2F0UA

Crystal structure of staphylococcal nuclease mutant v23i/l25i/i72v
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTIKIMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKVEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Staphylococcal nuclease
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0uA00
3NP8A 4OL7A 2F0TA 2KQ3A 4KY7A 5C5MA 5E1FA 2F0DA 5IODA 1SYCA 2F0VA 2OXPA 4K8IA 2PZUA 5HGTA 1JOQA 3NHHA 3SR1A 1A3VA 3MZ5A 4KJNA 4N9TA 5KYIA 4J1MA 1F2ZA 4KJOA 5DEHA 3QB3A 2RKSA 1NSNS 1EY7A 4EVOA 4ID6A 1EYAA 4ME5A 1EY8A 2ENBA 3NXWA 2PQEA 1SYBA 4K8JA 3U9OA 1SNPA 5HURA 4KY5A 4PMCA 1KAAA 5M9OA 5JOBA 3R3OA 3NUCA 2EYOA 3D4WA 4H7BA 5CV8A 4IALA 2PW7A 1KDAA 4HMIA 1SYGA 1RKNA 2F0MA 2F0HA 4KY6A 3TP5A 5CV6A 3NK9A 1SNCA 5IIFA 4NDXA 5CGKA 4EQNA 4WRDA 3TP8A 5J39A 1U9RA 2EYMA 4TRDA 4DGZA 2PZTA 2PZWA 1JORA 1EY5A 3EROA 5K5PA 4NMZA 2F0QA 3OWFA 4DF7A 4IUNA 5C6AA 1IHZA 4QF4A 2EY6A 3OMGA 3D6CA 5IGGA 5NUCA 1A2TA 1EY4A 2EXZA 3NQTA 3P75A 4K5VA 4IZ8A 1TQOA 1NUCA 1A2UA 3DMUA 3OMCA 5J1ZA 5C3WA 1EZ6A 3D4DA 4K2LA 4F8MA 4RKLA 3SK6A 2EYLA 4NKLA 1EY9A 3D8GA 2F0IA 3MXPA 5KEEA 1EY6A 4PNYA 4LAAA 1SNDA 1STGA 2SNMA 2F0SA 4ZQ3A 4K5WA 1KDCA 4ODGA 5ISRA 3LX0A 2PW5A 5CC4A 1STAA 3BDLA 5IGEA 2F3WA 4J6HA 5KRUA 5KYLA 5I9OA 2EY5A 4EQPA 5I6YA 2LKVA 2EYFA 4YIJA 2F0PA 2NUCA 4B9XA 1STYA 2EY2A 5IGCA 2HQEA 4EQOA 4DU9A 2F0WA 2M00A 4QMGA 1SNOA 2WACA 1F2YA 5EKKA 5C4ZA 4S3SA 3TP7A 1EYCA 3OSOA 1STBA 3QOJA 4KV6A 5IGBA 2F0KA 2EYPA 4KTAA 5IOCA 5EKLA 1EQVA 3TP6A 4ZUJA 3VA5A 4K14A 5C4HA 1STHA 3SHLA 3SK5A 5J22A 2F3VA 1SNQA 4K5XA 1ENAA 3TMEA 4NP5A 1SNMA 4RKBA 1SYEA 4KHVA 3E5SA 3SXHA 1EZ8A 2EYHA 1STNA 4QB4A 1KABA 5CV4A 5F2DA 3S9WA 2KHSA 3BDCA 2OF1A 5C3XA 3QOLA 3T13A 2SOBA 2EYJA 2F0JA 2PYKA 3P1HA 5DAUA 1TR5A 2QDBA 5I6WA 3V2TA 4PMBA 1AEXA 4DFAA 2RBMA 4B9WA 3PMFA 2OEOA 2F0EA 3EVQA 1II3A 2F0GA 4K6DA 4MIUA 2EY1A 5E3FA 3SK4A 3C1FA 3HEJA 4K2KA 2F0UA 2O4XA 5KIXA 1ENCA 1EYDA 5KGUA 1TT2A 4KD4A 3T16A 3C1EA 4HTHA 4KD3A 3MHBA 4R8NA 5IGDA 5EGTA 1JOOA 4HMJA 4ZUIA 3HZXA 4N9PA 2F0LA 3MVVA 4I65A 2SNSA 4WORA 5CV9A 1F2MA 4F7XA 1A3TA 3H6MA 1KDBA 1SYFA 5CV7A 5CV5A 5C5LA 5IGFA 1JOKA 3DHQA 4G57A 5JAVA 3MEHA 4E6IA 3SK8A 3EJIA 2F0NA 3ERQA 5I9PA 1SYDA 2F0FA 3RUZA 1EY0A 5CR3A 3ITPA 2F0OA 2RDFA 1A3UA
chains in the Genus database with same CATH superfamily
4KY7A 2R93H 1NY4A 3L9AX 5E1FA 3FRPB 1J5EL 5M5XB 4IJHA 1PTOF 3KDFB 2A69D 1ESRA 2R7DA 1LTLA 5JJZA 4KJNA 2A69C 1KLGD 2UUAL 4X6AH 1JQYD 1LT4D 2IX3A 5C0XI 5C44H 1BOSA 4DUYQ 3A74A 4I7ZC 2B39A 4QIWE 3DEPA 5D3IB 2KCMA 2RSOA 2HHHL 2D9UA 4HMIA 3VYRA 4AYBB 2E5LL 3E0EA 4LF9L 4LF6Q 3AYHB 3Q23A 4QY7A 3MFYA 1S5ED 1M1KC 1HZBA 1VQHA 2R92B 4YCUA 5EKIA 3K0XA 5LMUL 1A2UA 4FNFA 5E4WC 1X6OA 1UE1A 1UE5A 1KXLA 1EY6A 1FVIA 3OTOL 2PI2A 3LX0A 1W2BA 4OIKA 1JJ2A 2B63G 2FMCA 1SFOB 2ZTDA 1M90C 2HQEA 3I4NH 3NWSA 3I72A 2K28A 2WFWA 3H94A 3M4QA 3SDZA 5C4XH 1O7LA 4RMFA 2FFKB 1F9QA 1CK1A 4OONA 4KHVA 4XYOA 3E9HA 4CJ0B 3RLNA 2KHSA 2CKZB 5TSSA 4QCLA 2PYKA 1X9NA 4DPGA 3TS2A 1EOVA 1X55A 3ULJA 4MIUA 2LXJA 1QUQA 4HJ7A 4BXXH 2WAQG 5IP7H 3HEJA 2G9DA 3TZDA 2O5IC 1G2TA 1EYDA 1K0SA 3VYSA 2LSSA 4KD3A 5M5WB 4A3BG 1JOOA 1PH7A 2XTIA 4L5SA 1VQ8A 2JA5H 1I6HB 3I56A 1PYSB 2K05A 4YWKA 3F2BA 1MJCA 1QVGA 3J7AV 3MXNB 2Q8RE 2Q2HA 5I9PA 1F9SA 1TWFB 2FHTA 3RR5A 2F0OA 1CQVA 5BR8L 3NENA 1JOQA 3NHHA 4DV6L 3SR1A 2K5QA 5DEHA 4X3TA 1PLFA 5HURA 5E4XA 1HCZA 3GTKB 3S1QH 2HD3A 3PUXA 3UE1A 4JI1L 4OWWB 3S2HB 4H7BA 3DLLA 1AH9A 1K0RA 2ASBA 2PCFB 1NE3A 3BG3A 1CSPA 5DM63 3I70A 2F0HA 3NK9A 1SNCA 4QUFA 4RGOS 2K75A 4DGZA 2BH8A 2JA6G 2NVYH 5T1GA 1O7YA 1Y8NB 2WV6D 5M3MG 1PTOB 3HOUB 1KLUD 4GKKL 3A55A 2F3IA 1CA6A 2PI2E 5CYUA 3NE5B 2UXDL 2MP1A 4NKLA 1LUZA 4IO9A 1LYLA 4PNYA 1HHVA 1LT5D 1SJED 4LAAA 4ZQ3A 1HNZQ 2MNAA 4X64L 3M85A 4DUZQ 1FGBD 5C3EB 5IGEA 4JI3Q 1XWEA 1TXYA 4IQZA 1HQRD 4A3DH 3RZOB 3HOXG 2AHOB 1RF2D 3NBIA 2RDHA 2QDLA 1VQCA 3K7UC 4B3MQ 2F3VA 2B2WA 2DUDA 4GOPA 1OXVA 1PH8A 2CH4A 1HA6A 2NVQB 5CV4A 2VQFL 5M3FH 1S4ZA 5KNDA 2EJMA 2DNCA 4GLAC 1HJPA 4IURA 3EVQA 1N33Q 2VNUD 2UXBQ 1VQBA 5IYCG 3IFDA 4WJ3M 2KCCA 1C7YA 4LFAQ 3JAME 1VQLA 4N9PA 1X3FA 2X6GA 1AW7A 4WORA 2B29A 5JEAG 1F2MA 2X69A 4G57A 3S17B 2JEBI 2EDGA 3RD4A 4FVMA 5CR3A 2K33A 3NP8A 2M2LA 4NW2A 3KF8B 4JBMA 2NN6H 3PF5A 3PCOB 3CQZH 1OXUA 1IXRA 4HSVA 3G4SA 2NTTA 5IT9L 3IL8A 4X3UA 1SSOA 4UP7A 1TY0A 5IWAL 4GN4B 4KN7C 1JB3A 1SNPA 2E2IH 2AWOA 1KAAA 4QIWB 5C0XH 3M3YB 1VQ6A 1FNVA 4V190 2AUKA 2N55A 5FJ8H 2C5CA 3TP5A 3SGIA 1OXSC 3KLSA 5J39A 4UHVA 3PO3G 4RGMA 4LFCQ 2MGSA 1MGSA 4IFDI 3EROA 2E5LQ 3Q6SA 4AQYL 2B2TC 4AH6A 5I2YA 4LUZA 5G3LF 4GNXB 2F0IA 5LMUQ 2UXCL 2SNMA 1EYGA 3CP0A 1JB7A 4EGVA 2MJ8A 3S15B 5CC4A 2J7ZA 4XT1B 4J6HA 3KLWA 1SMXA 1QZHA 4A3KH 2VZAA 3VR5A 2CCZA 3PO3B 2C35B 2XWBB 3TEHB 1SNOA 4B3SQ 3KK7A 3GD7A 1AE3A 2OQKA 5ELOA 3GTMB 2VB3X 1B8AA 4A3GB 3CCEA 3RLFA 3SXHA 4Q5VA 5JJKA 1LM0A 2Y0SG 4LF5Q 3Q0AA 5JEAJ 3S24A 3QOLA 1WOCA 4R4OA 3CMAA 1VQPA 1UEAB 1B9NA 2MHVA 2L11A 5CMDA 2RBMA 1XMQL 3HOWH 1CZWA 2JSOA 2O4XA 3ND8A 5C4JH 1O7ZA 5FLXE 4JYAL 2B2VC 2KHJA 5LMNW 1ET6A 1ZEQX 1EIGA 4ZUIA 5M5YH 4IOCA 1H9SB 3NQIA 5CV9A 2E2DC 2NB0A 5IGFA 3EJIA 3K7AB 1AZPA 3R93A 1YJ9A 1X65A 3CCMA 1V8QA 1K83H 1TWAH 1BBXC 1WCMB 1D5ZC 4GN5A 2AKWB 4QQBX 1SYCA 4JC0A 1CT1D 2D5DA 4HAEA 1HQMC 3A5UA 5EQ0A 3A0JA 1FJGL 1B3AA 1HUMA 5BR8Q 1EY7A 1EYAA 4H13C 3H0GG 5IP9G 4BWGB 1GUOA 4PMCA 1WTVA 1S5DD 3RN2A 3I2ZA 2J4XA 3A54A 5JJLA 1WD1A 1V1PA 4RG1A 2LY7A 4IALA 3EBEA 4KMUC 4BBRB 1SYGA 4CDFC 1EUJA 3S1NB 1K28A 3SEBA 2GVAA 4IPCA 4A3EG 1K8GA 1GHJA 1EWHA 5K5PA 2NVTB 3EIVA 1PH3A 2N49A 4BY7H 4OIJA 1OO9B 4XT3B 5C3WA 3F2UA 3MEFA 4K2LA 1Q46A 4M1UB 2NYZD 2R7FA 4X3SA 3MXPA 1KRTA 1GHKA 1NMFA 1NMGA 1IYVA 4DKAC 4K5WA 4FO2A 2UXDQ 1C8CA 4LF6L 1K3RA 4DR7Q 1BCPD 4PZ7A 1IL8A 1Y14B 2QGQA 1BCPC 1NNXA 3HOVH 3WOEA 3TN2A 4OO1I 2EYPA 3ZYYX 3KJOA 2VXWA 1I5FA 5IOCA 4HJ9A 1PRTF 1SDFA 5C4HA 1CKNB 1BO0A 3J80i 4ZCKA 3VDYA 3HOZH 4A3IG 5DNFA 2OF1A 1B1ZA 1CZGA 1LTID 3Q8DA 1PH4A 1X3EA 2OEOA 2F0EA 3I4MB 2VQFQ 4BY1H 2DGYA 2EY1A 3TRZA 3SK4A 2D2CC 1H9RA 1ENFA 4ILWA 3PIO3 3I55A 5CORA 4K6LA 1NCVA 4PQXA 3UDGA 5FLMH 4IUPA 4DR4Q 1ILPA 1PHJA 1MJEA 3VYUA 1S72A 1I4GA 2YYZA 3VA7A 1XMOQ 1ML0D 3BS1A 1A6XA 4A3JH 4C3HG 1K8OA 4JVZA 4O1NA 1D2BA 3T1YQ 3GV3A 1LV9A 3L0OA 2RDFA 2XRQD 1F9RA 4A3FB 2VUMG 1ICFB 1PV4A 2UUBQ 2K03A 2VS1A 1PA6A 4KLKA 1QOHA 3TZUA 1AE2A 3PUWA 5KYIA 4BBSG 2N78A 1R9TB 1W6JA 1TWCB 4OWXB 3CCJA 3KBXA 3K59A 1GM5A 2WINB 2PQEA 1WI5A 5JVH3 2E2JH 4J15A 1DCZA 1RL2A 3J7AF 3KFUA 1RTNA 1MSGA 2NZOA 4C3HB 3V96A 3A56A 5IWAQ 2PQAA 2EYOA 2CVRA 2F52A 4A3MH 4JBWA 1TWHH 1UEBA 4NDXA 4X65Q 3FHWA 2YU9H 2VUMB 3KLRA 2A6ED 1HNXQ 1UUPA 2SDFA 5EBCA 2A6EC 4RGTA 4FXKC 4K5VA 3J81c 4IFDH 1NUCA 5E7NA 3CF5A 1BF4A 4DXGA 3GTJB 1A0IA 2OT2A 4ZAIA 3Q22A 4AQYQ 1PH1A 2R93G 3I8ZA 3GTLH 1GXDC 1D8LA 4H0LC 2NZ1D 1SE8A 2UXCQ 4EQPA 4IUTA 1P8LA 1HR0Q 1E1TA 3E3XA 5C44G 4C1NI 3E9IA 2L9HA 2N8NA 4KN4C 2F0KA 3V05A 1WTWA 1EQVA 1BUVT 4IUUA 1VQOA 1SLJA 3TSSA 1STEA 5FO9B 5ELEA 1SYEA 2VY3A 1PZID 3MA2B 2Q8TA 4JI3L 1IYUA 2XN9C 3BDCA 3PUVA 3AQQA 4CJ2C 3CKIB 4DFAA 5LHY1 2RSNA 4K6DA 1ONLA 3G6JB 1IZ6A 5EJWA 2CQOA 3C1FA 4K2KA 1WJJA 1S5CD 2JA7B 1XMQQ 3C1EA 4CDCC 4U68A 4HSPA 3CCVA 1XPUA 4A93G 1KRSA 4JYAQ 3PIPA 2R6GA 1PRTB 5JAVA 1EFWA 2FJ2A 4P72A 4H02A 3I4NG 3I90A 4WFN3 2UXBL 2A74C 3CC2A 2KBNA 4CBVA 1J8IA 4EQ5A 4KHZA 2VQEQ 2QW7A 4J1MA 1YIJA 5IYBH 1Y1WH 3GTPB 3NXWA 1PVOA 4A93B 3S1RH 1VQNA 5JOBA 3CCRA 3JAML 1L0YB 2IT1A 3A8JE 1G91A 4A3CH 4BXXG 2OTJA 5IP7G 3PO2H 3VYTA 1FNUA 2HCIA 2L0CA 4DAYA 3S16H 2KENA 1IL2A 1PDQA 1NJIC 2F0QA 4OWTB 2O5JC 2JA5G 1LT6D 5NUCA 1I4HA 1PFSA 3KYHC 1YZ6A 3FKIH 3A8KE 5A2QL 4JI6L 3I3CA 1XPOA 1N36L 3KBGA 1DM0B 1VQDA 1N32L 2B2TA 3S2DB 1SNDA 3A8IE 4F87A 4LFCL 4A4IA 3AEVA 3I4OA 4LFBL 1Y1VG 2BE5D 3EA6A 2DJGC 4GS3A 2BE5C 1KHIA 1I3QH 1QNKA 2ZXRA 3TP7A 2JA5B 3MFGA 1Z47A 5FLXc 5EKLA 4HCEA 1E7ZA 3HKZG 4OO1H 2CWPA 2NBFA 2ZXPA 3RZDH 2GA4B 2QF7A 4RFBA 3T13A 4C3IH 2R7ZH 1IBMQ 5A35A 2VB2X 1B2TA 4B9WA 3LNNA 4B3SL 4FXGC 1Y1VB 4G7ZC 3CAMA 1EIHA 3AFPA 4HTHA 1RHPA 3D4RA 3ZJYC 4ZLTF 1NR2A 2IW3A 2H4OA 4LF5L 2K14A 1TS2A 2ZT9C 3CPWA 5C5LA 3DWPA 3H09A 1U4PA 2E2HB 2B2VA 3MEHA 5AJ3L 3S1MH 1O80A 1EQTA 2WP8J 4A3DG 1SYDA 3WOFA 1EIYB 1A8VA 1JMCA 2B63B 4O0AA 2KUMA 1PTOD 1GD7A 4R4CA 1IW7D 2Q2UA 1XNQQ 5H1SE 3GTGB 1PTOC 5M5XH 1IW7C 2K6AA 2AQ1B 4G4KA 3J7YW 2CWAA 1V1PB 5M3FG 2TSSA 1UNSA 1KD1C 5FLXL 4Q0FA 2Q8IB 4DR5L 1FYCA 1O7IA 4PMWA 3R3OA 3D4WA 3DEOA 1QCBD 1V9PA 1GO3E 2Y0SE 3R2TA 1BDOA 4IUVA 4XQJA 3FMCA 1E22A 3X3NA 4O42A 1U9RA 4CKEA 4R4TA 4TRDA 1X3GA 2B8GA 4POFA 3IRBA 1ASYA 2Z4IA 4DR3L 1KNEA 4A75A 2K7VA 2WAQB 3OWFA 4LW1A 4QF4A 1TS4A 1A2TA 3TBIB 3FDTA 4IZ8A 2R92H 4A3BB 4JI8Q 2IL8A 2NN6G 2DY7A 4XYQA 1L1OA 3BZCA 2BH2A 2YTYA 3BDLA 2XGTA 1ET9A 4DXFA 1SAPA 1QVFA 2F0PA 2I07B 3T56B 2ES2A 1YJWA 2A68D 1QE6A 3ND9A 4KK7A 2M00A 5C4ZA 3O13A 2A68C 2JP1A 4KTAA 5C0XG 2IPKD 2DY8A 5FJ8G 3TMEA 4DR7L 4RKBA 4HN7A 3T1HQ 4C3JH 5JPMC 1SEBD 4QB4A 5C3XA 3D31A 3KF6B 4X3KA 1PH2A 3FP9A 4OGQC 2KHIA 1W6KA 3TS0A 4R4IA 2H1EA 4ZRZA 2JA6B 3W1GA 1UWVA 3W1BA 5IT9c 2KVMA 2E8GA 5M3MB 1K73C 3MXGA 5EGTA 2K5HA 3HZXA 1JJGA 5EPJA 4DNIA 4FDBA 1E2VA 1A3TA 1LTRD 3HP3A 4A3KG 1R4PB 4DR1Q 1LABA 5K36H 4Z9CB 1CHPD 1EY0A 5D65A 3F8TA 1I6HH 2KQ3A 3M9BA 2Z6KA 2VW9A 4DV5L 2LS01 2N3SA 3RN5A 2Z6BA 3AB9A 1GKHA 1LO5D 4DR4L 2Z1CA 1VQMA 2IWHA 4UPAA 1B3QA 1XMOL 3HOXB 1IBLL 2NVXB 3S14B 2RKSA 3R8BA 1VQGA 3J80E 4DV4Q 3MTSA 1VQ7A 2A6HD 3K80C 4OHJA 4MZ9A 4IN3A 4GNXC 3U4ZA 2A6HC 4H44C 3T1YL 1HPCA 5BN4A 1Q81C 1VQ9A 3M4OB 3UE0A 1JICA 4MTNA 3FPUB 3HOWG 5HGQA 3H3VI 1PFMA 2UUBL 3GTKH 1YHBA 4KY6A 4LK1C 3SVMA 3B6YA 4KHPL 1Q7YC 3S2HH 4WRDA 1EU4A 1MD2D 4YY3L 2NZHA 3PSIA 4P2CB 2WKDA 2RQXA 1IHZA 1Z6HA 1ESFA 5IGGA 5A2QE 5ELBA 2L55A 1B9MA 1EZ6A 1OXXK 3AMUA 4JPBW 1PTOH 3HOUH 1VF7A 1I94L 1EY9A 5KEEA 5C0XJ 1STGA 1YHQA 5AFWA 4JOIC 4X65L 3G48A 5FK9C 4JI6Q 1MSHA 4PZ6A 1N36Q 5FO7B 1AN8A 4YCWA 5KYLA 1N32Q 1HRJA 1HNXL 1X56A 4KKTA 5D3DA 2IY5B 5C3EH 1F2YA 4LFBQ 1FNWA 2DN8A 3CCUA 3RZOH 3K0YA 1K9MC 3K8AA 2VL6A 2Q2TA 2QA4A 1T5EA 1W3SA 4BA2I 1SNQA 3I7FA 4NP5A 1I4RA 1SNMA 3ULPA 1WTQA 1HR0L 2MFIA 4PMBA 2NVQH 4BY7G 1J9OA 4XIGS 2DNEA 2UU9L 1U5KA 4DR2L 3BDOA 4TKOB 5KIXA 2XVSA 2K1BA 4A3LH 4V0BA 3KDFA 4HMJA 4J8QA 1U4LA 1V1QA 4DNRB 3C2PA 1KTKA 1KDBA 2K5NA 2GVBA 2BA1A 4K0KL 3GTQB 3H3VC 1KC8C 2E74C 2QCPX 3HOVG 3A7LA 1EEID 5AJ3Q 1C9OA 4BY7B 3K6OA 4DN4M 1GOZA 3C46A 2RF4A 4JG2A 4JI7L 2HUGA 1CKOA 1DONA 3DXJC 3HOZG 2OQ0A 1NSNS 2JA8H 4DV2Q 4FF1A 4JBJA 2I5MX 1QWYA 2YTXA 4XDXA 4BY1G 4KI0A 2XIWA 5GROA 4UY8C 1GJXA 1X3QA 2Y0SB 1WD0A 1BCPF 3FVQA 4DR5Q 1L0XB 5CV6A 5FLMG 5CGKA 2VQEL 3TP8A 1HR0W 3CPFA 3M3YH 4DA2A 1IYJB 3D3RA 4GLXA 1VQ5A 4A3JG 2MO0A 4FXDA 1NR4A 2AUJD 2JN4A 4DR3Q 4GLVB 3T51B 1BQQT 1FL0A 2EE1A 3MWYW 4CJ1B 4DV7L 5G3LD 5T1IA 2EYLA 4XXEA 1XYIA 1B70B 5ELCA 4BY1B 1TKWB 5KRUA 2F3WA 3RLOA 1SMYD 1TU2B 3E6ZX 3S15H 1SMYC 5DM73 1SE3A 4DU9A 2F0WA 1EEFD 5CBEE 3QOJA 5IGBA 4C2MH 4DK3C 4L8JA 2ZJRA 4A3MG 2ZTEA 5J22A 1AP0A 2EPBA 2N88A 3H0GB 1YEZA 3GTMH 4PG3A 1YNND 2EZVA 4A3GH 1YNNC 4JI2Q 3GTOB 1XX8A 1EOTA 3PV0A 1Q1BA 5JVG3 1AEXA 1JE5A 4IFDG 2D0OA 3QG1A 1G6ZA 4JCVE 4A3EB 1HFNA 4R9WA 1FD7D 4KD4A 3ICEA 1WTPA 3J81i 4A3MB 4DAVA 2PNRC 3HKSA 1JT8A 1EIFA 4F7XA 1QILA 3DM1A 1IBML 1NBWA 1QUQB 4OELB 1F9PA 1GVPA 3EN2A 4HJ5A 1HNWQ 2JQOA 4OL7A 3K7AH 1E24A 4FF4A 5IODA 4MTKA 3CCQA 4RGNA 1WCMH 1A3VA 1N8RC 3I91A 1ZKOA 4DV5Q 1Q90A 3HFZB 1I4XA 3KOJA 5LL6S 4HR7B 4DAMA 2MUYA 1IBLQ 2F4VL 1HTPA 2D62A 3HKZE 5KNCA 4X62Q 2QILA 5LL6X 1WVLA 4A3IB 4B3TL 1LTGD 1D1IA 3BVMA 5IIFA 2Z8LA 4ULLA 1XNQL 4RA8A 1TS5A 3H15A 3H3VH 4P73A 4BBRH 2E76C 3GP7A 4N8FA 1BNZA 2LFNA 1QJOA 2B2WC 3S1NH 4KHPQ 1DJRD 1HTLD 4HJAA 4IUQA 4YY3Q 1E0BA 2EXZA 1PH9A 3HOYH 1M4VA 1L1OB 3X3MA 2NVTH 3ONAB 4RH6A 1WTHA 3L7ZC 5BN5A 3KJPA 2HQLA 4FF2A 3QIAA 1YHAA 4RHRA 3T4AC 4HJ8A 2EXDA 2XSCA 4CGYB 3OIPA 4ODGA 4DV0L 5IP9H 1E1OA 1I94Q 1EU3A 4Y7NB 4DR6L 1E2ZA 4A76A 1CTMA 3CC7A 4JK1C 1Y1WG 1RIPA 1L0WA 4WJWA 5EKKA 1DXMA 2K50A 4IFDJ 3L3OC 1EYCA 2WAQE 4BBSB 1XNRL 4JI8L 4A3CG 4U673 2K01A 2KEDA 1PRTD 2EOTA 4IPDA 4CKBA 3PO2G 2JYOA 1PZJD 1Y8OB 3DWAA 1PRTC 3E5SA 1EQQA 1D5MC 2DJFC 2RCNA 1TWGB 4CDDC 3GQBA 1JC7A 4GN3B 2R3ZA 3F1ZA 5EPKA 1ZXTA 1TR5A 1PH5A 1II3A 4MNOA 1IKMA 3PUZA 1AFPA 1DOLA 3FKIG 2BOSA 1D7QA 3I4MH 1VQAA 4JI5L 4GOPB 3S1RB 2RCFA 2UU9Q 3MHBA 1I50B 4QUCA 4R8NA 2ZM6Q 4DR2Q 3K58A 1XJVA 3KUPA 3K5NA 4N8X1 3T1HL 3J80c 1Q82C 3MVVA 4I65A 3QR8A 1Z9FA 2QEJC 3JAMc 3N52A 2R93B 5GADC 5GAEC 4CKCA 4L5QA 3S16B 2F0FA 5EAYA 5JJIA 5I2XA 1KAWA 2K5DA 2KOLA 1VQIA 3R2IA 4K0KQ 2FINB 2E75C 1BBUA 4K8IA 1RD9D 4A3FH 4OO1G 5C44B 1G6PA 1GUTA 4DV1Q 3QB3A 4JI7Q 5IY0A 2ENBA 4DV3L 4DR1L 3BZKA 4C3IG 2R7ZG 1R9TH 1TWCH 1D5XC 1YNJD 3VR2A 3G71A 1OXTA 3CRLC 1CI3M 1LACA 4G7HC 3PQIA 3TQYA 2F0MA 2Q2IA 4NB3A 4C3HH 4GNXA 1PZKD 4EQNA 3ULLA 5C4XG 1Q3LA 1L2FA 1UE6A 4DV4L 4IPGA 3OW7A 4AIMA 1S5BD 3HRZC 2JA9A 3CHBD 4HEDA 2ID0A 4F8MA 4RKLA 2CW0D 4NXML 3J80L 5IYDH 1C4QA 3GTJH 2CW0C 1VQKA 4DV7Q 5BN3A 4YHHL 4X66Q 1ICWA 1STAA 3I4NB 1G291 4TSSA 2M9VA 2A8VA 2EY2A 5C4XB 4JOIA 2OCEA 1WTRA 3C3LA 2EJGC 1SROA 3OSOA 1STBA 3H91A 1DOKA 2LMCB 2B2UC 2G9HD 3OYYA 2F1MA 4B3RQ 3RNUA 2LXKA 2L5TA 4HIOA 3CXCA 2EYHA 4R4QA 1STNA 3K5LA 1KABA 5F2DA 1YJNA 1XPRA 1KIXA 1VMCA 4AYBG 1JJCB 4P75A 2F4IA 2F0JA 3P1HA 2K04A 5DAUA 1QG7A 1S5FD 1IKLA 3V2TA 1GUGA 4JW0A 4APVA 1XXGA 3DM3A 1JWUD 2R92G 1RJTA 3URYA 1ENCA 3NTIA 4HCSA 1IBKQ 2SNSA 2JA7H 3I73A 1K3BC 5CV7A 1K8AC 2B3GA 3QO2A 3SK8A 2K32A 4OX9Q 3RUZA 2CQAA 2K5WA 2F0TA 2JEAI 1PFNA 1E2WA 1FR3A 5HGTA 4L6TB 1BR9A 1Q12A 4N9TA 2JXMB 4CHTB 4KJOA 4C3JG 3S1QB 4P71A 3E0JA 5ELNA 5FO8B 3N6RA 3A7AB 2HIVA 3HKZB 5M9OA 3J7A5 3GTPH 5CV8A 4A93H 2F4VQ 1KDAA 2NVYB 4HIMA 2IX1A 5L37A 3G7LA 1GUWA 1HUNA 4HIDA 1EL0A 2AQ2B 3CRKC 1H95A 4B3TQ 3VR4A 2XRSD 1V43A 4DV2L 4LUOA 4NMZA 2PMZE 4DF7A 4PV1C 2EY6A 1MKHA 5K36G 3TDQA 1WYDA 4C3JB 1TQOA 4QGUA 3DMUA 1DYQA 3D4DA 4LF8Q 1CFMA 1PYBA 2F0SA 1HH2P 4OEMB 2KA7A 4LF7L 1CKNA 5COYA 3NBHA 4A3DB 4DAPA 3S2DH 3EQLC 2I5LX 4GKJQ 1STYA 4DV0Q 4DR6Q 3GO5A 4P74A 1B7YB 2Z9HA 3OHXC 1Q86C 4GZYC 4YWMA 5M3FB 1STHA 3SK5A 1TY2A 2EIFA 1TIID 1XNRQ 2CH4W 2WKCA 1M8AA 1SN8A 2EYJA 4C1NK 2QDBA 4NXNQ 4IOAA 4OXPA 5E3FA 4JV5Q 3NEMA 4LWCA 2V4DA 3HOUG 5I4DA 1Y1VH 1S3OA 1SFOH 1CA5A 1T9HA 3M7GA 3BZDB 1G8ZD 3AFQA 2D0PA 1SR3A 1VS0A 1VQFA 3KLSX 4CDEC 1I6VC 4JI5Q 5CV5A 4JI2L 4E6IA 1TVXA 2HDMA 3WWVA 5J3BA 3TREA 5C3EG 1HA5A 3CQZB 2XNAC 1VQJA 2E2HH 2XWJB 3BYYB 3CD6A 2F0VA 2KECA 1CHQD 3PIP3 5JPNC 2B63H 3LWEA 1F2ZA 4UDUC 2KCTA 2E2IB 2KCNA 1G51A 4L5TA 3GTGH 2EVBA 1MHWC 1WFQA 4K8JA 1WTXA 4DNTB 1YBYA 1N34Q 5M5WH 2OWOA 1HNWL 4DV3Q 1SXTA 4ZKCB 4DK0A 1RKNA 4A3LG 4UP9A 1JE4A 4YCVA 2WB1G 1TWFH 3CW2C 3J81E 1DGSA 3NQTA 3L2PA 2PQAB 4XQQA 2B2YC 1CQFA 4B08A 4X62L 3K81C 1AZQA 4A3KB 4A3BH 4Y52H 4NXMQ 3P7JA 1KQSA 1SE4A 5EPLA 1VQ4A 2LKVA 2JA8G 4RCNA 5IGCA 4YHHQ 3UDFA 4IJLA 2WB1B 4QJFA 2RHQB 4JI0L 1T5XD 1HXYD 3PIOA 5IE8A 1Q1EA 2ZJQA 1J6QA 1EQRA 1BKBA 3P20A 1D1KA 2ZXOA 2A1AA 3BU2A 3HOWB 1SRUA 5I6WA 5C4JB 3BVGA 3UDXA 2TMPA 4PZ8A 2JA8B 2UUCL 3U50C 3U4VA 5M5YB 1J5EQ 3LWUA 2IJ0A 1V1OA 2JA6H 2UUAQ 3OPOA 2MQHA 3G6EA 1K83B 1TWAB 5M3MH 2CFMA 1SYFA 1C0AA 2RA4A 1U4MA 4UP8A 3F2DA 3ER0A 5GQOA 5KNBA 3HGBA 3ITPA 1RODA 2HHHQ 2OXPA 2PZUA 2A5HA 4LF9Q 2ZM6L 1NAPA 5LMNL 1H9KA 1YITA 4ALPA 1X3PA 5EBDA 2JK8A 1Z7TA 3FPPA 4ME5A 4A3GG 3U58A 1SYBA 1PFBA 1GUNA 3HOXH 2NVXH 4KY5A 3S14H 2YTVA 1QVCA 2EJFC 3CC4A 1OTCA 1JR0D 4DK6C 1K8MA 3M4OH 3OTOQ 1HFGA 3S17H 1E3PA 1SBBB 4DV1L 1EY5A 4C2MB 1I4PA 4MN3A 1Y8PB 2PMZB 1X54A 3OMGA 3D6CA 4JI4L 3P75A 2GN5A 5IYCH 2MO1A 3D8GA 2I0QA 2FXQA 3GV6A 2K52A 1WCMG 4DAYB 2JJQA 4L63B 3NSWA 2PW5A 2PO4A 4RCOA 3STBD 5JEAH 2NWGA 1PXUA 1TS3A 2EY5A 3HOVB 5I6YA 4YIJA 3RMHA 3STBC 3M4YA 4LF7Q 1BXTA 2O2LD 1XTCD 3OIQA 4KV6A 4KKSA 3J7ZC 3HOZB 1S40A 2I5HA 1FGUA 4LF4L 1O78A 4X66L 1I4QA 3UDIA 4F88A 1F77A 2B2UA 4KKUA 3S9WA 4BBRG 1GUSA 4WJ4A 4L5RC 1JWSD 1CM9A 1HZCA 3IKJA 1YVCA 3HOYG 2F0GA 3J81j 2G5DA 3BJUA 3K57A 3NWTA 1EFID 3HG9A 3DWQA 4ME3A 3JC66 2KEEA 3W3AA 4B3RL 4A3JB 1PH6A 1F2LA 4DV6Q 3PO3H 3IFTA 3BVZA 5GAHC 1B53A 3H6MA 2ALYB 3DHQA 3M4PA 1DD2A 2B8FA 1QB5D 3DUZA 1A62A 1P16A 4JI1Q 5C5MA 3GTQH 2F0DA 3HOYB 3MXNA 1YNXA 3MZ5A 2E2JB 4IPHA 4DUYL 2WIIB 1IBKL 2ZTCA 4EVOA 1H9JA 1L1OC 1U4RA 1YI2A 1EY8A 3NTHA 2IHFA 2K4KA 1JCKB 1CUKA 2L4NA 3U9OA 1H9MA 4ZK9B 3IAYA 4GKKQ 4R8IA 2HT1A 3BYTB 4OX9L 2V1CC 1BBWA 1LTTD 1TWHB 2NTSA 2IX0A 3VR6A 2YU9B 1RCVD 4FF3A 2EQSA 2PW7A 3AU7A 4TVAB 4AYBE 3I4MG 2RVLA 3HS0C 4X64Q 2EYMA 1WTOA 1Y69U 3D0FA 1PMRA 1KNAA 2PZWA 2R61A 3CCLA 3OOCA 3D6WA 1CSQA 1B4OA 1QZGA 1MIUA 5CBAE 1EY4A 3GTLB 3OMCA 3PUYA 4ZYSA 4LJZC 4ZKBB 4G7OC 4O2DA 1NTGA 2BA0A 3NBHB 1MBYA 3MXUA 3SK6A 3JAMi 2A19A 4RAUC 3Q24A 1LT3D 3NPPA 4A3FG 1KL9A 2H5XA 5I9OA 2I46A 4B9XA 3KF6A 3M7NA 3NELA 2L12A 3SE0A 4XQNA 5ELDA 4GOPC 1CKMA 4LF8L 3TP6A 1VDZA 3FEWX 4K14A 1N9WA 4FYDA 1ENAA 2Z6KC 4JI0Q 3A5ZB 5HY6A 1EZ8A 1R4QB 1UE7A 3OWEB 2MPMA 4DK1A 4GKJL 3F2CA 3H0GH 3CCSA 3CU7A 3W5OA 5GAGC 4TQUS 4LUVA 5IYBG 1U0LA 1EWIA 1BCPB 5IT9E 3GTOH 1HZ9A 2BDNA 2F0UA 1ZYRD 2HDLA 1TT2A 3QWNA 5IYDG 1VF5C 1ZYRC 3GDEA 2UUCQ 5IGDA 1Q8KA 4A3EH 4JBKA 3T53B 2F0LA 3ERSX 3CMEA 1B50A 1JOKA 2A73B 2HIXA 4RHSA 4NXNL 1SE2A 1LTBD 4FP5D 1DOMA 3K5OA 2ZJPA 4JV5L 1A3UA 4POGA 5FKAC 3VR3A 1Y1WB 4QL5A 1BVSA 3UI2A 1B44D 1ASZA 3KF8A 1VMPA 4ID6A 4LNQA 5LMNQ 2QEXA 3PO2B 2AQ3B 4UAIA 1XTDA 4YWLA 2BCOA 3NUCA 2L15A 4C56C 3WDNA 2KJXA 3LGJA 3OW2A 2HCCA 4RWSC 4A3IH 4I7AA 2PZTA 1JORA 1VCIA 3MAQA 2JA7G 3FKIB 4IUNA 5C6AA 4R1JA 5D14A 5J1ZA 1HNZL 1N34L 5ELFA 1JWMD 4MHEA 2ICIA 1Q8IA 1A15A 2FMMA 4DUZL 4ABNA 4JI4Q 3W2DA 2QKIC 1KDCA 1LTSD 2P5ZX 5ISRA 1YNJC 2B2YA 1HZAA 4M8AA 1I3QB 2L1BA 2AWNA 2X6LA 2EYFA 1RTOA 2BDOA 3K5MA 2NUCA 2K5VA 2OTLA 3MC0B 1DZ1A 4Y7NH 4EQOA 4QMGA 2WACA 4B3ML 4S3SA 1D6EC 3NTKA 1ILQA 1EWCA 4BS9A 2F03A 2VUMH 3RZDB 1A63A 3J81L 1PYWD 4XTCS 3PF4A 4ZUJA 3VA5A 2RDGA 2PPBC 3SHLA 5FOBB 4K5XA 4HIKA 3PGZA 4C3IB 1C48A 4BBSH 2R7ZB 1LLRD 2C9OA 1QNUA 2CHBD 1N33L 2SOBA 4BA1I 2J0TD 4LF4Q 2ICEC 2JE6I 1TWGH 2RHSB 1RDPD 1LTAD 3PMFA 2YV5A 2PNHA 3EFXD 4LFAL 1G2SA 1UAPA 4LMQD 2Z0SA 2Z4HA 1VQEA 4EX5A 2IHEA 5KGUA 2WB1E 3T16A 1MI2A 2ATWA 3S1MB 2SEBD 1FJGQ 5DLQE 4NPSA 2AMCB 1I50H 2F0NA 2NN6I 3ERQA 1SJHD 1X32A 3U9SA 1H9SA 3I4LA 3QJYA
chains in the Genus database with same CATH topology
4KY7A 3L9AX 5E1FA 3FRPB 5M5XB 1PTOF 2A69D 1ESRA 5JJZA 4KJNA 2A69C 1KLGD 1JQYD 1LT4D 2IX3A 5C0XI 1BOSA 4I7ZC 2B39A 3DEPA 5D3IB 2RSOA 2D9UA 4HMIA 3VYRA 4AYBB 3Q23A 3MFYA 1S5ED 2R92B 5EKIA 1A2UA 4FNFA 5E4WC 1EY6A 3LX0A 4OIKA 2FMCA 1SFOB 2HQEA 3NWSA 3I72A 2K28A 3H94A 3SDZA 1O7LA 2FFKB 1F9QA 1CK1A 4KHVA 4XYOA 4CJ0B 2KHSA 5TSSA 4QCLA 2PYKA 4MIUA 3HEJA 2G9DA 3TZDA 2O5IC 1G2TA 1EYDA 3VYSA 4KD3A 5M5WB 1JOOA 1I6HB 2K05A 3J7AV 2Q8RE 5I9PA 1F9SA 1TWFB 2FHTA 2F0OA 1CQVA 1JOQA 3NHHA 3SR1A 2K5QA 5DEHA 4X3TA 1PLFA 5HURA 5E4XA 1HCZA 3GTKB 3PUXA 3S2HB 4H7BA 2PCFB 3BG3A 5DM63 3I70A 2F0HA 3NK9A 1SNCA 4QUFA 4RGOS 4DGZA 5T1GA 1O7YA 1Y8NB 2WV6D 1PTOB 3HOUB 1KLUD 3A55A 1CA6A 5CYUA 3NE5B 2MP1A 4NKLA 1HHVA 4PNYA 1LT5D 1SJED 4LAAA 4ZQ3A 3M85A 1FGBD 5C3EB 5IGEA 1XWEA 4IQZA 1HQRD 3RZOB 1RF2D 3NBIA 2RDHA 2F3VA 2B2WA 1OXVA 1HA6A 2NVQB 5CV4A 1S4ZA 5KNDA 2EJMA 2DNCA 4IURA 3EVQA 2VNUD 3IFDA 2KCCA 3JAME 4N9PA 2X6GA 1AW7A 4WORA 5JEAG 1F2MA 2X69A 4G57A 3S17B 2JEBI 2EDGA 3RD4A 4FVMA 5CR3A 2K33A 3NP8A 2M2LA 4NW2A 2NN6H 1OXUA 4HSVA 2NTTA 5IT9L 3IL8A 4X3UA 1SSOA 1TY0A 4KN7C 1JB3A 1SNPA 2AWOA 1KAAA 4QIWB 5C0XH 3M3YB 1FNVA 4V190 2AUKA 2N55A 2C5CA 3TP5A 1OXSC 3KLSA 5J39A 4RGMA 2MGSA 1MGSA 4IFDI 3EROA 3Q6SA 2B2TC 5I2YA 5G3LF 2F0IA 2SNMA 4EGVA 2MJ8A 3S15B 5CC4A 2J7ZA 4XT1B 4J6HA 3VR5A 3PO3B 2XWBB 1SNOA 3KK7A 3GD7A 3GTMB 2VB3X 4A3GB 3RLFA 3SXHA 4Q5VA 3Q0AA 5JEAJ 3QOLA 1UEAB 1B9NA 2MHVA 2L11A 5CMDA 2RBMA 1CZWA 2JSOA 2O4XA 3ND8A 1O7ZA 5FLXE 2B2VC 1ET6A 1ZEQX 1EIGA 4ZUIA 1H9SB 3NQIA 5CV9A 2E2DC 2NB0A 5IGFA 3EJIA 3K7AB 1AZPA 3R93A 1V8QA 1BBXC 1WCMB 1D5ZC 1SYCA 1CT1D 2D5DA 4HAEA 1HQMC 5EQ0A 1B3AA 1HUMA 1EY7A 1EYAA 4H13C 4BWGB 1GUOA 4PMCA 1WTVA 1S5DD 2J4XA 3A54A 1WD1A 1V1PA 2LY7A 4IALA 4KMUC 4BBRB 1SYGA 3S1NB 3SEBA 1GHJA 1EWHA 5K5PA 2NVTB 4OIJA 1OO9B 4XT3B 5C3WA 3F2UA 4M1UB 4K2LA 2NYZD 4X3SA 3MXPA 1GHKA 1IYVA 4K5WA 4FO2A 1C8CA 1BCPD 1IL8A 1BCPC 3WOEA 3TN2A 4OO1I 2EYPA 3ZYYX 2VXWA 5IOCA 1PRTF 1SDFA 5C4HA 1BO0A 5DNFA 2OF1A 1B1ZA 1CZGA 1LTID 2OEOA 2F0EA 3I4MB 2EY1A 3SK4A 2D2CC 1H9RA 1ENFA 4ILWA 3PIO3 5CORA 4K6LA 1NCVA 4PQXA 1ILPA 4IUPA 3VYUA 1I4GA 2YYZA 3VA7A 1ML0D 3BS1A 1A6XA 4C3HG 1K8OA 4O1NA 1D2BA 3GV3A 1LV9A 2RDFA 2XRQD 1F9RA 4A3FB 2K03A 1QOHA 3TZUA 3PUWA 5KYIA 1R9TB 1W6JA 1TWCB 3KBXA 3K59A 2WINB 2PQEA 5JVH3 1DCZA 3J7AF 1RTNA 1MSGA 4C3HB 3V96A 3A56A 2EYOA 2CVRA 4JBWA 4NDXA 2VUMB 3KLRA 2A6ED 1UUPA 2SDFA 5EBCA 2A6EC 4RGTA 4FXKC 4K5VA 4IFDH 1NUCA 1BF4A 4DXGA 3GTJB 2OT2A 4ZAIA 3Q22A 3I8ZA 1GXDC 4H0LC 2NZ1D 4EQPA 4IUTA 4C1NI 2L9HA 4KN4C 2F0KA 3V05A 1WTWA 1EQVA 1BUVT 4IUUA 3TSSA 1STEA 5FO9B 5ELEA 1SYEA 1PZID 3MA2B 2Q8TA 1IYUA 2XN9C 3BDCA 3PUVA 4CJ2C 3CKIB 4DFAA 5LHY1 2RSNA 4K6DA 1ONLA 3G6JB 5EJWA 3C1FA 4K2KA 1S5CD 2JA7B 3C1EA 4U68A 4HSPA 2R6GA 1PRTB 5JAVA 2FJ2A 3I90A 4WFN3 2A74C 4CBVA 1J8IA 4KHZA 4J1MA 3GTPB 3NXWA 4A93B 5JOBA 3JAML 1L0YB 2IT1A 3A8JE 1G91A 3VYTA 1FNUA 2HCIA 2L0CA 4DAYA 1PDQA 2O5JC 2F0QA 1LT6D 5NUCA 1I4HA 3A8KE 5A2QL 3I3CA 3KBGA 1DM0B 2B2TA 3S2DB 1SNDA 3A8IE 4F87A 2BE5D 3EA6A 2BE5C 1QNKA 2ZXRA 3TP7A 2JA5B 3MFGA 1Z47A 5EKLA 4HCEA 4OO1H 2NBFA 2ZXPA 2GA4B 2QF7A 4RFBA 3T13A 5A35A 2VB2X 1B2TA 4B9WA 3LNNA 4FXGC 1Y1VB 4G7ZC 1EIHA 4HTHA 1RHPA 3D4RA 4ZLTF 1NR2A 2IW3A 2H4OA 1TS2A 2ZT9C 5C5LA 3DWPA 3H09A 1U4PA 2E2HB 2B2VA 3MEHA 1O80A 1EQTA 2WP8J 1SYDA 3WOFA 2B63B 2KUMA 1PTOD 1IW7D 3GTGB 1PTOC 3J7YW 1IW7C 2K6AA 2AQ1B 4G4KA 1V1PB 2TSSA 1UNSA 5FLXL 4Q0FA 2Q8IB 1FYCA 4PMWA 3R3OA 3D4WA 3DEOA 1QCBD 3R2TA 1BDOA 4IUVA 4XQJA 3FMCA 3X3NA 4O42A 1U9RA 4CKEA 4TRDA 2B8GA 2Z4IA 1KNEA 2K7VA 2WAQB 3OWFA 4QF4A 1TS4A 1A2TA 3TBIB 3FDTA 4IZ8A 4A3BB 2IL8A 2NN6G 2DY7A 4XYQA 3BDLA 1ET9A 4DXFA 1SAPA 2F0PA 2I07B 3T56B 2A68D 1QE6A 3ND9A 4KK7A 2M00A 5C4ZA 3O13A 2A68C 2JP1A 4KTAA 5C0XG 2IPKD 2DY8A 3TMEA 4RKBA 4HN7A 5JPMC 1SEBD 4QB4A 5C3XA 3D31A 4X3KA 4OGQC 1W6KA 2H1EA 4ZRZA 2JA6B 2KVMA 5M3MB 3MXGA 5EGTA 3HZXA 5EPJA 1E2VA 1A3TA 1LTRD 3HP3A 1R4PB 1LABA 5K36H 4Z9CB 1CHPD 1EY0A 5D65A 2KQ3A 2LS01 3AB9A 1LO5D 2Z1CA 2IWHA 3HOXB 2NVXB 3S14B 2RKSA 3R8BA 3J80E 3MTSA 2A6HD 4OHJA 4IN3A 2A6HC 4H44C 1HPCA 5BN4A 3M4OB 1JICA 3FPUB 1PFMA 4KY6A 4LK1C 3SVMA 4WRDA 1EU4A 1MD2D 4P2CB 2WKDA 2RQXA 1IHZA 1Z6HA 1ESFA 5IGGA 5A2QE 5ELBA 2L55A 1B9MA 1EZ6A 1OXXK 3AMUA 1PTOH 1VF7A 1EY9A 5KEEA 5C0XJ 1STGA 5AFWA 5FK9C 1MSHA 5FO7B 1AN8A 5KYLA 1HRJA 4KKTA 5D3DA 1F2YA 1FNWA 2DN8A 3K0YA 1T5EA 4BA2I 1SNQA 4NP5A 1I4RA 1SNMA 1WTQA 4PMBA 1J9OA 4XIGS 2DNEA 3BDOA 4TKOB 5KIXA 2XVSA 2K1BA 4V0BA 4HMJA 4J8QA 1U4LA 4DNRB 3C2PA 1KTKA 1KDBA 2BA1A 3GTQB 3H3VC 2E74C 2QCPX 3A7LA 1EEID 4BY7B 3K6OA 4DN4M 1GOZA 3C46A 2HUGA 1DONA 3DXJC 1NSNS 4FF1A 1QWYA 4XDXA 4KI0A 2XIWA 1GJXA 1X3QA 2Y0SB 1WD0A 1BCPF 3FVQA 1L0XB 5CV6A 5CGKA 3TP8A 4DA2A 3D3RA 4FXDA 1NR4A 2AUJD 3T51B 1BQQT 2EE1A 3MWYW 4CJ1B 5G3LD 5T1IA 2EYLA 4XXEA 1XYIA 5ELCA 4BY1B 1TKWB 5KRUA 2F3WA 1SMYD 1TU2B 3E6ZX 1SMYC 5DM73 1SE3A 4DU9A 2F0WA 1EEFD 5CBEE 3QOJA 5IGBA 4L8JA 5J22A 1AP0A 2EPBA 2N88A 3H0GB 1YNND 2EZVA 1YNNC 3GTOB 1XX8A 1EOTA 3PV0A 1Q1BA 5JVG3 1AEXA 4IFDG 3QG1A 1G6ZA 4A3EB 1HFNA 4R9WA 1FD7D 4KD4A 1WTPA 4A3MB 4DAVA 2PNRC 4F7XA 1QILA 3DM1A 1F9PA 4OL7A 4FF4A 5IODA 4RGNA 1A3VA 3I91A 1ZKOA 1Q90A 1I4XA 5LL6S 4HR7B 2MUYA 1HTPA 2D62A 5KNCA 2QILA 5LL6X 1WVLA 4A3IB 1LTGD 1D1IA 3BVMA 5IIFA 2Z8LA 4ULLA 4RA8A 1TS5A 2E76C 3GP7A 1BNZA 2LFNA 1QJOA 2B2WC 1DJRD 1HTLD 4IUQA 1E0BA 2EXZA 1M4VA 3X3MA 3ONAB 4RH6A 3L7ZC 5BN5A 4FF2A 3QIAA 4RHRA 3T4AC 2XSCA 4CGYB 3OIPA 4ODGA 1EU3A 4Y7NB 1E2ZA 1CTMA 4JK1C 4WJWA 5EKKA 1DXMA 4IFDJ 3L3OC 1EYCA 4BBSB 4U673 2K01A 2KEDA 1PRTD 2EOTA 4CKBA 2JYOA 1PZJD 1Y8OB 3DWAA 1PRTC 3E5SA 1D5MC 1TWGB 3GQBA 1JC7A 2R3ZA 5EPKA 1ZXTA 1TR5A 1II3A 1IKMA 1AFPA 3PUZA 1DOLA 2BOSA 3S1RB 3MHBA 1I50B 4QUCA 4R8NA 3K58A 3KUPA 3K5NA 3MVVA 4I65A 2QEJC 3N52A 2R93B 4CKCA 3S16B 2F0FA 5I2XA 2K5DA 2KOLA 3R2IA 2FINB 2E75C 4K8IA 1RD9D 4OO1G 5C44B 1GUTA 3QB3A 2ENBA 4C3IG 1D5XC 1YNJD 3VR2A 1OXTA 3CRLC 1CI3M 1LACA 4G7HC 2F0MA 1PZKD 4EQNA 1Q3LA 3OW7A 1S5BD 3HRZC 3CHBD 4HEDA 2ID0A 4F8MA 4RKLA 2CW0D 3J80L 1C4QA 2CW0C 5BN3A 1ICWA 1STAA 3I4NB 1G291 4TSSA 2M9VA 2EY2A 5C4XB 1WTRA 3C3LA 2EJGC 3OSOA 1STBA 3H91A 1DOKA 2LMCB 2B2UC 2G9HD 2F1MA 2L5TA 2EYHA 1STNA 3K5LA 1KABA 5F2DA 1VMCA 2F4IA 2F0JA 2K04A 3P1HA 5DAUA 1QG7A 1S5FD 1IKLA 3V2TA 1GUGA 1XXGA 1JWUD 1RJTA 3URYA 1ENCA 3NTIA 4HCSA 2SNSA 3I73A 5CV7A 3QO2A 3SK8A 2K32A 3RUZA 2CQAA 2K5WA 2F0TA 2JEAI 1PFNA 1E2WA 1FR3A 5HGTA 4L6TB 1BR9A 1Q12A 4N9TA 2JXMB 4CHTB 4KJOA 4C3JG 3S1QB 3E0JA 5FO8B 3N6RA 3A7AB 3HKZB 5M9OA 5CV8A 1KDAA 2NVYB 2IX1A 3G7LA 1GUWA 1HUNA 1EL0A 2AQ2B 3CRKC 3VR4A 2XRSD 1V43A 4NMZA 4DF7A 4PV1C 2EY6A 5K36G 3TDQA 4C3JB 1TQOA 3DMUA 1DYQA 3D4DA 1CFMA 2F0SA 2KA7A 5COYA 3NBHA 4A3DB 4DAPA 3EQLC 1STYA 3GO5A 3OHXC 4GZYC 5M3FB 1STHA 3SK5A 1TY2A 1TIID 2WKCA 1M8AA 2EYJA 4C1NK 2QDBA 5E3FA 2V4DA 5I4DA 1CA5A 3M7GA 3BZDB 1G8ZD 3KLSX 1I6VC 5CV5A 4E6IA 1TVXA 2HDMA 1HA5A 3CQZB 2XNAC 2XWJB 3BYYB 2F0VA 2KECA 1CHQD 3PIP3 5JPNC 3LWEA 1F2ZA 4UDUC 2E2IB 2KCNA 2EVBA 4K8JA 1WTXA 4DNTB 1SXTA 4ZKCB 4DK0A 1RKNA 1JE4A 3J81E 3NQTA 4XQQA 2B2YC 1CQFA 4B08A 1AZQA 4A3KB 3P7JA 1SE4A 5EPLA 2LKVA 4RCNA 5IGCA 2WB1B 1T5XD 1HXYD 1Q1EA 3P20A 1D1KA 2ZXOA 3HOWB 5I6WA 5C4JB 3BVGA 2TMPA 2JA8B 5M5YB 3LWUA 2IJ0A 1V1OA 3OPOA 1K83B 1TWAB 1SYFA 2RA4A 1U4MA 5KNBA 3HGBA 3ITPA 1RODA 2OXPA 2PZUA 2A5HA 1NAPA 1H9KA 1X3PA 5EBDA 1Z7TA 3FPPA 4ME5A 1SYBA 1PFBA 1GUNA 4KY5A 2EJFC 1JR0D 1K8MA 1HFGA 1SBBB 1EY5A 4C2MB 1I4PA 4MN3A 1Y8PB 2PMZB 3OMGA 3D6CA 3P75A 3D8GA 3GV6A 4L63B 3NSWA 2PW5A 2PO4A 4RCOA 5JEAH 2NWGA 1PXUA 1TS3A 2EY5A 3HOVB 5I6YA 4YIJA 3RMHA 3M4YA 1BXTA 2O2LD 1XTCD 3OIQA 4KV6A 4KKSA 3HOZB 1O78A 1I4QA 4F88A 1F77A 2B2UA 4KKUA 3S9WA 1GUSA 1JWSD 1CM9A 3IKJA 2F0GA 3K57A 3NWTA 1EFID 3HG9A 3DWQA 2KEEA 3W3AA 4A3JB 1F2LA 3IFTA 3BVZA 1B53A 3H6MA 3DHQA 1DD2A 2B8FA 1QB5D 3DUZA 5C5MA 2F0DA 3HOYB 3MXNA 3MZ5A 2E2JB 2WIIB 4EVOA 1H9JA 1U4RA 1EY8A 3NTHA 3IAYA 4ZK9B 1JCKB 2L4NA 3U9OA 1H9MA 4R8IA 3BYTB 1LTTD 1TWHB 2NTSA 2IX0A 3VR6A 2YU9B 1RCVD 4FF3A 2PW7A 3AU7A 2RVLA 3HS0C 2EYMA 1WTOA 1Y69U 1PMRA 1KNAA 2PZWA 2R61A 3OOCA 3D6WA 1B4OA 5CBAE 1EY4A 3GTLB 3OMCA 3PUYA 4ZYSA 4LJZC 4ZKBB 4G7OC 2BA0A 1MBYA 3MXUA 3SK6A 4RAUC 3Q24A 1LT3D 3NPPA 5I9OA 2I46A 4B9XA 3M7NA 2L12A 3SE0A 4XQNA 5ELDA 3TP6A 1VDZA 3FEWX 4K14A 4FYDA 1ENAA 1EZ8A 1R4QB 3OWEB 2MPMA 4DK1A 3CU7A 4TQUS 1BCPB 5IT9E 2BDNA 2F0UA 1ZYRD 2HDLA 1TT2A 3QWNA 1VF5C 1ZYRC 5IGDA 3T53B 2F0LA 1B50A 1JOKA 2A73B 4RHSA 1SE2A 1LTBD 4FP5D 1DOMA 3K5OA 1A3UA 5FKAC 3VR3A 1Y1WB 3UI2A 1B44D 3KF8A 1VMPA 4ID6A 3PO2B 2AQ3B 4UAIA 2BCOA 3NUCA 4C56C 3WDNA 2KJXA 2HCCA 4RWSC 2PZTA 1JORA 1VCIA 3MAQA 3FKIB 4IUNA 5C6AA 5D14A 5J1ZA 5ELFA 1JWMD 4MHEA 2ICIA 1Q8IA 1A15A 2FMMA 4ABNA 3W2DA 2QKIC 1KDCA 1LTSD 5ISRA 1YNJC 2B2YA 4M8AA 1I3QB 2L1BA 2AWNA 2X6LA 2EYFA 1RTOA 2BDOA 3K5MA 2NUCA 1DZ1A 3MC0B 4EQOA 4QMGA 2WACA 4S3SA 1D6EC 3NTKA 1ILQA 1EWCA 4BS9A 2F03A 3RZDB 3J81L 1PYWD 4XTCS 4ZUJA 3VA5A 2RDGA 2PPBC 3SHLA 5FOBB 4K5XA 4C3IB 1C48A 2R7ZB 1LLRD 2C9OA 1QNUA 2CHBD 2SOBA 4BA1I 2J0TD 2ICEC 2JE6I 1RDPD 1LTAD 3PMFA 3EFXD 1G2SA 1UAPA 4LMQD 2Z4HA 5KGUA 3T16A 1MI2A 3S1MB 2SEBD 2F0NA 2NN6I 3ERQA 1SJHD 1X32A 3U9SA 1H9SA 3I4LA 3QJYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NP8 A;  4OL7 A;  2F0T A;  2KQ3 A;  4KY7 A;  5C5M A;  5E1F A;  2F0D A;  5IOD A;  1SYC A;  2F0V A;  2OXP A;  4K8I A;  2PZU A;  5HGT A;  1JOQ A;  3NHH A;  3SR1 A;  1A3V A;  3MZ5 A;  4KJN A;  4N9T A;  5KYI A;  4J1M A;  1F2Z A;  4KJO A;  5DEH A;  3QB3 A;  2RKS A;  1NSN S;  1EY7 A;  4EVO A;  4ID6 A;  1EYA A;  4ME5 A;  1EY8 A;  2ENB A;  3NXW A;  2PQE A;  1SYB A;  4K8J A;  3U9O A;  1SNP A;  5HUR A;  4KY5 A;  4PMC A;  1KAA A;  5M9O A;  5JOB A;  3R3O A;  3NUC A;  2EYO A;  3D4W A;  4H7B A;  5CV8 A;  4IAL A;  2PW7 A;  1KDA A;  4HMI A;  1SYG A;  1RKN A;  2F0M A;  2F0H A;  4KY6 A;  3TP5 A;  5CV6 A;  3NK9 A;  1SNC A;  5IIF A;  4NDX A;  5CGK A;  4EQN A;  4WRD A;  3TP8 A;  5J39 A;  1U9R A;  2EYM A;  4TRD A;  4DGZ A;  2PZT A;  2PZW A;  1JOR A;  1EY5 A;  3ERO A;  5K5P A;  4NMZ A;  2F0Q A;  3OWF A;  4DF7 A;  4IUN A;  5C6A A;  1IHZ A;  4QF4 A;  2EY6 A;  3OMG A;  3D6C A;  5IGG A;  5NUC A;  1A2T A;  1EY4 A;  2EXZ A;  3NQT A;  3P75 A;  4K5V A;  4IZ8 A;  1TQO A;  1NUC A;  1A2U A;  3DMU A;  3OMC A;  5J1Z A;  5C3W A;  1EZ6 A;  3D4D A;  4K2L A;  4F8M A;  4RKL A;  3SK6 A;  2EYL A;  4NKL A;  1EY9 A;  3D8G A;  2F0I A;  3MXP A;  5KEE A;  1EY6 A;  4PNY A;  4LAA A;  1SND A;  1STG A;  2SNM A;  2F0S A;  4ZQ3 A;  4K5W A;  1KDC A;  4ODG A;  5ISR A;  3LX0 A;  2PW5 A;  5CC4 A;  1STA A;  3BDL A;  5IGE A;  2F3W A;  4J6H A;  5KRU A;  5KYL A;  5I9O A;  2EY5 A;  4EQP A;  5I6Y A;  2LKV A;  2EYF A;  4YIJ A;  2F0P A;  2NUC A;  4B9X A;  1STY A;  2EY2 A;  5IGC A;  2HQE A;  4EQO A;  4DU9 A;  2F0W A;  2M00 A;  4QMG A;  1SNO A;  2WAC A;  1F2Y A;  5EKK A;  5C4Z A;  4S3S A;  3TP7 A;  1EYC A;  3OSO A;  1STB A;  3QOJ A;  4KV6 A;  5IGB A;  2F0K A;  2EYP A;  4KTA A;  5IOC A;  5EKL A;  1EQV A;  3TP6 A;  4ZUJ A;  3VA5 A;  4K14 A;  5C4H A;  1STH A;  3SHL A;  3SK5 A;  5J22 A;  2F3V A;  1SNQ A;  4K5X A;  1ENA A;  3TME A;  4NP5 A;  1SNM A;  4RKB A;  1SYE A;  4KHV A;  3E5S A;  3SXH A;  1EZ8 A;  2EYH A;  1STN A;  4QB4 A;  1KAB A;  5CV4 A;  5F2D A;  3S9W A;  2KHS A;  3BDC A;  2OF1 A;  5C3X A;  3QOL A;  3T13 A;  2SOB A;  2EYJ A;  2F0J A;  2PYK A;  3P1H A;  5DAU A;  1TR5 A;  2QDB A;  5I6W A;  3V2T A;  4PMB A;  1AEX A;  4DFA A;  2RBM A;  4B9W A;  3PMF A;  2OEO A;  2F0E A;  3EVQ A;  1II3 A;  2F0G A;  4K6D A;  4MIU A;  2EY1 A;  5E3F A;  3SK4 A;  3C1F A;  3HEJ A;  4K2K A;  2F0U A;  2O4X A;  5KIX A;  1ENC A;  1EYD A;  5KGU A;  1TT2 A;  4KD4 A;  3T16 A;  3C1E A;  4HTH A;  4KD3 A;  3MHB A;  4R8N A;  5IGD A;  5EGT A;  1JOO A;  4HMJ A;  4ZUI A;  3HZX A;  4N9P A;  2F0L A;  3MVV A;  4I65 A;  2SNS A;  4WOR A;  5CV9 A;  1F2M A;  4F7X A;  1A3T A;  3H6M A;  1KDB A;  1SYF A;  5CV7 A;  5CV5 A;  5C5L A;  5IGF A;  1JOK A;  3DHQ A;  4G57 A;  5JAV A;  3MEH A;  4E6I A;  3SK8 A;  3EJI A;  2F0N A;  3ERQ A;  5I9P A;  1SYD A;  2F0F A;  3RUZ A;  1EY0 A;  5CR3 A;  3ITP A;  2F0O A;  2RDF A;  1A3U A; 
#chains in the Genus database with same CATH topology
 4KY7 A;  2R93 H;  1NY4 A;  3L9A X;  5E1F A;  3FRP B;  1J5E L;  5M5X B;  4IJH A;  1PTO F;  3KDF B;  2A69 D;  1ESR A;  2R7D A;  1LTL A;  5JJZ A;  4KJN A;  2A69 C;  1KLG D;  2UUA L;  4X6A H;  1JQY D;  1LT4 D;  2IX3 A;  5C0X I;  5C44 H;  1BOS A;  4DUY Q;  3A74 A;  4I7Z C;  2B39 A;  4QIW E;  3DEP A;  5D3I B;  2KCM A;  2RSO A;  2HHH L;  2D9U A;  4HMI A;  3VYR A;  4AYB B;  2E5L L;  3E0E A;  4LF9 L;  4LF6 Q;  3AYH B;  3Q23 A;  4QY7 A;  3MFY A;  1S5E D;  1M1K C;  1HZB A;  1VQH A;  2R92 B;  4YCU A;  5EKI A;  3K0X A;  5LMU L;  1A2U A;  4FNF A;  5E4W C;  1X6O A;  1UE1 A;  1UE5 A;  1KXL A;  1EY6 A;  1FVI A;  3OTO L;  2PI2 A;  3LX0 A;  1W2B A;  4OIK A;  1JJ2 A;  2B63 G;  2FMC A;  1SFO B;  2ZTD A;  1M90 C;  2HQE A;  3I4N H;  3NWS A;  3I72 A;  2K28 A;  2WFW A;  3H94 A;  3M4Q A;  3SDZ A;  5C4X H;  1O7L A;  4RMF A;  2FFK B;  1F9Q A;  1CK1 A;  4OON A;  4KHV A;  4XYO A;  3E9H A;  4CJ0 B;  3RLN A;  2KHS A;  2CKZ B;  5TSS A;  4QCL A;  2PYK A;  1X9N A;  4DPG A;  3TS2 A;  1EOV A;  1X55 A;  3ULJ A;  4MIU A;  2LXJ A;  1QUQ A;  4HJ7 A;  4BXX H;  2WAQ G;  5IP7 H;  3HEJ A;  2G9D A;  3TZD A;  2O5I C;  1G2T A;  1EYD A;  1K0S A;  3VYS A;  2LSS A;  4KD3 A;  5M5W B;  4A3B G;  1JOO A;  1PH7 A;  2XTI A;  4L5S A;  1VQ8 A;  2JA5 H;  1I6H B;  3I56 A;  1PYS B;  2K05 A;  4YWK A;  3F2B A;  1MJC A;  1QVG A;  3J7A V;  3MXN B;  2Q8R E;  2Q2H A;  5I9P A;  1F9S A;  1TWF B;  2FHT A;  3RR5 A;  2F0O A;  1CQV A;  5BR8 L;  3NEN A;  1JOQ A;  3NHH A;  4DV6 L;  3SR1 A;  2K5Q A;  5DEH A;  4X3T A;  1PLF A;  5HUR A;  5E4X A;  1HCZ A;  3GTK B;  3S1Q H;  2HD3 A;  3PUX A;  3UE1 A;  4JI1 L;  4OWW B;  3S2H B;  4H7B A;  3DLL A;  1AH9 A;  1K0R A;  2ASB A;  2PCF B;  1NE3 A;  3BG3 A;  1CSP A;  5DM6 3;  3I70 A;  2F0H A;  3NK9 A;  1SNC A;  4QUF A;  4RGO S;  2K75 A;  4DGZ A;  2BH8 A;  2JA6 G;  2NVY H;  5T1G A;  1O7Y A;  1Y8N B;  2WV6 D;  5M3M G;  1PTO B;  3HOU B;  1KLU D;  4GKK L;  3A55 A;  2F3I A;  1CA6 A;  2PI2 E;  5CYU A;  3NE5 B;  2UXD L;  2MP1 A;  4NKL A;  1LUZ A;  4IO9 A;  1LYL A;  4PNY A;  1HHV A;  1LT5 D;  1SJE D;  4LAA A;  4ZQ3 A;  1HNZ Q;  2MNA A;  4X64 L;  3M85 A;  4DUZ Q;  1FGB D;  5C3E B;  5IGE A;  4JI3 Q;  1XWE A;  1TXY A;  4IQZ A;  1HQR D;  4A3D H;  3RZO B;  3HOX G;  2AHO B;  1RF2 D;  3NBI A;  2RDH A;  2QDL A;  1VQC A;  3K7U C;  4B3M Q;  2F3V A;  2B2W A;  2DUD A;  4GOP A;  1OXV A;  1PH8 A;  2CH4 A;  1HA6 A;  2NVQ B;  5CV4 A;  2VQF L;  5M3F H;  1S4Z A;  5KND A;  2EJM A;  2DNC A;  4GLA C;  1HJP A;  4IUR A;  3EVQ A;  1N33 Q;  2VNU D;  2UXB Q;  1VQB A;  5IYC G;  3IFD A;  4WJ3 M;  2KCC A;  1C7Y A;  4LFA Q;  3JAM E;  1VQL A;  4N9P A;  1X3F A;  2X6G A;  1AW7 A;  4WOR A;  2B29 A;  5JEA G;  1F2M A;  2X69 A;  4G57 A;  3S17 B;  2JEB I;  2EDG A;  3RD4 A;  4FVM A;  5CR3 A;  2K33 A;  3NP8 A;  2M2L A;  4NW2 A;  3KF8 B;  4JBM A;  2NN6 H;  3PF5 A;  3PCO B;  3CQZ H;  1OXU A;  1IXR A;  4HSV A;  3G4S A;  2NTT A;  5IT9 L;  3IL8 A;  4X3U A;  1SSO A;  4UP7 A;  1TY0 A;  5IWA L;  4GN4 B;  4KN7 C;  1JB3 A;  1SNP A;  2E2I H;  2AWO A;  1KAA A;  4QIW B;  5C0X H;  3M3Y B;  1VQ6 A;  1FNV A;  4V19 0;  2AUK A;  2N55 A;  5FJ8 H;  2C5C A;  3TP5 A;  3SGI A;  1OXS C;  3KLS A;  5J39 A;  4UHV A;  3PO3 G;  4RGM A;  4LFC Q;  2MGS A;  1MGS A;  4IFD I;  3ERO A;  2E5L Q;  3Q6S A;  4AQY L;  2B2T C;  4AH6 A;  5I2Y A;  4LUZ A;  5G3L F;  4GNX B;  2F0I A;  5LMU Q;  2UXC L;  2SNM A;  1EYG A;  3CP0 A;  1JB7 A;  4EGV A;  2MJ8 A;  3S15 B;  5CC4 A;  2J7Z A;  4XT1 B;  4J6H A;  3KLW A;  1SMX A;  1QZH A;  4A3K H;  2VZA A;  3VR5 A;  2CCZ A;  3PO3 B;  2C35 B;  2XWB B;  3TEH B;  1SNO A;  4B3S Q;  3KK7 A;  3GD7 A;  1AE3 A;  2OQK A;  5ELO A;  3GTM B;  2VB3 X;  1B8A A;  4A3G B;  3CCE A;  3RLF A;  3SXH A;  4Q5V A;  5JJK A;  1LM0 A;  2Y0S G;  4LF5 Q;  3Q0A A;  5JEA J;  3S24 A;  3QOL A;  1WOC A;  4R4O A;  3CMA A;  1VQP A;  1UEA B;  1B9N A;  2MHV A;  2L11 A;  5CMD A;  2RBM A;  1XMQ L;  3HOW H;  1CZW A;  2JSO A;  2O4X A;  3ND8 A;  5C4J H;  1O7Z A;  5FLX E;  4JYA L;  2B2V C;  2KHJ A;  5LMN W;  1ET6 A;  1ZEQ X;  1EIG A;  4ZUI A;  5M5Y H;  4IOC A;  1H9S B;  3NQI A;  5CV9 A;  2E2D C;  2NB0 A;  5IGF A;  3EJI A;  3K7A B;  1AZP A;  3R93 A;  1YJ9 A;  1X65 A;  3CCM A;  1V8Q A;  1K83 H;  1TWA H;  1BBX C;  1WCM B;  1D5Z C;  4GN5 A;  2AKW B;  4QQB X;  1SYC A;  4JC0 A;  1CT1 D;  2D5D A;  4HAE A;  1HQM C;  3A5U A;  5EQ0 A;  3A0J A;  1FJG L;  1B3A A;  1HUM A;  5BR8 Q;  1EY7 A;  1EYA A;  4H13 C;  3H0G G;  5IP9 G;  4BWG B;  1GUO A;  4PMC A;  1WTV A;  1S5D D;  3RN2 A;  3I2Z A;  2J4X A;  3A54 A;  5JJL A;  1WD1 A;  1V1P A;  4RG1 A;  2LY7 A;  4IAL A;  3EBE A;  4KMU C;  4BBR B;  1SYG A;  4CDF C;  1EUJ A;  3S1N B;  1K28 A;  3SEB A;  2GVA A;  4IPC A;  4A3E G;  1K8G A;  1GHJ A;  1EWH A;  5K5P A;  2NVT B;  3EIV A;  1PH3 A;  2N49 A;  4BY7 H;  4OIJ A;  1OO9 B;  4XT3 B;  5C3W A;  3F2U A;  3MEF A;  4K2L A;  1Q46 A;  4M1U B;  2NYZ D;  2R7F A;  4X3S A;  3MXP A;  1KRT A;  1GHK A;  1NMF A;  1NMG A;  1IYV A;  4DKA C;  4K5W A;  4FO2 A;  2UXD Q;  1C8C A;  4LF6 L;  1K3R A;  4DR7 Q;  1BCP D;  4PZ7 A;  1IL8 A;  1Y14 B;  2QGQ A;  1BCP C;  1NNX A;  3HOV H;  3WOE A;  3TN2 A;  4OO1 I;  2EYP A;  3ZYY X;  3KJO A;  2VXW A;  1I5F A;  5IOC A;  4HJ9 A;  1PRT F;  1SDF A;  5C4H A;  1CKN B;  1BO0 A;  3J80 i;  4ZCK A;  3VDY A;  3HOZ H;  4A3I G;  5DNF A;  2OF1 A;  1B1Z A;  1CZG A;  1LTI D;  3Q8D A;  1PH4 A;  1X3E A;  2OEO A;  2F0E A;  3I4M B;  2VQF Q;  4BY1 H;  2DGY A;  2EY1 A;  3TRZ A;  3SK4 A;  2D2C C;  1H9R A;  1ENF A;  4ILW A;  3PIO 3;  3I55 A;  5COR A;  4K6L A;  1NCV A;  4PQX A;  3UDG A;  5FLM H;  4IUP A;  4DR4 Q;  1ILP A;  1PHJ A;  1MJE A;  3VYU A;  1S72 A;  1I4G A;  2YYZ A;  3VA7 A;  1XMO Q;  1ML0 D;  3BS1 A;  1A6X A;  4A3J H;  4C3H G;  1K8O A;  4JVZ A;  4O1N A;  1D2B A;  3T1Y Q;  3GV3 A;  1LV9 A;  3L0O A;  2RDF A;  2XRQ D;  1F9R A;  4A3F B;  2VUM G;  1ICF B;  1PV4 A;  2UUB Q;  2K03 A;  2VS1 A;  1PA6 A;  4KLK A;  1QOH A;  3TZU A;  1AE2 A;  3PUW A;  5KYI A;  4BBS G;  2N78 A;  1R9T B;  1W6J A;  1TWC B;  4OWX B;  3CCJ A;  3KBX A;  3K59 A;  1GM5 A;  2WIN B;  2PQE A;  1WI5 A;  5JVH 3;  2E2J H;  4J15 A;  1DCZ A;  1RL2 A;  3J7A F;  3KFU A;  1RTN A;  1MSG A;  2NZO A;  4C3H B;  3V96 A;  3A56 A;  5IWA Q;  2PQA A;  2EYO A;  2CVR A;  2F52 A;  4A3M H;  4JBW A;  1TWH H;  1UEB A;  4NDX A;  4X65 Q;  3FHW A;  2YU9 H;  2VUM B;  3KLR A;  2A6E D;  1HNX Q;  1UUP A;  2SDF A;  5EBC A;  2A6E C;  4RGT A;  4FXK C;  4K5V A;  3J81 c;  4IFD H;  1NUC A;  5E7N A;  3CF5 A;  1BF4 A;  4DXG A;  3GTJ B;  1A0I A;  2OT2 A;  4ZAI A;  3Q22 A;  4AQY Q;  1PH1 A;  2R93 G;  3I8Z A;  3GTL H;  1GXD C;  1D8L A;  4H0L C;  2NZ1 D;  1SE8 A;  2UXC Q;  4EQP A;  4IUT A;  1P8L A;  1HR0 Q;  1E1T A;  3E3X A;  5C44 G;  4C1N I;  3E9I A;  2L9H A;  2N8N A;  4KN4 C;  2F0K A;  3V05 A;  1WTW A;  1EQV A;  1BUV T;  4IUU A;  1VQO A;  1SLJ A;  3TSS A;  1STE A;  5FO9 B;  5ELE A;  1SYE A;  2VY3 A;  1PZI D;  3MA2 B;  2Q8T A;  4JI3 L;  1IYU A;  2XN9 C;  3BDC A;  3PUV A;  3AQQ A;  4CJ2 C;  3CKI B;  4DFA A;  5LHY 1;  2RSN A;  4K6D A;  1ONL A;  3G6J B;  1IZ6 A;  5EJW A;  2CQO A;  3C1F A;  4K2K A;  1WJJ A;  1S5C D;  2JA7 B;  1XMQ Q;  3C1E A;  4CDC C;  4U68 A;  4HSP A;  3CCV A;  1XPU A;  4A93 G;  1KRS A;  4JYA Q;  3PIP A;  2R6G A;  1PRT B;  5JAV A;  1EFW A;  2FJ2 A;  4P72 A;  4H02 A;  3I4N G;  3I90 A;  4WFN 3;  2UXB L;  2A74 C;  3CC2 A;  2KBN A;  4CBV A;  1J8I A;  4EQ5 A;  4KHZ A;  2VQE Q;  2QW7 A;  4J1M A;  1YIJ A;  5IYB H;  1Y1W H;  3GTP B;  3NXW A;  1PVO A;  4A93 B;  3S1R H;  1VQN A;  5JOB A;  3CCR A;  3JAM L;  1L0Y B;  2IT1 A;  3A8J E;  1G91 A;  4A3C H;  4BXX G;  2OTJ A;  5IP7 G;  3PO2 H;  3VYT A;  1FNU A;  2HCI A;  2L0C A;  4DAY A;  3S16 H;  2KEN A;  1IL2 A;  1PDQ A;  1NJI C;  2F0Q A;  4OWT B;  2O5J C;  2JA5 G;  1LT6 D;  5NUC A;  1I4H A;  1PFS A;  3KYH C;  1YZ6 A;  3FKI H;  3A8K E;  5A2Q L;  4JI6 L;  3I3C A;  1XPO A;  1N36 L;  3KBG A;  1DM0 B;  1VQD A;  1N32 L;  2B2T A;  3S2D B;  1SND A;  3A8I E;  4F87 A;  4LFC L;  4A4I A;  3AEV A;  3I4O A;  4LFB L;  1Y1V G;  2BE5 D;  3EA6 A;  2DJG C;  4GS3 A;  2BE5 C;  1KHI A;  1I3Q H;  1QNK A;  2ZXR A;  3TP7 A;  2JA5 B;  3MFG A;  1Z47 A;  5FLX c;  5EKL A;  4HCE A;  1E7Z A;  3HKZ G;  4OO1 H;  2CWP A;  2NBF A;  2ZXP A;  3RZD H;  2GA4 B;  2QF7 A;  4RFB A;  3T13 A;  4C3I H;  2R7Z H;  1IBM Q;  5A35 A;  2VB2 X;  1B2T A;  4B9W A;  3LNN A;  4B3S L;  4FXG C;  1Y1V B;  4G7Z C;  3CAM A;  1EIH A;  3AFP A;  4HTH A;  1RHP A;  3D4R A;  3ZJY C;  4ZLT F;  1NR2 A;  2IW3 A;  2H4O A;  4LF5 L;  2K14 A;  1TS2 A;  2ZT9 C;  3CPW A;  5C5L A;  3DWP A;  3H09 A;  1U4P A;  2E2H B;  2B2V A;  3MEH A;  5AJ3 L;  3S1M H;  1O80 A;  1EQT A;  2WP8 J;  4A3D G;  1SYD A;  3WOF A;  1EIY B;  1A8V A;  1JMC A;  2B63 B;  4O0A A;  2KUM A;  1PTO D;  1GD7 A;  4R4C A;  1IW7 D;  2Q2U A;  1XNQ Q;  5H1S E;  3GTG B;  1PTO C;  5M5X H;  1IW7 C;  2K6A A;  2AQ1 B;  4G4K A;  3J7Y W;  2CWA A;  1V1P B;  5M3F G;  2TSS A;  1UNS A;  1KD1 C;  5FLX L;  4Q0F A;  2Q8I B;  4DR5 L;  1FYC A;  1O7I A;  4PMW A;  3R3O A;  3D4W A;  3DEO A;  1QCB D;  1V9P A;  1GO3 E;  2Y0S E;  3R2T A;  1BDO A;  4IUV A;  4XQJ A;  3FMC A;  1E22 A;  3X3N A;  4O42 A;  1U9R A;  4CKE A;  4R4T A;  4TRD A;  1X3G A;  2B8G A;  4POF A;  3IRB A;  1ASY A;  2Z4I A;  4DR3 L;  1KNE A;  4A75 A;  2K7V A;  2WAQ B;  3OWF A;  4LW1 A;  4QF4 A;  1TS4 A;  1A2T A;  3TBI B;  3FDT A;  4IZ8 A;  2R92 H;  4A3B B;  4JI8 Q;  2IL8 A;  2NN6 G;  2DY7 A;  4XYQ A;  1L1O A;  3BZC A;  2BH2 A;  2YTY A;  3BDL A;  2XGT A;  1ET9 A;  4DXF A;  1SAP A;  1QVF A;  2F0P A;  2I07 B;  3T56 B;  2ES2 A;  1YJW A;  2A68 D;  1QE6 A;  3ND9 A;  4KK7 A;  2M00 A;  5C4Z A;  3O13 A;  2A68 C;  2JP1 A;  4KTA A;  5C0X G;  2IPK D;  2DY8 A;  5FJ8 G;  3TME A;  4DR7 L;  4RKB A;  4HN7 A;  3T1H Q;  4C3J H;  5JPM C;  1SEB D;  4QB4 A;  5C3X A;  3D31 A;  3KF6 B;  4X3K A;  1PH2 A;  3FP9 A;  4OGQ C;  2KHI A;  1W6K A;  3TS0 A;  4R4I A;  2H1E A;  4ZRZ A;  2JA6 B;  3W1G A;  1UWV A;  3W1B A;  5IT9 c;  2KVM A;  2E8G A;  5M3M B;  1K73 C;  3MXG A;  5EGT A;  2K5H A;  3HZX A;  1JJG A;  5EPJ A;  4DNI A;  4FDB A;  1E2V A;  1A3T A;  1LTR D;  3HP3 A;  4A3K G;  1R4P B;  4DR1 Q;  1LAB A;  5K36 H;  4Z9C B;  1CHP D;  1EY0 A;  5D65 A;  3F8T A;  1I6H H;  2KQ3 A;  3M9B A;  2Z6K A;  2VW9 A;  4DV5 L;  2LS0 1;  2N3S A;  3RN5 A;  2Z6B A;  3AB9 A;  1GKH A;  1LO5 D;  4DR4 L;  2Z1C A;  1VQM A;  2IWH A;  4UPA A;  1B3Q A;  1XMO L;  3HOX B;  1IBL L;  2NVX B;  3S14 B;  2RKS A;  3R8B A;  1VQG A;  3J80 E;  4DV4 Q;  3MTS A;  1VQ7 A;  2A6H D;  3K80 C;  4OHJ A;  4MZ9 A;  4IN3 A;  4GNX C;  3U4Z A;  2A6H C;  4H44 C;  3T1Y L;  1HPC A;  5BN4 A;  1Q81 C;  1VQ9 A;  3M4O B;  3UE0 A;  1JIC A;  4MTN A;  3FPU B;  3HOW G;  5HGQ A;  3H3V I;  1PFM A;  2UUB L;  3GTK H;  1YHB A;  4KY6 A;  4LK1 C;  3SVM A;  3B6Y A;  4KHP L;  1Q7Y C;  3S2H H;  4WRD A;  1EU4 A;  1MD2 D;  4YY3 L;  2NZH A;  3PSI A;  4P2C B;  2WKD A;  2RQX A;  1IHZ A;  1Z6H A;  1ESF A;  5IGG A;  5A2Q E;  5ELB A;  2L55 A;  1B9M A;  1EZ6 A;  1OXX K;  3AMU A;  4JPB W;  1PTO H;  3HOU H;  1VF7 A;  1I94 L;  1EY9 A;  5KEE A;  5C0X J;  1STG A;  1YHQ A;  5AFW A;  4JOI C;  4X65 L;  3G48 A;  5FK9 C;  4JI6 Q;  1MSH A;  4PZ6 A;  1N36 Q;  5FO7 B;  1AN8 A;  4YCW A;  5KYL A;  1N32 Q;  1HRJ A;  1HNX L;  1X56 A;  4KKT A;  5D3D A;  2IY5 B;  5C3E H;  1F2Y A;  4LFB Q;  1FNW A;  2DN8 A;  3CCU A;  3RZO H;  3K0Y A;  1K9M C;  3K8A A;  2VL6 A;  2Q2T A;  2QA4 A;  1T5E A;  1W3S A;  4BA2 I;  1SNQ A;  3I7F A;  4NP5 A;  1I4R A;  1SNM A;  3ULP A;  1WTQ A;  1HR0 L;  2MFI A;  4PMB A;  2NVQ H;  4BY7 G;  1J9O A;  4XIG S;  2DNE A;  2UU9 L;  1U5K A;  4DR2 L;  3BDO A;  4TKO B;  5KIX A;  2XVS A;  2K1B A;  4A3L H;  4V0B A;  3KDF A;  4HMJ A;  4J8Q A;  1U4L A;  1V1Q A;  4DNR B;  3C2P A;  1KTK A;  1KDB A;  2K5N A;  2GVB A;  2BA1 A;  4K0K L;  3GTQ B;  3H3V C;  1KC8 C;  2E74 C;  2QCP X;  3HOV G;  3A7L A;  1EEI D;  5AJ3 Q;  1C9O A;  4BY7 B;  3K6O A;  4DN4 M;  1GOZ A;  3C46 A;  2RF4 A;  4JG2 A;  4JI7 L;  2HUG A;  1CKO A;  1DON A;  3DXJ C;  3HOZ G;  2OQ0 A;  1NSN S;  2JA8 H;  4DV2 Q;  4FF1 A;  4JBJ A;  2I5M X;  1QWY A;  2YTX A;  4XDX A;  4BY1 G;  4KI0 A;  2XIW A;  5GRO A;  4UY8 C;  1GJX A;  1X3Q A;  2Y0S B;  1WD0 A;  1BCP F;  3FVQ A;  4DR5 Q;  1L0X B;  5CV6 A;  5FLM G;  5CGK A;  2VQE L;  3TP8 A;  1HR0 W;  3CPF A;  3M3Y H;  4DA2 A;  1IYJ B;  3D3R A;  4GLX A;  1VQ5 A;  4A3J G;  2MO0 A;  4FXD A;  1NR4 A;  2AUJ D;  2JN4 A;  4DR3 Q;  4GLV B;  3T51 B;  1BQQ T;  1FL0 A;  2EE1 A;  3MWY W;  4CJ1 B;  4DV7 L;  5G3L D;  5T1I A;  2EYL A;  4XXE A;  1XYI A;  1B70 B;  5ELC A;  4BY1 B;  1TKW B;  5KRU A;  2F3W A;  3RLO A;  1SMY D;  1TU2 B;  3E6Z X;  3S15 H;  1SMY C;  5DM7 3;  1SE3 A;  4DU9 A;  2F0W A;  1EEF D;  5CBE E;  3QOJ A;  5IGB A;  4C2M H;  4DK3 C;  4L8J A;  2ZJR A;  4A3M G;  2ZTE A;  5J22 A;  1AP0 A;  2EPB A;  2N88 A;  3H0G B;  1YEZ A;  3GTM H;  4PG3 A;  1YNN D;  2EZV A;  4A3G H;  1YNN C;  4JI2 Q;  3GTO B;  1XX8 A;  1EOT A;  3PV0 A;  1Q1B A;  5JVG 3;  1AEX A;  1JE5 A;  4IFD G;  2D0O A;  3QG1 A;  1G6Z A;  4JCV E;  4A3E B;  1HFN A;  4R9W A;  1FD7 D;  4KD4 A;  3ICE A;  1WTP A;  3J81 i;  4A3M B;  4DAV A;  2PNR C;  3HKS A;  1JT8 A;  1EIF A;  4F7X A;  1QIL A;  3DM1 A;  1IBM L;  1NBW A;  1QUQ B;  4OEL B;  1F9P A;  1GVP A;  3EN2 A;  4HJ5 A;  1HNW Q;  2JQO A;  4OL7 A;  3K7A H;  1E24 A;  4FF4 A;  5IOD A;  4MTK A;  3CCQ A;  4RGN A;  1WCM H;  1A3V A;  1N8R C;  3I91 A;  1ZKO A;  4DV5 Q;  1Q90 A;  3HFZ B;  1I4X A;  3KOJ A;  5LL6 S;  4HR7 B;  4DAM A;  2MUY A;  1IBL Q;  2F4V L;  1HTP A;  2D62 A;  3HKZ E;  5KNC A;  4X62 Q;  2QIL A;  5LL6 X;  1WVL A;  4A3I B;  4B3T L;  1LTG D;  1D1I A;  3BVM A;  5IIF A;  2Z8L A;  4ULL A;  1XNQ L;  4RA8 A;  1TS5 A;  3H15 A;  3H3V H;  4P73 A;  4BBR H;  2E76 C;  3GP7 A;  4N8F A;  1BNZ A;  2LFN A;  1QJO A;  2B2W C;  3S1N H;  4KHP Q;  1DJR D;  1HTL D;  4HJA A;  4IUQ A;  4YY3 Q;  1E0B A;  2EXZ A;  1PH9 A;  3HOY H;  1M4V A;  1L1O B;  3X3M A;  2NVT H;  3ONA B;  4RH6 A;  1WTH A;  3L7Z C;  5BN5 A;  3KJP A;  2HQL A;  4FF2 A;  3QIA A;  1YHA A;  4RHR A;  3T4A C;  4HJ8 A;  2EXD A;  2XSC A;  4CGY B;  3OIP A;  4ODG A;  4DV0 L;  5IP9 H;  1E1O A;  1I94 Q;  1EU3 A;  4Y7N B;  4DR6 L;  1E2Z A;  4A76 A;  1CTM A;  3CC7 A;  4JK1 C;  1Y1W G;  1RIP A;  1L0W A;  4WJW A;  5EKK A;  1DXM A;  2K50 A;  4IFD J;  3L3O C;  1EYC A;  2WAQ E;  4BBS B;  1XNR L;  4JI8 L;  4A3C G;  4U67 3;  2K01 A;  2KED A;  1PRT D;  2EOT A;  4IPD A;  4CKB A;  3PO2 G;  2JYO A;  1PZJ D;  1Y8O B;  3DWA A;  1PRT C;  3E5S A;  1EQQ A;  1D5M C;  2DJF C;  2RCN A;  1TWG B;  4CDD C;  3GQB A;  1JC7 A;  4GN3 B;  2R3Z A;  3F1Z A;  5EPK A;  1ZXT A;  1TR5 A;  1PH5 A;  1II3 A;  4MNO A;  1IKM A;  3PUZ A;  1AFP A;  1DOL A;  3FKI G;  2BOS A;  1D7Q A;  3I4M H;  1VQA A;  4JI5 L;  4GOP B;  3S1R B;  2RCF A;  2UU9 Q;  3MHB A;  1I50 B;  4QUC A;  4R8N A;  2ZM6 Q;  4DR2 Q;  3K58 A;  1XJV A;  3KUP A;  3K5N A;  4N8X 1;  3T1H L;  3J80 c;  1Q82 C;  3MVV A;  4I65 A;  3QR8 A;  1Z9F A;  2QEJ C;  3JAM c;  3N52 A;  2R93 B;  5GAD C;  5GAE C;  4CKC A;  4L5Q A;  3S16 B;  2F0F A;  5EAY A;  5JJI A;  5I2X A;  1KAW A;  2K5D A;  2KOL A;  1VQI A;  3R2I A;  4K0K Q;  2FIN B;  2E75 C;  1BBU A;  4K8I A;  1RD9 D;  4A3F H;  4OO1 G;  5C44 B;  1G6P A;  1GUT A;  4DV1 Q;  3QB3 A;  4JI7 Q;  5IY0 A;  2ENB A;  4DV3 L;  4DR1 L;  3BZK A;  4C3I G;  2R7Z G;  1R9T H;  1TWC H;  1D5X C;  1YNJ D;  3VR2 A;  3G71 A;  1OXT A;  3CRL C;  1CI3 M;  1LAC A;  4G7H C;  3PQI A;  3TQY A;  2F0M A;  2Q2I A;  4NB3 A;  4C3H H;  4GNX A;  1PZK D;  4EQN A;  3ULL A;  5C4X G;  1Q3L A;  1L2F A;  1UE6 A;  4DV4 L;  4IPG A;  3OW7 A;  4AIM A;  1S5B D;  3HRZ C;  2JA9 A;  3CHB D;  4HED A;  2ID0 A;  4F8M A;  4RKL A;  2CW0 D;  4NXM L;  3J80 L;  5IYD H;  1C4Q A;  3GTJ H;  2CW0 C;  1VQK A;  4DV7 Q;  5BN3 A;  4YHH L;  4X66 Q;  1ICW A;  1STA A;  3I4N B;  1G29 1;  4TSS A;  2M9V A;  2A8V A;  2EY2 A;  5C4X B;  4JOI A;  2OCE A;  1WTR A;  3C3L A;  2EJG C;  1SRO A;  3OSO A;  1STB A;  3H91 A;  1DOK A;  2LMC B;  2B2U C;  2G9H D;  3OYY A;  2F1M A;  4B3R Q;  3RNU A;  2LXK A;  2L5T A;  4HIO A;  3CXC A;  2EYH A;  4R4Q A;  1STN A;  3K5L A;  1KAB A;  5F2D A;  1YJN A;  1XPR A;  1KIX A;  1VMC A;  4AYB G;  1JJC B;  4P75 A;  2F4I A;  2F0J A;  3P1H A;  2K04 A;  5DAU A;  1QG7 A;  1S5F D;  1IKL A;  3V2T A;  1GUG A;  4JW0 A;  4APV A;  1XXG A;  3DM3 A;  1JWU D;  2R92 G;  1RJT A;  3URY A;  1ENC A;  3NTI A;  4HCS A;  1IBK Q;  2SNS A;  2JA7 H;  3I73 A;  1K3B C;  5CV7 A;  1K8A C;  2B3G A;  3QO2 A;  3SK8 A;  2K32 A;  4OX9 Q;  3RUZ A;  2CQA A;  2K5W A;  2F0T A;  2JEA I;  1PFN A;  1E2W A;  1FR3 A;  5HGT A;  4L6T B;  1BR9 A;  1Q12 A;  4N9T A;  2JXM B;  4CHT B;  4KJO A;  4C3J G;  3S1Q B;  4P71 A;  3E0J A;  5ELN A;  5FO8 B;  3N6R A;  3A7A B;  2HIV A;  3HKZ B;  5M9O A;  3J7A 5;  3GTP H;  5CV8 A;  4A93 H;  2F4V Q;  1KDA A;  2NVY B;  4HIM A;  2IX1 A;  5L37 A;  3G7L A;  1GUW A;  1HUN A;  4HID A;  1EL0 A;  2AQ2 B;  3CRK C;  1H95 A;  4B3T Q;  3VR4 A;  2XRS D;  1V43 A;  4DV2 L;  4LUO A;  4NMZ A;  2PMZ E;  4DF7 A;  4PV1 C;  2EY6 A;  1MKH A;  5K36 G;  3TDQ A;  1WYD A;  4C3J B;  1TQO A;  4QGU A;  3DMU A;  1DYQ A;  3D4D A;  4LF8 Q;  1CFM A;  1PYB A;  2F0S A;  1HH2 P;  4OEM B;  2KA7 A;  4LF7 L;  1CKN A;  5COY A;  3NBH A;  4A3D B;  4DAP A;  3S2D H;  3EQL C;  2I5L X;  4GKJ Q;  1STY A;  4DV0 Q;  4DR6 Q;  3GO5 A;  4P74 A;  1B7Y B;  2Z9H A;  3OHX C;  1Q86 C;  4GZY C;  4YWM A;  5M3F B;  1STH A;  3SK5 A;  1TY2 A;  2EIF A;  1TII D;  1XNR Q;  2CH4 W;  2WKC A;  1M8A A;  1SN8 A;  2EYJ A;  4C1N K;  2QDB A;  4NXN Q;  4IOA A;  4OXP A;  5E3F A;  4JV5 Q;  3NEM A;  4LWC A;  2V4D A;  3HOU G;  5I4D A;  1Y1V H;  1S3O A;  1SFO H;  1CA5 A;  1T9H A;  3M7G A;  3BZD B;  1G8Z D;  3AFQ A;  2D0P A;  1SR3 A;  1VS0 A;  1VQF A;  3KLS X;  4CDE C;  1I6V C;  4JI5 Q;  5CV5 A;  4JI2 L;  4E6I A;  1TVX A;  2HDM A;  3WWV A;  5J3B A;  3TRE A;  5C3E G;  1HA5 A;  3CQZ B;  2XNA C;  1VQJ A;  2E2H H;  2XWJ B;  3BYY B;  3CD6 A;  2F0V A;  2KEC A;  1CHQ D;  3PIP 3;  5JPN C;  2B63 H;  3LWE A;  1F2Z A;  4UDU C;  2KCT A;  2E2I B;  2KCN A;  1G51 A;  4L5T A;  3GTG H;  2EVB A;  1MHW C;  1WFQ A;  4K8J A;  1WTX A;  4DNT B;  1YBY A;  1N34 Q;  5M5W H;  2OWO A;  1HNW L;  4DV3 Q;  1SXT A;  4ZKC B;  4DK0 A;  1RKN A;  4A3L G;  4UP9 A;  1JE4 A;  4YCV A;  2WB1 G;  1TWF H;  3CW2 C;  3J81 E;  1DGS A;  3NQT A;  3L2P A;  2PQA B;  4XQQ A;  2B2Y C;  1CQF A;  4B08 A;  4X62 L;  3K81 C;  1AZQ A;  4A3K B;  4A3B H;  4Y52 H;  4NXM Q;  3P7J A;  1KQS A;  1SE4 A;  5EPL A;  1VQ4 A;  2LKV A;  2JA8 G;  4RCN A;  5IGC A;  4YHH Q;  3UDF A;  4IJL A;  2WB1 B;  4QJF A;  2RHQ B;  4JI0 L;  1T5X D;  1HXY D;  3PIO A;  5IE8 A;  1Q1E A;  2ZJQ A;  1J6Q A;  1EQR A;  1BKB A;  3P20 A;  1D1K A;  2ZXO A;  2A1A A;  3BU2 A;  3HOW B;  1SRU A;  5I6W A;  5C4J B;  3BVG A;  3UDX A;  2TMP A;  4PZ8 A;  2JA8 B;  2UUC L;  3U50 C;  3U4V A;  5M5Y B;  1J5E Q;  3LWU A;  2IJ0 A;  1V1O A;  2JA6 H;  2UUA Q;  3OPO A;  2MQH A;  3G6E A;  1K83 B;  1TWA B;  5M3M H;  2CFM A;  1SYF A;  1C0A A;  2RA4 A;  1U4M A;  4UP8 A;  3F2D A;  3ER0 A;  5GQO A;  5KNB A;  3HGB A;  3ITP A;  1ROD A;  2HHH Q;  2OXP A;  2PZU A;  2A5H A;  4LF9 Q;  2ZM6 L;  1NAP A;  5LMN L;  1H9K A;  1YIT A;  4ALP A;  1X3P A;  5EBD A;  2JK8 A;  1Z7T A;  3FPP A;  4ME5 A;  4A3G G;  3U58 A;  1SYB A;  1PFB A;  1GUN A;  3HOX H;  2NVX H;  4KY5 A;  3S14 H;  2YTV A;  1QVC A;  2EJF C;  3CC4 A;  1OTC A;  1JR0 D;  4DK6 C;  1K8M A;  3M4O H;  3OTO Q;  1HFG A;  3S17 H;  1E3P A;  1SBB B;  4DV1 L;  1EY5 A;  4C2M B;  1I4P A;  4MN3 A;  1Y8P B;  2PMZ B;  1X54 A;  3OMG A;  3D6C A;  4JI4 L;  3P75 A;  2GN5 A;  5IYC H;  2MO1 A;  3D8G A;  2I0Q A;  2FXQ A;  3GV6 A;  2K52 A;  1WCM G;  4DAY B;  2JJQ A;  4L63 B;  3NSW A;  2PW5 A;  2PO4 A;  4RCO A;  3STB D;  5JEA H;  2NWG A;  1PXU A;  1TS3 A;  2EY5 A;  3HOV B;  5I6Y A;  4YIJ A;  3RMH A;  3STB C;  3M4Y A;  4LF7 Q;  1BXT A;  2O2L D;  1XTC D;  3OIQ A;  4KV6 A;  4KKS A;  3J7Z C;  3HOZ B;  1S40 A;  2I5H A;  1FGU A;  4LF4 L;  1O78 A;  4X66 L;  1I4Q A;  3UDI A;  4F88 A;  1F77 A;  2B2U A;  4KKU A;  3S9W A;  4BBR G;  1GUS A;  4WJ4 A;  4L5R C;  1JWS D;  1CM9 A;  1HZC A;  3IKJ A;  1YVC A;  3HOY G;  2F0G A;  3J81 j;  2G5D A;  3BJU A;  3K57 A;  3NWT A;  1EFI D;  3HG9 A;  3DWQ A;  4ME3 A;  3JC6 6;  2KEE A;  3W3A A;  4B3R L;  4A3J B;  1PH6 A;  1F2L A;  4DV6 Q;  3PO3 H;  3IFT A;  3BVZ A;  5GAH C;  1B53 A;  3H6M A;  2ALY B;  3DHQ A;  3M4P A;  1DD2 A;  2B8F A;  1QB5 D;  3DUZ A;  1A62 A;  1P16 A;  4JI1 Q;  5C5M A;  3GTQ H;  2F0D A;  3HOY B;  3MXN A;  1YNX A;  3MZ5 A;  2E2J B;  4IPH A;  4DUY L;  2WII B;  1IBK L;  2ZTC A;  4EVO A;  1H9J A;  1L1O C;  1U4R A;  1YI2 A;  1EY8 A;  3NTH A;  2IHF A;  2K4K A;  1JCK B;  1CUK A;  2L4N A;  3U9O A;  1H9M A;  4ZK9 B;  3IAY A;  4GKK Q;  4R8I A;  2HT1 A;  3BYT B;  4OX9 L;  2V1C C;  1BBW A;  1LTT D;  1TWH B;  2NTS A;  2IX0 A;  3VR6 A;  2YU9 B;  1RCV D;  4FF3 A;  2EQS A;  2PW7 A;  3AU7 A;  4TVA B;  4AYB E;  3I4M G;  2RVL A;  3HS0 C;  4X64 Q;  2EYM A;  1WTO A;  1Y69 U;  3D0F A;  1PMR A;  1KNA A;  2PZW A;  2R61 A;  3CCL A;  3OOC A;  3D6W A;  1CSQ A;  1B4O A;  1QZG A;  1MIU A;  5CBA E;  1EY4 A;  3GTL B;  3OMC A;  3PUY A;  4ZYS A;  4LJZ C;  4ZKB B;  4G7O C;  4O2D A;  1NTG A;  2BA0 A;  3NBH B;  1MBY A;  3MXU A;  3SK6 A;  3JAM i;  2A19 A;  4RAU C;  3Q24 A;  1LT3 D;  3NPP A;  4A3F G;  1KL9 A;  2H5X A;  5I9O A;  2I46 A;  4B9X A;  3KF6 A;  3M7N A;  3NEL A;  2L12 A;  3SE0 A;  4XQN A;  5ELD A;  4GOP C;  1CKM A;  4LF8 L;  3TP6 A;  1VDZ A;  3FEW X;  4K14 A;  1N9W A;  4FYD A;  1ENA A;  2Z6K C;  4JI0 Q;  3A5Z B;  5HY6 A;  1EZ8 A;  1R4Q B;  1UE7 A;  3OWE B;  2MPM A;  4DK1 A;  4GKJ L;  3F2C A;  3H0G H;  3CCS A;  3CU7 A;  3W5O A;  5GAG C;  4TQU S;  4LUV A;  5IYB G;  1U0L A;  1EWI A;  1BCP B;  5IT9 E;  3GTO H;  1HZ9 A;  2BDN A;  2F0U A;  1ZYR D;  2HDL A;  1TT2 A;  3QWN A;  5IYD G;  1VF5 C;  1ZYR C;  3GDE A;  2UUC Q;  5IGD A;  1Q8K A;  4A3E H;  4JBK A;  3T53 B;  2F0L A;  3ERS X;  3CME A;  1B50 A;  1JOK A;  2A73 B;  2HIX A;  4RHS A;  4NXN L;  1SE2 A;  1LTB D;  4FP5 D;  1DOM A;  3K5O A;  2ZJP A;  4JV5 L;  1A3U A;  4POG A;  5FKA C;  3VR3 A;  1Y1W B;  4QL5 A;  1BVS A;  3UI2 A;  1B44 D;  1ASZ A;  3KF8 A;  1VMP A;  4ID6 A;  4LNQ A;  5LMN Q;  2QEX A;  3PO2 B;  2AQ3 B;  4UAI A;  1XTD A;  4YWL A;  2BCO A;  3NUC A;  2L15 A;  4C56 C;  3WDN A;  2KJX A;  3LGJ A;  3OW2 A;  2HCC A;  4RWS C;  4A3I H;  4I7A A;  2PZT A;  1JOR A;  1VCI A;  3MAQ A;  2JA7 G;  3FKI B;  4IUN A;  5C6A A;  4R1J A;  5D14 A;  5J1Z A;  1HNZ L;  1N34 L;  5ELF A;  1JWM D;  4MHE A;  2ICI A;  1Q8I A;  1A15 A;  2FMM A;  4DUZ L;  4ABN A;  4JI4 Q;  3W2D A;  2QKI C;  1KDC A;  1LTS D;  2P5Z X;  5ISR A;  1YNJ C;  2B2Y A;  1HZA A;  4M8A A;  1I3Q B;  2L1B A;  2AWN A;  2X6L A;  2EYF A;  1RTO A;  2BDO A;  3K5M A;  2NUC A;  2K5V A;  2OTL A;  3MC0 B;  1DZ1 A;  4Y7N H;  4EQO A;  4QMG A;  2WAC A;  4B3M L;  4S3S A;  1D6E C;  3NTK A;  1ILQ A;  1EWC A;  4BS9 A;  2F03 A;  2VUM H;  3RZD B;  1A63 A;  3J81 L;  1PYW D;  4XTC S;  3PF4 A;  4ZUJ A;  3VA5 A;  2RDG A;  2PPB C;  3SHL A;  5FOB B;  4K5X A;  4HIK A;  3PGZ A;  4C3I B;  1C48 A;  4BBS H;  2R7Z B;  1LLR D;  2C9O A;  1QNU A;  2CHB D;  1N33 L;  2SOB A;  4BA1 I;  2J0T D;  4LF4 Q;  2ICE C;  2JE6 I;  1TWG H;  2RHS B;  1RDP D;  1LTA D;  3PMF A;  2YV5 A;  2PNH A;  3EFX D;  4LFA L;  1G2S A;  1UAP A;  4LMQ D;  2Z0S A;  2Z4H A;  1VQE A;  4EX5 A;  2IHE A;  5KGU A;  2WB1 E;  3T16 A;  1MI2 A;  2ATW A;  3S1M B;  2SEB D;  1FJG Q;  5DLQ E;  4NPS A;  2AMC B;  1I50 H;  2F0N A;  2NN6 I;  3ERQ A;  1SJH D;  1X32 A;  3U9S A;  1H9S A;  3I4L A;  3QJY A; 
#chains in the Genus database with same CATH homology
 4KY7 A;  3L9A X;  5E1F A;  3FRP B;  5M5X B;  1PTO F;  2A69 D;  1ESR A;  5JJZ A;  4KJN A;  2A69 C;  1KLG D;  1JQY D;  1LT4 D;  2IX3 A;  5C0X I;  1BOS A;  4I7Z C;  2B39 A;  3DEP A;  5D3I B;  2RSO A;  2D9U A;  4HMI A;  3VYR A;  4AYB B;  3Q23 A;  3MFY A;  1S5E D;  2R92 B;  5EKI A;  1A2U A;  4FNF A;  5E4W C;  1EY6 A;  3LX0 A;  4OIK A;  2FMC A;  1SFO B;  2HQE A;  3NWS A;  3I72 A;  2K28 A;  3H94 A;  3SDZ A;  1O7L A;  2FFK B;  1F9Q A;  1CK1 A;  4KHV A;  4XYO A;  4CJ0 B;  2KHS A;  5TSS A;  4QCL A;  2PYK A;  4MIU A;  3HEJ A;  2G9D A;  3TZD A;  2O5I C;  1G2T A;  1EYD A;  3VYS A;  4KD3 A;  5M5W B;  1JOO A;  1I6H B;  2K05 A;  3J7A V;  2Q8R E;  5I9P A;  1F9S A;  1TWF B;  2FHT A;  2F0O A;  1CQV A;  1JOQ A;  3NHH A;  3SR1 A;  2K5Q A;  5DEH A;  4X3T A;  1PLF A;  5HUR A;  5E4X A;  1HCZ A;  3GTK B;  3PUX A;  3S2H B;  4H7B A;  2PCF B;  3BG3 A;  5DM6 3;  3I70 A;  2F0H A;  3NK9 A;  1SNC A;  4QUF A;  4RGO S;  4DGZ A;  5T1G A;  1O7Y A;  1Y8N B;  2WV6 D;  1PTO B;  3HOU B;  1KLU D;  3A55 A;  1CA6 A;  5CYU A;  3NE5 B;  2MP1 A;  4NKL A;  1HHV A;  4PNY A;  1LT5 D;  1SJE D;  4LAA A;  4ZQ3 A;  3M85 A;  1FGB D;  5C3E B;  5IGE A;  1XWE A;  4IQZ A;  1HQR D;  3RZO B;  1RF2 D;  3NBI A;  2RDH A;  2F3V A;  2B2W A;  1OXV A;  1HA6 A;  2NVQ B;  5CV4 A;  1S4Z A;  5KND A;  2EJM A;  2DNC A;  4IUR A;  3EVQ A;  2VNU D;  3IFD A;  2KCC A;  3JAM E;  4N9P A;  2X6G A;  1AW7 A;  4WOR A;  5JEA G;  1F2M A;  2X69 A;  4G57 A;  3S17 B;  2JEB I;  2EDG A;  3RD4 A;  4FVM A;  5CR3 A;  2K33 A;  3NP8 A;  2M2L A;  4NW2 A;  2NN6 H;  1OXU A;  4HSV A;  2NTT A;  5IT9 L;  3IL8 A;  4X3U A;  1SSO A;  1TY0 A;  4KN7 C;  1JB3 A;  1SNP A;  2AWO A;  1KAA A;  4QIW B;  5C0X H;  3M3Y B;  1FNV A;  4V19 0;  2AUK A;  2N55 A;  2C5C A;  3TP5 A;  1OXS C;  3KLS A;  5J39 A;  4RGM A;  2MGS A;  1MGS A;  4IFD I;  3ERO A;  3Q6S A;  2B2T C;  5I2Y A;  5G3L F;  2F0I A;  2SNM A;  4EGV A;  2MJ8 A;  3S15 B;  5CC4 A;  2J7Z A;  4XT1 B;  4J6H A;  3VR5 A;  3PO3 B;  2XWB B;  1SNO A;  3KK7 A;  3GD7 A;  3GTM B;  2VB3 X;  4A3G B;  3RLF A;  3SXH A;  4Q5V A;  3Q0A A;  5JEA J;  3QOL A;  1UEA B;  1B9N A;  2MHV A;  2L11 A;  5CMD A;  2RBM A;  1CZW A;  2JSO A;  2O4X A;  3ND8 A;  1O7Z A;  5FLX E;  2B2V C;  1ET6 A;  1ZEQ X;  1EIG A;  4ZUI A;  1H9S B;  3NQI A;  5CV9 A;  2E2D C;  2NB0 A;  5IGF A;  3EJI A;  3K7A B;  1AZP A;  3R93 A;  1V8Q A;  1BBX C;  1WCM B;  1D5Z C;  1SYC A;  1CT1 D;  2D5D A;  4HAE A;  1HQM C;  5EQ0 A;  1B3A A;  1HUM A;  1EY7 A;  1EYA A;  4H13 C;  4BWG B;  1GUO A;  4PMC A;  1WTV A;  1S5D D;  2J4X A;  3A54 A;  1WD1 A;  1V1P A;  2LY7 A;  4IAL A;  4KMU C;  4BBR B;  1SYG A;  3S1N B;  3SEB A;  1GHJ A;  1EWH A;  5K5P A;  2NVT B;  4OIJ A;  1OO9 B;  4XT3 B;  5C3W A;  3F2U A;  4M1U B;  4K2L A;  2NYZ D;  4X3S A;  3MXP A;  1GHK A;  1IYV A;  4K5W A;  4FO2 A;  1C8C A;  1BCP D;  1IL8 A;  1BCP C;  3WOE A;  3TN2 A;  4OO1 I;  2EYP A;  3ZYY X;  2VXW A;  5IOC A;  1PRT F;  1SDF A;  5C4H A;  1BO0 A;  5DNF A;  2OF1 A;  1B1Z A;  1CZG A;  1LTI D;  2OEO A;  2F0E A;  3I4M B;  2EY1 A;  3SK4 A;  2D2C C;  1H9R A;  1ENF A;  4ILW A;  3PIO 3;  5COR A;  4K6L A;  1NCV A;  4PQX A;  1ILP A;  4IUP A;  3VYU A;  1I4G A;  2YYZ A;  3VA7 A;  1ML0 D;  3BS1 A;  1A6X A;  4C3H G;  1K8O A;  4O1N A;  1D2B A;  3GV3 A;  1LV9 A;  2RDF A;  2XRQ D;  1F9R A;  4A3F B;  2K03 A;  1QOH A;  3TZU A;  3PUW A;  5KYI A;  1R9T B;  1W6J A;  1TWC B;  3KBX A;  3K59 A;  2WIN B;  2PQE A;  5JVH 3;  1DCZ A;  3J7A F;  1RTN A;  1MSG A;  4C3H B;  3V96 A;  3A56 A;  2EYO A;  2CVR A;  4JBW A;  4NDX A;  2VUM B;  3KLR A;  2A6E D;  1UUP A;  2SDF A;  5EBC A;  2A6E C;  4RGT A;  4FXK C;  4K5V A;  4IFD H;  1NUC A;  1BF4 A;  4DXG A;  3GTJ B;  2OT2 A;  4ZAI A;  3Q22 A;  3I8Z A;  1GXD C;  4H0L C;  2NZ1 D;  4EQP A;  4IUT A;  4C1N I;  2L9H A;  4KN4 C;  2F0K A;  3V05 A;  1WTW A;  1EQV A;  1BUV T;  4IUU A;  3TSS A;  1STE A;  5FO9 B;  5ELE A;  1SYE A;  1PZI D;  3MA2 B;  2Q8T A;  1IYU A;  2XN9 C;  3BDC A;  3PUV A;  4CJ2 C;  3CKI B;  4DFA A;  5LHY 1;  2RSN A;  4K6D A;  1ONL A;  3G6J B;  5EJW A;  3C1F A;  4K2K A;  1S5C D;  2JA7 B;  3C1E A;  4U68 A;  4HSP A;  2R6G A;  1PRT B;  5JAV A;  2FJ2 A;  3I90 A;  4WFN 3;  2A74 C;  4CBV A;  1J8I A;  4KHZ A;  4J1M A;  3GTP B;  3NXW A;  4A93 B;  5JOB A;  3JAM L;  1L0Y B;  2IT1 A;  3A8J E;  1G91 A;  3VYT A;  1FNU A;  2HCI A;  2L0C A;  4DAY A;  1PDQ A;  2O5J C;  2F0Q A;  1LT6 D;  5NUC A;  1I4H A;  3A8K E;  5A2Q L;  3I3C A;  3KBG A;  1DM0 B;  2B2T A;  3S2D B;  1SND A;  3A8I E;  4F87 A;  2BE5 D;  3EA6 A;  2BE5 C;  1QNK A;  2ZXR A;  3TP7 A;  2JA5 B;  3MFG A;  1Z47 A;  5EKL A;  4HCE A;  4OO1 H;  2NBF A;  2ZXP A;  2GA4 B;  2QF7 A;  4RFB A;  3T13 A;  5A35 A;  2VB2 X;  1B2T A;  4B9W A;  3LNN A;  4FXG C;  1Y1V B;  4G7Z C;  1EIH A;  4HTH A;  1RHP A;  3D4R A;  4ZLT F;  1NR2 A;  2IW3 A;  2H4O A;  1TS2 A;  2ZT9 C;  5C5L A;  3DWP A;  3H09 A;  1U4P A;  2E2H B;  2B2V A;  3MEH A;  1O80 A;  1EQT A;  2WP8 J;  1SYD A;  3WOF A;  2B63 B;  2KUM A;  1PTO D;  1IW7 D;  3GTG B;  1PTO C;  3J7Y W;  1IW7 C;  2K6A A;  2AQ1 B;  4G4K A;  1V1P B;  2TSS A;  1UNS A;  5FLX L;  4Q0F A;  2Q8I B;  1FYC A;  4PMW A;  3R3O A;  3D4W A;  3DEO A;  1QCB D;  3R2T A;  1BDO A;  4IUV A;  4XQJ A;  3FMC A;  3X3N A;  4O42 A;  1U9R A;  4CKE A;  4TRD A;  2B8G A;  2Z4I A;  1KNE A;  2K7V A;  2WAQ B;  3OWF A;  4QF4 A;  1TS4 A;  1A2T A;  3TBI B;  3FDT A;  4IZ8 A;  4A3B B;  2IL8 A;  2NN6 G;  2DY7 A;  4XYQ A;  3BDL A;  1ET9 A;  4DXF A;  1SAP A;  2F0P A;  2I07 B;  3T56 B;  2A68 D;  1QE6 A;  3ND9 A;  4KK7 A;  2M00 A;  5C4Z A;  3O13 A;  2A68 C;  2JP1 A;  4KTA A;  5C0X G;  2IPK D;  2DY8 A;  3TME A;  4RKB A;  4HN7 A;  5JPM C;  1SEB D;  4QB4 A;  5C3X A;  3D31 A;  4X3K A;  4OGQ C;  1W6K A;  2H1E A;  4ZRZ A;  2JA6 B;  2KVM A;  5M3M B;  3MXG A;  5EGT A;  3HZX A;  5EPJ A;  1E2V A;  1A3T A;  1LTR D;  3HP3 A;  1R4P B;  1LAB A;  5K36 H;  4Z9C B;  1CHP D;  1EY0 A;  5D65 A;  2KQ3 A;  2LS0 1;  3AB9 A;  1LO5 D;  2Z1C A;  2IWH A;  3HOX B;  2NVX B;  3S14 B;  2RKS A;  3R8B A;  3J80 E;  3MTS A;  2A6H D;  4OHJ A;  4IN3 A;  2A6H C;  4H44 C;  1HPC A;  5BN4 A;  3M4O B;  1JIC A;  3FPU B;  1PFM A;  4KY6 A;  4LK1 C;  3SVM A;  4WRD A;  1EU4 A;  1MD2 D;  4P2C B;  2WKD A;  2RQX A;  1IHZ A;  1Z6H A;  1ESF A;  5IGG A;  5A2Q E;  5ELB A;  2L55 A;  1B9M A;  1EZ6 A;  1OXX K;  3AMU A;  1PTO H;  1VF7 A;  1EY9 A;  5KEE A;  5C0X J;  1STG A;  5AFW A;  5FK9 C;  1MSH A;  5FO7 B;  1AN8 A;  5KYL A;  1HRJ A;  4KKT A;  5D3D A;  1F2Y A;  1FNW A;  2DN8 A;  3K0Y A;  1T5E A;  4BA2 I;  1SNQ A;  4NP5 A;  1I4R A;  1SNM A;  1WTQ A;  4PMB A;  1J9O A;  4XIG S;  2DNE A;  3BDO A;  4TKO B;  5KIX A;  2XVS A;  2K1B A;  4V0B A;  4HMJ A;  4J8Q A;  1U4L A;  4DNR B;  3C2P A;  1KTK A;  1KDB A;  2BA1 A;  3GTQ B;  3H3V C;  2E74 C;  2QCP X;  3A7L A;  1EEI D;  4BY7 B;  3K6O A;  4DN4 M;  1GOZ A;  3C46 A;  2HUG A;  1DON A;  3DXJ C;  1NSN S;  4FF1 A;  1QWY A;  4XDX A;  4KI0 A;  2XIW A;  1GJX A;  1X3Q A;  2Y0S B;  1WD0 A;  1BCP F;  3FVQ A;  1L0X B;  5CV6 A;  5CGK A;  3TP8 A;  4DA2 A;  3D3R A;  4FXD A;  1NR4 A;  2AUJ D;  3T51 B;  1BQQ T;  2EE1 A;  3MWY W;  4CJ1 B;  5G3L D;  5T1I A;  2EYL A;  4XXE A;  1XYI A;  5ELC A;  4BY1 B;  1TKW B;  5KRU A;  2F3W A;  1SMY D;  1TU2 B;  3E6Z X;  1SMY C;  5DM7 3;  1SE3 A;  4DU9 A;  2F0W A;  1EEF D;  5CBE E;  3QOJ A;  5IGB A;  4L8J A;  5J22 A;  1AP0 A;  2EPB A;  2N88 A;  3H0G B;  1YNN D;  2EZV A;  1YNN C;  3GTO B;  1XX8 A;  1EOT A;  3PV0 A;  1Q1B A;  5JVG 3;  1AEX A;  4IFD G;  3QG1 A;  1G6Z A;  4A3E B;  1HFN A;  4R9W A;  1FD7 D;  4KD4 A;  1WTP A;  4A3M B;  4DAV A;  2PNR C;  4F7X A;  1QIL A;  3DM1 A;  1F9P A;  4OL7 A;  4FF4 A;  5IOD A;  4RGN A;  1A3V A;  3I91 A;  1ZKO A;  1Q90 A;  1I4X A;  5LL6 S;  4HR7 B;  2MUY A;  1HTP A;  2D62 A;  5KNC A;  2QIL A;  5LL6 X;  1WVL A;  4A3I B;  1LTG D;  1D1I A;  3BVM A;  5IIF A;  2Z8L A;  4ULL A;  4RA8 A;  1TS5 A;  2E76 C;  3GP7 A;  1BNZ A;  2LFN A;  1QJO A;  2B2W C;  1DJR D;  1HTL D;  4IUQ A;  1E0B A;  2EXZ A;  1M4V A;  3X3M A;  3ONA B;  4RH6 A;  3L7Z C;  5BN5 A;  4FF2 A;  3QIA A;  4RHR A;  3T4A C;  2XSC A;  4CGY B;  3OIP A;  4ODG A;  1EU3 A;  4Y7N B;  1E2Z A;  1CTM A;  4JK1 C;  4WJW A;  5EKK A;  1DXM A;  4IFD J;  3L3O C;  1EYC A;  4BBS B;  4U67 3;  2K01 A;  2KED A;  1PRT D;  2EOT A;  4CKB A;  2JYO A;  1PZJ D;  1Y8O B;  3DWA A;  1PRT C;  3E5S A;  1D5M C;  1TWG B;  3GQB A;  1JC7 A;  2R3Z A;  5EPK A;  1ZXT A;  1TR5 A;  1II3 A;  1IKM A;  1AFP A;  3PUZ A;  1DOL A;  2BOS A;  3S1R B;  3MHB A;  1I50 B;  4QUC A;  4R8N A;  3K58 A;  3KUP A;  3K5N A;  3MVV A;  4I65 A;  2QEJ C;  3N52 A;  2R93 B;  4CKC A;  3S16 B;  2F0F A;  5I2X A;  2K5D A;  2KOL A;  3R2I A;  2FIN B;  2E75 C;  4K8I A;  1RD9 D;  4OO1 G;  5C44 B;  1GUT A;  3QB3 A;  2ENB A;  4C3I G;  1D5X C;  1YNJ D;  3VR2 A;  1OXT A;  3CRL C;  1CI3 M;  1LAC A;  4G7H C;  2F0M A;  1PZK D;  4EQN A;  1Q3L A;  3OW7 A;  1S5B D;  3HRZ C;  3CHB D;  4HED A;  2ID0 A;  4F8M A;  4RKL A;  2CW0 D;  3J80 L;  1C4Q A;  2CW0 C;  5BN3 A;  1ICW A;  1STA A;  3I4N B;  1G29 1;  4TSS A;  2M9V A;  2EY2 A;  5C4X B;  1WTR A;  3C3L A;  2EJG C;  3OSO A;  1STB A;  3H91 A;  1DOK A;  2LMC B;  2B2U C;  2G9H D;  2F1M A;  2L5T A;  2EYH A;  1STN A;  3K5L A;  1KAB A;  5F2D A;  1VMC A;  2F4I A;  2F0J A;  2K04 A;  3P1H A;  5DAU A;  1QG7 A;  1S5F D;  1IKL A;  3V2T A;  1GUG A;  1XXG A;  1JWU D;  1RJT A;  3URY A;  1ENC A;  3NTI A;  4HCS A;  2SNS A;  3I73 A;  5CV7 A;  3QO2 A;  3SK8 A;  2K32 A;  3RUZ A;  2CQA A;  2K5W A;  2F0T A;  2JEA I;  1PFN A;  1E2W A;  1FR3 A;  5HGT A;  4L6T B;  1BR9 A;  1Q12 A;  4N9T A;  2JXM B;  4CHT B;  4KJO A;  4C3J G;  3S1Q B;  3E0J A;  5FO8 B;  3N6R A;  3A7A B;  3HKZ B;  5M9O A;  5CV8 A;  1KDA A;  2NVY B;  2IX1 A;  3G7L A;  1GUW A;  1HUN A;  1EL0 A;  2AQ2 B;  3CRK C;  3VR4 A;  2XRS D;  1V43 A;  4NMZ A;  4DF7 A;  4PV1 C;  2EY6 A;  5K36 G;  3TDQ A;  4C3J B;  1TQO A;  3DMU A;  1DYQ A;  3D4D A;  1CFM A;  2F0S A;  2KA7 A;  5COY A;  3NBH A;  4A3D B;  4DAP A;  3EQL C;  1STY A;  3GO5 A;  3OHX C;  4GZY C;  5M3F B;  1STH A;  3SK5 A;  1TY2 A;  1TII D;  2WKC A;  1M8A A;  2EYJ A;  4C1N K;  2QDB A;  5E3F A;  2V4D A;  5I4D A;  1CA5 A;  3M7G A;  3BZD B;  1G8Z D;  3KLS X;  1I6V C;  5CV5 A;  4E6I A;  1TVX A;  2HDM A;  1HA5 A;  3CQZ B;  2XNA C;  2XWJ B;  3BYY B;  2F0V A;  2KEC A;  1CHQ D;  3PIP 3;  5JPN C;  3LWE A;  1F2Z A;  4UDU C;  2E2I B;  2KCN A;  2EVB A;  4K8J A;  1WTX A;  4DNT B;  1SXT A;  4ZKC B;  4DK0 A;  1RKN A;  1JE4 A;  3J81 E;  3NQT A;  4XQQ A;  2B2Y C;  1CQF A;  4B08 A;  1AZQ A;  4A3K B;  3P7J A;  1SE4 A;  5EPL A;  2LKV A;  4RCN A;  5IGC A;  2WB1 B;  1T5X D;  1HXY D;  1Q1E A;  3P20 A;  1D1K A;  2ZXO A;  3HOW B;  5I6W A;  5C4J B;  3BVG A;  2TMP A;  2JA8 B;  5M5Y B;  3LWU A;  2IJ0 A;  1V1O A;  3OPO A;  1K83 B;  1TWA B;  1SYF A;  2RA4 A;  1U4M A;  5KNB A;  3HGB A;  3ITP A;  1ROD A;  2OXP A;  2PZU A;  2A5H A;  1NAP A;  1H9K A;  1X3P A;  5EBD A;  1Z7T A;  3FPP A;  4ME5 A;  1SYB A;  1PFB A;  1GUN A;  4KY5 A;  2EJF C;  1JR0 D;  1K8M A;  1HFG A;  1SBB B;  1EY5 A;  4C2M B;  1I4P A;  4MN3 A;  1Y8P B;  2PMZ B;  3OMG A;  3D6C A;  3P75 A;  3D8G A;  3GV6 A;  4L63 B;  3NSW A;  2PW5 A;  2PO4 A;  4RCO A;  5JEA H;  2NWG A;  1PXU A;  1TS3 A;  2EY5 A;  3HOV B;  5I6Y A;  4YIJ A;  3RMH A;  3M4Y A;  1BXT A;  2O2L D;  1XTC D;  3OIQ A;  4KV6 A;  4KKS A;  3HOZ B;  1O78 A;  1I4Q A;  4F88 A;  1F77 A;  2B2U A;  4KKU A;  3S9W A;  1GUS A;  1JWS D;  1CM9 A;  3IKJ A;  2F0G A;  3K57 A;  3NWT A;  1EFI D;  3HG9 A;  3DWQ A;  2KEE A;  3W3A A;  4A3J B;  1F2L A;  3IFT A;  3BVZ A;  1B53 A;  3H6M A;  3DHQ A;  1DD2 A;  2B8F A;  1QB5 D;  3DUZ A;  5C5M A;  2F0D A;  3HOY B;  3MXN A;  3MZ5 A;  2E2J B;  2WII B;  4EVO A;  1H9J A;  1U4R A;  1EY8 A;  3NTH A;  3IAY A;  4ZK9 B;  1JCK B;  2L4N A;  3U9O A;  1H9M A;  4R8I A;  3BYT B;  1LTT D;  1TWH B;  2NTS A;  2IX0 A;  3VR6 A;  2YU9 B;  1RCV D;  4FF3 A;  2PW7 A;  3AU7 A;  2RVL A;  3HS0 C;  2EYM A;  1WTO A;  1Y69 U;  1PMR A;  1KNA A;  2PZW A;  2R61 A;  3OOC A;  3D6W A;  1B4O A;  5CBA E;  1EY4 A;  3GTL B;  3OMC A;  3PUY A;  4ZYS A;  4LJZ C;  4ZKB B;  4G7O C;  2BA0 A;  1MBY A;  3MXU A;  3SK6 A;  4RAU C;  3Q24 A;  1LT3 D;  3NPP A;  5I9O A;  2I46 A;  4B9X A;  3M7N A;  2L12 A;  3SE0 A;  4XQN A;  5ELD A;  3TP6 A;  1VDZ A;  3FEW X;  4K14 A;  4FYD A;  1ENA A;  1EZ8 A;  1R4Q B;  3OWE B;  2MPM A;  4DK1 A;  3CU7 A;  4TQU S;  1BCP B;  5IT9 E;  2BDN A;  2F0U A;  1ZYR D;  2HDL A;  1TT2 A;  3QWN A;  1VF5 C;  1ZYR C;  5IGD A;  3T53 B;  2F0L A;  1B50 A;  1JOK A;  2A73 B;  4RHS A;  1SE2 A;  1LTB D;  4FP5 D;  1DOM A;  3K5O A;  1A3U A;  5FKA C;  3VR3 A;  1Y1W B;  3UI2 A;  1B44 D;  3KF8 A;  1VMP A;  4ID6 A;  3PO2 B;  2AQ3 B;  4UAI A;  2BCO A;  3NUC A;  4C56 C;  3WDN A;  2KJX A;  2HCC A;  4RWS C;  2PZT A;  1JOR A;  1VCI A;  3MAQ A;  3FKI B;  4IUN A;  5C6A A;  5D14 A;  5J1Z A;  5ELF A;  1JWM D;  4MHE A;  2ICI A;  1Q8I A;  1A15 A;  2FMM A;  4ABN A;  3W2D A;  2QKI C;  1KDC A;  1LTS D;  5ISR A;  1YNJ C;  2B2Y A;  4M8A A;  1I3Q B;  2L1B A;  2AWN A;  2X6L A;  2EYF A;  1RTO A;  2BDO A;  3K5M A;  2NUC A;  1DZ1 A;  3MC0 B;  4EQO A;  4QMG A;  2WAC A;  4S3S A;  1D6E C;  3NTK A;  1ILQ A;  1EWC A;  4BS9 A;  2F03 A;  3RZD B;  3J81 L;  1PYW D;  4XTC S;  4ZUJ A;  3VA5 A;  2RDG A;  2PPB C;  3SHL A;  5FOB B;  4K5X A;  4C3I B;  1C48 A;  2R7Z B;  1LLR D;  2C9O A;  1QNU A;  2CHB D;  2SOB A;  4BA1 I;  2J0T D;  2ICE C;  2JE6 I;  1RDP D;  1LTA D;  3PMF A;  3EFX D;  1G2S A;  1UAP A;  4LMQ D;  2Z4H A;  5KGU A;  3T16 A;  1MI2 A;  3S1M B;  2SEB D;  2F0N A;  2NN6 I;  3ERQ A;  1SJH D;  1X32 A;  3U9S A;  1H9S A;  3I4L A;  3QJY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...