1HFGA

Nmr solution structure of vmip-ii 1-71 from kaposi's sarcoma-associated herpesvirus (minimized average structure).
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
71
structure length
71
Chain Sequence
LGASWHRPDKCCLGYQKRPLPQVLLSSWYPTSQLCSKPGVIFLTKRGRQVCADKSKDWVKKLMQQLPVTAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VIRAL MACROPHAGE INFLAMMATORY PROTEIN-II
publication title Structure/Function of Human Herpesvirus-8 Mip-II (1-71) and the Antagonist N-Terminal Segment (1-10)
pubmed doi rcsb
molecule tags Chemokine
total genus 10
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2000-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1hfgA00
1IL8A 2RSNA 2HUGA 3IL8A 4X3UA 4ZKBB 1SDFA 3GV3A 3SVMA 1CA6A 1EIHA 1GUWA 3KUPA 4ZK9B 4R8IA 3H91A 1X32A 1SSOA 1QNKA 2MPMA 2B2YA 4XT1B 1C8CA 1VMCA 2B2VA 2HDLA 3D6WA 3KBXA 1KNEA 1NCVA 3I91A 3QO2A 5E4XA 4HCSA 2EPBA 4ZKCB 1O7YA 1PFMA 2CVRA 2K28A 4IURA 2XIWA 4QUCA 2BDNA 1HA6A 1IKLA 2B2UC 3HP3A 1WTWA 1EL0A 1XYIA 5D65A 1ZXTA 4RWSC 1A15A 5DNFA 3ONAB 1IKMA 2DY7A 4X3KA 3R93A 5EKIA 1RTNA 2KEEA 1EQTA 4X3SA 3UI2A 1B3AA 2HCCA 3GV6A 4XDXA 5CMDA 1QE6A 1WTOA 2Q8RE 5COYA 1RTOA 3DEPA 1WD1A 1F9QA 2NZ1D 2B2YC 1XX8A 1HFGA 2B2VC 2L9HA 4R9WA 1J8IA 2EE1A 2RVLA 2MJ8A 1U4RA 2X6LA 1SAPA 1DONA 1DOMA 1TVXA 4U68A 3N52A 2RSOA 1WTRA 4HSVA 1NR2A 5EJWA 1B4OA 1MI2A 2K1BA 2RA4A 4OIJA 1X3QA 2B2WA 3F2UA 3LWEA 2H1EA 2N88A 2N55A 4OIKA 4CJ2C 2J7ZA 1HHVA 2NWGA 2KVMA 2KEDA 2KUMA 1BO0A 2K04A 1HUMA 1PLFA 2KECA 2L12A 1BF4A 5AFWA 5EPKA 1PFNA 1MSGA 4O42A 5D14A 2R3ZA 3MWYW 1U4MA 4HEDA 3I90A 4LMQD 2K01A 4HAEA 1Q3LA 5EPLA 1CM9A 5CBAE 1J9OA 1F9SA 2L1BA 4IUTA 1PDQA 2D9UA 2JYOA 1NR4A 2X6GA 1PFBA 2IL8A 1ESRA 3I3CA 1G91A 1RODA 2B2TA 3DM1A 4CJ1B 5JJZA 1KNAA 2MP1A 2B2WC 1WVLA 4IUUA 4IUQA 1WTQA 3DEOA 3Q6SA 4NW2A 2MGSA 2L4NA 1EIGA 2NYZD 1JE4A 1U4LA 4ZLTF 2B2UA 2HDMA 3P7JA 2X69A 5E4WC 1M8AA 1MSHA 3TN2A 5CBEE 1S4ZA 1ICWA 2EOTA 3IFDA 1RHPA 4X3TA 2VXWA 1B50A 1X3PA 4QUFA 4RA8A 1G2TA 4CJ0B 1HUNA 1CA5A 1F2LA 5EPJA 2KOLA 3FPUB 2Q8TA 5T1IA 1WTXA 1WTVA 1F9RA 3MTSA 2K03A 2DY8A 4MN3A 4RAUC 5EQ0A 2B2TC 2K05A 4IUPA 1ILQA 4MHEA 1B53A 1DOLA 3I8ZA 1B2TA 1DOKA 4ZAIA 5T1GA 4IUVA 5CORA 1E0BA 4DN4M 1WTPA 1BBXC 1EOTA 1ML0D 1U4PA 2JP1A 1LV9A 2FMMA 1WD0A 1F9PA 1RJTA 1HFNA 4UAIA 1JICA 2FINB 1QG7A 1O80A 2M2LA 1ILPA 3FDTA 1VMPA 1AP0A 4XT3B 1O7ZA 1HRJA 3G7LA 2FHTA 2L11A 1NAPA 2FFKB 2HCIA 1MGSA 2SDFA 1AZPA 1BNZA 3TZDA 1DZ1A 1AZQA 1G6ZA 1G2SA 2FJ2A
chains in the Genus database with same CATH superfamily
5IT9c 4DFAA 2BE5C 2K5QA 4IO9A 2BH2A 1H9MA 3DWAA 2NVTH 4ZK9B 1CZGA 1LT6D 3HS0C 4C2MB 4CDFC 2F0GA 1RCVD 1PTOC 3U9SA 3TMEA 2E75C 3D4RA 4B3SL 2A68C 2A6HC 5KNBA 4HJ8A 1WTWA 2Q2HA 2XTIA 1XYIA 4RGMA 1GVPA 5DNFA 3I72A 2DY7A 4YY3L 1SRUA 3GV6A 4L63B 1VQMA 1PH7A 2E2JH 1QNUA 4S3SA 5LL6X 4KHVA 1SYCA 1SE4A 2X6LA 3S2HH 3S1RB 2E2HH 3RZOH 5ELDA 1PYBA 3T1YL 2NBFA 1SYEA 3FRPB 5EJWA 4DK3C 5I6YA 3C46A 1MD2D 1PH6A 1X3QA 2KHIA 1KIXA 4RGTA 2N55A 3PCOB 2JA9A 4RKBA 2F0FA 5J3BA 2C35B 2E8GA 4IOCA 1Q12A 2HQEA 3TS2A 2SEBD 5FOBB 3U58A 2QILA 1I94Q 5EPLA 4A3LH 1BCPC 2AKWB 4A3MB 4RH6A 3A8IE 3GTLH 3S15B 4JI8Q 3CCSA 4QB4A 1SYBA 5FO7B 1EEFD 5HGTA 4Y7NB 1ASZA 3I4NH 2JA7B 3D31A 3PSIA 3SXHA 3GTGH 4QF4A 2WB1B 5BN3A 3F2CA 4LK1C 3P7JA 4LAAA 4ODGA 4A3DB 3MFYA 2F4IA 3CC7A 3CMAA 4M1UB 3NXWA 4NP5A 4MIUA 4CJ0B 1C0AA 4PQXA 3RN2A 4TKOB 4JI4Q 2QKIC 2PI2A 3MTSA 4DAYB 5DM73 5C3EG 3RZDH 2VY3A 1G6PA 4LFAL 1E0BA 1VS0A 3OMGA 5IT9E 1I4QA 3V2TA 2MNAA 1IXRA 3NENA 1UEAB 3EJIA 1XNRQ 4DV6Q 4IJHA 1AEXA 4A3EG 5DLQE 1VMPA 3BU2A 4JI1Q 3S16B 1E1OA 3TZDA 1Q1BA 1HNZQ 4OO1I 1X3EA 2AHOB 2NVQH 1PTOB 3A5UA 3HOUH 1TWFB 1O7IA 3I73A 3S17H 1EYAA 2NUCA 1N36Q 2B2YA 1D7QA 2B2VA 4KKUA 3SK6A 4EVOA 2CVRA 2A74C 3PUWA 4J8QA 2PW7A 2BH8A 1TWGB 1E24A 3CCVA 4FF4A 5K36G 1NTGA 2K7VA 4MNOA 1Y8PB 1BBUA 1IKMA 4JI3Q 2LS01 3H15A 3H6MA 1NBWA 4X3SA 4JOIA 5FLMH 5D3DA 1XX8A 1BQQT 2Z6KC 1IZ6A 4JBWA 4HIMA 4KHZA 4A3CH 1ICFB 2KQ3A 5E3FA 5M5XB 2RSOA 2CCZA 3H3VI 1B4OA 1EY4A 1YEZA 4BA1I 3MXNB 3VR2A 2H1EA 5LMNQ 1TY0A 1WTHA 2EXDA 3CHBD 2QA4A 4A3BH 1HUMA 1NNXA 1BCPB 4LF9L 3BG3A 4LFBQ 1EYCA 1JWUD 3F8TA 3SK4A 4DR1Q 5KNCA 3BS1A 2JYOA 4GZYC 1EYGA 1ESRA 1STGA 3DM1A 3M85A 1I4HA 1CSPA 3MEHA 4G4KA 1HTPA 1AW7A 1UE5A 1FYCA 1EIGA 2I46A 2NYZD 4I65A 5M5YH 5IWAQ 1SE2A 1B50A 1G2TA 2WKDA 1GD7A 1FL0A 1QVGA 1F9RA 3RMHA 3I4NG 1T5XD 2PMZB 3VYRA 1GO3E 4UP8A 4NKLA 1ILQA 4B3TQ 2V1CC 2B8GA 1I6HH 2F3VA 5C3EB 4N9PA 4BBRH 2AQ1B 3M7NA 2PW5A 4UAIA 3Q0AA 2A19A 3GTQH 4FYDA 1FD7D 4PMCA 5G3LF 2SDFA 1MGSA 1VQLA 1DZ1A 4RHSA 2NN6I 2DJGC 3TP7A 3GTPH 2RSNA 5KRUA 1EIFA 3LX0A 4AIMA 4GS3A 3E3XA 3GV3A 2D5DA 5C4ZA 3O13A 4R4OA 3NTKA 4PV1C 1A3TA 2IJ0A 3BVMA 3H0GH 3MA2B 4J15A 4OONA 2AMCB 1NUCA 4DUYL 1TKWB 1PFMA 2NTSA 2IX3A 5IGGA 4G7OC 4Q0FA 3KJOA 2R93B 4JC0A 2EJFC 3DXJC 3HP3A 4K2KA 5D65A 2QEXA 3GTKH 1PRTD 1UAPA 3DWPA 2DNEA 1IBKL 3F2BA 4K5XA 1OO9B 1HR0L 3X3NA 3K80C 1STNA 4IPGA 5C4JH 1E2ZA 3J7ZC 1CZWA 1Q86C 1NSNS 3LNNA 4OX9L 1B3QA 1JJCB 1SAPA 4AYBE 3KLRA 4JYAQ 3HRZC 1GM5A 1RIPA 4HN7A 2UUAL 3PMFA 4A3CG 4H02A 1XMQL 1U4MA 3BVZA 1E3PA 1FNVA 1BUVT 3ULJA 1QVCA 3GO5A 3AB9A 3S2HB 4X6AH 4DR4L 3A5ZB 1PMRA 3RZOB 3NPPA 3K6OA 2E2HB 2UXDL 3I3CA 1S72A 1AH9A 1ENCA 2D0PA 3P1HA 3K5LA 4C1NI 1B1ZA 1DYQA 4NW2A 4KTAA 4JI2Q 3KF6A 3TREA 1YJ9A 1Z6HA 4XXEA 3OMCA 1V1PB 1WFQA 4N8X1 4RA8A 4C56C 1LTSD 1PH4A 4HIDA 4XIGS 4WJWA 4CKBA 3BYTB 2F0HA 1EWHA 5C4XH 2IX0A 4MHEA 1KLGD 3I4MH 1R4QB 2PCFB 1B44D 3I4NB 4DGZA 3M4QA 2IX1A 2FMMA 1E1TA 1HFNA 1JICA 1ILPA 2F0DA 2FHTA 2UU9L 1LABA 4BBSH 2ZTCA 2OCEA 1K73C 3IKJA 2PZWA 1LTLA 3I56A 3NK9A 2SNMA 3KUPA 4BBRG 3D0FA 1VMCA 3BDLA 2HDLA 2B3GA 2MFIA 4DV1L 3M3YB 5EKLA 5C0XJ 3NP8A 3DMUA 1VQDA 1TWHH 2XIWA 4XYQA 3OIPA 1SNCA 1YJNA 2K5HA 4ZUJA 4GNXC 5CMDA 4JBJA 1EQQA 2ZM6L 2A69D 3S17B 3HGBA 4RGNA 1TWCH 2YTVA 4OEMB 1HJPA 4WORA 5A2QL 2K4KA 4ZYSA 4ID6A 4HSVA 3S1RH 4DR7Q 2K5WA 4FF1A 1MI2A 1SLJA 4QL5A 4TSSA 4CJ2C 3QG1A 2I0QA 1GJXA 4O42A 4KLKA 2K52A 2KENA 2NVYH 3CCUA 2O2LD 4LMQD 5C0XH 2MHVA 1Q3LA 5I6WA 5GAGC 4PZ8A 3T16A 1PHJA 1RODA 1G91A 1V1QA 3PO2H 3VR5A 1Z7TA 1IYVA 1Y1WG 4IQZA 4BWGB 1BCPF 1WVLA 4DR6L 3S15H 4ULLA 1CKNB 5CV4A 5JVH3 2V4DA 4IPCA 4YIJA 4ILWA 1Q7YC 1PZKD 4B3RL 1VQJA 4C3JH 1X3PA 4R1JA 4A3DH 3U4VA 4DV3L 1I5FA 3E0JA 3TEHB 5T1IA 3I7FA 1XTDA 1RD9D 1VQPA 2ATWA 1HNWL 5JJIA 1RDPD 5EQ0A 4OHJA 4NPSA 4ZQ3A 3BZCA 1EWCA 1B2TA 1DOKA 4ZAIA 3KK7A 5T1GA 4DV2L 5CORA 3PF5A 1PYWD 2K32A 4GLAC 1F2ZA 1X6OA 2AWOA 1F9PA 1TWAB 4OXPA 1TU2B 1BKBA 5M5YB 1AP0A 4CBVA 3W1GA 4DUZL 1FJGL 4A3IG 3D4WA 5C4XG 4GN3B 1YVCA 3G4SA 4AYBB 2HUGA 1HZAA 1YNJD 3S16H 2UXBQ 1EIHA 1JQYD 4IZ8A 1SE3A 4DXGA 4LF8Q 1PTOH 3D6WA 1I6HB 4BBRB 4FVMA 3A56A 1N33L 4LF7L 3HKZG 4HJ7A 1AE2A 4JVZA 3GTQB 1I4XA 1SYFA 4XQJA 4BBSG 2PQAB 2JQOA 4GNXB 1PH3A 3PIOA 1BDOA 3GTPB 1A62A 3NEMA 3NTHA 3WOFA 4FO2A 1VF7A 2ID0A 4FF3A 1IBML 1LTAD 2L9HA 1R9TH 4DR5Q 1HQRD 1X54A 2RDFA 2MJ8A 3L9AX 2EIFA 4LF4L 4CDDC 2ZXOA 4RKLA 3N52A 1WTRA 4POGA 2B29A 4RMFA 3NBHA 1H9SA 3GTKB 1N32L 4JV5L 1CSQA 2G5DA 2I07B 3HOVH 1SJHD 1XMOQ 1WCMG 1VQKA 4AH6A 5C4JB 4QQBX 5BN4A 4Y52H 5C44H 2VNUD 5AJ3L 3TS0A 4YHHL 5C6AA 1NR4A 1VQ7A 2VQEL 1VQAA 3QOJA 1H9KA 3X3MA 3AMUA 3S2DH 1QCBD 2XRQD 1XPRA 1SYDA 4IUQA 3E5SA 1KQSA 2A69C 5C0XG 1Y1WB 3TN2A 3OYYA 4LFCL 2Z6BA 2Q2TA 1MSHA 1S4ZA 2IY5B 1VQ6A 2XRSD 2KOLA 4DR2L 3PO2G 2Q8TA 4PMBA 4KHPL 2DY8A 4P2CB 3Q23A 3M9BA 3PV0A 4XYOA 2B2TC 4EQ5A 2XVSA 5IP9G 5I2YA 2EY1A 1XPOA 1HXYD 4DN4M 4GN5A 1ML0D 4ZCKA 5J1ZA 1WD0A 4C3JG 4JI0Q 2R61A 1CK1A 1QG7A 4KK7A 4P73A 4KJOA 1FGBD 5EGTA 2NZOA 4DAPA 2L11A 2F0JA 3WWVA 1G6ZA 1A63A 3K58A 3IL8A 1STAA 1ENAA 1LTID 4A3EH 5C4XB 2EVBA 1SSOA 3A8JE 5IY0A 1JE5A 1S5DD 2O4XA 4LF6L 2PNRC 1O7YA 2PYKA 4X66Q 4ABNA 1D1KA 3TZUA 3RUZA 1VQ5A 1DD2A 2XWJB 2F0OA 1QWYA 3HKZB 1STYA 2F0MA 5I9OA 4BBSB 1RTNA 4DXFA 1NMFA 3MFGA 1DXMA 2B63H 2Q8RE 1EEID 2Z9HA 3DEPA 1Q81C 1F9QA 4FXDA 5K36H 2O5IC 3U4ZA 1VDZA 4HIOA 2OT2A 4JBKA 2E76C 1TVXA 1OXSC 1XNQQ 1YHBA 1TWHB 3A74A 2E2DC 1Y1VH 3E9HA 2EZVA 3UDGA 3PIPA 1YNJC 4C1NK 1IYJB 2PMZE 1JR0D 1JWMD 1K83H 1Q8IA 1YZ6A 3QJYA 1TWCB 3E6ZX 1WCMB 1BXTA 4NXMQ 1JOOA 5CV8A 3RLOA 1GHJA 2D9UA 4QGUA 3KYHC 3K5MA 2XNAC 2DN8A 3UDXA 3HOVG 2HD3A 2B2WC 4IUUA 4IALA 1WTQA 4OELB 5H1SE 2L4NA 3CCMA 5C44G 4R4IA 1Q1EA 2KCMA 4JCVE 3KFUA 4K0KQ 2NVYB 1I3QH 1DJRD 1CA5A 5CGKA 4PZ7A 5CC4A 5LL6S 3OTOQ 1I4GA 3TDQA 1Q46A 4DV6L 3KOJA 1UE6A 3PO2B 4HJ5A 5ELBA 3VR3A 3JAML 2OTJA 3J80L 1HNZL 1LV9A 1K8AC 1L0XB 1R4PB 2FINB 2M2LA 3T4AC 1B9MA 1X65A 2JA8H 4NB3A 1HQMC 1WOCA 4C3JB 4H13C 1N36L 3AYHB 4B3SQ 5ELCA 2BCOA 2OXPA 3WOEA 3SVMA 1L0YB 2RBMA 2E5LL 1OTCA 3J81E 2QEJC 4K5WA 3STBD 3NE5B 3NQIA 4JI3L 1OXTA 4JI6L 1JWSD 1FNUA 3G6EA 3CPWA 3M3YH 3BZDB 4HMIA 1HZBA 3SE0A 3I70A 4IUNA 4PMWA 2HQLA 2Q2IA 3NSWA 5IGCA 3CXCA 3T1YQ 2JA5H 4FF2A 2DNCA 3DLLA 1SMXA 2Z0SA 2N3SA 1A3UA 1WTOA 1S40A 3ND8A 2DGYA 2OQKA 4B9WA 3FPPA 5EBDA 4YCUA 4KD4A 5LMNL 1G51A 2F4VQ 3E0EA 1WYDA 1DOMA 5A2QE 4JI5L 4LFBL 4Z9CB 4DR1L 2B63G 2NWGA 1VQ4A 2KUMA 4DNTB 2IHEA 1VQ9A 3KF8B 4HEDA 5FK9C 1LT5D 1R9TB 3E9IA 1XJVA 1Y1VG 2LKVA 1J9OA 1D2BA 4H7BA 3W5OA 5JJLA 4NXNQ 4DU9A 4DAYA 2VQFQ 3G48A 2YYZA 2EQSA 5L37A 2MGSA 3S9WA 4J1MA 2JJQA 4P72A 3I55A 3HOVB 3S1NH 1LT3D 3I4OA 2H4OA 5C44B 2I5HA 1KD1C 3M7GA 3FPUB 1F77A 2L55A 2R6GA 4FNFA 3NUCA 2HHHL 1QVFA 4HJAA 1LTBD 4MN3A 1K0SA 2PZUA 4E6IA 3S2DB 4CGYB 4A3KH 3FHWA 2UUCL 3D6CA 3W1BA 5E1FA 2AWNA 3R3OA 4RCOA 5CV5A 1RJTA 2BA1A 2ES2A 4FXKC 2EY5A 1EFWA 1VF5C 4X62L 1TWAH 1D5MC 2QF7A 1BNZA 1AZPA 4R4QA 1EIYB 4U673 2KCTA 2A8VA 1C48A 1GUOA 4X3UA 4BY7G 4KMUC 3Q24A 2EXZA 1B70B 4R8IA 3G6JB 1N34L 3CU7A 1HA5A 1JJGA 1V8QA 3RN5A 2JA8G 1KNEA 3I91A 2VUMH 3H94A 4HCSA 4CDEC 2RF4A 3B6YA 2Z8LA 4IURA 3L2PA 2JK8A 4ZUIA 4IFDJ 1VQFA 1O7LA 2XN9C 4X64Q 3PO3H 3CCEA 3MXNA 4KD3A 4A3EB 4GKKL 1TY2A 1LTTD 5TSSA 1EY8A 4JYAL 2Z4HA 5KIXA 2FMCA 2DUDA 2QDLA 4KN4C 5I9PA 2JA5G 1ONLA 1MKHA 4OIJA 1S5BD 1UE7A 4R4TA 4V0BA 1SYGA 1ESFA 1N9WA 4Q5VA 4AQYQ 4EGVA 4HTHA 4L5TA 4G7ZC 2B63B 5FLXL 1YIJA 4BS9A 4F88A 1EY0A 2RKSA 4JI7Q 1PH9A 3L3OC 2F0KA 2AQ2B 5ISRA 4BXXH 1KAAA 3GTJH 4IUTA 5FJ8G 4IFDH 2KJXA 4K5VA 4DKAC 1TR5A 1Y1VB 2MP1A 1IBLL 5M3FG 3M4OB 2F0VA 3SK8A 1JE4A 1E2VA 4RHRA 4GKJQ 1HNXL 4G7HC 1M8AA 1K83B 1U0LA 1Y1WH 3J81i 3HZXA 3KDFB 2BDOA 3NTIA 1WTXA 1G291 4P75A 2K03A 1Q82C 1RKNA 3PQIA 2WACA 3U9OA 5IIFA 2IT1A 2R7ZG 4DV0Q 1PFSA 3T51B 3TP8A 5C5MA 4QIWE 3K8AA 4DUYQ 1J5EQ 2UUBL 1S5ED 1I3QB 3AFQA 2QGQA 3UDFA 1G2SA 3FEWX 4QUFA 4A3KG 2NB0A 1GUWA 1SNMA 3J80c 3Q22A 4K6LA 1SNOA 4MTKA 4BY7B 1LUZA 1IBKQ 3UDIA 2ALYB 2MPMA 1L0WA 1FR3A 3OHXC 4A3IH 1GXDC 2BOSA 3AFPA 2Z6KA 1VQGA 4ZKCB 1DGSA 2BDNA 2JA8B 2M9VA 1LTGD 4OO1G 4A3GG 3C1EA 4LUZA 1A15A 1KHIA 5J39A 1QZHA 5G3LD 5C0XI 5EKIA 2VUMG 2ASBA 1QE6A 3OOCA 1KABA 1PH8A 4DR7L 1V1OA 5JPMC 3CKIB 3J81L 4HMJA 2UUAQ 2RVLA 4EQPA 5IGDA 2ZJPA 1UNSA 3C3LA 3PO3G 2KHSA 1PTOF 2JA5B 1HHVA 2OTLA 2WIIB 1YNXA 4KY5A 3A7AB 3C1FA 1KDBA 3A54A 3UE1A 2R3ZA 1I6VC 3KBGA 2QDBA 1LTRD 4DK0A 4H0LC 3BYYB 1WCMH 1V1PA 3EN2A 5LMUL 2KBNA 4DAMA 1SE8A 2A73B 2CFMA 3CAMA 3HOZH 5A35A 4LW1A 3PIO3 1YHQA 2JEBI 3GD7A 4O1NA 5M3FB 3H3VC 3AU7A 3N6RA 3L7ZC 4BXXG 2L15A 4NDXA 3QR8A 4IFDG 4IJLA 4DF7A 4DV7L 1HZ9A 1EQVA 3CP0A 1WTVA 5HY6A 1SFOH 1SEBD 1HTLD 3VYUA 2NVXH 3HKZE 2F0QA 4KY6A 1PRTC 4JBMA 3GTMH 1VQHA 1QUQB 1SR3A 1KXLA 4DV5L 2K50A 5CV9A 3JAME 3J80E 2WKCA 4XQQA 2Z1CA 2F1MA 2UXBL 3S1NB 1Z47A 5KGUA 2R7ZB 1C9OA 1JB3A 1VQBA 5IP9H 5FO9B 1HZCA 4GLVB 1RF2D 2K33A 4LF8L 3JC66 4JG2A 3PUYA 3F2DA 3VR4A 2FJ2A 1YBYA 2HIVA 1EU4A 1SDFA 4UPAA 2SOBA 4YWLA 1KRTA 4A3KB 1QNKA 1C8CA 4MZ9A 3GDEA 3D3RA 2TSSA 3NHHA 1ZXTA 4DPGA 4DR5L 1YNND 2Y0SE 1FGUA 3R93A 1STEA 3UI2A 1B3AA 4XDXA 1QZGA 3BJUA 3HEJA 3ER0A 1WI5A 3T13A 5GROA 3CCRA 3NELA 3TQYA 1J8IA 2VUMB 1B8AA 1EUJA 1XMOL 1DONA 4U68A 1CI3M 4B9XA 4DR3Q 1NR2A 3G71A 2GN5A 4RCNA 3CW2C 1PH1A 1EWIA 1MBYA 2CW0D 3EQLC 4OIKA 3S14H 2J7ZA 1QUQA 1PVOA 3MC0B 1JMCA 1NY4A 2A68D 2A6HD 1UUPA 1O78A 3FKIH 3GQBA 3PO3B 4R8NA 1PFNA 2GVAA 2ICIA 4GOPB 2J4XA 1CKNA 4QIWB 2E2IB 1CUKA 1K3BC 5M3MH 1TS2A 1K3RA 5JPNC 3OW2A 4B3RQ 2X6GA 4BA2I 3S1QH 3HKSA 1DCZA 5JJZA 3NQTA 1KNAA 2VW9A 1HNWQ 3AQQA 1A3VA 1UEBA 5BR8Q 2LSSA 2XGTA 5CBEE 5NUCA 1B9NA 4X65L 1VQCA 5EPJA 2Y0SG 1KTKA 2EJMA 2AUJD 3GTJB 4JI0L 1XPUA 3HOZG 2M00A 1PRTB 1VCIA 3I2ZA 1FJGQ 4KJNA 2UXCL 1QJOA 4IUVA 2EY6A 1UWVA 4WRDA 5GAHC 3URYA 4FDBA 1YJWA 4YCVA 4F87A 2HT1A 4C3IH 1JOQA 2G9DA 3A8KE 4EQNA 1D5ZC 3G7LA 2KCNA 5BN5A 4A76A 1X3GA 3T1HQ 1GKHA 4ZKBB 3PGZA 2PQAA 3DM3A 4CHTB 2P5ZX 4GNXA 3MXPA 4PNYA 4YWMA 4X66L 1KAWA 4BY1H 4KV6A 2CHBD 4LUOA 3KBXA 2JXMB 4OL7A 4LF5Q 5JVG3 4EQOA 4QUCA 1GUGA 5ELNA 2EJGC 5ELOA 3AEVA 4ME5A 3NBIA 4LF4Q 3ONAB 3OWFA 3BDCA 1JT8A 1V43A 1HPCA 2C9OA 3ND9A 1HH2P 1STBA 3IRBA 1L2FA 3KJPA 3SEBA 4JV5Q 2CH4W 5IYBH 1I4RA 2B2YC 2RCFA 2B2VC 2ZJRA 4A3IB 2VL6A 3V96A 1EY6A 5ELFA 3SGIA 5DM63 2ZXPA 4RGOS 4B3MQ 4YHHQ 3CQZH 2K1BA 1IYUA 1OXVA 3MZ5A 1RL2A 3LWEA 3Q8DA 1A2UA 2VQEQ 4NXML 1TXYA 3J81c 4UY8C 1HR0W 3KLWA 4JOIC 5IYCH 5FLXE 2K01A 5JEAJ 5IP7G 2F0IA 4LFCQ 3SR1A 2F52A 3JAMi 3J80i 2IL8A 2JN4A 4OWTB 1YNNC 2GVBA 1M1KC 3FKIG 1CTMA 3EFXD 4KHPQ 1JCKB 4GN4B 3S24A 3W3AA 3M4OH 1I94L 3T56B 4R4CA 4ZLTF 1W2BA 4HR7B 3CMEA 5M3MG 5M5WH 3IFDA 3MXGA 3TP5A 2EY2A 4XQNA 4JI8L 2G9HD 3RD4A 3HOXH 2F0WA 1BVSA 2N8NA 5HURA 2K05A 1CQFA 2D62A 2CW0C 3I8ZA 2Y0SB 2OQ0A 3LGJA 3QIAA 2WAQE 5EBCA 2L0CA 1GOZA 3HOZB 3J7YW 4G57A 4CKEA 3HOYH 4KKSA 4P71A 3CPFA 1FVIA 5JEAH 4JI4L 4XT3B 5EAYA 4DV4Q 1YITA 1LYLA 4JW0A 4LF6Q 1X9NA 4IPDA 4O0AA 1KC8C 1Q90A 2F0EA 1YI2A 5IGBA 1SFOB 1CA6A 2NVXB 5I4DA 5C3XA 1U5KA 2F3IA 3H91A 1XNRL 4YCWA 4C3IG 3GTMB 3K57A 3QO2A 4BY7H 1XXGA 1X3FA 5E4XA 2EPBA 4JI1L 1QB5D 2QCPX 3KLSX 2JA6H 2B2UC 3CCJA 4BY1G 1UE1A 2ZXRA 2R7DA 5GAEC 3ULPA 2F4VL 1LACA 4UDUC 2YV5A 2GA4B 3M4YA 5COYA 4RFBA 1CKMA 3IAYA 2RQXA 1VQEA 2K5DA 2PO4A 4A3FH 4YY3Q 5IYDH 1MIUA 4PZ6A 1T5EA 2R92H 5JOBA 1II3A 1ET9A 2KHJA 2WAQG 1M90C 1K9MC 2I5MX 5IYBG 2KEDA 2KECA 1NMGA 2MUYA 4KKTA 1CT1D 4NXNL 3R2IA 1LT4D 4L6TB 2VQFL 1ASYA 2ENBA 5M9OA 4JPBW 3QB3A 1CQVA 4FP5D 2B2TA 3T53B 3OPOA 5KNDA 5JAVA 4POFA 2MO1A 3S14B 4WJ3M 5LHY1 5IYCG 4I7AA 5FJ8H 3K7UC 1EOVA 2TMPA 3FKIB 1SROA 4XTCS 3C2PA 3VDYA 1ICWA 1TT2A 5CYUA 5M3FH 2CWAA 4I7ZC 1TS5A 5M3MB 2A6ED 4TRDA 3GTOH 4RAUC 3S1QB 2R93G 4L8JA 1YHAA 3FMCA 3TP6A 3HFZB 1WTPA 5IWAL 1BBXC 5KYIA 4ME3A 1EZ6A 2XWBB 2E5LQ 3RLFA 4LUVA 2D0OA 1PRTF 3FDTA 3HOXG 1JJ2A 2O5JC 1X55A 2LFNA 4LFAQ 2R7ZH 4JI6Q 4APVA 2EYOA 3CC2A 1EQRA 4B3TL 2K14A 1IL8A 3MEFA 1K28A 1KDCA 3CD6A 2K6AA 3HOYG 1A6XA 1S5FD 1X32A 2I5LX 3P20A 1AE3A 1EZ8A 5IGFA 3TBIB 3VYTA 2LY7A 5JEAG 2PPBC 1NCVA 1EU3A 3MVVA 1BBWA 2CQAA 1E22A 4X64L 2JSOA 4C3IB 2F0TA 3PUXA 1HA6A 3CCLA 4QCLA 1QILA 5I2XA 1EL0A 1C7YA 3PF4A 4CKCA 3K81C 3K7AH 3K0XA 4JI5Q 4F7XA 2HCCA 1VQIA 2PZTA 4BY1B 4OO1H 4A3GH 1V9PA 2NZ1D 4IFDI 1MHWC 2IHFA 4R9WA 4P74A 2JA6G 1Z9FA 5FO8B 4AQYL 3KF8A 3DWQA 3OW7A 4PG3A 4JK1C 4JI7L 2B2WA 2QW7A 3SK5A 5EKKA 5IOCA 2KVMA 2WV6D 1NJIC 4A3LG 1F2MA 2WAQB 4A3FG 2YTXA 5IYDG 5D14A 5D3IB 2A5HA 3MWYW 1ZYRD 5CR3A 2R92G 1D5XC 4M8AA 2CH4A 1W3SA 2IW3A 4OGQC 5CBAE 2E2IH 1PDQA 2YU9H 4GKJL 4DNIA 1IW7D 3H09A 4CJ1B 3CQZB 4LF9Q 2DJFC 1GHKA 1HCZA 2BA0A 1GUNA 3D4DA 2HHHQ 1JB7A 4A93H 1TQOA 4ZRZA 3H3VH 5IGEA 1Y69U 2B2UA 3RR5A 2UUCQ 4C3HH 2EOTA 2ZTEA 4DV0L 2F0LA 3STBC 1PA6A 2H5XA 1SN8A 1Y8NB 1N8RC 1U9RA 4X62Q 1DM0B 3J81j 1IHZA 4HJ9A 1CHQD 3R8BA 4JI2L 1J5EL 3KF6B 4EX5A 4RG1A 3PUVA 1C4QA 2AQ3B 1EOTA 4K8IA 5GQOA 3DHQA 3K59A 3PUZA 1N34Q 2K75A 1XTCD 5M5WB 4K14A 1PZJD 1W6JA 3VYSA 1EYDA 4HSPA 3HOUG 2VB2X 3I4LA 3FVQA 2NVTB 3ULLA 3HOXB 2PNHA 1K8GA 4WJ4A 3J7AV 2HIXA 4L5RC 3HOYB 4GKKQ 1CFMA 4K2LA 3L0OA 1IKLA 3K0YA 1PYSB 1M4VA 5CV7A 2F0NA 5FLMG 4V190 2A6EC 2F0PA 1OXUA 4RWSC 1TIID 4X3KA 3HOWH 2E2JB 3K5NA 3CCQA 1JOKA 1EY7A 1H95A 3S1MH 2KA7A 2NN6H 3UE0A 3JAMc 2VS1A 1K8MA 4DA2A 1EY5A 1U4RA 4A3JH 4A3BG 3RLNA 3OSOA 4QMGA 3A55A 1HR0Q 5ELEA 1E2WA 5KYLA 2VZAA 2JA6B 5JJKA 2OF1A 1I50H 1TS4A 4LWCA 4DAVA 2IPKD 2N88A 4OX9Q 4QJFA 1QOHA 2K04A 2L12A 1BF4A 1IBLQ 5AFWA 5EPKA 1I4PA 2EYLA 3A7LA 4QY7A 4A3FB 1D1IA 4GLXA 1HNXQ 3GTLB 3K5OA 2RHSB 3ERSX 2L5TA 3KDFA 2R92B 1JORA 1XMQQ 3GTGB 3P75A 4DK6C 1A2TA 4DR4Q 4AYBG 1U4LA 1IL2A 2UXDQ 2HDMA 1PH5A 5E4WC 1AFPA 2VB3X 1RHPA 5IODA 1EFID 1KDAA 1HUNA 1Y8OB 2F0SA 1STHA 1CHPD 3RZDB 2UUBQ 3J7A5 2CKZB 4GOPC 4A93G 5GADC 1A8VA 4KN7C 5IT9L 1VQ8A 4C2MH 3TRZA 1PZID 1MJCA 4C3HG 1U4PA 1ZYRC 1L1OC 2SNSA 3U50C 4N9TA 3EA6A 2EDGA 2KCCA 3KLSA 1HRJA 3H0GG 2HCIA 2C5CA 2NVQB 2F03A 2WP8J 5KEEA 1IW7C 1G8ZD 3HOUB 4IPHA 3CF5A 3GTOB 3V05A 4N8FA 3R2TA 1FNWA 4LNQA 2B8FA 2UU9Q 2NZHA 2F0UA 2K28A 5C5LA 2AUKA 3WDNA 3NWTA 1S5CD 4DV1Q 3CC4A 3A0JA 5E7NA 4K8JA 4OWWB 4DR3L 1RTOA 3ZYYX 1SNQA 2E74C 1MJEA 1P16A 4O2DA 2EE1A 2RDGA 1BR9A 1K0RA 1SXTA 4A3MH 2ZJQA 4H44C 2ICEC 1S3OA 3DUZA 2ZM6Q 3BZKA 3HOWG 2RA4A 2RHQB 3FP9A 4A3BB 5LMUQ 4Y7NH 1Q8KA 4L5QA 2JA7H 2NN6G 1SNPA 3K7AB 1BO0A 1SBBB 1PLFA 3OIQA 1MSGA 4ALPA 4A3JG 4A3GB 1Y14B 1PV4A 4HAEA 4UHVA 5LMNW 1SMYD 2EYPA 4KI0A 3MHBA 1CM9A 4F8MA 5BR8L 2D2CC 3VA5A 1KLUD 3NBHB 1H9SB 2PI2E 4TVAB 2WINB 4DV7Q 2BE5D 2K5VA 5IP7H 3Q6SA 1SJED 2XSCA 3BDOA 1K8OA 1A0IA 1PTOD 2R7FA 2X69A 2F3WA 2VXWA 4DV5Q 1XWEA 3I4MG 4DR6Q 4K6DA 1F2LA 4FXGC 3IFTA 2A1AA 1PXUA 2YU9B 3ZJYC 5C4HA 2CQOA 4HCEA 3TSSA 1TWFH 5IE8A 4A4IA 1L1OB 4TQUS 4DNRB 4DV3Q 3T1HL 2RCNA 3ICEA 4A93B 1SNDA 5DAUA 1PH2A 3CRLC 4L5SA 3F1ZA 1X56A 5HGQA 4C3HB 1TWGH 5FLXc 1O7ZA 4NMZA 4DV2Q 1NAPA 2MO0A 1AZQA 2LMCB 1JC7A 2B39A 5FKAC 2EYFA 2WFWA 3H0GB 4LF5L 4A75A 1KL9A 2WB1E 4YWKA 1F2YA 3VR6A 4XT1B 4DUZQ 3NWSA 3RNUA 2Z4IA 1OXXK 2J0TD 3ITPA 4LJZC 2N78A 1B7YB 3PIP3 3MAQA 5M5XH 2FXQA 1BCPD 3MXUA 5C3WA 2PQEA 3VA7A 4CDCC 4B08A 1WJJA 1P8LA 1T9HA 1ZEQX 4HIKA 2K5NA 1N33Q 2KEEA 4LF7Q 1EQTA 3EBEA 5K5PA 2IWHA 2EYHA 2OWOA 4B3ML 3M4PA 1WD1A 2RDHA 2ZT9C 1HFGA 3J7AF 4J6HA 4GOPA 1KRSA 3EROA 2CWPA 4IOAA 1EY9A 3BVGA 3QOLA 2LXKA 2JEAI 1IBMQ 3F2UA 1LO5D 4UP9A 3D8GA 1L1OA 5J22A 3HOWB 3GP7A 3SHLA 3S1MB 3I90A 4A3MG 1XNQL 3EVQA 3W2DA 1N32Q 1NE3A 4IN3A 4A3JB 1D8LA 1F9SA 2L1BA 3ERQA 5DEHA 4OWXB 3SDZA 4MTNA 1PFBA 2JA7G 1GUSA 4X65Q 1ET6A 1CKOA 2WB1G 1LLRD 1GUTA 1H9RA 1I50B 4A3DG 1ENFA 5AJ3Q 5C3EH 3DEOA 3EIVA 4DK1A 1J6QA 2UXCQ 5F2DA 2Q2UA 2N49A 1H9JA 1VQNA 1D6EC 4X3TA 3QWNA 1BOSA 2NTTA 1VQOA 3LWUA 5CV6A 3CRKC 3I4MB 2ZTDA 3HG9A 1AN8A 4WFN3 4IUPA 2OEOA 2YTYA 1B53A 1DOLA 4DV4L 1TS3A 1ZKOA 2EYJA 2JE6I 1LM0A 1W6KA 4DR2Q 4K0KL 2JP1A 4UP7A 3OWEB 2LXJA 1O80A 2R93H 4KY7A 2Q8IB 2MQHA 1SMYC 3OTOL 2EYMA 1E7ZA 2FFKB
chains in the Genus database with same CATH topology
4DFAA 2BE5C 2K5QA 1H9MA 3DWAA 4ZK9B 1CZGA 1LT6D 3HS0C 4C2MB 2F0GA 1RCVD 1PTOC 3U9SA 3TMEA 2E75C 3D4RA 2A68C 2A6HC 5KNBA 1WTWA 1XYIA 4RGMA 5DNFA 3I72A 2DY7A 3GV6A 4L63B 1QNUA 4S3SA 5LL6X 4KHVA 1SYCA 1SE4A 2X6LA 3S1RB 5ELDA 2NBFA 1SYEA 3FRPB 5EJWA 5I6YA 3C46A 1MD2D 1X3QA 4RGTA 2N55A 4RKBA 2F0FA 1Q12A 2HQEA 2SEBD 5FOBB 2QILA 5EPLA 1BCPC 4A3MB 4RH6A 3A8IE 3S15B 4QB4A 1SYBA 5FO7B 1EEFD 5HGTA 4Y7NB 2JA7B 3D31A 3SXHA 4QF4A 2WB1B 5BN3A 4LK1C 3P7JA 4LAAA 4ODGA 4A3DB 3MFYA 2F4IA 4M1UB 3NXWA 4NP5A 4MIUA 4CJ0B 4PQXA 4TKOB 2QKIC 3MTSA 5DM73 1E0BA 3OMGA 5IT9E 1I4QA 3V2TA 1UEAB 3EJIA 1AEXA 1VMPA 3S16B 3TZDA 1Q1BA 4OO1I 1PTOB 1TWFB 3I73A 1EYAA 2NUCA 2B2YA 2B2VA 4KKUA 3SK6A 4EVOA 2CVRA 2A74C 3PUWA 4J8QA 2PW7A 1TWGB 4FF4A 5K36G 2K7VA 1Y8PB 1IKMA 2LS01 3H6MA 4X3SA 5D3DA 1XX8A 1BQQT 4JBWA 4KHZA 2KQ3A 5E3FA 5M5XB 2RSOA 1B4OA 1EY4A 4BA1I 3VR2A 2H1EA 1TY0A 3CHBD 1HUMA 1BCPB 3BG3A 1EYCA 1JWUD 3SK4A 5KNCA 3BS1A 2JYOA 4GZYC 1ESRA 1STGA 3DM1A 3M85A 1I4HA 3MEHA 4G4KA 1HTPA 1AW7A 1FYCA 1EIGA 2I46A 2NYZD 4I65A 1SE2A 1B50A 1G2TA 2WKDA 1F9RA 3RMHA 1T5XD 2PMZB 3VYRA 4NKLA 1ILQA 2B8GA 2F3VA 5C3EB 4N9PA 2AQ1B 3M7NA 2PW5A 4UAIA 3Q0AA 4FYDA 1FD7D 4PMCA 5G3LF 2SDFA 1MGSA 1DZ1A 4RHSA 2NN6I 3TP7A 2RSNA 5KRUA 3LX0A 3GV3A 2D5DA 5C4ZA 3O13A 3NTKA 4PV1C 1A3TA 2IJ0A 3BVMA 3MA2B 1NUCA 1TKWB 1PFMA 2NTSA 2IX3A 5IGGA 4G7OC 4Q0FA 2R93B 2EJFC 3DXJC 3HP3A 4K2KA 5D65A 1PRTD 1UAPA 3DWPA 2DNEA 4K5XA 1OO9B 3X3NA 1STNA 1E2ZA 1CZWA 1NSNS 3LNNA 1SAPA 3KLRA 3HRZC 4HN7A 3PMFA 1U4MA 3BVZA 1FNVA 1BUVT 3GO5A 3AB9A 3S2HB 1PMRA 3RZOB 3NPPA 3K6OA 2E2HB 3I3CA 1ENCA 3P1HA 3K5LA 4C1NI 1B1ZA 1DYQA 4NW2A 4KTAA 1Z6HA 4XXEA 3OMCA 1V1PB 4RA8A 4C56C 1LTSD 4XIGS 4WJWA 4CKBA 3BYTB 2F0HA 1EWHA 2IX0A 4MHEA 1KLGD 1R4QB 2PCFB 1B44D 3I4NB 4DGZA 2IX1A 2FMMA 1HFNA 1JICA 1ILPA 2F0DA 2FHTA 1LABA 3IKJA 2PZWA 3NK9A 2SNMA 3KUPA 1VMCA 3BDLA 2HDLA 3M3YB 5EKLA 5C0XJ 3NP8A 3DMUA 2XIWA 4XYQA 3OIPA 1SNCA 4ZUJA 5CMDA 2A69D 3S17B 3HGBA 4RGNA 4WORA 5A2QL 4ZYSA 4ID6A 4HSVA 2K5WA 4FF1A 1MI2A 4TSSA 4CJ2C 3QG1A 1GJXA 4O42A 2O2LD 4LMQD 5C0XH 2MHVA 1Q3LA 5I6WA 3T16A 1G91A 1RODA 3VR5A 1Z7TA 1IYVA 4IQZA 4BWGB 1BCPF 1WVLA 4ULLA 5CV4A 5JVH3 2V4DA 4YIJA 4ILWA 1PZKD 1X3PA 3E0JA 5T1IA 1RD9D 1RDPD 5EQ0A 4OHJA 4ZQ3A 1B2TA 1EWCA 1DOKA 4ZAIA 3KK7A 5T1GA 5CORA 1PYWD 2K32A 1F2ZA 2AWOA 1F9PA 1TWAB 1TU2B 5M5YB 1AP0A 4CBVA 3D4WA 4AYBB 2HUGA 1YNJD 1EIHA 1JQYD 4IZ8A 1SE3A 4DXGA 1PTOH 3D6WA 1I6HB 4BBRB 4FVMA 3A56A 3GTQB 1I4XA 1SYFA 4XQJA 1BDOA 3GTPB 3NTHA 3WOFA 4FO2A 1VF7A 2ID0A 4FF3A 1LTAD 2L9HA 1HQRD 2RDFA 2MJ8A 3L9AX 2ZXOA 4RKLA 3N52A 1WTRA 3NBHA 1H9SA 3GTKB 2I07B 1SJHD 5C4JB 5BN4A 2VNUD 5C6AA 1NR4A 3QOJA 1H9KA 3X3MA 3AMUA 1QCBD 2XRQD 1SYDA 4IUQA 3E5SA 2A69C 5C0XG 1Y1WB 3TN2A 1MSHA 1S4ZA 2XRSD 2KOLA 2Q8TA 4PMBA 2DY8A 4P2CB 3Q23A 4XYOA 3PV0A 2B2TC 2XVSA 5I2YA 2EY1A 1HXYD 4DN4M 1ML0D 5J1ZA 1WD0A 4C3JG 2R61A 1CK1A 1QG7A 4KK7A 4KJOA 1FGBD 5EGTA 4DAPA 2L11A 2F0JA 1G6ZA 3K58A 3IL8A 1STAA 1ENAA 1LTID 5C4XB 2EVBA 1SSOA 3A8JE 1S5DD 2O4XA 2PNRC 1O7YA 2PYKA 4ABNA 1D1KA 3TZUA 3RUZA 1DD2A 2F0OA 2XWJB 1QWYA 3HKZB 1STYA 2F0MA 5I9OA 4BBSB 1RTNA 4DXFA 3MFGA 1DXMA 2Q8RE 1EEID 3DEPA 5K36H 1F9QA 4FXDA 2O5IC 1VDZA 2OT2A 2E76C 1TVXA 1OXSC 1TWHB 2E2DC 2EZVA 1YNJC 4C1NK 1JR0D 1JWMD 1Q8IA 3QJYA 1TWCB 3E6ZX 1WCMB 1BXTA 1JOOA 5CV8A 1GHJA 2D9UA 3K5MA 2XNAC 2DN8A 2B2WC 4IUUA 4IALA 1WTQA 2L4NA 1Q1EA 2NVYB 1DJRD 1CA5A 5CGKA 5CC4A 5LL6S 1I4GA 3TDQA 3PO2B 5ELBA 3VR3A 3JAML 3J80L 1LV9A 1L0XB 1R4PB 2FINB 2M2LA 3T4AC 1B9MA 1HQMC 4C3JB 4H13C 5ELCA 2BCOA 2OXPA 3WOEA 3SVMA 1L0YB 2RBMA 3J81E 2QEJC 4K5WA 3NE5B 3NQIA 1OXTA 1JWSD 1FNUA 3BZDB 4HMIA 3SE0A 3I70A 4IUNA 4PMWA 3NSWA 5IGCA 4FF2A 2DNCA 1WTOA 1A3UA 3ND8A 4B9WA 3FPPA 5EBDA 4KD4A 1DOMA 5A2QE 4Z9CB 2NWGA 2KUMA 4DNTB 4HEDA 5FK9C 1LT5D 1R9TB 2LKVA 1J9OA 1D2BA 4H7BA 4DU9A 4DAYA 2YYZA 2MGSA 3S9WA 4J1MA 3HOVB 1LT3D 2H4OA 5C44B 3M7GA 3FPUB 1F77A 2L55A 2R6GA 4FNFA 3NUCA 1LTBD 4MN3A 2PZUA 4E6IA 3S2DB 4CGYB 3D6CA 5E1FA 2AWNA 3R3OA 4RCOA 5CV5A 1RJTA 2BA1A 4FXKC 2EY5A 1VF5C 1D5MC 2QF7A 1BNZA 1AZPA 4U673 1C48A 1GUOA 4X3UA 4KMUC 3Q24A 2EXZA 4R8IA 3G6JB 3CU7A 1HA5A 1V8QA 1KNEA 3I91A 3H94A 4HCSA 2Z8LA 4IURA 4ZUIA 4IFDJ 1O7LA 2XN9C 3MXNA 4KD3A 4A3EB 1TY2A 1LTTD 5TSSA 1EY8A 2Z4HA 5KIXA 2FMCA 4KN4C 5I9PA 1ONLA 4OIJA 1S5BD 4V0BA 1SYGA 1ESFA 4Q5VA 4EGVA 4HTHA 4G7ZC 2B63B 5FLXL 4BS9A 4F88A 1EY0A 2RKSA 3L3OC 2F0KA 2AQ2B 5ISRA 1KAAA 4IUTA 4IFDH 4K5VA 2KJXA 1TR5A 1Y1VB 2MP1A 3M4OB 2F0VA 3SK8A 1JE4A 1E2VA 4RHRA 4G7HC 1M8AA 1K83B 3HZXA 2BDOA 3NTIA 1WTXA 1G291 2K03A 1RKNA 2WACA 3U9OA 5IIFA 2IT1A 3T51B 3TP8A 5C5MA 1S5ED 1I3QB 1G2SA 3FEWX 4QUFA 2NB0A 1GUWA 1SNMA 3Q22A 4K6LA 1SNOA 4BY7B 2MPMA 1FR3A 3OHXC 1GXDC 2BOSA 4ZKCB 2BDNA 2JA8B 2M9VA 1LTGD 4OO1G 3C1EA 1A15A 5J39A 5G3LD 5C0XI 5EKIA 1QE6A 3OOCA 1KABA 1V1OA 5JPMC 3CKIB 3J81L 4HMJA 2RVLA 4EQPA 5IGDA 1UNSA 3C3LA 2KHSA 1PTOF 2JA5B 1HHVA 2WIIB 4KY5A 3A7AB 3C1FA 1KDBA 3A54A 2R3ZA 1I6VC 3KBGA 2QDBA 1LTRD 4DK0A 4H0LC 3BYYB 1V1PA 2A73B 5A35A 3PIO3 2JEBI 3GD7A 4O1NA 5M3FB 3H3VC 3AU7A 3N6RA 3L7ZC 4NDXA 4IFDG 4DF7A 1EQVA 1WTVA 1SEBD 1HTLD 3VYUA 2F0QA 4KY6A 1PRTC 5CV9A 3JAME 3J80E 2WKCA 4XQQA 2Z1CA 2F1MA 3S1NB 1Z47A 5KGUA 2R7ZB 1JB3A 5FO9B 1RF2D 2K33A 3PUYA 3VR4A 2FJ2A 1EU4A 1SDFA 2SOBA 4A3KB 1QNKA 1C8CA 3D3RA 2TSSA 1ZXTA 3NHHA 1YNND 3R93A 1STEA 3UI2A 1B3AA 4XDXA 3HEJA 3T13A 1J8IA 2VUMB 1DONA 4U68A 1CI3M 4B9XA 1NR2A 4RCNA 1MBYA 2CW0D 3EQLC 4OIKA 2J7ZA 3MC0B 2A68D 2A6HD 1UUPA 1O78A 3PO3B 3GQBA 4R8NA 1PFNA 2ICIA 2J4XA 4QIWB 2E2IB 1TS2A 5JPNC 2X6GA 4BA2I 1DCZA 5JJZA 3NQTA 1KNAA 1A3VA 5CBEE 5NUCA 1B9NA 5EPJA 1KTKA 2EJMA 2AUJD 3GTJB 2M00A 1PRTB 1VCIA 4KJNA 1QJOA 4IUVA 2EY6A 4WRDA 3URYA 4F87A 1JOQA 2G9DA 3A8KE 4EQNA 1D5ZC 3G7LA 2KCNA 5BN5A 4ZKBB 4CHTB 3MXPA 4PNYA 4KV6A 2CHBD 3KBXA 2JXMB 4OL7A 5JVG3 4EQOA 4QUCA 1GUGA 2EJGC 4ME5A 3NBIA 3ONAB 3OWFA 3BDCA 1V43A 1HPCA 2C9OA 3ND9A 1STBA 3SEBA 1I4RA 2B2YC 4A3IB 2B2VC 3V96A 1EY6A 5ELFA 5DM63 2ZXPA 4RGOS 2K1BA 1IYUA 1OXVA 3MZ5A 3LWEA 1A2UA 5FLXE 2K01A 5JEAJ 2F0IA 3SR1A 2IL8A 1YNNC 1CTMA 3EFXD 1JCKB 3W3AA 3T56B 4ZLTF 4HR7B 3IFDA 3MXGA 3TP5A 2EY2A 4XQNA 2G9HD 3RD4A 2F0WA 5HURA 2K05A 1CQFA 2D62A 2CW0C 3I8ZA 2Y0SB 3QIAA 5EBCA 2L0CA 1GOZA 3HOZB 3J7YW 4G57A 4CKEA 4KKSA 5JEAH 4XT3B 1Q90A 2F0EA 5IGBA 1SFOB 1CA6A 2NVXB 5I4DA 5C3XA 3H91A 4C3IG 3GTMB 3K57A 3QO2A 1XXGA 5E4XA 2EPBA 1QB5D 2QCPX 3KLSX 2B2UC 2ZXRA 1LACA 4UDUC 2GA4B 3M4YA 5COYA 4RFBA 3IAYA 2RQXA 2K5DA 2PO4A 1T5EA 5JOBA 1II3A 1ET9A 2KEDA 2KECA 2MUYA 4KKTA 1CT1D 3R2IA 1LT4D 4L6TB 2ENBA 5M9OA 3QB3A 1CQVA 4FP5D 2B2TA 3T53B 3OPOA 5KNDA 5JAVA 3S14B 5LHY1 2TMPA 3C2PA 3FKIB 4XTCS 1ICWA 1TT2A 5CYUA 4I7ZC 1TS5A 5M3MB 2A6ED 4TRDA 4RAUC 3S1QB 4L8JA 3FMCA 3TP6A 1WTPA 1BBXC 5KYIA 1EZ6A 2XWBB 3RLFA 1PRTF 3FDTA 2O5JC 2LFNA 2EYOA 1IL8A 1KDCA 2K6AA 1A6XA 1S5FD 1X32A 3P20A 1EZ8A 5IGFA 3TBIB 3VYTA 2LY7A 5JEAG 2PPBC 1NCVA 1EU3A 3MVVA 2CQAA 2JSOA 4C3IB 2F0TA 3PUXA 1HA6A 4QCLA 1QILA 5I2XA 1EL0A 4CKCA 4F7XA 2HCCA 2PZTA 4BY1B 4OO1H 2NZ1D 4IFDI 4R9WA 5FO8B 3KF8A 3DWQA 3OW7A 4JK1C 2B2WA 3SK5A 5EKKA 5IOCA 2KVMA 2WV6D 1F2MA 2WAQB 5D14A 5D3IB 2A5HA 3MWYW 1ZYRD 5CR3A 1D5XC 4M8AA 2IW3A 4OGQC 5CBAE 1PDQA 1IW7D 3H09A 4CJ1B 3CQZB 1GHKA 1HCZA 2BA0A 1GUNA 3D4DA 1TQOA 4ZRZA 5IGEA 1Y69U 2B2UA 2EOTA 2F0LA 1Y8NB 1U9RA 1DM0B 1IHZA 1CHQD 3R8BA 3PUVA 1C4QA 2AQ3B 1EOTA 4K8IA 3DHQA 3K59A 3PUZA 1XTCD 5M5WB 4K14A 1PZJD 1W6JA 3VYSA 1EYDA 4HSPA 2VB2X 3I4LA 3FVQA 2NVTB 3HOXB 3J7AV 3HOYB 1CFMA 4K2LA 1IKLA 3K0YA 5CV7A 1M4VA 2F0NA 4V190 2A6EC 2F0PA 1OXUA 4RWSC 1TIID 4X3KA 2E2JB 3K5NA 1JOKA 1EY7A 2KA7A 2NN6H 1K8MA 4DA2A 1EY5A 1U4RA 3OSOA 4QMGA 3A55A 5ELEA 1E2WA 5KYLA 2JA6B 2OF1A 4DAVA 1TS4A 2IPKD 2N88A 1QOHA 2K04A 2L12A 1BF4A 5AFWA 5EPKA 1I4PA 2EYLA 3A7LA 4A3FB 1D1IA 3GTLB 3K5OA 2R92B 2L5TA 1JORA 3GTGB 3P75A 1A2TA 1U4LA 2HDMA 5E4WC 1AFPA 2VB3X 1RHPA 5IODA 1EFID 1KDAA 1HUNA 1Y8OB 2F0SA 1STHA 1CHPD 3RZDB 4KN7C 5IT9L 1PZID 4C3HG 1U4PA 1ZYRC 2SNSA 4N9TA 3EA6A 2EDGA 2KCCA 3KLSA 1HRJA 2HCIA 2C5CA 2NVQB 2F03A 2WP8J 5KEEA 1IW7C 1G8ZD 3HOUB 3GTOB 3V05A 3R2TA 1FNWA 2B8FA 2F0UA 2K28A 5C5LA 2AUKA 3WDNA 3NWTA 1S5CD 4K8JA 1RTOA 3ZYYX 1SNQA 2E74C 2EE1A 2RDGA 1BR9A 1SXTA 4H44C 2ICEC 3DUZA 2RA4A 4A3BB 2NN6G 1SNPA 3K7AB 1BO0A 1SBBB 1PLFA 3OIQA 1MSGA 4A3GB 4HAEA 1SMYD 2EYPA 4KI0A 3MHBA 1CM9A 4F8MA 2D2CC 3VA5A 1KLUD 1H9SB 2WINB 2BE5D 3Q6SA 1SJED 2XSCA 3BDOA 1K8OA 1PTOD 2X69A 2F3WA 2VXWA 1XWEA 4K6DA 1F2LA 4FXGC 3IFTA 1PXUA 2YU9B 5C4HA 4HCEA 3TSSA 4TQUS 4DNRB 4A93B 1SNDA 5DAUA 3CRLC 4C3HB 1O7ZA 4NMZA 1NAPA 1AZQA 2LMCB 1JC7A 2B39A 5FKAC 2EYFA 3H0GB 1F2YA 3VR6A 4XT1B 3NWSA 2Z4IA 1OXXK 2J0TD 3ITPA 4LJZC 3PIP3 3MAQA 1BCPD 3MXUA 5C3WA 2PQEA 3VA7A 4B08A 1ZEQX 2KEEA 1EQTA 5K5PA 2IWHA 2EYHA 1WD1A 2RDHA 2ZT9C 1HFGA 3J7AF 4J6HA 3EROA 1EY9A 3BVGA 3QOLA 2JEAI 3F2UA 1LO5D 3D8GA 5J22A 3HOWB 3GP7A 3SHLA 3S1MB 3I90A 3EVQA 3W2DA 4IN3A 4A3JB 1F9SA 2L1BA 3ERQA 5DEHA 3SDZA 1PFBA 1GUSA 1ET6A 1LLRD 1GUTA 1H9RA 1I50B 1ENFA 3DEOA 4DK1A 5F2DA 1H9JA 1D6EC 4X3TA 3QWNA 1BOSA 2NTTA 3LWUA 5CV6A 3CRKC 3I4MB 3HG9A 1AN8A 4WFN3 4IUPA 2OEOA 1B53A 1DOLA 1TS3A 1ZKOA 2EYJA 2JE6I 1W6KA 2JP1A 3OWEB 1O80A 4KY7A 2Q8IB 1SMYC 2EYMA 2FFKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IL8 A;  2RSN A;  2HUG A;  3IL8 A;  4X3U A;  4ZKB B;  1SDF A;  3GV3 A;  3SVM A;  1CA6 A;  1EIH A;  1GUW A;  3KUP A;  4ZK9 B;  4R8I A;  3H91 A;  1X32 A;  1SSO A;  1QNK A;  2MPM A;  2B2Y A;  4XT1 B;  1C8C A;  1VMC A;  2B2V A;  2HDL A;  3D6W A;  3KBX A;  1KNE A;  1NCV A;  3I91 A;  3QO2 A;  5E4X A;  4HCS A;  2EPB A;  4ZKC B;  1O7Y A;  1PFM A;  2CVR A;  2K28 A;  4IUR A;  2XIW A;  4QUC A;  2BDN A;  1HA6 A;  1IKL A;  2B2U C;  3HP3 A;  1WTW A;  1EL0 A;  1XYI A;  5D65 A;  1ZXT A;  4RWS C;  1A15 A;  5DNF A;  3ONA B;  1IKM A;  2DY7 A;  4X3K A;  3R93 A;  5EKI A;  1RTN A;  2KEE A;  1EQT A;  4X3S A;  3UI2 A;  1B3A A;  2HCC A;  3GV6 A;  4XDX A;  5CMD A;  1QE6 A;  1WTO A;  2Q8R E;  5COY A;  1RTO A;  3DEP A;  1WD1 A;  1F9Q A;  2NZ1 D;  2B2Y C;  1XX8 A;  1HFG A;  2B2V C;  2L9H A;  4R9W A;  1J8I A;  2EE1 A;  2RVL A;  2MJ8 A;  1U4R A;  2X6L A;  1SAP A;  1DON A;  1DOM A;  1TVX A;  4U68 A;  3N52 A;  2RSO A;  1WTR A;  4HSV A;  1NR2 A;  5EJW A;  1B4O A;  1MI2 A;  2K1B A;  2RA4 A;  4OIJ A;  1X3Q A;  2B2W A;  3F2U A;  3LWE A;  2H1E A;  2N88 A;  2N55 A;  4OIK A;  4CJ2 C;  2J7Z A;  1HHV A;  2NWG A;  2KVM A;  2KED A;  2KUM A;  1BO0 A;  2K04 A;  1HUM A;  1PLF A;  2KEC A;  2L12 A;  1BF4 A;  5AFW A;  5EPK A;  1PFN A;  1MSG A;  4O42 A;  5D14 A;  2R3Z A;  3MWY W;  1U4M A;  4HED A;  3I90 A;  4LMQ D;  2K01 A;  4HAE A;  1Q3L A;  5EPL A;  1CM9 A;  5CBA E;  1J9O A;  1F9S A;  2L1B A;  4IUT A;  1PDQ A;  2D9U A;  2JYO A;  1NR4 A;  2X6G A;  1PFB A;  2IL8 A;  1ESR A;  3I3C A;  1G91 A;  1ROD A;  2B2T A;  3DM1 A;  4CJ1 B;  5JJZ A;  1KNA A;  2MP1 A;  2B2W C;  1WVL A;  4IUU A;  4IUQ A;  1WTQ A;  3DEO A;  3Q6S A;  4NW2 A;  2MGS A;  2L4N A;  1EIG A;  2NYZ D;  1JE4 A;  1U4L A;  4ZLT F;  2B2U A;  2HDM A;  3P7J A;  2X69 A;  5E4W C;  1M8A A;  1MSH A;  3TN2 A;  5CBE E;  1S4Z A;  1ICW A;  2EOT A;  3IFD A;  1RHP A;  4X3T A;  2VXW A;  1B50 A;  1X3P A;  4QUF A;  4RA8 A;  1G2T A;  4CJ0 B;  1HUN A;  1CA5 A;  1F2L A;  5EPJ A;  2KOL A;  3FPU B;  2Q8T A;  5T1I A;  1WTX A;  1WTV A;  1F9R A;  3MTS A;  2K03 A;  2DY8 A;  4MN3 A;  4RAU C;  5EQ0 A;  2B2T C;  2K05 A;  4IUP A;  1ILQ A;  4MHE A;  1B53 A;  1DOL A;  3I8Z A;  1B2T A;  1DOK A;  4ZAI A;  5T1G A;  4IUV A;  5COR A;  1E0B A;  4DN4 M;  1WTP A;  1BBX C;  1EOT A;  1ML0 D;  1U4P A;  2JP1 A;  1LV9 A;  2FMM A;  1WD0 A;  1F9P A;  1RJT A;  1HFN A;  4UAI A;  1JIC A;  2FIN B;  1QG7 A;  1O80 A;  2M2L A;  1ILP A;  3FDT A;  1VMP A;  1AP0 A;  4XT3 B;  1O7Z A;  1HRJ A;  3G7L A;  2FHT A;  2L11 A;  1NAP A;  2FFK B;  2HCI A;  1MGS A;  2SDF A;  1AZP A;  1BNZ A;  3TZD A;  1DZ1 A;  1AZQ A;  1G6Z A;  1G2S A;  2FJ2 A; 
#chains in the Genus database with same CATH topology
 5IT9 c;  4DFA A;  2BE5 C;  2K5Q A;  4IO9 A;  2BH2 A;  1H9M A;  3DWA A;  2NVT H;  4ZK9 B;  1CZG A;  1LT6 D;  3HS0 C;  4C2M B;  4CDF C;  2F0G A;  1RCV D;  1PTO C;  3U9S A;  3TME A;  2E75 C;  3D4R A;  4B3S L;  2A68 C;  2A6H C;  5KNB A;  4HJ8 A;  1WTW A;  2Q2H A;  2XTI A;  1XYI A;  4RGM A;  1GVP A;  5DNF A;  3I72 A;  2DY7 A;  4YY3 L;  1SRU A;  3GV6 A;  4L63 B;  1VQM A;  1PH7 A;  2E2J H;  1QNU A;  4S3S A;  5LL6 X;  4KHV A;  1SYC A;  1SE4 A;  2X6L A;  3S2H H;  3S1R B;  2E2H H;  3RZO H;  5ELD A;  1PYB A;  3T1Y L;  2NBF A;  1SYE A;  3FRP B;  5EJW A;  4DK3 C;  5I6Y A;  3C46 A;  1MD2 D;  1PH6 A;  1X3Q A;  2KHI A;  1KIX A;  4RGT A;  2N55 A;  3PCO B;  2JA9 A;  4RKB A;  2F0F A;  5J3B A;  2C35 B;  2E8G A;  4IOC A;  1Q12 A;  2HQE A;  3TS2 A;  2SEB D;  5FOB B;  3U58 A;  2QIL A;  1I94 Q;  5EPL A;  4A3L H;  1BCP C;  2AKW B;  4A3M B;  4RH6 A;  3A8I E;  3GTL H;  3S15 B;  4JI8 Q;  3CCS A;  4QB4 A;  1SYB A;  5FO7 B;  1EEF D;  5HGT A;  4Y7N B;  1ASZ A;  3I4N H;  2JA7 B;  3D31 A;  3PSI A;  3SXH A;  3GTG H;  4QF4 A;  2WB1 B;  5BN3 A;  3F2C A;  4LK1 C;  3P7J A;  4LAA A;  4ODG A;  4A3D B;  3MFY A;  2F4I A;  3CC7 A;  3CMA A;  4M1U B;  3NXW A;  4NP5 A;  4MIU A;  4CJ0 B;  1C0A A;  4PQX A;  3RN2 A;  4TKO B;  4JI4 Q;  2QKI C;  2PI2 A;  3MTS A;  4DAY B;  5DM7 3;  5C3E G;  3RZD H;  2VY3 A;  1G6P A;  4LFA L;  1E0B A;  1VS0 A;  3OMG A;  5IT9 E;  1I4Q A;  3V2T A;  2MNA A;  1IXR A;  3NEN A;  1UEA B;  3EJI A;  1XNR Q;  4DV6 Q;  4IJH A;  1AEX A;  4A3E G;  5DLQ E;  1VMP A;  3BU2 A;  4JI1 Q;  3S16 B;  1E1O A;  3TZD A;  1Q1B A;  1HNZ Q;  4OO1 I;  1X3E A;  2AHO B;  2NVQ H;  1PTO B;  3A5U A;  3HOU H;  1TWF B;  1O7I A;  3I73 A;  3S17 H;  1EYA A;  2NUC A;  1N36 Q;  2B2Y A;  1D7Q A;  2B2V A;  4KKU A;  3SK6 A;  4EVO A;  2CVR A;  2A74 C;  3PUW A;  4J8Q A;  2PW7 A;  2BH8 A;  1TWG B;  1E24 A;  3CCV A;  4FF4 A;  5K36 G;  1NTG A;  2K7V A;  4MNO A;  1Y8P B;  1BBU A;  1IKM A;  4JI3 Q;  2LS0 1;  3H15 A;  3H6M A;  1NBW A;  4X3S A;  4JOI A;  5FLM H;  5D3D A;  1XX8 A;  1BQQ T;  2Z6K C;  1IZ6 A;  4JBW A;  4HIM A;  4KHZ A;  4A3C H;  1ICF B;  2KQ3 A;  5E3F A;  5M5X B;  2RSO A;  2CCZ A;  3H3V I;  1B4O A;  1EY4 A;  1YEZ A;  4BA1 I;  3MXN B;  3VR2 A;  2H1E A;  5LMN Q;  1TY0 A;  1WTH A;  2EXD A;  3CHB D;  2QA4 A;  4A3B H;  1HUM A;  1NNX A;  1BCP B;  4LF9 L;  3BG3 A;  4LFB Q;  1EYC A;  1JWU D;  3F8T A;  3SK4 A;  4DR1 Q;  5KNC A;  3BS1 A;  2JYO A;  4GZY C;  1EYG A;  1ESR A;  1STG A;  3DM1 A;  3M85 A;  1I4H A;  1CSP A;  3MEH A;  4G4K A;  1HTP A;  1AW7 A;  1UE5 A;  1FYC A;  1EIG A;  2I46 A;  2NYZ D;  4I65 A;  5M5Y H;  5IWA Q;  1SE2 A;  1B50 A;  1G2T A;  2WKD A;  1GD7 A;  1FL0 A;  1QVG A;  1F9R A;  3RMH A;  3I4N G;  1T5X D;  2PMZ B;  3VYR A;  1GO3 E;  4UP8 A;  4NKL A;  1ILQ A;  4B3T Q;  2V1C C;  2B8G A;  1I6H H;  2F3V A;  5C3E B;  4N9P A;  4BBR H;  2AQ1 B;  3M7N A;  2PW5 A;  4UAI A;  3Q0A A;  2A19 A;  3GTQ H;  4FYD A;  1FD7 D;  4PMC A;  5G3L F;  2SDF A;  1MGS A;  1VQL A;  1DZ1 A;  4RHS A;  2NN6 I;  2DJG C;  3TP7 A;  3GTP H;  2RSN A;  5KRU A;  1EIF A;  3LX0 A;  4AIM A;  4GS3 A;  3E3X A;  3GV3 A;  2D5D A;  5C4Z A;  3O13 A;  4R4O A;  3NTK A;  4PV1 C;  1A3T A;  2IJ0 A;  3BVM A;  3H0G H;  3MA2 B;  4J15 A;  4OON A;  2AMC B;  1NUC A;  4DUY L;  1TKW B;  1PFM A;  2NTS A;  2IX3 A;  5IGG A;  4G7O C;  4Q0F A;  3KJO A;  2R93 B;  4JC0 A;  2EJF C;  3DXJ C;  3HP3 A;  4K2K A;  5D65 A;  2QEX A;  3GTK H;  1PRT D;  1UAP A;  3DWP A;  2DNE A;  1IBK L;  3F2B A;  4K5X A;  1OO9 B;  1HR0 L;  3X3N A;  3K80 C;  1STN A;  4IPG A;  5C4J H;  1E2Z A;  3J7Z C;  1CZW A;  1Q86 C;  1NSN S;  3LNN A;  4OX9 L;  1B3Q A;  1JJC B;  1SAP A;  4AYB E;  3KLR A;  4JYA Q;  3HRZ C;  1GM5 A;  1RIP A;  4HN7 A;  2UUA L;  3PMF A;  4A3C G;  4H02 A;  1XMQ L;  1U4M A;  3BVZ A;  1E3P A;  1FNV A;  1BUV T;  3ULJ A;  1QVC A;  3GO5 A;  3AB9 A;  3S2H B;  4X6A H;  4DR4 L;  3A5Z B;  1PMR A;  3RZO B;  3NPP A;  3K6O A;  2E2H B;  2UXD L;  3I3C A;  1S72 A;  1AH9 A;  1ENC A;  2D0P A;  3P1H A;  3K5L A;  4C1N I;  1B1Z A;  1DYQ A;  4NW2 A;  4KTA A;  4JI2 Q;  3KF6 A;  3TRE A;  1YJ9 A;  1Z6H A;  4XXE A;  3OMC A;  1V1P B;  1WFQ A;  4N8X 1;  4RA8 A;  4C56 C;  1LTS D;  1PH4 A;  4HID A;  4XIG S;  4WJW A;  4CKB A;  3BYT B;  2F0H A;  1EWH A;  5C4X H;  2IX0 A;  4MHE A;  1KLG D;  3I4M H;  1R4Q B;  2PCF B;  1B44 D;  3I4N B;  4DGZ A;  3M4Q A;  2IX1 A;  2FMM A;  1E1T A;  1HFN A;  1JIC A;  1ILP A;  2F0D A;  2FHT A;  2UU9 L;  1LAB A;  4BBS H;  2ZTC A;  2OCE A;  1K73 C;  3IKJ A;  2PZW A;  1LTL A;  3I56 A;  3NK9 A;  2SNM A;  3KUP A;  4BBR G;  3D0F A;  1VMC A;  3BDL A;  2HDL A;  2B3G A;  2MFI A;  4DV1 L;  3M3Y B;  5EKL A;  5C0X J;  3NP8 A;  3DMU A;  1VQD A;  1TWH H;  2XIW A;  4XYQ A;  3OIP A;  1SNC A;  1YJN A;  2K5H A;  4ZUJ A;  4GNX C;  5CMD A;  4JBJ A;  1EQQ A;  2ZM6 L;  2A69 D;  3S17 B;  3HGB A;  4RGN A;  1TWC H;  2YTV A;  4OEM B;  1HJP A;  4WOR A;  5A2Q L;  2K4K A;  4ZYS A;  4ID6 A;  4HSV A;  3S1R H;  4DR7 Q;  2K5W A;  4FF1 A;  1MI2 A;  1SLJ A;  4QL5 A;  4TSS A;  4CJ2 C;  3QG1 A;  2I0Q A;  1GJX A;  4O42 A;  4KLK A;  2K52 A;  2KEN A;  2NVY H;  3CCU A;  2O2L D;  4LMQ D;  5C0X H;  2MHV A;  1Q3L A;  5I6W A;  5GAG C;  4PZ8 A;  3T16 A;  1PHJ A;  1ROD A;  1G91 A;  1V1Q A;  3PO2 H;  3VR5 A;  1Z7T A;  1IYV A;  1Y1W G;  4IQZ A;  4BWG B;  1BCP F;  1WVL A;  4DR6 L;  3S15 H;  4ULL A;  1CKN B;  5CV4 A;  5JVH 3;  2V4D A;  4IPC A;  4YIJ A;  4ILW A;  1Q7Y C;  1PZK D;  4B3R L;  1VQJ A;  4C3J H;  1X3P A;  4R1J A;  4A3D H;  3U4V A;  4DV3 L;  1I5F A;  3E0J A;  3TEH B;  5T1I A;  3I7F A;  1XTD A;  1RD9 D;  1VQP A;  2ATW A;  1HNW L;  5JJI A;  1RDP D;  5EQ0 A;  4OHJ A;  4NPS A;  4ZQ3 A;  3BZC A;  1EWC A;  1B2T A;  1DOK A;  4ZAI A;  3KK7 A;  5T1G A;  4DV2 L;  5COR A;  3PF5 A;  1PYW D;  2K32 A;  4GLA C;  1F2Z A;  1X6O A;  2AWO A;  1F9P A;  1TWA B;  4OXP A;  1TU2 B;  1BKB A;  5M5Y B;  1AP0 A;  4CBV A;  3W1G A;  4DUZ L;  1FJG L;  4A3I G;  3D4W A;  5C4X G;  4GN3 B;  1YVC A;  3G4S A;  4AYB B;  2HUG A;  1HZA A;  1YNJ D;  3S16 H;  2UXB Q;  1EIH A;  1JQY D;  4IZ8 A;  1SE3 A;  4DXG A;  4LF8 Q;  1PTO H;  3D6W A;  1I6H B;  4BBR B;  4FVM A;  3A56 A;  1N33 L;  4LF7 L;  3HKZ G;  4HJ7 A;  1AE2 A;  4JVZ A;  3GTQ B;  1I4X A;  1SYF A;  4XQJ A;  4BBS G;  2PQA B;  2JQO A;  4GNX B;  1PH3 A;  3PIO A;  1BDO A;  3GTP B;  1A62 A;  3NEM A;  3NTH A;  3WOF A;  4FO2 A;  1VF7 A;  2ID0 A;  4FF3 A;  1IBM L;  1LTA D;  2L9H A;  1R9T H;  4DR5 Q;  1HQR D;  1X54 A;  2RDF A;  2MJ8 A;  3L9A X;  2EIF A;  4LF4 L;  4CDD C;  2ZXO A;  4RKL A;  3N52 A;  1WTR A;  4POG A;  2B29 A;  4RMF A;  3NBH A;  1H9S A;  3GTK B;  1N32 L;  4JV5 L;  1CSQ A;  2G5D A;  2I07 B;  3HOV H;  1SJH D;  1XMO Q;  1WCM G;  1VQK A;  4AH6 A;  5C4J B;  4QQB X;  5BN4 A;  4Y52 H;  5C44 H;  2VNU D;  5AJ3 L;  3TS0 A;  4YHH L;  5C6A A;  1NR4 A;  1VQ7 A;  2VQE L;  1VQA A;  3QOJ A;  1H9K A;  3X3M A;  3AMU A;  3S2D H;  1QCB D;  2XRQ D;  1XPR A;  1SYD A;  4IUQ A;  3E5S A;  1KQS A;  2A69 C;  5C0X G;  1Y1W B;  3TN2 A;  3OYY A;  4LFC L;  2Z6B A;  2Q2T A;  1MSH A;  1S4Z A;  2IY5 B;  1VQ6 A;  2XRS D;  2KOL A;  4DR2 L;  3PO2 G;  2Q8T A;  4PMB A;  4KHP L;  2DY8 A;  4P2C B;  3Q23 A;  3M9B A;  3PV0 A;  4XYO A;  2B2T C;  4EQ5 A;  2XVS A;  5IP9 G;  5I2Y A;  2EY1 A;  1XPO A;  1HXY D;  4DN4 M;  4GN5 A;  1ML0 D;  4ZCK A;  5J1Z A;  1WD0 A;  4C3J G;  4JI0 Q;  2R61 A;  1CK1 A;  1QG7 A;  4KK7 A;  4P73 A;  4KJO A;  1FGB D;  5EGT A;  2NZO A;  4DAP A;  2L11 A;  2F0J A;  3WWV A;  1G6Z A;  1A63 A;  3K58 A;  3IL8 A;  1STA A;  1ENA A;  1LTI D;  4A3E H;  5C4X B;  2EVB A;  1SSO A;  3A8J E;  5IY0 A;  1JE5 A;  1S5D D;  2O4X A;  4LF6 L;  2PNR C;  1O7Y A;  2PYK A;  4X66 Q;  4ABN A;  1D1K A;  3TZU A;  3RUZ A;  1VQ5 A;  1DD2 A;  2XWJ B;  2F0O A;  1QWY A;  3HKZ B;  1STY A;  2F0M A;  5I9O A;  4BBS B;  1RTN A;  4DXF A;  1NMF A;  3MFG A;  1DXM A;  2B63 H;  2Q8R E;  1EEI D;  2Z9H A;  3DEP A;  1Q81 C;  1F9Q A;  4FXD A;  5K36 H;  2O5I C;  3U4Z A;  1VDZ A;  4HIO A;  2OT2 A;  4JBK A;  2E76 C;  1TVX A;  1OXS C;  1XNQ Q;  1YHB A;  1TWH B;  3A74 A;  2E2D C;  1Y1V H;  3E9H A;  2EZV A;  3UDG A;  3PIP A;  1YNJ C;  4C1N K;  1IYJ B;  2PMZ E;  1JR0 D;  1JWM D;  1K83 H;  1Q8I A;  1YZ6 A;  3QJY A;  1TWC B;  3E6Z X;  1WCM B;  1BXT A;  4NXM Q;  1JOO A;  5CV8 A;  3RLO A;  1GHJ A;  2D9U A;  4QGU A;  3KYH C;  3K5M A;  2XNA C;  2DN8 A;  3UDX A;  3HOV G;  2HD3 A;  2B2W C;  4IUU A;  4IAL A;  1WTQ A;  4OEL B;  5H1S E;  2L4N A;  3CCM A;  5C44 G;  4R4I A;  1Q1E A;  2KCM A;  4JCV E;  3KFU A;  4K0K Q;  2NVY B;  1I3Q H;  1DJR D;  1CA5 A;  5CGK A;  4PZ7 A;  5CC4 A;  5LL6 S;  3OTO Q;  1I4G A;  3TDQ A;  1Q46 A;  4DV6 L;  3KOJ A;  1UE6 A;  3PO2 B;  4HJ5 A;  5ELB A;  3VR3 A;  3JAM L;  2OTJ A;  3J80 L;  1HNZ L;  1LV9 A;  1K8A C;  1L0X B;  1R4P B;  2FIN B;  2M2L A;  3T4A C;  1B9M A;  1X65 A;  2JA8 H;  4NB3 A;  1HQM C;  1WOC A;  4C3J B;  4H13 C;  1N36 L;  3AYH B;  4B3S Q;  5ELC A;  2BCO A;  2OXP A;  3WOE A;  3SVM A;  1L0Y B;  2RBM A;  2E5L L;  1OTC A;  3J81 E;  2QEJ C;  4K5W A;  3STB D;  3NE5 B;  3NQI A;  4JI3 L;  1OXT A;  4JI6 L;  1JWS D;  1FNU A;  3G6E A;  3CPW A;  3M3Y H;  3BZD B;  4HMI A;  1HZB A;  3SE0 A;  3I70 A;  4IUN A;  4PMW A;  2HQL A;  2Q2I A;  3NSW A;  5IGC A;  3CXC A;  3T1Y Q;  2JA5 H;  4FF2 A;  2DNC A;  3DLL A;  1SMX A;  2Z0S A;  2N3S A;  1A3U A;  1WTO A;  1S40 A;  3ND8 A;  2DGY A;  2OQK A;  4B9W A;  3FPP A;  5EBD A;  4YCU A;  4KD4 A;  5LMN L;  1G51 A;  2F4V Q;  3E0E A;  1WYD A;  1DOM A;  5A2Q E;  4JI5 L;  4LFB L;  4Z9C B;  4DR1 L;  2B63 G;  2NWG A;  1VQ4 A;  2KUM A;  4DNT B;  2IHE A;  1VQ9 A;  3KF8 B;  4HED A;  5FK9 C;  1LT5 D;  1R9T B;  3E9I A;  1XJV A;  1Y1V G;  2LKV A;  1J9O A;  1D2B A;  4H7B A;  3W5O A;  5JJL A;  4NXN Q;  4DU9 A;  4DAY A;  2VQF Q;  3G48 A;  2YYZ A;  2EQS A;  5L37 A;  2MGS A;  3S9W A;  4J1M A;  2JJQ A;  4P72 A;  3I55 A;  3HOV B;  3S1N H;  1LT3 D;  3I4O A;  2H4O A;  5C44 B;  2I5H A;  1KD1 C;  3M7G A;  3FPU B;  1F77 A;  2L55 A;  2R6G A;  4FNF A;  3NUC A;  2HHH L;  1QVF A;  4HJA A;  1LTB D;  4MN3 A;  1K0S A;  2PZU A;  4E6I A;  3S2D B;  4CGY B;  4A3K H;  3FHW A;  2UUC L;  3D6C A;  3W1B A;  5E1F A;  2AWN A;  3R3O A;  4RCO A;  5CV5 A;  1RJT A;  2BA1 A;  2ES2 A;  4FXK C;  2EY5 A;  1EFW A;  1VF5 C;  4X62 L;  1TWA H;  1D5M C;  2QF7 A;  1BNZ A;  1AZP A;  4R4Q A;  1EIY B;  4U67 3;  2KCT A;  2A8V A;  1C48 A;  1GUO A;  4X3U A;  4BY7 G;  4KMU C;  3Q24 A;  2EXZ A;  1B70 B;  4R8I A;  3G6J B;  1N34 L;  3CU7 A;  1HA5 A;  1JJG A;  1V8Q A;  3RN5 A;  2JA8 G;  1KNE A;  3I91 A;  2VUM H;  3H94 A;  4HCS A;  4CDE C;  2RF4 A;  3B6Y A;  2Z8L A;  4IUR A;  3L2P A;  2JK8 A;  4ZUI A;  4IFD J;  1VQF A;  1O7L A;  2XN9 C;  4X64 Q;  3PO3 H;  3CCE A;  3MXN A;  4KD3 A;  4A3E B;  4GKK L;  1TY2 A;  1LTT D;  5TSS A;  1EY8 A;  4JYA L;  2Z4H A;  5KIX A;  2FMC A;  2DUD A;  2QDL A;  4KN4 C;  5I9P A;  2JA5 G;  1ONL A;  1MKH A;  4OIJ A;  1S5B D;  1UE7 A;  4R4T A;  4V0B A;  1SYG A;  1ESF A;  1N9W A;  4Q5V A;  4AQY Q;  4EGV A;  4HTH A;  4L5T A;  4G7Z C;  2B63 B;  5FLX L;  1YIJ A;  4BS9 A;  4F88 A;  1EY0 A;  2RKS A;  4JI7 Q;  1PH9 A;  3L3O C;  2F0K A;  2AQ2 B;  5ISR A;  4BXX H;  1KAA A;  3GTJ H;  4IUT A;  5FJ8 G;  4IFD H;  2KJX A;  4K5V A;  4DKA C;  1TR5 A;  1Y1V B;  2MP1 A;  1IBL L;  5M3F G;  3M4O B;  2F0V A;  3SK8 A;  1JE4 A;  1E2V A;  4RHR A;  4GKJ Q;  1HNX L;  4G7H C;  1M8A A;  1K83 B;  1U0L A;  1Y1W H;  3J81 i;  3HZX A;  3KDF B;  2BDO A;  3NTI A;  1WTX A;  1G29 1;  4P75 A;  2K03 A;  1Q82 C;  1RKN A;  3PQI A;  2WAC A;  3U9O A;  5IIF A;  2IT1 A;  2R7Z G;  4DV0 Q;  1PFS A;  3T51 B;  3TP8 A;  5C5M A;  4QIW E;  3K8A A;  4DUY Q;  1J5E Q;  2UUB L;  1S5E D;  1I3Q B;  3AFQ A;  2QGQ A;  3UDF A;  1G2S A;  3FEW X;  4QUF A;  4A3K G;  2NB0 A;  1GUW A;  1SNM A;  3J80 c;  3Q22 A;  4K6L A;  1SNO A;  4MTK A;  4BY7 B;  1LUZ A;  1IBK Q;  3UDI A;  2ALY B;  2MPM A;  1L0W A;  1FR3 A;  3OHX C;  4A3I H;  1GXD C;  2BOS A;  3AFP A;  2Z6K A;  1VQG A;  4ZKC B;  1DGS A;  2BDN A;  2JA8 B;  2M9V A;  1LTG D;  4OO1 G;  4A3G G;  3C1E A;  4LUZ A;  1A15 A;  1KHI A;  5J39 A;  1QZH A;  5G3L D;  5C0X I;  5EKI A;  2VUM G;  2ASB A;  1QE6 A;  3OOC A;  1KAB A;  1PH8 A;  4DR7 L;  1V1O A;  5JPM C;  3CKI B;  3J81 L;  4HMJ A;  2UUA Q;  2RVL A;  4EQP A;  5IGD A;  2ZJP A;  1UNS A;  3C3L A;  3PO3 G;  2KHS A;  1PTO F;  2JA5 B;  1HHV A;  2OTL A;  2WII B;  1YNX A;  4KY5 A;  3A7A B;  3C1F A;  1KDB A;  3A54 A;  3UE1 A;  2R3Z A;  1I6V C;  3KBG A;  2QDB A;  1LTR D;  4DK0 A;  4H0L C;  3BYY B;  1WCM H;  1V1P A;  3EN2 A;  5LMU L;  2KBN A;  4DAM A;  1SE8 A;  2A73 B;  2CFM A;  3CAM A;  3HOZ H;  5A35 A;  4LW1 A;  3PIO 3;  1YHQ A;  2JEB I;  3GD7 A;  4O1N A;  5M3F B;  3H3V C;  3AU7 A;  3N6R A;  3L7Z C;  4BXX G;  2L15 A;  4NDX A;  3QR8 A;  4IFD G;  4IJL A;  4DF7 A;  4DV7 L;  1HZ9 A;  1EQV A;  3CP0 A;  1WTV A;  5HY6 A;  1SFO H;  1SEB D;  1HTL D;  3VYU A;  2NVX H;  3HKZ E;  2F0Q A;  4KY6 A;  1PRT C;  4JBM A;  3GTM H;  1VQH A;  1QUQ B;  1SR3 A;  1KXL A;  4DV5 L;  2K50 A;  5CV9 A;  3JAM E;  3J80 E;  2WKC A;  4XQQ A;  2Z1C A;  2F1M A;  2UXB L;  3S1N B;  1Z47 A;  5KGU A;  2R7Z B;  1C9O A;  1JB3 A;  1VQB A;  5IP9 H;  5FO9 B;  1HZC A;  4GLV B;  1RF2 D;  2K33 A;  4LF8 L;  3JC6 6;  4JG2 A;  3PUY A;  3F2D A;  3VR4 A;  2FJ2 A;  1YBY A;  2HIV A;  1EU4 A;  1SDF A;  4UPA A;  2SOB A;  4YWL A;  1KRT A;  4A3K B;  1QNK A;  1C8C A;  4MZ9 A;  3GDE A;  3D3R A;  2TSS A;  3NHH A;  1ZXT A;  4DPG A;  4DR5 L;  1YNN D;  2Y0S E;  1FGU A;  3R93 A;  1STE A;  3UI2 A;  1B3A A;  4XDX A;  1QZG A;  3BJU A;  3HEJ A;  3ER0 A;  1WI5 A;  3T13 A;  5GRO A;  3CCR A;  3NEL A;  3TQY A;  1J8I A;  2VUM B;  1B8A A;  1EUJ A;  1XMO L;  1DON A;  4U68 A;  1CI3 M;  4B9X A;  4DR3 Q;  1NR2 A;  3G71 A;  2GN5 A;  4RCN A;  3CW2 C;  1PH1 A;  1EWI A;  1MBY A;  2CW0 D;  3EQL C;  4OIK A;  3S14 H;  2J7Z A;  1QUQ A;  1PVO A;  3MC0 B;  1JMC A;  1NY4 A;  2A68 D;  2A6H D;  1UUP A;  1O78 A;  3FKI H;  3GQB A;  3PO3 B;  4R8N A;  1PFN A;  2GVA A;  2ICI A;  4GOP B;  2J4X A;  1CKN A;  4QIW B;  2E2I B;  1CUK A;  1K3B C;  5M3M H;  1TS2 A;  1K3R A;  5JPN C;  3OW2 A;  4B3R Q;  2X6G A;  4BA2 I;  3S1Q H;  3HKS A;  1DCZ A;  5JJZ A;  3NQT A;  1KNA A;  2VW9 A;  1HNW Q;  3AQQ A;  1A3V A;  1UEB A;  5BR8 Q;  2LSS A;  2XGT A;  5CBE E;  5NUC A;  1B9N A;  4X65 L;  1VQC A;  5EPJ A;  2Y0S G;  1KTK A;  2EJM A;  2AUJ D;  3GTJ B;  4JI0 L;  1XPU A;  3HOZ G;  2M00 A;  1PRT B;  1VCI A;  3I2Z A;  1FJG Q;  4KJN A;  2UXC L;  1QJO A;  4IUV A;  2EY6 A;  1UWV A;  4WRD A;  5GAH C;  3URY A;  4FDB A;  1YJW A;  4YCV A;  4F87 A;  2HT1 A;  4C3I H;  1JOQ A;  2G9D A;  3A8K E;  4EQN A;  1D5Z C;  3G7L A;  2KCN A;  5BN5 A;  4A76 A;  1X3G A;  3T1H Q;  1GKH A;  4ZKB B;  3PGZ A;  2PQA A;  3DM3 A;  4CHT B;  2P5Z X;  4GNX A;  3MXP A;  4PNY A;  4YWM A;  4X66 L;  1KAW A;  4BY1 H;  4KV6 A;  2CHB D;  4LUO A;  3KBX A;  2JXM B;  4OL7 A;  4LF5 Q;  5JVG 3;  4EQO A;  4QUC A;  1GUG A;  5ELN A;  2EJG C;  5ELO A;  3AEV A;  4ME5 A;  3NBI A;  4LF4 Q;  3ONA B;  3OWF A;  3BDC A;  1JT8 A;  1V43 A;  1HPC A;  2C9O A;  3ND9 A;  1HH2 P;  1STB A;  3IRB A;  1L2F A;  3KJP A;  3SEB A;  4JV5 Q;  2CH4 W;  5IYB H;  1I4R A;  2B2Y C;  2RCF A;  2B2V C;  2ZJR A;  4A3I B;  2VL6 A;  3V96 A;  1EY6 A;  5ELF A;  3SGI A;  5DM6 3;  2ZXP A;  4RGO S;  4B3M Q;  4YHH Q;  3CQZ H;  2K1B A;  1IYU A;  1OXV A;  3MZ5 A;  1RL2 A;  3LWE A;  3Q8D A;  1A2U A;  2VQE Q;  4NXM L;  1TXY A;  3J81 c;  4UY8 C;  1HR0 W;  3KLW A;  4JOI C;  5IYC H;  5FLX E;  2K01 A;  5JEA J;  5IP7 G;  2F0I A;  4LFC Q;  3SR1 A;  2F52 A;  3JAM i;  3J80 i;  2IL8 A;  2JN4 A;  4OWT B;  1YNN C;  2GVB A;  1M1K C;  3FKI G;  1CTM A;  3EFX D;  4KHP Q;  1JCK B;  4GN4 B;  3S24 A;  3W3A A;  3M4O H;  1I94 L;  3T56 B;  4R4C A;  4ZLT F;  1W2B A;  4HR7 B;  3CME A;  5M3M G;  5M5W H;  3IFD A;  3MXG A;  3TP5 A;  2EY2 A;  4XQN A;  4JI8 L;  2G9H D;  3RD4 A;  3HOX H;  2F0W A;  1BVS A;  2N8N A;  5HUR A;  2K05 A;  1CQF A;  2D62 A;  2CW0 C;  3I8Z A;  2Y0S B;  2OQ0 A;  3LGJ A;  3QIA A;  2WAQ E;  5EBC A;  2L0C A;  1GOZ A;  3HOZ B;  3J7Y W;  4G57 A;  4CKE A;  3HOY H;  4KKS A;  4P71 A;  3CPF A;  1FVI A;  5JEA H;  4JI4 L;  4XT3 B;  5EAY A;  4DV4 Q;  1YIT A;  1LYL A;  4JW0 A;  4LF6 Q;  1X9N A;  4IPD A;  4O0A A;  1KC8 C;  1Q90 A;  2F0E A;  1YI2 A;  5IGB A;  1SFO B;  1CA6 A;  2NVX B;  5I4D A;  5C3X A;  1U5K A;  2F3I A;  3H91 A;  1XNR L;  4YCW A;  4C3I G;  3GTM B;  3K57 A;  3QO2 A;  4BY7 H;  1XXG A;  1X3F A;  5E4X A;  2EPB A;  4JI1 L;  1QB5 D;  2QCP X;  3KLS X;  2JA6 H;  2B2U C;  3CCJ A;  4BY1 G;  1UE1 A;  2ZXR A;  2R7D A;  5GAE C;  3ULP A;  2F4V L;  1LAC A;  4UDU C;  2YV5 A;  2GA4 B;  3M4Y A;  5COY A;  4RFB A;  1CKM A;  3IAY A;  2RQX A;  1VQE A;  2K5D A;  2PO4 A;  4A3F H;  4YY3 Q;  5IYD H;  1MIU A;  4PZ6 A;  1T5E A;  2R92 H;  5JOB A;  1II3 A;  1ET9 A;  2KHJ A;  2WAQ G;  1M90 C;  1K9M C;  2I5M X;  5IYB G;  2KED A;  2KEC A;  1NMG A;  2MUY A;  4KKT A;  1CT1 D;  4NXN L;  3R2I A;  1LT4 D;  4L6T B;  2VQF L;  1ASY A;  2ENB A;  5M9O A;  4JPB W;  3QB3 A;  1CQV A;  4FP5 D;  2B2T A;  3T53 B;  3OPO A;  5KND A;  5JAV A;  4POF A;  2MO1 A;  3S14 B;  4WJ3 M;  5LHY 1;  5IYC G;  4I7A A;  5FJ8 H;  3K7U C;  1EOV A;  2TMP A;  3FKI B;  1SRO A;  4XTC S;  3C2P A;  3VDY A;  1ICW A;  1TT2 A;  5CYU A;  5M3F H;  2CWA A;  4I7Z C;  1TS5 A;  5M3M B;  2A6E D;  4TRD A;  3GTO H;  4RAU C;  3S1Q B;  2R93 G;  4L8J A;  1YHA A;  3FMC A;  3TP6 A;  3HFZ B;  1WTP A;  5IWA L;  1BBX C;  5KYI A;  4ME3 A;  1EZ6 A;  2XWB B;  2E5L Q;  3RLF A;  4LUV A;  2D0O A;  1PRT F;  3FDT A;  3HOX G;  1JJ2 A;  2O5J C;  1X55 A;  2LFN A;  4LFA Q;  2R7Z H;  4JI6 Q;  4APV A;  2EYO A;  3CC2 A;  1EQR A;  4B3T L;  2K14 A;  1IL8 A;  3MEF A;  1K28 A;  1KDC A;  3CD6 A;  2K6A A;  3HOY G;  1A6X A;  1S5F D;  1X32 A;  2I5L X;  3P20 A;  1AE3 A;  1EZ8 A;  5IGF A;  3TBI B;  3VYT A;  2LY7 A;  5JEA G;  2PPB C;  1NCV A;  1EU3 A;  3MVV A;  1BBW A;  2CQA A;  1E22 A;  4X64 L;  2JSO A;  4C3I B;  2F0T A;  3PUX A;  1HA6 A;  3CCL A;  4QCL A;  1QIL A;  5I2X A;  1EL0 A;  1C7Y A;  3PF4 A;  4CKC A;  3K81 C;  3K7A H;  3K0X A;  4JI5 Q;  4F7X A;  2HCC A;  1VQI A;  2PZT A;  4BY1 B;  4OO1 H;  4A3G H;  1V9P A;  2NZ1 D;  4IFD I;  1MHW C;  2IHF A;  4R9W A;  4P74 A;  2JA6 G;  1Z9F A;  5FO8 B;  4AQY L;  3KF8 A;  3DWQ A;  3OW7 A;  4PG3 A;  4JK1 C;  4JI7 L;  2B2W A;  2QW7 A;  3SK5 A;  5EKK A;  5IOC A;  2KVM A;  2WV6 D;  1NJI C;  4A3L G;  1F2M A;  2WAQ B;  4A3F G;  2YTX A;  5IYD G;  5D14 A;  5D3I B;  2A5H A;  3MWY W;  1ZYR D;  5CR3 A;  2R92 G;  1D5X C;  4M8A A;  2CH4 A;  1W3S A;  2IW3 A;  4OGQ C;  5CBA E;  2E2I H;  1PDQ A;  2YU9 H;  4GKJ L;  4DNI A;  1IW7 D;  3H09 A;  4CJ1 B;  3CQZ B;  4LF9 Q;  2DJF C;  1GHK A;  1HCZ A;  2BA0 A;  1GUN A;  3D4D A;  2HHH Q;  1JB7 A;  4A93 H;  1TQO A;  4ZRZ A;  3H3V H;  5IGE A;  1Y69 U;  2B2U A;  3RR5 A;  2UUC Q;  4C3H H;  2EOT A;  2ZTE A;  4DV0 L;  2F0L A;  3STB C;  1PA6 A;  2H5X A;  1SN8 A;  1Y8N B;  1N8R C;  1U9R A;  4X62 Q;  1DM0 B;  3J81 j;  1IHZ A;  4HJ9 A;  1CHQ D;  3R8B A;  4JI2 L;  1J5E L;  3KF6 B;  4EX5 A;  4RG1 A;  3PUV A;  1C4Q A;  2AQ3 B;  1EOT A;  4K8I A;  5GQO A;  3DHQ A;  3K59 A;  3PUZ A;  1N34 Q;  2K75 A;  1XTC D;  5M5W B;  4K14 A;  1PZJ D;  1W6J A;  3VYS A;  1EYD A;  4HSP A;  3HOU G;  2VB2 X;  3I4L A;  3FVQ A;  2NVT B;  3ULL A;  3HOX B;  2PNH A;  1K8G A;  4WJ4 A;  3J7A V;  2HIX A;  4L5R C;  3HOY B;  4GKK Q;  1CFM A;  4K2L A;  3L0O A;  1IKL A;  3K0Y A;  1PYS B;  1M4V A;  5CV7 A;  2F0N A;  5FLM G;  4V19 0;  2A6E C;  2F0P A;  1OXU A;  4RWS C;  1TII D;  4X3K A;  3HOW H;  2E2J B;  3K5N A;  3CCQ A;  1JOK A;  1EY7 A;  1H95 A;  3S1M H;  2KA7 A;  2NN6 H;  3UE0 A;  3JAM c;  2VS1 A;  1K8M A;  4DA2 A;  1EY5 A;  1U4R A;  4A3J H;  4A3B G;  3RLN A;  3OSO A;  4QMG A;  3A55 A;  1HR0 Q;  5ELE A;  1E2W A;  5KYL A;  2VZA A;  2JA6 B;  5JJK A;  2OF1 A;  1I50 H;  1TS4 A;  4LWC A;  4DAV A;  2IPK D;  2N88 A;  4OX9 Q;  4QJF A;  1QOH A;  2K04 A;  2L12 A;  1BF4 A;  1IBL Q;  5AFW A;  5EPK A;  1I4P A;  2EYL A;  3A7L A;  4QY7 A;  4A3F B;  1D1I A;  4GLX A;  1HNX Q;  3GTL B;  3K5O A;  2RHS B;  3ERS X;  2L5T A;  3KDF A;  2R92 B;  1JOR A;  1XMQ Q;  3GTG B;  3P75 A;  4DK6 C;  1A2T A;  4DR4 Q;  4AYB G;  1U4L A;  1IL2 A;  2UXD Q;  2HDM A;  1PH5 A;  5E4W C;  1AFP A;  2VB3 X;  1RHP A;  5IOD A;  1EFI D;  1KDA A;  1HUN A;  1Y8O B;  2F0S A;  1STH A;  1CHP D;  3RZD B;  2UUB Q;  3J7A 5;  2CKZ B;  4GOP C;  4A93 G;  5GAD C;  1A8V A;  4KN7 C;  5IT9 L;  1VQ8 A;  4C2M H;  3TRZ A;  1PZI D;  1MJC A;  4C3H G;  1U4P A;  1ZYR C;  1L1O C;  2SNS A;  3U50 C;  4N9T A;  3EA6 A;  2EDG A;  2KCC A;  3KLS A;  1HRJ A;  3H0G G;  2HCI A;  2C5C A;  2NVQ B;  2F03 A;  2WP8 J;  5KEE A;  1IW7 C;  1G8Z D;  3HOU B;  4IPH A;  3CF5 A;  3GTO B;  3V05 A;  4N8F A;  3R2T A;  1FNW A;  4LNQ A;  2B8F A;  2UU9 Q;  2NZH A;  2F0U A;  2K28 A;  5C5L A;  2AUK A;  3WDN A;  3NWT A;  1S5C D;  4DV1 Q;  3CC4 A;  3A0J A;  5E7N A;  4K8J A;  4OWW B;  4DR3 L;  1RTO A;  3ZYY X;  1SNQ A;  2E74 C;  1MJE A;  1P16 A;  4O2D A;  2EE1 A;  2RDG A;  1BR9 A;  1K0R A;  1SXT A;  4A3M H;  2ZJQ A;  4H44 C;  2ICE C;  1S3O A;  3DUZ A;  2ZM6 Q;  3BZK A;  3HOW G;  2RA4 A;  2RHQ B;  3FP9 A;  4A3B B;  5LMU Q;  4Y7N H;  1Q8K A;  4L5Q A;  2JA7 H;  2NN6 G;  1SNP A;  3K7A B;  1BO0 A;  1SBB B;  1PLF A;  3OIQ A;  1MSG A;  4ALP A;  4A3J G;  4A3G B;  1Y14 B;  1PV4 A;  4HAE A;  4UHV A;  5LMN W;  1SMY D;  2EYP A;  4KI0 A;  3MHB A;  1CM9 A;  4F8M A;  5BR8 L;  2D2C C;  3VA5 A;  1KLU D;  3NBH B;  1H9S B;  2PI2 E;  4TVA B;  2WIN B;  4DV7 Q;  2BE5 D;  2K5V A;  5IP7 H;  3Q6S A;  1SJE D;  2XSC A;  3BDO A;  1K8O A;  1A0I A;  1PTO D;  2R7F A;  2X69 A;  2F3W A;  2VXW A;  4DV5 Q;  1XWE A;  3I4M G;  4DR6 Q;  4K6D A;  1F2L A;  4FXG C;  3IFT A;  2A1A A;  1PXU A;  2YU9 B;  3ZJY C;  5C4H A;  2CQO A;  4HCE A;  3TSS A;  1TWF H;  5IE8 A;  4A4I A;  1L1O B;  4TQU S;  4DNR B;  4DV3 Q;  3T1H L;  2RCN A;  3ICE A;  4A93 B;  1SND A;  5DAU A;  1PH2 A;  3CRL C;  4L5S A;  3F1Z A;  1X56 A;  5HGQ A;  4C3H B;  1TWG H;  5FLX c;  1O7Z A;  4NMZ A;  4DV2 Q;  1NAP A;  2MO0 A;  1AZQ A;  2LMC B;  1JC7 A;  2B39 A;  5FKA C;  2EYF A;  2WFW A;  3H0G B;  4LF5 L;  4A75 A;  1KL9 A;  2WB1 E;  4YWK A;  1F2Y A;  3VR6 A;  4XT1 B;  4DUZ Q;  3NWS A;  3RNU A;  2Z4I A;  1OXX K;  2J0T D;  3ITP A;  4LJZ C;  2N78 A;  1B7Y B;  3PIP 3;  3MAQ A;  5M5X H;  2FXQ A;  1BCP D;  3MXU A;  5C3W A;  2PQE A;  3VA7 A;  4CDC C;  4B08 A;  1WJJ A;  1P8L A;  1T9H A;  1ZEQ X;  4HIK A;  2K5N A;  1N33 Q;  2KEE A;  4LF7 Q;  1EQT A;  3EBE A;  5K5P A;  2IWH A;  2EYH A;  2OWO A;  4B3M L;  3M4P A;  1WD1 A;  2RDH A;  2ZT9 C;  1HFG A;  3J7A F;  4J6H A;  4GOP A;  1KRS A;  3ERO A;  2CWP A;  4IOA A;  1EY9 A;  3BVG A;  3QOL A;  2LXK A;  2JEA I;  1IBM Q;  3F2U A;  1LO5 D;  4UP9 A;  3D8G A;  1L1O A;  5J22 A;  3HOW B;  3GP7 A;  3SHL A;  3S1M B;  3I90 A;  4A3M G;  1XNQ L;  3EVQ A;  3W2D A;  1N32 Q;  1NE3 A;  4IN3 A;  4A3J B;  1D8L A;  1F9S A;  2L1B A;  3ERQ A;  5DEH A;  4OWX B;  3SDZ A;  4MTN A;  1PFB A;  2JA7 G;  1GUS A;  4X65 Q;  1ET6 A;  1CKO A;  2WB1 G;  1LLR D;  1GUT A;  1H9R A;  1I50 B;  4A3D G;  1ENF A;  5AJ3 Q;  5C3E H;  3DEO A;  3EIV A;  4DK1 A;  1J6Q A;  2UXC Q;  5F2D A;  2Q2U A;  2N49 A;  1H9J A;  1VQN A;  1D6E C;  4X3T A;  3QWN A;  1BOS A;  2NTT A;  1VQO A;  3LWU A;  5CV6 A;  3CRK C;  3I4M B;  2ZTD A;  3HG9 A;  1AN8 A;  4WFN 3;  4IUP A;  2OEO A;  2YTY A;  1B53 A;  1DOL A;  4DV4 L;  1TS3 A;  1ZKO A;  2EYJ A;  2JE6 I;  1LM0 A;  1W6K A;  4DR2 Q;  4K0K L;  2JP1 A;  4UP7 A;  3OWE B;  2LXJ A;  1O80 A;  2R93 H;  4KY7 A;  2Q8I B;  2MQH A;  1SMY C;  3OTO L;  2EYM A;  1E7Z A;  2FFK B; 
#chains in the Genus database with same CATH homology
 4DFA A;  2BE5 C;  2K5Q A;  1H9M A;  3DWA A;  4ZK9 B;  1CZG A;  1LT6 D;  3HS0 C;  4C2M B;  2F0G A;  1RCV D;  1PTO C;  3U9S A;  3TME A;  2E75 C;  3D4R A;  2A68 C;  2A6H C;  5KNB A;  1WTW A;  1XYI A;  4RGM A;  5DNF A;  3I72 A;  2DY7 A;  3GV6 A;  4L63 B;  1QNU A;  4S3S A;  5LL6 X;  4KHV A;  1SYC A;  1SE4 A;  2X6L A;  3S1R B;  5ELD A;  2NBF A;  1SYE A;  3FRP B;  5EJW A;  5I6Y A;  3C46 A;  1MD2 D;  1X3Q A;  4RGT A;  2N55 A;  4RKB A;  2F0F A;  1Q12 A;  2HQE A;  2SEB D;  5FOB B;  2QIL A;  5EPL A;  1BCP C;  4A3M B;  4RH6 A;  3A8I E;  3S15 B;  4QB4 A;  1SYB A;  5FO7 B;  1EEF D;  5HGT A;  4Y7N B;  2JA7 B;  3D31 A;  3SXH A;  4QF4 A;  2WB1 B;  5BN3 A;  4LK1 C;  3P7J A;  4LAA A;  4ODG A;  4A3D B;  3MFY A;  2F4I A;  4M1U B;  3NXW A;  4NP5 A;  4MIU A;  4CJ0 B;  4PQX A;  4TKO B;  2QKI C;  3MTS A;  5DM7 3;  1E0B A;  3OMG A;  5IT9 E;  1I4Q A;  3V2T A;  1UEA B;  3EJI A;  1AEX A;  1VMP A;  3S16 B;  3TZD A;  1Q1B A;  4OO1 I;  1PTO B;  1TWF B;  3I73 A;  1EYA A;  2NUC A;  2B2Y A;  2B2V A;  4KKU A;  3SK6 A;  4EVO A;  2CVR A;  2A74 C;  3PUW A;  4J8Q A;  2PW7 A;  1TWG B;  4FF4 A;  5K36 G;  2K7V A;  1Y8P B;  1IKM A;  2LS0 1;  3H6M A;  4X3S A;  5D3D A;  1XX8 A;  1BQQ T;  4JBW A;  4KHZ A;  2KQ3 A;  5E3F A;  5M5X B;  2RSO A;  1B4O A;  1EY4 A;  4BA1 I;  3VR2 A;  2H1E A;  1TY0 A;  3CHB D;  1HUM A;  1BCP B;  3BG3 A;  1EYC A;  1JWU D;  3SK4 A;  5KNC A;  3BS1 A;  2JYO A;  4GZY C;  1ESR A;  1STG A;  3DM1 A;  3M85 A;  1I4H A;  3MEH A;  4G4K A;  1HTP A;  1AW7 A;  1FYC A;  1EIG A;  2I46 A;  2NYZ D;  4I65 A;  1SE2 A;  1B50 A;  1G2T A;  2WKD A;  1F9R A;  3RMH A;  1T5X D;  2PMZ B;  3VYR A;  4NKL A;  1ILQ A;  2B8G A;  2F3V A;  5C3E B;  4N9P A;  2AQ1 B;  3M7N A;  2PW5 A;  4UAI A;  3Q0A A;  4FYD A;  1FD7 D;  4PMC A;  5G3L F;  2SDF A;  1MGS A;  1DZ1 A;  4RHS A;  2NN6 I;  3TP7 A;  2RSN A;  5KRU A;  3LX0 A;  3GV3 A;  2D5D A;  5C4Z A;  3O13 A;  3NTK A;  4PV1 C;  1A3T A;  2IJ0 A;  3BVM A;  3MA2 B;  1NUC A;  1TKW B;  1PFM A;  2NTS A;  2IX3 A;  5IGG A;  4G7O C;  4Q0F A;  2R93 B;  2EJF C;  3DXJ C;  3HP3 A;  4K2K A;  5D65 A;  1PRT D;  1UAP A;  3DWP A;  2DNE A;  4K5X A;  1OO9 B;  3X3N A;  1STN A;  1E2Z A;  1CZW A;  1NSN S;  3LNN A;  1SAP A;  3KLR A;  3HRZ C;  4HN7 A;  3PMF A;  1U4M A;  3BVZ A;  1FNV A;  1BUV T;  3GO5 A;  3AB9 A;  3S2H B;  1PMR A;  3RZO B;  3NPP A;  3K6O A;  2E2H B;  3I3C A;  1ENC A;  3P1H A;  3K5L A;  4C1N I;  1B1Z A;  1DYQ A;  4NW2 A;  4KTA A;  1Z6H A;  4XXE A;  3OMC A;  1V1P B;  4RA8 A;  4C56 C;  1LTS D;  4XIG S;  4WJW A;  4CKB A;  3BYT B;  2F0H A;  1EWH A;  2IX0 A;  4MHE A;  1KLG D;  1R4Q B;  2PCF B;  1B44 D;  3I4N B;  4DGZ A;  2IX1 A;  2FMM A;  1HFN A;  1JIC A;  1ILP A;  2F0D A;  2FHT A;  1LAB A;  3IKJ A;  2PZW A;  3NK9 A;  2SNM A;  3KUP A;  1VMC A;  3BDL A;  2HDL A;  3M3Y B;  5EKL A;  5C0X J;  3NP8 A;  3DMU A;  2XIW A;  4XYQ A;  3OIP A;  1SNC A;  4ZUJ A;  5CMD A;  2A69 D;  3S17 B;  3HGB A;  4RGN A;  4WOR A;  5A2Q L;  4ZYS A;  4ID6 A;  4HSV A;  2K5W A;  4FF1 A;  1MI2 A;  4TSS A;  4CJ2 C;  3QG1 A;  1GJX A;  4O42 A;  2O2L D;  4LMQ D;  5C0X H;  2MHV A;  1Q3L A;  5I6W A;  3T16 A;  1G91 A;  1ROD A;  3VR5 A;  1Z7T A;  1IYV A;  4IQZ A;  4BWG B;  1BCP F;  1WVL A;  4ULL A;  5CV4 A;  5JVH 3;  2V4D A;  4YIJ A;  4ILW A;  1PZK D;  1X3P A;  3E0J A;  5T1I A;  1RD9 D;  1RDP D;  5EQ0 A;  4OHJ A;  4ZQ3 A;  1B2T A;  1EWC A;  1DOK A;  4ZAI A;  3KK7 A;  5T1G A;  5COR A;  1PYW D;  2K32 A;  1F2Z A;  2AWO A;  1F9P A;  1TWA B;  1TU2 B;  5M5Y B;  1AP0 A;  4CBV A;  3D4W A;  4AYB B;  2HUG A;  1YNJ D;  1EIH A;  1JQY D;  4IZ8 A;  1SE3 A;  4DXG A;  1PTO H;  3D6W A;  1I6H B;  4BBR B;  4FVM A;  3A56 A;  3GTQ B;  1I4X A;  1SYF A;  4XQJ A;  1BDO A;  3GTP B;  3NTH A;  3WOF A;  4FO2 A;  1VF7 A;  2ID0 A;  4FF3 A;  1LTA D;  2L9H A;  1HQR D;  2RDF A;  2MJ8 A;  3L9A X;  2ZXO A;  4RKL A;  3N52 A;  1WTR A;  3NBH A;  1H9S A;  3GTK B;  2I07 B;  1SJH D;  5C4J B;  5BN4 A;  2VNU D;  5C6A A;  1NR4 A;  3QOJ A;  1H9K A;  3X3M A;  3AMU A;  1QCB D;  2XRQ D;  1SYD A;  4IUQ A;  3E5S A;  2A69 C;  5C0X G;  1Y1W B;  3TN2 A;  1MSH A;  1S4Z A;  2XRS D;  2KOL A;  2Q8T A;  4PMB A;  2DY8 A;  4P2C B;  3Q23 A;  4XYO A;  3PV0 A;  2B2T C;  2XVS A;  5I2Y A;  2EY1 A;  1HXY D;  4DN4 M;  1ML0 D;  5J1Z A;  1WD0 A;  4C3J G;  2R61 A;  1CK1 A;  1QG7 A;  4KK7 A;  4KJO A;  1FGB D;  5EGT A;  4DAP A;  2L11 A;  2F0J A;  1G6Z A;  3K58 A;  3IL8 A;  1STA A;  1ENA A;  1LTI D;  5C4X B;  2EVB A;  1SSO A;  3A8J E;  1S5D D;  2O4X A;  2PNR C;  1O7Y A;  2PYK A;  4ABN A;  1D1K A;  3TZU A;  3RUZ A;  1DD2 A;  2F0O A;  2XWJ B;  1QWY A;  3HKZ B;  1STY A;  2F0M A;  5I9O A;  4BBS B;  1RTN A;  4DXF A;  3MFG A;  1DXM A;  2Q8R E;  1EEI D;  3DEP A;  5K36 H;  1F9Q A;  4FXD A;  2O5I C;  1VDZ A;  2OT2 A;  2E76 C;  1TVX A;  1OXS C;  1TWH B;  2E2D C;  2EZV A;  1YNJ C;  4C1N K;  1JR0 D;  1JWM D;  1Q8I A;  3QJY A;  1TWC B;  3E6Z X;  1WCM B;  1BXT A;  1JOO A;  5CV8 A;  1GHJ A;  2D9U A;  3K5M A;  2XNA C;  2DN8 A;  2B2W C;  4IUU A;  4IAL A;  1WTQ A;  2L4N A;  1Q1E A;  2NVY B;  1DJR D;  1CA5 A;  5CGK A;  5CC4 A;  5LL6 S;  1I4G A;  3TDQ A;  3PO2 B;  5ELB A;  3VR3 A;  3JAM L;  3J80 L;  1LV9 A;  1L0X B;  1R4P B;  2FIN B;  2M2L A;  3T4A C;  1B9M A;  1HQM C;  4C3J B;  4H13 C;  5ELC A;  2BCO A;  2OXP A;  3WOE A;  3SVM A;  1L0Y B;  2RBM A;  3J81 E;  2QEJ C;  4K5W A;  3NE5 B;  3NQI A;  1OXT A;  1JWS D;  1FNU A;  3BZD B;  4HMI A;  3SE0 A;  3I70 A;  4IUN A;  4PMW A;  3NSW A;  5IGC A;  4FF2 A;  2DNC A;  1WTO A;  1A3U A;  3ND8 A;  4B9W A;  3FPP A;  5EBD A;  4KD4 A;  1DOM A;  5A2Q E;  4Z9C B;  2NWG A;  2KUM A;  4DNT B;  4HED A;  5FK9 C;  1LT5 D;  1R9T B;  2LKV A;  1J9O A;  1D2B A;  4H7B A;  4DU9 A;  4DAY A;  2YYZ A;  2MGS A;  3S9W A;  4J1M A;  3HOV B;  1LT3 D;  2H4O A;  5C44 B;  3M7G A;  3FPU B;  1F77 A;  2L55 A;  2R6G A;  4FNF A;  3NUC A;  1LTB D;  4MN3 A;  2PZU A;  4E6I A;  3S2D B;  4CGY B;  3D6C A;  5E1F A;  2AWN A;  3R3O A;  4RCO A;  5CV5 A;  1RJT A;  2BA1 A;  4FXK C;  2EY5 A;  1VF5 C;  1D5M C;  2QF7 A;  1BNZ A;  1AZP A;  4U67 3;  1C48 A;  1GUO A;  4X3U A;  4KMU C;  3Q24 A;  2EXZ A;  4R8I A;  3G6J B;  3CU7 A;  1HA5 A;  1V8Q A;  1KNE A;  3I91 A;  3H94 A;  4HCS A;  2Z8L A;  4IUR A;  4ZUI A;  4IFD J;  1O7L A;  2XN9 C;  3MXN A;  4KD3 A;  4A3E B;  1TY2 A;  1LTT D;  5TSS A;  1EY8 A;  2Z4H A;  5KIX A;  2FMC A;  4KN4 C;  5I9P A;  1ONL A;  4OIJ A;  1S5B D;  4V0B A;  1SYG A;  1ESF A;  4Q5V A;  4EGV A;  4HTH A;  4G7Z C;  2B63 B;  5FLX L;  4BS9 A;  4F88 A;  1EY0 A;  2RKS A;  3L3O C;  2F0K A;  2AQ2 B;  5ISR A;  1KAA A;  4IUT A;  4IFD H;  4K5V A;  2KJX A;  1TR5 A;  1Y1V B;  2MP1 A;  3M4O B;  2F0V A;  3SK8 A;  1JE4 A;  1E2V A;  4RHR A;  4G7H C;  1M8A A;  1K83 B;  3HZX A;  2BDO A;  3NTI A;  1WTX A;  1G29 1;  2K03 A;  1RKN A;  2WAC A;  3U9O A;  5IIF A;  2IT1 A;  3T51 B;  3TP8 A;  5C5M A;  1S5E D;  1I3Q B;  1G2S A;  3FEW X;  4QUF A;  2NB0 A;  1GUW A;  1SNM A;  3Q22 A;  4K6L A;  1SNO A;  4BY7 B;  2MPM A;  1FR3 A;  3OHX C;  1GXD C;  2BOS A;  4ZKC B;  2BDN A;  2JA8 B;  2M9V A;  1LTG D;  4OO1 G;  3C1E A;  1A15 A;  5J39 A;  5G3L D;  5C0X I;  5EKI A;  1QE6 A;  3OOC A;  1KAB A;  1V1O A;  5JPM C;  3CKI B;  3J81 L;  4HMJ A;  2RVL A;  4EQP A;  5IGD A;  1UNS A;  3C3L A;  2KHS A;  1PTO F;  2JA5 B;  1HHV A;  2WII B;  4KY5 A;  3A7A B;  3C1F A;  1KDB A;  3A54 A;  2R3Z A;  1I6V C;  3KBG A;  2QDB A;  1LTR D;  4DK0 A;  4H0L C;  3BYY B;  1V1P A;  2A73 B;  5A35 A;  3PIO 3;  2JEB I;  3GD7 A;  4O1N A;  5M3F B;  3H3V C;  3AU7 A;  3N6R A;  3L7Z C;  4NDX A;  4IFD G;  4DF7 A;  1EQV A;  1WTV A;  1SEB D;  1HTL D;  3VYU A;  2F0Q A;  4KY6 A;  1PRT C;  5CV9 A;  3JAM E;  3J80 E;  2WKC A;  4XQQ A;  2Z1C A;  2F1M A;  3S1N B;  1Z47 A;  5KGU A;  2R7Z B;  1JB3 A;  5FO9 B;  1RF2 D;  2K33 A;  3PUY A;  3VR4 A;  2FJ2 A;  1EU4 A;  1SDF A;  2SOB A;  4A3K B;  1QNK A;  1C8C A;  3D3R A;  2TSS A;  1ZXT A;  3NHH A;  1YNN D;  3R93 A;  1STE A;  3UI2 A;  1B3A A;  4XDX A;  3HEJ A;  3T13 A;  1J8I A;  2VUM B;  1DON A;  4U68 A;  1CI3 M;  4B9X A;  1NR2 A;  4RCN A;  1MBY A;  2CW0 D;  3EQL C;  4OIK A;  2J7Z A;  3MC0 B;  2A68 D;  2A6H D;  1UUP A;  1O78 A;  3PO3 B;  3GQB A;  4R8N A;  1PFN A;  2ICI A;  2J4X A;  4QIW B;  2E2I B;  1TS2 A;  5JPN C;  2X6G A;  4BA2 I;  1DCZ A;  5JJZ A;  3NQT A;  1KNA A;  1A3V A;  5CBE E;  5NUC A;  1B9N A;  5EPJ A;  1KTK A;  2EJM A;  2AUJ D;  3GTJ B;  2M00 A;  1PRT B;  1VCI A;  4KJN A;  1QJO A;  4IUV A;  2EY6 A;  4WRD A;  3URY A;  4F87 A;  1JOQ A;  2G9D A;  3A8K E;  4EQN A;  1D5Z C;  3G7L A;  2KCN A;  5BN5 A;  4ZKB B;  4CHT B;  3MXP A;  4PNY A;  4KV6 A;  2CHB D;  3KBX A;  2JXM B;  4OL7 A;  5JVG 3;  4EQO A;  4QUC A;  1GUG A;  2EJG C;  4ME5 A;  3NBI A;  3ONA B;  3OWF A;  3BDC A;  1V43 A;  1HPC A;  2C9O A;  3ND9 A;  1STB A;  3SEB A;  1I4R A;  2B2Y C;  4A3I B;  2B2V C;  3V96 A;  1EY6 A;  5ELF A;  5DM6 3;  2ZXP A;  4RGO S;  2K1B A;  1IYU A;  1OXV A;  3MZ5 A;  3LWE A;  1A2U A;  5FLX E;  2K01 A;  5JEA J;  2F0I A;  3SR1 A;  2IL8 A;  1YNN C;  1CTM A;  3EFX D;  1JCK B;  3W3A A;  3T56 B;  4ZLT F;  4HR7 B;  3IFD A;  3MXG A;  3TP5 A;  2EY2 A;  4XQN A;  2G9H D;  3RD4 A;  2F0W A;  5HUR A;  2K05 A;  1CQF A;  2D62 A;  2CW0 C;  3I8Z A;  2Y0S B;  3QIA A;  5EBC A;  2L0C A;  1GOZ A;  3HOZ B;  3J7Y W;  4G57 A;  4CKE A;  4KKS A;  5JEA H;  4XT3 B;  1Q90 A;  2F0E A;  5IGB A;  1SFO B;  1CA6 A;  2NVX B;  5I4D A;  5C3X A;  3H91 A;  4C3I G;  3GTM B;  3K57 A;  3QO2 A;  1XXG A;  5E4X A;  2EPB A;  1QB5 D;  2QCP X;  3KLS X;  2B2U C;  2ZXR A;  1LAC A;  4UDU C;  2GA4 B;  3M4Y A;  5COY A;  4RFB A;  3IAY A;  2RQX A;  2K5D A;  2PO4 A;  1T5E A;  5JOB A;  1II3 A;  1ET9 A;  2KED A;  2KEC A;  2MUY A;  4KKT A;  1CT1 D;  3R2I A;  1LT4 D;  4L6T B;  2ENB A;  5M9O A;  3QB3 A;  1CQV A;  4FP5 D;  2B2T A;  3T53 B;  3OPO A;  5KND A;  5JAV A;  3S14 B;  5LHY 1;  2TMP A;  3C2P A;  3FKI B;  4XTC S;  1ICW A;  1TT2 A;  5CYU A;  4I7Z C;  1TS5 A;  5M3M B;  2A6E D;  4TRD A;  4RAU C;  3S1Q B;  4L8J A;  3FMC A;  3TP6 A;  1WTP A;  1BBX C;  5KYI A;  1EZ6 A;  2XWB B;  3RLF A;  1PRT F;  3FDT A;  2O5J C;  2LFN A;  2EYO A;  1IL8 A;  1KDC A;  2K6A A;  1A6X A;  1S5F D;  1X32 A;  3P20 A;  1EZ8 A;  5IGF A;  3TBI B;  3VYT A;  2LY7 A;  5JEA G;  2PPB C;  1NCV A;  1EU3 A;  3MVV A;  2CQA A;  2JSO A;  4C3I B;  2F0T A;  3PUX A;  1HA6 A;  4QCL A;  1QIL A;  5I2X A;  1EL0 A;  4CKC A;  4F7X A;  2HCC A;  2PZT A;  4BY1 B;  4OO1 H;  2NZ1 D;  4IFD I;  4R9W A;  5FO8 B;  3KF8 A;  3DWQ A;  3OW7 A;  4JK1 C;  2B2W A;  3SK5 A;  5EKK A;  5IOC A;  2KVM A;  2WV6 D;  1F2M A;  2WAQ B;  5D14 A;  5D3I B;  2A5H A;  3MWY W;  1ZYR D;  5CR3 A;  1D5X C;  4M8A A;  2IW3 A;  4OGQ C;  5CBA E;  1PDQ A;  1IW7 D;  3H09 A;  4CJ1 B;  3CQZ B;  1GHK A;  1HCZ A;  2BA0 A;  1GUN A;  3D4D A;  1TQO A;  4ZRZ A;  5IGE A;  1Y69 U;  2B2U A;  2EOT A;  2F0L A;  1Y8N B;  1U9R A;  1DM0 B;  1IHZ A;  1CHQ D;  3R8B A;  3PUV A;  1C4Q A;  2AQ3 B;  1EOT A;  4K8I A;  3DHQ A;  3K59 A;  3PUZ A;  1XTC D;  5M5W B;  4K14 A;  1PZJ D;  1W6J A;  3VYS A;  1EYD A;  4HSP A;  2VB2 X;  3I4L A;  3FVQ A;  2NVT B;  3HOX B;  3J7A V;  3HOY B;  1CFM A;  4K2L A;  1IKL A;  3K0Y A;  5CV7 A;  1M4V A;  2F0N A;  4V19 0;  2A6E C;  2F0P A;  1OXU A;  4RWS C;  1TII D;  4X3K A;  2E2J B;  3K5N A;  1JOK A;  1EY7 A;  2KA7 A;  2NN6 H;  1K8M A;  4DA2 A;  1EY5 A;  1U4R A;  3OSO A;  4QMG A;  3A55 A;  5ELE A;  1E2W A;  5KYL A;  2JA6 B;  2OF1 A;  4DAV A;  1TS4 A;  2IPK D;  2N88 A;  1QOH A;  2K04 A;  2L12 A;  1BF4 A;  5AFW A;  5EPK A;  1I4P A;  2EYL A;  3A7L A;  4A3F B;  1D1I A;  3GTL B;  3K5O A;  2R92 B;  2L5T A;  1JOR A;  3GTG B;  3P75 A;  1A2T A;  1U4L A;  2HDM A;  5E4W C;  1AFP A;  2VB3 X;  1RHP A;  5IOD A;  1EFI D;  1KDA A;  1HUN A;  1Y8O B;  2F0S A;  1STH A;  1CHP D;  3RZD B;  4KN7 C;  5IT9 L;  1PZI D;  4C3H G;  1U4P A;  1ZYR C;  2SNS A;  4N9T A;  3EA6 A;  2EDG A;  2KCC A;  3KLS A;  1HRJ A;  2HCI A;  2C5C A;  2NVQ B;  2F03 A;  2WP8 J;  5KEE A;  1IW7 C;  1G8Z D;  3HOU B;  3GTO B;  3V05 A;  3R2T A;  1FNW A;  2B8F A;  2F0U A;  2K28 A;  5C5L A;  2AUK A;  3WDN A;  3NWT A;  1S5C D;  4K8J A;  1RTO A;  3ZYY X;  1SNQ A;  2E74 C;  2EE1 A;  2RDG A;  1BR9 A;  1SXT A;  4H44 C;  2ICE C;  3DUZ A;  2RA4 A;  4A3B B;  2NN6 G;  1SNP A;  3K7A B;  1BO0 A;  1SBB B;  1PLF A;  3OIQ A;  1MSG A;  4A3G B;  4HAE A;  1SMY D;  2EYP A;  4KI0 A;  3MHB A;  1CM9 A;  4F8M A;  2D2C C;  3VA5 A;  1KLU D;  1H9S B;  2WIN B;  2BE5 D;  3Q6S A;  1SJE D;  2XSC A;  3BDO A;  1K8O A;  1PTO D;  2X69 A;  2F3W A;  2VXW A;  1XWE A;  4K6D A;  1F2L A;  4FXG C;  3IFT A;  1PXU A;  2YU9 B;  5C4H A;  4HCE A;  3TSS A;  4TQU S;  4DNR B;  4A93 B;  1SND A;  5DAU A;  3CRL C;  4C3H B;  1O7Z A;  4NMZ A;  1NAP A;  1AZQ A;  2LMC B;  1JC7 A;  2B39 A;  5FKA C;  2EYF A;  3H0G B;  1F2Y A;  3VR6 A;  4XT1 B;  3NWS A;  2Z4I A;  1OXX K;  2J0T D;  3ITP A;  4LJZ C;  3PIP 3;  3MAQ A;  1BCP D;  3MXU A;  5C3W A;  2PQE A;  3VA7 A;  4B08 A;  1ZEQ X;  2KEE A;  1EQT A;  5K5P A;  2IWH A;  2EYH A;  1WD1 A;  2RDH A;  2ZT9 C;  1HFG A;  3J7A F;  4J6H A;  3ERO A;  1EY9 A;  3BVG A;  3QOL A;  2JEA I;  3F2U A;  1LO5 D;  3D8G A;  5J22 A;  3HOW B;  3GP7 A;  3SHL A;  3S1M B;  3I90 A;  3EVQ A;  3W2D A;  4IN3 A;  4A3J B;  1F9S A;  2L1B A;  3ERQ A;  5DEH A;  3SDZ A;  1PFB A;  1GUS A;  1ET6 A;  1LLR D;  1GUT A;  1H9R A;  1I50 B;  1ENF A;  3DEO A;  4DK1 A;  5F2D A;  1H9J A;  1D6E C;  4X3T A;  3QWN A;  1BOS A;  2NTT A;  3LWU A;  5CV6 A;  3CRK C;  3I4M B;  3HG9 A;  1AN8 A;  4WFN 3;  4IUP A;  2OEO A;  1B53 A;  1DOL A;  1TS3 A;  1ZKO A;  2EYJ A;  2JE6 I;  1W6K A;  2JP1 A;  3OWE B;  1O80 A;  4KY7 A;  2Q8I B;  1SMY C;  2EYM A;  2FFK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...