1HFGA

Nmr solution structure of vmip-ii 1-71 from kaposi's sarcoma-associated herpesvirus (minimized average structure).
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
71
structure length
71
Chain Sequence
LGASWHRPDKCCLGYQKRPLPQVLLSSWYPTSQLCSKPGVIFLTKRGRQVCADKSKDWVKKLMQQLPVTAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chemokine
molecule keywords VIRAL MACROPHAGE INFLAMMATORY PROTEIN-II
publication title Structure/Function of Human Herpesvirus-8 Mip-II (1-71) and the Antagonist N-Terminal Segment (1-10)
pubmed doi rcsb
total genus 10
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2000-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1hfgA00
2Q8RE 2Q8TA 4CJ1B 4CJ2C 4X3SA 5JJZA 4X3KA 1O80A 1AP0A 2HCCA 5EKIA 4RAUC 1IL8A 1X3QA 4HCSA 1F2LA 2D9UA 2MJ8A 2NZ1D 4X3TA 4XT1B 1EIHA 4RWSC 1PLFA 3DM1A 4IUVA 1WTXA 1BBXC 1HHVA 1WTPA 1M8AA 1U4LA 1BO0A 2H1EA 2B2YA 2K28A 3F2UA 3GV3A 1ESRA 1HUMA 1BNZA 2DY8A 1F9QA 1SAPA 5EPLA 3I8ZA 4HEDA 4ZLTF 4ZK9B 3R93A 3I3CA 1WVLA 1KNEA 1U4PA 1VMCA 2B2YC 2FFKB 2HDLA 2RSOA 1WTQA 1EOTA 1NAPA 3Q6SA 2CVRA 1WTWA 4ZAIA 1RTOA 1XX8A 2K01A 1SDFA 1G2SA 2B2UC 1PFBA 1RJTA 3HP3A 1F9PA 1Q3LA 1WTOA 2L1BA 2J7ZA 1DZ1A 2KEDA 1O7ZA 4OIKA 1DOKA 4U68A 1G91A 2N88A 1A15A 1SSOA 3MTSA 1JICA 1MSGA 2RA4A 2B2VA 3KBXA 5D14A 3TZDA 2K04A 1NR4A 1RHPA 2FHTA 2K1BA 3DEOA 2SDFA 2B2TA 3KUPA 1B53A 1CA6A 2EE1A 1HUNA 1EIGA 1HRJA 5EPKA 2B2VC 1QG7A 2MPMA 3UI2A 4NW2A 2JYOA 5T1IA 1U4MA 1WD0A 1TVXA 1GUWA 1HFGA 5T1GA 1NR2A 5D65A 5DNFA 1RODA 1B3AA 2L4NA 4IURA 2IL8A 3SVMA 4QUFA 3D6WA 4IUUA 1XYIA 4HAEA 2NYZD 2RSNA 2KEEA 1F9SA 1DONA 2L9HA 5E4WC 3DEPA 2NWGA 2K05A 1PDQA 1WTVA 1NCVA 1IKLA 5AFWA 1HFNA 2KUMA 4OIJA 4LMQD 4UAIA 1VMPA 1WTRA 4DN4M 2EPBA 2FINB 4IUTA 1AZQA 5EQ0A 2M2LA 2X69A 2RVLA 2VXWA 4HSVA 2K03A 3H91A 5CBAE 3FDTA 1B2TA 1C8CA 2KVMA 3IFDA 4R8IA 1MSHA 1B50A 2L12A 1CM9A 3LWEA 3ONAB 5COYA 2EOTA 2HUGA 1LV9A 1MGSA 1S4ZA 1G2TA 2B2WA 2KECA 1AZPA 4ZKCB 1G6ZA 2B2TC 4IUPA 2L11A 5EJWA 1B4OA 4MN3A 2X6GA 1KNAA 4CJ0B 3IL8A 1U4RA 1ILPA 3I90A 1DOMA 2N55A 3I91A 1O7YA 1J8IA 4XT3B 1ZXTA 2B2WC 3QO2A 4MHEA 4O42A 4RA8A 3TN2A 2R3ZA 4QUCA 1PFMA 1F9RA 2BDNA 2FJ2A 4R9WA 2HCIA 1RTNA 4ZKBB 1EQTA 1IKMA 2XIWA 1X32A 1ML0D 5CORA 1ICWA 1EL0A 2X6LA 4X3UA 4IUQA 3GV6A 1PFNA 2JP1A 2FMMA 2KOLA 1ILQA 3P7JA 1WD1A 2MGSA 2B2UA 1DOLA 1J9OA 2MP1A 3FPUB 5CMDA 1HA6A 1CA5A 3N52A 1QNKA 5EPJA 1E0BA 1QE6A 1JE4A 2HDMA 5E4XA 2DY7A 1BF4A 3G7LA 4XDXA 1X3PA 1MI2A 3MWYW 5CBEE
chains in the Genus database with same CATH superfamily
3PQIA 4A3EB 2L55A 2LFNA 3L2PA 2NVYH 3LNNA 4A3EG 1R9TB 3CAMA 2EQSA 3K80C 5M5YH 5I4DA 1PTOC 2OQ0A 2QILA 1JJCB 3FVQA 1K9MC 1EWIA 4LJZC 2UUAQ 2OEOA 1U9RA 1WTXA 2NN6H 2E5LL 1BO0A 2JK8A 3HKZE 4XYQA 2DJFC 2DY8A 3CMAA 5J39A 1LTTD 4HEDA 1SYGA 1DGSA 1UE7A 3QOJA 1G8ZD 4KHPL 1PH7A 4DUYQ 1RJTA 2JEBI 4DV3Q 4C1NI 4KN7C 2UXDQ 3ZJYC 3K0YA 2V4DA 3ERQA 4RMFA 1DD2A 4JG2A 1PH9A 5CV9A 4TQUS 1SYBA 2OWOA 2WFWA 3A0JA 1W3SA 3HEJA 4C3IB 4K5VA 5JJLA 1S5FD 4JV5Q 4BBSB 4QUFA 4C3IG 4GLAC 3GTPH 1F9SA 4DUYL 1QNUA 1Q8IA 1HFNA 5ISRA 4LMQD 3DLLA 1SNCA 2VZAA 4APVA 5DEHA 1B2TA 2F4VQ 1CZGA 1L2FA 1FNVA 2YV5A 2EJMA 2A5HA 1N34Q 4ID6A 1YJNA 2HUGA 3S14H 4A3JH 1E2VA 4ZKCB 1PTOF 4IFDH 1CT1D 4P2CB 3VA7A 1U4RA 3I90A 3QG1A 5CV6A 4GN3B 1T9HA 3HOZH 3PO2H 3QO2A 4WJ4A 4JV5L 1IYUA 5M3MB 2BDNA 2I5LX 3RZOB 1PMRA 5M3MG 1RKNA 5IGFA 2F52A 3I4MB 3QB3A 2OXPA 5HURA 1O7LA 3I4MG 4IZ8A 4A93H 1HA6A 5IGGA 2K52A 3G48A 3JAME 3I4LA 4FDBA 3GTMB 5JEAH 1N34L 4BY7H 1JMCA 1TWAH 1NNXA 4YCUA 5IGEA 4A76A 4RCOA 1RCVD 2Z4IA 1VQPA 4XT1B 2I07B 1UUPA 1H9JA 1Q12A 2JN4A 1IBKQ 1K0SA 2RCNA 5LMNL 1MJEA 1EEID 1K73C 5I6YA 5I9PA 1AN8A 2SNSA 2DJGC 1K8OA 4FF1A 2SNMA 2Z6KC 3RMHA 1ICFB 1VQOA 1XMOQ 1BUVT 1Y14B 2IWHA 1I6VC 4KKSA 1JWSD 1SDFA 4L5QA 1JOOA 2PI2A 3Q22A 4DR1Q 2LXJA 1NMGA 2KEDA 4IFDI 3GO5A 1FNWA 4C2MH 1G91A 3CCJA 5HY6A 3WDNA 2CQAA 1SFOB 3T53B 2F3WA 4GKKQ 1N36Q 2R7ZH 3S24A 1BBUA 1IBKL 4M1UB 5IY0A 2NVYB 3D6CA 4ILWA 3M3YH 2KBNA 4U673 1DXMA 2JYOA 4PZ7A 2QF7A 2OTLA 5M5YB 5I2YA 2PQAA 2CW0C 2ZJPA 1XMOL 2L4NA 4R4OA 2LKVA 1GJXA 3TBIB 1QJOA 2GVBA 1DM0B 3Q23A 3NELA 3AYHB 3HG9A 1S5ED 5FLXE 5A2QL 3UDFA 5EQ0A 2M2LA 2Z6BA 2F0OA 5IT9c 2PQAB 4XXEA 4GKKL 1N36L 4I7ZC 1HZAA 1S4ZA 1TKWB 4J6HA 2WKDA 4LWCA 2PW7A 1C9OA 5AJ3Q 4RGTA 4A3GH 2X6GA 1A3TA 1ENAA 2DNCA 1BXTA 1PH8A 3A54A 2BA0A 2F3VA 3TN2A 5TSSA 4FP5D 1LT4D 1EQQA 5CORA 1SXTA 2DNEA 4X64Q 2KOLA 3P7JA 2K5QA 2SEBD 3N52A 3GTPB 4JI6Q 2XWBB 3L9AX 2JSOA 4B3RQ 3UDXA 1Y1WH 4A75A 5AJ3L 4K0KQ 4KJOA 2NZ1D 1LTGD 1E24A 1EY8A 2EYOA 3DM1A 4XQJA 3S14B 4A3JB 2Z1CA 2O2LD 3NP8A 5K5PA 1PZKD 4A3BH 4DV2Q 4A3JG 1XNQQ 5NUCA 4AQYQ 2AHOB 3H94A 4IFDG 1SYEA 3HOYH 1GD7A 1QUQA 4OWXB 4A3IH 1KNEA 1Z47A 4OELB 2B2YC 5BR8Q 4DV1Q 4UY8C 3HOZB 3PO2B 5CR3A 3HOZG 3PO2G 3PCOB 5DLQE 2IX0A 1HJPA 4DAYA 3W1BA 3OTOQ 3IRBA 5FLMH 4B3RL 4OEMB 4FYDA 3ULPA 3HGBA 4KK7A 5D3IB 2BH8A 4OIKA 2EVBA 1VQMA 1GVPA 3J7ZC 4K0KL 2B2VA 1LT6D 3V2TA 1NR4A 1E7ZA 2NB0A 4POFA 4A93G 3EROA 2G9HD 4DUZQ 5C4HA 2HHHL 4FXKC 4BY7B 2D0PA 1TWAB 4WRDA 5JEAG 1HUNA 2HIXA 1FYCA 3LGJA 4BY7G 4DV2L 3HOXH 1H9SA 4HJAA 4NW2A 4AQYL 1N32Q 1TVXA 2N78A 3KJOA 5BR8L 1QOHA 3J80E 3MXGA 5KRUA 5HGTA 2NWGA 4KHZA 1SNDA 4XQNA 1KRSA 3OW2A 1LLRD 5IP9H 3MXUA 4BBRH 1H9SB 3KF8A 4OHJA 3V96A 1QVFA 4QMGA 3IFDA 3DWAA 3LWEA 4DUZL 2EOTA 2F0JA 1MGSA 2B2WA 1G6ZA 4C2MB 1GUNA 5EJWA 3WWVA 3J7AF 2AWOA 1N32L 3KLSA 4KD3A 3PF5A 2R7ZB 4NB3A 2XNAC 2ZXOA 2R7ZG 1F9RA 3M3YB 2F0GA 4EQ5A 1TY0A 5KYLA 1A0IA 3Q8DA 4HMJA 1UEBA 4IOAA 4NXMQ 1QILA 4QB4A 1FVIA 5ELOA 4DAVA 1VQDA 4ME3A 3K8AA 4PMBA 1QVCA 5C0XH 3FHWA 1O80A 1GOZA 5EKIA 3H3VC 4IFDJ 4O0AA 1H9MA 3S16H 1Q81C 2QDBA 2NTTA 2ICEC 2R92G 3U4VA 3U58A 2K28A 1GUGA 5J3BA 3OWFA 3MHBA 4A3GB 4A3GG 1LTAD 1B1ZA 3I3CA 3CF5A 4NXML 3TEHB 3RNUA 1E22A 2H5XA 3E0JA 2BE5C 3CKIB 4RKBA 5JEAJ 4DV6Q 3BJUA 2KHSA 1N9WA 2BDOA 3P20A 4A3KG 1WCMH 2JXMB 3WOFA 1HR0Q 4CDFC 3MXNA 1RHPA 2B3GA 2FXQA 3KUPA 1NTGA 3H09A 1QB5D 1Y1WB 1IBLL 3HRZC 2E2DC 3D4DA 3K5NA 1Y1WG 2CW0D 1KLUD 1YHBA 1SROA 1VF7A 1LTID 4R4QA 3TS2A 1OO9B 1CI3M 4A3FH 1PHJA 3GDEA 1J6QA 1LUZA 4DXFA 3MXNB 2KENA 3GTOH 4QY7A 4LF9L 4A3BB 2XSCA 1K3RA 1BDOA 3NENA 3M4OH 4A3BG 1JE5A 4DV6L 3BVZA 5C0XI 3HOYG 1RL2A 4JI2Q 3SHLA 3TZUA 1HR0L 1CHQD 2K03A 4A3IG 3FDTA 2JE6I 1B50A 3ICEA 1SE3A 1BCPB 2CHBD 4KN4C 1PZID 3KLWA 2B2TC 4IUPA 5FOBB 3P75A 2F0QA 4YCVA 1GXDC 4ULLA 3GTGH 4KMUC 4ZQ3A 4LAAA 3G6JB 4XTCS 2LSSA 3KOJA 1VQHA 4DKAC 3EIVA 2F3IA 4XQQA 1F2ZA 1STAA 2EXDA 4KD4A 1KXLA 1SR3A 5C4XH 3HOXG 4H44C 1K28A 1WD1A 4JI2L 1YNND 2BOSA 1CUKA 1TS4A 1XJVA 1JCKB 1KIXA 4LF4Q 4BBRB 1NUCA 3L0OA 1JOQA 5IP9G 4KY6A 1CTMA 2K7VA 1V8QA 4BBRG 1SJED 2D9UA 2QGQA 4Q0FA 4X3TA 4RGMA 3FMCA 1EOVA 3EFXD 1E3PA 3PIOA 5FJ8H 1E1OA 1EWHA 4RGNA 1VQBA 3JAMc 1SYDA 3QWNA 1N33Q 5IGBA 2LS01 3NBIA 4C3HH 1Y8NB 1VMCA 1JR0D 1R4PB 3BYYB 3H6MA 3J81j 4LUZA 1I50B 4CKBA 4P73A 2VUMH 4OX9Q 2EY1A 4XIGS 1Q3LA 2JA8H 4O2DA 4KI0A 1SYCA 4LF4L 4R8NA 1A15A 4JI4L 1MSGA 3NWTA 3PIPA 2FHTA 1S5CD 2OTJA 4LFAL 5IWAQ 2KCNA 3M9BA 4QIWB 2CWPA 2QEXA 1AEXA 1QG7A 1WFQA 5M5XH 1NMFA 3K5OA 1VQGA 4RHRA 5C3EB 5C0XG 2XWJB 1CZWA 2Q2UA 3S16B 1KD1C 4AYBB 4CBVA 4LNQA 3WOEA 1AFPA 1IYVA 4J1MA 2IX3A 2IL8A 4AYBG 2PZWA 1LACA 3A7LA 5IYBH 1D5MC 2TSSA 1KHIA 1IKLA 1LM0A 3I4OA 3L3OC 2IHEA 3T51B 4JI7Q 1EYCA 1KTKA 2WAQE 2A6HC 4A3DH 1I4QA 2Q2HA 5COYA 4X62Q 5IWAL 2F0KA 3CPFA 2KECA 2HIVA 1WCMB 3J81E 1B4OA 2VQEQ 2ID0A 2C35B 4HR7B 1EYDA 3UE0A 1J8IA 5IGCA 2A68C 3X3MA 5FLXc 1CKOA 2PMZE 3CQZH 4IJHA 2D2CC 1K0RA 3GTQB 1SE4A 2A73B 3E0EA 1JJ2A 4JI7L 3BZDB 4OWWB 1SMYC 3URYA 4A3FG 1D1KA 3JAMi 4LW1A 1CA5A 2XN9C 4OL7A 4FF3A 2F03A 3U9OA 5CC4A 4IN3A 4JI5Q 3MWYW 2F0PA 2Q8RE 4NKLA 2QA4A 1X6OA 5JAVA 1JB3A 2PO4A 5JJZA 1AP0A 3RUZA 3M4YA 5FO8B 2VQEL 2E5LQ 4HCSA 1F2LA 1XWEA 2JQOA 3A55A 1HZ9A 1ENFA 4E6IA 3H0GH 3E9HA 1M8AA 2EIFA 3F2UA 1VF5C 3SK8A 4QGUA 3J80L 3BZKA 1SAPA 4DPGA 3GTGB 1TXYA 3TREA 4AYBE 1GUTA 1U4PA 2BE5D 4KHPQ 1WTWA 3ULLA 2A69C 1VQ6A 2K01A 4GOPA 1JORA 1KAWA 4JI5L 5C4XB 2B8FA 5C4XG 1SBBB 3VYTA 3KBXA 3FEWX 3STBD 2K04A 5C0XJ 5IP7H 5G3LF 4LF7Q 3HOVH 4MZ9A 4GOPB 2L15A 3PUXA 1XNRQ 2KA7A 3CCQA 2OCEA 1TWCH 5T1GA 1NR2A 1Q7YC 3OSOA 5FKAC 3BVMA 2PNRC 1GM5A 4C3JH 5FJ8G 1Y8OB 4C1NK 3CXCA 2IJ0A 4XYOA 5I6WA 2CWAA 4IUTA 4C3HG 4PZ6A 2X69A 1B70B 2VL6A 5EBDA 2NUCA 4R8IA 5F2DA 2IHFA 4GLVB 3CD6A 1CKMA 4LF7L 3CCEA 2VUMG 1G2TA 2XRSD 1UAPA 4Y7NH 3MC0B 4ABNA 2JA8G 2N8NA 4LFCQ 1XNRL 3D4WA 3IL8A 4K2LA 4DV0L 1MBYA 1MJCA 2RHQB 1YNJC 5LMUQ 2CKZB 4HSPA 1EFWA 3RLOA 5JPNC 4FNFA 4R9WA 3PGZA 5M5XB 1F77A 1X32A 2D62A 4JI8Q 2X6LA 1IHZA 1LO5D 3J7AV 1EZ6A 4FVMA 1J9OA 4UP9A 1W6JA 5KEEA 2HDMA 5E4XA 4DV7Q 3CCLA 5CV7A 1JJGA 3G7LA 2XGTA 4NXNL 5IYBG 2R93G 5M5WH 1IW7D 4MTKA 4A3DB 4IJLA 4X3KA 4LFCL 2GN5A 4A3DG 1PLFA 5LMNQ 5LMUL 1HHVA 3DMUA 4HIMA 1FR3A 2F0HA 4JCVE 2RF4A 4ALPA 4JI8L 3P1HA 1XTDA 4N9PA 1PV4A 4A4IA 4K14A 5I9OA 2XRQD 3CQZB 4DV7L 2K5WA 3HP3A 1F9PA 1PH3A 1E2ZA 4K6DA 4IUNA 4KKUA 2Z4HA 4N8X1 3R2TA 3S17H 3EJIA 1PVOA 3RLFA 4JBKA 3UDGA 1IZ6A 2VQFL 3ZYYX 1STNA 3PV0A 5D3DA 3K7AH 5M9OA 5C44H 1XPRA 1C48A 3FP9A 3H0GB 4EGVA 4EQOA 1EU3A 3H0GG 5E4WC 3A5UA 3DEPA 1LT5D 1KDCA 2A6HD 1Q86C 3VR3A 4JI3Q 4UAIA 2DN8A 3CCMA 2F0DA 3MVVA 5ELNA 3K5MA 1PYWD 1T5XD 1PA6A 3SR1A 3AQQA 4DU9A 1TS3A 3KF6A 1KDBA 4GS3A 2Y0SE 4IPGA 1LTRD 2F1MA 2NVTH 4IOCA 4PMCA 3R8BA 1VQCA 4MHEA 5IP7G 3HOVB 2R3ZA 2R7DA 3KF6B 3M4QA 4IQZA 3HOVG 4B3MQ 3OYYA 1QZGA 3HS0C 4NDXA 1TWCB 1HZBA 4FF4A 4JI3L 1CSPA 5KNBA 2MGSA 4RHSA 3TQYA 1SNMA 2EY2A 2Z8LA 2R92H 5EPJA 1EY5A 4C3JG 5JVG3 3S1NH 5CV8A 2EDGA 1UE1A 2PYKA 3NE5B 5C4ZA 1I4RA 4RAUC 4P71A 2EYMA 3VR4A 4GKJL 2KHJA 3VR6A 4Y7NB 5JJKA 4A3KH 3K59A 1Q1BA 1ONLA 2Z0SA 2ZTDA 4B3ML 1O78A 3TRZA 2MO0A 1OXTA 3GTLH 3QR8A 3I72A 5BN5A 5GQOA 1X3EA 2C5CA 1PTOD 3M7GA 1G6PA 4JOIA 3TP6A 3H15A 3CCSA 3TZDA 3J81L 2HHHQ 4JK1C 1B53A 1U0LA 4GLXA 2ZJRA 3S2HH 1PH6A 2EE1A 4DK1A 5M5WB 1WTHA 4YWMA 2B2VC 4Z9CB 2MPMA 1D6EC 3W3AA 4YWKA 5T1IA 3J7A5 1B3AA 1X3FA 4HIKA 2NYZD 2RSNA 3R3OA 1Y1VH 1PDQA 1WTVA 1NCVA 1G51A 4A93B 1VMPA 2WIIB 1QUQB 3MEFA 5ELEA 1PYBA 2KCMA 3ONAB 4DAYB 4LF5L 4DAPA 1X9NA 1TIID 2A74C 2C9OA 2O4XA 2B29A 1FJGL 2G9DA 3MZ5A 3S17B 2A1AA 5GAHC 4DR4Q 2B2WC 2IPKD 4RFBA 3LWUA 2ZM6Q 2K75A 1PRTB 1ML0D 1TU2B 3K7AB 4PG3A 2KJXA 1D8LA 2Z9HA 1GUSA 3BDOA 4JVZA 3U9SA 1PFSA 5C44G 1L0WA 2MP1A 2TMPA 4EQNA 1WJJA 4GNXA 3OMCA 1I4HA 5CBEE 1CK1A 4BA1I 4HTHA 1KQSA 2MNAA 2JA5H 3H3VI 1CQVA 3KF8B 2E8GA 4KTAA 3GTKH 3S1QH 3TMEA 4JI0L 4DR4L 1TQOA 1HNWL 2ZM6L 4GNXB 1YI2A 3BYTB 2NVTB 2KHIA 1PRTF 1IBMQ 4ZLTF 2CFMA 4H13C 1VQJA 1EY0A 1ET6A 4ZAIA 1NY4A 4X6AH 1V43A 2IT1A 4J8QA 1X56A 4DV5L 1L0YB 1I4XA 2ZTEA 4K5WA 2ALYB 2AQ3B 3X3NA 1YITA 2R92B 2VB2X 2RA4A 3DEOA 1IBLQ 2RBMA 1EY9A 3S1NB 1JC7A 1A2TA 1HTPA 4RG1A 2R6GA 1V1PA 1STEA 1OTCA 1IBML 1YEZA 4L6TB 3BVGA 2AUKA 2PW5A 4LF9Q 2ZT9C 3W2DA 5KNDA 3V05A 1NJIC 4RH6A 4A3KB 1DONA 2L5TA 4H0LC 2F0MA 1U5KA 1Z9FA 5AFWA 2B63H 1MIUA 1V1PB 4R4TA 4DAMA 3GTLB 1BCPC 4AIMA 4Y52H 2A19A 2K33A 3ERSX 3S1RH 1CKNA 3IAYA 4MTNA 3I55A 1VQ7A 3S2HB 4DNRB 5KNCA 4JW0A 4X65Q 2BCOA 3CRLC 3HOYB 1EL0A 4DR5L 4A3IB 1TS5A 5C6AA 1CKNB 2AUJD 3D8GA 2VNUD 2J0TD 5GAGC 2MHVA 2E2IH 1X65A 3DHQA 4HN7A 1FL0A 1II3A 1Q1EA 1ESFA 4P72A 4JC0A 4S3SA 1V1QA 1Y1VG 4X3SA 4CJ2C 4DR3Q 3F8TA 5IGDA 2EY6A 5C4JH 2ZXPA 1W2BA 3CC4A 4KKTA 3CP0A 5E3FA 2HT1A 4CHTB 3HOXB 1HA5A 2EYPA 3JC66 4K5XA 1EIFA 1X3GA 1HUMA 4X65L 2IX1A 4DXGA 3Q24A 5IT9E 2WAQB 3O13A 1YJWA 1B8AA 1WTQA 1EUJA 2HDLA 2WAQG 3DM3A 3Q6SA 3U4ZA 3FKIH 4MNOA 1VS0A 3NSWA 1G2SA 3TP7A 1BCPF 3AB9A 1WYDA 2PZTA 4UP8A 1WTOA 4JI4Q 3D31A 5KYIA 2YYZA 4K2KA 2N88A 4RKLA 4DR3L 3R2IA 2I5HA 4LFAQ 4JYAL 2WKCA 4EQPA 2SDFA 2B2TA 1F2MA 2BH2A 2PMZB 1XPOA 1JQYD 4TSSA 4L5TA 3NTKA 2JA5B 1OXUA 2G5DA 1WD0A 3T13A 2JA5G 4V0BA 5D65A 4HCEA 5DNFA 3TS0A 3GTKB 2M00A 3T56B 3S1QB 2RDGA 4GN5A 4IURA 3OMGA 4JBWA 4IUUA 1TWGH 4DFAA 2KUMA 3PUYA 4DN4M 2Q2TA 3EN2A 4QJFA 3AFQA 4JPBW 2RVLA 2VXWA 2EYJA 1OXSC 1TR5A 4CKCA 1Q82C 2RKSA 2L12A 3E5SA 1LYLA 1NSNS 2E75C 2R61A 1ASZA 4FO2A 1E2WA 4WORA 4MN3A 1PTOH 4PZ8A 2RCFA 4DK0A 3T1HL 1EIYB 5IYDH 1ZXTA 1STHA 3C3LA 2R93H 3PF4A 4BBSH 1UEAB 2EYHA 3UDIA 1VQFA 2FMMA 2EJGC 2VB3X 1V9PA 1EY7A 5L37A 1D5ZC 3LX0A 1QE6A 5H1SE 4DR6L 4DF7A 3NEMA 5LMNW 3KDFA 3M4PA 1CSQA 3VA5A 2MUYA 2UU9L 2B63B 3CU7A 4TRDA 2XTIA 3RZDH 2B63G 4YWLA 1HNXQ 2QKIC 2F0SA 4KY5A 1EQVA 5ELCA 2DGYA 2N3SA 3PUVA 1SMXA 1DYQA 3S1RB 4EX5A 1YJ9A 1QVGA 5DAUA 3KDFB 3S1MH 2OT2A 4G4KA 4A3FB 4OONA 5FK9C 3GTOB 2RSOA 1EOTA 1NAPA 3A56A 3M4OB 1VQEA 3CRKC 2B2UC 1VQ9A 4H7BA 2B39A 5GROA 3EA6A 3C46A 4B9WA 4L5SA 3I4NH 4U68A 1X55A 3MTSA 1L1OA 2E2IB 5D14A 3NQTA 1HNXL 4GOPC 3KJPA 4V190 2GA4B 3SK5A 3PSIA 1S3OA 4DK3C 2JA6H 2MFIA 4UDUC 1S5BD 1Y69U 2NVQH 1RIPA 1A8VA 3NUCA 5C4JB 4FXDA 5DM73 1IL2A 3PMFA 1RODA 1L1OB 1PH5A 4IPHA 1C0AA 5BN4A 1SE2A 3T16A 1SE8A 2L9HA 3KK7A 1M1KC 4L8JA 2E74C 1WTRA 3I2ZA 2R7FA 4QQBX 2A8VA 2EPBA 2FINB 3T1YL 4O1NA 3K6OA 1C8CA 3FKIB 3AFPA 3VR5A 1SFOH 1SNOA 2UXBL 3FKIG 1VQIA 2PZUA 3K7UC 1UE6A 1UE5A 2AQ2B 1ZYRC 4HIDA 4DV0Q 4JBJA 3A74A 1KAAA 2I5MX 2N55A 2RQXA 1KABA 1O7YA 4XT3B 2O5JC 3I73A 4QL5A 4I7AA 5GAEC 1SJHD 4NMZA 4QUCA 4TVAB 2FJ2A 3S2DH 3OIPA 4C3HB 4ZKBB 1GKHA 1YIJA 4N9TA 1F2YA 3CCUA 3UE1A 1K8AC 5IE8A 1TT2A 4HJ9A 4AH6A 1HNZL 3M7NA 2VUMB 1WI5A 4HMIA 2B8GA 4NXNQ 2WB1E 4N8FA 1UNSA 1TWGB 2JA8B 2UXCQ 2PCFB 3J80c 3U50C 2Q8TA 1STBA 4B3SQ 1EY4A 1MHWC 3PIO3 1AW7A 2NZOA 3NXWA 1B3QA 3I70A 2NVXH 3NTHA 1HQRD 3F1ZA 1OXVA 1WTPA 2UUAL 1HCZA 4HJ7A 1PTOB 3KLRA 3I8ZA 5EKKA 3GP7A 3OPOA 5EAYA 1VQNA 4JI1Q 3L7ZC 2R93B 3OWEB 1Q90A 1KL9A 2K5NA 4C56C 5IYDG 1RTOA 2WV6D 2K6AA 1TY2A 2Y0SB 3PIP3 5J22A 4F87A 2UXCL 4K8IA 4BBSG 2J7ZA 2Y0SG 1O7ZA 2LXKA 4ZYSA 4OXPA 4B3SL 3HOUH 1FGUA 4DV3L 1JICA 2UXDL 1D2BA 4OO1H 2K1BA 2UUCQ 1JT8A 3D0FA 3VR2A 1CA6A 2NN6I 3DUZA 4DA2A 2VQFQ 1EWCA 3RZDB 1GUWA 4K6LA 1C4QA 4JI1L 1VQ4A 1QWYA 2HQLA 5E1FA 4A3MH 3GQBA 1AE3A 3ER0A 1B7YB 3S1MB 3K5LA 1JOKA 1P8LA 1T5EA 5EBCA 3EQLC 1VQKA 1VQAA 3NBHA 2E2JH 2CH4A 5JOBA 3HOWH 1W6KA 4HSVA 1BQQT 1AE2A 3DXJC 3A5ZB 2UUCL 1BBWA 2F4VL 3T4AC 2MO1A 4KHVA 2AWNA 3BDCA 3J7YW 1AZPA 3GTJH 3I4NB 4LF8Q 3I7FA 3D3RA 1A3VA 3BDLA 3I4NG 1KNAA 2ENBA 4BA2I 3NBHB 5C5MA 3J80i 2JA6B 5IT9L 4B08A 2CCZA 3DWPA 2JA6G 2NVQB 3C2PA 4OWTB 2BA1A 3OW7A 4X66Q 4OO1I 3QIAA 1Q46A 5G3LD 1I4PA 1D1IA 2A6EC 2HQEA 3OHXC 4I65A 2A68D 2NTSA 4LF8L 1B9MA 4P75A 2HCCA 3BS1A 2RHSB 1A62A 4ME5A 1X3QA 1I94Q 4FF2A 4GKJQ 1JWUD 4RWSC 2Z6KA 5FO9B 2H1EA 2F0TA 1SMYD 3CC2A 1XXGA 1KRTA 4G7ZC 4B9XA 3ND8A 1F9QA 5EPLA 3SE0A 3N6RA 1S40A 1ET9A 2VS1A 2YU9H 4ZK9B 4YCWA 4C3JB 3M85A 4G7HC 2D5DA 4X66L 3TP5A 1HQMC 4Q5VA 5IODA 3S2DB 4CGYB 4QCLA 3CW2C 3A8IE 2NBFA 2NN6G 2I46A 1DZ1A 1Y8PB 4JBMA 3C1FA 4ZRZA 4DR1L 4RGOS 1A63A 1H9RA 3SK6A 1I94L 5IYCH 1BOSA 1N8RC 1BVSA 4JOIC 4P74A 5LHY1 5EPKA 3A8JE 3GD7A 2K32A 5J1ZA 3IKJA 2E2HH 4DNTB 2A69D 4UP7A 1HR0W 1U4MA 1D7QA 2NVXB 4A3CH 3KBGA 2EJFC 3D6WA 1XYIA 4DV4Q 1PXUA 3HFZB 3OOCA 2KCCA 1Q8KA 5CYUA 4TKOB 2XVSA 2K4KA 1MKHA 4CKEA 4ZUJA 1R4QB 3KLSX 2F0WA 5FO7B 3SEBA 1PH2A 1GUOA 2L0CA 5CV5A 4KJNA 5CBAE 4LF5Q 4YY3Q 1LT3D 1ZYRD 1RDPD 5K36H 1FJGQ 2JA7H 4DR2Q 1S72A 1JWMD 3HKSA 1YNNC 1S5DD 2L11A 3H3VH 3HOUB 4LUOA 4G7OC 5C5LA 3HOUG 3S15H 1PYSB 1PRTC 3D4RA 2H4OA 1DOMA 4OO1G 5DM63 4MIUA 4GZYC 4DV4L 2HCIA 5CGKA 2PI2E 3MXPA 1YHAA 2YTXA 4X3UA 2QW7A 3GV6A 1BR9A 3FPPA 4X64L 3PUZA 1E0BA 4A3MB 1JE4A 4YY3L 4XDXA 4A3MG 4JI6L 1MI2A 2FMCA 4LK1C 1XPUA 2EY5A 1YNJD 2J4XA 1G291 4DR2L 3K81C 4CDEC 2E2JB 3HOWB 1NE3A 3VDYA 3A7AB 4GNXC 4JI0Q 3HOWG 2ES2A 1HNWQ 4BY1H 5EKLA 4H02A 4IO9A 3PO3H 1U4LA 2B2YA 3GV3A 3GTJB 1PZJD 4LF6Q 3I56A 5C44B 1I6HH 5C3XA 3KYHC 4KLKA 1FD7D 1XNQL 1SNPA 4NPSA 4RCNA 2ZXRA 3R93A 3J81c 1WVLA 3BG3A 1VDZA 2HD3A 3KFUA 5EGTA 2K5VA 4DV1L 1XX8A 4IALA 4DV5Q 4BXXH 1PFBA 1GHKA 4F7XA 3OTOL 1PH1A 1ZKOA 1TS2A 2QCPX 3NK9A 1B44D 3RR5A 1SSOA 2K50A 4NP5A 2M9VA 4POGA 3NTIA 1I3QH 5ELFA 4ZUIA 2CH4W 4BWGB 3CHBD 4LF6L 1AH9A 4F8MA 1YBYA 1VQ8A 3CCVA 1HFGA 2V1CC 2UUBQ 4PNYA 1LTBD 1QCBD 1A3UA 4WJWA 3K57A 2E76C 2F0EA 1HH2P 1SLJA 2YU9B 1HPCA 1EQRA 1I50H 3TP8A 2PQEA 1AZQA 2D0OA 3G4SA 1C7YA 3S9WA 1FGBD 3H91A 1L0XB 1CM9A 4A3LH 2F0NA 4UPAA 2AKWB 3MAQA 1EU4A 3RN2A 1ASYA 1OXXK 1RF2D 1ILPA 2DUDA 3PUWA 1V1OA 2ICIA 5C3EH 5M3FH 1TWHH 1Z6HA 2UUBL 2P5ZX 4RA8A 5IYCG 3E6ZX 2AMCB 5ELDA 4DR5Q 1H95A 1EYAA 1UWVA 1EQTA 3NQIA 2E2HB 1BKBA 3QJYA 1NBWA 3MEHA 1PFNA 2JP1A 1ILQA 2Q2IA 2A6ED 3SK4A 1STGA 2RDFA 4A3CG 5JPMC 1EFID 4L5RC 3EVQA 2DY7A 3J81i 4PMWA 1GO3E 1E1TA 4CJ1B 1TWFH 4ZCKA 1PH4A 3NHHA 2LY7A 1IL8A 3RLNA 3ND9A 2I0QA 2EXZA 1BBXC 2WACA 1SN8A 1SNQA 2IW3A 2JA7B 2ZTCA 5K36G 2JA7G 3STBC 3C1EA 4DK6C 3RN5A 1M90C 4R4CA 3S15B 4KY7A 2F0IA 1EYGA 3GTQH 2FFKB 4CDCC 2SOBA 1Y1VB 1X54A 1VQLA 3OIQA 3JAML 4B3TQ 1SEBD 2L1BA 4WFN3 4JYAQ 1DOKA 2EYFA 2EZVA 3G71A 2F0FA 2EYLA 4DR7Q 1I4GA 2GVAA 5ELBA 3AEVA 1K83H 2LMCB 2QDLA 2CQOA 2YTYA 5FLMG 1O7IA 5KIXA 1Z7TA 4R1JA 4BY1B 4R4IA 4IPDA 3PO3B 3SVMA 4BY1G 3AU7A 1LTLA 2O5IC 1I6HB 3PO3G 3F2CA 3Q0AA 2K05A 3W1GA 1A2UA 4B3TL 4OIJA 4A3EH 2JEAI 1B9NA 2F0LA 1A6XA 1R9TH 3W5OA 3K0XA 5E7NA 3QOLA 1MSHA 4DR7L 2PNHA 3NPPA 3IFTA 4LUVA 1LV9A 4BXXG 2MQHA 1MD2D 1KLGD 5CV4A 2F0VA 2ATWA 4PQXA 1PRTD 2JJQA 1SRUA 3T1HQ 1I3QB 2VY3A 3DWQA 2OQKA 1IXRA 3I91A 1IW7C 3HZXA 1XTCD 1PFMA 3SXHA 2QEJC 4OGQC 1RTNA 1IKMA 2XIWA 2OF1A 5I2XA 4IUQA 4EVOA 2KCTA 3MFYA 4QF4A 1DOLA 1HZCA 4L63B 5IOCA 2ZJQA 4DR6Q 1STYA 1QNKA 1K8MA 2UU9Q 1BF4A 5FLXL 1X3PA 3BZCA 1M4VA 5A2QE 1ZEQX 1J5EQ 3CPWA 4J15A 3MFGA 1DJRD 4FXGC 2MJ8A 4HJ5A 1YNXA 1EIHA 4C3IH 4IUVA 1EEFD 4KV6A 3CMEA 3G6EA 4A3LG 4M8AA 3F2DA 2K14A 1ESRA 1BNZA 2PPBC 4GN4B 4YHHQ 1N33L 1ENCA 2K5DA 2N49A 5M3FB 1TWHB 1HTLD 5LL6S 3A8KE 2CVRA 1LTSD 5C3EG 5M3FG 5BN3A 3FRPB 4ODGA 3CC7A 4G57A 1XMQQ 2Q8IB 3K58A 4HJ8A 1RD9D 4UHVA 4OX9L 3ULJA 4PV1C 5JJIA 1D5XC 2YTVA 2K5HA 4IPCA 1VCIA 1J5EL 5IIFA 4LFBQ 3VYRA 2JA9A 2VW9A 1KDAA 1CFMA 2KQ3A 3CCRA 5M3MH 1EIGA 1YZ6A 1GHJA 1L1OC 1CQFA 1K3BC 4HIOA 1TWFB 2AQ1B 3HKZB 5A35A 1HRJA 3RZOH 1YHQA 3UI2A 3HKZG 1QZHA 2F4IA 3RD4A 4YHHL 3I4MH 1JB7A 1WCMG 5HGQA 2WB1B 3SDZA 1P16A 3AMUA 4HAEA 1EZ8A 2KEEA 2WB1G 3GTMH 4K8JA 3E3XA 3VYSA 1XMQL 1LABA 4CDDC 3SGIA 4DNIA 3T1YQ 1EY6A 1WOCA 3ITPA 3BU2A 1VQ5A 1HXYD 2UXBQ 2KVMA 1KC8C 4LFBL 2WP8J 3TDQA 1DCZA 3E9IA 4X62L 3F2BA 2WINB 1IYJB 1FNUA 5JVH3 3NWSA 1CHPD 5C3WA 4CJ0B 1K8GA 3TSSA 4DGZA 4BS9A 2ASBA 4O42A 1SYFA 1K83B 1BCPD 2NZHA 4QIWE 3MA2B 3VYUA 4F88A 2IY5B 1ICWA 3EBEA 2RDHA 5KGUA 1HNZQ 1H9KA 2B2UA 4WJ3M 3FPUB 5CMDA 4YIJA 1I5FA 2F0UA 5LL6X 1YVCA 5GADC 3B6YA
chains in the Genus database with same CATH topology
4A3EB 2L55A 2LFNA 3LNNA 1R9TB 5I4DA 1PTOC 2QILA 3FVQA 4LJZC 2OEOA 1U9RA 1WTXA 2NN6H 1BO0A 4XYQA 2DY8A 5J39A 1LTTD 4HEDA 1SYGA 3QOJA 1G8ZD 1RJTA 2JEBI 4C1NI 4KN7C 3K0YA 2V4DA 3ERQA 1DD2A 5CV9A 4TQUS 1SYBA 3HEJA 4C3IB 4K5VA 1S5FD 4BBSB 4QUFA 4C3IG 1F9SA 1QNUA 1Q8IA 1HFNA 5ISRA 4LMQD 1SNCA 5DEHA 1B2TA 1CZGA 1FNVA 2EJMA 2A5HA 4ID6A 2HUGA 1E2VA 4ZKCB 1PTOF 4IFDH 1CT1D 4P2CB 3VA7A 1U4RA 3I90A 3QG1A 5CV6A 3QO2A 1IYUA 5M3MB 2BDNA 3RZOB 1PMRA 1RKNA 5IGFA 3I4MB 3QB3A 2OXPA 5HURA 1O7LA 4IZ8A 1HA6A 5IGGA 3JAME 3I4LA 3GTMB 5JEAH 5IGEA 4RCOA 1RCVD 2Z4IA 4XT1B 2I07B 1UUPA 1H9JA 1Q12A 1EEID 5I6YA 5I9PA 1AN8A 2SNSA 1K8OA 4FF1A 2SNMA 3RMHA 1BUVT 2IWHA 1I6VC 4KKSA 1JWSD 1SDFA 1JOOA 3Q22A 2KEDA 4IFDI 3GO5A 1FNWA 1G91A 3WDNA 2CQAA 1SFOB 3T53B 2F3WA 4M1UB 2NVYB 3D6CA 4ILWA 4U673 1DXMA 2JYOA 2QF7A 5M5YB 5I2YA 2CW0C 2L4NA 2LKVA 1GJXA 3TBIB 1QJOA 1DM0B 3Q23A 3HG9A 1S5ED 5FLXE 5A2QL 5EQ0A 2M2LA 2F0OA 4XXEA 4I7ZC 4J6HA 1S4ZA 1TKWB 2WKDA 2PW7A 4RGTA 2X6GA 1A3TA 1ENAA 2DNCA 1BXTA 3A54A 2BA0A 2F3VA 3TN2A 5TSSA 4FP5D 1LT4D 5CORA 1SXTA 2DNEA 2KOLA 3P7JA 2K5QA 2SEBD 3N52A 3GTPB 2XWBB 3L9AX 2JSOA 4KJOA 2NZ1D 1LTGD 1EY8A 2EYOA 3DM1A 4XQJA 3S14B 4A3JB 2Z1CA 2O2LD 3NP8A 5K5PA 1PZKD 5NUCA 3H94A 4IFDG 1SYEA 3HOZB 1KNEA 1Z47A 3PO2B 2B2YC 5CR3A 2IX0A 4DAYA 4FYDA 3HGBA 4KK7A 5D3IB 4OIKA 2EVBA 2B2VA 1LT6D 3V2TA 1NR4A 2NB0A 3EROA 2G9HD 5C4HA 4FXKC 4BY7B 1TWAB 4WRDA 5JEAG 1HUNA 1FYCA 1H9SA 4NW2A 1TVXA 1QOHA 3J80E 3MXGA 5KRUA 5HGTA 2NWGA 4KHZA 1SNDA 4XQNA 1LLRD 3MXUA 1H9SB 3KF8A 4OHJA 3V96A 4QMGA 3IFDA 3DWAA 3LWEA 2EOTA 2F0JA 1MGSA 2B2WA 1G6ZA 4C2MB 1GUNA 5EJWA 3J7AF 2AWOA 3KLSA 4KD3A 2R7ZB 2XNAC 2ZXOA 1F9RA 3M3YB 2F0GA 1TY0A 5KYLA 4HMJA 1QILA 4QB4A 4DAVA 4PMBA 5C0XH 1O80A 1GOZA 5EKIA 3H3VC 4IFDJ 1H9MA 2QDBA 2NTTA 2ICEC 2K28A 1GUGA 3OWFA 3MHBA 4A3GB 1LTAD 1B1ZA 3I3CA 3E0JA 2BE5C 3CKIB 4RKBA 5JEAJ 3P20A 2KHSA 2BDOA 2JXMB 3WOFA 3MXNA 1RHPA 3KUPA 3H09A 1QB5D 1Y1WB 3HRZC 2E2DC 3D4DA 3K5NA 2CW0D 1KLUD 1VF7A 1LTID 1OO9B 1CI3M 4DXFA 4A3BB 2XSCA 1BDOA 3BVZA 5C0XI 3SHLA 3TZUA 1CHQD 2K03A 3FDTA 2JE6I 1B50A 1SE3A 1BCPB 4KN4C 2CHBD 1PZID 2B2TC 4IUPA 5FOBB 3P75A 2F0QA 1GXDC 4ULLA 4KMUC 4ZQ3A 4LAAA 3G6JB 4XTCS 4XQQA 1F2ZA 1STAA 4KD4A 4H44C 1WD1A 1YNND 2BOSA 1TS4A 1JCKB 4BBRB 1NUCA 1JOQA 4KY6A 1CTMA 2K7VA 1V8QA 1SJED 2D9UA 4Q0FA 4X3TA 4RGMA 3FMCA 3EFXD 1EWHA 4RGNA 1SYDA 3QWNA 5IGBA 2LS01 3NBIA 1Y8NB 1VMCA 1JR0D 1R4PB 3BYYB 3H6MA 1I50B 4CKBA 2EY1A 4XIGS 1Q3LA 4KI0A 1SYCA 4R8NA 1A15A 1MSGA 3NWTA 2FHTA 1S5CD 2KCNA 4QIWB 1AEXA 1QG7A 3K5OA 4RHRA 5C3EB 5C0XG 2XWJB 1CZWA 3S16B 4AYBB 4CBVA 3WOEA 1AFPA 1IYVA 4J1MA 2IX3A 2IL8A 2PZWA 1LACA 3A7LA 1D5MC 2TSSA 1IKLA 3L3OC 3T51B 1EYCA 1KTKA 2A6HC 1I4QA 5COYA 2F0KA 2KECA 1WCMB 3J81E 1B4OA 2ID0A 4HR7B 1EYDA 1J8IA 5IGCA 2A68C 3X3MA 2D2CC 3GTQB 1SE4A 2A73B 3BZDB 1SMYC 3URYA 1D1KA 1CA5A 2XN9C 4OL7A 4FF3A 2F03A 3U9OA 5CC4A 4IN3A 3MWYW 2F0PA 2Q8RE 4NKLA 5JAVA 1JB3A 2PO4A 5JJZA 1AP0A 3RUZA 3M4YA 5FO8B 4HCSA 1F2LA 1XWEA 3A55A 1ENFA 4E6IA 1M8AA 3F2UA 1VF5C 3SK8A 3J80L 1SAPA 3GTGB 1GUTA 1U4PA 2BE5D 1WTWA 2A69C 2K01A 1JORA 5C4XB 2B8FA 1SBBB 3VYTA 3KBXA 3FEWX 5C0XJ 2K04A 5G3LF 3PUXA 2KA7A 5T1GA 1NR2A 3OSOA 5FKAC 3BVMA 2PNRC 1Y8OB 4C1NK 2IJ0A 4XYOA 5I6WA 4IUTA 4C3HG 2X69A 5EBDA 2NUCA 4R8IA 5F2DA 1G2TA 2XRSD 1UAPA 3MC0B 4ABNA 3D4WA 3IL8A 4K2LA 1MBYA 1YNJC 4HSPA 5JPNC 4FNFA 4R9WA 5M5XB 1F77A 1X32A 2D62A 2X6LA 1IHZA 1LO5D 3J7AV 1EZ6A 4FVMA 1J9OA 5KEEA 1W6JA 2HDMA 5E4XA 5CV7A 3G7LA 1IW7D 4A3DB 4X3KA 1PLFA 1HHVA 3DMUA 1FR3A 2F0HA 3P1HA 4N9PA 4K14A 5I9OA 2XRQD 3CQZB 2K5WA 3HP3A 1F9PA 1E2ZA 4K6DA 4IUNA 4KKUA 2Z4HA 3R2TA 3EJIA 3RLFA 3ZYYX 1STNA 3PV0A 5D3DA 5M9OA 1C48A 3H0GB 4EGVA 4EQOA 1EU3A 5E4WC 3DEPA 1LT5D 1KDCA 2A6HD 3VR3A 4UAIA 2DN8A 2F0DA 3MVVA 3K5MA 1PYWD 1T5XD 3SR1A 4DU9A 1TS3A 1KDBA 1LTRD 2F1MA 4PMCA 3R8BA 4MHEA 3HOVB 2R3ZA 4IQZA 3HS0C 4NDXA 1TWCB 4FF4A 5KNBA 2MGSA 4RHSA 1SNMA 2EY2A 2Z8LA 5EPJA 1EY5A 4C3JG 5JVG3 5CV8A 2EDGA 2PYKA 3NE5B 5C4ZA 1I4RA 4RAUC 2EYMA 3VR4A 3VR6A 4Y7NB 3K59A 1Q1BA 1ONLA 1O78A 1OXTA 3I72A 5BN5A 2C5CA 1PTOD 3M7GA 3TP6A 3TZDA 3J81L 4JK1C 1B53A 2EE1A 4DK1A 5M5WB 2B2VC 4Z9CB 2MPMA 1D6EC 3W3AA 5T1IA 1B3AA 2NYZD 2RSNA 3R3OA 1PDQA 1WTVA 1NCVA 4A93B 1VMPA 2WIIB 5ELEA 3ONAB 4DAPA 1TIID 2A74C 2C9OA 2O4XA 2G9DA 3MZ5A 3S17B 2B2WC 2IPKD 4RFBA 3LWUA 1PRTB 1ML0D 1TU2B 3K7AB 2KJXA 1GUSA 3BDOA 3U9SA 2MP1A 2TMPA 4EQNA 3OMCA 1I4HA 5CBEE 1CK1A 4BA1I 4HTHA 1CQVA 4KTAA 3TMEA 1TQOA 3BYTB 2NVTB 1PRTF 4ZLTF 4H13C 1EY0A 1ET6A 4ZAIA 1V43A 2IT1A 4J8QA 1L0YB 1I4XA 4K5WA 2AQ3B 3X3NA 2R92B 2VB2X 2RA4A 3DEOA 2RBMA 1EY9A 3S1NB 1JC7A 1A2TA 1HTPA 2R6GA 1V1PA 1STEA 4L6TB 3BVGA 2AUKA 2PW5A 2ZT9C 3W2DA 5KNDA 3V05A 4RH6A 4A3KB 1DONA 2L5TA 4H0LC 2F0MA 5AFWA 3GTLB 1V1PB 1BCPC 2K33A 3IAYA 3S2HB 4DNRB 5KNCA 2BCOA 3CRLC 3HOYB 1EL0A 4A3IB 1TS5A 5C6AA 2AUJD 3D8GA 2VNUD 2J0TD 2MHVA 3DHQA 4HN7A 1II3A 1Q1EA 1ESFA 4S3SA 4CJ2C 4X3SA 5IGDA 2EY6A 2ZXPA 4KKTA 5E3FA 4CHTB 3HOXB 1HA5A 2EYPA 4K5XA 1HUMA 2IX1A 4DXGA 3Q24A 5IT9E 2WAQB 3O13A 1WTQA 2HDLA 3Q6SA 3NSWA 1G2SA 3TP7A 1BCPF 3AB9A 2PZTA 1WTOA 3D31A 5KYIA 4RKLA 2YYZA 2N88A 4K2KA 3R2IA 2WKCA 4EQPA 2SDFA 2B2TA 1F2MA 2PMZB 1JQYD 4TSSA 3NTKA 2JA5B 1OXUA 1WD0A 3T13A 4V0BA 5D65A 4HCEA 5DNFA 3GTKB 3S1QB 2M00A 3T56B 2RDGA 4IURA 3OMGA 4JBWA 4IUUA 4DFAA 2KUMA 3PUYA 4DN4M 2RVLA 2VXWA 2EYJA 1OXSC 1TR5A 4CKCA 2RKSA 2L12A 3E5SA 1NSNS 2E75C 2R61A 4FO2A 1E2WA 4WORA 4MN3A 1PTOH 4DK0A 1ZXTA 1STHA 3C3LA 1UEAB 2EYHA 2FMMA 2EJGC 2VB3X 1EY7A 1D5ZC 3LX0A 1QE6A 4DF7A 3VA5A 2MUYA 2B63B 3CU7A 4TRDA 2QKIC 2F0SA 4KY5A 1EQVA 5ELCA 3PUVA 1DYQA 3S1RB 5DAUA 2OT2A 4G4KA 4A3FB 5FK9C 3GTOB 2RSOA 1EOTA 1NAPA 3A56A 3M4OB 3CRKC 2B2UC 4H7BA 2B39A 3EA6A 3C46A 4B9WA 4U68A 3MTSA 2E2IB 5D14A 3NQTA 4V190 2GA4B 3SK5A 4UDUC 1S5BD 1Y69U 3NUCA 5C4JB 4FXDA 5DM73 3PMFA 1RODA 5BN4A 1SE2A 3T16A 2L9HA 3KK7A 4L8JA 2E74C 1WTRA 2EPBA 2FINB 4O1NA 3K6OA 1C8CA 3FKIB 3VR5A 1SNOA 2PZUA 2AQ2B 1ZYRC 1KAAA 2N55A 2RQXA 1KABA 1O7YA 4XT3B 2O5JC 3I73A 1SJHD 4NMZA 4QUCA 2FJ2A 3OIPA 4C3HB 4ZKBB 4N9TA 1F2YA 1TT2A 3M7NA 2VUMB 4HMIA 2B8GA 1UNSA 1TWGB 2JA8B 2PCFB 2Q8TA 1STBA 1EY4A 3PIO3 1AW7A 3NXWA 3I70A 3NTHA 1HQRD 1OXVA 1WTPA 1HCZA 1PTOB 3KLRA 3I8ZA 5EKKA 3GP7A 3OPOA 3L7ZC 2R93B 3OWEB 1Q90A 4C56C 1RTOA 2WV6D 2K6AA 1TY2A 2Y0SB 3PIP3 5J22A 4F87A 4K8IA 2J7ZA 1O7ZA 4ZYSA 1JICA 1D2BA 4OO1H 2K1BA 3VR2A 1CA6A 2NN6I 3DUZA 4DA2A 1EWCA 3RZDB 1GUWA 4K6LA 1C4QA 1QWYA 5E1FA 3GQBA 3S1MB 3K5LA 1JOKA 1T5EA 5EBCA 3EQLC 3NBHA 5JOBA 1W6KA 4HSVA 1BQQT 3DXJC 3T4AC 4KHVA 2AWNA 3BDCA 3J7YW 1AZPA 3I4NB 3D3RA 1A3VA 3BDLA 1KNAA 2ENBA 4BA2I 5C5MA 2JA6B 5IT9L 4B08A 3DWPA 2NVQB 3C2PA 2BA1A 3OW7A 4OO1I 3QIAA 5G3LD 1I4PA 1D1IA 2A6EC 2HQEA 3OHXC 4I65A 2A68D 2NTSA 1B9MA 3BS1A 2HCCA 4ME5A 1X3QA 4FF2A 1JWUD 4RWSC 5FO9B 2H1EA 2F0TA 1SMYD 1XXGA 4G7ZC 4B9XA 3ND8A 1F9QA 5EPLA 3SE0A 3N6RA 1ET9A 4ZK9B 4C3JB 3M85A 4G7HC 2D5DA 3TP5A 1HQMC 4Q5VA 5IODA 3S2DB 4CGYB 4QCLA 3A8IE 2NBFA 2NN6G 2I46A 1DZ1A 1Y8PB 3C1FA 4ZRZA 4RGOS 1H9RA 3SK6A 1BOSA 5LHY1 5EPKA 3A8JE 3GD7A 2K32A 5J1ZA 3IKJA 4DNTB 2A69D 1U4MA 2NVXB 3KBGA 2EJFC 3D6WA 1XYIA 1PXUA 3OOCA 2KCCA 5CYUA 4TKOB 2XVSA 4CKEA 4ZUJA 1R4QB 3KLSX 2F0WA 5FO7B 3SEBA 1GUOA 2L0CA 5CV5A 4KJNA 5CBAE 1LT3D 1ZYRD 1RDPD 5K36H 1JWMD 1YNNC 1S5DD 2L11A 3HOUB 4G7OC 5C5LA 1PRTC 3D4RA 2H4OA 1DOMA 4OO1G 5DM63 4MIUA 4GZYC 2HCIA 5CGKA 3MXPA 4X3UA 3GV6A 1BR9A 3FPPA 3PUZA 1E0BA 4A3MB 1JE4A 4XDXA 1MI2A 2FMCA 4LK1C 2EY5A 1YNJD 2J4XA 1G291 2E2JB 3HOWB 3A7AB 5EKLA 1U4LA 2B2YA 3GV3A 3GTJB 1PZJD 5C44B 5C3XA 1FD7D 1SNPA 4RCNA 2ZXRA 3R93A 1WVLA 3BG3A 1VDZA 5EGTA 1XX8A 4IALA 1PFBA 1GHKA 4F7XA 1ZKOA 1TS2A 2QCPX 3NK9A 1B44D 1SSOA 4NP5A 2M9VA 3NTIA 5ELFA 4ZUIA 4BWGB 3CHBD 4F8MA 1HFGA 4PNYA 1LTBD 1QCBD 1A3UA 4WJWA 3K57A 2E76C 2F0EA 2YU9B 1HPCA 3TP8A 2PQEA 1AZQA 3S9WA 1FGBD 3H91A 1L0XB 1CM9A 2F0NA 3MAQA 1EU4A 1OXXK 1RF2D 1ILPA 3PUWA 1V1OA 2ICIA 1Z6HA 4RA8A 3E6ZX 5ELDA 1EYAA 1EQTA 3NQIA 2E2HB 3QJYA 3MEHA 1PFNA 2JP1A 1ILQA 2A6ED 3SK4A 1STGA 2RDFA 5JPMC 1EFID 3EVQA 2DY7A 4PMWA 4CJ1B 3NHHA 2LY7A 1IL8A 3ND9A 2EXZA 1BBXC 2WACA 1SNQA 2IW3A 2JA7B 5K36G 3C1EA 3S15B 4KY7A 2F0IA 2FFKB 2SOBA 1Y1VB 3OIQA 3JAML 1SEBD 2L1BA 4WFN3 1DOKA 2EYFA 2EZVA 2F0FA 2EYLA 1I4GA 5ELBA 2LMCB 5KIXA 1Z7TA 4BY1B 3PO3B 3SVMA 3AU7A 2O5IC 1I6HB 3Q0AA 2K05A 1A2UA 4OIJA 2JEAI 1B9NA 2F0LA 1A6XA 3QOLA 1MSHA 3NPPA 3IFTA 1LV9A 1MD2D 1KLGD 5CV4A 2F0VA 4PQXA 1PRTD 1I3QB 3DWQA 3I91A 1IW7C 3HZXA 1XTCD 1PFMA 3SXHA 2QEJC 4OGQC 1RTNA 1IKMA 2XIWA 2OF1A 5I2XA 4IUQA 4EVOA 3MFYA 4QF4A 1DOLA 4L63B 5IOCA 1STYA 1QNKA 1K8MA 1BF4A 5FLXL 1X3PA 1M4VA 5A2QE 1ZEQX 3MFGA 1DJRD 4FXGC 2MJ8A 1EIHA 4IUVA 1EEFD 4KV6A 4M8AA 1ESRA 1BNZA 2PPBC 1ENCA 2K5DA 5M3FB 1TWHB 1HTLD 5LL6S 3A8KE 2CVRA 1LTSD 5BN3A 3FRPB 4ODGA 4G57A 2Q8IB 3K58A 1RD9D 4PV1C 1D5XC 1VCIA 5IIFA 3VYRA 1KDAA 1CFMA 2KQ3A 1EIGA 1GHJA 1HRJA 1CQFA 1TWFB 2AQ1B 3HKZB 5A35A 3UI2A 2F4IA 3RD4A 2WB1B 3SDZA 3AMUA 4HAEA 1EZ8A 2KEEA 4K8JA 3VYSA 1LABA 1EY6A 3ITPA 1HXYD 2KVMA 2WP8J 3TDQA 1DCZA 2WINB 1FNUA 5JVH3 3NWSA 1CHPD 5C3WA 4CJ0B 3TSSA 4DGZA 4BS9A 4O42A 1SYFA 1K83B 1BCPD 3MA2B 3VYUA 4F88A 1ICWA 2RDHA 5KGUA 1H9KA 2B2UA 3FPUB 5CMDA 4YIJA 2F0UA 5LL6X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q8R E;  2Q8T A;  4CJ1 B;  4CJ2 C;  4X3S A;  5JJZ A;  4X3K A;  1O80 A;  1AP0 A;  2HCC A;  5EKI A;  4RAU C;  1IL8 A;  1X3Q A;  4HCS A;  1F2L A;  2D9U A;  2MJ8 A;  2NZ1 D;  4X3T A;  4XT1 B;  1EIH A;  4RWS C;  1PLF A;  3DM1 A;  4IUV A;  1WTX A;  1BBX C;  1HHV A;  1WTP A;  1M8A A;  1U4L A;  1BO0 A;  2H1E A;  2B2Y A;  2K28 A;  3F2U A;  3GV3 A;  1ESR A;  1HUM A;  1BNZ A;  2DY8 A;  1F9Q A;  1SAP A;  5EPL A;  3I8Z A;  4HED A;  4ZLT F;  4ZK9 B;  3R93 A;  3I3C A;  1WVL A;  1KNE A;  1U4P A;  1VMC A;  2B2Y C;  2FFK B;  2HDL A;  2RSO A;  1WTQ A;  1EOT A;  1NAP A;  3Q6S A;  2CVR A;  1WTW A;  4ZAI A;  1RTO A;  1XX8 A;  2K01 A;  1SDF A;  1G2S A;  2B2U C;  1PFB A;  1RJT A;  3HP3 A;  1F9P A;  1Q3L A;  1WTO A;  2L1B A;  2J7Z A;  1DZ1 A;  2KED A;  1O7Z A;  4OIK A;  1DOK A;  4U68 A;  1G91 A;  2N88 A;  1A15 A;  1SSO A;  3MTS A;  1JIC A;  1MSG A;  2RA4 A;  2B2V A;  3KBX A;  5D14 A;  3TZD A;  2K04 A;  1NR4 A;  1RHP A;  2FHT A;  2K1B A;  3DEO A;  2SDF A;  2B2T A;  3KUP A;  1B53 A;  1CA6 A;  2EE1 A;  1HUN A;  1EIG A;  1HRJ A;  5EPK A;  2B2V C;  1QG7 A;  2MPM A;  3UI2 A;  4NW2 A;  2JYO A;  5T1I A;  1U4M A;  1WD0 A;  1TVX A;  1GUW A;  1HFG A;  5T1G A;  1NR2 A;  5D65 A;  5DNF A;  1ROD A;  1B3A A;  2L4N A;  4IUR A;  2IL8 A;  3SVM A;  4QUF A;  3D6W A;  4IUU A;  1XYI A;  4HAE A;  2NYZ D;  2RSN A;  2KEE A;  1F9S A;  1DON A;  2L9H A;  5E4W C;  3DEP A;  2NWG A;  2K05 A;  1PDQ A;  1WTV A;  1NCV A;  1IKL A;  5AFW A;  1HFN A;  2KUM A;  4OIJ A;  4LMQ D;  4UAI A;  1VMP A;  1WTR A;  4DN4 M;  2EPB A;  2FIN B;  4IUT A;  1AZQ A;  5EQ0 A;  2M2L A;  2X69 A;  2RVL A;  2VXW A;  4HSV A;  2K03 A;  3H91 A;  5CBA E;  3FDT A;  1B2T A;  1C8C A;  2KVM A;  3IFD A;  4R8I A;  1MSH A;  1B50 A;  2L12 A;  1CM9 A;  3LWE A;  3ONA B;  5COY A;  2EOT A;  2HUG A;  1LV9 A;  1MGS A;  1S4Z A;  1G2T A;  2B2W A;  2KEC A;  1AZP A;  4ZKC B;  1G6Z A;  2B2T C;  4IUP A;  2L11 A;  5EJW A;  1B4O A;  4MN3 A;  2X6G A;  1KNA A;  4CJ0 B;  3IL8 A;  1U4R A;  1ILP A;  3I90 A;  1DOM A;  2N55 A;  3I91 A;  1O7Y A;  1J8I A;  4XT3 B;  1ZXT A;  2B2W C;  3QO2 A;  4MHE A;  4O42 A;  4RA8 A;  3TN2 A;  2R3Z A;  4QUC A;  1PFM A;  1F9R A;  2BDN A;  2FJ2 A;  4R9W A;  2HCI A;  1RTN A;  4ZKB B;  1EQT A;  1IKM A;  2XIW A;  1X32 A;  1ML0 D;  5COR A;  1ICW A;  1EL0 A;  2X6L A;  4X3U A;  4IUQ A;  3GV6 A;  1PFN A;  2JP1 A;  2FMM A;  2KOL A;  1ILQ A;  3P7J A;  1WD1 A;  2MGS A;  2B2U A;  1DOL A;  1J9O A;  2MP1 A;  3FPU B;  5CMD A;  1HA6 A;  1CA5 A;  3N52 A;  1QNK A;  5EPJ A;  1E0B A;  1QE6 A;  1JE4 A;  2HDM A;  5E4X A;  2DY7 A;  1BF4 A;  3G7L A;  4XDX A;  1X3P A;  1MI2 A;  3MWY W;  5CBE E; 
#chains in the Genus database with same CATH topology
 3PQI A;  4A3E B;  2L55 A;  2LFN A;  3L2P A;  2NVY H;  3LNN A;  4A3E G;  1R9T B;  3CAM A;  2EQS A;  3K80 C;  5M5Y H;  5I4D A;  1PTO C;  2OQ0 A;  2QIL A;  1JJC B;  3FVQ A;  1K9M C;  1EWI A;  4LJZ C;  2UUA Q;  2OEO A;  1U9R A;  1WTX A;  2NN6 H;  2E5L L;  1BO0 A;  2JK8 A;  3HKZ E;  4XYQ A;  2DJF C;  2DY8 A;  3CMA A;  5J39 A;  1LTT D;  4HED A;  1SYG A;  1DGS A;  1UE7 A;  3QOJ A;  1G8Z D;  4KHP L;  1PH7 A;  4DUY Q;  1RJT A;  2JEB I;  4DV3 Q;  4C1N I;  4KN7 C;  2UXD Q;  3ZJY C;  3K0Y A;  2V4D A;  3ERQ A;  4RMF A;  1DD2 A;  4JG2 A;  1PH9 A;  5CV9 A;  4TQU S;  1SYB A;  2OWO A;  2WFW A;  3A0J A;  1W3S A;  3HEJ A;  4C3I B;  4K5V A;  5JJL A;  1S5F D;  4JV5 Q;  4BBS B;  4QUF A;  4C3I G;  4GLA C;  3GTP H;  1F9S A;  4DUY L;  1QNU A;  1Q8I A;  1HFN A;  5ISR A;  4LMQ D;  3DLL A;  1SNC A;  2VZA A;  4APV A;  5DEH A;  1B2T A;  2F4V Q;  1CZG A;  1L2F A;  1FNV A;  2YV5 A;  2EJM A;  2A5H A;  1N34 Q;  4ID6 A;  1YJN A;  2HUG A;  3S14 H;  4A3J H;  1E2V A;  4ZKC B;  1PTO F;  4IFD H;  1CT1 D;  4P2C B;  3VA7 A;  1U4R A;  3I90 A;  3QG1 A;  5CV6 A;  4GN3 B;  1T9H A;  3HOZ H;  3PO2 H;  3QO2 A;  4WJ4 A;  4JV5 L;  1IYU A;  5M3M B;  2BDN A;  2I5L X;  3RZO B;  1PMR A;  5M3M G;  1RKN A;  5IGF A;  2F52 A;  3I4M B;  3QB3 A;  2OXP A;  5HUR A;  1O7L A;  3I4M G;  4IZ8 A;  4A93 H;  1HA6 A;  5IGG A;  2K52 A;  3G48 A;  3JAM E;  3I4L A;  4FDB A;  3GTM B;  5JEA H;  1N34 L;  4BY7 H;  1JMC A;  1TWA H;  1NNX A;  4YCU A;  5IGE A;  4A76 A;  4RCO A;  1RCV D;  2Z4I A;  1VQP A;  4XT1 B;  2I07 B;  1UUP A;  1H9J A;  1Q12 A;  2JN4 A;  1IBK Q;  1K0S A;  2RCN A;  5LMN L;  1MJE A;  1EEI D;  1K73 C;  5I6Y A;  5I9P A;  1AN8 A;  2SNS A;  2DJG C;  1K8O A;  4FF1 A;  2SNM A;  2Z6K C;  3RMH A;  1ICF B;  1VQO A;  1XMO Q;  1BUV T;  1Y14 B;  2IWH A;  1I6V C;  4KKS A;  1JWS D;  1SDF A;  4L5Q A;  1JOO A;  2PI2 A;  3Q22 A;  4DR1 Q;  2LXJ A;  1NMG A;  2KED A;  4IFD I;  3GO5 A;  1FNW A;  4C2M H;  1G91 A;  3CCJ A;  5HY6 A;  3WDN A;  2CQA A;  1SFO B;  3T53 B;  2F3W A;  4GKK Q;  1N36 Q;  2R7Z H;  3S24 A;  1BBU A;  1IBK L;  4M1U B;  5IY0 A;  2NVY B;  3D6C A;  4ILW A;  3M3Y H;  2KBN A;  4U67 3;  1DXM A;  2JYO A;  4PZ7 A;  2QF7 A;  2OTL A;  5M5Y B;  5I2Y A;  2PQA A;  2CW0 C;  2ZJP A;  1XMO L;  2L4N A;  4R4O A;  2LKV A;  1GJX A;  3TBI B;  1QJO A;  2GVB A;  1DM0 B;  3Q23 A;  3NEL A;  3AYH B;  3HG9 A;  1S5E D;  5FLX E;  5A2Q L;  3UDF A;  5EQ0 A;  2M2L A;  2Z6B A;  2F0O A;  5IT9 c;  2PQA B;  4XXE A;  4GKK L;  1N36 L;  4I7Z C;  1HZA A;  1S4Z A;  1TKW B;  4J6H A;  2WKD A;  4LWC A;  2PW7 A;  1C9O A;  5AJ3 Q;  4RGT A;  4A3G H;  2X6G A;  1A3T A;  1ENA A;  2DNC A;  1BXT A;  1PH8 A;  3A54 A;  2BA0 A;  2F3V A;  3TN2 A;  5TSS A;  4FP5 D;  1LT4 D;  1EQQ A;  5COR A;  1SXT A;  2DNE A;  4X64 Q;  2KOL A;  3P7J A;  2K5Q A;  2SEB D;  3N52 A;  3GTP B;  4JI6 Q;  2XWB B;  3L9A X;  2JSO A;  4B3R Q;  3UDX A;  1Y1W H;  4A75 A;  5AJ3 L;  4K0K Q;  4KJO A;  2NZ1 D;  1LTG D;  1E24 A;  1EY8 A;  2EYO A;  3DM1 A;  4XQJ A;  3S14 B;  4A3J B;  2Z1C A;  2O2L D;  3NP8 A;  5K5P A;  1PZK D;  4A3B H;  4DV2 Q;  4A3J G;  1XNQ Q;  5NUC A;  4AQY Q;  2AHO B;  3H94 A;  4IFD G;  1SYE A;  3HOY H;  1GD7 A;  1QUQ A;  4OWX B;  4A3I H;  1KNE A;  1Z47 A;  4OEL B;  2B2Y C;  5BR8 Q;  4DV1 Q;  4UY8 C;  3HOZ B;  3PO2 B;  5CR3 A;  3HOZ G;  3PO2 G;  3PCO B;  5DLQ E;  2IX0 A;  1HJP A;  4DAY A;  3W1B A;  3OTO Q;  3IRB A;  5FLM H;  4B3R L;  4OEM B;  4FYD A;  3ULP A;  3HGB A;  4KK7 A;  5D3I B;  2BH8 A;  4OIK A;  2EVB A;  1VQM A;  1GVP A;  3J7Z C;  4K0K L;  2B2V A;  1LT6 D;  3V2T A;  1NR4 A;  1E7Z A;  2NB0 A;  4POF A;  4A93 G;  3ERO A;  2G9H D;  4DUZ Q;  5C4H A;  2HHH L;  4FXK C;  4BY7 B;  2D0P A;  1TWA B;  4WRD A;  5JEA G;  1HUN A;  2HIX A;  1FYC A;  3LGJ A;  4BY7 G;  4DV2 L;  3HOX H;  1H9S A;  4HJA A;  4NW2 A;  4AQY L;  1N32 Q;  1TVX A;  2N78 A;  3KJO A;  5BR8 L;  1QOH A;  3J80 E;  3MXG A;  5KRU A;  5HGT A;  2NWG A;  4KHZ A;  1SND A;  4XQN A;  1KRS A;  3OW2 A;  1LLR D;  5IP9 H;  3MXU A;  4BBR H;  1H9S B;  3KF8 A;  4OHJ A;  3V96 A;  1QVF A;  4QMG A;  3IFD A;  3DWA A;  3LWE A;  4DUZ L;  2EOT A;  2F0J A;  1MGS A;  2B2W A;  1G6Z A;  4C2M B;  1GUN A;  5EJW A;  3WWV A;  3J7A F;  2AWO A;  1N32 L;  3KLS A;  4KD3 A;  3PF5 A;  2R7Z B;  4NB3 A;  2XNA C;  2ZXO A;  2R7Z G;  1F9R A;  3M3Y B;  2F0G A;  4EQ5 A;  1TY0 A;  5KYL A;  1A0I A;  3Q8D A;  4HMJ A;  1UEB A;  4IOA A;  4NXM Q;  1QIL A;  4QB4 A;  1FVI A;  5ELO A;  4DAV A;  1VQD A;  4ME3 A;  3K8A A;  4PMB A;  1QVC A;  5C0X H;  3FHW A;  1O80 A;  1GOZ A;  5EKI A;  3H3V C;  4IFD J;  4O0A A;  1H9M A;  3S16 H;  1Q81 C;  2QDB A;  2NTT A;  2ICE C;  2R92 G;  3U4V A;  3U58 A;  2K28 A;  1GUG A;  5J3B A;  3OWF A;  3MHB A;  4A3G B;  4A3G G;  1LTA D;  1B1Z A;  3I3C A;  3CF5 A;  4NXM L;  3TEH B;  3RNU A;  1E22 A;  2H5X A;  3E0J A;  2BE5 C;  3CKI B;  4RKB A;  5JEA J;  4DV6 Q;  3BJU A;  2KHS A;  1N9W A;  2BDO A;  3P20 A;  4A3K G;  1WCM H;  2JXM B;  3WOF A;  1HR0 Q;  4CDF C;  3MXN A;  1RHP A;  2B3G A;  2FXQ A;  3KUP A;  1NTG A;  3H09 A;  1QB5 D;  1Y1W B;  1IBL L;  3HRZ C;  2E2D C;  3D4D A;  3K5N A;  1Y1W G;  2CW0 D;  1KLU D;  1YHB A;  1SRO A;  1VF7 A;  1LTI D;  4R4Q A;  3TS2 A;  1OO9 B;  1CI3 M;  4A3F H;  1PHJ A;  3GDE A;  1J6Q A;  1LUZ A;  4DXF A;  3MXN B;  2KEN A;  3GTO H;  4QY7 A;  4LF9 L;  4A3B B;  2XSC A;  1K3R A;  1BDO A;  3NEN A;  3M4O H;  4A3B G;  1JE5 A;  4DV6 L;  3BVZ A;  5C0X I;  3HOY G;  1RL2 A;  4JI2 Q;  3SHL A;  3TZU A;  1HR0 L;  1CHQ D;  2K03 A;  4A3I G;  3FDT A;  2JE6 I;  1B50 A;  3ICE A;  1SE3 A;  1BCP B;  2CHB D;  4KN4 C;  1PZI D;  3KLW A;  2B2T C;  4IUP A;  5FOB B;  3P75 A;  2F0Q A;  4YCV A;  1GXD C;  4ULL A;  3GTG H;  4KMU C;  4ZQ3 A;  4LAA A;  3G6J B;  4XTC S;  2LSS A;  3KOJ A;  1VQH A;  4DKA C;  3EIV A;  2F3I A;  4XQQ A;  1F2Z A;  1STA A;  2EXD A;  4KD4 A;  1KXL A;  1SR3 A;  5C4X H;  3HOX G;  4H44 C;  1K28 A;  1WD1 A;  4JI2 L;  1YNN D;  2BOS A;  1CUK A;  1TS4 A;  1XJV A;  1JCK B;  1KIX A;  4LF4 Q;  4BBR B;  1NUC A;  3L0O A;  1JOQ A;  5IP9 G;  4KY6 A;  1CTM A;  2K7V A;  1V8Q A;  4BBR G;  1SJE D;  2D9U A;  2QGQ A;  4Q0F A;  4X3T A;  4RGM A;  3FMC A;  1EOV A;  3EFX D;  1E3P A;  3PIO A;  5FJ8 H;  1E1O A;  1EWH A;  4RGN A;  1VQB A;  3JAM c;  1SYD A;  3QWN A;  1N33 Q;  5IGB A;  2LS0 1;  3NBI A;  4C3H H;  1Y8N B;  1VMC A;  1JR0 D;  1R4P B;  3BYY B;  3H6M A;  3J81 j;  4LUZ A;  1I50 B;  4CKB A;  4P73 A;  2VUM H;  4OX9 Q;  2EY1 A;  4XIG S;  1Q3L A;  2JA8 H;  4O2D A;  4KI0 A;  1SYC A;  4LF4 L;  4R8N A;  1A15 A;  4JI4 L;  1MSG A;  3NWT A;  3PIP A;  2FHT A;  1S5C D;  2OTJ A;  4LFA L;  5IWA Q;  2KCN A;  3M9B A;  4QIW B;  2CWP A;  2QEX A;  1AEX A;  1QG7 A;  1WFQ A;  5M5X H;  1NMF A;  3K5O A;  1VQG A;  4RHR A;  5C3E B;  5C0X G;  2XWJ B;  1CZW A;  2Q2U A;  3S16 B;  1KD1 C;  4AYB B;  4CBV A;  4LNQ A;  3WOE A;  1AFP A;  1IYV A;  4J1M A;  2IX3 A;  2IL8 A;  4AYB G;  2PZW A;  1LAC A;  3A7L A;  5IYB H;  1D5M C;  2TSS A;  1KHI A;  1IKL A;  1LM0 A;  3I4O A;  3L3O C;  2IHE A;  3T51 B;  4JI7 Q;  1EYC A;  1KTK A;  2WAQ E;  2A6H C;  4A3D H;  1I4Q A;  2Q2H A;  5COY A;  4X62 Q;  5IWA L;  2F0K A;  3CPF A;  2KEC A;  2HIV A;  1WCM B;  3J81 E;  1B4O A;  2VQE Q;  2ID0 A;  2C35 B;  4HR7 B;  1EYD A;  3UE0 A;  1J8I A;  5IGC A;  2A68 C;  3X3M A;  5FLX c;  1CKO A;  2PMZ E;  3CQZ H;  4IJH A;  2D2C C;  1K0R A;  3GTQ B;  1SE4 A;  2A73 B;  3E0E A;  1JJ2 A;  4JI7 L;  3BZD B;  4OWW B;  1SMY C;  3URY A;  4A3F G;  1D1K A;  3JAM i;  4LW1 A;  1CA5 A;  2XN9 C;  4OL7 A;  4FF3 A;  2F03 A;  3U9O A;  5CC4 A;  4IN3 A;  4JI5 Q;  3MWY W;  2F0P A;  2Q8R E;  4NKL A;  2QA4 A;  1X6O A;  5JAV A;  1JB3 A;  2PO4 A;  5JJZ A;  1AP0 A;  3RUZ A;  3M4Y A;  5FO8 B;  2VQE L;  2E5L Q;  4HCS A;  1F2L A;  1XWE A;  2JQO A;  3A55 A;  1HZ9 A;  1ENF A;  4E6I A;  3H0G H;  3E9H A;  1M8A A;  2EIF A;  3F2U A;  1VF5 C;  3SK8 A;  4QGU A;  3J80 L;  3BZK A;  1SAP A;  4DPG A;  3GTG B;  1TXY A;  3TRE A;  4AYB E;  1GUT A;  1U4P A;  2BE5 D;  4KHP Q;  1WTW A;  3ULL A;  2A69 C;  1VQ6 A;  2K01 A;  4GOP A;  1JOR A;  1KAW A;  4JI5 L;  5C4X B;  2B8F A;  5C4X G;  1SBB B;  3VYT A;  3KBX A;  3FEW X;  3STB D;  2K04 A;  5C0X J;  5IP7 H;  5G3L F;  4LF7 Q;  3HOV H;  4MZ9 A;  4GOP B;  2L15 A;  3PUX A;  1XNR Q;  2KA7 A;  3CCQ A;  2OCE A;  1TWC H;  5T1G A;  1NR2 A;  1Q7Y C;  3OSO A;  5FKA C;  3BVM A;  2PNR C;  1GM5 A;  4C3J H;  5FJ8 G;  1Y8O B;  4C1N K;  3CXC A;  2IJ0 A;  4XYO A;  5I6W A;  2CWA A;  4IUT A;  4C3H G;  4PZ6 A;  2X69 A;  1B70 B;  2VL6 A;  5EBD A;  2NUC A;  4R8I A;  5F2D A;  2IHF A;  4GLV B;  3CD6 A;  1CKM A;  4LF7 L;  3CCE A;  2VUM G;  1G2T A;  2XRS D;  1UAP A;  4Y7N H;  3MC0 B;  4ABN A;  2JA8 G;  2N8N A;  4LFC Q;  1XNR L;  3D4W A;  3IL8 A;  4K2L A;  4DV0 L;  1MBY A;  1MJC A;  2RHQ B;  1YNJ C;  5LMU Q;  2CKZ B;  4HSP A;  1EFW A;  3RLO A;  5JPN C;  4FNF A;  4R9W A;  3PGZ A;  5M5X B;  1F77 A;  1X32 A;  2D62 A;  4JI8 Q;  2X6L A;  1IHZ A;  1LO5 D;  3J7A V;  1EZ6 A;  4FVM A;  1J9O A;  4UP9 A;  1W6J A;  5KEE A;  2HDM A;  5E4X A;  4DV7 Q;  3CCL A;  5CV7 A;  1JJG A;  3G7L A;  2XGT A;  4NXN L;  5IYB G;  2R93 G;  5M5W H;  1IW7 D;  4MTK A;  4A3D B;  4IJL A;  4X3K A;  4LFC L;  2GN5 A;  4A3D G;  1PLF A;  5LMN Q;  5LMU L;  1HHV A;  3DMU A;  4HIM A;  1FR3 A;  2F0H A;  4JCV E;  2RF4 A;  4ALP A;  4JI8 L;  3P1H A;  1XTD A;  4N9P A;  1PV4 A;  4A4I A;  4K14 A;  5I9O A;  2XRQ D;  3CQZ B;  4DV7 L;  2K5W A;  3HP3 A;  1F9P A;  1PH3 A;  1E2Z A;  4K6D A;  4IUN A;  4KKU A;  2Z4H A;  4N8X 1;  3R2T A;  3S17 H;  3EJI A;  1PVO A;  3RLF A;  4JBK A;  3UDG A;  1IZ6 A;  2VQF L;  3ZYY X;  1STN A;  3PV0 A;  5D3D A;  3K7A H;  5M9O A;  5C44 H;  1XPR A;  1C48 A;  3FP9 A;  3H0G B;  4EGV A;  4EQO A;  1EU3 A;  3H0G G;  5E4W C;  3A5U A;  3DEP A;  1LT5 D;  1KDC A;  2A6H D;  1Q86 C;  3VR3 A;  4JI3 Q;  4UAI A;  2DN8 A;  3CCM A;  2F0D A;  3MVV A;  5ELN A;  3K5M A;  1PYW D;  1T5X D;  1PA6 A;  3SR1 A;  3AQQ A;  4DU9 A;  1TS3 A;  3KF6 A;  1KDB A;  4GS3 A;  2Y0S E;  4IPG A;  1LTR D;  2F1M A;  2NVT H;  4IOC A;  4PMC A;  3R8B A;  1VQC A;  4MHE A;  5IP7 G;  3HOV B;  2R3Z A;  2R7D A;  3KF6 B;  3M4Q A;  4IQZ A;  3HOV G;  4B3M Q;  3OYY A;  1QZG A;  3HS0 C;  4NDX A;  1TWC B;  1HZB A;  4FF4 A;  4JI3 L;  1CSP A;  5KNB A;  2MGS A;  4RHS A;  3TQY A;  1SNM A;  2EY2 A;  2Z8L A;  2R92 H;  5EPJ A;  1EY5 A;  4C3J G;  5JVG 3;  3S1N H;  5CV8 A;  2EDG A;  1UE1 A;  2PYK A;  3NE5 B;  5C4Z A;  1I4R A;  4RAU C;  4P71 A;  2EYM A;  3VR4 A;  4GKJ L;  2KHJ A;  3VR6 A;  4Y7N B;  5JJK A;  4A3K H;  3K59 A;  1Q1B A;  1ONL A;  2Z0S A;  2ZTD A;  4B3M L;  1O78 A;  3TRZ A;  2MO0 A;  1OXT A;  3GTL H;  3QR8 A;  3I72 A;  5BN5 A;  5GQO A;  1X3E A;  2C5C A;  1PTO D;  3M7G A;  1G6P A;  4JOI A;  3TP6 A;  3H15 A;  3CCS A;  3TZD A;  3J81 L;  2HHH Q;  4JK1 C;  1B53 A;  1U0L A;  4GLX A;  2ZJR A;  3S2H H;  1PH6 A;  2EE1 A;  4DK1 A;  5M5W B;  1WTH A;  4YWM A;  2B2V C;  4Z9C B;  2MPM A;  1D6E C;  3W3A A;  4YWK A;  5T1I A;  3J7A 5;  1B3A A;  1X3F A;  4HIK A;  2NYZ D;  2RSN A;  3R3O A;  1Y1V H;  1PDQ A;  1WTV A;  1NCV A;  1G51 A;  4A93 B;  1VMP A;  2WII B;  1QUQ B;  3MEF A;  5ELE A;  1PYB A;  2KCM A;  3ONA B;  4DAY B;  4LF5 L;  4DAP A;  1X9N A;  1TII D;  2A74 C;  2C9O A;  2O4X A;  2B29 A;  1FJG L;  2G9D A;  3MZ5 A;  3S17 B;  2A1A A;  5GAH C;  4DR4 Q;  2B2W C;  2IPK D;  4RFB A;  3LWU A;  2ZM6 Q;  2K75 A;  1PRT B;  1ML0 D;  1TU2 B;  3K7A B;  4PG3 A;  2KJX A;  1D8L A;  2Z9H A;  1GUS A;  3BDO A;  4JVZ A;  3U9S A;  1PFS A;  5C44 G;  1L0W A;  2MP1 A;  2TMP A;  4EQN A;  1WJJ A;  4GNX A;  3OMC A;  1I4H A;  5CBE E;  1CK1 A;  4BA1 I;  4HTH A;  1KQS A;  2MNA A;  2JA5 H;  3H3V I;  1CQV A;  3KF8 B;  2E8G A;  4KTA A;  3GTK H;  3S1Q H;  3TME A;  4JI0 L;  4DR4 L;  1TQO A;  1HNW L;  2ZM6 L;  4GNX B;  1YI2 A;  3BYT B;  2NVT B;  2KHI A;  1PRT F;  1IBM Q;  4ZLT F;  2CFM A;  4H13 C;  1VQJ A;  1EY0 A;  1ET6 A;  4ZAI A;  1NY4 A;  4X6A H;  1V43 A;  2IT1 A;  4J8Q A;  1X56 A;  4DV5 L;  1L0Y B;  1I4X A;  2ZTE A;  4K5W A;  2ALY B;  2AQ3 B;  3X3N A;  1YIT A;  2R92 B;  2VB2 X;  2RA4 A;  3DEO A;  1IBL Q;  2RBM A;  1EY9 A;  3S1N B;  1JC7 A;  1A2T A;  1HTP A;  4RG1 A;  2R6G A;  1V1P A;  1STE A;  1OTC A;  1IBM L;  1YEZ A;  4L6T B;  3BVG A;  2AUK A;  2PW5 A;  4LF9 Q;  2ZT9 C;  3W2D A;  5KND A;  3V05 A;  1NJI C;  4RH6 A;  4A3K B;  1DON A;  2L5T A;  4H0L C;  2F0M A;  1U5K A;  1Z9F A;  5AFW A;  2B63 H;  1MIU A;  1V1P B;  4R4T A;  4DAM A;  3GTL B;  1BCP C;  4AIM A;  4Y52 H;  2A19 A;  2K33 A;  3ERS X;  3S1R H;  1CKN A;  3IAY A;  4MTN A;  3I55 A;  1VQ7 A;  3S2H B;  4DNR B;  5KNC A;  4JW0 A;  4X65 Q;  2BCO A;  3CRL C;  3HOY B;  1EL0 A;  4DR5 L;  4A3I B;  1TS5 A;  5C6A A;  1CKN B;  2AUJ D;  3D8G A;  2VNU D;  2J0T D;  5GAG C;  2MHV A;  2E2I H;  1X65 A;  3DHQ A;  4HN7 A;  1FL0 A;  1II3 A;  1Q1E A;  1ESF A;  4P72 A;  4JC0 A;  4S3S A;  1V1Q A;  1Y1V G;  4X3S A;  4CJ2 C;  4DR3 Q;  3F8T A;  5IGD A;  2EY6 A;  5C4J H;  2ZXP A;  1W2B A;  3CC4 A;  4KKT A;  3CP0 A;  5E3F A;  2HT1 A;  4CHT B;  3HOX B;  1HA5 A;  2EYP A;  3JC6 6;  4K5X A;  1EIF A;  1X3G A;  1HUM A;  4X65 L;  2IX1 A;  4DXG A;  3Q24 A;  5IT9 E;  2WAQ B;  3O13 A;  1YJW A;  1B8A A;  1WTQ A;  1EUJ A;  2HDL A;  2WAQ G;  3DM3 A;  3Q6S A;  3U4Z A;  3FKI H;  4MNO A;  1VS0 A;  3NSW A;  1G2S A;  3TP7 A;  1BCP F;  3AB9 A;  1WYD A;  2PZT A;  4UP8 A;  1WTO A;  4JI4 Q;  3D31 A;  5KYI A;  2YYZ A;  4K2K A;  2N88 A;  4RKL A;  4DR3 L;  3R2I A;  2I5H A;  4LFA Q;  4JYA L;  2WKC A;  4EQP A;  2SDF A;  2B2T A;  1F2M A;  2BH2 A;  2PMZ B;  1XPO A;  1JQY D;  4TSS A;  4L5T A;  3NTK A;  2JA5 B;  1OXU A;  2G5D A;  1WD0 A;  3T13 A;  2JA5 G;  4V0B A;  5D65 A;  4HCE A;  5DNF A;  3TS0 A;  3GTK B;  2M00 A;  3T56 B;  3S1Q B;  2RDG A;  4GN5 A;  4IUR A;  3OMG A;  4JBW A;  4IUU A;  1TWG H;  4DFA A;  2KUM A;  3PUY A;  4DN4 M;  2Q2T A;  3EN2 A;  4QJF A;  3AFQ A;  4JPB W;  2RVL A;  2VXW A;  2EYJ A;  1OXS C;  1TR5 A;  4CKC A;  1Q82 C;  2RKS A;  2L12 A;  3E5S A;  1LYL A;  1NSN S;  2E75 C;  2R61 A;  1ASZ A;  4FO2 A;  1E2W A;  4WOR A;  4MN3 A;  1PTO H;  4PZ8 A;  2RCF A;  4DK0 A;  3T1H L;  1EIY B;  5IYD H;  1ZXT A;  1STH A;  3C3L A;  2R93 H;  3PF4 A;  4BBS H;  1UEA B;  2EYH A;  3UDI A;  1VQF A;  2FMM A;  2EJG C;  2VB3 X;  1V9P A;  1EY7 A;  5L37 A;  1D5Z C;  3LX0 A;  1QE6 A;  5H1S E;  4DR6 L;  4DF7 A;  3NEM A;  5LMN W;  3KDF A;  3M4P A;  1CSQ A;  3VA5 A;  2MUY A;  2UU9 L;  2B63 B;  3CU7 A;  4TRD A;  2XTI A;  3RZD H;  2B63 G;  4YWL A;  1HNX Q;  2QKI C;  2F0S A;  4KY5 A;  1EQV A;  5ELC A;  2DGY A;  2N3S A;  3PUV A;  1SMX A;  1DYQ A;  3S1R B;  4EX5 A;  1YJ9 A;  1QVG A;  5DAU A;  3KDF B;  3S1M H;  2OT2 A;  4G4K A;  4A3F B;  4OON A;  5FK9 C;  3GTO B;  2RSO A;  1EOT A;  1NAP A;  3A56 A;  3M4O B;  1VQE A;  3CRK C;  2B2U C;  1VQ9 A;  4H7B A;  2B39 A;  5GRO A;  3EA6 A;  3C46 A;  4B9W A;  4L5S A;  3I4N H;  4U68 A;  1X55 A;  3MTS A;  1L1O A;  2E2I B;  5D14 A;  3NQT A;  1HNX L;  4GOP C;  3KJP A;  4V19 0;  2GA4 B;  3SK5 A;  3PSI A;  1S3O A;  4DK3 C;  2JA6 H;  2MFI A;  4UDU C;  1S5B D;  1Y69 U;  2NVQ H;  1RIP A;  1A8V A;  3NUC A;  5C4J B;  4FXD A;  5DM7 3;  1IL2 A;  3PMF A;  1ROD A;  1L1O B;  1PH5 A;  4IPH A;  1C0A A;  5BN4 A;  1SE2 A;  3T16 A;  1SE8 A;  2L9H A;  3KK7 A;  1M1K C;  4L8J A;  2E74 C;  1WTR A;  3I2Z A;  2R7F A;  4QQB X;  2A8V A;  2EPB A;  2FIN B;  3T1Y L;  4O1N A;  3K6O A;  1C8C A;  3FKI B;  3AFP A;  3VR5 A;  1SFO H;  1SNO A;  2UXB L;  3FKI G;  1VQI A;  2PZU A;  3K7U C;  1UE6 A;  1UE5 A;  2AQ2 B;  1ZYR C;  4HID A;  4DV0 Q;  4JBJ A;  3A74 A;  1KAA A;  2I5M X;  2N55 A;  2RQX A;  1KAB A;  1O7Y A;  4XT3 B;  2O5J C;  3I73 A;  4QL5 A;  4I7A A;  5GAE C;  1SJH D;  4NMZ A;  4QUC A;  4TVA B;  2FJ2 A;  3S2D H;  3OIP A;  4C3H B;  4ZKB B;  1GKH A;  1YIJ A;  4N9T A;  1F2Y A;  3CCU A;  3UE1 A;  1K8A C;  5IE8 A;  1TT2 A;  4HJ9 A;  4AH6 A;  1HNZ L;  3M7N A;  2VUM B;  1WI5 A;  4HMI A;  2B8G A;  4NXN Q;  2WB1 E;  4N8F A;  1UNS A;  1TWG B;  2JA8 B;  2UXC Q;  2PCF B;  3J80 c;  3U50 C;  2Q8T A;  1STB A;  4B3S Q;  1EY4 A;  1MHW C;  3PIO 3;  1AW7 A;  2NZO A;  3NXW A;  1B3Q A;  3I70 A;  2NVX H;  3NTH A;  1HQR D;  3F1Z A;  1OXV A;  1WTP A;  2UUA L;  1HCZ A;  4HJ7 A;  1PTO B;  3KLR A;  3I8Z A;  5EKK A;  3GP7 A;  3OPO A;  5EAY A;  1VQN A;  4JI1 Q;  3L7Z C;  2R93 B;  3OWE B;  1Q90 A;  1KL9 A;  2K5N A;  4C56 C;  5IYD G;  1RTO A;  2WV6 D;  2K6A A;  1TY2 A;  2Y0S B;  3PIP 3;  5J22 A;  4F87 A;  2UXC L;  4K8I A;  4BBS G;  2J7Z A;  2Y0S G;  1O7Z A;  2LXK A;  4ZYS A;  4OXP A;  4B3S L;  3HOU H;  1FGU A;  4DV3 L;  1JIC A;  2UXD L;  1D2B A;  4OO1 H;  2K1B A;  2UUC Q;  1JT8 A;  3D0F A;  3VR2 A;  1CA6 A;  2NN6 I;  3DUZ A;  4DA2 A;  2VQF Q;  1EWC A;  3RZD B;  1GUW A;  4K6L A;  1C4Q A;  4JI1 L;  1VQ4 A;  1QWY A;  2HQL A;  5E1F A;  4A3M H;  3GQB A;  1AE3 A;  3ER0 A;  1B7Y B;  3S1M B;  3K5L A;  1JOK A;  1P8L A;  1T5E A;  5EBC A;  3EQL C;  1VQK A;  1VQA A;  3NBH A;  2E2J H;  2CH4 A;  5JOB A;  3HOW H;  1W6K A;  4HSV A;  1BQQ T;  1AE2 A;  3DXJ C;  3A5Z B;  2UUC L;  1BBW A;  2F4V L;  3T4A C;  2MO1 A;  4KHV A;  2AWN A;  3BDC A;  3J7Y W;  1AZP A;  3GTJ H;  3I4N B;  4LF8 Q;  3I7F A;  3D3R A;  1A3V A;  3BDL A;  3I4N G;  1KNA A;  2ENB A;  4BA2 I;  3NBH B;  5C5M A;  3J80 i;  2JA6 B;  5IT9 L;  4B08 A;  2CCZ A;  3DWP A;  2JA6 G;  2NVQ B;  3C2P A;  4OWT B;  2BA1 A;  3OW7 A;  4X66 Q;  4OO1 I;  3QIA A;  1Q46 A;  5G3L D;  1I4P A;  1D1I A;  2A6E C;  2HQE A;  3OHX C;  4I65 A;  2A68 D;  2NTS A;  4LF8 L;  1B9M A;  4P75 A;  2HCC A;  3BS1 A;  2RHS B;  1A62 A;  4ME5 A;  1X3Q A;  1I94 Q;  4FF2 A;  4GKJ Q;  1JWU D;  4RWS C;  2Z6K A;  5FO9 B;  2H1E A;  2F0T A;  1SMY D;  3CC2 A;  1XXG A;  1KRT A;  4G7Z C;  4B9X A;  3ND8 A;  1F9Q A;  5EPL A;  3SE0 A;  3N6R A;  1S40 A;  1ET9 A;  2VS1 A;  2YU9 H;  4ZK9 B;  4YCW A;  4C3J B;  3M85 A;  4G7H C;  2D5D A;  4X66 L;  3TP5 A;  1HQM C;  4Q5V A;  5IOD A;  3S2D B;  4CGY B;  4QCL A;  3CW2 C;  3A8I E;  2NBF A;  2NN6 G;  2I46 A;  1DZ1 A;  1Y8P B;  4JBM A;  3C1F A;  4ZRZ A;  4DR1 L;  4RGO S;  1A63 A;  1H9R A;  3SK6 A;  1I94 L;  5IYC H;  1BOS A;  1N8R C;  1BVS A;  4JOI C;  4P74 A;  5LHY 1;  5EPK A;  3A8J E;  3GD7 A;  2K32 A;  5J1Z A;  3IKJ A;  2E2H H;  4DNT B;  2A69 D;  4UP7 A;  1HR0 W;  1U4M A;  1D7Q A;  2NVX B;  4A3C H;  3KBG A;  2EJF C;  3D6W A;  1XYI A;  4DV4 Q;  1PXU A;  3HFZ B;  3OOC A;  2KCC A;  1Q8K A;  5CYU A;  4TKO B;  2XVS A;  2K4K A;  1MKH A;  4CKE A;  4ZUJ A;  1R4Q B;  3KLS X;  2F0W A;  5FO7 B;  3SEB A;  1PH2 A;  1GUO A;  2L0C A;  5CV5 A;  4KJN A;  5CBA E;  4LF5 Q;  4YY3 Q;  1LT3 D;  1ZYR D;  1RDP D;  5K36 H;  1FJG Q;  2JA7 H;  4DR2 Q;  1S72 A;  1JWM D;  3HKS A;  1YNN C;  1S5D D;  2L11 A;  3H3V H;  3HOU B;  4LUO A;  4G7O C;  5C5L A;  3HOU G;  3S15 H;  1PYS B;  1PRT C;  3D4R A;  2H4O A;  1DOM A;  4OO1 G;  5DM6 3;  4MIU A;  4GZY C;  4DV4 L;  2HCI A;  5CGK A;  2PI2 E;  3MXP A;  1YHA A;  2YTX A;  4X3U A;  2QW7 A;  3GV6 A;  1BR9 A;  3FPP A;  4X64 L;  3PUZ A;  1E0B A;  4A3M B;  1JE4 A;  4YY3 L;  4XDX A;  4A3M G;  4JI6 L;  1MI2 A;  2FMC A;  4LK1 C;  1XPU A;  2EY5 A;  1YNJ D;  2J4X A;  1G29 1;  4DR2 L;  3K81 C;  4CDE C;  2E2J B;  3HOW B;  1NE3 A;  3VDY A;  3A7A B;  4GNX C;  4JI0 Q;  3HOW G;  2ES2 A;  1HNW Q;  4BY1 H;  5EKL A;  4H02 A;  4IO9 A;  3PO3 H;  1U4L A;  2B2Y A;  3GV3 A;  3GTJ B;  1PZJ D;  4LF6 Q;  3I56 A;  5C44 B;  1I6H H;  5C3X A;  3KYH C;  4KLK A;  1FD7 D;  1XNQ L;  1SNP A;  4NPS A;  4RCN A;  2ZXR A;  3R93 A;  3J81 c;  1WVL A;  3BG3 A;  1VDZ A;  2HD3 A;  3KFU A;  5EGT A;  2K5V A;  4DV1 L;  1XX8 A;  4IAL A;  4DV5 Q;  4BXX H;  1PFB A;  1GHK A;  4F7X A;  3OTO L;  1PH1 A;  1ZKO A;  1TS2 A;  2QCP X;  3NK9 A;  1B44 D;  3RR5 A;  1SSO A;  2K50 A;  4NP5 A;  2M9V A;  4POG A;  3NTI A;  1I3Q H;  5ELF A;  4ZUI A;  2CH4 W;  4BWG B;  3CHB D;  4LF6 L;  1AH9 A;  4F8M A;  1YBY A;  1VQ8 A;  3CCV A;  1HFG A;  2V1C C;  2UUB Q;  4PNY A;  1LTB D;  1QCB D;  1A3U A;  4WJW A;  3K57 A;  2E76 C;  2F0E A;  1HH2 P;  1SLJ A;  2YU9 B;  1HPC A;  1EQR A;  1I50 H;  3TP8 A;  2PQE A;  1AZQ A;  2D0O A;  3G4S A;  1C7Y A;  3S9W A;  1FGB D;  3H91 A;  1L0X B;  1CM9 A;  4A3L H;  2F0N A;  4UPA A;  2AKW B;  3MAQ A;  1EU4 A;  3RN2 A;  1ASY A;  1OXX K;  1RF2 D;  1ILP A;  2DUD A;  3PUW A;  1V1O A;  2ICI A;  5C3E H;  5M3F H;  1TWH H;  1Z6H A;  2UUB L;  2P5Z X;  4RA8 A;  5IYC G;  3E6Z X;  2AMC B;  5ELD A;  4DR5 Q;  1H95 A;  1EYA A;  1UWV A;  1EQT A;  3NQI A;  2E2H B;  1BKB A;  3QJY A;  1NBW A;  3MEH A;  1PFN A;  2JP1 A;  1ILQ A;  2Q2I A;  2A6E D;  3SK4 A;  1STG A;  2RDF A;  4A3C G;  5JPM C;  1EFI D;  4L5R C;  3EVQ A;  2DY7 A;  3J81 i;  4PMW A;  1GO3 E;  1E1T A;  4CJ1 B;  1TWF H;  4ZCK A;  1PH4 A;  3NHH A;  2LY7 A;  1IL8 A;  3RLN A;  3ND9 A;  2I0Q A;  2EXZ A;  1BBX C;  2WAC A;  1SN8 A;  1SNQ A;  2IW3 A;  2JA7 B;  2ZTC A;  5K36 G;  2JA7 G;  3STB C;  3C1E A;  4DK6 C;  3RN5 A;  1M90 C;  4R4C A;  3S15 B;  4KY7 A;  2F0I A;  1EYG A;  3GTQ H;  2FFK B;  4CDC C;  2SOB A;  1Y1V B;  1X54 A;  1VQL A;  3OIQ A;  3JAM L;  4B3T Q;  1SEB D;  2L1B A;  4WFN 3;  4JYA Q;  1DOK A;  2EYF A;  2EZV A;  3G71 A;  2F0F A;  2EYL A;  4DR7 Q;  1I4G A;  2GVA A;  5ELB A;  3AEV A;  1K83 H;  2LMC B;  2QDL A;  2CQO A;  2YTY A;  5FLM G;  1O7I A;  5KIX A;  1Z7T A;  4R1J A;  4BY1 B;  4R4I A;  4IPD A;  3PO3 B;  3SVM A;  4BY1 G;  3AU7 A;  1LTL A;  2O5I C;  1I6H B;  3PO3 G;  3F2C A;  3Q0A A;  2K05 A;  3W1G A;  1A2U A;  4B3T L;  4OIJ A;  4A3E H;  2JEA I;  1B9N A;  2F0L A;  1A6X A;  1R9T H;  3W5O A;  3K0X A;  5E7N A;  3QOL A;  1MSH A;  4DR7 L;  2PNH A;  3NPP A;  3IFT A;  4LUV A;  1LV9 A;  4BXX G;  2MQH A;  1MD2 D;  1KLG D;  5CV4 A;  2F0V A;  2ATW A;  4PQX A;  1PRT D;  2JJQ A;  1SRU A;  3T1H Q;  1I3Q B;  2VY3 A;  3DWQ A;  2OQK A;  1IXR A;  3I91 A;  1IW7 C;  3HZX A;  1XTC D;  1PFM A;  3SXH A;  2QEJ C;  4OGQ C;  1RTN A;  1IKM A;  2XIW A;  2OF1 A;  5I2X A;  4IUQ A;  4EVO A;  2KCT A;  3MFY A;  4QF4 A;  1DOL A;  1HZC A;  4L63 B;  5IOC A;  2ZJQ A;  4DR6 Q;  1STY A;  1QNK A;  1K8M A;  2UU9 Q;  1BF4 A;  5FLX L;  1X3P A;  3BZC A;  1M4V A;  5A2Q E;  1ZEQ X;  1J5E Q;  3CPW A;  4J15 A;  3MFG A;  1DJR D;  4FXG C;  2MJ8 A;  4HJ5 A;  1YNX A;  1EIH A;  4C3I H;  4IUV A;  1EEF D;  4KV6 A;  3CME A;  3G6E A;  4A3L G;  4M8A A;  3F2D A;  2K14 A;  1ESR A;  1BNZ A;  2PPB C;  4GN4 B;  4YHH Q;  1N33 L;  1ENC A;  2K5D A;  2N49 A;  5M3F B;  1TWH B;  1HTL D;  5LL6 S;  3A8K E;  2CVR A;  1LTS D;  5C3E G;  5M3F G;  5BN3 A;  3FRP B;  4ODG A;  3CC7 A;  4G57 A;  1XMQ Q;  2Q8I B;  3K58 A;  4HJ8 A;  1RD9 D;  4UHV A;  4OX9 L;  3ULJ A;  4PV1 C;  5JJI A;  1D5X C;  2YTV A;  2K5H A;  4IPC A;  1VCI A;  1J5E L;  5IIF A;  4LFB Q;  3VYR A;  2JA9 A;  2VW9 A;  1KDA A;  1CFM A;  2KQ3 A;  3CCR A;  5M3M H;  1EIG A;  1YZ6 A;  1GHJ A;  1L1O C;  1CQF A;  1K3B C;  4HIO A;  1TWF B;  2AQ1 B;  3HKZ B;  5A35 A;  1HRJ A;  3RZO H;  1YHQ A;  3UI2 A;  3HKZ G;  1QZH A;  2F4I A;  3RD4 A;  4YHH L;  3I4M H;  1JB7 A;  1WCM G;  5HGQ A;  2WB1 B;  3SDZ A;  1P16 A;  3AMU A;  4HAE A;  1EZ8 A;  2KEE A;  2WB1 G;  3GTM H;  4K8J A;  3E3X A;  3VYS A;  1XMQ L;  1LAB A;  4CDD C;  3SGI A;  4DNI A;  3T1Y Q;  1EY6 A;  1WOC A;  3ITP A;  3BU2 A;  1VQ5 A;  1HXY D;  2UXB Q;  2KVM A;  1KC8 C;  4LFB L;  2WP8 J;  3TDQ A;  1DCZ A;  3E9I A;  4X62 L;  3F2B A;  2WIN B;  1IYJ B;  1FNU A;  5JVH 3;  3NWS A;  1CHP D;  5C3W A;  4CJ0 B;  1K8G A;  3TSS A;  4DGZ A;  4BS9 A;  2ASB A;  4O42 A;  1SYF A;  1K83 B;  1BCP D;  2NZH A;  4QIW E;  3MA2 B;  3VYU A;  4F88 A;  2IY5 B;  1ICW A;  3EBE A;  2RDH A;  5KGU A;  1HNZ Q;  1H9K A;  2B2U A;  4WJ3 M;  3FPU B;  5CMD A;  4YIJ A;  1I5F A;  2F0U A;  5LL6 X;  1YVC A;  5GAD C;  3B6Y A; 
#chains in the Genus database with same CATH homology
 4A3E B;  2L55 A;  2LFN A;  3LNN A;  1R9T B;  5I4D A;  1PTO C;  2QIL A;  3FVQ A;  4LJZ C;  2OEO A;  1U9R A;  1WTX A;  2NN6 H;  1BO0 A;  4XYQ A;  2DY8 A;  5J39 A;  1LTT D;  4HED A;  1SYG A;  3QOJ A;  1G8Z D;  1RJT A;  2JEB I;  4C1N I;  4KN7 C;  3K0Y A;  2V4D A;  3ERQ A;  1DD2 A;  5CV9 A;  4TQU S;  1SYB A;  3HEJ A;  4C3I B;  4K5V A;  1S5F D;  4BBS B;  4QUF A;  4C3I G;  1F9S A;  1QNU A;  1Q8I A;  1HFN A;  5ISR A;  4LMQ D;  1SNC A;  5DEH A;  1B2T A;  1CZG A;  1FNV A;  2EJM A;  2A5H A;  4ID6 A;  2HUG A;  1E2V A;  4ZKC B;  1PTO F;  4IFD H;  1CT1 D;  4P2C B;  3VA7 A;  1U4R A;  3I90 A;  3QG1 A;  5CV6 A;  3QO2 A;  1IYU A;  5M3M B;  2BDN A;  3RZO B;  1PMR A;  1RKN A;  5IGF A;  3I4M B;  3QB3 A;  2OXP A;  5HUR A;  1O7L A;  4IZ8 A;  1HA6 A;  5IGG A;  3JAM E;  3I4L A;  3GTM B;  5JEA H;  5IGE A;  4RCO A;  1RCV D;  2Z4I A;  4XT1 B;  2I07 B;  1UUP A;  1H9J A;  1Q12 A;  1EEI D;  5I6Y A;  5I9P A;  1AN8 A;  2SNS A;  1K8O A;  4FF1 A;  2SNM A;  3RMH A;  1BUV T;  2IWH A;  1I6V C;  4KKS A;  1JWS D;  1SDF A;  1JOO A;  3Q22 A;  2KED A;  4IFD I;  3GO5 A;  1FNW A;  1G91 A;  3WDN A;  2CQA A;  1SFO B;  3T53 B;  2F3W A;  4M1U B;  2NVY B;  3D6C A;  4ILW A;  4U67 3;  1DXM A;  2JYO A;  2QF7 A;  5M5Y B;  5I2Y A;  2CW0 C;  2L4N A;  2LKV A;  1GJX A;  3TBI B;  1QJO A;  1DM0 B;  3Q23 A;  3HG9 A;  1S5E D;  5FLX E;  5A2Q L;  5EQ0 A;  2M2L A;  2F0O A;  4XXE A;  4I7Z C;  4J6H A;  1S4Z A;  1TKW B;  2WKD A;  2PW7 A;  4RGT A;  2X6G A;  1A3T A;  1ENA A;  2DNC A;  1BXT A;  3A54 A;  2BA0 A;  2F3V A;  3TN2 A;  5TSS A;  4FP5 D;  1LT4 D;  5COR A;  1SXT A;  2DNE A;  2KOL A;  3P7J A;  2K5Q A;  2SEB D;  3N52 A;  3GTP B;  2XWB B;  3L9A X;  2JSO A;  4KJO A;  2NZ1 D;  1LTG D;  1EY8 A;  2EYO A;  3DM1 A;  4XQJ A;  3S14 B;  4A3J B;  2Z1C A;  2O2L D;  3NP8 A;  5K5P A;  1PZK D;  5NUC A;  3H94 A;  4IFD G;  1SYE A;  3HOZ B;  1KNE A;  1Z47 A;  3PO2 B;  2B2Y C;  5CR3 A;  2IX0 A;  4DAY A;  4FYD A;  3HGB A;  4KK7 A;  5D3I B;  4OIK A;  2EVB A;  2B2V A;  1LT6 D;  3V2T A;  1NR4 A;  2NB0 A;  3ERO A;  2G9H D;  5C4H A;  4FXK C;  4BY7 B;  1TWA B;  4WRD A;  5JEA G;  1HUN A;  1FYC A;  1H9S A;  4NW2 A;  1TVX A;  1QOH A;  3J80 E;  3MXG A;  5KRU A;  5HGT A;  2NWG A;  4KHZ A;  1SND A;  4XQN A;  1LLR D;  3MXU A;  1H9S B;  3KF8 A;  4OHJ A;  3V96 A;  4QMG A;  3IFD A;  3DWA A;  3LWE A;  2EOT A;  2F0J A;  1MGS A;  2B2W A;  1G6Z A;  4C2M B;  1GUN A;  5EJW A;  3J7A F;  2AWO A;  3KLS A;  4KD3 A;  2R7Z B;  2XNA C;  2ZXO A;  1F9R A;  3M3Y B;  2F0G A;  1TY0 A;  5KYL A;  4HMJ A;  1QIL A;  4QB4 A;  4DAV A;  4PMB A;  5C0X H;  1O80 A;  1GOZ A;  5EKI A;  3H3V C;  4IFD J;  1H9M A;  2QDB A;  2NTT A;  2ICE C;  2K28 A;  1GUG A;  3OWF A;  3MHB A;  4A3G B;  1LTA D;  1B1Z A;  3I3C A;  3E0J A;  2BE5 C;  3CKI B;  4RKB A;  5JEA J;  3P20 A;  2KHS A;  2BDO A;  2JXM B;  3WOF A;  3MXN A;  1RHP A;  3KUP A;  3H09 A;  1QB5 D;  1Y1W B;  3HRZ C;  2E2D C;  3D4D A;  3K5N A;  2CW0 D;  1KLU D;  1VF7 A;  1LTI D;  1OO9 B;  1CI3 M;  4DXF A;  4A3B B;  2XSC A;  1BDO A;  3BVZ A;  5C0X I;  3SHL A;  3TZU A;  1CHQ D;  2K03 A;  3FDT A;  2JE6 I;  1B50 A;  1SE3 A;  1BCP B;  4KN4 C;  2CHB D;  1PZI D;  2B2T C;  4IUP A;  5FOB B;  3P75 A;  2F0Q A;  1GXD C;  4ULL A;  4KMU C;  4ZQ3 A;  4LAA A;  3G6J B;  4XTC S;  4XQQ A;  1F2Z A;  1STA A;  4KD4 A;  4H44 C;  1WD1 A;  1YNN D;  2BOS A;  1TS4 A;  1JCK B;  4BBR B;  1NUC A;  1JOQ A;  4KY6 A;  1CTM A;  2K7V A;  1V8Q A;  1SJE D;  2D9U A;  4Q0F A;  4X3T A;  4RGM A;  3FMC A;  3EFX D;  1EWH A;  4RGN A;  1SYD A;  3QWN A;  5IGB A;  2LS0 1;  3NBI A;  1Y8N B;  1VMC A;  1JR0 D;  1R4P B;  3BYY B;  3H6M A;  1I50 B;  4CKB A;  2EY1 A;  4XIG S;  1Q3L A;  4KI0 A;  1SYC A;  4R8N A;  1A15 A;  1MSG A;  3NWT A;  2FHT A;  1S5C D;  2KCN A;  4QIW B;  1AEX A;  1QG7 A;  3K5O A;  4RHR A;  5C3E B;  5C0X G;  2XWJ B;  1CZW A;  3S16 B;  4AYB B;  4CBV A;  3WOE A;  1AFP A;  1IYV A;  4J1M A;  2IX3 A;  2IL8 A;  2PZW A;  1LAC A;  3A7L A;  1D5M C;  2TSS A;  1IKL A;  3L3O C;  3T51 B;  1EYC A;  1KTK A;  2A6H C;  1I4Q A;  5COY A;  2F0K A;  2KEC A;  1WCM B;  3J81 E;  1B4O A;  2ID0 A;  4HR7 B;  1EYD A;  1J8I A;  5IGC A;  2A68 C;  3X3M A;  2D2C C;  3GTQ B;  1SE4 A;  2A73 B;  3BZD B;  1SMY C;  3URY A;  1D1K A;  1CA5 A;  2XN9 C;  4OL7 A;  4FF3 A;  2F03 A;  3U9O A;  5CC4 A;  4IN3 A;  3MWY W;  2F0P A;  2Q8R E;  4NKL A;  5JAV A;  1JB3 A;  2PO4 A;  5JJZ A;  1AP0 A;  3RUZ A;  3M4Y A;  5FO8 B;  4HCS A;  1F2L A;  1XWE A;  3A55 A;  1ENF A;  4E6I A;  1M8A A;  3F2U A;  1VF5 C;  3SK8 A;  3J80 L;  1SAP A;  3GTG B;  1GUT A;  1U4P A;  2BE5 D;  1WTW A;  2A69 C;  2K01 A;  1JOR A;  5C4X B;  2B8F A;  1SBB B;  3VYT A;  3KBX A;  3FEW X;  5C0X J;  2K04 A;  5G3L F;  3PUX A;  2KA7 A;  5T1G A;  1NR2 A;  3OSO A;  5FKA C;  3BVM A;  2PNR C;  1Y8O B;  4C1N K;  2IJ0 A;  4XYO A;  5I6W A;  4IUT A;  4C3H G;  2X69 A;  5EBD A;  2NUC A;  4R8I A;  5F2D A;  1G2T A;  2XRS D;  1UAP A;  3MC0 B;  4ABN A;  3D4W A;  3IL8 A;  4K2L A;  1MBY A;  1YNJ C;  4HSP A;  5JPN C;  4FNF A;  4R9W A;  5M5X B;  1F77 A;  1X32 A;  2D62 A;  2X6L A;  1IHZ A;  1LO5 D;  3J7A V;  1EZ6 A;  4FVM A;  1J9O A;  5KEE A;  1W6J A;  2HDM A;  5E4X A;  5CV7 A;  3G7L A;  1IW7 D;  4A3D B;  4X3K A;  1PLF A;  1HHV A;  3DMU A;  1FR3 A;  2F0H A;  3P1H A;  4N9P A;  4K14 A;  5I9O A;  2XRQ D;  3CQZ B;  2K5W A;  3HP3 A;  1F9P A;  1E2Z A;  4K6D A;  4IUN A;  4KKU A;  2Z4H A;  3R2T A;  3EJI A;  3RLF A;  3ZYY X;  1STN A;  3PV0 A;  5D3D A;  5M9O A;  1C48 A;  3H0G B;  4EGV A;  4EQO A;  1EU3 A;  5E4W C;  3DEP A;  1LT5 D;  1KDC A;  2A6H D;  3VR3 A;  4UAI A;  2DN8 A;  2F0D A;  3MVV A;  3K5M A;  1PYW D;  1T5X D;  3SR1 A;  4DU9 A;  1TS3 A;  1KDB A;  1LTR D;  2F1M A;  4PMC A;  3R8B A;  4MHE A;  3HOV B;  2R3Z A;  4IQZ A;  3HS0 C;  4NDX A;  1TWC B;  4FF4 A;  5KNB A;  2MGS A;  4RHS A;  1SNM A;  2EY2 A;  2Z8L A;  5EPJ A;  1EY5 A;  4C3J G;  5JVG 3;  5CV8 A;  2EDG A;  2PYK A;  3NE5 B;  5C4Z A;  1I4R A;  4RAU C;  2EYM A;  3VR4 A;  3VR6 A;  4Y7N B;  3K59 A;  1Q1B A;  1ONL A;  1O78 A;  1OXT A;  3I72 A;  5BN5 A;  2C5C A;  1PTO D;  3M7G A;  3TP6 A;  3TZD A;  3J81 L;  4JK1 C;  1B53 A;  2EE1 A;  4DK1 A;  5M5W B;  2B2V C;  4Z9C B;  2MPM A;  1D6E C;  3W3A A;  5T1I A;  1B3A A;  2NYZ D;  2RSN A;  3R3O A;  1PDQ A;  1WTV A;  1NCV A;  4A93 B;  1VMP A;  2WII B;  5ELE A;  3ONA B;  4DAP A;  1TII D;  2A74 C;  2C9O A;  2O4X A;  2G9D A;  3MZ5 A;  3S17 B;  2B2W C;  2IPK D;  4RFB A;  3LWU A;  1PRT B;  1ML0 D;  1TU2 B;  3K7A B;  2KJX A;  1GUS A;  3BDO A;  3U9S A;  2MP1 A;  2TMP A;  4EQN A;  3OMC A;  1I4H A;  5CBE E;  1CK1 A;  4BA1 I;  4HTH A;  1CQV A;  4KTA A;  3TME A;  1TQO A;  3BYT B;  2NVT B;  1PRT F;  4ZLT F;  4H13 C;  1EY0 A;  1ET6 A;  4ZAI A;  1V43 A;  2IT1 A;  4J8Q A;  1L0Y B;  1I4X A;  4K5W A;  2AQ3 B;  3X3N A;  2R92 B;  2VB2 X;  2RA4 A;  3DEO A;  2RBM A;  1EY9 A;  3S1N B;  1JC7 A;  1A2T A;  1HTP A;  2R6G A;  1V1P A;  1STE A;  4L6T B;  3BVG A;  2AUK A;  2PW5 A;  2ZT9 C;  3W2D A;  5KND A;  3V05 A;  4RH6 A;  4A3K B;  1DON A;  2L5T A;  4H0L C;  2F0M A;  5AFW A;  3GTL B;  1V1P B;  1BCP C;  2K33 A;  3IAY A;  3S2H B;  4DNR B;  5KNC A;  2BCO A;  3CRL C;  3HOY B;  1EL0 A;  4A3I B;  1TS5 A;  5C6A A;  2AUJ D;  3D8G A;  2VNU D;  2J0T D;  2MHV A;  3DHQ A;  4HN7 A;  1II3 A;  1Q1E A;  1ESF A;  4S3S A;  4CJ2 C;  4X3S A;  5IGD A;  2EY6 A;  2ZXP A;  4KKT A;  5E3F A;  4CHT B;  3HOX B;  1HA5 A;  2EYP A;  4K5X A;  1HUM A;  2IX1 A;  4DXG A;  3Q24 A;  5IT9 E;  2WAQ B;  3O13 A;  1WTQ A;  2HDL A;  3Q6S A;  3NSW A;  1G2S A;  3TP7 A;  1BCP F;  3AB9 A;  2PZT A;  1WTO A;  3D31 A;  5KYI A;  4RKL A;  2YYZ A;  2N88 A;  4K2K A;  3R2I A;  2WKC A;  4EQP A;  2SDF A;  2B2T A;  1F2M A;  2PMZ B;  1JQY D;  4TSS A;  3NTK A;  2JA5 B;  1OXU A;  1WD0 A;  3T13 A;  4V0B A;  5D65 A;  4HCE A;  5DNF A;  3GTK B;  3S1Q B;  2M00 A;  3T56 B;  2RDG A;  4IUR A;  3OMG A;  4JBW A;  4IUU A;  4DFA A;  2KUM A;  3PUY A;  4DN4 M;  2RVL A;  2VXW A;  2EYJ A;  1OXS C;  1TR5 A;  4CKC A;  2RKS A;  2L12 A;  3E5S A;  1NSN S;  2E75 C;  2R61 A;  4FO2 A;  1E2W A;  4WOR A;  4MN3 A;  1PTO H;  4DK0 A;  1ZXT A;  1STH A;  3C3L A;  1UEA B;  2EYH A;  2FMM A;  2EJG C;  2VB3 X;  1EY7 A;  1D5Z C;  3LX0 A;  1QE6 A;  4DF7 A;  3VA5 A;  2MUY A;  2B63 B;  3CU7 A;  4TRD A;  2QKI C;  2F0S A;  4KY5 A;  1EQV A;  5ELC A;  3PUV A;  1DYQ A;  3S1R B;  5DAU A;  2OT2 A;  4G4K A;  4A3F B;  5FK9 C;  3GTO B;  2RSO A;  1EOT A;  1NAP A;  3A56 A;  3M4O B;  3CRK C;  2B2U C;  4H7B A;  2B39 A;  3EA6 A;  3C46 A;  4B9W A;  4U68 A;  3MTS A;  2E2I B;  5D14 A;  3NQT A;  4V19 0;  2GA4 B;  3SK5 A;  4UDU C;  1S5B D;  1Y69 U;  3NUC A;  5C4J B;  4FXD A;  5DM7 3;  3PMF A;  1ROD A;  5BN4 A;  1SE2 A;  3T16 A;  2L9H A;  3KK7 A;  4L8J A;  2E74 C;  1WTR A;  2EPB A;  2FIN B;  4O1N A;  3K6O A;  1C8C A;  3FKI B;  3VR5 A;  1SNO A;  2PZU A;  2AQ2 B;  1ZYR C;  1KAA A;  2N55 A;  2RQX A;  1KAB A;  1O7Y A;  4XT3 B;  2O5J C;  3I73 A;  1SJH D;  4NMZ A;  4QUC A;  2FJ2 A;  3OIP A;  4C3H B;  4ZKB B;  4N9T A;  1F2Y A;  1TT2 A;  3M7N A;  2VUM B;  4HMI A;  2B8G A;  1UNS A;  1TWG B;  2JA8 B;  2PCF B;  2Q8T A;  1STB A;  1EY4 A;  3PIO 3;  1AW7 A;  3NXW A;  3I70 A;  3NTH A;  1HQR D;  1OXV A;  1WTP A;  1HCZ A;  1PTO B;  3KLR A;  3I8Z A;  5EKK A;  3GP7 A;  3OPO A;  3L7Z C;  2R93 B;  3OWE B;  1Q90 A;  4C56 C;  1RTO A;  2WV6 D;  2K6A A;  1TY2 A;  2Y0S B;  3PIP 3;  5J22 A;  4F87 A;  4K8I A;  2J7Z A;  1O7Z A;  4ZYS A;  1JIC A;  1D2B A;  4OO1 H;  2K1B A;  3VR2 A;  1CA6 A;  2NN6 I;  3DUZ A;  4DA2 A;  1EWC A;  3RZD B;  1GUW A;  4K6L A;  1C4Q A;  1QWY A;  5E1F A;  3GQB A;  3S1M B;  3K5L A;  1JOK A;  1T5E A;  5EBC A;  3EQL C;  3NBH A;  5JOB A;  1W6K A;  4HSV A;  1BQQ T;  3DXJ C;  3T4A C;  4KHV A;  2AWN A;  3BDC A;  3J7Y W;  1AZP A;  3I4N B;  3D3R A;  1A3V A;  3BDL A;  1KNA A;  2ENB A;  4BA2 I;  5C5M A;  2JA6 B;  5IT9 L;  4B08 A;  3DWP A;  2NVQ B;  3C2P A;  2BA1 A;  3OW7 A;  4OO1 I;  3QIA A;  5G3L D;  1I4P A;  1D1I A;  2A6E C;  2HQE A;  3OHX C;  4I65 A;  2A68 D;  2NTS A;  1B9M A;  3BS1 A;  2HCC A;  4ME5 A;  1X3Q A;  4FF2 A;  1JWU D;  4RWS C;  5FO9 B;  2H1E A;  2F0T A;  1SMY D;  1XXG A;  4G7Z C;  4B9X A;  3ND8 A;  1F9Q A;  5EPL A;  3SE0 A;  3N6R A;  1ET9 A;  4ZK9 B;  4C3J B;  3M85 A;  4G7H C;  2D5D A;  3TP5 A;  1HQM C;  4Q5V A;  5IOD A;  3S2D B;  4CGY B;  4QCL A;  3A8I E;  2NBF A;  2NN6 G;  2I46 A;  1DZ1 A;  1Y8P B;  3C1F A;  4ZRZ A;  4RGO S;  1H9R A;  3SK6 A;  1BOS A;  5LHY 1;  5EPK A;  3A8J E;  3GD7 A;  2K32 A;  5J1Z A;  3IKJ A;  4DNT B;  2A69 D;  1U4M A;  2NVX B;  3KBG A;  2EJF C;  3D6W A;  1XYI A;  1PXU A;  3OOC A;  2KCC A;  5CYU A;  4TKO B;  2XVS A;  4CKE A;  4ZUJ A;  1R4Q B;  3KLS X;  2F0W A;  5FO7 B;  3SEB A;  1GUO A;  2L0C A;  5CV5 A;  4KJN A;  5CBA E;  1LT3 D;  1ZYR D;  1RDP D;  5K36 H;  1JWM D;  1YNN C;  1S5D D;  2L11 A;  3HOU B;  4G7O C;  5C5L A;  1PRT C;  3D4R A;  2H4O A;  1DOM A;  4OO1 G;  5DM6 3;  4MIU A;  4GZY C;  2HCI A;  5CGK A;  3MXP A;  4X3U A;  3GV6 A;  1BR9 A;  3FPP A;  3PUZ A;  1E0B A;  4A3M B;  1JE4 A;  4XDX A;  1MI2 A;  2FMC A;  4LK1 C;  2EY5 A;  1YNJ D;  2J4X A;  1G29 1;  2E2J B;  3HOW B;  3A7A B;  5EKL A;  1U4L A;  2B2Y A;  3GV3 A;  3GTJ B;  1PZJ D;  5C44 B;  5C3X A;  1FD7 D;  1SNP A;  4RCN A;  2ZXR A;  3R93 A;  1WVL A;  3BG3 A;  1VDZ A;  5EGT A;  1XX8 A;  4IAL A;  1PFB A;  1GHK A;  4F7X A;  1ZKO A;  1TS2 A;  2QCP X;  3NK9 A;  1B44 D;  1SSO A;  4NP5 A;  2M9V A;  3NTI A;  5ELF A;  4ZUI A;  4BWG B;  3CHB D;  4F8M A;  1HFG A;  4PNY A;  1LTB D;  1QCB D;  1A3U A;  4WJW A;  3K57 A;  2E76 C;  2F0E A;  2YU9 B;  1HPC A;  3TP8 A;  2PQE A;  1AZQ A;  3S9W A;  1FGB D;  3H91 A;  1L0X B;  1CM9 A;  2F0N A;  3MAQ A;  1EU4 A;  1OXX K;  1RF2 D;  1ILP A;  3PUW A;  1V1O A;  2ICI A;  1Z6H A;  4RA8 A;  3E6Z X;  5ELD A;  1EYA A;  1EQT A;  3NQI A;  2E2H B;  3QJY A;  3MEH A;  1PFN A;  2JP1 A;  1ILQ A;  2A6E D;  3SK4 A;  1STG A;  2RDF A;  5JPM C;  1EFI D;  3EVQ A;  2DY7 A;  4PMW A;  4CJ1 B;  3NHH A;  2LY7 A;  1IL8 A;  3ND9 A;  2EXZ A;  1BBX C;  2WAC A;  1SNQ A;  2IW3 A;  2JA7 B;  5K36 G;  3C1E A;  3S15 B;  4KY7 A;  2F0I A;  2FFK B;  2SOB A;  1Y1V B;  3OIQ A;  3JAM L;  1SEB D;  2L1B A;  4WFN 3;  1DOK A;  2EYF A;  2EZV A;  2F0F A;  2EYL A;  1I4G A;  5ELB A;  2LMC B;  5KIX A;  1Z7T A;  4BY1 B;  3PO3 B;  3SVM A;  3AU7 A;  2O5I C;  1I6H B;  3Q0A A;  2K05 A;  1A2U A;  4OIJ A;  2JEA I;  1B9N A;  2F0L A;  1A6X A;  3QOL A;  1MSH A;  3NPP A;  3IFT A;  1LV9 A;  1MD2 D;  1KLG D;  5CV4 A;  2F0V A;  4PQX A;  1PRT D;  1I3Q B;  3DWQ A;  3I91 A;  1IW7 C;  3HZX A;  1XTC D;  1PFM A;  3SXH A;  2QEJ C;  4OGQ C;  1RTN A;  1IKM A;  2XIW A;  2OF1 A;  5I2X A;  4IUQ A;  4EVO A;  3MFY A;  4QF4 A;  1DOL A;  4L63 B;  5IOC A;  1STY A;  1QNK A;  1K8M A;  1BF4 A;  5FLX L;  1X3P A;  1M4V A;  5A2Q E;  1ZEQ X;  3MFG A;  1DJR D;  4FXG C;  2MJ8 A;  1EIH A;  4IUV A;  1EEF D;  4KV6 A;  4M8A A;  1ESR A;  1BNZ A;  2PPB C;  1ENC A;  2K5D A;  5M3F B;  1TWH B;  1HTL D;  5LL6 S;  3A8K E;  2CVR A;  1LTS D;  5BN3 A;  3FRP B;  4ODG A;  4G57 A;  2Q8I B;  3K58 A;  1RD9 D;  4PV1 C;  1D5X C;  1VCI A;  5IIF A;  3VYR A;  1KDA A;  1CFM A;  2KQ3 A;  1EIG A;  1GHJ A;  1HRJ A;  1CQF A;  1TWF B;  2AQ1 B;  3HKZ B;  5A35 A;  3UI2 A;  2F4I A;  3RD4 A;  2WB1 B;  3SDZ A;  3AMU A;  4HAE A;  1EZ8 A;  2KEE A;  4K8J A;  3VYS A;  1LAB A;  1EY6 A;  3ITP A;  1HXY D;  2KVM A;  2WP8 J;  3TDQ A;  1DCZ A;  2WIN B;  1FNU A;  5JVH 3;  3NWS A;  1CHP D;  5C3W A;  4CJ0 B;  3TSS A;  4DGZ A;  4BS9 A;  4O42 A;  1SYF A;  1K83 B;  1BCP D;  3MA2 B;  3VYU A;  4F88 A;  1ICW A;  2RDH A;  5KGU A;  1H9K A;  2B2U A;  3FPU B;  5CMD A;  4YIJ A;  2F0U A;  5LL6 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...