2F0UA

Crystal structure of staphylococcal nuclease mutant v23i/l25i/i72v
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTIKIMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKVEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Staphylococcal nuclease
total genus 35
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0uA00
4I65A 3ITPA 4RKLA 2F0MA 2M00A 5CGKA 4KHVA 2F0EA 4WRDA 1TQOA 1EY9A 2F0KA 2QDBA 3H6MA 3TP7A 5C6AA 3R3OA 4KV6A 1NUCA 3DMUA 4IALA 5I9OA 4KY7A 4QB4A 4QF4A 2PZUA 2EYMA 2RDFA 3DHQA 2RKSA 4MIUA 5ISRA 2OF1A 4EQNA 3EROA 4E6IA 1A3VA 2EY6A 3EJIA 4K8IA 2SOBA 5C5MA 4KD3A 4WORA 4J1MA 2EYLA 2F0WA 3TP8A 5EKLA 1IHZA 1EZ8A 5KYIA 1STHA 3RUZA 1STBA 4K5WA 4QMGA 5EGTA 1EY5A 4KJOA 4YIJA 3TMEA 1KDAA 3NUCA 3V2TA 1EY4A 1AEXA 2EYJA 4IZ8A 3NK9A 5CV7A 2PW5A 3TP5A 2F0FA 3C1FA 1SNPA 4LAAA 4ME5A 4DGZA 3LX0A 5E3FA 2OEOA 5KYLA 1JORA 5C3WA 2EY5A 2F0UA 3NHHA 5HURA 3OMCA 4NP5A 4H7BA 2O4XA 4TRDA 3QB3A 4EQPA 4K6DA 4K5VA 2F0NA 2F0HA 5I6YA 3OWFA 4KD4A 3MHBA 1SYGA 5JAVA 2F0IA 1SNOA 4DFAA 3SK4A 5CR3A 5IGGA 1STGA 5IOCA 5C4ZA 5C5LA 1RKNA 3PMFA 2PZWA 2EYFA 5KEEA 1SYEA 3MVVA 1EZ6A 3P1HA 2SNSA 1F2ZA 4ZUJA 5CC4A 2F3WA 5IGCA 5CV8A 5KGUA 2KQ3A 2F0DA 4R8NA 5HGTA 1SNDA 1SYCA 2EYPA 5F2DA 4IUNA 2F0VA 2F0JA 4HMIA 5E1FA 1NSNS 2F0OA 1EYDA 4K8JA 4PNYA 4EVOA 3D6CA 3HZXA 2F0PA 5K5PA 5IGDA 3S9WA 1EQVA 1II3A 1KAAA 1STNA 2RBMA 4B9WA 1KABA 3OMGA 2EYHA 5NUCA 1JOQA 3MZ5A 3QOLA 5CV6A 3SK6A 2EXZA 3SK8A 1STAA 4NMZA 3TP6A 5C4HA 1F2MA 2HQEA 3D8GA 4K2KA 1SYBA 4K2LA 1A3TA 4ZQ3A 5IGFA 5CV4A 5M9OA 1JOKA 3SK5A 2EY1A 3BDCA 2F0QA 2PZTA 3C1EA 3QOJA 1KDCA 3D4WA 1EY7A 2EY2A 3MXPA 5C3XA 3SHLA 1A3UA 2F0SA 1F2YA 1SYDA 1EY6A 1SNCA 3E5SA 2F0LA 3HEJA 3OSOA 4N9PA 4PMCA 5CV5A 4DU9A 5J22A 2KHSA 2F0GA 3EVQA 4F8MA 3NP8A 3D4DA 5IGEA 4J6HA 1EYCA 4OL7A 4DF7A 5J1ZA 2SNMA 1SYFA 3VA5A 1EY8A 2F3VA 5DEHA 3U9OA 1STYA 5I6WA 5J39A 1A2TA 1EYAA 3BDLA 4F7XA 1TR5A 1TT2A 2WACA 3ERQA 3NQTA 4G57A 4ID6A 2PW7A 4PMBA 5CV9A 3MEHA 2ENBA 3SR1A 5IODA 4ODGA 5EKKA 3NXWA 1SNMA 5IIFA 4S3SA 5KRUA 4KTAA 4NKLA 1ENCA 1EY0A 3P75A 4N9TA 3T16A 4NDXA 3SXHA 1ENAA 2OXPA 2PQEA 5IGBA 1A2UA 4ZUIA 4K14A 3T13A 5I9PA 4HTHA 2PYKA 5JOBA 1U9RA 4KJNA 5KIXA 2LKVA 1JOOA 4KY6A 2F0TA 1SNQA 2EYOA 4HMJA 1KDBA 5DAUA 4EQOA 4B9XA 4KY5A 4K5XA 4RKBA 2NUCA
chains in the Genus database with same CATH superfamily
1BCPB 5C3EB 4B3SL 2J4XA 3TP7A 2L0CA 5BR8L 1XMOL 2Y0SE 2BDOA 4KI0A 1XMQL 2B2WA 2HDLA 4C3IG 3RMHA 5IYCG 4JI1Q 4K8IA 2J7ZA 3HOUG 5KYIA 3CCRA 3UE1A 4G7HC 2JQOA 5FO7B 4DUZQ 1TWHB 3H0GH 3N52A 3CPWA 2CW0D 1JWUD 1KNAA 1VQIA 1TS4A 2ICEC 2PW5A 2C5CA 3JAME 3PUZA 4LW1A 1CZGA 5E4XA 2FINB 1JORA 3R93A 4A3EG 2CVRA 1RHPA 4EQPA 4JBMA 1OO9B 4I7AA 1JE4A 4MTNA 1SYGA 3FPPA 1JJ2A 1ESFA 3S2HB 2KBNA 3CCLA 2R92G 1NR4A 1GHKA 4CKCA 3MXNA 1X32A 2E5LL 2AUKA 3WOEA 3BZDB 2NB0A 4ME3A 2PNHA 1WTWA 2E2HB 4K8JA 1HQRD 4Y7NH 4DUZL 2Z4IA 2HIVA 3GTOB 4HEDA 4BBRG 1SN8A 3GQBA 1CTMA 4R9WA 5JJZA 3S1RB 1Q82C 1XNQQ 3OMGA 4C56C 1D1IA 5CV6A 3WWVA 1STAA 3NENA 3PUWA 1F77A 5I2XA 3PQIA 1Y8OB 5CBAE 1K83H 3MXNB 1HCZA 5IGFA 5ELOA 4TVAB 1EY7A 3CW2C 1SNCA 1I4HA 1PTOC 3AFPA 1M8AA 4XQNA 2FHTA 1D8LA 3IKJA 4AIMA 1QZGA 1NR2A 3S17H 3UDFA 1O7YA 2K04A 1I4GA 1F9PA 4HJ8A 3SR1A 3GTOH 3SDZA 3T1YQ 3BZKA 4P74A 3A0JA 2AMCB 3TEHB 3NXWA 5IIFA 1VMPA 4HIDA 2L55A 2I07B 4ILWA 5M5XH 4JI4Q 4A3MG 1NCVA 1N34Q 5JOBA 1CI3M 3WDNA 5IYBG 2F0TA 1C0AA 1CA5A 4A3BH 4NB3A 1H9SA 3S1QB 4JI8Q 3ULJA 3PO2B 2M00A 4RFBA 2Z6KA 2NVTH 2B2VA 2D62A 2JJQA 2JA9A 4KV6A 5GADC 2E2DC 1PTOF 1MD2D 2NBFA 2X6LA 2RDFA 1BCPD 3P7JA 1ZKOA 3KLSA 2B8FA 3CQZB 4K6LA 1W6JA 2SOBA 2K03A 1GUSA 4XT3B 2G9HD 4JI0Q 4O42A 1ESRA 1GUWA 1Z47A 1MKHA 4FF1A 3PGZA 5EGTA 3L0OA 3CXCA 4DAMA 2XTIA 3I2ZA 4CKEA 1R4QB 2A6ED 2F0FA 4ME5A 3LX0A 3OYYA 3I56A 4DAVA 4R8IA 4Z9CB 3WOFA 2EXDA 4R4QA 4TRDA 1RDPD 4K6DA 2RSOA 4P2CB 3OW7A 1EYGA 3L7ZC 5CORA 5EPKA 5M5WH 4LF9L 1A63A 3DWAA 1VF5C 1VQOA 3M4PA 5LL6X 1PDQA 4GZYC 5KGUA 2Q8IB 1SYCA 5FKAC 2DY7A 2X69A 2F0JA 4UP9A 2VL6A 4I7ZC 3LWUA 2F0OA 1SMYC 2C35B 1PHJA 3SEBA 3HOVH 3U9SA 4X65Q 4PNYA 3HOWB 1CQFA 3S9WA 3NTKA 5C0XJ 2ALYB 1XX8A 4DUYQ 2UXCQ 1KHIA 1K3BC 2DNEA 5CV4A 3SGIA 5M9OA 1PYSB 1DGSA 3SK5A 2EY1A 4MZ9A 4DAYA 1CA6A 3CC2A 2BDNA 3G48A 3K81C 3E5SA 3UDGA 2M9VA 3GD7A 1AP0A 2AQ1B 1QILA 1SR3A 4RCNA 4G7OC 1EYCA 4H13C 3I73A 1DCZA 2Q2HA 5CV9A 4V190 4A3GB 4MN3A 2EZVA 2AKWB 5T1IA 2VW9A 4YWMA 1A0IA 3FKIB 5CYUA 1A2UA 4KKTA 1VQPA 5G3LD 1IBKL 2IPKD 2BE5C 1LO5D 4LF8L 1W3SA 1X56A 1KDBA 1ZYRC 1K8AC 1VQ8A 4KY5A 2E2JH 2B2TC 4MHEA 1Q46A 4OX9Q 1AN8A 1SBBB 4DNRB 2OWOA 4MTKA 1LACA 1DM0B 3FEWX 3CCUA 3DHQA 3G6JB 4A3GH 3EROA 4E6IA 3T1HQ 3QG1A 1Y1VB 1YNJC 3HS0C 5COYA 1G51A 4U68A 5BN4A 1I3QB 2ASBA 1IZ6A 2KCCA 4XYOA 5EBDA 3GTKH 3RLFA 1BBWA 4X6AH 1BDOA 1UUPA 1QUQB 2F0NA 3CCSA 1CHQD 2VZAA 3I72A 4JG2A 4BWGB 4RHSA 1RJTA 3FDTA 4BA1I 3U4ZA 3HOUB 3HOWH 1SYEA 3DEPA 1F2ZA 5I4DA 2IHEA 5CC4A 1TS5A 3GTMH 2WKDA 3S16B 1HNZL 3T51B 4EVOA 2K75A 3J80c 4DR3L 4R4IA 1LABA 3NBHA 4CJ2C 3E0EA 4DR5Q 3HOUH 3FKIG 4HJ5A 2B2YC 2ZJRA 4FDBA 5ELCA 3SVMA 4DR4Q 2UXBQ 1D1KA 5IY0A 2ZXOA 1A3TA 3STBC 4DN4M 2VNUD 4L8JA 2QDLA 4AYBE 4LF8Q 4OO1I 1B44D 1EY6A 3BJUA 4C2MH 5J22A 4DV7Q 3J7AF 2F0GA 1CKNB 2R7ZG 1Y1WG 2A8VA 1VQLA 1PRTC 4FNFA 3CC7A 4F7XA 4QGUA 2ZXRA 3Q24A 2PW7A 3L3OC 2DY8A 1AE2A 1I4XA 2MO1A 5JEAJ 1SE3A 2QW7A 1SNMA 2RVLA 4AYBG 4S3SA 4EX5A 1N34L 4YY3Q 5DLQE 2R93G 3P75A 3C2PA 2XSCA 4RMFA 4HJ9A 4BY7G 1V1PA 4JBWA 5FJ8H 1B9NA 1O80A 1XXGA 4K5XA 1EIGA 5LHY1 3CCQA 1QVFA 4DV0L 1ENFA 4WRDA 1Y69U 3TBIB 1SJHD 3H6MA 5EPLA 2K52A 2I5LX 2ZT9C 1FNVA 1X6OA 2NVXB 1PH7A 3M7GA 1HPCA 1IBLQ 3CAMA 4LFAL 1X3FA 4H02A 2ID0A 1WJJA 3KF6A 2NN6G 3CHBD 4CJ1B 3TMEA 1QWYA 2JYOA 2NVYH 2KHIA 4O1NA 4IZ8A 4R1JA 4DR6L 3CC4A 2MP1A 3C1FA 1V43A 5LMNL 4WJWA 3BZCA 5HURA 4N8FA 4H7BA 1PYWD 3NTHA 3OWFA 1VQJA 2CH4W 2B2TA 2JE6I 4DFAA 4A76A 5JJLA 1EQQA 4P75A 3A7AB 4Y7NB 3MVVA 1EOVA 4HCEA 5HGTA 1TXYA 2VXWA 1NSNS 2IY5B 3TZUA 3S1NH 1EYDA 2Z0SA 3FRPB 4DA2A 5GAGC 3S2HH 1K28A 1WVLA 4YHHQ 2RBMA 4B9WA 1CKOA 1PTOD 3F2DA 3MZ5A 2XVSA 1S5FD 2Q2UA 4A3IB 3TP6A 1VQ5A 1S5CD 1SSOA 1AZPA 3I4NH 4K2LA 2YTXA 1PFBA 3F2CA 1HUNA 3AU7A 1W6KA 3HGBA 5LMNW 5E7NA 1D2BA 1N33L 1P8LA 4JI2Q 1RODA 2R6GA 5C44G 4CDEC 5JJIA 3HKZG 5DEHA 3I3CA 1HR0L 2B63H 4UY8C 4X64L 1EIYB 2WACA 2A1AA 3ERQA 5D14A 3HOXH 4DR6Q 1YHAA 3PCOB 2IX1A 3MXGA 3Q0AA 1PTOH 4KTAA 4NKLA 4JBKA 4R4TA 5LMNQ 1K0SA 1ZYRD 2UXBL 1B2TA 4GLAC 4WJ4A 2A5HA 4UDUC 4JI1L 1TU2B 4I65A 4FXKC 3DM1A 1UEAB 3PO2G 1JWSD 1O7LA 4C3HB 4IOCA 1VS0A 1NUCA 3VR6A 2TMPA 3S2DB 1EIHA 1A62A 3KF8B 1I6VC 4QF4A 2LS01 4A3JG 2PZUA 4JC0A 2PMZB 2ES2A 4GOPC 4IFDJ 4KD3A 3W2DA 3CCVA 4EQ5A 4IUUA 5M3MB 1WTVA 1JT8A 5IP7H 5IT9c 1J9OA 4B3RL 4L63B 3M9BA 1HJPA 1Q3LA 4HSVA 3I4NG 2QA4A 1KLGD 1N32L 2UUAQ 3BDOA 3J81c 1G2SA 3NEMA 1HA6A 3PUYA 3J80i 2A73B 4ZK9B 2L11A 4A3IG 1G8ZD 1CHPD 3MHBA 4RGMA 4FYDA 5IGGA 1STGA 1WTHA 3B6YA 3R8BA 1ZXTA 2F4VL 3KLRA 4BS9A 4QIWE 1O7ZA 4IUNA 2NVXH 1EQTA 2LY7A 5M5YB 1CSQA 2WFWA 2UUBQ 1VQEA 3QR8A 5DM73 2E2HH 2MUYA 1A6XA 1YZ6A 1V1QA 1ASYA 4M1UB 5K5PA 3GDEA 1ET6A 1KABA 4JK1C 3DEOA 3Q8DA 2DGYA 2E75C 1VQ6A 2PPBC 3HKSA 3J81i 4WFN3 4ZQ3A 3A5UA 1VQMA 1IYJB 2GVBA 1A3UA 2K32A 4P73A 3J7YW 2R7DA 2F0LA 4DU9A 1PH6A 1LTGD 1YJWA 3U58A 3D4DA 4YCUA 4DXFA 4X3UA 1WFQA 2AWOA 5IP7G 3RN2A 1V1OA 2HCCA 4XXEA 1TR5A 4C3HG 4AQYL 4IJHA 1HQMC 2FMMA 1S5ED 4DK3C 1Q86C 4X64Q 1DD2A 3SXHA 4DXGA 3H09A 4NXNQ 2UU9L 2WP8J 2R7ZH 2LKVA 1SMYD 1UWVA 1T9HA 3OPOA 3HRZC 2HUGA 4DV5L 2HHHL 4KHVA 1E2ZA 1AFPA 3D4RA 1LTLA 3J81j 3T1HL 3JAML 1Y1WB 4QUCA 4UPAA 2NVQB 4DV6Q 2EYMA 3D0FA 1E1TA 3MEFA 3R2IA 5EJWA 3VR5A 4LJZC 3NQIA 5JPMC 3CCMA 4BY7B 4BBRH 4LUZA 4OEMB 1Q7YC 2O2LD 1KC8C 1B50A 1XNRQ 3V2TA 4R4OA 5DNFA 1D5XC 4NXMQ 4KMUC 4DV4Q 3NK9A 1FJGQ 2JK8A 1GD7A 3K5OA 2QGQA 1R4PB 1STEA 1HZ9A 4K0KL 4J8QA 3HOZB 3OOCA 4TQUS 5ELDA 2JA5H 4QY7A 4C3IB 2K6AA 1LT3D 5CR3A 1PMRA 1QB5D 1PV4A 4OO1H 1Y1VH 5E4WC 2PQAA 2KCTA 2F3WA 3DM3A 3IFDA 2BH2A 1D5MC 3KFUA 1XPUA 2KJXA 2Y0SB 3JAMi 2I46A 2OQ0A 3QIAA 5IGDA 4CBVA 1HNWQ 4A3DH 1STNA 4UP8A 2ICIA 5A2QE 3LGJA 2E2JB 4OIJA 1VQHA 3TQYA 4KKUA 4C3JB 2A69D 1U4RA 2OTLA 1GUNA 4XIGS 4IQZA 1KD1C 1O7IA 5J3BA 4DK0A 1IL2A 3DWQA 3SHLA 4OWTB 1RTNA 5AFWA 1OXTA 4J6HA 2RCNA 3NSWA 4OL7A 3A7LA 4DR2L 2RHQB 4LWCA 2Z1CA 1LM0A 1HTPA 3TREA 2K50A 1TT2A 5EKKA 3A54A 3I7FA 5KRUA 1NY4A 3ONAB 3ZJYC 2IX0A 2JP1A 4NXML 1DXMA 2E76C 4ABNA 3RZOH 1U4PA 3PO3H 2L5TA 4IJLA 1YHBA 4RKLA 5C44B 1FNWA 3HOXG 4BBRB 4OIKA 2IX3A 4IALA 5ELBA 2FFKB 3K58A 2KOLA 4OGQC 1JMCA 5IP9G 2JA8H 4IUPA 2EY6A 4GOPA 2KEDA 4HIMA 4H0LC 3TP8A 1AZQA 1QJOA 1JB3A 1IHZA 4HCSA 4B3TQ 2CH4A 1IW7C 4LMQD 4O0AA 3KDFB 4B3MQ 1E3PA 5LMUL 1YJNA 5EQ0A 2PI2E 3TP5A 1I50H 3IRBA 1GJXA 1Y14B 5K36G 4JI4L 2IHFA 3OMCA 4A3JB 1HFGA 1GKHA 4FF2A 4ALPA 3PIPA 1T5XD 4X66Q 2HDMA 1SFOB 2BOSA 4LFAQ 3HOVG 5C5LA 3PMFA 3CD6A 5KEEA 3P1HA 3KF8A 5FLMG 1SNDA 4GNXC 1VQBA 4A3BG 3BS1A 5IYBH 2MNAA 1K8MA 3I4NB 1IKMA 4PZ7A 2WAQG 4OELB 2OTJA 1X55A 4GNXA 3BYTB 5AJ3L 2R92H 3K5NA 2VUMB 2P5ZX 1MI2A 1H9JA 1I94L 1F9SA 1HNXQ 2K01A 2I0QA 4OHJA 1TWFB 3K80C 1XTCD 1VQ9A 1JOKA 1G6ZA 2PZTA 5FO9B 2D9UA 1XMQQ 1GUOA 1F2YA 5KYLA 4PMCA 5IP9H 2EJGC 5IGEA 2SNMA 1SYFA 5J39A 4P71A 3KDFA 1EYAA 1C7YA 1DJRD 4BBSH 1PZKD 2N55A 3OW2A 1Q8KA 1MHWC 2AUJD 1ICFB 4TSSA 1E0BA 3ZYYX 3H3VC 5KNCA 3T13A 4DV2L 4B3RQ 4BBSB 4A3MB 1JOOA 3QWNA 4YWKA 4HIOA 5DAUA 1O78A 1I5FA 2JEBI 1TWGB 3UE0A 1TQOA 3G4SA 3EQLC 1E1OA 2PMZE 4KY7A 3PF4A 3GTQH 4QQBX 4LF7L 4GN3B 1VF7A 1YVCA 3EJIA 2KHJA 3NWSA 3F8TA 2BH8A 1U5KA 4JYAQ 4QMGA 1EUJA 2NN6I 2F03A 5LL6S 3S1MB 5C4XH 4RG1A 1XJVA 4LF5Q 1J6QA 2SEBD 2QF7A 1UNSA 3G6EA 4DAPA 1BCPF 1WTQA 4DV1Q 1B70B 2RDGA 5KNDA 1C48A 2MFIA 1I4RA 2GN5A 2UXDL 4A3EH 4C2MB 3Q23A 5IYDG 2EYFA 2ATWA 2SNSA 1YNXA 1VQKA 4LF7Q 1PRTD 1DYQA 2MGSA 1WTRA 2K7VA 3LWEA 3BU2A 1S72A 3FVQA 2YU9H 2Z6BA 1WCMB 1BQQT 1L0YB 1N32Q 5JEAH 1CK1A 1IYUA 3M4QA 2HCIA 3I4MG 1SRUA 3K5LA 3S15H 3U4VA 3IAYA 4NMZA 1YJ9A 5C4HA 1E7ZA 1WYDA 4GKJL 3KJPA 4HN7A 1Q8IA 2L1BA 3VR4A 3TN2A 1N36L 1NAPA 2K5NA 3OTOL 1MJEA 4ZLTF 2L15A 2UU9Q 2Y0SG 4PQXA 4CHTB 3W3AA 1LT5D 3FMCA 4A93G 2I5HA 1HH2P 2BA1A 4APVA 3F2BA 2K05A 4NPSA 1KLUD 5A35A 2VQEL 1K8GA 2VB3X 1YHQA 4GNXB 4ZCKA 1NBWA 3GTKB 3JC66 4IPGA 1B9MA 4LF4L 4POFA 1LTTD 5D65A 2K4KA 3NE5B 5H1SE 4A3KG 4ZRZA 2ZJQA 4KY6A 1K8OA 4HMJA 2B29A 2EYOA 4PZ6A 2NVYB 5C0XG 1GHJA 3Q6SA 3CRKC 1U0LA 1QVCA 1EFID 2QCPX 3E0JA 1M1KC 3G7LA 1M4VA 1N33Q 1YNJD 4MIUA 5ISRA 1CKMA 1UEBA 3K6OA 3TDQA 2L9HA 3H3VH 4RGOS 3CF5A 1VQFA 2EIFA 5L37A 1STBA 4OX9L 1RCVD 2HD3A 3GV6A 2QEXA 5IWAQ 3C46A 3BVGA 1KIXA 2EYJA 1L0WA 2A69C 5HGQA 4IUTA 2NZOA 1BOSA 4BY1H 1SNPA 5E3FA 1EWCA 4YY3L 2K5DA 2N78A 1XYIA 2EY5A 4IOAA 1PZJD 3VYRA 1B3QA 1EFWA 1MSHA 1V9PA 5IYDH 3A8KE 4B3ML 2CWAA 4ZKBB 5I6YA 1W2BA 1H9SB 1SJED 1ET9A 4C3IH 1L2FA 2WKCA 1SXTA 5C4ZA 4XYQA 1G6PA 2Q8TA 2WV6D 3W5OA 4LUOA 4R8NA 2I5MX 5F2DA 2F0VA 4HMIA 1VQCA 2XRSD 3S24A 2Q8RE 4GN5A 1I6HH 4X62L 4JPBW 4A3LH 3HZXA 2F0PA 1CM9A 1I94Q 1UE5A 3FPUB 2DN8A 4ZAIA 4UAIA 2M2LA 3SK6A 3ULPA 1EL0A 4EGVA 1QVGA 4K2KA 4OXPA 2H1EA 3AQQA 3BDCA 3D4WA 1U4MA 1X3PA 1PA6A 4N9PA 3VR3A 3M4OB 2J0TD 3GTMB 2A6HC 1SDFA 1L1OC 5C4XG 3IL8A 1FGBD 4BXXH 5J1ZA 3VA5A 1QOHA 2F3VA 4MNOA 2RHSB 1A2TA 3T4AC 2XWJB 1K9MC 4IFDH 2YU9B 4GLVB 2ENBA 1C9OA 3E3XA 4IFDI 2MJ8A 1I6HB 1TIID 4NDXA 1FGUA 1LTAD 1ML0D 3LNNA 3IFTA 3RD4A 4K14A 3GTLB 2ZTEA 1LTBD 1SNQA 2F3IA 5CBEE 1GXDC 1I3QH 2F0MA 1BVSA 2RDHA 4OWXB 1XNRL 2XIWA 1LUZA 3KF6B 4DPGA 4DV6L 2UUCQ 2B2WC 2JA7G 1Z7TA 1IBML 4PMWA 4X62Q 4BY1B 1A15A 3I91A 1LT4D 3RUZA 3CU7A 2AWNA 1S4ZA 1EY5A 4DR1Q 4B3SQ 1EQRA 5C3EG 3HKZB 5M5XB 3R2TA 4LAAA 1B1ZA 1WI5A 5M5YH 3A5ZB 1FJGL 5JJKA 1OTCA 3NPPA 4JI6L 4NXNL 1D7QA 1K0RA 2D0OA 2LFNA 3NBIA 2E2IH 2F0IA 1H9MA 3TSSA 1MBYA 2QEJC 5IOCA 2KVMA 2IWHA 2B2UA 1GUTA 1VDZA 1H95A 1ONLA 1CSPA 1BR9A 3ND8A 1TY2A 1XMOQ 2EPBA 3PV0A 3GV3A 1PH3A 1TWAB 3AMUA 1Q90A 1KQSA 3TS2A 3A74A 3RLOA 1A8VA 1WTOA 2WAQB 1JC7A 5T1GA 1GUGA 2EXZA 5M3MH 5M3MG 4DV0Q 3DWPA 4AYBB 2VUMG 3D8GA 3PF5A 1SYBA 4FP5D 1TWFH 1BNZA 4JV5L 4PZ8A 3S2DH 2B2YA 1Y1VG 5JEAG 4AQYQ 4GKKQ 4LF9Q 4LF4Q 1IBKQ 5I6WA 2HT1A 1OXUA 1OXVA 4FF4A 1TWCH 3I4MB 3MEHA 3KOJA 1DOMA 1X9NA 1VQDA 1AH9A 4HJ7A 1EEFD 1H9RA 1WCMH 4QIWB 3T53B 1ENAA 1SAPA 4G7ZC 3HOYH 4ZUIA 4A4IA 1HFNA 1UAPA 1LTID 4XT1B 4FXGC 1PRTF 1RTOA 2R93H 4KK7A 3W1GA 2X6GA 3M4YA 4JOIA 4DV3L 1BCPC 3BVMA 1TS3A 2ZM6L 2E74C 2F0KA 5FJ8G 2N3SA 4DR5L 3HOYB 1PLFA 4GKKL 3I4OA 2A6HD 2UXCL 4GOPB 2EJFC 1X3QA 4EQNA 4DUYL 4H44C 5C3EH 2EYLA 5EKLA 3A8JE 2EJMA 4A3IH 2A19A 4DNTB 2NVTB 1E22A 4A3DG 2F4IA 2HIXA 4IPDA 3PO2H 4A3KB 1QNKA 2OCEA 2VY3A 3S1QH 4A3BB 1CUKA 2JA5G 2WB1B 3BVZA 3S1NB 2PNRC 2OEOA 3AEVA 1PRTB 1HHVA 4LFCL 4B08A 4NP5A 4OO1G 4IUQA 2FJ2A 4X66L 2LSSA 4UHVA 3C3LA 3PO3B 1N9WA 3PSIA 4O2DA 2MQHA 4CDCC 4KHPQ 4JI6Q 1Y8NB 5FOBB 3S17B 1YNNC 4A3MH 3L9AX 1RL2A 3K59A 5EPJA 1EU3A 2KQ3A 2F0DA 4YCWA 5E1FA 2NZHA 4FO2A 3G71A 3X3NA 4RA8A 2RSNA 4DNIA 4C1NI 3KBGA 3TRZA 4DAYB 1DOLA 2EYHA 5NUCA 1YI2A 2YV5A 4KLKA 1EOTA 5G3LF 4LFBL 3E9HA 4DKAC 1EEID 4JI7L 4WJ3M 1T5EA 1G91A 1B3AA 4LNQA 2YTYA 1OXXK 3W1BA 3UI2A 5IT9E 4LF6Q 3HEJA 1NJIC 3MFYA 3KUPA 4J15A 3DLLA 1YIJA 2A74C 2Z9HA 3EVQA 4IPHA 3JAMc 1KXLA 1HZCA 4ULLA 3HOYG 4G57A 1VCIA 2FMCA 4FXDA 1B4OA 2ZTCA 3MA2B 3T1YL 3H3VI 1NMFA 1ENCA 3A8IE 2XRQD 4QUFA 1B53A 5FLXc 4C1NK 4KHZA 4JV5Q 1DZ1A 2VB2X 1IBMQ 2JA5B 4U673 1ASZA 4IO9A 1SFOH 3OWEB 3V05A 3HOZH 1X65A 4JYAL 1HA5A 1TWHH 3KBXA 4RWSC 3MAQA 3KJOA 1TY0A 3R3OA 3KYHC 3ER0A 4B3TL 1X54A 1Z6HA 2H5XA 4C3JG 4ZKCB 4L5QA 3J7AV 1A3VA 5C5MA 4RGNA 4J1MA 3P20A 1ILPA 2N49A 4JI3Q 3V96A 4RAUC 4X3KA 2IL8A 1XPOA 1GOZA 4X3SA 1KDAA 3DXJC 2NYZD 3S16H 5KNBA 1BUVT 1PH5A 4A3CH 1HR0Q 1FL0A 3NHHA 2RF4A 3H0GG 5C4JB 1PH2A 2O4XA 3OHXC 4K5VA 1XWEA 2D0PA 1X3EA 5CMDA 1VQ7A 2E5LQ 2JSOA 2EOTA 3M3YB 4BY1G 4HSPA 4F88A 1Q81C 3RN5A 1EIFA 2A6EC 3CCJA 4JI2L 2PZWA 1EZ6A 2NZ1D 1CZWA 2KENA 1PH1A 2XWBB 5CV8A 3K0XA 3RZDB 3PIP3 1GO3E 1LT6D 1TWAH 1RF2D 4FF3A 2R3ZA 2A68C 4DR4L 2ZJPA 2K5QA 3J81E 5I2YA 3AYHB 1F9RA 2RQXA 4RH6A 3NBHB 5JPNC 3NWTA 4DR7L 3H91A 2K33A 4Q0FA 3J7ZC 4JVZA 4KN7C 1D6EC 1S5DD 3F2UA 1CKNA 1KL9A 3TZDA 5FLXE 1I4QA 1L1OB 3EBEA 1KRTA 3H15A 4A93B 5CV5A 1HNZQ 3KLSX 1BO0A 2KHSA 3KLWA 4F87A 2Q2TA 1WOCA 5ELFA 1I4PA 1SMXA 1EY8A 3PUVA 2B63G 2AQ2B 4IUVA 2NTSA 3K5MA 5K36H 4ODGA 3NELA 1PFSA 1SEBD 2EDGA 4N9TA 1N8RC 1EWIA 3URYA 1JCKB 1EWHA 2SDFA 5ELEA 1U9RA 1HR0W 2AQ3B 3OIPA 5LMUQ 4HR7B 3GTGH 4OWWB 5BR8Q 1OXSC 2Z6KC 1S5BD 2DNCA 2RA4A 1LYLA 1VQAA 4XTCS 1HUMA 1XNQL 1JICA 2D2CC 2ZXPA 3UDXA 1JB7A 3RNUA 3GTLH 3J81L 2RKSA 3K7AH 2CW0C 1P16A 1TKWB 1BBXC 4IPCA 1IYVA 4X3TA 2F0WA 1PFNA 3MTSA 4PG3A 2JA7B 1TVXA 4JCVE 3KK7A 1FYCA 3VYUA 1IKLA 2GA4B 1KTKA 3STBD 1UE7A 4K0KQ 1EY4A 3HFZB 4QJFA 1KAWA 1VQGA 4GLXA 4LFCQ 3HOVB 4DGZA 3GTPH 3D3RA 2L12A 3M4OH 3GO5A 5C3WA 4RGTA 1JQYD 1JWMD 1L1OA 5BN5A 1HZAA 4L5TA 4A3FH 1J8IA 1Y1WH 3QB3A 2IW3A 2MPMA 1SE8A 1BBUA 1BF4A 3S15B 4KD4A 1SNOA 3OTOQ 1YEZA 2FXQA 3N6RA 1UE6A 2H4OA 2EVBA 2B3GA 3PIO3 3H94A 2G5DA 2IT1A 4QCLA 4LF6L 2EYPA 2JN4A 4PV1C 3I4LA 1VMCA 2B63B 3D6CA 2PO4A 1FR3A 4A3EB 4DR3Q 1SE4A 3AFQA 1PYBA 3QOLA 3GTJH 4N8X1 4NW2A 4AH6A 1F2MA 1NMGA 4X65L 1HNWL 3CQZH 1FD7D 4A75A 5M3FH 3SE0A 2UXDQ 5GAHC 1E2VA 1SYDA 3HG9A 4KHPL 5C4XB 1IXRA 3K57A 5GROA 4JW0A 1NTGA 5D3DA 3U9OA 1STYA 1F9QA 2O5IC 3BDLA 1ZEQX 3S14H 4A3LG 2VS1A 1QUQA 4LK1C 2NWGA 5C0XH 3M7NA 2B8GA 2JA6G 2OXPA 5FLMH 4DK1A 4XQJA 4RCOA 3D6WA 2CWPA 1JJGA 5KIXA 4KJNA 5EAYA 3CPFA 2K5WA 3TS0A 1C8CA 1WCMG 3HP3A 2VQFQ 1L0XB 2NUCA 1B7YB 4KN4C 5CGKA 3D31A 2QDBA 1XTDA 1HNXL 1RD9D 3DMUA 1Y8PB 1GM5A 1R9TB 4QB4A 2WIIB 4A3CG 2V4DA 3J7A5 1LLRD 5I9OA 1X3GA 4Q5VA 1EZ8A 1EU4A 2KUMA 1DOKA 1VQ4A 2F4VQ 1Q1EA 2K1BA 4KJOA 4DV3Q 3S1RH 1K73C 4YIJA 2WB1E 4BA2I 1AEXA 3MFGA 2KEEA 1KNEA 2CHBD 2CQOA 5ELNA 4XQQA 3EA6A 5JVH3 1LTRD 4DV1L 1K3RA 1JE5A 4TKOB 1SROA 1HTLD 1V1PB 3S14B 2BA0A 3RLNA 2F0HA 2VUMH 3NTIA 2R92B 3PUXA 2UUAL 2EQSA 3VR2A 2MO0A 2HQLA 1WTPA 4ZUJA 4CJ0B 3I55A 3U50C 2OQKA 5M3FB 1S3OA 1CQVA 3AB9A 3MXUA 3GP7A 1G2TA 1PH4A 1PTOB 4JI3L 1LV9A 5GQOA 4OONA 3M85A 5HY6A 3HOXB 1II3A 2K5VA 3BG3A 3H0GB 5A2QL 3QJYA 1MSGA 1JOQA 1TS2A 3SK8A 2R93B 1HRJA 2HQEA 5EBCA 4A3JH 4CKBA 3MWYW 2DJFC 3EN2A 5C3XA 1JR0D 3EFXD 2D5DA 2EY2A 3MXPA 3J80L 2GVAA 2ZTDA 2A68D 4HIKA 5DM63 1UE1A 1B8AA 1TWCB 3NP8A 3I4MH 4HJAA 5C0XI 3S1MH 3ERSX 3HOWG 1WTXA 3VA7A 3J80E 3T56B 2JA6H 4ID6A 4PMBA 3CMEA 1VQNA 4HAEA 2N88A 2JEAI 3VYTA 1DONA 1BKBA 4DR1L 4BBSG 2PQEA 3GTQB 4HTHA 4JI0L 5C44H 4DR7Q 1F2LA 2KCNA 4EQOA 2WB1G 4YHHL 2JA7H 3RZOB 1TWGH 2CCZA 1EY9A 3K7AB 5BN3A 1XPRA 5C6AA 1SLJA 5AJ3Q 4V0BA 4LFBQ 4A3GG 1R9TH 2MHVA 1WD1A 2JA8G 1D5ZC 4A3FG 2AHOB 1STHA 4K5WA 1MJCA 3OIQA 1YITA 4JI8L 1QCBD 2E2IB 1MGSA 5M3FG 3NUCA 3CCEA 1PXUA 2B39A 3MC0B 2K5HA 3CKIB 1YNND 1Q12A 2CFMA 5IE8A 4DR2Q 4R4CA 1E24A 1QZHA 1ILQA 5IWAL 4CGYB 4QL5A 2DUDA 2YYZA 5JAVA 3HOZG 4DK6C 1CFMA 4RHRA 5IT9L 1PFMA 1FVIA 5IGCA 4ZYSA 1N36Q 1IW7D 3UDIA 4DV7L 2KA7A 2NN6H 1NE3A 3PIOA 1JJCB 4LUVA 3GTJB 2V1CC 2E8GA 4IFDG 2Z4HA 3RZDH 3HKZE 1GVPA 2B2VC 1Z9FA 3CP0A 2F0QA 3C1EA 3QOJA 4L6TB 4POGA 2ZM6Q 2F0SA 3OSOA 2VQEQ 2QKIC 3FHWA 3I90A 1SE2A 5FK9C 3E6ZX 1S40A 1I50B 5FLXL 4DF7A 3M3YH 3CRLC 3NQTA 4YWLA 1V8QA 5C4JH 2VQFL 5IODA 2R7FA 1E2WA 3L2PA 3VDYA 1RIPA 2NVQH 4IURA 1IL8A 4A3FB 1AE3A 3PO3G 2JA8B 4GKJQ 2C9OA 4LF5L 4IN3A 2F1MA 3BYYB 5D3IB 5M5WB 1G291 3GTPB 2PYKA 4GS3A 4BXXG 4JI7Q 4UP7A 1KRSA 4RKBA 2XN9C 2WAQE 3ITPA 2R7ZB 2F52A 2JXMB 1CT1D 2BCOA 2F0EA 2YTVA 1U4LA 2LXJA 1QG7A 3O13A 3DUZA 1IBLL 3A55A 1FNUA 2BE5D 4GN4B 2OF1A 1MIUA 1AW7A 4FVMA 3EIVA 4WORA 5TSSA 2PI2A 1BXTA 2PCFB 2EE1A 3FP9A 2UUBL 3GTGB 2IJ0A 4CDDC 2RCFA 3QO2A 5CV7A 1NNXA 2N8NA 4Y52H 1PZID 2F0UA 3K7UC 2B2UC 3ICEA 2R61A 1HXYD 4XDXA 4JBJA 4L5SA 4JI5Q 4C3JH 3CMAA 3SK4A 1QE6A 4DV4L 2DJGC 1RKNA 1C4QA 1J5EQ 2K28A 4A3DB 4A93H 5IYCH 1M90C 1LTSD 3E9IA 1HZBA 1WD0A 1PH8A 2KCMA 1QNUA 3FKIH 4G4KA 4JOIC 1EQVA 1KAAA 4L5RC 1ICWA 4YCVA 3ND9A 4DV5Q 2HHHQ 2UUCL 2Q2IA 4M8AA 2L4NA 2CQAA 1PH9A 2WINB 5EKIA 1J5EL 2NTTA 1K83B 1Q1BA 2TSSA 2XGTA 3I70A 4KKSA 1KDCA 4P72A 5JVG3 3K0YA 5GAEC 4JI5L 2LXKA 1YBYA 4F8MA 1H9KA 2G9DA 2K14A 1PVOA 3VYSA 2CKZB 2OT2A 4BY7H 3K8AA 3F1ZA 5FO8B 3A56A 4DV2Q 3X3MA 2KECA 2QILA 1EY0A 3T16A 2LMCB 4C3HH 5IGBA 4CDFC 2XNAC 4A3KH 5I9PA 2PQAB 2JA6B 3RR5A 2O5JC 3I8ZA 3Q22A 4B9XA 2Z8LA 3ULLA
chains in the Genus database with same CATH topology
1BCPB 5C3EB 2J4XA 3TP7A 2L0CA 2BDOA 4KI0A 2B2WA 2HDLA 4C3IG 3RMHA 4K8IA 2J7ZA 5KYIA 4G7HC 5FO7B 1TWHB 3N52A 2CW0D 1JWUD 1KNAA 1TS4A 2ICEC 2PW5A 2C5CA 3JAME 3PUZA 1CZGA 5E4XA 2FINB 1JORA 3R93A 2CVRA 1RHPA 4EQPA 1OO9B 1JE4A 1SYGA 3FPPA 1ESFA 3S2HB 1NR4A 1GHKA 4CKCA 3MXNA 1X32A 2AUKA 3WOEA 3BZDB 2NB0A 1WTWA 2E2HB 4K8JA 1HQRD 2Z4IA 3GTOB 4HEDA 3GQBA 4R9WA 1CTMA 5JJZA 3S1RB 3OMGA 4C56C 1D1IA 5CV6A 1STAA 3PUWA 1F77A 5I2XA 1Y8OB 5CBAE 5IGFA 1HCZA 1EY7A 1SNCA 1I4HA 1PTOC 1M8AA 4XQNA 2FHTA 3IKJA 1NR2A 1O7YA 2K04A 1I4GA 1F9PA 3SR1A 3SDZA 3NXWA 5IIFA 1VMPA 2L55A 2I07B 4ILWA 1NCVA 5JOBA 1CI3M 3WDNA 2F0TA 1CA5A 3S1QB 1H9SA 3PO2B 2M00A 4RFBA 2B2VA 2D62A 4KV6A 2E2DC 1PTOF 1MD2D 2NBFA 2X6LA 2RDFA 1BCPD 3P7JA 1ZKOA 3KLSA 2B8FA 3CQZB 4K6LA 1W6JA 2SOBA 2K03A 1GUSA 4XT3B 2G9HD 4O42A 1ESRA 1GUWA 1Z47A 4FF1A 5EGTA 4CKEA 1R4QB 2A6ED 2F0FA 4ME5A 3LX0A 4DAVA 4R8IA 4Z9CB 3WOFA 4TRDA 1RDPD 4K6DA 2RSOA 4P2CB 3OW7A 3L7ZC 5CORA 5EPKA 3DWAA 1VF5C 5LL6X 1PDQA 4GZYC 5KGUA 2Q8IB 1SYCA 5FKAC 2DY7A 2X69A 2F0JA 4I7ZC 3LWUA 2F0OA 1SMYC 3SEBA 3U9SA 3HOWB 4PNYA 1CQFA 3S9WA 3NTKA 5C0XJ 1XX8A 2DNEA 5CV4A 5M9OA 4DAYA 1CA6A 3SK5A 2EY1A 2BDNA 3E5SA 2M9VA 3GD7A 1AP0A 2AQ1B 1QILA 4RCNA 4G7OC 1EYCA 4H13C 3I73A 1DCZA 5CV9A 4V190 4A3GB 4MN3A 2EZVA 5T1IA 3FKIB 5CYUA 1A2UA 4KKTA 5G3LD 2IPKD 2BE5C 1LO5D 1ZYRC 1KDBA 4KY5A 2B2TC 4MHEA 1AN8A 1SBBB 4DNRB 1LACA 1DM0B 3FEWX 3DHQA 3G6JB 3EROA 4E6IA 3QG1A 1Y1VB 1YNJC 3HS0C 5COYA 4U68A 5BN4A 1I3QB 2KCCA 4XYOA 5EBDA 3RLFA 1BDOA 1UUPA 2F0NA 1CHQD 3I72A 4BWGB 4RHSA 1RJTA 3FDTA 4BA1I 3HOUB 1SYEA 3DEPA 1F2ZA 5I4DA 5CC4A 1TS5A 2WKDA 3S16B 3T51B 4EVOA 1LABA 3NBHA 4CJ2C 2B2YC 5ELCA 3SVMA 1D1KA 2ZXOA 1A3TA 4DN4M 2VNUD 4L8JA 4OO1I 1B44D 1EY6A 5J22A 3J7AF 2F0GA 1PRTC 4FNFA 4F7XA 2ZXRA 3Q24A 2PW7A 3L3OC 2DY8A 1I4XA 5JEAJ 1SE3A 1SNMA 2RVLA 4S3SA 3P75A 3C2PA 2XSCA 1V1PA 4JBWA 1B9NA 1O80A 1XXGA 4K5XA 1EIGA 5LHY1 1ENFA 4WRDA 1Y69U 3TBIB 1SJHD 3H6MA 5EPLA 2ZT9C 1FNVA 2NVXB 3M7GA 1HPCA 2ID0A 2NN6G 3CHBD 4CJ1B 3TMEA 1QWYA 2JYOA 4O1NA 4IZ8A 2MP1A 3C1FA 1V43A 4WJWA 5HURA 4H7BA 1PYWD 3NTHA 3OWFA 2B2TA 2JE6I 4DFAA 3A7AB 4Y7NB 3MVVA 4HCEA 5HGTA 2VXWA 1NSNS 3TZUA 1EYDA 3FRPB 4DA2A 1WVLA 2RBMA 4B9WA 1PTOD 3MZ5A 2XVSA 1S5FD 4A3IB 3TP6A 1S5CD 1SSOA 1AZPA 4K2LA 1PFBA 1HUNA 3AU7A 1W6KA 3HGBA 1D2BA 1RODA 2R6GA 5DEHA 3I3CA 2WACA 3ERQA 5D14A 2IX1A 3MXGA 3Q0AA 1PTOH 4KTAA 4NKLA 1ZYRD 1B2TA 2A5HA 4UDUC 1TU2B 4I65A 4FXKC 3DM1A 1UEAB 1JWSD 1O7LA 4C3HB 1NUCA 3VR6A 2TMPA 3S2DB 1EIHA 1I6VC 4QF4A 2LS01 2PZUA 2PMZB 4IFDJ 4KD3A 3W2DA 4IUUA 5M3MB 1WTVA 1J9OA 4L63B 1Q3LA 4HSVA 1KLGD 3BDOA 1G2SA 1HA6A 3PUYA 2A73B 4ZK9B 2L11A 1G8ZD 1CHPD 3MHBA 4RGMA 4FYDA 5IGGA 1STGA 3R8BA 1ZXTA 3KLRA 4BS9A 1O7ZA 4IUNA 1EQTA 2LY7A 5M5YB 5DM73 1A6XA 2MUYA 4M1UB 5K5PA 1ET6A 1KABA 4JK1C 3DEOA 2E75C 2PPBC 4WFN3 4ZQ3A 1A3UA 2K32A 3J7YW 2F0LA 4DU9A 1LTGD 3D4DA 4DXFA 4X3UA 2AWOA 1V1OA 2HCCA 4XXEA 1TR5A 4C3HG 1HQMC 2FMMA 1S5ED 1DD2A 3SXHA 4DXGA 3H09A 2WP8J 2LKVA 1SMYD 3OPOA 3HRZC 2HUGA 4KHVA 1E2ZA 1AFPA 3D4RA 3JAML 1Y1WB 4QUCA 2NVQB 2EYMA 3R2IA 5EJWA 3VR5A 4LJZC 3NQIA 5JPMC 4BY7B 2O2LD 1B50A 3V2TA 5DNFA 1D5XC 4KMUC 3NK9A 3K5OA 1R4PB 1STEA 4J8QA 3HOZB 3OOCA 4TQUS 5ELDA 4C3IB 2K6AA 1LT3D 5CR3A 1PMRA 1QB5D 4OO1H 5E4WC 2F3WA 3IFDA 1D5MC 2KJXA 2Y0SB 2I46A 3QIAA 5IGDA 4CBVA 1STNA 2ICIA 5A2QE 2E2JB 4OIJA 4KKUA 4C3JB 2A69D 1U4RA 1GUNA 4XIGS 4IQZA 4DK0A 3DWQA 3SHLA 1RTNA 5AFWA 1OXTA 4J6HA 3NSWA 4OL7A 3A7LA 2Z1CA 1HTPA 1TT2A 5EKKA 3A54A 5KRUA 3ONAB 2IX0A 2JP1A 1DXMA 2E76C 4ABNA 1U4PA 2L5TA 4RKLA 5C44B 1FNWA 4BBRB 4OIKA 2IX3A 4IALA 5ELBA 2FFKB 3K58A 2KOLA 4OGQC 4IUPA 2EY6A 2KEDA 4H0LC 3TP8A 1AZQA 1QJOA 1JB3A 1IHZA 4HCSA 1IW7C 4LMQD 5EQ0A 3TP5A 1GJXA 5K36G 3OMCA 4A3JB 1HFGA 4FF2A 1T5XD 2HDMA 1SFOB 2BOSA 5C5LA 3PMFA 3P1HA 3KF8A 1SNDA 3BS1A 3I4NB 1K8MA 1IKMA 3BYTB 3K5NA 2VUMB 1MI2A 1H9JA 1F9SA 2K01A 4OHJA 1TWFB 1XTCD 1JOKA 1G6ZA 2PZTA 5FO9B 2D9UA 1GUOA 1F2YA 5KYLA 4PMCA 2EJGC 5IGEA 2SNMA 1SYFA 5J39A 1EYAA 1DJRD 1PZKD 2N55A 2AUJD 4TSSA 1E0BA 3ZYYX 3H3VC 5KNCA 3T13A 4BBSB 4A3MB 1JOOA 3QWNA 5DAUA 1O78A 2JEBI 1TWGB 1TQOA 3EQLC 4KY7A 1VF7A 3EJIA 3NWSA 4QMGA 2NN6I 2F03A 5LL6S 3S1MB 2SEBD 2QF7A 1UNSA 4DAPA 1BCPF 1WTQA 2RDGA 5KNDA 1C48A 1I4RA 4C2MB 3Q23A 2EYFA 2SNSA 1PRTD 1DYQA 2MGSA 1WTRA 2K7VA 3LWEA 3FVQA 1WCMB 1BQQT 1L0YB 5JEAH 1CK1A 1IYUA 2HCIA 3K5LA 3IAYA 4NMZA 5C4HA 4HN7A 1Q8IA 2L1BA 3VR4A 3TN2A 1NAPA 4ZLTF 4PQXA 4CHTB 3W3AA 1LT5D 3FMCA 2BA1A 2K05A 1KLUD 5A35A 2VB3X 3GTKB 1B9MA 1LTTD 5D65A 3NE5B 4ZRZA 4KY6A 1K8OA 4HMJA 2EYOA 2NVYB 5C0XG 1GHJA 3Q6SA 3CRKC 1EFID 2QCPX 3E0JA 3G7LA 1M4VA 1YNJD 4MIUA 5ISRA 3K6OA 3TDQA 2L9HA 4RGOS 1STBA 1RCVD 3GV6A 3C46A 3BVGA 2EYJA 2A69C 4IUTA 1BOSA 1SNPA 5E3FA 1EWCA 2K5DA 1XYIA 2EY5A 1PZJD 3VYRA 1MSHA 3A8KE 4ZKBB 5I6YA 1H9SB 1SJED 1ET9A 2WKCA 1SXTA 5C4ZA 4XYQA 2Q8TA 2WV6D 4R8NA 5F2DA 2F0VA 4HMIA 2XRSD 2Q8RE 3HZXA 2F0PA 1CM9A 3FPUB 2DN8A 4ZAIA 4UAIA 2M2LA 3SK6A 1EL0A 4EGVA 4K2KA 2H1EA 3BDCA 3D4WA 1U4MA 1X3PA 4N9PA 3VR3A 3M4OB 2J0TD 3GTMB 2A6HC 1SDFA 3IL8A 1FGBD 5J1ZA 3VA5A 1QOHA 2F3VA 1A2TA 3T4AC 2XWJB 4IFDH 2YU9B 2ENBA 4IFDI 2MJ8A 1I6HB 1TIID 4NDXA 1LTAD 1ML0D 3LNNA 3IFTA 3RD4A 4K14A 3GTLB 1LTBD 1SNQA 5CBEE 1GXDC 2F0MA 2RDHA 2XIWA 2B2WC 1Z7TA 4PMWA 4BY1B 1A15A 3I91A 1LT4D 3RUZA 3CU7A 2AWNA 1S4ZA 1EY5A 3HKZB 5M5XB 3R2TA 4LAAA 1B1ZA 3NPPA 2LFNA 3NBIA 2F0IA 1H9MA 3TSSA 1MBYA 2QEJC 5IOCA 2KVMA 2IWHA 2B2UA 1GUTA 1VDZA 1ONLA 1BR9A 3ND8A 1TY2A 2EPBA 3PV0A 3GV3A 1TWAB 3AMUA 1Q90A 1WTOA 2WAQB 1JC7A 5T1GA 1GUGA 2EXZA 3DWPA 4AYBB 3D8GA 1SYBA 4FP5D 1BNZA 2B2YA 5JEAG 5I6WA 1OXUA 1OXVA 4FF4A 3I4MB 3MEHA 1DOMA 1EEFD 1H9RA 4QIWB 3T53B 1ENAA 1SAPA 4G7ZC 4ZUIA 1HFNA 1UAPA 1LTID 4XT1B 4FXGC 1PRTF 1RTOA 4KK7A 2X6GA 3M4YA 1BCPC 3BVMA 1TS3A 2E74C 2F0KA 3HOYB 1PLFA 2A6HD 2EJFC 1X3QA 4EQNA 4H44C 2EYLA 5EKLA 3A8JE 2EJMA 4DNTB 2NVTB 2F4IA 4A3KB 1QNKA 4A3BB 2WB1B 3BVZA 3S1NB 2PNRC 2OEOA 1PRTB 1HHVA 4B08A 4NP5A 4OO1G 4IUQA 2FJ2A 3C3LA 3PO3B 1Y8NB 5FOBB 3S17B 1YNNC 3L9AX 3K59A 5EPJA 1EU3A 2KQ3A 2F0DA 5E1FA 4FO2A 3X3NA 4RA8A 2RSNA 4C1NI 3KBGA 1DOLA 2EYHA 5NUCA 1EOTA 5G3LF 1EEID 1T5EA 1G91A 1B3AA 1OXXK 5IT9E 3UI2A 3HEJA 3MFYA 3KUPA 2A74C 3EVQA 4ULLA 4G57A 1VCIA 2FMCA 4FXDA 1B4OA 3MA2B 1ENCA 3A8IE 2XRQD 4QUFA 1B53A 4C1NK 4KHZA 1DZ1A 2VB2X 2JA5B 4U673 3OWEB 3V05A 1HA5A 3KBXA 4RWSC 3MAQA 1TY0A 3R3OA 1Z6HA 4C3JG 4ZKCB 3J7AV 1A3VA 5C5MA 4RGNA 4J1MA 3P20A 1ILPA 3V96A 4RAUC 4X3KA 2IL8A 1GOZA 4X3SA 1KDAA 3DXJC 2NYZD 5KNBA 1BUVT 3NHHA 5C4JB 2O4XA 1XWEA 3OHXC 4K5VA 5CMDA 3M3YB 2JSOA 2EOTA 4HSPA 4F88A 2A6EC 2PZWA 4B9XA 1EZ6A 2NZ1D 1CZWA 2XWBB 5CV8A 3RZDB 3PIP3 1LT6D 1RF2D 4FF3A 2R3ZA 2A68C 2K5QA 3J81E 5I2YA 1F9RA 2RQXA 4RH6A 5JPNC 3NWTA 3H91A 2K33A 4Q0FA 4KN7C 1D6EC 1S5DD 3F2UA 5FLXE 3TZDA 1I4QA 4A93B 5CV5A 3KLSX 1BO0A 2KHSA 4F87A 5ELFA 1I4PA 1EY8A 3PUVA 2AQ2B 4IUVA 2NTSA 3K5MA 5K36H 4ODGA 1SEBD 2EDGA 4N9TA 3URYA 1JCKB 1EWHA 2SDFA 5ELEA 1U9RA 2AQ3B 3OIPA 4HR7B 1OXSC 1S5BD 2DNCA 2RA4A 4XTCS 1HUMA 1JICA 2D2CC 2ZXPA 3J81L 2RKSA 2CW0C 1TKWB 1BBXC 1IYVA 4X3TA 2F0WA 1PFNA 3MTSA 2JA7B 1TVXA 3KK7A 1FYCA 3VYUA 1IKLA 2GA4B 1KTKA 1EY4A 3HOVB 4DGZA 3D3RA 2L12A 3GO5A 5C3WA 4RGTA 1JQYD 1JWMD 5BN5A 1J8IA 3QB3A 2IW3A 2MPMA 1BF4A 3S15B 4KD4A 1SNOA 3N6RA 2H4OA 2EVBA 3PIO3 3H94A 2IT1A 4QCLA 2EYPA 4PV1C 3I4LA 1VMCA 2B63B 3D6CA 2PO4A 1FR3A 4A3EB 1SE4A 3QOLA 4NW2A 1F2MA 1FD7D 3SE0A 1E2VA 1SYDA 3HG9A 5C4XB 3K57A 5D3DA 3U9OA 1STYA 1F9QA 2O5IC 3BDLA 1ZEQX 4LK1C 2NWGA 5C0XH 3M7NA 2B8GA 2OXPA 4DK1A 4XQJA 4RCOA 3D6WA 5KIXA 4KJNA 2K5WA 1C8CA 3HP3A 1L0XB 2NUCA 4KN4C 5CGKA 3D31A 2QDBA 1RD9D 3DMUA 1Y8PB 1R9TB 4QB4A 2WIIB 2V4DA 1LLRD 5I9OA 4Q5VA 1EZ8A 1EU4A 2KUMA 1DOKA 1Q1EA 2K1BA 4KJOA 4YIJA 4BA2I 1AEXA 3MFGA 2KEEA 1KNEA 2CHBD 4XQQA 3EA6A 5JVH3 1LTRD 4TKOB 1HTLD 1V1PB 3S14B 2BA0A 2F0HA 3NTIA 2R92B 3PUXA 3VR2A 1WTPA 4ZUJA 4CJ0B 5M3FB 1CQVA 3AB9A 3MXUA 3GP7A 1G2TA 1PTOB 1LV9A 3M85A 3HOXB 1II3A 3BG3A 3H0GB 5A2QL 3QJYA 1MSGA 1JOQA 1TS2A 3SK8A 2R93B 1HRJA 2HQEA 5EBCA 4CKBA 3MWYW 5C3XA 1JR0D 3EFXD 2D5DA 2EY2A 3MXPA 3J80L 2A68D 5DM63 1TWCB 3NP8A 5C0XI 1WTXA 3VA7A 3J80E 3T56B 4ID6A 4PMBA 4HAEA 2N88A 2JEAI 3VYTA 1DONA 2PQEA 3GTQB 4HTHA 1F2LA 2KCNA 4EQOA 3RZOB 1EY9A 3K7AB 5BN3A 5C6AA 4V0BA 1WD1A 2MHVA 1D5ZC 1STHA 4K5WA 3OIQA 1QCBD 2E2IB 1MGSA 3NUCA 1PXUA 2B39A 3MC0B 3CKIB 1YNND 1Q12A 1ILQA 4CGYB 2YYZA 5JAVA 1CFMA 4RHRA 5IT9L 1PFMA 5IGCA 4ZYSA 1IW7D 2KA7A 2NN6H 3GTJB 4IFDG 2Z4HA 2B2VC 2F0QA 3C1EA 3QOJA 4L6TB 2F0SA 3OSOA 2QKIC 3I90A 1SE2A 5FK9C 3E6ZX 1I50B 5FLXL 4DF7A 3CRLC 3NQTA 1V8QA 5IODA 1E2WA 4IURA 1IL8A 4A3FB 2JA8B 2C9OA 4IN3A 2F1MA 3BYYB 5D3IB 5M5WB 1G291 3GTPB 2PYKA 4RKBA 2XN9C 3ITPA 2R7ZB 2JXMB 1CT1D 2BCOA 2F0EA 1U4LA 3O13A 1QG7A 3DUZA 3A55A 1FNUA 2BE5D 2OF1A 1AW7A 4FVMA 4WORA 5TSSA 1BXTA 2PCFB 2EE1A 3GTGB 2IJ0A 3QO2A 5CV7A 1PZID 2F0UA 2B2UC 2R61A 1HXYD 4XDXA 3SK4A 1QE6A 1RKNA 1C4QA 2K28A 4A3DB 1LTSD 1WD0A 1QNUA 4G4KA 1EQVA 1KAAA 1ICWA 3ND9A 4M8AA 2L4NA 2CQAA 2WINB 5EKIA 2NTTA 1K83B 1Q1BA 2TSSA 3I70A 4KKSA 1KDCA 5JVG3 3K0YA 4F8MA 1H9KA 2G9DA 3VYSA 2OT2A 5FO8B 3A56A 3X3MA 2KECA 2QILA 1EY0A 3T16A 2LMCB 5IGBA 2XNAC 5I9PA 2JA6B 2O5JC 3I8ZA 3Q22A 5KEEA 2Z8LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I65 A;  3ITP A;  4RKL A;  2F0M A;  2M00 A;  5CGK A;  4KHV A;  2F0E A;  4WRD A;  1TQO A;  1EY9 A;  2F0K A;  2QDB A;  3H6M A;  3TP7 A;  5C6A A;  3R3O A;  4KV6 A;  1NUC A;  3DMU A;  4IAL A;  5I9O A;  4KY7 A;  4QB4 A;  4QF4 A;  2PZU A;  2EYM A;  2RDF A;  3DHQ A;  2RKS A;  4MIU A;  5ISR A;  2OF1 A;  4EQN A;  3ERO A;  4E6I A;  1A3V A;  2EY6 A;  3EJI A;  4K8I A;  2SOB A;  5C5M A;  4KD3 A;  4WOR A;  4J1M A;  2EYL A;  2F0W A;  3TP8 A;  5EKL A;  1IHZ A;  1EZ8 A;  5KYI A;  1STH A;  3RUZ A;  1STB A;  4K5W A;  4QMG A;  5EGT A;  1EY5 A;  4KJO A;  4YIJ A;  3TME A;  1KDA A;  3NUC A;  3V2T A;  1EY4 A;  1AEX A;  2EYJ A;  4IZ8 A;  3NK9 A;  5CV7 A;  2PW5 A;  3TP5 A;  2F0F A;  3C1F A;  1SNP A;  4LAA A;  4ME5 A;  4DGZ A;  3LX0 A;  5E3F A;  2OEO A;  5KYL A;  1JOR A;  5C3W A;  2EY5 A;  2F0U A;  3NHH A;  5HUR A;  3OMC A;  4NP5 A;  4H7B A;  2O4X A;  4TRD A;  3QB3 A;  4EQP A;  4K6D A;  4K5V A;  2F0N A;  2F0H A;  5I6Y A;  3OWF A;  4KD4 A;  3MHB A;  1SYG A;  5JAV A;  2F0I A;  1SNO A;  4DFA A;  3SK4 A;  5CR3 A;  5IGG A;  1STG A;  5IOC A;  5C4Z A;  5C5L A;  1RKN A;  3PMF A;  2PZW A;  2EYF A;  5KEE A;  1SYE A;  3MVV A;  1EZ6 A;  3P1H A;  2SNS A;  1F2Z A;  4ZUJ A;  5CC4 A;  2F3W A;  5IGC A;  5CV8 A;  5KGU A;  2KQ3 A;  2F0D A;  4R8N A;  5HGT A;  1SND A;  1SYC A;  2EYP A;  5F2D A;  4IUN A;  2F0V A;  2F0J A;  4HMI A;  5E1F A;  1NSN S;  2F0O A;  1EYD A;  4K8J A;  4PNY A;  4EVO A;  3D6C A;  3HZX A;  2F0P A;  5K5P A;  5IGD A;  3S9W A;  1EQV A;  1II3 A;  1KAA A;  1STN A;  2RBM A;  4B9W A;  1KAB A;  3OMG A;  2EYH A;  5NUC A;  1JOQ A;  3MZ5 A;  3QOL A;  5CV6 A;  3SK6 A;  2EXZ A;  3SK8 A;  1STA A;  4NMZ A;  3TP6 A;  5C4H A;  1F2M A;  2HQE A;  3D8G A;  4K2K A;  1SYB A;  4K2L A;  1A3T A;  4ZQ3 A;  5IGF A;  5CV4 A;  5M9O A;  1JOK A;  3SK5 A;  2EY1 A;  3BDC A;  2F0Q A;  2PZT A;  3C1E A;  3QOJ A;  1KDC A;  3D4W A;  1EY7 A;  2EY2 A;  3MXP A;  5C3X A;  3SHL A;  1A3U A;  2F0S A;  1F2Y A;  1SYD A;  1EY6 A;  1SNC A;  3E5S A;  2F0L A;  3HEJ A;  3OSO A;  4N9P A;  4PMC A;  5CV5 A;  4DU9 A;  5J22 A;  2KHS A;  2F0G A;  3EVQ A;  4F8M A;  3NP8 A;  3D4D A;  5IGE A;  4J6H A;  1EYC A;  4OL7 A;  4DF7 A;  5J1Z A;  2SNM A;  1SYF A;  3VA5 A;  1EY8 A;  2F3V A;  5DEH A;  3U9O A;  1STY A;  5I6W A;  5J39 A;  1A2T A;  1EYA A;  3BDL A;  4F7X A;  1TR5 A;  1TT2 A;  2WAC A;  3ERQ A;  3NQT A;  4G57 A;  4ID6 A;  2PW7 A;  4PMB A;  5CV9 A;  3MEH A;  2ENB A;  3SR1 A;  5IOD A;  4ODG A;  5EKK A;  3NXW A;  1SNM A;  5IIF A;  4S3S A;  5KRU A;  4KTA A;  4NKL A;  1ENC A;  1EY0 A;  3P75 A;  4N9T A;  3T16 A;  4NDX A;  3SXH A;  1ENA A;  2OXP A;  2PQE A;  5IGB A;  1A2U A;  4ZUI A;  4K14 A;  3T13 A;  5I9P A;  4HTH A;  2PYK A;  5JOB A;  1U9R A;  4KJN A;  5KIX A;  2LKV A;  1JOO A;  4KY6 A;  2F0T A;  1SNQ A;  2EYO A;  4HMJ A;  1KDB A;  5DAU A;  4EQO A;  4B9X A;  4KY5 A;  4K5X A;  4RKB A;  2NUC A; 
#chains in the Genus database with same CATH topology
 1BCP B;  5C3E B;  4B3S L;  2J4X A;  3TP7 A;  2L0C A;  5BR8 L;  1XMO L;  2Y0S E;  2BDO A;  4KI0 A;  1XMQ L;  2B2W A;  2HDL A;  4C3I G;  3RMH A;  5IYC G;  4JI1 Q;  4K8I A;  2J7Z A;  3HOU G;  5KYI A;  3CCR A;  3UE1 A;  4G7H C;  2JQO A;  5FO7 B;  4DUZ Q;  1TWH B;  3H0G H;  3N52 A;  3CPW A;  2CW0 D;  1JWU D;  1KNA A;  1VQI A;  1TS4 A;  2ICE C;  2PW5 A;  2C5C A;  3JAM E;  3PUZ A;  4LW1 A;  1CZG A;  5E4X A;  2FIN B;  1JOR A;  3R93 A;  4A3E G;  2CVR A;  1RHP A;  4EQP A;  4JBM A;  1OO9 B;  4I7A A;  1JE4 A;  4MTN A;  1SYG A;  3FPP A;  1JJ2 A;  1ESF A;  3S2H B;  2KBN A;  3CCL A;  2R92 G;  1NR4 A;  1GHK A;  4CKC A;  3MXN A;  1X32 A;  2E5L L;  2AUK A;  3WOE A;  3BZD B;  2NB0 A;  4ME3 A;  2PNH A;  1WTW A;  2E2H B;  4K8J A;  1HQR D;  4Y7N H;  4DUZ L;  2Z4I A;  2HIV A;  3GTO B;  4HED A;  4BBR G;  1SN8 A;  3GQB A;  1CTM A;  4R9W A;  5JJZ A;  3S1R B;  1Q82 C;  1XNQ Q;  3OMG A;  4C56 C;  1D1I A;  5CV6 A;  3WWV A;  1STA A;  3NEN A;  3PUW A;  1F77 A;  5I2X A;  3PQI A;  1Y8O B;  5CBA E;  1K83 H;  3MXN B;  1HCZ A;  5IGF A;  5ELO A;  4TVA B;  1EY7 A;  3CW2 C;  1SNC A;  1I4H A;  1PTO C;  3AFP A;  1M8A A;  4XQN A;  2FHT A;  1D8L A;  3IKJ A;  4AIM A;  1QZG A;  1NR2 A;  3S17 H;  3UDF A;  1O7Y A;  2K04 A;  1I4G A;  1F9P A;  4HJ8 A;  3SR1 A;  3GTO H;  3SDZ A;  3T1Y Q;  3BZK A;  4P74 A;  3A0J A;  2AMC B;  3TEH B;  3NXW A;  5IIF A;  1VMP A;  4HID A;  2L55 A;  2I07 B;  4ILW A;  5M5X H;  4JI4 Q;  4A3M G;  1NCV A;  1N34 Q;  5JOB A;  1CI3 M;  3WDN A;  5IYB G;  2F0T A;  1C0A A;  1CA5 A;  4A3B H;  4NB3 A;  1H9S A;  3S1Q B;  4JI8 Q;  3ULJ A;  3PO2 B;  2M00 A;  4RFB A;  2Z6K A;  2NVT H;  2B2V A;  2D62 A;  2JJQ A;  2JA9 A;  4KV6 A;  5GAD C;  2E2D C;  1PTO F;  1MD2 D;  2NBF A;  2X6L A;  2RDF A;  1BCP D;  3P7J A;  1ZKO A;  3KLS A;  2B8F A;  3CQZ B;  4K6L A;  1W6J A;  2SOB A;  2K03 A;  1GUS A;  4XT3 B;  2G9H D;  4JI0 Q;  4O42 A;  1ESR A;  1GUW A;  1Z47 A;  1MKH A;  4FF1 A;  3PGZ A;  5EGT A;  3L0O A;  3CXC A;  4DAM A;  2XTI A;  3I2Z A;  4CKE A;  1R4Q B;  2A6E D;  2F0F A;  4ME5 A;  3LX0 A;  3OYY A;  3I56 A;  4DAV A;  4R8I A;  4Z9C B;  3WOF A;  2EXD A;  4R4Q A;  4TRD A;  1RDP D;  4K6D A;  2RSO A;  4P2C B;  3OW7 A;  1EYG A;  3L7Z C;  5COR A;  5EPK A;  5M5W H;  4LF9 L;  1A63 A;  3DWA A;  1VF5 C;  1VQO A;  3M4P A;  5LL6 X;  1PDQ A;  4GZY C;  5KGU A;  2Q8I B;  1SYC A;  5FKA C;  2DY7 A;  2X69 A;  2F0J A;  4UP9 A;  2VL6 A;  4I7Z C;  3LWU A;  2F0O A;  1SMY C;  2C35 B;  1PHJ A;  3SEB A;  3HOV H;  3U9S A;  4X65 Q;  4PNY A;  3HOW B;  1CQF A;  3S9W A;  3NTK A;  5C0X J;  2ALY B;  1XX8 A;  4DUY Q;  2UXC Q;  1KHI A;  1K3B C;  2DNE A;  5CV4 A;  3SGI A;  5M9O A;  1PYS B;  1DGS A;  3SK5 A;  2EY1 A;  4MZ9 A;  4DAY A;  1CA6 A;  3CC2 A;  2BDN A;  3G48 A;  3K81 C;  3E5S A;  3UDG A;  2M9V A;  3GD7 A;  1AP0 A;  2AQ1 B;  1QIL A;  1SR3 A;  4RCN A;  4G7O C;  1EYC A;  4H13 C;  3I73 A;  1DCZ A;  2Q2H A;  5CV9 A;  4V19 0;  4A3G B;  4MN3 A;  2EZV A;  2AKW B;  5T1I A;  2VW9 A;  4YWM A;  1A0I A;  3FKI B;  5CYU A;  1A2U A;  4KKT A;  1VQP A;  5G3L D;  1IBK L;  2IPK D;  2BE5 C;  1LO5 D;  4LF8 L;  1W3S A;  1X56 A;  1KDB A;  1ZYR C;  1K8A C;  1VQ8 A;  4KY5 A;  2E2J H;  2B2T C;  4MHE A;  1Q46 A;  4OX9 Q;  1AN8 A;  1SBB B;  4DNR B;  2OWO A;  4MTK A;  1LAC A;  1DM0 B;  3FEW X;  3CCU A;  3DHQ A;  3G6J B;  4A3G H;  3ERO A;  4E6I A;  3T1H Q;  3QG1 A;  1Y1V B;  1YNJ C;  3HS0 C;  5COY A;  1G51 A;  4U68 A;  5BN4 A;  1I3Q B;  2ASB A;  1IZ6 A;  2KCC A;  4XYO A;  5EBD A;  3GTK H;  3RLF A;  1BBW A;  4X6A H;  1BDO A;  1UUP A;  1QUQ B;  2F0N A;  3CCS A;  1CHQ D;  2VZA A;  3I72 A;  4JG2 A;  4BWG B;  4RHS A;  1RJT A;  3FDT A;  4BA1 I;  3U4Z A;  3HOU B;  3HOW H;  1SYE A;  3DEP A;  1F2Z A;  5I4D A;  2IHE A;  5CC4 A;  1TS5 A;  3GTM H;  2WKD A;  3S16 B;  1HNZ L;  3T51 B;  4EVO A;  2K75 A;  3J80 c;  4DR3 L;  4R4I A;  1LAB A;  3NBH A;  4CJ2 C;  3E0E A;  4DR5 Q;  3HOU H;  3FKI G;  4HJ5 A;  2B2Y C;  2ZJR A;  4FDB A;  5ELC A;  3SVM A;  4DR4 Q;  2UXB Q;  1D1K A;  5IY0 A;  2ZXO A;  1A3T A;  3STB C;  4DN4 M;  2VNU D;  4L8J A;  2QDL A;  4AYB E;  4LF8 Q;  4OO1 I;  1B44 D;  1EY6 A;  3BJU A;  4C2M H;  5J22 A;  4DV7 Q;  3J7A F;  2F0G A;  1CKN B;  2R7Z G;  1Y1W G;  2A8V A;  1VQL A;  1PRT C;  4FNF A;  3CC7 A;  4F7X A;  4QGU A;  2ZXR A;  3Q24 A;  2PW7 A;  3L3O C;  2DY8 A;  1AE2 A;  1I4X A;  2MO1 A;  5JEA J;  1SE3 A;  2QW7 A;  1SNM A;  2RVL A;  4AYB G;  4S3S A;  4EX5 A;  1N34 L;  4YY3 Q;  5DLQ E;  2R93 G;  3P75 A;  3C2P A;  2XSC A;  4RMF A;  4HJ9 A;  4BY7 G;  1V1P A;  4JBW A;  5FJ8 H;  1B9N A;  1O80 A;  1XXG A;  4K5X A;  1EIG A;  5LHY 1;  3CCQ A;  1QVF A;  4DV0 L;  1ENF A;  4WRD A;  1Y69 U;  3TBI B;  1SJH D;  3H6M A;  5EPL A;  2K52 A;  2I5L X;  2ZT9 C;  1FNV A;  1X6O A;  2NVX B;  1PH7 A;  3M7G A;  1HPC A;  1IBL Q;  3CAM A;  4LFA L;  1X3F A;  4H02 A;  2ID0 A;  1WJJ A;  3KF6 A;  2NN6 G;  3CHB D;  4CJ1 B;  3TME A;  1QWY A;  2JYO A;  2NVY H;  2KHI A;  4O1N A;  4IZ8 A;  4R1J A;  4DR6 L;  3CC4 A;  2MP1 A;  3C1F A;  1V43 A;  5LMN L;  4WJW A;  3BZC A;  5HUR A;  4N8F A;  4H7B A;  1PYW D;  3NTH A;  3OWF A;  1VQJ A;  2CH4 W;  2B2T A;  2JE6 I;  4DFA A;  4A76 A;  5JJL A;  1EQQ A;  4P75 A;  3A7A B;  4Y7N B;  3MVV A;  1EOV A;  4HCE A;  5HGT A;  1TXY A;  2VXW A;  1NSN S;  2IY5 B;  3TZU A;  3S1N H;  1EYD A;  2Z0S A;  3FRP B;  4DA2 A;  5GAG C;  3S2H H;  1K28 A;  1WVL A;  4YHH Q;  2RBM A;  4B9W A;  1CKO A;  1PTO D;  3F2D A;  3MZ5 A;  2XVS A;  1S5F D;  2Q2U A;  4A3I B;  3TP6 A;  1VQ5 A;  1S5C D;  1SSO A;  1AZP A;  3I4N H;  4K2L A;  2YTX A;  1PFB A;  3F2C A;  1HUN A;  3AU7 A;  1W6K A;  3HGB A;  5LMN W;  5E7N A;  1D2B A;  1N33 L;  1P8L A;  4JI2 Q;  1ROD A;  2R6G A;  5C44 G;  4CDE C;  5JJI A;  3HKZ G;  5DEH A;  3I3C A;  1HR0 L;  2B63 H;  4UY8 C;  4X64 L;  1EIY B;  2WAC A;  2A1A A;  3ERQ A;  5D14 A;  3HOX H;  4DR6 Q;  1YHA A;  3PCO B;  2IX1 A;  3MXG A;  3Q0A A;  1PTO H;  4KTA A;  4NKL A;  4JBK A;  4R4T A;  5LMN Q;  1K0S A;  1ZYR D;  2UXB L;  1B2T A;  4GLA C;  4WJ4 A;  2A5H A;  4UDU C;  4JI1 L;  1TU2 B;  4I65 A;  4FXK C;  3DM1 A;  1UEA B;  3PO2 G;  1JWS D;  1O7L A;  4C3H B;  4IOC A;  1VS0 A;  1NUC A;  3VR6 A;  2TMP A;  3S2D B;  1EIH A;  1A62 A;  3KF8 B;  1I6V C;  4QF4 A;  2LS0 1;  4A3J G;  2PZU A;  4JC0 A;  2PMZ B;  2ES2 A;  4GOP C;  4IFD J;  4KD3 A;  3W2D A;  3CCV A;  4EQ5 A;  4IUU A;  5M3M B;  1WTV A;  1JT8 A;  5IP7 H;  5IT9 c;  1J9O A;  4B3R L;  4L63 B;  3M9B A;  1HJP A;  1Q3L A;  4HSV A;  3I4N G;  2QA4 A;  1KLG D;  1N32 L;  2UUA Q;  3BDO A;  3J81 c;  1G2S A;  3NEM A;  1HA6 A;  3PUY A;  3J80 i;  2A73 B;  4ZK9 B;  2L11 A;  4A3I G;  1G8Z D;  1CHP D;  3MHB A;  4RGM A;  4FYD A;  5IGG A;  1STG A;  1WTH A;  3B6Y A;  3R8B A;  1ZXT A;  2F4V L;  3KLR A;  4BS9 A;  4QIW E;  1O7Z A;  4IUN A;  2NVX H;  1EQT A;  2LY7 A;  5M5Y B;  1CSQ A;  2WFW A;  2UUB Q;  1VQE A;  3QR8 A;  5DM7 3;  2E2H H;  2MUY A;  1A6X A;  1YZ6 A;  1V1Q A;  1ASY A;  4M1U B;  5K5P A;  3GDE A;  1ET6 A;  1KAB A;  4JK1 C;  3DEO A;  3Q8D A;  2DGY A;  2E75 C;  1VQ6 A;  2PPB C;  3HKS A;  3J81 i;  4WFN 3;  4ZQ3 A;  3A5U A;  1VQM A;  1IYJ B;  2GVB A;  1A3U A;  2K32 A;  4P73 A;  3J7Y W;  2R7D A;  2F0L A;  4DU9 A;  1PH6 A;  1LTG D;  1YJW A;  3U58 A;  3D4D A;  4YCU A;  4DXF A;  4X3U A;  1WFQ A;  2AWO A;  5IP7 G;  3RN2 A;  1V1O A;  2HCC A;  4XXE A;  1TR5 A;  4C3H G;  4AQY L;  4IJH A;  1HQM C;  2FMM A;  1S5E D;  4DK3 C;  1Q86 C;  4X64 Q;  1DD2 A;  3SXH A;  4DXG A;  3H09 A;  4NXN Q;  2UU9 L;  2WP8 J;  2R7Z H;  2LKV A;  1SMY D;  1UWV A;  1T9H A;  3OPO A;  3HRZ C;  2HUG A;  4DV5 L;  2HHH L;  4KHV A;  1E2Z A;  1AFP A;  3D4R A;  1LTL A;  3J81 j;  3T1H L;  3JAM L;  1Y1W B;  4QUC A;  4UPA A;  2NVQ B;  4DV6 Q;  2EYM A;  3D0F A;  1E1T A;  3MEF A;  3R2I A;  5EJW A;  3VR5 A;  4LJZ C;  3NQI A;  5JPM C;  3CCM A;  4BY7 B;  4BBR H;  4LUZ A;  4OEM B;  1Q7Y C;  2O2L D;  1KC8 C;  1B50 A;  1XNR Q;  3V2T A;  4R4O A;  5DNF A;  1D5X C;  4NXM Q;  4KMU C;  4DV4 Q;  3NK9 A;  1FJG Q;  2JK8 A;  1GD7 A;  3K5O A;  2QGQ A;  1R4P B;  1STE A;  1HZ9 A;  4K0K L;  4J8Q A;  3HOZ B;  3OOC A;  4TQU S;  5ELD A;  2JA5 H;  4QY7 A;  4C3I B;  2K6A A;  1LT3 D;  5CR3 A;  1PMR A;  1QB5 D;  1PV4 A;  4OO1 H;  1Y1V H;  5E4W C;  2PQA A;  2KCT A;  2F3W A;  3DM3 A;  3IFD A;  2BH2 A;  1D5M C;  3KFU A;  1XPU A;  2KJX A;  2Y0S B;  3JAM i;  2I46 A;  2OQ0 A;  3QIA A;  5IGD A;  4CBV A;  1HNW Q;  4A3D H;  1STN A;  4UP8 A;  2ICI A;  5A2Q E;  3LGJ A;  2E2J B;  4OIJ A;  1VQH A;  3TQY A;  4KKU A;  4C3J B;  2A69 D;  1U4R A;  2OTL A;  1GUN A;  4XIG S;  4IQZ A;  1KD1 C;  1O7I A;  5J3B A;  4DK0 A;  1IL2 A;  3DWQ A;  3SHL A;  4OWT B;  1RTN A;  5AFW A;  1OXT A;  4J6H A;  2RCN A;  3NSW A;  4OL7 A;  3A7L A;  4DR2 L;  2RHQ B;  4LWC A;  2Z1C A;  1LM0 A;  1HTP A;  3TRE A;  2K50 A;  1TT2 A;  5EKK A;  3A54 A;  3I7F A;  5KRU A;  1NY4 A;  3ONA B;  3ZJY C;  2IX0 A;  2JP1 A;  4NXM L;  1DXM A;  2E76 C;  4ABN A;  3RZO H;  1U4P A;  3PO3 H;  2L5T A;  4IJL A;  1YHB A;  4RKL A;  5C44 B;  1FNW A;  3HOX G;  4BBR B;  4OIK A;  2IX3 A;  4IAL A;  5ELB A;  2FFK B;  3K58 A;  2KOL A;  4OGQ C;  1JMC A;  5IP9 G;  2JA8 H;  4IUP A;  2EY6 A;  4GOP A;  2KED A;  4HIM A;  4H0L C;  3TP8 A;  1AZQ A;  1QJO A;  1JB3 A;  1IHZ A;  4HCS A;  4B3T Q;  2CH4 A;  1IW7 C;  4LMQ D;  4O0A A;  3KDF B;  4B3M Q;  1E3P A;  5LMU L;  1YJN A;  5EQ0 A;  2PI2 E;  3TP5 A;  1I50 H;  3IRB A;  1GJX A;  1Y14 B;  5K36 G;  4JI4 L;  2IHF A;  3OMC A;  4A3J B;  1HFG A;  1GKH A;  4FF2 A;  4ALP A;  3PIP A;  1T5X D;  4X66 Q;  2HDM A;  1SFO B;  2BOS A;  4LFA Q;  3HOV G;  5C5L A;  3PMF A;  3CD6 A;  5KEE A;  3P1H A;  3KF8 A;  5FLM G;  1SND A;  4GNX C;  1VQB A;  4A3B G;  3BS1 A;  5IYB H;  2MNA A;  1K8M A;  3I4N B;  1IKM A;  4PZ7 A;  2WAQ G;  4OEL B;  2OTJ A;  1X55 A;  4GNX A;  3BYT B;  5AJ3 L;  2R92 H;  3K5N A;  2VUM B;  2P5Z X;  1MI2 A;  1H9J A;  1I94 L;  1F9S A;  1HNX Q;  2K01 A;  2I0Q A;  4OHJ A;  1TWF B;  3K80 C;  1XTC D;  1VQ9 A;  1JOK A;  1G6Z A;  2PZT A;  5FO9 B;  2D9U A;  1XMQ Q;  1GUO A;  1F2Y A;  5KYL A;  4PMC A;  5IP9 H;  2EJG C;  5IGE A;  2SNM A;  1SYF A;  5J39 A;  4P71 A;  3KDF A;  1EYA A;  1C7Y A;  1DJR D;  4BBS H;  1PZK D;  2N55 A;  3OW2 A;  1Q8K A;  1MHW C;  2AUJ D;  1ICF B;  4TSS A;  1E0B A;  3ZYY X;  3H3V C;  5KNC A;  3T13 A;  4DV2 L;  4B3R Q;  4BBS B;  4A3M B;  1JOO A;  3QWN A;  4YWK A;  4HIO A;  5DAU A;  1O78 A;  1I5F A;  2JEB I;  1TWG B;  3UE0 A;  1TQO A;  3G4S A;  3EQL C;  1E1O A;  2PMZ E;  4KY7 A;  3PF4 A;  3GTQ H;  4QQB X;  4LF7 L;  4GN3 B;  1VF7 A;  1YVC A;  3EJI A;  2KHJ A;  3NWS A;  3F8T A;  2BH8 A;  1U5K A;  4JYA Q;  4QMG A;  1EUJ A;  2NN6 I;  2F03 A;  5LL6 S;  3S1M B;  5C4X H;  4RG1 A;  1XJV A;  4LF5 Q;  1J6Q A;  2SEB D;  2QF7 A;  1UNS A;  3G6E A;  4DAP A;  1BCP F;  1WTQ A;  4DV1 Q;  1B70 B;  2RDG A;  5KND A;  1C48 A;  2MFI A;  1I4R A;  2GN5 A;  2UXD L;  4A3E H;  4C2M B;  3Q23 A;  5IYD G;  2EYF A;  2ATW A;  2SNS A;  1YNX A;  1VQK A;  4LF7 Q;  1PRT D;  1DYQ A;  2MGS A;  1WTR A;  2K7V A;  3LWE A;  3BU2 A;  1S72 A;  3FVQ A;  2YU9 H;  2Z6B A;  1WCM B;  1BQQ T;  1L0Y B;  1N32 Q;  5JEA H;  1CK1 A;  1IYU A;  3M4Q A;  2HCI A;  3I4M G;  1SRU A;  3K5L A;  3S15 H;  3U4V A;  3IAY A;  4NMZ A;  1YJ9 A;  5C4H A;  1E7Z A;  1WYD A;  4GKJ L;  3KJP A;  4HN7 A;  1Q8I A;  2L1B A;  3VR4 A;  3TN2 A;  1N36 L;  1NAP A;  2K5N A;  3OTO L;  1MJE A;  4ZLT F;  2L15 A;  2UU9 Q;  2Y0S G;  4PQX A;  4CHT B;  3W3A A;  1LT5 D;  3FMC A;  4A93 G;  2I5H A;  1HH2 P;  2BA1 A;  4APV A;  3F2B A;  2K05 A;  4NPS A;  1KLU D;  5A35 A;  2VQE L;  1K8G A;  2VB3 X;  1YHQ A;  4GNX B;  4ZCK A;  1NBW A;  3GTK B;  3JC6 6;  4IPG A;  1B9M A;  4LF4 L;  4POF A;  1LTT D;  5D65 A;  2K4K A;  3NE5 B;  5H1S E;  4A3K G;  4ZRZ A;  2ZJQ A;  4KY6 A;  1K8O A;  4HMJ A;  2B29 A;  2EYO A;  4PZ6 A;  2NVY B;  5C0X G;  1GHJ A;  3Q6S A;  3CRK C;  1U0L A;  1QVC A;  1EFI D;  2QCP X;  3E0J A;  1M1K C;  3G7L A;  1M4V A;  1N33 Q;  1YNJ D;  4MIU A;  5ISR A;  1CKM A;  1UEB A;  3K6O A;  3TDQ A;  2L9H A;  3H3V H;  4RGO S;  3CF5 A;  1VQF A;  2EIF A;  5L37 A;  1STB A;  4OX9 L;  1RCV D;  2HD3 A;  3GV6 A;  2QEX A;  5IWA Q;  3C46 A;  3BVG A;  1KIX A;  2EYJ A;  1L0W A;  2A69 C;  5HGQ A;  4IUT A;  2NZO A;  1BOS A;  4BY1 H;  1SNP A;  5E3F A;  1EWC A;  4YY3 L;  2K5D A;  2N78 A;  1XYI A;  2EY5 A;  4IOA A;  1PZJ D;  3VYR A;  1B3Q A;  1EFW A;  1MSH A;  1V9P A;  5IYD H;  3A8K E;  4B3M L;  2CWA A;  4ZKB B;  5I6Y A;  1W2B A;  1H9S B;  1SJE D;  1ET9 A;  4C3I H;  1L2F A;  2WKC A;  1SXT A;  5C4Z A;  4XYQ A;  1G6P A;  2Q8T A;  2WV6 D;  3W5O A;  4LUO A;  4R8N A;  2I5M X;  5F2D A;  2F0V A;  4HMI A;  1VQC A;  2XRS D;  3S24 A;  2Q8R E;  4GN5 A;  1I6H H;  4X62 L;  4JPB W;  4A3L H;  3HZX A;  2F0P A;  1CM9 A;  1I94 Q;  1UE5 A;  3FPU B;  2DN8 A;  4ZAI A;  4UAI A;  2M2L A;  3SK6 A;  3ULP A;  1EL0 A;  4EGV A;  1QVG A;  4K2K A;  4OXP A;  2H1E A;  3AQQ A;  3BDC A;  3D4W A;  1U4M A;  1X3P A;  1PA6 A;  4N9P A;  3VR3 A;  3M4O B;  2J0T D;  3GTM B;  2A6H C;  1SDF A;  1L1O C;  5C4X G;  3IL8 A;  1FGB D;  4BXX H;  5J1Z A;  3VA5 A;  1QOH A;  2F3V A;  4MNO A;  2RHS B;  1A2T A;  3T4A C;  2XWJ B;  1K9M C;  4IFD H;  2YU9 B;  4GLV B;  2ENB A;  1C9O A;  3E3X A;  4IFD I;  2MJ8 A;  1I6H B;  1TII D;  4NDX A;  1FGU A;  1LTA D;  1ML0 D;  3LNN A;  3IFT A;  3RD4 A;  4K14 A;  3GTL B;  2ZTE A;  1LTB D;  1SNQ A;  2F3I A;  5CBE E;  1GXD C;  1I3Q H;  2F0M A;  1BVS A;  2RDH A;  4OWX B;  1XNR L;  2XIW A;  1LUZ A;  3KF6 B;  4DPG A;  4DV6 L;  2UUC Q;  2B2W C;  2JA7 G;  1Z7T A;  1IBM L;  4PMW A;  4X62 Q;  4BY1 B;  1A15 A;  3I91 A;  1LT4 D;  3RUZ A;  3CU7 A;  2AWN A;  1S4Z A;  1EY5 A;  4DR1 Q;  4B3S Q;  1EQR A;  5C3E G;  3HKZ B;  5M5X B;  3R2T A;  4LAA A;  1B1Z A;  1WI5 A;  5M5Y H;  3A5Z B;  1FJG L;  5JJK A;  1OTC A;  3NPP A;  4JI6 L;  4NXN L;  1D7Q A;  1K0R A;  2D0O A;  2LFN A;  3NBI A;  2E2I H;  2F0I A;  1H9M A;  3TSS A;  1MBY A;  2QEJ C;  5IOC A;  2KVM A;  2IWH A;  2B2U A;  1GUT A;  1VDZ A;  1H95 A;  1ONL A;  1CSP A;  1BR9 A;  3ND8 A;  1TY2 A;  1XMO Q;  2EPB A;  3PV0 A;  3GV3 A;  1PH3 A;  1TWA B;  3AMU A;  1Q90 A;  1KQS A;  3TS2 A;  3A74 A;  3RLO A;  1A8V A;  1WTO A;  2WAQ B;  1JC7 A;  5T1G A;  1GUG A;  2EXZ A;  5M3M H;  5M3M G;  4DV0 Q;  3DWP A;  4AYB B;  2VUM G;  3D8G A;  3PF5 A;  1SYB A;  4FP5 D;  1TWF H;  1BNZ A;  4JV5 L;  4PZ8 A;  3S2D H;  2B2Y A;  1Y1V G;  5JEA G;  4AQY Q;  4GKK Q;  4LF9 Q;  4LF4 Q;  1IBK Q;  5I6W A;  2HT1 A;  1OXU A;  1OXV A;  4FF4 A;  1TWC H;  3I4M B;  3MEH A;  3KOJ A;  1DOM A;  1X9N A;  1VQD A;  1AH9 A;  4HJ7 A;  1EEF D;  1H9R A;  1WCM H;  4QIW B;  3T53 B;  1ENA A;  1SAP A;  4G7Z C;  3HOY H;  4ZUI A;  4A4I A;  1HFN A;  1UAP A;  1LTI D;  4XT1 B;  4FXG C;  1PRT F;  1RTO A;  2R93 H;  4KK7 A;  3W1G A;  2X6G A;  3M4Y A;  4JOI A;  4DV3 L;  1BCP C;  3BVM A;  1TS3 A;  2ZM6 L;  2E74 C;  2F0K A;  5FJ8 G;  2N3S A;  4DR5 L;  3HOY B;  1PLF A;  4GKK L;  3I4O A;  2A6H D;  2UXC L;  4GOP B;  2EJF C;  1X3Q A;  4EQN A;  4DUY L;  4H44 C;  5C3E H;  2EYL A;  5EKL A;  3A8J E;  2EJM A;  4A3I H;  2A19 A;  4DNT B;  2NVT B;  1E22 A;  4A3D G;  2F4I A;  2HIX A;  4IPD A;  3PO2 H;  4A3K B;  1QNK A;  2OCE A;  2VY3 A;  3S1Q H;  4A3B B;  1CUK A;  2JA5 G;  2WB1 B;  3BVZ A;  3S1N B;  2PNR C;  2OEO A;  3AEV A;  1PRT B;  1HHV A;  4LFC L;  4B08 A;  4NP5 A;  4OO1 G;  4IUQ A;  2FJ2 A;  4X66 L;  2LSS A;  4UHV A;  3C3L A;  3PO3 B;  1N9W A;  3PSI A;  4O2D A;  2MQH A;  4CDC C;  4KHP Q;  4JI6 Q;  1Y8N B;  5FOB B;  3S17 B;  1YNN C;  4A3M H;  3L9A X;  1RL2 A;  3K59 A;  5EPJ A;  1EU3 A;  2KQ3 A;  2F0D A;  4YCW A;  5E1F A;  2NZH A;  4FO2 A;  3G71 A;  3X3N A;  4RA8 A;  2RSN A;  4DNI A;  4C1N I;  3KBG A;  3TRZ A;  4DAY B;  1DOL A;  2EYH A;  5NUC A;  1YI2 A;  2YV5 A;  4KLK A;  1EOT A;  5G3L F;  4LFB L;  3E9H A;  4DKA C;  1EEI D;  4JI7 L;  4WJ3 M;  1T5E A;  1G91 A;  1B3A A;  4LNQ A;  2YTY A;  1OXX K;  3W1B A;  3UI2 A;  5IT9 E;  4LF6 Q;  3HEJ A;  1NJI C;  3MFY A;  3KUP A;  4J15 A;  3DLL A;  1YIJ A;  2A74 C;  2Z9H A;  3EVQ A;  4IPH A;  3JAM c;  1KXL A;  1HZC A;  4ULL A;  3HOY G;  4G57 A;  1VCI A;  2FMC A;  4FXD A;  1B4O A;  2ZTC A;  3MA2 B;  3T1Y L;  3H3V I;  1NMF A;  1ENC A;  3A8I E;  2XRQ D;  4QUF A;  1B53 A;  5FLX c;  4C1N K;  4KHZ A;  4JV5 Q;  1DZ1 A;  2VB2 X;  1IBM Q;  2JA5 B;  4U67 3;  1ASZ A;  4IO9 A;  1SFO H;  3OWE B;  3V05 A;  3HOZ H;  1X65 A;  4JYA L;  1HA5 A;  1TWH H;  3KBX A;  4RWS C;  3MAQ A;  3KJO A;  1TY0 A;  3R3O A;  3KYH C;  3ER0 A;  4B3T L;  1X54 A;  1Z6H A;  2H5X A;  4C3J G;  4ZKC B;  4L5Q A;  3J7A V;  1A3V A;  5C5M A;  4RGN A;  4J1M A;  3P20 A;  1ILP A;  2N49 A;  4JI3 Q;  3V96 A;  4RAU C;  4X3K A;  2IL8 A;  1XPO A;  1GOZ A;  4X3S A;  1KDA A;  3DXJ C;  2NYZ D;  3S16 H;  5KNB A;  1BUV T;  1PH5 A;  4A3C H;  1HR0 Q;  1FL0 A;  3NHH A;  2RF4 A;  3H0G G;  5C4J B;  1PH2 A;  2O4X A;  3OHX C;  4K5V A;  1XWE A;  2D0P A;  1X3E A;  5CMD A;  1VQ7 A;  2E5L Q;  2JSO A;  2EOT A;  3M3Y B;  4BY1 G;  4HSP A;  4F88 A;  1Q81 C;  3RN5 A;  1EIF A;  2A6E C;  3CCJ A;  4JI2 L;  2PZW A;  1EZ6 A;  2NZ1 D;  1CZW A;  2KEN A;  1PH1 A;  2XWB B;  5CV8 A;  3K0X A;  3RZD B;  3PIP 3;  1GO3 E;  1LT6 D;  1TWA H;  1RF2 D;  4FF3 A;  2R3Z A;  2A68 C;  4DR4 L;  2ZJP A;  2K5Q A;  3J81 E;  5I2Y A;  3AYH B;  1F9R A;  2RQX A;  4RH6 A;  3NBH B;  5JPN C;  3NWT A;  4DR7 L;  3H91 A;  2K33 A;  4Q0F A;  3J7Z C;  4JVZ A;  4KN7 C;  1D6E C;  1S5D D;  3F2U A;  1CKN A;  1KL9 A;  3TZD A;  5FLX E;  1I4Q A;  1L1O B;  3EBE A;  1KRT A;  3H15 A;  4A93 B;  5CV5 A;  1HNZ Q;  3KLS X;  1BO0 A;  2KHS A;  3KLW A;  4F87 A;  2Q2T A;  1WOC A;  5ELF A;  1I4P A;  1SMX A;  1EY8 A;  3PUV A;  2B63 G;  2AQ2 B;  4IUV A;  2NTS A;  3K5M A;  5K36 H;  4ODG A;  3NEL A;  1PFS A;  1SEB D;  2EDG A;  4N9T A;  1N8R C;  1EWI A;  3URY A;  1JCK B;  1EWH A;  2SDF A;  5ELE A;  1U9R A;  1HR0 W;  2AQ3 B;  3OIP A;  5LMU Q;  4HR7 B;  3GTG H;  4OWW B;  5BR8 Q;  1OXS C;  2Z6K C;  1S5B D;  2DNC A;  2RA4 A;  1LYL A;  1VQA A;  4XTC S;  1HUM A;  1XNQ L;  1JIC A;  2D2C C;  2ZXP A;  3UDX A;  1JB7 A;  3RNU A;  3GTL H;  3J81 L;  2RKS A;  3K7A H;  2CW0 C;  1P16 A;  1TKW B;  1BBX C;  4IPC A;  1IYV A;  4X3T A;  2F0W A;  1PFN A;  3MTS A;  4PG3 A;  2JA7 B;  1TVX A;  4JCV E;  3KK7 A;  1FYC A;  3VYU A;  1IKL A;  2GA4 B;  1KTK A;  3STB D;  1UE7 A;  4K0K Q;  1EY4 A;  3HFZ B;  4QJF A;  1KAW A;  1VQG A;  4GLX A;  4LFC Q;  3HOV B;  4DGZ A;  3GTP H;  3D3R A;  2L12 A;  3M4O H;  3GO5 A;  5C3W A;  4RGT A;  1JQY D;  1JWM D;  1L1O A;  5BN5 A;  1HZA A;  4L5T A;  4A3F H;  1J8I A;  1Y1W H;  3QB3 A;  2IW3 A;  2MPM A;  1SE8 A;  1BBU A;  1BF4 A;  3S15 B;  4KD4 A;  1SNO A;  3OTO Q;  1YEZ A;  2FXQ A;  3N6R A;  1UE6 A;  2H4O A;  2EVB A;  2B3G A;  3PIO 3;  3H94 A;  2G5D A;  2IT1 A;  4QCL A;  4LF6 L;  2EYP A;  2JN4 A;  4PV1 C;  3I4L A;  1VMC A;  2B63 B;  3D6C A;  2PO4 A;  1FR3 A;  4A3E B;  4DR3 Q;  1SE4 A;  3AFQ A;  1PYB A;  3QOL A;  3GTJ H;  4N8X 1;  4NW2 A;  4AH6 A;  1F2M A;  1NMG A;  4X65 L;  1HNW L;  3CQZ H;  1FD7 D;  4A75 A;  5M3F H;  3SE0 A;  2UXD Q;  5GAH C;  1E2V A;  1SYD A;  3HG9 A;  4KHP L;  5C4X B;  1IXR A;  3K57 A;  5GRO A;  4JW0 A;  1NTG A;  5D3D A;  3U9O A;  1STY A;  1F9Q A;  2O5I C;  3BDL A;  1ZEQ X;  3S14 H;  4A3L G;  2VS1 A;  1QUQ A;  4LK1 C;  2NWG A;  5C0X H;  3M7N A;  2B8G A;  2JA6 G;  2OXP A;  5FLM H;  4DK1 A;  4XQJ A;  4RCO A;  3D6W A;  2CWP A;  1JJG A;  5KIX A;  4KJN A;  5EAY A;  3CPF A;  2K5W A;  3TS0 A;  1C8C A;  1WCM G;  3HP3 A;  2VQF Q;  1L0X B;  2NUC A;  1B7Y B;  4KN4 C;  5CGK A;  3D31 A;  2QDB A;  1XTD A;  1HNX L;  1RD9 D;  3DMU A;  1Y8P B;  1GM5 A;  1R9T B;  4QB4 A;  2WII B;  4A3C G;  2V4D A;  3J7A 5;  1LLR D;  5I9O A;  1X3G A;  4Q5V A;  1EZ8 A;  1EU4 A;  2KUM A;  1DOK A;  1VQ4 A;  2F4V Q;  1Q1E A;  2K1B A;  4KJO A;  4DV3 Q;  3S1R H;  1K73 C;  4YIJ A;  2WB1 E;  4BA2 I;  1AEX A;  3MFG A;  2KEE A;  1KNE A;  2CHB D;  2CQO A;  5ELN A;  4XQQ A;  3EA6 A;  5JVH 3;  1LTR D;  4DV1 L;  1K3R A;  1JE5 A;  4TKO B;  1SRO A;  1HTL D;  1V1P B;  3S14 B;  2BA0 A;  3RLN A;  2F0H A;  2VUM H;  3NTI A;  2R92 B;  3PUX A;  2UUA L;  2EQS A;  3VR2 A;  2MO0 A;  2HQL A;  1WTP A;  4ZUJ A;  4CJ0 B;  3I55 A;  3U50 C;  2OQK A;  5M3F B;  1S3O A;  1CQV A;  3AB9 A;  3MXU A;  3GP7 A;  1G2T A;  1PH4 A;  1PTO B;  4JI3 L;  1LV9 A;  5GQO A;  4OON A;  3M85 A;  5HY6 A;  3HOX B;  1II3 A;  2K5V A;  3BG3 A;  3H0G B;  5A2Q L;  3QJY A;  1MSG A;  1JOQ A;  1TS2 A;  3SK8 A;  2R93 B;  1HRJ A;  2HQE A;  5EBC A;  4A3J H;  4CKB A;  3MWY W;  2DJF C;  3EN2 A;  5C3X A;  1JR0 D;  3EFX D;  2D5D A;  2EY2 A;  3MXP A;  3J80 L;  2GVA A;  2ZTD A;  2A68 D;  4HIK A;  5DM6 3;  1UE1 A;  1B8A A;  1TWC B;  3NP8 A;  3I4M H;  4HJA A;  5C0X I;  3S1M H;  3ERS X;  3HOW G;  1WTX A;  3VA7 A;  3J80 E;  3T56 B;  2JA6 H;  4ID6 A;  4PMB A;  3CME A;  1VQN A;  4HAE A;  2N88 A;  2JEA I;  3VYT A;  1DON A;  1BKB A;  4DR1 L;  4BBS G;  2PQE A;  3GTQ B;  4HTH A;  4JI0 L;  5C44 H;  4DR7 Q;  1F2L A;  2KCN A;  4EQO A;  2WB1 G;  4YHH L;  2JA7 H;  3RZO B;  1TWG H;  2CCZ A;  1EY9 A;  3K7A B;  5BN3 A;  1XPR A;  5C6A A;  1SLJ A;  5AJ3 Q;  4V0B A;  4LFB Q;  4A3G G;  1R9T H;  2MHV A;  1WD1 A;  2JA8 G;  1D5Z C;  4A3F G;  2AHO B;  1STH A;  4K5W A;  1MJC A;  3OIQ A;  1YIT A;  4JI8 L;  1QCB D;  2E2I B;  1MGS A;  5M3F G;  3NUC A;  3CCE A;  1PXU A;  2B39 A;  3MC0 B;  2K5H A;  3CKI B;  1YNN D;  1Q12 A;  2CFM A;  5IE8 A;  4DR2 Q;  4R4C A;  1E24 A;  1QZH A;  1ILQ A;  5IWA L;  4CGY B;  4QL5 A;  2DUD A;  2YYZ A;  5JAV A;  3HOZ G;  4DK6 C;  1CFM A;  4RHR A;  5IT9 L;  1PFM A;  1FVI A;  5IGC A;  4ZYS A;  1N36 Q;  1IW7 D;  3UDI A;  4DV7 L;  2KA7 A;  2NN6 H;  1NE3 A;  3PIO A;  1JJC B;  4LUV A;  3GTJ B;  2V1C C;  2E8G A;  4IFD G;  2Z4H A;  3RZD H;  3HKZ E;  1GVP A;  2B2V C;  1Z9F A;  3CP0 A;  2F0Q A;  3C1E A;  3QOJ A;  4L6T B;  4POG A;  2ZM6 Q;  2F0S A;  3OSO A;  2VQE Q;  2QKI C;  3FHW A;  3I90 A;  1SE2 A;  5FK9 C;  3E6Z X;  1S40 A;  1I50 B;  5FLX L;  4DF7 A;  3M3Y H;  3CRL C;  3NQT A;  4YWL A;  1V8Q A;  5C4J H;  2VQF L;  5IOD A;  2R7F A;  1E2W A;  3L2P A;  3VDY A;  1RIP A;  2NVQ H;  4IUR A;  1IL8 A;  4A3F B;  1AE3 A;  3PO3 G;  2JA8 B;  4GKJ Q;  2C9O A;  4LF5 L;  4IN3 A;  2F1M A;  3BYY B;  5D3I B;  5M5W B;  1G29 1;  3GTP B;  2PYK A;  4GS3 A;  4BXX G;  4JI7 Q;  4UP7 A;  1KRS A;  4RKB A;  2XN9 C;  2WAQ E;  3ITP A;  2R7Z B;  2F52 A;  2JXM B;  1CT1 D;  2BCO A;  2F0E A;  2YTV A;  1U4L A;  2LXJ A;  1QG7 A;  3O13 A;  3DUZ A;  1IBL L;  3A55 A;  1FNU A;  2BE5 D;  4GN4 B;  2OF1 A;  1MIU A;  1AW7 A;  4FVM A;  3EIV A;  4WOR A;  5TSS A;  2PI2 A;  1BXT A;  2PCF B;  2EE1 A;  3FP9 A;  2UUB L;  3GTG B;  2IJ0 A;  4CDD C;  2RCF A;  3QO2 A;  5CV7 A;  1NNX A;  2N8N A;  4Y52 H;  1PZI D;  2F0U A;  3K7U C;  2B2U C;  3ICE A;  2R61 A;  1HXY D;  4XDX A;  4JBJ A;  4L5S A;  4JI5 Q;  4C3J H;  3CMA A;  3SK4 A;  1QE6 A;  4DV4 L;  2DJG C;  1RKN A;  1C4Q A;  1J5E Q;  2K28 A;  4A3D B;  4A93 H;  5IYC H;  1M90 C;  1LTS D;  3E9I A;  1HZB A;  1WD0 A;  1PH8 A;  2KCM A;  1QNU A;  3FKI H;  4G4K A;  4JOI C;  1EQV A;  1KAA A;  4L5R C;  1ICW A;  4YCV A;  3ND9 A;  4DV5 Q;  2HHH Q;  2UUC L;  2Q2I A;  4M8A A;  2L4N A;  2CQA A;  1PH9 A;  2WIN B;  5EKI A;  1J5E L;  2NTT A;  1K83 B;  1Q1B A;  2TSS A;  2XGT A;  3I70 A;  4KKS A;  1KDC A;  4P72 A;  5JVG 3;  3K0Y A;  5GAE C;  4JI5 L;  2LXK A;  1YBY A;  4F8M A;  1H9K A;  2G9D A;  2K14 A;  1PVO A;  3VYS A;  2CKZ B;  2OT2 A;  4BY7 H;  3K8A A;  3F1Z A;  5FO8 B;  3A56 A;  4DV2 Q;  3X3M A;  2KEC A;  2QIL A;  1EY0 A;  3T16 A;  2LMC B;  4C3H H;  5IGB A;  4CDF C;  2XNA C;  4A3K H;  5I9P A;  2PQA B;  2JA6 B;  3RR5 A;  2O5J C;  3I8Z A;  3Q22 A;  4B9X A;  2Z8L A;  3ULL A; 
#chains in the Genus database with same CATH homology
 1BCP B;  5C3E B;  2J4X A;  3TP7 A;  2L0C A;  2BDO A;  4KI0 A;  2B2W A;  2HDL A;  4C3I G;  3RMH A;  4K8I A;  2J7Z A;  5KYI A;  4G7H C;  5FO7 B;  1TWH B;  3N52 A;  2CW0 D;  1JWU D;  1KNA A;  1TS4 A;  2ICE C;  2PW5 A;  2C5C A;  3JAM E;  3PUZ A;  1CZG A;  5E4X A;  2FIN B;  1JOR A;  3R93 A;  2CVR A;  1RHP A;  4EQP A;  1OO9 B;  1JE4 A;  1SYG A;  3FPP A;  1ESF A;  3S2H B;  1NR4 A;  1GHK A;  4CKC A;  3MXN A;  1X32 A;  2AUK A;  3WOE A;  3BZD B;  2NB0 A;  1WTW A;  2E2H B;  4K8J A;  1HQR D;  2Z4I A;  3GTO B;  4HED A;  3GQB A;  4R9W A;  1CTM A;  5JJZ A;  3S1R B;  3OMG A;  4C56 C;  1D1I A;  5CV6 A;  1STA A;  3PUW A;  1F77 A;  5I2X A;  1Y8O B;  5CBA E;  5IGF A;  1HCZ A;  1EY7 A;  1SNC A;  1I4H A;  1PTO C;  1M8A A;  4XQN A;  2FHT A;  3IKJ A;  1NR2 A;  1O7Y A;  2K04 A;  1I4G A;  1F9P A;  3SR1 A;  3SDZ A;  3NXW A;  5IIF A;  1VMP A;  2L55 A;  2I07 B;  4ILW A;  1NCV A;  5JOB A;  1CI3 M;  3WDN A;  2F0T A;  1CA5 A;  3S1Q B;  1H9S A;  3PO2 B;  2M00 A;  4RFB A;  2B2V A;  2D62 A;  4KV6 A;  2E2D C;  1PTO F;  1MD2 D;  2NBF A;  2X6L A;  2RDF A;  1BCP D;  3P7J A;  1ZKO A;  3KLS A;  2B8F A;  3CQZ B;  4K6L A;  1W6J A;  2SOB A;  2K03 A;  1GUS A;  4XT3 B;  2G9H D;  4O42 A;  1ESR A;  1GUW A;  1Z47 A;  4FF1 A;  5EGT A;  4CKE A;  1R4Q B;  2A6E D;  2F0F A;  4ME5 A;  3LX0 A;  4DAV A;  4R8I A;  4Z9C B;  3WOF A;  4TRD A;  1RDP D;  4K6D A;  2RSO A;  4P2C B;  3OW7 A;  3L7Z C;  5COR A;  5EPK A;  3DWA A;  1VF5 C;  5LL6 X;  1PDQ A;  4GZY C;  5KGU A;  2Q8I B;  1SYC A;  5FKA C;  2DY7 A;  2X69 A;  2F0J A;  4I7Z C;  3LWU A;  2F0O A;  1SMY C;  3SEB A;  3U9S A;  3HOW B;  4PNY A;  1CQF A;  3S9W A;  3NTK A;  5C0X J;  1XX8 A;  2DNE A;  5CV4 A;  5M9O A;  4DAY A;  1CA6 A;  3SK5 A;  2EY1 A;  2BDN A;  3E5S A;  2M9V A;  3GD7 A;  1AP0 A;  2AQ1 B;  1QIL A;  4RCN A;  4G7O C;  1EYC A;  4H13 C;  3I73 A;  1DCZ A;  5CV9 A;  4V19 0;  4A3G B;  4MN3 A;  2EZV A;  5T1I A;  3FKI B;  5CYU A;  1A2U A;  4KKT A;  5G3L D;  2IPK D;  2BE5 C;  1LO5 D;  1ZYR C;  1KDB A;  4KY5 A;  2B2T C;  4MHE A;  1AN8 A;  1SBB B;  4DNR B;  1LAC A;  1DM0 B;  3FEW X;  3DHQ A;  3G6J B;  3ERO A;  4E6I A;  3QG1 A;  1Y1V B;  1YNJ C;  3HS0 C;  5COY A;  4U68 A;  5BN4 A;  1I3Q B;  2KCC A;  4XYO A;  5EBD A;  3RLF A;  1BDO A;  1UUP A;  2F0N A;  1CHQ D;  3I72 A;  4BWG B;  4RHS A;  1RJT A;  3FDT A;  4BA1 I;  3HOU B;  1SYE A;  3DEP A;  1F2Z A;  5I4D A;  5CC4 A;  1TS5 A;  2WKD A;  3S16 B;  3T51 B;  4EVO A;  1LAB A;  3NBH A;  4CJ2 C;  2B2Y C;  5ELC A;  3SVM A;  1D1K A;  2ZXO A;  1A3T A;  4DN4 M;  2VNU D;  4L8J A;  4OO1 I;  1B44 D;  1EY6 A;  5J22 A;  3J7A F;  2F0G A;  1PRT C;  4FNF A;  4F7X A;  2ZXR A;  3Q24 A;  2PW7 A;  3L3O C;  2DY8 A;  1I4X A;  5JEA J;  1SE3 A;  1SNM A;  2RVL A;  4S3S A;  3P75 A;  3C2P A;  2XSC A;  1V1P A;  4JBW A;  1B9N A;  1O80 A;  1XXG A;  4K5X A;  1EIG A;  5LHY 1;  1ENF A;  4WRD A;  1Y69 U;  3TBI B;  1SJH D;  3H6M A;  5EPL A;  2ZT9 C;  1FNV A;  2NVX B;  3M7G A;  1HPC A;  2ID0 A;  2NN6 G;  3CHB D;  4CJ1 B;  3TME A;  1QWY A;  2JYO A;  4O1N A;  4IZ8 A;  2MP1 A;  3C1F A;  1V43 A;  4WJW A;  5HUR A;  4H7B A;  1PYW D;  3NTH A;  3OWF A;  2B2T A;  2JE6 I;  4DFA A;  3A7A B;  4Y7N B;  3MVV A;  4HCE A;  5HGT A;  2VXW A;  1NSN S;  3TZU A;  1EYD A;  3FRP B;  4DA2 A;  1WVL A;  2RBM A;  4B9W A;  1PTO D;  3MZ5 A;  2XVS A;  1S5F D;  4A3I B;  3TP6 A;  1S5C D;  1SSO A;  1AZP A;  4K2L A;  1PFB A;  1HUN A;  3AU7 A;  1W6K A;  3HGB A;  1D2B A;  1ROD A;  2R6G A;  5DEH A;  3I3C A;  2WAC A;  3ERQ A;  5D14 A;  2IX1 A;  3MXG A;  3Q0A A;  1PTO H;  4KTA A;  4NKL A;  1ZYR D;  1B2T A;  2A5H A;  4UDU C;  1TU2 B;  4I65 A;  4FXK C;  3DM1 A;  1UEA B;  1JWS D;  1O7L A;  4C3H B;  1NUC A;  3VR6 A;  2TMP A;  3S2D B;  1EIH A;  1I6V C;  4QF4 A;  2LS0 1;  2PZU A;  2PMZ B;  4IFD J;  4KD3 A;  3W2D A;  4IUU A;  5M3M B;  1WTV A;  1J9O A;  4L63 B;  1Q3L A;  4HSV A;  1KLG D;  3BDO A;  1G2S A;  1HA6 A;  3PUY A;  2A73 B;  4ZK9 B;  2L11 A;  1G8Z D;  1CHP D;  3MHB A;  4RGM A;  4FYD A;  5IGG A;  1STG A;  3R8B A;  1ZXT A;  3KLR A;  4BS9 A;  1O7Z A;  4IUN A;  1EQT A;  2LY7 A;  5M5Y B;  5DM7 3;  1A6X A;  2MUY A;  4M1U B;  5K5P A;  1ET6 A;  1KAB A;  4JK1 C;  3DEO A;  2E75 C;  2PPB C;  4WFN 3;  4ZQ3 A;  1A3U A;  2K32 A;  3J7Y W;  2F0L A;  4DU9 A;  1LTG D;  3D4D A;  4DXF A;  4X3U A;  2AWO A;  1V1O A;  2HCC A;  4XXE A;  1TR5 A;  4C3H G;  1HQM C;  2FMM A;  1S5E D;  1DD2 A;  3SXH A;  4DXG A;  3H09 A;  2WP8 J;  2LKV A;  1SMY D;  3OPO A;  3HRZ C;  2HUG A;  4KHV A;  1E2Z A;  1AFP A;  3D4R A;  3JAM L;  1Y1W B;  4QUC A;  2NVQ B;  2EYM A;  3R2I A;  5EJW A;  3VR5 A;  4LJZ C;  3NQI A;  5JPM C;  4BY7 B;  2O2L D;  1B50 A;  3V2T A;  5DNF A;  1D5X C;  4KMU C;  3NK9 A;  3K5O A;  1R4P B;  1STE A;  4J8Q A;  3HOZ B;  3OOC A;  4TQU S;  5ELD A;  4C3I B;  2K6A A;  1LT3 D;  5CR3 A;  1PMR A;  1QB5 D;  4OO1 H;  5E4W C;  2F3W A;  3IFD A;  1D5M C;  2KJX A;  2Y0S B;  2I46 A;  3QIA A;  5IGD A;  4CBV A;  1STN A;  2ICI A;  5A2Q E;  2E2J B;  4OIJ A;  4KKU A;  4C3J B;  2A69 D;  1U4R A;  1GUN A;  4XIG S;  4IQZ A;  4DK0 A;  3DWQ A;  3SHL A;  1RTN A;  5AFW A;  1OXT A;  4J6H A;  3NSW A;  4OL7 A;  3A7L A;  2Z1C A;  1HTP A;  1TT2 A;  5EKK A;  3A54 A;  5KRU A;  3ONA B;  2IX0 A;  2JP1 A;  1DXM A;  2E76 C;  4ABN A;  1U4P A;  2L5T A;  4RKL A;  5C44 B;  1FNW A;  4BBR B;  4OIK A;  2IX3 A;  4IAL A;  5ELB A;  2FFK B;  3K58 A;  2KOL A;  4OGQ C;  4IUP A;  2EY6 A;  2KED A;  4H0L C;  3TP8 A;  1AZQ A;  1QJO A;  1JB3 A;  1IHZ A;  4HCS A;  1IW7 C;  4LMQ D;  5EQ0 A;  3TP5 A;  1GJX A;  5K36 G;  3OMC A;  4A3J B;  1HFG A;  4FF2 A;  1T5X D;  2HDM A;  1SFO B;  2BOS A;  5C5L A;  3PMF A;  3P1H A;  3KF8 A;  1SND A;  3BS1 A;  3I4N B;  1K8M A;  1IKM A;  3BYT B;  3K5N A;  2VUM B;  1MI2 A;  1H9J A;  1F9S A;  2K01 A;  4OHJ A;  1TWF B;  1XTC D;  1JOK A;  1G6Z A;  2PZT A;  5FO9 B;  2D9U A;  1GUO A;  1F2Y A;  5KYL A;  4PMC A;  2EJG C;  5IGE A;  2SNM A;  1SYF A;  5J39 A;  1EYA A;  1DJR D;  1PZK D;  2N55 A;  2AUJ D;  4TSS A;  1E0B A;  3ZYY X;  3H3V C;  5KNC A;  3T13 A;  4BBS B;  4A3M B;  1JOO A;  3QWN A;  5DAU A;  1O78 A;  2JEB I;  1TWG B;  1TQO A;  3EQL C;  4KY7 A;  1VF7 A;  3EJI A;  3NWS A;  4QMG A;  2NN6 I;  2F03 A;  5LL6 S;  3S1M B;  2SEB D;  2QF7 A;  1UNS A;  4DAP A;  1BCP F;  1WTQ A;  2RDG A;  5KND A;  1C48 A;  1I4R A;  4C2M B;  3Q23 A;  2EYF A;  2SNS A;  1PRT D;  1DYQ A;  2MGS A;  1WTR A;  2K7V A;  3LWE A;  3FVQ A;  1WCM B;  1BQQ T;  1L0Y B;  5JEA H;  1CK1 A;  1IYU A;  2HCI A;  3K5L A;  3IAY A;  4NMZ A;  5C4H A;  4HN7 A;  1Q8I A;  2L1B A;  3VR4 A;  3TN2 A;  1NAP A;  4ZLT F;  4PQX A;  4CHT B;  3W3A A;  1LT5 D;  3FMC A;  2BA1 A;  2K05 A;  1KLU D;  5A35 A;  2VB3 X;  3GTK B;  1B9M A;  1LTT D;  5D65 A;  3NE5 B;  4ZRZ A;  4KY6 A;  1K8O A;  4HMJ A;  2EYO A;  2NVY B;  5C0X G;  1GHJ A;  3Q6S A;  3CRK C;  1EFI D;  2QCP X;  3E0J A;  3G7L A;  1M4V A;  1YNJ D;  4MIU A;  5ISR A;  3K6O A;  3TDQ A;  2L9H A;  4RGO S;  1STB A;  1RCV D;  3GV6 A;  3C46 A;  3BVG A;  2EYJ A;  2A69 C;  4IUT A;  1BOS A;  1SNP A;  5E3F A;  1EWC A;  2K5D A;  1XYI A;  2EY5 A;  1PZJ D;  3VYR A;  1MSH A;  3A8K E;  4ZKB B;  5I6Y A;  1H9S B;  1SJE D;  1ET9 A;  2WKC A;  1SXT A;  5C4Z A;  4XYQ A;  2Q8T A;  2WV6 D;  4R8N A;  5F2D A;  2F0V A;  4HMI A;  2XRS D;  2Q8R E;  3HZX A;  2F0P A;  1CM9 A;  3FPU B;  2DN8 A;  4ZAI A;  4UAI A;  2M2L A;  3SK6 A;  1EL0 A;  4EGV A;  4K2K A;  2H1E A;  3BDC A;  3D4W A;  1U4M A;  1X3P A;  4N9P A;  3VR3 A;  3M4O B;  2J0T D;  3GTM B;  2A6H C;  1SDF A;  3IL8 A;  1FGB D;  5J1Z A;  3VA5 A;  1QOH A;  2F3V A;  1A2T A;  3T4A C;  2XWJ B;  4IFD H;  2YU9 B;  2ENB A;  4IFD I;  2MJ8 A;  1I6H B;  1TII D;  4NDX A;  1LTA D;  1ML0 D;  3LNN A;  3IFT A;  3RD4 A;  4K14 A;  3GTL B;  1LTB D;  1SNQ A;  5CBE E;  1GXD C;  2F0M A;  2RDH A;  2XIW A;  2B2W C;  1Z7T A;  4PMW A;  4BY1 B;  1A15 A;  3I91 A;  1LT4 D;  3RUZ A;  3CU7 A;  2AWN A;  1S4Z A;  1EY5 A;  3HKZ B;  5M5X B;  3R2T A;  4LAA A;  1B1Z A;  3NPP A;  2LFN A;  3NBI A;  2F0I A;  1H9M A;  3TSS A;  1MBY A;  2QEJ C;  5IOC A;  2KVM A;  2IWH A;  2B2U A;  1GUT A;  1VDZ A;  1ONL A;  1BR9 A;  3ND8 A;  1TY2 A;  2EPB A;  3PV0 A;  3GV3 A;  1TWA B;  3AMU A;  1Q90 A;  1WTO A;  2WAQ B;  1JC7 A;  5T1G A;  1GUG A;  2EXZ A;  3DWP A;  4AYB B;  3D8G A;  1SYB A;  4FP5 D;  1BNZ A;  2B2Y A;  5JEA G;  5I6W A;  1OXU A;  1OXV A;  4FF4 A;  3I4M B;  3MEH A;  1DOM A;  1EEF D;  1H9R A;  4QIW B;  3T53 B;  1ENA A;  1SAP A;  4G7Z C;  4ZUI A;  1HFN A;  1UAP A;  1LTI D;  4XT1 B;  4FXG C;  1PRT F;  1RTO A;  4KK7 A;  2X6G A;  3M4Y A;  1BCP C;  3BVM A;  1TS3 A;  2E74 C;  2F0K A;  3HOY B;  1PLF A;  2A6H D;  2EJF C;  1X3Q A;  4EQN A;  4H44 C;  2EYL A;  5EKL A;  3A8J E;  2EJM A;  4DNT B;  2NVT B;  2F4I A;  4A3K B;  1QNK A;  4A3B B;  2WB1 B;  3BVZ A;  3S1N B;  2PNR C;  2OEO A;  1PRT B;  1HHV A;  4B08 A;  4NP5 A;  4OO1 G;  4IUQ A;  2FJ2 A;  3C3L A;  3PO3 B;  1Y8N B;  5FOB B;  3S17 B;  1YNN C;  3L9A X;  3K59 A;  5EPJ A;  1EU3 A;  2KQ3 A;  2F0D A;  5E1F A;  4FO2 A;  3X3N A;  4RA8 A;  2RSN A;  4C1N I;  3KBG A;  1DOL A;  2EYH A;  5NUC A;  1EOT A;  5G3L F;  1EEI D;  1T5E A;  1G91 A;  1B3A A;  1OXX K;  5IT9 E;  3UI2 A;  3HEJ A;  3MFY A;  3KUP A;  2A74 C;  3EVQ A;  4ULL A;  4G57 A;  1VCI A;  2FMC A;  4FXD A;  1B4O A;  3MA2 B;  1ENC A;  3A8I E;  2XRQ D;  4QUF A;  1B53 A;  4C1N K;  4KHZ A;  1DZ1 A;  2VB2 X;  2JA5 B;  4U67 3;  3OWE B;  3V05 A;  1HA5 A;  3KBX A;  4RWS C;  3MAQ A;  1TY0 A;  3R3O A;  1Z6H A;  4C3J G;  4ZKC B;  3J7A V;  1A3V A;  5C5M A;  4RGN A;  4J1M A;  3P20 A;  1ILP A;  3V96 A;  4RAU C;  4X3K A;  2IL8 A;  1GOZ A;  4X3S A;  1KDA A;  3DXJ C;  2NYZ D;  5KNB A;  1BUV T;  3NHH A;  5C4J B;  2O4X A;  1XWE A;  3OHX C;  4K5V A;  5CMD A;  3M3Y B;  2JSO A;  2EOT A;  4HSP A;  4F88 A;  2A6E C;  2PZW A;  4B9X A;  1EZ6 A;  2NZ1 D;  1CZW A;  2XWB B;  5CV8 A;  3RZD B;  3PIP 3;  1LT6 D;  1RF2 D;  4FF3 A;  2R3Z A;  2A68 C;  2K5Q A;  3J81 E;  5I2Y A;  1F9R A;  2RQX A;  4RH6 A;  5JPN C;  3NWT A;  3H91 A;  2K33 A;  4Q0F A;  4KN7 C;  1D6E C;  1S5D D;  3F2U A;  5FLX E;  3TZD A;  1I4Q A;  4A93 B;  5CV5 A;  3KLS X;  1BO0 A;  2KHS A;  4F87 A;  5ELF A;  1I4P A;  1EY8 A;  3PUV A;  2AQ2 B;  4IUV A;  2NTS A;  3K5M A;  5K36 H;  4ODG A;  1SEB D;  2EDG A;  4N9T A;  3URY A;  1JCK B;  1EWH A;  2SDF A;  5ELE A;  1U9R A;  2AQ3 B;  3OIP A;  4HR7 B;  1OXS C;  1S5B D;  2DNC A;  2RA4 A;  4XTC S;  1HUM A;  1JIC A;  2D2C C;  2ZXP A;  3J81 L;  2RKS A;  2CW0 C;  1TKW B;  1BBX C;  1IYV A;  4X3T A;  2F0W A;  1PFN A;  3MTS A;  2JA7 B;  1TVX A;  3KK7 A;  1FYC A;  3VYU A;  1IKL A;  2GA4 B;  1KTK A;  1EY4 A;  3HOV B;  4DGZ A;  3D3R A;  2L12 A;  3GO5 A;  5C3W A;  4RGT A;  1JQY D;  1JWM D;  5BN5 A;  1J8I A;  3QB3 A;  2IW3 A;  2MPM A;  1BF4 A;  3S15 B;  4KD4 A;  1SNO A;  3N6R A;  2H4O A;  2EVB A;  3PIO 3;  3H94 A;  2IT1 A;  4QCL A;  2EYP A;  4PV1 C;  3I4L A;  1VMC A;  2B63 B;  3D6C A;  2PO4 A;  1FR3 A;  4A3E B;  1SE4 A;  3QOL A;  4NW2 A;  1F2M A;  1FD7 D;  3SE0 A;  1E2V A;  1SYD A;  3HG9 A;  5C4X B;  3K57 A;  5D3D A;  3U9O A;  1STY A;  1F9Q A;  2O5I C;  3BDL A;  1ZEQ X;  4LK1 C;  2NWG A;  5C0X H;  3M7N A;  2B8G A;  2OXP A;  4DK1 A;  4XQJ A;  4RCO A;  3D6W A;  5KIX A;  4KJN A;  2K5W A;  1C8C A;  3HP3 A;  1L0X B;  2NUC A;  4KN4 C;  5CGK A;  3D31 A;  2QDB A;  1RD9 D;  3DMU A;  1Y8P B;  1R9T B;  4QB4 A;  2WII B;  2V4D A;  1LLR D;  5I9O A;  4Q5V A;  1EZ8 A;  1EU4 A;  2KUM A;  1DOK A;  1Q1E A;  2K1B A;  4KJO A;  4YIJ A;  4BA2 I;  1AEX A;  3MFG A;  2KEE A;  1KNE A;  2CHB D;  4XQQ A;  3EA6 A;  5JVH 3;  1LTR D;  4TKO B;  1HTL D;  1V1P B;  3S14 B;  2BA0 A;  2F0H A;  3NTI A;  2R92 B;  3PUX A;  3VR2 A;  1WTP A;  4ZUJ A;  4CJ0 B;  5M3F B;  1CQV A;  3AB9 A;  3MXU A;  3GP7 A;  1G2T A;  1PTO B;  1LV9 A;  3M85 A;  3HOX B;  1II3 A;  3BG3 A;  3H0G B;  5A2Q L;  3QJY A;  1MSG A;  1JOQ A;  1TS2 A;  3SK8 A;  2R93 B;  1HRJ A;  2HQE A;  5EBC A;  4CKB A;  3MWY W;  5C3X A;  1JR0 D;  3EFX D;  2D5D A;  2EY2 A;  3MXP A;  3J80 L;  2A68 D;  5DM6 3;  1TWC B;  3NP8 A;  5C0X I;  1WTX A;  3VA7 A;  3J80 E;  3T56 B;  4ID6 A;  4PMB A;  4HAE A;  2N88 A;  2JEA I;  3VYT A;  1DON A;  2PQE A;  3GTQ B;  4HTH A;  1F2L A;  2KCN A;  4EQO A;  3RZO B;  1EY9 A;  3K7A B;  5BN3 A;  5C6A A;  4V0B A;  1WD1 A;  2MHV A;  1D5Z C;  1STH A;  4K5W A;  3OIQ A;  1QCB D;  2E2I B;  1MGS A;  3NUC A;  1PXU A;  2B39 A;  3MC0 B;  3CKI B;  1YNN D;  1Q12 A;  1ILQ A;  4CGY B;  2YYZ A;  5JAV A;  1CFM A;  4RHR A;  5IT9 L;  1PFM A;  5IGC A;  4ZYS A;  1IW7 D;  2KA7 A;  2NN6 H;  3GTJ B;  4IFD G;  2Z4H A;  2B2V C;  2F0Q A;  3C1E A;  3QOJ A;  4L6T B;  2F0S A;  3OSO A;  2QKI C;  3I90 A;  1SE2 A;  5FK9 C;  3E6Z X;  1I50 B;  5FLX L;  4DF7 A;  3CRL C;  3NQT A;  1V8Q A;  5IOD A;  1E2W A;  4IUR A;  1IL8 A;  4A3F B;  2JA8 B;  2C9O A;  4IN3 A;  2F1M A;  3BYY B;  5D3I B;  5M5W B;  1G29 1;  3GTP B;  2PYK A;  4RKB A;  2XN9 C;  3ITP A;  2R7Z B;  2JXM B;  1CT1 D;  2BCO A;  2F0E A;  1U4L A;  3O13 A;  1QG7 A;  3DUZ A;  3A55 A;  1FNU A;  2BE5 D;  2OF1 A;  1AW7 A;  4FVM A;  4WOR A;  5TSS A;  1BXT A;  2PCF B;  2EE1 A;  3GTG B;  2IJ0 A;  3QO2 A;  5CV7 A;  1PZI D;  2F0U A;  2B2U C;  2R61 A;  1HXY D;  4XDX A;  3SK4 A;  1QE6 A;  1RKN A;  1C4Q A;  2K28 A;  4A3D B;  1LTS D;  1WD0 A;  1QNU A;  4G4K A;  1EQV A;  1KAA A;  1ICW A;  3ND9 A;  4M8A A;  2L4N A;  2CQA A;  2WIN B;  5EKI A;  2NTT A;  1K83 B;  1Q1B A;  2TSS A;  3I70 A;  4KKS A;  1KDC A;  5JVG 3;  3K0Y A;  4F8M A;  1H9K A;  2G9D A;  3VYS A;  2OT2 A;  5FO8 B;  3A56 A;  3X3M A;  2KEC A;  2QIL A;  1EY0 A;  3T16 A;  2LMC B;  5IGB A;  2XNA C;  5I9P A;  2JA6 B;  2O5J C;  3I8Z A;  3Q22 A;  5KEE A;  2Z8L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...