2F0UA

Crystal structure of staphylococcal nuclease mutant v23i/l25i/i72v
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTIKIMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKVEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal nuclease
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0uA00
4PMCA 3QB3A 2SNMA 2F3WA 2OXPA 3HZXA 1JOOA 4EQPA 2F0DA 2PZWA 4RKLA 5CV5A 5HGTA 4KJNA 2F0GA 2PYKA 4I65A 3S9WA 1SYEA 2F0IA 1EZ6A 3OMCA 2EYFA 1JOKA 1STYA 4J6HA 1JORA 4K14A 2F0LA 5CV6A 1F2ZA 4OL7A 5EGTA 1SNCA 1EY8A 2O4XA 4K8JA 3SR1A 5EKLA 5C4ZA 3D4DA 2EYOA 1F2YA 2EYJA 2F0UA 3T16A 4QMGA 4YIJA 4KTAA 4NP5A 2EXZA 4H7BA 4HTHA 4QF4A 3NQTA 1EY9A 1STBA 1EY4A 3EVQA 5CC4A 4N9PA 5IGCA 5M9OA 1EY6A 4J1MA 4NDXA 4EVOA 3TP7A 5IGFA 5CV9A 3TP8A 3SHLA 3MXPA 2EYMA 5C4HA 4QB4A 3DMUA 3MEHA 5J39A 2RKSA 3LX0A 1STAA 3SK5A 3TP6A 2HQEA 5KIXA 4ZQ3A 1SNMA 1KDCA 4DGZA 3U9OA 5DEHA 4KY7A 5J22A 4NKLA 3R3OA 2LKVA 5KGUA 5JOBA 1NSNS 2NUCA 3NP8A 4PNYA 5CV7A 4IZ8A 1A3UA 4ZUIA 2RBMA 3OSOA 5IGEA 5IODA 4HMJA 3MVVA 3C1FA 1A2TA 2F0SA 2PQEA 5DAUA 1IHZA 3D4WA 5ISRA 5CV4A 2EY1A 3C1EA 3VA5A 5KYLA 4K8IA 4IUNA 3NHHA 4K5VA 1ENAA 1TQOA 4EQNA 2EYPA 3H6MA 4MIUA 4K2LA 4TRDA 3SXHA 1KAAA 2PW7A 4KD3A 2F0NA 3TP5A 5IGGA 2SOBA 5F2DA 4E6IA 2EY2A 3OMGA 1STHA 3BDCA 4WRDA 5EKKA 5IGBA 4F7XA 5CV8A 2KHSA 2ENBA 3NUCA 2KQ3A 4KV6A 3PMFA 3SK6A 3HEJA 2F0HA 2F3VA 4ID6A 4ZUJA 3RUZA 5JAVA 5KYIA 2F0EA 1II3A 1SNDA 1U9RA 2EY5A 1STNA 5K5PA 1EZ8A 3QOJA 3OWFA 4EQOA 4NMZA 3P1HA 3ITPA 4DF7A 4ODGA 1EYDA 3P75A 5IOCA 4WORA 2F0TA 2PZTA 3BDLA 4K5WA 4KY5A 4KD4A 4LAAA 1NUCA 3V2TA 2F0QA 5C6AA 2PZUA 1SNQA 5E1FA 1KDAA 5IIFA 2M00A 4K5XA 2F0MA 1EYAA 5I9OA 5KRUA 3NK9A 1SYGA 1STGA 1SYDA 4N9TA 2PW5A 1EYCA 1TT2A 1TR5A 1SNPA 2F0OA 3NXWA 2F0KA 1RKNA 2WACA 4KY6A 4R8NA 5C3XA 5HURA 2SNSA 4KHVA 1ENCA 1KDBA 4F8MA 1SYBA 1JOQA 4DU9A 1EY5A 3T13A 4S3SA 4ME5A 3SK4A 1EQVA 2F0WA 1F2MA 3E5SA 5CGKA 5J1ZA 1A2UA 2OF1A 4K6DA 2RDFA 2OEOA 3TMEA 1EY0A 5C3WA 5NUCA 5I6YA 4PMBA 4B9WA 2EYHA 1A3TA 1SYCA 3ERQA 5IGDA 3MHBA 4B9XA 5C5LA 2EY6A 4RKBA 5CR3A 1SNOA 4KJOA 4K2KA 4DFAA 2F0PA 2F0JA 3MZ5A 5C5MA 5E3FA 1EY7A 2EYLA 3EROA 4G57A 4HMIA 4IALA 3EJIA 3DHQA 3QOLA 3SK8A 2F0FA 1AEXA 3D6CA 5I6WA 3D8GA 1A3VA 1SYFA 5I9PA 5KEEA 1KABA 2F0VA 2QDBA
chains in the Genus database with same CATH superfamily
1I3QB 4NPSA 2K03A 4X66Q 5C0XH 5DM73 4JYAL 2KCTA 5K36G 5LMNW 1LUZA 4EX5A 3J7YW 2LXJA 5M3FG 5IP9G 1JE5A 4ME3A 3SR1A 3GTJB 1KTKA 4BY1G 4DAYB 4A3LH 3LGJA 5I4DA 2EYJA 2A68D 4A3DB 2IW3A 2B2VA 5ELDA 1STBA 2AQ2B 5JJLA 5LMUL 1VQIA 1TVXA 3TBIB 1WVLA 2G9HD 3RZOB 4HIKA 3BJUA 4ZRZA 3MEHA 1PH8A 4JI7L 2RKSA 3MWYW 1GUSA 2UUCQ 1SSOA 1YJ9A 1AH9A 2MUYA 2R3ZA 2K7VA 4OO1I 2NVQH 3H3VI 3NBHB 1CA6A 1HNXQ 4IJLA 1UUPA 2E2DC 1BDOA 1UE5A 3PO3H 4OHJA 1GUGA 4LF7Q 1VQHA 2SOBA 3SE0A 2K5VA 4BBSG 1XNQL 2I5LX 3RLNA 5JEAH 4KHZA 4GNXB 3M4OB 1HPCA 3HOWH 2VS1A 4DNIA 4ABNA 5M5WH 4ZUJA 3NE5B 3S1QH 1PYSB 2WFWA 3MA2B 3UE0A 2Z0SA 2MGSA 3HOZG 3V2TA 1YITA 4K5WA 3Q6SA 4ILWA 1WTPA 4LF6Q 3BZKA 1JWSD 1SAPA 3S1NB 1VQOA 3K7AB 2D2CC 1TT2A 4JV5Q 1TR5A 4I7ZC 4TKOB 2R7ZB 1F9QA 2XRQD 3T4AC 4RGTA 1EIGA 5HURA 1GUWA 2NZHA 1E2VA 4MZ9A 2ALYB 4GLVB 4DR1Q 4JI1Q 4K6DA 2CKZB 4P71A 2ASBA 3S17H 3Q0AA 1YJNA 1V1QA 5NUCA 4LJZC 1IBMQ 4RFBA 3S16B 1K0RA 3JC66 3FMCA 1UNSA 4IOCA 3GTLB 2K5WA 2DY7A 5IGDA 1MJCA 1WI5A 2R6GA 3CMEA 1YNNC 4G57A 1IYUA 4HEDA 4LF4Q 5ELCA 4DK0A 2Y0SE 4DXFA 1F9SA 3C2PA 4OONA 3CCLA 2Z1CA 2F0DA 3T1YQ 2A6HD 3J7A5 4OIJA 2Z4HA 5M5XH 3TREA 1STYA 4ZLTF 3HOXG 5FLMH 1F2ZA 2KHJA 3KOJA 1YI2A 2E8GA 3PIO3 2E5LQ 1FD7D 2NVYB 1I4XA 2IHFA 3K58A 3FPUB 3PIOA 5H1SE 5I2YA 1NMGA 2NVXB 1EEID 4WJ4A 2WAQB 1SLJA 4YY3Q 1IBKQ 5BN3A 4XTCS 1RJTA 1ZYRC 2Y0SG 4A3IB 1KDCA 4DGZA 4DAMA 1WTWA 4IPCA 1FNUA 1TU2B 5M3MH 2MNAA 3DWPA 1A3UA 4IZ8A 2D9UA 3H94A 2IL8A 3VYTA 3MVVA 1VQKA 2VZAA 3VA5A 1LTBD 1BO0A 2QA4A 2F3IA 4A3EH 1K0SA 4MHEA 2A69D 4BXXG 3A8JE 4KD3A 2PW7A 3TP5A 4LFCQ 3DUZA 5F2DA 2YTYA 3OMGA 2ZTEA 3I72A 1C48A 3NUCA 4KV6A 2VQFL 1R9TH 3MXNA 4KK7A 1U9RA 4H44C 5IP7H 1EZ8A 3NQIA 5T1GA 2UUBL 4FF1A 1HR0L 1YNJD 3HOUB 3PGZA 4KKUA 1CA5A 1W3SA 3KLWA 1BCPC 4KD4A 2NZ1D 3PIPA 3H09A 1WFQA 1ESFA 1JJCB 3GTPB 1KAWA 2B63H 2N78A 4RG1A 2JA5G 2AUJD 2UU9Q 3J81j 1X54A 1I50H 5E4WC 1Q8KA 2K75A 1XWEA 1Q82C 2JN4A 3STBC 4IUQA 2F4VQ 1F2LA 4PMBA 4AYBB 2FMCA 1GHJA 1B53A 3NEMA 3S24A 2NVTH 2JA8B 4PV1C 2F0JA 4X62L 1E24A 4DV4Q 3RN5A 1AN8A 3EROA 2GVAA 1LM0A 2X6LA 3QOLA 4HCEA 4G4KA 1Y1VH 2KHIA 3OW2A 3NWTA 2VUMG 1TWGB 2F3WA 1IZ6A 2JA6H 1O7LA 1CKNB 4K14A 1E2WA 1GUTA 3QG1A 3I4MB 1EY8A 3KFUA 3I7FA 5EKLA 3VR2A 2YU9H 2KEEA 3TN2A 1DXMA 4JC0A 3FDTA 4QF4A 2IPKD 5IGCA 1DOMA 4ZKBB 1SROA 5CV9A 3CHBD 3K5MA 4DV5L 1STAA 2VXWA 3H0GB 4UP7A 5ELFA 2JA9A 3J81L 4C3HG 3H91A 3GDEA 3LWUA 1PZKD 3NTHA 5IYBH 3F2DA 2EQSA 1IKMA 1DM0B 3NENA 1EOVA 4LFBQ 5FO7B 4MN3A 3EFXD 3CPWA 4FF4A 2B29A 3SXHA 3H3VC 3BZCA 1EEFD 3J7ZC 1FJGL 2X69A 4IFDG 1B70B 4A3CH 1O80A 1C7YA 1PZJD 3PV0A 1QVFA 4GOPC 1CKMA 1DGSA 5GAEC 4L6TB 3PF4A 1V1PA 4CDCC 2UUAL 3VDYA 1HA6A 1O7ZA 2MO1A 3FP9A 3RR5A 4KY5A 1SXTA 1UE1A 4FF2A 3UDXA 1L0XB 4JI2L 4DR5Q 2LMCB 3OHXC 1YVCA 2F0OA 2NVQB 2A19A 2EJMA 2N49A 3M85A 1P16A 4FVMA 4BWGB 5GQOA 4RGNA 1J9OA 3PO3B 1SBBB 5JJKA 4X64Q 4PZ7A 2D5DA 2PCFB 3TMEA 1EFID 1UEAB 4JW0A 3HOWB 1H95A 5M5WB 1AP0A 4X3KA 2XNAC 4OIKA 3S1QB 2Z4IA 4P75A 2XN9C 3AU7A 3TDQA 3CU7A 3BS1A 5J3BA 3I4NH 4DV7Q 1QOHA 1WTVA 1MI2A 2PNHA 3CAMA 1TWCH 1K8GA 4DUZL 2EVBA 1CZGA 1U4PA 4RKLA 1PH1A 2K52A 2VY3A 3S9WA 2RDGA 3GTOH 5BR8L 1X32A 1ILPA 2X6GA 3L3OC 2J0TD 5EGTA 4WJWA 4A3FG 1MD2D 1ZXTA 3S17B 1AFPA 1RL2A 4KMUC 1PDQA 2EXZA 1VQ9A 1MHWC 2A6EC 2DNEA 3EVQA 5CC4A 5A2QL 4YHHL 2Z8LA 4CGYB 3TP8A 1NCVA 3I4OA 3STBD 3SVMA 2XVSA 2M2LA 3LWEA 2J7ZA 1XMQL 1LABA 1RTOA 5C3EH 1N33Q 3E9HA 4A76A 2UXBL 5IE8A 3NP8A 5CV7A 3EQLC 3L0OA 4HJ8A 1W2BA 5DAUA 3N6RA 4A3GH 4CJ0B 5M5XB 2KVMA 1QUQA 2GVBA 4LMQD 1K3RA 2B3GA 3NHHA 5FO8B 4K5VA 1N9WA 2K04A 3I70A 1B3QA 2IX3A 1CUKA 1PTOH 1X3QA 2QF7A 4QUFA 3K5LA 1D5XC 2G9DA 2IX0A 4FP5D 1LO5D 1LT4D 4BBRG 4XXEA 1PFBA 4ID6A 3GV3A 4QY7A 4RGMA 4NXML 2E76C 2CWPA 1O7YA 2SEBD 3KBXA 4QJFA 4GKJQ 4P73A 1WOCA 4NMZA 4BY7H 4DR4L 4I7AA 1H9JA 3BVMA 2F0QA 5M3MB 5JPNC 2F0MA 1VQBA 1KC8C 5GROA 1WD1A 2Q2TA 3G7LA 2JP1A 2VB2X 2KCNA 5C0XJ 2WACA 2NBFA 3OIPA 1ENCA 1KDBA 5AJ3Q 1JOQA 4QIWB 4A3EB 2B2TC 1MGSA 1JE4A 1R4PB 2B2YC 4DV3Q 4DAYA 4N8FA 1HZAA 1PVOA 3D6WA 3BYTB 1R9TB 1A3TA 4U673 3T56B 2QCPX 4FNFA 4DK1A 3GO5A 2R7FA 5CR3A 2DN8A 2N3SA 1QCBD 3OTOL 3SK8A 1L1OB 5HY6A 3D6CA 2A68C 5D14A 2H5XA 2HIXA 1I6HH 3QB3A 1VQPA 5EPLA 4B3SQ 2WP8J 1G91A 2B63B 3ZYYX 3WOEA 4XDXA 4CJ2C 5IWAL 1FNWA 4FYDA 1I50B 3AFPA 3CPFA 5CV6A 2KCCA 1CZWA 2F03A 1TWAH 3KF8B 1VQJA 5JEAJ 1GOZA 2NN6I 1LTSD 4GNXA 4LFAL 4EQ5A 3S2HH 2NVTB 4JI4L 1I94L 1SJHD 3PUXA 1Z9FA 2K01A 1A8VA 4NW2A 2WB1G 1Y1VB 5JOBA 4Q5VA 5JVH3 3FKIG 2K14A 3OSOA 4PZ6A 1A2TA 4OWXB 3KLSA 4UP8A 3ER0A 1X65A 2JA6B 5D3DA 5FO9B 1HNZL 4UAIA 4DV6L 4X65Q 1M4VA 1SE2A 1JICA 5ELOA 4CHTB 3A56A 3K6OA 1GM5A 1A62A 4J8QA 1VF5C 2YU9B 5G3LF 4JOIC 2PNRC 4U68A 5EKKA 2QEJC 4DV1Q 2Q8IB 3M7GA 2KHSA 2PQAB 5CV8A 4ULLA 3CD6A 3J7AF 3K81C 3PMFA 5KYIA 2K5DA 3AEVA 3GQBA 4M1UB 5IY0A 3HKZG 1HRJA 2JEBI 4DNRB 4EQOA 3J80c 1LTAD 1X3FA 2I5HA 1PTOC 4TVAB 4GNXC 5M5YH 3PO2G 1EYAA 2YTXA 1SYGA 1J5EL 5DM63 1UAPA 1E7ZA 3M7NA 1EQVA 1EUJA 3PUYA 3HOYG 1M1KC 1FGBD 1PLFA 3G6EA 3J7AV 3I55A 5C3WA 4DR2L 3S15H 2RCFA 1HUNA 2HD3A 4QL5A 1IKLA 1Q90A 2A6HC 2XGTA 4JI8Q 4AH6A 4DN4M 1H9SA 5FKAC 1BOSA 1QILA 2JXMB 4HMIA 3F1ZA 2UXDL 2F0FA 3IL8A 3K0YA 4OWTB 4A93G 2D0OA 1LT6D 1WCMH 4UPAA 3RZDH 2AWNA 4A3JG 4A75A 4EQPA 2NN6H 5HGQA 2TMPA 5C4XH 1Y14B 5CV5A 4KJNA 1PRTF 3ONAB 5FJ8H 2R92H 4DV2Q 4J6HA 2ZJRA 1NAPA 1W6KA 5EBDA 1SNCA 2O4XA 1EQRA 4DR6L 2EYOA 1J8IA 1S5BD 5C44G 2F0UA 3FPPA 2XTIA 4BS9A 3TRZA 1VQ8A 1UEBA 2A69C 3DM1A 5IGFA 4AQYL 1CQFA 3PCOB 5C4HA 1BBXC 2TSSA 3I4NB 4KHPL 1D7QA 3DEOA 4KY7A 3W3AA 3TQYA 2WV6D 1TWCB 4JI0L 1EQQA 4GN4B 2ZJQA 3SEBA 1Z7TA 2JJQA 4KN4C 1V1OA 5JVG3 2Z6BA 5KNDA 3HGBA 1Y69U 3GTOB 1TQOA 3FHWA 2O5IC 2LXKA 4OO1G 1YNJC 3UDIA 4XQJA 4LF9L 4HJ5A 1K83H 1F9RA 3RD4A 5JJZA 2JK8A 2K6AA 1EQTA 4GN3B 3K80C 1BBWA 1QJOA 5FLXL 3J81E 1B50A 1F77A 1LACA 3HEJA 2F0HA 3HFZB 1VDZA 1II3A 1NR2A 2H4OA 3PF5A 4JI6Q 3OWFA 2N55A 3P1HA 2HHHQ 4K6LA 5C3EB 1M8AA 2OQKA 1Y8NB 2SDFA 5IYDH 3MC0B 4A3GB 5C3XA 3FRPB 4JI5L 3AMUA 2CVRA 4A3KG 2PMZB 3A7LA 1PTOB 1CKNA 3SK4A 4G7HC 4FXGC 1S40A 5L37A 2JQOA 4OX9L 5J1ZA 4CKBA 1LLRD 2N88A 3URYA 1XTDA 1RHPA 1S3OA 4B3ML 1RF2D 1XNRL 2B8GA 2V4DA 3BG3A 4B9XA 5C5LA 2IWHA 4R4CA 2IX1A 4HSVA 1WTQA 4BY7B 2F1MA 2NB0A 2IJ0A 3EN2A 2UUAQ 2R93H 3D31A 1QE6A 1PH7A 5KEEA 4LUVA 1QNKA 2F0VA 2FHTA 2OT2A 4DK3C 1G6ZA 4R1JA 3K57A 3N52A 1B9MA 3JAMc 5LMNL 1PH5A 4DR7L 1VF7A 2F0GA 2L12A 2ES2A 1HTLD 1PTOD 1SYEA 1EYGA 1JORA 2ZM6Q 3VYRA 2UXCQ 3O13A 1X3EA 4OL7A 4IUTA 3PQIA 4DV0L 2HCIA 3MFGA 1B9NA 2EOTA 1B1ZA 4YIJA 4KTAA 4NP5A 1QNUA 1B8AA 1EY9A 3E9IA 2RSNA 2RSOA 4HR7B 1QVGA 5DEHA 3R3OA 4PNYA 1RTNA 1I6HB 1IYJB 5T1IA 3S1RH 1IXRA 2FINB 3E6ZX 1Y1WH 3GTQH 5A2QE 2ZT9C 3HS0C 4YCVA 4DNTB 1D8LA 3Q8DA 1E2ZA 1F9PA 2DJFC 3KDFB 2VQEL 1TWAB 4RAUC 3HKSA 1ESRA 4F7XA 1A15A 3BYYB 3SK6A 1BXTA 3GP7A 1AZPA 3IFTA 3S2HB 1IBLQ 3PUZA 4ALPA 3QOJA 4ZK9B 1KD1C 4C3JG 1ASYA 2WIIB 1SFOH 1KLGD 3A8IE 1D5MC 1L0WA 5IOCA 3T1HL 5K36H 2JA7G 4WORA 1NBWA 5IIFA 5IT9c 2CFMA 1SNQA 2QDLA 1KDAA 5IP9H 3CCEA 5M3FH 3I4LA 2UXBQ 2QW7A 5KRUA 4N8X1 4BY1H 3BVGA 1HHVA 3F2CA 4KHVA 2CCZA 1SYBA 3C46A 3T53B 1FR3A 3BDOA 3HOVG 5BN4A 5CGKA 4DPGA 2ID0A 2PO4A 1AW7A 4C2MH 1EY0A 4A3BG 2E2IH 1IL8A 3PIP3 1CHPD 2LY7A 4QGUA 3BVZA 4C3IG 2DUDA 4K2KA 5JPMC 1TS3A 2BE5C 4DR4Q 1A3VA 5M5YB 3OW7A 3CCSA 1N34L 2HDLA 4BBSH 2A8VA 3IKJA 3IFDA 1AE3A 4R4TA 4GLXA 4O1NA 4YCUA 3D4DA 2ATWA 2VB3X 3HOZH 1VQEA 3KYHC 3S15B 3MXUA 4FF3A 4CDDC 3I56A 1CTMA 1M90C 4FO2A 5M9OA 4IPDA 1JCKB 1W6JA 5J39A 1A63A 4GKKQ 3LX0A 3SK5A 3I3CA 3VA7A 4H13C 1SJED 4PMWA 4A3DG 2I46A 4NKLA 3V96A 1WCMB 3RZDB 2PPBC 4WFN3 2E74C 3CCRA 4GOPA 2CWAA 5C4XB 3E0EA 5CV4A 5JJIA 4DK6C 4DXGA 3OOCA 2R92B 4X66L 1G51A 1TY2A 2ZTDA 1T5EA 1ET6A 2HCCA 3U4ZA 4X6AH 4LFAQ 4RGOS 3AQQA 3EA6A 2AUKA 2PI2A 1DYQA 3W2DA 3OYYA 1U0LA 1I94Q 4YWMA 1E0BA 1T5XD 3RN2A 2F0TA 5KNCA 4B08A 1SN8A 1DOKA 2ZXOA 3P20A 3HOXH 4XYOA 2IHEA 3AB9A 3G6JB 4C56C 3U4VA 3MTSA 1VQCA 1LTGD 5G3LD 1RKNA 4YWKA 3GTGH 1QB5D 4NXNQ 4KKTA 2DJGC 4S3SA 3QIAA 1K83B 1XPUA 1OXSC 1A2UA 1O7IA 4IUPA 3KF6A 5LL6X 4FDBA 2R7ZG 1BUVT 4LF7L 3M3YH 2EYHA 1PFMA 4NB3A 1K9MC 3CKIB 2L15A 3H15A 1PV4A 4HIDA 2Q2HA 4IALA 2A5HA 4CBVA 1VQDA 1H9KA 1PRTB 4BXXH 3X3MA 4PG3A 4UP9A 1D2BA 3CCMA 1HZBA 3KJPA 4LF6L 5BN5A 4QQBX 1CK1A 1V8QA 1EZ6A 3OMCA 1L1OC 3CCQA 4HJ9A 4JV5L 4IURA 4JPBW 4V190 4OXPA 1WTHA 1AZQA 1WTRA 2AHOB 1NTGA 4DR1L 2L5TA 4Z9CB 1OXXK 4JI3Q 1S5ED 4N9PA 4UHVA 4L5TA 1IBML 1ONLA 1S5DD 4IUUA 2JA5H 2WKCA 4QB4A 3Q22A 1VS0A 4L5QA 1GO3E 5A35A 2HQEA 4LF8Q 2R93B 1PRTD 2L1BA 3FVQA 1PH6A 4LNQA 1NSNS 2CH4W 4ZUIA 2O2LD 2WAQG 2C5CA 1PH3A 2BE5D 1KNEA 1ENAA 4A3IG 2EYPA 1CI3M 1S5CD 2NYZD 3MEFA 4TRDA 3TZDA 3T1YL 1I4HA 1OXTA 5FOBB 1Y8PB 3J80i 3R2TA 1MSGA 1SMXA 1LYLA 3RUZA 1FGUA 2B2TA 1SNDA 2MFIA 2VUMH 2AMCB 2ICIA 1I4GA 2B2YA 4AQYQ 3MXNB 4XYQA 1RODA 5C6AA 4P72A 1XPRA 3CCJA 2KECA 1T9HA 4YY3L 1IBKL 5IYCG 4JYAQ 3VYUA 5I9OA 3NK9A 2OTJA 2K4KA 1EYCA 5FLXE 3S1RB 4KY6A 1Y1WB 1RCVD 2SNSA 4MTNA 2FMMA 3GTQB 4B3RL 3R2IA 4DU9A 3HOUG 1QG7A 4F87A 2F0WA 1F2MA 1HTPA 5LMUQ 3KJOA 4YCWA 3D4RA 1Q86C 4C3HH 1TKWB 4JI7Q 3A74A 3CQZH 2KA7A 2F0PA 3PUVA 1SFOB 1PA6A 3QWNA 2K05A 3D3RA 2BOSA 2EDGA 3CF5A 5M3FB 4AYBG 5EKIA 4BY1B 1SRUA 5TSSA 4DA2A 2SNMA 2JA8G 4IFDH 1D6EC 2WINB 1HZ9A 3CRKC 2PYKA 4JI5Q 5E7NA 3RLFA 4MNOA 1VQ4A 1XNQQ 2RQXA 4DR3L 4C2MB 2Q2UA 4IQZA 1YZ6A 3IAYA 2E2IB 3G48A 4H7BA 4B3MQ 1XNRQ 2F4VL 4J1MA 4EVOA 1BR9A 2WB1E 3TP7A 3I4MG 1NE3A 3DMUA 3UDFA 5KIXA 4JOIA 1SNMA 4DV4L 3NBHA 4GS3A 1D1IA 4BBSB 2EIFA 2YTVA 4TSSA 4O42A 3H0GG 2L11A 1LTLA 2EE1A 3GTKH 3HP3A 1IL2A 3HKZE 1R4QB 4WRDA 3VR6A 3HOZB 5C0XG 1JJ2A 2E2JH 3CC2A 2L4NA 3A8KE 2CQAA 1D1KA 1KQSA 4JBMA 4RCNA 3CCVA 1KRSA 4LUZA 4A3LG 3MAQA 3TS2A 1PH2A 1LT5D 4LAAA 1U5KA 3I91A 1ML0D 2LFNA 2M00A 1ET9A 4A3FH 3DM3A 2RF4A 2NTSA 4N9TA 3WWVA 1VQ7A 2XSCA 4LFBL 1DOLA 2ZTCA 3W1BA 1XPOA 2Z6KC 3R8BA 1OO9B 4IUVA 4LK1C 1BNZA 4Y7NH 3QJYA 1L0YB 1EWHA 3MXGA 1X3PA 3PO3G 3QR8A 3PSIA 4RKBA 3J81c 4R4OA 2OWOA 3MZ5A 1WD0A 1Z6HA 4RHSA 3JAMi 1OTCA 1VQGA 3A5UA 3HOWG 4HN7A 3HOXB 2GA4B 5EPJA 2HDMA 3K5NA 1EIYB 3NSWA 1B4OA 5FK9C 1WTXA 4A4IA 4BBRH 2PZWA 3GTGB 3DWQA 1HQMC 2OTLA 2LS01 3BZDB 2KJXA 1Q1EA 3KDFA 2VQFQ 4RCOA 3AYHB 4BA1I 4IJHA 2Y0SB 2DNCA 4X64L 3M3YB 5CMDA 2H1EA 2UUBQ 3SGIA 3NQTA 1HR0Q 4KI0A 4P2CB 1K8MA 2FJ2A 1XTCD 1FNVA 1DZ1A 3CMAA 1Q12A 3KLSX 3OPOA 3TEHB 4LF5L 2K33A 1N34Q 4HMJA 4JG2A 3VYSA 1JWUD 3C1EA 1FL0A 4HJAA 4ZYSA 4B3TL 1LT3D 3L7ZC 3G4SA 1QUQB 3M4YA 1ENFA 3WOFA 2DY8A 1NY4A 4O0AA 2EJFC 1HUMA 1CT1D 1YHBA 3S2DH 1V43A 4X62Q 1NMFA 3L2PA 5FLMG 1Q1BA 1HFGA 1RDPD 3F8TA 4IPGA 1QZHA 1BCPF 2JA5B 2B2WC 1LTTD 3P75A 2RCNA 4HSPA 1H9RA 5E1FA 1C4QA 4GN5A 1EFWA 1CSQA 2PI2E 1N33L 1SNPA 4OELB 1QVCA 3DLLA 4F8MA 3KBGA 4RH6A 1HH2P 4DAVA 2HQLA 2HUGA 4QUCA 5M3MG 1MKHA 4HIMA 1N32L 1HJPA 3TSSA 2YYZA 4B9WA 4A3EG 2VUMB 3FKIH 4DV5Q 2XRSD 1SMYD 3CC4A 1K3BC 1A0IA 3WDNA 2P5ZX 3J80E 4GKJL 5D3IB 2BDOA 1PXUA 3E5SA 4L8JA 3Q24A 2QDBA 1IYVA 5ELNA 5IP7G 5E4XA 5HGTA 2O5JC 2B8FA 2JYOA 4I65A 4JBWA 1U4LA 5GAHC 2EYFA 1FJGQ 1I4QA 3RNUA 3C3LA 2KUMA 5AJ3L 2Q8TA 5C4ZA 1PH9A 2FXQA 2HT1A 2DGYA 1E1TA 3T16A 2B63G 1N36L 4DV3L 1KL9A 1VMPA 1GKHA 4C3HB 3PO2H 3W5OA 3CQZB 2EYMA 4JI2Q 3OIQA 5I2XA 3RMHA 1JR0D 1X6OA 1BQQT 1WJJA 2B2UA 1Q46A 3HOYH 2K32A 1NJIC 1HNWL 1G291 1GD7A 3C1FA 2F0SA 1UE7A 1PYBA 2B2VC 1HA5A 2K50A 3S1MH 4B3SL 1TXYA 1G8ZD 1Y1VG 3A7AB 1TIID 2F0NA 2Q2IA 4WJ3M 3UDGA 1STHA 1DCZA 5IGBA 1B44D 2JA6G 4A93H 2C35B 4DUYL 1X3GA 4FXDA 1I4RA 2ZXRA 2EY5A 2L0CA 5K5PA 4A3JH 3ND9A 1Q8IA 4ODGA 2D62A 1Z47A 4RA8A 2PZTA 1HR0W 4XQNA 2GN5A 4DUZQ 1X9NA 1PZID 2PZUA 1MJEA 4L5RC 4H02A 4X3UA 1HZCA 3V05A 5BR8Q 2PW5A 5C44H 2KOLA 2F0KA 2ICEC 4R8NA 5COYA 1PHJA 1EY5A 2RHQB 4K0KL 1DJRD 1IW7D 1HXYD 4HAEA 3GTKB 1XMOL 2B2UC 2MO0A 4IPHA 1GXDC 5IYBG 1X56A 2OEOA 4RHRA 4YHHQ 4X65L 4H0LC 3M4QA 2E2JB 3F2UA 4IN3A 1SYCA 2QGQA 3MHBA 4DV1L 1H9MA 3I2ZA 1BKBA 3K8AA 1XX8A 4KJOA 1XMQQ 5KNBA 2EYLA 4A3CG 1H9SB 1Q7YC 4OO1H 3D8GA 1YEZA 3H3VH 5EQ0A 3X3NA 3CXCA 4PMCA 1EWCA 4A3FB 1JOOA 5ELEA 4JK1C 1HQRD 2CW0D 2CQOA 2AQ1B 2F0IA 4B3RQ 4KKSA 1PRTC 1KLUD 2XWBB 2YV5A 3F2BA 1SE4A 4NXMQ 4Y7NB 5GADC 2MHVA 2XIWA 4NDXA 4YWLA 4HIOA 1O78A 3IRBA 4A3MG 4JI8L 4A3KH 3A0JA 4GZYC 1OXVA 1DONA 3DEPA 4J15A 1S72A 1K8OA 1A6XA 2NUCA 2K5HA 3I90A 5IGEA 1YIJA 4BBRB 5C4JH 4IOAA 3I4NG 1SE8A 3JAME 3H6MA 3KUPA 4K2LA 1JWMD 1KAAA 2MPMA 2MP1A 3PUWA 4LUOA 4DV2L 3DXJC 4DR3Q 4XT3B 2PMZE 4TQUS 1JQYD 1YJWA 4C1NI 3OTOQ 1MBYA 2MQHA 1STNA 1S4ZA 3U58A 5DLQE 4HJ7A 2EJGC 3ITPA 4PQXA 4CJ1B 3ZJYC 2AQ3B 2AKWB 1L2FA 1STGA 5IWAQ 3S14H 1TS2A 3M9BA 1Q81C 3K0XA 3NXWA 4UY8C 4IFDJ 1GUOA 1PFNA 1XXGA 4EGVA 2LSSA 3EIVA 1PFSA 4RWSC 4JBJA 1I5FA 4FXKC 4IO9A 5C3EG 3CW2C 3VR4A 1VQLA 1LTRD 2RHSB 2VL6A 1B7YB 2BH8A 3T51B 4G7OC 1B2TA 2F52A 4A3GG 4JI4Q 3S2DB 3A55A 1CM9A 2JSOA 1VQ5A 2E2HH 2EXDA 1L1OA 1VQNA 2EY6A 1EL0A 4DFAA 5C5MA 2NWGA 3DHQA 2UUCL 2RVLA 5I6WA 4JI6L 2G5DA 1OXUA 2HHHL 5IT9E 1UWVA 3J80L 1HNZQ 1GHKA 3HZXA 4DV6Q 2ZXPA 4BY7G 1HNXL 5FLXc 3KF8A 1JOKA 2F0LA 3CC7A 1YNND 4C3JH 1ZKOA 2KBNA 1CKOA 2JA7H 4QMGA 2WB1B 3Q23A 4XQQA 4HTHA 1EY4A 3FKIB 1EY6A 2QILA 4DKAC 1TWFH 1TWHH 2K1BA 2BH2A 5GAGC 4ZQ3A 1C0AA 1KRTA 1ICWA 4POGA 3GTMH 1RIPA 2WAQE 3HOVH 1J5EQ 2R7DA 2RBMA 5LL6S 1V9PA 2PQEA 4A3BH 5ISRA 2EY1A 1VMCA 2J4XA 5KYLA 4K8IA 4IUNA 3ULLA 4Q0FA 3HKZB 4P74A 3NBIA 1SR3A 4C3IH 3TS0A 2PQAA 2RA4A 4IFDI 2VNUD 4DR2Q 4JI1L 5IGGA 3NTKA 1ZYRD 1ZEQX 2ZM6L 1N8RC 2UXCL 2I5MX 1BCPB 2ENBA 2QKIC 2F3VA 5JAVA 2F0EA 3U9SA 3PO2B 4A3MH 1CSPA 2UXDQ 1PTOF 4LF4L 2BA1A 1BVSA 1EYDA 1VQFA 1JB7A 5AFWA 4F88A 2KCMA 2M9VA 3BDLA 1EWIA 4JVZA 1E1OA 1EOTA 3HOYB 2HIVA 1I3QH 4LF5Q 1JC7A 1QWYA 2D0PA 1ICFB 4G7ZC 1CQVA 1C8CA 1VQMA 3UI2A 3LNNA 3S1MB 4DR6Q 3MFYA 1EU4A 2F4IA 1CHQD 4ME5A 4B3TQ 1EIHA 1EU3A 3GTJH 2E5LL 3J81i 2OF1A 1BCPD 5I6YA 4C1NK 4A3DH 4A93B 4LW1A 1YNXA 1KXLA 4KHPQ 2IY5B 3VR5A 4A3JB 3RZOH 2V1CC 4AYBE 2OQ0A 4PZ8A 1EY7A 1IBLL 4R4QA 2QEXA 1AEXA 4JI0Q 1S5FD 4CDFC 1VQ6A 1K73C 3KLRA 1YHQA 2A1AA 5C44B 1DD2A 4XT1B 3E3XA 4BA2I 1EIFA 4LF9Q 4R9WA 5LHY1 1HCZA 4LFCL 1TS4A 3U50C 2L55A 1TY0A 1UE6A 1PYWD 1F2YA 4JBKA 1N32Q 2EZVA 3M4OH 1I4PA 4L63B 1SEBD 3A54A 1GJXA 1Y8OB 3CRLC 3W1GA 1GVPA 3SHLA 2A74C 3CP0A 2NZOA 3TP6A 2C9OA 1JB3A 1LTID 4GLAC 3S1NH 3K7AH 3AFQA 2R7ZH 1IHZA 5D65A 2CH4A 4X3SA 3VR3A 2UU9L 2KENA 4OX9Q 4EQNA 4GOPB 4MIUA 1WCMG 3TZUA 1KNAA 4ZAIA 2I0QA 4E6IA 3NELA 2EY2A 3JAML 3GV6A 4OEMB 1JJGA 1PH4A 2NN6G 5CBAE 4QCLA 4LWCA 5C4XG 4ZKCB 1N36Q 3S16H 2KQ3A 4CKCA 5FJ8G 4R8IA 2R92G 3P7JA 3GTLH 2EPBA 1XYIA 2VW9A 1NNXA 3E0JA 4DF7A 2Z6KA 4A3KB 3SDZA 4OWWB 2B39A 1NUCA 2K28A 1KHIA 5EPKA 4GKKL 5LMNQ 4K5XA 4DR7Q 1HNWQ 1VCIA 2JEAI 5C4JB 3GD7A 2N8NA 1SMYC 4DV0Q 4ZCKA 5DNFA 2JE6I 3ULPA 1P8LA 2ZJPA 1CFMA 4AIMA 2RDFA 1WTOA 2NVYH 4DAPA 1E3PA 3ERQA 1C9OA 3KF6B 2IT1A 3FEWX 3L9AX 4DUYQ 2NVXH 1ILQA 1LV9A 4V0BA 1SNOA 2BDNA 1V1PB 3OWEB 3ULJA 3QO2A 4POFA 3D0FA 3BU2A 4A3IH 5I9PA 3KK7A 1SYFA 1HFNA 1KABA 5EBCA 3I73A 4CKEA 1FYCA 3HG9A 3S14B 2FFKB 2K5QA 2OXPA 3A5ZB 1STEA 2AWOA 3ERSX 3ICEA 1BBUA 1RD9D 4MTKA 5IT9L 3ND8A 2E75C 2VQEQ 4K0KQ 1YHAA 4UDUC 4X3TA 3M4PA 1FVIA 4NXNL 1XMOQ 4K8JA 3I8ZA 5IYDG 1B3AA 1G2SA 2K5NA 5C0XI 3RLOA 4KLKA 2KEDA 2XWJB 4APVA 2OCEA 3R93A 4OGQC 2E2HB 5IYCH 5JEAG 3T1HQ 1MSHA 4Y52H 3MXPA 1G6PA 2CHBD 1GUNA 4L5SA 5ELBA 3NWSA 3HOUH 3NPPA 4HCSA 2I07B 3U9OA 5J22A 1K8AC 1BF4A 2LKVA 4KN7C 1J6QA 1VQAA 2WKDA 5KGUA 4DR5L 5IODA 3GTPH 3D4WA 2A6ED 3UE1A 2A73B 5EJWA 2B2WA 2BCOA 1AE2A 5CORA 5CYUA 2R93G 2RDHA 2NTTA 4C3JB 4JCVE 3BDCA 5EAYA 1KIXA 2JA7B 3G71A 3K5OA 1U4MA 1IW7C 1TWFB 1SE3A 1TWHB 2JA8H 4JI3L 4DV7L 1G2TA 3NTIA 1ASZA 1PMRA 3EBEA 1JT8A 3GTMB 1XJVA 1TS5A 3HOVB 1WYDA 4RMFA 2Q8RE 3CCUA 1TWGH 4LF8L 1SDFA 1SYDA 1D5ZC 3DWAA 4A3BB 2MJ8A 1Q3LA 3T13A 1YBYA 4C3IB 2R61A 4M8AA 1I6VC 3I4MH 4QIWE 3K59A 1JMCA 5CBEE 2Z9HA 1U4RA 1Y1WG 1X55A 4O2DA 2CW0C 4A3MB 4CDEC 4R4IA 1E22A 2L9HA 5E3FA 3B6YA 3EJIA 3HRZC 3K7UC 4XIGS 3H0GH 1MIUA 1NR4A 1QZGA 2BA0A 1K28A
chains in the Genus database with same CATH topology
1I3QB 2K03A 5C0XH 5DM73 5K36G 3J7YW 3GTJB 3SR1A 1KTKA 5I4DA 2EYJA 2A68D 4A3DB 2IW3A 2B2VA 5ELDA 1STBA 2AQ2B 1TVXA 3TBIB 1WVLA 2G9HD 3RZOB 4ZRZA 3MEHA 2RKSA 3MWYW 1GUSA 1SSOA 2MUYA 2R3ZA 2K7VA 4OO1I 1CA6A 1UUPA 2E2DC 1BDOA 4OHJA 1GUGA 2SOBA 3SE0A 5JEAH 4KHZA 3M4OB 1HPCA 4ABNA 4ZUJA 3NE5B 3MA2B 2MGSA 3V2TA 4K5WA 3Q6SA 4ILWA 1WTPA 1JWSD 1SAPA 3S1NB 3K7AB 2D2CC 1TT2A 1TR5A 4I7ZC 4TKOB 2R7ZB 1F9QA 2XRQD 3T4AC 4RGTA 1EIGA 5HURA 1GUWA 1E2VA 4K6DA 3Q0AA 5NUCA 4LJZC 4RFBA 3S16B 3FMCA 1UNSA 3GTLB 2K5WA 2DY7A 5IGDA 2R6GA 1YNNC 4G57A 1IYUA 4HEDA 5ELCA 4DK0A 4DXFA 1F9SA 3C2PA 2Z1CA 2F0DA 2A6HD 4OIJA 2Z4HA 1STYA 4ZLTF 1F2ZA 3PIO3 1FD7D 2NVYB 1I4XA 3K58A 3FPUB 5I2YA 2NVXB 1EEID 2WAQB 5BN3A 4XTCS 1RJTA 1ZYRC 4A3IB 1KDCA 4DGZA 1WTWA 1FNUA 1TU2B 3DWPA 1A3UA 4IZ8A 2D9UA 3H94A 2IL8A 3VYTA 3MVVA 3VA5A 1LTBD 1BO0A 4MHEA 2A69D 3A8JE 4KD3A 2PW7A 3TP5A 3DUZA 5F2DA 3OMGA 3I72A 1C48A 3NUCA 4KV6A 3MXNA 4KK7A 1U9RA 4H44C 1EZ8A 3NQIA 5T1GA 4FF1A 1YNJD 3HOUB 4KKUA 1CA5A 4KD4A 1BCPC 2NZ1D 3H09A 1ESFA 3GTPB 2AUJD 5E4WC 1XWEA 4IUQA 1F2LA 4PMBA 4AYBB 2FMCA 1GHJA 1B53A 2JA8B 4PV1C 2F0JA 1AN8A 3EROA 3QOLA 2X6LA 4HCEA 4G4KA 3NWTA 1TWGB 2F3WA 1O7LA 4K14A 1E2WA 1GUTA 3QG1A 3I4MB 1EY8A 5EKLA 3VR2A 2KEEA 3TN2A 1DXMA 3FDTA 4QF4A 2IPKD 5IGCA 1DOMA 4ZKBB 5CV9A 3CHBD 3K5MA 1STAA 2VXWA 3H0GB 5ELFA 3J81L 4C3HG 3H91A 3LWUA 1PZKD 3NTHA 1IKMA 1DM0B 5FO7B 4MN3A 3EFXD 4FF4A 3SXHA 3H3VC 1EEFD 2X69A 4IFDG 1O80A 1PZJD 3PV0A 4L6TB 1V1PA 1HA6A 1O7ZA 4KY5A 1SXTA 4FF2A 1L0XB 2LMCB 3OHXC 2F0OA 2NVQB 2EJMA 3M85A 4FVMA 4BWGB 4RGNA 1J9OA 3PO3B 1SBBB 2D5DA 2PCFB 3TMEA 1EFID 1UEAB 3HOWB 5M5WB 1AP0A 4X3KA 2XNAC 4OIKA 3S1QB 2Z4IA 2XN9C 3AU7A 3TDQA 3CU7A 3BS1A 1QOHA 1WTVA 1MI2A 2EVBA 1CZGA 1U4PA 4RKLA 3S9WA 2RDGA 1X32A 1ILPA 2X6GA 3L3OC 2J0TD 5EGTA 4WJWA 1MD2D 1ZXTA 3S17B 1AFPA 4KMUC 1PDQA 2EXZA 2A6EC 5CC4A 2DNEA 3EVQA 5A2QL 2Z8LA 4CGYB 3TP8A 1NCVA 3SVMA 2XVSA 2M2LA 3LWEA 2J7ZA 1LABA 1RTOA 3NP8A 5CV7A 3EQLC 5DAUA 3N6RA 4CJ0B 5M5XB 2KVMA 5FO8B 4LMQD 3NHHA 4K5VA 2K04A 3I70A 2IX3A 1PTOH 1X3QA 2QF7A 4QUFA 3K5LA 1D5XC 2G9DA 2IX0A 4FP5D 1LO5D 1LT4D 4XXEA 1PFBA 4ID6A 3GV3A 4RGMA 2E76C 2SEBD 1O7YA 3KBXA 4NMZA 1H9JA 3BVMA 2F0QA 5M3MB 5JPNC 2F0MA 1WD1A 3G7LA 2JP1A 2KCNA 2VB2X 5C0XJ 2WACA 2NBFA 3OIPA 1ENCA 1KDBA 1JOQA 4QIWB 4A3EB 2B2TC 1MGSA 1JE4A 1R4PB 2B2YC 4DAYA 3D6WA 3BYTB 1R9TB 1A3TA 4U673 3T56B 2QCPX 4FNFA 4DK1A 3GO5A 5CR3A 2DN8A 1QCBD 3SK8A 3D6CA 5D14A 2A68C 3QB3A 5EPLA 2WP8J 1G91A 2B63B 3ZYYX 3WOEA 4XDXA 4CJ2C 1FNWA 4FYDA 1I50B 5CV6A 2KCCA 1CZWA 2F03A 5JEAJ 1GOZA 2NN6I 1LTSD 2NVTB 1SJHD 3PUXA 2K01A 4NW2A 1Y1VB 5JOBA 4Q5VA 5JVH3 3OSOA 1A2TA 3KLSA 2JA6B 5D3DA 5FO9B 4UAIA 1M4VA 1SE2A 1JICA 4CHTB 3A56A 3K6OA 4J8QA 1VF5C 2YU9B 5G3LF 2PNRC 4U68A 5EKKA 2QEJC 2Q8IB 3M7GA 2KHSA 5CV8A 4ULLA 3J7AF 3PMFA 5KYIA 2K5DA 3GQBA 4M1UB 1HRJA 2JEBI 4DNRB 4EQOA 1LTAD 1PTOC 1EYAA 1SYGA 5DM63 1UAPA 3M7NA 1EQVA 3PUYA 1FGBD 1PLFA 3J7AV 5C3WA 1HUNA 1IKLA 1Q90A 2A6HC 4DN4M 1H9SA 5FKAC 1BOSA 1QILA 2JXMB 4HMIA 2F0FA 3IL8A 3K0YA 1LT6D 2AWNA 4EQPA 2NN6H 2TMPA 5CV5A 4KJNA 1PRTF 3ONAB 4J6HA 1NAPA 1W6KA 5EBDA 1SNCA 2O4XA 2EYOA 1J8IA 1S5BD 2F0UA 3FPPA 4BS9A 2A69C 3DM1A 5IGFA 1CQFA 5C4HA 1BBXC 2TSSA 3I4NB 3DEOA 4KY7A 3W3AA 2WV6D 1TWCB 3SEBA 1Z7TA 4KN4C 1V1OA 5JVG3 3GTOB 5KNDA 3HGBA 1Y69U 1TQOA 2O5IC 4OO1G 1YNJC 4XQJA 1F9RA 3RD4A 5JJZA 2K6AA 1EQTA 1QJOA 5FLXL 3J81E 1B50A 1F77A 1LACA 3HEJA 2F0HA 1VDZA 1II3A 1NR2A 2H4OA 3OWFA 2N55A 3P1HA 4K6LA 5C3EB 1M8AA 1Y8NB 2SDFA 3MC0B 4A3GB 5C3XA 3FRPB 3AMUA 2CVRA 2PMZB 3A7LA 1PTOB 3SK4A 4G7HC 4FXGC 5J1ZA 4CKBA 1LLRD 2N88A 3URYA 1RHPA 1RF2D 2B8GA 2V4DA 3BG3A 4B9XA 5C5LA 2IWHA 2IX1A 4HSVA 1WTQA 4BY7B 2F1MA 2NB0A 2IJ0A 3D31A 1QE6A 5KEEA 1QNKA 2F0VA 2FHTA 2OT2A 1G6ZA 3K57A 3N52A 1B9MA 1VF7A 2F0GA 2L12A 1HTLD 1PTOD 1SYEA 1JORA 3VYRA 3O13A 4OL7A 4IUTA 2HCIA 3MFGA 1B9NA 2EOTA 1B1ZA 4YIJA 4KTAA 4NP5A 1QNUA 1EY9A 2RSNA 2RSOA 4HR7B 5DEHA 3R3OA 4PNYA 1RTNA 1I6HB 5T1IA 2FINB 3E6ZX 5A2QE 2ZT9C 3HS0C 4DNTB 1E2ZA 1F9PA 1TWAB 4RAUC 1ESRA 4F7XA 1A15A 3BYYB 3SK6A 1BXTA 3GP7A 1AZPA 3IFTA 3S2HB 3PUZA 3QOJA 4ZK9B 4C3JG 2WIIB 1KLGD 3A8IE 1D5MC 5IOCA 5K36H 4WORA 5IIFA 1SNQA 1KDAA 3I4LA 5KRUA 3BVGA 1HHVA 4KHVA 1SYBA 3C46A 3T53B 1FR3A 3BDOA 5BN4A 5CGKA 2ID0A 2PO4A 1AW7A 1EY0A 1IL8A 3PIP3 1CHPD 2LY7A 3BVZA 4C3IG 4K2KA 5JPMC 1TS3A 2BE5C 1A3VA 5M5YB 3OW7A 2HDLA 3IKJA 3IFDA 4O1NA 3D4DA 2VB3X 3S15B 3MXUA 4FF3A 1CTMA 4FO2A 5M9OA 1JCKB 1W6JA 5J39A 3LX0A 3SK5A 3I3CA 3VA7A 4H13C 1SJED 4PMWA 4NKLA 2I46A 3V96A 1WCMB 3RZDB 2PPBC 4WFN3 2E74C 5C4XB 5CV4A 4DXGA 3OOCA 2R92B 1TY2A 1T5EA 1ET6A 2HCCA 4RGOS 3EA6A 2AUKA 3W2DA 1DYQA 1E0BA 1T5XD 2F0TA 5KNCA 4B08A 1DOKA 2ZXOA 3P20A 4XYOA 3AB9A 3G6JB 4C56C 3MTSA 5G3LD 1LTGD 1RKNA 1QB5D 4KKTA 4S3SA 3QIAA 1K83B 1OXSC 1A2UA 4IUPA 5LL6X 1BUVT 2EYHA 1PFMA 3CKIB 4IALA 2A5HA 4CBVA 1H9KA 1PRTB 3X3MA 1D2BA 5BN5A 1CK1A 1V8QA 1EZ6A 3OMCA 4IURA 4V190 1AZQA 1WTRA 2L5TA 4Z9CB 1OXXK 1S5ED 4N9PA 1ONLA 1S5DD 4IUUA 2WKCA 4QB4A 3Q22A 5A35A 2HQEA 2R93B 1PRTD 2L1BA 3FVQA 1NSNS 4ZUIA 2O2LD 2C5CA 2BE5D 1KNEA 1ENAA 2EYPA 1CI3M 1S5CD 2NYZD 4TRDA 3TZDA 1I4HA 1OXTA 5FOBB 1Y8PB 3R2TA 1MSGA 3RUZA 2B2TA 1SNDA 2ICIA 1I4GA 2B2YA 4XYQA 1RODA 5C6AA 2KECA 3VYUA 5I9OA 3NK9A 1EYCA 5FLXE 3S1RB 4KY6A 1Y1WB 1RCVD 2SNSA 2FMMA 3GTQB 3R2IA 4DU9A 1QG7A 4F87A 2F0WA 1F2MA 1HTPA 3D4RA 1TKWB 2KA7A 2F0PA 3PUVA 1SFOB 3QWNA 2K05A 3D3RA 2BOSA 2EDGA 5M3FB 5EKIA 4BY1B 5TSSA 4DA2A 2SNMA 4IFDH 1D6EC 2WINB 3CRKC 2PYKA 3RLFA 2RQXA 4C2MB 4IQZA 3IAYA 2E2IB 4H7BA 4J1MA 4EVOA 1BR9A 3TP7A 3DMUA 5KIXA 1SNMA 3NBHA 1D1IA 4BBSB 4TSSA 4O42A 2L11A 2EE1A 3HP3A 1R4QB 4WRDA 3VR6A 3HOZB 5C0XG 2L4NA 3A8KE 2CQAA 1D1KA 4RCNA 3MAQA 1LT5D 4LAAA 3I91A 1ML0D 2LFNA 2M00A 1ET9A 2NTSA 4N9TA 2XSCA 1DOLA 3R8BA 1OO9B 4IUVA 4LK1C 1BNZA 3QJYA 1L0YB 1EWHA 3MXGA 1X3PA 4RKBA 3MZ5A 1WD0A 1Z6HA 4RHSA 4HN7A 3HOXB 2GA4B 5EPJA 2HDMA 3K5NA 3NSWA 1B4OA 5FK9C 1WTXA 2PZWA 3GTGB 3DWQA 1HQMC 2LS01 3BZDB 2KJXA 1Q1EA 4RCOA 4BA1I 2Y0SB 2DNCA 3M3YB 5CMDA 2H1EA 3NQTA 4KI0A 4P2CB 1K8MA 2FJ2A 1XTCD 1FNVA 1DZ1A 1Q12A 3KLSX 3OPOA 2K33A 4HMJA 3VYSA 1JWUD 3C1EA 4ZYSA 1LT3D 3L7ZC 3M4YA 1ENFA 3WOFA 2DY8A 2EJFC 1HUMA 1CT1D 1V43A 1Q1BA 1HFGA 1RDPD 1BCPF 2JA5B 2B2WC 1LTTD 3P75A 4HSPA 1H9RA 5E1FA 1C4QA 1SNPA 4F8MA 3KBGA 4RH6A 4DAVA 2HUGA 4QUCA 3TSSA 2YYZA 4B9WA 2VUMB 2XRSD 1SMYD 3WDNA 3J80E 5D3IB 2BDOA 1PXUA 3E5SA 4L8JA 3Q24A 2QDBA 1IYVA 5E4XA 5HGTA 2O5JC 2B8FA 2JYOA 4I65A 4JBWA 1U4LA 2EYFA 1I4QA 3C3LA 2KUMA 2Q8TA 5C4ZA 3T16A 1VMPA 4C3HB 3CQZB 2EYMA 3OIQA 5I2XA 3RMHA 1JR0D 1BQQT 2B2UA 2K32A 1G291 3C1FA 2F0SA 2B2VC 1HA5A 1G8ZD 3A7AB 1TIID 2F0NA 1STHA 1DCZA 5IGBA 1B44D 4FXDA 5K5PA 1I4RA 2EY5A 2L0CA 2ZXRA 3ND9A 1Q8IA 4ODGA 2D62A 1Z47A 4RA8A 2PZTA 4XQNA 1PZID 2PZUA 4X3UA 3V05A 2PW5A 2KOLA 2F0KA 2ICEC 4R8NA 5COYA 1EY5A 1DJRD 1IW7D 1HXYD 4HAEA 3GTKB 2B2UC 1GXDC 2OEOA 4RHRA 4H0LC 2E2JB 3F2UA 4IN3A 1SYCA 3MHBA 1H9MA 1XX8A 4KJOA 5KNBA 2EYLA 1H9SB 4OO1H 3D8GA 5EQ0A 3X3NA 4PMCA 1EWCA 4A3FB 1JOOA 5ELEA 4JK1C 1HQRD 2CW0D 2AQ1B 2F0IA 4KKSA 1PRTC 1KLUD 2XWBB 1SE4A 4Y7NB 2MHVA 2XIWA 4NDXA 1O78A 1DONA 4GZYC 1OXVA 3DEPA 1K8OA 1A6XA 2NUCA 3I90A 5IGEA 4BBRB 3JAME 3H6MA 3KUPA 4K2LA 1JWMD 1KAAA 2MPMA 2MP1A 3PUWA 3DXJC 4XT3B 4TQUS 1JQYD 4C1NI 1MBYA 1STNA 1S4ZA 2EJGC 3ITPA 4PQXA 4CJ1B 2AQ3B 1STGA 1TS2A 3NXWA 4IFDJ 1GUOA 1PFNA 1XXGA 4EGVA 4RWSC 4FXKC 3VR4A 1LTRD 3T51B 4G7OC 1B2TA 3S2DB 3A55A 1CM9A 2JSOA 2EY6A 1EL0A 4DFAA 5C5MA 2NWGA 3DHQA 2RVLA 5I6WA 1OXUA 5IT9E 3J80L 1GHKA 3HZXA 2ZXPA 3KF8A 1JOKA 2F0LA 1YNND 1ZKOA 4QMGA 2WB1B 3Q23A 4XQQA 4HTHA 1EY4A 3FKIB 1EY6A 2QILA 2K1BA 4ZQ3A 1ICWA 5LL6S 2RBMA 2PQEA 5ISRA 2EY1A 1VMCA 2J4XA 5KYLA 4K8IA 4IUNA 4Q0FA 3HKZB 3NBIA 4IFDI 2RA4A 2VNUD 5IGGA 3NTKA 1ZYRD 1ZEQX 1BCPB 2ENBA 2QKIC 2F3VA 5JAVA 2F0EA 3U9SA 3PO2B 1PTOF 2BA1A 1EYDA 5AFWA 4F88A 2M9VA 3BDLA 1EOTA 3HOYB 1JC7A 1QWYA 4G7ZC 1CQVA 1C8CA 3UI2A 3LNNA 3S1MB 3MFYA 1EU4A 2F4IA 1CHQD 4ME5A 1EIHA 1EU3A 2OF1A 1BCPD 5I6YA 4C1NK 4A93B 3VR5A 4A3JB 1EY7A 1AEXA 1S5FD 3KLRA 5C44B 1DD2A 4XT1B 4BA2I 4R9WA 5LHY1 1HCZA 1TS4A 2L55A 1TY0A 1PYWD 1F2YA 2EZVA 1I4PA 4L63B 1SEBD 3A54A 1GJXA 1Y8OB 3CRLC 3SHLA 2A74C 3TP6A 2C9OA 1JB3A 1LTID 1IHZA 5D65A 4X3SA 3VR3A 4EQNA 4MIUA 3TZUA 1KNAA 4ZAIA 4E6IA 2EY2A 3JAML 3GV6A 2NN6G 5CBAE 4QCLA 4ZKCB 2KQ3A 4CKCA 4R8IA 3P7JA 2EPBA 1XYIA 3E0JA 4DF7A 4A3KB 3SDZA 2B39A 1NUCA 2K28A 5EPKA 4K5XA 1VCIA 2JEAI 5C4JB 3GD7A 1SMYC 5DNFA 2JE6I 1CFMA 2RDFA 1WTOA 4DAPA 3ERQA 2IT1A 3FEWX 3L9AX 1ILQA 1LV9A 4V0BA 1SNOA 2BDNA 1V1PB 3OWEB 3QO2A 5I9PA 3KK7A 1SYFA 1HFNA 1KABA 5EBCA 3I73A 4CKEA 1FYCA 3HG9A 3S14B 2FFKB 2K5QA 2OXPA 1STEA 2AWOA 1RD9D 5IT9L 3ND8A 2E75C 4UDUC 4X3TA 4K8JA 3I8ZA 1B3AA 1G2SA 5C0XI 2KEDA 2XWJB 3R93A 4OGQC 2E2HB 5JEAG 1MSHA 3MXPA 2CHBD 1GUNA 5ELBA 3NWSA 3NPPA 4HCSA 2I07B 3U9OA 5J22A 1BF4A 2LKVA 4KN7C 5KGUA 2WKDA 5IODA 3D4WA 2A6ED 2A73B 5EJWA 2B2WA 2BCOA 5CORA 5CYUA 2RDHA 2NTTA 4C3JB 3BDCA 2JA7B 3K5OA 1U4MA 1IW7C 1TWFB 1SE3A 1TWHB 1G2TA 3NTIA 1PMRA 3GTMB 1TS5A 3HOVB 2Q8RE 1SDFA 1SYDA 1D5ZC 3DWAA 4A3BB 2MJ8A 1Q3LA 3T13A 4C3IB 2R61A 4M8AA 1I6VC 3K59A 5CBEE 1U4RA 2CW0C 4A3MB 2L9HA 5E3FA 3EJIA 3HRZC 4XIGS 1NR4A 2BA0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PMC A;  3QB3 A;  2SNM A;  2F3W A;  2OXP A;  3HZX A;  1JOO A;  4EQP A;  2F0D A;  2PZW A;  4RKL A;  5CV5 A;  5HGT A;  4KJN A;  2F0G A;  2PYK A;  4I65 A;  3S9W A;  1SYE A;  2F0I A;  1EZ6 A;  3OMC A;  2EYF A;  1JOK A;  1STY A;  4J6H A;  1JOR A;  4K14 A;  2F0L A;  5CV6 A;  1F2Z A;  4OL7 A;  5EGT A;  1SNC A;  1EY8 A;  2O4X A;  4K8J A;  3SR1 A;  5EKL A;  5C4Z A;  3D4D A;  2EYO A;  1F2Y A;  2EYJ A;  2F0U A;  3T16 A;  4QMG A;  4YIJ A;  4KTA A;  4NP5 A;  2EXZ A;  4H7B A;  4HTH A;  4QF4 A;  3NQT A;  1EY9 A;  1STB A;  1EY4 A;  3EVQ A;  5CC4 A;  4N9P A;  5IGC A;  5M9O A;  1EY6 A;  4J1M A;  4NDX A;  4EVO A;  3TP7 A;  5IGF A;  5CV9 A;  3TP8 A;  3SHL A;  3MXP A;  2EYM A;  5C4H A;  4QB4 A;  3DMU A;  3MEH A;  5J39 A;  2RKS A;  3LX0 A;  1STA A;  3SK5 A;  3TP6 A;  2HQE A;  5KIX A;  4ZQ3 A;  1SNM A;  1KDC A;  4DGZ A;  3U9O A;  5DEH A;  4KY7 A;  5J22 A;  4NKL A;  3R3O A;  2LKV A;  5KGU A;  5JOB A;  1NSN S;  2NUC A;  3NP8 A;  4PNY A;  5CV7 A;  4IZ8 A;  1A3U A;  4ZUI A;  2RBM A;  3OSO A;  5IGE A;  5IOD A;  4HMJ A;  3MVV A;  3C1F A;  1A2T A;  2F0S A;  2PQE A;  5DAU A;  1IHZ A;  3D4W A;  5ISR A;  5CV4 A;  2EY1 A;  3C1E A;  3VA5 A;  5KYL A;  4K8I A;  4IUN A;  3NHH A;  4K5V A;  1ENA A;  1TQO A;  4EQN A;  2EYP A;  3H6M A;  4MIU A;  4K2L A;  4TRD A;  3SXH A;  1KAA A;  2PW7 A;  4KD3 A;  2F0N A;  3TP5 A;  5IGG A;  2SOB A;  5F2D A;  4E6I A;  2EY2 A;  3OMG A;  1STH A;  3BDC A;  4WRD A;  5EKK A;  5IGB A;  4F7X A;  5CV8 A;  2KHS A;  2ENB A;  3NUC A;  2KQ3 A;  4KV6 A;  3PMF A;  3SK6 A;  3HEJ A;  2F0H A;  2F3V A;  4ID6 A;  4ZUJ A;  3RUZ A;  5JAV A;  5KYI A;  2F0E A;  1II3 A;  1SND A;  1U9R A;  2EY5 A;  1STN A;  5K5P A;  1EZ8 A;  3QOJ A;  3OWF A;  4EQO A;  4NMZ A;  3P1H A;  3ITP A;  4DF7 A;  4ODG A;  1EYD A;  3P75 A;  5IOC A;  4WOR A;  2F0T A;  2PZT A;  3BDL A;  4K5W A;  4KY5 A;  4KD4 A;  4LAA A;  1NUC A;  3V2T A;  2F0Q A;  5C6A A;  2PZU A;  1SNQ A;  5E1F A;  1KDA A;  5IIF A;  2M00 A;  4K5X A;  2F0M A;  1EYA A;  5I9O A;  5KRU A;  3NK9 A;  1SYG A;  1STG A;  1SYD A;  4N9T A;  2PW5 A;  1EYC A;  1TT2 A;  1TR5 A;  1SNP A;  2F0O A;  3NXW A;  2F0K A;  1RKN A;  2WAC A;  4KY6 A;  4R8N A;  5C3X A;  5HUR A;  2SNS A;  4KHV A;  1ENC A;  1KDB A;  4F8M A;  1SYB A;  1JOQ A;  4DU9 A;  1EY5 A;  3T13 A;  4S3S A;  4ME5 A;  3SK4 A;  1EQV A;  2F0W A;  1F2M A;  3E5S A;  5CGK A;  5J1Z A;  1A2U A;  2OF1 A;  4K6D A;  2RDF A;  2OEO A;  3TME A;  1EY0 A;  5C3W A;  5NUC A;  5I6Y A;  4PMB A;  4B9W A;  2EYH A;  1A3T A;  1SYC A;  3ERQ A;  5IGD A;  3MHB A;  4B9X A;  5C5L A;  2EY6 A;  4RKB A;  5CR3 A;  1SNO A;  4KJO A;  4K2K A;  4DFA A;  2F0P A;  2F0J A;  3MZ5 A;  5C5M A;  5E3F A;  1EY7 A;  2EYL A;  3ERO A;  4G57 A;  4HMI A;  4IAL A;  3EJI A;  3DHQ A;  3QOL A;  3SK8 A;  2F0F A;  1AEX A;  3D6C A;  5I6W A;  3D8G A;  1A3V A;  1SYF A;  5I9P A;  5KEE A;  1KAB A;  2F0V A;  2QDB A; 
#chains in the Genus database with same CATH topology
 1I3Q B;  4NPS A;  2K03 A;  4X66 Q;  5C0X H;  5DM7 3;  4JYA L;  2KCT A;  5K36 G;  5LMN W;  1LUZ A;  4EX5 A;  3J7Y W;  2LXJ A;  5M3F G;  5IP9 G;  1JE5 A;  4ME3 A;  3SR1 A;  3GTJ B;  1KTK A;  4BY1 G;  4DAY B;  4A3L H;  3LGJ A;  5I4D A;  2EYJ A;  2A68 D;  4A3D B;  2IW3 A;  2B2V A;  5ELD A;  1STB A;  2AQ2 B;  5JJL A;  5LMU L;  1VQI A;  1TVX A;  3TBI B;  1WVL A;  2G9H D;  3RZO B;  4HIK A;  3BJU A;  4ZRZ A;  3MEH A;  1PH8 A;  4JI7 L;  2RKS A;  3MWY W;  1GUS A;  2UUC Q;  1SSO A;  1YJ9 A;  1AH9 A;  2MUY A;  2R3Z A;  2K7V A;  4OO1 I;  2NVQ H;  3H3V I;  3NBH B;  1CA6 A;  1HNX Q;  4IJL A;  1UUP A;  2E2D C;  1BDO A;  1UE5 A;  3PO3 H;  4OHJ A;  1GUG A;  4LF7 Q;  1VQH A;  2SOB A;  3SE0 A;  2K5V A;  4BBS G;  1XNQ L;  2I5L X;  3RLN A;  5JEA H;  4KHZ A;  4GNX B;  3M4O B;  1HPC A;  3HOW H;  2VS1 A;  4DNI A;  4ABN A;  5M5W H;  4ZUJ A;  3NE5 B;  3S1Q H;  1PYS B;  2WFW A;  3MA2 B;  3UE0 A;  2Z0S A;  2MGS A;  3HOZ G;  3V2T A;  1YIT A;  4K5W A;  3Q6S A;  4ILW A;  1WTP A;  4LF6 Q;  3BZK A;  1JWS D;  1SAP A;  3S1N B;  1VQO A;  3K7A B;  2D2C C;  1TT2 A;  4JV5 Q;  1TR5 A;  4I7Z C;  4TKO B;  2R7Z B;  1F9Q A;  2XRQ D;  3T4A C;  4RGT A;  1EIG A;  5HUR A;  1GUW A;  2NZH A;  1E2V A;  4MZ9 A;  2ALY B;  4GLV B;  4DR1 Q;  4JI1 Q;  4K6D A;  2CKZ B;  4P71 A;  2ASB A;  3S17 H;  3Q0A A;  1YJN A;  1V1Q A;  5NUC A;  4LJZ C;  1IBM Q;  4RFB A;  3S16 B;  1K0R A;  3JC6 6;  3FMC A;  1UNS A;  4IOC A;  3GTL B;  2K5W A;  2DY7 A;  5IGD A;  1MJC A;  1WI5 A;  2R6G A;  3CME A;  1YNN C;  4G57 A;  1IYU A;  4HED A;  4LF4 Q;  5ELC A;  4DK0 A;  2Y0S E;  4DXF A;  1F9S A;  3C2P A;  4OON A;  3CCL A;  2Z1C A;  2F0D A;  3T1Y Q;  2A6H D;  3J7A 5;  4OIJ A;  2Z4H A;  5M5X H;  3TRE A;  1STY A;  4ZLT F;  3HOX G;  5FLM H;  1F2Z A;  2KHJ A;  3KOJ A;  1YI2 A;  2E8G A;  3PIO 3;  2E5L Q;  1FD7 D;  2NVY B;  1I4X A;  2IHF A;  3K58 A;  3FPU B;  3PIO A;  5H1S E;  5I2Y A;  1NMG A;  2NVX B;  1EEI D;  4WJ4 A;  2WAQ B;  1SLJ A;  4YY3 Q;  1IBK Q;  5BN3 A;  4XTC S;  1RJT A;  1ZYR C;  2Y0S G;  4A3I B;  1KDC A;  4DGZ A;  4DAM A;  1WTW A;  4IPC A;  1FNU A;  1TU2 B;  5M3M H;  2MNA A;  3DWP A;  1A3U A;  4IZ8 A;  2D9U A;  3H94 A;  2IL8 A;  3VYT A;  3MVV A;  1VQK A;  2VZA A;  3VA5 A;  1LTB D;  1BO0 A;  2QA4 A;  2F3I A;  4A3E H;  1K0S A;  4MHE A;  2A69 D;  4BXX G;  3A8J E;  4KD3 A;  2PW7 A;  3TP5 A;  4LFC Q;  3DUZ A;  5F2D A;  2YTY A;  3OMG A;  2ZTE A;  3I72 A;  1C48 A;  3NUC A;  4KV6 A;  2VQF L;  1R9T H;  3MXN A;  4KK7 A;  1U9R A;  4H44 C;  5IP7 H;  1EZ8 A;  3NQI A;  5T1G A;  2UUB L;  4FF1 A;  1HR0 L;  1YNJ D;  3HOU B;  3PGZ A;  4KKU A;  1CA5 A;  1W3S A;  3KLW A;  1BCP C;  4KD4 A;  2NZ1 D;  3PIP A;  3H09 A;  1WFQ A;  1ESF A;  1JJC B;  3GTP B;  1KAW A;  2B63 H;  2N78 A;  4RG1 A;  2JA5 G;  2AUJ D;  2UU9 Q;  3J81 j;  1X54 A;  1I50 H;  5E4W C;  1Q8K A;  2K75 A;  1XWE A;  1Q82 C;  2JN4 A;  3STB C;  4IUQ A;  2F4V Q;  1F2L A;  4PMB A;  4AYB B;  2FMC A;  1GHJ A;  1B53 A;  3NEM A;  3S24 A;  2NVT H;  2JA8 B;  4PV1 C;  2F0J A;  4X62 L;  1E24 A;  4DV4 Q;  3RN5 A;  1AN8 A;  3ERO A;  2GVA A;  1LM0 A;  2X6L A;  3QOL A;  4HCE A;  4G4K A;  1Y1V H;  2KHI A;  3OW2 A;  3NWT A;  2VUM G;  1TWG B;  2F3W A;  1IZ6 A;  2JA6 H;  1O7L A;  1CKN B;  4K14 A;  1E2W A;  1GUT A;  3QG1 A;  3I4M B;  1EY8 A;  3KFU A;  3I7F A;  5EKL A;  3VR2 A;  2YU9 H;  2KEE A;  3TN2 A;  1DXM A;  4JC0 A;  3FDT A;  4QF4 A;  2IPK D;  5IGC A;  1DOM A;  4ZKB B;  1SRO A;  5CV9 A;  3CHB D;  3K5M A;  4DV5 L;  1STA A;  2VXW A;  3H0G B;  4UP7 A;  5ELF A;  2JA9 A;  3J81 L;  4C3H G;  3H91 A;  3GDE A;  3LWU A;  1PZK D;  3NTH A;  5IYB H;  3F2D A;  2EQS A;  1IKM A;  1DM0 B;  3NEN A;  1EOV A;  4LFB Q;  5FO7 B;  4MN3 A;  3EFX D;  3CPW A;  4FF4 A;  2B29 A;  3SXH A;  3H3V C;  3BZC A;  1EEF D;  3J7Z C;  1FJG L;  2X69 A;  4IFD G;  1B70 B;  4A3C H;  1O80 A;  1C7Y A;  1PZJ D;  3PV0 A;  1QVF A;  4GOP C;  1CKM A;  1DGS A;  5GAE C;  4L6T B;  3PF4 A;  1V1P A;  4CDC C;  2UUA L;  3VDY A;  1HA6 A;  1O7Z A;  2MO1 A;  3FP9 A;  3RR5 A;  4KY5 A;  1SXT A;  1UE1 A;  4FF2 A;  3UDX A;  1L0X B;  4JI2 L;  4DR5 Q;  2LMC B;  3OHX C;  1YVC A;  2F0O A;  2NVQ B;  2A19 A;  2EJM A;  2N49 A;  3M85 A;  1P16 A;  4FVM A;  4BWG B;  5GQO A;  4RGN A;  1J9O A;  3PO3 B;  1SBB B;  5JJK A;  4X64 Q;  4PZ7 A;  2D5D A;  2PCF B;  3TME A;  1EFI D;  1UEA B;  4JW0 A;  3HOW B;  1H95 A;  5M5W B;  1AP0 A;  4X3K A;  2XNA C;  4OIK A;  3S1Q B;  2Z4I A;  4P75 A;  2XN9 C;  3AU7 A;  3TDQ A;  3CU7 A;  3BS1 A;  5J3B A;  3I4N H;  4DV7 Q;  1QOH A;  1WTV A;  1MI2 A;  2PNH A;  3CAM A;  1TWC H;  1K8G A;  4DUZ L;  2EVB A;  1CZG A;  1U4P A;  4RKL A;  1PH1 A;  2K52 A;  2VY3 A;  3S9W A;  2RDG A;  3GTO H;  5BR8 L;  1X32 A;  1ILP A;  2X6G A;  3L3O C;  2J0T D;  5EGT A;  4WJW A;  4A3F G;  1MD2 D;  1ZXT A;  3S17 B;  1AFP A;  1RL2 A;  4KMU C;  1PDQ A;  2EXZ A;  1VQ9 A;  1MHW C;  2A6E C;  2DNE A;  3EVQ A;  5CC4 A;  5A2Q L;  4YHH L;  2Z8L A;  4CGY B;  3TP8 A;  1NCV A;  3I4O A;  3STB D;  3SVM A;  2XVS A;  2M2L A;  3LWE A;  2J7Z A;  1XMQ L;  1LAB A;  1RTO A;  5C3E H;  1N33 Q;  3E9H A;  4A76 A;  2UXB L;  5IE8 A;  3NP8 A;  5CV7 A;  3EQL C;  3L0O A;  4HJ8 A;  1W2B A;  5DAU A;  3N6R A;  4A3G H;  4CJ0 B;  5M5X B;  2KVM A;  1QUQ A;  2GVB A;  4LMQ D;  1K3R A;  2B3G A;  3NHH A;  5FO8 B;  4K5V A;  1N9W A;  2K04 A;  3I70 A;  1B3Q A;  2IX3 A;  1CUK A;  1PTO H;  1X3Q A;  2QF7 A;  4QUF A;  3K5L A;  1D5X C;  2G9D A;  2IX0 A;  4FP5 D;  1LO5 D;  1LT4 D;  4BBR G;  4XXE A;  1PFB A;  4ID6 A;  3GV3 A;  4QY7 A;  4RGM A;  4NXM L;  2E76 C;  2CWP A;  1O7Y A;  2SEB D;  3KBX A;  4QJF A;  4GKJ Q;  4P73 A;  1WOC A;  4NMZ A;  4BY7 H;  4DR4 L;  4I7A A;  1H9J A;  3BVM A;  2F0Q A;  5M3M B;  5JPN C;  2F0M A;  1VQB A;  1KC8 C;  5GRO A;  1WD1 A;  2Q2T A;  3G7L A;  2JP1 A;  2VB2 X;  2KCN A;  5C0X J;  2WAC A;  2NBF A;  3OIP A;  1ENC A;  1KDB A;  5AJ3 Q;  1JOQ A;  4QIW B;  4A3E B;  2B2T C;  1MGS A;  1JE4 A;  1R4P B;  2B2Y C;  4DV3 Q;  4DAY A;  4N8F A;  1HZA A;  1PVO A;  3D6W A;  3BYT B;  1R9T B;  1A3T A;  4U67 3;  3T56 B;  2QCP X;  4FNF A;  4DK1 A;  3GO5 A;  2R7F A;  5CR3 A;  2DN8 A;  2N3S A;  1QCB D;  3OTO L;  3SK8 A;  1L1O B;  5HY6 A;  3D6C A;  2A68 C;  5D14 A;  2H5X A;  2HIX A;  1I6H H;  3QB3 A;  1VQP A;  5EPL A;  4B3S Q;  2WP8 J;  1G91 A;  2B63 B;  3ZYY X;  3WOE A;  4XDX A;  4CJ2 C;  5IWA L;  1FNW A;  4FYD A;  1I50 B;  3AFP A;  3CPF A;  5CV6 A;  2KCC A;  1CZW A;  2F03 A;  1TWA H;  3KF8 B;  1VQJ A;  5JEA J;  1GOZ A;  2NN6 I;  1LTS D;  4GNX A;  4LFA L;  4EQ5 A;  3S2H H;  2NVT B;  4JI4 L;  1I94 L;  1SJH D;  3PUX A;  1Z9F A;  2K01 A;  1A8V A;  4NW2 A;  2WB1 G;  1Y1V B;  5JOB A;  4Q5V A;  5JVH 3;  3FKI G;  2K14 A;  3OSO A;  4PZ6 A;  1A2T A;  4OWX B;  3KLS A;  4UP8 A;  3ER0 A;  1X65 A;  2JA6 B;  5D3D A;  5FO9 B;  1HNZ L;  4UAI A;  4DV6 L;  4X65 Q;  1M4V A;  1SE2 A;  1JIC A;  5ELO A;  4CHT B;  3A56 A;  3K6O A;  1GM5 A;  1A62 A;  4J8Q A;  1VF5 C;  2YU9 B;  5G3L F;  4JOI C;  2PNR C;  4U68 A;  5EKK A;  2QEJ C;  4DV1 Q;  2Q8I B;  3M7G A;  2KHS A;  2PQA B;  5CV8 A;  4ULL A;  3CD6 A;  3J7A F;  3K81 C;  3PMF A;  5KYI A;  2K5D A;  3AEV A;  3GQB A;  4M1U B;  5IY0 A;  3HKZ G;  1HRJ A;  2JEB I;  4DNR B;  4EQO A;  3J80 c;  1LTA D;  1X3F A;  2I5H A;  1PTO C;  4TVA B;  4GNX C;  5M5Y H;  3PO2 G;  1EYA A;  2YTX A;  1SYG A;  1J5E L;  5DM6 3;  1UAP A;  1E7Z A;  3M7N A;  1EQV A;  1EUJ A;  3PUY A;  3HOY G;  1M1K C;  1FGB D;  1PLF A;  3G6E A;  3J7A V;  3I55 A;  5C3W A;  4DR2 L;  3S15 H;  2RCF A;  1HUN A;  2HD3 A;  4QL5 A;  1IKL A;  1Q90 A;  2A6H C;  2XGT A;  4JI8 Q;  4AH6 A;  4DN4 M;  1H9S A;  5FKA C;  1BOS A;  1QIL A;  2JXM B;  4HMI A;  3F1Z A;  2UXD L;  2F0F A;  3IL8 A;  3K0Y A;  4OWT B;  4A93 G;  2D0O A;  1LT6 D;  1WCM H;  4UPA A;  3RZD H;  2AWN A;  4A3J G;  4A75 A;  4EQP A;  2NN6 H;  5HGQ A;  2TMP A;  5C4X H;  1Y14 B;  5CV5 A;  4KJN A;  1PRT F;  3ONA B;  5FJ8 H;  2R92 H;  4DV2 Q;  4J6H A;  2ZJR A;  1NAP A;  1W6K A;  5EBD A;  1SNC A;  2O4X A;  1EQR A;  4DR6 L;  2EYO A;  1J8I A;  1S5B D;  5C44 G;  2F0U A;  3FPP A;  2XTI A;  4BS9 A;  3TRZ A;  1VQ8 A;  1UEB A;  2A69 C;  3DM1 A;  5IGF A;  4AQY L;  1CQF A;  3PCO B;  5C4H A;  1BBX C;  2TSS A;  3I4N B;  4KHP L;  1D7Q A;  3DEO A;  4KY7 A;  3W3A A;  3TQY A;  2WV6 D;  1TWC B;  4JI0 L;  1EQQ A;  4GN4 B;  2ZJQ A;  3SEB A;  1Z7T A;  2JJQ A;  4KN4 C;  1V1O A;  5JVG 3;  2Z6B A;  5KND A;  3HGB A;  1Y69 U;  3GTO B;  1TQO A;  3FHW A;  2O5I C;  2LXK A;  4OO1 G;  1YNJ C;  3UDI A;  4XQJ A;  4LF9 L;  4HJ5 A;  1K83 H;  1F9R A;  3RD4 A;  5JJZ A;  2JK8 A;  2K6A A;  1EQT A;  4GN3 B;  3K80 C;  1BBW A;  1QJO A;  5FLX L;  3J81 E;  1B50 A;  1F77 A;  1LAC A;  3HEJ A;  2F0H A;  3HFZ B;  1VDZ A;  1II3 A;  1NR2 A;  2H4O A;  3PF5 A;  4JI6 Q;  3OWF A;  2N55 A;  3P1H A;  2HHH Q;  4K6L A;  5C3E B;  1M8A A;  2OQK A;  1Y8N B;  2SDF A;  5IYD H;  3MC0 B;  4A3G B;  5C3X A;  3FRP B;  4JI5 L;  3AMU A;  2CVR A;  4A3K G;  2PMZ B;  3A7L A;  1PTO B;  1CKN A;  3SK4 A;  4G7H C;  4FXG C;  1S40 A;  5L37 A;  2JQO A;  4OX9 L;  5J1Z A;  4CKB A;  1LLR D;  2N88 A;  3URY A;  1XTD A;  1RHP A;  1S3O A;  4B3M L;  1RF2 D;  1XNR L;  2B8G A;  2V4D A;  3BG3 A;  4B9X A;  5C5L A;  2IWH A;  4R4C A;  2IX1 A;  4HSV A;  1WTQ A;  4BY7 B;  2F1M A;  2NB0 A;  2IJ0 A;  3EN2 A;  2UUA Q;  2R93 H;  3D31 A;  1QE6 A;  1PH7 A;  5KEE A;  4LUV A;  1QNK A;  2F0V A;  2FHT A;  2OT2 A;  4DK3 C;  1G6Z A;  4R1J A;  3K57 A;  3N52 A;  1B9M A;  3JAM c;  5LMN L;  1PH5 A;  4DR7 L;  1VF7 A;  2F0G A;  2L12 A;  2ES2 A;  1HTL D;  1PTO D;  1SYE A;  1EYG A;  1JOR A;  2ZM6 Q;  3VYR A;  2UXC Q;  3O13 A;  1X3E A;  4OL7 A;  4IUT A;  3PQI A;  4DV0 L;  2HCI A;  3MFG A;  1B9N A;  2EOT A;  1B1Z A;  4YIJ A;  4KTA A;  4NP5 A;  1QNU A;  1B8A A;  1EY9 A;  3E9I A;  2RSN A;  2RSO A;  4HR7 B;  1QVG A;  5DEH A;  3R3O A;  4PNY A;  1RTN A;  1I6H B;  1IYJ B;  5T1I A;  3S1R H;  1IXR A;  2FIN B;  3E6Z X;  1Y1W H;  3GTQ H;  5A2Q E;  2ZT9 C;  3HS0 C;  4YCV A;  4DNT B;  1D8L A;  3Q8D A;  1E2Z A;  1F9P A;  2DJF C;  3KDF B;  2VQE L;  1TWA B;  4RAU C;  3HKS A;  1ESR A;  4F7X A;  1A15 A;  3BYY B;  3SK6 A;  1BXT A;  3GP7 A;  1AZP A;  3IFT A;  3S2H B;  1IBL Q;  3PUZ A;  4ALP A;  3QOJ A;  4ZK9 B;  1KD1 C;  4C3J G;  1ASY A;  2WII B;  1SFO H;  1KLG D;  3A8I E;  1D5M C;  1L0W A;  5IOC A;  3T1H L;  5K36 H;  2JA7 G;  4WOR A;  1NBW A;  5IIF A;  5IT9 c;  2CFM A;  1SNQ A;  2QDL A;  1KDA A;  5IP9 H;  3CCE A;  5M3F H;  3I4L A;  2UXB Q;  2QW7 A;  5KRU A;  4N8X 1;  4BY1 H;  3BVG A;  1HHV A;  3F2C A;  4KHV A;  2CCZ A;  1SYB A;  3C46 A;  3T53 B;  1FR3 A;  3BDO A;  3HOV G;  5BN4 A;  5CGK A;  4DPG A;  2ID0 A;  2PO4 A;  1AW7 A;  4C2M H;  1EY0 A;  4A3B G;  2E2I H;  1IL8 A;  3PIP 3;  1CHP D;  2LY7 A;  4QGU A;  3BVZ A;  4C3I G;  2DUD A;  4K2K A;  5JPM C;  1TS3 A;  2BE5 C;  4DR4 Q;  1A3V A;  5M5Y B;  3OW7 A;  3CCS A;  1N34 L;  2HDL A;  4BBS H;  2A8V A;  3IKJ A;  3IFD A;  1AE3 A;  4R4T A;  4GLX A;  4O1N A;  4YCU A;  3D4D A;  2ATW A;  2VB3 X;  3HOZ H;  1VQE A;  3KYH C;  3S15 B;  3MXU A;  4FF3 A;  4CDD C;  3I56 A;  1CTM A;  1M90 C;  4FO2 A;  5M9O A;  4IPD A;  1JCK B;  1W6J A;  5J39 A;  1A63 A;  4GKK Q;  3LX0 A;  3SK5 A;  3I3C A;  3VA7 A;  4H13 C;  1SJE D;  4PMW A;  4A3D G;  2I46 A;  4NKL A;  3V96 A;  1WCM B;  3RZD B;  2PPB C;  4WFN 3;  2E74 C;  3CCR A;  4GOP A;  2CWA A;  5C4X B;  3E0E A;  5CV4 A;  5JJI A;  4DK6 C;  4DXG A;  3OOC A;  2R92 B;  4X66 L;  1G51 A;  1TY2 A;  2ZTD A;  1T5E A;  1ET6 A;  2HCC A;  3U4Z A;  4X6A H;  4LFA Q;  4RGO S;  3AQQ A;  3EA6 A;  2AUK A;  2PI2 A;  1DYQ A;  3W2D A;  3OYY A;  1U0L A;  1I94 Q;  4YWM A;  1E0B A;  1T5X D;  3RN2 A;  2F0T A;  5KNC A;  4B08 A;  1SN8 A;  1DOK A;  2ZXO A;  3P20 A;  3HOX H;  4XYO A;  2IHE A;  3AB9 A;  3G6J B;  4C56 C;  3U4V A;  3MTS A;  1VQC A;  1LTG D;  5G3L D;  1RKN A;  4YWK A;  3GTG H;  1QB5 D;  4NXN Q;  4KKT A;  2DJG C;  4S3S A;  3QIA A;  1K83 B;  1XPU A;  1OXS C;  1A2U A;  1O7I A;  4IUP A;  3KF6 A;  5LL6 X;  4FDB A;  2R7Z G;  1BUV T;  4LF7 L;  3M3Y H;  2EYH A;  1PFM A;  4NB3 A;  1K9M C;  3CKI B;  2L15 A;  3H15 A;  1PV4 A;  4HID A;  2Q2H A;  4IAL A;  2A5H A;  4CBV A;  1VQD A;  1H9K A;  1PRT B;  4BXX H;  3X3M A;  4PG3 A;  4UP9 A;  1D2B A;  3CCM A;  1HZB A;  3KJP A;  4LF6 L;  5BN5 A;  4QQB X;  1CK1 A;  1V8Q A;  1EZ6 A;  3OMC A;  1L1O C;  3CCQ A;  4HJ9 A;  4JV5 L;  4IUR A;  4JPB W;  4V19 0;  4OXP A;  1WTH A;  1AZQ A;  1WTR A;  2AHO B;  1NTG A;  4DR1 L;  2L5T A;  4Z9C B;  1OXX K;  4JI3 Q;  1S5E D;  4N9P A;  4UHV A;  4L5T A;  1IBM L;  1ONL A;  1S5D D;  4IUU A;  2JA5 H;  2WKC A;  4QB4 A;  3Q22 A;  1VS0 A;  4L5Q A;  1GO3 E;  5A35 A;  2HQE A;  4LF8 Q;  2R93 B;  1PRT D;  2L1B A;  3FVQ A;  1PH6 A;  4LNQ A;  1NSN S;  2CH4 W;  4ZUI A;  2O2L D;  2WAQ G;  2C5C A;  1PH3 A;  2BE5 D;  1KNE A;  1ENA A;  4A3I G;  2EYP A;  1CI3 M;  1S5C D;  2NYZ D;  3MEF A;  4TRD A;  3TZD A;  3T1Y L;  1I4H A;  1OXT A;  5FOB B;  1Y8P B;  3J80 i;  3R2T A;  1MSG A;  1SMX A;  1LYL A;  3RUZ A;  1FGU A;  2B2T A;  1SND A;  2MFI A;  2VUM H;  2AMC B;  2ICI A;  1I4G A;  2B2Y A;  4AQY Q;  3MXN B;  4XYQ A;  1ROD A;  5C6A A;  4P72 A;  1XPR A;  3CCJ A;  2KEC A;  1T9H A;  4YY3 L;  1IBK L;  5IYC G;  4JYA Q;  3VYU A;  5I9O A;  3NK9 A;  2OTJ A;  2K4K A;  1EYC A;  5FLX E;  3S1R B;  4KY6 A;  1Y1W B;  1RCV D;  2SNS A;  4MTN A;  2FMM A;  3GTQ B;  4B3R L;  3R2I A;  4DU9 A;  3HOU G;  1QG7 A;  4F87 A;  2F0W A;  1F2M A;  1HTP A;  5LMU Q;  3KJO A;  4YCW A;  3D4R A;  1Q86 C;  4C3H H;  1TKW B;  4JI7 Q;  3A74 A;  3CQZ H;  2KA7 A;  2F0P A;  3PUV A;  1SFO B;  1PA6 A;  3QWN A;  2K05 A;  3D3R A;  2BOS A;  2EDG A;  3CF5 A;  5M3F B;  4AYB G;  5EKI A;  4BY1 B;  1SRU A;  5TSS A;  4DA2 A;  2SNM A;  2JA8 G;  4IFD H;  1D6E C;  2WIN B;  1HZ9 A;  3CRK C;  2PYK A;  4JI5 Q;  5E7N A;  3RLF A;  4MNO A;  1VQ4 A;  1XNQ Q;  2RQX A;  4DR3 L;  4C2M B;  2Q2U A;  4IQZ A;  1YZ6 A;  3IAY A;  2E2I B;  3G48 A;  4H7B A;  4B3M Q;  1XNR Q;  2F4V L;  4J1M A;  4EVO A;  1BR9 A;  2WB1 E;  3TP7 A;  3I4M G;  1NE3 A;  3DMU A;  3UDF A;  5KIX A;  4JOI A;  1SNM A;  4DV4 L;  3NBH A;  4GS3 A;  1D1I A;  4BBS B;  2EIF A;  2YTV A;  4TSS A;  4O42 A;  3H0G G;  2L11 A;  1LTL A;  2EE1 A;  3GTK H;  3HP3 A;  1IL2 A;  3HKZ E;  1R4Q B;  4WRD A;  3VR6 A;  3HOZ B;  5C0X G;  1JJ2 A;  2E2J H;  3CC2 A;  2L4N A;  3A8K E;  2CQA A;  1D1K A;  1KQS A;  4JBM A;  4RCN A;  3CCV A;  1KRS A;  4LUZ A;  4A3L G;  3MAQ A;  3TS2 A;  1PH2 A;  1LT5 D;  4LAA A;  1U5K A;  3I91 A;  1ML0 D;  2LFN A;  2M00 A;  1ET9 A;  4A3F H;  3DM3 A;  2RF4 A;  2NTS A;  4N9T A;  3WWV A;  1VQ7 A;  2XSC A;  4LFB L;  1DOL A;  2ZTC A;  3W1B A;  1XPO A;  2Z6K C;  3R8B A;  1OO9 B;  4IUV A;  4LK1 C;  1BNZ A;  4Y7N H;  3QJY A;  1L0Y B;  1EWH A;  3MXG A;  1X3P A;  3PO3 G;  3QR8 A;  3PSI A;  4RKB A;  3J81 c;  4R4O A;  2OWO A;  3MZ5 A;  1WD0 A;  1Z6H A;  4RHS A;  3JAM i;  1OTC A;  1VQG A;  3A5U A;  3HOW G;  4HN7 A;  3HOX B;  2GA4 B;  5EPJ A;  2HDM A;  3K5N A;  1EIY B;  3NSW A;  1B4O A;  5FK9 C;  1WTX A;  4A4I A;  4BBR H;  2PZW A;  3GTG B;  3DWQ A;  1HQM C;  2OTL A;  2LS0 1;  3BZD B;  2KJX A;  1Q1E A;  3KDF A;  2VQF Q;  4RCO A;  3AYH B;  4BA1 I;  4IJH A;  2Y0S B;  2DNC A;  4X64 L;  3M3Y B;  5CMD A;  2H1E A;  2UUB Q;  3SGI A;  3NQT A;  1HR0 Q;  4KI0 A;  4P2C B;  1K8M A;  2FJ2 A;  1XTC D;  1FNV A;  1DZ1 A;  3CMA A;  1Q12 A;  3KLS X;  3OPO A;  3TEH B;  4LF5 L;  2K33 A;  1N34 Q;  4HMJ A;  4JG2 A;  3VYS A;  1JWU D;  3C1E A;  1FL0 A;  4HJA A;  4ZYS A;  4B3T L;  1LT3 D;  3L7Z C;  3G4S A;  1QUQ B;  3M4Y A;  1ENF A;  3WOF A;  2DY8 A;  1NY4 A;  4O0A A;  2EJF C;  1HUM A;  1CT1 D;  1YHB A;  3S2D H;  1V43 A;  4X62 Q;  1NMF A;  3L2P A;  5FLM G;  1Q1B A;  1HFG A;  1RDP D;  3F8T A;  4IPG A;  1QZH A;  1BCP F;  2JA5 B;  2B2W C;  1LTT D;  3P75 A;  2RCN A;  4HSP A;  1H9R A;  5E1F A;  1C4Q A;  4GN5 A;  1EFW A;  1CSQ A;  2PI2 E;  1N33 L;  1SNP A;  4OEL B;  1QVC A;  3DLL A;  4F8M A;  3KBG A;  4RH6 A;  1HH2 P;  4DAV A;  2HQL A;  2HUG A;  4QUC A;  5M3M G;  1MKH A;  4HIM A;  1N32 L;  1HJP A;  3TSS A;  2YYZ A;  4B9W A;  4A3E G;  2VUM B;  3FKI H;  4DV5 Q;  2XRS D;  1SMY D;  3CC4 A;  1K3B C;  1A0I A;  3WDN A;  2P5Z X;  3J80 E;  4GKJ L;  5D3I B;  2BDO A;  1PXU A;  3E5S A;  4L8J A;  3Q24 A;  2QDB A;  1IYV A;  5ELN A;  5IP7 G;  5E4X A;  5HGT A;  2O5J C;  2B8F A;  2JYO A;  4I65 A;  4JBW A;  1U4L A;  5GAH C;  2EYF A;  1FJG Q;  1I4Q A;  3RNU A;  3C3L A;  2KUM A;  5AJ3 L;  2Q8T A;  5C4Z A;  1PH9 A;  2FXQ A;  2HT1 A;  2DGY A;  1E1T A;  3T16 A;  2B63 G;  1N36 L;  4DV3 L;  1KL9 A;  1VMP A;  1GKH A;  4C3H B;  3PO2 H;  3W5O A;  3CQZ B;  2EYM A;  4JI2 Q;  3OIQ A;  5I2X A;  3RMH A;  1JR0 D;  1X6O A;  1BQQ T;  1WJJ A;  2B2U A;  1Q46 A;  3HOY H;  2K32 A;  1NJI C;  1HNW L;  1G29 1;  1GD7 A;  3C1F A;  2F0S A;  1UE7 A;  1PYB A;  2B2V C;  1HA5 A;  2K50 A;  3S1M H;  4B3S L;  1TXY A;  1G8Z D;  1Y1V G;  3A7A B;  1TII D;  2F0N A;  2Q2I A;  4WJ3 M;  3UDG A;  1STH A;  1DCZ A;  5IGB A;  1B44 D;  2JA6 G;  4A93 H;  2C35 B;  4DUY L;  1X3G A;  4FXD A;  1I4R A;  2ZXR A;  2EY5 A;  2L0C A;  5K5P A;  4A3J H;  3ND9 A;  1Q8I A;  4ODG A;  2D62 A;  1Z47 A;  4RA8 A;  2PZT A;  1HR0 W;  4XQN A;  2GN5 A;  4DUZ Q;  1X9N A;  1PZI D;  2PZU A;  1MJE A;  4L5R C;  4H02 A;  4X3U A;  1HZC A;  3V05 A;  5BR8 Q;  2PW5 A;  5C44 H;  2KOL A;  2F0K A;  2ICE C;  4R8N A;  5COY A;  1PHJ A;  1EY5 A;  2RHQ B;  4K0K L;  1DJR D;  1IW7 D;  1HXY D;  4HAE A;  3GTK B;  1XMO L;  2B2U C;  2MO0 A;  4IPH A;  1GXD C;  5IYB G;  1X56 A;  2OEO A;  4RHR A;  4YHH Q;  4X65 L;  4H0L C;  3M4Q A;  2E2J B;  3F2U A;  4IN3 A;  1SYC A;  2QGQ A;  3MHB A;  4DV1 L;  1H9M A;  3I2Z A;  1BKB A;  3K8A A;  1XX8 A;  4KJO A;  1XMQ Q;  5KNB A;  2EYL A;  4A3C G;  1H9S B;  1Q7Y C;  4OO1 H;  3D8G A;  1YEZ A;  3H3V H;  5EQ0 A;  3X3N A;  3CXC A;  4PMC A;  1EWC A;  4A3F B;  1JOO A;  5ELE A;  4JK1 C;  1HQR D;  2CW0 D;  2CQO A;  2AQ1 B;  2F0I A;  4B3R Q;  4KKS A;  1PRT C;  1KLU D;  2XWB B;  2YV5 A;  3F2B A;  1SE4 A;  4NXM Q;  4Y7N B;  5GAD C;  2MHV A;  2XIW A;  4NDX A;  4YWL A;  4HIO A;  1O78 A;  3IRB A;  4A3M G;  4JI8 L;  4A3K H;  3A0J A;  4GZY C;  1OXV A;  1DON A;  3DEP A;  4J15 A;  1S72 A;  1K8O A;  1A6X A;  2NUC A;  2K5H A;  3I90 A;  5IGE A;  1YIJ A;  4BBR B;  5C4J H;  4IOA A;  3I4N G;  1SE8 A;  3JAM E;  3H6M A;  3KUP A;  4K2L A;  1JWM D;  1KAA A;  2MPM A;  2MP1 A;  3PUW A;  4LUO A;  4DV2 L;  3DXJ C;  4DR3 Q;  4XT3 B;  2PMZ E;  4TQU S;  1JQY D;  1YJW A;  4C1N I;  3OTO Q;  1MBY A;  2MQH A;  1STN A;  1S4Z A;  3U58 A;  5DLQ E;  4HJ7 A;  2EJG C;  3ITP A;  4PQX A;  4CJ1 B;  3ZJY C;  2AQ3 B;  2AKW B;  1L2F A;  1STG A;  5IWA Q;  3S14 H;  1TS2 A;  3M9B A;  1Q81 C;  3K0X A;  3NXW A;  4UY8 C;  4IFD J;  1GUO A;  1PFN A;  1XXG A;  4EGV A;  2LSS A;  3EIV A;  1PFS A;  4RWS C;  4JBJ A;  1I5F A;  4FXK C;  4IO9 A;  5C3E G;  3CW2 C;  3VR4 A;  1VQL A;  1LTR D;  2RHS B;  2VL6 A;  1B7Y B;  2BH8 A;  3T51 B;  4G7O C;  1B2T A;  2F52 A;  4A3G G;  4JI4 Q;  3S2D B;  3A55 A;  1CM9 A;  2JSO A;  1VQ5 A;  2E2H H;  2EXD A;  1L1O A;  1VQN A;  2EY6 A;  1EL0 A;  4DFA A;  5C5M A;  2NWG A;  3DHQ A;  2UUC L;  2RVL A;  5I6W A;  4JI6 L;  2G5D A;  1OXU A;  2HHH L;  5IT9 E;  1UWV A;  3J80 L;  1HNZ Q;  1GHK A;  3HZX A;  4DV6 Q;  2ZXP A;  4BY7 G;  1HNX L;  5FLX c;  3KF8 A;  1JOK A;  2F0L A;  3CC7 A;  1YNN D;  4C3J H;  1ZKO A;  2KBN A;  1CKO A;  2JA7 H;  4QMG A;  2WB1 B;  3Q23 A;  4XQQ A;  4HTH A;  1EY4 A;  3FKI B;  1EY6 A;  2QIL A;  4DKA C;  1TWF H;  1TWH H;  2K1B A;  2BH2 A;  5GAG C;  4ZQ3 A;  1C0A A;  1KRT A;  1ICW A;  4POG A;  3GTM H;  1RIP A;  2WAQ E;  3HOV H;  1J5E Q;  2R7D A;  2RBM A;  5LL6 S;  1V9P A;  2PQE A;  4A3B H;  5ISR A;  2EY1 A;  1VMC A;  2J4X A;  5KYL A;  4K8I A;  4IUN A;  3ULL A;  4Q0F A;  3HKZ B;  4P74 A;  3NBI A;  1SR3 A;  4C3I H;  3TS0 A;  2PQA A;  2RA4 A;  4IFD I;  2VNU D;  4DR2 Q;  4JI1 L;  5IGG A;  3NTK A;  1ZYR D;  1ZEQ X;  2ZM6 L;  1N8R C;  2UXC L;  2I5M X;  1BCP B;  2ENB A;  2QKI C;  2F3V A;  5JAV A;  2F0E A;  3U9S A;  3PO2 B;  4A3M H;  1CSP A;  2UXD Q;  1PTO F;  4LF4 L;  2BA1 A;  1BVS A;  1EYD A;  1VQF A;  1JB7 A;  5AFW A;  4F88 A;  2KCM A;  2M9V A;  3BDL A;  1EWI A;  4JVZ A;  1E1O A;  1EOT A;  3HOY B;  2HIV A;  1I3Q H;  4LF5 Q;  1JC7 A;  1QWY A;  2D0P A;  1ICF B;  4G7Z C;  1CQV A;  1C8C A;  1VQM A;  3UI2 A;  3LNN A;  3S1M B;  4DR6 Q;  3MFY A;  1EU4 A;  2F4I A;  1CHQ D;  4ME5 A;  4B3T Q;  1EIH A;  1EU3 A;  3GTJ H;  2E5L L;  3J81 i;  2OF1 A;  1BCP D;  5I6Y A;  4C1N K;  4A3D H;  4A93 B;  4LW1 A;  1YNX A;  1KXL A;  4KHP Q;  2IY5 B;  3VR5 A;  4A3J B;  3RZO H;  2V1C C;  4AYB E;  2OQ0 A;  4PZ8 A;  1EY7 A;  1IBL L;  4R4Q A;  2QEX A;  1AEX A;  4JI0 Q;  1S5F D;  4CDF C;  1VQ6 A;  1K73 C;  3KLR A;  1YHQ A;  2A1A A;  5C44 B;  1DD2 A;  4XT1 B;  3E3X A;  4BA2 I;  1EIF A;  4LF9 Q;  4R9W A;  5LHY 1;  1HCZ A;  4LFC L;  1TS4 A;  3U50 C;  2L55 A;  1TY0 A;  1UE6 A;  1PYW D;  1F2Y A;  4JBK A;  1N32 Q;  2EZV A;  3M4O H;  1I4P A;  4L63 B;  1SEB D;  3A54 A;  1GJX A;  1Y8O B;  3CRL C;  3W1G A;  1GVP A;  3SHL A;  2A74 C;  3CP0 A;  2NZO A;  3TP6 A;  2C9O A;  1JB3 A;  1LTI D;  4GLA C;  3S1N H;  3K7A H;  3AFQ A;  2R7Z H;  1IHZ A;  5D65 A;  2CH4 A;  4X3S A;  3VR3 A;  2UU9 L;  2KEN A;  4OX9 Q;  4EQN A;  4GOP B;  4MIU A;  1WCM G;  3TZU A;  1KNA A;  4ZAI A;  2I0Q A;  4E6I A;  3NEL A;  2EY2 A;  3JAM L;  3GV6 A;  4OEM B;  1JJG A;  1PH4 A;  2NN6 G;  5CBA E;  4QCL A;  4LWC A;  5C4X G;  4ZKC B;  1N36 Q;  3S16 H;  2KQ3 A;  4CKC A;  5FJ8 G;  4R8I A;  2R92 G;  3P7J A;  3GTL H;  2EPB A;  1XYI A;  2VW9 A;  1NNX A;  3E0J A;  4DF7 A;  2Z6K A;  4A3K B;  3SDZ A;  4OWW B;  2B39 A;  1NUC A;  2K28 A;  1KHI A;  5EPK A;  4GKK L;  5LMN Q;  4K5X A;  4DR7 Q;  1HNW Q;  1VCI A;  2JEA I;  5C4J B;  3GD7 A;  2N8N A;  1SMY C;  4DV0 Q;  4ZCK A;  5DNF A;  2JE6 I;  3ULP A;  1P8L A;  2ZJP A;  1CFM A;  4AIM A;  2RDF A;  1WTO A;  2NVY H;  4DAP A;  1E3P A;  3ERQ A;  1C9O A;  3KF6 B;  2IT1 A;  3FEW X;  3L9A X;  4DUY Q;  2NVX H;  1ILQ A;  1LV9 A;  4V0B A;  1SNO A;  2BDN A;  1V1P B;  3OWE B;  3ULJ A;  3QO2 A;  4POF A;  3D0F A;  3BU2 A;  4A3I H;  5I9P A;  3KK7 A;  1SYF A;  1HFN A;  1KAB A;  5EBC A;  3I73 A;  4CKE A;  1FYC A;  3HG9 A;  3S14 B;  2FFK B;  2K5Q A;  2OXP A;  3A5Z B;  1STE A;  2AWO A;  3ERS X;  3ICE A;  1BBU A;  1RD9 D;  4MTK A;  5IT9 L;  3ND8 A;  2E75 C;  2VQE Q;  4K0K Q;  1YHA A;  4UDU C;  4X3T A;  3M4P A;  1FVI A;  4NXN L;  1XMO Q;  4K8J A;  3I8Z A;  5IYD G;  1B3A A;  1G2S A;  2K5N A;  5C0X I;  3RLO A;  4KLK A;  2KED A;  2XWJ B;  4APV A;  2OCE A;  3R93 A;  4OGQ C;  2E2H B;  5IYC H;  5JEA G;  3T1H Q;  1MSH A;  4Y52 H;  3MXP A;  1G6P A;  2CHB D;  1GUN A;  4L5S A;  5ELB A;  3NWS A;  3HOU H;  3NPP A;  4HCS A;  2I07 B;  3U9O A;  5J22 A;  1K8A C;  1BF4 A;  2LKV A;  4KN7 C;  1J6Q A;  1VQA A;  2WKD A;  5KGU A;  4DR5 L;  5IOD A;  3GTP H;  3D4W A;  2A6E D;  3UE1 A;  2A73 B;  5EJW A;  2B2W A;  2BCO A;  1AE2 A;  5COR A;  5CYU A;  2R93 G;  2RDH A;  2NTT A;  4C3J B;  4JCV E;  3BDC A;  5EAY A;  1KIX A;  2JA7 B;  3G71 A;  3K5O A;  1U4M A;  1IW7 C;  1TWF B;  1SE3 A;  1TWH B;  2JA8 H;  4JI3 L;  4DV7 L;  1G2T A;  3NTI A;  1ASZ A;  1PMR A;  3EBE A;  1JT8 A;  3GTM B;  1XJV A;  1TS5 A;  3HOV B;  1WYD A;  4RMF A;  2Q8R E;  3CCU A;  1TWG H;  4LF8 L;  1SDF A;  1SYD A;  1D5Z C;  3DWA A;  4A3B B;  2MJ8 A;  1Q3L A;  3T13 A;  1YBY A;  4C3I B;  2R61 A;  4M8A A;  1I6V C;  3I4M H;  4QIW E;  3K59 A;  1JMC A;  5CBE E;  2Z9H A;  1U4R A;  1Y1W G;  1X55 A;  4O2D A;  2CW0 C;  4A3M B;  4CDE C;  4R4I A;  1E22 A;  2L9H A;  5E3F A;  3B6Y A;  3EJI A;  3HRZ C;  3K7U C;  4XIG S;  3H0G H;  1MIU A;  1NR4 A;  1QZG A;  2BA0 A;  1K28 A; 
#chains in the Genus database with same CATH homology
 1I3Q B;  2K03 A;  5C0X H;  5DM7 3;  5K36 G;  3J7Y W;  3GTJ B;  3SR1 A;  1KTK A;  5I4D A;  2EYJ A;  2A68 D;  4A3D B;  2IW3 A;  2B2V A;  5ELD A;  1STB A;  2AQ2 B;  1TVX A;  3TBI B;  1WVL A;  2G9H D;  3RZO B;  4ZRZ A;  3MEH A;  2RKS A;  3MWY W;  1GUS A;  1SSO A;  2MUY A;  2R3Z A;  2K7V A;  4OO1 I;  1CA6 A;  1UUP A;  2E2D C;  1BDO A;  4OHJ A;  1GUG A;  2SOB A;  3SE0 A;  5JEA H;  4KHZ A;  3M4O B;  1HPC A;  4ABN A;  4ZUJ A;  3NE5 B;  3MA2 B;  2MGS A;  3V2T A;  4K5W A;  3Q6S A;  4ILW A;  1WTP A;  1JWS D;  1SAP A;  3S1N B;  3K7A B;  2D2C C;  1TT2 A;  1TR5 A;  4I7Z C;  4TKO B;  2R7Z B;  1F9Q A;  2XRQ D;  3T4A C;  4RGT A;  1EIG A;  5HUR A;  1GUW A;  1E2V A;  4K6D A;  3Q0A A;  5NUC A;  4LJZ C;  4RFB A;  3S16 B;  3FMC A;  1UNS A;  3GTL B;  2K5W A;  2DY7 A;  5IGD A;  2R6G A;  1YNN C;  4G57 A;  1IYU A;  4HED A;  5ELC A;  4DK0 A;  4DXF A;  1F9S A;  3C2P A;  2Z1C A;  2F0D A;  2A6H D;  4OIJ A;  2Z4H A;  1STY A;  4ZLT F;  1F2Z A;  3PIO 3;  1FD7 D;  2NVY B;  1I4X A;  3K58 A;  3FPU B;  5I2Y A;  2NVX B;  1EEI D;  2WAQ B;  5BN3 A;  4XTC S;  1RJT A;  1ZYR C;  4A3I B;  1KDC A;  4DGZ A;  1WTW A;  1FNU A;  1TU2 B;  3DWP A;  1A3U A;  4IZ8 A;  2D9U A;  3H94 A;  2IL8 A;  3VYT A;  3MVV A;  3VA5 A;  1LTB D;  1BO0 A;  4MHE A;  2A69 D;  3A8J E;  4KD3 A;  2PW7 A;  3TP5 A;  3DUZ A;  5F2D A;  3OMG A;  3I72 A;  1C48 A;  3NUC A;  4KV6 A;  3MXN A;  4KK7 A;  1U9R A;  4H44 C;  1EZ8 A;  3NQI A;  5T1G A;  4FF1 A;  1YNJ D;  3HOU B;  4KKU A;  1CA5 A;  4KD4 A;  1BCP C;  2NZ1 D;  3H09 A;  1ESF A;  3GTP B;  2AUJ D;  5E4W C;  1XWE A;  4IUQ A;  1F2L A;  4PMB A;  4AYB B;  2FMC A;  1GHJ A;  1B53 A;  2JA8 B;  4PV1 C;  2F0J A;  1AN8 A;  3ERO A;  3QOL A;  2X6L A;  4HCE A;  4G4K A;  3NWT A;  1TWG B;  2F3W A;  1O7L A;  4K14 A;  1E2W A;  1GUT A;  3QG1 A;  3I4M B;  1EY8 A;  5EKL A;  3VR2 A;  2KEE A;  3TN2 A;  1DXM A;  3FDT A;  4QF4 A;  2IPK D;  5IGC A;  1DOM A;  4ZKB B;  5CV9 A;  3CHB D;  3K5M A;  1STA A;  2VXW A;  3H0G B;  5ELF A;  3J81 L;  4C3H G;  3H91 A;  3LWU A;  1PZK D;  3NTH A;  1IKM A;  1DM0 B;  5FO7 B;  4MN3 A;  3EFX D;  4FF4 A;  3SXH A;  3H3V C;  1EEF D;  2X69 A;  4IFD G;  1O80 A;  1PZJ D;  3PV0 A;  4L6T B;  1V1P A;  1HA6 A;  1O7Z A;  4KY5 A;  1SXT A;  4FF2 A;  1L0X B;  2LMC B;  3OHX C;  2F0O A;  2NVQ B;  2EJM A;  3M85 A;  4FVM A;  4BWG B;  4RGN A;  1J9O A;  3PO3 B;  1SBB B;  2D5D A;  2PCF B;  3TME A;  1EFI D;  1UEA B;  3HOW B;  5M5W B;  1AP0 A;  4X3K A;  2XNA C;  4OIK A;  3S1Q B;  2Z4I A;  2XN9 C;  3AU7 A;  3TDQ A;  3CU7 A;  3BS1 A;  1QOH A;  1WTV A;  1MI2 A;  2EVB A;  1CZG A;  1U4P A;  4RKL A;  3S9W A;  2RDG A;  1X32 A;  1ILP A;  2X6G A;  3L3O C;  2J0T D;  5EGT A;  4WJW A;  1MD2 D;  1ZXT A;  3S17 B;  1AFP A;  4KMU C;  1PDQ A;  2EXZ A;  2A6E C;  5CC4 A;  2DNE A;  3EVQ A;  5A2Q L;  2Z8L A;  4CGY B;  3TP8 A;  1NCV A;  3SVM A;  2XVS A;  2M2L A;  3LWE A;  2J7Z A;  1LAB A;  1RTO A;  3NP8 A;  5CV7 A;  3EQL C;  5DAU A;  3N6R A;  4CJ0 B;  5M5X B;  2KVM A;  5FO8 B;  4LMQ D;  3NHH A;  4K5V A;  2K04 A;  3I70 A;  2IX3 A;  1PTO H;  1X3Q A;  2QF7 A;  4QUF A;  3K5L A;  1D5X C;  2G9D A;  2IX0 A;  4FP5 D;  1LO5 D;  1LT4 D;  4XXE A;  1PFB A;  4ID6 A;  3GV3 A;  4RGM A;  2E76 C;  2SEB D;  1O7Y A;  3KBX A;  4NMZ A;  1H9J A;  3BVM A;  2F0Q A;  5M3M B;  5JPN C;  2F0M A;  1WD1 A;  3G7L A;  2JP1 A;  2KCN A;  2VB2 X;  5C0X J;  2WAC A;  2NBF A;  3OIP A;  1ENC A;  1KDB A;  1JOQ A;  4QIW B;  4A3E B;  2B2T C;  1MGS A;  1JE4 A;  1R4P B;  2B2Y C;  4DAY A;  3D6W A;  3BYT B;  1R9T B;  1A3T A;  4U67 3;  3T56 B;  2QCP X;  4FNF A;  4DK1 A;  3GO5 A;  5CR3 A;  2DN8 A;  1QCB D;  3SK8 A;  3D6C A;  5D14 A;  2A68 C;  3QB3 A;  5EPL A;  2WP8 J;  1G91 A;  2B63 B;  3ZYY X;  3WOE A;  4XDX A;  4CJ2 C;  1FNW A;  4FYD A;  1I50 B;  5CV6 A;  2KCC A;  1CZW A;  2F03 A;  5JEA J;  1GOZ A;  2NN6 I;  1LTS D;  2NVT B;  1SJH D;  3PUX A;  2K01 A;  4NW2 A;  1Y1V B;  5JOB A;  4Q5V A;  5JVH 3;  3OSO A;  1A2T A;  3KLS A;  2JA6 B;  5D3D A;  5FO9 B;  4UAI A;  1M4V A;  1SE2 A;  1JIC A;  4CHT B;  3A56 A;  3K6O A;  4J8Q A;  1VF5 C;  2YU9 B;  5G3L F;  2PNR C;  4U68 A;  5EKK A;  2QEJ C;  2Q8I B;  3M7G A;  2KHS A;  5CV8 A;  4ULL A;  3J7A F;  3PMF A;  5KYI A;  2K5D A;  3GQB A;  4M1U B;  1HRJ A;  2JEB I;  4DNR B;  4EQO A;  1LTA D;  1PTO C;  1EYA A;  1SYG A;  5DM6 3;  1UAP A;  3M7N A;  1EQV A;  3PUY A;  1FGB D;  1PLF A;  3J7A V;  5C3W A;  1HUN A;  1IKL A;  1Q90 A;  2A6H C;  4DN4 M;  1H9S A;  5FKA C;  1BOS A;  1QIL A;  2JXM B;  4HMI A;  2F0F A;  3IL8 A;  3K0Y A;  1LT6 D;  2AWN A;  4EQP A;  2NN6 H;  2TMP A;  5CV5 A;  4KJN A;  1PRT F;  3ONA B;  4J6H A;  1NAP A;  1W6K A;  5EBD A;  1SNC A;  2O4X A;  2EYO A;  1J8I A;  1S5B D;  2F0U A;  3FPP A;  4BS9 A;  2A69 C;  3DM1 A;  5IGF A;  1CQF A;  5C4H A;  1BBX C;  2TSS A;  3I4N B;  3DEO A;  4KY7 A;  3W3A A;  2WV6 D;  1TWC B;  3SEB A;  1Z7T A;  4KN4 C;  1V1O A;  5JVG 3;  3GTO B;  5KND A;  3HGB A;  1Y69 U;  1TQO A;  2O5I C;  4OO1 G;  1YNJ C;  4XQJ A;  1F9R A;  3RD4 A;  5JJZ A;  2K6A A;  1EQT A;  1QJO A;  5FLX L;  3J81 E;  1B50 A;  1F77 A;  1LAC A;  3HEJ A;  2F0H A;  1VDZ A;  1II3 A;  1NR2 A;  2H4O A;  3OWF A;  2N55 A;  3P1H A;  4K6L A;  5C3E B;  1M8A A;  1Y8N B;  2SDF A;  3MC0 B;  4A3G B;  5C3X A;  3FRP B;  3AMU A;  2CVR A;  2PMZ B;  3A7L A;  1PTO B;  3SK4 A;  4G7H C;  4FXG C;  5J1Z A;  4CKB A;  1LLR D;  2N88 A;  3URY A;  1RHP A;  1RF2 D;  2B8G A;  2V4D A;  3BG3 A;  4B9X A;  5C5L A;  2IWH A;  2IX1 A;  4HSV A;  1WTQ A;  4BY7 B;  2F1M A;  2NB0 A;  2IJ0 A;  3D31 A;  1QE6 A;  5KEE A;  1QNK A;  2F0V A;  2FHT A;  2OT2 A;  1G6Z A;  3K57 A;  3N52 A;  1B9M A;  1VF7 A;  2F0G A;  2L12 A;  1HTL D;  1PTO D;  1SYE A;  1JOR A;  3VYR A;  3O13 A;  4OL7 A;  4IUT A;  2HCI A;  3MFG A;  1B9N A;  2EOT A;  1B1Z A;  4YIJ A;  4KTA A;  4NP5 A;  1QNU A;  1EY9 A;  2RSN A;  2RSO A;  4HR7 B;  5DEH A;  3R3O A;  4PNY A;  1RTN A;  1I6H B;  5T1I A;  2FIN B;  3E6Z X;  5A2Q E;  2ZT9 C;  3HS0 C;  4DNT B;  1E2Z A;  1F9P A;  1TWA B;  4RAU C;  1ESR A;  4F7X A;  1A15 A;  3BYY B;  3SK6 A;  1BXT A;  3GP7 A;  1AZP A;  3IFT A;  3S2H B;  3PUZ A;  3QOJ A;  4ZK9 B;  4C3J G;  2WII B;  1KLG D;  3A8I E;  1D5M C;  5IOC A;  5K36 H;  4WOR A;  5IIF A;  1SNQ A;  1KDA A;  3I4L A;  5KRU A;  3BVG A;  1HHV A;  4KHV A;  1SYB A;  3C46 A;  3T53 B;  1FR3 A;  3BDO A;  5BN4 A;  5CGK A;  2ID0 A;  2PO4 A;  1AW7 A;  1EY0 A;  1IL8 A;  3PIP 3;  1CHP D;  2LY7 A;  3BVZ A;  4C3I G;  4K2K A;  5JPM C;  1TS3 A;  2BE5 C;  1A3V A;  5M5Y B;  3OW7 A;  2HDL A;  3IKJ A;  3IFD A;  4O1N A;  3D4D A;  2VB3 X;  3S15 B;  3MXU A;  4FF3 A;  1CTM A;  4FO2 A;  5M9O A;  1JCK B;  1W6J A;  5J39 A;  3LX0 A;  3SK5 A;  3I3C A;  3VA7 A;  4H13 C;  1SJE D;  4PMW A;  4NKL A;  2I46 A;  3V96 A;  1WCM B;  3RZD B;  2PPB C;  4WFN 3;  2E74 C;  5C4X B;  5CV4 A;  4DXG A;  3OOC A;  2R92 B;  1TY2 A;  1T5E A;  1ET6 A;  2HCC A;  4RGO S;  3EA6 A;  2AUK A;  3W2D A;  1DYQ A;  1E0B A;  1T5X D;  2F0T A;  5KNC A;  4B08 A;  1DOK A;  2ZXO A;  3P20 A;  4XYO A;  3AB9 A;  3G6J B;  4C56 C;  3MTS A;  5G3L D;  1LTG D;  1RKN A;  1QB5 D;  4KKT A;  4S3S A;  3QIA A;  1K83 B;  1OXS C;  1A2U A;  4IUP A;  5LL6 X;  1BUV T;  2EYH A;  1PFM A;  3CKI B;  4IAL A;  2A5H A;  4CBV A;  1H9K A;  1PRT B;  3X3M A;  1D2B A;  5BN5 A;  1CK1 A;  1V8Q A;  1EZ6 A;  3OMC A;  4IUR A;  4V19 0;  1AZQ A;  1WTR A;  2L5T A;  4Z9C B;  1OXX K;  1S5E D;  4N9P A;  1ONL A;  1S5D D;  4IUU A;  2WKC A;  4QB4 A;  3Q22 A;  5A35 A;  2HQE A;  2R93 B;  1PRT D;  2L1B A;  3FVQ A;  1NSN S;  4ZUI A;  2O2L D;  2C5C A;  2BE5 D;  1KNE A;  1ENA A;  2EYP A;  1CI3 M;  1S5C D;  2NYZ D;  4TRD A;  3TZD A;  1I4H A;  1OXT A;  5FOB B;  1Y8P B;  3R2T A;  1MSG A;  3RUZ A;  2B2T A;  1SND A;  2ICI A;  1I4G A;  2B2Y A;  4XYQ A;  1ROD A;  5C6A A;  2KEC A;  3VYU A;  5I9O A;  3NK9 A;  1EYC A;  5FLX E;  3S1R B;  4KY6 A;  1Y1W B;  1RCV D;  2SNS A;  2FMM A;  3GTQ B;  3R2I A;  4DU9 A;  1QG7 A;  4F87 A;  2F0W A;  1F2M A;  1HTP A;  3D4R A;  1TKW B;  2KA7 A;  2F0P A;  3PUV A;  1SFO B;  3QWN A;  2K05 A;  3D3R A;  2BOS A;  2EDG A;  5M3F B;  5EKI A;  4BY1 B;  5TSS A;  4DA2 A;  2SNM A;  4IFD H;  1D6E C;  2WIN B;  3CRK C;  2PYK A;  3RLF A;  2RQX A;  4C2M B;  4IQZ A;  3IAY A;  2E2I B;  4H7B A;  4J1M A;  4EVO A;  1BR9 A;  3TP7 A;  3DMU A;  5KIX A;  1SNM A;  3NBH A;  1D1I A;  4BBS B;  4TSS A;  4O42 A;  2L11 A;  2EE1 A;  3HP3 A;  1R4Q B;  4WRD A;  3VR6 A;  3HOZ B;  5C0X G;  2L4N A;  3A8K E;  2CQA A;  1D1K A;  4RCN A;  3MAQ A;  1LT5 D;  4LAA A;  3I91 A;  1ML0 D;  2LFN A;  2M00 A;  1ET9 A;  2NTS A;  4N9T A;  2XSC A;  1DOL A;  3R8B A;  1OO9 B;  4IUV A;  4LK1 C;  1BNZ A;  3QJY A;  1L0Y B;  1EWH A;  3MXG A;  1X3P A;  4RKB A;  3MZ5 A;  1WD0 A;  1Z6H A;  4RHS A;  4HN7 A;  3HOX B;  2GA4 B;  5EPJ A;  2HDM A;  3K5N A;  3NSW A;  1B4O A;  5FK9 C;  1WTX A;  2PZW A;  3GTG B;  3DWQ A;  1HQM C;  2LS0 1;  3BZD B;  2KJX A;  1Q1E A;  4RCO A;  4BA1 I;  2Y0S B;  2DNC A;  3M3Y B;  5CMD A;  2H1E A;  3NQT A;  4KI0 A;  4P2C B;  1K8M A;  2FJ2 A;  1XTC D;  1FNV A;  1DZ1 A;  1Q12 A;  3KLS X;  3OPO A;  2K33 A;  4HMJ A;  3VYS A;  1JWU D;  3C1E A;  4ZYS A;  1LT3 D;  3L7Z C;  3M4Y A;  1ENF A;  3WOF A;  2DY8 A;  2EJF C;  1HUM A;  1CT1 D;  1V43 A;  1Q1B A;  1HFG A;  1RDP D;  1BCP F;  2JA5 B;  2B2W C;  1LTT D;  3P75 A;  4HSP A;  1H9R A;  5E1F A;  1C4Q A;  1SNP A;  4F8M A;  3KBG A;  4RH6 A;  4DAV A;  2HUG A;  4QUC A;  3TSS A;  2YYZ A;  4B9W A;  2VUM B;  2XRS D;  1SMY D;  3WDN A;  3J80 E;  5D3I B;  2BDO A;  1PXU A;  3E5S A;  4L8J A;  3Q24 A;  2QDB A;  1IYV A;  5E4X A;  5HGT A;  2O5J C;  2B8F A;  2JYO A;  4I65 A;  4JBW A;  1U4L A;  2EYF A;  1I4Q A;  3C3L A;  2KUM A;  2Q8T A;  5C4Z A;  3T16 A;  1VMP A;  4C3H B;  3CQZ B;  2EYM A;  3OIQ A;  5I2X A;  3RMH A;  1JR0 D;  1BQQ T;  2B2U A;  2K32 A;  1G29 1;  3C1F A;  2F0S A;  2B2V C;  1HA5 A;  1G8Z D;  3A7A B;  1TII D;  2F0N A;  1STH A;  1DCZ A;  5IGB A;  1B44 D;  4FXD A;  5K5P A;  1I4R A;  2EY5 A;  2L0C A;  2ZXR A;  3ND9 A;  1Q8I A;  4ODG A;  2D62 A;  1Z47 A;  4RA8 A;  2PZT A;  4XQN A;  1PZI D;  2PZU A;  4X3U A;  3V05 A;  2PW5 A;  2KOL A;  2F0K A;  2ICE C;  4R8N A;  5COY A;  1EY5 A;  1DJR D;  1IW7 D;  1HXY D;  4HAE A;  3GTK B;  2B2U C;  1GXD C;  2OEO A;  4RHR A;  4H0L C;  2E2J B;  3F2U A;  4IN3 A;  1SYC A;  3MHB A;  1H9M A;  1XX8 A;  4KJO A;  5KNB A;  2EYL A;  1H9S B;  4OO1 H;  3D8G A;  5EQ0 A;  3X3N A;  4PMC A;  1EWC A;  4A3F B;  1JOO A;  5ELE A;  4JK1 C;  1HQR D;  2CW0 D;  2AQ1 B;  2F0I A;  4KKS A;  1PRT C;  1KLU D;  2XWB B;  1SE4 A;  4Y7N B;  2MHV A;  2XIW A;  4NDX A;  1O78 A;  1DON A;  4GZY C;  1OXV A;  3DEP A;  1K8O A;  1A6X A;  2NUC A;  3I90 A;  5IGE A;  4BBR B;  3JAM E;  3H6M A;  3KUP A;  4K2L A;  1JWM D;  1KAA A;  2MPM A;  2MP1 A;  3PUW A;  3DXJ C;  4XT3 B;  4TQU S;  1JQY D;  4C1N I;  1MBY A;  1STN A;  1S4Z A;  2EJG C;  3ITP A;  4PQX A;  4CJ1 B;  2AQ3 B;  1STG A;  1TS2 A;  3NXW A;  4IFD J;  1GUO A;  1PFN A;  1XXG A;  4EGV A;  4RWS C;  4FXK C;  3VR4 A;  1LTR D;  3T51 B;  4G7O C;  1B2T A;  3S2D B;  3A55 A;  1CM9 A;  2JSO A;  2EY6 A;  1EL0 A;  4DFA A;  5C5M A;  2NWG A;  3DHQ A;  2RVL A;  5I6W A;  1OXU A;  5IT9 E;  3J80 L;  1GHK A;  3HZX A;  2ZXP A;  3KF8 A;  1JOK A;  2F0L A;  1YNN D;  1ZKO A;  4QMG A;  2WB1 B;  3Q23 A;  4XQQ A;  4HTH A;  1EY4 A;  3FKI B;  1EY6 A;  2QIL A;  2K1B A;  4ZQ3 A;  1ICW A;  5LL6 S;  2RBM A;  2PQE A;  5ISR A;  2EY1 A;  1VMC A;  2J4X A;  5KYL A;  4K8I A;  4IUN A;  4Q0F A;  3HKZ B;  3NBI A;  4IFD I;  2RA4 A;  2VNU D;  5IGG A;  3NTK A;  1ZYR D;  1ZEQ X;  1BCP B;  2ENB A;  2QKI C;  2F3V A;  5JAV A;  2F0E A;  3U9S A;  3PO2 B;  1PTO F;  2BA1 A;  1EYD A;  5AFW A;  4F88 A;  2M9V A;  3BDL A;  1EOT A;  3HOY B;  1JC7 A;  1QWY A;  4G7Z C;  1CQV A;  1C8C A;  3UI2 A;  3LNN A;  3S1M B;  3MFY A;  1EU4 A;  2F4I A;  1CHQ D;  4ME5 A;  1EIH A;  1EU3 A;  2OF1 A;  1BCP D;  5I6Y A;  4C1N K;  4A93 B;  3VR5 A;  4A3J B;  1EY7 A;  1AEX A;  1S5F D;  3KLR A;  5C44 B;  1DD2 A;  4XT1 B;  4BA2 I;  4R9W A;  5LHY 1;  1HCZ A;  1TS4 A;  2L55 A;  1TY0 A;  1PYW D;  1F2Y A;  2EZV A;  1I4P A;  4L63 B;  1SEB D;  3A54 A;  1GJX A;  1Y8O B;  3CRL C;  3SHL A;  2A74 C;  3TP6 A;  2C9O A;  1JB3 A;  1LTI D;  1IHZ A;  5D65 A;  4X3S A;  3VR3 A;  4EQN A;  4MIU A;  3TZU A;  1KNA A;  4ZAI A;  4E6I A;  2EY2 A;  3JAM L;  3GV6 A;  2NN6 G;  5CBA E;  4QCL A;  4ZKC B;  2KQ3 A;  4CKC A;  4R8I A;  3P7J A;  2EPB A;  1XYI A;  3E0J A;  4DF7 A;  4A3K B;  3SDZ A;  2B39 A;  1NUC A;  2K28 A;  5EPK A;  4K5X A;  1VCI A;  2JEA I;  5C4J B;  3GD7 A;  1SMY C;  5DNF A;  2JE6 I;  1CFM A;  2RDF A;  1WTO A;  4DAP A;  3ERQ A;  2IT1 A;  3FEW X;  3L9A X;  1ILQ A;  1LV9 A;  4V0B A;  1SNO A;  2BDN A;  1V1P B;  3OWE B;  3QO2 A;  5I9P A;  3KK7 A;  1SYF A;  1HFN A;  1KAB A;  5EBC A;  3I73 A;  4CKE A;  1FYC A;  3HG9 A;  3S14 B;  2FFK B;  2K5Q A;  2OXP A;  1STE A;  2AWO A;  1RD9 D;  5IT9 L;  3ND8 A;  2E75 C;  4UDU C;  4X3T A;  4K8J A;  3I8Z A;  1B3A A;  1G2S A;  5C0X I;  2KED A;  2XWJ B;  3R93 A;  4OGQ C;  2E2H B;  5JEA G;  1MSH A;  3MXP A;  2CHB D;  1GUN A;  5ELB A;  3NWS A;  3NPP A;  4HCS A;  2I07 B;  3U9O A;  5J22 A;  1BF4 A;  2LKV A;  4KN7 C;  5KGU A;  2WKD A;  5IOD A;  3D4W A;  2A6E D;  2A73 B;  5EJW A;  2B2W A;  2BCO A;  5COR A;  5CYU A;  2RDH A;  2NTT A;  4C3J B;  3BDC A;  2JA7 B;  3K5O A;  1U4M A;  1IW7 C;  1TWF B;  1SE3 A;  1TWH B;  1G2T A;  3NTI A;  1PMR A;  3GTM B;  1TS5 A;  3HOV B;  2Q8R E;  1SDF A;  1SYD A;  1D5Z C;  3DWA A;  4A3B B;  2MJ8 A;  1Q3L A;  3T13 A;  4C3I B;  2R61 A;  4M8A A;  1I6V C;  3K59 A;  5CBE E;  1U4R A;  2CW0 C;  4A3M B;  2L9H A;  5E3F A;  3EJI A;  3HRZ C;  4XIG S;  1NR4 A;  2BA0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...