3TZDA

Crystal structure of the complex of human chromobox homolog 3 (cbx3)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
58
structure length
58
Chain Sequence
b'LYFQGEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromobox protein homolog 3
molecule tags Transcription/dna binding protein
source organism Homo sapiens
publication title Structural basis of the chromodomain of Cbx3 bound to methylated peptides from histone h1 and G9a.
pubmed doi rcsb
total genus 12
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2011-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3tzdA00
5D65A 1E0BA 1G2TA 3SVMA 4ZKBB 3R93A 5T1GA 2BDNA 2FFKB 2KECA 5CORA 1C8CA 4ZK9B 1F9RA 3P7JA 2R3ZA 2VXWA 5EJWA 4HEDA 1WD1A 2B2YA 4X3UA 5AFWA 1EL0A 1M8AA 3KBXA 2K03A 1QG7A 4X3TA 2HCIA 5JJZA 1U4MA 2HCCA 5E4WC 3IL8A 3FPUB 1QNKA 4MHEA 1RHPA 2FJ2A 1HUMA 2HUGA 2Q8TA 1B3AA 2K01A 1O7ZA 2KOLA 1BF4A 2HDLA 5D14A 1WD0A 4R9WA 1DOKA 2DY8A 1VMPA 2EOTA 4RAUC 3QO2A 2L11A 4XT3B 3FDTA 1B2TA 2EPBA 1O80A 4HCSA 2NYZD 3I3CA 2L9HA 1NCVA 1U4PA 1MSGA 2FINB 3UI2A 1MI2A 5EPLA 1F9PA 5EQ0A 1CA6A 1F9SA 4XT1B 2X6LA 1LV9A 4X3KA 2FMMA 2JYOA 3DEPA 1WTQA 5T1IA 1RODA 1X3PA 3I8ZA 5EPKA 3DEOA 4CJ1B 4IURA 1AZPA 1DZ1A 1G91A 1XX8A 1B53A 1AP0A 3GV6A 1PFNA 3F2UA 3Q6SA 2CVRA 4ZKCB 1TVXA 4ZAIA 1KNAA 1ESRA 4LMQD 1WTRA 1HHVA 3IFDA 1PFMA 1QE6A 1ILPA 2HDMA 2H1EA 1SAPA 4UAIA 3N52A 1WTPA 4CJ2C 1CM9A 1Q3LA 1IL8A 1IKMA 1KNEA 3GV3A 4IUUA 1B4OA 4OIKA 4IUVA 1RJTA 2B2WA 1DOLA 2SDFA 1BO0A 1A15A 1WTWA 2B2TA 1MGSA 1SSOA 1HA6A 1X3QA 1ILQA 1J9OA 1U4RA 1XYIA 2D9UA 4RWSC 1WVLA 1PFBA 1MSHA 1G6ZA 3TZDA 3G7LA 4IUQA 2B2VC 5EKIA 3D6WA 2K28A 1J8IA 1U4LA 4HAEA 4ZLTF 4XDXA 1NR2A 2N55A 2XIWA 5CBEE 2J7ZA 3LWEA 2KEDA 2JP1A 4O42A 1DONA 3KUPA 1PDQA 2K1BA 4MN3A 1B50A 3DM1A 1VMCA 2B2WC 1F2LA 3I91A 2B2UA 2L1BA 2B2TC 4RA8A 5CBAE 1GUWA 2L12A 1RTNA 1DOMA 2K05A 2KEEA 3MTSA 1JICA 2Q8RE 3ONAB 4IUPA 4OIJA 1EIHA 2L4NA 2MGSA 4QUCA 1NR4A 2N88A 2NZ1D 2NWGA 3HP3A 1ZXTA 3I90A 1EIGA 2B2VA 1S4ZA 2X69A 2M2LA 1PLFA 2X6GA 5COYA 4QUFA 2KVMA 1F9QA 1ICWA 2RSOA 1JE4A 4X3SA 2IL8A 2MPMA 4CJ0B 2FHTA 2K04A 1BNZA 1HFGA 1X32A 1ML0D 4HSVA 1EOTA 4DN4M 1HUNA 1IKLA 1RTOA 2B2UC 1O7YA 4U68A 3MWYW 1HRJA 2B2YC 2RA4A 1BBXC 1G2SA 1CA5A 2MJ8A 1WTOA 5CMDA 5EPJA 3H91A 2EE1A 4IUTA 3TN2A 5DNFA 5E4XA 1AZQA 4R8IA 1HFNA 2DY7A 2RSNA 1EQTA 4NW2A 2MP1A 1WTXA 1SDFA 1WTVA 2KUMA 2RVLA 1NAPA
chains in the Genus database with same CATH superfamily
1UEBA 3PIP3 1SYDA 3EVQA 2NB0A 2SNMA 2UXBL 2UUAQ 5AFWA 2NZOA 3UE0A 4B3MQ 3IL8A 2F3WA 3LWUA 4MHEA 1PYWD 1I6HB 4X65Q 5C3EH 2UXDQ 1KXLA 3AB9A 3OW7A 5L37A 4AYBB 2EPBA 5AJ3L 1QUQA 1EY5A 1HQRD 4LUOA 4GNXA 5LL6S 5C3XA 1EZ6A 1NMGA 2NVXB 5FKAC 1Y1WH 4AH6A 1SR3A 4BBSB 2MO0A 2BH2A 4JC0A 3RNUA 1G91A 1G6PA 3GV6A 1K8OA 3F2UA 3NPPA 4K5VA 1ESRA 4DPGA 5HGTA 1QE6A 3K58A 1WCMG 3M7NA 1RDPD 1KNEA 1YNJC 4OIKA 5KYIA 4K0KL 2F0OA 1DOLA 4DV0L 2BDOA 4RMFA 3RR5A 4PZ8A 4KY6A 1IHZA 1QNUA 1WVLA 3GTLH 3G7LA 2KCTA 3PQIA 3HOXG 3D6WA 4DR4L 4IZ8A 5IIFA 3BDLA 1PV4A 3BG3A 3DWPA 3G4SA 5M5YB 2B3GA 3VYRA 5IGFA 4H7BA 2VQEL 5CV5A 3SK6A 1AE3A 5C4XH 3TZUA 3MTSA 5D3IB 2L4NA 5M5WB 1NR4A 5C0XI 5C4XB 2C35B 5COYA 3J80E 2WP8J 1JE4A 1EQRA 1EY8A 1STHA 4J15A 3BVMA 1EWIA 1R9TB 4DNIA 1T5XD 3H09A 1PH6A 1CA5A 5IGGA 1ONLA 4DV7Q 1EYAA 1DXMA 3TN2A 4CGYB 4ZQ3A 4X65L 3KOJA 2UUBL 1NE3A 1NY4A 4JI2L 3NSWA 4UP8A 1NAPA 2G9DA 3CF5A 4LF4L 3RN2A 2KJXA 3R93A 2A69D 3I4NB 2ZTEA 3F2DA 2LMCB 1OXUA 1UE5A 1S5BD 1SXTA 1PTOH 1SYBA 4RGOS 3V96A 2E2HB 3FPUB 2F0HA 5JVG3 1HJPA 4K14A 2Q8TA 4IN3A 4R9WA 2EOTA 2DY8A 3S1RB 1IYVA 4QJFA 2PYKA 1KC8C 1TKWB 1OXVA 1PYSB 2EY2A 4MTNA 4IFDG 3FRPB 4DXFA 3S9WA 1HCZA 1EY7A 4YHHL 1MI2A 1Y8NB 3K6OA 4A3FH 1CA6A 1FYCA 4WRDA 4DXGA 1PH4A 3MFGA 4XT1B 2ZJRA 2NVTB 4LJZC 4R4CA 1EIFA 1A2UA 3L3OC 4XXEA 5IGDA 2R61A 2XRSD 2NN6G 2KHIA 3BYTB 4B3RQ 1SE4A 1CKNA 3PO3H 3HOXB 4A3JB 5CV9A 1VCIA 2NVYB 1BO0A 2XGTA 1Q1EA 3TP7A 4F88A 1K3RA 1PFBA 4LWCA 3CCUA 4LF9L 3NQIA 1K83H 4L6TB 1QZHA 2K28A 4TRDA 5LMNW 4NXML 3TP8A 3LWEA 1C4QA 2HQEA 4XYQA 2O5IC 2LSSA 4HMIA 1SEBD 2B2WC 5HY6A 1HNZL 4KV6A 2K7VA 4A3BB 1E3PA 3OIQA 2K5QA 3RN5A 1HNWQ 2E2IB 3CQZH 2PO4A 1E2VA 1K0RA 3T1HQ 4JI3Q 1BDOA 1HNXL 4RKLA 2PPBC 3S16B 1NMFA 3MEHA 3UDFA 2IL8A 2MPMA 3PUYA 4Y52H 4ZUIA 1KABA 2WFWA 5EAYA 3U58A 4LUZA 2EYFA 3H3VI 1IBLQ 1NSNS 4F8MA 1N9WA 3I55A 5CV8A 3K0XA 1KTKA 2ZM6Q 2R93H 4DK3C 4LAAA 1VQLA 1QWYA 2K5DA 4DR2Q 4JV5Q 2A6HC 2EY5A 4LNQA 3S2HH 2EYMA 1NNXA 1WTVA 1CKOA 3AYHB 4DGZA 3MXUA 1D7QA 4EVOA 2BDNA 3L2PA 5CORA 3CC2A 2LXKA 3HOZB 3TMEA 4O2DA 4RHRA 1ET9A 1MHWC 1HNZQ 3NEMA 4JCVE 4FF3A 2EIFA 3T53B 3J7ZC 1WD0A 3TP5A 2SNSA 1TT2A 1V1OA 3FKIH 4HIKA 3KK7A 2MUYA 2WINB 1NCVA 2FINB 2MHVA 2CQOA 4EQOA 2NN6I 2UUAL 3X3NA 2A74C 5BN4A 4X62L 2IWHA 1VS0A 1QOHA 1H9MA 2UXBQ 4DUZL 3NWSA 4DFAA 1QJOA 1V1PB 4ZAIA 1K9MC 1WTRA 2BE5C 4BBRB 3SK4A 4GKJL 2PW5A 2RF4A 1K28A 2JEAI 1QCBD 1I94L 3J7AV 2JSOA 4LFAL 1AN8A 3T4AC 4IFDI 2AQ1B 1RJTA 2R7ZH 1AFPA 4RH6A 3NQTA 1A15A 2Z1CA 1GM5A 2RBMA 4X62Q 1VQMA 3T1HL 1HA6A 2F0NA 3J80i 3UDXA 1JWMD 1UUPA 4KJNA 3GTPB 3GTPH 3C3LA 3T13A 4Y7NB 2N3SA 4PMCA 1J8IA 1KL9A 4QL5A 4JOIA 2GVAA 3FEWX 3VA7A 4QMGA 4B9WA 4C3IG 4MN3A 4YWKA 3KJPA 1ZKOA 1S72A 2J0TD 4O0AA 1U9RA 4DA2A 1BCPC 1MBYA 1NUCA 3OMGA 4BBRH 4DAYB 1A6XA 2MFIA 2UUCQ 3BJUA 4PV1C 4DUYL 5CGKA 4YCVA 3V05A 3L9AX 1MJEA 4B08A 3I4NH 4A3GH 2EQSA 1QVGA 1P16A 1GO3E 4HTHA 4P75A 3S1QB 3G48A 3MVVA 1L1OB 4CHTB 4U68A 2KCMA 4DV1L 1UE7A 4JBMA 1Q86C 1D5XC 1N36L 2KUMA 2A68C 1G2TA 1VQJA 3HZXA 1Y8PB 1S5CD 4KN4C 4R4OA 1A3TA 2E2DC 1VQPA 1PTOC 3PCOB 5C5MA 3VYTA 1LTBD 5KGUA 1YI2A 4I7ZC 1GXDC 4IPDA 1DM0B 5KYLA 4FDBA 2A1AA 4J8QA 3S2HB 4KKSA 4G7HC 4LF7Q 2AQ2B 1XNRQ 5FJ8H 5E3FA 4C3JB 1O7LA 1NBWA 4DV6Q 2CCZA 1X9NA 1CHPD 2K5HA 3A5UA 1EU3A 2AWNA 1F9PA 1SMXA 5EQ0A 2HHHQ 4K0KQ 4DV4L 2BA1A 3GTMH 1ET6A 4UPAA 1R4PB 5HGQA 5KEEA 4P74A 2UU9L 1AZPA 2A6EC 4ZKCB 3OYYA 1TWHB 2E5LL 3I2ZA 1SAPA 2MNAA 4MZ9A 2B2WA 2VL6A 4A75A 2O4XA 1H9RA 1O78A 5C44H 4ZUJA 3QR8A 5NUCA 4LF8L 1JJCB 1I50B 3KLSA 5IP7G 1F2YA 2NVXH 3OMCA 5IYDH 4OO1G 2KEDA 1PDQA 2B63B 1VQ6A 5EKLA 1JOOA 5LMNQ 2F4VL 2Q8RE 3HP3A 2OCEA 1EIGA 1L0WA 2Q8IB 3I56A 3RLNA 3PO2B 2O5JC 3STBD 1FVIA 4B3TQ 3ITPA 2UXCQ 3ICEA 1IXRA 4JI6Q 4M8AA 1KIXA 1LYLA 5I9OA 2NBFA 5DM73 4XQQA 3U4ZA 1CZWA 4J6HA 1PH8A 3K7AH 4BA2I 1PZID 5CMDA 3CMAA 4IUTA 2ZTCA 5E4XA 3LNNA 3GTQB 2R92B 2F0IA 3H15A 4FXKC 2MP1A 1PTOB 3A74A 1Z47A 1BUVT 1MSHA 3A7AB 2E2HH 4B3SQ 1STNA 3CRLC 4B3TL 1SNPA 1IZ6A 3SVMA 4FF4A 2OF1A 3EA6A 3GTKH 3TP6A 3FPPA 1QZGA 4GLVB 5C0XH 5FLXE 2B2YA 2K03A 1QG7A 4ULLA 4JI8Q 3NUCA 1GUSA 3OPOA 2K50A 4DR1Q 2WACA 1I4QA 3CXCA 3Q8DA 5IP9H 2HDLA 1LTAD 3TDQA 1IBML 5C3WA 4DV5L 4DR3Q 1XPRA 4XT3B 3S14H 1XTDA 3GTKB 4DV2Q 4MNOA 1K3BC 1VQEA 3WOFA 1VQ8A 4IUNA 2QGQA 1JWSD 2QEJC 5JPNC 2NVQB 1E2WA 4IPHA 3L7ZC 4IURA 1V9PA 1AP0A 1BXTA 2OTJA 2K52A 4HJAA 3EQLC 5IGBA 1B3QA 1SMYC 1HHVA 4JOIC 2QEXA 3MFYA 3NP8A 2HDMA 1YIJA 3OTOL 2EYHA 4IUUA 1JOQA 1B4OA 2KHJA 3B6YA 1MJCA 1SNQA 4R4IA 2ZJPA 3V2TA 2B2TA 3PO2G 3RMHA 2GVBA 1MD2D 4JI5Q 2YTYA 3C46A 5DLQE 3A54A 1L0YB 4RCOA 2F1MA 4I65A 1YNND 1PH9A 4XDXA 1HZBA 2N55A 3W1GA 5CBEE 4QGUA 2B63H 4WJ4A 3A8IE 2JP1A 1F2MA 1DONA 3U9SA 2K5WA 2RCNA 5C44G 3DM1A 4BY7G 5JEAG 1SLJA 1D5ZC 2B2UA 2FMCA 3PUWA 2KQ3A 4KHPQ 1RTNA 1DOMA 3HOYH 4LFBL 2A19A 1EIHA 4K6DA 1GJXA 2F0TA 3F1ZA 3D4WA 1KQSA 2VY3A 2M2LA 2JA7G 1PH5A 3GTGH 5JJKA 3HKZB 4K6LA 2FHTA 2PNHA 2AMCB 3O13A 4A3IH 4LF8Q 3S1NH 3MXGA 4R1JA 1GHKA 3I4MG 1IKLA 1LTGD 4HCEA 1BVSA 2B2UC 4BS9A 3BZCA 3I73A 4ILWA 1RL2A 1TR5A 2VZAA 5GADC 2VQFL 4AIMA 2LXJA 3J80c 4P73A 1HTLD 3GTMB 1BQQT 4C1NK 1EQTA 1VQ7A 1TS5A 2ALYB 4GOPB 1AEXA 2DUDA 2WB1G 1VQDA 3M3YH 2F0QA 2HHHL 1T9HA 2ZT9C 4V190 4JI1L 1VQOA 5F2DA 1HH2P 3A5ZB 3UDGA 1CT1D 3AU7A 2JQOA 2L5TA 5FLMH 4QIWB 4LF7L 3RD4A 4DR6Q 3UDIA 2XSCA 4IQZA 1JOKA 1SMYD 4ZCKA 2X6LA 2RDFA 2OT2A 3CP0A 5KNCA 3EJIA 1JT8A 2RQXA 4A93B 5EPKA 4C3IH 3I8ZA 1Q7YC 3MEFA 1J5EQ 2E76C 1RD9D 5M9OA 1KNAA 3Q0AA 4BY1G 2IT1A 4LFCL 5M3FH 1N32L 1EIYB 2KA7A 1YBYA 1Y1WG 1GUNA 4IUVA 4NMZA 2ATWA 4DK0A 1OXSC 1OXXK 1AE2A 2KENA 5A2QE 4A3DB 4JPBW 3HGBA 3AEVA 1E2ZA 2D9UA 2CWAA 1IW7C 2XWBB 4C3HH 1HNXQ 2B2VC 1SN8A 1WJJA 4Q5VA 4C1NI 1HA5A 1EUJA 5GAGC 1SFOB 2EYLA 1SE8A 4TSSA 5G3LF 4P71A 2F52A 4FYDA 2V1CC 1F2LA 5I2XA 2OQ0A 3PO2H 4JI0Q 2KEEA 3D4RA 2I0QA 4LUVA 3TRZA 4LF9Q 2WAQG 3PUVA 2HD3A 4B3SL 2EXDA 4X66L 3IAYA 4LF4Q 1EFWA 1BNZA 1X32A 4JI4L 4HIDA 2YU9B 4UP7A 3STBC 1XMQQ 3MWYW 4JI0L 2ENBA 2WAQE 4A4IA 1HFNA 1GD7A 3MXNA 2WV6D 4KKTA 2F0FA 2XRQD 4KD4A 4WJWA 4OXPA 3F8TA 2YU9H 3FKIB 2RCFA 4A3CH 3CPFA 2PZTA 3RZDB 5FLXL 3SXHA 5I2YA 1EL0A 4GS3A 3T51B 4A3IG 4ME5A 2RDGA 2KOLA 4DAPA 4HJ5A 2QCPX 1PZKD 2L11A 4N9TA 1JJ2A 1TS2A 1YZ6A 2PCFB 1TWAB 2ICIA 4C3JH 1NJIC 4BBRG 1F77A 4JI5L 4LW1A 1WTQA 4C3HB 4XIGS 1FNUA 1X3PA 2ASBA 2XN9C 2EY6A 3OSOA 3H0GB 4DR7L 2DJFC 3OIPA 5M5XB 4A3DG 1A63A 1M90C 4FVMA 1JWUD 3GD7A 3N52A 2B39A 1FJGQ 5IT9c 1CKMA 2RHSB 4C56C 3S16H 2WAQB 2GN5A 1X55A 1JCKB 5FLMG 4C3IB 3CQZB 3I4LA 3CW2C 3ZJYC 5K36H 2NN6H 3K80C 5EKIA 3MZ5A 1SYGA 2Z9HA 4GLXA 1UNSA 3RLOA 3S1QH 5DAUA 4A3GB 5ELBA 1N8RC 2Q2UA 4RA8A 5M5XH 2K05A 4R8NA 1DJRD 3H0GH 1QVFA 5JPMC 4QUCA 2NWGA 3MA2B 3MAQA 3TBIB 4A3JH 3KF6B 4L63B 3PO3B 3SEBA 3MHBA 1TWAH 3CHBD 5FJ8G 3J81L 4JI3L 1V8QA 2H5XA 1W6JA 3A55A 4FNFA 4IFDJ 5ISRA 3C1EA 4DN4M 2OXPA 1VQAA 2WKDA 2I5HA 2JE6I 2OTLA 5C0XG 1HRJA 4DV2L 1UWVA 2MJ8A 2EE1A 5G3LD 4JI4Q 1YITA 3VYSA 2ZXRA 3HS0C 4HSPA 3KLWA 1BCPD 2Z6KC 2RVLA 5D65A 4JI6L 3NTHA 1TWFH 1RCVD 2I5MX 4A3IB 1C8CA 3S1NB 1SE2A 5CV6A 5AJ3Q 3BU2A 2F0LA 4RGTA 3GTGB 3H0GG 1N33L 3BZDB 4GOPC 3E6ZX 3QB3A 3GO5A 1VQNA 1HZAA 4ID6A 4RGNA 3HOYB 2Y0SE 1DOKA 4X6AH 5C4HA 1XNQQ 1VQGA 3QO2A 2LKVA 1MIUA 2AUJD 3CCMA 1HTPA 2BE5D 2HQLA 1VDZA 4ZRZA 3R8BA 4DV0Q 3CC4A 1DGSA 4FXGC 1TXYA 1WI5A 4QF4A 4DNRB 1N34L 3S24A 2N8NA 1N32Q 3T1YL 3GTOB 4A3GG 1LACA 2E2JB 1PFMA 1Y8OB 1WOCA 3A8JE 3BDOA 4UP9A 4EGVA 2H4OA 1DD2A 3NWTA 1HZ9A 1JB3A 2SDFA 1WTWA 3H6MA 2F0DA 3J81i 5M5WH 3PO3G 5BR8Q 1C0AA 1X3QA 2NTSA 2Z4HA 4CDDC 3TZDA 4DR6L 3HOWB 4JI2Q 3S17B 1U4LA 1Q12A 4A3DH 2ID0A 1SNDA 2YTXA 1I4RA 3OWEB 4A3KB 5EKKA 1J5EL 2F3IA 2R6GA 4ALPA 4A3EH 1XMQL 2XVSA 4IOCA 3U4VA 1CHQD 3FP9A 2N88A 1PH3A 3HG9A 3I90A 1V1QA 1EY4A 2A8VA 2E2IH 4JI7L 4A3BH 4H0LC 4OEMB 5ELDA 4APVA 2ICEC 4H44C 4FP5D 1JMCA 5IYCG 1S3OA 2K75A 3QOJA 4PZ6A 4KKUA 1BBXC 1I4HA 5KNBA 4KTAA 5H1SE 1BBUA 1XMOQ 1FGBD 2BH8A 1XNRL 3I4NG 3QIAA 4NW2A 1WTXA 3K7AB 4OL7A 2NVYH 1ENCA 1IL2A 2AUKA 3HOXH 2Z4IA 1TIID 3CAMA 5T1GA 4ZK9B 3NK9A 3CCSA 2R3ZA 4DUYQ 4ZYSA 5C3EB 3NBIA 1M1KC 4L8JA 4X3UA 1GKHA 1LABA 5FO9B 5ELCA 1W2BA 2HCCA 1A0IA 2HUGA 1O7ZA 2NVTH 2OWOA 3CCJA 5LMUL 4EQNA 1Q81C 1X3FA 3K5LA 3EROA 4KY7A 4HCSA 2NYZD 2L9HA 1MSGA 4JV5L 4KHPL 4PMWA 2A6ED 1KD1C 4BY7H 3RUZA 3KYHC 2N78A 5J1ZA 4IPCA 5LMUQ 1BCPB 5C44B 2CVRA 3ULPA 3TS2A 2UXDL 1CZGA 4K5XA 3IFDA 2UUCL 1SYFA 2CW0D 2NTTA 3CPWA 3QJYA 1EU4A 1UAPA 5IGEA 5KIXA 3S2DH 3AFPA 1MKHA 4LF6L 4XTCS 2VUMH 3PSIA 4K8JA 1EY0A 1XYIA 4A3KG 1H95A 4IUQA 2LY7A 3MXNB 5C4ZA 4PNYA 3ND9A 4DKAC 4DR3L 4MTKA 2Z6BA 2JA5B 1Z6HA 4LFCQ 2FXQA 5CC4A 3KDFB 1AH9A 4FO2A 5IY0A 1VMCA 4DUZQ 2A68D 4P2CB 3S17H 4RG1A 4K8IA 1I4PA 1TY2A 1D1KA 1A3VA 4GLAC 3M4OH 2JA7B 1KDCA 3ONAB 1V43A 5IYBH 3E0JA 4OIJA 5J22A 1XWEA 4AQYL 3SR1A 2JA8H 1VF7A 2X69A 2X6GA 4A3MB 2RSOA 1BKBA 2PI2A 2CH4W 1FL0A 3WOEA 2LFNA 3OW2A 2Y0SG 3VA5A 4M1UB 3GTJB 3KF8A 1EEID 1YEZA 2F3VA 4GOPA 1WTOA 2JXMB 1I4GA 3H91A 5KRUA 2WB1B 5DNFA 1AZQA 3HOZG 1CKNB 4XQNA 3W5OA 1SNCA 3S2DB 1CFMA 3IFTA 3K7UC 4ZKBB 3AFQA 2A73B 3D4DA 1F9RA 1NTGA 2E8GA 1LTLA 2B29A 3BZKA 1GVPA 2F0JA 4YHHQ 5K5PA 2QF7A 1STGA 5CR3A 4DU9A 2PNRC 4X3TA 2EZVA 1IBLL 3NTIA 1GUTA 3KDFA 4LFAQ 1BF4A 1HUMA 3GTQH 4C2MH 4DR2L 3HRZC 1Y1WB 5BN3A 5J39A 3BVGA 3K59A 2Z8LA 3JC66 4RAUC 3BS1A 4HMJA 3M9BA 2IX3A 3S15B 1SROA 5K36G 1HZCA 3D8GA 4E6IA 3RZOB 2CW0C 2JA9A 2OEOA 1AW7A 4BY1B 1I6HH 3C2PA 4X3KA 4A76A 5T1IA 1B9NA 3DEOA 2RHQB 3JAME 1B53A 3K57A 1XMOL 3C1FA 3K8AA 2Q2IA 2K4KA 2ZTDA 2A5HA 4HN7A 1F2ZA 2F0GA 3P1HA 2WB1E 4U673 2IHFA 4AYBE 4NDXA 4A3MG 3E9IA 3P20A 5C6AA 1PRTC 4RWSC 1H9SA 2CFMA 5E1FA 4IO9A 3HOVH 4CKCA 2NUCA 4MIUA 3KJOA 5IP7H 1HR0Q 4CKBA 3T1YQ 2VUMG 4KJOA 1E7ZA 4YWLA 2DJGC 1JJGA 4K2KA 2L1BA 2IY5B 4YIJA 5JOBA 3DHQA 5BN5A 2A6HD 3A8KE 3SE0A 4L5TA 2I46A 3JAML 4OWTB 4F7XA 5FLXc 3F2BA 2C9OA 2D2CC 4F87A 4A3EB 3MC0B 5JEAJ 1PRTB 5ELNA 4PZ7A 1PXUA 4S3SA 4A3KH 4HSVA 2VQEQ 1HUNA 2PMZB 1IBMQ 1HR0W 1T5EA 3I7FA 1LT4D 5IOCA 1G2SA 3HOWH 1PTOF 2R7ZG 5EPJA 3J81c 1XJVA 2R93B 1TY0A 5IGCA 2DY7A 4KK7A 3HOUH 4IALA 4P72A 1Q8KA 4KD3A 1SYEA 5GAHC 1E0BA 2P5ZX 3E3XA 5JVH3 2EYOA 1A3UA 3DXJC 3KLRA 3QOLA 1EY9A 1G8ZD 1WFQA 2E2JH 4IOAA 1CK1A 5JJZA 3Q23A 1XNQL 3GTOH 2EYJA 1I6VC 5CYUA 1UE6A 1PRTD 1OTCA 2FJ2A 3RLFA 3ZYYX 1SE3A 2IPKD 2Z6KA 1PRTF 1K73C 3FDTA 1B2TA 5GROA 1N34Q 3LX0A 3UI2A 1JE5A 1SJHD 2IJ0A 3FMCA 1LV9A 3VR6A 1U5KA 2F4IA 2K32A 2VNUD 4JW0A 2CWPA 4GN4B 1A62A 3H94A 4L5RC 1HR0L 1XXGA 1WTPA 1TWFB 4PQXA 4J1MA 2DGYA 1X56A 2KCNA 4Z9CB 1PA6A 1MGSA 3VYUA 3NENA 1G291 3KFUA 1K8MA 2B63G 4DAMA 2L0CA 4BY1H 1H9SB 1N36Q 4YY3Q 4HIOA 1R4QB 3EIVA 3NELA 5IT9E 3RZOH 2J7ZA 5GQOA 2A69C 1CQVA 2R7ZB 1FD7D 3E5SA 4RFBA 1KHIA 3VR3A 1Q82C 4A3LG 2J4XA 1KDAA 1LTSD 4B3ML 4KLKA 2G9HD 4UHVA 4LF5Q 2B2VA 4OWXB 5CV4A 4GZYC 4JBKA 1WYDA 5M3FB 1X54A 3NTKA 4AQYQ 5FO8B 1LO5D 4CBVA 4V0BA 4JBWA 4QB4A 1JB7A 1O7YA 1TWGB 1CTMA 1X3GA 3CRKC 2JA5G 3M4YA 4OONA 3J7AF 4A93H 3PGZA 3I70A 2EYPA 4WFN3 2RSNA 1S40A 1SBBB 4NXNL 3GTJH 1Q90A 4PG3A 1SJED 4TVAB 1VQKA 4DF7A 4JK1C 1EQQA 1K8AC 3PUXA 3HFZB 4EX5A 3HOZH 5E7NA 1ENFA 5I4DA 3NBHB 3DWAA 4LF6Q 3T56B 4X64L 4RHSA 4DV1Q 3EN2A 1S5ED 3BVZA 3CCRA 1LT3D 1RF2D 1J6QA 1EFID 2BOSA 5EGTA 2JA6B 1YHAA 3IRBA 5M5YH 1YNJD 2KBNA 3I3CA 4BA1I 1VQCA 1PH2A 2JA5H 1N33Q 5EPLA 5C0XJ 1F9SA 4H02A 4GN5A 3TSSA 1WTHA 3J7YW 3CMEA 1DZ1A 1XX8A 3K5OA 2AKWB 4HR7B 4LMQD 4DK1A 4G57A 1ASYA 1CI3M 4JI1Q 2H1EA 3AQQA 5IYBG 3LGJA 2JN4A 3CCQA 2JA8G 3S1MH 2YV5A 5TSSA 3VDYA 3TS0A 1SSOA 2Q2TA 2O2LD 3ERQA 3J81j 5M3FG 5LHY1 3HOVB 2E75C 3A0JA 4BY7B 1M4VA 4IPGA 2ZJQA 1FNWA 4ZLTF 3N6RA 4C3HG 4G7OC 1LTRD 1SNOA 3PMFA 2TMPA 2ZM6L 1X65A 3I91A 1LT5D 1PMRA 4TKOB 5IODA 5DEHA 5JAVA 4BXXH 5CBAE 4IJHA 1KLUD 1L1OC 1GUWA 1QILA 2CHBD 3H3VH 2M00A 1EWHA 3PIPA 1TU2B 1EY6A 1S4ZA 3BDCA 2QA4A 3J80L 3VR4A 4OX9Q 3PUZA 2R7DA 4A3FB 4ODGA 3BYYB 1LLRD 1RTOA 4KY5A 1H9JA 1L1OA 3FHWA 1D8LA 2JA6G 2PW7A 3S1RH 1IBKL 1BBWA 1LM0A 2YTVA 1LTID 5JJIA 1SDFA 5IYDG 4QQBX 1E24A 1BOSA 1GUGA 3P7JA 5ELFA 4OGQC 4RGMA 1IYJB 5EJWA 3NBHA 1XPOA 2EY1A 3T16A 2DN8A 1M8AA 3KBXA 1D2BA 2I07B 1U4MA 1IYUA 3QG1A 1B1ZA 3FKIG 3K0YA 1KDBA 4GKJQ 3SK8A 1B3AA 1PYBA 1EYDA 2RKSA 3KF6A 1TS3A 1VQFA 2F03A 4HJ7A 4A93G 1II3A 2QILA 1R9TH 4OWWB 2WKCA 3HOVG 3K81C 5J3BA 3I4MH 4FXDA 1C48A 2FMMA 3ERSX 1D5MC 1GHJA 2JA8B 1PH1A 1QUQB 2L55A 1HNWL 3TQYA 4DAVA 1B44D 5I9PA 2F0UA 2JA7H 3GDEA 3M3YB 1KAAA 4BBSG 4R4QA 4CJ2C 1STYA 1YHQA 1IL8A 1BR9A 4EQPA 1HQMC 4PMBA 1ZYRD 3CCEA 5I6YA 1EZ8A 4JYAL 1W3SA 1J9OA 1CSPA 1VQHA 4K2LA 3W1BA 1G6ZA 1I5FA 3CKIB 3I72A 5C5LA 3E0EA 1STEA 1P8LA 1A8VA 3WDNA 4FF2A 3D6CA 4DR7Q 1JORA 3SGIA 1B70B 2Z0SA 1IBKQ 3KUPA 2TSSA 3A7LA 3M85A 4NP5A 3EFXD 1K8GA 4G7ZC 1LUZA 2B2TC 3SHLA 2AHOB 2IHEA 4A3FG 4HJ8A 2OQKA 3DM3A 4H13C 5M3MG 3ER0A 3U50C 4BBSH 2QDBA 1EYCA 4Q0FA 1E22A 2MQHA 3U9OA 3S1MB 2DNCA 1F9QA 4CJ0B 4HIMA 3GP7A 2K04A 1HPCA 1HFGA 1CSQA 1ML0D 2EDGA 5A35A 3W3AA 4XQJA 1TWHH 2F0MA 5A2QL 1HXYD 4JI8L 4YCUA 5I6WA 4NPSA 4GKKQ 1STAA 2F0SA 3TEHB 1VQBA 2CH4A 2IW3A 2HIVA 4DR4Q 2XWJB 4QIWE 4CDFC 2MO1A 1GOZA 2JA6H 5C4XG 1VF5C 3PIO3 1YNNC 4HEDA 4DR5L 3F2CA 2LS01 4KI0A 2K14A 1FJGL 1K0SA 1QNKA 1RHPA 2ES2A 1SNMA 2PQAA 4KHZA 1ZYRC 2B8FA 2UXCL 1EQVA 1PZJD 1TS4A 3OOCA 1VQIA 5C4JH 3S14B 3HOYG 2AWOA 2B8GA 5BR8L 1Y1VH 3DEPA 4O1NA 3I4OA 4CJ1B 5GAEC 3K5NA 2IX1A 2EJMA 5C3EG 5IT9L 3TREA 4KHVA 1ILPA 3PF4A 4UAIA 1B9MA 1Q3LA 1UE1A 5IWAQ 2DNEA 2CKZB 4QCLA 2R92H 3NHHA 1Z7TA 3R2IA 1W6KA 4OO1H 2D0OA 3E9HA 4OELB 4NXNQ 3HOUG 4N8FA 4HAEA 4L5SA 1L2FA 4WORA 4XYOA 2NZHA 4DV7L 1PHJA 3HKSA 1XPUA 1O7IA 1E1TA 5IWAL 4GNXB 1Y1VG 2K6AA 4IJLA 2CQAA 3G71A 5EBCA 2KHSA 4A3EG 1Y14B 1JICA 1JC7A 1RIPA 1WCMH 1I3QH 1ZXTA 1B7YB 4KN7C 1STBA 4YY3L 3Q24A 4DV6L 2PZUA 3RZDH 3K5MA 3UE1A 1QVCA 4WJ3M 4JYAQ 3M7GA 3QWNA 3DUZA 3CD6A 3J7A5 5KNDA 2B2YC 2RA4A 2ZXOA 4C3JG 3ULJA 2VW9A 3HKZG 1I50H 3DLLA 4AYBG 1YJNA 2D62A 4X66Q 2YYZA 2F0WA 3NXWA 1VQ9A 4DNTB 2FFKB 1JR0D 3D0FA 4OO1I 1PFSA 5M3MH 2R7FA 2C5CA 2WIIB 1EEFD 2HCIA 5E4WC 5D3DA 3ULLA 1TWCB 1IW7D 1I3QB 1WCMB 2V4DA 2K01A 4YWMA 5FOBB 1YHBA 4G4KA 2PQAB 3NE5B 3D31A 1OXTA 5IP9G 1C7YA 4DR1L 1O80A 2UU9Q 4N9PA 3KF8B 3HOUB 1OO9B 1RKNA 4ABNA 1DCZA 4A3LH 2D0PA 4CDEC 3P75A 1PFNA 2QKIC 3Q6SA 3OHXC 1KLGD 5HURA 1C9OA 5DM63 3PF5A 4CDCC 2G5DA 2Q2HA 1EWCA 3G6JB 1FNVA 4POFA 2JK8A 1IKMA 3GV3A 2XNAC 4N8X1 4GNXC 3HOWG 1V1PA 4JBJA 4DV4Q 1TQOA 4DR5Q 4RKBA 2PI2E 1U4RA 3SDZA 1H9KA 3M4QA 4TQUS 3M4PA 1Y1VB 1VQ5A 1UEAB 3D3RA 2K33A 1TWGH 2XIWA 1PTOD 2EJGC 2F0VA 4I7AA 1D1IA 4DV3L 2VQFQ 1Z9FA 4GKKL 2R92G 3AMUA 3PIOA 2VS1A 2D5DA 3R3OA 2I5LX 3A56A 4IUPA 1YJWA 2MGSA 2VB3X 2NZ1D 2F0PA 3R2TA 4YCWA 4NKLA 1PLFA 1X3EA 1G51A 5JJLA 2KVMA 2QW7A 4B9XA 1I4XA 4DAYA 2ZXPA 3H3VC 2HT1A 4UDUC 1LT6D 1EOTA 1KRSA 1S5FD 5EBDA 4ME3A 1FGUA 1YNXA 4Y7NH 1BCPF 4JVZA 2F0KA 1Q8IA 3VR2A 1FR3A 1S5DD 2Y0SB 2EXZA 4R8IA 3CC7A 1ASZA 2PZWA 1B8AA 3JAMi 1EYGA 5FO7B 1TWCH 2BCOA 4KMUC 3KLSX 3S15H 3JAMc 4JI7Q 3DMUA 1EOVA 1QB5D 4OX9L 3WWVA 2VB2X 1KRTA 2M9VA 2KECA 3GQBA 1D6EC 4LFBQ 5M3MB 2N49A 3Q22A 2VXWA 2PMZE 1ENAA 1WD1A 3CCLA 4C2MB 4B3RL 1Y69U 3SK5A 3FVQA 4FF1A 2RDHA 3W2DA 5FK9C 4IFDH 2QDLA 3L0OA 1L0XB 3PV0A 1I94Q 2PQEA 4BWGB 5D14A 1VMPA 4A3JG 5LL6X 5ELOA 3HEJA 1YVCA 4OHJA 2XTIA 1PH7A 1ICFB 2R93G 3G6EA 3ND8A 3CCVA 1U4PA 1GUOA 2GA4B 2SEBD 2F4VQ 4BXXG 5IYCH 3IKJA 3KBGA 2JYOA 1LTTD 5IE8A 1RODA 3OTOQ 1SRUA 1VQ4A 1YJ9A 2HIXA 2F0EA 2K5NA 1TVXA 4K5WA 4QY7A 4DV5Q 4A3BG 1ZEQX 1Q46A 4EQ5A 4DV3Q 2E74C 4JG2A 1CM9A 4LK1C 5CV7A 4A3MH 1ESFA 4DK6C 3VR5A 1E1OA 3URYA 1SFOH 3OWFA 4LF5L 4NXMQ 5JEAH 3X3MA 4R4TA 1ILQA 1SYCA 3DWQA 3M4OB 2NVQH 2UUBQ 2IX0A 5ELEA 3I4MB 3J81E 4GN3B 4UY8C 2E5LQ 3HKZE 1U0LA 4RCNA 1NR2A 4O42A 2K1BA 2K5VA 2KCCA 1B50A 4CKEA 4NB3A 2L12A 3GTLB 1KAWA 3EBEA 2VUMB 3MXPA 1X6OA 1PVOA 4QUFA 1ICWA 4X3SA 2L15A 4POGA 5C4JB 1DYQA 2EVBA 2JJQA 1XTCD 2EJFC 2JEBI 3CU7A 4HJ9A 5LMNL 1Q1BA 1A2TA 4X64Q 1K83B 1CQFA 1CUKA 4L5QA 2AQ3B 1JQYD 4A3CG 2BA0A 2SOBA
chains in the Genus database with same CATH topology
3PIP3 1SYDA 3EVQA 2NB0A 2SNMA 5AFWA 3IL8A 2F3WA 3LWUA 4MHEA 1PYWD 1I6HB 3AB9A 3OW7A 4AYBB 2EPBA 1EY5A 1HQRD 5LL6S 5C3XA 1EZ6A 2NVXB 5FKAC 4BBSB 1G91A 3GV6A 1K8OA 3F2UA 3NPPA 4K5VA 1ESRA 5HGTA 1QE6A 3K58A 3M7NA 1RDPD 1KNEA 1YNJC 4OIKA 5KYIA 2F0OA 1DOLA 2BDOA 4KY6A 1IHZA 1QNUA 1WVLA 3G7LA 3D6WA 4IZ8A 5IIFA 3BDLA 3BG3A 3DWPA 5M5YB 3VYRA 5IGFA 4H7BA 5CV5A 3SK6A 3TZUA 3MTSA 5D3IB 2L4NA 5M5WB 1NR4A 5C0XI 5C4XB 5COYA 3J80E 2WP8J 1JE4A 1EY8A 1STHA 3BVMA 1R9TB 1T5XD 3H09A 1CA5A 5IGGA 1ONLA 1EYAA 1DXMA 3TN2A 4CGYB 4ZQ3A 3NSWA 1NAPA 2G9DA 2KJXA 3R93A 2A69D 3I4NB 2LMCB 1OXUA 1S5BD 1SXTA 1PTOH 1SYBA 4RGOS 3V96A 2E2HB 3FPUB 2F0HA 5JVG3 4K14A 2Q8TA 4IN3A 4R9WA 2EOTA 2DY8A 3S1RB 1IYVA 2PYKA 1TKWB 1OXVA 2EY2A 4IFDG 3FRPB 4DXFA 3S9WA 1HCZA 1EY7A 1MI2A 1Y8NB 3K6OA 1CA6A 1FYCA 4WRDA 4DXGA 3MFGA 4XT1B 2NVTB 4LJZC 1A2UA 3L3OC 4XXEA 5IGDA 2R61A 2XRSD 2NN6G 3BYTB 1SE4A 3HOXB 4A3JB 5CV9A 1VCIA 2NVYB 1BO0A 1Q1EA 3TP7A 4F88A 1PFBA 3NQIA 4L6TB 2K28A 4TRDA 3TP8A 3LWEA 1C4QA 2HQEA 4XYQA 2O5IC 4HMIA 1SEBD 2B2WC 4KV6A 2K7VA 4A3BB 2E2IB 3OIQA 2K5QA 2PO4A 1E2VA 1BDOA 4RKLA 2PPBC 3S16B 3MEHA 2IL8A 2MPMA 3PUYA 4ZUIA 1KABA 2EYFA 1NSNS 4F8MA 5CV8A 1KTKA 4LAAA 1QWYA 2K5DA 2A6HC 2EY5A 2EYMA 1WTVA 4DGZA 3MXUA 4EVOA 2BDNA 5CORA 3HOZB 3TMEA 4RHRA 1ET9A 4FF3A 3T53B 1WD0A 3TP5A 2SNSA 1TT2A 1V1OA 3KK7A 2MUYA 2WINB 1NCVA 2FINB 2MHVA 4EQOA 2NN6I 3X3NA 2A74C 5BN4A 2IWHA 1QOHA 1H9MA 3NWSA 4DFAA 1QJOA 1V1PB 4ZAIA 1WTRA 2BE5C 4BBRB 3SK4A 2PW5A 2JEAI 1QCBD 3J7AV 2JSOA 1AN8A 3T4AC 4IFDI 2AQ1B 1RJTA 1AFPA 4RH6A 3NQTA 1A15A 2Z1CA 2RBMA 1HA6A 2F0NA 1JWMD 1UUPA 4KJNA 3GTPB 3C3LA 3T13A 4Y7NB 4PMCA 1J8IA 3FEWX 3VA7A 4QMGA 4B9WA 4C3IG 4MN3A 1ZKOA 2J0TD 1U9RA 4DA2A 1BCPC 1MBYA 1NUCA 3OMGA 1A6XA 4PV1C 5CGKA 3V05A 3L9AX 4B08A 4HTHA 3S1QB 3MVVA 4CHTB 4U68A 1D5XC 2KUMA 2A68C 1G2TA 1Y8PB 3HZXA 1S5CD 4KN4C 1A3TA 2E2DC 1PTOC 3VYTA 5C5MA 5KGUA 1LTBD 4I7ZC 1GXDC 1DM0B 5KYLA 3S2HB 4J8QA 4KKSA 4G7HC 2AQ2B 5E3FA 4C3JB 1O7LA 1CHPD 1EU3A 2AWNA 1F9PA 5EQ0A 2BA1A 1ET6A 1R4PB 5KEEA 1AZPA 2A6EC 4ZKCB 1TWHB 1SAPA 2B2WA 2O4XA 1H9RA 1O78A 4ZUJA 5NUCA 1I50B 3KLSA 1F2YA 3OMCA 4OO1G 2KEDA 1PDQA 2B63B 5EKLA 1JOOA 2Q8RE 3HP3A 1EIGA 2Q8IB 3PO2B 2O5JC 3ITPA 4M8AA 5I9OA 5DM73 2NBFA 4XQQA 1CZWA 4J6HA 4BA2I 1PZID 5CMDA 4IUTA 5E4XA 3LNNA 3GTQB 2R92B 2F0IA 4FXKC 2MP1A 1PTOB 1Z47A 1MSHA 1BUVT 3A7AB 1STNA 3CRLC 1SNPA 3SVMA 4FF4A 2OF1A 3EA6A 3TP6A 3FPPA 5C0XH 5FLXE 2B2YA 2K03A 1QG7A 4ULLA 3NUCA 1GUSA 3OPOA 2WACA 1I4QA 2HDLA 1LTAD 3TDQA 5C3WA 4XT3B 3GTKB 3WOFA 4IUNA 1JWSD 2QEJC 5JPNC 2NVQB 1E2WA 3L7ZC 4IURA 1AP0A 1BXTA 3EQLC 5IGBA 1SMYC 1HHVA 3MFYA 3NP8A 2HDMA 2EYHA 4IUUA 1JOQA 1B4OA 1SNQA 3V2TA 2B2TA 3RMHA 1MD2D 3C46A 3A54A 1L0YB 4RCOA 2F1MA 4I65A 1YNND 4XDXA 2N55A 5CBEE 3A8IE 2JP1A 1F2MA 1DONA 3U9SA 2K5WA 3DM1A 5JEAG 1D5ZC 2B2UA 2FMCA 3PUWA 2KQ3A 1RTNA 1DOMA 1EIHA 4K6DA 1GJXA 2F0TA 3D4WA 2M2LA 3HKZB 4K6LA 2FHTA 3O13A 3MXGA 1GHKA 1IKLA 1LTGD 4HCEA 2B2UC 4BS9A 3I73A 4ILWA 1TR5A 3GTMB 1HTLD 1BQQT 4C1NK 1EQTA 1TS5A 1AEXA 2F0QA 2ZT9C 4V190 5F2DA 1CT1D 3AU7A 2L5TA 4QIWB 3RD4A 2XSCA 4IQZA 1JOKA 1SMYD 2X6LA 2RDFA 2OT2A 5KNCA 3EJIA 2RQXA 4A93B 5EPKA 3I8ZA 2E76C 1RD9D 5M9OA 1KNAA 3Q0AA 2IT1A 2KA7A 1GUNA 4IUVA 4NMZA 4DK0A 1OXSC 1OXXK 5A2QE 4A3DB 3HGBA 1E2ZA 2D9UA 1IW7C 2XWBB 2B2VC 4Q5VA 4C1NI 1HA5A 1SFOB 2EYLA 5G3LF 4TSSA 4FYDA 1F2LA 5I2XA 2KEEA 3D4RA 3PUVA 3IAYA 1BNZA 1X32A 2YU9B 3MWYW 2ENBA 1HFNA 3MXNA 2WV6D 4KKTA 2F0FA 2XRQD 4KD4A 4WJWA 3FKIB 2PZTA 3RZDB 5FLXL 3SXHA 5I2YA 1EL0A 3T51B 4ME5A 2RDGA 2KOLA 4DAPA 2QCPX 1PZKD 2L11A 4N9TA 1TS2A 2PCFB 1TWAB 2ICIA 1F77A 1WTQA 4C3HB 4XIGS 1FNUA 1X3PA 2XN9C 2EY6A 3OSOA 3H0GB 3OIPA 5M5XB 4FVMA 1JWUD 3GD7A 3N52A 2B39A 4C56C 2WAQB 1JCKB 4C3IB 3CQZB 3I4LA 5K36H 2NN6H 5EKIA 3MZ5A 1SYGA 1UNSA 5DAUA 4A3GB 5ELBA 4RA8A 2K05A 4R8NA 1DJRD 5JPMC 4QUCA 2NWGA 3MA2B 3MAQA 3TBIB 4L63B 3PO3B 3SEBA 3MHBA 3J81L 3CHBD 1V8QA 1W6JA 3A55A 4FNFA 4IFDJ 5ISRA 3C1EA 4DN4M 2OXPA 2WKDA 2JE6I 5C0XG 1HRJA 2MJ8A 2EE1A 5G3LD 3VYSA 2ZXRA 3HS0C 4HSPA 1BCPD 2RVLA 5D65A 3NTHA 1C8CA 4A3IB 1RCVD 3S1NB 1SE2A 5CV6A 3GTGB 2F0LA 4RGTA 3BZDB 3E6ZX 3QB3A 3GO5A 4ID6A 4RGNA 3HOYB 1DOKA 5C4HA 3QO2A 2LKVA 2AUJD 1HTPA 2BE5D 1VDZA 4ZRZA 3R8BA 4FXGC 4QF4A 4DNRB 3GTOB 1LACA 2E2JB 1PFMA 1Y8OB 3A8JE 3BDOA 4EGVA 2H4OA 1DD2A 3NWTA 1JB3A 2SDFA 1WTWA 3H6MA 2F0DA 1X3QA 2NTSA 2Z4HA 3TZDA 3HOWB 3S17B 1U4LA 1Q12A 2ID0A 1SNDA 1I4RA 3OWEB 4A3KB 5EKKA 2R6GA 2XVSA 1CHQD 2N88A 3HG9A 3I90A 1EY4A 4H0LC 5ELDA 2ICEC 4H44C 4FP5D 3QOJA 4KKUA 1BBXC 1I4HA 5KNBA 4KTAA 1FGBD 3QIAA 4NW2A 1WTXA 3K7AB 4OL7A 1ENCA 2AUKA 2Z4IA 1TIID 5T1GA 4ZK9B 3NK9A 2R3ZA 4ZYSA 5C3EB 3NBIA 4L8JA 4X3UA 1LABA 5FO9B 5ELCA 2HCCA 2HUGA 1O7ZA 4EQNA 3K5LA 3EROA 4KY7A 4HCSA 2NYZD 2L9HA 1MSGA 4PMWA 2A6ED 3RUZA 5J1ZA 1BCPB 5C44B 2CVRA 1CZGA 4K5XA 3IFDA 1SYFA 2CW0D 2NTTA 3QJYA 1EU4A 1UAPA 5IGEA 5KIXA 4XTCS 4K8JA 1EY0A 1XYIA 4IUQA 2LY7A 5C4ZA 4PNYA 3ND9A 2JA5B 1Z6HA 5CC4A 4FO2A 1VMCA 2A68D 4P2CB 4K8IA 1I4PA 1TY2A 1A3VA 1D1KA 2JA7B 1KDCA 3ONAB 1V43A 3E0JA 4OIJA 5J22A 1XWEA 3SR1A 1VF7A 2X69A 2X6GA 4A3MB 2RSOA 3WOEA 2LFNA 3VA5A 4M1UB 3GTJB 3KF8A 1EEID 2F3VA 1WTOA 2JXMB 1I4GA 3H91A 5KRUA 2WB1B 5DNFA 1AZQA 4XQNA 1SNCA 3S2DB 1CFMA 3IFTA 4ZKBB 2A73B 3D4DA 1F9RA 2F0JA 5K5PA 2QF7A 1STGA 5CR3A 4DU9A 2PNRC 4X3TA 2EZVA 3NTIA 1GUTA 1BF4A 1HUMA 3HRZC 1Y1WB 5BN3A 5J39A 3BVGA 3K59A 2Z8LA 4RAUC 3BS1A 4HMJA 2IX3A 3S15B 5K36G 3D8GA 4E6IA 3RZOB 2CW0C 2OEOA 1AW7A 4BY1B 3C2PA 4X3KA 5T1IA 1B9NA 3DEOA 3JAME 1B53A 3K57A 3C1FA 2A5HA 4HN7A 1F2ZA 2F0GA 3P1HA 4U673 4NDXA 3P20A 5C6AA 1PRTC 4RWSC 1H9SA 5E1FA 4CKCA 2NUCA 4MIUA 4CKBA 4KJOA 4K2KA 2L1BA 4YIJA 5JOBA 3DHQA 5BN5A 2A6HD 3A8KE 3SE0A 2I46A 3JAML 4F7XA 2C9OA 2D2CC 4F87A 4A3EB 3MC0B 5JEAJ 1PRTB 4S3SA 1PXUA 4HSVA 1HUNA 2PMZB 1T5EA 1LT4D 5IOCA 1G2SA 1PTOF 5EPJA 2R93B 1TY0A 5IGCA 2DY7A 4KK7A 4IALA 4KD3A 1SYEA 1E0BA 5JVH3 2EYOA 1A3UA 3DXJC 3KLRA 3QOLA 1EY9A 1G8ZD 1CK1A 5JJZA 3Q23A 2EYJA 1I6VC 5CYUA 1PRTD 2FJ2A 3RLFA 3ZYYX 1SE3A 2IPKD 1PRTF 3FDTA 1B2TA 3LX0A 3UI2A 1SJHD 2IJ0A 3FMCA 1LV9A 3VR6A 2F4IA 2K32A 2VNUD 3H94A 1XXGA 1WTPA 1TWFB 4PQXA 4J1MA 2KCNA 4Z9CB 1MGSA 3VYUA 1G291 1K8MA 2L0CA 1H9SB 1R4QB 5IT9E 2J7ZA 2A69C 1CQVA 2R7ZB 1FD7D 3E5SA 4RFBA 3VR3A 2J4XA 1KDAA 1LTSD 2G9HD 2B2VA 5CV4A 4GZYC 5M3FB 3NTKA 5FO8B 1LO5D 4CBVA 4V0BA 4JBWA 4QB4A 1TWGB 1O7YA 1CTMA 3CRKC 3M4YA 3J7AF 3I70A 2EYPA 4WFN3 2RSNA 1SBBB 1Q90A 1SJED 4DF7A 4JK1C 3PUXA 1ENFA 5I4DA 3DWAA 3T56B 4RHSA 1S5ED 3BVZA 1LT3D 1RF2D 1EFID 2BOSA 5EGTA 2JA6B 1YNJD 3I3CA 4BA1I 5EPLA 5C0XJ 1F9SA 3TSSA 3J7YW 1DZ1A 1XX8A 3K5OA 4HR7B 4LMQD 4DK1A 4G57A 1CI3M 2H1EA 5TSSA 1SSOA 2O2LD 3ERQA 5LHY1 3HOVB 2E75C 4BY7B 1M4VA 1FNWA 4ZLTF 3N6RA 4C3HG 4G7OC 1LTRD 1SNOA 3PMFA 2TMPA 3I91A 1LT5D 1PMRA 4TKOB 5IODA 5DEHA 5JAVA 5CBAE 1KLUD 1GUWA 1QILA 2CHBD 2M00A 1EWHA 1TU2B 1EY6A 1S4ZA 3BDCA 3J80L 3VR4A 3PUZA 4A3FB 4ODGA 3BYYB 1LLRD 1RTOA 4KY5A 1H9JA 2PW7A 1LTID 1SDFA 1BOSA 1GUGA 3P7JA 5ELFA 4OGQC 4RGMA 5EJWA 3NBHA 2EY1A 3T16A 2DN8A 1M8AA 3KBXA 1D2BA 2I07B 1U4MA 1IYUA 3QG1A 1B1ZA 3K0YA 1KDBA 3SK8A 1B3AA 1EYDA 2RKSA 1TS3A 2F03A 1II3A 2QILA 2WKCA 4FXDA 1C48A 2FMMA 1D5MC 1GHJA 2JA8B 2L55A 4DAVA 1B44D 5I9PA 2F0UA 3M3YB 1KAAA 4CJ2C 1STYA 1IL8A 1BR9A 4EQPA 1HQMC 4PMBA 1ZYRD 5I6YA 1EZ8A 1J9OA 1G6ZA 4K2LA 3CKIB 3I72A 5C5LA 3WDNA 1STEA 4FF2A 3D6CA 1JORA 3KUPA 2TSSA 3A7LA 3M85A 4NP5A 3EFXD 4G7ZC 2B2TC 3SHLA 4H13C 2QDBA 1EYCA 4Q0FA 3U9OA 3S1MB 2DNCA 1F9QA 4CJ0B 3GP7A 2K04A 1HPCA 1HFGA 1ML0D 2EDGA 5A35A 3W3AA 4XQJA 2F0MA 5A2QL 1HXYD 5I6WA 1STAA 2F0SA 2IW3A 2XWJB 1GOZA 1VF5C 3PIO3 1YNNC 4HEDA 2LS01 4KI0A 1QNKA 1RHPA 1SNMA 4KHZA 1ZYRC 2B8FA 1EQVA 1PZJD 1TS4A 3OOCA 3S14B 2AWOA 2B8GA 3DEPA 4O1NA 4CJ1B 3K5NA 2IX1A 2EJMA 5IT9L 4KHVA 1ILPA 4UAIA 1B9MA 1Q3LA 2DNEA 4QCLA 3NHHA 1Z7TA 3R2IA 1W6KA 4OO1H 4HAEA 4WORA 4XYOA 2K6AA 2CQAA 5EBCA 2KHSA 1JICA 1JC7A 1ZXTA 4KN7C 1STBA 3Q24A 2PZUA 3K5MA 3M7GA 3QWNA 3DUZA 5KNDA 2B2YC 2RA4A 2ZXOA 4C3JG 2D62A 2YYZA 2F0WA 3NXWA 4DNTB 2FFKB 1JR0D 4OO1I 2C5CA 2WIIB 1EEFD 2HCIA 5E4WC 5D3DA 1TWCB 1IW7D 1I3QB 1WCMB 2V4DA 2K01A 5FOBB 4G4KA 3NE5B 3D31A 1OXTA 1O80A 4N9PA 3HOUB 1OO9B 1RKNA 4ABNA 1DCZA 3P75A 1PFNA 2QKIC 3Q6SA 3OHXC 1KLGD 5HURA 5DM63 1EWCA 3G6JB 1FNVA 1IKMA 3GV3A 2XNAC 1V1PA 1TQOA 4RKBA 1U4RA 3SDZA 1H9KA 4TQUS 1Y1VB 1UEAB 3D3RA 2K33A 2XIWA 1PTOD 2EJGC 2F0VA 1D1IA 3AMUA 2D5DA 3R3OA 3A56A 4IUPA 2MGSA 2VB3X 2NZ1D 2F0PA 3R2TA 4NKLA 1PLFA 2KVMA 4B9XA 1I4XA 4DAYA 2ZXPA 3H3VC 4UDUC 1LT6D 1EOTA 1S5FD 5EBDA 1BCPF 2F0KA 1Q8IA 3VR2A 1FR3A 1S5DD 2Y0SB 2EXZA 4R8IA 2PZWA 5FO7B 2BCOA 4KMUC 3KLSX 3DMUA 1QB5D 2VB2X 2M9VA 2KECA 3GQBA 1D6EC 5M3MB 3Q22A 2VXWA 1ENAA 1WD1A 4C2MB 1Y69U 3SK5A 3FVQA 4FF1A 2RDHA 3W2DA 5FK9C 4IFDH 3PV0A 1L0XB 2PQEA 4BWGB 5D14A 1VMPA 5LL6X 3HEJA 4OHJA 3ND8A 1U4PA 1GUOA 2GA4B 2SEBD 3IKJA 3KBGA 2JYOA 1LTTD 1RODA 2F0EA 1TVXA 4K5WA 1ZEQX 2E74C 1CM9A 4LK1C 5CV7A 1ESFA 3VR5A 3URYA 3OWFA 5JEAH 3X3MA 1ILQA 1SYCA 3DWQA 3M4OB 2IX0A 5ELEA 3I4MB 3J81E 4RCNA 1NR2A 4O42A 2K1BA 2KCCA 1B50A 4CKEA 2L12A 3GTLB 2VUMB 3MXPA 4QUFA 1ICWA 4X3SA 5C4JB 1DYQA 2EVBA 1XTCD 2EJFC 2JEBI 3CU7A 1Q1BA 1A2TA 1K83B 1CQFA 2AQ3B 1JQYD 2BA0A 2SOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D65 A;  1E0B A;  1G2T A;  3SVM A;  4ZKB B;  3R93 A;  5T1G A;  2BDN A;  2FFK B;  2KEC A;  5COR A;  1C8C A;  4ZK9 B;  1F9R A;  3P7J A;  2R3Z A;  2VXW A;  5EJW A;  4HED A;  1WD1 A;  2B2Y A;  4X3U A;  5AFW A;  1EL0 A;  1M8A A;  3KBX A;  2K03 A;  1QG7 A;  4X3T A;  2HCI A;  5JJZ A;  1U4M A;  2HCC A;  5E4W C;  3IL8 A;  3FPU B;  1QNK A;  4MHE A;  1RHP A;  2FJ2 A;  1HUM A;  2HUG A;  2Q8T A;  1B3A A;  2K01 A;  1O7Z A;  2KOL A;  1BF4 A;  2HDL A;  5D14 A;  1WD0 A;  4R9W A;  1DOK A;  2DY8 A;  1VMP A;  2EOT A;  4RAU C;  3QO2 A;  2L11 A;  4XT3 B;  3FDT A;  1B2T A;  2EPB A;  1O80 A;  4HCS A;  2NYZ D;  3I3C A;  2L9H A;  1NCV A;  1U4P A;  1MSG A;  2FIN B;  3UI2 A;  1MI2 A;  5EPL A;  1F9P A;  5EQ0 A;  1CA6 A;  1F9S A;  4XT1 B;  2X6L A;  1LV9 A;  4X3K A;  2FMM A;  2JYO A;  3DEP A;  1WTQ A;  5T1I A;  1ROD A;  1X3P A;  3I8Z A;  5EPK A;  3DEO A;  4CJ1 B;  4IUR A;  1AZP A;  1DZ1 A;  1G91 A;  1XX8 A;  1B53 A;  1AP0 A;  3GV6 A;  1PFN A;  3F2U A;  3Q6S A;  2CVR A;  4ZKC B;  1TVX A;  4ZAI A;  1KNA A;  1ESR A;  4LMQ D;  1WTR A;  1HHV A;  3IFD A;  1PFM A;  1QE6 A;  1ILP A;  2HDM A;  2H1E A;  1SAP A;  4UAI A;  3N52 A;  1WTP A;  4CJ2 C;  1CM9 A;  1Q3L A;  1IL8 A;  1IKM A;  1KNE A;  3GV3 A;  4IUU A;  1B4O A;  4OIK A;  4IUV A;  1RJT A;  2B2W A;  1DOL A;  2SDF A;  1BO0 A;  1A15 A;  1WTW A;  2B2T A;  1MGS A;  1SSO A;  1HA6 A;  1X3Q A;  1ILQ A;  1J9O A;  1U4R A;  1XYI A;  2D9U A;  4RWS C;  1WVL A;  1PFB A;  1MSH A;  1G6Z A;  3TZD A;  3G7L A;  4IUQ A;  2B2V C;  5EKI A;  3D6W A;  2K28 A;  1J8I A;  1U4L A;  4HAE A;  4ZLT F;  4XDX A;  1NR2 A;  2N55 A;  2XIW A;  5CBE E;  2J7Z A;  3LWE A;  2KED A;  2JP1 A;  4O42 A;  1DON A;  3KUP A;  1PDQ A;  2K1B A;  4MN3 A;  1B50 A;  3DM1 A;  1VMC A;  2B2W C;  1F2L A;  3I91 A;  2B2U A;  2L1B A;  2B2T C;  4RA8 A;  5CBA E;  1GUW A;  2L12 A;  1RTN A;  1DOM A;  2K05 A;  2KEE A;  3MTS A;  1JIC A;  2Q8R E;  3ONA B;  4IUP A;  4OIJ A;  1EIH A;  2L4N A;  2MGS A;  4QUC A;  1NR4 A;  2N88 A;  2NZ1 D;  2NWG A;  3HP3 A;  1ZXT A;  3I90 A;  1EIG A;  2B2V A;  1S4Z A;  2X69 A;  2M2L A;  1PLF A;  2X6G A;  5COY A;  4QUF A;  2KVM A;  1F9Q A;  1ICW A;  2RSO A;  1JE4 A;  4X3S A;  2IL8 A;  2MPM A;  4CJ0 B;  2FHT A;  2K04 A;  1BNZ A;  1HFG A;  1X32 A;  1ML0 D;  4HSV A;  1EOT A;  4DN4 M;  1HUN A;  1IKL A;  1RTO A;  2B2U C;  1O7Y A;  4U68 A;  3MWY W;  1HRJ A;  2B2Y C;  2RA4 A;  1BBX C;  1G2S A;  1CA5 A;  2MJ8 A;  1WTO A;  5CMD A;  5EPJ A;  3H91 A;  2EE1 A;  4IUT A;  3TN2 A;  5DNF A;  5E4X A;  1AZQ A;  4R8I A;  1HFN A;  2DY7 A;  2RSN A;  1EQT A;  4NW2 A;  2MP1 A;  1WTX A;  1SDF A;  1WTV A;  2KUM A;  2RVL A;  1NAP A; 
#chains in the Genus database with same CATH topology
 1UEB A;  3PIP 3;  1SYD A;  3EVQ A;  2NB0 A;  2SNM A;  2UXB L;  2UUA Q;  5AFW A;  2NZO A;  3UE0 A;  4B3M Q;  3IL8 A;  2F3W A;  3LWU A;  4MHE A;  1PYW D;  1I6H B;  4X65 Q;  5C3E H;  2UXD Q;  1KXL A;  3AB9 A;  3OW7 A;  5L37 A;  4AYB B;  2EPB A;  5AJ3 L;  1QUQ A;  1EY5 A;  1HQR D;  4LUO A;  4GNX A;  5LL6 S;  5C3X A;  1EZ6 A;  1NMG A;  2NVX B;  5FKA C;  1Y1W H;  4AH6 A;  1SR3 A;  4BBS B;  2MO0 A;  2BH2 A;  4JC0 A;  3RNU A;  1G91 A;  1G6P A;  3GV6 A;  1K8O A;  3F2U A;  3NPP A;  4K5V A;  1ESR A;  4DPG A;  5HGT A;  1QE6 A;  3K58 A;  1WCM G;  3M7N A;  1RDP D;  1KNE A;  1YNJ C;  4OIK A;  5KYI A;  4K0K L;  2F0O A;  1DOL A;  4DV0 L;  2BDO A;  4RMF A;  3RR5 A;  4PZ8 A;  4KY6 A;  1IHZ A;  1QNU A;  1WVL A;  3GTL H;  3G7L A;  2KCT A;  3PQI A;  3HOX G;  3D6W A;  4DR4 L;  4IZ8 A;  5IIF A;  3BDL A;  1PV4 A;  3BG3 A;  3DWP A;  3G4S A;  5M5Y B;  2B3G A;  3VYR A;  5IGF A;  4H7B A;  2VQE L;  5CV5 A;  3SK6 A;  1AE3 A;  5C4X H;  3TZU A;  3MTS A;  5D3I B;  2L4N A;  5M5W B;  1NR4 A;  5C0X I;  5C4X B;  2C35 B;  5COY A;  3J80 E;  2WP8 J;  1JE4 A;  1EQR A;  1EY8 A;  1STH A;  4J15 A;  3BVM A;  1EWI A;  1R9T B;  4DNI A;  1T5X D;  3H09 A;  1PH6 A;  1CA5 A;  5IGG A;  1ONL A;  4DV7 Q;  1EYA A;  1DXM A;  3TN2 A;  4CGY B;  4ZQ3 A;  4X65 L;  3KOJ A;  2UUB L;  1NE3 A;  1NY4 A;  4JI2 L;  3NSW A;  4UP8 A;  1NAP A;  2G9D A;  3CF5 A;  4LF4 L;  3RN2 A;  2KJX A;  3R93 A;  2A69 D;  3I4N B;  2ZTE A;  3F2D A;  2LMC B;  1OXU A;  1UE5 A;  1S5B D;  1SXT A;  1PTO H;  1SYB A;  4RGO S;  3V96 A;  2E2H B;  3FPU B;  2F0H A;  5JVG 3;  1HJP A;  4K14 A;  2Q8T A;  4IN3 A;  4R9W A;  2EOT A;  2DY8 A;  3S1R B;  1IYV A;  4QJF A;  2PYK A;  1KC8 C;  1TKW B;  1OXV A;  1PYS B;  2EY2 A;  4MTN A;  4IFD G;  3FRP B;  4DXF A;  3S9W A;  1HCZ A;  1EY7 A;  4YHH L;  1MI2 A;  1Y8N B;  3K6O A;  4A3F H;  1CA6 A;  1FYC A;  4WRD A;  4DXG A;  1PH4 A;  3MFG A;  4XT1 B;  2ZJR A;  2NVT B;  4LJZ C;  4R4C A;  1EIF A;  1A2U A;  3L3O C;  4XXE A;  5IGD A;  2R61 A;  2XRS D;  2NN6 G;  2KHI A;  3BYT B;  4B3R Q;  1SE4 A;  1CKN A;  3PO3 H;  3HOX B;  4A3J B;  5CV9 A;  1VCI A;  2NVY B;  1BO0 A;  2XGT A;  1Q1E A;  3TP7 A;  4F88 A;  1K3R A;  1PFB A;  4LWC A;  3CCU A;  4LF9 L;  3NQI A;  1K83 H;  4L6T B;  1QZH A;  2K28 A;  4TRD A;  5LMN W;  4NXM L;  3TP8 A;  3LWE A;  1C4Q A;  2HQE A;  4XYQ A;  2O5I C;  2LSS A;  4HMI A;  1SEB D;  2B2W C;  5HY6 A;  1HNZ L;  4KV6 A;  2K7V A;  4A3B B;  1E3P A;  3OIQ A;  2K5Q A;  3RN5 A;  1HNW Q;  2E2I B;  3CQZ H;  2PO4 A;  1E2V A;  1K0R A;  3T1H Q;  4JI3 Q;  1BDO A;  1HNX L;  4RKL A;  2PPB C;  3S16 B;  1NMF A;  3MEH A;  3UDF A;  2IL8 A;  2MPM A;  3PUY A;  4Y52 H;  4ZUI A;  1KAB A;  2WFW A;  5EAY A;  3U58 A;  4LUZ A;  2EYF A;  3H3V I;  1IBL Q;  1NSN S;  4F8M A;  1N9W A;  3I55 A;  5CV8 A;  3K0X A;  1KTK A;  2ZM6 Q;  2R93 H;  4DK3 C;  4LAA A;  1VQL A;  1QWY A;  2K5D A;  4DR2 Q;  4JV5 Q;  2A6H C;  2EY5 A;  4LNQ A;  3S2H H;  2EYM A;  1NNX A;  1WTV A;  1CKO A;  3AYH B;  4DGZ A;  3MXU A;  1D7Q A;  4EVO A;  2BDN A;  3L2P A;  5COR A;  3CC2 A;  2LXK A;  3HOZ B;  3TME A;  4O2D A;  4RHR A;  1ET9 A;  1MHW C;  1HNZ Q;  3NEM A;  4JCV E;  4FF3 A;  2EIF A;  3T53 B;  3J7Z C;  1WD0 A;  3TP5 A;  2SNS A;  1TT2 A;  1V1O A;  3FKI H;  4HIK A;  3KK7 A;  2MUY A;  2WIN B;  1NCV A;  2FIN B;  2MHV A;  2CQO A;  4EQO A;  2NN6 I;  2UUA L;  3X3N A;  2A74 C;  5BN4 A;  4X62 L;  2IWH A;  1VS0 A;  1QOH A;  1H9M A;  2UXB Q;  4DUZ L;  3NWS A;  4DFA A;  1QJO A;  1V1P B;  4ZAI A;  1K9M C;  1WTR A;  2BE5 C;  4BBR B;  3SK4 A;  4GKJ L;  2PW5 A;  2RF4 A;  1K28 A;  2JEA I;  1QCB D;  1I94 L;  3J7A V;  2JSO A;  4LFA L;  1AN8 A;  3T4A C;  4IFD I;  2AQ1 B;  1RJT A;  2R7Z H;  1AFP A;  4RH6 A;  3NQT A;  1A15 A;  2Z1C A;  1GM5 A;  2RBM A;  4X62 Q;  1VQM A;  3T1H L;  1HA6 A;  2F0N A;  3J80 i;  3UDX A;  1JWM D;  1UUP A;  4KJN A;  3GTP B;  3GTP H;  3C3L A;  3T13 A;  4Y7N B;  2N3S A;  4PMC A;  1J8I A;  1KL9 A;  4QL5 A;  4JOI A;  2GVA A;  3FEW X;  3VA7 A;  4QMG A;  4B9W A;  4C3I G;  4MN3 A;  4YWK A;  3KJP A;  1ZKO A;  1S72 A;  2J0T D;  4O0A A;  1U9R A;  4DA2 A;  1BCP C;  1MBY A;  1NUC A;  3OMG A;  4BBR H;  4DAY B;  1A6X A;  2MFI A;  2UUC Q;  3BJU A;  4PV1 C;  4DUY L;  5CGK A;  4YCV A;  3V05 A;  3L9A X;  1MJE A;  4B08 A;  3I4N H;  4A3G H;  2EQS A;  1QVG A;  1P16 A;  1GO3 E;  4HTH A;  4P75 A;  3S1Q B;  3G48 A;  3MVV A;  1L1O B;  4CHT B;  4U68 A;  2KCM A;  4DV1 L;  1UE7 A;  4JBM A;  1Q86 C;  1D5X C;  1N36 L;  2KUM A;  2A68 C;  1G2T A;  1VQJ A;  3HZX A;  1Y8P B;  1S5C D;  4KN4 C;  4R4O A;  1A3T A;  2E2D C;  1VQP A;  1PTO C;  3PCO B;  5C5M A;  3VYT A;  1LTB D;  5KGU A;  1YI2 A;  4I7Z C;  1GXD C;  4IPD A;  1DM0 B;  5KYL A;  4FDB A;  2A1A A;  4J8Q A;  3S2H B;  4KKS A;  4G7H C;  4LF7 Q;  2AQ2 B;  1XNR Q;  5FJ8 H;  5E3F A;  4C3J B;  1O7L A;  1NBW A;  4DV6 Q;  2CCZ A;  1X9N A;  1CHP D;  2K5H A;  3A5U A;  1EU3 A;  2AWN A;  1F9P A;  1SMX A;  5EQ0 A;  2HHH Q;  4K0K Q;  4DV4 L;  2BA1 A;  3GTM H;  1ET6 A;  4UPA A;  1R4P B;  5HGQ A;  5KEE A;  4P74 A;  2UU9 L;  1AZP A;  2A6E C;  4ZKC B;  3OYY A;  1TWH B;  2E5L L;  3I2Z A;  1SAP A;  2MNA A;  4MZ9 A;  2B2W A;  2VL6 A;  4A75 A;  2O4X A;  1H9R A;  1O78 A;  5C44 H;  4ZUJ A;  3QR8 A;  5NUC A;  4LF8 L;  1JJC B;  1I50 B;  3KLS A;  5IP7 G;  1F2Y A;  2NVX H;  3OMC A;  5IYD H;  4OO1 G;  2KED A;  1PDQ A;  2B63 B;  1VQ6 A;  5EKL A;  1JOO A;  5LMN Q;  2F4V L;  2Q8R E;  3HP3 A;  2OCE A;  1EIG A;  1L0W A;  2Q8I B;  3I56 A;  3RLN A;  3PO2 B;  2O5J C;  3STB D;  1FVI A;  4B3T Q;  3ITP A;  2UXC Q;  3ICE A;  1IXR A;  4JI6 Q;  4M8A A;  1KIX A;  1LYL A;  5I9O A;  2NBF A;  5DM7 3;  4XQQ A;  3U4Z A;  1CZW A;  4J6H A;  1PH8 A;  3K7A H;  4BA2 I;  1PZI D;  5CMD A;  3CMA A;  4IUT A;  2ZTC A;  5E4X A;  3LNN A;  3GTQ B;  2R92 B;  2F0I A;  3H15 A;  4FXK C;  2MP1 A;  1PTO B;  3A74 A;  1Z47 A;  1BUV T;  1MSH A;  3A7A B;  2E2H H;  4B3S Q;  1STN A;  3CRL C;  4B3T L;  1SNP A;  1IZ6 A;  3SVM A;  4FF4 A;  2OF1 A;  3EA6 A;  3GTK H;  3TP6 A;  3FPP A;  1QZG A;  4GLV B;  5C0X H;  5FLX E;  2B2Y A;  2K03 A;  1QG7 A;  4ULL A;  4JI8 Q;  3NUC A;  1GUS A;  3OPO A;  2K50 A;  4DR1 Q;  2WAC A;  1I4Q A;  3CXC A;  3Q8D A;  5IP9 H;  2HDL A;  1LTA D;  3TDQ A;  1IBM L;  5C3W A;  4DV5 L;  4DR3 Q;  1XPR A;  4XT3 B;  3S14 H;  1XTD A;  3GTK B;  4DV2 Q;  4MNO A;  1K3B C;  1VQE A;  3WOF A;  1VQ8 A;  4IUN A;  2QGQ A;  1JWS D;  2QEJ C;  5JPN C;  2NVQ B;  1E2W A;  4IPH A;  3L7Z C;  4IUR A;  1V9P A;  1AP0 A;  1BXT A;  2OTJ A;  2K52 A;  4HJA A;  3EQL C;  5IGB A;  1B3Q A;  1SMY C;  1HHV A;  4JOI C;  2QEX A;  3MFY A;  3NP8 A;  2HDM A;  1YIJ A;  3OTO L;  2EYH A;  4IUU A;  1JOQ A;  1B4O A;  2KHJ A;  3B6Y A;  1MJC A;  1SNQ A;  4R4I A;  2ZJP A;  3V2T A;  2B2T A;  3PO2 G;  3RMH A;  2GVB A;  1MD2 D;  4JI5 Q;  2YTY A;  3C46 A;  5DLQ E;  3A54 A;  1L0Y B;  4RCO A;  2F1M A;  4I65 A;  1YNN D;  1PH9 A;  4XDX A;  1HZB A;  2N55 A;  3W1G A;  5CBE E;  4QGU A;  2B63 H;  4WJ4 A;  3A8I E;  2JP1 A;  1F2M A;  1DON A;  3U9S A;  2K5W A;  2RCN A;  5C44 G;  3DM1 A;  4BY7 G;  5JEA G;  1SLJ A;  1D5Z C;  2B2U A;  2FMC A;  3PUW A;  2KQ3 A;  4KHP Q;  1RTN A;  1DOM A;  3HOY H;  4LFB L;  2A19 A;  1EIH A;  4K6D A;  1GJX A;  2F0T A;  3F1Z A;  3D4W A;  1KQS A;  2VY3 A;  2M2L A;  2JA7 G;  1PH5 A;  3GTG H;  5JJK A;  3HKZ B;  4K6L A;  2FHT A;  2PNH A;  2AMC B;  3O13 A;  4A3I H;  4LF8 Q;  3S1N H;  3MXG A;  4R1J A;  1GHK A;  3I4M G;  1IKL A;  1LTG D;  4HCE A;  1BVS A;  2B2U C;  4BS9 A;  3BZC A;  3I73 A;  4ILW A;  1RL2 A;  1TR5 A;  2VZA A;  5GAD C;  2VQF L;  4AIM A;  2LXJ A;  3J80 c;  4P73 A;  1HTL D;  3GTM B;  1BQQ T;  4C1N K;  1EQT A;  1VQ7 A;  1TS5 A;  2ALY B;  4GOP B;  1AEX A;  2DUD A;  2WB1 G;  1VQD A;  3M3Y H;  2F0Q A;  2HHH L;  1T9H A;  2ZT9 C;  4V19 0;  4JI1 L;  1VQO A;  5F2D A;  1HH2 P;  3A5Z B;  3UDG A;  1CT1 D;  3AU7 A;  2JQO A;  2L5T A;  5FLM H;  4QIW B;  4LF7 L;  3RD4 A;  4DR6 Q;  3UDI A;  2XSC A;  4IQZ A;  1JOK A;  1SMY D;  4ZCK A;  2X6L A;  2RDF A;  2OT2 A;  3CP0 A;  5KNC A;  3EJI A;  1JT8 A;  2RQX A;  4A93 B;  5EPK A;  4C3I H;  3I8Z A;  1Q7Y C;  3MEF A;  1J5E Q;  2E76 C;  1RD9 D;  5M9O A;  1KNA A;  3Q0A A;  4BY1 G;  2IT1 A;  4LFC L;  5M3F H;  1N32 L;  1EIY B;  2KA7 A;  1YBY A;  1Y1W G;  1GUN A;  4IUV A;  4NMZ A;  2ATW A;  4DK0 A;  1OXS C;  1OXX K;  1AE2 A;  2KEN A;  5A2Q E;  4A3D B;  4JPB W;  3HGB A;  3AEV A;  1E2Z A;  2D9U A;  2CWA A;  1IW7 C;  2XWB B;  4C3H H;  1HNX Q;  2B2V C;  1SN8 A;  1WJJ A;  4Q5V A;  4C1N I;  1HA5 A;  1EUJ A;  5GAG C;  1SFO B;  2EYL A;  1SE8 A;  4TSS A;  5G3L F;  4P71 A;  2F52 A;  4FYD A;  2V1C C;  1F2L A;  5I2X A;  2OQ0 A;  3PO2 H;  4JI0 Q;  2KEE A;  3D4R A;  2I0Q A;  4LUV A;  3TRZ A;  4LF9 Q;  2WAQ G;  3PUV A;  2HD3 A;  4B3S L;  2EXD A;  4X66 L;  3IAY A;  4LF4 Q;  1EFW A;  1BNZ A;  1X32 A;  4JI4 L;  4HID A;  2YU9 B;  4UP7 A;  3STB C;  1XMQ Q;  3MWY W;  4JI0 L;  2ENB A;  2WAQ E;  4A4I A;  1HFN A;  1GD7 A;  3MXN A;  2WV6 D;  4KKT A;  2F0F A;  2XRQ D;  4KD4 A;  4WJW A;  4OXP A;  3F8T A;  2YU9 H;  3FKI B;  2RCF A;  4A3C H;  3CPF A;  2PZT A;  3RZD B;  5FLX L;  3SXH A;  5I2Y A;  1EL0 A;  4GS3 A;  3T51 B;  4A3I G;  4ME5 A;  2RDG A;  2KOL A;  4DAP A;  4HJ5 A;  2QCP X;  1PZK D;  2L11 A;  4N9T A;  1JJ2 A;  1TS2 A;  1YZ6 A;  2PCF B;  1TWA B;  2ICI A;  4C3J H;  1NJI C;  4BBR G;  1F77 A;  4JI5 L;  4LW1 A;  1WTQ A;  4C3H B;  4XIG S;  1FNU A;  1X3P A;  2ASB A;  2XN9 C;  2EY6 A;  3OSO A;  3H0G B;  4DR7 L;  2DJF C;  3OIP A;  5M5X B;  4A3D G;  1A63 A;  1M90 C;  4FVM A;  1JWU D;  3GD7 A;  3N52 A;  2B39 A;  1FJG Q;  5IT9 c;  1CKM A;  2RHS B;  4C56 C;  3S16 H;  2WAQ B;  2GN5 A;  1X55 A;  1JCK B;  5FLM G;  4C3I B;  3CQZ B;  3I4L A;  3CW2 C;  3ZJY C;  5K36 H;  2NN6 H;  3K80 C;  5EKI A;  3MZ5 A;  1SYG A;  2Z9H A;  4GLX A;  1UNS A;  3RLO A;  3S1Q H;  5DAU A;  4A3G B;  5ELB A;  1N8R C;  2Q2U A;  4RA8 A;  5M5X H;  2K05 A;  4R8N A;  1DJR D;  3H0G H;  1QVF A;  5JPM C;  4QUC A;  2NWG A;  3MA2 B;  3MAQ A;  3TBI B;  4A3J H;  3KF6 B;  4L63 B;  3PO3 B;  3SEB A;  3MHB A;  1TWA H;  3CHB D;  5FJ8 G;  3J81 L;  4JI3 L;  1V8Q A;  2H5X A;  1W6J A;  3A55 A;  4FNF A;  4IFD J;  5ISR A;  3C1E A;  4DN4 M;  2OXP A;  1VQA A;  2WKD A;  2I5H A;  2JE6 I;  2OTL A;  5C0X G;  1HRJ A;  4DV2 L;  1UWV A;  2MJ8 A;  2EE1 A;  5G3L D;  4JI4 Q;  1YIT A;  3VYS A;  2ZXR A;  3HS0 C;  4HSP A;  3KLW A;  1BCP D;  2Z6K C;  2RVL A;  5D65 A;  4JI6 L;  3NTH A;  1TWF H;  1RCV D;  2I5M X;  4A3I B;  1C8C A;  3S1N B;  1SE2 A;  5CV6 A;  5AJ3 Q;  3BU2 A;  2F0L A;  4RGT A;  3GTG B;  3H0G G;  1N33 L;  3BZD B;  4GOP C;  3E6Z X;  3QB3 A;  3GO5 A;  1VQN A;  1HZA A;  4ID6 A;  4RGN A;  3HOY B;  2Y0S E;  1DOK A;  4X6A H;  5C4H A;  1XNQ Q;  1VQG A;  3QO2 A;  2LKV A;  1MIU A;  2AUJ D;  3CCM A;  1HTP A;  2BE5 D;  2HQL A;  1VDZ A;  4ZRZ A;  3R8B A;  4DV0 Q;  3CC4 A;  1DGS A;  4FXG C;  1TXY A;  1WI5 A;  4QF4 A;  4DNR B;  1N34 L;  3S24 A;  2N8N A;  1N32 Q;  3T1Y L;  3GTO B;  4A3G G;  1LAC A;  2E2J B;  1PFM A;  1Y8O B;  1WOC A;  3A8J E;  3BDO A;  4UP9 A;  4EGV A;  2H4O A;  1DD2 A;  3NWT A;  1HZ9 A;  1JB3 A;  2SDF A;  1WTW A;  3H6M A;  2F0D A;  3J81 i;  5M5W H;  3PO3 G;  5BR8 Q;  1C0A A;  1X3Q A;  2NTS A;  2Z4H A;  4CDD C;  3TZD A;  4DR6 L;  3HOW B;  4JI2 Q;  3S17 B;  1U4L A;  1Q12 A;  4A3D H;  2ID0 A;  1SND A;  2YTX A;  1I4R A;  3OWE B;  4A3K B;  5EKK A;  1J5E L;  2F3I A;  2R6G A;  4ALP A;  4A3E H;  1XMQ L;  2XVS A;  4IOC A;  3U4V A;  1CHQ D;  3FP9 A;  2N88 A;  1PH3 A;  3HG9 A;  3I90 A;  1V1Q A;  1EY4 A;  2A8V A;  2E2I H;  4JI7 L;  4A3B H;  4H0L C;  4OEM B;  5ELD A;  4APV A;  2ICE C;  4H44 C;  4FP5 D;  1JMC A;  5IYC G;  1S3O A;  2K75 A;  3QOJ A;  4PZ6 A;  4KKU A;  1BBX C;  1I4H A;  5KNB A;  4KTA A;  5H1S E;  1BBU A;  1XMO Q;  1FGB D;  2BH8 A;  1XNR L;  3I4N G;  3QIA A;  4NW2 A;  1WTX A;  3K7A B;  4OL7 A;  2NVY H;  1ENC A;  1IL2 A;  2AUK A;  3HOX H;  2Z4I A;  1TII D;  3CAM A;  5T1G A;  4ZK9 B;  3NK9 A;  3CCS A;  2R3Z A;  4DUY Q;  4ZYS A;  5C3E B;  3NBI A;  1M1K C;  4L8J A;  4X3U A;  1GKH A;  1LAB A;  5FO9 B;  5ELC A;  1W2B A;  2HCC A;  1A0I A;  2HUG A;  1O7Z A;  2NVT H;  2OWO A;  3CCJ A;  5LMU L;  4EQN A;  1Q81 C;  1X3F A;  3K5L A;  3ERO A;  4KY7 A;  4HCS A;  2NYZ D;  2L9H A;  1MSG A;  4JV5 L;  4KHP L;  4PMW A;  2A6E D;  1KD1 C;  4BY7 H;  3RUZ A;  3KYH C;  2N78 A;  5J1Z A;  4IPC A;  5LMU Q;  1BCP B;  5C44 B;  2CVR A;  3ULP A;  3TS2 A;  2UXD L;  1CZG A;  4K5X A;  3IFD A;  2UUC L;  1SYF A;  2CW0 D;  2NTT A;  3CPW A;  3QJY A;  1EU4 A;  1UAP A;  5IGE A;  5KIX A;  3S2D H;  3AFP A;  1MKH A;  4LF6 L;  4XTC S;  2VUM H;  3PSI A;  4K8J A;  1EY0 A;  1XYI A;  4A3K G;  1H95 A;  4IUQ A;  2LY7 A;  3MXN B;  5C4Z A;  4PNY A;  3ND9 A;  4DKA C;  4DR3 L;  4MTK A;  2Z6B A;  2JA5 B;  1Z6H A;  4LFC Q;  2FXQ A;  5CC4 A;  3KDF B;  1AH9 A;  4FO2 A;  5IY0 A;  1VMC A;  4DUZ Q;  2A68 D;  4P2C B;  3S17 H;  4RG1 A;  4K8I A;  1I4P A;  1TY2 A;  1D1K A;  1A3V A;  4GLA C;  3M4O H;  2JA7 B;  1KDC A;  3ONA B;  1V43 A;  5IYB H;  3E0J A;  4OIJ A;  5J22 A;  1XWE A;  4AQY L;  3SR1 A;  2JA8 H;  1VF7 A;  2X69 A;  2X6G A;  4A3M B;  2RSO A;  1BKB A;  2PI2 A;  2CH4 W;  1FL0 A;  3WOE A;  2LFN A;  3OW2 A;  2Y0S G;  3VA5 A;  4M1U B;  3GTJ B;  3KF8 A;  1EEI D;  1YEZ A;  2F3V A;  4GOP A;  1WTO A;  2JXM B;  1I4G A;  3H91 A;  5KRU A;  2WB1 B;  5DNF A;  1AZQ A;  3HOZ G;  1CKN B;  4XQN A;  3W5O A;  1SNC A;  3S2D B;  1CFM A;  3IFT A;  3K7U C;  4ZKB B;  3AFQ A;  2A73 B;  3D4D A;  1F9R A;  1NTG A;  2E8G A;  1LTL A;  2B29 A;  3BZK A;  1GVP A;  2F0J A;  4YHH Q;  5K5P A;  2QF7 A;  1STG A;  5CR3 A;  4DU9 A;  2PNR C;  4X3T A;  2EZV A;  1IBL L;  3NTI A;  1GUT A;  3KDF A;  4LFA Q;  1BF4 A;  1HUM A;  3GTQ H;  4C2M H;  4DR2 L;  3HRZ C;  1Y1W B;  5BN3 A;  5J39 A;  3BVG A;  3K59 A;  2Z8L A;  3JC6 6;  4RAU C;  3BS1 A;  4HMJ A;  3M9B A;  2IX3 A;  3S15 B;  1SRO A;  5K36 G;  1HZC A;  3D8G A;  4E6I A;  3RZO B;  2CW0 C;  2JA9 A;  2OEO A;  1AW7 A;  4BY1 B;  1I6H H;  3C2P A;  4X3K A;  4A76 A;  5T1I A;  1B9N A;  3DEO A;  2RHQ B;  3JAM E;  1B53 A;  3K57 A;  1XMO L;  3C1F A;  3K8A A;  2Q2I A;  2K4K A;  2ZTD A;  2A5H A;  4HN7 A;  1F2Z A;  2F0G A;  3P1H A;  2WB1 E;  4U67 3;  2IHF A;  4AYB E;  4NDX A;  4A3M G;  3E9I A;  3P20 A;  5C6A A;  1PRT C;  4RWS C;  1H9S A;  2CFM A;  5E1F A;  4IO9 A;  3HOV H;  4CKC A;  2NUC A;  4MIU A;  3KJO A;  5IP7 H;  1HR0 Q;  4CKB A;  3T1Y Q;  2VUM G;  4KJO A;  1E7Z A;  4YWL A;  2DJG C;  1JJG A;  4K2K A;  2L1B A;  2IY5 B;  4YIJ A;  5JOB A;  3DHQ A;  5BN5 A;  2A6H D;  3A8K E;  3SE0 A;  4L5T A;  2I46 A;  3JAM L;  4OWT B;  4F7X A;  5FLX c;  3F2B A;  2C9O A;  2D2C C;  4F87 A;  4A3E B;  3MC0 B;  5JEA J;  1PRT B;  5ELN A;  4PZ7 A;  1PXU A;  4S3S A;  4A3K H;  4HSV A;  2VQE Q;  1HUN A;  2PMZ B;  1IBM Q;  1HR0 W;  1T5E A;  3I7F A;  1LT4 D;  5IOC A;  1G2S A;  3HOW H;  1PTO F;  2R7Z G;  5EPJ A;  3J81 c;  1XJV A;  2R93 B;  1TY0 A;  5IGC A;  2DY7 A;  4KK7 A;  3HOU H;  4IAL A;  4P72 A;  1Q8K A;  4KD3 A;  1SYE A;  5GAH C;  1E0B A;  2P5Z X;  3E3X A;  5JVH 3;  2EYO A;  1A3U A;  3DXJ C;  3KLR A;  3QOL A;  1EY9 A;  1G8Z D;  1WFQ A;  2E2J H;  4IOA A;  1CK1 A;  5JJZ A;  3Q23 A;  1XNQ L;  3GTO H;  2EYJ A;  1I6V C;  5CYU A;  1UE6 A;  1PRT D;  1OTC A;  2FJ2 A;  3RLF A;  3ZYY X;  1SE3 A;  2IPK D;  2Z6K A;  1PRT F;  1K73 C;  3FDT A;  1B2T A;  5GRO A;  1N34 Q;  3LX0 A;  3UI2 A;  1JE5 A;  1SJH D;  2IJ0 A;  3FMC A;  1LV9 A;  3VR6 A;  1U5K A;  2F4I A;  2K32 A;  2VNU D;  4JW0 A;  2CWP A;  4GN4 B;  1A62 A;  3H94 A;  4L5R C;  1HR0 L;  1XXG A;  1WTP A;  1TWF B;  4PQX A;  4J1M A;  2DGY A;  1X56 A;  2KCN A;  4Z9C B;  1PA6 A;  1MGS A;  3VYU A;  3NEN A;  1G29 1;  3KFU A;  1K8M A;  2B63 G;  4DAM A;  2L0C A;  4BY1 H;  1H9S B;  1N36 Q;  4YY3 Q;  4HIO A;  1R4Q B;  3EIV A;  3NEL A;  5IT9 E;  3RZO H;  2J7Z A;  5GQO A;  2A69 C;  1CQV A;  2R7Z B;  1FD7 D;  3E5S A;  4RFB A;  1KHI A;  3VR3 A;  1Q82 C;  4A3L G;  2J4X A;  1KDA A;  1LTS D;  4B3M L;  4KLK A;  2G9H D;  4UHV A;  4LF5 Q;  2B2V A;  4OWX B;  5CV4 A;  4GZY C;  4JBK A;  1WYD A;  5M3F B;  1X54 A;  3NTK A;  4AQY Q;  5FO8 B;  1LO5 D;  4CBV A;  4V0B A;  4JBW A;  4QB4 A;  1JB7 A;  1O7Y A;  1TWG B;  1CTM A;  1X3G A;  3CRK C;  2JA5 G;  3M4Y A;  4OON A;  3J7A F;  4A93 H;  3PGZ A;  3I70 A;  2EYP A;  4WFN 3;  2RSN A;  1S40 A;  1SBB B;  4NXN L;  3GTJ H;  1Q90 A;  4PG3 A;  1SJE D;  4TVA B;  1VQK A;  4DF7 A;  4JK1 C;  1EQQ A;  1K8A C;  3PUX A;  3HFZ B;  4EX5 A;  3HOZ H;  5E7N A;  1ENF A;  5I4D A;  3NBH B;  3DWA A;  4LF6 Q;  3T56 B;  4X64 L;  4RHS A;  4DV1 Q;  3EN2 A;  1S5E D;  3BVZ A;  3CCR A;  1LT3 D;  1RF2 D;  1J6Q A;  1EFI D;  2BOS A;  5EGT A;  2JA6 B;  1YHA A;  3IRB A;  5M5Y H;  1YNJ D;  2KBN A;  3I3C A;  4BA1 I;  1VQC A;  1PH2 A;  2JA5 H;  1N33 Q;  5EPL A;  5C0X J;  1F9S A;  4H02 A;  4GN5 A;  3TSS A;  1WTH A;  3J7Y W;  3CME A;  1DZ1 A;  1XX8 A;  3K5O A;  2AKW B;  4HR7 B;  4LMQ D;  4DK1 A;  4G57 A;  1ASY A;  1CI3 M;  4JI1 Q;  2H1E A;  3AQQ A;  5IYB G;  3LGJ A;  2JN4 A;  3CCQ A;  2JA8 G;  3S1M H;  2YV5 A;  5TSS A;  3VDY A;  3TS0 A;  1SSO A;  2Q2T A;  2O2L D;  3ERQ A;  3J81 j;  5M3F G;  5LHY 1;  3HOV B;  2E75 C;  3A0J A;  4BY7 B;  1M4V A;  4IPG A;  2ZJQ A;  1FNW A;  4ZLT F;  3N6R A;  4C3H G;  4G7O C;  1LTR D;  1SNO A;  3PMF A;  2TMP A;  2ZM6 L;  1X65 A;  3I91 A;  1LT5 D;  1PMR A;  4TKO B;  5IOD A;  5DEH A;  5JAV A;  4BXX H;  5CBA E;  4IJH A;  1KLU D;  1L1O C;  1GUW A;  1QIL A;  2CHB D;  3H3V H;  2M00 A;  1EWH A;  3PIP A;  1TU2 B;  1EY6 A;  1S4Z A;  3BDC A;  2QA4 A;  3J80 L;  3VR4 A;  4OX9 Q;  3PUZ A;  2R7D A;  4A3F B;  4ODG A;  3BYY B;  1LLR D;  1RTO A;  4KY5 A;  1H9J A;  1L1O A;  3FHW A;  1D8L A;  2JA6 G;  2PW7 A;  3S1R H;  1IBK L;  1BBW A;  1LM0 A;  2YTV A;  1LTI D;  5JJI A;  1SDF A;  5IYD G;  4QQB X;  1E24 A;  1BOS A;  1GUG A;  3P7J A;  5ELF A;  4OGQ C;  4RGM A;  1IYJ B;  5EJW A;  3NBH A;  1XPO A;  2EY1 A;  3T16 A;  2DN8 A;  1M8A A;  3KBX A;  1D2B A;  2I07 B;  1U4M A;  1IYU A;  3QG1 A;  1B1Z A;  3FKI G;  3K0Y A;  1KDB A;  4GKJ Q;  3SK8 A;  1B3A A;  1PYB A;  1EYD A;  2RKS A;  3KF6 A;  1TS3 A;  1VQF A;  2F03 A;  4HJ7 A;  4A93 G;  1II3 A;  2QIL A;  1R9T H;  4OWW B;  2WKC A;  3HOV G;  3K81 C;  5J3B A;  3I4M H;  4FXD A;  1C48 A;  2FMM A;  3ERS X;  1D5M C;  1GHJ A;  2JA8 B;  1PH1 A;  1QUQ B;  2L55 A;  1HNW L;  3TQY A;  4DAV A;  1B44 D;  5I9P A;  2F0U A;  2JA7 H;  3GDE A;  3M3Y B;  1KAA A;  4BBS G;  4R4Q A;  4CJ2 C;  1STY A;  1YHQ A;  1IL8 A;  1BR9 A;  4EQP A;  1HQM C;  4PMB A;  1ZYR D;  3CCE A;  5I6Y A;  1EZ8 A;  4JYA L;  1W3S A;  1J9O A;  1CSP A;  1VQH A;  4K2L A;  3W1B A;  1G6Z A;  1I5F A;  3CKI B;  3I72 A;  5C5L A;  3E0E A;  1STE A;  1P8L A;  1A8V A;  3WDN A;  4FF2 A;  3D6C A;  4DR7 Q;  1JOR A;  3SGI A;  1B70 B;  2Z0S A;  1IBK Q;  3KUP A;  2TSS A;  3A7L A;  3M85 A;  4NP5 A;  3EFX D;  1K8G A;  4G7Z C;  1LUZ A;  2B2T C;  3SHL A;  2AHO B;  2IHE A;  4A3F G;  4HJ8 A;  2OQK A;  3DM3 A;  4H13 C;  5M3M G;  3ER0 A;  3U50 C;  4BBS H;  2QDB A;  1EYC A;  4Q0F A;  1E22 A;  2MQH A;  3U9O A;  3S1M B;  2DNC A;  1F9Q A;  4CJ0 B;  4HIM A;  3GP7 A;  2K04 A;  1HPC A;  1HFG A;  1CSQ A;  1ML0 D;  2EDG A;  5A35 A;  3W3A A;  4XQJ A;  1TWH H;  2F0M A;  5A2Q L;  1HXY D;  4JI8 L;  4YCU A;  5I6W A;  4NPS A;  4GKK Q;  1STA A;  2F0S A;  3TEH B;  1VQB A;  2CH4 A;  2IW3 A;  2HIV A;  4DR4 Q;  2XWJ B;  4QIW E;  4CDF C;  2MO1 A;  1GOZ A;  2JA6 H;  5C4X G;  1VF5 C;  3PIO 3;  1YNN C;  4HED A;  4DR5 L;  3F2C A;  2LS0 1;  4KI0 A;  2K14 A;  1FJG L;  1K0S A;  1QNK A;  1RHP A;  2ES2 A;  1SNM A;  2PQA A;  4KHZ A;  1ZYR C;  2B8F A;  2UXC L;  1EQV A;  1PZJ D;  1TS4 A;  3OOC A;  1VQI A;  5C4J H;  3S14 B;  3HOY G;  2AWO A;  2B8G A;  5BR8 L;  1Y1V H;  3DEP A;  4O1N A;  3I4O A;  4CJ1 B;  5GAE C;  3K5N A;  2IX1 A;  2EJM A;  5C3E G;  5IT9 L;  3TRE A;  4KHV A;  1ILP A;  3PF4 A;  4UAI A;  1B9M A;  1Q3L A;  1UE1 A;  5IWA Q;  2DNE A;  2CKZ B;  4QCL A;  2R92 H;  3NHH A;  1Z7T A;  3R2I A;  1W6K A;  4OO1 H;  2D0O A;  3E9H A;  4OEL B;  4NXN Q;  3HOU G;  4N8F A;  4HAE A;  4L5S A;  1L2F A;  4WOR A;  4XYO A;  2NZH A;  4DV7 L;  1PHJ A;  3HKS A;  1XPU A;  1O7I A;  1E1T A;  5IWA L;  4GNX B;  1Y1V G;  2K6A A;  4IJL A;  2CQA A;  3G71 A;  5EBC A;  2KHS A;  4A3E G;  1Y14 B;  1JIC A;  1JC7 A;  1RIP A;  1WCM H;  1I3Q H;  1ZXT A;  1B7Y B;  4KN7 C;  1STB A;  4YY3 L;  3Q24 A;  4DV6 L;  2PZU A;  3RZD H;  3K5M A;  3UE1 A;  1QVC A;  4WJ3 M;  4JYA Q;  3M7G A;  3QWN A;  3DUZ A;  3CD6 A;  3J7A 5;  5KND A;  2B2Y C;  2RA4 A;  2ZXO A;  4C3J G;  3ULJ A;  2VW9 A;  3HKZ G;  1I50 H;  3DLL A;  4AYB G;  1YJN A;  2D62 A;  4X66 Q;  2YYZ A;  2F0W A;  3NXW A;  1VQ9 A;  4DNT B;  2FFK B;  1JR0 D;  3D0F A;  4OO1 I;  1PFS A;  5M3M H;  2R7F A;  2C5C A;  2WII B;  1EEF D;  2HCI A;  5E4W C;  5D3D A;  3ULL A;  1TWC B;  1IW7 D;  1I3Q B;  1WCM B;  2V4D A;  2K01 A;  4YWM A;  5FOB B;  1YHB A;  4G4K A;  2PQA B;  3NE5 B;  3D31 A;  1OXT A;  5IP9 G;  1C7Y A;  4DR1 L;  1O80 A;  2UU9 Q;  4N9P A;  3KF8 B;  3HOU B;  1OO9 B;  1RKN A;  4ABN A;  1DCZ A;  4A3L H;  2D0P A;  4CDE C;  3P75 A;  1PFN A;  2QKI C;  3Q6S A;  3OHX C;  1KLG D;  5HUR A;  1C9O A;  5DM6 3;  3PF5 A;  4CDC C;  2G5D A;  2Q2H A;  1EWC A;  3G6J B;  1FNV A;  4POF A;  2JK8 A;  1IKM A;  3GV3 A;  2XNA C;  4N8X 1;  4GNX C;  3HOW G;  1V1P A;  4JBJ A;  4DV4 Q;  1TQO A;  4DR5 Q;  4RKB A;  2PI2 E;  1U4R A;  3SDZ A;  1H9K A;  3M4Q A;  4TQU S;  3M4P A;  1Y1V B;  1VQ5 A;  1UEA B;  3D3R A;  2K33 A;  1TWG H;  2XIW A;  1PTO D;  2EJG C;  2F0V A;  4I7A A;  1D1I A;  4DV3 L;  2VQF Q;  1Z9F A;  4GKK L;  2R92 G;  3AMU A;  3PIO A;  2VS1 A;  2D5D A;  3R3O A;  2I5L X;  3A56 A;  4IUP A;  1YJW A;  2MGS A;  2VB3 X;  2NZ1 D;  2F0P A;  3R2T A;  4YCW A;  4NKL A;  1PLF A;  1X3E A;  1G51 A;  5JJL A;  2KVM A;  2QW7 A;  4B9X A;  1I4X A;  4DAY A;  2ZXP A;  3H3V C;  2HT1 A;  4UDU C;  1LT6 D;  1EOT A;  1KRS A;  1S5F D;  5EBD A;  4ME3 A;  1FGU A;  1YNX A;  4Y7N H;  1BCP F;  4JVZ A;  2F0K A;  1Q8I A;  3VR2 A;  1FR3 A;  1S5D D;  2Y0S B;  2EXZ A;  4R8I A;  3CC7 A;  1ASZ A;  2PZW A;  1B8A A;  3JAM i;  1EYG A;  5FO7 B;  1TWC H;  2BCO A;  4KMU C;  3KLS X;  3S15 H;  3JAM c;  4JI7 Q;  3DMU A;  1EOV A;  1QB5 D;  4OX9 L;  3WWV A;  2VB2 X;  1KRT A;  2M9V A;  2KEC A;  3GQB A;  1D6E C;  4LFB Q;  5M3M B;  2N49 A;  3Q22 A;  2VXW A;  2PMZ E;  1ENA A;  1WD1 A;  3CCL A;  4C2M B;  4B3R L;  1Y69 U;  3SK5 A;  3FVQ A;  4FF1 A;  2RDH A;  3W2D A;  5FK9 C;  4IFD H;  2QDL A;  3L0O A;  1L0X B;  3PV0 A;  1I94 Q;  2PQE A;  4BWG B;  5D14 A;  1VMP A;  4A3J G;  5LL6 X;  5ELO A;  3HEJ A;  1YVC A;  4OHJ A;  2XTI A;  1PH7 A;  1ICF B;  2R93 G;  3G6E A;  3ND8 A;  3CCV A;  1U4P A;  1GUO A;  2GA4 B;  2SEB D;  2F4V Q;  4BXX G;  5IYC H;  3IKJ A;  3KBG A;  2JYO A;  1LTT D;  5IE8 A;  1ROD A;  3OTO Q;  1SRU A;  1VQ4 A;  1YJ9 A;  2HIX A;  2F0E A;  2K5N A;  1TVX A;  4K5W A;  4QY7 A;  4DV5 Q;  4A3B G;  1ZEQ X;  1Q46 A;  4EQ5 A;  4DV3 Q;  2E74 C;  4JG2 A;  1CM9 A;  4LK1 C;  5CV7 A;  4A3M H;  1ESF A;  4DK6 C;  3VR5 A;  1E1O A;  3URY A;  1SFO H;  3OWF A;  4LF5 L;  4NXM Q;  5JEA H;  3X3M A;  4R4T A;  1ILQ A;  1SYC A;  3DWQ A;  3M4O B;  2NVQ H;  2UUB Q;  2IX0 A;  5ELE A;  3I4M B;  3J81 E;  4GN3 B;  4UY8 C;  2E5L Q;  3HKZ E;  1U0L A;  4RCN A;  1NR2 A;  4O42 A;  2K1B A;  2K5V A;  2KCC A;  1B50 A;  4CKE A;  4NB3 A;  2L12 A;  3GTL B;  1KAW A;  3EBE A;  2VUM B;  3MXP A;  1X6O A;  1PVO A;  4QUF A;  1ICW A;  4X3S A;  2L15 A;  4POG A;  5C4J B;  1DYQ A;  2EVB A;  2JJQ A;  1XTC D;  2EJF C;  2JEB I;  3CU7 A;  4HJ9 A;  5LMN L;  1Q1B A;  1A2T A;  4X64 Q;  1K83 B;  1CQF A;  1CUK A;  4L5Q A;  2AQ3 B;  1JQY D;  4A3C G;  2BA0 A;  2SOB A; 
#chains in the Genus database with same CATH homology
 3PIP 3;  1SYD A;  3EVQ A;  2NB0 A;  2SNM A;  5AFW A;  3IL8 A;  2F3W A;  3LWU A;  4MHE A;  1PYW D;  1I6H B;  3AB9 A;  3OW7 A;  4AYB B;  2EPB A;  1EY5 A;  1HQR D;  5LL6 S;  5C3X A;  1EZ6 A;  2NVX B;  5FKA C;  4BBS B;  1G91 A;  3GV6 A;  1K8O A;  3F2U A;  3NPP A;  4K5V A;  1ESR A;  5HGT A;  1QE6 A;  3K58 A;  3M7N A;  1RDP D;  1KNE A;  1YNJ C;  4OIK A;  5KYI A;  2F0O A;  1DOL A;  2BDO A;  4KY6 A;  1IHZ A;  1QNU A;  1WVL A;  3G7L A;  3D6W A;  4IZ8 A;  5IIF A;  3BDL A;  3BG3 A;  3DWP A;  5M5Y B;  3VYR A;  5IGF A;  4H7B A;  5CV5 A;  3SK6 A;  3TZU A;  3MTS A;  5D3I B;  2L4N A;  5M5W B;  1NR4 A;  5C0X I;  5C4X B;  5COY A;  3J80 E;  2WP8 J;  1JE4 A;  1EY8 A;  1STH A;  3BVM A;  1R9T B;  1T5X D;  3H09 A;  1CA5 A;  5IGG A;  1ONL A;  1EYA A;  1DXM A;  3TN2 A;  4CGY B;  4ZQ3 A;  3NSW A;  1NAP A;  2G9D A;  2KJX A;  3R93 A;  2A69 D;  3I4N B;  2LMC B;  1OXU A;  1S5B D;  1SXT A;  1PTO H;  1SYB A;  4RGO S;  3V96 A;  2E2H B;  3FPU B;  2F0H A;  5JVG 3;  4K14 A;  2Q8T A;  4IN3 A;  4R9W A;  2EOT A;  2DY8 A;  3S1R B;  1IYV A;  2PYK A;  1TKW B;  1OXV A;  2EY2 A;  4IFD G;  3FRP B;  4DXF A;  3S9W A;  1HCZ A;  1EY7 A;  1MI2 A;  1Y8N B;  3K6O A;  1CA6 A;  1FYC A;  4WRD A;  4DXG A;  3MFG A;  4XT1 B;  2NVT B;  4LJZ C;  1A2U A;  3L3O C;  4XXE A;  5IGD A;  2R61 A;  2XRS D;  2NN6 G;  3BYT B;  1SE4 A;  3HOX B;  4A3J B;  5CV9 A;  1VCI A;  2NVY B;  1BO0 A;  1Q1E A;  3TP7 A;  4F88 A;  1PFB A;  3NQI A;  4L6T B;  2K28 A;  4TRD A;  3TP8 A;  3LWE A;  1C4Q A;  2HQE A;  4XYQ A;  2O5I C;  4HMI A;  1SEB D;  2B2W C;  4KV6 A;  2K7V A;  4A3B B;  2E2I B;  3OIQ A;  2K5Q A;  2PO4 A;  1E2V A;  1BDO A;  4RKL A;  2PPB C;  3S16 B;  3MEH A;  2IL8 A;  2MPM A;  3PUY A;  4ZUI A;  1KAB A;  2EYF A;  1NSN S;  4F8M A;  5CV8 A;  1KTK A;  4LAA A;  1QWY A;  2K5D A;  2A6H C;  2EY5 A;  2EYM A;  1WTV A;  4DGZ A;  3MXU A;  4EVO A;  2BDN A;  5COR A;  3HOZ B;  3TME A;  4RHR A;  1ET9 A;  4FF3 A;  3T53 B;  1WD0 A;  3TP5 A;  2SNS A;  1TT2 A;  1V1O A;  3KK7 A;  2MUY A;  2WIN B;  1NCV A;  2FIN B;  2MHV A;  4EQO A;  2NN6 I;  3X3N A;  2A74 C;  5BN4 A;  2IWH A;  1QOH A;  1H9M A;  3NWS A;  4DFA A;  1QJO A;  1V1P B;  4ZAI A;  1WTR A;  2BE5 C;  4BBR B;  3SK4 A;  2PW5 A;  2JEA I;  1QCB D;  3J7A V;  2JSO A;  1AN8 A;  3T4A C;  4IFD I;  2AQ1 B;  1RJT A;  1AFP A;  4RH6 A;  3NQT A;  1A15 A;  2Z1C A;  2RBM A;  1HA6 A;  2F0N A;  1JWM D;  1UUP A;  4KJN A;  3GTP B;  3C3L A;  3T13 A;  4Y7N B;  4PMC A;  1J8I A;  3FEW X;  3VA7 A;  4QMG A;  4B9W A;  4C3I G;  4MN3 A;  1ZKO A;  2J0T D;  1U9R A;  4DA2 A;  1BCP C;  1MBY A;  1NUC A;  3OMG A;  1A6X A;  4PV1 C;  5CGK A;  3V05 A;  3L9A X;  4B08 A;  4HTH A;  3S1Q B;  3MVV A;  4CHT B;  4U68 A;  1D5X C;  2KUM A;  2A68 C;  1G2T A;  1Y8P B;  3HZX A;  1S5C D;  4KN4 C;  1A3T A;  2E2D C;  1PTO C;  3VYT A;  5C5M A;  5KGU A;  1LTB D;  4I7Z C;  1GXD C;  1DM0 B;  5KYL A;  3S2H B;  4J8Q A;  4KKS A;  4G7H C;  2AQ2 B;  5E3F A;  4C3J B;  1O7L A;  1CHP D;  1EU3 A;  2AWN A;  1F9P A;  5EQ0 A;  2BA1 A;  1ET6 A;  1R4P B;  5KEE A;  1AZP A;  2A6E C;  4ZKC B;  1TWH B;  1SAP A;  2B2W A;  2O4X A;  1H9R A;  1O78 A;  4ZUJ A;  5NUC A;  1I50 B;  3KLS A;  1F2Y A;  3OMC A;  4OO1 G;  2KED A;  1PDQ A;  2B63 B;  5EKL A;  1JOO A;  2Q8R E;  3HP3 A;  1EIG A;  2Q8I B;  3PO2 B;  2O5J C;  3ITP A;  4M8A A;  5I9O A;  5DM7 3;  2NBF A;  4XQQ A;  1CZW A;  4J6H A;  4BA2 I;  1PZI D;  5CMD A;  4IUT A;  5E4X A;  3LNN A;  3GTQ B;  2R92 B;  2F0I A;  4FXK C;  2MP1 A;  1PTO B;  1Z47 A;  1MSH A;  1BUV T;  3A7A B;  1STN A;  3CRL C;  1SNP A;  3SVM A;  4FF4 A;  2OF1 A;  3EA6 A;  3TP6 A;  3FPP A;  5C0X H;  5FLX E;  2B2Y A;  2K03 A;  1QG7 A;  4ULL A;  3NUC A;  1GUS A;  3OPO A;  2WAC A;  1I4Q A;  2HDL A;  1LTA D;  3TDQ A;  5C3W A;  4XT3 B;  3GTK B;  3WOF A;  4IUN A;  1JWS D;  2QEJ C;  5JPN C;  2NVQ B;  1E2W A;  3L7Z C;  4IUR A;  1AP0 A;  1BXT A;  3EQL C;  5IGB A;  1SMY C;  1HHV A;  3MFY A;  3NP8 A;  2HDM A;  2EYH A;  4IUU A;  1JOQ A;  1B4O A;  1SNQ A;  3V2T A;  2B2T A;  3RMH A;  1MD2 D;  3C46 A;  3A54 A;  1L0Y B;  4RCO A;  2F1M A;  4I65 A;  1YNN D;  4XDX A;  2N55 A;  5CBE E;  3A8I E;  2JP1 A;  1F2M A;  1DON A;  3U9S A;  2K5W A;  3DM1 A;  5JEA G;  1D5Z C;  2B2U A;  2FMC A;  3PUW A;  2KQ3 A;  1RTN A;  1DOM A;  1EIH A;  4K6D A;  1GJX A;  2F0T A;  3D4W A;  2M2L A;  3HKZ B;  4K6L A;  2FHT A;  3O13 A;  3MXG A;  1GHK A;  1IKL A;  1LTG D;  4HCE A;  2B2U C;  4BS9 A;  3I73 A;  4ILW A;  1TR5 A;  3GTM B;  1HTL D;  1BQQ T;  4C1N K;  1EQT A;  1TS5 A;  1AEX A;  2F0Q A;  2ZT9 C;  4V19 0;  5F2D A;  1CT1 D;  3AU7 A;  2L5T A;  4QIW B;  3RD4 A;  2XSC A;  4IQZ A;  1JOK A;  1SMY D;  2X6L A;  2RDF A;  2OT2 A;  5KNC A;  3EJI A;  2RQX A;  4A93 B;  5EPK A;  3I8Z A;  2E76 C;  1RD9 D;  5M9O A;  1KNA A;  3Q0A A;  2IT1 A;  2KA7 A;  1GUN A;  4IUV A;  4NMZ A;  4DK0 A;  1OXS C;  1OXX K;  5A2Q E;  4A3D B;  3HGB A;  1E2Z A;  2D9U A;  1IW7 C;  2XWB B;  2B2V C;  4Q5V A;  4C1N I;  1HA5 A;  1SFO B;  2EYL A;  5G3L F;  4TSS A;  4FYD A;  1F2L A;  5I2X A;  2KEE A;  3D4R A;  3PUV A;  3IAY A;  1BNZ A;  1X32 A;  2YU9 B;  3MWY W;  2ENB A;  1HFN A;  3MXN A;  2WV6 D;  4KKT A;  2F0F A;  2XRQ D;  4KD4 A;  4WJW A;  3FKI B;  2PZT A;  3RZD B;  5FLX L;  3SXH A;  5I2Y A;  1EL0 A;  3T51 B;  4ME5 A;  2RDG A;  2KOL A;  4DAP A;  2QCP X;  1PZK D;  2L11 A;  4N9T A;  1TS2 A;  2PCF B;  1TWA B;  2ICI A;  1F77 A;  1WTQ A;  4C3H B;  4XIG S;  1FNU A;  1X3P A;  2XN9 C;  2EY6 A;  3OSO A;  3H0G B;  3OIP A;  5M5X B;  4FVM A;  1JWU D;  3GD7 A;  3N52 A;  2B39 A;  4C56 C;  2WAQ B;  1JCK B;  4C3I B;  3CQZ B;  3I4L A;  5K36 H;  2NN6 H;  5EKI A;  3MZ5 A;  1SYG A;  1UNS A;  5DAU A;  4A3G B;  5ELB A;  4RA8 A;  2K05 A;  4R8N A;  1DJR D;  5JPM C;  4QUC A;  2NWG A;  3MA2 B;  3MAQ A;  3TBI B;  4L63 B;  3PO3 B;  3SEB A;  3MHB A;  3J81 L;  3CHB D;  1V8Q A;  1W6J A;  3A55 A;  4FNF A;  4IFD J;  5ISR A;  3C1E A;  4DN4 M;  2OXP A;  2WKD A;  2JE6 I;  5C0X G;  1HRJ A;  2MJ8 A;  2EE1 A;  5G3L D;  3VYS A;  2ZXR A;  3HS0 C;  4HSP A;  1BCP D;  2RVL A;  5D65 A;  3NTH A;  1C8C A;  4A3I B;  1RCV D;  3S1N B;  1SE2 A;  5CV6 A;  3GTG B;  2F0L A;  4RGT A;  3BZD B;  3E6Z X;  3QB3 A;  3GO5 A;  4ID6 A;  4RGN A;  3HOY B;  1DOK A;  5C4H A;  3QO2 A;  2LKV A;  2AUJ D;  1HTP A;  2BE5 D;  1VDZ A;  4ZRZ A;  3R8B A;  4FXG C;  4QF4 A;  4DNR B;  3GTO B;  1LAC A;  2E2J B;  1PFM A;  1Y8O B;  3A8J E;  3BDO A;  4EGV A;  2H4O A;  1DD2 A;  3NWT A;  1JB3 A;  2SDF A;  1WTW A;  3H6M A;  2F0D A;  1X3Q A;  2NTS A;  2Z4H A;  3TZD A;  3HOW B;  3S17 B;  1U4L A;  1Q12 A;  2ID0 A;  1SND A;  1I4R A;  3OWE B;  4A3K B;  5EKK A;  2R6G A;  2XVS A;  1CHQ D;  2N88 A;  3HG9 A;  3I90 A;  1EY4 A;  4H0L C;  5ELD A;  2ICE C;  4H44 C;  4FP5 D;  3QOJ A;  4KKU A;  1BBX C;  1I4H A;  5KNB A;  4KTA A;  1FGB D;  3QIA A;  4NW2 A;  1WTX A;  3K7A B;  4OL7 A;  1ENC A;  2AUK A;  2Z4I A;  1TII D;  5T1G A;  4ZK9 B;  3NK9 A;  2R3Z A;  4ZYS A;  5C3E B;  3NBI A;  4L8J A;  4X3U A;  1LAB A;  5FO9 B;  5ELC A;  2HCC A;  2HUG A;  1O7Z A;  4EQN A;  3K5L A;  3ERO A;  4KY7 A;  4HCS A;  2NYZ D;  2L9H A;  1MSG A;  4PMW A;  2A6E D;  3RUZ A;  5J1Z A;  1BCP B;  5C44 B;  2CVR A;  1CZG A;  4K5X A;  3IFD A;  1SYF A;  2CW0 D;  2NTT A;  3QJY A;  1EU4 A;  1UAP A;  5IGE A;  5KIX A;  4XTC S;  4K8J A;  1EY0 A;  1XYI A;  4IUQ A;  2LY7 A;  5C4Z A;  4PNY A;  3ND9 A;  2JA5 B;  1Z6H A;  5CC4 A;  4FO2 A;  1VMC A;  2A68 D;  4P2C B;  4K8I A;  1I4P A;  1TY2 A;  1A3V A;  1D1K A;  2JA7 B;  1KDC A;  3ONA B;  1V43 A;  3E0J A;  4OIJ A;  5J22 A;  1XWE A;  3SR1 A;  1VF7 A;  2X69 A;  2X6G A;  4A3M B;  2RSO A;  3WOE A;  2LFN A;  3VA5 A;  4M1U B;  3GTJ B;  3KF8 A;  1EEI D;  2F3V A;  1WTO A;  2JXM B;  1I4G A;  3H91 A;  5KRU A;  2WB1 B;  5DNF A;  1AZQ A;  4XQN A;  1SNC A;  3S2D B;  1CFM A;  3IFT A;  4ZKB B;  2A73 B;  3D4D A;  1F9R A;  2F0J A;  5K5P A;  2QF7 A;  1STG A;  5CR3 A;  4DU9 A;  2PNR C;  4X3T A;  2EZV A;  3NTI A;  1GUT A;  1BF4 A;  1HUM A;  3HRZ C;  1Y1W B;  5BN3 A;  5J39 A;  3BVG A;  3K59 A;  2Z8L A;  4RAU C;  3BS1 A;  4HMJ A;  2IX3 A;  3S15 B;  5K36 G;  3D8G A;  4E6I A;  3RZO B;  2CW0 C;  2OEO A;  1AW7 A;  4BY1 B;  3C2P A;  4X3K A;  5T1I A;  1B9N A;  3DEO A;  3JAM E;  1B53 A;  3K57 A;  3C1F A;  2A5H A;  4HN7 A;  1F2Z A;  2F0G A;  3P1H A;  4U67 3;  4NDX A;  3P20 A;  5C6A A;  1PRT C;  4RWS C;  1H9S A;  5E1F A;  4CKC A;  2NUC A;  4MIU A;  4CKB A;  4KJO A;  4K2K A;  2L1B A;  4YIJ A;  5JOB A;  3DHQ A;  5BN5 A;  2A6H D;  3A8K E;  3SE0 A;  2I46 A;  3JAM L;  4F7X A;  2C9O A;  2D2C C;  4F87 A;  4A3E B;  3MC0 B;  5JEA J;  1PRT B;  4S3S A;  1PXU A;  4HSV A;  1HUN A;  2PMZ B;  1T5E A;  1LT4 D;  5IOC A;  1G2S A;  1PTO F;  5EPJ A;  2R93 B;  1TY0 A;  5IGC A;  2DY7 A;  4KK7 A;  4IAL A;  4KD3 A;  1SYE A;  1E0B A;  5JVH 3;  2EYO A;  1A3U A;  3DXJ C;  3KLR A;  3QOL A;  1EY9 A;  1G8Z D;  1CK1 A;  5JJZ A;  3Q23 A;  2EYJ A;  1I6V C;  5CYU A;  1PRT D;  2FJ2 A;  3RLF A;  3ZYY X;  1SE3 A;  2IPK D;  1PRT F;  3FDT A;  1B2T A;  3LX0 A;  3UI2 A;  1SJH D;  2IJ0 A;  3FMC A;  1LV9 A;  3VR6 A;  2F4I A;  2K32 A;  2VNU D;  3H94 A;  1XXG A;  1WTP A;  1TWF B;  4PQX A;  4J1M A;  2KCN A;  4Z9C B;  1MGS A;  3VYU A;  1G29 1;  1K8M A;  2L0C A;  1H9S B;  1R4Q B;  5IT9 E;  2J7Z A;  2A69 C;  1CQV A;  2R7Z B;  1FD7 D;  3E5S A;  4RFB A;  3VR3 A;  2J4X A;  1KDA A;  1LTS D;  2G9H D;  2B2V A;  5CV4 A;  4GZY C;  5M3F B;  3NTK A;  5FO8 B;  1LO5 D;  4CBV A;  4V0B A;  4JBW A;  4QB4 A;  1TWG B;  1O7Y A;  1CTM A;  3CRK C;  3M4Y A;  3J7A F;  3I70 A;  2EYP A;  4WFN 3;  2RSN A;  1SBB B;  1Q90 A;  1SJE D;  4DF7 A;  4JK1 C;  3PUX A;  1ENF A;  5I4D A;  3DWA A;  3T56 B;  4RHS A;  1S5E D;  3BVZ A;  1LT3 D;  1RF2 D;  1EFI D;  2BOS A;  5EGT A;  2JA6 B;  1YNJ D;  3I3C A;  4BA1 I;  5EPL A;  5C0X J;  1F9S A;  3TSS A;  3J7Y W;  1DZ1 A;  1XX8 A;  3K5O A;  4HR7 B;  4LMQ D;  4DK1 A;  4G57 A;  1CI3 M;  2H1E A;  5TSS A;  1SSO A;  2O2L D;  3ERQ A;  5LHY 1;  3HOV B;  2E75 C;  4BY7 B;  1M4V A;  1FNW A;  4ZLT F;  3N6R A;  4C3H G;  4G7O C;  1LTR D;  1SNO A;  3PMF A;  2TMP A;  3I91 A;  1LT5 D;  1PMR A;  4TKO B;  5IOD A;  5DEH A;  5JAV A;  5CBA E;  1KLU D;  1GUW A;  1QIL A;  2CHB D;  2M00 A;  1EWH A;  1TU2 B;  1EY6 A;  1S4Z A;  3BDC A;  3J80 L;  3VR4 A;  3PUZ A;  4A3F B;  4ODG A;  3BYY B;  1LLR D;  1RTO A;  4KY5 A;  1H9J A;  2PW7 A;  1LTI D;  1SDF A;  1BOS A;  1GUG A;  3P7J A;  5ELF A;  4OGQ C;  4RGM A;  5EJW A;  3NBH A;  2EY1 A;  3T16 A;  2DN8 A;  1M8A A;  3KBX A;  1D2B A;  2I07 B;  1U4M A;  1IYU A;  3QG1 A;  1B1Z A;  3K0Y A;  1KDB A;  3SK8 A;  1B3A A;  1EYD A;  2RKS A;  1TS3 A;  2F03 A;  1II3 A;  2QIL A;  2WKC A;  4FXD A;  1C48 A;  2FMM A;  1D5M C;  1GHJ A;  2JA8 B;  2L55 A;  4DAV A;  1B44 D;  5I9P A;  2F0U A;  3M3Y B;  1KAA A;  4CJ2 C;  1STY A;  1IL8 A;  1BR9 A;  4EQP A;  1HQM C;  4PMB A;  1ZYR D;  5I6Y A;  1EZ8 A;  1J9O A;  1G6Z A;  4K2L A;  3CKI B;  3I72 A;  5C5L A;  3WDN A;  1STE A;  4FF2 A;  3D6C A;  1JOR A;  3KUP A;  2TSS A;  3A7L A;  3M85 A;  4NP5 A;  3EFX D;  4G7Z C;  2B2T C;  3SHL A;  4H13 C;  2QDB A;  1EYC A;  4Q0F A;  3U9O A;  3S1M B;  2DNC A;  1F9Q A;  4CJ0 B;  3GP7 A;  2K04 A;  1HPC A;  1HFG A;  1ML0 D;  2EDG A;  5A35 A;  3W3A A;  4XQJ A;  2F0M A;  5A2Q L;  1HXY D;  5I6W A;  1STA A;  2F0S A;  2IW3 A;  2XWJ B;  1GOZ A;  1VF5 C;  3PIO 3;  1YNN C;  4HED A;  2LS0 1;  4KI0 A;  1QNK A;  1RHP A;  1SNM A;  4KHZ A;  1ZYR C;  2B8F A;  1EQV A;  1PZJ D;  1TS4 A;  3OOC A;  3S14 B;  2AWO A;  2B8G A;  3DEP A;  4O1N A;  4CJ1 B;  3K5N A;  2IX1 A;  2EJM A;  5IT9 L;  4KHV A;  1ILP A;  4UAI A;  1B9M A;  1Q3L A;  2DNE A;  4QCL A;  3NHH A;  1Z7T A;  3R2I A;  1W6K A;  4OO1 H;  4HAE A;  4WOR A;  4XYO A;  2K6A A;  2CQA A;  5EBC A;  2KHS A;  1JIC A;  1JC7 A;  1ZXT A;  4KN7 C;  1STB A;  3Q24 A;  2PZU A;  3K5M A;  3M7G A;  3QWN A;  3DUZ A;  5KND A;  2B2Y C;  2RA4 A;  2ZXO A;  4C3J G;  2D62 A;  2YYZ A;  2F0W A;  3NXW A;  4DNT B;  2FFK B;  1JR0 D;  4OO1 I;  2C5C A;  2WII B;  1EEF D;  2HCI A;  5E4W C;  5D3D A;  1TWC B;  1IW7 D;  1I3Q B;  1WCM B;  2V4D A;  2K01 A;  5FOB B;  4G4K A;  3NE5 B;  3D31 A;  1OXT A;  1O80 A;  4N9P A;  3HOU B;  1OO9 B;  1RKN A;  4ABN A;  1DCZ A;  3P75 A;  1PFN A;  2QKI C;  3Q6S A;  3OHX C;  1KLG D;  5HUR A;  5DM6 3;  1EWC A;  3G6J B;  1FNV A;  1IKM A;  3GV3 A;  2XNA C;  1V1P A;  1TQO A;  4RKB A;  1U4R A;  3SDZ A;  1H9K A;  4TQU S;  1Y1V B;  1UEA B;  3D3R A;  2K33 A;  2XIW A;  1PTO D;  2EJG C;  2F0V A;  1D1I A;  3AMU A;  2D5D A;  3R3O A;  3A56 A;  4IUP A;  2MGS A;  2VB3 X;  2NZ1 D;  2F0P A;  3R2T A;  4NKL A;  1PLF A;  2KVM A;  4B9X A;  1I4X A;  4DAY A;  2ZXP A;  3H3V C;  4UDU C;  1LT6 D;  1EOT A;  1S5F D;  5EBD A;  1BCP F;  2F0K A;  1Q8I A;  3VR2 A;  1FR3 A;  1S5D D;  2Y0S B;  2EXZ A;  4R8I A;  2PZW A;  5FO7 B;  2BCO A;  4KMU C;  3KLS X;  3DMU A;  1QB5 D;  2VB2 X;  2M9V A;  2KEC A;  3GQB A;  1D6E C;  5M3M B;  3Q22 A;  2VXW A;  1ENA A;  1WD1 A;  4C2M B;  1Y69 U;  3SK5 A;  3FVQ A;  4FF1 A;  2RDH A;  3W2D A;  5FK9 C;  4IFD H;  3PV0 A;  1L0X B;  2PQE A;  4BWG B;  5D14 A;  1VMP A;  5LL6 X;  3HEJ A;  4OHJ A;  3ND8 A;  1U4P A;  1GUO A;  2GA4 B;  2SEB D;  3IKJ A;  3KBG A;  2JYO A;  1LTT D;  1ROD A;  2F0E A;  1TVX A;  4K5W A;  1ZEQ X;  2E74 C;  1CM9 A;  4LK1 C;  5CV7 A;  1ESF A;  3VR5 A;  3URY A;  3OWF A;  5JEA H;  3X3M A;  1ILQ A;  1SYC A;  3DWQ A;  3M4O B;  2IX0 A;  5ELE A;  3I4M B;  3J81 E;  4RCN A;  1NR2 A;  4O42 A;  2K1B A;  2KCC A;  1B50 A;  4CKE A;  2L12 A;  3GTL B;  2VUM B;  3MXP A;  4QUF A;  1ICW A;  4X3S A;  5C4J B;  1DYQ A;  2EVB A;  1XTC D;  2EJF C;  2JEB I;  3CU7 A;  1Q1B A;  1A2T A;  1K83 B;  1CQF A;  2AQ3 B;  1JQY D;  2BA0 A;  2SOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...