1HFGA

Nmr solution structure of vmip-ii 1-71 from kaposi's sarcoma-associated herpesvirus (minimized average structure).
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
71
structure length
71
Chain Sequence
LGASWHRPDKCCLGYQKRPLPQVLLSSWYPTSQLCSKPGVIFLTKRGRQVCADKSKDWVKKLMQQLPVTAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure/Function of Human Herpesvirus-8 Mip-II (1-71) and the Antagonist N-Terminal Segment (1-10)
pubmed doi rcsb
molecule tags Chemokine
molecule keywords VIRAL MACROPHAGE INFLAMMATORY PROTEIN-II
total genus 10
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2000-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1hfgA00
1DONA 1B53A 1TVXA 1LV9A 1BBXC 2KUMA 2D9UA 3I3CA 1PFMA 2K04A 1KNAA 2NZ1D 4MHEA 2B2WC 2KOLA 3DM1A 1U4PA 1M8AA 2K1BA 5AFWA 1EIGA 1HHVA 2R3ZA 4NW2A 3UI2A 4LMQD 3GV3A 2KECA 4RWSC 4R9WA 1O80A 2L12A 3Q6SA 2FHTA 1QE6A 1X3QA 2K01A 2N55A 5D65A 1MI2A 2KVMA 2L1BA 2JP1A 2K28A 4R8IA 3IL8A 1NR2A 1NCVA 2X6LA 1HUNA 5CMDA 5T1IA 5EPKA 2EE1A 1WTVA 1X32A 2B2TA 3TZDA 3DEOA 2FINB 1J9OA 2IL8A 4ZK9B 1WTPA 2B2VA 1IKMA 3F2UA 1WVLA 1E0BA 1G2SA 2FFKB 3IFDA 1IKLA 1B4OA 2XIWA 4U68A 3I91A 3H91A 2HCIA 1EOTA 2B2UC 1RODA 3DEPA 2FMMA 2B2WA 2HDMA 1EIHA 4CJ1B 3TN2A 2HDLA 3FDTA 3R93A 2J7ZA 1U4MA 4RAUC 2L4NA 5E4XA 5T1GA 1B50A 2KEEA 3P7JA 5CBAE 5JJZA 1F9RA 2DY8A 1ESRA 1F9QA 1A15A 4X3UA 1J8IA 2HUGA 4ZKBB 1G6ZA 1JE4A 2CVRA 4QUFA 2Q8RE 1EL0A 2L9HA 4UAIA 3KUPA 2RA4A 2L11A 1G2TA 1SAPA 2B2TC 2Q8TA 4CJ0B 2EOTA 1EQTA 4ZAIA 1DZ1A 1F2LA 1F9SA 1QNKA 2JYOA 4CJ2C 1RTNA 1O7ZA 2FJ2A 1HA6A 1XX8A 1NAPA 2SDFA 1PFNA 1ILQA 3MTSA 4HAEA 1HFGA 1NR4A 4HEDA 5EKIA 1WTWA 1G91A 1X3PA 1GUWA 2MGSA 1AP0A 2X69A 5E4WC 2EPBA 2B2UA 5D14A 1MGSA 2K03A 4DN4M 1MSGA 5COYA 2M2LA 5EPLA 1DOLA 4QUCA 4RA8A 1WD1A 4ZKCB 4IUTA 3LWEA 5EPJA 3I8ZA 5EQ0A 1BO0A 1SSOA 1PFBA 1PDQA 1RJTA 3ONAB 4HCSA 1IL8A 2MJ8A 2K05A 4IUVA 3SVMA 1F9PA 3QO2A 1RHPA 4IUPA 1SDFA 4XDXA 1VMCA 1C8CA 1CA5A 4IURA 4OIJA 2B2YC 2RSOA 1WD0A 2NYZD 1O7YA 1ZXTA 2B2VC 3FPUB 4ZLTF 1U4RA 1B2TA 4X3TA 5DNFA 2KEDA 2VXWA 4MN3A 1RTOA 1PLFA 4X3SA 1WTRA 1BF4A 1ICWA 1MSHA 5EJWA 4HSVA 3G7LA 5CORA 2BDNA 1HRJA 1DOKA 4IUQA 1S4ZA 1AZQA 1ILPA 1CA6A 1B3AA 1XYIA 2X6GA 1QG7A 5CBEE 2RVLA 4XT3B 1BNZA 3GV6A 3N52A 4X3KA 2N88A 1JICA 1U4LA 1VMPA 2NWGA 3HP3A 4OIKA 2HCCA 2H1EA 1AZPA 1HFNA 3MWYW 3I90A 1WTQA 1ML0D 4IUUA 1DOMA 1Q3LA 4O42A 1WTXA 2MPMA 1WTOA 2B2YA 2MP1A 3KBXA 1CM9A 4XT1B 2DY7A 1KNEA 2RSNA 1HUMA 3D6WA
chains in the Genus database with same CATH superfamily
4OELB 2YYZA 4GKJL 4KHZA 4NP5A 2NVXH 2PI2A 4DXGA 2F0TA 5I6YA 1AEXA 3HOYG 2D5DA 2Z6KC 4GKJQ 1I50H 1XPRA 2ICIA 1BOSA 4U673 1YNJD 1PH1A 4X65Q 3D4DA 1VQNA 3OTOL 4EQNA 1PVOA 4X62L 1JOKA 2RHQB 1EIHA 1QCBD 4RCOA 4AYBE 2Y0SB 1IW7C 1B50A 2KEEA 5CBAE 4A93G 4L6TB 4DR7Q 5JEAH 3HGBA 1WJJA 2CH4A 2D0PA 5FO7B 3L2PA 2RA4A 4WORA 4NXML 4CDDC 3K5MA 3CC2A 4IJLA 2EYPA 4FF4A 3MFGA 2FJ2A 3F8TA 2Y0SE 1PH7A 3SHLA 4LAAA 4PQXA 2O4XA 2B2UA 1H9SB 3M4QA 2I07B 2RKSA 1HQRD 4DV3Q 3T4AC 3DWQA 2QDLA 2MJ8A 3AFQA 4L8JA 3LNNA 3CF5A 1MD2D 3I56A 4NXNQ 5L37A 2XWJB 3UE0A 2YV5A 1TWFH 2BDOA 3BYYB 5E7NA 3CMAA 2R93G 1PRTD 4OO1H 1MIUA 4LF8Q 1EZ6A 3M9BA 4JBJA 1MSHA 4HIDA 3NEMA 5BN3A 1SJED 1JWUD 1S4ZA 2XNAC 3E9HA 5C6AA 1V8QA 4O2DA 2KHIA 1DD2A 1BKBA 3N52A 1B9NA 2JSOA 1U4LA 4OIKA 2NB0A 5IGBA 3S14B 4A3BB 2DJGC 3HOYB 2F4IA 2KHJA 3S1MB 4IFDH 2K33A 4ULLA 5LL6X 2PZWA 2VUMH 1HUMA 1YVCA 1CUKA 1SNDA 3P1HA 2WIIB 4A3FG 5A2QL 2C5CA 4K2KA 1YJWA 3M4PA 1GHJA 4HMIA 1P8LA 2F0GA 3Q6SA 3TP7A 3RNUA 3WOFA 4MIUA 3ND9A 4OO1I 2A73B 1QZGA 5T1IA 1QNUA 1PH4A 3J7A5 2HIXA 3TZDA 4PZ8A 4WJWA 3P75A 1IKMA 1S5DD 1C0AA 2OTLA 2F03A 1PH5A 3K80C 5BR8Q 1LTSD 5FJ8G 5M5XH 3G6JB 2VY3A 2I5MX 2K14A 3RZOH 2E2IB 1N33Q 1SMYD 3K59A 4LFCQ 1I4PA 1DCZA 5IOCA 2DN8A 3CQZB 2AQ2B 1J8IA 3HFZB 2LXJA 2WACA 5CV4A 5D3IB 3GTQH 2TMPA 3HKZE 1AE2A 4NKLA 2VUMG 2JYOA 3MTSA 1HFGA 3CCJA 5LMNQ 3G48A 2PQAB 3RZDH 4JI8L 1JT8A 5CR3A 1TWCB 1LTGD 1D8LA 1XNRL 4J6HA 3F1ZA 2K5QA 1T9HA 3E6ZX 4C56C 5IGEA 3CCMA 1I6HH 4A3EB 3DWPA 2I5HA 4CBVA 2XRSD 2IW3A 3OPOA 4KJOA 4IUVA 1EY8A 2L5TA 4H7BA 2BE5D 1RHPA 3VYUA 1R9TH 5IWAL 4NXNL 2ID0A 4IURA 2F0EA 1HNWL 2WFWA 5LMUQ 1D6EC 5KRUA 4DR6L 3IRBA 2ZTEA 4MTKA 3D4WA 5CV5A 5ELNA 4A3BG 4ME3A 3WWVA 1Y1WG 1NMGA 4FF1A 1AZQA 1Y1VB 4DR7L 4A3IH 4DV0L 1TQOA 2ZJQA 2K52A 1GXDC 1EU3A 2WV6D 1Q8KA 3CXCA 3MXUA 2NWGA 4DV3L 4PMCA 2MHVA 1SNQA 4X64L 4DV1Q 2AUJD 3MEHA 1EFWA 1K0RA 3JAMc 4CGYB 2C35B 3TP6A 1TWHH 1X56A 2NZ1D 1CQVA 4MHEA 5IWAQ 1K83B 3HOUB 4IJHA 3NELA 1JWSD 1WFQA 2D0OA 1EY7A 3GDEA 5D65A 1PTOB 1YIJA 2F0PA 4DV5L 1KHIA 4HN7A 2PYKA 2E2HB 1G2SA 2A74C 4PG3A 5KNBA 4GNXC 4DAYA 3J80L 1HR0W 2VQFL 3HS0C 2L0CA 1RODA 2FMMA 5E4XA 1W6KA 3J7ZC 3VDYA 3P7JA 5JJZA 2BA1A 1CKOA 1VF7A 3O13A 3JAML 1FJGQ 3RLOA 3MXNB 1R9TB 1TIID 5M3FB 1TS4A 3M4OB 4A3KG 1C7YA 3MXGA 3JAME 5JVG3 1L2FA 1A3TA 4A3EH 4A3CH 2PNRC 4B3ML 1HA6A 1GUOA 1G91A 4C3JG 1A63A 4LF4Q 3HOYH 3I72A 2PZTA 4X6AH 2EY1A 4LF9Q 3HOZG 4HJ8A 4DR4Q 4ODGA 3T1HQ 2K32A 1SSOA 2NVTH 3S17H 4IOCA 4GLXA 3FKIB 5K5PA 3RR5A 2VB3X 2K4KA 1L0YB 3HOVH 2KEDA 1BDOA 1OXVA 4B3SQ 5M5XB 2OT2A 2PNHA 2LFNA 1XXGA 1VQJA 1MBYA 4DUZQ 2E76C 3V05A 1ET9A 4GN3B 5CGKA 3CCRA 3C1EA 3U4ZA 4DUYQ 3PCOB 4O0AA 3NQTA 1PTOF 4BBRH 1D2BA 3KFUA 2WINB 2KJXA 3W2DA 5GQOA 1HCZA 3E3XA 3ULJA 4H0LC 1W6JA 3CAMA 1PYBA 2XN9C 2B2YA 3Q24A 4X66Q 1SRUA 1CHPD 2QGQA 4R8NA 4DK1A 4GLAC 1PFMA 2BA0A 2NVYB 3BG3A 3OOCA 1W3SA 1M90C 1QUQB 4AIMA 1G6PA 1SJHD 1O80A 3PGZA 2R7FA 4XIGS 1IXRA 2K01A 2OQKA 3ZJYC 3KJPA 2K28A 4R4QA 3K0XA 4GKKQ 1SYCA 2MFIA 4A3FB 1X32A 4KHPQ 3D3RA 3K5LA 3KLWA 1WCMG 4LNQA 1HPCA 2AWOA 2Z0SA 3DEPA 2B2WA 2L15A 4GN5A 4TSSA 3R93A 4A3FH 4BBRG 3TS2A 2UXCL 1ENCA 1F2ZA 5IYBH 1G6ZA 2CVRA 4UAIA 2F0OA 4RMFA 3MHBA 2F0FA 1A6XA 3DMUA 2VQFQ 5FLMH 3S16H 1JJ2A 1VS0A 2EY2A 1ZYRC 5IT9E 2RBMA 4HIOA 2LS01 1F77A 3KK7A 1KIXA 1Y1WH 4GZYC 4RFBA 1MJCA 3K0YA 3SK6A 1HTPA 4LFAQ 1H95A 1BVSA 4DN4M 1MSGA 4AYBB 2HHHQ 2B63B 4IUTA 5FOBB 3I8ZA 2Z6KA 1U5KA 1QUQA 3F2BA 1KQSA 2Q2UA 2UUBL 3A55A 1ZKOA 1CSQA 1LABA 5M9OA 1SYBA 3OMGA 1C8CA 5IYDH 1S5ED 3BDOA 1H9SA 4BY1H 3M7NA 3VA5A 4HMJA 4ZQ3A 1ZYRD 3RD4A 5FLMG 4NPSA 3S1NB 3HOVB 1RTOA 3S2DB 4TKOB 5EJWA 2O5IC 1XMQQ 2NVQH 2HQEA 4IPCA 3P20A 2G9HD 3KF6A 1SEBD 4J15A 5KYLA 3J81E 3T1YQ 1QOHA 4FF3A 4IFDG 2JA6G 5FK9C 4B3SL 4B9XA 2VQEL 1WTOA 1SE4A 4XT1B 3TZUA 5GAHC 1IHZA 3D6WA 4IO9A 4A3LH 3TBIB 3DM1A 2GVAA 1TS5A 4JI5Q 2RDFA 3SXHA 4LMQD 4A3IB 3H3VI 1SFOH 2KCNA 2WAQB 3DXJC 2WB1B 1NY4A 4WFN3 1JJCB 3FEWX 2AQ1B 2R92G 4LF6Q 2F0QA 4BY7B 5HGTA 5C3EB 4P71A 3GTQB 2GVBA 3CW2C 3QWNA 3IFDA 1B4OA 1PH6A 2JA8H 1I94L 2VNUD 3CQZH 4XQNA 3E0JA 3LX0A 1A2UA 1CHQD 1UE6A 4PNYA 3RZOB 2J7ZA 1VQAA 4GKKL 2K50A 4G7HC 5C4XB 3ERQA 1ONLA 5M3MB 5CV8A 1YEZA 1JC7A 2LXKA 2Q8RE 3M3YH 3L9AX 2EYHA 4CHTB 4UY8C 2PW7A 4YCUA 4Q5VA 3W1GA 3I70A 2B63H 3BDCA 1TWHB 3OSOA 2JK8A 2K5WA 1ILQA 4L5TA 2EJFC 1M1KC 4QQBX 2BH8A 3OHXC 2YTVA 4L5QA 4QUCA 4ZKCB 3GTLB 4BXXH 1RIPA 3S16B 1FNUA 1IL8A 2L55A 4KTAA 4IUPA 4A3MG 4DR1L 3I4MB 1CA5A 2BCOA 2KA7A 3PF4A 3F2CA 4YCVA 4JBKA 1OXUA 4OIJA 2F0LA 4UPAA 3GTPB 2R7ZB 4ZLTF 1TS3A 3CPFA 3S2HH 3K58A 1UEAB 4X64Q 1WCMH 1X55A 4R4IA 1PH8A 3D6CA 4TRDA 4DF7A 2F0IA 2H5XA 1FYCA 1K8MA 1E2VA 4ZUIA 2X6GA 3WDNA 1TXYA 3D31A 1L1OA 1TY0A 1PH3A 3I4NH 1WYDA 4JG2A 1QJOA 4I7AA 1BCPC 2RHSB 2ZJRA 2K6AA 4DV7L 2IWHA 5I9OA 2MPMA 3DWAA 4KKSA 1O7LA 4YHHL 4QGUA 1EYDA 1PXUA 2LSSA 5EAYA 4IZ8A 1KNAA 3S24A 4IPHA 5D3DA 1M8AA 1HR0L 3A8KE 4A3JG 2E75C 1VQ7A 2XVSA 1OXXK 2KECA 4P74A 4R9WA 1H9RA 3KF8B 1UE1A 4K2LA 1MI2A 4KHVA 1SYDA 4R8IA 4JK1C 3QIAA 3J81c 1K8AC 1Y8OB 1E7ZA 2A5HA 3EBEA 4PZ6A 5M3FG 1WTVA 2B2TA 4QIWB 1AN8A 1J9OA 1D5ZC 5IYCG 1XMOQ 2PCFB 4V190 2R7DA 2ZM6L 1S5CD 1HZ9A 5FLXE 2OCEA 3BZKA 1VQMA 1KABA 3TDQA 3QOJA 4RAUC 3NBHA 2M00A 3J80i 2OQ0A 2I0QA 2PMZE 2I46A 5IP9H 5C44H 4DV1L 3KUPA 4OX9L 1I4QA 3KJOA 5EKKA 5F2DA 1EQTA 1F2LA 1FVIA 1AW7A 1QNKA 5GADC 4ALPA 2N8NA 1EWIA 4DAPA 1IBLQ 3K57A 1I50B 2VUMB 5JPNC 1NJIC 1VQKA 3I4MH 5COYA 2A6HC 2C9OA 2B8FA 4UP7A 4DAYB 4OWWB 2NVYH 3H0GH 3HEJA 4KN7C 1SLJA 1TU2B 2A6ED 2F0HA 4NB3A 1VCIA 1C4QA 1NTGA 4BA1I 2Z8LA 4FO2A 4XXEA 3KYHC 1O7YA 2KCCA 1BCPD 2B2VC 3J81j 3KBGA 1L1OB 5E1FA 1LACA 2E74C 1WTRA 1ICWA 2QEXA 3HOWB 1DOKA 4A76A 3HRZC 4QF4A 3SDZA 4A3DH 4V0BA 3WOEA 2E2HH 5C4XH 1LTLA 4XT3B 1LM0A 3E9IA 3TRZA 1JB3A 4RGMA 3U58A 4N9TA 1CI3M 1TWAB 5FLXc 2K5DA 3FPPA 2JA8B 2RSNA 3AU7A 3NP8A 4JI4L 4R4TA 4HSPA 1U4PA 3U9SA 3A5ZB 5IT9c 5C3EH 4HJ9A 5I4DA 3UE1A 1PRTB 1Q12A 3GV3A 2EJMA 3NK9A 3VR4A 4HCEA 2FXQA 1Q1EA 3V96A 2EIFA 1SNCA 4FXGC 1EU4A 3CC4A 1CK1A 2NUCA 4LF7Q 5BN4A 1VQHA 4DA2A 5JPMC 5KEEA 4A3MH 3DEOA 5IE8A 3EQLC 3F2UA 5A2QE 1PZKD 3H15A 1H9MA 4RKBA 5C5LA 2MNAA 3U9OA 2WAQG 2E5LL 1A3UA 4P75A 1TR5A 1GUTA 2B8GA 2QA4A 1N33L 1D1IA 4BY7G 1Z47A 5C3EG 4B3TQ 4J8QA 3W3AA 1QVFA 2F4VQ 1GUSA 3HOXH 1W2BA 3W5OA 3VR6A 2OEOA 2VW9A 4PMBA 2QILA 3PQIA 2E2JH 4DUYL 2PMZB 3R8BA 1NR4A 1STEA 1J5EQ 1SXTA 1P16A 4TVAB 5CV6A 1IYJB 5C0XH 4B3RL 4EGVA 1N36L 3ONAB 4P2CB 1PH9A 4LF8L 3SVMA 4K14A 1XTCD 4KD4A 2N3SA 1SDFA 1IBKQ 2UUCQ 4DR2L 1HXYD 2JA6B 1HH2P 2ES2A 4M8AA 1B2TA 3MZ5A 3PUWA 5DNFA 1YNJC 3JAMi 4KMUC 4DU9A 5FJ8H 5CORA 1IL2A 1JQYD 3CPWA 1B3AA 4QIWE 3SK5A 2ASBA 4CKCA 4JOIA 3VR5A 1ZEQX 1VMPA 3ER0A 4JI7L 4DK0A 2H1EA 1XNQQ 1AZPA 4A3EG 4BA2I 1HFNA 3S1QB 1OO9B 5LMNW 2ZTDA 2XGTA 1GKHA 4P72A 2UUAL 4K6DA 4Q0FA 5ELOA 2EXDA 3T16A 1Q81C 5JVH3 1BBXC 1K9MC 1ASYA 1DYQA 1BQQT 2UUCL 4POFA 1EIGA 1RDPD 3AQQA 5K36G 4NW2A 1I6HB 2Z4HA 4WJ3M 1V1OA 4AH6A 3S1MH 4DPGA 1SNOA 1X6OA 3K6OA 2L1BA 2KVMA 2P5ZX 1GOZA 3DHQA 4A4IA 1PYSB 4DR3Q 1STHA 1Y1VG 5M5YH 1V1PA 4JI1Q 2DNEA 1N32L 3EN2A 3B6YA 1ICFB 1WTPA 4HR7B 1XWEA 1HQMC 4WRDA 1LT4D 2FFKB 1ESFA 2D62A 3T1YL 1IYVA 3GP7A 3KOJA 1VQPA 4G7ZC 3J7AF 1PA6A 1XMOL 1VQ9A 4MTNA 1JR0D 5T1GA 5DM73 1D5MC 2WB1E 1F9RA 4BXXG 1L1OC 2Y0SG 2UU9L 4A93H 4K5WA 3M85A 5ISRA 4RKLA 1EL0A 1UWVA 2WKCA 2Z6BA 4A3DB 3QB3A 4JI8Q 3QOLA 3GTKB 4B9WA 3TQYA 3NPPA 2A19A 2SDFA 5JJLA 1WTWA 5C4ZA 2F4VL 1EY4A 2ATWA 4LFCL 3T51B 1VQLA 3BVZA 3PUZA 5BN5A 2M2LA 3GTGH 1A8VA 1KRTA 5IODA 5EPJA 5EQ0A 2NVTB 2EVBA 3T1HL 2JA7B 2LMCB 1PDQA 3A56A 2DJFC 4JI5L 3HKZB 1PRTF 1E3PA 1IBMQ 2JEBI 3C46A 1A62A 2B2YC 2JXMB 4C3IB 3Q22A 5IY0A 1I4GA 1K8OA 2E2DC 2VXWA 4P73A 2PQEA 4X3SA 3H09A 2EDGA 1VQ6A 1HRJA 2I5LX 5H1SE 4XQJA 1I4XA 4JV5Q 3EVQA 2K7VA 3VYTA 1KL9A 1SMXA 1ENAA 2N88A 2HCCA 3S2HB 4DV6L 3MWYW 5J1ZA 1EWHA 1Q3LA 4LFBQ 1QZHA 3KBXA 1GJXA 3K7AB 4YY3L 2QW7A 1A2TA 1HA5A 2KUMA 3I3CA 1PMRA 3Q0AA 3S1RB 2KOLA 4KY5A 4A93B 2VS1A 1LYLA 4JVZA 2GA4B 4YWMA 4DGZA 5IIFA 2OF1A 4A3IG 1LTAD 4JYAL 1V1QA 1HNXQ 3RUZA 4R4OA 4E6IA 5DEHA 3A8JE 2CCZA 1CZWA 2R92B 4APVA 4HIKA 4J1MA 1WVLA 3PIP3 1IBLL 2XIWA 2UUAQ 3I91A 1EOTA 1JB7A 3PV0A 1B70B 2HDMA 4A3DG 4CKBA 1Q46A 5IGGA 5C3WA 5M5WH 2YU9H 1EEFD 4B3TL 3URYA 2ZXOA 1UNSA 5I2XA 4UP9A 1BCPF 2F0MA 4PMWA 1G2TA 3FKIG 4JI1L 1FJGL 3ZYYX 4L63B 4X65L 1Y69U 4HAEA 4HTHA 1VQ8A 2BOSA 2JA9A 1KXLA 1MGSA 1Z6HA 2K03A 2UXBL 3QJYA 1PHJA 1EWCA 2JJQA 3LGJA 3QO2A 3CD6A 4XDXA 1QB5D 1K28A 3IFTA 1AH9A 1FL0A 2JA6H 2OWOA 5ELFA 1U4RA 1OXSC 2F3IA 5IGDA 5G3LF 1KLUD 3I4LA 4QL5A 3Q8DA 1K3BC 2CW0D 5LHY1 1FNVA 2ENBA 1X65A 4DKAC 4JI3L 4RCNA 1CA6A 4YCWA 1QG7A 4JC0A 4RHRA 5CBEE 1LTID 1JOQA 2EJGC 1SYGA 3OWFA 4GNXB 3X3NA 2SEBD 4OEMB 4FNFA 5IP7H 2A6EC 3CCQA 3I90A 1Q8IA 1WOCA 5LMNL 4A3LG 1PTOH 2G9DA 3GTMH 1EOVA 2F0NA 3T56B 1SR3A 3VYRA 3H94A 2R93B 2YTYA 3HOUH 1D5XC 1LO5D 2CW0C 2EYOA 1Z9FA 4QMGA 1QVCA 3MVVA 4TQUS 1KTKA 4OWXB 3NXWA 2KQ3A 1X3QA 1NSNS 4ID6A 4UP8A 2XWBB 4DNIA 3FRPB 1E1OA 1LTRD 1MHWC 4LWCA 1HNWQ 5EPKA 1HNXL 1L0XB 1PFSA 1R4PB 3I73A 1RF2D 2J0TD 2RCNA 1IKLA 3BU2A 1VQBA 1RD9D 2F3WA 4CDEC 1Q86C 4XYOA 4DNTB 2NBFA 3TN2A 2RF4A 2G5DA 3K7AH 1HTLD 5AJ3Q 4LF6L 3PO2G 3HOXG 1M4VA 2DY8A 1A15A 1EQQA 4EQPA 2F0KA 2JN4A 1JWMD 3PUYA 4ZKBB 4EX5A 4F7XA 2V1CC 5KYIA 5CYUA 4DR2Q 1SAPA 1GVPA 4JYAQ 3QG1A 4F88A 1S5BD 4HEDA 4OHJA 1GO3E 4GNXA 4OO1G 4KV6A 3NSWA 3S1NH 3IKJA 4ZYSA 1CKNA 3HOZH 5D14A 1EYAA 3A0JA 2A8VA 4KN4C 1EYGA 3QR8A 4GN4B 2BH2A 3M4YA 4AQYQ 1BCPB 5FKAC 2HIVA 1FR3A 4UHVA 4HCSA 4JI4Q 1EY6A 2HHHL 5JOBA 3H3VH 2RCFA 5JAVA 4LUOA 3NBIA 2R92H 2JA5G 4DR3L 2RSOA 1FGUA 1S72A 4IUNA 3CRLC 3MAQA 5CC4A 4MN3A 2MUYA 1C9OA 5GROA 5KNDA 1TWAH 2BDNA 1HZCA 1ILPA 2CH4W 4RGTA 1B1ZA 2IT1A 1XYIA 2UUBQ 2Q8IB 5ELDA 2E5LQ 1EY9A 1VDZA 4QCLA 4S3SA 1YZ6A 5GAEC 3U4VA 1PH2A 3J80E 4UDUC 4CKEA 3ITPA 4O42A 1WTXA 4A3KH 3M7GA 5JEAJ 2IX0A 2D2CC 1DONA 2RQXA 4FP5D 4JI3Q 2D9UA 1DXMA 3BVMA 2K1BA 5AFWA 4LF9L 3JC66 2R3ZA 3KDFB 1VQDA 4RWSC 4A3KB 1QE6A 2Z9HA 3J80c 2R7ZH 3GTPH 3TS0A 4YWLA 2ZXPA 5C4XG 1PRTC 1BR9A 2VQEQ 3NUCA 3TEHB 4A3GB 1STGA 4X62Q 5KNCA 4DNRB 2UU9Q 3CCSA 3CMEA 5C4HA 1N34L 2B3GA 4DR6Q 1NNXA 1YJ9A 4Y7NB 4CJ1B 2PI2E 3PO3B 3DM3A 3NHHA 1N34Q 3OW2A 3MFYA 1F9QA 1VQEA 3GTOH 4JI0L 2HUGA 4BBRB 4FXKC 2EY5A 4L5RC 4OX9Q 2R93H 4CDFC 4H13C 3PF5A 5IYDG 2KENA 1SE3A 5NUCA 3I7FA 3Q23A 4C3IG 1T5EA 3UDGA 3IAYA 3OW7A 1EUJA 2ZXRA 1XPOA 1G291 3S9WA 3DLLA 5IYBG 4K0KQ 5IP9G 5C44G 1YNNC 1S3OA 1BO0A 1K8GA 3K7UC 4MZ9A 3S17B 3K5NA 3E5SA 3TP8A 1CQFA 1VMCA 4IPGA 4ZRZA 5HGQA 1JMCA 2QKIC 4LF7L 5HURA 3SK8A 4DR5L 4I7ZC 3CU7A 5JJIA 2EYFA 1V9PA 4X3TA 1UEBA 1YI2A 1QVGA 5CV7A 4BBSG 3EFXD 1PLFA 1CT1D 5C0XI 3TMEA 2Z1CA 1PV4A 4O1NA 2N49A 1KDBA 4QB4A 4A3JB 2F3VA 3HKSA 1Q1BA 4QJFA 4C1NK 1VQ4A 2JE6I 3VR3A 3SK4A 1WCMB 3BVGA 3PSIA 2IPKD 1UE7A 3RN2A 1NMFA 2PZUA 3BZDB 3SE0A 4NDXA 2MO1A 4ABNA 1PTOC 1B53A 1LV9A 4B3MQ 4K8JA 3M3YB 2B2WC 1DJRD 4K8IA 1Q82C 3BJUA 3RLFA 3S15H 2XRQD 3F2DA 4KY6A 2EYMA 2QDBA 3TREA 1VQFA 1NBWA 3I55A 3RZDB 1NCVA 2CFMA 2X6LA 5CMDA 4BY1B 2ZT9C 4LF4L 1XPUA 2IL8A 1STAA 2BE5C 2B2VA 2IY5B 1TY2A 2CQOA 3OYYA 1STYA 1PTOD 4LUVA 4GOPA 2B63G 1ET6A 1VQIA 4JV5L 2A1AA 1FNWA 1N8RC 5TSSA 4JPBW 4DK3C 4RGOS 4QUFA 4IFDJ 2PQAA 5DAUA 1XMQL 1DGSA 1Y1VH 5ELCA 2Q8TA 2EOTA 1H9JA 3U50C 3PO2B 1QWYA 3HOXB 2IX1A 2F0WA 2PW5A 3GTOB 1EEID 3C1FA 1DM0B 1SE8A 2DGYA 4OWTB 2UXDQ 3PO3H 1VQCA 4OONA 3G4SA 1I94Q 2M9VA 2QCPX 5I6WA 1E1TA 1ENFA 1PFBA 1L0WA 1CKMA 4A75A 3ICEA 1X3FA 3STBC 3KDFA 1KRSA 1EZ8A 3H0GB 1XNRQ 2UXDL 3A7AB 2CHBD 3A54A 4DXFA 2J4XA 4A3GH 4A3MB 1SE2A 1WD0A 2H4OA 1E22A 4IPDA 2E8GA 3L3OC 3FPUB 3I2ZA 4YY3Q 4C3JH 3N6RA 3RLNA 1HNZQ 1N9WA 4KKUA 4JI6Q 4BBSH 2WB1G 2F0UA 5EGTA 4LFAL 1U0LA 4IUQA 1S40A 1E2WA 3HG9A 1C48A 1GUGA 1T5XD 4KK7A 4N9PA 3J81L 4GOPB 3H3VC 2JA7H 1YJNA 2OTJA 5AJ3L 4AYBG 4EVOA 4DR5Q 2A69C 1ML0D 4IUUA 1DOMA 3MXNA 4DV5Q 1LTBD 4MNOA 4KLKA 3K81C 1UUPA 1KNEA 2YTXA 2NN6G 1F2MA 4JBMA 3S1RH 2K04A 4OL7A 4JBWA 1NE3A 4EQ5A 1TWGH 1X54A 1MJEA 3W1BA 1HHVA 1K3RA 4XQQA 5C4JH 3OIQA 1V1PB 3I4OA 2L12A 2FHTA 2WP8J 1E24A 2Z4IA 5IP7G 2JP1A 4JI2L 3IL8A 4PZ7A 1NR2A 4C2MH 4K5XA 2IJ0A 3FKIH 4H44C 1KDCA 3VYSA 4DFAA 4Y7NH 1MKHA 4KD3A 1XNQL 4B08A 3T13A 5KGUA 3DUZA 3R2IA 4ZCKA 2PO4A 2F0VA 3BDLA 5FO8B 5C3XA 3CHBD 4HJ7A 1VQ5A 2B2UC 1B8AA 2VL6A 5EBCA 1S5FD 1KAAA 5M5YB 1LUZA 5C0XG 1Y8PB 1EIFA 1I3QB 3FDTA 4K6LA 1TT2A 2IHEA 1HZBA 3I4MG 2WKDA 2F52A 3OTOQ 1KLGD 4JOIC 1ESRA 3J81i 3MXPA 1VQGA 2R7ZG 2QEJC 3ND8A 1TS2A 2AWNA 3ULLA 1A0IA 3M4OH 4DV6Q 1EQRA 1EIYB 2B2TC 5FO9B 3A7LA 4FYDA 1IBKL 1F9SA 1O78A 3KF8A 1RTNA 1O7ZA 2GN5A 1II3A 1PYWD 2PPBC 4C2MB 3UDXA 4DV4Q 4M1UB 4RH6A 2A6HD 4YIJA 2LY7A 1BXTA 1HJPA 1TWFB 5C4JB 1WD1A 1J5EL 1G8ZD 2SNSA 1YHAA 3MEFA 4YHHQ 3GTMB 3SR1A 4KKTA 4LK1C 1F9PA 4FF2A 1JE5A 1YBYA 1Q7YC 4Y52H 1VF5C 3FP9A 3TSSA 4DV7Q 4RHSA 4BWGB 1YHQA 4Z9CB 1ASZA 2NYZD 2DNCA 2A69D 3GTJH 1EY0A 4C3HG 5BR8L 2QF7A 4JCVE 3NBHB 2JEAI 3EJIA 3KF6B 1OTCA 1BF4A 3CRKC 4IFDI 4F87A 1J6QA 1LLRD 3A74A 4FVMA 4DV2L 4ILWA 2JQOA 3AYHB 3HOWG 1SN8A 2RVLA 1FGBD 4X3KA 4ZUJA 4BBSB 4LF5L 4HJ5A 2Q2IA 2K5VA 4HIMA 1CKNB 1HNZL 2MP1A 5E3FA 1BUVT 1CM9A 3NTKA 2AQ3B 3I4NB 5J22A 3HKZG 1LT6D 2JA8G 4AQYL 5CV9A 1GD7A 1EQVA 1LT3D 4DAMA 2NZOA 1STBA 4JI7Q 3PO3G 2N55A 1H9KA 1XTDA 1B9MA 1HUNA 2Q2TA 1STNA 4FDBA 2AUKA 2HQLA 1SFOB 3BZCA 4ZK9B 4JI6L 5M5WB 1SYEA 2CWPA 1UE5A 3KLSX 2O2LD 4IQZA 1CSPA 2HDLA 2OXPA 2V4DA 1LTTD 2MQHA 1SNPA 2JA7G 1JE4A 4R1JA 1OXTA 2R6GA 1B44D 1V43A 4CJ0B 5J39A 3V2TA 4LUZA 1DZ1A 3SEBA 3TP5A 1IZ6A 1BBWA 1Y8NB 2KCMA 2A68C 2MGSA 2NN6H 3ULPA 1AE3A 2X69A 4G57A 2E2IH 4LJZC 4QY7A 1SROA 4RGNA 2E2JB 5IGFA 3S15B 4RA8A 3LWEA 2N78A 2AKWB 3AB9A 2K05A 1RCVD 4FXDA 2EY6A 3FHWA 3NTIA 4DV4L 3C2PA 1X3EA 4JI0Q 3AMUA 1B7YB 3VA7A 1Y1WB 4C3HH 4PV1C 1SNMA 3J7AV 2XSCA 4GS3A 3STBD 4A3JH 3RN5A 3I4NG 1HZAA 1YNND 3GV6A 1Q90A 2ZM6Q 2EZVA 2O5JC 3HZXA 2K75A 3EIVA 2Q2HA 2ZJPA 3GQBA 1JORA 3SGIA 1JCKB 1GM5A 4POGA 1TVXA 3HOUG 1D1KA 3UDIA 2CQAA 4KJNA 4WJ4A 4LW1A 3CP0A 1SMYC 1FD7D 4N8X1 5C5MA 2VZAA 4LF5Q 2FMCA 2YU9B 3S2DH 2EYJA 5DM63 5G3LD 4GLVB 4LFBL 1TWCH 2EE1A 2F0JA 5HY6A 2ZTCA 1TWGB 2FINB 3R2TA 4C3IH 4RG1A 4JI2Q 3PUXA 4IOAA 4K0KL 1KC8C 1VQOA 1Z7TA 1K0SA 4L5SA 3H91A 5K36H 4XTCS 3R3OA 4DUZL 2B39A 2K5HA 5IT9L 1U4MA 2A68D 3GTGB 3EA6A 3VR2A 2SNMA 5C0XJ 2L9HA 1K73C 3H0GG 2XTIA 1JOOA 3MA2B 3LWUA 5FLXL 3GTKH 4DR1Q 3CC7A 4N8FA 4C3JB 2R61A 1I5FA 1NAPA 1PFNA 1AFPA 2IHFA 2KHSA 3G71A 1X3PA 1GUWA 3HOZB 5A35A 4KY7A 2NZHA 4BS9A 3PIO3 1KDAA 5KIXA 1A3VA 1DOLA 3L7ZC 1X3GA 3ERSX 3T53B 1U9RA 1RJTA 5M3MG 2RDGA 3NTHA 2AMCB 4DAVA 5C44B 1N32Q 1I4RA 4ME5A 5LL6S 3S1QH 1QILA 1Y14B 4I65A 2KCTA 2NN6I 3G6EA 1EFID 4EQOA 1CZGA 2UXBQ 1I3QH 2EXZA 3G7LA 4HSVA 2CWAA 3S14H 4A3BH 2NVXB 2EQSA 1YHBA 5EKLA 2F1MA 5J3BA 3OIPA 1WTHA 5ELBA 1XJVA 1N36Q 2AHOB 5M3FH 3HP3A 1CFMA 1RKNA 3CCVA 2B29A 3OMCA 4H02A 3EROA 3NWSA 1WTQA 1SYFA 4HJAA 2CKZB 4F8MA 3CCEA 1HR0Q 3RMHA 3CCUA 3KLRA 1R4QB 2DY7A 3AEVA 2ICEC 3D4RA 4DV0Q 4GOPC 1SBBB 1IBML 4DK6C 1NUCA 1WI5A 1X9NA 1YNXA 1JJGA 4IN3A 5I2YA 1CTMA 2RDHA 3UI2A 1IYUA 3NENA 2VB2X 3D8GA 3E0EA 4B3RQ 3GO5A 5LMUL 5EBDA 2DUDA 3D0FA 4NXMQ 1I6VC 1PZID 2IX3A 1UAPA 4BY1G 1E0BA 3BYTB 1LT5D 3NE5B 3NQIA 4U68A 2HD3A 2ALYB 2MO0A 1D7QA 2HCIA 4BY7H 2K5NA 3PIOA 3J7YW 2L4NA 3A8IE 3OWEB 2WAQE 1TKWB 4R4CA 1O7IA 3K8AA 4X3UA 3MC0B 1GUNA 1G51A 2L11A 4A3CG 3GTLH 2JA5B 2TSSA 4ZAIA 4C1NI 3X3MA 5GAGC 2KBNA 4CJ2C 3A5UA 1XX8A 4C3HB 5EKIA 4X66L 5ELEA 1AP0A 1IW7D 5E4WC 3CCLA 2EPBA 3FVQA 5DLQE 5EPLA 4G4KA 3PUVA 3KLSA 4IALA 1KD1C 2EYLA 5JEAG 5IGCA 3BS1A 3PO2H 4K5VA 4XYQA 1I4HA 2NTTA 2SOBA 3PIPA 5M3MH 4NMZA 2NVQB 4DV2Q 4JW0A 3H6MA 5IYCH 2F0SA 1EYCA 4YWKA 3HOVG 4OXPA 1ZXTA 1EY5A 2HT1A 3FMCA 3L0OA 3UDFA 3C3LA 4KI0A 5JJKA 4DR4L 2UXCQ 4KHPL 1E2ZA 2NTSA 1BBUA 1GHKA 2LKVA 4CDCC 1F2YA 3HOWH 1K83H 3K5OA 1KAWA 3CKIB 3NWTA 1BNZA 1JICA 2F0DA 1B3QA 1PZJD 3AFPA 5I9PA 1RL2A 4OGQC 3GD7A 4G7OC 3GTJB 3PMFA 2JA5H 4A3GG 1YITA
chains in the Genus database with same CATH topology
2YYZA 4KHZA 4NP5A 5I6YA 4DXGA 2F0TA 1AEXA 2D5DA 2ICIA 1BOSA 4U673 1YNJD 3D4DA 4EQNA 1JOKA 1EIHA 1QCBD 4RCOA 2Y0SB 1IW7C 1B50A 2KEEA 5CBAE 4L6TB 5JEAH 3HGBA 5FO7B 2RA4A 4WORA 3K5MA 2EYPA 4FF4A 3MFGA 2FJ2A 3SHLA 4LAAA 4PQXA 2O4XA 2B2UA 1H9SB 2I07B 2RKSA 1HQRD 3T4AC 3DWQA 2MJ8A 4L8JA 3LNNA 1MD2D 2XWJB 2BDOA 3BYYB 1PRTD 4OO1H 1EZ6A 1MSHA 5BN3A 1SJED 1S4ZA 1JWUD 2XNAC 5C6AA 1V8QA 1DD2A 3N52A 1B9NA 2JSOA 1U4LA 4OIKA 2NB0A 5IGBA 3S14B 4A3BB 3HOYB 2F4IA 3S1MB 4IFDH 2K33A 4ULLA 5LL6X 2PZWA 1HUMA 1SNDA 3P1HA 2WIIB 5A2QL 2C5CA 4K2KA 1GHJA 4HMIA 2F0GA 3Q6SA 3TP7A 3WOFA 4MIUA 3ND9A 4OO1I 2A73B 5T1IA 1QNUA 3TZDA 4WJWA 3P75A 1IKMA 1S5DD 2F03A 1LTSD 3G6JB 2E2IB 1SMYD 3K59A 1I4PA 1DCZA 5IOCA 2DN8A 3CQZB 2AQ2B 1J8IA 2WACA 5CV4A 5D3IB 2TMPA 4NKLA 2JYOA 3MTSA 1HFGA 5CR3A 1TWCB 1LTGD 4J6HA 2K5QA 3E6ZX 4C56C 5IGEA 4A3EB 3DWPA 4CBVA 2XRSD 2IW3A 3OPOA 4IUVA 4KJOA 1EY8A 2L5TA 4H7BA 2BE5D 1RHPA 3VYUA 2ID0A 4IURA 2F0EA 1D6EC 5KRUA 3D4WA 5CV5A 4FF1A 1AZQA 1Y1VB 1TQOA 1GXDC 1EU3A 2WV6D 3MXUA 2NWGA 4PMCA 2MHVA 1SNQA 2AUJD 3MEHA 4CGYB 3TP6A 2NZ1D 1CQVA 4MHEA 1K83B 3HOUB 1JWSD 1EY7A 5D65A 1PTOB 2F0PA 4HN7A 2PYKA 2E2HB 1G2SA 2A74C 5KNBA 4DAYA 3J80L 3HS0C 2L0CA 1RODA 2FMMA 5E4XA 1W6KA 3P7JA 5JJZA 2BA1A 3O13A 1VF7A 3JAML 1R9TB 1TIID 5M3FB 1TS4A 3M4OB 3MXGA 3JAME 5JVG3 1A3TA 2PNRC 1HA6A 1GUOA 1G91A 4C3JG 3I72A 2PZTA 2EY1A 4ODGA 2K32A 1SSOA 3FKIB 5K5PA 2VB3X 1L0YB 2KEDA 1BDOA 1OXVA 5M5XB 2OT2A 2LFNA 1XXGA 1MBYA 2E76C 3V05A 1ET9A 5CGKA 3C1EA 1D2BA 3NQTA 1PTOF 2WINB 2KJXA 3W2DA 1HCZA 4H0LC 1W6JA 2XN9C 2B2YA 3Q24A 1CHPD 4R8NA 4DK1A 1PFMA 2BA0A 2NVYB 3BG3A 3OOCA 1SJHD 1O80A 4XIGS 2K01A 2K28A 1SYCA 4A3FB 1X32A 3D3RA 3K5LA 1HPCA 2AWOA 3DEPA 2B2WA 4TSSA 3R93A 1ENCA 1F2ZA 1G6ZA 2CVRA 4UAIA 2F0OA 3MHBA 2F0FA 1A6XA 3DMUA 2EY2A 1ZYRC 5IT9E 2RBMA 2LS01 1F77A 3KK7A 4GZYC 4RFBA 3K0YA 3SK6A 1HTPA 4DN4M 1MSGA 4AYBB 2B63B 4IUTA 5FOBB 3I8ZA 3A55A 1ZKOA 1LABA 5M9OA 1SYBA 3OMGA 1C8CA 1S5ED 3BDOA 3M7NA 1H9SA 3VA5A 4HMJA 4ZQ3A 1ZYRD 3RD4A 3S1NB 3HOVB 1RTOA 3S2DB 4TKOB 5EJWA 2O5IC 2HQEA 3P20A 2G9HD 1SEBD 5KYLA 3J81E 1QOHA 4FF3A 4IFDG 5FK9C 4B9XA 1WTOA 1SE4A 4XT1B 3TZUA 1IHZA 3D6WA 3TBIB 3DM1A 1TS5A 2RDFA 3SXHA 4LMQD 4A3IB 2KCNA 2WAQB 3DXJC 2WB1B 4WFN3 3FEWX 2AQ1B 2F0QA 4BY7B 5HGTA 5C3EB 3GTQB 3QWNA 3IFDA 1B4OA 2VNUD 4XQNA 3E0JA 3LX0A 1A2UA 1CHQD 4PNYA 3RZOB 2J7ZA 4G7HC 5C4XB 3ERQA 1ONLA 5M3MB 5CV8A 1JC7A 2Q8RE 3L9AX 2EYHA 4CHTB 2PW7A 4Q5VA 3I70A 3BDCA 1TWHB 3OSOA 2K5WA 1ILQA 2EJFC 3OHXC 4QUCA 4ZKCB 3GTLB 3S16B 1FNUA 1IL8A 2L55A 4KTAA 4IUPA 3I4MB 1CA5A 2BCOA 2KA7A 1OXUA 4OIJA 2F0LA 3GTPB 2R7ZB 4ZLTF 1TS3A 3K58A 1UEAB 3D6CA 4TRDA 4DF7A 2F0IA 1FYCA 1K8MA 1E2VA 4ZUIA 2X6GA 3WDNA 3D31A 1TY0A 1QJOA 1BCPC 2K6AA 2IWHA 5I9OA 2MPMA 3DWAA 4KKSA 1O7LA 1EYDA 1PXUA 4IZ8A 1KNAA 5D3DA 1M8AA 3A8KE 2E75C 2XVSA 1OXXK 2KECA 4R9WA 1H9RA 4K2LA 1MI2A 4KHVA 1SYDA 4R8IA 4JK1C 3QIAA 1Y8OB 2A5HA 1WTVA 2B2TA 4QIWB 1AN8A 1J9OA 1D5ZC 4V190 2PCFB 1S5CD 5FLXE 1KABA 3TDQA 3QOJA 4RAUC 3NBHA 2M00A 2I46A 3KUPA 1I4QA 5EKKA 5F2DA 1EQTA 1F2LA 1AW7A 1QNKA 4DAPA 3K57A 1I50B 2VUMB 5JPNC 5COYA 2A6HC 2C9OA 2B8FA 3HEJA 4KN7C 1TU2B 2A6ED 2F0HA 1VCIA 1C4QA 4BA1I 2Z8LA 4FO2A 4XXEA 1O7YA 2KCCA 1BCPD 2B2VC 3KBGA 5E1FA 1LACA 2E74C 1WTRA 1ICWA 3HOWB 1DOKA 3HRZC 4QF4A 3SDZA 4V0BA 3WOEA 4XT3B 1JB3A 4RGMA 4N9TA 1CI3M 1TWAB 2K5DA 3FPPA 2JA8B 2RSNA 3AU7A 3NP8A 4HSPA 1U4PA 3U9SA 5I4DA 1PRTB 1Q12A 3GV3A 2EJMA 3NK9A 3VR4A 4HCEA 1Q1EA 3V96A 1SNCA 4FXGC 1EU4A 1CK1A 2NUCA 5BN4A 5KEEA 4DA2A 5JPMC 3DEOA 3EQLC 3F2UA 5A2QE 1PZKD 1H9MA 4RKBA 5C5LA 3U9OA 1A3UA 1TR5A 1GUTA 2B8GA 1D1IA 1Z47A 4J8QA 3W3AA 1GUSA 3VR6A 2OEOA 4PMBA 2QILA 2PMZB 3R8BA 1NR4A 1STEA 1SXTA 5CV6A 5C0XH 4EGVA 3ONAB 4P2CB 3SVMA 4K14A 1XTCD 4KD4A 1SDFA 1HXYD 2JA6B 4M8AA 1B2TA 3MZ5A 3PUWA 5DNFA 1YNJC 4KMUC 4DU9A 5CORA 1JQYD 1B3AA 3SK5A 4CKCA 3VR5A 1ZEQX 1VMPA 4DK0A 2H1EA 1AZPA 4BA2I 1HFNA 3S1QB 1OO9B 4K6DA 4Q0FA 3T16A 5JVH3 1BBXC 1DYQA 1BQQT 1EIGA 1RDPD 5K36G 4NW2A 1I6HB 2Z4HA 1V1OA 1SNOA 3K6OA 2L1BA 2KVMA 1GOZA 3DHQA 1STHA 1V1PA 2DNEA 1WTPA 4HR7B 1XWEA 1HQMC 4WRDA 1LT4D 2FFKB 1ESFA 2D62A 1IYVA 3GP7A 4G7ZC 3J7AF 1JR0D 5T1GA 5DM73 1D5MC 1F9RA 4K5WA 3M85A 5ISRA 4RKLA 1EL0A 2WKCA 4A3DB 3QB3A 3QOLA 3GTKB 4B9WA 3NPPA 2SDFA 1WTWA 5C4ZA 1EY4A 3T51B 3BVZA 3PUZA 5BN5A 2M2LA 5IODA 5EPJA 5EQ0A 2NVTB 2EVBA 2JA7B 2LMCB 1PDQA 3A56A 3HKZB 1PRTF 2JEBI 3C46A 2B2YC 2JXMB 4C3IB 3Q22A 1I4GA 1K8OA 2E2DC 2VXWA 2PQEA 4X3SA 3H09A 2EDGA 1HRJA 4XQJA 1I4XA 3EVQA 2K7VA 3VYTA 1ENAA 2N88A 2HCCA 3S2HB 3MWYW 5J1ZA 1EWHA 1Q3LA 3KBXA 1GJXA 3K7AB 1A2TA 1HA5A 2KUMA 3I3CA 1PMRA 3Q0AA 3S1RB 2KOLA 4KY5A 4A93B 2GA4B 4DGZA 5IIFA 2OF1A 1LTAD 3RUZA 4E6IA 5DEHA 3A8JE 1CZWA 2R92B 4J1MA 1WVLA 3PIP3 2XIWA 3I91A 1EOTA 3PV0A 2HDMA 4CKBA 5IGGA 5C3WA 1EEFD 3URYA 2ZXOA 1UNSA 5I2XA 1BCPF 2F0MA 4PMWA 1G2TA 3ZYYX 4L63B 1Y69U 4HAEA 4HTHA 2BOSA 1MGSA 1Z6HA 2K03A 3QJYA 1EWCA 3QO2A 4XDXA 1QB5D 3IFTA 5ELFA 1U4RA 1OXSC 5IGDA 5G3LF 1KLUD 3I4LA 2CW0D 5LHY1 1FNVA 2ENBA 4RCNA 1CA6A 1QG7A 4RHRA 5CBEE 1LTID 1JOQA 2EJGC 1SYGA 3OWFA 3X3NA 2SEBD 4FNFA 2A6EC 3I90A 1Q8IA 1PTOH 2G9DA 2F0NA 3T56B 3VYRA 3H94A 2R93B 1D5XC 1LO5D 2CW0C 2EYOA 4QMGA 3MVVA 4TQUS 1KTKA 3NXWA 2KQ3A 1X3QA 1NSNS 4ID6A 2XWBB 3FRPB 1LTRD 5EPKA 1L0XB 1R4PB 3I73A 1RF2D 2J0TD 1IKLA 1RD9D 2F3WA 4XYOA 4DNTB 2NBFA 3TN2A 1HTLD 1M4VA 2DY8A 1A15A 4EQPA 2F0KA 3PUYA 1JWMD 4ZKBB 4F7XA 5KYIA 5CYUA 1SAPA 3QG1A 4F88A 1S5BD 4HEDA 4OHJA 4OO1G 4KV6A 3NSWA 3IKJA 4ZYSA 5D14A 1EYAA 4KN4C 3M4YA 1BCPB 5FKAC 1FR3A 4HCSA 1EY6A 5JOBA 5JAVA 3NBIA 2RSOA 4IUNA 3CRLC 3MAQA 5CC4A 4MN3A 2MUYA 5KNDA 2BDNA 1ILPA 4RGTA 1B1ZA 2IT1A 1XYIA 2Q8IB 5ELDA 1EY9A 1VDZA 4QCLA 4S3SA 3J80E 4UDUC 4CKEA 3ITPA 4O42A 1WTXA 3M7GA 5JEAJ 2IX0A 2D2CC 1DONA 2RQXA 4FP5D 2D9UA 1DXMA 3BVMA 2K1BA 5AFWA 2R3ZA 4RWSC 4A3KB 1QE6A 2ZXPA 1PRTC 1BR9A 3NUCA 4A3GB 1STGA 5KNCA 4DNRB 5C4HA 4Y7NB 4CJ1B 3PO3B 3NHHA 3MFYA 1F9QA 2HUGA 4BBRB 4FXKC 2EY5A 4H13C 5NUCA 1SE3A 3Q23A 4C3IG 1T5EA 3IAYA 3OW7A 2ZXRA 1G291 3S9WA 1YNNC 1BO0A 3S17B 3K5NA 3E5SA 3TP8A 1CQFA 1VMCA 4ZRZA 2QKIC 5HURA 3SK8A 4I7ZC 3CU7A 2EYFA 4X3TA 5CV7A 3EFXD 1PLFA 1CT1D 5C0XI 3TMEA 2Z1CA 4O1NA 1KDBA 4QB4A 4A3JB 2F3VA 1Q1BA 4C1NK 2JE6I 3VR3A 3SK4A 1WCMB 2IPKD 3BVGA 2PZUA 3SE0A 3BZDB 4NDXA 4ABNA 1PTOC 1B53A 1LV9A 3M3YB 4K8JA 2B2WC 1DJRD 4K8IA 3RLFA 2XRQD 4KY6A 2EYMA 2QDBA 3RZDB 1NCVA 2X6LA 5CMDA 4BY1B 2ZT9C 2IL8A 1STAA 2BE5C 2B2VA 1TY2A 1STYA 1PTOD 1ET6A 1FNWA 5TSSA 4RGOS 4QUFA 4IFDJ 5DAUA 5ELCA 2Q8TA 2EOTA 1H9JA 3PO2B 1QWYA 3HOXB 2IX1A 3GTOB 2F0WA 2PW5A 1EEID 3C1FA 1DM0B 2M9VA 2QCPX 5I6WA 1ENFA 1PFBA 1EZ8A 3H0GB 3A7AB 2CHBD 3A54A 4DXFA 2J4XA 4A3MB 1SE2A 1WD0A 2H4OA 3L3OC 3FPUB 3N6RA 4KKUA 2F0UA 5EGTA 4IUQA 1E2WA 3H3VC 3HG9A 1C48A 3J81L 1GUGA 1T5XD 4KK7A 4N9PA 4EVOA 2A69C 1ML0D 4IUUA 1DOMA 3MXNA 1LTBD 1UUPA 1KNEA 2NN6G 1F2MA 2K04A 4OL7A 4JBWA 1HHVA 4XQQA 3OIQA 1V1PB 2L12A 2FHTA 2WP8J 2Z4IA 2JP1A 3IL8A 1NR2A 4K5XA 2IJ0A 4H44C 1KDCA 3VYSA 4DFAA 4KD3A 4B08A 3T13A 5KGUA 3DUZA 3R2IA 2PO4A 2F0VA 3BDLA 5FO8B 5C3XA 3CHBD 2B2UC 5EBCA 1S5FD 1KAAA 5M5YB 5C0XG 1Y8PB 1I3QB 3FDTA 4K6LA 1TT2A 2WKDA 1KLGD 1ESRA 3MXPA 2QEJC 3ND8A 1TS2A 2AWNA 2B2TC 5FO9B 3A7LA 4FYDA 1F9SA 1O78A 3KF8A 1RTNA 1O7ZA 1II3A 1PYWD 2PPBC 4C2MB 4M1UB 4RH6A 2A6HD 4YIJA 2LY7A 1BXTA 1TWFB 5C4JB 1WD1A 1G8ZD 2SNSA 3GTMB 3SR1A 4KKTA 4LK1C 1F9PA 4FF2A 1VF5C 3TSSA 4RHSA 4BWGB 4Z9CB 2NYZD 2DNCA 2A69D 1EY0A 4C3HG 2QF7A 2JEAI 3EJIA 4IFDI 1BF4A 3CRKC 4F87A 1LLRD 4FVMA 4ILWA 2RVLA 1FGBD 4X3KA 4ZUJA 4BBSB 2MP1A 5E3FA 1BUVT 1CM9A 3NTKA 2AQ3B 3I4NB 5J22A 1LT6D 5CV9A 1EQVA 1LT3D 1STBA 2N55A 1H9KA 1B9MA 1HUNA 1STNA 2AUKA 1SFOB 4ZK9B 5M5WB 1SYEA 3KLSX 2O2LD 4IQZA 2HDLA 2OXPA 2V4DA 1LTTD 1SNPA 1JE4A 1OXTA 2R6GA 1B44D 1V43A 4CJ0B 5J39A 3V2TA 1DZ1A 3SEBA 3TP5A 1Y8NB 2A68C 2MGSA 2NN6H 2X69A 4G57A 4LJZC 4RGNA 2E2JB 5IGFA 3S15B 4RA8A 3LWEA 3AB9A 2K05A 1RCVD 4FXDA 2EY6A 3NTIA 3C2PA 3AMUA 3VA7A 1Y1WB 4PV1C 1SNMA 3J7AV 2XSCA 1YNND 3GV6A 1Q90A 2EZVA 2O5JC 3HZXA 3GQBA 1JORA 1JCKB 1TVXA 1D1KA 2CQAA 4KJNA 1SMYC 1FD7D 5C5MA 2FMCA 2YU9B 2EYJA 5DM63 5G3LD 2EE1A 2F0JA 1TWGB 2FINB 3R2TA 3PUXA 1Z7TA 3H91A 5K36H 4XTCS 3R3OA 2B39A 5IT9L 1U4MA 2A68D 3GTGB 3EA6A 3VR2A 2SNMA 5C0XJ 2L9HA 1JOOA 3MA2B 3LWUA 5FLXL 4C3JB 2R61A 1NAPA 1PFNA 1AFPA 2KHSA 1X3PA 1GUWA 3HOZB 5A35A 4KY7A 4BS9A 3PIO3 1KDAA 5KIXA 1A3VA 1DOLA 3L7ZC 3T53B 1U9RA 1RJTA 2RDGA 3NTHA 4DAVA 5C44B 1I4RA 4ME5A 5LL6S 1QILA 4I65A 2NN6I 1EFID 4EQOA 1CZGA 2EXZA 3G7LA 4HSVA 2NVXB 5EKLA 2F1MA 3OIPA 5ELBA 3HP3A 1CFMA 1RKNA 3OMCA 3EROA 1WTQA 3NWSA 1SYFA 4F8MA 3RMHA 3KLRA 1R4QB 2DY7A 2ICEC 3D4RA 1SBBB 1NUCA 4IN3A 5I2YA 1CTMA 2RDHA 3UI2A 1IYUA 2VB2X 3D8GA 3GO5A 5EBDA 1I6VC 1PZID 2IX3A 1UAPA 1E0BA 3BYTB 1LT5D 3NE5B 3NQIA 4U68A 2HCIA 3J7YW 2L4NA 3A8IE 3OWEB 1TKWB 4X3UA 3MC0B 1GUNA 2L11A 2JA5B 2TSSA 4ZAIA 4C1NI 3X3MA 4CJ2C 1XX8A 4C3HB 5EKIA 5ELEA 1AP0A 1IW7D 5E4WC 2EPBA 3FVQA 5EPLA 4G4KA 3PUVA 3KLSA 4IALA 2EYLA 5JEAG 5IGCA 3BS1A 4K5VA 4XYQA 1I4HA 2NTTA 2SOBA 4NMZA 2NVQB 3H6MA 2F0SA 1EYCA 1ZXTA 1EY5A 3FMCA 3C3LA 4KI0A 1E2ZA 2NTSA 1GHKA 2LKVA 1F2YA 3K5OA 3CKIB 3NWTA 1BNZA 1JICA 2F0DA 1PZJD 5I9PA 4OGQC 3GD7A 4G7OC 3GTJB 3PMFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DON A;  1B53 A;  1TVX A;  1LV9 A;  1BBX C;  2KUM A;  2D9U A;  3I3C A;  1PFM A;  2K04 A;  1KNA A;  2NZ1 D;  4MHE A;  2B2W C;  2KOL A;  3DM1 A;  1U4P A;  1M8A A;  2K1B A;  5AFW A;  1EIG A;  1HHV A;  2R3Z A;  4NW2 A;  3UI2 A;  4LMQ D;  3GV3 A;  2KEC A;  4RWS C;  4R9W A;  1O80 A;  2L12 A;  3Q6S A;  2FHT A;  1QE6 A;  1X3Q A;  2K01 A;  2N55 A;  5D65 A;  1MI2 A;  2KVM A;  2L1B A;  2JP1 A;  2K28 A;  4R8I A;  3IL8 A;  1NR2 A;  1NCV A;  2X6L A;  1HUN A;  5CMD A;  5T1I A;  5EPK A;  2EE1 A;  1WTV A;  1X32 A;  2B2T A;  3TZD A;  3DEO A;  2FIN B;  1J9O A;  2IL8 A;  4ZK9 B;  1WTP A;  2B2V A;  1IKM A;  3F2U A;  1WVL A;  1E0B A;  1G2S A;  2FFK B;  3IFD A;  1IKL A;  1B4O A;  2XIW A;  4U68 A;  3I91 A;  3H91 A;  2HCI A;  1EOT A;  2B2U C;  1ROD A;  3DEP A;  2FMM A;  2B2W A;  2HDM A;  1EIH A;  4CJ1 B;  3TN2 A;  2HDL A;  3FDT A;  3R93 A;  2J7Z A;  1U4M A;  4RAU C;  2L4N A;  5E4X A;  5T1G A;  1B50 A;  2KEE A;  3P7J A;  5CBA E;  5JJZ A;  1F9R A;  2DY8 A;  1ESR A;  1F9Q A;  1A15 A;  4X3U A;  1J8I A;  2HUG A;  4ZKB B;  1G6Z A;  1JE4 A;  2CVR A;  4QUF A;  2Q8R E;  1EL0 A;  2L9H A;  4UAI A;  3KUP A;  2RA4 A;  2L11 A;  1G2T A;  1SAP A;  2B2T C;  2Q8T A;  4CJ0 B;  2EOT A;  1EQT A;  4ZAI A;  1DZ1 A;  1F2L A;  1F9S A;  1QNK A;  2JYO A;  4CJ2 C;  1RTN A;  1O7Z A;  2FJ2 A;  1HA6 A;  1XX8 A;  1NAP A;  2SDF A;  1PFN A;  1ILQ A;  3MTS A;  4HAE A;  1HFG A;  1NR4 A;  4HED A;  5EKI A;  1WTW A;  1G91 A;  1X3P A;  1GUW A;  2MGS A;  1AP0 A;  2X69 A;  5E4W C;  2EPB A;  2B2U A;  5D14 A;  1MGS A;  2K03 A;  4DN4 M;  1MSG A;  5COY A;  2M2L A;  5EPL A;  1DOL A;  4QUC A;  4RA8 A;  1WD1 A;  4ZKC B;  4IUT A;  3LWE A;  5EPJ A;  3I8Z A;  5EQ0 A;  1BO0 A;  1SSO A;  1PFB A;  1PDQ A;  1RJT A;  3ONA B;  4HCS A;  1IL8 A;  2MJ8 A;  2K05 A;  4IUV A;  3SVM A;  1F9P A;  3QO2 A;  1RHP A;  4IUP A;  1SDF A;  4XDX A;  1VMC A;  1C8C A;  1CA5 A;  4IUR A;  4OIJ A;  2B2Y C;  2RSO A;  1WD0 A;  2NYZ D;  1O7Y A;  1ZXT A;  2B2V C;  3FPU B;  4ZLT F;  1U4R A;  1B2T A;  4X3T A;  5DNF A;  2KED A;  2VXW A;  4MN3 A;  1RTO A;  1PLF A;  4X3S A;  1WTR A;  1BF4 A;  1ICW A;  1MSH A;  5EJW A;  4HSV A;  3G7L A;  5COR A;  2BDN A;  1HRJ A;  1DOK A;  4IUQ A;  1S4Z A;  1AZQ A;  1ILP A;  1CA6 A;  1B3A A;  1XYI A;  2X6G A;  1QG7 A;  5CBE E;  2RVL A;  4XT3 B;  1BNZ A;  3GV6 A;  3N52 A;  4X3K A;  2N88 A;  1JIC A;  1U4L A;  1VMP A;  2NWG A;  3HP3 A;  4OIK A;  2HCC A;  2H1E A;  1AZP A;  1HFN A;  3MWY W;  3I90 A;  1WTQ A;  1ML0 D;  4IUU A;  1DOM A;  1Q3L A;  4O42 A;  1WTX A;  2MPM A;  1WTO A;  2B2Y A;  2MP1 A;  3KBX A;  1CM9 A;  4XT1 B;  2DY7 A;  1KNE A;  2RSN A;  1HUM A;  3D6W A; 
#chains in the Genus database with same CATH topology
 4OEL B;  2YYZ A;  4GKJ L;  4KHZ A;  4NP5 A;  2NVX H;  2PI2 A;  4DXG A;  2F0T A;  5I6Y A;  1AEX A;  3HOY G;  2D5D A;  2Z6K C;  4GKJ Q;  1I50 H;  1XPR A;  2ICI A;  1BOS A;  4U67 3;  1YNJ D;  1PH1 A;  4X65 Q;  3D4D A;  1VQN A;  3OTO L;  4EQN A;  1PVO A;  4X62 L;  1JOK A;  2RHQ B;  1EIH A;  1QCB D;  4RCO A;  4AYB E;  2Y0S B;  1IW7 C;  1B50 A;  2KEE A;  5CBA E;  4A93 G;  4L6T B;  4DR7 Q;  5JEA H;  3HGB A;  1WJJ A;  2CH4 A;  2D0P A;  5FO7 B;  3L2P A;  2RA4 A;  4WOR A;  4NXM L;  4CDD C;  3K5M A;  3CC2 A;  4IJL A;  2EYP A;  4FF4 A;  3MFG A;  2FJ2 A;  3F8T A;  2Y0S E;  1PH7 A;  3SHL A;  4LAA A;  4PQX A;  2O4X A;  2B2U A;  1H9S B;  3M4Q A;  2I07 B;  2RKS A;  1HQR D;  4DV3 Q;  3T4A C;  3DWQ A;  2QDL A;  2MJ8 A;  3AFQ A;  4L8J A;  3LNN A;  3CF5 A;  1MD2 D;  3I56 A;  4NXN Q;  5L37 A;  2XWJ B;  3UE0 A;  2YV5 A;  1TWF H;  2BDO A;  3BYY B;  5E7N A;  3CMA A;  2R93 G;  1PRT D;  4OO1 H;  1MIU A;  4LF8 Q;  1EZ6 A;  3M9B A;  4JBJ A;  1MSH A;  4HID A;  3NEM A;  5BN3 A;  1SJE D;  1JWU D;  1S4Z A;  2XNA C;  3E9H A;  5C6A A;  1V8Q A;  4O2D A;  2KHI A;  1DD2 A;  1BKB A;  3N52 A;  1B9N A;  2JSO A;  1U4L A;  4OIK A;  2NB0 A;  5IGB A;  3S14 B;  4A3B B;  2DJG C;  3HOY B;  2F4I A;  2KHJ A;  3S1M B;  4IFD H;  2K33 A;  4ULL A;  5LL6 X;  2PZW A;  2VUM H;  1HUM A;  1YVC A;  1CUK A;  1SND A;  3P1H A;  2WII B;  4A3F G;  5A2Q L;  2C5C A;  4K2K A;  1YJW A;  3M4P A;  1GHJ A;  4HMI A;  1P8L A;  2F0G A;  3Q6S A;  3TP7 A;  3RNU A;  3WOF A;  4MIU A;  3ND9 A;  4OO1 I;  2A73 B;  1QZG A;  5T1I A;  1QNU A;  1PH4 A;  3J7A 5;  2HIX A;  3TZD A;  4PZ8 A;  4WJW A;  3P75 A;  1IKM A;  1S5D D;  1C0A A;  2OTL A;  2F03 A;  1PH5 A;  3K80 C;  5BR8 Q;  1LTS D;  5FJ8 G;  5M5X H;  3G6J B;  2VY3 A;  2I5M X;  2K14 A;  3RZO H;  2E2I B;  1N33 Q;  1SMY D;  3K59 A;  4LFC Q;  1I4P A;  1DCZ A;  5IOC A;  2DN8 A;  3CQZ B;  2AQ2 B;  1J8I A;  3HFZ B;  2LXJ A;  2WAC A;  5CV4 A;  5D3I B;  3GTQ H;  2TMP A;  3HKZ E;  1AE2 A;  4NKL A;  2VUM G;  2JYO A;  3MTS A;  1HFG A;  3CCJ A;  5LMN Q;  3G48 A;  2PQA B;  3RZD H;  4JI8 L;  1JT8 A;  5CR3 A;  1TWC B;  1LTG D;  1D8L A;  1XNR L;  4J6H A;  3F1Z A;  2K5Q A;  1T9H A;  3E6Z X;  4C56 C;  5IGE A;  3CCM A;  1I6H H;  4A3E B;  3DWP A;  2I5H A;  4CBV A;  2XRS D;  2IW3 A;  3OPO A;  4KJO A;  4IUV A;  1EY8 A;  2L5T A;  4H7B A;  2BE5 D;  1RHP A;  3VYU A;  1R9T H;  5IWA L;  4NXN L;  2ID0 A;  4IUR A;  2F0E A;  1HNW L;  2WFW A;  5LMU Q;  1D6E C;  5KRU A;  4DR6 L;  3IRB A;  2ZTE A;  4MTK A;  3D4W A;  5CV5 A;  5ELN A;  4A3B G;  4ME3 A;  3WWV A;  1Y1W G;  1NMG A;  4FF1 A;  1AZQ A;  1Y1V B;  4DR7 L;  4A3I H;  4DV0 L;  1TQO A;  2ZJQ A;  2K52 A;  1GXD C;  1EU3 A;  2WV6 D;  1Q8K A;  3CXC A;  3MXU A;  2NWG A;  4DV3 L;  4PMC A;  2MHV A;  1SNQ A;  4X64 L;  4DV1 Q;  2AUJ D;  3MEH A;  1EFW A;  1K0R A;  3JAM c;  4CGY B;  2C35 B;  3TP6 A;  1TWH H;  1X56 A;  2NZ1 D;  1CQV A;  4MHE A;  5IWA Q;  1K83 B;  3HOU B;  4IJH A;  3NEL A;  1JWS D;  1WFQ A;  2D0O A;  1EY7 A;  3GDE A;  5D65 A;  1PTO B;  1YIJ A;  2F0P A;  4DV5 L;  1KHI A;  4HN7 A;  2PYK A;  2E2H B;  1G2S A;  2A74 C;  4PG3 A;  5KNB A;  4GNX C;  4DAY A;  3J80 L;  1HR0 W;  2VQF L;  3HS0 C;  2L0C A;  1ROD A;  2FMM A;  5E4X A;  1W6K A;  3J7Z C;  3VDY A;  3P7J A;  5JJZ A;  2BA1 A;  1CKO A;  1VF7 A;  3O13 A;  3JAM L;  1FJG Q;  3RLO A;  3MXN B;  1R9T B;  1TII D;  5M3F B;  1TS4 A;  3M4O B;  4A3K G;  1C7Y A;  3MXG A;  3JAM E;  5JVG 3;  1L2F A;  1A3T A;  4A3E H;  4A3C H;  2PNR C;  4B3M L;  1HA6 A;  1GUO A;  1G91 A;  4C3J G;  1A63 A;  4LF4 Q;  3HOY H;  3I72 A;  2PZT A;  4X6A H;  2EY1 A;  4LF9 Q;  3HOZ G;  4HJ8 A;  4DR4 Q;  4ODG A;  3T1H Q;  2K32 A;  1SSO A;  2NVT H;  3S17 H;  4IOC A;  4GLX A;  3FKI B;  5K5P A;  3RR5 A;  2VB3 X;  2K4K A;  1L0Y B;  3HOV H;  2KED A;  1BDO A;  1OXV A;  4B3S Q;  5M5X B;  2OT2 A;  2PNH A;  2LFN A;  1XXG A;  1VQJ A;  1MBY A;  4DUZ Q;  2E76 C;  3V05 A;  1ET9 A;  4GN3 B;  5CGK A;  3CCR A;  3C1E A;  3U4Z A;  4DUY Q;  3PCO B;  4O0A A;  3NQT A;  1PTO F;  4BBR H;  1D2B A;  3KFU A;  2WIN B;  2KJX A;  3W2D A;  5GQO A;  1HCZ A;  3E3X A;  3ULJ A;  4H0L C;  1W6J A;  3CAM A;  1PYB A;  2XN9 C;  2B2Y A;  3Q24 A;  4X66 Q;  1SRU A;  1CHP D;  2QGQ A;  4R8N A;  4DK1 A;  4GLA C;  1PFM A;  2BA0 A;  2NVY B;  3BG3 A;  3OOC A;  1W3S A;  1M90 C;  1QUQ B;  4AIM A;  1G6P A;  1SJH D;  1O80 A;  3PGZ A;  2R7F A;  4XIG S;  1IXR A;  2K01 A;  2OQK A;  3ZJY C;  3KJP A;  2K28 A;  4R4Q A;  3K0X A;  4GKK Q;  1SYC A;  2MFI A;  4A3F B;  1X32 A;  4KHP Q;  3D3R A;  3K5L A;  3KLW A;  1WCM G;  4LNQ A;  1HPC A;  2AWO A;  2Z0S A;  3DEP A;  2B2W A;  2L15 A;  4GN5 A;  4TSS A;  3R93 A;  4A3F H;  4BBR G;  3TS2 A;  2UXC L;  1ENC A;  1F2Z A;  5IYB H;  1G6Z A;  2CVR A;  4UAI A;  2F0O A;  4RMF A;  3MHB A;  2F0F A;  1A6X A;  3DMU A;  2VQF Q;  5FLM H;  3S16 H;  1JJ2 A;  1VS0 A;  2EY2 A;  1ZYR C;  5IT9 E;  2RBM A;  4HIO A;  2LS0 1;  1F77 A;  3KK7 A;  1KIX A;  1Y1W H;  4GZY C;  4RFB A;  1MJC A;  3K0Y A;  3SK6 A;  1HTP A;  4LFA Q;  1H95 A;  1BVS A;  4DN4 M;  1MSG A;  4AYB B;  2HHH Q;  2B63 B;  4IUT A;  5FOB B;  3I8Z A;  2Z6K A;  1U5K A;  1QUQ A;  3F2B A;  1KQS A;  2Q2U A;  2UUB L;  3A55 A;  1ZKO A;  1CSQ A;  1LAB A;  5M9O A;  1SYB A;  3OMG A;  1C8C A;  5IYD H;  1S5E D;  3BDO A;  1H9S A;  4BY1 H;  3M7N A;  3VA5 A;  4HMJ A;  4ZQ3 A;  1ZYR D;  3RD4 A;  5FLM G;  4NPS A;  3S1N B;  3HOV B;  1RTO A;  3S2D B;  4TKO B;  5EJW A;  2O5I C;  1XMQ Q;  2NVQ H;  2HQE A;  4IPC A;  3P20 A;  2G9H D;  3KF6 A;  1SEB D;  4J15 A;  5KYL A;  3J81 E;  3T1Y Q;  1QOH A;  4FF3 A;  4IFD G;  2JA6 G;  5FK9 C;  4B3S L;  4B9X A;  2VQE L;  1WTO A;  1SE4 A;  4XT1 B;  3TZU A;  5GAH C;  1IHZ A;  3D6W A;  4IO9 A;  4A3L H;  3TBI B;  3DM1 A;  2GVA A;  1TS5 A;  4JI5 Q;  2RDF A;  3SXH A;  4LMQ D;  4A3I B;  3H3V I;  1SFO H;  2KCN A;  2WAQ B;  3DXJ C;  2WB1 B;  1NY4 A;  4WFN 3;  1JJC B;  3FEW X;  2AQ1 B;  2R92 G;  4LF6 Q;  2F0Q A;  4BY7 B;  5HGT A;  5C3E B;  4P71 A;  3GTQ B;  2GVB A;  3CW2 C;  3QWN A;  3IFD A;  1B4O A;  1PH6 A;  2JA8 H;  1I94 L;  2VNU D;  3CQZ H;  4XQN A;  3E0J A;  3LX0 A;  1A2U A;  1CHQ D;  1UE6 A;  4PNY A;  3RZO B;  2J7Z A;  1VQA A;  4GKK L;  2K50 A;  4G7H C;  5C4X B;  3ERQ A;  1ONL A;  5M3M B;  5CV8 A;  1YEZ A;  1JC7 A;  2LXK A;  2Q8R E;  3M3Y H;  3L9A X;  2EYH A;  4CHT B;  4UY8 C;  2PW7 A;  4YCU A;  4Q5V A;  3W1G A;  3I70 A;  2B63 H;  3BDC A;  1TWH B;  3OSO A;  2JK8 A;  2K5W A;  1ILQ A;  4L5T A;  2EJF C;  1M1K C;  4QQB X;  2BH8 A;  3OHX C;  2YTV A;  4L5Q A;  4QUC A;  4ZKC B;  3GTL B;  4BXX H;  1RIP A;  3S16 B;  1FNU A;  1IL8 A;  2L55 A;  4KTA A;  4IUP A;  4A3M G;  4DR1 L;  3I4M B;  1CA5 A;  2BCO A;  2KA7 A;  3PF4 A;  3F2C A;  4YCV A;  4JBK A;  1OXU A;  4OIJ A;  2F0L A;  4UPA A;  3GTP B;  2R7Z B;  4ZLT F;  1TS3 A;  3CPF A;  3S2H H;  3K58 A;  1UEA B;  4X64 Q;  1WCM H;  1X55 A;  4R4I A;  1PH8 A;  3D6C A;  4TRD A;  4DF7 A;  2F0I A;  2H5X A;  1FYC A;  1K8M A;  1E2V A;  4ZUI A;  2X6G A;  3WDN A;  1TXY A;  3D31 A;  1L1O A;  1TY0 A;  1PH3 A;  3I4N H;  1WYD A;  4JG2 A;  1QJO A;  4I7A A;  1BCP C;  2RHS B;  2ZJR A;  2K6A A;  4DV7 L;  2IWH A;  5I9O A;  2MPM A;  3DWA A;  4KKS A;  1O7L A;  4YHH L;  4QGU A;  1EYD A;  1PXU A;  2LSS A;  5EAY A;  4IZ8 A;  1KNA A;  3S24 A;  4IPH A;  5D3D A;  1M8A A;  1HR0 L;  3A8K E;  4A3J G;  2E75 C;  1VQ7 A;  2XVS A;  1OXX K;  2KEC A;  4P74 A;  4R9W A;  1H9R A;  3KF8 B;  1UE1 A;  4K2L A;  1MI2 A;  4KHV A;  1SYD A;  4R8I A;  4JK1 C;  3QIA A;  3J81 c;  1K8A C;  1Y8O B;  1E7Z A;  2A5H A;  3EBE A;  4PZ6 A;  5M3F G;  1WTV A;  2B2T A;  4QIW B;  1AN8 A;  1J9O A;  1D5Z C;  5IYC G;  1XMO Q;  2PCF B;  4V19 0;  2R7D A;  2ZM6 L;  1S5C D;  1HZ9 A;  5FLX E;  2OCE A;  3BZK A;  1VQM A;  1KAB A;  3TDQ A;  3QOJ A;  4RAU C;  3NBH A;  2M00 A;  3J80 i;  2OQ0 A;  2I0Q A;  2PMZ E;  2I46 A;  5IP9 H;  5C44 H;  4DV1 L;  3KUP A;  4OX9 L;  1I4Q A;  3KJO A;  5EKK A;  5F2D A;  1EQT A;  1F2L A;  1FVI A;  1AW7 A;  1QNK A;  5GAD C;  4ALP A;  2N8N A;  1EWI A;  4DAP A;  1IBL Q;  3K57 A;  1I50 B;  2VUM B;  5JPN C;  1NJI C;  1VQK A;  3I4M H;  5COY A;  2A6H C;  2C9O A;  2B8F A;  4UP7 A;  4DAY B;  4OWW B;  2NVY H;  3H0G H;  3HEJ A;  4KN7 C;  1SLJ A;  1TU2 B;  2A6E D;  2F0H A;  4NB3 A;  1VCI A;  1C4Q A;  1NTG A;  4BA1 I;  2Z8L A;  4FO2 A;  4XXE A;  3KYH C;  1O7Y A;  2KCC A;  1BCP D;  2B2V C;  3J81 j;  3KBG A;  1L1O B;  5E1F A;  1LAC A;  2E74 C;  1WTR A;  1ICW A;  2QEX A;  3HOW B;  1DOK A;  4A76 A;  3HRZ C;  4QF4 A;  3SDZ A;  4A3D H;  4V0B A;  3WOE A;  2E2H H;  5C4X H;  1LTL A;  4XT3 B;  1LM0 A;  3E9I A;  3TRZ A;  1JB3 A;  4RGM A;  3U58 A;  4N9T A;  1CI3 M;  1TWA B;  5FLX c;  2K5D A;  3FPP A;  2JA8 B;  2RSN A;  3AU7 A;  3NP8 A;  4JI4 L;  4R4T A;  4HSP A;  1U4P A;  3U9S A;  3A5Z B;  5IT9 c;  5C3E H;  4HJ9 A;  5I4D A;  3UE1 A;  1PRT B;  1Q12 A;  3GV3 A;  2EJM A;  3NK9 A;  3VR4 A;  4HCE A;  2FXQ A;  1Q1E A;  3V96 A;  2EIF A;  1SNC A;  4FXG C;  1EU4 A;  3CC4 A;  1CK1 A;  2NUC A;  4LF7 Q;  5BN4 A;  1VQH A;  4DA2 A;  5JPM C;  5KEE A;  4A3M H;  3DEO A;  5IE8 A;  3EQL C;  3F2U A;  5A2Q E;  1PZK D;  3H15 A;  1H9M A;  4RKB A;  5C5L A;  2MNA A;  3U9O A;  2WAQ G;  2E5L L;  1A3U A;  4P75 A;  1TR5 A;  1GUT A;  2B8G A;  2QA4 A;  1N33 L;  1D1I A;  4BY7 G;  1Z47 A;  5C3E G;  4B3T Q;  4J8Q A;  3W3A A;  1QVF A;  2F4V Q;  1GUS A;  3HOX H;  1W2B A;  3W5O A;  3VR6 A;  2OEO A;  2VW9 A;  4PMB A;  2QIL A;  3PQI A;  2E2J H;  4DUY L;  2PMZ B;  3R8B A;  1NR4 A;  1STE A;  1J5E Q;  1SXT A;  1P16 A;  4TVA B;  5CV6 A;  1IYJ B;  5C0X H;  4B3R L;  4EGV A;  1N36 L;  3ONA B;  4P2C B;  1PH9 A;  4LF8 L;  3SVM A;  4K14 A;  1XTC D;  4KD4 A;  2N3S A;  1SDF A;  1IBK Q;  2UUC Q;  4DR2 L;  1HXY D;  2JA6 B;  1HH2 P;  2ES2 A;  4M8A A;  1B2T A;  3MZ5 A;  3PUW A;  5DNF A;  1YNJ C;  3JAM i;  4KMU C;  4DU9 A;  5FJ8 H;  5COR A;  1IL2 A;  1JQY D;  3CPW A;  1B3A A;  4QIW E;  3SK5 A;  2ASB A;  4CKC A;  4JOI A;  3VR5 A;  1ZEQ X;  1VMP A;  3ER0 A;  4JI7 L;  4DK0 A;  2H1E A;  1XNQ Q;  1AZP A;  4A3E G;  4BA2 I;  1HFN A;  3S1Q B;  1OO9 B;  5LMN W;  2ZTD A;  2XGT A;  1GKH A;  4P72 A;  2UUA L;  4K6D A;  4Q0F A;  5ELO A;  2EXD A;  3T16 A;  1Q81 C;  5JVH 3;  1BBX C;  1K9M C;  1ASY A;  1DYQ A;  1BQQ T;  2UUC L;  4POF A;  1EIG A;  1RDP D;  3AQQ A;  5K36 G;  4NW2 A;  1I6H B;  2Z4H A;  4WJ3 M;  1V1O A;  4AH6 A;  3S1M H;  4DPG A;  1SNO A;  1X6O A;  3K6O A;  2L1B A;  2KVM A;  2P5Z X;  1GOZ A;  3DHQ A;  4A4I A;  1PYS B;  4DR3 Q;  1STH A;  1Y1V G;  5M5Y H;  1V1P A;  4JI1 Q;  2DNE A;  1N32 L;  3EN2 A;  3B6Y A;  1ICF B;  1WTP A;  4HR7 B;  1XWE A;  1HQM C;  4WRD A;  1LT4 D;  2FFK B;  1ESF A;  2D62 A;  3T1Y L;  1IYV A;  3GP7 A;  3KOJ A;  1VQP A;  4G7Z C;  3J7A F;  1PA6 A;  1XMO L;  1VQ9 A;  4MTN A;  1JR0 D;  5T1G A;  5DM7 3;  1D5M C;  2WB1 E;  1F9R A;  4BXX G;  1L1O C;  2Y0S G;  2UU9 L;  4A93 H;  4K5W A;  3M85 A;  5ISR A;  4RKL A;  1EL0 A;  1UWV A;  2WKC A;  2Z6B A;  4A3D B;  3QB3 A;  4JI8 Q;  3QOL A;  3GTK B;  4B9W A;  3TQY A;  3NPP A;  2A19 A;  2SDF A;  5JJL A;  1WTW A;  5C4Z A;  2F4V L;  1EY4 A;  2ATW A;  4LFC L;  3T51 B;  1VQL A;  3BVZ A;  3PUZ A;  5BN5 A;  2M2L A;  3GTG H;  1A8V A;  1KRT A;  5IOD A;  5EPJ A;  5EQ0 A;  2NVT B;  2EVB A;  3T1H L;  2JA7 B;  2LMC B;  1PDQ A;  3A56 A;  2DJF C;  4JI5 L;  3HKZ B;  1PRT F;  1E3P A;  1IBM Q;  2JEB I;  3C46 A;  1A62 A;  2B2Y C;  2JXM B;  4C3I B;  3Q22 A;  5IY0 A;  1I4G A;  1K8O A;  2E2D C;  2VXW A;  4P73 A;  2PQE A;  4X3S A;  3H09 A;  2EDG A;  1VQ6 A;  1HRJ A;  2I5L X;  5H1S E;  4XQJ A;  1I4X A;  4JV5 Q;  3EVQ A;  2K7V A;  3VYT A;  1KL9 A;  1SMX A;  1ENA A;  2N88 A;  2HCC A;  3S2H B;  4DV6 L;  3MWY W;  5J1Z A;  1EWH A;  1Q3L A;  4LFB Q;  1QZH A;  3KBX A;  1GJX A;  3K7A B;  4YY3 L;  2QW7 A;  1A2T A;  1HA5 A;  2KUM A;  3I3C A;  1PMR A;  3Q0A A;  3S1R B;  2KOL A;  4KY5 A;  4A93 B;  2VS1 A;  1LYL A;  4JVZ A;  2GA4 B;  4YWM A;  4DGZ A;  5IIF A;  2OF1 A;  4A3I G;  1LTA D;  4JYA L;  1V1Q A;  1HNX Q;  3RUZ A;  4R4O A;  4E6I A;  5DEH A;  3A8J E;  2CCZ A;  1CZW A;  2R92 B;  4APV A;  4HIK A;  4J1M A;  1WVL A;  3PIP 3;  1IBL L;  2XIW A;  2UUA Q;  3I91 A;  1EOT A;  1JB7 A;  3PV0 A;  1B70 B;  2HDM A;  4A3D G;  4CKB A;  1Q46 A;  5IGG A;  5C3W A;  5M5W H;  2YU9 H;  1EEF D;  4B3T L;  3URY A;  2ZXO A;  1UNS A;  5I2X A;  4UP9 A;  1BCP F;  2F0M A;  4PMW A;  1G2T A;  3FKI G;  4JI1 L;  1FJG L;  3ZYY X;  4L63 B;  4X65 L;  1Y69 U;  4HAE A;  4HTH A;  1VQ8 A;  2BOS A;  2JA9 A;  1KXL A;  1MGS A;  1Z6H A;  2K03 A;  2UXB L;  3QJY A;  1PHJ A;  1EWC A;  2JJQ A;  3LGJ A;  3QO2 A;  3CD6 A;  4XDX A;  1QB5 D;  1K28 A;  3IFT A;  1AH9 A;  1FL0 A;  2JA6 H;  2OWO A;  5ELF A;  1U4R A;  1OXS C;  2F3I A;  5IGD A;  5G3L F;  1KLU D;  3I4L A;  4QL5 A;  3Q8D A;  1K3B C;  2CW0 D;  5LHY 1;  1FNV A;  2ENB A;  1X65 A;  4DKA C;  4JI3 L;  4RCN A;  1CA6 A;  4YCW A;  1QG7 A;  4JC0 A;  4RHR A;  5CBE E;  1LTI D;  1JOQ A;  2EJG C;  1SYG A;  3OWF A;  4GNX B;  3X3N A;  2SEB D;  4OEM B;  4FNF A;  5IP7 H;  2A6E C;  3CCQ A;  3I90 A;  1Q8I A;  1WOC A;  5LMN L;  4A3L G;  1PTO H;  2G9D A;  3GTM H;  1EOV A;  2F0N A;  3T56 B;  1SR3 A;  3VYR A;  3H94 A;  2R93 B;  2YTY A;  3HOU H;  1D5X C;  1LO5 D;  2CW0 C;  2EYO A;  1Z9F A;  4QMG A;  1QVC A;  3MVV A;  4TQU S;  1KTK A;  4OWX B;  3NXW A;  2KQ3 A;  1X3Q A;  1NSN S;  4ID6 A;  4UP8 A;  2XWB B;  4DNI A;  3FRP B;  1E1O A;  1LTR D;  1MHW C;  4LWC A;  1HNW Q;  5EPK A;  1HNX L;  1L0X B;  1PFS A;  1R4P B;  3I73 A;  1RF2 D;  2J0T D;  2RCN A;  1IKL A;  3BU2 A;  1VQB A;  1RD9 D;  2F3W A;  4CDE C;  1Q86 C;  4XYO A;  4DNT B;  2NBF A;  3TN2 A;  2RF4 A;  2G5D A;  3K7A H;  1HTL D;  5AJ3 Q;  4LF6 L;  3PO2 G;  3HOX G;  1M4V A;  2DY8 A;  1A15 A;  1EQQ A;  4EQP A;  2F0K A;  2JN4 A;  1JWM D;  3PUY A;  4ZKB B;  4EX5 A;  4F7X A;  2V1C C;  5KYI A;  5CYU A;  4DR2 Q;  1SAP A;  1GVP A;  4JYA Q;  3QG1 A;  4F88 A;  1S5B D;  4HED A;  4OHJ A;  1GO3 E;  4GNX A;  4OO1 G;  4KV6 A;  3NSW A;  3S1N H;  3IKJ A;  4ZYS A;  1CKN A;  3HOZ H;  5D14 A;  1EYA A;  3A0J A;  2A8V A;  4KN4 C;  1EYG A;  3QR8 A;  4GN4 B;  2BH2 A;  3M4Y A;  4AQY Q;  1BCP B;  5FKA C;  2HIV A;  1FR3 A;  4UHV A;  4HCS A;  4JI4 Q;  1EY6 A;  2HHH L;  5JOB A;  3H3V H;  2RCF A;  5JAV A;  4LUO A;  3NBI A;  2R92 H;  2JA5 G;  4DR3 L;  2RSO A;  1FGU A;  1S72 A;  4IUN A;  3CRL C;  3MAQ A;  5CC4 A;  4MN3 A;  2MUY A;  1C9O A;  5GRO A;  5KND A;  1TWA H;  2BDN A;  1HZC A;  1ILP A;  2CH4 W;  4RGT A;  1B1Z A;  2IT1 A;  1XYI A;  2UUB Q;  2Q8I B;  5ELD A;  2E5L Q;  1EY9 A;  1VDZ A;  4QCL A;  4S3S A;  1YZ6 A;  5GAE C;  3U4V A;  1PH2 A;  3J80 E;  4UDU C;  4CKE A;  3ITP A;  4O42 A;  1WTX A;  4A3K H;  3M7G A;  5JEA J;  2IX0 A;  2D2C C;  1DON A;  2RQX A;  4FP5 D;  4JI3 Q;  2D9U A;  1DXM A;  3BVM A;  2K1B A;  5AFW A;  4LF9 L;  3JC6 6;  2R3Z A;  3KDF B;  1VQD A;  4RWS C;  4A3K B;  1QE6 A;  2Z9H A;  3J80 c;  2R7Z H;  3GTP H;  3TS0 A;  4YWL A;  2ZXP A;  5C4X G;  1PRT C;  1BR9 A;  2VQE Q;  3NUC A;  3TEH B;  4A3G B;  1STG A;  4X62 Q;  5KNC A;  4DNR B;  2UU9 Q;  3CCS A;  3CME A;  5C4H A;  1N34 L;  2B3G A;  4DR6 Q;  1NNX A;  1YJ9 A;  4Y7N B;  4CJ1 B;  2PI2 E;  3PO3 B;  3DM3 A;  3NHH A;  1N34 Q;  3OW2 A;  3MFY A;  1F9Q A;  1VQE A;  3GTO H;  4JI0 L;  2HUG A;  4BBR B;  4FXK C;  2EY5 A;  4L5R C;  4OX9 Q;  2R93 H;  4CDF C;  4H13 C;  3PF5 A;  5IYD G;  2KEN A;  1SE3 A;  5NUC A;  3I7F A;  3Q23 A;  4C3I G;  1T5E A;  3UDG A;  3IAY A;  3OW7 A;  1EUJ A;  2ZXR A;  1XPO A;  1G29 1;  3S9W A;  3DLL A;  5IYB G;  4K0K Q;  5IP9 G;  5C44 G;  1YNN C;  1S3O A;  1BO0 A;  1K8G A;  3K7U C;  4MZ9 A;  3S17 B;  3K5N A;  3E5S A;  3TP8 A;  1CQF A;  1VMC A;  4IPG A;  4ZRZ A;  5HGQ A;  1JMC A;  2QKI C;  4LF7 L;  5HUR A;  3SK8 A;  4DR5 L;  4I7Z C;  3CU7 A;  5JJI A;  2EYF A;  1V9P A;  4X3T A;  1UEB A;  1YI2 A;  1QVG A;  5CV7 A;  4BBS G;  3EFX D;  1PLF A;  1CT1 D;  5C0X I;  3TME A;  2Z1C A;  1PV4 A;  4O1N A;  2N49 A;  1KDB A;  4QB4 A;  4A3J B;  2F3V A;  3HKS A;  1Q1B A;  4QJF A;  4C1N K;  1VQ4 A;  2JE6 I;  3VR3 A;  3SK4 A;  1WCM B;  3BVG A;  3PSI A;  2IPK D;  1UE7 A;  3RN2 A;  1NMF A;  2PZU A;  3BZD B;  3SE0 A;  4NDX A;  2MO1 A;  4ABN A;  1PTO C;  1B53 A;  1LV9 A;  4B3M Q;  4K8J A;  3M3Y B;  2B2W C;  1DJR D;  4K8I A;  1Q82 C;  3BJU A;  3RLF A;  3S15 H;  2XRQ D;  3F2D A;  4KY6 A;  2EYM A;  2QDB A;  3TRE A;  1VQF A;  1NBW A;  3I55 A;  3RZD B;  1NCV A;  2CFM A;  2X6L A;  5CMD A;  4BY1 B;  2ZT9 C;  4LF4 L;  1XPU A;  2IL8 A;  1STA A;  2BE5 C;  2B2V A;  2IY5 B;  1TY2 A;  2CQO A;  3OYY A;  1STY A;  1PTO D;  4LUV A;  4GOP A;  2B63 G;  1ET6 A;  1VQI A;  4JV5 L;  2A1A A;  1FNW A;  1N8R C;  5TSS A;  4JPB W;  4DK3 C;  4RGO S;  4QUF A;  4IFD J;  2PQA A;  5DAU A;  1XMQ L;  1DGS A;  1Y1V H;  5ELC A;  2Q8T A;  2EOT A;  1H9J A;  3U50 C;  3PO2 B;  1QWY A;  3HOX B;  2IX1 A;  2F0W A;  2PW5 A;  3GTO B;  1EEI D;  3C1F A;  1DM0 B;  1SE8 A;  2DGY A;  4OWT B;  2UXD Q;  3PO3 H;  1VQC A;  4OON A;  3G4S A;  1I94 Q;  2M9V A;  2QCP X;  5I6W A;  1E1T A;  1ENF A;  1PFB A;  1L0W A;  1CKM A;  4A75 A;  3ICE A;  1X3F A;  3STB C;  3KDF A;  1KRS A;  1EZ8 A;  3H0G B;  1XNR Q;  2UXD L;  3A7A B;  2CHB D;  3A54 A;  4DXF A;  2J4X A;  4A3G H;  4A3M B;  1SE2 A;  1WD0 A;  2H4O A;  1E22 A;  4IPD A;  2E8G A;  3L3O C;  3FPU B;  3I2Z A;  4YY3 Q;  4C3J H;  3N6R A;  3RLN A;  1HNZ Q;  1N9W A;  4KKU A;  4JI6 Q;  4BBS H;  2WB1 G;  2F0U A;  5EGT A;  4LFA L;  1U0L A;  4IUQ A;  1S40 A;  1E2W A;  3HG9 A;  1C48 A;  1GUG A;  1T5X D;  4KK7 A;  4N9P A;  3J81 L;  4GOP B;  3H3V C;  2JA7 H;  1YJN A;  2OTJ A;  5AJ3 L;  4AYB G;  4EVO A;  4DR5 Q;  2A69 C;  1ML0 D;  4IUU A;  1DOM A;  3MXN A;  4DV5 Q;  1LTB D;  4MNO A;  4KLK A;  3K81 C;  1UUP A;  1KNE A;  2YTX A;  2NN6 G;  1F2M A;  4JBM A;  3S1R H;  2K04 A;  4OL7 A;  4JBW A;  1NE3 A;  4EQ5 A;  1TWG H;  1X54 A;  1MJE A;  3W1B A;  1HHV A;  1K3R A;  4XQQ A;  5C4J H;  3OIQ A;  1V1P B;  3I4O A;  2L12 A;  2FHT A;  2WP8 J;  1E24 A;  2Z4I A;  5IP7 G;  2JP1 A;  4JI2 L;  3IL8 A;  4PZ7 A;  1NR2 A;  4C2M H;  4K5X A;  2IJ0 A;  3FKI H;  4H44 C;  1KDC A;  3VYS A;  4DFA A;  4Y7N H;  1MKH A;  4KD3 A;  1XNQ L;  4B08 A;  3T13 A;  5KGU A;  3DUZ A;  3R2I A;  4ZCK A;  2PO4 A;  2F0V A;  3BDL A;  5FO8 B;  5C3X A;  3CHB D;  4HJ7 A;  1VQ5 A;  2B2U C;  1B8A A;  2VL6 A;  5EBC A;  1S5F D;  1KAA A;  5M5Y B;  1LUZ A;  5C0X G;  1Y8P B;  1EIF A;  1I3Q B;  3FDT A;  4K6L A;  1TT2 A;  2IHE A;  1HZB A;  3I4M G;  2WKD A;  2F52 A;  3OTO Q;  1KLG D;  4JOI C;  1ESR A;  3J81 i;  3MXP A;  1VQG A;  2R7Z G;  2QEJ C;  3ND8 A;  1TS2 A;  2AWN A;  3ULL A;  1A0I A;  3M4O H;  4DV6 Q;  1EQR A;  1EIY B;  2B2T C;  5FO9 B;  3A7L A;  4FYD A;  1IBK L;  1F9S A;  1O78 A;  3KF8 A;  1RTN A;  1O7Z A;  2GN5 A;  1II3 A;  1PYW D;  2PPB C;  4C2M B;  3UDX A;  4DV4 Q;  4M1U B;  4RH6 A;  2A6H D;  4YIJ A;  2LY7 A;  1BXT A;  1HJP A;  1TWF B;  5C4J B;  1WD1 A;  1J5E L;  1G8Z D;  2SNS A;  1YHA A;  3MEF A;  4YHH Q;  3GTM B;  3SR1 A;  4KKT A;  4LK1 C;  1F9P A;  4FF2 A;  1JE5 A;  1YBY A;  1Q7Y C;  4Y52 H;  1VF5 C;  3FP9 A;  3TSS A;  4DV7 Q;  4RHS A;  4BWG B;  1YHQ A;  4Z9C B;  1ASZ A;  2NYZ D;  2DNC A;  2A69 D;  3GTJ H;  1EY0 A;  4C3H G;  5BR8 L;  2QF7 A;  4JCV E;  3NBH B;  2JEA I;  3EJI A;  3KF6 B;  1OTC A;  1BF4 A;  3CRK C;  4IFD I;  4F87 A;  1J6Q A;  1LLR D;  3A74 A;  4FVM A;  4DV2 L;  4ILW A;  2JQO A;  3AYH B;  3HOW G;  1SN8 A;  2RVL A;  1FGB D;  4X3K A;  4ZUJ A;  4BBS B;  4LF5 L;  4HJ5 A;  2Q2I A;  2K5V A;  4HIM A;  1CKN B;  1HNZ L;  2MP1 A;  5E3F A;  1BUV T;  1CM9 A;  3NTK A;  2AQ3 B;  3I4N B;  5J22 A;  3HKZ G;  1LT6 D;  2JA8 G;  4AQY L;  5CV9 A;  1GD7 A;  1EQV A;  1LT3 D;  4DAM A;  2NZO A;  1STB A;  4JI7 Q;  3PO3 G;  2N55 A;  1H9K A;  1XTD A;  1B9M A;  1HUN A;  2Q2T A;  1STN A;  4FDB A;  2AUK A;  2HQL A;  1SFO B;  3BZC A;  4ZK9 B;  4JI6 L;  5M5W B;  1SYE A;  2CWP A;  1UE5 A;  3KLS X;  2O2L D;  4IQZ A;  1CSP A;  2HDL A;  2OXP A;  2V4D A;  1LTT D;  2MQH A;  1SNP A;  2JA7 G;  1JE4 A;  4R1J A;  1OXT A;  2R6G A;  1B44 D;  1V43 A;  4CJ0 B;  5J39 A;  3V2T A;  4LUZ A;  1DZ1 A;  3SEB A;  3TP5 A;  1IZ6 A;  1BBW A;  1Y8N B;  2KCM A;  2A68 C;  2MGS A;  2NN6 H;  3ULP A;  1AE3 A;  2X69 A;  4G57 A;  2E2I H;  4LJZ C;  4QY7 A;  1SRO A;  4RGN A;  2E2J B;  5IGF A;  3S15 B;  4RA8 A;  3LWE A;  2N78 A;  2AKW B;  3AB9 A;  2K05 A;  1RCV D;  4FXD A;  2EY6 A;  3FHW A;  3NTI A;  4DV4 L;  3C2P A;  1X3E A;  4JI0 Q;  3AMU A;  1B7Y B;  3VA7 A;  1Y1W B;  4C3H H;  4PV1 C;  1SNM A;  3J7A V;  2XSC A;  4GS3 A;  3STB D;  4A3J H;  3RN5 A;  3I4N G;  1HZA A;  1YNN D;  3GV6 A;  1Q90 A;  2ZM6 Q;  2EZV A;  2O5J C;  3HZX A;  2K75 A;  3EIV A;  2Q2H A;  2ZJP A;  3GQB A;  1JOR A;  3SGI A;  1JCK B;  1GM5 A;  4POG A;  1TVX A;  3HOU G;  1D1K A;  3UDI A;  2CQA A;  4KJN A;  4WJ4 A;  4LW1 A;  3CP0 A;  1SMY C;  1FD7 D;  4N8X 1;  5C5M A;  2VZA A;  4LF5 Q;  2FMC A;  2YU9 B;  3S2D H;  2EYJ A;  5DM6 3;  5G3L D;  4GLV B;  4LFB L;  1TWC H;  2EE1 A;  2F0J A;  5HY6 A;  2ZTC A;  1TWG B;  2FIN B;  3R2T A;  4C3I H;  4RG1 A;  4JI2 Q;  3PUX A;  4IOA A;  4K0K L;  1KC8 C;  1VQO A;  1Z7T A;  1K0S A;  4L5S A;  3H91 A;  5K36 H;  4XTC S;  3R3O A;  4DUZ L;  2B39 A;  2K5H A;  5IT9 L;  1U4M A;  2A68 D;  3GTG B;  3EA6 A;  3VR2 A;  2SNM A;  5C0X J;  2L9H A;  1K73 C;  3H0G G;  2XTI A;  1JOO A;  3MA2 B;  3LWU A;  5FLX L;  3GTK H;  4DR1 Q;  3CC7 A;  4N8F A;  4C3J B;  2R61 A;  1I5F A;  1NAP A;  1PFN A;  1AFP A;  2IHF A;  2KHS A;  3G71 A;  1X3P A;  1GUW A;  3HOZ B;  5A35 A;  4KY7 A;  2NZH A;  4BS9 A;  3PIO 3;  1KDA A;  5KIX A;  1A3V A;  1DOL A;  3L7Z C;  1X3G A;  3ERS X;  3T53 B;  1U9R A;  1RJT A;  5M3M G;  2RDG A;  3NTH A;  2AMC B;  4DAV A;  5C44 B;  1N32 Q;  1I4R A;  4ME5 A;  5LL6 S;  3S1Q H;  1QIL A;  1Y14 B;  4I65 A;  2KCT A;  2NN6 I;  3G6E A;  1EFI D;  4EQO A;  1CZG A;  2UXB Q;  1I3Q H;  2EXZ A;  3G7L A;  4HSV A;  2CWA A;  3S14 H;  4A3B H;  2NVX B;  2EQS A;  1YHB A;  5EKL A;  2F1M A;  5J3B A;  3OIP A;  1WTH A;  5ELB A;  1XJV A;  1N36 Q;  2AHO B;  5M3F H;  3HP3 A;  1CFM A;  1RKN A;  3CCV A;  2B29 A;  3OMC A;  4H02 A;  3ERO A;  3NWS A;  1WTQ A;  1SYF A;  4HJA A;  2CKZ B;  4F8M A;  3CCE A;  1HR0 Q;  3RMH A;  3CCU A;  3KLR A;  1R4Q B;  2DY7 A;  3AEV A;  2ICE C;  3D4R A;  4DV0 Q;  4GOP C;  1SBB B;  1IBM L;  4DK6 C;  1NUC A;  1WI5 A;  1X9N A;  1YNX A;  1JJG A;  4IN3 A;  5I2Y A;  1CTM A;  2RDH A;  3UI2 A;  1IYU A;  3NEN A;  2VB2 X;  3D8G A;  3E0E A;  4B3R Q;  3GO5 A;  5LMU L;  5EBD A;  2DUD A;  3D0F A;  4NXM Q;  1I6V C;  1PZI D;  2IX3 A;  1UAP A;  4BY1 G;  1E0B A;  3BYT B;  1LT5 D;  3NE5 B;  3NQI A;  4U68 A;  2HD3 A;  2ALY B;  2MO0 A;  1D7Q A;  2HCI A;  4BY7 H;  2K5N A;  3PIO A;  3J7Y W;  2L4N A;  3A8I E;  3OWE B;  2WAQ E;  1TKW B;  4R4C A;  1O7I A;  3K8A A;  4X3U A;  3MC0 B;  1GUN A;  1G51 A;  2L11 A;  4A3C G;  3GTL H;  2JA5 B;  2TSS A;  4ZAI A;  4C1N I;  3X3M A;  5GAG C;  2KBN A;  4CJ2 C;  3A5U A;  1XX8 A;  4C3H B;  5EKI A;  4X66 L;  5ELE A;  1AP0 A;  1IW7 D;  5E4W C;  3CCL A;  2EPB A;  3FVQ A;  5DLQ E;  5EPL A;  4G4K A;  3PUV A;  3KLS A;  4IAL A;  1KD1 C;  2EYL A;  5JEA G;  5IGC A;  3BS1 A;  3PO2 H;  4K5V A;  4XYQ A;  1I4H A;  2NTT A;  2SOB A;  3PIP A;  5M3M H;  4NMZ A;  2NVQ B;  4DV2 Q;  4JW0 A;  3H6M A;  5IYC H;  2F0S A;  1EYC A;  4YWK A;  3HOV G;  4OXP A;  1ZXT A;  1EY5 A;  2HT1 A;  3FMC A;  3L0O A;  3UDF A;  3C3L A;  4KI0 A;  5JJK A;  4DR4 L;  2UXC Q;  4KHP L;  1E2Z A;  2NTS A;  1BBU A;  1GHK A;  2LKV A;  4CDC C;  1F2Y A;  3HOW H;  1K83 H;  3K5O A;  1KAW A;  3CKI B;  3NWT A;  1BNZ A;  1JIC A;  2F0D A;  1B3Q A;  1PZJ D;  3AFP A;  5I9P A;  1RL2 A;  4OGQ C;  3GD7 A;  4G7O C;  3GTJ B;  3PMF A;  2JA5 H;  4A3G G;  1YIT A; 
#chains in the Genus database with same CATH homology
 2YYZ A;  4KHZ A;  4NP5 A;  5I6Y A;  4DXG A;  2F0T A;  1AEX A;  2D5D A;  2ICI A;  1BOS A;  4U67 3;  1YNJ D;  3D4D A;  4EQN A;  1JOK A;  1EIH A;  1QCB D;  4RCO A;  2Y0S B;  1IW7 C;  1B50 A;  2KEE A;  5CBA E;  4L6T B;  5JEA H;  3HGB A;  5FO7 B;  2RA4 A;  4WOR A;  3K5M A;  2EYP A;  4FF4 A;  3MFG A;  2FJ2 A;  3SHL A;  4LAA A;  4PQX A;  2O4X A;  2B2U A;  1H9S B;  2I07 B;  2RKS A;  1HQR D;  3T4A C;  3DWQ A;  2MJ8 A;  4L8J A;  3LNN A;  1MD2 D;  2XWJ B;  2BDO A;  3BYY B;  1PRT D;  4OO1 H;  1EZ6 A;  1MSH A;  5BN3 A;  1SJE D;  1S4Z A;  1JWU D;  2XNA C;  5C6A A;  1V8Q A;  1DD2 A;  3N52 A;  1B9N A;  2JSO A;  1U4L A;  4OIK A;  2NB0 A;  5IGB A;  3S14 B;  4A3B B;  3HOY B;  2F4I A;  3S1M B;  4IFD H;  2K33 A;  4ULL A;  5LL6 X;  2PZW A;  1HUM A;  1SND A;  3P1H A;  2WII B;  5A2Q L;  2C5C A;  4K2K A;  1GHJ A;  4HMI A;  2F0G A;  3Q6S A;  3TP7 A;  3WOF A;  4MIU A;  3ND9 A;  4OO1 I;  2A73 B;  5T1I A;  1QNU A;  3TZD A;  4WJW A;  3P75 A;  1IKM A;  1S5D D;  2F03 A;  1LTS D;  3G6J B;  2E2I B;  1SMY D;  3K59 A;  1I4P A;  1DCZ A;  5IOC A;  2DN8 A;  3CQZ B;  2AQ2 B;  1J8I A;  2WAC A;  5CV4 A;  5D3I B;  2TMP A;  4NKL A;  2JYO A;  3MTS A;  1HFG A;  5CR3 A;  1TWC B;  1LTG D;  4J6H A;  2K5Q A;  3E6Z X;  4C56 C;  5IGE A;  4A3E B;  3DWP A;  4CBV A;  2XRS D;  2IW3 A;  3OPO A;  4IUV A;  4KJO A;  1EY8 A;  2L5T A;  4H7B A;  2BE5 D;  1RHP A;  3VYU A;  2ID0 A;  4IUR A;  2F0E A;  1D6E C;  5KRU A;  3D4W A;  5CV5 A;  4FF1 A;  1AZQ A;  1Y1V B;  1TQO A;  1GXD C;  1EU3 A;  2WV6 D;  3MXU A;  2NWG A;  4PMC A;  2MHV A;  1SNQ A;  2AUJ D;  3MEH A;  4CGY B;  3TP6 A;  2NZ1 D;  1CQV A;  4MHE A;  1K83 B;  3HOU B;  1JWS D;  1EY7 A;  5D65 A;  1PTO B;  2F0P A;  4HN7 A;  2PYK A;  2E2H B;  1G2S A;  2A74 C;  5KNB A;  4DAY A;  3J80 L;  3HS0 C;  2L0C A;  1ROD A;  2FMM A;  5E4X A;  1W6K A;  3P7J A;  5JJZ A;  2BA1 A;  3O13 A;  1VF7 A;  3JAM L;  1R9T B;  1TII D;  5M3F B;  1TS4 A;  3M4O B;  3MXG A;  3JAM E;  5JVG 3;  1A3T A;  2PNR C;  1HA6 A;  1GUO A;  1G91 A;  4C3J G;  3I72 A;  2PZT A;  2EY1 A;  4ODG A;  2K32 A;  1SSO A;  3FKI B;  5K5P A;  2VB3 X;  1L0Y B;  2KED A;  1BDO A;  1OXV A;  5M5X B;  2OT2 A;  2LFN A;  1XXG A;  1MBY A;  2E76 C;  3V05 A;  1ET9 A;  5CGK A;  3C1E A;  1D2B A;  3NQT A;  1PTO F;  2WIN B;  2KJX A;  3W2D A;  1HCZ A;  4H0L C;  1W6J A;  2XN9 C;  2B2Y A;  3Q24 A;  1CHP D;  4R8N A;  4DK1 A;  1PFM A;  2BA0 A;  2NVY B;  3BG3 A;  3OOC A;  1SJH D;  1O80 A;  4XIG S;  2K01 A;  2K28 A;  1SYC A;  4A3F B;  1X32 A;  3D3R A;  3K5L A;  1HPC A;  2AWO A;  3DEP A;  2B2W A;  4TSS A;  3R93 A;  1ENC A;  1F2Z A;  1G6Z A;  2CVR A;  4UAI A;  2F0O A;  3MHB A;  2F0F A;  1A6X A;  3DMU A;  2EY2 A;  1ZYR C;  5IT9 E;  2RBM A;  2LS0 1;  1F77 A;  3KK7 A;  4GZY C;  4RFB A;  3K0Y A;  3SK6 A;  1HTP A;  4DN4 M;  1MSG A;  4AYB B;  2B63 B;  4IUT A;  5FOB B;  3I8Z A;  3A55 A;  1ZKO A;  1LAB A;  5M9O A;  1SYB A;  3OMG A;  1C8C A;  1S5E D;  3BDO A;  3M7N A;  1H9S A;  3VA5 A;  4HMJ A;  4ZQ3 A;  1ZYR D;  3RD4 A;  3S1N B;  3HOV B;  1RTO A;  3S2D B;  4TKO B;  5EJW A;  2O5I C;  2HQE A;  3P20 A;  2G9H D;  1SEB D;  5KYL A;  3J81 E;  1QOH A;  4FF3 A;  4IFD G;  5FK9 C;  4B9X A;  1WTO A;  1SE4 A;  4XT1 B;  3TZU A;  1IHZ A;  3D6W A;  3TBI B;  3DM1 A;  1TS5 A;  2RDF A;  3SXH A;  4LMQ D;  4A3I B;  2KCN A;  2WAQ B;  3DXJ C;  2WB1 B;  4WFN 3;  3FEW X;  2AQ1 B;  2F0Q A;  4BY7 B;  5HGT A;  5C3E B;  3GTQ B;  3QWN A;  3IFD A;  1B4O A;  2VNU D;  4XQN A;  3E0J A;  3LX0 A;  1A2U A;  1CHQ D;  4PNY A;  3RZO B;  2J7Z A;  4G7H C;  5C4X B;  3ERQ A;  1ONL A;  5M3M B;  5CV8 A;  1JC7 A;  2Q8R E;  3L9A X;  2EYH A;  4CHT B;  2PW7 A;  4Q5V A;  3I70 A;  3BDC A;  1TWH B;  3OSO A;  2K5W A;  1ILQ A;  2EJF C;  3OHX C;  4QUC A;  4ZKC B;  3GTL B;  3S16 B;  1FNU A;  1IL8 A;  2L55 A;  4KTA A;  4IUP A;  3I4M B;  1CA5 A;  2BCO A;  2KA7 A;  1OXU A;  4OIJ A;  2F0L A;  3GTP B;  2R7Z B;  4ZLT F;  1TS3 A;  3K58 A;  1UEA B;  3D6C A;  4TRD A;  4DF7 A;  2F0I A;  1FYC A;  1K8M A;  1E2V A;  4ZUI A;  2X6G A;  3WDN A;  3D31 A;  1TY0 A;  1QJO A;  1BCP C;  2K6A A;  2IWH A;  5I9O A;  2MPM A;  3DWA A;  4KKS A;  1O7L A;  1EYD A;  1PXU A;  4IZ8 A;  1KNA A;  5D3D A;  1M8A A;  3A8K E;  2E75 C;  2XVS A;  1OXX K;  2KEC A;  4R9W A;  1H9R A;  4K2L A;  1MI2 A;  4KHV A;  1SYD A;  4R8I A;  4JK1 C;  3QIA A;  1Y8O B;  2A5H A;  1WTV A;  2B2T A;  4QIW B;  1AN8 A;  1J9O A;  1D5Z C;  4V19 0;  2PCF B;  1S5C D;  5FLX E;  1KAB A;  3TDQ A;  3QOJ A;  4RAU C;  3NBH A;  2M00 A;  2I46 A;  3KUP A;  1I4Q A;  5EKK A;  5F2D A;  1EQT A;  1F2L A;  1AW7 A;  1QNK A;  4DAP A;  3K57 A;  1I50 B;  2VUM B;  5JPN C;  5COY A;  2A6H C;  2C9O A;  2B8F A;  3HEJ A;  4KN7 C;  1TU2 B;  2A6E D;  2F0H A;  1VCI A;  1C4Q A;  4BA1 I;  2Z8L A;  4FO2 A;  4XXE A;  1O7Y A;  2KCC A;  1BCP D;  2B2V C;  3KBG A;  5E1F A;  1LAC A;  2E74 C;  1WTR A;  1ICW A;  3HOW B;  1DOK A;  3HRZ C;  4QF4 A;  3SDZ A;  4V0B A;  3WOE A;  4XT3 B;  1JB3 A;  4RGM A;  4N9T A;  1CI3 M;  1TWA B;  2K5D A;  3FPP A;  2JA8 B;  2RSN A;  3AU7 A;  3NP8 A;  4HSP A;  1U4P A;  3U9S A;  5I4D A;  1PRT B;  1Q12 A;  3GV3 A;  2EJM A;  3NK9 A;  3VR4 A;  4HCE A;  1Q1E A;  3V96 A;  1SNC A;  4FXG C;  1EU4 A;  1CK1 A;  2NUC A;  5BN4 A;  5KEE A;  4DA2 A;  5JPM C;  3DEO A;  3EQL C;  3F2U A;  5A2Q E;  1PZK D;  1H9M A;  4RKB A;  5C5L A;  3U9O A;  1A3U A;  1TR5 A;  1GUT A;  2B8G A;  1D1I A;  1Z47 A;  4J8Q A;  3W3A A;  1GUS A;  3VR6 A;  2OEO A;  4PMB A;  2QIL A;  2PMZ B;  3R8B A;  1NR4 A;  1STE A;  1SXT A;  5CV6 A;  5C0X H;  4EGV A;  3ONA B;  4P2C B;  3SVM A;  4K14 A;  1XTC D;  4KD4 A;  1SDF A;  1HXY D;  2JA6 B;  4M8A A;  1B2T A;  3MZ5 A;  3PUW A;  5DNF A;  1YNJ C;  4KMU C;  4DU9 A;  5COR A;  1JQY D;  1B3A A;  3SK5 A;  4CKC A;  3VR5 A;  1ZEQ X;  1VMP A;  4DK0 A;  2H1E A;  1AZP A;  4BA2 I;  1HFN A;  3S1Q B;  1OO9 B;  4K6D A;  4Q0F A;  3T16 A;  5JVH 3;  1BBX C;  1DYQ A;  1BQQ T;  1EIG A;  1RDP D;  5K36 G;  4NW2 A;  1I6H B;  2Z4H A;  1V1O A;  1SNO A;  3K6O A;  2L1B A;  2KVM A;  1GOZ A;  3DHQ A;  1STH A;  1V1P A;  2DNE A;  1WTP A;  4HR7 B;  1XWE A;  1HQM C;  4WRD A;  1LT4 D;  2FFK B;  1ESF A;  2D62 A;  1IYV A;  3GP7 A;  4G7Z C;  3J7A F;  1JR0 D;  5T1G A;  5DM7 3;  1D5M C;  1F9R A;  4K5W A;  3M85 A;  5ISR A;  4RKL A;  1EL0 A;  2WKC A;  4A3D B;  3QB3 A;  3QOL A;  3GTK B;  4B9W A;  3NPP A;  2SDF A;  1WTW A;  5C4Z A;  1EY4 A;  3T51 B;  3BVZ A;  3PUZ A;  5BN5 A;  2M2L A;  5IOD A;  5EPJ A;  5EQ0 A;  2NVT B;  2EVB A;  2JA7 B;  2LMC B;  1PDQ A;  3A56 A;  3HKZ B;  1PRT F;  2JEB I;  3C46 A;  2B2Y C;  2JXM B;  4C3I B;  3Q22 A;  1I4G A;  1K8O A;  2E2D C;  2VXW A;  2PQE A;  4X3S A;  3H09 A;  2EDG A;  1HRJ A;  4XQJ A;  1I4X A;  3EVQ A;  2K7V A;  3VYT A;  1ENA A;  2N88 A;  2HCC A;  3S2H B;  3MWY W;  5J1Z A;  1EWH A;  1Q3L A;  3KBX A;  1GJX A;  3K7A B;  1A2T A;  1HA5 A;  2KUM A;  3I3C A;  1PMR A;  3Q0A A;  3S1R B;  2KOL A;  4KY5 A;  4A93 B;  2GA4 B;  4DGZ A;  5IIF A;  2OF1 A;  1LTA D;  3RUZ A;  4E6I A;  5DEH A;  3A8J E;  1CZW A;  2R92 B;  4J1M A;  1WVL A;  3PIP 3;  2XIW A;  3I91 A;  1EOT A;  3PV0 A;  2HDM A;  4CKB A;  5IGG A;  5C3W A;  1EEF D;  3URY A;  2ZXO A;  1UNS A;  5I2X A;  1BCP F;  2F0M A;  4PMW A;  1G2T A;  3ZYY X;  4L63 B;  1Y69 U;  4HAE A;  4HTH A;  2BOS A;  1MGS A;  1Z6H A;  2K03 A;  3QJY A;  1EWC A;  3QO2 A;  4XDX A;  1QB5 D;  3IFT A;  5ELF A;  1U4R A;  1OXS C;  5IGD A;  5G3L F;  1KLU D;  3I4L A;  2CW0 D;  5LHY 1;  1FNV A;  2ENB A;  4RCN A;  1CA6 A;  1QG7 A;  4RHR A;  5CBE E;  1LTI D;  1JOQ A;  2EJG C;  1SYG A;  3OWF A;  3X3N A;  2SEB D;  4FNF A;  2A6E C;  3I90 A;  1Q8I A;  1PTO H;  2G9D A;  2F0N A;  3T56 B;  3VYR A;  3H94 A;  2R93 B;  1D5X C;  1LO5 D;  2CW0 C;  2EYO A;  4QMG A;  3MVV A;  4TQU S;  1KTK A;  3NXW A;  2KQ3 A;  1X3Q A;  1NSN S;  4ID6 A;  2XWB B;  3FRP B;  1LTR D;  5EPK A;  1L0X B;  1R4P B;  3I73 A;  1RF2 D;  2J0T D;  1IKL A;  1RD9 D;  2F3W A;  4XYO A;  4DNT B;  2NBF A;  3TN2 A;  1HTL D;  1M4V A;  2DY8 A;  1A15 A;  4EQP A;  2F0K A;  3PUY A;  1JWM D;  4ZKB B;  4F7X A;  5KYI A;  5CYU A;  1SAP A;  3QG1 A;  4F88 A;  1S5B D;  4HED A;  4OHJ A;  4OO1 G;  4KV6 A;  3NSW A;  3IKJ A;  4ZYS A;  5D14 A;  1EYA A;  4KN4 C;  3M4Y A;  1BCP B;  5FKA C;  1FR3 A;  4HCS A;  1EY6 A;  5JOB A;  5JAV A;  3NBI A;  2RSO A;  4IUN A;  3CRL C;  3MAQ A;  5CC4 A;  4MN3 A;  2MUY A;  5KND A;  2BDN A;  1ILP A;  4RGT A;  1B1Z A;  2IT1 A;  1XYI A;  2Q8I B;  5ELD A;  1EY9 A;  1VDZ A;  4QCL A;  4S3S A;  3J80 E;  4UDU C;  4CKE A;  3ITP A;  4O42 A;  1WTX A;  3M7G A;  5JEA J;  2IX0 A;  2D2C C;  1DON A;  2RQX A;  4FP5 D;  2D9U A;  1DXM A;  3BVM A;  2K1B A;  5AFW A;  2R3Z A;  4RWS C;  4A3K B;  1QE6 A;  2ZXP A;  1PRT C;  1BR9 A;  3NUC A;  4A3G B;  1STG A;  5KNC A;  4DNR B;  5C4H A;  4Y7N B;  4CJ1 B;  3PO3 B;  3NHH A;  3MFY A;  1F9Q A;  2HUG A;  4BBR B;  4FXK C;  2EY5 A;  4H13 C;  5NUC A;  1SE3 A;  3Q23 A;  4C3I G;  1T5E A;  3IAY A;  3OW7 A;  2ZXR A;  1G29 1;  3S9W A;  1YNN C;  1BO0 A;  3S17 B;  3K5N A;  3E5S A;  3TP8 A;  1CQF A;  1VMC A;  4ZRZ A;  2QKI C;  5HUR A;  3SK8 A;  4I7Z C;  3CU7 A;  2EYF A;  4X3T A;  5CV7 A;  3EFX D;  1PLF A;  1CT1 D;  5C0X I;  3TME A;  2Z1C A;  4O1N A;  1KDB A;  4QB4 A;  4A3J B;  2F3V A;  1Q1B A;  4C1N K;  2JE6 I;  3VR3 A;  3SK4 A;  1WCM B;  2IPK D;  3BVG A;  2PZU A;  3SE0 A;  3BZD B;  4NDX A;  4ABN A;  1PTO C;  1B53 A;  1LV9 A;  3M3Y B;  4K8J A;  2B2W C;  1DJR D;  4K8I A;  3RLF A;  2XRQ D;  4KY6 A;  2EYM A;  2QDB A;  3RZD B;  1NCV A;  2X6L A;  5CMD A;  4BY1 B;  2ZT9 C;  2IL8 A;  1STA A;  2BE5 C;  2B2V A;  1TY2 A;  1STY A;  1PTO D;  1ET6 A;  1FNW A;  5TSS A;  4RGO S;  4QUF A;  4IFD J;  5DAU A;  5ELC A;  2Q8T A;  2EOT A;  1H9J A;  3PO2 B;  1QWY A;  3HOX B;  2IX1 A;  3GTO B;  2F0W A;  2PW5 A;  1EEI D;  3C1F A;  1DM0 B;  2M9V A;  2QCP X;  5I6W A;  1ENF A;  1PFB A;  1EZ8 A;  3H0G B;  3A7A B;  2CHB D;  3A54 A;  4DXF A;  2J4X A;  4A3M B;  1SE2 A;  1WD0 A;  2H4O A;  3L3O C;  3FPU B;  3N6R A;  4KKU A;  2F0U A;  5EGT A;  4IUQ A;  1E2W A;  3H3V C;  3HG9 A;  1C48 A;  3J81 L;  1GUG A;  1T5X D;  4KK7 A;  4N9P A;  4EVO A;  2A69 C;  1ML0 D;  4IUU A;  1DOM A;  3MXN A;  1LTB D;  1UUP A;  1KNE A;  2NN6 G;  1F2M A;  2K04 A;  4OL7 A;  4JBW A;  1HHV A;  4XQQ A;  3OIQ A;  1V1P B;  2L12 A;  2FHT A;  2WP8 J;  2Z4I A;  2JP1 A;  3IL8 A;  1NR2 A;  4K5X A;  2IJ0 A;  4H44 C;  1KDC A;  3VYS A;  4DFA A;  4KD3 A;  4B08 A;  3T13 A;  5KGU A;  3DUZ A;  3R2I A;  2PO4 A;  2F0V A;  3BDL A;  5FO8 B;  5C3X A;  3CHB D;  2B2U C;  5EBC A;  1S5F D;  1KAA A;  5M5Y B;  5C0X G;  1Y8P B;  1I3Q B;  3FDT A;  4K6L A;  1TT2 A;  2WKD A;  1KLG D;  1ESR A;  3MXP A;  2QEJ C;  3ND8 A;  1TS2 A;  2AWN A;  2B2T C;  5FO9 B;  3A7L A;  4FYD A;  1F9S A;  1O78 A;  3KF8 A;  1RTN A;  1O7Z A;  1II3 A;  1PYW D;  2PPB C;  4C2M B;  4M1U B;  4RH6 A;  2A6H D;  4YIJ A;  2LY7 A;  1BXT A;  1TWF B;  5C4J B;  1WD1 A;  1G8Z D;  2SNS A;  3GTM B;  3SR1 A;  4KKT A;  4LK1 C;  1F9P A;  4FF2 A;  1VF5 C;  3TSS A;  4RHS A;  4BWG B;  4Z9C B;  2NYZ D;  2DNC A;  2A69 D;  1EY0 A;  4C3H G;  2QF7 A;  2JEA I;  3EJI A;  4IFD I;  1BF4 A;  3CRK C;  4F87 A;  1LLR D;  4FVM A;  4ILW A;  2RVL A;  1FGB D;  4X3K A;  4ZUJ A;  4BBS B;  2MP1 A;  5E3F A;  1BUV T;  1CM9 A;  3NTK A;  2AQ3 B;  3I4N B;  5J22 A;  1LT6 D;  5CV9 A;  1EQV A;  1LT3 D;  1STB A;  2N55 A;  1H9K A;  1B9M A;  1HUN A;  1STN A;  2AUK A;  1SFO B;  4ZK9 B;  5M5W B;  1SYE A;  3KLS X;  2O2L D;  4IQZ A;  2HDL A;  2OXP A;  2V4D A;  1LTT D;  1SNP A;  1JE4 A;  1OXT A;  2R6G A;  1B44 D;  1V43 A;  4CJ0 B;  5J39 A;  3V2T A;  1DZ1 A;  3SEB A;  3TP5 A;  1Y8N B;  2A68 C;  2MGS A;  2NN6 H;  2X69 A;  4G57 A;  4LJZ C;  4RGN A;  2E2J B;  5IGF A;  3S15 B;  4RA8 A;  3LWE A;  3AB9 A;  2K05 A;  1RCV D;  4FXD A;  2EY6 A;  3NTI A;  3C2P A;  3AMU A;  3VA7 A;  1Y1W B;  4PV1 C;  1SNM A;  3J7A V;  2XSC A;  1YNN D;  3GV6 A;  1Q90 A;  2EZV A;  2O5J C;  3HZX A;  3GQB A;  1JOR A;  1JCK B;  1TVX A;  1D1K A;  2CQA A;  4KJN A;  1SMY C;  1FD7 D;  5C5M A;  2FMC A;  2YU9 B;  2EYJ A;  5DM6 3;  5G3L D;  2EE1 A;  2F0J A;  1TWG B;  2FIN B;  3R2T A;  3PUX A;  1Z7T A;  3H91 A;  5K36 H;  4XTC S;  3R3O A;  2B39 A;  5IT9 L;  1U4M A;  2A68 D;  3GTG B;  3EA6 A;  3VR2 A;  2SNM A;  5C0X J;  2L9H A;  1JOO A;  3MA2 B;  3LWU A;  5FLX L;  4C3J B;  2R61 A;  1NAP A;  1PFN A;  1AFP A;  2KHS A;  1X3P A;  1GUW A;  3HOZ B;  5A35 A;  4KY7 A;  4BS9 A;  3PIO 3;  1KDA A;  5KIX A;  1A3V A;  1DOL A;  3L7Z C;  3T53 B;  1U9R A;  1RJT A;  2RDG A;  3NTH A;  4DAV A;  5C44 B;  1I4R A;  4ME5 A;  5LL6 S;  1QIL A;  4I65 A;  2NN6 I;  1EFI D;  4EQO A;  1CZG A;  2EXZ A;  3G7L A;  4HSV A;  2NVX B;  5EKL A;  2F1M A;  3OIP A;  5ELB A;  3HP3 A;  1CFM A;  1RKN A;  3OMC A;  3ERO A;  1WTQ A;  3NWS A;  1SYF A;  4F8M A;  3RMH A;  3KLR A;  1R4Q B;  2DY7 A;  2ICE C;  3D4R A;  1SBB B;  1NUC A;  4IN3 A;  5I2Y A;  1CTM A;  2RDH A;  3UI2 A;  1IYU A;  2VB2 X;  3D8G A;  3GO5 A;  5EBD A;  1I6V C;  1PZI D;  2IX3 A;  1UAP A;  1E0B A;  3BYT B;  1LT5 D;  3NE5 B;  3NQI A;  4U68 A;  2HCI A;  3J7Y W;  2L4N A;  3A8I E;  3OWE B;  1TKW B;  4X3U A;  3MC0 B;  1GUN A;  2L11 A;  2JA5 B;  2TSS A;  4ZAI A;  4C1N I;  3X3M A;  4CJ2 C;  1XX8 A;  4C3H B;  5EKI A;  5ELE A;  1AP0 A;  1IW7 D;  5E4W C;  2EPB A;  3FVQ A;  5EPL A;  4G4K A;  3PUV A;  3KLS A;  4IAL A;  2EYL A;  5JEA G;  5IGC A;  3BS1 A;  4K5V A;  4XYQ A;  1I4H A;  2NTT A;  2SOB A;  4NMZ A;  2NVQ B;  3H6M A;  2F0S A;  1EYC A;  1ZXT A;  1EY5 A;  3FMC A;  3C3L A;  4KI0 A;  1E2Z A;  2NTS A;  1GHK A;  2LKV A;  1F2Y A;  3K5O A;  3CKI B;  3NWT A;  1BNZ A;  1JIC A;  2F0D A;  1PZJ D;  5I9P A;  4OGQ C;  3GD7 A;  4G7O C;  3GTJ B;  3PMF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...