1HFGA

Nmr solution structure of vmip-ii 1-71 from kaposi's sarcoma-associated herpesvirus (minimized average structure).
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
71
structure length
71
Chain Sequence
LGASWHRPDKCCLGYQKRPLPQVLLSSWYPTSQLCSKPGVIFLTKRGRQVCADKSKDWVKKLMQQLPVTAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VIRAL MACROPHAGE INFLAMMATORY PROTEIN-II
publication title Structure/Function of Human Herpesvirus-8 Mip-II (1-71) and the Antagonist N-Terminal Segment (1-10)
pubmed doi rcsb
molecule tags Chemokine
total genus 10
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2000-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1hfgA00
1O7YA 2XIWA 1XX8A 1O7ZA 1HUNA 4ZAIA 2L1BA 1WTQA 4DN4M 2DY7A 4O42A 2KUMA 1WTWA 3FPUB 1B2TA 1GUWA 1ICWA 3I8ZA 1NCVA 2K05A 2VXWA 1DZ1A 2B2TA 1U4PA 2HUGA 2RSOA 2EOTA 5CBEE 4RAUC 1J9OA 5DNFA 2M2LA 1RHPA 4XT3B 1F9PA 1WTVA 1U4RA 4ZK9B 5CORA 1SSOA 1MSGA 2IL8A 5D14A 1WTOA 1HRJA 3I3CA 4UAIA 4IUPA 4X3SA 3IL8A 5D65A 1F2LA 1Q3LA 3GV3A 1HFNA 1LV9A 5COYA 2L9HA 2N55A 1O80A 2K01A 2D9UA 3KUPA 3UI2A 1B50A 2RSNA 3DEPA 5EPJA 1SDFA 1X32A 3Q6SA 3F2UA 1HFGA 4HAEA 3SVMA 2Q8RE 1PFBA 2L12A 4IUQA 5CBAE 5E4WC 1EL0A 1ILPA 1HUMA 3D6WA 1EQTA 1BO0A 1PLFA 1RJTA 1EIGA 1J8IA 2KEDA 1PDQA 2B2WA 4LMQD 1B53A 2N88A 1G2SA 4CJ0B 4MN3A 2HCCA 1IKMA 1RTOA 2KECA 1SAPA 2R3ZA 1S4ZA 1VMCA 1TVXA 3I90A 1ESRA 4OIKA 3TZDA 1JE4A 4ZLTF 4R8IA 1WD0A 2B2YA 2CVRA 1VMPA 3G7LA 2B2UC 4HEDA 2FINB 3MTSA 2HCIA 1AZPA 1ILQA 2DY8A 1ZXTA 3I91A 1WVLA 1HA6A 2Q8TA 2JP1A 2K03A 5JJZA 4HCSA 1NAPA 1NR2A 3MWYW 5AFWA 5EPLA 1X3QA 1MGSA 4QUFA 1BBXC 5EQ0A 2X69A 1HHVA 1KNEA 1F9RA 1F9QA 3HP3A 4U68A 3DM1A 1IKLA 2NWGA 3LWEA 5T1GA 2KOLA 1EIHA 5CMDA 1G2TA 1PFMA 2X6LA 1U4LA 4XT1B 2B2UA 1A15A 1ML0D 2H1EA 4OIJA 2EPBA 2FFKB 2HDLA 1CA5A 3ONAB 5EPKA 1DOMA 1G6ZA 2NYZD 5T1IA 3TN2A 1MSHA 1F9SA 1NR4A 2KEEA 4ZKCB 1E0BA 3R93A 1XYIA 2NZ1D 1X3PA 4CJ2C 1KNAA 1QE6A 4XDXA 1WTXA 4ZKBB 2FMMA 4RWSC 1WTRA 1CA6A 4CJ1B 2B2VC 3DEOA 4X3TA 2MPMA 1QG7A 2HDMA 4IURA 2RA4A 1DONA 1IL8A 3IFDA 1MI2A 2FJ2A 4IUTA 1RTNA 3GV6A 4NW2A 1AZQA 2J7ZA 2L11A 1C8CA 4X3UA 5EJWA 1DOLA 4QUCA 2JYOA 1BF4A 2L4NA 1M8AA 3KBXA 1JICA 2BDNA 1WD1A 2K04A 3FDTA 1DOKA 3P7JA 4HSVA 2SDFA 4IUUA 2B2VA 1B4OA 2MGSA 1WTPA 2MP1A 4R9WA 1G91A 2MJ8A 1RODA 4RA8A 1AP0A 2KVMA 1PFNA 2X6GA 1BNZA 3H91A 1EOTA 3QO2A 5E4XA 1CM9A 2B2WC 4X3KA 2B2TC 1U4MA 1QNKA 2K1BA 4IUVA 2RVLA 5EKIA 1B3AA 4MHEA 3N52A 2FHTA 2EE1A 2K28A 2B2YC
chains in the Genus database with same CATH superfamily
3C1FA 2XIWA 5I6YA 3NENA 1K0SA 3U4ZA 2YYZA 5FJ8H 2FXQA 1GUWA 2NZHA 2VXWA 1UWVA 1SBBB 3CCMA 1OXSC 3U50C 1F9PA 4KMUC 3VR2A 2JEBI 4K8IA 3PSIA 1N34L 4DV4Q 2SNSA 1IBLL 4DXGA 2L9HA 1E24A 5IP9H 3PIPA 5CV4A 2JXMB 3NBIA 5I4DA 3AB9A 1X32A 2B63B 3F2UA 1N36L 2DUDA 4APVA 3ULJA 2JA6G 3A74A 3GTMH 1KAWA 4NMZA 4MTKA 3RD4A 3H3VC 3D8GA 5EAYA 3STBC 4DK3C 1SAPA 4OIKA 1CI3M 1WD0A 3PUZA 2MUYA 2WACA 3QB3A 3U4VA 2F4VL 4TRDA 4RH6A 3G71A 5JJZA 3HOYG 3NBHA 2AWOA 2AMCB 2LMCB 4YCVA 2KQ3A 5T1GA 4WORA 1EIHA 3QIAA 4IJHA 2EVBA 4OIJA 4DFAA 2EPBA 4YHHL 4PMBA 4OEMB 3A5UA 4R4IA 1EY0A 2KBNA 4A3BG 4AYBE 1PZID 4YWKA 2WB1B 3IRBA 1H9MA 1HA5A 4UHVA 1CZGA 1NMGA 1A3TA 1B44D 2O4XA 3KF6B 3OIPA 5TSSA 1LTBD 1KLGD 1SRUA 2MGSA 1Q81C 4A3FB 1V9PA 4JI3L 4K2KA 4HJ5A 4IN3A 1LO5D 5IY0A 5EBDA 1CM9A 1TWAH 5KGUA 3JAML 3HKSA 2XNAC 2K5DA 3S16H 5HGQA 4GN4B 1FL0A 4YWLA 5KNBA 5IP9G 3PO2B 4UDUC 3DUZA 1VCIA 5ELEA 1KHIA 4HIKA 1A0IA 1U0LA 2A6EC 3NHHA 2DN8A 2NB0A 2KUMA 1NCVA 1DZ1A 1RD9D 3STBD 1ICFB 4AYBG 3F8TA 2EOTA 1RHPA 3A8KE 2EQSA 4DV0Q 4UAIA 4IUPA 4X3SA 3T16A 1XPUA 4GLAC 3GDEA 1TS3A 2A68C 2G9DA 1I3QH 1YEZA 2H4OA 3HZXA 1L2FA 1VQHA 3TP5A 3A5ZB 5EGTA 3KFUA 3J7ZC 1SNOA 2RKSA 4BS9A 4YCUA 1M4VA 4ULLA 1G2SA 2NVYB 3SEBA 3TZDA 1KDAA 1QJOA 3RUZA 1G51A 1GKHA 2F1MA 5DAUA 2DNCA 2FINB 3TS0A 1LM0A 1ILQA 2G9HD 1Y1WH 2XGTA 5JJIA 4BBRB 2K7VA 4BY1B 5EPLA 1I94L 2N78A 1STGA 1XMQL 2VL6A 1K3BC 1K9MC 2EDGA 1VF7A 2LSSA 1Q8KA 1UEBA 1VS0A 3PUWA 3VR3A 2MFIA 3BU2A 1JWMD 3OHXC 1JR0D 3SK8A 1STAA 5M3FH 5JEAH 4XDXA 4B3SL 4HSPA 3OTOQ 1NSNS 4KD4A 3S1MH 1I6VC 5FLMH 1P16A 2R7ZB 4A3MH 1LUZA 2LS01 3I4LA 1X55A 2A6ED 4FXGC 3PQIA 4NW2A 5EJWA 3WDNA 4R4TA 3RN5A 2SDFA 1LT3D 2NBFA 3S1QB 1AP0A 1YVCA 1BNZA 3H91A 2F3IA 5E4XA 4K14A 2A68D 1JT8A 4IUVA 1EY7A 2CHBD 4RHRA 4DR4L 4X65Q 1A63A 5CV6A 4GOPB 2BDOA 1N9WA 2JA5B 2VQEQ 1C48A 1B2TA 2BOSA 3NE5B 3G4SA 2UXBQ 4BY7H 4EVOA 1TKWB 4A3KB 1SNPA 1VQGA 1TWHH 3I3CA 2WKDA 1LV9A 4A3CG 4X6AH 3MC0B 2XTIA 1Y1WG 1K73C 1SDFA 5G3LD 3Q6SA 1LTID 2EYJA 1L0YB 1YNJD 5LMUQ 5A2QL 1HUMA 4QGUA 1A2UA 2YU9H 1LTLA 2ZT9C 1CQVA 2KEDA 4FO2A 1K83B 3UDFA 4Y7NH 4HR7B 4EX5A 4EQPA 1HNWL 3KJPA 2F52A 1KL9A 1UE6A 3ICEA 3I4MH 2HT1A 1DGSA 4R4CA 1EYGA 1EYDA 5M3FG 3QR8A 4HCSA 3RNUA 1CK1A 3I4NH 5AFWA 3DM3A 1GD7A 1AN8A 2E2HB 3NUCA 3S14H 1M1KC 5CMDA 3CRKC 4YCWA 2N49A 3KDFB 1HZ9A 2H5XA 1BBUA 4RKLA 5C4JB 4M1UB 1AFPA 1A15A 1ML0D 5M5XB 3U9OA 4B3TL 3M4OH 1G6ZA 1WJJA 2UUBL 2R7DA 5IP7G 1EY6A 2F0SA 2BH8A 1HNXQ 5HY6A 3J7A5 4X3TA 5ISRA 2EYLA 1LT6D 2I0QA 2JA6B 4C56C 5AJ3Q 1QCBD 1MJEA 2L5TA 1AZQA 1SN8A 2JYOA 3SK5A 1WD1A 1D7QA 4HJ9A 3HFZB 1A2TA 1VQ5A 4JOIA 4LW1A 1MBYA 5IGGA 3OWFA 4GNXA 4FVMA 4A3JH 3K5MA 5M5YB 3MFYA 3PIP3 3S1RB 5C4XH 3UDIA 2KHSA 3R2IA 3T4AC 1K8MA 5LL6S 1PH9A 2IW3A 1D5ZC 1PFSA 4DA2A 5C0XG 2JQOA 2JE6I 3PF5A 3AFPA 4A3BB 5C4ZA 3G48A 2IX0A 1A62A 3I56A 1NJIC 3P75A 2DNEA 1WTVA 1EY4A 4LF5L 2GA4B 2NN6G 3AFQA 4B3MQ 2KCCA 5COYA 3MXUA 3I4MG 3MXNA 3GTGH 4YY3Q 1LACA 3I4NG 1ASYA 4FF4A 1Y14B 1EQTA 2GN5A 2ZTDA 2R92H 4HJ8A 2ALYB 2B2WA 1GOZA 4JI5Q 1GUGA 5BN5A 1E1OA 5J39A 1G6PA 4RKBA 1Y1VH 3JAMc 3GTOH 1XNRQ 1X54A 5FLXL 1WVLA 1ZYRD 1D5MC 2JP1A 4GOPA 5D3DA 1YJWA 5LMNW 2K5VA 4AYBB 1GHJA 3GTMB 5C3WA 3MHBA 4J15A 3FP9A 1TWCH 5ELBA 1STNA 4GKJQ 3SGIA 1S72A 1J5EL 4HIMA 4JI6Q 2RHSB 2FFKB 2CWAA 4OO1H 5T1IA 1F9SA 1ONLA 4LJZC 1D6EC 1UE7A 3TSSA 2UU9L 1IL2A 1EU4A 4POGA 4ZKBB 4A3JG 1VQLA 1SNCA 3J81i 2WAQE 2F3VA 4A3FG 4JI0L 4L63B 3QG1A 4DR2Q 1IBMQ 5C4XG 1PH7A 3IFDA 4BWGB 2XRSD 2E5LL 1ESFA 1MKHA 1R4PB 4QQBX 1M8AA 5GAEC 3ERSX 1IXRA 1XMOQ 4DR1Q 4DK1A 1MIUA 1ZEQX 3I4OA 1PH4A 1HR0W 1Q8IA 2QCPX 3SHLA 1PH3A 3LWUA 4ZQ3A 1R9TH 4NXNQ 2K1BA 2UUCQ 4AQYQ 2IT1A 1B3AA 2QILA 1L0XB 1LTRD 2WINB 3N52A 4DV4L 4DK6C 1JOQA 1PRTB 3TDQA 1YHBA 3Q8DA 3E0JA 4DUYQ 2KCNA 4DN4M 3D3RA 1SNMA 3RMHA 4A3GG 1STHA 2J0TD 4ALPA 2R92G 2HUGA 2LFNA 3KYHC 1PV4A 1TWAB 2RF4A 3PIO3 5D14A 3J81L 3HOUH 4DXFA 2E75C 3QOLA 3S16B 4O0AA 3L7ZC 4POFA 3Q0AA 2VB3X 2VB2X 1GXDC 4TKOB 1FGUA 2YTXA 2AQ1B 1EIYB 1HFGA 2QKIC 3NBHB 3OMCA 1KXLA 1C4QA 4IZ8A 4PG3A 3D6WA 1PZKD 5IGEA 4O1NA 4BY1G 1EIGA 1N8RC 5C0XI 3JAME 4IQZA 4PV1C 4ID6A 3CCVA 4IOAA 4DAVA 1SFOB 4OO1G 5EBCA 2CVRA 1VQNA 1BQQT 2HCIA 3ND9A 2NN6I 3H09A 2EY2A 1P8LA 2IHEA 2Q8TA 1EZ8A 1CFMA 1QZGA 2F0PA 2RDHA 1VQ9A 5GROA 3OSOA 2GVBA 3CU7A 5C0XJ 1LABA 4X62Q 1Q86C 2MO1A 2Z1CA 2R7ZG 4NXMQ 1HNZQ 4KK7A 2VQFQ 1CSPA 5IIFA 1Y1WB 3KLRA 1TXYA 3CCQA 2EXDA 1QWYA 5ELOA 1E2VA 3K6OA 5KIXA 2NVTH 2F03A 3PO3H 4FNFA 1DD2A 3T1YQ 2RA4A 4OGQC 3SK4A 1HPCA 4KJNA 2YV5A 5DM63 3EA6A 4QIWE 1CKNA 1FR3A 1TU2B 1N33Q 2BDNA 4WJ4A 1I4RA 2DGYA 3CW2C 3I72A 4IPCA 4HMJA 5M3FB 1LTTD 5M5WH 2E2IH 1STBA 4XQJA 3S1MB 2CQAA 2AWNA 2I5LX 2Z4IA 4A3MB 3HOUG 1Q1EA 1Z9FA 4RGOS 3HOZH 3HOVH 2NTSA 4EQOA 4LFAQ 5IYDH 2QW7A 2OXPA 5ELCA 1X3GA 2NZOA 3H3VH 1W3SA 4QL5A 1U4PA 1I4QA 3K59A 3F1ZA 1JQYD 4WRDA 2IL8A 4UP7A 2PCFB 2CCZA 4DR7Q 4HN7A 3EBEA 3OYYA 3S2DH 2WIIB 2RSNA 1FD7D 4DR6Q 1N32Q 2LY7A 4H0LC 3VR4A 3SVMA 1GJXA 1ILPA 2E76C 4X66Q 4FYDA 4BY7B 3EIVA 3HGBA 3DXJC 1UNSA 4RCOA 1XNQQ 4LMQD 4R1JA 3GTJH 1TWHB 2JA9A 5G3LF 5LL6X 3TBIB 1IKMA 2KECA 5D3IB 5K36G 5JJLA 1WCMH 1TVXA 1I4HA 4H02A 2B2YA 1VMPA 1I4XA 4HEDA 3H15A 3L3OC 4MZ9A 3WWVA 4NB3A 3E0EA 1KIXA 1STYA 3K7UC 4FDBA 3PO3G 1X3QA 4QUFA 3S2HH 5EQ0A 1TS4A 2JEAI 2YU9B 3QJYA 3DM1A 4GLVB 3OMGA 1SROA 4Y7NB 4NPSA 1CKMA 4DAYB 2VUMH 2EJFC 4TVAB 3GTPH 4DV6Q 1SYGA 1RL2A 3CMEA 1II3A 2QGQA 3UDXA 1Q82C 3TN2A 3I4MB 2I5MX 3R93A 1IYVA 2MQHA 1XPRA 2WP8J 1A3UA 1QE6A 3I4NB 5LHY1 5A2QE 2JK8A 2HDMA 2HQLA 3PV0A 2F0LA 2B3GA 2Z6KA 3JAMi 2ZJRA 4QY7A 1DONA 1BDOA 2A73B 2Q2UA 3K5LA 4DKAC 1TS2A 2V1CC 3HOZG 1Z7TA 3SR1A 4X65L 3M4OB 4JI8Q 4HSVA 1VQMA 3VA7A 1BCPC 2VQEL 1L1OA 2KVMA 1GUSA 4DAPA 5FLXc 4ME3A 3FEWX 2UXBL 3SXHA 2B2TC 4JV5Q 1PH1A 1HTPA 4PZ7A 1L0WA 1F2MA 4H13C 3NPPA 1I5FA 5E7NA 1D2BA 3UE0A 1O7ZA 5I2XA 4ZAIA 3EN2A 5I9PA 3HKZE 3NTKA 1YZ6A 4A3JB 2Q8IB 5FJ8G 4LFBQ 4RAUC 2KJXA 3S9WA 4XT3B 1D5XC 4IFDH 2XSCA 1F2ZA 5C4XB 3D31A 3FKIH 3J81j 3HOXH 2K01A 3GTKH 3V2TA 3F2BA 1B50A 3R8BA 2K33A 3F2DA 3CCUA 3BS1A 1PYSB 1SMYC 2L12A 4IUQA 4B3RL 4P75A 4KV6A 4Q5VA 1KLUD 1VQBA 2PMZE 3CCEA 2VNUD 2VUMG 4PZ8A 1GVPA 3RZDH 1G291 2EZVA 1WYDA 5CC4A 3LGJA 4A3LH 4KHPQ 1CQFA 3K58A 4G7OC 2OCEA 4A3IH 1KD1C 3GTGB 2VZAA 3BVMA 4A3GB 2ICEC 2VY3A 1VQPA 2CQOA 1HNXL 4DAMA 2R92B 3ERQA 3C2PA 1YIJA 1YITA 4UPAA 1G2TA 1CKOA 1GO3E 1BCPD 5AJ3L 2YTVA 4ZRZA 1FJGQ 3VYUA 5EPKA 3MXPA 1Y1VB 3GTOB 1NR4A 1YBYA 2PW7A 3J81c 4OL7A 4KKUA 1KNAA 3HS0C 3NXWA 4GNXB 1WFQA 2FMMA 4RWSC 2UUAQ 4CJ1B 3DEOA 3P1HA 3KF8A 4ME5A 1FNUA 1TWCB 3SK6A 2ES2A 4F88A 4K5VA 4PZ6A 2PI2E 3HEJA 2L4NA 1YNJC 5IOCA 4LF8L 3P7JA 5IWAL 5FLXE 3A54A 3W1GA 3MA2B 2TMPA 3KLSX 5L37A 4K6LA 4BXXH 1I6HH 5CV7A 2ID0A 5IODA 1BXTA 3FKIG 1U9RA 1SMYD 1UEAB 4B3ML 4PNYA 3KOJA 1EFWA 4DAYA 3MXNB 1S3OA 2EIFA 2VS1A 3K81C 3BVZA 2BE5D 1EY9A 3FPUB 1N34Q 5DNFA 1PH8A 1JC7A 4MNOA 3CP0A 1R9TB 3GQBA 3S17H 4JI5L 1JOOA 4C2MH 3E6ZX 1F2LA 4OWTB 1N36Q 2N55A 4LF7L 4I7ZC 2OT2A 2WV6D 4A3LG 1XNRL 3WOFA 1H95A 2CKZB 3WOEA 2F0GA 4DR5Q 5GAHC 3T13A 2F0NA 1BO0A 2K75A 1RJTA 1Y8PB 1PYWD 5C44H 4C3HH 4LF9Q 3W3AA 1PH6A 3K7AH 4HCEA 3HOUB 2L55A 1VMCA 1SE8A 2RHQB 4QCLA 1JCKB 3I55A 3G7LA 3MTSA 1T5XD 1VQKA 2RBMA 3M3YH 1BOSA 5JPNC 4FF1A 1NNXA 1SJED 2Q2HA 2RCFA 1V1OA 1WOCA 1NTGA 2F0DA 5K5PA 4HIOA 4JYAL 4EQNA 4DR2L 1VQIA 3J81E 4KY6A 5LMNQ 1KQSA 2BH2A 5I9OA 4ZKCB 4QIWB 2N3SA 4OX9Q 4X64L 1PTOC 5IYBH 2VW9A 4DR1L 4R8NA 2OTLA 2EY5A 1WTXA 3TP6A 3T1HQ 5JEAG 1LTAD 4B08A 4NXNL 1JB3A 2BA1A 4AQYL 1SEBD 1QB5D 5FLMG 4JI3Q 1PH2A 4A3MG 1VQAA 2ZTCA 1Y8OB 1DJRD 2BCOA 1RODA 3CCLA 2A74C 2X6GA 1VQ4A 3AMUA 2K14A 4GKKQ 1X3FA 3PO3B 1IBKQ 1XTCD 3HOWH 2F0OA 1I4GA 2L15A 2IX3A 1Z47A 2R61A 1X6OA 4CDFC 1HR0Q 3GD7A 1V1PA 2EE1A 1ZYRC 3UI2A 3IKJA 4Q0FA 2DY7A 4N8FA 4O42A 3NQIA 5IT9L 4BBSH 5M5WB 2RSOA 4ZCKA 5CBEE 3K5OA 2M2LA 1XXGA 2E2IB 5C44G 4C3HG 4IPHA 4CDDC 4JI1L 1HRJA 4KN7C 4BY7G 1S5CD 3H0GH 1AH9A 2IJ0A 3HOZB 1SJHD 3NEMA 1Q7YC 4H44C 3DEPA 1CZWA 3DLLA 4JI4Q 1SE3A 1DCZA 1SE4A 4XQQA 5M3MH 2E8GA 5JOBA 3CC4A 1O7IA 4ODGA 3BYTB 4JBJA 4R4QA 1R4QB 4QF4A 4U673 5NUCA 3F2CA 1PTOD 3CRLC 3I90A 3J80i 1PH5A 1JJ2A 4X62L 2NTTA 1I94Q 2NVXH 2C35B 3S2DB 2HHHQ 1HNZL 2PQEA 4DV2L 1E2WA 5J3BA 4CBVA 1XMQQ 2VQFL 3MZ5A 1QZHA 1D1IA 4KJOA 3BG3A 2PQAA 1G8ZD 1NUCA 3PO2H 1E2ZA 1KRTA 3T1YL 2D5DA 2KCMA 3GTJB 4F7XA 4XT1B 2L0CA 4DF7A 1CKNB 2HDLA 4DV3Q 1WCMB 3ONAB 3AU7A 3VR6A 2D2CC 5C6AA 2NZ1D 4FF3A 1VF5C 2SNMA 4C3IH 3ER0A 1CA6A 1C9OA 4L5QA 3S15H 3S2HB 2ZJPA 3M85A 3HOWG 4NP5A 3TS2A 2PZWA 2VUMB 3URYA 3GTPB 1KABA 1H9RA 1J6QA 3CKIB 3J7YW 4LFAL 4R9WA 1G91A 3J80L 3BDCA 4N9PA 4BBSG 1HZAA 4DR4Q 3I7FA 4JI2Q 4BA2I 4JPBW 4IPGA 1KC8C 2E2JH 3UE1A 4JI7Q 3H0GG 1KTKA 4DV7L 4O2DA 1UUPA 2KHIA 4AIMA 4LFCQ 4DR7L 4XYOA 2N8NA 1Q12A 1UE1A 1O7YA 1HZCA 4JW0A 4YIJA 4LUOA 2MO0A 1HUNA 2HQEA 5DM73 1VQ6A 4DR6L 2UXCL 4A4IA 1N32L 5M3MG 3VA5A 3ULLA 2KHJA 1WI5A 2I46A 4CHTB 2ICIA 1J9OA 3M9BA 3TMEA 2EYMA 4JBKA 4A93H 1U4RA 1MSGA 4FF2A 3X3NA 1XNQL 1IW7D 2PMZB 4KKTA 4UP9A 3RR5A 1QNUA 5I2YA 2ZTEA 3IAYA 4J6HA 4HIDA 2KCTA 5EPJA 3ULPA 5JEAJ 1OXUA 1SMXA 4JC0A 1U5KA 3S1NH 2EYFA 3CQZH 4KHZA 2N88A 3FKIB 1DM0B 1B9MA 3PGZA 5KYLA 3HOXB 1AEXA 1RTOA 1S5DD 2R3ZA 2WAQG 4R8IA 2IY5B 4C3JH 1PMRA 2MNAA 4DV6L 3GTKB 4JOIC 3I91A 5KNCA 1NY4A 5JPMC 2Z6BA 1Y1VG 3I70A 3NK9A 4C3IG 4FXKC 1JJGA 3EJIA 2B8FA 1RKNA 3MFGA 4QMGA 1MJCA 2UXDQ 2NWGA 2KOLA 2PZTA 4LUVA 1YNND 4K0KQ 3RZDB 2H1EA 2F3WA 2ZXRA 2OF1A 4A3DH 4KD3A 4LF4Q 1K28A 4B9XA 4JI8L 1L1OB 1Y8NB 4A3IB 1I3QB 5IYCH 1BCPF 3CC7A 1FNWA 2ZM6Q 4LAAA 3K80C 4KY5A 1C7YA 1XWEA 1EUJA 1K3RA 5EKLA 4DR3Q 3KK7A 1D8LA 1YJNA 2J7ZA 2R93H 4EGVA 1IZ6A 4CKCA 3A7LA 3QWNA 1JICA 2K04A 3FDTA 1GUOA 5CV5A 1WTPA 4IUUA 1B4OA 1VQ7A 1GUTA 5FO9B 3PMFA 1LYLA 3T51B 5FO8B 4G7HC 2B2WC 2M00A 3PUXA 3TP7A 1B1ZA 4LFBL 4GN3B 1TWGH 3T56B 4ABNA 2D0OA 1ZKOA 1OXVA 5BN4A 4DU9A 4DNRB 4IJLA 1QVGA 4A75A 3H94A 2JA8H 2L1BA 4LF5Q 4GOPC 3MVVA 5FO7B 1X65A 2K05A 1H9SA 2B2TA 1SR3A 3C46A 3B6YA 3M4QA 4JK1C 3V96A 2K50A 2ASBA 3GTQH 3BDLA 1V8QA 3UDGA 5D65A 3JC66 1KDBA 1HFNA 2E74C 2XN9C 1YHQA 1JMCA 3W5OA 4DV0L 4KHPL 3V05A 2YTYA 2MHVA 3CAMA 2Z4HA 2E2DC 4DGZA 2IWHA 5CBAE 5E4WC 3CC2A 3LX0A 4PQXA 1SNDA 2F0TA 4S3SA 4L8JA 4IPDA 2Z0SA 3S17B 3OIQA 4CJ0B 3BZKA 1TWFH 2HCCA 4RGNA 4C2MB 4DV1Q 4QJFA 1IYUA 4IUNA 4A3DG 1J8IA 1TIID 3HOYH 2B2UC 3W1BA 5ELNA 2Q2IA 1C0AA 3ND8A 1ZXTA 1HA6A 1NBWA 2K32A 4YWMA 1S40A 5IYCG 3PCOB 1HTLD 3KLSA 2F0VA 1J5EQ 3KF8B 5KEEA 2UUAL 1A6XA 1HHVA 2EJGC 3NELA 5C44B 4C3HB 5IT9c 1STEA 5JVH3 2UU9Q 1SYFA 1HQMC 2OEOA 3K8AA 1E7ZA 1B70B 1O7LA 2NYZD 2AQ2B 1E0BA 1VDZA 4RGMA 3OWEB 3M3YB 1X3PA 4WJ3M 3FPPA 4OXPA 3TZUA 2B2VC 1LT4D 2MPMA 3OW2A 1EU3A 2TSSA 1RF2D 4P71A 1UAPA 5CV9A 4Y52H 1RTNA 1ENFA 3OTOL 2C5CA 3CD6A 2ATWA 1C8CA 2K5QA 4QUCA 3QOJA 2DJFC 3MEFA 1EQVA 2EXZA 2JA8G 2QF7A 2CH4A 1TS5A 4DPGA 4KTAA 3BZDB 2SEBD 1O78A 4LUZA 2Z8LA 2F0IA 2Z9HA 1Y69U 4OO1I 3PUVA 2LXJA 1AE2A 1QUQA 2P5ZX 2OQ0A 3S14B 3GV6A 2QA4A 1TY0A 1TY2A 4J8QA 3HOVG 5JJKA 1SYEA 4RGTA 1DYQA 4KLKA 1WTWA 1UE5A 5IYDG 4TSSA 4DR5L 1ENAA 2PI2A 3ZYYX 3HOWB 1EWCA 4DV5Q 4LF9L 1SNQA 3IL8A 3M4YA 4CDCC 3BZCA 2DJGC 5M9OA 4ILWA 3C3LA 2CH4W 4JVZA 1X9NA 1EYCA 4KN4C 1D1KA 3K57A 1FYCA 4FXDA 1PZJD 4BBSB 1EL0A 1LT5D 3RN2A 5BN3A 1LTSD 1ET6A 2I5HA 1PLFA 2ZJQA 3A56A 3J80c 4DNTB 2AKWB 3Q22A 4A76A 3CMAA 5LMUL 1HQRD 3H0GB 3G6JB 4OWXB 1PYBA 1JE4A 4ZLTF 5LMNL 2OTJA 5C3XA 1CHPD 5JVG3 4OX9L 1WCMG 4P2CB 2K03A 3MAQA 5M3MB 1PTOF 5IT9E 1MGSA 5CYUA 2G5DA 3T1HL 3LWEA 3H6MA 4KY7A 4K5WA 1S5FD 4L6TB 1B7YB 3EVQA 4WFN3 1PFMA 3IFTA 2O2LD 4RCNA 1CA5A 1YI2A 2BE5C 4DUZQ 3D6CA 1MSHA 3NTIA 1PHJA 2NVXB 1QOHA 1E22A 5C3EH 1JB7A 5FOBB 5ELDA 2PO4A 3KLWA 4LF6Q 4GKKL 1IBKL 3HKZG 3BDOA 1IL8A 1I50H 4K5XA 1V1PB 1QVFA 3D4RA 1KDCA 5BR8Q 2L11A 2EYHA 2WAQB 4X3UA 1HR0L 1BVSA 3ITPA 4JCVE 1VQOA 3BVGA 2EY1A 2MP1A 1EZ6A 1HJPA 4RA8A 2XWJB 4C3IB 3OPOA 3QO2A 2LKVA 3S15B 1SFOH 4X3KA 2F0UA 2PZUA 5DEHA 4PMWA 3NWTA 4HMIA 5EKIA 4MHEA 1X56A 4DNIA 2K28A 1JWSD 2B2YC 2NVQH 3A7AB 2CWPA 3U9SA 3CPWA 3CHBD 4JI4L 2CW0C 1JORA 3I8ZA 1NE3A 1PRTC 3RZOH 2K5NA 1V43A 1W6JA 4NKLA 3A0JA 4A3CH 2E2JB 2I07B 1WTOA 1HZBA 1Q3LA 3PIOA 5F2DA 4J1MA 2A69C 4OWWB 4IFDG 5FK9C 4XTCS 3D4WA 3CXCA 3W2DA 4JG2A 3HOXG 4A3EH 3GTLH 1EYAA 2HHHL 4CDEC 2D62A 1FGBD 1I4PA 2C9OA 3J80E 4LNQA 2PQAB 2IPKD 4BA1I 4XYQA 2Z6KC 1K8AC 5H1SE 1PDQA 4YY3L 4P73A 1B53A 3VR5A 1IBLQ 4A93B 4L5SA 4HJ7A 4MN3A 1PTOH 1EQQA 2JN4A 1ESRA 3T53B 5J22A 1A3VA 4DV3L 3KBGA 3H3VI 5C3EG 2A6HC 1L1OC 2PW5A 2ZXPA 3OW7A 5EKKA 1HXYD 1VQJA 1BBXC 4A3IG 3BYYB 3HP3A 1F9QA 3S1NB 4IALA 2A8VA 3E9HA 3TREA 3CQZB 2NUCA 1U4LA 5IP7H 2Y0SE 2F0QA 3GP7A 5ELFA 2F0EA 4IO9A 2OWOA 2JA7H 4C3JB 5GADC 1TQOA 2F4VQ 1ET9A 4GKJL 1EY8A 4JI6L 1B9NA 4TQUS 1EEFD 1S5BD 3NQTA 4IURA 1B8AA 4C1NI 4JI2L 2K4KA 1EIFA 1MI2A 1Q1BA 3AEVA 2R7FA 4JI7L 1DXMA 4E6IA 4YHHQ 2CW0D 1CTMA 1PRTD 3S24A 4OELB 1IBML 3OOCA 4LFCL 1T9HA 5C4HA 4A3DB 1KRSA 1DOKA 2K52A 3SDZA 4CKBA 2A69D 5JAVA 1EOVA 5FKAC 5C5MA 1XMOL 2R6GA 1CT1D 2B8GA 3CCJA 4BXXG 3I73A 2RVLA 1YNXA 3TP8A 5C0XH 2FHTA 2Y0SG 3KF6A 2R93B 2AUJD 1B3QA 1NMFA 2XWBB 1Q46A 1V1QA 4A3EG 1SXTA 2B39A 2UUCL 2AUKA 5E3FA 2B63H 4N8X1 3C1EA 1YJ9A 5DLQE 2PNHA 4K6DA 3G6EA 4DK0A 2PYKA 2XRQD 2NN6H 1CUKA 2FMCA 5A35A 1JE5A 4DUYL 4ZK9B 5CORA 3VYSA 1SSOA 2A6HD 4M8AA 2NVTB 3CCRA 1TWGB 3DWQA 1W2BA 4B3RQ 3L0OA 2BA0A 3KUPA 5I6WA 2KA7A 3PUYA 2JA8B 1H9JA 4K8JA 1PFBA 1RIPA 3EFXD 5KYIA 3GTQB 2UXDL 2HD3A 3HG9A 4FP5D 4XXEA 1GUNA 4K0KL 1VQDA 2JA7G 1MD2D 2PNRC 3E5SA 2RDGA 1VQCA 3K0YA 4LF4L 1A8VA 4KKSA 3HOVB 1WTHA 2F0JA 4MTNA 1H9KA 1F2YA 4IFDI 3M7GA 1XJVA 5E1FA 1EY5A 1KNEA 2A5HA 3HRZC 3U58A 1VQEA 2ZM6L 2QDBA 4GZYC 2HIVA 1TR5A 2X6LA 4DR3L 2M9VA 1E1TA 3E9IA 3RLNA 4OHJA 1TWFB 2IX1A 4NDXA 3NWSA 4ZUJA 1VQ8A 4R4OA 1XPOA 4RFBA 3HOYB 2KEEA 3AYHB 2EYOA 4A3FH 1W6KA 2F0WA 4NXML 4P74A 2JSOA 3DMUA 1IW7C 5IYBG 2F0KA 4IFDJ 3VYRA 4LF8Q 1CHQD 2FJ2A 5IWAQ 2QDLA 1M90C 1BCPB 3FVQA 3D0FA 1SE2A 1BBWA 3KBXA 4N9TA 4EQ5A 3MEHA 3DWPA 3K0XA 1LLRD 2B63G 4AH6A 4B3SQ 1H9SB 1GM5A 3Q23A 2WB1E 1OXTA 3X3MA 1N33L 3TRZA 4C1NK 3GO5A 1U4MA 4UY8C 5J1ZA 3NSWA 3RLOA 3L9AX 3E3XA 3R3OA 1TT2A 1VQFA 4A3GH 2A19A 3FRPB 3CF5A 3NTHA 3M4PA 3A8JE 3RLFA 1YNNC 4ZUIA 3DHQA 3LNNA 1YHAA 4V0BA 1OTCA 2O5IC 4LF7Q 2SOBA 4QB4A 2F0HA 1JJCB 3HKZB 3P20A 2NVYH 4ZYSA 5CGKA 1BUVT 4DV1L 1RDPD 5GQOA 4JBMA 4B9WA 2K5WA 4BBRH 5CV8A 4BY1H 4HAEA 1E3PA 2Q8RE 4HTHA 1IYJB 3PF4A 2CFMA 2WB1G 1SYDA 4H7BA 4UP8A 1SLJA 2GVAA 2QEXA 1EFID 1EQRA 1S4ZA 4X66L 1JWUD 2XVSA 4JYAQ 1MHWC 4PMCA 1X3EA 3NP8A 2K5HA 5IE8A 3M7NA 3MWYW 4RHSA 2X69A 4XIGS 1F9RA 4U68A 1IKLA 1HNWQ 3SE0A 2R7ZH 1SYBA 1AW7A 3CPFA 4X64Q 1LTGD 2B2UA 1ASZA 2J4XA 3PO2G 1OO9B 3D4DA 3MXGA 4OONA 4V190 1EWHA 3S1QH 4CJ2C 3J7AV 4Z9CB 3VYTA 3BJUA 1Q90A 4LWCA 1PVOA 4XQNA 5HGTA 2WKCA 2AQ3B 4F8MA 1GHKA 4GNXC 5C5LA 2D0PA 2PPBC 1QUQB 3A8IE 2B29A 3KDFA 2A1AA 1AE3A 4IUTA 4B3TQ 1F77A 2AHOB 2UUBQ 1DOLA 2JA5H 4RMFA 2B2VA 5C3EB 4JBWA 3ZJYC 3Q24A 2MJ8A 2WFWA 3AQQA 3R2TA 5IGBA 1EOTA 1FVIA 5GAGC 4A3KH 2ZXOA 1OXXK 4WJWA 1QNKA 1I50B 4DV5L 1K0RA 1T5EA 1PXUA 1RCVD 1BKBA 2F0FA 3J7AF 1SYCA 4L5TA 4HJAA 1XX8A 2V4DA 4BBRG 4JV5L 2RCNA 1WTQA 1FNVA 4JI1Q 2EJMA 1ICWA 5IGDA 1EWIA 1EEID 4K2LA 1QILA 4GS3A 5HURA 3A55A 4IOCA 1K83H 3CCSA 1K8OA 1PA6A 4G57A 3GV3A 5IGFA 4A93G 1O80A 2K6AA 2D9UA 4RG1A 2O5JC 2NVQB 5IGCA 1HCZA 3K5NA 4P72A 3VDYA 2RQXA 3DWAA 4GN5A 1BR9A 4F87A 2E2HH 3RZOB 1JOKA 3I2ZA 5K36H 2IHFA 4DV2Q 5C4JH 1I6HB 2KENA 5M5XH 2F0MA 4KHVA 4KI0A 2Y0SB 2HIXA 4L5RC 1AZPA 4LK1C 4DUZL 4A3EB 3GTLB 2DY8A 4GLXA 4C3JG 2JJQA 3N6RA 1NAPA 1NR2A 1ENCA 2JA6H 4LF6L 1HH2P 3FMCA 2LXKA 3O13A 1K8GA 1PTOB 2RDFA 1DOMA 5BR8L 2JA5G 4I7AA 1XYIA 2EY6A 1FJGL 4I65A 2QEJC 4MIUA 1WTRA 5M5YH 5KNDA 3FHWA 1QG7A 2F4IA 3EROA 4A3KG 3S1RH 1S5ED 1IHZA 3TQYA 2EYPA 1KAAA 2JA7B 1BF4A 5KRUA 3K7AB 2Q2TA 3L2PA 2ENBA 2R93G 1XTDA 3KJOA 1QVCA 3EQLC 1PFNA 4A3BH 4CKEA 1CSQA 4JI0Q 4DV7Q 2OQKA 1PRTF 5CR3A 4G7ZC 2E5LQ 2UXCQ 4G4KA 3TEHB 1Z6HA 4CGYB
chains in the Genus database with same CATH topology
3C1FA 2XIWA 5I6YA 2YYZA 1GUWA 2VXWA 1SBBB 1OXSC 1F9PA 4KMUC 3VR2A 2JEBI 4K8IA 2SNSA 4DXGA 2L9HA 5CV4A 2JXMB 3NBIA 5I4DA 3AB9A 1X32A 2B63B 3F2UA 4NMZA 3H3VC 3RD4A 3D8GA 1SAPA 4OIKA 1CI3M 1WD0A 3PUZA 2MUYA 2WACA 3QB3A 4TRDA 4RH6A 5JJZA 3NBHA 2AWOA 2LMCB 2KQ3A 5T1GA 4WORA 1EIHA 3QIAA 2EVBA 4OIJA 4DFAA 2EPBA 4PMBA 1EY0A 1PZID 2WB1B 1H9MA 1HA5A 1CZGA 1A3TA 1B44D 2O4XA 3OIPA 5TSSA 1LTBD 1KLGD 2MGSA 4A3FB 4K2KA 4IN3A 1LO5D 5EBDA 1CM9A 5KGUA 3JAML 2XNAC 2K5DA 5KNBA 3PO2B 4UDUC 3DUZA 1VCIA 5ELEA 2A6EC 3NHHA 2DN8A 2NB0A 2KUMA 1NCVA 1DZ1A 1RD9D 2EOTA 1RHPA 3A8KE 4UAIA 4IUPA 4X3SA 3T16A 1TS3A 2A68C 2G9DA 2H4OA 3HZXA 3TP5A 5EGTA 1SNOA 2RKSA 4BS9A 1M4VA 4ULLA 1G2SA 2NVYB 3SEBA 3TZDA 1KDAA 1QJOA 3RUZA 2F1MA 5DAUA 2DNCA 2FINB 1ILQA 2G9HD 4BBRB 2K7VA 4BY1B 5EPLA 1STGA 2EDGA 1VF7A 3PUWA 3VR3A 1JWMD 3OHXC 1JR0D 3SK8A 1STAA 5JEAH 4XDXA 4HSPA 1NSNS 4KD4A 1I6VC 2R7ZB 2LS01 3I4LA 2A6ED 4FXGC 4NW2A 5EJWA 3WDNA 2SDFA 1LT3D 2NBFA 3S1QB 1AP0A 1BNZA 3H91A 5E4XA 4K14A 2A68D 4IUVA 1EY7A 2CHBD 4RHRA 5CV6A 2BDOA 2JA5B 1C48A 1B2TA 2BOSA 3NE5B 4EVOA 1TKWB 4A3KB 1SNPA 3I3CA 2WKDA 1LV9A 3MC0B 1SDFA 5G3LD 3Q6SA 1LTID 2EYJA 1L0YB 1YNJD 5A2QL 1HUMA 1A2UA 2ZT9C 1CQVA 2KEDA 4FO2A 1K83B 4HR7B 4EQPA 1EYDA 4HCSA 1CK1A 5AFWA 1AN8A 2E2HB 3NUCA 5CMDA 3CRKC 4RKLA 5C4JB 4M1UB 1AFPA 1A15A 1ML0D 5M5XB 3U9OA 1G6ZA 1EY6A 2F0SA 4X3TA 5ISRA 2EYLA 1LT6D 2JA6B 4C56C 1QCBD 2L5TA 1AZQA 2JYOA 3SK5A 1WD1A 1A2TA 1MBYA 5IGGA 3OWFA 4FVMA 3K5MA 5M5YB 3MFYA 3PIP3 3S1RB 2KHSA 3R2IA 3T4AC 1K8MA 5LL6S 2IW3A 1D5ZC 4DA2A 5C0XG 2JE6I 4A3BB 5C4ZA 2IX0A 3P75A 2DNEA 1WTVA 1EY4A 2GA4B 2NN6G 2KCCA 5COYA 3MXUA 3MXNA 1LACA 4FF4A 1EQTA 2B2WA 1GOZA 1GUGA 5BN5A 5J39A 4RKBA 5FLXL 1WVLA 1ZYRD 1D5MC 2JP1A 5D3DA 4AYBB 1GHJA 3GTMB 5C3WA 3MHBA 5ELBA 1STNA 2FFKB 4OO1H 5T1IA 1F9SA 1ONLA 4LJZC 1D6EC 3TSSA 1EU4A 4ZKBB 1SNCA 2F3VA 4L63B 3QG1A 3IFDA 4BWGB 2XRSD 1ESFA 1R4PB 1M8AA 4DK1A 1ZEQX 1Q8IA 2QCPX 3SHLA 3LWUA 4ZQ3A 2K1BA 2IT1A 1B3AA 2QILA 1L0XB 1LTRD 2WINB 3N52A 1JOQA 1PRTB 3TDQA 3E0JA 2KCNA 4DN4M 3D3RA 1SNMA 3RMHA 1STHA 2J0TD 2HUGA 2LFNA 1TWAB 3PIO3 5D14A 3J81L 4DXFA 2E75C 3QOLA 3S16B 3L7ZC 3Q0AA 2VB3X 2VB2X 1GXDC 4TKOB 2AQ1B 1HFGA 2QKIC 3OMCA 1C4QA 4IZ8A 3D6WA 1PZKD 5IGEA 4O1NA 1EIGA 5C0XI 3JAME 4IQZA 4PV1C 4ID6A 4DAVA 1SFOB 4OO1G 5EBCA 2CVRA 1BQQT 2HCIA 3ND9A 2NN6I 3H09A 2EY2A 2Q8TA 1EZ8A 1CFMA 2F0PA 2RDHA 3OSOA 3CU7A 5C0XJ 1LABA 2Z1CA 4KK7A 5IIFA 1Y1WB 3KLRA 1QWYA 5KIXA 1E2VA 3K6OA 2F03A 4FNFA 1DD2A 2RA4A 4OGQC 3SK4A 1HPCA 4KJNA 5DM63 3EA6A 1FR3A 1TU2B 2BDNA 1I4RA 3I72A 4HMJA 5M3FB 1LTTD 1STBA 4XQJA 3S1MB 2CQAA 2AWNA 2Z4IA 4A3MB 1Q1EA 4RGOS 2NTSA 4EQOA 2OXPA 5ELCA 1U4PA 1I4QA 3K59A 1JQYD 4WRDA 2IL8A 2PCFB 4HN7A 2WIIB 2RSNA 1FD7D 2LY7A 4H0LC 3VR4A 3SVMA 1GJXA 1ILPA 2E76C 4FYDA 4BY7B 3HGBA 3DXJC 1UNSA 4RCOA 4LMQD 1TWHB 5LL6X 5G3LF 3TBIB 1IKMA 5D3IB 2KECA 5K36G 1TVXA 1I4HA 2B2YA 1VMPA 1I4XA 4HEDA 3L3OC 1STYA 1X3QA 4QUFA 5EQ0A 1TS4A 2JEAI 2YU9B 3QJYA 3DM1A 3OMGA 4Y7NB 2EJFC 1SYGA 1II3A 3TN2A 3I4MB 3R93A 1IYVA 2WP8J 1A3UA 1QE6A 3I4NB 5LHY1 5A2QE 2HDMA 3PV0A 2F0LA 1DONA 1BDOA 2A73B 3K5LA 1TS2A 1Z7TA 3SR1A 3M4OB 4HSVA 3VA7A 1BCPC 2KVMA 1GUSA 4DAPA 3FEWX 3SXHA 2B2TC 1HTPA 1F2MA 4H13C 3NPPA 1D2BA 1O7ZA 5I2XA 4ZAIA 5I9PA 3NTKA 4A3JB 2Q8IB 4RAUC 2KJXA 3S9WA 4XT3B 1D5XC 4IFDH 2XSCA 1F2ZA 5C4XB 3D31A 2K01A 3V2TA 1B50A 3R8BA 2K33A 3BS1A 1SMYC 2L12A 4IUQA 4KV6A 4Q5VA 1KLUD 2VNUD 1G291 2EZVA 5CC4A 1CQFA 3K58A 4G7OC 3GTGB 3BVMA 4A3GB 2ICEC 2R92B 3ERQA 3C2PA 1G2TA 1BCPD 4ZRZA 3VYUA 5EPKA 3MXPA 1Y1VB 3GTOB 1NR4A 2PW7A 4OL7A 4KKUA 1KNAA 3HS0C 3NXWA 2FMMA 4RWSC 4CJ1B 3DEOA 3P1HA 3KF8A 4ME5A 1FNUA 1TWCB 3SK6A 4F88A 4K5VA 3HEJA 2L4NA 1YNJC 5IOCA 3P7JA 5FLXE 3A54A 3MA2B 2TMPA 3KLSX 4K6LA 5CV7A 2ID0A 5IODA 1BXTA 1U9RA 1SMYD 1UEAB 4PNYA 4DAYA 3BVZA 2BE5D 1EY9A 3FPUB 5DNFA 1JC7A 1R9TB 3GQBA 1JOOA 3E6ZX 1F2LA 2N55A 4I7ZC 2OT2A 2WV6D 3WOFA 3WOEA 2F0GA 3T13A 2F0NA 1BO0A 1RJTA 1Y8PB 1PYWD 3W3AA 4HCEA 3HOUB 2L55A 1VMCA 4QCLA 1JCKB 3G7LA 3MTSA 1T5XD 2RBMA 1BOSA 5JPNC 4FF1A 1SJED 1V1OA 2F0DA 5K5PA 4EQNA 3J81E 4KY6A 5I9OA 4ZKCB 4QIWB 1PTOC 4R8NA 2EY5A 1WTXA 3TP6A 5JEAG 1LTAD 4B08A 1JB3A 2BA1A 1SEBD 1QB5D 1Y8OB 1DJRD 2BCOA 1RODA 2A74C 2X6GA 3AMUA 3PO3B 1XTCD 2F0OA 1I4GA 2IX3A 1Z47A 2R61A 3GD7A 1V1PA 2EE1A 1ZYRC 3UI2A 3IKJA 4Q0FA 2DY7A 4O42A 3NQIA 5IT9L 5M5WB 2RSOA 5CBEE 3K5OA 2M2LA 1XXGA 2E2IB 4C3HG 1HRJA 4KN7C 1S5CD 2IJ0A 3HOZB 1SJHD 4H44C 3DEPA 1CZWA 1SE3A 1DCZA 1SE4A 4XQQA 5JOBA 4ODGA 3BYTB 1R4QB 4QF4A 4U673 5NUCA 1PTOD 3CRLC 3I90A 2NTTA 3S2DB 2PQEA 1E2WA 4CBVA 3MZ5A 1D1IA 4KJOA 3BG3A 1G8ZD 1NUCA 1E2ZA 2D5DA 3GTJB 4F7XA 4XT1B 2L0CA 4DF7A 2HDLA 1WCMB 3ONAB 3AU7A 3VR6A 2D2CC 5C6AA 2NZ1D 4FF3A 1VF5C 2SNMA 1CA6A 3S2HB 3M85A 4NP5A 2PZWA 2VUMB 3URYA 3GTPB 1KABA 1H9RA 3CKIB 3J7YW 4R9WA 1G91A 3J80L 3BDCA 4N9PA 4BA2I 1KTKA 1UUPA 4XYOA 1Q12A 1O7YA 4YIJA 1HUNA 2HQEA 5DM73 3VA5A 2I46A 4CHTB 2ICIA 1J9OA 3TMEA 2EYMA 1U4RA 1MSGA 4FF2A 3X3NA 1IW7D 2PMZB 4KKTA 1QNUA 5I2YA 3IAYA 4J6HA 5EPJA 5JEAJ 1OXUA 2EYFA 4KHZA 2N88A 3FKIB 1DM0B 1B9MA 5KYLA 3HOXB 1AEXA 1S5DD 1RTOA 2R3ZA 4R8IA 1PMRA 3GTKB 3I91A 5KNCA 5JPMC 3NK9A 3I70A 4C3IG 4FXKC 3EJIA 2B8FA 1RKNA 3MFGA 4QMGA 2NWGA 2KOLA 2PZTA 1YNND 3RZDB 2H1EA 2F3WA 2ZXRA 2OF1A 4KD3A 4B9XA 1Y8NB 4A3IB 1I3QB 1BCPF 1FNWA 4LAAA 4KY5A 1XWEA 5EKLA 3KK7A 2J7ZA 4EGVA 4CKCA 3A7LA 3QWNA 1JICA 2K04A 3FDTA 1GUOA 5CV5A 1WTPA 4IUUA 1B4OA 1GUTA 5FO9B 3PMFA 3T51B 5FO8B 4G7HC 2B2WC 2M00A 3PUXA 3TP7A 1B1ZA 3T56B 4ABNA 1ZKOA 1OXVA 5BN4A 4DU9A 4DNRB 3H94A 2L1BA 3MVVA 5FO7B 2K05A 1H9SA 2B2TA 3C46A 4JK1C 3V96A 3BDLA 1V8QA 5D65A 1HFNA 1KDBA 2E74C 2XN9C 3V05A 2MHVA 4DGZA 2Z4HA 2E2DC 2IWHA 5CBAE 5E4WC 3LX0A 4PQXA 1SNDA 2F0TA 4S3SA 4L8JA 3S17B 3OIQA 4CJ0B 4C2MB 2HCCA 4RGNA 1IYUA 4IUNA 1J8IA 1TIID 2B2UC 3ND8A 1ZXTA 1HA6A 2K32A 1HTLD 3KLSA 2F0VA 5KEEA 1A6XA 1HHVA 2EJGC 5C44B 4C3HB 1STEA 5JVH3 1SYFA 1HQMC 2OEOA 1O7LA 2NYZD 2AQ2B 1E0BA 1VDZA 4RGMA 3OWEB 3M3YB 1X3PA 3FPPA 3TZUA 2B2VC 1LT4D 2MPMA 1EU3A 2TSSA 1RF2D 1UAPA 5CV9A 1RTNA 1ENFA 2C5CA 1C8CA 2K5QA 4QUCA 3QOJA 1EQVA 2EXZA 2QF7A 1TS5A 4KTAA 3BZDB 2SEBD 1O78A 2Z8LA 2F0IA 1Y69U 4OO1I 3PUVA 3S14B 3GV6A 1TY0A 1TY2A 4J8QA 1SYEA 4RGTA 1DYQA 1WTWA 4TSSA 1ENAA 3ZYYX 3HOWB 1EWCA 1SNQA 3IL8A 3M4YA 5M9OA 4ILWA 3C3LA 1EYCA 4KN4C 1D1KA 3K57A 1FYCA 4FXDA 1PZJD 4BBSB 1EL0A 1LT5D 5BN3A 1LTSD 1ET6A 1PLFA 3A56A 4DNTB 3Q22A 1HQRD 3H0GB 3G6JB 1JE4A 4ZLTF 5C3XA 1CHPD 5JVG3 4P2CB 2K03A 3MAQA 5M3MB 1PTOF 5IT9E 1MGSA 5CYUA 3LWEA 3H6MA 4KY7A 4K5WA 1S5FD 4L6TB 3EVQA 4WFN3 1PFMA 3IFTA 2O2LD 4RCNA 1CA5A 2BE5C 3D6CA 1MSHA 3NTIA 2NVXB 1QOHA 5FOBB 5ELDA 2PO4A 3BDOA 1IL8A 4K5XA 1V1PB 3D4RA 1KDCA 2L11A 2EYHA 2WAQB 4X3UA 3ITPA 3BVGA 2EY1A 2MP1A 1EZ6A 4RA8A 2XWJB 4C3IB 3OPOA 3QO2A 2LKVA 3S15B 4X3KA 2F0UA 2PZUA 5DEHA 4PMWA 3NWTA 4HMIA 5EKIA 4MHEA 2K28A 1JWSD 2B2YC 3A7AB 3U9SA 3CHBD 2CW0C 1JORA 3I8ZA 1PRTC 1V43A 1W6JA 4NKLA 2E2JB 2I07B 1WTOA 1Q3LA 5F2DA 4J1MA 2A69C 4IFDG 5FK9C 4XTCS 3D4WA 3W2DA 1EYAA 2D62A 1FGBD 1I4PA 2C9OA 3J80E 2IPKD 4BA1I 4XYQA 1PDQA 4A93B 1B53A 3VR5A 4MN3A 1PTOH 1ESRA 3T53B 5J22A 1A3VA 3KBGA 2A6HC 2PW5A 2ZXPA 3OW7A 5EKKA 1HXYD 1BBXC 3BYYB 3HP3A 1F9QA 3S1NB 4IALA 3CQZB 2NUCA 1U4LA 2F0QA 3GP7A 5ELFA 2F0EA 4C3JB 1TQOA 1ET9A 1EY8A 1B9NA 4TQUS 1EEFD 1S5BD 3NQTA 4IURA 4C1NI 1MI2A 1Q1BA 1DXMA 4E6IA 2CW0D 1CTMA 1PRTD 3OOCA 4A3DB 5C4HA 1DOKA 3SDZA 4CKBA 2A69D 5JAVA 5FKAC 5C5MA 2R6GA 1CT1D 2B8GA 3I73A 2RVLA 3TP8A 5C0XH 2FHTA 2R93B 2AUJD 2XWBB 1SXTA 2B39A 2AUKA 5E3FA 3C1EA 4K6DA 4DK0A 2PYKA 2XRQD 2NN6H 2FMCA 5A35A 4ZK9B 5CORA 3VYSA 1SSOA 2A6HD 4M8AA 2NVTB 1TWGB 3DWQA 2BA0A 3KUPA 5I6WA 2KA7A 3PUYA 2JA8B 1H9JA 4K8JA 1PFBA 3EFXD 5KYIA 3GTQB 3HG9A 4FP5D 4XXEA 1GUNA 1MD2D 2PNRC 3E5SA 2RDGA 3K0YA 4KKSA 3HOVB 2F0JA 1H9KA 1F2YA 4IFDI 3M7GA 5E1FA 1EY5A 1KNEA 2A5HA 3HRZC 2QDBA 4GZYC 1TR5A 2X6LA 2M9VA 4OHJA 1TWFB 2IX1A 4NDXA 3NWSA 4ZUJA 4RFBA 3HOYB 2KEEA 2EYOA 1W6KA 2F0WA 2JSOA 3DMUA 1IW7C 2F0KA 4IFDJ 3VYRA 1CHQD 2FJ2A 1BCPB 3FVQA 1SE2A 3KBXA 4N9TA 3MEHA 3DWPA 1LLRD 1H9SB 3Q23A 1OXTA 3X3MA 4C1NK 3GO5A 1U4MA 5J1ZA 3NSWA 3L9AX 3R3OA 1TT2A 3FRPB 3NTHA 3A8JE 3RLFA 1YNNC 4ZUIA 3DHQA 3LNNA 4V0BA 2O5IC 2SOBA 4QB4A 2F0HA 3HKZB 3P20A 4ZYSA 5CGKA 1BUVT 1RDPD 4B9WA 2K5WA 5CV8A 4HAEA 2Q8RE 4HTHA 1SYDA 4H7BA 1EFID 1S4ZA 1JWUD 2XVSA 4PMCA 3NP8A 3M7NA 3MWYW 4RHSA 2X69A 4XIGS 1F9RA 4U68A 1IKLA 3SE0A 1SYBA 1AW7A 1LTGD 2B2UA 2J4XA 1OO9B 3D4DA 3MXGA 4V190 1EWHA 4CJ2C 3J7AV 4Z9CB 3VYTA 1Q90A 4XQNA 5HGTA 2WKCA 2AQ3B 4F8MA 1GHKA 5C5LA 2PPBC 3A8IE 4IUTA 1F77A 1DOLA 2B2VA 5C3EB 4JBWA 3Q24A 2MJ8A 3R2TA 5IGBA 1EOTA 2ZXOA 1OXXK 4WJWA 1QNKA 1I50B 1T5EA 1PXUA 1RCVD 2F0FA 3J7AF 1SYCA 1XX8A 2V4DA 1WTQA 1FNVA 2EJMA 1ICWA 5IGDA 1EEID 4K2LA 1QILA 5HURA 3A55A 1K8OA 4G57A 3GV3A 5IGFA 1O80A 2K6AA 2D9UA 2O5JC 2NVQB 5IGCA 1HCZA 3K5NA 2RQXA 3DWAA 1BR9A 4F87A 3RZOB 1JOKA 5K36H 1I6HB 2F0MA 4KHVA 4KI0A 2Y0SB 1AZPA 4LK1C 4A3EB 3GTLB 2DY8A 4C3JG 3N6RA 1NAPA 1NR2A 1ENCA 3FMCA 3O13A 1PTOB 2RDFA 1DOMA 1XYIA 2EY6A 4I65A 2QEJC 4MIUA 1WTRA 5KNDA 1QG7A 2F4IA 3EROA 1S5ED 1IHZA 2EYPA 1KAAA 2JA7B 1BF4A 5KRUA 3K7AB 2ENBA 3EQLC 1PFNA 4CKEA 1PRTF 5CR3A 4G7ZC 4G4KA 1Z6HA 4CGYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7Y A;  2XIW A;  1XX8 A;  1O7Z A;  1HUN A;  4ZAI A;  2L1B A;  1WTQ A;  4DN4 M;  2DY7 A;  4O42 A;  2KUM A;  1WTW A;  3FPU B;  1B2T A;  1GUW A;  1ICW A;  3I8Z A;  1NCV A;  2K05 A;  2VXW A;  1DZ1 A;  2B2T A;  1U4P A;  2HUG A;  2RSO A;  2EOT A;  5CBE E;  4RAU C;  1J9O A;  5DNF A;  2M2L A;  1RHP A;  4XT3 B;  1F9P A;  1WTV A;  1U4R A;  4ZK9 B;  5COR A;  1SSO A;  1MSG A;  2IL8 A;  5D14 A;  1WTO A;  1HRJ A;  3I3C A;  4UAI A;  4IUP A;  4X3S A;  3IL8 A;  5D65 A;  1F2L A;  1Q3L A;  3GV3 A;  1HFN A;  1LV9 A;  5COY A;  2L9H A;  2N55 A;  1O80 A;  2K01 A;  2D9U A;  3KUP A;  3UI2 A;  1B50 A;  2RSN A;  3DEP A;  5EPJ A;  1SDF A;  1X32 A;  3Q6S A;  3F2U A;  1HFG A;  4HAE A;  3SVM A;  2Q8R E;  1PFB A;  2L12 A;  4IUQ A;  5CBA E;  5E4W C;  1EL0 A;  1ILP A;  1HUM A;  3D6W A;  1EQT A;  1BO0 A;  1PLF A;  1RJT A;  1EIG A;  1J8I A;  2KED A;  1PDQ A;  2B2W A;  4LMQ D;  1B53 A;  2N88 A;  1G2S A;  4CJ0 B;  4MN3 A;  2HCC A;  1IKM A;  1RTO A;  2KEC A;  1SAP A;  2R3Z A;  1S4Z A;  1VMC A;  1TVX A;  3I90 A;  1ESR A;  4OIK A;  3TZD A;  1JE4 A;  4ZLT F;  4R8I A;  1WD0 A;  2B2Y A;  2CVR A;  1VMP A;  3G7L A;  2B2U C;  4HED A;  2FIN B;  3MTS A;  2HCI A;  1AZP A;  1ILQ A;  2DY8 A;  1ZXT A;  3I91 A;  1WVL A;  1HA6 A;  2Q8T A;  2JP1 A;  2K03 A;  5JJZ A;  4HCS A;  1NAP A;  1NR2 A;  3MWY W;  5AFW A;  5EPL A;  1X3Q A;  1MGS A;  4QUF A;  1BBX C;  5EQ0 A;  2X69 A;  1HHV A;  1KNE A;  1F9R A;  1F9Q A;  3HP3 A;  4U68 A;  3DM1 A;  1IKL A;  2NWG A;  3LWE A;  5T1G A;  2KOL A;  1EIH A;  5CMD A;  1G2T A;  1PFM A;  2X6L A;  1U4L A;  4XT1 B;  2B2U A;  1A15 A;  1ML0 D;  2H1E A;  4OIJ A;  2EPB A;  2FFK B;  2HDL A;  1CA5 A;  3ONA B;  5EPK A;  1DOM A;  1G6Z A;  2NYZ D;  5T1I A;  3TN2 A;  1MSH A;  1F9S A;  1NR4 A;  2KEE A;  4ZKC B;  1E0B A;  3R93 A;  1XYI A;  2NZ1 D;  1X3P A;  4CJ2 C;  1KNA A;  1QE6 A;  4XDX A;  1WTX A;  4ZKB B;  2FMM A;  4RWS C;  1WTR A;  1CA6 A;  4CJ1 B;  2B2V C;  3DEO A;  4X3T A;  2MPM A;  1QG7 A;  2HDM A;  4IUR A;  2RA4 A;  1DON A;  1IL8 A;  3IFD A;  1MI2 A;  2FJ2 A;  4IUT A;  1RTN A;  3GV6 A;  4NW2 A;  1AZQ A;  2J7Z A;  2L11 A;  1C8C A;  4X3U A;  5EJW A;  1DOL A;  4QUC A;  2JYO A;  1BF4 A;  2L4N A;  1M8A A;  3KBX A;  1JIC A;  2BDN A;  1WD1 A;  2K04 A;  3FDT A;  1DOK A;  3P7J A;  4HSV A;  2SDF A;  4IUU A;  2B2V A;  1B4O A;  2MGS A;  1WTP A;  2MP1 A;  4R9W A;  1G91 A;  2MJ8 A;  1ROD A;  4RA8 A;  1AP0 A;  2KVM A;  1PFN A;  2X6G A;  1BNZ A;  3H91 A;  1EOT A;  3QO2 A;  5E4X A;  1CM9 A;  2B2W C;  4X3K A;  2B2T C;  1U4M A;  1QNK A;  2K1B A;  4IUV A;  2RVL A;  5EKI A;  1B3A A;  4MHE A;  3N52 A;  2FHT A;  2EE1 A;  2K28 A;  2B2Y C; 
#chains in the Genus database with same CATH topology
 3C1F A;  2XIW A;  5I6Y A;  3NEN A;  1K0S A;  3U4Z A;  2YYZ A;  5FJ8 H;  2FXQ A;  1GUW A;  2NZH A;  2VXW A;  1UWV A;  1SBB B;  3CCM A;  1OXS C;  3U50 C;  1F9P A;  4KMU C;  3VR2 A;  2JEB I;  4K8I A;  3PSI A;  1N34 L;  4DV4 Q;  2SNS A;  1IBL L;  4DXG A;  2L9H A;  1E24 A;  5IP9 H;  3PIP A;  5CV4 A;  2JXM B;  3NBI A;  5I4D A;  3AB9 A;  1X32 A;  2B63 B;  3F2U A;  1N36 L;  2DUD A;  4APV A;  3ULJ A;  2JA6 G;  3A74 A;  3GTM H;  1KAW A;  4NMZ A;  4MTK A;  3RD4 A;  3H3V C;  3D8G A;  5EAY A;  3STB C;  4DK3 C;  1SAP A;  4OIK A;  1CI3 M;  1WD0 A;  3PUZ A;  2MUY A;  2WAC A;  3QB3 A;  3U4V A;  2F4V L;  4TRD A;  4RH6 A;  3G71 A;  5JJZ A;  3HOY G;  3NBH A;  2AWO A;  2AMC B;  2LMC B;  4YCV A;  2KQ3 A;  5T1G A;  4WOR A;  1EIH A;  3QIA A;  4IJH A;  2EVB A;  4OIJ A;  4DFA A;  2EPB A;  4YHH L;  4PMB A;  4OEM B;  3A5U A;  4R4I A;  1EY0 A;  2KBN A;  4A3B G;  4AYB E;  1PZI D;  4YWK A;  2WB1 B;  3IRB A;  1H9M A;  1HA5 A;  4UHV A;  1CZG A;  1NMG A;  1A3T A;  1B44 D;  2O4X A;  3KF6 B;  3OIP A;  5TSS A;  1LTB D;  1KLG D;  1SRU A;  2MGS A;  1Q81 C;  4A3F B;  1V9P A;  4JI3 L;  4K2K A;  4HJ5 A;  4IN3 A;  1LO5 D;  5IY0 A;  5EBD A;  1CM9 A;  1TWA H;  5KGU A;  3JAM L;  3HKS A;  2XNA C;  2K5D A;  3S16 H;  5HGQ A;  4GN4 B;  1FL0 A;  4YWL A;  5KNB A;  5IP9 G;  3PO2 B;  4UDU C;  3DUZ A;  1VCI A;  5ELE A;  1KHI A;  4HIK A;  1A0I A;  1U0L A;  2A6E C;  3NHH A;  2DN8 A;  2NB0 A;  2KUM A;  1NCV A;  1DZ1 A;  1RD9 D;  3STB D;  1ICF B;  4AYB G;  3F8T A;  2EOT A;  1RHP A;  3A8K E;  2EQS A;  4DV0 Q;  4UAI A;  4IUP A;  4X3S A;  3T16 A;  1XPU A;  4GLA C;  3GDE A;  1TS3 A;  2A68 C;  2G9D A;  1I3Q H;  1YEZ A;  2H4O A;  3HZX A;  1L2F A;  1VQH A;  3TP5 A;  3A5Z B;  5EGT A;  3KFU A;  3J7Z C;  1SNO A;  2RKS A;  4BS9 A;  4YCU A;  1M4V A;  4ULL A;  1G2S A;  2NVY B;  3SEB A;  3TZD A;  1KDA A;  1QJO A;  3RUZ A;  1G51 A;  1GKH A;  2F1M A;  5DAU A;  2DNC A;  2FIN B;  3TS0 A;  1LM0 A;  1ILQ A;  2G9H D;  1Y1W H;  2XGT A;  5JJI A;  4BBR B;  2K7V A;  4BY1 B;  5EPL A;  1I94 L;  2N78 A;  1STG A;  1XMQ L;  2VL6 A;  1K3B C;  1K9M C;  2EDG A;  1VF7 A;  2LSS A;  1Q8K A;  1UEB A;  1VS0 A;  3PUW A;  3VR3 A;  2MFI A;  3BU2 A;  1JWM D;  3OHX C;  1JR0 D;  3SK8 A;  1STA A;  5M3F H;  5JEA H;  4XDX A;  4B3S L;  4HSP A;  3OTO Q;  1NSN S;  4KD4 A;  3S1M H;  1I6V C;  5FLM H;  1P16 A;  2R7Z B;  4A3M H;  1LUZ A;  2LS0 1;  3I4L A;  1X55 A;  2A6E D;  4FXG C;  3PQI A;  4NW2 A;  5EJW A;  3WDN A;  4R4T A;  3RN5 A;  2SDF A;  1LT3 D;  2NBF A;  3S1Q B;  1AP0 A;  1YVC A;  1BNZ A;  3H91 A;  2F3I A;  5E4X A;  4K14 A;  2A68 D;  1JT8 A;  4IUV A;  1EY7 A;  2CHB D;  4RHR A;  4DR4 L;  4X65 Q;  1A63 A;  5CV6 A;  4GOP B;  2BDO A;  1N9W A;  2JA5 B;  2VQE Q;  1C48 A;  1B2T A;  2BOS A;  3NE5 B;  3G4S A;  2UXB Q;  4BY7 H;  4EVO A;  1TKW B;  4A3K B;  1SNP A;  1VQG A;  1TWH H;  3I3C A;  2WKD A;  1LV9 A;  4A3C G;  4X6A H;  3MC0 B;  2XTI A;  1Y1W G;  1K73 C;  1SDF A;  5G3L D;  3Q6S A;  1LTI D;  2EYJ A;  1L0Y B;  1YNJ D;  5LMU Q;  5A2Q L;  1HUM A;  4QGU A;  1A2U A;  2YU9 H;  1LTL A;  2ZT9 C;  1CQV A;  2KED A;  4FO2 A;  1K83 B;  3UDF A;  4Y7N H;  4HR7 B;  4EX5 A;  4EQP A;  1HNW L;  3KJP A;  2F52 A;  1KL9 A;  1UE6 A;  3ICE A;  3I4M H;  2HT1 A;  1DGS A;  4R4C A;  1EYG A;  1EYD A;  5M3F G;  3QR8 A;  4HCS A;  3RNU A;  1CK1 A;  3I4N H;  5AFW A;  3DM3 A;  1GD7 A;  1AN8 A;  2E2H B;  3NUC A;  3S14 H;  1M1K C;  5CMD A;  3CRK C;  4YCW A;  2N49 A;  3KDF B;  1HZ9 A;  2H5X A;  1BBU A;  4RKL A;  5C4J B;  4M1U B;  1AFP A;  1A15 A;  1ML0 D;  5M5X B;  3U9O A;  4B3T L;  3M4O H;  1G6Z A;  1WJJ A;  2UUB L;  2R7D A;  5IP7 G;  1EY6 A;  2F0S A;  2BH8 A;  1HNX Q;  5HY6 A;  3J7A 5;  4X3T A;  5ISR A;  2EYL A;  1LT6 D;  2I0Q A;  2JA6 B;  4C56 C;  5AJ3 Q;  1QCB D;  1MJE A;  2L5T A;  1AZQ A;  1SN8 A;  2JYO A;  3SK5 A;  1WD1 A;  1D7Q A;  4HJ9 A;  3HFZ B;  1A2T A;  1VQ5 A;  4JOI A;  4LW1 A;  1MBY A;  5IGG A;  3OWF A;  4GNX A;  4FVM A;  4A3J H;  3K5M A;  5M5Y B;  3MFY A;  3PIP 3;  3S1R B;  5C4X H;  3UDI A;  2KHS A;  3R2I A;  3T4A C;  1K8M A;  5LL6 S;  1PH9 A;  2IW3 A;  1D5Z C;  1PFS A;  4DA2 A;  5C0X G;  2JQO A;  2JE6 I;  3PF5 A;  3AFP A;  4A3B B;  5C4Z A;  3G48 A;  2IX0 A;  1A62 A;  3I56 A;  1NJI C;  3P75 A;  2DNE A;  1WTV A;  1EY4 A;  4LF5 L;  2GA4 B;  2NN6 G;  3AFQ A;  4B3M Q;  2KCC A;  5COY A;  3MXU A;  3I4M G;  3MXN A;  3GTG H;  4YY3 Q;  1LAC A;  3I4N G;  1ASY A;  4FF4 A;  1Y14 B;  1EQT A;  2GN5 A;  2ZTD A;  2R92 H;  4HJ8 A;  2ALY B;  2B2W A;  1GOZ A;  4JI5 Q;  1GUG A;  5BN5 A;  1E1O A;  5J39 A;  1G6P A;  4RKB A;  1Y1V H;  3JAM c;  3GTO H;  1XNR Q;  1X54 A;  5FLX L;  1WVL A;  1ZYR D;  1D5M C;  2JP1 A;  4GOP A;  5D3D A;  1YJW A;  5LMN W;  2K5V A;  4AYB B;  1GHJ A;  3GTM B;  5C3W A;  3MHB A;  4J15 A;  3FP9 A;  1TWC H;  5ELB A;  1STN A;  4GKJ Q;  3SGI A;  1S72 A;  1J5E L;  4HIM A;  4JI6 Q;  2RHS B;  2FFK B;  2CWA A;  4OO1 H;  5T1I A;  1F9S A;  1ONL A;  4LJZ C;  1D6E C;  1UE7 A;  3TSS A;  2UU9 L;  1IL2 A;  1EU4 A;  4POG A;  4ZKB B;  4A3J G;  1VQL A;  1SNC A;  3J81 i;  2WAQ E;  2F3V A;  4A3F G;  4JI0 L;  4L63 B;  3QG1 A;  4DR2 Q;  1IBM Q;  5C4X G;  1PH7 A;  3IFD A;  4BWG B;  2XRS D;  2E5L L;  1ESF A;  1MKH A;  1R4P B;  4QQB X;  1M8A A;  5GAE C;  3ERS X;  1IXR A;  1XMO Q;  4DR1 Q;  4DK1 A;  1MIU A;  1ZEQ X;  3I4O A;  1PH4 A;  1HR0 W;  1Q8I A;  2QCP X;  3SHL A;  1PH3 A;  3LWU A;  4ZQ3 A;  1R9T H;  4NXN Q;  2K1B A;  2UUC Q;  4AQY Q;  2IT1 A;  1B3A A;  2QIL A;  1L0X B;  1LTR D;  2WIN B;  3N52 A;  4DV4 L;  4DK6 C;  1JOQ A;  1PRT B;  3TDQ A;  1YHB A;  3Q8D A;  3E0J A;  4DUY Q;  2KCN A;  4DN4 M;  3D3R A;  1SNM A;  3RMH A;  4A3G G;  1STH A;  2J0T D;  4ALP A;  2R92 G;  2HUG A;  2LFN A;  3KYH C;  1PV4 A;  1TWA B;  2RF4 A;  3PIO 3;  5D14 A;  3J81 L;  3HOU H;  4DXF A;  2E75 C;  3QOL A;  3S16 B;  4O0A A;  3L7Z C;  4POF A;  3Q0A A;  2VB3 X;  2VB2 X;  1GXD C;  4TKO B;  1FGU A;  2YTX A;  2AQ1 B;  1EIY B;  1HFG A;  2QKI C;  3NBH B;  3OMC A;  1KXL A;  1C4Q A;  4IZ8 A;  4PG3 A;  3D6W A;  1PZK D;  5IGE A;  4O1N A;  4BY1 G;  1EIG A;  1N8R C;  5C0X I;  3JAM E;  4IQZ A;  4PV1 C;  4ID6 A;  3CCV A;  4IOA A;  4DAV A;  1SFO B;  4OO1 G;  5EBC A;  2CVR A;  1VQN A;  1BQQ T;  2HCI A;  3ND9 A;  2NN6 I;  3H09 A;  2EY2 A;  1P8L A;  2IHE A;  2Q8T A;  1EZ8 A;  1CFM A;  1QZG A;  2F0P A;  2RDH A;  1VQ9 A;  5GRO A;  3OSO A;  2GVB A;  3CU7 A;  5C0X J;  1LAB A;  4X62 Q;  1Q86 C;  2MO1 A;  2Z1C A;  2R7Z G;  4NXM Q;  1HNZ Q;  4KK7 A;  2VQF Q;  1CSP A;  5IIF A;  1Y1W B;  3KLR A;  1TXY A;  3CCQ A;  2EXD A;  1QWY A;  5ELO A;  1E2V A;  3K6O A;  5KIX A;  2NVT H;  2F03 A;  3PO3 H;  4FNF A;  1DD2 A;  3T1Y Q;  2RA4 A;  4OGQ C;  3SK4 A;  1HPC A;  4KJN A;  2YV5 A;  5DM6 3;  3EA6 A;  4QIW E;  1CKN A;  1FR3 A;  1TU2 B;  1N33 Q;  2BDN A;  4WJ4 A;  1I4R A;  2DGY A;  3CW2 C;  3I72 A;  4IPC A;  4HMJ A;  5M3F B;  1LTT D;  5M5W H;  2E2I H;  1STB A;  4XQJ A;  3S1M B;  2CQA A;  2AWN A;  2I5L X;  2Z4I A;  4A3M B;  3HOU G;  1Q1E A;  1Z9F A;  4RGO S;  3HOZ H;  3HOV H;  2NTS A;  4EQO A;  4LFA Q;  5IYD H;  2QW7 A;  2OXP A;  5ELC A;  1X3G A;  2NZO A;  3H3V H;  1W3S A;  4QL5 A;  1U4P A;  1I4Q A;  3K59 A;  3F1Z A;  1JQY D;  4WRD A;  2IL8 A;  4UP7 A;  2PCF B;  2CCZ A;  4DR7 Q;  4HN7 A;  3EBE A;  3OYY A;  3S2D H;  2WII B;  2RSN A;  1FD7 D;  4DR6 Q;  1N32 Q;  2LY7 A;  4H0L C;  3VR4 A;  3SVM A;  1GJX A;  1ILP A;  2E76 C;  4X66 Q;  4FYD A;  4BY7 B;  3EIV A;  3HGB A;  3DXJ C;  1UNS A;  4RCO A;  1XNQ Q;  4LMQ D;  4R1J A;  3GTJ H;  1TWH B;  2JA9 A;  5G3L F;  5LL6 X;  3TBI B;  1IKM A;  2KEC A;  5D3I B;  5K36 G;  5JJL A;  1WCM H;  1TVX A;  1I4H A;  4H02 A;  2B2Y A;  1VMP A;  1I4X A;  4HED A;  3H15 A;  3L3O C;  4MZ9 A;  3WWV A;  4NB3 A;  3E0E A;  1KIX A;  1STY A;  3K7U C;  4FDB A;  3PO3 G;  1X3Q A;  4QUF A;  3S2H H;  5EQ0 A;  1TS4 A;  2JEA I;  2YU9 B;  3QJY A;  3DM1 A;  4GLV B;  3OMG A;  1SRO A;  4Y7N B;  4NPS A;  1CKM A;  4DAY B;  2VUM H;  2EJF C;  4TVA B;  3GTP H;  4DV6 Q;  1SYG A;  1RL2 A;  3CME A;  1II3 A;  2QGQ A;  3UDX A;  1Q82 C;  3TN2 A;  3I4M B;  2I5M X;  3R93 A;  1IYV A;  2MQH A;  1XPR A;  2WP8 J;  1A3U A;  1QE6 A;  3I4N B;  5LHY 1;  5A2Q E;  2JK8 A;  2HDM A;  2HQL A;  3PV0 A;  2F0L A;  2B3G A;  2Z6K A;  3JAM i;  2ZJR A;  4QY7 A;  1DON A;  1BDO A;  2A73 B;  2Q2U A;  3K5L A;  4DKA C;  1TS2 A;  2V1C C;  3HOZ G;  1Z7T A;  3SR1 A;  4X65 L;  3M4O B;  4JI8 Q;  4HSV A;  1VQM A;  3VA7 A;  1BCP C;  2VQE L;  1L1O A;  2KVM A;  1GUS A;  4DAP A;  5FLX c;  4ME3 A;  3FEW X;  2UXB L;  3SXH A;  2B2T C;  4JV5 Q;  1PH1 A;  1HTP A;  4PZ7 A;  1L0W A;  1F2M A;  4H13 C;  3NPP A;  1I5F A;  5E7N A;  1D2B A;  3UE0 A;  1O7Z A;  5I2X A;  4ZAI A;  3EN2 A;  5I9P A;  3HKZ E;  3NTK A;  1YZ6 A;  4A3J B;  2Q8I B;  5FJ8 G;  4LFB Q;  4RAU C;  2KJX A;  3S9W A;  4XT3 B;  1D5X C;  4IFD H;  2XSC A;  1F2Z A;  5C4X B;  3D31 A;  3FKI H;  3J81 j;  3HOX H;  2K01 A;  3GTK H;  3V2T A;  3F2B A;  1B50 A;  3R8B A;  2K33 A;  3F2D A;  3CCU A;  3BS1 A;  1PYS B;  1SMY C;  2L12 A;  4IUQ A;  4B3R L;  4P75 A;  4KV6 A;  4Q5V A;  1KLU D;  1VQB A;  2PMZ E;  3CCE A;  2VNU D;  2VUM G;  4PZ8 A;  1GVP A;  3RZD H;  1G29 1;  2EZV A;  1WYD A;  5CC4 A;  3LGJ A;  4A3L H;  4KHP Q;  1CQF A;  3K58 A;  4G7O C;  2OCE A;  4A3I H;  1KD1 C;  3GTG B;  2VZA A;  3BVM A;  4A3G B;  2ICE C;  2VY3 A;  1VQP A;  2CQO A;  1HNX L;  4DAM A;  2R92 B;  3ERQ A;  3C2P A;  1YIJ A;  1YIT A;  4UPA A;  1G2T A;  1CKO A;  1GO3 E;  1BCP D;  5AJ3 L;  2YTV A;  4ZRZ A;  1FJG Q;  3VYU A;  5EPK A;  3MXP A;  1Y1V B;  3GTO B;  1NR4 A;  1YBY A;  2PW7 A;  3J81 c;  4OL7 A;  4KKU A;  1KNA A;  3HS0 C;  3NXW A;  4GNX B;  1WFQ A;  2FMM A;  4RWS C;  2UUA Q;  4CJ1 B;  3DEO A;  3P1H A;  3KF8 A;  4ME5 A;  1FNU A;  1TWC B;  3SK6 A;  2ES2 A;  4F88 A;  4K5V A;  4PZ6 A;  2PI2 E;  3HEJ A;  2L4N A;  1YNJ C;  5IOC A;  4LF8 L;  3P7J A;  5IWA L;  5FLX E;  3A54 A;  3W1G A;  3MA2 B;  2TMP A;  3KLS X;  5L37 A;  4K6L A;  4BXX H;  1I6H H;  5CV7 A;  2ID0 A;  5IOD A;  1BXT A;  3FKI G;  1U9R A;  1SMY D;  1UEA B;  4B3M L;  4PNY A;  3KOJ A;  1EFW A;  4DAY A;  3MXN B;  1S3O A;  2EIF A;  2VS1 A;  3K81 C;  3BVZ A;  2BE5 D;  1EY9 A;  3FPU B;  1N34 Q;  5DNF A;  1PH8 A;  1JC7 A;  4MNO A;  3CP0 A;  1R9T B;  3GQB A;  3S17 H;  4JI5 L;  1JOO A;  4C2M H;  3E6Z X;  1F2L A;  4OWT B;  1N36 Q;  2N55 A;  4LF7 L;  4I7Z C;  2OT2 A;  2WV6 D;  4A3L G;  1XNR L;  3WOF A;  1H95 A;  2CKZ B;  3WOE A;  2F0G A;  4DR5 Q;  5GAH C;  3T13 A;  2F0N A;  1BO0 A;  2K75 A;  1RJT A;  1Y8P B;  1PYW D;  5C44 H;  4C3H H;  4LF9 Q;  3W3A A;  1PH6 A;  3K7A H;  4HCE A;  3HOU B;  2L55 A;  1VMC A;  1SE8 A;  2RHQ B;  4QCL A;  1JCK B;  3I55 A;  3G7L A;  3MTS A;  1T5X D;  1VQK A;  2RBM A;  3M3Y H;  1BOS A;  5JPN C;  4FF1 A;  1NNX A;  1SJE D;  2Q2H A;  2RCF A;  1V1O A;  1WOC A;  1NTG A;  2F0D A;  5K5P A;  4HIO A;  4JYA L;  4EQN A;  4DR2 L;  1VQI A;  3J81 E;  4KY6 A;  5LMN Q;  1KQS A;  2BH2 A;  5I9O A;  4ZKC B;  4QIW B;  2N3S A;  4OX9 Q;  4X64 L;  1PTO C;  5IYB H;  2VW9 A;  4DR1 L;  4R8N A;  2OTL A;  2EY5 A;  1WTX A;  3TP6 A;  3T1H Q;  5JEA G;  1LTA D;  4B08 A;  4NXN L;  1JB3 A;  2BA1 A;  4AQY L;  1SEB D;  1QB5 D;  5FLM G;  4JI3 Q;  1PH2 A;  4A3M G;  1VQA A;  2ZTC A;  1Y8O B;  1DJR D;  2BCO A;  1ROD A;  3CCL A;  2A74 C;  2X6G A;  1VQ4 A;  3AMU A;  2K14 A;  4GKK Q;  1X3F A;  3PO3 B;  1IBK Q;  1XTC D;  3HOW H;  2F0O A;  1I4G A;  2L15 A;  2IX3 A;  1Z47 A;  2R61 A;  1X6O A;  4CDF C;  1HR0 Q;  3GD7 A;  1V1P A;  2EE1 A;  1ZYR C;  3UI2 A;  3IKJ A;  4Q0F A;  2DY7 A;  4N8F A;  4O42 A;  3NQI A;  5IT9 L;  4BBS H;  5M5W B;  2RSO A;  4ZCK A;  5CBE E;  3K5O A;  2M2L A;  1XXG A;  2E2I B;  5C44 G;  4C3H G;  4IPH A;  4CDD C;  4JI1 L;  1HRJ A;  4KN7 C;  4BY7 G;  1S5C D;  3H0G H;  1AH9 A;  2IJ0 A;  3HOZ B;  1SJH D;  3NEM A;  1Q7Y C;  4H44 C;  3DEP A;  1CZW A;  3DLL A;  4JI4 Q;  1SE3 A;  1DCZ A;  1SE4 A;  4XQQ A;  5M3M H;  2E8G A;  5JOB A;  3CC4 A;  1O7I A;  4ODG A;  3BYT B;  4JBJ A;  4R4Q A;  1R4Q B;  4QF4 A;  4U67 3;  5NUC A;  3F2C A;  1PTO D;  3CRL C;  3I90 A;  3J80 i;  1PH5 A;  1JJ2 A;  4X62 L;  2NTT A;  1I94 Q;  2NVX H;  2C35 B;  3S2D B;  2HHH Q;  1HNZ L;  2PQE A;  4DV2 L;  1E2W A;  5J3B A;  4CBV A;  1XMQ Q;  2VQF L;  3MZ5 A;  1QZH A;  1D1I A;  4KJO A;  3BG3 A;  2PQA A;  1G8Z D;  1NUC A;  3PO2 H;  1E2Z A;  1KRT A;  3T1Y L;  2D5D A;  2KCM A;  3GTJ B;  4F7X A;  4XT1 B;  2L0C A;  4DF7 A;  1CKN B;  2HDL A;  4DV3 Q;  1WCM B;  3ONA B;  3AU7 A;  3VR6 A;  2D2C C;  5C6A A;  2NZ1 D;  4FF3 A;  1VF5 C;  2SNM A;  4C3I H;  3ER0 A;  1CA6 A;  1C9O A;  4L5Q A;  3S15 H;  3S2H B;  2ZJP A;  3M85 A;  3HOW G;  4NP5 A;  3TS2 A;  2PZW A;  2VUM B;  3URY A;  3GTP B;  1KAB A;  1H9R A;  1J6Q A;  3CKI B;  3J7Y W;  4LFA L;  4R9W A;  1G91 A;  3J80 L;  3BDC A;  4N9P A;  4BBS G;  1HZA A;  4DR4 Q;  3I7F A;  4JI2 Q;  4BA2 I;  4JPB W;  4IPG A;  1KC8 C;  2E2J H;  3UE1 A;  4JI7 Q;  3H0G G;  1KTK A;  4DV7 L;  4O2D A;  1UUP A;  2KHI A;  4AIM A;  4LFC Q;  4DR7 L;  4XYO A;  2N8N A;  1Q12 A;  1UE1 A;  1O7Y A;  1HZC A;  4JW0 A;  4YIJ A;  4LUO A;  2MO0 A;  1HUN A;  2HQE A;  5DM7 3;  1VQ6 A;  4DR6 L;  2UXC L;  4A4I A;  1N32 L;  5M3M G;  3VA5 A;  3ULL A;  2KHJ A;  1WI5 A;  2I46 A;  4CHT B;  2ICI A;  1J9O A;  3M9B A;  3TME A;  2EYM A;  4JBK A;  4A93 H;  1U4R A;  1MSG A;  4FF2 A;  3X3N A;  1XNQ L;  1IW7 D;  2PMZ B;  4KKT A;  4UP9 A;  3RR5 A;  1QNU A;  5I2Y A;  2ZTE A;  3IAY A;  4J6H A;  4HID A;  2KCT A;  5EPJ A;  3ULP A;  5JEA J;  1OXU A;  1SMX A;  4JC0 A;  1U5K A;  3S1N H;  2EYF A;  3CQZ H;  4KHZ A;  2N88 A;  3FKI B;  1DM0 B;  1B9M A;  3PGZ A;  5KYL A;  3HOX B;  1AEX A;  1RTO A;  1S5D D;  2R3Z A;  2WAQ G;  4R8I A;  2IY5 B;  4C3J H;  1PMR A;  2MNA A;  4DV6 L;  3GTK B;  4JOI C;  3I91 A;  5KNC A;  1NY4 A;  5JPM C;  2Z6B A;  1Y1V G;  3I70 A;  3NK9 A;  4C3I G;  4FXK C;  1JJG A;  3EJI A;  2B8F A;  1RKN A;  3MFG A;  4QMG A;  1MJC A;  2UXD Q;  2NWG A;  2KOL A;  2PZT A;  4LUV A;  1YNN D;  4K0K Q;  3RZD B;  2H1E A;  2F3W A;  2ZXR A;  2OF1 A;  4A3D H;  4KD3 A;  4LF4 Q;  1K28 A;  4B9X A;  4JI8 L;  1L1O B;  1Y8N B;  4A3I B;  1I3Q B;  5IYC H;  1BCP F;  3CC7 A;  1FNW A;  2ZM6 Q;  4LAA A;  3K80 C;  4KY5 A;  1C7Y A;  1XWE A;  1EUJ A;  1K3R A;  5EKL A;  4DR3 Q;  3KK7 A;  1D8L A;  1YJN A;  2J7Z A;  2R93 H;  4EGV A;  1IZ6 A;  4CKC A;  3A7L A;  3QWN A;  1JIC A;  2K04 A;  3FDT A;  1GUO A;  5CV5 A;  1WTP A;  4IUU A;  1B4O A;  1VQ7 A;  1GUT A;  5FO9 B;  3PMF A;  1LYL A;  3T51 B;  5FO8 B;  4G7H C;  2B2W C;  2M00 A;  3PUX A;  3TP7 A;  1B1Z A;  4LFB L;  4GN3 B;  1TWG H;  3T56 B;  4ABN A;  2D0O A;  1ZKO A;  1OXV A;  5BN4 A;  4DU9 A;  4DNR B;  4IJL A;  1QVG A;  4A75 A;  3H94 A;  2JA8 H;  2L1B A;  4LF5 Q;  4GOP C;  3MVV A;  5FO7 B;  1X65 A;  2K05 A;  1H9S A;  2B2T A;  1SR3 A;  3C46 A;  3B6Y A;  3M4Q A;  4JK1 C;  3V96 A;  2K50 A;  2ASB A;  3GTQ H;  3BDL A;  1V8Q A;  3UDG A;  5D65 A;  3JC6 6;  1KDB A;  1HFN A;  2E74 C;  2XN9 C;  1YHQ A;  1JMC A;  3W5O A;  4DV0 L;  4KHP L;  3V05 A;  2YTY A;  2MHV A;  3CAM A;  2Z4H A;  2E2D C;  4DGZ A;  2IWH A;  5CBA E;  5E4W C;  3CC2 A;  3LX0 A;  4PQX A;  1SND A;  2F0T A;  4S3S A;  4L8J A;  4IPD A;  2Z0S A;  3S17 B;  3OIQ A;  4CJ0 B;  3BZK A;  1TWF H;  2HCC A;  4RGN A;  4C2M B;  4DV1 Q;  4QJF A;  1IYU A;  4IUN A;  4A3D G;  1J8I A;  1TII D;  3HOY H;  2B2U C;  3W1B A;  5ELN A;  2Q2I A;  1C0A A;  3ND8 A;  1ZXT A;  1HA6 A;  1NBW A;  2K32 A;  4YWM A;  1S40 A;  5IYC G;  3PCO B;  1HTL D;  3KLS A;  2F0V A;  1J5E Q;  3KF8 B;  5KEE A;  2UUA L;  1A6X A;  1HHV A;  2EJG C;  3NEL A;  5C44 B;  4C3H B;  5IT9 c;  1STE A;  5JVH 3;  2UU9 Q;  1SYF A;  1HQM C;  2OEO A;  3K8A A;  1E7Z A;  1B70 B;  1O7L A;  2NYZ D;  2AQ2 B;  1E0B A;  1VDZ A;  4RGM A;  3OWE B;  3M3Y B;  1X3P A;  4WJ3 M;  3FPP A;  4OXP A;  3TZU A;  2B2V C;  1LT4 D;  2MPM A;  3OW2 A;  1EU3 A;  2TSS A;  1RF2 D;  4P71 A;  1UAP A;  5CV9 A;  4Y52 H;  1RTN A;  1ENF A;  3OTO L;  2C5C A;  3CD6 A;  2ATW A;  1C8C A;  2K5Q A;  4QUC A;  3QOJ A;  2DJF C;  3MEF A;  1EQV A;  2EXZ A;  2JA8 G;  2QF7 A;  2CH4 A;  1TS5 A;  4DPG A;  4KTA A;  3BZD B;  2SEB D;  1O78 A;  4LUZ A;  2Z8L A;  2F0I A;  2Z9H A;  1Y69 U;  4OO1 I;  3PUV A;  2LXJ A;  1AE2 A;  1QUQ A;  2P5Z X;  2OQ0 A;  3S14 B;  3GV6 A;  2QA4 A;  1TY0 A;  1TY2 A;  4J8Q A;  3HOV G;  5JJK A;  1SYE A;  4RGT A;  1DYQ A;  4KLK A;  1WTW A;  1UE5 A;  5IYD G;  4TSS A;  4DR5 L;  1ENA A;  2PI2 A;  3ZYY X;  3HOW B;  1EWC A;  4DV5 Q;  4LF9 L;  1SNQ A;  3IL8 A;  3M4Y A;  4CDC C;  3BZC A;  2DJG C;  5M9O A;  4ILW A;  3C3L A;  2CH4 W;  4JVZ A;  1X9N A;  1EYC A;  4KN4 C;  1D1K A;  3K57 A;  1FYC A;  4FXD A;  1PZJ D;  4BBS B;  1EL0 A;  1LT5 D;  3RN2 A;  5BN3 A;  1LTS D;  1ET6 A;  2I5H A;  1PLF A;  2ZJQ A;  3A56 A;  3J80 c;  4DNT B;  2AKW B;  3Q22 A;  4A76 A;  3CMA A;  5LMU L;  1HQR D;  3H0G B;  3G6J B;  4OWX B;  1PYB A;  1JE4 A;  4ZLT F;  5LMN L;  2OTJ A;  5C3X A;  1CHP D;  5JVG 3;  4OX9 L;  1WCM G;  4P2C B;  2K03 A;  3MAQ A;  5M3M B;  1PTO F;  5IT9 E;  1MGS A;  5CYU A;  2G5D A;  3T1H L;  3LWE A;  3H6M A;  4KY7 A;  4K5W A;  1S5F D;  4L6T B;  1B7Y B;  3EVQ A;  4WFN 3;  1PFM A;  3IFT A;  2O2L D;  4RCN A;  1CA5 A;  1YI2 A;  2BE5 C;  4DUZ Q;  3D6C A;  1MSH A;  3NTI A;  1PHJ A;  2NVX B;  1QOH A;  1E22 A;  5C3E H;  1JB7 A;  5FOB B;  5ELD A;  2PO4 A;  3KLW A;  4LF6 Q;  4GKK L;  1IBK L;  3HKZ G;  3BDO A;  1IL8 A;  1I50 H;  4K5X A;  1V1P B;  1QVF A;  3D4R A;  1KDC A;  5BR8 Q;  2L11 A;  2EYH A;  2WAQ B;  4X3U A;  1HR0 L;  1BVS A;  3ITP A;  4JCV E;  1VQO A;  3BVG A;  2EY1 A;  2MP1 A;  1EZ6 A;  1HJP A;  4RA8 A;  2XWJ B;  4C3I B;  3OPO A;  3QO2 A;  2LKV A;  3S15 B;  1SFO H;  4X3K A;  2F0U A;  2PZU A;  5DEH A;  4PMW A;  3NWT A;  4HMI A;  5EKI A;  4MHE A;  1X56 A;  4DNI A;  2K28 A;  1JWS D;  2B2Y C;  2NVQ H;  3A7A B;  2CWP A;  3U9S A;  3CPW A;  3CHB D;  4JI4 L;  2CW0 C;  1JOR A;  3I8Z A;  1NE3 A;  1PRT C;  3RZO H;  2K5N A;  1V43 A;  1W6J A;  4NKL A;  3A0J A;  4A3C H;  2E2J B;  2I07 B;  1WTO A;  1HZB A;  1Q3L A;  3PIO A;  5F2D A;  4J1M A;  2A69 C;  4OWW B;  4IFD G;  5FK9 C;  4XTC S;  3D4W A;  3CXC A;  3W2D A;  4JG2 A;  3HOX G;  4A3E H;  3GTL H;  1EYA A;  2HHH L;  4CDE C;  2D62 A;  1FGB D;  1I4P A;  2C9O A;  3J80 E;  4LNQ A;  2PQA B;  2IPK D;  4BA1 I;  4XYQ A;  2Z6K C;  1K8A C;  5H1S E;  1PDQ A;  4YY3 L;  4P73 A;  1B53 A;  3VR5 A;  1IBL Q;  4A93 B;  4L5S A;  4HJ7 A;  4MN3 A;  1PTO H;  1EQQ A;  2JN4 A;  1ESR A;  3T53 B;  5J22 A;  1A3V A;  4DV3 L;  3KBG A;  3H3V I;  5C3E G;  2A6H C;  1L1O C;  2PW5 A;  2ZXP A;  3OW7 A;  5EKK A;  1HXY D;  1VQJ A;  1BBX C;  4A3I G;  3BYY B;  3HP3 A;  1F9Q A;  3S1N B;  4IAL A;  2A8V A;  3E9H A;  3TRE A;  3CQZ B;  2NUC A;  1U4L A;  5IP7 H;  2Y0S E;  2F0Q A;  3GP7 A;  5ELF A;  2F0E A;  4IO9 A;  2OWO A;  2JA7 H;  4C3J B;  5GAD C;  1TQO A;  2F4V Q;  1ET9 A;  4GKJ L;  1EY8 A;  4JI6 L;  1B9N A;  4TQU S;  1EEF D;  1S5B D;  3NQT A;  4IUR A;  1B8A A;  4C1N I;  4JI2 L;  2K4K A;  1EIF A;  1MI2 A;  1Q1B A;  3AEV A;  2R7F A;  4JI7 L;  1DXM A;  4E6I A;  4YHH Q;  2CW0 D;  1CTM A;  1PRT D;  3S24 A;  4OEL B;  1IBM L;  3OOC A;  4LFC L;  1T9H A;  5C4H A;  4A3D B;  1KRS A;  1DOK A;  2K52 A;  3SDZ A;  4CKB A;  2A69 D;  5JAV A;  1EOV A;  5FKA C;  5C5M A;  1XMO L;  2R6G A;  1CT1 D;  2B8G A;  3CCJ A;  4BXX G;  3I73 A;  2RVL A;  1YNX A;  3TP8 A;  5C0X H;  2FHT A;  2Y0S G;  3KF6 A;  2R93 B;  2AUJ D;  1B3Q A;  1NMF A;  2XWB B;  1Q46 A;  1V1Q A;  4A3E G;  1SXT A;  2B39 A;  2UUC L;  2AUK A;  5E3F A;  2B63 H;  4N8X 1;  3C1E A;  1YJ9 A;  5DLQ E;  2PNH A;  4K6D A;  3G6E A;  4DK0 A;  2PYK A;  2XRQ D;  2NN6 H;  1CUK A;  2FMC A;  5A35 A;  1JE5 A;  4DUY L;  4ZK9 B;  5COR A;  3VYS A;  1SSO A;  2A6H D;  4M8A A;  2NVT B;  3CCR A;  1TWG B;  3DWQ A;  1W2B A;  4B3R Q;  3L0O A;  2BA0 A;  3KUP A;  5I6W A;  2KA7 A;  3PUY A;  2JA8 B;  1H9J A;  4K8J A;  1PFB A;  1RIP A;  3EFX D;  5KYI A;  3GTQ B;  2UXD L;  2HD3 A;  3HG9 A;  4FP5 D;  4XXE A;  1GUN A;  4K0K L;  1VQD A;  2JA7 G;  1MD2 D;  2PNR C;  3E5S A;  2RDG A;  1VQC A;  3K0Y A;  4LF4 L;  1A8V A;  4KKS A;  3HOV B;  1WTH A;  2F0J A;  4MTN A;  1H9K A;  1F2Y A;  4IFD I;  3M7G A;  1XJV A;  5E1F A;  1EY5 A;  1KNE A;  2A5H A;  3HRZ C;  3U58 A;  1VQE A;  2ZM6 L;  2QDB A;  4GZY C;  2HIV A;  1TR5 A;  2X6L A;  4DR3 L;  2M9V A;  1E1T A;  3E9I A;  3RLN A;  4OHJ A;  1TWF B;  2IX1 A;  4NDX A;  3NWS A;  4ZUJ A;  1VQ8 A;  4R4O A;  1XPO A;  4RFB A;  3HOY B;  2KEE A;  3AYH B;  2EYO A;  4A3F H;  1W6K A;  2F0W A;  4NXM L;  4P74 A;  2JSO A;  3DMU A;  1IW7 C;  5IYB G;  2F0K A;  4IFD J;  3VYR A;  4LF8 Q;  1CHQ D;  2FJ2 A;  5IWA Q;  2QDL A;  1M90 C;  1BCP B;  3FVQ A;  3D0F A;  1SE2 A;  1BBW A;  3KBX A;  4N9T A;  4EQ5 A;  3MEH A;  3DWP A;  3K0X A;  1LLR D;  2B63 G;  4AH6 A;  4B3S Q;  1H9S B;  1GM5 A;  3Q23 A;  2WB1 E;  1OXT A;  3X3M A;  1N33 L;  3TRZ A;  4C1N K;  3GO5 A;  1U4M A;  4UY8 C;  5J1Z A;  3NSW A;  3RLO A;  3L9A X;  3E3X A;  3R3O A;  1TT2 A;  1VQF A;  4A3G H;  2A19 A;  3FRP B;  3CF5 A;  3NTH A;  3M4P A;  3A8J E;  3RLF A;  1YNN C;  4ZUI A;  3DHQ A;  3LNN A;  1YHA A;  4V0B A;  1OTC A;  2O5I C;  4LF7 Q;  2SOB A;  4QB4 A;  2F0H A;  1JJC B;  3HKZ B;  3P20 A;  2NVY H;  4ZYS A;  5CGK A;  1BUV T;  4DV1 L;  1RDP D;  5GQO A;  4JBM A;  4B9W A;  2K5W A;  4BBR H;  5CV8 A;  4BY1 H;  4HAE A;  1E3P A;  2Q8R E;  4HTH A;  1IYJ B;  3PF4 A;  2CFM A;  2WB1 G;  1SYD A;  4H7B A;  4UP8 A;  1SLJ A;  2GVA A;  2QEX A;  1EFI D;  1EQR A;  1S4Z A;  4X66 L;  1JWU D;  2XVS A;  4JYA Q;  1MHW C;  4PMC A;  1X3E A;  3NP8 A;  2K5H A;  5IE8 A;  3M7N A;  3MWY W;  4RHS A;  2X69 A;  4XIG S;  1F9R A;  4U68 A;  1IKL A;  1HNW Q;  3SE0 A;  2R7Z H;  1SYB A;  1AW7 A;  3CPF A;  4X64 Q;  1LTG D;  2B2U A;  1ASZ A;  2J4X A;  3PO2 G;  1OO9 B;  3D4D A;  3MXG A;  4OON A;  4V19 0;  1EWH A;  3S1Q H;  4CJ2 C;  3J7A V;  4Z9C B;  3VYT A;  3BJU A;  1Q90 A;  4LWC A;  1PVO A;  4XQN A;  5HGT A;  2WKC A;  2AQ3 B;  4F8M A;  1GHK A;  4GNX C;  5C5L A;  2D0P A;  2PPB C;  1QUQ B;  3A8I E;  2B29 A;  3KDF A;  2A1A A;  1AE3 A;  4IUT A;  4B3T Q;  1F77 A;  2AHO B;  2UUB Q;  1DOL A;  2JA5 H;  4RMF A;  2B2V A;  5C3E B;  4JBW A;  3ZJY C;  3Q24 A;  2MJ8 A;  2WFW A;  3AQQ A;  3R2T A;  5IGB A;  1EOT A;  1FVI A;  5GAG C;  4A3K H;  2ZXO A;  1OXX K;  4WJW A;  1QNK A;  1I50 B;  4DV5 L;  1K0R A;  1T5E A;  1PXU A;  1RCV D;  1BKB A;  2F0F A;  3J7A F;  1SYC A;  4L5T A;  4HJA A;  1XX8 A;  2V4D A;  4BBR G;  4JV5 L;  2RCN A;  1WTQ A;  1FNV A;  4JI1 Q;  2EJM A;  1ICW A;  5IGD A;  1EWI A;  1EEI D;  4K2L A;  1QIL A;  4GS3 A;  5HUR A;  3A55 A;  4IOC A;  1K83 H;  3CCS A;  1K8O A;  1PA6 A;  4G57 A;  3GV3 A;  5IGF A;  4A93 G;  1O80 A;  2K6A A;  2D9U A;  4RG1 A;  2O5J C;  2NVQ B;  5IGC A;  1HCZ A;  3K5N A;  4P72 A;  3VDY A;  2RQX A;  3DWA A;  4GN5 A;  1BR9 A;  4F87 A;  2E2H H;  3RZO B;  1JOK A;  3I2Z A;  5K36 H;  2IHF A;  4DV2 Q;  5C4J H;  1I6H B;  2KEN A;  5M5X H;  2F0M A;  4KHV A;  4KI0 A;  2Y0S B;  2HIX A;  4L5R C;  1AZP A;  4LK1 C;  4DUZ L;  4A3E B;  3GTL B;  2DY8 A;  4GLX A;  4C3J G;  2JJQ A;  3N6R A;  1NAP A;  1NR2 A;  1ENC A;  2JA6 H;  4LF6 L;  1HH2 P;  3FMC A;  2LXK A;  3O13 A;  1K8G A;  1PTO B;  2RDF A;  1DOM A;  5BR8 L;  2JA5 G;  4I7A A;  1XYI A;  2EY6 A;  1FJG L;  4I65 A;  2QEJ C;  4MIU A;  1WTR A;  5M5Y H;  5KND A;  3FHW A;  1QG7 A;  2F4I A;  3ERO A;  4A3K G;  3S1R H;  1S5E D;  1IHZ A;  3TQY A;  2EYP A;  1KAA A;  2JA7 B;  1BF4 A;  5KRU A;  3K7A B;  2Q2T A;  3L2P A;  2ENB A;  2R93 G;  1XTD A;  3KJO A;  1QVC A;  3EQL C;  1PFN A;  4A3B H;  4CKE A;  1CSQ A;  4JI0 Q;  4DV7 Q;  2OQK A;  1PRT F;  5CR3 A;  4G7Z C;  2E5L Q;  2UXC Q;  4G4K A;  3TEH B;  1Z6H A;  4CGY B; 
#chains in the Genus database with same CATH homology
 3C1F A;  2XIW A;  5I6Y A;  2YYZ A;  1GUW A;  2VXW A;  1SBB B;  1OXS C;  1F9P A;  4KMU C;  3VR2 A;  2JEB I;  4K8I A;  2SNS A;  4DXG A;  2L9H A;  5CV4 A;  2JXM B;  3NBI A;  5I4D A;  3AB9 A;  1X32 A;  2B63 B;  3F2U A;  4NMZ A;  3H3V C;  3RD4 A;  3D8G A;  1SAP A;  4OIK A;  1CI3 M;  1WD0 A;  3PUZ A;  2MUY A;  2WAC A;  3QB3 A;  4TRD A;  4RH6 A;  5JJZ A;  3NBH A;  2AWO A;  2LMC B;  2KQ3 A;  5T1G A;  4WOR A;  1EIH A;  3QIA A;  2EVB A;  4OIJ A;  4DFA A;  2EPB A;  4PMB A;  1EY0 A;  1PZI D;  2WB1 B;  1H9M A;  1HA5 A;  1CZG A;  1A3T A;  1B44 D;  2O4X A;  3OIP A;  5TSS A;  1LTB D;  1KLG D;  2MGS A;  4A3F B;  4K2K A;  4IN3 A;  1LO5 D;  5EBD A;  1CM9 A;  5KGU A;  3JAM L;  2XNA C;  2K5D A;  5KNB A;  3PO2 B;  4UDU C;  3DUZ A;  1VCI A;  5ELE A;  2A6E C;  3NHH A;  2DN8 A;  2NB0 A;  2KUM A;  1NCV A;  1DZ1 A;  1RD9 D;  2EOT A;  1RHP A;  3A8K E;  4UAI A;  4IUP A;  4X3S A;  3T16 A;  1TS3 A;  2A68 C;  2G9D A;  2H4O A;  3HZX A;  3TP5 A;  5EGT A;  1SNO A;  2RKS A;  4BS9 A;  1M4V A;  4ULL A;  1G2S A;  2NVY B;  3SEB A;  3TZD A;  1KDA A;  1QJO A;  3RUZ A;  2F1M A;  5DAU A;  2DNC A;  2FIN B;  1ILQ A;  2G9H D;  4BBR B;  2K7V A;  4BY1 B;  5EPL A;  1STG A;  2EDG A;  1VF7 A;  3PUW A;  3VR3 A;  1JWM D;  3OHX C;  1JR0 D;  3SK8 A;  1STA A;  5JEA H;  4XDX A;  4HSP A;  1NSN S;  4KD4 A;  1I6V C;  2R7Z B;  2LS0 1;  3I4L A;  2A6E D;  4FXG C;  4NW2 A;  5EJW A;  3WDN A;  2SDF A;  1LT3 D;  2NBF A;  3S1Q B;  1AP0 A;  1BNZ A;  3H91 A;  5E4X A;  4K14 A;  2A68 D;  4IUV A;  1EY7 A;  2CHB D;  4RHR A;  5CV6 A;  2BDO A;  2JA5 B;  1C48 A;  1B2T A;  2BOS A;  3NE5 B;  4EVO A;  1TKW B;  4A3K B;  1SNP A;  3I3C A;  2WKD A;  1LV9 A;  3MC0 B;  1SDF A;  5G3L D;  3Q6S A;  1LTI D;  2EYJ A;  1L0Y B;  1YNJ D;  5A2Q L;  1HUM A;  1A2U A;  2ZT9 C;  1CQV A;  2KED A;  4FO2 A;  1K83 B;  4HR7 B;  4EQP A;  1EYD A;  4HCS A;  1CK1 A;  5AFW A;  1AN8 A;  2E2H B;  3NUC A;  5CMD A;  3CRK C;  4RKL A;  5C4J B;  4M1U B;  1AFP A;  1A15 A;  1ML0 D;  5M5X B;  3U9O A;  1G6Z A;  1EY6 A;  2F0S A;  4X3T A;  5ISR A;  2EYL A;  1LT6 D;  2JA6 B;  4C56 C;  1QCB D;  2L5T A;  1AZQ A;  2JYO A;  3SK5 A;  1WD1 A;  1A2T A;  1MBY A;  5IGG A;  3OWF A;  4FVM A;  3K5M A;  5M5Y B;  3MFY A;  3PIP 3;  3S1R B;  2KHS A;  3R2I A;  3T4A C;  1K8M A;  5LL6 S;  2IW3 A;  1D5Z C;  4DA2 A;  5C0X G;  2JE6 I;  4A3B B;  5C4Z A;  2IX0 A;  3P75 A;  2DNE A;  1WTV A;  1EY4 A;  2GA4 B;  2NN6 G;  2KCC A;  5COY A;  3MXU A;  3MXN A;  1LAC A;  4FF4 A;  1EQT A;  2B2W A;  1GOZ A;  1GUG A;  5BN5 A;  5J39 A;  4RKB A;  5FLX L;  1WVL A;  1ZYR D;  1D5M C;  2JP1 A;  5D3D A;  4AYB B;  1GHJ A;  3GTM B;  5C3W A;  3MHB A;  5ELB A;  1STN A;  2FFK B;  4OO1 H;  5T1I A;  1F9S A;  1ONL A;  4LJZ C;  1D6E C;  3TSS A;  1EU4 A;  4ZKB B;  1SNC A;  2F3V A;  4L63 B;  3QG1 A;  3IFD A;  4BWG B;  2XRS D;  1ESF A;  1R4P B;  1M8A A;  4DK1 A;  1ZEQ X;  1Q8I A;  2QCP X;  3SHL A;  3LWU A;  4ZQ3 A;  2K1B A;  2IT1 A;  1B3A A;  2QIL A;  1L0X B;  1LTR D;  2WIN B;  3N52 A;  1JOQ A;  1PRT B;  3TDQ A;  3E0J A;  2KCN A;  4DN4 M;  3D3R A;  1SNM A;  3RMH A;  1STH A;  2J0T D;  2HUG A;  2LFN A;  1TWA B;  3PIO 3;  5D14 A;  3J81 L;  4DXF A;  2E75 C;  3QOL A;  3S16 B;  3L7Z C;  3Q0A A;  2VB3 X;  2VB2 X;  1GXD C;  4TKO B;  2AQ1 B;  1HFG A;  2QKI C;  3OMC A;  1C4Q A;  4IZ8 A;  3D6W A;  1PZK D;  5IGE A;  4O1N A;  1EIG A;  5C0X I;  3JAM E;  4IQZ A;  4PV1 C;  4ID6 A;  4DAV A;  1SFO B;  4OO1 G;  5EBC A;  2CVR A;  1BQQ T;  2HCI A;  3ND9 A;  2NN6 I;  3H09 A;  2EY2 A;  2Q8T A;  1EZ8 A;  1CFM A;  2F0P A;  2RDH A;  3OSO A;  3CU7 A;  5C0X J;  1LAB A;  2Z1C A;  4KK7 A;  5IIF A;  1Y1W B;  3KLR A;  1QWY A;  5KIX A;  1E2V A;  3K6O A;  2F03 A;  4FNF A;  1DD2 A;  2RA4 A;  4OGQ C;  3SK4 A;  1HPC A;  4KJN A;  5DM6 3;  3EA6 A;  1FR3 A;  1TU2 B;  2BDN A;  1I4R A;  3I72 A;  4HMJ A;  5M3F B;  1LTT D;  1STB A;  4XQJ A;  3S1M B;  2CQA A;  2AWN A;  2Z4I A;  4A3M B;  1Q1E A;  4RGO S;  2NTS A;  4EQO A;  2OXP A;  5ELC A;  1U4P A;  1I4Q A;  3K59 A;  1JQY D;  4WRD A;  2IL8 A;  2PCF B;  4HN7 A;  2WII B;  2RSN A;  1FD7 D;  2LY7 A;  4H0L C;  3VR4 A;  3SVM A;  1GJX A;  1ILP A;  2E76 C;  4FYD A;  4BY7 B;  3HGB A;  3DXJ C;  1UNS A;  4RCO A;  4LMQ D;  1TWH B;  5LL6 X;  5G3L F;  3TBI B;  1IKM A;  5D3I B;  2KEC A;  5K36 G;  1TVX A;  1I4H A;  2B2Y A;  1VMP A;  1I4X A;  4HED A;  3L3O C;  1STY A;  1X3Q A;  4QUF A;  5EQ0 A;  1TS4 A;  2JEA I;  2YU9 B;  3QJY A;  3DM1 A;  3OMG A;  4Y7N B;  2EJF C;  1SYG A;  1II3 A;  3TN2 A;  3I4M B;  3R93 A;  1IYV A;  2WP8 J;  1A3U A;  1QE6 A;  3I4N B;  5LHY 1;  5A2Q E;  2HDM A;  3PV0 A;  2F0L A;  1DON A;  1BDO A;  2A73 B;  3K5L A;  1TS2 A;  1Z7T A;  3SR1 A;  3M4O B;  4HSV A;  3VA7 A;  1BCP C;  2KVM A;  1GUS A;  4DAP A;  3FEW X;  3SXH A;  2B2T C;  1HTP A;  1F2M A;  4H13 C;  3NPP A;  1D2B A;  1O7Z A;  5I2X A;  4ZAI A;  5I9P A;  3NTK A;  4A3J B;  2Q8I B;  4RAU C;  2KJX A;  3S9W A;  4XT3 B;  1D5X C;  4IFD H;  2XSC A;  1F2Z A;  5C4X B;  3D31 A;  2K01 A;  3V2T A;  1B50 A;  3R8B A;  2K33 A;  3BS1 A;  1SMY C;  2L12 A;  4IUQ A;  4KV6 A;  4Q5V A;  1KLU D;  2VNU D;  1G29 1;  2EZV A;  5CC4 A;  1CQF A;  3K58 A;  4G7O C;  3GTG B;  3BVM A;  4A3G B;  2ICE C;  2R92 B;  3ERQ A;  3C2P A;  1G2T A;  1BCP D;  4ZRZ A;  3VYU A;  5EPK A;  3MXP A;  1Y1V B;  3GTO B;  1NR4 A;  2PW7 A;  4OL7 A;  4KKU A;  1KNA A;  3HS0 C;  3NXW A;  2FMM A;  4RWS C;  4CJ1 B;  3DEO A;  3P1H A;  3KF8 A;  4ME5 A;  1FNU A;  1TWC B;  3SK6 A;  4F88 A;  4K5V A;  3HEJ A;  2L4N A;  1YNJ C;  5IOC A;  3P7J A;  5FLX E;  3A54 A;  3MA2 B;  2TMP A;  3KLS X;  4K6L A;  5CV7 A;  2ID0 A;  5IOD A;  1BXT A;  1U9R A;  1SMY D;  1UEA B;  4PNY A;  4DAY A;  3BVZ A;  2BE5 D;  1EY9 A;  3FPU B;  5DNF A;  1JC7 A;  1R9T B;  3GQB A;  1JOO A;  3E6Z X;  1F2L A;  2N55 A;  4I7Z C;  2OT2 A;  2WV6 D;  3WOF A;  3WOE A;  2F0G A;  3T13 A;  2F0N A;  1BO0 A;  1RJT A;  1Y8P B;  1PYW D;  3W3A A;  4HCE A;  3HOU B;  2L55 A;  1VMC A;  4QCL A;  1JCK B;  3G7L A;  3MTS A;  1T5X D;  2RBM A;  1BOS A;  5JPN C;  4FF1 A;  1SJE D;  1V1O A;  2F0D A;  5K5P A;  4EQN A;  3J81 E;  4KY6 A;  5I9O A;  4ZKC B;  4QIW B;  1PTO C;  4R8N A;  2EY5 A;  1WTX A;  3TP6 A;  5JEA G;  1LTA D;  4B08 A;  1JB3 A;  2BA1 A;  1SEB D;  1QB5 D;  1Y8O B;  1DJR D;  2BCO A;  1ROD A;  2A74 C;  2X6G A;  3AMU A;  3PO3 B;  1XTC D;  2F0O A;  1I4G A;  2IX3 A;  1Z47 A;  2R61 A;  3GD7 A;  1V1P A;  2EE1 A;  1ZYR C;  3UI2 A;  3IKJ A;  4Q0F A;  2DY7 A;  4O42 A;  3NQI A;  5IT9 L;  5M5W B;  2RSO A;  5CBE E;  3K5O A;  2M2L A;  1XXG A;  2E2I B;  4C3H G;  1HRJ A;  4KN7 C;  1S5C D;  2IJ0 A;  3HOZ B;  1SJH D;  4H44 C;  3DEP A;  1CZW A;  1SE3 A;  1DCZ A;  1SE4 A;  4XQQ A;  5JOB A;  4ODG A;  3BYT B;  1R4Q B;  4QF4 A;  4U67 3;  5NUC A;  1PTO D;  3CRL C;  3I90 A;  2NTT A;  3S2D B;  2PQE A;  1E2W A;  4CBV A;  3MZ5 A;  1D1I A;  4KJO A;  3BG3 A;  1G8Z D;  1NUC A;  1E2Z A;  2D5D A;  3GTJ B;  4F7X A;  4XT1 B;  2L0C A;  4DF7 A;  2HDL A;  1WCM B;  3ONA B;  3AU7 A;  3VR6 A;  2D2C C;  5C6A A;  2NZ1 D;  4FF3 A;  1VF5 C;  2SNM A;  1CA6 A;  3S2H B;  3M85 A;  4NP5 A;  2PZW A;  2VUM B;  3URY A;  3GTP B;  1KAB A;  1H9R A;  3CKI B;  3J7Y W;  4R9W A;  1G91 A;  3J80 L;  3BDC A;  4N9P A;  4BA2 I;  1KTK A;  1UUP A;  4XYO A;  1Q12 A;  1O7Y A;  4YIJ A;  1HUN A;  2HQE A;  5DM7 3;  3VA5 A;  2I46 A;  4CHT B;  2ICI A;  1J9O A;  3TME A;  2EYM A;  1U4R A;  1MSG A;  4FF2 A;  3X3N A;  1IW7 D;  2PMZ B;  4KKT A;  1QNU A;  5I2Y A;  3IAY A;  4J6H A;  5EPJ A;  5JEA J;  1OXU A;  2EYF A;  4KHZ A;  2N88 A;  3FKI B;  1DM0 B;  1B9M A;  5KYL A;  3HOX B;  1AEX A;  1S5D D;  1RTO A;  2R3Z A;  4R8I A;  1PMR A;  3GTK B;  3I91 A;  5KNC A;  5JPM C;  3NK9 A;  3I70 A;  4C3I G;  4FXK C;  3EJI A;  2B8F A;  1RKN A;  3MFG A;  4QMG A;  2NWG A;  2KOL A;  2PZT A;  1YNN D;  3RZD B;  2H1E A;  2F3W A;  2ZXR A;  2OF1 A;  4KD3 A;  4B9X A;  1Y8N B;  4A3I B;  1I3Q B;  1BCP F;  1FNW A;  4LAA A;  4KY5 A;  1XWE A;  5EKL A;  3KK7 A;  2J7Z A;  4EGV A;  4CKC A;  3A7L A;  3QWN A;  1JIC A;  2K04 A;  3FDT A;  1GUO A;  5CV5 A;  1WTP A;  4IUU A;  1B4O A;  1GUT A;  5FO9 B;  3PMF A;  3T51 B;  5FO8 B;  4G7H C;  2B2W C;  2M00 A;  3PUX A;  3TP7 A;  1B1Z A;  3T56 B;  4ABN A;  1ZKO A;  1OXV A;  5BN4 A;  4DU9 A;  4DNR B;  3H94 A;  2L1B A;  3MVV A;  5FO7 B;  2K05 A;  1H9S A;  2B2T A;  3C46 A;  4JK1 C;  3V96 A;  3BDL A;  1V8Q A;  5D65 A;  1HFN A;  1KDB A;  2E74 C;  2XN9 C;  3V05 A;  2MHV A;  4DGZ A;  2Z4H A;  2E2D C;  2IWH A;  5CBA E;  5E4W C;  3LX0 A;  4PQX A;  1SND A;  2F0T A;  4S3S A;  4L8J A;  3S17 B;  3OIQ A;  4CJ0 B;  4C2M B;  2HCC A;  4RGN A;  1IYU A;  4IUN A;  1J8I A;  1TII D;  2B2U C;  3ND8 A;  1ZXT A;  1HA6 A;  2K32 A;  1HTL D;  3KLS A;  2F0V A;  5KEE A;  1A6X A;  1HHV A;  2EJG C;  5C44 B;  4C3H B;  1STE A;  5JVH 3;  1SYF A;  1HQM C;  2OEO A;  1O7L A;  2NYZ D;  2AQ2 B;  1E0B A;  1VDZ A;  4RGM A;  3OWE B;  3M3Y B;  1X3P A;  3FPP A;  3TZU A;  2B2V C;  1LT4 D;  2MPM A;  1EU3 A;  2TSS A;  1RF2 D;  1UAP A;  5CV9 A;  1RTN A;  1ENF A;  2C5C A;  1C8C A;  2K5Q A;  4QUC A;  3QOJ A;  1EQV A;  2EXZ A;  2QF7 A;  1TS5 A;  4KTA A;  3BZD B;  2SEB D;  1O78 A;  2Z8L A;  2F0I A;  1Y69 U;  4OO1 I;  3PUV A;  3S14 B;  3GV6 A;  1TY0 A;  1TY2 A;  4J8Q A;  1SYE A;  4RGT A;  1DYQ A;  1WTW A;  4TSS A;  1ENA A;  3ZYY X;  3HOW B;  1EWC A;  1SNQ A;  3IL8 A;  3M4Y A;  5M9O A;  4ILW A;  3C3L A;  1EYC A;  4KN4 C;  1D1K A;  3K57 A;  1FYC A;  4FXD A;  1PZJ D;  4BBS B;  1EL0 A;  1LT5 D;  5BN3 A;  1LTS D;  1ET6 A;  1PLF A;  3A56 A;  4DNT B;  3Q22 A;  1HQR D;  3H0G B;  3G6J B;  1JE4 A;  4ZLT F;  5C3X A;  1CHP D;  5JVG 3;  4P2C B;  2K03 A;  3MAQ A;  5M3M B;  1PTO F;  5IT9 E;  1MGS A;  5CYU A;  3LWE A;  3H6M A;  4KY7 A;  4K5W A;  1S5F D;  4L6T B;  3EVQ A;  4WFN 3;  1PFM A;  3IFT A;  2O2L D;  4RCN A;  1CA5 A;  2BE5 C;  3D6C A;  1MSH A;  3NTI A;  2NVX B;  1QOH A;  5FOB B;  5ELD A;  2PO4 A;  3BDO A;  1IL8 A;  4K5X A;  1V1P B;  3D4R A;  1KDC A;  2L11 A;  2EYH A;  2WAQ B;  4X3U A;  3ITP A;  3BVG A;  2EY1 A;  2MP1 A;  1EZ6 A;  4RA8 A;  2XWJ B;  4C3I B;  3OPO A;  3QO2 A;  2LKV A;  3S15 B;  4X3K A;  2F0U A;  2PZU A;  5DEH A;  4PMW A;  3NWT A;  4HMI A;  5EKI A;  4MHE A;  2K28 A;  1JWS D;  2B2Y C;  3A7A B;  3U9S A;  3CHB D;  2CW0 C;  1JOR A;  3I8Z A;  1PRT C;  1V43 A;  1W6J A;  4NKL A;  2E2J B;  2I07 B;  1WTO A;  1Q3L A;  5F2D A;  4J1M A;  2A69 C;  4IFD G;  5FK9 C;  4XTC S;  3D4W A;  3W2D A;  1EYA A;  2D62 A;  1FGB D;  1I4P A;  2C9O A;  3J80 E;  2IPK D;  4BA1 I;  4XYQ A;  1PDQ A;  4A93 B;  1B53 A;  3VR5 A;  4MN3 A;  1PTO H;  1ESR A;  3T53 B;  5J22 A;  1A3V A;  3KBG A;  2A6H C;  2PW5 A;  2ZXP A;  3OW7 A;  5EKK A;  1HXY D;  1BBX C;  3BYY B;  3HP3 A;  1F9Q A;  3S1N B;  4IAL A;  3CQZ B;  2NUC A;  1U4L A;  2F0Q A;  3GP7 A;  5ELF A;  2F0E A;  4C3J B;  1TQO A;  1ET9 A;  1EY8 A;  1B9N A;  4TQU S;  1EEF D;  1S5B D;  3NQT A;  4IUR A;  4C1N I;  1MI2 A;  1Q1B A;  1DXM A;  4E6I A;  2CW0 D;  1CTM A;  1PRT D;  3OOC A;  4A3D B;  5C4H A;  1DOK A;  3SDZ A;  4CKB A;  2A69 D;  5JAV A;  5FKA C;  5C5M A;  2R6G A;  1CT1 D;  2B8G A;  3I73 A;  2RVL A;  3TP8 A;  5C0X H;  2FHT A;  2R93 B;  2AUJ D;  2XWB B;  1SXT A;  2B39 A;  2AUK A;  5E3F A;  3C1E A;  4K6D A;  4DK0 A;  2PYK A;  2XRQ D;  2NN6 H;  2FMC A;  5A35 A;  4ZK9 B;  5COR A;  3VYS A;  1SSO A;  2A6H D;  4M8A A;  2NVT B;  1TWG B;  3DWQ A;  2BA0 A;  3KUP A;  5I6W A;  2KA7 A;  3PUY A;  2JA8 B;  1H9J A;  4K8J A;  1PFB A;  3EFX D;  5KYI A;  3GTQ B;  3HG9 A;  4FP5 D;  4XXE A;  1GUN A;  1MD2 D;  2PNR C;  3E5S A;  2RDG A;  3K0Y A;  4KKS A;  3HOV B;  2F0J A;  1H9K A;  1F2Y A;  4IFD I;  3M7G A;  5E1F A;  1EY5 A;  1KNE A;  2A5H A;  3HRZ C;  2QDB A;  4GZY C;  1TR5 A;  2X6L A;  2M9V A;  4OHJ A;  1TWF B;  2IX1 A;  4NDX A;  3NWS A;  4ZUJ A;  4RFB A;  3HOY B;  2KEE A;  2EYO A;  1W6K A;  2F0W A;  2JSO A;  3DMU A;  1IW7 C;  2F0K A;  4IFD J;  3VYR A;  1CHQ D;  2FJ2 A;  1BCP B;  3FVQ A;  1SE2 A;  3KBX A;  4N9T A;  3MEH A;  3DWP A;  1LLR D;  1H9S B;  3Q23 A;  1OXT A;  3X3M A;  4C1N K;  3GO5 A;  1U4M A;  5J1Z A;  3NSW A;  3L9A X;  3R3O A;  1TT2 A;  3FRP B;  3NTH A;  3A8J E;  3RLF A;  1YNN C;  4ZUI A;  3DHQ A;  3LNN A;  4V0B A;  2O5I C;  2SOB A;  4QB4 A;  2F0H A;  3HKZ B;  3P20 A;  4ZYS A;  5CGK A;  1BUV T;  1RDP D;  4B9W A;  2K5W A;  5CV8 A;  4HAE A;  2Q8R E;  4HTH A;  1SYD A;  4H7B A;  1EFI D;  1S4Z A;  1JWU D;  2XVS A;  4PMC A;  3NP8 A;  3M7N A;  3MWY W;  4RHS A;  2X69 A;  4XIG S;  1F9R A;  4U68 A;  1IKL A;  3SE0 A;  1SYB A;  1AW7 A;  1LTG D;  2B2U A;  2J4X A;  1OO9 B;  3D4D A;  3MXG A;  4V19 0;  1EWH A;  4CJ2 C;  3J7A V;  4Z9C B;  3VYT A;  1Q90 A;  4XQN A;  5HGT A;  2WKC A;  2AQ3 B;  4F8M A;  1GHK A;  5C5L A;  2PPB C;  3A8I E;  4IUT A;  1F77 A;  1DOL A;  2B2V A;  5C3E B;  4JBW A;  3Q24 A;  2MJ8 A;  3R2T A;  5IGB A;  1EOT A;  2ZXO A;  1OXX K;  4WJW A;  1QNK A;  1I50 B;  1T5E A;  1PXU A;  1RCV D;  2F0F A;  3J7A F;  1SYC A;  1XX8 A;  2V4D A;  1WTQ A;  1FNV A;  2EJM A;  1ICW A;  5IGD A;  1EEI D;  4K2L A;  1QIL A;  5HUR A;  3A55 A;  1K8O A;  4G57 A;  3GV3 A;  5IGF A;  1O80 A;  2K6A A;  2D9U A;  2O5J C;  2NVQ B;  5IGC A;  1HCZ A;  3K5N A;  2RQX A;  3DWA A;  1BR9 A;  4F87 A;  3RZO B;  1JOK A;  5K36 H;  1I6H B;  2F0M A;  4KHV A;  4KI0 A;  2Y0S B;  1AZP A;  4LK1 C;  4A3E B;  3GTL B;  2DY8 A;  4C3J G;  3N6R A;  1NAP A;  1NR2 A;  1ENC A;  3FMC A;  3O13 A;  1PTO B;  2RDF A;  1DOM A;  1XYI A;  2EY6 A;  4I65 A;  2QEJ C;  4MIU A;  1WTR A;  5KND A;  1QG7 A;  2F4I A;  3ERO A;  1S5E D;  1IHZ A;  2EYP A;  1KAA A;  2JA7 B;  1BF4 A;  5KRU A;  3K7A B;  2ENB A;  3EQL C;  1PFN A;  4CKE A;  1PRT F;  5CR3 A;  4G7Z C;  4G4K A;  1Z6H A;  4CGY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...