1RIPA

Ribosomal protein s17: characterization of the three-dimensional structure by 1h-and 15n-nmr
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
81
structure length
81
Chain Sequence
QRKVYVGRVVSDKMDKTITVLVETYKKHPLYGKRVKYSKKYKAHDEHNEAKVGDIVKIMETRPLSATKRFRLVEIVEKAVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosomal protein
molecule keywords RIBOSOMAL PROTEIN S17
publication title Ribosomal protein S17: characterization of the three-dimensional structure by 1H and 15N NMR.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 2
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 1993-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1ripA00
3EBEA 2OQ0A 2EXDA 1KAWA 2MO1A 1HNXQ 4DV6L 4H02A 4DR3Q 5GAHC 4GOPA 2KHJA 1OXSC 4ALPA 4JI7L 1I5FA 2DGYA 2FXQA 2CFMA 3AYHB 2K14A 4X65L 4OX9Q 2JA8H 5FJ8G 1L1OB 1HH2P 5C44G 2R7ZH 3S17H 4A3EH 1I94Q 4LF7Q 4IPGA 3ZJYC 1X55A 2LXKA 3TRZA 5H1SE 4DK6C 1SFOH 2WAQE 4JI2L 3CCVA 4AQYL 4LF8Q 2WFWA 1VQOA 2GN5A 3RLOA 2E2IH 3PUYA 4HJ7A 3I4MH 4MNOA 1VQFA 3OTOL 4ME3A 2KHIA 1T9HA 3RR5A 3I7FA 1Q81C 4C3JH 1IBLL 2UUBQ 4GKKL 4O2DA 1B8AA 4GN3B 1VS0A 5C3EH 4A3KH 2UXBL 3FHWA 1U5KA 2D0PA 4AH6A 3F2CA 4IPCA 1MIUA 4LUOA 1C0AA 1Y1WG 4UP8A 3KF8B 2XGTA 4TQUS 4JC0A 3ULPA 1G6PA 3PO3H 2OQKA 2YTYA 4IJLA 1IYJB 4HJ9A 1IL2A 1XPUA 4DR6L 3UE0A 5IYBH 2JJQA 3HKSA 3HOWH 4R4OA 5LMNW 4UPAA 1CKNB 2K50A 1L1OA 4C3HH 4DV4Q 1A63A 2N8NA 3JAMi 3H0GG 4DR5L 1Q1BA 4QQBX 3AFPA 3DM3A 3PUXA 1IBML 5IP9H 1SR3A 3F2BA 4HJ8A 1Q86C 5M3FG 4MZ9A 4A3LH 2OTJA 2OWOA 1CSQA 3PIPA 1AE2A 1X3EA 1X6OA 2Y0SG 4R4QA 1YI2A 4JI1L 3CCJA 1TWCH 1LYLA 2JA9A 2PMZE 4R4IA 3GTMH 5IP7G 3LGJA 3PUZA 4JG2A 2JEAI 1P8LA 4DAYB 1J5EQ 2JEBI 1ASYA 4LFBQ 3E0EA 1VQPA 1EYGA 1P16A 4DV2Q 4DR1Q 4JBKA 5C44H 3W1GA 1UWVA 3CP0A 3FP9A 1HNZQ 1NTGA 2Z0SA 2HIVA 4A3GG 2IX0A 3RZOH 1RL2A 4JI4Q 3GD7A 3CCEA 2IT1A 3KDFB 4BA1I 3HOXH 3G4SA 2NZHA 1SLJA 1J6QA 3RNUA 2F4VL 3H3VH 3K80C 2AWOA 2E5LQ 2VW9A 1CKNA 1KRTA 4DV3Q 4DV0L 5K36G 3CW2C 3HOVH 1D8LA 3S1MH 2HHHL 1RIPA 1SRUA 4NXNL 1VQHA 1K9MC 4BY1G 2ZM6Q 3RN2A 4QY7A 1HZ9A 2ALYB 3OYYA 2R92G 2V1CC 4QL5A 4X66L 2VQEL 1HZBA 1X3GA 4L5TA 2YTXA 5GROA 4KHPL 2MO0A 4A3CG 2Q2HA 3AQQA 1VQNA 1V1QA 1BBWA 1PH8A 4JI5Q 4A93G 3AFQA 1WCMG 3S24A 1WI5A 5IYDH 1SN8A 2UXCQ 4Y52H 1FJGQ 2N49A 2WB1E 4APVA 2CWPA 3S1NH 5IT9c 2I5MX 1Z9FA 2UXDQ 3S2DH 4JI6L 1JE5A 3J81c 5M3FH 3KDFA 1C9OA 2R7ZG 1A8VA 2GVBA 4JBJA 4A3EG 3IRBA 1VQGA 3M9BA 2E2HH 1BVSA 3H3VI 1PH1A 3TREA 3W5OA 2JQOA 2A1AA 2KCMA 1IXRA 1S72A 2PQAA 1W2BA 5E7NA 2OTLA 5BR8Q 2IY5B 1EOVA 4X6AH 3G48A 1E1TA 3KJOA 4DK3C 2Q2UA 1Y1VG 4XTCS 1ASZA 1O7IA 5LMNQ 1PH5A 3I4MG 2LXJA 4P72A 4A3GH 4B3TL 1VQ5A 1I6HH 3CC2A 1NJIC 2VQFL 2K5VA 4A3JH 1GM5A 1QUQB 5FLXc 3M7NA 3CCSA 1YJWA 3S15H 5M3MG 1G291 3RLFA 1Q8KA 1PH4A 3PO3G 2RF4A 1Z47A 5IYBG 5FLMG 2JA5G 3OTOQ 1YJNA 1EQRA 3UDXA 4B3SQ 4GKKQ 4IPHA 4DV7L 1XMQQ 2YU9H 5M5YH 1KIXA 2Q2TA 1X3FA 3F8TA 4POGA 2R92H 3BZCA 1PA6A 5IP9G 4DR7L 5IYCH 4DUZQ 1TWGH 3HOYG 4OWTB 3PUWA 1VQLA 4LF5Q 4K0KL 5M5XH 3T1YQ 4KHZA 3UDIA 2PI2A 4OO1I 5ELOA 4DR6Q 4A93H 3J80i 1WCMH 4JI8L 3MXNB 2BA0A 3NENA 4BBRG 4OONA 4YWKA 1KQSA 4NPSA 4BBSH 2DUDA 2N3SA 2VL6A 4B3ML 1N34L 4L5QA 4HIDA 5ELNA 4DR2L 1SROA 1QUQA 3HKZE 4GN4B 2K4KA 2F52A 5GADC 1S40A 3PO2G 1N32L 1TWFH 3H15A 1H95A 4NXML 1VQBA 4RMFA 2VS1A 1WOCA 3JC66 4LWCA 4JI1Q 5M5WH 3HOXG 4JI3L 1HR0W 1V9PA 4LF6Q 4LF4Q 1GKHA 3PSIA 1TXYA 1Y1VH 1N33L 3U58A 2CKZB 1KRSA 2PNHA 2AWNA 3HOVG 5LMUL 3RN5A 3D31A 2D0OA 1PFSA 4LFAL 3U4VA 4A75A 4A3FG 3SGIA 3NEMA 5M3MH 5JJIA 4DPGA 2F4VQ 4QIWE 4A3IH 1PH6A 2YTVA 3JAMc 2IX1A 1IBKQ 5FLMH 2JA5H 1PH7A 2BA1A 4GLAC 3ULLA 5AJ3Q 4NXNQ 3HFZB 5IYDG 2N78A 2OCEA 5GQOA 3Q8DA 2QGQA 3D0FA 1K73C 1BBUA 4A4IA 4QGUA 3GTLH 1FVIA 4LFCL 1Q12A 1I3QH 3HOYH 3PGZA 3F2DA 3KFUA 1HZCA 3S14H 5C4XH 1OXTA 3A0JA 5C4JH 1CSPA 2KCTA 3A74A 1X54A 4BBRH 4LW1A 1GVPA 4OWWB 4UP7A 1UE7A 5GAEC 5GAGC 3TS0A 4AIMA 3GTOH 2I0QA 4DR4Q 5IE8A 4QJFA 2QEXA 1HNXL 3PO2H 3I55A 1UE1A 3CPWA 4DR3L 1VQKA 4DNIA 4IPDA 1VQAA 1TWHH 3CCUA 4JOIC 3CC7A 4A76A 4A3JG 3HKZG 4JBWA 3WWVA 4YY3L 4OX9L 2CQOA 1JT8A 1I94L 3CCRA 1E3PA 3I56A 4LF7L 1NBWA 3KYHC 3K7AH 3TEHB 1FGUA 4YCWA 2WAQG 4A3DG 3I2ZA 4NB3A 2PQAB 1WYDA 2KBNA 2NN6G 4IO9A 4B3RQ 4IOCA 1XMOQ 4KLKA 3KF6A 4BA2I 2UUAL 3FKIH 3ICEA 4A3FH 1OXVA 1VCIA 2AMCB 4FDBA 1KHIA 2VQFQ 2CWAA 2ZTCA 5IYCG 3STBD 2NVYH 4LF9Q 1U0LA 2Q2IA 1XNQQ 4LUZA 1HR0Q 1CKOA 3KOJA 1B7YB 2UU9L 2E8GA 4L5SA 4BBSG 1S3OA 3CD6A 2YV5A 2ZJPA 4AYBE 3VDYA 1PH3A 2EQSA 2JK8A 4O0AA 4JCVE 4Y7NH 1YBYA 4C2MH 3ERSX 3PV0A 2QA4A 4RG1A 2K75A 5J3BA 1W3SA 1N36L 1QVFA 1EFWA 2GVAA 1PV4A 5JEAG 3NELA 4DV6Q 3G71A 3S2HH 2K52A 2LSSA 4JI7Q 4DUYL 4B3MQ 1KL9A 3M4QA 4X65Q 3CXCA 1SMXA 4DR2Q 1OTCA 3PIOA 1N32Q 4GNXA 3G6EA 4BXXG 4P74A 4NXMQ 1J5EL 2BH2A 4EX5A 3I4NG 3S1RH 4DR1L 4DV2L 4R4CA 4JI2Q 1QVGA 2D62A 4AQYQ 1HNWL 3T1HL 1M90C 1HNZL 4A3IG 1Q1EA 1K3RA 3F1ZA 4HIOA 1E22A 4A3DH 1QZGA 3EN2A 3ER0A 4YCUA 2XTIA 1EQQA 2WP8J 4YWLA 4JYAL 1IBLQ 3K7UC 4JBMA 1XNRL 4KI0A 4YHHL 4DV3L 2ES2A 1KXLA 4IOAA 3STBC 1EIYB 2UXBQ 1WJJA 2CCZA 4JV5L 2Z6KA 1XJVA 4JI0L 2HT1A 1DGSA 3K81C 3J80c 2ID0A 4A3MG 4PZ7A 4GKJL 5C4XG 5C0XG 1VQ9A 2R7DA 5JEAJ 4EQ5A 4GNXC 4A3BG 4DKAC 3KJPA 4PZ8A 2B29A 2AHOB 3B6YA 4DR5Q 3S16H 2KENA 4JI5L 1VQ4A 1IBMQ 2RHSB 1YJ9A 2B63G 3GTQH 4BY7G 2NVTH 2AKWB 2WB1G 4IFDG 2UXCL 4X64L 2Y0SE 3W1BA 1MJEA 3M4OH 2NZOA 4OWXB 1IZ6A 3L0OA 2Z6KC 3TQYA 2NN6I 2UUCL 2MQHA 2ASBA 1UEBA 1E7ZA 4YWMA 1XPOA 5BR8L 3EIVA 2R93G 4BXXH 3S1QH 4GN5A 1XTDA 2I5HA 3FKIG 3I4NH 1QVCA 5LMNL 3PF5A 1Q7YC 1C7YA 2VUMG 4YY3Q 2BH8A 5IWAL 1NE3A 5C0XJ 4DV0Q 1AE3A 1E1OA 2ZTDA 4OXPA 2MNAA 3OW2A 1XPRA 4DV5L 2HHHQ 2ATWA 1FL0A 1K8AC 4JOIA 1VQEA 4DV1L 2UUAQ 1K0RA 3K0XA 4X62L 1PH2A 4POFA 1NMGA 3PCOB 1WFQA 2HQLA 3J7ZC 4B3SL 4IFDJ 4A3MH 4X66Q 1JJCB 3KF6B 2VQEQ 5JJLA 4PZ6A 1XMQL 4KHPQ 5DLQE 3BZKA 2IHEA 2H5XA 3GTPH 4GOPC 1N9WA 5EAYA 1Q46A 1YEZA 4DUZL 1PHJA 2JA7G 4GS3A 1JJ2A 2UU9Q 4LF5L 1YZ6A 3M85A 1MJCA 3UDFA 3T1YL 2NVXH 1YHQA 2B63H 3U50C 2PI2E 4JI6Q 1X9NA 4LUVA 1QZHA 1A0IA 4BY7H 3GTJH 1VQIA 1EUJA 4WJ4A 1OXUA 1M1KC 1D7QA 1JMCA 1N36Q 1YVCA 1K8GA 4A3BH 1PVOA 1PYBA 4LNQA 1TWAH 3HOUG 4DUYQ 1I50H 5HGQA 1PH9A 4LF6L 4LF4L 2R93H 4OO1G 4B3TQ 1UE5A 2K5HA 4XIGS 1VQMA 4LF8L 1YHAA 1BKBA 1NY4A 3CCLA 1E24A 5HY6A 2VUMH 1NMFA 5FJ8H 2UUBL 4GNXB 4YCVA 5C0XI 2E2JH 2F3IA 3T1HQ 1HNWQ 1L2FA 1UE6A 2K5NA 2VY3A 1PYSB 1SE8A 2ZTEA 4P75A 1L1OC 1K83H 4GLVB 1YIJA 3M4PA 3M3YH 4JYAQ 4DV7Q 1XNRQ 4YHHQ 3ULJA 1HZAA 2HIXA 2R7FA 3K8AA 4PG3A 1IBKL 4IFDI 4JV5Q 3CMEA 3UDGA 4JI0Q 4HIKA 4DR7Q 4DV4L 4K0KQ 1HJPA 3I4OA 5AJ3L 3HOZG 1CKMA 3CMAA 4GKJQ 4J15A 1Y1WH 1B70B 4JI8Q 2JA7H 2JA6G 4R4TA 3TS2A 1MKHA 2ZJQA 3DLLA 3J7A5 4WJ3M 2R6GA 1N34Q 1KD1C 3RZDH 1KC8C 3KLWA 3CCMA 3CCQA 3CQZH 3H0GH 1N8RC 4L5RC 4R1JA 3RLNA 4TVAB 4X64Q 1YITA 1Y14B 4LFBL 4IJHA 1G51A 4DR4L 4JI3Q 2JA8G 4C3IH 4UY8C 1VQ8A 3HOUH 1YHBA 4JI4L 1N33Q 3BJUA 3PF4A 2YYZA 2JE6I 2UUCQ 3J81i 2VZAA 1A62A 5IY0A 5LMUQ 5IP7H 1EWIA 1LTLA 2E5LL 3A5UA 4P71A 1EIFA 4MTNA 1GO3E 1OXXK 1VQJA 3GO5A 4P73A 4LFAQ 2RCNA 1CUKA 4PMWA 3CC4A 3E9IA 2C35B 4GOPB 1L0WA 2IHFA 3GTKH 4GLXA 1R9TH 4B3RL 1XMOL 2ZM6L 2NVQH 3U4ZA 4DAMA 5IWAQ 5C3EG 1JB7A 1X56A 4A3KG 4HIMA 4UP9A 2A19A 3CPFA 4DV5Q 3A5ZB 2I5LX 1LUZA 2EIFA 1AH9A 3CAMA 1V43A 2B3GA 2ZJRA 1Q82C 4HJ5A 1GD7A 4DV1Q 4LF9L 3E9HA 1XNQL 1HR0L 3BU2A 3MEFA 4X62Q 2A8VA 5JJKA 1VQCA 4LFCQ 3HOWG 3J81j 3L2PA 3HOZH 1JJGA 1VQ6A 2L15A 2MFIA 3CF5A 4BY1H 3PUVA 3UE1A 1FJGL 4AYBG 2UXDL 3AEVA 4HJAA 3L7ZC 2RHQB 2VNUD 1VQ7A 3GTGH 2JA6H 4A3LG 1VQDA 3NBHB 1YNXA 1LM0A 4A3CH 1X65A 3GDEA
chains in the Genus database with same CATH superfamily
3HOWB 3QR8A 2FJ2A 2MO1A 4C3HB 4DV6L 4H02A 4ALPA 4XQQA 1I5FA 5IGFA 2E75C 5FJ8G 1I94Q 4LF7Q 1I50B 1PTOB 4I65A 1TWCB 3GTMB 4LJZC 3I90A 1STNA 4JI2L 1QNKA 1K0SA 1SNPA 1LT3D 5IGCA 2WFWA 4LF8Q 2GN5A 3OWFA 3D4RA 3MFGA 3RR5A 1T9HA 1PTOD 4O2DA 1B8AA 4A3KH 3FHWA 2D0PA 1PZJD 2BDOA 1HUNA 4KK7A 2XGTA 3PIP3 1AW7A 1HHVA 2L4NA 3P75A 1WTPA 1KLGD 3UE0A 1B50A 3HOWH 4R4OA 4C3HH 2HUGA 1D5XC 4DR5L 1HPCA 1Q1BA 5CBAE 4RHSA 3F2BA 4HJ8A 2TSSA 4ZYSA 4MZ9A 4X3UA 4K6LA 2OWOA 1STGA 2G5DA 1CSQA 2XIWA 4R4QA 1UUPA 3KLSA 1VF7A 3CRKC 1PZKD 1TWCH 3GTMH 2PMZE 3LX0A 5IP7G 3LGJA 4ULLA 1HUMA 1CM9A 1P8LA 2JEBI 5BN3A 4DV2Q 1M4VA 1LTTD 1U4LA 1UWVA 3CP0A 4LAAA 3VYSA 1NTGA 2VB2X 2HIVA 5C3WA 2E2HB 2F0QA 1RL2A 1SE3A 3GD7A 4UAIA 4BA1I 5FKAC 3HOXH 1CTMA 5KGUA 3G4SA 4L8JA 3K80C 2AWOA 2E5LQ 4DV0L 1R9TB 1D8LA 4WJWA 3M7GA 1K9MC 4BY1G 3RN2A 1DYQA 4MHEA 5ELCA 3VR4A 2R92G 1HCZA 1HZBA 2YTXA 4KHPL 4IZ8A 3AQQA 1PZID 1VQNA 4DAYA 1PH8A 4BY1B 3AFQA 2EY2A 5C5MA 2F0HA 4RCNA 2N49A 2WB1E 2UXDQ 3OIQA 1TWGB 2RBMA 1BOSA 1JE5A 4JI6L 3KDFA 1FD7D 2R7ZG 3IRBA 1VQGA 2E2HH 3H3VI 1W2BA 2OTLA 5BR8Q 3OPOA 4DK3C 1LABA 3MFYA 4XTCS 2JA8B 2R7ZB 3I4MG 3LNNA 1FGBD 2LXJA 1JC7A 1SMYD 3HZXA 1NJIC 1QUQB 3CCSA 3S15H 1G291 1LT6D 4K5WA 1Q8KA 3I4MB 3PO3G 1RTOA 2V4DA 2RF4A 4C56C 1MD2D 1Z47A 1BNZA 4Z9CB 3TP5A 5FLMG 4OIKA 2JA5G 1YJNA 4IPHA 1F2YA 5KYLA 4XQJA 5EQ0A 4IUNA 4UHVA 3F8TA 2L5TA 2R92H 3BZCA 3A8JE 5IYCH 3PO3B 1TWGH 2PW5A 2EY1A 5COYA 3T1YQ 3TMEA 2PI2A 2B39A 2PCFB 5ELOA 1BXTA 4BWGB 3MXNB 4OONA 2N3SA 4E6IA 2VL6A 1N34L 4HIDA 1RJTA 4KKSA 1N32L 2A68C 5C4JB 1H95A 5C4ZA 1SNMA 4LWCA 3TP6A 4JI1Q 2XN9C 4JPBW 4LF4Q 4IUUA 4I7AA 2KEDA 1GKHA 1TXYA 1N33L 5C44B 1WTXA 2CKZB 3HOVG 5FLXL 1B53A 5EJWA 3Q0AA 3FVQA 1FNVA 3U4VA 4R9WA 2G9DA 5JJIA 4DPGA 1PMRA 4A3IH 2F4VQ 3HOVB 3S1MB 1JB3A 5FLMH 2JA5H 4RWSC 4GLAC 4XQNA 5AJ3Q 4NXNQ 2N78A 3Q8DA 3R2IA 1GUOA 2Z4HA 5KEEA 5C4XH 1OXTA 3A0JA 5I2YA 3FPPA 5C4JH 2KCTA 1GHKA 3UI2A 1PXUA 3K59A 4OWWB 2ZT9C 1UE7A 1PFBA 4HTHA 4AIMA 3EVQA 4UDUC 2Z8LA 4KKUA 2BE5D 1VQAA 2BCOA 1JT8A 3WWVA 2CH4W 1RTNA 2EY6A 1I94L 3CCRA 4LF7L 2WAQG 2B2UC 4A3DG 4A3GB 5DAUA 1WYDA 4DAVA 1RD9D 3JAML 3VA5A 1VCIA 2VQFQ 3DMUA 3C46A 2WAQB 4HN7A 4LF9Q 3HGBA 1XNQQ 1AFPA 2M2LA 2PQEA 5M5YB 5HGTA 1I4QA 4BBSG 1S3OA 3CD6A 1DXMA 5BN5A 1PH3A 2A5HA 5M5XB 2IJ0A 3ERSX 4FF4A 4G7ZC 5J3BA 1W3SA 1N36L 1TY0A 4BBSB 3G71A 2K52A 4B3MQ 1VMPA 1SMXA 3E3XA 2VXWA 4BXXG 1WTWA 1V1PA 3C1FA 2F4IA 3E5SA 1A3VA 4NXMQ 3S1RH 4DV2L 1SJED 3CKIB 4AQYQ 3T1HL 1C8CA 1Q1EA 5A2QE 4HIOA 4A3DH 3DM1A 4YCUA 1EQQA 2WP8J 1I4GA 4YWLA 2O2LD 1XNRL 1EIYB 5M3MB 3TP8A 3OSOA 4CJ0B 3J80c 3K81C 1KDAA 4PZ7A 2F0SA 5C0XG 4FXGC 4EQ5A 3SDZA 2EYJA 4X3SA 3BDLA 5IGEA 2K5DA 5ISRA 3I73A 1K3BC 3S14B 4RHRA 2RVLA 2AKWB 4IFDG 2KHSA 1AZQA 3W1BA 2K03A 1MJEA 2Z6KC 5EKIA 3PMFA 5E4WC 4KJOA 2ASBA 1E7ZA 1XPOA 5K5PA 1B1ZA 3VYTA 5KNCA 5BR8L 4BXXH 2I5HA 3FKIG 1JOKA 1Q7YC 1ESRA 3K7AB 4RCOA 2A6HD 5IWAL 1E1OA 2ZTDA 3BYTB 1PRTF 4PMBA 2HHHQ 3SK8A 3FKIB 1FL0A 1K8AC 4FNFA 3WOFA 3FRPB 1VQEA 2UUAQ 1K0RA 3K0XA 4PV1C 1BDOA 4POFA 1QB5D 3KLSX 4Q5VA 2ZXOA 1GUTA 5C0XH 2DJGC 3IFTA 1QWYA 4RH6A 5EAYA 1PHJA 3NUCA 3ND9A 2JA7G 3Q6SA 1YZ6A 3T1YL 2MJ8A 4H7BA 1YHQA 1V1OA 3OIPA 1SEBD 1EWCA 3U50C 4Y7NB 4C2MB 5D65A 3GTJH 1VQIA 3T4AC 1H9SA 2HQEA 1M1KC 2Z1CA 3MA2B 1PVOA 1TWAH 1F2MA 4LF4L 1JWSD 1UE5A 2AQ2B 2HCIA 1NY4A 3HRZC 4QMGA 2FINB 2UUBL 1IKMA 2F3IA 2ZTEA 2K5NA 2VY3A 4ABNA 1YIJA 1BUVT 1G8ZD 2F0NA 4JYAQ 4CDEC 1HZAA 2HIXA 3K8AA 3GTKB 5C6AA 4KHVA 1O7ZA 3PIO3 1NNXA 4HIKA 4JI0Q 1KAAA 5AJ3L 1IYUA 4ZKBB 4DFAA 1Y1WH 4JI8Q 2JA7H 1SAPA 2KVMA 2JA6G 2O5IC 3TS2A 2ZJQA 3DLLA 2R6GA 1KC8C 1NR2A 1FR3A 3CCMA 4KD4A 4L5RC 2WKDA 4X64Q 5TSSA 2JA6B 2QW7A 1DD2A 3BDCA 5M9OA 1XXGA 2F3VA 4UY8C 1VQ8A 4YIJA 3V96A 1TKWB 2E74C 4WFN3 1BCPB 2UUCQ 2VZAA 2O4XA 4K8IA 5T1IA 1O80A 3K5MA 2O5JC 1A6XA 2K7VA 1EIFA 4MTNA 1KNEA 4P73A 1VQJA 3GO5A 4LFAQ 3NTKA 3E9IA 4GOPB 1L0WA 3GTKH 1BCPD 2ZM6L 3L3OC 3U4ZA 4J8QA 5C3EG 1JB7A 4C1NI 2NVQH 4HIMA 5KRUA 1CI3M 1EYCA 1U4RA 2NB0A 3CAMA 4LF9L 1IL8A 3EA6A 4HJ5A 4DV1Q 1XNQL 3MEFA 4X62Q 4RKBA 1II3A 5T1GA 3J81j 5C3EB 1JJGA 2EYOA 3CF5A 3UE1A 2NZ1D 4AYBG 2B2VA 1ESFA 2VNUD 3GTGH 2JA6H 4A3LG 4A3BG 3GDEA 2OQ0A 2AQ3B 4AYBB 4DR3Q 2KHJA 1OXSC 5LL6S 2IWHA 2DGYA 2FXQA 2CFMA 4TSSA 4A3BB 1L1OB 3S17H 4A3EH 4XT1B 1H9SB 4KY6A 1X55A 1ILQA 2A69C 2WAQE 4AQYL 3OWEB 2VUMB 1UEAB 3PUYA 1HXYD 4HJ7A 4MNOA 3C1EA 1WVLA 2E2JB 2KHIA 4GKKL 2XVSA 5C3EH 3NBHA 3A8IE 3MXPA 1TQOA 4IPCA 4TQUS 3OMCA 1HQRD 2YTYA 4HJ9A 4DR6L 2JJQA 3HKSA 1IHZA 3SVMA 4UPAA 4IUTA 1CKNB 4DV4Q 2DNCA 1SNQA 2N8NA 3H0GG 3JAMi 4ZKCB 1PTOF 5I4DA 1Q86C 4A3LH 1LO5D 2X6GA 3RZDB 1X3EA 1X6OA 1ENFA 1ML0D 3CCJA 1Q90A 2JA9A 3H91A 3H0GB 1S4ZA 2K5WA 2JEAI 2JP1A 2B2YA 4R8IA 1EYGA 1P16A 1WTOA 4JBKA 4FVMA 3HOUB 2A73B 5KNBA 2Z0SA 1JQYD 2IX0A 3RZOH 4JI4Q 1ZXTA 3GV6A 2IT1A 1S5CD 3GV3A 1SLJA 1QOHA 4RGNA 4RKLA 5K36G 3DWQA 2HHHL 1I6HB 4MTKA 4MIUA 4HCSA 1HZ9A 2ALYB 2F0KA 4L5TA 3EFXD 1O78A 4A3CG 4EGVA 4CJ2C 4A93G 4DN4M 3S24A 5IYDH 2UXCQ 2F0PA 5FO8B 4K2KA 3S1NH 4APVA 1TU2B 3J81c 5BN4A 4JBJA 4A93B 1GOZA 4BS9A 4H0LC 2J0TD 2JQOA 2X69A 1SSOA 4X6AH 1EOVA 4MN3A 1E1TA 3KJOA 5EKKA 3T53B 2Q2UA 2B8FA 3D4DA 1G91A 1O7IA 5LMNQ 1JR0D 4P72A 2FMCA 2NYZD 1I6HH 3CC2A 4A3JH 3M7NA 1MHWC 4WRDA 2CH4A 5EGTA 2H4OA 3RLFA 3H94A 1S5DD 1W6KA 3OTOQ 1SNDA 1X3FA 1EZ8A 1PA6A 3NBIA 3ND8A 4DUZQ 1VQLA 3X3MA 3UDIA 4A93H 4JI8L 3OW7A 1C48A 4BBRG 1LTID 3HG9A 3ITPA 4RGOS 1DOLA 1I3QB 2Z4IA 5ELNA 1IW7D 1SROA 1QUQA 2K4KA 1V8QA 1WTHA 1VQBA 2KECA 5D3IB 5ELEA 4BBRB 1TS3A 3JC66 3OMGA 3DWPA 3HOXG 4FP5D 2HDLA 5KNDA 1EWHA 4HCEA 3HOXB 4LFAL 3I3CA 4U68A 3QOLA 4TRDA 3MXNA 1Y69U 3MTSA 2DY7A 1IBKQ 5IGDA 1PH7A 2BA1A 2LKVA 1TR5A 1H9JA 3HFZB 4M8AA 4A4IA 3GTLH 1I3QH 2NVYB 2QDBA 3PGZA 2Q8IB 5LHY1 4TKOB 1HTPA 3A74A 4BBRH 1E2ZA 2F0WA 1TT2A 2N55A 2NBFA 2EXZA 1NR4A 1KDCA 5GAEC 3TS0A 3GTOH 4V0BA 1CHQD 2QEXA 3KBXA 1LACA 3IKJA 4DR3L 1JOQA 3CPWA 1PRTC 2K04A 2M00A 1JICA 3HKZG 4YY3L 2CQOA 3I56A 5HURA 1NBWA 3TEHB 1FGUA 4YCWA 4DK0A 2NWGA 2KBNA 4B3RQ 4IOCA 5CV8A 3KF6A 4G7HC 3ICEA 3S15B 1OXVA 2K1BA 1KHIA 5IYCG 2ENBA 2NVYH 1F2LA 1SYCA 1HR0Q 2UU9L 2R3ZA 1A15A 2R92B 2IPKD 3NQIA 2JSOA 4AYBE 3SR1A 2EQSA 4O0AA 1YBYA 2B2WA 4ZAIA 1QVFA 2GVAA 3VR6A 1VMCA 1KL9A 3M4QA 1TS4A 2NUCA 4DR2Q 3PIOA 4QF4A 4GNXA 1B44D 3G6EA 4P74A 4EX5A 3I4NG 2PZTA 1HNWL 1M90C 4CKBA 4A3IG 5IT9E 3SHLA 3Q24A 2F03A 5D14A 3ER0A 5J22A 3N6RA 3K7UC 4JBMA 4YHHL 3I4NB 3STBC 3QG1A 2EZVA 4JV5L 5J39A 4OIJA 4A3IB 4A3MG 2JA5B 4GKJL 1CT1D 5A2QL 5C4XG 3RMHA 1VQ9A 5JEAJ 4DKAC 4F88A 3KJPA 4PZ8A 2B29A 3NQTA 3B6YA 1KLUD 3S16H 1LT4D 4A3MB 2RHSB 1YJ9A 1IBMQ 4I7ZC 4BY7G 5C4XB 3VYRA 2NVTH 2UXCL 2XSCA 1SJHD 5CMDA 4OL7A 2NZOA 1I6VC 2NVXB 3L0OA 4XYOA 1AP0A 1SE4A 1SYGA 2NN6I 3LWUA 1UEBA 3EIVA 2R93G 3S1QH 4GN5A 2RA4A 5I6WA 1QCBD 1QVCA 3I4NH 5LMNL 3MWYW 1ICWA 1C7YA 2RQXA 1AE3A 2MNAA 2R93B 3MXUA 3A55A 3D8GA 2B2VC 4DNTB 4DNRB 4A3MH 1JJCB 3KF6B 5JJLA 1Q3LA 1I4PA 2H5XA 1Q46A 1YEZA 4DUZL 1G6ZA 3M85A 1MJCA 5EKLA 3UDFA 4CDFC 2NVXH 4OELB 2F0FA 2EYPA 1X9NA 4BY7H 4WJ4A 4H44C 1D7QA 2C5CA 2L12A 4DUYQ 2XWBB 3CQZB 2R93H 4B3TQ 3VR5A 5I6YA 1YHAA 1SDFA 4IUQA 1BKBA 3S1RB 1H9KA 4LF8L 2F3WA 1PFMA 3W2DA 4GNXB 1LTAD 4CHTB 4A3DB 3NTHA 2DN8A 1UE6A 1PYSB 2F0TA 2QEJC 4GLVB 5CV5A 1PTOC 4RAUC 5EPJA 4PG3A 1IBKL 3UDGA 4DR7Q 2PO4A 5NUCA 2XWJB 4K0KQ 1HJPA 3I4OA 3HOZG 1MI2A 3BDOA 3CMAA 3FDTA 4QIWB 5JAVA 4J15A 1B70B 2NTTA 2OT2A 3MAQA 1MKHA 2XNAC 3HOZB 1UAPA 3KLWA 5C5LA 3F2UA 3CQZH 1CA6A 4IJHA 1G51A 1DZ1A 4C3IH 2L9HA 4QCLA 3PF4A 4HEDA 4HSPA 1ONLA 3DEPA 5LMUQ 1LTLA 2E5LL 3NWTA 4X3TA 3A5UA 4P71A 2EOTA 3L9AX 4RA8A 1OXXK 1J9OA 2IHFA 4B3RL 1PLFA 5D3DA 4GLXA 4C3JG 3C2PA 4UP9A 2C9OA 2JXMB 4DV5Q 2EIFA 1KNAA 1JORA 1V43A 2E2IB 3E9HA 1HR0L 4C3JB 5JJKA 1VQCA 2BOSA 2EJFC 2B8GA 3L2PA 1VQ6A 1B9MA 3HOZH 2MFIA 2UXDL 4FF1A 3L7ZC 2RHQB 1BCPF 1YNXA 1X65A 1STAA 3EBEA 4ME5A 2EXDA 3GTJB 1HNXQ 2X6LA 1EOTA 5GAHC 4GOPA 3X3NA 5JJZA 4HR7B 1EQVA 3AYHB 4OX9Q 1HH2P 1TWAB 4LK1C 1GUWA 1RF2D 1SFOH 1S5BD 1I4RA 1ZYRD 3A7LA 3TSSA 1SMYC 2ICEC 1O7YA 5CV9A 5JPMC 2E2IH 1VQFA 4ME3A 3I7FA 1Q81C 4C3JH 1B2TA 4GN3B 1CQFA 1D1KA 1Y1WG 4UP8A 3KF8B 3ULPA 2K32A 2OQKA 1E2WA 4IJLA 1IL2A 4OHJA 5IYBH 4DGZA 2K50A 1L1OA 1K8OA 1A63A 2WV6D 1Y1WB 4QQBX 2JA7B 3PUXA 1IBML 2EYMA 5IP9H 2F0MA 5M3FG 4ZRZA 3PIPA 1AE2A 2Y0SG 1YI2A 4JI1L 1LYLA 5EPKA 4IUVA 3PUZA 4JG2A 3S2DB 5M3FB 3QWNA 1ASYA 3E0EA 1RDPD 4LFBQ 4DR1Q 1FYCA 1BF4A 5CC4A 2Y0SB 3ONAB 3H3VH 2F4VL 2VW9A 1CKNA 1KRTA 4DV3Q 1YNND 3ZYYX 2NVQB 1RIPA 4NXNL 3NXWA 2VB3X 2B2TA 4JW0A 3I91A 4QY7A 3V2TA 2DJFC 3U9SA 1GUGA 2F1MA 4K5XA 2MO0A 2WINB 1D6EC 4DU9A 1EEID 1BBWA 1WCMG 2YU9B 3URYA 1FJGQ 3R93A 2L0CA 4KY7A 4NP5A 3GTGB 3VR3A 2I5MX 3S2DH 4ILWA 5M3FH 3QB3A 1C9OA 4A3EG 4ZK9B 1BVSA 1WCMB 1PH1A 3QO2A 3TREA 2SDFA 2A1AA 2J4XA 2KCMA 1STEA 5E7NA 3RUZA 1DCZA 1Y1VG 1PYWD 3MVVA 3S17B 1I4XA 1PH5A 2BE5C 4A3EB 2OEOA 4H13C 4B3TL 1G2SA 4L6TB 1SNOA 3BG3A 2VQFL 2N88A 5FLXc 1GUNA 2EYHA 2GA4B 1XX8A 2KQ3A 4KN4C 3J81E 2B2WC 4B3SQ 2JN4A 4CDCC 3G6JB 2SOBA 1XMQQ 2YU9H 4FF3A 2J7ZA 4XT3B 4DR7L 4K0KL 3HOYG 4OWTB 3PUWA 1CQVA 4FO2A 4KHZA 1WCMH 3J7AV 2BA0A 3NENA 2HDMA 4NPSA 2DUDA 3MEHA 1GUSA 4B3ML 3TN2A 4L5QA 1JWMD 5GADC 4GN4B 3PO2G 2E76C 3H15A 4NXML 3GQBA 4RMFA 1DJRD 1TY2A 2VS1A 1WOCA 5M5WH 1V9PA 1EY0A 1BR9A 3CHBD 3PSIA 1Y1VH 3R2TA 1KABA 3PO2B 2AWNA 5LMUL 1HFGA 5C4HA 3RZOB 3EQLC 1CHPD 1DONA 4A3FG 2MHVA 3SGIA 2F0VA 4QIWE 1PH6A 2EDGA 2K01A 2YTVA 3JAMc 1D1IA 1U4MA 5IYDG 2KOLA 4A3FB 1S5FD 3K57A 2QGQA 1H9RA 1BBUA 4QGUA 1FVIA 2K05A 3HOYH 5ELDA 2B2UA 3AMUA 1CSPA 2Z9HA 1X54A 3P1HA 3TZDA 3S1NB 4UP7A 4KN7C 5DM63 1H9MA 2KEEA 1B3AA 2I0QA 5IE8A 4QJFA 1HNXL 3PO2H 3I55A 1UE1A 4C1NK 4DNIA 3P7JA 1EZ6A 4IPDA 1TWHH 3CCUA 4OX9L 3CC7A 4A3JG 3WDNA 2Z6BA 3S2HB 1E3PA 4NW2A 5AFWA 5EBDA 3I2ZA 4NB3A 4WORA 2XRSD 3EJIA 4IO9A 2R61A 1XMOQ 2A6HC 4A3JB 1R4PB 2UUAL 4BA2I 3A56A 4DXGA 4IQZA 4A3FH 4FDBA 2CWAA 2HCCA 3VA7A 2TMPA 3STBD 1SNCA 2Q2IA 3FEWX 1CKOA 2E8GA 1LTBD 2D9UA 4L5SA 1FNWA 2K6AA 2YV5A 2ZJPA 3VDYA 2JK8A 2F0IA 3OOCA 1EEFD 1L0XB 4JCVE 5IGGA 1F2ZA 3P20A 4OGQC 2K75A 2Q8TA 4EVOA 1GJXA 1EIGA 1EFWA 1IKLA 3NELA 2A68D 3S2HH 2KA7A 2LSSA 4JI7Q 4F7XA 4X65Q 1HA5A 2F0DA 3CXCA 1OTCA 1N32Q 3E6ZX 4F87A 2SNSA 4B9XA 4DR1L 4R4CA 1QE6A 1E22A 1QZGA 3EN2A 3SE0A 1EY9A 4JYAL 1A2UA 1IBLQ 2MUYA 4KI0A 4DV3L 2ES2A 4IOAA 2UXBQ 1WJJA 1T5XD 2Z6KA 4JI0L 1BQQT 2PW7A 1ZEQX 4KJNA 1T5EA 4CKCA 5IT9L 3QOJA 5CBEE 1ICFB 1YNJC 2XRQD 3GTLB 4NKLA 1MBYA 1ZKOA 2B63G 1QJOA 4X64L 1B3QA 5IOCA 2Y0SE 2JYOA 2EY5A 4OWXB 1EYDA 4KV6A 2B63B 3GTOB 2UUCL 2MQHA 4FXKC 4K5VA 3G7LA 1MGSA 2F0OA 4RGTA 5G3LD 2BH8A 1CZGA 2I46A 5C0XJ 4OXPA 1XPRA 1CK1A 2HD3A 1Y8NB 2MGSA 3J80L 2ATWA 2F0UA 4JOIA 2DY8A 1BCPC 4DV1L 4RGMA 4X62L 1PH2A 1NMGA 4DA2A 2HQLA 4IFDJ 4B3SL 4X66Q 2VQEQ 4PZ6A 2K33A 1XMQL 5DLQE 2CVRA 3M3YB 4PNYA 2OF1A 3GTPH 1HA6A 5FO9B 4GOPC 1JJ2A 1G2TA 3MHBA 4HAEA 2B63H 1HRJA 4LUVA 3D6WA 1EUJA 1OXUA 1LTRD 1N36Q 1YVCA 3SK4A 1K8GA 5JOBA 2PPBC 4NDXA 1I50H 5HGQA 1X3QA 1PTOH 4FXDA 2EYFA 4XIGS 3TBIB 3HKZB 2M9VA 3GP7A 2MP1A 3S9WA 5FJ8H 1LTGD 2ZXRA 4YCVA 4ZUIA 5C0XI 2IX3A 3T1HQ 1GHJA 2F0EA 4G4KA 1Y8OB 1SE8A 2RSNA 4P75A 2EJMA 1L1OC 3M3YH 3M4PA 3NWSA 3DXJC 1Y8PB 4DV7Q 1XNRQ 2A6EC 3A8KE 3VYUA 4IFDI 3CMEA 1EY7A 3BZDB 3BVZA 5CORA 3AB9A 4DV4L 2G9HD 1I4HA 5E4XA 4DAPA 4ODGA 3SXHA 3T16A 4R4TA 3I70A 3CRLC 3S16B 4WJ3M 2LY7A 2NVTB 1LV9A 1SYDA 1N8RC 3D4WA 4R1JA 3RLNA 2MPMA 2QDLA 4TVAB 1Y14B 4XXEA 1D5ZC 4JI3Q 1NSNS 2JA8G 1FNUA 3MZ5A 4DK1A 4JI4L 2JE6I 3BVMA 4O1NA 5IY0A 2B2TC 3S1QB 5IP7H 1A3UA 4IALA 4IURA 2EE1A 1WTQA 3CC4A 1CUKA 1ET6A 2Q8RE 1R9TH 3CU7A 1XMOL 4R8NA 5IWAQ 1X56A 2A19A 3CPFA 3DHQA 2I5LX 2CW0C 1LUZA 1AH9A 1Q82C 1GD7A 3BU2A 4QUFA 4LFCQ 1ET9A 1A2TA 4BY1H 4KTAA 1VF5C 3AEVA 4PQXA 4HJAA 1VQ7A 3SK6A 3T51B 1DOMA 1LM0A 1RODA 4JC0A 1XPUA 2H1EA 4BY7B 3HP3A 3J80E 1ILPA 1M8AA 1KAWA 5JVG3 2NTSA 1EY5A 3C3LA 1XTCD 4JI7L 2PZUA 4B08A 4X65L 2K14A 2JA8H 2R7ZH 3EROA 5C44G 1A3TA 1K28A 4IPGA 3ZJYC 1NAPA 2LXKA 3BS1A 3TRZA 5H1SE 4DK6C 4K8JA 3CCVA 5JVH3 1TVXA 1VQOA 3RLOA 3I4MH 3OTOL 4P2CB 1IBLL 2UUBQ 1E0BA 1VS0A 2KCNA 2UXBL 1U5KA 4AH6A 3F2CA 4LUOA 1MIUA 1C0AA 1G6PA 2RDHA 1TIID 4V190 3PO3H 1IYJB 5CV6A 2RSOA 2RCFA 4N9PA 1EYAA 5LMNW 3NHHA 2RKSA 2KUMA 5FOBB 3AFPA 3DM3A 5DEHA 1SR3A 5JPNC 4FF2A 2OTJA 4S3SA 4C3IG 1JWUD 1HFNA 1STBA 3KBGA 2PZWA 4GZYC 4R4IA 1IW7C 5CR3A 5CGKA 3H09A 4K14A 2SEBD 4DAYB 1J5EQ 3DWAA 1QILA 1VQPA 4C3IB 1KTKA 2D2CC 5C44H 3W1GA 1HNZQ 3KF8A 3FP9A 4A3GG 3CCEA 3KDFB 1F9RA 2NZHA 1J6QA 3RNUA 4O42A 4M1UB 3TDQA 3CW2C 3HOVH 3S1MH 3RD4A 1J8IA 1SRUA 1VQHA 2ZXPA 3J7YW 2ZM6Q 3H6MA 4HMIA 1EY4A 3I72A 3OYYA 2V1CC 4QL5A 2B2YC 4X66L 2VQEL 1X3GA 5GROA 4DXFA 1TS2A 2Q2HA 3LWEA 4N9TA 3WOEA 1V1QA 5F2DA 4JI5Q 2QF7A 3N52A 2WKCA 1MSGA 1WI5A 1SN8A 4Y52H 4N8FA 2CWPA 2F0JA 5IT9c 1Z9FA 1A8VA 2GVBA 3TZUA 3SK5A 3W5OA 1IXRA 1S72A 2PQAA 2IY5B 4EQPA 3FMCA 3G48A 3DEOA 2A69D 1ASZA 1TWFB 4A3GH 1VQ5A 1SFOB 5CYUA 1GM5A 2K5VA 3IAYA 1K8MA 1YJWA 5M3MG 4KD3A 1PH4A 4FYDA 3SEBA 5IYBG 4K2LA 1EQRA 3UDXA 1HQMC 4GKKQ 4DV7L 4J6HA 1SBBB 5M5YH 1KIXA 2Q2TA 4POGA 5IP9G 5LL6X 4HMJA 4LF5Q 5M5XH 1IYVA 2ICIA 4OO1I 4DR6Q 4N8X1 3J80i 3J81L 2LS01 4YWKA 1KQSA 4BBSH 5E1FA 3TP7A 5FLXE 3O13A 4X3KA 1QG7A 4DR2L 1S40A 3HKZE 4J1MA 2F52A 1X32A 1TWFH 1VDZA 4G7OC 3IL8A 4G57A 3M4YA 3I8ZA 4Q0FA 1EU4A 4QB4A 4JI3L 1D5MC 1HR0W 4LF6Q 1L0YB 2KCCA 2F0GA 4ZCKA 1AEXA 3U58A 1KRSA 2PNHA 3MC0B 3RN5A 2LMCB 3D31A 2D0OA 4XYQA 1PFSA 4DF7A 4XDXA 4A75A 1SYBA 3NEMA 1KDBA 5M3MH 2IL8A 1NCVA 4B9WA 2IX1A 2LFNA 1PDQA 3ULLA 3K5OA 3E0JA 1STHA 5C3XA 2OCEA 5GQOA 3D0FA 1K73C 4K6DA 4LFCL 1EY8A 1Q12A 1TS5A 3F2DA 3KFUA 1B9NA 2E2DC 1HZCA 3S14H 1HTLD 1W6JA 3PQIA 4LW1A 1GVPA 5GAGC 2L55A 3HS0C 2KJXA 1SE2A 4DR4Q 3A7AB 3K58A 1VQKA 4IFDH 2L11A 3JAME 4A76A 4JOIC 4JBWA 1RHPA 3OHXC 3KYHC 3K7AH 5CV7A 2PQAB 4ZQ3A 2NN6G 3U9OA 2EVBA 4KLKA 4F8MA 3FKIH 1EIHA 2AMCB 2ZTCA 1ENCA 4CBVA 3T13A 1V1PB 1CFMA 5IGBA 5IODA 1U0LA 3KK7A 4LUZA 3KOJA 2QCPX 3D3RA 1B7YB 1X3PA 3NP8A 4U673 4QUCA 1CZWA 1AZPA 3VR2A 1LLRD 2F0LA 1SXTA 2D5DA 4Y7NH 1YNJD 4C2MH 2QA4A 3PV0A 4IUPA 4RG1A 5EBCA 3NPPA 1PV4A 3R3OA 5JEAG 2QILA 4DV6Q 3GTQB 4JK1C 4DUYL 1Z7TA 2WIIB 4L63B 5M5WB 2BH2A 1J5EL 1Z6HA 1PFNA 3M4OB 3KUPA 1QVGA 4JI2Q 2D62A 1Y1VB 1HNZL 4LMQD 1U9RA 5A35A 1K3RA 2PMZB 3F1ZA 1E2VA 4KY5A 2NN6H 2XTIA 3NTIA 4CGYB 1RCVD 1KXLA 5KYIA 2CCZA 2EPBA 1R4QB 1EU3A 1XJVA 2HT1A 5I9OA 1DGSA 2ID0A 2K5QA 2OXPA 3D6CA 2K28A 3KLRA 2R7DA 4GNXC 1AN8A 1DM0B 2L1BA 1BBXC 5E3FA 3K6OA 2AHOB 2RDFA 4DR5Q 3FPUB 1PRTB 1NUCA 2KENA 4JI5L 1VQ4A 4OEMB 3GTQH 3HOYB 1Q8IA 2WB1G 4ZLTF 5JEAH 3M4OH 4KKTA 1PRTD 1IZ6A 1EL0A 3NK9A 3TQYA 1EFID 4HSVA 1F9QA 1WTRA 2WB1B 4YWMA 1OO9B 2EYLA 3NE5B 2AQ1B 1TWHB 1XTDA 3AU7A 4ID6A 3PF5A 2P5ZX 2VUMG 5FO7B 4YY3Q 5CV4A 2AUJD 3HEJA 1NE3A 4DV0Q 3OW2A 4DV5L 4KMUC 2IW3A 1D2BA 2PYKA 2I07B 5EPLA 3PCOB 1WFQA 3J7ZC 2WACA 2A6ED 4KHPQ 1K83B 5G3LF 3BZKA 1LT5D 1SYFA 2IHEA 5KIXA 2FFKB 1N9WA 1DOKA 5J1ZA 4GS3A 2UU9Q 4LF5L 1EQTA 1O7LA 2FMMA 1XWEA 2PI2E 4JI6Q 3J7AF 4RFBA 1QZHA 1A0IA 1JOOA 3Q23A 1JMCA 3I4LA 5I9PA 4A3BH 1PYBA 4LNQA 2A74C 3K0YA 3HOUG 2QKIC 3MXGA 3R8BA 1PH9A 4LF6L 1JE4A 4OO1G 2K5HA 1VQMA 3CCLA 3ERQA 1E24A 5HY6A 4CJ1B 2VUMH 1NMFA 1ZYRC 2E2JH 1HNWQ 1L2FA 1GXDC 1SYEA 4CDDC 3QIAA 3BYYB 4JVZA 1K83H 1S5ED 1STYA 4CKEA 3ULJA 4YHHQ 1WD1A 1F9SA 1BO0A 2R7FA 1U4PA 4JV5Q 2SNMA 1WTVA 2CW0D 4ZUJA 4IN3A 1RKNA 1CKMA 1B4OA 4NMZA 4GKJQ 1JCKB 2FHTA 5ELBA 2CHBD 1XYIA 4PMCA 3J7A5 3H3VC 4EQOA 1C4QA 1N34Q 5ELFA 1KD1C 3RZDH 1LTSD 1EY6A 3CCQA 1MSHA 1WD0A 3H0GH 1YITA 4LFBL 1F77A 4DR4L 3DUZA 3IFDA 3HOUH 1YHBA 1N33Q 3BJUA 2YYZA 5L37A 3J81i 1A62A 3QJYA 4OO1H 1EWIA 2PNRC 3W3AA 5IIFA 3K5LA 2BDNA 1GO3E 4EQNA 2RCNA 4PMWA 2C35B 4DAMA 4A3KG 1YNNC 5DM73 2EJGC 1ENAA 3A5ZB 1QNUA 1UNSA 5FK9C 1F9PA 2DNEA 5I2XA 3A54A 3BVGA 2B3GA 5K36H 2ZJRA 3K5NA 3Q22A 2CQAA 2A8VA 5DNFA 3HOWG 4A3KB 2L15A 1FJGL 3GTPB 3PUVA 4C3HG 2AUKA 3NSWA 1CA5A 3T56B 3V05A 1VQDA 2RDGA 3NBHB 3M9BA 4A3CH
chains in the Genus database with same CATH topology
3EBEA 2OQ0A 2EXDA 1KAWA 2MO1A 1HNXQ 4DV6L 4H02A 4DR3Q 5GAHC 4GOPA 2KHJA 1OXSC 4ALPA 4JI7L 1I5FA 2DGYA 2FXQA 2CFMA 3AYHB 2K14A 4X65L 4OX9Q 2JA8H 5FJ8G 1L1OB 1HH2P 5C44G 2R7ZH 3S17H 4A3EH 1I94Q 4LF7Q 4IPGA 3ZJYC 1X55A 2LXKA 3TRZA 5H1SE 4DK6C 1SFOH 2WAQE 4JI2L 3CCVA 4AQYL 4LF8Q 2WFWA 1VQOA 2GN5A 3RLOA 2E2IH 3PUYA 4HJ7A 3I4MH 4MNOA 1VQFA 3OTOL 4ME3A 2KHIA 1T9HA 3RR5A 3I7FA 1Q81C 4C3JH 1IBLL 2UUBQ 4GKKL 4O2DA 1B8AA 4GN3B 1VS0A 5C3EH 4A3KH 2UXBL 3FHWA 1U5KA 2D0PA 4AH6A 3F2CA 4IPCA 1MIUA 4LUOA 1C0AA 1Y1WG 4UP8A 3KF8B 2XGTA 4TQUS 4JC0A 3ULPA 1G6PA 3PO3H 2OQKA 2YTYA 4IJLA 1IYJB 4HJ9A 1IL2A 1XPUA 4DR6L 3UE0A 5IYBH 2JJQA 3HKSA 3HOWH 4R4OA 5LMNW 4UPAA 1CKNB 2K50A 1L1OA 4C3HH 4DV4Q 1A63A 2N8NA 3JAMi 3H0GG 4DR5L 1Q1BA 4QQBX 3AFPA 3DM3A 3PUXA 1IBML 5IP9H 1SR3A 3F2BA 4HJ8A 1Q86C 5M3FG 4MZ9A 4A3LH 2OTJA 2OWOA 1CSQA 3PIPA 1AE2A 1X3EA 1X6OA 2Y0SG 4R4QA 1YI2A 4JI1L 3CCJA 1TWCH 1LYLA 2JA9A 2PMZE 4R4IA 3GTMH 5IP7G 3LGJA 3PUZA 4JG2A 2JEAI 1P8LA 4DAYB 1J5EQ 2JEBI 1ASYA 4LFBQ 3E0EA 1VQPA 1EYGA 1P16A 4DV2Q 4DR1Q 4JBKA 5C44H 3W1GA 1UWVA 3CP0A 3FP9A 1HNZQ 1NTGA 2Z0SA 2HIVA 4A3GG 2IX0A 3RZOH 1RL2A 4JI4Q 3GD7A 3CCEA 2IT1A 3KDFB 4BA1I 3HOXH 3G4SA 2NZHA 1SLJA 1J6QA 3RNUA 2F4VL 3H3VH 3K80C 2AWOA 2E5LQ 2VW9A 1CKNA 1KRTA 4DV3Q 4DV0L 5K36G 3CW2C 3HOVH 1D8LA 3S1MH 2HHHL 1RIPA 1SRUA 4NXNL 1VQHA 1K9MC 4BY1G 2ZM6Q 3RN2A 4QY7A 1HZ9A 2ALYB 3OYYA 2R92G 2V1CC 4QL5A 4X66L 2VQEL 1HZBA 1X3GA 4L5TA 2YTXA 5GROA 4KHPL 2MO0A 4A3CG 2Q2HA 3AQQA 1VQNA 1V1QA 1BBWA 1PH8A 4JI5Q 4A93G 3AFQA 1WCMG 3S24A 1WI5A 5IYDH 1SN8A 2UXCQ 4Y52H 1FJGQ 2N49A 2WB1E 4APVA 2CWPA 3S1NH 5IT9c 2I5MX 1Z9FA 2UXDQ 3S2DH 4JI6L 1JE5A 3J81c 5M3FH 3KDFA 1C9OA 2R7ZG 1A8VA 2GVBA 4JBJA 4A3EG 3IRBA 1VQGA 3M9BA 2E2HH 1BVSA 3H3VI 1PH1A 3TREA 3W5OA 2JQOA 2A1AA 2KCMA 1IXRA 1S72A 2PQAA 1W2BA 5E7NA 2OTLA 5BR8Q 2IY5B 1EOVA 4X6AH 3G48A 1E1TA 3KJOA 4DK3C 2Q2UA 1Y1VG 4XTCS 1ASZA 1O7IA 5LMNQ 1PH5A 3I4MG 2LXJA 4P72A 4A3GH 4B3TL 1VQ5A 1I6HH 3CC2A 1NJIC 2VQFL 2K5VA 4A3JH 1GM5A 1QUQB 5FLXc 3M7NA 3CCSA 1YJWA 3S15H 5M3MG 1G291 3RLFA 1Q8KA 1PH4A 3PO3G 2RF4A 1Z47A 5IYBG 5FLMG 2JA5G 3OTOQ 1YJNA 1EQRA 3UDXA 4B3SQ 4GKKQ 4IPHA 4DV7L 1XMQQ 2YU9H 5M5YH 1KIXA 2Q2TA 1X3FA 3F8TA 4POGA 2R92H 3BZCA 1PA6A 5IP9G 4DR7L 5IYCH 4DUZQ 1TWGH 3HOYG 4OWTB 3PUWA 1VQLA 4LF5Q 4K0KL 5M5XH 3T1YQ 4KHZA 3UDIA 2PI2A 4OO1I 5ELOA 4DR6Q 4A93H 3J80i 1WCMH 4JI8L 3MXNB 2BA0A 3NENA 4BBRG 4OONA 4YWKA 1KQSA 4NPSA 4BBSH 2DUDA 2N3SA 2VL6A 4B3ML 1N34L 4L5QA 4HIDA 5ELNA 4DR2L 1SROA 1QUQA 3HKZE 4GN4B 2K4KA 2F52A 5GADC 1S40A 3PO2G 1N32L 1TWFH 3H15A 1H95A 4NXML 1VQBA 4RMFA 2VS1A 1WOCA 3JC66 4LWCA 4JI1Q 5M5WH 3HOXG 4JI3L 1HR0W 1V9PA 4LF6Q 4LF4Q 1GKHA 3PSIA 1TXYA 1Y1VH 1N33L 3U58A 2CKZB 1KRSA 2PNHA 2AWNA 3HOVG 5LMUL 3RN5A 3D31A 2D0OA 1PFSA 4LFAL 3U4VA 4A75A 4A3FG 3SGIA 3NEMA 5M3MH 5JJIA 4DPGA 2F4VQ 4QIWE 4A3IH 1PH6A 2YTVA 3JAMc 2IX1A 1IBKQ 5FLMH 2JA5H 1PH7A 2BA1A 4GLAC 3ULLA 5AJ3Q 4NXNQ 3HFZB 5IYDG 2N78A 2OCEA 5GQOA 3Q8DA 2QGQA 3D0FA 1K73C 1BBUA 4A4IA 4QGUA 3GTLH 1FVIA 4LFCL 1Q12A 1I3QH 3HOYH 3PGZA 3F2DA 3KFUA 1HZCA 3S14H 5C4XH 1OXTA 3A0JA 5C4JH 1CSPA 2KCTA 3A74A 1X54A 4BBRH 4LW1A 1GVPA 4OWWB 4UP7A 1UE7A 5GAEC 5GAGC 3TS0A 4AIMA 3GTOH 2I0QA 4DR4Q 5IE8A 4QJFA 2QEXA 1HNXL 3PO2H 3I55A 1UE1A 3CPWA 4DR3L 1VQKA 4DNIA 4IPDA 1VQAA 1TWHH 3CCUA 4JOIC 3CC7A 4A76A 4A3JG 3HKZG 4JBWA 3WWVA 4YY3L 4OX9L 2CQOA 1JT8A 1I94L 3CCRA 1E3PA 3I56A 4LF7L 1NBWA 3KYHC 3K7AH 3TEHB 1FGUA 4YCWA 2WAQG 4A3DG 3I2ZA 4NB3A 2PQAB 1WYDA 2KBNA 2NN6G 4IO9A 4B3RQ 4IOCA 1XMOQ 4KLKA 3KF6A 4BA2I 2UUAL 3FKIH 3ICEA 4A3FH 1OXVA 1VCIA 2AMCB 4FDBA 1KHIA 2VQFQ 2CWAA 2ZTCA 5IYCG 3STBD 2NVYH 4LF9Q 1U0LA 2Q2IA 1XNQQ 4LUZA 1HR0Q 1CKOA 3KOJA 1B7YB 2UU9L 2E8GA 4L5SA 4BBSG 1S3OA 3CD6A 2YV5A 2ZJPA 4AYBE 3VDYA 1PH3A 2EQSA 2JK8A 4O0AA 4JCVE 4Y7NH 1YBYA 4C2MH 3ERSX 3PV0A 2QA4A 4RG1A 2K75A 5J3BA 1W3SA 1N36L 1QVFA 1EFWA 2GVAA 1PV4A 5JEAG 3NELA 4DV6Q 3G71A 3S2HH 2K52A 2LSSA 4JI7Q 4DUYL 4B3MQ 1KL9A 3M4QA 4X65Q 3CXCA 1SMXA 4DR2Q 1OTCA 3PIOA 1N32Q 4GNXA 3G6EA 4BXXG 4P74A 4NXMQ 1J5EL 2BH2A 4EX5A 3I4NG 3S1RH 4DR1L 4DV2L 4R4CA 4JI2Q 1QVGA 2D62A 4AQYQ 1HNWL 3T1HL 1M90C 1HNZL 4A3IG 1Q1EA 1K3RA 3F1ZA 4HIOA 1E22A 4A3DH 1QZGA 3EN2A 3ER0A 4YCUA 2XTIA 1EQQA 2WP8J 4YWLA 4JYAL 1IBLQ 3K7UC 4JBMA 1XNRL 4KI0A 4YHHL 4DV3L 2ES2A 1KXLA 4IOAA 3STBC 1EIYB 2UXBQ 1WJJA 2CCZA 4JV5L 2Z6KA 1XJVA 4JI0L 2HT1A 1DGSA 3K81C 3J80c 2ID0A 4A3MG 4PZ7A 4GKJL 5C4XG 5C0XG 1VQ9A 2R7DA 5JEAJ 4EQ5A 4GNXC 4A3BG 4DKAC 3KJPA 4PZ8A 2B29A 2AHOB 3B6YA 4DR5Q 3S16H 2KENA 4JI5L 1VQ4A 1IBMQ 2RHSB 1YJ9A 2B63G 3GTQH 4BY7G 2NVTH 2AKWB 2WB1G 4IFDG 2UXCL 4X64L 2Y0SE 3W1BA 1MJEA 3M4OH 2NZOA 4OWXB 1IZ6A 3L0OA 2Z6KC 3TQYA 2NN6I 2UUCL 2MQHA 2ASBA 1UEBA 1E7ZA 4YWMA 1XPOA 5BR8L 3EIVA 2R93G 4BXXH 3S1QH 4GN5A 1XTDA 2I5HA 3FKIG 3I4NH 1QVCA 5LMNL 3PF5A 1Q7YC 1C7YA 2VUMG 4YY3Q 2BH8A 5IWAL 1NE3A 5C0XJ 4DV0Q 1AE3A 1E1OA 2ZTDA 4OXPA 2MNAA 3OW2A 1XPRA 4DV5L 2HHHQ 2ATWA 1FL0A 1K8AC 4JOIA 1VQEA 4DV1L 2UUAQ 1K0RA 3K0XA 4X62L 1PH2A 4POFA 1NMGA 3PCOB 1WFQA 2HQLA 3J7ZC 4B3SL 4IFDJ 4A3MH 4X66Q 1JJCB 3KF6B 2VQEQ 5JJLA 4PZ6A 1XMQL 4KHPQ 5DLQE 3BZKA 2IHEA 2H5XA 3GTPH 4GOPC 1N9WA 5EAYA 1Q46A 1YEZA 4DUZL 1PHJA 2JA7G 4GS3A 1JJ2A 2UU9Q 4LF5L 1YZ6A 3M85A 1MJCA 3UDFA 3T1YL 2NVXH 1YHQA 2B63H 3U50C 2PI2E 4JI6Q 1X9NA 4LUVA 1QZHA 1A0IA 4BY7H 3GTJH 1VQIA 1EUJA 4WJ4A 1OXUA 1M1KC 1D7QA 1JMCA 1N36Q 1YVCA 1K8GA 4A3BH 1PVOA 1PYBA 4LNQA 1TWAH 3HOUG 4DUYQ 1I50H 5HGQA 1PH9A 4LF6L 4LF4L 2R93H 4OO1G 4B3TQ 1UE5A 2K5HA 4XIGS 1VQMA 4LF8L 1YHAA 1BKBA 1NY4A 3CCLA 1E24A 5HY6A 2VUMH 1NMFA 5FJ8H 2UUBL 4GNXB 4YCVA 5C0XI 2E2JH 2F3IA 3T1HQ 1HNWQ 1L2FA 1UE6A 2K5NA 2VY3A 1PYSB 1SE8A 2ZTEA 4P75A 1L1OC 1K83H 4GLVB 1YIJA 3M4PA 3M3YH 4JYAQ 4DV7Q 1XNRQ 4YHHQ 3ULJA 1HZAA 2HIXA 2R7FA 3K8AA 4PG3A 1IBKL 4IFDI 4JV5Q 3CMEA 3UDGA 4JI0Q 4HIKA 4DR7Q 4DV4L 4K0KQ 1HJPA 3I4OA 5AJ3L 3HOZG 1CKMA 3CMAA 4GKJQ 4J15A 1Y1WH 1B70B 4JI8Q 2JA7H 2JA6G 4R4TA 3TS2A 1MKHA 2ZJQA 3DLLA 3J7A5 4WJ3M 2R6GA 1N34Q 1KD1C 3RZDH 1KC8C 3KLWA 3CCMA 3CCQA 3CQZH 3H0GH 1N8RC 4L5RC 4R1JA 3RLNA 4TVAB 4X64Q 1YITA 1Y14B 4LFBL 4IJHA 1G51A 4DR4L 4JI3Q 2JA8G 4C3IH 4UY8C 1VQ8A 3HOUH 1YHBA 4JI4L 1N33Q 3BJUA 3PF4A 2YYZA 2JE6I 2UUCQ 3J81i 2VZAA 1A62A 5IY0A 5LMUQ 5IP7H 1EWIA 1LTLA 2E5LL 3A5UA 4P71A 1EIFA 4MTNA 1GO3E 1OXXK 1VQJA 3GO5A 4P73A 4LFAQ 2RCNA 1CUKA 4PMWA 3CC4A 3E9IA 2C35B 4GOPB 1L0WA 2IHFA 3GTKH 4GLXA 1R9TH 4B3RL 1XMOL 2ZM6L 2NVQH 3U4ZA 4DAMA 5IWAQ 5C3EG 1JB7A 1X56A 4A3KG 4HIMA 4UP9A 2A19A 3CPFA 4DV5Q 3A5ZB 2I5LX 1LUZA 2EIFA 1AH9A 3CAMA 1V43A 2B3GA 2ZJRA 1Q82C 4HJ5A 1GD7A 4DV1Q 4LF9L 3E9HA 1XNQL 1HR0L 3BU2A 3MEFA 4X62Q 2A8VA 5JJKA 1VQCA 4LFCQ 3HOWG 3J81j 3L2PA 3HOZH 1JJGA 1VQ6A 2L15A 2MFIA 3CF5A 4BY1H 3PUVA 3UE1A 1FJGL 4AYBG 2UXDL 3AEVA 4HJAA 3L7ZC 2RHQB 2VNUD 1VQ7A 3GTGH 2JA6H 4A3LG 1VQDA 3NBHB 1YNXA 1LM0A 4A3CH 1X65A 3GDEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EBE A;  2OQ0 A;  2EXD A;  1KAW A;  2MO1 A;  1HNX Q;  4DV6 L;  4H02 A;  4DR3 Q;  5GAH C;  4GOP A;  2KHJ A;  1OXS C;  4ALP A;  4JI7 L;  1I5F A;  2DGY A;  2FXQ A;  2CFM A;  3AYH B;  2K14 A;  4X65 L;  4OX9 Q;  2JA8 H;  5FJ8 G;  1L1O B;  1HH2 P;  5C44 G;  2R7Z H;  3S17 H;  4A3E H;  1I94 Q;  4LF7 Q;  4IPG A;  3ZJY C;  1X55 A;  2LXK A;  3TRZ A;  5H1S E;  4DK6 C;  1SFO H;  2WAQ E;  4JI2 L;  3CCV A;  4AQY L;  4LF8 Q;  2WFW A;  1VQO A;  2GN5 A;  3RLO A;  2E2I H;  3PUY A;  4HJ7 A;  3I4M H;  4MNO A;  1VQF A;  3OTO L;  4ME3 A;  2KHI A;  1T9H A;  3RR5 A;  3I7F A;  1Q81 C;  4C3J H;  1IBL L;  2UUB Q;  4GKK L;  4O2D A;  1B8A A;  4GN3 B;  1VS0 A;  5C3E H;  4A3K H;  2UXB L;  3FHW A;  1U5K A;  2D0P A;  4AH6 A;  3F2C A;  4IPC A;  1MIU A;  4LUO A;  1C0A A;  1Y1W G;  4UP8 A;  3KF8 B;  2XGT A;  4TQU S;  4JC0 A;  3ULP A;  1G6P A;  3PO3 H;  2OQK A;  2YTY A;  4IJL A;  1IYJ B;  4HJ9 A;  1IL2 A;  1XPU A;  4DR6 L;  3UE0 A;  5IYB H;  2JJQ A;  3HKS A;  3HOW H;  4R4O A;  5LMN W;  4UPA A;  1CKN B;  2K50 A;  1L1O A;  4C3H H;  4DV4 Q;  1A63 A;  2N8N A;  3JAM i;  3H0G G;  4DR5 L;  1Q1B A;  4QQB X;  3AFP A;  3DM3 A;  3PUX A;  1IBM L;  5IP9 H;  1SR3 A;  3F2B A;  4HJ8 A;  1Q86 C;  5M3F G;  4MZ9 A;  4A3L H;  2OTJ A;  2OWO A;  1CSQ A;  3PIP A;  1AE2 A;  1X3E A;  1X6O A;  2Y0S G;  4R4Q A;  1YI2 A;  4JI1 L;  3CCJ A;  1TWC H;  1LYL A;  2JA9 A;  2PMZ E;  4R4I A;  3GTM H;  5IP7 G;  3LGJ A;  3PUZ A;  4JG2 A;  2JEA I;  1P8L A;  4DAY B;  1J5E Q;  2JEB I;  1ASY A;  4LFB Q;  3E0E A;  1VQP A;  1EYG A;  1P16 A;  4DV2 Q;  4DR1 Q;  4JBK A;  5C44 H;  3W1G A;  1UWV A;  3CP0 A;  3FP9 A;  1HNZ Q;  1NTG A;  2Z0S A;  2HIV A;  4A3G G;  2IX0 A;  3RZO H;  1RL2 A;  4JI4 Q;  3GD7 A;  3CCE A;  2IT1 A;  3KDF B;  4BA1 I;  3HOX H;  3G4S A;  2NZH A;  1SLJ A;  1J6Q A;  3RNU A;  2F4V L;  3H3V H;  3K80 C;  2AWO A;  2E5L Q;  2VW9 A;  1CKN A;  1KRT A;  4DV3 Q;  4DV0 L;  5K36 G;  3CW2 C;  3HOV H;  1D8L A;  3S1M H;  2HHH L;  1RIP A;  1SRU A;  4NXN L;  1VQH A;  1K9M C;  4BY1 G;  2ZM6 Q;  3RN2 A;  4QY7 A;  1HZ9 A;  2ALY B;  3OYY A;  2R92 G;  2V1C C;  4QL5 A;  4X66 L;  2VQE L;  1HZB A;  1X3G A;  4L5T A;  2YTX A;  5GRO A;  4KHP L;  2MO0 A;  4A3C G;  2Q2H A;  3AQQ A;  1VQN A;  1V1Q A;  1BBW A;  1PH8 A;  4JI5 Q;  4A93 G;  3AFQ A;  1WCM G;  3S24 A;  1WI5 A;  5IYD H;  1SN8 A;  2UXC Q;  4Y52 H;  1FJG Q;  2N49 A;  2WB1 E;  4APV A;  2CWP A;  3S1N H;  5IT9 c;  2I5M X;  1Z9F A;  2UXD Q;  3S2D H;  4JI6 L;  1JE5 A;  3J81 c;  5M3F H;  3KDF A;  1C9O A;  2R7Z G;  1A8V A;  2GVB A;  4JBJ A;  4A3E G;  3IRB A;  1VQG A;  3M9B A;  2E2H H;  1BVS A;  3H3V I;  1PH1 A;  3TRE A;  3W5O A;  2JQO A;  2A1A A;  2KCM A;  1IXR A;  1S72 A;  2PQA A;  1W2B A;  5E7N A;  2OTL A;  5BR8 Q;  2IY5 B;  1EOV A;  4X6A H;  3G48 A;  1E1T A;  3KJO A;  4DK3 C;  2Q2U A;  1Y1V G;  4XTC S;  1ASZ A;  1O7I A;  5LMN Q;  1PH5 A;  3I4M G;  2LXJ A;  4P72 A;  4A3G H;  4B3T L;  1VQ5 A;  1I6H H;  3CC2 A;  1NJI C;  2VQF L;  2K5V A;  4A3J H;  1GM5 A;  1QUQ B;  5FLX c;  3M7N A;  3CCS A;  1YJW A;  3S15 H;  5M3M G;  1G29 1;  3RLF A;  1Q8K A;  1PH4 A;  3PO3 G;  2RF4 A;  1Z47 A;  5IYB G;  5FLM G;  2JA5 G;  3OTO Q;  1YJN A;  1EQR A;  3UDX A;  4B3S Q;  4GKK Q;  4IPH A;  4DV7 L;  1XMQ Q;  2YU9 H;  5M5Y H;  1KIX A;  2Q2T A;  1X3F A;  3F8T A;  4POG A;  2R92 H;  3BZC A;  1PA6 A;  5IP9 G;  4DR7 L;  5IYC H;  4DUZ Q;  1TWG H;  3HOY G;  4OWT B;  3PUW A;  1VQL A;  4LF5 Q;  4K0K L;  5M5X H;  3T1Y Q;  4KHZ A;  3UDI A;  2PI2 A;  4OO1 I;  5ELO A;  4DR6 Q;  4A93 H;  3J80 i;  1WCM H;  4JI8 L;  3MXN B;  2BA0 A;  3NEN A;  4BBR G;  4OON A;  4YWK A;  1KQS A;  4NPS A;  4BBS H;  2DUD A;  2N3S A;  2VL6 A;  4B3M L;  1N34 L;  4L5Q A;  4HID A;  5ELN A;  4DR2 L;  1SRO A;  1QUQ A;  3HKZ E;  4GN4 B;  2K4K A;  2F52 A;  5GAD C;  1S40 A;  3PO2 G;  1N32 L;  1TWF H;  3H15 A;  1H95 A;  4NXM L;  1VQB A;  4RMF A;  2VS1 A;  1WOC A;  3JC6 6;  4LWC A;  4JI1 Q;  5M5W H;  3HOX G;  4JI3 L;  1HR0 W;  1V9P A;  4LF6 Q;  4LF4 Q;  1GKH A;  3PSI A;  1TXY A;  1Y1V H;  1N33 L;  3U58 A;  2CKZ B;  1KRS A;  2PNH A;  2AWN A;  3HOV G;  5LMU L;  3RN5 A;  3D31 A;  2D0O A;  1PFS A;  4LFA L;  3U4V A;  4A75 A;  4A3F G;  3SGI A;  3NEM A;  5M3M H;  5JJI A;  4DPG A;  2F4V Q;  4QIW E;  4A3I H;  1PH6 A;  2YTV A;  3JAM c;  2IX1 A;  1IBK Q;  5FLM H;  2JA5 H;  1PH7 A;  2BA1 A;  4GLA C;  3ULL A;  5AJ3 Q;  4NXN Q;  3HFZ B;  5IYD G;  2N78 A;  2OCE A;  5GQO A;  3Q8D A;  2QGQ A;  3D0F A;  1K73 C;  1BBU A;  4A4I A;  4QGU A;  3GTL H;  1FVI A;  4LFC L;  1Q12 A;  1I3Q H;  3HOY H;  3PGZ A;  3F2D A;  3KFU A;  1HZC A;  3S14 H;  5C4X H;  1OXT A;  3A0J A;  5C4J H;  1CSP A;  2KCT A;  3A74 A;  1X54 A;  4BBR H;  4LW1 A;  1GVP A;  4OWW B;  4UP7 A;  1UE7 A;  5GAE C;  5GAG C;  3TS0 A;  4AIM A;  3GTO H;  2I0Q A;  4DR4 Q;  5IE8 A;  4QJF A;  2QEX A;  1HNX L;  3PO2 H;  3I55 A;  1UE1 A;  3CPW A;  4DR3 L;  1VQK A;  4DNI A;  4IPD A;  1VQA A;  1TWH H;  3CCU A;  4JOI C;  3CC7 A;  4A76 A;  4A3J G;  3HKZ G;  4JBW A;  3WWV A;  4YY3 L;  4OX9 L;  2CQO A;  1JT8 A;  1I94 L;  3CCR A;  1E3P A;  3I56 A;  4LF7 L;  1NBW A;  3KYH C;  3K7A H;  3TEH B;  1FGU A;  4YCW A;  2WAQ G;  4A3D G;  3I2Z A;  4NB3 A;  2PQA B;  1WYD A;  2KBN A;  2NN6 G;  4IO9 A;  4B3R Q;  4IOC A;  1XMO Q;  4KLK A;  3KF6 A;  4BA2 I;  2UUA L;  3FKI H;  3ICE A;  4A3F H;  1OXV A;  1VCI A;  2AMC B;  4FDB A;  1KHI A;  2VQF Q;  2CWA A;  2ZTC A;  5IYC G;  3STB D;  2NVY H;  4LF9 Q;  1U0L A;  2Q2I A;  1XNQ Q;  4LUZ A;  1HR0 Q;  1CKO A;  3KOJ A;  1B7Y B;  2UU9 L;  2E8G A;  4L5S A;  4BBS G;  1S3O A;  3CD6 A;  2YV5 A;  2ZJP A;  4AYB E;  3VDY A;  1PH3 A;  2EQS A;  2JK8 A;  4O0A A;  4JCV E;  4Y7N H;  1YBY A;  4C2M H;  3ERS X;  3PV0 A;  2QA4 A;  4RG1 A;  2K75 A;  5J3B A;  1W3S A;  1N36 L;  1QVF A;  1EFW A;  2GVA A;  1PV4 A;  5JEA G;  3NEL A;  4DV6 Q;  3G71 A;  3S2H H;  2K52 A;  2LSS A;  4JI7 Q;  4DUY L;  4B3M Q;  1KL9 A;  3M4Q A;  4X65 Q;  3CXC A;  1SMX A;  4DR2 Q;  1OTC A;  3PIO A;  1N32 Q;  4GNX A;  3G6E A;  4BXX G;  4P74 A;  4NXM Q;  1J5E L;  2BH2 A;  4EX5 A;  3I4N G;  3S1R H;  4DR1 L;  4DV2 L;  4R4C A;  4JI2 Q;  1QVG A;  2D62 A;  4AQY Q;  1HNW L;  3T1H L;  1M90 C;  1HNZ L;  4A3I G;  1Q1E A;  1K3R A;  3F1Z A;  4HIO A;  1E22 A;  4A3D H;  1QZG A;  3EN2 A;  3ER0 A;  4YCU A;  2XTI A;  1EQQ A;  2WP8 J;  4YWL A;  4JYA L;  1IBL Q;  3K7U C;  4JBM A;  1XNR L;  4KI0 A;  4YHH L;  4DV3 L;  2ES2 A;  1KXL A;  4IOA A;  3STB C;  1EIY B;  2UXB Q;  1WJJ A;  2CCZ A;  4JV5 L;  2Z6K A;  1XJV A;  4JI0 L;  2HT1 A;  1DGS A;  3K81 C;  3J80 c;  2ID0 A;  4A3M G;  4PZ7 A;  4GKJ L;  5C4X G;  5C0X G;  1VQ9 A;  2R7D A;  5JEA J;  4EQ5 A;  4GNX C;  4A3B G;  4DKA C;  3KJP A;  4PZ8 A;  2B29 A;  2AHO B;  3B6Y A;  4DR5 Q;  3S16 H;  2KEN A;  4JI5 L;  1VQ4 A;  1IBM Q;  2RHS B;  1YJ9 A;  2B63 G;  3GTQ H;  4BY7 G;  2NVT H;  2AKW B;  2WB1 G;  4IFD G;  2UXC L;  4X64 L;  2Y0S E;  3W1B A;  1MJE A;  3M4O H;  2NZO A;  4OWX B;  1IZ6 A;  3L0O A;  2Z6K C;  3TQY A;  2NN6 I;  2UUC L;  2MQH A;  2ASB A;  1UEB A;  1E7Z A;  4YWM A;  1XPO A;  5BR8 L;  3EIV A;  2R93 G;  4BXX H;  3S1Q H;  4GN5 A;  1XTD A;  2I5H A;  3FKI G;  3I4N H;  1QVC A;  5LMN L;  3PF5 A;  1Q7Y C;  1C7Y A;  2VUM G;  4YY3 Q;  2BH8 A;  5IWA L;  1NE3 A;  5C0X J;  4DV0 Q;  1AE3 A;  1E1O A;  2ZTD A;  4OXP A;  2MNA A;  3OW2 A;  1XPR A;  4DV5 L;  2HHH Q;  2ATW A;  1FL0 A;  1K8A C;  4JOI A;  1VQE A;  4DV1 L;  2UUA Q;  1K0R A;  3K0X A;  4X62 L;  1PH2 A;  4POF A;  1NMG A;  3PCO B;  1WFQ A;  2HQL A;  3J7Z C;  4B3S L;  4IFD J;  4A3M H;  4X66 Q;  1JJC B;  3KF6 B;  2VQE Q;  5JJL A;  4PZ6 A;  1XMQ L;  4KHP Q;  5DLQ E;  3BZK A;  2IHE A;  2H5X A;  3GTP H;  4GOP C;  1N9W A;  5EAY A;  1Q46 A;  1YEZ A;  4DUZ L;  1PHJ A;  2JA7 G;  4GS3 A;  1JJ2 A;  2UU9 Q;  4LF5 L;  1YZ6 A;  3M85 A;  1MJC A;  3UDF A;  3T1Y L;  2NVX H;  1YHQ A;  2B63 H;  3U50 C;  2PI2 E;  4JI6 Q;  1X9N A;  4LUV A;  1QZH A;  1A0I A;  4BY7 H;  3GTJ H;  1VQI A;  1EUJ A;  4WJ4 A;  1OXU A;  1M1K C;  1D7Q A;  1JMC A;  1N36 Q;  1YVC A;  1K8G A;  4A3B H;  1PVO A;  1PYB A;  4LNQ A;  1TWA H;  3HOU G;  4DUY Q;  1I50 H;  5HGQ A;  1PH9 A;  4LF6 L;  4LF4 L;  2R93 H;  4OO1 G;  4B3T Q;  1UE5 A;  2K5H A;  4XIG S;  1VQM A;  4LF8 L;  1YHA A;  1BKB A;  1NY4 A;  3CCL A;  1E24 A;  5HY6 A;  2VUM H;  1NMF A;  5FJ8 H;  2UUB L;  4GNX B;  4YCV A;  5C0X I;  2E2J H;  2F3I A;  3T1H Q;  1HNW Q;  1L2F A;  1UE6 A;  2K5N A;  2VY3 A;  1PYS B;  1SE8 A;  2ZTE A;  4P75 A;  1L1O C;  1K83 H;  4GLV B;  1YIJ A;  3M4P A;  3M3Y H;  4JYA Q;  4DV7 Q;  1XNR Q;  4YHH Q;  3ULJ A;  1HZA A;  2HIX A;  2R7F A;  3K8A A;  4PG3 A;  1IBK L;  4IFD I;  4JV5 Q;  3CME A;  3UDG A;  4JI0 Q;  4HIK A;  4DR7 Q;  4DV4 L;  4K0K Q;  1HJP A;  3I4O A;  5AJ3 L;  3HOZ G;  1CKM A;  3CMA A;  4GKJ Q;  4J15 A;  1Y1W H;  1B70 B;  4JI8 Q;  2JA7 H;  2JA6 G;  4R4T A;  3TS2 A;  1MKH A;  2ZJQ A;  3DLL A;  3J7A 5;  4WJ3 M;  2R6G A;  1N34 Q;  1KD1 C;  3RZD H;  1KC8 C;  3KLW A;  3CCM A;  3CCQ A;  3CQZ H;  3H0G H;  1N8R C;  4L5R C;  4R1J A;  3RLN A;  4TVA B;  4X64 Q;  1YIT A;  1Y14 B;  4LFB L;  4IJH A;  1G51 A;  4DR4 L;  4JI3 Q;  2JA8 G;  4C3I H;  4UY8 C;  1VQ8 A;  3HOU H;  1YHB A;  4JI4 L;  1N33 Q;  3BJU A;  3PF4 A;  2YYZ A;  2JE6 I;  2UUC Q;  3J81 i;  2VZA A;  1A62 A;  5IY0 A;  5LMU Q;  5IP7 H;  1EWI A;  1LTL A;  2E5L L;  3A5U A;  4P71 A;  1EIF A;  4MTN A;  1GO3 E;  1OXX K;  1VQJ A;  3GO5 A;  4P73 A;  4LFA Q;  2RCN A;  1CUK A;  4PMW A;  3CC4 A;  3E9I A;  2C35 B;  4GOP B;  1L0W A;  2IHF A;  3GTK H;  4GLX A;  1R9T H;  4B3R L;  1XMO L;  2ZM6 L;  2NVQ H;  3U4Z A;  4DAM A;  5IWA Q;  5C3E G;  1JB7 A;  1X56 A;  4A3K G;  4HIM A;  4UP9 A;  2A19 A;  3CPF A;  4DV5 Q;  3A5Z B;  2I5L X;  1LUZ A;  2EIF A;  1AH9 A;  3CAM A;  1V43 A;  2B3G A;  2ZJR A;  1Q82 C;  4HJ5 A;  1GD7 A;  4DV1 Q;  4LF9 L;  3E9H A;  1XNQ L;  1HR0 L;  3BU2 A;  3MEF A;  4X62 Q;  2A8V A;  5JJK A;  1VQC A;  4LFC Q;  3HOW G;  3J81 j;  3L2P A;  3HOZ H;  1JJG A;  1VQ6 A;  2L15 A;  2MFI A;  3CF5 A;  4BY1 H;  3PUV A;  3UE1 A;  1FJG L;  4AYB G;  2UXD L;  3AEV A;  4HJA A;  3L7Z C;  2RHQ B;  2VNU D;  1VQ7 A;  3GTG H;  2JA6 H;  4A3L G;  1VQD A;  3NBH B;  1YNX A;  1LM0 A;  4A3C H;  1X65 A;  3GDE A; 
#chains in the Genus database with same CATH topology
 3HOW B;  3QR8 A;  2FJ2 A;  2MO1 A;  4C3H B;  4DV6 L;  4H02 A;  4ALP A;  4XQQ A;  1I5F A;  5IGF A;  2E75 C;  5FJ8 G;  1I94 Q;  4LF7 Q;  1I50 B;  1PTO B;  4I65 A;  1TWC B;  3GTM B;  4LJZ C;  3I90 A;  1STN A;  4JI2 L;  1QNK A;  1K0S A;  1SNP A;  1LT3 D;  5IGC A;  2WFW A;  4LF8 Q;  2GN5 A;  3OWF A;  3D4R A;  3MFG A;  3RR5 A;  1T9H A;  1PTO D;  4O2D A;  1B8A A;  4A3K H;  3FHW A;  2D0P A;  1PZJ D;  2BDO A;  1HUN A;  4KK7 A;  2XGT A;  3PIP 3;  1AW7 A;  1HHV A;  2L4N A;  3P75 A;  1WTP A;  1KLG D;  3UE0 A;  1B50 A;  3HOW H;  4R4O A;  4C3H H;  2HUG A;  1D5X C;  4DR5 L;  1HPC A;  1Q1B A;  5CBA E;  4RHS A;  3F2B A;  4HJ8 A;  2TSS A;  4ZYS A;  4MZ9 A;  4X3U A;  4K6L A;  2OWO A;  1STG A;  2G5D A;  1CSQ A;  2XIW A;  4R4Q A;  1UUP A;  3KLS A;  1VF7 A;  3CRK C;  1PZK D;  1TWC H;  3GTM H;  2PMZ E;  3LX0 A;  5IP7 G;  3LGJ A;  4ULL A;  1HUM A;  1CM9 A;  1P8L A;  2JEB I;  5BN3 A;  4DV2 Q;  1M4V A;  1LTT D;  1U4L A;  1UWV A;  3CP0 A;  4LAA A;  3VYS A;  1NTG A;  2VB2 X;  2HIV A;  5C3W A;  2E2H B;  2F0Q A;  1RL2 A;  1SE3 A;  3GD7 A;  4UAI A;  4BA1 I;  5FKA C;  3HOX H;  1CTM A;  5KGU A;  3G4S A;  4L8J A;  3K80 C;  2AWO A;  2E5L Q;  4DV0 L;  1R9T B;  1D8L A;  4WJW A;  3M7G A;  1K9M C;  4BY1 G;  3RN2 A;  1DYQ A;  4MHE A;  5ELC A;  3VR4 A;  2R92 G;  1HCZ A;  1HZB A;  2YTX A;  4KHP L;  4IZ8 A;  3AQQ A;  1PZI D;  1VQN A;  4DAY A;  1PH8 A;  4BY1 B;  3AFQ A;  2EY2 A;  5C5M A;  2F0H A;  4RCN A;  2N49 A;  2WB1 E;  2UXD Q;  3OIQ A;  1TWG B;  2RBM A;  1BOS A;  1JE5 A;  4JI6 L;  3KDF A;  1FD7 D;  2R7Z G;  3IRB A;  1VQG A;  2E2H H;  3H3V I;  1W2B A;  2OTL A;  5BR8 Q;  3OPO A;  4DK3 C;  1LAB A;  3MFY A;  4XTC S;  2JA8 B;  2R7Z B;  3I4M G;  3LNN A;  1FGB D;  2LXJ A;  1JC7 A;  1SMY D;  3HZX A;  1NJI C;  1QUQ B;  3CCS A;  3S15 H;  1G29 1;  1LT6 D;  4K5W A;  1Q8K A;  3I4M B;  3PO3 G;  1RTO A;  2V4D A;  2RF4 A;  4C56 C;  1MD2 D;  1Z47 A;  1BNZ A;  4Z9C B;  3TP5 A;  5FLM G;  4OIK A;  2JA5 G;  1YJN A;  4IPH A;  1F2Y A;  5KYL A;  4XQJ A;  5EQ0 A;  4IUN A;  4UHV A;  3F8T A;  2L5T A;  2R92 H;  3BZC A;  3A8J E;  5IYC H;  3PO3 B;  1TWG H;  2PW5 A;  2EY1 A;  5COY A;  3T1Y Q;  3TME A;  2PI2 A;  2B39 A;  2PCF B;  5ELO A;  1BXT A;  4BWG B;  3MXN B;  4OON A;  2N3S A;  4E6I A;  2VL6 A;  1N34 L;  4HID A;  1RJT A;  4KKS A;  1N32 L;  2A68 C;  5C4J B;  1H95 A;  5C4Z A;  1SNM A;  4LWC A;  3TP6 A;  4JI1 Q;  2XN9 C;  4JPB W;  4LF4 Q;  4IUU A;  4I7A A;  2KED A;  1GKH A;  1TXY A;  1N33 L;  5C44 B;  1WTX A;  2CKZ B;  3HOV G;  5FLX L;  1B53 A;  5EJW A;  3Q0A A;  3FVQ A;  1FNV A;  3U4V A;  4R9W A;  2G9D A;  5JJI A;  4DPG A;  1PMR A;  4A3I H;  2F4V Q;  3HOV B;  3S1M B;  1JB3 A;  5FLM H;  2JA5 H;  4RWS C;  4GLA C;  4XQN A;  5AJ3 Q;  4NXN Q;  2N78 A;  3Q8D A;  3R2I A;  1GUO A;  2Z4H A;  5KEE A;  5C4X H;  1OXT A;  3A0J A;  5I2Y A;  3FPP A;  5C4J H;  2KCT A;  1GHK A;  3UI2 A;  1PXU A;  3K59 A;  4OWW B;  2ZT9 C;  1UE7 A;  1PFB A;  4HTH A;  4AIM A;  3EVQ A;  4UDU C;  2Z8L A;  4KKU A;  2BE5 D;  1VQA A;  2BCO A;  1JT8 A;  3WWV A;  2CH4 W;  1RTN A;  2EY6 A;  1I94 L;  3CCR A;  4LF7 L;  2WAQ G;  2B2U C;  4A3D G;  4A3G B;  5DAU A;  1WYD A;  4DAV A;  1RD9 D;  3JAM L;  3VA5 A;  1VCI A;  2VQF Q;  3DMU A;  3C46 A;  2WAQ B;  4HN7 A;  4LF9 Q;  3HGB A;  1XNQ Q;  1AFP A;  2M2L A;  2PQE A;  5M5Y B;  5HGT A;  1I4Q A;  4BBS G;  1S3O A;  3CD6 A;  1DXM A;  5BN5 A;  1PH3 A;  2A5H A;  5M5X B;  2IJ0 A;  3ERS X;  4FF4 A;  4G7Z C;  5J3B A;  1W3S A;  1N36 L;  1TY0 A;  4BBS B;  3G71 A;  2K52 A;  4B3M Q;  1VMP A;  1SMX A;  3E3X A;  2VXW A;  4BXX G;  1WTW A;  1V1P A;  3C1F A;  2F4I A;  3E5S A;  1A3V A;  4NXM Q;  3S1R H;  4DV2 L;  1SJE D;  3CKI B;  4AQY Q;  3T1H L;  1C8C A;  1Q1E A;  5A2Q E;  4HIO A;  4A3D H;  3DM1 A;  4YCU A;  1EQQ A;  2WP8 J;  1I4G A;  4YWL A;  2O2L D;  1XNR L;  1EIY B;  5M3M B;  3TP8 A;  3OSO A;  4CJ0 B;  3J80 c;  3K81 C;  1KDA A;  4PZ7 A;  2F0S A;  5C0X G;  4FXG C;  4EQ5 A;  3SDZ A;  2EYJ A;  4X3S A;  3BDL A;  5IGE A;  2K5D A;  5ISR A;  3I73 A;  1K3B C;  3S14 B;  4RHR A;  2RVL A;  2AKW B;  4IFD G;  2KHS A;  1AZQ A;  3W1B A;  2K03 A;  1MJE A;  2Z6K C;  5EKI A;  3PMF A;  5E4W C;  4KJO A;  2ASB A;  1E7Z A;  1XPO A;  5K5P A;  1B1Z A;  3VYT A;  5KNC A;  5BR8 L;  4BXX H;  2I5H A;  3FKI G;  1JOK A;  1Q7Y C;  1ESR A;  3K7A B;  4RCO A;  2A6H D;  5IWA L;  1E1O A;  2ZTD A;  3BYT B;  1PRT F;  4PMB A;  2HHH Q;  3SK8 A;  3FKI B;  1FL0 A;  1K8A C;  4FNF A;  3WOF A;  3FRP B;  1VQE A;  2UUA Q;  1K0R A;  3K0X A;  4PV1 C;  1BDO A;  4POF A;  1QB5 D;  3KLS X;  4Q5V A;  2ZXO A;  1GUT A;  5C0X H;  2DJG C;  3IFT A;  1QWY A;  4RH6 A;  5EAY A;  1PHJ A;  3NUC A;  3ND9 A;  2JA7 G;  3Q6S A;  1YZ6 A;  3T1Y L;  2MJ8 A;  4H7B A;  1YHQ A;  1V1O A;  3OIP A;  1SEB D;  1EWC A;  3U50 C;  4Y7N B;  4C2M B;  5D65 A;  3GTJ H;  1VQI A;  3T4A C;  1H9S A;  2HQE A;  1M1K C;  2Z1C A;  3MA2 B;  1PVO A;  1TWA H;  1F2M A;  4LF4 L;  1JWS D;  1UE5 A;  2AQ2 B;  2HCI A;  1NY4 A;  3HRZ C;  4QMG A;  2FIN B;  2UUB L;  1IKM A;  2F3I A;  2ZTE A;  2K5N A;  2VY3 A;  4ABN A;  1YIJ A;  1BUV T;  1G8Z D;  2F0N A;  4JYA Q;  4CDE C;  1HZA A;  2HIX A;  3K8A A;  3GTK B;  5C6A A;  4KHV A;  1O7Z A;  3PIO 3;  1NNX A;  4HIK A;  4JI0 Q;  1KAA A;  5AJ3 L;  1IYU A;  4ZKB B;  4DFA A;  1Y1W H;  4JI8 Q;  2JA7 H;  1SAP A;  2KVM A;  2JA6 G;  2O5I C;  3TS2 A;  2ZJQ A;  3DLL A;  2R6G A;  1KC8 C;  1NR2 A;  1FR3 A;  3CCM A;  4KD4 A;  4L5R C;  2WKD A;  4X64 Q;  5TSS A;  2JA6 B;  2QW7 A;  1DD2 A;  3BDC A;  5M9O A;  1XXG A;  2F3V A;  4UY8 C;  1VQ8 A;  4YIJ A;  3V96 A;  1TKW B;  2E74 C;  4WFN 3;  1BCP B;  2UUC Q;  2VZA A;  2O4X A;  4K8I A;  5T1I A;  1O80 A;  3K5M A;  2O5J C;  1A6X A;  2K7V A;  1EIF A;  4MTN A;  1KNE A;  4P73 A;  1VQJ A;  3GO5 A;  4LFA Q;  3NTK A;  3E9I A;  4GOP B;  1L0W A;  3GTK H;  1BCP D;  2ZM6 L;  3L3O C;  3U4Z A;  4J8Q A;  5C3E G;  1JB7 A;  4C1N I;  2NVQ H;  4HIM A;  5KRU A;  1CI3 M;  1EYC A;  1U4R A;  2NB0 A;  3CAM A;  4LF9 L;  1IL8 A;  3EA6 A;  4HJ5 A;  4DV1 Q;  1XNQ L;  3MEF A;  4X62 Q;  4RKB A;  1II3 A;  5T1G A;  3J81 j;  5C3E B;  1JJG A;  2EYO A;  3CF5 A;  3UE1 A;  2NZ1 D;  4AYB G;  2B2V A;  1ESF A;  2VNU D;  3GTG H;  2JA6 H;  4A3L G;  4A3B G;  3GDE A;  2OQ0 A;  2AQ3 B;  4AYB B;  4DR3 Q;  2KHJ A;  1OXS C;  5LL6 S;  2IWH A;  2DGY A;  2FXQ A;  2CFM A;  4TSS A;  4A3B B;  1L1O B;  3S17 H;  4A3E H;  4XT1 B;  1H9S B;  4KY6 A;  1X55 A;  1ILQ A;  2A69 C;  2WAQ E;  4AQY L;  3OWE B;  2VUM B;  1UEA B;  3PUY A;  1HXY D;  4HJ7 A;  4MNO A;  3C1E A;  1WVL A;  2E2J B;  2KHI A;  4GKK L;  2XVS A;  5C3E H;  3NBH A;  3A8I E;  3MXP A;  1TQO A;  4IPC A;  4TQU S;  3OMC A;  1HQR D;  2YTY A;  4HJ9 A;  4DR6 L;  2JJQ A;  3HKS A;  1IHZ A;  3SVM A;  4UPA A;  4IUT A;  1CKN B;  4DV4 Q;  2DNC A;  1SNQ A;  2N8N A;  3H0G G;  3JAM i;  4ZKC B;  1PTO F;  5I4D A;  1Q86 C;  4A3L H;  1LO5 D;  2X6G A;  3RZD B;  1X3E A;  1X6O A;  1ENF A;  1ML0 D;  3CCJ A;  1Q90 A;  2JA9 A;  3H91 A;  3H0G B;  1S4Z A;  2K5W A;  2JEA I;  2JP1 A;  2B2Y A;  4R8I A;  1EYG A;  1P16 A;  1WTO A;  4JBK A;  4FVM A;  3HOU B;  2A73 B;  5KNB A;  2Z0S A;  1JQY D;  2IX0 A;  3RZO H;  4JI4 Q;  1ZXT A;  3GV6 A;  2IT1 A;  1S5C D;  3GV3 A;  1SLJ A;  1QOH A;  4RGN A;  4RKL A;  5K36 G;  3DWQ A;  2HHH L;  1I6H B;  4MTK A;  4MIU A;  4HCS A;  1HZ9 A;  2ALY B;  2F0K A;  4L5T A;  3EFX D;  1O78 A;  4A3C G;  4EGV A;  4CJ2 C;  4A93 G;  4DN4 M;  3S24 A;  5IYD H;  2UXC Q;  2F0P A;  5FO8 B;  4K2K A;  3S1N H;  4APV A;  1TU2 B;  3J81 c;  5BN4 A;  4JBJ A;  4A93 B;  1GOZ A;  4BS9 A;  4H0L C;  2J0T D;  2JQO A;  2X69 A;  1SSO A;  4X6A H;  1EOV A;  4MN3 A;  1E1T A;  3KJO A;  5EKK A;  3T53 B;  2Q2U A;  2B8F A;  3D4D A;  1G91 A;  1O7I A;  5LMN Q;  1JR0 D;  4P72 A;  2FMC A;  2NYZ D;  1I6H H;  3CC2 A;  4A3J H;  3M7N A;  1MHW C;  4WRD A;  2CH4 A;  5EGT A;  2H4O A;  3RLF A;  3H94 A;  1S5D D;  1W6K A;  3OTO Q;  1SND A;  1X3F A;  1EZ8 A;  1PA6 A;  3NBI A;  3ND8 A;  4DUZ Q;  1VQL A;  3X3M A;  3UDI A;  4A93 H;  4JI8 L;  3OW7 A;  1C48 A;  4BBR G;  1LTI D;  3HG9 A;  3ITP A;  4RGO S;  1DOL A;  1I3Q B;  2Z4I A;  5ELN A;  1IW7 D;  1SRO A;  1QUQ A;  2K4K A;  1V8Q A;  1WTH A;  1VQB A;  2KEC A;  5D3I B;  5ELE A;  4BBR B;  1TS3 A;  3JC6 6;  3OMG A;  3DWP A;  3HOX G;  4FP5 D;  2HDL A;  5KND A;  1EWH A;  4HCE A;  3HOX B;  4LFA L;  3I3C A;  4U68 A;  3QOL A;  4TRD A;  3MXN A;  1Y69 U;  3MTS A;  2DY7 A;  1IBK Q;  5IGD A;  1PH7 A;  2BA1 A;  2LKV A;  1TR5 A;  1H9J A;  3HFZ B;  4M8A A;  4A4I A;  3GTL H;  1I3Q H;  2NVY B;  2QDB A;  3PGZ A;  2Q8I B;  5LHY 1;  4TKO B;  1HTP A;  3A74 A;  4BBR H;  1E2Z A;  2F0W A;  1TT2 A;  2N55 A;  2NBF A;  2EXZ A;  1NR4 A;  1KDC A;  5GAE C;  3TS0 A;  3GTO H;  4V0B A;  1CHQ D;  2QEX A;  3KBX A;  1LAC A;  3IKJ A;  4DR3 L;  1JOQ A;  3CPW A;  1PRT C;  2K04 A;  2M00 A;  1JIC A;  3HKZ G;  4YY3 L;  2CQO A;  3I56 A;  5HUR A;  1NBW A;  3TEH B;  1FGU A;  4YCW A;  4DK0 A;  2NWG A;  2KBN A;  4B3R Q;  4IOC A;  5CV8 A;  3KF6 A;  4G7H C;  3ICE A;  3S15 B;  1OXV A;  2K1B A;  1KHI A;  5IYC G;  2ENB A;  2NVY H;  1F2L A;  1SYC A;  1HR0 Q;  2UU9 L;  2R3Z A;  1A15 A;  2R92 B;  2IPK D;  3NQI A;  2JSO A;  4AYB E;  3SR1 A;  2EQS A;  4O0A A;  1YBY A;  2B2W A;  4ZAI A;  1QVF A;  2GVA A;  3VR6 A;  1VMC A;  1KL9 A;  3M4Q A;  1TS4 A;  2NUC A;  4DR2 Q;  3PIO A;  4QF4 A;  4GNX A;  1B44 D;  3G6E A;  4P74 A;  4EX5 A;  3I4N G;  2PZT A;  1HNW L;  1M90 C;  4CKB A;  4A3I G;  5IT9 E;  3SHL A;  3Q24 A;  2F03 A;  5D14 A;  3ER0 A;  5J22 A;  3N6R A;  3K7U C;  4JBM A;  4YHH L;  3I4N B;  3STB C;  3QG1 A;  2EZV A;  4JV5 L;  5J39 A;  4OIJ A;  4A3I B;  4A3M G;  2JA5 B;  4GKJ L;  1CT1 D;  5A2Q L;  5C4X G;  3RMH A;  1VQ9 A;  5JEA J;  4DKA C;  4F88 A;  3KJP A;  4PZ8 A;  2B29 A;  3NQT A;  3B6Y A;  1KLU D;  3S16 H;  1LT4 D;  4A3M B;  2RHS B;  1YJ9 A;  1IBM Q;  4I7Z C;  4BY7 G;  5C4X B;  3VYR A;  2NVT H;  2UXC L;  2XSC A;  1SJH D;  5CMD A;  4OL7 A;  2NZO A;  1I6V C;  2NVX B;  3L0O A;  4XYO A;  1AP0 A;  1SE4 A;  1SYG A;  2NN6 I;  3LWU A;  1UEB A;  3EIV A;  2R93 G;  3S1Q H;  4GN5 A;  2RA4 A;  5I6W A;  1QCB D;  1QVC A;  3I4N H;  5LMN L;  3MWY W;  1ICW A;  1C7Y A;  2RQX A;  1AE3 A;  2MNA A;  2R93 B;  3MXU A;  3A55 A;  3D8G A;  2B2V C;  4DNT B;  4DNR B;  4A3M H;  1JJC B;  3KF6 B;  5JJL A;  1Q3L A;  1I4P A;  2H5X A;  1Q46 A;  1YEZ A;  4DUZ L;  1G6Z A;  3M85 A;  1MJC A;  5EKL A;  3UDF A;  4CDF C;  2NVX H;  4OEL B;  2F0F A;  2EYP A;  1X9N A;  4BY7 H;  4WJ4 A;  4H44 C;  1D7Q A;  2C5C A;  2L12 A;  4DUY Q;  2XWB B;  3CQZ B;  2R93 H;  4B3T Q;  3VR5 A;  5I6Y A;  1YHA A;  1SDF A;  4IUQ A;  1BKB A;  3S1R B;  1H9K A;  4LF8 L;  2F3W A;  1PFM A;  3W2D A;  4GNX B;  1LTA D;  4CHT B;  4A3D B;  3NTH A;  2DN8 A;  1UE6 A;  1PYS B;  2F0T A;  2QEJ C;  4GLV B;  5CV5 A;  1PTO C;  4RAU C;  5EPJ A;  4PG3 A;  1IBK L;  3UDG A;  4DR7 Q;  2PO4 A;  5NUC A;  2XWJ B;  4K0K Q;  1HJP A;  3I4O A;  3HOZ G;  1MI2 A;  3BDO A;  3CMA A;  3FDT A;  4QIW B;  5JAV A;  4J15 A;  1B70 B;  2NTT A;  2OT2 A;  3MAQ A;  1MKH A;  2XNA C;  3HOZ B;  1UAP A;  3KLW A;  5C5L A;  3F2U A;  3CQZ H;  1CA6 A;  4IJH A;  1G51 A;  1DZ1 A;  4C3I H;  2L9H A;  4QCL A;  3PF4 A;  4HED A;  4HSP A;  1ONL A;  3DEP A;  5LMU Q;  1LTL A;  2E5L L;  3NWT A;  4X3T A;  3A5U A;  4P71 A;  2EOT A;  3L9A X;  4RA8 A;  1OXX K;  1J9O A;  2IHF A;  4B3R L;  1PLF A;  5D3D A;  4GLX A;  4C3J G;  3C2P A;  4UP9 A;  2C9O A;  2JXM B;  4DV5 Q;  2EIF A;  1KNA A;  1JOR A;  1V43 A;  2E2I B;  3E9H A;  1HR0 L;  4C3J B;  5JJK A;  1VQC A;  2BOS A;  2EJF C;  2B8G A;  3L2P A;  1VQ6 A;  1B9M A;  3HOZ H;  2MFI A;  2UXD L;  4FF1 A;  3L7Z C;  2RHQ B;  1BCP F;  1YNX A;  1X65 A;  1STA A;  3EBE A;  4ME5 A;  2EXD A;  3GTJ B;  1HNX Q;  2X6L A;  1EOT A;  5GAH C;  4GOP A;  3X3N A;  5JJZ A;  4HR7 B;  1EQV A;  3AYH B;  4OX9 Q;  1HH2 P;  1TWA B;  4LK1 C;  1GUW A;  1RF2 D;  1SFO H;  1S5B D;  1I4R A;  1ZYR D;  3A7L A;  3TSS A;  1SMY C;  2ICE C;  1O7Y A;  5CV9 A;  5JPM C;  2E2I H;  1VQF A;  4ME3 A;  3I7F A;  1Q81 C;  4C3J H;  1B2T A;  4GN3 B;  1CQF A;  1D1K A;  1Y1W G;  4UP8 A;  3KF8 B;  3ULP A;  2K32 A;  2OQK A;  1E2W A;  4IJL A;  1IL2 A;  4OHJ A;  5IYB H;  4DGZ A;  2K50 A;  1L1O A;  1K8O A;  1A63 A;  2WV6 D;  1Y1W B;  4QQB X;  2JA7 B;  3PUX A;  1IBM L;  2EYM A;  5IP9 H;  2F0M A;  5M3F G;  4ZRZ A;  3PIP A;  1AE2 A;  2Y0S G;  1YI2 A;  4JI1 L;  1LYL A;  5EPK A;  4IUV A;  3PUZ A;  4JG2 A;  3S2D B;  5M3F B;  3QWN A;  1ASY A;  3E0E A;  1RDP D;  4LFB Q;  4DR1 Q;  1FYC A;  1BF4 A;  5CC4 A;  2Y0S B;  3ONA B;  3H3V H;  2F4V L;  2VW9 A;  1CKN A;  1KRT A;  4DV3 Q;  1YNN D;  3ZYY X;  2NVQ B;  1RIP A;  4NXN L;  3NXW A;  2VB3 X;  2B2T A;  4JW0 A;  3I91 A;  4QY7 A;  3V2T A;  2DJF C;  3U9S A;  1GUG A;  2F1M A;  4K5X A;  2MO0 A;  2WIN B;  1D6E C;  4DU9 A;  1EEI D;  1BBW A;  1WCM G;  2YU9 B;  3URY A;  1FJG Q;  3R93 A;  2L0C A;  4KY7 A;  4NP5 A;  3GTG B;  3VR3 A;  2I5M X;  3S2D H;  4ILW A;  5M3F H;  3QB3 A;  1C9O A;  4A3E G;  4ZK9 B;  1BVS A;  1WCM B;  1PH1 A;  3QO2 A;  3TRE A;  2SDF A;  2A1A A;  2J4X A;  2KCM A;  1STE A;  5E7N A;  3RUZ A;  1DCZ A;  1Y1V G;  1PYW D;  3MVV A;  3S17 B;  1I4X A;  1PH5 A;  2BE5 C;  4A3E B;  2OEO A;  4H13 C;  4B3T L;  1G2S A;  4L6T B;  1SNO A;  3BG3 A;  2VQF L;  2N88 A;  5FLX c;  1GUN A;  2EYH A;  2GA4 B;  1XX8 A;  2KQ3 A;  4KN4 C;  3J81 E;  2B2W C;  4B3S Q;  2JN4 A;  4CDC C;  3G6J B;  2SOB A;  1XMQ Q;  2YU9 H;  4FF3 A;  2J7Z A;  4XT3 B;  4DR7 L;  4K0K L;  3HOY G;  4OWT B;  3PUW A;  1CQV A;  4FO2 A;  4KHZ A;  1WCM H;  3J7A V;  2BA0 A;  3NEN A;  2HDM A;  4NPS A;  2DUD A;  3MEH A;  1GUS A;  4B3M L;  3TN2 A;  4L5Q A;  1JWM D;  5GAD C;  4GN4 B;  3PO2 G;  2E76 C;  3H15 A;  4NXM L;  3GQB A;  4RMF A;  1DJR D;  1TY2 A;  2VS1 A;  1WOC A;  5M5W H;  1V9P A;  1EY0 A;  1BR9 A;  3CHB D;  3PSI A;  1Y1V H;  3R2T A;  1KAB A;  3PO2 B;  2AWN A;  5LMU L;  1HFG A;  5C4H A;  3RZO B;  3EQL C;  1CHP D;  1DON A;  4A3F G;  2MHV A;  3SGI A;  2F0V A;  4QIW E;  1PH6 A;  2EDG A;  2K01 A;  2YTV A;  3JAM c;  1D1I A;  1U4M A;  5IYD G;  2KOL A;  4A3F B;  1S5F D;  3K57 A;  2QGQ A;  1H9R A;  1BBU A;  4QGU A;  1FVI A;  2K05 A;  3HOY H;  5ELD A;  2B2U A;  3AMU A;  1CSP A;  2Z9H A;  1X54 A;  3P1H A;  3TZD A;  3S1N B;  4UP7 A;  4KN7 C;  5DM6 3;  1H9M A;  2KEE A;  1B3A A;  2I0Q A;  5IE8 A;  4QJF A;  1HNX L;  3PO2 H;  3I55 A;  1UE1 A;  4C1N K;  4DNI A;  3P7J A;  1EZ6 A;  4IPD A;  1TWH H;  3CCU A;  4OX9 L;  3CC7 A;  4A3J G;  3WDN A;  2Z6B A;  3S2H B;  1E3P A;  4NW2 A;  5AFW A;  5EBD A;  3I2Z A;  4NB3 A;  4WOR A;  2XRS D;  3EJI A;  4IO9 A;  2R61 A;  1XMO Q;  2A6H C;  4A3J B;  1R4P B;  2UUA L;  4BA2 I;  3A56 A;  4DXG A;  4IQZ A;  4A3F H;  4FDB A;  2CWA A;  2HCC A;  3VA7 A;  2TMP A;  3STB D;  1SNC A;  2Q2I A;  3FEW X;  1CKO A;  2E8G A;  1LTB D;  2D9U A;  4L5S A;  1FNW A;  2K6A A;  2YV5 A;  2ZJP A;  3VDY A;  2JK8 A;  2F0I A;  3OOC A;  1EEF D;  1L0X B;  4JCV E;  5IGG A;  1F2Z A;  3P20 A;  4OGQ C;  2K75 A;  2Q8T A;  4EVO A;  1GJX A;  1EIG A;  1EFW A;  1IKL A;  3NEL A;  2A68 D;  3S2H H;  2KA7 A;  2LSS A;  4JI7 Q;  4F7X A;  4X65 Q;  1HA5 A;  2F0D A;  3CXC A;  1OTC A;  1N32 Q;  3E6Z X;  4F87 A;  2SNS A;  4B9X A;  4DR1 L;  4R4C A;  1QE6 A;  1E22 A;  1QZG A;  3EN2 A;  3SE0 A;  1EY9 A;  4JYA L;  1A2U A;  1IBL Q;  2MUY A;  4KI0 A;  4DV3 L;  2ES2 A;  4IOA A;  2UXB Q;  1WJJ A;  1T5X D;  2Z6K A;  4JI0 L;  1BQQ T;  2PW7 A;  1ZEQ X;  4KJN A;  1T5E A;  4CKC A;  5IT9 L;  3QOJ A;  5CBE E;  1ICF B;  1YNJ C;  2XRQ D;  3GTL B;  4NKL A;  1MBY A;  1ZKO A;  2B63 G;  1QJO A;  4X64 L;  1B3Q A;  5IOC A;  2Y0S E;  2JYO A;  2EY5 A;  4OWX B;  1EYD A;  4KV6 A;  2B63 B;  3GTO B;  2UUC L;  2MQH A;  4FXK C;  4K5V A;  3G7L A;  1MGS A;  2F0O A;  4RGT A;  5G3L D;  2BH8 A;  1CZG A;  2I46 A;  5C0X J;  4OXP A;  1XPR A;  1CK1 A;  2HD3 A;  1Y8N B;  2MGS A;  3J80 L;  2ATW A;  2F0U A;  4JOI A;  2DY8 A;  1BCP C;  4DV1 L;  4RGM A;  4X62 L;  1PH2 A;  1NMG A;  4DA2 A;  2HQL A;  4IFD J;  4B3S L;  4X66 Q;  2VQE Q;  4PZ6 A;  2K33 A;  1XMQ L;  5DLQ E;  2CVR A;  3M3Y B;  4PNY A;  2OF1 A;  3GTP H;  1HA6 A;  5FO9 B;  4GOP C;  1JJ2 A;  1G2T A;  3MHB A;  4HAE A;  2B63 H;  1HRJ A;  4LUV A;  3D6W A;  1EUJ A;  1OXU A;  1LTR D;  1N36 Q;  1YVC A;  3SK4 A;  1K8G A;  5JOB A;  2PPB C;  4NDX A;  1I50 H;  5HGQ A;  1X3Q A;  1PTO H;  4FXD A;  2EYF A;  4XIG S;  3TBI B;  3HKZ B;  2M9V A;  3GP7 A;  2MP1 A;  3S9W A;  5FJ8 H;  1LTG D;  2ZXR A;  4YCV A;  4ZUI A;  5C0X I;  2IX3 A;  3T1H Q;  1GHJ A;  2F0E A;  4G4K A;  1Y8O B;  1SE8 A;  2RSN A;  4P75 A;  2EJM A;  1L1O C;  3M3Y H;  3M4P A;  3NWS A;  3DXJ C;  1Y8P B;  4DV7 Q;  1XNR Q;  2A6E C;  3A8K E;  3VYU A;  4IFD I;  3CME A;  1EY7 A;  3BZD B;  3BVZ A;  5COR A;  3AB9 A;  4DV4 L;  2G9H D;  1I4H A;  5E4X A;  4DAP A;  4ODG A;  3SXH A;  3T16 A;  4R4T A;  3I70 A;  3CRL C;  3S16 B;  4WJ3 M;  2LY7 A;  2NVT B;  1LV9 A;  1SYD A;  1N8R C;  3D4W A;  4R1J A;  3RLN A;  2MPM A;  2QDL A;  4TVA B;  1Y14 B;  4XXE A;  1D5Z C;  4JI3 Q;  1NSN S;  2JA8 G;  1FNU A;  3MZ5 A;  4DK1 A;  4JI4 L;  2JE6 I;  3BVM A;  4O1N A;  5IY0 A;  2B2T C;  3S1Q B;  5IP7 H;  1A3U A;  4IAL A;  4IUR A;  2EE1 A;  1WTQ A;  3CC4 A;  1CUK A;  1ET6 A;  2Q8R E;  1R9T H;  3CU7 A;  1XMO L;  4R8N A;  5IWA Q;  1X56 A;  2A19 A;  3CPF A;  3DHQ A;  2I5L X;  2CW0 C;  1LUZ A;  1AH9 A;  1Q82 C;  1GD7 A;  3BU2 A;  4QUF A;  4LFC Q;  1ET9 A;  1A2T A;  4BY1 H;  4KTA A;  1VF5 C;  3AEV A;  4PQX A;  4HJA A;  1VQ7 A;  3SK6 A;  3T51 B;  1DOM A;  1LM0 A;  1ROD A;  4JC0 A;  1XPU A;  2H1E A;  4BY7 B;  3HP3 A;  3J80 E;  1ILP A;  1M8A A;  1KAW A;  5JVG 3;  2NTS A;  1EY5 A;  3C3L A;  1XTC D;  4JI7 L;  2PZU A;  4B08 A;  4X65 L;  2K14 A;  2JA8 H;  2R7Z H;  3ERO A;  5C44 G;  1A3T A;  1K28 A;  4IPG A;  3ZJY C;  1NAP A;  2LXK A;  3BS1 A;  3TRZ A;  5H1S E;  4DK6 C;  4K8J A;  3CCV A;  5JVH 3;  1TVX A;  1VQO A;  3RLO A;  3I4M H;  3OTO L;  4P2C B;  1IBL L;  2UUB Q;  1E0B A;  1VS0 A;  2KCN A;  2UXB L;  1U5K A;  4AH6 A;  3F2C A;  4LUO A;  1MIU A;  1C0A A;  1G6P A;  2RDH A;  1TII D;  4V19 0;  3PO3 H;  1IYJ B;  5CV6 A;  2RSO A;  2RCF A;  4N9P A;  1EYA A;  5LMN W;  3NHH A;  2RKS A;  2KUM A;  5FOB B;  3AFP A;  3DM3 A;  5DEH A;  1SR3 A;  5JPN C;  4FF2 A;  2OTJ A;  4S3S A;  4C3I G;  1JWU D;  1HFN A;  1STB A;  3KBG A;  2PZW A;  4GZY C;  4R4I A;  1IW7 C;  5CR3 A;  5CGK A;  3H09 A;  4K14 A;  2SEB D;  4DAY B;  1J5E Q;  3DWA A;  1QIL A;  1VQP A;  4C3I B;  1KTK A;  2D2C C;  5C44 H;  3W1G A;  1HNZ Q;  3KF8 A;  3FP9 A;  4A3G G;  3CCE A;  3KDF B;  1F9R A;  2NZH A;  1J6Q A;  3RNU A;  4O42 A;  4M1U B;  3TDQ A;  3CW2 C;  3HOV H;  3S1M H;  3RD4 A;  1J8I A;  1SRU A;  1VQH A;  2ZXP A;  3J7Y W;  2ZM6 Q;  3H6M A;  4HMI A;  1EY4 A;  3I72 A;  3OYY A;  2V1C C;  4QL5 A;  2B2Y C;  4X66 L;  2VQE L;  1X3G A;  5GRO A;  4DXF A;  1TS2 A;  2Q2H A;  3LWE A;  4N9T A;  3WOE A;  1V1Q A;  5F2D A;  4JI5 Q;  2QF7 A;  3N52 A;  2WKC A;  1MSG A;  1WI5 A;  1SN8 A;  4Y52 H;  4N8F A;  2CWP A;  2F0J A;  5IT9 c;  1Z9F A;  1A8V A;  2GVB A;  3TZU A;  3SK5 A;  3W5O A;  1IXR A;  1S72 A;  2PQA A;  2IY5 B;  4EQP A;  3FMC A;  3G48 A;  3DEO A;  2A69 D;  1ASZ A;  1TWF B;  4A3G H;  1VQ5 A;  1SFO B;  5CYU A;  1GM5 A;  2K5V A;  3IAY A;  1K8M A;  1YJW A;  5M3M G;  4KD3 A;  1PH4 A;  4FYD A;  3SEB A;  5IYB G;  4K2L A;  1EQR A;  3UDX A;  1HQM C;  4GKK Q;  4DV7 L;  4J6H A;  1SBB B;  5M5Y H;  1KIX A;  2Q2T A;  4POG A;  5IP9 G;  5LL6 X;  4HMJ A;  4LF5 Q;  5M5X H;  1IYV A;  2ICI A;  4OO1 I;  4DR6 Q;  4N8X 1;  3J80 i;  3J81 L;  2LS0 1;  4YWK A;  1KQS A;  4BBS H;  5E1F A;  3TP7 A;  5FLX E;  3O13 A;  4X3K A;  1QG7 A;  4DR2 L;  1S40 A;  3HKZ E;  4J1M A;  2F52 A;  1X32 A;  1TWF H;  1VDZ A;  4G7O C;  3IL8 A;  4G57 A;  3M4Y A;  3I8Z A;  4Q0F A;  1EU4 A;  4QB4 A;  4JI3 L;  1D5M C;  1HR0 W;  4LF6 Q;  1L0Y B;  2KCC A;  2F0G A;  4ZCK A;  1AEX A;  3U58 A;  1KRS A;  2PNH A;  3MC0 B;  3RN5 A;  2LMC B;  3D31 A;  2D0O A;  4XYQ A;  1PFS A;  4DF7 A;  4XDX A;  4A75 A;  1SYB A;  3NEM A;  1KDB A;  5M3M H;  2IL8 A;  1NCV A;  4B9W A;  2IX1 A;  2LFN A;  1PDQ A;  3ULL A;  3K5O A;  3E0J A;  1STH A;  5C3X A;  2OCE A;  5GQO A;  3D0F A;  1K73 C;  4K6D A;  4LFC L;  1EY8 A;  1Q12 A;  1TS5 A;  3F2D A;  3KFU A;  1B9N A;  2E2D C;  1HZC A;  3S14 H;  1HTL D;  1W6J A;  3PQI A;  4LW1 A;  1GVP A;  5GAG C;  2L55 A;  3HS0 C;  2KJX A;  1SE2 A;  4DR4 Q;  3A7A B;  3K58 A;  1VQK A;  4IFD H;  2L11 A;  3JAM E;  4A76 A;  4JOI C;  4JBW A;  1RHP A;  3OHX C;  3KYH C;  3K7A H;  5CV7 A;  2PQA B;  4ZQ3 A;  2NN6 G;  3U9O A;  2EVB A;  4KLK A;  4F8M A;  3FKI H;  1EIH A;  2AMC B;  2ZTC A;  1ENC A;  4CBV A;  3T13 A;  1V1P B;  1CFM A;  5IGB A;  5IOD A;  1U0L A;  3KK7 A;  4LUZ A;  3KOJ A;  2QCP X;  3D3R A;  1B7Y B;  1X3P A;  3NP8 A;  4U67 3;  4QUC A;  1CZW A;  1AZP A;  3VR2 A;  1LLR D;  2F0L A;  1SXT A;  2D5D A;  4Y7N H;  1YNJ D;  4C2M H;  2QA4 A;  3PV0 A;  4IUP A;  4RG1 A;  5EBC A;  3NPP A;  1PV4 A;  3R3O A;  5JEA G;  2QIL A;  4DV6 Q;  3GTQ B;  4JK1 C;  4DUY L;  1Z7T A;  2WII B;  4L63 B;  5M5W B;  2BH2 A;  1J5E L;  1Z6H A;  1PFN A;  3M4O B;  3KUP A;  1QVG A;  4JI2 Q;  2D62 A;  1Y1V B;  1HNZ L;  4LMQ D;  1U9R A;  5A35 A;  1K3R A;  2PMZ B;  3F1Z A;  1E2V A;  4KY5 A;  2NN6 H;  2XTI A;  3NTI A;  4CGY B;  1RCV D;  1KXL A;  5KYI A;  2CCZ A;  2EPB A;  1R4Q B;  1EU3 A;  1XJV A;  2HT1 A;  5I9O A;  1DGS A;  2ID0 A;  2K5Q A;  2OXP A;  3D6C A;  2K28 A;  3KLR A;  2R7D A;  4GNX C;  1AN8 A;  1DM0 B;  2L1B A;  1BBX C;  5E3F A;  3K6O A;  2AHO B;  2RDF A;  4DR5 Q;  3FPU B;  1PRT B;  1NUC A;  2KEN A;  4JI5 L;  1VQ4 A;  4OEM B;  3GTQ H;  3HOY B;  1Q8I A;  2WB1 G;  4ZLT F;  5JEA H;  3M4O H;  4KKT A;  1PRT D;  1IZ6 A;  1EL0 A;  3NK9 A;  3TQY A;  1EFI D;  4HSV A;  1F9Q A;  1WTR A;  2WB1 B;  4YWM A;  1OO9 B;  2EYL A;  3NE5 B;  2AQ1 B;  1TWH B;  1XTD A;  3AU7 A;  4ID6 A;  3PF5 A;  2P5Z X;  2VUM G;  5FO7 B;  4YY3 Q;  5CV4 A;  2AUJ D;  3HEJ A;  1NE3 A;  4DV0 Q;  3OW2 A;  4DV5 L;  4KMU C;  2IW3 A;  1D2B A;  2PYK A;  2I07 B;  5EPL A;  3PCO B;  1WFQ A;  3J7Z C;  2WAC A;  2A6E D;  4KHP Q;  1K83 B;  5G3L F;  3BZK A;  1LT5 D;  1SYF A;  2IHE A;  5KIX A;  2FFK B;  1N9W A;  1DOK A;  5J1Z A;  4GS3 A;  2UU9 Q;  4LF5 L;  1EQT A;  1O7L A;  2FMM A;  1XWE A;  2PI2 E;  4JI6 Q;  3J7A F;  4RFB A;  1QZH A;  1A0I A;  1JOO A;  3Q23 A;  1JMC A;  3I4L A;  5I9P A;  4A3B H;  1PYB A;  4LNQ A;  2A74 C;  3K0Y A;  3HOU G;  2QKI C;  3MXG A;  3R8B A;  1PH9 A;  4LF6 L;  1JE4 A;  4OO1 G;  2K5H A;  1VQM A;  3CCL A;  3ERQ A;  1E24 A;  5HY6 A;  4CJ1 B;  2VUM H;  1NMF A;  1ZYR C;  2E2J H;  1HNW Q;  1L2F A;  1GXD C;  1SYE A;  4CDD C;  3QIA A;  3BYY B;  4JVZ A;  1K83 H;  1S5E D;  1STY A;  4CKE A;  3ULJ A;  4YHH Q;  1WD1 A;  1F9S A;  1BO0 A;  2R7F A;  1U4P A;  4JV5 Q;  2SNM A;  1WTV A;  2CW0 D;  4ZUJ A;  4IN3 A;  1RKN A;  1CKM A;  1B4O A;  4NMZ A;  4GKJ Q;  1JCK B;  2FHT A;  5ELB A;  2CHB D;  1XYI A;  4PMC A;  3J7A 5;  3H3V C;  4EQO A;  1C4Q A;  1N34 Q;  5ELF A;  1KD1 C;  3RZD H;  1LTS D;  1EY6 A;  3CCQ A;  1MSH A;  1WD0 A;  3H0G H;  1YIT A;  4LFB L;  1F77 A;  4DR4 L;  3DUZ A;  3IFD A;  3HOU H;  1YHB A;  1N33 Q;  3BJU A;  2YYZ A;  5L37 A;  3J81 i;  1A62 A;  3QJY A;  4OO1 H;  1EWI A;  2PNR C;  3W3A A;  5IIF A;  3K5L A;  2BDN A;  1GO3 E;  4EQN A;  2RCN A;  4PMW A;  2C35 B;  4DAM A;  4A3K G;  1YNN C;  5DM7 3;  2EJG C;  1ENA A;  3A5Z B;  1QNU A;  1UNS A;  5FK9 C;  1F9P A;  2DNE A;  5I2X A;  3A54 A;  3BVG A;  2B3G A;  5K36 H;  2ZJR A;  3K5N A;  3Q22 A;  2CQA A;  2A8V A;  5DNF A;  3HOW G;  4A3K B;  2L15 A;  1FJG L;  3GTP B;  3PUV A;  4C3H G;  2AUK A;  3NSW A;  1CA5 A;  3T56 B;  3V05 A;  1VQD A;  2RDG A;  3NBH B;  3M9B A;  4A3C H; 
#chains in the Genus database with same CATH homology
 3EBE A;  2OQ0 A;  2EXD A;  1KAW A;  2MO1 A;  1HNX Q;  4DV6 L;  4H02 A;  4DR3 Q;  5GAH C;  4GOP A;  2KHJ A;  1OXS C;  4ALP A;  4JI7 L;  1I5F A;  2DGY A;  2FXQ A;  2CFM A;  3AYH B;  2K14 A;  4X65 L;  4OX9 Q;  2JA8 H;  5FJ8 G;  1L1O B;  1HH2 P;  5C44 G;  2R7Z H;  3S17 H;  4A3E H;  1I94 Q;  4LF7 Q;  4IPG A;  3ZJY C;  1X55 A;  2LXK A;  3TRZ A;  5H1S E;  4DK6 C;  1SFO H;  2WAQ E;  4JI2 L;  3CCV A;  4AQY L;  4LF8 Q;  2WFW A;  1VQO A;  2GN5 A;  3RLO A;  2E2I H;  3PUY A;  4HJ7 A;  3I4M H;  4MNO A;  1VQF A;  3OTO L;  4ME3 A;  2KHI A;  1T9H A;  3RR5 A;  3I7F A;  1Q81 C;  4C3J H;  1IBL L;  2UUB Q;  4GKK L;  4O2D A;  1B8A A;  4GN3 B;  1VS0 A;  5C3E H;  4A3K H;  2UXB L;  3FHW A;  1U5K A;  2D0P A;  4AH6 A;  3F2C A;  4IPC A;  1MIU A;  4LUO A;  1C0A A;  1Y1W G;  4UP8 A;  3KF8 B;  2XGT A;  4TQU S;  4JC0 A;  3ULP A;  1G6P A;  3PO3 H;  2OQK A;  2YTY A;  4IJL A;  1IYJ B;  4HJ9 A;  1IL2 A;  1XPU A;  4DR6 L;  3UE0 A;  5IYB H;  2JJQ A;  3HKS A;  3HOW H;  4R4O A;  5LMN W;  4UPA A;  1CKN B;  2K50 A;  1L1O A;  4C3H H;  4DV4 Q;  1A63 A;  2N8N A;  3JAM i;  3H0G G;  4DR5 L;  1Q1B A;  4QQB X;  3AFP A;  3DM3 A;  3PUX A;  1IBM L;  5IP9 H;  1SR3 A;  3F2B A;  4HJ8 A;  1Q86 C;  5M3F G;  4MZ9 A;  4A3L H;  2OTJ A;  2OWO A;  1CSQ A;  3PIP A;  1AE2 A;  1X3E A;  1X6O A;  2Y0S G;  4R4Q A;  1YI2 A;  4JI1 L;  3CCJ A;  1TWC H;  1LYL A;  2JA9 A;  2PMZ E;  4R4I A;  3GTM H;  5IP7 G;  3LGJ A;  3PUZ A;  4JG2 A;  2JEA I;  1P8L A;  4DAY B;  1J5E Q;  2JEB I;  1ASY A;  4LFB Q;  3E0E A;  1VQP A;  1EYG A;  1P16 A;  4DV2 Q;  4DR1 Q;  4JBK A;  5C44 H;  3W1G A;  1UWV A;  3CP0 A;  3FP9 A;  1HNZ Q;  1NTG A;  2Z0S A;  2HIV A;  4A3G G;  2IX0 A;  3RZO H;  1RL2 A;  4JI4 Q;  3GD7 A;  3CCE A;  2IT1 A;  3KDF B;  4BA1 I;  3HOX H;  3G4S A;  2NZH A;  1SLJ A;  1J6Q A;  3RNU A;  2F4V L;  3H3V H;  3K80 C;  2AWO A;  2E5L Q;  2VW9 A;  1CKN A;  1KRT A;  4DV3 Q;  4DV0 L;  5K36 G;  3CW2 C;  3HOV H;  1D8L A;  3S1M H;  2HHH L;  1RIP A;  1SRU A;  4NXN L;  1VQH A;  1K9M C;  4BY1 G;  2ZM6 Q;  3RN2 A;  4QY7 A;  1HZ9 A;  2ALY B;  3OYY A;  2R92 G;  2V1C C;  4QL5 A;  4X66 L;  2VQE L;  1HZB A;  1X3G A;  4L5T A;  2YTX A;  5GRO A;  4KHP L;  2MO0 A;  4A3C G;  2Q2H A;  3AQQ A;  1VQN A;  1V1Q A;  1BBW A;  1PH8 A;  4JI5 Q;  4A93 G;  3AFQ A;  1WCM G;  3S24 A;  1WI5 A;  5IYD H;  1SN8 A;  2UXC Q;  4Y52 H;  1FJG Q;  2N49 A;  2WB1 E;  4APV A;  2CWP A;  3S1N H;  5IT9 c;  2I5M X;  1Z9F A;  2UXD Q;  3S2D H;  4JI6 L;  1JE5 A;  3J81 c;  5M3F H;  3KDF A;  1C9O A;  2R7Z G;  1A8V A;  2GVB A;  4JBJ A;  4A3E G;  3IRB A;  1VQG A;  3M9B A;  2E2H H;  1BVS A;  3H3V I;  1PH1 A;  3TRE A;  3W5O A;  2JQO A;  2A1A A;  2KCM A;  1IXR A;  1S72 A;  2PQA A;  1W2B A;  5E7N A;  2OTL A;  5BR8 Q;  2IY5 B;  1EOV A;  4X6A H;  3G48 A;  1E1T A;  3KJO A;  4DK3 C;  2Q2U A;  1Y1V G;  4XTC S;  1ASZ A;  1O7I A;  5LMN Q;  1PH5 A;  3I4M G;  2LXJ A;  4P72 A;  4A3G H;  4B3T L;  1VQ5 A;  1I6H H;  3CC2 A;  1NJI C;  2VQF L;  2K5V A;  4A3J H;  1GM5 A;  1QUQ B;  5FLX c;  3M7N A;  3CCS A;  1YJW A;  3S15 H;  5M3M G;  1G29 1;  3RLF A;  1Q8K A;  1PH4 A;  3PO3 G;  2RF4 A;  1Z47 A;  5IYB G;  5FLM G;  2JA5 G;  3OTO Q;  1YJN A;  1EQR A;  3UDX A;  4B3S Q;  4GKK Q;  4IPH A;  4DV7 L;  1XMQ Q;  2YU9 H;  5M5Y H;  1KIX A;  2Q2T A;  1X3F A;  3F8T A;  4POG A;  2R92 H;  3BZC A;  1PA6 A;  5IP9 G;  4DR7 L;  5IYC H;  4DUZ Q;  1TWG H;  3HOY G;  4OWT B;  3PUW A;  1VQL A;  4LF5 Q;  4K0K L;  5M5X H;  3T1Y Q;  4KHZ A;  3UDI A;  2PI2 A;  4OO1 I;  5ELO A;  4DR6 Q;  4A93 H;  3J80 i;  1WCM H;  4JI8 L;  3MXN B;  2BA0 A;  3NEN A;  4BBR G;  4OON A;  4YWK A;  1KQS A;  4NPS A;  4BBS H;  2DUD A;  2N3S A;  2VL6 A;  4B3M L;  1N34 L;  4L5Q A;  4HID A;  5ELN A;  4DR2 L;  1SRO A;  1QUQ A;  3HKZ E;  4GN4 B;  2K4K A;  2F52 A;  5GAD C;  1S40 A;  3PO2 G;  1N32 L;  1TWF H;  3H15 A;  1H95 A;  4NXM L;  1VQB A;  4RMF A;  2VS1 A;  1WOC A;  3JC6 6;  4LWC A;  4JI1 Q;  5M5W H;  3HOX G;  4JI3 L;  1HR0 W;  1V9P A;  4LF6 Q;  4LF4 Q;  1GKH A;  3PSI A;  1TXY A;  1Y1V H;  1N33 L;  3U58 A;  2CKZ B;  1KRS A;  2PNH A;  2AWN A;  3HOV G;  5LMU L;  3RN5 A;  3D31 A;  2D0O A;  1PFS A;  4LFA L;  3U4V A;  4A75 A;  4A3F G;  3SGI A;  3NEM A;  5M3M H;  5JJI A;  4DPG A;  2F4V Q;  4QIW E;  4A3I H;  1PH6 A;  2YTV A;  3JAM c;  2IX1 A;  1IBK Q;  5FLM H;  2JA5 H;  1PH7 A;  2BA1 A;  4GLA C;  3ULL A;  5AJ3 Q;  4NXN Q;  3HFZ B;  5IYD G;  2N78 A;  2OCE A;  5GQO A;  3Q8D A;  2QGQ A;  3D0F A;  1K73 C;  1BBU A;  4A4I A;  4QGU A;  3GTL H;  1FVI A;  4LFC L;  1Q12 A;  1I3Q H;  3HOY H;  3PGZ A;  3F2D A;  3KFU A;  1HZC A;  3S14 H;  5C4X H;  1OXT A;  3A0J A;  5C4J H;  1CSP A;  2KCT A;  3A74 A;  1X54 A;  4BBR H;  4LW1 A;  1GVP A;  4OWW B;  4UP7 A;  1UE7 A;  5GAE C;  5GAG C;  3TS0 A;  4AIM A;  3GTO H;  2I0Q A;  4DR4 Q;  5IE8 A;  4QJF A;  2QEX A;  1HNX L;  3PO2 H;  3I55 A;  1UE1 A;  3CPW A;  4DR3 L;  1VQK A;  4DNI A;  4IPD A;  1VQA A;  1TWH H;  3CCU A;  4JOI C;  3CC7 A;  4A76 A;  4A3J G;  3HKZ G;  4JBW A;  3WWV A;  4YY3 L;  4OX9 L;  2CQO A;  1JT8 A;  1I94 L;  3CCR A;  1E3P A;  3I56 A;  4LF7 L;  1NBW A;  3KYH C;  3K7A H;  3TEH B;  1FGU A;  4YCW A;  2WAQ G;  4A3D G;  3I2Z A;  4NB3 A;  2PQA B;  1WYD A;  2KBN A;  2NN6 G;  4IO9 A;  4B3R Q;  4IOC A;  1XMO Q;  4KLK A;  3KF6 A;  4BA2 I;  2UUA L;  3FKI H;  3ICE A;  4A3F H;  1OXV A;  1VCI A;  2AMC B;  4FDB A;  1KHI A;  2VQF Q;  2CWA A;  2ZTC A;  5IYC G;  3STB D;  2NVY H;  4LF9 Q;  1U0L A;  2Q2I A;  1XNQ Q;  4LUZ A;  1HR0 Q;  1CKO A;  3KOJ A;  1B7Y B;  2UU9 L;  2E8G A;  4L5S A;  4BBS G;  1S3O A;  3CD6 A;  2YV5 A;  2ZJP A;  4AYB E;  3VDY A;  1PH3 A;  2EQS A;  2JK8 A;  4O0A A;  4JCV E;  4Y7N H;  1YBY A;  4C2M H;  3ERS X;  3PV0 A;  2QA4 A;  4RG1 A;  2K75 A;  5J3B A;  1W3S A;  1N36 L;  1QVF A;  1EFW A;  2GVA A;  1PV4 A;  5JEA G;  3NEL A;  4DV6 Q;  3G71 A;  3S2H H;  2K52 A;  2LSS A;  4JI7 Q;  4DUY L;  4B3M Q;  1KL9 A;  3M4Q A;  4X65 Q;  3CXC A;  1SMX A;  4DR2 Q;  1OTC A;  3PIO A;  1N32 Q;  4GNX A;  3G6E A;  4BXX G;  4P74 A;  4NXM Q;  1J5E L;  2BH2 A;  4EX5 A;  3I4N G;  3S1R H;  4DR1 L;  4DV2 L;  4R4C A;  4JI2 Q;  1QVG A;  2D62 A;  4AQY Q;  1HNW L;  3T1H L;  1M90 C;  1HNZ L;  4A3I G;  1Q1E A;  1K3R A;  3F1Z A;  4HIO A;  1E22 A;  4A3D H;  1QZG A;  3EN2 A;  3ER0 A;  4YCU A;  2XTI A;  1EQQ A;  2WP8 J;  4YWL A;  4JYA L;  1IBL Q;  3K7U C;  4JBM A;  1XNR L;  4KI0 A;  4YHH L;  4DV3 L;  2ES2 A;  1KXL A;  4IOA A;  3STB C;  1EIY B;  2UXB Q;  1WJJ A;  2CCZ A;  4JV5 L;  2Z6K A;  1XJV A;  4JI0 L;  2HT1 A;  1DGS A;  3K81 C;  3J80 c;  2ID0 A;  4A3M G;  4PZ7 A;  4GKJ L;  5C4X G;  5C0X G;  1VQ9 A;  2R7D A;  5JEA J;  4EQ5 A;  4GNX C;  4A3B G;  4DKA C;  3KJP A;  4PZ8 A;  2B29 A;  2AHO B;  3B6Y A;  4DR5 Q;  3S16 H;  2KEN A;  4JI5 L;  1VQ4 A;  1IBM Q;  2RHS B;  1YJ9 A;  2B63 G;  3GTQ H;  4BY7 G;  2NVT H;  2AKW B;  2WB1 G;  4IFD G;  2UXC L;  4X64 L;  2Y0S E;  3W1B A;  1MJE A;  3M4O H;  2NZO A;  4OWX B;  1IZ6 A;  3L0O A;  2Z6K C;  3TQY A;  2NN6 I;  2UUC L;  2MQH A;  2ASB A;  1UEB A;  1E7Z A;  4YWM A;  1XPO A;  5BR8 L;  3EIV A;  2R93 G;  4BXX H;  3S1Q H;  4GN5 A;  1XTD A;  2I5H A;  3FKI G;  3I4N H;  1QVC A;  5LMN L;  3PF5 A;  1Q7Y C;  1C7Y A;  2VUM G;  4YY3 Q;  2BH8 A;  5IWA L;  1NE3 A;  5C0X J;  4DV0 Q;  1AE3 A;  1E1O A;  2ZTD A;  4OXP A;  2MNA A;  3OW2 A;  1XPR A;  4DV5 L;  2HHH Q;  2ATW A;  1FL0 A;  1K8A C;  4JOI A;  1VQE A;  4DV1 L;  2UUA Q;  1K0R A;  3K0X A;  4X62 L;  1PH2 A;  4POF A;  1NMG A;  3PCO B;  1WFQ A;  2HQL A;  3J7Z C;  4B3S L;  4IFD J;  4A3M H;  4X66 Q;  1JJC B;  3KF6 B;  2VQE Q;  5JJL A;  4PZ6 A;  1XMQ L;  4KHP Q;  5DLQ E;  3BZK A;  2IHE A;  2H5X A;  3GTP H;  4GOP C;  1N9W A;  5EAY A;  1Q46 A;  1YEZ A;  4DUZ L;  1PHJ A;  2JA7 G;  4GS3 A;  1JJ2 A;  2UU9 Q;  4LF5 L;  1YZ6 A;  3M85 A;  1MJC A;  3UDF A;  3T1Y L;  2NVX H;  1YHQ A;  2B63 H;  3U50 C;  2PI2 E;  4JI6 Q;  1X9N A;  4LUV A;  1QZH A;  1A0I A;  4BY7 H;  3GTJ H;  1VQI A;  1EUJ A;  4WJ4 A;  1OXU A;  1M1K C;  1D7Q A;  1JMC A;  1N36 Q;  1YVC A;  1K8G A;  4A3B H;  1PVO A;  1PYB A;  4LNQ A;  1TWA H;  3HOU G;  4DUY Q;  1I50 H;  5HGQ A;  1PH9 A;  4LF6 L;  4LF4 L;  2R93 H;  4OO1 G;  4B3T Q;  1UE5 A;  2K5H A;  4XIG S;  1VQM A;  4LF8 L;  1YHA A;  1BKB A;  1NY4 A;  3CCL A;  1E24 A;  5HY6 A;  2VUM H;  1NMF A;  5FJ8 H;  2UUB L;  4GNX B;  4YCV A;  5C0X I;  2E2J H;  2F3I A;  3T1H Q;  1HNW Q;  1L2F A;  1UE6 A;  2K5N A;  2VY3 A;  1PYS B;  1SE8 A;  2ZTE A;  4P75 A;  1L1O C;  1K83 H;  4GLV B;  1YIJ A;  3M4P A;  3M3Y H;  4JYA Q;  4DV7 Q;  1XNR Q;  4YHH Q;  3ULJ A;  1HZA A;  2HIX A;  2R7F A;  3K8A A;  4PG3 A;  1IBK L;  4IFD I;  4JV5 Q;  3CME A;  3UDG A;  4JI0 Q;  4HIK A;  4DR7 Q;  4DV4 L;  4K0K Q;  1HJP A;  3I4O A;  5AJ3 L;  3HOZ G;  1CKM A;  3CMA A;  4GKJ Q;  4J15 A;  1Y1W H;  1B70 B;  4JI8 Q;  2JA7 H;  2JA6 G;  4R4T A;  3TS2 A;  1MKH A;  2ZJQ A;  3DLL A;  3J7A 5;  4WJ3 M;  2R6G A;  1N34 Q;  1KD1 C;  3RZD H;  1KC8 C;  3KLW A;  3CCM A;  3CCQ A;  3CQZ H;  3H0G H;  1N8R C;  4L5R C;  4R1J A;  3RLN A;  4TVA B;  4X64 Q;  1YIT A;  1Y14 B;  4LFB L;  4IJH A;  1G51 A;  4DR4 L;  4JI3 Q;  2JA8 G;  4C3I H;  4UY8 C;  1VQ8 A;  3HOU H;  1YHB A;  4JI4 L;  1N33 Q;  3BJU A;  3PF4 A;  2YYZ A;  2JE6 I;  2UUC Q;  3J81 i;  2VZA A;  1A62 A;  5IY0 A;  5LMU Q;  5IP7 H;  1EWI A;  1LTL A;  2E5L L;  3A5U A;  4P71 A;  1EIF A;  4MTN A;  1GO3 E;  1OXX K;  1VQJ A;  3GO5 A;  4P73 A;  4LFA Q;  2RCN A;  1CUK A;  4PMW A;  3CC4 A;  3E9I A;  2C35 B;  4GOP B;  1L0W A;  2IHF A;  3GTK H;  4GLX A;  1R9T H;  4B3R L;  1XMO L;  2ZM6 L;  2NVQ H;  3U4Z A;  4DAM A;  5IWA Q;  5C3E G;  1JB7 A;  1X56 A;  4A3K G;  4HIM A;  4UP9 A;  2A19 A;  3CPF A;  4DV5 Q;  3A5Z B;  2I5L X;  1LUZ A;  2EIF A;  1AH9 A;  3CAM A;  1V43 A;  2B3G A;  2ZJR A;  1Q82 C;  4HJ5 A;  1GD7 A;  4DV1 Q;  4LF9 L;  3E9H A;  1XNQ L;  1HR0 L;  3BU2 A;  3MEF A;  4X62 Q;  2A8V A;  5JJK A;  1VQC A;  4LFC Q;  3HOW G;  3J81 j;  3L2P A;  3HOZ H;  1JJG A;  1VQ6 A;  2L15 A;  2MFI A;  3CF5 A;  4BY1 H;  3PUV A;  3UE1 A;  1FJG L;  4AYB G;  2UXD L;  3AEV A;  4HJA A;  3L7Z C;  2RHQ B;  2VNU D;  1VQ7 A;  3GTG H;  2JA6 H;  4A3L G;  1VQD A;  3NBH B;  1YNX A;  1LM0 A;  4A3C H;  1X65 A;  3GDE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...