1SE8A

Structure of single-stranded dna-binding protein (ssb) from d. radiodurans
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
231
structure length
213
Chain Sequence
RGMNHVYLIGALARDPELRYTGNGMAVFEATVAGEDRVRNLPWYHRVSILGKPAEWQAERNLKGGDAVVVEGTLEYRQWEKRSAVNVKALRMEQLGTQPELIQDAGGGVRMSGAMNEVLVLGNVTRDPEIRYTPAGDAVLSLSIAVNENYQDRQGQRQEKVHYIDATLWRDLAENMKELRKGDPVMIMGRLVNEGWTRNSTRVEATRVEALAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single-strand binding protein
publication title Crystal structure of the Deinococcus radiodurans single-stranded DNA-binding protein suggests a mechanism for coping with DNA damage.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Dna binding protein
total genus 40
structure length 213
sequence length 231
ec nomenclature
pdb deposition date 2004-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1se8A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1se8A02
1IBMQ 4DV4Q 5IE8A 2BH2A 3KF6A 4NPSA 2ALYB 5C3EH 4YY3Q 3RNUA 3T1YQ 2NN6I 3CMEA 1CKMA 3T1HL 1JJ2A 2MO1A 1JMCA 3E0EA 1VQMA 1GVPA 4JCVE 1PH9A 1W2BA 1FJGL 1Q12A 1U5KA 4A3FH 2ZJPA 1YITA 4LF9Q 2QGQA 3HOUG 4DR5L 2UUAQ 4GS3A 3H3VI 3CC7A 4DR1L 4AQYL 1I94L 3G6EA 4LUOA 3PO3H 3S1QH 3KF8B 4DR7Q 4A3CG 4Y52H 4APVA 3CMAA 4DV0L 2JJQA 1NMGA 3CP0A 1XMOL 4LF7Q 3NEMA 1QVFA 2LXJA 3STBD 2JK8A 3WWVA 4C2MH 2Z6KA 4HIKA 1X56A 4DV6Q 4A76A 4DV1Q 2MO0A 4JV5Q 3ER0A 1TWAH 4YCWA 1N32L 1EYGA 2IT1A 2WFWA 3S1RH 2OQKA 1XPOA 2IHFA 1IYJB 4TQUS 4A93H 3S17H 1EFWA 4K0KQ 4OWXB 3JAMi 2CCZA 3RLNA 3ERSX 1K0RA 4GLAC 1WJJA 3CCUA 5JJIA 4IFDG 4IO9A 4LFBL 1CKOA 5J3BA 1V9PA 1FL0A 3PUYA 1SN8A 3UE0A 3ULJA 4QJFA 5C44H 4DV7L 4A3DH 3ICEA 3PF5A 1L2FA 1J6QA 1SMXA 1QVCA 4LF8Q 1KRTA 5BR8Q 2DUDA 3GTQH 4A3EH 1KL9A 1G6PA 3J81c 4A75A 4RMFA 4JI7L 4IOAA 3UDGA 2WB1G 3CCVA 1YZ6A 2IHEA 3S2HH 4IPCA 4KI0A 1IBKL 4B3MQ 1MJCA 4JOIC 5M5WH 4DR4Q 2HHHL 2AMCB 2VQEL 1PV4A 4GOPB 2RF4A 1E1TA 3H0GH 4A3MG 1Q46A 1X3FA 3GDEA 4QL5A 1CSQA 4HJ9A 2CWAA 2KENA 1YJ9A 1WCMG 4QY7A 3B6YA 2K5NA 3GO5A 2R92G 2YTVA 2UUCL 3CC2A 1VQIA 2N3SA 2VQFQ 3GTGH 1GM5A 4JI4L 2WAQE 1OXTA 3H3VH 1VQPA 2IY5B 5FJ8G 3HKZE 2RHQB 2ZJRA 1PH7A 2Q2IA 4YCUA 3CC4A 4NXNQ 2ZTCA 1Y1VH 1ASZA 1VQDA 4A3IG 4GKKL 2ATWA 1NMFA 3PGZA 1RL2A 2MFIA 4B3SQ 1X3GA 1PH2A 4OX9L 3I4NH 1BKBA 1SLJA 2I0QA 3K0XA 4HIOA 1VQ6A 4GNXB 4DR3Q 3U58A 5C4JH 5IP7H 3LGJA 1VQEA 3BJUA 1KHIA 1I6HH 3JC66 1XJVA 3EN2A 4GLVB 3CCSA 5M3FH 4JI5Q 1HNWQ 2K50A 5IYBG 5GADC 1HR0W 4PZ7A 3STBC 1VQLA 2N8NA 2NVYH 2YU9H 2VNUD 4OWWB 3PV0A 3CPFA 4JC0A 4HJAA 4Y7NH 3I4MG 2JA8G 1IBLL 2B3GA 1N34L 1CKNB 4TVAB 4JI0L 3PIPA 3J80c 4X65L 2Y0SG 4LF6Q 2ZTEA 1WFQA 2KHJA 2R7FA 3OYYA 5IP9H 1OXXK 1Y1WH 4QIWE 1TWFH 3RN2A 1N9WA 1KRSA 2HT1A 3GTLH 1AE3A 2ZTDA 3HOZH 2EIFA 1PHJA 1YHQA 4JI3L 4X62Q 1IL2A 5M3MH 3FKIH 3G71A 4JOIA 1WYDA 1E3PA 1YJNA 5LMNQ 3HOWH 5IY0A 4DV5L 1I5FA 3CD6A 3S24A 4YWKA 1HNXL 1HZ9A 2VY3A 4JBWA 4A3JG 2AHOB 3TEHB 3T1HQ 3GTMH 4DV2L 5JEAG 2PI2A 3F2DA 1HZCA 1Q82C 1FJGQ 1OXUA 3H15A 1OTCA 2BA0A 2HQLA 4DR5Q 2KCTA 3I55A 1XNRL 3HOYG 4DR1Q 2A1AA 4DPGA 4GOPC 2R6GA 2GVBA 3M4QA 4AQYQ 3ULPA 1I94Q 3A5UA 1YHAA 4BBRG 3PO2H 1YNXA 3KFUA 4DV0Q 3GTJH 4A3BG 1XMOQ 1E1OA 2Q2HA 1B8AA 1N32Q 2NVQH 1D7QA 4RG1A 2D62A 5HGQA 4DR6L 3S1NH 1PH1A 4KHPL 1FGUA 3K8AA 1K8GA 4DUYQ 4IPDA 1KQSA 2F4VL 3ULLA 5GAGC 2N78A 2QA4A 3J7A5 1VQJA 1KC8C 5FLMG 3M85A 1KXLA 4JBMA 2K5HA 4P74A 1K83H 5M5XH 3CCJA 1K3RA 4GNXC 2R7ZG 1Y14B 2I5MX 4PG3A 1QVGA 1LM0A 2F52A 1YIJA 2JA6G 3CXCA 3S16H 4BY7G 4A3KG 3HOXG 4DV4L 3BU2A 2GVAA 4EQ5A 3AFQA 2JEBI 1YI2A 1PH5A 3AEVA 2PNHA 3GTKH 1WCMH 4YY3L 1JB7A 1IBKQ 2JA5G 4ME3A 4GKJQ 1WI5A 1VQBA 2OWOA 3KLWA 3I7FA 4JG2A 1VS0A 2HHHQ 3M7NA 1Z9FA 2VQEQ 1XNQL 2N49A 2Z0SA 3CAMA 5FJ8H 4MZ9A 2R93H 2WAQG 3HKZG 5C3EG 2ZJQA 1X9NA 1L1OB 4A3IH 1VQ8A 2ZM6L 3KOJA 1X6OA 3TQYA 1HNZQ 4IPGA 2UUCQ 4C3HH 5IYDH 1YHBA 4C3JH 4JI4Q 1UE1A 2VL6A 4AYBG 4NXML 1TWHH 2B29A 1L1OA 1UEBA 1X65A 4JI1L 4QGUA 3I56A 4UY8C 4X66L 1N36L 4BBSG 2BH8A 3K80C 4JV5L 4A3LH 1SR3A 1GKHA 1VQCA 4DV3L 1VQOA 4GKKQ 4DUZL 4GOPA 2UXDQ 4IJLA 3OTOL 3TRZA 4DK3C 3K7UC 4X64L 2KHIA 3JAMc 3TS0A 3U50C 5E7NA 1PH4A 1Z47A 1XPRA 2CWPA 4P75A 3TS2A 3GTOH 4O0AA 1K73C 1UE7A 4JBKA 3F1ZA 2XTIA 3PUVA 4BA1I 3S2DH 1BVSA 4JI2Q 3CCLA 4OXPA 1TWCH 4EX5A 4A93G 1G51A 1PH6A 1HZAA 2UU9L 5BR8L 4DR2L 2YTYA 1JE5A 1J5EL 4LF5L 2NVXH 2NVTH 3NELA 2A8VA 3F8TA 1P16A 1IBLQ 1N34Q 3HKSA 4K0KL 1EQRA 1S3OA 2AWOA 2CFMA 3MEFA 4GNXA 4X65Q 1HR0L 4DK6C 4JI0Q 4BXXH 2BA1A 4WJ4A 1D8LA 1X3EA 5C0XG 1NTGA 2B63H 3M9BA 2JA7G 4IPHA 4A3EG 4B3TL 5AJ3Q 1LYLA 2PI2E 2K75A 2VS1A 3CCRA 4NB3A 3A0JA 4JI6L 2UXBL 2VW9A 3PCOB 3I2ZA 5GAEC 4IFDI 1I3QH 4JI3Q 2WP8J 4JBJA 2VUMH 3PSIA 4GN4B 1PA6A 4H02A 2E5LQ 2AWNA 2ASBA 1VQGA 4DV5Q 1CKNA 3GD7A 1S40A 1NY4A 3H0GG 3TREA 1YJWA 4JI8L 2NZHA 1HNXQ 1S72A 4LF4L 3M4PA 5LMUL 4YHHQ 2E2JH 1RIPA 1A63A 3HOYH 1VQ5A 3L7ZC 2CQOA 4LFCL 1EIFA 4BBRH 1N33Q 5JJLA 1GD7A 3D31A 3G4SA 2C35B 1XMQL 3K7AH 1LTLA 3HOUH 5IYCG 5FLXc 1E22A 2AKWB 3Q8DA 2EQSA 1CSPA 1XNRQ 1XTDA 1OXSC 1X55A 2CKZB 4YWMA 3OW2A 1NJIC 3I4NG 4JYAL 1PYSB 4A3CH 1HJPA 3FP9A 4AIMA 1HNWL 4R4CA 2UXCL 3M4OH 1L1OC 3RZOH 4XIGS 3GTPH 5IP7G 1AH9A 3AFPA 4GLXA 4A3GG 3E9HA 4OWTB 5FLMH 1V1QA 3RLFA 2UUBL 4DR6Q 2VZAA 5ELNA 2JA6H 5M3FG 2FXQA 1M1KC 2MQHA 4LFAL 4OO1G 2KBNA 1Q8KA 3HOVG 3UDXA 1L0WA 4YWLA 2K52A 1B7YB 3EIVA 4R4TA 2F3IA 4A4IA 3PUWA 4X62L 1VQKA 4IFDJ 1MKHA 4L5SA 5K36G 5LMNL 1P8LA 5C0XI 1JJGA 2PQAB 1Y1WG 1VQNA 4PZ6A 4MTNA 1XPUA 4X6AH 1MIUA 3U4ZA 5LMNW 4DKAC 4BY1G 3HOZG 2HIVA 1KIXA 2LXKA 2I5HA 4LFBQ 2PQAA 3DLLA 3IRBA 5IWAL 4DV7Q 1SFOH 5M3MG 3FKIG 3W5OA 4P72A 3HOWG 2K14A 1XNQQ 1WOCA 2JQOA 2YTXA 1OXVA 3S15H 2JEAI 1HH2P 1IBML 4LW1A 4DNIA 4BBSH 4WJ3M 3DM3A 4GN3B 4A3MH 4JI7Q 4GN5A 3J81i 4B3RL 3F2BA 1VQHA 2ZM6Q 3T1YL 1UE5A 2R92H 3RLOA 1EOVA 4LNQA 2ID0A 3S1MH 1GO3E 3NBHB 5C4XG 3UDIA 4HJ8A 1A0IA 3RR5A 3RN5A 4NXMQ 4LWCA 1C0AA 4JI1Q 3S14H 2JE6I 4HIMA 4X66Q 3CCMA 4KLKA 1N36Q 4B3RQ 4LF9L 1YVCA 1QUQB 3F2CA 3CW2C 4DV3Q 1QZHA 1DGSA 2OQ0A 3L0OA 4POGA 2K4KA 2UUAL 1VQ7A 4DUZQ 1SROA 5ELOA 1EUJA 3OTOQ 1IXRA 2NZOA 2E2HH 1EIYB 4X64Q 4DR7L 3PO2G 1QUQA 5M5YH 3KJPA 2YYZA 4IJHA 4DUYL 4BA2I 1YEZA 3CCQA 4LF7L 5GQOA 4A3FG 3UDFA 3AQQA 1SE8A 4DV6L 4DV1L 1K8AC 4UP8A 1E24A 1UE6A 2IX0A 2IX1A 4C3IH 3PO3G 1T9HA 2UU9Q 2JA9A 4OX9Q 2JA7H 2E2IH 4DR2Q 1W3SA 1Q1BA 1BBUA 5GROA 5IYBH 5C0XJ 1J5EQ 4LF5Q 4OO1I 1YBYA 3ZJYC 2D0PA 4L5RC 1A62A 1TWGH 1PFSA 2DGYA 3I4MH 2JA8H 1LUZA 3W1BA 2XGTA 3FHWA 5IT9c 3I4OA 1HR0Q 2Q2UA 4PZ8A 4GKJL 1EWIA 1TXYA 2OTJA 1V43A 3VDYA 4LF8L 4B3TQ 3A74A 1I50H 1Q7YC 1N8RC 3CQZH 3A5ZB 2R7DA 4L5TA 3CCEA 1BBWA 1VCIA 4DAMA 1Q86C 4JI6Q 4J15A 1C9OA 2UXBQ 4XTCS 2HIXA 1FVIA 2K5VA 4R4IA 3EBEA 5C44G 4OONA 4A3DG 1NBWA 1HNZL 4HJ7A 1VQ9A 1SRUA 4B3ML 4AH6A 4DR4L 1QZGA 3J80i 2D0OA 2R93G 1VQAA 2RCNA 5DLQE 4JI8Q 4L5QA 1PYBA 2WB1E 3HFZB 4UP7A 4PMWA 4LF4Q 5LMUQ 4HIDA 2A19A 2RHSB 4KHZA 5IYCH 4R4OA 2NN6G 3MXNB 5HY6A 4A3JH 1M90C 1B70B 3KDFB 4AYBE 5GAHC 3CF5A 2L15A 3PUZA 2I5LX 1IZ6A 4LFCQ 5IYDG 2UXDL 2VQFL 3SGIA 4YCVA 5JEAJ 1XMQQ 4HJ5A 1HZBA 3KDFA 4FDBA 1NE3A 1K9MC 4A3LG 4NXNL 3PF4A 4A3GH 1G291 4UPAA 2MNAA 3CPWA 4O2DA 4JYAQ 2GN5A 2H5XA 2KCMA 4JI2L 4DV2Q 3M3YH 1H95A 1VQ4A 2E8GA 4B3SL 2OCEA 4R4QA 1PH8A 1R9TH 2UXCQ 4A3BH 1MJEA 3HOVH 4DR3L 3RZDH 3L2PA 2Z6KC 5EAYA 4MNOA 2OTLA 4P73A 5H1SE 1Y1VG 3K81C 1PH3A 1E7ZA 2UUBQ 2PMZE 4DAYB 2QEXA 4LFAQ 3J81j 4JI5L 4QQBX 3BZCA 4ALPA 5AJ3L 1CUKA 1VQFA 3NENA 1KD1C 3E9IA 4LUVA 3BZKA 3W1GA 3J7ZC 3KYHC 3PIOA 1Q81C 4BY1H 4UP9A 3PUXA 3G48A 4IOCA 4BXXG 2YV5A 2R7ZH 1EQQA 2EXDA 1UWVA 4LF6L 2B63G 4KHPQ 1KAWA 4BY7H 2E5LL 4A3KH 5JJKA 2V1CC 3UE1A 2ES2A 2F4VQ 3D0FA 1ASYA 3HOXH 1Q1EA 1U0LA 3AYHB 4R1JA 4YHHL 2Q2TA 2Y0SE 4P71A 1JT8A 2LSSA 4POFA 1AE2A 1X54A 1O7IA 4LUZA 5IWAQ 2JA5H 2VUMG 1PVOA 3U4VA 5C4XH 1A8VA 1N33L 5IP9G 3KF6B 1C7YA 3KJOA 1JJCB
chains in the Genus database with same CATH superfamily
1EWHA 1O7YA 4DXFA 1TS3A 4IUUA 4IN3A 3T56B 4QIWB 3DMUA 3BVGA 1LABA 2ALYB 4NPSA 4R9WA 3RNUA 2EY1A 1CKMA 3T1HL 1JOOA 2A69D 1JWSD 2DNEA 1E0BA 3CRKC 1WTOA 1U5KA 4B9XA 2AUKA 4FF3A 1SEBD 2UUAQ 3CC7A 3G6EA 4HSVA 1VDZA 4LUOA 3PO3H 1FGBD 3CMAA 1WTQA 1DJRD 1XMOL 3H3VI 3WWVA 4A76A 3KBGA 2Z6KA 4DV6Q 1B50A 4JV5Q 4YCWA 1N32L 3I72A 2OQKA 5KRUA 1PTOB 4K6LA 4TQUS 2LFNA 1CT1D 3S17H 4CKCA 1EFWA 2F3WA 1HFGA 1STBA 2B2TA 3ERSX 5C4HA 4C1NK 3CCUA 2EPBA 5TSSA 1PTOD 4IO9A 4RKBA 1V9PA 5NUCA 3UE0A 4LFBL 2JSOA 3NTHA 1PRTB 1NCVA 4A3GB 2F0HA 3LWUA 4IOAA 1BQQT 2NN6H 3S2HH 1MJCA 3CRLC 1PRTD 5M3FB 1R9TB 3ITPA 2YU9B 4GOPB 1E1TA 3T13A 4A3MG 1Q46A 3GDEA 1CSQA 2KENA 2LS01 2J7ZA 3GQBA 3H6MA 1I4PA 2K5NA 1U4MA 2KJXA 1GM5A 2WAQE 1OXTA 1Y1WB 1VQPA 1TWFB 3SHLA 2R61A 4RGMA 3GTLB 2RHQB 2Q2IA 3F2UA 1LTTD 2PW7A 4CHTB 4A3IG 4GKKL 5CV4A 2ATWA 5J1ZA 1R4QB 1BKBA 1SLJA 2I0QA 4I7ZC 1EEFD 5BN3A 4DR3Q 3U58A 1RCVD 1RDPD 4U673 3NBIA 1VQEA 3EN2A 3VR4A 1BCPB 5M3FH 5C4XB 2K50A 5IGDA 5GADC 1HR0W 3STBC 1VQLA 2DJGC 2N8NA 2YU9H 3H09A 3CPFA 3PV0A 4HJAA 1G6ZA 1EZ6A 4MIUA 2JA8G 1BCPD 3PIPA 4X65L 1IL8A 4N8X1 1MD2D 2ZTEA 5CC4A 5K36H 1Y1WH 4QIWE 1TWFH 3RN2A 1KRSA 1N9WA 3IL8A 2V4DA 3GTLH 2NVQB 4IUTA 1EU3A 1O78A 2EIFA 3HRZC 2QILA 3CU7A 1SJHD 1YHQA 4X62Q 1IL2A 3G71A 2KCCA 1JICA 1WTWA 1GOZA 4DV5L 3CD6A 3A56A 5FLXE 1HZ9A 3R8BA 5M5XB 3MTSA 2EDGA 1Q8IA 1HZCA 1NSNS 2QW7A 5A35A 3NK9A 1OTCA 2BA0A 3A8IE 2HQLA 3GTKB 4DNRB 2WKCA 2KCTA 3I55A 4B9WA 4DR1Q 2F0SA 3M4QA 1AP0A 3A5UA 4KJNA 3NWSA 2K33A 4ZCKA 2R93B 1G8ZD 1JQYD 2B2WA 1B8AA 1EY6A 2NVQH 1D7QA 2H1EA 3RUZA 4CJ2C 2D62A 4C3HB 1TWHB 5JOBA 3QJYA 4DUYQ 2FMCA 2F4VL 1B53A 2EYFA 1ONLA 4RGTA 4JBMA 1QNUA 4P74A 3E0JA 5M5XH 3CCJA 1K3RA 1SYCA 4NMZA 1F2YA 2I5MX 3PIP3 1LM0A 3CXCA 1CHPD 4LJZC 4KY6A 4KY7A 4JVZA 3TDQA 5IT9L 3AEVA 2JEBI 1PH5A 3GTKH 1JB7A 4ME3A 3DEPA 3KLWA 4JG2A 3C1EA 4Q5VA 2O2LD 2VQEQ 2EJGC 2NVXB 3CAMA 3KK7A 2R93H 1PZKD 3HKZG 3OMCA 1UUPA 5C3EG 2ZJQA 1VQ8A 4RCOA 1H9SA 4J1MA 3KOJA 1HNZQ 1KDCA 4QF4A 4C3HH 1EOTA 1YHBA 4JI4Q 1UE1A 2VL6A 3QOLA 1TWHH 4QGUA 1UEBA 1X65A 4JI1L 3I56A 1WTXA 1N36L 1EYCA 1STAA 4BBSG 1HFNA 2WACA 2VUMB 4ZUIA 3TS0A 3JAMc 2KHIA 2WIIB 2J0TD 4KN4C 4P75A 5D3IB 3TS2A 5IT9E 1TY0A 1UE7A 4JBKA 4XYQA 1EEID 1GXDC 3HGBA 4A93G 5BR8L 4LF5L 2NVXH 3NELA 2B2WC 1IBLQ 3D6WA 1HR0L 1K3BC 1X3EA 2JA7G 3MHBA 4IPHA 4A3EG 4B3TL 4PMBA 2PI2E 1BOSA 2NBFA 3GTPB 4JI6L 3A0JA 1YNND 3PCOB 3I91A 1I3QH 2JA6B 1EYDA 4JBJA 2VUMH 2EYJA 3PSIA 1PA6A 1NAPA 4BS9A 2ASBA 1JORA 1S40A 1HNXQ 2NZHA 2JXMB 4LF4L 3M4PA 4YHHQ 3VA7A 3VR3A 3WOEA 4CDDC 3D8GA 4HMJA 3J7AF 1EIFA 1N33Q 1Z7TA 1GD7A 2QKIC 5CGKA 3P1HA 1UAPA 1SFOB 1CSPA 2F0IA 2L1BA 4YWMA 1X55A 2CKZB 1NJIC 3I4NG 5LL6S 3TSSA 3HEJA 1HNWL 2UXCL 3TP6A 1U4PA 4RKLA 4XIGS 3GTPH 3E9HA 2R92B 2M9VA 2K5QA 2HUGA 2JA6H 2MQHA 5G3LD 3UDXA 2NWGA 3V05A 2K52A 1TVXA 4R4TA 1K0SA 5J22A 4RWSC 2F3IA 3D6CA 4RGOS 5LL6X 4IFDJ 3T51B 4L5SA 4KMUC 1TT2A 4K2KA 2HCCA 2PNRC 5JVG3 3S9WA 5LMNW 4DKAC 3L9AX 4BY1G 5CR3A 1XWEA 1U4RA 1SFOH 3WDNA 1XNQQ 1CI3M 2C9OA 1QB5D 4WJ3M 1SMYD 4JI7Q 2F0NA 5IGEA 4B3RL 4RGNA 1VQHA 3T1YL 1WTHA 2BDOA 2Y0SB 2R92H 4ZYSA 3NBHB 4HSPA 1XX8A 1X3PA 2K5WA 3DXJC 5KNDA 2JE6I 4KLKA 1HHVA 4XT3B 3SVMA 1SYEA 2F0PA 4DV3Q 2NYZD 3JAML 4POGA 1K8OA 3TBIB 4J8QA 3AU7A 3ND8A 1O7ZA 4LF7L 5GQOA 4DV1L 3MA2B 2SNMA 2KCNA 3QB3A 3R3OA 2Q8TA 2UU9Q 4L6TB 1J5EQ 4XXEA 2NTTA 4CKEA 1BBXC 4K0KQ 3KBXA 3HOYB 1QNKA 3I4OA 3M3YB 2OTJA 4DF7A 4LF8L 5BN4A 3RZDB 1X32A 3BVZA 1NR4A 2UXBQ 4J15A 4XTCS 1BUVT 2ICEC 2RKSA 1SRUA 2FHTA 3T53B 3MVVA 4OHJA 5T1GA 4JI8Q 4RFBA 5CV7A 3OWEB 1EZ8A 3MXNB 5HY6A 1B70B 3CF5A 1IZ6A 5JEAH 4BY7B 2MGSA 1PYWD 3HOXB 1EIHA 2A68C 4EVOA 5DM73 4CJ1B 1K9MC 2ZT9C 4A3LG 4UPAA 2MNAA 2JA5B 4JYAQ 1CM9A 1H95A 2H5XA 4JI2L 3M3YH 5FKAC 4X3UA 3OPOA 4G7HC 4OO1H 3RZDH 2M2LA 2XRSD 1Y1VG 3QOJA 3K81C 1Z6HA 1S5FD 1S5ED 2SEBD 2RBMA 3J81j 3BZCA 3FRPB 5AJ3L 1KD1C 1VQFA 3NENA 4A3FB 3E9IA 4DAYA 1B2TA 3KLSA 2YV5A 3S1QB 1Y8PB 2OF1A 4BY7H 1SYGA 4C2MB 2ES2A 3D0FA 1ASYA 3HOXH 3AYHB 2Q2TA 5JJZA 2Y0SE 1JT8A 2JA5H 2EY5A 4LUZA 5IP9G 1IBMQ 1LV9A 4E6IA 2XRQD 1F9QA 2OEOA 2A5HA 2BH2A 4DU9A 3KF6A 1DD2A 2MO1A 1VQMA 5CV6A 3Q22A 4DK1A 3V96A 1KNEA 4A3FH 4H0LC 2EE1A 1EY4A 2QGQA 5CYUA 4LF9Q 3HOUG 4DR5L 3NQIA 4GS3A 3CHBD 2IX3A 4AQYL 1I94L 3S1QH 4Y52H 5KNCA 4DR7Q 4A3CG 2EYHA 3P75A 4HMIA 4HTHA 3CP0A 4DV0L 1QVFA 3NEMA 2XSCA 3H0GB 4C2MH 5C3XA 1DOKA 4F88A 5EBDA 1J9OA 3A54A 4N9PA 1TQOA 2B2YA 2PZUA 3TMEA 1XPOA 3Q24A 2E74C 3GTGB 4PV1C 3DM1A 3JAMi 3MXUA 3RLNA 4GLAC 1EFID 5J3BA 3ULJA 4QJFA 1IYUA 1JC7A 3ICEA 5BN5A 1L2FA 1SMXA 2H4OA 1LO5D 2K32A 4FF4A 2WB1G 3DHQA 3CCVA 3AB9A 3BYYB 1IBKL 4DR4Q 5EGTA 2HHHL 2L55A 4FYDA 4Y7NB 3H0GH 4HJ9A 1YJ9A 1D6EC 1LTRD 3GO5A 4O1NA 4Z9CB 5I6YA 3D3RA 2UUCL 3CC2A 2VQFQ 2KEEA 3GTGH 1SNPA 3SK5A 5FJ8G 5CV9A 4PNYA 4OELB 2ZTCA 2KHSA 1VQDA 1NMFA 3FKIB 1SSOA 3FDTA 1VQ6A 1QWYA 4HIOA 3BG3A 5IP7H 2QEJC 3GTMB 3JC66 1XJVA 1U9RA 1HTLD 4JI5Q 3LX0A 4KV6A 5IIFA 5IYBG 4HCSA 4OWWB 2F0LA 4GZYC 1ZYRD 2E75C 4Y7NH 3J7YW 3I4MG 1N34L 2B2YC 5CV5A 4IUQA 4KD3A 1LTAD 1MSGA 1RODA 4LF6Q 1J8IA 3PO2B 2R7FA 3OYYA 1OXXK 1JWMD 3K59A 5EKIA 1LLRD 1PHJA 2LKVA 2MPMA 4JI3L 2B2VA 3PO3B 1JOQA 3FKIH 1AEXA 1PDQA 1I5FA 4G4KA 4YWKA 1S5DD 4HCEA 2AQ2B 3OIQA 3BDOA 1II3A 3T1HQ 3GTMH 2KUMA 3S16B 4QCLA 3HS0C 1SE2A 1OXUA 1DOLA 5IGBA 4ZKCB 1XNRL 1CHQD 4DPGA 3ULPA 2R6GA 1SNQA 5C6AA 3NHHA 2Q8IB 3PO2H 4A3BG 1XMOQ 5I4DA 1HTPA 1NNXA 3M4YA 1N32Q 1EY8A 3J7AV 4R8IA 4A3IB 3S2HB 2X6LA 2HD3A 4DR6L 3E3XA 4XQJA 1YNJC 4K8IA 1PH1A 4C3JB 1FGUA 4K14A 3RD4A 1K8GA 4IPDA 5GAGC 3BVMA 1KC8C 3KF8A 1T5EA 5FLMG 1KXLA 2ENBA 4GNXC 2R7ZG 1Y14B 1QVGA 3S16H 1KLUD 4JPBW 4A3KG 1LT6D 2MJ8A 1V1PB 2EY6A 2PPBC 3QWNA 3AFQA 5DAUA 2G5DA 1QCBD 1F2LA 1VQBA 5DM63 2E2DC 3I7FA 3M7NA 4KJOA 2NVTB 2Z0SA 4MZ9A 5IGFA 2WAQG 2XWBB 4QMGA 1X9NA 1PXUA 4A3IH 3R2TA 1X6OA 2B2VC 4C3JH 5FO9B 3H94A 4NXML 1L1OA 4UY8C 3SR1A 4ABNA 4X66L 2BH8A 4JV5L 1GKHA 1VQCA 2FFKB 4GKKQ 1GUGA 4DUZL 2UXDQ 3OTOL 1QE6A 3TRZA 5KGUA 3HP3A 4X64L 1S5CD 2QCPX 1A3UA 5E7NA 1HQRD 1GUOA 1HCZA 2CWPA 2I07B 3A7AB 1K73C 2E2JB 1LT4D 3F1ZA 5JPMC 4HN7A 3CCLA 1ZEQX 2Z8LA 1G51A 3K7AB 2YTYA 2NVTH 4X65Q 4C3IG 4DK6C 2BA1A 1D8LA 3IFTA 1NTGA 3M9BA 3M4OB 1LYLA 3DUZA 2I46A 2VS1A 1LTBD 1CZWA 3I2ZA 4IZ8A 1DZ1A 1G2TA 2CHBD 4L8JA 2WP8J 4H02A 1STHA 2E5LQ 1VQGA 4LMQD 4DV5Q 3GD7A 1STEA 1NY4A 1GUWA 5LMUL 2IWHA 2E2JH 1RIPA 3H3VC 4FP5D 3I73A 3W3AA 1B9NA 3MXGA 5E1FA 2CQOA 1V1OA 4LFCL 3I90A 1I4GA 1XMQL 3K7AH 4EQOA 1MGSA 3N52A 1LTLA 3NSWA 3MAQA 3ERQA 1WD1A 4G57A 1OXSC 3OW2A 1HJPA 3M4OH 1L1OC 4DK0A 5D65A 4DFAA 4A3GG 4OWTB 4RHRA 1GUNA 4DAPA 1OO9B 2UUBL 2VZAA 5M3FG 2FXQA 4J6HA 1M1KC 2KBNA 3HOVG 2JN4A 3S14B 1EY0A 1B7YB 5F2DA 3EIVA 2PW5A 1C48A 2K01A 4IFDH 1XYIA 4X62L 2F0FA 1MKHA 2DY7A 5K36G 1P8LA 2ZXOA 5C0XI 1SNCA 2PQAB 3E5SA 1Y1WG 1B44D 1XPUA 2R3ZA 2ZXPA 2LXKA 5E4XA 2BE5D 5IWAL 4DV7Q 1AZPA 5CBEE 3W5OA 2JA7B 3SE0A 1MI2A 4KKUA 2JEAI 1QILA 1GHJA 1TWGB 4ZLTF 4BBSH 3SK6A 3LWEA 4GN5A 4XDXA 3F2BA 1UE5A 3LNNA 1W6JA 1ICFB 2A6ED 5C4XG 2SNSA 2NZ1D 4JI1Q 4HIMA 3S14H 1N36Q 1O80A 1YVCA 1QUQB 3F2CA 3L0OA 1QJOA 4P2CB 1SROA 5ELOA 1IXRA 1EIYB 2AQ3B 3KJPA 4DUYL 5AFWA 1B9MA 2PCFB 1EWCA 4A3JB 5I2XA 1UE6A 2IX0A 3I4LA 1I3QB 1SAPA 1JOKA 2RDFA 4OX9Q 2JA7H 3IFDA 2PQEA 3NQTA 1PZID 4LF5Q 1DCZA 1YBYA 3ZJYC 1A62A 1TWGH 1LUZA 2XGTA 4XT1B 1HR0Q 1LTID 1EWIA 1TXYA 3MFYA 4KD4A 1V43A 4B3TQ 1Q7YC 5FO7B 2PZWA 3T16A 2R7DA 1Q86C 4JI6Q 2EXZA 1FVIA 4R4IA 3EBEA 3SXHA 5C44G 1L0YB 2O5IC 4A3DG 1NBWA 1EQTA 4HJ7A 1HNZL 4B3ML 4AH6A 3ZYYX 3DEOA 1TY2A 2D0OA 3V2TA 2R93G 1VQAA 1PTOF 1PYBA 4UP7A 2CQAA 4LF4Q 4HIDA 3TP7A 4R4OA 4A3JH 4OL7A 5DEHA 3KDFB 3PUZA 3ONAB 4C3HG 3SGIA 1IKLA 3UI2A 1HZBA 4NXNL 1RKNA 4O2DA 4DV2Q 4B3SL 2OCEA 4R4QA 2UXCQ 3MXPA 5EAYA 3N6RA 1PH3A 1UNSA 4QQBX 4N9TA 4ALPA 3NTKA 4EQPA 5I6WA 3J7ZC 4BY1H 3BDLA 5ELFA 1EQQA 5HURA 4KHPQ 1KAWA 2L0CA 3W2DA 1WTPA 4JK1C 4R1JA 2CW0C 4YHHL 1SDFA 2LSSA 1M8AA 1PVOA 2VUMG 1ENAA 1A8VA 4Q0FA 3URYA 1N33L 4H44C 1C7YA 3EA6A 1BCPF 4DV4Q 1EY9A 3P20A 5KEEA 4YY3Q 4NKLA 3T1YQ 2KECA 2NN6I 3CMEA 1JMCA 1JJ2A 3GTQB 5J39A 1PH9A 1W2BA 3RMHA 1FJGL 1Q12A 1VF5C 2CH4A 1YITA 1SNDA 1B3AA 1DYQA 3KF8B 3MWYW 2RSNA 4LF7Q 2JJQA 1NMGA 2LXJA 4KHVA 1U4LA 1VMPA 2JK8A 3STBD 3FPPA 1X56A 4XYOA 2MO0A 4DV1Q 3ER0A 1EYGA 3VR2A 2WFWA 1CZGA 3TP8A 1IW7C 2NB0A 4OWXB 1K0RA 2E76C 1Y1VB 1CKOA 5C5LA 2K5DA 4PQXA 4LF8Q 1QVCA 3GTQH 2DUDA 2RCFA 5L37A 2G9DA 2J4XA 1G6PA 5C4JB 3J81c 4JI7L 1I6HB 3M7GA 2F0VA 2HDMA 4RCNA 3UDGA 1YZ6A 2IHEA 4KI0A 1PMRA 1IKMA 4JOIC 1W6KA 5DNFA 1BF4A 4IURA 5K5PA 5EPLA 2AMCB 5EQ0A 1F9SA 4LAAA 2ICIA 2L9HA 4CDFC 1TS4A 1R4PB 3MEHA 1JR0D 4EQNA 1WCMG 2EOTA 4QY7A 2BOSA 3JAME 2R92G 1VQIA 2Z1CA 2FINB 3H3VH 1EL0A 1PH7A 4FF1A 1ILQA 4YCUA 3HOZB 1Y1VH 5COYA 4OGQC 5M3MB 3PGZA 2A69C 1RL2A 2MFIA 1X3GA 3HOWB 3DWAA 2EYPA 1XXGA 5C4JH 1I6HH 2DNCA 1KHIA 3CCSA 2QF7A 2VNUD 1H9JA 1VMCA 5M9OA 4TVAB 2X69A 4JI0L 3J80c 5ISRA 2Y0SG 4QUCA 2EJFC 3BYTB 1WFQA 2KHJA 5IP9H 1ILPA 1WTVA 2HT1A 1HRJA 2B8FA 1AE3A 2ZTDA 1PTOC 2K1BA 3HOZH 3C46A 3Q0AA 1HXYD 3G7LA 3GV3A 5M3MH 1WYDA 1E3PA 3HOWH 4ULLA 5LMNQ 3K6OA 5A2QL 2MUYA 3S24A 3ND9A 4X3KA 4DNTB 5ELBA 2AHOB 3TEHB 1PRTC 5JEAG 2PI2A 3H91A 5KYIA 1HUMA 4JW0A 1KAAA 3H15A 3VR6A 5EKLA 1SE3A 4DR5Q 1A15A 3KLSX 3HOYG 2A1AA 4GOPC 4G7ZC 4AQYQ 2GVBA 1I94Q 4BBRG 1YNXA 3KFUA 2SDFA 4DV0Q 4CKBA 2BDNA 1E1OA 4K5VA 2B2UA 3SK8A 4KTAA 1F9PA 3NPPA 4RG1A 1Y8NB 3BDCA 1EIGA 3S1NH 3OHXC 1BR9A 4V190 3DWQA 4X3TA 1KQSA 5A2QE 4WFN3 2N88A 4QB4A 5CMDA 2K5HA 4BWGB 1YIJA 4BY7G 1KABA 1EY7A 3HOXG 2Z4IA 4K6DA 1SXTA 2F0QA 2GVAA 3BU2A 4EQ5A 1A3VA 1BCPC 4KN7C 2KQ3A 2PNHA 4B08A 2EZVA 2JA5G 1IBKQ 4I7AA 1EU4A 4GKJQ 5CBAE 1KLGD 5G3LF 2OWOA 2HHHQ 1VS0A 1Z9FA 1Y8OB 2N49A 5FJ8H 1H9SB 4RH6A 1RF2D 2ZM6L 2L5TA 3TQYA 2UUCQ 2B63B 3NE5B 5IYDH 1H9MA 4AYBG 2SOBA 5HGTA 1BNZA 4K2LA 1VQOA 2CVRA 3K7UC 5CORA 3TZDA 2VB2X 4O0AA 2XNAC 1C4QA 1RJTA 1TKWB 4F8MA 5D14A 4ZQ3A 2XTIA 3PUVA 4BA1I 1BVSA 3FPUB 4OXPA 4EX5A 1NR2A 1HZAA 4DR2L 1JE5A 1M4VA 3I8ZA 2A8VA 4ZKBB 3J80L 2B2UC 1ZKOA 1P16A 1ML0D 1N34Q 3PQIA 1EQRA 1S3OA 2AWOA 2CFMA 3MEFA 4GNXA 4BXXH 3NTIA 1S4ZA 5C0XG 2B63H 1GHKA 4IUPA 1BDOA 3RZOB 1D5XC 4NB3A 2BE5C 5EKKA 3OSOA 5GAEC 4TKOB 4OEMB 1PFBA 2CH4W 1CA6A 4JI3Q 2GA4B 4GN4B 4OIJA 2KOLA 1CKNA 3H0GG 1KDAA 1S72A 3G6JB 1ET6A 1F2ZA 3L7ZC 1CQFA 5JJLA 3D31A 2C35B 2K04A 1TU2B 1CQVA 5IYCG 4EGVA 5FLXc 1XNRQ 3KJOA 1XTDA 2PO4A 3GP7A 3S15B 1PYSB 4AIMA 2JP1A 2RA4A 1S5BD 3RZOH 5IP7G 4A3MB 2F0DA 5FLMH 1NUCA 4DR6Q 5ELNA 4L63B 4LFAL 1L0WA 4YWLA 4IUNA 1PFNA 2EVBA 4A4IA 4IALA 1HA6A 3A7LA 2PMZB 2RDHA 1JJGA 4PZ6A 4X6AH 1MIUA 3U4ZA 4UHVA 2HIVA 2I5HA 4LFBQ 3DLLA 4C3IB 1A2TA 2K05A 3FKIG 4C56C 3S15H 2JQOA 1OXVA 2XIWA 1HH2P 4F7XA 1TS2A 1FYCA 1YNNC 2A68D 4GN3B 4WRDA 5CV8A 4A3MH 2JA8B 3J81i 4M8AA 4LNQA 2ID0A 4X3SA 1I50B 3UDIA 1A0IA 4NXMQ 2LY7A 2XVSA 2AQ1B 1I4RA 4X66Q 1RTNA 3CCMA 3NBHA 1QZHA 1RHPA 2OQ0A 2K4KA 5E3FA 2UUAL 4DUZQ 3OTOQ 1EUJA 3OMGA 4X64Q 4FNFA 3PO2G 2N55A 5KIXA 1ZXTA 4BA2I 4ZRZA 3CCQA 1WD0A 1H9KA 3L3OC 1DONA 1VF7A 2KA7A 4DV6L 1K8AC 2IX1A 2IL8A 4C3IH 3PO3G 1T9HA 2JA9A 5JPNC 1Q1BA 5GROA 1STYA 5C0XJ 4M1UB 4OO1I 2D0PA 4L5RC 2DGYA 2JA8H 4ME5A 2AUJD 5IT9c 3TP5A 5FO8B 1WTRA 3VDYA 3A74A 1I50H 1JE4A 1N8RC 3HOVB 4DN4M 3A5ZB 4L5TA 1BBWA 1VCIA 1C9OA 1FNUA 1SJED 3Q23A 1C8CA 2K5VA 2XN9C 2RVLA 4OONA 1GUTA 5FK9C 1QZGA 1PTOH 3J80i 2RCNA 1ESRA 3HFZB 4PMWA 5LMUQ 1XTCD 1KTKA 2NN6G 1F9RA 1M90C 3HZXA 2UXDL 5GAHC 4LFCQ 4C3JG 2NUCA 1L0XB 4YCVA 1XMQQ 3MXNA 2A73B 5FLXL 1TS5A 2WINB 3PMFA 4FDBA 4HR7B 1NE3A 1SMYC 4A3GH 3PF4A 1G291 3CPWA 3FVQA 2KCMA 2F3VA 1R9TH 5JVH3 1MJEA 2OT2A 3HOVH 4DR3L 3A8JE 4H7BA 2Z6KC 3VR5A 3L2PA 3HKZB 5C3EB 2UUBQ 2PMZE 3SDZA 4DAYB 2QEXA 2K28A 2B2TC 4LUVA 3BZKA 3W1GA 4BBSB 2Z6BA 3PIOA 1Q81C 2L4NA 3X3NA 3G48A 4IOCA 1HA5A 3NP8A 3KUPA 5C4ZA 1UWVA 2EYOA 2E5LL 4ID6A 2V1CC 2F4VQ 1HQMC 1U0LA 1TWAB 3MC0B 4P71A 3S1RB 1JCKB 5IWAQ 3D4WA 1O7IA 3MZ5A 4XQQA 5C5MA 4A93B 5C4XH 4G7OC 3KF6B 1JJCB 4DXGA 1FNWA 4IUVA 2F0UA 1AN8A 5IE8A 5C44B 4DAVA 5C3EH 4A3DB 2K03A 3MFGA 3A8KE 1I4HA 3E0EA 2WV6D 1PFMA 2EYLA 1GVPA 4JCVE 4A3EB 4CGYB 3QG1A 2ZJPA 2WKDA 4XQNA 4DR1L 5M5WB 5ELEA 4KKSA 2Z9HA 4APVA 1D1IA 2B39A 2M00A 4KY5A 4KKTA 1V8QA 4HIKA 2F0KA 1TWAH 3E6ZX 1D2BA 3T4AC 2IT1A 3S1RH 2IHFA 1IYJB 2C5CA 4A93H 4DGZA 3TZUA 3QR8A 2F0TA 2CCZA 1GUSA 1AZQA 3TN2A 1WJJA 3BS1A 5JJIA 2D5DA 4IFDG 3PIO3 5C44H 3PUYA 1FL0A 1SN8A 5T1IA 2A6HD 4DV7L 4A3DH 3I4NB 2K6AA 3PF5A 4HEDA 5EPJA 1J6QA 1KRTA 5BR8Q 4ZUJA 1SYDA 3EVQA 4FXGC 4A3EH 1KL9A 2LMCB 1TR5A 4NW2A 4A75A 4RMFA 4IPCA 4B3MQ 5M5WH 3FMCA 2VQEL 2NVYB 1PV4A 4QUFA 4CDCC 1EYAA 2RF4A 1X3FA 4QL5A 2CWAA 5EBCA 3HG9A 3B6YA 2YTVA 4ILWA 2N3SA 4JI4L 2IY5B 4CJ0B 3HKZE 2ZJRA 1D5MC 1F77A 1FD7D 3CC4A 4BY1B 4NXNQ 1CK1A 4UDUC 1ASZA 1PLFA 1A3TA 4WJWA 4ZAIA 3QO2A 3I4NH 4B3SQ 1PH2A 4OX9L 1YNJD 2L12A 3K0XA 4GNXB 1F2MA 2PZTA 5KYLA 3LGJA 3C3LA 1D1KA 1PRTF 3BJUA 4PMCA 4GLVB 1B4OA 3C1FA 1HNWQ 4WORA 4PZ7A 2NVYH 4JC0A 2F0MA 3VA5A 1IBLL 2B3GA 1CKNB 1ESFA 5IODA 4I65A 3GTJB 1KNAA 3P7JA 5I9OA 3EQLC 4V0BA 1CTMA 4JOIA 1YJNA 5IY0A 2QDLA 1HNXL 1FR3A 2VY3A 1K83B 4JBWA 4A3JG 1JB3A 2F1MA 4DV2L 2B8GA 3F2DA 5IOCA 2VB3X 5JAVA 1Q82C 1FJGQ 1D5ZC 3A55A 1WCMB 3EROA 1HPCA 4B3RQ 4DA2A 1E2VA 1YHAA 2EY2A 3GTJH 1MHWC 2Q2HA 3OW7A 4TSSA 5HGQA 3EJIA 3WOFA 4KHPL 3K8AA 2P5ZX 1JWUD 2RDGA 2G9HD 3OOCA 4CDEC 3GV6A 1KDBA 2HCIA 5EPKA 3ULLA 3J7A5 2N78A 2QA4A 1VQJA 2O4XA 1SNOA 3M85A 1K83H 4PG3A 2JA6G 2F52A 3OWFA 2EJMA 3QIAA 4FF2A 4DV4L 2TSSA 1ZYRC 2QDBA 5ELCA 5ELDA 2L11A 3GTOB 1WVLA 1YI2A 3BZDB 1WCMH 4YY3L 3S2DB 1K28A 1TWCB 1V1PA 1WI5A 2MP1A 1XNQL 4HAEA 1STGA 2K7VA 1A6XA 3K5LA 1L1OB 2IJ0A 2KEDA 1IYVA 4IPGA 2O5JC 4K8JA 4MHEA 2B29A 2A74C 3CKIB 4R8NA 3K80C 4RHSA 4A3LH 2F0OA 1SR3A 4DV3L 1DOMA 4K5WA 4GOPA 4IJLA 2F0WA 4FVMA 4DK3C 1PH4A 3U50C 1LT3D 1Z47A 1XPRA 3GTOH 3X3MA 5FOBB 3S2DH 4LK1C 4JI2Q 1TWCH 4BBRB 2XWJB 1PH6A 2UU9L 5I9PA 5C3WA 1RTOA 3FEWX 1J5EL 2OXPA 1PZJD 3HOUB 3F8TA 3HKSA 4K0KL 4JI0Q 2IPKD 4WJ4A 5AJ3Q 4RA8A 1AFPA 2K75A 1MSHA 4H13C 3AMUA 3CCRA 1G91A 2UXBL 2VW9A 1I4QA 2HDLA 4IFDI 1K8MA 3SEBA 3NWTA 4N8FA 2AWNA 1YJWA 3TREA 4JI8L 2HQEA 1E2WA 1SYBA 1A63A 2RQXA 3HOYH 1VQ5A 3S1NB 1BO0A 4BBRH 3NXWA 3IKJA 3G4SA 5IGGA 3VYRA 3R93A 3HOUH 2WB1B 1E22A 2AKWB 2KVMA 2EQSA 1LTGD 3Q8DA 2MHVA 4JYAL 3OIPA 4AYBB 4A3CH 1LT5D 3FP9A 4R4CA 3R2IA 1DXMA 1SE4A 2RSOA 1ENCA 1AH9A 3AFPA 4GLXA 4MN3A 1V1QA 4FO2A 1EY5A 3RLFA 4UAIA 3S1MB 1QOHA 1GJXA 2Z4HA 2PYKA 4OO1G 1Q8KA 1IHZA 2EYMA 1MBYA 4F87A 1G2SA 1TIID 2E2HB 3PUWA 2FJ2A 1VQKA 4CBVA 4NP5A 5M5YB 5LMNL 5IGCA 3K0YA 1B3QA 1VQNA 4MTNA 1BXTA 3HOZG 1Q90A 2F0EA 1KIXA 2PQAA 3IRBA 5M3MG 4P72A 2E2IB 3HOWG 2K14A 4OIKA 2IW3A 1WOCA 2YTXA 3J81L 3K57A 5E4WC 3VYSA 5I2YA 4C1NI 1IBML 1T5XD 4LW1A 3K58A 4DNIA 4ZK9B 1CA5A 3DM3A 4RAUC 3I4MB 1SYFA 5D3DA 2ZM6Q 3RLOA 1EOVA 1I6VC 5LHY1 3S1MH 1GO3E 3I3CA 4FXKC 4HJ8A 3CQZB 4O42A 3RR5A 3RN5A 2D2CC 3C2PA 4LWCA 3NUCA 4LF9L 1STNA 1Y69U 3D4DA 3CW2C 4S3SA 1DGSA 1B1ZA 5KNBA 1VQ7A 2E2HH 1Q3LA 4KK7A 1ENFA 2NZOA 4DR7L 1QUQA 5M5YH 2YYZA 3Q6SA 4IJHA 1YEZA 4FXDA 4A3FG 3UDFA 1QG7A 3AQQA 1SE8A 3VYTA 4UP8A 1E24A 5C0XH 2TMPA 2E2IH 4DR2Q 1W3SA 3J81E 1BBUA 5IYBH 2DJFC 3I70A 4NDXA 3D4RA 1RD9D 1FNVA 1CFMA 1DM0B 1PFSA 2CW0D 3I4MH 3W1BA 1SBBB 3FHWA 2Q2UA 2X6GA 4PZ8A 4GKJL 1ET9A 3K5MA 4ODGA 1HUNA 5EJWA 4U68A 4A3BB 3CQZH 2DY8A 1A2UA 1H9RA 4MTKA 4DAMA 1EQVA 3CCEA 3U9OA 2HIXA 1LACA 1VQ9A 3DWPA 4DR4L 2ZXRA 3EFXD 5DLQE 3O13A 4L5QA 2WB1E 1O7LA 2VXWA 2A19A 2RHSB 4KHZA 5IYCH 2F0JA 1I4XA 2R7ZB 4AYBE 2Q8RE 1C0AA 2L15A 2I5LX 5IYDG 2VQFL 1AW7A 4A3KB 5JEAJ 4HJ5A 3KDFA 1ICWA 2GN5A 2DN8A 3U9SA 2A6EC 1VQ4A 2E8GA 3IAYA 1PH8A 1IW7D 4A3BH 2WAQB 4MNOA 2OTLA 4P73A 5H1SE 3J80E 1UEAB 1E7ZA 3KLRA 1LTSD 2FMMA 4LFAQ 4JI5L 1CUKA 2F4IA 3K5NA 3K5OA 2F0GA 3KYHC 4TRDA 2A6HC 4UP9A 3PUXA 4K5XA 3SK4A 4BXXG 2JYOA 2NTSA 2R7ZH 2EXDA 2B63G 4LF6L 4A3KH 1SNMA 5JJKA 3UE1A 2F03A 1Q1EA 2BCOA 4POFA 1AE2A 1E2ZA 1X54A 4YIJA 4IQZA 3U4VA 2D9UA 3S17B 1X3QA 3VYUA
chains in the Genus database with same CATH topology
1IBMQ 4DV4Q 5IE8A 2BH2A 3KF6A 4NPSA 2ALYB 5C3EH 4YY3Q 3RNUA 3T1YQ 2NN6I 3CMEA 1CKMA 3T1HL 1JJ2A 2MO1A 1JMCA 3E0EA 1VQMA 1GVPA 4JCVE 1PH9A 1W2BA 1FJGL 1Q12A 1U5KA 4A3FH 2ZJPA 1YITA 4LF9Q 2QGQA 3HOUG 4DR5L 2UUAQ 4GS3A 3H3VI 3CC7A 4DR1L 4AQYL 1I94L 3G6EA 4LUOA 3PO3H 3S1QH 3KF8B 4DR7Q 4A3CG 4Y52H 4APVA 3CMAA 4DV0L 2JJQA 1NMGA 3CP0A 1XMOL 4LF7Q 3NEMA 1QVFA 2LXJA 3STBD 2JK8A 3WWVA 4C2MH 2Z6KA 4HIKA 1X56A 4DV6Q 4A76A 4DV1Q 2MO0A 4JV5Q 3ER0A 1TWAH 4YCWA 1N32L 1EYGA 2IT1A 2WFWA 3S1RH 2OQKA 1XPOA 2IHFA 1IYJB 4TQUS 4A93H 3S17H 1EFWA 4K0KQ 4OWXB 3JAMi 2CCZA 3RLNA 3ERSX 1K0RA 4GLAC 1WJJA 3CCUA 5JJIA 4IFDG 4IO9A 4LFBL 1CKOA 5J3BA 1V9PA 1FL0A 3PUYA 1SN8A 3UE0A 3ULJA 4QJFA 5C44H 4DV7L 4A3DH 3ICEA 3PF5A 1L2FA 1J6QA 1SMXA 1QVCA 4LF8Q 1KRTA 5BR8Q 2DUDA 3GTQH 4A3EH 1KL9A 1G6PA 3J81c 4A75A 4RMFA 4JI7L 4IOAA 3UDGA 2WB1G 3CCVA 1YZ6A 2IHEA 3S2HH 4IPCA 4KI0A 1IBKL 4B3MQ 1MJCA 4JOIC 5M5WH 4DR4Q 2HHHL 2AMCB 2VQEL 1PV4A 4GOPB 2RF4A 1E1TA 3H0GH 4A3MG 1Q46A 1X3FA 3GDEA 4QL5A 1CSQA 4HJ9A 2CWAA 2KENA 1YJ9A 1WCMG 4QY7A 3B6YA 2K5NA 3GO5A 2R92G 2YTVA 2UUCL 3CC2A 1VQIA 2N3SA 2VQFQ 3GTGH 1GM5A 4JI4L 2WAQE 1OXTA 3H3VH 1VQPA 2IY5B 5FJ8G 3HKZE 2RHQB 2ZJRA 1PH7A 2Q2IA 4YCUA 3CC4A 4NXNQ 2ZTCA 1Y1VH 1ASZA 1VQDA 4A3IG 4GKKL 2ATWA 1NMFA 3PGZA 1RL2A 2MFIA 4B3SQ 1X3GA 1PH2A 4OX9L 3I4NH 1BKBA 1SLJA 2I0QA 3K0XA 4HIOA 1VQ6A 4GNXB 4DR3Q 3U58A 5C4JH 5IP7H 3LGJA 1VQEA 3BJUA 1KHIA 1I6HH 3JC66 1XJVA 3EN2A 4GLVB 3CCSA 5M3FH 4JI5Q 1HNWQ 2K50A 5IYBG 5GADC 1HR0W 4PZ7A 3STBC 1VQLA 2N8NA 2NVYH 2YU9H 2VNUD 4OWWB 3PV0A 3CPFA 4JC0A 4HJAA 4Y7NH 3I4MG 2JA8G 1IBLL 2B3GA 1N34L 1CKNB 4TVAB 4JI0L 3PIPA 3J80c 4X65L 2Y0SG 4LF6Q 2ZTEA 1WFQA 2KHJA 2R7FA 3OYYA 5IP9H 1OXXK 1Y1WH 4QIWE 1TWFH 3RN2A 1N9WA 1KRSA 2HT1A 3GTLH 1AE3A 2ZTDA 3HOZH 2EIFA 1PHJA 1YHQA 4JI3L 4X62Q 1IL2A 5M3MH 3FKIH 3G71A 4JOIA 1WYDA 1E3PA 1YJNA 5LMNQ 3HOWH 5IY0A 4DV5L 1I5FA 3CD6A 3S24A 4YWKA 1HNXL 1HZ9A 2VY3A 4JBWA 4A3JG 2AHOB 3TEHB 3T1HQ 3GTMH 4DV2L 5JEAG 2PI2A 3F2DA 1HZCA 1Q82C 1FJGQ 1OXUA 3H15A 1OTCA 2BA0A 2HQLA 4DR5Q 2KCTA 3I55A 1XNRL 3HOYG 4DR1Q 2A1AA 4DPGA 4GOPC 2R6GA 2GVBA 3M4QA 4AQYQ 3ULPA 1I94Q 3A5UA 1YHAA 4BBRG 3PO2H 1YNXA 3KFUA 4DV0Q 3GTJH 4A3BG 1XMOQ 1E1OA 2Q2HA 1B8AA 1N32Q 2NVQH 1D7QA 4RG1A 2D62A 5HGQA 4DR6L 3S1NH 1PH1A 4KHPL 1FGUA 3K8AA 1K8GA 4DUYQ 4IPDA 1KQSA 2F4VL 3ULLA 5GAGC 2N78A 2QA4A 3J7A5 1VQJA 1KC8C 5FLMG 3M85A 1KXLA 4JBMA 2K5HA 4P74A 1K83H 5M5XH 3CCJA 1K3RA 4GNXC 2R7ZG 1Y14B 2I5MX 4PG3A 1QVGA 1LM0A 2F52A 1YIJA 2JA6G 3CXCA 3S16H 4BY7G 4A3KG 3HOXG 4DV4L 3BU2A 2GVAA 4EQ5A 3AFQA 2JEBI 1YI2A 1PH5A 3AEVA 2PNHA 3GTKH 1WCMH 4YY3L 1JB7A 1IBKQ 2JA5G 4ME3A 4GKJQ 1WI5A 1VQBA 2OWOA 3KLWA 3I7FA 4JG2A 1VS0A 2HHHQ 3M7NA 1Z9FA 2VQEQ 1XNQL 2N49A 2Z0SA 3CAMA 5FJ8H 4MZ9A 2R93H 2WAQG 3HKZG 5C3EG 2ZJQA 1X9NA 1L1OB 4A3IH 1VQ8A 2ZM6L 3KOJA 1X6OA 3TQYA 1HNZQ 4IPGA 2UUCQ 4C3HH 5IYDH 1YHBA 4C3JH 4JI4Q 1UE1A 2VL6A 4AYBG 4NXML 1TWHH 2B29A 1L1OA 1UEBA 1X65A 4JI1L 4QGUA 3I56A 4UY8C 4X66L 1N36L 4BBSG 2BH8A 3K80C 4JV5L 4A3LH 1SR3A 1GKHA 1VQCA 4DV3L 1VQOA 4GKKQ 4DUZL 4GOPA 2UXDQ 4IJLA 3OTOL 3TRZA 4DK3C 3K7UC 4X64L 2KHIA 3JAMc 3TS0A 3U50C 5E7NA 1PH4A 1Z47A 1XPRA 2CWPA 4P75A 3TS2A 3GTOH 4O0AA 1K73C 1UE7A 4JBKA 3F1ZA 2XTIA 3PUVA 4BA1I 3S2DH 1BVSA 4JI2Q 3CCLA 4OXPA 1TWCH 4EX5A 4A93G 1G51A 1PH6A 1HZAA 2UU9L 5BR8L 4DR2L 2YTYA 1JE5A 1J5EL 4LF5L 2NVXH 2NVTH 3NELA 2A8VA 3F8TA 1P16A 1IBLQ 1N34Q 3HKSA 4K0KL 1EQRA 1S3OA 2AWOA 2CFMA 3MEFA 4GNXA 4X65Q 1HR0L 4DK6C 4JI0Q 4BXXH 2BA1A 4WJ4A 1D8LA 1X3EA 5C0XG 1NTGA 2B63H 3M9BA 2JA7G 4IPHA 4A3EG 4B3TL 5AJ3Q 1LYLA 2PI2E 2K75A 2VS1A 3CCRA 4NB3A 3A0JA 4JI6L 2UXBL 2VW9A 3PCOB 3I2ZA 5GAEC 4IFDI 1I3QH 4JI3Q 2WP8J 4JBJA 2VUMH 3PSIA 4GN4B 1PA6A 4H02A 2E5LQ 2AWNA 2ASBA 1VQGA 4DV5Q 1CKNA 3GD7A 1S40A 1NY4A 3H0GG 3TREA 1YJWA 4JI8L 2NZHA 1HNXQ 1S72A 4LF4L 3M4PA 5LMUL 4YHHQ 2E2JH 1RIPA 1A63A 3HOYH 1VQ5A 3L7ZC 2CQOA 4LFCL 1EIFA 4BBRH 1N33Q 5JJLA 1GD7A 3D31A 3G4SA 2C35B 1XMQL 3K7AH 1LTLA 3HOUH 5IYCG 5FLXc 1E22A 2AKWB 3Q8DA 2EQSA 1CSPA 1XNRQ 1XTDA 1OXSC 1X55A 2CKZB 4YWMA 3OW2A 1NJIC 3I4NG 4JYAL 1PYSB 4A3CH 1HJPA 3FP9A 4AIMA 1HNWL 4R4CA 2UXCL 3M4OH 1L1OC 3RZOH 4XIGS 3GTPH 5IP7G 1AH9A 3AFPA 4GLXA 4A3GG 3E9HA 4OWTB 5FLMH 1V1QA 3RLFA 2UUBL 4DR6Q 2VZAA 5ELNA 2JA6H 5M3FG 2FXQA 1M1KC 2MQHA 4LFAL 4OO1G 2KBNA 1Q8KA 3HOVG 3UDXA 1L0WA 4YWLA 2K52A 1B7YB 3EIVA 4R4TA 2F3IA 4A4IA 3PUWA 4X62L 1VQKA 4IFDJ 1MKHA 4L5SA 5K36G 5LMNL 1P8LA 5C0XI 1JJGA 2PQAB 1Y1WG 1VQNA 4PZ6A 4MTNA 1XPUA 4X6AH 1MIUA 3U4ZA 5LMNW 4DKAC 4BY1G 3HOZG 2HIVA 1KIXA 2LXKA 2I5HA 4LFBQ 2PQAA 3DLLA 3IRBA 5IWAL 4DV7Q 1SFOH 5M3MG 3FKIG 3W5OA 4P72A 3HOWG 2K14A 1XNQQ 1WOCA 2JQOA 2YTXA 1OXVA 3S15H 2JEAI 1HH2P 1IBML 4LW1A 4DNIA 4BBSH 4WJ3M 3DM3A 4GN3B 4A3MH 4JI7Q 4GN5A 3J81i 4B3RL 3F2BA 1VQHA 2ZM6Q 3T1YL 1UE5A 2R92H 3RLOA 1EOVA 4LNQA 2ID0A 3S1MH 1GO3E 3NBHB 5C4XG 3UDIA 4HJ8A 1A0IA 3RR5A 3RN5A 4NXMQ 4LWCA 1C0AA 4JI1Q 3S14H 2JE6I 4HIMA 4X66Q 3CCMA 4KLKA 1N36Q 4B3RQ 4LF9L 1YVCA 1QUQB 3F2CA 3CW2C 4DV3Q 1QZHA 1DGSA 2OQ0A 3L0OA 4POGA 2K4KA 2UUAL 1VQ7A 4DUZQ 1SROA 5ELOA 1EUJA 3OTOQ 1IXRA 2NZOA 2E2HH 1EIYB 4X64Q 4DR7L 3PO2G 1QUQA 5M5YH 3KJPA 2YYZA 4IJHA 4DUYL 4BA2I 1YEZA 3CCQA 4LF7L 5GQOA 4A3FG 3UDFA 3AQQA 1SE8A 4DV6L 4DV1L 1K8AC 4UP8A 1E24A 1UE6A 2IX0A 2IX1A 4C3IH 3PO3G 1T9HA 2UU9Q 2JA9A 4OX9Q 2JA7H 2E2IH 4DR2Q 1W3SA 1Q1BA 1BBUA 5GROA 5IYBH 5C0XJ 1J5EQ 4LF5Q 4OO1I 1YBYA 3ZJYC 2D0PA 4L5RC 1A62A 1TWGH 1PFSA 2DGYA 3I4MH 2JA8H 1LUZA 3W1BA 2XGTA 3FHWA 5IT9c 3I4OA 1HR0Q 2Q2UA 4PZ8A 4GKJL 1EWIA 1TXYA 2OTJA 1V43A 3VDYA 4LF8L 4B3TQ 3A74A 1I50H 1Q7YC 1N8RC 3CQZH 3A5ZB 2R7DA 4L5TA 3CCEA 1BBWA 1VCIA 4DAMA 1Q86C 4JI6Q 4J15A 1C9OA 2UXBQ 4XTCS 2HIXA 1FVIA 2K5VA 4R4IA 3EBEA 5C44G 4OONA 4A3DG 1NBWA 1HNZL 4HJ7A 1VQ9A 1SRUA 4B3ML 4AH6A 4DR4L 1QZGA 3J80i 2D0OA 2R93G 1VQAA 2RCNA 5DLQE 4JI8Q 4L5QA 1PYBA 2WB1E 3HFZB 4UP7A 4PMWA 4LF4Q 5LMUQ 4HIDA 2A19A 2RHSB 4KHZA 5IYCH 4R4OA 2NN6G 3MXNB 5HY6A 4A3JH 1M90C 1B70B 3KDFB 4AYBE 5GAHC 3CF5A 2L15A 3PUZA 2I5LX 1IZ6A 4LFCQ 5IYDG 2UXDL 2VQFL 3SGIA 4YCVA 5JEAJ 1XMQQ 4HJ5A 1HZBA 3KDFA 4FDBA 1NE3A 1K9MC 4A3LG 4NXNL 3PF4A 4A3GH 1G291 4UPAA 2MNAA 3CPWA 4O2DA 4JYAQ 2GN5A 2H5XA 2KCMA 4JI2L 4DV2Q 3M3YH 1H95A 1VQ4A 2E8GA 4B3SL 2OCEA 4R4QA 1PH8A 1R9TH 2UXCQ 4A3BH 1MJEA 3HOVH 4DR3L 3RZDH 3L2PA 2Z6KC 5EAYA 4MNOA 2OTLA 4P73A 5H1SE 1Y1VG 3K81C 1PH3A 1E7ZA 2UUBQ 2PMZE 4DAYB 2QEXA 4LFAQ 3J81j 4JI5L 4QQBX 3BZCA 4ALPA 5AJ3L 1CUKA 1VQFA 3NENA 1KD1C 3E9IA 4LUVA 3BZKA 3W1GA 3J7ZC 3KYHC 3PIOA 1Q81C 4BY1H 4UP9A 3PUXA 3G48A 4IOCA 4BXXG 2YV5A 2R7ZH 1EQQA 2EXDA 1UWVA 4LF6L 2B63G 4KHPQ 1KAWA 4BY7H 2E5LL 4A3KH 5JJKA 2V1CC 3UE1A 2ES2A 2F4VQ 3D0FA 1ASYA 3HOXH 1Q1EA 1U0LA 3AYHB 4R1JA 4YHHL 2Q2TA 2Y0SE 4P71A 1JT8A 2LSSA 4POFA 1AE2A 1X54A 1O7IA 4LUZA 5IWAQ 2JA5H 2VUMG 1PVOA 3U4VA 5C4XH 1A8VA 1N33L 5IP9G 3KF6B 1C7YA 3KJOA 1JJCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBM Q;  4DV4 Q;  5IE8 A;  2BH2 A;  3KF6 A;  4NPS A;  2ALY B;  5C3E H;  4YY3 Q;  3RNU A;  3T1Y Q;  2NN6 I;  3CME A;  1CKM A;  3T1H L;  1JJ2 A;  2MO1 A;  1JMC A;  3E0E A;  1VQM A;  1GVP A;  4JCV E;  1PH9 A;  1W2B A;  1FJG L;  1Q12 A;  1U5K A;  4A3F H;  2ZJP A;  1YIT A;  4LF9 Q;  2QGQ A;  3HOU G;  4DR5 L;  2UUA Q;  4GS3 A;  3H3V I;  3CC7 A;  4DR1 L;  4AQY L;  1I94 L;  3G6E A;  4LUO A;  3PO3 H;  3S1Q H;  3KF8 B;  4DR7 Q;  4A3C G;  4Y52 H;  4APV A;  3CMA A;  4DV0 L;  2JJQ A;  1NMG A;  3CP0 A;  1XMO L;  4LF7 Q;  3NEM A;  1QVF A;  2LXJ A;  3STB D;  2JK8 A;  3WWV A;  4C2M H;  2Z6K A;  4HIK A;  1X56 A;  4DV6 Q;  4A76 A;  4DV1 Q;  2MO0 A;  4JV5 Q;  3ER0 A;  1TWA H;  4YCW A;  1N32 L;  1EYG A;  2IT1 A;  2WFW A;  3S1R H;  2OQK A;  1XPO A;  2IHF A;  1IYJ B;  4TQU S;  4A93 H;  3S17 H;  1EFW A;  4K0K Q;  4OWX B;  3JAM i;  2CCZ A;  3RLN A;  3ERS X;  1K0R A;  4GLA C;  1WJJ A;  3CCU A;  5JJI A;  4IFD G;  4IO9 A;  4LFB L;  1CKO A;  5J3B A;  1V9P A;  1FL0 A;  3PUY A;  1SN8 A;  3UE0 A;  3ULJ A;  4QJF A;  5C44 H;  4DV7 L;  4A3D H;  3ICE A;  3PF5 A;  1L2F A;  1J6Q A;  1SMX A;  1QVC A;  4LF8 Q;  1KRT A;  5BR8 Q;  2DUD A;  3GTQ H;  4A3E H;  1KL9 A;  1G6P A;  3J81 c;  4A75 A;  4RMF A;  4JI7 L;  4IOA A;  3UDG A;  2WB1 G;  3CCV A;  1YZ6 A;  2IHE A;  3S2H H;  4IPC A;  4KI0 A;  1IBK L;  4B3M Q;  1MJC A;  4JOI C;  5M5W H;  4DR4 Q;  2HHH L;  2AMC B;  2VQE L;  1PV4 A;  4GOP B;  2RF4 A;  1E1T A;  3H0G H;  4A3M G;  1Q46 A;  1X3F A;  3GDE A;  4QL5 A;  1CSQ A;  4HJ9 A;  2CWA A;  2KEN A;  1YJ9 A;  1WCM G;  4QY7 A;  3B6Y A;  2K5N A;  3GO5 A;  2R92 G;  2YTV A;  2UUC L;  3CC2 A;  1VQI A;  2N3S A;  2VQF Q;  3GTG H;  1GM5 A;  4JI4 L;  2WAQ E;  1OXT A;  3H3V H;  1VQP A;  2IY5 B;  5FJ8 G;  3HKZ E;  2RHQ B;  2ZJR A;  1PH7 A;  2Q2I A;  4YCU A;  3CC4 A;  4NXN Q;  2ZTC A;  1Y1V H;  1ASZ A;  1VQD A;  4A3I G;  4GKK L;  2ATW A;  1NMF A;  3PGZ A;  1RL2 A;  2MFI A;  4B3S Q;  1X3G A;  1PH2 A;  4OX9 L;  3I4N H;  1BKB A;  1SLJ A;  2I0Q A;  3K0X A;  4HIO A;  1VQ6 A;  4GNX B;  4DR3 Q;  3U58 A;  5C4J H;  5IP7 H;  3LGJ A;  1VQE A;  3BJU A;  1KHI A;  1I6H H;  3JC6 6;  1XJV A;  3EN2 A;  4GLV B;  3CCS A;  5M3F H;  4JI5 Q;  1HNW Q;  2K50 A;  5IYB G;  5GAD C;  1HR0 W;  4PZ7 A;  3STB C;  1VQL A;  2N8N A;  2NVY H;  2YU9 H;  2VNU D;  4OWW B;  3PV0 A;  3CPF A;  4JC0 A;  4HJA A;  4Y7N H;  3I4M G;  2JA8 G;  1IBL L;  2B3G A;  1N34 L;  1CKN B;  4TVA B;  4JI0 L;  3PIP A;  3J80 c;  4X65 L;  2Y0S G;  4LF6 Q;  2ZTE A;  1WFQ A;  2KHJ A;  2R7F A;  3OYY A;  5IP9 H;  1OXX K;  1Y1W H;  4QIW E;  1TWF H;  3RN2 A;  1N9W A;  1KRS A;  2HT1 A;  3GTL H;  1AE3 A;  2ZTD A;  3HOZ H;  2EIF A;  1PHJ A;  1YHQ A;  4JI3 L;  4X62 Q;  1IL2 A;  5M3M H;  3FKI H;  3G71 A;  4JOI A;  1WYD A;  1E3P A;  1YJN A;  5LMN Q;  3HOW H;  5IY0 A;  4DV5 L;  1I5F A;  3CD6 A;  3S24 A;  4YWK A;  1HNX L;  1HZ9 A;  2VY3 A;  4JBW A;  4A3J G;  2AHO B;  3TEH B;  3T1H Q;  3GTM H;  4DV2 L;  5JEA G;  2PI2 A;  3F2D A;  1HZC A;  1Q82 C;  1FJG Q;  1OXU A;  3H15 A;  1OTC A;  2BA0 A;  2HQL A;  4DR5 Q;  2KCT A;  3I55 A;  1XNR L;  3HOY G;  4DR1 Q;  2A1A A;  4DPG A;  4GOP C;  2R6G A;  2GVB A;  3M4Q A;  4AQY Q;  3ULP A;  1I94 Q;  3A5U A;  1YHA A;  4BBR G;  3PO2 H;  1YNX A;  3KFU A;  4DV0 Q;  3GTJ H;  4A3B G;  1XMO Q;  1E1O A;  2Q2H A;  1B8A A;  1N32 Q;  2NVQ H;  1D7Q A;  4RG1 A;  2D62 A;  5HGQ A;  4DR6 L;  3S1N H;  1PH1 A;  4KHP L;  1FGU A;  3K8A A;  1K8G A;  4DUY Q;  4IPD A;  1KQS A;  2F4V L;  3ULL A;  5GAG C;  2N78 A;  2QA4 A;  3J7A 5;  1VQJ A;  1KC8 C;  5FLM G;  3M85 A;  1KXL A;  4JBM A;  2K5H A;  4P74 A;  1K83 H;  5M5X H;  3CCJ A;  1K3R A;  4GNX C;  2R7Z G;  1Y14 B;  2I5M X;  4PG3 A;  1QVG A;  1LM0 A;  2F52 A;  1YIJ A;  2JA6 G;  3CXC A;  3S16 H;  4BY7 G;  4A3K G;  3HOX G;  4DV4 L;  3BU2 A;  2GVA A;  4EQ5 A;  3AFQ A;  2JEB I;  1YI2 A;  1PH5 A;  3AEV A;  2PNH A;  3GTK H;  1WCM H;  4YY3 L;  1JB7 A;  1IBK Q;  2JA5 G;  4ME3 A;  4GKJ Q;  1WI5 A;  1VQB A;  2OWO A;  3KLW A;  3I7F A;  4JG2 A;  1VS0 A;  2HHH Q;  3M7N A;  1Z9F A;  2VQE Q;  1XNQ L;  2N49 A;  2Z0S A;  3CAM A;  5FJ8 H;  4MZ9 A;  2R93 H;  2WAQ G;  3HKZ G;  5C3E G;  2ZJQ A;  1X9N A;  1L1O B;  4A3I H;  1VQ8 A;  2ZM6 L;  3KOJ A;  1X6O A;  3TQY A;  1HNZ Q;  4IPG A;  2UUC Q;  4C3H H;  5IYD H;  1YHB A;  4C3J H;  4JI4 Q;  1UE1 A;  2VL6 A;  4AYB G;  4NXM L;  1TWH H;  2B29 A;  1L1O A;  1UEB A;  1X65 A;  4JI1 L;  4QGU A;  3I56 A;  4UY8 C;  4X66 L;  1N36 L;  4BBS G;  2BH8 A;  3K80 C;  4JV5 L;  4A3L H;  1SR3 A;  1GKH A;  1VQC A;  4DV3 L;  1VQO A;  4GKK Q;  4DUZ L;  4GOP A;  2UXD Q;  4IJL A;  3OTO L;  3TRZ A;  4DK3 C;  3K7U C;  4X64 L;  2KHI A;  3JAM c;  3TS0 A;  3U50 C;  5E7N A;  1PH4 A;  1Z47 A;  1XPR A;  2CWP A;  4P75 A;  3TS2 A;  3GTO H;  4O0A A;  1K73 C;  1UE7 A;  4JBK A;  3F1Z A;  2XTI A;  3PUV A;  4BA1 I;  3S2D H;  1BVS A;  4JI2 Q;  3CCL A;  4OXP A;  1TWC H;  4EX5 A;  4A93 G;  1G51 A;  1PH6 A;  1HZA A;  2UU9 L;  5BR8 L;  4DR2 L;  2YTY A;  1JE5 A;  1J5E L;  4LF5 L;  2NVX H;  2NVT H;  3NEL A;  2A8V A;  3F8T A;  1P16 A;  1IBL Q;  1N34 Q;  3HKS A;  4K0K L;  1EQR A;  1S3O A;  2AWO A;  2CFM A;  3MEF A;  4GNX A;  4X65 Q;  1HR0 L;  4DK6 C;  4JI0 Q;  4BXX H;  2BA1 A;  4WJ4 A;  1D8L A;  1X3E A;  5C0X G;  1NTG A;  2B63 H;  3M9B A;  2JA7 G;  4IPH A;  4A3E G;  4B3T L;  5AJ3 Q;  1LYL A;  2PI2 E;  2K75 A;  2VS1 A;  3CCR A;  4NB3 A;  3A0J A;  4JI6 L;  2UXB L;  2VW9 A;  3PCO B;  3I2Z A;  5GAE C;  4IFD I;  1I3Q H;  4JI3 Q;  2WP8 J;  4JBJ A;  2VUM H;  3PSI A;  4GN4 B;  1PA6 A;  4H02 A;  2E5L Q;  2AWN A;  2ASB A;  1VQG A;  4DV5 Q;  1CKN A;  3GD7 A;  1S40 A;  1NY4 A;  3H0G G;  3TRE A;  1YJW A;  4JI8 L;  2NZH A;  1HNX Q;  1S72 A;  4LF4 L;  3M4P A;  5LMU L;  4YHH Q;  2E2J H;  1RIP A;  1A63 A;  3HOY H;  1VQ5 A;  3L7Z C;  2CQO A;  4LFC L;  1EIF A;  4BBR H;  1N33 Q;  5JJL A;  1GD7 A;  3D31 A;  3G4S A;  2C35 B;  1XMQ L;  3K7A H;  1LTL A;  3HOU H;  5IYC G;  5FLX c;  1E22 A;  2AKW B;  3Q8D A;  2EQS A;  1CSP A;  1XNR Q;  1XTD A;  1OXS C;  1X55 A;  2CKZ B;  4YWM A;  3OW2 A;  1NJI C;  3I4N G;  4JYA L;  1PYS B;  4A3C H;  1HJP A;  3FP9 A;  4AIM A;  1HNW L;  4R4C A;  2UXC L;  3M4O H;  1L1O C;  3RZO H;  4XIG S;  3GTP H;  5IP7 G;  1AH9 A;  3AFP A;  4GLX A;  4A3G G;  3E9H A;  4OWT B;  5FLM H;  1V1Q A;  3RLF A;  2UUB L;  4DR6 Q;  2VZA A;  5ELN A;  2JA6 H;  5M3F G;  2FXQ A;  1M1K C;  2MQH A;  4LFA L;  4OO1 G;  2KBN A;  1Q8K A;  3HOV G;  3UDX A;  1L0W A;  4YWL A;  2K52 A;  1B7Y B;  3EIV A;  4R4T A;  2F3I A;  4A4I A;  3PUW A;  4X62 L;  1VQK A;  4IFD J;  1MKH A;  4L5S A;  5K36 G;  5LMN L;  1P8L A;  5C0X I;  1JJG A;  2PQA B;  1Y1W G;  1VQN A;  4PZ6 A;  4MTN A;  1XPU A;  4X6A H;  1MIU A;  3U4Z A;  5LMN W;  4DKA C;  4BY1 G;  3HOZ G;  2HIV A;  1KIX A;  2LXK A;  2I5H A;  4LFB Q;  2PQA A;  3DLL A;  3IRB A;  5IWA L;  4DV7 Q;  1SFO H;  5M3M G;  3FKI G;  3W5O A;  4P72 A;  3HOW G;  2K14 A;  1XNQ Q;  1WOC A;  2JQO A;  2YTX A;  1OXV A;  3S15 H;  2JEA I;  1HH2 P;  1IBM L;  4LW1 A;  4DNI A;  4BBS H;  4WJ3 M;  3DM3 A;  4GN3 B;  4A3M H;  4JI7 Q;  4GN5 A;  3J81 i;  4B3R L;  3F2B A;  1VQH A;  2ZM6 Q;  3T1Y L;  1UE5 A;  2R92 H;  3RLO A;  1EOV A;  4LNQ A;  2ID0 A;  3S1M H;  1GO3 E;  3NBH B;  5C4X G;  3UDI A;  4HJ8 A;  1A0I A;  3RR5 A;  3RN5 A;  4NXM Q;  4LWC A;  1C0A A;  4JI1 Q;  3S14 H;  2JE6 I;  4HIM A;  4X66 Q;  3CCM A;  4KLK A;  1N36 Q;  4B3R Q;  4LF9 L;  1YVC A;  1QUQ B;  3F2C A;  3CW2 C;  4DV3 Q;  1QZH A;  1DGS A;  2OQ0 A;  3L0O A;  4POG A;  2K4K A;  2UUA L;  1VQ7 A;  4DUZ Q;  1SRO A;  5ELO A;  1EUJ A;  3OTO Q;  1IXR A;  2NZO A;  2E2H H;  1EIY B;  4X64 Q;  4DR7 L;  3PO2 G;  1QUQ A;  5M5Y H;  3KJP A;  2YYZ A;  4IJH A;  4DUY L;  4BA2 I;  1YEZ A;  3CCQ A;  4LF7 L;  5GQO A;  4A3F G;  3UDF A;  3AQQ A;  1SE8 A;  4DV6 L;  4DV1 L;  1K8A C;  4UP8 A;  1E24 A;  1UE6 A;  2IX0 A;  2IX1 A;  4C3I H;  3PO3 G;  1T9H A;  2UU9 Q;  2JA9 A;  4OX9 Q;  2JA7 H;  2E2I H;  4DR2 Q;  1W3S A;  1Q1B A;  1BBU A;  5GRO A;  5IYB H;  5C0X J;  1J5E Q;  4LF5 Q;  4OO1 I;  1YBY A;  3ZJY C;  2D0P A;  4L5R C;  1A62 A;  1TWG H;  1PFS A;  2DGY A;  3I4M H;  2JA8 H;  1LUZ A;  3W1B A;  2XGT A;  3FHW A;  5IT9 c;  3I4O A;  1HR0 Q;  2Q2U A;  4PZ8 A;  4GKJ L;  1EWI A;  1TXY A;  2OTJ A;  1V43 A;  3VDY A;  4LF8 L;  4B3T Q;  3A74 A;  1I50 H;  1Q7Y C;  1N8R C;  3CQZ H;  3A5Z B;  2R7D A;  4L5T A;  3CCE A;  1BBW A;  1VCI A;  4DAM A;  1Q86 C;  4JI6 Q;  4J15 A;  1C9O A;  2UXB Q;  4XTC S;  2HIX A;  1FVI A;  2K5V A;  4R4I A;  3EBE A;  5C44 G;  4OON A;  4A3D G;  1NBW A;  1HNZ L;  4HJ7 A;  1VQ9 A;  1SRU A;  4B3M L;  4AH6 A;  4DR4 L;  1QZG A;  3J80 i;  2D0O A;  2R93 G;  1VQA A;  2RCN A;  5DLQ E;  4JI8 Q;  4L5Q A;  1PYB A;  2WB1 E;  3HFZ B;  4UP7 A;  4PMW A;  4LF4 Q;  5LMU Q;  4HID A;  2A19 A;  2RHS B;  4KHZ A;  5IYC H;  4R4O A;  2NN6 G;  3MXN B;  5HY6 A;  4A3J H;  1M90 C;  1B70 B;  3KDF B;  4AYB E;  5GAH C;  3CF5 A;  2L15 A;  3PUZ A;  2I5L X;  1IZ6 A;  4LFC Q;  5IYD G;  2UXD L;  2VQF L;  3SGI A;  4YCV A;  5JEA J;  1XMQ Q;  4HJ5 A;  1HZB A;  3KDF A;  4FDB A;  1NE3 A;  1K9M C;  4A3L G;  4NXN L;  3PF4 A;  4A3G H;  1G29 1;  4UPA A;  2MNA A;  3CPW A;  4O2D A;  4JYA Q;  2GN5 A;  2H5X A;  2KCM A;  4JI2 L;  4DV2 Q;  3M3Y H;  1H95 A;  1VQ4 A;  2E8G A;  4B3S L;  2OCE A;  4R4Q A;  1PH8 A;  1R9T H;  2UXC Q;  4A3B H;  1MJE A;  3HOV H;  4DR3 L;  3RZD H;  3L2P A;  2Z6K C;  5EAY A;  4MNO A;  2OTL A;  4P73 A;  5H1S E;  1Y1V G;  3K81 C;  1PH3 A;  1E7Z A;  2UUB Q;  2PMZ E;  4DAY B;  2QEX A;  4LFA Q;  3J81 j;  4JI5 L;  4QQB X;  3BZC A;  4ALP A;  5AJ3 L;  1CUK A;  1VQF A;  3NEN A;  1KD1 C;  3E9I A;  4LUV A;  3BZK A;  3W1G A;  3J7Z C;  3KYH C;  3PIO A;  1Q81 C;  4BY1 H;  4UP9 A;  3PUX A;  3G48 A;  4IOC A;  4BXX G;  2YV5 A;  2R7Z H;  1EQQ A;  2EXD A;  1UWV A;  4LF6 L;  2B63 G;  4KHP Q;  1KAW A;  4BY7 H;  2E5L L;  4A3K H;  5JJK A;  2V1C C;  3UE1 A;  2ES2 A;  2F4V Q;  3D0F A;  1ASY A;  3HOX H;  1Q1E A;  1U0L A;  3AYH B;  4R1J A;  4YHH L;  2Q2T A;  2Y0S E;  4P71 A;  1JT8 A;  2LSS A;  4POF A;  1AE2 A;  1X54 A;  1O7I A;  4LUZ A;  5IWA Q;  2JA5 H;  2VUM G;  1PVO A;  3U4V A;  5C4X H;  1A8V A;  1N33 L;  5IP9 G;  3KF6 B;  1C7Y A;  3KJO A;  1JJC B; 
#chains in the Genus database with same CATH topology
 1EWH A;  1O7Y A;  4DXF A;  1TS3 A;  4IUU A;  4IN3 A;  3T56 B;  4QIW B;  3DMU A;  3BVG A;  1LAB A;  2ALY B;  4NPS A;  4R9W A;  3RNU A;  2EY1 A;  1CKM A;  3T1H L;  1JOO A;  2A69 D;  1JWS D;  2DNE A;  1E0B A;  3CRK C;  1WTO A;  1U5K A;  4B9X A;  2AUK A;  4FF3 A;  1SEB D;  2UUA Q;  3CC7 A;  3G6E A;  4HSV A;  1VDZ A;  4LUO A;  3PO3 H;  1FGB D;  3CMA A;  1WTQ A;  1DJR D;  1XMO L;  3H3V I;  3WWV A;  4A76 A;  3KBG A;  2Z6K A;  4DV6 Q;  1B50 A;  4JV5 Q;  4YCW A;  1N32 L;  3I72 A;  2OQK A;  5KRU A;  1PTO B;  4K6L A;  4TQU S;  2LFN A;  1CT1 D;  3S17 H;  4CKC A;  1EFW A;  2F3W A;  1HFG A;  1STB A;  2B2T A;  3ERS X;  5C4H A;  4C1N K;  3CCU A;  2EPB A;  5TSS A;  1PTO D;  4IO9 A;  4RKB A;  1V9P A;  5NUC A;  3UE0 A;  4LFB L;  2JSO A;  3NTH A;  1PRT B;  1NCV A;  4A3G B;  2F0H A;  3LWU A;  4IOA A;  1BQQ T;  2NN6 H;  3S2H H;  1MJC A;  3CRL C;  1PRT D;  5M3F B;  1R9T B;  3ITP A;  2YU9 B;  4GOP B;  1E1T A;  3T13 A;  4A3M G;  1Q46 A;  3GDE A;  1CSQ A;  2KEN A;  2LS0 1;  2J7Z A;  3GQB A;  3H6M A;  1I4P A;  2K5N A;  1U4M A;  2KJX A;  1GM5 A;  2WAQ E;  1OXT A;  1Y1W B;  1VQP A;  1TWF B;  3SHL A;  2R61 A;  4RGM A;  3GTL B;  2RHQ B;  2Q2I A;  3F2U A;  1LTT D;  2PW7 A;  4CHT B;  4A3I G;  4GKK L;  5CV4 A;  2ATW A;  5J1Z A;  1R4Q B;  1BKB A;  1SLJ A;  2I0Q A;  4I7Z C;  1EEF D;  5BN3 A;  4DR3 Q;  3U58 A;  1RCV D;  1RDP D;  4U67 3;  3NBI A;  1VQE A;  3EN2 A;  3VR4 A;  1BCP B;  5M3F H;  5C4X B;  2K50 A;  5IGD A;  5GAD C;  1HR0 W;  3STB C;  1VQL A;  2DJG C;  2N8N A;  2YU9 H;  3H09 A;  3CPF A;  3PV0 A;  4HJA A;  1G6Z A;  1EZ6 A;  4MIU A;  2JA8 G;  1BCP D;  3PIP A;  4X65 L;  1IL8 A;  4N8X 1;  1MD2 D;  2ZTE A;  5CC4 A;  5K36 H;  1Y1W H;  4QIW E;  1TWF H;  3RN2 A;  1KRS A;  1N9W A;  3IL8 A;  2V4D A;  3GTL H;  2NVQ B;  4IUT A;  1EU3 A;  1O78 A;  2EIF A;  3HRZ C;  2QIL A;  3CU7 A;  1SJH D;  1YHQ A;  4X62 Q;  1IL2 A;  3G71 A;  2KCC A;  1JIC A;  1WTW A;  1GOZ A;  4DV5 L;  3CD6 A;  3A56 A;  5FLX E;  1HZ9 A;  3R8B A;  5M5X B;  3MTS A;  2EDG A;  1Q8I A;  1HZC A;  1NSN S;  2QW7 A;  5A35 A;  3NK9 A;  1OTC A;  2BA0 A;  3A8I E;  2HQL A;  3GTK B;  4DNR B;  2WKC A;  2KCT A;  3I55 A;  4B9W A;  4DR1 Q;  2F0S A;  3M4Q A;  1AP0 A;  3A5U A;  4KJN A;  3NWS A;  2K33 A;  4ZCK A;  2R93 B;  1G8Z D;  1JQY D;  2B2W A;  1B8A A;  1EY6 A;  2NVQ H;  1D7Q A;  2H1E A;  3RUZ A;  4CJ2 C;  2D62 A;  4C3H B;  1TWH B;  5JOB A;  3QJY A;  4DUY Q;  2FMC A;  2F4V L;  1B53 A;  2EYF A;  1ONL A;  4RGT A;  4JBM A;  1QNU A;  4P74 A;  3E0J A;  5M5X H;  3CCJ A;  1K3R A;  1SYC A;  4NMZ A;  1F2Y A;  2I5M X;  3PIP 3;  1LM0 A;  3CXC A;  1CHP D;  4LJZ C;  4KY6 A;  4KY7 A;  4JVZ A;  3TDQ A;  5IT9 L;  3AEV A;  2JEB I;  1PH5 A;  3GTK H;  1JB7 A;  4ME3 A;  3DEP A;  3KLW A;  4JG2 A;  3C1E A;  4Q5V A;  2O2L D;  2VQE Q;  2EJG C;  2NVX B;  3CAM A;  3KK7 A;  2R93 H;  1PZK D;  3HKZ G;  3OMC A;  1UUP A;  5C3E G;  2ZJQ A;  1VQ8 A;  4RCO A;  1H9S A;  4J1M A;  3KOJ A;  1HNZ Q;  1KDC A;  4QF4 A;  4C3H H;  1EOT A;  1YHB A;  4JI4 Q;  1UE1 A;  2VL6 A;  3QOL A;  1TWH H;  4QGU A;  1UEB A;  1X65 A;  4JI1 L;  3I56 A;  1WTX A;  1N36 L;  1EYC A;  1STA A;  4BBS G;  1HFN A;  2WAC A;  2VUM B;  4ZUI A;  3TS0 A;  3JAM c;  2KHI A;  2WII B;  2J0T D;  4KN4 C;  4P75 A;  5D3I B;  3TS2 A;  5IT9 E;  1TY0 A;  1UE7 A;  4JBK A;  4XYQ A;  1EEI D;  1GXD C;  3HGB A;  4A93 G;  5BR8 L;  4LF5 L;  2NVX H;  3NEL A;  2B2W C;  1IBL Q;  3D6W A;  1HR0 L;  1K3B C;  1X3E A;  2JA7 G;  3MHB A;  4IPH A;  4A3E G;  4B3T L;  4PMB A;  2PI2 E;  1BOS A;  2NBF A;  3GTP B;  4JI6 L;  3A0J A;  1YNN D;  3PCO B;  3I91 A;  1I3Q H;  2JA6 B;  1EYD A;  4JBJ A;  2VUM H;  2EYJ A;  3PSI A;  1PA6 A;  1NAP A;  4BS9 A;  2ASB A;  1JOR A;  1S40 A;  1HNX Q;  2NZH A;  2JXM B;  4LF4 L;  3M4P A;  4YHH Q;  3VA7 A;  3VR3 A;  3WOE A;  4CDD C;  3D8G A;  4HMJ A;  3J7A F;  1EIF A;  1N33 Q;  1Z7T A;  1GD7 A;  2QKI C;  5CGK A;  3P1H A;  1UAP A;  1SFO B;  1CSP A;  2F0I A;  2L1B A;  4YWM A;  1X55 A;  2CKZ B;  1NJI C;  3I4N G;  5LL6 S;  3TSS A;  3HEJ A;  1HNW L;  2UXC L;  3TP6 A;  1U4P A;  4RKL A;  4XIG S;  3GTP H;  3E9H A;  2R92 B;  2M9V A;  2K5Q A;  2HUG A;  2JA6 H;  2MQH A;  5G3L D;  3UDX A;  2NWG A;  3V05 A;  2K52 A;  1TVX A;  4R4T A;  1K0S A;  5J22 A;  4RWS C;  2F3I A;  3D6C A;  4RGO S;  5LL6 X;  4IFD J;  3T51 B;  4L5S A;  4KMU C;  1TT2 A;  4K2K A;  2HCC A;  2PNR C;  5JVG 3;  3S9W A;  5LMN W;  4DKA C;  3L9A X;  4BY1 G;  5CR3 A;  1XWE A;  1U4R A;  1SFO H;  3WDN A;  1XNQ Q;  1CI3 M;  2C9O A;  1QB5 D;  4WJ3 M;  1SMY D;  4JI7 Q;  2F0N A;  5IGE A;  4B3R L;  4RGN A;  1VQH A;  3T1Y L;  1WTH A;  2BDO A;  2Y0S B;  2R92 H;  4ZYS A;  3NBH B;  4HSP A;  1XX8 A;  1X3P A;  2K5W A;  3DXJ C;  5KND A;  2JE6 I;  4KLK A;  1HHV A;  4XT3 B;  3SVM A;  1SYE A;  2F0P A;  4DV3 Q;  2NYZ D;  3JAM L;  4POG A;  1K8O A;  3TBI B;  4J8Q A;  3AU7 A;  3ND8 A;  1O7Z A;  4LF7 L;  5GQO A;  4DV1 L;  3MA2 B;  2SNM A;  2KCN A;  3QB3 A;  3R3O A;  2Q8T A;  2UU9 Q;  4L6T B;  1J5E Q;  4XXE A;  2NTT A;  4CKE A;  1BBX C;  4K0K Q;  3KBX A;  3HOY B;  1QNK A;  3I4O A;  3M3Y B;  2OTJ A;  4DF7 A;  4LF8 L;  5BN4 A;  3RZD B;  1X32 A;  3BVZ A;  1NR4 A;  2UXB Q;  4J15 A;  4XTC S;  1BUV T;  2ICE C;  2RKS A;  1SRU A;  2FHT A;  3T53 B;  3MVV A;  4OHJ A;  5T1G A;  4JI8 Q;  4RFB A;  5CV7 A;  3OWE B;  1EZ8 A;  3MXN B;  5HY6 A;  1B70 B;  3CF5 A;  1IZ6 A;  5JEA H;  4BY7 B;  2MGS A;  1PYW D;  3HOX B;  1EIH A;  2A68 C;  4EVO A;  5DM7 3;  4CJ1 B;  1K9M C;  2ZT9 C;  4A3L G;  4UPA A;  2MNA A;  2JA5 B;  4JYA Q;  1CM9 A;  1H95 A;  2H5X A;  4JI2 L;  3M3Y H;  5FKA C;  4X3U A;  3OPO A;  4G7H C;  4OO1 H;  3RZD H;  2M2L A;  2XRS D;  1Y1V G;  3QOJ A;  3K81 C;  1Z6H A;  1S5F D;  1S5E D;  2SEB D;  2RBM A;  3J81 j;  3BZC A;  3FRP B;  5AJ3 L;  1KD1 C;  1VQF A;  3NEN A;  4A3F B;  3E9I A;  4DAY A;  1B2T A;  3KLS A;  2YV5 A;  3S1Q B;  1Y8P B;  2OF1 A;  4BY7 H;  1SYG A;  4C2M B;  2ES2 A;  3D0F A;  1ASY A;  3HOX H;  3AYH B;  2Q2T A;  5JJZ A;  2Y0S E;  1JT8 A;  2JA5 H;  2EY5 A;  4LUZ A;  5IP9 G;  1IBM Q;  1LV9 A;  4E6I A;  2XRQ D;  1F9Q A;  2OEO A;  2A5H A;  2BH2 A;  4DU9 A;  3KF6 A;  1DD2 A;  2MO1 A;  1VQM A;  5CV6 A;  3Q22 A;  4DK1 A;  3V96 A;  1KNE A;  4A3F H;  4H0L C;  2EE1 A;  1EY4 A;  2QGQ A;  5CYU A;  4LF9 Q;  3HOU G;  4DR5 L;  3NQI A;  4GS3 A;  3CHB D;  2IX3 A;  4AQY L;  1I94 L;  3S1Q H;  4Y52 H;  5KNC A;  4DR7 Q;  4A3C G;  2EYH A;  3P75 A;  4HMI A;  4HTH A;  3CP0 A;  4DV0 L;  1QVF A;  3NEM A;  2XSC A;  3H0G B;  4C2M H;  5C3X A;  1DOK A;  4F88 A;  5EBD A;  1J9O A;  3A54 A;  4N9P A;  1TQO A;  2B2Y A;  2PZU A;  3TME A;  1XPO A;  3Q24 A;  2E74 C;  3GTG B;  4PV1 C;  3DM1 A;  3JAM i;  3MXU A;  3RLN A;  4GLA C;  1EFI D;  5J3B A;  3ULJ A;  4QJF A;  1IYU A;  1JC7 A;  3ICE A;  5BN5 A;  1L2F A;  1SMX A;  2H4O A;  1LO5 D;  2K32 A;  4FF4 A;  2WB1 G;  3DHQ A;  3CCV A;  3AB9 A;  3BYY B;  1IBK L;  4DR4 Q;  5EGT A;  2HHH L;  2L55 A;  4FYD A;  4Y7N B;  3H0G H;  4HJ9 A;  1YJ9 A;  1D6E C;  1LTR D;  3GO5 A;  4O1N A;  4Z9C B;  5I6Y A;  3D3R A;  2UUC L;  3CC2 A;  2VQF Q;  2KEE A;  3GTG H;  1SNP A;  3SK5 A;  5FJ8 G;  5CV9 A;  4PNY A;  4OEL B;  2ZTC A;  2KHS A;  1VQD A;  1NMF A;  3FKI B;  1SSO A;  3FDT A;  1VQ6 A;  1QWY A;  4HIO A;  3BG3 A;  5IP7 H;  2QEJ C;  3GTM B;  3JC6 6;  1XJV A;  1U9R A;  1HTL D;  4JI5 Q;  3LX0 A;  4KV6 A;  5IIF A;  5IYB G;  4HCS A;  4OWW B;  2F0L A;  4GZY C;  1ZYR D;  2E75 C;  4Y7N H;  3J7Y W;  3I4M G;  1N34 L;  2B2Y C;  5CV5 A;  4IUQ A;  4KD3 A;  1LTA D;  1MSG A;  1ROD A;  4LF6 Q;  1J8I A;  3PO2 B;  2R7F A;  3OYY A;  1OXX K;  1JWM D;  3K59 A;  5EKI A;  1LLR D;  1PHJ A;  2LKV A;  2MPM A;  4JI3 L;  2B2V A;  3PO3 B;  1JOQ A;  3FKI H;  1AEX A;  1PDQ A;  1I5F A;  4G4K A;  4YWK A;  1S5D D;  4HCE A;  2AQ2 B;  3OIQ A;  3BDO A;  1II3 A;  3T1H Q;  3GTM H;  2KUM A;  3S16 B;  4QCL A;  3HS0 C;  1SE2 A;  1OXU A;  1DOL A;  5IGB A;  4ZKC B;  1XNR L;  1CHQ D;  4DPG A;  3ULP A;  2R6G A;  1SNQ A;  5C6A A;  3NHH A;  2Q8I B;  3PO2 H;  4A3B G;  1XMO Q;  5I4D A;  1HTP A;  1NNX A;  3M4Y A;  1N32 Q;  1EY8 A;  3J7A V;  4R8I A;  4A3I B;  3S2H B;  2X6L A;  2HD3 A;  4DR6 L;  3E3X A;  4XQJ A;  1YNJ C;  4K8I A;  1PH1 A;  4C3J B;  1FGU A;  4K14 A;  3RD4 A;  1K8G A;  4IPD A;  5GAG C;  3BVM A;  1KC8 C;  3KF8 A;  1T5E A;  5FLM G;  1KXL A;  2ENB A;  4GNX C;  2R7Z G;  1Y14 B;  1QVG A;  3S16 H;  1KLU D;  4JPB W;  4A3K G;  1LT6 D;  2MJ8 A;  1V1P B;  2EY6 A;  2PPB C;  3QWN A;  3AFQ A;  5DAU A;  2G5D A;  1QCB D;  1F2L A;  1VQB A;  5DM6 3;  2E2D C;  3I7F A;  3M7N A;  4KJO A;  2NVT B;  2Z0S A;  4MZ9 A;  5IGF A;  2WAQ G;  2XWB B;  4QMG A;  1X9N A;  1PXU A;  4A3I H;  3R2T A;  1X6O A;  2B2V C;  4C3J H;  5FO9 B;  3H94 A;  4NXM L;  1L1O A;  4UY8 C;  3SR1 A;  4ABN A;  4X66 L;  2BH8 A;  4JV5 L;  1GKH A;  1VQC A;  2FFK B;  4GKK Q;  1GUG A;  4DUZ L;  2UXD Q;  3OTO L;  1QE6 A;  3TRZ A;  5KGU A;  3HP3 A;  4X64 L;  1S5C D;  2QCP X;  1A3U A;  5E7N A;  1HQR D;  1GUO A;  1HCZ A;  2CWP A;  2I07 B;  3A7A B;  1K73 C;  2E2J B;  1LT4 D;  3F1Z A;  5JPM C;  4HN7 A;  3CCL A;  1ZEQ X;  2Z8L A;  1G51 A;  3K7A B;  2YTY A;  2NVT H;  4X65 Q;  4C3I G;  4DK6 C;  2BA1 A;  1D8L A;  3IFT A;  1NTG A;  3M9B A;  3M4O B;  1LYL A;  3DUZ A;  2I46 A;  2VS1 A;  1LTB D;  1CZW A;  3I2Z A;  4IZ8 A;  1DZ1 A;  1G2T A;  2CHB D;  4L8J A;  2WP8 J;  4H02 A;  1STH A;  2E5L Q;  1VQG A;  4LMQ D;  4DV5 Q;  3GD7 A;  1STE A;  1NY4 A;  1GUW A;  5LMU L;  2IWH A;  2E2J H;  1RIP A;  3H3V C;  4FP5 D;  3I73 A;  3W3A A;  1B9N A;  3MXG A;  5E1F A;  2CQO A;  1V1O A;  4LFC L;  3I90 A;  1I4G A;  1XMQ L;  3K7A H;  4EQO A;  1MGS A;  3N52 A;  1LTL A;  3NSW A;  3MAQ A;  3ERQ A;  1WD1 A;  4G57 A;  1OXS C;  3OW2 A;  1HJP A;  3M4O H;  1L1O C;  4DK0 A;  5D65 A;  4DFA A;  4A3G G;  4OWT B;  4RHR A;  1GUN A;  4DAP A;  1OO9 B;  2UUB L;  2VZA A;  5M3F G;  2FXQ A;  4J6H A;  1M1K C;  2KBN A;  3HOV G;  2JN4 A;  3S14 B;  1EY0 A;  1B7Y B;  5F2D A;  3EIV A;  2PW5 A;  1C48 A;  2K01 A;  4IFD H;  1XYI A;  4X62 L;  2F0F A;  1MKH A;  2DY7 A;  5K36 G;  1P8L A;  2ZXO A;  5C0X I;  1SNC A;  2PQA B;  3E5S A;  1Y1W G;  1B44 D;  1XPU A;  2R3Z A;  2ZXP A;  2LXK A;  5E4X A;  2BE5 D;  5IWA L;  4DV7 Q;  1AZP A;  5CBE E;  3W5O A;  2JA7 B;  3SE0 A;  1MI2 A;  4KKU A;  2JEA I;  1QIL A;  1GHJ A;  1TWG B;  4ZLT F;  4BBS H;  3SK6 A;  3LWE A;  4GN5 A;  4XDX A;  3F2B A;  1UE5 A;  3LNN A;  1W6J A;  1ICF B;  2A6E D;  5C4X G;  2SNS A;  2NZ1 D;  4JI1 Q;  4HIM A;  3S14 H;  1N36 Q;  1O80 A;  1YVC A;  1QUQ B;  3F2C A;  3L0O A;  1QJO A;  4P2C B;  1SRO A;  5ELO A;  1IXR A;  1EIY B;  2AQ3 B;  3KJP A;  4DUY L;  5AFW A;  1B9M A;  2PCF B;  1EWC A;  4A3J B;  5I2X A;  1UE6 A;  2IX0 A;  3I4L A;  1I3Q B;  1SAP A;  1JOK A;  2RDF A;  4OX9 Q;  2JA7 H;  3IFD A;  2PQE A;  3NQT A;  1PZI D;  4LF5 Q;  1DCZ A;  1YBY A;  3ZJY C;  1A62 A;  1TWG H;  1LUZ A;  2XGT A;  4XT1 B;  1HR0 Q;  1LTI D;  1EWI A;  1TXY A;  3MFY A;  4KD4 A;  1V43 A;  4B3T Q;  1Q7Y C;  5FO7 B;  2PZW A;  3T16 A;  2R7D A;  1Q86 C;  4JI6 Q;  2EXZ A;  1FVI A;  4R4I A;  3EBE A;  3SXH A;  5C44 G;  1L0Y B;  2O5I C;  4A3D G;  1NBW A;  1EQT A;  4HJ7 A;  1HNZ L;  4B3M L;  4AH6 A;  3ZYY X;  3DEO A;  1TY2 A;  2D0O A;  3V2T A;  2R93 G;  1VQA A;  1PTO F;  1PYB A;  4UP7 A;  2CQA A;  4LF4 Q;  4HID A;  3TP7 A;  4R4O A;  4A3J H;  4OL7 A;  5DEH A;  3KDF B;  3PUZ A;  3ONA B;  4C3H G;  3SGI A;  1IKL A;  3UI2 A;  1HZB A;  4NXN L;  1RKN A;  4O2D A;  4DV2 Q;  4B3S L;  2OCE A;  4R4Q A;  2UXC Q;  3MXP A;  5EAY A;  3N6R A;  1PH3 A;  1UNS A;  4QQB X;  4N9T A;  4ALP A;  3NTK A;  4EQP A;  5I6W A;  3J7Z C;  4BY1 H;  3BDL A;  5ELF A;  1EQQ A;  5HUR A;  4KHP Q;  1KAW A;  2L0C A;  3W2D A;  1WTP A;  4JK1 C;  4R1J A;  2CW0 C;  4YHH L;  1SDF A;  2LSS A;  1M8A A;  1PVO A;  2VUM G;  1ENA A;  1A8V A;  4Q0F A;  3URY A;  1N33 L;  4H44 C;  1C7Y A;  3EA6 A;  1BCP F;  4DV4 Q;  1EY9 A;  3P20 A;  5KEE A;  4YY3 Q;  4NKL A;  3T1Y Q;  2KEC A;  2NN6 I;  3CME A;  1JMC A;  1JJ2 A;  3GTQ B;  5J39 A;  1PH9 A;  1W2B A;  3RMH A;  1FJG L;  1Q12 A;  1VF5 C;  2CH4 A;  1YIT A;  1SND A;  1B3A A;  1DYQ A;  3KF8 B;  3MWY W;  2RSN A;  4LF7 Q;  2JJQ A;  1NMG A;  2LXJ A;  4KHV A;  1U4L A;  1VMP A;  2JK8 A;  3STB D;  3FPP A;  1X56 A;  4XYO A;  2MO0 A;  4DV1 Q;  3ER0 A;  1EYG A;  3VR2 A;  2WFW A;  1CZG A;  3TP8 A;  1IW7 C;  2NB0 A;  4OWX B;  1K0R A;  2E76 C;  1Y1V B;  1CKO A;  5C5L A;  2K5D A;  4PQX A;  4LF8 Q;  1QVC A;  3GTQ H;  2DUD A;  2RCF A;  5L37 A;  2G9D A;  2J4X A;  1G6P A;  5C4J B;  3J81 c;  4JI7 L;  1I6H B;  3M7G A;  2F0V A;  2HDM A;  4RCN A;  3UDG A;  1YZ6 A;  2IHE A;  4KI0 A;  1PMR A;  1IKM A;  4JOI C;  1W6K A;  5DNF A;  1BF4 A;  4IUR A;  5K5P A;  5EPL A;  2AMC B;  5EQ0 A;  1F9S A;  4LAA A;  2ICI A;  2L9H A;  4CDF C;  1TS4 A;  1R4P B;  3MEH A;  1JR0 D;  4EQN A;  1WCM G;  2EOT A;  4QY7 A;  2BOS A;  3JAM E;  2R92 G;  1VQI A;  2Z1C A;  2FIN B;  3H3V H;  1EL0 A;  1PH7 A;  4FF1 A;  1ILQ A;  4YCU A;  3HOZ B;  1Y1V H;  5COY A;  4OGQ C;  5M3M B;  3PGZ A;  2A69 C;  1RL2 A;  2MFI A;  1X3G A;  3HOW B;  3DWA A;  2EYP A;  1XXG A;  5C4J H;  1I6H H;  2DNC A;  1KHI A;  3CCS A;  2QF7 A;  2VNU D;  1H9J A;  1VMC A;  5M9O A;  4TVA B;  2X69 A;  4JI0 L;  3J80 c;  5ISR A;  2Y0S G;  4QUC A;  2EJF C;  3BYT B;  1WFQ A;  2KHJ A;  5IP9 H;  1ILP A;  1WTV A;  2HT1 A;  1HRJ A;  2B8F A;  1AE3 A;  2ZTD A;  1PTO C;  2K1B A;  3HOZ H;  3C46 A;  3Q0A A;  1HXY D;  3G7L A;  3GV3 A;  5M3M H;  1WYD A;  1E3P A;  3HOW H;  4ULL A;  5LMN Q;  3K6O A;  5A2Q L;  2MUY A;  3S24 A;  3ND9 A;  4X3K A;  4DNT B;  5ELB A;  2AHO B;  3TEH B;  1PRT C;  5JEA G;  2PI2 A;  3H91 A;  5KYI A;  1HUM A;  4JW0 A;  1KAA A;  3H15 A;  3VR6 A;  5EKL A;  1SE3 A;  4DR5 Q;  1A15 A;  3KLS X;  3HOY G;  2A1A A;  4GOP C;  4G7Z C;  4AQY Q;  2GVB A;  1I94 Q;  4BBR G;  1YNX A;  3KFU A;  2SDF A;  4DV0 Q;  4CKB A;  2BDN A;  1E1O A;  4K5V A;  2B2U A;  3SK8 A;  4KTA A;  1F9P A;  3NPP A;  4RG1 A;  1Y8N B;  3BDC A;  1EIG A;  3S1N H;  3OHX C;  1BR9 A;  4V19 0;  3DWQ A;  4X3T A;  1KQS A;  5A2Q E;  4WFN 3;  2N88 A;  4QB4 A;  5CMD A;  2K5H A;  4BWG B;  1YIJ A;  4BY7 G;  1KAB A;  1EY7 A;  3HOX G;  2Z4I A;  4K6D A;  1SXT A;  2F0Q A;  2GVA A;  3BU2 A;  4EQ5 A;  1A3V A;  1BCP C;  4KN7 C;  2KQ3 A;  2PNH A;  4B08 A;  2EZV A;  2JA5 G;  1IBK Q;  4I7A A;  1EU4 A;  4GKJ Q;  5CBA E;  1KLG D;  5G3L F;  2OWO A;  2HHH Q;  1VS0 A;  1Z9F A;  1Y8O B;  2N49 A;  5FJ8 H;  1H9S B;  4RH6 A;  1RF2 D;  2ZM6 L;  2L5T A;  3TQY A;  2UUC Q;  2B63 B;  3NE5 B;  5IYD H;  1H9M A;  4AYB G;  2SOB A;  5HGT A;  1BNZ A;  4K2L A;  1VQO A;  2CVR A;  3K7U C;  5COR A;  3TZD A;  2VB2 X;  4O0A A;  2XNA C;  1C4Q A;  1RJT A;  1TKW B;  4F8M A;  5D14 A;  4ZQ3 A;  2XTI A;  3PUV A;  4BA1 I;  1BVS A;  3FPU B;  4OXP A;  4EX5 A;  1NR2 A;  1HZA A;  4DR2 L;  1JE5 A;  1M4V A;  3I8Z A;  2A8V A;  4ZKB B;  3J80 L;  2B2U C;  1ZKO A;  1P16 A;  1ML0 D;  1N34 Q;  3PQI A;  1EQR A;  1S3O A;  2AWO A;  2CFM A;  3MEF A;  4GNX A;  4BXX H;  3NTI A;  1S4Z A;  5C0X G;  2B63 H;  1GHK A;  4IUP A;  1BDO A;  3RZO B;  1D5X C;  4NB3 A;  2BE5 C;  5EKK A;  3OSO A;  5GAE C;  4TKO B;  4OEM B;  1PFB A;  2CH4 W;  1CA6 A;  4JI3 Q;  2GA4 B;  4GN4 B;  4OIJ A;  2KOL A;  1CKN A;  3H0G G;  1KDA A;  1S72 A;  3G6J B;  1ET6 A;  1F2Z A;  3L7Z C;  1CQF A;  5JJL A;  3D31 A;  2C35 B;  2K04 A;  1TU2 B;  1CQV A;  5IYC G;  4EGV A;  5FLX c;  1XNR Q;  3KJO A;  1XTD A;  2PO4 A;  3GP7 A;  3S15 B;  1PYS B;  4AIM A;  2JP1 A;  2RA4 A;  1S5B D;  3RZO H;  5IP7 G;  4A3M B;  2F0D A;  5FLM H;  1NUC A;  4DR6 Q;  5ELN A;  4L63 B;  4LFA L;  1L0W A;  4YWL A;  4IUN A;  1PFN A;  2EVB A;  4A4I A;  4IAL A;  1HA6 A;  3A7L A;  2PMZ B;  2RDH A;  1JJG A;  4PZ6 A;  4X6A H;  1MIU A;  3U4Z A;  4UHV A;  2HIV A;  2I5H A;  4LFB Q;  3DLL A;  4C3I B;  1A2T A;  2K05 A;  3FKI G;  4C56 C;  3S15 H;  2JQO A;  1OXV A;  2XIW A;  1HH2 P;  4F7X A;  1TS2 A;  1FYC A;  1YNN C;  2A68 D;  4GN3 B;  4WRD A;  5CV8 A;  4A3M H;  2JA8 B;  3J81 i;  4M8A A;  4LNQ A;  2ID0 A;  4X3S A;  1I50 B;  3UDI A;  1A0I A;  4NXM Q;  2LY7 A;  2XVS A;  2AQ1 B;  1I4R A;  4X66 Q;  1RTN A;  3CCM A;  3NBH A;  1QZH A;  1RHP A;  2OQ0 A;  2K4K A;  5E3F A;  2UUA L;  4DUZ Q;  3OTO Q;  1EUJ A;  3OMG A;  4X64 Q;  4FNF A;  3PO2 G;  2N55 A;  5KIX A;  1ZXT A;  4BA2 I;  4ZRZ A;  3CCQ A;  1WD0 A;  1H9K A;  3L3O C;  1DON A;  1VF7 A;  2KA7 A;  4DV6 L;  1K8A C;  2IX1 A;  2IL8 A;  4C3I H;  3PO3 G;  1T9H A;  2JA9 A;  5JPN C;  1Q1B A;  5GRO A;  1STY A;  5C0X J;  4M1U B;  4OO1 I;  2D0P A;  4L5R C;  2DGY A;  2JA8 H;  4ME5 A;  2AUJ D;  5IT9 c;  3TP5 A;  5FO8 B;  1WTR A;  3VDY A;  3A74 A;  1I50 H;  1JE4 A;  1N8R C;  3HOV B;  4DN4 M;  3A5Z B;  4L5T A;  1BBW A;  1VCI A;  1C9O A;  1FNU A;  1SJE D;  3Q23 A;  1C8C A;  2K5V A;  2XN9 C;  2RVL A;  4OON A;  1GUT A;  5FK9 C;  1QZG A;  1PTO H;  3J80 i;  2RCN A;  1ESR A;  3HFZ B;  4PMW A;  5LMU Q;  1XTC D;  1KTK A;  2NN6 G;  1F9R A;  1M90 C;  3HZX A;  2UXD L;  5GAH C;  4LFC Q;  4C3J G;  2NUC A;  1L0X B;  4YCV A;  1XMQ Q;  3MXN A;  2A73 B;  5FLX L;  1TS5 A;  2WIN B;  3PMF A;  4FDB A;  4HR7 B;  1NE3 A;  1SMY C;  4A3G H;  3PF4 A;  1G29 1;  3CPW A;  3FVQ A;  2KCM A;  2F3V A;  1R9T H;  5JVH 3;  1MJE A;  2OT2 A;  3HOV H;  4DR3 L;  3A8J E;  4H7B A;  2Z6K C;  3VR5 A;  3L2P A;  3HKZ B;  5C3E B;  2UUB Q;  2PMZ E;  3SDZ A;  4DAY B;  2QEX A;  2K28 A;  2B2T C;  4LUV A;  3BZK A;  3W1G A;  4BBS B;  2Z6B A;  3PIO A;  1Q81 C;  2L4N A;  3X3N A;  3G48 A;  4IOC A;  1HA5 A;  3NP8 A;  3KUP A;  5C4Z A;  1UWV A;  2EYO A;  2E5L L;  4ID6 A;  2V1C C;  2F4V Q;  1HQM C;  1U0L A;  1TWA B;  3MC0 B;  4P71 A;  3S1R B;  1JCK B;  5IWA Q;  3D4W A;  1O7I A;  3MZ5 A;  4XQQ A;  5C5M A;  4A93 B;  5C4X H;  4G7O C;  3KF6 B;  1JJC B;  4DXG A;  1FNW A;  4IUV A;  2F0U A;  1AN8 A;  5IE8 A;  5C44 B;  4DAV A;  5C3E H;  4A3D B;  2K03 A;  3MFG A;  3A8K E;  1I4H A;  3E0E A;  2WV6 D;  1PFM A;  2EYL A;  1GVP A;  4JCV E;  4A3E B;  4CGY B;  3QG1 A;  2ZJP A;  2WKD A;  4XQN A;  4DR1 L;  5M5W B;  5ELE A;  4KKS A;  2Z9H A;  4APV A;  1D1I A;  2B39 A;  2M00 A;  4KY5 A;  4KKT A;  1V8Q A;  4HIK A;  2F0K A;  1TWA H;  3E6Z X;  1D2B A;  3T4A C;  2IT1 A;  3S1R H;  2IHF A;  1IYJ B;  2C5C A;  4A93 H;  4DGZ A;  3TZU A;  3QR8 A;  2F0T A;  2CCZ A;  1GUS A;  1AZQ A;  3TN2 A;  1WJJ A;  3BS1 A;  5JJI A;  2D5D A;  4IFD G;  3PIO 3;  5C44 H;  3PUY A;  1FL0 A;  1SN8 A;  5T1I A;  2A6H D;  4DV7 L;  4A3D H;  3I4N B;  2K6A A;  3PF5 A;  4HED A;  5EPJ A;  1J6Q A;  1KRT A;  5BR8 Q;  4ZUJ A;  1SYD A;  3EVQ A;  4FXG C;  4A3E H;  1KL9 A;  2LMC B;  1TR5 A;  4NW2 A;  4A75 A;  4RMF A;  4IPC A;  4B3M Q;  5M5W H;  3FMC A;  2VQE L;  2NVY B;  1PV4 A;  4QUF A;  4CDC C;  1EYA A;  2RF4 A;  1X3F A;  4QL5 A;  2CWA A;  5EBC A;  3HG9 A;  3B6Y A;  2YTV A;  4ILW A;  2N3S A;  4JI4 L;  2IY5 B;  4CJ0 B;  3HKZ E;  2ZJR A;  1D5M C;  1F77 A;  1FD7 D;  3CC4 A;  4BY1 B;  4NXN Q;  1CK1 A;  4UDU C;  1ASZ A;  1PLF A;  1A3T A;  4WJW A;  4ZAI A;  3QO2 A;  3I4N H;  4B3S Q;  1PH2 A;  4OX9 L;  1YNJ D;  2L12 A;  3K0X A;  4GNX B;  1F2M A;  2PZT A;  5KYL A;  3LGJ A;  3C3L A;  1D1K A;  1PRT F;  3BJU A;  4PMC A;  4GLV B;  1B4O A;  3C1F A;  1HNW Q;  4WOR A;  4PZ7 A;  2NVY H;  4JC0 A;  2F0M A;  3VA5 A;  1IBL L;  2B3G A;  1CKN B;  1ESF A;  5IOD A;  4I65 A;  3GTJ B;  1KNA A;  3P7J A;  5I9O A;  3EQL C;  4V0B A;  1CTM A;  4JOI A;  1YJN A;  5IY0 A;  2QDL A;  1HNX L;  1FR3 A;  2VY3 A;  1K83 B;  4JBW A;  4A3J G;  1JB3 A;  2F1M A;  4DV2 L;  2B8G A;  3F2D A;  5IOC A;  2VB3 X;  5JAV A;  1Q82 C;  1FJG Q;  1D5Z C;  3A55 A;  1WCM B;  3ERO A;  1HPC A;  4B3R Q;  4DA2 A;  1E2V A;  1YHA A;  2EY2 A;  3GTJ H;  1MHW C;  2Q2H A;  3OW7 A;  4TSS A;  5HGQ A;  3EJI A;  3WOF A;  4KHP L;  3K8A A;  2P5Z X;  1JWU D;  2RDG A;  2G9H D;  3OOC A;  4CDE C;  3GV6 A;  1KDB A;  2HCI A;  5EPK A;  3ULL A;  3J7A 5;  2N78 A;  2QA4 A;  1VQJ A;  2O4X A;  1SNO A;  3M85 A;  1K83 H;  4PG3 A;  2JA6 G;  2F52 A;  3OWF A;  2EJM A;  3QIA A;  4FF2 A;  4DV4 L;  2TSS A;  1ZYR C;  2QDB A;  5ELC A;  5ELD A;  2L11 A;  3GTO B;  1WVL A;  1YI2 A;  3BZD B;  1WCM H;  4YY3 L;  3S2D B;  1K28 A;  1TWC B;  1V1P A;  1WI5 A;  2MP1 A;  1XNQ L;  4HAE A;  1STG A;  2K7V A;  1A6X A;  3K5L A;  1L1O B;  2IJ0 A;  2KED A;  1IYV A;  4IPG A;  2O5J C;  4K8J A;  4MHE A;  2B29 A;  2A74 C;  3CKI B;  4R8N A;  3K80 C;  4RHS A;  4A3L H;  2F0O A;  1SR3 A;  4DV3 L;  1DOM A;  4K5W A;  4GOP A;  4IJL A;  2F0W A;  4FVM A;  4DK3 C;  1PH4 A;  3U50 C;  1LT3 D;  1Z47 A;  1XPR A;  3GTO H;  3X3M A;  5FOB B;  3S2D H;  4LK1 C;  4JI2 Q;  1TWC H;  4BBR B;  2XWJ B;  1PH6 A;  2UU9 L;  5I9P A;  5C3W A;  1RTO A;  3FEW X;  1J5E L;  2OXP A;  1PZJ D;  3HOU B;  3F8T A;  3HKS A;  4K0K L;  4JI0 Q;  2IPK D;  4WJ4 A;  5AJ3 Q;  4RA8 A;  1AFP A;  2K75 A;  1MSH A;  4H13 C;  3AMU A;  3CCR A;  1G91 A;  2UXB L;  2VW9 A;  1I4Q A;  2HDL A;  4IFD I;  1K8M A;  3SEB A;  3NWT A;  4N8F A;  2AWN A;  1YJW A;  3TRE A;  4JI8 L;  2HQE A;  1E2W A;  1SYB A;  1A63 A;  2RQX A;  3HOY H;  1VQ5 A;  3S1N B;  1BO0 A;  4BBR H;  3NXW A;  3IKJ A;  3G4S A;  5IGG A;  3VYR A;  3R93 A;  3HOU H;  2WB1 B;  1E22 A;  2AKW B;  2KVM A;  2EQS A;  1LTG D;  3Q8D A;  2MHV A;  4JYA L;  3OIP A;  4AYB B;  4A3C H;  1LT5 D;  3FP9 A;  4R4C A;  3R2I A;  1DXM A;  1SE4 A;  2RSO A;  1ENC A;  1AH9 A;  3AFP A;  4GLX A;  4MN3 A;  1V1Q A;  4FO2 A;  1EY5 A;  3RLF A;  4UAI A;  3S1M B;  1QOH A;  1GJX A;  2Z4H A;  2PYK A;  4OO1 G;  1Q8K A;  1IHZ A;  2EYM A;  1MBY A;  4F87 A;  1G2S A;  1TII D;  2E2H B;  3PUW A;  2FJ2 A;  1VQK A;  4CBV A;  4NP5 A;  5M5Y B;  5LMN L;  5IGC A;  3K0Y A;  1B3Q A;  1VQN A;  4MTN A;  1BXT A;  3HOZ G;  1Q90 A;  2F0E A;  1KIX A;  2PQA A;  3IRB A;  5M3M G;  4P72 A;  2E2I B;  3HOW G;  2K14 A;  4OIK A;  2IW3 A;  1WOC A;  2YTX A;  3J81 L;  3K57 A;  5E4W C;  3VYS A;  5I2Y A;  4C1N I;  1IBM L;  1T5X D;  4LW1 A;  3K58 A;  4DNI A;  4ZK9 B;  1CA5 A;  3DM3 A;  4RAU C;  3I4M B;  1SYF A;  5D3D A;  2ZM6 Q;  3RLO A;  1EOV A;  1I6V C;  5LHY 1;  3S1M H;  1GO3 E;  3I3C A;  4FXK C;  4HJ8 A;  3CQZ B;  4O42 A;  3RR5 A;  3RN5 A;  2D2C C;  3C2P A;  4LWC A;  3NUC A;  4LF9 L;  1STN A;  1Y69 U;  3D4D A;  3CW2 C;  4S3S A;  1DGS A;  1B1Z A;  5KNB A;  1VQ7 A;  2E2H H;  1Q3L A;  4KK7 A;  1ENF A;  2NZO A;  4DR7 L;  1QUQ A;  5M5Y H;  2YYZ A;  3Q6S A;  4IJH A;  1YEZ A;  4FXD A;  4A3F G;  3UDF A;  1QG7 A;  3AQQ A;  1SE8 A;  3VYT A;  4UP8 A;  1E24 A;  5C0X H;  2TMP A;  2E2I H;  4DR2 Q;  1W3S A;  3J81 E;  1BBU A;  5IYB H;  2DJF C;  3I70 A;  4NDX A;  3D4R A;  1RD9 D;  1FNV A;  1CFM A;  1DM0 B;  1PFS A;  2CW0 D;  3I4M H;  3W1B A;  1SBB B;  3FHW A;  2Q2U A;  2X6G A;  4PZ8 A;  4GKJ L;  1ET9 A;  3K5M A;  4ODG A;  1HUN A;  5EJW A;  4U68 A;  4A3B B;  3CQZ H;  2DY8 A;  1A2U A;  1H9R A;  4MTK A;  4DAM A;  1EQV A;  3CCE A;  3U9O A;  2HIX A;  1LAC A;  1VQ9 A;  3DWP A;  4DR4 L;  2ZXR A;  3EFX D;  5DLQ E;  3O13 A;  4L5Q A;  2WB1 E;  1O7L A;  2VXW A;  2A19 A;  2RHS B;  4KHZ A;  5IYC H;  2F0J A;  1I4X A;  2R7Z B;  4AYB E;  2Q8R E;  1C0A A;  2L15 A;  2I5L X;  5IYD G;  2VQF L;  1AW7 A;  4A3K B;  5JEA J;  4HJ5 A;  3KDF A;  1ICW A;  2GN5 A;  2DN8 A;  3U9S A;  2A6E C;  1VQ4 A;  2E8G A;  3IAY A;  1PH8 A;  1IW7 D;  4A3B H;  2WAQ B;  4MNO A;  2OTL A;  4P73 A;  5H1S E;  3J80 E;  1UEA B;  1E7Z A;  3KLR A;  1LTS D;  2FMM A;  4LFA Q;  4JI5 L;  1CUK A;  2F4I A;  3K5N A;  3K5O A;  2F0G A;  3KYH C;  4TRD A;  2A6H C;  4UP9 A;  3PUX A;  4K5X A;  3SK4 A;  4BXX G;  2JYO A;  2NTS A;  2R7Z H;  2EXD A;  2B63 G;  4LF6 L;  4A3K H;  1SNM A;  5JJK A;  3UE1 A;  2F03 A;  1Q1E A;  2BCO A;  4POF A;  1AE2 A;  1E2Z A;  1X54 A;  4YIJ A;  4IQZ A;  3U4V A;  2D9U A;  3S17 B;  1X3Q A;  3VYU A; 
#chains in the Genus database with same CATH homology
 1IBM Q;  4DV4 Q;  5IE8 A;  2BH2 A;  3KF6 A;  4NPS A;  2ALY B;  5C3E H;  4YY3 Q;  3RNU A;  3T1Y Q;  2NN6 I;  3CME A;  1CKM A;  3T1H L;  1JJ2 A;  2MO1 A;  1JMC A;  3E0E A;  1VQM A;  1GVP A;  4JCV E;  1PH9 A;  1W2B A;  1FJG L;  1Q12 A;  1U5K A;  4A3F H;  2ZJP A;  1YIT A;  4LF9 Q;  2QGQ A;  3HOU G;  4DR5 L;  2UUA Q;  4GS3 A;  3H3V I;  3CC7 A;  4DR1 L;  4AQY L;  1I94 L;  3G6E A;  4LUO A;  3PO3 H;  3S1Q H;  3KF8 B;  4DR7 Q;  4A3C G;  4Y52 H;  4APV A;  3CMA A;  4DV0 L;  2JJQ A;  1NMG A;  3CP0 A;  1XMO L;  4LF7 Q;  3NEM A;  1QVF A;  2LXJ A;  3STB D;  2JK8 A;  3WWV A;  4C2M H;  2Z6K A;  4HIK A;  1X56 A;  4DV6 Q;  4A76 A;  4DV1 Q;  2MO0 A;  4JV5 Q;  3ER0 A;  1TWA H;  4YCW A;  1N32 L;  1EYG A;  2IT1 A;  2WFW A;  3S1R H;  2OQK A;  1XPO A;  2IHF A;  1IYJ B;  4TQU S;  4A93 H;  3S17 H;  1EFW A;  4K0K Q;  4OWX B;  3JAM i;  2CCZ A;  3RLN A;  3ERS X;  1K0R A;  4GLA C;  1WJJ A;  3CCU A;  5JJI A;  4IFD G;  4IO9 A;  4LFB L;  1CKO A;  5J3B A;  1V9P A;  1FL0 A;  3PUY A;  1SN8 A;  3UE0 A;  3ULJ A;  4QJF A;  5C44 H;  4DV7 L;  4A3D H;  3ICE A;  3PF5 A;  1L2F A;  1J6Q A;  1SMX A;  1QVC A;  4LF8 Q;  1KRT A;  5BR8 Q;  2DUD A;  3GTQ H;  4A3E H;  1KL9 A;  1G6P A;  3J81 c;  4A75 A;  4RMF A;  4JI7 L;  4IOA A;  3UDG A;  2WB1 G;  3CCV A;  1YZ6 A;  2IHE A;  3S2H H;  4IPC A;  4KI0 A;  1IBK L;  4B3M Q;  1MJC A;  4JOI C;  5M5W H;  4DR4 Q;  2HHH L;  2AMC B;  2VQE L;  1PV4 A;  4GOP B;  2RF4 A;  1E1T A;  3H0G H;  4A3M G;  1Q46 A;  1X3F A;  3GDE A;  4QL5 A;  1CSQ A;  4HJ9 A;  2CWA A;  2KEN A;  1YJ9 A;  1WCM G;  4QY7 A;  3B6Y A;  2K5N A;  3GO5 A;  2R92 G;  2YTV A;  2UUC L;  3CC2 A;  1VQI A;  2N3S A;  2VQF Q;  3GTG H;  1GM5 A;  4JI4 L;  2WAQ E;  1OXT A;  3H3V H;  1VQP A;  2IY5 B;  5FJ8 G;  3HKZ E;  2RHQ B;  2ZJR A;  1PH7 A;  2Q2I A;  4YCU A;  3CC4 A;  4NXN Q;  2ZTC A;  1Y1V H;  1ASZ A;  1VQD A;  4A3I G;  4GKK L;  2ATW A;  1NMF A;  3PGZ A;  1RL2 A;  2MFI A;  4B3S Q;  1X3G A;  1PH2 A;  4OX9 L;  3I4N H;  1BKB A;  1SLJ A;  2I0Q A;  3K0X A;  4HIO A;  1VQ6 A;  4GNX B;  4DR3 Q;  3U58 A;  5C4J H;  5IP7 H;  3LGJ A;  1VQE A;  3BJU A;  1KHI A;  1I6H H;  3JC6 6;  1XJV A;  3EN2 A;  4GLV B;  3CCS A;  5M3F H;  4JI5 Q;  1HNW Q;  2K50 A;  5IYB G;  5GAD C;  1HR0 W;  4PZ7 A;  3STB C;  1VQL A;  2N8N A;  2NVY H;  2YU9 H;  2VNU D;  4OWW B;  3PV0 A;  3CPF A;  4JC0 A;  4HJA A;  4Y7N H;  3I4M G;  2JA8 G;  1IBL L;  2B3G A;  1N34 L;  1CKN B;  4TVA B;  4JI0 L;  3PIP A;  3J80 c;  4X65 L;  2Y0S G;  4LF6 Q;  2ZTE A;  1WFQ A;  2KHJ A;  2R7F A;  3OYY A;  5IP9 H;  1OXX K;  1Y1W H;  4QIW E;  1TWF H;  3RN2 A;  1N9W A;  1KRS A;  2HT1 A;  3GTL H;  1AE3 A;  2ZTD A;  3HOZ H;  2EIF A;  1PHJ A;  1YHQ A;  4JI3 L;  4X62 Q;  1IL2 A;  5M3M H;  3FKI H;  3G71 A;  4JOI A;  1WYD A;  1E3P A;  1YJN A;  5LMN Q;  3HOW H;  5IY0 A;  4DV5 L;  1I5F A;  3CD6 A;  3S24 A;  4YWK A;  1HNX L;  1HZ9 A;  2VY3 A;  4JBW A;  4A3J G;  2AHO B;  3TEH B;  3T1H Q;  3GTM H;  4DV2 L;  5JEA G;  2PI2 A;  3F2D A;  1HZC A;  1Q82 C;  1FJG Q;  1OXU A;  3H15 A;  1OTC A;  2BA0 A;  2HQL A;  4DR5 Q;  2KCT A;  3I55 A;  1XNR L;  3HOY G;  4DR1 Q;  2A1A A;  4DPG A;  4GOP C;  2R6G A;  2GVB A;  3M4Q A;  4AQY Q;  3ULP A;  1I94 Q;  3A5U A;  1YHA A;  4BBR G;  3PO2 H;  1YNX A;  3KFU A;  4DV0 Q;  3GTJ H;  4A3B G;  1XMO Q;  1E1O A;  2Q2H A;  1B8A A;  1N32 Q;  2NVQ H;  1D7Q A;  4RG1 A;  2D62 A;  5HGQ A;  4DR6 L;  3S1N H;  1PH1 A;  4KHP L;  1FGU A;  3K8A A;  1K8G A;  4DUY Q;  4IPD A;  1KQS A;  2F4V L;  3ULL A;  5GAG C;  2N78 A;  2QA4 A;  3J7A 5;  1VQJ A;  1KC8 C;  5FLM G;  3M85 A;  1KXL A;  4JBM A;  2K5H A;  4P74 A;  1K83 H;  5M5X H;  3CCJ A;  1K3R A;  4GNX C;  2R7Z G;  1Y14 B;  2I5M X;  4PG3 A;  1QVG A;  1LM0 A;  2F52 A;  1YIJ A;  2JA6 G;  3CXC A;  3S16 H;  4BY7 G;  4A3K G;  3HOX G;  4DV4 L;  3BU2 A;  2GVA A;  4EQ5 A;  3AFQ A;  2JEB I;  1YI2 A;  1PH5 A;  3AEV A;  2PNH A;  3GTK H;  1WCM H;  4YY3 L;  1JB7 A;  1IBK Q;  2JA5 G;  4ME3 A;  4GKJ Q;  1WI5 A;  1VQB A;  2OWO A;  3KLW A;  3I7F A;  4JG2 A;  1VS0 A;  2HHH Q;  3M7N A;  1Z9F A;  2VQE Q;  1XNQ L;  2N49 A;  2Z0S A;  3CAM A;  5FJ8 H;  4MZ9 A;  2R93 H;  2WAQ G;  3HKZ G;  5C3E G;  2ZJQ A;  1X9N A;  1L1O B;  4A3I H;  1VQ8 A;  2ZM6 L;  3KOJ A;  1X6O A;  3TQY A;  1HNZ Q;  4IPG A;  2UUC Q;  4C3H H;  5IYD H;  1YHB A;  4C3J H;  4JI4 Q;  1UE1 A;  2VL6 A;  4AYB G;  4NXM L;  1TWH H;  2B29 A;  1L1O A;  1UEB A;  1X65 A;  4JI1 L;  4QGU A;  3I56 A;  4UY8 C;  4X66 L;  1N36 L;  4BBS G;  2BH8 A;  3K80 C;  4JV5 L;  4A3L H;  1SR3 A;  1GKH A;  1VQC A;  4DV3 L;  1VQO A;  4GKK Q;  4DUZ L;  4GOP A;  2UXD Q;  4IJL A;  3OTO L;  3TRZ A;  4DK3 C;  3K7U C;  4X64 L;  2KHI A;  3JAM c;  3TS0 A;  3U50 C;  5E7N A;  1PH4 A;  1Z47 A;  1XPR A;  2CWP A;  4P75 A;  3TS2 A;  3GTO H;  4O0A A;  1K73 C;  1UE7 A;  4JBK A;  3F1Z A;  2XTI A;  3PUV A;  4BA1 I;  3S2D H;  1BVS A;  4JI2 Q;  3CCL A;  4OXP A;  1TWC H;  4EX5 A;  4A93 G;  1G51 A;  1PH6 A;  1HZA A;  2UU9 L;  5BR8 L;  4DR2 L;  2YTY A;  1JE5 A;  1J5E L;  4LF5 L;  2NVX H;  2NVT H;  3NEL A;  2A8V A;  3F8T A;  1P16 A;  1IBL Q;  1N34 Q;  3HKS A;  4K0K L;  1EQR A;  1S3O A;  2AWO A;  2CFM A;  3MEF A;  4GNX A;  4X65 Q;  1HR0 L;  4DK6 C;  4JI0 Q;  4BXX H;  2BA1 A;  4WJ4 A;  1D8L A;  1X3E A;  5C0X G;  1NTG A;  2B63 H;  3M9B A;  2JA7 G;  4IPH A;  4A3E G;  4B3T L;  5AJ3 Q;  1LYL A;  2PI2 E;  2K75 A;  2VS1 A;  3CCR A;  4NB3 A;  3A0J A;  4JI6 L;  2UXB L;  2VW9 A;  3PCO B;  3I2Z A;  5GAE C;  4IFD I;  1I3Q H;  4JI3 Q;  2WP8 J;  4JBJ A;  2VUM H;  3PSI A;  4GN4 B;  1PA6 A;  4H02 A;  2E5L Q;  2AWN A;  2ASB A;  1VQG A;  4DV5 Q;  1CKN A;  3GD7 A;  1S40 A;  1NY4 A;  3H0G G;  3TRE A;  1YJW A;  4JI8 L;  2NZH A;  1HNX Q;  1S72 A;  4LF4 L;  3M4P A;  5LMU L;  4YHH Q;  2E2J H;  1RIP A;  1A63 A;  3HOY H;  1VQ5 A;  3L7Z C;  2CQO A;  4LFC L;  1EIF A;  4BBR H;  1N33 Q;  5JJL A;  1GD7 A;  3D31 A;  3G4S A;  2C35 B;  1XMQ L;  3K7A H;  1LTL A;  3HOU H;  5IYC G;  5FLX c;  1E22 A;  2AKW B;  3Q8D A;  2EQS A;  1CSP A;  1XNR Q;  1XTD A;  1OXS C;  1X55 A;  2CKZ B;  4YWM A;  3OW2 A;  1NJI C;  3I4N G;  4JYA L;  1PYS B;  4A3C H;  1HJP A;  3FP9 A;  4AIM A;  1HNW L;  4R4C A;  2UXC L;  3M4O H;  1L1O C;  3RZO H;  4XIG S;  3GTP H;  5IP7 G;  1AH9 A;  3AFP A;  4GLX A;  4A3G G;  3E9H A;  4OWT B;  5FLM H;  1V1Q A;  3RLF A;  2UUB L;  4DR6 Q;  2VZA A;  5ELN A;  2JA6 H;  5M3F G;  2FXQ A;  1M1K C;  2MQH A;  4LFA L;  4OO1 G;  2KBN A;  1Q8K A;  3HOV G;  3UDX A;  1L0W A;  4YWL A;  2K52 A;  1B7Y B;  3EIV A;  4R4T A;  2F3I A;  4A4I A;  3PUW A;  4X62 L;  1VQK A;  4IFD J;  1MKH A;  4L5S A;  5K36 G;  5LMN L;  1P8L A;  5C0X I;  1JJG A;  2PQA B;  1Y1W G;  1VQN A;  4PZ6 A;  4MTN A;  1XPU A;  4X6A H;  1MIU A;  3U4Z A;  5LMN W;  4DKA C;  4BY1 G;  3HOZ G;  2HIV A;  1KIX A;  2LXK A;  2I5H A;  4LFB Q;  2PQA A;  3DLL A;  3IRB A;  5IWA L;  4DV7 Q;  1SFO H;  5M3M G;  3FKI G;  3W5O A;  4P72 A;  3HOW G;  2K14 A;  1XNQ Q;  1WOC A;  2JQO A;  2YTX A;  1OXV A;  3S15 H;  2JEA I;  1HH2 P;  1IBM L;  4LW1 A;  4DNI A;  4BBS H;  4WJ3 M;  3DM3 A;  4GN3 B;  4A3M H;  4JI7 Q;  4GN5 A;  3J81 i;  4B3R L;  3F2B A;  1VQH A;  2ZM6 Q;  3T1Y L;  1UE5 A;  2R92 H;  3RLO A;  1EOV A;  4LNQ A;  2ID0 A;  3S1M H;  1GO3 E;  3NBH B;  5C4X G;  3UDI A;  4HJ8 A;  1A0I A;  3RR5 A;  3RN5 A;  4NXM Q;  4LWC A;  1C0A A;  4JI1 Q;  3S14 H;  2JE6 I;  4HIM A;  4X66 Q;  3CCM A;  4KLK A;  1N36 Q;  4B3R Q;  4LF9 L;  1YVC A;  1QUQ B;  3F2C A;  3CW2 C;  4DV3 Q;  1QZH A;  1DGS A;  2OQ0 A;  3L0O A;  4POG A;  2K4K A;  2UUA L;  1VQ7 A;  4DUZ Q;  1SRO A;  5ELO A;  1EUJ A;  3OTO Q;  1IXR A;  2NZO A;  2E2H H;  1EIY B;  4X64 Q;  4DR7 L;  3PO2 G;  1QUQ A;  5M5Y H;  3KJP A;  2YYZ A;  4IJH A;  4DUY L;  4BA2 I;  1YEZ A;  3CCQ A;  4LF7 L;  5GQO A;  4A3F G;  3UDF A;  3AQQ A;  1SE8 A;  4DV6 L;  4DV1 L;  1K8A C;  4UP8 A;  1E24 A;  1UE6 A;  2IX0 A;  2IX1 A;  4C3I H;  3PO3 G;  1T9H A;  2UU9 Q;  2JA9 A;  4OX9 Q;  2JA7 H;  2E2I H;  4DR2 Q;  1W3S A;  1Q1B A;  1BBU A;  5GRO A;  5IYB H;  5C0X J;  1J5E Q;  4LF5 Q;  4OO1 I;  1YBY A;  3ZJY C;  2D0P A;  4L5R C;  1A62 A;  1TWG H;  1PFS A;  2DGY A;  3I4M H;  2JA8 H;  1LUZ A;  3W1B A;  2XGT A;  3FHW A;  5IT9 c;  3I4O A;  1HR0 Q;  2Q2U A;  4PZ8 A;  4GKJ L;  1EWI A;  1TXY A;  2OTJ A;  1V43 A;  3VDY A;  4LF8 L;  4B3T Q;  3A74 A;  1I50 H;  1Q7Y C;  1N8R C;  3CQZ H;  3A5Z B;  2R7D A;  4L5T A;  3CCE A;  1BBW A;  1VCI A;  4DAM A;  1Q86 C;  4JI6 Q;  4J15 A;  1C9O A;  2UXB Q;  4XTC S;  2HIX A;  1FVI A;  2K5V A;  4R4I A;  3EBE A;  5C44 G;  4OON A;  4A3D G;  1NBW A;  1HNZ L;  4HJ7 A;  1VQ9 A;  1SRU A;  4B3M L;  4AH6 A;  4DR4 L;  1QZG A;  3J80 i;  2D0O A;  2R93 G;  1VQA A;  2RCN A;  5DLQ E;  4JI8 Q;  4L5Q A;  1PYB A;  2WB1 E;  3HFZ B;  4UP7 A;  4PMW A;  4LF4 Q;  5LMU Q;  4HID A;  2A19 A;  2RHS B;  4KHZ A;  5IYC H;  4R4O A;  2NN6 G;  3MXN B;  5HY6 A;  4A3J H;  1M90 C;  1B70 B;  3KDF B;  4AYB E;  5GAH C;  3CF5 A;  2L15 A;  3PUZ A;  2I5L X;  1IZ6 A;  4LFC Q;  5IYD G;  2UXD L;  2VQF L;  3SGI A;  4YCV A;  5JEA J;  1XMQ Q;  4HJ5 A;  1HZB A;  3KDF A;  4FDB A;  1NE3 A;  1K9M C;  4A3L G;  4NXN L;  3PF4 A;  4A3G H;  1G29 1;  4UPA A;  2MNA A;  3CPW A;  4O2D A;  4JYA Q;  2GN5 A;  2H5X A;  2KCM A;  4JI2 L;  4DV2 Q;  3M3Y H;  1H95 A;  1VQ4 A;  2E8G A;  4B3S L;  2OCE A;  4R4Q A;  1PH8 A;  1R9T H;  2UXC Q;  4A3B H;  1MJE A;  3HOV H;  4DR3 L;  3RZD H;  3L2P A;  2Z6K C;  5EAY A;  4MNO A;  2OTL A;  4P73 A;  5H1S E;  1Y1V G;  3K81 C;  1PH3 A;  1E7Z A;  2UUB Q;  2PMZ E;  4DAY B;  2QEX A;  4LFA Q;  3J81 j;  4JI5 L;  4QQB X;  3BZC A;  4ALP A;  5AJ3 L;  1CUK A;  1VQF A;  3NEN A;  1KD1 C;  3E9I A;  4LUV A;  3BZK A;  3W1G A;  3J7Z C;  3KYH C;  3PIO A;  1Q81 C;  4BY1 H;  4UP9 A;  3PUX A;  3G48 A;  4IOC A;  4BXX G;  2YV5 A;  2R7Z H;  1EQQ A;  2EXD A;  1UWV A;  4LF6 L;  2B63 G;  4KHP Q;  1KAW A;  4BY7 H;  2E5L L;  4A3K H;  5JJK A;  2V1C C;  3UE1 A;  2ES2 A;  2F4V Q;  3D0F A;  1ASY A;  3HOX H;  1Q1E A;  1U0L A;  3AYH B;  4R1J A;  4YHH L;  2Q2T A;  2Y0S E;  4P71 A;  1JT8 A;  2LSS A;  4POF A;  1AE2 A;  1X54 A;  1O7I A;  4LUZ A;  5IWA Q;  2JA5 H;  2VUM G;  1PVO A;  3U4V A;  5C4X H;  1A8V A;  1N33 L;  5IP9 G;  3KF6 B;  1C7Y A;  3KJO A;  1JJC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...