3TZDA

Crystal structure of the complex of human chromobox homolog 3 (cbx3)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
58
structure length
58
Chain Sequence
LYFQGEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the chromodomain of Cbx3 bound to methylated peptides from histone h1 and G9a.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna binding protein
molecule keywords Chromobox protein homolog 3
total genus 12
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2011-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3tzdA00
1IKMA 2Q8RE 4ZKBB 2X6LA 2L1BA 1U4RA 1MGSA 1U4MA 1U4LA 2Q8TA 1JICA 1RHPA 2L4NA 4ZAIA 1MSHA 3MTSA 4CJ1B 1HUNA 1XYIA 3MWYW 1BNZA 2B2VC 1AZQA 4XDXA 2FFKB 4CJ2C 1WTXA 2FJ2A 1F9PA 1KNAA 5E4WC 1Q3LA 5EPLA 1PFBA 1RJTA 1HA6A 2K1BA 2HCCA 1J9OA 1MI2A 1DZ1A 5EKIA 2MPMA 2XIWA 3GV6A 5T1IA 4R8IA 1CA5A 1E0BA 1O7YA 3P7JA 3KUPA 4IUTA 3TZDA 3SVMA 5COYA 1QE6A 2BDNA 1EOTA 1PDQA 2B2YA 2B2TC 1QG7A 3FPUB 3I3CA 1AZPA 1MSGA 1ILQA 2KUMA 2X69A 2RSOA 1VMPA 5EPKA 1NAPA 1EIHA 1G2SA 5T1GA 1IKLA 1BO0A 2MP1A 2N55A 5DNFA 1U4PA 2L12A 3R93A 2L9HA 4IUPA 1TVXA 2EOTA 1SSOA 3F2UA 4QUCA 1WVLA 1JE4A 2JYOA 2NWGA 3DM1A 4IUVA 1WTOA 2HDLA 1DOLA 4RAUC 5EQ0A 2RSNA 4RWSC 4OIJA 1DONA 1VMCA 1BBXC 1EIGA 2K05A 4ZK9B 1WTRA 1G91A 2H1EA 1NCVA 2M2LA 1F9QA 1LV9A 3D6WA 1GUWA 3ONAB 4MN3A 2K03A 1F2LA 3Q6SA 5CORA 1XX8A 2RA4A 5AFWA 1WD1A 5EJWA 1PLFA 4RA8A 5CBAE 2KOLA 4UAIA 4HAEA 1NR2A 5CMDA 4OIKA 2DY7A 4HSVA 1RTOA 2KVMA 5CBEE 1SAPA 2B2WC 4R9WA 2B2YC 2B2TA 1ML0D 4IUQA 2KEDA 1EL0A 3I90A 2N88A 1EQTA 1WD0A 1SDFA 1O80A 2NZ1D 3QO2A 2FHTA 3IFDA 3FDTA 1HRJA 1G2TA 2RVLA 3I91A 1A15A 2HDMA 1ILPA 1B4OA 2L11A 2DY8A 2CVRA 1RODA 2B2UC 1J8IA 3I8ZA 3KBXA 4U68A 4X3TA 1B3AA 1DOMA 1HUMA 2K01A 5D14A 5JJZA 2FMMA 2J7ZA 4XT3B 4DN4M 4HEDA 1QNKA 4X3SA 3UI2A 1ZXTA 5D65A 4MHEA 2FINB 2K28A 4X3UA 4IURA 1B53A 2D9UA 2SDFA 1NR4A 3HP3A 1X3PA 5EPJA 1M8AA 3DEOA 1WTVA 1PFNA 2B2VA 2EE1A 2K04A 4NW2A 2MGSA 2EPBA 4ZLTF 1HHVA 1O7ZA 2B2WA 5E4XA 2HCIA 4QUFA 1WTPA 3IL8A 4XT1B 4IUUA 1DOKA 2R3ZA 1BF4A 1CM9A 1HFNA 1IL8A 2X6GA 4ZKCB 1B2TA 1B50A 2MJ8A 1F9RA 2KECA 4LMQD 1C8CA 2HUGA 4O42A 1G6ZA 1HFGA 1X3QA 2IL8A 3TN2A 1S4ZA 2NYZD 1RTNA 3N52A 2B2UA 1WTWA 1X32A 1WTQA 1AP0A 1CA6A 4CJ0B 3G7LA 3H91A 2JP1A 1F9SA 3LWEA 2KEEA 4HCSA 3GV3A 2VXWA 1ESRA 1ICWA 3DEPA 1KNEA 4X3KA 1PFMA
chains in the Genus database with same CATH superfamily
5JEAJ 1IKMA 2F1MA 2ICEC 3CAMA 3M4QA 2A6HD 3BVZA 2EXDA 5FJ8H 2NN6I 1C7YA 1TY2A 3I4NG 3RLOA 2O5JC 2F0NA 3T56B 3CC4A 4XQQA 3J80L 4WFN3 3I56A 4H02A 3M4OB 2JA5G 2XIWA 3WOFA 2VUMB 3A8KE 3KYHC 4Y52H 4LK1C 5KRUA 2JA8H 2MQHA 1NAPA 2N8NA 2RBMA 3ITPA 4KD3A 4H13C 5DNFA 4DV5Q 1A62A 1FL0A 1KDBA 2O5IC 3MXNB 4JBMA 1U0LA 5EQ0A 2EJFC 3CU7A 1TWAB 3CC7A 2H1EA 2A6ED 4MTKA 3SE0A 2A68C 5IP9G 5KNDA 1CZWA 2PPBC 4V0BA 2HQEA 1TWHB 3I4MB 2JA7B 3NHHA 4UHVA 2B2WC 1GD7A 1WFQA 4KKUA 4JI5L 1Q82C 3I90A 2NN6H 3E9HA 1O80A 3NTHA 2RVLA 3KOJA 2E74C 3CMEA 2RHSB 3K5OA 3G6EA 2F0OA 4RH6A 3S24A 2AKWB 2I0QA 1I4PA 3S2DB 4GOPA 4DN4M 4FXKC 3S1MH 2WKCA 4MTNA 4G7OC 4IURA 2LSSA 3VYRA 2OQ0A 3PQIA 4OXPA 5EAYA 1V1PB 2K04A 2FXQA 3CW2C 3AU7A 1QCBD 5M3FG 1JT8A 1D5MC 1XMQL 4DAPA 2PCFB 4HIMA 4RMFA 2L15A 2IW3A 2PQEA 1HNXL 3HKZE 4B3SL 5FLMH 4MIUA 1LTBD 2B2UA 5IIFA 4CJ0B 3G7LA 1SJED 2D0OA 2OQKA 1HZCA 3CXCA 4DV0L 1ICWA 4JI7L 1PFMA 4A3JB 1NE3A 4O0AA 2E2DC 1LLRD 5HURA 1J6QA 2IJ0A 2I07B 5G3LD 4CJ1B 3HOZB 4CKCA 1IBLQ 3MWYW 1CQVA 4NP5A 1WTXA 5C4JH 3IRBA 3A7LA 1YBYA 2J0TD 1N34Q 1EY5A 1UE1A 4LF8L 1M4VA 1STNA 3H3VI 2BDNA 2NVTB 2AMCB 4KD4A 5C3EB 1JC7A 2KCCA 2D0PA 4UY8C 1I5FA 4JW0A 3F2UA 3PUWA 3UDXA 2F0EA 3U4VA 3M4OH 4RWSC 2BCOA 3I4OA 1G8ZD 1B3QA 1T5XD 5C0XI 4DR7Q 3MVVA 2TMPA 1HNZQ 3OIQA 2GN5A 5EJWA 3EVQA 4BBRH 1RF2D 1B9NA 1I4QA 2K14A 2F4VQ 1CZGA 3ERSX 1JOOA 4TKOB 1YHQA 1T9HA 4KK7A 3CCRA 2CWPA 2AUJD 3K7AB 1SBBB 2A69D 1I6HH 3I2ZA 3IFDA 2D62A 3KDFA 5M5XH 4NXNL 3T4AC 3BDOA 3U9SA 2VS1A 1GUNA 4DR7L 4C3HG 3CKIB 3I8ZA 2ZJRA 3NPPA 4IUNA 4F8MA 3RZOB 1VQKA 2UU9Q 1KTKA 2FMMA 4FF1A 3GTJH 1MKHA 4LFAQ 1KLGD 2PMZE 4X3UA 4A3EG 2K5DA 2HHHL 4DV4Q 2NVXH 3QIAA 4A76A 5IE8A 4DNRB 1VQ5A 1YNNC 1UE5A 4FO2A 3ER0A 3S1RB 1HA5A 3I73A 5J3BA 4GNXB 2EY5A 1B8AA 2EIFA 1BCPF 3VYTA 4JI5Q 4A3IH 4NXMQ 5GQOA 2IWHA 5K36G 5JEAG 2VZAA 5CC4A 3S17B 4L5RC 3NP8A 1WTWA 1LTSD 2UUBL 3HGBA 3JAML 4QB4A 5C44G 4OO1G 5C0XJ 4RGOS 4P2CB 2VL6A 5J1ZA 3J80c 4P73A 2PO4A 4A4IA 1F2ZA 1EOVA 2MUYA 3I72A 3X3MA 4LUVA 1I4RA 1Q3LA 3H6MA 1FNVA 1VQGA 3P75A 1RJTA 1TS4A 3LGJA 4X64L 3NK9A 4HIOA 1TIID 5T1IA 3GV6A 4XYQA 3KUPA 4JI6Q 3MXGA 4FXGC 5JJIA 3NQTA 3HOUH 1ZYRC 2WAQB 1CK1A 5GAEC 1I4XA 1XTCD 2EYJA 2BDOA 3R93A 1SYBA 1XMOQ 1EYDA 1VQBA 4IUVA 2A5HA 5IGCA 4HR7B 3PO3B 2E2IB 3VA5A 1EIGA 5C44B 2YTYA 4IPDA 1A8VA 4MN3A 3Q23A 4HMJA 4XYOA 2K4KA 2VQFQ 5C4HA 4GLVB 1ASYA 3FMCA 1NR2A 3CRKC 4CDDC 1V1OA 5CMDA 3SEBA 3IAYA 1I4HA 2ICIA 1YNJC 3DM3A 1XMOL 5IGBA 4JC0A 3E5SA 3QO2A 3MZ5A 3FDTA 4KMUC 1ET9A 1SRUA 1WCMB 5IP7G 4DAVA 3W5OA 4UP8A 2ATWA 2B2UC 2UUCL 2AHOB 5JJZA 4LWCA 2J7ZA 2RDFA 1K0RA 2KQ3A 3K7AH 1PH4A 3FKIB 1RKNA 3L2PA 2QDLA 1LT5D 1Q1BA 4L8JA 2MGSA 3M4YA 1FNUA 4P74A 4EVOA 3Q24A 4K5XA 3AB9A 1C9OA 4N9TA 4TRDA 1BVSA 1CI3M 4IUUA 4O2DA 2PNHA 3PSIA 2OCEA 2CFMA 1H9JA 3HOUG 3HZXA 4EQNA 1QB5D 5ELDA 2OTJA 4DV5L 1WTQA 5CYUA 3PCOB 1Q46A 1X32A 3IFTA 3H3VC 4IPHA 1B1ZA 3FEWX 4HJ7A 2RQXA 3BYYB 2YU9B 2NZHA 3PUZA 4IPCA 1EFID 1D1IA 2DGYA 3J7AV 2D5DA 2AWOA 2K5QA 1U4RA 1A3TA 1IYJB 1E1OA 3MTSA 4A3KG 2EJMA 1TWAH 4ALPA 1XYIA 4JV5L 1A6XA 1FR3A 4XDXA 2FJ2A 4F87A 1XNQL 1N32Q 2ZXOA 4N9PA 3AFPA 2VUMG 3LNNA 1KIXA 3T1HQ 4R8IA 4JI6L 1E0BA 2Q8IB 3SVMA 4IFDH 2LKVA 1YVCA 2B2YA 4JI8Q 1NY4A 1KAWA 3TP5A 4BWGB 5M5YH 1Y1VB 1S5ED 3I4MH 1AN8A 5T1GA 3SK5A 2F3VA 4DR1L 2DUDA 3GTOB 4KHPL 5LL6S 3K59A 3PGZA 4GN5A 4ZUIA 4RFBA 3V2TA 1DOLA 4QIWB 2VB3X 1A0IA 2CW0D 3AMUA 1YNJD 4B3ML 5KNBA 3EA6A 1S5CD 2JA8G 4N8FA 2QW7A 1OXUA 1K8AC 3M7NA 1N33Q 1TU2B 3U50C 5IT9L 1JWUD 4GKKL 4A3CG 1D8LA 2WB1E 1JWMD 1RIPA 1KD1C 4JYAL 3ERQA 3PIOA 3HOWB 3DHQA 4AQYL 3FPPA 3STBC 1MJCA 1YITA 3HKZG 1SNMA 3LX0A 1JMCA 1N34L 2R7DA 2F0LA 3D3RA 3QWNA 3CCEA 2K28A 4HJ9A 1QVCA 3TREA 2D9UA 5EBDA 2SDFA 1FJGL 3BG3A 4R8NA 1X3PA 2A73B 1YJWA 4LFBQ 1H9SB 4PZ8A 3S15H 5C4JB 3GTMH 1I3QH 1PRTD 1SMYD 1B50A 5CV9A 4G7ZC 2R92G 1MHWC 2HUGA 3OW2A 4B3SQ 3V96A 1E24A 3A7AB 3TP6A 1JE5A 1IW7D 3I4LA 3K5LA 1F9SA 2LS01 2WAQE 3KF8A 1R9TH 2CQOA 5ELEA 3CCQA 1YI2A 3C2PA 1EWHA 1MGSA 5BR8Q 4M1UB 4IFDG 4UP7A 3KDFB 3Q8DA 1OXSC 3CCUA 1YJ9A 4A3LH 1PH7A 5I2XA 4K0KQ 5HGQA 4NPSA 1EY7A 2EYHA 2ZTCA 4JBKA 1MI2A 5EKIA 1QILA 1C4QA 3GTPH 1PV4A 1JORA 1RCVD 4C56C 4K6DA 1K83B 4A3KH 4BBRB 1OO9B 1DJRD 4A3MB 3F1ZA 2ZT9C 5CR3A 3PO3G 4OWTB 1E7ZA 1EQRA 4QY7A 4DKAC 2JEAI 1MBYA 2QDBA 1I6HB 3H15A 4B9XA 4KKTA 2F0MA 2N55A 5IWAQ 1EL0A 5E1FA 1PTOF 3PUVA 4KN7C 4IUPA 2EOTA 4IN3A 2UU9L 2Z9HA 3M3YB 1JE4A 1R9TB 1VQ8A 2IX0A 5JOBA 1EQQA 1NCVA 2RKSA 4RKBA 1V43A 2B8GA 2DN8A 5FLXL 4S3SA 5BN4A 4YY3Q 1ICFB 5CBAE 3TP7A 4LFCQ 3FVQA 5M5YB 3RNUA 1TWGH 1EWIA 5C5LA 1HZBA 1P8LA 2I5HA 1D1KA 4EQ5A 4DR2Q 2V4DA 4R9WA 2XSCA 5ELOA 1VQJA 2VNUD 1HQRD 4EQOA 1Y8PB 4JK1C 4B3TQ 4PMWA 4DPGA 2Y0SB 3GTLB 4RCOA 4A3CH 1PZKD 1MIUA 2PNRC 1EIYB 1PYWD 2QF7A 3D4RA 5C4XB 1GHJA 4KY6A 4LF5Q 1KRSA 1TT2A 2XRSD 2P5ZX 1UEAB 1I3QB 1LT6D 3OPOA 5D3DA 2WKDA 2UUBQ 4K6LA 1VQMA 4A3MG 2YYZA 4DR4Q 2LMCB 1V1PA 4LMQD 3H0GG 4KV6A 4RKLA 4LAAA 1HFGA 3TN2A 3MXPA 4XIGS 1RL2A 2EJGC 4BY7H 3D31A 3CD6A 4B9WA 1Q8KA 4DV3L 1UE7A 3T1YQ 3HOZH 2RCFA 2X6LA 3EJIA 1BCPC 2ENBA 3HKSA 3MFYA 4J1MA 2EY6A 1Y1VG 3KLRA 2GVAA 3SK4A 3STBD 3GTGB 1NMFA 4L5SA 4LF9L 3EBEA 2DNCA 4UDUC 1K8OA 1QG7A 1HCZA 2PW5A 1L1OC 4R4IA 4BY1G 3CCMA 1A3VA 1AW7A 4AYBB 4DXFA 4IZ8A 3K7UC 1QOHA 4BY7G 3ICEA 4JV5Q 5ELBA 4DF7A 1QZGA 1SR3A 4DR3Q 1GUWA 1VQAA 2PZTA 3ONAB 4X66L 4LF6L 1D7QA 4DAYB 3E0JA 1PTOH 4JYAQ 3R2IA 2WB1B 4NKLA 2F3WA 1EY4A 4HSVA 2ALYB 2F0TA 2F0UA 1SAPA 4DV1Q 3G4SA 4JI0Q 3ZYYX 3RMHA 4YY3L 4RG1A 2O4XA 4JOIA 1CFMA 4Z9CB 3S1NH 1HZ9A 4WORA 1VF7A 1EY9A 4C3JH 3WWVA 1SN8A 2B29A 1Y1WG 1ZXTA 2E8GA 4UP9A 5LMNQ 1B53A 3J7YW 3WDNA 3HOVH 3Q22A 2JK8A 3W1GA 2GA4B 1O7ZA 1X3FA 2XRQD 4Y7NB 1R4QB 5E4XA 3KK7A 2QKIC 1K8MA 5FKAC 3FP9A 3RR5A 4K0KL 1PMRA 1K0SA 5C0XH 3F2CA 2KECA 1XXGA 3HOUB 3H3VH 3S2DH 1RTNA 4LFAL 5C5MA 2ZJPA 4OWXB 3EROA 1JQYD 1IW7C 4L5TA 3TBIB 5IYDG 5I9PA 3MEFA 1CHQD 1IHZA 5IOCA 1GXDC 3VYSA 2NUCA 4DAMA 4X62Q 2SNSA 4V190 1RHPA 3HOVB 1H9KA 4KHVA 2FFKB 2IY5B 1IBKL 5EGTA 2UXBL 2NZOA 3J80E 1HA6A 1BCPB 2A19A 4DK6C 1ENFA 1SYDA 3VYUA 5IP9H 1SYEA 1PZJD 3NWTA 4APVA 1IXRA 3K81C 3OTOQ 1MSGA 1VMPA 1Y8OB 1X55A 2A69C 3HS0C 1YHBA 2QEXA 1EU4A 3OW7A 4HJ5A 2NVQB 2ZM6L 4IJHA 3A0JA 2K5HA 1SFOB 1WTOA 1IBKQ 1L1OB 1GJXA 2RSNA 4CGYB 1BBXC 2K05A 1G91A 2M2LA 1DM0B 1W6KA 4RGTA 3JAME 3K5NA 4F88A 2RA4A 1SNOA 4OEMB 1WOCA 4KY7A 4RA8A 2RDHA 5TSSA 1STGA 1EUJA 2VY3A 4C3HH 4DK0A 5A2QE 4BY1H 4A93G 3J7ZC 2JA6H 1SDFA 4JI1L 4XQJA 1E2WA 4Q0FA 3I91A 4K14A 2UXDL 3GQBA 2JA8B 3K0YA 4B3RL 4MZ9A 1R4PB 4ILWA 4OX9L 3CQZB 1O78A 2F0IA 1YEZA 2CWAA 5CV5A 2PI2E 1HH2P 4X66Q 4LF6Q 4A93H 3HOXG 1WTVA 4HJAA 4FP5D 4GN3B 1UUPA 2B2WA 3PMFA 4QUFA 1S3OA 1SE2A 4B3TL 1D6EC 3CCVA 1HFNA 3QR8A 1EEFD 1F9RA 1CKOA 1Y69U 4DXGA 4NDXA 3EN2A 2R92B 4LFCL 2NYZD 4A3MH 2Z6KC 2F4VL 4HCSA 2VXWA 3A8IE 1KHIA 3EQLC 3VDYA 3S1RH 4XXEA 2VQFL 2OTLA 5J39A 1JICA 1HUNA 2AWNA 2CH4A 1I6VC 2B2VC 1AZQA 5C4XH 5BN5A 1SE4A 2XN9C 4POFA 1J9OA 1K3BC 5CV4A 1BXTA 3KBGA 4LUZA 3BU2A 5I6YA 1D5XC 3V05A 5JVH3 1EZ8A 2JA9A 4GNXC 1TXYA 4LF5L 2A1AA 2X69A 1GO3E 2HHHQ 2R92H 1QJOA 4X65Q 3DXJC 1VQCA 4HTHA 5LL6X 2ZM6Q 2NBFA 2BE5D 4A3KB 2NB0A 3PF4A 2Z0SA 2IPKD 3K57A 1IBLL 1SNQA 3MXNA 4EX5A 2QEJC 4PQXA 1DYQA 3D6WA 1KRTA 2BA0A 3MA2B 1I4GA 1LTTD 2N49A 2MFIA 3ND9A 2B63G 2OEOA 4X6AH 4EQPA 1OXTA 4P72A 1HNWQ 3HOVG 1TS2A 1ML0D 2E2IH 3PO3H 1X9NA 2NZ1D 3PO2B 3A54A 4JPBW 3NUCA 2WB1G 2NVTH 4FXDA 3D4WA 3VR3A 1LT4D 3P20A 1LO5D 5GROA 4A75A 1B3AA 5C4XG 2I5LX 1NUCA 4WJ4A 1K28A 4L63B 2IT1A 4DUYQ 5D65A 2K5WA 4KY5A 5KNCA 3GDEA 3VA7A 1HZAA 3T53B 3H0GH 4IALA 4DNTB 5JAVA 3TP8A 2HIVA 3KLWA 1PA6A 1E22A 2WAQG 1M8AA 1HRJA 1HHVA 1A2UA 4K8JA 4ZUJA 4I7ZC 4AQYQ 4WJ3M 2SNMA 1KDAA 2CQAA 4N8X1 5CV8A 4ZKCB 3A5UA 1B2TA 3K6OA 1UE6A 4ZCKA 2K5VA 4YCUA 4QGUA 1X3QA 3I70A 3D0FA 2UXCL 3SDZA 4BA2I 2QILA 1CUKA 5EKKA 1JB7A 1UNSA 3BDCA 1JJ2A 4B3MQ 5M5XB 4EGVA 4JBWA 4DV3Q 2Q8RE 4OO1I 3R2TA 4H44C 1B44D 3ULJA 2E2HB 2NVYB 4GS3A 5NUCA 3J7AF 1KABA 3KF6B 3PIO3 1Q12A 4J6HA 2JA7G 2K5NA 3DUZA 1JJGA 2JA7H 1LM0A 2VW9A 1I94L 1JOKA 5C6AA 3TZDA 5COYA 5F2DA 3J81i 2B2TC 3QOLA 4ID6A 3NWSA 3F2DA 1SNDA 2C9OA 5C0XG 1N32L 1EIHA 1PH2A 1CKNB 4GKJQ 1BO0A 2L9HA 3D4DA 1QWYA 1EIFA 4YWLA 4ZQ3A 2NWGA 3PUYA 2QGQA 5DM73 3KFUA 5HGTA 1CKMA 4JCVE 1ESFA 5BN3A 2XGTA 1BKBA 1LV9A 1W6JA 4A3IG 1U9RA 3KLSA 1F2LA 1TWGB 3I55A 4DV2L 1Y1WH 3BZKA 2UUAQ 5DM63 1K3RA 4KJOA 3BS1A 4GKKQ 4HCEA 3TS0A 3E6ZX 5I2YA 3L9AX 3OSOA 3GTKB 5A2QL 4DUZQ 2M9VA 2UXDQ 2KEDA 5M3MB 5M5WH 1LACA 1VQPA 1VS0A 5EKLA 2EQSA 4ODGA 3BVMA 4K2KA 1ZEQX 4BA1I 1FVIA 3U4ZA 4C3IB 1B4OA 4FF2A 2BH2A 4X3TA 2A6EC 5J22A 1HUMA 3K58A 1KLUD 4BXXH 2PQAA 4DV7L 3EFXD 2JJQA 3W1BA 2E75C 1EU3A 1XNRQ 2EY1A 1TWCB 3MEHA 3J80i 3T51B 2EYLA 1PFNA 2B2VA 5HY6A 5IYDH 2JEBI 2GVBA 3GTQH 4A3FG 1XNQQ 1DOKA 1CM9A 1IL8A 1ET6A 4FF4A 4DR6Q 4ABNA 3NTKA 5L37A 4A3FH 3CHBD 3MAQA 3UE1A 1PH6A 5M9OA 4DV7Q 4OGQC 1Z47A 4A3BH 1SNCA 5IODA 2NTSA 1Q90A 1KNEA 2CW0C 2KCTA 4A3BB 1IBMQ 1TS3A 3GTMB 2NTTA 1M1KC 2F0PA 2L4NA 3S9WA 2A74C 4KI0A 4QIWE 1PTOB 2D2CC 3KJOA 4GN4B 4DGZA 4O1NA 1Z9FA 2XVSA 2R93B 5C44H 2K1BA 4RHRA 1PH3A 3K8AA 5IGFA 2J4XA 4Q5VA 5E7NA 4HN7A 2R93H 1AE2A 1VQ7A 1ZKOA 1EY0A 1PDQA 3D6CA 3RLNA 3UE0A 1AZPA 3J7A5 2F03A 4BS9A 2Y0SE 1G2SA 4QF4A 3TDQA 3T1HL 3I4NB 3W3AA 2DNEA 1K9MC 2JA6B 2HDLA 3A56A 2B3GA 3OYYA 2AQ1B 2AUKA 5IGDA 2JN4A 5CORA 1BR9A 5AFWA 1D5ZC 1KXLA 4CBVA 4HAEA 1BBUA 4YHHL 1DD2A 1P16A 4OIKA 1YNXA 3HOXH 3DLLA 4R4TA 1JWSD 3DWQA 2B2YC 2A68D 3CP0A 4PNYA 2KA7A 3URYA 2F0JA 4DV0Q 1A15A 2HDMA 1GUGA 3T1YL 5C4ZA 1KQSA 1GM5A 2NVYH 3U9OA 4LF7Q 2WV6D 3RZDH 1Y1VH 4U68A 3CCLA 3PV0A 2RF4A 1KDCA 2KJXA 3NBHA 1GUOA 1A3UA 2JA6G 2BH8A 4DU9A 2NN6G 1K73C 2IHEA 4H7BA 2KCNA 4DR1Q 3NEMA 1AE3A 5EPJA 1OTCA 5BR8L 1X3EA 4NW2A 4LNQA 3NBIA 2XWJB 5M3MH 5M5WB 3L3OC 1A2TA 1HPCA 5JEAH 2LY7A 3RN5A 1SYCA 4QMGA 5IGGA 2F0DA 5G3LF 1X54A 3M85A 1IYVA 1Q8IA 4DA2A 4DV2Q 2OWOA 1D2BA 2JP1A 1B9MA 3HKZB 2IX1A 3BVGA 1TWFB 4BBSB 4FVMA 3UDGA 4A3LG 2R7ZB 4UPAA 1CT1D 3T13A 4CHTB 4ME3A 2Q8TA 3S1QB 4IJLA 4ZAIA 1MSHA 1B7YB 2Q2TA 4ULLA 2AQ2B 5AJ3Q 2NVXB 2YU9H 3M7GA 1DXMA 1F2MA 4GLAC 3GTOH 2R7FA 2KHIA 5JVG3 2CH4W 4JBJA 3AFQA 3TS2A 3CCJA 1PTOD 1GOZA 1VF5C 4AYBE 3P7JA 1WI5A 4B08A 1AEXA 2UXCQ 1XPOA 1EFWA 2Z4HA 1S5DD 1I94Q 2KHJA 5LHY1 1F77A 2RDGA 1SSOA 3A5ZB 4CKBA 1GUSA 2B63H 4NMZA 4DR4L 1LYLA 5C3EG 4JI7Q 3HEJA 3ULLA 1QUQB 2YV5A 4E6IA 2K03A 3Q6SA 4AH6A 1SROA 3CPFA 4J8QA 5DEHA 3DWPA 1H95A 3E3XA 4JI0L 2JSOA 3SXHA 4A3FB 5A35A 2B39A 3N6RA 4IUQA 2N88A 5JJKA 4F7XA 2ZJQA 1N36Q 3C46A 1E3PA 5C3WA 2C35B 4A3DB 3A55A 3OMGA 3B6YA 2F52A 1GKHA 5I6WA 2NVQH 2L11A 4JI3Q 2CVRA 3KBXA 4A3EB 3FKIG 2JA5B 4I7AA 1W3SA 3VR2A 1VCIA 1PZID 3UI2A 1JOQA 3FRPB 1STYA 1N8RC 1NR4A 1IBML 1WCMG 1Y14B 1KAAA 5DLQE 1GUTA 4GKJL 3CQZH 1HNZL 4TQUS 1XJVA 2K50A 1MD2D 2F0WA 1PVOA 3PO2G 3S1NB 2EY2A 4LFBL 1KL9A 1V9PA 5FOBB 1C0AA 5FO8B 4DV6Q 3D8GA 3UDFA 2DJFC 3W2DA 3I4MG 1Q86C 3SK8A 1TR5A 4IFDI 3X3NA 1KC8C 5KIXA 2E76C 3MC0B 3H09A 1BDOA 2JA5H 3GV3A 3RLFA 3M9BA 1SLJA 4KKSA 2HD3A 1XNRL 2F0SA 1VDZA 1PFSA 4IPGA 3TZUA 1U4MA 4LF9Q 2XTIA 5KYIA 3G71A 3WOEA 1BNZA 4GLXA 5ELCA 3S1MB 1WTHA 1OXXK 2EYFA 2EXZA 5IWAL 4R4CA 2BA1A 2CCZA 4YHHQ 2PI2A 3AQQA 5GAHC 2YTVA 4OL7A 3J81E 4YCWA 2KCMA 5M3FB 2F0QA 4DV4L 3C3LA 1G6PA 4IQZA 2IHFA 1IKLA 1QUQA 1PYSB 2G9HD 4FNFA 1U4PA 1TVXA 2R7ZH 2UUAL 2K75A 5IYCH 1XPRA 3NELA 1MJEA 5K36H 5FK9C 1VQ4A 4QCLA 4C1NI 3PIP3 3OMCA 3L0OA 4UAIA 4G4KA 3TEHB 4CDEC 3F8TA 2JXMB 2KVMA 5EBCA 1GVPA 1HQMC 4DR2L 4AIMA 3S2HH 2RCNA 3ND8A 3F2BA 4H0LC 2EZVA 2E2JB 2F0GA 5GAGC 1VQLA 1RODA 2K7VA 1DOMA 1BUVT 1PRTC 5FO7B 2WP8J 4C1NK 4X64Q 3EIVA 4KJNA 4LF4Q 3H94A 2MHVA 3H0GB 4HEDA 3I4NH 3SGIA 1PTOC 3L7ZC 3S14B 4K5WA 3DMUA 5FLMG 4K2LA 3PF5A 1O7LA 4DR6L 4LJZC 1SNPA 1YZ6A 1E1TA 2OXPA 4DR5Q 2UUCQ 4JI4L 2LFNA 3DWAA 1A63A 4LF8Q 4BBRG 2QCPX 1NTGA 4A3JH 3SK6A 1BF4A 4MNOA 2EYPA 1L2FA 1WCMH 1HR0L 4P71A 1Q1EA 3N52A 4PV1C 3HFZB 2ZXPA 3OTOL 1BCPD 5I9OA 4OONA 5CV7A 4OHJA 4A3GH 1UWVA 2F0FA 1SJHD 2YTXA 2VQEQ 1V8QA 1M90C 4CJ2C 4A3GB 1KNAA 4BY1B 5E4WC 1N9WA 1ASZA 1O7IA 2Z8LA 4DV1L 3CF5A 2EYMA 2HCCA 5ELNA 4DK1A 1YJNA 1O7YA 4PMCA 1QE6A 3FPUB 3PUXA 1I50H 4PG3A 4NXNQ 1SXTA 5EPKA 3TQYA 4A3DG 1LABA 1E2VA 4WJWA 4YWMA 3HOXB 1I50B 3GTLH 1DGSA 4A93B 3NSWA 2IX3A 2JYOA 2B8FA 2F0VA 1VMCA 4JI3L 1WYDA 4C2MH 4B3RQ 1DCZA 1H9MA 1N36L 2KOLA 2C5CA 3I7FA 5M3FH 4DFAA 3G48A 5IYBH 1HJPA 1LTGD 2DY7A 1XPUA 1VQ6A 1X56A 4G57A 4OWWB 1K83H 2ZTEA 4Y7NH 1QZHA 4IOCA 3NQIA 3JC66 4K5VA 2N78A 3S14H 2DY8A 4LF7L 1FD7D 4JI1Q 3NE5B 4JVZA 4G7HC 4PMBA 1QNKA 2Z4IA 1QNUA 4A3GG 1VQDA 2Q2HA 4DAYA 1Z6HA 3S16H 4FYDA 5LMNL 3CPWA 4NXML 3QJYA 4TVAB 1X6OA 1ENCA 2Y0SG 3HOZG 1FGUA 2KHSA 1J5EL 4FDBA 1T5EA 2E2JH 2EE1A 3S2HB 3GTGH 4GZYC 2Z1CA 3GTKH 5M3MG 4YWKA 3J81L 3S1QH 1NJIC 1RDPD 3OWFA 2X6GA 1XTDA 3G6JB 1C8CA 4O42A 1YIJA 2RHQB 2FMCA 2IL8A 1FNWA 3M4PA 4QJFA 1S4ZA 1AP0A 1CA6A 1HXYD 2PQAB 3KF8B 3DEPA 5CGKA 5LMUL 2DJGC 4RCNA 2MO1A 4ZYSA 2L55A 4A3EH 5LMNW 2Q2UA 4R4QA 3AYHB 4JI2L 1HTPA 1SMXA 1X65A 2A8VA 1BOSA 2WFWA 1PHJA 1JCKB 5EPLA 1SMYC 1N33L 4HMIA 4PZ7A 2K52A 4JI4Q 2QA4A 5IYBG 2K6AA 1CQFA 1CA5A 2V1CC 3QB3A 5E3FA 3I3CA 1F2YA 2R61A 3HOYB 2Z6KA 1ZYRD 2E2HH 2L12A 3RD4A 3SHLA 1TS5A 1SEBD 1VQIA 4AYBG 1Y1WB 2HIXA 5IT9c 3T16A 1YHAA 2N3SA 2G5DA 1F9QA 2L0CA 2KBNA 3FHWA 4A3DH 1EEID 4P75A 1Q81C 3J81j 1WD1A 1PLFA 5IT9E 2R93G 4ME5A 4KHZA 5GADC 1RTOA 2F0HA 4L6TB 1L0WA 2F3IA 2PW7A 4DV6L 1II3A 1EYCA 4WRDA 4GNXA 1VQOA 1EQTA 4R1JA 5CV6A 1AFPA 2A6HC 4HIDA 2TSSA 2O2LD 2ZTDA 1Q7YC 5IP7H 2E5LL 1BQQT 3TMEA 4M8AA 4DR5L 1FGBD 1TWHH 3K80C 3NXWA 1HR0W 1YNND 5KGUA 3HP3A 1LTLA 4X62L 4A3JG 3E9IA 2EPBA 1IZ6A 5D3IB 4U673 1W2BA 1LTAD 5IGEA 1WTPA 3IL8A 2ID0A 3KLSX 1CKNA 1QVGA 1FJGQ 4KTAA 1G51A 1FYCA 4RGMA 4KLKA 3OIPA 1SYGA 2F0KA 1CSQA 1VQ9A 2OF1A 2HQLA 2WINB 1K8GA 4ZRZA 2VQEL 4IO9A 3PO2H 3S17H 4BXXG 3LWEA 1NSNS 1RD9D 3GP7A 3ZJYC 3RZOH 3VR5A 2CKZB 4DNIA 4NB3A 3VR4A 1VQNA 1V1QA 3R3OA 1WJJA 4YCVA 4ZKBB 5KYLA 3C1FA 2L1BA 3HOWG 3CCSA 1U4LA 4I65A 1EY8A 3OOCA 3MFGA 2EDGA 1OXVA 1UEBA 3JAMc 1S5BD 2R6GA 4X65L 1IL2A 3P1HA 2OT2A 1PFBA 1PXUA 2LXJA 2WIIB 4C3HB 5KEEA 4R4OA 3HRZC 4A3IB 4C3IG 3U58A 1ILQA 2KUMA 1L0XB 2RSOA 5DAUA 1B70B 1CHPD 3NTIA 4HSPA 3MXUA 3S16B 3BZCA 2JQOA 3E0EA 2MP1A 5ISRA 1H9SA 5AJ3L 3Q0AA 4QUCA 5FLXc 5IYCG 4IFDJ 1TWFH 2R7ZG 4BBSH 3IKJA 3KJPA 3CRLC 4ZK9B 1LT3D 1BBWA 3O13A 1PYBA 5C3EH 1XX8A 3GTQB 1L0YB 3ULPA 3TSSA 2F4IA 1LTID 4LUOA 4OX9Q 1SE8A 2B2TA 2H5XA 3QOJA 1CTMA 4FF3A 1PH1A 3A74A 4DK3C 4C3JB 1X3GA 1ONLA 3GTPB 3HG9A 3NENA 2VUMH 3C1EA 3JAMi 1JB3A 1ENAA 1PRTF 1SFOH 5D14A 3R8BA 1J5EQ 1NNXA 1C48A 3SR1A 4RGNA 4X3SA 4JG2A 5ELFA 5C3XA 2FINB 2PZUA 5FJ8G 5JPMC 1LUZA 1IYUA 4C2MB 2VB2X 2E5LQ 1H9RA 1LTRD 1CSPA 2HCIA 2LXKA 3BZDB 4XT1B 1UAPA 5I4DA 3GO5A 2MJ8A 1PH5A 1EYAA 3CC2A 1PH8A 1HR0Q 3J81c 1L1OA 3S15B 1QVFA 2M00A 4GOPC 2KEEA 4JI8L 1ESRA 2G9DA 2AQ3B 2BE5C 3GD7A 1SE3A 2ZXRA 1Y8NB 1EQVA 4C3IH 2ASBA 4KHPQ 3K0XA 1EWCA 4DUYL 4TSSA 1F9PA 3HOYG 4POGA 3OHXC 2CHBD 1DZ1A 2MPMA 4QQBX 1STAA 3KF6A 4JI2Q 3RZDB 2MO0A 3NBHB 4IUTA 1EOTA 3HOWH 1STEA 5K5PA 3GTJB 1GHKA 2ES2A 2UXBQ 3CMAA 5LMUQ 1HNWL 4RHSA 4XQNA 1DONA 2KENA 1SYFA 4JOIC 1WVLA 3QG1A 2XWBB 3DM1A 3AEVA 2SEBD 4RAUC 4CDCC 1XMQQ 4OIJA 4K8IA 1WTRA 2Q2IA 2PYKA 2MNAA 1TKWB 1PH9A 3TRZA 4YIJA 5JPNC 3A8JE 5FLXE 2I46A 3M3YH 4LW1A 1VQHA 1NMGA 3PIPA 2L5TA 4J15A 4C3JG 2SOBA 2K32A 1XWEA 3RUZA 5CBEE 1U5KA 3OWEB 2BOSA 1EYGA 1EZ6A 5FO9B 4HJ8A 3BYTB 4OELB 1PRTB 1VQFA 1WD0A 3LWUA 2FHTA 1G2TA 1E2ZA 1TWCH 1EY6A 1TY0A 2B63B 4IOAA 1ILPA 3FKIH 2PMZB 3BDLA 1S72A 1J8IA 3HOYH 2PZWA 3VR6A 3MHBA 2K01A 1G291 2K33A 4XT3B 1TQOA 4MHEA 2EYOA 3K5MA 4BY7B 4L5QA 1HTLD 2H4OA 4GOPB 4OO1H 3DEOA 1JR0D 4PZ6A 4ZLTF 2HT1A 5IY0A 2JE6I 1JJCB 4KN4C 4A3BG 4BBSG 2WACA 3RN2A 3BJUA 1VQEA 2EVBA 2R3ZA 4QL5A 4HIKA 1NBWA 1STHA 1STBA 3UDIA 1Z7TA 4DUZL 1G6ZA 1HNXQ 2XNAC 4LF4L 4CKEA 2I5MX 4CDFC 1S5FD 5JJLA 5H1SE 3H91A 1S40A 4XTCS 1AH9A 2Z6BA 4X3KA 4DR3L
chains in the Genus database with same CATH topology
5JEAJ 1IKMA 2F1MA 2ICEC 2A6HD 3BVZA 2NN6I 1TY2A 2O5JC 2F0NA 3T56B 4XQQA 3J80L 4WFN3 3M4OB 2XIWA 3WOFA 2VUMB 3A8KE 4LK1C 5KRUA 1NAPA 3ITPA 2RBMA 4KD3A 4H13C 5DNFA 1KDBA 2O5IC 5EQ0A 2EJFC 3CU7A 1TWAB 2H1EA 2A6ED 3SE0A 2A68C 5KNDA 1CZWA 2PPBC 4V0BA 2HQEA 1TWHB 3I4MB 2JA7B 3NHHA 2B2WC 4KKUA 3I90A 2NN6H 1O80A 3NTHA 2RVLA 2E74C 3K5OA 2F0OA 4RH6A 1I4PA 3S2DB 4DN4M 4FXKC 2WKCA 4G7OC 4IURA 3VYRA 1V1PB 2K04A 3AU7A 1QCBD 1D5MC 4DAPA 2PCFB 2IW3A 2PQEA 4MIUA 1LTBD 2B2UA 5IIFA 4CJ0B 3G7LA 1SJED 1ICWA 1PFMA 4A3JB 2E2DC 1LLRD 5HURA 5G3LD 2IJ0A 2I07B 4CJ1B 3HOZB 4CKCA 3MWYW 1CQVA 4NP5A 1WTXA 3A7LA 2J0TD 1EY5A 1M4VA 1STNA 2BDNA 2NVTB 4KD4A 5C3EB 1JC7A 2KCCA 3F2UA 3PUWA 2F0EA 4RWSC 2BCOA 1G8ZD 1T5XD 5C0XI 3MVVA 2TMPA 3OIQA 5EJWA 3EVQA 1RF2D 1B9NA 1I4QA 1CZGA 1JOOA 4TKOB 4KK7A 2AUJD 3K7AB 1SBBB 2A69D 3IFDA 2D62A 3T4AC 3BDOA 3U9SA 1GUNA 4C3HG 3CKIB 3I8ZA 3NPPA 4IUNA 4F8MA 3RZOB 1KTKA 2FMMA 4FF1A 1KLGD 4X3UA 2K5DA 3QIAA 4DNRB 1YNNC 4FO2A 3S1RB 1HA5A 3I73A 2EY5A 1BCPF 3VYTA 2IWHA 5K36G 5JEAG 5CC4A 3S17B 3NP8A 1WTWA 1LTSD 3HGBA 4QB4A 4OO1G 5C0XJ 4RGOS 4P2CB 5J1ZA 2PO4A 1F2ZA 2MUYA 3I72A 3X3MA 1I4RA 1Q3LA 3H6MA 1FNVA 3P75A 1RJTA 1TS4A 3NK9A 1TIID 5T1IA 3GV6A 4XYQA 3KUPA 3MXGA 4FXGC 3NQTA 1ZYRC 2WAQB 1CK1A 1I4XA 1XTCD 2EYJA 2BDOA 3R93A 1SYBA 1EYDA 4IUVA 5IGCA 2A5HA 4HR7B 3PO3B 2E2IB 3VA5A 1EIGA 5C44B 4MN3A 3Q23A 4HMJA 4XYOA 5C4HA 3FMCA 1NR2A 3CRKC 5CMDA 1V1OA 3SEBA 3IAYA 1I4HA 2ICIA 1YNJC 5IGBA 3E5SA 3QO2A 3MZ5A 3FDTA 4KMUC 1ET9A 1WCMB 4DAVA 2B2UC 5JJZA 2J7ZA 2RDFA 2KQ3A 3FKIB 1RKNA 1LT5D 1Q1BA 4L8JA 2MGSA 3M4YA 1FNUA 4EVOA 3Q24A 4K5XA 3AB9A 4N9TA 4TRDA 1CI3M 4IUUA 1H9JA 3HZXA 4EQNA 1QB5D 5ELDA 1WTQA 5CYUA 1X32A 3IFTA 3H3VC 1B1ZA 3FEWX 2RQXA 3BYYB 2YU9B 3PUZA 1EFID 1D1IA 3J7AV 2D5DA 2AWOA 2K5QA 1U4RA 1A3TA 3MTSA 2EJMA 1XYIA 1A6XA 1FR3A 4XDXA 2FJ2A 4F87A 2ZXOA 4N9PA 3LNNA 4R8IA 1E0BA 2Q8IB 3SVMA 4IFDH 2LKVA 2B2YA 3TP5A 4BWGB 1Y1VB 1S5ED 1AN8A 5T1GA 3SK5A 2F3VA 3GTOB 5LL6S 3K59A 4ZUIA 4RFBA 3V2TA 1DOLA 4QIWB 2VB3X 2CW0D 3AMUA 1YNJD 5KNBA 3EA6A 1S5CD 1OXUA 3M7NA 1TU2B 5IT9L 1JWUD 1JWMD 3ERQA 3HOWB 3DHQA 3FPPA 1SNMA 3LX0A 2F0LA 3D3RA 3QWNA 2K28A 2D9UA 5EBDA 2SDFA 3BG3A 4R8NA 1X3PA 2A73B 1H9SB 5C4JB 1PRTD 1SMYD 1B50A 5CV9A 4G7ZC 2HUGA 3V96A 3A7AB 3TP6A 1IW7D 3I4LA 3K5LA 1F9SA 2LS01 3KF8A 5ELEA 3C2PA 1EWHA 1MGSA 4M1UB 4IFDG 1OXSC 5I2XA 1EY7A 2EYHA 1MI2A 5EKIA 1QILA 1C4QA 1JORA 1RCVD 4C56C 4K6DA 1K83B 4BBRB 1OO9B 1DJRD 4A3MB 2ZT9C 5CR3A 2JEAI 1MBYA 2QDBA 1I6HB 4B9XA 4KKTA 2F0MA 2N55A 1EL0A 5E1FA 1PTOF 3PUVA 4IN3A 4IUPA 2EOTA 4KN7C 3M3YB 1JE4A 1R9TB 2IX0A 5JOBA 1NCVA 2RKSA 4RKBA 1V43A 2B8GA 2DN8A 5FLXL 4S3SA 5BN4A 5CBAE 3TP7A 3FVQA 5M5YB 5C5LA 1D1KA 2V4DA 4R9WA 2XSCA 2VNUD 1HQRD 4EQOA 1Y8PB 4JK1C 4PMWA 2Y0SB 3GTLB 4RCOA 1PZKD 2PNRC 1PYWD 2QF7A 3D4RA 5C4XB 1GHJA 4KY6A 1TT2A 2XRSD 1UEAB 1I3QB 1LT6D 3OPOA 5D3DA 2WKDA 4K6LA 2YYZA 2LMCB 1V1PA 4LMQD 4RKLA 4KV6A 4LAAA 1HFGA 3TN2A 3MXPA 4XIGS 2EJGC 3D31A 4B9WA 2X6LA 3EJIA 1BCPC 2ENBA 3MFYA 4J1MA 2EY6A 3KLRA 3SK4A 3GTGB 2DNCA 4UDUC 1K8OA 1QG7A 1HCZA 2PW5A 1A3VA 1AW7A 4AYBB 4DXFA 4IZ8A 1QOHA 5ELBA 4DF7A 1GUWA 2PZTA 3ONAB 3E0JA 1PTOH 3R2IA 2WB1B 4NKLA 2F3WA 1EY4A 4HSVA 2F0TA 2F0UA 1SAPA 3ZYYX 3RMHA 2O4XA 1CFMA 4Z9CB 4WORA 1VF7A 1EY9A 1ZXTA 1B53A 3J7YW 3WDNA 3Q22A 2GA4B 1O7ZA 2XRQD 4Y7NB 1R4QB 5E4XA 3KK7A 2QKIC 1K8MA 5FKAC 1PMRA 5C0XH 2KECA 1XXGA 3HOUB 1RTNA 5C5MA 3EROA 1JQYD 1IW7C 3TBIB 5I9PA 1CHQD 1IHZA 5IOCA 1GXDC 3VYSA 2NUCA 2SNSA 4V190 1RHPA 3HOVB 1H9KA 4KHVA 2FFKB 5EGTA 3J80E 1HA6A 1BCPB 1ENFA 1SYDA 3VYUA 1SYEA 1PZJD 3NWTA 1MSGA 1VMPA 1Y8OB 2A69C 3HS0C 1EU4A 3OW7A 2NVQB 1SFOB 1WTOA 1GJXA 2RSNA 4CGYB 1BBXC 2K05A 1G91A 2M2LA 1DM0B 1W6KA 4RGTA 3JAME 3K5NA 4F88A 2RA4A 1SNOA 4KY7A 4RA8A 2RDHA 5TSSA 1STGA 5A2QE 4DK0A 1SDFA 4XQJA 1E2WA 4Q0FA 3I91A 4K14A 3GQBA 2JA8B 3K0YA 1R4PB 4ILWA 3CQZB 1O78A 2F0IA 5CV5A 1WTVA 4FP5D 1UUPA 2B2WA 3PMFA 4QUFA 1SE2A 1D6EC 1HFNA 1EEFD 1F9RA 1Y69U 4DXGA 4NDXA 2R92B 2NYZD 4HCSA 2VXWA 3A8IE 3EQLC 4XXEA 5J39A 1JICA 1HUNA 2AWNA 1I6VC 2B2VC 1AZQA 5BN5A 1SE4A 2XN9C 1J9OA 5CV4A 1BXTA 3KBGA 5I6YA 1D5XC 3V05A 5JVH3 1EZ8A 2X69A 1QJOA 3DXJC 4HTHA 5LL6X 2NBFA 2BE5D 4A3KB 2NB0A 2IPKD 3K57A 1SNQA 3MXNA 2QEJC 4PQXA 1DYQA 3D6WA 2BA0A 3MA2B 1I4GA 1LTTD 3ND9A 2OEOA 4EQPA 1OXTA 1TS2A 1ML0D 2NZ1D 3PO2B 3A54A 3NUCA 4FXDA 3D4WA 3VR3A 1LT4D 3P20A 1LO5D 1B3AA 1NUCA 4L63B 2IT1A 5D65A 2K5WA 4KY5A 5KNCA 3VA7A 3T53B 5JAVA 4IALA 4DNTB 3TP8A 1M8AA 1HRJA 1HHVA 1A2UA 4K8JA 4ZUJA 4I7ZC 2SNMA 1KDAA 2CQAA 5CV8A 4ZKCB 1B2TA 3K6OA 1X3QA 3I70A 3SDZA 4BA2I 2QILA 5EKKA 1UNSA 3BDCA 5M5XB 4EGVA 4JBWA 2Q8RE 4OO1I 3R2TA 4H44C 1B44D 2E2HB 2NVYB 5NUCA 3J7AF 1KABA 3PIO3 1Q12A 4J6HA 3DUZA 1JOKA 5C6AA 3TZDA 5COYA 5F2DA 2B2TC 3QOLA 4ID6A 3NWSA 1SNDA 2C9OA 5C0XG 1EIHA 1BO0A 2L9HA 3D4DA 1QWYA 5DM73 4ZQ3A 2NWGA 3PUYA 5HGTA 1ESFA 5BN3A 1W6JA 1LV9A 1U9RA 3KLSA 1F2LA 1TWGB 5DM63 4KJOA 3BS1A 4HCEA 3E6ZX 5I2YA 3L9AX 3OSOA 3GTKB 5A2QL 2M9VA 2KEDA 5M3MB 1LACA 5EKLA 4ODGA 3BVMA 4K2KA 1ZEQX 4BA1I 4C3IB 1B4OA 4FF2A 4X3TA 2A6EC 5J22A 1HUMA 3K58A 1KLUD 3EFXD 2E75C 1EU3A 2EY1A 1TWCB 3MEHA 3T51B 2EYLA 1PFNA 2B2VA 2JEBI 1DOKA 1CM9A 1IL8A 1ET6A 4FF4A 4ABNA 3NTKA 3CHBD 3MAQA 5M9OA 4OGQC 1Z47A 1SNCA 5IODA 4X3KA 2NTSA 1Q90A 1KNEA 2CW0C 4A3BB 1TS3A 3GTMB 2NTTA 2F0PA 2L4NA 3S9WA 2A74C 4KI0A 1PTOB 2D2CC 4DGZA 4O1NA 2XVSA 2R93B 2K1BA 4RHRA 5IGFA 2J4XA 4Q5VA 4HN7A 1ZKOA 1EY0A 1PDQA 3D6CA 1AZPA 2F03A 4BS9A 1G2SA 4QF4A 3TDQA 3I4NB 3W3AA 2DNEA 2JA6B 2HDLA 3A56A 2AQ1B 2AUKA 5IGDA 5CORA 1BR9A 5AFWA 1D5ZC 4CBVA 4HAEA 1DD2A 4OIKA 1JWSD 3DWQA 2B2YC 2A68D 4PNYA 2KA7A 3URYA 2F0JA 1A15A 2HDMA 1GUGA 5C4ZA 3U9OA 2WV6D 4U68A 3PV0A 1KDCA 2KJXA 3NBHA 1GUOA 1A3UA 4DU9A 2NN6G 4H7BA 2KCNA 5EPJA 4NW2A 3NBIA 2XWJB 5M5WB 3L3OC 1A2TA 1HPCA 5JEAH 2LY7A 1SYCA 4QMGA 5IGGA 2F0DA 5G3LF 3M85A 1IYVA 1Q8IA 4DA2A 1D2BA 2JP1A 1B9MA 3HKZB 2IX1A 3BVGA 1TWFB 4BBSB 4FVMA 2R7ZB 1CT1D 3T13A 4CHTB 2Q8TA 3S1QB 4ZAIA 1MSHA 4ULLA 2AQ2B 2NVXB 3M7GA 1DXMA 1F2MA 5JVG3 1PTOD 1GOZA 1VF5C 3P7JA 4B08A 1AEXA 2Z4HA 1S5DD 5LHY1 1F77A 2RDGA 1SSOA 4CKBA 1GUSA 4NMZA 3HEJA 4E6IA 2K03A 3Q6SA 4J8QA 5DEHA 3DWPA 2JSOA 3SXHA 4A3FB 5A35A 2B39A 3N6RA 4IUQA 2N88A 4F7XA 3C46A 5C3WA 4A3DB 3A55A 3OMGA 5I6WA 2L11A 2CVRA 3KBXA 4A3EB 2JA5B 3VR2A 1VCIA 1PZID 3UI2A 1JOQA 3FRPB 1STYA 1NR4A 1KAAA 1GUTA 4TQUS 1MD2D 2F0WA 3S1NB 2EY2A 5FOBB 5FO8B 3D8GA 3W2DA 3SK8A 1TR5A 4IFDI 3X3NA 5KIXA 2E76C 3MC0B 3H09A 1BDOA 3GV3A 3RLFA 4KKSA 2F0SA 1VDZA 3TZUA 1U4MA 5KYIA 3WOEA 1BNZA 5ELCA 3S1MB 1OXXK 2EYFA 2EXZA 2BA1A 4OL7A 3J81E 5M3FB 2F0QA 3C3LA 4IQZA 1IKLA 2G9HD 4FNFA 1U4PA 1TVXA 5K36H 5FK9C 4QCLA 4C1NI 3PIP3 3OMCA 4UAIA 4G4KA 2JXMB 2KVMA 5EBCA 1HQMC 3ND8A 2EZVA 4H0LC 2E2JB 2F0GA 1RODA 2K7VA 1DOMA 1BUVT 1PRTC 5FO7B 2WP8J 4C1NK 4KJNA 3H94A 2MHVA 3H0GB 4HEDA 1PTOC 3L7ZC 3S14B 4K5WA 3DMUA 4K2LA 1O7LA 4LJZC 1SNPA 2OXPA 2LFNA 3DWAA 2QCPX 3SK6A 1BF4A 2EYPA 1Q1EA 3N52A 4PV1C 2ZXPA 1BCPD 5I9OA 5CV7A 4OHJA 2F0FA 1SJHD 1V8QA 4CJ2C 4A3GB 1KNAA 4BY1B 5E4WC 2Z8LA 2EYMA 2HCCA 4DK1A 1O7YA 4PMCA 1QE6A 3FPUB 3PUXA 1SXTA 5EPKA 1LABA 1E2VA 4WJWA 3HOXB 1I50B 4A93B 3NSWA 2IX3A 2JYOA 2B8FA 2F0VA 1VMCA 1DCZA 1H9MA 2KOLA 2C5CA 4DFAA 1LTGD 2DY7A 4G57A 3NQIA 4K5VA 2DY8A 1FD7D 3NE5B 4G7HC 4PMBA 1QNKA 2Z4IA 1QNUA 4DAYA 1Z6HA 4FYDA 3QJYA 1ENCA 2KHSA 1T5EA 2EE1A 3S2HB 4GZYC 2Z1CA 3J81L 1RDPD 3OWFA 2X6GA 3G6JB 1C8CA 4O42A 2FMCA 2IL8A 1FNWA 1S4ZA 1AP0A 1CA6A 1HXYD 3DEPA 5CGKA 4RCNA 4ZYSA 2L55A 1HTPA 1BOSA 1JCKB 5EPLA 1SMYC 4HMIA 2K6AA 1CQFA 1CA5A 3QB3A 5E3FA 3I3CA 1F2YA 2R61A 3HOYB 1ZYRD 2L12A 3RD4A 3SHLA 1TS5A 1SEBD 1Y1WB 3T16A 1F9QA 2L0CA 1EEID 1WD1A 1PLFA 5IT9E 4ME5A 4KHZA 1RTOA 2F0HA 4L6TB 2PW7A 1II3A 1EYCA 4WRDA 1EQTA 5CV6A 1AFPA 2A6HC 2TSSA 2O2LD 1BQQT 3TMEA 4M8AA 1FGBD 3NXWA 1YNND 5KGUA 3HP3A 2EPBA 5D3IB 4U673 1LTAD 5IGEA 1WTPA 3IL8A 2ID0A 3KLSX 4KTAA 1FYCA 4RGMA 3OIPA 1SYGA 2F0KA 2OF1A 2WINB 4ZRZA 3LWEA 1NSNS 1RD9D 3GP7A 3VR5A 3VR4A 3R3OA 4ZKBB 5KYLA 3C1FA 2L1BA 1U4LA 4I65A 1EY8A 3OOCA 3MFGA 2EDGA 1OXVA 1S5BD 2R6GA 3P1HA 2OT2A 1PFBA 1PXUA 2WIIB 4C3HB 5KEEA 3HRZC 4A3IB 4C3IG 1ILQA 2KUMA 1L0XB 2RSOA 5DAUA 1CHPD 3NTIA 4HSPA 3MXUA 3S16B 2MP1A 5ISRA 1H9SA 3Q0AA 4QUCA 4IFDJ 3IKJA 3CRLC 4ZK9B 1LT3D 3O13A 1XX8A 3GTQB 1L0YB 3TSSA 2F4IA 1LTID 2B2TA 3QOJA 1CTMA 4FF3A 4C3JB 1ONLA 3GTPB 3HG9A 3C1EA 1JB3A 1ENAA 1PRTF 5D14A 3R8BA 1C48A 3SR1A 4RGNA 4X3SA 5ELFA 5C3XA 2FINB 2PZUA 5JPMC 1IYUA 4C2MB 2VB2X 1H9RA 1LTRD 2HCIA 3BZDB 4XT1B 1UAPA 5I4DA 3GO5A 2MJ8A 1EYAA 3S15B 2M00A 2KEEA 1ESRA 2G9DA 2AQ3B 2BE5C 3GD7A 1SE3A 2ZXRA 1Y8NB 1EQVA 1EWCA 4TSSA 1F9PA 3OHXC 2CHBD 1DZ1A 2MPMA 1STAA 3RZDB 4IUTA 1EOTA 1STEA 5K5PA 3GTJB 1GHKA 4RHSA 4XQNA 1DONA 1SYFA 1WVLA 3QG1A 2XWBB 3DM1A 2SEBD 4RAUC 4OIJA 4K8IA 1WTRA 2PYKA 1TKWB 4YIJA 5JPNC 3A8JE 5FLXE 2I46A 2L5TA 4C3JG 2SOBA 2K32A 1XWEA 3RUZA 5CBEE 3OWEB 2BOSA 1EZ6A 5FO9B 3BYTB 1PRTB 1WD0A 3LWUA 2FHTA 1G2TA 1E2ZA 1TY0A 1EY6A 2B63B 1ILPA 2PMZB 3BDLA 1J8IA 2PZWA 3VR6A 2K01A 3MHBA 1G291 2K33A 4XT3B 1TQOA 4MHEA 2EYOA 3K5MA 4BY7B 1HTLD 2H4OA 4OO1H 3DEOA 1JR0D 4ZLTF 2JE6I 4KN4C 2WACA 2EVBA 2R3ZA 1STHA 1STBA 1Z7TA 1G6ZA 2XNAC 4CKEA 1S5FD 3H91A 4XTCS 3JAML
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IKM A;  2Q8R E;  4ZKB B;  2X6L A;  2L1B A;  1U4R A;  1MGS A;  1U4M A;  1U4L A;  2Q8T A;  1JIC A;  1RHP A;  2L4N A;  4ZAI A;  1MSH A;  3MTS A;  4CJ1 B;  1HUN A;  1XYI A;  3MWY W;  1BNZ A;  2B2V C;  1AZQ A;  4XDX A;  2FFK B;  4CJ2 C;  1WTX A;  2FJ2 A;  1F9P A;  1KNA A;  5E4W C;  1Q3L A;  5EPL A;  1PFB A;  1RJT A;  1HA6 A;  2K1B A;  2HCC A;  1J9O A;  1MI2 A;  1DZ1 A;  5EKI A;  2MPM A;  2XIW A;  3GV6 A;  5T1I A;  4R8I A;  1CA5 A;  1E0B A;  1O7Y A;  3P7J A;  3KUP A;  4IUT A;  3TZD A;  3SVM A;  5COY A;  1QE6 A;  2BDN A;  1EOT A;  1PDQ A;  2B2Y A;  2B2T C;  1QG7 A;  3FPU B;  3I3C A;  1AZP A;  1MSG A;  1ILQ A;  2KUM A;  2X69 A;  2RSO A;  1VMP A;  5EPK A;  1NAP A;  1EIH A;  1G2S A;  5T1G A;  1IKL A;  1BO0 A;  2MP1 A;  2N55 A;  5DNF A;  1U4P A;  2L12 A;  3R93 A;  2L9H A;  4IUP A;  1TVX A;  2EOT A;  1SSO A;  3F2U A;  4QUC A;  1WVL A;  1JE4 A;  2JYO A;  2NWG A;  3DM1 A;  4IUV A;  1WTO A;  2HDL A;  1DOL A;  4RAU C;  5EQ0 A;  2RSN A;  4RWS C;  4OIJ A;  1DON A;  1VMC A;  1BBX C;  1EIG A;  2K05 A;  4ZK9 B;  1WTR A;  1G91 A;  2H1E A;  1NCV A;  2M2L A;  1F9Q A;  1LV9 A;  3D6W A;  1GUW A;  3ONA B;  4MN3 A;  2K03 A;  1F2L A;  3Q6S A;  5COR A;  1XX8 A;  2RA4 A;  5AFW A;  1WD1 A;  5EJW A;  1PLF A;  4RA8 A;  5CBA E;  2KOL A;  4UAI A;  4HAE A;  1NR2 A;  5CMD A;  4OIK A;  2DY7 A;  4HSV A;  1RTO A;  2KVM A;  5CBE E;  1SAP A;  2B2W C;  4R9W A;  2B2Y C;  2B2T A;  1ML0 D;  4IUQ A;  2KED A;  1EL0 A;  3I90 A;  2N88 A;  1EQT A;  1WD0 A;  1SDF A;  1O80 A;  2NZ1 D;  3QO2 A;  2FHT A;  3IFD A;  3FDT A;  1HRJ A;  1G2T A;  2RVL A;  3I91 A;  1A15 A;  2HDM A;  1ILP A;  1B4O A;  2L11 A;  2DY8 A;  2CVR A;  1ROD A;  2B2U C;  1J8I A;  3I8Z A;  3KBX A;  4U68 A;  4X3T A;  1B3A A;  1DOM A;  1HUM A;  2K01 A;  5D14 A;  5JJZ A;  2FMM A;  2J7Z A;  4XT3 B;  4DN4 M;  4HED A;  1QNK A;  4X3S A;  3UI2 A;  1ZXT A;  5D65 A;  4MHE A;  2FIN B;  2K28 A;  4X3U A;  4IUR A;  1B53 A;  2D9U A;  2SDF A;  1NR4 A;  3HP3 A;  1X3P A;  5EPJ A;  1M8A A;  3DEO A;  1WTV A;  1PFN A;  2B2V A;  2EE1 A;  2K04 A;  4NW2 A;  2MGS A;  2EPB A;  4ZLT F;  1HHV A;  1O7Z A;  2B2W A;  5E4X A;  2HCI A;  4QUF A;  1WTP A;  3IL8 A;  4XT1 B;  4IUU A;  1DOK A;  2R3Z A;  1BF4 A;  1CM9 A;  1HFN A;  1IL8 A;  2X6G A;  4ZKC B;  1B2T A;  1B50 A;  2MJ8 A;  1F9R A;  2KEC A;  4LMQ D;  1C8C A;  2HUG A;  4O42 A;  1G6Z A;  1HFG A;  1X3Q A;  2IL8 A;  3TN2 A;  1S4Z A;  2NYZ D;  1RTN A;  3N52 A;  2B2U A;  1WTW A;  1X32 A;  1WTQ A;  1AP0 A;  1CA6 A;  4CJ0 B;  3G7L A;  3H91 A;  2JP1 A;  1F9S A;  3LWE A;  2KEE A;  4HCS A;  3GV3 A;  2VXW A;  1ESR A;  1ICW A;  3DEP A;  1KNE A;  4X3K A;  1PFM A; 
#chains in the Genus database with same CATH topology
 5JEA J;  1IKM A;  2F1M A;  2ICE C;  3CAM A;  3M4Q A;  2A6H D;  3BVZ A;  2EXD A;  5FJ8 H;  2NN6 I;  1C7Y A;  1TY2 A;  3I4N G;  3RLO A;  2O5J C;  2F0N A;  3T56 B;  3CC4 A;  4XQQ A;  3J80 L;  4WFN 3;  3I56 A;  4H02 A;  3M4O B;  2JA5 G;  2XIW A;  3WOF A;  2VUM B;  3A8K E;  3KYH C;  4Y52 H;  4LK1 C;  5KRU A;  2JA8 H;  2MQH A;  1NAP A;  2N8N A;  2RBM A;  3ITP A;  4KD3 A;  4H13 C;  5DNF A;  4DV5 Q;  1A62 A;  1FL0 A;  1KDB A;  2O5I C;  3MXN B;  4JBM A;  1U0L A;  5EQ0 A;  2EJF C;  3CU7 A;  1TWA B;  3CC7 A;  2H1E A;  2A6E D;  4MTK A;  3SE0 A;  2A68 C;  5IP9 G;  5KND A;  1CZW A;  2PPB C;  4V0B A;  2HQE A;  1TWH B;  3I4M B;  2JA7 B;  3NHH A;  4UHV A;  2B2W C;  1GD7 A;  1WFQ A;  4KKU A;  4JI5 L;  1Q82 C;  3I90 A;  2NN6 H;  3E9H A;  1O80 A;  3NTH A;  2RVL A;  3KOJ A;  2E74 C;  3CME A;  2RHS B;  3K5O A;  3G6E A;  2F0O A;  4RH6 A;  3S24 A;  2AKW B;  2I0Q A;  1I4P A;  3S2D B;  4GOP A;  4DN4 M;  4FXK C;  3S1M H;  2WKC A;  4MTN A;  4G7O C;  4IUR A;  2LSS A;  3VYR A;  2OQ0 A;  3PQI A;  4OXP A;  5EAY A;  1V1P B;  2K04 A;  2FXQ A;  3CW2 C;  3AU7 A;  1QCB D;  5M3F G;  1JT8 A;  1D5M C;  1XMQ L;  4DAP A;  2PCF B;  4HIM A;  4RMF A;  2L15 A;  2IW3 A;  2PQE A;  1HNX L;  3HKZ E;  4B3S L;  5FLM H;  4MIU A;  1LTB D;  2B2U A;  5IIF A;  4CJ0 B;  3G7L A;  1SJE D;  2D0O A;  2OQK A;  1HZC A;  3CXC A;  4DV0 L;  1ICW A;  4JI7 L;  1PFM A;  4A3J B;  1NE3 A;  4O0A A;  2E2D C;  1LLR D;  5HUR A;  1J6Q A;  2IJ0 A;  2I07 B;  5G3L D;  4CJ1 B;  3HOZ B;  4CKC A;  1IBL Q;  3MWY W;  1CQV A;  4NP5 A;  1WTX A;  5C4J H;  3IRB A;  3A7L A;  1YBY A;  2J0T D;  1N34 Q;  1EY5 A;  1UE1 A;  4LF8 L;  1M4V A;  1STN A;  3H3V I;  2BDN A;  2NVT B;  2AMC B;  4KD4 A;  5C3E B;  1JC7 A;  2KCC A;  2D0P A;  4UY8 C;  1I5F A;  4JW0 A;  3F2U A;  3PUW A;  3UDX A;  2F0E A;  3U4V A;  3M4O H;  4RWS C;  2BCO A;  3I4O A;  1G8Z D;  1B3Q A;  1T5X D;  5C0X I;  4DR7 Q;  3MVV A;  2TMP A;  1HNZ Q;  3OIQ A;  2GN5 A;  5EJW A;  3EVQ A;  4BBR H;  1RF2 D;  1B9N A;  1I4Q A;  2K14 A;  2F4V Q;  1CZG A;  3ERS X;  1JOO A;  4TKO B;  1YHQ A;  1T9H A;  4KK7 A;  3CCR A;  2CWP A;  2AUJ D;  3K7A B;  1SBB B;  2A69 D;  1I6H H;  3I2Z A;  3IFD A;  2D62 A;  3KDF A;  5M5X H;  4NXN L;  3T4A C;  3BDO A;  3U9S A;  2VS1 A;  1GUN A;  4DR7 L;  4C3H G;  3CKI B;  3I8Z A;  2ZJR A;  3NPP A;  4IUN A;  4F8M A;  3RZO B;  1VQK A;  2UU9 Q;  1KTK A;  2FMM A;  4FF1 A;  3GTJ H;  1MKH A;  4LFA Q;  1KLG D;  2PMZ E;  4X3U A;  4A3E G;  2K5D A;  2HHH L;  4DV4 Q;  2NVX H;  3QIA A;  4A76 A;  5IE8 A;  4DNR B;  1VQ5 A;  1YNN C;  1UE5 A;  4FO2 A;  3ER0 A;  3S1R B;  1HA5 A;  3I73 A;  5J3B A;  4GNX B;  2EY5 A;  1B8A A;  2EIF A;  1BCP F;  3VYT A;  4JI5 Q;  4A3I H;  4NXM Q;  5GQO A;  2IWH A;  5K36 G;  5JEA G;  2VZA A;  5CC4 A;  3S17 B;  4L5R C;  3NP8 A;  1WTW A;  1LTS D;  2UUB L;  3HGB A;  3JAM L;  4QB4 A;  5C44 G;  4OO1 G;  5C0X J;  4RGO S;  4P2C B;  2VL6 A;  5J1Z A;  3J80 c;  4P73 A;  2PO4 A;  4A4I A;  1F2Z A;  1EOV A;  2MUY A;  3I72 A;  3X3M A;  4LUV A;  1I4R A;  1Q3L A;  3H6M A;  1FNV A;  1VQG A;  3P75 A;  1RJT A;  1TS4 A;  3LGJ A;  4X64 L;  3NK9 A;  4HIO A;  1TII D;  5T1I A;  3GV6 A;  4XYQ A;  3KUP A;  4JI6 Q;  3MXG A;  4FXG C;  5JJI A;  3NQT A;  3HOU H;  1ZYR C;  2WAQ B;  1CK1 A;  5GAE C;  1I4X A;  1XTC D;  2EYJ A;  2BDO A;  3R93 A;  1SYB A;  1XMO Q;  1EYD A;  1VQB A;  4IUV A;  2A5H A;  5IGC A;  4HR7 B;  3PO3 B;  2E2I B;  3VA5 A;  1EIG A;  5C44 B;  2YTY A;  4IPD A;  1A8V A;  4MN3 A;  3Q23 A;  4HMJ A;  4XYO A;  2K4K A;  2VQF Q;  5C4H A;  4GLV B;  1ASY A;  3FMC A;  1NR2 A;  3CRK C;  4CDD C;  1V1O A;  5CMD A;  3SEB A;  3IAY A;  1I4H A;  2ICI A;  1YNJ C;  3DM3 A;  1XMO L;  5IGB A;  4JC0 A;  3E5S A;  3QO2 A;  3MZ5 A;  3FDT A;  4KMU C;  1ET9 A;  1SRU A;  1WCM B;  5IP7 G;  4DAV A;  3W5O A;  4UP8 A;  2ATW A;  2B2U C;  2UUC L;  2AHO B;  5JJZ A;  4LWC A;  2J7Z A;  2RDF A;  1K0R A;  2KQ3 A;  3K7A H;  1PH4 A;  3FKI B;  1RKN A;  3L2P A;  2QDL A;  1LT5 D;  1Q1B A;  4L8J A;  2MGS A;  3M4Y A;  1FNU A;  4P74 A;  4EVO A;  3Q24 A;  4K5X A;  3AB9 A;  1C9O A;  4N9T A;  4TRD A;  1BVS A;  1CI3 M;  4IUU A;  4O2D A;  2PNH A;  3PSI A;  2OCE A;  2CFM A;  1H9J A;  3HOU G;  3HZX A;  4EQN A;  1QB5 D;  5ELD A;  2OTJ A;  4DV5 L;  1WTQ A;  5CYU A;  3PCO B;  1Q46 A;  1X32 A;  3IFT A;  3H3V C;  4IPH A;  1B1Z A;  3FEW X;  4HJ7 A;  2RQX A;  3BYY B;  2YU9 B;  2NZH A;  3PUZ A;  4IPC A;  1EFI D;  1D1I A;  2DGY A;  3J7A V;  2D5D A;  2AWO A;  2K5Q A;  1U4R A;  1A3T A;  1IYJ B;  1E1O A;  3MTS A;  4A3K G;  2EJM A;  1TWA H;  4ALP A;  1XYI A;  4JV5 L;  1A6X A;  1FR3 A;  4XDX A;  2FJ2 A;  4F87 A;  1XNQ L;  1N32 Q;  2ZXO A;  4N9P A;  3AFP A;  2VUM G;  3LNN A;  1KIX A;  3T1H Q;  4R8I A;  4JI6 L;  1E0B A;  2Q8I B;  3SVM A;  4IFD H;  2LKV A;  1YVC A;  2B2Y A;  4JI8 Q;  1NY4 A;  1KAW A;  3TP5 A;  4BWG B;  5M5Y H;  1Y1V B;  1S5E D;  3I4M H;  1AN8 A;  5T1G A;  3SK5 A;  2F3V A;  4DR1 L;  2DUD A;  3GTO B;  4KHP L;  5LL6 S;  3K59 A;  3PGZ A;  4GN5 A;  4ZUI A;  4RFB A;  3V2T A;  1DOL A;  4QIW B;  2VB3 X;  1A0I A;  2CW0 D;  3AMU A;  1YNJ D;  4B3M L;  5KNB A;  3EA6 A;  1S5C D;  2JA8 G;  4N8F A;  2QW7 A;  1OXU A;  1K8A C;  3M7N A;  1N33 Q;  1TU2 B;  3U50 C;  5IT9 L;  1JWU D;  4GKK L;  4A3C G;  1D8L A;  2WB1 E;  1JWM D;  1RIP A;  1KD1 C;  4JYA L;  3ERQ A;  3PIO A;  3HOW B;  3DHQ A;  4AQY L;  3FPP A;  3STB C;  1MJC A;  1YIT A;  3HKZ G;  1SNM A;  3LX0 A;  1JMC A;  1N34 L;  2R7D A;  2F0L A;  3D3R A;  3QWN A;  3CCE A;  2K28 A;  4HJ9 A;  1QVC A;  3TRE A;  2D9U A;  5EBD A;  2SDF A;  1FJG L;  3BG3 A;  4R8N A;  1X3P A;  2A73 B;  1YJW A;  4LFB Q;  1H9S B;  4PZ8 A;  3S15 H;  5C4J B;  3GTM H;  1I3Q H;  1PRT D;  1SMY D;  1B50 A;  5CV9 A;  4G7Z C;  2R92 G;  1MHW C;  2HUG A;  3OW2 A;  4B3S Q;  3V96 A;  1E24 A;  3A7A B;  3TP6 A;  1JE5 A;  1IW7 D;  3I4L A;  3K5L A;  1F9S A;  2LS0 1;  2WAQ E;  3KF8 A;  1R9T H;  2CQO A;  5ELE A;  3CCQ A;  1YI2 A;  3C2P A;  1EWH A;  1MGS A;  5BR8 Q;  4M1U B;  4IFD G;  4UP7 A;  3KDF B;  3Q8D A;  1OXS C;  3CCU A;  1YJ9 A;  4A3L H;  1PH7 A;  5I2X A;  4K0K Q;  5HGQ A;  4NPS A;  1EY7 A;  2EYH A;  2ZTC A;  4JBK A;  1MI2 A;  5EKI A;  1QIL A;  1C4Q A;  3GTP H;  1PV4 A;  1JOR A;  1RCV D;  4C56 C;  4K6D A;  1K83 B;  4A3K H;  4BBR B;  1OO9 B;  1DJR D;  4A3M B;  3F1Z A;  2ZT9 C;  5CR3 A;  3PO3 G;  4OWT B;  1E7Z A;  1EQR A;  4QY7 A;  4DKA C;  2JEA I;  1MBY A;  2QDB A;  1I6H B;  3H15 A;  4B9X A;  4KKT A;  2F0M A;  2N55 A;  5IWA Q;  1EL0 A;  5E1F A;  1PTO F;  3PUV A;  4KN7 C;  4IUP A;  2EOT A;  4IN3 A;  2UU9 L;  2Z9H A;  3M3Y B;  1JE4 A;  1R9T B;  1VQ8 A;  2IX0 A;  5JOB A;  1EQQ A;  1NCV A;  2RKS A;  4RKB A;  1V43 A;  2B8G A;  2DN8 A;  5FLX L;  4S3S A;  5BN4 A;  4YY3 Q;  1ICF B;  5CBA E;  3TP7 A;  4LFC Q;  3FVQ A;  5M5Y B;  3RNU A;  1TWG H;  1EWI A;  5C5L A;  1HZB A;  1P8L A;  2I5H A;  1D1K A;  4EQ5 A;  4DR2 Q;  2V4D A;  4R9W A;  2XSC A;  5ELO A;  1VQJ A;  2VNU D;  1HQR D;  4EQO A;  1Y8P B;  4JK1 C;  4B3T Q;  4PMW A;  4DPG A;  2Y0S B;  3GTL B;  4RCO A;  4A3C H;  1PZK D;  1MIU A;  2PNR C;  1EIY B;  1PYW D;  2QF7 A;  3D4R A;  5C4X B;  1GHJ A;  4KY6 A;  4LF5 Q;  1KRS A;  1TT2 A;  2XRS D;  2P5Z X;  1UEA B;  1I3Q B;  1LT6 D;  3OPO A;  5D3D A;  2WKD A;  2UUB Q;  4K6L A;  1VQM A;  4A3M G;  2YYZ A;  4DR4 Q;  2LMC B;  1V1P A;  4LMQ D;  3H0G G;  4KV6 A;  4RKL A;  4LAA A;  1HFG A;  3TN2 A;  3MXP A;  4XIG S;  1RL2 A;  2EJG C;  4BY7 H;  3D31 A;  3CD6 A;  4B9W A;  1Q8K A;  4DV3 L;  1UE7 A;  3T1Y Q;  3HOZ H;  2RCF A;  2X6L A;  3EJI A;  1BCP C;  2ENB A;  3HKS A;  3MFY A;  4J1M A;  2EY6 A;  1Y1V G;  3KLR A;  2GVA A;  3SK4 A;  3STB D;  3GTG B;  1NMF A;  4L5S A;  4LF9 L;  3EBE A;  2DNC A;  4UDU C;  1K8O A;  1QG7 A;  1HCZ A;  2PW5 A;  1L1O C;  4R4I A;  4BY1 G;  3CCM A;  1A3V A;  1AW7 A;  4AYB B;  4DXF A;  4IZ8 A;  3K7U C;  1QOH A;  4BY7 G;  3ICE A;  4JV5 Q;  5ELB A;  4DF7 A;  1QZG A;  1SR3 A;  4DR3 Q;  1GUW A;  1VQA A;  2PZT A;  3ONA B;  4X66 L;  4LF6 L;  1D7Q A;  4DAY B;  3E0J A;  1PTO H;  4JYA Q;  3R2I A;  2WB1 B;  4NKL A;  2F3W A;  1EY4 A;  4HSV A;  2ALY B;  2F0T A;  2F0U A;  1SAP A;  4DV1 Q;  3G4S A;  4JI0 Q;  3ZYY X;  3RMH A;  4YY3 L;  4RG1 A;  2O4X A;  4JOI A;  1CFM A;  4Z9C B;  3S1N H;  1HZ9 A;  4WOR A;  1VF7 A;  1EY9 A;  4C3J H;  3WWV A;  1SN8 A;  2B29 A;  1Y1W G;  1ZXT A;  2E8G A;  4UP9 A;  5LMN Q;  1B53 A;  3J7Y W;  3WDN A;  3HOV H;  3Q22 A;  2JK8 A;  3W1G A;  2GA4 B;  1O7Z A;  1X3F A;  2XRQ D;  4Y7N B;  1R4Q B;  5E4X A;  3KK7 A;  2QKI C;  1K8M A;  5FKA C;  3FP9 A;  3RR5 A;  4K0K L;  1PMR A;  1K0S A;  5C0X H;  3F2C A;  2KEC A;  1XXG A;  3HOU B;  3H3V H;  3S2D H;  1RTN A;  4LFA L;  5C5M A;  2ZJP A;  4OWX B;  3ERO A;  1JQY D;  1IW7 C;  4L5T A;  3TBI B;  5IYD G;  5I9P A;  3MEF A;  1CHQ D;  1IHZ A;  5IOC A;  1GXD C;  3VYS A;  2NUC A;  4DAM A;  4X62 Q;  2SNS A;  4V19 0;  1RHP A;  3HOV B;  1H9K A;  4KHV A;  2FFK B;  2IY5 B;  1IBK L;  5EGT A;  2UXB L;  2NZO A;  3J80 E;  1HA6 A;  1BCP B;  2A19 A;  4DK6 C;  1ENF A;  1SYD A;  3VYU A;  5IP9 H;  1SYE A;  1PZJ D;  3NWT A;  4APV A;  1IXR A;  3K81 C;  3OTO Q;  1MSG A;  1VMP A;  1Y8O B;  1X55 A;  2A69 C;  3HS0 C;  1YHB A;  2QEX A;  1EU4 A;  3OW7 A;  4HJ5 A;  2NVQ B;  2ZM6 L;  4IJH A;  3A0J A;  2K5H A;  1SFO B;  1WTO A;  1IBK Q;  1L1O B;  1GJX A;  2RSN A;  4CGY B;  1BBX C;  2K05 A;  1G91 A;  2M2L A;  1DM0 B;  1W6K A;  4RGT A;  3JAM E;  3K5N A;  4F88 A;  2RA4 A;  1SNO A;  4OEM B;  1WOC A;  4KY7 A;  4RA8 A;  2RDH A;  5TSS A;  1STG A;  1EUJ A;  2VY3 A;  4C3H H;  4DK0 A;  5A2Q E;  4BY1 H;  4A93 G;  3J7Z C;  2JA6 H;  1SDF A;  4JI1 L;  4XQJ A;  1E2W A;  4Q0F A;  3I91 A;  4K14 A;  2UXD L;  3GQB A;  2JA8 B;  3K0Y A;  4B3R L;  4MZ9 A;  1R4P B;  4ILW A;  4OX9 L;  3CQZ B;  1O78 A;  2F0I A;  1YEZ A;  2CWA A;  5CV5 A;  2PI2 E;  1HH2 P;  4X66 Q;  4LF6 Q;  4A93 H;  3HOX G;  1WTV A;  4HJA A;  4FP5 D;  4GN3 B;  1UUP A;  2B2W A;  3PMF A;  4QUF A;  1S3O A;  1SE2 A;  4B3T L;  1D6E C;  3CCV A;  1HFN A;  3QR8 A;  1EEF D;  1F9R A;  1CKO A;  1Y69 U;  4DXG A;  4NDX A;  3EN2 A;  2R92 B;  4LFC L;  2NYZ D;  4A3M H;  2Z6K C;  2F4V L;  4HCS A;  2VXW A;  3A8I E;  1KHI A;  3EQL C;  3VDY A;  3S1R H;  4XXE A;  2VQF L;  2OTL A;  5J39 A;  1JIC A;  1HUN A;  2AWN A;  2CH4 A;  1I6V C;  2B2V C;  1AZQ A;  5C4X H;  5BN5 A;  1SE4 A;  2XN9 C;  4POF A;  1J9O A;  1K3B C;  5CV4 A;  1BXT A;  3KBG A;  4LUZ A;  3BU2 A;  5I6Y A;  1D5X C;  3V05 A;  5JVH 3;  1EZ8 A;  2JA9 A;  4GNX C;  1TXY A;  4LF5 L;  2A1A A;  2X69 A;  1GO3 E;  2HHH Q;  2R92 H;  1QJO A;  4X65 Q;  3DXJ C;  1VQC A;  4HTH A;  5LL6 X;  2ZM6 Q;  2NBF A;  2BE5 D;  4A3K B;  2NB0 A;  3PF4 A;  2Z0S A;  2IPK D;  3K57 A;  1IBL L;  1SNQ A;  3MXN A;  4EX5 A;  2QEJ C;  4PQX A;  1DYQ A;  3D6W A;  1KRT A;  2BA0 A;  3MA2 B;  1I4G A;  1LTT D;  2N49 A;  2MFI A;  3ND9 A;  2B63 G;  2OEO A;  4X6A H;  4EQP A;  1OXT A;  4P72 A;  1HNW Q;  3HOV G;  1TS2 A;  1ML0 D;  2E2I H;  3PO3 H;  1X9N A;  2NZ1 D;  3PO2 B;  3A54 A;  4JPB W;  3NUC A;  2WB1 G;  2NVT H;  4FXD A;  3D4W A;  3VR3 A;  1LT4 D;  3P20 A;  1LO5 D;  5GRO A;  4A75 A;  1B3A A;  5C4X G;  2I5L X;  1NUC A;  4WJ4 A;  1K28 A;  4L63 B;  2IT1 A;  4DUY Q;  5D65 A;  2K5W A;  4KY5 A;  5KNC A;  3GDE A;  3VA7 A;  1HZA A;  3T53 B;  3H0G H;  4IAL A;  4DNT B;  5JAV A;  3TP8 A;  2HIV A;  3KLW A;  1PA6 A;  1E22 A;  2WAQ G;  1M8A A;  1HRJ A;  1HHV A;  1A2U A;  4K8J A;  4ZUJ A;  4I7Z C;  4AQY Q;  4WJ3 M;  2SNM A;  1KDA A;  2CQA A;  4N8X 1;  5CV8 A;  4ZKC B;  3A5U A;  1B2T A;  3K6O A;  1UE6 A;  4ZCK A;  2K5V A;  4YCU A;  4QGU A;  1X3Q A;  3I70 A;  3D0F A;  2UXC L;  3SDZ A;  4BA2 I;  2QIL A;  1CUK A;  5EKK A;  1JB7 A;  1UNS A;  3BDC A;  1JJ2 A;  4B3M Q;  5M5X B;  4EGV A;  4JBW A;  4DV3 Q;  2Q8R E;  4OO1 I;  3R2T A;  4H44 C;  1B44 D;  3ULJ A;  2E2H B;  2NVY B;  4GS3 A;  5NUC A;  3J7A F;  1KAB A;  3KF6 B;  3PIO 3;  1Q12 A;  4J6H A;  2JA7 G;  2K5N A;  3DUZ A;  1JJG A;  2JA7 H;  1LM0 A;  2VW9 A;  1I94 L;  1JOK A;  5C6A A;  3TZD A;  5COY A;  5F2D A;  3J81 i;  2B2T C;  3QOL A;  4ID6 A;  3NWS A;  3F2D A;  1SND A;  2C9O A;  5C0X G;  1N32 L;  1EIH A;  1PH2 A;  1CKN B;  4GKJ Q;  1BO0 A;  2L9H A;  3D4D A;  1QWY A;  1EIF A;  4YWL A;  4ZQ3 A;  2NWG A;  3PUY A;  2QGQ A;  5DM7 3;  3KFU A;  5HGT A;  1CKM A;  4JCV E;  1ESF A;  5BN3 A;  2XGT A;  1BKB A;  1LV9 A;  1W6J A;  4A3I G;  1U9R A;  3KLS A;  1F2L A;  1TWG B;  3I55 A;  4DV2 L;  1Y1W H;  3BZK A;  2UUA Q;  5DM6 3;  1K3R A;  4KJO A;  3BS1 A;  4GKK Q;  4HCE A;  3TS0 A;  3E6Z X;  5I2Y A;  3L9A X;  3OSO A;  3GTK B;  5A2Q L;  4DUZ Q;  2M9V A;  2UXD Q;  2KED A;  5M3M B;  5M5W H;  1LAC A;  1VQP A;  1VS0 A;  5EKL A;  2EQS A;  4ODG A;  3BVM A;  4K2K A;  1ZEQ X;  4BA1 I;  1FVI A;  3U4Z A;  4C3I B;  1B4O A;  4FF2 A;  2BH2 A;  4X3T A;  2A6E C;  5J22 A;  1HUM A;  3K58 A;  1KLU D;  4BXX H;  2PQA A;  4DV7 L;  3EFX D;  2JJQ A;  3W1B A;  2E75 C;  1EU3 A;  1XNR Q;  2EY1 A;  1TWC B;  3MEH A;  3J80 i;  3T51 B;  2EYL A;  1PFN A;  2B2V A;  5HY6 A;  5IYD H;  2JEB I;  2GVB A;  3GTQ H;  4A3F G;  1XNQ Q;  1DOK A;  1CM9 A;  1IL8 A;  1ET6 A;  4FF4 A;  4DR6 Q;  4ABN A;  3NTK A;  5L37 A;  4A3F H;  3CHB D;  3MAQ A;  3UE1 A;  1PH6 A;  5M9O A;  4DV7 Q;  4OGQ C;  1Z47 A;  4A3B H;  1SNC A;  5IOD A;  2NTS A;  1Q90 A;  1KNE A;  2CW0 C;  2KCT A;  4A3B B;  1IBM Q;  1TS3 A;  3GTM B;  2NTT A;  1M1K C;  2F0P A;  2L4N A;  3S9W A;  2A74 C;  4KI0 A;  4QIW E;  1PTO B;  2D2C C;  3KJO A;  4GN4 B;  4DGZ A;  4O1N A;  1Z9F A;  2XVS A;  2R93 B;  5C44 H;  2K1B A;  4RHR A;  1PH3 A;  3K8A A;  5IGF A;  2J4X A;  4Q5V A;  5E7N A;  4HN7 A;  2R93 H;  1AE2 A;  1VQ7 A;  1ZKO A;  1EY0 A;  1PDQ A;  3D6C A;  3RLN A;  3UE0 A;  1AZP A;  3J7A 5;  2F03 A;  4BS9 A;  2Y0S E;  1G2S A;  4QF4 A;  3TDQ A;  3T1H L;  3I4N B;  3W3A A;  2DNE A;  1K9M C;  2JA6 B;  2HDL A;  3A56 A;  2B3G A;  3OYY A;  2AQ1 B;  2AUK A;  5IGD A;  2JN4 A;  5COR A;  1BR9 A;  5AFW A;  1D5Z C;  1KXL A;  4CBV A;  4HAE A;  1BBU A;  4YHH L;  1DD2 A;  1P16 A;  4OIK A;  1YNX A;  3HOX H;  3DLL A;  4R4T A;  1JWS D;  3DWQ A;  2B2Y C;  2A68 D;  3CP0 A;  4PNY A;  2KA7 A;  3URY A;  2F0J A;  4DV0 Q;  1A15 A;  2HDM A;  1GUG A;  3T1Y L;  5C4Z A;  1KQS A;  1GM5 A;  2NVY H;  3U9O A;  4LF7 Q;  2WV6 D;  3RZD H;  1Y1V H;  4U68 A;  3CCL A;  3PV0 A;  2RF4 A;  1KDC A;  2KJX A;  3NBH A;  1GUO A;  1A3U A;  2JA6 G;  2BH8 A;  4DU9 A;  2NN6 G;  1K73 C;  2IHE A;  4H7B A;  2KCN A;  4DR1 Q;  3NEM A;  1AE3 A;  5EPJ A;  1OTC A;  5BR8 L;  1X3E A;  4NW2 A;  4LNQ A;  3NBI A;  2XWJ B;  5M3M H;  5M5W B;  3L3O C;  1A2T A;  1HPC A;  5JEA H;  2LY7 A;  3RN5 A;  1SYC A;  4QMG A;  5IGG A;  2F0D A;  5G3L F;  1X54 A;  3M85 A;  1IYV A;  1Q8I A;  4DA2 A;  4DV2 Q;  2OWO A;  1D2B A;  2JP1 A;  1B9M A;  3HKZ B;  2IX1 A;  3BVG A;  1TWF B;  4BBS B;  4FVM A;  3UDG A;  4A3L G;  2R7Z B;  4UPA A;  1CT1 D;  3T13 A;  4CHT B;  4ME3 A;  2Q8T A;  3S1Q B;  4IJL A;  4ZAI A;  1MSH A;  1B7Y B;  2Q2T A;  4ULL A;  2AQ2 B;  5AJ3 Q;  2NVX B;  2YU9 H;  3M7G A;  1DXM A;  1F2M A;  4GLA C;  3GTO H;  2R7F A;  2KHI A;  5JVG 3;  2CH4 W;  4JBJ A;  3AFQ A;  3TS2 A;  3CCJ A;  1PTO D;  1GOZ A;  1VF5 C;  4AYB E;  3P7J A;  1WI5 A;  4B08 A;  1AEX A;  2UXC Q;  1XPO A;  1EFW A;  2Z4H A;  1S5D D;  1I94 Q;  2KHJ A;  5LHY 1;  1F77 A;  2RDG A;  1SSO A;  3A5Z B;  4CKB A;  1GUS A;  2B63 H;  4NMZ A;  4DR4 L;  1LYL A;  5C3E G;  4JI7 Q;  3HEJ A;  3ULL A;  1QUQ B;  2YV5 A;  4E6I A;  2K03 A;  3Q6S A;  4AH6 A;  1SRO A;  3CPF A;  4J8Q A;  5DEH A;  3DWP A;  1H95 A;  3E3X A;  4JI0 L;  2JSO A;  3SXH A;  4A3F B;  5A35 A;  2B39 A;  3N6R A;  4IUQ A;  2N88 A;  5JJK A;  4F7X A;  2ZJQ A;  1N36 Q;  3C46 A;  1E3P A;  5C3W A;  2C35 B;  4A3D B;  3A55 A;  3OMG A;  3B6Y A;  2F52 A;  1GKH A;  5I6W A;  2NVQ H;  2L11 A;  4JI3 Q;  2CVR A;  3KBX A;  4A3E B;  3FKI G;  2JA5 B;  4I7A A;  1W3S A;  3VR2 A;  1VCI A;  1PZI D;  3UI2 A;  1JOQ A;  3FRP B;  1STY A;  1N8R C;  1NR4 A;  1IBM L;  1WCM G;  1Y14 B;  1KAA A;  5DLQ E;  1GUT A;  4GKJ L;  3CQZ H;  1HNZ L;  4TQU S;  1XJV A;  2K50 A;  1MD2 D;  2F0W A;  1PVO A;  3PO2 G;  3S1N B;  2EY2 A;  4LFB L;  1KL9 A;  1V9P A;  5FOB B;  1C0A A;  5FO8 B;  4DV6 Q;  3D8G A;  3UDF A;  2DJF C;  3W2D A;  3I4M G;  1Q86 C;  3SK8 A;  1TR5 A;  4IFD I;  3X3N A;  1KC8 C;  5KIX A;  2E76 C;  3MC0 B;  3H09 A;  1BDO A;  2JA5 H;  3GV3 A;  3RLF A;  3M9B A;  1SLJ A;  4KKS A;  2HD3 A;  1XNR L;  2F0S A;  1VDZ A;  1PFS A;  4IPG A;  3TZU A;  1U4M A;  4LF9 Q;  2XTI A;  5KYI A;  3G71 A;  3WOE A;  1BNZ A;  4GLX A;  5ELC A;  3S1M B;  1WTH A;  1OXX K;  2EYF A;  2EXZ A;  5IWA L;  4R4C A;  2BA1 A;  2CCZ A;  4YHH Q;  2PI2 A;  3AQQ A;  5GAH C;  2YTV A;  4OL7 A;  3J81 E;  4YCW A;  2KCM A;  5M3F B;  2F0Q A;  4DV4 L;  3C3L A;  1G6P A;  4IQZ A;  2IHF A;  1IKL A;  1QUQ A;  1PYS B;  2G9H D;  4FNF A;  1U4P A;  1TVX A;  2R7Z H;  2UUA L;  2K75 A;  5IYC H;  1XPR A;  3NEL A;  1MJE A;  5K36 H;  5FK9 C;  1VQ4 A;  4QCL A;  4C1N I;  3PIP 3;  3OMC A;  3L0O A;  4UAI A;  4G4K A;  3TEH B;  4CDE C;  3F8T A;  2JXM B;  2KVM A;  5EBC A;  1GVP A;  1HQM C;  4DR2 L;  4AIM A;  3S2H H;  2RCN A;  3ND8 A;  3F2B A;  4H0L C;  2EZV A;  2E2J B;  2F0G A;  5GAG C;  1VQL A;  1ROD A;  2K7V A;  1DOM A;  1BUV T;  1PRT C;  5FO7 B;  2WP8 J;  4C1N K;  4X64 Q;  3EIV A;  4KJN A;  4LF4 Q;  3H94 A;  2MHV A;  3H0G B;  4HED A;  3I4N H;  3SGI A;  1PTO C;  3L7Z C;  3S14 B;  4K5W A;  3DMU A;  5FLM G;  4K2L A;  3PF5 A;  1O7L A;  4DR6 L;  4LJZ C;  1SNP A;  1YZ6 A;  1E1T A;  2OXP A;  4DR5 Q;  2UUC Q;  4JI4 L;  2LFN A;  3DWA A;  1A63 A;  4LF8 Q;  4BBR G;  2QCP X;  1NTG A;  4A3J H;  3SK6 A;  1BF4 A;  4MNO A;  2EYP A;  1L2F A;  1WCM H;  1HR0 L;  4P71 A;  1Q1E A;  3N52 A;  4PV1 C;  3HFZ B;  2ZXP A;  3OTO L;  1BCP D;  5I9O A;  4OON A;  5CV7 A;  4OHJ A;  4A3G H;  1UWV A;  2F0F A;  1SJH D;  2YTX A;  2VQE Q;  1V8Q A;  1M90 C;  4CJ2 C;  4A3G B;  1KNA A;  4BY1 B;  5E4W C;  1N9W A;  1ASZ A;  1O7I A;  2Z8L A;  4DV1 L;  3CF5 A;  2EYM A;  2HCC A;  5ELN A;  4DK1 A;  1YJN A;  1O7Y A;  4PMC A;  1QE6 A;  3FPU B;  3PUX A;  1I50 H;  4PG3 A;  4NXN Q;  1SXT A;  5EPK A;  3TQY A;  4A3D G;  1LAB A;  1E2V A;  4WJW A;  4YWM A;  3HOX B;  1I50 B;  3GTL H;  1DGS A;  4A93 B;  3NSW A;  2IX3 A;  2JYO A;  2B8F A;  2F0V A;  1VMC A;  4JI3 L;  1WYD A;  4C2M H;  4B3R Q;  1DCZ A;  1H9M A;  1N36 L;  2KOL A;  2C5C A;  3I7F A;  5M3F H;  4DFA A;  3G48 A;  5IYB H;  1HJP A;  1LTG D;  2DY7 A;  1XPU A;  1VQ6 A;  1X56 A;  4G57 A;  4OWW B;  1K83 H;  2ZTE A;  4Y7N H;  1QZH A;  4IOC A;  3NQI A;  3JC6 6;  4K5V A;  2N78 A;  3S14 H;  2DY8 A;  4LF7 L;  1FD7 D;  4JI1 Q;  3NE5 B;  4JVZ A;  4G7H C;  4PMB A;  1QNK A;  2Z4I A;  1QNU A;  4A3G G;  1VQD A;  2Q2H A;  4DAY A;  1Z6H A;  3S16 H;  4FYD A;  5LMN L;  3CPW A;  4NXM L;  3QJY A;  4TVA B;  1X6O A;  1ENC A;  2Y0S G;  3HOZ G;  1FGU A;  2KHS A;  1J5E L;  4FDB A;  1T5E A;  2E2J H;  2EE1 A;  3S2H B;  3GTG H;  4GZY C;  2Z1C A;  3GTK H;  5M3M G;  4YWK A;  3J81 L;  3S1Q H;  1NJI C;  1RDP D;  3OWF A;  2X6G A;  1XTD A;  3G6J B;  1C8C A;  4O42 A;  1YIJ A;  2RHQ B;  2FMC A;  2IL8 A;  1FNW A;  3M4P A;  4QJF A;  1S4Z A;  1AP0 A;  1CA6 A;  1HXY D;  2PQA B;  3KF8 B;  3DEP A;  5CGK A;  5LMU L;  2DJG C;  4RCN A;  2MO1 A;  4ZYS A;  2L55 A;  4A3E H;  5LMN W;  2Q2U A;  4R4Q A;  3AYH B;  4JI2 L;  1HTP A;  1SMX A;  1X65 A;  2A8V A;  1BOS A;  2WFW A;  1PHJ A;  1JCK B;  5EPL A;  1SMY C;  1N33 L;  4HMI A;  4PZ7 A;  2K52 A;  4JI4 Q;  2QA4 A;  5IYB G;  2K6A A;  1CQF A;  1CA5 A;  2V1C C;  3QB3 A;  5E3F A;  3I3C A;  1F2Y A;  2R61 A;  3HOY B;  2Z6K A;  1ZYR D;  2E2H H;  2L12 A;  3RD4 A;  3SHL A;  1TS5 A;  1SEB D;  1VQI A;  4AYB G;  1Y1W B;  2HIX A;  5IT9 c;  3T16 A;  1YHA A;  2N3S A;  2G5D A;  1F9Q A;  2L0C A;  2KBN A;  3FHW A;  4A3D H;  1EEI D;  4P75 A;  1Q81 C;  3J81 j;  1WD1 A;  1PLF A;  5IT9 E;  2R93 G;  4ME5 A;  4KHZ A;  5GAD C;  1RTO A;  2F0H A;  4L6T B;  1L0W A;  2F3I A;  2PW7 A;  4DV6 L;  1II3 A;  1EYC A;  4WRD A;  4GNX A;  1VQO A;  1EQT A;  4R1J A;  5CV6 A;  1AFP A;  2A6H C;  4HID A;  2TSS A;  2O2L D;  2ZTD A;  1Q7Y C;  5IP7 H;  2E5L L;  1BQQ T;  3TME A;  4M8A A;  4DR5 L;  1FGB D;  1TWH H;  3K80 C;  3NXW A;  1HR0 W;  1YNN D;  5KGU A;  3HP3 A;  1LTL A;  4X62 L;  4A3J G;  3E9I A;  2EPB A;  1IZ6 A;  5D3I B;  4U67 3;  1W2B A;  1LTA D;  5IGE A;  1WTP A;  3IL8 A;  2ID0 A;  3KLS X;  1CKN A;  1QVG A;  1FJG Q;  4KTA A;  1G51 A;  1FYC A;  4RGM A;  4KLK A;  3OIP A;  1SYG A;  2F0K A;  1CSQ A;  1VQ9 A;  2OF1 A;  2HQL A;  2WIN B;  1K8G A;  4ZRZ A;  2VQE L;  4IO9 A;  3PO2 H;  3S17 H;  4BXX G;  3LWE A;  1NSN S;  1RD9 D;  3GP7 A;  3ZJY C;  3RZO H;  3VR5 A;  2CKZ B;  4DNI A;  4NB3 A;  3VR4 A;  1VQN A;  1V1Q A;  3R3O A;  1WJJ A;  4YCV A;  4ZKB B;  5KYL A;  3C1F A;  2L1B A;  3HOW G;  3CCS A;  1U4L A;  4I65 A;  1EY8 A;  3OOC A;  3MFG A;  2EDG A;  1OXV A;  1UEB A;  3JAM c;  1S5B D;  2R6G A;  4X65 L;  1IL2 A;  3P1H A;  2OT2 A;  1PFB A;  1PXU A;  2LXJ A;  2WII B;  4C3H B;  5KEE A;  4R4O A;  3HRZ C;  4A3I B;  4C3I G;  3U58 A;  1ILQ A;  2KUM A;  1L0X B;  2RSO A;  5DAU A;  1B70 B;  1CHP D;  3NTI A;  4HSP A;  3MXU A;  3S16 B;  3BZC A;  2JQO A;  3E0E A;  2MP1 A;  5ISR A;  1H9S A;  5AJ3 L;  3Q0A A;  4QUC A;  5FLX c;  5IYC G;  4IFD J;  1TWF H;  2R7Z G;  4BBS H;  3IKJ A;  3KJP A;  3CRL C;  4ZK9 B;  1LT3 D;  1BBW A;  3O13 A;  1PYB A;  5C3E H;  1XX8 A;  3GTQ B;  1L0Y B;  3ULP A;  3TSS A;  2F4I A;  1LTI D;  4LUO A;  4OX9 Q;  1SE8 A;  2B2T A;  2H5X A;  3QOJ A;  1CTM A;  4FF3 A;  1PH1 A;  3A74 A;  4DK3 C;  4C3J B;  1X3G A;  1ONL A;  3GTP B;  3HG9 A;  3NEN A;  2VUM H;  3C1E A;  3JAM i;  1JB3 A;  1ENA A;  1PRT F;  1SFO H;  5D14 A;  3R8B A;  1J5E Q;  1NNX A;  1C48 A;  3SR1 A;  4RGN A;  4X3S A;  4JG2 A;  5ELF A;  5C3X A;  2FIN B;  2PZU A;  5FJ8 G;  5JPM C;  1LUZ A;  1IYU A;  4C2M B;  2VB2 X;  2E5L Q;  1H9R A;  1LTR D;  1CSP A;  2HCI A;  2LXK A;  3BZD B;  4XT1 B;  1UAP A;  5I4D A;  3GO5 A;  2MJ8 A;  1PH5 A;  1EYA A;  3CC2 A;  1PH8 A;  1HR0 Q;  3J81 c;  1L1O A;  3S15 B;  1QVF A;  2M00 A;  4GOP C;  2KEE A;  4JI8 L;  1ESR A;  2G9D A;  2AQ3 B;  2BE5 C;  3GD7 A;  1SE3 A;  2ZXR A;  1Y8N B;  1EQV A;  4C3I H;  2ASB A;  4KHP Q;  3K0X A;  1EWC A;  4DUY L;  4TSS A;  1F9P A;  3HOY G;  4POG A;  3OHX C;  2CHB D;  1DZ1 A;  2MPM A;  4QQB X;  1STA A;  3KF6 A;  4JI2 Q;  3RZD B;  2MO0 A;  3NBH B;  4IUT A;  1EOT A;  3HOW H;  1STE A;  5K5P A;  3GTJ B;  1GHK A;  2ES2 A;  2UXB Q;  3CMA A;  5LMU Q;  1HNW L;  4RHS A;  4XQN A;  1DON A;  2KEN A;  1SYF A;  4JOI C;  1WVL A;  3QG1 A;  2XWB B;  3DM1 A;  3AEV A;  2SEB D;  4RAU C;  4CDC C;  1XMQ Q;  4OIJ A;  4K8I A;  1WTR A;  2Q2I A;  2PYK A;  2MNA A;  1TKW B;  1PH9 A;  3TRZ A;  4YIJ A;  5JPN C;  3A8J E;  5FLX E;  2I46 A;  3M3Y H;  4LW1 A;  1VQH A;  1NMG A;  3PIP A;  2L5T A;  4J15 A;  4C3J G;  2SOB A;  2K32 A;  1XWE A;  3RUZ A;  5CBE E;  1U5K A;  3OWE B;  2BOS A;  1EYG A;  1EZ6 A;  5FO9 B;  4HJ8 A;  3BYT B;  4OEL B;  1PRT B;  1VQF A;  1WD0 A;  3LWU A;  2FHT A;  1G2T A;  1E2Z A;  1TWC H;  1EY6 A;  1TY0 A;  2B63 B;  4IOA A;  1ILP A;  3FKI H;  2PMZ B;  3BDL A;  1S72 A;  1J8I A;  3HOY H;  2PZW A;  3VR6 A;  3MHB A;  2K01 A;  1G29 1;  2K33 A;  4XT3 B;  1TQO A;  4MHE A;  2EYO A;  3K5M A;  4BY7 B;  4L5Q A;  1HTL D;  2H4O A;  4GOP B;  4OO1 H;  3DEO A;  1JR0 D;  4PZ6 A;  4ZLT F;  2HT1 A;  5IY0 A;  2JE6 I;  1JJC B;  4KN4 C;  4A3B G;  4BBS G;  2WAC A;  3RN2 A;  3BJU A;  1VQE A;  2EVB A;  2R3Z A;  4QL5 A;  4HIK A;  1NBW A;  1STH A;  1STB A;  3UDI A;  1Z7T A;  4DUZ L;  1G6Z A;  1HNX Q;  2XNA C;  4LF4 L;  4CKE A;  2I5M X;  4CDF C;  1S5F D;  5JJL A;  5H1S E;  3H91 A;  1S40 A;  4XTC S;  1AH9 A;  2Z6B A;  4X3K A;  4DR3 L; 
#chains in the Genus database with same CATH homology
 5JEA J;  1IKM A;  2F1M A;  2ICE C;  2A6H D;  3BVZ A;  2NN6 I;  1TY2 A;  2O5J C;  2F0N A;  3T56 B;  4XQQ A;  3J80 L;  4WFN 3;  3M4O B;  2XIW A;  3WOF A;  2VUM B;  3A8K E;  4LK1 C;  5KRU A;  1NAP A;  3ITP A;  2RBM A;  4KD3 A;  4H13 C;  5DNF A;  1KDB A;  2O5I C;  5EQ0 A;  2EJF C;  3CU7 A;  1TWA B;  2H1E A;  2A6E D;  3SE0 A;  2A68 C;  5KND A;  1CZW A;  2PPB C;  4V0B A;  2HQE A;  1TWH B;  3I4M B;  2JA7 B;  3NHH A;  2B2W C;  4KKU A;  3I90 A;  2NN6 H;  1O80 A;  3NTH A;  2RVL A;  2E74 C;  3K5O A;  2F0O A;  4RH6 A;  1I4P A;  3S2D B;  4DN4 M;  4FXK C;  2WKC A;  4G7O C;  4IUR A;  3VYR A;  1V1P B;  2K04 A;  3AU7 A;  1QCB D;  1D5M C;  4DAP A;  2PCF B;  2IW3 A;  2PQE A;  4MIU A;  1LTB D;  2B2U A;  5IIF A;  4CJ0 B;  3G7L A;  1SJE D;  1ICW A;  1PFM A;  4A3J B;  2E2D C;  1LLR D;  5HUR A;  5G3L D;  2IJ0 A;  2I07 B;  4CJ1 B;  3HOZ B;  4CKC A;  3MWY W;  1CQV A;  4NP5 A;  1WTX A;  3A7L A;  2J0T D;  1EY5 A;  1M4V A;  1STN A;  2BDN A;  2NVT B;  4KD4 A;  5C3E B;  1JC7 A;  2KCC A;  3F2U A;  3PUW A;  2F0E A;  4RWS C;  2BCO A;  1G8Z D;  1T5X D;  5C0X I;  3MVV A;  2TMP A;  3OIQ A;  5EJW A;  3EVQ A;  1RF2 D;  1B9N A;  1I4Q A;  1CZG A;  1JOO A;  4TKO B;  4KK7 A;  2AUJ D;  3K7A B;  1SBB B;  2A69 D;  3IFD A;  2D62 A;  3T4A C;  3BDO A;  3U9S A;  1GUN A;  4C3H G;  3CKI B;  3I8Z A;  3NPP A;  4IUN A;  4F8M A;  3RZO B;  1KTK A;  2FMM A;  4FF1 A;  1KLG D;  4X3U A;  2K5D A;  3QIA A;  4DNR B;  1YNN C;  4FO2 A;  3S1R B;  1HA5 A;  3I73 A;  2EY5 A;  1BCP F;  3VYT A;  2IWH A;  5K36 G;  5JEA G;  5CC4 A;  3S17 B;  3NP8 A;  1WTW A;  1LTS D;  3HGB A;  4QB4 A;  4OO1 G;  5C0X J;  4RGO S;  4P2C B;  5J1Z A;  2PO4 A;  1F2Z A;  2MUY A;  3I72 A;  3X3M A;  1I4R A;  1Q3L A;  3H6M A;  1FNV A;  3P75 A;  1RJT A;  1TS4 A;  3NK9 A;  1TII D;  5T1I A;  3GV6 A;  4XYQ A;  3KUP A;  3MXG A;  4FXG C;  3NQT A;  1ZYR C;  2WAQ B;  1CK1 A;  1I4X A;  1XTC D;  2EYJ A;  2BDO A;  3R93 A;  1SYB A;  1EYD A;  4IUV A;  5IGC A;  2A5H A;  4HR7 B;  3PO3 B;  2E2I B;  3VA5 A;  1EIG A;  5C44 B;  4MN3 A;  3Q23 A;  4HMJ A;  4XYO A;  5C4H A;  3FMC A;  1NR2 A;  3CRK C;  5CMD A;  1V1O A;  3SEB A;  3IAY A;  1I4H A;  2ICI A;  1YNJ C;  5IGB A;  3E5S A;  3QO2 A;  3MZ5 A;  3FDT A;  4KMU C;  1ET9 A;  1WCM B;  4DAV A;  2B2U C;  5JJZ A;  2J7Z A;  2RDF A;  2KQ3 A;  3FKI B;  1RKN A;  1LT5 D;  1Q1B A;  4L8J A;  2MGS A;  3M4Y A;  1FNU A;  4EVO A;  3Q24 A;  4K5X A;  3AB9 A;  4N9T A;  4TRD A;  1CI3 M;  4IUU A;  1H9J A;  3HZX A;  4EQN A;  1QB5 D;  5ELD A;  1WTQ A;  5CYU A;  1X32 A;  3IFT A;  3H3V C;  1B1Z A;  3FEW X;  2RQX A;  3BYY B;  2YU9 B;  3PUZ A;  1EFI D;  1D1I A;  3J7A V;  2D5D A;  2AWO A;  2K5Q A;  1U4R A;  1A3T A;  3MTS A;  2EJM A;  1XYI A;  1A6X A;  1FR3 A;  4XDX A;  2FJ2 A;  4F87 A;  2ZXO A;  4N9P A;  3LNN A;  4R8I A;  1E0B A;  2Q8I B;  3SVM A;  4IFD H;  2LKV A;  2B2Y A;  3TP5 A;  4BWG B;  1Y1V B;  1S5E D;  1AN8 A;  5T1G A;  3SK5 A;  2F3V A;  3GTO B;  5LL6 S;  3K59 A;  4ZUI A;  4RFB A;  3V2T A;  1DOL A;  4QIW B;  2VB3 X;  2CW0 D;  3AMU A;  1YNJ D;  5KNB A;  3EA6 A;  1S5C D;  1OXU A;  3M7N A;  1TU2 B;  5IT9 L;  1JWU D;  1JWM D;  3ERQ A;  3HOW B;  3DHQ A;  3FPP A;  1SNM A;  3LX0 A;  2F0L A;  3D3R A;  3QWN A;  2K28 A;  2D9U A;  5EBD A;  2SDF A;  3BG3 A;  4R8N A;  1X3P A;  2A73 B;  1H9S B;  5C4J B;  1PRT D;  1SMY D;  1B50 A;  5CV9 A;  4G7Z C;  2HUG A;  3V96 A;  3A7A B;  3TP6 A;  1IW7 D;  3I4L A;  3K5L A;  1F9S A;  2LS0 1;  3KF8 A;  5ELE A;  3C2P A;  1EWH A;  1MGS A;  4M1U B;  4IFD G;  1OXS C;  5I2X A;  1EY7 A;  2EYH A;  1MI2 A;  5EKI A;  1QIL A;  1C4Q A;  1JOR A;  1RCV D;  4C56 C;  4K6D A;  1K83 B;  4BBR B;  1OO9 B;  1DJR D;  4A3M B;  2ZT9 C;  5CR3 A;  2JEA I;  1MBY A;  2QDB A;  1I6H B;  4B9X A;  4KKT A;  2F0M A;  2N55 A;  1EL0 A;  5E1F A;  1PTO F;  3PUV A;  4IN3 A;  4IUP A;  2EOT A;  4KN7 C;  3M3Y B;  1JE4 A;  1R9T B;  2IX0 A;  5JOB A;  1NCV A;  2RKS A;  4RKB A;  1V43 A;  2B8G A;  2DN8 A;  5FLX L;  4S3S A;  5BN4 A;  5CBA E;  3TP7 A;  3FVQ A;  5M5Y B;  5C5L A;  1D1K A;  2V4D A;  4R9W A;  2XSC A;  2VNU D;  1HQR D;  4EQO A;  1Y8P B;  4JK1 C;  4PMW A;  2Y0S B;  3GTL B;  4RCO A;  1PZK D;  2PNR C;  1PYW D;  2QF7 A;  3D4R A;  5C4X B;  1GHJ A;  4KY6 A;  1TT2 A;  2XRS D;  1UEA B;  1I3Q B;  1LT6 D;  3OPO A;  5D3D A;  2WKD A;  4K6L A;  2YYZ A;  2LMC B;  1V1P A;  4LMQ D;  4RKL A;  4KV6 A;  4LAA A;  1HFG A;  3TN2 A;  3MXP A;  4XIG S;  2EJG C;  3D31 A;  4B9W A;  2X6L A;  3EJI A;  1BCP C;  2ENB A;  3MFY A;  4J1M A;  2EY6 A;  3KLR A;  3SK4 A;  3GTG B;  2DNC A;  4UDU C;  1K8O A;  1QG7 A;  1HCZ A;  2PW5 A;  1A3V A;  1AW7 A;  4AYB B;  4DXF A;  4IZ8 A;  1QOH A;  5ELB A;  4DF7 A;  1GUW A;  2PZT A;  3ONA B;  3E0J A;  1PTO H;  3R2I A;  2WB1 B;  4NKL A;  2F3W A;  1EY4 A;  4HSV A;  2F0T A;  2F0U A;  1SAP A;  3ZYY X;  3RMH A;  2O4X A;  1CFM A;  4Z9C B;  4WOR A;  1VF7 A;  1EY9 A;  1ZXT A;  1B53 A;  3J7Y W;  3WDN A;  3Q22 A;  2GA4 B;  1O7Z A;  2XRQ D;  4Y7N B;  1R4Q B;  5E4X A;  3KK7 A;  2QKI C;  1K8M A;  5FKA C;  1PMR A;  5C0X H;  2KEC A;  1XXG A;  3HOU B;  1RTN A;  5C5M A;  3ERO A;  1JQY D;  1IW7 C;  3TBI B;  5I9P A;  1CHQ D;  1IHZ A;  5IOC A;  1GXD C;  3VYS A;  2NUC A;  2SNS A;  4V19 0;  1RHP A;  3HOV B;  1H9K A;  4KHV A;  2FFK B;  5EGT A;  3J80 E;  1HA6 A;  1BCP B;  1ENF A;  1SYD A;  3VYU A;  1SYE A;  1PZJ D;  3NWT A;  1MSG A;  1VMP A;  1Y8O B;  2A69 C;  3HS0 C;  1EU4 A;  3OW7 A;  2NVQ B;  1SFO B;  1WTO A;  1GJX A;  2RSN A;  4CGY B;  1BBX C;  2K05 A;  1G91 A;  2M2L A;  1DM0 B;  1W6K A;  4RGT A;  3JAM E;  3K5N A;  4F88 A;  2RA4 A;  1SNO A;  4KY7 A;  4RA8 A;  2RDH A;  5TSS A;  1STG A;  5A2Q E;  4DK0 A;  1SDF A;  4XQJ A;  1E2W A;  4Q0F A;  3I91 A;  4K14 A;  3GQB A;  2JA8 B;  3K0Y A;  1R4P B;  4ILW A;  3CQZ B;  1O78 A;  2F0I A;  5CV5 A;  1WTV A;  4FP5 D;  1UUP A;  2B2W A;  3PMF A;  4QUF A;  1SE2 A;  1D6E C;  1HFN A;  1EEF D;  1F9R A;  1Y69 U;  4DXG A;  4NDX A;  2R92 B;  2NYZ D;  4HCS A;  2VXW A;  3A8I E;  3EQL C;  4XXE A;  5J39 A;  1JIC A;  1HUN A;  2AWN A;  1I6V C;  2B2V C;  1AZQ A;  5BN5 A;  1SE4 A;  2XN9 C;  1J9O A;  5CV4 A;  1BXT A;  3KBG A;  5I6Y A;  1D5X C;  3V05 A;  5JVH 3;  1EZ8 A;  2X69 A;  1QJO A;  3DXJ C;  4HTH A;  5LL6 X;  2NBF A;  2BE5 D;  4A3K B;  2NB0 A;  2IPK D;  3K57 A;  1SNQ A;  3MXN A;  2QEJ C;  4PQX A;  1DYQ A;  3D6W A;  2BA0 A;  3MA2 B;  1I4G A;  1LTT D;  3ND9 A;  2OEO A;  4EQP A;  1OXT A;  1TS2 A;  1ML0 D;  2NZ1 D;  3PO2 B;  3A54 A;  3NUC A;  4FXD A;  3D4W A;  3VR3 A;  1LT4 D;  3P20 A;  1LO5 D;  1B3A A;  1NUC A;  4L63 B;  2IT1 A;  5D65 A;  2K5W A;  4KY5 A;  5KNC A;  3VA7 A;  3T53 B;  5JAV A;  4IAL A;  4DNT B;  3TP8 A;  1M8A A;  1HRJ A;  1HHV A;  1A2U A;  4K8J A;  4ZUJ A;  4I7Z C;  2SNM A;  1KDA A;  2CQA A;  5CV8 A;  4ZKC B;  1B2T A;  3K6O A;  1X3Q A;  3I70 A;  3SDZ A;  4BA2 I;  2QIL A;  5EKK A;  1UNS A;  3BDC A;  5M5X B;  4EGV A;  4JBW A;  2Q8R E;  4OO1 I;  3R2T A;  4H44 C;  1B44 D;  2E2H B;  2NVY B;  5NUC A;  3J7A F;  1KAB A;  3PIO 3;  1Q12 A;  4J6H A;  3DUZ A;  1JOK A;  5C6A A;  3TZD A;  5COY A;  5F2D A;  2B2T C;  3QOL A;  4ID6 A;  3NWS A;  1SND A;  2C9O A;  5C0X G;  1EIH A;  1BO0 A;  2L9H A;  3D4D A;  1QWY A;  5DM7 3;  4ZQ3 A;  2NWG A;  3PUY A;  5HGT A;  1ESF A;  5BN3 A;  1W6J A;  1LV9 A;  1U9R A;  3KLS A;  1F2L A;  1TWG B;  5DM6 3;  4KJO A;  3BS1 A;  4HCE A;  3E6Z X;  5I2Y A;  3L9A X;  3OSO A;  3GTK B;  5A2Q L;  2M9V A;  2KED A;  5M3M B;  1LAC A;  5EKL A;  4ODG A;  3BVM A;  4K2K A;  1ZEQ X;  4BA1 I;  4C3I B;  1B4O A;  4FF2 A;  4X3T A;  2A6E C;  5J22 A;  1HUM A;  3K58 A;  1KLU D;  3EFX D;  2E75 C;  1EU3 A;  2EY1 A;  1TWC B;  3MEH A;  3T51 B;  2EYL A;  1PFN A;  2B2V A;  2JEB I;  1DOK A;  1CM9 A;  1IL8 A;  1ET6 A;  4FF4 A;  4ABN A;  3NTK A;  3CHB D;  3MAQ A;  5M9O A;  4OGQ C;  1Z47 A;  1SNC A;  5IOD A;  4X3K A;  2NTS A;  1Q90 A;  1KNE A;  2CW0 C;  4A3B B;  1TS3 A;  3GTM B;  2NTT A;  2F0P A;  2L4N A;  3S9W A;  2A74 C;  4KI0 A;  1PTO B;  2D2C C;  4DGZ A;  4O1N A;  2XVS A;  2R93 B;  2K1B A;  4RHR A;  5IGF A;  2J4X A;  4Q5V A;  4HN7 A;  1ZKO A;  1EY0 A;  1PDQ A;  3D6C A;  1AZP A;  2F03 A;  4BS9 A;  1G2S A;  4QF4 A;  3TDQ A;  3I4N B;  3W3A A;  2DNE A;  2JA6 B;  2HDL A;  3A56 A;  2AQ1 B;  2AUK A;  5IGD A;  5COR A;  1BR9 A;  5AFW A;  1D5Z C;  4CBV A;  4HAE A;  1DD2 A;  4OIK A;  1JWS D;  3DWQ A;  2B2Y C;  2A68 D;  4PNY A;  2KA7 A;  3URY A;  2F0J A;  1A15 A;  2HDM A;  1GUG A;  5C4Z A;  3U9O A;  2WV6 D;  4U68 A;  3PV0 A;  1KDC A;  2KJX A;  3NBH A;  1GUO A;  1A3U A;  4DU9 A;  2NN6 G;  4H7B A;  2KCN A;  5EPJ A;  4NW2 A;  3NBI A;  2XWJ B;  5M5W B;  3L3O C;  1A2T A;  1HPC A;  5JEA H;  2LY7 A;  1SYC A;  4QMG A;  5IGG A;  2F0D A;  5G3L F;  3M85 A;  1IYV A;  1Q8I A;  4DA2 A;  1D2B A;  2JP1 A;  1B9M A;  3HKZ B;  2IX1 A;  3BVG A;  1TWF B;  4BBS B;  4FVM A;  2R7Z B;  1CT1 D;  3T13 A;  4CHT B;  2Q8T A;  3S1Q B;  4ZAI A;  1MSH A;  4ULL A;  2AQ2 B;  2NVX B;  3M7G A;  1DXM A;  1F2M A;  5JVG 3;  1PTO D;  1GOZ A;  1VF5 C;  3P7J A;  4B08 A;  1AEX A;  2Z4H A;  1S5D D;  5LHY 1;  1F77 A;  2RDG A;  1SSO A;  4CKB A;  1GUS A;  4NMZ A;  3HEJ A;  4E6I A;  2K03 A;  3Q6S A;  4J8Q A;  5DEH A;  3DWP A;  2JSO A;  3SXH A;  4A3F B;  5A35 A;  2B39 A;  3N6R A;  4IUQ A;  2N88 A;  4F7X A;  3C46 A;  5C3W A;  4A3D B;  3A55 A;  3OMG A;  5I6W A;  2L11 A;  2CVR A;  3KBX A;  4A3E B;  2JA5 B;  3VR2 A;  1VCI A;  1PZI D;  3UI2 A;  1JOQ A;  3FRP B;  1STY A;  1NR4 A;  1KAA A;  1GUT A;  4TQU S;  1MD2 D;  2F0W A;  3S1N B;  2EY2 A;  5FOB B;  5FO8 B;  3D8G A;  3W2D A;  3SK8 A;  1TR5 A;  4IFD I;  3X3N A;  5KIX A;  2E76 C;  3MC0 B;  3H09 A;  1BDO A;  3GV3 A;  3RLF A;  4KKS A;  2F0S A;  1VDZ A;  3TZU A;  1U4M A;  5KYI A;  3WOE A;  1BNZ A;  5ELC A;  3S1M B;  1OXX K;  2EYF A;  2EXZ A;  2BA1 A;  4OL7 A;  3J81 E;  5M3F B;  2F0Q A;  3C3L A;  4IQZ A;  1IKL A;  2G9H D;  4FNF A;  1U4P A;  1TVX A;  5K36 H;  5FK9 C;  4QCL A;  4C1N I;  3PIP 3;  3OMC A;  4UAI A;  4G4K A;  2JXM B;  2KVM A;  5EBC A;  1HQM C;  3ND8 A;  2EZV A;  4H0L C;  2E2J B;  2F0G A;  1ROD A;  2K7V A;  1DOM A;  1BUV T;  1PRT C;  5FO7 B;  2WP8 J;  4C1N K;  4KJN A;  3H94 A;  2MHV A;  3H0G B;  4HED A;  1PTO C;  3L7Z C;  3S14 B;  4K5W A;  3DMU A;  4K2L A;  1O7L A;  4LJZ C;  1SNP A;  2OXP A;  2LFN A;  3DWA A;  2QCP X;  3SK6 A;  1BF4 A;  2EYP A;  1Q1E A;  3N52 A;  4PV1 C;  2ZXP A;  1BCP D;  5I9O A;  5CV7 A;  4OHJ A;  2F0F A;  1SJH D;  1V8Q A;  4CJ2 C;  4A3G B;  1KNA A;  4BY1 B;  5E4W C;  2Z8L A;  2EYM A;  2HCC A;  4DK1 A;  1O7Y A;  4PMC A;  1QE6 A;  3FPU B;  3PUX A;  1SXT A;  5EPK A;  1LAB A;  1E2V A;  4WJW A;  3HOX B;  1I50 B;  4A93 B;  3NSW A;  2IX3 A;  2JYO A;  2B8F A;  2F0V A;  1VMC A;  1DCZ A;  1H9M A;  2KOL A;  2C5C A;  4DFA A;  1LTG D;  2DY7 A;  4G57 A;  3NQI A;  4K5V A;  2DY8 A;  1FD7 D;  3NE5 B;  4G7H C;  4PMB A;  1QNK A;  2Z4I A;  1QNU A;  4DAY A;  1Z6H A;  4FYD A;  3QJY A;  1ENC A;  2KHS A;  1T5E A;  2EE1 A;  3S2H B;  4GZY C;  2Z1C A;  3J81 L;  1RDP D;  3OWF A;  2X6G A;  3G6J B;  1C8C A;  4O42 A;  2FMC A;  2IL8 A;  1FNW A;  1S4Z A;  1AP0 A;  1CA6 A;  1HXY D;  3DEP A;  5CGK A;  4RCN A;  4ZYS A;  2L55 A;  1HTP A;  1BOS A;  1JCK B;  5EPL A;  1SMY C;  4HMI A;  2K6A A;  1CQF A;  1CA5 A;  3QB3 A;  5E3F A;  3I3C A;  1F2Y A;  2R61 A;  3HOY B;  1ZYR D;  2L12 A;  3RD4 A;  3SHL A;  1TS5 A;  1SEB D;  1Y1W B;  3T16 A;  1F9Q A;  2L0C A;  1EEI D;  1WD1 A;  1PLF A;  5IT9 E;  4ME5 A;  4KHZ A;  1RTO A;  2F0H A;  4L6T B;  2PW7 A;  1II3 A;  1EYC A;  4WRD A;  1EQT A;  5CV6 A;  1AFP A;  2A6H C;  2TSS A;  2O2L D;  1BQQ T;  3TME A;  4M8A A;  1FGB D;  3NXW A;  1YNN D;  5KGU A;  3HP3 A;  2EPB A;  5D3I B;  4U67 3;  1LTA D;  5IGE A;  1WTP A;  3IL8 A;  2ID0 A;  3KLS X;  4KTA A;  1FYC A;  4RGM A;  3OIP A;  1SYG A;  2F0K A;  2OF1 A;  2WIN B;  4ZRZ A;  3LWE A;  1NSN S;  1RD9 D;  3GP7 A;  3VR5 A;  3VR4 A;  3R3O A;  4ZKB B;  5KYL A;  3C1F A;  2L1B A;  1U4L A;  4I65 A;  1EY8 A;  3OOC A;  3MFG A;  2EDG A;  1OXV A;  1S5B D;  2R6G A;  3P1H A;  2OT2 A;  1PFB A;  1PXU A;  2WII B;  4C3H B;  5KEE A;  3HRZ C;  4A3I B;  4C3I G;  1ILQ A;  2KUM A;  1L0X B;  2RSO A;  5DAU A;  1CHP D;  3NTI A;  4HSP A;  3MXU A;  3S16 B;  2MP1 A;  5ISR A;  1H9S A;  3Q0A A;  4QUC A;  4IFD J;  3IKJ A;  3CRL C;  4ZK9 B;  1LT3 D;  3O13 A;  1XX8 A;  3GTQ B;  1L0Y B;  3TSS A;  2F4I A;  1LTI D;  2B2T A;  3QOJ A;  1CTM A;  4FF3 A;  4C3J B;  1ONL A;  3GTP B;  3HG9 A;  3C1E A;  1JB3 A;  1ENA A;  1PRT F;  5D14 A;  3R8B A;  1C48 A;  3SR1 A;  4RGN A;  4X3S A;  5ELF A;  5C3X A;  2FIN B;  2PZU A;  5JPM C;  1IYU A;  4C2M B;  2VB2 X;  1H9R A;  1LTR D;  2HCI A;  3BZD B;  4XT1 B;  1UAP A;  5I4D A;  3GO5 A;  2MJ8 A;  1EYA A;  3S15 B;  2M00 A;  2KEE A;  1ESR A;  2G9D A;  2AQ3 B;  2BE5 C;  3GD7 A;  1SE3 A;  2ZXR A;  1Y8N B;  1EQV A;  1EWC A;  4TSS A;  1F9P A;  3OHX C;  2CHB D;  1DZ1 A;  2MPM A;  1STA A;  3RZD B;  4IUT A;  1EOT A;  1STE A;  5K5P A;  3GTJ B;  1GHK A;  4RHS A;  4XQN A;  1DON A;  1SYF A;  1WVL A;  3QG1 A;  2XWB B;  3DM1 A;  2SEB D;  4RAU C;  4OIJ A;  4K8I A;  1WTR A;  2PYK A;  1TKW B;  4YIJ A;  5JPN C;  3A8J E;  5FLX E;  2I46 A;  2L5T A;  4C3J G;  2SOB A;  2K32 A;  1XWE A;  3RUZ A;  5CBE E;  3OWE B;  2BOS A;  1EZ6 A;  5FO9 B;  3BYT B;  1PRT B;  1WD0 A;  3LWU A;  2FHT A;  1G2T A;  1E2Z A;  1TY0 A;  1EY6 A;  2B63 B;  1ILP A;  2PMZ B;  3BDL A;  1J8I A;  2PZW A;  3VR6 A;  2K01 A;  3MHB A;  1G29 1;  2K33 A;  4XT3 B;  1TQO A;  4MHE A;  2EYO A;  3K5M A;  4BY7 B;  1HTL D;  2H4O A;  4OO1 H;  3DEO A;  1JR0 D;  4ZLT F;  2JE6 I;  4KN4 C;  2WAC A;  2EVB A;  2R3Z A;  1STH A;  1STB A;  1Z7T A;  1G6Z A;  2XNA C;  4CKE A;  1S5F D;  3H91 A;  4XTC S;  3JAM L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...