1SE8A

Structure of single-stranded dna-binding protein (ssb) from d. radiodurans
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
231
structure length
213
Chain Sequence
RGMNHVYLIGALARDPELRYTGNGMAVFEATVAGEDRVRNLPWYHRVSILGKPAEWQAERNLKGGDAVVVEGTLEYRQWEKRSAVNVKALRMEQLGTQPELIQDAGGGVRMSGAMNEVLVLGNVTRDPEIRYTPAGDAVLSLSIAVNENYQDRQGQRQEKVHYIDATLWRDLAENMKELRKGDPVMIMGRLVNEGWTRNSTRVEATRVEALAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Single-strand binding protein
publication title Crystal structure of the Deinococcus radiodurans single-stranded DNA-binding protein suggests a mechanism for coping with DNA damage.
pubmed doi rcsb
source organism Deinococcus radiodurans
total genus 40
structure length 213
sequence length 231
ec nomenclature
pdb deposition date 2004-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1se8A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1se8A02
2AWOA 5IP9H 1CKOA 2HHHQ 4YWKA 2KCTA 3E0EA 4A76A 3I2ZA 3F2BA 4TQUS 4AQYQ 5LMNL 1N32L 3S1MH 2DGYA 3KOJA 2A8VA 3T1HL 3J80i 2HIXA 1C0AA 5C3EH 1B7YB 3AFQA 4NXNL 4OWXB 3K7AH 4X64Q 3H15A 3RN2A 2UXDQ 4LW1A 1Y1VG 1KC8C 3KJPA 4OWWB 4KHPL 3JC66 4BBSH 4DNIA 4BBRH 4B3RL 3T1HQ 1IYJB 3PF5A 4DR7L 3CAMA 1A8VA 4OXPA 3M4OH 4LWCA 4MZ9A 1YJNA 5K36G 2CFMA 1XPRA 1RL2A 2A1AA 4KHPQ 4QY7A 2I5HA 2JJQA 2PMZE 4QJFA 3I55A 3G6EA 4A3BH 3I56A 4L5SA 4DR5L 3RLNA 1VQ7A 4DV4L 4DR7Q 1LM0A 1KIXA 1HZ9A 1AH9A 3PUVA 3HOUH 4GOPC 3PO2H 3CCUA 1L1OA 3PIPA 1KHIA 1LTLA 4R1JA 2Z6KC 1K83H 3GTGH 1GVPA 4DUZQ 1YHBA 2WAQG 4P72A 3ULLA 1MJEA 1GM5A 3TEHB 4DR5Q 2IHEA 3M9BA 1VQ4A 1S40A 4A3LG 4DV4Q 1IBKL 5JJLA 3BZCA 3RNUA 1JJGA 4HJ9A 3HFZB 4DV5L 3T1YL 2R7ZH 1BKBA 1A63A 4OO1I 1WCMG 4GN3B 2EXDA 2JEBI 4JI8L 4C3HH 2UXCL 1E3PA 5IYDG 1XMOL 2JK8A 1I50H 4A75A 1PH9A 1IBKQ 4A3FG 4BXXH 1Z9FA 4A3CG 2K14A 4DV5Q 2Y0SE 3T1YQ 3STBC 4GN4B 5FLMG 3HOWG 4L5QA 4A3MG 2UUCL 2OQ0A 3H3VI 1VQJA 1XMOQ 4LUVA 3OW2A 2E5LQ 3AFPA 2R7FA 2NN6G 4LFCL 5FJ8G 4X65L 3TS0A 2RHQB 1X3FA 4LF8L 5DLQE 1YI2A 3J7A5 4ME3A 1PH7A 4BY7G 1PHJA 4A3EG 3G71A 3CC2A 4JI4Q 1BVSA 2Q2IA 1PH6A 1OXSC 2RHSB 2AKWB 2UUCQ 5IYCH 2WB1G 4IJLA 2VL6A 4R4QA 3U58A 3TS2A 3W1BA 3VDYA 4A3GH 4QL5A 2IX1A 1AE2A 2Q2TA 2FXQA 1B70B 2GN5A 1ASYA 3S16H 4LFCQ 4X65Q 3EN2A 1JB7A 4LF8Q 1C7YA 1E24A 1M90C 3M4PA 2VZAA 1YZ6A 4LF5L 3CCMA 4POGA 1SR3A 2OCEA 4DR2L 1JT8A 1V9PA 3CCQA 4K0KL 1EWIA 1KXLA 1Q1BA 1Q46A 4PMWA 2OQKA 3S1RH 1GD7A 4LFBL 2JA5H 1UE7A 2IY5B 2VQEL 1VQLA 1WYDA 1JE5A 1V43A 1QVCA 2KHIA 3AQQA 3I4OA 4C3IH 4AIMA 2QEXA 4LF5Q 1EYGA 4DR2Q 4TVAB 1EQQA 1HZCA 4K0KQ 1K0RA 2ALYB 2K5NA 1HH2P 1M1KC 1J5EL 4DV7L 4AYBG 1UE1A 1IBML 1WFQA 3UDFA 2VUMH 3GO5A 5J3BA 1Q82C 4XIGS 4LFBQ 1E22A 3CD6A 2E8GA 4B3ML 4FDBA 3U50C 4UY8C 4DUYL 5HY6A 1Y1VH 1XTDA 4KLKA 1L1OB 2WB1E 3H0GH 4WJ4A 1SFOH 3HKZG 4JI1Q 4LUOA 4MNOA 4LUZA 4JOIC 5M3FH 1J5EQ 4DV7Q 1N32Q 5GAEC 1OXTA 2JA6G 3A74A 1D7QA 2KENA 4YY3L 1TXYA 1YJWA 4LNQA 4DAYB 5C4JH 5LMNW 1P8LA 4P75A 5M5XH 3G4SA 3MEFA 4DUYQ 3GTLH 2NZHA 2A19A 2GVAA 2CWAA 2CKZB 1MIUA 4BY1G 2JA7G 2R93H 3BJUA 3CXCA 3HKSA 2LXJA 2NVTH 1IL2A 4DR3L 2JA8H 3L0OA 3W5OA 1VQIA 4OONA 1S72A 1NE3A 1VQ6A 4YY3Q 1SRUA 3K0XA 3PGZA 4GLVB 1V1QA 3K80C 4MTNA 1VQ5A 4IOAA 1S3OA 3CMAA 4J15A 4X62Q 3PO3H 5IP7G 4DV0L 2ASBA 4IOCA 2R6GA 1TWGH 1SROA 3I4MG 4AH6A 2E2JH 4LFAL 2WP8J 4AYBE 3CMEA 5LMUL 5GQOA 4HIDA 1YITA 5GADC 3ICEA 2CQOA 2IT1A 2YTVA 1PYBA 5FLXc 5LMNQ 2C35B 1XMQL 3PF4A 3HOZH 1HR0W 1TWFH 4DV0Q 1K3RA 4NXNQ 1TWAH 1VQOA 1K8GA 1TWHH 3PUZA 1L1OC 1YHAA 4IPHA 1EIYB 1E7ZA 5JEAJ 3RZDH 2Q2HA 1I6HH 4UP9A 4OWTB 2ZTDA 2JEAI 3H3VH 3I7FA 1HR0L 1XMQQ 4B3RQ 4JI5L 3HOYG 3HOWH 4PZ8A 4A93H 2UXBL 1GKHA 1UWVA 3L7ZC 1VQHA 4B3TL 3E9IA 1PA6A 3J81j 1SLJA 1L2FA 2UU9L 4JBWA 2UUBL 1KAWA 4HJAA 3I4NG 2EQSA 1WI5A 4NB3A 2BH8A 5FJ8H 3CCRA 1HR0Q 3RLOA 2K4KA 1VQFA 3S2DH 1WJJA 1VQNA 4Y7NH 2UXBQ 2DUDA 5M3MG 4JI6L 3GTQH 4B3TQ 1X3GA 3F2CA 2OTLA 2UUBQ 4YCWA 1PFSA 4A3IG 2E2IH 2UU9Q 3E9HA 4RMFA 5IP9G 3PUYA 3A5ZB 1CUKA 2K75A 4GLXA 2JA9A 4LF7L 1JJCB 1CKMA 3PV0A 4OX9L 5C0XG 3STBD 5C3EG 2NVXH 3ZJYC 2R92H 1Q8KA 2MO1A 1I5FA 3B6YA 4IPDA 3TQYA 4L5RC 2ZJPA 1Y1WH 5IYBH 1KQSA 2AWNA 3CP0A 3GD7A 4NPSA 3CCSA 3GTOH 1VQ9A 4JI8Q 3JAMi 1XNQL 4BBSG 4JBKA 3K7UC 2UXCQ 1G291 2ATWA 1VQAA 2GVBA 2JQOA 4BBRG 4OX9Q 1IBLL 1X56A 1YJ9A 1FJGL 1UE6A 1VQDA 1KL9A 1SE8A 4JV5L 3W1GA 2B63H 3J7ZC 3ER0A 4A3KH 1NY4A 3GTPH 2KHJA 3CQZH 5M5WH 2CCZA 2WAQE 1XPUA 1XNQQ 4A3BG 1YNXA 2MFIA 2N8NA 3KF6A 1SMXA 1FL0A 4LF6L 2NN6I 4A3DH 3BU2A 1HZBA 2I5MX 1IBLQ 1K73C 1FVIA 3UE0A 1FJGQ 1X65A 3KLWA 3PUWA 3FKIH 4R4IA 1ASZA 4GKKL 4JV5Q 3HOUG 2AMCB 3PO2G 4YCUA 1N9WA 1PYSB 3GDEA 5JJKA 2I5LX 1Q86C 1W3SA 3U4VA 2ZJRA 2MQHA 4A3JH 1W2BA 2F52A 1N34L 4HIOA 1MJCA 4LF6Q 4YHHL 2VQFL 1KRTA 1G51A 4ALPA 1VCIA 4QIWE 4GKKQ 4DV6L 4JI3L 3CC7A 5C4XH 3CCVA 1QUQA 2ES2A 1X55A 1HZAA 1L0WA 1EIFA 2R7ZG 3KDFA 4HJ8A 3HOXH 5C44G 3LGJA 4DV1L 3EBEA 4YCVA 1I94L 1N34Q 4EX5A 5IE8A 2YYZA 5ELOA 4EQ5A 4YHHQ 3J81c 3TRZA 4UP7A 1GO3E 4JI7L 4JYAL 4DR6L 1LYLA 1D8LA 4GKJL 4UP8A 4DV6Q 4JI3Q 3JAMc 1IXRA 3PCOB 2Z0SA 4P71A 3RLFA 3UDIA 4DK3C 2MNAA 1TWCH 2VQEQ 1I94Q 4DV1Q 1QZHA 2IHFA 3Q8DA 1U0LA 4IPCA 1HNWL 1IZ6A 2V1CC 3EIVA 1QZGA 2E2HH 4P73A 4DKAC 2YU9H 4NXML 1BBWA 1EQRA 1IBMQ 1E1OA 1UE5A 4B3SL 4JI7Q 4JYAQ 1XNRL 5GAGC 1YIJA 1Q81C 4IFDG 4B3MQ 1Y14B 4GKJQ 1PV4A 4UPAA 1PH2A 2BH2A 5H1SE 1YVCA 3FP9A 2I0QA 4A4IA 3ERSX 1Q1EA 3PSIA 5IYCG 4DR1L 4A3GG 4P74A 3CW2C 4DK6C 4WJ3M 3HOYH 3KF8B 1XNRQ 1A62A 3NENA 2LXKA 1PH5A 3F8TA 3M7NA 3IRBA 4DR1Q 2CWPA 4AQYL 4DR3Q 3M4QA 4A3LH 2BA0A 4YWMA 1VQKA 3S1NH 2JA5G 5GROA 4HIMA 1EOVA 2OWOA 1PH4A 2BA1A 1EUJA 3CCLA 2KBNA 4IPGA 1WCMH 1VQEA 4GNXA 5IY0A 2LSSA 2AHOB 3HKZE 5M5YH 1HNZL 5IYDH 4LFAQ 2KCMA 5LMUQ 3S24A 2VUMG 4A3FH 3KF6B 1G6PA 3RR5A 2PQAB 3D31A 2N78A 4JCVE 4X66L 4A3CH 4DV3L 4APVA 3UDGA 4R4CA 1CKNA 5FLMH 1DGSA 2HT1A 4A3MH 3WWVA 2K52A 3H0GG 1K8AC 4JI0L 2NVQH 1HNZQ 2N49A 4JBMA 5M3FG 4RG1A 2QGQA 4DPGA 1PH1A 1OXVA 2NZOA 3HOVG 1X3EA 1Q12A 4X66Q 4O0AA 2YTYA 1X54A 4LF9L 1N33L 2YTXA 4DV3Q 4DR4L 4BY7H 4JI5Q 4JC0A 1X9NA 2Y0SG 4A3EH 4BA1I 2UUAL 1QUQB 3U4ZA 4JI0Q 1T9HA 2D0PA 3KDFB 4DUZL 2R93G 3FHWA 4R4TA 4YWLA 1CSQA 3D0FA 1KD1C 2JA8G 4HJ7A 3L2PA 5JJIA 2K50A 4IFDJ 4LF9Q 2VNUD 1X6OA 1N33Q 4DR4Q 3GTKH 4PG3A 1BBUA 3CCJA 1H95A 5HGQA 2D0OA 1JMCA 3PUXA 3PO3G 4QQBX 1VS0A 2UUAQ 1NJIC 4L5TA 4JI6Q 3J81i 4OO1G 3GTJH 5IWAL 3BZKA 2ID0A 5GAHC 5C0XI 1QVGA 3CC4A 4LF7Q 5E7NA 2PI2E 4KHZA 1A0IA 4GOPA 3HOZG 2N3SA 1NMGA 2PNHA 3GTMH 1U5KA 3G48A 3OYYA 4LF4L 2Z6KA 5C44H 1VQGA 3NBHB 3J80c 4C2MH 3F2DA 3RZOH 5IWAQ 3S1QH 2ZTCA 2RF4A 2QA4A 5EAYA 4O2DA 1YBYA 2ZM6L 2E5LL 2VY3A 2PQAA 2PI2A 1SN8A 1XJVA 2F4VL 1VQ8A 1RIPA 2K5VA 1VQPA 1E1TA 4KI0A 4JI4L 3UDXA 4LF4Q 4A93G 2MO0A 4PZ6A 1MKHA 4GLAC 2NVYH 2JA6H 4Y52H 3K8AA 1NTGA 2ZM6Q 4GN5A 2B3GA 5IT9c 1B8AA 1AE3A 3CPWA 3RN5A 2F4VQ 1LUZA 1HJPA 1NMFA 2RCNA 2VS1A 1N36L 4IO9A 4BY1H 1R9TH 2JA7H 3S2HH 4DV2L 3S14H 3PIOA 4R4OA 4GNXB 2HQLA 2XGTA 1PH8A 1OTCA 3S15H 2VW9A 4JG2A 1J6QA 1NBWA 2L15A 4BA2I 3AEVA 2Q2UA 1VQBA 2R7DA 1P16A 1FGUA 2VQFQ 1Q7YC 4HIKA 4BXXG 4GS3A 2K5HA 2R92G 5IP7H 1N36Q 1C9OA 1YEZA 3AYHB 3CPFA 1CKNB 4QGUA 1I3QH 4DV2Q 4HJ5A 3I4MH 1Y1WG 5IYBG 3TREA 5JEAG 1HNXL 1XPOA 2WFWA 3K81C 3CCEA 3MXNB 4PZ7A 4JI2L 1CSPA 3A0JA 4C3JH 5C0XJ 1UEBA 3ULJA 2ZTEA 1PVOA 1OXXK 1K9MC 4DR6Q 4X6AH 2YV5A 1O7IA 2B63G 3KJOA 4A3KG 4JI1L 1HNWQ 2F3IA 1VQMA 3OTOL 1HNXQ 1YHQA 3KYHC 1N8RC 1WOCA 4JI2Q 1KRSA 3NELA 4NXMQ 1VQCA 2JE6I 4A3DG 4IFDI 4B3SQ 2H5XA 4POFA 1Z47A 3KFUA 5AJ3L 2D62A 3FKIG 2IX0A 5BR8L 3CF5A 2OTJA 3ULPA 3S17H 3M3YH 1OXUA 3UE1A 5ELNA 1JJ2A 4GNXC 4A3JG 1EFWA 1QVFA 3OTOQ 3F1ZA 3HOVH 2XTIA 4H02A 2HHHL 3I4NH 3M85A 4IJHA 4DAMA 3SGIA 2ZJQA 4X62L 5AJ3Q 3NEMA 5BR8Q 3DLLA 4X64L 5M3MH 2B29A 4JBJA 4GOPB 2EIFA 3A5UA 1PH3A 2UXDL 5C4XG 4XTCS 2HIVA 4A3IH 3HOXG 4JOIA 3DM3A
chains in the Genus database with same CATH superfamily
2BE5D 3E0EA 4AQYQ 3I2ZA 4TQUS 1N32L 1LABA 2LY7A 5C0XH 3HEJA 3T1HL 1B7YB 3EA6A 3K7AH 3H15A 4M8AA 3R93A 4ZCKA 1PDQA 1Y1VG 3M3YB 1KC8C 4OWWB 4ODGA 1BOSA 3I4NB 4B3RL 2FHTA 1A8VA 1PFNA 4LWCA 1YJNA 5K36G 1GHKA 4XDXA 2KHSA 2I5HA 4A3IB 3G6EA 4A3BH 2B2YA 3MZ5A 4NW2A 4UDUC 4XYQA 4DV4L 4DR7Q 1LM0A 5EPKA 1HZ9A 4DXGA 5T1GA 3CCUA 1BR9A 3K7AB 4OL7A 3F2UA 1K83H 4L8JA 5LHY1 2WAQG 4P72A 1GM5A 1MJEA 3TEHB 3VR2A 2IHEA 3ZYYX 1VQ4A 1S40A 4NMZA 4A3LG 1IBKL 2K32A 1JJGA 4HJ9A 4DV5L 3T1YL 1EY8A 1ZXTA 2L5TA 1BKBA 1A63A 4GN3B 1HCZA 1QOHA 2EXDA 2JEBI 1YNNC 2UXCL 4K6DA 4A3BB 2JK8A 4A75A 4KD4A 2PQEA 5KNCA 2EYJA 4GN4B 4L5QA 4CDEC 5ISRA 2PW5A 4ID6A 1K83B 1LTSD 1JC7A 1TT2A 2KVMA 2NN6G 3TS0A 1X3FA 5DLQE 5J22A 4JK1C 1E2VA 4ME3A 5HURA 1KDCA 2UUCQ 2EYPA 2WB1G 2PZUA 3TS2A 3W1BA 3VDYA 1QWYA 2FXQA 3DEPA 1TS5A 1JB7A 4LF8Q 3CU7A 1STBA 1E24A 3VR6A 3A54A 5K5PA 1YZ6A 3ND9A 5F2DA 3MFYA 1SR3A 3E3XA 1JT8A 5G3LD 4K0KL 2B2TC 3MVVA 3S1RH 1PXUA 1GUWA 3P1HA 1LTTD 1UE7A 2IY5B 4HSVA 3OW7A 2VQEL 3I8ZA 3I4OA 3RD4A 3SE0A 2QEXA 4LF5Q 2TSSA 4DR2Q 4TVAB 1K0RA 4QQBX 4AYBG 1UE1A 1IBML 4XIGS 1CA6A 3HRZC 3CD6A 1VF7A 3FPPA 4UY8C 2F0VA 4DUYL 1L1OB 1A2TA 1TR5A 1J5EQ 4DV7Q 2JA6G 3X3MA 1BO0A 2K01A 3A74A 1D7QA 3S1RB 1YJWA 1TXYA 3I70A 4FP5D 2F0MA 4P75A 2KCCA 3MEFA 3GTLH 2GVAA 3HS0C 3QOLA 3NQTA 2LXJA 4DR3L 3V96A 1KABA 1VQIA 4OONA 1NE3A 1SRUA 2ZXPA 4GLVB 4MTNA 5CMDA 1VQ5A 3FMCA 1S3OA 4EQOA 3CMAA 3PO3H 2R3ZA 5EQ0A 1DD2A 4DV0L 2R6GA 1SROA 2F0EA 2WINB 4OO1H 2WP8J 1STHA 3L3OC 1YITA 2B2YC 2YTVA 2IT1A 1N32Q 1XMQL 1Q90A 5ELBA 1TWAH 3I4LA 2C9OA 2G9HD 5IIFA 2RSOA 4UP9A 5J39A 4B3RQ 4JI5L 2SEBD 3HOWH 4A93H 1LTID 4ME5A 4QUFA 1VQHA 4TKOB 3J81j 1L2FA 4HJAA 1B53A 2QDBA 2B8GA 4NB3A 2BH8A 4DF7A 2PYKA 3S2DH 1C8CA 1MHWC 1VQNA 1FGBD 4JI6L 3GTQH 4DK1A 3F2CA 1TWAB 2UU9Q 1SAPA 4RMFA 3PUYA 4GLXA 2K75A 1Q8IA 1ILQA 3A8JE 3OOCA 3PV0A 1D6EC 1Q8KA 1I5FA 3K5LA 3HOWB 4FXGC 4A3MB 4A93B 1Y1WH 5IYBH 1KQSA 1NAPA 2AWNA 3GTOH 1VQ9A 2L4NA 2UXCQ 1MBYA 1LTAD 5CV6A 4OX9Q 1IBLL 3MAQA 1YJ9A 1UE6A 1BQQT 1ESFA 3S2DB 4JV5L 5CORA 2B63H 2EZVA 1NY4A 3GTQB 5M5WH 1YNXA 2MFIA 2N8NA 1SMXA 5AFWA 5CBAE 1RTOA 1FJGQ 1X65A 3KLWA 3PUWA 3FKIH 3PO2G 1PYSB 3GDEA 3SK8A 1O7ZA 1GHJA 2ZJRA 1W2BA 1Y1WB 3GTOB 2ZT9C 4LF6Q 2A69D 1KRTA 2EJFC 5C4XH 2R7ZG 1EIFA 2B63B 3JAME 2A6HC 5C44G 4YCVA 4EX5A 4YIJA 5C5MA 5M5WB 2YYZA 4EQ5A 3TRZA 1GO3E 4DR6L 3GTMH 1DM0B 1IXRA 2VQEQ 3FKIB 1HNWL 1UEAB 1U0LA 4IPCA 2V1CC 5I6YA 4X3TA 2BDOA 2YU9H 4NXML 1EQRA 1IBMQ 1E1OA 1VMCA 4GKJQ 2EOTA 4I65A 4J1MA 1PH2A 1PV4A 3E5SA 5H1SE 5K36H 1V1PA 1R4PB 5FKAC 2I0QA 5C4XB 3ERSX 1B3QA 5C4ZA 4DR1L 2F0JA 3E0JA 4F88A 4DK6C 4WJ3M 3HOYH 3T51B 3SK4A 3NENA 2VB3X 1SNPA 2Q8RE 5FLXE 1PH5A 3F8TA 3GTMB 4FF2A 1QNUA 4DR3Q 4WFN3 4A3LH 1RHPA 2QW7A 2BA0A 4YWMA 2YU9B 3S1NH 2JA5G 1PRTF 5GROA 1CK1A 1JR0D 1EOVA 2EJMA 3IAYA 1LV9A 2BA1A 1PH4A 1EUJA 3CCLA 5C5LA 3HKZE 2FMCA 2XIWA 2TMPA 3FEWX 3RUZA 3S24A 3KF6B 1MD2D 3D31A 2XN9C 4JCVE 3HOYB 4APVA 5JPNC 2MPMA 2KEEA 3M7GA 4JI0L 1HNZQ 4N9TA 2WAQB 4DPGA 1CM9A 4X3KA 1X3QA 1X3EA 4X66Q 2NN6H 1R4QB 4DR4L 4RAUC 4JI5Q 4QB4A 5CV8A 3KBGA 2RSNA 4BA1I 1F9QA 2R93G 2IWHA 1B1ZA 1DYQA 3FHWA 3DUZA 3D0FA 4R4TA 4YWLA 3JAML 4DAVA 4IFDJ 4CKBA 2K04A 5C6AA 2R61A 2D0OA 2SNMA 3PUXA 4JW0A 1HPCA 3NTHA 3Q6SA 4H13C 1AZPA 4L5TA 4JI6Q 2IX3A 3EJIA 1ENAA 1ZEQX 3DWAA 5IWAL 2ID0A 2PZTA 5ELEA 5C0XI 4HEDA 1QVGA 2VB2X 2PI2E 4V0BA 4KHZA 1NNXA 4GOPA 3HOZG 3KBXA 4IURA 3F2DA 1FR3A 3NP8A 2WB1B 2RF4A 3MXUA 5DNFA 5DM73 1SN8A 1IYUA 3SEBA 1O78A 1VQ8A 1RIPA 2K5VA 1E1TA 4KI0A 4JI4L 4LF4Q 4KN7C 1WD0A 1MKHA 1I4HA 5IGBA 1F2ZA 2JA6H 2NWGA 3CHBD 5BN4A 2A68D 1B8AA 2F4VQ 2B2VA 4WORA 1N36L 5I9PA 3NPPA 1QE6A 5BN3A 4R4OA 4GNXB 2XGTA 2A6ED 2VW9A 2F0NA 4CKCA 4PNYA 2SDFA 3AEVA 4AYBB 1FGUA 2B8FA 4LAAA 2DY8A 4HIKA 2C5CA 4GS3A 2K33A 5BN5A 1CKNB 4QGUA 2KUMA 1RF2D 1XPOA 2WFWA 3MXNB 1EY0A 2JA6B 3A0JA 1K9MC 4DR6Q 1Z6HA 3AMUA 4H0LC 3W3AA 4EVOA 4JI1L 3P75A 1HNWQ 1VMPA 5KNBA 1VQMA 3ONAB 1YHQA 1N8RC 4JI2Q 4NXMQ 2A74C 2JYOA 4KY6A 3KFUA 2D62A 4FXDA 1S5CD 4IUNA 1OXUA 3UE1A 5ELNA 1EFWA 5A2QE 4OIKA 3OTOQ 3F1ZA 2XTIA 4U673 1OO9B 5EGTA 5DEHA 1DZ1A 2QDLA 3SGIA 4S3SA 2ZJQA 3NHHA 5EPLA 3NEMA 4WRDA 4XTCS 4JOIA 1CKOA 4BWGB 2CHBD 3KOJA 2HIXA 1C0AA 1ILPA 4G57A 3AFQA 1MI2A 4OWXB 4C1NI 4RHRA 1EWHA 2ICEC 2B2WC 3KJPA 3H91A 1EIHA 1LT3D 1MSHA 3T4AC 3PF5A 4DR7L 3A7LA 4HTHA 1GUTA 3M4OH 4MZ9A 1SYEA 1AEXA 2CFMA 4IQZA 1XPRA 4KHPQ 2JJQA 2PMZE 4QJFA 1W6JA 2JA8B 4G7HC 1LT4D 1AN8A 2NZ1D 2XRQD 1CA5A 3PO2H 1SE3A 4GOPC 3NSWA 1L1OA 3A8KE 2EY6A 4R1JA 3PIP3 3D4RA 4RH6A 3D4WA 4NDXA 4K6LA 3ULLA 3J80E 4DR5Q 3CRKC 3M9BA 1SE4A 2RCFA 3BDLA 2RBMA 1NR2A 2K1BA 1X3PA 4H44C 2R7ZH 3M4OB 1ET6A 1I4GA 1WCMG 2DJGC 4OO1I 4ZK9B 4JI8L 4C3HH 3GV3A 1CT1D 1E3PA 5IYDG 3NE5B 1I50H 4A3FG 4A3CG 2B2VC 2Y0SE 5IT9E 3TP6A 5FLMG 3PO2B 3HOWG 4A3MG 2B2UA 2F0DA 1A3TA 3K59A 5JVG3 1PFMA 1TS2A 2SNSA 2OQ0A 2UUCL 2KA7A 5A2QL 3DHQA 2R7FA 1RDPD 1SBBB 1D1IA 4LF8L 1QNKA 3GV6A 3GP7A 4ZLTF 3G71A 1PHJA 3CC2A 4JI4Q 1PH6A 2R7ZB 2RHSB 4F7XA 2VL6A 3U58A 3SVMA 1FNVA 4C3HB 5D14A 2Q2TA 2QKIC 4LFCQ 5DM63 4X65Q 3Q22A 1STAA 1FNUA 1M90C 4FF3A 4LF5L 4POGA 3T53B 2OCEA 3NK9A 4UHVA 4DR2L 2L9HA 1HRJA 3CCQA 4PMWA 2OQKA 3BYYB 2JA5H 2A69C 4RCNA 1WYDA 1V43A 3AQQA 3QG1A 2OEOA 1Y69U 1KNEA 2CW0D 1PZID 1EQQA 2O2LD 5D3DA 1ZKOA 4DV7L 1J5EL 4LFBQ 1Q82C 1L0XB 2E8GA 3C1EA 1QB5D 2MP1A 4X3UA 1DCZA 2MGSA 3HKZG 4JI1Q 3VYSA 4CKEA 4JOIC 3J80L 5JVH3 2JA5B 5C4JH 1GUOA 3C3LA 3QO2A 2A19A 1A15A 1E0BA 2CWAA 1ZYRD 2F0TA 2R93H 3LNNA 2NVTH 4LK1C 1S5BD 3L0OA 4GZYC 1S72A 1VQ6A 1WTWA 4IN3A 3Q24A 1TIID 1K8OA 5IP7G 4IOCA 1I6VC 1TWCB 1TWGH 4G7OC 3T16A 4UAIA 5IT9L 4AH6A 4RGOS 3CMEA 3DEOA 2EJGC 5GQOA 3H94A 5GADC 2CQOA 5FLXc 1SXTA 1IYVA 2C35B 3HOZH 1HR0W 1TWFH 5C4JB 1LTGD 3SXHA 1L1OC 3RZDH 2Q2HA 1I6HH 2R93B 4IALA 2NVTB 1GXDC 2RVLA 3HOYG 3OWFA 2UU9L 1TWGB 3QOJA 1KAWA 4PV1C 1TS3A 1U9RA 1XTCD 2EQSA 1H9JA 2PW7A 5FJ8H 1HR0Q 1VQFA 1WJJA 2H4OA 3VYRA 3HOZB 4Y7NH 4DXFA 2DUDA 1PYWD 1TWFB 5M3MG 3K5NA 2OTLA 2UUBQ 2B2UC 1BNZA 2F0QA 3A5ZB 3OIPA 3RZDB 1I6HB 1PRTB 5A35A 1JJCB 4OX9L 2DJFC 2HQEA 3ZJYC 4BS9A 1NCVA 1XX8A 5CV9A 5DAUA 3CP0A 5C3XA 2F0OA 3GD7A 2ZXRA 4NPSA 1TQOA 4JI8Q 2J4XA 3JAMi 4BBSG 1VQAA 2GVBA 4BBRG 1A3UA 1FJGL 4HCSA 1II3A 4Y7NB 1JB3A 2DNCA 2NB0A 1XPUA 2K5DA 1CZGA 1XNQQ 3KF6A 4LF6L 2NN6I 3BU2A 1HZBA 2Q8TA 4DU9A 3UE0A 1YNJD 4R4IA 3R2TA 3HOUG 1KDAA 1AP0A 3V05A 2MQHA 2F52A 1S5DD 1I4XA 2VQFL 2WKCA 4ALPA 4QIWE 2A68C 3BS1A 1ET9A 1X55A 1EYDA 2HCIA 4HJ8A 4KKUA 3E6ZX 1N34Q 1U4LA 1TVXA 2A6EC 4PQXA 3PQIA 5LL6X 3K57A 4GKJL 4DV6Q 4JI3Q 2EPBA 2Z0SA 1DOLA 1I94Q 1AFPA 2IHFA 3VA7A 1JE4A 4KJOA 1ICWA 1QZGA 3J7YW 1F77A 4JYAQ 2RDFA 3VR5A 1YIJA 1Q81C 4XQJA 3QWNA 1I4RA 4IFDG 2BH2A 3NBIA 1B9MA 3FP9A 1Q1EA 3OHXC 1A3VA 5IYCG 1HA6A 4P74A 4K5VA 1RODA 1EYCA 2AUKA 1XNRQ 1A62A 3NXWA 2PPBC 3DMUA 2QILA 3I3CA 3IRBA 1QILA 2XNAC 1SYFA 5C4HA 1GUGA 1STNA 2LKVA 1T5XD 2OWOA 1WCMH 1VQEA 4GNXA 3DWQA 4DAPA 1F9SA 2LSSA 5M5YH 3HG9A 3DM1A 1BUVT 1HNZL 5IYDH 2KCMA 2RA4A 2VUMG 4A3FH 2K6AA 4A3CH 4OIJA 4X66L 1STEA 3MTSA 2JN4A 1CHQD 1JOQA 1CFMA 2Z9HA 4R4CA 1CKNA 5FLMH 2HT1A 4A3MH 5I4DA 3WWVA 3HGBA 2L0CA 3CKIB 5M3FG 3MXNA 1OXVA 2NZOA 3EVQA 4I7ZC 2YTYA 4DV3Q 3BG3A 1NR4A 4QCLA 2Y0SG 4EQNA 4XT3B 1H9KA 3GQBA 2D0PA 1WCMB 3KDFB 1CSQA 3BZDB 5HGTA 1KD1C 2JA8G 5M5YB 4ZQ3A 1FNWA 2K50A 2F4IA 4PG3A 3CCJA 4A3FB 5HGQA 3I90A 4HSPA 1VS0A 2UUAQ 1NJIC 1O7YA 3BZKA 2KEDA 5GAHC 3CC4A 2Z4HA 2MHVA 1NMGA 2PNHA 3NQIA 4FO2A 1SNQA 1U5KA 4LF4L 1SE2A 2Z6KA 4L6TB 1VQGA 3J80c 1UAPA 1B3AA 2ZTCA 1XWEA 1YBYA 2PQAA 2B39A 3C46A 4ZRZA 3P20A 1XJVA 2F4VL 3W2DA 2E75C 4OGQC 2L1BA 1HA5A 5E4WC 1VQPA 3TMEA 3UDXA 1F9RA 4CHTB 1PRTD 2DN8A 1EEFD 2V4DA 3K8AA 1NTGA 4DNTB 4XXEA 5IT9c 3RN5A 3J81E 2RCNA 2VS1A 1SNDA 1R9TH 1Y8OB 2HQLA 3PIO3 1LLRD 2FMMA 1OTCA 2EYMA 1NBWA 1FD7D 4ZAIA 4C3HG 1LTBD 2VQFQ 2K5HA 2R92G 2F03A 5IP7H 1C9OA 2EYLA 3CPFA 3HP3A 3SDZA 3URYA 2J0TD 3HKZB 5E4XA 4JI2L 5FO9B 1Y8NB 2K7VA 3TN2A 1WTHA 3M4YA 3BVGA 1O7IA 5LL6S 2CH4W 2PCFB 3KJOA 1R9TB 3OTOL 1HNXQ 2CW0C 1ESRA 1WOCA 1KRSA 2JE6I 2H5XA 1PZJD 4P2CB 3S17H 1X32A 2WKDA 1SYBA 4GNXC 1LT6D 3K5MA 4A3JG 4IUVA 3HOVH 1G91A 4H02A 1SNCA 5AJ3Q 5BR8Q 5M3MH 4ZUJA 4LMQD 3A7AB 2HIVA 3AB9A 1ZYRC 1BCPF 4K5WA 2AWOA 3NTKA 4NP5A 2HHHQ 4YWKA 4X3SA 5ELCA 3F2BA 5LMNL 5FO7B 2BE5C 3J80i 2IW3A 2LFNA 2NUCA 4KD3A 2H1EA 5E1FA 5CGKA 3I72A 5JPMC 1D5ZC 3S17B 1K3BC 3H0GB 5NUCA 1SFOB 4KHPL 2K28A 4BBSH 3I91A 3HOVB 5FOBB 4BBRH 1HUMA 1IYJB 1LT5D 4RGNA 5M3MB 3J81L 3EFXD 4KJNA 1RL2A 2B2WA 4QY7A 3I55A 3TP5A 3MC0B 4L5SA 2P5ZX 4DR5L 1VQ7A 2HD3A 1AH9A 3HOUH 5M9OA 3PIPA 1LTLA 2F0GA 2Z6KC 4DK0A 4BBSB 2QCPX 5JJLA 2Q8IB 3BZCA 4BBRB 2CH4A 3OIQA 2F0FA 3HFZB 2ZXOA 4C56C 5CV7A 1CI3M 3H6MA 5I2YA 3A56A 3D4DA 2ENBA 1PH9A 1Z9FA 1BDOA 1D5XC 2K14A 3HOUB 4IUPA 3LWUA 1U4RA 5JOBA 2O4XA 1VQJA 1XMOQ 1O7LA 4LUVA 3MXGA 3OW2A 3AFPA 3A55A 4LFCL 5FJ8G 4IFDH 4X65L 1YI2A 3J7A5 1PH7A 4ZKCB 4HAEA 2A5HA 5IYCH 1DJRD 4IJLA 4R4QA 1AE2A 3EN2A 3VYTA 1IW7D 1ENFA 1YNJC 2AQ3B 2F1MA 3M4PA 2VZAA 1DXMA 2LMCB 5JJZA 5CV5A 4B08A 1EWIA 1KXLA 1Q46A 4LFBL 1C4QA 1EU3A 2X69A 3MEHA 4C3IH 1CTMA 1HZCA 1M1KC 1ICFB 2VUMH 3UDFA 5J3BA 5IODA 1E22A 3Q23A 1SSOA 4Z9CB 2WB1E 1GUSA 4WJ4A 1LTRD 4LUOA 5M3FH 2PMZB 1D5MC 1EY6A 3MFGA 5I2XA 2KENA 4LNQA 3KLSX 4DAYB 5LMNW 1P8LA 3ERQA 3G4SA 3NWSA 2CKZB 4C3IB 1UUPA 2O5IC 4BY1G 3R8BA 2JA7G 3CXCA 3HKSA 3TP7A 2JA8H 2BOSA 5EKIA 3W5OA 4YY3Q 2VUMB 3PGZA 4IOAA 1V1QA 3K80C 4J15A 4TRDA 2NBFA 1MGSA 3I4MG 2E2JH 4LFAL 1B50A 1S5ED 4AYBE 4EQPA 1HFNA 5M3FB 5LMNQ 1WVLA 2Y0SB 1VQOA 2K5WA 1K8GA 2L55A 4ZKBB 2EVBA 4OWTB 2ZTDA 3EQLC 3H3VH 4FYDA 1TS4A 3FVQA 1HR0L 1DOMA 4PZ8A 1UWVA 5KRUA 1PA6A 2UUBL 1SLJA 2E2JB 1A2UA 1WI5A 3CCRA 3FPUB 3RLOA 2K4KA 4KTAA 2KQ3A 2UXBQ 4FVMA 1RJTA 4B3TQ 3VR3A 4QUCA 4YCWA 1PFSA 3D6CA 1G2SA 4FXKC 1MSGA 3VYUA 5IP9G 3NTIA 1CUKA 4LF7L 2JA9A 3MHBA 1CHPD 3STBD 5C3EG 2NVXH 2R92H 4IPDA 2MO1A 3B6YA 4L5RC 3LWEA 4CDFC 3CCSA 1EY7A 1XNQL 1EY4A 3K7UC 4JBKA 3LX0A 3FDTA 2JQOA 4TSSA 1EYAA 4FF4A 1KL9A 1SE8A 4ILWA 1TY2A 5CR3A 3GTPH 2KHJA 1PTOH 2I5MX 1K73C 2NTSA 1ASZA 2AMCB 2NVXB 1N9WA 1RD9D 2R92B 5JJKA 1G6ZA 1W3SA 3U4VA 4A3JH 1N34L 4HIOA 1MJCA 1PRTC 1G51A 2OT2A 1VCIA 2M00A 4HMIA 4GKKQ 1U4MA 4DV6L 4JI3L 5IGGA 3CCVA 2ES2A 1HZAA 1L0WA 3KDFA 3LGJA 1I94L 3EBEA 3GTPB 2MUYA 1EY9A 4YHHQ 1JWUD 3QB3A 5COYA 1PTOB 3J81c 4UP7A 4JYAL 1LYLA 1D8LA 4UP8A 3WOFA 2EE1A 3JAMc 4DK3C 3PCOB 4JVZA 4P71A 3L9AX 1TWCH 4HR7B 1EEID 4DV1Q 1QZHA 4KK7A 4A3JB 4DKAC 1UE5A 1DOKA 4B3SL 4JI7Q 1XNRL 1Y14B 4UPAA 5KIXA 5KNDA 2Z6BA 3G7LA 1QCBD 3G6JB 3IFDA 1ENCA 2PZWA 2VXWA 3PSIA 5IGCA 4A3GG 1VDZA 1F2LA 3RMHA 2KCNA 3KF8B 4L63B 3M7NA 2CWPA 3M4QA 4MHEA 2OXPA 4B9WA 3DXJC 2J7ZA 1IKLA 2KBNA 5IY0A 4KMUC 1W6KA 2AHOB 2PO4A 2HUGA 4LFAQ 2Z1CA 1E2ZA 1G6PA 4H7BA 3RR5A 4DV3L 3UDGA 3H09A 3NWTA 2K52A 3H0GG 4PMBA 4JBMA 3R2IA 4DFAA 1PH1A 2QGQA 3HOVG 1K0SA 4O0AA 1SYCA 1X54A 1PLFA 3PMFA 2UUAL 1QUQB 3U4ZA 3TZDA 4DUZL 1NSNS 3IFTA 4CJ1B 2LS01 4HJ7A 1WTVA 5JJIA 4LF9Q 1X6OA 4N8FA 1N33Q 1H95A 4QIWB 5D3IB 1D1KA 2M2LA 2I07B 4E6IA 1BCPB 3J81i 2O5JC 1H9SB 4F87A 4C1NK 1IKMA 1CZWA 4LF7Q 3D8GA 1JOKA 2N3SA 5JAVA 3OYYA 2EYHA 2GA4B 3NBHB 3A8IE 3MWYW 3S1QH 2NYZD 2E5LL 2PI2A 4K8JA 4JPBW 2EY2A 4I7AA 5ELFA 4DN4M 2ZM6Q 2B3GA 1LUZA 2KJXA 4BY1H 2JA7H 2RKSA 3PIOA 2F3WA 3S15H 4JG2A 2L15A 1SEBD 4BA2I 2ICIA 3S1QB 3K0YA 2KOLA 2FFKB 1Q7YC 1EZ6A 3AYHB 4HJ5A 1IW7C 4DV2Q 3I4MH 2CQAA 3TREA 3K58A 2EYFA 5JEAG 1HNXL 4CDCC 3K81C 4N9PA 4PZ7A 3SK5A 3ULJA 2ZTEA 5EBDA 4X6AH 2CVRA 2YV5A 2IL8A 1LO5D 1PZKD 3BDOA 3K5OA 5FK9C 4A3KG 5D65A 4BY1B 2JA7B 3S15B 1SMYD 1V1OA 4IFDI 3NELA 3OSOA 4A3DG 1VQCA 5EJWA 4B3SQ 4POFA 5AJ3L 2XVSA 4OELB 2IX0A 5BR8L 2OTJA 4RGTA 2PNRC 1EQVA 1PFBA 2QEJC 3I4MB 1PTOD 3TP8A 2HHHL 4IJHA 4DAMA 1KDBA 2Z8LA 3ND8A 4X62L 4XT1B 4HCEA 4RGMA 3DLLA 2B29A 4JBJA 4C3IG 5C3WA 3HOXG 5IP9H 4O1NA 2KCTA 4IUUA 4A76A 3S1MH 2DGYA 2A8VA 5C3EH 1B44D 4NXNL 4X64Q 2UXDQ 3RN2A 1G8ZD 4R8NA 4LW1A 1BXTA 2K5QA 3JC66 3EROA 3NUCA 4DNIA 5G3LF 3T1HQ 1IHZA 3CAMA 4OXPA 4CGYB 3GTLB 2G5DA 2A1AA 3QJYA 3BVMA 3I56A 2AUJD 1AW7A 3RLNA 2DNEA 1KIXA 3VR4A 3S1MB 3TZUA 3PUVA 2RDGA 1BBXC 3PO3B 1SYDA 5C3EB 3FRPB 1KHIA 3GTGH 1GVPA 4DUZQ 1YHBA 3Q0AA 1EOTA 2IJ0A 4O42A 4DV4Q 1K8MA 4XQNA 1EL0A 4DAYA 3RNUA 1PTOF 4MTKA 1RTNA 2AQ2B 5IOCA 1XMOL 1IBKQ 4BXXH 2HCCA 2OF1A 2I46A 4DV5Q 3T1YQ 3STBC 1HTPA 3UI2A 1PMRA 3H3VI 3GTGB 4RA8A 2K03A 2N55A 4J6HA 4K2LA 3IL8A 2E5LQ 1XXGA 2RHQB 4BY7G 3S9WA 1BCPD 4A3EG 1BVSA 2Q2IA 1OXSC 2AKWB 2D2CC 1S4ZA 4A3GH 2SOBA 4QL5A 2IX1A 1B70B 2GN5A 1ASYA 3S16H 4K5XA 1GJXA 1C7YA 2XSCA 4RFBA 2XRSD 3TDQA 1JWSD 1RKNA 3CCMA 3QR8A 2HDLA 1V9PA 1Q1BA 1GD7A 1Q3LA 1VQLA 1JE5A 1QVCA 2KHIA 3AU7A 4AIMA 2F0WA 1EYGA 2WV6D 1A6XA 1WTPA 4K0KQ 2ALYB 2K5NA 1HH2P 1M4VA 4A3GB 1WFQA 3GO5A 1JCKB 4B3ML 2EYOA 4FDBA 3S16B 3U50C 2JP1A 4U68A 4PMCA 5HY6A 1Y1VH 3R3OA 1XTDA 4KLKA 3H0GH 1WTOA 1SFOH 2M9VA 4MNOA 3T13A 4LUZA 1SNOA 5GAEC 1OXTA 3D6WA 4YY3L 3KK7A 4FF1A 5EPJA 1SJED 5M5XH 4DUYQ 2NZHA 4M1UB 2K05A 1MIUA 1SYGA 5CYUA 3BJUA 4KV6A 1IL2A 3P7JA 4KN4C 3K0XA 2F0UA 4X62Q 4K2KA 3CRLC 3DWPA 2ASBA 1Y8PB 1Y1VB 1HXYD 5IGEA 5LMUL 1JOOA 4HIDA 1HFGA 4IUTA 4WJWA 1B2TA 3ICEA 3PF4A 1PYBA 4C3JG 1SNMA 2EY5A 4DV0Q 1K3RA 4NXNQ 5M5XB 4IUQA 1TWHH 2WIIB 3PUZA 4IPHA 1YHAA 2FINB 1EIYB 1E7ZA 5JEAJ 4K8IA 1H9MA 2JEAI 4MN3A 3I7FA 1XMQQ 3SR1A 4B9XA 1J8IA 5KEEA 3SHLA 2UXBL 1GKHA 3N6RA 3L7ZC 3BVZA 1XYIA 4B3TL 3E9IA 4JBWA 1CQVA 3TSSA 1JORA 3I4NG 1EZ8A 1FYCA 3S1NB 5I6WA 5L37A 3U9SA 2E2DC 4RHSA 4DNRB 4R9WA 1X3GA 1YNND 3T56B 3C1FA 4EGVA 4A3IG 1TWHB 2E2IH 3E9HA 1JWMD 5EBCA 2KECA 3BYTB 4QMGA 3KF8A 4IZ8A 1CKMA 1RCVD 5C0XG 2EDGA 2F0IA 4KKTA 3TQYA 1KLGD 4ULLA 2ZJPA 2BDNA 1HQMC 4CDDC 5JEAH 1G291 2ATWA 2D9UA 1E2WA 1X56A 1S5FD 1M8AA 2QF7A 1VQDA 3W1GA 3J7ZC 3ER0A 3BDCA 4K14A 4A3KH 2AQ1B 3CQZH 2CCZA 2WAQE 4A3BG 2E2IB 5CBEE 1TY0A 1FL0A 5T1IA 4A3DH 3OMGA 1IBLQ 1FVIA 1K28A 4GKKL 4JV5Q 4YCUA 2I5LX 5FLXL 1Q86C 4XYOA 4RKLA 1SJHD 1HUNA 4V190 3N52A 1NUCA 4YHHL 1WD1A 3H3VC 3OMCA 1G2TA 3CC7A 1F2YA 1QUQA 3QIAA 3HOXH 1STGA 1VF5C 2X6GA 5TSSA 4DV1L 4A3KB 1EQTA 3CQZB 2RQXA 5IE8A 5ELOA 2EXZA 1HTLD 4JI7L 4A3DB 2F0LA 3OWEB 1CQFA 1T5EA 2X6LA 3RLFA 3UDIA 1J9OA 2MNAA 1WTXA 1H9SA 3D3RA 1SDFA 3Q8DA 4N8X1 4CBVA 1IZ6A 3EIVA 2E2HH 4P73A 1EU4A 5IGDA 1BBWA 1HQRD 4HN7A 1KLUD 5GAGC 4XQQA 4FNFA 4B3MQ 4OEMB 3NBHA 1YVCA 5KGUA 4A4IA 3HOXB 3J7AV 4ABNA 3K6OA 2EY1A 3CW2C 1V8QA 1KTKA 1SMYC 1D2BA 3TBIB 3WDNA 2LXKA 4J8QA 2L12A 1B9NA 4CJ2C 4DR1Q 1WTRA 4AQYL 4ZUIA 2E2HB 1ML0D 1STYA 5EKLA 3J7AF 1PTOC 2Z4IA 1VQKA 4HIMA 4ZYSA 1O80A 4IPGA 1TU2B 2D5DA 2XWJB 2G9DA 5LMUQ 2BCOA 2PQAB 1L0YB 2N78A 3OPOA 3IKJA 4RKBA 2DY7A 1DGSA 1GUNA 1ONLA 2RDHA 5I9OA 1K8AC 2F3VA 2NVQH 3MA2B 2N49A 4RG1A 4HMJA 4LF9L 1Q12A 5CV4A 4G7ZC 1N33L 2YTXA 4BY7H 4LJZC 2XWBB 4JC0A 5KYLA 1X9NA 2HDMA 4A3EH 1KNAA 4RCOA 1GOZA 4JI0Q 4QF4A 1T9HA 1EWCA 2E74C 1BF4A 3L2PA 2L11A 2VNUD 4DR4Q 3KLRA 3GTKH 1BBUA 1JQYD 1JMCA 3PO3G 1B4OA 4DA2A 4OO1G 3GTJH 1LACA 2NVQB 4MIUA 4DGZA 5FO8B 5E7NA 1A0IA 1F9PA 2MJ8A 4BY7B 3G48A 2F0PA 1IL8A 5C44H 4A3EB 3V2TA 1V1PB 4C2MH 1WTQA 3RZOH 1I4PA 5IWAQ 2QA4A 1F2MA 5E3FA 4G4KA 5EAYA 4O2DA 2ZM6L 2VY3A 1I4QA 2F0HA 1EIGA 3C2PA 3GTKB 4CJ0B 3VA5A 4A93G 2A73B 2MO0A 4PZ6A 1HHVA 3HZXA 4GLAC 3SK6A 3I73A 5J1ZA 2NVYH 3GTJB 4Y52H 1JICA 4GN5A 3WOEA 3CPWA 1AE3A 1HJPA 1NMFA 1QG7A 1QJOA 2A6HD 4IO9A 3S2HH 4DV2L 1BCPC 3S14H 5C44B 1PH8A 4C2MB 3RZOB 1J6QA 4Q0FA 2Q2UA 1VQBA 1I50B 1P16A 2R7DA 2IPKD 4KY7A 4BXXG 4KHVA 1H9RA 1YEZA 4RWSC 1N36Q 1Z7TA 4KKSA 4NKLA 1I3QH 2N88A 1KAAA 3O13A 1EFID 5IYBG 4R8IA 4Q5VA 1Y1WG 2JSOA 3U9OA 2NTTA 5KYIA 3CCEA 2NVYB 1CSPA 2F0KA 4C3JH 5C0XJ 1UEBA 1PVOA 1OXXK 4F8MA 1DONA 2F0SA 2B63G 3X3NA 2FJ2A 1EY5A 3S2HB 2JXMB 4KY5A 3S14B 2F3IA 2B2TA 2WACA 3KUPA 1C48A 3KYHC 2E76C 1Z47A 3MXPA 5CC4A 1TKWB 4OHJA 3FKIG 3CF5A 3ULPA 3ITPA 3M3YH 1UNSA 1U4PA 1JJ2A 1I3QB 1QVFA 5EKKA 3I4NH 3KLSA 3M85A 5ELDA 5IGFA 4C3JB 4GOPB 4X64L 1PH3A 2UXDL 2EIFA 3A5UA 5C4XG 1AZQA 4A3IH 3DM3A
chains in the Genus database with same CATH topology
2AWOA 5IP9H 1CKOA 2HHHQ 4YWKA 2KCTA 3E0EA 4A76A 3I2ZA 3F2BA 4TQUS 4AQYQ 5LMNL 1N32L 3S1MH 2DGYA 3KOJA 2A8VA 3T1HL 3J80i 2HIXA 1C0AA 5C3EH 1B7YB 3AFQA 4NXNL 4OWXB 3K7AH 4X64Q 3H15A 3RN2A 2UXDQ 4LW1A 1Y1VG 1KC8C 3KJPA 4OWWB 4KHPL 3JC66 4BBSH 4DNIA 4BBRH 4B3RL 3T1HQ 1IYJB 3PF5A 4DR7L 3CAMA 1A8VA 4OXPA 3M4OH 4LWCA 4MZ9A 1YJNA 5K36G 2CFMA 1XPRA 1RL2A 2A1AA 4KHPQ 4QY7A 2I5HA 2JJQA 2PMZE 4QJFA 3I55A 3G6EA 4A3BH 3I56A 4L5SA 4DR5L 3RLNA 1VQ7A 4DV4L 4DR7Q 1LM0A 1KIXA 1HZ9A 1AH9A 3PUVA 3HOUH 4GOPC 3PO2H 3CCUA 1L1OA 3PIPA 1KHIA 1LTLA 4R1JA 2Z6KC 1K83H 3GTGH 1GVPA 4DUZQ 1YHBA 2WAQG 4P72A 3ULLA 1MJEA 1GM5A 3TEHB 4DR5Q 2IHEA 3M9BA 1VQ4A 1S40A 4A3LG 4DV4Q 1IBKL 5JJLA 3BZCA 3RNUA 1JJGA 4HJ9A 3HFZB 4DV5L 3T1YL 2R7ZH 1BKBA 1A63A 4OO1I 1WCMG 4GN3B 2EXDA 2JEBI 4JI8L 4C3HH 2UXCL 1E3PA 5IYDG 1XMOL 2JK8A 1I50H 4A75A 1PH9A 1IBKQ 4A3FG 4BXXH 1Z9FA 4A3CG 2K14A 4DV5Q 2Y0SE 3T1YQ 3STBC 4GN4B 5FLMG 3HOWG 4L5QA 4A3MG 2UUCL 2OQ0A 3H3VI 1VQJA 1XMOQ 4LUVA 3OW2A 2E5LQ 3AFPA 2R7FA 2NN6G 4LFCL 5FJ8G 4X65L 3TS0A 2RHQB 1X3FA 4LF8L 5DLQE 1YI2A 3J7A5 4ME3A 1PH7A 4BY7G 1PHJA 4A3EG 3G71A 3CC2A 4JI4Q 1BVSA 2Q2IA 1PH6A 1OXSC 2RHSB 2AKWB 2UUCQ 5IYCH 2WB1G 4IJLA 2VL6A 4R4QA 3U58A 3TS2A 3W1BA 3VDYA 4A3GH 4QL5A 2IX1A 1AE2A 2Q2TA 2FXQA 1B70B 2GN5A 1ASYA 3S16H 4LFCQ 4X65Q 3EN2A 1JB7A 4LF8Q 1C7YA 1E24A 1M90C 3M4PA 2VZAA 1YZ6A 4LF5L 3CCMA 4POGA 1SR3A 2OCEA 4DR2L 1JT8A 1V9PA 3CCQA 4K0KL 1EWIA 1KXLA 1Q1BA 1Q46A 4PMWA 2OQKA 3S1RH 1GD7A 4LFBL 2JA5H 1UE7A 2IY5B 2VQEL 1VQLA 1WYDA 1JE5A 1V43A 1QVCA 2KHIA 3AQQA 3I4OA 4C3IH 4AIMA 2QEXA 4LF5Q 1EYGA 4DR2Q 4TVAB 1EQQA 1HZCA 4K0KQ 1K0RA 2ALYB 2K5NA 1HH2P 1M1KC 1J5EL 4DV7L 4AYBG 1UE1A 1IBML 1WFQA 3UDFA 2VUMH 3GO5A 5J3BA 1Q82C 4XIGS 4LFBQ 1E22A 3CD6A 2E8GA 4B3ML 4FDBA 3U50C 4UY8C 4DUYL 5HY6A 1Y1VH 1XTDA 4KLKA 1L1OB 2WB1E 3H0GH 4WJ4A 1SFOH 3HKZG 4JI1Q 4LUOA 4MNOA 4LUZA 4JOIC 5M3FH 1J5EQ 4DV7Q 1N32Q 5GAEC 1OXTA 2JA6G 3A74A 1D7QA 2KENA 4YY3L 1TXYA 1YJWA 4LNQA 4DAYB 5C4JH 5LMNW 1P8LA 4P75A 5M5XH 3G4SA 3MEFA 4DUYQ 3GTLH 2NZHA 2A19A 2GVAA 2CWAA 2CKZB 1MIUA 4BY1G 2JA7G 2R93H 3BJUA 3CXCA 3HKSA 2LXJA 2NVTH 1IL2A 4DR3L 2JA8H 3L0OA 3W5OA 1VQIA 4OONA 1S72A 1NE3A 1VQ6A 4YY3Q 1SRUA 3K0XA 3PGZA 4GLVB 1V1QA 3K80C 4MTNA 1VQ5A 4IOAA 1S3OA 3CMAA 4J15A 4X62Q 3PO3H 5IP7G 4DV0L 2ASBA 4IOCA 2R6GA 1TWGH 1SROA 3I4MG 4AH6A 2E2JH 4LFAL 2WP8J 4AYBE 3CMEA 5LMUL 5GQOA 4HIDA 1YITA 5GADC 3ICEA 2CQOA 2IT1A 2YTVA 1PYBA 5FLXc 5LMNQ 2C35B 1XMQL 3PF4A 3HOZH 1HR0W 1TWFH 4DV0Q 1K3RA 4NXNQ 1TWAH 1VQOA 1K8GA 1TWHH 3PUZA 1L1OC 1YHAA 4IPHA 1EIYB 1E7ZA 5JEAJ 3RZDH 2Q2HA 1I6HH 4UP9A 4OWTB 2ZTDA 2JEAI 3H3VH 3I7FA 1HR0L 1XMQQ 4B3RQ 4JI5L 3HOYG 3HOWH 4PZ8A 4A93H 2UXBL 1GKHA 1UWVA 3L7ZC 1VQHA 4B3TL 3E9IA 1PA6A 3J81j 1SLJA 1L2FA 2UU9L 4JBWA 2UUBL 1KAWA 4HJAA 3I4NG 2EQSA 1WI5A 4NB3A 2BH8A 5FJ8H 3CCRA 1HR0Q 3RLOA 2K4KA 1VQFA 3S2DH 1WJJA 1VQNA 4Y7NH 2UXBQ 2DUDA 5M3MG 4JI6L 3GTQH 4B3TQ 1X3GA 3F2CA 2OTLA 2UUBQ 4YCWA 1PFSA 4A3IG 2E2IH 2UU9Q 3E9HA 4RMFA 5IP9G 3PUYA 3A5ZB 1CUKA 2K75A 4GLXA 2JA9A 4LF7L 1JJCB 1CKMA 3PV0A 4OX9L 5C0XG 3STBD 5C3EG 2NVXH 3ZJYC 2R92H 1Q8KA 2MO1A 1I5FA 3B6YA 4IPDA 3TQYA 4L5RC 2ZJPA 1Y1WH 5IYBH 1KQSA 2AWNA 3CP0A 3GD7A 4NPSA 3CCSA 3GTOH 1VQ9A 4JI8Q 3JAMi 1XNQL 4BBSG 4JBKA 3K7UC 2UXCQ 1G291 2ATWA 1VQAA 2GVBA 2JQOA 4BBRG 4OX9Q 1IBLL 1X56A 1YJ9A 1FJGL 1UE6A 1VQDA 1KL9A 1SE8A 4JV5L 3W1GA 2B63H 3J7ZC 3ER0A 4A3KH 1NY4A 3GTPH 2KHJA 3CQZH 5M5WH 2CCZA 2WAQE 1XPUA 1XNQQ 4A3BG 1YNXA 2MFIA 2N8NA 3KF6A 1SMXA 1FL0A 4LF6L 2NN6I 4A3DH 3BU2A 1HZBA 2I5MX 1IBLQ 1K73C 1FVIA 3UE0A 1FJGQ 1X65A 3KLWA 3PUWA 3FKIH 4R4IA 1ASZA 4GKKL 4JV5Q 3HOUG 2AMCB 3PO2G 4YCUA 1N9WA 1PYSB 3GDEA 5JJKA 2I5LX 1Q86C 1W3SA 3U4VA 2ZJRA 2MQHA 4A3JH 1W2BA 2F52A 1N34L 4HIOA 1MJCA 4LF6Q 4YHHL 2VQFL 1KRTA 1G51A 4ALPA 1VCIA 4QIWE 4GKKQ 4DV6L 4JI3L 3CC7A 5C4XH 3CCVA 1QUQA 2ES2A 1X55A 1HZAA 1L0WA 1EIFA 2R7ZG 3KDFA 4HJ8A 3HOXH 5C44G 3LGJA 4DV1L 3EBEA 4YCVA 1I94L 1N34Q 4EX5A 5IE8A 2YYZA 5ELOA 4EQ5A 4YHHQ 3J81c 3TRZA 4UP7A 1GO3E 4JI7L 4JYAL 4DR6L 1LYLA 1D8LA 4GKJL 4UP8A 4DV6Q 4JI3Q 3JAMc 1IXRA 3PCOB 2Z0SA 4P71A 3RLFA 3UDIA 4DK3C 2MNAA 1TWCH 2VQEQ 1I94Q 4DV1Q 1QZHA 2IHFA 3Q8DA 1U0LA 4IPCA 1HNWL 1IZ6A 2V1CC 3EIVA 1QZGA 2E2HH 4P73A 4DKAC 2YU9H 4NXML 1BBWA 1EQRA 1IBMQ 1E1OA 1UE5A 4B3SL 4JI7Q 4JYAQ 1XNRL 5GAGC 1YIJA 1Q81C 4IFDG 4B3MQ 1Y14B 4GKJQ 1PV4A 4UPAA 1PH2A 2BH2A 5H1SE 1YVCA 3FP9A 2I0QA 4A4IA 3ERSX 1Q1EA 3PSIA 5IYCG 4DR1L 4A3GG 4P74A 3CW2C 4DK6C 4WJ3M 3HOYH 3KF8B 1XNRQ 1A62A 3NENA 2LXKA 1PH5A 3F8TA 3M7NA 3IRBA 4DR1Q 2CWPA 4AQYL 4DR3Q 3M4QA 4A3LH 2BA0A 4YWMA 1VQKA 3S1NH 2JA5G 5GROA 4HIMA 1EOVA 2OWOA 1PH4A 2BA1A 1EUJA 3CCLA 2KBNA 4IPGA 1WCMH 1VQEA 4GNXA 5IY0A 2LSSA 2AHOB 3HKZE 5M5YH 1HNZL 5IYDH 4LFAQ 2KCMA 5LMUQ 3S24A 2VUMG 4A3FH 3KF6B 1G6PA 3RR5A 2PQAB 3D31A 2N78A 4JCVE 4X66L 4A3CH 4DV3L 4APVA 3UDGA 4R4CA 1CKNA 5FLMH 1DGSA 2HT1A 4A3MH 3WWVA 2K52A 3H0GG 1K8AC 4JI0L 2NVQH 1HNZQ 2N49A 4JBMA 5M3FG 4RG1A 2QGQA 4DPGA 1PH1A 1OXVA 2NZOA 3HOVG 1X3EA 1Q12A 4X66Q 4O0AA 2YTYA 1X54A 4LF9L 1N33L 2YTXA 4DV3Q 4DR4L 4BY7H 4JI5Q 4JC0A 1X9NA 2Y0SG 4A3EH 4BA1I 2UUAL 1QUQB 3U4ZA 4JI0Q 1T9HA 2D0PA 3KDFB 4DUZL 2R93G 3FHWA 4R4TA 4YWLA 1CSQA 3D0FA 1KD1C 2JA8G 4HJ7A 3L2PA 5JJIA 2K50A 4IFDJ 4LF9Q 2VNUD 1X6OA 1N33Q 4DR4Q 3GTKH 4PG3A 1BBUA 3CCJA 1H95A 5HGQA 2D0OA 1JMCA 3PUXA 3PO3G 4QQBX 1VS0A 2UUAQ 1NJIC 4L5TA 4JI6Q 3J81i 4OO1G 3GTJH 5IWAL 3BZKA 2ID0A 5GAHC 5C0XI 1QVGA 3CC4A 4LF7Q 5E7NA 2PI2E 4KHZA 1A0IA 4GOPA 3HOZG 2N3SA 1NMGA 2PNHA 3GTMH 1U5KA 3G48A 3OYYA 4LF4L 2Z6KA 5C44H 1VQGA 3NBHB 3J80c 4C2MH 3F2DA 3RZOH 5IWAQ 3S1QH 2ZTCA 2RF4A 2QA4A 5EAYA 4O2DA 1YBYA 2ZM6L 2E5LL 2VY3A 2PQAA 2PI2A 1SN8A 1XJVA 2F4VL 1VQ8A 1RIPA 2K5VA 1VQPA 1E1TA 4KI0A 4JI4L 3UDXA 4LF4Q 4A93G 2MO0A 4PZ6A 1MKHA 4GLAC 2NVYH 2JA6H 4Y52H 3K8AA 1NTGA 2ZM6Q 4GN5A 2B3GA 5IT9c 1B8AA 1AE3A 3CPWA 3RN5A 2F4VQ 1LUZA 1HJPA 1NMFA 2RCNA 2VS1A 1N36L 4IO9A 4BY1H 1R9TH 2JA7H 3S2HH 4DV2L 3S14H 3PIOA 4R4OA 4GNXB 2HQLA 2XGTA 1PH8A 1OTCA 3S15H 2VW9A 4JG2A 1J6QA 1NBWA 2L15A 4BA2I 3AEVA 2Q2UA 1VQBA 2R7DA 1P16A 1FGUA 2VQFQ 1Q7YC 4HIKA 4BXXG 4GS3A 2K5HA 2R92G 5IP7H 1N36Q 1C9OA 1YEZA 3AYHB 3CPFA 1CKNB 4QGUA 1I3QH 4DV2Q 4HJ5A 3I4MH 1Y1WG 5IYBG 3TREA 5JEAG 1HNXL 1XPOA 2WFWA 3K81C 3CCEA 3MXNB 4PZ7A 4JI2L 1CSPA 3A0JA 4C3JH 5C0XJ 1UEBA 3ULJA 2ZTEA 1PVOA 1OXXK 1K9MC 4DR6Q 4X6AH 2YV5A 1O7IA 2B63G 3KJOA 4A3KG 4JI1L 1HNWQ 2F3IA 1VQMA 3OTOL 1HNXQ 1YHQA 3KYHC 1N8RC 1WOCA 4JI2Q 1KRSA 3NELA 4NXMQ 1VQCA 2JE6I 4A3DG 4IFDI 4B3SQ 2H5XA 4POFA 1Z47A 3KFUA 5AJ3L 2D62A 3FKIG 2IX0A 5BR8L 3CF5A 2OTJA 3ULPA 3S17H 3M3YH 1OXUA 3UE1A 5ELNA 1JJ2A 4GNXC 4A3JG 1EFWA 1QVFA 3OTOQ 3F1ZA 3HOVH 2XTIA 4H02A 2HHHL 3I4NH 3M85A 4IJHA 4DAMA 3SGIA 2ZJQA 4X62L 5AJ3Q 3NEMA 5BR8Q 3DLLA 4X64L 5M3MH 2B29A 4JBJA 4GOPB 2EIFA 3A5UA 1PH3A 2UXDL 5C4XG 4XTCS 2HIVA 4A3IH 3HOXG 4JOIA 3DM3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AWO A;  5IP9 H;  1CKO A;  2HHH Q;  4YWK A;  2KCT A;  3E0E A;  4A76 A;  3I2Z A;  3F2B A;  4TQU S;  4AQY Q;  5LMN L;  1N32 L;  3S1M H;  2DGY A;  3KOJ A;  2A8V A;  3T1H L;  3J80 i;  2HIX A;  1C0A A;  5C3E H;  1B7Y B;  3AFQ A;  4NXN L;  4OWX B;  3K7A H;  4X64 Q;  3H15 A;  3RN2 A;  2UXD Q;  4LW1 A;  1Y1V G;  1KC8 C;  3KJP A;  4OWW B;  4KHP L;  3JC6 6;  4BBS H;  4DNI A;  4BBR H;  4B3R L;  3T1H Q;  1IYJ B;  3PF5 A;  4DR7 L;  3CAM A;  1A8V A;  4OXP A;  3M4O H;  4LWC A;  4MZ9 A;  1YJN A;  5K36 G;  2CFM A;  1XPR A;  1RL2 A;  2A1A A;  4KHP Q;  4QY7 A;  2I5H A;  2JJQ A;  2PMZ E;  4QJF A;  3I55 A;  3G6E A;  4A3B H;  3I56 A;  4L5S A;  4DR5 L;  3RLN A;  1VQ7 A;  4DV4 L;  4DR7 Q;  1LM0 A;  1KIX A;  1HZ9 A;  1AH9 A;  3PUV A;  3HOU H;  4GOP C;  3PO2 H;  3CCU A;  1L1O A;  3PIP A;  1KHI A;  1LTL A;  4R1J A;  2Z6K C;  1K83 H;  3GTG H;  1GVP A;  4DUZ Q;  1YHB A;  2WAQ G;  4P72 A;  3ULL A;  1MJE A;  1GM5 A;  3TEH B;  4DR5 Q;  2IHE A;  3M9B A;  1VQ4 A;  1S40 A;  4A3L G;  4DV4 Q;  1IBK L;  5JJL A;  3BZC A;  3RNU A;  1JJG A;  4HJ9 A;  3HFZ B;  4DV5 L;  3T1Y L;  2R7Z H;  1BKB A;  1A63 A;  4OO1 I;  1WCM G;  4GN3 B;  2EXD A;  2JEB I;  4JI8 L;  4C3H H;  2UXC L;  1E3P A;  5IYD G;  1XMO L;  2JK8 A;  1I50 H;  4A75 A;  1PH9 A;  1IBK Q;  4A3F G;  4BXX H;  1Z9F A;  4A3C G;  2K14 A;  4DV5 Q;  2Y0S E;  3T1Y Q;  3STB C;  4GN4 B;  5FLM G;  3HOW G;  4L5Q A;  4A3M G;  2UUC L;  2OQ0 A;  3H3V I;  1VQJ A;  1XMO Q;  4LUV A;  3OW2 A;  2E5L Q;  3AFP A;  2R7F A;  2NN6 G;  4LFC L;  5FJ8 G;  4X65 L;  3TS0 A;  2RHQ B;  1X3F A;  4LF8 L;  5DLQ E;  1YI2 A;  3J7A 5;  4ME3 A;  1PH7 A;  4BY7 G;  1PHJ A;  4A3E G;  3G71 A;  3CC2 A;  4JI4 Q;  1BVS A;  2Q2I A;  1PH6 A;  1OXS C;  2RHS B;  2AKW B;  2UUC Q;  5IYC H;  2WB1 G;  4IJL A;  2VL6 A;  4R4Q A;  3U58 A;  3TS2 A;  3W1B A;  3VDY A;  4A3G H;  4QL5 A;  2IX1 A;  1AE2 A;  2Q2T A;  2FXQ A;  1B70 B;  2GN5 A;  1ASY A;  3S16 H;  4LFC Q;  4X65 Q;  3EN2 A;  1JB7 A;  4LF8 Q;  1C7Y A;  1E24 A;  1M90 C;  3M4P A;  2VZA A;  1YZ6 A;  4LF5 L;  3CCM A;  4POG A;  1SR3 A;  2OCE A;  4DR2 L;  1JT8 A;  1V9P A;  3CCQ A;  4K0K L;  1EWI A;  1KXL A;  1Q1B A;  1Q46 A;  4PMW A;  2OQK A;  3S1R H;  1GD7 A;  4LFB L;  2JA5 H;  1UE7 A;  2IY5 B;  2VQE L;  1VQL A;  1WYD A;  1JE5 A;  1V43 A;  1QVC A;  2KHI A;  3AQQ A;  3I4O A;  4C3I H;  4AIM A;  2QEX A;  4LF5 Q;  1EYG A;  4DR2 Q;  4TVA B;  1EQQ A;  1HZC A;  4K0K Q;  1K0R A;  2ALY B;  2K5N A;  1HH2 P;  1M1K C;  1J5E L;  4DV7 L;  4AYB G;  1UE1 A;  1IBM L;  1WFQ A;  3UDF A;  2VUM H;  3GO5 A;  5J3B A;  1Q82 C;  4XIG S;  4LFB Q;  1E22 A;  3CD6 A;  2E8G A;  4B3M L;  4FDB A;  3U50 C;  4UY8 C;  4DUY L;  5HY6 A;  1Y1V H;  1XTD A;  4KLK A;  1L1O B;  2WB1 E;  3H0G H;  4WJ4 A;  1SFO H;  3HKZ G;  4JI1 Q;  4LUO A;  4MNO A;  4LUZ A;  4JOI C;  5M3F H;  1J5E Q;  4DV7 Q;  1N32 Q;  5GAE C;  1OXT A;  2JA6 G;  3A74 A;  1D7Q A;  2KEN A;  4YY3 L;  1TXY A;  1YJW A;  4LNQ A;  4DAY B;  5C4J H;  5LMN W;  1P8L A;  4P75 A;  5M5X H;  3G4S A;  3MEF A;  4DUY Q;  3GTL H;  2NZH A;  2A19 A;  2GVA A;  2CWA A;  2CKZ B;  1MIU A;  4BY1 G;  2JA7 G;  2R93 H;  3BJU A;  3CXC A;  3HKS A;  2LXJ A;  2NVT H;  1IL2 A;  4DR3 L;  2JA8 H;  3L0O A;  3W5O A;  1VQI A;  4OON A;  1S72 A;  1NE3 A;  1VQ6 A;  4YY3 Q;  1SRU A;  3K0X A;  3PGZ A;  4GLV B;  1V1Q A;  3K80 C;  4MTN A;  1VQ5 A;  4IOA A;  1S3O A;  3CMA A;  4J15 A;  4X62 Q;  3PO3 H;  5IP7 G;  4DV0 L;  2ASB A;  4IOC A;  2R6G A;  1TWG H;  1SRO A;  3I4M G;  4AH6 A;  2E2J H;  4LFA L;  2WP8 J;  4AYB E;  3CME A;  5LMU L;  5GQO A;  4HID A;  1YIT A;  5GAD C;  3ICE A;  2CQO A;  2IT1 A;  2YTV A;  1PYB A;  5FLX c;  5LMN Q;  2C35 B;  1XMQ L;  3PF4 A;  3HOZ H;  1HR0 W;  1TWF H;  4DV0 Q;  1K3R A;  4NXN Q;  1TWA H;  1VQO A;  1K8G A;  1TWH H;  3PUZ A;  1L1O C;  1YHA A;  4IPH A;  1EIY B;  1E7Z A;  5JEA J;  3RZD H;  2Q2H A;  1I6H H;  4UP9 A;  4OWT B;  2ZTD A;  2JEA I;  3H3V H;  3I7F A;  1HR0 L;  1XMQ Q;  4B3R Q;  4JI5 L;  3HOY G;  3HOW H;  4PZ8 A;  4A93 H;  2UXB L;  1GKH A;  1UWV A;  3L7Z C;  1VQH A;  4B3T L;  3E9I A;  1PA6 A;  3J81 j;  1SLJ A;  1L2F A;  2UU9 L;  4JBW A;  2UUB L;  1KAW A;  4HJA A;  3I4N G;  2EQS A;  1WI5 A;  4NB3 A;  2BH8 A;  5FJ8 H;  3CCR A;  1HR0 Q;  3RLO A;  2K4K A;  1VQF A;  3S2D H;  1WJJ A;  1VQN A;  4Y7N H;  2UXB Q;  2DUD A;  5M3M G;  4JI6 L;  3GTQ H;  4B3T Q;  1X3G A;  3F2C A;  2OTL A;  2UUB Q;  4YCW A;  1PFS A;  4A3I G;  2E2I H;  2UU9 Q;  3E9H A;  4RMF A;  5IP9 G;  3PUY A;  3A5Z B;  1CUK A;  2K75 A;  4GLX A;  2JA9 A;  4LF7 L;  1JJC B;  1CKM A;  3PV0 A;  4OX9 L;  5C0X G;  3STB D;  5C3E G;  2NVX H;  3ZJY C;  2R92 H;  1Q8K A;  2MO1 A;  1I5F A;  3B6Y A;  4IPD A;  3TQY A;  4L5R C;  2ZJP A;  1Y1W H;  5IYB H;  1KQS A;  2AWN A;  3CP0 A;  3GD7 A;  4NPS A;  3CCS A;  3GTO H;  1VQ9 A;  4JI8 Q;  3JAM i;  1XNQ L;  4BBS G;  4JBK A;  3K7U C;  2UXC Q;  1G29 1;  2ATW A;  1VQA A;  2GVB A;  2JQO A;  4BBR G;  4OX9 Q;  1IBL L;  1X56 A;  1YJ9 A;  1FJG L;  1UE6 A;  1VQD A;  1KL9 A;  1SE8 A;  4JV5 L;  3W1G A;  2B63 H;  3J7Z C;  3ER0 A;  4A3K H;  1NY4 A;  3GTP H;  2KHJ A;  3CQZ H;  5M5W H;  2CCZ A;  2WAQ E;  1XPU A;  1XNQ Q;  4A3B G;  1YNX A;  2MFI A;  2N8N A;  3KF6 A;  1SMX A;  1FL0 A;  4LF6 L;  2NN6 I;  4A3D H;  3BU2 A;  1HZB A;  2I5M X;  1IBL Q;  1K73 C;  1FVI A;  3UE0 A;  1FJG Q;  1X65 A;  3KLW A;  3PUW A;  3FKI H;  4R4I A;  1ASZ A;  4GKK L;  4JV5 Q;  3HOU G;  2AMC B;  3PO2 G;  4YCU A;  1N9W A;  1PYS B;  3GDE A;  5JJK A;  2I5L X;  1Q86 C;  1W3S A;  3U4V A;  2ZJR A;  2MQH A;  4A3J H;  1W2B A;  2F52 A;  1N34 L;  4HIO A;  1MJC A;  4LF6 Q;  4YHH L;  2VQF L;  1KRT A;  1G51 A;  4ALP A;  1VCI A;  4QIW E;  4GKK Q;  4DV6 L;  4JI3 L;  3CC7 A;  5C4X H;  3CCV A;  1QUQ A;  2ES2 A;  1X55 A;  1HZA A;  1L0W A;  1EIF A;  2R7Z G;  3KDF A;  4HJ8 A;  3HOX H;  5C44 G;  3LGJ A;  4DV1 L;  3EBE A;  4YCV A;  1I94 L;  1N34 Q;  4EX5 A;  5IE8 A;  2YYZ A;  5ELO A;  4EQ5 A;  4YHH Q;  3J81 c;  3TRZ A;  4UP7 A;  1GO3 E;  4JI7 L;  4JYA L;  4DR6 L;  1LYL A;  1D8L A;  4GKJ L;  4UP8 A;  4DV6 Q;  4JI3 Q;  3JAM c;  1IXR A;  3PCO B;  2Z0S A;  4P71 A;  3RLF A;  3UDI A;  4DK3 C;  2MNA A;  1TWC H;  2VQE Q;  1I94 Q;  4DV1 Q;  1QZH A;  2IHF A;  3Q8D A;  1U0L A;  4IPC A;  1HNW L;  1IZ6 A;  2V1C C;  3EIV A;  1QZG A;  2E2H H;  4P73 A;  4DKA C;  2YU9 H;  4NXM L;  1BBW A;  1EQR A;  1IBM Q;  1E1O A;  1UE5 A;  4B3S L;  4JI7 Q;  4JYA Q;  1XNR L;  5GAG C;  1YIJ A;  1Q81 C;  4IFD G;  4B3M Q;  1Y14 B;  4GKJ Q;  1PV4 A;  4UPA A;  1PH2 A;  2BH2 A;  5H1S E;  1YVC A;  3FP9 A;  2I0Q A;  4A4I A;  3ERS X;  1Q1E A;  3PSI A;  5IYC G;  4DR1 L;  4A3G G;  4P74 A;  3CW2 C;  4DK6 C;  4WJ3 M;  3HOY H;  3KF8 B;  1XNR Q;  1A62 A;  3NEN A;  2LXK A;  1PH5 A;  3F8T A;  3M7N A;  3IRB A;  4DR1 Q;  2CWP A;  4AQY L;  4DR3 Q;  3M4Q A;  4A3L H;  2BA0 A;  4YWM A;  1VQK A;  3S1N H;  2JA5 G;  5GRO A;  4HIM A;  1EOV A;  2OWO A;  1PH4 A;  2BA1 A;  1EUJ A;  3CCL A;  2KBN A;  4IPG A;  1WCM H;  1VQE A;  4GNX A;  5IY0 A;  2LSS A;  2AHO B;  3HKZ E;  5M5Y H;  1HNZ L;  5IYD H;  4LFA Q;  2KCM A;  5LMU Q;  3S24 A;  2VUM G;  4A3F H;  3KF6 B;  1G6P A;  3RR5 A;  2PQA B;  3D31 A;  2N78 A;  4JCV E;  4X66 L;  4A3C H;  4DV3 L;  4APV A;  3UDG A;  4R4C A;  1CKN A;  5FLM H;  1DGS A;  2HT1 A;  4A3M H;  3WWV A;  2K52 A;  3H0G G;  1K8A C;  4JI0 L;  2NVQ H;  1HNZ Q;  2N49 A;  4JBM A;  5M3F G;  4RG1 A;  2QGQ A;  4DPG A;  1PH1 A;  1OXV A;  2NZO A;  3HOV G;  1X3E A;  1Q12 A;  4X66 Q;  4O0A A;  2YTY A;  1X54 A;  4LF9 L;  1N33 L;  2YTX A;  4DV3 Q;  4DR4 L;  4BY7 H;  4JI5 Q;  4JC0 A;  1X9N A;  2Y0S G;  4A3E H;  4BA1 I;  2UUA L;  1QUQ B;  3U4Z A;  4JI0 Q;  1T9H A;  2D0P A;  3KDF B;  4DUZ L;  2R93 G;  3FHW A;  4R4T A;  4YWL A;  1CSQ A;  3D0F A;  1KD1 C;  2JA8 G;  4HJ7 A;  3L2P A;  5JJI A;  2K50 A;  4IFD J;  4LF9 Q;  2VNU D;  1X6O A;  1N33 Q;  4DR4 Q;  3GTK H;  4PG3 A;  1BBU A;  3CCJ A;  1H95 A;  5HGQ A;  2D0O A;  1JMC A;  3PUX A;  3PO3 G;  4QQB X;  1VS0 A;  2UUA Q;  1NJI C;  4L5T A;  4JI6 Q;  3J81 i;  4OO1 G;  3GTJ H;  5IWA L;  3BZK A;  2ID0 A;  5GAH C;  5C0X I;  1QVG A;  3CC4 A;  4LF7 Q;  5E7N A;  2PI2 E;  4KHZ A;  1A0I A;  4GOP A;  3HOZ G;  2N3S A;  1NMG A;  2PNH A;  3GTM H;  1U5K A;  3G48 A;  3OYY A;  4LF4 L;  2Z6K A;  5C44 H;  1VQG A;  3NBH B;  3J80 c;  4C2M H;  3F2D A;  3RZO H;  5IWA Q;  3S1Q H;  2ZTC A;  2RF4 A;  2QA4 A;  5EAY A;  4O2D A;  1YBY A;  2ZM6 L;  2E5L L;  2VY3 A;  2PQA A;  2PI2 A;  1SN8 A;  1XJV A;  2F4V L;  1VQ8 A;  1RIP A;  2K5V A;  1VQP A;  1E1T A;  4KI0 A;  4JI4 L;  3UDX A;  4LF4 Q;  4A93 G;  2MO0 A;  4PZ6 A;  1MKH A;  4GLA C;  2NVY H;  2JA6 H;  4Y52 H;  3K8A A;  1NTG A;  2ZM6 Q;  4GN5 A;  2B3G A;  5IT9 c;  1B8A A;  1AE3 A;  3CPW A;  3RN5 A;  2F4V Q;  1LUZ A;  1HJP A;  1NMF A;  2RCN A;  2VS1 A;  1N36 L;  4IO9 A;  4BY1 H;  1R9T H;  2JA7 H;  3S2H H;  4DV2 L;  3S14 H;  3PIO A;  4R4O A;  4GNX B;  2HQL A;  2XGT A;  1PH8 A;  1OTC A;  3S15 H;  2VW9 A;  4JG2 A;  1J6Q A;  1NBW A;  2L15 A;  4BA2 I;  3AEV A;  2Q2U A;  1VQB A;  2R7D A;  1P16 A;  1FGU A;  2VQF Q;  1Q7Y C;  4HIK A;  4BXX G;  4GS3 A;  2K5H A;  2R92 G;  5IP7 H;  1N36 Q;  1C9O A;  1YEZ A;  3AYH B;  3CPF A;  1CKN B;  4QGU A;  1I3Q H;  4DV2 Q;  4HJ5 A;  3I4M H;  1Y1W G;  5IYB G;  3TRE A;  5JEA G;  1HNX L;  1XPO A;  2WFW A;  3K81 C;  3CCE A;  3MXN B;  4PZ7 A;  4JI2 L;  1CSP A;  3A0J A;  4C3J H;  5C0X J;  1UEB A;  3ULJ A;  2ZTE A;  1PVO A;  1OXX K;  1K9M C;  4DR6 Q;  4X6A H;  2YV5 A;  1O7I A;  2B63 G;  3KJO A;  4A3K G;  4JI1 L;  1HNW Q;  2F3I A;  1VQM A;  3OTO L;  1HNX Q;  1YHQ A;  3KYH C;  1N8R C;  1WOC A;  4JI2 Q;  1KRS A;  3NEL A;  4NXM Q;  1VQC A;  2JE6 I;  4A3D G;  4IFD I;  4B3S Q;  2H5X A;  4POF A;  1Z47 A;  3KFU A;  5AJ3 L;  2D62 A;  3FKI G;  2IX0 A;  5BR8 L;  3CF5 A;  2OTJ A;  3ULP A;  3S17 H;  3M3Y H;  1OXU A;  3UE1 A;  5ELN A;  1JJ2 A;  4GNX C;  4A3J G;  1EFW A;  1QVF A;  3OTO Q;  3F1Z A;  3HOV H;  2XTI A;  4H02 A;  2HHH L;  3I4N H;  3M85 A;  4IJH A;  4DAM A;  3SGI A;  2ZJQ A;  4X62 L;  5AJ3 Q;  3NEM A;  5BR8 Q;  3DLL A;  4X64 L;  5M3M H;  2B29 A;  4JBJ A;  4GOP B;  2EIF A;  3A5U A;  1PH3 A;  2UXD L;  5C4X G;  4XTC S;  2HIV A;  4A3I H;  3HOX G;  4JOI A;  3DM3 A; 
#chains in the Genus database with same CATH topology
 2BE5 D;  3E0E A;  4AQY Q;  3I2Z A;  4TQU S;  1N32 L;  1LAB A;  2LY7 A;  5C0X H;  3HEJ A;  3T1H L;  1B7Y B;  3EA6 A;  3K7A H;  3H15 A;  4M8A A;  3R93 A;  4ZCK A;  1PDQ A;  1Y1V G;  3M3Y B;  1KC8 C;  4OWW B;  4ODG A;  1BOS A;  3I4N B;  4B3R L;  2FHT A;  1A8V A;  1PFN A;  4LWC A;  1YJN A;  5K36 G;  1GHK A;  4XDX A;  2KHS A;  2I5H A;  4A3I B;  3G6E A;  4A3B H;  2B2Y A;  3MZ5 A;  4NW2 A;  4UDU C;  4XYQ A;  4DV4 L;  4DR7 Q;  1LM0 A;  5EPK A;  1HZ9 A;  4DXG A;  5T1G A;  3CCU A;  1BR9 A;  3K7A B;  4OL7 A;  3F2U A;  1K83 H;  4L8J A;  5LHY 1;  2WAQ G;  4P72 A;  1GM5 A;  1MJE A;  3TEH B;  3VR2 A;  2IHE A;  3ZYY X;  1VQ4 A;  1S40 A;  4NMZ A;  4A3L G;  1IBK L;  2K32 A;  1JJG A;  4HJ9 A;  4DV5 L;  3T1Y L;  1EY8 A;  1ZXT A;  2L5T A;  1BKB A;  1A63 A;  4GN3 B;  1HCZ A;  1QOH A;  2EXD A;  2JEB I;  1YNN C;  2UXC L;  4K6D A;  4A3B B;  2JK8 A;  4A75 A;  4KD4 A;  2PQE A;  5KNC A;  2EYJ A;  4GN4 B;  4L5Q A;  4CDE C;  5ISR A;  2PW5 A;  4ID6 A;  1K83 B;  1LTS D;  1JC7 A;  1TT2 A;  2KVM A;  2NN6 G;  3TS0 A;  1X3F A;  5DLQ E;  5J22 A;  4JK1 C;  1E2V A;  4ME3 A;  5HUR A;  1KDC A;  2UUC Q;  2EYP A;  2WB1 G;  2PZU A;  3TS2 A;  3W1B A;  3VDY A;  1QWY A;  2FXQ A;  3DEP A;  1TS5 A;  1JB7 A;  4LF8 Q;  3CU7 A;  1STB A;  1E24 A;  3VR6 A;  3A54 A;  5K5P A;  1YZ6 A;  3ND9 A;  5F2D A;  3MFY A;  1SR3 A;  3E3X A;  1JT8 A;  5G3L D;  4K0K L;  2B2T C;  3MVV A;  3S1R H;  1PXU A;  1GUW A;  3P1H A;  1LTT D;  1UE7 A;  2IY5 B;  4HSV A;  3OW7 A;  2VQE L;  3I8Z A;  3I4O A;  3RD4 A;  3SE0 A;  2QEX A;  4LF5 Q;  2TSS A;  4DR2 Q;  4TVA B;  1K0R A;  4QQB X;  4AYB G;  1UE1 A;  1IBM L;  4XIG S;  1CA6 A;  3HRZ C;  3CD6 A;  1VF7 A;  3FPP A;  4UY8 C;  2F0V A;  4DUY L;  1L1O B;  1A2T A;  1TR5 A;  1J5E Q;  4DV7 Q;  2JA6 G;  3X3M A;  1BO0 A;  2K01 A;  3A74 A;  1D7Q A;  3S1R B;  1YJW A;  1TXY A;  3I70 A;  4FP5 D;  2F0M A;  4P75 A;  2KCC A;  3MEF A;  3GTL H;  2GVA A;  3HS0 C;  3QOL A;  3NQT A;  2LXJ A;  4DR3 L;  3V96 A;  1KAB A;  1VQI A;  4OON A;  1NE3 A;  1SRU A;  2ZXP A;  4GLV B;  4MTN A;  5CMD A;  1VQ5 A;  3FMC A;  1S3O A;  4EQO A;  3CMA A;  3PO3 H;  2R3Z A;  5EQ0 A;  1DD2 A;  4DV0 L;  2R6G A;  1SRO A;  2F0E A;  2WIN B;  4OO1 H;  2WP8 J;  1STH A;  3L3O C;  1YIT A;  2B2Y C;  2YTV A;  2IT1 A;  1N32 Q;  1XMQ L;  1Q90 A;  5ELB A;  1TWA H;  3I4L A;  2C9O A;  2G9H D;  5IIF A;  2RSO A;  4UP9 A;  5J39 A;  4B3R Q;  4JI5 L;  2SEB D;  3HOW H;  4A93 H;  1LTI D;  4ME5 A;  4QUF A;  1VQH A;  4TKO B;  3J81 j;  1L2F A;  4HJA A;  1B53 A;  2QDB A;  2B8G A;  4NB3 A;  2BH8 A;  4DF7 A;  2PYK A;  3S2D H;  1C8C A;  1MHW C;  1VQN A;  1FGB D;  4JI6 L;  3GTQ H;  4DK1 A;  3F2C A;  1TWA B;  2UU9 Q;  1SAP A;  4RMF A;  3PUY A;  4GLX A;  2K75 A;  1Q8I A;  1ILQ A;  3A8J E;  3OOC A;  3PV0 A;  1D6E C;  1Q8K A;  1I5F A;  3K5L A;  3HOW B;  4FXG C;  4A3M B;  4A93 B;  1Y1W H;  5IYB H;  1KQS A;  1NAP A;  2AWN A;  3GTO H;  1VQ9 A;  2L4N A;  2UXC Q;  1MBY A;  1LTA D;  5CV6 A;  4OX9 Q;  1IBL L;  3MAQ A;  1YJ9 A;  1UE6 A;  1BQQ T;  1ESF A;  3S2D B;  4JV5 L;  5COR A;  2B63 H;  2EZV A;  1NY4 A;  3GTQ B;  5M5W H;  1YNX A;  2MFI A;  2N8N A;  1SMX A;  5AFW A;  5CBA E;  1RTO A;  1FJG Q;  1X65 A;  3KLW A;  3PUW A;  3FKI H;  3PO2 G;  1PYS B;  3GDE A;  3SK8 A;  1O7Z A;  1GHJ A;  2ZJR A;  1W2B A;  1Y1W B;  3GTO B;  2ZT9 C;  4LF6 Q;  2A69 D;  1KRT A;  2EJF C;  5C4X H;  2R7Z G;  1EIF A;  2B63 B;  3JAM E;  2A6H C;  5C44 G;  4YCV A;  4EX5 A;  4YIJ A;  5C5M A;  5M5W B;  2YYZ A;  4EQ5 A;  3TRZ A;  1GO3 E;  4DR6 L;  3GTM H;  1DM0 B;  1IXR A;  2VQE Q;  3FKI B;  1HNW L;  1UEA B;  1U0L A;  4IPC A;  2V1C C;  5I6Y A;  4X3T A;  2BDO A;  2YU9 H;  4NXM L;  1EQR A;  1IBM Q;  1E1O A;  1VMC A;  4GKJ Q;  2EOT A;  4I65 A;  4J1M A;  1PH2 A;  1PV4 A;  3E5S A;  5H1S E;  5K36 H;  1V1P A;  1R4P B;  5FKA C;  2I0Q A;  5C4X B;  3ERS X;  1B3Q A;  5C4Z A;  4DR1 L;  2F0J A;  3E0J A;  4F88 A;  4DK6 C;  4WJ3 M;  3HOY H;  3T51 B;  3SK4 A;  3NEN A;  2VB3 X;  1SNP A;  2Q8R E;  5FLX E;  1PH5 A;  3F8T A;  3GTM B;  4FF2 A;  1QNU A;  4DR3 Q;  4WFN 3;  4A3L H;  1RHP A;  2QW7 A;  2BA0 A;  4YWM A;  2YU9 B;  3S1N H;  2JA5 G;  1PRT F;  5GRO A;  1CK1 A;  1JR0 D;  1EOV A;  2EJM A;  3IAY A;  1LV9 A;  2BA1 A;  1PH4 A;  1EUJ A;  3CCL A;  5C5L A;  3HKZ E;  2FMC A;  2XIW A;  2TMP A;  3FEW X;  3RUZ A;  3S24 A;  3KF6 B;  1MD2 D;  3D31 A;  2XN9 C;  4JCV E;  3HOY B;  4APV A;  5JPN C;  2MPM A;  2KEE A;  3M7G A;  4JI0 L;  1HNZ Q;  4N9T A;  2WAQ B;  4DPG A;  1CM9 A;  4X3K A;  1X3Q A;  1X3E A;  4X66 Q;  2NN6 H;  1R4Q B;  4DR4 L;  4RAU C;  4JI5 Q;  4QB4 A;  5CV8 A;  3KBG A;  2RSN A;  4BA1 I;  1F9Q A;  2R93 G;  2IWH A;  1B1Z A;  1DYQ A;  3FHW A;  3DUZ A;  3D0F A;  4R4T A;  4YWL A;  3JAM L;  4DAV A;  4IFD J;  4CKB A;  2K04 A;  5C6A A;  2R61 A;  2D0O A;  2SNM A;  3PUX A;  4JW0 A;  1HPC A;  3NTH A;  3Q6S A;  4H13 C;  1AZP A;  4L5T A;  4JI6 Q;  2IX3 A;  3EJI A;  1ENA A;  1ZEQ X;  3DWA A;  5IWA L;  2ID0 A;  2PZT A;  5ELE A;  5C0X I;  4HED A;  1QVG A;  2VB2 X;  2PI2 E;  4V0B A;  4KHZ A;  1NNX A;  4GOP A;  3HOZ G;  3KBX A;  4IUR A;  3F2D A;  1FR3 A;  3NP8 A;  2WB1 B;  2RF4 A;  3MXU A;  5DNF A;  5DM7 3;  1SN8 A;  1IYU A;  3SEB A;  1O78 A;  1VQ8 A;  1RIP A;  2K5V A;  1E1T A;  4KI0 A;  4JI4 L;  4LF4 Q;  4KN7 C;  1WD0 A;  1MKH A;  1I4H A;  5IGB A;  1F2Z A;  2JA6 H;  2NWG A;  3CHB D;  5BN4 A;  2A68 D;  1B8A A;  2F4V Q;  2B2V A;  4WOR A;  1N36 L;  5I9P A;  3NPP A;  1QE6 A;  5BN3 A;  4R4O A;  4GNX B;  2XGT A;  2A6E D;  2VW9 A;  2F0N A;  4CKC A;  4PNY A;  2SDF A;  3AEV A;  4AYB B;  1FGU A;  2B8F A;  4LAA A;  2DY8 A;  4HIK A;  2C5C A;  4GS3 A;  2K33 A;  5BN5 A;  1CKN B;  4QGU A;  2KUM A;  1RF2 D;  1XPO A;  2WFW A;  3MXN B;  1EY0 A;  2JA6 B;  3A0J A;  1K9M C;  4DR6 Q;  1Z6H A;  3AMU A;  4H0L C;  3W3A A;  4EVO A;  4JI1 L;  3P75 A;  1HNW Q;  1VMP A;  5KNB A;  1VQM A;  3ONA B;  1YHQ A;  1N8R C;  4JI2 Q;  4NXM Q;  2A74 C;  2JYO A;  4KY6 A;  3KFU A;  2D62 A;  4FXD A;  1S5C D;  4IUN A;  1OXU A;  3UE1 A;  5ELN A;  1EFW A;  5A2Q E;  4OIK A;  3OTO Q;  3F1Z A;  2XTI A;  4U67 3;  1OO9 B;  5EGT A;  5DEH A;  1DZ1 A;  2QDL A;  3SGI A;  4S3S A;  2ZJQ A;  3NHH A;  5EPL A;  3NEM A;  4WRD A;  4XTC S;  4JOI A;  1CKO A;  4BWG B;  2CHB D;  3KOJ A;  2HIX A;  1C0A A;  1ILP A;  4G57 A;  3AFQ A;  1MI2 A;  4OWX B;  4C1N I;  4RHR A;  1EWH A;  2ICE C;  2B2W C;  3KJP A;  3H91 A;  1EIH A;  1LT3 D;  1MSH A;  3T4A C;  3PF5 A;  4DR7 L;  3A7L A;  4HTH A;  1GUT A;  3M4O H;  4MZ9 A;  1SYE A;  1AEX A;  2CFM A;  4IQZ A;  1XPR A;  4KHP Q;  2JJQ A;  2PMZ E;  4QJF A;  1W6J A;  2JA8 B;  4G7H C;  1LT4 D;  1AN8 A;  2NZ1 D;  2XRQ D;  1CA5 A;  3PO2 H;  1SE3 A;  4GOP C;  3NSW A;  1L1O A;  3A8K E;  2EY6 A;  4R1J A;  3PIP 3;  3D4R A;  4RH6 A;  3D4W A;  4NDX A;  4K6L A;  3ULL A;  3J80 E;  4DR5 Q;  3CRK C;  3M9B A;  1SE4 A;  2RCF A;  3BDL A;  2RBM A;  1NR2 A;  2K1B A;  1X3P A;  4H44 C;  2R7Z H;  3M4O B;  1ET6 A;  1I4G A;  1WCM G;  2DJG C;  4OO1 I;  4ZK9 B;  4JI8 L;  4C3H H;  3GV3 A;  1CT1 D;  1E3P A;  5IYD G;  3NE5 B;  1I50 H;  4A3F G;  4A3C G;  2B2V C;  2Y0S E;  5IT9 E;  3TP6 A;  5FLM G;  3PO2 B;  3HOW G;  4A3M G;  2B2U A;  2F0D A;  1A3T A;  3K59 A;  5JVG 3;  1PFM A;  1TS2 A;  2SNS A;  2OQ0 A;  2UUC L;  2KA7 A;  5A2Q L;  3DHQ A;  2R7F A;  1RDP D;  1SBB B;  1D1I A;  4LF8 L;  1QNK A;  3GV6 A;  3GP7 A;  4ZLT F;  3G71 A;  1PHJ A;  3CC2 A;  4JI4 Q;  1PH6 A;  2R7Z B;  2RHS B;  4F7X A;  2VL6 A;  3U58 A;  3SVM A;  1FNV A;  4C3H B;  5D14 A;  2Q2T A;  2QKI C;  4LFC Q;  5DM6 3;  4X65 Q;  3Q22 A;  1STA A;  1FNU A;  1M90 C;  4FF3 A;  4LF5 L;  4POG A;  3T53 B;  2OCE A;  3NK9 A;  4UHV A;  4DR2 L;  2L9H A;  1HRJ A;  3CCQ A;  4PMW A;  2OQK A;  3BYY B;  2JA5 H;  2A69 C;  4RCN A;  1WYD A;  1V43 A;  3AQQ A;  3QG1 A;  2OEO A;  1Y69 U;  1KNE A;  2CW0 D;  1PZI D;  1EQQ A;  2O2L D;  5D3D A;  1ZKO A;  4DV7 L;  1J5E L;  4LFB Q;  1Q82 C;  1L0X B;  2E8G A;  3C1E A;  1QB5 D;  2MP1 A;  4X3U A;  1DCZ A;  2MGS A;  3HKZ G;  4JI1 Q;  3VYS A;  4CKE A;  4JOI C;  3J80 L;  5JVH 3;  2JA5 B;  5C4J H;  1GUO A;  3C3L A;  3QO2 A;  2A19 A;  1A15 A;  1E0B A;  2CWA A;  1ZYR D;  2F0T A;  2R93 H;  3LNN A;  2NVT H;  4LK1 C;  1S5B D;  3L0O A;  4GZY C;  1S72 A;  1VQ6 A;  1WTW A;  4IN3 A;  3Q24 A;  1TII D;  1K8O A;  5IP7 G;  4IOC A;  1I6V C;  1TWC B;  1TWG H;  4G7O C;  3T16 A;  4UAI A;  5IT9 L;  4AH6 A;  4RGO S;  3CME A;  3DEO A;  2EJG C;  5GQO A;  3H94 A;  5GAD C;  2CQO A;  5FLX c;  1SXT A;  1IYV A;  2C35 B;  3HOZ H;  1HR0 W;  1TWF H;  5C4J B;  1LTG D;  3SXH A;  1L1O C;  3RZD H;  2Q2H A;  1I6H H;  2R93 B;  4IAL A;  2NVT B;  1GXD C;  2RVL A;  3HOY G;  3OWF A;  2UU9 L;  1TWG B;  3QOJ A;  1KAW A;  4PV1 C;  1TS3 A;  1U9R A;  1XTC D;  2EQS A;  1H9J A;  2PW7 A;  5FJ8 H;  1HR0 Q;  1VQF A;  1WJJ A;  2H4O A;  3VYR A;  3HOZ B;  4Y7N H;  4DXF A;  2DUD A;  1PYW D;  1TWF B;  5M3M G;  3K5N A;  2OTL A;  2UUB Q;  2B2U C;  1BNZ A;  2F0Q A;  3A5Z B;  3OIP A;  3RZD B;  1I6H B;  1PRT B;  5A35 A;  1JJC B;  4OX9 L;  2DJF C;  2HQE A;  3ZJY C;  4BS9 A;  1NCV A;  1XX8 A;  5CV9 A;  5DAU A;  3CP0 A;  5C3X A;  2F0O A;  3GD7 A;  2ZXR A;  4NPS A;  1TQO A;  4JI8 Q;  2J4X A;  3JAM i;  4BBS G;  1VQA A;  2GVB A;  4BBR G;  1A3U A;  1FJG L;  4HCS A;  1II3 A;  4Y7N B;  1JB3 A;  2DNC A;  2NB0 A;  1XPU A;  2K5D A;  1CZG A;  1XNQ Q;  3KF6 A;  4LF6 L;  2NN6 I;  3BU2 A;  1HZB A;  2Q8T A;  4DU9 A;  3UE0 A;  1YNJ D;  4R4I A;  3R2T A;  3HOU G;  1KDA A;  1AP0 A;  3V05 A;  2MQH A;  2F52 A;  1S5D D;  1I4X A;  2VQF L;  2WKC A;  4ALP A;  4QIW E;  2A68 C;  3BS1 A;  1ET9 A;  1X55 A;  1EYD A;  2HCI A;  4HJ8 A;  4KKU A;  3E6Z X;  1N34 Q;  1U4L A;  1TVX A;  2A6E C;  4PQX A;  3PQI A;  5LL6 X;  3K57 A;  4GKJ L;  4DV6 Q;  4JI3 Q;  2EPB A;  2Z0S A;  1DOL A;  1I94 Q;  1AFP A;  2IHF A;  3VA7 A;  1JE4 A;  4KJO A;  1ICW A;  1QZG A;  3J7Y W;  1F77 A;  4JYA Q;  2RDF A;  3VR5 A;  1YIJ A;  1Q81 C;  4XQJ A;  3QWN A;  1I4R A;  4IFD G;  2BH2 A;  3NBI A;  1B9M A;  3FP9 A;  1Q1E A;  3OHX C;  1A3V A;  5IYC G;  1HA6 A;  4P74 A;  4K5V A;  1ROD A;  1EYC A;  2AUK A;  1XNR Q;  1A62 A;  3NXW A;  2PPB C;  3DMU A;  2QIL A;  3I3C A;  3IRB A;  1QIL A;  2XNA C;  1SYF A;  5C4H A;  1GUG A;  1STN A;  2LKV A;  1T5X D;  2OWO A;  1WCM H;  1VQE A;  4GNX A;  3DWQ A;  4DAP A;  1F9S A;  2LSS A;  5M5Y H;  3HG9 A;  3DM1 A;  1BUV T;  1HNZ L;  5IYD H;  2KCM A;  2RA4 A;  2VUM G;  4A3F H;  2K6A A;  4A3C H;  4OIJ A;  4X66 L;  1STE A;  3MTS A;  2JN4 A;  1CHQ D;  1JOQ A;  1CFM A;  2Z9H A;  4R4C A;  1CKN A;  5FLM H;  2HT1 A;  4A3M H;  5I4D A;  3WWV A;  3HGB A;  2L0C A;  3CKI B;  5M3F G;  3MXN A;  1OXV A;  2NZO A;  3EVQ A;  4I7Z C;  2YTY A;  4DV3 Q;  3BG3 A;  1NR4 A;  4QCL A;  2Y0S G;  4EQN A;  4XT3 B;  1H9K A;  3GQB A;  2D0P A;  1WCM B;  3KDF B;  1CSQ A;  3BZD B;  5HGT A;  1KD1 C;  2JA8 G;  5M5Y B;  4ZQ3 A;  1FNW A;  2K50 A;  2F4I A;  4PG3 A;  3CCJ A;  4A3F B;  5HGQ A;  3I90 A;  4HSP A;  1VS0 A;  2UUA Q;  1NJI C;  1O7Y A;  3BZK A;  2KED A;  5GAH C;  3CC4 A;  2Z4H A;  2MHV A;  1NMG A;  2PNH A;  3NQI A;  4FO2 A;  1SNQ A;  1U5K A;  4LF4 L;  1SE2 A;  2Z6K A;  4L6T B;  1VQG A;  3J80 c;  1UAP A;  1B3A A;  2ZTC A;  1XWE A;  1YBY A;  2PQA A;  2B39 A;  3C46 A;  4ZRZ A;  3P20 A;  1XJV A;  2F4V L;  3W2D A;  2E75 C;  4OGQ C;  2L1B A;  1HA5 A;  5E4W C;  1VQP A;  3TME A;  3UDX A;  1F9R A;  4CHT B;  1PRT D;  2DN8 A;  1EEF D;  2V4D A;  3K8A A;  1NTG A;  4DNT B;  4XXE A;  5IT9 c;  3RN5 A;  3J81 E;  2RCN A;  2VS1 A;  1SND A;  1R9T H;  1Y8O B;  2HQL A;  3PIO 3;  1LLR D;  2FMM A;  1OTC A;  2EYM A;  1NBW A;  1FD7 D;  4ZAI A;  4C3H G;  1LTB D;  2VQF Q;  2K5H A;  2R92 G;  2F03 A;  5IP7 H;  1C9O A;  2EYL A;  3CPF A;  3HP3 A;  3SDZ A;  3URY A;  2J0T D;  3HKZ B;  5E4X A;  4JI2 L;  5FO9 B;  1Y8N B;  2K7V A;  3TN2 A;  1WTH A;  3M4Y A;  3BVG A;  1O7I A;  5LL6 S;  2CH4 W;  2PCF B;  3KJO A;  1R9T B;  3OTO L;  1HNX Q;  2CW0 C;  1ESR A;  1WOC A;  1KRS A;  2JE6 I;  2H5X A;  1PZJ D;  4P2C B;  3S17 H;  1X32 A;  2WKD A;  1SYB A;  4GNX C;  1LT6 D;  3K5M A;  4A3J G;  4IUV A;  3HOV H;  1G91 A;  4H02 A;  1SNC A;  5AJ3 Q;  5BR8 Q;  5M3M H;  4ZUJ A;  4LMQ D;  3A7A B;  2HIV A;  3AB9 A;  1ZYR C;  1BCP F;  4K5W A;  2AWO A;  3NTK A;  4NP5 A;  2HHH Q;  4YWK A;  4X3S A;  5ELC A;  3F2B A;  5LMN L;  5FO7 B;  2BE5 C;  3J80 i;  2IW3 A;  2LFN A;  2NUC A;  4KD3 A;  2H1E A;  5E1F A;  5CGK A;  3I72 A;  5JPM C;  1D5Z C;  3S17 B;  1K3B C;  3H0G B;  5NUC A;  1SFO B;  4KHP L;  2K28 A;  4BBS H;  3I91 A;  3HOV B;  5FOB B;  4BBR H;  1HUM A;  1IYJ B;  1LT5 D;  4RGN A;  5M3M B;  3J81 L;  3EFX D;  4KJN A;  1RL2 A;  2B2W A;  4QY7 A;  3I55 A;  3TP5 A;  3MC0 B;  4L5S A;  2P5Z X;  4DR5 L;  1VQ7 A;  2HD3 A;  1AH9 A;  3HOU H;  5M9O A;  3PIP A;  1LTL A;  2F0G A;  2Z6K C;  4DK0 A;  4BBS B;  2QCP X;  5JJL A;  2Q8I B;  3BZC A;  4BBR B;  2CH4 A;  3OIQ A;  2F0F A;  3HFZ B;  2ZXO A;  4C56 C;  5CV7 A;  1CI3 M;  3H6M A;  5I2Y A;  3A56 A;  3D4D A;  2ENB A;  1PH9 A;  1Z9F A;  1BDO A;  1D5X C;  2K14 A;  3HOU B;  4IUP A;  3LWU A;  1U4R A;  5JOB A;  2O4X A;  1VQJ A;  1XMO Q;  1O7L A;  4LUV A;  3MXG A;  3OW2 A;  3AFP A;  3A55 A;  4LFC L;  5FJ8 G;  4IFD H;  4X65 L;  1YI2 A;  3J7A 5;  1PH7 A;  4ZKC B;  4HAE A;  2A5H A;  5IYC H;  1DJR D;  4IJL A;  4R4Q A;  1AE2 A;  3EN2 A;  3VYT A;  1IW7 D;  1ENF A;  1YNJ C;  2AQ3 B;  2F1M A;  3M4P A;  2VZA A;  1DXM A;  2LMC B;  5JJZ A;  5CV5 A;  4B08 A;  1EWI A;  1KXL A;  1Q46 A;  4LFB L;  1C4Q A;  1EU3 A;  2X69 A;  3MEH A;  4C3I H;  1CTM A;  1HZC A;  1M1K C;  1ICF B;  2VUM H;  3UDF A;  5J3B A;  5IOD A;  1E22 A;  3Q23 A;  1SSO A;  4Z9C B;  2WB1 E;  1GUS A;  4WJ4 A;  1LTR D;  4LUO A;  5M3F H;  2PMZ B;  1D5M C;  1EY6 A;  3MFG A;  5I2X A;  2KEN A;  4LNQ A;  3KLS X;  4DAY B;  5LMN W;  1P8L A;  3ERQ A;  3G4S A;  3NWS A;  2CKZ B;  4C3I B;  1UUP A;  2O5I C;  4BY1 G;  3R8B A;  2JA7 G;  3CXC A;  3HKS A;  3TP7 A;  2JA8 H;  2BOS A;  5EKI A;  3W5O A;  4YY3 Q;  2VUM B;  3PGZ A;  4IOA A;  1V1Q A;  3K80 C;  4J15 A;  4TRD A;  2NBF A;  1MGS A;  3I4M G;  2E2J H;  4LFA L;  1B50 A;  1S5E D;  4AYB E;  4EQP A;  1HFN A;  5M3F B;  5LMN Q;  1WVL A;  2Y0S B;  1VQO A;  2K5W A;  1K8G A;  2L55 A;  4ZKB B;  2EVB A;  4OWT B;  2ZTD A;  3EQL C;  3H3V H;  4FYD A;  1TS4 A;  3FVQ A;  1HR0 L;  1DOM A;  4PZ8 A;  1UWV A;  5KRU A;  1PA6 A;  2UUB L;  1SLJ A;  2E2J B;  1A2U A;  1WI5 A;  3CCR A;  3FPU B;  3RLO A;  2K4K A;  4KTA A;  2KQ3 A;  2UXB Q;  4FVM A;  1RJT A;  4B3T Q;  3VR3 A;  4QUC A;  4YCW A;  1PFS A;  3D6C A;  1G2S A;  4FXK C;  1MSG A;  3VYU A;  5IP9 G;  3NTI A;  1CUK A;  4LF7 L;  2JA9 A;  3MHB A;  1CHP D;  3STB D;  5C3E G;  2NVX H;  2R92 H;  4IPD A;  2MO1 A;  3B6Y A;  4L5R C;  3LWE A;  4CDF C;  3CCS A;  1EY7 A;  1XNQ L;  1EY4 A;  3K7U C;  4JBK A;  3LX0 A;  3FDT A;  2JQO A;  4TSS A;  1EYA A;  4FF4 A;  1KL9 A;  1SE8 A;  4ILW A;  1TY2 A;  5CR3 A;  3GTP H;  2KHJ A;  1PTO H;  2I5M X;  1K73 C;  2NTS A;  1ASZ A;  2AMC B;  2NVX B;  1N9W A;  1RD9 D;  2R92 B;  5JJK A;  1G6Z A;  1W3S A;  3U4V A;  4A3J H;  1N34 L;  4HIO A;  1MJC A;  1PRT C;  1G51 A;  2OT2 A;  1VCI A;  2M00 A;  4HMI A;  4GKK Q;  1U4M A;  4DV6 L;  4JI3 L;  5IGG A;  3CCV A;  2ES2 A;  1HZA A;  1L0W A;  3KDF A;  3LGJ A;  1I94 L;  3EBE A;  3GTP B;  2MUY A;  1EY9 A;  4YHH Q;  1JWU D;  3QB3 A;  5COY A;  1PTO B;  3J81 c;  4UP7 A;  4JYA L;  1LYL A;  1D8L A;  4UP8 A;  3WOF A;  2EE1 A;  3JAM c;  4DK3 C;  3PCO B;  4JVZ A;  4P71 A;  3L9A X;  1TWC H;  4HR7 B;  1EEI D;  4DV1 Q;  1QZH A;  4KK7 A;  4A3J B;  4DKA C;  1UE5 A;  1DOK A;  4B3S L;  4JI7 Q;  1XNR L;  1Y14 B;  4UPA A;  5KIX A;  5KND A;  2Z6B A;  3G7L A;  1QCB D;  3G6J B;  3IFD A;  1ENC A;  2PZW A;  2VXW A;  3PSI A;  5IGC A;  4A3G G;  1VDZ A;  1F2L A;  3RMH A;  2KCN A;  3KF8 B;  4L63 B;  3M7N A;  2CWP A;  3M4Q A;  4MHE A;  2OXP A;  4B9W A;  3DXJ C;  2J7Z A;  1IKL A;  2KBN A;  5IY0 A;  4KMU C;  1W6K A;  2AHO B;  2PO4 A;  2HUG A;  4LFA Q;  2Z1C A;  1E2Z A;  1G6P A;  4H7B A;  3RR5 A;  4DV3 L;  3UDG A;  3H09 A;  3NWT A;  2K52 A;  3H0G G;  4PMB A;  4JBM A;  3R2I A;  4DFA A;  1PH1 A;  2QGQ A;  3HOV G;  1K0S A;  4O0A A;  1SYC A;  1X54 A;  1PLF A;  3PMF A;  2UUA L;  1QUQ B;  3U4Z A;  3TZD A;  4DUZ L;  1NSN S;  3IFT A;  4CJ1 B;  2LS0 1;  4HJ7 A;  1WTV A;  5JJI A;  4LF9 Q;  1X6O A;  4N8F A;  1N33 Q;  1H95 A;  4QIW B;  5D3I B;  1D1K A;  2M2L A;  2I07 B;  4E6I A;  1BCP B;  3J81 i;  2O5J C;  1H9S B;  4F87 A;  4C1N K;  1IKM A;  1CZW A;  4LF7 Q;  3D8G A;  1JOK A;  2N3S A;  5JAV A;  3OYY A;  2EYH A;  2GA4 B;  3NBH B;  3A8I E;  3MWY W;  3S1Q H;  2NYZ D;  2E5L L;  2PI2 A;  4K8J A;  4JPB W;  2EY2 A;  4I7A A;  5ELF A;  4DN4 M;  2ZM6 Q;  2B3G A;  1LUZ A;  2KJX A;  4BY1 H;  2JA7 H;  2RKS A;  3PIO A;  2F3W A;  3S15 H;  4JG2 A;  2L15 A;  1SEB D;  4BA2 I;  2ICI A;  3S1Q B;  3K0Y A;  2KOL A;  2FFK B;  1Q7Y C;  1EZ6 A;  3AYH B;  4HJ5 A;  1IW7 C;  4DV2 Q;  3I4M H;  2CQA A;  3TRE A;  3K58 A;  2EYF A;  5JEA G;  1HNX L;  4CDC C;  3K81 C;  4N9P A;  4PZ7 A;  3SK5 A;  3ULJ A;  2ZTE A;  5EBD A;  4X6A H;  2CVR A;  2YV5 A;  2IL8 A;  1LO5 D;  1PZK D;  3BDO A;  3K5O A;  5FK9 C;  4A3K G;  5D65 A;  4BY1 B;  2JA7 B;  3S15 B;  1SMY D;  1V1O A;  4IFD I;  3NEL A;  3OSO A;  4A3D G;  1VQC A;  5EJW A;  4B3S Q;  4POF A;  5AJ3 L;  2XVS A;  4OEL B;  2IX0 A;  5BR8 L;  2OTJ A;  4RGT A;  2PNR C;  1EQV A;  1PFB A;  2QEJ C;  3I4M B;  1PTO D;  3TP8 A;  2HHH L;  4IJH A;  4DAM A;  1KDB A;  2Z8L A;  3ND8 A;  4X62 L;  4XT1 B;  4HCE A;  4RGM A;  3DLL A;  2B29 A;  4JBJ A;  4C3I G;  5C3W A;  3HOX G;  5IP9 H;  4O1N A;  2KCT A;  4IUU A;  4A76 A;  3S1M H;  2DGY A;  2A8V A;  5C3E H;  1B44 D;  4NXN L;  4X64 Q;  2UXD Q;  3RN2 A;  1G8Z D;  4R8N A;  4LW1 A;  1BXT A;  2K5Q A;  3JC6 6;  3ERO A;  3NUC A;  4DNI A;  5G3L F;  3T1H Q;  1IHZ A;  3CAM A;  4OXP A;  4CGY B;  3GTL B;  2G5D A;  2A1A A;  3QJY A;  3BVM A;  3I56 A;  2AUJ D;  1AW7 A;  3RLN A;  2DNE A;  1KIX A;  3VR4 A;  3S1M B;  3TZU A;  3PUV A;  2RDG A;  1BBX C;  3PO3 B;  1SYD A;  5C3E B;  3FRP B;  1KHI A;  3GTG H;  1GVP A;  4DUZ Q;  1YHB A;  3Q0A A;  1EOT A;  2IJ0 A;  4O42 A;  4DV4 Q;  1K8M A;  4XQN A;  1EL0 A;  4DAY A;  3RNU A;  1PTO F;  4MTK A;  1RTN A;  2AQ2 B;  5IOC A;  1XMO L;  1IBK Q;  4BXX H;  2HCC A;  2OF1 A;  2I46 A;  4DV5 Q;  3T1Y Q;  3STB C;  1HTP A;  3UI2 A;  1PMR A;  3H3V I;  3GTG B;  4RA8 A;  2K03 A;  2N55 A;  4J6H A;  4K2L A;  3IL8 A;  2E5L Q;  1XXG A;  2RHQ B;  4BY7 G;  3S9W A;  1BCP D;  4A3E G;  1BVS A;  2Q2I A;  1OXS C;  2AKW B;  2D2C C;  1S4Z A;  4A3G H;  2SOB A;  4QL5 A;  2IX1 A;  1B70 B;  2GN5 A;  1ASY A;  3S16 H;  4K5X A;  1GJX A;  1C7Y A;  2XSC A;  4RFB A;  2XRS D;  3TDQ A;  1JWS D;  1RKN A;  3CCM A;  3QR8 A;  2HDL A;  1V9P A;  1Q1B A;  1GD7 A;  1Q3L A;  1VQL A;  1JE5 A;  1QVC A;  2KHI A;  3AU7 A;  4AIM A;  2F0W A;  1EYG A;  2WV6 D;  1A6X A;  1WTP A;  4K0K Q;  2ALY B;  2K5N A;  1HH2 P;  1M4V A;  4A3G B;  1WFQ A;  3GO5 A;  1JCK B;  4B3M L;  2EYO A;  4FDB A;  3S16 B;  3U50 C;  2JP1 A;  4U68 A;  4PMC A;  5HY6 A;  1Y1V H;  3R3O A;  1XTD A;  4KLK A;  3H0G H;  1WTO A;  1SFO H;  2M9V A;  4MNO A;  3T13 A;  4LUZ A;  1SNO A;  5GAE C;  1OXT A;  3D6W A;  4YY3 L;  3KK7 A;  4FF1 A;  5EPJ A;  1SJE D;  5M5X H;  4DUY Q;  2NZH A;  4M1U B;  2K05 A;  1MIU A;  1SYG A;  5CYU A;  3BJU A;  4KV6 A;  1IL2 A;  3P7J A;  4KN4 C;  3K0X A;  2F0U A;  4X62 Q;  4K2K A;  3CRL C;  3DWP A;  2ASB A;  1Y8P B;  1Y1V B;  1HXY D;  5IGE A;  5LMU L;  1JOO A;  4HID A;  1HFG A;  4IUT A;  4WJW A;  1B2T A;  3ICE A;  3PF4 A;  1PYB A;  4C3J G;  1SNM A;  2EY5 A;  4DV0 Q;  1K3R A;  4NXN Q;  5M5X B;  4IUQ A;  1TWH H;  2WII B;  3PUZ A;  4IPH A;  1YHA A;  2FIN B;  1EIY B;  1E7Z A;  5JEA J;  4K8I A;  1H9M A;  2JEA I;  4MN3 A;  3I7F A;  1XMQ Q;  3SR1 A;  4B9X A;  1J8I A;  5KEE A;  3SHL A;  2UXB L;  1GKH A;  3N6R A;  3L7Z C;  3BVZ A;  1XYI A;  4B3T L;  3E9I A;  4JBW A;  1CQV A;  3TSS A;  1JOR A;  3I4N G;  1EZ8 A;  1FYC A;  3S1N B;  5I6W A;  5L37 A;  3U9S A;  2E2D C;  4RHS A;  4DNR B;  4R9W A;  1X3G A;  1YNN D;  3T56 B;  3C1F A;  4EGV A;  4A3I G;  1TWH B;  2E2I H;  3E9H A;  1JWM D;  5EBC A;  2KEC A;  3BYT B;  4QMG A;  3KF8 A;  4IZ8 A;  1CKM A;  1RCV D;  5C0X G;  2EDG A;  2F0I A;  4KKT A;  3TQY A;  1KLG D;  4ULL A;  2ZJP A;  2BDN A;  1HQM C;  4CDD C;  5JEA H;  1G29 1;  2ATW A;  2D9U A;  1E2W A;  1X56 A;  1S5F D;  1M8A A;  2QF7 A;  1VQD A;  3W1G A;  3J7Z C;  3ER0 A;  3BDC A;  4K14 A;  4A3K H;  2AQ1 B;  3CQZ H;  2CCZ A;  2WAQ E;  4A3B G;  2E2I B;  5CBE E;  1TY0 A;  1FL0 A;  5T1I A;  4A3D H;  3OMG A;  1IBL Q;  1FVI A;  1K28 A;  4GKK L;  4JV5 Q;  4YCU A;  2I5L X;  5FLX L;  1Q86 C;  4XYO A;  4RKL A;  1SJH D;  1HUN A;  4V19 0;  3N52 A;  1NUC A;  4YHH L;  1WD1 A;  3H3V C;  3OMC A;  1G2T A;  3CC7 A;  1F2Y A;  1QUQ A;  3QIA A;  3HOX H;  1STG A;  1VF5 C;  2X6G A;  5TSS A;  4DV1 L;  4A3K B;  1EQT A;  3CQZ B;  2RQX A;  5IE8 A;  5ELO A;  2EXZ A;  1HTL D;  4JI7 L;  4A3D B;  2F0L A;  3OWE B;  1CQF A;  1T5E A;  2X6L A;  3RLF A;  3UDI A;  1J9O A;  2MNA A;  1WTX A;  1H9S A;  3D3R A;  1SDF A;  3Q8D A;  4N8X 1;  4CBV A;  1IZ6 A;  3EIV A;  2E2H H;  4P73 A;  1EU4 A;  5IGD A;  1BBW A;  1HQR D;  4HN7 A;  1KLU D;  5GAG C;  4XQQ A;  4FNF A;  4B3M Q;  4OEM B;  3NBH A;  1YVC A;  5KGU A;  4A4I A;  3HOX B;  3J7A V;  4ABN A;  3K6O A;  2EY1 A;  3CW2 C;  1V8Q A;  1KTK A;  1SMY C;  1D2B A;  3TBI B;  3WDN A;  2LXK A;  4J8Q A;  2L12 A;  1B9N A;  4CJ2 C;  4DR1 Q;  1WTR A;  4AQY L;  4ZUI A;  2E2H B;  1ML0 D;  1STY A;  5EKL A;  3J7A F;  1PTO C;  2Z4I A;  1VQK A;  4HIM A;  4ZYS A;  1O80 A;  4IPG A;  1TU2 B;  2D5D A;  2XWJ B;  2G9D A;  5LMU Q;  2BCO A;  2PQA B;  1L0Y B;  2N78 A;  3OPO A;  3IKJ A;  4RKB A;  2DY7 A;  1DGS A;  1GUN A;  1ONL A;  2RDH A;  5I9O A;  1K8A C;  2F3V A;  2NVQ H;  3MA2 B;  2N49 A;  4RG1 A;  4HMJ A;  4LF9 L;  1Q12 A;  5CV4 A;  4G7Z C;  1N33 L;  2YTX A;  4BY7 H;  4LJZ C;  2XWB B;  4JC0 A;  5KYL A;  1X9N A;  2HDM A;  4A3E H;  1KNA A;  4RCO A;  1GOZ A;  4JI0 Q;  4QF4 A;  1T9H A;  1EWC A;  2E74 C;  1BF4 A;  3L2P A;  2L11 A;  2VNU D;  4DR4 Q;  3KLR A;  3GTK H;  1BBU A;  1JQY D;  1JMC A;  3PO3 G;  1B4O A;  4DA2 A;  4OO1 G;  3GTJ H;  1LAC A;  2NVQ B;  4MIU A;  4DGZ A;  5FO8 B;  5E7N A;  1A0I A;  1F9P A;  2MJ8 A;  4BY7 B;  3G48 A;  2F0P A;  1IL8 A;  5C44 H;  4A3E B;  3V2T A;  1V1P B;  4C2M H;  1WTQ A;  3RZO H;  1I4P A;  5IWA Q;  2QA4 A;  1F2M A;  5E3F A;  4G4K A;  5EAY A;  4O2D A;  2ZM6 L;  2VY3 A;  1I4Q A;  2F0H A;  1EIG A;  3C2P A;  3GTK B;  4CJ0 B;  3VA5 A;  4A93 G;  2A73 B;  2MO0 A;  4PZ6 A;  1HHV A;  3HZX A;  4GLA C;  3SK6 A;  3I73 A;  5J1Z A;  2NVY H;  3GTJ B;  4Y52 H;  1JIC A;  4GN5 A;  3WOE A;  3CPW A;  1AE3 A;  1HJP A;  1NMF A;  1QG7 A;  1QJO A;  2A6H D;  4IO9 A;  3S2H H;  4DV2 L;  1BCP C;  3S14 H;  5C44 B;  1PH8 A;  4C2M B;  3RZO B;  1J6Q A;  4Q0F A;  2Q2U A;  1VQB A;  1I50 B;  1P16 A;  2R7D A;  2IPK D;  4KY7 A;  4BXX G;  4KHV A;  1H9R A;  1YEZ A;  4RWS C;  1N36 Q;  1Z7T A;  4KKS A;  4NKL A;  1I3Q H;  2N88 A;  1KAA A;  3O13 A;  1EFI D;  5IYB G;  4R8I A;  4Q5V A;  1Y1W G;  2JSO A;  3U9O A;  2NTT A;  5KYI A;  3CCE A;  2NVY B;  1CSP A;  2F0K A;  4C3J H;  5C0X J;  1UEB A;  1PVO A;  1OXX K;  4F8M A;  1DON A;  2F0S A;  2B63 G;  3X3N A;  2FJ2 A;  1EY5 A;  3S2H B;  2JXM B;  4KY5 A;  3S14 B;  2F3I A;  2B2T A;  2WAC A;  3KUP A;  1C48 A;  3KYH C;  2E76 C;  1Z47 A;  3MXP A;  5CC4 A;  1TKW B;  4OHJ A;  3FKI G;  3CF5 A;  3ULP A;  3ITP A;  3M3Y H;  1UNS A;  1U4P A;  1JJ2 A;  1I3Q B;  1QVF A;  5EKK A;  3I4N H;  3KLS A;  3M85 A;  5ELD A;  5IGF A;  4C3J B;  4GOP B;  4X64 L;  1PH3 A;  2UXD L;  2EIF A;  3A5U A;  5C4X G;  1AZQ A;  4A3I H;  3DM3 A; 
#chains in the Genus database with same CATH homology
 2AWO A;  5IP9 H;  1CKO A;  2HHH Q;  4YWK A;  2KCT A;  3E0E A;  4A76 A;  3I2Z A;  3F2B A;  4TQU S;  4AQY Q;  5LMN L;  1N32 L;  3S1M H;  2DGY A;  3KOJ A;  2A8V A;  3T1H L;  3J80 i;  2HIX A;  1C0A A;  5C3E H;  1B7Y B;  3AFQ A;  4NXN L;  4OWX B;  3K7A H;  4X64 Q;  3H15 A;  3RN2 A;  2UXD Q;  4LW1 A;  1Y1V G;  1KC8 C;  3KJP A;  4OWW B;  4KHP L;  3JC6 6;  4BBS H;  4DNI A;  4BBR H;  4B3R L;  3T1H Q;  1IYJ B;  3PF5 A;  4DR7 L;  3CAM A;  1A8V A;  4OXP A;  3M4O H;  4LWC A;  4MZ9 A;  1YJN A;  5K36 G;  2CFM A;  1XPR A;  1RL2 A;  2A1A A;  4KHP Q;  4QY7 A;  2I5H A;  2JJQ A;  2PMZ E;  4QJF A;  3I55 A;  3G6E A;  4A3B H;  3I56 A;  4L5S A;  4DR5 L;  3RLN A;  1VQ7 A;  4DV4 L;  4DR7 Q;  1LM0 A;  1KIX A;  1HZ9 A;  1AH9 A;  3PUV A;  3HOU H;  4GOP C;  3PO2 H;  3CCU A;  1L1O A;  3PIP A;  1KHI A;  1LTL A;  4R1J A;  2Z6K C;  1K83 H;  3GTG H;  1GVP A;  4DUZ Q;  1YHB A;  2WAQ G;  4P72 A;  3ULL A;  1MJE A;  1GM5 A;  3TEH B;  4DR5 Q;  2IHE A;  3M9B A;  1VQ4 A;  1S40 A;  4A3L G;  4DV4 Q;  1IBK L;  5JJL A;  3BZC A;  3RNU A;  1JJG A;  4HJ9 A;  3HFZ B;  4DV5 L;  3T1Y L;  2R7Z H;  1BKB A;  1A63 A;  4OO1 I;  1WCM G;  4GN3 B;  2EXD A;  2JEB I;  4JI8 L;  4C3H H;  2UXC L;  1E3P A;  5IYD G;  1XMO L;  2JK8 A;  1I50 H;  4A75 A;  1PH9 A;  1IBK Q;  4A3F G;  4BXX H;  1Z9F A;  4A3C G;  2K14 A;  4DV5 Q;  2Y0S E;  3T1Y Q;  3STB C;  4GN4 B;  5FLM G;  3HOW G;  4L5Q A;  4A3M G;  2UUC L;  2OQ0 A;  3H3V I;  1VQJ A;  1XMO Q;  4LUV A;  3OW2 A;  2E5L Q;  3AFP A;  2R7F A;  2NN6 G;  4LFC L;  5FJ8 G;  4X65 L;  3TS0 A;  2RHQ B;  1X3F A;  4LF8 L;  5DLQ E;  1YI2 A;  3J7A 5;  4ME3 A;  1PH7 A;  4BY7 G;  1PHJ A;  4A3E G;  3G71 A;  3CC2 A;  4JI4 Q;  1BVS A;  2Q2I A;  1PH6 A;  1OXS C;  2RHS B;  2AKW B;  2UUC Q;  5IYC H;  2WB1 G;  4IJL A;  2VL6 A;  4R4Q A;  3U58 A;  3TS2 A;  3W1B A;  3VDY A;  4A3G H;  4QL5 A;  2IX1 A;  1AE2 A;  2Q2T A;  2FXQ A;  1B70 B;  2GN5 A;  1ASY A;  3S16 H;  4LFC Q;  4X65 Q;  3EN2 A;  1JB7 A;  4LF8 Q;  1C7Y A;  1E24 A;  1M90 C;  3M4P A;  2VZA A;  1YZ6 A;  4LF5 L;  3CCM A;  4POG A;  1SR3 A;  2OCE A;  4DR2 L;  1JT8 A;  1V9P A;  3CCQ A;  4K0K L;  1EWI A;  1KXL A;  1Q1B A;  1Q46 A;  4PMW A;  2OQK A;  3S1R H;  1GD7 A;  4LFB L;  2JA5 H;  1UE7 A;  2IY5 B;  2VQE L;  1VQL A;  1WYD A;  1JE5 A;  1V43 A;  1QVC A;  2KHI A;  3AQQ A;  3I4O A;  4C3I H;  4AIM A;  2QEX A;  4LF5 Q;  1EYG A;  4DR2 Q;  4TVA B;  1EQQ A;  1HZC A;  4K0K Q;  1K0R A;  2ALY B;  2K5N A;  1HH2 P;  1M1K C;  1J5E L;  4DV7 L;  4AYB G;  1UE1 A;  1IBM L;  1WFQ A;  3UDF A;  2VUM H;  3GO5 A;  5J3B A;  1Q82 C;  4XIG S;  4LFB Q;  1E22 A;  3CD6 A;  2E8G A;  4B3M L;  4FDB A;  3U50 C;  4UY8 C;  4DUY L;  5HY6 A;  1Y1V H;  1XTD A;  4KLK A;  1L1O B;  2WB1 E;  3H0G H;  4WJ4 A;  1SFO H;  3HKZ G;  4JI1 Q;  4LUO A;  4MNO A;  4LUZ A;  4JOI C;  5M3F H;  1J5E Q;  4DV7 Q;  1N32 Q;  5GAE C;  1OXT A;  2JA6 G;  3A74 A;  1D7Q A;  2KEN A;  4YY3 L;  1TXY A;  1YJW A;  4LNQ A;  4DAY B;  5C4J H;  5LMN W;  1P8L A;  4P75 A;  5M5X H;  3G4S A;  3MEF A;  4DUY Q;  3GTL H;  2NZH A;  2A19 A;  2GVA A;  2CWA A;  2CKZ B;  1MIU A;  4BY1 G;  2JA7 G;  2R93 H;  3BJU A;  3CXC A;  3HKS A;  2LXJ A;  2NVT H;  1IL2 A;  4DR3 L;  2JA8 H;  3L0O A;  3W5O A;  1VQI A;  4OON A;  1S72 A;  1NE3 A;  1VQ6 A;  4YY3 Q;  1SRU A;  3K0X A;  3PGZ A;  4GLV B;  1V1Q A;  3K80 C;  4MTN A;  1VQ5 A;  4IOA A;  1S3O A;  3CMA A;  4J15 A;  4X62 Q;  3PO3 H;  5IP7 G;  4DV0 L;  2ASB A;  4IOC A;  2R6G A;  1TWG H;  1SRO A;  3I4M G;  4AH6 A;  2E2J H;  4LFA L;  2WP8 J;  4AYB E;  3CME A;  5LMU L;  5GQO A;  4HID A;  1YIT A;  5GAD C;  3ICE A;  2CQO A;  2IT1 A;  2YTV A;  1PYB A;  5FLX c;  5LMN Q;  2C35 B;  1XMQ L;  3PF4 A;  3HOZ H;  1HR0 W;  1TWF H;  4DV0 Q;  1K3R A;  4NXN Q;  1TWA H;  1VQO A;  1K8G A;  1TWH H;  3PUZ A;  1L1O C;  1YHA A;  4IPH A;  1EIY B;  1E7Z A;  5JEA J;  3RZD H;  2Q2H A;  1I6H H;  4UP9 A;  4OWT B;  2ZTD A;  2JEA I;  3H3V H;  3I7F A;  1HR0 L;  1XMQ Q;  4B3R Q;  4JI5 L;  3HOY G;  3HOW H;  4PZ8 A;  4A93 H;  2UXB L;  1GKH A;  1UWV A;  3L7Z C;  1VQH A;  4B3T L;  3E9I A;  1PA6 A;  3J81 j;  1SLJ A;  1L2F A;  2UU9 L;  4JBW A;  2UUB L;  1KAW A;  4HJA A;  3I4N G;  2EQS A;  1WI5 A;  4NB3 A;  2BH8 A;  5FJ8 H;  3CCR A;  1HR0 Q;  3RLO A;  2K4K A;  1VQF A;  3S2D H;  1WJJ A;  1VQN A;  4Y7N H;  2UXB Q;  2DUD A;  5M3M G;  4JI6 L;  3GTQ H;  4B3T Q;  1X3G A;  3F2C A;  2OTL A;  2UUB Q;  4YCW A;  1PFS A;  4A3I G;  2E2I H;  2UU9 Q;  3E9H A;  4RMF A;  5IP9 G;  3PUY A;  3A5Z B;  1CUK A;  2K75 A;  4GLX A;  2JA9 A;  4LF7 L;  1JJC B;  1CKM A;  3PV0 A;  4OX9 L;  5C0X G;  3STB D;  5C3E G;  2NVX H;  3ZJY C;  2R92 H;  1Q8K A;  2MO1 A;  1I5F A;  3B6Y A;  4IPD A;  3TQY A;  4L5R C;  2ZJP A;  1Y1W H;  5IYB H;  1KQS A;  2AWN A;  3CP0 A;  3GD7 A;  4NPS A;  3CCS A;  3GTO H;  1VQ9 A;  4JI8 Q;  3JAM i;  1XNQ L;  4BBS G;  4JBK A;  3K7U C;  2UXC Q;  1G29 1;  2ATW A;  1VQA A;  2GVB A;  2JQO A;  4BBR G;  4OX9 Q;  1IBL L;  1X56 A;  1YJ9 A;  1FJG L;  1UE6 A;  1VQD A;  1KL9 A;  1SE8 A;  4JV5 L;  3W1G A;  2B63 H;  3J7Z C;  3ER0 A;  4A3K H;  1NY4 A;  3GTP H;  2KHJ A;  3CQZ H;  5M5W H;  2CCZ A;  2WAQ E;  1XPU A;  1XNQ Q;  4A3B G;  1YNX A;  2MFI A;  2N8N A;  3KF6 A;  1SMX A;  1FL0 A;  4LF6 L;  2NN6 I;  4A3D H;  3BU2 A;  1HZB A;  2I5M X;  1IBL Q;  1K73 C;  1FVI A;  3UE0 A;  1FJG Q;  1X65 A;  3KLW A;  3PUW A;  3FKI H;  4R4I A;  1ASZ A;  4GKK L;  4JV5 Q;  3HOU G;  2AMC B;  3PO2 G;  4YCU A;  1N9W A;  1PYS B;  3GDE A;  5JJK A;  2I5L X;  1Q86 C;  1W3S A;  3U4V A;  2ZJR A;  2MQH A;  4A3J H;  1W2B A;  2F52 A;  1N34 L;  4HIO A;  1MJC A;  4LF6 Q;  4YHH L;  2VQF L;  1KRT A;  1G51 A;  4ALP A;  1VCI A;  4QIW E;  4GKK Q;  4DV6 L;  4JI3 L;  3CC7 A;  5C4X H;  3CCV A;  1QUQ A;  2ES2 A;  1X55 A;  1HZA A;  1L0W A;  1EIF A;  2R7Z G;  3KDF A;  4HJ8 A;  3HOX H;  5C44 G;  3LGJ A;  4DV1 L;  3EBE A;  4YCV A;  1I94 L;  1N34 Q;  4EX5 A;  5IE8 A;  2YYZ A;  5ELO A;  4EQ5 A;  4YHH Q;  3J81 c;  3TRZ A;  4UP7 A;  1GO3 E;  4JI7 L;  4JYA L;  4DR6 L;  1LYL A;  1D8L A;  4GKJ L;  4UP8 A;  4DV6 Q;  4JI3 Q;  3JAM c;  1IXR A;  3PCO B;  2Z0S A;  4P71 A;  3RLF A;  3UDI A;  4DK3 C;  2MNA A;  1TWC H;  2VQE Q;  1I94 Q;  4DV1 Q;  1QZH A;  2IHF A;  3Q8D A;  1U0L A;  4IPC A;  1HNW L;  1IZ6 A;  2V1C C;  3EIV A;  1QZG A;  2E2H H;  4P73 A;  4DKA C;  2YU9 H;  4NXM L;  1BBW A;  1EQR A;  1IBM Q;  1E1O A;  1UE5 A;  4B3S L;  4JI7 Q;  4JYA Q;  1XNR L;  5GAG C;  1YIJ A;  1Q81 C;  4IFD G;  4B3M Q;  1Y14 B;  4GKJ Q;  1PV4 A;  4UPA A;  1PH2 A;  2BH2 A;  5H1S E;  1YVC A;  3FP9 A;  2I0Q A;  4A4I A;  3ERS X;  1Q1E A;  3PSI A;  5IYC G;  4DR1 L;  4A3G G;  4P74 A;  3CW2 C;  4DK6 C;  4WJ3 M;  3HOY H;  3KF8 B;  1XNR Q;  1A62 A;  3NEN A;  2LXK A;  1PH5 A;  3F8T A;  3M7N A;  3IRB A;  4DR1 Q;  2CWP A;  4AQY L;  4DR3 Q;  3M4Q A;  4A3L H;  2BA0 A;  4YWM A;  1VQK A;  3S1N H;  2JA5 G;  5GRO A;  4HIM A;  1EOV A;  2OWO A;  1PH4 A;  2BA1 A;  1EUJ A;  3CCL A;  2KBN A;  4IPG A;  1WCM H;  1VQE A;  4GNX A;  5IY0 A;  2LSS A;  2AHO B;  3HKZ E;  5M5Y H;  1HNZ L;  5IYD H;  4LFA Q;  2KCM A;  5LMU Q;  3S24 A;  2VUM G;  4A3F H;  3KF6 B;  1G6P A;  3RR5 A;  2PQA B;  3D31 A;  2N78 A;  4JCV E;  4X66 L;  4A3C H;  4DV3 L;  4APV A;  3UDG A;  4R4C A;  1CKN A;  5FLM H;  1DGS A;  2HT1 A;  4A3M H;  3WWV A;  2K52 A;  3H0G G;  1K8A C;  4JI0 L;  2NVQ H;  1HNZ Q;  2N49 A;  4JBM A;  5M3F G;  4RG1 A;  2QGQ A;  4DPG A;  1PH1 A;  1OXV A;  2NZO A;  3HOV G;  1X3E A;  1Q12 A;  4X66 Q;  4O0A A;  2YTY A;  1X54 A;  4LF9 L;  1N33 L;  2YTX A;  4DV3 Q;  4DR4 L;  4BY7 H;  4JI5 Q;  4JC0 A;  1X9N A;  2Y0S G;  4A3E H;  4BA1 I;  2UUA L;  1QUQ B;  3U4Z A;  4JI0 Q;  1T9H A;  2D0P A;  3KDF B;  4DUZ L;  2R93 G;  3FHW A;  4R4T A;  4YWL A;  1CSQ A;  3D0F A;  1KD1 C;  2JA8 G;  4HJ7 A;  3L2P A;  5JJI A;  2K50 A;  4IFD J;  4LF9 Q;  2VNU D;  1X6O A;  1N33 Q;  4DR4 Q;  3GTK H;  4PG3 A;  1BBU A;  3CCJ A;  1H95 A;  5HGQ A;  2D0O A;  1JMC A;  3PUX A;  3PO3 G;  4QQB X;  1VS0 A;  2UUA Q;  1NJI C;  4L5T A;  4JI6 Q;  3J81 i;  4OO1 G;  3GTJ H;  5IWA L;  3BZK A;  2ID0 A;  5GAH C;  5C0X I;  1QVG A;  3CC4 A;  4LF7 Q;  5E7N A;  2PI2 E;  4KHZ A;  1A0I A;  4GOP A;  3HOZ G;  2N3S A;  1NMG A;  2PNH A;  3GTM H;  1U5K A;  3G48 A;  3OYY A;  4LF4 L;  2Z6K A;  5C44 H;  1VQG A;  3NBH B;  3J80 c;  4C2M H;  3F2D A;  3RZO H;  5IWA Q;  3S1Q H;  2ZTC A;  2RF4 A;  2QA4 A;  5EAY A;  4O2D A;  1YBY A;  2ZM6 L;  2E5L L;  2VY3 A;  2PQA A;  2PI2 A;  1SN8 A;  1XJV A;  2F4V L;  1VQ8 A;  1RIP A;  2K5V A;  1VQP A;  1E1T A;  4KI0 A;  4JI4 L;  3UDX A;  4LF4 Q;  4A93 G;  2MO0 A;  4PZ6 A;  1MKH A;  4GLA C;  2NVY H;  2JA6 H;  4Y52 H;  3K8A A;  1NTG A;  2ZM6 Q;  4GN5 A;  2B3G A;  5IT9 c;  1B8A A;  1AE3 A;  3CPW A;  3RN5 A;  2F4V Q;  1LUZ A;  1HJP A;  1NMF A;  2RCN A;  2VS1 A;  1N36 L;  4IO9 A;  4BY1 H;  1R9T H;  2JA7 H;  3S2H H;  4DV2 L;  3S14 H;  3PIO A;  4R4O A;  4GNX B;  2HQL A;  2XGT A;  1PH8 A;  1OTC A;  3S15 H;  2VW9 A;  4JG2 A;  1J6Q A;  1NBW A;  2L15 A;  4BA2 I;  3AEV A;  2Q2U A;  1VQB A;  2R7D A;  1P16 A;  1FGU A;  2VQF Q;  1Q7Y C;  4HIK A;  4BXX G;  4GS3 A;  2K5H A;  2R92 G;  5IP7 H;  1N36 Q;  1C9O A;  1YEZ A;  3AYH B;  3CPF A;  1CKN B;  4QGU A;  1I3Q H;  4DV2 Q;  4HJ5 A;  3I4M H;  1Y1W G;  5IYB G;  3TRE A;  5JEA G;  1HNX L;  1XPO A;  2WFW A;  3K81 C;  3CCE A;  3MXN B;  4PZ7 A;  4JI2 L;  1CSP A;  3A0J A;  4C3J H;  5C0X J;  1UEB A;  3ULJ A;  2ZTE A;  1PVO A;  1OXX K;  1K9M C;  4DR6 Q;  4X6A H;  2YV5 A;  1O7I A;  2B63 G;  3KJO A;  4A3K G;  4JI1 L;  1HNW Q;  2F3I A;  1VQM A;  3OTO L;  1HNX Q;  1YHQ A;  3KYH C;  1N8R C;  1WOC A;  4JI2 Q;  1KRS A;  3NEL A;  4NXM Q;  1VQC A;  2JE6 I;  4A3D G;  4IFD I;  4B3S Q;  2H5X A;  4POF A;  1Z47 A;  3KFU A;  5AJ3 L;  2D62 A;  3FKI G;  2IX0 A;  5BR8 L;  3CF5 A;  2OTJ A;  3ULP A;  3S17 H;  3M3Y H;  1OXU A;  3UE1 A;  5ELN A;  1JJ2 A;  4GNX C;  4A3J G;  1EFW A;  1QVF A;  3OTO Q;  3F1Z A;  3HOV H;  2XTI A;  4H02 A;  2HHH L;  3I4N H;  3M85 A;  4IJH A;  4DAM A;  3SGI A;  2ZJQ A;  4X62 L;  5AJ3 Q;  3NEM A;  5BR8 Q;  3DLL A;  4X64 L;  5M3M H;  2B29 A;  4JBJ A;  4GOP B;  2EIF A;  3A5U A;  1PH3 A;  2UXD L;  5C4X G;  4XTC S;  2HIV A;  4A3I H;  3HOX G;  4JOI A;  3DM3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...