2L11A

Solution nmr structure of the cbx3 in complex with h3k9me3 peptide
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
54
structure length
54
Chain Sequence
GEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition and specificity determinants of the human cbx chromodomains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator
molecule keywords Chromobox protein homolog 3
total genus 7
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2010-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2l11A00
2NWGA 1B2TA 5D14A 1RTNA 2FFKB 3F2UA 3MWYW 1SAPA 2H1EA 2M2LA 5E4XA 2FINB 4ZKCB 1IKMA 1GUWA 4LMQD 3LWEA 3P7JA 3GV6A 1AZQA 1LV9A 4IURA 4R8IA 4NW2A 3Q6SA 1WD0A 1ESRA 1S4ZA 2RSNA 4DN4M 4X3SA 1HFGA 4U68A 5EQ0A 2N88A 1X3QA 2KECA 1RTOA 2FJ2A 4HEDA 5T1GA 1HA6A 2KEDA 2L9HA 3MTSA 1JICA 1O80A 4O42A 1DOKA 3HP3A 4RAUC 3I3CA 1X3PA 4RA8A 1X32A 1KNAA 2L12A 2EOTA 3DEPA 1U4RA 1KNEA 2HDLA 2FMMA 2NZ1D 4MN3A 4R9WA 4MHEA 1WTPA 1DONA 3I90A 2X6LA 5EPJA 1ILPA 1DZ1A 1NAPA 1VMPA 2B2VA 3FPUB 1F9RA 1CA5A 1O7YA 1F9QA 1WTRA 1ML0D 1MSHA 4QUFA 4CJ1B 1A15A 2CVRA 1IL8A 1B53A 1SSOA 2FHTA 1U4PA 2DY7A 4X3KA 5CMDA 1CA6A 2RA4A 5E4WC 3ONAB 4CJ0B 1JE4A 2Q8RE 4IUQA 1G6ZA 3IL8A 1J9OA 1EOTA 1RHPA 2JYOA 3GV3A 4HSVA 2Q8TA 1CM9A 1NR2A 2K1BA 2L1BA 1O7ZA 1Q3LA 2VXWA 1BO0A 3N52A 4UAIA 3I91A 3I8ZA 1G2SA 2MP1A 1PFMA 2R3ZA 3H91A 4ZLTF 1EL0A 5CORA 2HUGA 1ZXTA 2EE1A 1TVXA 2NYZD 5EJWA 3KUPA 2IL8A 2MGSA 4ZK9B 1M8AA 2RSOA 1RJTA 1MSGA 3TZDA 3UI2A 4CJ2C 1WTVA 4IUVA 2B2TC 1VMCA 1SDFA 2K04A 3R93A 3D6WA 2JP1A 1F9PA 5EPKA 1WD1A 1AZPA 5COYA 4XT1B 4OIJA 1HHVA 3FDTA 3DEOA 1F2LA 1WTOA 2K01A 1HUMA 1RODA 1BF4A 2B2YA 1WTXA 3SVMA 1C8CA 4IUTA 2SDFA 2N55A 2J7ZA 2B2TA 3QO2A 5EKIA 1PDQA 2K05A 2KVMA 4IUPA 4IUUA 2L11A 1MI2A 4OIKA 2B2WC 2B2WA 2MJ8A 2HDMA 1EIGA 1F9SA 2L4NA 4HCSA 2D9UA 1PFNA 1U4LA 3G7LA 1HRJA 5CBAE 2K03A 1ICWA 1BBXC 1U4MA 1QE6A 2B2YC 2X69A 1MGSA 3KBXA 4X3UA 2KUMA 2RVLA 1BNZA 2HCIA 2K28A 1EQTA 2B2VC 5CBEE 1WTQA 4X3TA 5T1IA 1WTWA 2DY8A 2EPBA 2MPMA 1NCVA 2B2UA 2XIWA 1WVLA 2KEEA 1XYIA 1QG7A 4XT3B 5EPLA 1DOMA 1PFBA 5AFWA 1G91A 1XX8A 5JJZA 1HFNA 1J8IA 1NR4A 2BDNA 1B4OA 1DOLA 1HUNA 1B50A 2B2UC 4RWSC 4ZAIA 1B3AA 2HCCA 3TN2A 2KOLA 4HAEA 4XDXA 5D65A 2X6GA 1G2TA 1QNKA 1ILQA 3DM1A 1PLFA 4QUCA 1E0BA 4ZKBB 1AP0A 1EIHA 5DNFA 1IKLA 3IFDA
chains in the Genus database with same CATH superfamily
2G9HD 2VQFQ 4ME5A 3I56A 1LLRD 2M2LA 1D1KA 2DNCA 1ET9A 3IAYA 3FKIB 4U673 3S17B 2I0QA 1EYGA 3KF8A 1WD0A 3AFQA 4ID6A 3TP7A 1XJVA 5ELNA 3BZKA 1TS2A 1STYA 3URYA 4XQQA 3MHBA 5BN5A 1RIPA 1SNQA 2Z1CA 2UXCQ 1HTPA 5JVH3 1LT3D 5FKAC 3PUXA 4L5SA 1YHAA 2AKWB 4ZYSA 1NAPA 5A35A 3FPUB 1QILA 3CQZB 3KF6B 3K6OA 1PZJD 2NTSA 4MNOA 4K0KQ 1J9OA 5JJIA 1FR3A 4RH6A 3B6YA 1O7ZA 4ABNA 1BOSA 3H3VI 2Z9HA 3IKJA 2E75C 5ELOA 1VQ4A 4UP7A 1ZKOA 2F3VA 4TVAB 1WTOA 1MJEA 1C7YA 2M9VA 4FXGC 4FF2A 4DUYQ 2E2JH 4HTHA 1EYDA 1PDQA 3NHHA 2KVMA 2UXBL 1VQLA 3KJPA 4B3TL 2A68C 5GAEC 3TRZA 3DUZA 4NXMQ 3U9OA 1UAPA 1JOOA 3DMUA 3NENA 4XXEA 2V1CC 3D4RA 3PV0A 2Z8LA 2KHJA 1L1OB 1WTQA 1STNA 1KXLA 3BVZA 3VYRA 4A3FG 2L0CA 4L8JA 2QGQA 2K5QA 4LFAL 1HH2P 4PMWA 3CCQA 3NWSA 1DOLA 2R92H 1B3AA 2XNAC 4HAEA 3E0JA 4RG1A 3T1YL 4APVA 3K5LA 3CCMA 3OYYA 4QUCA 1X3FA 4A3CG 3PQIA 3EQLC 3U58A 4ZKBB 2RKSA 3RMHA 1EIHA 1KRSA 5D14A 5GROA 4LF5Q 2AUJD 2SEBD 2NN6G 4IPHA 1P16A 5JOBA 5FLMH 2NVYH 2DN8A 3ND9A 3J81E 3E5SA 4J8QA 5IP9H 5JEAG 4A3IG 4IJLA 1PH6A 4A3JH 5BN3A 5T1GA 5M3FB 4C3IG 3UDGA 4JBWA 2XWJB 3LX0A 1JICA 1PXUA 1DJRD 4OO1G 3ULPA 1IBML 3MA2B 4A3MH 4BY7H 3I90A 3SDZA 4AYBE 3BZDB 3T4AC 3J80c 5GQOA 1V1OA 4QQBX 1N34L 4K2KA 4GLAC 4BBSG 3OW2A 2F0QA 3SXHA 3ONAB 2HT1A 1DYQA 3HZXA 3HKZG 3GV3A 2ATWA 1BQQT 2JA8B 1VQHA 3PUYA 4C3JG 2ZJRA 4IZ8A 1G2SA 2R3ZA 4PV1C 4KV6A 4B3SQ 2EE1A 1PYWD 4JV5L 4IUVA 1UUPA 4NB3A 4JOIA 3K5NA 5C5MA 1W6KA 5M5WH 2HHHL 1EQVA 1PA6A 1RKNA 1HHVA 2RBMA 2XSCA 4JI0Q 1VQ7A 3J7AV 2BOSA 5I6YA 3K5OA 2R93B 2AQ1B 2O2LD 3FVQA 2N55A 2JJQA 4A3IB 3NQIA 4IUNA 3L0OA 3G7LA 3HRZC 3OMGA 4ZRZA 1QE6A 4DV6Q 1MGSA 1PTOH 1AE3A 1HZCA 3ITPA 2E5LL 1EU4A 4NDXA 4EQPA 3NUCA 1TY2A 1QG7A 4WRDA 2CQAA 3PO2B 4LFCQ 3CPFA 1AN8A 1E1OA 1QUQA 1VQNA 3K7AB 3SEBA 3I4NB 1G2TA 2KOLA 2ENBA 2BDOA 2RF4A 3TP6A 5BN4A 1E1TA 1RDPD 4CHTB 1E0BA 1U5KA 4KHPL 2KCTA 2IX1A 4XIGS 2JA6B 1RTNA 2FFKB 2RQXA 2ZTDA 3EJIA 4OWXB 2E76C 2Z0SA 1JE5A 1KDAA 5CYUA 3K81C 2H1EA 3NXWA 4C3JH 5C0XI 1K3BC 4K8IA 4DR6Q 3TS2A 3OW7A 4GLVB 3CCUA 2LKVA 4G7ZC 3QIAA 2EZVA 5IYDG 1T5XD 4HEDA 1FGUA 1XNRL 1H9JA 1STBA 3PF4A 3DLLA 4GOPB 1O80A 1I94L 2ZJQA 3W3AA 4P71A 2NZOA 4MTNA 2K5NA 1HNWL 5LMUL 2HDLA 4MN3A 4OX9L 1DONA 2X6LA 2UU9Q 3OMCA 5HGQA 5IIFA 2B2VA 1W2BA 2SNSA 2B8GA 3RZOB 4GKJQ 2G9DA 1B53A 4DR3L 2LSSA 4IUQA 3IL8A 4CDEC 2Q2IA 1GM5A 1EWCA 1JJ2A 1PH7A 2WB1G 3BYTB 3D6CA 3N52A 1X6OA 4A3LG 1VQPA 3C2PA 2UXCL 1HUNA 2IL8A 4CJ2C 2PYKA 3D4WA 4KY7A 1I50H 4OHJA 5GAGC 4K8JA 1WD1A 2K7VA 4V190 2Z4HA 1UE1A 3DEOA 4FO2A 3H0GG 1VQ8A 2N3SA 3PCOB 5J1ZA 3HGBA 3H6MA 1Q8KA 3MXNA 4LF4Q 4DR4Q 2B2WC 2BH8A 4KHZA 3QJYA 1RL2A 2ZTCA 3U4ZA 3Q24A 3A56A 1LTTD 4HJ7A 4JOIC 3G6EA 4KI0A 2YYZA 1J5EL 1R4QB 5C44B 1DM0B 1NTGA 1N36L 3PUZA 3EN2A 4A76A 1CKMA 1JT8A 1XX8A 1H9KA 1YJWA 2CWAA 5C3WA 1B50A 2HCCA 5CV8A 4XDXA 1QNKA 5FO9B 4KD3A 2VB2X 1UE7A 1I6HH 1C0AA 1Z7TA 1YNND 3GD7A 3PIO3 4HJ8A 2QDBA 4IPCA 4XT1B 2VQEQ 5EKKA 3F2UA 1CSPA 4ZKCB 1NNXA 1PRTB 1M4VA 5F2DA 2F52A 1BCPF 5GADC 4RGOS 1U0LA 1B70B 2ZXOA 5LMNW 1X3QA 3ERSX 1KDBA 1LO5D 3CCJA 1IBKL 3WDNA 4JI8Q 2EYOA 1HZ9A 4UP9A 5LMUQ 3I4MH 1EY7A 3ZJYC 4A3EH 2F0VA 1A2UA 1BCPB 3WOFA 2JN4A 2HQEA 1FNUA 2A6HD 2UXDL 2VQFL 2F0DA 1F9QA 5IGGA 2XGTA 5CV4A 2BCOA 1SSOA 5ELFA 1K28A 5I6WA 3KBGA 1KTKA 2K5VA 3S16B 3VYUA 1Q3LA 3GDEA 3L3OC 2MP1A 3H91A 4ZLTF 4V0BA 3H0GH 4B3ML 1PHJA 1LTLA 3HOYB 2RSOA 2O5IC 1G6PA 2F0KA 3BJUA 1IZ6A 4DK6C 4A93H 4OIJA 3FDTA 3SK6A 4N8X1 5LMNQ 1HUMA 4JI7L 1LTSD 2A69D 2PNRC 3I73A 3E9HA 2AQ3B 2ICIA 3BDCA 4YWKA 3GQBA 3RN5A 4B08A 2NVQH 1TWFH 1A8VA 1CSQA 1HRJA 2PZTA 5CBAE 1ICWA 1BBXC 2JA7H 4GKKQ 5IYBH 1RF2D 3D31A 5I2YA 1WCMB 1JB7A 2IJ0A 1K3RA 4F7XA 1FNVA 3VR6A 1G91A 2EYMA 1JOKA 4IOCA 3ICEA 1X56A 3FRPB 4BBRG 2PI2E 4ZAIA 1SNMA 1SE3A 4JBMA 2AWNA 1YZ6A 4JI2L 1J5EQ 4K6LA 5KEEA 2Y0SE 4A3CH 2KENA 3NTKA 2KHIA 3NE5B 5JPMC 3RZDH 3R2IA 3EFXD 1LTGD 2TMPA 2NN6H 4OO1H 4LF4L 4DR4L 4XYQA 3PF5A 3GV6A 1B1ZA 3CKIB 1XPUA 3LNNA 1X9NA 4JW0A 5GAHC 4X3SA 4IFDG 5KYIA 1JJCB 1TWFB 5KNBA 1KAAA 2PPBC 2R93G 1LUZA 1PH3A 2A1AA 1VQBA 1E24A 1SFOH 1X32A 3GO5A 1KNEA 2LY7A 1BKBA 3FMCA 3PUVA 5C4ZA 3J7ZC 5EPJA 2F0TA 3MXNB 1NMFA 4GNXB 1VMPA 2K50A 4LNQA 2B8FA 4DV4Q 3GTMH 2A69C 4PMCA 1GOZA 3V96A 4X3KA 3CCEA 4DV2Q 4WJ4A 4QIWB 5IYCG 1PH2A 3M4OH 3W2DA 4DF7A 5IYBG 1JE4A 1LM0A 1VQ5A 4J1MA 4A3DB 3H94A 1V1QA 1A3TA 1SMYC 1BR9A 4KHPQ 1JCKB 1HNXL 3MEHA 4CBVA 1OXUA 1I4GA 1G291 1M8AA 1NUCA 1WJJA 1JC7A 4DR1Q 4JI0L 5M5XH 4A3JG 4HMJA 1N9WA 2JE6I 3R93A 1F9PA 3VR4A 1MHWC 3U9SA 5C4JB 3T1HL 1UE5A 1EIYB 4JV5Q 4H02A 2C9OA 1WTXA 3EVQA 2F3IA 1VQEA 4B9XA 2EXDA 3QB3A 4JC0A 2CW0C 2NBFA 4BBSB 2ZTEA 2B2WA 3OWEB 1I4RA 4HCSA 2D9UA 4DAPA 1GUNA 1K9MC 3GTKB 1CKNA 1H9RA 2I5LX 5IT9L 3S14H 4R4OA 2PW7A 3PO2H 2EJGC 4L6TB 3HOYG 2JA8H 4DUZQ 1Y69U 2DY8A 1GXDC 4YY3L 1JJGA 3C46A 2CFMA 4XT3B 4YWMA 2FXQA 1V1PB 1YEZA 1HFNA 1EWIA 2DUDA 1GVPA 2BA1A 2SOBA 4F8MA 1SYEA 5C3XA 4JI3Q 1II3A 1G51A 4KK7A 4KJOA 3STBC 1OXXK 1VDZA 1BBWA 1ZYRD 3JC66 3K0YA 3CCSA 4R4CA 3M9BA 3HKZB 5C0XH 1PH8A 4A3JB 1A62A 1SRUA 4KTAA 2NB0A 5C44H 4KJNA 1WCMG 1X3EA 2F0JA 4EQNA 1HZBA 1O78A 4DR7Q 4QIWE 4CGYB 3K5MA 1CHQD 1QB5D 4NW2A 1K8OA 2RSNA 4LFCL 4LUOA 4BY1H 3DWPA 5EGTA 3GTJB 2DJFC 1QVCA 4YHHQ 4FVMA 1X3PA 2E2DC 2GVAA 3JAME 3GTPH 3DM3A 5KIXA 1HPCA 3NTIA 1NSNS 1PRTC 1YVCA 1SR3A 3A7AB 1UWVA 4HMIA 1EFWA 1XXGA 1UEBA 2CHBD 4HJ5A 2ZT9C 4GN5A 3GP7A 3NWTA 2ZXRA 4K0KL 1G8ZD 1NBWA 5IP7G 4HIOA 1K8GA 3HOWH 2UXBQ 4DV7Q 4RKBA 1V8QA 1T5EA 1WTVA 3TZDA 1PV4A 4R4TA 1PFSA 1FD7D 4RGMA 3AQQA 3L7ZC 4G4KA 2K04A 3FKIG 4K14A 1VQGA 4JI1Q 2G5DA 4PZ8A 1F2MA 3W1GA 4BY1G 1HNZL 1RODA 4NXNQ 5C3EB 4GKJL 4UY8C 1HNXQ 4R8NA 4I65A 3TBIB 5C0XG 1SEBD 2F0MA 2Q2UA 3HOXB 4UHVA 1Y1VG 4P2CB 1EZ6A 1EIGA 3VA7A 1B44D 2EIFA 1U4MA 3D3RA 1Y1WH 1XPRA 1FYCA 4CKEA 1O7LA 4DV2L 4K6DA 3CW2C 4K2LA 3CMAA 2J0TD 3P20A 1Y8OB 2OQKA 4ZUIA 3SR1A 4WJWA 2R61A 4UP8A 2VNUD 5A2QE 3HOZG 2KBNA 4DUZL 1QNUA 4FNFA 1YNJC 1V9PA 4Y7NH 4LWCA 3IRBA 4HIKA 1AP0A 5DNFA 1QJOA 5ISRA 1B2TA 4DFAA 2ZXPA 4NPSA 4AYBB 1XTCD 4A3KH 3UE0A 1LYLA 4Y7NB 2F0EA 3EROA 1HR0W 1QZHA 2LXKA 2PCFB 3SK8A 4DN4M 4JI2Q 4HIMA 5CV7A 1PRTD 3D0FA 3HOXH 4PMBA 4XTCS 1SE8A 1EUJA 4C56C 5ELCA 4YWLA 3HOXG 5M5YH 4O42A 1DOKA 3HP3A 4RAUC 2N49A 3E9IA 2AWOA 3A8IE 4POGA 5L37A 1YIJA 4ULLA 1DZ1A 1R4PB 1I4XA 4R4IA 1S72A 2RA4A 2E8GA 1MKHA 4JG2A 4XYOA 2I07B 2OEOA 2Q8TA 3M4PA 2B3GA 2UUBQ 1DGSA 1NE3A 2R93H 3G6JB 1VMCA 1K8AC 2E2JB 1LT5D 1OXTA 3OOCA 2Z4IA 1LACA 1STHA 1GHJA 4ZUJA 4A3BG 1NJIC 4DV1L 4C3JB 1I5FA 3BVMA 1BF4A 2JA7B 2J4XA 3GTQB 1SN8A 2AQ2B 1U9RA 3CMEA 3F2BA 4IUTA 4YCWA 2EY2A 5EKLA 4HIDA 4DV0Q 1N8RC 4A3DH 5K36H 2NVXB 1U4LA 3PGZA 3SHLA 3S2DH 3FP9A 4MIUA 3HOVB 4LJZC 5ELDA 3KBXA 4O1NA 2PI2A 1I6VC 2RVLA 1T9HA 1I4PA 2OTJA 5C4XG 5EBDA 1B9NA 2JK8A 2A6ED 3NPPA 5I9OA 4BWGB 4UPAA 3PSIA 2KHSA 1B4OA 3SK4A 3S15H 2K5WA 1PMRA 1VF5C 4CDCC 4LF9Q 1HXYD 1JORA 1CHPD 4ALPA 3PO3H 1W3SA 4BXXG 2CH4W 5FJ8G 4X64Q 1XNRQ 1L1OC 3RLNA 2BH2A 4GKKL 3VR3A 4A3MG 2M00A 5FLMG 4BY7G 2UUCQ 2YV5A 3RNUA 2FINB 2EVBA 4KKUA 1XMOQ 5H1SE 3LWEA 3Q6SA 3S16H 2IPKD 1PTOD 4K5XA 2N88A 2B63B 1KDCA 3LGJA 4A3GB 4G57A 2MFIA 5JJLA 2JXMB 1HJPA 2L12A 5C0XJ 4RGTA 3U4VA 1BVSA 1Q86C 4JK1C 5JJKA 1SLJA 3VR2A 4DAYB 1GUGA 2Y0SB 4CJ1B 2CQOA 4IFDH 3BYYB 2RHQB 1LTRD 1EOTA 2HIXA 5C6AA 2YU9H 1KQSA 1CM9A 1NR2A 2F4VQ 1ZYRC 1FVIA 2YTVA 2JEAI 2A6EC 3S1NH 2HUGA 1ZXTA 2AHOB 5EJWA 2K52A 3KUPA 3I55A 1TR5A 2F0FA 1CZGA 4O2DA 3CC7A 2MQHA 3TP8A 3MFGA 1A3VA 4QF4A 4OONA 3M7GA 2NVXH 1SYDA 1VQAA 4N9TA 1N36Q 3SVMA 5EKIA 2K05A 4A3GH 4CDFC 4P75A 2B63H 4TRDA 1F9SA 2B63G 1Y14B 2AUKA 3KK7A 4FF1A 3J81c 1PTOF 2QCPX 3CP0A 4DR7L 3HOWB 4LUZA 4Z9CB 2EPBA 4FXKC 4CDDC 4KKTA 1KABA 1CUKA 2I46A 3L2PA 1XPOA 3J81i 1Q1EA 1STAA 4LUVA 1SROA 1FNWA 1L2FA 2PMZE 3CCRA 2K4KA 1J6QA 5JPNC 4A3IH 5K5PA 2ZM6Q 4J15A 3E3XA 4DV5L 4CKBA 4A3KG 3S17H 3L9AX 4G7OC 3ULLA 2NZHA 1IKLA 2R7DA 2XN9C 5IGFA 2EYJA 4P74A 1TWAH 1VQ6A 5E4XA 1K73C 4KD4A 1SYGA 4LMQD 1R9TH 3SGIA 4L63B 2UU9L 2JA8G 5E3FA 1HFGA 1TWHH 5FLXE 2R7ZG 1HA6A 1E2VA 1LT4D 1YNNC 4A3KB 1VQCA 4A3LH 1YITA 4DR2Q 4ODGA 1QUQB 2EOTA 3M3YH 1U4RA 1L0YB 1TQOA 3TQYA 4DXGA 3HOUG 1EY0A 5CC4A 3OTOL 2IT1A 1A2TA 1Q82C 4QUFA 1ENFA 1Y1WG 4FF4A 2A68D 2FHTA 1IXRA 3SE0A 4YCVA 4KKSA 2Q8RE 1F2YA 2VXWA 4DPGA 4JI8L 3PO3G 3TP5A 2VZAA 3VDYA 4A3GG 1CI3M 2RCNA 3Q8DA 4HJ9A 1IBLL 2PNHA 3UI2A 2D62A 3BDLA 4NXNL 2B2TC 4AIMA 4FXDA 3D6WA 2IWHA 4X62Q 1VQJA 5IWAL 2VL6A 2DJGC 4JVZA 4B3SL 2B2TA 3M4YA 1ASZA 1EYAA 1PH9A 4IPGA 5TSSA 2C35B 1D7QA 3K0XA 4DR5L 2E2IB 1PFNA 4DK0A 1QOHA 2ID0A 4K5VA 4C3HB 2QDLA 3UDFA 3J81L 3OPOA 1Q81C 2EYHA 2O5JC 2B2VC 4A3EB 3KJOA 4LF8Q 4H44C 2F4VL 3GTKH 3J7YW 4JI4Q 1DOMA 4H7BA 1O7IA 2PQEA 1DD2A 2JA9A 4M8AA 1M1KC 1ONLA 2OCEA 3TN2A 3S1RB 2ZM6L 3NTHA 4P73A 1IHZA 4AH6A 2MNAA 3KLRA 1FJGL 4Y52H 4JCVE 5C44G 4RCOA 2KJXA 3Q23A 3R3OA 1S5ED 1QZGA 5FO7B 4TSSA 1EEID 2WKDA 1VQFA 3X3NA 3BS1A 1GUWA 3GTJH 2RDGA 1I6HB 1TS3A 4IO9A 1HNZQ 5CV5A 2NN6I 3D8GA 3EIVA 3I4MG 2XWBB 1TY0A 2HIVA 4Q0FA 5IT9E 4EQOA 4QJFA 4LFBL 1I4HA 3MTSA 1JQYD 1KHIA 2ES2A 5KRUA 1KNAA 5C3EG 4RKLA 1CQFA 2NZ1D 4LFAQ 3AEVA 5DM63 2K14A 5IGDA 5AJ3L 5D3IB 4EGVA 5FO8B 3OIPA 2B29A 4HSPA 2QEXA 2I5HA 2CVRA 2R7FA 2L55A 4KMUC 4LF6L 1G6ZA 1LTAD 4HSVA 3KLSX 2K1BA 1SYFA 3LWUA 4UAIA 5IE8A 3I8ZA 2KCNA 1EL0A 1FL0A 5CORA 4DUYL 3TEHB 5IGBA 1L0XB 4RGNA 3CHBD 3NP8A 4LFBQ 4O0AA 4YCUA 4LW1A 5COYA 3QOLA 1A63A 2E5LQ 2L15A 4X65L 3KYHC 2IY5B 4GZYC 1BBUA 2YTYA 1IBLQ 1TWGB 4BY1B 4IUPA 2LMCB 5LL6S 4RMFA 2A19A 2GVBA 2B39A 3R8BA 1B9MA 2K03A 3V05A 2UUAL 1Y1VB 3G71A 3PIOA 2HCIA 1A0IA 1OXSC 2YTXA 4X3TA 4YHHL 1KD1C 3T51B 1EWHA 4X6AH 2D0OA 2KCMA 2BE5C 4A75A 5LMNL 1ENCA 4JI7Q 2YU9B 1YJ9A 1LABA 2Y0SG 3MEFA 4JPBW 3QG1A 3SK5A 1JB3A 1EIFA 2OTLA 1QCBD 1SBBB 4A3BH 1OO9B 4ME3A 1EY5A 1SMYD 2JA5B 1TT2A 1V1PA 1ESFA 3HKZE 5C5LA 4XQJA 2NWGA 5JVG3 2Q2TA 5CV6A 2XRSD 1SAPA 1KRTA 1IKMA 4JI5Q 2VUMB 4K5WA 2WIIB 1CT1D 4ILWA 1LV9A 1AZQA 3GTQH 2D2CC 4AYBG 3J81j 3VA5A 2KA7A 3K8AA 4DV3L 4BBSH 3JAML 1BUVT 3BZCA 5EAYA 1HR0Q 2L9HA 3KDFA 3HOZH 3K57A 1E2WA 3O13A 1C9OA 4QY7A 4IPDA 5J22A 4RHRA 3A7LA 1EY8A 1BCPD 3A8JE 1YNJD 1WTRA 3TZUA 4IFDJ 1MSHA 1IL2A 1Y8NB 3FEWX 1RCVD 1CA6A 1PZKD 5E4WC 4A3DG 1XMOL 4CJ0B 2QEJC 5HY6A 4DV4L 3FPPA 3S15B 4PG3A 4NP5A 5I2XA 3S1QH 4DV5Q 1XMQL 3I91A 3RZOH 5M3FG 3JAMi 2EY5A 2NYZD 1TVXA 3F8TA 1MSGA 2EYLA 4PQXA 4A93G 3N6RA 2JP1A 5DAUA 3CRKC 2C5CA 4QCLA 1F2LA 2PZUA 1B8AA 1IW7C 1C8CA 4B3MQ 4JYAL 2WV6D 4WJ3M 2L11A 2EY6A 4OIKA 1XTDA 1STGA 5FOBB 3U50C 2L4NA 3GTGH 2K6AA 5C4HA 1XNQL 2ICEC 3PMFA 3RLFA 4LAAA 2B2YC 2K33A 4X3UA 4DR6L 1MBYA 2ALYB 2K28A 2JEBI 3G4SA 4DNIA 4DV0L 1WVLA 3H0GB 4LF8L 5EPLA 2A74C 1JOQA 5AFWA 4GN4B 4DK1A 1VQ9A 5JJZA 3D4DA 1A6XA 1J8IA 1N32Q 4LF9L 4JI6Q 1C4QA 2PQAA 5HURA 1SNCA 3J7A5 3M4QA 3NBIA 3S1MH 2IW3A 1SNDA 1GJXA 4OWTB 1NY4A 4IALA 3S2DB 1TXYA 4DXFA 3KF8B 4OO1I 1PTOB 1YI2A 1I50B 2UUBL 1WCMH 2NUCA 1VQOA 2XRQD 5IODA 4BS9A 1Q8IA 1TIID 1GUTA 1D5XC 3HOWG 3NEMA 4DKAC 3C3LA 4R8IA 3RD4A 4X64L 4FF3A 1ESRA 3AYHB 2R92B 1A3UA 2JQOA 4X66Q 5M3MB 3EBEA 2EQSA 3R2TA 4RA8A 3DEPA 2H4OA 4N8FA 4R9WA 5M5XB 2LS01 1I3QB 1BDOA 1O7YA 3PIP3 4DV3Q 4G7HC 1E2ZA 3OWFA 1IW7D 2F0NA 2EY1A 1DXMA 3NBHB 3DHQA 4HN7A 3I4NH 1BO0A 1JMCA 2WB1E 5C4XB 2PZWA 1EEFD 2O4XA 3DWAA 5LL6X 2VS1A 2JA6H 1E3PA 1JR0D 4F88A 1WFQA 1H9SB 4PNYA 5IGCA 2DGYA 1C48A 3W5OA 1D5ZC 4A3FB 4X65Q 1EYCA 1TKWB 5A2QL 1PVOA 4JI1L 4HR7B 1M90C 3CCLA 2J7ZA 2UUCL 3H3VC 3A5ZB 4OGQC 2MJ8A 4C1NK 3QOJA 1XNQQ 4A3BB 1SNPA 4IQZA 1EFID 5DLQE 3CCVA 3WOEA 1K8MA 3S1NB 4DV7L 2EYPA 2X69A 3HOYH 4DU9A 4HJAA 4B3RQ 5E1FA 1EQTA 2QW7A 3S1RH 1GO3E 2XIWA 4DK3C 2JA5G 2CCZA 2WKCA 5BR8L 3KDFB 2Q8IB 3KLSA 5EBCA 4B3RL 2VB3X 2BDNA 1JWSD 4B3TQ 4R4QA 2WFWA 3ERQA 1ILQA 2MO0A 4OEMB 4IOAA 2RHSB 2F0SA 2P5ZX 4DR2L 1UE6A 3S9WA 2E2HH 3UDXA 3RUZA 1VCIA 5M5WB 3GTPB 1D2BA 2JA7G 1V43A 5JAVA 3CQZH 3I4OA 1N33L 2WAQG 1WTHA 2PMZB 1TS4A 1KIXA 2HD3A 1W6JA 2EDGA 1SJHD 3NQTA 5D3DA 1S4ZA 1WYDA 1HNWQ 3GTLH 4M1UB 3S1QB 4B9WA 1Y8PB 1RTOA 1Q46A 4C1NI 3Q22A 1STEA 3A54A 2IX0A 3OIQA 3M7NA 4JBJA 3K7UC 1IBMQ 2RDHA 1B3QA 4KHVA 3E0EA 2FMMA 3OTOQ 3RN2A 1ILPA 2F0OA 2LFNA 3MC0B 4NMZA 1GKHA 1WOCA 3BG3A 1CA5A 3AMUA 4GN3B 4I7ZC 3F2DA 3J7AF 1JWMD 2DY7A 1AH9A 5CMDA 5ELEA 3BVGA 1BXTA 1LTID 1HZAA 2L1BA 2OT2A 3G48A 4E6IA 2WB1B 3ND8A 4DAYA 1FGBD 4C3IH 1SFOB 2AMCB 3KFUA 2F03A 1SDFA 2PQAB 3EA6A 2HHHQ 1TWGH 2OF1A 3PIPA 4OXPA 1L0WA 3GTOB 1I3QH 4C2MB 1R9TB 1S5BD 1HQMC 2BA0A 2B2YA 2SDFA 2H5XA 1VQIA 3A74A 2Z6BA 2K5HA 1EOVA 4R1JA 1EQRA 3A8KE 2VY3A 2WACA 2KCCA 4H0LC 1BCPC 1HA5A 2KUMA 4A4IA 2VW9A 4TKOB 5CV9A 1QVFA 1PH1A 1WI5A 1DCZA 2MPMA 5IGEA 3PO3B 1GUOA 3UE1A 1HR0L 5DEHA 4OL7A 1GD7A 4N9PA 4A3EG 2F0IA 1NR4A 1ASYA 4C3HH 4DAMA 1KC8C 3HEJA 2F0LA 5KNCA 2VQEL 2EJMA 3DM1A 3HOZB 1TWCB 3T16A 5I4DA 4WFN3 4QL5A 3RR5A 4DV6L 3HOUB 2CH4A 1K83B 2R6GA 3MXUA 3MAQA 1IYJB 2K32A 3T56B 2QKIC 5M3MG 4OX9Q 3PUWA 1P8LA 4EQ5A 4LF5L 4MTKA 3CC4A 2Z6KC 2I5MX 1Z6HA 1Q12A 2SNMA 1JWUD 4GNXC 4LF7Q 4U68A 5EQ0A 2XVSA 2KEDA 3P1HA 2NVYB 3ZYYX 1D5MC 3FKIH 3I3CA 3T1HQ 4LF7L 4FYDA 1CKOA 2ASBA 4DAVA 1AFPA 1F2ZA 3I4LA 4MHEA 4RFBA 4JYAQ 3J80L 3NELA 1ML0D 5IP7H 4ZCKA 5KGUA 1LT6D 4JBKA 1U4PA 1CFMA 3TSSA 5JEAJ 2N78A 2R7ZB 5M9OA 1E7ZA 2F0HA 1RHPA 3HS0C 1I94Q 4PZ6A 3P75A 1KLGD 1SNOA 5AJ3Q 1KAWA 1ET6A 1PFMA 1TU2B 1QVGA 3HOVG 1Y1WB 5FK9C 1RJTA 2R7ZH 3I4MB 3A55A 4GS3A 1SE4A 3MXGA 3S2HB 5EPKA 3TDQA 4EX5A 2F0UA 2HQLA 5IYCH 1Q90A 1AZPA 3T53B 3CD6A 3OHXC 3NK9A 1TWAB 4AQYQ 4DR3Q 2NVQB 5C4XH 2K01A 3MXPA 2CW0D 4BA2I 1EY4A 5CR3A 3QO2A 5M3FH 1AW7A 4IUUA 1MIUA 1IYUA 5C4JH 4KLKA 2HDMA 3RZDB 4DR5Q 4L5TA 3BU2A 4YIJA 4RHSA 3I70A 4TQUS 3M85A 5IY0A 3J80i 4JI3L 3AB9A 4ZQ3A 3DXJC 4L5RC 1YHBA 5HGTA 2IX3A 5FLXL 4GOPA 1AEXA 5KNDA 2F4IA 3M4OB 2KQ3A 4KN4C 1L1OA 4RWSC 2A8VA 4GNXA 3PO2G 1VQMA 5M5YB 1D6EC 3GTGB 4BXXH 2F3WA 3TMEA 4LF6Q 3QR8A 3F2CA 4JI6L 2Z6KA 2EYFA 3Q0AA 1X3GA 1S5DD 2K75A 2FMCA 2MO1A 1YNXA 1Q7YC 1CTMA 1ENAA 3MZ5A 1TWHB 5KYLA 1N34Q 2IHFA 4NXML 1D1IA 1GHKA 1X54A 2K5DA 1SYBA 2GN5A 1KLUD 5G3LF 2WAQB 2JA5H 2OQ0A 5C3EH 1D8LA 5IYDH 5IT9c 1SJED 2VUMG 2TSSA 4DR1L 1SYCA 1S5CD 1Z9FA 4OELB 2D0PA 1MJCA 2MHVA 4KY6A 3HFZB 4C2MH 2A73B 5E7NA 5NUCA 1PYBA 1S3OA 1TS5A 1IL8A 3C1FA 4EVOA 3HKSA 3V2TA 3KLWA 4Q5VA 1MD2D 3CXCA 4C3IB 1E22A 3CF5A 2F0WA 5FLXc 4J6HA 4NKLA 1CZWA 1PZID 4UDUC 1CQVA 2QILA 2RCFA 2R92G 1F77A 3CC2A 4POFA 2UUAQ 4YY3Q 4A3MB 4BY7B 4LK1C 2GA4B 2RDFA 3CRLC 2ZJPA 2CKZB 3RLOA 4FDBA 1N32L 1IBKQ 3QWNA 3H3VH 3UDIA 4CKCA 3NSWA 1SXTA 1KL9A 3C1EA 4DNTB 3K59A 1MI2A 1H9SA 3E6ZX 3KF6A 5FJ8H 2NVTH 4F87A 1EY6A 4GLXA 4BBRH 4I7AA 2Q2HA 1YBYA 3IFTA 3CPWA 2B2UA 4QB4A 1XYIA 2KEEA 1I4QA 2NVTB 1EY9A 1PFBA 2EJFC 2WINB 4H13C 2L5TA 1NMGA 3VYSA 2E2HB 2LXJA 1SE2A 3M3YB 1H95A 5BR8Q 1UNSA 5D65A 4X66L 3H09A 1PRTF 1PLFA 2V4DA 2A6HC 1N33Q 2VUMH 2JSOA 4WORA 1OTCA 1EZ8A 4AQYL 3JAMc 3W1BA 3S14B 3IFDA 3CU7A 1FJGQ 3NBHA 4IFDI 3VYTA 1XMQQ 3MWYW 1YJNA 5CGKA 4XQNA 1K83H 5IWAQ 4L5QA 3HOUH 2IHEA 3P7JA 4JI5L 1OXVA 4IURA 4JI4L 3A0JA 1HTLD 3FHWA 1IYVA 1EQQA 2NTTA 2KECA 3A5UA 2FJ2A 1S40A 2E2IH 3J80E 3F1ZA 2F1MA 3MFYA 1X65A 4DV1Q 2PW5A 3KOJA 1EU3A 1VS0A 1WTPA 3WWVA 4IJHA 1F9RA 1XWEA 2QA4A 1Z47A 1QWYA 4OWWB 3HG9A 4DNRB 2WAQE 2PO4A 5M3MH 2A5HA 3I4NG 4KY5A 1A15A 2CWPA 5K36G 3TS0A 3K7AH 3MVVA 5IP9G 5JEAH 2JYOA 3I7FA 1B7YB 1HQRD 5LHY1 3S1MB 2XTIA 1TWCH 3GTMB 1SMXA 3OSOA 2N8NA 2F0PA 2E74C 3T13A 1RD9D 3H15A 5ELBA 4ZK9B 2MGSA 4C3HG 5G3LD 4A3FH 2EXZA 2OWOA 4BBRB 3K80C 3TREA 3ULJA 4PZ7A 4DGZA 3I2ZA 1CKNB 3BDOA 2WP8J 3VR5A 5J39A 5I9PA 1VQKA 4MZ9A 5J3BA 1ZEQX 1VF7A 4DA2A 2QF7A 1Y1VH 2BE5D 1Q1BA 1PYSB 4A93B 4HCEA 1HCZA 2DNEA 1GUSA 3DWQA 4BA1I 4GOPC 4S3SA 3ER0A 1H9MA 4X62L 2D5DA 1YHQA 1UEAB 5DM73 3STBD 2MUYA 1BNZA 1X55A 5CBEE 4KN7C 5T1IA 1WTWA 3S2HH 1NCVA 1S5FD 3GTOH 1PH4A 2OXPA 3S24A 3HOVH 3AU7A 2F0GA 1PTOC 3GTLB 2B2UC 4IN3A 3AFPA 1CK1A 2X6GA 4QMGA 1K0SA 1AE2A 4FP5D 4P72A 3T1YQ 1LTBD 3I72A 3K58A 1PH5A 4RCNA 1K0RA 3X3MA 4QGUA 1ICFB 2JA6G 1VQDA 5IOCA 3CAMA 2UXDQ
chains in the Genus database with same CATH topology
2G9HD 4ME5A 1LLRD 2M2LA 1D1KA 2DNCA 1ET9A 3IAYA 3FKIB 4U673 3S17B 3KF8A 1WD0A 4ID6A 3TP7A 1TS2A 1STYA 3URYA 4XQQA 3MHBA 5BN5A 1SNQA 2Z1CA 5JVH3 1HTPA 1LT3D 5FKAC 3PUXA 4ZYSA 1NAPA 5A35A 3FPUB 1QILA 3CQZB 3K6OA 1PZJD 2NTSA 1J9OA 1FR3A 4RH6A 1O7ZA 4ABNA 1BOSA 3IKJA 2E75C 1ZKOA 2F3VA 1WTOA 2M9VA 4FXGC 4FF2A 4HTHA 1EYDA 1PDQA 3NHHA 2KVMA 2A68C 3DUZA 3U9OA 1UAPA 1JOOA 3DMUA 4XXEA 3D4RA 3PV0A 2Z8LA 1WTQA 1STNA 3BVZA 3VYRA 2L0CA 4L8JA 2K5QA 4PMWA 3NWSA 1DOLA 1B3AA 2XNAC 4HAEA 3E0JA 3K5LA 4QUCA 3EQLC 4ZKBB 2RKSA 3RMHA 1EIHA 5D14A 2AUJD 2SEBD 2NN6G 5JOBA 2DN8A 3ND9A 3J81E 3E5SA 4J8QA 5JEAG 5BN3A 5T1GA 5M3FB 4C3IG 4JBWA 2XWJB 3LX0A 1JICA 1PXUA 1DJRD 4OO1G 3MA2B 3I90A 3SDZA 3BZDB 3T4AC 1V1OA 4K2KA 2F0QA 3SXHA 3ONAB 1DYQA 3HZXA 3GV3A 1BQQT 2JA8B 3PUYA 4C3JG 4IZ8A 1G2SA 2R3ZA 4PV1C 4KV6A 2EE1A 1PYWD 4IUVA 1UUPA 3K5NA 5C5MA 1W6KA 1EQVA 1HHVA 1RKNA 2RBMA 2XSCA 3J7AV 2BOSA 5I6YA 3K5OA 2R93B 2AQ1B 2O2LD 3FVQA 2N55A 4A3IB 3NQIA 4IUNA 3G7LA 3HRZC 3OMGA 4ZRZA 1QE6A 1MGSA 1PTOH 3ITPA 1EU4A 4NDXA 4EQPA 3NUCA 1TY2A 1QG7A 4WRDA 2CQAA 3PO2B 1AN8A 3K7AB 3SEBA 3I4NB 1G2TA 2KOLA 2ENBA 2BDOA 3TP6A 5BN4A 1RDPD 4CHTB 1E0BA 2IX1A 4XIGS 2JA6B 1RTNA 2FFKB 2RQXA 3EJIA 2E76C 1KDAA 5CYUA 2H1EA 3NXWA 5C0XI 4K8IA 3OW7A 2LKVA 4G7ZC 3QIAA 2EZVA 1T5XD 4HEDA 1H9JA 1STBA 1O80A 3W3AA 2HDLA 4MN3A 1DONA 2X6LA 3OMCA 5IIFA 2B2VA 2SNSA 2B8GA 3RZOB 2G9DA 1B53A 4IUQA 3IL8A 1EWCA 3BYTB 3D6CA 3N52A 3C2PA 1HUNA 2IL8A 4CJ2C 2PYKA 3D4WA 4KY7A 4OHJA 4K8JA 1WD1A 2K7VA 4V190 2Z4HA 3DEOA 4FO2A 5J1ZA 3HGBA 3H6MA 3MXNA 2B2WC 4KHZA 3QJYA 3Q24A 3A56A 1LTTD 4KI0A 2YYZA 1R4QB 5C44B 1DM0B 3PUZA 1XX8A 1H9KA 5C3WA 1B50A 2HCCA 5CV8A 4XDXA 1QNKA 5FO9B 4KD3A 2VB2X 1Z7TA 1YNND 3GD7A 3PIO3 2QDBA 4XT1B 5EKKA 3F2UA 4ZKCB 1PRTB 1M4VA 5F2DA 1BCPF 4RGOS 2ZXOA 1X3QA 1KDBA 1LO5D 3WDNA 2EYOA 1EY7A 2F0VA 1A2UA 1BCPB 3WOFA 2HQEA 1FNUA 2A6HD 2F0DA 1F9QA 5IGGA 5CV4A 2BCOA 1SSOA 5ELFA 5I6WA 3KBGA 1KTKA 3S16B 3VYUA 1Q3LA 3L3OC 2MP1A 3H91A 4ZLTF 4V0BA 3HOYB 2RSOA 2O5IC 2F0KA 4OIJA 3FDTA 3SK6A 1HUMA 1LTSD 2A69D 2PNRC 3I73A 2AQ3B 2ICIA 3BDCA 3GQBA 4B08A 1HRJA 2PZTA 5CBAE 1ICWA 1BBXC 1RF2D 3D31A 5I2YA 1WCMB 2IJ0A 4F7XA 1FNVA 3VR6A 1G91A 2EYMA 1JOKA 3FRPB 4ZAIA 1SNMA 1SE3A 2AWNA 4K6LA 5KEEA 3NTKA 3NE5B 5JPMC 3R2IA 3EFXD 1LTGD 2TMPA 2NN6H 4OO1H 4XYQA 3GV6A 1B1ZA 3CKIB 3LNNA 4X3SA 4IFDG 5KYIA 2PPBC 1TWFB 5KNBA 1KAAA 1X32A 3GO5A 1KNEA 2LY7A 5C4ZA 3FMCA 3PUVA 5EPJA 2F0TA 1VMPA 2B8FA 2A69C 4PMCA 1GOZA 3V96A 4X3KA 4QIWB 3W2DA 4DF7A 1JE4A 4J1MA 4A3DB 3H94A 1A3TA 1SMYC 1BR9A 1JCKB 3MEHA 4CBVA 1OXUA 1I4GA 1G291 1M8AA 1NUCA 1JC7A 4HMJA 3R93A 2JE6I 1F9PA 3VR4A 3U9SA 5C4JB 2C9OA 1WTXA 3EVQA 4B9XA 3QB3A 2CW0C 2NBFA 4BBSB 2B2WA 3OWEB 1I4RA 4HCSA 2D9UA 4DAPA 1GUNA 3GTKB 1H9RA 5IT9L 2PW7A 2EJGC 4L6TB 1Y69U 2DY8A 1GXDC 3C46A 4XT3B 1V1PB 1HFNA 2BA1A 4F8MA 2SOBA 1SYEA 5C3XA 1II3A 4KK7A 4KJOA 1OXXK 1VDZA 1ZYRD 3K0YA 3HKZB 5C0XH 4A3JB 4KTAA 2NB0A 4KJNA 2F0JA 4EQNA 1O78A 4CGYB 3K5MA 1CHQD 1QB5D 4NW2A 1K8OA 2RSNA 3DWPA 5EGTA 3GTJB 4FVMA 1X3PA 2E2DC 3JAME 5KIXA 1HPCA 3NTIA 1NSNS 1PRTC 3A7AB 4HMIA 1XXGA 2CHBD 2ZT9C 3GP7A 3NWTA 2ZXRA 1G8ZD 4RKBA 1V8QA 1T5EA 1WTVA 3TZDA 1FD7D 4RGMA 3L7ZC 4G4KA 2K04A 4K14A 1F2MA 1RODA 5C3EB 4R8NA 4I65A 3TBIB 5C0XG 1SEBD 2F0MA 3HOXB 4P2CB 1EZ6A 1EIGA 3VA7A 1B44D 1U4MA 3D3RA 1FYCA 4CKEA 1O7LA 4K6DA 4K2LA 2J0TD 3P20A 1Y8OB 4ZUIA 3SR1A 4WJWA 2R61A 2VNUD 5A2QE 1QNUA 4FNFA 1YNJC 1AP0A 5DNFA 1QJOA 5ISRA 1B2TA 4DFAA 2ZXPA 4AYBB 1XTCD 4Y7NB 2F0EA 3EROA 3SK8A 2PCFB 4DN4M 5CV7A 1PRTD 4PMBA 4XTCS 4C56C 5ELCA 4O42A 1DOKA 3HP3A 4RAUC 2AWOA 3A8IE 4ULLA 1DZ1A 1R4PB 1I4XA 2RA4A 4XYOA 2I07B 2OEOA 2Q8TA 3G6JB 1VMCA 2E2JB 1LT5D 1OXTA 3OOCA 2Z4IA 1LACA 1STHA 1GHJA 4ZUJA 4C3JB 3BVMA 1BF4A 2JA7B 2J4XA 3GTQB 2AQ2B 1U9RA 4IUTA 2EY2A 5EKLA 5K36H 2NVXB 1U4LA 3SHLA 3HOVB 4MIUA 4LJZC 5ELDA 3KBXA 4O1NA 1I6VC 2RVLA 1I4PA 5EBDA 1B9NA 2A6ED 3NPPA 5I9OA 4BWGB 2KHSA 1B4OA 3SK4A 2K5WA 1PMRA 1VF5C 1JORA 1HXYD 1CHPD 3VR3A 2M00A 2FINB 2EVBA 4KKUA 3LWEA 3Q6SA 2IPKD 1PTOD 4K5XA 2N88A 2B63B 1KDCA 4A3GB 4G57A 2JXMB 2L12A 5C0XJ 4RGTA 4JK1C 3VR2A 1GUGA 2Y0SB 4CJ1B 4IFDH 3BYYB 1LTRD 1EOTA 5C6AA 1CM9A 1NR2A 1ZYRC 2JEAI 2A6EC 2HUGA 1ZXTA 5EJWA 3KUPA 1TR5A 2F0FA 1CZGA 3TP8A 3MFGA 1A3VA 4QF4A 3M7GA 1SYDA 4N9TA 3SVMA 5EKIA 2K05A 4TRDA 1F9SA 2AUKA 3KK7A 4FF1A 1PTOF 2QCPX 3HOWB 4Z9CB 2EPBA 4FXKC 4KKTA 1KABA 2I46A 1Q1EA 1STAA 1FNWA 5JPNC 5K5PA 4CKBA 3L9AX 4G7OC 1IKLA 2XN9C 5IGFA 2EYJA 5E4XA 4KD4A 1SYGA 4LMQD 4L63B 5E3FA 1HFGA 5FLXE 1HA6A 1E2VA 1LT4D 1YNNC 4A3KB 4ODGA 2EOTA 1U4RA 1L0YB 1TQOA 4DXGA 1EY0A 5CC4A 2IT1A 1A2TA 4QUFA 1ENFA 4FF4A 2A68D 2FHTA 3SE0A 4KKSA 2Q8RE 1F2YA 2VXWA 3TP5A 1CI3M 3UI2A 2D62A 3BDLA 2B2TC 4FXDA 3D6WA 2IWHA 2B2TA 3M4YA 1EYAA 5TSSA 2E2IB 1PFNA 4DK0A 1QOHA 2ID0A 4K5VA 4C3HB 3J81L 3OPOA 2EYHA 2O5JC 2B2VC 4A3EB 4H44C 3J7YW 1DOMA 4H7BA 2PQEA 1DD2A 4M8AA 1ONLA 3TN2A 3S1RB 3NTHA 1IHZA 3KLRA 4RCOA 2KJXA 3Q23A 3R3OA 1S5ED 5FO7B 4TSSA 1EEID 2WKDA 3X3NA 3BS1A 1GUWA 2RDGA 1I6HB 1TS3A 5CV5A 2NN6I 3D8GA 2XWBB 1TY0A 4Q0FA 5IT9E 4EQOA 1I4HA 3MTSA 1JQYD 5KRUA 1KNAA 4RKLA 1CQFA 2NZ1D 5DM63 5IGDA 5D3IB 4EGVA 5FO8B 3OIPA 4HSPA 2CVRA 2L55A 4KMUC 1G6ZA 1LTAD 4HSVA 3KLSX 2K1BA 1SYFA 3LWUA 4UAIA 3I8ZA 2KCNA 1EL0A 5CORA 5IGBA 1L0XB 4RGNA 3CHBD 3NP8A 5COYA 3QOLA 4GZYC 1TWGB 4BY1B 4IUPA 2LMCB 5LL6S 2B39A 3R8BA 1B9MA 2K03A 3V05A 1Y1VB 2HCIA 1OXSC 4X3TA 3T51B 1EWHA 2BE5C 1ENCA 2YU9B 1LABA 3QG1A 3SK5A 1JB3A 1QCBD 1SBBB 1OO9B 1EY5A 1SMYD 2JA5B 1TT2A 1V1PA 1ESFA 5C5LA 4XQJA 2NWGA 5JVG3 5CV6A 2XRSD 1SAPA 1IKMA 2VUMB 4K5WA 2WIIB 1CT1D 4ILWA 1LV9A 1AZQA 2D2CC 3VA5A 2KA7A 3JAML 1BUVT 2L9HA 3K57A 1E2WA 3O13A 5J22A 4RHRA 3A7LA 1EY8A 1BCPD 3A8JE 1YNJD 1WTRA 3TZUA 4IFDJ 1MSHA 1Y8NB 3FEWX 1RCVD 1CA6A 1PZKD 5E4WC 4CJ0B 2QEJC 3FPPA 3S15B 4NP5A 5I2XA 3I91A 2EY5A 2NYZD 1TVXA 1MSGA 2EYLA 4PQXA 3N6RA 2JP1A 5DAUA 3CRKC 2C5CA 4QCLA 1F2LA 2PZUA 1IW7C 1C8CA 2WV6D 2L11A 2EY6A 4OIKA 1STGA 5FOBB 2L4NA 2K6AA 5C4HA 2ICEC 3PMFA 3RLFA 4LAAA 2B2YC 2K33A 4X3UA 1MBYA 2K28A 2JEBI 1WVLA 3H0GB 5EPLA 2A74C 1JOQA 5AFWA 4DK1A 5JJZA 3D4DA 1A6XA 1J8IA 1C4QA 5HURA 1SNCA 3NBIA 2IW3A 1SNDA 1GJXA 4IALA 3S2DB 4DXFA 4OO1I 1PTOB 1I50B 2NUCA 2XRQD 5IODA 4BS9A 1Q8IA 1TIID 1GUTA 1D5XC 3C3LA 4R8IA 3RD4A 4FF3A 1ESRA 2R92B 1A3UA 5M3MB 3R2TA 4RA8A 3DEPA 2H4OA 4R9WA 5M5XB 2LS01 1I3QB 1BDOA 1O7YA 3PIP3 4G7HC 1E2ZA 3OWFA 1IW7D 2F0NA 2EY1A 1DXMA 3DHQA 4HN7A 1BO0A 5C4XB 2PZWA 1EEFD 2O4XA 3DWAA 5LL6X 4F88A 1JR0D 1H9SB 4PNYA 5IGCA 1C48A 1D5ZC 4A3FB 5A2QL 1EYCA 1TKWB 4HR7B 2J7ZA 3H3VC 4OGQC 2MJ8A 4C1NK 3QOJA 4A3BB 1SNPA 4IQZA 1EFID 3WOEA 1K8MA 3S1NB 2EYPA 2X69A 4DU9A 5E1FA 1EQTA 2XIWA 2WKCA 2Q8IB 3KLSA 5EBCA 2VB3X 2BDNA 1JWSD 3ERQA 1ILQA 2F0SA 3S9WA 3RUZA 3GTPB 1VCIA 5M5WB 1D2BA 1V43A 5JAVA 2PMZB 1TS4A 1W6JA 2EDGA 1SJHD 3NQTA 5D3DA 1S4ZA 4M1UB 3S1QB 4B9WA 1Y8PB 1RTOA 4C1NI 3Q22A 1STEA 3A54A 2IX0A 3OIQA 3M7NA 2RDHA 4KHVA 2FMMA 1ILPA 2F0OA 2LFNA 3MC0B 4NMZA 3AMUA 1CA5A 3BG3A 4I7ZC 3J7AF 1JWMD 2DY7A 5CMDA 5ELEA 3BVGA 1BXTA 1LTID 2L1BA 2OT2A 4E6IA 2WB1B 3ND8A 4DAYA 1FGBD 1SFOB 2F03A 1SDFA 3EA6A 2OF1A 3GTOB 4C2MB 1R9TB 1S5BD 1HQMC 2BA0A 2B2YA 2SDFA 3A8KE 2WACA 2KCCA 4H0LC 1BCPC 1HA5A 2KUMA 4TKOB 5CV9A 1DCZA 2MPMA 5IGEA 3PO3B 1GUOA 5DEHA 4OL7A 4N9PA 2F0IA 1NR4A 3HEJA 2F0LA 5KNCA 2EJMA 3DM1A 3HOZB 1TWCB 3T16A 5I4DA 4WFN3 3HOUB 1K83B 2R6GA 3MXUA 3MAQA 2K32A 3T56B 2QKIC 3PUWA 1Z6HA 1Q12A 2SNMA 1JWUD 4U68A 5EQ0A 2XVSA 2KEDA 3P1HA 2NVYB 3ZYYX 1D5MC 3I3CA 4FYDA 4DAVA 1AFPA 1F2ZA 3I4LA 4MHEA 4RFBA 3J80L 1ML0D 5KGUA 1LT6D 1U4PA 1CFMA 3TSSA 5JEAJ 2R7ZB 5M9OA 2F0HA 1RHPA 3HS0C 3P75A 1KLGD 1SNOA 1ET6A 1PFMA 1TU2B 1Y1WB 5FK9C 1RJTA 3I4MB 3A55A 1SE4A 3MXGA 3S2HB 5EPKA 3TDQA 2F0UA 1AZPA 1Q90A 3T53B 3OHXC 3NK9A 1TWAB 2NVQB 2K01A 3MXPA 2CW0D 4BA2I 1EY4A 5CR3A 3QO2A 1AW7A 4IUUA 1IYUA 2HDMA 3RZDB 4YIJA 4RHSA 3I70A 4TQUS 3M85A 3AB9A 4ZQ3A 3DXJC 2IX3A 5HGTA 5FLXL 1AEXA 5KNDA 2F4IA 3M4OB 2KQ3A 4KN4C 4RWSC 5M5YB 1D6EC 3GTGB 2F3WA 3TMEA 2EYFA 3Q0AA 1S5DD 2FMCA 1CTMA 1ENAA 3MZ5A 1TWHB 5KYLA 1D1IA 1GHKA 2K5DA 1SYBA 1KLUD 5G3LF 2WAQB 1SJED 2TSSA 1SYCA 1S5CD 2MHVA 4KY6A 2A73B 5NUCA 1TS5A 1IL8A 3C1FA 4EVOA 3V2TA 4Q5VA 1MD2D 4C3IB 2F0WA 4J6HA 4NKLA 1CZWA 1PZID 4UDUC 1CQVA 2QILA 1F77A 4A3MB 4BY7B 4LK1C 2GA4B 2RDFA 3CRLC 3QWNA 4CKCA 3NSWA 1SXTA 3C1EA 4DNTB 3K59A 1MI2A 1H9SA 3E6ZX 4F87A 1EY6A 3IFTA 2B2UA 4QB4A 1XYIA 2KEEA 1I4QA 2NVTB 1EY9A 1PFBA 2EJFC 2WINB 4H13C 2L5TA 3VYSA 2E2HB 1SE2A 3M3YB 1UNSA 5D65A 3H09A 1PRTF 1PLFA 2V4DA 2A6HC 2JSOA 4WORA 1EZ8A 3S14B 3IFDA 3CU7A 3NBHA 4IFDI 3VYTA 3MWYW 5CGKA 4XQNA 3P7JA 1OXVA 4IURA 1HTLD 1IYVA 2NTTA 2KECA 2FJ2A 3J80E 2F1MA 3MFYA 2PW5A 1EU3A 1WTPA 1F9RA 1XWEA 1Z47A 1QWYA 3HG9A 4DNRB 2PO4A 2A5HA 1A15A 4KY5A 5K36G 3MVVA 5JEAH 2JYOA 1HQRD 5LHY1 3S1MB 3GTMB 3OSOA 2F0PA 2E74C 3T13A 1RD9D 5ELBA 4ZK9B 2MGSA 4C3HG 5G3LD 2EXZA 4BBRB 4DGZA 3BDOA 2WP8J 3VR5A 5J39A 5I9PA 1ZEQX 1VF7A 4DA2A 2QF7A 2BE5D 1Q1BA 4A93B 4HCEA 1HCZA 2DNEA 1GUSA 3DWQA 4BA1I 4S3SA 1H9MA 2D5DA 1UEAB 5DM73 2MUYA 1BNZA 5CBEE 4KN7C 5T1IA 1WTWA 1NCVA 1S5FD 2OXPA 3AU7A 2F0GA 1PTOC 3GTLB 2B2UC 4IN3A 1CK1A 2X6GA 4QMGA 4FP5D 1LTBD 3I72A 3K58A 4RCNA 3X3MA 5IOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NWG A;  1B2T A;  5D14 A;  1RTN A;  2FFK B;  3F2U A;  3MWY W;  1SAP A;  2H1E A;  2M2L A;  5E4X A;  2FIN B;  4ZKC B;  1IKM A;  1GUW A;  4LMQ D;  3LWE A;  3P7J A;  3GV6 A;  1AZQ A;  1LV9 A;  4IUR A;  4R8I A;  4NW2 A;  3Q6S A;  1WD0 A;  1ESR A;  1S4Z A;  2RSN A;  4DN4 M;  4X3S A;  1HFG A;  4U68 A;  5EQ0 A;  2N88 A;  1X3Q A;  2KEC A;  1RTO A;  2FJ2 A;  4HED A;  5T1G A;  1HA6 A;  2KED A;  2L9H A;  3MTS A;  1JIC A;  1O80 A;  4O42 A;  1DOK A;  3HP3 A;  4RAU C;  3I3C A;  1X3P A;  4RA8 A;  1X32 A;  1KNA A;  2L12 A;  2EOT A;  3DEP A;  1U4R A;  1KNE A;  2HDL A;  2FMM A;  2NZ1 D;  4MN3 A;  4R9W A;  4MHE A;  1WTP A;  1DON A;  3I90 A;  2X6L A;  5EPJ A;  1ILP A;  1DZ1 A;  1NAP A;  1VMP A;  2B2V A;  3FPU B;  1F9R A;  1CA5 A;  1O7Y A;  1F9Q A;  1WTR A;  1ML0 D;  1MSH A;  4QUF A;  4CJ1 B;  1A15 A;  2CVR A;  1IL8 A;  1B53 A;  1SSO A;  2FHT A;  1U4P A;  2DY7 A;  4X3K A;  5CMD A;  1CA6 A;  2RA4 A;  5E4W C;  3ONA B;  4CJ0 B;  1JE4 A;  2Q8R E;  4IUQ A;  1G6Z A;  3IL8 A;  1J9O A;  1EOT A;  1RHP A;  2JYO A;  3GV3 A;  4HSV A;  2Q8T A;  1CM9 A;  1NR2 A;  2K1B A;  2L1B A;  1O7Z A;  1Q3L A;  2VXW A;  1BO0 A;  3N52 A;  4UAI A;  3I91 A;  3I8Z A;  1G2S A;  2MP1 A;  1PFM A;  2R3Z A;  3H91 A;  4ZLT F;  1EL0 A;  5COR A;  2HUG A;  1ZXT A;  2EE1 A;  1TVX A;  2NYZ D;  5EJW A;  3KUP A;  2IL8 A;  2MGS A;  4ZK9 B;  1M8A A;  2RSO A;  1RJT A;  1MSG A;  3TZD A;  3UI2 A;  4CJ2 C;  1WTV A;  4IUV A;  2B2T C;  1VMC A;  1SDF A;  2K04 A;  3R93 A;  3D6W A;  2JP1 A;  1F9P A;  5EPK A;  1WD1 A;  1AZP A;  5COY A;  4XT1 B;  4OIJ A;  1HHV A;  3FDT A;  3DEO A;  1F2L A;  1WTO A;  2K01 A;  1HUM A;  1ROD A;  1BF4 A;  2B2Y A;  1WTX A;  3SVM A;  1C8C A;  4IUT A;  2SDF A;  2N55 A;  2J7Z A;  2B2T A;  3QO2 A;  5EKI A;  1PDQ A;  2K05 A;  2KVM A;  4IUP A;  4IUU A;  2L11 A;  1MI2 A;  4OIK A;  2B2W C;  2B2W A;  2MJ8 A;  2HDM A;  1EIG A;  1F9S A;  2L4N A;  4HCS A;  2D9U A;  1PFN A;  1U4L A;  3G7L A;  1HRJ A;  5CBA E;  2K03 A;  1ICW A;  1BBX C;  1U4M A;  1QE6 A;  2B2Y C;  2X69 A;  1MGS A;  3KBX A;  4X3U A;  2KUM A;  2RVL A;  1BNZ A;  2HCI A;  2K28 A;  1EQT A;  2B2V C;  5CBE E;  1WTQ A;  4X3T A;  5T1I A;  1WTW A;  2DY8 A;  2EPB A;  2MPM A;  1NCV A;  2B2U A;  2XIW A;  1WVL A;  2KEE A;  1XYI A;  1QG7 A;  4XT3 B;  5EPL A;  1DOM A;  1PFB A;  5AFW A;  1G91 A;  1XX8 A;  5JJZ A;  1HFN A;  1J8I A;  1NR4 A;  2BDN A;  1B4O A;  1DOL A;  1HUN A;  1B50 A;  2B2U C;  4RWS C;  4ZAI A;  1B3A A;  2HCC A;  3TN2 A;  2KOL A;  4HAE A;  4XDX A;  5D65 A;  2X6G A;  1G2T A;  1QNK A;  1ILQ A;  3DM1 A;  1PLF A;  4QUC A;  1E0B A;  4ZKB B;  1AP0 A;  1EIH A;  5DNF A;  1IKL A;  3IFD A; 
#chains in the Genus database with same CATH topology
 2G9H D;  2VQF Q;  4ME5 A;  3I56 A;  1LLR D;  2M2L A;  1D1K A;  2DNC A;  1ET9 A;  3IAY A;  3FKI B;  4U67 3;  3S17 B;  2I0Q A;  1EYG A;  3KF8 A;  1WD0 A;  3AFQ A;  4ID6 A;  3TP7 A;  1XJV A;  5ELN A;  3BZK A;  1TS2 A;  1STY A;  3URY A;  4XQQ A;  3MHB A;  5BN5 A;  1RIP A;  1SNQ A;  2Z1C A;  2UXC Q;  1HTP A;  5JVH 3;  1LT3 D;  5FKA C;  3PUX A;  4L5S A;  1YHA A;  2AKW B;  4ZYS A;  1NAP A;  5A35 A;  3FPU B;  1QIL A;  3CQZ B;  3KF6 B;  3K6O A;  1PZJ D;  2NTS A;  4MNO A;  4K0K Q;  1J9O A;  5JJI A;  1FR3 A;  4RH6 A;  3B6Y A;  1O7Z A;  4ABN A;  1BOS A;  3H3V I;  2Z9H A;  3IKJ A;  2E75 C;  5ELO A;  1VQ4 A;  4UP7 A;  1ZKO A;  2F3V A;  4TVA B;  1WTO A;  1MJE A;  1C7Y A;  2M9V A;  4FXG C;  4FF2 A;  4DUY Q;  2E2J H;  4HTH A;  1EYD A;  1PDQ A;  3NHH A;  2KVM A;  2UXB L;  1VQL A;  3KJP A;  4B3T L;  2A68 C;  5GAE C;  3TRZ A;  3DUZ A;  4NXM Q;  3U9O A;  1UAP A;  1JOO A;  3DMU A;  3NEN A;  4XXE A;  2V1C C;  3D4R A;  3PV0 A;  2Z8L A;  2KHJ A;  1L1O B;  1WTQ A;  1STN A;  1KXL A;  3BVZ A;  3VYR A;  4A3F G;  2L0C A;  4L8J A;  2QGQ A;  2K5Q A;  4LFA L;  1HH2 P;  4PMW A;  3CCQ A;  3NWS A;  1DOL A;  2R92 H;  1B3A A;  2XNA C;  4HAE A;  3E0J A;  4RG1 A;  3T1Y L;  4APV A;  3K5L A;  3CCM A;  3OYY A;  4QUC A;  1X3F A;  4A3C G;  3PQI A;  3EQL C;  3U58 A;  4ZKB B;  2RKS A;  3RMH A;  1EIH A;  1KRS A;  5D14 A;  5GRO A;  4LF5 Q;  2AUJ D;  2SEB D;  2NN6 G;  4IPH A;  1P16 A;  5JOB A;  5FLM H;  2NVY H;  2DN8 A;  3ND9 A;  3J81 E;  3E5S A;  4J8Q A;  5IP9 H;  5JEA G;  4A3I G;  4IJL A;  1PH6 A;  4A3J H;  5BN3 A;  5T1G A;  5M3F B;  4C3I G;  3UDG A;  4JBW A;  2XWJ B;  3LX0 A;  1JIC A;  1PXU A;  1DJR D;  4OO1 G;  3ULP A;  1IBM L;  3MA2 B;  4A3M H;  4BY7 H;  3I90 A;  3SDZ A;  4AYB E;  3BZD B;  3T4A C;  3J80 c;  5GQO A;  1V1O A;  4QQB X;  1N34 L;  4K2K A;  4GLA C;  4BBS G;  3OW2 A;  2F0Q A;  3SXH A;  3ONA B;  2HT1 A;  1DYQ A;  3HZX A;  3HKZ G;  3GV3 A;  2ATW A;  1BQQ T;  2JA8 B;  1VQH A;  3PUY A;  4C3J G;  2ZJR A;  4IZ8 A;  1G2S A;  2R3Z A;  4PV1 C;  4KV6 A;  4B3S Q;  2EE1 A;  1PYW D;  4JV5 L;  4IUV A;  1UUP A;  4NB3 A;  4JOI A;  3K5N A;  5C5M A;  1W6K A;  5M5W H;  2HHH L;  1EQV A;  1PA6 A;  1RKN A;  1HHV A;  2RBM A;  2XSC A;  4JI0 Q;  1VQ7 A;  3J7A V;  2BOS A;  5I6Y A;  3K5O A;  2R93 B;  2AQ1 B;  2O2L D;  3FVQ A;  2N55 A;  2JJQ A;  4A3I B;  3NQI A;  4IUN A;  3L0O A;  3G7L A;  3HRZ C;  3OMG A;  4ZRZ A;  1QE6 A;  4DV6 Q;  1MGS A;  1PTO H;  1AE3 A;  1HZC A;  3ITP A;  2E5L L;  1EU4 A;  4NDX A;  4EQP A;  3NUC A;  1TY2 A;  1QG7 A;  4WRD A;  2CQA A;  3PO2 B;  4LFC Q;  3CPF A;  1AN8 A;  1E1O A;  1QUQ A;  1VQN A;  3K7A B;  3SEB A;  3I4N B;  1G2T A;  2KOL A;  2ENB A;  2BDO A;  2RF4 A;  3TP6 A;  5BN4 A;  1E1T A;  1RDP D;  4CHT B;  1E0B A;  1U5K A;  4KHP L;  2KCT A;  2IX1 A;  4XIG S;  2JA6 B;  1RTN A;  2FFK B;  2RQX A;  2ZTD A;  3EJI A;  4OWX B;  2E76 C;  2Z0S A;  1JE5 A;  1KDA A;  5CYU A;  3K81 C;  2H1E A;  3NXW A;  4C3J H;  5C0X I;  1K3B C;  4K8I A;  4DR6 Q;  3TS2 A;  3OW7 A;  4GLV B;  3CCU A;  2LKV A;  4G7Z C;  3QIA A;  2EZV A;  5IYD G;  1T5X D;  4HED A;  1FGU A;  1XNR L;  1H9J A;  1STB A;  3PF4 A;  3DLL A;  4GOP B;  1O80 A;  1I94 L;  2ZJQ A;  3W3A A;  4P71 A;  2NZO A;  4MTN A;  2K5N A;  1HNW L;  5LMU L;  2HDL A;  4MN3 A;  4OX9 L;  1DON A;  2X6L A;  2UU9 Q;  3OMC A;  5HGQ A;  5IIF A;  2B2V A;  1W2B A;  2SNS A;  2B8G A;  3RZO B;  4GKJ Q;  2G9D A;  1B53 A;  4DR3 L;  2LSS A;  4IUQ A;  3IL8 A;  4CDE C;  2Q2I A;  1GM5 A;  1EWC A;  1JJ2 A;  1PH7 A;  2WB1 G;  3BYT B;  3D6C A;  3N52 A;  1X6O A;  4A3L G;  1VQP A;  3C2P A;  2UXC L;  1HUN A;  2IL8 A;  4CJ2 C;  2PYK A;  3D4W A;  4KY7 A;  1I50 H;  4OHJ A;  5GAG C;  4K8J A;  1WD1 A;  2K7V A;  4V19 0;  2Z4H A;  1UE1 A;  3DEO A;  4FO2 A;  3H0G G;  1VQ8 A;  2N3S A;  3PCO B;  5J1Z A;  3HGB A;  3H6M A;  1Q8K A;  3MXN A;  4LF4 Q;  4DR4 Q;  2B2W C;  2BH8 A;  4KHZ A;  3QJY A;  1RL2 A;  2ZTC A;  3U4Z A;  3Q24 A;  3A56 A;  1LTT D;  4HJ7 A;  4JOI C;  3G6E A;  4KI0 A;  2YYZ A;  1J5E L;  1R4Q B;  5C44 B;  1DM0 B;  1NTG A;  1N36 L;  3PUZ A;  3EN2 A;  4A76 A;  1CKM A;  1JT8 A;  1XX8 A;  1H9K A;  1YJW A;  2CWA A;  5C3W A;  1B50 A;  2HCC A;  5CV8 A;  4XDX A;  1QNK A;  5FO9 B;  4KD3 A;  2VB2 X;  1UE7 A;  1I6H H;  1C0A A;  1Z7T A;  1YNN D;  3GD7 A;  3PIO 3;  4HJ8 A;  2QDB A;  4IPC A;  4XT1 B;  2VQE Q;  5EKK A;  3F2U A;  1CSP A;  4ZKC B;  1NNX A;  1PRT B;  1M4V A;  5F2D A;  2F52 A;  1BCP F;  5GAD C;  4RGO S;  1U0L A;  1B70 B;  2ZXO A;  5LMN W;  1X3Q A;  3ERS X;  1KDB A;  1LO5 D;  3CCJ A;  1IBK L;  3WDN A;  4JI8 Q;  2EYO A;  1HZ9 A;  4UP9 A;  5LMU Q;  3I4M H;  1EY7 A;  3ZJY C;  4A3E H;  2F0V A;  1A2U A;  1BCP B;  3WOF A;  2JN4 A;  2HQE A;  1FNU A;  2A6H D;  2UXD L;  2VQF L;  2F0D A;  1F9Q A;  5IGG A;  2XGT A;  5CV4 A;  2BCO A;  1SSO A;  5ELF A;  1K28 A;  5I6W A;  3KBG A;  1KTK A;  2K5V A;  3S16 B;  3VYU A;  1Q3L A;  3GDE A;  3L3O C;  2MP1 A;  3H91 A;  4ZLT F;  4V0B A;  3H0G H;  4B3M L;  1PHJ A;  1LTL A;  3HOY B;  2RSO A;  2O5I C;  1G6P A;  2F0K A;  3BJU A;  1IZ6 A;  4DK6 C;  4A93 H;  4OIJ A;  3FDT A;  3SK6 A;  4N8X 1;  5LMN Q;  1HUM A;  4JI7 L;  1LTS D;  2A69 D;  2PNR C;  3I73 A;  3E9H A;  2AQ3 B;  2ICI A;  3BDC A;  4YWK A;  3GQB A;  3RN5 A;  4B08 A;  2NVQ H;  1TWF H;  1A8V A;  1CSQ A;  1HRJ A;  2PZT A;  5CBA E;  1ICW A;  1BBX C;  2JA7 H;  4GKK Q;  5IYB H;  1RF2 D;  3D31 A;  5I2Y A;  1WCM B;  1JB7 A;  2IJ0 A;  1K3R A;  4F7X A;  1FNV A;  3VR6 A;  1G91 A;  2EYM A;  1JOK A;  4IOC A;  3ICE A;  1X56 A;  3FRP B;  4BBR G;  2PI2 E;  4ZAI A;  1SNM A;  1SE3 A;  4JBM A;  2AWN A;  1YZ6 A;  4JI2 L;  1J5E Q;  4K6L A;  5KEE A;  2Y0S E;  4A3C H;  2KEN A;  3NTK A;  2KHI A;  3NE5 B;  5JPM C;  3RZD H;  3R2I A;  3EFX D;  1LTG D;  2TMP A;  2NN6 H;  4OO1 H;  4LF4 L;  4DR4 L;  4XYQ A;  3PF5 A;  3GV6 A;  1B1Z A;  3CKI B;  1XPU A;  3LNN A;  1X9N A;  4JW0 A;  5GAH C;  4X3S A;  4IFD G;  5KYI A;  1JJC B;  1TWF B;  5KNB A;  1KAA A;  2PPB C;  2R93 G;  1LUZ A;  1PH3 A;  2A1A A;  1VQB A;  1E24 A;  1SFO H;  1X32 A;  3GO5 A;  1KNE A;  2LY7 A;  1BKB A;  3FMC A;  3PUV A;  5C4Z A;  3J7Z C;  5EPJ A;  2F0T A;  3MXN B;  1NMF A;  4GNX B;  1VMP A;  2K50 A;  4LNQ A;  2B8F A;  4DV4 Q;  3GTM H;  2A69 C;  4PMC A;  1GOZ A;  3V96 A;  4X3K A;  3CCE A;  4DV2 Q;  4WJ4 A;  4QIW B;  5IYC G;  1PH2 A;  3M4O H;  3W2D A;  4DF7 A;  5IYB G;  1JE4 A;  1LM0 A;  1VQ5 A;  4J1M A;  4A3D B;  3H94 A;  1V1Q A;  1A3T A;  1SMY C;  1BR9 A;  4KHP Q;  1JCK B;  1HNX L;  3MEH A;  4CBV A;  1OXU A;  1I4G A;  1G29 1;  1M8A A;  1NUC A;  1WJJ A;  1JC7 A;  4DR1 Q;  4JI0 L;  5M5X H;  4A3J G;  4HMJ A;  1N9W A;  2JE6 I;  3R93 A;  1F9P A;  3VR4 A;  1MHW C;  3U9S A;  5C4J B;  3T1H L;  1UE5 A;  1EIY B;  4JV5 Q;  4H02 A;  2C9O A;  1WTX A;  3EVQ A;  2F3I A;  1VQE A;  4B9X A;  2EXD A;  3QB3 A;  4JC0 A;  2CW0 C;  2NBF A;  4BBS B;  2ZTE A;  2B2W A;  3OWE B;  1I4R A;  4HCS A;  2D9U A;  4DAP A;  1GUN A;  1K9M C;  3GTK B;  1CKN A;  1H9R A;  2I5L X;  5IT9 L;  3S14 H;  4R4O A;  2PW7 A;  3PO2 H;  2EJG C;  4L6T B;  3HOY G;  2JA8 H;  4DUZ Q;  1Y69 U;  2DY8 A;  1GXD C;  4YY3 L;  1JJG A;  3C46 A;  2CFM A;  4XT3 B;  4YWM A;  2FXQ A;  1V1P B;  1YEZ A;  1HFN A;  1EWI A;  2DUD A;  1GVP A;  2BA1 A;  2SOB A;  4F8M A;  1SYE A;  5C3X A;  4JI3 Q;  1II3 A;  1G51 A;  4KK7 A;  4KJO A;  3STB C;  1OXX K;  1VDZ A;  1BBW A;  1ZYR D;  3JC6 6;  3K0Y A;  3CCS A;  4R4C A;  3M9B A;  3HKZ B;  5C0X H;  1PH8 A;  4A3J B;  1A62 A;  1SRU A;  4KTA A;  2NB0 A;  5C44 H;  4KJN A;  1WCM G;  1X3E A;  2F0J A;  4EQN A;  1HZB A;  1O78 A;  4DR7 Q;  4QIW E;  4CGY B;  3K5M A;  1CHQ D;  1QB5 D;  4NW2 A;  1K8O A;  2RSN A;  4LFC L;  4LUO A;  4BY1 H;  3DWP A;  5EGT A;  3GTJ B;  2DJF C;  1QVC A;  4YHH Q;  4FVM A;  1X3P A;  2E2D C;  2GVA A;  3JAM E;  3GTP H;  3DM3 A;  5KIX A;  1HPC A;  3NTI A;  1NSN S;  1PRT C;  1YVC A;  1SR3 A;  3A7A B;  1UWV A;  4HMI A;  1EFW A;  1XXG A;  1UEB A;  2CHB D;  4HJ5 A;  2ZT9 C;  4GN5 A;  3GP7 A;  3NWT A;  2ZXR A;  4K0K L;  1G8Z D;  1NBW A;  5IP7 G;  4HIO A;  1K8G A;  3HOW H;  2UXB Q;  4DV7 Q;  4RKB A;  1V8Q A;  1T5E A;  1WTV A;  3TZD A;  1PV4 A;  4R4T A;  1PFS A;  1FD7 D;  4RGM A;  3AQQ A;  3L7Z C;  4G4K A;  2K04 A;  3FKI G;  4K14 A;  1VQG A;  4JI1 Q;  2G5D A;  4PZ8 A;  1F2M A;  3W1G A;  4BY1 G;  1HNZ L;  1ROD A;  4NXN Q;  5C3E B;  4GKJ L;  4UY8 C;  1HNX Q;  4R8N A;  4I65 A;  3TBI B;  5C0X G;  1SEB D;  2F0M A;  2Q2U A;  3HOX B;  4UHV A;  1Y1V G;  4P2C B;  1EZ6 A;  1EIG A;  3VA7 A;  1B44 D;  2EIF A;  1U4M A;  3D3R A;  1Y1W H;  1XPR A;  1FYC A;  4CKE A;  1O7L A;  4DV2 L;  4K6D A;  3CW2 C;  4K2L A;  3CMA A;  2J0T D;  3P20 A;  1Y8O B;  2OQK A;  4ZUI A;  3SR1 A;  4WJW A;  2R61 A;  4UP8 A;  2VNU D;  5A2Q E;  3HOZ G;  2KBN A;  4DUZ L;  1QNU A;  4FNF A;  1YNJ C;  1V9P A;  4Y7N H;  4LWC A;  3IRB A;  4HIK A;  1AP0 A;  5DNF A;  1QJO A;  5ISR A;  1B2T A;  4DFA A;  2ZXP A;  4NPS A;  4AYB B;  1XTC D;  4A3K H;  3UE0 A;  1LYL A;  4Y7N B;  2F0E A;  3ERO A;  1HR0 W;  1QZH A;  2LXK A;  2PCF B;  3SK8 A;  4DN4 M;  4JI2 Q;  4HIM A;  5CV7 A;  1PRT D;  3D0F A;  3HOX H;  4PMB A;  4XTC S;  1SE8 A;  1EUJ A;  4C56 C;  5ELC A;  4YWL A;  3HOX G;  5M5Y H;  4O42 A;  1DOK A;  3HP3 A;  4RAU C;  2N49 A;  3E9I A;  2AWO A;  3A8I E;  4POG A;  5L37 A;  1YIJ A;  4ULL A;  1DZ1 A;  1R4P B;  1I4X A;  4R4I A;  1S72 A;  2RA4 A;  2E8G A;  1MKH A;  4JG2 A;  4XYO A;  2I07 B;  2OEO A;  2Q8T A;  3M4P A;  2B3G A;  2UUB Q;  1DGS A;  1NE3 A;  2R93 H;  3G6J B;  1VMC A;  1K8A C;  2E2J B;  1LT5 D;  1OXT A;  3OOC A;  2Z4I A;  1LAC A;  1STH A;  1GHJ A;  4ZUJ A;  4A3B G;  1NJI C;  4DV1 L;  4C3J B;  1I5F A;  3BVM A;  1BF4 A;  2JA7 B;  2J4X A;  3GTQ B;  1SN8 A;  2AQ2 B;  1U9R A;  3CME A;  3F2B A;  4IUT A;  4YCW A;  2EY2 A;  5EKL A;  4HID A;  4DV0 Q;  1N8R C;  4A3D H;  5K36 H;  2NVX B;  1U4L A;  3PGZ A;  3SHL A;  3S2D H;  3FP9 A;  4MIU A;  3HOV B;  4LJZ C;  5ELD A;  3KBX A;  4O1N A;  2PI2 A;  1I6V C;  2RVL A;  1T9H A;  1I4P A;  2OTJ A;  5C4X G;  5EBD A;  1B9N A;  2JK8 A;  2A6E D;  3NPP A;  5I9O A;  4BWG B;  4UPA A;  3PSI A;  2KHS A;  1B4O A;  3SK4 A;  3S15 H;  2K5W A;  1PMR A;  1VF5 C;  4CDC C;  4LF9 Q;  1HXY D;  1JOR A;  1CHP D;  4ALP A;  3PO3 H;  1W3S A;  4BXX G;  2CH4 W;  5FJ8 G;  4X64 Q;  1XNR Q;  1L1O C;  3RLN A;  2BH2 A;  4GKK L;  3VR3 A;  4A3M G;  2M00 A;  5FLM G;  4BY7 G;  2UUC Q;  2YV5 A;  3RNU A;  2FIN B;  2EVB A;  4KKU A;  1XMO Q;  5H1S E;  3LWE A;  3Q6S A;  3S16 H;  2IPK D;  1PTO D;  4K5X A;  2N88 A;  2B63 B;  1KDC A;  3LGJ A;  4A3G B;  4G57 A;  2MFI A;  5JJL A;  2JXM B;  1HJP A;  2L12 A;  5C0X J;  4RGT A;  3U4V A;  1BVS A;  1Q86 C;  4JK1 C;  5JJK A;  1SLJ A;  3VR2 A;  4DAY B;  1GUG A;  2Y0S B;  4CJ1 B;  2CQO A;  4IFD H;  3BYY B;  2RHQ B;  1LTR D;  1EOT A;  2HIX A;  5C6A A;  2YU9 H;  1KQS A;  1CM9 A;  1NR2 A;  2F4V Q;  1ZYR C;  1FVI A;  2YTV A;  2JEA I;  2A6E C;  3S1N H;  2HUG A;  1ZXT A;  2AHO B;  5EJW A;  2K52 A;  3KUP A;  3I55 A;  1TR5 A;  2F0F A;  1CZG A;  4O2D A;  3CC7 A;  2MQH A;  3TP8 A;  3MFG A;  1A3V A;  4QF4 A;  4OON A;  3M7G A;  2NVX H;  1SYD A;  1VQA A;  4N9T A;  1N36 Q;  3SVM A;  5EKI A;  2K05 A;  4A3G H;  4CDF C;  4P75 A;  2B63 H;  4TRD A;  1F9S A;  2B63 G;  1Y14 B;  2AUK A;  3KK7 A;  4FF1 A;  3J81 c;  1PTO F;  2QCP X;  3CP0 A;  4DR7 L;  3HOW B;  4LUZ A;  4Z9C B;  2EPB A;  4FXK C;  4CDD C;  4KKT A;  1KAB A;  1CUK A;  2I46 A;  3L2P A;  1XPO A;  3J81 i;  1Q1E A;  1STA A;  4LUV A;  1SRO A;  1FNW A;  1L2F A;  2PMZ E;  3CCR A;  2K4K A;  1J6Q A;  5JPN C;  4A3I H;  5K5P A;  2ZM6 Q;  4J15 A;  3E3X A;  4DV5 L;  4CKB A;  4A3K G;  3S17 H;  3L9A X;  4G7O C;  3ULL A;  2NZH A;  1IKL A;  2R7D A;  2XN9 C;  5IGF A;  2EYJ A;  4P74 A;  1TWA H;  1VQ6 A;  5E4X A;  1K73 C;  4KD4 A;  1SYG A;  4LMQ D;  1R9T H;  3SGI A;  4L63 B;  2UU9 L;  2JA8 G;  5E3F A;  1HFG A;  1TWH H;  5FLX E;  2R7Z G;  1HA6 A;  1E2V A;  1LT4 D;  1YNN C;  4A3K B;  1VQC A;  4A3L H;  1YIT A;  4DR2 Q;  4ODG A;  1QUQ B;  2EOT A;  3M3Y H;  1U4R A;  1L0Y B;  1TQO A;  3TQY A;  4DXG A;  3HOU G;  1EY0 A;  5CC4 A;  3OTO L;  2IT1 A;  1A2T A;  1Q82 C;  4QUF A;  1ENF A;  1Y1W G;  4FF4 A;  2A68 D;  2FHT A;  1IXR A;  3SE0 A;  4YCV A;  4KKS A;  2Q8R E;  1F2Y A;  2VXW A;  4DPG A;  4JI8 L;  3PO3 G;  3TP5 A;  2VZA A;  3VDY A;  4A3G G;  1CI3 M;  2RCN A;  3Q8D A;  4HJ9 A;  1IBL L;  2PNH A;  3UI2 A;  2D62 A;  3BDL A;  4NXN L;  2B2T C;  4AIM A;  4FXD A;  3D6W A;  2IWH A;  4X62 Q;  1VQJ A;  5IWA L;  2VL6 A;  2DJG C;  4JVZ A;  4B3S L;  2B2T A;  3M4Y A;  1ASZ A;  1EYA A;  1PH9 A;  4IPG A;  5TSS A;  2C35 B;  1D7Q A;  3K0X A;  4DR5 L;  2E2I B;  1PFN A;  4DK0 A;  1QOH A;  2ID0 A;  4K5V A;  4C3H B;  2QDL A;  3UDF A;  3J81 L;  3OPO A;  1Q81 C;  2EYH A;  2O5J C;  2B2V C;  4A3E B;  3KJO A;  4LF8 Q;  4H44 C;  2F4V L;  3GTK H;  3J7Y W;  4JI4 Q;  1DOM A;  4H7B A;  1O7I A;  2PQE A;  1DD2 A;  2JA9 A;  4M8A A;  1M1K C;  1ONL A;  2OCE A;  3TN2 A;  3S1R B;  2ZM6 L;  3NTH A;  4P73 A;  1IHZ A;  4AH6 A;  2MNA A;  3KLR A;  1FJG L;  4Y52 H;  4JCV E;  5C44 G;  4RCO A;  2KJX A;  3Q23 A;  3R3O A;  1S5E D;  1QZG A;  5FO7 B;  4TSS A;  1EEI D;  2WKD A;  1VQF A;  3X3N A;  3BS1 A;  1GUW A;  3GTJ H;  2RDG A;  1I6H B;  1TS3 A;  4IO9 A;  1HNZ Q;  5CV5 A;  2NN6 I;  3D8G A;  3EIV A;  3I4M G;  2XWB B;  1TY0 A;  2HIV A;  4Q0F A;  5IT9 E;  4EQO A;  4QJF A;  4LFB L;  1I4H A;  3MTS A;  1JQY D;  1KHI A;  2ES2 A;  5KRU A;  1KNA A;  5C3E G;  4RKL A;  1CQF A;  2NZ1 D;  4LFA Q;  3AEV A;  5DM6 3;  2K14 A;  5IGD A;  5AJ3 L;  5D3I B;  4EGV A;  5FO8 B;  3OIP A;  2B29 A;  4HSP A;  2QEX A;  2I5H A;  2CVR A;  2R7F A;  2L55 A;  4KMU C;  4LF6 L;  1G6Z A;  1LTA D;  4HSV A;  3KLS X;  2K1B A;  1SYF A;  3LWU A;  4UAI A;  5IE8 A;  3I8Z A;  2KCN A;  1EL0 A;  1FL0 A;  5COR A;  4DUY L;  3TEH B;  5IGB A;  1L0X B;  4RGN A;  3CHB D;  3NP8 A;  4LFB Q;  4O0A A;  4YCU A;  4LW1 A;  5COY A;  3QOL A;  1A63 A;  2E5L Q;  2L15 A;  4X65 L;  3KYH C;  2IY5 B;  4GZY C;  1BBU A;  2YTY A;  1IBL Q;  1TWG B;  4BY1 B;  4IUP A;  2LMC B;  5LL6 S;  4RMF A;  2A19 A;  2GVB A;  2B39 A;  3R8B A;  1B9M A;  2K03 A;  3V05 A;  2UUA L;  1Y1V B;  3G71 A;  3PIO A;  2HCI A;  1A0I A;  1OXS C;  2YTX A;  4X3T A;  4YHH L;  1KD1 C;  3T51 B;  1EWH A;  4X6A H;  2D0O A;  2KCM A;  2BE5 C;  4A75 A;  5LMN L;  1ENC A;  4JI7 Q;  2YU9 B;  1YJ9 A;  1LAB A;  2Y0S G;  3MEF A;  4JPB W;  3QG1 A;  3SK5 A;  1JB3 A;  1EIF A;  2OTL A;  1QCB D;  1SBB B;  4A3B H;  1OO9 B;  4ME3 A;  1EY5 A;  1SMY D;  2JA5 B;  1TT2 A;  1V1P A;  1ESF A;  3HKZ E;  5C5L A;  4XQJ A;  2NWG A;  5JVG 3;  2Q2T A;  5CV6 A;  2XRS D;  1SAP A;  1KRT A;  1IKM A;  4JI5 Q;  2VUM B;  4K5W A;  2WII B;  1CT1 D;  4ILW A;  1LV9 A;  1AZQ A;  3GTQ H;  2D2C C;  4AYB G;  3J81 j;  3VA5 A;  2KA7 A;  3K8A A;  4DV3 L;  4BBS H;  3JAM L;  1BUV T;  3BZC A;  5EAY A;  1HR0 Q;  2L9H A;  3KDF A;  3HOZ H;  3K57 A;  1E2W A;  3O13 A;  1C9O A;  4QY7 A;  4IPD A;  5J22 A;  4RHR A;  3A7L A;  1EY8 A;  1BCP D;  3A8J E;  1YNJ D;  1WTR A;  3TZU A;  4IFD J;  1MSH A;  1IL2 A;  1Y8N B;  3FEW X;  1RCV D;  1CA6 A;  1PZK D;  5E4W C;  4A3D G;  1XMO L;  4CJ0 B;  2QEJ C;  5HY6 A;  4DV4 L;  3FPP A;  3S15 B;  4PG3 A;  4NP5 A;  5I2X A;  3S1Q H;  4DV5 Q;  1XMQ L;  3I91 A;  3RZO H;  5M3F G;  3JAM i;  2EY5 A;  2NYZ D;  1TVX A;  3F8T A;  1MSG A;  2EYL A;  4PQX A;  4A93 G;  3N6R A;  2JP1 A;  5DAU A;  3CRK C;  2C5C A;  4QCL A;  1F2L A;  2PZU A;  1B8A A;  1IW7 C;  1C8C A;  4B3M Q;  4JYA L;  2WV6 D;  4WJ3 M;  2L11 A;  2EY6 A;  4OIK A;  1XTD A;  1STG A;  5FOB B;  3U50 C;  2L4N A;  3GTG H;  2K6A A;  5C4H A;  1XNQ L;  2ICE C;  3PMF A;  3RLF A;  4LAA A;  2B2Y C;  2K33 A;  4X3U A;  4DR6 L;  1MBY A;  2ALY B;  2K28 A;  2JEB I;  3G4S A;  4DNI A;  4DV0 L;  1WVL A;  3H0G B;  4LF8 L;  5EPL A;  2A74 C;  1JOQ A;  5AFW A;  4GN4 B;  4DK1 A;  1VQ9 A;  5JJZ A;  3D4D A;  1A6X A;  1J8I A;  1N32 Q;  4LF9 L;  4JI6 Q;  1C4Q A;  2PQA A;  5HUR A;  1SNC A;  3J7A 5;  3M4Q A;  3NBI A;  3S1M H;  2IW3 A;  1SND A;  1GJX A;  4OWT B;  1NY4 A;  4IAL A;  3S2D B;  1TXY A;  4DXF A;  3KF8 B;  4OO1 I;  1PTO B;  1YI2 A;  1I50 B;  2UUB L;  1WCM H;  2NUC A;  1VQO A;  2XRQ D;  5IOD A;  4BS9 A;  1Q8I A;  1TII D;  1GUT A;  1D5X C;  3HOW G;  3NEM A;  4DKA C;  3C3L A;  4R8I A;  3RD4 A;  4X64 L;  4FF3 A;  1ESR A;  3AYH B;  2R92 B;  1A3U A;  2JQO A;  4X66 Q;  5M3M B;  3EBE A;  2EQS A;  3R2T A;  4RA8 A;  3DEP A;  2H4O A;  4N8F A;  4R9W A;  5M5X B;  2LS0 1;  1I3Q B;  1BDO A;  1O7Y A;  3PIP 3;  4DV3 Q;  4G7H C;  1E2Z A;  3OWF A;  1IW7 D;  2F0N A;  2EY1 A;  1DXM A;  3NBH B;  3DHQ A;  4HN7 A;  3I4N H;  1BO0 A;  1JMC A;  2WB1 E;  5C4X B;  2PZW A;  1EEF D;  2O4X A;  3DWA A;  5LL6 X;  2VS1 A;  2JA6 H;  1E3P A;  1JR0 D;  4F88 A;  1WFQ A;  1H9S B;  4PNY A;  5IGC A;  2DGY A;  1C48 A;  3W5O A;  1D5Z C;  4A3F B;  4X65 Q;  1EYC A;  1TKW B;  5A2Q L;  1PVO A;  4JI1 L;  4HR7 B;  1M90 C;  3CCL A;  2J7Z A;  2UUC L;  3H3V C;  3A5Z B;  4OGQ C;  2MJ8 A;  4C1N K;  3QOJ A;  1XNQ Q;  4A3B B;  1SNP A;  4IQZ A;  1EFI D;  5DLQ E;  3CCV A;  3WOE A;  1K8M A;  3S1N B;  4DV7 L;  2EYP A;  2X69 A;  3HOY H;  4DU9 A;  4HJA A;  4B3R Q;  5E1F A;  1EQT A;  2QW7 A;  3S1R H;  1GO3 E;  2XIW A;  4DK3 C;  2JA5 G;  2CCZ A;  2WKC A;  5BR8 L;  3KDF B;  2Q8I B;  3KLS A;  5EBC A;  4B3R L;  2VB3 X;  2BDN A;  1JWS D;  4B3T Q;  4R4Q A;  2WFW A;  3ERQ A;  1ILQ A;  2MO0 A;  4OEM B;  4IOA A;  2RHS B;  2F0S A;  2P5Z X;  4DR2 L;  1UE6 A;  3S9W A;  2E2H H;  3UDX A;  3RUZ A;  1VCI A;  5M5W B;  3GTP B;  1D2B A;  2JA7 G;  1V43 A;  5JAV A;  3CQZ H;  3I4O A;  1N33 L;  2WAQ G;  1WTH A;  2PMZ B;  1TS4 A;  1KIX A;  2HD3 A;  1W6J A;  2EDG A;  1SJH D;  3NQT A;  5D3D A;  1S4Z A;  1WYD A;  1HNW Q;  3GTL H;  4M1U B;  3S1Q B;  4B9W A;  1Y8P B;  1RTO A;  1Q46 A;  4C1N I;  3Q22 A;  1STE A;  3A54 A;  2IX0 A;  3OIQ A;  3M7N A;  4JBJ A;  3K7U C;  1IBM Q;  2RDH A;  1B3Q A;  4KHV A;  3E0E A;  2FMM A;  3OTO Q;  3RN2 A;  1ILP A;  2F0O A;  2LFN A;  3MC0 B;  4NMZ A;  1GKH A;  1WOC A;  3BG3 A;  1CA5 A;  3AMU A;  4GN3 B;  4I7Z C;  3F2D A;  3J7A F;  1JWM D;  2DY7 A;  1AH9 A;  5CMD A;  5ELE A;  3BVG A;  1BXT A;  1LTI D;  1HZA A;  2L1B A;  2OT2 A;  3G48 A;  4E6I A;  2WB1 B;  3ND8 A;  4DAY A;  1FGB D;  4C3I H;  1SFO B;  2AMC B;  3KFU A;  2F03 A;  1SDF A;  2PQA B;  3EA6 A;  2HHH Q;  1TWG H;  2OF1 A;  3PIP A;  4OXP A;  1L0W A;  3GTO B;  1I3Q H;  4C2M B;  1R9T B;  1S5B D;  1HQM C;  2BA0 A;  2B2Y A;  2SDF A;  2H5X A;  1VQI A;  3A74 A;  2Z6B A;  2K5H A;  1EOV A;  4R1J A;  1EQR A;  3A8K E;  2VY3 A;  2WAC A;  2KCC A;  4H0L C;  1BCP C;  1HA5 A;  2KUM A;  4A4I A;  2VW9 A;  4TKO B;  5CV9 A;  1QVF A;  1PH1 A;  1WI5 A;  1DCZ A;  2MPM A;  5IGE A;  3PO3 B;  1GUO A;  3UE1 A;  1HR0 L;  5DEH A;  4OL7 A;  1GD7 A;  4N9P A;  4A3E G;  2F0I A;  1NR4 A;  1ASY A;  4C3H H;  4DAM A;  1KC8 C;  3HEJ A;  2F0L A;  5KNC A;  2VQE L;  2EJM A;  3DM1 A;  3HOZ B;  1TWC B;  3T16 A;  5I4D A;  4WFN 3;  4QL5 A;  3RR5 A;  4DV6 L;  3HOU B;  2CH4 A;  1K83 B;  2R6G A;  3MXU A;  3MAQ A;  1IYJ B;  2K32 A;  3T56 B;  2QKI C;  5M3M G;  4OX9 Q;  3PUW A;  1P8L A;  4EQ5 A;  4LF5 L;  4MTK A;  3CC4 A;  2Z6K C;  2I5M X;  1Z6H A;  1Q12 A;  2SNM A;  1JWU D;  4GNX C;  4LF7 Q;  4U68 A;  5EQ0 A;  2XVS A;  2KED A;  3P1H A;  2NVY B;  3ZYY X;  1D5M C;  3FKI H;  3I3C A;  3T1H Q;  4LF7 L;  4FYD A;  1CKO A;  2ASB A;  4DAV A;  1AFP A;  1F2Z A;  3I4L A;  4MHE A;  4RFB A;  4JYA Q;  3J80 L;  3NEL A;  1ML0 D;  5IP7 H;  4ZCK A;  5KGU A;  1LT6 D;  4JBK A;  1U4P A;  1CFM A;  3TSS A;  5JEA J;  2N78 A;  2R7Z B;  5M9O A;  1E7Z A;  2F0H A;  1RHP A;  3HS0 C;  1I94 Q;  4PZ6 A;  3P75 A;  1KLG D;  1SNO A;  5AJ3 Q;  1KAW A;  1ET6 A;  1PFM A;  1TU2 B;  1QVG A;  3HOV G;  1Y1W B;  5FK9 C;  1RJT A;  2R7Z H;  3I4M B;  3A55 A;  4GS3 A;  1SE4 A;  3MXG A;  3S2H B;  5EPK A;  3TDQ A;  4EX5 A;  2F0U A;  2HQL A;  5IYC H;  1Q90 A;  1AZP A;  3T53 B;  3CD6 A;  3OHX C;  3NK9 A;  1TWA B;  4AQY Q;  4DR3 Q;  2NVQ B;  5C4X H;  2K01 A;  3MXP A;  2CW0 D;  4BA2 I;  1EY4 A;  5CR3 A;  3QO2 A;  5M3F H;  1AW7 A;  4IUU A;  1MIU A;  1IYU A;  5C4J H;  4KLK A;  2HDM A;  3RZD B;  4DR5 Q;  4L5T A;  3BU2 A;  4YIJ A;  4RHS A;  3I70 A;  4TQU S;  3M85 A;  5IY0 A;  3J80 i;  4JI3 L;  3AB9 A;  4ZQ3 A;  3DXJ C;  4L5R C;  1YHB A;  5HGT A;  2IX3 A;  5FLX L;  4GOP A;  1AEX A;  5KND A;  2F4I A;  3M4O B;  2KQ3 A;  4KN4 C;  1L1O A;  4RWS C;  2A8V A;  4GNX A;  3PO2 G;  1VQM A;  5M5Y B;  1D6E C;  3GTG B;  4BXX H;  2F3W A;  3TME A;  4LF6 Q;  3QR8 A;  3F2C A;  4JI6 L;  2Z6K A;  2EYF A;  3Q0A A;  1X3G A;  1S5D D;  2K75 A;  2FMC A;  2MO1 A;  1YNX A;  1Q7Y C;  1CTM A;  1ENA A;  3MZ5 A;  1TWH B;  5KYL A;  1N34 Q;  2IHF A;  4NXM L;  1D1I A;  1GHK A;  1X54 A;  2K5D A;  1SYB A;  2GN5 A;  1KLU D;  5G3L F;  2WAQ B;  2JA5 H;  2OQ0 A;  5C3E H;  1D8L A;  5IYD H;  5IT9 c;  1SJE D;  2VUM G;  2TSS A;  4DR1 L;  1SYC A;  1S5C D;  1Z9F A;  4OEL B;  2D0P A;  1MJC A;  2MHV A;  4KY6 A;  3HFZ B;  4C2M H;  2A73 B;  5E7N A;  5NUC A;  1PYB A;  1S3O A;  1TS5 A;  1IL8 A;  3C1F A;  4EVO A;  3HKS A;  3V2T A;  3KLW A;  4Q5V A;  1MD2 D;  3CXC A;  4C3I B;  1E22 A;  3CF5 A;  2F0W A;  5FLX c;  4J6H A;  4NKL A;  1CZW A;  1PZI D;  4UDU C;  1CQV A;  2QIL A;  2RCF A;  2R92 G;  1F77 A;  3CC2 A;  4POF A;  2UUA Q;  4YY3 Q;  4A3M B;  4BY7 B;  4LK1 C;  2GA4 B;  2RDF A;  3CRL C;  2ZJP A;  2CKZ B;  3RLO A;  4FDB A;  1N32 L;  1IBK Q;  3QWN A;  3H3V H;  3UDI A;  4CKC A;  3NSW A;  1SXT A;  1KL9 A;  3C1E A;  4DNT B;  3K59 A;  1MI2 A;  1H9S A;  3E6Z X;  3KF6 A;  5FJ8 H;  2NVT H;  4F87 A;  1EY6 A;  4GLX A;  4BBR H;  4I7A A;  2Q2H A;  1YBY A;  3IFT A;  3CPW A;  2B2U A;  4QB4 A;  1XYI A;  2KEE A;  1I4Q A;  2NVT B;  1EY9 A;  1PFB A;  2EJF C;  2WIN B;  4H13 C;  2L5T A;  1NMG A;  3VYS A;  2E2H B;  2LXJ A;  1SE2 A;  3M3Y B;  1H95 A;  5BR8 Q;  1UNS A;  5D65 A;  4X66 L;  3H09 A;  1PRT F;  1PLF A;  2V4D A;  2A6H C;  1N33 Q;  2VUM H;  2JSO A;  4WOR A;  1OTC A;  1EZ8 A;  4AQY L;  3JAM c;  3W1B A;  3S14 B;  3IFD A;  3CU7 A;  1FJG Q;  3NBH A;  4IFD I;  3VYT A;  1XMQ Q;  3MWY W;  1YJN A;  5CGK A;  4XQN A;  1K83 H;  5IWA Q;  4L5Q A;  3HOU H;  2IHE A;  3P7J A;  4JI5 L;  1OXV A;  4IUR A;  4JI4 L;  3A0J A;  1HTL D;  3FHW A;  1IYV A;  1EQQ A;  2NTT A;  2KEC A;  3A5U A;  2FJ2 A;  1S40 A;  2E2I H;  3J80 E;  3F1Z A;  2F1M A;  3MFY A;  1X65 A;  4DV1 Q;  2PW5 A;  3KOJ A;  1EU3 A;  1VS0 A;  1WTP A;  3WWV A;  4IJH A;  1F9R A;  1XWE A;  2QA4 A;  1Z47 A;  1QWY A;  4OWW B;  3HG9 A;  4DNR B;  2WAQ E;  2PO4 A;  5M3M H;  2A5H A;  3I4N G;  4KY5 A;  1A15 A;  2CWP A;  5K36 G;  3TS0 A;  3K7A H;  3MVV A;  5IP9 G;  5JEA H;  2JYO A;  3I7F A;  1B7Y B;  1HQR D;  5LHY 1;  3S1M B;  2XTI A;  1TWC H;  3GTM B;  1SMX A;  3OSO A;  2N8N A;  2F0P A;  2E74 C;  3T13 A;  1RD9 D;  3H15 A;  5ELB A;  4ZK9 B;  2MGS A;  4C3H G;  5G3L D;  4A3F H;  2EXZ A;  2OWO A;  4BBR B;  3K80 C;  3TRE A;  3ULJ A;  4PZ7 A;  4DGZ A;  3I2Z A;  1CKN B;  3BDO A;  2WP8 J;  3VR5 A;  5J39 A;  5I9P A;  1VQK A;  4MZ9 A;  5J3B A;  1ZEQ X;  1VF7 A;  4DA2 A;  2QF7 A;  1Y1V H;  2BE5 D;  1Q1B A;  1PYS B;  4A93 B;  4HCE A;  1HCZ A;  2DNE A;  1GUS A;  3DWQ A;  4BA1 I;  4GOP C;  4S3S A;  3ER0 A;  1H9M A;  4X62 L;  2D5D A;  1YHQ A;  1UEA B;  5DM7 3;  3STB D;  2MUY A;  1BNZ A;  1X55 A;  5CBE E;  4KN7 C;  5T1I A;  1WTW A;  3S2H H;  1NCV A;  1S5F D;  3GTO H;  1PH4 A;  2OXP A;  3S24 A;  3HOV H;  3AU7 A;  2F0G A;  1PTO C;  3GTL B;  2B2U C;  4IN3 A;  3AFP A;  1CK1 A;  2X6G A;  4QMG A;  1K0S A;  1AE2 A;  4FP5 D;  4P72 A;  3T1Y Q;  1LTB D;  3I72 A;  3K58 A;  1PH5 A;  4RCN A;  1K0R A;  3X3M A;  4QGU A;  1ICF B;  2JA6 G;  1VQD A;  5IOC A;  3CAM A;  2UXD Q; 
#chains in the Genus database with same CATH homology
 2G9H D;  4ME5 A;  1LLR D;  2M2L A;  1D1K A;  2DNC A;  1ET9 A;  3IAY A;  3FKI B;  4U67 3;  3S17 B;  3KF8 A;  1WD0 A;  4ID6 A;  3TP7 A;  1TS2 A;  1STY A;  3URY A;  4XQQ A;  3MHB A;  5BN5 A;  1SNQ A;  2Z1C A;  5JVH 3;  1HTP A;  1LT3 D;  5FKA C;  3PUX A;  4ZYS A;  1NAP A;  5A35 A;  3FPU B;  1QIL A;  3CQZ B;  3K6O A;  1PZJ D;  2NTS A;  1J9O A;  1FR3 A;  4RH6 A;  1O7Z A;  4ABN A;  1BOS A;  3IKJ A;  2E75 C;  1ZKO A;  2F3V A;  1WTO A;  2M9V A;  4FXG C;  4FF2 A;  4HTH A;  1EYD A;  1PDQ A;  3NHH A;  2KVM A;  2A68 C;  3DUZ A;  3U9O A;  1UAP A;  1JOO A;  3DMU A;  4XXE A;  3D4R A;  3PV0 A;  2Z8L A;  1WTQ A;  1STN A;  3BVZ A;  3VYR A;  2L0C A;  4L8J A;  2K5Q A;  4PMW A;  3NWS A;  1DOL A;  1B3A A;  2XNA C;  4HAE A;  3E0J A;  3K5L A;  4QUC A;  3EQL C;  4ZKB B;  2RKS A;  3RMH A;  1EIH A;  5D14 A;  2AUJ D;  2SEB D;  2NN6 G;  5JOB A;  2DN8 A;  3ND9 A;  3J81 E;  3E5S A;  4J8Q A;  5JEA G;  5BN3 A;  5T1G A;  5M3F B;  4C3I G;  4JBW A;  2XWJ B;  3LX0 A;  1JIC A;  1PXU A;  1DJR D;  4OO1 G;  3MA2 B;  3I90 A;  3SDZ A;  3BZD B;  3T4A C;  1V1O A;  4K2K A;  2F0Q A;  3SXH A;  3ONA B;  1DYQ A;  3HZX A;  3GV3 A;  1BQQ T;  2JA8 B;  3PUY A;  4C3J G;  4IZ8 A;  1G2S A;  2R3Z A;  4PV1 C;  4KV6 A;  2EE1 A;  1PYW D;  4IUV A;  1UUP A;  3K5N A;  5C5M A;  1W6K A;  1EQV A;  1HHV A;  1RKN A;  2RBM A;  2XSC A;  3J7A V;  2BOS A;  5I6Y A;  3K5O A;  2R93 B;  2AQ1 B;  2O2L D;  3FVQ A;  2N55 A;  4A3I B;  3NQI A;  4IUN A;  3G7L A;  3HRZ C;  3OMG A;  4ZRZ A;  1QE6 A;  1MGS A;  1PTO H;  3ITP A;  1EU4 A;  4NDX A;  4EQP A;  3NUC A;  1TY2 A;  1QG7 A;  4WRD A;  2CQA A;  3PO2 B;  1AN8 A;  3K7A B;  3SEB A;  3I4N B;  1G2T A;  2KOL A;  2ENB A;  2BDO A;  3TP6 A;  5BN4 A;  1RDP D;  4CHT B;  1E0B A;  2IX1 A;  4XIG S;  2JA6 B;  1RTN A;  2FFK B;  2RQX A;  3EJI A;  2E76 C;  1KDA A;  5CYU A;  2H1E A;  3NXW A;  5C0X I;  4K8I A;  3OW7 A;  2LKV A;  4G7Z C;  3QIA A;  2EZV A;  1T5X D;  4HED A;  1H9J A;  1STB A;  1O80 A;  3W3A A;  2HDL A;  4MN3 A;  1DON A;  2X6L A;  3OMC A;  5IIF A;  2B2V A;  2SNS A;  2B8G A;  3RZO B;  2G9D A;  1B53 A;  4IUQ A;  3IL8 A;  1EWC A;  3BYT B;  3D6C A;  3N52 A;  3C2P A;  1HUN A;  2IL8 A;  4CJ2 C;  2PYK A;  3D4W A;  4KY7 A;  4OHJ A;  4K8J A;  1WD1 A;  2K7V A;  4V19 0;  2Z4H A;  3DEO A;  4FO2 A;  5J1Z A;  3HGB A;  3H6M A;  3MXN A;  2B2W C;  4KHZ A;  3QJY A;  3Q24 A;  3A56 A;  1LTT D;  4KI0 A;  2YYZ A;  1R4Q B;  5C44 B;  1DM0 B;  3PUZ A;  1XX8 A;  1H9K A;  5C3W A;  1B50 A;  2HCC A;  5CV8 A;  4XDX A;  1QNK A;  5FO9 B;  4KD3 A;  2VB2 X;  1Z7T A;  1YNN D;  3GD7 A;  3PIO 3;  2QDB A;  4XT1 B;  5EKK A;  3F2U A;  4ZKC B;  1PRT B;  1M4V A;  5F2D A;  1BCP F;  4RGO S;  2ZXO A;  1X3Q A;  1KDB A;  1LO5 D;  3WDN A;  2EYO A;  1EY7 A;  2F0V A;  1A2U A;  1BCP B;  3WOF A;  2HQE A;  1FNU A;  2A6H D;  2F0D A;  1F9Q A;  5IGG A;  5CV4 A;  2BCO A;  1SSO A;  5ELF A;  5I6W A;  3KBG A;  1KTK A;  3S16 B;  3VYU A;  1Q3L A;  3L3O C;  2MP1 A;  3H91 A;  4ZLT F;  4V0B A;  3HOY B;  2RSO A;  2O5I C;  2F0K A;  4OIJ A;  3FDT A;  3SK6 A;  1HUM A;  1LTS D;  2A69 D;  2PNR C;  3I73 A;  2AQ3 B;  2ICI A;  3BDC A;  3GQB A;  4B08 A;  1HRJ A;  2PZT A;  5CBA E;  1ICW A;  1BBX C;  1RF2 D;  3D31 A;  5I2Y A;  1WCM B;  2IJ0 A;  4F7X A;  1FNV A;  3VR6 A;  1G91 A;  2EYM A;  1JOK A;  3FRP B;  4ZAI A;  1SNM A;  1SE3 A;  2AWN A;  4K6L A;  5KEE A;  3NTK A;  3NE5 B;  5JPM C;  3R2I A;  3EFX D;  1LTG D;  2TMP A;  2NN6 H;  4OO1 H;  4XYQ A;  3GV6 A;  1B1Z A;  3CKI B;  3LNN A;  4X3S A;  4IFD G;  5KYI A;  2PPB C;  1TWF B;  5KNB A;  1KAA A;  1X32 A;  3GO5 A;  1KNE A;  2LY7 A;  5C4Z A;  3FMC A;  3PUV A;  5EPJ A;  2F0T A;  1VMP A;  2B8F A;  2A69 C;  4PMC A;  1GOZ A;  3V96 A;  4X3K A;  4QIW B;  3W2D A;  4DF7 A;  1JE4 A;  4J1M A;  4A3D B;  3H94 A;  1A3T A;  1SMY C;  1BR9 A;  1JCK B;  3MEH A;  4CBV A;  1OXU A;  1I4G A;  1G29 1;  1M8A A;  1NUC A;  1JC7 A;  4HMJ A;  3R93 A;  2JE6 I;  1F9P A;  3VR4 A;  3U9S A;  5C4J B;  2C9O A;  1WTX A;  3EVQ A;  4B9X A;  3QB3 A;  2CW0 C;  2NBF A;  4BBS B;  2B2W A;  3OWE B;  1I4R A;  4HCS A;  2D9U A;  4DAP A;  1GUN A;  3GTK B;  1H9R A;  5IT9 L;  2PW7 A;  2EJG C;  4L6T B;  1Y69 U;  2DY8 A;  1GXD C;  3C46 A;  4XT3 B;  1V1P B;  1HFN A;  2BA1 A;  4F8M A;  2SOB A;  1SYE A;  5C3X A;  1II3 A;  4KK7 A;  4KJO A;  1OXX K;  1VDZ A;  1ZYR D;  3K0Y A;  3HKZ B;  5C0X H;  4A3J B;  4KTA A;  2NB0 A;  4KJN A;  2F0J A;  4EQN A;  1O78 A;  4CGY B;  3K5M A;  1CHQ D;  1QB5 D;  4NW2 A;  1K8O A;  2RSN A;  3DWP A;  5EGT A;  3GTJ B;  4FVM A;  1X3P A;  2E2D C;  3JAM E;  5KIX A;  1HPC A;  3NTI A;  1NSN S;  1PRT C;  3A7A B;  4HMI A;  1XXG A;  2CHB D;  2ZT9 C;  3GP7 A;  3NWT A;  2ZXR A;  1G8Z D;  4RKB A;  1V8Q A;  1T5E A;  1WTV A;  3TZD A;  1FD7 D;  4RGM A;  3L7Z C;  4G4K A;  2K04 A;  4K14 A;  1F2M A;  1ROD A;  5C3E B;  4R8N A;  4I65 A;  3TBI B;  5C0X G;  1SEB D;  2F0M A;  3HOX B;  4P2C B;  1EZ6 A;  1EIG A;  3VA7 A;  1B44 D;  1U4M A;  3D3R A;  1FYC A;  4CKE A;  1O7L A;  4K6D A;  4K2L A;  2J0T D;  3P20 A;  1Y8O B;  4ZUI A;  3SR1 A;  4WJW A;  2R61 A;  2VNU D;  5A2Q E;  1QNU A;  4FNF A;  1YNJ C;  1AP0 A;  5DNF A;  1QJO A;  5ISR A;  1B2T A;  4DFA A;  2ZXP A;  4AYB B;  1XTC D;  4Y7N B;  2F0E A;  3ERO A;  3SK8 A;  2PCF B;  4DN4 M;  5CV7 A;  1PRT D;  4PMB A;  4XTC S;  4C56 C;  5ELC A;  4O42 A;  1DOK A;  3HP3 A;  4RAU C;  2AWO A;  3A8I E;  4ULL A;  1DZ1 A;  1R4P B;  1I4X A;  2RA4 A;  4XYO A;  2I07 B;  2OEO A;  2Q8T A;  3G6J B;  1VMC A;  2E2J B;  1LT5 D;  1OXT A;  3OOC A;  2Z4I A;  1LAC A;  1STH A;  1GHJ A;  4ZUJ A;  4C3J B;  3BVM A;  1BF4 A;  2JA7 B;  2J4X A;  3GTQ B;  2AQ2 B;  1U9R A;  4IUT A;  2EY2 A;  5EKL A;  5K36 H;  2NVX B;  1U4L A;  3SHL A;  3HOV B;  4MIU A;  4LJZ C;  5ELD A;  3KBX A;  4O1N A;  1I6V C;  2RVL A;  1I4P A;  5EBD A;  1B9N A;  2A6E D;  3NPP A;  5I9O A;  4BWG B;  2KHS A;  1B4O A;  3SK4 A;  2K5W A;  1PMR A;  1VF5 C;  1JOR A;  1HXY D;  1CHP D;  3VR3 A;  2M00 A;  2FIN B;  2EVB A;  4KKU A;  3LWE A;  3Q6S A;  2IPK D;  1PTO D;  4K5X A;  2N88 A;  2B63 B;  1KDC A;  4A3G B;  4G57 A;  2JXM B;  2L12 A;  5C0X J;  4RGT A;  4JK1 C;  3VR2 A;  1GUG A;  2Y0S B;  4CJ1 B;  4IFD H;  3BYY B;  1LTR D;  1EOT A;  5C6A A;  1CM9 A;  1NR2 A;  1ZYR C;  2JEA I;  2A6E C;  2HUG A;  1ZXT A;  5EJW A;  3KUP A;  1TR5 A;  2F0F A;  1CZG A;  3TP8 A;  3MFG A;  1A3V A;  4QF4 A;  3M7G A;  1SYD A;  4N9T A;  3SVM A;  5EKI A;  2K05 A;  4TRD A;  1F9S A;  2AUK A;  3KK7 A;  4FF1 A;  1PTO F;  2QCP X;  3HOW B;  4Z9C B;  2EPB A;  4FXK C;  4KKT A;  1KAB A;  2I46 A;  1Q1E A;  1STA A;  1FNW A;  5JPN C;  5K5P A;  4CKB A;  3L9A X;  4G7O C;  1IKL A;  2XN9 C;  5IGF A;  2EYJ A;  5E4X A;  4KD4 A;  1SYG A;  4LMQ D;  4L63 B;  5E3F A;  1HFG A;  5FLX E;  1HA6 A;  1E2V A;  1LT4 D;  1YNN C;  4A3K B;  4ODG A;  2EOT A;  1U4R A;  1L0Y B;  1TQO A;  4DXG A;  1EY0 A;  5CC4 A;  2IT1 A;  1A2T A;  4QUF A;  1ENF A;  4FF4 A;  2A68 D;  2FHT A;  3SE0 A;  4KKS A;  2Q8R E;  1F2Y A;  2VXW A;  3TP5 A;  1CI3 M;  3UI2 A;  2D62 A;  3BDL A;  2B2T C;  4FXD A;  3D6W A;  2IWH A;  2B2T A;  3M4Y A;  1EYA A;  5TSS A;  2E2I B;  1PFN A;  4DK0 A;  1QOH A;  2ID0 A;  4K5V A;  4C3H B;  3J81 L;  3OPO A;  2EYH A;  2O5J C;  2B2V C;  4A3E B;  4H44 C;  3J7Y W;  1DOM A;  4H7B A;  2PQE A;  1DD2 A;  4M8A A;  1ONL A;  3TN2 A;  3S1R B;  3NTH A;  1IHZ A;  3KLR A;  4RCO A;  2KJX A;  3Q23 A;  3R3O A;  1S5E D;  5FO7 B;  4TSS A;  1EEI D;  2WKD A;  3X3N A;  3BS1 A;  1GUW A;  2RDG A;  1I6H B;  1TS3 A;  5CV5 A;  2NN6 I;  3D8G A;  2XWB B;  1TY0 A;  4Q0F A;  5IT9 E;  4EQO A;  1I4H A;  3MTS A;  1JQY D;  5KRU A;  1KNA A;  4RKL A;  1CQF A;  2NZ1 D;  5DM6 3;  5IGD A;  5D3I B;  4EGV A;  5FO8 B;  3OIP A;  4HSP A;  2CVR A;  2L55 A;  4KMU C;  1G6Z A;  1LTA D;  4HSV A;  3KLS X;  2K1B A;  1SYF A;  3LWU A;  4UAI A;  3I8Z A;  2KCN A;  1EL0 A;  5COR A;  5IGB A;  1L0X B;  4RGN A;  3CHB D;  3NP8 A;  5COY A;  3QOL A;  4GZY C;  1TWG B;  4BY1 B;  4IUP A;  2LMC B;  5LL6 S;  2B39 A;  3R8B A;  1B9M A;  2K03 A;  3V05 A;  1Y1V B;  2HCI A;  1OXS C;  4X3T A;  3T51 B;  1EWH A;  2BE5 C;  1ENC A;  2YU9 B;  1LAB A;  3QG1 A;  3SK5 A;  1JB3 A;  1QCB D;  1SBB B;  1OO9 B;  1EY5 A;  1SMY D;  2JA5 B;  1TT2 A;  1V1P A;  1ESF A;  5C5L A;  4XQJ A;  2NWG A;  5JVG 3;  5CV6 A;  2XRS D;  1SAP A;  1IKM A;  2VUM B;  4K5W A;  2WII B;  1CT1 D;  4ILW A;  1LV9 A;  1AZQ A;  2D2C C;  3VA5 A;  2KA7 A;  3JAM L;  1BUV T;  2L9H A;  3K57 A;  1E2W A;  3O13 A;  5J22 A;  4RHR A;  3A7L A;  1EY8 A;  1BCP D;  3A8J E;  1YNJ D;  1WTR A;  3TZU A;  4IFD J;  1MSH A;  1Y8N B;  3FEW X;  1RCV D;  1CA6 A;  1PZK D;  5E4W C;  4CJ0 B;  2QEJ C;  3FPP A;  3S15 B;  4NP5 A;  5I2X A;  3I91 A;  2EY5 A;  2NYZ D;  1TVX A;  1MSG A;  2EYL A;  4PQX A;  3N6R A;  2JP1 A;  5DAU A;  3CRK C;  2C5C A;  4QCL A;  1F2L A;  2PZU A;  1IW7 C;  1C8C A;  2WV6 D;  2L11 A;  2EY6 A;  4OIK A;  1STG A;  5FOB B;  2L4N A;  2K6A A;  5C4H A;  2ICE C;  3PMF A;  3RLF A;  4LAA A;  2B2Y C;  2K33 A;  4X3U A;  1MBY A;  2K28 A;  2JEB I;  1WVL A;  3H0G B;  5EPL A;  2A74 C;  1JOQ A;  5AFW A;  4DK1 A;  5JJZ A;  3D4D A;  1A6X A;  1J8I A;  1C4Q A;  5HUR A;  1SNC A;  3NBI A;  2IW3 A;  1SND A;  1GJX A;  4IAL A;  3S2D B;  4DXF A;  4OO1 I;  1PTO B;  1I50 B;  2NUC A;  2XRQ D;  5IOD A;  4BS9 A;  1Q8I A;  1TII D;  1GUT A;  1D5X C;  3C3L A;  4R8I A;  3RD4 A;  4FF3 A;  1ESR A;  2R92 B;  1A3U A;  5M3M B;  3R2T A;  4RA8 A;  3DEP A;  2H4O A;  4R9W A;  5M5X B;  2LS0 1;  1I3Q B;  1BDO A;  1O7Y A;  3PIP 3;  4G7H C;  1E2Z A;  3OWF A;  1IW7 D;  2F0N A;  2EY1 A;  1DXM A;  3DHQ A;  4HN7 A;  1BO0 A;  5C4X B;  2PZW A;  1EEF D;  2O4X A;  3DWA A;  5LL6 X;  4F88 A;  1JR0 D;  1H9S B;  4PNY A;  5IGC A;  1C48 A;  1D5Z C;  4A3F B;  5A2Q L;  1EYC A;  1TKW B;  4HR7 B;  2J7Z A;  3H3V C;  4OGQ C;  2MJ8 A;  4C1N K;  3QOJ A;  4A3B B;  1SNP A;  4IQZ A;  1EFI D;  3WOE A;  1K8M A;  3S1N B;  2EYP A;  2X69 A;  4DU9 A;  5E1F A;  1EQT A;  2XIW A;  2WKC A;  2Q8I B;  3KLS A;  5EBC A;  2VB3 X;  2BDN A;  1JWS D;  3ERQ A;  1ILQ A;  2F0S A;  3S9W A;  3RUZ A;  3GTP B;  1VCI A;  5M5W B;  1D2B A;  1V43 A;  5JAV A;  2PMZ B;  1TS4 A;  1W6J A;  2EDG A;  1SJH D;  3NQT A;  5D3D A;  1S4Z A;  4M1U B;  3S1Q B;  4B9W A;  1Y8P B;  1RTO A;  4C1N I;  3Q22 A;  1STE A;  3A54 A;  2IX0 A;  3OIQ A;  3M7N A;  2RDH A;  4KHV A;  2FMM A;  1ILP A;  2F0O A;  2LFN A;  3MC0 B;  4NMZ A;  3AMU A;  1CA5 A;  3BG3 A;  4I7Z C;  3J7A F;  1JWM D;  2DY7 A;  5CMD A;  5ELE A;  3BVG A;  1BXT A;  1LTI D;  2L1B A;  2OT2 A;  4E6I A;  2WB1 B;  3ND8 A;  4DAY A;  1FGB D;  1SFO B;  2F03 A;  1SDF A;  3EA6 A;  2OF1 A;  3GTO B;  4C2M B;  1R9T B;  1S5B D;  1HQM C;  2BA0 A;  2B2Y A;  2SDF A;  3A8K E;  2WAC A;  2KCC A;  4H0L C;  1BCP C;  1HA5 A;  2KUM A;  4TKO B;  5CV9 A;  1DCZ A;  2MPM A;  5IGE A;  3PO3 B;  1GUO A;  5DEH A;  4OL7 A;  4N9P A;  2F0I A;  1NR4 A;  3HEJ A;  2F0L A;  5KNC A;  2EJM A;  3DM1 A;  3HOZ B;  1TWC B;  3T16 A;  5I4D A;  4WFN 3;  3HOU B;  1K83 B;  2R6G A;  3MXU A;  3MAQ A;  2K32 A;  3T56 B;  2QKI C;  3PUW A;  1Z6H A;  1Q12 A;  2SNM A;  1JWU D;  4U68 A;  5EQ0 A;  2XVS A;  2KED A;  3P1H A;  2NVY B;  3ZYY X;  1D5M C;  3I3C A;  4FYD A;  4DAV A;  1AFP A;  1F2Z A;  3I4L A;  4MHE A;  4RFB A;  3J80 L;  1ML0 D;  5KGU A;  1LT6 D;  1U4P A;  1CFM A;  3TSS A;  5JEA J;  2R7Z B;  5M9O A;  2F0H A;  1RHP A;  3HS0 C;  3P75 A;  1KLG D;  1SNO A;  1ET6 A;  1PFM A;  1TU2 B;  1Y1W B;  5FK9 C;  1RJT A;  3I4M B;  3A55 A;  1SE4 A;  3MXG A;  3S2H B;  5EPK A;  3TDQ A;  2F0U A;  1AZP A;  1Q90 A;  3T53 B;  3OHX C;  3NK9 A;  1TWA B;  2NVQ B;  2K01 A;  3MXP A;  2CW0 D;  4BA2 I;  1EY4 A;  5CR3 A;  3QO2 A;  1AW7 A;  4IUU A;  1IYU A;  2HDM A;  3RZD B;  4YIJ A;  4RHS A;  3I70 A;  4TQU S;  3M85 A;  3AB9 A;  4ZQ3 A;  3DXJ C;  2IX3 A;  5HGT A;  5FLX L;  1AEX A;  5KND A;  2F4I A;  3M4O B;  2KQ3 A;  4KN4 C;  4RWS C;  5M5Y B;  1D6E C;  3GTG B;  2F3W A;  3TME A;  2EYF A;  3Q0A A;  1S5D D;  2FMC A;  1CTM A;  1ENA A;  3MZ5 A;  1TWH B;  5KYL A;  1D1I A;  1GHK A;  2K5D A;  1SYB A;  1KLU D;  5G3L F;  2WAQ B;  1SJE D;  2TSS A;  1SYC A;  1S5C D;  2MHV A;  4KY6 A;  2A73 B;  5NUC A;  1TS5 A;  1IL8 A;  3C1F A;  4EVO A;  3V2T A;  4Q5V A;  1MD2 D;  4C3I B;  2F0W A;  4J6H A;  4NKL A;  1CZW A;  1PZI D;  4UDU C;  1CQV A;  2QIL A;  1F77 A;  4A3M B;  4BY7 B;  4LK1 C;  2GA4 B;  2RDF A;  3CRL C;  3QWN A;  4CKC A;  3NSW A;  1SXT A;  3C1E A;  4DNT B;  3K59 A;  1MI2 A;  1H9S A;  3E6Z X;  4F87 A;  1EY6 A;  3IFT A;  2B2U A;  4QB4 A;  1XYI A;  2KEE A;  1I4Q A;  2NVT B;  1EY9 A;  1PFB A;  2EJF C;  2WIN B;  4H13 C;  2L5T A;  3VYS A;  2E2H B;  1SE2 A;  3M3Y B;  1UNS A;  5D65 A;  3H09 A;  1PRT F;  1PLF A;  2V4D A;  2A6H C;  2JSO A;  4WOR A;  1EZ8 A;  3S14 B;  3IFD A;  3CU7 A;  3NBH A;  4IFD I;  3VYT A;  3MWY W;  5CGK A;  4XQN A;  3P7J A;  1OXV A;  4IUR A;  1HTL D;  1IYV A;  2NTT A;  2KEC A;  2FJ2 A;  3J80 E;  2F1M A;  3MFY A;  2PW5 A;  1EU3 A;  1WTP A;  1F9R A;  1XWE A;  1Z47 A;  1QWY A;  3HG9 A;  4DNR B;  2PO4 A;  2A5H A;  1A15 A;  4KY5 A;  5K36 G;  3MVV A;  5JEA H;  2JYO A;  1HQR D;  5LHY 1;  3S1M B;  3GTM B;  3OSO A;  2F0P A;  2E74 C;  3T13 A;  1RD9 D;  5ELB A;  4ZK9 B;  2MGS A;  4C3H G;  5G3L D;  2EXZ A;  4BBR B;  4DGZ A;  3BDO A;  2WP8 J;  3VR5 A;  5J39 A;  5I9P A;  1ZEQ X;  1VF7 A;  4DA2 A;  2QF7 A;  2BE5 D;  1Q1B A;  4A93 B;  4HCE A;  1HCZ A;  2DNE A;  1GUS A;  3DWQ A;  4BA1 I;  4S3S A;  1H9M A;  2D5D A;  1UEA B;  5DM7 3;  2MUY A;  1BNZ A;  5CBE E;  4KN7 C;  5T1I A;  1WTW A;  1NCV A;  1S5F D;  2OXP A;  3AU7 A;  2F0G A;  1PTO C;  3GTL B;  2B2U C;  4IN3 A;  1CK1 A;  2X6G A;  4QMG A;  4FP5 D;  1LTB D;  3I72 A;  3K58 A;  4RCN A;  3X3M A;  5IOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...