C;  5LMN L;  4B3T L;  3D4R A;  1B50 A;  3HKS A;  4FO2 A;  2JA8 G;  5IT9 E;  4BWG B;  3OHX C;  2AUJ D;  2EJG C;  2K52 A;  2B63 B;  3KLS A;  4A3F B;  1AN8 A;  4FF3 A;  4LMQ D;  1F77 A;  4AH6 A;  1BF4 A;  4NDX A;  1O80 A;  3EFX D;  1IZ6 A;  4QL5 A;  1E2W A;  1VCI A;  5AJ3 L;  4G7Z C;  2R93 H;  1WD0 A;  4MIU A;  2UUB L;  4LFC L;  5IWA Q;  2RHQ B;  4KHV A;  3K8A A;  1IYV A;  1D1I A;  3U50 C;  3S1Q H;  3ERS X;  2FFK B;  4LNQ A;  1G8Z D;  2EY1 A;  1EYA A;  4TSS A;  4A3M H;  2JSO A;  5ELF A;  3M4P A;  2R92 H;  2JA8 B;  2YTY A;  3FHW A;  1LTL A;  3I55 A;  2PZW A;  4LAA A;  1XNQ L;  5KNB A;  4PQX A;  3G6J B;  3C2P A;  3S1N H;  4A3G H;  4RCO A;  5K36 G;  4XXE A; 
#chains in the Genus database with same CATH homology
 4QIW E;  1YHA A;  3TEH B;  1Y1V G;  3BZC A;  1K0R A;  2R7Z H;  3GTO H;  3I4N G;  2JA6 H;  3H3V I;  3CCS A;  3KDF A;  2GVA A;  5IYC G;  5ELN A;  3PV0 A;  4B3M Q;  3ICE A;  2CCZ A;  3T1H L;  4MNO A;  3NEM A;  4DV2 Q;  1N34 Q;  3F1Z A;  2UXB L;  1VQF A;  4DKA C;  1KC8 C;  1K8G A;  2KBN A;  4PG3 A;  4YCU A;  3U4Z A;  4DR3 Q;  1EWI A;  2UU9 Q;  3HKZ G;  4DR5 L;  1FGU A;  3HOW H;  1EOV A;  4K0K L;  3KOJ A;  1YJ9 A;  3GO5 A;  4YHH L;  4R1J A;  4HJA A;  2IY5 B;  2Z6K A;  1B70 B;  2PMZ E;  3H0G H;  4LF4 Q;  4LF8 L;  1VQK A;  2JA7 H;  3GTL H;  4QJF A;  1JJC B;  5IE8 A;  1MJC A;  3W1G A;  4PZ8 A;  1L0W A;  1X6O A;  5IYD G;  4JI1 Q;  1Q46 A;  5C4X H;  4JI3 L;  1E7Z A;  1MIU A;  4OWT B;  3F8T A;  4R4O A;  1IBK Q;  1IBL L;  2E5L L;  4YWK A;  1KD1 C;  4IPG A;  1LUZ A;  5C4J H;  1QVF A;  3CC4 A;  1OTC A;  3K7U C;  1JB7 A;  2N3S A;  4JI8 L;  3TRZ A;  2JEB I;  4DV1 Q;  4DV4 Q;  4YY3 L;  2MFI A;  1QZH A;  5C44 G;  1EFW A;  3I4M H;  3DM3 A;  2UXD L;  1VQD A;  3I7F A;  2R6G A;  1IYJ B;  3PO2 H;  1RL2 A;  3ULJ A;  4A3J G;  3S1M H;  5EAY A;  4WJ3 M;  4HID A;  3OYY A;  2NN6 G;  4X66 Q;  2GN5 A;  3K81 C;  4DNI A;  4GKJ L;  2XGT A;  1WFQ A;  3UDF A;  2FXQ A;  4A76 A;  3MXN B;  3HOV H;  3PF5 A;  1UE5 A;  4YWM A;  1VQ7 A;  2VQE Q;  2Z0S A;  1P8L A;  2Q2H A;  2AWO A;  4DR2 Q;  3HKZ E;  3E9H A;  1V9P A;  4MZ9 A;  1XMO L;  5H1S E;  2WB1 E;  3CCL A;  3AFQ A;  3RZO H;  1PH3 A;  2JA5 H;  2IX1 A;  2WAQ G;  3CCU A;  4OWW B;  2CKZ B;  3HFZ B;  4LF9 L;  2VUM H;  2IX0 A;  2JK8 A;  4A3M G;  2BH8 A;  4RG1 A;  1VQ6 A;  1GM5 A;  1Z47 A;  3CC2 A;  2N8N A;  1N33 L;  1K3R A;  3PGZ A;  3U58 A;  2R92 G;  2RCN A;  2OTJ A;  4A3K G;  3M3Y H;  1O7I A;  4DR6 L;  4A3B H;  1Q8K A;  4HJ5 A;  4BA1 I;  1ASY A;  4DAY B;  4DV3 Q;  1XNR Q;  2GVB A;  2KHJ A;  3HOX H;  4B3M L;  1EIY B;  2RF4 A;  3H15 A;  1X56 A;  4A3G G;  4OO1 G;  1L1O B;  1OXS C;  2IHF A;  3KDF B;  2R7Z G;  3K7A H;  1FVI A;  4HJ9 A;  1DGS A;  2JJQ A;  4HJ8 A;  2JA6 G;  1PYB A;  2UU9 L;  1GVP A;  2HT1 A;  3B6Y A;  4BBR H;  4GLX A;  4IOC A;  1GO3 E;  1XPO A;  4QQB X;  3W1B A;  3J81 i;  2VY3 A;  3G71 A;  4NXM Q;  2JEA I;  4TQU S;  1V43 A;  3F2C A;  2QEX A;  4GOP B;  2L15 A;  4DR7 Q;  1N9W A;  4DK3 C;  1VQJ A;  1NE3 A;  1E1O A;  3SGI A;  4B3S Q;  5E7N A;  4A75 A;  2MQH A;  4JI1 L;  5M3F H;  4KI0 A;  2ES2 A;  1UEB A;  3GD7 A;  1PH2 A;  4NXN Q;  3KJP A;  2ZJP A;  4GKK Q;  1IBK L;  3H0G G;  5IYB H;  4PMW A;  2JA7 G;  2K50 A;  4KHP Q;  1CKM A;  3KYH C;  4GNX B;  2YTV A;  4A3I H;  2ZTC A;  5FLX c;  3TS2 A;  1VQH A;  3OTO Q;  4DV4 L;  2UUA Q;  5C4X G;  2AHO B;  3UDX A;  4Y7N H;  2I5M X;  2YTX A;  4LUO A;  2OWO A;  4JI4 Q;  2XTI A;  3CPF A;  1HH2 P;  1X3G A;  2VS1 A;  3AYH B;  4PZ7 A;  5IT9 c;  4LF7 Q;  2I5L X;  5GAG C;  1PVO A;  4X64 Q;  3I4M G;  1HR0 Q;  5HY6 A;  3GTM H;  1EIF A;  1LYL A;  3CF5 A;  2BH2 A;  4DV0 L;  1V1Q A;  3PO2 G;  4UP7 A;  1XTD A;  3AFP A;  3F2B A;  4LFA L;  4DR2 L;  4YWL A;  1YJW A;  4IFD J;  4IFD G;  4GN5 A;  2HIX A;  4GN4 B;  3JAM c;  4X65 Q;  1YBY A;  1J5E Q;  3CC7 A;  1EYG A;  4DV6 Q;  1MJE A;  1JE5 A;  2OTL A;  3HOV G;  4P73 A;  1Y14 B;  2Y0S G;  2PQA A;  1E3P A;  2RHS B;  4P75 A;  4LW1 A;  2E2I H;  3PO3 H;  4NB3 A;  2VZA A;  1AE3 A;  3JC6 6;  3STB C;  5M5W H;  2JA5 G;  2NVQ H;  3PCO B;  2LXK A;  3M85 A;  1BVS A;  4AYB G;  2VL6 A;  2VUM G;  3ULL A;  1GD7 A;  4UY8 C;  1L1O A;  1QVC A;  2E2H H;  1XNR L;  5FLM H;  3E9I A;  2B63 H;  4DUZ L;  2Z6K C;  3VDY A;  1YIT A;  2NVX H;  5DLQ E;  2ATW A;  1N36 L;  4A3D H;  1XPU A;  4AQY Q;  4A3B G;  3TQY A;  1HZB A;  3M4O H;  4UP9 A;  3GTP H;  3HOX G;  4GOP A;  3FP9 A;  3EIV A;  4A3C H;  1NJI C;  1C9O A;  4IOA A;  3GTK H;  2MO0 A;  4DR7 L;  1K83 H;  1I50 H;  1WOC A;  4YCV A;  4DUY Q;  1KAW A;  1VQM A;  3RN2 A;  4BBR G;  1PA6 A;  1HR0 W;  1PH6 A;  1LM0 A;  3BJU A;  3H3V H;  1UE7 A;  3PSI A;  2K4K A;  1L2F A;  4JV5 L;  2UXC L;  4GNX A;  4C3I H;  1JJ2 A;  2HHH Q;  3NBH B;  1KRT A;  3AEV A;  3PIP A;  3OTO L;  5M3F G;  2Y0S E;  1NMG A;  1Q7Y C;  3RR5 A;  2UUA L;  4A93 H;  3HOZ H;  1T9H A;  3F2D A;  1R9T H;  1K73 C;  5IYB G;  4R4C A;  2BA1 A;  3G6E A;  4LF6 L;  4JI4 L;  1W3S A;  3EN2 A;  4A3I G;  3CAM A;  1N32 Q;  1Q82 C;  3M9B A;  1HNW Q;  1Q12 A;  4X64 L;  1HR0 L;  1SFO H;  1SLJ A;  5IWA L;  3G4S A;  1XJV A;  3RN5 A;  4DV5 Q;  1PH5 A;  4DR1 Q;  1MKH A;  3NEN A;  4JOI A;  2PI2 E;  3STB D;  3KF6 B;  3I56 A;  4DAM A;  4DK6 C;  4BA2 I;  2R93 G;  3EBE A;  2VQF L;  4Y52 H;  1PV4 A;  3KLW A;  1WJJ A;  1CUK A;  2H5X A;  4DV6 L;  3T1Y Q;  3ULP A;  4JI6 Q;  1YVC A;  1CSP A;  4X62 Q;  1PH9 A;  1WCM H;  2OQ0 A;  1X9N A;  4BBS H;  2UUC Q;  4JYA Q;  1HZA A;  3PUW A;  2D62 A;  1OXT A;  4IPH A;  4TVA B;  5JJK A;  2KEN A;  4LUV A;  4OWX B;  4P72 A;  2PQA B;  4R4I A;  4UP8 A;  1HJP A;  4C3J H;  4BY1 H;  3S16 H;  3HOU H;  4AIM A;  4POF A;  3J81 j;  1Q1E A;  1Q1B A;  1PHJ A;  1XPR A;  1X3E A;  4LFC Q;  1VQ8 A;  3PO3 G;  1VQ9 A;  3CCV A;  1K9M C;  1Y1W H;  2F52 A;  4BY7 H;  4DV2 L;  1M90 C;  2Q2T A;  1N34 L;  3G48 A;  1VQN A;  3NEL A;  2JA9 A;  4DR3 L;  1I94 Q;  5FLM G;  4DPG A;  1J6Q A;  2B63 G;  3JAM i;  2F4V Q;  3S17 H;  4P71 A;  1HNZ Q;  3I4N H;  4A3D G;  1SN8 A;  2CFM A;  4LF4 L;  1FL0 A;  4A3C G;  3HOW G;  1N8R C;  2K14 A;  2KCT A;  2IHE A;  4NPS A;  1KQS A;  4QGU A;  4B3R Q;  2B29 A;  1XMQ Q;  3J80 c;  3DLL A;  1BBU A;  2WAQ E;  1X3F A;  1AH9 A;  2NVT H;  4JI7 Q;  3TRE A;  4DV1 L;  2K5N A;  2NZO A;  5FJ8 H;  2ZJQ A;  1JMC A;  1TWF H;  3HOY H;  5GAE C;  2NN6 I;  4DR5 Q;  1ASZ A;  1H95 A;  1G51 A;  1HNX Q;  1D8L A;  3J7A 5;  1N32 L;  1HNW L;  4A93 G;  1NTG A;  4X66 L;  3HOZ G;  1QVG A;  4DV7 Q;  2YU9 H;  3K80 C;  1VS0 A;  1YZ6 A;  1NMF A;  3KF6 A;  4DV5 L;  1UE6 A;  2MNA A;  4DR1 L;  2ZTE A;  4JBM A;  4JI5 Q;  1VQA A;  4J15 A;  2VQE L;  4IJH A;  4IPC A;  3CCR A;  3KFU A;  4IO9 A;  2BA0 A;  1I3Q H;  2E5L Q;  1IBL Q;  3S2H H;  5JJI A;  2DUD A;  3PUY A;  3T1Y L;  2LXJ A;  2R7F A;  1L1O C;  1PFS A;  3RLN A;  4JI6 L;  4X62 L;  2VW9 A;  1TWC H;  3BU2 A;  2UXD Q;  1UWV A;  1AE2 A;  1C7Y A;  2UUC L;  1WI5 A;  2AWN A;  1TWG H;  4JI2 Q;  4KHZ A;  4EX5 A;  3S1R H;  4OX9 Q;  2ZJR A;  4LFB Q;  1BBW A;  1PH8 A;  1B8A A;  3CD6 A;  2AMC B;  4DR4 Q;  1YIJ A;  1VQP A;  4ME3 A;  4QY7 A;  5LMU Q;  5J3B A;  1PH7 A;  5IP7 H;  4GOP C;  1WCM G;  4L5R C;  4BBS G;  4OO1 I;  3A5Z B;  1SE8 A;  1RIP A;  4ALP A;  3FKI H;  4IPD A;  5BR8 Q;  4DV3 L;  2JE6 I;  1YI2 A;  2Q2U A;  3UE1 A;  1VQI A;  3W5O A;  4RMF A;  5C0X I;  4BY1 G;  4A3F H;  1OXX K;  1Q81 C;  1IL2 A;  4BXX H;  2CWP A;  2EXD A;  2E2J H;  3AQQ A;  4L5Q A;  3RLO A;  1CSQ A;  3J81 c;  1K8A C;  5IY0 A;  1Y1W G;  4GNX C;  4C2M H;  1VQL A;  4NXM L;  4BY7 G;  1KHI A;  1HNZ L;  1NY4 A;  2B3G A;  1VQE A;  2K5H A;  2WP8 J;  1QZG A;  1QUQ B;  2KHI A;  5M5X H;  4FDB A;  1S3O A;  3E0E A;  1S40 A;  1SR3 A;  1OXV A;  4B3S L;  2PNH A;  4R4Q A;  4DR6 Q;  3GDE A;  2HQL A;  4NXN L;  1PH1 A;  3S14 H;  4GKK L;  1YHB A;  4B3R L;  2N78 A;  1XMQ L;  4KHP L;  1JT8 A;  1KL9 A;  3GTQ H;  4OXP A;  4XTC S;  1I6H H;  2I5H A;  2C35 B;  3D31 A;  2A1A A;  2AKW B;  4JI0 Q;  4JI7 L;  3I4O A;  1BKB A;  1X54 A;  4GS3 A;  3RLF A;  4JOI C;  1M1K C;  2JA8 H;  1KXL A;  4UPA A;  3PIO A;  2WB1 G;  4LUZ A;  4A3E H;  1KRS A;  1HNX L;  4YCW A;  1FJG Q;  4LF7 L;  1C0A A;  4AYB E;  1NBW A;  4JC0 A;  3UE0 A;  5LMN Q;  1VQ5 A;  2WFW A;  5FJ8 G;  4DV7 L;  4B3T Q;  1SRU A;  1W2B A;  3IRB A;  3CCE A;  3HOY G;  4GLV B;  5GAD C;  2OQK A;  4JI5 L;  1KIX A;  4IFD I;  2D0P A;  3D0F A;  3PUX A;  1CKN B;  1EQR A;  5M3M H;  1SRO A;  1VQB A;  3J80 i;  5ELO A;  4X65 L;  1J5E L;  1WYD A;  2QA4 A;  3PF4 A;  3L2P A;  3ER0 A;  5M5Y H;  5GQO A;  4H02 A;  2ZM6 Q;  4JI2 L;  2CWA A;  3PUV A;  1G6P A;  4OX9 L;  4LFB L;  2A8V A;  4OON A;  4KLK A;  4DR4 L;  3S24 A;  5AJ3 Q;  5LMU L;  1P16 A;  4JBW A;  3RZD H;  1CKO A;  1SMX A;  1B7Y B;  5BR8 L;  3UDG A;  2UUB Q;  2ASB A;  4DV0 Q;  3LGJ A;  2VNU D;  4LFA Q;  4A3L H;  4GN3 B;  5IP9 H;  5IP7 G;  4O2D A;  2F3I A;  2E8G A;  4AQY L;  4LF5 Q;  3OW2 A;  2R7D A;  3A74 A;  3FKI G;  3A5U A;  2K5V A;  2N49 A;  1S72 A;  1U0L A;  5C3E H;  1Q86 C;  1QUQ A;  4HIK A;  4JBK A;  2K75 A;  2NZH A;  4A3F G;  4HJ7 A;  1Y1V H;  1UE1 A;  4JCV E;  1XNQ Q;  4BXX G;  1PYS B;  4HIM A;  1I5F A;  1D7Q A;  4GLA C;  4DUY L;  1X65 A;  5LMN W;  5IYC H;  1JJG A;  1A8V A;  5GAH C;  1IBM Q;  3L0O A;  4HIO A;  4P74 A;  4L5S A;  4LWC A;  3CXC A;  3GTG H;  2HHH L;  1HZ9 A;  2A19 A;  2JQO A;  1U5K A;  1VQG A;  3UDI A;  4A4I A;  3KJO A;  3L7Z C;  4DUZ Q;  1YNX A;  1TXY A;  4JI0 L;  3T1H Q;  4C3H H;  1N36 Q;  3M4Q A;  3BZK A;  2HIV A;  2UXB Q;  2ALY B;  5C0X J;  5JEA J;  4EQ5 A;  1E24 A;  5JEA G;  5C0X G;  4X6A H;  3GTJ H;  4POG A;  2MO1 A;  1A63 A;  4JBJ A;  3CCQ A;  1YJN A;  1TWH H;  2QGQ A;  1FJG L;  1EQQ A;  4K0K Q;  2NVY H;  3I2Z A;  5IYD H;  4YHH Q;  3TS0 A;  4APV A;  5LMN L;  4B3T L;  3S15 H;  4PZ6 A;  3HKS A;  4LF8 Q;  2JA8 G;  1Z9F A;  1E22 A;  4A3E G;  1GKH A;  3CP0 A;  5GRO A;  2YYZ A;  1YEZ A;  1YHQ A;  1CKN A;  2K52 A;  2KCM A;  2V1C C;  3A0J A;  4JV5 Q;  5C44 H;  2UXC Q;  2D0O A;  4JI3 Q;  2IT1 A;  4IJL A;  1TWA H;  2ID0 A;  4AH6 A;  3CCM A;  1VQ4 A;  4A3J H;  2I0Q A;  1A62 A;  1PH4 A;  4JI8 Q;  1IZ6 A;  2ZM6 L;  4L5T A;  4YY3 Q;  3PUZ A;  1A0I A;  4XIG S;  2ZTD A;  4QL5 A;  5HGQ A;  5M3M G;  4JYA L;  2EQS A;  4R4T A;  3RNU A;  4LF6 Q;  2PI2 A;  1VCI A;  5AJ3 L;  4MTN A;  3S2D H;  2R93 H;  3ZJY C;  1G29 1;  4JG2 A;  1IXR A;  2UUB L;  4LFC L;  5IWA Q;  2RHQ B;  1E1T A;  4GKJ Q;  3K8A A;  3KF8 B;  1HZC A;  3U4V A;  3U50 C;  3S1Q H;  3ERS X;  2Q2I A;  4LNQ A;  3M7N A;  1EUJ A;  2OCE A;  3CMA A;  3J7Z C;  3HOU G;  4LF5 L;  4A3M H;  2EIF A;  3CME A;  3MEF A;  2VQF Q;  1VQO A;  1I94 L;  1XMO Q;  3M4P A;  3CQZ H;  2LSS A;  2R92 H;  3Q8D A;  2F4V L;  3CPW A;  1VQC A;  2YTY A;  3CW2 C;  3CCJ A;  3FHW A;  1LTL A;  4O0A A;  5IP9 G;  2DGY A;  3I55 A;  4A3K H;  1XNQ L;  4A3L G;  4LF9 Q;  2CQO A;  3WWV A;  4WJ4 A;  3S1N H;  5JJL A;  4A3G H;  1X55 A;  2YV5 A;  1N33 Q;  5K36 G;  5C3E G;  1OXU A;  1IBM L;  3K0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...