3TZDA

Crystal structure of the complex of human chromobox homolog 3 (cbx3)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
58
structure length
58
Chain Sequence
LYFQGEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna binding protein
molecule keywords Chromobox protein homolog 3
publication title Structural basis of the chromodomain of Cbx3 bound to methylated peptides from histone h1 and G9a.
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2011-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3tzdA00
1O7ZA 4LMQD 5CMDA 1EOTA 4ZKBB 2HDLA 1CA5A 2B2TA 4HEDA 2B2WC 2B2UA 4IUPA 3MTSA 4IUTA 1RODA 1SDFA 3LWEA 2X6GA 5E4WC 1PLFA 2L1BA 2KEDA 1ESRA 2K05A 1EQTA 4HAEA 1XYIA 1CM9A 2K1BA 4MN3A 4MHEA 1WTPA 4IUVA 1U4LA 2KVMA 2FJ2A 3D6WA 5EPKA 3TZDA 3DEPA 3KUPA 2H1EA 1RTNA 2B2VA 4X3KA 5CBEE 1G2SA 3TN2A 4RA8A 1MSHA 5AFWA 4IUQA 2KECA 5EPLA 5EQ0A 3R93A 2FMMA 3FDTA 4RWSC 1B50A 4U68A 1SAPA 1ZXTA 1O7YA 1QNKA 2N55A 5JJZA 1HUMA 2KOLA 5T1GA 1HHVA 4X3UA 2HDMA 1MI2A 1WTOA 1PDQA 1X3PA 4OIKA 2EOTA 5D65A 2NYZD 2B2YA 3G7LA 1U4RA 3KBXA 3MWYW 1ICWA 2KEEA 4QUCA 1WTVA 3I91A 4X3TA 2RA4A 1TVXA 2SDFA 2IL8A 1F2LA 3F2UA 1G6ZA 1J9OA 2RVLA 1HUNA 1PFNA 1A15A 1IL8A 1VMCA 3GV6A 2KUMA 4ZAIA 1HA6A 1EIGA 1VMPA 1ILQA 1KNAA 2DY7A 2K04A 1M8AA 2X6LA 2K01A 2MPMA 3H91A 1MGSA 1B53A 2HCIA 4XT3B 2X69A 1BNZA 3FPUB 3P7JA 1MSGA 5E4XA 1RHPA 1SSOA 2B2TC 1RTOA 2K03A 1NCVA 2BDNA 3I90A 5EKIA 1F9QA 1O80A 3UI2A 1X32A 5DNFA 2N88A 4CJ2C 1NR2A 1IKMA 1DOMA 3I3CA 3DEOA 1EIHA 1U4PA 2FFKB 2J7ZA 2FHTA 1BBXC 2MJ8A 2K28A 1HFNA 2L9HA 4HCSA 2FINB 1QE6A 4RAUC 2B2WA 5EPJA 4O42A 1B2TA 1IKLA 2B2VC 3ONAB 2R3ZA 3I8ZA 2HUGA 2L4NA 4ZK9B 4ZKCB 2D9UA 1LV9A 1BO0A 4HSVA 4OIJA 1J8IA 1WVLA 3N52A 2Q8RE 2NZ1D 1NR4A 2VXWA 2HCCA 1WTXA 2CVRA 1ML0D 4XDXA 1DOLA 1CA6A 4ZLTF 1WTWA 1EL0A 2MGSA 2JYOA 1ILPA 5D14A 5COYA 1PFMA 2B2YC 1C8CA 2L12A 2M2LA 2MP1A 2B2UC 1Q3LA 1GUWA 3IFDA 1BF4A 2RSNA 1QG7A 1U4MA 3GV3A 4R9WA 3SVMA 2EE1A 1HRJA 1F9RA 1RJTA 4UAIA 4NW2A 4IUUA 1F9PA 1XX8A 5EJWA 1G2TA 1B4OA 1HFGA 4CJ0B 4IURA 3Q6SA 5CBAE 4R8IA 1DZ1A 1S4ZA 2EPBA 2RSOA 3IL8A 3QO2A 1DOKA 4CJ1B 1WD0A 2DY8A 5T1IA 4DN4M 1JE4A 4QUFA 1DONA 2XIWA 1AZQA 4XT1B 1WTQA 1WTRA 1E0BA 5CORA 4X3SA 1F9SA 1B3AA 2L11A 1G91A 1WD1A 1KNEA 3HP3A 1NAPA 1JICA 1X3QA 2Q8TA 1PFBA 1AZPA 2JP1A 2NWGA 3DM1A 1AP0A
chains in the Genus database with same CATH superfamily
1II3A 1QZHA 3K7UC 3U50C 3PF5A 2LS01 4UPAA 1CA5A 1PFSA 4JI2Q 1E24A 4C3JG 1QWYA 3STBD 4YCVA 3KYHC 1JE5A 1LACA 2F0GA 5NUCA 2K52A 2EIFA 1R4QB 1SYGA 4K0KQ 4E6IA 2Z6KA 1RTNA 4PV1C 3G48A 5KIXA 4B08A 2NVQH 1L1OA 2GVBA 5FO8B 3S2HH 4LAAA 1QNKA 3BZDB 5FJ8H 2UUBQ 1N33Q 3CAMA 3QIAA 2MQHA 1X55A 5D65A 1C9OA 1O78A 3MXUA 4ZQ3A 4DV0L 2IJ0A 1WOCA 1AEXA 2F0NA 1WJJA 1P16A 1AFPA 4IFDG 1VQ8A 2X6LA 5EGTA 2G9DA 1K28A 4GKJL 4FF2A 2VUMG 1QOHA 1TWCH 1EFWA 1YNNC 2JA6H 1GXDC 1BOSA 3M4YA 2P5ZX 1W6JA 3RD4A 2YU9H 3S17B 1S5BD 2QDLA 2JJQA 3CKIB 3D31A 2Q2UA 4A3EB 3M9BA 2K28A 1R4PB 4HCSA 3J81j 2RDGA 4JI4L 2QW7A 2F0KA 3STBC 1JQYD 5KNCA 5DM63 3JAML 1SNDA 1JC7A 2E74C 2N8NA 1FJGQ 1ET6A 1WTXA 3I4OA 3NK9A 1ML0D 4OWWB 5IWAQ 3KF8B 4K6LA 1VQIA 3X3MA 2LFNA 2VB3X 4C1NI 2MO0A 1D1KA 4LF4Q 4AIMA 3PV0A 3NWTA 2ZTDA 3ZJYC 4NW2A 1IHZA 1VQPA 4OO1H 4A3GB 2ZJPA 1NE3A 1BXTA 2Z4HA 2A74C 4AH6A 3HOVB 5C4XG 4YY3L 5FLMH 1S5CD 1KXLA 4KHPQ 2BA1A 1X3QA 2XGTA 4NPSA 5TSSA 1LTAD 4CKBA 1HZBA 3DXJC 3HOYB 4IZ8A 1MIUA 3J80c 1QB5D 2HD3A 3L2PA 3MXGA 4DF7A 4XQJA 2ZM6Q 3KUPA 3S17H 3SK5A 1G2SA 3BVZA 3CCMA 4A3EH 5EQ0A 2JN4A 4BY7G 2D0OA 3CF5A 2R7ZB 3J7ZC 1L0WA 1HUMA 1VQAA 1VQEA 3W1BA 3RNUA 1SMXA 1ZYRD 4DV0Q 1HNXQ 3MWYW 3H3VC 1HXYD 1BKBA 4WFN3 2UXCL 5K36G 2B29A 2OEOA 4K2LA 1FNWA 3K0YA 3T4AC 1HA6A 2D2CC 3QR8A 2F52A 2NUCA 3SEBA 2OTLA 1PH6A 4P74A 3KFUA 3OW2A 1MGSA 3E5SA 2HCIA 5IYCG 5C4ZA 4DK0A 3UDIA 4A3GH 2PNHA 3KLWA 3BZCA 3K80C 4QQBX 2QKIC 3L7ZC 1X9NA 2Y0SE 3SDZA 3HOVH 4GN4B 3ITPA 2I0QA 1DOMA 1ZEQX 1VQOA 1IBML 5LMNW 1YIJA 4DUZL 2O5JC 3I7FA 3DWAA 1EY4A 3K8AA 4GNXB 4KV6A 2R7DA 4DR3L 2AWOA 2EYLA 4U673 1SE3A 2FINB 1QE6A 4LF9L 3J81E 5HURA 5HGQA 2R3ZA 3V2TA 1STGA 1SJHD 1UE7A 4YCWA 1AE2A 1V8QA 5C0XI 2O4XA 3HOYH 2O5IC 3ULJA 4KKUA 3N52A 2JA5G 2Q2IA 3V05A 1X6OA 3K5LA 1C8CA 1LTLA 1EWIA 1U4MA 3NHHA 3GD7A 4JI6L 1CKMA 4RCOA 3OOCA 4MIUA 4CJ0B 2R7ZH 5JEAH 3MHBA 1I6HB 1ZYRC 2K50A 2LY7A 5BN3A 4DAMA 4FDBA 4A3DG 4POFA 4A3FG 2NZHA 1YVCA 3KJPA 2C35B 2RDHA 3DM1A 3CCUA 1AE3A 3IFTA 1JWSD 2BOSA 4CBVA 3S9WA 4DV7Q 2B2TA 4YCUA 5G3LD 1SXTA 4RHSA 3ERSX 2L1BA 4LFCQ 3GTQB 4Q5VA 3E9IA 4OWXB 1KQSA 1ENAA 4A3LH 3C2PA 4DAVA 1Q86C 3TN2A 3J7AV 3R93A 3MAQA 3C1EA 1XXGA 1TS4A 2HDMA 3A8IE 1MI2A 1H9SA 4O0AA 2BH2A 1I4GA 2CH4A 1U0LA 4TRDA 3CMAA 5CV8A 5D3IB 2WB1G 3X3NA 3F2BA 3CCJA 4BBSG 4A3DB 2F0WA 3PMFA 5IP9G 1PMRA 5D3DA 4TVAB 1B7YB 4QL5A 5GADC 2MPMA 2UU9L 3PQIA 2F0OA 1NSNS 3WOEA 1I6HH 4L5RC 1GJXA 2M9VA 1RTOA 3UDFA 4LUOA 1RL2A 4DAPA 1F9QA 4KN7C 4LF8L 3F8TA 1UE1A 4IJHA 1HCZA 3WWVA 3GTGH 4LJZC 4DV6L 1K83B 1MD2D 1FYCA 3IRBA 1YITA 1V1OA 4R4QA 1H9RA 2JEAI 2B2VC 5C3WA 2IT1A 5M3FB 4FVMA 3J81L 2PQEA 1Y1WG 3PO3G 2B39A 1D2BA 3GTQH 4NDXA 4ZUIA 3U4ZA 2IX3A 5JOBA 2B2YC 4A75A 2WB1B 2EE1A 3EIVA 4B3TQ 1TWFB 4UAIA 3HOXG 4X66L 2VQEL 1B4OA 2PYKA 4WJ3M 1I4HA 2PI2A 1Y14B 2IPKD 5JPMC 2JA7G 3GTKB 3S16B 4DR6Q 4LFBL 2WP8J 4IFDJ 1Z7TA 1PRTB 2R61A 3K5OA 1L1OB 3OMCA 5C5MA 2K5WA 2NTSA 1N34Q 1B3AA 4A3DH 1JJ2A 3PO2B 4LF7L 3AQQA 5CV4A 1EQQA 1JORA 2F03A 4QJFA 4A3CG 3TREA 1IYJB 1YHBA 5I9OA 1PA6A 2HT1A 4LF6Q 5IGDA 2I5LX 3R2IA 1G51A 1J5EL 5GROA 4EQNA 1PH8A 3FHWA 2RHSB 1ESRA 3T1YQ 4MN3A 4MHEA 3OIPA 4IUVA 1K0SA 3GTJB 5DAUA 3TP6A 4DU9A 5ELDA 1K83H 1PXUA 1K8OA 1XTDA 1H95A 5BN5A 4DV5L 3TMEA 4GOPC 3VR3A 1D5MC 3Q24A 5M3FH 2WINB 4ID6A 3GTPB 1YBYA 1SYDA 4KLKA 1U4RA 2KENA 3VR2A 2YTYA 4CDDC 1TVXA 3F2UA 1F2ZA 1CQVA 2OCEA 3J80i 4HIKA 1A62A 3ND9A 4HIDA 4TQUS 2Y0SB 1P8LA 2CKZB 1BDOA 1TWFH 4YHHQ 2I46A 4FF1A 3S16H 4LWCA 2CFMA 4ALPA 3GTKH 1HTPA 2CQOA 3HOWG 4HJ7A 4DR1Q 3CCLA 4PZ6A 5IT9E 1X32A 3TP8A 2K5DA 3NSWA 4KY6A 3W1GA 1H9MA 2FHTA 2L9HA 5C0XH 1V1QA 3PUYA 4EX5A 3HZXA 4JI0L 1LV9A 2PI2E 2R7FA 4POGA 5IGFA 1VQCA 2ZTEA 5I6YA 2HCCA 1ESFA 4FO2A 3J7AF 4S3SA 3M4OB 1Q1BA 3D4RA 4P2CB 3GTJH 1QG7A 3KJOA 1Y1VB 3NTKA 1SFOB 4EVOA 3S1RB 1G8ZD 2PMZE 4OX9L 1S40A 1BCPB 1PTOB 3MC0B 1GHKA 3GTPH 2KHIA 4RGTA 4H7BA 1AH9A 2F0HA 3DWPA 1HA5A 4FNFA 5KEEA 4JYAL 1B70B 3HP3A 3QOJA 2F0QA 4A76A 2H4OA 3T51B 4A3IG 4LMQD 1RKNA 4X65L 1EZ6A 1CZGA 2EYHA 3TQYA 3PF4A 1U5KA 2OQ0A 3EJIA 1VQGA 1LABA 4JC0A 2KA7A 1I94Q 1CTMA 4EQOA 3CCQA 4K5WA 1FNUA 4HTHA 5AFWA 5AJ3Q 3AFQA 1K8MA 1SNOA 1B50A 1G291 2UUAL 2CW0C 3KBGA 5ELBA 2R92B 1EYGA 4JI7Q 3ZYYX 4KHZA 1JJGA 1IYVA 3OWEB 4L5TA 2NVTB 4JI2L 3M4OH 3C3LA 2RVLA 3MFYA 2JEBI 1Y1VH 2DY7A 1SFOH 3EA6A 2ICEC 3S1RH 2ICIA 4NXMQ 1TR5A 3PUXA 4CKEA 1HNWQ 2OT2A 5FJ8G 4K0KL 5J3BA 1GD7A 1PTOH 1VQJA 4JV5Q 1LO5D 5BN4A 3KF6A 2F0DA 5DNFA 2VQFQ 3I3CA 2UUBL 1N33L 3MXPA 5IT9L 3QJYA 1UWVA 3GTLB 5BR8Q 2AWNA 1DM0B 1V1PA 5EKKA 4R4OA 5HY6A 2RCNA 3CCSA 3R2TA 4A3BB 3FMCA 2Q8RE 2TSSA 4J15A 4XDXA 4IPDA 4DUYQ 2JA6G 3NPPA 1A3VA 1XNRQ 2C5CA 2IHEA 2M2LA 2B2UC 4IOAA 2XRQD 3IFDA 4A3KB 4JI3Q 4RGMA 1E3PA 1GUNA 4PMCA 1VQBA 3VA5A 2AQ3B 1A8VA 2K33A 3NELA 2R92H 2QDBA 1IBLQ 1Q1EA 1CUKA 1KAWA 4GLVB 3NE5B 3I2ZA 5CORA 2NVTH 1KNEA 2CHBD 1NMFA 3FVQA 3A55A 5GAEC 1H9SB 1FJGL 4KN4C 2YTVA 5IWAL 4OO1G 1SYBA 1Y8OB 5ELNA 3BS1A 3CCRA 3D3RA 3LWEA 4LF4L 1OTCA 5IOCA 4NXNQ 1I6VC 2QILA 2VZAA 3EROA 4H44C 1PH2A 2K1BA 5FLMG 3PGZA 1KDBA 5ELOA 1B9NA 1D5ZC 2LXJA 3B6YA 1PH9A 3K0XA 2QA4A 1Z47A 3VR6A 4JK1C 1D1IA 2UUAQ 1I4XA 2KECA 3GTLH 1EEID 3E9HA 4Y7NB 3FDTA 2PW5A 1ZXTA 1O7YA 1QILA 3H15A 4KHPL 3R8BA 3F1ZA 1B1ZA 1Y8PB 1Z6HA 1LTGD 4P71A 1O7IA 4DV3Q 4B3RQ 4HSPA 1UNSA 2A68D 1N32Q 3KLRA 3CCVA 1E2WA 4BY1B 4I7ZC 3K57A 1NJIC 2I5HA 1IYUA 3GV6A 4K2KA 5FLXE 2F3WA 4A3EG 4A3KH 2A6ED 1VMPA 3JAMc 3MVVA 4NB3A 1BNZA 2ENBA 2ZM6L 2SOBA 2ZJRA 1VS0A 4KTAA 4R1JA 1BR9A 3BDCA 2VNUD 1OXUA 2CWPA 2J7ZA 1YHQA 3C46A 1HNXL 2HIVA 3TS0A 2B8GA 2GA4B 1EIYB 2L55A 3TZUA 1LT5D 5EBCA 4A3GG 2D9UA 1GHJA 3BDOA 4XQQA 3BVMA 4CDCC 1PH5A 1PV4A 4ODGA 2NZ1D 1PH7A 2BH8A 1CA6A 2PMZB 5IYDH 1HR0W 1B44D 2RBMA 2ZXPA 3BDLA 3HOVG 4WJWA 5C44B 3M7GA 4PNYA 4HIMA 2EY1A 1Q3LA 4A3JB 1W2BA 2I07B 4LW1A 2J4XA 4Y7NH 1F9PA 2F0IA 1E2ZA 3NP8A 3Q6SA 1DZ1A 3NQTA 1QVGA 1IW7D 2NN6I 3HOYG 2F0TA 2A68C 5LHY1 1WTRA 2GVAA 2WV6D 3GO5A 2CH4W 4KI0A 1WCMB 4N9PA 2A6EC 4BY1H 1EOTA 4ZCKA 1LYLA 2UXDQ 5IYBG 2R7ZG 4DXGA 5JEAG 1PRTD 1JT8A 1N9WA 5JAVA 3MXNA 1ASYA 5C4HA 1U4LA 4ME5A 2D62A 5ELFA 4PZ8A 4HIOA 1QVCA 2E2HB 2DUDA 3S14B 3PUZA 5CV6A 1BBUA 5LMNQ 4KKTA 4IUNA 1SYEA 2N55A 1HHVA 4RKBA 2MNAA 3SK8A 4KY5A 3P75A 4AYBB 2J0TD 3ICEA 3M7NA 1ICWA 1CFMA 4QUCA 3RLNA 1VQMA 4DR4Q 4DV7L 2IL8A 4G4KA 2K5NA 4NMZA 4CDFC 5A35A 5C44H 4QMGA 4A3LG 4C2MB 5GAGC 1IL8A 3E0EA 4DR5Q 4A3JH 1JB3A 4LFCL 2M00A 3NXWA 1HPCA 1STEA 4C3IB 3CC4A 5FLXL 3SK4A 1IW7C 3HS0C 4RGNA 1DXMA 3FPUB 3WOFA 1XTCD 3M3YB 1EEFD 1K73C 1SMYD 2K4KA 4IALA 3NTIA 4L8JA 3I4LA 2F0LA 1WCMH 3G6EA 3RN5A 3SE0A 2Z6KC 2BCOA 4QB4A 1PRTC 2F3IA 1EY0A 1L1OC 1OXSC 1Q46A 5M3MB 3A56A 1YI2A 2E8GA 1X56A 1NR4A 5JJKA 4XYQA 1VQDA 2MP1A 2QEXA 4B9XA 2E2HH 3S14H 4JBKA 1RJTA 1KHIA 5C6AA 1STNA 3LNNA 5CBAE 3N6RA 5M5WB 2XNAC 1B3QA 4JBJA 1DONA 1IXRA 2WKCA 3CXCA 5GQOA 1OXVA 4IPGA 3VA7A 2Q8TA 1UUPA 4RMFA 4C2MH 1S5ED 1O7ZA 4C3IH 3RUZA 1BCPD 1PHJA 1YNXA 1PTOD 4DV1Q 1SMYC 1N8RC 2KJXA 3MTSA 2C9OA 4G7ZC 5KNBA 2LXKA 3M3YH 4B3TL 5IYBH 2E2JB 1FR3A 1AN8A 4XQNA 2FJ2A 1F2YA 4DR6L 5DEHA 1A0IA 3HOUB 1EY9A 3KF6B 1N34L 4H02A 1PVOA 1MKHA 1PDQA 5M3MH 4PZ7A 1A2UA 3V96A 5EAYA 3KBXA 3I55A 3U58A 1V1PB 4LF6L 5K5PA 1LUZA 4WRDA 3MEFA 2EZVA 1A15A 3H94A 2LKVA 4HMIA 3J81c 1PH4A 4N8X1 3T1YL 1M8AA 1N36Q 5M3FG 4YIJA 1JR0D 3RZOB 1Z9FA 1KD1C 5CV5A 5M5WH 2K03A 4HJ8A 3S15B 4A3MB 2EY2A 4CJ2C 3S1MB 2UUCQ 1L2FA 3EQLC 5C3EB 3DEOA 1U4PA 4IPCA 2BE5D 3HFZB 3OHXC 2MJ8A 4LK1C 1BCPC 3A54A 3DM3A 5EPJA 1PTOC 1I4QA 1DJRD 1GUSA 4L63B 1KLUD 4P73A 1YJWA 4OIJA 3JAMi 2KHSA 1DOLA 2E2JH 1QCBD 4ZLTF 4YHHL 1BBWA 5M5YB 3PIO3 3CHBD 4IN3A 2KCTA 5IP7G 3T1HQ 1BF4A 1V43A 3HRZC 5C0XG 3PO2G 4DR1L 2NN6H 3HOUH 1PZKD 5I6WA 4CHTB 2OWOA 1PYBA 1LT3D 1S4ZA 3IL8A 1WD0A 1EQVA 5KGUA 2ID0A 1QNUA 1TQOA 4JI1Q 1NY4A 2HHHL 1JOQA 2R6GA 4LF5Q 1F9SA 3PIOA 4BXXH 2K5HA 2K75A 3EVQA 1AZPA 1CT1D 4FP5D 2JSOA 2YTXA 4DV4Q 3BYTB 4JBMA 2GN5A 4N8FA 4ZKBB 2IY5B 1EUJA 2IX0A 1SDFA 3RZOH 1PLFA 4ABNA 3ULPA 1XYIA 1K8GA 1PZID 1EFID 3S15H 4A3MH 1SYCA 2BE5C 3F2DA 5JPNC 3S1MH 1ENFA 2R93B 2IHFA 2E2IB 5C3EH 5CBEE 2MHVA 2WAQE 4O1NA 2Y0SG 1Q90A 3S24A 2YYZA 3CRKC 5IGBA 3LGJA 1EYCA 5T1GA 3GDEA 3HKZE 1WTOA 3I72A 4OL7A 3G7LA 4WJ4A 3DWQA 5J39A 1K9MC 1VQ5A 5M5YH 2EJMA 2K7VA 3A0JA 2B63G 4JOIA 5I9PA 5IGCA 4BA2I 3CCEA 1ILQA 4FXKC 1I94L 4RG1A 3KLSX 2K5VA 3KK7A 5IGGA 1IZ6A 3G6JB 4HN7A 2Z9HA 5E4XA 1D5XC 4BBRB 2B2TC 3OW7A 3RLOA 5AJ3L 2SEBD 5JEAJ 4ZUJA 2IWHA 2KBNA 4DK6C 2Q2TA 3J7YW 4JI7L 1BBXC 1GUOA 3KLSA 2VS1A 1Y1VG 5LMUQ 2B2WA 3H0GB 2E75C 1M90C 1EOVA 2K32A 2A73B 4KKSA 4RHRA 2HUGA 2ASBA 4DV2Q 2AUJD 3PUWA 1KC8C 4NXML 1CSQA 1I50B 2E2IH 1HNWL 1G6PA 3H09A 3W2DA 2R93H 3CW2C 5HGTA 3BJUA 2LSSA 2ZT9C 3Q22A 4FF4A 4O2DA 4JV5L 3MXNB 1HRJA 1NBWA 5KNDA 3D8GA 2B63B 4GKKQ 1RCVD 2VL6A 5IP7H 1SYFA 2VQFL 4B3SQ 3R3OA 4IURA 1YEZA 3PO2H 2HHHQ 4KD4A 4KJOA 5BR8L 3W3AA 1FD7D 2F4IA 4X3SA 2CW0D 1SNMA 2LMCB 4M1UB 4C56C 2EYFA 3HGBA 2Z8LA 5C4JB 1ET9A 5EBDA 3TP7A 4A4IA 1TKWB 4DUYL 2EYMA 4A93B 1GO3E 1XNRL 1OXTA 4X64Q 1HZ9A 4HEDA 2B2UA 4JG2A 1I4PA 1NTGA 1HNZQ 2R92G 4JI3L 4TKOB 1VQ6A 4BBRH 1TY0A 1RF2D 3NBHA 4IQZA 1KABA 5ELEA 4HJAA 1LTRD 3M85A 3TZDA 4QCLA 2RF4A 1XNQL 4X3KA 2Z6BA 4RA8A 1IBLL 2Q8IB 2FMMA 3H0GH 1XMQL 1SAPA 2F4VQ 1IBKQ 3A7AB 1MJCA 3I91A 2SDFA 1I50H 1KLGD 4DXFA 5LL6S 5I2XA 2AMCB 1PFNA 1HUNA 1T5EA 1VF7A 4ZAIA 3G71A 4G7OC 4NXNL 1KNAA 5EKLA 2EYOA 2B63H 3H91A 2SNMA 2EJGC 5IY0A 2IX1A 4B9WA 4A3BG 3VYTA 1XPUA 3MZ5A 2N88A 1NR2A 1EIHA 1SLJA 3HEJA 1VQLA 2ES2A 3RMHA 5C4JH 4A3KG 1HFNA 4DV3L 4B3RL 1EWCA 1ONLA 1SR3A 1N32L 4EGVA 4A93H 4IOCA 2L4NA 5CV7A 1HQMC 2UXBQ 3AB9A 2BDOA 2JQOA 3I4NB 2FXQA 4L6TB 3J81i 2V1CC 2VXWA 4BS9A 2D0PA 3RN2A 1XMOQ 1ILPA 5COYA 4F8MA 1FL0A 5C5LA 2KCCA 3FEWX 4JCVE 5E7NA 3A7LA 4DK1A 2A1AA 4IUUA 2E5LQ 1HFGA 2EYPA 4DR7Q 2EPBA 1PTOF 1QUQA 5IYDG 4PQXA 4QUFA 3ER0A 2N49A 1E0BA 2RKSA 1L0XB 2QCPX 2N78A 2NTTA 2YV5A 5CMDA 1R9TB 1EZ8A 1A3UA 3K6OA 1JMCA 2F0UA 2PW7A 3VYUA 4CDEC 1D6EC 2WAQB 3P20A 4HAEA 1TS5A 2EXDA 4KJNA 2KVMA 5G3LF 3HKZB 1XNQQ 2VB2X 3MFGA 4R4CA 4BY1G 3DEPA 1VQ9A 3E0JA 3CU7A 4B3MQ 1XMQQ 1E1OA 2XWBB 1CI3M 4LFAQ 1TWAB 4JBWA 1A2TA 4X3UA 1ASZA 5C0XJ 4IFDI 4DK3C 4IJLA 3GTOB 3I4NH 2NYZD 3FPPA 1PH1A 2UXDL 2DJFC 4FF3A 1HR0Q 1Q82C 1PH3A 1TWGB 4OXPA 1YJ9A 3K7AB 1YZ6A 1EIFA 5DLQE 3CPWA 1MSGA 2NZOA 2H5XA 1VQKA 1VCIA 2Q2HA 3D4DA 3EFXD 4DAYA 5LMNL 1WI5A 4J8QA 2VY3A 2HQLA 1TY2A 3W5OA 1KDCA 4DR2Q 1IKMA 1PZJD 1KL9A 3SR1A 1HQRD 5C44G 1X3FA 4A3BH 3Q0AA 3OWFA 2XN9C 4GNXC 2AUKA 4DNRB 4A3JG 1VDZA 1UE6A 4RAUC 3BZKA 1FNVA 4DR4L 3ONAB 1B9MA 2K5QA 3KDFA 1R9TH 2PZUA 2DNEA 3I8ZA 5JVG3 4RH6A 2WIIB 4DR5L 1J8IA 2PQAA 3OTOQ 2WFWA 4DNIA 1WTWA 1EL0A 2JYOA 2JA8G 2A8VA 1WCMG 3AU7A 3ERQA 3I4MB 1C0AA 1CK1A 1LTSD 2F1MA 1TWHB 1Q81C 1XX8A 3GQBA 1TWAH 4R4IA 5KYIA 1MBYA 1SBBB 3G4SA 3S1QB 1JE4A 3GTOH 4X62Q 4QF4A 1KDAA 2ZXOA 5A2QE 1VQ4A 4GZYC 1WD1A 2XTIA 1NAPA 3AFPA 4JVZA 1K0RA 4OEMB 1T9HA 1TWGH 3UE0A 3T16A 4FXDA 2XSCA 3FKIB 3A5UA 3IKJA 2HDLA 4C3HB 1C4QA 1S5DD 2F0VA 4K5VA 3K7AH 3CMEA 4IUTA 5I4DA 4R8NA 5E4WC 2HQEA 1CHQD 1KTKA 4AYBG 1CSPA 3SK6A 1TU2B 3CP0A 4RGOS 1GM5A 3D4WA 5EPKA 4P75A 4JI8Q 5FLXc 1K3BC 1RDPD 3JC66 1JOKA 4C3IG 2JA8B 3CD6A 2QGQA 1UEAB 3OMGA 4C3JB 2V4DA 1KIXA 4J6HA 3VYSA 2CCZA 2XRSD 2AHOB 4RCNA 3CQZB 2ZXRA 4I65A 3J80E 1YHAA 1WFQA 1VQ7A 1DD2A 1WTVA 4G57A 4DV1L 3VDYA 3PSIA 1SNPA 3CC7A 3I4MH 1LTTD 4P72A 3DHQA 1QZGA 1UEBA 1TWHH 1B53A 2X69A 3UDGA 5M3MG 1RHPA 2EQSA 3S1QH 3I90A 1O80A 3LX0A 3KOJA 1SE2A 3L3OC 3TP5A 1STHA 4F87A 3E3XA 4JI5Q 3OPOA 2N3SA 2VW9A 3FKIH 2VUMB 1SJED 2WB1E 4C3HH 3QG1A 3K59A 4WORA 1X54A 2CVRA 1N36L 2XWJB 4MZ9A 1JCKB 4OWTB 5DM73 2A19A 1VQHA 1GKHA 2F0JA 5H1SE 4ULLA 4R9WA 4R4TA 1F9RA 3NBHB 2JA8H 4MTKA 2UUCL 4JW0A 1CZWA 1I4RA 4KMUC 4CJ1B 4C3JH 4V0BA 2DJGC 2AKWB 2TMPA 1SNQA 1NNXA 3U9OA 5CV9A 3CQZH 4JPBW 4XT1B 5F2DA 3VR5A 1EQRA 1L0YB 4UP8A 2A5HA 3A74A 1U9RA 5A2QL 1PFBA 2NWGA 2NN6G 3HOUG 1Y69U 4XYOA 3T53B 4IUPA 3UE1A 3T1HL 1JJCB 3DMUA 2MUYA 3HG9A 4QY7A 2KEDA 1JOOA 5C4XB 1CM9A 4F7XA 3P1HA 1E2VA 1Y8NB 4BXXG 2EDGA 4GKJQ 2DNCA 1ICFB 2E2DC 2B2VA 4X6AH 4YWKA 4IFDH 4JI1L 1TXYA 3M4PA 4IUQA 5EPLA 1O7LA 3ULLA 1D8LA 1CQFA 4LF5L 1SEBD 2KQ3A 2VUMH 3H3VI 2JK8A 1XPOA 4XXEA 3D0FA 1V9PA 1H9JA 2F0PA 4DV4L 2B2YA 4Q0FA 4JI4Q 4A3MG 1SNCA 5FK9C 3J80L 1TIID 1TS2A 5C3EG 1JWMD 1SE4A 2KUMA 4QIWE 1DYQA 1EIGA 3BU2A 4BY7B 4K14A 2K01A 4DFAA 1HTLD 2KCMA 4NKLA 1S5FD 4DGZA 2FMCA 1XPRA 1M1KC 5E1FA 1EYDA 1NCVA 1XWEA 2NVYB 1K8AC 4H13C 4CGYB 4BWGB 4DPGA 1LTID 1A3TA 1QUQB 2F3VA 4OGQC 1HZAA 1S72A 1CKOA 1FVIA 4YY3Q 3NWSA 4ZRZA 5IODA 2OTJA 4ZK9B 3K5MA 2CQAA 1STAA 3GTGB 2KCNA 5C4XH 5M5XB 3TRZA 5D14A 1A6XA 2L12A 3I56A 2A6HD 4C1NK 3K81C 4GOPA 5L37A 3SVMA 4RKLA 5EJWA 1G2TA 4K8IA 2KHJA 2MFIA 2QEJC 4PMBA 3OIQA 2DY8A 4DN4M 3AYHB 2JA5B 5LMUL 2XIWA 1AZQA 4KK7A 4L5SA 1QVFA 4NP5A 2R93G 4DV2L 1JICA 5FOBB 1NUCA 3AMUA 2NVXB 1BQQT 2UXCQ 3E6ZX 4BY7H 3DUZA 5CYUA 4TSSA 1I5FA 3SGIA 4N9TA 5ISRA 3SXHA 4FXGC 1RODA 1DGSA 3TSSA 4A3FB 4GKKL 2NVYH 2PO4A 5K36H 4FYDA 1B8AA 4B3SL 1X3GA 3CPFA 4DAYB 1MSHA 2F0SA 1CKNA 3D6CA 4LNQA 4DA2A 4U68A 4APVA 5IYCH 1IBMQ 4DUZQ 3RR5A 5I2YA 1FGBD 4DR3Q 4OIKA 4BBRG 2WKDA 3QB3A 4LF9Q 3S1NB 2KEEA 3ND8A 5J1ZA 2G9HD 1E22A 2JE6I 4X3TA 3KDFB 5M5XH 4X64L 1F2LA 2A6HC 1HH2P 1G6ZA 2B8FA 1A63A 1F2MA 4YWLA 4GN5A 1HNZL 1VMCA 3FRPB 1MJEA 1Q8IA 2PQAB 2PNRC 2B3GA 1EY8A 2NBFA 3H0GG 3VYRA 1F77A 3MA2B 5FO9B 1W6KA 2DN8A 2I5MX 1J6QA 1C48A 4OHJA 5FKAC 4IPHA 5IE8A 2K14A 5EKIA 2JA5H 3T56B 4JI6Q 3GTMB 4I7AA 1T5XD 2F4VL 4BBSB 2FFKB 1GVPA 1IBKL 2EJFC 3CRLC 4BA1I 1EWHA 1LT6D 5CR3A 2NVXH 1STYA 3PUVA 1PYWD 5E3FA 3O13A 4HJ5A 2ZTCA 4Z9CB 2EYJA 3VR4A 1BUVT 4A3FH 1WTHA 4V190 4GLXA 3A8JE 4K8JA 4UY8C 3I73A 1GUTA 1SRUA 2JXMB 3EN2A 3GP7A 1Q8KA 4A93G 1MHWC 2PZWA 1Q12A 3QO2A 2RSOA 1Y1WB 3PO3B 2SNSA 3PCOB 1QJOA 2QF7A 5FO7B 1AW7A 3S1NH 3L0OA 2EY6A 3AEVA 3RLFA 2Z1CA 4HR7B 2OF1A 2UXBL 2Z4IA 4ME3A 1FGUA 2JP1A 1LLRD 1M4VA 1AP0A 4K5XA 4G7HC 3HOXB 3TS2A 1XMOL 3WDNA 5KRUA 3KF8A 2DGYA 3HKSA 2JA7B 2PPBC 1VQNA 1VQFA 3BYYB 2X6GA 1X65A 3NTHA 1EY6A 2K05A 1EQTA 4K6DA 4KD3A 3PIP3 2E5LL 1WTPA 2UU9Q 3GTMH 1CHPD 1PRTF 4UHVA 3S2DB 4QGUA 4BBSH 1X3EA 3CC2A 4DR7L 1XJVA 5IP9H 3H3VH 1EU4A 3OSOA 3T13A 2A69D 4RWSC 4LF8Q 3FP9A 3U9SA 3RZDB 1VF5C 4QIWB 4DV6Q 3HOZG 2F0MA 3PIPA 4XTCS 2L0CA 4AQYL 1DCZA 2PCFB 4PG3A 3BVGA 3K58A 1J9OA 5IGEA 4GLAC 2PZTA 1ZKOA 5JVH3 2F0FA 2CWAA 4OELB 4B3ML 1Y1WH 3I4NG 3PO3H 1SSOA 1UAPA 4MNOA 4X66Q 2VQEQ 4LFAL 3URYA 4DKAC 5IT9c 3SHLA 4LFBQ 3A8KE 4L5QA 4OONA 4DNTB 1SE8A 3DLLA 2ATWA 4IO9A 4EQPA 3HOXH 5JJIA 4ZKCB 2JA7H 5J22A 1HR0L 4F88A 3HOWB 2JA9A 1WVLA 1KAAA 1K3RA 4LF7Q 3MEHA 3NEMA 4HCEA 3S2DH 1PFMA 2ZJQA 3HOZB 3K5NA 1GUWA 1J5EQ 1OXXK 2RSNA 1WYDA 2A69C 4UDUC 4M8AA 1HJPA 1LTBD 4JOIC 3F2CA 4DR2L 4A3CH 2IW3A 2OQKA 4LUVA 5JJLA 4EQ5A 2WACA 1I3QB 3RZDH 4GNXA 1C7YA 5CGKA 2WAQG 1W3SA 5T1IA 5C3XA 3U4VA 3QOLA 1IL2A 1STBA 1NMGA 2NB0A 1WTQA 3H6MA 4OO1I 1UE5A 4DV5Q 1S3OA 1G91A 3HKZG 3NUCA 3NBIA 2RDFA 1E7ZA 3OYYA 5M9OA 1GOZA 3OTOL 2B2WC 2Z0SA 3NENA 2HIXA 1RD9D 1BCPF 1ENCA 3M4QA 4GS3A 3D6WA 2L5TA 4AYBE 2H1EA 1LM0A 3UDXA 4X62L 1SROA 3L9AX 1YNJD 4A3IB 1YJNA 2EY5A 4ILWA 5JJZA 2KOLA 2EVBA 2L15A 1X3PA 2XVSA 2OXPA 1PYSB 1BVSA 2K6AA 3HOWH 2F0EA 4AQYQ 2EOTA 1OO9B 4JI0Q 3IAYA 4RFBA 2RA4A 4UP9A 5CC4A 5LL6X 1EY5A 5IIFA 3HOZH 2RHQB 1EU3A 4MTNA 2AQ2B 4CKCA 4Y52H 2K04A 1RIPA 2D5DA 1SN8A 4XT3B 4JI8L 2ALYB 2RCFA 3P7JA 1EY7A 1KRTA 2O2LD 1I3QH 3Q8DA 1D7QA 3TDQA 4GOPB 2BDNA 3UI2A 2E76C 3BG3A 1TS3A 4OX9Q 1E1TA 1JB7A 3TEHB 3A5ZB 3I4MG 2NVQB 3TBIB 1B2TA 1KRSA 4O42A 3NQIA 4XIGS 1IKLA 3S2HB 1EYAA 1GUGA 3JAME 3C1FA 4JYAQ 1H9KA 3QWNA 4J1MA 1BO0A 1HZCA 4HSVA 4H0LC 2RQXA 2BA0A 2MGSA 5KYLA 3EBEA 4X65Q 1TT2A 2EXZA 4GN3B 4HMJA 2AQ1B 5ELCA 3Q23A 2G5DA 1YNJC 4YWMA 4HJ9A 3LWUA 3GV3A 4KHVA 4A3IH 3J7A5 4ZYSA 3FKIG 2MO1A 4UP7A 4PMWA 4C3HG 4R8IA 1TWCB 1DOKA 4JI5L 1CKNB 2JA6B 1JWUD 5GAHC 1LT4D 1Q7YC 2YU9B 2L11A 1YNND 4KY7A 3I70A 4LUZA
chains in the Genus database with same CATH topology
1II3A 2LS01 1CA5A 4C3JG 1QWYA 1LACA 2F0GA 5NUCA 1R4QB 1SYGA 4E6IA 4PV1C 1RTNA 5KIXA 4B08A 5FO8B 4LAAA 1QNKA 3BZDB 3QIAA 5D65A 1O78A 3MXUA 4ZQ3A 2IJ0A 1AEXA 2F0NA 1AFPA 4IFDG 2X6LA 5EGTA 2G9DA 4FF2A 1QOHA 1YNNC 1GXDC 1BOSA 3M4YA 1W6JA 3RD4A 3S17B 1S5BD 3D31A 3CKIB 4A3EB 2K28A 1R4PB 4HCSA 2RDGA 2F0KA 1JQYD 5KNCA 5DM63 3JAML 1SNDA 1JC7A 2E74C 1ET6A 1WTXA 3NK9A 1ML0D 4K6LA 3X3MA 2LFNA 2VB3X 4C1NI 1D1KA 3PV0A 3NWTA 4NW2A 1IHZA 4OO1H 4A3GB 1BXTA 2Z4HA 2A74C 3HOVB 1S5CD 2BA1A 1X3QA 5TSSA 1LTAD 4CKBA 3DXJC 3HOYB 4IZ8A 1QB5D 3MXGA 4DF7A 4XQJA 3KUPA 3SK5A 1G2SA 3BVZA 5EQ0A 2R7ZB 1HUMA 1ZYRD 3MWYW 3H3VC 1HXYD 4WFN3 5K36G 2OEOA 4K2LA 1FNWA 3K0YA 3T4AC 1HA6A 2D2CC 2NUCA 3SEBA 1MGSA 3E5SA 2HCIA 5C4ZA 4DK0A 2QKIC 3L7ZC 3SDZA 3ITPA 1DOMA 1ZEQX 2O5JC 3DWAA 1EY4A 4KV6A 2AWOA 2EYLA 4U673 1SE3A 2FINB 1QE6A 3J81E 5HURA 2R3ZA 3V2TA 1STGA 1SJHD 1V8QA 5C0XI 2O4XA 2O5IC 4KKUA 3N52A 3V05A 3K5LA 1C8CA 1U4MA 3NHHA 3GD7A 4RCOA 3OOCA 4MIUA 4CJ0B 5JEAH 3MHBA 1I6HB 1ZYRC 2LY7A 5BN3A 2RDHA 3DM1A 3IFTA 1JWSD 2BOSA 4CBVA 3S9WA 2B2TA 5G3LD 1SXTA 4RHSA 2L1BA 3GTQB 4Q5VA 1ENAA 3C2PA 4DAVA 3TN2A 3J7AV 3R93A 3MAQA 3C1EA 1XXGA 1TS4A 2HDMA 3A8IE 1MI2A 1H9SA 1I4GA 4TRDA 5CV8A 5D3IB 3X3NA 4A3DB 2F0WA 3PMFA 1PMRA 5D3DA 2MPMA 2F0OA 1NSNS 3WOEA 1GJXA 2M9VA 1RTOA 4DAPA 1F9QA 4KN7C 1HCZA 4LJZC 1K83B 1MD2D 1FYCA 1V1OA 2JEAI 1H9RA 2B2VC 5C3WA 2IT1A 5M3FB 4FVMA 3J81L 2PQEA 2B39A 1D2BA 4NDXA 4ZUIA 2IX3A 5JOBA 2B2YC 2WB1B 2EE1A 1TWFB 4UAIA 1B4OA 2PYKA 1I4HA 2IPKD 5JPMC 3S16B 3GTKB 4IFDJ 2WP8J 1Z7TA 1PRTB 2R61A 3K5OA 3OMCA 5C5MA 2K5WA 2NTSA 1B3AA 3PO2B 5CV4A 1JORA 2F03A 5I9OA 5IGDA 3R2IA 4EQNA 1ESRA 4MN3A 4MHEA 3OIPA 4IUVA 3GTJB 5DAUA 3TP6A 4DU9A 5ELDA 1PXUA 1K8OA 5BN5A 3TMEA 3VR3A 1D5MC 3Q24A 2WINB 4ID6A 3GTPB 1SYDA 1U4RA 3VR2A 1TVXA 3F2UA 1F2ZA 1CQVA 3ND9A 4TQUS 2Y0SB 1BDOA 2I46A 4FF1A 1HTPA 5IT9E 1X32A 3TP8A 2K5DA 3NSWA 4KY6A 1H9MA 2FHTA 2L9HA 5C0XH 3PUYA 3HZXA 1LV9A 5IGFA 5I6YA 2HCCA 1ESFA 4FO2A 3J7AF 4S3SA 3M4OB 1Q1BA 3D4RA 4P2CB 1QG7A 1Y1VB 3NTKA 1SFOB 4EVOA 3S1RB 1G8ZD 1BCPB 1PTOB 3MC0B 1GHKA 4RGTA 4H7BA 2F0HA 3DWPA 1HA5A 4FNFA 5KEEA 3HP3A 3QOJA 2F0QA 2H4OA 3T51B 4LMQD 1RKNA 1EZ6A 1CZGA 2EYHA 3EJIA 1LABA 2KA7A 1CTMA 4EQOA 4K5WA 1FNUA 4HTHA 5AFWA 1K8MA 1SNOA 1B50A 1G291 2CW0C 3KBGA 5ELBA 2R92B 3ZYYX 4KHZA 1IYVA 3OWEB 2NVTB 3C3LA 2RVLA 3MFYA 2JEBI 2DY7A 3EA6A 2ICEC 2ICIA 1TR5A 3PUXA 4CKEA 2OT2A 1PTOH 1LO5D 5BN4A 2F0DA 5DNFA 3I3CA 3MXPA 5IT9L 3QJYA 3GTLB 2AWNA 1DM0B 1V1PA 5EKKA 3R2TA 4A3BB 3FMCA 2Q8RE 2TSSA 4XDXA 3NPPA 1A3VA 2C5CA 2M2LA 2B2UC 2XRQD 3IFDA 4A3KB 4RGMA 1GUNA 4PMCA 3VA5A 2AQ3B 2K33A 2QDBA 1Q1EA 3NE5B 5CORA 1KNEA 2CHBD 3FVQA 3A55A 1H9SB 4KN4C 4OO1G 1SYBA 1Y8OB 3BS1A 3D3RA 3LWEA 5IOCA 1I6VC 2QILA 4H44C 3EROA 2K1BA 1KDBA 1B9NA 1D5ZC 1Z47A 3VR6A 4JK1C 1D1IA 1I4XA 2KECA 1EEID 4Y7NB 3FDTA 2PW5A 1ZXTA 1O7YA 1QILA 3R8BA 1B1ZA 1Y8PB 1Z6HA 1LTGD 4HSPA 1UNSA 2A68D 3KLRA 1E2WA 4BY1B 4I7ZC 3K57A 5FLXE 1IYUA 3GV6A 4K2KA 2F3WA 2A6ED 1VMPA 3MVVA 1BNZA 2ENBA 2SOBA 4KTAA 1BR9A 3BDCA 2VNUD 1OXUA 2J7ZA 3C46A 2B8GA 2GA4B 2L55A 3TZUA 1LT5D 5EBCA 2D9UA 1GHJA 3BDOA 4XQQA 3BVMA 4ODGA 2NZ1D 1CA6A 2PMZB 1B44D 2RBMA 2ZXPA 3BDLA 4WJWA 5C44B 3M7GA 4PNYA 2EY1A 1Q3LA 4A3JB 2I07B 2J4XA 1F9PA 2F0IA 1E2ZA 3NP8A 3Q6SA 1DZ1A 3NQTA 1IW7D 2NN6I 2F0TA 2A68C 5LHY1 1WTRA 2WV6D 3GO5A 4KI0A 1WCMB 4N9PA 2A6EC 1EOTA 4DXGA 5JEAG 1PRTD 5JAVA 3MXNA 5C4HA 1U4LA 4ME5A 2D62A 5ELFA 2E2HB 3S14B 3PUZA 5CV6A 4KKTA 4IUNA 1SYEA 2N55A 1HHVA 4RKBA 3SK8A 4KY5A 3P75A 4AYBB 2J0TD 3M7NA 1ICWA 1CFMA 4QUCA 2IL8A 4G4KA 5A35A 4NMZA 4QMGA 4C2MB 1IL8A 1JB3A 2M00A 3NXWA 1HPCA 1STEA 4C3IB 5FLXL 3SK4A 1IW7C 3HS0C 4RGNA 1DXMA 3FPUB 3WOFA 1XTCD 3M3YB 1EEFD 1SMYD 4IALA 3NTIA 4L8JA 3I4LA 2F0LA 3SE0A 4QB4A 2BCOA 1PRTC 1EY0A 1OXSC 5M3MB 3A56A 1NR4A 4XYQA 2MP1A 4B9XA 1RJTA 5C6AA 1STNA 3LNNA 5CBAE 3N6RA 5M5WB 2XNAC 1DONA 2WKCA 1OXVA 3VA7A 2Q8TA 1UUPA 1S5ED 1O7ZA 3RUZA 1BCPD 1PTOD 1SMYC 2KJXA 3MTSA 2C9OA 4G7ZC 5KNBA 2E2JB 1FR3A 1AN8A 4XQNA 2FJ2A 1F2YA 5DEHA 3HOUB 1EY9A 1PDQA 1A2UA 3V96A 3KBXA 1V1PB 5K5PA 4WRDA 2EZVA 1A15A 3H94A 2LKVA 4HMIA 1M8AA 4YIJA 1JR0D 3RZOB 5CV5A 2K03A 3S15B 4A3MB 2EY2A 4CJ2C 3S1MB 3EQLC 5C3EB 3DEOA 1U4PA 2BE5D 3OHXC 2MJ8A 4LK1C 1BCPC 3A54A 5EPJA 1PTOC 1I4QA 1DJRD 1GUSA 4L63B 1KLUD 4OIJA 2KHSA 1DOLA 1QCBD 4ZLTF 5M5YB 3PIO3 3CHBD 4IN3A 1BF4A 1V43A 3HRZC 5C0XG 2NN6H 1PZKD 5I6WA 4CHTB 1LT3D 1S4ZA 3IL8A 1WD0A 1EQVA 5KGUA 2ID0A 1QNUA 1TQOA 1JOQA 2R6GA 1F9SA 3EVQA 1AZPA 1CT1D 4FP5D 2JSOA 3BYTB 4ZKBB 2IX0A 1SDFA 1PLFA 4ABNA 1XYIA 1PZID 1EFID 1SYCA 2BE5C 2E2IB 5JPNC 1ENFA 2R93B 5CBEE 2MHVA 4O1NA 1Q90A 2YYZA 3CRKC 5IGBA 1EYCA 5T1GA 1WTOA 3I72A 4OL7A 3G7LA 3DWQA 5J39A 2EJMA 2K7VA 5I9PA 5IGCA 4BA2I 1ILQA 4FXKC 3KLSX 3KK7A 5IGGA 3G6JB 4HN7A 5E4XA 1D5XC 4BBRB 2B2TC 3OW7A 2SEBD 5JEAJ 4ZUJA 2IWHA 3J7YW 1BBXC 1GUOA 3KLSA 2B2WA 3H0GB 2E75C 2K32A 2A73B 4KKSA 4RHRA 2HUGA 2AUJD 3PUWA 1I50B 3H09A 3W2DA 5HGTA 2ZT9C 3Q22A 4FF4A 1HRJA 5KNDA 3D8GA 2B63B 1RCVD 1SYFA 3R3OA 4IURA 4KD4A 4KJOA 3W3AA 1FD7D 2F4IA 4X3SA 2CW0D 1SNMA 2LMCB 4M1UB 4C56C 2EYFA 3HGBA 2Z8LA 5C4JB 1ET9A 5EBDA 3TP7A 1TKWB 2EYMA 4A93B 1OXTA 4HEDA 2B2UA 1I4PA 4TKOB 1TY0A 1RF2D 3NBHA 4IQZA 1KABA 5ELEA 1LTRD 3M85A 3TZDA 4QCLA 4X3KA 4RA8A 2Q8IB 2FMMA 1SAPA 3A7AB 3I91A 2SDFA 1KLGD 4DXFA 5LL6S 5I2XA 1HUNA 1PFNA 1T5EA 1VF7A 4ZAIA 4G7OC 1KNAA 5EKLA 2EYOA 3H91A 2SNMA 2EJGC 2IX1A 4B9WA 3VYTA 3MZ5A 2N88A 1NR2A 1EIHA 3HEJA 3RMHA 1HFNA 1EWCA 1ONLA 4EGVA 2L4NA 5CV7A 1HQMC 3AB9A 2BDOA 3I4NB 4L6TB 2VXWA 4BS9A 1ILPA 5COYA 4F8MA 5C5LA 2KCCA 3FEWX 3A7LA 4DK1A 4IUUA 1HFGA 2EYPA 2EPBA 1PTOF 4PQXA 4QUFA 1E0BA 2RKSA 1L0XB 2QCPX 2NTTA 5CMDA 1R9TB 1EZ8A 1A3UA 3K6OA 2F0UA 2PW7A 3VYUA 1D6EC 2WAQB 3P20A 4HAEA 1TS5A 4KJNA 2KVMA 5G3LF 3HKZB 2VB2X 3MFGA 3DEPA 3E0JA 3CU7A 2XWBB 1CI3M 1TWAB 4JBWA 1A2TA 4X3UA 5C0XJ 4IFDI 3GTOB 2NYZD 3FPPA 4FF3A 1TWGB 3K7AB 1MSGA 1VCIA 3D4DA 3EFXD 4DAYA 4J8QA 1TY2A 1KDCA 1IKMA 1PZJD 3SR1A 1HQRD 3Q0AA 3OWFA 2XN9C 2AUKA 4DNRB 1VDZA 4RAUC 1FNVA 3ONAB 1B9MA 2K5QA 2PZUA 2DNEA 3I8ZA 5JVG3 4RH6A 2WIIB 1J8IA 1EL0A 1WTWA 2JYOA 3AU7A 3ERQA 3I4MB 1CK1A 1LTSD 2F1MA 1TWHB 1XX8A 3GQBA 5KYIA 1MBYA 1SBBB 3S1QB 1JE4A 4QF4A 1KDAA 2ZXOA 5A2QE 4GZYC 1WD1A 1NAPA 3T16A 4FXDA 2XSCA 3FKIB 3IKJA 2HDLA 4C3HB 1C4QA 1S5DD 2F0VA 4K5VA 4IUTA 5I4DA 4R8NA 5E4WC 2HQEA 1CHQD 1KTKA 3SK6A 1TU2B 4RGOS 3D4WA 5EPKA 1RDPD 1JOKA 4C3IG 2JA8B 1UEAB 3OMGA 4C3JB 2V4DA 4J6HA 3VYSA 2XRSD 4RCNA 3CQZB 2ZXRA 4I65A 3J80E 1DD2A 1WTVA 4G57A 1SNPA 1LTTD 3DHQA 1B53A 2X69A 1RHPA 3I90A 1O80A 3LX0A 1SE2A 3L3OC 3TP5A 1STHA 4F87A 3OPOA 2VUMB 1SJED 3QG1A 3K59A 4WORA 2CVRA 2XWJB 1JCKB 5DM73 2F0JA 4ULLA 4R9WA 1F9RA 1CZWA 1I4RA 4KMUC 4CJ1B 4V0BA 2TMPA 1SNQA 3U9OA 5CV9A 5F2DA 4XT1B 3VR5A 1L0YB 2A5HA 1U9RA 5A2QL 1PFBA 2NWGA 2NN6G 1Y69U 4XYOA 3T53B 4IUPA 3DMUA 2MUYA 3HG9A 2KEDA 1JOOA 5C4XB 1CM9A 4F7XA 3P1HA 1E2VA 1Y8NB 2EDGA 2DNCA 2E2DC 2B2VA 4IFDH 4IUQA 5EPLA 1O7LA 1CQFA 1SEBD 2KQ3A 4XXEA 1H9JA 2F0PA 2B2YA 4Q0FA 1SNCA 5FK9C 3J80L 1TIID 1TS2A 1JWMD 1SE4A 2KUMA 1DYQA 1EIGA 4BY7B 4K14A 2K01A 4DFAA 1HTLD 4NKLA 1S5FD 4DGZA 2FMCA 5E1FA 1EYDA 1NCVA 1XWEA 2NVYB 4H13C 4CGYB 4BWGB 1LTID 1A3TA 2F3VA 4OGQC 3NWSA 4ZRZA 5IODA 4ZK9B 3K5MA 2CQAA 1STAA 3GTGB 2KCNA 5M5XB 5D14A 1A6XA 2L12A 2A6HD 4C1NK 3SVMA 4RKLA 5EJWA 1G2TA 4K8IA 2QEJC 4PMBA 3OIQA 2DY8A 4DN4M 2JA5B 2XIWA 1AZQA 4KK7A 4NP5A 1JICA 5FOBB 1NUCA 3AMUA 2NVXB 1BQQT 3E6ZX 3DUZA 5CYUA 4TSSA 4N9TA 5ISRA 3SXHA 4FXGC 1RODA 3TSSA 4A3FB 2PO4A 5K36H 4FYDA 1MSHA 2F0SA 3D6CA 4DA2A 4U68A 5I2YA 1FGBD 4OIKA 2WKDA 3QB3A 3S1NB 2KEEA 3ND8A 5J1ZA 2G9HD 2JE6I 4X3TA 1F2LA 2A6HC 1G6ZA 2B8FA 1F2MA 1VMCA 3FRPB 1Q8IA 2PNRC 1EY8A 2NBFA 3VYRA 1F77A 3MA2B 5FO9B 1W6KA 2DN8A 1C48A 4OHJA 5FKAC 5EKIA 3T56B 3GTMB 1T5XD 4BBSB 2FFKB 2EJFC 3CRLC 4BA1I 1EWHA 1LT6D 5CR3A 1STYA 3PUVA 1PYWD 5E3FA 3O13A 4Z9CB 2EYJA 3VR4A 1BUVT 4V190 3A8JE 4K8JA 3I73A 1GUTA 2JXMB 3GP7A 2PZWA 1Q12A 3QO2A 2RSOA 1Y1WB 3PO3B 2SNSA 1QJOA 2QF7A 5FO7B 1AW7A 2EY6A 3RLFA 2Z1CA 4HR7B 2OF1A 2Z4IA 2JP1A 1LLRD 1M4VA 1AP0A 4K5XA 4G7HC 3HOXB 3WDNA 5KRUA 3KF8A 2JA7B 2PPBC 3BYYB 2X6GA 3NTHA 1EY6A 2K05A 1EQTA 4K6DA 4KD3A 3PIP3 1WTPA 1CHPD 1PRTF 3S2DB 1EU4A 3OSOA 3T13A 2A69D 4RWSC 3U9SA 3RZDB 1VF5C 4QIWB 2F0MA 4XTCS 2L0CA 1DCZA 2PCFB 3BVGA 3K58A 1J9OA 5IGEA 2PZTA 1ZKOA 5JVH3 2F0FA 1SSOA 1UAPA 3URYA 3SHLA 3A8KE 4DNTB 4EQPA 4ZKCB 5J22A 4F88A 3HOWB 1WVLA 1KAAA 3MEHA 4HCEA 1PFMA 3HOZB 3K5NA 1GUWA 1OXXK 2RSNA 2A69C 4UDUC 4M8AA 1LTBD 2IW3A 2WACA 1I3QB 5CGKA 5T1IA 5C3XA 3QOLA 1STBA 2NB0A 1WTQA 3H6MA 4OO1I 1G91A 3NUCA 3NBIA 2RDFA 5M9OA 1GOZA 2B2WC 1RD9D 1BCPF 1ENCA 3D6WA 2L5TA 2H1EA 4A3IB 3L9AX 1YNJD 2EY5A 4ILWA 5JJZA 2KOLA 2EVBA 1X3PA 2XVSA 2OXPA 2K6AA 2F0EA 2EOTA 1OO9B 3IAYA 4RFBA 2RA4A 5CC4A 5LL6X 1EY5A 5IIFA 1EU3A 2AQ2B 4CKCA 2K04A 2D5DA 4XT3B 3P7JA 1EY7A 2O2LD 3TDQA 2BDNA 3UI2A 2E76C 3BG3A 1TS3A 2NVQB 3TBIB 1B2TA 4O42A 3NQIA 4XIGS 1IKLA 3S2HB 1EYAA 1GUGA 3JAME 3C1FA 1H9KA 3QWNA 4J1MA 1BO0A 4HSVA 4H0LC 2RQXA 2BA0A 2MGSA 5KYLA 1TT2A 2EXZA 4HMJA 2AQ1B 5ELCA 3Q23A 1YNJC 3LWUA 3GV3A 4KHVA 4ZYSA 4PMWA 4C3HG 4R8IA 1TWCB 1DOKA 2JA6B 1JWUD 1LT4D 2YU9B 2L11A 1YNND 4KY7A 3I70A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7Z A;  4LMQ D;  5CMD A;  1EOT A;  4ZKB B;  2HDL A;  1CA5 A;  2B2T A;  4HED A;  2B2W C;  2B2U A;  4IUP A;  3MTS A;  4IUT A;  1ROD A;  1SDF A;  3LWE A;  2X6G A;  5E4W C;  1PLF A;  2L1B A;  2KED A;  1ESR A;  2K05 A;  1EQT A;  4HAE A;  1XYI A;  1CM9 A;  2K1B A;  4MN3 A;  4MHE A;  1WTP A;  4IUV A;  1U4L A;  2KVM A;  2FJ2 A;  3D6W A;  5EPK A;  3TZD A;  3DEP A;  3KUP A;  2H1E A;  1RTN A;  2B2V A;  4X3K A;  5CBE E;  1G2S A;  3TN2 A;  4RA8 A;  1MSH A;  5AFW A;  4IUQ A;  2KEC A;  5EPL A;  5EQ0 A;  3R93 A;  2FMM A;  3FDT A;  4RWS C;  1B50 A;  4U68 A;  1SAP A;  1ZXT A;  1O7Y A;  1QNK A;  2N55 A;  5JJZ A;  1HUM A;  2KOL A;  5T1G A;  1HHV A;  4X3U A;  2HDM A;  1MI2 A;  1WTO A;  1PDQ A;  1X3P A;  4OIK A;  2EOT A;  5D65 A;  2NYZ D;  2B2Y A;  3G7L A;  1U4R A;  3KBX A;  3MWY W;  1ICW A;  2KEE A;  4QUC A;  1WTV A;  3I91 A;  4X3T A;  2RA4 A;  1TVX A;  2SDF A;  2IL8 A;  1F2L A;  3F2U A;  1G6Z A;  1J9O A;  2RVL A;  1HUN A;  1PFN A;  1A15 A;  1IL8 A;  1VMC A;  3GV6 A;  2KUM A;  4ZAI A;  1HA6 A;  1EIG A;  1VMP A;  1ILQ A;  1KNA A;  2DY7 A;  2K04 A;  1M8A A;  2X6L A;  2K01 A;  2MPM A;  3H91 A;  1MGS A;  1B53 A;  2HCI A;  4XT3 B;  2X69 A;  1BNZ A;  3FPU B;  3P7J A;  1MSG A;  5E4X A;  1RHP A;  1SSO A;  2B2T C;  1RTO A;  2K03 A;  1NCV A;  2BDN A;  3I90 A;  5EKI A;  1F9Q A;  1O80 A;  3UI2 A;  1X32 A;  5DNF A;  2N88 A;  4CJ2 C;  1NR2 A;  1IKM A;  1DOM A;  3I3C A;  3DEO A;  1EIH A;  1U4P A;  2FFK B;  2J7Z A;  2FHT A;  1BBX C;  2MJ8 A;  2K28 A;  1HFN A;  2L9H A;  4HCS A;  2FIN B;  1QE6 A;  4RAU C;  2B2W A;  5EPJ A;  4O42 A;  1B2T A;  1IKL A;  2B2V C;  3ONA B;  2R3Z A;  3I8Z A;  2HUG A;  2L4N A;  4ZK9 B;  4ZKC B;  2D9U A;  1LV9 A;  1BO0 A;  4HSV A;  4OIJ A;  1J8I A;  1WVL A;  3N52 A;  2Q8R E;  2NZ1 D;  1NR4 A;  2VXW A;  2HCC A;  1WTX A;  2CVR A;  1ML0 D;  4XDX A;  1DOL A;  1CA6 A;  4ZLT F;  1WTW A;  1EL0 A;  2MGS A;  2JYO A;  1ILP A;  5D14 A;  5COY A;  1PFM A;  2B2Y C;  1C8C A;  2L12 A;  2M2L A;  2MP1 A;  2B2U C;  1Q3L A;  1GUW A;  3IFD A;  1BF4 A;  2RSN A;  1QG7 A;  1U4M A;  3GV3 A;  4R9W A;  3SVM A;  2EE1 A;  1HRJ A;  1F9R A;  1RJT A;  4UAI A;  4NW2 A;  4IUU A;  1F9P A;  1XX8 A;  5EJW A;  1G2T A;  1B4O A;  1HFG A;  4CJ0 B;  4IUR A;  3Q6S A;  5CBA E;  4R8I A;  1DZ1 A;  1S4Z A;  2EPB A;  2RSO A;  3IL8 A;  3QO2 A;  1DOK A;  4CJ1 B;  1WD0 A;  2DY8 A;  5T1I A;  4DN4 M;  1JE4 A;  4QUF A;  1DON A;  2XIW A;  1AZQ A;  4XT1 B;  1WTQ A;  1WTR A;  1E0B A;  5COR A;  4X3S A;  1F9S A;  1B3A A;  2L11 A;  1G91 A;  1WD1 A;  1KNE A;  3HP3 A;  1NAP A;  1JIC A;  1X3Q A;  2Q8T A;  1PFB A;  1AZP A;  2JP1 A;  2NWG A;  3DM1 A;  1AP0 A; 
#chains in the Genus database with same CATH topology
 1II3 A;  1QZH A;  3K7U C;  3U50 C;  3PF5 A;  2LS0 1;  4UPA A;  1CA5 A;  1PFS A;  4JI2 Q;  1E24 A;  4C3J G;  1QWY A;  3STB D;  4YCV A;  3KYH C;  1JE5 A;  1LAC A;  2F0G A;  5NUC A;  2K52 A;  2EIF A;  1R4Q B;  1SYG A;  4K0K Q;  4E6I A;  2Z6K A;  1RTN A;  4PV1 C;  3G48 A;  5KIX A;  4B08 A;  2NVQ H;  1L1O A;  2GVB A;  5FO8 B;  3S2H H;  4LAA A;  1QNK A;  3BZD B;  5FJ8 H;  2UUB Q;  1N33 Q;  3CAM A;  3QIA A;  2MQH A;  1X55 A;  5D65 A;  1C9O A;  1O78 A;  3MXU A;  4ZQ3 A;  4DV0 L;  2IJ0 A;  1WOC A;  1AEX A;  2F0N A;  1WJJ A;  1P16 A;  1AFP A;  4IFD G;  1VQ8 A;  2X6L A;  5EGT A;  2G9D A;  1K28 A;  4GKJ L;  4FF2 A;  2VUM G;  1QOH A;  1TWC H;  1EFW A;  1YNN C;  2JA6 H;  1GXD C;  1BOS A;  3M4Y A;  2P5Z X;  1W6J A;  3RD4 A;  2YU9 H;  3S17 B;  1S5B D;  2QDL A;  2JJQ A;  3CKI B;  3D31 A;  2Q2U A;  4A3E B;  3M9B A;  2K28 A;  1R4P B;  4HCS A;  3J81 j;  2RDG A;  4JI4 L;  2QW7 A;  2F0K A;  3STB C;  1JQY D;  5KNC A;  5DM6 3;  3JAM L;  1SND A;  1JC7 A;  2E74 C;  2N8N A;  1FJG Q;  1ET6 A;  1WTX A;  3I4O A;  3NK9 A;  1ML0 D;  4OWW B;  5IWA Q;  3KF8 B;  4K6L A;  1VQI A;  3X3M A;  2LFN A;  2VB3 X;  4C1N I;  2MO0 A;  1D1K A;  4LF4 Q;  4AIM A;  3PV0 A;  3NWT A;  2ZTD A;  3ZJY C;  4NW2 A;  1IHZ A;  1VQP A;  4OO1 H;  4A3G B;  2ZJP A;  1NE3 A;  1BXT A;  2Z4H A;  2A74 C;  4AH6 A;  3HOV B;  5C4X G;  4YY3 L;  5FLM H;  1S5C D;  1KXL A;  4KHP Q;  2BA1 A;  1X3Q A;  2XGT A;  4NPS A;  5TSS A;  1LTA D;  4CKB A;  1HZB A;  3DXJ C;  3HOY B;  4IZ8 A;  1MIU A;  3J80 c;  1QB5 D;  2HD3 A;  3L2P A;  3MXG A;  4DF7 A;  4XQJ A;  2ZM6 Q;  3KUP A;  3S17 H;  3SK5 A;  1G2S A;  3BVZ A;  3CCM A;  4A3E H;  5EQ0 A;  2JN4 A;  4BY7 G;  2D0O A;  3CF5 A;  2R7Z B;  3J7Z C;  1L0W A;  1HUM A;  1VQA A;  1VQE A;  3W1B A;  3RNU A;  1SMX A;  1ZYR D;  4DV0 Q;  1HNX Q;  3MWY W;  3H3V C;  1HXY D;  1BKB A;  4WFN 3;  2UXC L;  5K36 G;  2B29 A;  2OEO A;  4K2L A;  1FNW A;  3K0Y A;  3T4A C;  1HA6 A;  2D2C C;  3QR8 A;  2F52 A;  2NUC A;  3SEB A;  2OTL A;  1PH6 A;  4P74 A;  3KFU A;  3OW2 A;  1MGS A;  3E5S A;  2HCI A;  5IYC G;  5C4Z A;  4DK0 A;  3UDI A;  4A3G H;  2PNH A;  3KLW A;  3BZC A;  3K80 C;  4QQB X;  2QKI C;  3L7Z C;  1X9N A;  2Y0S E;  3SDZ A;  3HOV H;  4GN4 B;  3ITP A;  2I0Q A;  1DOM A;  1ZEQ X;  1VQO A;  1IBM L;  5LMN W;  1YIJ A;  4DUZ L;  2O5J C;  3I7F A;  3DWA A;  1EY4 A;  3K8A A;  4GNX B;  4KV6 A;  2R7D A;  4DR3 L;  2AWO A;  2EYL A;  4U67 3;  1SE3 A;  2FIN B;  1QE6 A;  4LF9 L;  3J81 E;  5HUR A;  5HGQ A;  2R3Z A;  3V2T A;  1STG A;  1SJH D;  1UE7 A;  4YCW A;  1AE2 A;  1V8Q A;  5C0X I;  2O4X A;  3HOY H;  2O5I C;  3ULJ A;  4KKU A;  3N52 A;  2JA5 G;  2Q2I A;  3V05 A;  1X6O A;  3K5L A;  1C8C A;  1LTL A;  1EWI A;  1U4M A;  3NHH A;  3GD7 A;  4JI6 L;  1CKM A;  4RCO A;  3OOC A;  4MIU A;  4CJ0 B;  2R7Z H;  5JEA H;  3MHB A;  1I6H B;  1ZYR C;  2K50 A;  2LY7 A;  5BN3 A;  4DAM A;  4FDB A;  4A3D G;  4POF A;  4A3F G;  2NZH A;  1YVC A;  3KJP A;  2C35 B;  2RDH A;  3DM1 A;  3CCU A;  1AE3 A;  3IFT A;  1JWS D;  2BOS A;  4CBV A;  3S9W A;  4DV7 Q;  2B2T A;  4YCU A;  5G3L D;  1SXT A;  4RHS A;  3ERS X;  2L1B A;  4LFC Q;  3GTQ B;  4Q5V A;  3E9I A;  4OWX B;  1KQS A;  1ENA A;  4A3L H;  3C2P A;  4DAV A;  1Q86 C;  3TN2 A;  3J7A V;  3R93 A;  3MAQ A;  3C1E A;  1XXG A;  1TS4 A;  2HDM A;  3A8I E;  1MI2 A;  1H9S A;  4O0A A;  2BH2 A;  1I4G A;  2CH4 A;  1U0L A;  4TRD A;  3CMA A;  5CV8 A;  5D3I B;  2WB1 G;  3X3N A;  3F2B A;  3CCJ A;  4BBS G;  4A3D B;  2F0W A;  3PMF A;  5IP9 G;  1PMR A;  5D3D A;  4TVA B;  1B7Y B;  4QL5 A;  5GAD C;  2MPM A;  2UU9 L;  3PQI A;  2F0O A;  1NSN S;  3WOE A;  1I6H H;  4L5R C;  1GJX A;  2M9V A;  1RTO A;  3UDF A;  4LUO A;  1RL2 A;  4DAP A;  1F9Q A;  4KN7 C;  4LF8 L;  3F8T A;  1UE1 A;  4IJH A;  1HCZ A;  3WWV A;  3GTG H;  4LJZ C;  4DV6 L;  1K83 B;  1MD2 D;  1FYC A;  3IRB A;  1YIT A;  1V1O A;  4R4Q A;  1H9R A;  2JEA I;  2B2V C;  5C3W A;  2IT1 A;  5M3F B;  4FVM A;  3J81 L;  2PQE A;  1Y1W G;  3PO3 G;  2B39 A;  1D2B A;  3GTQ H;  4NDX A;  4ZUI A;  3U4Z A;  2IX3 A;  5JOB A;  2B2Y C;  4A75 A;  2WB1 B;  2EE1 A;  3EIV A;  4B3T Q;  1TWF B;  4UAI A;  3HOX G;  4X66 L;  2VQE L;  1B4O A;  2PYK A;  4WJ3 M;  1I4H A;  2PI2 A;  1Y14 B;  2IPK D;  5JPM C;  2JA7 G;  3GTK B;  3S16 B;  4DR6 Q;  4LFB L;  2WP8 J;  4IFD J;  1Z7T A;  1PRT B;  2R61 A;  3K5O A;  1L1O B;  3OMC A;  5C5M A;  2K5W A;  2NTS A;  1N34 Q;  1B3A A;  4A3D H;  1JJ2 A;  3PO2 B;  4LF7 L;  3AQQ A;  5CV4 A;  1EQQ A;  1JOR A;  2F03 A;  4QJF A;  4A3C G;  3TRE A;  1IYJ B;  1YHB A;  5I9O A;  1PA6 A;  2HT1 A;  4LF6 Q;  5IGD A;  2I5L X;  3R2I A;  1G51 A;  1J5E L;  5GRO A;  4EQN A;  1PH8 A;  3FHW A;  2RHS B;  1ESR A;  3T1Y Q;  4MN3 A;  4MHE A;  3OIP A;  4IUV A;  1K0S A;  3GTJ B;  5DAU A;  3TP6 A;  4DU9 A;  5ELD A;  1K83 H;  1PXU A;  1K8O A;  1XTD A;  1H95 A;  5BN5 A;  4DV5 L;  3TME A;  4GOP C;  3VR3 A;  1D5M C;  3Q24 A;  5M3F H;  2WIN B;  4ID6 A;  3GTP B;  1YBY A;  1SYD A;  4KLK A;  1U4R A;  2KEN A;  3VR2 A;  2YTY A;  4CDD C;  1TVX A;  3F2U A;  1F2Z A;  1CQV A;  2OCE A;  3J80 i;  4HIK A;  1A62 A;  3ND9 A;  4HID A;  4TQU S;  2Y0S B;  1P8L A;  2CKZ B;  1BDO A;  1TWF H;  4YHH Q;  2I46 A;  4FF1 A;  3S16 H;  4LWC A;  2CFM A;  4ALP A;  3GTK H;  1HTP A;  2CQO A;  3HOW G;  4HJ7 A;  4DR1 Q;  3CCL A;  4PZ6 A;  5IT9 E;  1X32 A;  3TP8 A;  2K5D A;  3NSW A;  4KY6 A;  3W1G A;  1H9M A;  2FHT A;  2L9H A;  5C0X H;  1V1Q A;  3PUY A;  4EX5 A;  3HZX A;  4JI0 L;  1LV9 A;  2PI2 E;  2R7F A;  4POG A;  5IGF A;  1VQC A;  2ZTE A;  5I6Y A;  2HCC A;  1ESF A;  4FO2 A;  3J7A F;  4S3S A;  3M4O B;  1Q1B A;  3D4R A;  4P2C B;  3GTJ H;  1QG7 A;  3KJO A;  1Y1V B;  3NTK A;  1SFO B;  4EVO A;  3S1R B;  1G8Z D;  2PMZ E;  4OX9 L;  1S40 A;  1BCP B;  1PTO B;  3MC0 B;  1GHK A;  3GTP H;  2KHI A;  4RGT A;  4H7B A;  1AH9 A;  2F0H A;  3DWP A;  1HA5 A;  4FNF A;  5KEE A;  4JYA L;  1B70 B;  3HP3 A;  3QOJ A;  2F0Q A;  4A76 A;  2H4O A;  3T51 B;  4A3I G;  4LMQ D;  1RKN A;  4X65 L;  1EZ6 A;  1CZG A;  2EYH A;  3TQY A;  3PF4 A;  1U5K A;  2OQ0 A;  3EJI A;  1VQG A;  1LAB A;  4JC0 A;  2KA7 A;  1I94 Q;  1CTM A;  4EQO A;  3CCQ A;  4K5W A;  1FNU A;  4HTH A;  5AFW A;  5AJ3 Q;  3AFQ A;  1K8M A;  1SNO A;  1B50 A;  1G29 1;  2UUA L;  2CW0 C;  3KBG A;  5ELB A;  2R92 B;  1EYG A;  4JI7 Q;  3ZYY X;  4KHZ A;  1JJG A;  1IYV A;  3OWE B;  4L5T A;  2NVT B;  4JI2 L;  3M4O H;  3C3L A;  2RVL A;  3MFY A;  2JEB I;  1Y1V H;  2DY7 A;  1SFO H;  3EA6 A;  2ICE C;  3S1R H;  2ICI A;  4NXM Q;  1TR5 A;  3PUX A;  4CKE A;  1HNW Q;  2OT2 A;  5FJ8 G;  4K0K L;  5J3B A;  1GD7 A;  1PTO H;  1VQJ A;  4JV5 Q;  1LO5 D;  5BN4 A;  3KF6 A;  2F0D A;  5DNF A;  2VQF Q;  3I3C A;  2UUB L;  1N33 L;  3MXP A;  5IT9 L;  3QJY A;  1UWV A;  3GTL B;  5BR8 Q;  2AWN A;  1DM0 B;  1V1P A;  5EKK A;  4R4O A;  5HY6 A;  2RCN A;  3CCS A;  3R2T A;  4A3B B;  3FMC A;  2Q8R E;  2TSS A;  4J15 A;  4XDX A;  4IPD A;  4DUY Q;  2JA6 G;  3NPP A;  1A3V A;  1XNR Q;  2C5C A;  2IHE A;  2M2L A;  2B2U C;  4IOA A;  2XRQ D;  3IFD A;  4A3K B;  4JI3 Q;  4RGM A;  1E3P A;  1GUN A;  4PMC A;  1VQB A;  3VA5 A;  2AQ3 B;  1A8V A;  2K33 A;  3NEL A;  2R92 H;  2QDB A;  1IBL Q;  1Q1E A;  1CUK A;  1KAW A;  4GLV B;  3NE5 B;  3I2Z A;  5COR A;  2NVT H;  1KNE A;  2CHB D;  1NMF A;  3FVQ A;  3A55 A;  5GAE C;  1H9S B;  1FJG L;  4KN4 C;  2YTV A;  5IWA L;  4OO1 G;  1SYB A;  1Y8O B;  5ELN A;  3BS1 A;  3CCR A;  3D3R A;  3LWE A;  4LF4 L;  1OTC A;  5IOC A;  4NXN Q;  1I6V C;  2QIL A;  2VZA A;  3ERO A;  4H44 C;  1PH2 A;  2K1B A;  5FLM G;  3PGZ A;  1KDB A;  5ELO A;  1B9N A;  1D5Z C;  2LXJ A;  3B6Y A;  1PH9 A;  3K0X A;  2QA4 A;  1Z47 A;  3VR6 A;  4JK1 C;  1D1I A;  2UUA Q;  1I4X A;  2KEC A;  3GTL H;  1EEI D;  3E9H A;  4Y7N B;  3FDT A;  2PW5 A;  1ZXT A;  1O7Y A;  1QIL A;  3H15 A;  4KHP L;  3R8B A;  3F1Z A;  1B1Z A;  1Y8P B;  1Z6H A;  1LTG D;  4P71 A;  1O7I A;  4DV3 Q;  4B3R Q;  4HSP A;  1UNS A;  2A68 D;  1N32 Q;  3KLR A;  3CCV A;  1E2W A;  4BY1 B;  4I7Z C;  3K57 A;  1NJI C;  2I5H A;  1IYU A;  3GV6 A;  4K2K A;  5FLX E;  2F3W A;  4A3E G;  4A3K H;  2A6E D;  1VMP A;  3JAM c;  3MVV A;  4NB3 A;  1BNZ A;  2ENB A;  2ZM6 L;  2SOB A;  2ZJR A;  1VS0 A;  4KTA A;  4R1J A;  1BR9 A;  3BDC A;  2VNU D;  1OXU A;  2CWP A;  2J7Z A;  1YHQ A;  3C46 A;  1HNX L;  2HIV A;  3TS0 A;  2B8G A;  2GA4 B;  1EIY B;  2L55 A;  3TZU A;  1LT5 D;  5EBC A;  4A3G G;  2D9U A;  1GHJ A;  3BDO A;  4XQQ A;  3BVM A;  4CDC C;  1PH5 A;  1PV4 A;  4ODG A;  2NZ1 D;  1PH7 A;  2BH8 A;  1CA6 A;  2PMZ B;  5IYD H;  1HR0 W;  1B44 D;  2RBM A;  2ZXP A;  3BDL A;  3HOV G;  4WJW A;  5C44 B;  3M7G A;  4PNY A;  4HIM A;  2EY1 A;  1Q3L A;  4A3J B;  1W2B A;  2I07 B;  4LW1 A;  2J4X A;  4Y7N H;  1F9P A;  2F0I A;  1E2Z A;  3NP8 A;  3Q6S A;  1DZ1 A;  3NQT A;  1QVG A;  1IW7 D;  2NN6 I;  3HOY G;  2F0T A;  2A68 C;  5LHY 1;  1WTR A;  2GVA A;  2WV6 D;  3GO5 A;  2CH4 W;  4KI0 A;  1WCM B;  4N9P A;  2A6E C;  4BY1 H;  1EOT A;  4ZCK A;  1LYL A;  2UXD Q;  5IYB G;  2R7Z G;  4DXG A;  5JEA G;  1PRT D;  1JT8 A;  1N9W A;  5JAV A;  3MXN A;  1ASY A;  5C4H A;  1U4L A;  4ME5 A;  2D62 A;  5ELF A;  4PZ8 A;  4HIO A;  1QVC A;  2E2H B;  2DUD A;  3S14 B;  3PUZ A;  5CV6 A;  1BBU A;  5LMN Q;  4KKT A;  4IUN A;  1SYE A;  2N55 A;  1HHV A;  4RKB A;  2MNA A;  3SK8 A;  4KY5 A;  3P75 A;  4AYB B;  2J0T D;  3ICE A;  3M7N A;  1ICW A;  1CFM A;  4QUC A;  3RLN A;  1VQM A;  4DR4 Q;  4DV7 L;  2IL8 A;  4G4K A;  2K5N A;  4NMZ A;  4CDF C;  5A35 A;  5C44 H;  4QMG A;  4A3L G;  4C2M B;  5GAG C;  1IL8 A;  3E0E A;  4DR5 Q;  4A3J H;  1JB3 A;  4LFC L;  2M00 A;  3NXW A;  1HPC A;  1STE A;  4C3I B;  3CC4 A;  5FLX L;  3SK4 A;  1IW7 C;  3HS0 C;  4RGN A;  1DXM A;  3FPU B;  3WOF A;  1XTC D;  3M3Y B;  1EEF D;  1K73 C;  1SMY D;  2K4K A;  4IAL A;  3NTI A;  4L8J A;  3I4L A;  2F0L A;  1WCM H;  3G6E A;  3RN5 A;  3SE0 A;  2Z6K C;  2BCO A;  4QB4 A;  1PRT C;  2F3I A;  1EY0 A;  1L1O C;  1OXS C;  1Q46 A;  5M3M B;  3A56 A;  1YI2 A;  2E8G A;  1X56 A;  1NR4 A;  5JJK A;  4XYQ A;  1VQD A;  2MP1 A;  2QEX A;  4B9X A;  2E2H H;  3S14 H;  4JBK A;  1RJT A;  1KHI A;  5C6A A;  1STN A;  3LNN A;  5CBA E;  3N6R A;  5M5W B;  2XNA C;  1B3Q A;  4JBJ A;  1DON A;  1IXR A;  2WKC A;  3CXC A;  5GQO A;  1OXV A;  4IPG A;  3VA7 A;  2Q8T A;  1UUP A;  4RMF A;  4C2M H;  1S5E D;  1O7Z A;  4C3I H;  3RUZ A;  1BCP D;  1PHJ A;  1YNX A;  1PTO D;  4DV1 Q;  1SMY C;  1N8R C;  2KJX A;  3MTS A;  2C9O A;  4G7Z C;  5KNB A;  2LXK A;  3M3Y H;  4B3T L;  5IYB H;  2E2J B;  1FR3 A;  1AN8 A;  4XQN A;  2FJ2 A;  1F2Y A;  4DR6 L;  5DEH A;  1A0I A;  3HOU B;  1EY9 A;  3KF6 B;  1N34 L;  4H02 A;  1PVO A;  1MKH A;  1PDQ A;  5M3M H;  4PZ7 A;  1A2U A;  3V96 A;  5EAY A;  3KBX A;  3I55 A;  3U58 A;  1V1P B;  4LF6 L;  5K5P A;  1LUZ A;  4WRD A;  3MEF A;  2EZV A;  1A15 A;  3H94 A;  2LKV A;  4HMI A;  3J81 c;  1PH4 A;  4N8X 1;  3T1Y L;  1M8A A;  1N36 Q;  5M3F G;  4YIJ A;  1JR0 D;  3RZO B;  1Z9F A;  1KD1 C;  5CV5 A;  5M5W H;  2K03 A;  4HJ8 A;  3S15 B;  4A3M B;  2EY2 A;  4CJ2 C;  3S1M B;  2UUC Q;  1L2F A;  3EQL C;  5C3E B;  3DEO A;  1U4P A;  4IPC A;  2BE5 D;  3HFZ B;  3OHX C;  2MJ8 A;  4LK1 C;  1BCP C;  3A54 A;  3DM3 A;  5EPJ A;  1PTO C;  1I4Q A;  1DJR D;  1GUS A;  4L63 B;  1KLU D;  4P73 A;  1YJW A;  4OIJ A;  3JAM i;  2KHS A;  1DOL A;  2E2J H;  1QCB D;  4ZLT F;  4YHH L;  1BBW A;  5M5Y B;  3PIO 3;  3CHB D;  4IN3 A;  2KCT A;  5IP7 G;  3T1H Q;  1BF4 A;  1V43 A;  3HRZ C;  5C0X G;  3PO2 G;  4DR1 L;  2NN6 H;  3HOU H;  1PZK D;  5I6W A;  4CHT B;  2OWO A;  1PYB A;  1LT3 D;  1S4Z A;  3IL8 A;  1WD0 A;  1EQV A;  5KGU A;  2ID0 A;  1QNU A;  1TQO A;  4JI1 Q;  1NY4 A;  2HHH L;  1JOQ A;  2R6G A;  4LF5 Q;  1F9S A;  3PIO A;  4BXX H;  2K5H A;  2K75 A;  3EVQ A;  1AZP A;  1CT1 D;  4FP5 D;  2JSO A;  2YTX A;  4DV4 Q;  3BYT B;  4JBM A;  2GN5 A;  4N8F A;  4ZKB B;  2IY5 B;  1EUJ A;  2IX0 A;  1SDF A;  3RZO H;  1PLF A;  4ABN A;  3ULP A;  1XYI A;  1K8G A;  1PZI D;  1EFI D;  3S15 H;  4A3M H;  1SYC A;  2BE5 C;  3F2D A;  5JPN C;  3S1M H;  1ENF A;  2R93 B;  2IHF A;  2E2I B;  5C3E H;  5CBE E;  2MHV A;  2WAQ E;  4O1N A;  2Y0S G;  1Q90 A;  3S24 A;  2YYZ A;  3CRK C;  5IGB A;  3LGJ A;  1EYC A;  5T1G A;  3GDE A;  3HKZ E;  1WTO A;  3I72 A;  4OL7 A;  3G7L A;  4WJ4 A;  3DWQ A;  5J39 A;  1K9M C;  1VQ5 A;  5M5Y H;  2EJM A;  2K7V A;  3A0J A;  2B63 G;  4JOI A;  5I9P A;  5IGC A;  4BA2 I;  3CCE A;  1ILQ A;  4FXK C;  1I94 L;  4RG1 A;  3KLS X;  2K5V A;  3KK7 A;  5IGG A;  1IZ6 A;  3G6J B;  4HN7 A;  2Z9H A;  5E4X A;  1D5X C;  4BBR B;  2B2T C;  3OW7 A;  3RLO A;  5AJ3 L;  2SEB D;  5JEA J;  4ZUJ A;  2IWH A;  2KBN A;  4DK6 C;  2Q2T A;  3J7Y W;  4JI7 L;  1BBX C;  1GUO A;  3KLS A;  2VS1 A;  1Y1V G;  5LMU Q;  2B2W A;  3H0G B;  2E75 C;  1M90 C;  1EOV A;  2K32 A;  2A73 B;  4KKS A;  4RHR A;  2HUG A;  2ASB A;  4DV2 Q;  2AUJ D;  3PUW A;  1KC8 C;  4NXM L;  1CSQ A;  1I50 B;  2E2I H;  1HNW L;  1G6P A;  3H09 A;  3W2D A;  2R93 H;  3CW2 C;  5HGT A;  3BJU A;  2LSS A;  2ZT9 C;  3Q22 A;  4FF4 A;  4O2D A;  4JV5 L;  3MXN B;  1HRJ A;  1NBW A;  5KND A;  3D8G A;  2B63 B;  4GKK Q;  1RCV D;  2VL6 A;  5IP7 H;  1SYF A;  2VQF L;  4B3S Q;  3R3O A;  4IUR A;  1YEZ A;  3PO2 H;  2HHH Q;  4KD4 A;  4KJO A;  5BR8 L;  3W3A A;  1FD7 D;  2F4I A;  4X3S A;  2CW0 D;  1SNM A;  2LMC B;  4M1U B;  4C56 C;  2EYF A;  3HGB A;  2Z8L A;  5C4J B;  1ET9 A;  5EBD A;  3TP7 A;  4A4I A;  1TKW B;  4DUY L;  2EYM A;  4A93 B;  1GO3 E;  1XNR L;  1OXT A;  4X64 Q;  1HZ9 A;  4HED A;  2B2U A;  4JG2 A;  1I4P A;  1NTG A;  1HNZ Q;  2R92 G;  4JI3 L;  4TKO B;  1VQ6 A;  4BBR H;  1TY0 A;  1RF2 D;  3NBH A;  4IQZ A;  1KAB A;  5ELE A;  4HJA A;  1LTR D;  3M85 A;  3TZD A;  4QCL A;  2RF4 A;  1XNQ L;  4X3K A;  2Z6B A;  4RA8 A;  1IBL L;  2Q8I B;  2FMM A;  3H0G H;  1XMQ L;  1SAP A;  2F4V Q;  1IBK Q;  3A7A B;  1MJC A;  3I91 A;  2SDF A;  1I50 H;  1KLG D;  4DXF A;  5LL6 S;  5I2X A;  2AMC B;  1PFN A;  1HUN A;  1T5E A;  1VF7 A;  4ZAI A;  3G71 A;  4G7O C;  4NXN L;  1KNA A;  5EKL A;  2EYO A;  2B63 H;  3H91 A;  2SNM A;  2EJG C;  5IY0 A;  2IX1 A;  4B9W A;  4A3B G;  3VYT A;  1XPU A;  3MZ5 A;  2N88 A;  1NR2 A;  1EIH A;  1SLJ A;  3HEJ A;  1VQL A;  2ES2 A;  3RMH A;  5C4J H;  4A3K G;  1HFN A;  4DV3 L;  4B3R L;  1EWC A;  1ONL A;  1SR3 A;  1N32 L;  4EGV A;  4A93 H;  4IOC A;  2L4N A;  5CV7 A;  1HQM C;  2UXB Q;  3AB9 A;  2BDO A;  2JQO A;  3I4N B;  2FXQ A;  4L6T B;  3J81 i;  2V1C C;  2VXW A;  4BS9 A;  2D0P A;  3RN2 A;  1XMO Q;  1ILP A;  5COY A;  4F8M A;  1FL0 A;  5C5L A;  2KCC A;  3FEW X;  4JCV E;  5E7N A;  3A7L A;  4DK1 A;  2A1A A;  4IUU A;  2E5L Q;  1HFG A;  2EYP A;  4DR7 Q;  2EPB A;  1PTO F;  1QUQ A;  5IYD G;  4PQX A;  4QUF A;  3ER0 A;  2N49 A;  1E0B A;  2RKS A;  1L0X B;  2QCP X;  2N78 A;  2NTT A;  2YV5 A;  5CMD A;  1R9T B;  1EZ8 A;  1A3U A;  3K6O A;  1JMC A;  2F0U A;  2PW7 A;  3VYU A;  4CDE C;  1D6E C;  2WAQ B;  3P20 A;  4HAE A;  1TS5 A;  2EXD A;  4KJN A;  2KVM A;  5G3L F;  3HKZ B;  1XNQ Q;  2VB2 X;  3MFG A;  4R4C A;  4BY1 G;  3DEP A;  1VQ9 A;  3E0J A;  3CU7 A;  4B3M Q;  1XMQ Q;  1E1O A;  2XWB B;  1CI3 M;  4LFA Q;  1TWA B;  4JBW A;  1A2T A;  4X3U A;  1ASZ A;  5C0X J;  4IFD I;  4DK3 C;  4IJL A;  3GTO B;  3I4N H;  2NYZ D;  3FPP A;  1PH1 A;  2UXD L;  2DJF C;  4FF3 A;  1HR0 Q;  1Q82 C;  1PH3 A;  1TWG B;  4OXP A;  1YJ9 A;  3K7A B;  1YZ6 A;  1EIF A;  5DLQ E;  3CPW A;  1MSG A;  2NZO A;  2H5X A;  1VQK A;  1VCI A;  2Q2H A;  3D4D A;  3EFX D;  4DAY A;  5LMN L;  1WI5 A;  4J8Q A;  2VY3 A;  2HQL A;  1TY2 A;  3W5O A;  1KDC A;  4DR2 Q;  1IKM A;  1PZJ D;  1KL9 A;  3SR1 A;  1HQR D;  5C44 G;  1X3F A;  4A3B H;  3Q0A A;  3OWF A;  2XN9 C;  4GNX C;  2AUK A;  4DNR B;  4A3J G;  1VDZ A;  1UE6 A;  4RAU C;  3BZK A;  1FNV A;  4DR4 L;  3ONA B;  1B9M A;  2K5Q A;  3KDF A;  1R9T H;  2PZU A;  2DNE A;  3I8Z A;  5JVG 3;  4RH6 A;  2WII B;  4DR5 L;  1J8I A;  2PQA A;  3OTO Q;  2WFW A;  4DNI A;  1WTW A;  1EL0 A;  2JYO A;  2JA8 G;  2A8V A;  1WCM G;  3AU7 A;  3ERQ A;  3I4M B;  1C0A A;  1CK1 A;  1LTS D;  2F1M A;  1TWH B;  1Q81 C;  1XX8 A;  3GQB A;  1TWA H;  4R4I A;  5KYI A;  1MBY A;  1SBB B;  3G4S A;  3S1Q B;  1JE4 A;  3GTO H;  4X62 Q;  4QF4 A;  1KDA A;  2ZXO A;  5A2Q E;  1VQ4 A;  4GZY C;  1WD1 A;  2XTI A;  1NAP A;  3AFP A;  4JVZ A;  1K0R A;  4OEM B;  1T9H A;  1TWG H;  3UE0 A;  3T16 A;  4FXD A;  2XSC A;  3FKI B;  3A5U A;  3IKJ A;  2HDL A;  4C3H B;  1C4Q A;  1S5D D;  2F0V A;  4K5V A;  3K7A H;  3CME A;  4IUT A;  5I4D A;  4R8N A;  5E4W C;  2HQE A;  1CHQ D;  1KTK A;  4AYB G;  1CSP A;  3SK6 A;  1TU2 B;  3CP0 A;  4RGO S;  1GM5 A;  3D4W A;  5EPK A;  4P75 A;  4JI8 Q;  5FLX c;  1K3B C;  1RDP D;  3JC6 6;  1JOK A;  4C3I G;  2JA8 B;  3CD6 A;  2QGQ A;  1UEA B;  3OMG A;  4C3J B;  2V4D A;  1KIX A;  4J6H A;  3VYS A;  2CCZ A;  2XRS D;  2AHO B;  4RCN A;  3CQZ B;  2ZXR A;  4I65 A;  3J80 E;  1YHA A;  1WFQ A;  1VQ7 A;  1DD2 A;  1WTV A;  4G57 A;  4DV1 L;  3VDY A;  3PSI A;  1SNP A;  3CC7 A;  3I4M H;  1LTT D;  4P72 A;  3DHQ A;  1QZG A;  1UEB A;  1TWH H;  1B53 A;  2X69 A;  3UDG A;  5M3M G;  1RHP A;  2EQS A;  3S1Q H;  3I90 A;  1O80 A;  3LX0 A;  3KOJ A;  1SE2 A;  3L3O C;  3TP5 A;  1STH A;  4F87 A;  3E3X A;  4JI5 Q;  3OPO A;  2N3S A;  2VW9 A;  3FKI H;  2VUM B;  1SJE D;  2WB1 E;  4C3H H;  3QG1 A;  3K59 A;  4WOR A;  1X54 A;  2CVR A;  1N36 L;  2XWJ B;  4MZ9 A;  1JCK B;  4OWT B;  5DM7 3;  2A19 A;  1VQH A;  1GKH A;  2F0J A;  5H1S E;  4ULL A;  4R9W A;  4R4T A;  1F9R A;  3NBH B;  2JA8 H;  4MTK A;  2UUC L;  4JW0 A;  1CZW A;  1I4R A;  4KMU C;  4CJ1 B;  4C3J H;  4V0B A;  2DJG C;  2AKW B;  2TMP A;  1SNQ A;  1NNX A;  3U9O A;  5CV9 A;  3CQZ H;  4JPB W;  4XT1 B;  5F2D A;  3VR5 A;  1EQR A;  1L0Y B;  4UP8 A;  2A5H A;  3A74 A;  1U9R A;  5A2Q L;  1PFB A;  2NWG A;  2NN6 G;  3HOU G;  1Y69 U;  4XYO A;  3T53 B;  4IUP A;  3UE1 A;  3T1H L;  1JJC B;  3DMU A;  2MUY A;  3HG9 A;  4QY7 A;  2KED A;  1JOO A;  5C4X B;  1CM9 A;  4F7X A;  3P1H A;  1E2V A;  1Y8N B;  4BXX G;  2EDG A;  4GKJ Q;  2DNC A;  1ICF B;  2E2D C;  2B2V A;  4X6A H;  4YWK A;  4IFD H;  4JI1 L;  1TXY A;  3M4P A;  4IUQ A;  5EPL A;  1O7L A;  3ULL A;  1D8L A;  1CQF A;  4LF5 L;  1SEB D;  2KQ3 A;  2VUM H;  3H3V I;  2JK8 A;  1XPO A;  4XXE A;  3D0F A;  1V9P A;  1H9J A;  2F0P A;  4DV4 L;  2B2Y A;  4Q0F A;  4JI4 Q;  4A3M G;  1SNC A;  5FK9 C;  3J80 L;  1TII D;  1TS2 A;  5C3E G;  1JWM D;  1SE4 A;  2KUM A;  4QIW E;  1DYQ A;  1EIG A;  3BU2 A;  4BY7 B;  4K14 A;  2K01 A;  4DFA A;  1HTL D;  2KCM A;  4NKL A;  1S5F D;  4DGZ A;  2FMC A;  1XPR A;  1M1K C;  5E1F A;  1EYD A;  1NCV A;  1XWE A;  2NVY B;  1K8A C;  4H13 C;  4CGY B;  4BWG B;  4DPG A;  1LTI D;  1A3T A;  1QUQ B;  2F3V A;  4OGQ C;  1HZA A;  1S72 A;  1CKO A;  1FVI A;  4YY3 Q;  3NWS A;  4ZRZ A;  5IOD A;  2OTJ A;  4ZK9 B;  3K5M A;  2CQA A;  1STA A;  3GTG B;  2KCN A;  5C4X H;  5M5X B;  3TRZ A;  5D14 A;  1A6X A;  2L12 A;  3I56 A;  2A6H D;  4C1N K;  3K81 C;  4GOP A;  5L37 A;  3SVM A;  4RKL A;  5EJW A;  1G2T A;  4K8I A;  2KHJ A;  2MFI A;  2QEJ C;  4PMB A;  3OIQ A;  2DY8 A;  4DN4 M;  3AYH B;  2JA5 B;  5LMU L;  2XIW A;  1AZQ A;  4KK7 A;  4L5S A;  1QVF A;  4NP5 A;  2R93 G;  4DV2 L;  1JIC A;  5FOB B;  1NUC A;  3AMU A;  2NVX B;  1BQQ T;  2UXC Q;  3E6Z X;  4BY7 H;  3DUZ A;  5CYU A;  4TSS A;  1I5F A;  3SGI A;  4N9T A;  5ISR A;  3SXH A;  4FXG C;  1ROD A;  1DGS A;  3TSS A;  4A3F B;  4GKK L;  2NVY H;  2PO4 A;  5K36 H;  4FYD A;  1B8A A;  4B3S L;  1X3G A;  3CPF A;  4DAY B;  1MSH A;  2F0S A;  1CKN A;  3D6C A;  4LNQ A;  4DA2 A;  4U68 A;  4APV A;  5IYC H;  1IBM Q;  4DUZ Q;  3RR5 A;  5I2Y A;  1FGB D;  4DR3 Q;  4OIK A;  4BBR G;  2WKD A;  3QB3 A;  4LF9 Q;  3S1N B;  2KEE A;  3ND8 A;  5J1Z A;  2G9H D;  1E22 A;  2JE6 I;  4X3T A;  3KDF B;  5M5X H;  4X64 L;  1F2L A;  2A6H C;  1HH2 P;  1G6Z A;  2B8F A;  1A63 A;  1F2M A;  4YWL A;  4GN5 A;  1HNZ L;  1VMC A;  3FRP B;  1MJE A;  1Q8I A;  2PQA B;  2PNR C;  2B3G A;  1EY8 A;  2NBF A;  3H0G G;  3VYR A;  1F77 A;  3MA2 B;  5FO9 B;  1W6K A;  2DN8 A;  2I5M X;  1J6Q A;  1C48 A;  4OHJ A;  5FKA C;  4IPH A;  5IE8 A;  2K14 A;  5EKI A;  2JA5 H;  3T56 B;  4JI6 Q;  3GTM B;  4I7A A;  1T5X D;  2F4V L;  4BBS B;  2FFK B;  1GVP A;  1IBK L;  2EJF C;  3CRL C;  4BA1 I;  1EWH A;  1LT6 D;  5CR3 A;  2NVX H;  1STY A;  3PUV A;  1PYW D;  5E3F A;  3O13 A;  4HJ5 A;  2ZTC A;  4Z9C B;  2EYJ A;  3VR4 A;  1BUV T;  4A3F H;  1WTH A;  4V19 0;  4GLX A;  3A8J E;  4K8J A;  4UY8 C;  3I73 A;  1GUT A;  1SRU A;  2JXM B;  3EN2 A;  3GP7 A;  1Q8K A;  4A93 G;  1MHW C;  2PZW A;  1Q12 A;  3QO2 A;  2RSO A;  1Y1W B;  3PO3 B;  2SNS A;  3PCO B;  1QJO A;  2QF7 A;  5FO7 B;  1AW7 A;  3S1N H;  3L0O A;  2EY6 A;  3AEV A;  3RLF A;  2Z1C A;  4HR7 B;  2OF1 A;  2UXB L;  2Z4I A;  4ME3 A;  1FGU A;  2JP1 A;  1LLR D;  1M4V A;  1AP0 A;  4K5X A;  4G7H C;  3HOX B;  3TS2 A;  1XMO L;  3WDN A;  5KRU A;  3KF8 A;  2DGY A;  3HKS A;  2JA7 B;  2PPB C;  1VQN A;  1VQF A;  3BYY B;  2X6G A;  1X65 A;  3NTH A;  1EY6 A;  2K05 A;  1EQT A;  4K6D A;  4KD3 A;  3PIP 3;  2E5L L;  1WTP A;  2UU9 Q;  3GTM H;  1CHP D;  1PRT F;  4UHV A;  3S2D B;  4QGU A;  4BBS H;  1X3E A;  3CC2 A;  4DR7 L;  1XJV A;  5IP9 H;  3H3V H;  1EU4 A;  3OSO A;  3T13 A;  2A69 D;  4RWS C;  4LF8 Q;  3FP9 A;  3U9S A;  3RZD B;  1VF5 C;  4QIW B;  4DV6 Q;  3HOZ G;  2F0M A;  3PIP A;  4XTC S;  2L0C A;  4AQY L;  1DCZ A;  2PCF B;  4PG3 A;  3BVG A;  3K58 A;  1J9O A;  5IGE A;  4GLA C;  2PZT A;  1ZKO A;  5JVH 3;  2F0F A;  2CWA A;  4OEL B;  4B3M L;  1Y1W H;  3I4N G;  3PO3 H;  1SSO A;  1UAP A;  4MNO A;  4X66 Q;  2VQE Q;  4LFA L;  3URY A;  4DKA C;  5IT9 c;  3SHL A;  4LFB Q;  3A8K E;  4L5Q A;  4OON A;  4DNT B;  1SE8 A;  3DLL A;  2ATW A;  4IO9 A;  4EQP A;  3HOX H;  5JJI A;  4ZKC B;  2JA7 H;  5J22 A;  1HR0 L;  4F88 A;  3HOW B;  2JA9 A;  1WVL A;  1KAA A;  1K3R A;  4LF7 Q;  3MEH A;  3NEM A;  4HCE A;  3S2D H;  1PFM A;  2ZJQ A;  3HOZ B;  3K5N A;  1GUW A;  1J5E Q;  1OXX K;  2RSN A;  1WYD A;  2A69 C;  4UDU C;  4M8A A;  1HJP A;  1LTB D;  4JOI C;  3F2C A;  4DR2 L;  4A3C H;  2IW3 A;  2OQK A;  4LUV A;  5JJL A;  4EQ5 A;  2WAC A;  1I3Q B;  3RZD H;  4GNX A;  1C7Y A;  5CGK A;  2WAQ G;  1W3S A;  5T1I A;  5C3X A;  3U4V A;  3QOL A;  1IL2 A;  1STB A;  1NMG A;  2NB0 A;  1WTQ A;  3H6M A;  4OO1 I;  1UE5 A;  4DV5 Q;  1S3O A;  1G91 A;  3HKZ G;  3NUC A;  3NBI A;  2RDF A;  1E7Z A;  3OYY A;  5M9O A;  1GOZ A;  3OTO L;  2B2W C;  2Z0S A;  3NEN A;  2HIX A;  1RD9 D;  1BCP F;  1ENC A;  3M4Q A;  4GS3 A;  3D6W A;  2L5T A;  4AYB E;  2H1E A;  1LM0 A;  3UDX A;  4X62 L;  1SRO A;  3L9A X;  1YNJ D;  4A3I B;  1YJN A;  2EY5 A;  4ILW A;  5JJZ A;  2KOL A;  2EVB A;  2L15 A;  1X3P A;  2XVS A;  2OXP A;  1PYS B;  1BVS A;  2K6A A;  3HOW H;  2F0E A;  4AQY Q;  2EOT A;  1OO9 B;  4JI0 Q;  3IAY A;  4RFB A;  2RA4 A;  4UP9 A;  5CC4 A;  5LL6 X;  1EY5 A;  5IIF A;  3HOZ H;  2RHQ B;  1EU3 A;  4MTN A;  2AQ2 B;  4CKC A;  4Y52 H;  2K04 A;  1RIP A;  2D5D A;  1SN8 A;  4XT3 B;  4JI8 L;  2ALY B;  2RCF A;  3P7J A;  1EY7 A;  1KRT A;  2O2L D;  1I3Q H;  3Q8D A;  1D7Q A;  3TDQ A;  4GOP B;  2BDN A;  3UI2 A;  2E76 C;  3BG3 A;  1TS3 A;  4OX9 Q;  1E1T A;  1JB7 A;  3TEH B;  3A5Z B;  3I4M G;  2NVQ B;  3TBI B;  1B2T A;  1KRS A;  4O42 A;  3NQI A;  4XIG S;  1IKL A;  3S2H B;  1EYA A;  1GUG A;  3JAM E;  3C1F A;  4JYA Q;  1H9K A;  3QWN A;  4J1M A;  1BO0 A;  1HZC A;  4HSV A;  4H0L C;  2RQX A;  2BA0 A;  2MGS A;  5KYL A;  3EBE A;  4X65 Q;  1TT2 A;  2EXZ A;  4GN3 B;  4HMJ A;  2AQ1 B;  5ELC A;  3Q23 A;  2G5D A;  1YNJ C;  4YWM A;  4HJ9 A;  3LWU A;  3GV3 A;  4KHV A;  4A3I H;  3J7A 5;  4ZYS A;  3FKI G;  2MO1 A;  4UP7 A;  4PMW A;  4C3H G;  4R8I A;  1TWC B;  1DOK A;  4JI5 L;  1CKN B;  2JA6 B;  1JWU D;  5GAH C;  1LT4 D;  1Q7Y C;  2YU9 B;  2L11 A;  1YNN D;  4KY7 A;  3I70 A;  4LUZ A; 
#chains in the Genus database with same CATH homology
 1II3 A;  2LS0 1;  1CA5 A;  4C3J G;  1QWY A;  1LAC A;  2F0G A;  5NUC A;  1R4Q B;  1SYG A;  4E6I A;  4PV1 C;  1RTN A;  5KIX A;  4B08 A;  5FO8 B;  4LAA A;  1QNK A;  3BZD B;  3QIA A;  5D65 A;  1O78 A;  3MXU A;  4ZQ3 A;  2IJ0 A;  1AEX A;  2F0N A;  1AFP A;  4IFD G;  2X6L A;  5EGT A;  2G9D A;  4FF2 A;  1QOH A;  1YNN C;  1GXD C;  1BOS A;  3M4Y A;  1W6J A;  3RD4 A;  3S17 B;  1S5B D;  3D31 A;  3CKI B;  4A3E B;  2K28 A;  1R4P B;  4HCS A;  2RDG A;  2F0K A;  1JQY D;  5KNC A;  5DM6 3;  3JAM L;  1SND A;  1JC7 A;  2E74 C;  1ET6 A;  1WTX A;  3NK9 A;  1ML0 D;  4K6L A;  3X3M A;  2LFN A;  2VB3 X;  4C1N I;  1D1K A;  3PV0 A;  3NWT A;  4NW2 A;  1IHZ A;  4OO1 H;  4A3G B;  1BXT A;  2Z4H A;  2A74 C;  3HOV B;  1S5C D;  2BA1 A;  1X3Q A;  5TSS A;  1LTA D;  4CKB A;  3DXJ C;  3HOY B;  4IZ8 A;  1QB5 D;  3MXG A;  4DF7 A;  4XQJ A;  3KUP A;  3SK5 A;  1G2S A;  3BVZ A;  5EQ0 A;  2R7Z B;  1HUM A;  1ZYR D;  3MWY W;  3H3V C;  1HXY D;  4WFN 3;  5K36 G;  2OEO A;  4K2L A;  1FNW A;  3K0Y A;  3T4A C;  1HA6 A;  2D2C C;  2NUC A;  3SEB A;  1MGS A;  3E5S A;  2HCI A;  5C4Z A;  4DK0 A;  2QKI C;  3L7Z C;  3SDZ A;  3ITP A;  1DOM A;  1ZEQ X;  2O5J C;  3DWA A;  1EY4 A;  4KV6 A;  2AWO A;  2EYL A;  4U67 3;  1SE3 A;  2FIN B;  1QE6 A;  3J81 E;  5HUR A;  2R3Z A;  3V2T A;  1STG A;  1SJH D;  1V8Q A;  5C0X I;  2O4X A;  2O5I C;  4KKU A;  3N52 A;  3V05 A;  3K5L A;  1C8C A;  1U4M A;  3NHH A;  3GD7 A;  4RCO A;  3OOC A;  4MIU A;  4CJ0 B;  5JEA H;  3MHB A;  1I6H B;  1ZYR C;  2LY7 A;  5BN3 A;  2RDH A;  3DM1 A;  3IFT A;  1JWS D;  2BOS A;  4CBV A;  3S9W A;  2B2T A;  5G3L D;  1SXT A;  4RHS A;  2L1B A;  3GTQ B;  4Q5V A;  1ENA A;  3C2P A;  4DAV A;  3TN2 A;  3J7A V;  3R93 A;  3MAQ A;  3C1E A;  1XXG A;  1TS4 A;  2HDM A;  3A8I E;  1MI2 A;  1H9S A;  1I4G A;  4TRD A;  5CV8 A;  5D3I B;  3X3N A;  4A3D B;  2F0W A;  3PMF A;  1PMR A;  5D3D A;  2MPM A;  2F0O A;  1NSN S;  3WOE A;  1GJX A;  2M9V A;  1RTO A;  4DAP A;  1F9Q A;  4KN7 C;  1HCZ A;  4LJZ C;  1K83 B;  1MD2 D;  1FYC A;  1V1O A;  2JEA I;  1H9R A;  2B2V C;  5C3W A;  2IT1 A;  5M3F B;  4FVM A;  3J81 L;  2PQE A;  2B39 A;  1D2B A;  4NDX A;  4ZUI A;  2IX3 A;  5JOB A;  2B2Y C;  2WB1 B;  2EE1 A;  1TWF B;  4UAI A;  1B4O A;  2PYK A;  1I4H A;  2IPK D;  5JPM C;  3S16 B;  3GTK B;  4IFD J;  2WP8 J;  1Z7T A;  1PRT B;  2R61 A;  3K5O A;  3OMC A;  5C5M A;  2K5W A;  2NTS A;  1B3A A;  3PO2 B;  5CV4 A;  1JOR A;  2F03 A;  5I9O A;  5IGD A;  3R2I A;  4EQN A;  1ESR A;  4MN3 A;  4MHE A;  3OIP A;  4IUV A;  3GTJ B;  5DAU A;  3TP6 A;  4DU9 A;  5ELD A;  1PXU A;  1K8O A;  5BN5 A;  3TME A;  3VR3 A;  1D5M C;  3Q24 A;  2WIN B;  4ID6 A;  3GTP B;  1SYD A;  1U4R A;  3VR2 A;  1TVX A;  3F2U A;  1F2Z A;  1CQV A;  3ND9 A;  4TQU S;  2Y0S B;  1BDO A;  2I46 A;  4FF1 A;  1HTP A;  5IT9 E;  1X32 A;  3TP8 A;  2K5D A;  3NSW A;  4KY6 A;  1H9M A;  2FHT A;  2L9H A;  5C0X H;  3PUY A;  3HZX A;  1LV9 A;  5IGF A;  5I6Y A;  2HCC A;  1ESF A;  4FO2 A;  3J7A F;  4S3S A;  3M4O B;  1Q1B A;  3D4R A;  4P2C B;  1QG7 A;  1Y1V B;  3NTK A;  1SFO B;  4EVO A;  3S1R B;  1G8Z D;  1BCP B;  1PTO B;  3MC0 B;  1GHK A;  4RGT A;  4H7B A;  2F0H A;  3DWP A;  1HA5 A;  4FNF A;  5KEE A;  3HP3 A;  3QOJ A;  2F0Q A;  2H4O A;  3T51 B;  4LMQ D;  1RKN A;  1EZ6 A;  1CZG A;  2EYH A;  3EJI A;  1LAB A;  2KA7 A;  1CTM A;  4EQO A;  4K5W A;  1FNU A;  4HTH A;  5AFW A;  1K8M A;  1SNO A;  1B50 A;  1G29 1;  2CW0 C;  3KBG A;  5ELB A;  2R92 B;  3ZYY X;  4KHZ A;  1IYV A;  3OWE B;  2NVT B;  3C3L A;  2RVL A;  3MFY A;  2JEB I;  2DY7 A;  3EA6 A;  2ICE C;  2ICI A;  1TR5 A;  3PUX A;  4CKE A;  2OT2 A;  1PTO H;  1LO5 D;  5BN4 A;  2F0D A;  5DNF A;  3I3C A;  3MXP A;  5IT9 L;  3QJY A;  3GTL B;  2AWN A;  1DM0 B;  1V1P A;  5EKK A;  3R2T A;  4A3B B;  3FMC A;  2Q8R E;  2TSS A;  4XDX A;  3NPP A;  1A3V A;  2C5C A;  2M2L A;  2B2U C;  2XRQ D;  3IFD A;  4A3K B;  4RGM A;  1GUN A;  4PMC A;  3VA5 A;  2AQ3 B;  2K33 A;  2QDB A;  1Q1E A;  3NE5 B;  5COR A;  1KNE A;  2CHB D;  3FVQ A;  3A55 A;  1H9S B;  4KN4 C;  4OO1 G;  1SYB A;  1Y8O B;  3BS1 A;  3D3R A;  3LWE A;  5IOC A;  1I6V C;  2QIL A;  4H44 C;  3ERO A;  2K1B A;  1KDB A;  1B9N A;  1D5Z C;  1Z47 A;  3VR6 A;  4JK1 C;  1D1I A;  1I4X A;  2KEC A;  1EEI D;  4Y7N B;  3FDT A;  2PW5 A;  1ZXT A;  1O7Y A;  1QIL A;  3R8B A;  1B1Z A;  1Y8P B;  1Z6H A;  1LTG D;  4HSP A;  1UNS A;  2A68 D;  3KLR A;  1E2W A;  4BY1 B;  4I7Z C;  3K57 A;  5FLX E;  1IYU A;  3GV6 A;  4K2K A;  2F3W A;  2A6E D;  1VMP A;  3MVV A;  1BNZ A;  2ENB A;  2SOB A;  4KTA A;  1BR9 A;  3BDC A;  2VNU D;  1OXU A;  2J7Z A;  3C46 A;  2B8G A;  2GA4 B;  2L55 A;  3TZU A;  1LT5 D;  5EBC A;  2D9U A;  1GHJ A;  3BDO A;  4XQQ A;  3BVM A;  4ODG A;  2NZ1 D;  1CA6 A;  2PMZ B;  1B44 D;  2RBM A;  2ZXP A;  3BDL A;  4WJW A;  5C44 B;  3M7G A;  4PNY A;  2EY1 A;  1Q3L A;  4A3J B;  2I07 B;  2J4X A;  1F9P A;  2F0I A;  1E2Z A;  3NP8 A;  3Q6S A;  1DZ1 A;  3NQT A;  1IW7 D;  2NN6 I;  2F0T A;  2A68 C;  5LHY 1;  1WTR A;  2WV6 D;  3GO5 A;  4KI0 A;  1WCM B;  4N9P A;  2A6E C;  1EOT A;  4DXG A;  5JEA G;  1PRT D;  5JAV A;  3MXN A;  5C4H A;  1U4L A;  4ME5 A;  2D62 A;  5ELF A;  2E2H B;  3S14 B;  3PUZ A;  5CV6 A;  4KKT A;  4IUN A;  1SYE A;  2N55 A;  1HHV A;  4RKB A;  3SK8 A;  4KY5 A;  3P75 A;  4AYB B;  2J0T D;  3M7N A;  1ICW A;  1CFM A;  4QUC A;  2IL8 A;  4G4K A;  5A35 A;  4NMZ A;  4QMG A;  4C2M B;  1IL8 A;  1JB3 A;  2M00 A;  3NXW A;  1HPC A;  1STE A;  4C3I B;  5FLX L;  3SK4 A;  1IW7 C;  3HS0 C;  4RGN A;  1DXM A;  3FPU B;  3WOF A;  1XTC D;  3M3Y B;  1EEF D;  1SMY D;  4IAL A;  3NTI A;  4L8J A;  3I4L A;  2F0L A;  3SE0 A;  4QB4 A;  2BCO A;  1PRT C;  1EY0 A;  1OXS C;  5M3M B;  3A56 A;  1NR4 A;  4XYQ A;  2MP1 A;  4B9X A;  1RJT A;  5C6A A;  1STN A;  3LNN A;  5CBA E;  3N6R A;  5M5W B;  2XNA C;  1DON A;  2WKC A;  1OXV A;  3VA7 A;  2Q8T A;  1UUP A;  1S5E D;  1O7Z A;  3RUZ A;  1BCP D;  1PTO D;  1SMY C;  2KJX A;  3MTS A;  2C9O A;  4G7Z C;  5KNB A;  2E2J B;  1FR3 A;  1AN8 A;  4XQN A;  2FJ2 A;  1F2Y A;  5DEH A;  3HOU B;  1EY9 A;  1PDQ A;  1A2U A;  3V96 A;  3KBX A;  1V1P B;  5K5P A;  4WRD A;  2EZV A;  1A15 A;  3H94 A;  2LKV A;  4HMI A;  1M8A A;  4YIJ A;  1JR0 D;  3RZO B;  5CV5 A;  2K03 A;  3S15 B;  4A3M B;  2EY2 A;  4CJ2 C;  3S1M B;  3EQL C;  5C3E B;  3DEO A;  1U4P A;  2BE5 D;  3OHX C;  2MJ8 A;  4LK1 C;  1BCP C;  3A54 A;  5EPJ A;  1PTO C;  1I4Q A;  1DJR D;  1GUS A;  4L63 B;  1KLU D;  4OIJ A;  2KHS A;  1DOL A;  1QCB D;  4ZLT F;  5M5Y B;  3PIO 3;  3CHB D;  4IN3 A;  1BF4 A;  1V43 A;  3HRZ C;  5C0X G;  2NN6 H;  1PZK D;  5I6W A;  4CHT B;  1LT3 D;  1S4Z A;  3IL8 A;  1WD0 A;  1EQV A;  5KGU A;  2ID0 A;  1QNU A;  1TQO A;  1JOQ A;  2R6G A;  1F9S A;  3EVQ A;  1AZP A;  1CT1 D;  4FP5 D;  2JSO A;  3BYT B;  4ZKB B;  2IX0 A;  1SDF A;  1PLF A;  4ABN A;  1XYI A;  1PZI D;  1EFI D;  1SYC A;  2BE5 C;  2E2I B;  5JPN C;  1ENF A;  2R93 B;  5CBE E;  2MHV A;  4O1N A;  1Q90 A;  2YYZ A;  3CRK C;  5IGB A;  1EYC A;  5T1G A;  1WTO A;  3I72 A;  4OL7 A;  3G7L A;  3DWQ A;  5J39 A;  2EJM A;  2K7V A;  5I9P A;  5IGC A;  4BA2 I;  1ILQ A;  4FXK C;  3KLS X;  3KK7 A;  5IGG A;  3G6J B;  4HN7 A;  5E4X A;  1D5X C;  4BBR B;  2B2T C;  3OW7 A;  2SEB D;  5JEA J;  4ZUJ A;  2IWH A;  3J7Y W;  1BBX C;  1GUO A;  3KLS A;  2B2W A;  3H0G B;  2E75 C;  2K32 A;  2A73 B;  4KKS A;  4RHR A;  2HUG A;  2AUJ D;  3PUW A;  1I50 B;  3H09 A;  3W2D A;  5HGT A;  2ZT9 C;  3Q22 A;  4FF4 A;  1HRJ A;  5KND A;  3D8G A;  2B63 B;  1RCV D;  1SYF A;  3R3O A;  4IUR A;  4KD4 A;  4KJO A;  3W3A A;  1FD7 D;  2F4I A;  4X3S A;  2CW0 D;  1SNM A;  2LMC B;  4M1U B;  4C56 C;  2EYF A;  3HGB A;  2Z8L A;  5C4J B;  1ET9 A;  5EBD A;  3TP7 A;  1TKW B;  2EYM A;  4A93 B;  1OXT A;  4HED A;  2B2U A;  1I4P A;  4TKO B;  1TY0 A;  1RF2 D;  3NBH A;  4IQZ A;  1KAB A;  5ELE A;  1LTR D;  3M85 A;  3TZD A;  4QCL A;  4X3K A;  4RA8 A;  2Q8I B;  2FMM A;  1SAP A;  3A7A B;  3I91 A;  2SDF A;  1KLG D;  4DXF A;  5LL6 S;  5I2X A;  1HUN A;  1PFN A;  1T5E A;  1VF7 A;  4ZAI A;  4G7O C;  1KNA A;  5EKL A;  2EYO A;  3H91 A;  2SNM A;  2EJG C;  2IX1 A;  4B9W A;  3VYT A;  3MZ5 A;  2N88 A;  1NR2 A;  1EIH A;  3HEJ A;  3RMH A;  1HFN A;  1EWC A;  1ONL A;  4EGV A;  2L4N A;  5CV7 A;  1HQM C;  3AB9 A;  2BDO A;  3I4N B;  4L6T B;  2VXW A;  4BS9 A;  1ILP A;  5COY A;  4F8M A;  5C5L A;  2KCC A;  3FEW X;  3A7L A;  4DK1 A;  4IUU A;  1HFG A;  2EYP A;  2EPB A;  1PTO F;  4PQX A;  4QUF A;  1E0B A;  2RKS A;  1L0X B;  2QCP X;  2NTT A;  5CMD A;  1R9T B;  1EZ8 A;  1A3U A;  3K6O A;  2F0U A;  2PW7 A;  3VYU A;  1D6E C;  2WAQ B;  3P20 A;  4HAE A;  1TS5 A;  4KJN A;  2KVM A;  5G3L F;  3HKZ B;  2VB2 X;  3MFG A;  3DEP A;  3E0J A;  3CU7 A;  2XWB B;  1CI3 M;  1TWA B;  4JBW A;  1A2T A;  4X3U A;  5C0X J;  4IFD I;  3GTO B;  2NYZ D;  3FPP A;  4FF3 A;  1TWG B;  3K7A B;  1MSG A;  1VCI A;  3D4D A;  3EFX D;  4DAY A;  4J8Q A;  1TY2 A;  1KDC A;  1IKM A;  1PZJ D;  3SR1 A;  1HQR D;  3Q0A A;  3OWF A;  2XN9 C;  2AUK A;  4DNR B;  1VDZ A;  4RAU C;  1FNV A;  3ONA B;  1B9M A;  2K5Q A;  2PZU A;  2DNE A;  3I8Z A;  5JVG 3;  4RH6 A;  2WII B;  1J8I A;  1EL0 A;  1WTW A;  2JYO A;  3AU7 A;  3ERQ A;  3I4M B;  1CK1 A;  1LTS D;  2F1M A;  1TWH B;  1XX8 A;  3GQB A;  5KYI A;  1MBY A;  1SBB B;  3S1Q B;  1JE4 A;  4QF4 A;  1KDA A;  2ZXO A;  5A2Q E;  4GZY C;  1WD1 A;  1NAP A;  3T16 A;  4FXD A;  2XSC A;  3FKI B;  3IKJ A;  2HDL A;  4C3H B;  1C4Q A;  1S5D D;  2F0V A;  4K5V A;  4IUT A;  5I4D A;  4R8N A;  5E4W C;  2HQE A;  1CHQ D;  1KTK A;  3SK6 A;  1TU2 B;  4RGO S;  3D4W A;  5EPK A;  1RDP D;  1JOK A;  4C3I G;  2JA8 B;  1UEA B;  3OMG A;  4C3J B;  2V4D A;  4J6H A;  3VYS A;  2XRS D;  4RCN A;  3CQZ B;  2ZXR A;  4I65 A;  3J80 E;  1DD2 A;  1WTV A;  4G57 A;  1SNP A;  1LTT D;  3DHQ A;  1B53 A;  2X69 A;  1RHP A;  3I90 A;  1O80 A;  3LX0 A;  1SE2 A;  3L3O C;  3TP5 A;  1STH A;  4F87 A;  3OPO A;  2VUM B;  1SJE D;  3QG1 A;  3K59 A;  4WOR A;  2CVR A;  2XWJ B;  1JCK B;  5DM7 3;  2F0J A;  4ULL A;  4R9W A;  1F9R A;  1CZW A;  1I4R A;  4KMU C;  4CJ1 B;  4V0B A;  2TMP A;  1SNQ A;  3U9O A;  5CV9 A;  5F2D A;  4XT1 B;  3VR5 A;  1L0Y B;  2A5H A;  1U9R A;  5A2Q L;  1PFB A;  2NWG A;  2NN6 G;  1Y69 U;  4XYO A;  3T53 B;  4IUP A;  3DMU A;  2MUY A;  3HG9 A;  2KED A;  1JOO A;  5C4X B;  1CM9 A;  4F7X A;  3P1H A;  1E2V A;  1Y8N B;  2EDG A;  2DNC A;  2E2D C;  2B2V A;  4IFD H;  4IUQ A;  5EPL A;  1O7L A;  1CQF A;  1SEB D;  2KQ3 A;  4XXE A;  1H9J A;  2F0P A;  2B2Y A;  4Q0F A;  1SNC A;  5FK9 C;  3J80 L;  1TII D;  1TS2 A;  1JWM D;  1SE4 A;  2KUM A;  1DYQ A;  1EIG A;  4BY7 B;  4K14 A;  2K01 A;  4DFA A;  1HTL D;  4NKL A;  1S5F D;  4DGZ A;  2FMC A;  5E1F A;  1EYD A;  1NCV A;  1XWE A;  2NVY B;  4H13 C;  4CGY B;  4BWG B;  1LTI D;  1A3T A;  2F3V A;  4OGQ C;  3NWS A;  4ZRZ A;  5IOD A;  4ZK9 B;  3K5M A;  2CQA A;  1STA A;  3GTG B;  2KCN A;  5M5X B;  5D14 A;  1A6X A;  2L12 A;  2A6H D;  4C1N K;  3SVM A;  4RKL A;  5EJW A;  1G2T A;  4K8I A;  2QEJ C;  4PMB A;  3OIQ A;  2DY8 A;  4DN4 M;  2JA5 B;  2XIW A;  1AZQ A;  4KK7 A;  4NP5 A;  1JIC A;  5FOB B;  1NUC A;  3AMU A;  2NVX B;  1BQQ T;  3E6Z X;  3DUZ A;  5CYU A;  4TSS A;  4N9T A;  5ISR A;  3SXH A;  4FXG C;  1ROD A;  3TSS A;  4A3F B;  2PO4 A;  5K36 H;  4FYD A;  1MSH A;  2F0S A;  3D6C A;  4DA2 A;  4U68 A;  5I2Y A;  1FGB D;  4OIK A;  2WKD A;  3QB3 A;  3S1N B;  2KEE A;  3ND8 A;  5J1Z A;  2G9H D;  2JE6 I;  4X3T A;  1F2L A;  2A6H C;  1G6Z A;  2B8F A;  1F2M A;  1VMC A;  3FRP B;  1Q8I A;  2PNR C;  1EY8 A;  2NBF A;  3VYR A;  1F77 A;  3MA2 B;  5FO9 B;  1W6K A;  2DN8 A;  1C48 A;  4OHJ A;  5FKA C;  5EKI A;  3T56 B;  3GTM B;  1T5X D;  4BBS B;  2FFK B;  2EJF C;  3CRL C;  4BA1 I;  1EWH A;  1LT6 D;  5CR3 A;  1STY A;  3PUV A;  1PYW D;  5E3F A;  3O13 A;  4Z9C B;  2EYJ A;  3VR4 A;  1BUV T;  4V19 0;  3A8J E;  4K8J A;  3I73 A;  1GUT A;  2JXM B;  3GP7 A;  2PZW A;  1Q12 A;  3QO2 A;  2RSO A;  1Y1W B;  3PO3 B;  2SNS A;  1QJO A;  2QF7 A;  5FO7 B;  1AW7 A;  2EY6 A;  3RLF A;  2Z1C A;  4HR7 B;  2OF1 A;  2Z4I A;  2JP1 A;  1LLR D;  1M4V A;  1AP0 A;  4K5X A;  4G7H C;  3HOX B;  3WDN A;  5KRU A;  3KF8 A;  2JA7 B;  2PPB C;  3BYY B;  2X6G A;  3NTH A;  1EY6 A;  2K05 A;  1EQT A;  4K6D A;  4KD3 A;  3PIP 3;  1WTP A;  1CHP D;  1PRT F;  3S2D B;  1EU4 A;  3OSO A;  3T13 A;  2A69 D;  4RWS C;  3U9S A;  3RZD B;  1VF5 C;  4QIW B;  2F0M A;  4XTC S;  2L0C A;  1DCZ A;  2PCF B;  3BVG A;  3K58 A;  1J9O A;  5IGE A;  2PZT A;  1ZKO A;  5JVH 3;  2F0F A;  1SSO A;  1UAP A;  3URY A;  3SHL A;  3A8K E;  4DNT B;  4EQP A;  4ZKC B;  5J22 A;  4F88 A;  3HOW B;  1WVL A;  1KAA A;  3MEH A;  4HCE A;  1PFM A;  3HOZ B;  3K5N A;  1GUW A;  1OXX K;  2RSN A;  2A69 C;  4UDU C;  4M8A A;  1LTB D;  2IW3 A;  2WAC A;  1I3Q B;  5CGK A;  5T1I A;  5C3X A;  3QOL A;  1STB A;  2NB0 A;  1WTQ A;  3H6M A;  4OO1 I;  1G91 A;  3NUC A;  3NBI A;  2RDF A;  5M9O A;  1GOZ A;  2B2W C;  1RD9 D;  1BCP F;  1ENC A;  3D6W A;  2L5T A;  2H1E A;  4A3I B;  3L9A X;  1YNJ D;  2EY5 A;  4ILW A;  5JJZ A;  2KOL A;  2EVB A;  1X3P A;  2XVS A;  2OXP A;  2K6A A;  2F0E A;  2EOT A;  1OO9 B;  3IAY A;  4RFB A;  2RA4 A;  5CC4 A;  5LL6 X;  1EY5 A;  5IIF A;  1EU3 A;  2AQ2 B;  4CKC A;  2K04 A;  2D5D A;  4XT3 B;  3P7J A;  1EY7 A;  2O2L D;  3TDQ A;  2BDN A;  3UI2 A;  2E76 C;  3BG3 A;  1TS3 A;  2NVQ B;  3TBI B;  1B2T A;  4O42 A;  3NQI A;  4XIG S;  1IKL A;  3S2H B;  1EYA A;  1GUG A;  3JAM E;  3C1F A;  1H9K A;  3QWN A;  4J1M A;  1BO0 A;  4HSV A;  4H0L C;  2RQX A;  2BA0 A;  2MGS A;  5KYL A;  1TT2 A;  2EXZ A;  4HMJ A;  2AQ1 B;  5ELC A;  3Q23 A;  1YNJ C;  3LWU A;  3GV3 A;  4KHV A;  4ZYS A;  4PMW A;  4C3H G;  4R8I A;  1TWC B;  1DOK A;  2JA6 B;  1JWU D;  1LT4 D;  2YU9 B;  2L11 A;  1YNN D;  4KY7 A;  3I70 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...