3TZDA

Crystal structure of the complex of human chromobox homolog 3 (cbx3)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
58
structure length
58
Chain Sequence
LYFQGEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromobox protein homolog 3
publication title Structural basis of the chromodomain of Cbx3 bound to methylated peptides from histone h1 and G9a.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna binding protein
total genus 12
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2011-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3tzdA00
3DEOA 3MWYW 3I90A 3ONAB 3KUPA 1DOLA 1MI2A 3DM1A 1WTPA 5EPLA 2X6GA 3HP3A 1HFNA 2KOLA 1C8CA 1MSHA 1G2SA 2MGSA 2EPBA 1CA5A 3H91A 4HEDA 2N55A 1BO0A 3DEPA 4LMQD 1LV9A 2HDMA 1SDFA 5CBAE 2HCCA 1F9QA 2HUGA 1QNKA 3N52A 5E4WC 5EJWA 4ZKCB 4DN4M 3R93A 4MN3A 3F2UA 2B2UA 3I91A 3KBXA 4IURA 5E4XA 1CA6A 2L12A 3I3CA 1WTOA 3TZDA 1EOTA 5T1GA 1AZQA 5COYA 2L11A 3GV6A 2RSOA 1HRJA 5EPKA 1B4OA 4U68A 1EL0A 1NCVA 1ESRA 1G2TA 1J8IA 1X3PA 5JJZA 1WTWA 2D9UA 1F9RA 1MGSA 2B2WC 1NAPA 5CORA 2K28A 3QO2A 5EPJA 1RODA 1WVLA 1S4ZA 2KUMA 5T1IA 1JE4A 5EQ0A 1SAPA 1WD1A 1BNZA 4XT3B 1NR4A 4X3KA 4CJ1B 1AP0A 2IL8A 2R3ZA 2B2YA 2NYZD 1B3AA 1U4LA 1DOMA 1X3QA 2K04A 1KNAA 1RTNA 1SSOA 2B2TC 2L9HA 2M2LA 3Q6SA 5EKIA 1KNEA 2Q8TA 1DOKA 1WTXA 1EQTA 1BBXC 2K01A 1HUNA 5D14A 1QE6A 4XDXA 4RA8A 4CJ0B 4RAUC 2H1EA 3UI2A 2MP1A 1PDQA 4IUTA 4IUPA 1G91A 1HUMA 1BF4A 2KVMA 2L4NA 3LWEA 1U4PA 3D6WA 1CM9A 3TN2A 1E0BA 2N88A 1G6ZA 4X3SA 4OIJA 4IUUA 4R8IA 2KECA 2VXWA 1QG7A 2X69A 1ILQA 1F9PA 1VMPA 2KEDA 1O80A 4OIKA 4RWSC 1ML0D 2HDLA 1AZPA 3GV3A 2FMMA 2FJ2A 2EE1A 1DONA 1ILPA 1F9SA 1XX8A 3SVMA 2NZ1D 1Q3LA 1IKLA 1B50A 4X3TA 1IL8A 2DY7A 4ZK9B 2JYOA 2L1BA 1U4MA 1HFGA 1RHPA 1VMCA 1WD0A 1B2TA 1EIHA 2B2WA 3G7LA 2RSNA 1A15A 1M8AA 1MSGA 1RTOA 2J7ZA 5D65A 5AFWA 1JICA 2NWGA 1NR2A 1PFBA 1DZ1A 1J9OA 1ICWA 2FFKB 2FHTA 2B2TA 3IL8A 4NW2A 2BDNA 1WTVA 4R9WA 2K1BA 1X32A 4QUCA 3P7JA 3FPUB 4IUQA 1XYIA 3FDTA 3IFDA 4HSVA 2X6LA 2RVLA 2FINB 2RA4A 1F2LA 2B2VC 2CVRA 2B2UC 2JP1A 1ZXTA 1PFMA 2EOTA 3MTSA 4ZLTF 5CMDA 1IKMA 4HAEA 1EIGA 4IUVA 1PFNA 4XT1B 1PLFA 4MHEA 4QUFA 2XIWA 4ZAIA 1WTRA 1B53A 2MPMA 1HA6A 2B2VA 4HCSA 3I8ZA 2K05A 2KEEA 2DY8A 4X3UA 2SDFA 2Q8RE 1O7ZA 2HCIA 5DNFA 4CJ2C 1O7YA 1U4RA 1GUWA 1HHVA 2K03A 1TVXA 4UAIA 4O42A 2B2YC 2MJ8A 1WTQA 5CBEE 1RJTA 4ZKBB
chains in the Genus database with same CATH superfamily
3JAML 4A3LG 3KUPA 1ONLA 3OMCA 3CQZB 5CV5A 1V8QA 5IYBG 1HNXQ 4BBSB 4KI0A 1U9RA 1H9JA 2JA8B 1PTOD 4LFCL 4YIJA 3S1QH 1ASZA 1PTOC 1S5ED 2A5HA 3A8JE 4KK7A 4C3IG 2BE5D 3C3LA 1J5EL 1B9NA 4A93H 2BE5C 3IAYA 3M3YB 2QDLA 2R92B 5M9OA 3SXHA 3D4WA 3NBHA 2UU9L 1HJPA 3QO2A 2D62A 1HXYD 4I7AA 5KNCA 1W6KA 2IL8A 1T9HA 3F2BA 3EJIA 2K5HA 5IT9L 1KNEA 3CCVA 1W6JA 3TP5A 2RHQB 1XMOQ 4C56C 1Q7YC 4RG1A 1PH2A 4I7ZC 4FYDA 1KD1C 2IHFA 4IUUA 2VXWA 1QB5D 1JE5A 1VMPA 4AYBG 1A63A 4DV0Q 3U9OA 3OW7A 2K6AA 2L5TA 3P75A 5IYCH 1AZPA 1SBBB 1STBA 3RN2A 4A3BB 5LHY1 4NKLA 1SFOH 2V1CC 3HOUB 4DUZL 1U4MA 5E1FA 4OWWB 2UUAL 5IP9G 1N36L 1JJCB 1KAWA 2I5HA 3PO3G 2SNSA 1EY9A 1GHJA 1HTPA 1J9OA 1X9NA 4S3SA 3CAMA 3CRLC 3PF5A 4C3JB 1TQOA 4C2MH 3HOYB 2EY6A 4UPAA 3TRZA 2FINB 4JI8L 1STEA 3MFGA 4Z9CB 4IO9A 1XNRL 3IFTA 2KHIA 2CH4W 1MIUA 1VQLA 4X3UA 5HY6A 2DJFC 4KHZA 4CJ2C 3PCOB 3K0XA 5FOBB 4IALA 4CKEA 1N32L 3S1RH 1JB7A 5DM73 4DV3L 4A3IH 2IX3A 4R1JA 2RQXA 5EPLA 3CQZH 3HOXG 3HOVB 3PQIA 2EPBA 2A19A 3EIVA 3KK7A 5KYIA 4BBSH 2JE6I 5JEAJ 1I4HA 2BA0A 4A3GB 1V1OA 1SDFA 4G7HC 5EJWA 2MHVA 1SRUA 1HNXL 2JA8H 3RLNA 3H09A 4ZYSA 5IT9E 1IZ6A 4IURA 5CYUA 4DR2Q 3U58A 1WTOA 1EEID 3I55A 3MFYA 3NE5B 1UEBA 2A6ED 1VQEA 3M3YH 2R92H 2E2HB 2A6EC 1L1OB 4IFDJ 3GTJB 1NR4A 1B3AA 4U673 1WTHA 1C48A 1IYVA 1H9SA 3FPPA 1VQ4A 1VQ5A 5IY0A 1UWVA 1KXLA 1WCMG 2HQEA 3EQLC 4DR3Q 4XXEA 2CHBD 2PMZE 3S9WA 3J81i 1F9PA 4HMIA 3SR1A 3HGBA 5K5PA 3J7A5 2XTIA 3M4QA 3E9IA 1IYUA 4NXMQ 2A73B 1XXGA 1VQAA 4BY7G 2K4KA 2E5LQ 4IZ8A 1IKLA 4DV0L 1B50A 5CR3A 3HOUH 4DUYQ 4NB3A 4LFBL 3S14B 4QIWB 3URYA 2NBFA 4JC0A 3FPUB 4OONA 4C3JH 1K8OA 4QCLA 4BA2I 2PW7A 3UDIA 2A6HD 3HOYH 2A6HC 5FK9C 5AJ3Q 4IOAA 1GOZA 1SNPA 3ULLA 4XT1B 4HIMA 1PLFA 1QWYA 4LUZA 4DR6Q 1B53A 2LS01 4CHTB 3KLSX 2K50A 2DY8A 1A2UA 3DMUA 4XYOA 5M3MG 1BCPB 1EUJA 1J6QA 4J6HA 1PRTD 4P73A 4MTKA 1XTCD 3RLFA 1PRTC 2EYHA 5ISRA 2JA6G 4UDUC 3DEOA 4CDCC 2C35B 4HJ7A 1GUTA 4UP9A 3PF4A 3HOVH 2IT1A 1FNVA 2PO4A 1Q8IA 1Y8NB 3K0YA 5ELEA 4GOPC 4LF7Q 3M4OB 4DNRB 4A3GH 5E4WC 4HIKA 4TSSA 1F2MA 3BYTB 2QCPX 4LF8Q 2K5NA 1JWSD 5I2YA 1LTSD 3KFUA 1C4QA 1YIJA 3F2DA 2XRSD 1CTMA 4N9TA 4B3RQ 1LYLA 5D3DA 1NCVA 4DR2L 4HIDA 1WTWA 2E2HH 2KUMA 5BN4A 4V190 1SMXA 5FJ8H 2R3ZA 3GTJH 5C0XJ 1U4LA 4POFA 3KDFB 4TRDA 2Y0SG 2AKWB 2CWAA 5ELDA 1CM9A 5HGQA 4OL7A 1P16A 3PO3B 1K83B 4X3SA 4L5SA 4GS3A 3SGIA 4R8IA 4MZ9A 5E3FA 4LJZC 4JI3L 2N8NA 4ZQ3A 1YZ6A 2F0GA 4DGZA 4DR3L 3CRKC 4ZCKA 5DEHA 2F0KA 4X3TA 1Y8PB 2F52A 3W5OA 4NXML 2PI2A 1A15A 5J1ZA 3UDGA 4DV7Q 5AFWA 2PZWA 3S14H 2E5LL 2VB3X 1PZKD 2EY2A 2BDOA 2K1BA 2XRQD 4EGVA 2NVTB 3TSSA 1EEFD 1PH3A 2NVQB 4QMGA 2B2VC 1RL2A 5C4XG 4A3LH 1KHIA 2UXCQ 2K33A 5NUCA 1UAPA 3PUYA 4OELB 3T4AC 3BZCA 2DN8A 2EY5A 1V1PA 4FNFA 5AJ3L 1H9SB 2HCIA 5G3LD 5J39A 2VQFQ 1HR0Q 5DLQE 1VF5C 4FO2A 4M1UB 2MJ8A 2NZHA 3VA7A 1CSPA 4IFDI 3CW2C 3HG9A 3KF8A 3MXGA 2X6GA 3P20A 3AYHB 2JA7B 3U4VA 2R7ZG 4A3FG 3M4OH 4DA2A 4R4CA 1G51A 1CKOA 3RLOA 1VQ9A 1SROA 3R93A 3KLRA 1JOOA 4LF7L 4IPHA 1CKNB 2A1AA 1QCBD 1PV4A 4LF8L 3ZYYX 1WCMB 2TMPA 4Q0FA 1MGSA 1NAPA 1N34Q 2RBMA 3H94A 4B3RL 1I4GA 4X3KA 5FLMH 1B7YB 3L2PA 1WTXA 3BDCA 4A3JG 1DOKA 4UY8C 4NPSA 1NTGA 3KLWA 3A5ZB 4CJ0B 4X6AH 1HUMA 2PNRC 2KVMA 4GOPA 2F3IA 3UE1A 5IP9H 3MEFA 5EKLA 3PO3H 3OIQA 2H5XA 1K83H 2KEDA 1EZ6A 4AQYQ 4E6IA 3VR2A 3I73A 1RKNA 1H9MA 1XPOA 1DONA 3NENA 3KF6A 3SVMA 2ZXRA 5FLXE 2K5VA 1EFID 2LKVA 1TY2A 1VMCA 3JAMc 5C3EG 1QVFA 4RH6A 5C3WA 4J15A 5DM63 3HKZE 1I3QB 1GO3E 3VR3A 1L1OC 1CKMA 4JYAQ 1I4PA 2BDNA 1Y69U 1YNJD 2VQEQ 1XMQQ 2NVTH 1Y1WG 2K52A 3VR6A 2D0OA 1YNJC 2X6LA 4DV7L 3D0FA 3M85A 2NVQH 2JA6B 1BR9A 1ZXTA 1Q12A 4XTCS 1E2VA 1S5DD 2YV5A 3OMGA 1A8VA 3TP8A 4DAVA 4ZAIA 2MPMA 3A7LA 1CSQA 4R4IA 3RN5A 2B39A 2I46A 1HNWQ 3NQIA 1D2BA 3OPOA 5JVH3 4B9WA 1BQQT 4DK0A 4OEMB 1VQHA 4JI1L 4O42A 4PMWA 3PO2G 2KCMA 4RCNA 3A0JA 3VA5A 4X64Q 2NB0A 1T5XD 4DAPA 5LMUQ 2PW5A 4DXFA 1HR0L 4IJHA 3AMUA 1HFNA 2KOLA 1CZWA 3BZKA 1G2SA 3K6OA 2JA7H 4TKOB 2N55A 4LMQD 1YJ9A 2G9HD 3N6RA 1K3RA 2LSSA 1AH9A 3HS0C 2IY5B 4PMBA 2OWOA 5I9OA 4ZKCB 5IP7H 1K0RA 4A3MG 1W2BA 5LL6S 1MKHA 3VYSA 4O1NA 4WJ4A 1VQKA 4OO1H 2Y0SB 1SN8A 3HOWB 3DWQA 4QF4A 1CQFA 1OXVA 1WCMH 1X3PA 2D9UA 4LF5Q 4A3EG 2RF4A 5TSSA 5L37A 1BCPD 3GTGB 1JE4A 3CC2A 1AP0A 1BCPC 1AFPA 2Q8IB 3JAMi 1SMYD 3NXWA 3Q6SA 1V1PB 5I9PA 1N34L 1SMYC 1TKWB 3D31A 1SE4A 4HR7B 4WJWA 3H0GG 1PDQA 4IUTA 1D1IA 2F0TA 1D8LA 3ULPA 1ESFA 5ELNA 3GTLB 1LTLA 5HURA 2HIXA 2X69A 4JOIA 5J22A 3W1BA 2WV6D 2EIFA 2KCNA 2MO0A 2EE1A 3CMEA 3NWSA 3MAQA 4ZUIA 2P5ZX 4KN7C 2NZ1D 1STGA 2QILA 3HOZG 3MXNB 5IYDG 4R4QA 4AQYL 1LT6D 2AWOA 1LTID 4BA1I 2NZOA 2N49A 4DK3C 4DNTB 2BH2A 2OCEA 4LF4Q 1I3QH 3VYUA 3U4ZA 3OSOA 1GM5A 1IHZA 1STAA 4QUCA 3O13A 3K57A 1LTAD 1XYIA 2F0JA 4HSVA 4GLVB 1VCIA 3CPFA 2PI2E 5ELOA 3VR4A 4R8NA 2JA6H 4K6LA 1RCVD 3MA2B 4JYAL 1XMQL 2VQEL 4MIUA 4OXPA 2GN5A 3G6EA 1XNQQ 4HJ9A 1JJ2A 4DV5Q 2EJGC 1QZHA 2K05A 3Q8DA 1E2WA 3OHXC 1O7YA 1SJHD 4J8QA 1FJGQ 3I72A 4JI4Q 1SYFA 1VQGA 5K36G 2B2YC 3I4MG 1HNWL 4ZKBB 4KV6A 4JG2A 4KHVA 1CK1A 4BY1B 3MXUA 4BBRB 1WTPA 3WOEA 1FD7D 2IW3A 3EROA 1C8CA 3KF6B 1S5BD 1L1OA 1I6HB 2F3VA 1E2ZA 5LMUL 4X64L 5CBAE 3BYYB 1KTKA 1EU4A 1VQPA 3CCJA 2R7FA 4P2CB 3F2UA 3CPWA 1JT8A 2LXKA 1SJED 4OWXB 3RMHA 4A3CG 1PH6A 3LX0A 2LY7A 1SNQA 2L11A 3BDLA 5KGUA 2Q2HA 1B70B 3HKSA 3HOWH 4YCWA 4G7ZC 1YJWA 3A56A 3KYHC 1DD2A 1SNDA 3GTGH 1KLGD 2EYPA 1B3QA 5M3FB 3QB3A 2L9HA 1LTTD 3H6MA 1EWIA 5F2DA 3F1ZA 2Q8TA 3JC66 1X3FA 3NK9A 5C44G 2PNHA 1S5CD 1BF4A 4DAMA 4B3MQ 1C7YA 2JA5G 3I4NG 2Q2UA 4PV1C 1RIPA 2F0MA 5EGTA 3GTLH 2WAQE 4Y52H 4LAAA 4A76A 2OTJA 2FMMA 3TS0A 2UUBQ 1TU2B 5JPMC 1Q3LA 1DCZA 3FRPB 4ALPA 3OIPA 4YWKA 4RGTA 1BKBA 2IWHA 2F0IA 3TQYA 1L2FA 4LF6Q 4IUQA 3TZUA 4LF4L 4C3HB 2WKDA 5LL6X 2CVRA 2OQ0A 3T1HQ 2B2UC 4IPGA 4K8JA 1HPCA 3EFXD 3NP8A 4K0KQ 4KTAA 1CQVA 2MNAA 1CI3M 3SK6A 5KNDA 1B9MA 2WKCA 1NNXA 1BVSA 2KCTA 3CD6A 1V43A 1LACA 2KA7A 1XJVA 2YYZA 4A3MB 1EY5A 1IYJB 4L8JA 4DV5L 2L55A 2DGYA 2KHSA 2EY1A 2NN6I 1DOLA 2UXBQ 1TWCB 2ZTCA 5IGBA 4YHHQ 4BY1H 2E2JB 4BBRH 3J81c 3M7GA 4RHSA 3H91A 4L5TA 1OO9B 4M8AA 1I6HH 2RHSB 2C9OA 4KJOA 4GN3B 2HHHQ 1Z47A 1ET9A 4B08A 4OWTB 4IFDG 3KDFA 5CV8A 5ELBA 2KJXA 3TZDA 1EOTA 5LMNQ 3E0JA 1LT4D 1VQFA 4GLXA 4KN4C 2Z4HA 5EPKA 3FKIB 1M90C 4JI7L 2F0NA 5EPJA 2MQHA 1YHQA 1S4ZA 4N8X1 4XT3B 2EXZA 4JBJA 2JN4A 3GTQB 1PFSA 4RA8A 2B2YA 2B63G 5M3FH 1Q46A 1VQMA 4BWGB 4ABNA 2VUMG 4Q5VA 2ZM6Q 4A3KG 2F0EA 1BUVT 1TIID 1U4PA 4IUNA 4PMCA 1SNCA 2LMCB 4H13C 4UP7A 3V96A 3S17B 1PMRA 1QVGA 2NN6H 4IN3A 4B3ML 1CFMA 2F4VQ 1ZKOA 3QOJA 3UE0A 4YCUA 1I4QA 4LFAQ 2DY7A 3MHBA 3AFPA 2UUBL 2YTVA 2RSNA 3OW2A 4N9PA 1PFBA 4GN4B 2NUCA 2Q2IA 3HKZG 2BOSA 2FHTA 1JMCA 1II3A 2JXMB 1X32A 5BR8Q 5GAHC 1PZID 1XMOL 3FDTA 3E9HA 1KIXA 2AMCB 2WB1B 2LFNA 3BU2A 4C3HH 1I94Q 5A2QE 1A3UA 1PFMA 5CMDA 1TT2A 1B44D 2QGQA 1N8RC 1TS5A 1YITA 3TBIB 1Q1BA 4F88A 4NDXA 1K9MC 1EQVA 1EYCA 3I8ZA 2ZT9C 5IGEA 4KY6A 1EU3A 4ULLA 4A3MH 3OWEB 1CKNA 3J80E 2Z6BA 3C1EA 3S15B 1TWCH 4DR1Q 3IRBA 2E2JH 1KLUD 1A3TA 1QUQB 1VDZA 2K75A 3K81C 3TDQA 2OXPA 1LABA 4JBMA 2B3GA 1VQOA 1VQ6A 1V9PA 1QNKA 1X55A 3N52A 4YHHL 2RDGA 1A6XA 1HQRD 1SYGA 4C1NI 2B2UA 1E1OA 1GUNA 4HJ5A 5C0XG 1CA6A 2G9DA 1GUOA 3ERSX 3RUZA 1VF7A 1SYEA 3HRZC 2HHHL 2E76C 2ZJRA 1JC7A 3FKIH 4C3IB 5JJZA 2B2WC 1A2TA 1STHA 5T1IA 1SAPA 2CQOA 3CMAA 3Q23A 1AEXA 2NYZD 3MXPA 3GTQH 2K04A 3I70A 3ICEA 2K01A 2O5IC 4XDXA 1FL0A 3DWAA 4XYQA 4RKLA 4JBWA 5JAVA 1E24A 1DXMA 5GQOA 2N88A 3RZOB 3K7AB 3PIO3 1EFWA 4RWSC 3S17H 4ZRZA 1JB3A 2F0DA 2Q2TA 4AYBB 5JOBA 4F7XA 1YNND 2NTSA 4QIWE 2F0OA 5J3BA 1YNNC 1PVOA 1WD0A 2F4VL 1VQ8A 3G7LA 1LUZA 2I5LX 1S40A 2Z4IA 1QVCA 3NHHA 4LFAL 1IBMQ 2FFKB 1NSNS 1PTOF 4ODGA 4BXXG 1KABA 2B29A 1JR0D 3J81j 1DJRD 3GQBA 2FMCA 4DR7Q 1FGUA 2ES2A 1UE5A 3D4RA 2F0FA 2M9VA 4ZLTF 4HAEA 1Y1VG 3WDNA 4RHRA 1I94L 3OOCA 1HH2P 1L0YB 2BH8A 1EIFA 1KDAA 2EXDA 3R2IA 1YI2A 5JJIA 1Y8OB 1STYA 3SE0A 4GZYC 3NWTA 2VY3A 4DUYL 1RJTA 4A3CH 1FNUA 2ZJPA 3TP6A 4QY7A 4KD4A 3ND9A 1D5ZC 3CCSA 3S15H 1E7ZA 1VQIA 1RD9D 5FLXL 1VQDA 1E22A 5FO7B 4AH6A 4L5RC 2HDMA 5IYBH 4DAYB 3HOXB 2XGTA 1EWCA 3TP7A 4KY5A 1YEZA 4DR1L 2EYOA 4XQQA 2EQSA 2G5DA 3F8TA 4A93G 2IHEA 3I91A 1M1KC 2L12A 5C4ZA 5T1GA 4AYBE 2D2CC 4DR6L 1BOSA 3I7FA 3PUWA 2CWPA 1S5FD 1IL2A 1T5EA 4EQ5A 2EVBA 1IBLQ 4C3IH 2GA4B 4GNXA 4JI6Q 1Y14B 2QEXA 1EY8A 1UEAB 3MVVA 4L6TB 3CCQA 1XWEA 1PYWD 4CJ1B 3S2DB 1G6ZA 1DOMA 1QZGA 5KEEA 1X56A 1YHBA 3MXNA 1PH1A 1X3GA 4JOIC 4NXNQ 3ZJYC 4RMFA 4KKTA 1M4VA 4DNIA 5IYCG 3D3RA 4JI2Q 2F03A 3CF5A 3RZOH 3K7AH 3PUXA 4POGA 2HDLA 2WAQG 1Q1EA 1O78A 1TXYA 5IGGA 4IPCA 3SEBA 4X65Q 3K80C 5IWAQ 2B2WA 5FKAC 2E2IH 5GAEC 4BY7B 3BVZA 3AQQA 1RTOA 3R3OA 1TWHH 2R93G 4O2DA 3WWVA 2NVYB 1EYAA 4N8FA 4I65A 1IXRA 3V05A 3S1MB 3A74A 3NQTA 2V4DA 4K5WA 4OHJA 1MBYA 2DUDA 3J7ZC 1IBML 1EY6A 1ENCA 5HGTA 1EIGA 1LT5D 5E7NA 1KDCA 4CDDC 1CHQD 2IX0A 3Q24A 4HCSA 2E74C 1GD7A 4P75A 4A3IG 4UP8A 1EQRA 3OWFA 1PHJA 4LF9Q 1TVXA 3EBEA 5M3MB 4OO1I 2VNUD 1I6VC 2CH4A 1AE3A 3ONAB 1LTGD 2WFWA 1XPUA 4DV4Q 2ICEC 3OTOQ 1JWMD 4L63B 3SK8A 2CW0D 2E8GA 4HTHA 1PA6A 1F9QA 2CW0C 2HUGA 3HOXH 2EZVA 1EQQA 2AQ3B 4EVOA 4P74A 5EBDA 3FMCA 2B63H 1HQMC 2KCCA 2UXCL 1I50B 4DR5Q 5CV4A 3PIOA 2R92G 2PZTA 4LK1C 3E0EA 3ERQA 3RR5A 4B3TQ 2K5WA 1NUCA 1HRJA 1SNOA 2K5DA 2RSOA 3CU7A 1D7QA 5IT9c 1EL0A 2VQFL 1HCZA 1PZJD 1W3SA 4HJ8A 3KBGA 1K73C 3CC4A 1TWAB 4GKKQ 3D6CA 1MD2D 1IW7D 1MHWC 5KIXA 5EKIA 3CCLA 3S2DH 1IW7C 3TREA 1IBLL 4G4KA 1EQTA 2UUCQ 4CBVA 4B9XA 1X65A 3S16B 2O5JC 3VYRA 4A3BG 4NXNL 1JQYD 5C4JB 1PRTF 1OXUA 1OXSC 1Q8KA 1DYQA 1DM0B 1OXXK 2HIVA 1ENAA 3HOUG 4JI2L 3A54A 3M4PA 4H0LC 1FNWA 1QNUA 2F0PA 2ID0A 4JV5Q 4YWMA 3EVQA 1RHPA 1Y1VB 2PCFB 1B1ZA 1H95A 3DUZA 4BY7H 5CV9A 4C3JG 2F3WA 1LLRD 5D65A 3HOYG 4XQNA 2ATWA 5IGDA 1SEBD 3T1YQ 5IWAL 2NVYH 3S2HB 2XWBB 3S1MH 1KL9A 4GNXB 4DK6C 4HN7A 2BA1A 2PQEA 4FF3A 4K5XA 4QB4A 4FXGC 1GVPA 3MTSA 1IKMA 3NELA 4MHEA 3A5UA 2B8FA 5C4XB 5BN5A 4DR4Q 2JJQA 3C46A 2ASBA 2XN9C 2SDFA 2RCFA 3QG1A 4JW0A 5CV7A 2ZJQA 3CXCA 5M3MH 3HOVG 2WP8J 2OQKA 3MWYW 2CCZA 1PH9A 1O7LA 4A3GG 3HP3A 4HCEA 4LF9L 5I4DA 4X66Q 1R9TB 3L3OC 5GADC 1CA5A 3L9AX 2VZAA 5D3IB 3CCRA 4DV2Q 1YBYA 5C5MA 1SXTA 3K8AA 3W3AA 4DV4L 3H3VH 2R7ZB 3T16A 2Y0SE 1UE7A 3UDXA 4QGUA 3OTOL 4A3FB 4FP5D 5BN3A 1BDOA 1F2ZA 2VB2X 1I50H 3ND8A 5IGFA 2JSOA 3A7AB 3QIAA 4JI5Q 1K3BC 3KLSA 3SK4A 4U68A 1G2TA 2F0SA 1OXTA 2K28A 4HIOA 4B3TL 1JJGA 1TWAH 4K6DA 4JVZA 5M5YB 3NSWA 2B2TC 1L0XB 5C3XA 3PMFA 2QKIC 1CUKA 5M5WH 3G4SA 2KBNA 3WOFA 4RAUC 3NTIA 4GKKL 4FXKC 4A3JB 3S1NB 2F0HA 1KAAA 3S16H 2R93B 3DHQA 3Q22A 2KECA 1ET6A 3AU7A 5G3LF 4OIKA 5C4JH 1Z9FA 4RGMA 4P72A 1LT3D 5EKKA 3E5SA 3GD7A 1HR0W 1ILPA 5C4HA 4KJNA 4RGNA 4DKAC 2JYOA 1HFGA 3P1HA 4LF5L 1Y1VH 3U9SA 1MSGA 1C0AA 4JV5L 2OEOA 1YNXA 5C3EB 5ELFA 1S3OA 2QF7A 3T56B 3S2HH 4FVMA 1I5FA 4R4OA 4RGOS 2RVLA 3EN2A 4LUOA 3K5MA 1CT1D 2JP1A 4HSPA 1QILA 4AIMA 1Y1WB 3T1YL 3I56A 4IJLA 1QUQA 4IPDA 1KQSA 5FO8B 1ASYA 1HA6A 5C4XH 4FXDA 5DNFA 1WOCA 2ZTEA 3NPPA 5I6WA 2UXDQ 4DR4L 2N3SA 1K8MA 3DWPA 2RCNA 2O2LD 3QJYA 1MI2A 1SE3A 4QJFA 3AFQA 2EDGA 5A35A 1FVIA 2MGSA 1R9TH 3PO2B 3HZXA 1RDPD 2HCCA 3T13A 1TWFB 1X54A 4KKSA 3VYTA 4X66L 4RKBA 2R7ZH 5JJLA 4HJAA 4A3FH 2ZXOA 3DM3A 3K59A 2FXQA 5KRUA 5JEAG 4DV2L 3CC7A 4JI0Q 1BBWA 5COYA 1XNQL 4G7OC 1R4PB 5A2QL 1B8AA 2N78A 1UE1A 5FLMG 5CORA 3CKIB 1TS4A 1K8GA 4JI4L 1FJGL 4LFBQ 2OTLA 2IX1A 2IPKD 4FF2A 4JI5L 3F2CA 3LNNA 4DU9A 5M5YH 1B2TA 4A3EB 5I6YA 5DAUA 1HUNA 2O4XA 1A3VA 2CKZB 2CFMA 1KRTA 3GO5A 3PUZA 3K58A 2L4NA 4A3JH 2GVBA 3J80L 3S1NH 2PPBC 5CGKA 3H0GB 4PQXA 3C1FA 2R93H 1WTRA 4JPBW 1ILQA 1UE6A 3JAME 3H3VC 2SNMA 4P71A 1SYCA 2FJ2A 1Z6HA 2J4XA 1F9SA 4ID6A 2PMZB 2PQAA 1PYBA 4ZK9B 3K5NA 2VW9A 1S72A 2F0WA 1KC8C 4OGQC 3AB9A 2J0TD 2AUJD 3HOZB 2DNCA 5FLXc 5C3EH 2B2TA 2TSSA 3GTKB 4TQUS 4NMZA 2SOBA 4MTNA 1BXTA 5KYLA 1K28A 3CHBD 3QR8A 1VQBA 1Y1WH 3BS1A 3A55A 4KKUA 1AE2A 4FF1A 3GTOB 4WFN3 1BCPF 3GTMB 3MZ5A 4DAYA 1PH7A 2RKSA 2NVXB 2WINB 2A69D 2JA7G 2A69C 2SEBD 3PIPA 2HQLA 5GAGC 5M5XB 2UXDL 3I4MB 4APVA 5IP7G 4KMUC 3PO2H 1EY7A 3DEPA 1VS0A 4LF6L 5ELCA 2F0QA 1TWFH 3T1HL 1Q81C 4JI3Q 4OO1G 3D4DA 4K0KL 4X62Q 4K14A 4GNXC 3I3CA 3KJPA 4G57A 1D6EC 3VDYA 3HEJA 2MFIA 1EYGA 3V2TA 1EOVA 1ESRA 1SE2A 1IBKQ 1LTRD 1RODA 4JI0L 4IOCA 4A3BH 4MNOA 2H4OA 5IE8A 4PNYA 1NMFA 4A3EH 1QOHA 2UXBL 2KQ3A 1QE6A 1WYDA 1EIYB 1X3EA 2H1EA 3SHLA 3STBD 3X3NA 1KRSA 4LW1A 3L7ZC 5C44B 3STBC 3TN2A 2KHJA 2Z8LA 3H0GH 5H1SE 3NBHB 3B6YA 4LWCA 2JEBI 3AEVA 1F2YA 1NMGA 3I4NB 2JA5B 2JK8A 4K8IA 3GV3A 5LMNL 1XX8A 2RDFA 1PH5A 2OF1A 3BZDB 3VR5A 1A0IA 5CC4A 1G8ZD 1M8AA 2CQAA 1N9WA 1JORA 1JOKA 5C6AA 2WB1E 1K0SA 3HOZH 1JICA 2VS1A 2YU9B 5IYDH 3CCEA 2R6GA 3T53B 1JWUD 2VL6A 3GTKH 4JCVE 3P7JA 2ZM6L 4YY3Q 5I2XA 2AQ2B 1DGSA 4B3SQ 3A8IE 2L15A 1F2LA 2ZTDA 1PH8A 4A3DG 2EOTA 4EQNA 1P8LA 3DXJC 2JQOA 2XIWA 1UNSA 4UHVA 4CDEC 3GTOH 3GTMH 2E2IB 1BBUA 1TS3A 2EJMA 4WORA 2Q8RE 2WIIB 2B8GA 2XVSA 1ZYRD 1TWHB 2NVXH 5JVG3 1GHKA 3RZDB 1HHVA 2K03A 1ZYRC 4A4IA 2E2DC 1VQCA 2MO1A 4RCOA 2Z9HA 1HZCA 3J7AV 3DM1A 1L0WA 1KDBA 1NBWA 1OTCA 5M5XH 5K36H 4PZ6A 3I4MH 3CP0A 2PQAB 3K5LA 4EQOA 5BR8L 3NBIA 2KENA 1AW7A 1G291 3J81L 5EAYA 3KBXA 3HOWG 3BVMA 4H7BA 3PUVA 1SYDA 2A68D 4O0AA 1HZBA 4X62L 1EWHA 2A68C 1J8IA 1F9RA 5EQ0A 2YTYA 1BNZA 4A75A 4K2KA 1ENFA 1V1QA 3U50C 4DXGA 1JCKB 1RTNA 3M7NA 1O7IA 1IBKL 1PYSB 3GDEA 4JK1C 5D14A 2PZUA 2B63B 2QW7A 3UI2A 3RD4A 3H15A 3J7YW 1G91A 4ME5A 4WJ3M 4XQJA 2VUMB 5C44H 1SNMA 4A3KB 1QG7A 2F0VA 1ML0D 3I4NH 2JA5H 1U5KA 3G71A 1C9OA 4DV6Q 3FVQA 2I07B 1G6PA 4RFBA 4JI1Q 2AQ1B 3BG3A 1STNA 1YHAA 4C1NK 1EIHA 4DPGA 1VQJA 2XWJB 2J7ZA 3RNUA 2XSCA 2NWGA 1ZEQX 1ICWA 2YU9H 2ENBA 4R9WA 1D5XC 2M00A 3E3XA 1PTOB 3W2DA 3HFZB 3HKZB 2I5MX 2RA4A 2EYJA 1LTBD 2R7DA 4F8MA 1UUPA 3BDOA 3Q0AA 4GN5A 3R8BA 4KY7A 4QUFA 5LMNW 4YY3L 1CZGA 3FP9A 4B3SL 1SR3A 1EY0A 5IIFA 2E75C 1U4RA 3C2PA 2Z0SA 2K32A 4PG3A 3RZDH 4BY1G 3NTHA 1PXUA 4BBRG 3J81E 1WTQA 2EYFA 3LGJA 2F0LA 5JEAH 4GKJQ 3R2TA 5IOCA 5IGCA 4PZ7A 1PH4A 1MSHA 1E3PA 4Y7NB 4HEDA 3FHWA 1BO0A 4ILWA 4WRDA 3SDZA 2IJ0A 2A74C 2OT2A 1NE3A 5JJKA 4DR7L 4MN3A 1XTDA 1E1TA 1LO5D 2ICIA 1H9KA 3MEHA 1AZQA 1Q82C 1FGBD 2K5QA 5IODA 3GV6A 1HNZQ 4IFDH 1B4OA 4BBSG 5M3FG 1HA5A 1Q86C 1WVLA 2HT1A 3KOJA 3EA6A 1H9RA 2A8VA 2JA8G 1DZ1A 1WTVA 5C5LA 1X6OA 1BBXC 4R4TA 3OYYA 2PYKA 4IQZA 2DNEA 2MP1A 4IUPA 2NTTA 1JOQA 2NN6G 3D8GA 3LWEA 3D6WA 2F1MA 4OX9Q 2VUMH 3UDFA 3E6ZX 2R61A 3M4YA 4OIJA 4BS9A 2LXJA 2Z6KC 4A3KH 1O80A 1WJJA 4KHPQ 4XIGS 3G48A 1QJOA 4L5QA 4DV1Q 5JPNC 3CCMA 4TVAB 4A3DB 1IL8A 2L1BA 5M5WB 2L0CA 3NTKA 2ZXPA 4JI6L 4DV6L 1YVCA 4DF7A 3NUCA 5GROA 1HTLD 4YCVA 5CV6A 2EYLA 3FEWX 1TWGB 4C3HG 1NJIC 2GVAA 5C0XI 3IFDA 4EQPA 1PTOH 3A8KE 4GLAC 4LNQA 1SLJA 3PSIA 3ITPA 2I0QA 2DJGC 2WACA 4DK1A 2RDHA 4IUVA 1N33Q 2AHOB 4V0BA 4CKBA 2QA4A 4PZ8A 1MJEA 2B2VA 3H3VI 3PGZA 2KEEA 5FO9B 1HZAA 3BJUA 1O7ZA 3GTPB 4LUVA 3PV0A 4CKCA 1GUWA 3G6JB 4UAIA 1GUGA 4X65L 5CBEE 2MUYA 1VQ7A 3I90A 2Z1CA 2BCOA 1TY0A 2K14A 2JEAI 3ULJA 1VQNA 4LFCQ 3MC0B 1EYDA 4Y7NH 3CCUA 3J80c 1LV9A 4GKJL 3K5OA 3TMEA 3I4LA 1K8AC 3LWUA 1J5EQ 4DN4M 3S1QB 3QOLA 4ME3A 2HD3A 5E4XA 3FKIG 2D0PA 2F0UA 2UU9Q 3ER0A 4A93B 1NY4A 1U0LA 3KF8B 3TEHB 1WFQA 3T51B 3DLLA 5C0XH 1SYBA 4J1MA 2AUKA 4JBKA 4CGYB 4EX5A 1I4RA 1Q90A 2ALYB 2D5DA 3IKJA 1WD1A 1HNZL 2QEJC 1X3QA 2M2LA 4ZUJA 2K7VA 1KNAA 1SSOA 5EBCA 3L0OA 1GKHA 4KLKA 3GP7A 1GXDC 4KD3A 1GJXA 4H44C 3I2ZA 1MJCA 1E0BA 4QL5A 1D1KA 1FR3A 3NEMA 2XNAC 3TS2A 3K7UC 5FJ8G 4DR5L 4DUZQ 1EZ8A 1AN8A 3PIP3 1PRTB 2UUAQ 1F77A 1N36Q 4OX9L 2JA9A 3W1GA 1GUSA 2EYMA 4K5VA 1SFOB 1EY4A 2WAQB 1ICFB 1TS2A 2F4IA 3BVGA 4A3DH 4KHPL 1A62A 4DV1L 5KNBA 3J7AF 3M9BA 4GOPB 1R4QB 3S24A 1XPRA 1NR2A 4JI8Q 4QQBX 4NP5A 4FDBA 1RF2D 2WB1G 3IL8A 1TWGH 2EJFC 4NW2A 2QDBA 2AWNA 3X3MA 4C2MB 4K2LA 2UUCL 1XNRQ 1Z7TA 4F87A 3I4OA 1TR5A 4H02A 3J80i 4BXXH 1CHPD 1FYCA 3SK5A 2YTXA 2C5CA 1PFNA 2Z6KA 1HZ9A 4FF4A 4HMJA 1I4XA 4YWLA 1D5MC 1N32Q 1WI5A 4DV3Q 4JI7Q 4CDFC 1YJNA 4DFAA 3KJOA 1N33L 3GTPH 3S1RB 3QWNA 1LM0A 4A3IB 1SE8A
chains in the Genus database with same CATH topology
3JAML 3KUPA 1ONLA 3OMCA 3CQZB 5CV5A 1V8QA 4BBSB 4KI0A 1U9RA 1H9JA 2JA8B 1PTOD 4YIJA 1PTOC 1S5ED 2A5HA 3A8JE 4KK7A 4C3IG 2BE5D 3C3LA 1B9NA 2BE5C 3IAYA 3M3YB 2R92B 5M9OA 3SXHA 3D4WA 3NBHA 3QO2A 2D62A 1HXYD 5KNCA 1W6KA 2IL8A 3EJIA 5IT9L 1KNEA 1W6JA 3TP5A 4C56C 4I7ZC 4FYDA 4IUUA 2VXWA 1QB5D 1VMPA 3U9OA 3OW7A 2K6AA 2L5TA 3P75A 1AZPA 1SBBB 1STBA 4A3BB 5LHY1 4NKLA 3HOUB 1U4MA 5E1FA 2SNSA 1EY9A 1GHJA 1HTPA 1J9OA 4S3SA 3CRLC 4C3JB 1TQOA 3HOYB 2EY6A 2FINB 1STEA 3MFGA 4Z9CB 3IFTA 4X3UA 4KHZA 4CJ2C 5FOBB 4IALA 4CKEA 5DM73 2IX3A 2RQXA 5EPLA 3HOVB 2EPBA 5KYIA 3KK7A 2JE6I 5JEAJ 1I4HA 2BA0A 4A3GB 1V1OA 1SDFA 4G7HC 5EJWA 2MHVA 3H09A 4ZYSA 5IT9E 4IURA 5CYUA 1WTOA 1EEID 3MFYA 3NE5B 2A6ED 2E2HB 2A6EC 4IFDJ 3GTJB 1NR4A 1B3AA 4U673 1C48A 1IYVA 1H9SA 3FPPA 2HQEA 3EQLC 4XXEA 2CHBD 3S9WA 1F9PA 4HMIA 3SR1A 3HGBA 5K5PA 1IYUA 2A73B 1XXGA 4IZ8A 1IKLA 1B50A 5CR3A 3S14B 4QIWB 3URYA 2NBFA 3FPUB 1K8OA 4QCLA 4BA2I 2PW7A 2A6HD 2A6HC 5FK9C 1GOZA 1SNPA 4XT1B 1PLFA 1QWYA 1B53A 2LS01 4CHTB 3KLSX 2DY8A 1A2UA 3DMUA 4XYOA 1BCPB 4J6HA 1PRTD 1XTCD 3RLFA 1PRTC 2EYHA 5ISRA 4UDUC 3DEOA 1GUTA 2IT1A 1FNVA 2PO4A 1Q8IA 1Y8NB 3K0YA 5ELEA 3M4OB 4DNRB 5E4WC 4TSSA 1F2MA 3BYTB 2QCPX 1JWSD 5I2YA 1LTSD 1C4QA 2XRSD 1CTMA 4N9TA 5D3DA 1NCVA 1WTWA 2KUMA 5BN4A 4V190 2R3ZA 5C0XJ 1U4LA 4TRDA 5ELDA 1CM9A 4OL7A 3PO3B 1K83B 4X3SA 4R8IA 5E3FA 4LJZC 4ZQ3A 2F0GA 4DGZA 3CRKC 5DEHA 2F0KA 4X3TA 1Y8PB 1A15A 5J1ZA 5AFWA 2PZWA 2VB3X 1PZKD 2EY2A 2BDOA 2K1BA 2XRQD 4EGVA 2NVTB 3TSSA 1EEFD 2NVQB 4QMGA 2B2VC 2K33A 5NUCA 1UAPA 3PUYA 3T4AC 2DN8A 2EY5A 1V1PA 4FNFA 1H9SB 2HCIA 5G3LD 5J39A 1VF5C 4FO2A 4M1UB 2MJ8A 3VA7A 4IFDI 3HG9A 3KF8A 3MXGA 2X6GA 3P20A 2JA7B 4DA2A 3R93A 3KLRA 1JOOA 1QCBD 3ZYYX 1WCMB 2TMPA 4Q0FA 1MGSA 1NAPA 2RBMA 3H94A 1I4GA 4X3KA 1WTXA 3BDCA 1DOKA 4CJ0B 1HUMA 2PNRC 2KVMA 5EKLA 3OIQA 2KEDA 1EZ6A 4E6IA 3VR2A 3I73A 1RKNA 1H9MA 1DONA 3SVMA 2ZXRA 5FLXE 1EFID 2LKVA 1TY2A 1VMCA 4RH6A 5C3WA 5DM63 1I3QB 3VR3A 1I4PA 2BDNA 1Y69U 1YNJD 3VR6A 1YNJC 2X6LA 3M85A 2JA6B 1BR9A 1ZXTA 1Q12A 4XTCS 1E2VA 1S5DD 3OMGA 3TP8A 4DAVA 4ZAIA 2MPMA 3A7LA 2B39A 2I46A 3NQIA 1D2BA 3OPOA 5JVH3 4B9WA 1BQQT 4DK0A 4O42A 4PMWA 4RCNA 3VA5A 2NB0A 1T5XD 4DAPA 3AMUA 2PW5A 4DXFA 1HFNA 2KOLA 1CZWA 1G2SA 3K6OA 4TKOB 2N55A 4LMQD 2G9HD 3N6RA 3HS0C 4PMBA 5I9OA 4ZKCB 5LL6S 3VYSA 4O1NA 4OO1H 2Y0SB 3HOWB 3DWQA 4QF4A 1CQFA 1OXVA 1X3PA 2D9UA 5TSSA 3GTGB 1BCPD 1JE4A 1AP0A 1BCPC 1AFPA 2Q8IB 1SMYD 3NXWA 3Q6SA 1V1PB 5I9PA 1SMYC 1TKWB 3D31A 1SE4A 4HR7B 4WJWA 1PDQA 4IUTA 1D1IA 2F0TA 1ESFA 3GTLB 5HURA 2X69A 5J22A 2WV6D 2KCNA 2EE1A 3NWSA 3MAQA 4ZUIA 4KN7C 2NZ1D 1STGA 2QILA 1LT6D 2AWOA 1LTID 4BA1I 4DNTB 3VYUA 3OSOA 1IHZA 1STAA 4QUCA 3O13A 3K57A 1LTAD 1XYIA 2F0JA 4HSVA 1VCIA 3VR4A 4R8NA 4K6LA 1RCVD 3MA2B 4MIUA 2EJGC 2K05A 1E2WA 3OHXC 1O7YA 1SJHD 4J8QA 3I72A 1SYFA 5K36G 2B2YC 4ZKBB 4KV6A 4KHVA 1CK1A 4BY1B 3MXUA 4BBRB 1WTPA 3WOEA 1FD7D 2IW3A 3EROA 1C8CA 1S5BD 1I6HB 2F3VA 1E2ZA 5CBAE 3BYYB 1KTKA 1EU4A 4P2CB 3F2UA 1SJED 3RMHA 3LX0A 2LY7A 1SNQA 2L11A 3BDLA 5KGUA 4G7ZC 3A56A 1DD2A 1SNDA 1KLGD 2EYPA 5M3FB 3QB3A 2L9HA 1LTTD 3H6MA 2Q8TA 5F2DA 3NK9A 1S5CD 1BF4A 4PV1C 2F0MA 5EGTA 4LAAA 2FMMA 1TU2B 5JPMC 1Q3LA 1DCZA 3FRPB 3OIPA 4RGTA 2IWHA 2F0IA 4IUQA 3TZUA 4C3HB 2WKDA 5LL6X 2CVRA 2B2UC 4K8JA 1HPCA 3EFXD 3NP8A 4KTAA 1CQVA 1CI3M 3SK6A 5KNDA 1B9MA 2WKCA 1V43A 1LACA 2KA7A 2YYZA 4A3MB 1EY5A 4L8JA 2L55A 2KHSA 2EY1A 2NN6I 1DOLA 1TWCB 5IGBA 2E2JB 3M7GA 4RHSA 3H91A 1OO9B 4M8AA 2C9OA 4KJOA 1Z47A 1ET9A 4B08A 4IFDG 5CV8A 5ELBA 2KJXA 3TZDA 1EOTA 3E0JA 1LT4D 4KN4C 2Z4HA 5EPKA 3FKIB 2F0NA 5EPJA 1S4ZA 4XT3B 2EXZA 3GTQB 4RA8A 2B2YA 4BWGB 4ABNA 4Q5VA 2F0EA 1BUVT 1TIID 1U4PA 4IUNA 4PMCA 1SNCA 2LMCB 4H13C 3V96A 3S17B 1PMRA 2NN6H 4IN3A 1CFMA 1ZKOA 3QOJA 1I4QA 2DY7A 3MHBA 2RSNA 4N9PA 1PFBA 2NUCA 2BOSA 2FHTA 1II3A 2JXMB 1X32A 1PZID 3FDTA 2WB1B 2LFNA 5A2QE 1A3UA 1PFMA 5CMDA 1TT2A 1B44D 1TS5A 3TBIB 1Q1BA 4F88A 4NDXA 1EQVA 1EYCA 3I8ZA 2ZT9C 5IGEA 4KY6A 1EU3A 4ULLA 3OWEB 3J80E 3C1EA 3S15B 1KLUD 1A3TA 1VDZA 3TDQA 2OXPA 1LABA 1QNKA 3N52A 2RDGA 1A6XA 1HQRD 1SYGA 4C1NI 2B2UA 1GUNA 5C0XG 1CA6A 2G9DA 1GUOA 3RUZA 1VF7A 1SYEA 3HRZC 2E76C 1JC7A 5JJZA 4C3IB 2B2WC 1A2TA 1STHA 5T1IA 1SAPA 3Q23A 1AEXA 2NYZD 3MXPA 2K04A 3I70A 2K01A 2O5IC 4XDXA 3DWAA 4XYQA 4RKLA 4JBWA 5JAVA 1DXMA 2N88A 3RZOB 3K7AB 3PIO3 4RWSC 4ZRZA 1JB3A 2F0DA 4AYBB 5JOBA 4F7XA 1YNND 2NTSA 2F0OA 1YNNC 1WD0A 3G7LA 2Z4IA 3NHHA 2FFKB 1NSNS 1PTOF 4ODGA 1KABA 1JR0D 1DJRD 3GQBA 2FMCA 3D4RA 2F0FA 2M9VA 4ZLTF 4HAEA 3WDNA 4RHRA 3OOCA 1L0YB 1KDAA 3R2IA 1Y8OB 1STYA 3SE0A 4GZYC 3NWTA 1RJTA 1FNUA 3TP6A 4KD4A 3ND9A 1D5ZC 1RD9D 5FLXL 5FO7B 2HDMA 3HOXB 1EWCA 3TP7A 4KY5A 2EYOA 4XQQA 3I91A 2L12A 5C4ZA 5T1GA 2D2CC 1BOSA 3PUWA 1S5FD 1T5EA 2EVBA 2GA4B 1EY8A 1UEAB 3MVVA 4L6TB 1XWEA 1PYWD 4CJ1B 3S2DB 1G6ZA 1DOMA 5KEEA 3MXNA 4KKTA 1M4VA 3D3RA 2F03A 3PUXA 2HDLA 1Q1EA 1O78A 5IGGA 3SEBA 2B2WA 5FKAC 4BY7B 3BVZA 1RTOA 3R3OA 2NVYB 1EYAA 4I65A 3V05A 3S1MB 3NQTA 2V4DA 4K5WA 4OHJA 1MBYA 1EY6A 1ENCA 5HGTA 1EIGA 1LT5D 1KDCA 1CHQD 2IX0A 3Q24A 4HCSA 2E74C 3OWFA 1TVXA 5M3MB 4OO1I 2VNUD 1I6VC 3ONAB 1LTGD 2ICEC 1JWMD 4L63B 3SK8A 2CW0D 4HTHA 1F9QA 2CW0C 2HUGA 2EZVA 2AQ3B 4EVOA 5EBDA 3FMCA 1HQMC 2KCCA 1I50B 5CV4A 2PZTA 4LK1C 3ERQA 2K5WA 1NUCA 1HRJA 1SNOA 2K5DA 2RSOA 3CU7A 1EL0A 1HCZA 1PZJD 3KBGA 1TWAB 3D6CA 1MD2D 1IW7D 5KIXA 5EKIA 1IW7C 4G4KA 1EQTA 4CBVA 4B9XA 3S16B 2O5JC 3VYRA 1JQYD 5C4JB 1PRTF 1OXUA 1OXSC 1DYQA 1DM0B 1OXXK 1ENAA 3A54A 4H0LC 1FNWA 1QNUA 2F0PA 2ID0A 3EVQA 1RHPA 1Y1VB 2PCFB 1B1ZA 3DUZA 5CV9A 4C3JG 2F3WA 1LLRD 5D65A 4XQNA 5IGDA 1SEBD 3S2HB 2XWBB 4HN7A 2BA1A 2PQEA 4FF3A 4K5XA 4QB4A 4FXGC 3MTSA 1IKMA 4MHEA 2B8FA 5C4XB 5BN5A 3C46A 2XN9C 2SDFA 3QG1A 5CV7A 2WP8J 3MWYW 1O7LA 3HP3A 4HCEA 5I4DA 1R9TB 3L3OC 1CA5A 3L9AX 5D3IB 5C5MA 1SXTA 3W3AA 2R7ZB 3T16A 4A3FB 4FP5D 5BN3A 1BDOA 1F2ZA 2VB2X 3ND8A 5IGFA 2JSOA 3A7AB 3QIAA 3KLSA 3SK4A 4U68A 1G2TA 2F0SA 1OXTA 2K28A 4K6DA 5M5YB 3NSWA 2B2TC 1L0XB 5C3XA 3PMFA 2QKIC 3WOFA 4RAUC 3NTIA 4FXKC 4A3JB 3S1NB 2F0HA 1KAAA 2R93B 3DHQA 3Q22A 2KECA 1ET6A 3AU7A 5G3LF 4OIKA 4RGMA 1LT3D 5EKKA 3E5SA 3GD7A 1ILPA 5C4HA 4KJNA 4RGNA 2JYOA 1HFGA 3P1HA 3U9SA 1MSGA 2OEOA 5C3EB 5ELFA 2QF7A 3T56B 4FVMA 4RGOS 2RVLA 3K5MA 1CT1D 2JP1A 4HSPA 1QILA 1Y1WB 5FO8B 1HA6A 4FXDA 5DNFA 3NPPA 5I6WA 1K8MA 3DWPA 2O2LD 3QJYA 1MI2A 1SE3A 2EDGA 5A35A 2MGSA 3PO2B 3HZXA 1RDPD 2HCCA 3T13A 1TWFB 4KKSA 3VYTA 4RKBA 2ZXOA 3K59A 5KRUA 5JEAG 5COYA 4G7OC 1R4PB 5A2QL 5CORA 3CKIB 1TS4A 2IX1A 2IPKD 4FF2A 3LNNA 4DU9A 1B2TA 4A3EB 5I6YA 5DAUA 1HUNA 2O4XA 1A3VA 3GO5A 3PUZA 3K58A 2L4NA 3J80L 2PPBC 5CGKA 3H0GB 4PQXA 3C1FA 1WTRA 1ILQA 3JAME 3H3VC 2SNMA 1SYCA 2FJ2A 1Z6HA 2J4XA 1F9SA 4ID6A 2PMZB 4ZK9B 3K5NA 2F0WA 4OGQC 3AB9A 2J0TD 2AUJD 3HOZB 2DNCA 2B2TA 2TSSA 3GTKB 4TQUS 4NMZA 2SOBA 1BXTA 5KYLA 3CHBD 3BS1A 3A55A 4KKUA 4FF1A 3GTOB 4WFN3 1BCPF 3GTMB 3MZ5A 4DAYA 2RKSA 2NVXB 2WINB 2A69D 2A69C 2SEBD 5M5XB 3I4MB 4KMUC 1EY7A 3DEPA 5ELCA 2F0QA 4OO1G 3D4DA 4K14A 3I3CA 4G57A 1D6EC 3HEJA 3V2TA 1ESRA 1SE2A 1LTRD 1RODA 2H4OA 4PNYA 1QOHA 2KQ3A 1QE6A 2H1EA 3SHLA 3X3NA 3L7ZC 5C44B 3TN2A 2Z8LA 2JEBI 3I4NB 1F2YA 2JA5B 4K8IA 3GV3A 1XX8A 2RDFA 2OF1A 3BZDB 3VR5A 5CC4A 1G8ZD 1M8AA 2CQAA 1JORA 1JOKA 5C6AA 1JICA 2YU9B 2R6GA 3T53B 1JWUD 3P7JA 5I2XA 2AQ2B 3A8IE 1F2LA 2EOTA 4EQNA 3DXJC 2XIWA 1UNSA 2E2IB 1TS3A 2EJMA 4WORA 2Q8RE 2WIIB 2B8GA 2XVSA 1ZYRD 1TWHB 5JVG3 1GHKA 3RZDB 1HHVA 2K03A 1ZYRC 2E2DC 4RCOA 3J7AV 3DM1A 1KDBA 5K36H 3K5LA 4EQOA 3NBIA 1AW7A 1G291 3J81L 3KBXA 3BVMA 4H7BA 3PUVA 1SYDA 2A68D 1EWHA 2A68C 1J8IA 1F9RA 5EQ0A 1BNZA 4K2KA 1ENFA 4DXGA 1JCKB 1RTNA 3M7NA 4JK1C 5D14A 2PZUA 2B63B 3UI2A 3RD4A 3J7YW 1G91A 4ME5A 4XQJA 2VUMB 1SNMA 4A3KB 1QG7A 2F0VA 1ML0D 3FVQA 2I07B 4RFBA 2AQ1B 3BG3A 1STNA 4C1NK 1EIHA 2XWJB 2J7ZA 2XSCA 2NWGA 1ZEQX 1ICWA 2ENBA 4R9WA 1D5XC 2M00A 1PTOB 3W2DA 3HKZB 2RA4A 2EYJA 1LTBD 4F8MA 1UUPA 3BDOA 3Q0AA 3R8BA 4KY7A 4QUFA 1CZGA 1EY0A 5IIFA 2E75C 1U4RA 3C2PA 2K32A 3NTHA 1PXUA 3J81E 1WTQA 2EYFA 2F0LA 5JEAH 3R2TA 5IOCA 5IGCA 1MSHA 4Y7NB 4HEDA 1BO0A 4ILWA 4WRDA 3SDZA 2IJ0A 2A74C 2OT2A 4MN3A 1LO5D 2ICIA 1H9KA 3MEHA 1AZQA 1FGBD 2K5QA 5IODA 3GV6A 4IFDH 1B4OA 1HA5A 1WVLA 3EA6A 1H9RA 1DZ1A 1WTVA 5C5LA 1BBXC 2PYKA 4IQZA 2DNEA 2MP1A 4IUPA 2NTTA 1JOQA 2NN6G 3D8GA 3LWEA 3D6WA 2F1MA 3E6ZX 2R61A 3M4YA 4OIJA 4BS9A 1O80A 4XIGS 1QJOA 5JPNC 4A3DB 1IL8A 2L1BA 5M5WB 2L0CA 3NTKA 2ZXPA 4DF7A 3NUCA 1HTLD 5CV6A 2EYLA 3FEWX 1TWGB 4C3HG 5C0XI 3IFDA 4EQPA 1PTOH 3A8KE 3ITPA 2WACA 4DK1A 2RDHA 4IUVA 4V0BA 4CKBA 2B2VA 5FO9B 2KEEA 1O7ZA 3GTPB 3PV0A 4CKCA 1GUWA 3G6JB 4UAIA 1GUGA 5CBEE 2MUYA 3I90A 2Z1CA 2BCOA 1TY0A 2JEAI 3MC0B 1EYDA 1LV9A 3K5OA 3TMEA 3I4LA 3LWUA 4DN4M 3S1QB 3QOLA 5E4XA 2F0UA 4A93B 3T51B 5C0XH 1SYBA 4J1MA 2AUKA 4CGYB 1I4RA 1Q90A 2D5DA 3IKJA 1WD1A 2QEJC 1X3QA 2M2LA 4ZUJA 2K7VA 1KNAA 1SSOA 5EBCA 3GP7A 1GXDC 4KD3A 1GJXA 4H44C 1E0BA 1D1KA 1FR3A 2XNAC 1EZ8A 1AN8A 3PIP3 1PRTB 1F77A 1GUSA 2EYMA 4K5VA 1SFOB 1EY4A 2WAQB 1TS2A 2F4IA 3BVGA 5KNBA 3J7AF 1R4QB 1NR2A 4NP5A 1RF2D 3IL8A 2EJFC 4NW2A 2QDBA 2AWNA 3X3MA 4C2MB 4K2LA 1Z7TA 4F87A 1TR5A 1CHPD 1FYCA 3SK5A 2C5CA 1PFNA 4FF4A 4HMJA 1I4XA 1D5MC 4DFAA 3S1RB 3QWNA 4A3IB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DEO A;  3MWY W;  3I90 A;  3ONA B;  3KUP A;  1DOL A;  1MI2 A;  3DM1 A;  1WTP A;  5EPL A;  2X6G A;  3HP3 A;  1HFN A;  2KOL A;  1C8C A;  1MSH A;  1G2S A;  2MGS A;  2EPB A;  1CA5 A;  3H91 A;  4HED A;  2N55 A;  1BO0 A;  3DEP A;  4LMQ D;  1LV9 A;  2HDM A;  1SDF A;  5CBA E;  2HCC A;  1F9Q A;  2HUG A;  1QNK A;  3N52 A;  5E4W C;  5EJW A;  4ZKC B;  4DN4 M;  3R93 A;  4MN3 A;  3F2U A;  2B2U A;  3I91 A;  3KBX A;  4IUR A;  5E4X A;  1CA6 A;  2L12 A;  3I3C A;  1WTO A;  3TZD A;  1EOT A;  5T1G A;  1AZQ A;  5COY A;  2L11 A;  3GV6 A;  2RSO A;  1HRJ A;  5EPK A;  1B4O A;  4U68 A;  1EL0 A;  1NCV A;  1ESR A;  1G2T A;  1J8I A;  1X3P A;  5JJZ A;  1WTW A;  2D9U A;  1F9R A;  1MGS A;  2B2W C;  1NAP A;  5COR A;  2K28 A;  3QO2 A;  5EPJ A;  1ROD A;  1WVL A;  1S4Z A;  2KUM A;  5T1I A;  1JE4 A;  5EQ0 A;  1SAP A;  1WD1 A;  1BNZ A;  4XT3 B;  1NR4 A;  4X3K A;  4CJ1 B;  1AP0 A;  2IL8 A;  2R3Z A;  2B2Y A;  2NYZ D;  1B3A A;  1U4L A;  1DOM A;  1X3Q A;  2K04 A;  1KNA A;  1RTN A;  1SSO A;  2B2T C;  2L9H A;  2M2L A;  3Q6S A;  5EKI A;  1KNE A;  2Q8T A;  1DOK A;  1WTX A;  1EQT A;  1BBX C;  2K01 A;  1HUN A;  5D14 A;  1QE6 A;  4XDX A;  4RA8 A;  4CJ0 B;  4RAU C;  2H1E A;  3UI2 A;  2MP1 A;  1PDQ A;  4IUT A;  4IUP A;  1G91 A;  1HUM A;  1BF4 A;  2KVM A;  2L4N A;  3LWE A;  1U4P A;  3D6W A;  1CM9 A;  3TN2 A;  1E0B A;  2N88 A;  1G6Z A;  4X3S A;  4OIJ A;  4IUU A;  4R8I A;  2KEC A;  2VXW A;  1QG7 A;  2X69 A;  1ILQ A;  1F9P A;  1VMP A;  2KED A;  1O80 A;  4OIK A;  4RWS C;  1ML0 D;  2HDL A;  1AZP A;  3GV3 A;  2FMM A;  2FJ2 A;  2EE1 A;  1DON A;  1ILP A;  1F9S A;  1XX8 A;  3SVM A;  2NZ1 D;  1Q3L A;  1IKL A;  1B50 A;  4X3T A;  1IL8 A;  2DY7 A;  4ZK9 B;  2JYO A;  2L1B A;  1U4M A;  1HFG A;  1RHP A;  1VMC A;  1WD0 A;  1B2T A;  1EIH A;  2B2W A;  3G7L A;  2RSN A;  1A15 A;  1M8A A;  1MSG A;  1RTO A;  2J7Z A;  5D65 A;  5AFW A;  1JIC A;  2NWG A;  1NR2 A;  1PFB A;  1DZ1 A;  1J9O A;  1ICW A;  2FFK B;  2FHT A;  2B2T A;  3IL8 A;  4NW2 A;  2BDN A;  1WTV A;  4R9W A;  2K1B A;  1X32 A;  4QUC A;  3P7J A;  3FPU B;  4IUQ A;  1XYI A;  3FDT A;  3IFD A;  4HSV A;  2X6L A;  2RVL A;  2FIN B;  2RA4 A;  1F2L A;  2B2V C;  2CVR A;  2B2U C;  2JP1 A;  1ZXT A;  1PFM A;  2EOT A;  3MTS A;  4ZLT F;  5CMD A;  1IKM A;  4HAE A;  1EIG A;  4IUV A;  1PFN A;  4XT1 B;  1PLF A;  4MHE A;  4QUF A;  2XIW A;  4ZAI A;  1WTR A;  1B53 A;  2MPM A;  1HA6 A;  2B2V A;  4HCS A;  3I8Z A;  2K05 A;  2KEE A;  2DY8 A;  4X3U A;  2SDF A;  2Q8R E;  1O7Z A;  2HCI A;  5DNF A;  4CJ2 C;  1O7Y A;  1U4R A;  1GUW A;  1HHV A;  2K03 A;  1TVX A;  4UAI A;  4O42 A;  2B2Y C;  2MJ8 A;  1WTQ A;  5CBE E;  1RJT A;  4ZKB B; 
#chains in the Genus database with same CATH topology
 3JAM L;  4A3L G;  3KUP A;  1ONL A;  3OMC A;  3CQZ B;  5CV5 A;  1V8Q A;  5IYB G;  1HNX Q;  4BBS B;  4KI0 A;  1U9R A;  1H9J A;  2JA8 B;  1PTO D;  4LFC L;  4YIJ A;  3S1Q H;  1ASZ A;  1PTO C;  1S5E D;  2A5H A;  3A8J E;  4KK7 A;  4C3I G;  2BE5 D;  3C3L A;  1J5E L;  1B9N A;  4A93 H;  2BE5 C;  3IAY A;  3M3Y B;  2QDL A;  2R92 B;  5M9O A;  3SXH A;  3D4W A;  3NBH A;  2UU9 L;  1HJP A;  3QO2 A;  2D62 A;  1HXY D;  4I7A A;  5KNC A;  1W6K A;  2IL8 A;  1T9H A;  3F2B A;  3EJI A;  2K5H A;  5IT9 L;  1KNE A;  3CCV A;  1W6J A;  3TP5 A;  2RHQ B;  1XMO Q;  4C56 C;  1Q7Y C;  4RG1 A;  1PH2 A;  4I7Z C;  4FYD A;  1KD1 C;  2IHF A;  4IUU A;  2VXW A;  1QB5 D;  1JE5 A;  1VMP A;  4AYB G;  1A63 A;  4DV0 Q;  3U9O A;  3OW7 A;  2K6A A;  2L5T A;  3P75 A;  5IYC H;  1AZP A;  1SBB B;  1STB A;  3RN2 A;  4A3B B;  5LHY 1;  4NKL A;  1SFO H;  2V1C C;  3HOU B;  4DUZ L;  1U4M A;  5E1F A;  4OWW B;  2UUA L;  5IP9 G;  1N36 L;  1JJC B;  1KAW A;  2I5H A;  3PO3 G;  2SNS A;  1EY9 A;  1GHJ A;  1HTP A;  1J9O A;  1X9N A;  4S3S A;  3CAM A;  3CRL C;  3PF5 A;  4C3J B;  1TQO A;  4C2M H;  3HOY B;  2EY6 A;  4UPA A;  3TRZ A;  2FIN B;  4JI8 L;  1STE A;  3MFG A;  4Z9C B;  4IO9 A;  1XNR L;  3IFT A;  2KHI A;  2CH4 W;  1MIU A;  1VQL A;  4X3U A;  5HY6 A;  2DJF C;  4KHZ A;  4CJ2 C;  3PCO B;  3K0X A;  5FOB B;  4IAL A;  4CKE A;  1N32 L;  3S1R H;  1JB7 A;  5DM7 3;  4DV3 L;  4A3I H;  2IX3 A;  4R1J A;  2RQX A;  5EPL A;  3CQZ H;  3HOX G;  3HOV B;  3PQI A;  2EPB A;  2A19 A;  3EIV A;  3KK7 A;  5KYI A;  4BBS H;  2JE6 I;  5JEA J;  1I4H A;  2BA0 A;  4A3G B;  1V1O A;  1SDF A;  4G7H C;  5EJW A;  2MHV A;  1SRU A;  1HNX L;  2JA8 H;  3RLN A;  3H09 A;  4ZYS A;  5IT9 E;  1IZ6 A;  4IUR A;  5CYU A;  4DR2 Q;  3U58 A;  1WTO A;  1EEI D;  3I55 A;  3MFY A;  3NE5 B;  1UEB A;  2A6E D;  1VQE A;  3M3Y H;  2R92 H;  2E2H B;  2A6E C;  1L1O B;  4IFD J;  3GTJ B;  1NR4 A;  1B3A A;  4U67 3;  1WTH A;  1C48 A;  1IYV A;  1H9S A;  3FPP A;  1VQ4 A;  1VQ5 A;  5IY0 A;  1UWV A;  1KXL A;  1WCM G;  2HQE A;  3EQL C;  4DR3 Q;  4XXE A;  2CHB D;  2PMZ E;  3S9W A;  3J81 i;  1F9P A;  4HMI A;  3SR1 A;  3HGB A;  5K5P A;  3J7A 5;  2XTI A;  3M4Q A;  3E9I A;  1IYU A;  4NXM Q;  2A73 B;  1XXG A;  1VQA A;  4BY7 G;  2K4K A;  2E5L Q;  4IZ8 A;  1IKL A;  4DV0 L;  1B50 A;  5CR3 A;  3HOU H;  4DUY Q;  4NB3 A;  4LFB L;  3S14 B;  4QIW B;  3URY A;  2NBF A;  4JC0 A;  3FPU B;  4OON A;  4C3J H;  1K8O A;  4QCL A;  4BA2 I;  2PW7 A;  3UDI A;  2A6H D;  3HOY H;  2A6H C;  5FK9 C;  5AJ3 Q;  4IOA A;  1GOZ A;  1SNP A;  3ULL A;  4XT1 B;  4HIM A;  1PLF A;  1QWY A;  4LUZ A;  4DR6 Q;  1B53 A;  2LS0 1;  4CHT B;  3KLS X;  2K50 A;  2DY8 A;  1A2U A;  3DMU A;  4XYO A;  5M3M G;  1BCP B;  1EUJ A;  1J6Q A;  4J6H A;  1PRT D;  4P73 A;  4MTK A;  1XTC D;  3RLF A;  1PRT C;  2EYH A;  5ISR A;  2JA6 G;  4UDU C;  3DEO A;  4CDC C;  2C35 B;  4HJ7 A;  1GUT A;  4UP9 A;  3PF4 A;  3HOV H;  2IT1 A;  1FNV A;  2PO4 A;  1Q8I A;  1Y8N B;  3K0Y A;  5ELE A;  4GOP C;  4LF7 Q;  3M4O B;  4DNR B;  4A3G H;  5E4W C;  4HIK A;  4TSS A;  1F2M A;  3BYT B;  2QCP X;  4LF8 Q;  2K5N A;  1JWS D;  5I2Y A;  1LTS D;  3KFU A;  1C4Q A;  1YIJ A;  3F2D A;  2XRS D;  1CTM A;  4N9T A;  4B3R Q;  1LYL A;  5D3D A;  1NCV A;  4DR2 L;  4HID A;  1WTW A;  2E2H H;  2KUM A;  5BN4 A;  4V19 0;  1SMX A;  5FJ8 H;  2R3Z A;  3GTJ H;  5C0X J;  1U4L A;  4POF A;  3KDF B;  4TRD A;  2Y0S G;  2AKW B;  2CWA A;  5ELD A;  1CM9 A;  5HGQ A;  4OL7 A;  1P16 A;  3PO3 B;  1K83 B;  4X3S A;  4L5S A;  4GS3 A;  3SGI A;  4R8I A;  4MZ9 A;  5E3F A;  4LJZ C;  4JI3 L;  2N8N A;  4ZQ3 A;  1YZ6 A;  2F0G A;  4DGZ A;  4DR3 L;  3CRK C;  4ZCK A;  5DEH A;  2F0K A;  4X3T A;  1Y8P B;  2F52 A;  3W5O A;  4NXM L;  2PI2 A;  1A15 A;  5J1Z A;  3UDG A;  4DV7 Q;  5AFW A;  2PZW A;  3S14 H;  2E5L L;  2VB3 X;  1PZK D;  2EY2 A;  2BDO A;  2K1B A;  2XRQ D;  4EGV A;  2NVT B;  3TSS A;  1EEF D;  1PH3 A;  2NVQ B;  4QMG A;  2B2V C;  1RL2 A;  5C4X G;  4A3L H;  1KHI A;  2UXC Q;  2K33 A;  5NUC A;  1UAP A;  3PUY A;  4OEL B;  3T4A C;  3BZC A;  2DN8 A;  2EY5 A;  1V1P A;  4FNF A;  5AJ3 L;  1H9S B;  2HCI A;  5G3L D;  5J39 A;  2VQF Q;  1HR0 Q;  5DLQ E;  1VF5 C;  4FO2 A;  4M1U B;  2MJ8 A;  2NZH A;  3VA7 A;  1CSP A;  4IFD I;  3CW2 C;  3HG9 A;  3KF8 A;  3MXG A;  2X6G A;  3P20 A;  3AYH B;  2JA7 B;  3U4V A;  2R7Z G;  4A3F G;  3M4O H;  4DA2 A;  4R4C A;  1G51 A;  1CKO A;  3RLO A;  1VQ9 A;  1SRO A;  3R93 A;  3KLR A;  1JOO A;  4LF7 L;  4IPH A;  1CKN B;  2A1A A;  1QCB D;  1PV4 A;  4LF8 L;  3ZYY X;  1WCM B;  2TMP A;  4Q0F A;  1MGS A;  1NAP A;  1N34 Q;  2RBM A;  3H94 A;  4B3R L;  1I4G A;  4X3K A;  5FLM H;  1B7Y B;  3L2P A;  1WTX A;  3BDC A;  4A3J G;  1DOK A;  4UY8 C;  4NPS A;  1NTG A;  3KLW A;  3A5Z B;  4CJ0 B;  4X6A H;  1HUM A;  2PNR C;  2KVM A;  4GOP A;  2F3I A;  3UE1 A;  5IP9 H;  3MEF A;  5EKL A;  3PO3 H;  3OIQ A;  2H5X A;  1K83 H;  2KED A;  1EZ6 A;  4AQY Q;  4E6I A;  3VR2 A;  3I73 A;  1RKN A;  1H9M A;  1XPO A;  1DON A;  3NEN A;  3KF6 A;  3SVM A;  2ZXR A;  5FLX E;  2K5V A;  1EFI D;  2LKV A;  1TY2 A;  1VMC A;  3JAM c;  5C3E G;  1QVF A;  4RH6 A;  5C3W A;  4J15 A;  5DM6 3;  3HKZ E;  1I3Q B;  1GO3 E;  3VR3 A;  1L1O C;  1CKM A;  4JYA Q;  1I4P A;  2BDN A;  1Y69 U;  1YNJ D;  2VQE Q;  1XMQ Q;  2NVT H;  1Y1W G;  2K52 A;  3VR6 A;  2D0O A;  1YNJ C;  2X6L A;  4DV7 L;  3D0F A;  3M85 A;  2NVQ H;  2JA6 B;  1BR9 A;  1ZXT A;  1Q12 A;  4XTC S;  1E2V A;  1S5D D;  2YV5 A;  3OMG A;  1A8V A;  3TP8 A;  4DAV A;  4ZAI A;  2MPM A;  3A7L A;  1CSQ A;  4R4I A;  3RN5 A;  2B39 A;  2I46 A;  1HNW Q;  3NQI A;  1D2B A;  3OPO A;  5JVH 3;  4B9W A;  1BQQ T;  4DK0 A;  4OEM B;  1VQH A;  4JI1 L;  4O42 A;  4PMW A;  3PO2 G;  2KCM A;  4RCN A;  3A0J A;  3VA5 A;  4X64 Q;  2NB0 A;  1T5X D;  4DAP A;  5LMU Q;  2PW5 A;  4DXF A;  1HR0 L;  4IJH A;  3AMU A;  1HFN A;  2KOL A;  1CZW A;  3BZK A;  1G2S A;  3K6O A;  2JA7 H;  4TKO B;  2N55 A;  4LMQ D;  1YJ9 A;  2G9H D;  3N6R A;  1K3R A;  2LSS A;  1AH9 A;  3HS0 C;  2IY5 B;  4PMB A;  2OWO A;  5I9O A;  4ZKC B;  5IP7 H;  1K0R A;  4A3M G;  1W2B A;  5LL6 S;  1MKH A;  3VYS A;  4O1N A;  4WJ4 A;  1VQK A;  4OO1 H;  2Y0S B;  1SN8 A;  3HOW B;  3DWQ A;  4QF4 A;  1CQF A;  1OXV A;  1WCM H;  1X3P A;  2D9U A;  4LF5 Q;  4A3E G;  2RF4 A;  5TSS A;  5L37 A;  1BCP D;  3GTG B;  1JE4 A;  3CC2 A;  1AP0 A;  1BCP C;  1AFP A;  2Q8I B;  3JAM i;  1SMY D;  3NXW A;  3Q6S A;  1V1P B;  5I9P A;  1N34 L;  1SMY C;  1TKW B;  3D31 A;  1SE4 A;  4HR7 B;  4WJW A;  3H0G G;  1PDQ A;  4IUT A;  1D1I A;  2F0T A;  1D8L A;  3ULP A;  1ESF A;  5ELN A;  3GTL B;  1LTL A;  5HUR A;  2HIX A;  2X69 A;  4JOI A;  5J22 A;  3W1B A;  2WV6 D;  2EIF A;  2KCN A;  2MO0 A;  2EE1 A;  3CME A;  3NWS A;  3MAQ A;  4ZUI A;  2P5Z X;  4KN7 C;  2NZ1 D;  1STG A;  2QIL A;  3HOZ G;  3MXN B;  5IYD G;  4R4Q A;  4AQY L;  1LT6 D;  2AWO A;  1LTI D;  4BA1 I;  2NZO A;  2N49 A;  4DK3 C;  4DNT B;  2BH2 A;  2OCE A;  4LF4 Q;  1I3Q H;  3VYU A;  3U4Z A;  3OSO A;  1GM5 A;  1IHZ A;  1STA A;  4QUC A;  3O13 A;  3K57 A;  1LTA D;  1XYI A;  2F0J A;  4HSV A;  4GLV B;  1VCI A;  3CPF A;  2PI2 E;  5ELO A;  3VR4 A;  4R8N A;  2JA6 H;  4K6L A;  1RCV D;  3MA2 B;  4JYA L;  1XMQ L;  2VQE L;  4MIU A;  4OXP A;  2GN5 A;  3G6E A;  1XNQ Q;  4HJ9 A;  1JJ2 A;  4DV5 Q;  2EJG C;  1QZH A;  2K05 A;  3Q8D A;  1E2W A;  3OHX C;  1O7Y A;  1SJH D;  4J8Q A;  1FJG Q;  3I72 A;  4JI4 Q;  1SYF A;  1VQG A;  5K36 G;  2B2Y C;  3I4M G;  1HNW L;  4ZKB B;  4KV6 A;  4JG2 A;  4KHV A;  1CK1 A;  4BY1 B;  3MXU A;  4BBR B;  1WTP A;  3WOE A;  1FD7 D;  2IW3 A;  3ERO A;  1C8C A;  3KF6 B;  1S5B D;  1L1O A;  1I6H B;  2F3V A;  1E2Z A;  5LMU L;  4X64 L;  5CBA E;  3BYY B;  1KTK A;  1EU4 A;  1VQP A;  3CCJ A;  2R7F A;  4P2C B;  3F2U A;  3CPW A;  1JT8 A;  2LXK A;  1SJE D;  4OWX B;  3RMH A;  4A3C G;  1PH6 A;  3LX0 A;  2LY7 A;  1SNQ A;  2L11 A;  3BDL A;  5KGU A;  2Q2H A;  1B70 B;  3HKS A;  3HOW H;  4YCW A;  4G7Z C;  1YJW A;  3A56 A;  3KYH C;  1DD2 A;  1SND A;  3GTG H;  1KLG D;  2EYP A;  1B3Q A;  5M3F B;  3QB3 A;  2L9H A;  1LTT D;  3H6M A;  1EWI A;  5F2D A;  3F1Z A;  2Q8T A;  3JC6 6;  1X3F A;  3NK9 A;  5C44 G;  2PNH A;  1S5C D;  1BF4 A;  4DAM A;  4B3M Q;  1C7Y A;  2JA5 G;  3I4N G;  2Q2U A;  4PV1 C;  1RIP A;  2F0M A;  5EGT A;  3GTL H;  2WAQ E;  4Y52 H;  4LAA A;  4A76 A;  2OTJ A;  2FMM A;  3TS0 A;  2UUB Q;  1TU2 B;  5JPM C;  1Q3L A;  1DCZ A;  3FRP B;  4ALP A;  3OIP A;  4YWK A;  4RGT A;  1BKB A;  2IWH A;  2F0I A;  3TQY A;  1L2F A;  4LF6 Q;  4IUQ A;  3TZU A;  4LF4 L;  4C3H B;  2WKD A;  5LL6 X;  2CVR A;  2OQ0 A;  3T1H Q;  2B2U C;  4IPG A;  4K8J A;  1HPC A;  3EFX D;  3NP8 A;  4K0K Q;  4KTA A;  1CQV A;  2MNA A;  1CI3 M;  3SK6 A;  5KND A;  1B9M A;  2WKC A;  1NNX A;  1BVS A;  2KCT A;  3CD6 A;  1V43 A;  1LAC A;  2KA7 A;  1XJV A;  2YYZ A;  4A3M B;  1EY5 A;  1IYJ B;  4L8J A;  4DV5 L;  2L55 A;  2DGY A;  2KHS A;  2EY1 A;  2NN6 I;  1DOL A;  2UXB Q;  1TWC B;  2ZTC A;  5IGB A;  4YHH Q;  4BY1 H;  2E2J B;  4BBR H;  3J81 c;  3M7G A;  4RHS A;  3H91 A;  4L5T A;  1OO9 B;  4M8A A;  1I6H H;  2RHS B;  2C9O A;  4KJO A;  4GN3 B;  2HHH Q;  1Z47 A;  1ET9 A;  4B08 A;  4OWT B;  4IFD G;  3KDF A;  5CV8 A;  5ELB A;  2KJX A;  3TZD A;  1EOT A;  5LMN Q;  3E0J A;  1LT4 D;  1VQF A;  4GLX A;  4KN4 C;  2Z4H A;  5EPK A;  3FKI B;  1M90 C;  4JI7 L;  2F0N A;  5EPJ A;  2MQH A;  1YHQ A;  1S4Z A;  4N8X 1;  4XT3 B;  2EXZ A;  4JBJ A;  2JN4 A;  3GTQ B;  1PFS A;  4RA8 A;  2B2Y A;  2B63 G;  5M3F H;  1Q46 A;  1VQM A;  4BWG B;  4ABN A;  2VUM G;  4Q5V A;  2ZM6 Q;  4A3K G;  2F0E A;  1BUV T;  1TII D;  1U4P A;  4IUN A;  4PMC A;  1SNC A;  2LMC B;  4H13 C;  4UP7 A;  3V96 A;  3S17 B;  1PMR A;  1QVG A;  2NN6 H;  4IN3 A;  4B3M L;  1CFM A;  2F4V Q;  1ZKO A;  3QOJ A;  3UE0 A;  4YCU A;  1I4Q A;  4LFA Q;  2DY7 A;  3MHB A;  3AFP A;  2UUB L;  2YTV A;  2RSN A;  3OW2 A;  4N9P A;  1PFB A;  4GN4 B;  2NUC A;  2Q2I A;  3HKZ G;  2BOS A;  2FHT A;  1JMC A;  1II3 A;  2JXM B;  1X32 A;  5BR8 Q;  5GAH C;  1PZI D;  1XMO L;  3FDT A;  3E9H A;  1KIX A;  2AMC B;  2WB1 B;  2LFN A;  3BU2 A;  4C3H H;  1I94 Q;  5A2Q E;  1A3U A;  1PFM A;  5CMD A;  1TT2 A;  1B44 D;  2QGQ A;  1N8R C;  1TS5 A;  1YIT A;  3TBI B;  1Q1B A;  4F88 A;  4NDX A;  1K9M C;  1EQV A;  1EYC A;  3I8Z A;  2ZT9 C;  5IGE A;  4KY6 A;  1EU3 A;  4ULL A;  4A3M H;  3OWE B;  1CKN A;  3J80 E;  2Z6B A;  3C1E A;  3S15 B;  1TWC H;  4DR1 Q;  3IRB A;  2E2J H;  1KLU D;  1A3T A;  1QUQ B;  1VDZ A;  2K75 A;  3K81 C;  3TDQ A;  2OXP A;  1LAB A;  4JBM A;  2B3G A;  1VQO A;  1VQ6 A;  1V9P A;  1QNK A;  1X55 A;  3N52 A;  4YHH L;  2RDG A;  1A6X A;  1HQR D;  1SYG A;  4C1N I;  2B2U A;  1E1O A;  1GUN A;  4HJ5 A;  5C0X G;  1CA6 A;  2G9D A;  1GUO A;  3ERS X;  3RUZ A;  1VF7 A;  1SYE A;  3HRZ C;  2HHH L;  2E76 C;  2ZJR A;  1JC7 A;  3FKI H;  4C3I B;  5JJZ A;  2B2W C;  1A2T A;  1STH A;  5T1I A;  1SAP A;  2CQO A;  3CMA A;  3Q23 A;  1AEX A;  2NYZ D;  3MXP A;  3GTQ H;  2K04 A;  3I70 A;  3ICE A;  2K01 A;  2O5I C;  4XDX A;  1FL0 A;  3DWA A;  4XYQ A;  4RKL A;  4JBW A;  5JAV A;  1E24 A;  1DXM A;  5GQO A;  2N88 A;  3RZO B;  3K7A B;  3PIO 3;  1EFW A;  4RWS C;  3S17 H;  4ZRZ A;  1JB3 A;  2F0D A;  2Q2T A;  4AYB B;  5JOB A;  4F7X A;  1YNN D;  2NTS A;  4QIW E;  2F0O A;  5J3B A;  1YNN C;  1PVO A;  1WD0 A;  2F4V L;  1VQ8 A;  3G7L A;  1LUZ A;  2I5L X;  1S40 A;  2Z4I A;  1QVC A;  3NHH A;  4LFA L;  1IBM Q;  2FFK B;  1NSN S;  1PTO F;  4ODG A;  4BXX G;  1KAB A;  2B29 A;  1JR0 D;  3J81 j;  1DJR D;  3GQB A;  2FMC A;  4DR7 Q;  1FGU A;  2ES2 A;  1UE5 A;  3D4R A;  2F0F A;  2M9V A;  4ZLT F;  4HAE A;  1Y1V G;  3WDN A;  4RHR A;  1I94 L;  3OOC A;  1HH2 P;  1L0Y B;  2BH8 A;  1EIF A;  1KDA A;  2EXD A;  3R2I A;  1YI2 A;  5JJI A;  1Y8O B;  1STY A;  3SE0 A;  4GZY C;  3NWT A;  2VY3 A;  4DUY L;  1RJT A;  4A3C H;  1FNU A;  2ZJP A;  3TP6 A;  4QY7 A;  4KD4 A;  3ND9 A;  1D5Z C;  3CCS A;  3S15 H;  1E7Z A;  1VQI A;  1RD9 D;  5FLX L;  1VQD A;  1E22 A;  5FO7 B;  4AH6 A;  4L5R C;  2HDM A;  5IYB H;  4DAY B;  3HOX B;  2XGT A;  1EWC A;  3TP7 A;  4KY5 A;  1YEZ A;  4DR1 L;  2EYO A;  4XQQ A;  2EQS A;  2G5D A;  3F8T A;  4A93 G;  2IHE A;  3I91 A;  1M1K C;  2L12 A;  5C4Z A;  5T1G A;  4AYB E;  2D2C C;  4DR6 L;  1BOS A;  3I7F A;  3PUW A;  2CWP A;  1S5F D;  1IL2 A;  1T5E A;  4EQ5 A;  2EVB A;  1IBL Q;  4C3I H;  2GA4 B;  4GNX A;  4JI6 Q;  1Y14 B;  2QEX A;  1EY8 A;  1UEA B;  3MVV A;  4L6T B;  3CCQ A;  1XWE A;  1PYW D;  4CJ1 B;  3S2D B;  1G6Z A;  1DOM A;  1QZG A;  5KEE A;  1X56 A;  1YHB A;  3MXN A;  1PH1 A;  1X3G A;  4JOI C;  4NXN Q;  3ZJY C;  4RMF A;  4KKT A;  1M4V A;  4DNI A;  5IYC G;  3D3R A;  4JI2 Q;  2F03 A;  3CF5 A;  3RZO H;  3K7A H;  3PUX A;  4POG A;  2HDL A;  2WAQ G;  1Q1E A;  1O78 A;  1TXY A;  5IGG A;  4IPC A;  3SEB A;  4X65 Q;  3K80 C;  5IWA Q;  2B2W A;  5FKA C;  2E2I H;  5GAE C;  4BY7 B;  3BVZ A;  3AQQ A;  1RTO A;  3R3O A;  1TWH H;  2R93 G;  4O2D A;  3WWV A;  2NVY B;  1EYA A;  4N8F A;  4I65 A;  1IXR A;  3V05 A;  3S1M B;  3A74 A;  3NQT A;  2V4D A;  4K5W A;  4OHJ A;  1MBY A;  2DUD A;  3J7Z C;  1IBM L;  1EY6 A;  1ENC A;  5HGT A;  1EIG A;  1LT5 D;  5E7N A;  1KDC A;  4CDD C;  1CHQ D;  2IX0 A;  3Q24 A;  4HCS A;  2E74 C;  1GD7 A;  4P75 A;  4A3I G;  4UP8 A;  1EQR A;  3OWF A;  1PHJ A;  4LF9 Q;  1TVX A;  3EBE A;  5M3M B;  4OO1 I;  2VNU D;  1I6V C;  2CH4 A;  1AE3 A;  3ONA B;  1LTG D;  2WFW A;  1XPU A;  4DV4 Q;  2ICE C;  3OTO Q;  1JWM D;  4L63 B;  3SK8 A;  2CW0 D;  2E8G A;  4HTH A;  1PA6 A;  1F9Q A;  2CW0 C;  2HUG A;  3HOX H;  2EZV A;  1EQQ A;  2AQ3 B;  4EVO A;  4P74 A;  5EBD A;  3FMC A;  2B63 H;  1HQM C;  2KCC A;  2UXC L;  1I50 B;  4DR5 Q;  5CV4 A;  3PIO A;  2R92 G;  2PZT A;  4LK1 C;  3E0E A;  3ERQ A;  3RR5 A;  4B3T Q;  2K5W A;  1NUC A;  1HRJ A;  1SNO A;  2K5D A;  2RSO A;  3CU7 A;  1D7Q A;  5IT9 c;  1EL0 A;  2VQF L;  1HCZ A;  1PZJ D;  1W3S A;  4HJ8 A;  3KBG A;  1K73 C;  3CC4 A;  1TWA B;  4GKK Q;  3D6C A;  1MD2 D;  1IW7 D;  1MHW C;  5KIX A;  5EKI A;  3CCL A;  3S2D H;  1IW7 C;  3TRE A;  1IBL L;  4G4K A;  1EQT A;  2UUC Q;  4CBV A;  4B9X A;  1X65 A;  3S16 B;  2O5J C;  3VYR A;  4A3B G;  4NXN L;  1JQY D;  5C4J B;  1PRT F;  1OXU A;  1OXS C;  1Q8K A;  1DYQ A;  1DM0 B;  1OXX K;  2HIV A;  1ENA A;  3HOU G;  4JI2 L;  3A54 A;  3M4P A;  4H0L C;  1FNW A;  1QNU A;  2F0P A;  2ID0 A;  4JV5 Q;  4YWM A;  3EVQ A;  1RHP A;  1Y1V B;  2PCF B;  1B1Z A;  1H95 A;  3DUZ A;  4BY7 H;  5CV9 A;  4C3J G;  2F3W A;  1LLR D;  5D65 A;  3HOY G;  4XQN A;  2ATW A;  5IGD A;  1SEB D;  3T1Y Q;  5IWA L;  2NVY H;  3S2H B;  2XWB B;  3S1M H;  1KL9 A;  4GNX B;  4DK6 C;  4HN7 A;  2BA1 A;  2PQE A;  4FF3 A;  4K5X A;  4QB4 A;  4FXG C;  1GVP A;  3MTS A;  1IKM A;  3NEL A;  4MHE A;  3A5U A;  2B8F A;  5C4X B;  5BN5 A;  4DR4 Q;  2JJQ A;  3C46 A;  2ASB A;  2XN9 C;  2SDF A;  2RCF A;  3QG1 A;  4JW0 A;  5CV7 A;  2ZJQ A;  3CXC A;  5M3M H;  3HOV G;  2WP8 J;  2OQK A;  3MWY W;  2CCZ A;  1PH9 A;  1O7L A;  4A3G G;  3HP3 A;  4HCE A;  4LF9 L;  5I4D A;  4X66 Q;  1R9T B;  3L3O C;  5GAD C;  1CA5 A;  3L9A X;  2VZA A;  5D3I B;  3CCR A;  4DV2 Q;  1YBY A;  5C5M A;  1SXT A;  3K8A A;  3W3A A;  4DV4 L;  3H3V H;  2R7Z B;  3T16 A;  2Y0S E;  1UE7 A;  3UDX A;  4QGU A;  3OTO L;  4A3F B;  4FP5 D;  5BN3 A;  1BDO A;  1F2Z A;  2VB2 X;  1I50 H;  3ND8 A;  5IGF A;  2JSO A;  3A7A B;  3QIA A;  4JI5 Q;  1K3B C;  3KLS A;  3SK4 A;  4U68 A;  1G2T A;  2F0S A;  1OXT A;  2K28 A;  4HIO A;  4B3T L;  1JJG A;  1TWA H;  4K6D A;  4JVZ A;  5M5Y B;  3NSW A;  2B2T C;  1L0X B;  5C3X A;  3PMF A;  2QKI C;  1CUK A;  5M5W H;  3G4S A;  2KBN A;  3WOF A;  4RAU C;  3NTI A;  4GKK L;  4FXK C;  4A3J B;  3S1N B;  2F0H A;  1KAA A;  3S16 H;  2R93 B;  3DHQ A;  3Q22 A;  2KEC A;  1ET6 A;  3AU7 A;  5G3L F;  4OIK A;  5C4J H;  1Z9F A;  4RGM A;  4P72 A;  1LT3 D;  5EKK A;  3E5S A;  3GD7 A;  1HR0 W;  1ILP A;  5C4H A;  4KJN A;  4RGN A;  4DKA C;  2JYO A;  1HFG A;  3P1H A;  4LF5 L;  1Y1V H;  3U9S A;  1MSG A;  1C0A A;  4JV5 L;  2OEO A;  1YNX A;  5C3E B;  5ELF A;  1S3O A;  2QF7 A;  3T56 B;  3S2H H;  4FVM A;  1I5F A;  4R4O A;  4RGO S;  2RVL A;  3EN2 A;  4LUO A;  3K5M A;  1CT1 D;  2JP1 A;  4HSP A;  1QIL A;  4AIM A;  1Y1W B;  3T1Y L;  3I56 A;  4IJL A;  1QUQ A;  4IPD A;  1KQS A;  5FO8 B;  1ASY A;  1HA6 A;  5C4X H;  4FXD A;  5DNF A;  1WOC A;  2ZTE A;  3NPP A;  5I6W A;  2UXD Q;  4DR4 L;  2N3S A;  1K8M A;  3DWP A;  2RCN A;  2O2L D;  3QJY A;  1MI2 A;  1SE3 A;  4QJF A;  3AFQ A;  2EDG A;  5A35 A;  1FVI A;  2MGS A;  1R9T H;  3PO2 B;  3HZX A;  1RDP D;  2HCC A;  3T13 A;  1TWF B;  1X54 A;  4KKS A;  3VYT A;  4X66 L;  4RKB A;  2R7Z H;  5JJL A;  4HJA A;  4A3F H;  2ZXO A;  3DM3 A;  3K59 A;  2FXQ A;  5KRU A;  5JEA G;  4DV2 L;  3CC7 A;  4JI0 Q;  1BBW A;  5COY A;  1XNQ L;  4G7O C;  1R4P B;  5A2Q L;  1B8A A;  2N78 A;  1UE1 A;  5FLM G;  5COR A;  3CKI B;  1TS4 A;  1K8G A;  4JI4 L;  1FJG L;  4LFB Q;  2OTL A;  2IX1 A;  2IPK D;  4FF2 A;  4JI5 L;  3F2C A;  3LNN A;  4DU9 A;  5M5Y H;  1B2T A;  4A3E B;  5I6Y A;  5DAU A;  1HUN A;  2O4X A;  1A3V A;  2CKZ B;  2CFM A;  1KRT A;  3GO5 A;  3PUZ A;  3K58 A;  2L4N A;  4A3J H;  2GVB A;  3J80 L;  3S1N H;  2PPB C;  5CGK A;  3H0G B;  4PQX A;  3C1F A;  2R93 H;  1WTR A;  4JPB W;  1ILQ A;  1UE6 A;  3JAM E;  3H3V C;  2SNM A;  4P71 A;  1SYC A;  2FJ2 A;  1Z6H A;  2J4X A;  1F9S A;  4ID6 A;  2PMZ B;  2PQA A;  1PYB A;  4ZK9 B;  3K5N A;  2VW9 A;  1S72 A;  2F0W A;  1KC8 C;  4OGQ C;  3AB9 A;  2J0T D;  2AUJ D;  3HOZ B;  2DNC A;  5FLX c;  5C3E H;  2B2T A;  2TSS A;  3GTK B;  4TQU S;  4NMZ A;  2SOB A;  4MTN A;  1BXT A;  5KYL A;  1K28 A;  3CHB D;  3QR8 A;  1VQB A;  1Y1W H;  3BS1 A;  3A55 A;  4KKU A;  1AE2 A;  4FF1 A;  3GTO B;  4WFN 3;  1BCP F;  3GTM B;  3MZ5 A;  4DAY A;  1PH7 A;  2RKS A;  2NVX B;  2WIN B;  2A69 D;  2JA7 G;  2A69 C;  2SEB D;  3PIP A;  2HQL A;  5GAG C;  5M5X B;  2UXD L;  3I4M B;  4APV A;  5IP7 G;  4KMU C;  3PO2 H;  1EY7 A;  3DEP A;  1VS0 A;  4LF6 L;  5ELC A;  2F0Q A;  1TWF H;  3T1H L;  1Q81 C;  4JI3 Q;  4OO1 G;  3D4D A;  4K0K L;  4X62 Q;  4K14 A;  4GNX C;  3I3C A;  3KJP A;  4G57 A;  1D6E C;  3VDY A;  3HEJ A;  2MFI A;  1EYG A;  3V2T A;  1EOV A;  1ESR A;  1SE2 A;  1IBK Q;  1LTR D;  1ROD A;  4JI0 L;  4IOC A;  4A3B H;  4MNO A;  2H4O A;  5IE8 A;  4PNY A;  1NMF A;  4A3E H;  1QOH A;  2UXB L;  2KQ3 A;  1QE6 A;  1WYD A;  1EIY B;  1X3E A;  2H1E A;  3SHL A;  3STB D;  3X3N A;  1KRS A;  4LW1 A;  3L7Z C;  5C44 B;  3STB C;  3TN2 A;  2KHJ A;  2Z8L A;  3H0G H;  5H1S E;  3NBH B;  3B6Y A;  4LWC A;  2JEB I;  3AEV A;  1F2Y A;  1NMG A;  3I4N B;  2JA5 B;  2JK8 A;  4K8I A;  3GV3 A;  5LMN L;  1XX8 A;  2RDF A;  1PH5 A;  2OF1 A;  3BZD B;  3VR5 A;  1A0I A;  5CC4 A;  1G8Z D;  1M8A A;  2CQA A;  1N9W A;  1JOR A;  1JOK A;  5C6A A;  2WB1 E;  1K0S A;  3HOZ H;  1JIC A;  2VS1 A;  2YU9 B;  5IYD H;  3CCE A;  2R6G A;  3T53 B;  1JWU D;  2VL6 A;  3GTK H;  4JCV E;  3P7J A;  2ZM6 L;  4YY3 Q;  5I2X A;  2AQ2 B;  1DGS A;  4B3S Q;  3A8I E;  2L15 A;  1F2L A;  2ZTD A;  1PH8 A;  4A3D G;  2EOT A;  4EQN A;  1P8L A;  3DXJ C;  2JQO A;  2XIW A;  1UNS A;  4UHV A;  4CDE C;  3GTO H;  3GTM H;  2E2I B;  1BBU A;  1TS3 A;  2EJM A;  4WOR A;  2Q8R E;  2WII B;  2B8G A;  2XVS A;  1ZYR D;  1TWH B;  2NVX H;  5JVG 3;  1GHK A;  3RZD B;  1HHV A;  2K03 A;  1ZYR C;  4A4I A;  2E2D C;  1VQC A;  2MO1 A;  4RCO A;  2Z9H A;  1HZC A;  3J7A V;  3DM1 A;  1L0W A;  1KDB A;  1NBW A;  1OTC A;  5M5X H;  5K36 H;  4PZ6 A;  3I4M H;  3CP0 A;  2PQA B;  3K5L A;  4EQO A;  5BR8 L;  3NBI A;  2KEN A;  1AW7 A;  1G29 1;  3J81 L;  5EAY A;  3KBX A;  3HOW G;  3BVM A;  4H7B A;  3PUV A;  1SYD A;  2A68 D;  4O0A A;  1HZB A;  4X62 L;  1EWH A;  2A68 C;  1J8I A;  1F9R A;  5EQ0 A;  2YTY A;  1BNZ A;  4A75 A;  4K2K A;  1ENF A;  1V1Q A;  3U50 C;  4DXG A;  1JCK B;  1RTN A;  3M7N A;  1O7I A;  1IBK L;  1PYS B;  3GDE A;  4JK1 C;  5D14 A;  2PZU A;  2B63 B;  2QW7 A;  3UI2 A;  3RD4 A;  3H15 A;  3J7Y W;  1G91 A;  4ME5 A;  4WJ3 M;  4XQJ A;  2VUM B;  5C44 H;  1SNM A;  4A3K B;  1QG7 A;  2F0V A;  1ML0 D;  3I4N H;  2JA5 H;  1U5K A;  3G71 A;  1C9O A;  4DV6 Q;  3FVQ A;  2I07 B;  1G6P A;  4RFB A;  4JI1 Q;  2AQ1 B;  3BG3 A;  1STN A;  1YHA A;  4C1N K;  1EIH A;  4DPG A;  1VQJ A;  2XWJ B;  2J7Z A;  3RNU A;  2XSC A;  2NWG A;  1ZEQ X;  1ICW A;  2YU9 H;  2ENB A;  4R9W A;  1D5X C;  2M00 A;  3E3X A;  1PTO B;  3W2D A;  3HFZ B;  3HKZ B;  2I5M X;  2RA4 A;  2EYJ A;  1LTB D;  2R7D A;  4F8M A;  1UUP A;  3BDO A;  3Q0A A;  4GN5 A;  3R8B A;  4KY7 A;  4QUF A;  5LMN W;  4YY3 L;  1CZG A;  3FP9 A;  4B3S L;  1SR3 A;  1EY0 A;  5IIF A;  2E75 C;  1U4R A;  3C2P A;  2Z0S A;  2K32 A;  4PG3 A;  3RZD H;  4BY1 G;  3NTH A;  1PXU A;  4BBR G;  3J81 E;  1WTQ A;  2EYF A;  3LGJ A;  2F0L A;  5JEA H;  4GKJ Q;  3R2T A;  5IOC A;  5IGC A;  4PZ7 A;  1PH4 A;  1MSH A;  1E3P A;  4Y7N B;  4HED A;  3FHW A;  1BO0 A;  4ILW A;  4WRD A;  3SDZ A;  2IJ0 A;  2A74 C;  2OT2 A;  1NE3 A;  5JJK A;  4DR7 L;  4MN3 A;  1XTD A;  1E1T A;  1LO5 D;  2ICI A;  1H9K A;  3MEH A;  1AZQ A;  1Q82 C;  1FGB D;  2K5Q A;  5IOD A;  3GV6 A;  1HNZ Q;  4IFD H;  1B4O A;  4BBS G;  5M3F G;  1HA5 A;  1Q86 C;  1WVL A;  2HT1 A;  3KOJ A;  3EA6 A;  1H9R A;  2A8V A;  2JA8 G;  1DZ1 A;  1WTV A;  5C5L A;  1X6O A;  1BBX C;  4R4T A;  3OYY A;  2PYK A;  4IQZ A;  2DNE A;  2MP1 A;  4IUP A;  2NTT A;  1JOQ A;  2NN6 G;  3D8G A;  3LWE A;  3D6W A;  2F1M A;  4OX9 Q;  2VUM H;  3UDF A;  3E6Z X;  2R61 A;  3M4Y A;  4OIJ A;  4BS9 A;  2LXJ A;  2Z6K C;  4A3K H;  1O80 A;  1WJJ A;  4KHP Q;  4XIG S;  3G48 A;  1QJO A;  4L5Q A;  4DV1 Q;  5JPN C;  3CCM A;  4TVA B;  4A3D B;  1IL8 A;  2L1B A;  5M5W B;  2L0C A;  3NTK A;  2ZXP A;  4JI6 L;  4DV6 L;  1YVC A;  4DF7 A;  3NUC A;  5GRO A;  1HTL D;  4YCV A;  5CV6 A;  2EYL A;  3FEW X;  1TWG B;  4C3H G;  1NJI C;  2GVA A;  5C0X I;  3IFD A;  4EQP A;  1PTO H;  3A8K E;  4GLA C;  4LNQ A;  1SLJ A;  3PSI A;  3ITP A;  2I0Q A;  2DJG C;  2WAC A;  4DK1 A;  2RDH A;  4IUV A;  1N33 Q;  2AHO B;  4V0B A;  4CKB A;  2QA4 A;  4PZ8 A;  1MJE A;  2B2V A;  3H3V I;  3PGZ A;  2KEE A;  5FO9 B;  1HZA A;  3BJU A;  1O7Z A;  3GTP B;  4LUV A;  3PV0 A;  4CKC A;  1GUW A;  3G6J B;  4UAI A;  1GUG A;  4X65 L;  5CBE E;  2MUY A;  1VQ7 A;  3I90 A;  2Z1C A;  2BCO A;  1TY0 A;  2K14 A;  2JEA I;  3ULJ A;  1VQN A;  4LFC Q;  3MC0 B;  1EYD A;  4Y7N H;  3CCU A;  3J80 c;  1LV9 A;  4GKJ L;  3K5O A;  3TME A;  3I4L A;  1K8A C;  3LWU A;  1J5E Q;  4DN4 M;  3S1Q B;  3QOL A;  4ME3 A;  2HD3 A;  5E4X A;  3FKI G;  2D0P A;  2F0U A;  2UU9 Q;  3ER0 A;  4A93 B;  1NY4 A;  1U0L A;  3KF8 B;  3TEH B;  1WFQ A;  3T51 B;  3DLL A;  5C0X H;  1SYB A;  4J1M A;  2AUK A;  4JBK A;  4CGY B;  4EX5 A;  1I4R A;  1Q90 A;  2ALY B;  2D5D A;  3IKJ A;  1WD1 A;  1HNZ L;  2QEJ C;  1X3Q A;  2M2L A;  4ZUJ A;  2K7V A;  1KNA A;  1SSO A;  5EBC A;  3L0O A;  1GKH A;  4KLK A;  3GP7 A;  1GXD C;  4KD3 A;  1GJX A;  4H44 C;  3I2Z A;  1MJC A;  1E0B A;  4QL5 A;  1D1K A;  1FR3 A;  3NEM A;  2XNA C;  3TS2 A;  3K7U C;  5FJ8 G;  4DR5 L;  4DUZ Q;  1EZ8 A;  1AN8 A;  3PIP 3;  1PRT B;  2UUA Q;  1F77 A;  1N36 Q;  4OX9 L;  2JA9 A;  3W1G A;  1GUS A;  2EYM A;  4K5V A;  1SFO B;  1EY4 A;  2WAQ B;  1ICF B;  1TS2 A;  2F4I A;  3BVG A;  4A3D H;  4KHP L;  1A62 A;  4DV1 L;  5KNB A;  3J7A F;  3M9B A;  4GOP B;  1R4Q B;  3S24 A;  1XPR A;  1NR2 A;  4JI8 Q;  4QQB X;  4NP5 A;  4FDB A;  1RF2 D;  2WB1 G;  3IL8 A;  1TWG H;  2EJF C;  4NW2 A;  2QDB A;  2AWN A;  3X3M A;  4C2M B;  4K2L A;  2UUC L;  1XNR Q;  1Z7T A;  4F87 A;  3I4O A;  1TR5 A;  4H02 A;  3J80 i;  4BXX H;  1CHP D;  1FYC A;  3SK5 A;  2YTX A;  2C5C A;  1PFN A;  2Z6K A;  1HZ9 A;  4FF4 A;  4HMJ A;  1I4X A;  4YWL A;  1D5M C;  1N32 Q;  1WI5 A;  4DV3 Q;  4JI7 Q;  4CDF C;  1YJN A;  4DFA A;  3KJO A;  1N33 L;  3GTP H;  3S1R B;  3QWN A;  1LM0 A;  4A3I B;  1SE8 A; 
#chains in the Genus database with same CATH homology
 3JAM L;  3KUP A;  1ONL A;  3OMC A;  3CQZ B;  5CV5 A;  1V8Q A;  4BBS B;  4KI0 A;  1U9R A;  1H9J A;  2JA8 B;  1PTO D;  4YIJ A;  1PTO C;  1S5E D;  2A5H A;  3A8J E;  4KK7 A;  4C3I G;  2BE5 D;  3C3L A;  1B9N A;  2BE5 C;  3IAY A;  3M3Y B;  2R92 B;  5M9O A;  3SXH A;  3D4W A;  3NBH A;  3QO2 A;  2D62 A;  1HXY D;  5KNC A;  1W6K A;  2IL8 A;  3EJI A;  5IT9 L;  1KNE A;  1W6J A;  3TP5 A;  4C56 C;  4I7Z C;  4FYD A;  4IUU A;  2VXW A;  1QB5 D;  1VMP A;  3U9O A;  3OW7 A;  2K6A A;  2L5T A;  3P75 A;  1AZP A;  1SBB B;  1STB A;  4A3B B;  5LHY 1;  4NKL A;  3HOU B;  1U4M A;  5E1F A;  2SNS A;  1EY9 A;  1GHJ A;  1HTP A;  1J9O A;  4S3S A;  3CRL C;  4C3J B;  1TQO A;  3HOY B;  2EY6 A;  2FIN B;  1STE A;  3MFG A;  4Z9C B;  3IFT A;  4X3U A;  4KHZ A;  4CJ2 C;  5FOB B;  4IAL A;  4CKE A;  5DM7 3;  2IX3 A;  2RQX A;  5EPL A;  3HOV B;  2EPB A;  5KYI A;  3KK7 A;  2JE6 I;  5JEA J;  1I4H A;  2BA0 A;  4A3G B;  1V1O A;  1SDF A;  4G7H C;  5EJW A;  2MHV A;  3H09 A;  4ZYS A;  5IT9 E;  4IUR A;  5CYU A;  1WTO A;  1EEI D;  3MFY A;  3NE5 B;  2A6E D;  2E2H B;  2A6E C;  4IFD J;  3GTJ B;  1NR4 A;  1B3A A;  4U67 3;  1C48 A;  1IYV A;  1H9S A;  3FPP A;  2HQE A;  3EQL C;  4XXE A;  2CHB D;  3S9W A;  1F9P A;  4HMI A;  3SR1 A;  3HGB A;  5K5P A;  1IYU A;  2A73 B;  1XXG A;  4IZ8 A;  1IKL A;  1B50 A;  5CR3 A;  3S14 B;  4QIW B;  3URY A;  2NBF A;  3FPU B;  1K8O A;  4QCL A;  4BA2 I;  2PW7 A;  2A6H D;  2A6H C;  5FK9 C;  1GOZ A;  1SNP A;  4XT1 B;  1PLF A;  1QWY A;  1B53 A;  2LS0 1;  4CHT B;  3KLS X;  2DY8 A;  1A2U A;  3DMU A;  4XYO A;  1BCP B;  4J6H A;  1PRT D;  1XTC D;  3RLF A;  1PRT C;  2EYH A;  5ISR A;  4UDU C;  3DEO A;  1GUT A;  2IT1 A;  1FNV A;  2PO4 A;  1Q8I A;  1Y8N B;  3K0Y A;  5ELE A;  3M4O B;  4DNR B;  5E4W C;  4TSS A;  1F2M A;  3BYT B;  2QCP X;  1JWS D;  5I2Y A;  1LTS D;  1C4Q A;  2XRS D;  1CTM A;  4N9T A;  5D3D A;  1NCV A;  1WTW A;  2KUM A;  5BN4 A;  4V19 0;  2R3Z A;  5C0X J;  1U4L A;  4TRD A;  5ELD A;  1CM9 A;  4OL7 A;  3PO3 B;  1K83 B;  4X3S A;  4R8I A;  5E3F A;  4LJZ C;  4ZQ3 A;  2F0G A;  4DGZ A;  3CRK C;  5DEH A;  2F0K A;  4X3T A;  1Y8P B;  1A15 A;  5J1Z A;  5AFW A;  2PZW A;  2VB3 X;  1PZK D;  2EY2 A;  2BDO A;  2K1B A;  2XRQ D;  4EGV A;  2NVT B;  3TSS A;  1EEF D;  2NVQ B;  4QMG A;  2B2V C;  2K33 A;  5NUC A;  1UAP A;  3PUY A;  3T4A C;  2DN8 A;  2EY5 A;  1V1P A;  4FNF A;  1H9S B;  2HCI A;  5G3L D;  5J39 A;  1VF5 C;  4FO2 A;  4M1U B;  2MJ8 A;  3VA7 A;  4IFD I;  3HG9 A;  3KF8 A;  3MXG A;  2X6G A;  3P20 A;  2JA7 B;  4DA2 A;  3R93 A;  3KLR A;  1JOO A;  1QCB D;  3ZYY X;  1WCM B;  2TMP A;  4Q0F A;  1MGS A;  1NAP A;  2RBM A;  3H94 A;  1I4G A;  4X3K A;  1WTX A;  3BDC A;  1DOK A;  4CJ0 B;  1HUM A;  2PNR C;  2KVM A;  5EKL A;  3OIQ A;  2KED A;  1EZ6 A;  4E6I A;  3VR2 A;  3I73 A;  1RKN A;  1H9M A;  1DON A;  3SVM A;  2ZXR A;  5FLX E;  1EFI D;  2LKV A;  1TY2 A;  1VMC A;  4RH6 A;  5C3W A;  5DM6 3;  1I3Q B;  3VR3 A;  1I4P A;  2BDN A;  1Y69 U;  1YNJ D;  3VR6 A;  1YNJ C;  2X6L A;  3M85 A;  2JA6 B;  1BR9 A;  1ZXT A;  1Q12 A;  4XTC S;  1E2V A;  1S5D D;  3OMG A;  3TP8 A;  4DAV A;  4ZAI A;  2MPM A;  3A7L A;  2B39 A;  2I46 A;  3NQI A;  1D2B A;  3OPO A;  5JVH 3;  4B9W A;  1BQQ T;  4DK0 A;  4O42 A;  4PMW A;  4RCN A;  3VA5 A;  2NB0 A;  1T5X D;  4DAP A;  3AMU A;  2PW5 A;  4DXF A;  1HFN A;  2KOL A;  1CZW A;  1G2S A;  3K6O A;  4TKO B;  2N55 A;  4LMQ D;  2G9H D;  3N6R A;  3HS0 C;  4PMB A;  5I9O A;  4ZKC B;  5LL6 S;  3VYS A;  4O1N A;  4OO1 H;  2Y0S B;  3HOW B;  3DWQ A;  4QF4 A;  1CQF A;  1OXV A;  1X3P A;  2D9U A;  5TSS A;  3GTG B;  1BCP D;  1JE4 A;  1AP0 A;  1BCP C;  1AFP A;  2Q8I B;  1SMY D;  3NXW A;  3Q6S A;  1V1P B;  5I9P A;  1SMY C;  1TKW B;  3D31 A;  1SE4 A;  4HR7 B;  4WJW A;  1PDQ A;  4IUT A;  1D1I A;  2F0T A;  1ESF A;  3GTL B;  5HUR A;  2X69 A;  5J22 A;  2WV6 D;  2KCN A;  2EE1 A;  3NWS A;  3MAQ A;  4ZUI A;  4KN7 C;  2NZ1 D;  1STG A;  2QIL A;  1LT6 D;  2AWO A;  1LTI D;  4BA1 I;  4DNT B;  3VYU A;  3OSO A;  1IHZ A;  1STA A;  4QUC A;  3O13 A;  3K57 A;  1LTA D;  1XYI A;  2F0J A;  4HSV A;  1VCI A;  3VR4 A;  4R8N A;  4K6L A;  1RCV D;  3MA2 B;  4MIU A;  2EJG C;  2K05 A;  1E2W A;  3OHX C;  1O7Y A;  1SJH D;  4J8Q A;  3I72 A;  1SYF A;  5K36 G;  2B2Y C;  4ZKB B;  4KV6 A;  4KHV A;  1CK1 A;  4BY1 B;  3MXU A;  4BBR B;  1WTP A;  3WOE A;  1FD7 D;  2IW3 A;  3ERO A;  1C8C A;  1S5B D;  1I6H B;  2F3V A;  1E2Z A;  5CBA E;  3BYY B;  1KTK A;  1EU4 A;  4P2C B;  3F2U A;  1SJE D;  3RMH A;  3LX0 A;  2LY7 A;  1SNQ A;  2L11 A;  3BDL A;  5KGU A;  4G7Z C;  3A56 A;  1DD2 A;  1SND A;  1KLG D;  2EYP A;  5M3F B;  3QB3 A;  2L9H A;  1LTT D;  3H6M A;  2Q8T A;  5F2D A;  3NK9 A;  1S5C D;  1BF4 A;  4PV1 C;  2F0M A;  5EGT A;  4LAA A;  2FMM A;  1TU2 B;  5JPM C;  1Q3L A;  1DCZ A;  3FRP B;  3OIP A;  4RGT A;  2IWH A;  2F0I A;  4IUQ A;  3TZU A;  4C3H B;  2WKD A;  5LL6 X;  2CVR A;  2B2U C;  4K8J A;  1HPC A;  3EFX D;  3NP8 A;  4KTA A;  1CQV A;  1CI3 M;  3SK6 A;  5KND A;  1B9M A;  2WKC A;  1V43 A;  1LAC A;  2KA7 A;  2YYZ A;  4A3M B;  1EY5 A;  4L8J A;  2L55 A;  2KHS A;  2EY1 A;  2NN6 I;  1DOL A;  1TWC B;  5IGB A;  2E2J B;  3M7G A;  4RHS A;  3H91 A;  1OO9 B;  4M8A A;  2C9O A;  4KJO A;  1Z47 A;  1ET9 A;  4B08 A;  4IFD G;  5CV8 A;  5ELB A;  2KJX A;  3TZD A;  1EOT A;  3E0J A;  1LT4 D;  4KN4 C;  2Z4H A;  5EPK A;  3FKI B;  2F0N A;  5EPJ A;  1S4Z A;  4XT3 B;  2EXZ A;  3GTQ B;  4RA8 A;  2B2Y A;  4BWG B;  4ABN A;  4Q5V A;  2F0E A;  1BUV T;  1TII D;  1U4P A;  4IUN A;  4PMC A;  1SNC A;  2LMC B;  4H13 C;  3V96 A;  3S17 B;  1PMR A;  2NN6 H;  4IN3 A;  1CFM A;  1ZKO A;  3QOJ A;  1I4Q A;  2DY7 A;  3MHB A;  2RSN A;  4N9P A;  1PFB A;  2NUC A;  2BOS A;  2FHT A;  1II3 A;  2JXM B;  1X32 A;  1PZI D;  3FDT A;  2WB1 B;  2LFN A;  5A2Q E;  1A3U A;  1PFM A;  5CMD A;  1TT2 A;  1B44 D;  1TS5 A;  3TBI B;  1Q1B A;  4F88 A;  4NDX A;  1EQV A;  1EYC A;  3I8Z A;  2ZT9 C;  5IGE A;  4KY6 A;  1EU3 A;  4ULL A;  3OWE B;  3J80 E;  3C1E A;  3S15 B;  1KLU D;  1A3T A;  1VDZ A;  3TDQ A;  2OXP A;  1LAB A;  1QNK A;  3N52 A;  2RDG A;  1A6X A;  1HQR D;  1SYG A;  4C1N I;  2B2U A;  1GUN A;  5C0X G;  1CA6 A;  2G9D A;  1GUO A;  3RUZ A;  1VF7 A;  1SYE A;  3HRZ C;  2E76 C;  1JC7 A;  5JJZ A;  4C3I B;  2B2W C;  1A2T A;  1STH A;  5T1I A;  1SAP A;  3Q23 A;  1AEX A;  2NYZ D;  3MXP A;  2K04 A;  3I70 A;  2K01 A;  2O5I C;  4XDX A;  3DWA A;  4XYQ A;  4RKL A;  4JBW A;  5JAV A;  1DXM A;  2N88 A;  3RZO B;  3K7A B;  3PIO 3;  4RWS C;  4ZRZ A;  1JB3 A;  2F0D A;  4AYB B;  5JOB A;  4F7X A;  1YNN D;  2NTS A;  2F0O A;  1YNN C;  1WD0 A;  3G7L A;  2Z4I A;  3NHH A;  2FFK B;  1NSN S;  1PTO F;  4ODG A;  1KAB A;  1JR0 D;  1DJR D;  3GQB A;  2FMC A;  3D4R A;  2F0F A;  2M9V A;  4ZLT F;  4HAE A;  3WDN A;  4RHR A;  3OOC A;  1L0Y B;  1KDA A;  3R2I A;  1Y8O B;  1STY A;  3SE0 A;  4GZY C;  3NWT A;  1RJT A;  1FNU A;  3TP6 A;  4KD4 A;  3ND9 A;  1D5Z C;  1RD9 D;  5FLX L;  5FO7 B;  2HDM A;  3HOX B;  1EWC A;  3TP7 A;  4KY5 A;  2EYO A;  4XQQ A;  3I91 A;  2L12 A;  5C4Z A;  5T1G A;  2D2C C;  1BOS A;  3PUW A;  1S5F D;  1T5E A;  2EVB A;  2GA4 B;  1EY8 A;  1UEA B;  3MVV A;  4L6T B;  1XWE A;  1PYW D;  4CJ1 B;  3S2D B;  1G6Z A;  1DOM A;  5KEE A;  3MXN A;  4KKT A;  1M4V A;  3D3R A;  2F03 A;  3PUX A;  2HDL A;  1Q1E A;  1O78 A;  5IGG A;  3SEB A;  2B2W A;  5FKA C;  4BY7 B;  3BVZ A;  1RTO A;  3R3O A;  2NVY B;  1EYA A;  4I65 A;  3V05 A;  3S1M B;  3NQT A;  2V4D A;  4K5W A;  4OHJ A;  1MBY A;  1EY6 A;  1ENC A;  5HGT A;  1EIG A;  1LT5 D;  1KDC A;  1CHQ D;  2IX0 A;  3Q24 A;  4HCS A;  2E74 C;  3OWF A;  1TVX A;  5M3M B;  4OO1 I;  2VNU D;  1I6V C;  3ONA B;  1LTG D;  2ICE C;  1JWM D;  4L63 B;  3SK8 A;  2CW0 D;  4HTH A;  1F9Q A;  2CW0 C;  2HUG A;  2EZV A;  2AQ3 B;  4EVO A;  5EBD A;  3FMC A;  1HQM C;  2KCC A;  1I50 B;  5CV4 A;  2PZT A;  4LK1 C;  3ERQ A;  2K5W A;  1NUC A;  1HRJ A;  1SNO A;  2K5D A;  2RSO A;  3CU7 A;  1EL0 A;  1HCZ A;  1PZJ D;  3KBG A;  1TWA B;  3D6C A;  1MD2 D;  1IW7 D;  5KIX A;  5EKI A;  1IW7 C;  4G4K A;  1EQT A;  4CBV A;  4B9X A;  3S16 B;  2O5J C;  3VYR A;  1JQY D;  5C4J B;  1PRT F;  1OXU A;  1OXS C;  1DYQ A;  1DM0 B;  1OXX K;  1ENA A;  3A54 A;  4H0L C;  1FNW A;  1QNU A;  2F0P A;  2ID0 A;  3EVQ A;  1RHP A;  1Y1V B;  2PCF B;  1B1Z A;  3DUZ A;  5CV9 A;  4C3J G;  2F3W A;  1LLR D;  5D65 A;  4XQN A;  5IGD A;  1SEB D;  3S2H B;  2XWB B;  4HN7 A;  2BA1 A;  2PQE A;  4FF3 A;  4K5X A;  4QB4 A;  4FXG C;  3MTS A;  1IKM A;  4MHE A;  2B8F A;  5C4X B;  5BN5 A;  3C46 A;  2XN9 C;  2SDF A;  3QG1 A;  5CV7 A;  2WP8 J;  3MWY W;  1O7L A;  3HP3 A;  4HCE A;  5I4D A;  1R9T B;  3L3O C;  1CA5 A;  3L9A X;  5D3I B;  5C5M A;  1SXT A;  3W3A A;  2R7Z B;  3T16 A;  4A3F B;  4FP5 D;  5BN3 A;  1BDO A;  1F2Z A;  2VB2 X;  3ND8 A;  5IGF A;  2JSO A;  3A7A B;  3QIA A;  3KLS A;  3SK4 A;  4U68 A;  1G2T A;  2F0S A;  1OXT A;  2K28 A;  4K6D A;  5M5Y B;  3NSW A;  2B2T C;  1L0X B;  5C3X A;  3PMF A;  2QKI C;  3WOF A;  4RAU C;  3NTI A;  4FXK C;  4A3J B;  3S1N B;  2F0H A;  1KAA A;  2R93 B;  3DHQ A;  3Q22 A;  2KEC A;  1ET6 A;  3AU7 A;  5G3L F;  4OIK A;  4RGM A;  1LT3 D;  5EKK A;  3E5S A;  3GD7 A;  1ILP A;  5C4H A;  4KJN A;  4RGN A;  2JYO A;  1HFG A;  3P1H A;  3U9S A;  1MSG A;  2OEO A;  5C3E B;  5ELF A;  2QF7 A;  3T56 B;  4FVM A;  4RGO S;  2RVL A;  3K5M A;  1CT1 D;  2JP1 A;  4HSP A;  1QIL A;  1Y1W B;  5FO8 B;  1HA6 A;  4FXD A;  5DNF A;  3NPP A;  5I6W A;  1K8M A;  3DWP A;  2O2L D;  3QJY A;  1MI2 A;  1SE3 A;  2EDG A;  5A35 A;  2MGS A;  3PO2 B;  3HZX A;  1RDP D;  2HCC A;  3T13 A;  1TWF B;  4KKS A;  3VYT A;  4RKB A;  2ZXO A;  3K59 A;  5KRU A;  5JEA G;  5COY A;  4G7O C;  1R4P B;  5A2Q L;  5COR A;  3CKI B;  1TS4 A;  2IX1 A;  2IPK D;  4FF2 A;  3LNN A;  4DU9 A;  1B2T A;  4A3E B;  5I6Y A;  5DAU A;  1HUN A;  2O4X A;  1A3V A;  3GO5 A;  3PUZ A;  3K58 A;  2L4N A;  3J80 L;  2PPB C;  5CGK A;  3H0G B;  4PQX A;  3C1F A;  1WTR A;  1ILQ A;  3JAM E;  3H3V C;  2SNM A;  1SYC A;  2FJ2 A;  1Z6H A;  2J4X A;  1F9S A;  4ID6 A;  2PMZ B;  4ZK9 B;  3K5N A;  2F0W A;  4OGQ C;  3AB9 A;  2J0T D;  2AUJ D;  3HOZ B;  2DNC A;  2B2T A;  2TSS A;  3GTK B;  4TQU S;  4NMZ A;  2SOB A;  1BXT A;  5KYL A;  3CHB D;  3BS1 A;  3A55 A;  4KKU A;  4FF1 A;  3GTO B;  4WFN 3;  1BCP F;  3GTM B;  3MZ5 A;  4DAY A;  2RKS A;  2NVX B;  2WIN B;  2A69 D;  2A69 C;  2SEB D;  5M5X B;  3I4M B;  4KMU C;  1EY7 A;  3DEP A;  5ELC A;  2F0Q A;  4OO1 G;  3D4D A;  4K14 A;  3I3C A;  4G57 A;  1D6E C;  3HEJ A;  3V2T A;  1ESR A;  1SE2 A;  1LTR D;  1ROD A;  2H4O A;  4PNY A;  1QOH A;  2KQ3 A;  1QE6 A;  2H1E A;  3SHL A;  3X3N A;  3L7Z C;  5C44 B;  3TN2 A;  2Z8L A;  2JEB I;  3I4N B;  1F2Y A;  2JA5 B;  4K8I A;  3GV3 A;  1XX8 A;  2RDF A;  2OF1 A;  3BZD B;  3VR5 A;  5CC4 A;  1G8Z D;  1M8A A;  2CQA A;  1JOR A;  1JOK A;  5C6A A;  1JIC A;  2YU9 B;  2R6G A;  3T53 B;  1JWU D;  3P7J A;  5I2X A;  2AQ2 B;  3A8I E;  1F2L A;  2EOT A;  4EQN A;  3DXJ C;  2XIW A;  1UNS A;  2E2I B;  1TS3 A;  2EJM A;  4WOR A;  2Q8R E;  2WII B;  2B8G A;  2XVS A;  1ZYR D;  1TWH B;  5JVG 3;  1GHK A;  3RZD B;  1HHV A;  2K03 A;  1ZYR C;  2E2D C;  4RCO A;  3J7A V;  3DM1 A;  1KDB A;  5K36 H;  3K5L A;  4EQO A;  3NBI A;  1AW7 A;  1G29 1;  3J81 L;  3KBX A;  3BVM A;  4H7B A;  3PUV A;  1SYD A;  2A68 D;  1EWH A;  2A68 C;  1J8I A;  1F9R A;  5EQ0 A;  1BNZ A;  4K2K A;  1ENF A;  4DXG A;  1JCK B;  1RTN A;  3M7N A;  4JK1 C;  5D14 A;  2PZU A;  2B63 B;  3UI2 A;  3RD4 A;  3J7Y W;  1G91 A;  4ME5 A;  4XQJ A;  2VUM B;  1SNM A;  4A3K B;  1QG7 A;  2F0V A;  1ML0 D;  3FVQ A;  2I07 B;  4RFB A;  2AQ1 B;  3BG3 A;  1STN A;  4C1N K;  1EIH A;  2XWJ B;  2J7Z A;  2XSC A;  2NWG A;  1ZEQ X;  1ICW A;  2ENB A;  4R9W A;  1D5X C;  2M00 A;  1PTO B;  3W2D A;  3HKZ B;  2RA4 A;  2EYJ A;  1LTB D;  4F8M A;  1UUP A;  3BDO A;  3Q0A A;  3R8B A;  4KY7 A;  4QUF A;  1CZG A;  1EY0 A;  5IIF A;  2E75 C;  1U4R A;  3C2P A;  2K32 A;  3NTH A;  1PXU A;  3J81 E;  1WTQ A;  2EYF A;  2F0L A;  5JEA H;  3R2T A;  5IOC A;  5IGC A;  1MSH A;  4Y7N B;  4HED A;  1BO0 A;  4ILW A;  4WRD A;  3SDZ A;  2IJ0 A;  2A74 C;  2OT2 A;  4MN3 A;  1LO5 D;  2ICI A;  1H9K A;  3MEH A;  1AZQ A;  1FGB D;  2K5Q A;  5IOD A;  3GV6 A;  4IFD H;  1B4O A;  1HA5 A;  1WVL A;  3EA6 A;  1H9R A;  1DZ1 A;  1WTV A;  5C5L A;  1BBX C;  2PYK A;  4IQZ A;  2DNE A;  2MP1 A;  4IUP A;  2NTT A;  1JOQ A;  2NN6 G;  3D8G A;  3LWE A;  3D6W A;  2F1M A;  3E6Z X;  2R61 A;  3M4Y A;  4OIJ A;  4BS9 A;  1O80 A;  4XIG S;  1QJO A;  5JPN C;  4A3D B;  1IL8 A;  2L1B A;  5M5W B;  2L0C A;  3NTK A;  2ZXP A;  4DF7 A;  3NUC A;  1HTL D;  5CV6 A;  2EYL A;  3FEW X;  1TWG B;  4C3H G;  5C0X I;  3IFD A;  4EQP A;  1PTO H;  3A8K E;  3ITP A;  2WAC A;  4DK1 A;  2RDH A;  4IUV A;  4V0B A;  4CKB A;  2B2V A;  5FO9 B;  2KEE A;  1O7Z A;  3GTP B;  3PV0 A;  4CKC A;  1GUW A;  3G6J B;  4UAI A;  1GUG A;  5CBE E;  2MUY A;  3I90 A;  2Z1C A;  2BCO A;  1TY0 A;  2JEA I;  3MC0 B;  1EYD A;  1LV9 A;  3K5O A;  3TME A;  3I4L A;  3LWU A;  4DN4 M;  3S1Q B;  3QOL A;  5E4X A;  2F0U A;  4A93 B;  3T51 B;  5C0X H;  1SYB A;  4J1M A;  2AUK A;  4CGY B;  1I4R A;  1Q90 A;  2D5D A;  3IKJ A;  1WD1 A;  2QEJ C;  1X3Q A;  2M2L A;  4ZUJ A;  2K7V A;  1KNA A;  1SSO A;  5EBC A;  3GP7 A;  1GXD C;  4KD3 A;  1GJX A;  4H44 C;  1E0B A;  1D1K A;  1FR3 A;  2XNA C;  1EZ8 A;  1AN8 A;  3PIP 3;  1PRT B;  1F77 A;  1GUS A;  2EYM A;  4K5V A;  1SFO B;  1EY4 A;  2WAQ B;  1TS2 A;  2F4I A;  3BVG A;  5KNB A;  3J7A F;  1R4Q B;  1NR2 A;  4NP5 A;  1RF2 D;  3IL8 A;  2EJF C;  4NW2 A;  2QDB A;  2AWN A;  3X3M A;  4C2M B;  4K2L A;  1Z7T A;  4F87 A;  1TR5 A;  1CHP D;  1FYC A;  3SK5 A;  2C5C A;  1PFN A;  4FF4 A;  4HMJ A;  1I4X A;  1D5M C;  4DFA A;  3S1R B;  3QWN A;  4A3I B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...