2F0UA

Crystal structure of staphylococcal nuclease mutant v23i/l25i/i72v
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTIKIMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKVEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Staphylococcal nuclease
total genus 35
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0uA00
4IALA 2F3VA 5F2DA 1SYBA 4KTAA 1EZ6A 1A2UA 2F0EA 5J1ZA 1JOQA 2ENBA 2F0PA 4ZQ3A 4DGZA 2OEOA 4KY5A 3C1EA 1ENAA 3NQTA 5KYIA 5C4HA 5KIXA 3TP8A 5DAUA 4NP5A 1EZ8A 4QF4A 5CV4A 1KDBA 3SR1A 4J1MA 5IGCA 5NUCA 1STYA 5DEHA 1JORA 4OL7A 5JOBA 1EYCA 4MIUA 2PW5A 4RKBA 3OMGA 5CV8A 5C5MA 3OWFA 5ISRA 3NUCA 3MXPA 4KJOA 5J39A 2PZWA 4PMCA 5E3FA 1STNA 5IIFA 3BDLA 5E1FA 2PQEA 2PZUA 4QMGA 2F0OA 3MHBA 5CR3A 2KHSA 4EQOA 2RKSA 4RKLA 3ERQA 3EVQA 2KQ3A 5IGBA 4PNYA 4B9XA 4NKLA 3E5SA 3MZ5A 4KY7A 3BDCA 4PMBA 5KEEA 3NHHA 2WACA 1F2YA 2RBMA 5KYLA 3RUZA 1F2ZA 3D4DA 4KJNA 1EY4A 1EY9A 1EY0A 5CV6A 4WORA 5CV5A 4TRDA 4HMJA 1JOOA 1A3UA 1STBA 1STGA 2F0JA 3EJIA 2F0MA 2F0LA 4G57A 4K2KA 4DU9A 2OF1A 4EQNA 2EY1A 4S3SA 1AEXA 2EYMA 3DMUA 5I6YA 2SNSA 4IUNA 2PW7A 4HTHA 2EYFA 2F0TA 2PZTA 3DHQA 3P1HA 4J6HA 3SXHA 3SHLA 5HURA 5IOCA 1ENCA 2LKVA 3SK4A 5IODA 2F0HA 1TR5A 3NXWA 2F0GA 2F0IA 1KDAA 1TQOA 5C5LA 4KD3A 5EGTA 5C4ZA 1EYAA 5IGFA 4DF7A 4KV6A 2EY5A 1KAAA 3MVVA 2F0DA 1EY6A 4WRDA 4B9WA 3TP6A 3HEJA 2F0QA 5IGDA 1EY7A 2F0FA 1EYDA 3U9OA 4KHVA 5KRUA 3D6CA 3D8GA 5KGUA 2EYOA 5M9OA 3TP7A 1SYFA 3T16A 5I6WA 2EY2A 4ME5A 5CV7A 4ODGA 1NSNS 1SYDA 2SNMA 3ITPA 3P75A 4K6DA 3OSOA 4N9TA 1A3VA 4NDXA 2EYLA 1SNCA 5CV9A 3SK8A 3VA5A 2NUCA 4EVOA 5C3XA 3QOJA 5CGKA 2M00A 2F0UA 1SNQA 3OMCA 4K8IA 5I9PA 1SNMA 2O4XA 1JOKA 4I65A 1NUCA 1U9RA 4LAAA 3R3OA 4YIJA 3NP8A 3QB3A 2RDFA 3NK9A 4K14A 4ZUIA 3TP5A 4E6IA 2EYJA 5C3WA 5JAVA 4ZUJA 5J22A 2F0VA 4K5VA 3EROA 1STAA 1EY5A 2EYPA 5CC4A 4HMIA 2F0WA 4K2LA 3PMFA 5EKLA 4N9PA 5IGGA 1EQVA 3HZXA 1SNPA 4KY6A 1KABA 5HGTA 2SOBA 3SK6A 5IGEA 4F7XA 3D4WA 2PYKA 2F0SA 4NMZA 3T13A 3S9WA 1IHZA 2OXPA 2F0NA 4QB4A 4F8MA 1F2MA 3C1FA 4ID6A 3LX0A 1RKNA 1SNOA 1TT2A 3H6MA 4IZ8A 4K8JA 2HQEA 1II3A 1SNDA 1EY8A 3QOLA 4H7BA 3SK5A 3V2TA 1SYEA 2EY6A 3MEHA 1SYGA 4K5WA 4R8NA 5EKKA 3TMEA 5K5PA 2EYHA 5C6AA 1A3TA 1STHA 4EQPA 4KD4A 1A2TA 2QDBA 5I9OA 1KDCA 2EXZA 2F3WA 2F0KA 1SYCA 4DFAA 4K5XA
chains in the Genus database with same CATH superfamily
4A3BH 1AE3A 4B3ML 1M4VA 3GD7A 1EWIA 1DXMA 1XTDA 1KIXA 4X66L 1NTGA 2D2CC 3PO3G 4LF5Q 4KHPL 1QVCA 3NSWA 4Z9CB 2NN6I 2K50A 2H4OA 2K5WA 4FYDA 1SFOB 4GN5A 4RAUC 4FF1A 4TQUS 2B63H 4IPHA 5KNBA 1TWHH 1BBUA 3OMGA 2R92B 2RA4A 2DNCA 2F4VL 4K0KQ 1SROA 3A7AB 4JOIC 1IXRA 2B63G 4L5SA 3S1QB 1CFMA 1GHJA 4A3EH 4DXGA 2MO0A 1I4RA 4RGNA 3K5OA 1G2TA 5L37A 2A19A 4QIWB 1KXLA 4JCVE 2Y0SB 1CQFA 1VQNA 4QCLA 1LM0A 2LFNA 2EQSA 2KA7A 1D8LA 3Q6SA 3K0XA 4JI6L 4KJNA 2QCPX 3EN2A 1JCKB 2O2LD 1XXGA 1PA6A 2Z8LA 2MO1A 1STGA 1CKMA 3GQBA 1YZ6A 1AEXA 1QUQA 5T1IA 3CCRA 1X3FA 2K28A 1JB3A 2NVYH 2LKVA 2RQXA 2K5DA 4Y7NB 3NXWA 1D1IA 2A6ED 2I07B 4JBWA 1YJWA 1BCPC 3M7GA 1I94L 1G8ZD 2EJMA 2FJ2A 5IY0A 1XNRQ 5I6WA 4RCNA 3FP9A 1E22A 1TIID 2R7DA 3T4AC 5GQOA 2D5DA 4LFCQ 3HG9A 1UEBA 2RHSB 3CC4A 1U9RA 3R3OA 4ULLA 2RHQB 4YHHQ 2WAQE 5LHY1 3GTMB 4JI7L 2JA8B 1EY5A 1QB5D 1Y1WG 1EQRA 1GUNA 1PH4A 4FXDA 4K2LA 3S1NH 3S1RH 4MZ9A 3IFTA 1C48A 1XMQQ 1U4PA 4LF4Q 4KN4C 4XYOA 1YJ9A 3CXCA 3C1FA 2ICIA 4JI4Q 4C3HG 1HR0W 4OWXB 3BYTB 3PO2B 3OIQA 1I4HA 2WAQB 2JJQA 3T1HQ 4F8MA 3KJOA 4GNXA 4YY3Q 2ZXPA 4AYBG 1EZ6A 3TN2A 2UU9L 3A55A 3C1EA 4C2MB 1ENAA 2Q2TA 1QOHA 4NP5A 1R9TB 5IGCA 1LT4D 2KCNA 1CTMA 1DONA 3F2BA 3PO2H 4X65L 2KVMA 1K3BC 2BH2A 3ND8A 1LYLA 2B29A 1PVOA 3CCVA 5G3LF 1E24A 1V1PB 3DLLA 1K8AC 3PCOB 1CHPD 3JAMc 1PZJD 4BY1B 3HOVH 3OOCA 1L0YB 2UUAQ 4LWCA 4JI0L 2BDOA 1LTBD 4DAMA 3BDCA 1LTID 2WKDA 1S5CD 1SEBD 2OTLA 2EJGC 1U4MA 5CV6A 1X65A 1JR0D 3S2DH 1MSHA 2AWOA 2Z6KA 3HOXB 1SMYC 2SNSA 1NNXA 1RDPD 2F0TA 2HUGA 3P1HA 1FNVA 3K58A 2DNEA 4POGA 3ER0A 2F0GA 1P8LA 1E7ZA 2NZHA 1XYIA 2A69D 2DJFC 2NB0A 2F0DA 4X66Q 4WRDA 3Q23A 4KHVA 4MTNA 2B2TA 2UUBQ 1PTOH 3ICEA 2B2TC 2ZXOA 2L11A 1FGUA 5CV7A 5BN4A 5HGTA 4NDXA 4B3TQ 2JEBI 2NVYB 5CV9A 4XDXA 1YJNA 2NUCA 1PFSA 2JA6H 1KLGD 1JJ2A 4A3BB 2KEEA 3MC0B 5LL6X 2O4XA 3HRZC 4B3RQ 1TWGB 4CKEA 3I90A 5DNFA 2CFMA 4DR2L 1YBYA 5CC4A 2WP8J 1S4ZA 4XYQA 2D9UA 2PPBC 3WWVA 1EIGA 4O2DA 1X3QA 2QF7A 3KDFA 3A5UA 1F2MA 2E75C 3HOWH 4A3IB 2HDMA 4DV1Q 3PIPA 5IYDG 1SYEA 5EKKA 3TZUA 3HOUG 2YYZA 1I6VC 1IYUA 3S2HB 3RLOA 1SYBA 1QCBD 1EQQA 2YU9B 1TWGH 1R9TH 4IURA 4A3MB 3NQTA 4QL5A 3ULPA 1LLRD 1ASYA 1EZ8A 1GUGA 4UHVA 1N33Q 2M9VA 1DM0B 2E74C 2RVLA 5NUCA 3FKIB 2E2DC 4MIUA 4EGVA 5M5XB 4GLAC 2I5LX 3T53B 1L0WA 1XJVA 1SSOA 5IP7G 2MJ8A 4FXKC 4XQNA 3FHWA 4CDDC 5M5YB 1N36Q 3NWTA 4HAEA 2LXKA 3AB9A 5J3BA 5AJ3L 2CCZA 2ZJRA 2F0LA 3PO3H 4HJAA 1HTPA 1D2BA 2K4KA 1C0AA 3AFPA 3HOXG 4DR5L 3GTGH 3IKJA 2ZTEA 1TR5A 4OONA 2NTSA 3MXUA 4WFN3 1JC7A 3CCSA 1J5EL 2FINB 4R4IA 4B3SL 3A8KE 4LF8Q 4YWKA 3J7ZC 1B1ZA 3FRPB 2F0QA 4P71A 2NVXH 5FLXL 1VQBA 5EPLA 3X3MA 2MUYA 3S17B 5D65A 1QNUA 1CZWA 2JA6B 4YCWA 4RHRA 4NPSA 1WCMG 1IL8A 1EWHA 4GKJL 4FO2A 1ZYRC 1K73C 1W6JA 1VMCA 5BR8L 1EFID 4CHTB 1STAA 1L0XB 4OEMB 2F0WA 4LF6L 1I50B 5FJ8G 2R7ZG 1OO9B 1M90C 1KABA 4KN7C 5ELOA 4A3FG 2C35B 3UDIA 3I4NG 1RKNA 4FF4A 4QQBX 1UE5A 1SNDA 1EEFD 1BCPD 1ET6A 1OXXK 2QEJC 1RD9D 4FNFA 2IX0A 4LJZC 3QIAA 3D6WA 4JI3Q 3PQIA 1HR0Q 4R4QA 1A63A 3PUWA 3I4MB 2HCIA 4C3JG 2K03A 3URYA 1X54A 1GD7A 4WJWA 5K36G 4IFDH 5ELNA 5D14A 2B8GA 1PH8A 2MP1A 3TP8A 3SR1A 4XQJA 4UY8C 1UE7A 2X69A 4DAYB 1VQFA 3HOWG 2I0QA 4TKOB 2EDGA 4HN7A 4DPGA 3IRBA 4JYAL 4WJ4A 3SDZA 1YNXA 4XT3B 1E1TA 1N32Q 1HQMC 4OXPA 2O5IC 2AQ3B 3EVQA 2BOSA 4QGUA 4JI7Q 1VF7A 1Y1VH 4MTKA 1WTHA 1PLFA 3G48A 3N52A 3RUZA 4LMQD 5C0XJ 4A3CH 3PIOA 4WORA 4LW1A 1PRTD 2EZVA 5BN5A 4B3SQ 1HNWL 1K8GA 1SE8A 2B39A 1FYCA 1WJJA 4JI6Q 3L7ZC 3W2DA 1X3PA 3CU7A 3BZDB 3CW2C 3EQLC 1H9SA 2E8GA 2KOLA 1PV4A 4GKJQ 1HZCA 5DLQE 4PMWA 1O80A 1FD7D 4DV0L 3A54A 3M9BA 4LF7L 4DF7A 5LMNW 4GOPB 2Z9HA 3AEVA 1PTOC 1YHBA 3F2UA 3U50C 1TY0A 2GVAA 1SXTA 4H02A 4DV5Q 5IYDH 1MGSA 3OPOA 4JI1Q 4LFAL 1YNJC 2EYLA 2JSOA 3B6YA 3FDTA 1FL0A 3OMCA 1DOLA 5JJKA 5ELEA 2X6GA 1PRTF 5J39A 2HHHL 5JAVA 4G7ZC 2F0VA 5E4WC 4OWWB 4DAVA 1U4RA 1K3RA 1SMYD 1V1PA 4DNIA 3TS0A 4A3KG 5M3FB 4I7ZC 1HRJA 1MBYA 5C4XH 3KLSX 3F2DA 1C8CA 4QB4A 2B2UC 1SNOA 2KHJA 4JC0A 3J80E 2ASBA 1PTOF 3V2TA 5GADC 4BBSH 3I55A 1NAPA 5K5PA 4RWSC 1A2TA 3TZDA 1D5ZC 3RN2A 2BA1A 1SYCA 1J8IA 1X9NA 4OGQC 5JEAJ 1K83B 1A2UA 1XNQL 2F1MA 3I4NH 1XNQQ 2B8FA 3PUXA 1MD2D 4A3KB 1IZ6A 3J81E 3S1MB 2H1EA 2A69C 5IE8A 4GZYC 2PMZB 4J1MA 5DEHA 1IBML 2PW5A 1B9NA 4L5RC 2AQ1B 2CH4A 1VQEA 1PH6A 2CWAA 1VQ7A 3M3YB 1QZHA 4BBSB 3UE1A 1TXYA 4JG2A 1YIJA 4RKLA 4ZAIA 2JA7B 1WTPA 4RCOA 3RZDB 2KQ3A 3BS1A 3UDGA 1E3PA 2E2IB 4NKLA 4BY7H 2WACA 2NTTA 3HOWB 1EY9A 1IKMA 2XSCA 2EVBA 1Y1VG 4HMJA 4TRDA 2IHEA 1GKHA 1YNND 5CBAE 2VL6A 1ASZA 1NE3A 4AH6A 2JA7H 4DK1A 4ILWA 1R4PB 4BY7B 5G3LD 2PO4A 3HOYG 4A3GH 1PHJA 5C5LA 3H3VH 4KD3A 2KEDA 4KLKA 2NVQB 4OELB 4QIWE 1KAAA 1Q90A 3GTLB 1ZKOA 4B9WA 1I6HH 2JN4A 2VUMB 4KKUA 1VQLA 4GKKQ 5M5XH 5IYBG 3A5ZB 3BVGA 3M4PA 2OWOA 1KLUD 4ME5A 1KAWA 3IL8A 4EVOA 2AUJD 1SNCA 3SK8A 5CGKA 1VQPA 2M00A 2F0UA 1SNQA 5IYCH 1QJOA 3C46A 4IUVA 1VQKA 1WOCA 4KMUC 1KNEA 1TS4A 5FKAC 1CZGA 1KHIA 5M3FH 3VR2A 4BBRG 3M4QA 3I4LA 1YEZA 1WCMB 1PH7A 2AKWB 1K8OA 2XWJB 4A3DB 3L3OC 3I4MG 2OXPA 2JA6G 5FLXE 2PI2A 1JQYD 2O5JC 3A74A 3KK7A 1KQSA 2E2JH 1EOVA 4APVA 2VQFL 4JOIA 1HHVA 1DOMA 1X56A 3NTKA 3I4NB 3TRZA 2WIIB 3A56A 1FJGL 1JJGA 1WTRA 4A3LH 2M2LA 1GXDC 3TREA 1LACA 2B2WC 4IFDI 1ZYRD 5C3EG 2R93G 2KHIA 3RZOB 1RL2A 2JE6I 3CC7A 5CV8A 1Q12A 3S24A 2OCEA 5KNCA 5E3FA 2L9HA 2PQEA 1X3EA 3IAYA 4MNOA 1N34Q 4R4OA 2XVSA 2FHTA 1DGSA 1HNWQ 2J4XA 1K28A 4JI4L 4JVZA 5JJZA 1SE4A 1TS5A 2RBMA 2KCTA 1SJHD 4POFA 3J81i 2BCOA 3K5NA 3HOYB 1K8MA 2ZJQA 3M4OB 4BY7G 4JI3L 1SLJA 2IW3A 4DK6C 3DMUA 3EFXD 2PW7A 1HH2P 4J6HA 4A3GB 1EEID 1VQ8A 1L2FA 3SK4A 5E7NA 1VQ4A 2CH4W 3H0GH 4LF8L 2JYOA 4KV6A 3HOUB 1B3QA 1EY6A 1I4GA 2AHOB 2NVTB 3K5MA 2G5DA 1PYBA 4IPGA 1RJTA 4PZ7A 3T16A 2BDNA 2EY2A 1SJED 1BCPB 4K6DA 5I6YA 2YV5A 1IBKQ 2FFKB 3K80C 3MFYA 1SNMA 3W5OA 1NUCA 1G91A 1AE2A 1FR3A 2WKCA 3S2DB 1JE5A 4YWLA 2K1BA 2ID0A 1A62A 5IGGA 1FJGQ 1EQVA 1BCPF 2K5NA 2P5ZX 3T13A 3PV0A 4DUYQ 2KUMA 1A8VA 3TDQA 3Q0AA 1EIFA 2NBFA 4K8JA 1II3A 1BXTA 3MEHA 4LF9Q 1EFWA 4M8AA 2Q8IB 3AYHB 5I9OA 4JI2Q 4DR4Q 3CMAA 3H91A 1OXTA 1I4PA 4KKTA 1YNJD 2BE5C 1G2SA 3K81C 1IBLL 3SVMA 2QEXA 1WTWA 3GTPB 4DR7Q 1UNSA 2ES2A 5EAYA 1HPCA 2Z4IA 1OXSC 3Q22A 4LFBL 3OWFA 4K6LA 4DV1L 1VCIA 3UDFA 1WVLA 4NXML 3OTOL 1PH5A 3DM3A 4PZ8A 5IGBA 1L1OB 2TMPA 3WOEA 4DXFA 4KY7A 3K7AH 4A3EG 4DN4M 2UXDL 4KK7A 4DR6Q 2UXDQ 1DYQA 2CW0C 1STBA 1VS0A 3EJIA 1AP0A 5ELDA 1BQQT 3RLNA 3DUZA 1CK1A 1HZ9A 2MGSA 1V1QA 3I4OA 1LTAD 2JP1A 2UXBQ 5BN3A 2WAQG 1PDQA 4HCSA 4JI5Q 1I5FA 1EYAA 1GM5A 2EY5A 2NVTH 3FKIH 1M1KC 3LGJA 4G7HC 4IJLA 5M3MG 2A73B 5IT9c 3CCQA 1ONLA 1LUZA 3A8IE 3ITPA 2OQKA 1F77A 2GVBA 3CCLA 3S9WA 2K52A 1DCZA 4YIJA 4BBRB 5D3IB 1CT1D 3LNNA 2EOTA 1NR4A 1WD0A 1ENFA 1V43A 2QGQA 4FF2A 4NXMQ 1S3OA 3J7YW 5C4XB 1XWEA 4HMIA 1Q86C 2NWGA 3J81j 1B3AA 3KYHC 2HHHQ 1K0SA 4RG1A 5IGEA 2ALYB 3EBEA 3R93A 4OX9Q 3MXGA 3U9SA 1XMOQ 4OWTB 4H44C 4Y52H 3MA2B 4IOCA 4C3IB 1J9OA 5M3MB 4K5WA 1SYGA 3OHXC 5KNDA 1GJXA 2EYHA 1X32A 1AH9A 3FEWX 4DNTB 1NJIC 4B3TL 2F3VA 1K0RA 1IBKL 5J1ZA 4ZQ3A 4TVAB 1SFOH 4EQ5A 4BY1H 5KYIA 2UUBL 3HOVB 1JT8A 3AQQA 5I2XA 4GLXA 2JA8G 2A1AA 3GTKH 5C44H 1B9MA 5JOBA 1EYCA 1E1OA 2RCNA 5FOBB 5ISRA 1S5FD 4LFAQ 4JI1L 4A3EB 3BDLA 1BF4A 1EYGA 5M3MH 1CA6A 3H3VI 5TSSA 4JI8L 3VR3A 3K7AB 3MFGA 2F4IA 3D4RA 4PNYA 4QY7A 4DR1Q 3ONAB 3FPPA 1P16A 2LXJA 1UE6A 1F2YA 5KYLA 4LF9L 1UUPA 2WV6D 1C4QA 2E2JB 1A3UA 2KCCA 3CQZB 4A3JB 3JC66 4HTHA 1D5MC 1LTSD 1MKHA 2EE1A 1VQ6A 2XGTA 2B2WA 5EGTA 3I56A 2PCFB 1EIYB 1CKNB 3RZOH 1LTTD 1FVIA 2Z0SA 1I3QH 1ML0D 2H5XA 3J80c 3D6CA 4RGOS 3GTQH 4DV7L 2EYOA 5M9OA 4JYAQ 1RF2D 4CDEC 2ATWA 2N3SA 2E76C 4UPAA 4YHHL 4N9TA 3P75A 3CCUA 5EPKA 2B63B 3R8BA 4DA2A 5I9PA 4R4TA 4ZUIA 3TP5A 1UEAB 1ICFB 2KJXA 3FKIG 4C3HH 1XNRL 3EA6A 3VYUA 4GNXC 1HTLD 1RIPA 4A93G 2FMMA 3NENA 3KBGA 4XIGS 5EPJA 3S16B 4JBMA 2IX3A 3S14H 3SGIA 3J7AF 2F0NA 1F9RA 3M7NA 1IW7C 3LWUA 4IZ8A 3D3RA 1GVPA 4L63B 3SK5A 1BBWA 1EIHA 2L1BA 2XTIA 5E4XA 5EBDA 2EIFA 2FMCA 2F3WA 1O78A 1Q8IA 4YCUA 1UWVA 1J5EQ 5LMNL 1OXUA 4XT1B 4DAPA 1F2LA 3SE0A 3QR8A 1YNNC 2IL8A 1UAPA 1NCVA 3H94A 5DAUA 2V4DA 3STBD 1SE2A 1I94Q 3CC2A 1Q3LA 1A15A 5JEAH 5FO7B 5HGQA 1QILA 2K5VA 1PFNA 5C0XG 4K0KL 4KKSA 2SDFA 1HCZA 3RD4A 3MHBA 1NR2A 1S5DD 2WB1E 5IP9H 2UXCL 4DV3L 5T1GA 1XMOL 3ZJYC 2DGYA 1D1KA 5KEEA 4CJ1B 1MIUA 4LF5L 2OT2A 1XPUA 3JAML 4EX5A 5I2YA 4X62L 4DU9A 3E0JA 4O0AA 1Q1EA 1TVXA 2EYMA 1WTXA 1N33L 5FO8B 2E2HH 3HGBA 2F0IA 2IJ0A 4JV5Q 4A75A 1QG7A 2D62A 4L6TB 1VF5C 4HSVA 3MVVA 3QJYA 1XPOA 3TP6A 1YVCA 3U9OA 4C3IH 1X55A 4CDFC 3L0OA 2A74C 3TP7A 1W6KA 4GOPC 4A3JH 4IN3A 4P73A 4A3DG 3MTSA 3OIPA 4BS9A 2R7ZB 5IWAQ 2B2VC 2XWBB 4MHEA 4A4IA 3CMEA 5EQ0A 1E2ZA 3N6RA 1Q1BA 3BDOA 1T9HA 3BYYB 3S16H 1V9PA 3HS0C 1UE1A 2QILA 1BO0A 1PYWD 4N9PA 3GTQB 1TKWB 1HNXQ 1ESRA 4KI0A 3R2IA 4HR7B 5EBCA 2CW0D 1RCVD 4KHZA 3OW7A 2VUMG 4C3HB 3JAMi 4EQPA 4KD4A 4A3IH 2QDBA 2ZT9C 1CHQD 1GUTA 1WFQA 3T56B 2A6EC 3KDFB 1B2TA 1ILPA 3AFQA 1LT3D 1TWHB 1JJCB 1VQIA 3G7LA 1ZEQX 3H09A 4OHJA 4R4CA 1Y1WB 2YU9H 1Y1VB 1FNWA 3RLFA 2CVRA 1HA6A 4PMCA 1STNA 2Z6BA 4BXXH 2VQEQ 1TY2A 1Y14B 3KLWA 2ZXRA 3PUZA 5COYA 4JI0Q 2NZOA 4GLVB 3RMHA 4P72A 4OIJA 3E5SA 3U4ZA 3MZ5A 1BUVT 5M5YH 1CSQA 1OXVA 3A0JA 4DR7L 2CHBD 4A3LG 2EY1A 1PFMA 2QDLA 4S3SA 1VQMA 1PRTB 1B8AA 4A3MG 4FXGC 2K01A 2L5TA 1PH2A 2PZTA 2B2VA 3U58A 5IOCA 2F0HA 4HIOA 3OW2A 3KF8B 1Z7TA 1TQOA 5I4DA 5C4ZA 4IO9A 3KFUA 5IP9G 4YY3L 1AFPA 5A2QE 2XNAC 1GHKA 3GTKB 5C44B 3HEJA 2Y0SG 1LV9A 1EY7A 4LUZA 2I5HA 5IYCG 3DM1A 3HKZB 3WOFA 4ODGA 1Q81C 1QNKA 4DV5L 1A3VA 3BVZA 3K5LA 3QOJA 2BE5D 5M3FG 1IYJB 4K8IA 4DV7Q 4A93B 2G9HD 3S1NB 2Q2IA 4K14A 1YHAA 1QZGA 2I46A 1I4XA 4RA8A 3X3NA 4IFDG 2B2YA 2PQAB 2K33A 3W1GA 5CORA 4IPCA 1VQHA 1K83H 3D4WA 4HJ9A 2QA4A 1MSGA 3RZDH 3MXNA 3HOUH 3NBIA 3H6MA 4A3KH 2JA5H 1PH3A 3CP0A 3GO5A 2HD3A 3TMEA 1Y8NB 1CI3M 4L5TA 1KC8C 2IY5B 2A68D 3T1YL 1KDCA 1HZBA 1JWSD 1F9QA 4LF4L 1GUWA 4TSSA 3I2ZA 3ULJA 1STEA 4R1JA 4DGZA 1Y1WH 2LS01 1Y69U 1HJPA 4CDCC 2K05A 1GOZA 3PSIA 5LL6S 1VQOA 4RKBA 3I8ZA 4RMFA 2AQ2B 3HP3A 3MXPA 2Z6KC 4DV2Q 1D6EC 5IIFA 4AQYQ 4JPBW 4WJ3M 1BKBA 3KUPA 3GTJH 3DWQA 3HKSA 3HKZG 2K7VA 4BY1G 4P2CB 1TS3A 3MXNB 2RDHA 2B2UA 3S14B 5C44G 3CCJA 4G4KA 5ELFA 4DR1L 1Q46A 2XRQD 3PF4A 1L1OA 3HOXH 2N8NA 2Q2UA 2F4VQ 4HJ5A 1JOOA 1A0IA 2Q2HA 2DY7A 4RFBA 4FF3A 3HOVG 2EYFA 1ZXTA 3DWAA 3DHQA 4OX9L 4C3JB 5FLMG 4DAYA 1HZAA 4N8X1 1GO3E 2CQAA 1CA5A 2IWHA 3SEBA 5ELCA 2KBNA 4A3MH 3PO2G 1PTOB 4DR5Q 4ZKCB 3H3VC 1T5XD 2OQ0A 5JVH3 1Z9FA 3GP7A 1WCMH 1D5XC 3OYYA 4X3SA 3F1ZA 1B53A 1HFNA 3S1QH 1C9OA 3QG1A 2DJGC 2N88A 3LWEA 4I65A 1B70B 1G291 2GN5A 4E6IA 5C3EH 2R93H 1S72A 2EYJA 2R61A 3G71A 4DV4Q 2SEBD 1EWCA 1L1OC 4KY6A 5FO9B 1PMRA 1PRTC 3E6ZX 1D7QA 4X3TA 1U4LA 2VQEL 2B3GA 4HSPA 4IUUA 2AUKA 3W3AA 1N9WA 3AU7A 3LX0A 4UAIA 1ICWA 2XN9C 1BVSA 3HKZE 3KF6A 4H7BA 1VQAA 1EQTA 1CKOA 1XX8A 3VYSA 4J8QA 4GOPA 3K59A 1WD1A 5F2DA 4A3FB 1PTOD 2Q8TA 1EOTA 5FK9C 5C4HA 1ESFA 1U0LA 3OTOQ 3S17H 2UXBL 2FXQA 1JWUD 4GS3A 3F8TA 3NPPA 4UP7A 2C9OA 1RTOA 4X64Q 4XQQA 3S1MH 3L9AX 2G9DA 3E0EA 4KJOA 4ALPA 1DJRD 1MI2A 5E1FA 1WTOA 2VXWA 3M4OH 2F3IA 3I73A 2HT1A 5D3DA 2IX1A 2PNRC 4ABNA 2UUCL 4EQOA 3NQIA 4OO1H 4DV6Q 1WYDA 2K5HA 2ZTCA 1HA5A 3KLSA 4PMBA 3ZYYX 4GN4B 2A5HA 5IYBH 1G51A 2R92H 4F88A 4HIMA 4DR3Q 2F0JA 4BWGB 1H9MA 3A8JE 2L55A 3E3XA 4U673 1AZQA 3PO3B 4QUFA 1LABA 3VYTA 1B7YB 4DV4L 1G6PA 1VQ5A 1NY4A 4BBRH 1IW7D 3GV3A 1E0BA 3KBXA 5ELBA 3CAMA 3MWYW 2LY7A 2NVQH 1VMPA 2AMCB 2JEAI 4DV0Q 1S40A 4JI2L 4DR4L 4XXEA 1NSNS 3NTIA 1BNZA 3VA5A 4RGTA 4X62Q 1TS2A 4AYBE 1JE4A 4LAAA 3T1HL 2RDFA 2F52A 3NK9A 1HQRD 2YTYA 3CRLC 5HY6A 3STBC 3PIO3 4DV2L 1GUOA 3FPUB 1NBWA 2RDGA 2VB3X 4DV3Q 2CWPA 1H9JA 4CKCA 3HZXA 4HCEA 2SOBA 3SK6A 1GUSA 1PH1A 1LTGD 1KTKA 3RR5A 1ET9A 3NWSA 3NE5B 1RTNA 4B08A 1V1OA 3QOLA 4XTCS 4RH6A 4DK0A 2R3ZA 2Z4HA 4DK3C 2UU9Q 3KF6B 2EXZA 2J0TD 3NTHA 4J15A 3S1RB 2Q8RE 1MJCA 2V1CC 4KTAA 1JOQA 1Z6HA 4C56C 4KY5A 4LNQA 5KIXA 1N34L 2I5MX 4QF4A 4OIKA 4NXNQ 3K0YA 1CM9A 2VUMH 3G4SA 3GTLH 1I6HB 2HIVA 4X65Q 4OL7A 2L0CA 1KRSA 2R6GA 2HQLA 5C5MA 3NUCA 4A93H 1XMQL 4IUTA 3IFDA 2HDLA 3U4VA 5IP7H 4A3BG 1RHPA 3DEPA 1TWCH 4NB3A 5A35A 2PZUA 1N32L 1DZ1A 1W2BA 5CR3A 5EKIA 3T1YQ 1SN8A 2ZJPA 5C0XI 2R7FA 2L4NA 1XPRA 4A76A 1B50A 4O42A 5GAHC 4CJ2C 3O13A 2KECA 1PXUA 4LF6Q 1JB7A 4A3DH 3W1BA 4G57A 5C3EB 2A8VA 2R93B 5C4JH 4DKAC 2N49A 3CRKC 4A3JG 1HR0L 4P74A 2OTJA 1M8AA 4AYBB 2VB2X 3MAQA 2X6LA 1N8RC 1O7ZA 4BA1I 2VY3A 2D0PA 5IT9E 1OTCA 1Y8OB 1QWYA 3TBIB 4C1NK 2GA4B 1QVGA 4NXNL 2NZ1D 1NMFA 4P75A 1O7LA 1EYDA 5FLXc 1FNUA 3NBHB 4LFCL 2IPKD 4C2MH 4LUVA 3GTJB 1O7YA 1Z47A 3A7LA 3KF8A 4HIKA 4GKKL 1TWAB 1BDOA 3TQYA 2MNAA 4DR3L 3NP8A 3QB3A 1AZPA 3GTOH 1VQCA 2AWNA 3L2PA 5H1SE 4IOAA 1EU3A 3D0FA 2RSOA 4UP8A 5CYUA 2A6HD 3BZKA 1C7YA 4QUCA 1SAPA 3PF5A 2RSNA 1SNPA 4F7XA 4OO1I 2F0SA 4PQXA 3G6JB 4O1NA 4ID6A 3S15B 1BOSA 1TT2A 3K57A 1TWAH 1IYVA 5JJLA 1Y8PB 2EY6A 2NYZD 4C3JH 4X64L 3EIVA 1STHA 4C3IG 1B44D 3K7UC 3CPWA 1I50H 4B3MQ 3CQZH 3UE0A 1LTLA 3FMCA 3PGZA 4HEDA 1BBXC 2ENBA 2K75A 5AJ3Q 2RCFA 3BG3A 1N36L 4IQZA 1HNXL 1QE6A 5C4XG 1CQVA 2F03A 1HUMA 2JQOA 2NN6H 5GROA 3S2HH 2PNHA 4ZLTF 1JICA 2WB1B 5IT9L 2L15A 5IWAL 3HOZG 5JJIA 3PUYA 3ERQA 4RHSA 3KLRA 2ZM6Q 1K9MC 4YWMA 2K6AA 4YCVA 4HJ7A 2HCCA 3K6OA 1HXYD 2PI2E 4ZK9B 5CMDA 4PV1C 1IKLA 1LTRD 1EY4A 2MPMA 2QKIC 3KJPA 4DV6L 1F9PA 1KD1C 1XTCD 2N78A 2F0MA 1TWCB 2YTVA 4UDUC 4ZRZA 4JV5L 2K14A 3CPFA 2UUCQ 4X6AH 3SHLA 1IBMQ 5IODA 2YTXA 5EJWA 2Y0SE 5IGFA 4JI5L 1U5KA 3F2CA 5FLMH 5GAEC 3E9HA 1MJEA 4CGYB 2D0OA 4V0BA 1X3GA 2F0FA 2A68C 3J80L 4GN3B 1FGBD 3C3LA 4LFBQ 1SYFA 4X3UA 1YITA 3PUVA 3TEHB 2CQOA 2SNMA 3VDYA 3GV6A 3OWEB 2UXCQ 1O7IA 3V96A 4DR2Q 4RGMA 4DR6L 3DWPA 1JOKA 1G6ZA 1IBLQ 3K8AA 2R92G 3NEMA 1S5BD 4DNRB 1SR3A 3QO2A 3EROA 3BZCA 1CSPA 5JEAG 1RODA 3PMFA 3MEFA 1KRTA 3D31A 2JA8H 1LT6D 1ILQA 2PYKA 4ZYSA 3PIP3 3VR6A 4CBVA 4PZ6A 1DOKA 3E9IA 3M85A 4H13C 4DUYL 3H15A 4AQYL 1EY8A 4MN3A 3VR4A 1EUJA 5LMNQ 2KCMA 2HIXA 4A3FH 3Q24A 2IT1A 2XRSD 3UDXA 3H0GB 4JW0A 4K5XA 1JORA 2LSSA 1T5EA 2F0EA 2VZAA 4FP5D 2F0PA 3JAME 4HIDA 2ICEC 2OEOA 5M5WH 3GDEA 4LF7Q 5C4JB 5CV4A 1KDBA 3DEOA 2LMCB 1SRUA 2WFWA 4IUQA 3CCEA 1E2WA 1VQJA 1X6OA 1DD2A 2UUAL 4IJHA 2VNUD 2L12A 3NELA 3J81c 4X3KA 3TSSA 1W3SA 3P20A 1LT5D 3ULLA 4QMGA 4IPDA 2F0OA 3V05A 3QWNA 5A2QL 3J7A5 2RKSA 4AIMA 3HOZB 1Q7YC 1AN8A 2WB1G 3RN5A 1B4OA 3NHHA 4H0LC 3I72A 1F2ZA 3G6EA 4L8JA 4I7AA 1EY0A 3ND9A 2QW7A 4R9WA 1HNZQ 3M3YH 4K2KA 3GTOB 4GNXB 3HOYH 4A3GG 2EXDA 3HOZH 4V190 2ZTDA 1AW7A 5HURA 2E2IH 1Q8KA 5DM73 4CJ0B 1KDAA 4U68A 1SMXA 1HUNA 1SBBB 5BR8Q 2MFIA 3I4MH 5IGDA 5DM63 1HNZL 4N8FA 4FDBA 5FJ8H 1E2VA 3BJUA 4Q5VA 2C5CA 1NMGA 3HFZB 1SYDA 1I3QB 5GAGC 5C3WA 5C3XA 3Q8DA 3BU2A 2Z1CA 1PH9A 2JA5B 1Q82C 4LUOA 3C2PA 1QUQB 1R4QB 4G7OC 4ZUJA 2TSSA 4K5VA 3VR5A 2WINB 5K36H 2E2HB 4BA2I 3DXJC 2K04A 4QJFA 2VQFQ 2JA5G 1CUKA 1SE3A 2PQAA 4F87A 2K32A 4NMZA 3VA7A 1J6QA 4HJ8A 1KL9A 3CHBD 1SDFA 1PZID 1S5ED 2BA0A 2HQEA 4IFDJ 3I70A 4R8NA 1VQ9A 5JVG3 2JK8A 2VS1A 1MHWC 4JI8Q 2R7ZH 4DFAA 1WTVA 2MQHA 4IALA 3J81L 1TWFB 3ERSX 1KNAA 5JPMC 1EU4A 4JBKA 3NBHA 3T51B 2EJFC 3I91A 2JA9A 2CKZB 1I4QA 1STYA 3VYRA 2PMZE 1VDZA 2PZWA 1H9KA 2RF4A 4JBJA 3KOJA 1TWFH 2KHSA 3UI2A 5M5WB 4R8IA 1HFGA 1PYSB 2EPBA 4L5QA 4Y7NH 4DUZQ 4B9XA 1WTQA 4PG3A 4ZKBB 4JK1C 1TU2B 2A6HC 4ZCKA 3D4DA 4LK1C 3WDNA 1LO5D 4BXXG 2VW9A 5CV5A 1VQGA 3CF5A 4KHPQ 2OF1A 4EQNA 1F9SA 4ME3A 3J80i 2ZM6L 1H9SB 2KENA 4Q0FA 3FVQA 4IUNA 5LMUL 2JXMB 1YI2A 3SXHA 3CD6A 2E5LQ 4NW2A 1ENCA 1WI5A 5C0XH 3RNUA 1H95A 1A6XA 4C1NI 4FVMA 3GTGB 1V8QA 2NN6G 4OO1G 3I7FA 3GTMH 3R2TA 2XIWA 2MHVA 3CCMA 5KRUA 4A3IG 3D8GA 5KGUA 2B2YC 2JA7G 5AFWA 1JMCA 2J7ZA 1VQDA 2NVXB 4BBSG 5JPNC 3OSOA 4UP9A 1PZKD 2E5LL 3J7AV 1YHQA 5LMUQ 4A3CG 5J22A 5CBEE 1JWMD 2EYPA 1PFBA 3GTPH 2K5QA 4M1UB 5EKLA 3M4YA 3S15H 3I3CA 3P7JA 4IUPA 1EL0A 3TS2A 1QVFA 4CKBA 1IHZA 2BH8A 1BR9A 1H9RA 2DN8A 4DUZL 3AMUA 2IHFA 1IL2A 4B3RL 1CKNA 3CKIB 3H0GG 2N55A 5C6AA 1A3TA 2DY8A 3BVMA 2F0KA 2DUDA
chains in the Genus database with same CATH topology
1M4VA 3GD7A 1DXMA 2D2CC 3NSWA 4Z9CB 2NN6I 2H4OA 2K5WA 4FYDA 1SFOB 4RAUC 4FF1A 4TQUS 5KNBA 3OMGA 2R92B 2RA4A 2DNCA 3A7AB 3S1QB 1CFMA 1GHJA 4DXGA 1I4RA 4RGNA 3K5OA 1G2TA 4QIWB 2Y0SB 1CQFA 4QCLA 2LFNA 2KA7A 3Q6SA 4KJNA 2QCPX 1JCKB 2O2LD 1XXGA 2Z8LA 1STGA 3GQBA 1AEXA 5T1IA 2K28A 1JB3A 2LKVA 2RQXA 2K5DA 4Y7NB 3NXWA 1D1IA 2A6ED 2I07B 4JBWA 1BCPC 3M7GA 1G8ZD 2EJMA 2FJ2A 5I6WA 4RCNA 1TIID 3T4AC 2D5DA 3HG9A 1U9RA 3R3OA 4ULLA 5LHY1 3GTMB 2JA8B 1EY5A 1QB5D 4FXDA 1GUNA 4K2LA 3IFTA 1C48A 1U4PA 4KN4C 4XYOA 3C1FA 2ICIA 4C3HG 3BYTB 3PO2B 3OIQA 1I4HA 2WAQB 4F8MA 2ZXPA 1EZ6A 3TN2A 3A55A 3C1EA 4C2MB 1ENAA 1QOHA 4NP5A 1R9TB 5IGCA 1LT4D 2KCNA 1CTMA 1DONA 2KVMA 3ND8A 5G3LF 1V1PB 1CHPD 1PZJD 4BY1B 3OOCA 1L0YB 2BDOA 1LTBD 3BDCA 1LTID 2WKDA 1S5CD 1SEBD 2EJGC 1U4MA 5CV6A 1JR0D 1MSHA 2AWOA 3HOXB 1SMYC 2SNSA 1RDPD 2F0TA 2HUGA 3P1HA 1FNVA 3K58A 2DNEA 2F0GA 1XYIA 2A69D 2NB0A 2F0DA 4WRDA 3Q23A 4KHVA 2B2TA 1PTOH 2B2TC 2ZXOA 2L11A 5CV7A 5BN4A 5HGTA 4NDXA 2JEBI 2NVYB 5CV9A 4XDXA 2NUCA 1KLGD 4A3BB 2KEEA 3MC0B 5LL6X 2O4XA 3HRZC 1TWGB 4CKEA 3I90A 5DNFA 5CC4A 2WP8J 1S4ZA 4XYQA 2D9UA 2PPBC 1EIGA 1X3QA 2QF7A 1F2MA 2E75C 4A3IB 2HDMA 1SYEA 5EKKA 3TZUA 2YYZA 1I6VC 1IYUA 3S2HB 1SYBA 1QCBD 2YU9B 4IURA 4A3MB 3NQTA 1LLRD 1EZ8A 1GUGA 2M9VA 1DM0B 2E74C 2RVLA 5NUCA 3FKIB 2E2DC 4MIUA 4EGVA 5M5XB 3T53B 1SSOA 2MJ8A 4FXKC 4XQNA 5M5YB 3NWTA 4HAEA 3AB9A 2F0LA 1HTPA 1D2BA 3IKJA 1TR5A 2NTSA 3MXUA 4WFN3 1JC7A 2FINB 3A8KE 1B1ZA 3FRPB 2F0QA 5FLXL 5EPLA 3X3MA 2MUYA 3S17B 5D65A 1QNUA 1CZWA 2JA6B 4RHRA 1IL8A 1EWHA 4FO2A 1ZYRC 1W6JA 1VMCA 1EFID 4CHTB 1STAA 1L0XB 2F0WA 1I50B 1OO9B 1KABA 4KN7C 1RKNA 4FF4A 1SNDA 1EEFD 1BCPD 1ET6A 1OXXK 2QEJC 1RD9D 4FNFA 2IX0A 4LJZC 3QIAA 3D6WA 3PUWA 3I4MB 2HCIA 4C3JG 2K03A 3URYA 4WJWA 5K36G 4IFDH 5D14A 2B8GA 2MP1A 3TP8A 3SR1A 4XQJA 2X69A 4TKOB 2EDGA 4HN7A 3SDZA 4XT3B 1HQMC 2O5IC 2AQ3B 3EVQA 2BOSA 1VF7A 1PLFA 3N52A 3RUZA 4LMQD 5C0XJ 4WORA 2EZVA 1PRTD 5BN5A 2B39A 1FYCA 3L7ZC 3W2DA 1X3PA 3BZDB 3CU7A 3EQLC 1H9SA 2KOLA 4PMWA 1O80A 1FD7D 3A54A 4DF7A 1PTOC 3F2UA 1TY0A 1SXTA 1MGSA 3OPOA 1YNJC 2EYLA 2JSOA 3FDTA 3OMCA 1DOLA 5ELEA 2X6GA 1PRTF 5J39A 5JAVA 4G7ZC 2F0VA 5E4WC 4DAVA 1U4RA 1SMYD 1V1PA 5M3FB 4I7ZC 1HRJA 1MBYA 3KLSX 1C8CA 4QB4A 2B2UC 1SNOA 3J80E 1PTOF 3V2TA 1NAPA 5K5PA 4RWSC 1A2TA 3TZDA 1D5ZC 2BA1A 1SYCA 1J8IA 4OGQC 5JEAJ 1K83B 1A2UA 2F1MA 2B8FA 3PUXA 1MD2D 4A3KB 3J81E 3S1MB 2H1EA 2A69C 4GZYC 2PMZB 4J1MA 5DEHA 2PW5A 1B9NA 2AQ1B 3M3YB 4BBSB 4RKLA 4ZAIA 2JA7B 1WTPA 4RCOA 3RZDB 2KQ3A 3BS1A 2E2IB 4NKLA 2WACA 2NTTA 3HOWB 1EY9A 1IKMA 2XSCA 2EVBA 4TRDA 4HMJA 1YNND 5CBAE 4DK1A 4ILWA 1R4PB 4BY7B 5G3LD 2PO4A 5C5LA 4KD3A 2KEDA 2NVQB 1KAAA 1Q90A 3GTLB 1ZKOA 4B9WA 2VUMB 4KKUA 3BVGA 1KLUD 4ME5A 3IL8A 4EVOA 2AUJD 1SNCA 3SK8A 5CGKA 2M00A 2F0UA 1SNQA 3C46A 1QJOA 4IUVA 4KMUC 1KNEA 1TS4A 5FKAC 1CZGA 3VR2A 3I4LA 1WCMB 1K8OA 2XWJB 4A3DB 3L3OC 2OXPA 5FLXE 1JQYD 2O5JC 3KK7A 1HHVA 1DOMA 3NTKA 3I4NB 2WIIB 3A56A 1WTRA 2M2LA 1GXDC 1LACA 2B2WC 4IFDI 1ZYRD 3RZOB 2JE6I 5CV8A 1Q12A 5KNCA 5E3FA 2L9HA 2PQEA 3IAYA 2XVSA 2FHTA 2J4XA 5JJZA 1SE4A 1TS5A 2RBMA 1SJHD 2BCOA 3K5NA 3HOYB 1K8MA 3M4OB 2IW3A 3DMUA 3EFXD 2PW7A 4J6HA 4A3GB 1EEID 3SK4A 2JYOA 4KV6A 3HOUB 1EY6A 1I4GA 2NVTB 3K5MA 1RJTA 3T16A 2BDNA 2EY2A 1SJED 1BCPB 4K6DA 5I6YA 2FFKB 3MFYA 1SNMA 1NUCA 1G91A 2WKCA 1FR3A 3S2DB 2K1BA 2ID0A 5IGGA 1EQVA 1BCPF 3T13A 3PV0A 2KUMA 3TDQA 3Q0AA 2NBFA 4K8JA 1II3A 1BXTA 3MEHA 4M8AA 2Q8IB 5I9OA 3H91A 1OXTA 1I4PA 4KKTA 1YNJD 2BE5C 1G2SA 3SVMA 1WTWA 3GTPB 1UNSA 1HPCA 2Z4IA 1OXSC 3Q22A 3OWFA 4K6LA 1VCIA 1WVLA 5IGBA 3WOEA 2TMPA 4DXFA 4KY7A 4DN4M 4KK7A 1DYQA 2CW0C 1STBA 3EJIA 1AP0A 5ELDA 1BQQT 3DUZA 1CK1A 2MGSA 1LTAD 2JP1A 5BN3A 1PDQA 4HCSA 1EYAA 2EY5A 4G7HC 2A73B 1ONLA 3A8IE 3ITPA 1F77A 3S9WA 4BBRB 1DCZA 4YIJA 5D3IB 1CT1D 3LNNA 2EOTA 1WD0A 1NR4A 1ENFA 1V43A 4FF2A 3J7YW 5C4XB 1XWEA 4HMIA 2NWGA 1B3AA 5IGEA 3R93A 3MXGA 3U9SA 4H44C 3MA2B 4C3IB 1J9OA 5M3MB 4K5WA 1SYGA 3OHXC 5KNDA 1GJXA 2EYHA 1X32A 3FEWX 4DNTB 2F3VA 5J1ZA 4ZQ3A 3HOVB 5KYIA 5I2XA 1B9MA 5JOBA 1EYCA 5FOBB 5ISRA 1S5FD 4A3EB 3BDLA 1BF4A 1CA6A 5TSSA 3VR3A 3K7AB 3MFGA 2F4IA 3D4RA 4PNYA 3ONAB 3FPPA 1F2YA 5KYLA 1UUPA 2WV6D 1C4QA 2E2JB 1A3UA 2KCCA 3CQZB 4A3JB 4HTHA 1D5MC 1LTSD 2EE1A 2B2WA 5EGTA 2PCFB 1LTTD 1ML0D 3D6CA 4RGOS 2EYOA 5M9OA 1RF2D 2E76C 4N9TA 3P75A 5EPKA 2B63B 3R8BA 4DA2A 5I9PA 4ZUIA 3TP5A 1UEAB 2KJXA 3EA6A 3VYUA 1HTLD 2FMMA 5EPJA 3KBGA 4XIGS 3S16B 2IX3A 3J7AF 2F0NA 1F9RA 3M7NA 1IW7C 3LWUA 4IZ8A 3D3RA 4L63B 3SK5A 1EIHA 2L1BA 5E4XA 5EBDA 2FMCA 2F3WA 1O78A 1Q8IA 1OXUA 4XT1B 4DAPA 1F2LA 3SE0A 1YNNC 2IL8A 1UAPA 1NCVA 3H94A 5DAUA 2V4DA 1SE2A 1Q3LA 1A15A 5JEAH 5FO7B 1QILA 1PFNA 5C0XG 4KKSA 2SDFA 1HCZA 3RD4A 3MHBA 1NR2A 1S5DD 5T1GA 1D1KA 5KEEA 4CJ1B 2OT2A 3JAML 5I2YA 4DU9A 3E0JA 1Q1EA 1TVXA 2EYMA 1WTXA 5FO8B 3HGBA 2F0IA 2IJ0A 1QG7A 2D62A 4L6TB 1VF5C 4HSVA 3MVVA 3QJYA 3TP6A 3U9OA 2A74C 3TP7A 1W6KA 4IN3A 3MTSA 4BS9A 3OIPA 2R7ZB 2B2VC 2XWBB 4MHEA 5EQ0A 1E2ZA 3N6RA 1Q1BA 3BDOA 3BYYB 3HS0C 2QILA 1BO0A 1PYWD 4N9PA 3GTQB 1TKWB 1ESRA 4KI0A 3R2IA 4HR7B 5EBCA 2CW0D 1RCVD 4KHZA 3OW7A 4C3HB 4EQPA 4KD4A 2QDBA 2ZT9C 1CHQD 1GUTA 3T56B 2A6EC 1B2TA 1ILPA 1LT3D 1TWHB 3H09A 3G7LA 1Y1WB 1ZEQX 4OHJA 1Y1VB 1FNWA 3RLFA 2CVRA 1HA6A 4PMCA 1STNA 1TY2A 2ZXRA 3PUZA 5COYA 3RMHA 4OIJA 3E5SA 3MZ5A 1BUVT 1OXVA 2CHBD 2EY1A 1PFMA 4S3SA 1PRTB 4FXGC 2K01A 2L5TA 2PZTA 2B2VA 5IOCA 2F0HA 1Z7TA 1TQOA 5I4DA 5C4ZA 1AFPA 5A2QE 2XNAC 1GHKA 3GTKB 5C44B 3HEJA 1LV9A 1EY7A 3DM1A 3HKZB 3WOFA 4ODGA 1QNKA 1A3VA 3BVZA 3K5LA 3QOJA 2BE5D 4K8IA 4A93B 2G9HD 3S1NB 4K14A 2I46A 1I4XA 4RA8A 3X3NA 4IFDG 2B2YA 2K33A 5CORA 3D4WA 1MSGA 3MXNA 3NBIA 3H6MA 3GO5A 3TMEA 1Y8NB 1CI3M 2A68D 1KDCA 1JWSD 1F9QA 1GUWA 4TSSA 1STEA 4DGZA 2LS01 1Y69U 2K05A 1GOZA 5LL6S 4RKBA 3I8ZA 2AQ2B 3HP3A 3MXPA 1D6EC 5IIFA 3KUPA 3DWQA 2K7VA 4P2CB 1TS3A 2RDHA 2B2UA 3S14B 4G4KA 5ELFA 2XRQD 1JOOA 2DY7A 4RFBA 4FF3A 2EYFA 1ZXTA 3DWAA 3DHQA 4C3JB 4DAYA 2CQAA 1CA5A 2IWHA 3SEBA 5ELCA 1PTOB 4ZKCB 3H3VC 1T5XD 5JVH3 3GP7A 1D5XC 4X3SA 1B53A 1HFNA 3QG1A 2N88A 3LWEA 4I65A 1G291 4E6IA 2EYJA 2R61A 2SEBD 1EWCA 4KY6A 5FO9B 1PMRA 1PRTC 3E6ZX 4X3TA 1U4LA 4HSPA 4IUUA 2AUKA 3W3AA 3AU7A 4UAIA 3LX0A 1ICWA 2XN9C 4H7BA 1EQTA 1XX8A 3VYSA 4J8QA 3K59A 1WD1A 5F2DA 4A3FB 1PTOD 2Q8TA 1EOTA 5FK9C 5C4HA 1ESFA 1JWUD 3NPPA 2C9OA 1RTOA 4XQQA 3L9AX 2G9DA 4KJOA 1DJRD 1MI2A 5E1FA 1WTOA 2VXWA 3I73A 2IX1A 5D3DA 2PNRC 4ABNA 4EQOA 3NQIA 4OO1H 4PMBA 1HA5A 3KLSA 3ZYYX 2A5HA 4F88A 2F0JA 4BWGB 1H9MA 3A8JE 2L55A 4U673 1AZQA 3PO3B 4QUFA 1LABA 3VYTA 1IW7D 3GV3A 1E0BA 3KBXA 5ELBA 3MWYW 2LY7A 1VMPA 2JEAI 4XXEA 1NSNS 3NTIA 1BNZA 3VA5A 4RGTA 1TS2A 1JE4A 4LAAA 2RDFA 3NK9A 1HQRD 3CRLC 3PIO3 1GUOA 3FPUB 2RDGA 2VB3X 1H9JA 4CKCA 3HZXA 4HCEA 2SOBA 3SK6A 1GUSA 1LTGD 1KTKA 1ET9A 3NWSA 3NE5B 1RTNA 4B08A 1V1OA 3QOLA 4XTCS 4RH6A 4DK0A 2R3ZA 2Z4HA 2EXZA 2J0TD 3NTHA 3S1RB 2Q8RE 4KTAA 1JOQA 1Z6HA 4C56C 4KY5A 5KIXA 4QF4A 4OIKA 3K0YA 1CM9A 1I6HB 4OL7A 2L0CA 2R6GA 5C5MA 3NUCA 4IUTA 3IFDA 2HDLA 1RHPA 3DEPA 5A35A 2PZUA 1DZ1A 5CR3A 5EKIA 5C0XI 2L4NA 1B50A 4O42A 4CJ2C 3O13A 2KECA 1PXUA 4G57A 5C3EB 2R93B 3CRKC 1M8AA 4AYBB 2VB2X 3MAQA 2X6LA 1O7ZA 4BA1I 5IT9E 1Y8OB 1QWYA 3TBIB 4C1NK 2GA4B 2NZ1D 1O7LA 1EYDA 1FNUA 2IPKD 3GTJB 1O7YA 1Z47A 3A7LA 3KF8A 1TWAB 1BDOA 3NP8A 3QB3A 1AZPA 2AWNA 1EU3A 2RSOA 5CYUA 2A6HD 4QUCA 1SAPA 2RSNA 1SNPA 4F7XA 4OO1I 2F0SA 4PQXA 3G6JB 4O1NA 4ID6A 3S15B 1BOSA 1TT2A 3K57A 1IYVA 1Y8PB 2EY6A 2NYZD 1STHA 4C3IG 1B44D 3FMCA 4HEDA 1BBXC 2ENBA 3BG3A 4IQZA 1QE6A 1CQVA 2F03A 1HUMA 2NN6H 4ZLTF 1JICA 2WB1B 5IT9L 3PUYA 3ERQA 4RHSA 3KLRA 2K6AA 2HCCA 3K6OA 1HXYD 4ZK9B 5CMDA 4PV1C 1IKLA 1LTRD 1EY4A 2MPMA 2QKIC 1F9PA 1XTCD 2F0MA 1TWCB 4UDUC 4ZRZA 3SHLA 5IODA 5EJWA 5IGFA 4CGYB 4V0BA 2F0FA 2A68C 3J80L 1FGBD 3C3LA 1SYFA 4X3UA 3PUVA 2SNMA 3GV6A 3OWEB 3V96A 4RGMA 3DWPA 1JOKA 1G6ZA 1S5BD 4DNRB 3QO2A 3EROA 5JEAG 1RODA 3PMFA 3D31A 1LT6D 1ILQA 2PYKA 4ZYSA 3PIP3 3VR6A 4CBVA 1DOKA 3M85A 4H13C 1EY8A 4MN3A 3VR4A 3Q24A 2IT1A 2XRSD 3H0GB 4K5XA 1JORA 1T5EA 2F0EA 4FP5D 2F0PA 3JAME 2ICEC 2OEOA 5C4JB 5CV4A 1KDBA 2LMCB 3DEOA 4IUQA 1E2WA 1DD2A 2VNUD 2L12A 4X3KA 3TSSA 3P20A 1LT5D 4QMGA 2F0OA 3V05A 3QWNA 5A2QL 2RKSA 3HOZB 1AN8A 1B4OA 3NHHA 4H0LC 3I72A 1F2ZA 4L8JA 1EY0A 3ND9A 4R9WA 4K2KA 3GTOB 4V190 1AW7A 5HURA 5DM73 4CJ0B 1KDAA 4U68A 1HUNA 1SBBB 5IGDA 5DM63 1E2VA 4Q5VA 2C5CA 1SYDA 1I3QB 5C3WA 5C3XA 2Z1CA 2JA5B 3C2PA 1R4QB 4G7OC 4ZUJA 2TSSA 4K5VA 3VR5A 2WINB 5K36H 2E2HB 4BA2I 3DXJC 2K04A 1SE3A 4F87A 2K32A 4NMZA 3VA7A 3CHBD 1SDFA 1PZID 1S5ED 2BA0A 2HQEA 4IFDJ 3I70A 4R8NA 5JVG3 4DFAA 1WTVA 4IALA 3J81L 1TWFB 1KNAA 5JPMC 1EU4A 3NBHA 3T51B 2EJFC 3I91A 1I4QA 1STYA 3VYRA 1VDZA 2PZWA 1H9KA 2KHSA 3UI2A 5M5WB 4R8IA 1HFGA 2EPBA 4B9XA 1WTQA 4ZKBB 4JK1C 1TU2B 2A6HC 3D4DA 4LK1C 3WDNA 1LO5D 5CV5A 2OF1A 4EQNA 1F9SA 1H9SB 4Q0FA 3FVQA 4IUNA 2JXMB 3SXHA 4NW2A 1ENCA 5C0XH 1A6XA 4C1NI 4FVMA 3GTGB 1V8QA 2NN6G 4OO1G 3R2TA 2XIWA 2MHVA 5KRUA 3D8GA 5KGUA 2B2YC 5AFWA 2J7ZA 2NVXB 5JPNC 3OSOA 1PZKD 3J7AV 5J22A 5CBEE 1JWMD 2EYPA 1PFBA 2K5QA 4M1UB 5EKLA 3M4YA 3I3CA 3P7JA 4IUPA 1EL0A 4CKBA 1IHZA 1BR9A 1H9RA 2DN8A 3AMUA 3CKIB 2N55A 5C6AA 1A3TA 2DY8A 3BVMA 2F0KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IAL A;  2F3V A;  5F2D A;  1SYB A;  4KTA A;  1EZ6 A;  1A2U A;  2F0E A;  5J1Z A;  1JOQ A;  2ENB A;  2F0P A;  4ZQ3 A;  4DGZ A;  2OEO A;  4KY5 A;  3C1E A;  1ENA A;  3NQT A;  5KYI A;  5C4H A;  5KIX A;  3TP8 A;  5DAU A;  4NP5 A;  1EZ8 A;  4QF4 A;  5CV4 A;  1KDB A;  3SR1 A;  4J1M A;  5IGC A;  5NUC A;  1STY A;  5DEH A;  1JOR A;  4OL7 A;  5JOB A;  1EYC A;  4MIU A;  2PW5 A;  4RKB A;  3OMG A;  5CV8 A;  5C5M A;  3OWF A;  5ISR A;  3NUC A;  3MXP A;  4KJO A;  5J39 A;  2PZW A;  4PMC A;  5E3F A;  1STN A;  5IIF A;  3BDL A;  5E1F A;  2PQE A;  2PZU A;  4QMG A;  2F0O A;  3MHB A;  5CR3 A;  2KHS A;  4EQO A;  2RKS A;  4RKL A;  3ERQ A;  3EVQ A;  2KQ3 A;  5IGB A;  4PNY A;  4B9X A;  4NKL A;  3E5S A;  3MZ5 A;  4KY7 A;  3BDC A;  4PMB A;  5KEE A;  3NHH A;  2WAC A;  1F2Y A;  2RBM A;  5KYL A;  3RUZ A;  1F2Z A;  3D4D A;  4KJN A;  1EY4 A;  1EY9 A;  1EY0 A;  5CV6 A;  4WOR A;  5CV5 A;  4TRD A;  4HMJ A;  1JOO A;  1A3U A;  1STB A;  1STG A;  2F0J A;  3EJI A;  2F0M A;  2F0L A;  4G57 A;  4K2K A;  4DU9 A;  2OF1 A;  4EQN A;  2EY1 A;  4S3S A;  1AEX A;  2EYM A;  3DMU A;  5I6Y A;  2SNS A;  4IUN A;  2PW7 A;  4HTH A;  2EYF A;  2F0T A;  2PZT A;  3DHQ A;  3P1H A;  4J6H A;  3SXH A;  3SHL A;  5HUR A;  5IOC A;  1ENC A;  2LKV A;  3SK4 A;  5IOD A;  2F0H A;  1TR5 A;  3NXW A;  2F0G A;  2F0I A;  1KDA A;  1TQO A;  5C5L A;  4KD3 A;  5EGT A;  5C4Z A;  1EYA A;  5IGF A;  4DF7 A;  4KV6 A;  2EY5 A;  1KAA A;  3MVV A;  2F0D A;  1EY6 A;  4WRD A;  4B9W A;  3TP6 A;  3HEJ A;  2F0Q A;  5IGD A;  1EY7 A;  2F0F A;  1EYD A;  3U9O A;  4KHV A;  5KRU A;  3D6C A;  3D8G A;  5KGU A;  2EYO A;  5M9O A;  3TP7 A;  1SYF A;  3T16 A;  5I6W A;  2EY2 A;  4ME5 A;  5CV7 A;  4ODG A;  1NSN S;  1SYD A;  2SNM A;  3ITP A;  3P75 A;  4K6D A;  3OSO A;  4N9T A;  1A3V A;  4NDX A;  2EYL A;  1SNC A;  5CV9 A;  3SK8 A;  3VA5 A;  2NUC A;  4EVO A;  5C3X A;  3QOJ A;  5CGK A;  2M00 A;  2F0U A;  1SNQ A;  3OMC A;  4K8I A;  5I9P A;  1SNM A;  2O4X A;  1JOK A;  4I65 A;  1NUC A;  1U9R A;  4LAA A;  3R3O A;  4YIJ A;  3NP8 A;  3QB3 A;  2RDF A;  3NK9 A;  4K14 A;  4ZUI A;  3TP5 A;  4E6I A;  2EYJ A;  5C3W A;  5JAV A;  4ZUJ A;  5J22 A;  2F0V A;  4K5V A;  3ERO A;  1STA A;  1EY5 A;  2EYP A;  5CC4 A;  4HMI A;  2F0W A;  4K2L A;  3PMF A;  5EKL A;  4N9P A;  5IGG A;  1EQV A;  3HZX A;  1SNP A;  4KY6 A;  1KAB A;  5HGT A;  2SOB A;  3SK6 A;  5IGE A;  4F7X A;  3D4W A;  2PYK A;  2F0S A;  4NMZ A;  3T13 A;  3S9W A;  1IHZ A;  2OXP A;  2F0N A;  4QB4 A;  4F8M A;  1F2M A;  3C1F A;  4ID6 A;  3LX0 A;  1RKN A;  1SNO A;  1TT2 A;  3H6M A;  4IZ8 A;  4K8J A;  2HQE A;  1II3 A;  1SND A;  1EY8 A;  3QOL A;  4H7B A;  3SK5 A;  3V2T A;  1SYE A;  2EY6 A;  3MEH A;  1SYG A;  4K5W A;  4R8N A;  5EKK A;  3TME A;  5K5P A;  2EYH A;  5C6A A;  1A3T A;  1STH A;  4EQP A;  4KD4 A;  1A2T A;  2QDB A;  5I9O A;  1KDC A;  2EXZ A;  2F3W A;  2F0K A;  1SYC A;  4DFA A;  4K5X A; 
#chains in the Genus database with same CATH topology
 4A3B H;  1AE3 A;  4B3M L;  1M4V A;  3GD7 A;  1EWI A;  1DXM A;  1XTD A;  1KIX A;  4X66 L;  1NTG A;  2D2C C;  3PO3 G;  4LF5 Q;  4KHP L;  1QVC A;  3NSW A;  4Z9C B;  2NN6 I;  2K50 A;  2H4O A;  2K5W A;  4FYD A;  1SFO B;  4GN5 A;  4RAU C;  4FF1 A;  4TQU S;  2B63 H;  4IPH A;  5KNB A;  1TWH H;  1BBU A;  3OMG A;  2R92 B;  2RA4 A;  2DNC A;  2F4V L;  4K0K Q;  1SRO A;  3A7A B;  4JOI C;  1IXR A;  2B63 G;  4L5S A;  3S1Q B;  1CFM A;  1GHJ A;  4A3E H;  4DXG A;  2MO0 A;  1I4R A;  4RGN A;  3K5O A;  1G2T A;  5L37 A;  2A19 A;  4QIW B;  1KXL A;  4JCV E;  2Y0S B;  1CQF A;  1VQN A;  4QCL A;  1LM0 A;  2LFN A;  2EQS A;  2KA7 A;  1D8L A;  3Q6S A;  3K0X A;  4JI6 L;  4KJN A;  2QCP X;  3EN2 A;  1JCK B;  2O2L D;  1XXG A;  1PA6 A;  2Z8L A;  2MO1 A;  1STG A;  1CKM A;  3GQB A;  1YZ6 A;  1AEX A;  1QUQ A;  5T1I A;  3CCR A;  1X3F A;  2K28 A;  1JB3 A;  2NVY H;  2LKV A;  2RQX A;  2K5D A;  4Y7N B;  3NXW A;  1D1I A;  2A6E D;  2I07 B;  4JBW A;  1YJW A;  1BCP C;  3M7G A;  1I94 L;  1G8Z D;  2EJM A;  2FJ2 A;  5IY0 A;  1XNR Q;  5I6W A;  4RCN A;  3FP9 A;  1E22 A;  1TII D;  2R7D A;  3T4A C;  5GQO A;  2D5D A;  4LFC Q;  3HG9 A;  1UEB A;  2RHS B;  3CC4 A;  1U9R A;  3R3O A;  4ULL A;  2RHQ B;  4YHH Q;  2WAQ E;  5LHY 1;  3GTM B;  4JI7 L;  2JA8 B;  1EY5 A;  1QB5 D;  1Y1W G;  1EQR A;  1GUN A;  1PH4 A;  4FXD A;  4K2L A;  3S1N H;  3S1R H;  4MZ9 A;  3IFT A;  1C48 A;  1XMQ Q;  1U4P A;  4LF4 Q;  4KN4 C;  4XYO A;  1YJ9 A;  3CXC A;  3C1F A;  2ICI A;  4JI4 Q;  4C3H G;  1HR0 W;  4OWX B;  3BYT B;  3PO2 B;  3OIQ A;  1I4H A;  2WAQ B;  2JJQ A;  3T1H Q;  4F8M A;  3KJO A;  4GNX A;  4YY3 Q;  2ZXP A;  4AYB G;  1EZ6 A;  3TN2 A;  2UU9 L;  3A55 A;  3C1E A;  4C2M B;  1ENA A;  2Q2T A;  1QOH A;  4NP5 A;  1R9T B;  5IGC A;  1LT4 D;  2KCN A;  1CTM A;  1DON A;  3F2B A;  3PO2 H;  4X65 L;  2KVM A;  1K3B C;  2BH2 A;  3ND8 A;  1LYL A;  2B29 A;  1PVO A;  3CCV A;  5G3L F;  1E24 A;  1V1P B;  3DLL A;  1K8A C;  3PCO B;  1CHP D;  3JAM c;  1PZJ D;  4BY1 B;  3HOV H;  3OOC A;  1L0Y B;  2UUA Q;  4LWC A;  4JI0 L;  2BDO A;  1LTB D;  4DAM A;  3BDC A;  1LTI D;  2WKD A;  1S5C D;  1SEB D;  2OTL A;  2EJG C;  1U4M A;  5CV6 A;  1X65 A;  1JR0 D;  3S2D H;  1MSH A;  2AWO A;  2Z6K A;  3HOX B;  1SMY C;  2SNS A;  1NNX A;  1RDP D;  2F0T A;  2HUG A;  3P1H A;  1FNV A;  3K58 A;  2DNE A;  4POG A;  3ER0 A;  2F0G A;  1P8L A;  1E7Z A;  2NZH A;  1XYI A;  2A69 D;  2DJF C;  2NB0 A;  2F0D A;  4X66 Q;  4WRD A;  3Q23 A;  4KHV A;  4MTN A;  2B2T A;  2UUB Q;  1PTO H;  3ICE A;  2B2T C;  2ZXO A;  2L11 A;  1FGU A;  5CV7 A;  5BN4 A;  5HGT A;  4NDX A;  4B3T Q;  2JEB I;  2NVY B;  5CV9 A;  4XDX A;  1YJN A;  2NUC A;  1PFS A;  2JA6 H;  1KLG D;  1JJ2 A;  4A3B B;  2KEE A;  3MC0 B;  5LL6 X;  2O4X A;  3HRZ C;  4B3R Q;  1TWG B;  4CKE A;  3I90 A;  5DNF A;  2CFM A;  4DR2 L;  1YBY A;  5CC4 A;  2WP8 J;  1S4Z A;  4XYQ A;  2D9U A;  2PPB C;  3WWV A;  1EIG A;  4O2D A;  1X3Q A;  2QF7 A;  3KDF A;  3A5U A;  1F2M A;  2E75 C;  3HOW H;  4A3I B;  2HDM A;  4DV1 Q;  3PIP A;  5IYD G;  1SYE A;  5EKK A;  3TZU A;  3HOU G;  2YYZ A;  1I6V C;  1IYU A;  3S2H B;  3RLO A;  1SYB A;  1QCB D;  1EQQ A;  2YU9 B;  1TWG H;  1R9T H;  4IUR A;  4A3M B;  3NQT A;  4QL5 A;  3ULP A;  1LLR D;  1ASY A;  1EZ8 A;  1GUG A;  4UHV A;  1N33 Q;  2M9V A;  1DM0 B;  2E74 C;  2RVL A;  5NUC A;  3FKI B;  2E2D C;  4MIU A;  4EGV A;  5M5X B;  4GLA C;  2I5L X;  3T53 B;  1L0W A;  1XJV A;  1SSO A;  5IP7 G;  2MJ8 A;  4FXK C;  4XQN A;  3FHW A;  4CDD C;  5M5Y B;  1N36 Q;  3NWT A;  4HAE A;  2LXK A;  3AB9 A;  5J3B A;  5AJ3 L;  2CCZ A;  2ZJR A;  2F0L A;  3PO3 H;  4HJA A;  1HTP A;  1D2B A;  2K4K A;  1C0A A;  3AFP A;  3HOX G;  4DR5 L;  3GTG H;  3IKJ A;  2ZTE A;  1TR5 A;  4OON A;  2NTS A;  3MXU A;  4WFN 3;  1JC7 A;  3CCS A;  1J5E L;  2FIN B;  4R4I A;  4B3S L;  3A8K E;  4LF8 Q;  4YWK A;  3J7Z C;  1B1Z A;  3FRP B;  2F0Q A;  4P71 A;  2NVX H;  5FLX L;  1VQB A;  5EPL A;  3X3M A;  2MUY A;  3S17 B;  5D65 A;  1QNU A;  1CZW A;  2JA6 B;  4YCW A;  4RHR A;  4NPS A;  1WCM G;  1IL8 A;  1EWH A;  4GKJ L;  4FO2 A;  1ZYR C;  1K73 C;  1W6J A;  1VMC A;  5BR8 L;  1EFI D;  4CHT B;  1STA A;  1L0X B;  4OEM B;  2F0W A;  4LF6 L;  1I50 B;  5FJ8 G;  2R7Z G;  1OO9 B;  1M90 C;  1KAB A;  4KN7 C;  5ELO A;  4A3F G;  2C35 B;  3UDI A;  3I4N G;  1RKN A;  4FF4 A;  4QQB X;  1UE5 A;  1SND A;  1EEF D;  1BCP D;  1ET6 A;  1OXX K;  2QEJ C;  1RD9 D;  4FNF A;  2IX0 A;  4LJZ C;  3QIA A;  3D6W A;  4JI3 Q;  3PQI A;  1HR0 Q;  4R4Q A;  1A63 A;  3PUW A;  3I4M B;  2HCI A;  4C3J G;  2K03 A;  3URY A;  1X54 A;  1GD7 A;  4WJW A;  5K36 G;  4IFD H;  5ELN A;  5D14 A;  2B8G A;  1PH8 A;  2MP1 A;  3TP8 A;  3SR1 A;  4XQJ A;  4UY8 C;  1UE7 A;  2X69 A;  4DAY B;  1VQF A;  3HOW G;  2I0Q A;  4TKO B;  2EDG A;  4HN7 A;  4DPG A;  3IRB A;  4JYA L;  4WJ4 A;  3SDZ A;  1YNX A;  4XT3 B;  1E1T A;  1N32 Q;  1HQM C;  4OXP A;  2O5I C;  2AQ3 B;  3EVQ A;  2BOS A;  4QGU A;  4JI7 Q;  1VF7 A;  1Y1V H;  4MTK A;  1WTH A;  1PLF A;  3G48 A;  3N52 A;  3RUZ A;  4LMQ D;  5C0X J;  4A3C H;  3PIO A;  4WOR A;  4LW1 A;  1PRT D;  2EZV A;  5BN5 A;  4B3S Q;  1HNW L;  1K8G A;  1SE8 A;  2B39 A;  1FYC A;  1WJJ A;  4JI6 Q;  3L7Z C;  3W2D A;  1X3P A;  3CU7 A;  3BZD B;  3CW2 C;  3EQL C;  1H9S A;  2E8G A;  2KOL A;  1PV4 A;  4GKJ Q;  1HZC A;  5DLQ E;  4PMW A;  1O80 A;  1FD7 D;  4DV0 L;  3A54 A;  3M9B A;  4LF7 L;  4DF7 A;  5LMN W;  4GOP B;  2Z9H A;  3AEV A;  1PTO C;  1YHB A;  3F2U A;  3U50 C;  1TY0 A;  2GVA A;  1SXT A;  4H02 A;  4DV5 Q;  5IYD H;  1MGS A;  3OPO A;  4JI1 Q;  4LFA L;  1YNJ C;  2EYL A;  2JSO A;  3B6Y A;  3FDT A;  1FL0 A;  3OMC A;  1DOL A;  5JJK A;  5ELE A;  2X6G A;  1PRT F;  5J39 A;  2HHH L;  5JAV A;  4G7Z C;  2F0V A;  5E4W C;  4OWW B;  4DAV A;  1U4R A;  1K3R A;  1SMY D;  1V1P A;  4DNI A;  3TS0 A;  4A3K G;  5M3F B;  4I7Z C;  1HRJ A;  1MBY A;  5C4X H;  3KLS X;  3F2D A;  1C8C A;  4QB4 A;  2B2U C;  1SNO A;  2KHJ A;  4JC0 A;  3J80 E;  2ASB A;  1PTO F;  3V2T A;  5GAD C;  4BBS H;  3I55 A;  1NAP A;  5K5P A;  4RWS C;  1A2T A;  3TZD A;  1D5Z C;  3RN2 A;  2BA1 A;  1SYC A;  1J8I A;  1X9N A;  4OGQ C;  5JEA J;  1K83 B;  1A2U A;  1XNQ L;  2F1M A;  3I4N H;  1XNQ Q;  2B8F A;  3PUX A;  1MD2 D;  4A3K B;  1IZ6 A;  3J81 E;  3S1M B;  2H1E A;  2A69 C;  5IE8 A;  4GZY C;  2PMZ B;  4J1M A;  5DEH A;  1IBM L;  2PW5 A;  1B9N A;  4L5R C;  2AQ1 B;  2CH4 A;  1VQE A;  1PH6 A;  2CWA A;  1VQ7 A;  3M3Y B;  1QZH A;  4BBS B;  3UE1 A;  1TXY A;  4JG2 A;  1YIJ A;  4RKL A;  4ZAI A;  2JA7 B;  1WTP A;  4RCO A;  3RZD B;  2KQ3 A;  3BS1 A;  3UDG A;  1E3P A;  2E2I B;  4NKL A;  4BY7 H;  2WAC A;  2NTT A;  3HOW B;  1EY9 A;  1IKM A;  2XSC A;  2EVB A;  1Y1V G;  4HMJ A;  4TRD A;  2IHE A;  1GKH A;  1YNN D;  5CBA E;  2VL6 A;  1ASZ A;  1NE3 A;  4AH6 A;  2JA7 H;  4DK1 A;  4ILW A;  1R4P B;  4BY7 B;  5G3L D;  2PO4 A;  3HOY G;  4A3G H;  1PHJ A;  5C5L A;  3H3V H;  4KD3 A;  2KED A;  4KLK A;  2NVQ B;  4OEL B;  4QIW E;  1KAA A;  1Q90 A;  3GTL B;  1ZKO A;  4B9W A;  1I6H H;  2JN4 A;  2VUM B;  4KKU A;  1VQL A;  4GKK Q;  5M5X H;  5IYB G;  3A5Z B;  3BVG A;  3M4P A;  2OWO A;  1KLU D;  4ME5 A;  1KAW A;  3IL8 A;  4EVO A;  2AUJ D;  1SNC A;  3SK8 A;  5CGK A;  1VQP A;  2M00 A;  2F0U A;  1SNQ A;  5IYC H;  1QJO A;  3C46 A;  4IUV A;  1VQK A;  1WOC A;  4KMU C;  1KNE A;  1TS4 A;  5FKA C;  1CZG A;  1KHI A;  5M3F H;  3VR2 A;  4BBR G;  3M4Q A;  3I4L A;  1YEZ A;  1WCM B;  1PH7 A;  2AKW B;  1K8O A;  2XWJ B;  4A3D B;  3L3O C;  3I4M G;  2OXP A;  2JA6 G;  5FLX E;  2PI2 A;  1JQY D;  2O5J C;  3A74 A;  3KK7 A;  1KQS A;  2E2J H;  1EOV A;  4APV A;  2VQF L;  4JOI A;  1HHV A;  1DOM A;  1X56 A;  3NTK A;  3I4N B;  3TRZ A;  2WII B;  3A56 A;  1FJG L;  1JJG A;  1WTR A;  4A3L H;  2M2L A;  1GXD C;  3TRE A;  1LAC A;  2B2W C;  4IFD I;  1ZYR D;  5C3E G;  2R93 G;  2KHI A;  3RZO B;  1RL2 A;  2JE6 I;  3CC7 A;  5CV8 A;  1Q12 A;  3S24 A;  2OCE A;  5KNC A;  5E3F A;  2L9H A;  2PQE A;  1X3E A;  3IAY A;  4MNO A;  1N34 Q;  4R4O A;  2XVS A;  2FHT A;  1DGS A;  1HNW Q;  2J4X A;  1K28 A;  4JI4 L;  4JVZ A;  5JJZ A;  1SE4 A;  1TS5 A;  2RBM A;  2KCT A;  1SJH D;  4POF A;  3J81 i;  2BCO A;  3K5N A;  3HOY B;  1K8M A;  2ZJQ A;  3M4O B;  4BY7 G;  4JI3 L;  1SLJ A;  2IW3 A;  4DK6 C;  3DMU A;  3EFX D;  2PW7 A;  1HH2 P;  4J6H A;  4A3G B;  1EEI D;  1VQ8 A;  1L2F A;  3SK4 A;  5E7N A;  1VQ4 A;  2CH4 W;  3H0G H;  4LF8 L;  2JYO A;  4KV6 A;  3HOU B;  1B3Q A;  1EY6 A;  1I4G A;  2AHO B;  2NVT B;  3K5M A;  2G5D A;  1PYB A;  4IPG A;  1RJT A;  4PZ7 A;  3T16 A;  2BDN A;  2EY2 A;  1SJE D;  1BCP B;  4K6D A;  5I6Y A;  2YV5 A;  1IBK Q;  2FFK B;  3K80 C;  3MFY A;  1SNM A;  3W5O A;  1NUC A;  1G91 A;  1AE2 A;  1FR3 A;  2WKC A;  3S2D B;  1JE5 A;  4YWL A;  2K1B A;  2ID0 A;  1A62 A;  5IGG A;  1FJG Q;  1EQV A;  1BCP F;  2K5N A;  2P5Z X;  3T13 A;  3PV0 A;  4DUY Q;  2KUM A;  1A8V A;  3TDQ A;  3Q0A A;  1EIF A;  2NBF A;  4K8J A;  1II3 A;  1BXT A;  3MEH A;  4LF9 Q;  1EFW A;  4M8A A;  2Q8I B;  3AYH B;  5I9O A;  4JI2 Q;  4DR4 Q;  3CMA A;  3H91 A;  1OXT A;  1I4P A;  4KKT A;  1YNJ D;  2BE5 C;  1G2S A;  3K81 C;  1IBL L;  3SVM A;  2QEX A;  1WTW A;  3GTP B;  4DR7 Q;  1UNS A;  2ES2 A;  5EAY A;  1HPC A;  2Z4I A;  1OXS C;  3Q22 A;  4LFB L;  3OWF A;  4K6L A;  4DV1 L;  1VCI A;  3UDF A;  1WVL A;  4NXM L;  3OTO L;  1PH5 A;  3DM3 A;  4PZ8 A;  5IGB A;  1L1O B;  2TMP A;  3WOE A;  4DXF A;  4KY7 A;  3K7A H;  4A3E G;  4DN4 M;  2UXD L;  4KK7 A;  4DR6 Q;  2UXD Q;  1DYQ A;  2CW0 C;  1STB A;  1VS0 A;  3EJI A;  1AP0 A;  5ELD A;  1BQQ T;  3RLN A;  3DUZ A;  1CK1 A;  1HZ9 A;  2MGS A;  1V1Q A;  3I4O A;  1LTA D;  2JP1 A;  2UXB Q;  5BN3 A;  2WAQ G;  1PDQ A;  4HCS A;  4JI5 Q;  1I5F A;  1EYA A;  1GM5 A;  2EY5 A;  2NVT H;  3FKI H;  1M1K C;  3LGJ A;  4G7H C;  4IJL A;  5M3M G;  2A73 B;  5IT9 c;  3CCQ A;  1ONL A;  1LUZ A;  3A8I E;  3ITP A;  2OQK A;  1F77 A;  2GVB A;  3CCL A;  3S9W A;  2K52 A;  1DCZ A;  4YIJ A;  4BBR B;  5D3I B;  1CT1 D;  3LNN A;  2EOT A;  1NR4 A;  1WD0 A;  1ENF A;  1V43 A;  2QGQ A;  4FF2 A;  4NXM Q;  1S3O A;  3J7Y W;  5C4X B;  1XWE A;  4HMI A;  1Q86 C;  2NWG A;  3J81 j;  1B3A A;  3KYH C;  2HHH Q;  1K0S A;  4RG1 A;  5IGE A;  2ALY B;  3EBE A;  3R93 A;  4OX9 Q;  3MXG A;  3U9S A;  1XMO Q;  4OWT B;  4H44 C;  4Y52 H;  3MA2 B;  4IOC A;  4C3I B;  1J9O A;  5M3M B;  4K5W A;  1SYG A;  3OHX C;  5KND A;  1GJX A;  2EYH A;  1X32 A;  1AH9 A;  3FEW X;  4DNT B;  1NJI C;  4B3T L;  2F3V A;  1K0R A;  1IBK L;  5J1Z A;  4ZQ3 A;  4TVA B;  1SFO H;  4EQ5 A;  4BY1 H;  5KYI A;  2UUB L;  3HOV B;  1JT8 A;  3AQQ A;  5I2X A;  4GLX A;  2JA8 G;  2A1A A;  3GTK H;  5C44 H;  1B9M A;  5JOB A;  1EYC A;  1E1O A;  2RCN A;  5FOB B;  5ISR A;  1S5F D;  4LFA Q;  4JI1 L;  4A3E B;  3BDL A;  1BF4 A;  1EYG A;  5M3M H;  1CA6 A;  3H3V I;  5TSS A;  4JI8 L;  3VR3 A;  3K7A B;  3MFG A;  2F4I A;  3D4R A;  4PNY A;  4QY7 A;  4DR1 Q;  3ONA B;  3FPP A;  1P16 A;  2LXJ A;  1UE6 A;  1F2Y A;  5KYL A;  4LF9 L;  1UUP A;  2WV6 D;  1C4Q A;  2E2J B;  1A3U A;  2KCC A;  3CQZ B;  4A3J B;  3JC6 6;  4HTH A;  1D5M C;  1LTS D;  1MKH A;  2EE1 A;  1VQ6 A;  2XGT A;  2B2W A;  5EGT A;  3I56 A;  2PCF B;  1EIY B;  1CKN B;  3RZO H;  1LTT D;  1FVI A;  2Z0S A;  1I3Q H;  1ML0 D;  2H5X A;  3J80 c;  3D6C A;  4RGO S;  3GTQ H;  4DV7 L;  2EYO A;  5M9O A;  4JYA Q;  1RF2 D;  4CDE C;  2ATW A;  2N3S A;  2E76 C;  4UPA A;  4YHH L;  4N9T A;  3P75 A;  3CCU A;  5EPK A;  2B63 B;  3R8B A;  4DA2 A;  5I9P A;  4R4T A;  4ZUI A;  3TP5 A;  1UEA B;  1ICF B;  2KJX A;  3FKI G;  4C3H H;  1XNR L;  3EA6 A;  3VYU A;  4GNX C;  1HTL D;  1RIP A;  4A93 G;  2FMM A;  3NEN A;  3KBG A;  4XIG S;  5EPJ A;  3S16 B;  4JBM A;  2IX3 A;  3S14 H;  3SGI A;  3J7A F;  2F0N A;  1F9R A;  3M7N A;  1IW7 C;  3LWU A;  4IZ8 A;  3D3R A;  1GVP A;  4L63 B;  3SK5 A;  1BBW A;  1EIH A;  2L1B A;  2XTI A;  5E4X A;  5EBD A;  2EIF A;  2FMC A;  2F3W A;  1O78 A;  1Q8I A;  4YCU A;  1UWV A;  1J5E Q;  5LMN L;  1OXU A;  4XT1 B;  4DAP A;  1F2L A;  3SE0 A;  3QR8 A;  1YNN C;  2IL8 A;  1UAP A;  1NCV A;  3H94 A;  5DAU A;  2V4D A;  3STB D;  1SE2 A;  1I94 Q;  3CC2 A;  1Q3L A;  1A15 A;  5JEA H;  5FO7 B;  5HGQ A;  1QIL A;  2K5V A;  1PFN A;  5C0X G;  4K0K L;  4KKS A;  2SDF A;  1HCZ A;  3RD4 A;  3MHB A;  1NR2 A;  1S5D D;  2WB1 E;  5IP9 H;  2UXC L;  4DV3 L;  5T1G A;  1XMO L;  3ZJY C;  2DGY A;  1D1K A;  5KEE A;  4CJ1 B;  1MIU A;  4LF5 L;  2OT2 A;  1XPU A;  3JAM L;  4EX5 A;  5I2Y A;  4X62 L;  4DU9 A;  3E0J A;  4O0A A;  1Q1E A;  1TVX A;  2EYM A;  1WTX A;  1N33 L;  5FO8 B;  2E2H H;  3HGB A;  2F0I A;  2IJ0 A;  4JV5 Q;  4A75 A;  1QG7 A;  2D62 A;  4L6T B;  1VF5 C;  4HSV A;  3MVV A;  3QJY A;  1XPO A;  3TP6 A;  1YVC A;  3U9O A;  4C3I H;  1X55 A;  4CDF C;  3L0O A;  2A74 C;  3TP7 A;  1W6K A;  4GOP C;  4A3J H;  4IN3 A;  4P73 A;  4A3D G;  3MTS A;  3OIP A;  4BS9 A;  2R7Z B;  5IWA Q;  2B2V C;  2XWB B;  4MHE A;  4A4I A;  3CME A;  5EQ0 A;  1E2Z A;  3N6R A;  1Q1B A;  3BDO A;  1T9H A;  3BYY B;  3S16 H;  1V9P A;  3HS0 C;  1UE1 A;  2QIL A;  1BO0 A;  1PYW D;  4N9P A;  3GTQ B;  1TKW B;  1HNX Q;  1ESR A;  4KI0 A;  3R2I A;  4HR7 B;  5EBC A;  2CW0 D;  1RCV D;  4KHZ A;  3OW7 A;  2VUM G;  4C3H B;  3JAM i;  4EQP A;  4KD4 A;  4A3I H;  2QDB A;  2ZT9 C;  1CHQ D;  1GUT A;  1WFQ A;  3T56 B;  2A6E C;  3KDF B;  1B2T A;  1ILP A;  3AFQ A;  1LT3 D;  1TWH B;  1JJC B;  1VQI A;  3G7L A;  1ZEQ X;  3H09 A;  4OHJ A;  4R4C A;  1Y1W B;  2YU9 H;  1Y1V B;  1FNW A;  3RLF A;  2CVR A;  1HA6 A;  4PMC A;  1STN A;  2Z6B A;  4BXX H;  2VQE Q;  1TY2 A;  1Y14 B;  3KLW A;  2ZXR A;  3PUZ A;  5COY A;  4JI0 Q;  2NZO A;  4GLV B;  3RMH A;  4P72 A;  4OIJ A;  3E5S A;  3U4Z A;  3MZ5 A;  1BUV T;  5M5Y H;  1CSQ A;  1OXV A;  3A0J A;  4DR7 L;  2CHB D;  4A3L G;  2EY1 A;  1PFM A;  2QDL A;  4S3S A;  1VQM A;  1PRT B;  1B8A A;  4A3M G;  4FXG C;  2K01 A;  2L5T A;  1PH2 A;  2PZT A;  2B2V A;  3U58 A;  5IOC A;  2F0H A;  4HIO A;  3OW2 A;  3KF8 B;  1Z7T A;  1TQO A;  5I4D A;  5C4Z A;  4IO9 A;  3KFU A;  5IP9 G;  4YY3 L;  1AFP A;  5A2Q E;  2XNA C;  1GHK A;  3GTK B;  5C44 B;  3HEJ A;  2Y0S G;  1LV9 A;  1EY7 A;  4LUZ A;  2I5H A;  5IYC G;  3DM1 A;  3HKZ B;  3WOF A;  4ODG A;  1Q81 C;  1QNK A;  4DV5 L;  1A3V A;  3BVZ A;  3K5L A;  3QOJ A;  2BE5 D;  5M3F G;  1IYJ B;  4K8I A;  4DV7 Q;  4A93 B;  2G9H D;  3S1N B;  2Q2I A;  4K14 A;  1YHA A;  1QZG A;  2I46 A;  1I4X A;  4RA8 A;  3X3N A;  4IFD G;  2B2Y A;  2PQA B;  2K33 A;  3W1G A;  5COR A;  4IPC A;  1VQH A;  1K83 H;  3D4W A;  4HJ9 A;  2QA4 A;  1MSG A;  3RZD H;  3MXN A;  3HOU H;  3NBI A;  3H6M A;  4A3K H;  2JA5 H;  1PH3 A;  3CP0 A;  3GO5 A;  2HD3 A;  3TME A;  1Y8N B;  1CI3 M;  4L5T A;  1KC8 C;  2IY5 B;  2A68 D;  3T1Y L;  1KDC A;  1HZB A;  1JWS D;  1F9Q A;  4LF4 L;  1GUW A;  4TSS A;  3I2Z A;  3ULJ A;  1STE A;  4R1J A;  4DGZ A;  1Y1W H;  2LS0 1;  1Y69 U;  1HJP A;  4CDC C;  2K05 A;  1GOZ A;  3PSI A;  5LL6 S;  1VQO A;  4RKB A;  3I8Z A;  4RMF A;  2AQ2 B;  3HP3 A;  3MXP A;  2Z6K C;  4DV2 Q;  1D6E C;  5IIF A;  4AQY Q;  4JPB W;  4WJ3 M;  1BKB A;  3KUP A;  3GTJ H;  3DWQ A;  3HKS A;  3HKZ G;  2K7V A;  4BY1 G;  4P2C B;  1TS3 A;  3MXN B;  2RDH A;  2B2U A;  3S14 B;  5C44 G;  3CCJ A;  4G4K A;  5ELF A;  4DR1 L;  1Q46 A;  2XRQ D;  3PF4 A;  1L1O A;  3HOX H;  2N8N A;  2Q2U A;  2F4V Q;  4HJ5 A;  1JOO A;  1A0I A;  2Q2H A;  2DY7 A;  4RFB A;  4FF3 A;  3HOV G;  2EYF A;  1ZXT A;  3DWA A;  3DHQ A;  4OX9 L;  4C3J B;  5FLM G;  4DAY A;  1HZA A;  4N8X 1;  1GO3 E;  2CQA A;  1CA5 A;  2IWH A;  3SEB A;  5ELC A;  2KBN A;  4A3M H;  3PO2 G;  1PTO B;  4DR5 Q;  4ZKC B;  3H3V C;  1T5X D;  2OQ0 A;  5JVH 3;  1Z9F A;  3GP7 A;  1WCM H;  1D5X C;  3OYY A;  4X3S A;  3F1Z A;  1B53 A;  1HFN A;  3S1Q H;  1C9O A;  3QG1 A;  2DJG C;  2N88 A;  3LWE A;  4I65 A;  1B70 B;  1G29 1;  2GN5 A;  4E6I A;  5C3E H;  2R93 H;  1S72 A;  2EYJ A;  2R61 A;  3G71 A;  4DV4 Q;  2SEB D;  1EWC A;  1L1O C;  4KY6 A;  5FO9 B;  1PMR A;  1PRT C;  3E6Z X;  1D7Q A;  4X3T A;  1U4L A;  2VQE L;  2B3G A;  4HSP A;  4IUU A;  2AUK A;  3W3A A;  1N9W A;  3AU7 A;  3LX0 A;  4UAI A;  1ICW A;  2XN9 C;  1BVS A;  3HKZ E;  3KF6 A;  4H7B A;  1VQA A;  1EQT A;  1CKO A;  1XX8 A;  3VYS A;  4J8Q A;  4GOP A;  3K59 A;  1WD1 A;  5F2D A;  4A3F B;  1PTO D;  2Q8T A;  1EOT A;  5FK9 C;  5C4H A;  1ESF A;  1U0L A;  3OTO Q;  3S17 H;  2UXB L;  2FXQ A;  1JWU D;  4GS3 A;  3F8T A;  3NPP A;  4UP7 A;  2C9O A;  1RTO A;  4X64 Q;  4XQQ A;  3S1M H;  3L9A X;  2G9D A;  3E0E A;  4KJO A;  4ALP A;  1DJR D;  1MI2 A;  5E1F A;  1WTO A;  2VXW A;  3M4O H;  2F3I A;  3I73 A;  2HT1 A;  5D3D A;  2IX1 A;  2PNR C;  4ABN A;  2UUC L;  4EQO A;  3NQI A;  4OO1 H;  4DV6 Q;  1WYD A;  2K5H A;  2ZTC A;  1HA5 A;  3KLS A;  4PMB A;  3ZYY X;  4GN4 B;  2A5H A;  5IYB H;  1G51 A;  2R92 H;  4F88 A;  4HIM A;  4DR3 Q;  2F0J A;  4BWG B;  1H9M A;  3A8J E;  2L55 A;  3E3X A;  4U67 3;  1AZQ A;  3PO3 B;  4QUF A;  1LAB A;  3VYT A;  1B7Y B;  4DV4 L;  1G6P A;  1VQ5 A;  1NY4 A;  4BBR H;  1IW7 D;  3GV3 A;  1E0B A;  3KBX A;  5ELB A;  3CAM A;  3MWY W;  2LY7 A;  2NVQ H;  1VMP A;  2AMC B;  2JEA I;  4DV0 Q;  1S40 A;  4JI2 L;  4DR4 L;  4XXE A;  1NSN S;  3NTI A;  1BNZ A;  3VA5 A;  4RGT A;  4X62 Q;  1TS2 A;  4AYB E;  1JE4 A;  4LAA A;  3T1H L;  2RDF A;  2F52 A;  3NK9 A;  1HQR D;  2YTY A;  3CRL C;  5HY6 A;  3STB C;  3PIO 3;  4DV2 L;  1GUO A;  3FPU B;  1NBW A;  2RDG A;  2VB3 X;  4DV3 Q;  2CWP A;  1H9J A;  4CKC A;  3HZX A;  4HCE A;  2SOB A;  3SK6 A;  1GUS A;  1PH1 A;  1LTG D;  1KTK A;  3RR5 A;  1ET9 A;  3NWS A;  3NE5 B;  1RTN A;  4B08 A;  1V1O A;  3QOL A;  4XTC S;  4RH6 A;  4DK0 A;  2R3Z A;  2Z4H A;  4DK3 C;  2UU9 Q;  3KF6 B;  2EXZ A;  2J0T D;  3NTH A;  4J15 A;  3S1R B;  2Q8R E;  1MJC A;  2V1C C;  4KTA A;  1JOQ A;  1Z6H A;  4C56 C;  4KY5 A;  4LNQ A;  5KIX A;  1N34 L;  2I5M X;  4QF4 A;  4OIK A;  4NXN Q;  3K0Y A;  1CM9 A;  2VUM H;  3G4S A;  3GTL H;  1I6H B;  2HIV A;  4X65 Q;  4OL7 A;  2L0C A;  1KRS A;  2R6G A;  2HQL A;  5C5M A;  3NUC A;  4A93 H;  1XMQ L;  4IUT A;  3IFD A;  2HDL A;  3U4V A;  5IP7 H;  4A3B G;  1RHP A;  3DEP A;  1TWC H;  4NB3 A;  5A35 A;  2PZU A;  1N32 L;  1DZ1 A;  1W2B A;  5CR3 A;  5EKI A;  3T1Y Q;  1SN8 A;  2ZJP A;  5C0X I;  2R7F A;  2L4N A;  1XPR A;  4A76 A;  1B50 A;  4O42 A;  5GAH C;  4CJ2 C;  3O13 A;  2KEC A;  1PXU A;  4LF6 Q;  1JB7 A;  4A3D H;  3W1B A;  4G57 A;  5C3E B;  2A8V A;  2R93 B;  5C4J H;  4DKA C;  2N49 A;  3CRK C;  4A3J G;  1HR0 L;  4P74 A;  2OTJ A;  1M8A A;  4AYB B;  2VB2 X;  3MAQ A;  2X6L A;  1N8R C;  1O7Z A;  4BA1 I;  2VY3 A;  2D0P A;  5IT9 E;  1OTC A;  1Y8O B;  1QWY A;  3TBI B;  4C1N K;  2GA4 B;  1QVG A;  4NXN L;  2NZ1 D;  1NMF A;  4P75 A;  1O7L A;  1EYD A;  5FLX c;  1FNU A;  3NBH B;  4LFC L;  2IPK D;  4C2M H;  4LUV A;  3GTJ B;  1O7Y A;  1Z47 A;  3A7L A;  3KF8 A;  4HIK A;  4GKK L;  1TWA B;  1BDO A;  3TQY A;  2MNA A;  4DR3 L;  3NP8 A;  3QB3 A;  1AZP A;  3GTO H;  1VQC A;  2AWN A;  3L2P A;  5H1S E;  4IOA A;  1EU3 A;  3D0F A;  2RSO A;  4UP8 A;  5CYU A;  2A6H D;  3BZK A;  1C7Y A;  4QUC A;  1SAP A;  3PF5 A;  2RSN A;  1SNP A;  4F7X A;  4OO1 I;  2F0S A;  4PQX A;  3G6J B;  4O1N A;  4ID6 A;  3S15 B;  1BOS A;  1TT2 A;  3K57 A;  1TWA H;  1IYV A;  5JJL A;  1Y8P B;  2EY6 A;  2NYZ D;  4C3J H;  4X64 L;  3EIV A;  1STH A;  4C3I G;  1B44 D;  3K7U C;  3CPW A;  1I50 H;  4B3M Q;  3CQZ H;  3UE0 A;  1LTL A;  3FMC A;  3PGZ A;  4HED A;  1BBX C;  2ENB A;  2K75 A;  5AJ3 Q;  2RCF A;  3BG3 A;  1N36 L;  4IQZ A;  1HNX L;  1QE6 A;  5C4X G;  1CQV A;  2F03 A;  1HUM A;  2JQO A;  2NN6 H;  5GRO A;  3S2H H;  2PNH A;  4ZLT F;  1JIC A;  2WB1 B;  5IT9 L;  2L15 A;  5IWA L;  3HOZ G;  5JJI A;  3PUY A;  3ERQ A;  4RHS A;  3KLR A;  2ZM6 Q;  1K9M C;  4YWM A;  2K6A A;  4YCV A;  4HJ7 A;  2HCC A;  3K6O A;  1HXY D;  2PI2 E;  4ZK9 B;  5CMD A;  4PV1 C;  1IKL A;  1LTR D;  1EY4 A;  2MPM A;  2QKI C;  3KJP A;  4DV6 L;  1F9P A;  1KD1 C;  1XTC D;  2N78 A;  2F0M A;  1TWC B;  2YTV A;  4UDU C;  4ZRZ A;  4JV5 L;  2K14 A;  3CPF A;  2UUC Q;  4X6A H;  3SHL A;  1IBM Q;  5IOD A;  2YTX A;  5EJW A;  2Y0S E;  5IGF A;  4JI5 L;  1U5K A;  3F2C A;  5FLM H;  5GAE C;  3E9H A;  1MJE A;  4CGY B;  2D0O A;  4V0B A;  1X3G A;  2F0F A;  2A68 C;  3J80 L;  4GN3 B;  1FGB D;  3C3L A;  4LFB Q;  1SYF A;  4X3U A;  1YIT A;  3PUV A;  3TEH B;  2CQO A;  2SNM A;  3VDY A;  3GV6 A;  3OWE B;  2UXC Q;  1O7I A;  3V96 A;  4DR2 Q;  4RGM A;  4DR6 L;  3DWP A;  1JOK A;  1G6Z A;  1IBL Q;  3K8A A;  2R92 G;  3NEM A;  1S5B D;  4DNR B;  1SR3 A;  3QO2 A;  3ERO A;  3BZC A;  1CSP A;  5JEA G;  1ROD A;  3PMF A;  3MEF A;  1KRT A;  3D31 A;  2JA8 H;  1LT6 D;  1ILQ A;  2PYK A;  4ZYS A;  3PIP 3;  3VR6 A;  4CBV A;  4PZ6 A;  1DOK A;  3E9I A;  3M85 A;  4H13 C;  4DUY L;  3H15 A;  4AQY L;  1EY8 A;  4MN3 A;  3VR4 A;  1EUJ A;  5LMN Q;  2KCM A;  2HIX A;  4A3F H;  3Q24 A;  2IT1 A;  2XRS D;  3UDX A;  3H0G B;  4JW0 A;  4K5X A;  1JOR A;  2LSS A;  1T5E A;  2F0E A;  2VZA A;  4FP5 D;  2F0P A;  3JAM E;  4HID A;  2ICE C;  2OEO A;  5M5W H;  3GDE A;  4LF7 Q;  5C4J B;  5CV4 A;  1KDB A;  3DEO A;  2LMC B;  1SRU A;  2WFW A;  4IUQ A;  3CCE A;  1E2W A;  1VQJ A;  1X6O A;  1DD2 A;  2UUA L;  4IJH A;  2VNU D;  2L12 A;  3NEL A;  3J81 c;  4X3K A;  3TSS A;  1W3S A;  3P20 A;  1LT5 D;  3ULL A;  4QMG A;  4IPD A;  2F0O A;  3V05 A;  3QWN A;  5A2Q L;  3J7A 5;  2RKS A;  4AIM A;  3HOZ B;  1Q7Y C;  1AN8 A;  2WB1 G;  3RN5 A;  1B4O A;  3NHH A;  4H0L C;  3I72 A;  1F2Z A;  3G6E A;  4L8J A;  4I7A A;  1EY0 A;  3ND9 A;  2QW7 A;  4R9W A;  1HNZ Q;  3M3Y H;  4K2K A;  3GTO B;  4GNX B;  3HOY H;  4A3G G;  2EXD A;  3HOZ H;  4V19 0;  2ZTD A;  1AW7 A;  5HUR A;  2E2I H;  1Q8K A;  5DM7 3;  4CJ0 B;  1KDA A;  4U68 A;  1SMX A;  1HUN A;  1SBB B;  5BR8 Q;  2MFI A;  3I4M H;  5IGD A;  5DM6 3;  1HNZ L;  4N8F A;  4FDB A;  5FJ8 H;  1E2V A;  3BJU A;  4Q5V A;  2C5C A;  1NMG A;  3HFZ B;  1SYD A;  1I3Q B;  5GAG C;  5C3W A;  5C3X A;  3Q8D A;  3BU2 A;  2Z1C A;  1PH9 A;  2JA5 B;  1Q82 C;  4LUO A;  3C2P A;  1QUQ B;  1R4Q B;  4G7O C;  4ZUJ A;  2TSS A;  4K5V A;  3VR5 A;  2WIN B;  5K36 H;  2E2H B;  4BA2 I;  3DXJ C;  2K04 A;  4QJF A;  2VQF Q;  2JA5 G;  1CUK A;  1SE3 A;  2PQA A;  4F87 A;  2K32 A;  4NMZ A;  3VA7 A;  1J6Q A;  4HJ8 A;  1KL9 A;  3CHB D;  1SDF A;  1PZI D;  1S5E D;  2BA0 A;  2HQE A;  4IFD J;  3I70 A;  4R8N A;  1VQ9 A;  5JVG 3;  2JK8 A;  2VS1 A;  1MHW C;  4JI8 Q;  2R7Z H;  4DFA A;  1WTV A;  2MQH A;  4IAL A;  3J81 L;  1TWF B;  3ERS X;  1KNA A;  5JPM C;  1EU4 A;  4JBK A;  3NBH A;  3T51 B;  2EJF C;  3I91 A;  2JA9 A;  2CKZ B;  1I4Q A;  1STY A;  3VYR A;  2PMZ E;  1VDZ A;  2PZW A;  1H9K A;  2RF4 A;  4JBJ A;  3KOJ A;  1TWF H;  2KHS A;  3UI2 A;  5M5W B;  4R8I A;  1HFG A;  1PYS B;  2EPB A;  4L5Q A;  4Y7N H;  4DUZ Q;  4B9X A;  1WTQ A;  4PG3 A;  4ZKB B;  4JK1 C;  1TU2 B;  2A6H C;  4ZCK A;  3D4D A;  4LK1 C;  3WDN A;  1LO5 D;  4BXX G;  2VW9 A;  5CV5 A;  1VQG A;  3CF5 A;  4KHP Q;  2OF1 A;  4EQN A;  1F9S A;  4ME3 A;  3J80 i;  2ZM6 L;  1H9S B;  2KEN A;  4Q0F A;  3FVQ A;  4IUN A;  5LMU L;  2JXM B;  1YI2 A;  3SXH A;  3CD6 A;  2E5L Q;  4NW2 A;  1ENC A;  1WI5 A;  5C0X H;  3RNU A;  1H95 A;  1A6X A;  4C1N I;  4FVM A;  3GTG B;  1V8Q A;  2NN6 G;  4OO1 G;  3I7F A;  3GTM H;  3R2T A;  2XIW A;  2MHV A;  3CCM A;  5KRU A;  4A3I G;  3D8G A;  5KGU A;  2B2Y C;  2JA7 G;  5AFW A;  1JMC A;  2J7Z A;  1VQD A;  2NVX B;  4BBS G;  5JPN C;  3OSO A;  4UP9 A;  1PZK D;  2E5L L;  3J7A V;  1YHQ A;  5LMU Q;  4A3C G;  5J22 A;  5CBE E;  1JWM D;  2EYP A;  1PFB A;  3GTP H;  2K5Q A;  4M1U B;  5EKL A;  3M4Y A;  3S15 H;  3I3C A;  3P7J A;  4IUP A;  1EL0 A;  3TS2 A;  1QVF A;  4CKB A;  1IHZ A;  2BH8 A;  1BR9 A;  1H9R A;  2DN8 A;  4DUZ L;  3AMU A;  2IHF A;  1IL2 A;  4B3R L;  1CKN A;  3CKI B;  3H0G G;  2N55 A;  5C6A A;  1A3T A;  2DY8 A;  3BVM A;  2F0K A;  2DUD A; 
#chains in the Genus database with same CATH homology
 1M4V A;  3GD7 A;  1DXM A;  2D2C C;  3NSW A;  4Z9C B;  2NN6 I;  2H4O A;  2K5W A;  4FYD A;  1SFO B;  4RAU C;  4FF1 A;  4TQU S;  5KNB A;  3OMG A;  2R92 B;  2RA4 A;  2DNC A;  3A7A B;  3S1Q B;  1CFM A;  1GHJ A;  4DXG A;  1I4R A;  4RGN A;  3K5O A;  1G2T A;  4QIW B;  2Y0S B;  1CQF A;  4QCL A;  2LFN A;  2KA7 A;  3Q6S A;  4KJN A;  2QCP X;  1JCK B;  2O2L D;  1XXG A;  2Z8L A;  1STG A;  3GQB A;  1AEX A;  5T1I A;  2K28 A;  1JB3 A;  2LKV A;  2RQX A;  2K5D A;  4Y7N B;  3NXW A;  1D1I A;  2A6E D;  2I07 B;  4JBW A;  1BCP C;  3M7G A;  1G8Z D;  2EJM A;  2FJ2 A;  5I6W A;  4RCN A;  1TII D;  3T4A C;  2D5D A;  3HG9 A;  1U9R A;  3R3O A;  4ULL A;  5LHY 1;  3GTM B;  2JA8 B;  1EY5 A;  1QB5 D;  4FXD A;  1GUN A;  4K2L A;  3IFT A;  1C48 A;  1U4P A;  4KN4 C;  4XYO A;  3C1F A;  2ICI A;  4C3H G;  3BYT B;  3PO2 B;  3OIQ A;  1I4H A;  2WAQ B;  4F8M A;  2ZXP A;  1EZ6 A;  3TN2 A;  3A55 A;  3C1E A;  4C2M B;  1ENA A;  1QOH A;  4NP5 A;  1R9T B;  5IGC A;  1LT4 D;  2KCN A;  1CTM A;  1DON A;  2KVM A;  3ND8 A;  5G3L F;  1V1P B;  1CHP D;  1PZJ D;  4BY1 B;  3OOC A;  1L0Y B;  2BDO A;  1LTB D;  3BDC A;  1LTI D;  2WKD A;  1S5C D;  1SEB D;  2EJG C;  1U4M A;  5CV6 A;  1JR0 D;  1MSH A;  2AWO A;  3HOX B;  1SMY C;  2SNS A;  1RDP D;  2F0T A;  2HUG A;  3P1H A;  1FNV A;  3K58 A;  2DNE A;  2F0G A;  1XYI A;  2A69 D;  2NB0 A;  2F0D A;  4WRD A;  3Q23 A;  4KHV A;  2B2T A;  1PTO H;  2B2T C;  2ZXO A;  2L11 A;  5CV7 A;  5BN4 A;  5HGT A;  4NDX A;  2JEB I;  2NVY B;  5CV9 A;  4XDX A;  2NUC A;  1KLG D;  4A3B B;  2KEE A;  3MC0 B;  5LL6 X;  2O4X A;  3HRZ C;  1TWG B;  4CKE A;  3I90 A;  5DNF A;  5CC4 A;  2WP8 J;  1S4Z A;  4XYQ A;  2D9U A;  2PPB C;  1EIG A;  1X3Q A;  2QF7 A;  1F2M A;  2E75 C;  4A3I B;  2HDM A;  1SYE A;  5EKK A;  3TZU A;  2YYZ A;  1I6V C;  1IYU A;  3S2H B;  1SYB A;  1QCB D;  2YU9 B;  4IUR A;  4A3M B;  3NQT A;  1LLR D;  1EZ8 A;  1GUG A;  2M9V A;  1DM0 B;  2E74 C;  2RVL A;  5NUC A;  3FKI B;  2E2D C;  4MIU A;  4EGV A;  5M5X B;  3T53 B;  1SSO A;  2MJ8 A;  4FXK C;  4XQN A;  5M5Y B;  3NWT A;  4HAE A;  3AB9 A;  2F0L A;  1HTP A;  1D2B A;  3IKJ A;  1TR5 A;  2NTS A;  3MXU A;  4WFN 3;  1JC7 A;  2FIN B;  3A8K E;  1B1Z A;  3FRP B;  2F0Q A;  5FLX L;  5EPL A;  3X3M A;  2MUY A;  3S17 B;  5D65 A;  1QNU A;  1CZW A;  2JA6 B;  4RHR A;  1IL8 A;  1EWH A;  4FO2 A;  1ZYR C;  1W6J A;  1VMC A;  1EFI D;  4CHT B;  1STA A;  1L0X B;  2F0W A;  1I50 B;  1OO9 B;  1KAB A;  4KN7 C;  1RKN A;  4FF4 A;  1SND A;  1EEF D;  1BCP D;  1ET6 A;  1OXX K;  2QEJ C;  1RD9 D;  4FNF A;  2IX0 A;  4LJZ C;  3QIA A;  3D6W A;  3PUW A;  3I4M B;  2HCI A;  4C3J G;  2K03 A;  3URY A;  4WJW A;  5K36 G;  4IFD H;  5D14 A;  2B8G A;  2MP1 A;  3TP8 A;  3SR1 A;  4XQJ A;  2X69 A;  4TKO B;  2EDG A;  4HN7 A;  3SDZ A;  4XT3 B;  1HQM C;  2O5I C;  2AQ3 B;  3EVQ A;  2BOS A;  1VF7 A;  1PLF A;  3N52 A;  3RUZ A;  4LMQ D;  5C0X J;  4WOR A;  2EZV A;  1PRT D;  5BN5 A;  2B39 A;  1FYC A;  3L7Z C;  3W2D A;  1X3P A;  3BZD B;  3CU7 A;  3EQL C;  1H9S A;  2KOL A;  4PMW A;  1O80 A;  1FD7 D;  3A54 A;  4DF7 A;  1PTO C;  3F2U A;  1TY0 A;  1SXT A;  1MGS A;  3OPO A;  1YNJ C;  2EYL A;  2JSO A;  3FDT A;  3OMC A;  1DOL A;  5ELE A;  2X6G A;  1PRT F;  5J39 A;  5JAV A;  4G7Z C;  2F0V A;  5E4W C;  4DAV A;  1U4R A;  1SMY D;  1V1P A;  5M3F B;  4I7Z C;  1HRJ A;  1MBY A;  3KLS X;  1C8C A;  4QB4 A;  2B2U C;  1SNO A;  3J80 E;  1PTO F;  3V2T A;  1NAP A;  5K5P A;  4RWS C;  1A2T A;  3TZD A;  1D5Z C;  2BA1 A;  1SYC A;  1J8I A;  4OGQ C;  5JEA J;  1K83 B;  1A2U A;  2F1M A;  2B8F A;  3PUX A;  1MD2 D;  4A3K B;  3J81 E;  3S1M B;  2H1E A;  2A69 C;  4GZY C;  2PMZ B;  4J1M A;  5DEH A;  2PW5 A;  1B9N A;  2AQ1 B;  3M3Y B;  4BBS B;  4RKL A;  4ZAI A;  2JA7 B;  1WTP A;  4RCO A;  3RZD B;  2KQ3 A;  3BS1 A;  2E2I B;  4NKL A;  2WAC A;  2NTT A;  3HOW B;  1EY9 A;  1IKM A;  2XSC A;  2EVB A;  4TRD A;  4HMJ A;  1YNN D;  5CBA E;  4DK1 A;  4ILW A;  1R4P B;  4BY7 B;  5G3L D;  2PO4 A;  5C5L A;  4KD3 A;  2KED A;  2NVQ B;  1KAA A;  1Q90 A;  3GTL B;  1ZKO A;  4B9W A;  2VUM B;  4KKU A;  3BVG A;  1KLU D;  4ME5 A;  3IL8 A;  4EVO A;  2AUJ D;  1SNC A;  3SK8 A;  5CGK A;  2M00 A;  2F0U A;  1SNQ A;  3C46 A;  1QJO A;  4IUV A;  4KMU C;  1KNE A;  1TS4 A;  5FKA C;  1CZG A;  3VR2 A;  3I4L A;  1WCM B;  1K8O A;  2XWJ B;  4A3D B;  3L3O C;  2OXP A;  5FLX E;  1JQY D;  2O5J C;  3KK7 A;  1HHV A;  1DOM A;  3NTK A;  3I4N B;  2WII B;  3A56 A;  1WTR A;  2M2L A;  1GXD C;  1LAC A;  2B2W C;  4IFD I;  1ZYR D;  3RZO B;  2JE6 I;  5CV8 A;  1Q12 A;  5KNC A;  5E3F A;  2L9H A;  2PQE A;  3IAY A;  2XVS A;  2FHT A;  2J4X A;  5JJZ A;  1SE4 A;  1TS5 A;  2RBM A;  1SJH D;  2BCO A;  3K5N A;  3HOY B;  1K8M A;  3M4O B;  2IW3 A;  3DMU A;  3EFX D;  2PW7 A;  4J6H A;  4A3G B;  1EEI D;  3SK4 A;  2JYO A;  4KV6 A;  3HOU B;  1EY6 A;  1I4G A;  2NVT B;  3K5M A;  1RJT A;  3T16 A;  2BDN A;  2EY2 A;  1SJE D;  1BCP B;  4K6D A;  5I6Y A;  2FFK B;  3MFY A;  1SNM A;  1NUC A;  1G91 A;  2WKC A;  1FR3 A;  3S2D B;  2K1B A;  2ID0 A;  5IGG A;  1EQV A;  1BCP F;  3T13 A;  3PV0 A;  2KUM A;  3TDQ A;  3Q0A A;  2NBF A;  4K8J A;  1II3 A;  1BXT A;  3MEH A;  4M8A A;  2Q8I B;  5I9O A;  3H91 A;  1OXT A;  1I4P A;  4KKT A;  1YNJ D;  2BE5 C;  1G2S A;  3SVM A;  1WTW A;  3GTP B;  1UNS A;  1HPC A;  2Z4I A;  1OXS C;  3Q22 A;  3OWF A;  4K6L A;  1VCI A;  1WVL A;  5IGB A;  3WOE A;  2TMP A;  4DXF A;  4KY7 A;  4DN4 M;  4KK7 A;  1DYQ A;  2CW0 C;  1STB A;  3EJI A;  1AP0 A;  5ELD A;  1BQQ T;  3DUZ A;  1CK1 A;  2MGS A;  1LTA D;  2JP1 A;  5BN3 A;  1PDQ A;  4HCS A;  1EYA A;  2EY5 A;  4G7H C;  2A73 B;  1ONL A;  3A8I E;  3ITP A;  1F77 A;  3S9W A;  4BBR B;  1DCZ A;  4YIJ A;  5D3I B;  1CT1 D;  3LNN A;  2EOT A;  1WD0 A;  1NR4 A;  1ENF A;  1V43 A;  4FF2 A;  3J7Y W;  5C4X B;  1XWE A;  4HMI A;  2NWG A;  1B3A A;  5IGE A;  3R93 A;  3MXG A;  3U9S A;  4H44 C;  3MA2 B;  4C3I B;  1J9O A;  5M3M B;  4K5W A;  1SYG A;  3OHX C;  5KND A;  1GJX A;  2EYH A;  1X32 A;  3FEW X;  4DNT B;  2F3V A;  5J1Z A;  4ZQ3 A;  3HOV B;  5KYI A;  5I2X A;  1B9M A;  5JOB A;  1EYC A;  5FOB B;  5ISR A;  1S5F D;  4A3E B;  3BDL A;  1BF4 A;  1CA6 A;  5TSS A;  3VR3 A;  3K7A B;  3MFG A;  2F4I A;  3D4R A;  4PNY A;  3ONA B;  3FPP A;  1F2Y A;  5KYL A;  1UUP A;  2WV6 D;  1C4Q A;  2E2J B;  1A3U A;  2KCC A;  3CQZ B;  4A3J B;  4HTH A;  1D5M C;  1LTS D;  2EE1 A;  2B2W A;  5EGT A;  2PCF B;  1LTT D;  1ML0 D;  3D6C A;  4RGO S;  2EYO A;  5M9O A;  1RF2 D;  2E76 C;  4N9T A;  3P75 A;  5EPK A;  2B63 B;  3R8B A;  4DA2 A;  5I9P A;  4ZUI A;  3TP5 A;  1UEA B;  2KJX A;  3EA6 A;  3VYU A;  1HTL D;  2FMM A;  5EPJ A;  3KBG A;  4XIG S;  3S16 B;  2IX3 A;  3J7A F;  2F0N A;  1F9R A;  3M7N A;  1IW7 C;  3LWU A;  4IZ8 A;  3D3R A;  4L63 B;  3SK5 A;  1EIH A;  2L1B A;  5E4X A;  5EBD A;  2FMC A;  2F3W A;  1O78 A;  1Q8I A;  1OXU A;  4XT1 B;  4DAP A;  1F2L A;  3SE0 A;  1YNN C;  2IL8 A;  1UAP A;  1NCV A;  3H94 A;  5DAU A;  2V4D A;  1SE2 A;  1Q3L A;  1A15 A;  5JEA H;  5FO7 B;  1QIL A;  1PFN A;  5C0X G;  4KKS A;  2SDF A;  1HCZ A;  3RD4 A;  3MHB A;  1NR2 A;  1S5D D;  5T1G A;  1D1K A;  5KEE A;  4CJ1 B;  2OT2 A;  3JAM L;  5I2Y A;  4DU9 A;  3E0J A;  1Q1E A;  1TVX A;  2EYM A;  1WTX A;  5FO8 B;  3HGB A;  2F0I A;  2IJ0 A;  1QG7 A;  2D62 A;  4L6T B;  1VF5 C;  4HSV A;  3MVV A;  3QJY A;  3TP6 A;  3U9O A;  2A74 C;  3TP7 A;  1W6K A;  4IN3 A;  3MTS A;  4BS9 A;  3OIP A;  2R7Z B;  2B2V C;  2XWB B;  4MHE A;  5EQ0 A;  1E2Z A;  3N6R A;  1Q1B A;  3BDO A;  3BYY B;  3HS0 C;  2QIL A;  1BO0 A;  1PYW D;  4N9P A;  3GTQ B;  1TKW B;  1ESR A;  4KI0 A;  3R2I A;  4HR7 B;  5EBC A;  2CW0 D;  1RCV D;  4KHZ A;  3OW7 A;  4C3H B;  4EQP A;  4KD4 A;  2QDB A;  2ZT9 C;  1CHQ D;  1GUT A;  3T56 B;  2A6E C;  1B2T A;  1ILP A;  1LT3 D;  1TWH B;  3H09 A;  3G7L A;  1Y1W B;  1ZEQ X;  4OHJ A;  1Y1V B;  1FNW A;  3RLF A;  2CVR A;  1HA6 A;  4PMC A;  1STN A;  1TY2 A;  2ZXR A;  3PUZ A;  5COY A;  3RMH A;  4OIJ A;  3E5S A;  3MZ5 A;  1BUV T;  1OXV A;  2CHB D;  2EY1 A;  1PFM A;  4S3S A;  1PRT B;  4FXG C;  2K01 A;  2L5T A;  2PZT A;  2B2V A;  5IOC A;  2F0H A;  1Z7T A;  1TQO A;  5I4D A;  5C4Z A;  1AFP A;  5A2Q E;  2XNA C;  1GHK A;  3GTK B;  5C44 B;  3HEJ A;  1LV9 A;  1EY7 A;  3DM1 A;  3HKZ B;  3WOF A;  4ODG A;  1QNK A;  1A3V A;  3BVZ A;  3K5L A;  3QOJ A;  2BE5 D;  4K8I A;  4A93 B;  2G9H D;  3S1N B;  4K14 A;  2I46 A;  1I4X A;  4RA8 A;  3X3N A;  4IFD G;  2B2Y A;  2K33 A;  5COR A;  3D4W A;  1MSG A;  3MXN A;  3NBI A;  3H6M A;  3GO5 A;  3TME A;  1Y8N B;  1CI3 M;  2A68 D;  1KDC A;  1JWS D;  1F9Q A;  1GUW A;  4TSS A;  1STE A;  4DGZ A;  2LS0 1;  1Y69 U;  2K05 A;  1GOZ A;  5LL6 S;  4RKB A;  3I8Z A;  2AQ2 B;  3HP3 A;  3MXP A;  1D6E C;  5IIF A;  3KUP A;  3DWQ A;  2K7V A;  4P2C B;  1TS3 A;  2RDH A;  2B2U A;  3S14 B;  4G4K A;  5ELF A;  2XRQ D;  1JOO A;  2DY7 A;  4RFB A;  4FF3 A;  2EYF A;  1ZXT A;  3DWA A;  3DHQ A;  4C3J B;  4DAY A;  2CQA A;  1CA5 A;  2IWH A;  3SEB A;  5ELC A;  1PTO B;  4ZKC B;  3H3V C;  1T5X D;  5JVH 3;  3GP7 A;  1D5X C;  4X3S A;  1B53 A;  1HFN A;  3QG1 A;  2N88 A;  3LWE A;  4I65 A;  1G29 1;  4E6I A;  2EYJ A;  2R61 A;  2SEB D;  1EWC A;  4KY6 A;  5FO9 B;  1PMR A;  1PRT C;  3E6Z X;  4X3T A;  1U4L A;  4HSP A;  4IUU A;  2AUK A;  3W3A A;  3AU7 A;  4UAI A;  3LX0 A;  1ICW A;  2XN9 C;  4H7B A;  1EQT A;  1XX8 A;  3VYS A;  4J8Q A;  3K59 A;  1WD1 A;  5F2D A;  4A3F B;  1PTO D;  2Q8T A;  1EOT A;  5FK9 C;  5C4H A;  1ESF A;  1JWU D;  3NPP A;  2C9O A;  1RTO A;  4XQQ A;  3L9A X;  2G9D A;  4KJO A;  1DJR D;  1MI2 A;  5E1F A;  1WTO A;  2VXW A;  3I73 A;  2IX1 A;  5D3D A;  2PNR C;  4ABN A;  4EQO A;  3NQI A;  4OO1 H;  4PMB A;  1HA5 A;  3KLS A;  3ZYY X;  2A5H A;  4F88 A;  2F0J A;  4BWG B;  1H9M A;  3A8J E;  2L55 A;  4U67 3;  1AZQ A;  3PO3 B;  4QUF A;  1LAB A;  3VYT A;  1IW7 D;  3GV3 A;  1E0B A;  3KBX A;  5ELB A;  3MWY W;  2LY7 A;  1VMP A;  2JEA I;  4XXE A;  1NSN S;  3NTI A;  1BNZ A;  3VA5 A;  4RGT A;  1TS2 A;  1JE4 A;  4LAA A;  2RDF A;  3NK9 A;  1HQR D;  3CRL C;  3PIO 3;  1GUO A;  3FPU B;  2RDG A;  2VB3 X;  1H9J A;  4CKC A;  3HZX A;  4HCE A;  2SOB A;  3SK6 A;  1GUS A;  1LTG D;  1KTK A;  1ET9 A;  3NWS A;  3NE5 B;  1RTN A;  4B08 A;  1V1O A;  3QOL A;  4XTC S;  4RH6 A;  4DK0 A;  2R3Z A;  2Z4H A;  2EXZ A;  2J0T D;  3NTH A;  3S1R B;  2Q8R E;  4KTA A;  1JOQ A;  1Z6H A;  4C56 C;  4KY5 A;  5KIX A;  4QF4 A;  4OIK A;  3K0Y A;  1CM9 A;  1I6H B;  4OL7 A;  2L0C A;  2R6G A;  5C5M A;  3NUC A;  4IUT A;  3IFD A;  2HDL A;  1RHP A;  3DEP A;  5A35 A;  2PZU A;  1DZ1 A;  5CR3 A;  5EKI A;  5C0X I;  2L4N A;  1B50 A;  4O42 A;  4CJ2 C;  3O13 A;  2KEC A;  1PXU A;  4G57 A;  5C3E B;  2R93 B;  3CRK C;  1M8A A;  4AYB B;  2VB2 X;  3MAQ A;  2X6L A;  1O7Z A;  4BA1 I;  5IT9 E;  1Y8O B;  1QWY A;  3TBI B;  4C1N K;  2GA4 B;  2NZ1 D;  1O7L A;  1EYD A;  1FNU A;  2IPK D;  3GTJ B;  1O7Y A;  1Z47 A;  3A7L A;  3KF8 A;  1TWA B;  1BDO A;  3NP8 A;  3QB3 A;  1AZP A;  2AWN A;  1EU3 A;  2RSO A;  5CYU A;  2A6H D;  4QUC A;  1SAP A;  2RSN A;  1SNP A;  4F7X A;  4OO1 I;  2F0S A;  4PQX A;  3G6J B;  4O1N A;  4ID6 A;  3S15 B;  1BOS A;  1TT2 A;  3K57 A;  1IYV A;  1Y8P B;  2EY6 A;  2NYZ D;  1STH A;  4C3I G;  1B44 D;  3FMC A;  4HED A;  1BBX C;  2ENB A;  3BG3 A;  4IQZ A;  1QE6 A;  1CQV A;  2F03 A;  1HUM A;  2NN6 H;  4ZLT F;  1JIC A;  2WB1 B;  5IT9 L;  3PUY A;  3ERQ A;  4RHS A;  3KLR A;  2K6A A;  2HCC A;  3K6O A;  1HXY D;  4ZK9 B;  5CMD A;  4PV1 C;  1IKL A;  1LTR D;  1EY4 A;  2MPM A;  2QKI C;  1F9P A;  1XTC D;  2F0M A;  1TWC B;  4UDU C;  4ZRZ A;  3SHL A;  5IOD A;  5EJW A;  5IGF A;  4CGY B;  4V0B A;  2F0F A;  2A68 C;  3J80 L;  1FGB D;  3C3L A;  1SYF A;  4X3U A;  3PUV A;  2SNM A;  3GV6 A;  3OWE B;  3V96 A;  4RGM A;  3DWP A;  1JOK A;  1G6Z A;  1S5B D;  4DNR B;  3QO2 A;  3ERO A;  5JEA G;  1ROD A;  3PMF A;  3D31 A;  1LT6 D;  1ILQ A;  2PYK A;  4ZYS A;  3PIP 3;  3VR6 A;  4CBV A;  1DOK A;  3M85 A;  4H13 C;  1EY8 A;  4MN3 A;  3VR4 A;  3Q24 A;  2IT1 A;  2XRS D;  3H0G B;  4K5X A;  1JOR A;  1T5E A;  2F0E A;  4FP5 D;  2F0P A;  3JAM E;  2ICE C;  2OEO A;  5C4J B;  5CV4 A;  1KDB A;  2LMC B;  3DEO A;  4IUQ A;  1E2W A;  1DD2 A;  2VNU D;  2L12 A;  4X3K A;  3TSS A;  3P20 A;  1LT5 D;  4QMG A;  2F0O A;  3V05 A;  3QWN A;  5A2Q L;  2RKS A;  3HOZ B;  1AN8 A;  1B4O A;  3NHH A;  4H0L C;  3I72 A;  1F2Z A;  4L8J A;  1EY0 A;  3ND9 A;  4R9W A;  4K2K A;  3GTO B;  4V19 0;  1AW7 A;  5HUR A;  5DM7 3;  4CJ0 B;  1KDA A;  4U68 A;  1HUN A;  1SBB B;  5IGD A;  5DM6 3;  1E2V A;  4Q5V A;  2C5C A;  1SYD A;  1I3Q B;  5C3W A;  5C3X A;  2Z1C A;  2JA5 B;  3C2P A;  1R4Q B;  4G7O C;  4ZUJ A;  2TSS A;  4K5V A;  3VR5 A;  2WIN B;  5K36 H;  2E2H B;  4BA2 I;  3DXJ C;  2K04 A;  1SE3 A;  4F87 A;  2K32 A;  4NMZ A;  3VA7 A;  3CHB D;  1SDF A;  1PZI D;  1S5E D;  2BA0 A;  2HQE A;  4IFD J;  3I70 A;  4R8N A;  5JVG 3;  4DFA A;  1WTV A;  4IAL A;  3J81 L;  1TWF B;  1KNA A;  5JPM C;  1EU4 A;  3NBH A;  3T51 B;  2EJF C;  3I91 A;  1I4Q A;  1STY A;  3VYR A;  1VDZ A;  2PZW A;  1H9K A;  2KHS A;  3UI2 A;  5M5W B;  4R8I A;  1HFG A;  2EPB A;  4B9X A;  1WTQ A;  4ZKB B;  4JK1 C;  1TU2 B;  2A6H C;  3D4D A;  4LK1 C;  3WDN A;  1LO5 D;  5CV5 A;  2OF1 A;  4EQN A;  1F9S A;  1H9S B;  4Q0F A;  3FVQ A;  4IUN A;  2JXM B;  3SXH A;  4NW2 A;  1ENC A;  5C0X H;  1A6X A;  4C1N I;  4FVM A;  3GTG B;  1V8Q A;  2NN6 G;  4OO1 G;  3R2T A;  2XIW A;  2MHV A;  5KRU A;  3D8G A;  5KGU A;  2B2Y C;  5AFW A;  2J7Z A;  2NVX B;  5JPN C;  3OSO A;  1PZK D;  3J7A V;  5J22 A;  5CBE E;  1JWM D;  2EYP A;  1PFB A;  2K5Q A;  4M1U B;  5EKL A;  3M4Y A;  3I3C A;  3P7J A;  4IUP A;  1EL0 A;  4CKB A;  1IHZ A;  1BR9 A;  1H9R A;  2DN8 A;  3AMU A;  3CKI B;  2N55 A;  5C6A A;  1A3T A;  2DY8 A;  3BVM A;  2F0K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...