2EY1A

Crystal structure of staphylococcal nuclease mutant t22v
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDVVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal nuclease
publication title Threonine mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ey1A00
2F0DA 1SYBA 2O4XA 5CV5A 3MEHA 3E5SA 5CV8A 3R3OA 2EYPA 1STAA 2EYHA 3P1HA 5HGTA 5IGFA 3EVQA 5KRUA 4H7BA 3DMUA 5EKKA 1SNQA 1SNPA 1STYA 2EYFA 2F0OA 5I9PA 4OL7A 2F0UA 2F0TA 4KJOA 3V2TA 3ERQA 5C5MA 4EQOA 2EY2A 3U9OA 5C4HA 3EJIA 2F3VA 3D4DA 3MHBA 3NP8A 4G57A 4K5XA 3RUZA 2F0GA 2EXZA 3EROA 4K8JA 3OWFA 4K8IA 4LAAA 3MXPA 4IALA 5KEEA 1SYDA 3TP7A 1SYFA 5CV4A 2RDFA 1EYDA 4J1MA 5HURA 4NMZA 5J1ZA 5DAUA 5J22A 1IHZA 2EYOA 4HMIA 1EY4A 4K2LA 5E3FA 3MZ5A 2SNMA 5E1FA 5F2DA 2F0SA 1SNMA 4ZUJA 3NQTA 1ENAA 1JOKA 1ENCA 2EYJA 5CR3A 3NHHA 5C4ZA 3TP5A 4NP5A 2EY5A 4DF7A 4S3SA 5C3XA 4EQNA 1A3UA 2F0IA 4ID6A 3SK5A 4DFAA 4F7XA 5IGGA 1EQVA 4EVOA 1NSNS 5I6WA 1TT2A 4PMCA 3D6CA 2F0PA 3SXHA 5C5LA 5KYIA 1STGA 2KHSA 3SHLA 3TP8A 4WRDA 5CC4A 5KIXA 2EYLA 3D4WA 5JOBA 2SOBA 5M9OA 1EZ8A 1SNDA 2F0WA 3OSOA 4QB4A 3VA5A 4E6IA 4KJNA 3C1FA 2F0KA 1SYCA 1TQOA 2F0NA 2F0QA 4I65A 4N9PA 4RKLA 5IGDA 2F3WA 4PNYA 5IIFA 2EYMA 5ISRA 1JOQA 2PW7A 2RKSA 4ZQ3A 2KQ3A 1A2UA 4ODGA 4QMGA 5K5PA 5NUCA 1U9RA 4K5VA 2F0LA 1KDAA 5J39A 2EY1A 5IOCA 4KD4A 3SK6A 3HZXA 4PMBA 4KY7A 1EY5A 4ZUIA 4IUNA 5JAVA 1A3TA 2F0MA 4KD3A 4TRDA 1STNA 3T16A 5KGUA 2LKVA 1KDCA 3QOLA 4B9XA 4KY5A 4YIJA 5EKLA 1KABA 3QOJA 3SK4A 2OEOA 2RBMA 4WORA 3SK8A 4F8MA 1A3VA 1II3A 5I9OA 5CV6A 3SR1A 4IZ8A 1SYEA 2SNSA 1KDBA 3OMCA 3NK9A 4N9TA 5IGCA 4K6DA 3T13A 4EQPA 2HQEA 2QDBA 3BDLA 4QF4A 1EY7A 3NXWA 2F0FA 3P75A 4KTAA 1KAAA 2PZWA 5C3WA 2OF1A 5C6AA 3H6MA 3BDCA 1EY9A 1JORA 3C1EA 1SNOA 1SNCA 2M00A 4J6HA 2F0HA 4K5WA 2ENBA 3D8GA 4ME5A 4NKLA 5KYLA 1NUCA 3OMGA 4DU9A 4KHVA 5DEHA 5CV7A 2F0VA 3NUCA 1F2ZA 2NUCA 4KY6A 4B9WA 3DHQA 4HMJA 5IODA 4DGZA 1EYCA 4NDXA 1RKNA 1STHA 2PZUA 4RKBA 2PQEA 1JOOA 5CV9A 1EY8A 5CGKA 1F2MA 1TR5A 4HTHA 2OXPA 3S9WA 1F2YA 1EZ6A 3PMFA 1SYGA 2F0JA 4K2KA 5IGEA 1STBA 1EY0A 2PW5A 3ITPA 4R8NA 3MVVA 3TP6A 2EY6A 1EYAA 2PZTA 3QB3A 4KV6A 5EGTA 1A2TA 2F0EA 2PYKA 3HEJA 5IGBA 2WACA 3LX0A 4K14A 4MIUA 1AEXA 5I6YA 3TMEA 1EY6A
chains in the Genus database with same CATH superfamily
2DY8A 1TS2A 1HQRD 2H4OA 2AWNA 1XNRL 2K33A 1QB5D 3CHBD 4EGVA 2Q2TA 3OTOL 2R7FA 4CHTB 1SNQA 3J80E 3GTGH 4NB3A 1G6PA 3ONAB 4C1NK 2NVXH 2KCNA 3C46A 1FNWA 3L7ZC 2E2HB 2JE6I 1BCPC 4G4KA 3EROA 4K8JA 5EJWA 3TN2A 1S5DD 1X3FA 5T1GA 2UUBQ 1O7ZA 1Z47A 3F1ZA 2F4VQ 1P8LA 3VYRA 3B6YA 3S17H 3CF5A 2L9HA 4JI5Q 1EIGA 5T1IA 4GKJL 1YNJD 1NMFA 2HUGA 3M7NA 2FMCA 4QIWB 4EX5A 1TVXA 1VQ9A 4DV4Q 4RGMA 3I4MH 2D0PA 4BBRH 2B2VC 2J0TD 1QVCA 4ABNA 3RLFA 4KI0A 1I3QH 3G6JB 2K01A 1L0WA 2RCNA 2WB1B 1OXVA 1WTHA 1E22A 2QGQA 4Z9CB 4OELB 1IYVA 1CKOA 2F0QA 1SYCA 2KBNA 3U4VA 4JI3L 5FLXE 1YI2A 4QCLA 2HD3A 3BVMA 4NPSA 4ODGA 1SFOH 1PV4A 5IOCA 1BUVT 4KY7A 1TU2B 3CAMA 5JJZA 4GOPC 5C3EG 2CFMA 3CRLC 4KKSA 3VYUA 4DV2L 4DR7Q 1UNSA 1F9RA 1QE6A 4IZ8A 1UWVA 5M3FG 2XRQD 5D65A 3M9BA 4AYBG 4DR3L 3K0XA 2PMZB 1WTOA 3NXWA 3OOCA 3QWNA 1MIUA 5JPNC 2XSCA 1EUJA 4V0BA 3MXGA 1AZQA 3IFTA 3I4NG 1N36Q 5K36G 1HHVA 3NUCA 4C3JG 5IODA 3CCRA 3WDNA 1RKNA 1Y8NB 1ZKOA 2EPBA 4RKBA 5CYUA 3KYHC 1NY4A 3K5NA 3TZDA 3T1YL 2JN4A 4QY7A 2K14A 2V4DA 1EYAA 5KNCA 1TS4A 5C0XI 1CQVA 2AUKA 2F0EA 4MN3A 5M3MG 4DR1Q 2WACA 1JR0D 4GS3A 2RSOA 3J81c 4CGYB 3CCSA 5ELBA 2LSSA 1WYDA 3HOVB 2QKIC 3C2PA 1LTID 1KL9A 1GO3E 1PZJD 3QJYA 5KRUA 1WVLA 2F0OA 4NXNL 1B53A 2B29A 4R4OA 5JJIA 4A3MG 1G6ZA 2G5DA 2EY2A 4IFDJ 2B8FA 2LFNA 1NCVA 1SDFA 2HDLA 1VQGA 1M8AA 3DM1A 1K3BC 1J8IA 4OO1H 4GKKQ 3BYYB 4B3SQ 5CV4A 5GADC 3A55A 5E3FA 3J81j 1I4PA 2F4IA 4JBMA 1EEID 3RZOH 4DR6L 3PIO3 2KJXA 2VUMH 3D0FA 1U4PA 3K59A 3KJPA 3S14H 2VXWA 4ZKBB 2QEXA 1NAPA 1Y1VB 3X3MA 3ND8A 4JPBW 1S5ED 3SHLA 3S16H 3VR2A 2WAQE 4F88A 3OW2A 3C1FA 4I65A 3HGBA 4PMWA 3Q8DA 2BOSA 1BKBA 3F2UA 4ZQ3A 1FD7D 1DGSA 2ZJRA 3JAMi 1ONLA 2DNCA 3TQYA 1X56A 4A3IG 1OXTA 2F0LA 3SDZA 3J7A5 3VR3A 1J9OA 3I91A 4JI1L 3FEWX 2SDFA 4PQXA 4LMQD 2E74C 4GN5A 1KABA 1EU3A 1JC7A 4WORA 1MSGA 1IBKL 4A3DH 2UXDL 1B44D 3H0GG 5J3BA 2O2LD 2D9UA 1W3SA 2HCCA 1JB7A 1DONA 2R7DA 4IPHA 1KAAA 1X55A 2E5LQ 1PRTD 1W6JA 5DNFA 5BN4A 4N8X1 4LFAL 5JEAJ 2R7ZG 2PI2A 3NTKA 4DKAC 4LF4Q 5M5YH 1MJCA 4HCEA 3BVGA 2LXJA 5E4WC 3M4QA 2F0JA 2VQEL 3ITPA 2K75A 3I8ZA 4A3GH 2K5HA 4MIUA 2RDHA 1PYBA 1L2FA 1RDPD 2WFWA 3DM3A 3HP3A 4OGQC 3S1RB 4IOAA 3ERSX 1CQFA 4DR5L 4G7OC 1AE3A 3G6EA 1MGSA 2O5IC 3NPPA 3GTKB 1VQDA 3ULJA 3K6OA 4UP9A 4XXEA 5EKIA 1WTXA 4DAYB 1IXRA 1O7LA 3CQZH 2LMCB 3UE0A 5BR8L 1XMOL 1U4RA 2HQLA 1B1ZA 3JC66 2DJFC 3H94A 3DEOA 2RCFA 3IAYA 2VQFQ 3MZ5A 4BWGB 4JI8L 4LF5Q 4HIDA 2SEBD 2F03A 3NHHA 1MKHA 1LTLA 1N9WA 1E0BA 2KCCA 1YHBA 3GTJH 3DWAA 5I6WA 3F2BA 2PQAB 3GV6A 1BF4A 5CC4A 4C56C 2E2IB 3BS1A 1VQ6A 4A3BB 4OX9Q 1PH7A 4L5RC 1HUMA 1HZ9A 3RD4A 4IFDG 1W2BA 4K5VA 4C3IB 1IBMQ 3SK6A 3S1NH 3Q23A 2MO0A 1PH4A 4X66L 4A4IA 4UP7A 4GNXB 1I4HA 2UXCQ 3R2IA 3SK4A 3VA7A 1Q1EA 5CV6A 3Q22A 4FXKC 4C1NI 2AWOA 3WOEA 1I94Q 1Q90A 4JI4L 2F0FA 1RHPA 1K8AC 4DV5L 3C1EA 3DUZA 2M00A 4Q5VA 4ZKCB 3CC7A 4NKLA 4IPCA 2K7VA 1IBLL 1GUNA 2A6HD 4LF7L 1K8GA 1LTBD 3M4OB 5CBEE 2ZJPA 1Q81C 3HKZG 1QVGA 1GJXA 2A19A 4C2MB 5M3FH 1GD7A 1QG7A 5LMUL 1V1PB 2F3IA 2I5MX 1EEFD 2B2TC 5G3LF 3PO2B 3I4NH 1YVCA 5K36H 1DCZA 4C3JH 1OTCA 3S15H 1LT3D 4JOIA 1XTDA 3P1HA 2IX3A 4BBSB 1E1TA 5I9PA 4OL7A 5TSSA 1X3QA 3HOYB 1BNZA 4IJLA 1J6QA 1K83B 3AFQA 5M3MH 3HOWB 4ZLTF 1WD1A 4IALA 2YTXA 3AU7A 1PZID 4YWMA 1WTWA 2NBFA 1HTLD 1VDZA 2LXKA 3E9IA 5HURA 3I73A 5I2XA 4FXDA 2FFKB 4OEMB 4GZYC 4DR4L 1PTOB 1SE4A 4CDEC 1TWHH 1BXTA 5E1FA 4DK0A 4DPGA 3R93A 4CBVA 3NQTA 2JK8A 3EN2A 1BCPD 1PH3A 4A3MH 3JAMc 4BY1B 3TP5A 4DF7A 4AQYQ 3T51B 4EQNA 1VQOA 2YU9B 1D6EC 4DV7L 3D6CA 3PSIA 3I72A 2ALYB 2MPMA 1EZ8A 1SE8A 3SVMA 1WCMH 1TQOA 2KOLA 4RKLA 2EYMA 2KQ3A 4OWXB 3BZDB 3O13A 1JQYD 3EA6A 2G9DA 3KK7A 2HHHQ 4DN4M 1EQQA 1M1KC 2R93G 2LS01 4LF6L 2K05A 2JA5B 2JA8H 3A8KE 2OTLA 4QIWE 3M85A 3CCEA 2ICEC 5I9OA 1JWSD 4B3ML 4QL5A 1I4XA 1Z7TA 4EQ5A 2XN9C 1KRSA 2GVAA 3FKIG 1L1OC 2KA7A 3VYTA 2IPKD 4K0KQ 4A76A 2WB1E 1KAWA 2ZT9C 4A3IH 1FYCA 3TSSA 2OQKA 3DHQA 1D2BA 4DUYL 3FP9A 1JICA 2B2YA 4DAYA 1E7ZA 3H0GH 4JV5L 3H3VH 1KD1C 1N32Q 1B70B 1G2SA 3S1QH 4JBJA 2Z4HA 4X64Q 2AQ2B 5C44G 1QUQB 3VDYA 3KBGA 2PMZE 4FF2A 1ICFB 2R7ZH 3E5SA 3LGJA 5GQOA 4HJ8A 3KFUA 1AFPA 2MJ8A 2WIIB 1KTKA 2XVSA 1AZPA 3S2HH 1PYSB 1SLJA 1TWCB 2PQAA 2Z6KC 3GTQH 4LF8Q 4LFBL 1FR3A 2VL6A 5C4HA 3NSWA 2F3VA 4XQNA 1GOZA 1HZBA 4ILWA 1AW7A 3PO3H 4QQBX 4A3JB 3GTPH 3MXPA 1PFMA 1PRTF 4J1MA 1GUGA 3K81C 1A63A 3QG1A 1I50B 2CWPA 1CKMA 1EY4A 2JA6G 3KF6B 4CJ0B 4DK3C 4GNXA 3AFPA 2A69C 1Y1WB 2FINB 4NW2A 5IT9E 3S2DH 2IJ0A 4S3SA 3E0JA 4A3FG 2JYOA 3H3VC 4DUZQ 3CCQA 1Y69U 5AJ3L 3J81i 4NXML 2SOBA 4CKCA 1SE2A 5C4JH 4C3HB 5IIFA 4PNYA 1Q3LA 4FNFA 1RCVD 2X6GA 3GQBA 4BXXG 5C4XB 4P71A 1GXDC 4A93B 1NE3A 2FXQA 2UUCL 1IKMA 1C9OA 1TWGH 1PDQA 3W1BA 3R8BA 1RJTA 1V1PA 4Y7NB 1QWYA 1NJIC 4RFBA 3OIPA 4H0LC 1Q12A 3W1GA 2B39A 2K50A 3D4RA 2OF1A 3BZKA 2YTYA 3KF8B 1XJVA 4IFDH 3TEHB 2K04A 4DXFA 4DXGA 5CV7A 1F2ZA 1DZ1A 1F2LA 3L9AX 1VQKA 1E24A 3Q6SA 3NBHB 3GDEA 1H9JA 4YHHL 3PMFA 1KNEA 4POFA 4R8NA 4DV3L 4ZAIA 3TP6A 2PPBC 2I5HA 2NVXB 4LWCA 4KV6A 4KHPQ 1H95A 1EQRA 3KLSA 4JI2L 2HT1A 1QCBD 1EIHA 2O4XA 5CV5A 1X3PA 1Q8IA 1PFSA 4KMUC 1KLUD 2Y0SG 3MWYW 2Q2IA 1VQFA 3H09A 3RZDH 5ELNA 3EVQA 2EYFA 4TSSA 1EYGA 1SAPA 2ATWA 1JB3A 1YJNA 1ILQA 4KHZA 2BDNA 4JI0L 1Y14B 3L0OA 2KCMA 1MD2D 1TIID 2IT1A 1WTVA 2JJQA 3I4MB 1ICWA 3Q0AA 4RGTA 1I3QB 4JK1C 1DM0B 2KUMA 3J80c 1ZYRD 5FJ8G 4RG1A 4BY7B 4HIKA 2F4VL 3NENA 2K28A 4JI5L 3HOUG 2EJGC 4R4QA 1V43A 2EE1A 1SFOB 4F7XA 1TS3A 4EVOA 1NSNS 3CCJA 2NZ1D 1RODA 2UU9Q 1X32A 4DV4L 1A0IA 1I6VC 3KDFB 1YHAA 1HNWQ 1HFNA 3VA5A 3RN5A 3S1MH 3E6ZX 4N9PA 3CC4A 3PIOA 1Z9FA 4LFCQ 5IGDA 2F3WA 5KNBA 3F2CA 2RSNA 3MC0B 3OHXC 1XPOA 2K03A 3PUWA 5NUCA 1OXUA 1JT8A 4PMBA 2LY7A 4OIKA 3T16A 2EVBA 4A3LG 1Q82C 4U673 2F52A 4TKOB 2A73B 1VQAA 3P7JA 2SNSA 1QUQA 2VW9A 1CHQD 4GLAC 5FLXc 3A5UA 1UE5A 3FDTA 2NVTB 4DR7L 4OO1I 3V05A 4ME5A 3KJOA 2EDGA 1U0LA 5IWAQ 1SE3A 1BCPF 2NN6G 4AYBE 2NUCA 1VMCA 3K7UC 4P74A 2R93H 4OWWB 4LF9Q 2MP1A 3NE5B 5CV9A 2EIFA 4LUZA 1N36L 4IUUA 2MHVA 1D5XC 3CCLA 1DOKA 3FKIH 2QEJC 1VCIA 3HEJA 4A3KB 1UEBA 1QZHA 3KF6A 4ZCKA 3W2DA 1R9TH 3TMEA 5FLMG 2GVBA 4B3RQ 5EPLA 4YCVA 5CV8A 5DLQE 4XQQA 4XQJA 3PUZA 3A7AB 1STYA 5IP7H 3SE0A 3R2TA 4G57A 1WOCA 3RUZA 2B63G 2R61A 2VUMB 4JG2A 1V1OA 1KRTA 3OIQA 1E2ZA 2VY3A 5C44H 2E2JH 3S14B 3K57A 1Q86C 3M4PA 4C3IG 4CJ2C 1LUZA 1K0SA 1FGBD 2EYOA 5IYDH 4GKKL 4ZUJA 2L12A 2C9OA 1ENCA 2EYJA 2DJGC 1BO0A 4HJAA 3M3YB 5C3XA 1TY0A 1EQVA 1ML0D 3I2ZA 4L6TB 1BBUA 2B2VA 2DN8A 3PUYA 4M8AA 1STGA 1RL2A 4WRDA 3KF8A 2ZXRA 5KIXA 3JAML 3EIVA 3AMUA 1UE6A 1JCKB 1I6HH 1N33Q 2JA6H 2M2LA 4DV1Q 2IHEA 1C7YA 1WCMG 4JW0A 3NBHA 5GAHC 1U9RA 5M5XH 2K5NA 2EY1A 1I5FA 3T1YQ 3KLWA 4ZUIA 1YZ6A 4A3FH 4KD3A 1N34L 4BS9A 4KY5A 2I07B 4U68A 5E7NA 1I4RA 3Q24A 4F8MA 1QNUA 1II3A 1LYLA 2JA8G 5M5YB 2DY7A 2QDBA 4XT1B 3I90A 5C6AA 1EFID 4NXNQ 1S5FD 4BXXH 2C5CA 2RHQB 3E3XA 4P2CB 3OMGA 4A3GB 4YCUA 4HMJA 2E5LL 3MA2B 1PH1A 1ILPA 2PQEA 3N52A 1C48A 4JI6Q 1U5KA 3HOWG 2AQ1B 4FF4A 4YWKA 2PW5A 2VNUD 4DV6Q 4LF4L 1NR4A 3QB3A 5EGTA 1A2TA 2K32A 2L4NA 2ZJQA 4RCNA 4FP5D 3CQZB 4QJFA 3ICEA 1CZGA 4MTKA 4FXGC 4IUVA 3IKJA 5IGFA 4H7BA 4RWSC 1E2VA 2F0UA 2WAQG 4R4TA 1B7YB 3KDFA 1BR9A 4QUCA 4M1UB 1YNND 4K5XA 3NP8A 3NBIA 2Z6BA 2KEEA 2EZVA 2NWGA 5IT9L 3PO3G 3GTJB 3D31A 1SYFA 2RDFA 1B50A 4NMZA 5J1ZA 4HMIA 1BDOA 4P73A 2SNMA 2VB3X 4UY8C 5ELOA 1SNMA 1B3QA 1Y1VH 1IYUA 3PQIA 3DWQA 3I4LA 2VQFL 4NP5A 2NZHA 4IPGA 1ESFA 1JE5A 3UDXA 2E76C 1NTGA 1CA5A 1ZYRC 1TS5A 4JYAL 4MTNA 1TXYA 2KECA 1LABA 4KN7C 3SXHA 4CKEA 5C5LA 4X62L 4HJ9A 1BBWA 5LMNW 1N8RC 1K9MC 5LMNL 2JQOA 2F0WA 4UPAA 3M7GA 3SGIA 5ISRA 2VS1A 2A69D 3GTOH 1PFNA 5FJ8H 4N8FA 1HR0W 4OX9L 2B2WA 3HOUH 3HZXA 2BDOA 1XMQL 1HR0L 1IYJB 1LO5D 1RIPA 1IBML 1SROA 3U50C 2K1BA 2K5DA 1VQIA 5C3EB 4N9TA 5IGCA 3I4OA 2UXCL 3T1HQ 1JMCA 1K28A 5M3FB 4AYBB 5IY0A 1PHJA 4JOIC 4KLKA 3DLLA 4J6HA 2ENBA 3HKSA 2CQAA 4H44C 3G71A 5CBAE 4A3LH 3I4NB 1GKHA 2K5QA 3UE1A 2EQSA 3MXNB 4P75A 5FO7B 4C3JB 3S15B 3S9WA 1R4PB 2OXPA 3NTIA 1J5EL 5BN3A 3HOZB 2HIXA 1YBYA 2PCFB 3S1RH 3UDGA 3KLRA 4DNTB 5KEEA 1H9SB 5M3MB 2V1CC 5JJKA 2NN6H 1DD2A 3GTKH 3BDOA 4L63B 2JEAI 1JJGA 5H1SE 4JBWA 1JE4A 5EKKA 1SNPA 2F0TA 1TWHB 1GUSA 2PNHA 4HJ7A 4DR2L 1V9PA 2N3SA 1H9KA 4A3MB 1D1IA 5EBCA 1IKLA 1PRTB 4HN7A 2RQXA 4ZYSA 1HRJA 1SYDA 1JJ2A 3TP7A 2WINB 2J4XA 1JWMD 5FLMH 1D1KA 3CKIB 3NELA 2E8GA 4WJ4A 2L1BA 1CSPA 3GV3A 3EBEA 3GP7A 4A3EG 1BOSA 5CR3A 1X9NA 3HOXB 1CK1A 1HZCA 2DNEA 4X3TA 3CU7A 1DOMA 2E2IH 1A3UA 5IYBG 4KK7A 2B63H 3FHWA 3OWEB 5I4DA 2JXMB 4JC0A 4AQYL 3WWVA 2EXDA 1PA6A 3CCVA 4CDCC 5JEAG 5JOBA 4C3IH 1SNDA 4QB4A 2F0NA 4R4CA 1SN8A 1TWFB 2HIVA 1F9QA 1RF2D 4XYQA 1TWAB 4L5SA 1WTRA 1GUTA 1LV9A 4O0AA 1GHKA 4X65Q 1EWIA 5JAVA 1Q7YC 5HY6A 4A3IB 3KLSX 4QGUA 4B9XA 5IE8A 2L55A 1A3VA 1EFWA 4YCWA 2A6ED 3I7FA 1ASZA 2Q8IB 4FVMA 3F2DA 2UUAQ 5ELDA 2JA7G 4QF4A 5FKAC 2OWOA 1ET9A 1QZGA 3CP0A 3BDCA 3J80i 2R3ZA 3S1QB 4APVA 3U58A 1HNXQ 2R92G 5C0XJ 4DU9A 1SMXA 1LT4D 2WV6D 3RMHA 2UXBQ 1R4QB 2EJMA 1LACA 2N49A 2R7ZB 1Q46A 1FJGQ 3BVZA 3JAME 3HG9A 1PZKD 2IW3A 1B9MA 1UAPA 2XGTA 4K6LA 1IL2A 1VQCA 4LK1C 5ELFA 3CCUA 3S2HB 3X3NA 3GTQB 1S5CD 2BCOA 5FOBB 1LLRD 4L5QA 5BN5A 1N32L 2F0DA 4GNXC 3GTPB 3K0YA 1G51A 3NTHA 1F9SA 4J15A 3GTLH 1AH9A 1Y8OB 1PVOA 3HOWH 4KJOA 3VYSA 4EQOA 1Q8KA 1EOVA 5IP7G 4GN4B 2GN5A 3K7AH 4TVAB 4HIOA 1PTOH 2CQOA 2JA9A 5JJLA 4LUOA 3L2PA 4CDFC 4YY3Q 5GROA 1T5XD 1YNNC 2RVLA 2YYZA 4BY1H 2ZXOA 3J7ZC 5EQ0A 5F2DA 2F0SA 3PCOB 1GM5A 4IFDI 1AP0A 1GUWA 5IYDG 5C4JB 2I0QA 2ZXPA 1RTOA 1XXGA 3AB9A 3UDFA 1HA6A 3IRBA 3ER0A 3J81L 4FF1A 1AN8A 4CJ1B 1G8ZD 4DFAA 5IGGA 2WB1G 2CH4W 1CUKA 4PMCA 2NTTA 5M5WH 1VQ8A 4IPDA 2KHSA 4CKBA 3OSOA 4R8IA 4DUZL 5J22A 1XPUA 1LTSD 4UDUC 1D5ZC 2K52A 2Z4IA 1VMPA 4DV0Q 2ZM6Q 2Z0SA 3MXNA 2D5DA 2D0OA 3GTMH 1HNZQ 2F0MA 4YIJA 2IL8A 1K8MA 3QOJA 1IW7C 1VQHA 1PTOC 4A3KG 2A8VA 3H15A 3T13A 4EQPA 3BDLA 2PZWA 1WTPA 1HXYD 2QW7A 1SR3A 1BCPB 3K5OA 2CVRA 1A6XA 2L11A 5JVG3 1UE1A 3W3AA 3ULLA 4NDXA 5FO8B 4WJ3M 1M4VA 1KHIA 1VQPA 4PZ6A 4XIGS 2D62A 4LUVA 3RZDB 1EU4A 2D2CC 5IGEA 1F9PA 3MVVA 1Q1BA 4L8JA 3HKZB 2I46A 1OXXK 4QUFA 3DWPA 3OPOA 4IUQA 3HOVG 1VF5C 2QCPX 4FYDA 3EFXD 1SYBA 4KHPL 4X3SA 1NMGA 2A68C 1STAA 3RR5A 3T56B 3BZCA 4HR7B 4J8QA 1YHQA 1O7IA 4POGA 1D7QA 3V2TA 3RN2A 4KN4C 5COYA 2CW0C 4O2DA 2Z6KA 2XWJB 3CW2C 2IY5B 5C0XG 1U4MA 4LNQA 3GTGB 3BG3A 4A3CG 1HUNA 5ELCA 2NTSA 1VQ7A 2VB2X 4GOPB 1Y1WH 3EQLC 4B3TQ 1PFBA 3ND9A 1VQMA 1X54A 4P72A 1YIJA 3S1MB 3I55A 5C4ZA 3S17B 3PUVA 2EY5A 1Y1VG 1P16A 1YEZA 2NYZD 1V8QA 1MHWC 1DXMA 3V96A 1O80A 3CD6A 1PH9A 4BBRB 2NVYH 1BVSA 2UU9L 1S72A 1SEBD 4A75A 1L0XB 1XNQQ 1HNWL 4KKTA 1CTMA 3K8AA 4AIMA 4A3EH 5K5PA 2UUBL 1CA6A 1KDAA 2K5VA 3PGZA 4LFCL 4ZRZA 4TRDA 5IYBH 1KIXA 2MO1A 2IX0A 1S5BD 1LM0A 2IX1A 3SR1A 2R93B 5JEAH 4RHRA 1HZAA 2R6GA 2B2UA 1XX8A 1VQLA 1PLFA 4JI7Q 3P75A 4FO2A 1EY9A 2WKDA 4MHEA 1SNOA 3FKIB 2A6EC 3MEFA 1YITA 2JP1A 3TRZA 1NUCA 4GLVB 5AFWA 1O78A 1R9TB 2K4KA 4JI0Q 4DGZA 1EOTA 1FGUA 2B8GA 5IWAL 1PH2A 1F2MA 1C4QA 3K80C 1PH5A 4K2KA 4LF9L 2EY6A 4R4IA 1XNRQ 2JA7H 4Y52H 3OTOQ 1EY6A 3OW7A 2R92H 3MEHA 4B08A 1LT6D 5C44B 2E2JB 1QILA 2VZAA 4WJWA 3T53B 4B3RL 4DNIA 4IO9A 1SMYD 1H9RA 2NVQH 3LWEA 2Q2HA 2N55A 1MI2A 4K8IA 4OHJA 5IYCH 3MXUA 4GKJQ 3NQIA 4BY7H 1K73C 4IURA 5LL6S 5G3LD 2WP8J 4V190 2PNRC 4OXPA 2KHIA 4XYOA 5E4XA 1WI5A 4DR1L 1ENAA 2E2HH 1I6HB 3FPUB 2JA6B 2N8NA 1CT1D 2Q8TA 1TY2A 2F0IA 3URYA 5M5XB 3SK5A 4GLXA 2DUDA 1TT2A 3RZOB 1LTTD 4BA2I 4A3FB 4JI3Q 4A3BG 1VQJA 1K3RA 1B8AA 1Z6HA 3A0JA 1EWHA 2F0KA 4DK1A 5EPJA 4RHSA 1JOQA 2PW7A 2RKSA 3S16B 1ET6A 4B3SL 5J39A 4KD4A 1N33L 2BE5C 2J7ZA 5CORA 4DV2Q 1HTPA 2RF4A 4PV1C 4RGOS 4DV1L 1MSHA 4PZ8A 1S4ZA 3HOZG 1STNA 3J7YW 3N6RA 4DR3Q 1M90C 1KDCA 1ZEQX 2NVTH 2FHTA 1D8LA 2OEOA 4PG3A 2TSSA 3FRPB 1KLGD 3PV0A 1EIFA 4ZK9B 4K6DA 2BH2A 2N88A 5IP9H 4A3DB 3F8TA 4KKUA 3PIP3 1YJWA 4K5WA 2IWHA 4XT3B 3UDIA 3J81E 2EOTA 1PH8A 3G4SA 2F0VA 4B9WA 2C35B 3H91A 1EIYB 1EYCA 3STBC 1VQNA 1JOOA 2OQ0A 1NR2A 4A3KH 1S3OA 2E2DC 2F1MA 4UP8A 3PF4A 3PO2G 4GOPA 4JI6L 4IUTA 2CWAA 3DEPA 4K14A 1EQTA 3NWTA 4IQZA 2P5ZX 2QF7A 3HOXG 4DV6L 4BBSG 3TS0A 3HFZB 1F77A 3HOYG 2XTIA 1JJCB 1O7YA 4G7ZC 2Y0SB 1X65A 3A56A 3IL8A 1DJRD 3A5ZB 1FVIA 4I7ZC 5CMDA 2HCIA 3D4DA 1HJPA 2I5LX 4ULLA 1TKWB 1ENFA 3HOVH 2OTJA 2MNAA 3CXCA 1OXSC 3A7LA 4R1JA 4DR6Q 5DAUA 3M3YH 2B2WC 1XPRA 1N34Q 1G291 4BY1G 1HQMC 1A8VA 1EWCA 1XTCD 5HGQA 5JPMC 3GTOB 2CHBD 3T4AC 2N78A 3HOUB 1NNXA 1ZXTA 5C0XH 2BA0A 4A3CH 3LNNA 4MNOA 3VR4A 1CZWA 3E0EA 1QNKA 1PXUA 3A8JE 3TS2A 4JI1Q 5EAYA 4H13C 4QMGA 3ZJYC 2A74C 2NN6I 3OYYA 1IBKQ 2UXDQ 2JA5G 1EY5A 3M4YA 2G9HD 3DXJC 1RTNA 1CI3M 4LF5L 4H02A 3LWUA 3SK8A 2Z9HA 2RBMA 3KUPA 1LT5D 2KENA 4HSVA 3S1NB 3E9HA 3RLNA 1LTGD 2OT2A 2HQEA 4LFAQ 4MZ9A 1X3GA 3WOFA 1VQBA 2AUJD 2NB0A 2CCZA 3CMEA 3T1HL 5DEHA 3AYHB 4X6AH 4KY6A 1IW7D 1PTOD 2VQEQ 5D3IB 3CRKC 2AHOB 1EZ6A 1SSOA 1STBA 5IGBA 5A2QL 1L0YB 3G7LA 3U9SA 3L3OC 3FMCA 3J7AV 1KQSA 4DR5Q 3J7AF 4HEDA 1ESRA 4RA8A 1I94L 3R3OA 1B4OA 4JYAQ 2K5WA 4IUPA 4YWLA 2M9VA 4X62Q 4HIMA 1YNJC 4R9WA 5C5MA 3TZUA 1X6OA 2BA1A 5LMNQ 4A3JG 1PH6A 3U9OA 1MJEA 3EJIA 4JCVE 1GUOA 5BR8Q 3ZYYX 1B3AA 1XMOQ 4JBKA 2F0GA 2MFIA 5EBDA 4JI8Q 1KNAA 1SMYC 2CKZB 2Z1CA 4OIJA 2B63B 2IHFA 3RLOA 5D3DA 1W6KA 2A68D 1XMQQ 1HR0Q 3HKZE 1OO9B 3NEMA 3MFGA 1Y1WG 3NWSA 1JOKA 1CM9A 4G7HC 2KEDA 2CW0D 2H5XA 3VR6A 1L1OB 2MGSA 3VR5A 1VF7A 1HH2P 3HRZC 1WD0A 4C3HG 1C0AA 5C4XG 4E6IA 4KJNA 5LHY1 5DM63 4A93G 1IZ6A 4X66Q 1E3PA 2AQ3B 4HJ5A 1FL0A 1J5EQ 3BYTB 3MFYA 3U4ZA 1VQ4A 1WCMB 3A54A 5C3EH 3G48A 3I3CA 3QOLA 1WFQA 4JI4Q 4RH6A 4A3BH 1RD9D 4X65L 3J80L 3HS0C 4DV5Q 4LW1A 3OMCA 1A62A 4F87A 3H3VI 4X3UA 5FK9C 1IBLQ 2JA8B 4FF3A 4LF7Q 1SNCA 2DGYA 3CMAA 5KYLA 3PUXA 4DR2Q 2UUAL 1IL8A 1UE7A 4AH6A 2B2YC 3HOZH 2ES2A 1I4GA 3D3RA 4UAIA 1GHJA 1STHA 5LMUQ 4LJZC 2PZUA 5I2YA 1HNXL 1T9HA 1TR5A 1HFGA 4RCOA 4XDXA 1F2YA 3TBIB 3GTLB 1SYGA 2Z8LA 1HPCA 3P20A 2UXBL 2HHHL 2PZTA 3S24A 1X3EA 1FJGL 1A15A 4DAVA 3LX0A 1AEXA 3H0GB 3K7AB 4RGNA 1XWEA 2WKCA 3M4OH 3QR8A 2PO4A 2EYPA 2EYHA 4C2MH 5HGTA 4X3KA 5FLXL 4IN3A 4K0KL 5KNDA 3I4MG 3PO2H 3MHBA 1SJED 1GVPA 1STEA 2ID0A 1SXTA 2EXZA 2PI2E 2WAQB 4BBRG 4DR4Q 1CKNB 3BJUA 4LAAA 1XYIA 1S40A 3HOXH 1EYDA 4RAUC 5IYCG 4BBSH 1DYQA 1T5EA 5M5WB 2B2TA 4BY7G 3PO3B 1CFMA 3HOYH 4HSPA 1U4LA 4YY3L 4X64L 5GAEC 4DV7Q 1K83H 2RA4A 4TQUS 1PYWD 3MAQA 5A35A 2KCTA 3GTMB 1TWFH 2F0PA 2AMCB 5KYIA 2YV5A 1HA5A 3TP8A 5M9OA 4OWTB 3S2DB 1TWAH 4LF8L 4DAMA 3FPPA 3A74A 4ME3A 3A8IE 4RMFA 5EPKA 2L5TA 3TREA 2YTVA 4LF6Q 1LTAD 1UUPA 2QA4A 1PRTC 2NZOA 4B3MQ 2YU9H 3C3LA 3KOJA 1A3TA 4UHVA 2XRSD 5KGUA 2LKVA 4DV0L 2ZM6L 4DNRB 1HCZA 2RHSB 3I56A 1HNZL 1KDBA 4HAEA 1BQQT 3NK9A 1TWGB 1G2TA 2XIWA 2MUYA 4KTAA 1K8OA 3ULPA 2K6AA 2JSOA 3H6MA 2BE5D 5IP9G 4DUYQ 5ELEA 2HDMA 2JEBI 4HCSA 4KHVA 3UI2A 2JA5H 5IT9c 4JV5Q 1E2WA 1BBXC 3QO2A 4HTHA 1I4QA 2GA4B 1FNVA 1YNXA 3CCMA 1EL0A 4DAPA 5L37A 4WFN3 4DA2A 1H9SA 1ASYA 2QDLA 4OO1G 1CHPD 5I6YA 2EYLA 2XWBB 1WTQA 1L1OA 3STBD 2MQHA 4ALPA 2L15A 4LFBQ 1WJJA 1SBBB 1SRUA 1B9NA 3DMUA 2VUMG 3ERQA 2ASBA 1PMRA 1VS0A 2FJ2A 3K58A 1D5MC 1YJ9A 2OCEA 3OWFA 2L0CA 5DM73 3CC2A 2ZTEA 1B2TA 1K0RA 3IFDA 4FDBA 4DK6C 3K5LA 1QJOA 1QOHA 1H9MA 1IHZA 4K2LA 1G91A 3RNUA 4Q0FA 1TWCH 1PTOF 1CSQA 1C8CA 1MBYA 2NVYB 2FMMA 4B3TL 4A3JH 3MTSA 5AJ3Q 4A3EB 4NXMQ 4OONA 2XNAC 4ID6A 5A2QE 2KVMA 2B2UC 2EJFC 2Y0SE 1I50H 4A3DG 2ZTCA 2Q8RE 4CDDC 3D4WA 1QVFA 3PF5A 4O1NA 1VQ5A 3FVQA 1DOLA 2CH4A 4JVZA 2UUCQ 1UEAB 4GN3B 2X6LA 1A2UA 4IJHA 3QIAA 2H1EA 2O5JC 3CPWA 1XNQL 4IUNA 1FNUA 2KHJA 5GAGC 2QILA 5EKLA 2RDGA 3GO5A 3K5MA 1V1QA 2A6HC 2X69A 3AEVA 1JWUD 4BA1I 4C3HH 1LTRD 1SYEA 3GD7A 3W5OA 4PZ7A 5C4XH 3SEBA 4IOCA 1VQEA 3D6WA 2A5HA 1EY7A 5C3WA 1SJHD 1Y8PB 2ICIA 2ZTDA 4A93H 1NBWA 2B3GA 2E75C 4A3GG 1JORA 2JA7B 2F0HA 3D8GA 1KXLA 4Y7NH 3KBXA 4JI7L 2TMPA 5FO9B 1KC8C 4YHHQ 4L5TA 3TDQA 4O42A 1AE2A 3I70A 5D14A 4DV3Q 2R92B 2Q2UA 3CPFA 4I7AA 2AKWB 1EY8A 5CGKA 1CKNA 2A1AA 4XTCS 3AQQA 1EY0A 4JI2Q 3PIPA 2BH8A 5JVH3 3BU2A 2PYKA 5LL6X 1E1OA 2NVQB
chains in the Genus database with same CATH topology
2DY8A 1TS2A 1HQRD 2H4OA 2AWNA 2K33A 1QB5D 3CHBD 4EGVA 4CHTB 1SNQA 3J80E 3ONAB 4C1NK 2KCNA 3C46A 1FNWA 3L7ZC 2E2HB 2JE6I 1BCPC 4G4KA 3EROA 4K8JA 5EJWA 3TN2A 1S5DD 5T1GA 1O7ZA 1Z47A 3VYRA 2L9HA 1EIGA 5T1IA 1YNJD 2HUGA 3M7NA 2FMCA 4QIWB 1TVXA 4RGMA 2B2VC 2J0TD 4ABNA 3RLFA 4KI0A 3G6JB 2K01A 2WB1B 1OXVA 4Z9CB 1IYVA 2F0QA 1SYCA 5FLXE 4QCLA 3BVMA 4ODGA 5IOCA 1BUVT 4KY7A 1TU2B 5JJZA 3CRLC 4KKSA 3VYUA 1UNSA 1F9RA 1QE6A 4IZ8A 2XRQD 5D65A 1WTOA 2PMZB 3NXWA 3OOCA 3QWNA 5JPNC 2XSCA 4V0BA 3MXGA 1AZQA 3IFTA 5K36G 1HHVA 3NUCA 4C3JG 5IODA 3WDNA 1RKNA 1Y8NB 1ZKOA 2EPBA 4RKBA 5CYUA 3K5NA 3TZDA 2V4DA 1EYAA 5KNCA 1TS4A 5C0XI 1CQVA 2AUKA 2F0EA 4MN3A 2WACA 1JR0D 2RSOA 4CGYB 5ELBA 3HOVB 2QKIC 3C2PA 1LTID 1PZJD 3QJYA 5KRUA 1WVLA 2F0OA 1B53A 1G6ZA 2EY2A 4IFDJ 2B8FA 2LFNA 1NCVA 1SDFA 2HDLA 3DM1A 1M8AA 1J8IA 4OO1H 3BYYB 5CV4A 3A55A 5E3FA 1I4PA 2F4IA 1EEID 3PIO3 2KJXA 1U4PA 3K59A 2VXWA 4ZKBB 1NAPA 1Y1VB 3X3MA 3ND8A 1S5ED 3SHLA 3VR2A 4F88A 3C1FA 4I65A 3HGBA 4PMWA 2BOSA 3F2UA 4ZQ3A 1FD7D 1ONLA 2DNCA 1OXTA 2F0LA 3SDZA 3VR3A 1J9OA 3I91A 3FEWX 2SDFA 4PQXA 4LMQD 2E74C 1KABA 1EU3A 1JC7A 4WORA 1MSGA 1B44D 2O2LD 2D9UA 2HCCA 1DONA 1KAAA 1PRTD 1W6JA 5DNFA 5BN4A 5JEAJ 3NTKA 4HCEA 3BVGA 5E4WC 2F0JA 3ITPA 3I8ZA 4MIUA 2RDHA 1RDPD 3HP3A 4OGQC 3S1RB 1CQFA 4G7OC 1MGSA 2O5IC 3NPPA 3GTKB 3K6OA 4XXEA 5EKIA 1WTXA 1O7LA 2LMCB 1U4RA 1B1ZA 3H94A 3DEOA 3IAYA 3MZ5A 4BWGB 2SEBD 2F03A 3NHHA 1E0BA 2KCCA 3DWAA 5I6WA 3GV6A 1BF4A 5CC4A 4C56C 2E2IB 3BS1A 4A3BB 1HUMA 3RD4A 4IFDG 4K5VA 4C3IB 3SK6A 3Q23A 1I4HA 3R2IA 3SK4A 3VA7A 1Q1EA 5CV6A 3Q22A 4FXKC 4C1NI 2AWOA 3WOEA 1Q90A 2F0FA 1RHPA 3C1EA 3DUZA 2M00A 4Q5VA 4ZKCB 4NKLA 2K7VA 1GUNA 2A6HD 1LTBD 3M4OB 5CBEE 1GJXA 4C2MB 1QG7A 1V1PB 1EEFD 2B2TC 5G3LF 3PO2B 5K36H 1DCZA 1LT3D 3P1HA 2IX3A 4BBSB 5I9PA 4OL7A 5TSSA 1X3QA 3HOYB 1BNZA 1K83B 3HOWB 4ZLTF 1WD1A 4IALA 3AU7A 1PZID 1WTWA 2NBFA 5HURA 1HTLD 1VDZA 5I2XA 4GZYC 3I73A 4FXDA 2FFKB 1PTOB 1SE4A 4DK0A 1BXTA 5E1FA 3R93A 4CBVA 3NQTA 1BCPD 4BY1B 3TP5A 4DF7A 3T51B 4EQNA 2YU9B 1D6EC 3D6CA 3I72A 2MPMA 1EZ8A 3SVMA 1TQOA 2KOLA 4RKLA 2EYMA 2KQ3A 3BZDB 3O13A 1JQYD 3EA6A 2G9DA 3KK7A 4DN4M 2LS01 2K05A 2JA5B 3A8KE 3M85A 2ICEC 5I9OA 1JWSD 1I4XA 1Z7TA 2XN9C 2KA7A 3VYTA 2IPKD 2ZT9C 1FYCA 3TSSA 3DHQA 1D2BA 1JICA 2B2YA 4DAYA 1G2SA 2Z4HA 2AQ2B 3KBGA 4FF2A 3E5SA 1AFPA 2MJ8A 2WIIB 1KTKA 2XVSA 1AZPA 1TWCB 1FR3A 5C4HA 3NSWA 2F3VA 4XQNA 1GOZA 4ILWA 1AW7A 4A3JB 3MXPA 1PFMA 1PRTF 4J1MA 1GUGA 3QG1A 1I50B 1EY4A 4CJ0B 2A69C 1Y1WB 2FINB 4NW2A 5IT9E 2IJ0A 4S3SA 3E0JA 2JYOA 3H3VC 1Y69U 2SOBA 4CKCA 1SE2A 4C3HB 5IIFA 4PNYA 1Q3LA 4FNFA 1RCVD 2X6GA 3GQBA 5C4XB 1GXDC 4A93B 1IKMA 1PDQA 3R8BA 1RJTA 1V1PA 4Y7NB 1QWYA 4RFBA 3OIPA 4H0LC 1Q12A 2B39A 3D4RA 2OF1A 4IFDH 2K04A 4DXFA 4DXGA 5CV7A 1F2ZA 1DZ1A 1F2LA 3L9AX 3Q6SA 1H9JA 3PMFA 1KNEA 4R8NA 4ZAIA 3TP6A 2PPBC 2NVXB 4KV6A 3KLSA 1QCBD 1EIHA 2O4XA 5CV5A 1X3PA 1Q8IA 4KMUC 1KLUD 3MWYW 3H09A 3EVQA 2EYFA 4TSSA 1SAPA 1JB3A 1ILQA 4KHZA 2BDNA 1MD2D 1TIID 2IT1A 1WTVA 3I4MB 1ICWA 3Q0AA 4RGTA 1I3QB 4JK1C 1DM0B 2KUMA 1ZYRD 4BY7B 2K28A 2EJGC 1V43A 2EE1A 1SFOB 4F7XA 1TS3A 4EVOA 1NSNS 2NZ1D 1RODA 1X32A 1I6VC 1HFNA 3VA5A 3E6ZX 4N9PA 5IGDA 2F3WA 5KNBA 2RSNA 3MC0B 3OHXC 2K03A 3PUWA 5NUCA 1OXUA 4PMBA 2LY7A 4OIKA 3T16A 2EVBA 4U673 4TKOB 2A73B 3P7JA 2SNSA 1CHQD 3FDTA 2NVTB 4OO1I 3V05A 4ME5A 2EDGA 1SE3A 1BCPF 2NN6G 2NUCA 1VMCA 2MP1A 3NE5B 5CV9A 4IUUA 2MHVA 1D5XC 1DOKA 2QEJC 1VCIA 3HEJA 4A3KB 3W2DA 3TMEA 5EPLA 5CV8A 4XQQA 4XQJA 3PUZA 3A7AB 1STYA 3SE0A 3R2TA 4G57A 3RUZA 2R61A 2VUMB 1V1OA 3OIQA 1E2ZA 3S14B 3K57A 4C3IG 4CJ2C 1FGBD 2EYOA 4ZUJA 2L12A 2C9OA 1ENCA 2EYJA 1BO0A 3M3YB 5C3XA 1TY0A 1EQVA 1ML0D 4L6TB 2B2VA 2DN8A 3PUYA 4M8AA 1STGA 4WRDA 3KF8A 2ZXRA 5KIXA 3JAML 3AMUA 1JCKB 2M2LA 3NBHA 1U9RA 2EY1A 4ZUIA 4KD3A 4BS9A 4KY5A 2I07B 4U68A 1I4RA 3Q24A 4F8MA 1QNUA 1II3A 5M5YB 2DY7A 2QDBA 4XT1B 3I90A 5C6AA 1EFID 1S5FD 2C5CA 4P2CB 3OMGA 4A3GB 4HMJA 3MA2B 1ILPA 2PQEA 3N52A 1C48A 2AQ1B 4FF4A 2PW5A 2VNUD 1NR4A 3QB3A 5EGTA 1A2TA 2K32A 2L4NA 4RCNA 4FP5D 3CQZB 1CZGA 4FXGC 4IUVA 3IKJA 5IGFA 4H7BA 4RWSC 1E2VA 2F0UA 1BR9A 4QUCA 4M1UB 1YNND 4K5XA 3NP8A 3NBIA 2KEEA 2EZVA 2NWGA 5IT9L 3GTJB 3D31A 1SYFA 2RDFA 1B50A 4NMZA 5J1ZA 4HMIA 1BDOA 2SNMA 2VB3X 1SNMA 1IYUA 3DWQA 3I4LA 4NP5A 1ESFA 2E76C 1CA5A 1ZYRC 1TS5A 2KECA 1LABA 4KN7C 3SXHA 4CKEA 5C5LA 2F0WA 3M7GA 5ISRA 2A69D 1PFNA 2B2WA 3HZXA 2BDOA 1LO5D 2K1BA 2K5DA 5C3EB 4N9TA 5IGCA 5M3FB 4AYBB 4J6HA 2ENBA 2CQAA 4H44C 5CBAE 3I4NB 2K5QA 4C3JB 5FO7B 3S15B 3S9WA 1R4PB 2OXPA 3NTIA 5BN3A 3HOZB 2PCFB 3KLRA 4DNTB 5KEEA 1H9SB 5M3MB 2NN6H 1DD2A 3BDOA 4L63B 2JEAI 4JBWA 1JE4A 5EKKA 1SNPA 2F0TA 1TWHB 1GUSA 1H9KA 4A3MB 1D1IA 5EBCA 1IKLA 1PRTB 4HN7A 2RQXA 4ZYSA 1HRJA 1SYDA 3TP7A 2WINB 2J4XA 1JWMD 1D1KA 3CKIB 2L1BA 3GV3A 3GP7A 1BOSA 5CR3A 3HOXB 1CK1A 2DNEA 4X3TA 3CU7A 1DOMA 1A3UA 4KK7A 3OWEB 5I4DA 2JXMB 5JEAG 5JOBA 1SNDA 4QB4A 2F0NA 1TWFB 1F9QA 1RF2D 4XYQA 1TWAB 1WTRA 1GUTA 1LV9A 1GHKA 5JAVA 4A3IB 3KLSX 4B9XA 2L55A 1A3VA 2A6ED 2Q8IB 4FVMA 5ELDA 4QF4A 5FKAC 1ET9A 3BDCA 2R3ZA 3S1QB 5C0XJ 4DU9A 1LT4D 2WV6D 3RMHA 1R4QB 2EJMA 1LACA 2R7ZB 3BVZA 3JAME 3HG9A 1PZKD 2IW3A 1B9MA 1UAPA 4K6LA 4LK1C 5ELFA 3S2HB 3X3NA 3GTQB 1S5CD 2BCOA 5FOBB 1LLRD 5BN5A 2F0DA 3GTPB 3K0YA 3NTHA 1F9SA 1Y8OB 4KJOA 3VYSA 4EQOA 1PTOH 1T5XD 1YNNC 2RVLA 2YYZA 2ZXOA 5EQ0A 5F2DA 2F0SA 4IFDI 1AP0A 1GUWA 5C4JB 2ZXPA 1RTOA 1XXGA 3AB9A 1HA6A 3J81L 4FF1A 1AN8A 4CJ1B 1G8ZD 4DFAA 5IGGA 4PMCA 2NTTA 2KHSA 4CKBA 3OSOA 4R8IA 5J22A 1LTSD 4UDUC 1D5ZC 2Z4IA 1VMPA 3MXNA 2D5DA 2F0MA 4YIJA 2IL8A 1K8MA 3QOJA 1IW7C 1PTOC 3T13A 4EQPA 3BDLA 2PZWA 1WTPA 1HXYD 1BCPB 3K5OA 2CVRA 1A6XA 2L11A 5JVG3 3W3AA 4NDXA 5FO8B 1M4VA 4XIGS 2D62A 3RZDB 1EU4A 2D2CC 5IGEA 1F9PA 3MVVA 1Q1BA 4L8JA 3HKZB 2I46A 1OXXK 4QUFA 3DWPA 3OPOA 4IUQA 1VF5C 2QCPX 4FYDA 3EFXD 1SYBA 4X3SA 2A68C 1STAA 3T56B 4HR7B 4J8QA 3V2TA 4KN4C 5COYA 2CW0C 2XWJB 5C0XG 1U4MA 3GTGB 3BG3A 1HUNA 5ELCA 2NTSA 2VB2X 3EQLC 1PFBA 3ND9A 3S1MB 5C4ZA 3S17B 3PUVA 2EY5A 2NYZD 1V8QA 1DXMA 3V96A 1O80A 4BBRB 1SEBD 1L0XB 4KKTA 1CTMA 5K5PA 1CA6A 1KDAA 4ZRZA 4TRDA 2IX0A 1S5BD 2IX1A 3SR1A 2R93B 5JEAH 4RHRA 2R6GA 2B2UA 1XX8A 1PLFA 3P75A 4FO2A 1EY9A 2WKDA 4MHEA 1SNOA 3FKIB 2A6EC 2JP1A 1NUCA 5AFWA 1O78A 1R9TB 4DGZA 1EOTA 2B8GA 1F2MA 1C4QA 4K2KA 2EY6A 1EY6A 3OW7A 3MEHA 4B08A 1LT6D 5C44B 2E2JB 1QILA 4WJWA 3T53B 1SMYD 1H9RA 3LWEA 2N55A 1MI2A 4K8IA 4OHJA 3MXUA 3NQIA 4IURA 5LL6S 5G3LD 2WP8J 4V190 2PNRC 4XYOA 5E4XA 1ENAA 1I6HB 3FPUB 2JA6B 1CT1D 2Q8TA 1TY2A 2F0IA 3URYA 5M5XB 3SK5A 1TT2A 3RZOB 1LTTD 4BA2I 4A3FB 1Z6HA 1EWHA 2F0KA 4DK1A 5EPJA 4RHSA 1JOQA 2PW7A 2RKSA 3S16B 1ET6A 5J39A 4KD4A 2BE5C 2J7ZA 5CORA 1HTPA 4PV1C 4RGOS 1MSHA 1S4ZA 1STNA 3J7YW 3N6RA 1KDCA 1ZEQX 2FHTA 2OEOA 2TSSA 3FRPB 1KLGD 3PV0A 4ZK9B 4K6DA 2N88A 4A3DB 4KKUA 3PIP3 4K5WA 2IWHA 4XT3B 3J81E 2EOTA 2F0VA 4B9WA 3H91A 1EYCA 1JOOA 1NR2A 2E2DC 2F1MA 4IUTA 3DEPA 4K14A 1EQTA 3NWTA 4IQZA 2QF7A 1F77A 1O7YA 4G7ZC 2Y0SB 3A56A 3IL8A 1DJRD 4I7ZC 5CMDA 2HCIA 3D4DA 4ULLA 1TKWB 1ENFA 1OXSC 3A7LA 5DAUA 2B2WC 1G291 1HQMC 1EWCA 1XTCD 5JPMC 3GTOB 2CHBD 3T4AC 3HOUB 5C0XH 1ZXTA 2BA0A 3LNNA 3VR4A 1CZWA 1QNKA 1PXUA 3A8JE 4H13C 4QMGA 2A74C 2NN6I 1EY5A 3M4YA 2G9HD 3DXJC 1RTNA 1CI3M 3LWUA 3SK8A 2RBMA 3KUPA 1LT5D 4HSVA 3S1NB 1LTGD 2OT2A 2HQEA 3WOFA 2AUJD 2NB0A 5DEHA 4KY6A 1IW7D 1PTOD 5D3IB 3CRKC 1EZ6A 1SSOA 1STBA 5IGBA 5A2QL 1L0YB 3G7LA 3U9SA 3L3OC 3FMCA 3J7AV 3J7AF 4HEDA 1ESRA 4RA8A 3R3OA 1B4OA 2K5WA 4IUPA 2M9VA 1YNJC 4R9WA 5C5MA 3TZUA 2BA1A 3U9OA 3EJIA 1GUOA 3ZYYX 1B3AA 2F0GA 5EBDA 1KNAA 1SMYC 2Z1CA 2B63B 4OIJA 5D3DA 1W6KA 2A68D 1OO9B 3MFGA 3NWSA 1JOKA 1CM9A 4G7HC 2KEDA 2CW0D 3VR6A 2MGSA 3VR5A 1VF7A 3HRZC 1WD0A 4C3HG 4E6IA 4KJNA 5LHY1 5DM63 2AQ3B 3BYTB 3MFYA 1WCMB 3A54A 3I3CA 3QOLA 4RH6A 1RD9D 3J80L 3HS0C 3OMCA 4F87A 4X3UA 5FK9C 2JA8B 4FF3A 1SNCA 5KYLA 3PUXA 1IL8A 2B2YC 1I4GA 3D3RA 4UAIA 1GHJA 1STHA 4LJZC 2PZUA 5I2YA 1TR5A 1HFGA 3TBIB 4RCOA 1F2YA 4XDXA 3GTLB 1SYGA 2Z8LA 1HPCA 3P20A 2PZTA 1A15A 4DAVA 3LX0A 1AEXA 3H0GB 3K7AB 4RGNA 1XWEA 2WKCA 2PO4A 2EYPA 2EYHA 5HGTA 4X3KA 5FLXL 4IN3A 5KNDA 3MHBA 1SJED 1STEA 2WAQB 2ID0A 1SXTA 2EXZA 4LAAA 1XYIA 1EYDA 4RAUC 1DYQA 1T5EA 5M5WB 2B2TA 3PO3B 1CFMA 4HSPA 1U4LA 2RA4A 4TQUS 1PYWD 3MAQA 5A35A 3GTMB 2F0PA 5KYIA 1HA5A 3TP8A 5M9OA 3S2DB 3FPPA 3A8IE 5EPKA 2L5TA 1LTAD 1UUPA 1PRTC 3C3LA 1A3TA 2XRSD 5KGUA 2LKVA 4DNRB 1HCZA 1KDBA 4HAEA 1BQQT 3NK9A 1TWGB 1G2TA 2XIWA 2MUYA 4KTAA 1K8OA 2K6AA 2JSOA 3H6MA 2BE5D 5ELEA 2HDMA 2JEBI 4HCSA 4KHVA 3UI2A 1E2WA 1BBXC 3QO2A 4HTHA 1I4QA 2GA4B 1FNVA 1EL0A 4DAPA 4WFN3 4DA2A 1H9SA 4OO1G 1CHPD 5I6YA 2EYLA 2XWBB 1WTQA 1SBBB 1B9NA 3DMUA 3ERQA 1PMRA 2FJ2A 3K58A 1D5MC 3OWFA 2L0CA 5DM73 1B2TA 3IFDA 3K5LA 1QJOA 1QOHA 1H9MA 1IHZA 4K2LA 1G91A 4Q0FA 1PTOF 1C8CA 1MBYA 2NVYB 2FMMA 3MTSA 4A3EB 2XNAC 4ID6A 5A2QE 2KVMA 2B2UC 2EJFC 2Q8RE 3D4WA 4O1NA 3FVQA 1DOLA 1UEAB 2X6LA 1A2UA 3QIAA 2H1EA 2O5JC 4IUNA 1FNUA 2QILA 5EKLA 2RDGA 3GO5A 3K5MA 2A6HC 2X69A 1JWUD 4BA1I 1LTRD 1SYEA 3GD7A 3SEBA 3D6WA 2A5HA 1EY7A 5C3WA 1SJHD 1Y8PB 2ICIA 2E75C 1JORA 2JA7B 2F0HA 3D8GA 3KBXA 2TMPA 5FO9B 3TDQA 4O42A 3I70A 5D14A 2R92B 1EY8A 5CGKA 4XTCS 1EY0A 5JVH3 2PYKA 5LL6X 2NVQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0D A;  1SYB A;  2O4X A;  5CV5 A;  3MEH A;  3E5S A;  5CV8 A;  3R3O A;  2EYP A;  1STA A;  2EYH A;  3P1H A;  5HGT A;  5IGF A;  3EVQ A;  5KRU A;  4H7B A;  3DMU A;  5EKK A;  1SNQ A;  1SNP A;  1STY A;  2EYF A;  2F0O A;  5I9P A;  4OL7 A;  2F0U A;  2F0T A;  4KJO A;  3V2T A;  3ERQ A;  5C5M A;  4EQO A;  2EY2 A;  3U9O A;  5C4H A;  3EJI A;  2F3V A;  3D4D A;  3MHB A;  3NP8 A;  4G57 A;  4K5X A;  3RUZ A;  2F0G A;  2EXZ A;  3ERO A;  4K8J A;  3OWF A;  4K8I A;  4LAA A;  3MXP A;  4IAL A;  5KEE A;  1SYD A;  3TP7 A;  1SYF A;  5CV4 A;  2RDF A;  1EYD A;  4J1M A;  5HUR A;  4NMZ A;  5J1Z A;  5DAU A;  5J22 A;  1IHZ A;  2EYO A;  4HMI A;  1EY4 A;  4K2L A;  5E3F A;  3MZ5 A;  2SNM A;  5E1F A;  5F2D A;  2F0S A;  1SNM A;  4ZUJ A;  3NQT A;  1ENA A;  1JOK A;  1ENC A;  2EYJ A;  5CR3 A;  3NHH A;  5C4Z A;  3TP5 A;  4NP5 A;  2EY5 A;  4DF7 A;  4S3S A;  5C3X A;  4EQN A;  1A3U A;  2F0I A;  4ID6 A;  3SK5 A;  4DFA A;  4F7X A;  5IGG A;  1EQV A;  4EVO A;  1NSN S;  5I6W A;  1TT2 A;  4PMC A;  3D6C A;  2F0P A;  3SXH A;  5C5L A;  5KYI A;  1STG A;  2KHS A;  3SHL A;  3TP8 A;  4WRD A;  5CC4 A;  5KIX A;  2EYL A;  3D4W A;  5JOB A;  2SOB A;  5M9O A;  1EZ8 A;  1SND A;  2F0W A;  3OSO A;  4QB4 A;  3VA5 A;  4E6I A;  4KJN A;  3C1F A;  2F0K A;  1SYC A;  1TQO A;  2F0N A;  2F0Q A;  4I65 A;  4N9P A;  4RKL A;  5IGD A;  2F3W A;  4PNY A;  5IIF A;  2EYM A;  5ISR A;  1JOQ A;  2PW7 A;  2RKS A;  4ZQ3 A;  2KQ3 A;  1A2U A;  4ODG A;  4QMG A;  5K5P A;  5NUC A;  1U9R A;  4K5V A;  2F0L A;  1KDA A;  5J39 A;  2EY1 A;  5IOC A;  4KD4 A;  3SK6 A;  3HZX A;  4PMB A;  4KY7 A;  1EY5 A;  4ZUI A;  4IUN A;  5JAV A;  1A3T A;  2F0M A;  4KD3 A;  4TRD A;  1STN A;  3T16 A;  5KGU A;  2LKV A;  1KDC A;  3QOL A;  4B9X A;  4KY5 A;  4YIJ A;  5EKL A;  1KAB A;  3QOJ A;  3SK4 A;  2OEO A;  2RBM A;  4WOR A;  3SK8 A;  4F8M A;  1A3V A;  1II3 A;  5I9O A;  5CV6 A;  3SR1 A;  4IZ8 A;  1SYE A;  2SNS A;  1KDB A;  3OMC A;  3NK9 A;  4N9T A;  5IGC A;  4K6D A;  3T13 A;  4EQP A;  2HQE A;  2QDB A;  3BDL A;  4QF4 A;  1EY7 A;  3NXW A;  2F0F A;  3P75 A;  4KTA A;  1KAA A;  2PZW A;  5C3W A;  2OF1 A;  5C6A A;  3H6M A;  3BDC A;  1EY9 A;  1JOR A;  3C1E A;  1SNO A;  1SNC A;  2M00 A;  4J6H A;  2F0H A;  4K5W A;  2ENB A;  3D8G A;  4ME5 A;  4NKL A;  5KYL A;  1NUC A;  3OMG A;  4DU9 A;  4KHV A;  5DEH A;  5CV7 A;  2F0V A;  3NUC A;  1F2Z A;  2NUC A;  4KY6 A;  4B9W A;  3DHQ A;  4HMJ A;  5IOD A;  4DGZ A;  1EYC A;  4NDX A;  1RKN A;  1STH A;  2PZU A;  4RKB A;  2PQE A;  1JOO A;  5CV9 A;  1EY8 A;  5CGK A;  1F2M A;  1TR5 A;  4HTH A;  2OXP A;  3S9W A;  1F2Y A;  1EZ6 A;  3PMF A;  1SYG A;  2F0J A;  4K2K A;  5IGE A;  1STB A;  1EY0 A;  2PW5 A;  3ITP A;  4R8N A;  3MVV A;  3TP6 A;  2EY6 A;  1EYA A;  2PZT A;  3QB3 A;  4KV6 A;  5EGT A;  1A2T A;  2F0E A;  2PYK A;  3HEJ A;  5IGB A;  2WAC A;  3LX0 A;  4K14 A;  4MIU A;  1AEX A;  5I6Y A;  3TME A;  1EY6 A; 
#chains in the Genus database with same CATH topology
 2DY8 A;  1TS2 A;  1HQR D;  2H4O A;  2AWN A;  1XNR L;  2K33 A;  1QB5 D;  3CHB D;  4EGV A;  2Q2T A;  3OTO L;  2R7F A;  4CHT B;  1SNQ A;  3J80 E;  3GTG H;  4NB3 A;  1G6P A;  3ONA B;  4C1N K;  2NVX H;  2KCN A;  3C46 A;  1FNW A;  3L7Z C;  2E2H B;  2JE6 I;  1BCP C;  4G4K A;  3ERO A;  4K8J A;  5EJW A;  3TN2 A;  1S5D D;  1X3F A;  5T1G A;  2UUB Q;  1O7Z A;  1Z47 A;  3F1Z A;  2F4V Q;  1P8L A;  3VYR A;  3B6Y A;  3S17 H;  3CF5 A;  2L9H A;  4JI5 Q;  1EIG A;  5T1I A;  4GKJ L;  1YNJ D;  1NMF A;  2HUG A;  3M7N A;  2FMC A;  4QIW B;  4EX5 A;  1TVX A;  1VQ9 A;  4DV4 Q;  4RGM A;  3I4M H;  2D0P A;  4BBR H;  2B2V C;  2J0T D;  1QVC A;  4ABN A;  3RLF A;  4KI0 A;  1I3Q H;  3G6J B;  2K01 A;  1L0W A;  2RCN A;  2WB1 B;  1OXV A;  1WTH A;  1E22 A;  2QGQ A;  4Z9C B;  4OEL B;  1IYV A;  1CKO A;  2F0Q A;  1SYC A;  2KBN A;  3U4V A;  4JI3 L;  5FLX E;  1YI2 A;  4QCL A;  2HD3 A;  3BVM A;  4NPS A;  4ODG A;  1SFO H;  1PV4 A;  5IOC A;  1BUV T;  4KY7 A;  1TU2 B;  3CAM A;  5JJZ A;  4GOP C;  5C3E G;  2CFM A;  3CRL C;  4KKS A;  3VYU A;  4DV2 L;  4DR7 Q;  1UNS A;  1F9R A;  1QE6 A;  4IZ8 A;  1UWV A;  5M3F G;  2XRQ D;  5D65 A;  3M9B A;  4AYB G;  4DR3 L;  3K0X A;  2PMZ B;  1WTO A;  3NXW A;  3OOC A;  3QWN A;  1MIU A;  5JPN C;  2XSC A;  1EUJ A;  4V0B A;  3MXG A;  1AZQ A;  3IFT A;  3I4N G;  1N36 Q;  5K36 G;  1HHV A;  3NUC A;  4C3J G;  5IOD A;  3CCR A;  3WDN A;  1RKN A;  1Y8N B;  1ZKO A;  2EPB A;  4RKB A;  5CYU A;  3KYH C;  1NY4 A;  3K5N A;  3TZD A;  3T1Y L;  2JN4 A;  4QY7 A;  2K14 A;  2V4D A;  1EYA A;  5KNC A;  1TS4 A;  5C0X I;  1CQV A;  2AUK A;  2F0E A;  4MN3 A;  5M3M G;  4DR1 Q;  2WAC A;  1JR0 D;  4GS3 A;  2RSO A;  3J81 c;  4CGY B;  3CCS A;  5ELB A;  2LSS A;  1WYD A;  3HOV B;  2QKI C;  3C2P A;  1LTI D;  1KL9 A;  1GO3 E;  1PZJ D;  3QJY A;  5KRU A;  1WVL A;  2F0O A;  4NXN L;  1B53 A;  2B29 A;  4R4O A;  5JJI A;  4A3M G;  1G6Z A;  2G5D A;  2EY2 A;  4IFD J;  2B8F A;  2LFN A;  1NCV A;  1SDF A;  2HDL A;  1VQG A;  1M8A A;  3DM1 A;  1K3B C;  1J8I A;  4OO1 H;  4GKK Q;  3BYY B;  4B3S Q;  5CV4 A;  5GAD C;  3A55 A;  5E3F A;  3J81 j;  1I4P A;  2F4I A;  4JBM A;  1EEI D;  3RZO H;  4DR6 L;  3PIO 3;  2KJX A;  2VUM H;  3D0F A;  1U4P A;  3K59 A;  3KJP A;  3S14 H;  2VXW A;  4ZKB B;  2QEX A;  1NAP A;  1Y1V B;  3X3M A;  3ND8 A;  4JPB W;  1S5E D;  3SHL A;  3S16 H;  3VR2 A;  2WAQ E;  4F88 A;  3OW2 A;  3C1F A;  4I65 A;  3HGB A;  4PMW A;  3Q8D A;  2BOS A;  1BKB A;  3F2U A;  4ZQ3 A;  1FD7 D;  1DGS A;  2ZJR A;  3JAM i;  1ONL A;  2DNC A;  3TQY A;  1X56 A;  4A3I G;  1OXT A;  2F0L A;  3SDZ A;  3J7A 5;  3VR3 A;  1J9O A;  3I91 A;  4JI1 L;  3FEW X;  2SDF A;  4PQX A;  4LMQ D;  2E74 C;  4GN5 A;  1KAB A;  1EU3 A;  1JC7 A;  4WOR A;  1MSG A;  1IBK L;  4A3D H;  2UXD L;  1B44 D;  3H0G G;  5J3B A;  2O2L D;  2D9U A;  1W3S A;  2HCC A;  1JB7 A;  1DON A;  2R7D A;  4IPH A;  1KAA A;  1X55 A;  2E5L Q;  1PRT D;  1W6J A;  5DNF A;  5BN4 A;  4N8X 1;  4LFA L;  5JEA J;  2R7Z G;  2PI2 A;  3NTK A;  4DKA C;  4LF4 Q;  5M5Y H;  1MJC A;  4HCE A;  3BVG A;  2LXJ A;  5E4W C;  3M4Q A;  2F0J A;  2VQE L;  3ITP A;  2K75 A;  3I8Z A;  4A3G H;  2K5H A;  4MIU A;  2RDH A;  1PYB A;  1L2F A;  1RDP D;  2WFW A;  3DM3 A;  3HP3 A;  4OGQ C;  3S1R B;  4IOA A;  3ERS X;  1CQF A;  4DR5 L;  4G7O C;  1AE3 A;  3G6E A;  1MGS A;  2O5I C;  3NPP A;  3GTK B;  1VQD A;  3ULJ A;  3K6O A;  4UP9 A;  4XXE A;  5EKI A;  1WTX A;  4DAY B;  1IXR A;  1O7L A;  3CQZ H;  2LMC B;  3UE0 A;  5BR8 L;  1XMO L;  1U4R A;  2HQL A;  1B1Z A;  3JC6 6;  2DJF C;  3H94 A;  3DEO A;  2RCF A;  3IAY A;  2VQF Q;  3MZ5 A;  4BWG B;  4JI8 L;  4LF5 Q;  4HID A;  2SEB D;  2F03 A;  3NHH A;  1MKH A;  1LTL A;  1N9W A;  1E0B A;  2KCC A;  1YHB A;  3GTJ H;  3DWA A;  5I6W A;  3F2B A;  2PQA B;  3GV6 A;  1BF4 A;  5CC4 A;  4C56 C;  2E2I B;  3BS1 A;  1VQ6 A;  4A3B B;  4OX9 Q;  1PH7 A;  4L5R C;  1HUM A;  1HZ9 A;  3RD4 A;  4IFD G;  1W2B A;  4K5V A;  4C3I B;  1IBM Q;  3SK6 A;  3S1N H;  3Q23 A;  2MO0 A;  1PH4 A;  4X66 L;  4A4I A;  4UP7 A;  4GNX B;  1I4H A;  2UXC Q;  3R2I A;  3SK4 A;  3VA7 A;  1Q1E A;  5CV6 A;  3Q22 A;  4FXK C;  4C1N I;  2AWO A;  3WOE A;  1I94 Q;  1Q90 A;  4JI4 L;  2F0F A;  1RHP A;  1K8A C;  4DV5 L;  3C1E A;  3DUZ A;  2M00 A;  4Q5V A;  4ZKC B;  3CC7 A;  4NKL A;  4IPC A;  2K7V A;  1IBL L;  1GUN A;  2A6H D;  4LF7 L;  1K8G A;  1LTB D;  3M4O B;  5CBE E;  2ZJP A;  1Q81 C;  3HKZ G;  1QVG A;  1GJX A;  2A19 A;  4C2M B;  5M3F H;  1GD7 A;  1QG7 A;  5LMU L;  1V1P B;  2F3I A;  2I5M X;  1EEF D;  2B2T C;  5G3L F;  3PO2 B;  3I4N H;  1YVC A;  5K36 H;  1DCZ A;  4C3J H;  1OTC A;  3S15 H;  1LT3 D;  4JOI A;  1XTD A;  3P1H A;  2IX3 A;  4BBS B;  1E1T A;  5I9P A;  4OL7 A;  5TSS A;  1X3Q A;  3HOY B;  1BNZ A;  4IJL A;  1J6Q A;  1K83 B;  3AFQ A;  5M3M H;  3HOW B;  4ZLT F;  1WD1 A;  4IAL A;  2YTX A;  3AU7 A;  1PZI D;  4YWM A;  1WTW A;  2NBF A;  1HTL D;  1VDZ A;  2LXK A;  3E9I A;  5HUR A;  3I73 A;  5I2X A;  4FXD A;  2FFK B;  4OEM B;  4GZY C;  4DR4 L;  1PTO B;  1SE4 A;  4CDE C;  1TWH H;  1BXT A;  5E1F A;  4DK0 A;  4DPG A;  3R93 A;  4CBV A;  3NQT A;  2JK8 A;  3EN2 A;  1BCP D;  1PH3 A;  4A3M H;  3JAM c;  4BY1 B;  3TP5 A;  4DF7 A;  4AQY Q;  3T51 B;  4EQN A;  1VQO A;  2YU9 B;  1D6E C;  4DV7 L;  3D6C A;  3PSI A;  3I72 A;  2ALY B;  2MPM A;  1EZ8 A;  1SE8 A;  3SVM A;  1WCM H;  1TQO A;  2KOL A;  4RKL A;  2EYM A;  2KQ3 A;  4OWX B;  3BZD B;  3O13 A;  1JQY D;  3EA6 A;  2G9D A;  3KK7 A;  2HHH Q;  4DN4 M;  1EQQ A;  1M1K C;  2R93 G;  2LS0 1;  4LF6 L;  2K05 A;  2JA5 B;  2JA8 H;  3A8K E;  2OTL A;  4QIW E;  3M85 A;  3CCE A;  2ICE C;  5I9O A;  1JWS D;  4B3M L;  4QL5 A;  1I4X A;  1Z7T A;  4EQ5 A;  2XN9 C;  1KRS A;  2GVA A;  3FKI G;  1L1O C;  2KA7 A;  3VYT A;  2IPK D;  4K0K Q;  4A76 A;  2WB1 E;  1KAW A;  2ZT9 C;  4A3I H;  1FYC A;  3TSS A;  2OQK A;  3DHQ A;  1D2B A;  4DUY L;  3FP9 A;  1JIC A;  2B2Y A;  4DAY A;  1E7Z A;  3H0G H;  4JV5 L;  3H3V H;  1KD1 C;  1N32 Q;  1B70 B;  1G2S A;  3S1Q H;  4JBJ A;  2Z4H A;  4X64 Q;  2AQ2 B;  5C44 G;  1QUQ B;  3VDY A;  3KBG A;  2PMZ E;  4FF2 A;  1ICF B;  2R7Z H;  3E5S A;  3LGJ A;  5GQO A;  4HJ8 A;  3KFU A;  1AFP A;  2MJ8 A;  2WII B;  1KTK A;  2XVS A;  1AZP A;  3S2H H;  1PYS B;  1SLJ A;  1TWC B;  2PQA A;  2Z6K C;  3GTQ H;  4LF8 Q;  4LFB L;  1FR3 A;  2VL6 A;  5C4H A;  3NSW A;  2F3V A;  4XQN A;  1GOZ A;  1HZB A;  4ILW A;  1AW7 A;  3PO3 H;  4QQB X;  4A3J B;  3GTP H;  3MXP A;  1PFM A;  1PRT F;  4J1M A;  1GUG A;  3K81 C;  1A63 A;  3QG1 A;  1I50 B;  2CWP A;  1CKM A;  1EY4 A;  2JA6 G;  3KF6 B;  4CJ0 B;  4DK3 C;  4GNX A;  3AFP A;  2A69 C;  1Y1W B;  2FIN B;  4NW2 A;  5IT9 E;  3S2D H;  2IJ0 A;  4S3S A;  3E0J A;  4A3F G;  2JYO A;  3H3V C;  4DUZ Q;  3CCQ A;  1Y69 U;  5AJ3 L;  3J81 i;  4NXM L;  2SOB A;  4CKC A;  1SE2 A;  5C4J H;  4C3H B;  5IIF A;  4PNY A;  1Q3L A;  4FNF A;  1RCV D;  2X6G A;  3GQB A;  4BXX G;  5C4X B;  4P71 A;  1GXD C;  4A93 B;  1NE3 A;  2FXQ A;  2UUC L;  1IKM A;  1C9O A;  1TWG H;  1PDQ A;  3W1B A;  3R8B A;  1RJT A;  1V1P A;  4Y7N B;  1QWY A;  1NJI C;  4RFB A;  3OIP A;  4H0L C;  1Q12 A;  3W1G A;  2B39 A;  2K50 A;  3D4R A;  2OF1 A;  3BZK A;  2YTY A;  3KF8 B;  1XJV A;  4IFD H;  3TEH B;  2K04 A;  4DXF A;  4DXG A;  5CV7 A;  1F2Z A;  1DZ1 A;  1F2L A;  3L9A X;  1VQK A;  1E24 A;  3Q6S A;  3NBH B;  3GDE A;  1H9J A;  4YHH L;  3PMF A;  1KNE A;  4POF A;  4R8N A;  4DV3 L;  4ZAI A;  3TP6 A;  2PPB C;  2I5H A;  2NVX B;  4LWC A;  4KV6 A;  4KHP Q;  1H95 A;  1EQR A;  3KLS A;  4JI2 L;  2HT1 A;  1QCB D;  1EIH A;  2O4X A;  5CV5 A;  1X3P A;  1Q8I A;  1PFS A;  4KMU C;  1KLU D;  2Y0S G;  3MWY W;  2Q2I A;  1VQF A;  3H09 A;  3RZD H;  5ELN A;  3EVQ A;  2EYF A;  4TSS A;  1EYG A;  1SAP A;  2ATW A;  1JB3 A;  1YJN A;  1ILQ A;  4KHZ A;  2BDN A;  4JI0 L;  1Y14 B;  3L0O A;  2KCM A;  1MD2 D;  1TII D;  2IT1 A;  1WTV A;  2JJQ A;  3I4M B;  1ICW A;  3Q0A A;  4RGT A;  1I3Q B;  4JK1 C;  1DM0 B;  2KUM A;  3J80 c;  1ZYR D;  5FJ8 G;  4RG1 A;  4BY7 B;  4HIK A;  2F4V L;  3NEN A;  2K28 A;  4JI5 L;  3HOU G;  2EJG C;  4R4Q A;  1V43 A;  2EE1 A;  1SFO B;  4F7X A;  1TS3 A;  4EVO A;  1NSN S;  3CCJ A;  2NZ1 D;  1ROD A;  2UU9 Q;  1X32 A;  4DV4 L;  1A0I A;  1I6V C;  3KDF B;  1YHA A;  1HNW Q;  1HFN A;  3VA5 A;  3RN5 A;  3S1M H;  3E6Z X;  4N9P A;  3CC4 A;  3PIO A;  1Z9F A;  4LFC Q;  5IGD A;  2F3W A;  5KNB A;  3F2C A;  2RSN A;  3MC0 B;  3OHX C;  1XPO A;  2K03 A;  3PUW A;  5NUC A;  1OXU A;  1JT8 A;  4PMB A;  2LY7 A;  4OIK A;  3T16 A;  2EVB A;  4A3L G;  1Q82 C;  4U67 3;  2F52 A;  4TKO B;  2A73 B;  1VQA A;  3P7J A;  2SNS A;  1QUQ A;  2VW9 A;  1CHQ D;  4GLA C;  5FLX c;  3A5U A;  1UE5 A;  3FDT A;  2NVT B;  4DR7 L;  4OO1 I;  3V05 A;  4ME5 A;  3KJO A;  2EDG A;  1U0L A;  5IWA Q;  1SE3 A;  1BCP F;  2NN6 G;  4AYB E;  2NUC A;  1VMC A;  3K7U C;  4P74 A;  2R93 H;  4OWW B;  4LF9 Q;  2MP1 A;  3NE5 B;  5CV9 A;  2EIF A;  4LUZ A;  1N36 L;  4IUU A;  2MHV A;  1D5X C;  3CCL A;  1DOK A;  3FKI H;  2QEJ C;  1VCI A;  3HEJ A;  4A3K B;  1UEB A;  1QZH A;  3KF6 A;  4ZCK A;  3W2D A;  1R9T H;  3TME A;  5FLM G;  2GVB A;  4B3R Q;  5EPL A;  4YCV A;  5CV8 A;  5DLQ E;  4XQQ A;  4XQJ A;  3PUZ A;  3A7A B;  1STY A;  5IP7 H;  3SE0 A;  3R2T A;  4G57 A;  1WOC A;  3RUZ A;  2B63 G;  2R61 A;  2VUM B;  4JG2 A;  1V1O A;  1KRT A;  3OIQ A;  1E2Z A;  2VY3 A;  5C44 H;  2E2J H;  3S14 B;  3K57 A;  1Q86 C;  3M4P A;  4C3I G;  4CJ2 C;  1LUZ A;  1K0S A;  1FGB D;  2EYO A;  5IYD H;  4GKK L;  4ZUJ A;  2L12 A;  2C9O A;  1ENC A;  2EYJ A;  2DJG C;  1BO0 A;  4HJA A;  3M3Y B;  5C3X A;  1TY0 A;  1EQV A;  1ML0 D;  3I2Z A;  4L6T B;  1BBU A;  2B2V A;  2DN8 A;  3PUY A;  4M8A A;  1STG A;  1RL2 A;  4WRD A;  3KF8 A;  2ZXR A;  5KIX A;  3JAM L;  3EIV A;  3AMU A;  1UE6 A;  1JCK B;  1I6H H;  1N33 Q;  2JA6 H;  2M2L A;  4DV1 Q;  2IHE A;  1C7Y A;  1WCM G;  4JW0 A;  3NBH A;  5GAH C;  1U9R A;  5M5X H;  2K5N A;  2EY1 A;  1I5F A;  3T1Y Q;  3KLW A;  4ZUI A;  1YZ6 A;  4A3F H;  4KD3 A;  1N34 L;  4BS9 A;  4KY5 A;  2I07 B;  4U68 A;  5E7N A;  1I4R A;  3Q24 A;  4F8M A;  1QNU A;  1II3 A;  1LYL A;  2JA8 G;  5M5Y B;  2DY7 A;  2QDB A;  4XT1 B;  3I90 A;  5C6A A;  1EFI D;  4NXN Q;  1S5F D;  4BXX H;  2C5C A;  2RHQ B;  3E3X A;  4P2C B;  3OMG A;  4A3G B;  4YCU A;  4HMJ A;  2E5L L;  3MA2 B;  1PH1 A;  1ILP A;  2PQE A;  3N52 A;  1C48 A;  4JI6 Q;  1U5K A;  3HOW G;  2AQ1 B;  4FF4 A;  4YWK A;  2PW5 A;  2VNU D;  4DV6 Q;  4LF4 L;  1NR4 A;  3QB3 A;  5EGT A;  1A2T A;  2K32 A;  2L4N A;  2ZJQ A;  4RCN A;  4FP5 D;  3CQZ B;  4QJF A;  3ICE A;  1CZG A;  4MTK A;  4FXG C;  4IUV A;  3IKJ A;  5IGF A;  4H7B A;  4RWS C;  1E2V A;  2F0U A;  2WAQ G;  4R4T A;  1B7Y B;  3KDF A;  1BR9 A;  4QUC A;  4M1U B;  1YNN D;  4K5X A;  3NP8 A;  3NBI A;  2Z6B A;  2KEE A;  2EZV A;  2NWG A;  5IT9 L;  3PO3 G;  3GTJ B;  3D31 A;  1SYF A;  2RDF A;  1B50 A;  4NMZ A;  5J1Z A;  4HMI A;  1BDO A;  4P73 A;  2SNM A;  2VB3 X;  4UY8 C;  5ELO A;  1SNM A;  1B3Q A;  1Y1V H;  1IYU A;  3PQI A;  3DWQ A;  3I4L A;  2VQF L;  4NP5 A;  2NZH A;  4IPG A;  1ESF A;  1JE5 A;  3UDX A;  2E76 C;  1NTG A;  1CA5 A;  1ZYR C;  1TS5 A;  4JYA L;  4MTN A;  1TXY A;  2KEC A;  1LAB A;  4KN7 C;  3SXH A;  4CKE A;  5C5L A;  4X62 L;  4HJ9 A;  1BBW A;  5LMN W;  1N8R C;  1K9M C;  5LMN L;  2JQO A;  2F0W A;  4UPA A;  3M7G A;  3SGI A;  5ISR A;  2VS1 A;  2A69 D;  3GTO H;  1PFN A;  5FJ8 H;  4N8F A;  1HR0 W;  4OX9 L;  2B2W A;  3HOU H;  3HZX A;  2BDO A;  1XMQ L;  1HR0 L;  1IYJ B;  1LO5 D;  1RIP A;  1IBM L;  1SRO A;  3U50 C;  2K1B A;  2K5D A;  1VQI A;  5C3E B;  4N9T A;  5IGC A;  3I4O A;  2UXC L;  3T1H Q;  1JMC A;  1K28 A;  5M3F B;  4AYB B;  5IY0 A;  1PHJ A;  4JOI C;  4KLK A;  3DLL A;  4J6H A;  2ENB A;  3HKS A;  2CQA A;  4H44 C;  3G71 A;  5CBA E;  4A3L H;  3I4N B;  1GKH A;  2K5Q A;  3UE1 A;  2EQS A;  3MXN B;  4P75 A;  5FO7 B;  4C3J B;  3S15 B;  3S9W A;  1R4P B;  2OXP A;  3NTI A;  1J5E L;  5BN3 A;  3HOZ B;  2HIX A;  1YBY A;  2PCF B;  3S1R H;  3UDG A;  3KLR A;  4DNT B;  5KEE A;  1H9S B;  5M3M B;  2V1C C;  5JJK A;  2NN6 H;  1DD2 A;  3GTK H;  3BDO A;  4L63 B;  2JEA I;  1JJG A;  5H1S E;  4JBW A;  1JE4 A;  5EKK A;  1SNP A;  2F0T A;  1TWH B;  1GUS A;  2PNH A;  4HJ7 A;  4DR2 L;  1V9P A;  2N3S A;  1H9K A;  4A3M B;  1D1I A;  5EBC A;  1IKL A;  1PRT B;  4HN7 A;  2RQX A;  4ZYS A;  1HRJ A;  1SYD A;  1JJ2 A;  3TP7 A;  2WIN B;  2J4X A;  1JWM D;  5FLM H;  1D1K A;  3CKI B;  3NEL A;  2E8G A;  4WJ4 A;  2L1B A;  1CSP A;  3GV3 A;  3EBE A;  3GP7 A;  4A3E G;  1BOS A;  5CR3 A;  1X9N A;  3HOX B;  1CK1 A;  1HZC A;  2DNE A;  4X3T A;  3CU7 A;  1DOM A;  2E2I H;  1A3U A;  5IYB G;  4KK7 A;  2B63 H;  3FHW A;  3OWE B;  5I4D A;  2JXM B;  4JC0 A;  4AQY L;  3WWV A;  2EXD A;  1PA6 A;  3CCV A;  4CDC C;  5JEA G;  5JOB A;  4C3I H;  1SND A;  4QB4 A;  2F0N A;  4R4C A;  1SN8 A;  1TWF B;  2HIV A;  1F9Q A;  1RF2 D;  4XYQ A;  1TWA B;  4L5S A;  1WTR A;  1GUT A;  1LV9 A;  4O0A A;  1GHK A;  4X65 Q;  1EWI A;  5JAV A;  1Q7Y C;  5HY6 A;  4A3I B;  3KLS X;  4QGU A;  4B9X A;  5IE8 A;  2L55 A;  1A3V A;  1EFW A;  4YCW A;  2A6E D;  3I7F A;  1ASZ A;  2Q8I B;  4FVM A;  3F2D A;  2UUA Q;  5ELD A;  2JA7 G;  4QF4 A;  5FKA C;  2OWO A;  1ET9 A;  1QZG A;  3CP0 A;  3BDC A;  3J80 i;  2R3Z A;  3S1Q B;  4APV A;  3U58 A;  1HNX Q;  2R92 G;  5C0X J;  4DU9 A;  1SMX A;  1LT4 D;  2WV6 D;  3RMH A;  2UXB Q;  1R4Q B;  2EJM A;  1LAC A;  2N49 A;  2R7Z B;  1Q46 A;  1FJG Q;  3BVZ A;  3JAM E;  3HG9 A;  1PZK D;  2IW3 A;  1B9M A;  1UAP A;  2XGT A;  4K6L A;  1IL2 A;  1VQC A;  4LK1 C;  5ELF A;  3CCU A;  3S2H B;  3X3N A;  3GTQ B;  1S5C D;  2BCO A;  5FOB B;  1LLR D;  4L5Q A;  5BN5 A;  1N32 L;  2F0D A;  4GNX C;  3GTP B;  3K0Y A;  1G51 A;  3NTH A;  1F9S A;  4J15 A;  3GTL H;  1AH9 A;  1Y8O B;  1PVO A;  3HOW H;  4KJO A;  3VYS A;  4EQO A;  1Q8K A;  1EOV A;  5IP7 G;  4GN4 B;  2GN5 A;  3K7A H;  4TVA B;  4HIO A;  1PTO H;  2CQO A;  2JA9 A;  5JJL A;  4LUO A;  3L2P A;  4CDF C;  4YY3 Q;  5GRO A;  1T5X D;  1YNN C;  2RVL A;  2YYZ A;  4BY1 H;  2ZXO A;  3J7Z C;  5EQ0 A;  5F2D A;  2F0S A;  3PCO B;  1GM5 A;  4IFD I;  1AP0 A;  1GUW A;  5IYD G;  5C4J B;  2I0Q A;  2ZXP A;  1RTO A;  1XXG A;  3AB9 A;  3UDF A;  1HA6 A;  3IRB A;  3ER0 A;  3J81 L;  4FF1 A;  1AN8 A;  4CJ1 B;  1G8Z D;  4DFA A;  5IGG A;  2WB1 G;  2CH4 W;  1CUK A;  4PMC A;  2NTT A;  5M5W H;  1VQ8 A;  4IPD A;  2KHS A;  4CKB A;  3OSO A;  4R8I A;  4DUZ L;  5J22 A;  1XPU A;  1LTS D;  4UDU C;  1D5Z C;  2K52 A;  2Z4I A;  1VMP A;  4DV0 Q;  2ZM6 Q;  2Z0S A;  3MXN A;  2D5D A;  2D0O A;  3GTM H;  1HNZ Q;  2F0M A;  4YIJ A;  2IL8 A;  1K8M A;  3QOJ A;  1IW7 C;  1VQH A;  1PTO C;  4A3K G;  2A8V A;  3H15 A;  3T13 A;  4EQP A;  3BDL A;  2PZW A;  1WTP A;  1HXY D;  2QW7 A;  1SR3 A;  1BCP B;  3K5O A;  2CVR A;  1A6X A;  2L11 A;  5JVG 3;  1UE1 A;  3W3A A;  3ULL A;  4NDX A;  5FO8 B;  4WJ3 M;  1M4V A;  1KHI A;  1VQP A;  4PZ6 A;  4XIG S;  2D62 A;  4LUV A;  3RZD B;  1EU4 A;  2D2C C;  5IGE A;  1F9P A;  3MVV A;  1Q1B A;  4L8J A;  3HKZ B;  2I46 A;  1OXX K;  4QUF A;  3DWP A;  3OPO A;  4IUQ A;  3HOV G;  1VF5 C;  2QCP X;  4FYD A;  3EFX D;  1SYB A;  4KHP L;  4X3S A;  1NMG A;  2A68 C;  1STA A;  3RR5 A;  3T56 B;  3BZC A;  4HR7 B;  4J8Q A;  1YHQ A;  1O7I A;  4POG A;  1D7Q A;  3V2T A;  3RN2 A;  4KN4 C;  5COY A;  2CW0 C;  4O2D A;  2Z6K A;  2XWJ B;  3CW2 C;  2IY5 B;  5C0X G;  1U4M A;  4LNQ A;  3GTG B;  3BG3 A;  4A3C G;  1HUN A;  5ELC A;  2NTS A;  1VQ7 A;  2VB2 X;  4GOP B;  1Y1W H;  3EQL C;  4B3T Q;  1PFB A;  3ND9 A;  1VQM A;  1X54 A;  4P72 A;  1YIJ A;  3S1M B;  3I55 A;  5C4Z A;  3S17 B;  3PUV A;  2EY5 A;  1Y1V G;  1P16 A;  1YEZ A;  2NYZ D;  1V8Q A;  1MHW C;  1DXM A;  3V96 A;  1O80 A;  3CD6 A;  1PH9 A;  4BBR B;  2NVY H;  1BVS A;  2UU9 L;  1S72 A;  1SEB D;  4A75 A;  1L0X B;  1XNQ Q;  1HNW L;  4KKT A;  1CTM A;  3K8A A;  4AIM A;  4A3E H;  5K5P A;  2UUB L;  1CA6 A;  1KDA A;  2K5V A;  3PGZ A;  4LFC L;  4ZRZ A;  4TRD A;  5IYB H;  1KIX A;  2MO1 A;  2IX0 A;  1S5B D;  1LM0 A;  2IX1 A;  3SR1 A;  2R93 B;  5JEA H;  4RHR A;  1HZA A;  2R6G A;  2B2U A;  1XX8 A;  1VQL A;  1PLF A;  4JI7 Q;  3P75 A;  4FO2 A;  1EY9 A;  2WKD A;  4MHE A;  1SNO A;  3FKI B;  2A6E C;  3MEF A;  1YIT A;  2JP1 A;  3TRZ A;  1NUC A;  4GLV B;  5AFW A;  1O78 A;  1R9T B;  2K4K A;  4JI0 Q;  4DGZ A;  1EOT A;  1FGU A;  2B8G A;  5IWA L;  1PH2 A;  1F2M A;  1C4Q A;  3K80 C;  1PH5 A;  4K2K A;  4LF9 L;  2EY6 A;  4R4I A;  1XNR Q;  2JA7 H;  4Y52 H;  3OTO Q;  1EY6 A;  3OW7 A;  2R92 H;  3MEH A;  4B08 A;  1LT6 D;  5C44 B;  2E2J B;  1QIL A;  2VZA A;  4WJW A;  3T53 B;  4B3R L;  4DNI A;  4IO9 A;  1SMY D;  1H9R A;  2NVQ H;  3LWE A;  2Q2H A;  2N55 A;  1MI2 A;  4K8I A;  4OHJ A;  5IYC H;  3MXU A;  4GKJ Q;  3NQI A;  4BY7 H;  1K73 C;  4IUR A;  5LL6 S;  5G3L D;  2WP8 J;  4V19 0;  2PNR C;  4OXP A;  2KHI A;  4XYO A;  5E4X A;  1WI5 A;  4DR1 L;  1ENA A;  2E2H H;  1I6H B;  3FPU B;  2JA6 B;  2N8N A;  1CT1 D;  2Q8T A;  1TY2 A;  2F0I A;  3URY A;  5M5X B;  3SK5 A;  4GLX A;  2DUD A;  1TT2 A;  3RZO B;  1LTT D;  4BA2 I;  4A3F B;  4JI3 Q;  4A3B G;  1VQJ A;  1K3R A;  1B8A A;  1Z6H A;  3A0J A;  1EWH A;  2F0K A;  4DK1 A;  5EPJ A;  4RHS A;  1JOQ A;  2PW7 A;  2RKS A;  3S16 B;  1ET6 A;  4B3S L;  5J39 A;  4KD4 A;  1N33 L;  2BE5 C;  2J7Z A;  5COR A;  4DV2 Q;  1HTP A;  2RF4 A;  4PV1 C;  4RGO S;  4DV1 L;  1MSH A;  4PZ8 A;  1S4Z A;  3HOZ G;  1STN A;  3J7Y W;  3N6R A;  4DR3 Q;  1M90 C;  1KDC A;  1ZEQ X;  2NVT H;  2FHT A;  1D8L A;  2OEO A;  4PG3 A;  2TSS A;  3FRP B;  1KLG D;  3PV0 A;  1EIF A;  4ZK9 B;  4K6D A;  2BH2 A;  2N88 A;  5IP9 H;  4A3D B;  3F8T A;  4KKU A;  3PIP 3;  1YJW A;  4K5W A;  2IWH A;  4XT3 B;  3UDI A;  3J81 E;  2EOT A;  1PH8 A;  3G4S A;  2F0V A;  4B9W A;  2C35 B;  3H91 A;  1EIY B;  1EYC A;  3STB C;  1VQN A;  1JOO A;  2OQ0 A;  1NR2 A;  4A3K H;  1S3O A;  2E2D C;  2F1M A;  4UP8 A;  3PF4 A;  3PO2 G;  4GOP A;  4JI6 L;  4IUT A;  2CWA A;  3DEP A;  4K14 A;  1EQT A;  3NWT A;  4IQZ A;  2P5Z X;  2QF7 A;  3HOX G;  4DV6 L;  4BBS G;  3TS0 A;  3HFZ B;  1F77 A;  3HOY G;  2XTI A;  1JJC B;  1O7Y A;  4G7Z C;  2Y0S B;  1X65 A;  3A56 A;  3IL8 A;  1DJR D;  3A5Z B;  1FVI A;  4I7Z C;  5CMD A;  2HCI A;  3D4D A;  1HJP A;  2I5L X;  4ULL A;  1TKW B;  1ENF A;  3HOV H;  2OTJ A;  2MNA A;  3CXC A;  1OXS C;  3A7L A;  4R1J A;  4DR6 Q;  5DAU A;  3M3Y H;  2B2W C;  1XPR A;  1N34 Q;  1G29 1;  4BY1 G;  1HQM C;  1A8V A;  1EWC A;  1XTC D;  5HGQ A;  5JPM C;  3GTO B;  2CHB D;  3T4A C;  2N78 A;  3HOU B;  1NNX A;  1ZXT A;  5C0X H;  2BA0 A;  4A3C H;  3LNN A;  4MNO A;  3VR4 A;  1CZW A;  3E0E A;  1QNK A;  1PXU A;  3A8J E;  3TS2 A;  4JI1 Q;  5EAY A;  4H13 C;  4QMG A;  3ZJY C;  2A74 C;  2NN6 I;  3OYY A;  1IBK Q;  2UXD Q;  2JA5 G;  1EY5 A;  3M4Y A;  2G9H D;  3DXJ C;  1RTN A;  1CI3 M;  4LF5 L;  4H02 A;  3LWU A;  3SK8 A;  2Z9H A;  2RBM A;  3KUP A;  1LT5 D;  2KEN A;  4HSV A;  3S1N B;  3E9H A;  3RLN A;  1LTG D;  2OT2 A;  2HQE A;  4LFA Q;  4MZ9 A;  1X3G A;  3WOF A;  1VQB A;  2AUJ D;  2NB0 A;  2CCZ A;  3CME A;  3T1H L;  5DEH A;  3AYH B;  4X6A H;  4KY6 A;  1IW7 D;  1PTO D;  2VQE Q;  5D3I B;  3CRK C;  2AHO B;  1EZ6 A;  1SSO A;  1STB A;  5IGB A;  5A2Q L;  1L0Y B;  3G7L A;  3U9S A;  3L3O C;  3FMC A;  3J7A V;  1KQS A;  4DR5 Q;  3J7A F;  4HED A;  1ESR A;  4RA8 A;  1I94 L;  3R3O A;  1B4O A;  4JYA Q;  2K5W A;  4IUP A;  4YWL A;  2M9V A;  4X62 Q;  4HIM A;  1YNJ C;  4R9W A;  5C5M A;  3TZU A;  1X6O A;  2BA1 A;  5LMN Q;  4A3J G;  1PH6 A;  3U9O A;  1MJE A;  3EJI A;  4JCV E;  1GUO A;  5BR8 Q;  3ZYY X;  1B3A A;  1XMO Q;  4JBK A;  2F0G A;  2MFI A;  5EBD A;  4JI8 Q;  1KNA A;  1SMY C;  2CKZ B;  2Z1C A;  4OIJ A;  2B63 B;  2IHF A;  3RLO A;  5D3D A;  1W6K A;  2A68 D;  1XMQ Q;  1HR0 Q;  3HKZ E;  1OO9 B;  3NEM A;  3MFG A;  1Y1W G;  3NWS A;  1JOK A;  1CM9 A;  4G7H C;  2KED A;  2CW0 D;  2H5X A;  3VR6 A;  1L1O B;  2MGS A;  3VR5 A;  1VF7 A;  1HH2 P;  3HRZ C;  1WD0 A;  4C3H G;  1C0A A;  5C4X G;  4E6I A;  4KJN A;  5LHY 1;  5DM6 3;  4A93 G;  1IZ6 A;  4X66 Q;  1E3P A;  2AQ3 B;  4HJ5 A;  1FL0 A;  1J5E Q;  3BYT B;  3MFY A;  3U4Z A;  1VQ4 A;  1WCM B;  3A54 A;  5C3E H;  3G48 A;  3I3C A;  3QOL A;  1WFQ A;  4JI4 Q;  4RH6 A;  4A3B H;  1RD9 D;  4X65 L;  3J80 L;  3HS0 C;  4DV5 Q;  4LW1 A;  3OMC A;  1A62 A;  4F87 A;  3H3V I;  4X3U A;  5FK9 C;  1IBL Q;  2JA8 B;  4FF3 A;  4LF7 Q;  1SNC A;  2DGY A;  3CMA A;  5KYL A;  3PUX A;  4DR2 Q;  2UUA L;  1IL8 A;  1UE7 A;  4AH6 A;  2B2Y C;  3HOZ H;  2ES2 A;  1I4G A;  3D3R A;  4UAI A;  1GHJ A;  1STH A;  5LMU Q;  4LJZ C;  2PZU A;  5I2Y A;  1HNX L;  1T9H A;  1TR5 A;  1HFG A;  4RCO A;  4XDX A;  1F2Y A;  3TBI B;  3GTL B;  1SYG A;  2Z8L A;  1HPC A;  3P20 A;  2UXB L;  2HHH L;  2PZT A;  3S24 A;  1X3E A;  1FJG L;  1A15 A;  4DAV A;  3LX0 A;  1AEX A;  3H0G B;  3K7A B;  4RGN A;  1XWE A;  2WKC A;  3M4O H;  3QR8 A;  2PO4 A;  2EYP A;  2EYH A;  4C2M H;  5HGT A;  4X3K A;  5FLX L;  4IN3 A;  4K0K L;  5KND A;  3I4M G;  3PO2 H;  3MHB A;  1SJE D;  1GVP A;  1STE A;  2ID0 A;  1SXT A;  2EXZ A;  2PI2 E;  2WAQ B;  4BBR G;  4DR4 Q;  1CKN B;  3BJU A;  4LAA A;  1XYI A;  1S40 A;  3HOX H;  1EYD A;  4RAU C;  5IYC G;  4BBS H;  1DYQ A;  1T5E A;  5M5W B;  2B2T A;  4BY7 G;  3PO3 B;  1CFM A;  3HOY H;  4HSP A;  1U4L A;  4YY3 L;  4X64 L;  5GAE C;  4DV7 Q;  1K83 H;  2RA4 A;  4TQU S;  1PYW D;  3MAQ A;  5A35 A;  2KCT A;  3GTM B;  1TWF H;  2F0P A;  2AMC B;  5KYI A;  2YV5 A;  1HA5 A;  3TP8 A;  5M9O A;  4OWT B;  3S2D B;  1TWA H;  4LF8 L;  4DAM A;  3FPP A;  3A74 A;  4ME3 A;  3A8I E;  4RMF A;  5EPK A;  2L5T A;  3TRE A;  2YTV A;  4LF6 Q;  1LTA D;  1UUP A;  2QA4 A;  1PRT C;  2NZO A;  4B3M Q;  2YU9 H;  3C3L A;  3KOJ A;  1A3T A;  4UHV A;  2XRS D;  5KGU A;  2LKV A;  4DV0 L;  2ZM6 L;  4DNR B;  1HCZ A;  2RHS B;  3I56 A;  1HNZ L;  1KDB A;  4HAE A;  1BQQ T;  3NK9 A;  1TWG B;  1G2T A;  2XIW A;  2MUY A;  4KTA A;  1K8O A;  3ULP A;  2K6A A;  2JSO A;  3H6M A;  2BE5 D;  5IP9 G;  4DUY Q;  5ELE A;  2HDM A;  2JEB I;  4HCS A;  4KHV A;  3UI2 A;  2JA5 H;  5IT9 c;  4JV5 Q;  1E2W A;  1BBX C;  3QO2 A;  4HTH A;  1I4Q A;  2GA4 B;  1FNV A;  1YNX A;  3CCM A;  1EL0 A;  4DAP A;  5L37 A;  4WFN 3;  4DA2 A;  1H9S A;  1ASY A;  2QDL A;  4OO1 G;  1CHP D;  5I6Y A;  2EYL A;  2XWB B;  1WTQ A;  1L1O A;  3STB D;  2MQH A;  4ALP A;  2L15 A;  4LFB Q;  1WJJ A;  1SBB B;  1SRU A;  1B9N A;  3DMU A;  2VUM G;  3ERQ A;  2ASB A;  1PMR A;  1VS0 A;  2FJ2 A;  3K58 A;  1D5M C;  1YJ9 A;  2OCE A;  3OWF A;  2L0C A;  5DM7 3;  3CC2 A;  2ZTE A;  1B2T A;  1K0R A;  3IFD A;  4FDB A;  4DK6 C;  3K5L A;  1QJO A;  1QOH A;  1H9M A;  1IHZ A;  4K2L A;  1G91 A;  3RNU A;  4Q0F A;  1TWC H;  1PTO F;  1CSQ A;  1C8C A;  1MBY A;  2NVY B;  2FMM A;  4B3T L;  4A3J H;  3MTS A;  5AJ3 Q;  4A3E B;  4NXM Q;  4OON A;  2XNA C;  4ID6 A;  5A2Q E;  2KVM A;  2B2U C;  2EJF C;  2Y0S E;  1I50 H;  4A3D G;  2ZTC A;  2Q8R E;  4CDD C;  3D4W A;  1QVF A;  3PF5 A;  4O1N A;  1VQ5 A;  3FVQ A;  1DOL A;  2CH4 A;  4JVZ A;  2UUC Q;  1UEA B;  4GN3 B;  2X6L A;  1A2U A;  4IJH A;  3QIA A;  2H1E A;  2O5J C;  3CPW A;  1XNQ L;  4IUN A;  1FNU A;  2KHJ A;  5GAG C;  2QIL A;  5EKL A;  2RDG A;  3GO5 A;  3K5M A;  1V1Q A;  2A6H C;  2X69 A;  3AEV A;  1JWU D;  4BA1 I;  4C3H H;  1LTR D;  1SYE A;  3GD7 A;  3W5O A;  4PZ7 A;  5C4X H;  3SEB A;  4IOC A;  1VQE A;  3D6W A;  2A5H A;  1EY7 A;  5C3W A;  1SJH D;  1Y8P B;  2ICI A;  2ZTD A;  4A93 H;  1NBW A;  2B3G A;  2E75 C;  4A3G G;  1JOR A;  2JA7 B;  2F0H A;  3D8G A;  1KXL A;  4Y7N H;  3KBX A;  4JI7 L;  2TMP A;  5FO9 B;  1KC8 C;  4YHH Q;  4L5T A;  3TDQ A;  4O42 A;  1AE2 A;  3I70 A;  5D14 A;  4DV3 Q;  2R92 B;  2Q2U A;  3CPF A;  4I7A A;  2AKW B;  1EY8 A;  5CGK A;  1CKN A;  2A1A A;  4XTC S;  3AQQ A;  1EY0 A;  4JI2 Q;  3PIP A;  2BH8 A;  5JVH 3;  3BU2 A;  2PYK A;  5LL6 X;  1E1O A;  2NVQ B; 
#chains in the Genus database with same CATH homology
 2DY8 A;  1TS2 A;  1HQR D;  2H4O A;  2AWN A;  2K33 A;  1QB5 D;  3CHB D;  4EGV A;  4CHT B;  1SNQ A;  3J80 E;  3ONA B;  4C1N K;  2KCN A;  3C46 A;  1FNW A;  3L7Z C;  2E2H B;  2JE6 I;  1BCP C;  4G4K A;  3ERO A;  4K8J A;  5EJW A;  3TN2 A;  1S5D D;  5T1G A;  1O7Z A;  1Z47 A;  3VYR A;  2L9H A;  1EIG A;  5T1I A;  1YNJ D;  2HUG A;  3M7N A;  2FMC A;  4QIW B;  1TVX A;  4RGM A;  2B2V C;  2J0T D;  4ABN A;  3RLF A;  4KI0 A;  3G6J B;  2K01 A;  2WB1 B;  1OXV A;  4Z9C B;  1IYV A;  2F0Q A;  1SYC A;  5FLX E;  4QCL A;  3BVM A;  4ODG A;  5IOC A;  1BUV T;  4KY7 A;  1TU2 B;  5JJZ A;  3CRL C;  4KKS A;  3VYU A;  1UNS A;  1F9R A;  1QE6 A;  4IZ8 A;  2XRQ D;  5D65 A;  1WTO A;  2PMZ B;  3NXW A;  3OOC A;  3QWN A;  5JPN C;  2XSC A;  4V0B A;  3MXG A;  1AZQ A;  3IFT A;  5K36 G;  1HHV A;  3NUC A;  4C3J G;  5IOD A;  3WDN A;  1RKN A;  1Y8N B;  1ZKO A;  2EPB A;  4RKB A;  5CYU A;  3K5N A;  3TZD A;  2V4D A;  1EYA A;  5KNC A;  1TS4 A;  5C0X I;  1CQV A;  2AUK A;  2F0E A;  4MN3 A;  2WAC A;  1JR0 D;  2RSO A;  4CGY B;  5ELB A;  3HOV B;  2QKI C;  3C2P A;  1LTI D;  1PZJ D;  3QJY A;  5KRU A;  1WVL A;  2F0O A;  1B53 A;  1G6Z A;  2EY2 A;  4IFD J;  2B8F A;  2LFN A;  1NCV A;  1SDF A;  2HDL A;  3DM1 A;  1M8A A;  1J8I A;  4OO1 H;  3BYY B;  5CV4 A;  3A55 A;  5E3F A;  1I4P A;  2F4I A;  1EEI D;  3PIO 3;  2KJX A;  1U4P A;  3K59 A;  2VXW A;  4ZKB B;  1NAP A;  1Y1V B;  3X3M A;  3ND8 A;  1S5E D;  3SHL A;  3VR2 A;  4F88 A;  3C1F A;  4I65 A;  3HGB A;  4PMW A;  2BOS A;  3F2U A;  4ZQ3 A;  1FD7 D;  1ONL A;  2DNC A;  1OXT A;  2F0L A;  3SDZ A;  3VR3 A;  1J9O A;  3I91 A;  3FEW X;  2SDF A;  4PQX A;  4LMQ D;  2E74 C;  1KAB A;  1EU3 A;  1JC7 A;  4WOR A;  1MSG A;  1B44 D;  2O2L D;  2D9U A;  2HCC A;  1DON A;  1KAA A;  1PRT D;  1W6J A;  5DNF A;  5BN4 A;  5JEA J;  3NTK A;  4HCE A;  3BVG A;  5E4W C;  2F0J A;  3ITP A;  3I8Z A;  4MIU A;  2RDH A;  1RDP D;  3HP3 A;  4OGQ C;  3S1R B;  1CQF A;  4G7O C;  1MGS A;  2O5I C;  3NPP A;  3GTK B;  3K6O A;  4XXE A;  5EKI A;  1WTX A;  1O7L A;  2LMC B;  1U4R A;  1B1Z A;  3H94 A;  3DEO A;  3IAY A;  3MZ5 A;  4BWG B;  2SEB D;  2F03 A;  3NHH A;  1E0B A;  2KCC A;  3DWA A;  5I6W A;  3GV6 A;  1BF4 A;  5CC4 A;  4C56 C;  2E2I B;  3BS1 A;  4A3B B;  1HUM A;  3RD4 A;  4IFD G;  4K5V A;  4C3I B;  3SK6 A;  3Q23 A;  1I4H A;  3R2I A;  3SK4 A;  3VA7 A;  1Q1E A;  5CV6 A;  3Q22 A;  4FXK C;  4C1N I;  2AWO A;  3WOE A;  1Q90 A;  2F0F A;  1RHP A;  3C1E A;  3DUZ A;  2M00 A;  4Q5V A;  4ZKC B;  4NKL A;  2K7V A;  1GUN A;  2A6H D;  1LTB D;  3M4O B;  5CBE E;  1GJX A;  4C2M B;  1QG7 A;  1V1P B;  1EEF D;  2B2T C;  5G3L F;  3PO2 B;  5K36 H;  1DCZ A;  1LT3 D;  3P1H A;  2IX3 A;  4BBS B;  5I9P A;  4OL7 A;  5TSS A;  1X3Q A;  3HOY B;  1BNZ A;  1K83 B;  3HOW B;  4ZLT F;  1WD1 A;  4IAL A;  3AU7 A;  1PZI D;  1WTW A;  2NBF A;  5HUR A;  1HTL D;  1VDZ A;  5I2X A;  4GZY C;  3I73 A;  4FXD A;  2FFK B;  1PTO B;  1SE4 A;  4DK0 A;  1BXT A;  5E1F A;  3R93 A;  4CBV A;  3NQT A;  1BCP D;  4BY1 B;  3TP5 A;  4DF7 A;  3T51 B;  4EQN A;  2YU9 B;  1D6E C;  3D6C A;  3I72 A;  2MPM A;  1EZ8 A;  3SVM A;  1TQO A;  2KOL A;  4RKL A;  2EYM A;  2KQ3 A;  3BZD B;  3O13 A;  1JQY D;  3EA6 A;  2G9D A;  3KK7 A;  4DN4 M;  2LS0 1;  2K05 A;  2JA5 B;  3A8K E;  3M85 A;  2ICE C;  5I9O A;  1JWS D;  1I4X A;  1Z7T A;  2XN9 C;  2KA7 A;  3VYT A;  2IPK D;  2ZT9 C;  1FYC A;  3TSS A;  3DHQ A;  1D2B A;  1JIC A;  2B2Y A;  4DAY A;  1G2S A;  2Z4H A;  2AQ2 B;  3KBG A;  4FF2 A;  3E5S A;  1AFP A;  2MJ8 A;  2WII B;  1KTK A;  2XVS A;  1AZP A;  1TWC B;  1FR3 A;  5C4H A;  3NSW A;  2F3V A;  4XQN A;  1GOZ A;  4ILW A;  1AW7 A;  4A3J B;  3MXP A;  1PFM A;  1PRT F;  4J1M A;  1GUG A;  3QG1 A;  1I50 B;  1EY4 A;  4CJ0 B;  2A69 C;  1Y1W B;  2FIN B;  4NW2 A;  5IT9 E;  2IJ0 A;  4S3S A;  3E0J A;  2JYO A;  3H3V C;  1Y69 U;  2SOB A;  4CKC A;  1SE2 A;  4C3H B;  5IIF A;  4PNY A;  1Q3L A;  4FNF A;  1RCV D;  2X6G A;  3GQB A;  5C4X B;  1GXD C;  4A93 B;  1IKM A;  1PDQ A;  3R8B A;  1RJT A;  1V1P A;  4Y7N B;  1QWY A;  4RFB A;  3OIP A;  4H0L C;  1Q12 A;  2B39 A;  3D4R A;  2OF1 A;  4IFD H;  2K04 A;  4DXF A;  4DXG A;  5CV7 A;  1F2Z A;  1DZ1 A;  1F2L A;  3L9A X;  3Q6S A;  1H9J A;  3PMF A;  1KNE A;  4R8N A;  4ZAI A;  3TP6 A;  2PPB C;  2NVX B;  4KV6 A;  3KLS A;  1QCB D;  1EIH A;  2O4X A;  5CV5 A;  1X3P A;  1Q8I A;  4KMU C;  1KLU D;  3MWY W;  3H09 A;  3EVQ A;  2EYF A;  4TSS A;  1SAP A;  1JB3 A;  1ILQ A;  4KHZ A;  2BDN A;  1MD2 D;  1TII D;  2IT1 A;  1WTV A;  3I4M B;  1ICW A;  3Q0A A;  4RGT A;  1I3Q B;  4JK1 C;  1DM0 B;  2KUM A;  1ZYR D;  4BY7 B;  2K28 A;  2EJG C;  1V43 A;  2EE1 A;  1SFO B;  4F7X A;  1TS3 A;  4EVO A;  1NSN S;  2NZ1 D;  1ROD A;  1X32 A;  1I6V C;  1HFN A;  3VA5 A;  3E6Z X;  4N9P A;  5IGD A;  2F3W A;  5KNB A;  2RSN A;  3MC0 B;  3OHX C;  2K03 A;  3PUW A;  5NUC A;  1OXU A;  4PMB A;  2LY7 A;  4OIK A;  3T16 A;  2EVB A;  4U67 3;  4TKO B;  2A73 B;  3P7J A;  2SNS A;  1CHQ D;  3FDT A;  2NVT B;  4OO1 I;  3V05 A;  4ME5 A;  2EDG A;  1SE3 A;  1BCP F;  2NN6 G;  2NUC A;  1VMC A;  2MP1 A;  3NE5 B;  5CV9 A;  4IUU A;  2MHV A;  1D5X C;  1DOK A;  2QEJ C;  1VCI A;  3HEJ A;  4A3K B;  3W2D A;  3TME A;  5EPL A;  5CV8 A;  4XQQ A;  4XQJ A;  3PUZ A;  3A7A B;  1STY A;  3SE0 A;  3R2T A;  4G57 A;  3RUZ A;  2R61 A;  2VUM B;  1V1O A;  3OIQ A;  1E2Z A;  3S14 B;  3K57 A;  4C3I G;  4CJ2 C;  1FGB D;  2EYO A;  4ZUJ A;  2L12 A;  2C9O A;  1ENC A;  2EYJ A;  1BO0 A;  3M3Y B;  5C3X A;  1TY0 A;  1EQV A;  1ML0 D;  4L6T B;  2B2V A;  2DN8 A;  3PUY A;  4M8A A;  1STG A;  4WRD A;  3KF8 A;  2ZXR A;  5KIX A;  3JAM L;  3AMU A;  1JCK B;  2M2L A;  3NBH A;  1U9R A;  2EY1 A;  4ZUI A;  4KD3 A;  4BS9 A;  4KY5 A;  2I07 B;  4U68 A;  1I4R A;  3Q24 A;  4F8M A;  1QNU A;  1II3 A;  5M5Y B;  2DY7 A;  2QDB A;  4XT1 B;  3I90 A;  5C6A A;  1EFI D;  1S5F D;  2C5C A;  4P2C B;  3OMG A;  4A3G B;  4HMJ A;  3MA2 B;  1ILP A;  2PQE A;  3N52 A;  1C48 A;  2AQ1 B;  4FF4 A;  2PW5 A;  2VNU D;  1NR4 A;  3QB3 A;  5EGT A;  1A2T A;  2K32 A;  2L4N A;  4RCN A;  4FP5 D;  3CQZ B;  1CZG A;  4FXG C;  4IUV A;  3IKJ A;  5IGF A;  4H7B A;  4RWS C;  1E2V A;  2F0U A;  1BR9 A;  4QUC A;  4M1U B;  1YNN D;  4K5X A;  3NP8 A;  3NBI A;  2KEE A;  2EZV A;  2NWG A;  5IT9 L;  3GTJ B;  3D31 A;  1SYF A;  2RDF A;  1B50 A;  4NMZ A;  5J1Z A;  4HMI A;  1BDO A;  2SNM A;  2VB3 X;  1SNM A;  1IYU A;  3DWQ A;  3I4L A;  4NP5 A;  1ESF A;  2E76 C;  1CA5 A;  1ZYR C;  1TS5 A;  2KEC A;  1LAB A;  4KN7 C;  3SXH A;  4CKE A;  5C5L A;  2F0W A;  3M7G A;  5ISR A;  2A69 D;  1PFN A;  2B2W A;  3HZX A;  2BDO A;  1LO5 D;  2K1B A;  2K5D A;  5C3E B;  4N9T A;  5IGC A;  5M3F B;  4AYB B;  4J6H A;  2ENB A;  2CQA A;  4H44 C;  5CBA E;  3I4N B;  2K5Q A;  4C3J B;  5FO7 B;  3S15 B;  3S9W A;  1R4P B;  2OXP A;  3NTI A;  5BN3 A;  3HOZ B;  2PCF B;  3KLR A;  4DNT B;  5KEE A;  1H9S B;  5M3M B;  2NN6 H;  1DD2 A;  3BDO A;  4L63 B;  2JEA I;  4JBW A;  1JE4 A;  5EKK A;  1SNP A;  2F0T A;  1TWH B;  1GUS A;  1H9K A;  4A3M B;  1D1I A;  5EBC A;  1IKL A;  1PRT B;  4HN7 A;  2RQX A;  4ZYS A;  1HRJ A;  1SYD A;  3TP7 A;  2WIN B;  2J4X A;  1JWM D;  1D1K A;  3CKI B;  2L1B A;  3GV3 A;  3GP7 A;  1BOS A;  5CR3 A;  3HOX B;  1CK1 A;  2DNE A;  4X3T A;  3CU7 A;  1DOM A;  1A3U A;  4KK7 A;  3OWE B;  5I4D A;  2JXM B;  5JEA G;  5JOB A;  1SND A;  4QB4 A;  2F0N A;  1TWF B;  1F9Q A;  1RF2 D;  4XYQ A;  1TWA B;  1WTR A;  1GUT A;  1LV9 A;  1GHK A;  5JAV A;  4A3I B;  3KLS X;  4B9X A;  2L55 A;  1A3V A;  2A6E D;  2Q8I B;  4FVM A;  5ELD A;  4QF4 A;  5FKA C;  1ET9 A;  3BDC A;  2R3Z A;  3S1Q B;  5C0X J;  4DU9 A;  1LT4 D;  2WV6 D;  3RMH A;  1R4Q B;  2EJM A;  1LAC A;  2R7Z B;  3BVZ A;  3JAM E;  3HG9 A;  1PZK D;  2IW3 A;  1B9M A;  1UAP A;  4K6L A;  4LK1 C;  5ELF A;  3S2H B;  3X3N A;  3GTQ B;  1S5C D;  2BCO A;  5FOB B;  1LLR D;  5BN5 A;  2F0D A;  3GTP B;  3K0Y A;  3NTH A;  1F9S A;  1Y8O B;  4KJO A;  3VYS A;  4EQO A;  1PTO H;  1T5X D;  1YNN C;  2RVL A;  2YYZ A;  2ZXO A;  5EQ0 A;  5F2D A;  2F0S A;  4IFD I;  1AP0 A;  1GUW A;  5C4J B;  2ZXP A;  1RTO A;  1XXG A;  3AB9 A;  1HA6 A;  3J81 L;  4FF1 A;  1AN8 A;  4CJ1 B;  1G8Z D;  4DFA A;  5IGG A;  4PMC A;  2NTT A;  2KHS A;  4CKB A;  3OSO A;  4R8I A;  5J22 A;  1LTS D;  4UDU C;  1D5Z C;  2Z4I A;  1VMP A;  3MXN A;  2D5D A;  2F0M A;  4YIJ A;  2IL8 A;  1K8M A;  3QOJ A;  1IW7 C;  1PTO C;  3T13 A;  4EQP A;  3BDL A;  2PZW A;  1WTP A;  1HXY D;  1BCP B;  3K5O A;  2CVR A;  1A6X A;  2L11 A;  5JVG 3;  3W3A A;  4NDX A;  5FO8 B;  1M4V A;  4XIG S;  2D62 A;  3RZD B;  1EU4 A;  2D2C C;  5IGE A;  1F9P A;  3MVV A;  1Q1B A;  4L8J A;  3HKZ B;  2I46 A;  1OXX K;  4QUF A;  3DWP A;  3OPO A;  4IUQ A;  1VF5 C;  2QCP X;  4FYD A;  3EFX D;  1SYB A;  4X3S A;  2A68 C;  1STA A;  3T56 B;  4HR7 B;  4J8Q A;  3V2T A;  4KN4 C;  5COY A;  2CW0 C;  2XWJ B;  5C0X G;  1U4M A;  3GTG B;  3BG3 A;  1HUN A;  5ELC A;  2NTS A;  2VB2 X;  3EQL C;  1PFB A;  3ND9 A;  3S1M B;  5C4Z A;  3S17 B;  3PUV A;  2EY5 A;  2NYZ D;  1V8Q A;  1DXM A;  3V96 A;  1O80 A;  4BBR B;  1SEB D;  1L0X B;  4KKT A;  1CTM A;  5K5P A;  1CA6 A;  1KDA A;  4ZRZ A;  4TRD A;  2IX0 A;  1S5B D;  2IX1 A;  3SR1 A;  2R93 B;  5JEA H;  4RHR A;  2R6G A;  2B2U A;  1XX8 A;  1PLF A;  3P75 A;  4FO2 A;  1EY9 A;  2WKD A;  4MHE A;  1SNO A;  3FKI B;  2A6E C;  2JP1 A;  1NUC A;  5AFW A;  1O78 A;  1R9T B;  4DGZ A;  1EOT A;  2B8G A;  1F2M A;  1C4Q A;  4K2K A;  2EY6 A;  1EY6 A;  3OW7 A;  3MEH A;  4B08 A;  1LT6 D;  5C44 B;  2E2J B;  1QIL A;  4WJW A;  3T53 B;  1SMY D;  1H9R A;  3LWE A;  2N55 A;  1MI2 A;  4K8I A;  4OHJ A;  3MXU A;  3NQI A;  4IUR A;  5LL6 S;  5G3L D;  2WP8 J;  4V19 0;  2PNR C;  4XYO A;  5E4X A;  1ENA A;  1I6H B;  3FPU B;  2JA6 B;  1CT1 D;  2Q8T A;  1TY2 A;  2F0I A;  3URY A;  5M5X B;  3SK5 A;  1TT2 A;  3RZO B;  1LTT D;  4BA2 I;  4A3F B;  1Z6H A;  1EWH A;  2F0K A;  4DK1 A;  5EPJ A;  4RHS A;  1JOQ A;  2PW7 A;  2RKS A;  3S16 B;  1ET6 A;  5J39 A;  4KD4 A;  2BE5 C;  2J7Z A;  5COR A;  1HTP A;  4PV1 C;  4RGO S;  1MSH A;  1S4Z A;  1STN A;  3J7Y W;  3N6R A;  1KDC A;  1ZEQ X;  2FHT A;  2OEO A;  2TSS A;  3FRP B;  1KLG D;  3PV0 A;  4ZK9 B;  4K6D A;  2N88 A;  4A3D B;  4KKU A;  3PIP 3;  4K5W A;  2IWH A;  4XT3 B;  3J81 E;  2EOT A;  2F0V A;  4B9W A;  3H91 A;  1EYC A;  1JOO A;  1NR2 A;  2E2D C;  2F1M A;  4IUT A;  3DEP A;  4K14 A;  1EQT A;  3NWT A;  4IQZ A;  2QF7 A;  1F77 A;  1O7Y A;  4G7Z C;  2Y0S B;  3A56 A;  3IL8 A;  1DJR D;  4I7Z C;  5CMD A;  2HCI A;  3D4D A;  4ULL A;  1TKW B;  1ENF A;  1OXS C;  3A7L A;  5DAU A;  2B2W C;  1G29 1;  1HQM C;  1EWC A;  1XTC D;  5JPM C;  3GTO B;  2CHB D;  3T4A C;  3HOU B;  5C0X H;  1ZXT A;  2BA0 A;  3LNN A;  3VR4 A;  1CZW A;  1QNK A;  1PXU A;  3A8J E;  4H13 C;  4QMG A;  2A74 C;  2NN6 I;  1EY5 A;  3M4Y A;  2G9H D;  3DXJ C;  1RTN A;  1CI3 M;  3LWU A;  3SK8 A;  2RBM A;  3KUP A;  1LT5 D;  4HSV A;  3S1N B;  1LTG D;  2OT2 A;  2HQE A;  3WOF A;  2AUJ D;  2NB0 A;  5DEH A;  4KY6 A;  1IW7 D;  1PTO D;  5D3I B;  3CRK C;  1EZ6 A;  1SSO A;  1STB A;  5IGB A;  5A2Q L;  1L0Y B;  3G7L A;  3U9S A;  3L3O C;  3FMC A;  3J7A V;  3J7A F;  4HED A;  1ESR A;  4RA8 A;  3R3O A;  1B4O A;  2K5W A;  4IUP A;  2M9V A;  1YNJ C;  4R9W A;  5C5M A;  3TZU A;  2BA1 A;  3U9O A;  3EJI A;  1GUO A;  3ZYY X;  1B3A A;  2F0G A;  5EBD A;  1KNA A;  1SMY C;  2Z1C A;  2B63 B;  4OIJ A;  5D3D A;  1W6K A;  2A68 D;  1OO9 B;  3MFG A;  3NWS A;  1JOK A;  1CM9 A;  4G7H C;  2KED A;  2CW0 D;  3VR6 A;  2MGS A;  3VR5 A;  1VF7 A;  3HRZ C;  1WD0 A;  4C3H G;  4E6I A;  4KJN A;  5LHY 1;  5DM6 3;  2AQ3 B;  3BYT B;  3MFY A;  1WCM B;  3A54 A;  3I3C A;  3QOL A;  4RH6 A;  1RD9 D;  3J80 L;  3HS0 C;  3OMC A;  4F87 A;  4X3U A;  5FK9 C;  2JA8 B;  4FF3 A;  1SNC A;  5KYL A;  3PUX A;  1IL8 A;  2B2Y C;  1I4G A;  3D3R A;  4UAI A;  1GHJ A;  1STH A;  4LJZ C;  2PZU A;  5I2Y A;  1TR5 A;  1HFG A;  3TBI B;  4RCO A;  1F2Y A;  4XDX A;  3GTL B;  1SYG A;  2Z8L A;  1HPC A;  3P20 A;  2PZT A;  1A15 A;  4DAV A;  3LX0 A;  1AEX A;  3H0G B;  3K7A B;  4RGN A;  1XWE A;  2WKC A;  2PO4 A;  2EYP A;  2EYH A;  5HGT A;  4X3K A;  5FLX L;  4IN3 A;  5KND A;  3MHB A;  1SJE D;  1STE A;  2WAQ B;  2ID0 A;  1SXT A;  2EXZ A;  4LAA A;  1XYI A;  1EYD A;  4RAU C;  1DYQ A;  1T5E A;  5M5W B;  2B2T A;  3PO3 B;  1CFM A;  4HSP A;  1U4L A;  2RA4 A;  4TQU S;  1PYW D;  3MAQ A;  5A35 A;  3GTM B;  2F0P A;  5KYI A;  1HA5 A;  3TP8 A;  5M9O A;  3S2D B;  3FPP A;  3A8I E;  5EPK A;  2L5T A;  1LTA D;  1UUP A;  1PRT C;  3C3L A;  1A3T A;  2XRS D;  5KGU A;  2LKV A;  4DNR B;  1HCZ A;  1KDB A;  4HAE A;  1BQQ T;  3NK9 A;  1TWG B;  1G2T A;  2XIW A;  2MUY A;  4KTA A;  1K8O A;  2K6A A;  2JSO A;  3H6M A;  2BE5 D;  5ELE A;  2HDM A;  2JEB I;  4HCS A;  4KHV A;  3UI2 A;  1E2W A;  1BBX C;  3QO2 A;  4HTH A;  1I4Q A;  2GA4 B;  1FNV A;  1EL0 A;  4DAP A;  4WFN 3;  4DA2 A;  1H9S A;  4OO1 G;  1CHP D;  5I6Y A;  2EYL A;  2XWB B;  1WTQ A;  1SBB B;  1B9N A;  3DMU A;  3ERQ A;  1PMR A;  2FJ2 A;  3K58 A;  1D5M C;  3OWF A;  2L0C A;  5DM7 3;  1B2T A;  3IFD A;  3K5L A;  1QJO A;  1QOH A;  1H9M A;  1IHZ A;  4K2L A;  1G91 A;  4Q0F A;  1PTO F;  1C8C A;  1MBY A;  2NVY B;  2FMM A;  3MTS A;  4A3E B;  2XNA C;  4ID6 A;  5A2Q E;  2KVM A;  2B2U C;  2EJF C;  2Q8R E;  3D4W A;  4O1N A;  3FVQ A;  1DOL A;  1UEA B;  2X6L A;  1A2U A;  3QIA A;  2H1E A;  2O5J C;  4IUN A;  1FNU A;  2QIL A;  5EKL A;  2RDG A;  3GO5 A;  3K5M A;  2A6H C;  2X69 A;  1JWU D;  4BA1 I;  1LTR D;  1SYE A;  3GD7 A;  3SEB A;  3D6W A;  2A5H A;  1EY7 A;  5C3W A;  1SJH D;  1Y8P B;  2ICI A;  2E75 C;  1JOR A;  2JA7 B;  2F0H A;  3D8G A;  3KBX A;  2TMP A;  5FO9 B;  3TDQ A;  4O42 A;  3I70 A;  5D14 A;  2R92 B;  1EY8 A;  5CGK A;  4XTC S;  1EY0 A;  5JVH 3;  2PYK A;  5LL6 X;  2NVQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...