2F0UA

Crystal structure of staphylococcal nuclease mutant v23i/l25i/i72v
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
136
structure length
136
Chain Sequence
b'KLHKEPATLIKAIDGDTIKIMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKVEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal nuclease
molecule tags Hydrolase
source organism Staphylococcus aureus
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
total genus 35
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0uA00
1EY5A 2F0GA 4N9TA 5KYLA 4PMCA 3QB3A 3BDLA 1EYAA 2O4XA 3V2TA 4J6HA 1JORA 2F0EA 5C6AA 2RBMA 3NUCA 1EZ6A 2PW7A 4MIUA 3NXWA 3EVQA 2ENBA 4TRDA 2F3VA 2PZTA 5IGGA 4K8IA 5EKLA 2EYHA 5IGFA 3HZXA 2F0VA 1A3UA 1F2YA 2EYMA 3DMUA 4HTHA 1SNDA 2RKSA 4K5XA 2F0UA 3MZ5A 3TP5A 1SYGA 4NKLA 5C4ZA 4ZUJA 2F0MA 4ME5A 4S3SA 4IZ8A 5IGCA 1ENCA 1IHZA 2KQ3A 3OMCA 4NMZA 4PNYA 1EY7A 2EYFA 4R8NA 2F0PA 3VA5A 5M9OA 5C3XA 3EROA 1STAA 3D4WA 3E5SA 2F0QA 4RKBA 3SK6A 3PMFA 1EY4A 5JOBA 2PYKA 5I9OA 5EGTA 1EZ8A 2F0LA 3TP6A 5DEHA 5KGUA 4KTAA 5KRUA 4DFAA 5IODA 1EQVA 2EYOA 4K8JA 4IALA 2F0TA 5CC4A 3T13A 3OMGA 4KD3A 4ZUIA 4I65A 4KJNA 3SK5A 1EY0A 3RUZA 4EQPA 1SNCA 3QOLA 5KYIA 5IGEA 4F7XA 3R3OA 3EJIA 1SYDA 4KV6A 1JOQA 3NHHA 1SYFA 1A2TA 1STGA 4RKLA 1SNQA 2PQEA 3D8GA 4KJOA 3MVVA 2OXPA 4YIJA 4K14A 4E6IA 1SNOA 3TMEA 4F8MA 1KABA 3LX0A 2EYLA 5I6YA 1II3A 1JOKA 5K5PA 2LKVA 2F0HA 1AEXA 4NP5A 5CV8A 4NDXA 3DHQA 4ODGA 3U9OA 1SYBA 2EYPA 5CV9A 4DGZA 4QB4A 5EKKA 2SNSA 5IGBA 2F0WA 3MEHA 3SHLA 4B9WA 5F2DA 4HMJA 1A3VA 5KEEA 1F2MA 1STBA 1U9RA 2SNMA 3C1FA 4K2KA 4ZQ3A 5HGTA 5KIXA 1EYCA 2F0IA 2EY5A 4K5VA 4EVOA 2F0OA 4N9PA 1TQOA 2HQEA 3MHBA 3QOJA 1EY6A 5J1ZA 5IOCA 4OL7A 1A2UA 2PW5A 5E3FA 1KDBA 5C4HA 1STNA 2SOBA 3OSOA 4QF4A 2F3WA 3SK8A 5J22A 4PMBA 3NP8A 5CV4A 1TR5A 3SXHA 3TP7A 3NQTA 4K2LA 5C3WA 1NUCA 3ITPA 2PZWA 2EY1A 3BDCA 4KY6A 1EYDA 5I6WA 2QDBA 3NK9A 4HMIA 2F0NA 4G57A 2EY6A 4K5WA 4KD4A 5DAUA 4KY5A 2F0JA 5CV6A 4WRDA 1RKNA 3C1EA 5NUCA 5CGKA 4ID6A 5IIFA 2EY2A 1F2ZA 1EY9A 4DU9A 3P1HA 4EQOA 3HEJA 5E1FA 2OF1A 1STYA 4B9XA 4WORA 5CV5A 1KDAA 3SK4A 3P75A 3OWFA 1KDCA 2OEOA 1KAAA 4IUNA 3H6MA 2EXZA 4QMGA 5CV7A 2EYJA 3TP8A 1SNMA 1SNPA 5C5MA 4EQNA 1ENAA 2F0SA 4KHVA 2KHSA 1JOOA 2RDFA 4KY7A 3SR1A 5IGDA 5C5LA 3D6CA 5ISRA 1SYEA 1SYCA 2WACA 3ERQA 4H7BA 4DF7A 2M00A 3S9WA 2F0FA 1A3TA 1EY8A 3T16A 3D4DA 3MXPA 4K6DA 2NUCA 5HURA 4LAAA 4J1MA 5J39A 1NSNS 5I9PA 2F0DA 5CR3A 2PZUA 5JAVA 2F0KA 1TT2A 1STHA
chains in the Genus database with same CATH superfamily
4LF5Q 1BCPC 2F0EA 5G3LF 1KNAA 2PW7A 1H9KA 4H44C 1QNUA 5ELOA 1JJGA 1NNXA 2JXMB 5AJ3L 1BBXC 5IP7G 4FF4A 4DK3C 5IGCA 4LFAQ 5DM63 2FFKB 2KCMA 1CZGA 4DXGA 2B2TA 1WD1A 3PF5A 3HOVH 3S1QB 1VQOA 2JK8A 3PV0A 5KGUA 2IL8A 1FR3A 4A3MB 4A3JB 1AP0A 2CHBD 1L0YB 3GV3A 2AUJD 2E75C 4NB3A 3FEWX 3EJIA 5AFWA 4X3SA 2K52A 1ICFB 2JA5B 1B2TA 3S15H 1X3EA 3H94A 4A3LG 1KQSA 3S1QH 4OONA 2B2VA 4LMQD 4QB4A 4TVAB 2QILA 1SE2A 1MD2D 4C3HH 3A56A 1YNNC 2RSOA 4UHVA 2FXQA 4ZCKA 2F4VL 3VYSA 1EY6A 3G48A 2FMCA 1PV4A 2A69C 3I4MG 5CV4A 1XNQL 2D0PA 1CA6A 1N32L 4KKSA 3TDQA 1HNXL 2ZTEA 2R7ZG 2PQAA 1Q12A 4DAMA 2MPMA 4G57A 1DOMA 5CV6A 1K8AC 4JW0A 5CGKA 1Q46A 1PYSB 4X64Q 4A3CG 3M4YA 3S1MH 1TS5A 5ELNA 4QCLA 2N88A 3A54A 3QJYA 3BVZA 4L5SA 4HSVA 3NTIA 2I46A 1FGBD 3E0EA 3KLSA 4DR7Q 4CJ2C 1B3AA 2K5NA 3BZDB 4MNOA 3URYA 3HOWG 5AJ3Q 2B3GA 1KD1C 4CDCC 2K6AA 4J1MA 1IYVA 4JG2A 2HD3A 1EWHA 1X9NA 3HOYG 4DR6L 4YCUA 3RLFA 2F52A 4BXXH 2UXBQ 1WTQA 1C48A 2JA5G 2YU9B 1QVFA 5L37A 3I2ZA 4LUZA 4LFBQ 1F77A 3GQBA 3PIO3 1L0XB 1CUKA 3KF8A 4X66Q 4LF7L 1QILA 4DV0Q 5C3XA 4JBMA 1STAA 1SMYC 3P7JA 5CMDA 1TKWB 3NBHA 4G4KA 4PZ8A 4UAIA 4PQXA 4IPHA 2LMCB 4MZ9A 1AE3A 3FMCA 4KTAA 2J0TD 1Q1BA 1WI5A 2LXKA 2V4DA 1XMOQ 4Q0FA 1E0BA 1LABA 1K83B 3ULJA 2B2YA 1VQ4A 4LF7Q 2R7ZB 2E2DC 1SDFA 4RKLA 2X69A 5C0XH 2QA4A 4KN4C 2PQEA 4KJOA 4A93G 4IFDG 1WCMH 3PGZA 1XX8A 2Z1CA 2ZJRA 1RCVD 4LFCQ 1JMCA 5I2XA 2NVQB 5A35A 1CKMA 2IX1A 4JOIC 1YHAA 2LFNA 2AKWB 1KC8C 3S17B 5JAVA 5GAHC 1SMYD 2DY8A 4IJLA 3EA6A 4U673 4ZQ3A 3V05A 4A3FG 1EU3A 1YNXA 2B2WA 2CWAA 1D5XC 1LACA 1XTCD 1M90C 1KRTA 3A74A 2CH4W 2H4OA 2RSNA 4LFCL 5EQ0A 5GQOA 3HOWB 1I50B 3KLSX 2A68D 4A3DB 3GV6A 4FVMA 3HOYB 4C3JH 1E7ZA 4YWLA 2ZT9C 1NCVA 5C3WA 2PZWA 3MA2B 1Z6HA 1LLRD 2L1BA 4A3BH 2LSSA 1B53A 1IYUA 4KY5A 1VQAA 1RKNA 4C3IH 2NWGA 1STYA 1SRUA 2K5QA 1Y8PB 1KDAA 1NAPA 3K0XA 3P75A 4GNXA 1M4VA 3CCUA 1LT4D 1CA5A 4XYOA 1EQRA 3VR6A 1CKOA 2D62A 1Y1VG 1O78A 1XPRA 2WKDA 2BE5D 2IPKD 3STBC 1CFMA 3UI2A 5GAEC 3T53B 4HJ7A 1V9PA 2R92B 5J39A 4P71A 1PFBA 1ZEQX 4LF4Q 3F2CA 3MC0B 1EYAA 2O4XA 1JWUD 4A3KB 4TSSA 2EYHA 2F0VA 2ZTDA 2R7DA 4GLVB 1XMQL 1JC7A 1CK1A 4B3RQ 4RHRA 5CBAE 1AFPA 4ZUJA 3ND9A 3J81L 3BJUA 3HG9A 2L11A 5IYBG 2AWNA 4JYAL 1D5ZC 1IW7D 1PTOB 2Q8RE 1HZ9A 4IUVA 1VQJA 3TP6A 4DR5L 1I4RA 1K8GA 1C8CA 3Q0AA 3BG3A 1JE5A 5T1IA 1VQHA 3K5MA 3CMAA 2Z6BA 5KYIA 2UU9L 3LGJA 3PF4A 4A3GB 1JOQA 3S1RH 3X3NA 4JI7Q 2WP8J 5K5PA 4OELB 2UXDQ 3CRKC 1LTTD 3TEHB 4K6LA 3SHLA 3PUYA 3ERSX 1F9PA 1HCZA 5FO8B 2NVXH 4EVOA 1PFNA 4LJZC 1RTOA 2K32A 1EWCA 2NZOA 1CZWA 3FKIB 2EPBA 2EVBA 4C3HB 4GLXA 4DNTB 2R92G 3KOJA 1G91A 2K28A 3DXJC 5D3DA 5LL6X 1X54A 3UE1A 3OW7A 3K6OA 2QF7A 2Z6KC 2MQHA 1HZBA 4PV1C 2HHHL 5M3FB 3RZOB 5CV7A 1NY4A 1K8OA 2K75A 4JI1L 4DV2Q 2RHQB 3M4PA 1GXDC 5C5LA 5EBCA 3U4ZA 4K0KL 3Q23A 4GKJL 3NPPA 3T16A 2VY3A 1HHVA 1Q90A 4RCOA 2RF4A 3H0GH 3K80C 4DNRB 4XQJA 2Q2UA 2F0DA 5IY0A 4BBSH 1TT2A 5A2QE 4KKUA 2WB1E 1K73C 3U50C 5KYLA 2NBFA 4YY3Q 1JCKB 2I5LX 4GN4B 4Y7NH 3CCEA 3D4RA 1FNVA 3GD7A 4K0KQ 4Q5VA 3NXWA 4A3CH 1I5FA 2PZTA 5IGGA 2CQOA 1A3UA 1A6XA 2NVTH 2H1EA 5BN5A 1EIGA 3H0GG 4C3JB 1Y8NB 1ZXTA 1JE4A 1WTHA 4AQYQ 5EPKA 4HIKA 3S17H 4BWGB 3S14H 3GTGB 1MKHA 3FVQA 2K05A 1YIJA 1DONA 3QO2A 4C3HG 3TRZA 4DV6Q 4ZUIA 4NXNQ 3R3OA 1BBWA 5IT9E 1JWSD 3MWYW 4EQ5A 4DXFA 5C0XJ 4JVZA 4LW1A 3PIOA 4LF4L 4DR4L 5KNDA 2I0QA 2ICEC 4NPSA 2HUGA 1PYBA 4LF6Q 2QDLA 2KEEA 2R6GA 1SROA 4IUTA 2A69D 1AZPA 4DV7L 4XT1B 1SLJA 4YHHQ 3MHBA 5J1ZA 1H95A 2RA4A 5HGQA 1U4LA 3A5UA 4JI6Q 1KDBA 2A5HA 1STNA 4RGOS 5C4HA 3U9SA 1YNND 3WOFA 1FD7D 2Z8LA 1C7YA 4YWMA 2UUAQ 1KNEA 3T1YQ 4JI5L 1ESFA 3ITPA 4ZAIA 2YYZA 1HA6A 5IP7H 4PG3A 2KECA 3MXNB 4A3KH 4B9XA 3HKZG 4XQQA 2O5IC 1S5DD 4C2MH 4C3JG 4B3SL 3CPFA 3D6CA 1SYEA 1YVCA 1SYCA 2VS1A 2WACA 4O42A 3F2UA 3RNUA 3F2DA 1MBYA 2KEDA 2XVSA 2JA8H 3FKIH 1ESRA 4A3MG 4FDBA 1SN8A 4RA8A 1LV9A 2AMCB 4L6TB 3A8JE 1CSQA 3QB3A 3BDLA 3V2TA 4JI3L 3HOXH 1EZ6A 4NXNL 3RN2A 4UP9A 1IW7C 1VQ5A 3NSWA 1QUQA 1QOHA 2LY7A 3QWNA 2F0UA 2YTXA 2NB0A 1HUMA 1L1OB 1I4GA 4IZ8A 1IHZA 5K36G 1UWVA 3TZUA 5M3MG 3M4OH 1UEBA 4RGMA 2Z4IA 1QVCA 2TMPA 1EFWA 1S5ED 4FXGC 4B08A 4Z9CB 1CHPD 1LTRD 2BDOA 1IBLQ 2EIFA 3MFGA 3PO2B 3E0JA 1BOSA 1T9HA 2R3ZA 4A76A 1NMGA 3EQLC 4KHZA 1PA6A 4KN7C 1ET6A 4RCNA 2FJ2A 3D8GA 2F1MA 3CQZB 1R9TB 2G5DA 5H1SE 2Y0SE 3DUZA 1I4HA 3VR4A 3AB9A 2C5CA 1EQQA 1BDOA 4P74A 3J80i 4HJ8A 3KF6A 4LF9L 1NJIC 1PFMA 4F87A 4A3EH 3C1FA 1EYCA 5D65A 4FF3A 3PUXA 1F9SA 2GN5A 1PTOF 3HKZE 1HZCA 3WOEA 1YJWA 4A3JG 5M3MH 3QG1A 3J7AF 1HQRD 5E4XA 5G3LD 1PH8A 5C0XI 3R2TA 5IP9H 4BA1I 4K2LA 1ET9A 2IX3A 2WFWA 3NK9A 2PNRC 5ELBA 2A74C 2XIWA 1RIPA 2Z9HA 4GLAC 1N33L 1LT5D 3CCSA 5M5XB 4BY1B 4WORA 3A8KE 1I4PA 4QMGA 1LYLA 1IBMQ 1RDPD 2EXZA 1WJJA 1TY0A 4JV5Q 4FXKC 2F0SA 2Y0SB 1V1PA 4DV1Q 1SFOH 1B9NA 5IGDA 1XPUA 2X6GA 3I72A 4KLKA 3I4OA 2EQSA 2FHTA 1PTOC 2F0FA 3GTQH 5C3EB 3R8BA 3I4MB 4DV0L 1WOCA 1DCZA 4RGNA 4A4IA 1VQ8A 4AIMA 1BCPB 1YHBA 1HZAA 4DR1L 2L0CA 2MO0A 4RHSA 3S2DB 3M3YB 4QGUA 2PPBC 5DLQE 1V8QA 4OO1H 2AQ2B 3CW2C 4R4QA 3CCMA 3ZJYC 4KHPQ 2NVYB 1T5EA 1VQGA 4JI8Q 2L9HA 4XT3B 1SYGA 3D3RA 3RN5A 3NWTA 1XMOL 3OPOA 1PMRA 4RKBA 3SK6A 3HOWH 1XTDA 3CD6A 1UUPA 4HAEA 4RFBA 5I9OA 1EZ8A 3VR2A 4O0AA 2MNAA 4DV5L 3IKJA 1XMQQ 4PZ6A 1EUJA 1HNWQ 4DV4Q 1I6HB 4OO1I 2OT2A 4F7XA 5LMNQ 2WB1G 5JJKA 3NHHA 1Y69U 2UUCQ 1Z9FA 1N36L 4YIJA 5EAYA 1AEXA 2K50A 4BY1G 3KLRA 4H02A 3FP9A 2A1AA 1PZJD 4NXMQ 1C9OA 2N3SA 2ID0A 2K03A 5DNFA 1KRSA 2D9UA 3MXGA 2VUMH 2UXCL 2Y0SG 4A3GH 1B50A 2L55A 3HOUB 2PW5A 5JVG3 4A3EG 1SE3A 2NZHA 1D6EC 1FGUA 4QF4A 4PMBA 3J81c 3NP8A 2G9DA 1TR5A 2IJ0A 5M5WH 1H9RA 5JEAH 4WJWA 2EY1A 3I4LA 1WTXA 1B8AA 2XNAC 1WYDA 4ILWA 1T5XD 4IUQA 2F0JA 1CM9A 1ILQA 4RG1A 2OF1A 1Y1WG 1K0RA 2B39A 4X62Q 3X3MA 3TP8A 1VQCA 4JI2Q 3A55A 1E22A 4DR1Q 1G291 2JA6B 2C9OA 1G2SA 1EU4A 2KJXA 3Q22A 1QUQB 1A3TA 2HHHQ 3ND8A 1CT1D 2K5DA 1W6JA 3PO3B 1NSNS 2L12A 2PI2E 1O7LA 2AWOA 2EJGC 1J8IA 2GVAA 4N9TA 4PMCA 2XRSD 1Q3LA 3H09A 1JB7A 1OXUA 1WD0A 5EKLA 2CFMA 3NEMA 1VQPA 2EZVA 4O2DA 4GZYC 3DWQA 3K5OA 4ME5A 3BYYB 4HIOA 4QL5A 4R8NA 1N36Q 2E2HB 2VQEQ 5I4DA 1EQTA 3CF5A 1F2LA 2QCPX 3FPPA 2WINB 3DM3A 3CPWA 3BYTB 3SVMA 3HOUG 2B2TC 3S2HB 1GM5A 1I3QH 4DK1A 4DA2A 5T1GA 2CCZA 3SK5A 1EY0A 2HIXA 3NELA 5BR8Q 3FPUB 1L1OC 4A3KG 2VNUD 1UE7A 2L15A 3BVMA 3JAMc 4FF2A 1PH9A 2QGQA 4C1NI 1B3QA 1NE3A 5GAGC 1A62A 5M3FG 1I94Q 1SYBA 3K7UC 1PLFA 3SE0A 3MEHA 1EIHA 2SNMA 1XNRQ 4M1UB 5CBEE 2Z6KA 4K5VA 3W5OA 1KHIA 1IBLL 5E3FA 2SDFA 5D3IB 2E5LL 1VCIA 1YI2A 4Y7NB 3TP7A 4GOPA 3GTKH 1UNSA 4V190 2HT1A 2EY6A 1DXMA 1IZ6A 1GVPA 5NUCA 1B7YB 1A63A 5IWAQ 4AYBG 5EBDA 2R93B 2E5LQ 1E2ZA 2JQOA 1GUWA 2Q8IB 2MUYA 3AEVA 1IXRA 1X32A 1JOOA 3Q24A 2DNEA 1EWIA 4IO9A 1PTOH 3J81i 4HEDA 2HIVA 4BBRH 1L1OA 2Q8TA 2BA0A 2M00A 4ZLTF 2OQKA 3CC4A 4KI0A 1VQIA 1X56A 2N49A 1AH9A 1Y1WH 1GKHA 3FDTA 4JI3Q 1HNWL 4C2MB 1EY5A 3DEPA 3CCJA 3RZDH 4GN3B 1C0AA 2HCCA 2TSSA 4M8AA 4MIUA 3K7AB 2BCOA 2B2WC 1QE6A 3HOUH 1SSOA 4HTHA 1ZYRC 4OHJA 4KMUC 2EE1A 4DUYQ 1A15A 2F0MA 3K57A 1MGSA 4NMZA 1EY7A 5M5WB 1BO0A 3I70A 2IHEA 1D1KA 5JJZA 1D2BA 3A5ZB 5JOBA 1IYJB 3HOXB 5E7NA 2A6HD 1GUSA 2F0LA 1WTPA 3PO3H 4A3MH 4DFAA 1NR4A 4CJ1B 4TKOB 3T56B 4EQPA 3H91A 1X3PA 2N55A 2B63H 2PMZE 2ZXPA 2ZXOA 4K14A 5J3BA 3CC2A 1N34Q 3CHBD 2EJFC 3T51B 1PH6A 1JT8A 1F9RA 1PH5A 2C35B 5LMUL 4R4IA 4DGZA 1UAPA 5M9OA 3HKZB 5F2DA 3S24A 2JP1A 2WAQB 4A3LH 4CKBA 5M5YH 3IRBA 4JYAQ 3OSOA 2IX0A 1STEA 2AQ3B 3SXHA 2UXBL 2JA7H 1S3OA 1FYCA 4KY6A 4L5TA 4OO1G 2F0NA 4V0BA 3S16H 3TBIB 3HP3A 3C1EA 3GTQB 1K83H 3TREA 2VQFL 1U4MA 1E2VA 3SK4A 2JEBI 1RTNA 4POFA 2OEOA 4QY7A 5DM73 4GOPC 3C2PA 4JBWA 5A2QL 1W2BA 2JA7B 2BA1A 4H7BA 1VS0A 3CU7A 4R4CA 4LWCA 4OWXB 2F03A 2K7VA 1FJGQ 1S4ZA 5HURA 1YBYA 1SEBD 3CP0A 3PO2G 4FO2A 4G7OC 2F0KA 2CVRA 3G71A 4YHHL 4A3IH 1G6ZA 1X3QA 2OQ0A 2HQLA 4J6HA 1SFOB 4PZ7A 3S2DH 4ZKBB 4X66L 4OGQC 3VYRA 3EVQA 3GO5A 2NVYH 3N6RA 1S5BD 2RKSA 5FLMG 1PVOA 4NKLA 4Y52H 1O7YA 1HR0W 3F1ZA 1E24A 4A3JH 3NTKA 1KLGD 3PMFA 2KA7A 3GTOB 2WKCA 1H9SA 4A3IB 3S1NH 1MHWC 1GHKA 5C44B 1HFNA 5LMUQ 2F0TA 1GUOA 2ZM6Q 4GKKQ 4P75A 4KJNA 4OIKA 2M2LA 1HTPA 2VXWA 4IPCA 1JWMD 1YEZA 4WFN3 2PNHA 1VQ6A 3CRLC 4DAPA 4MTNA 2E2JB 1KABA 4DV3Q 5FKAC 1GUTA 3GTOH 5JVH3 3MXUA 2PQAB 4ULLA 1CSPA 2F0WA 2R93H 4GNXC 4HMJA 4XIGS 5KIXA 4GOPB 1VQNA 2WAQE 1LO5D 3K7AH 1ICWA 1W6KA 4P72A 5FOBB 3LWUA 1GOZA 4HCSA 3FRPB 3NQIA 1NUCA 1SE8A 1BBUA 3H15A 1IBKQ 4BY7G 1SAPA 1S5CD 2VW9A 4JI6L 5DAUA 3K5LA 1H9JA 1BNZA 3KDFB 4H13C 2DUDA 1A8VA 1GD7A 1HQMC 1I94L 5LMNW 1Y8OB 4C3IB 2YV5A 1LT6D 4JBJA 1PYWD 2B2UC 2CW0D 4DR2Q 1YITA 2ICIA 4KKTA 3KF6B 1KDCA 1P8LA 3KBGA 4X3KA 3H6MA 3VYUA 3I8ZA 1SNMA 3J7ZC 4A3FB 3KF8B 3VR5A 1D5MC 1U4RA 2A6ED 1PTOD 2NN6G 3W1BA 1CQFA 5JEAJ 4O1NA 4R4TA 1JICA 2NZ1D 1UE6A 2NYZD 3D4DA 3MXPA 1B44D 1TS2A 4DR2L 1B4OA 1HR0Q 3NE5B 5IIFA 4FXDA 3KJOA 3OIPA 3TSSA 1H9MA 3U58A 4OX9L 1TWGH 2AHOB 2WB1B 3NUCA 3UDGA 4G7HC 2E74C 1N34L 1LUZA 4CDDC 2EYMA 1BF4A 3TP5A 4X3TA 1FL0A 4P73A 1XYIA 1ENCA 3HOYH 3RD4A 1RL2A 3K58A 3EROA 4A3BB 1EYGA 4HIMA 2UU9Q 2RDGA 1LTGD 2K01A 1KXLA 4CBVA 1EQVA 5M5YB 3STBD 2NTTA 3I90A 1V1QA 2XWBB 5COYA 3GTJB 4GN5A 4ZYSA 3J80E 4C1NK 1SNCA 1MSGA 3M7GA 4DK0A 2UXCQ 4IN3A 2E2HH 4JI7L 3GDEA 3Q8DA 2HDMA 5IYCG 2OXPA 3GP7A 3H3VI 1FNUA 4C3IG 4JCVE 2R7ZH 4NDXA 3ER0A 3DHQA 1DGSA 2E8GA 4B9WA 1WCMB 1U9RA 3WWVA 1LTLA 2I5MX 2EY5A 5JEAG 1B70B 2MO1A 1BQQT 4N9PA 3T1HL 4OL7A 1A2UA 2KHJA 2CWPA 1N9WA 1RJTA 1YJNA 5JPMC 1CI3M 4YY3L 4HR7B 3HOZG 3H3VC 2JSOA 4A3GG 5IYDH 4FNFA 2QDBA 2VUMG 1IL8A 4CDFC 2EY2A 1F2ZA 5ELFA 2I07B 4DU9A 5GADC 5E1FA 2A6EC 1D8LA 1HUNA 1TWFB 1ASYA 2GVBA 1ENAA 1OTCA 3JAML 4JBKA 2VZAA 4IJHA 4DN4M 1SBBB 4IPDA 1HRJA 2IW3A 3ERQA 2CW0C 1TWAB 3OHXC 1KAWA 2M9VA 3T1YL 3IFDA 3I4NG 5CR3A 4G7ZC 3L2PA 4QUFA 2ASBA 4ZKCB 3I91A 3VA7A 1L2FA 4LF8Q 2FINB 3ICEA 3HZXA 5LHY1 4F88A 1E3PA 3MZ5A 5BR8L 2XTIA 1A0IA 4IFDI 4S3SA 3GTPB 2KQ3A 1TXYA 4PNYA 3I56A 3K5NA 4L63B 1X65A 1D1IA 3W1GA 2BH2A 1HA5A 3P20A 3BZKA 1J5EQ 3L0OA 3PO3G 5DEHA 5KRUA 2F4VQ 2EOTA 3TS2A 1DJRD 3S1RB 3OYYA 4I65A 3DM1A 4MN3A 5KNBA 1GUNA 3JC66 5IGEA 1SJED 5JPNC 3A7LA 1HPCA 3A0JA 1DOKA 2JJQA 3HS0C 5BN4A 3KFUA 3RLOA 5C4XG 2ZTCA 3LNNA 4DV4L 4IOCA 3UDIA 4JI0Q 1EIYB 2XSCA 4APVA 4LF6L 2KHIA 1D7QA 4CKEA 3U9OA 1B1ZA 3H0GB 1XXGA 2EYPA 3UE0A 4BBRG 3ONAB 1F2MA 1STBA 4HJ5A 1Y1VB 1VQBA 2RCFA 1Z47A 2F0OA 3QOJA 4TQUS 3B6YA 1E2WA 3I7FA 3PCOB 2CQAA 1BUVT 2SOBA 3GTJH 4MTKA 1Q81C 2K04A 2Q2TA 2F3WA 3AMUA 1ASZA 2ZJPA 3I4NB 1IL2A 3EBEA 2VB2X 4BBSB 1PH1A 4AQYL 1TS4A 4OWTB 2Z4HA 1KL9A 2RCNA 1BVSA 3OWFA 3PUZA 3RLNA 3PUVA 3W2DA 2BE5C 1KAAA 4HSPA 2EYJA 3MFYA 1KIXA 4UP8A 2RDFA 1W3SA 5ISRA 3RR5A 1I4XA 2IHFA 3AFPA 4EX5A 1QVGA 4LAAA 2ZJQA 4QIWE 1F9QA 3OW2A 1FVIA 4DR4Q 4DR3L 1AN8A 2RBMA 5M3FH 3NWSA 1CTMA 5E4WC 2DNCA 4DV7Q 5KNCA 1QB5D 1VQFA 4X6AH 2K14A 2LS01 2XN9C 4H0LC 5C3EH 2L5TA 3OMCA 1MI2A 5IP9G 1BKBA 2F0PA 2MP1A 3D4WA 3E5SA 3OWEB 1BXTA 4JI2L 2NVQH 1EY4A 2PO4A 4GNXB 2E2JH 1X55A 3J80c 2B2YC 4JI4Q 4BY7H 4IALA 5FJ8H 3FKIG 5IT9c 3ULPA 4FYDA 2DGYA 2UUCL 3J80L 2VL6A 4I7AA 3L7ZC 1PFSA 1XWEA 4IFDH 4KHPL 5EPLA 5C0XG 2NVTB 4E6IA 1JJ2A 3E9HA 3NBHB 3IL8A 1MIUA 1LTBD 4GKKL 1TS3A 4ALPA 2AQ1B 5EKKA 3CC7A 1S40A 2P5ZX 4K2KA 1MJCA 4YCVA 4EGVA 2NVXB 4NXML 1E1OA 2IWHA 1HXYD 2QEJC 1I6HH 4DNIA 2VQEL 1K3BC 2KCNA 1O80A 1VQEA 5C4JB 1RHPA 1DYQA 4DKAC 1PDQA 2Q2IA 2O2LD 3JAMi 3FHWA 5K36H 2NTSA 1LM0A 2IY5B 2JA5H 1VDZA 2L4NA 5FK9C 3F2BA 1K0SA 5C4XH 4BXXG 4LFBL 3QR8A 1VQLA 3M7NA 4X62L 3CXCA 4ZRZA 1EFID 4JK1C 5CV5A 3J81j 4CDEC 3TQYA 1CHQD 4DR3Q 5CORA 5FLMH 2UUBL 2E2IB 1J9OA 1CKNA 3HOZH 3UDXA 1YNJC 4RAUC 1HR0L 2EXDA 2KCTA 4A3IG 3I4MH 3HGBA 3N52A 4JI4L 1IBKL 4BS9A 2PZUA 4A93H 3M85A 3GTMB 3PO2H 4U68A 1ONLA 4OEMB 2QW7A 1DM0B 5FLXc 1SXTA 1MJEA 1DZ1A 1MSHA 2DJGC 4IOAA 4XXEA 1VMPA 4GS3A 1QZGA 2ES2A 1LTAD 4K8IA 1U4PA 1KLUD 4RWSC 1PH2A 4LF5L 4K5XA 1WVLA 3SDZA 3C46A 3UDFA 3CMEA 3BDOA 3I4NH 3PSIA 1PZKD 2JA7G 3E9IA 2F0QA 1XNQQ 1PH7A 2I5HA 1TWGB 1EOVA 3SGIA 5EGTA 3M4OB 2OWOA 2EYOA 3PIPA 3KJPA 1N33Q 3T13A 1AZQA 1H9SB 3TN2A 1K8MA 3RUZA 2N78A 1TU2B 4POGA 1G51A 1SYDA 4B3ML 3HOVG 1TWCB 2YTYA 2A73B 2Q2HA 3AQQA 2YU9H 1IBML 3TMEA 1QNKA 2Z0SA 5I6YA 1JOKA 4L5RC 2LKVA 4NP5A 3V96A 3J81E 4XDXA 3DWPA 3CQZH 2JYOA 3W3AA 3SEBA 1R9TH 5JJLA 5KEEA 2H5XA 1Q8KA 5HGTA 1X3GA 1VF5C 4UP7A 4R8IA 1VQ7A 5FLXL 3TS0A 4XQNA 5C44G 3H3VH 2B29A 3J7A5 1QZHA 2A8VA 4AYBE 1AE2A 4HIDA 4B3TQ 1HH2P 5J22A 1B9MA 2K5WA 1TVXA 4ME3A 4DK6C 4UY8C 1M1KC 3K0YA 4IUUA 2D0OA 3BDCA 4YCWA 3VDYA 3T4AC 1CQVA 2D5DA 2XRQD 4WJ3M 4X3UA 4LF9Q 1VMCA 2R61A 3AU7A 1DOLA 4HJAA 4WRDA 3OTOQ 1SE4A 3D6WA 4EQOA 2B8GA 1YNJD 4UDUC 2OTLA 4FP5D 5D14A 5IWAL 4IUNA 1YJ9A 2KBNA 1TIID 1XPOA 1Q82C 2BOSA 1SR3A 1Q7YC 5M3MB 1X3FA 2N8NA 1OXSC 3G6EA 5EJWA 4JI1Q 4CJ0B 2F3IA 1I4QA 1TWAH 1JJCB 2A6HC 3S9WA 5C4JH 3CCVA 4OX9Q 1EY8A 3S1NB 3G6JB 5TSSA 3GTLB 1DD2A 3CCLA 1EIFA 3U4VA 1TWFH 4BY7B 1BR9A 2KCCA 4I7ZC 3S14B 1QJOA 1RF2D 3ZYYX 1ZYRD 2UUAL 5M5XH 3HOVB 3KUPA 3C3LA 4DR7L 1JORA 3M9BA 4TRDA 2ENBA 2ZXRA 2MHVA 1LTSD 3DMUA 2X6LA 1SNDA 4N8X1 4YWKA 2MJ8A 1WTWA 1EOTA 3M3YH 2JA6G 1ML0D 3Q6SA 3VA5A 3IAYA 4LUVA 1UE1A 5JJIA 4DUYL 5ELEA 1PXUA 3E6ZX 3EFXD 4WJ4A 4N8FA 2CKZB 3DEOA 3RZDB 4L5QA 1X6OA 5IODA 4XTCS 4K8JA 2DN8A 4JOIA 5CC4A 4HJ9A 4KD3A 1JR0D 2KOLA 2WV6D 3QOLA 2E2IH 4KV6A 1Y1VH 1QG7A 1A2TA 4JI5Q 2G9HD 4QJFA 3MVVA 1SNOA 4F8MA 2MGSA 4AH6A 2YTVA 3KBXA 1C4QA 2HDLA 1O7ZA 5FJ8G 1R4PB 2BH8A 1TWHH 4R1JA 4A3BG 3I3CA 4L8JA 1BCPD 3OIQA 3PIP3 1HFGA 2HQEA 5IOCA 3AYHB 1PRTB 3OOCA 5C3EG 3BS1A 1Q8IA 2ZM6L 2E76C 5IYBH 4DUZQ 1WFQA 1ENFA 4DR6Q 2B2UA 2PI2A 1OXVA 4A93B 1QCBD 1OO9B 4K5WA 3GTPH 3R2IA 3G7LA 1V1OA 1PRTF 1R4QB 3J7AV 3CAMA 4IPGA 4GKJQ 3DWAA 1WCMG 1LT3D 3E3XA 1SNPA 4R4OA 1Y14B 4UPAA 4KY7A 4DPGA 4LF8L 3EN2A 4DV6L 1NTGA 2PMZB 2K4KA 4K6DA 3BZCA 1J6QA 2KVMA 2IT1A 4RH6A 5FLXE 3I55A 3HOZB 4MHEA 4A3DG 5FO9B 1G6PA 1VQMA 1K28A 4CKCA 2UXDL 2VUMB 2KENA 1I50H 4JI0L 4HCEA 1VQDA 2JE6I 3TZDA 4J8QA 1G2TA 2F3VA 1JB3A 3IFTA 5CV9A 1F2YA 5CYUA 3DLLA 1PRTC 3MXNA 1RODA 1CKNB 4R9WA 3GTKB 2EYFA 3R93A 1SJHD 4P2CB 1RD9D 1I3QB 2AUKA 1EEID 1G8ZD 3KK7A 2PYKA 1U0LA 4J15A 5IYDG 1WTRA 3O13A 4NW2A 4A3EB 3KYHC 4DV5Q 4QIWB 3JAME 3NTHA 4B3RL 4IQZA 4XYQA 4ZK9B 4BY1H 1SYFA 1S5FD 2WIIB 1STGA 3K81C 1BCPF 2LXJA 5FO7B 4BBSG 1Z7TA 2ALYB 2XWJB 3K8AA 1GUGA 4OXPA 4DV2L 1M8AA 1NBWA 2OCEA 1TWCH 4B3SQ 3D31A 4X64L 4A75A 4DUZL 1Y1WB 3NBIA 4OWWB 1VQ9A 1Q1EA 2SNSA 1GO3E 3ULLA 1A3VA 2SEBD 3G4SA 3L3OC 1FJGL 2F0IA 1K3RA 3CCRA 1GJXA 1TQOA 3GTGH 2B2VC 1HNZL 1O7IA 2JN4A 1GHJA 1S72A 3EIVA 1EL0A 4PMWA 4A3DH 3A7AB 2DY7A 2RDHA 4LNQA 3NQTA 4X65Q 1KTKA 1LTID 1YZ6A 3GTLH 5I6WA 2MFIA 3MTSA 4HMIA 4KD4A 3KLWA 4LFAL 5LL6S 1VQKA 1ZKOA 5C4XB 4ID6A 2R92H 1WTOA 3P1HA 2B63G 4JV5L 3HEJA 3S2HH 5ELDA 4OIJA 1JQYD 4BBRB 3LWEA 4CGYB 3GTMH 5C5MA 2WAQG 5IT9L 4KHVA 4RGTA 2KHSA 3L9AX 1EEFD 1P16A 2D2CC 2RVLA 2K5HA 5GROA 3T1HQ 5I2YA 1PH4A 2B8FA 2KUMA 1V43A 4ABNA 2NUCA 4B3TL 1YHQA 1PH3A 5I9PA 3HRZC 1STHA 2K33A 2F0GA 1NR2A 4IUPA 4QUCA 3OTOL 5C6AA 1OXTA 2ATWA 4C56C 1E1TA 4RMFA 1WTVA 3S1MB 5IGFA 3S15B 5C4ZA 1HJPA 4HN7A 1PHJA 1IKLA 2RQXA 5IYCH 1UE5A 1PZID 3WDNA 5HY6A 5BN3A 2JA8B 1V1PB 3MEFA 4JC0A 2J7ZA 1AW7A 3M4QA 2VB3X 3VR3A 1I6VC 1VF7A 4QQBX 5LMNL 3OMGA 4DR5Q 5ELCA 4FF1A 1IKMA 4DV3L 3A8IE 2CH4A 3I73A 4LUOA 3HFZB 1U5KA 2EDGA 3CKIB 1N8RC 1SNQA 4LK1C 2K5VA 4DAYB 4IFDJ 2HCIA 3AFQA 3LX0A 2NN6I 2EYLA 1NMFA 1II3A 4AYBB 2JEAI 2F0HA 2GA4B 5CV8A 2B63B 4DV1L 4ODGA 2BDNA 2R93G 2DJFC 4BA2I 2A19A 1FNWA 4KK7A 5IGBA 3K59A 4DAVA 2PCFB 1ILPA 5EPJA 1J5EL 2A68C 1TWHB 2R7FA 1XNRL 2JA6H 2RHSB 1K9MC 4IURA 3SK8A 3RZOH 3VYTA 3F8TA 1PRTD 5IE8A 2QEXA 2QKIC 2O5JC 1EYDA 2J4XA 1QWYA 2JA9A 3D0FA 3PUWA 2K1BA 1OXXK 1XJVA 2UUBQ 5EKIA 1EY9A 2EJMA 2F4IA 3RMHA 3BVGA 4JI8L 4DAYA 2XGTA 2FMMA 3PQIA 4JPBW 3S16B 3HKSA 1N32Q 4EQNA 1HNXQ 3QIAA 4A3FH 3SR1A 2OTJA 2NN6H 1L0WA 3MAQA 1Q86C 1HNZQ 3CCQA 3NENA 4DF7A 3J7YW 2JA8G 3HOXG 1HTLD 1SMXA 2V1CC 1TY2A 3BU2A 4CHTB 4B3MQ 3KDFA 2VQFQ 1UEAB 4X65L 5C44H
chains in the Genus database with same CATH topology
1BCPC 2F0EA 5G3LF 1KNAA 2PW7A 1H9KA 4H44C 1QNUA 2JXMB 1BBXC 4FF4A 5IGCA 5DM63 2FFKB 1CZGA 4DXGA 2B2TA 1WD1A 3S1QB 3PV0A 5KGUA 2IL8A 1FR3A 4A3MB 4A3JB 1AP0A 2CHBD 1L0YB 3GV3A 2AUJD 2E75C 3FEWX 3EJIA 5AFWA 4X3SA 2JA5B 1B2TA 3H94A 2B2VA 4LMQD 4QB4A 2QILA 1SE2A 1MD2D 3A56A 1YNNC 2RSOA 3VYSA 1EY6A 2FMCA 2A69C 5CV4A 1CA6A 4KKSA 3TDQA 1Q12A 2MPMA 4G57A 1DOMA 5CV6A 5CGKA 3M4YA 1TS5A 4QCLA 2N88A 3A54A 3QJYA 3BVZA 4HSVA 3NTIA 2I46A 1FGBD 3KLSA 4CJ2C 1B3AA 3BZDB 3URYA 2K6AA 4J1MA 1IYVA 1EWHA 3RLFA 1WTQA 1C48A 2YU9B 1F77A 3GQBA 3PIO3 1L0XB 3KF8A 1QILA 5C3XA 1STAA 1SMYC 3P7JA 5CMDA 1TKWB 3NBHA 4G4KA 4UAIA 4PQXA 2LMCB 3FMCA 4KTAA 2J0TD 1Q1BA 2V4DA 4Q0FA 1E0BA 1LABA 1K83B 2B2YA 2R7ZB 2E2DC 1SDFA 4RKLA 2X69A 5C0XH 4KN4C 2PQEA 4KJOA 4IFDG 1XX8A 2Z1CA 1RCVD 5I2XA 2NVQB 5A35A 2IX1A 2LFNA 3S17B 5JAVA 1SMYD 2DY8A 3EA6A 4U673 4ZQ3A 3V05A 1EU3A 2B2WA 1D5XC 1LACA 1XTCD 2H4OA 2RSNA 5EQ0A 3HOWB 1I50B 3KLSX 2A68D 4A3DB 3GV6A 4FVMA 3HOYB 2ZT9C 1NCVA 5C3WA 2PZWA 3MA2B 1Z6HA 1LLRD 2L1BA 1B53A 1IYUA 4KY5A 1RKNA 2NWGA 1STYA 2K5QA 1Y8PB 1KDAA 1NAPA 3P75A 1M4VA 1CA5A 1LT4D 4XYOA 3VR6A 2D62A 1O78A 2WKDA 2BE5D 2IPKD 1CFMA 3UI2A 3T53B 2R92B 5J39A 1PFBA 1ZEQX 3MC0B 1EYAA 2O4XA 1JWUD 4A3KB 4TSSA 2EYHA 2F0VA 1JC7A 1CK1A 4RHRA 5CBAE 1AFPA 4ZUJA 3ND9A 3J81L 3HG9A 2L11A 2AWNA 1D5ZC 1IW7D 1PTOB 2Q8RE 4IUVA 3TP6A 1I4RA 1C8CA 3Q0AA 3BG3A 5T1IA 3K5MA 5KYIA 4A3GB 1JOQA 3X3NA 2WP8J 5K5PA 3CRKC 1LTTD 4K6LA 3SHLA 3PUYA 1F9PA 1HCZA 5FO8B 4EVOA 1PFNA 4LJZC 1RTOA 2K32A 1EWCA 1CZWA 3FKIB 2EPBA 2EVBA 4C3HB 4DNTB 1G91A 2K28A 3DXJC 5D3DA 5LL6X 3OW7A 3K6OA 2QF7A 4PV1C 5M3FB 3RZOB 5CV7A 1K8OA 1GXDC 5C5LA 5EBCA 3Q23A 3NPPA 3T16A 1HHVA 1Q90A 4RCOA 4DNRB 4XQJA 2F0DA 1TT2A 5A2QE 4KKUA 5KYLA 2NBFA 1JCKB 3D4RA 1FNVA 3GD7A 4Q5VA 3NXWA 2PZTA 5IGGA 1A3UA 1A6XA 2H1EA 5BN5A 1EIGA 4C3JB 1Y8NB 1ZXTA 1JE4A 5EPKA 4BWGB 3GTGB 3FVQA 2K05A 1DONA 3QO2A 4C3HG 4ZUIA 3R3OA 5IT9E 1JWSD 3MWYW 4DXFA 5C0XJ 5KNDA 2ICEC 2HUGA 2KEEA 2R6GA 4IUTA 2A69D 1AZPA 4XT1B 3MHBA 5J1ZA 2RA4A 1U4LA 1KDBA 5C4HA 1STNA 2A5HA 4RGOS 3U9SA 1YNND 3WOFA 1FD7D 2Z8LA 1KNEA 1ESFA 3ITPA 4ZAIA 2YYZA 1HA6A 2KECA 4B9XA 4XQQA 2O5IC 1S5DD 4C3JG 3D6CA 1SYEA 1SYCA 2WACA 4O42A 3F2UA 1MBYA 2KEDA 2XVSA 1ESRA 4RA8A 1LV9A 4L6TB 3A8JE 3QB3A 3BDLA 3V2TA 1EZ6A 1IW7C 3NSWA 1QOHA 2LY7A 3QWNA 2F0UA 2NB0A 1HUMA 1I4GA 4IZ8A 1IHZA 5K36G 3TZUA 4RGMA 2Z4IA 2TMPA 1S5ED 4FXGC 4B08A 4Z9CB 1CHPD 1LTRD 2BDOA 3MFGA 3PO2B 3E0JA 1BOSA 2R3ZA 3EQLC 4KHZA 4KN7C 1ET6A 4RCNA 2FJ2A 3D8GA 2F1MA 3CQZB 1R9TB 3DUZA 1I4HA 3VR4A 3AB9A 2C5CA 1BDOA 1PFMA 4F87A 3C1FA 1EYCA 5D65A 4FF3A 3PUXA 1F9SA 1PTOF 3WOEA 3QG1A 3J7AF 1HQRD 5E4XA 5G3LD 5C0XI 3R2TA 4BA1I 4K2LA 1ET9A 2IX3A 3NK9A 2PNRC 5ELBA 2A74C 2XIWA 1LT5D 5M5XB 4BY1B 4WORA 3A8KE 1I4PA 4QMGA 1RDPD 2EXZA 1TY0A 4FXKC 2F0SA 2Y0SB 1V1PA 1B9NA 5IGDA 2X6GA 3I72A 2FHTA 1PTOC 2F0FA 5C3EB 3R8BA 3I4MB 1DCZA 4RGNA 1BCPB 2L0CA 3S2DB 4RHSA 3M3YB 2PPBC 1V8QA 4OO1H 2AQ2B 2NVYB 1T5EA 2L9HA 4XT3B 1SYGA 3D3RA 3NWTA 3OPOA 1PMRA 4RKBA 3SK6A 1UUPA 4HAEA 4RFBA 5I9OA 1EZ8A 3VR2A 3IKJA 1I6HB 4OO1I 2OT2A 4F7XA 3NHHA 1Y69U 4YIJA 1AEXA 3KLRA 1PZJD 2ID0A 2K03A 5DNFA 2D9UA 3MXGA 1B50A 2L55A 3HOUB 2PW5A 5JVG3 1SE3A 4QF4A 1D6EC 4PMBA 3NP8A 2G9DA 1TR5A 2IJ0A 1H9RA 5JEAH 4WJWA 2EY1A 3I4LA 1WTXA 2XNAC 4ILWA 1T5XD 4IUQA 2F0JA 1CM9A 1ILQA 2OF1A 2B39A 3X3MA 3TP8A 3A55A 2JA6B 1G291 2C9OA 1G2SA 1EU4A 2KJXA 3Q22A 1A3TA 3ND8A 1CT1D 2K5DA 1W6JA 3PO3B 1NSNS 2L12A 1O7LA 2AWOA 2EJGC 1J8IA 4N9TA 4PMCA 2XRSD 1Q3LA 3H09A 1OXUA 1WD0A 5EKLA 2EZVA 4GZYC 3DWQA 3K5OA 4ME5A 3BYYB 4R8NA 2E2HB 5I4DA 1EQTA 1F2LA 2QCPX 3FPPA 2WINB 3BYTB 3SVMA 2B2TC 3S2HB 4DK1A 4DA2A 5T1GA 3SK5A 1EY0A 3FPUB 2VNUD 3BVMA 4FF2A 4C1NI 1SYBA 1PLFA 3SE0A 3MEHA 1EIHA 2SNMA 4M1UB 5CBEE 4K5VA 5E3FA 2SDFA 5D3IB 1VCIA 4Y7NB 3TP7A 1UNSA 4V190 2EY6A 1DXMA 5NUCA 5EBDA 2R93B 1E2ZA 1GUWA 2Q8IB 2MUYA 1X32A 1JOOA 3Q24A 2DNEA 1PTOH 4HEDA 2Q8TA 2BA0A 2M00A 4ZLTF 4KI0A 3FDTA 4C2MB 1EY5A 3DEPA 2HCCA 2TSSA 4M8AA 4MIUA 3K7AB 2BCOA 2B2WC 1QE6A 1SSOA 4HTHA 1ZYRC 4OHJA 4KMUC 2EE1A 1A15A 2F0MA 3K57A 1MGSA 4NMZA 5M5WB 1EY7A 1BO0A 3I70A 1D1KA 5JJZA 1D2BA 5JOBA 3HOXB 2A6HD 1GUSA 2F0LA 1WTPA 4DFAA 1NR4A 4CJ1B 4TKOB 3T56B 4EQPA 3H91A 1X3PA 2N55A 2ZXPA 2ZXOA 4K14A 3CHBD 2EJFC 3T51B 1F9RA 4DGZA 1UAPA 5M9OA 3HKZB 5F2DA 2JP1A 2WAQB 4CKBA 3OSOA 2IX0A 1STEA 2AQ3B 3SXHA 1FYCA 4KY6A 4OO1G 2F0NA 4V0BA 3TBIB 3HP3A 3C1EA 3GTQB 1U4MA 1E2VA 3SK4A 2JEBI 1RTNA 2OEOA 5DM73 3C2PA 4JBWA 5A2QL 2JA7B 2BA1A 4H7BA 3CU7A 2F03A 2K7VA 1S4ZA 5HURA 1SEBD 4FO2A 4G7OC 2F0KA 2CVRA 1G6ZA 1X3QA 4J6HA 1SFOB 4ZKBB 4OGQC 3VYRA 3EVQA 3GO5A 3N6RA 1S5BD 2RKSA 4NKLA 1O7YA 3NTKA 1KLGD 3PMFA 2KA7A 3GTOB 2WKCA 1H9SA 4A3IB 1GHKA 5C44B 1HFNA 2F0TA 1GUOA 4KJNA 4OIKA 2M2LA 1HTPA 2VXWA 1JWMD 4WFN3 3CRLC 4DAPA 2E2JB 1KABA 5FKAC 1GUTA 5JVH3 3MXUA 4ULLA 2F0WA 4HMJA 4XIGS 5KIXA 1LO5D 1ICWA 1W6KA 5FOBB 3LWUA 1GOZA 4HCSA 3FRPB 3NQIA 1NUCA 1SAPA 1S5CD 5DAUA 3K5LA 1H9JA 1BNZA 4H13C 1HQMC 1Y8OB 4C3IB 1LT6D 1PYWD 2B2UC 2CW0D 2ICIA 4KKTA 1KDCA 3VYUA 3KBGA 4X3KA 3H6MA 3I8ZA 1SNMA 4A3FB 3VR5A 1D5MC 1U4RA 2A6ED 1PTOD 2NN6G 1CQFA 5JEAJ 4O1NA 1JICA 2NZ1D 2NYZD 3D4DA 3MXPA 1B44D 1TS2A 1B4OA 3NE5B 5IIFA 4FXDA 3OIPA 3TSSA 1H9MA 2WB1B 3NUCA 4G7HC 2E74C 2EYMA 1BF4A 3TP5A 4X3TA 1XYIA 1ENCA 3RD4A 3K58A 3EROA 4A3BB 2RDGA 1LTGD 2K01A 4CBVA 1EQVA 5M5YB 2NTTA 3I90A 2XWBB 5COYA 3GTJB 4ZYSA 3J80E 4C1NK 1SNCA 1MSGA 3M7GA 4DK0A 4IN3A 2HDMA 2OXPA 3GP7A 1FNUA 4C3IG 4NDXA 3DHQA 4B9WA 1WCMB 1U9RA 2EY5A 5JEAG 1BQQT 4N9PA 4OL7A 1A2UA 1RJTA 5JPMC 1CI3M 4HR7B 3H3VC 2JSOA 4FNFA 2QDBA 1IL8A 2EY2A 1F2ZA 5ELFA 2I07B 4DU9A 5E1FA 2A6EC 1HUNA 1TWFB 1ENAA 3JAML 4DN4M 1SBBB 1HRJA 2IW3A 3ERQA 2CW0C 1TWAB 3OHXC 2M9VA 3IFDA 5CR3A 4G7ZC 4QUFA 4ZKCB 3I91A 3VA7A 2FINB 3HZXA 5LHY1 4F88A 3MZ5A 4IFDI 4S3SA 3GTPB 2KQ3A 4PNYA 3K5NA 4L63B 1D1IA 1HA5A 3P20A 5DEHA 5KRUA 2EOTA 1DJRD 3S1RB 4I65A 3DM1A 4MN3A 5KNBA 1GUNA 5IGEA 1SJED 5JPNC 3A7LA 1HPCA 1DOKA 3HS0C 5BN4A 3LNNA 2XSCA 4CKEA 3U9OA 1B1ZA 3H0GB 1XXGA 2EYPA 3ONAB 1F2MA 1STBA 1Y1VB 1Z47A 2F0OA 3QOJA 4TQUS 1E2WA 2CQAA 1BUVT 2SOBA 2K04A 3AMUA 2F3WA 3I4NB 2VB2X 4BBSB 1TS4A 2Z4HA 3OWFA 3PUZA 3W2DA 3PUVA 2BE5C 1KAAA 4HSPA 2EYJA 3MFYA 2RDFA 5ISRA 1I4XA 4LAAA 1F9QA 1AN8A 2RBMA 3NWSA 1CTMA 5E4WC 2DNCA 5KNCA 1QB5D 2XN9C 2LS01 4H0LC 2L5TA 3OMCA 1MI2A 2F0PA 2MP1A 3D4WA 3E5SA 3OWEB 1BXTA 1EY4A 2PO4A 2B2YC 4IALA 4FYDA 3J80L 3L7ZC 1XWEA 4IFDH 5EPLA 5C0XG 2NVTB 4E6IA 3IL8A 1LTBD 1TS3A 2AQ1B 5EKKA 4K2KA 4EGVA 2NVXB 2IWHA 1HXYD 2QEJC 2KCNA 1O80A 5C4JB 1RHPA 1DYQA 1PDQA 2O2LD 5K36H 2NTSA 1VDZA 2L4NA 5FK9C 3M7NA 4ZRZA 1EFID 4JK1C 5CV5A 1CHQD 5CORA 2E2IB 1J9OA 1YNJC 4RAUC 3HGBA 3N52A 4BS9A 2PZUA 3M85A 3GTMB 4U68A 1ONLA 1DM0B 1SXTA 1DZ1A 1MSHA 4XXEA 1VMPA 1LTAD 4K8IA 1U4PA 1KLUD 4RWSC 4K5XA 1WVLA 3SDZA 3C46A 3BDOA 1PZKD 2F0QA 1TWGB 5EGTA 3M4OB 2EYOA 3T13A 1AZQA 1H9SB 3TN2A 1K8MA 3RUZA 1TU2B 1SYDA 1TWCB 2A73B 3TMEA 1QNKA 5I6YA 1JOKA 2LKVA 4NP5A 3V96A 3J81E 4XDXA 3DWPA 3W3AA 2JYOA 3SEBA 5KEEA 5HGTA 1VF5C 4R8IA 5FLXL 4XQNA 5J22A 1B9MA 2K5WA 1TVXA 3K0YA 4IUUA 3BDCA 3T4AC 1CQVA 2D5DA 2XRQD 4X3UA 1VMCA 2R61A 3AU7A 1DOLA 4WRDA 1SE4A 3D6WA 4EQOA 2B8GA 1YNJD 4UDUC 4FP5D 5D14A 4IUNA 1TIID 2BOSA 5M3MB 1OXSC 5EJWA 4CJ0B 1I4QA 2A6HC 3S9WA 1EY8A 3S1NB 3G6JB 5TSSA 3GTLB 1DD2A 4BY7B 1BR9A 2KCCA 4I7ZC 3S14B 1QJOA 1RF2D 3ZYYX 1ZYRD 3HOVB 1JORA 3KUPA 3C3LA 4TRDA 2ENBA 2ZXRA 2MHVA 1LTSD 3DMUA 2X6LA 1SNDA 2MJ8A 1WTWA 1EOTA 1ML0D 3Q6SA 3VA5A 3IAYA 5ELEA 1PXUA 3E6ZX 3EFXD 3DEOA 3RZDB 5IODA 4XTCS 4K8JA 2DN8A 5CC4A 4KD3A 1JR0D 2KOLA 2WV6D 3QOLA 4KV6A 1QG7A 1A2TA 2G9HD 3MVVA 1SNOA 4F8MA 2MGSA 3KBXA 1C4QA 2HDLA 1O7ZA 1R4PB 3I3CA 4L8JA 1BCPD 3OIQA 3PIP3 1HFGA 2HQEA 5IOCA 1PRTB 3OOCA 3BS1A 1Q8IA 2E76C 1ENFA 2B2UA 1OXVA 4A93B 1QCBD 1OO9B 4K5WA 3R2IA 3G7LA 1V1OA 1PRTF 1R4QB 3J7AV 3DWAA 1LT3D 1SNPA 4KY7A 2PMZB 4K6DA 2KVMA 2IT1A 4RH6A 5FLXE 3HOZB 4MHEA 5FO9B 4CKCA 2VUMB 4HCEA 2JE6I 3TZDA 4J8QA 1G2TA 2F3VA 1JB3A 3IFTA 5CV9A 1F2YA 5CYUA 1PRTC 3MXNA 1RODA 4R9WA 3GTKB 2EYFA 3R93A 1SJHD 4P2CB 1RD9D 1I3QB 2AUKA 1EEID 1G8ZD 3KK7A 2PYKA 1WTRA 3O13A 4NW2A 4A3EB 4QIWB 3JAME 3NTHA 4IQZA 4XYQA 4ZK9B 1SYFA 1S5FD 2WIIB 1STGA 1BCPF 5FO7B 1Z7TA 2XWJB 1GUGA 1M8AA 3D31A 1Y1WB 3NBIA 1Q1EA 2SNSA 1A3VA 2SEBD 3L3OC 2F0IA 1GJXA 1TQOA 2B2VC 1GHJA 1EL0A 4PMWA 3A7AB 2DY7A 2RDHA 3NQTA 1KTKA 1LTID 5I6WA 4HMIA 3MTSA 4KD4A 5LL6S 1ZKOA 5C4XB 4ID6A 1WTOA 3P1HA 3HEJA 5ELDA 4OIJA 1JQYD 4BBRB 3LWEA 4CGYB 5C5MA 5IT9L 4KHVA 4RGTA 2KHSA 3L9AX 1EEFD 2D2CC 2RVLA 5I2YA 2B8FA 2KUMA 1V43A 4ABNA 2NUCA 5I9PA 3HRZC 1STHA 2K33A 2F0GA 1NR2A 4IUPA 4QUCA 5C6AA 1OXTA 4C56C 1WTVA 3S1MB 5IGFA 3S15B 5C4ZA 4HN7A 1IKLA 2RQXA 1PZID 3WDNA 5BN3A 2JA8B 1V1PB 2J7ZA 1AW7A 2VB3X 3VR3A 1I6VC 1VF7A 3OMGA 4FF1A 5ELCA 1IKMA 3A8IE 3I73A 2EDGA 3CKIB 1SNQA 4LK1C 4IFDJ 2HCIA 3LX0A 2NN6I 2EYLA 1II3A 4AYBB 2JEAI 2F0HA 2GA4B 5CV8A 2B63B 4ODGA 2BDNA 4BA2I 1FNWA 4KK7A 5IGBA 3K59A 4DAVA 2PCFB 1ILPA 5EPJA 2A68C 1TWHB 4IURA 3SK8A 3VYTA 1PRTD 2QKIC 2O5JC 1EYDA 2J4XA 1QWYA 3PUWA 2K1BA 1OXXK 5EKIA 1EY9A 2EJMA 2F4IA 3RMHA 3BVGA 4DAYA 2FMMA 3S16B 4EQNA 3QIAA 3SR1A 2NN6H 3MAQA 4DF7A 3J7YW 1HTLD 1TY2A 4CHTB 1UEAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EY5 A;  2F0G A;  4N9T A;  5KYL A;  4PMC A;  3QB3 A;  3BDL A;  1EYA A;  2O4X A;  3V2T A;  4J6H A;  1JOR A;  2F0E A;  5C6A A;  2RBM A;  3NUC A;  1EZ6 A;  2PW7 A;  4MIU A;  3NXW A;  3EVQ A;  2ENB A;  4TRD A;  2F3V A;  2PZT A;  5IGG A;  4K8I A;  5EKL A;  2EYH A;  5IGF A;  3HZX A;  2F0V A;  1A3U A;  1F2Y A;  2EYM A;  3DMU A;  4HTH A;  1SND A;  2RKS A;  4K5X A;  2F0U A;  3MZ5 A;  3TP5 A;  1SYG A;  4NKL A;  5C4Z A;  4ZUJ A;  2F0M A;  4ME5 A;  4S3S A;  4IZ8 A;  5IGC A;  1ENC A;  1IHZ A;  2KQ3 A;  3OMC A;  4NMZ A;  4PNY A;  1EY7 A;  2EYF A;  4R8N A;  2F0P A;  3VA5 A;  5M9O A;  5C3X A;  3ERO A;  1STA A;  3D4W A;  3E5S A;  2F0Q A;  4RKB A;  3SK6 A;  3PMF A;  1EY4 A;  5JOB A;  2PYK A;  5I9O A;  5EGT A;  1EZ8 A;  2F0L A;  3TP6 A;  5DEH A;  5KGU A;  4KTA A;  5KRU A;  4DFA A;  5IOD A;  1EQV A;  2EYO A;  4K8J A;  4IAL A;  2F0T A;  5CC4 A;  3T13 A;  3OMG A;  4KD3 A;  4ZUI A;  4I65 A;  4KJN A;  3SK5 A;  1EY0 A;  3RUZ A;  4EQP A;  1SNC A;  3QOL A;  5KYI A;  5IGE A;  4F7X A;  3R3O A;  3EJI A;  1SYD A;  4KV6 A;  1JOQ A;  3NHH A;  1SYF A;  1A2T A;  1STG A;  4RKL A;  1SNQ A;  2PQE A;  3D8G A;  4KJO A;  3MVV A;  2OXP A;  4YIJ A;  4K14 A;  4E6I A;  1SNO A;  3TME A;  4F8M A;  1KAB A;  3LX0 A;  2EYL A;  5I6Y A;  1II3 A;  1JOK A;  5K5P A;  2LKV A;  2F0H A;  1AEX A;  4NP5 A;  5CV8 A;  4NDX A;  3DHQ A;  4ODG A;  3U9O A;  1SYB A;  2EYP A;  5CV9 A;  4DGZ A;  4QB4 A;  5EKK A;  2SNS A;  5IGB A;  2F0W A;  3MEH A;  3SHL A;  4B9W A;  5F2D A;  4HMJ A;  1A3V A;  5KEE A;  1F2M A;  1STB A;  1U9R A;  2SNM A;  3C1F A;  4K2K A;  4ZQ3 A;  5HGT A;  5KIX A;  1EYC A;  2F0I A;  2EY5 A;  4K5V A;  4EVO A;  2F0O A;  4N9P A;  1TQO A;  2HQE A;  3MHB A;  3QOJ A;  1EY6 A;  5J1Z A;  5IOC A;  4OL7 A;  1A2U A;  2PW5 A;  5E3F A;  1KDB A;  5C4H A;  1STN A;  2SOB A;  3OSO A;  4QF4 A;  2F3W A;  3SK8 A;  5J22 A;  4PMB A;  3NP8 A;  5CV4 A;  1TR5 A;  3SXH A;  3TP7 A;  3NQT A;  4K2L A;  5C3W A;  1NUC A;  3ITP A;  2PZW A;  2EY1 A;  3BDC A;  4KY6 A;  1EYD A;  5I6W A;  2QDB A;  3NK9 A;  4HMI A;  2F0N A;  4G57 A;  2EY6 A;  4K5W A;  4KD4 A;  5DAU A;  4KY5 A;  2F0J A;  5CV6 A;  4WRD A;  1RKN A;  3C1E A;  5NUC A;  5CGK A;  4ID6 A;  5IIF A;  2EY2 A;  1F2Z A;  1EY9 A;  4DU9 A;  3P1H A;  4EQO A;  3HEJ A;  5E1F A;  2OF1 A;  1STY A;  4B9X A;  4WOR A;  5CV5 A;  1KDA A;  3SK4 A;  3P75 A;  3OWF A;  1KDC A;  2OEO A;  1KAA A;  4IUN A;  3H6M A;  2EXZ A;  4QMG A;  5CV7 A;  2EYJ A;  3TP8 A;  1SNM A;  1SNP A;  5C5M A;  4EQN A;  1ENA A;  2F0S A;  4KHV A;  2KHS A;  1JOO A;  2RDF A;  4KY7 A;  3SR1 A;  5IGD A;  5C5L A;  3D6C A;  5ISR A;  1SYE A;  1SYC A;  2WAC A;  3ERQ A;  4H7B A;  4DF7 A;  2M00 A;  3S9W A;  2F0F A;  1A3T A;  1EY8 A;  3T16 A;  3D4D A;  3MXP A;  4K6D A;  2NUC A;  5HUR A;  4LAA A;  4J1M A;  5J39 A;  1NSN S;  5I9P A;  2F0D A;  5CR3 A;  2PZU A;  5JAV A;  2F0K A;  1TT2 A;  1STH A; 
#chains in the Genus database with same CATH topology
 4LF5 Q;  1BCP C;  2F0E A;  5G3L F;  1KNA A;  2PW7 A;  1H9K A;  4H44 C;  1QNU A;  5ELO A;  1JJG A;  1NNX A;  2JXM B;  5AJ3 L;  1BBX C;  5IP7 G;  4FF4 A;  4DK3 C;  5IGC A;  4LFA Q;  5DM6 3;  2FFK B;  2KCM A;  1CZG A;  4DXG A;  2B2T A;  1WD1 A;  3PF5 A;  3HOV H;  3S1Q B;  1VQO A;  2JK8 A;  3PV0 A;  5KGU A;  2IL8 A;  1FR3 A;  4A3M B;  4A3J B;  1AP0 A;  2CHB D;  1L0Y B;  3GV3 A;  2AUJ D;  2E75 C;  4NB3 A;  3FEW X;  3EJI A;  5AFW A;  4X3S A;  2K52 A;  1ICF B;  2JA5 B;  1B2T A;  3S15 H;  1X3E A;  3H94 A;  4A3L G;  1KQS A;  3S1Q H;  4OON A;  2B2V A;  4LMQ D;  4QB4 A;  4TVA B;  2QIL A;  1SE2 A;  1MD2 D;  4C3H H;  3A56 A;  1YNN C;  2RSO A;  4UHV A;  2FXQ A;  4ZCK A;  2F4V L;  3VYS A;  1EY6 A;  3G48 A;  2FMC A;  1PV4 A;  2A69 C;  3I4M G;  5CV4 A;  1XNQ L;  2D0P A;  1CA6 A;  1N32 L;  4KKS A;  3TDQ A;  1HNX L;  2ZTE A;  2R7Z G;  2PQA A;  1Q12 A;  4DAM A;  2MPM A;  4G57 A;  1DOM A;  5CV6 A;  1K8A C;  4JW0 A;  5CGK A;  1Q46 A;  1PYS B;  4X64 Q;  4A3C G;  3M4Y A;  3S1M H;  1TS5 A;  5ELN A;  4QCL A;  2N88 A;  3A54 A;  3QJY A;  3BVZ A;  4L5S A;  4HSV A;  3NTI A;  2I46 A;  1FGB D;  3E0E A;  3KLS A;  4DR7 Q;  4CJ2 C;  1B3A A;  2K5N A;  3BZD B;  4MNO A;  3URY A;  3HOW G;  5AJ3 Q;  2B3G A;  1KD1 C;  4CDC C;  2K6A A;  4J1M A;  1IYV A;  4JG2 A;  2HD3 A;  1EWH A;  1X9N A;  3HOY G;  4DR6 L;  4YCU A;  3RLF A;  2F52 A;  4BXX H;  2UXB Q;  1WTQ A;  1C48 A;  2JA5 G;  2YU9 B;  1QVF A;  5L37 A;  3I2Z A;  4LUZ A;  4LFB Q;  1F77 A;  3GQB A;  3PIO 3;  1L0X B;  1CUK A;  3KF8 A;  4X66 Q;  4LF7 L;  1QIL A;  4DV0 Q;  5C3X A;  4JBM A;  1STA A;  1SMY C;  3P7J A;  5CMD A;  1TKW B;  3NBH A;  4G4K A;  4PZ8 A;  4UAI A;  4PQX A;  4IPH A;  2LMC B;  4MZ9 A;  1AE3 A;  3FMC A;  4KTA A;  2J0T D;  1Q1B A;  1WI5 A;  2LXK A;  2V4D A;  1XMO Q;  4Q0F A;  1E0B A;  1LAB A;  1K83 B;  3ULJ A;  2B2Y A;  1VQ4 A;  4LF7 Q;  2R7Z B;  2E2D C;  1SDF A;  4RKL A;  2X69 A;  5C0X H;  2QA4 A;  4KN4 C;  2PQE A;  4KJO A;  4A93 G;  4IFD G;  1WCM H;  3PGZ A;  1XX8 A;  2Z1C A;  2ZJR A;  1RCV D;  4LFC Q;  1JMC A;  5I2X A;  2NVQ B;  5A35 A;  1CKM A;  2IX1 A;  4JOI C;  1YHA A;  2LFN A;  2AKW B;  1KC8 C;  3S17 B;  5JAV A;  5GAH C;  1SMY D;  2DY8 A;  4IJL A;  3EA6 A;  4U67 3;  4ZQ3 A;  3V05 A;  4A3F G;  1EU3 A;  1YNX A;  2B2W A;  2CWA A;  1D5X C;  1LAC A;  1XTC D;  1M90 C;  1KRT A;  3A74 A;  2CH4 W;  2H4O A;  2RSN A;  4LFC L;  5EQ0 A;  5GQO A;  3HOW B;  1I50 B;  3KLS X;  2A68 D;  4A3D B;  3GV6 A;  4FVM A;  3HOY B;  4C3J H;  1E7Z A;  4YWL A;  2ZT9 C;  1NCV A;  5C3W A;  2PZW A;  3MA2 B;  1Z6H A;  1LLR D;  2L1B A;  4A3B H;  2LSS A;  1B53 A;  1IYU A;  4KY5 A;  1VQA A;  1RKN A;  4C3I H;  2NWG A;  1STY A;  1SRU A;  2K5Q A;  1Y8P B;  1KDA A;  1NAP A;  3K0X A;  3P75 A;  4GNX A;  1M4V A;  3CCU A;  1LT4 D;  1CA5 A;  4XYO A;  1EQR A;  3VR6 A;  1CKO A;  2D62 A;  1Y1V G;  1O78 A;  1XPR A;  2WKD A;  2BE5 D;  2IPK D;  3STB C;  1CFM A;  3UI2 A;  5GAE C;  3T53 B;  4HJ7 A;  1V9P A;  2R92 B;  5J39 A;  4P71 A;  1PFB A;  1ZEQ X;  4LF4 Q;  3F2C A;  3MC0 B;  1EYA A;  2O4X A;  1JWU D;  4A3K B;  4TSS A;  2EYH A;  2F0V A;  2ZTD A;  2R7D A;  4GLV B;  1XMQ L;  1JC7 A;  1CK1 A;  4B3R Q;  4RHR A;  5CBA E;  1AFP A;  4ZUJ A;  3ND9 A;  3J81 L;  3BJU A;  3HG9 A;  2L11 A;  5IYB G;  2AWN A;  4JYA L;  1D5Z C;  1IW7 D;  1PTO B;  2Q8R E;  1HZ9 A;  4IUV A;  1VQJ A;  3TP6 A;  4DR5 L;  1I4R A;  1K8G A;  1C8C A;  3Q0A A;  3BG3 A;  1JE5 A;  5T1I A;  1VQH A;  3K5M A;  3CMA A;  2Z6B A;  5KYI A;  2UU9 L;  3LGJ A;  3PF4 A;  4A3G B;  1JOQ A;  3S1R H;  3X3N A;  4JI7 Q;  2WP8 J;  5K5P A;  4OEL B;  2UXD Q;  3CRK C;  1LTT D;  3TEH B;  4K6L A;  3SHL A;  3PUY A;  3ERS X;  1F9P A;  1HCZ A;  5FO8 B;  2NVX H;  4EVO A;  1PFN A;  4LJZ C;  1RTO A;  2K32 A;  1EWC A;  2NZO A;  1CZW A;  3FKI B;  2EPB A;  2EVB A;  4C3H B;  4GLX A;  4DNT B;  2R92 G;  3KOJ A;  1G91 A;  2K28 A;  3DXJ C;  5D3D A;  5LL6 X;  1X54 A;  3UE1 A;  3OW7 A;  3K6O A;  2QF7 A;  2Z6K C;  2MQH A;  1HZB A;  4PV1 C;  2HHH L;  5M3F B;  3RZO B;  5CV7 A;  1NY4 A;  1K8O A;  2K75 A;  4JI1 L;  4DV2 Q;  2RHQ B;  3M4P A;  1GXD C;  5C5L A;  5EBC A;  3U4Z A;  4K0K L;  3Q23 A;  4GKJ L;  3NPP A;  3T16 A;  2VY3 A;  1HHV A;  1Q90 A;  4RCO A;  2RF4 A;  3H0G H;  3K80 C;  4DNR B;  4XQJ A;  2Q2U A;  2F0D A;  5IY0 A;  4BBS H;  1TT2 A;  5A2Q E;  4KKU A;  2WB1 E;  1K73 C;  3U50 C;  5KYL A;  2NBF A;  4YY3 Q;  1JCK B;  2I5L X;  4GN4 B;  4Y7N H;  3CCE A;  3D4R A;  1FNV A;  3GD7 A;  4K0K Q;  4Q5V A;  3NXW A;  4A3C H;  1I5F A;  2PZT A;  5IGG A;  2CQO A;  1A3U A;  1A6X A;  2NVT H;  2H1E A;  5BN5 A;  1EIG A;  3H0G G;  4C3J B;  1Y8N B;  1ZXT A;  1JE4 A;  1WTH A;  4AQY Q;  5EPK A;  4HIK A;  3S17 H;  4BWG B;  3S14 H;  3GTG B;  1MKH A;  3FVQ A;  2K05 A;  1YIJ A;  1DON A;  3QO2 A;  4C3H G;  3TRZ A;  4DV6 Q;  4ZUI A;  4NXN Q;  3R3O A;  1BBW A;  5IT9 E;  1JWS D;  3MWY W;  4EQ5 A;  4DXF A;  5C0X J;  4JVZ A;  4LW1 A;  3PIO A;  4LF4 L;  4DR4 L;  5KND A;  2I0Q A;  2ICE C;  4NPS A;  2HUG A;  1PYB A;  4LF6 Q;  2QDL A;  2KEE A;  2R6G A;  1SRO A;  4IUT A;  2A69 D;  1AZP A;  4DV7 L;  4XT1 B;  1SLJ A;  4YHH Q;  3MHB A;  5J1Z A;  1H95 A;  2RA4 A;  5HGQ A;  1U4L A;  3A5U A;  4JI6 Q;  1KDB A;  2A5H A;  1STN A;  4RGO S;  5C4H A;  3U9S A;  1YNN D;  3WOF A;  1FD7 D;  2Z8L A;  1C7Y A;  4YWM A;  2UUA Q;  1KNE A;  3T1Y Q;  4JI5 L;  1ESF A;  3ITP A;  4ZAI A;  2YYZ A;  1HA6 A;  5IP7 H;  4PG3 A;  2KEC A;  3MXN B;  4A3K H;  4B9X A;  3HKZ G;  4XQQ A;  2O5I C;  1S5D D;  4C2M H;  4C3J G;  4B3S L;  3CPF A;  3D6C A;  1SYE A;  1YVC A;  1SYC A;  2VS1 A;  2WAC A;  4O42 A;  3F2U A;  3RNU A;  3F2D A;  1MBY A;  2KED A;  2XVS A;  2JA8 H;  3FKI H;  1ESR A;  4A3M G;  4FDB A;  1SN8 A;  4RA8 A;  1LV9 A;  2AMC B;  4L6T B;  3A8J E;  1CSQ A;  3QB3 A;  3BDL A;  3V2T A;  4JI3 L;  3HOX H;  1EZ6 A;  4NXN L;  3RN2 A;  4UP9 A;  1IW7 C;  1VQ5 A;  3NSW A;  1QUQ A;  1QOH A;  2LY7 A;  3QWN A;  2F0U A;  2YTX A;  2NB0 A;  1HUM A;  1L1O B;  1I4G A;  4IZ8 A;  1IHZ A;  5K36 G;  1UWV A;  3TZU A;  5M3M G;  3M4O H;  1UEB A;  4RGM A;  2Z4I A;  1QVC A;  2TMP A;  1EFW A;  1S5E D;  4FXG C;  4B08 A;  4Z9C B;  1CHP D;  1LTR D;  2BDO A;  1IBL Q;  2EIF A;  3MFG A;  3PO2 B;  3E0J A;  1BOS A;  1T9H A;  2R3Z A;  4A76 A;  1NMG A;  3EQL C;  4KHZ A;  1PA6 A;  4KN7 C;  1ET6 A;  4RCN A;  2FJ2 A;  3D8G A;  2F1M A;  3CQZ B;  1R9T B;  2G5D A;  5H1S E;  2Y0S E;  3DUZ A;  1I4H A;  3VR4 A;  3AB9 A;  2C5C A;  1EQQ A;  1BDO A;  4P74 A;  3J80 i;  4HJ8 A;  3KF6 A;  4LF9 L;  1NJI C;  1PFM A;  4F87 A;  4A3E H;  3C1F A;  1EYC A;  5D65 A;  4FF3 A;  3PUX A;  1F9S A;  2GN5 A;  1PTO F;  3HKZ E;  1HZC A;  3WOE A;  1YJW A;  4A3J G;  5M3M H;  3QG1 A;  3J7A F;  1HQR D;  5E4X A;  5G3L D;  1PH8 A;  5C0X I;  3R2T A;  5IP9 H;  4BA1 I;  4K2L A;  1ET9 A;  2IX3 A;  2WFW A;  3NK9 A;  2PNR C;  5ELB A;  2A74 C;  2XIW A;  1RIP A;  2Z9H A;  4GLA C;  1N33 L;  1LT5 D;  3CCS A;  5M5X B;  4BY1 B;  4WOR A;  3A8K E;  1I4P A;  4QMG A;  1LYL A;  1IBM Q;  1RDP D;  2EXZ A;  1WJJ A;  1TY0 A;  4JV5 Q;  4FXK C;  2F0S A;  2Y0S B;  1V1P A;  4DV1 Q;  1SFO H;  1B9N A;  5IGD A;  1XPU A;  2X6G A;  3I72 A;  4KLK A;  3I4O A;  2EQS A;  2FHT A;  1PTO C;  2F0F A;  3GTQ H;  5C3E B;  3R8B A;  3I4M B;  4DV0 L;  1WOC A;  1DCZ A;  4RGN A;  4A4I A;  1VQ8 A;  4AIM A;  1BCP B;  1YHB A;  1HZA A;  4DR1 L;  2L0C A;  2MO0 A;  4RHS A;  3S2D B;  3M3Y B;  4QGU A;  2PPB C;  5DLQ E;  1V8Q A;  4OO1 H;  2AQ2 B;  3CW2 C;  4R4Q A;  3CCM A;  3ZJY C;  4KHP Q;  2NVY B;  1T5E A;  1VQG A;  4JI8 Q;  2L9H A;  4XT3 B;  1SYG A;  3D3R A;  3RN5 A;  3NWT A;  1XMO L;  3OPO A;  1PMR A;  4RKB A;  3SK6 A;  3HOW H;  1XTD A;  3CD6 A;  1UUP A;  4HAE A;  4RFB A;  5I9O A;  1EZ8 A;  3VR2 A;  4O0A A;  2MNA A;  4DV5 L;  3IKJ A;  1XMQ Q;  4PZ6 A;  1EUJ A;  1HNW Q;  4DV4 Q;  1I6H B;  4OO1 I;  2OT2 A;  4F7X A;  5LMN Q;  2WB1 G;  5JJK A;  3NHH A;  1Y69 U;  2UUC Q;  1Z9F A;  1N36 L;  4YIJ A;  5EAY A;  1AEX A;  2K50 A;  4BY1 G;  3KLR A;  4H02 A;  3FP9 A;  2A1A A;  1PZJ D;  4NXM Q;  1C9O A;  2N3S A;  2ID0 A;  2K03 A;  5DNF A;  1KRS A;  2D9U A;  3MXG A;  2VUM H;  2UXC L;  2Y0S G;  4A3G H;  1B50 A;  2L55 A;  3HOU B;  2PW5 A;  5JVG 3;  4A3E G;  1SE3 A;  2NZH A;  1D6E C;  1FGU A;  4QF4 A;  4PMB A;  3J81 c;  3NP8 A;  2G9D A;  1TR5 A;  2IJ0 A;  5M5W H;  1H9R A;  5JEA H;  4WJW A;  2EY1 A;  3I4L A;  1WTX A;  1B8A A;  2XNA C;  1WYD A;  4ILW A;  1T5X D;  4IUQ A;  2F0J A;  1CM9 A;  1ILQ A;  4RG1 A;  2OF1 A;  1Y1W G;  1K0R A;  2B39 A;  4X62 Q;  3X3M A;  3TP8 A;  1VQC A;  4JI2 Q;  3A55 A;  1E22 A;  4DR1 Q;  1G29 1;  2JA6 B;  2C9O A;  1G2S A;  1EU4 A;  2KJX A;  3Q22 A;  1QUQ B;  1A3T A;  2HHH Q;  3ND8 A;  1CT1 D;  2K5D A;  1W6J A;  3PO3 B;  1NSN S;  2L12 A;  2PI2 E;  1O7L A;  2AWO A;  2EJG C;  1J8I A;  2GVA A;  4N9T A;  4PMC A;  2XRS D;  1Q3L A;  3H09 A;  1JB7 A;  1OXU A;  1WD0 A;  5EKL A;  2CFM A;  3NEM A;  1VQP A;  2EZV A;  4O2D A;  4GZY C;  3DWQ A;  3K5O A;  4ME5 A;  3BYY B;  4HIO A;  4QL5 A;  4R8N A;  1N36 Q;  2E2H B;  2VQE Q;  5I4D A;  1EQT A;  3CF5 A;  1F2L A;  2QCP X;  3FPP A;  2WIN B;  3DM3 A;  3CPW A;  3BYT B;  3SVM A;  3HOU G;  2B2T C;  3S2H B;  1GM5 A;  1I3Q H;  4DK1 A;  4DA2 A;  5T1G A;  2CCZ A;  3SK5 A;  1EY0 A;  2HIX A;  3NEL A;  5BR8 Q;  3FPU B;  1L1O C;  4A3K G;  2VNU D;  1UE7 A;  2L15 A;  3BVM A;  3JAM c;  4FF2 A;  1PH9 A;  2QGQ A;  4C1N I;  1B3Q A;  1NE3 A;  5GAG C;  1A62 A;  5M3F G;  1I94 Q;  1SYB A;  3K7U C;  1PLF A;  3SE0 A;  3MEH A;  1EIH A;  2SNM A;  1XNR Q;  4M1U B;  5CBE E;  2Z6K A;  4K5V A;  3W5O A;  1KHI A;  1IBL L;  5E3F A;  2SDF A;  5D3I B;  2E5L L;  1VCI A;  1YI2 A;  4Y7N B;  3TP7 A;  4GOP A;  3GTK H;  1UNS A;  4V19 0;  2HT1 A;  2EY6 A;  1DXM A;  1IZ6 A;  1GVP A;  5NUC A;  1B7Y B;  1A63 A;  5IWA Q;  4AYB G;  5EBD A;  2R93 B;  2E5L Q;  1E2Z A;  2JQO A;  1GUW A;  2Q8I B;  2MUY A;  3AEV A;  1IXR A;  1X32 A;  1JOO A;  3Q24 A;  2DNE A;  1EWI A;  4IO9 A;  1PTO H;  3J81 i;  4HED A;  2HIV A;  4BBR H;  1L1O A;  2Q8T A;  2BA0 A;  2M00 A;  4ZLT F;  2OQK A;  3CC4 A;  4KI0 A;  1VQI A;  1X56 A;  2N49 A;  1AH9 A;  1Y1W H;  1GKH A;  3FDT A;  4JI3 Q;  1HNW L;  4C2M B;  1EY5 A;  3DEP A;  3CCJ A;  3RZD H;  4GN3 B;  1C0A A;  2HCC A;  2TSS A;  4M8A A;  4MIU A;  3K7A B;  2BCO A;  2B2W C;  1QE6 A;  3HOU H;  1SSO A;  4HTH A;  1ZYR C;  4OHJ A;  4KMU C;  2EE1 A;  4DUY Q;  1A15 A;  2F0M A;  3K57 A;  1MGS A;  4NMZ A;  1EY7 A;  5M5W B;  1BO0 A;  3I70 A;  2IHE A;  1D1K A;  5JJZ A;  1D2B A;  3A5Z B;  5JOB A;  1IYJ B;  3HOX B;  5E7N A;  2A6H D;  1GUS A;  2F0L A;  1WTP A;  3PO3 H;  4A3M H;  4DFA A;  1NR4 A;  4CJ1 B;  4TKO B;  3T56 B;  4EQP A;  3H91 A;  1X3P A;  2N55 A;  2B63 H;  2PMZ E;  2ZXP A;  2ZXO A;  4K14 A;  5J3B A;  3CC2 A;  1N34 Q;  3CHB D;  2EJF C;  3T51 B;  1PH6 A;  1JT8 A;  1F9R A;  1PH5 A;  2C35 B;  5LMU L;  4R4I A;  4DGZ A;  1UAP A;  5M9O A;  3HKZ B;  5F2D A;  3S24 A;  2JP1 A;  2WAQ B;  4A3L H;  4CKB A;  5M5Y H;  3IRB A;  4JYA Q;  3OSO A;  2IX0 A;  1STE A;  2AQ3 B;  3SXH A;  2UXB L;  2JA7 H;  1S3O A;  1FYC A;  4KY6 A;  4L5T A;  4OO1 G;  2F0N A;  4V0B A;  3S16 H;  3TBI B;  3HP3 A;  3C1E A;  3GTQ B;  1K83 H;  3TRE A;  2VQF L;  1U4M A;  1E2V A;  3SK4 A;  2JEB I;  1RTN A;  4POF A;  2OEO A;  4QY7 A;  5DM7 3;  4GOP C;  3C2P A;  4JBW A;  5A2Q L;  1W2B A;  2JA7 B;  2BA1 A;  4H7B A;  1VS0 A;  3CU7 A;  4R4C A;  4LWC A;  4OWX B;  2F03 A;  2K7V A;  1FJG Q;  1S4Z A;  5HUR A;  1YBY A;  1SEB D;  3CP0 A;  3PO2 G;  4FO2 A;  4G7O C;  2F0K A;  2CVR A;  3G71 A;  4YHH L;  4A3I H;  1G6Z A;  1X3Q A;  2OQ0 A;  2HQL A;  4J6H A;  1SFO B;  4PZ7 A;  3S2D H;  4ZKB B;  4X66 L;  4OGQ C;  3VYR A;  3EVQ A;  3GO5 A;  2NVY H;  3N6R A;  1S5B D;  2RKS A;  5FLM G;  1PVO A;  4NKL A;  4Y52 H;  1O7Y A;  1HR0 W;  3F1Z A;  1E24 A;  4A3J H;  3NTK A;  1KLG D;  3PMF A;  2KA7 A;  3GTO B;  2WKC A;  1H9S A;  4A3I B;  3S1N H;  1MHW C;  1GHK A;  5C44 B;  1HFN A;  5LMU Q;  2F0T A;  1GUO A;  2ZM6 Q;  4GKK Q;  4P75 A;  4KJN A;  4OIK A;  2M2L A;  1HTP A;  2VXW A;  4IPC A;  1JWM D;  1YEZ A;  4WFN 3;  2PNH A;  1VQ6 A;  3CRL C;  4DAP A;  4MTN A;  2E2J B;  1KAB A;  4DV3 Q;  5FKA C;  1GUT A;  3GTO H;  5JVH 3;  3MXU A;  2PQA B;  4ULL A;  1CSP A;  2F0W A;  2R93 H;  4GNX C;  4HMJ A;  4XIG S;  5KIX A;  4GOP B;  1VQN A;  2WAQ E;  1LO5 D;  3K7A H;  1ICW A;  1W6K A;  4P72 A;  5FOB B;  3LWU A;  1GOZ A;  4HCS A;  3FRP B;  3NQI A;  1NUC A;  1SE8 A;  1BBU A;  3H15 A;  1IBK Q;  4BY7 G;  1SAP A;  1S5C D;  2VW9 A;  4JI6 L;  5DAU A;  3K5L A;  1H9J A;  1BNZ A;  3KDF B;  4H13 C;  2DUD A;  1A8V A;  1GD7 A;  1HQM C;  1I94 L;  5LMN W;  1Y8O B;  4C3I B;  2YV5 A;  1LT6 D;  4JBJ A;  1PYW D;  2B2U C;  2CW0 D;  4DR2 Q;  1YIT A;  2ICI A;  4KKT A;  3KF6 B;  1KDC A;  1P8L A;  3KBG A;  4X3K A;  3H6M A;  3VYU A;  3I8Z A;  1SNM A;  3J7Z C;  4A3F B;  3KF8 B;  3VR5 A;  1D5M C;  1U4R A;  2A6E D;  1PTO D;  2NN6 G;  3W1B A;  1CQF A;  5JEA J;  4O1N A;  4R4T A;  1JIC A;  2NZ1 D;  1UE6 A;  2NYZ D;  3D4D A;  3MXP A;  1B44 D;  1TS2 A;  4DR2 L;  1B4O A;  1HR0 Q;  3NE5 B;  5IIF A;  4FXD A;  3KJO A;  3OIP A;  3TSS A;  1H9M A;  3U58 A;  4OX9 L;  1TWG H;  2AHO B;  2WB1 B;  3NUC A;  3UDG A;  4G7H C;  2E74 C;  1N34 L;  1LUZ A;  4CDD C;  2EYM A;  1BF4 A;  3TP5 A;  4X3T A;  1FL0 A;  4P73 A;  1XYI A;  1ENC A;  3HOY H;  3RD4 A;  1RL2 A;  3K58 A;  3ERO A;  4A3B B;  1EYG A;  4HIM A;  2UU9 Q;  2RDG A;  1LTG D;  2K01 A;  1KXL A;  4CBV A;  1EQV A;  5M5Y B;  3STB D;  2NTT A;  3I90 A;  1V1Q A;  2XWB B;  5COY A;  3GTJ B;  4GN5 A;  4ZYS A;  3J80 E;  4C1N K;  1SNC A;  1MSG A;  3M7G A;  4DK0 A;  2UXC Q;  4IN3 A;  2E2H H;  4JI7 L;  3GDE A;  3Q8D A;  2HDM A;  5IYC G;  2OXP A;  3GP7 A;  3H3V I;  1FNU A;  4C3I G;  4JCV E;  2R7Z H;  4NDX A;  3ER0 A;  3DHQ A;  1DGS A;  2E8G A;  4B9W A;  1WCM B;  1U9R A;  3WWV A;  1LTL A;  2I5M X;  2EY5 A;  5JEA G;  1B70 B;  2MO1 A;  1BQQ T;  4N9P A;  3T1H L;  4OL7 A;  1A2U A;  2KHJ A;  2CWP A;  1N9W A;  1RJT A;  1YJN A;  5JPM C;  1CI3 M;  4YY3 L;  4HR7 B;  3HOZ G;  3H3V C;  2JSO A;  4A3G G;  5IYD H;  4FNF A;  2QDB A;  2VUM G;  1IL8 A;  4CDF C;  2EY2 A;  1F2Z A;  5ELF A;  2I07 B;  4DU9 A;  5GAD C;  5E1F A;  2A6E C;  1D8L A;  1HUN A;  1TWF B;  1ASY A;  2GVB A;  1ENA A;  1OTC A;  3JAM L;  4JBK A;  2VZA A;  4IJH A;  4DN4 M;  1SBB B;  4IPD A;  1HRJ A;  2IW3 A;  3ERQ A;  2CW0 C;  1TWA B;  3OHX C;  1KAW A;  2M9V A;  3T1Y L;  3IFD A;  3I4N G;  5CR3 A;  4G7Z C;  3L2P A;  4QUF A;  2ASB A;  4ZKC B;  3I91 A;  3VA7 A;  1L2F A;  4LF8 Q;  2FIN B;  3ICE A;  3HZX A;  5LHY 1;  4F88 A;  1E3P A;  3MZ5 A;  5BR8 L;  2XTI A;  1A0I A;  4IFD I;  4S3S A;  3GTP B;  2KQ3 A;  1TXY A;  4PNY A;  3I56 A;  3K5N A;  4L63 B;  1X65 A;  1D1I A;  3W1G A;  2BH2 A;  1HA5 A;  3P20 A;  3BZK A;  1J5E Q;  3L0O A;  3PO3 G;  5DEH A;  5KRU A;  2F4V Q;  2EOT A;  3TS2 A;  1DJR D;  3S1R B;  3OYY A;  4I65 A;  3DM1 A;  4MN3 A;  5KNB A;  1GUN A;  3JC6 6;  5IGE A;  1SJE D;  5JPN C;  3A7L A;  1HPC A;  3A0J A;  1DOK A;  2JJQ A;  3HS0 C;  5BN4 A;  3KFU A;  3RLO A;  5C4X G;  2ZTC A;  3LNN A;  4DV4 L;  4IOC A;  3UDI A;  4JI0 Q;  1EIY B;  2XSC A;  4APV A;  4LF6 L;  2KHI A;  1D7Q A;  4CKE A;  3U9O A;  1B1Z A;  3H0G B;  1XXG A;  2EYP A;  3UE0 A;  4BBR G;  3ONA B;  1F2M A;  1STB A;  4HJ5 A;  1Y1V B;  1VQB A;  2RCF A;  1Z47 A;  2F0O A;  3QOJ A;  4TQU S;  3B6Y A;  1E2W A;  3I7F A;  3PCO B;  2CQA A;  1BUV T;  2SOB A;  3GTJ H;  4MTK A;  1Q81 C;  2K04 A;  2Q2T A;  2F3W A;  3AMU A;  1ASZ A;  2ZJP A;  3I4N B;  1IL2 A;  3EBE A;  2VB2 X;  4BBS B;  1PH1 A;  4AQY L;  1TS4 A;  4OWT B;  2Z4H A;  1KL9 A;  2RCN A;  1BVS A;  3OWF A;  3PUZ A;  3RLN A;  3PUV A;  3W2D A;  2BE5 C;  1KAA A;  4HSP A;  2EYJ A;  3MFY A;  1KIX A;  4UP8 A;  2RDF A;  1W3S A;  5ISR A;  3RR5 A;  1I4X A;  2IHF A;  3AFP A;  4EX5 A;  1QVG A;  4LAA A;  2ZJQ A;  4QIW E;  1F9Q A;  3OW2 A;  1FVI A;  4DR4 Q;  4DR3 L;  1AN8 A;  2RBM A;  5M3F H;  3NWS A;  1CTM A;  5E4W C;  2DNC A;  4DV7 Q;  5KNC A;  1QB5 D;  1VQF A;  4X6A H;  2K14 A;  2LS0 1;  2XN9 C;  4H0L C;  5C3E H;  2L5T A;  3OMC A;  1MI2 A;  5IP9 G;  1BKB A;  2F0P A;  2MP1 A;  3D4W A;  3E5S A;  3OWE B;  1BXT A;  4JI2 L;  2NVQ H;  1EY4 A;  2PO4 A;  4GNX B;  2E2J H;  1X55 A;  3J80 c;  2B2Y C;  4JI4 Q;  4BY7 H;  4IAL A;  5FJ8 H;  3FKI G;  5IT9 c;  3ULP A;  4FYD A;  2DGY A;  2UUC L;  3J80 L;  2VL6 A;  4I7A A;  3L7Z C;  1PFS A;  1XWE A;  4IFD H;  4KHP L;  5EPL A;  5C0X G;  2NVT B;  4E6I A;  1JJ2 A;  3E9H A;  3NBH B;  3IL8 A;  1MIU A;  1LTB D;  4GKK L;  1TS3 A;  4ALP A;  2AQ1 B;  5EKK A;  3CC7 A;  1S40 A;  2P5Z X;  4K2K A;  1MJC A;  4YCV A;  4EGV A;  2NVX B;  4NXM L;  1E1O A;  2IWH A;  1HXY D;  2QEJ C;  1I6H H;  4DNI A;  2VQE L;  1K3B C;  2KCN A;  1O80 A;  1VQE A;  5C4J B;  1RHP A;  1DYQ A;  4DKA C;  1PDQ A;  2Q2I A;  2O2L D;  3JAM i;  3FHW A;  5K36 H;  2NTS A;  1LM0 A;  2IY5 B;  2JA5 H;  1VDZ A;  2L4N A;  5FK9 C;  3F2B A;  1K0S A;  5C4X H;  4BXX G;  4LFB L;  3QR8 A;  1VQL A;  3M7N A;  4X62 L;  3CXC A;  4ZRZ A;  1EFI D;  4JK1 C;  5CV5 A;  3J81 j;  4CDE C;  3TQY A;  1CHQ D;  4DR3 Q;  5COR A;  5FLM H;  2UUB L;  2E2I B;  1J9O A;  1CKN A;  3HOZ H;  3UDX A;  1YNJ C;  4RAU C;  1HR0 L;  2EXD A;  2KCT A;  4A3I G;  3I4M H;  3HGB A;  3N52 A;  4JI4 L;  1IBK L;  4BS9 A;  2PZU A;  4A93 H;  3M85 A;  3GTM B;  3PO2 H;  4U68 A;  1ONL A;  4OEM B;  2QW7 A;  1DM0 B;  5FLX c;  1SXT A;  1MJE A;  1DZ1 A;  1MSH A;  2DJG C;  4IOA A;  4XXE A;  1VMP A;  4GS3 A;  1QZG A;  2ES2 A;  1LTA D;  4K8I A;  1U4P A;  1KLU D;  4RWS C;  1PH2 A;  4LF5 L;  4K5X A;  1WVL A;  3SDZ A;  3C46 A;  3UDF A;  3CME A;  3BDO A;  3I4N H;  3PSI A;  1PZK D;  2JA7 G;  3E9I A;  2F0Q A;  1XNQ Q;  1PH7 A;  2I5H A;  1TWG B;  1EOV A;  3SGI A;  5EGT A;  3M4O B;  2OWO A;  2EYO A;  3PIP A;  3KJP A;  1N33 Q;  3T13 A;  1AZQ A;  1H9S B;  3TN2 A;  1K8M A;  3RUZ A;  2N78 A;  1TU2 B;  4POG A;  1G51 A;  1SYD A;  4B3M L;  3HOV G;  1TWC B;  2YTY A;  2A73 B;  2Q2H A;  3AQQ A;  2YU9 H;  1IBM L;  3TME A;  1QNK A;  2Z0S A;  5I6Y A;  1JOK A;  4L5R C;  2LKV A;  4NP5 A;  3V96 A;  3J81 E;  4XDX A;  3DWP A;  3CQZ H;  2JYO A;  3W3A A;  3SEB A;  1R9T H;  5JJL A;  5KEE A;  2H5X A;  1Q8K A;  5HGT A;  1X3G A;  1VF5 C;  4UP7 A;  4R8I A;  1VQ7 A;  5FLX L;  3TS0 A;  4XQN A;  5C44 G;  3H3V H;  2B29 A;  3J7A 5;  1QZH A;  2A8V A;  4AYB E;  1AE2 A;  4HID A;  4B3T Q;  1HH2 P;  5J22 A;  1B9M A;  2K5W A;  1TVX A;  4ME3 A;  4DK6 C;  4UY8 C;  1M1K C;  3K0Y A;  4IUU A;  2D0O A;  3BDC A;  4YCW A;  3VDY A;  3T4A C;  1CQV A;  2D5D A;  2XRQ D;  4WJ3 M;  4X3U A;  4LF9 Q;  1VMC A;  2R61 A;  3AU7 A;  1DOL A;  4HJA A;  4WRD A;  3OTO Q;  1SE4 A;  3D6W A;  4EQO A;  2B8G A;  1YNJ D;  4UDU C;  2OTL A;  4FP5 D;  5D14 A;  5IWA L;  4IUN A;  1YJ9 A;  2KBN A;  1TII D;  1XPO A;  1Q82 C;  2BOS A;  1SR3 A;  1Q7Y C;  5M3M B;  1X3F A;  2N8N A;  1OXS C;  3G6E A;  5EJW A;  4JI1 Q;  4CJ0 B;  2F3I A;  1I4Q A;  1TWA H;  1JJC B;  2A6H C;  3S9W A;  5C4J H;  3CCV A;  4OX9 Q;  1EY8 A;  3S1N B;  3G6J B;  5TSS A;  3GTL B;  1DD2 A;  3CCL A;  1EIF A;  3U4V A;  1TWF H;  4BY7 B;  1BR9 A;  2KCC A;  4I7Z C;  3S14 B;  1QJO A;  1RF2 D;  3ZYY X;  1ZYR D;  2UUA L;  5M5X H;  3HOV B;  3KUP A;  3C3L A;  4DR7 L;  1JOR A;  3M9B A;  4TRD A;  2ENB A;  2ZXR A;  2MHV A;  1LTS D;  3DMU A;  2X6L A;  1SND A;  4N8X 1;  4YWK A;  2MJ8 A;  1WTW A;  1EOT A;  3M3Y H;  2JA6 G;  1ML0 D;  3Q6S A;  3VA5 A;  3IAY A;  4LUV A;  1UE1 A;  5JJI A;  4DUY L;  5ELE A;  1PXU A;  3E6Z X;  3EFX D;  4WJ4 A;  4N8F A;  2CKZ B;  3DEO A;  3RZD B;  4L5Q A;  1X6O A;  5IOD A;  4XTC S;  4K8J A;  2DN8 A;  4JOI A;  5CC4 A;  4HJ9 A;  4KD3 A;  1JR0 D;  2KOL A;  2WV6 D;  3QOL A;  2E2I H;  4KV6 A;  1Y1V H;  1QG7 A;  1A2T A;  4JI5 Q;  2G9H D;  4QJF A;  3MVV A;  1SNO A;  4F8M A;  2MGS A;  4AH6 A;  2YTV A;  3KBX A;  1C4Q A;  2HDL A;  1O7Z A;  5FJ8 G;  1R4P B;  2BH8 A;  1TWH H;  4R1J A;  4A3B G;  3I3C A;  4L8J A;  1BCP D;  3OIQ A;  3PIP 3;  1HFG A;  2HQE A;  5IOC A;  3AYH B;  1PRT B;  3OOC A;  5C3E G;  3BS1 A;  1Q8I A;  2ZM6 L;  2E76 C;  5IYB H;  4DUZ Q;  1WFQ A;  1ENF A;  4DR6 Q;  2B2U A;  2PI2 A;  1OXV A;  4A93 B;  1QCB D;  1OO9 B;  4K5W A;  3GTP H;  3R2I A;  3G7L A;  1V1O A;  1PRT F;  1R4Q B;  3J7A V;  3CAM A;  4IPG A;  4GKJ Q;  3DWA A;  1WCM G;  1LT3 D;  3E3X A;  1SNP A;  4R4O A;  1Y14 B;  4UPA A;  4KY7 A;  4DPG A;  4LF8 L;  3EN2 A;  4DV6 L;  1NTG A;  2PMZ B;  2K4K A;  4K6D A;  3BZC A;  1J6Q A;  2KVM A;  2IT1 A;  4RH6 A;  5FLX E;  3I55 A;  3HOZ B;  4MHE A;  4A3D G;  5FO9 B;  1G6P A;  1VQM A;  1K28 A;  4CKC A;  2UXD L;  2VUM B;  2KEN A;  1I50 H;  4JI0 L;  4HCE A;  1VQD A;  2JE6 I;  3TZD A;  4J8Q A;  1G2T A;  2F3V A;  1JB3 A;  3IFT A;  5CV9 A;  1F2Y A;  5CYU A;  3DLL A;  1PRT C;  3MXN A;  1ROD A;  1CKN B;  4R9W A;  3GTK B;  2EYF A;  3R93 A;  1SJH D;  4P2C B;  1RD9 D;  1I3Q B;  2AUK A;  1EEI D;  1G8Z D;  3KK7 A;  2PYK A;  1U0L A;  4J15 A;  5IYD G;  1WTR A;  3O13 A;  4NW2 A;  4A3E B;  3KYH C;  4DV5 Q;  4QIW B;  3JAM E;  3NTH A;  4B3R L;  4IQZ A;  4XYQ A;  4ZK9 B;  4BY1 H;  1SYF A;  1S5F D;  2WII B;  1STG A;  3K81 C;  1BCP F;  2LXJ A;  5FO7 B;  4BBS G;  1Z7T A;  2ALY B;  2XWJ B;  3K8A A;  1GUG A;  4OXP A;  4DV2 L;  1M8A A;  1NBW A;  2OCE A;  1TWC H;  4B3S Q;  3D31 A;  4X64 L;  4A75 A;  4DUZ L;  1Y1W B;  3NBI A;  4OWW B;  1VQ9 A;  1Q1E A;  2SNS A;  1GO3 E;  3ULL A;  1A3V A;  2SEB D;  3G4S A;  3L3O C;  1FJG L;  2F0I A;  1K3R A;  3CCR A;  1GJX A;  1TQO A;  3GTG H;  2B2V C;  1HNZ L;  1O7I A;  2JN4 A;  1GHJ A;  1S72 A;  3EIV A;  1EL0 A;  4PMW A;  4A3D H;  3A7A B;  2DY7 A;  2RDH A;  4LNQ A;  3NQT A;  4X65 Q;  1KTK A;  1LTI D;  1YZ6 A;  3GTL H;  5I6W A;  2MFI A;  3MTS A;  4HMI A;  4KD4 A;  3KLW A;  4LFA L;  5LL6 S;  1VQK A;  1ZKO A;  5C4X B;  4ID6 A;  2R92 H;  1WTO A;  3P1H A;  2B63 G;  4JV5 L;  3HEJ A;  3S2H H;  5ELD A;  4OIJ A;  1JQY D;  4BBR B;  3LWE A;  4CGY B;  3GTM H;  5C5M A;  2WAQ G;  5IT9 L;  4KHV A;  4RGT A;  2KHS A;  3L9A X;  1EEF D;  1P16 A;  2D2C C;  2RVL A;  2K5H A;  5GRO A;  3T1H Q;  5I2Y A;  1PH4 A;  2B8F A;  2KUM A;  1V43 A;  4ABN A;  2NUC A;  4B3T L;  1YHQ A;  1PH3 A;  5I9P A;  3HRZ C;  1STH A;  2K33 A;  2F0G A;  1NR2 A;  4IUP A;  4QUC A;  3OTO L;  5C6A A;  1OXT A;  2ATW A;  4C56 C;  1E1T A;  4RMF A;  1WTV A;  3S1M B;  5IGF A;  3S15 B;  5C4Z A;  1HJP A;  4HN7 A;  1PHJ A;  1IKL A;  2RQX A;  5IYC H;  1UE5 A;  1PZI D;  3WDN A;  5HY6 A;  5BN3 A;  2JA8 B;  1V1P B;  3MEF A;  4JC0 A;  2J7Z A;  1AW7 A;  3M4Q A;  2VB3 X;  3VR3 A;  1I6V C;  1VF7 A;  4QQB X;  5LMN L;  3OMG A;  4DR5 Q;  5ELC A;  4FF1 A;  1IKM A;  4DV3 L;  3A8I E;  2CH4 A;  3I73 A;  4LUO A;  3HFZ B;  1U5K A;  2EDG A;  3CKI B;  1N8R C;  1SNQ A;  4LK1 C;  2K5V A;  4DAY B;  4IFD J;  2HCI A;  3AFQ A;  3LX0 A;  2NN6 I;  2EYL A;  1NMF A;  1II3 A;  4AYB B;  2JEA I;  2F0H A;  2GA4 B;  5CV8 A;  2B63 B;  4DV1 L;  4ODG A;  2BDN A;  2R93 G;  2DJF C;  4BA2 I;  2A19 A;  1FNW A;  4KK7 A;  5IGB A;  3K59 A;  4DAV A;  2PCF B;  1ILP A;  5EPJ A;  1J5E L;  2A68 C;  1TWH B;  2R7F A;  1XNR L;  2JA6 H;  2RHS B;  1K9M C;  4IUR A;  3SK8 A;  3RZO H;  3VYT A;  3F8T A;  1PRT D;  5IE8 A;  2QEX A;  2QKI C;  2O5J C;  1EYD A;  2J4X A;  1QWY A;  2JA9 A;  3D0F A;  3PUW A;  2K1B A;  1OXX K;  1XJV A;  2UUB Q;  5EKI A;  1EY9 A;  2EJM A;  2F4I A;  3RMH A;  3BVG A;  4JI8 L;  4DAY A;  2XGT A;  2FMM A;  3PQI A;  4JPB W;  3S16 B;  3HKS A;  1N32 Q;  4EQN A;  1HNX Q;  3QIA A;  4A3F H;  3SR1 A;  2OTJ A;  2NN6 H;  1L0W A;  3MAQ A;  1Q86 C;  1HNZ Q;  3CCQ A;  3NEN A;  4DF7 A;  3J7Y W;  2JA8 G;  3HOX G;  1HTL D;  1SMX A;  2V1C C;  1TY2 A;  3BU2 A;  4CHT B;  4B3M Q;  3KDF A;  2VQF Q;  1UEA B;  4X65 L;  5C44 H; 
#chains in the Genus database with same CATH homology
 1BCP C;  2F0E A;  5G3L F;  1KNA A;  2PW7 A;  1H9K A;  4H44 C;  1QNU A;  2JXM B;  1BBX C;  4FF4 A;  5IGC A;  5DM6 3;  2FFK B;  1CZG A;  4DXG A;  2B2T A;  1WD1 A;  3S1Q B;  3PV0 A;  5KGU A;  2IL8 A;  1FR3 A;  4A3M B;  4A3J B;  1AP0 A;  2CHB D;  1L0Y B;  3GV3 A;  2AUJ D;  2E75 C;  3FEW X;  3EJI A;  5AFW A;  4X3S A;  2JA5 B;  1B2T A;  3H94 A;  2B2V A;  4LMQ D;  4QB4 A;  2QIL A;  1SE2 A;  1MD2 D;  3A56 A;  1YNN C;  2RSO A;  3VYS A;  1EY6 A;  2FMC A;  2A69 C;  5CV4 A;  1CA6 A;  4KKS A;  3TDQ A;  1Q12 A;  2MPM A;  4G57 A;  1DOM A;  5CV6 A;  5CGK A;  3M4Y A;  1TS5 A;  4QCL A;  2N88 A;  3A54 A;  3QJY A;  3BVZ A;  4HSV A;  3NTI A;  2I46 A;  1FGB D;  3KLS A;  4CJ2 C;  1B3A A;  3BZD B;  3URY A;  2K6A A;  4J1M A;  1IYV A;  1EWH A;  3RLF A;  1WTQ A;  1C48 A;  2YU9 B;  1F77 A;  3GQB A;  3PIO 3;  1L0X B;  3KF8 A;  1QIL A;  5C3X A;  1STA A;  1SMY C;  3P7J A;  5CMD A;  1TKW B;  3NBH A;  4G4K A;  4UAI A;  4PQX A;  2LMC B;  3FMC A;  4KTA A;  2J0T D;  1Q1B A;  2V4D A;  4Q0F A;  1E0B A;  1LAB A;  1K83 B;  2B2Y A;  2R7Z B;  2E2D C;  1SDF A;  4RKL A;  2X69 A;  5C0X H;  4KN4 C;  2PQE A;  4KJO A;  4IFD G;  1XX8 A;  2Z1C A;  1RCV D;  5I2X A;  2NVQ B;  5A35 A;  2IX1 A;  2LFN A;  3S17 B;  5JAV A;  1SMY D;  2DY8 A;  3EA6 A;  4U67 3;  4ZQ3 A;  3V05 A;  1EU3 A;  2B2W A;  1D5X C;  1LAC A;  1XTC D;  2H4O A;  2RSN A;  5EQ0 A;  3HOW B;  1I50 B;  3KLS X;  2A68 D;  4A3D B;  3GV6 A;  4FVM A;  3HOY B;  2ZT9 C;  1NCV A;  5C3W A;  2PZW A;  3MA2 B;  1Z6H A;  1LLR D;  2L1B A;  1B53 A;  1IYU A;  4KY5 A;  1RKN A;  2NWG A;  1STY A;  2K5Q A;  1Y8P B;  1KDA A;  1NAP A;  3P75 A;  1M4V A;  1CA5 A;  1LT4 D;  4XYO A;  3VR6 A;  2D62 A;  1O78 A;  2WKD A;  2BE5 D;  2IPK D;  1CFM A;  3UI2 A;  3T53 B;  2R92 B;  5J39 A;  1PFB A;  1ZEQ X;  3MC0 B;  1EYA A;  2O4X A;  1JWU D;  4A3K B;  4TSS A;  2EYH A;  2F0V A;  1JC7 A;  1CK1 A;  4RHR A;  5CBA E;  1AFP A;  4ZUJ A;  3ND9 A;  3J81 L;  3HG9 A;  2L11 A;  2AWN A;  1D5Z C;  1IW7 D;  1PTO B;  2Q8R E;  4IUV A;  3TP6 A;  1I4R A;  1C8C A;  3Q0A A;  3BG3 A;  5T1I A;  3K5M A;  5KYI A;  4A3G B;  1JOQ A;  3X3N A;  2WP8 J;  5K5P A;  3CRK C;  1LTT D;  4K6L A;  3SHL A;  3PUY A;  1F9P A;  1HCZ A;  5FO8 B;  4EVO A;  1PFN A;  4LJZ C;  1RTO A;  2K32 A;  1EWC A;  1CZW A;  3FKI B;  2EPB A;  2EVB A;  4C3H B;  4DNT B;  1G91 A;  2K28 A;  3DXJ C;  5D3D A;  5LL6 X;  3OW7 A;  3K6O A;  2QF7 A;  4PV1 C;  5M3F B;  3RZO B;  5CV7 A;  1K8O A;  1GXD C;  5C5L A;  5EBC A;  3Q23 A;  3NPP A;  3T16 A;  1HHV A;  1Q90 A;  4RCO A;  4DNR B;  4XQJ A;  2F0D A;  1TT2 A;  5A2Q E;  4KKU A;  5KYL A;  2NBF A;  1JCK B;  3D4R A;  1FNV A;  3GD7 A;  4Q5V A;  3NXW A;  2PZT A;  5IGG A;  1A3U A;  1A6X A;  2H1E A;  5BN5 A;  1EIG A;  4C3J B;  1Y8N B;  1ZXT A;  1JE4 A;  5EPK A;  4BWG B;  3GTG B;  3FVQ A;  2K05 A;  1DON A;  3QO2 A;  4C3H G;  4ZUI A;  3R3O A;  5IT9 E;  1JWS D;  3MWY W;  4DXF A;  5C0X J;  5KND A;  2ICE C;  2HUG A;  2KEE A;  2R6G A;  4IUT A;  2A69 D;  1AZP A;  4XT1 B;  3MHB A;  5J1Z A;  2RA4 A;  1U4L A;  1KDB A;  5C4H A;  1STN A;  2A5H A;  4RGO S;  3U9S A;  1YNN D;  3WOF A;  1FD7 D;  2Z8L A;  1KNE A;  1ESF A;  3ITP A;  4ZAI A;  2YYZ A;  1HA6 A;  2KEC A;  4B9X A;  4XQQ A;  2O5I C;  1S5D D;  4C3J G;  3D6C A;  1SYE A;  1SYC A;  2WAC A;  4O42 A;  3F2U A;  1MBY A;  2KED A;  2XVS A;  1ESR A;  4RA8 A;  1LV9 A;  4L6T B;  3A8J E;  3QB3 A;  3BDL A;  3V2T A;  1EZ6 A;  1IW7 C;  3NSW A;  1QOH A;  2LY7 A;  3QWN A;  2F0U A;  2NB0 A;  1HUM A;  1I4G A;  4IZ8 A;  1IHZ A;  5K36 G;  3TZU A;  4RGM A;  2Z4I A;  2TMP A;  1S5E D;  4FXG C;  4B08 A;  4Z9C B;  1CHP D;  1LTR D;  2BDO A;  3MFG A;  3PO2 B;  3E0J A;  1BOS A;  2R3Z A;  3EQL C;  4KHZ A;  4KN7 C;  1ET6 A;  4RCN A;  2FJ2 A;  3D8G A;  2F1M A;  3CQZ B;  1R9T B;  3DUZ A;  1I4H A;  3VR4 A;  3AB9 A;  2C5C A;  1BDO A;  1PFM A;  4F87 A;  3C1F A;  1EYC A;  5D65 A;  4FF3 A;  3PUX A;  1F9S A;  1PTO F;  3WOE A;  3QG1 A;  3J7A F;  1HQR D;  5E4X A;  5G3L D;  5C0X I;  3R2T A;  4BA1 I;  4K2L A;  1ET9 A;  2IX3 A;  3NK9 A;  2PNR C;  5ELB A;  2A74 C;  2XIW A;  1LT5 D;  5M5X B;  4BY1 B;  4WOR A;  3A8K E;  1I4P A;  4QMG A;  1RDP D;  2EXZ A;  1TY0 A;  4FXK C;  2F0S A;  2Y0S B;  1V1P A;  1B9N A;  5IGD A;  2X6G A;  3I72 A;  2FHT A;  1PTO C;  2F0F A;  5C3E B;  3R8B A;  3I4M B;  1DCZ A;  4RGN A;  1BCP B;  2L0C A;  3S2D B;  4RHS A;  3M3Y B;  2PPB C;  1V8Q A;  4OO1 H;  2AQ2 B;  2NVY B;  1T5E A;  2L9H A;  4XT3 B;  1SYG A;  3D3R A;  3NWT A;  3OPO A;  1PMR A;  4RKB A;  3SK6 A;  1UUP A;  4HAE A;  4RFB A;  5I9O A;  1EZ8 A;  3VR2 A;  3IKJ A;  1I6H B;  4OO1 I;  2OT2 A;  4F7X A;  3NHH A;  1Y69 U;  4YIJ A;  1AEX A;  3KLR A;  1PZJ D;  2ID0 A;  2K03 A;  5DNF A;  2D9U A;  3MXG A;  1B50 A;  2L55 A;  3HOU B;  2PW5 A;  5JVG 3;  1SE3 A;  4QF4 A;  1D6E C;  4PMB A;  3NP8 A;  2G9D A;  1TR5 A;  2IJ0 A;  1H9R A;  5JEA H;  4WJW A;  2EY1 A;  3I4L A;  1WTX A;  2XNA C;  4ILW A;  1T5X D;  4IUQ A;  2F0J A;  1CM9 A;  1ILQ A;  2OF1 A;  2B39 A;  3X3M A;  3TP8 A;  3A55 A;  2JA6 B;  1G29 1;  2C9O A;  1G2S A;  1EU4 A;  2KJX A;  3Q22 A;  1A3T A;  3ND8 A;  1CT1 D;  2K5D A;  1W6J A;  3PO3 B;  1NSN S;  2L12 A;  1O7L A;  2AWO A;  2EJG C;  1J8I A;  4N9T A;  4PMC A;  2XRS D;  1Q3L A;  3H09 A;  1OXU A;  1WD0 A;  5EKL A;  2EZV A;  4GZY C;  3DWQ A;  3K5O A;  4ME5 A;  3BYY B;  4R8N A;  2E2H B;  5I4D A;  1EQT A;  1F2L A;  2QCP X;  3FPP A;  2WIN B;  3BYT B;  3SVM A;  2B2T C;  3S2H B;  4DK1 A;  4DA2 A;  5T1G A;  3SK5 A;  1EY0 A;  3FPU B;  2VNU D;  3BVM A;  4FF2 A;  4C1N I;  1SYB A;  1PLF A;  3SE0 A;  3MEH A;  1EIH A;  2SNM A;  4M1U B;  5CBE E;  4K5V A;  5E3F A;  2SDF A;  5D3I B;  1VCI A;  4Y7N B;  3TP7 A;  1UNS A;  4V19 0;  2EY6 A;  1DXM A;  5NUC A;  5EBD A;  2R93 B;  1E2Z A;  1GUW A;  2Q8I B;  2MUY A;  1X32 A;  1JOO A;  3Q24 A;  2DNE A;  1PTO H;  4HED A;  2Q8T A;  2BA0 A;  2M00 A;  4ZLT F;  4KI0 A;  3FDT A;  4C2M B;  1EY5 A;  3DEP A;  2HCC A;  2TSS A;  4M8A A;  4MIU A;  3K7A B;  2BCO A;  2B2W C;  1QE6 A;  1SSO A;  4HTH A;  1ZYR C;  4OHJ A;  4KMU C;  2EE1 A;  1A15 A;  2F0M A;  3K57 A;  1MGS A;  4NMZ A;  5M5W B;  1EY7 A;  1BO0 A;  3I70 A;  1D1K A;  5JJZ A;  1D2B A;  5JOB A;  3HOX B;  2A6H D;  1GUS A;  2F0L A;  1WTP A;  4DFA A;  1NR4 A;  4CJ1 B;  4TKO B;  3T56 B;  4EQP A;  3H91 A;  1X3P A;  2N55 A;  2ZXP A;  2ZXO A;  4K14 A;  3CHB D;  2EJF C;  3T51 B;  1F9R A;  4DGZ A;  1UAP A;  5M9O A;  3HKZ B;  5F2D A;  2JP1 A;  2WAQ B;  4CKB A;  3OSO A;  2IX0 A;  1STE A;  2AQ3 B;  3SXH A;  1FYC A;  4KY6 A;  4OO1 G;  2F0N A;  4V0B A;  3TBI B;  3HP3 A;  3C1E A;  3GTQ B;  1U4M A;  1E2V A;  3SK4 A;  2JEB I;  1RTN A;  2OEO A;  5DM7 3;  3C2P A;  4JBW A;  5A2Q L;  2JA7 B;  2BA1 A;  4H7B A;  3CU7 A;  2F03 A;  2K7V A;  1S4Z A;  5HUR A;  1SEB D;  4FO2 A;  4G7O C;  2F0K A;  2CVR A;  1G6Z A;  1X3Q A;  4J6H A;  1SFO B;  4ZKB B;  4OGQ C;  3VYR A;  3EVQ A;  3GO5 A;  3N6R A;  1S5B D;  2RKS A;  4NKL A;  1O7Y A;  3NTK A;  1KLG D;  3PMF A;  2KA7 A;  3GTO B;  2WKC A;  1H9S A;  4A3I B;  1GHK A;  5C44 B;  1HFN A;  2F0T A;  1GUO A;  4KJN A;  4OIK A;  2M2L A;  1HTP A;  2VXW A;  1JWM D;  4WFN 3;  3CRL C;  4DAP A;  2E2J B;  1KAB A;  5FKA C;  1GUT A;  5JVH 3;  3MXU A;  4ULL A;  2F0W A;  4HMJ A;  4XIG S;  5KIX A;  1LO5 D;  1ICW A;  1W6K A;  5FOB B;  3LWU A;  1GOZ A;  4HCS A;  3FRP B;  3NQI A;  1NUC A;  1SAP A;  1S5C D;  5DAU A;  3K5L A;  1H9J A;  1BNZ A;  4H13 C;  1HQM C;  1Y8O B;  4C3I B;  1LT6 D;  1PYW D;  2B2U C;  2CW0 D;  2ICI A;  4KKT A;  1KDC A;  3VYU A;  3KBG A;  4X3K A;  3H6M A;  3I8Z A;  1SNM A;  4A3F B;  3VR5 A;  1D5M C;  1U4R A;  2A6E D;  1PTO D;  2NN6 G;  1CQF A;  5JEA J;  4O1N A;  1JIC A;  2NZ1 D;  2NYZ D;  3D4D A;  3MXP A;  1B44 D;  1TS2 A;  1B4O A;  3NE5 B;  5IIF A;  4FXD A;  3OIP A;  3TSS A;  1H9M A;  2WB1 B;  3NUC A;  4G7H C;  2E74 C;  2EYM A;  1BF4 A;  3TP5 A;  4X3T A;  1XYI A;  1ENC A;  3RD4 A;  3K58 A;  3ERO A;  4A3B B;  2RDG A;  1LTG D;  2K01 A;  4CBV A;  1EQV A;  5M5Y B;  2NTT A;  3I90 A;  2XWB B;  5COY A;  3GTJ B;  4ZYS A;  3J80 E;  4C1N K;  1SNC A;  1MSG A;  3M7G A;  4DK0 A;  4IN3 A;  2HDM A;  2OXP A;  3GP7 A;  1FNU A;  4C3I G;  4NDX A;  3DHQ A;  4B9W A;  1WCM B;  1U9R A;  2EY5 A;  5JEA G;  1BQQ T;  4N9P A;  4OL7 A;  1A2U A;  1RJT A;  5JPM C;  1CI3 M;  4HR7 B;  3H3V C;  2JSO A;  4FNF A;  2QDB A;  1IL8 A;  2EY2 A;  1F2Z A;  5ELF A;  2I07 B;  4DU9 A;  5E1F A;  2A6E C;  1HUN A;  1TWF B;  1ENA A;  3JAM L;  4DN4 M;  1SBB B;  1HRJ A;  2IW3 A;  3ERQ A;  2CW0 C;  1TWA B;  3OHX C;  2M9V A;  3IFD A;  5CR3 A;  4G7Z C;  4QUF A;  4ZKC B;  3I91 A;  3VA7 A;  2FIN B;  3HZX A;  5LHY 1;  4F88 A;  3MZ5 A;  4IFD I;  4S3S A;  3GTP B;  2KQ3 A;  4PNY A;  3K5N A;  4L63 B;  1D1I A;  1HA5 A;  3P20 A;  5DEH A;  5KRU A;  2EOT A;  1DJR D;  3S1R B;  4I65 A;  3DM1 A;  4MN3 A;  5KNB A;  1GUN A;  5IGE A;  1SJE D;  5JPN C;  3A7L A;  1HPC A;  1DOK A;  3HS0 C;  5BN4 A;  3LNN A;  2XSC A;  4CKE A;  3U9O A;  1B1Z A;  3H0G B;  1XXG A;  2EYP A;  3ONA B;  1F2M A;  1STB A;  1Y1V B;  1Z47 A;  2F0O A;  3QOJ A;  4TQU S;  1E2W A;  2CQA A;  1BUV T;  2SOB A;  2K04 A;  3AMU A;  2F3W A;  3I4N B;  2VB2 X;  4BBS B;  1TS4 A;  2Z4H A;  3OWF A;  3PUZ A;  3W2D A;  3PUV A;  2BE5 C;  1KAA A;  4HSP A;  2EYJ A;  3MFY A;  2RDF A;  5ISR A;  1I4X A;  4LAA A;  1F9Q A;  1AN8 A;  2RBM A;  3NWS A;  1CTM A;  5E4W C;  2DNC A;  5KNC A;  1QB5 D;  2XN9 C;  2LS0 1;  4H0L C;  2L5T A;  3OMC A;  1MI2 A;  2F0P A;  2MP1 A;  3D4W A;  3E5S A;  3OWE B;  1BXT A;  1EY4 A;  2PO4 A;  2B2Y C;  4IAL A;  4FYD A;  3J80 L;  3L7Z C;  1XWE A;  4IFD H;  5EPL A;  5C0X G;  2NVT B;  4E6I A;  3IL8 A;  1LTB D;  1TS3 A;  2AQ1 B;  5EKK A;  4K2K A;  4EGV A;  2NVX B;  2IWH A;  1HXY D;  2QEJ C;  2KCN A;  1O80 A;  5C4J B;  1RHP A;  1DYQ A;  1PDQ A;  2O2L D;  5K36 H;  2NTS A;  1VDZ A;  2L4N A;  5FK9 C;  3M7N A;  4ZRZ A;  1EFI D;  4JK1 C;  5CV5 A;  1CHQ D;  5COR A;  2E2I B;  1J9O A;  1YNJ C;  4RAU C;  3HGB A;  3N52 A;  4BS9 A;  2PZU A;  3M85 A;  3GTM B;  4U68 A;  1ONL A;  1DM0 B;  1SXT A;  1DZ1 A;  1MSH A;  4XXE A;  1VMP A;  1LTA D;  4K8I A;  1U4P A;  1KLU D;  4RWS C;  4K5X A;  1WVL A;  3SDZ A;  3C46 A;  3BDO A;  1PZK D;  2F0Q A;  1TWG B;  5EGT A;  3M4O B;  2EYO A;  3T13 A;  1AZQ A;  1H9S B;  3TN2 A;  1K8M A;  3RUZ A;  1TU2 B;  1SYD A;  1TWC B;  2A73 B;  3TME A;  1QNK A;  5I6Y A;  1JOK A;  2LKV A;  4NP5 A;  3V96 A;  3J81 E;  4XDX A;  3DWP A;  3W3A A;  2JYO A;  3SEB A;  5KEE A;  5HGT A;  1VF5 C;  4R8I A;  5FLX L;  4XQN A;  5J22 A;  1B9M A;  2K5W A;  1TVX A;  3K0Y A;  4IUU A;  3BDC A;  3T4A C;  1CQV A;  2D5D A;  2XRQ D;  4X3U A;  1VMC A;  2R61 A;  3AU7 A;  1DOL A;  4WRD A;  1SE4 A;  3D6W A;  4EQO A;  2B8G A;  1YNJ D;  4UDU C;  4FP5 D;  5D14 A;  4IUN A;  1TII D;  2BOS A;  5M3M B;  1OXS C;  5EJW A;  4CJ0 B;  1I4Q A;  2A6H C;  3S9W A;  1EY8 A;  3S1N B;  3G6J B;  5TSS A;  3GTL B;  1DD2 A;  4BY7 B;  1BR9 A;  2KCC A;  4I7Z C;  3S14 B;  1QJO A;  1RF2 D;  3ZYY X;  1ZYR D;  3HOV B;  1JOR A;  3KUP A;  3C3L A;  4TRD A;  2ENB A;  2ZXR A;  2MHV A;  1LTS D;  3DMU A;  2X6L A;  1SND A;  2MJ8 A;  1WTW A;  1EOT A;  1ML0 D;  3Q6S A;  3VA5 A;  3IAY A;  5ELE A;  1PXU A;  3E6Z X;  3EFX D;  3DEO A;  3RZD B;  5IOD A;  4XTC S;  4K8J A;  2DN8 A;  5CC4 A;  4KD3 A;  1JR0 D;  2KOL A;  2WV6 D;  3QOL A;  4KV6 A;  1QG7 A;  1A2T A;  2G9H D;  3MVV A;  1SNO A;  4F8M A;  2MGS A;  3KBX A;  1C4Q A;  2HDL A;  1O7Z A;  1R4P B;  3I3C A;  4L8J A;  1BCP D;  3OIQ A;  3PIP 3;  1HFG A;  2HQE A;  5IOC A;  1PRT B;  3OOC A;  3BS1 A;  1Q8I A;  2E76 C;  1ENF A;  2B2U A;  1OXV A;  4A93 B;  1QCB D;  1OO9 B;  4K5W A;  3R2I A;  3G7L A;  1V1O A;  1PRT F;  1R4Q B;  3J7A V;  3DWA A;  1LT3 D;  1SNP A;  4KY7 A;  2PMZ B;  4K6D A;  2KVM A;  2IT1 A;  4RH6 A;  5FLX E;  3HOZ B;  4MHE A;  5FO9 B;  4CKC A;  2VUM B;  4HCE A;  2JE6 I;  3TZD A;  4J8Q A;  1G2T A;  2F3V A;  1JB3 A;  3IFT A;  5CV9 A;  1F2Y A;  5CYU A;  1PRT C;  3MXN A;  1ROD A;  4R9W A;  3GTK B;  2EYF A;  3R93 A;  1SJH D;  4P2C B;  1RD9 D;  1I3Q B;  2AUK A;  1EEI D;  1G8Z D;  3KK7 A;  2PYK A;  1WTR A;  3O13 A;  4NW2 A;  4A3E B;  4QIW B;  3JAM E;  3NTH A;  4IQZ A;  4XYQ A;  4ZK9 B;  1SYF A;  1S5F D;  2WII B;  1STG A;  1BCP F;  5FO7 B;  1Z7T A;  2XWJ B;  1GUG A;  1M8A A;  3D31 A;  1Y1W B;  3NBI A;  1Q1E A;  2SNS A;  1A3V A;  2SEB D;  3L3O C;  2F0I A;  1GJX A;  1TQO A;  2B2V C;  1GHJ A;  1EL0 A;  4PMW A;  3A7A B;  2DY7 A;  2RDH A;  3NQT A;  1KTK A;  1LTI D;  5I6W A;  4HMI A;  3MTS A;  4KD4 A;  5LL6 S;  1ZKO A;  5C4X B;  4ID6 A;  1WTO A;  3P1H A;  3HEJ A;  5ELD A;  4OIJ A;  1JQY D;  4BBR B;  3LWE A;  4CGY B;  5C5M A;  5IT9 L;  4KHV A;  4RGT A;  2KHS A;  3L9A X;  1EEF D;  2D2C C;  2RVL A;  5I2Y A;  2B8F A;  2KUM A;  1V43 A;  4ABN A;  2NUC A;  5I9P A;  3HRZ C;  1STH A;  2K33 A;  2F0G A;  1NR2 A;  4IUP A;  4QUC A;  5C6A A;  1OXT A;  4C56 C;  1WTV A;  3S1M B;  5IGF A;  3S15 B;  5C4Z A;  4HN7 A;  1IKL A;  2RQX A;  1PZI D;  3WDN A;  5BN3 A;  2JA8 B;  1V1P B;  2J7Z A;  1AW7 A;  2VB3 X;  3VR3 A;  1I6V C;  1VF7 A;  3OMG A;  4FF1 A;  5ELC A;  1IKM A;  3A8I E;  3I73 A;  2EDG A;  3CKI B;  1SNQ A;  4LK1 C;  4IFD J;  2HCI A;  3LX0 A;  2NN6 I;  2EYL A;  1II3 A;  4AYB B;  2JEA I;  2F0H A;  2GA4 B;  5CV8 A;  2B63 B;  4ODG A;  2BDN A;  4BA2 I;  1FNW A;  4KK7 A;  5IGB A;  3K59 A;  4DAV A;  2PCF B;  1ILP A;  5EPJ A;  2A68 C;  1TWH B;  4IUR A;  3SK8 A;  3VYT A;  1PRT D;  2QKI C;  2O5J C;  1EYD A;  2J4X A;  1QWY A;  3PUW A;  2K1B A;  1OXX K;  5EKI A;  1EY9 A;  2EJM A;  2F4I A;  3RMH A;  3BVG A;  4DAY A;  2FMM A;  3S16 B;  4EQN A;  3QIA A;  3SR1 A;  2NN6 H;  3MAQ A;  4DF7 A;  3J7Y W;  1HTL D;  1TY2 A;  4CHT B;  1UEA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...