3TZDA

Crystal structure of the complex of human chromobox homolog 3 (cbx3)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
58
structure length
58
Chain Sequence
LYFQGEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromobox protein homolog 3
publication title Structural basis of the chromodomain of Cbx3 bound to methylated peptides from histone h1 and G9a.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna binding protein
total genus 12
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2011-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3tzdA00
2B2YC 1JICA 3I3CA 4NW2A 4XT3B 1VMCA 1SAPA 1CA6A 5E4XA 2HUGA 1MSGA 4IUQA 4RA8A 4IURA 1DZ1A 1F9SA 1M8AA 2MGSA 3HP3A 4O42A 4DN4M 5JJZA 5EJWA 1X3QA 1S4ZA 1PFNA 1HUMA 2SDFA 2DY8A 1HFNA 2RSNA 5CORA 1Q3LA 1WTQA 1RTNA 2B2WC 2FJ2A 2K05A 3F2UA 1EIGA 1X3PA 3UI2A 1RHPA 2X69A 3LWEA 5EPLA 1PFBA 2B2YA 2HDLA 5CBEE 4X3KA 1EL0A 2HCIA 4CJ0B 1BO0A 1QNKA 2B2UA 2H1EA 1IKLA 2B2VA 2KECA 2R3ZA 2KVMA 1B4OA 3Q6SA 2JP1A 1BNZA 1RODA 1QE6A 4RWSC 4XT1B 2JYOA 4IUTA 1WD0A 4ZLTF 1B2TA 4OIKA 2RA4A 1QG7A 2DY7A 3R93A 2XIWA 3G7LA 1WTOA 3IL8A 1CA5A 2EPBA 2B2WA 2RSOA 4IUUA 1WTWA 5T1GA 2K28A 4HAEA 2D9UA 2B2UC 2FFKB 2K04A 2B2VC 3IFDA 4HCSA 4X3UA 2FINB 2KEDA 3FDTA 1PFMA 4OIJA 2KOLA 3DM1A 4ZKBB 2B2TC 1TVXA 5EKIA 1B50A 3KUPA 1IL8A 1B53A 1E0BA 5EPJA 2Q8TA 1NCVA 2BDNA 4HEDA 1IKMA 1J8IA 4HSVA 4IUPA 1WTVA 2X6LA 1HUNA 1WTRA 1KNEA 3I91A 1F2LA 1GUWA 5AFWA 1MI2A 4X3SA 1DOMA 2L11A 4R9WA 5E4WC 2MJ8A 3H91A 4CJ1B 2NYZD 4R8IA 3I90A 2K03A 2L9HA 4ZAIA 3SVMA 2EE1A 3P7JA 1NR4A 2B2TA 2MP1A 1DONA 3N52A 1F9RA 2L1BA 4UAIA 1PLFA 1BF4A 1CM9A 2NWGA 2L12A 4ZKCB 1ZXTA 4IUVA 1U4PA 1MGSA 1NAPA 3FPUB 3KBXA 4X3TA 5D65A 1A15A 1ICWA 1O80A 1RJTA 3TZDA 1RTOA 2CVRA 1EOTA 1HFGA 1AZQA 1EQTA 1VMPA 4QUCA 4MHEA 1G2TA 2FHTA 3MTSA 1U4LA 5EQ0A 1ILQA 1WTPA 1O7ZA 4XDXA 3GV6A 1MSHA 1G91A 1EIHA 3DEPA 5EPKA 3MWYW 1J9OA 2Q8RE 3I8ZA 2KUMA 1G6ZA 1HA6A 5CMDA 2X6GA 1NR2A 1PDQA 1AP0A 1KNAA 2IL8A 1DOLA 1G2SA 1F9PA 3GV3A 3QO2A 4RAUC 3TN2A 2L4NA 3D6WA 1U4RA 4MN3A 2HDMA 2K01A 1WTXA 2N88A 4CJ2C 1BBXC 5DNFA 4LMQD 2J7ZA 5COYA 1F9QA 1LV9A 1U4MA 1SSOA 1O7YA 4QUFA 2K1BA 4ZK9B 1ILPA 2NZ1D 1XYIA 1HRJA 1ESRA 1SDFA 2HCCA 2M2LA 5CBAE 2FMMA 1B3AA 1XX8A 2MPMA 5T1IA 1WVLA 1HHVA 1ML0D 2N55A 2KEEA 2VXWA 1C8CA 3DEOA 3ONAB 1DOKA 1WD1A 2RVLA 5D14A 2EOTA 1AZPA 1JE4A 1X32A 4U68A
chains in the Genus database with same CATH superfamily
4LK1C 1JICA 4XQNA 5E4XA 3GTGH 1MJEA 3NBHB 3NEMA 2XWJB 4OX9L 3PO2H 4JOIA 1X65A 1I3QH 3SE0A 1TS3A 1WTQA 1RTNA 1VF7A 2UXCQ 1PFBA 5CBEE 1D1KA 2HDLA 5AJ3Q 2E2HB 4KLKA 2EZVA 1CHPD 5C4XB 2JA7G 4JI0Q 4OEMB 4YCVA 1JB3A 2DY7A 1S5FD 1L0WA 4DR5L 5IP7G 1M4VA 4HAEA 4KHVA 4PNYA 4UDUC 5ELOA 1O7IA 4HCSA 4X3UA 3J7AV 3ERQA 1RCVD 1RIPA 3PSIA 1LABA 5C4ZA 1KRTA 2CW0D 4WRDA 5M3FG 5M3MB 1TY2A 4HSVA 1NMGA 3CD6A 1SNDA 4RG1A 2CH4W 2CKZB 3U4ZA 3DWPA 3S1QB 1GUGA 1U0LA 1DD2A 1UE5A 1RL2A 1KDCA 2JA6G 3GTLB 2I5MX 3I4NG 2R93B 5C44G 5C6AA 1E22A 2WV6D 4KHZA 4KY7A 4KMUC 1PRTC 3T1HQ 2WAQB 1QB5D 3KBXA 1RF2D 3WWVA 1H9KA 5C3XA 4B3SQ 2VL6A 3M9BA 1VQ7A 1BCPF 1O7LA 4CBVA 3NQIA 4KKTA 2XNAC 5EBDA 1EWHA 1GUSA 4MNOA 3KLWA 4LWCA 1V1OA 1DXMA 1H9JA 4A3DH 2X6GA 1GUTA 1WTHA 4LFAL 3A8JE 4TQUS 2IL8A 1V1PA 3D4WA 1PH2A 2Q8IB 4FF4A 4P74A 3S1NH 1FNVA 2XGTA 1QJOA 2RHQB 2QEXA 2AQ3B 4G57A 3RNUA 5KNDA 4PZ8A 1MKHA 2EJGC 2PI2A 4FO2A 3NHHA 1EWCA 1DCZA 4ZRZA 3ONAB 3CXCA 4JI8Q 5C5MA 1IW7D 3M4YA 1AE2A 3I4MB 4ZUJA 1A3UA 5C3EH 4U68A 1FNUA 3STBD 3W1GA 3T1YL 4XT3B 1VMCA 4R4QA 1FGUA 1OXUA 4IURA 3RZDH 4DN4M 1S5CD 4XYOA 1G51A 2DY8A 5CC4A 1SNMA 3PF5A 3VDYA 1SJED 3OWEB 4DV1Q 4LUZA 5J1ZA 1J5EL 4K8IA 3SDZA 3OSOA 4XT1B 1CQFA 3TS0A 1C4QA 4FVMA 5IYBH 1WI5A 4OWWB 4CKCA 4KY6A 3NXWA 3I56A 1IYUA 1QWYA 2UXDL 1UEBA 3EVQA 3VYUA 3L3OC 5IODA 1F2ZA 3WDNA 3ND9A 1D6EC 1EUJA 3RLFA 5EKIA 2M9VA 2BDNA 2MO1A 3A7LA 1TWCB 3BJUA 1RKNA 2EY1A 2R7ZG 3J7ZC 3Q23A 4JK1C 1NE3A 2FXQA 4A3LG 1X56A 3I73A 5IGCA 4A3JB 4BBSB 2RF4A 3OMCA 4JV5L 2WINB 3NE5B 3CCJA 1BF4A 1SYBA 4JI3L 3CPFA 1VQGA 2K5HA 4LW1A 1KL9A 5FJ8G 1CKOA 5D65A 3F8TA 3FEWX 3FP9A 2OQ0A 1QOHA 2EY5A 1J6QA 2UUCQ 2FHTA 3L0OA 5A2QE 3U9SA 3S16B 4XYQA 2I46A 2Q8RE 2A73B 3DUZA 2KCMA 2SNMA 3PV0A 4GOPB 5JAVA 1LUZA 1KABA 2B29A 3DWAA 1AH9A 2KHSA 1JORA 1CZGA 1YNXA 3KBGA 4JI7Q 2OT2A 1XXGA 3PUWA 4MN3A 2QDLA 4RKBA 4WJ3M 1F2MA 4GKJL 1XMOQ 3FKIG 1PRTF 3CC2A 3HOYB 2Q2UA 1ZKOA 4QQBX 2QW7A 2E8GA 1Q8IA 3S17B 3GTOB 2GN5A 1JE4A 1PZJD 3CU7A 2I5HA 3RN2A 5ELDA 3CMAA 3OW7A 3H3VI 2YTVA 1R4QB 5FO8B 4MZ9A 4JI6L 5KNBA 2EY6A 4JVZA 1Q3LA 5NUCA 2QCPX 3UI2A 5GAGC 5LMNQ 4J1MA 1X3PA 5IT9c 4DUYL 4POGA 3LWEA 3H3VH 4A3IB 1LM0A 3ITPA 1QNKA 5M3FH 1X55A 2R3ZA 1SYCA 2KVMA 2VUMG 4RWSC 4JG2A 1CQVA 2JYOA 4ZLTF 5C5LA 3HOZB 4O0AA 4GKKL 2RSOA 4NKLA 1NTGA 4KHPL 1EYCA 2JA6H 4ABNA 1HR0Q 1QUQB 5IYDG 4NXML 4YCWA 5C44H 2B2TC 2AUKA 1PMRA 5KGUA 1AW7A 3U50C 1B70B 4DR7Q 3ERSX 1A8VA 2LMCB 1JQYD 4HTHA 2GVBA 3F1ZA 1B9NA 5E4WC 5EAYA 1PH5A 3BVMA 1K8MA 4Y7NH 1TY0A 2L9HA 2F0PA 1IYVA 4A93B 1Q1BA 1I6HH 1QNUA 2ICEC 5G3LD 4HJ5A 1UE6A 2ZXOA 2AHOB 2EYHA 1LACA 2ZXPA 1I3QB 4Q5VA 1I4QA 1YHBA 2UXBL 1AZQA 5CR3A 3K5NA 1VQPA 4BY1G 1N32L 4DNRB 2E2JH 2DJGC 4BA1I 4Z9CB 2A1AA 2EYJA 2XN9C 3UDIA 2R7FA 5I9PA 1HQRD 1HTPA 3FRPB 2A6ED 1F9PA 4OWXB 4IFDJ 2B63G 1YJWA 1PZID 1HXYD 4NXNQ 3H0GG 3AB9A 3C3LA 5D3IB 5IWAQ 1SLJA 3OHXC 1EEID 5CV5A 4X62L 4I7AA 1EYGA 4K2KA 4A3FG 5D14A 4AIMA 4KTAA 4A76A 2K75A 1S40A 2WACA 1CA6A 4DK1A 3WOEA 4QIWB 2HUGA 2ZXRA 2F0QA 1M8AA 1VCIA 2Y0SB 5IE8A 4C2MH 5KIXA 4OO1G 5A2QL 4WFN3 3SK6A 3CCVA 2FJ2A 1VQJA 4IFDG 1EL0A 1U9RA 5HGQA 1E2WA 2H1EA 1K3RA 3GTPB 4XQQA 2R7ZH 1UE7A 1H9SA 1HCZA 1LTTD 5BN3A 4A3LH 1H9SB 3HGBA 3LGJA 3F2DA 4KI0A 5IP9G 3PIP3 4A3DB 2AKWB 2F3WA 4DV0Q 3CRKC 2EVBA 2Z6KC 1MJCA 2VNUD 1PFMA 3E9HA 3DHQA 3TDQA 4UP9A 1K3BC 1VQHA 2K33A 4KJNA 5FJ8H 1QILA 4L63B 2Q8TA 2H5XA 1IKMA 1CFMA 3M7GA 4EQOA 3S1RH 1JOKA 1JR0D 4A3CG 5LMUL 2K6AA 2ATWA 4QMGA 4X3SA 4P72A 4DV7Q 3P7JA 3NUCA 5C3EB 2EYMA 4OHJA 1L1OC 2CW0C 2IX0A 4E6IA 1WCMG 1N33Q 5D3DA 3RZDB 2E75C 1Y1WB 4L5SA 4JBKA 2R7DA 4IUVA 2EYLA 2Z0SA 4EQNA 4X3TA 5DM73 1G8ZD 1RJTA 4DAMA 2E2IB 1A63A 3K0XA 2QA4A 2ALYB 4HIKA 2RQXA 4DK0A 3M3YH 3HFZB 3D31A 1K0SA 5EQ0A 3K59A 1WTPA 3AEVA 3CCEA 5J3BA 1EY7A 4C3JB 4DR2L 3FKIH 2NN6H 2KHJA 2LXKA 3AU7A 3GTMH 2R92B 1TS5A 3JAME 1K8GA 1V8QA 4JI2L 4JI4Q 2BH2A 1Z6HA 2VB2X 1XPOA 4DA2A 1PTOC 3TQYA 2XRQD 4ZYSA 1FNWA 3T16A 2K52A 1HPCA 3QWNA 2QEJC 1GUOA 4POFA 3E0JA 1Z9FA 1XPRA 3T56B 5CYUA 4HCEA 2KQ3A 1A6XA 2VUMH 2O5IC 4X65Q 1YHAA 1WD1A 2ZJRA 3H3VC 2AMCB 5DAUA 2L15A 5I6YA 3HKSA 1K8OA 2F4VQ 5IYDH 5CORA 2JE6I 1IW7C 3STBC 1Q81C 4KN4C 4DR4L 4B3TQ 1G291 5FK9C 1H9MA 5LL6X 1B4OA 1TWGB 2JP1A 1A0IA 2PZUA 2ZM6Q 1WD0A 4B3MQ 1IBLQ 5KNCA 4JYAL 3M4QA 1W6KA 1JT8A 1HH2P 1GOZA 4DV6Q 1STAA 3MZ5A 1YNNC 3PQIA 1F77A 1I4HA 1MBYA 2KHIA 3ICEA 2B2VC 2D0OA 5E3FA 2JQOA 4B9WA 2E74C 4LF8Q 3OWFA 4EQPA 4KK7A 5HURA 4GNXA 2K5DA 1OXSC 1PYWD 1V43A 3T53B 4GNXB 1ICFB 1RDPD 2B8FA 4GN5A 1X3FA 3NTIA 1F2LA 4BY1H 3FPPA 4R4IA 1ENFA 4ZCKA 3HOUG 4LF7L 4LF5L 1V1QA 4P73A 3TP5A 4BY7B 2F0UA 1NR4A 3CCLA 1XPUA 3D3RA 1TU2B 2VQEQ 1BXTA 2NZOA 4UAIA 5IOCA 2NVTB 5ELEA 4RCOA 2G9HD 1I6VC 1SMXA 3GD7A 4AYBG 2B63H 1EZ6A 3SK4A 1EU3A 5CV7A 1ICWA 1YHQA 4PMBA 1RTOA 4X66Q 3I7FA 5C4JH 1VQDA 1KAWA 2C35B 1O7ZA 4LF4L 1TWFH 3CP0A 3W2DA 1J9OA 4JI5Q 1AFPA 4YY3L 4A3FH 1SJHD 2KENA 4OO1I 2WKDA 3HOXG 3PIOA 4K0KL 1EY8A 3MA2B 3NWSA 4IFDI 1RD9D 4C1NK 2J7ZA 3A74A 1S72A 1LV9A 4BXXH 4OO1H 1W2BA 2VS1A 4IJLA 2E76C 2NB0A 2M2LA 2K4KA 4A75A 1B3AA 1XX8A 3M4OH 4RHSA 2FMCA 1HHVA 1KIXA 4JOIC 2VQFL 5BR8L 5DLQE 1DM0B 4CKEA 4P2CB 4LF9Q 3HOVG 4PG3A 2AQ2B 4IO9A 2GA4B 3I70A 1I6HB 4NW2A 2F0WA 3EQLC 5IP9H 1G6PA 3HP3A 2LSSA 1KC8C 4DV3L 1LYLA 4AYBE 1HTLD 3SXHA 1BR9A 1T9HA 1KAAA 2DN8A 4QCLA 2MUYA 2AQ1B 1VQAA 4DR3L 1LLRD 1NY4A 4A3CH 3JAML 1LTBD 3GP7A 1QVCA 2HQLA 1Y69U 4DXFA 2L0CA 2B2WA 4IUUA 5M5WH 1K0RA 3NBHA 3CPWA 1HNWQ 4RH6A 2EQSA 1WCMH 3GTQB 2A5HA 4BBRB 1I5FA 3I2ZA 5JPMC 1PV4A 1HZAA 1Y8OB 1JC7A 3DLLA 4FF2A 1AE3A 1BVSA 5ELCA 3OYYA 4DR6Q 2LY7A 2F0OA 3NK9A 1KNEA 3IKJA 4DNIA 1EY5A 2KCNA 1STBA 4KKSA 4CJ1B 4GZYC 1XMQL 3SVMA 2IWHA 4DUZL 1P8LA 3MC0B 3BDLA 3HOWG 3K80C 3LWUA 4BWGB 1Z7TA 1JJGA 1TWHH 3CW2C 1ZXTA 1I4XA 2NVXB 2PW5A 2ID0A 1Y14B 1E7ZA 3U58A 2CVRA 3SEBA 4A3MG 4MHEA 1GKHA 1S5ED 3MTSA 2PQAB 2UU9Q 2Q2TA 3GV6A 5FLXE 5IY0A 4H0LC 2QF7A 4PZ6A 5KYLA 1VQ8A 3NPPA 4RGOS 1VS0A 2PNRC 5CMDA 1XNQQ 2JA5B 4A3BH 1K8AC 4LFBQ 1DOLA 3GV3A 2YTYA 2L4NA 1CUKA 3UE1A 3G48A 4C3HG 2HDMA 2K01A 2Z6BA 3K7UC 1F9QA 3TSSA 4ZK9B 4K6DA 1EZ8A 3JAMi 5FO9B 2XTIA 5K5PA 4A3EB 4DV2L 4P71A 2A6EC 1EQVA 3IAYA 4UY8C 3R8BA 3D4RA 1JWSD 1JWUD 1PTOD 4UP8A 2MNAA 1PHJA 1AZPA 1ET6A 3R3OA 4YHHQ 4IUQA 1TWAB 2UUAQ 1Q1EA 1A3TA 4K6LA 2F0TA 4X6AH 1GXDC 1LTAD 4RHRA 4G4KA 4DV4L 2JSOA 4NPSA 2O4XA 1XNRQ 4PMCA 3CQZH 4LFCQ 3HKZG 1B2TA 3GTMB 4A3GH 1HNXQ 1QG7A 2IPKD 4DK6C 3HOUH 1N36L 4ME3A 2OCEA 3H6MA 1GVPA 2K50A 2D0PA 3IL8A 1EFWA 1IYJB 2Z4IA 1KRSA 1K9MC 5JPNC 3ER0A 5M9OA 5L37A 1B50A 4JBMA 3BU2A 4B3RL 4HEDA 3W1BA 4APVA 1YNND 1SFOB 2K14A 1PH1A 1I50H 5AFWA 3PO3G 2HHHQ 4IPHA 1DOMA 4ILWA 2MJ8A 3NSWA 2RCFA 4YIJA 1HNZQ 1LO5D 1PRTB 3K5LA 2K5QA 1ONLA 4LUOA 2L1BA 3VR6A 1VQ6A 3MFYA 1NSNS 3HOXH 1ET9A 3GTKH 1W6JA 4MTNA 3HRZC 3KLRA 4HIMA 5BN5A 4DR1L 3TP7A 2TMPA 1VMPA 5C4XG 1I94Q 4AQYL 4G7ZC 3A56A 3NENA 3K5OA 5JJIA 1EIHA 2NVQH 3MWYW 2E5LQ 1FR3A 3HKZE 2UUBL 3C46A 3RN5A 4ID6A 1I4RA 3DXJC 1DJRD 4NDXA 3TREA 1UWVA 5DM63 2BOSA 5JVG3 5IGGA 1WTXA 3S14H 4LMQD 2EYPA 2N78A 5M3MG 1GJXA 2K1BA 1XYIA 1LTSD 2JA9A 4RGNA 4DPGA 5KRUA 2IX3A 5T1IA 1YIJA 3PMFA 3KOJA 3C2PA 3RMHA 4GLVB 3CC7A 4GOPA 5K36G 2VZAA 3L7ZC 1ENCA 3TP8A 2PO4A 1BBUA 1MHWC 2RHSB 5G3LF 1Y1VB 3UDXA 5C0XG 1CHQD 1S5DD 1X6OA 2R93G 4B9XA 2WAQG 4LF6L 5EJWA 1GM5A 1P16A 3MXPA 1VQLA 2OTLA 2RSNA 5FLXL 3OTOL 2EY2A 3IRBA 2OTJA 1EIGA 2EDGA 5C4JB 2B2YA 1BO0A 4OELB 4CHTB 2F0JA 1YZ6A 3K7AH 5CV4A 1MIUA 2L5TA 1BNZA 4ALPA 4C3IB 1TWFB 2NBFA 2WIIB 1C48A 1HZ9A 2JA7H 1SE8A 2YV5A 1PTOH 5DEHA 2XWBB 4IPDA 1Q12A 5CV9A 1EY6A 2VB3X 2B2UC 2D5DA 2FFKB 5IP7H 3HOWH 3W3AA 3BZKA 1JB7A 2WB1B 2HD3A 2JA8B 1JJ2A 1KXLA 1JCKB 4JW0A 1Q46A 5EPJA 3BS1A 1FYCA 1FJGL 3M4OB 2SNSA 1ASZA 2V1CC 4LJZC 4A3MH 3MXNA 2L11A 3H91A 3I4MG 3MXNB 2K03A 3ZYYX 4A3KB 1QUQA 2ZJQA 3QOLA 1CM9A 3MVVA 1STYA 5FOBB 1VQEA 1U4PA 2WAQE 1K83H 3I4NH 2CQAA 4DV5Q 2BE5D 1EYDA 2CFMA 5IGDA 2RDGA 3VYTA 4J15A 3CCUA 4DF7A 2JEAI 4FDBA 4ME5A 3TZUA 4OX9Q 1B3QA 1SBBB 1BUVT 3S15H 1Y8NB 5IYCG 3KJPA 4BS9A 1BDOA 3D4DA 2JN4A 3GTGB 1SXTA 1IBML 3PO2B 1STGA 4CDCC 4F87A 2OEOA 1V9PA 5COYA 3J81j 1IBKL 2YU9H 3QJYA 4N8X1 2FMMA 4DR5Q 3H94A 5E7NA 1WVLA 2PI2E 4JI1L 2VXWA 2EJMA 4A3JG 1N34L 1C8CA 3QG1A 5KEEA 2YYZA 1FL0A 4BBSG 1S5BD 1R9TH 3OPOA 1XTCD 2RVLA 2F0NA 1YEZA 1SE3A 2IHFA 3I3CA 4UHVA 3SR1A 1X3QA 2ZTEA 1KHIA 3C1EA 2X69A 3P75A 2KECA 2ZT9C 3Q6SA 4B08A 1QE6A 5M5YH 3S1MH 3PO3H 1EWIA 1JOQA 1WYDA 3SK5A 2HT1A 3X3MA 2F0VA 2EPBA 3CF5A 2A74C 1KQSA 4A3BB 3PIO3 2D9UA 4UP7A 3QB3A 1EIFA 3MEFA 1KDAA 4X64L 1LTGD 5EKKA 3FDTA 2CH4A 4QY7A 3J80c 2A8VA 1EYAA 3ULPA 1NCVA 3OMGA 2E2HH 4C3IG 1MD2D 4LFAQ 3HOYG 3QIAA 5C4XH 5FO7B 4R9WA 2F0GA 4OGQC 1L0YB 1TXYA 1NUCA 1S3OA 2RBMA 1HZCA 1SYDA 1DGSA 3BZCA 2UXCL 4S3SA 5AJ3L 2VW9A 3MXUA 4JI0L 3KLSX 3WOFA 2Z4HA 3ZJYC 3J80E 3BVZA 3S1NB 2YTXA 1A15A 2LFNA 4A3IG 2KCCA 1HJPA 1HFGA 5M3MH 3NTHA 4QUCA 1U4LA 3T1YQ 5C0XI 3CCRA 3HOZG 1G91A 4OWTB 4HMIA 5EPKA 1EIYB 2F0FA 5CV6A 3S1QH 4A3GB 1SE4A 5ISRA 1SNCA 2K7VA 4FF1A 4WJWA 2BA1A 1PDQA 1D5ZC 3GTLH 3S2HH 1SNOA 2R93H 2JJQA 1VQBA 1J5EQ 3JAMc 3AFPA 2KA7A 5DNFA 4WORA 3I55A 2IJ0A 2NTSA 1SSOA 3HS0C 1C7YA 2PNHA 4Q0FA 2CWPA 4R4CA 4UPAA 4IALA 1I50B 1LTID 2ENBA 3T1HL 2UXDQ 4A93G 2A6HD 2Z1CA 3KF6B 3C1FA 3J81E 2DGYA 2BA0A 4B3SL 4F8MA 4JC0A 1SAPA 3NTKA 4K8JA 1D7QA 3E5SA 5JJZA 1D5XC 4GN3B 2EYOA 1HFNA 4HR7B 2K05A 4IPGA 4JCVE 2PW7A 4CJ0B 1X54A 4JV5Q 3A8IE 3K0YA 1Q8KA 4PMWA 4JI3Q 4GNXC 2NVQB 4O2DA 3NP8A 3I4MH 1AEXA 3A8KE 3MEHA 3NQTA 1CA5A 1K28A 1KDBA 4I7ZC 1Q82C 2K04A 1PH9A 2QGQA 3EROA 3HEJA 1PA6A 4JI8L 4CDEC 5IGBA 1L1OA 3I72A 4FP5D 2RDFA 4CKBA 1HUNA 2B3GA 1L1OB 1SYEA 3J7A5 4EGVA 1I4GA 4U673 4DV1L 2Y0SG 3MXGA 4N8FA 5IYCH 4GKJQ 2MFIA 1CT1D 4IQZA 1NBWA 3L9AX 5CV8A 3K57A 3JC66 1YITA 3FVQA 3PUXA 3GTJH 1A2TA 1O78A 4TKOB 1ILQA 4XXEA 2F0EA 4JI6Q 4DXGA 4A3DG 4A3JH 2JA7B 3I8ZA 1VQIA 2KBNA 1K73C 2O5JC 1EU4A 3K58A 4MTKA 1B9MA 1PZKD 3O13A 1SYGA 4DUYQ 1AP0A 4RAUC 3NBIA 3SK8A 2I5LX 1CKNB 1SE2A 1C9OA 2J4XA 4HJ8A 2N3SA 3QOJA 4GKKQ 5CBAE 3PF4A 1SN8A 1YJNA 4QJFA 2K5VA 2N55A 3H0GH 4KHPQ 5M3FB 1TQOA 5C3EG 3G71A 4NXMQ 1Y8PB 3UDFA 2EOTA 2ZTDA 3A0JA 3SHLA 3J80L 4ULLA 4JBWA 2Z9HA 4QIWE 1Y1WG 1OTCA 2UUCL 1VQ4A 1M1KC 1X3GA 2Y0SE 1YNJD 2F52A 3G4SA 2JA6B 4GS3A 1BCPC 2MGSA 4L6TB 2KJXA 1PFNA 1HUMA 3W5OA 3I4NB 5C44B 1PH3A 1NJIC 2B2WC 5CGKA 5LMNW 4X3KA 4C3JG 4JI7L 1IKLA 2B2VA 1E1OA 1IHZA 3I4LA 2R92G 4IFDH 5HY6A 3HOYH 5IYBG 2F3IA 4AH6A 3S15B 4Y7NB 3S17H 3GTOH 3RD4A 2IX1A 2LXJA 4I65A 2UXBQ 1XMOL 1BBWA 3E3XA 5JJKA 4M8AA 2I0QA 1HR0W 1PYBA 2BH8A 1N32Q 4OIJA 2R6GA 1TKWB 4L5RC 3VYSA 2YU9B 1GHKA 3A5UA 5I2XA 2CCZA 1IL8A 3K81C 1E0BA 1PH8A 4A3IH 3P1HA 3PUZA 3J81L 1XWEA 1WTRA 2AWNA 1GUWA 2HIVA 2F0HA 4CDDC 2N8NA 1SMYC 3NWTA 1PTOF 3K6OA 5JOBA 1C0AA 2E2JB 3HOZH 5LMNL 3UDGA 1QZHA 3PIPA 4HJAA 1FGBD 3Q8DA 1PLFA 1R4PB 3TMEA 1LT3D 1NAPA 4X62Q 1T5EA 4K5XA 3DM3A 3EFXD 1EOTA 1EQTA 2IW3A 4K2LA 1HR0L 1GO3E 4FXDA 2Q2HA 3J80i 4H13C 2F0MA 3CCMA 1PVOA 2PQEA 4CGYB 2A68C 3K5MA 2A69D 5IGEA 4XQJA 2BE5C 4YWMA 2A19A 1D8LA 3LNNA 5FLXc 4A93H 4DR7L 1VQ9A 1NR2A 1YI2A 4OL7A 5LHY1 3CHBD 4C2MB 1HQMC 3OOCA 4H44C 4J6HA 5I4DA 1CI3M 4XTCS 4Y52H 1D2BA 2PQAA 1VQCA 5FKAC 4BY7G 2R7ZB 2OWOA 1CK1A 2PZWA 5J22A 2AWOA 4PZ7A 3BYTB 3T13A 4RGTA 3UE0A 3EN2A 1LT6D 1SR3A 4NB3A 4F88A 5C4HA 5LMUQ 5JJLA 4DAYA 1II3A 1ZYRC 4M1UB 3TEHB 3J81i 4DAYB 3PUVA 4FXKC 4FNFA 3S1RB 2E2DC 1WOCA 4HSPA 1RODA 5H1SE 1OXXK 4NXNL 4TVAB 1QVGA 3VR5A 3VA7A 3BDOA 2F03A 1SNPA 1SEBD 5JEAJ 5IWAL 4C56C 1Q86C 3S2HB 3VR3A 1YJ9A 3B6YA 5KYIA 3IFDA 2XVSA 5EBCA 3F2CA 2KOLA 3DM1A 3H09A 4DR2Q 4ODGA 3OW2A 3RUZA 1JWMD 1E1TA 1J8IA 2J0TD 1WTVA 3M3YB 2D2CC 4JBJA 2PZTA 1VQMA 3GTPH 4JI2Q 1HA5A 3A5ZB 3SGIA 4EQ5A 3I90A 3FKIB 1E24A 2CQOA 3OIPA 1V1PB 4IOCA 5JEAG 3D6CA 2H4OA 3FPUB 5F2DA 1F2YA 3HG9A 1L2FA 2PMZB 3GDEA 4DV0L 3KF8A 5IGFA 2ASBA 3KF8B 4QL5A 2VUMB 4OONA 3PGZA 3E0EA 2RDHA 1G6ZA 3NELA 4BBRG 1Y1WH 4DR4Q 3T51B 2F0LA 2F0SA 1KD1C 1U4RA 2LS01 4DV7L 4GOPC 4V0BA 3MHBA 1EEFD 3V96A 4CJ2C 2JK8A 1B8AA 4KY5A 4JYAQ 2E2IH 1TS4A 1U4MA 2F3VA 1O7YA 4QUFA 3TS2A 3RR5A 1GD7A 1ILPA 2BCOA 1ESRA 2ES2A 1N33L 4ZUIA 4C3JH 1VQFA 4NP5A 5C0XJ 1B44D 2R92H 3P20A 3VR4A 1PFSA 2B2YC 4DKAC 1UNSA 2EIFA 3HOVH 1JE5A 1STHA 4QGUA 3CAMA 1ZEQX 2A6HC 4LF7Q 4LF5Q 3S2DH 1EFID 2MHVA 4JI4L 3GTJB 2HCIA 5M5XH 2IHEA 3Q24A 1YBYA 3AFQA 1BCPD 4BY1B 4IUTA 4RMFA 2SOBA 4OIKA 2RA4A 2JA5G 2HIXA 1Q7YC 3A7AB 4O1NA 3E6ZX 3GO5A 4X65L 4LF4Q 2KEDA 2QILA 4L8JA 5GROA 4K5VA 2B63B 1TVXA 1EY4A 3V05A 1XTDA 1B7YB 4EVOA 4A3EG 3AMUA 4YY3Q 2X6LA 3TP6A 3H0GB 1TWGH 2F4VL 2MO0A 4K0KQ 5ELBA 2NYZD 3J7YW 2D62A 2DNEA 5I6WA 4B3TL 4A3FB 1F9RA 3CMEA 2WP8J 1VDZA 4IZ8A 4HIOA 2NWGA 1VF5C 4ZKCB 2ZM6L 4B3ML 3G6EA 1IBLL 1SMYD 1MGSA 2VQFQ 5BR8Q 1T5XD 1U5KA 4DV6L 4K5WA 3TZDA 1D5MC 3GQBA 5E1FA 5GQOA 4QB4A 2NN6G 4LF8L 1QVFA 2QKIC 4BY7H 3CKIB 1EOVA 2KUMA 4DV3Q 3EJIA 4LNQA 1EQQA 2HQEA 2B39A 4HJ7A 4L5TA 1KLUD 2NVTH 3QO2A 3D6WA 4DR3Q 2N88A 4DU9A 1TIID 4R8NA 3CRLC 2A68D 4C3HH 2VQEL 2NZ1D 2L55A 2XSCA 1SROA 2V4DA 1FD7D 1LTLA 2JEBI 4XIGS 2MQHA 1LT4D 2K5NA 4K14A 3T4AC 2DNCA 1H9RA 2PCFB 4X66L 3DWQA 1VQ5A 4HJ9A 1X32A 4KJOA 1UE1A 1TR5A 5M5WB 2BDOA 1IZ6A 3BVGA 1F9SA 1WCMB 4DGZA 1UAPA 4JPBW 4JI5L 1TT2A 1S4ZA 2SDFA 5IT9E 3TRZA 4N9TA 1XMQQ 1BOSA 1PH4A 3F2UA 1UEAB 4DUZQ 4P75A 1QCBD 1YNJC 5LL6S 3BDCA 2B2UA 4HIDA 2SEBD 3V2TA 2XIWA 1ZYRD 3KYHC 1WTWA 4YWKA 5T1GA 2K28A 1BQQT 4KKUA 1GUNA 1TWHB 1JMCA 4LAAA 2NVYH 2FINB 4LF9L 3S24A 3M4PA 2PMZE 4ZKBB 3MFGA 5JEAH 4TRDA 1B53A 3ULJA 1H95A 1KTKA 3RZOH 3D0FA 3RLOA 1PRTD 1B1ZA 2NUCA 2EE1A 4ZAIA 1Y1VG 2G9DA 2F4IA 2XRSD 3EA6A 2B2TA 3AYHB 3Q0AA 1DONA 4N9PA 1VQNA 2C9OA 2EYFA 3DMUA 4J8QA 3I4OA 5GAHC 3VYRA 3GTQH 4BBRH 3G6JB 1W3SA 2F0IA 4DV2Q 2EXZA 1D1IA 3FMCA 1JJCB 3URYA 4DK3C 4FYDA 4YWLA 2N49A 3U4VA 1HNWL 2F0DA 1G2TA 1L0XB 1QZGA 1A2UA 1CKMA 5EGTA 1MSHA 4RCNA 4DR6L 1VQKA 1UUPA 4IJHA 5C3WA 4R1JA 4DV4Q 2WB1G 1CSQA 3TN2A 2JA8G 4BXXG 1KLGD 2C5CA 1JOOA 2NVXH 2A69C 4H7BA 1ENAA 3EBEA 3M85A 1N36Q 4KV6A 3A54A 5GADC 3BG3A 1SNQA 5FLMG 2DJFC 2KCTA 3CQZB 3Q22A 4A3KG 2DUDA 2WFWA 3HOUB 3ND8A 1EY0A 4WJ4A 5K36H 2JA5H 2F1MA 1NNXA 5J39A 2UU9L 4B3RQ 3J81c 1MSGA 4RA8A 1DZ1A 1Z47A 5C0XH 2QDBA 5IIFA 3VR2A 1PXUA 1CZWA 2ZJPA 1CSPA 5I2YA 1XNQL 4AYBB 1RHPA 4LFBL 5EPLA 4A3EH 1ESFA 2K5WA 3J7AF 1E2ZA 2OXPA 3CC4A 3KF6A 4R4TA 1YVCA 2AUJD 3KLSA 3G7LA 3R93A 1XJVA 2JXMB 4RGMA 1HZBA 3AQQA 5ELFA 3PO2G 4IN3A 5A35A 2R61A 4DR1Q 2ZTCA 4AQYQ 1TWAH 2WB1E 1PYSB 1AN8A 3HOXB 3GTKB 1OO9B 2NN6I 2UUBQ 3EIVA 4YHHL 1IXRA 2WKCA 2UUAL 2OF1A 4RKLA 2RKSA 1TS2A 1MI2A 2NTTA 4LUVA 2Z6KA 1X3EA 1IL2A 4DFAA 3PCOB 1SYFA 2MP1A 2GVAA 5IT9L 3ULLA 4KD4A 3HOVB 4C1NI 3H15A 1XNRL 2L12A 4LFCL 4ZQ3A 3OIQA 3TBIB 1HNXL 2LKVA 1EQRA 3S2DB 5TSSA 3S14B 3U9OA 1O80A 1E3PA 2EJFC 4HMJA 4TSSA 3L2PA 1SFOH 5M5XB 1GHJA 1A3VA 3KK7A 4XDXA 1A62A 4LF6Q 4A3BG 5JVH3 4GLXA 3OTOQ 5EKLA 4IPCA 2HHHL 2F0KA 1I4PA 4H02A 1BBXC 1HNZL 2I07B 2K32A 3PUYA 4G7HC 1FVIA 5I9OA 1WFQA 1TWCH 2MPMA 2KEEA 3K7AB 1DOKA 4EX5A 2CHBD 4BBSH 1I94L 1PTOB 2M00A 5BN4A 1FJGQ 3D8GA 1CKNA 3HOWB 4O42A 4R4OA 2E5LL 4DAPA 4L5QA 2B8GA 4BA2I 1PH6A 1SRUA 1NMFA 1OXVA 4A3GG 4A3MB 3N6RA 3CCQA 3S16H 2RCNA 3A55A 2IT1A 1WTOA 3FHWA 4A4IA 2TSSA 1N8RC 2EXDA 1Y1VH 3VA5A 1WJJA 3HZXA 3CCSA 1BKBA 4NMZA 1E2VA 4V190 1STEA 4YCUA 3S9WA 5ELNA 4GN4B 1K83B 4QF4A 4C3HB 3KUPA 3F2BA 2P5ZX 3R2IA 1EY9A 4G7OC 4IUPA 3QR8A 3I91A 1LT5D 4C3IH 4R8IA 3LX0A 1IBMQ 4MIUA 2G5DA 2PYKA 2Z8LA 4KD3A 1IBKQ 3N52A 1LTRD 4FXGC 4IOAA 5HGTA 4FF3A 2NZHA 1Q90A 2CWAA 4GLAC 1PH7A 4JI1Q 4KN7C 1N34Q 5GAEC 2JA8H 4OXPA 1M90C 2IY5B 3KJOA 4PQXA 1CTMA 3MAQA 4RFBA 4DAVA 2Q2IA 3DEPA 5FLMH 1X9NA 1ASYA 3KFUA 1R9TB 3R2TA 3E9IA 3KDFA 4CDFC 3HKZB 4A3KH 1HA6A 2PPBC 3KDFB 1N9WA 3RLNA 3X3NA 1KNAA 4HN7A 1G2SA 3M7NA 2NVYB 2VY3A 3BZDB 1STNA 1HRJA 1SDFA 2HCCA 2OQKA 1VQOA 2ICIA 3RZOB 3BYYB 4F7XA 1ML0D 4DNTB 3K8AA 5M5YB 4DV5L 3DEOA 3S1MB 1BCPB 1OXTA 4X64Q 2O2LD 3PO3B 3IFTA 4PV1C 4IUNA 1DYQA
chains in the Genus database with same CATH topology
4LK1C 1JICA 4XQNA 5E4XA 2XWJB 3SE0A 1TS3A 1WTQA 1RTNA 1VF7A 1PFBA 5CBEE 1D1KA 2HDLA 2E2HB 2EZVA 1CHPD 5C4XB 1JB3A 2DY7A 1S5FD 1M4VA 4HAEA 4KHVA 4PNYA 4UDUC 4HCSA 4X3UA 3J7AV 3ERQA 1RCVD 1LABA 5C4ZA 2CW0D 4WRDA 5M3MB 1TY2A 4HSVA 1SNDA 3DWPA 3S1QB 1GUGA 1DD2A 1KDCA 3GTLB 2R93B 5C6AA 2WV6D 4KHZA 4KY7A 4KMUC 1PRTC 2WAQB 1QB5D 3KBXA 1RF2D 1H9KA 5C3XA 1BCPF 1O7LA 4CBVA 3NQIA 4KKTA 2XNAC 5EBDA 1EWHA 1GUSA 1V1OA 1DXMA 1H9JA 2X6GA 1GUTA 3A8JE 4TQUS 2IL8A 1V1PA 3D4WA 2Q8IB 4FF4A 1FNVA 1QJOA 2AQ3B 4G57A 5KNDA 2EJGC 4FO2A 3NHHA 1EWCA 1DCZA 4ZRZA 3ONAB 5C5MA 1IW7D 3M4YA 3I4MB 4ZUJA 1A3UA 4U68A 1FNUA 4XT3B 1VMCA 1OXUA 4IURA 4DN4M 1S5CD 4XYOA 2DY8A 5CC4A 1SNMA 1SJED 3OWEB 5J1ZA 4K8IA 3SDZA 3OSOA 4XT1B 1CQFA 1C4QA 4FVMA 4CKCA 4KY6A 3NXWA 1IYUA 1QWYA 3EVQA 3VYUA 3L3OC 5IODA 1F2ZA 3WDNA 3ND9A 1D6EC 3RLFA 5EKIA 2M9VA 2BDNA 3A7LA 1TWCB 1RKNA 2EY1A 3Q23A 4JK1C 3I73A 5IGCA 4A3JB 4BBSB 3OMCA 2WINB 3NE5B 1BF4A 1SYBA 5D65A 3FEWX 1QOHA 2EY5A 2FHTA 5A2QE 3U9SA 3S16B 4XYQA 2I46A 2Q8RE 2A73B 3DUZA 2SNMA 3PV0A 5JAVA 1KABA 1JORA 3DWAA 2KHSA 1CZGA 3KBGA 1XXGA 2OT2A 3PUWA 4MN3A 4RKBA 1F2MA 1PRTF 3HOYB 1ZKOA 1Q8IA 3S17B 3GTOB 1JE4A 1PZJD 3CU7A 5ELDA 3OW7A 1R4QB 5FO8B 5KNBA 2EY6A 1Q3LA 5NUCA 2QCPX 3UI2A 4J1MA 1X3PA 3LWEA 4A3IB 3ITPA 1QNKA 2R3ZA 1SYCA 2KVMA 4RWSC 1CQVA 2JYOA 4ZLTF 5C5LA 3HOZB 2RSOA 4NKLA 1EYCA 4ABNA 2B2TC 2AUKA 1PMRA 5KGUA 1AW7A 4HTHA 2LMCB 1JQYD 1B9NA 5E4WC 3BVMA 1K8MA 1TY0A 2L9HA 2F0PA 1IYVA 4A93B 1Q1BA 1QNUA 2ICEC 5G3LD 2ZXOA 2EYHA 1LACA 2ZXPA 1I3QB 4Q5VA 1I4QA 1AZQA 5CR3A 3K5NA 4DNRB 4BA1I 4Z9CB 2EYJA 2XN9C 5I9PA 1HQRD 1HTPA 3FRPB 2A6ED 1F9PA 4IFDJ 1PZID 1HXYD 3AB9A 3C3LA 5D3IB 3OHXC 1EEID 5CV5A 4K2KA 5D14A 4KTAA 2WACA 1CA6A 4DK1A 3WOEA 4QIWB 2HUGA 2ZXRA 2F0QA 1M8AA 1VCIA 2Y0SB 5KIXA 4OO1G 5A2QL 4WFN3 3SK6A 2FJ2A 4IFDG 1EL0A 1U9RA 1E2WA 2H1EA 3GTPB 4XQQA 1H9SA 1HCZA 1LTTD 5BN3A 1H9SB 3HGBA 4KI0A 3PIP3 4A3DB 2F3WA 3CRKC 2EVBA 2VNUD 1PFMA 3DHQA 3TDQA 2K33A 4KJNA 1QILA 4L63B 2Q8TA 1IKMA 1CFMA 3M7GA 4EQOA 1JOKA 1JR0D 2K6AA 4QMGA 4X3SA 3P7JA 3NUCA 5C3EB 2EYMA 4OHJA 2CW0C 2IX0A 4E6IA 5D3DA 3RZDB 2E75C 1Y1WB 4IUVA 2EYLA 4EQNA 4X3TA 5DM73 1G8ZD 1RJTA 2E2IB 2RQXA 4DK0A 3D31A 5EQ0A 3K59A 1WTPA 1EY7A 4C3JB 2NN6H 3AU7A 2R92B 1TS5A 3JAME 1V8QA 1Z6HA 2VB2X 4DA2A 1PTOC 2XRQD 4ZYSA 1FNWA 3T16A 1HPCA 3QWNA 2QEJC 1GUOA 3E0JA 3T56B 5CYUA 4HCEA 2KQ3A 1A6XA 2O5IC 1WD1A 3H3VC 5DAUA 5I6YA 1K8OA 5CORA 2JE6I 1IW7C 4KN4C 1G291 5FK9C 1H9MA 5LL6X 1B4OA 1TWGB 2JP1A 2PZUA 1WD0A 5KNCA 1W6KA 1GOZA 1STAA 3MZ5A 1YNNC 1F77A 1I4HA 1MBYA 2B2VC 5E3FA 4B9WA 2E74C 3OWFA 4EQPA 4KK7A 5HURA 2K5DA 1OXSC 1PYWD 1V43A 3T53B 1RDPD 2B8FA 3NTIA 1F2LA 3FPPA 1ENFA 3TP5A 4BY7B 2F0UA 1NR4A 3D3RA 1TU2B 1BXTA 4UAIA 5IOCA 2NVTB 5ELEA 4RCOA 2G9HD 1I6VC 3GD7A 1EZ6A 3SK4A 1EU3A 5CV7A 1ICWA 4PMBA 1RTOA 1O7ZA 3W2DA 1J9OA 1AFPA 4OO1I 1SJHD 2WKDA 1EY8A 3MA2B 3NWSA 4IFDI 1RD9D 4C1NK 2J7ZA 1LV9A 4OO1H 2E76C 2NB0A 2M2LA 1B3AA 1XX8A 4RHSA 2FMCA 1HHVA 1DM0B 4CKEA 4P2CB 2AQ2B 2GA4B 3I70A 1I6HB 4NW2A 2F0WA 3EQLC 3HP3A 1HTLD 3SXHA 1BR9A 1KAAA 2DN8A 4QCLA 2MUYA 2AQ1B 1LLRD 3JAML 1LTBD 3GP7A 1Y69U 4DXFA 2L0CA 2B2WA 4IUUA 3NBHA 4RH6A 3GTQB 2A5HA 4BBRB 5JPMC 1Y8OB 1JC7A 4FF2A 5ELCA 2LY7A 2F0OA 3NK9A 1KNEA 3IKJA 1EY5A 2KCNA 1STBA 4KKSA 4CJ1B 4GZYC 3SVMA 2IWHA 3MC0B 3BDLA 3LWUA 4BWGB 1Z7TA 1ZXTA 1I4XA 2NVXB 2PW5A 2ID0A 2CVRA 3SEBA 4MHEA 1S5ED 3MTSA 3GV6A 5FLXE 4H0LC 2QF7A 5KYLA 3NPPA 4RGOS 2PNRC 5CMDA 2JA5B 1DOLA 3GV3A 2L4NA 4C3HG 2HDMA 2K01A 3TSSA 1F9QA 4ZK9B 4K6DA 1EZ8A 5FO9B 5K5PA 4A3EB 2A6EC 1EQVA 3IAYA 3R8BA 3D4RA 1JWSD 1JWUD 1PTOD 1AZPA 1ET6A 3R3OA 4IUQA 1TWAB 1Q1EA 1A3TA 4K6LA 2F0TA 1GXDC 1LTAD 4RHRA 4G4KA 2JSOA 2O4XA 4PMCA 1B2TA 3GTMB 1QG7A 2IPKD 3H6MA 3IL8A 2Z4IA 5JPNC 5M9OA 1B50A 4HEDA 1YNND 1SFOB 5AFWA 1DOMA 4ILWA 2MJ8A 3NSWA 4YIJA 1LO5D 1PRTB 3K5LA 2K5QA 1ONLA 2L1BA 3VR6A 3MFYA 1NSNS 1ET9A 1W6JA 3HRZC 3KLRA 5BN5A 3TP7A 2TMPA 1VMPA 4G7ZC 3A56A 3K5OA 1EIHA 3MWYW 1FR3A 3C46A 4ID6A 1I4RA 3DXJC 1DJRD 4NDXA 5DM63 2BOSA 5JVG3 5IGGA 1WTXA 4LMQD 2EYPA 1GJXA 2K1BA 1XYIA 1LTSD 4RGNA 2IX3A 5KRUA 5T1IA 3PMFA 3C2PA 3RMHA 5K36G 3L7ZC 1ENCA 3TP8A 2PO4A 5G3LF 1Y1VB 5C0XG 1CHQD 1S5DD 4B9XA 5EJWA 3MXPA 2RSNA 5FLXL 2EY2A 1EIGA 2EDGA 5C4JB 2B2YA 1BO0A 4CHTB 2F0JA 5CV4A 1BNZA 2L5TA 4C3IB 1TWFB 2NBFA 2WIIB 1C48A 1PTOH 5DEHA 2XWBB 5CV9A 1Q12A 1EY6A 2VB3X 2B2UC 2D5DA 2FFKB 3W3AA 2WB1B 2JA8B 1JCKB 5EPJA 3BS1A 1FYCA 3M4OB 2SNSA 4LJZC 3MXNA 2L11A 3H91A 2K03A 3ZYYX 4A3KB 3QOLA 1CM9A 3MVVA 1STYA 5FOBB 1U4PA 2CQAA 2BE5D 1EYDA 5IGDA 2RDGA 3VYTA 4DF7A 2JEAI 4ME5A 3TZUA 1SBBB 1BUVT 1Y8NB 4BS9A 1BDOA 3D4DA 3GTGB 1SXTA 3PO2B 1STGA 4F87A 2OEOA 5COYA 3QJYA 2FMMA 3H94A 1WVLA 2VXWA 2EJMA 1C8CA 3QG1A 5KEEA 2YYZA 1S5BD 3OPOA 1XTCD 2RVLA 2F0NA 1SE3A 3I3CA 3SR1A 1X3QA 3C1EA 2X69A 3P75A 2KECA 2ZT9C 3Q6SA 4B08A 1QE6A 1JOQA 3SK5A 3X3MA 2F0VA 2EPBA 2A74C 4A3BB 3PIO3 2D9UA 3QB3A 1KDAA 1LTGD 5EKKA 3FDTA 1EYAA 1NCVA 3OMGA 4C3IG 1MD2D 3QIAA 5FO7B 4R9WA 2F0GA 4OGQC 1L0YB 1NUCA 2RBMA 1SYDA 4S3SA 3MXUA 3KLSX 3WOFA 2Z4HA 3J80E 3BVZA 3S1NB 1A15A 2LFNA 2KCCA 1HFGA 3NTHA 4QUCA 1U4LA 5C0XI 1G91A 4HMIA 5EPKA 4A3GB 2F0FA 5CV6A 1SE4A 5ISRA 1SNCA 2K7VA 4FF1A 4WJWA 2BA1A 1PDQA 1D5ZC 1SNOA 2KA7A 5DNFA 4WORA 2IJ0A 2NTSA 1SSOA 3HS0C 4Q0FA 4IALA 1I50B 1LTID 2ENBA 2A6HD 2Z1CA 3J81E 3C1FA 2BA0A 4F8MA 1SAPA 3NTKA 4K8JA 3E5SA 5JJZA 1D5XC 2EYOA 1HFNA 4HR7B 2K05A 2PW7A 4CJ0B 3A8IE 3K0YA 4PMWA 2NVQB 3NP8A 1AEXA 3A8KE 3MEHA 3NQTA 1CA5A 1KDBA 4I7ZC 2K04A 3EROA 3HEJA 5IGBA 4FP5D 3I72A 2RDFA 4CKBA 1HUNA 1SYEA 4EGVA 1I4GA 4U673 3MXGA 1CT1D 4IQZA 3L9AX 5CV8A 3K57A 3FVQA 3PUXA 1A2TA 1O78A 4TKOB 1ILQA 4XXEA 2F0EA 4DXGA 2JA7B 3I8ZA 2O5JC 1EU4A 3K58A 1B9MA 1PZKD 3O13A 1SYGA 1AP0A 4RAUC 3NBIA 3SK8A 1SE2A 2J4XA 3QOJA 5CBAE 2N55A 5M3FB 1TQOA 1Y8PB 2EOTA 3J80L 3SHLA 4ULLA 4JBWA 1YNJD 2JA6B 1BCPC 2MGSA 4L6TB 2KJXA 1PFNA 1HUMA 3I4NB 5C44B 2B2WC 5CGKA 4X3KA 4C3JG 1IKLA 2B2VA 1IHZA 3I4LA 4IFDH 3S15B 4Y7NB 3RD4A 2IX1A 4I65A 4M8AA 4OIJA 2R6GA 1TKWB 3VYSA 2YU9B 1GHKA 5I2XA 1IL8A 1E0BA 3P1HA 3PUZA 3J81L 1XWEA 1WTRA 2AWNA 1GUWA 2F0HA 1SMYC 3NWTA 1PTOF 3K6OA 5JOBA 2E2JB 1FGBD 1PLFA 1R4PB 3TMEA 1LT3D 1NAPA 1T5EA 4K5XA 3EFXD 1EOTA 1EQTA 2IW3A 4K2LA 4FXDA 4H13C 2F0MA 2PQEA 4CGYB 2A68C 3K5MA 2A69D 5IGEA 4XQJA 2BE5C 3LNNA 1NR2A 4OL7A 5LHY1 3CHBD 4C2MB 1HQMC 3OOCA 4H44C 4J6HA 5I4DA 1CI3M 4XTCS 1D2BA 5FKAC 2R7ZB 1CK1A 2PZWA 5J22A 2AWOA 3BYTB 3T13A 4RGTA 1LT6D 4F88A 5C4HA 4DAYA 1II3A 1ZYRC 4M1UB 3PUVA 4FNFA 4FXKC 3S1RB 2E2DC 4HSPA 1RODA 1OXXK 3VR5A 3VA7A 3BDOA 2F03A 1SNPA 1SEBD 5JEAJ 4C56C 3S2HB 3VR3A 5KYIA 3IFDA 2XVSA 5EBCA 2KOLA 3DM1A 3H09A 4ODGA 3RUZA 1JWMD 1J8IA 2J0TD 1WTVA 3M3YB 2D2CC 2PZTA 1HA5A 3I90A 3FKIB 3OIPA 1V1PB 5JEAG 3D6CA 2H4OA 3FPUB 5F2DA 1F2YA 3HG9A 2PMZB 3KF8A 5IGFA 2VUMB 2RDHA 1G6ZA 3T51B 2F0LA 2F0SA 1U4RA 2LS01 4V0BA 3MHBA 1EEFD 3V96A 4CJ2C 4KY5A 1TS4A 1U4MA 2F3VA 1O7YA 4QUFA 1ILPA 2BCOA 1ESRA 4ZUIA 4NP5A 5C0XJ 1B44D 3P20A 3VR4A 2B2YC 1UNSA 1STHA 1ZEQX 2A6HC 1EFID 2MHVA 3GTJB 2HCIA 3Q24A 4BY1B 1BCPD 4IUTA 2SOBA 4OIKA 2RA4A 3A7AB 4O1NA 3E6ZX 3GO5A 2KEDA 2QILA 4L8JA 4K5VA 2B63B 1TVXA 1EY4A 3V05A 4EVOA 3AMUA 2X6LA 3TP6A 3H0GB 5ELBA 2NYZD 3J7YW 2D62A 2DNEA 5I6WA 4A3FB 1F9RA 2WP8J 1VDZA 4IZ8A 2NWGA 1VF5C 4ZKCB 1SMYD 1MGSA 1T5XD 4K5WA 3TZDA 1D5MC 3GQBA 5E1FA 4QB4A 2NN6G 2QKIC 3CKIB 2KUMA 3EJIA 2HQEA 2B39A 1KLUD 3QO2A 3D6WA 2N88A 4DU9A 1TIID 4R8NA 3CRLC 2A68D 2NZ1D 2L55A 2XSCA 2V4DA 1FD7D 2JEBI 4XIGS 1LT4D 4K14A 3T4AC 2DNCA 1H9RA 2PCFB 3DWQA 1X32A 4KJOA 1TR5A 5M5WB 2BDOA 3BVGA 1F9SA 1WCMB 4DGZA 1UAPA 5IT9E 1TT2A 1S4ZA 2SDFA 4N9TA 1BOSA 3F2UA 1UEAB 1QCBD 1YNJC 5LL6S 3BDCA 2B2UA 2SEBD 3V2TA 2XIWA 1ZYRD 1WTWA 5T1GA 2K28A 1BQQT 4KKUA 1GUNA 1TWHB 4LAAA 2FINB 4ZKBB 3MFGA 5JEAH 4TRDA 1B53A 1KTKA 1PRTD 1B1ZA 2NUCA 2EE1A 4ZAIA 2XRSD 2G9DA 2F4IA 3EA6A 2B2TA 3Q0AA 1DONA 4N9PA 2C9OA 2EYFA 3DMUA 4J8QA 3VYRA 3G6JB 2F0IA 2EXZA 1D1IA 3FMCA 3URYA 4FYDA 2F0DA 1G2TA 1L0XB 1A2UA 5EGTA 1MSHA 4RCNA 1UUPA 5C3WA 3TN2A 1KLGD 2C5CA 1JOOA 2A69C 4H7BA 1ENAA 3M85A 4KV6A 3A54A 3BG3A 1SNQA 3CQZB 3Q22A 3HOUB 3ND8A 1EY0A 5K36H 2F1MA 5J39A 1MSGA 4RA8A 1DZ1A 1Z47A 5C0XH 2QDBA 5IIFA 3VR2A 1PXUA 1CZWA 5I2YA 4AYBB 1RHPA 5EPLA 1ESFA 2K5WA 3J7AF 1E2ZA 2OXPA 2AUJD 3KLSA 3G7LA 3R93A 2JXMB 4RGMA 5ELFA 4IN3A 5A35A 2R61A 1AN8A 3HOXB 3GTKB 1OO9B 2NN6I 2WKCA 2OF1A 4RKLA 2RKSA 1TS2A 1MI2A 2NTTA 4DFAA 1SYFA 2MP1A 5IT9L 4KD4A 3HOVB 4C1NI 2L12A 4ZQ3A 3OIQA 3TBIB 2LKVA 3S2DB 5TSSA 3S14B 3U9OA 1O80A 2EJFC 4HMJA 4TSSA 5M5XB 1GHJA 1A3VA 3KK7A 4XDXA 5JVH3 5EKLA 2F0KA 1I4PA 1BBXC 2I07B 2K32A 3PUYA 4G7HC 5I9OA 2MPMA 2KEEA 3K7AB 1DOKA 2CHBD 1PTOB 2M00A 5BN4A 3D8GA 3HOWB 4O42A 4DAPA 2B8GA 4BA2I 1OXVA 4A3MB 3N6RA 3A55A 2IT1A 1WTOA 2TSSA 3VA5A 3HZXA 4NMZA 1E2VA 4V190 1STEA 3S9WA 1K83B 4QF4A 4C3HB 3KUPA 3R2IA 1EY9A 4G7OC 4IUPA 3I91A 1LT5D 4R8IA 3LX0A 4MIUA 2PYKA 2Z8LA 4KD3A 3N52A 1LTRD 4FXGC 5HGTA 4FF3A 1Q90A 4KN7C 4PQXA 1CTMA 3MAQA 4RFBA 4DAVA 3DEPA 1R9TB 3R2TA 3HKZB 1HA6A 2PPBC 3X3NA 1KNAA 4HN7A 1G2SA 3M7NA 2NVYB 3BZDB 1STNA 1HRJA 1SDFA 2HCCA 2ICIA 3RZOB 3BYYB 4F7XA 1ML0D 4DNTB 5M5YB 3DEOA 3S1MB 1BCPB 1OXTA 3PO3B 2O2LD 3IFTA 4PV1C 4IUNA 1DYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B2Y C;  1JIC A;  3I3C A;  4NW2 A;  4XT3 B;  1VMC A;  1SAP A;  1CA6 A;  5E4X A;  2HUG A;  1MSG A;  4IUQ A;  4RA8 A;  4IUR A;  1DZ1 A;  1F9S A;  1M8A A;  2MGS A;  3HP3 A;  4O42 A;  4DN4 M;  5JJZ A;  5EJW A;  1X3Q A;  1S4Z A;  1PFN A;  1HUM A;  2SDF A;  2DY8 A;  1HFN A;  2RSN A;  5COR A;  1Q3L A;  1WTQ A;  1RTN A;  2B2W C;  2FJ2 A;  2K05 A;  3F2U A;  1EIG A;  1X3P A;  3UI2 A;  1RHP A;  2X69 A;  3LWE A;  5EPL A;  1PFB A;  2B2Y A;  2HDL A;  5CBE E;  4X3K A;  1EL0 A;  2HCI A;  4CJ0 B;  1BO0 A;  1QNK A;  2B2U A;  2H1E A;  1IKL A;  2B2V A;  2KEC A;  2R3Z A;  2KVM A;  1B4O A;  3Q6S A;  2JP1 A;  1BNZ A;  1ROD A;  1QE6 A;  4RWS C;  4XT1 B;  2JYO A;  4IUT A;  1WD0 A;  4ZLT F;  1B2T A;  4OIK A;  2RA4 A;  1QG7 A;  2DY7 A;  3R93 A;  2XIW A;  3G7L A;  1WTO A;  3IL8 A;  1CA5 A;  2EPB A;  2B2W A;  2RSO A;  4IUU A;  1WTW A;  5T1G A;  2K28 A;  4HAE A;  2D9U A;  2B2U C;  2FFK B;  2K04 A;  2B2V C;  3IFD A;  4HCS A;  4X3U A;  2FIN B;  2KED A;  3FDT A;  1PFM A;  4OIJ A;  2KOL A;  3DM1 A;  4ZKB B;  2B2T C;  1TVX A;  5EKI A;  1B50 A;  3KUP A;  1IL8 A;  1B53 A;  1E0B A;  5EPJ A;  2Q8T A;  1NCV A;  2BDN A;  4HED A;  1IKM A;  1J8I A;  4HSV A;  4IUP A;  1WTV A;  2X6L A;  1HUN A;  1WTR A;  1KNE A;  3I91 A;  1F2L A;  1GUW A;  5AFW A;  1MI2 A;  4X3S A;  1DOM A;  2L11 A;  4R9W A;  5E4W C;  2MJ8 A;  3H91 A;  4CJ1 B;  2NYZ D;  4R8I A;  3I90 A;  2K03 A;  2L9H A;  4ZAI A;  3SVM A;  2EE1 A;  3P7J A;  1NR4 A;  2B2T A;  2MP1 A;  1DON A;  3N52 A;  1F9R A;  2L1B A;  4UAI A;  1PLF A;  1BF4 A;  1CM9 A;  2NWG A;  2L12 A;  4ZKC B;  1ZXT A;  4IUV A;  1U4P A;  1MGS A;  1NAP A;  3FPU B;  3KBX A;  4X3T A;  5D65 A;  1A15 A;  1ICW A;  1O80 A;  1RJT A;  3TZD A;  1RTO A;  2CVR A;  1EOT A;  1HFG A;  1AZQ A;  1EQT A;  1VMP A;  4QUC A;  4MHE A;  1G2T A;  2FHT A;  3MTS A;  1U4L A;  5EQ0 A;  1ILQ A;  1WTP A;  1O7Z A;  4XDX A;  3GV6 A;  1MSH A;  1G91 A;  1EIH A;  3DEP A;  5EPK A;  3MWY W;  1J9O A;  2Q8R E;  3I8Z A;  2KUM A;  1G6Z A;  1HA6 A;  5CMD A;  2X6G A;  1NR2 A;  1PDQ A;  1AP0 A;  1KNA A;  2IL8 A;  1DOL A;  1G2S A;  1F9P A;  3GV3 A;  3QO2 A;  4RAU C;  3TN2 A;  2L4N A;  3D6W A;  1U4R A;  4MN3 A;  2HDM A;  2K01 A;  1WTX A;  2N88 A;  4CJ2 C;  1BBX C;  5DNF A;  4LMQ D;  2J7Z A;  5COY A;  1F9Q A;  1LV9 A;  1U4M A;  1SSO A;  1O7Y A;  4QUF A;  2K1B A;  4ZK9 B;  1ILP A;  2NZ1 D;  1XYI A;  1HRJ A;  1ESR A;  1SDF A;  2HCC A;  2M2L A;  5CBA E;  2FMM A;  1B3A A;  1XX8 A;  2MPM A;  5T1I A;  1WVL A;  1HHV A;  1ML0 D;  2N55 A;  2KEE A;  2VXW A;  1C8C A;  3DEO A;  3ONA B;  1DOK A;  1WD1 A;  2RVL A;  5D14 A;  2EOT A;  1AZP A;  1JE4 A;  1X32 A;  4U68 A; 
#chains in the Genus database with same CATH topology
 4LK1 C;  1JIC A;  4XQN A;  5E4X A;  3GTG H;  1MJE A;  3NBH B;  3NEM A;  2XWJ B;  4OX9 L;  3PO2 H;  4JOI A;  1X65 A;  1I3Q H;  3SE0 A;  1TS3 A;  1WTQ A;  1RTN A;  1VF7 A;  2UXC Q;  1PFB A;  5CBE E;  1D1K A;  2HDL A;  5AJ3 Q;  2E2H B;  4KLK A;  2EZV A;  1CHP D;  5C4X B;  2JA7 G;  4JI0 Q;  4OEM B;  4YCV A;  1JB3 A;  2DY7 A;  1S5F D;  1L0W A;  4DR5 L;  5IP7 G;  1M4V A;  4HAE A;  4KHV A;  4PNY A;  4UDU C;  5ELO A;  1O7I A;  4HCS A;  4X3U A;  3J7A V;  3ERQ A;  1RCV D;  1RIP A;  3PSI A;  1LAB A;  5C4Z A;  1KRT A;  2CW0 D;  4WRD A;  5M3F G;  5M3M B;  1TY2 A;  4HSV A;  1NMG A;  3CD6 A;  1SND A;  4RG1 A;  2CH4 W;  2CKZ B;  3U4Z A;  3DWP A;  3S1Q B;  1GUG A;  1U0L A;  1DD2 A;  1UE5 A;  1RL2 A;  1KDC A;  2JA6 G;  3GTL B;  2I5M X;  3I4N G;  2R93 B;  5C44 G;  5C6A A;  1E22 A;  2WV6 D;  4KHZ A;  4KY7 A;  4KMU C;  1PRT C;  3T1H Q;  2WAQ B;  1QB5 D;  3KBX A;  1RF2 D;  3WWV A;  1H9K A;  5C3X A;  4B3S Q;  2VL6 A;  3M9B A;  1VQ7 A;  1BCP F;  1O7L A;  4CBV A;  3NQI A;  4KKT A;  2XNA C;  5EBD A;  1EWH A;  1GUS A;  4MNO A;  3KLW A;  4LWC A;  1V1O A;  1DXM A;  1H9J A;  4A3D H;  2X6G A;  1GUT A;  1WTH A;  4LFA L;  3A8J E;  4TQU S;  2IL8 A;  1V1P A;  3D4W A;  1PH2 A;  2Q8I B;  4FF4 A;  4P74 A;  3S1N H;  1FNV A;  2XGT A;  1QJO A;  2RHQ B;  2QEX A;  2AQ3 B;  4G57 A;  3RNU A;  5KND A;  4PZ8 A;  1MKH A;  2EJG C;  2PI2 A;  4FO2 A;  3NHH A;  1EWC A;  1DCZ A;  4ZRZ A;  3ONA B;  3CXC A;  4JI8 Q;  5C5M A;  1IW7 D;  3M4Y A;  1AE2 A;  3I4M B;  4ZUJ A;  1A3U A;  5C3E H;  4U68 A;  1FNU A;  3STB D;  3W1G A;  3T1Y L;  4XT3 B;  1VMC A;  4R4Q A;  1FGU A;  1OXU A;  4IUR A;  3RZD H;  4DN4 M;  1S5C D;  4XYO A;  1G51 A;  2DY8 A;  5CC4 A;  1SNM A;  3PF5 A;  3VDY A;  1SJE D;  3OWE B;  4DV1 Q;  4LUZ A;  5J1Z A;  1J5E L;  4K8I A;  3SDZ A;  3OSO A;  4XT1 B;  1CQF A;  3TS0 A;  1C4Q A;  4FVM A;  5IYB H;  1WI5 A;  4OWW B;  4CKC A;  4KY6 A;  3NXW A;  3I56 A;  1IYU A;  1QWY A;  2UXD L;  1UEB A;  3EVQ A;  3VYU A;  3L3O C;  5IOD A;  1F2Z A;  3WDN A;  3ND9 A;  1D6E C;  1EUJ A;  3RLF A;  5EKI A;  2M9V A;  2BDN A;  2MO1 A;  3A7L A;  1TWC B;  3BJU A;  1RKN A;  2EY1 A;  2R7Z G;  3J7Z C;  3Q23 A;  4JK1 C;  1NE3 A;  2FXQ A;  4A3L G;  1X56 A;  3I73 A;  5IGC A;  4A3J B;  4BBS B;  2RF4 A;  3OMC A;  4JV5 L;  2WIN B;  3NE5 B;  3CCJ A;  1BF4 A;  1SYB A;  4JI3 L;  3CPF A;  1VQG A;  2K5H A;  4LW1 A;  1KL9 A;  5FJ8 G;  1CKO A;  5D65 A;  3F8T A;  3FEW X;  3FP9 A;  2OQ0 A;  1QOH A;  2EY5 A;  1J6Q A;  2UUC Q;  2FHT A;  3L0O A;  5A2Q E;  3U9S A;  3S16 B;  4XYQ A;  2I46 A;  2Q8R E;  2A73 B;  3DUZ A;  2KCM A;  2SNM A;  3PV0 A;  4GOP B;  5JAV A;  1LUZ A;  1KAB A;  2B29 A;  3DWA A;  1AH9 A;  2KHS A;  1JOR A;  1CZG A;  1YNX A;  3KBG A;  4JI7 Q;  2OT2 A;  1XXG A;  3PUW A;  4MN3 A;  2QDL A;  4RKB A;  4WJ3 M;  1F2M A;  4GKJ L;  1XMO Q;  3FKI G;  1PRT F;  3CC2 A;  3HOY B;  2Q2U A;  1ZKO A;  4QQB X;  2QW7 A;  2E8G A;  1Q8I A;  3S17 B;  3GTO B;  2GN5 A;  1JE4 A;  1PZJ D;  3CU7 A;  2I5H A;  3RN2 A;  5ELD A;  3CMA A;  3OW7 A;  3H3V I;  2YTV A;  1R4Q B;  5FO8 B;  4MZ9 A;  4JI6 L;  5KNB A;  2EY6 A;  4JVZ A;  1Q3L A;  5NUC A;  2QCP X;  3UI2 A;  5GAG C;  5LMN Q;  4J1M A;  1X3P A;  5IT9 c;  4DUY L;  4POG A;  3LWE A;  3H3V H;  4A3I B;  1LM0 A;  3ITP A;  1QNK A;  5M3F H;  1X55 A;  2R3Z A;  1SYC A;  2KVM A;  2VUM G;  4RWS C;  4JG2 A;  1CQV A;  2JYO A;  4ZLT F;  5C5L A;  3HOZ B;  4O0A A;  4GKK L;  2RSO A;  4NKL A;  1NTG A;  4KHP L;  1EYC A;  2JA6 H;  4ABN A;  1HR0 Q;  1QUQ B;  5IYD G;  4NXM L;  4YCW A;  5C44 H;  2B2T C;  2AUK A;  1PMR A;  5KGU A;  1AW7 A;  3U50 C;  1B70 B;  4DR7 Q;  3ERS X;  1A8V A;  2LMC B;  1JQY D;  4HTH A;  2GVB A;  3F1Z A;  1B9N A;  5E4W C;  5EAY A;  1PH5 A;  3BVM A;  1K8M A;  4Y7N H;  1TY0 A;  2L9H A;  2F0P A;  1IYV A;  4A93 B;  1Q1B A;  1I6H H;  1QNU A;  2ICE C;  5G3L D;  4HJ5 A;  1UE6 A;  2ZXO A;  2AHO B;  2EYH A;  1LAC A;  2ZXP A;  1I3Q B;  4Q5V A;  1I4Q A;  1YHB A;  2UXB L;  1AZQ A;  5CR3 A;  3K5N A;  1VQP A;  4BY1 G;  1N32 L;  4DNR B;  2E2J H;  2DJG C;  4BA1 I;  4Z9C B;  2A1A A;  2EYJ A;  2XN9 C;  3UDI A;  2R7F A;  5I9P A;  1HQR D;  1HTP A;  3FRP B;  2A6E D;  1F9P A;  4OWX B;  4IFD J;  2B63 G;  1YJW A;  1PZI D;  1HXY D;  4NXN Q;  3H0G G;  3AB9 A;  3C3L A;  5D3I B;  5IWA Q;  1SLJ A;  3OHX C;  1EEI D;  5CV5 A;  4X62 L;  4I7A A;  1EYG A;  4K2K A;  4A3F G;  5D14 A;  4AIM A;  4KTA A;  4A76 A;  2K75 A;  1S40 A;  2WAC A;  1CA6 A;  4DK1 A;  3WOE A;  4QIW B;  2HUG A;  2ZXR A;  2F0Q A;  1M8A A;  1VCI A;  2Y0S B;  5IE8 A;  4C2M H;  5KIX A;  4OO1 G;  5A2Q L;  4WFN 3;  3SK6 A;  3CCV A;  2FJ2 A;  1VQJ A;  4IFD G;  1EL0 A;  1U9R A;  5HGQ A;  1E2W A;  2H1E A;  1K3R A;  3GTP B;  4XQQ A;  2R7Z H;  1UE7 A;  1H9S A;  1HCZ A;  1LTT D;  5BN3 A;  4A3L H;  1H9S B;  3HGB A;  3LGJ A;  3F2D A;  4KI0 A;  5IP9 G;  3PIP 3;  4A3D B;  2AKW B;  2F3W A;  4DV0 Q;  3CRK C;  2EVB A;  2Z6K C;  1MJC A;  2VNU D;  1PFM A;  3E9H A;  3DHQ A;  3TDQ A;  4UP9 A;  1K3B C;  1VQH A;  2K33 A;  4KJN A;  5FJ8 H;  1QIL A;  4L63 B;  2Q8T A;  2H5X A;  1IKM A;  1CFM A;  3M7G A;  4EQO A;  3S1R H;  1JOK A;  1JR0 D;  4A3C G;  5LMU L;  2K6A A;  2ATW A;  4QMG A;  4X3S A;  4P72 A;  4DV7 Q;  3P7J A;  3NUC A;  5C3E B;  2EYM A;  4OHJ A;  1L1O C;  2CW0 C;  2IX0 A;  4E6I A;  1WCM G;  1N33 Q;  5D3D A;  3RZD B;  2E75 C;  1Y1W B;  4L5S A;  4JBK A;  2R7D A;  4IUV A;  2EYL A;  2Z0S A;  4EQN A;  4X3T A;  5DM7 3;  1G8Z D;  1RJT A;  4DAM A;  2E2I B;  1A63 A;  3K0X A;  2QA4 A;  2ALY B;  4HIK A;  2RQX A;  4DK0 A;  3M3Y H;  3HFZ B;  3D31 A;  1K0S A;  5EQ0 A;  3K59 A;  1WTP A;  3AEV A;  3CCE A;  5J3B A;  1EY7 A;  4C3J B;  4DR2 L;  3FKI H;  2NN6 H;  2KHJ A;  2LXK A;  3AU7 A;  3GTM H;  2R92 B;  1TS5 A;  3JAM E;  1K8G A;  1V8Q A;  4JI2 L;  4JI4 Q;  2BH2 A;  1Z6H A;  2VB2 X;  1XPO A;  4DA2 A;  1PTO C;  3TQY A;  2XRQ D;  4ZYS A;  1FNW A;  3T16 A;  2K52 A;  1HPC A;  3QWN A;  2QEJ C;  1GUO A;  4POF A;  3E0J A;  1Z9F A;  1XPR A;  3T56 B;  5CYU A;  4HCE A;  2KQ3 A;  1A6X A;  2VUM H;  2O5I C;  4X65 Q;  1YHA A;  1WD1 A;  2ZJR A;  3H3V C;  2AMC B;  5DAU A;  2L15 A;  5I6Y A;  3HKS A;  1K8O A;  2F4V Q;  5IYD H;  5COR A;  2JE6 I;  1IW7 C;  3STB C;  1Q81 C;  4KN4 C;  4DR4 L;  4B3T Q;  1G29 1;  5FK9 C;  1H9M A;  5LL6 X;  1B4O A;  1TWG B;  2JP1 A;  1A0I A;  2PZU A;  2ZM6 Q;  1WD0 A;  4B3M Q;  1IBL Q;  5KNC A;  4JYA L;  3M4Q A;  1W6K A;  1JT8 A;  1HH2 P;  1GOZ A;  4DV6 Q;  1STA A;  3MZ5 A;  1YNN C;  3PQI A;  1F77 A;  1I4H A;  1MBY A;  2KHI A;  3ICE A;  2B2V C;  2D0O A;  5E3F A;  2JQO A;  4B9W A;  2E74 C;  4LF8 Q;  3OWF A;  4EQP A;  4KK7 A;  5HUR A;  4GNX A;  2K5D A;  1OXS C;  1PYW D;  1V43 A;  3T53 B;  4GNX B;  1ICF B;  1RDP D;  2B8F A;  4GN5 A;  1X3F A;  3NTI A;  1F2L A;  4BY1 H;  3FPP A;  4R4I A;  1ENF A;  4ZCK A;  3HOU G;  4LF7 L;  4LF5 L;  1V1Q A;  4P73 A;  3TP5 A;  4BY7 B;  2F0U A;  1NR4 A;  3CCL A;  1XPU A;  3D3R A;  1TU2 B;  2VQE Q;  1BXT A;  2NZO A;  4UAI A;  5IOC A;  2NVT B;  5ELE A;  4RCO A;  2G9H D;  1I6V C;  1SMX A;  3GD7 A;  4AYB G;  2B63 H;  1EZ6 A;  3SK4 A;  1EU3 A;  5CV7 A;  1ICW A;  1YHQ A;  4PMB A;  1RTO A;  4X66 Q;  3I7F A;  5C4J H;  1VQD A;  1KAW A;  2C35 B;  1O7Z A;  4LF4 L;  1TWF H;  3CP0 A;  3W2D A;  1J9O A;  4JI5 Q;  1AFP A;  4YY3 L;  4A3F H;  1SJH D;  2KEN A;  4OO1 I;  2WKD A;  3HOX G;  3PIO A;  4K0K L;  1EY8 A;  3MA2 B;  3NWS A;  4IFD I;  1RD9 D;  4C1N K;  2J7Z A;  3A74 A;  1S72 A;  1LV9 A;  4BXX H;  4OO1 H;  1W2B A;  2VS1 A;  4IJL A;  2E76 C;  2NB0 A;  2M2L A;  2K4K A;  4A75 A;  1B3A A;  1XX8 A;  3M4O H;  4RHS A;  2FMC A;  1HHV A;  1KIX A;  4JOI C;  2VQF L;  5BR8 L;  5DLQ E;  1DM0 B;  4CKE A;  4P2C B;  4LF9 Q;  3HOV G;  4PG3 A;  2AQ2 B;  4IO9 A;  2GA4 B;  3I70 A;  1I6H B;  4NW2 A;  2F0W A;  3EQL C;  5IP9 H;  1G6P A;  3HP3 A;  2LSS A;  1KC8 C;  4DV3 L;  1LYL A;  4AYB E;  1HTL D;  3SXH A;  1BR9 A;  1T9H A;  1KAA A;  2DN8 A;  4QCL A;  2MUY A;  2AQ1 B;  1VQA A;  4DR3 L;  1LLR D;  1NY4 A;  4A3C H;  3JAM L;  1LTB D;  3GP7 A;  1QVC A;  2HQL A;  1Y69 U;  4DXF A;  2L0C A;  2B2W A;  4IUU A;  5M5W H;  1K0R A;  3NBH A;  3CPW A;  1HNW Q;  4RH6 A;  2EQS A;  1WCM H;  3GTQ B;  2A5H A;  4BBR B;  1I5F A;  3I2Z A;  5JPM C;  1PV4 A;  1HZA A;  1Y8O B;  1JC7 A;  3DLL A;  4FF2 A;  1AE3 A;  1BVS A;  5ELC A;  3OYY A;  4DR6 Q;  2LY7 A;  2F0O A;  3NK9 A;  1KNE A;  3IKJ A;  4DNI A;  1EY5 A;  2KCN A;  1STB A;  4KKS A;  4CJ1 B;  4GZY C;  1XMQ L;  3SVM A;  2IWH A;  4DUZ L;  1P8L A;  3MC0 B;  3BDL A;  3HOW G;  3K80 C;  3LWU A;  4BWG B;  1Z7T A;  1JJG A;  1TWH H;  3CW2 C;  1ZXT A;  1I4X A;  2NVX B;  2PW5 A;  2ID0 A;  1Y14 B;  1E7Z A;  3U58 A;  2CVR A;  3SEB A;  4A3M G;  4MHE A;  1GKH A;  1S5E D;  3MTS A;  2PQA B;  2UU9 Q;  2Q2T A;  3GV6 A;  5FLX E;  5IY0 A;  4H0L C;  2QF7 A;  4PZ6 A;  5KYL A;  1VQ8 A;  3NPP A;  4RGO S;  1VS0 A;  2PNR C;  5CMD A;  1XNQ Q;  2JA5 B;  4A3B H;  1K8A C;  4LFB Q;  1DOL A;  3GV3 A;  2YTY A;  2L4N A;  1CUK A;  3UE1 A;  3G48 A;  4C3H G;  2HDM A;  2K01 A;  2Z6B A;  3K7U C;  1F9Q A;  3TSS A;  4ZK9 B;  4K6D A;  1EZ8 A;  3JAM i;  5FO9 B;  2XTI A;  5K5P A;  4A3E B;  4DV2 L;  4P71 A;  2A6E C;  1EQV A;  3IAY A;  4UY8 C;  3R8B A;  3D4R A;  1JWS D;  1JWU D;  1PTO D;  4UP8 A;  2MNA A;  1PHJ A;  1AZP A;  1ET6 A;  3R3O A;  4YHH Q;  4IUQ A;  1TWA B;  2UUA Q;  1Q1E A;  1A3T A;  4K6L A;  2F0T A;  4X6A H;  1GXD C;  1LTA D;  4RHR A;  4G4K A;  4DV4 L;  2JSO A;  4NPS A;  2O4X A;  1XNR Q;  4PMC A;  3CQZ H;  4LFC Q;  3HKZ G;  1B2T A;  3GTM B;  4A3G H;  1HNX Q;  1QG7 A;  2IPK D;  4DK6 C;  3HOU H;  1N36 L;  4ME3 A;  2OCE A;  3H6M A;  1GVP A;  2K50 A;  2D0P A;  3IL8 A;  1EFW A;  1IYJ B;  2Z4I A;  1KRS A;  1K9M C;  5JPN C;  3ER0 A;  5M9O A;  5L37 A;  1B50 A;  4JBM A;  3BU2 A;  4B3R L;  4HED A;  3W1B A;  4APV A;  1YNN D;  1SFO B;  2K14 A;  1PH1 A;  1I50 H;  5AFW A;  3PO3 G;  2HHH Q;  4IPH A;  1DOM A;  4ILW A;  2MJ8 A;  3NSW A;  2RCF A;  4YIJ A;  1HNZ Q;  1LO5 D;  1PRT B;  3K5L A;  2K5Q A;  1ONL A;  4LUO A;  2L1B A;  3VR6 A;  1VQ6 A;  3MFY A;  1NSN S;  3HOX H;  1ET9 A;  3GTK H;  1W6J A;  4MTN A;  3HRZ C;  3KLR A;  4HIM A;  5BN5 A;  4DR1 L;  3TP7 A;  2TMP A;  1VMP A;  5C4X G;  1I94 Q;  4AQY L;  4G7Z C;  3A56 A;  3NEN A;  3K5O A;  5JJI A;  1EIH A;  2NVQ H;  3MWY W;  2E5L Q;  1FR3 A;  3HKZ E;  2UUB L;  3C46 A;  3RN5 A;  4ID6 A;  1I4R A;  3DXJ C;  1DJR D;  4NDX A;  3TRE A;  1UWV A;  5DM6 3;  2BOS A;  5JVG 3;  5IGG A;  1WTX A;  3S14 H;  4LMQ D;  2EYP A;  2N78 A;  5M3M G;  1GJX A;  2K1B A;  1XYI A;  1LTS D;  2JA9 A;  4RGN A;  4DPG A;  5KRU A;  2IX3 A;  5T1I A;  1YIJ A;  3PMF A;  3KOJ A;  3C2P A;  3RMH A;  4GLV B;  3CC7 A;  4GOP A;  5K36 G;  2VZA A;  3L7Z C;  1ENC A;  3TP8 A;  2PO4 A;  1BBU A;  1MHW C;  2RHS B;  5G3L F;  1Y1V B;  3UDX A;  5C0X G;  1CHQ D;  1S5D D;  1X6O A;  2R93 G;  4B9X A;  2WAQ G;  4LF6 L;  5EJW A;  1GM5 A;  1P16 A;  3MXP A;  1VQL A;  2OTL A;  2RSN A;  5FLX L;  3OTO L;  2EY2 A;  3IRB A;  2OTJ A;  1EIG A;  2EDG A;  5C4J B;  2B2Y A;  1BO0 A;  4OEL B;  4CHT B;  2F0J A;  1YZ6 A;  3K7A H;  5CV4 A;  1MIU A;  2L5T A;  1BNZ A;  4ALP A;  4C3I B;  1TWF B;  2NBF A;  2WII B;  1C48 A;  1HZ9 A;  2JA7 H;  1SE8 A;  2YV5 A;  1PTO H;  5DEH A;  2XWB B;  4IPD A;  1Q12 A;  5CV9 A;  1EY6 A;  2VB3 X;  2B2U C;  2D5D A;  2FFK B;  5IP7 H;  3HOW H;  3W3A A;  3BZK A;  1JB7 A;  2WB1 B;  2HD3 A;  2JA8 B;  1JJ2 A;  1KXL A;  1JCK B;  4JW0 A;  1Q46 A;  5EPJ A;  3BS1 A;  1FYC A;  1FJG L;  3M4O B;  2SNS A;  1ASZ A;  2V1C C;  4LJZ C;  4A3M H;  3MXN A;  2L11 A;  3H91 A;  3I4M G;  3MXN B;  2K03 A;  3ZYY X;  4A3K B;  1QUQ A;  2ZJQ A;  3QOL A;  1CM9 A;  3MVV A;  1STY A;  5FOB B;  1VQE A;  1U4P A;  2WAQ E;  1K83 H;  3I4N H;  2CQA A;  4DV5 Q;  2BE5 D;  1EYD A;  2CFM A;  5IGD A;  2RDG A;  3VYT A;  4J15 A;  3CCU A;  4DF7 A;  2JEA I;  4FDB A;  4ME5 A;  3TZU A;  4OX9 Q;  1B3Q A;  1SBB B;  1BUV T;  3S15 H;  1Y8N B;  5IYC G;  3KJP A;  4BS9 A;  1BDO A;  3D4D A;  2JN4 A;  3GTG B;  1SXT A;  1IBM L;  3PO2 B;  1STG A;  4CDC C;  4F87 A;  2OEO A;  1V9P A;  5COY A;  3J81 j;  1IBK L;  2YU9 H;  3QJY A;  4N8X 1;  2FMM A;  4DR5 Q;  3H94 A;  5E7N A;  1WVL A;  2PI2 E;  4JI1 L;  2VXW A;  2EJM A;  4A3J G;  1N34 L;  1C8C A;  3QG1 A;  5KEE A;  2YYZ A;  1FL0 A;  4BBS G;  1S5B D;  1R9T H;  3OPO A;  1XTC D;  2RVL A;  2F0N A;  1YEZ A;  1SE3 A;  2IHF A;  3I3C A;  4UHV A;  3SR1 A;  1X3Q A;  2ZTE A;  1KHI A;  3C1E A;  2X69 A;  3P75 A;  2KEC A;  2ZT9 C;  3Q6S A;  4B08 A;  1QE6 A;  5M5Y H;  3S1M H;  3PO3 H;  1EWI A;  1JOQ A;  1WYD A;  3SK5 A;  2HT1 A;  3X3M A;  2F0V A;  2EPB A;  3CF5 A;  2A74 C;  1KQS A;  4A3B B;  3PIO 3;  2D9U A;  4UP7 A;  3QB3 A;  1EIF A;  3MEF A;  1KDA A;  4X64 L;  1LTG D;  5EKK A;  3FDT A;  2CH4 A;  4QY7 A;  3J80 c;  2A8V A;  1EYA A;  3ULP A;  1NCV A;  3OMG A;  2E2H H;  4C3I G;  1MD2 D;  4LFA Q;  3HOY G;  3QIA A;  5C4X H;  5FO7 B;  4R9W A;  2F0G A;  4OGQ C;  1L0Y B;  1TXY A;  1NUC A;  1S3O A;  2RBM A;  1HZC A;  1SYD A;  1DGS A;  3BZC A;  2UXC L;  4S3S A;  5AJ3 L;  2VW9 A;  3MXU A;  4JI0 L;  3KLS X;  3WOF A;  2Z4H A;  3ZJY C;  3J80 E;  3BVZ A;  3S1N B;  2YTX A;  1A15 A;  2LFN A;  4A3I G;  2KCC A;  1HJP A;  1HFG A;  5M3M H;  3NTH A;  4QUC A;  1U4L A;  3T1Y Q;  5C0X I;  3CCR A;  3HOZ G;  1G91 A;  4OWT B;  4HMI A;  5EPK A;  1EIY B;  2F0F A;  5CV6 A;  3S1Q H;  4A3G B;  1SE4 A;  5ISR A;  1SNC A;  2K7V A;  4FF1 A;  4WJW A;  2BA1 A;  1PDQ A;  1D5Z C;  3GTL H;  3S2H H;  1SNO A;  2R93 H;  2JJQ A;  1VQB A;  1J5E Q;  3JAM c;  3AFP A;  2KA7 A;  5DNF A;  4WOR A;  3I55 A;  2IJ0 A;  2NTS A;  1SSO A;  3HS0 C;  1C7Y A;  2PNH A;  4Q0F A;  2CWP A;  4R4C A;  4UPA A;  4IAL A;  1I50 B;  1LTI D;  2ENB A;  3T1H L;  2UXD Q;  4A93 G;  2A6H D;  2Z1C A;  3KF6 B;  3C1F A;  3J81 E;  2DGY A;  2BA0 A;  4B3S L;  4F8M A;  4JC0 A;  1SAP A;  3NTK A;  4K8J A;  1D7Q A;  3E5S A;  5JJZ A;  1D5X C;  4GN3 B;  2EYO A;  1HFN A;  4HR7 B;  2K05 A;  4IPG A;  4JCV E;  2PW7 A;  4CJ0 B;  1X54 A;  4JV5 Q;  3A8I E;  3K0Y A;  1Q8K A;  4PMW A;  4JI3 Q;  4GNX C;  2NVQ B;  4O2D A;  3NP8 A;  3I4M H;  1AEX A;  3A8K E;  3MEH A;  3NQT A;  1CA5 A;  1K28 A;  1KDB A;  4I7Z C;  1Q82 C;  2K04 A;  1PH9 A;  2QGQ A;  3ERO A;  3HEJ A;  1PA6 A;  4JI8 L;  4CDE C;  5IGB A;  1L1O A;  3I72 A;  4FP5 D;  2RDF A;  4CKB A;  1HUN A;  2B3G A;  1L1O B;  1SYE A;  3J7A 5;  4EGV A;  1I4G A;  4U67 3;  4DV1 L;  2Y0S G;  3MXG A;  4N8F A;  5IYC H;  4GKJ Q;  2MFI A;  1CT1 D;  4IQZ A;  1NBW A;  3L9A X;  5CV8 A;  3K57 A;  3JC6 6;  1YIT A;  3FVQ A;  3PUX A;  3GTJ H;  1A2T A;  1O78 A;  4TKO B;  1ILQ A;  4XXE A;  2F0E A;  4JI6 Q;  4DXG A;  4A3D G;  4A3J H;  2JA7 B;  3I8Z A;  1VQI A;  2KBN A;  1K73 C;  2O5J C;  1EU4 A;  3K58 A;  4MTK A;  1B9M A;  1PZK D;  3O13 A;  1SYG A;  4DUY Q;  1AP0 A;  4RAU C;  3NBI A;  3SK8 A;  2I5L X;  1CKN B;  1SE2 A;  1C9O A;  2J4X A;  4HJ8 A;  2N3S A;  3QOJ A;  4GKK Q;  5CBA E;  3PF4 A;  1SN8 A;  1YJN A;  4QJF A;  2K5V A;  2N55 A;  3H0G H;  4KHP Q;  5M3F B;  1TQO A;  5C3E G;  3G71 A;  4NXM Q;  1Y8P B;  3UDF A;  2EOT A;  2ZTD A;  3A0J A;  3SHL A;  3J80 L;  4ULL A;  4JBW A;  2Z9H A;  4QIW E;  1Y1W G;  1OTC A;  2UUC L;  1VQ4 A;  1M1K C;  1X3G A;  2Y0S E;  1YNJ D;  2F52 A;  3G4S A;  2JA6 B;  4GS3 A;  1BCP C;  2MGS A;  4L6T B;  2KJX A;  1PFN A;  1HUM A;  3W5O A;  3I4N B;  5C44 B;  1PH3 A;  1NJI C;  2B2W C;  5CGK A;  5LMN W;  4X3K A;  4C3J G;  4JI7 L;  1IKL A;  2B2V A;  1E1O A;  1IHZ A;  3I4L A;  2R92 G;  4IFD H;  5HY6 A;  3HOY H;  5IYB G;  2F3I A;  4AH6 A;  3S15 B;  4Y7N B;  3S17 H;  3GTO H;  3RD4 A;  2IX1 A;  2LXJ A;  4I65 A;  2UXB Q;  1XMO L;  1BBW A;  3E3X A;  5JJK A;  4M8A A;  2I0Q A;  1HR0 W;  1PYB A;  2BH8 A;  1N32 Q;  4OIJ A;  2R6G A;  1TKW B;  4L5R C;  3VYS A;  2YU9 B;  1GHK A;  3A5U A;  5I2X A;  2CCZ A;  1IL8 A;  3K81 C;  1E0B A;  1PH8 A;  4A3I H;  3P1H A;  3PUZ A;  3J81 L;  1XWE A;  1WTR A;  2AWN A;  1GUW A;  2HIV A;  2F0H A;  4CDD C;  2N8N A;  1SMY C;  3NWT A;  1PTO F;  3K6O A;  5JOB A;  1C0A A;  2E2J B;  3HOZ H;  5LMN L;  3UDG A;  1QZH A;  3PIP A;  4HJA A;  1FGB D;  3Q8D A;  1PLF A;  1R4P B;  3TME A;  1LT3 D;  1NAP A;  4X62 Q;  1T5E A;  4K5X A;  3DM3 A;  3EFX D;  1EOT A;  1EQT A;  2IW3 A;  4K2L A;  1HR0 L;  1GO3 E;  4FXD A;  2Q2H A;  3J80 i;  4H13 C;  2F0M A;  3CCM A;  1PVO A;  2PQE A;  4CGY B;  2A68 C;  3K5M A;  2A69 D;  5IGE A;  4XQJ A;  2BE5 C;  4YWM A;  2A19 A;  1D8L A;  3LNN A;  5FLX c;  4A93 H;  4DR7 L;  1VQ9 A;  1NR2 A;  1YI2 A;  4OL7 A;  5LHY 1;  3CHB D;  4C2M B;  1HQM C;  3OOC A;  4H44 C;  4J6H A;  5I4D A;  1CI3 M;  4XTC S;  4Y52 H;  1D2B A;  2PQA A;  1VQC A;  5FKA C;  4BY7 G;  2R7Z B;  2OWO A;  1CK1 A;  2PZW A;  5J22 A;  2AWO A;  4PZ7 A;  3BYT B;  3T13 A;  4RGT A;  3UE0 A;  3EN2 A;  1LT6 D;  1SR3 A;  4NB3 A;  4F88 A;  5C4H A;  5LMU Q;  5JJL A;  4DAY A;  1II3 A;  1ZYR C;  4M1U B;  3TEH B;  3J81 i;  4DAY B;  3PUV A;  4FXK C;  4FNF A;  3S1R B;  2E2D C;  1WOC A;  4HSP A;  1ROD A;  5H1S E;  1OXX K;  4NXN L;  4TVA B;  1QVG A;  3VR5 A;  3VA7 A;  3BDO A;  2F03 A;  1SNP A;  1SEB D;  5JEA J;  5IWA L;  4C56 C;  1Q86 C;  3S2H B;  3VR3 A;  1YJ9 A;  3B6Y A;  5KYI A;  3IFD A;  2XVS A;  5EBC A;  3F2C A;  2KOL A;  3DM1 A;  3H09 A;  4DR2 Q;  4ODG A;  3OW2 A;  3RUZ A;  1JWM D;  1E1T A;  1J8I A;  2J0T D;  1WTV A;  3M3Y B;  2D2C C;  4JBJ A;  2PZT A;  1VQM A;  3GTP H;  4JI2 Q;  1HA5 A;  3A5Z B;  3SGI A;  4EQ5 A;  3I90 A;  3FKI B;  1E24 A;  2CQO A;  3OIP A;  1V1P B;  4IOC A;  5JEA G;  3D6C A;  2H4O A;  3FPU B;  5F2D A;  1F2Y A;  3HG9 A;  1L2F A;  2PMZ B;  3GDE A;  4DV0 L;  3KF8 A;  5IGF A;  2ASB A;  3KF8 B;  4QL5 A;  2VUM B;  4OON A;  3PGZ A;  3E0E A;  2RDH A;  1G6Z A;  3NEL A;  4BBR G;  1Y1W H;  4DR4 Q;  3T51 B;  2F0L A;  2F0S A;  1KD1 C;  1U4R A;  2LS0 1;  4DV7 L;  4GOP C;  4V0B A;  3MHB A;  1EEF D;  3V96 A;  4CJ2 C;  2JK8 A;  1B8A A;  4KY5 A;  4JYA Q;  2E2I H;  1TS4 A;  1U4M A;  2F3V A;  1O7Y A;  4QUF A;  3TS2 A;  3RR5 A;  1GD7 A;  1ILP A;  2BCO A;  1ESR A;  2ES2 A;  1N33 L;  4ZUI A;  4C3J H;  1VQF A;  4NP5 A;  5C0X J;  1B44 D;  2R92 H;  3P20 A;  3VR4 A;  1PFS A;  2B2Y C;  4DKA C;  1UNS A;  2EIF A;  3HOV H;  1JE5 A;  1STH A;  4QGU A;  3CAM A;  1ZEQ X;  2A6H C;  4LF7 Q;  4LF5 Q;  3S2D H;  1EFI D;  2MHV A;  4JI4 L;  3GTJ B;  2HCI A;  5M5X H;  2IHE A;  3Q24 A;  1YBY A;  3AFQ A;  1BCP D;  4BY1 B;  4IUT A;  4RMF A;  2SOB A;  4OIK A;  2RA4 A;  2JA5 G;  2HIX A;  1Q7Y C;  3A7A B;  4O1N A;  3E6Z X;  3GO5 A;  4X65 L;  4LF4 Q;  2KED A;  2QIL A;  4L8J A;  5GRO A;  4K5V A;  2B63 B;  1TVX A;  1EY4 A;  3V05 A;  1XTD A;  1B7Y B;  4EVO A;  4A3E G;  3AMU A;  4YY3 Q;  2X6L A;  3TP6 A;  3H0G B;  1TWG H;  2F4V L;  2MO0 A;  4K0K Q;  5ELB A;  2NYZ D;  3J7Y W;  2D62 A;  2DNE A;  5I6W A;  4B3T L;  4A3F B;  1F9R A;  3CME A;  2WP8 J;  1VDZ A;  4IZ8 A;  4HIO A;  2NWG A;  1VF5 C;  4ZKC B;  2ZM6 L;  4B3M L;  3G6E A;  1IBL L;  1SMY D;  1MGS A;  2VQF Q;  5BR8 Q;  1T5X D;  1U5K A;  4DV6 L;  4K5W A;  3TZD A;  1D5M C;  3GQB A;  5E1F A;  5GQO A;  4QB4 A;  2NN6 G;  4LF8 L;  1QVF A;  2QKI C;  4BY7 H;  3CKI B;  1EOV A;  2KUM A;  4DV3 Q;  3EJI A;  4LNQ A;  1EQQ A;  2HQE A;  2B39 A;  4HJ7 A;  4L5T A;  1KLU D;  2NVT H;  3QO2 A;  3D6W A;  4DR3 Q;  2N88 A;  4DU9 A;  1TII D;  4R8N A;  3CRL C;  2A68 D;  4C3H H;  2VQE L;  2NZ1 D;  2L55 A;  2XSC A;  1SRO A;  2V4D A;  1FD7 D;  1LTL A;  2JEB I;  4XIG S;  2MQH A;  1LT4 D;  2K5N A;  4K14 A;  3T4A C;  2DNC A;  1H9R A;  2PCF B;  4X66 L;  3DWQ A;  1VQ5 A;  4HJ9 A;  1X32 A;  4KJO A;  1UE1 A;  1TR5 A;  5M5W B;  2BDO A;  1IZ6 A;  3BVG A;  1F9S A;  1WCM B;  4DGZ A;  1UAP A;  4JPB W;  4JI5 L;  1TT2 A;  1S4Z A;  2SDF A;  5IT9 E;  3TRZ A;  4N9T A;  1XMQ Q;  1BOS A;  1PH4 A;  3F2U A;  1UEA B;  4DUZ Q;  4P75 A;  1QCB D;  1YNJ C;  5LL6 S;  3BDC A;  2B2U A;  4HID A;  2SEB D;  3V2T A;  2XIW A;  1ZYR D;  3KYH C;  1WTW A;  4YWK A;  5T1G A;  2K28 A;  1BQQ T;  4KKU A;  1GUN A;  1TWH B;  1JMC A;  4LAA A;  2NVY H;  2FIN B;  4LF9 L;  3S24 A;  3M4P A;  2PMZ E;  4ZKB B;  3MFG A;  5JEA H;  4TRD A;  1B53 A;  3ULJ A;  1H95 A;  1KTK A;  3RZO H;  3D0F A;  3RLO A;  1PRT D;  1B1Z A;  2NUC A;  2EE1 A;  4ZAI A;  1Y1V G;  2G9D A;  2F4I A;  2XRS D;  3EA6 A;  2B2T A;  3AYH B;  3Q0A A;  1DON A;  4N9P A;  1VQN A;  2C9O A;  2EYF A;  3DMU A;  4J8Q A;  3I4O A;  5GAH C;  3VYR A;  3GTQ H;  4BBR H;  3G6J B;  1W3S A;  2F0I A;  4DV2 Q;  2EXZ A;  1D1I A;  3FMC A;  1JJC B;  3URY A;  4DK3 C;  4FYD A;  4YWL A;  2N49 A;  3U4V A;  1HNW L;  2F0D A;  1G2T A;  1L0X B;  1QZG A;  1A2U A;  1CKM A;  5EGT A;  1MSH A;  4RCN A;  4DR6 L;  1VQK A;  1UUP A;  4IJH A;  5C3W A;  4R1J A;  4DV4 Q;  2WB1 G;  1CSQ A;  3TN2 A;  2JA8 G;  4BXX G;  1KLG D;  2C5C A;  1JOO A;  2NVX H;  2A69 C;  4H7B A;  1ENA A;  3EBE A;  3M85 A;  1N36 Q;  4KV6 A;  3A54 A;  5GAD C;  3BG3 A;  1SNQ A;  5FLM G;  2DJF C;  2KCT A;  3CQZ B;  3Q22 A;  4A3K G;  2DUD A;  2WFW A;  3HOU B;  3ND8 A;  1EY0 A;  4WJ4 A;  5K36 H;  2JA5 H;  2F1M A;  1NNX A;  5J39 A;  2UU9 L;  4B3R Q;  3J81 c;  1MSG A;  4RA8 A;  1DZ1 A;  1Z47 A;  5C0X H;  2QDB A;  5IIF A;  3VR2 A;  1PXU A;  1CZW A;  2ZJP A;  1CSP A;  5I2Y A;  1XNQ L;  4AYB B;  1RHP A;  4LFB L;  5EPL A;  4A3E H;  1ESF A;  2K5W A;  3J7A F;  1E2Z A;  2OXP A;  3CC4 A;  3KF6 A;  4R4T A;  1YVC A;  2AUJ D;  3KLS A;  3G7L A;  3R93 A;  1XJV A;  2JXM B;  4RGM A;  1HZB A;  3AQQ A;  5ELF A;  3PO2 G;  4IN3 A;  5A35 A;  2R61 A;  4DR1 Q;  2ZTC A;  4AQY Q;  1TWA H;  2WB1 E;  1PYS B;  1AN8 A;  3HOX B;  3GTK B;  1OO9 B;  2NN6 I;  2UUB Q;  3EIV A;  4YHH L;  1IXR A;  2WKC A;  2UUA L;  2OF1 A;  4RKL A;  2RKS A;  1TS2 A;  1MI2 A;  2NTT A;  4LUV A;  2Z6K A;  1X3E A;  1IL2 A;  4DFA A;  3PCO B;  1SYF A;  2MP1 A;  2GVA A;  5IT9 L;  3ULL A;  4KD4 A;  3HOV B;  4C1N I;  3H15 A;  1XNR L;  2L12 A;  4LFC L;  4ZQ3 A;  3OIQ A;  3TBI B;  1HNX L;  2LKV A;  1EQR A;  3S2D B;  5TSS A;  3S14 B;  3U9O A;  1O80 A;  1E3P A;  2EJF C;  4HMJ A;  4TSS A;  3L2P A;  1SFO H;  5M5X B;  1GHJ A;  1A3V A;  3KK7 A;  4XDX A;  1A62 A;  4LF6 Q;  4A3B G;  5JVH 3;  4GLX A;  3OTO Q;  5EKL A;  4IPC A;  2HHH L;  2F0K A;  1I4P A;  4H02 A;  1BBX C;  1HNZ L;  2I07 B;  2K32 A;  3PUY A;  4G7H C;  1FVI A;  5I9O A;  1WFQ A;  1TWC H;  2MPM A;  2KEE A;  3K7A B;  1DOK A;  4EX5 A;  2CHB D;  4BBS H;  1I94 L;  1PTO B;  2M00 A;  5BN4 A;  1FJG Q;  3D8G A;  1CKN A;  3HOW B;  4O42 A;  4R4O A;  2E5L L;  4DAP A;  4L5Q A;  2B8G A;  4BA2 I;  1PH6 A;  1SRU A;  1NMF A;  1OXV A;  4A3G G;  4A3M B;  3N6R A;  3CCQ A;  3S16 H;  2RCN A;  3A55 A;  2IT1 A;  1WTO A;  3FHW A;  4A4I A;  2TSS A;  1N8R C;  2EXD A;  1Y1V H;  3VA5 A;  1WJJ A;  3HZX A;  3CCS A;  1BKB A;  4NMZ A;  1E2V A;  4V19 0;  1STE A;  4YCU A;  3S9W A;  5ELN A;  4GN4 B;  1K83 B;  4QF4 A;  4C3H B;  3KUP A;  3F2B A;  2P5Z X;  3R2I A;  1EY9 A;  4G7O C;  4IUP A;  3QR8 A;  3I91 A;  1LT5 D;  4C3I H;  4R8I A;  3LX0 A;  1IBM Q;  4MIU A;  2G5D A;  2PYK A;  2Z8L A;  4KD3 A;  1IBK Q;  3N52 A;  1LTR D;  4FXG C;  4IOA A;  5HGT A;  4FF3 A;  2NZH A;  1Q90 A;  2CWA A;  4GLA C;  1PH7 A;  4JI1 Q;  4KN7 C;  1N34 Q;  5GAE C;  2JA8 H;  4OXP A;  1M90 C;  2IY5 B;  3KJO A;  4PQX A;  1CTM A;  3MAQ A;  4RFB A;  4DAV A;  2Q2I A;  3DEP A;  5FLM H;  1X9N A;  1ASY A;  3KFU A;  1R9T B;  3R2T A;  3E9I A;  3KDF A;  4CDF C;  3HKZ B;  4A3K H;  1HA6 A;  2PPB C;  3KDF B;  1N9W A;  3RLN A;  3X3N A;  1KNA A;  4HN7 A;  1G2S A;  3M7N A;  2NVY B;  2VY3 A;  3BZD B;  1STN A;  1HRJ A;  1SDF A;  2HCC A;  2OQK A;  1VQO A;  2ICI A;  3RZO B;  3BYY B;  4F7X A;  1ML0 D;  4DNT B;  3K8A A;  5M5Y B;  4DV5 L;  3DEO A;  3S1M B;  1BCP B;  1OXT A;  4X64 Q;  2O2L D;  3PO3 B;  3IFT A;  4PV1 C;  4IUN A;  1DYQ A; 
#chains in the Genus database with same CATH homology
 4LK1 C;  1JIC A;  4XQN A;  5E4X A;  2XWJ B;  3SE0 A;  1TS3 A;  1WTQ A;  1RTN A;  1VF7 A;  1PFB A;  5CBE E;  1D1K A;  2HDL A;  2E2H B;  2EZV A;  1CHP D;  5C4X B;  1JB3 A;  2DY7 A;  1S5F D;  1M4V A;  4HAE A;  4KHV A;  4PNY A;  4UDU C;  4HCS A;  4X3U A;  3J7A V;  3ERQ A;  1RCV D;  1LAB A;  5C4Z A;  2CW0 D;  4WRD A;  5M3M B;  1TY2 A;  4HSV A;  1SND A;  3DWP A;  3S1Q B;  1GUG A;  1DD2 A;  1KDC A;  3GTL B;  2R93 B;  5C6A A;  2WV6 D;  4KHZ A;  4KY7 A;  4KMU C;  1PRT C;  2WAQ B;  1QB5 D;  3KBX A;  1RF2 D;  1H9K A;  5C3X A;  1BCP F;  1O7L A;  4CBV A;  3NQI A;  4KKT A;  2XNA C;  5EBD A;  1EWH A;  1GUS A;  1V1O A;  1DXM A;  1H9J A;  2X6G A;  1GUT A;  3A8J E;  4TQU S;  2IL8 A;  1V1P A;  3D4W A;  2Q8I B;  4FF4 A;  1FNV A;  1QJO A;  2AQ3 B;  4G57 A;  5KND A;  2EJG C;  4FO2 A;  3NHH A;  1EWC A;  1DCZ A;  4ZRZ A;  3ONA B;  5C5M A;  1IW7 D;  3M4Y A;  3I4M B;  4ZUJ A;  1A3U A;  4U68 A;  1FNU A;  4XT3 B;  1VMC A;  1OXU A;  4IUR A;  4DN4 M;  1S5C D;  4XYO A;  2DY8 A;  5CC4 A;  1SNM A;  1SJE D;  3OWE B;  5J1Z A;  4K8I A;  3SDZ A;  3OSO A;  4XT1 B;  1CQF A;  1C4Q A;  4FVM A;  4CKC A;  4KY6 A;  3NXW A;  1IYU A;  1QWY A;  3EVQ A;  3VYU A;  3L3O C;  5IOD A;  1F2Z A;  3WDN A;  3ND9 A;  1D6E C;  3RLF A;  5EKI A;  2M9V A;  2BDN A;  3A7L A;  1TWC B;  1RKN A;  2EY1 A;  3Q23 A;  4JK1 C;  3I73 A;  5IGC A;  4A3J B;  4BBS B;  3OMC A;  2WIN B;  3NE5 B;  1BF4 A;  1SYB A;  5D65 A;  3FEW X;  1QOH A;  2EY5 A;  2FHT A;  5A2Q E;  3U9S A;  3S16 B;  4XYQ A;  2I46 A;  2Q8R E;  2A73 B;  3DUZ A;  2SNM A;  3PV0 A;  5JAV A;  1KAB A;  1JOR A;  3DWA A;  2KHS A;  1CZG A;  3KBG A;  1XXG A;  2OT2 A;  3PUW A;  4MN3 A;  4RKB A;  1F2M A;  1PRT F;  3HOY B;  1ZKO A;  1Q8I A;  3S17 B;  3GTO B;  1JE4 A;  1PZJ D;  3CU7 A;  5ELD A;  3OW7 A;  1R4Q B;  5FO8 B;  5KNB A;  2EY6 A;  1Q3L A;  5NUC A;  2QCP X;  3UI2 A;  4J1M A;  1X3P A;  3LWE A;  4A3I B;  3ITP A;  1QNK A;  2R3Z A;  1SYC A;  2KVM A;  4RWS C;  1CQV A;  2JYO A;  4ZLT F;  5C5L A;  3HOZ B;  2RSO A;  4NKL A;  1EYC A;  4ABN A;  2B2T C;  2AUK A;  1PMR A;  5KGU A;  1AW7 A;  4HTH A;  2LMC B;  1JQY D;  1B9N A;  5E4W C;  3BVM A;  1K8M A;  1TY0 A;  2L9H A;  2F0P A;  1IYV A;  4A93 B;  1Q1B A;  1QNU A;  2ICE C;  5G3L D;  2ZXO A;  2EYH A;  1LAC A;  2ZXP A;  1I3Q B;  4Q5V A;  1I4Q A;  1AZQ A;  5CR3 A;  3K5N A;  4DNR B;  4BA1 I;  4Z9C B;  2EYJ A;  2XN9 C;  5I9P A;  1HQR D;  1HTP A;  3FRP B;  2A6E D;  1F9P A;  4IFD J;  1PZI D;  1HXY D;  3AB9 A;  3C3L A;  5D3I B;  3OHX C;  1EEI D;  5CV5 A;  4K2K A;  5D14 A;  4KTA A;  2WAC A;  1CA6 A;  4DK1 A;  3WOE A;  4QIW B;  2HUG A;  2ZXR A;  2F0Q A;  1M8A A;  1VCI A;  2Y0S B;  5KIX A;  4OO1 G;  5A2Q L;  4WFN 3;  3SK6 A;  2FJ2 A;  4IFD G;  1EL0 A;  1U9R A;  1E2W A;  2H1E A;  3GTP B;  4XQQ A;  1H9S A;  1HCZ A;  1LTT D;  5BN3 A;  1H9S B;  3HGB A;  4KI0 A;  3PIP 3;  4A3D B;  2F3W A;  3CRK C;  2EVB A;  2VNU D;  1PFM A;  3DHQ A;  3TDQ A;  2K33 A;  4KJN A;  1QIL A;  4L63 B;  2Q8T A;  1IKM A;  1CFM A;  3M7G A;  4EQO A;  1JOK A;  1JR0 D;  2K6A A;  4QMG A;  4X3S A;  3P7J A;  3NUC A;  5C3E B;  2EYM A;  4OHJ A;  2CW0 C;  2IX0 A;  4E6I A;  5D3D A;  3RZD B;  2E75 C;  1Y1W B;  4IUV A;  2EYL A;  4EQN A;  4X3T A;  5DM7 3;  1G8Z D;  1RJT A;  2E2I B;  2RQX A;  4DK0 A;  3D31 A;  5EQ0 A;  3K59 A;  1WTP A;  1EY7 A;  4C3J B;  2NN6 H;  3AU7 A;  2R92 B;  1TS5 A;  3JAM E;  1V8Q A;  1Z6H A;  2VB2 X;  4DA2 A;  1PTO C;  2XRQ D;  4ZYS A;  1FNW A;  3T16 A;  1HPC A;  3QWN A;  2QEJ C;  1GUO A;  3E0J A;  3T56 B;  5CYU A;  4HCE A;  2KQ3 A;  1A6X A;  2O5I C;  1WD1 A;  3H3V C;  5DAU A;  5I6Y A;  1K8O A;  5COR A;  2JE6 I;  1IW7 C;  4KN4 C;  1G29 1;  5FK9 C;  1H9M A;  5LL6 X;  1B4O A;  1TWG B;  2JP1 A;  2PZU A;  1WD0 A;  5KNC A;  1W6K A;  1GOZ A;  1STA A;  3MZ5 A;  1YNN C;  1F77 A;  1I4H A;  1MBY A;  2B2V C;  5E3F A;  4B9W A;  2E74 C;  3OWF A;  4EQP A;  4KK7 A;  5HUR A;  2K5D A;  1OXS C;  1PYW D;  1V43 A;  3T53 B;  1RDP D;  2B8F A;  3NTI A;  1F2L A;  3FPP A;  1ENF A;  3TP5 A;  4BY7 B;  2F0U A;  1NR4 A;  3D3R A;  1TU2 B;  1BXT A;  4UAI A;  5IOC A;  2NVT B;  5ELE A;  4RCO A;  2G9H D;  1I6V C;  3GD7 A;  1EZ6 A;  3SK4 A;  1EU3 A;  5CV7 A;  1ICW A;  4PMB A;  1RTO A;  1O7Z A;  3W2D A;  1J9O A;  1AFP A;  4OO1 I;  1SJH D;  2WKD A;  1EY8 A;  3MA2 B;  3NWS A;  4IFD I;  1RD9 D;  4C1N K;  2J7Z A;  1LV9 A;  4OO1 H;  2E76 C;  2NB0 A;  2M2L A;  1B3A A;  1XX8 A;  4RHS A;  2FMC A;  1HHV A;  1DM0 B;  4CKE A;  4P2C B;  2AQ2 B;  2GA4 B;  3I70 A;  1I6H B;  4NW2 A;  2F0W A;  3EQL C;  3HP3 A;  1HTL D;  3SXH A;  1BR9 A;  1KAA A;  2DN8 A;  4QCL A;  2MUY A;  2AQ1 B;  1LLR D;  3JAM L;  1LTB D;  3GP7 A;  1Y69 U;  4DXF A;  2L0C A;  2B2W A;  4IUU A;  3NBH A;  4RH6 A;  3GTQ B;  2A5H A;  4BBR B;  5JPM C;  1Y8O B;  1JC7 A;  4FF2 A;  5ELC A;  2LY7 A;  2F0O A;  3NK9 A;  1KNE A;  3IKJ A;  1EY5 A;  2KCN A;  1STB A;  4KKS A;  4CJ1 B;  4GZY C;  3SVM A;  2IWH A;  3MC0 B;  3BDL A;  3LWU A;  4BWG B;  1Z7T A;  1ZXT A;  1I4X A;  2NVX B;  2PW5 A;  2ID0 A;  2CVR A;  3SEB A;  4MHE A;  1S5E D;  3MTS A;  3GV6 A;  5FLX E;  4H0L C;  2QF7 A;  5KYL A;  3NPP A;  4RGO S;  2PNR C;  5CMD A;  2JA5 B;  1DOL A;  3GV3 A;  2L4N A;  4C3H G;  2HDM A;  2K01 A;  3TSS A;  1F9Q A;  4ZK9 B;  4K6D A;  1EZ8 A;  5FO9 B;  5K5P A;  4A3E B;  2A6E C;  1EQV A;  3IAY A;  3R8B A;  3D4R A;  1JWS D;  1JWU D;  1PTO D;  1AZP A;  1ET6 A;  3R3O A;  4IUQ A;  1TWA B;  1Q1E A;  1A3T A;  4K6L A;  2F0T A;  1GXD C;  1LTA D;  4RHR A;  4G4K A;  2JSO A;  2O4X A;  4PMC A;  1B2T A;  3GTM B;  1QG7 A;  2IPK D;  3H6M A;  3IL8 A;  2Z4I A;  5JPN C;  5M9O A;  1B50 A;  4HED A;  1YNN D;  1SFO B;  5AFW A;  1DOM A;  4ILW A;  2MJ8 A;  3NSW A;  4YIJ A;  1LO5 D;  1PRT B;  3K5L A;  2K5Q A;  1ONL A;  2L1B A;  3VR6 A;  3MFY A;  1NSN S;  1ET9 A;  1W6J A;  3HRZ C;  3KLR A;  5BN5 A;  3TP7 A;  2TMP A;  1VMP A;  4G7Z C;  3A56 A;  3K5O A;  1EIH A;  3MWY W;  1FR3 A;  3C46 A;  4ID6 A;  1I4R A;  3DXJ C;  1DJR D;  4NDX A;  5DM6 3;  2BOS A;  5JVG 3;  5IGG A;  1WTX A;  4LMQ D;  2EYP A;  1GJX A;  2K1B A;  1XYI A;  1LTS D;  4RGN A;  2IX3 A;  5KRU A;  5T1I A;  3PMF A;  3C2P A;  3RMH A;  5K36 G;  3L7Z C;  1ENC A;  3TP8 A;  2PO4 A;  5G3L F;  1Y1V B;  5C0X G;  1CHQ D;  1S5D D;  4B9X A;  5EJW A;  3MXP A;  2RSN A;  5FLX L;  2EY2 A;  1EIG A;  2EDG A;  5C4J B;  2B2Y A;  1BO0 A;  4CHT B;  2F0J A;  5CV4 A;  1BNZ A;  2L5T A;  4C3I B;  1TWF B;  2NBF A;  2WII B;  1C48 A;  1PTO H;  5DEH A;  2XWB B;  5CV9 A;  1Q12 A;  1EY6 A;  2VB3 X;  2B2U C;  2D5D A;  2FFK B;  3W3A A;  2WB1 B;  2JA8 B;  1JCK B;  5EPJ A;  3BS1 A;  1FYC A;  3M4O B;  2SNS A;  4LJZ C;  3MXN A;  2L11 A;  3H91 A;  2K03 A;  3ZYY X;  4A3K B;  3QOL A;  1CM9 A;  3MVV A;  1STY A;  5FOB B;  1U4P A;  2CQA A;  2BE5 D;  1EYD A;  5IGD A;  2RDG A;  3VYT A;  4DF7 A;  2JEA I;  4ME5 A;  3TZU A;  1SBB B;  1BUV T;  1Y8N B;  4BS9 A;  1BDO A;  3D4D A;  3GTG B;  1SXT A;  3PO2 B;  1STG A;  4F87 A;  2OEO A;  5COY A;  3QJY A;  2FMM A;  3H94 A;  1WVL A;  2VXW A;  2EJM A;  1C8C A;  3QG1 A;  5KEE A;  2YYZ A;  1S5B D;  3OPO A;  1XTC D;  2RVL A;  2F0N A;  1SE3 A;  3I3C A;  3SR1 A;  1X3Q A;  3C1E A;  2X69 A;  3P75 A;  2KEC A;  2ZT9 C;  3Q6S A;  4B08 A;  1QE6 A;  1JOQ A;  3SK5 A;  3X3M A;  2F0V A;  2EPB A;  2A74 C;  4A3B B;  3PIO 3;  2D9U A;  3QB3 A;  1KDA A;  1LTG D;  5EKK A;  3FDT A;  1EYA A;  1NCV A;  3OMG A;  4C3I G;  1MD2 D;  3QIA A;  5FO7 B;  4R9W A;  2F0G A;  4OGQ C;  1L0Y B;  1NUC A;  2RBM A;  1SYD A;  4S3S A;  3MXU A;  3KLS X;  3WOF A;  2Z4H A;  3J80 E;  3BVZ A;  3S1N B;  1A15 A;  2LFN A;  2KCC A;  1HFG A;  3NTH A;  4QUC A;  1U4L A;  5C0X I;  1G91 A;  4HMI A;  5EPK A;  4A3G B;  2F0F A;  5CV6 A;  1SE4 A;  5ISR A;  1SNC A;  2K7V A;  4FF1 A;  4WJW A;  2BA1 A;  1PDQ A;  1D5Z C;  1SNO A;  2KA7 A;  5DNF A;  4WOR A;  2IJ0 A;  2NTS A;  1SSO A;  3HS0 C;  4Q0F A;  4IAL A;  1I50 B;  1LTI D;  2ENB A;  2A6H D;  2Z1C A;  3J81 E;  3C1F A;  2BA0 A;  4F8M A;  1SAP A;  3NTK A;  4K8J A;  3E5S A;  5JJZ A;  1D5X C;  2EYO A;  1HFN A;  4HR7 B;  2K05 A;  2PW7 A;  4CJ0 B;  3A8I E;  3K0Y A;  4PMW A;  2NVQ B;  3NP8 A;  1AEX A;  3A8K E;  3MEH A;  3NQT A;  1CA5 A;  1KDB A;  4I7Z C;  2K04 A;  3ERO A;  3HEJ A;  5IGB A;  4FP5 D;  3I72 A;  2RDF A;  4CKB A;  1HUN A;  1SYE A;  4EGV A;  1I4G A;  4U67 3;  3MXG A;  1CT1 D;  4IQZ A;  3L9A X;  5CV8 A;  3K57 A;  3FVQ A;  3PUX A;  1A2T A;  1O78 A;  4TKO B;  1ILQ A;  4XXE A;  2F0E A;  4DXG A;  2JA7 B;  3I8Z A;  2O5J C;  1EU4 A;  3K58 A;  1B9M A;  1PZK D;  3O13 A;  1SYG A;  1AP0 A;  4RAU C;  3NBI A;  3SK8 A;  1SE2 A;  2J4X A;  3QOJ A;  5CBA E;  2N55 A;  5M3F B;  1TQO A;  1Y8P B;  2EOT A;  3J80 L;  3SHL A;  4ULL A;  4JBW A;  1YNJ D;  2JA6 B;  1BCP C;  2MGS A;  4L6T B;  2KJX A;  1PFN A;  1HUM A;  3I4N B;  5C44 B;  2B2W C;  5CGK A;  4X3K A;  4C3J G;  1IKL A;  2B2V A;  1IHZ A;  3I4L A;  4IFD H;  3S15 B;  4Y7N B;  3RD4 A;  2IX1 A;  4I65 A;  4M8A A;  4OIJ A;  2R6G A;  1TKW B;  3VYS A;  2YU9 B;  1GHK A;  5I2X A;  1IL8 A;  1E0B A;  3P1H A;  3PUZ A;  3J81 L;  1XWE A;  1WTR A;  2AWN A;  1GUW A;  2F0H A;  1SMY C;  3NWT A;  1PTO F;  3K6O A;  5JOB A;  2E2J B;  1FGB D;  1PLF A;  1R4P B;  3TME A;  1LT3 D;  1NAP A;  1T5E A;  4K5X A;  3EFX D;  1EOT A;  1EQT A;  2IW3 A;  4K2L A;  4FXD A;  4H13 C;  2F0M A;  2PQE A;  4CGY B;  2A68 C;  3K5M A;  2A69 D;  5IGE A;  4XQJ A;  2BE5 C;  3LNN A;  1NR2 A;  4OL7 A;  5LHY 1;  3CHB D;  4C2M B;  1HQM C;  3OOC A;  4H44 C;  4J6H A;  5I4D A;  1CI3 M;  4XTC S;  1D2B A;  5FKA C;  2R7Z B;  1CK1 A;  2PZW A;  5J22 A;  2AWO A;  3BYT B;  3T13 A;  4RGT A;  1LT6 D;  4F88 A;  5C4H A;  4DAY A;  1II3 A;  1ZYR C;  4M1U B;  3PUV A;  4FNF A;  4FXK C;  3S1R B;  2E2D C;  4HSP A;  1ROD A;  1OXX K;  3VR5 A;  3VA7 A;  3BDO A;  2F03 A;  1SNP A;  1SEB D;  5JEA J;  4C56 C;  3S2H B;  3VR3 A;  5KYI A;  3IFD A;  2XVS A;  5EBC A;  2KOL A;  3DM1 A;  3H09 A;  4ODG A;  3RUZ A;  1JWM D;  1J8I A;  2J0T D;  1WTV A;  3M3Y B;  2D2C C;  2PZT A;  1HA5 A;  3I90 A;  3FKI B;  3OIP A;  1V1P B;  5JEA G;  3D6C A;  2H4O A;  3FPU B;  5F2D A;  1F2Y A;  3HG9 A;  2PMZ B;  3KF8 A;  5IGF A;  2VUM B;  2RDH A;  1G6Z A;  3T51 B;  2F0L A;  2F0S A;  1U4R A;  2LS0 1;  4V0B A;  3MHB A;  1EEF D;  3V96 A;  4CJ2 C;  4KY5 A;  1TS4 A;  1U4M A;  2F3V A;  1O7Y A;  4QUF A;  1ILP A;  2BCO A;  1ESR A;  4ZUI A;  4NP5 A;  5C0X J;  1B44 D;  3P20 A;  3VR4 A;  2B2Y C;  1UNS A;  1STH A;  1ZEQ X;  2A6H C;  1EFI D;  2MHV A;  3GTJ B;  2HCI A;  3Q24 A;  4BY1 B;  1BCP D;  4IUT A;  2SOB A;  4OIK A;  2RA4 A;  3A7A B;  4O1N A;  3E6Z X;  3GO5 A;  2KED A;  2QIL A;  4L8J A;  4K5V A;  2B63 B;  1TVX A;  1EY4 A;  3V05 A;  4EVO A;  3AMU A;  2X6L A;  3TP6 A;  3H0G B;  5ELB A;  2NYZ D;  3J7Y W;  2D62 A;  2DNE A;  5I6W A;  4A3F B;  1F9R A;  2WP8 J;  1VDZ A;  4IZ8 A;  2NWG A;  1VF5 C;  4ZKC B;  1SMY D;  1MGS A;  1T5X D;  4K5W A;  3TZD A;  1D5M C;  3GQB A;  5E1F A;  4QB4 A;  2NN6 G;  2QKI C;  3CKI B;  2KUM A;  3EJI A;  2HQE A;  2B39 A;  1KLU D;  3QO2 A;  3D6W A;  2N88 A;  4DU9 A;  1TII D;  4R8N A;  3CRL C;  2A68 D;  2NZ1 D;  2L55 A;  2XSC A;  2V4D A;  1FD7 D;  2JEB I;  4XIG S;  1LT4 D;  4K14 A;  3T4A C;  2DNC A;  1H9R A;  2PCF B;  3DWQ A;  1X32 A;  4KJO A;  1TR5 A;  5M5W B;  2BDO A;  3BVG A;  1F9S A;  1WCM B;  4DGZ A;  1UAP A;  5IT9 E;  1TT2 A;  1S4Z A;  2SDF A;  4N9T A;  1BOS A;  3F2U A;  1UEA B;  1QCB D;  1YNJ C;  5LL6 S;  3BDC A;  2B2U A;  2SEB D;  3V2T A;  2XIW A;  1ZYR D;  1WTW A;  5T1G A;  2K28 A;  1BQQ T;  4KKU A;  1GUN A;  1TWH B;  4LAA A;  2FIN B;  4ZKB B;  3MFG A;  5JEA H;  4TRD A;  1B53 A;  1KTK A;  1PRT D;  1B1Z A;  2NUC A;  2EE1 A;  4ZAI A;  2XRS D;  2G9D A;  2F4I A;  3EA6 A;  2B2T A;  3Q0A A;  1DON A;  4N9P A;  2C9O A;  2EYF A;  3DMU A;  4J8Q A;  3VYR A;  3G6J B;  2F0I A;  2EXZ A;  1D1I A;  3FMC A;  3URY A;  4FYD A;  2F0D A;  1G2T A;  1L0X B;  1A2U A;  5EGT A;  1MSH A;  4RCN A;  1UUP A;  5C3W A;  3TN2 A;  1KLG D;  2C5C A;  1JOO A;  2A69 C;  4H7B A;  1ENA A;  3M85 A;  4KV6 A;  3A54 A;  3BG3 A;  1SNQ A;  3CQZ B;  3Q22 A;  3HOU B;  3ND8 A;  1EY0 A;  5K36 H;  2F1M A;  5J39 A;  1MSG A;  4RA8 A;  1DZ1 A;  1Z47 A;  5C0X H;  2QDB A;  5IIF A;  3VR2 A;  1PXU A;  1CZW A;  5I2Y A;  4AYB B;  1RHP A;  5EPL A;  1ESF A;  2K5W A;  3J7A F;  1E2Z A;  2OXP A;  2AUJ D;  3KLS A;  3G7L A;  3R93 A;  2JXM B;  4RGM A;  5ELF A;  4IN3 A;  5A35 A;  2R61 A;  1AN8 A;  3HOX B;  3GTK B;  1OO9 B;  2NN6 I;  2WKC A;  2OF1 A;  4RKL A;  2RKS A;  1TS2 A;  1MI2 A;  2NTT A;  4DFA A;  1SYF A;  2MP1 A;  5IT9 L;  4KD4 A;  3HOV B;  4C1N I;  2L12 A;  4ZQ3 A;  3OIQ A;  3TBI B;  2LKV A;  3S2D B;  5TSS A;  3S14 B;  3U9O A;  1O80 A;  2EJF C;  4HMJ A;  4TSS A;  5M5X B;  1GHJ A;  1A3V A;  3KK7 A;  4XDX A;  5JVH 3;  5EKL A;  2F0K A;  1I4P A;  1BBX C;  2I07 B;  2K32 A;  3PUY A;  4G7H C;  5I9O A;  2MPM A;  2KEE A;  3K7A B;  1DOK A;  2CHB D;  1PTO B;  2M00 A;  5BN4 A;  3D8G A;  3HOW B;  4O42 A;  4DAP A;  2B8G A;  4BA2 I;  1OXV A;  4A3M B;  3N6R A;  3A55 A;  2IT1 A;  1WTO A;  2TSS A;  3VA5 A;  3HZX A;  4NMZ A;  1E2V A;  4V19 0;  1STE A;  3S9W A;  1K83 B;  4QF4 A;  4C3H B;  3KUP A;  3R2I A;  1EY9 A;  4G7O C;  4IUP A;  3I91 A;  1LT5 D;  4R8I A;  3LX0 A;  4MIU A;  2PYK A;  2Z8L A;  4KD3 A;  3N52 A;  1LTR D;  4FXG C;  5HGT A;  4FF3 A;  1Q90 A;  4KN7 C;  4PQX A;  1CTM A;  3MAQ A;  4RFB A;  4DAV A;  3DEP A;  1R9T B;  3R2T A;  3HKZ B;  1HA6 A;  2PPB C;  3X3N A;  1KNA A;  4HN7 A;  1G2S A;  3M7N A;  2NVY B;  3BZD B;  1STN A;  1HRJ A;  1SDF A;  2HCC A;  2ICI A;  3RZO B;  3BYY B;  4F7X A;  1ML0 D;  4DNT B;  5M5Y B;  3DEO A;  3S1M B;  1BCP B;  1OXT A;  3PO3 B;  2O2L D;  3IFT A;  4PV1 C;  4IUN A;  1DYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...