2EY1A

Crystal structure of staphylococcal nuclease mutant t22v
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDVVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal nuclease
publication title Threonine mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ey1A00
4WRDA 1F2MA 4KHVA 2PYKA 4HMIA 3TP7A 1EY6A 2O4XA 1EY5A 2EY2A 2OF1A 4KJOA 1A2UA 2NUCA 5C4ZA 1A3TA 1EY0A 4RKBA 5KIXA 4KY5A 1KAAA 4MIUA 3SR1A 2F0DA 5F2DA 1TT2A 3D8GA 3H6MA 4N9TA 1SNMA 2F0QA 4ZQ3A 3P1HA 5C5LA 4B9WA 3D6CA 4K2LA 4E6IA 2EYFA 4QB4A 4NP5A 4DGZA 5ISRA 3QOJA 2EYHA 3NUCA 4G57A 3U9OA 2LKVA 4DF7A 1RKNA 2PW5A 4K5VA 5CV4A 4K6DA 4H7BA 4PMBA 3SK6A 3TMEA 3OMGA 2PZUA 2RKSA 5JAVA 5CV8A 3SK5A 3C1FA 5HURA 1ENCA 3ITPA 1SYDA 4RKLA 1SNOA 4KV6A 4S3SA 5JOBA 5C3WA 3ERQA 3NHHA 1SNDA 3EVQA 4K8IA 4F8MA 2RBMA 3OSOA 5IGBA 3PMFA 5IGCA 2HQEA 1SNQA 2SNMA 1JOOA 2F0SA 4K5XA 2F0OA 5CV6A 2F0FA 3HZXA 2RDFA 3SXHA 1SYFA 3T16A 3QB3A 5EKKA 4DFAA 3TP5A 1NUCA 1SYGA 1EZ6A 5C3XA 3NQTA 1IHZA 1AEXA 1SYBA 4KTAA 4TRDA 5KRUA 2F0NA 4QMGA 1JORA 4NKLA 1EYDA 2F0GA 4K14A 4NDXA 4K2KA 5K5PA 4EQOA 5C6AA 4N9PA 5CC4A 5KGUA 2EYLA 3MVVA 1A2TA 3LX0A 2F0HA 5KYIA 3S9WA 1EY7A 5CGKA 3EROA 1EY8A 5J22A 2F0PA 5J39A 1EY4A 3SK8A 3RUZA 1NSNS 1SYEA 4PNYA 1JOQA 3EJIA 5I9PA 1II3A 3NXWA 1EYCA 4EQNA 5I6YA 1A3VA 2EY5A 2PZTA 3TP8A 2EXZA 4QF4A 1EQVA 3SHLA 5KYLA 2F3VA 3HEJA 5C4HA 2OEOA 2KHSA 3D4WA 3DHQA 4DU9A 3QOLA 5IIFA 5KEEA 4F7XA 4HMJA 5DEHA 2EY1A 3MXPA 3P75A 2F0IA 2KQ3A 3DMUA 3MEHA 4IALA 4KY7A 4LAAA 5E1FA 1KDBA 3VA5A 5M9OA 3R3OA 4EQPA 2WACA 4KJNA 2PQEA 5CV9A 3C1EA 2F0VA 1TQOA 1ENAA 2PW7A 3D4DA 3MZ5A 4HTHA 4NMZA 4I65A 2F0JA 2M00A 4PMCA 4ZUIA 5CV5A 2EYJA 1KABA 5DAUA 4ZUJA 3SK4A 4KY6A 2ENBA 4WORA 1SNCA 1EZ8A 4YIJA 5IOCA 5EGTA 5IGDA 1STNA 4J1MA 5IGGA 3TP6A 1STGA 2EYMA 3BDCA 5I9OA 1TR5A 4IZ8A 4ODGA 3V2TA 2SNSA 1STAA 4K5WA 1EY9A 3E5SA 5CV7A 4ID6A 2OXPA 2PZWA 5CR3A 1SNPA 2F0KA 3BDLA 5E3FA 5J1ZA 5IODA 4J6HA 4KD4A 4K8JA 3MHBA 5HGTA 2EY6A 1SYCA 4ME5A 5C5MA 3NP8A 4EVOA 2SOBA 1F2ZA 2F0WA 2EYPA 1EYAA 2F0TA 1A3UA 2F3WA 2F0LA 5NUCA 3NK9A 1STBA 1STYA 1STHA 3T13A 4B9XA 5IGEA 1KDCA 2QDBA 5IGFA 2F0EA 3OWFA 4IUNA 4OL7A 4KD3A 4R8NA 1JOKA 2EYOA 2F0MA 1F2YA 5EKLA 2F0UA 5I6WA 1KDAA 1U9RA 3OMCA
chains in the Genus database with same CATH superfamily
2CH4W 1BVSA 2VQEL 4DAYB 1ZYRC 1U4MA 4A75A 1IXRA 2O4XA 2ZTEA 1EY0A 1I6HH 1UE5A 4HJAA 1L1OA 1CK1A 3GTMB 3M4OH 3GTOH 1P8LA 5JVH3 1G2SA 1WTRA 2LKVA 1HCZA 4DR7Q 3M3YB 1MSGA 4XTCS 1UWVA 1ZYRD 1H9SB 3RN2A 1Y1WG 1WOCA 3X3NA 3S17B 2QW7A 4Q0FA 2NVXH 2R92B 4PZ6A 2IW3A 2Q2HA 4DV2Q 5IYCG 3B6YA 4DFAA 1EZ6A 1IBKL 1LTAD 1CKNB 3HG9A 4QMGA 1K83H 1UNSA 5FKAC 1UUPA 2JA7G 2UXCL 1TU2B 2DNCA 2VL6A 5TSSA 2D62A 3U9SA 3O13A 3KLRA 4HSPA 1HR0L 4GZYC 1SEBD 4JI1Q 4F88A 4X3KA 2C9OA 1YJNA 1IL8A 1TWGH 4LNQA 4AYBE 4GNXB 4IJLA 4RGOS 1LT6D 5KYLA 3S1QH 3CD6A 3NTIA 3QOLA 1JT8A 1KL9A 4LAAA 4YCUA 1LTRD 1BOSA 1GOZA 4GKKL 1SBBB 5FO7B 1B3AA 4AYBG 1VQOA 2PW7A 1PTOH 4DA2A 1TWAH 4UAIA 4RHSA 3W3AA 4A3JG 2PNHA 1ET6A 4QL5A 3J81E 1B4OA 4UHVA 3FPPA 1G6ZA 1VQEA 2OXPA 2K4KA 1HTLD 2CW0C 3NPPA 3S1NB 1I4PA 4JI2Q 4IFDG 4KHPL 1I94L 2RVLA 2F3WA 2NN6I 5M5XH 1VQFA 4GNXC 3MFGA 3AEVA 1RHPA 4EX5A 2CW0D 3GTQH 4X64L 1K28A 3CC2A 2XNAC 5C4XB 3TP7A 4KJOA 1XTDA 1FD7D 4G7HC 4GN4B 5A2QE 2VUMB 1FVIA 4BBSB 2EQSA 3P1HA 5CBEE 3D6CA 5D3DA 4QUCA 2YU9B 3P20A 2XRQD 1X3QA 4H7BA 3SK6A 1DM0B 3HOVH 3T56B 1S3OA 2ZXRA 3CP0A 3SK5A 2FHTA 3CHBD 2B2WA 1I4GA 4JOIA 2TSSA 1SNDA 4M8AA 3NENA 1YJ9A 1MGSA 4YCVA 1ILPA 1O78A 3HKSA 2D9UA 5FO8B 4FO2A 1JOOA 5C3EG 2RF4A 2KCNA 3SXHA 1GD7A 3T16A 3C2PA 2KCMA 1SMYC 5C3XA 3CCQA 4GOPA 5A35A 3GV3A 2KEDA 2NVYH 1KD1C 4A3BG 1Q8IA 3HKZB 1G2TA 4QGUA 1XTCD 1VDZA 1AN8A 2Z6BA 2E76C 2BA1A 2DN8A 1I50B 1MI2A 1SMYD 2E2HB 4YHHQ 4DUZQ 3JAMc 4DNTB 5BR8Q 3TDQA 3PF5A 2J7ZA 1PH7A 2NWGA 2I46A 2X69A 1QOHA 1YJWA 2G9HD 5IT9E 1O7IA 1Q8KA 3GTPB 3PUWA 2UUCL 3AFQA 4EQPA 2C35B 2L5TA 1F9PA 4H0LC 2ZJPA 2P5ZX 3HGBA 3LNNA 1DOMA 2I5HA 5IGDA 2K14A 4J1MA 2HCIA 3K5MA 1VQ5A 3KBGA 4DV0L 3R2TA 1LTGD 5M3MG 2SEBD 5LMNW 4DAPA 5EQ0A 1D1IA 2EY6A 5ELOA 1S5BD 4ZK9B 1CZGA 2UUAL 1G6PA 1Q90A 1YI2A 1CUKA 3HOYH 4JI3Q 3SDZA 1MKHA 4B9XA 3NK9A 1HNXL 3HOWG 4MN3A 4IPHA 2IJ0A 4KKSA 5M5WH 1JOKA 1U9RA 1G291 1YBYA 4CBVA 4CDCC 1N8RC 3OHXC 4RKBA 1CKOA 1KAAA 2F0DA 3DUZA 3HRZC 3D4RA 3CQZH 4ZYSA 4JBKA 3KLSA 4K2LA 2EYFA 3V96A 4NP5A 1MHWC 3A8JE 1DCZA 1PRTB 3I2ZA 4DR6Q 1EWIA 3A74A 3HP3A 1D2BA 4DV4Q 3M4QA 4C3HB 1LT3D 4PZ8A 4RKLA 4BA2I 1I6VC 4A93B 1Q82C 3S14H 1BKBA 3H3VC 4LK1C 2KBNA 2CQOA 1X3PA 4K5XA 2I5LX 4LF8L 2AMCB 5CORA 1KRSA 3A7LA 1QVGA 1KC8C 3NQTA 4LF9L 5EJWA 4IQZA 1QB5D 3GD7A 5ELFA 5K5PA 3G6EA 5M3FG 2B39A 4JI1L 1V9PA 2RHSB 1EY8A 4YWMA 3C46A 1O7ZA 4DAYA 2UXBL 1II3A 3UE1A 2Z6KC 4A3DH 1A3VA 3KLWA 3CXCA 1XX8A 1ML0D 2KHSA 1PRTC 3DHQA 5C4JB 1IYJB 3QWNA 5JJIA 5LMUL 1RJTA 1EOVA 1LTBD 4HAEA 4DV3Q 2Q2UA 1HNZL 3GO5A 2M00A 1PRTD 1UAPA 4FF1A 3TQYA 3M9BA 4DV1L 3IAYA 3GDEA 3I56A 4B3SQ 1STGA 2R7ZB 1BBWA 1GHJA 1E0BA 4A3FH 4IPGA 4NPSA 1B9NA 2BH2A 4JI2L 4OIJA 3BDLA 1CKNA 1YNXA 3J81L 2NZHA 1Q7YC 3BDOA 3FMCA 2HHHL 1VMPA 1Q81C 5EPJA 1V1QA 5ELDA 2FJ2A 3OYYA 4FNFA 3K7AH 2VY3A 3GQBA 3OWFA 5DLQE 4RGTA 1ILQA 1WTQA 3KUPA 1B7YB 2F3VA 4GNXA 1F2MA 2PYKA 4A3IH 2IWHA 2NUCA 4DKAC 2J0TD 1Z47A 2K05A 3LWUA 2K5NA 1EU4A 4TSSA 5IWAQ 4G57A 2XIWA 1X3EA 1YHAA 5CV4A 1WTOA 2OQ0A 1A15A 3TMEA 1PYBA 5A2QL 4DUYQ 1GJXA 2A8VA 4S3SA 4BWGB 3KDFB 5IYDG 5FLMH 3HOVG 4C1NK 4M1UB 1HRJA 5IGCA 3F8TA 1VQCA 3BVZA 3CRLC 2QGQA 4KK7A 1FGBD 2JEAI 3H0GB 3PO2H 4U68A 3LWEA 3C3LA 1X56A 3I4MH 2B63H 3CCVA 5JEAJ 2VB2X 2LFNA 1G8ZD 4YHHL 4FDBA 3LX0A 3J80c 1EL0A 5CGKA 3VR4A 4CDDC 4BY7G 4AH6A 1JWSD 5GAHC 4IURA 2N78A 3K59A 4RGMA 1N33Q 2KA7A 3S1RB 4RWSC 1E3PA 4IOCA 2K50A 2LSSA 1JJ2A 5ELCA 4R4CA 3R2IA 3D4WA 1UEBA 3J80E 4L5RC 4LMQD 1I3QB 1IBLQ 3GTMH 3I90A 2B2YC 4LUVA 4WFN3 2WACA 4BY1H 1F2LA 3VR6A 4X66Q 3ULLA 3MZ5A 5IT9L 2WKDA 2N3SA 4ZUIA 1HH2P 2GVAA 4O0AA 3K58A 3I4OA 1PHJA 2ENBA 3MEFA 1ET9A 1L0XB 4QIWB 2R92H 1A8VA 3CC4A 3TS0A 4AQYL 1B50A 3D3RA 4KMUC 3VDYA 1EY9A 3E5SA 3VA7A 4A3EB 3VYRA 3HOUH 4K8JA 4JI3L 4DR3L 1C0AA 3R93A 2SOBA 4RHRA 3IRBA 2F4VQ 4MTKA 3I4NB 2EIFA 2F3IA 5NUCA 4NW2A 1STHA 5I2YA 1TWHB 2JA8B 3KFUA 1N34L 4OX9Q 1FR3A 4XDXA 3HOYG 2A19A 1RIPA 1BCPB 1DONA 1EQQA 2V4DA 2CWPA 4DR6L 3H6MA 1LT4D 1XMOL 3EFXD 4JI5L 4DV4L 3S1MH 3IKJA 1QJOA 1F9QA 5DM73 1FNWA 3OOCA 4Z9CB 4LFCQ 3E0JA 4HCEA 3ERQA 1NR2A 1RODA 1NJIC 3BZKA 3PIOA 4B3RQ 3I91A 3PO3B 2HDMA 2SNMA 5EBDA 2F0OA 3VR3A 3FVQA 4ABNA 4DK3C 1LTTD 2A6HC 2PCFB 3G48A 2TMPA 1IL2A 4DK0A 4NXNQ 4C3JB 3S1NH 1HFGA 1S40A 1LYLA 4EGVA 2WIIB 1A2TA 1TWFB 2F0HA 4OEMB 4JOIC 2WB1B 2DNEA 3EROA 3RLFA 2A6HD 4JG2A 1V8QA 1BCPC 2NZOA 2B2TC 1NSNS 3FRPB 2HDLA 4DR2Q 3X3MA 2PQAB 1BF4A 1CSPA 1PH6A 2D5DA 3OIQA 1HQMC 2Z6KA 2F1MA 2I0QA 4BBRB 5FLXc 4IOAA 1OXVA 1EEID 4IO9A 4A3DG 3T4AC 2VUMH 4BBSH 1BCPD 3CCRA 1SE8A 5C44H 2QCPX 4XQNA 3HOZB 1WVLA 3J7ZC 5I2XA 1ZEQX 1VQBA 3TEHB 5BN3A 4X3UA 3A0JA 1KABA 2A73B 4B3SL 3ZYYX 1YNJC 4CKEA 4ALPA 4JK1C 2FXQA 3BDCA 4A3GH 2EZVA 4R4TA 3IFDA 2N55A 2F0KA 1FNUA 5E3FA 3K5OA 5IODA 4KD4A 4A3FG 4L8JA 3Q8DA 1MJEA 2Z8LA 1ICWA 5IP7H 4CJ0B 3PIO3 2F0TA 3E3XA 2WAQE 3AU7A 1I50H 5EPKA 1AE2A 4R8IA 4F7XA 4WRDA 1NMFA 4XXEA 4FYDA 1Q1BA 3QO2A 3W2DA 4LF6Q 1JWMD 2HUGA 2KEEA 4KY5A 3OTOQ 2O5JC 2XRSD 3I72A 2WAQG 1SNMA 4A3IG 5ELBA 2ZJQA 4LW1A 3GTPH 1R9TB 1FYCA 2PMZE 1HZ9A 1RKNA 3K7UC 1SROA 2QKIC 5HY6A 5CV8A 2BDNA 2LMCB 3A54A 2WV6D 3QJYA 4FF3A 5JOBA 1WCMB 1GHKA 3ER0A 4X65L 2ZT9C 2F52A 2EJMA 3PMFA 1AP0A 3L3OC 5FLMG 1TY0A 1UE6A 4UP7A 1M4VA 1VF7A 4LF4L 1NUCA 1SYGA 2N49A 3K57A 2B2UC 1YIJA 2EE1A 1Y1WB 3VYUA 1K3RA 4B3MQ 1HFNA 3PO2G 3CCEA 2JEBI 5CC4A 3I4MG 1PH8A 2B63G 4KHZA 3PGZA 4POFA 1EWCA 4QUFA 1SYEA 4PNYA 1I4RA 5I9PA 1PH3A 3NXWA 1V1PB 1MD2D 1NBWA 4DR5Q 3E6ZX 4QF4A 1IBLL 2ZM6Q 4X6AH 2MQHA 5DEHA 4OGQC 3MEHA 2R93H 4X66L 5CV9A 4N8X1 5KNCA 4YWKA 2B2YA 2E5LL 4QQBX 3J80L 5E7NA 2F0JA 2B8FA 2ICIA 4C3HH 3KDFA 2ZJRA 4BY1G 3RR5A 4YWLA 2YTVA 1ASZA 4A93H 2NVQB 3M4PA 1G51A 1RTOA 1E1TA 5GAGC 3TSSA 2FMCA 3PUYA 4QY7A 4AYBB 1B70B 1RCVD 4ID6A 1NR4A 5CR3A 2XGTA 5JVG3 4IPCA 2R92G 1VQGA 2IT1A 5C0XH 2HIVA 4DAMA 2F4VL 1ASYA 1LT5D 3FPUB 4A3JB 2K6AA 5M5YH 5JJZA 2NN6G 3HOUG 4TVAB 3T13A 4HCSA 3EA6A 3S2DB 3ND9A 4IN3A 4IUNA 4XQJA 2JSOA 5GADC 1QNKA 3VA5A 5EKLA 3GTLH 2KHIA 1F77A 2MHVA 1C7YA 5C4ZA 1EY5A 2A1AA 2RSOA 4LWCA 2Z0SA 4J15A 1EYGA 4MIUA 3S2HB 3A7AB 3SR1A 1I4HA 1HZCA 3HOXB 1GUTA 5C4JH 4UY8C 3T53B 1E22A 1T5EA 3OW7A 2L15A 4WJWA 5LMNL 1Y1VH 3A8IE 1H9MA 4K6DA 1SE2A 1IW7D 2JK8A 4QCLA 3OMGA 2J4XA 5HURA 2NVTH 3VYSA 4RGNA 2MP1A 4ZLTF 4GS3A 1FJGQ 4L5QA 2BA0A 2I07B 4MZ9A 4JVZA 2R7ZH 2ICEC 4DPGA 1E2WA 4OWXB 1IHZA 1SYBA 3ERSX 1UEAB 1X65A 2Z4IA 3F2BA 1XXGA 4A3KH 2HD3A 4XQQA 4C2MH 4G4KA 1HNWQ 2AHOB 1X9NA 2RHQB 3T1YQ 2B2TA 2NZ1D 4DNRB 1SFOB 2Y0SE 2K5WA 3A5UA 1TS4A 2KCCA 2CWAA 2DJGC 2F0IA 1J5EL 1IYUA 1JMCA 1J9OA 3GTJH 1Q1EA 2VUMG 2AWNA 4OHJA 5FOBB 4BBSG 2Y0SG 5C44G 1T5XD 2I5MX 4DV5L 4ZUJA 4KY6A 2DY8A 3NTHA 4RA8A 2VQFQ 1OXUA 2GVBA 3FKIB 4FP5D 4RCOA 1STNA 3TS2A 4OO1I 1HA6A 3QG1A 5I9OA 2FMMA 3GTKB 4JPBW 3I70A 3H0GH 4DN4M 2CFMA 4ZRZA 4JCVE 4A3GG 3CCSA 3MHBA 3JAME 4R1JA 1NMGA 3NP8A 3OW2A 4XIGS 1XNQQ 2OTJA 1KRTA 1E2ZA 2F0LA 1SSOA 1L2FA 4OL7A 5IP7G 2PQAA 1BXTA 4UP9A 5M3MB 1PFNA 2HIXA 4HMIA 3S16B 2MUYA 3S1RH 2PI2E 5J22A 3T1HQ 2YTXA 4DV6L 1AFPA 1K9MC 2E75C 3NELA 3QOJA 2EYHA 3NUCA 4XYOA 2NTSA 1EU3A 1L0YB 1CI3M 4ZCKA 1BUVT 3J7A5 4PMBA 3TBIB 2F03A 1Z7TA 4R4IA 2MO0A 3KF8B 2CCZA 5IY0A 3OSOA 1QNUA 4KI0A 3D6WA 4A76A 5IP9H 1PFMA 2RDFA 2WINB 3WOFA 1V1OA 3TZDA 5EKKA 4P71A 4A3EH 3GTOB 4DR7L 2MNAA 1ESFA 3I55A 1EYDA 2B2UA 3CCLA 4EQOA 1SAPA 3QIAA 4N9PA 4UPAA 2IHFA 1N32Q 3W1GA 3MVVA 1H9RA 1OXSC 3I4NH 2K04A 3U4VA 3KJOA 1HTPA 5CBAE 4HIKA 2NVXB 1X6OA 1AZQA 4PG3A 4DV2L 3KF6B 2L0CA 2ZM6L 3BU2A 1P16A 1RD9D 3E0EA 5M3FB 2UU9Q 4DU9A 1CM9A 1ESRA 2CKZB 3MXPA 2KQ3A 3MXGA 5E1FA 1K83B 5HGQA 4B3TQ 2N8NA 1GKHA 4KJNA 1DYQA 4PQXA 4QJFA 1EIGA 2SDFA 1ICFB 2R93G 3H3VI 1Q46A 4DK6C 3ND8A 1K8GA 4K0KQ 3K5NA 1WD0A 1E2VA 2JA5H 2HQLA 4JBJA 3RZDB 1WI5A 3BZCA 1HZBA 1D5ZC 3UDIA 4C3HG 3PO3H 5D14A 2KJXA 4FXGC 3BS1A 4LUOA 1HA5A 4C3JH 1GUSA 3KK7A 1CA6A 5KNDA 1QUQB 1PTOB 3QR8A 3BJUA 1TWAB 5C0XG 1TWFH 5T1IA 1CA5A 4GKJQ 2QDBA 3L0OA 3AB9A 5E4XA 4KD3A 3TREA 1V1PA 3DWAA 1B3QA 1JICA 2YV5A 4NXMQ 1EY6A 2QILA 3E9IA 4BBRH 5G3LD 1N36Q 1CZWA 4Y7NH 4E6IA 2KECA 4DNIA 5ISRA 1STEA 3U9OA 4DF7A 2H4OA 1I5FA 1LACA 3EQLC 1FNVA 3NWSA 3ONAB 1W3SA 4P72A 5GAEC 2AUJD 4OWWB 1Y1VG 3TN2A 3BYTB 5C0XI 3F2CA 3GTQB 1CT1D 4JI7Q 2RBMA 1SNQA 2K28A 3R8BA 4UDUC 4C3IB 2F0FA 4R4QA 2A6EC 5E4WC 2DJFC 3QB3A 4RCNA 2AUKA 1CKMA 1PTOC 1NE3A 2JQOA 4GLVB 1AE3A 4IFDJ 4RH6A 4ZAIA 3HOVB 1HNWL 3MWYW 4A3MH 1SXTA 1PVOA 3VR5A 2A6ED 3T1YL 3UDFA 5BN5A 5J39A 4DR4Q 1PTOD 1EEFD 3GV6A 3EJIA 3Q6SA 4A3KG 2K7VA 5LL6S 1JCKB 1E7ZA 2PZTA 3SHLA 2BE5C 2JYOA 4MTNA 5COYA 3P75A 2NVYB 4BS9A 3DMUA 1R9TH 2Q8RE 3A5ZB 4BY7B 2AQ3B 2K33A 1ENAA 2ZXPA 1PH5A 3D4DA 1OTCA 4HTHA 1IBMQ 4DUZL 2BE5D 1VQAA 3CF5A 2VQFL 5BR8L 4IUQA 4R4OA 2IHEA 1WCMH 2BOSA 1C9OA 1LTSD 5IOCA 5EGTA 4CKCA 5EKIA 1X3GA 3IL8A 4B08A 1XMQQ 4JI4Q 4CGYB 4CJ1B 2E2JB 1WD1A 3A8KE 3J81i 4HJ7A 2K52A 1SNPA 5J1ZA 2RQXA 3M7GA 4J6HA 4PZ7A 1ENFA 3K0YA 5C5MA 3H0GG 3DWPA 2O2LD 4EVOA 4YY3Q 3M3YH 2F0WA 3CKIB 5D65A 2K5DA 2WP8J 4KN4C 4R8NA 4O42A 3JAML 1IKLA 3S17H 5I6WA 2EJFC 3F2DA 3T1HL 3RLOA 5EPLA 1WTVA 3STBC 4IUUA 1O80A 3AQQA 4U673 3Q24A 1PZKD 1VQ8A 3K8AA 1TT2A 1KNAA 2G9DA 2LXKA 1HHVA 3J7AV 2QA4A 1RTNA 1HPCA 2DGYA 3STBD 3KJPA 2F4IA 2UXCQ 1WTWA 1H95A 1Q12A 2PZUA 3C1FA 1ENCA 3I3CA 5C3WA 1HR0Q 1KQSA 1TWCB 1PRTF 2K03A 4GLAC 2Q8IB 4LJZC 1PV4A 4A3LH 4TQUS 2LXJA 5J3BA 2FFKB 1UE1A 3TP5A 1B44D 4DV7Q 2XWBB 2EDGA 1AEXA 3OIPA 5IP9G 5K36H 1N32L 1JORA 4HN7A 3PIPA 2L9HA 4BA1I 4GKKQ 1X3FA 4A3JH 1JB7A 3W1BA 1XWEA 3CCJA 4ILWA 2CHBD 2OWOA 4HIOA 1GUOA 3S2DH 2K5VA 3NBHB 1S72A 1G91A 1QG7A 3PQIA 1EYCA 1JB3A 4H02A 2CQAA 3HEJA 4IFDH 5H1SE 1EFID 3S2HH 1LO5D 5IIFA 3HOXH 2EY1A 3U4ZA 4KY7A 3GTGB 3NE5B 3KOJA 4WJ4A 1KLUD 3RMHA 2F0VA 4L63B 3L9AX 4K0KL 1PZID 2KUMA 4KHPQ 4OO1H 1QVFA 3UDGA 1DXMA 3KF8A 3MFYA 2Z4HA 3K5LA 3SK4A 3V05A 2VB3X 1J8IA 2XTIA 1EZ8A 2MJ8A 1E24A 3EBEA 3NEMA 1RL2A 5C4XH 2JA5G 4X64Q 2EYMA 4HJ8A 1KNEA 4ODGA 3V2TA 1Q86C 1STAA 5CV7A 2MPMA 3PO3G 5JEAH 4JI8Q 3EIVA 1UE7A 4JW0A 4P73A 4GKJL 4DV3L 2YU9H 2LS01 2NTTA 2ES2A 2E2IB 1CQFA 5FLXE 2CH4A 4NXML 2PPBC 3KF6A 1WFQA 3ZJYC 1BBUA 4RG1A 1U0LA 2E8GA 4UP8A 1SFOH 1S5DD 5KIXA 2JJQA 4LFBQ 3PIP3 4N9TA 3D8GA 2VNUD 1O7LA 3CCMA 1QCBD 5C5LA 2N88A 2JA9A 3NTKA 4BBRG 1TS5A 1O7YA 2A69C 5AJ3Q 3RZOB 5JPNC 1DD2A 3W5OA 4LFAQ 4IUTA 3CW2C 1LLRD 4K8IA 2E2HH 3FDTA 5IYBH 2JA6B 2G5DA 3DM1A 3FKIH 2KCTA 2PNRC 3GTKH 2A69D 2ASBA 3OWEB 4HIDA 5IWAL 1N9WA 1PLFA 2O5IC 3G7LA 4R9WA 1QUQA 2F0GA 4OXPA 4Y52H 4DUYL 2UUCQ 2PMZB 5KYIA 1B2TA 1PH4A 3RUZA 4A3MG 5M3MH 1FL0A 2K75A 1M90C 3S16H 2IX0A 4RAUC 3PUZA 5C4HA 4FVMA 1SE3A 3H3VH 3FEWX 1A0IA 1S5ED 1VF5C 4DV0Q 1CHPD 3R3OA 3SEBA 1A63A 1YITA 4J8QA 4RFBA 4X3TA 1E1OA 4NMZA 1JR0D 2UUAQ 3LGJA 1PH1A 3CC7A 2D0PA 1N33L 1KLGD 5EAYA 1HNXQ 2ZTDA 3UI2A 3I4LA 1W6KA 1SJHD 5IGGA 4G7OC 1KAWA 1WCMG 1H9JA 4CDEC 3J7YW 4BXXH 1Y8OB 2JA7B 4DR1Q 2AQ2B 2PZWA 3MTSA 1EFWA 1K0RA 4YY3L 3CMAA 5HGTA 1SYCA 4BY1B 3K80C 2FINB 1EIYB 1QWYA 1OXXK 1KDCA 4ULLA 2F0EA 4ZKBB 1K8MA 3NBIA 4Q5VA 1GXDC 4KHVA 1C8CA 2OF1A 2R6GA 1PA6A 4LF8Q 5M3FH 1WJJA 2AQ1B 3M4YA 4B9WA 3HOUB 2X6GA 2JP1A 4QB4A 1VQKA 2XVSA 4LF9Q 2AWOA 1BCPF 4L5TA 1XPUA 1T9HA 3KLSX 4CDFC 4OX9L 1U4LA 3ITPA 1EIHA 2NB0A 3RZDH 1Y8PB 2IY5B 4L6TB 2F0SA 3AFPA 4DV7L 1CFMA 2JN4A 1IW7C 2UXBQ 3MC0B 2K01A 3G6JB 3HFZB 2MGSA 2KENA 4JI0Q 4A3LG 3E9HA 1PZJD 2VZAA 1OO9B 1A6XA 2QEJC 3S1MB 3J81c 1VQHA 4K2KA 5LMUQ 1S4ZA 5KGUA 4LFCL 5K36G 3S15B 1BR9A 4X62Q 3CU7A 4B3RL 3PSIA 2Q2TA 1HNZQ 1EWHA 1EY4A 1GVPA 3SK8A 4IPDA 1SRUA 1YHBA 5I6YA 1LABA 4EQNA 1H9KA 1Y8NB 2EY5A 4DV1Q 4ZKCB 1KTKA 2OEOA 4NXNL 2OTLA 4HMJA 2OT2A 1U5KA 2R7DA 2Z9HA 3J80i 2RCFA 5T1GA 4NB3A 3HOXG 3S24A 1Z6HA 2HHHQ 3AMUA 5C3EB 5FJ8H 4FF2A 2EYJA 5DAUA 4DR2L 2UUBQ 1PYWD 1W6JA 1EQTA 4OO1G 3H94A 1SNCA 4YIJA 4OONA 4I7AA 2XWJB 3TP6A 4C3IH 1K8AC 1QZGA 3I7FA 2K1BA 4JI8L 4A3BB 1YEZA 4IUPA 1R4PB 3T51B 5L37A 2Y0SB 5C44B 3JC66 1VQPA 1PMRA 5C4XG 3BVMA 1Z9FA 5JEAG 5IYDH 1NNXA 1L0WA 1X54A 4IFDI 3MAQA 3NBHA 1C4QA 2XSCA 1Y69U 3CAMA 2QF7A 1VQ6A 2F0MA 4H44C 3ULJA 1KDAA 2K32A 1GO3E 5JJKA 1U4PA 4LFBL 1ONLA 4A3GB 2HCCA 1A2UA 1AW7A 1A3TA 5FLXL 3PCOB 5JPMC 2F0QA 4IJHA 3PV0A 5AJ3L 3HKZE 1XJVA 1XNRQ 2WFWA 4BY7H 1K73C 4LFAL 1NCVA 1HR0W 5IT9c 3ICEA 3DXJC 3WWVA 1MSHA 2DY7A 3EVQA 4CKBA 3HKZG 3RLNA 2EPBA 2HQEA 4LF6L 3OTOL 2E2JH 5IYBG 3CCUA 3FKIG 5JJLA 1VQ9A 4KTAA 2BCOA 4P74A 4F87A 1IZ6A 1I3QH 2F0NA 1PXUA 1VQLA 3HOWB 3NQIA 1DOLA 2ID0A 2EYLA 2RDGA 1BDOA 4XT1B 4LF5Q 1XPOA 1XMQL 1B8AA 2EXDA 1RDPD 4L5SA 1D7QA 2EJGC 1YHQA 1I4QA 1VQJA 2EVBA 1EQVA 1I6HB 3A55A 3K81C 4AQYQ 2ALYB 5BN4A 4KKUA 4IALA 4B3ML 1DJRD 3M4OB 4ME3A 1KDBA 1CHQD 4MHEA 4CJ2C 3C1EA 1DOKA 3Q0AA 1DZ1A 4DR3Q 2UXDQ 1JE5A 4KN7C 1K3BC 1TWHH 1NY4A 2JA8H 1TWCH 4DR5L 3RD4A 1N34Q 1Y14B 2KVMA 4IUVA 4DAVA 4DR1L 4PMWA 2H5XA 4IZ8A 3G71A 2SNSA 2R93B 5GROA 3TZUA 2D2CC 4HJ5A 3PUVA 3WDNA 2CVRA 4BXXG 1KIXA 1WYDA 1XMOQ 4JI5Q 4H13C 1LTLA 2EYPA 1EYAA 1B1ZA 1STBA 1D8LA 5ELEA 2NBFA 1TVXA 3U50C 2EYOA 1BO0A 1F2YA 4JI6Q 1TWGB 2X6LA 2RDHA 1D5XC 3GP7A 3S1QB 4A93G 1MIUA 4XYQA 4KKTA 3GTGH 3N52A 1TS3A 3KYHC 4JV5Q 3HS0C 3DEPA 5M5YB 5DM63 2PW5A 4K5VA 3DWQA 1YZ6A 4OELB 2IX3A 5JAVA 2D0OA 1VCIA 2B29A 2WKCA 1TKWB 4KV6A 3NHHA 3GTLB 2K5HA 1A62A 1EUJA 4F8MA 1PFSA 3M85A 2IPKD 4JI0L 3FHWA 3HZXA 4P2CB 1EOTA 3J81j 1F9SA 1SYFA 1ZXTA 2ZXOA 4JYAQ 2VS1A 3EN2A 4TRDA 1VQ7A 2HT1A 1D1KA 1Y1VB 3PF4A 1H9SA 4K14A 5I4DA 4NDXA 2B2VC 4X62L 3HOZH 4V190 2NVTB 3H09A 2E2DC 5M5XB 2E2IH 1TY2A 2F0PA 1FJGL 1VQNA 4LUZA 4HJ9A 4EQ5A 1JE4A 4PV1C 3MXNB 4WJ3M 1XYIA 2BDOA 1CQVA 4JBMA 1F9RA 2M2LA 4A3CH 2IX1A 1QZHA 1L1OB 2R7ZG 3TRZA 1CTMA 5D3IB 5M9OA 2NYZD 4MNOA 4A3KB 3Q22A 4C2MB 3RZOH 2RA4A 1KHIA 2A74C 3RN5A 2UUBL 5LL6X 4I65A 3CRKC 1D6EC 2Q8TA 4GLXA 2JA6H 4P75A 5FJ8G 1GUGA 1SJED 1AZPA 1EIFA 1M1KC 2BH8A 4C3IG 4OIKA 3GTJB 4ME5A 4LF7Q 3DM3A 1STYA 5ELNA 4DXFA 4C1NI 1BNZA 2L11A 2YTYA 2F0UA 1IKMA 2RSNA 4X65Q 1S5CD 3L7ZC 3SVMA 1X32A 1IYVA 1BQQT 3K6OA 1LUZA 1SDFA 2VQEQ 1L1OC 1YVCA 5F2DA 3P7JA 1LV9A 1Q3LA 1YNNC 1XNRL 4ZQ3A 3BYYB 5C6AA 4LF4Q 3D31A 4DGZA 1XNQL 1U4RA 1Y1WH 1OXTA 1QILA 1VS0A 1WTHA 2K5QA 4JC0A 3URYA 4HEDA 1NAPA 1SMXA 3KBXA 1TIID 3I8ZA 5CYUA 1SYDA 1YNND 3CPFA 4GN5A 5KNBA 5IYCH 4C56C 1PFBA 1TS2A 2M9VA 2AKWB 4I7ZC 5DNFA 4APVA 2JA7H 5IE8A 2LY7A 2JXMB 1JQYD 3I73A 2A5HA 2L12A 2EOTA 4XT3B 4NKLA 5GQOA 1IBKQ 4LF5L 1SE4A 1X55A 1CSQA 2QEXA 3HOYB 1WTXA 2L4NA 2GA4B 3VYTA 1EY7A 4QIWE 2E5LQ 1WTPA 5M5WB 1JJCB 3DEOA 2MFIA 3N6RA 1JOQA 1GUWA 1EQRA 1HZAA 2NVQH 1RF2D 3NSWA 4O2DA 3WOEA 1JJGA 4O1NA 2EXZA 5FO9B 2L55A 1XPRA 1HUNA 3CQZB 5KEEA 2E74C 2NN6H 3U58A 2KHJA 4DK1A 2IL8A 4KLKA 5G3LF 3DLLA 5CMDA 2PQEA 2UXDL 2Q2IA 4AIMA 1PYSB 1TQOA 1PH9A 4A3EG 5LHY1 1QVCA 3F1ZA 1VMCA 1K0SA 4HR7B 5CV5A 1PDQA 2B3GA 4OWTB 3SGIA 3S14B 3BG3A 4WORA 1VQIA 3I4NG 1VQDA 3OPOA 2OCEA 2UU9L 2JA8G 1I4XA 4K5WA 2PI2A 4B3TL 2V1CC 2OQKA 1NTGA 4DXGA 1JC7A 4GOPB 1J6QA 1AH9A 1KXLA 3UDXA 2VW9A 3JAMi 3SE0A 1F2ZA 5LMNQ 3VR2A 4N8FA 3S15H 2R3ZA 1A3UA 1I94Q 2JA5B 1V43A 4JI6L 3NWTA 5IGFA 1BBXC 3H91A 3D0FA 3H15A 4A3DB 1S5FD 1PTOF 4HIMA 2EY2A 1HUMA 3PUXA 2JE6I 3BZDB 1MBYA 2R7FA 4V0BA 3IFTA 3RNUA 4G7ZC 1M8AA 1LTID 4JV5L 2WB1E 1QE6A 2ZTCA 3MA2B 2B2WC 2RKSA 4K6LA 5AFWA 4C3JG 5C3EH 1SNOA 2YYZA 2GN5A 5IGBA 1R4QB 2ATWA 5CV6A 4FXDA 2B8GA 2WB1G 4JYAL 1B53A 2A68C 4A3FB 1N36L 3MXUA 4GOPC 3Q23A 4A3BH 4Y7NB 2KOLA 3UE0A 5KRUA 4X3SA 3AYHB 3J7AF 3CPWA 1SN8A 1J5EQ 4TKOB 5C0XJ 3M7NA 2B2VA 1JWUD 2A68D 3S9WA 3K7AB 3L2PA 4JI7L 1B9MA 2VXWA 4FXKC 3HOZG 4DV5Q 4POGA 3FP9A 3K0XA 2WAQB 4A3IB 4RMFA 1VQMA 3TP8A 2L1BA 2XN9C 1FGUA 3BVGA 1TXYA 1YNJD 4A3CG 1C48A 4JBWA 1MJCA 4A3MB 1HQRD 3ULPA 2Z1CA 4DR4L 4PMCA 5FK9C 2DUDA 1HJPA 1HXYD 1GUNA 2QDLA 1VQ4A 4YCWA 1W2BA 1TR5A 1ZKOA 2MO1A 1DGSA 3PO2B 2RCNA 2JA6G 4FF4A 1GM5A 3I4MB 4DV6Q 3A56A 3G4SA 2B63B 4LF7L 1LM0A 4CHTB 3HOWH 4GN3B 3CMEA 1IBML 1SR3A 4A4IA 5EBCA 2R61A 1PH2A 1SLJA 1K8OA 5IGEA 2C5CA 4HSVA 2PO4A 1D5MC 3F2UA 4JI4L 3MXNA 2H1EA 3OMCA
chains in the Genus database with same CATH topology
1ZYRC 1U4MA 2O4XA 1EY0A 1CK1A 3GTMB 5JVH3 1G2SA 1WTRA 2LKVA 1HCZA 3M3YB 1MSGA 4XTCS 1ZYRD 1H9SB 3X3NA 3S17B 4Q0FA 2R92B 2IW3A 4DFAA 1EZ6A 1LTAD 4QMGA 3HG9A 1UNSA 5FKAC 1UUPA 1TU2B 2DNCA 5TSSA 2D62A 3U9SA 3O13A 3KLRA 4HSPA 4GZYC 1SEBD 4F88A 4X3KA 2C9OA 1IL8A 4RGOS 1LT6D 5KYLA 3NTIA 3QOLA 4LAAA 1BOSA 1GOZA 1LTRD 1SBBB 5FO7B 1B3AA 2PW7A 1PTOH 4DA2A 4UAIA 4RHSA 3W3AA 1ET6A 3J81E 1B4OA 3FPPA 1G6ZA 2OXPA 1HTLD 2CW0C 3NPPA 3S1NB 1I4PA 4IFDG 2RVLA 2F3WA 2NN6I 3MFGA 1RHPA 2CW0D 2XNAC 5C4XB 3TP7A 4KJOA 1FD7D 4G7HC 5A2QE 2VUMB 4BBSB 3P1HA 5CBEE 3D6CA 5D3DA 4QUCA 2YU9B 3P20A 2XRQD 1X3QA 4H7BA 3SK6A 1DM0B 3T56B 2ZXRA 3SK5A 2FHTA 3CHBD 2B2WA 1I4GA 2TSSA 1SNDA 4M8AA 1MGSA 1ILPA 1O78A 2D9UA 5FO8B 4FO2A 1JOOA 2KCNA 3SXHA 3T16A 3C2PA 1SMYC 5C3XA 5A35A 3GV3A 2KEDA 1Q8IA 3HKZB 1G2TA 1XTCD 1VDZA 1AN8A 2E76C 2BA1A 2DN8A 1I50B 1MI2A 1SMYD 2E2HB 4DNTB 3TDQA 2J7ZA 2NWGA 2I46A 2X69A 1QOHA 2G9HD 5IT9E 3GTPB 3PUWA 4EQPA 2L5TA 1F9PA 4H0LC 3HGBA 3LNNA 1DOMA 5IGDA 4J1MA 2HCIA 3K5MA 3KBGA 3R2TA 1LTGD 2SEBD 4DAPA 5EQ0A 1D1IA 2EY6A 1S5BD 4ZK9B 1CZGA 1Q90A 3SDZA 4B9XA 3NK9A 4MN3A 2IJ0A 4KKSA 1JOKA 1U9RA 1G291 4CBVA 3OHXC 4RKBA 1KAAA 2F0DA 4ZYSA 3DUZA 3D4RA 3HRZC 3KLSA 4K2LA 2EYFA 3V96A 4NP5A 3A8JE 1DCZA 1PRTB 3HP3A 1D2BA 4C3HB 1LT3D 4BA2I 4RKLA 1I6VC 4A93B 3H3VC 4LK1C 4K5XA 1X3PA 5CORA 3A7LA 3NQTA 5EJWA 4IQZA 1QB5D 3GD7A 5ELFA 5K5PA 2B39A 1EY8A 3C46A 1O7ZA 4DAYA 1II3A 1A3VA 1XX8A 1ML0D 2KHSA 1PRTC 3DHQA 5C4JB 3QWNA 1RJTA 1LTBD 4HAEA 3GO5A 2M00A 1PRTD 1UAPA 4FF1A 3IAYA 1STGA 2R7ZB 1GHJA 1E0BA 1B9NA 4OIJA 3BDLA 3J81L 3BDOA 3FMCA 1VMPA 5EPJA 5ELDA 2FJ2A 4FNFA 3GQBA 3OWFA 4RGTA 1ILQA 1WTQA 3KUPA 2F3VA 1F2MA 2PYKA 2IWHA 2NUCA 2J0TD 1Z47A 2K05A 3LWUA 1EU4A 4TSSA 4G57A 2XIWA 5CV4A 1WTOA 1A15A 3TMEA 5A2QL 1GJXA 4S3SA 4BWGB 4C1NK 4M1UB 1HRJA 5IGCA 3BVZA 3CRLC 4KK7A 2JEAI 1FGBD 3H0GB 4U68A 3LWEA 3C3LA 5JEAJ 2VB2X 2LFNA 1G8ZD 3LX0A 1EL0A 5CGKA 3VR4A 1JWSD 3K59A 4IURA 4RGMA 2KA7A 3S1RB 4RWSC 5ELCA 3R2IA 3D4WA 3J80E 4LMQD 1I3QB 3I90A 2B2YC 4WFN3 2WACA 1F2LA 3VR6A 3MZ5A 5IT9L 2WKDA 4ZUIA 3K58A 2ENBA 1ET9A 1L0XB 4QIWB 1B50A 3D3RA 4KMUC 1EY9A 3E5SA 3VA7A 4A3EB 3VYRA 4K8JA 3R93A 2SOBA 4RHRA 3I4NB 5NUCA 4NW2A 1STHA 5I2YA 1TWHB 2JA8B 1FR3A 4XDXA 1BCPB 1DONA 2V4DA 3H6MA 1LT4D 3EFXD 3IKJA 1QJOA 1F9QA 5DM73 1FNWA 3OOCA 4Z9CB 3E0JA 4HCEA 3ERQA 1NR2A 1RODA 3I91A 3PO3B 2HDMA 2SNMA 5EBDA 2F0OA 3VR3A 3FVQA 4ABNA 1LTTD 2A6HC 2PCFB 2TMPA 4DK0A 4C3JB 1HFGA 4EGVA 2WIIB 1A2TA 1TWFB 2F0HA 2WB1B 2DNEA 3EROA 3RLFA 2A6HD 1V8QA 1BCPC 2B2TC 1NSNS 3FRPB 2HDLA 3X3MA 1BF4A 2D5DA 3OIQA 1HQMC 2F1MA 4BBRB 1OXVA 1EEID 3T4AC 1BCPD 2QCPX 4XQNA 3HOZB 1WVLA 5I2XA 1ZEQX 5BN3A 4X3UA 1KABA 2A73B 3ZYYX 1YNJC 4CKEA 4JK1C 3BDCA 2EZVA 3IFDA 2N55A 2F0KA 1FNUA 5E3FA 3K5OA 5IODA 4KD4A 4L8JA 2Z8LA 1ICWA 4CJ0B 3PIO3 2F0TA 3AU7A 5EPKA 4R8IA 4F7XA 4WRDA 4XXEA 4FYDA 1Q1BA 3QO2A 3W2DA 1JWMD 2HUGA 2KEEA 4KY5A 2O5JC 2XRSD 3I72A 1SNMA 5ELBA 1R9TB 1FYCA 1RKNA 2QKIC 5CV8A 2BDNA 2LMCB 3A54A 2WV6D 3QJYA 4FF3A 5JOBA 1WCMB 1GHKA 2ZT9C 2EJMA 3PMFA 1AP0A 3L3OC 1TY0A 1M4VA 1VF7A 1NUCA 1SYGA 3K57A 2B2UC 1Y1WB 2EE1A 3VYUA 1HFNA 2JEBI 5CC4A 4KHZA 1EWCA 4QUFA 1SYEA 4PNYA 1I4RA 5I9PA 3NXWA 1V1PB 1MD2D 3E6ZX 4QF4A 5DEHA 4OGQC 3MEHA 5CV9A 5KNCA 2B2YA 3J80L 2F0JA 2B8FA 2ICIA 2NVQB 1RTOA 3TSSA 2FMCA 3PUYA 4AYBB 1RCVD 4ID6A 1NR4A 5CR3A 5JVG3 2IT1A 5C0XH 1LT5D 3FPUB 4A3JB 2K6AA 5JJZA 2NN6G 3T13A 4HCSA 3EA6A 3S2DB 3ND9A 4IN3A 4IUNA 4XQJA 2JSOA 1QNKA 3VA5A 5EKLA 1F77A 2MHVA 5C4ZA 1EY5A 2RSOA 4MIUA 3S2HB 3SR1A 3A7AB 1I4HA 3HOXB 1GUTA 3T53B 1T5EA 3OW7A 4WJWA 3A8IE 1H9MA 4K6DA 1SE2A 1IW7D 4QCLA 3OMGA 5HURA 2J4XA 3VYSA 4RGNA 2MP1A 4ZLTF 2BA0A 2I07B 2ICEC 1E2WA 1IHZA 1SYBA 1UEAB 2Z4IA 1XXGA 4XQQA 4G4KA 2B2TA 2NZ1D 4DNRB 1SFOB 2K5WA 1TS4A 2KCCA 2F0IA 1IYUA 1J9OA 1Q1EA 2AWNA 4OHJA 5FOBB 1T5XD 4ZUJA 4KY6A 2DY8A 3NTHA 4RA8A 1OXUA 3FKIB 4FP5D 4RCOA 1STNA 4OO1I 1HA6A 3QG1A 5I9OA 2FMMA 3GTKB 3I70A 4DN4M 4ZRZA 3MHBA 3JAME 3NP8A 4XIGS 1E2ZA 2F0LA 1SSOA 4OL7A 1BXTA 5M3MB 1PFNA 4HMIA 3S16B 2MUYA 5J22A 1AFPA 2E75C 3QOJA 2EYHA 3NUCA 4XYOA 2NTSA 1EU3A 1L0YB 1CI3M 1BUVT 4PMBA 3TBIB 2F03A 1Z7TA 3OSOA 1QNUA 4KI0A 3D6WA 1PFMA 2RDFA 2WINB 3WOFA 1V1OA 3TZDA 5EKKA 3GTOB 1ESFA 1EYDA 2B2UA 4EQOA 1SAPA 3QIAA 4N9PA 3MVVA 1H9RA 1OXSC 2K04A 1HTPA 5CBAE 2NVXB 1AZQA 2L0CA 1RD9D 5M3FB 4DU9A 1CM9A 1ESRA 3MXPA 2KQ3A 3MXGA 5E1FA 1K83B 4KJNA 1DYQA 4PQXA 1EIGA 2SDFA 3ND8A 3K5NA 1WD0A 1E2VA 3RZDB 1D5ZC 4C3HG 5D14A 2KJXA 4FXGC 3BS1A 1HA5A 1GUSA 3KK7A 1CA6A 5KNDA 1PTOB 1TWAB 5C0XG 5T1IA 1CA5A 2QDBA 3AB9A 5E4XA 4KD3A 1V1PA 3DWAA 1JICA 1EY6A 2QILA 5G3LD 1CZWA 4E6IA 2KECA 5ISRA 1STEA 3U9OA 4DF7A 2H4OA 1LACA 3EQLC 1FNVA 3NWSA 3ONAB 2AUJD 3TN2A 3BYTB 5C0XI 3GTQB 1CT1D 2RBMA 1SNQA 2K28A 3R8BA 4UDUC 4C3IB 2F0FA 2A6EC 5E4WC 3QB3A 4RCNA 2AUKA 1PTOC 4IFDJ 4RH6A 4ZAIA 3HOVB 3MWYW 1SXTA 3VR5A 2A6ED 5BN5A 5J39A 1PTOD 1EEFD 3GV6A 3EJIA 3Q6SA 2K7VA 5LL6S 1JCKB 2PZTA 3SHLA 2BE5C 2JYOA 5COYA 3P75A 2NVYB 4BS9A 3DMUA 2Q8RE 4BY7B 2AQ3B 2K33A 1ENAA 2ZXPA 3D4DA 4HTHA 2BE5D 4IUQA 2BOSA 1LTSD 5IOCA 5EGTA 4CKCA 5EKIA 3IL8A 4B08A 4CGYB 4CJ1B 2E2JB 1WD1A 3A8KE 1SNPA 5J1ZA 2RQXA 3M7GA 4J6HA 1ENFA 3K0YA 5C5MA 3DWPA 2O2LD 4EVOA 2F0WA 3CKIB 5D65A 2K5DA 2WP8J 4KN4C 4R8NA 4O42A 3JAML 1IKLA 5I6WA 2EJFC 5EPLA 1WTVA 4IUUA 1O80A 4U673 3Q24A 1PZKD 1TT2A 1KNAA 2G9DA 1HHVA 3J7AV 1RTNA 1HPCA 2F4IA 1WTWA 1Q12A 2PZUA 3C1FA 1ENCA 3I3CA 5C3WA 1TWCB 1PRTF 2K03A 2Q8IB 4LJZC 4TQUS 2FFKB 3TP5A 1B44D 2XWBB 2EDGA 1AEXA 3OIPA 5K36H 1JORA 4HN7A 2L9HA 4BA1I 1XWEA 4ILWA 2CHBD 1GUOA 1G91A 1QG7A 1EYCA 1JB3A 2CQAA 3HEJA 4IFDH 1EFID 1LO5D 5IIFA 2EY1A 4KY7A 3GTGB 3NE5B 1KLUD 3RMHA 2F0VA 4L63B 3L9AX 1PZID 2KUMA 4OO1H 1DXMA 3KF8A 3MFYA 2Z4HA 3K5LA 3SK4A 3V05A 2VB3X 1J8IA 1EZ8A 2MJ8A 2EYMA 1KNEA 4ODGA 3V2TA 1STAA 5CV7A 2MPMA 5JEAH 2LS01 2NTTA 2E2IB 1CQFA 5FLXE 2PPBC 1S5DD 5KIXA 3PIP3 4N9TA 3D8GA 2VNUD 1O7LA 1QCBD 5C5LA 2N88A 3NTKA 1TS5A 1O7YA 2A69C 3RZOB 5JPNC 1DD2A 4IUTA 1LLRD 4K8IA 3FDTA 2JA6B 3DM1A 2PNRC 2A69D 3OWEB 1PLFA 2O5IC 3G7LA 4R9WA 2F0GA 2PMZB 5KYIA 1B2TA 3RUZA 2IX0A 4RAUC 3PUZA 5C4HA 4FVMA 1SE3A 3FEWX 1S5ED 1VF5C 1CHPD 3R3OA 3SEBA 4J8QA 4RFBA 4X3TA 4NMZA 1JR0D 1KLGD 3UI2A 3I4LA 1W6KA 1SJHD 5IGGA 4G7OC 1H9JA 3J7YW 1Y8OB 2JA7B 2AQ2B 2PZWA 3MTSA 5HGTA 1SYCA 4BY1B 2FINB 1QWYA 1OXXK 1KDCA 4ULLA 2F0EA 4ZKBB 1K8MA 3NBIA 4Q5VA 1GXDC 4KHVA 1C8CA 2OF1A 2R6GA 2AQ1B 3M4YA 4B9WA 3HOUB 2X6GA 2JP1A 4QB4A 2XVSA 2AWOA 1BCPF 3KLSX 1U4LA 3ITPA 1EIHA 2NB0A 1Y8PB 4L6TB 2F0SA 1CFMA 1IW7C 3MC0B 2K01A 3G6JB 2MGSA 1PZJD 1OO9B 1A6XA 2QEJC 3S1MB 4K2KA 1S4ZA 5KGUA 5K36G 3S15B 1BR9A 3CU7A 1EWHA 1EY4A 3SK8A 5I6YA 1LABA 4EQNA 1H9KA 1Y8NB 2EY5A 4ZKCB 1KTKA 2OEOA 4HMJA 2OT2A 5T1GA 1Z6HA 3AMUA 5C3EB 4FF2A 2EYJA 5DAUA 1PYWD 1W6JA 1EQTA 4OO1G 3H94A 1SNCA 4YIJA 2XWJB 3TP6A 2K1BA 4A3BB 4IUPA 1R4PB 3T51B 2Y0SB 5C44B 1PMRA 3BVMA 5JEAG 4IFDI 3MAQA 3NBHA 1C4QA 2XSCA 1Y69U 2QF7A 2F0MA 4H44C 1KDAA 2K32A 1U4PA 1ONLA 4A3GB 2HCCA 1A2UA 1AW7A 1A3TA 5FLXL 5JPMC 2F0QA 3PV0A 1NCVA 3DXJC 1MSHA 2DY7A 3EVQA 4CKBA 2EPBA 2HQEA 4KTAA 2BCOA 4F87A 2F0NA 1PXUA 3HOWB 3NQIA 1DOLA 2ID0A 2EYLA 2RDGA 1BDOA 4XT1B 1RDPD 2EJGC 1I4QA 2EVBA 1EQVA 1I6HB 3A55A 5BN4A 4KKUA 4IALA 1DJRD 3M4OB 1KDBA 1CHQD 4MHEA 4CJ2C 3C1EA 1DOKA 3Q0AA 1DZ1A 4KN7C 3RD4A 2KVMA 4IUVA 4DAVA 4PMWA 4IZ8A 2SNSA 2R93B 3TZUA 2D2CC 3PUVA 3WDNA 2CVRA 4H13C 2EYPA 1EYAA 1B1ZA 1STBA 5ELEA 2NBFA 1TVXA 2EYOA 1BO0A 1F2YA 1TWGB 2X6LA 2RDHA 1D5XC 3GP7A 3S1QB 4XYQA 4KKTA 3N52A 1TS3A 3HS0C 3DEPA 5M5YB 5DM63 2PW5A 4K5VA 3DWQA 2IX3A 5JAVA 1VCIA 2WKCA 4KV6A 1TKWB 3NHHA 3GTLB 4F8MA 3M85A 2IPKD 3HZXA 4P2CB 1EOTA 1F9SA 1SYFA 1ZXTA 2ZXOA 4TRDA 1D1KA 1Y1VB 1H9SA 4K14A 5I4DA 4NDXA 2B2VC 4V190 2NVTB 3H09A 2E2DC 5M5XB 1TY2A 2F0PA 1JE4A 4PV1C 1XYIA 2BDOA 1CQVA 1F9RA 2M2LA 2IX1A 1CTMA 5D3IB 5M9OA 2NYZD 4A3KB 3Q22A 4C2MB 2RA4A 2A74C 5LL6X 4I65A 3CRKC 1D6EC 2Q8TA 1GUGA 1SJED 1AZPA 4C3IG 4OIKA 3GTJB 4ME5A 1STYA 4DXFA 4C1NI 1BNZA 2L11A 2F0UA 1IKMA 2RSNA 1S5CD 3L7ZC 3SVMA 1X32A 1IYVA 1BQQT 3K6OA 1SDFA 5F2DA 3P7JA 1LV9A 1Q3LA 1YNNC 4ZQ3A 5C6AA 3BYYB 3D31A 4DGZA 1U4RA 1OXTA 1QILA 2K5QA 3URYA 4HEDA 1NAPA 3KBXA 1TIID 3I8ZA 5CYUA 1SYDA 1YNND 5KNBA 4C56C 1PFBA 1TS2A 2M9VA 4I7ZC 5DNFA 2LY7A 2JXMB 1JQYD 3I73A 2A5HA 2L12A 2EOTA 4XT3B 4NKLA 1SE4A 3HOYB 1WTXA 2L4NA 2GA4B 3VYTA 1EY7A 1WTPA 5M5WB 3DEOA 3N6RA 1JOQA 1GUWA 1RF2D 3NSWA 3WOEA 4O1NA 2EXZA 5FO9B 2L55A 1HUNA 3CQZB 5KEEA 2E74C 2NN6H 4DK1A 2IL8A 5G3LF 5CMDA 2PQEA 1TQOA 5LHY1 1VMCA 4HR7B 5CV5A 1PDQA 3S14B 3BG3A 4WORA 3OPOA 1I4XA 4K5WA 4DXGA 1JC7A 3SE0A 1F2ZA 3VR2A 2R3ZA 1A3UA 2JA5B 1V43A 3NWTA 5IGFA 1BBXC 3H91A 4A3DB 1S5FD 1PTOF 2EY2A 1HUMA 3PUXA 2JE6I 3BZDB 1MBYA 4V0BA 3IFTA 4G7ZC 1M8AA 1LTID 1QE6A 3MA2B 2B2WC 2RKSA 4K6LA 5AFWA 4C3JG 1SNOA 2YYZA 5IGBA 1R4QB 5CV6A 4FXDA 2B8GA 1B53A 2A68C 4A3FB 3MXUA 3Q23A 4Y7NB 2KOLA 5KRUA 4X3SA 3J7AF 4TKOB 5C0XJ 3M7NA 2B2VA 1JWUD 2A68D 3S9WA 3K7AB 1B9MA 2VXWA 4FXKC 2WAQB 4A3IB 3TP8A 2L1BA 2XN9C 3BVGA 1YNJD 1C48A 4JBWA 4A3MB 1HQRD 2Z1CA 4PMCA 5FK9C 1HXYD 1GUNA 1TR5A 1ZKOA 3PO2B 4FF4A 3I4MB 3A56A 2B63B 4CHTB 5EBCA 2R61A 1K8OA 5IGEA 2C5CA 4HSVA 2PO4A 1D5MC 3F2UA 3MXNA 2H1EA 3OMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WRD A;  1F2M A;  4KHV A;  2PYK A;  4HMI A;  3TP7 A;  1EY6 A;  2O4X A;  1EY5 A;  2EY2 A;  2OF1 A;  4KJO A;  1A2U A;  2NUC A;  5C4Z A;  1A3T A;  1EY0 A;  4RKB A;  5KIX A;  4KY5 A;  1KAA A;  4MIU A;  3SR1 A;  2F0D A;  5F2D A;  1TT2 A;  3D8G A;  3H6M A;  4N9T A;  1SNM A;  2F0Q A;  4ZQ3 A;  3P1H A;  5C5L A;  4B9W A;  3D6C A;  4K2L A;  4E6I A;  2EYF A;  4QB4 A;  4NP5 A;  4DGZ A;  5ISR A;  3QOJ A;  2EYH A;  3NUC A;  4G57 A;  3U9O A;  2LKV A;  4DF7 A;  1RKN A;  2PW5 A;  4K5V A;  5CV4 A;  4K6D A;  4H7B A;  4PMB A;  3SK6 A;  3TME A;  3OMG A;  2PZU A;  2RKS A;  5JAV A;  5CV8 A;  3SK5 A;  3C1F A;  5HUR A;  1ENC A;  3ITP A;  1SYD A;  4RKL A;  1SNO A;  4KV6 A;  4S3S A;  5JOB A;  5C3W A;  3ERQ A;  3NHH A;  1SND A;  3EVQ A;  4K8I A;  4F8M A;  2RBM A;  3OSO A;  5IGB A;  3PMF A;  5IGC A;  2HQE A;  1SNQ A;  2SNM A;  1JOO A;  2F0S A;  4K5X A;  2F0O A;  5CV6 A;  2F0F A;  3HZX A;  2RDF A;  3SXH A;  1SYF A;  3T16 A;  3QB3 A;  5EKK A;  4DFA A;  3TP5 A;  1NUC A;  1SYG A;  1EZ6 A;  5C3X A;  3NQT A;  1IHZ A;  1AEX A;  1SYB A;  4KTA A;  4TRD A;  5KRU A;  2F0N A;  4QMG A;  1JOR A;  4NKL A;  1EYD A;  2F0G A;  4K14 A;  4NDX A;  4K2K A;  5K5P A;  4EQO A;  5C6A A;  4N9P A;  5CC4 A;  5KGU A;  2EYL A;  3MVV A;  1A2T A;  3LX0 A;  2F0H A;  5KYI A;  3S9W A;  1EY7 A;  5CGK A;  3ERO A;  1EY8 A;  5J22 A;  2F0P A;  5J39 A;  1EY4 A;  3SK8 A;  3RUZ A;  1NSN S;  1SYE A;  4PNY A;  1JOQ A;  3EJI A;  5I9P A;  1II3 A;  3NXW A;  1EYC A;  4EQN A;  5I6Y A;  1A3V A;  2EY5 A;  2PZT A;  3TP8 A;  2EXZ A;  4QF4 A;  1EQV A;  3SHL A;  5KYL A;  2F3V A;  3HEJ A;  5C4H A;  2OEO A;  2KHS A;  3D4W A;  3DHQ A;  4DU9 A;  3QOL A;  5IIF A;  5KEE A;  4F7X A;  4HMJ A;  5DEH A;  2EY1 A;  3MXP A;  3P75 A;  2F0I A;  2KQ3 A;  3DMU A;  3MEH A;  4IAL A;  4KY7 A;  4LAA A;  5E1F A;  1KDB A;  3VA5 A;  5M9O A;  3R3O A;  4EQP A;  2WAC A;  4KJN A;  2PQE A;  5CV9 A;  3C1E A;  2F0V A;  1TQO A;  1ENA A;  2PW7 A;  3D4D A;  3MZ5 A;  4HTH A;  4NMZ A;  4I65 A;  2F0J A;  2M00 A;  4PMC A;  4ZUI A;  5CV5 A;  2EYJ A;  1KAB A;  5DAU A;  4ZUJ A;  3SK4 A;  4KY6 A;  2ENB A;  4WOR A;  1SNC A;  1EZ8 A;  4YIJ A;  5IOC A;  5EGT A;  5IGD A;  1STN A;  4J1M A;  5IGG A;  3TP6 A;  1STG A;  2EYM A;  3BDC A;  5I9O A;  1TR5 A;  4IZ8 A;  4ODG A;  3V2T A;  2SNS A;  1STA A;  4K5W A;  1EY9 A;  3E5S A;  5CV7 A;  4ID6 A;  2OXP A;  2PZW A;  5CR3 A;  1SNP A;  2F0K A;  3BDL A;  5E3F A;  5J1Z A;  5IOD A;  4J6H A;  4KD4 A;  4K8J A;  3MHB A;  5HGT A;  2EY6 A;  1SYC A;  4ME5 A;  5C5M A;  3NP8 A;  4EVO A;  2SOB A;  1F2Z A;  2F0W A;  2EYP A;  1EYA A;  2F0T A;  1A3U A;  2F3W A;  2F0L A;  5NUC A;  3NK9 A;  1STB A;  1STY A;  1STH A;  3T13 A;  4B9X A;  5IGE A;  1KDC A;  2QDB A;  5IGF A;  2F0E A;  3OWF A;  4IUN A;  4OL7 A;  4KD3 A;  4R8N A;  1JOK A;  2EYO A;  2F0M A;  1F2Y A;  5EKL A;  2F0U A;  5I6W A;  1KDA A;  1U9R A;  3OMC A; 
#chains in the Genus database with same CATH topology
 2CH4 W;  1BVS A;  2VQE L;  4DAY B;  1ZYR C;  1U4M A;  4A75 A;  1IXR A;  2O4X A;  2ZTE A;  1EY0 A;  1I6H H;  1UE5 A;  4HJA A;  1L1O A;  1CK1 A;  3GTM B;  3M4O H;  3GTO H;  1P8L A;  5JVH 3;  1G2S A;  1WTR A;  2LKV A;  1HCZ A;  4DR7 Q;  3M3Y B;  1MSG A;  4XTC S;  1UWV A;  1ZYR D;  1H9S B;  3RN2 A;  1Y1W G;  1WOC A;  3X3N A;  3S17 B;  2QW7 A;  4Q0F A;  2NVX H;  2R92 B;  4PZ6 A;  2IW3 A;  2Q2H A;  4DV2 Q;  5IYC G;  3B6Y A;  4DFA A;  1EZ6 A;  1IBK L;  1LTA D;  1CKN B;  3HG9 A;  4QMG A;  1K83 H;  1UNS A;  5FKA C;  1UUP A;  2JA7 G;  2UXC L;  1TU2 B;  2DNC A;  2VL6 A;  5TSS A;  2D62 A;  3U9S A;  3O13 A;  3KLR A;  4HSP A;  1HR0 L;  4GZY C;  1SEB D;  4JI1 Q;  4F88 A;  4X3K A;  2C9O A;  1YJN A;  1IL8 A;  1TWG H;  4LNQ A;  4AYB E;  4GNX B;  4IJL A;  4RGO S;  1LT6 D;  5KYL A;  3S1Q H;  3CD6 A;  3NTI A;  3QOL A;  1JT8 A;  1KL9 A;  4LAA A;  4YCU A;  1LTR D;  1BOS A;  1GOZ A;  4GKK L;  1SBB B;  5FO7 B;  1B3A A;  4AYB G;  1VQO A;  2PW7 A;  1PTO H;  4DA2 A;  1TWA H;  4UAI A;  4RHS A;  3W3A A;  4A3J G;  2PNH A;  1ET6 A;  4QL5 A;  3J81 E;  1B4O A;  4UHV A;  3FPP A;  1G6Z A;  1VQE A;  2OXP A;  2K4K A;  1HTL D;  2CW0 C;  3NPP A;  3S1N B;  1I4P A;  4JI2 Q;  4IFD G;  4KHP L;  1I94 L;  2RVL A;  2F3W A;  2NN6 I;  5M5X H;  1VQF A;  4GNX C;  3MFG A;  3AEV A;  1RHP A;  4EX5 A;  2CW0 D;  3GTQ H;  4X64 L;  1K28 A;  3CC2 A;  2XNA C;  5C4X B;  3TP7 A;  4KJO A;  1XTD A;  1FD7 D;  4G7H C;  4GN4 B;  5A2Q E;  2VUM B;  1FVI A;  4BBS B;  2EQS A;  3P1H A;  5CBE E;  3D6C A;  5D3D A;  4QUC A;  2YU9 B;  3P20 A;  2XRQ D;  1X3Q A;  4H7B A;  3SK6 A;  1DM0 B;  3HOV H;  3T56 B;  1S3O A;  2ZXR A;  3CP0 A;  3SK5 A;  2FHT A;  3CHB D;  2B2W A;  1I4G A;  4JOI A;  2TSS A;  1SND A;  4M8A A;  3NEN A;  1YJ9 A;  1MGS A;  4YCV A;  1ILP A;  1O78 A;  3HKS A;  2D9U A;  5FO8 B;  4FO2 A;  1JOO A;  5C3E G;  2RF4 A;  2KCN A;  3SXH A;  1GD7 A;  3T16 A;  3C2P A;  2KCM A;  1SMY C;  5C3X A;  3CCQ A;  4GOP A;  5A35 A;  3GV3 A;  2KED A;  2NVY H;  1KD1 C;  4A3B G;  1Q8I A;  3HKZ B;  1G2T A;  4QGU A;  1XTC D;  1VDZ A;  1AN8 A;  2Z6B A;  2E76 C;  2BA1 A;  2DN8 A;  1I50 B;  1MI2 A;  1SMY D;  2E2H B;  4YHH Q;  4DUZ Q;  3JAM c;  4DNT B;  5BR8 Q;  3TDQ A;  3PF5 A;  2J7Z A;  1PH7 A;  2NWG A;  2I46 A;  2X69 A;  1QOH A;  1YJW A;  2G9H D;  5IT9 E;  1O7I A;  1Q8K A;  3GTP B;  3PUW A;  2UUC L;  3AFQ A;  4EQP A;  2C35 B;  2L5T A;  1F9P A;  4H0L C;  2ZJP A;  2P5Z X;  3HGB A;  3LNN A;  1DOM A;  2I5H A;  5IGD A;  2K14 A;  4J1M A;  2HCI A;  3K5M A;  1VQ5 A;  3KBG A;  4DV0 L;  3R2T A;  1LTG D;  5M3M G;  2SEB D;  5LMN W;  4DAP A;  5EQ0 A;  1D1I A;  2EY6 A;  5ELO A;  1S5B D;  4ZK9 B;  1CZG A;  2UUA L;  1G6P A;  1Q90 A;  1YI2 A;  1CUK A;  3HOY H;  4JI3 Q;  3SDZ A;  1MKH A;  4B9X A;  3NK9 A;  1HNX L;  3HOW G;  4MN3 A;  4IPH A;  2IJ0 A;  4KKS A;  5M5W H;  1JOK A;  1U9R A;  1G29 1;  1YBY A;  4CBV A;  4CDC C;  1N8R C;  3OHX C;  4RKB A;  1CKO A;  1KAA A;  2F0D A;  3DUZ A;  3HRZ C;  3D4R A;  3CQZ H;  4ZYS A;  4JBK A;  3KLS A;  4K2L A;  2EYF A;  3V96 A;  4NP5 A;  1MHW C;  3A8J E;  1DCZ A;  1PRT B;  3I2Z A;  4DR6 Q;  1EWI A;  3A74 A;  3HP3 A;  1D2B A;  4DV4 Q;  3M4Q A;  4C3H B;  1LT3 D;  4PZ8 A;  4RKL A;  4BA2 I;  1I6V C;  4A93 B;  1Q82 C;  3S14 H;  1BKB A;  3H3V C;  4LK1 C;  2KBN A;  2CQO A;  1X3P A;  4K5X A;  2I5L X;  4LF8 L;  2AMC B;  5COR A;  1KRS A;  3A7L A;  1QVG A;  1KC8 C;  3NQT A;  4LF9 L;  5EJW A;  4IQZ A;  1QB5 D;  3GD7 A;  5ELF A;  5K5P A;  3G6E A;  5M3F G;  2B39 A;  4JI1 L;  1V9P A;  2RHS B;  1EY8 A;  4YWM A;  3C46 A;  1O7Z A;  4DAY A;  2UXB L;  1II3 A;  3UE1 A;  2Z6K C;  4A3D H;  1A3V A;  3KLW A;  3CXC A;  1XX8 A;  1ML0 D;  2KHS A;  1PRT C;  3DHQ A;  5C4J B;  1IYJ B;  3QWN A;  5JJI A;  5LMU L;  1RJT A;  1EOV A;  1LTB D;  4HAE A;  4DV3 Q;  2Q2U A;  1HNZ L;  3GO5 A;  2M00 A;  1PRT D;  1UAP A;  4FF1 A;  3TQY A;  3M9B A;  4DV1 L;  3IAY A;  3GDE A;  3I56 A;  4B3S Q;  1STG A;  2R7Z B;  1BBW A;  1GHJ A;  1E0B A;  4A3F H;  4IPG A;  4NPS A;  1B9N A;  2BH2 A;  4JI2 L;  4OIJ A;  3BDL A;  1CKN A;  1YNX A;  3J81 L;  2NZH A;  1Q7Y C;  3BDO A;  3FMC A;  2HHH L;  1VMP A;  1Q81 C;  5EPJ A;  1V1Q A;  5ELD A;  2FJ2 A;  3OYY A;  4FNF A;  3K7A H;  2VY3 A;  3GQB A;  3OWF A;  5DLQ E;  4RGT A;  1ILQ A;  1WTQ A;  3KUP A;  1B7Y B;  2F3V A;  4GNX A;  1F2M A;  2PYK A;  4A3I H;  2IWH A;  2NUC A;  4DKA C;  2J0T D;  1Z47 A;  2K05 A;  3LWU A;  2K5N A;  1EU4 A;  4TSS A;  5IWA Q;  4G57 A;  2XIW A;  1X3E A;  1YHA A;  5CV4 A;  1WTO A;  2OQ0 A;  1A15 A;  3TME A;  1PYB A;  5A2Q L;  4DUY Q;  1GJX A;  2A8V A;  4S3S A;  4BWG B;  3KDF B;  5IYD G;  5FLM H;  3HOV G;  4C1N K;  4M1U B;  1HRJ A;  5IGC A;  3F8T A;  1VQC A;  3BVZ A;  3CRL C;  2QGQ A;  4KK7 A;  1FGB D;  2JEA I;  3H0G B;  3PO2 H;  4U68 A;  3LWE A;  3C3L A;  1X56 A;  3I4M H;  2B63 H;  3CCV A;  5JEA J;  2VB2 X;  2LFN A;  1G8Z D;  4YHH L;  4FDB A;  3LX0 A;  3J80 c;  1EL0 A;  5CGK A;  3VR4 A;  4CDD C;  4BY7 G;  4AH6 A;  1JWS D;  5GAH C;  4IUR A;  2N78 A;  3K59 A;  4RGM A;  1N33 Q;  2KA7 A;  3S1R B;  4RWS C;  1E3P A;  4IOC A;  2K50 A;  2LSS A;  1JJ2 A;  5ELC A;  4R4C A;  3R2I A;  3D4W A;  1UEB A;  3J80 E;  4L5R C;  4LMQ D;  1I3Q B;  1IBL Q;  3GTM H;  3I90 A;  2B2Y C;  4LUV A;  4WFN 3;  2WAC A;  4BY1 H;  1F2L A;  3VR6 A;  4X66 Q;  3ULL A;  3MZ5 A;  5IT9 L;  2WKD A;  2N3S A;  4ZUI A;  1HH2 P;  2GVA A;  4O0A A;  3K58 A;  3I4O A;  1PHJ A;  2ENB A;  3MEF A;  1ET9 A;  1L0X B;  4QIW B;  2R92 H;  1A8V A;  3CC4 A;  3TS0 A;  4AQY L;  1B50 A;  3D3R A;  4KMU C;  3VDY A;  1EY9 A;  3E5S A;  3VA7 A;  4A3E B;  3VYR A;  3HOU H;  4K8J A;  4JI3 L;  4DR3 L;  1C0A A;  3R93 A;  2SOB A;  4RHR A;  3IRB A;  2F4V Q;  4MTK A;  3I4N B;  2EIF A;  2F3I A;  5NUC A;  4NW2 A;  1STH A;  5I2Y A;  1TWH B;  2JA8 B;  3KFU A;  1N34 L;  4OX9 Q;  1FR3 A;  4XDX A;  3HOY G;  2A19 A;  1RIP A;  1BCP B;  1DON A;  1EQQ A;  2V4D A;  2CWP A;  4DR6 L;  3H6M A;  1LT4 D;  1XMO L;  3EFX D;  4JI5 L;  4DV4 L;  3S1M H;  3IKJ A;  1QJO A;  1F9Q A;  5DM7 3;  1FNW A;  3OOC A;  4Z9C B;  4LFC Q;  3E0J A;  4HCE A;  3ERQ A;  1NR2 A;  1ROD A;  1NJI C;  3BZK A;  3PIO A;  4B3R Q;  3I91 A;  3PO3 B;  2HDM A;  2SNM A;  5EBD A;  2F0O A;  3VR3 A;  3FVQ A;  4ABN A;  4DK3 C;  1LTT D;  2A6H C;  2PCF B;  3G48 A;  2TMP A;  1IL2 A;  4DK0 A;  4NXN Q;  4C3J B;  3S1N H;  1HFG A;  1S40 A;  1LYL A;  4EGV A;  2WII B;  1A2T A;  1TWF B;  2F0H A;  4OEM B;  4JOI C;  2WB1 B;  2DNE A;  3ERO A;  3RLF A;  2A6H D;  4JG2 A;  1V8Q A;  1BCP C;  2NZO A;  2B2T C;  1NSN S;  3FRP B;  2HDL A;  4DR2 Q;  3X3M A;  2PQA B;  1BF4 A;  1CSP A;  1PH6 A;  2D5D A;  3OIQ A;  1HQM C;  2Z6K A;  2F1M A;  2I0Q A;  4BBR B;  5FLX c;  4IOA A;  1OXV A;  1EEI D;  4IO9 A;  4A3D G;  3T4A C;  2VUM H;  4BBS H;  1BCP D;  3CCR A;  1SE8 A;  5C44 H;  2QCP X;  4XQN A;  3HOZ B;  1WVL A;  3J7Z C;  5I2X A;  1ZEQ X;  1VQB A;  3TEH B;  5BN3 A;  4X3U A;  3A0J A;  1KAB A;  2A73 B;  4B3S L;  3ZYY X;  1YNJ C;  4CKE A;  4ALP A;  4JK1 C;  2FXQ A;  3BDC A;  4A3G H;  2EZV A;  4R4T A;  3IFD A;  2N55 A;  2F0K A;  1FNU A;  5E3F A;  3K5O A;  5IOD A;  4KD4 A;  4A3F G;  4L8J A;  3Q8D A;  1MJE A;  2Z8L A;  1ICW A;  5IP7 H;  4CJ0 B;  3PIO 3;  2F0T A;  3E3X A;  2WAQ E;  3AU7 A;  1I50 H;  5EPK A;  1AE2 A;  4R8I A;  4F7X A;  4WRD A;  1NMF A;  4XXE A;  4FYD A;  1Q1B A;  3QO2 A;  3W2D A;  4LF6 Q;  1JWM D;  2HUG A;  2KEE A;  4KY5 A;  3OTO Q;  2O5J C;  2XRS D;  3I72 A;  2WAQ G;  1SNM A;  4A3I G;  5ELB A;  2ZJQ A;  4LW1 A;  3GTP H;  1R9T B;  1FYC A;  2PMZ E;  1HZ9 A;  1RKN A;  3K7U C;  1SRO A;  2QKI C;  5HY6 A;  5CV8 A;  2BDN A;  2LMC B;  3A54 A;  2WV6 D;  3QJY A;  4FF3 A;  5JOB A;  1WCM B;  1GHK A;  3ER0 A;  4X65 L;  2ZT9 C;  2F52 A;  2EJM A;  3PMF A;  1AP0 A;  3L3O C;  5FLM G;  1TY0 A;  1UE6 A;  4UP7 A;  1M4V A;  1VF7 A;  4LF4 L;  1NUC A;  1SYG A;  2N49 A;  3K57 A;  2B2U C;  1YIJ A;  2EE1 A;  1Y1W B;  3VYU A;  1K3R A;  4B3M Q;  1HFN A;  3PO2 G;  3CCE A;  2JEB I;  5CC4 A;  3I4M G;  1PH8 A;  2B63 G;  4KHZ A;  3PGZ A;  4POF A;  1EWC A;  4QUF A;  1SYE A;  4PNY A;  1I4R A;  5I9P A;  1PH3 A;  3NXW A;  1V1P B;  1MD2 D;  1NBW A;  4DR5 Q;  3E6Z X;  4QF4 A;  1IBL L;  2ZM6 Q;  4X6A H;  2MQH A;  5DEH A;  4OGQ C;  3MEH A;  2R93 H;  4X66 L;  5CV9 A;  4N8X 1;  5KNC A;  4YWK A;  2B2Y A;  2E5L L;  4QQB X;  3J80 L;  5E7N A;  2F0J A;  2B8F A;  2ICI A;  4C3H H;  3KDF A;  2ZJR A;  4BY1 G;  3RR5 A;  4YWL A;  2YTV A;  1ASZ A;  4A93 H;  2NVQ B;  3M4P A;  1G51 A;  1RTO A;  1E1T A;  5GAG C;  3TSS A;  2FMC A;  3PUY A;  4QY7 A;  4AYB B;  1B70 B;  1RCV D;  4ID6 A;  1NR4 A;  5CR3 A;  2XGT A;  5JVG 3;  4IPC A;  2R92 G;  1VQG A;  2IT1 A;  5C0X H;  2HIV A;  4DAM A;  2F4V L;  1ASY A;  1LT5 D;  3FPU B;  4A3J B;  2K6A A;  5M5Y H;  5JJZ A;  2NN6 G;  3HOU G;  4TVA B;  3T13 A;  4HCS A;  3EA6 A;  3S2D B;  3ND9 A;  4IN3 A;  4IUN A;  4XQJ A;  2JSO A;  5GAD C;  1QNK A;  3VA5 A;  5EKL A;  3GTL H;  2KHI A;  1F77 A;  2MHV A;  1C7Y A;  5C4Z A;  1EY5 A;  2A1A A;  2RSO A;  4LWC A;  2Z0S A;  4J15 A;  1EYG A;  4MIU A;  3S2H B;  3A7A B;  3SR1 A;  1I4H A;  1HZC A;  3HOX B;  1GUT A;  5C4J H;  4UY8 C;  3T53 B;  1E22 A;  1T5E A;  3OW7 A;  2L15 A;  4WJW A;  5LMN L;  1Y1V H;  3A8I E;  1H9M A;  4K6D A;  1SE2 A;  1IW7 D;  2JK8 A;  4QCL A;  3OMG A;  2J4X A;  5HUR A;  2NVT H;  3VYS A;  4RGN A;  2MP1 A;  4ZLT F;  4GS3 A;  1FJG Q;  4L5Q A;  2BA0 A;  2I07 B;  4MZ9 A;  4JVZ A;  2R7Z H;  2ICE C;  4DPG A;  1E2W A;  4OWX B;  1IHZ A;  1SYB A;  3ERS X;  1UEA B;  1X65 A;  2Z4I A;  3F2B A;  1XXG A;  4A3K H;  2HD3 A;  4XQQ A;  4C2M H;  4G4K A;  1HNW Q;  2AHO B;  1X9N A;  2RHQ B;  3T1Y Q;  2B2T A;  2NZ1 D;  4DNR B;  1SFO B;  2Y0S E;  2K5W A;  3A5U A;  1TS4 A;  2KCC A;  2CWA A;  2DJG C;  2F0I A;  1J5E L;  1IYU A;  1JMC A;  1J9O A;  3GTJ H;  1Q1E A;  2VUM G;  2AWN A;  4OHJ A;  5FOB B;  4BBS G;  2Y0S G;  5C44 G;  1T5X D;  2I5M X;  4DV5 L;  4ZUJ A;  4KY6 A;  2DY8 A;  3NTH A;  4RA8 A;  2VQF Q;  1OXU A;  2GVB A;  3FKI B;  4FP5 D;  4RCO A;  1STN A;  3TS2 A;  4OO1 I;  1HA6 A;  3QG1 A;  5I9O A;  2FMM A;  3GTK B;  4JPB W;  3I70 A;  3H0G H;  4DN4 M;  2CFM A;  4ZRZ A;  4JCV E;  4A3G G;  3CCS A;  3MHB A;  3JAM E;  4R1J A;  1NMG A;  3NP8 A;  3OW2 A;  4XIG S;  1XNQ Q;  2OTJ A;  1KRT A;  1E2Z A;  2F0L A;  1SSO A;  1L2F A;  4OL7 A;  5IP7 G;  2PQA A;  1BXT A;  4UP9 A;  5M3M B;  1PFN A;  2HIX A;  4HMI A;  3S16 B;  2MUY A;  3S1R H;  2PI2 E;  5J22 A;  3T1H Q;  2YTX A;  4DV6 L;  1AFP A;  1K9M C;  2E75 C;  3NEL A;  3QOJ A;  2EYH A;  3NUC A;  4XYO A;  2NTS A;  1EU3 A;  1L0Y B;  1CI3 M;  4ZCK A;  1BUV T;  3J7A 5;  4PMB A;  3TBI B;  2F03 A;  1Z7T A;  4R4I A;  2MO0 A;  3KF8 B;  2CCZ A;  5IY0 A;  3OSO A;  1QNU A;  4KI0 A;  3D6W A;  4A76 A;  5IP9 H;  1PFM A;  2RDF A;  2WIN B;  3WOF A;  1V1O A;  3TZD A;  5EKK A;  4P71 A;  4A3E H;  3GTO B;  4DR7 L;  2MNA A;  1ESF A;  3I55 A;  1EYD A;  2B2U A;  3CCL A;  4EQO A;  1SAP A;  3QIA A;  4N9P A;  4UPA A;  2IHF A;  1N32 Q;  3W1G A;  3MVV A;  1H9R A;  1OXS C;  3I4N H;  2K04 A;  3U4V A;  3KJO A;  1HTP A;  5CBA E;  4HIK A;  2NVX B;  1X6O A;  1AZQ A;  4PG3 A;  4DV2 L;  3KF6 B;  2L0C A;  2ZM6 L;  3BU2 A;  1P16 A;  1RD9 D;  3E0E A;  5M3F B;  2UU9 Q;  4DU9 A;  1CM9 A;  1ESR A;  2CKZ B;  3MXP A;  2KQ3 A;  3MXG A;  5E1F A;  1K83 B;  5HGQ A;  4B3T Q;  2N8N A;  1GKH A;  4KJN A;  1DYQ A;  4PQX A;  4QJF A;  1EIG A;  2SDF A;  1ICF B;  2R93 G;  3H3V I;  1Q46 A;  4DK6 C;  3ND8 A;  1K8G A;  4K0K Q;  3K5N A;  1WD0 A;  1E2V A;  2JA5 H;  2HQL A;  4JBJ A;  3RZD B;  1WI5 A;  3BZC A;  1HZB A;  1D5Z C;  3UDI A;  4C3H G;  3PO3 H;  5D14 A;  2KJX A;  4FXG C;  3BS1 A;  4LUO A;  1HA5 A;  4C3J H;  1GUS A;  3KK7 A;  1CA6 A;  5KND A;  1QUQ B;  1PTO B;  3QR8 A;  3BJU A;  1TWA B;  5C0X G;  1TWF H;  5T1I A;  1CA5 A;  4GKJ Q;  2QDB A;  3L0O A;  3AB9 A;  5E4X A;  4KD3 A;  3TRE A;  1V1P A;  3DWA A;  1B3Q A;  1JIC A;  2YV5 A;  4NXM Q;  1EY6 A;  2QIL A;  3E9I A;  4BBR H;  5G3L D;  1N36 Q;  1CZW A;  4Y7N H;  4E6I A;  2KEC A;  4DNI A;  5ISR A;  1STE A;  3U9O A;  4DF7 A;  2H4O A;  1I5F A;  1LAC A;  3EQL C;  1FNV A;  3NWS A;  3ONA B;  1W3S A;  4P72 A;  5GAE C;  2AUJ D;  4OWW B;  1Y1V G;  3TN2 A;  3BYT B;  5C0X I;  3F2C A;  3GTQ B;  1CT1 D;  4JI7 Q;  2RBM A;  1SNQ A;  2K28 A;  3R8B A;  4UDU C;  4C3I B;  2F0F A;  4R4Q A;  2A6E C;  5E4W C;  2DJF C;  3QB3 A;  4RCN A;  2AUK A;  1CKM A;  1PTO C;  1NE3 A;  2JQO A;  4GLV B;  1AE3 A;  4IFD J;  4RH6 A;  4ZAI A;  3HOV B;  1HNW L;  3MWY W;  4A3M H;  1SXT A;  1PVO A;  3VR5 A;  2A6E D;  3T1Y L;  3UDF A;  5BN5 A;  5J39 A;  4DR4 Q;  1PTO D;  1EEF D;  3GV6 A;  3EJI A;  3Q6S A;  4A3K G;  2K7V A;  5LL6 S;  1JCK B;  1E7Z A;  2PZT A;  3SHL A;  2BE5 C;  2JYO A;  4MTN A;  5COY A;  3P75 A;  2NVY B;  4BS9 A;  3DMU A;  1R9T H;  2Q8R E;  3A5Z B;  4BY7 B;  2AQ3 B;  2K33 A;  1ENA A;  2ZXP A;  1PH5 A;  3D4D A;  1OTC A;  4HTH A;  1IBM Q;  4DUZ L;  2BE5 D;  1VQA A;  3CF5 A;  2VQF L;  5BR8 L;  4IUQ A;  4R4O A;  2IHE A;  1WCM H;  2BOS A;  1C9O A;  1LTS D;  5IOC A;  5EGT A;  4CKC A;  5EKI A;  1X3G A;  3IL8 A;  4B08 A;  1XMQ Q;  4JI4 Q;  4CGY B;  4CJ1 B;  2E2J B;  1WD1 A;  3A8K E;  3J81 i;  4HJ7 A;  2K52 A;  1SNP A;  5J1Z A;  2RQX A;  3M7G A;  4J6H A;  4PZ7 A;  1ENF A;  3K0Y A;  5C5M A;  3H0G G;  3DWP A;  2O2L D;  4EVO A;  4YY3 Q;  3M3Y H;  2F0W A;  3CKI B;  5D65 A;  2K5D A;  2WP8 J;  4KN4 C;  4R8N A;  4O42 A;  3JAM L;  1IKL A;  3S17 H;  5I6W A;  2EJF C;  3F2D A;  3T1H L;  3RLO A;  5EPL A;  1WTV A;  3STB C;  4IUU A;  1O80 A;  3AQQ A;  4U67 3;  3Q24 A;  1PZK D;  1VQ8 A;  3K8A A;  1TT2 A;  1KNA A;  2G9D A;  2LXK A;  1HHV A;  3J7A V;  2QA4 A;  1RTN A;  1HPC A;  2DGY A;  3STB D;  3KJP A;  2F4I A;  2UXC Q;  1WTW A;  1H95 A;  1Q12 A;  2PZU A;  3C1F A;  1ENC A;  3I3C A;  5C3W A;  1HR0 Q;  1KQS A;  1TWC B;  1PRT F;  2K03 A;  4GLA C;  2Q8I B;  4LJZ C;  1PV4 A;  4A3L H;  4TQU S;  2LXJ A;  5J3B A;  2FFK B;  1UE1 A;  3TP5 A;  1B44 D;  4DV7 Q;  2XWB B;  2EDG A;  1AEX A;  3OIP A;  5IP9 G;  5K36 H;  1N32 L;  1JOR A;  4HN7 A;  3PIP A;  2L9H A;  4BA1 I;  4GKK Q;  1X3F A;  4A3J H;  1JB7 A;  3W1B A;  1XWE A;  3CCJ A;  4ILW A;  2CHB D;  2OWO A;  4HIO A;  1GUO A;  3S2D H;  2K5V A;  3NBH B;  1S72 A;  1G91 A;  1QG7 A;  3PQI A;  1EYC A;  1JB3 A;  4H02 A;  2CQA A;  3HEJ A;  4IFD H;  5H1S E;  1EFI D;  3S2H H;  1LO5 D;  5IIF A;  3HOX H;  2EY1 A;  3U4Z A;  4KY7 A;  3GTG B;  3NE5 B;  3KOJ A;  4WJ4 A;  1KLU D;  3RMH A;  2F0V A;  4L63 B;  3L9A X;  4K0K L;  1PZI D;  2KUM A;  4KHP Q;  4OO1 H;  1QVF A;  3UDG A;  1DXM A;  3KF8 A;  3MFY A;  2Z4H A;  3K5L A;  3SK4 A;  3V05 A;  2VB3 X;  1J8I A;  2XTI A;  1EZ8 A;  2MJ8 A;  1E24 A;  3EBE A;  3NEM A;  1RL2 A;  5C4X H;  2JA5 G;  4X64 Q;  2EYM A;  4HJ8 A;  1KNE A;  4ODG A;  3V2T A;  1Q86 C;  1STA A;  5CV7 A;  2MPM A;  3PO3 G;  5JEA H;  4JI8 Q;  3EIV A;  1UE7 A;  4JW0 A;  4P73 A;  4GKJ L;  4DV3 L;  2YU9 H;  2LS0 1;  2NTT A;  2ES2 A;  2E2I B;  1CQF A;  5FLX E;  2CH4 A;  4NXM L;  2PPB C;  3KF6 A;  1WFQ A;  3ZJY C;  1BBU A;  4RG1 A;  1U0L A;  2E8G A;  4UP8 A;  1SFO H;  1S5D D;  5KIX A;  2JJQ A;  4LFB Q;  3PIP 3;  4N9T A;  3D8G A;  2VNU D;  1O7L A;  3CCM A;  1QCB D;  5C5L A;  2N88 A;  2JA9 A;  3NTK A;  4BBR G;  1TS5 A;  1O7Y A;  2A69 C;  5AJ3 Q;  3RZO B;  5JPN C;  1DD2 A;  3W5O A;  4LFA Q;  4IUT A;  3CW2 C;  1LLR D;  4K8I A;  2E2H H;  3FDT A;  5IYB H;  2JA6 B;  2G5D A;  3DM1 A;  3FKI H;  2KCT A;  2PNR C;  3GTK H;  2A69 D;  2ASB A;  3OWE B;  4HID A;  5IWA L;  1N9W A;  1PLF A;  2O5I C;  3G7L A;  4R9W A;  1QUQ A;  2F0G A;  4OXP A;  4Y52 H;  4DUY L;  2UUC Q;  2PMZ B;  5KYI A;  1B2T A;  1PH4 A;  3RUZ A;  4A3M G;  5M3M H;  1FL0 A;  2K75 A;  1M90 C;  3S16 H;  2IX0 A;  4RAU C;  3PUZ A;  5C4H A;  4FVM A;  1SE3 A;  3H3V H;  3FEW X;  1A0I A;  1S5E D;  1VF5 C;  4DV0 Q;  1CHP D;  3R3O A;  3SEB A;  1A63 A;  1YIT A;  4J8Q A;  4RFB A;  4X3T A;  1E1O A;  4NMZ A;  1JR0 D;  2UUA Q;  3LGJ A;  1PH1 A;  3CC7 A;  2D0P A;  1N33 L;  1KLG D;  5EAY A;  1HNX Q;  2ZTD A;  3UI2 A;  3I4L A;  1W6K A;  1SJH D;  5IGG A;  4G7O C;  1KAW A;  1WCM G;  1H9J A;  4CDE C;  3J7Y W;  4BXX H;  1Y8O B;  2JA7 B;  4DR1 Q;  2AQ2 B;  2PZW A;  3MTS A;  1EFW A;  1K0R A;  4YY3 L;  3CMA A;  5HGT A;  1SYC A;  4BY1 B;  3K80 C;  2FIN B;  1EIY B;  1QWY A;  1OXX K;  1KDC A;  4ULL A;  2F0E A;  4ZKB B;  1K8M A;  3NBI A;  4Q5V A;  1GXD C;  4KHV A;  1C8C A;  2OF1 A;  2R6G A;  1PA6 A;  4LF8 Q;  5M3F H;  1WJJ A;  2AQ1 B;  3M4Y A;  4B9W A;  3HOU B;  2X6G A;  2JP1 A;  4QB4 A;  1VQK A;  2XVS A;  4LF9 Q;  2AWO A;  1BCP F;  4L5T A;  1XPU A;  1T9H A;  3KLS X;  4CDF C;  4OX9 L;  1U4L A;  3ITP A;  1EIH A;  2NB0 A;  3RZD H;  1Y8P B;  2IY5 B;  4L6T B;  2F0S A;  3AFP A;  4DV7 L;  1CFM A;  2JN4 A;  1IW7 C;  2UXB Q;  3MC0 B;  2K01 A;  3G6J B;  3HFZ B;  2MGS A;  2KEN A;  4JI0 Q;  4A3L G;  3E9H A;  1PZJ D;  2VZA A;  1OO9 B;  1A6X A;  2QEJ C;  3S1M B;  3J81 c;  1VQH A;  4K2K A;  5LMU Q;  1S4Z A;  5KGU A;  4LFC L;  5K36 G;  3S15 B;  1BR9 A;  4X62 Q;  3CU7 A;  4B3R L;  3PSI A;  2Q2T A;  1HNZ Q;  1EWH A;  1EY4 A;  1GVP A;  3SK8 A;  4IPD A;  1SRU A;  1YHB A;  5I6Y A;  1LAB A;  4EQN A;  1H9K A;  1Y8N B;  2EY5 A;  4DV1 Q;  4ZKC B;  1KTK A;  2OEO A;  4NXN L;  2OTL A;  4HMJ A;  2OT2 A;  1U5K A;  2R7D A;  2Z9H A;  3J80 i;  2RCF A;  5T1G A;  4NB3 A;  3HOX G;  3S24 A;  1Z6H A;  2HHH Q;  3AMU A;  5C3E B;  5FJ8 H;  4FF2 A;  2EYJ A;  5DAU A;  4DR2 L;  2UUB Q;  1PYW D;  1W6J A;  1EQT A;  4OO1 G;  3H94 A;  1SNC A;  4YIJ A;  4OON A;  4I7A A;  2XWJ B;  3TP6 A;  4C3I H;  1K8A C;  1QZG A;  3I7F A;  2K1B A;  4JI8 L;  4A3B B;  1YEZ A;  4IUP A;  1R4P B;  3T51 B;  5L37 A;  2Y0S B;  5C44 B;  3JC6 6;  1VQP A;  1PMR A;  5C4X G;  3BVM A;  1Z9F A;  5JEA G;  5IYD H;  1NNX A;  1L0W A;  1X54 A;  4IFD I;  3MAQ A;  3NBH A;  1C4Q A;  2XSC A;  1Y69 U;  3CAM A;  2QF7 A;  1VQ6 A;  2F0M A;  4H44 C;  3ULJ A;  1KDA A;  2K32 A;  1GO3 E;  5JJK A;  1U4P A;  4LFB L;  1ONL A;  4A3G B;  2HCC A;  1A2U A;  1AW7 A;  1A3T A;  5FLX L;  3PCO B;  5JPM C;  2F0Q A;  4IJH A;  3PV0 A;  5AJ3 L;  3HKZ E;  1XJV A;  1XNR Q;  2WFW A;  4BY7 H;  1K73 C;  4LFA L;  1NCV A;  1HR0 W;  5IT9 c;  3ICE A;  3DXJ C;  3WWV A;  1MSH A;  2DY7 A;  3EVQ A;  4CKB A;  3HKZ G;  3RLN A;  2EPB A;  2HQE A;  4LF6 L;  3OTO L;  2E2J H;  5IYB G;  3CCU A;  3FKI G;  5JJL A;  1VQ9 A;  4KTA A;  2BCO A;  4P74 A;  4F87 A;  1IZ6 A;  1I3Q H;  2F0N A;  1PXU A;  1VQL A;  3HOW B;  3NQI A;  1DOL A;  2ID0 A;  2EYL A;  2RDG A;  1BDO A;  4XT1 B;  4LF5 Q;  1XPO A;  1XMQ L;  1B8A A;  2EXD A;  1RDP D;  4L5S A;  1D7Q A;  2EJG C;  1YHQ A;  1I4Q A;  1VQJ A;  2EVB A;  1EQV A;  1I6H B;  3A55 A;  3K81 C;  4AQY Q;  2ALY B;  5BN4 A;  4KKU A;  4IAL A;  4B3M L;  1DJR D;  3M4O B;  4ME3 A;  1KDB A;  1CHQ D;  4MHE A;  4CJ2 C;  3C1E A;  1DOK A;  3Q0A A;  1DZ1 A;  4DR3 Q;  2UXD Q;  1JE5 A;  4KN7 C;  1K3B C;  1TWH H;  1NY4 A;  2JA8 H;  1TWC H;  4DR5 L;  3RD4 A;  1N34 Q;  1Y14 B;  2KVM A;  4IUV A;  4DAV A;  4DR1 L;  4PMW A;  2H5X A;  4IZ8 A;  3G71 A;  2SNS A;  2R93 B;  5GRO A;  3TZU A;  2D2C C;  4HJ5 A;  3PUV A;  3WDN A;  2CVR A;  4BXX G;  1KIX A;  1WYD A;  1XMO Q;  4JI5 Q;  4H13 C;  1LTL A;  2EYP A;  1EYA A;  1B1Z A;  1STB A;  1D8L A;  5ELE A;  2NBF A;  1TVX A;  3U50 C;  2EYO A;  1BO0 A;  1F2Y A;  4JI6 Q;  1TWG B;  2X6L A;  2RDH A;  1D5X C;  3GP7 A;  3S1Q B;  4A93 G;  1MIU A;  4XYQ A;  4KKT A;  3GTG H;  3N52 A;  1TS3 A;  3KYH C;  4JV5 Q;  3HS0 C;  3DEP A;  5M5Y B;  5DM6 3;  2PW5 A;  4K5V A;  3DWQ A;  1YZ6 A;  4OEL B;  2IX3 A;  5JAV A;  2D0O A;  1VCI A;  2B29 A;  2WKC A;  1TKW B;  4KV6 A;  3NHH A;  3GTL B;  2K5H A;  1A62 A;  1EUJ A;  4F8M A;  1PFS A;  3M85 A;  2IPK D;  4JI0 L;  3FHW A;  3HZX A;  4P2C B;  1EOT A;  3J81 j;  1F9S A;  1SYF A;  1ZXT A;  2ZXO A;  4JYA Q;  2VS1 A;  3EN2 A;  4TRD A;  1VQ7 A;  2HT1 A;  1D1K A;  1Y1V B;  3PF4 A;  1H9S A;  4K14 A;  5I4D A;  4NDX A;  2B2V C;  4X62 L;  3HOZ H;  4V19 0;  2NVT B;  3H09 A;  2E2D C;  5M5X B;  2E2I H;  1TY2 A;  2F0P A;  1FJG L;  1VQN A;  4LUZ A;  4HJ9 A;  4EQ5 A;  1JE4 A;  4PV1 C;  3MXN B;  4WJ3 M;  1XYI A;  2BDO A;  1CQV A;  4JBM A;  1F9R A;  2M2L A;  4A3C H;  2IX1 A;  1QZH A;  1L1O B;  2R7Z G;  3TRZ A;  1CTM A;  5D3I B;  5M9O A;  2NYZ D;  4MNO A;  4A3K B;  3Q22 A;  4C2M B;  3RZO H;  2RA4 A;  1KHI A;  2A74 C;  3RN5 A;  2UUB L;  5LL6 X;  4I65 A;  3CRK C;  1D6E C;  2Q8T A;  4GLX A;  2JA6 H;  4P75 A;  5FJ8 G;  1GUG A;  1SJE D;  1AZP A;  1EIF A;  1M1K C;  2BH8 A;  4C3I G;  4OIK A;  3GTJ B;  4ME5 A;  4LF7 Q;  3DM3 A;  1STY A;  5ELN A;  4DXF A;  4C1N I;  1BNZ A;  2L11 A;  2YTY A;  2F0U A;  1IKM A;  2RSN A;  4X65 Q;  1S5C D;  3L7Z C;  3SVM A;  1X32 A;  1IYV A;  1BQQ T;  3K6O A;  1LUZ A;  1SDF A;  2VQE Q;  1L1O C;  1YVC A;  5F2D A;  3P7J A;  1LV9 A;  1Q3L A;  1YNN C;  1XNR L;  4ZQ3 A;  3BYY B;  5C6A A;  4LF4 Q;  3D31 A;  4DGZ A;  1XNQ L;  1U4R A;  1Y1W H;  1OXT A;  1QIL A;  1VS0 A;  1WTH A;  2K5Q A;  4JC0 A;  3URY A;  4HED A;  1NAP A;  1SMX A;  3KBX A;  1TII D;  3I8Z A;  5CYU A;  1SYD A;  1YNN D;  3CPF A;  4GN5 A;  5KNB A;  5IYC H;  4C56 C;  1PFB A;  1TS2 A;  2M9V A;  2AKW B;  4I7Z C;  5DNF A;  4APV A;  2JA7 H;  5IE8 A;  2LY7 A;  2JXM B;  1JQY D;  3I73 A;  2A5H A;  2L12 A;  2EOT A;  4XT3 B;  4NKL A;  5GQO A;  1IBK Q;  4LF5 L;  1SE4 A;  1X55 A;  1CSQ A;  2QEX A;  3HOY B;  1WTX A;  2L4N A;  2GA4 B;  3VYT A;  1EY7 A;  4QIW E;  2E5L Q;  1WTP A;  5M5W B;  1JJC B;  3DEO A;  2MFI A;  3N6R A;  1JOQ A;  1GUW A;  1EQR A;  1HZA A;  2NVQ H;  1RF2 D;  3NSW A;  4O2D A;  3WOE A;  1JJG A;  4O1N A;  2EXZ A;  5FO9 B;  2L55 A;  1XPR A;  1HUN A;  3CQZ B;  5KEE A;  2E74 C;  2NN6 H;  3U58 A;  2KHJ A;  4DK1 A;  2IL8 A;  4KLK A;  5G3L F;  3DLL A;  5CMD A;  2PQE A;  2UXD L;  2Q2I A;  4AIM A;  1PYS B;  1TQO A;  1PH9 A;  4A3E G;  5LHY 1;  1QVC A;  3F1Z A;  1VMC A;  1K0S A;  4HR7 B;  5CV5 A;  1PDQ A;  2B3G A;  4OWT B;  3SGI A;  3S14 B;  3BG3 A;  4WOR A;  1VQI A;  3I4N G;  1VQD A;  3OPO A;  2OCE A;  2UU9 L;  2JA8 G;  1I4X A;  4K5W A;  2PI2 A;  4B3T L;  2V1C C;  2OQK A;  1NTG A;  4DXG A;  1JC7 A;  4GOP B;  1J6Q A;  1AH9 A;  1KXL A;  3UDX A;  2VW9 A;  3JAM i;  3SE0 A;  1F2Z A;  5LMN Q;  3VR2 A;  4N8F A;  3S15 H;  2R3Z A;  1A3U A;  1I94 Q;  2JA5 B;  1V43 A;  4JI6 L;  3NWT A;  5IGF A;  1BBX C;  3H91 A;  3D0F A;  3H15 A;  4A3D B;  1S5F D;  1PTO F;  4HIM A;  2EY2 A;  1HUM A;  3PUX A;  2JE6 I;  3BZD B;  1MBY A;  2R7F A;  4V0B A;  3IFT A;  3RNU A;  4G7Z C;  1M8A A;  1LTI D;  4JV5 L;  2WB1 E;  1QE6 A;  2ZTC A;  3MA2 B;  2B2W C;  2RKS A;  4K6L A;  5AFW A;  4C3J G;  5C3E H;  1SNO A;  2YYZ A;  2GN5 A;  5IGB A;  1R4Q B;  2ATW A;  5CV6 A;  4FXD A;  2B8G A;  2WB1 G;  4JYA L;  1B53 A;  2A68 C;  4A3F B;  1N36 L;  3MXU A;  4GOP C;  3Q23 A;  4A3B H;  4Y7N B;  2KOL A;  3UE0 A;  5KRU A;  4X3S A;  3AYH B;  3J7A F;  3CPW A;  1SN8 A;  1J5E Q;  4TKO B;  5C0X J;  3M7N A;  2B2V A;  1JWU D;  2A68 D;  3S9W A;  3K7A B;  3L2P A;  4JI7 L;  1B9M A;  2VXW A;  4FXK C;  3HOZ G;  4DV5 Q;  4POG A;  3FP9 A;  3K0X A;  2WAQ B;  4A3I B;  4RMF A;  1VQM A;  3TP8 A;  2L1B A;  2XN9 C;  1FGU A;  3BVG A;  1TXY A;  1YNJ D;  4A3C G;  1C48 A;  4JBW A;  1MJC A;  4A3M B;  1HQR D;  3ULP A;  2Z1C A;  4DR4 L;  4PMC A;  5FK9 C;  2DUD A;  1HJP A;  1HXY D;  1GUN A;  2QDL A;  1VQ4 A;  4YCW A;  1W2B A;  1TR5 A;  1ZKO A;  2MO1 A;  1DGS A;  3PO2 B;  2RCN A;  2JA6 G;  4FF4 A;  1GM5 A;  3I4M B;  4DV6 Q;  3A56 A;  3G4S A;  2B63 B;  4LF7 L;  1LM0 A;  4CHT B;  3HOW H;  4GN3 B;  3CME A;  1IBM L;  1SR3 A;  4A4I A;  5EBC A;  2R61 A;  1PH2 A;  1SLJ A;  1K8O A;  5IGE A;  2C5C A;  4HSV A;  2PO4 A;  1D5M C;  3F2U A;  4JI4 L;  3MXN A;  2H1E A;  3OMC A; 
#chains in the Genus database with same CATH homology
 1ZYR C;  1U4M A;  2O4X A;  1EY0 A;  1CK1 A;  3GTM B;  5JVH 3;  1G2S A;  1WTR A;  2LKV A;  1HCZ A;  3M3Y B;  1MSG A;  4XTC S;  1ZYR D;  1H9S B;  3X3N A;  3S17 B;  4Q0F A;  2R92 B;  2IW3 A;  4DFA A;  1EZ6 A;  1LTA D;  4QMG A;  3HG9 A;  1UNS A;  5FKA C;  1UUP A;  1TU2 B;  2DNC A;  5TSS A;  2D62 A;  3U9S A;  3O13 A;  3KLR A;  4HSP A;  4GZY C;  1SEB D;  4F88 A;  4X3K A;  2C9O A;  1IL8 A;  4RGO S;  1LT6 D;  5KYL A;  3NTI A;  3QOL A;  4LAA A;  1BOS A;  1GOZ A;  1LTR D;  1SBB B;  5FO7 B;  1B3A A;  2PW7 A;  1PTO H;  4DA2 A;  4UAI A;  4RHS A;  3W3A A;  1ET6 A;  3J81 E;  1B4O A;  3FPP A;  1G6Z A;  2OXP A;  1HTL D;  2CW0 C;  3NPP A;  3S1N B;  1I4P A;  4IFD G;  2RVL A;  2F3W A;  2NN6 I;  3MFG A;  1RHP A;  2CW0 D;  2XNA C;  5C4X B;  3TP7 A;  4KJO A;  1FD7 D;  4G7H C;  5A2Q E;  2VUM B;  4BBS B;  3P1H A;  5CBE E;  3D6C A;  5D3D A;  4QUC A;  2YU9 B;  3P20 A;  2XRQ D;  1X3Q A;  4H7B A;  3SK6 A;  1DM0 B;  3T56 B;  2ZXR A;  3SK5 A;  2FHT A;  3CHB D;  2B2W A;  1I4G A;  2TSS A;  1SND A;  4M8A A;  1MGS A;  1ILP A;  1O78 A;  2D9U A;  5FO8 B;  4FO2 A;  1JOO A;  2KCN A;  3SXH A;  3T16 A;  3C2P A;  1SMY C;  5C3X A;  5A35 A;  3GV3 A;  2KED A;  1Q8I A;  3HKZ B;  1G2T A;  1XTC D;  1VDZ A;  1AN8 A;  2E76 C;  2BA1 A;  2DN8 A;  1I50 B;  1MI2 A;  1SMY D;  2E2H B;  4DNT B;  3TDQ A;  2J7Z A;  2NWG A;  2I46 A;  2X69 A;  1QOH A;  2G9H D;  5IT9 E;  3GTP B;  3PUW A;  4EQP A;  2L5T A;  1F9P A;  4H0L C;  3HGB A;  3LNN A;  1DOM A;  5IGD A;  4J1M A;  2HCI A;  3K5M A;  3KBG A;  3R2T A;  1LTG D;  2SEB D;  4DAP A;  5EQ0 A;  1D1I A;  2EY6 A;  1S5B D;  4ZK9 B;  1CZG A;  1Q90 A;  3SDZ A;  4B9X A;  3NK9 A;  4MN3 A;  2IJ0 A;  4KKS A;  1JOK A;  1U9R A;  1G29 1;  4CBV A;  3OHX C;  4RKB A;  1KAA A;  2F0D A;  4ZYS A;  3DUZ A;  3D4R A;  3HRZ C;  3KLS A;  4K2L A;  2EYF A;  3V96 A;  4NP5 A;  3A8J E;  1DCZ A;  1PRT B;  3HP3 A;  1D2B A;  4C3H B;  1LT3 D;  4BA2 I;  4RKL A;  1I6V C;  4A93 B;  3H3V C;  4LK1 C;  4K5X A;  1X3P A;  5COR A;  3A7L A;  3NQT A;  5EJW A;  4IQZ A;  1QB5 D;  3GD7 A;  5ELF A;  5K5P A;  2B39 A;  1EY8 A;  3C46 A;  1O7Z A;  4DAY A;  1II3 A;  1A3V A;  1XX8 A;  1ML0 D;  2KHS A;  1PRT C;  3DHQ A;  5C4J B;  3QWN A;  1RJT A;  1LTB D;  4HAE A;  3GO5 A;  2M00 A;  1PRT D;  1UAP A;  4FF1 A;  3IAY A;  1STG A;  2R7Z B;  1GHJ A;  1E0B A;  1B9N A;  4OIJ A;  3BDL A;  3J81 L;  3BDO A;  3FMC A;  1VMP A;  5EPJ A;  5ELD A;  2FJ2 A;  4FNF A;  3GQB A;  3OWF A;  4RGT A;  1ILQ A;  1WTQ A;  3KUP A;  2F3V A;  1F2M A;  2PYK A;  2IWH A;  2NUC A;  2J0T D;  1Z47 A;  2K05 A;  3LWU A;  1EU4 A;  4TSS A;  4G57 A;  2XIW A;  5CV4 A;  1WTO A;  1A15 A;  3TME A;  5A2Q L;  1GJX A;  4S3S A;  4BWG B;  4C1N K;  4M1U B;  1HRJ A;  5IGC A;  3BVZ A;  3CRL C;  4KK7 A;  2JEA I;  1FGB D;  3H0G B;  4U68 A;  3LWE A;  3C3L A;  5JEA J;  2VB2 X;  2LFN A;  1G8Z D;  3LX0 A;  1EL0 A;  5CGK A;  3VR4 A;  1JWS D;  3K59 A;  4IUR A;  4RGM A;  2KA7 A;  3S1R B;  4RWS C;  5ELC A;  3R2I A;  3D4W A;  3J80 E;  4LMQ D;  1I3Q B;  3I90 A;  2B2Y C;  4WFN 3;  2WAC A;  1F2L A;  3VR6 A;  3MZ5 A;  5IT9 L;  2WKD A;  4ZUI A;  3K58 A;  2ENB A;  1ET9 A;  1L0X B;  4QIW B;  1B50 A;  3D3R A;  4KMU C;  1EY9 A;  3E5S A;  3VA7 A;  4A3E B;  3VYR A;  4K8J A;  3R93 A;  2SOB A;  4RHR A;  3I4N B;  5NUC A;  4NW2 A;  1STH A;  5I2Y A;  1TWH B;  2JA8 B;  1FR3 A;  4XDX A;  1BCP B;  1DON A;  2V4D A;  3H6M A;  1LT4 D;  3EFX D;  3IKJ A;  1QJO A;  1F9Q A;  5DM7 3;  1FNW A;  3OOC A;  4Z9C B;  3E0J A;  4HCE A;  3ERQ A;  1NR2 A;  1ROD A;  3I91 A;  3PO3 B;  2HDM A;  2SNM A;  5EBD A;  2F0O A;  3VR3 A;  3FVQ A;  4ABN A;  1LTT D;  2A6H C;  2PCF B;  2TMP A;  4DK0 A;  4C3J B;  1HFG A;  4EGV A;  2WII B;  1A2T A;  1TWF B;  2F0H A;  2WB1 B;  2DNE A;  3ERO A;  3RLF A;  2A6H D;  1V8Q A;  1BCP C;  2B2T C;  1NSN S;  3FRP B;  2HDL A;  3X3M A;  1BF4 A;  2D5D A;  3OIQ A;  1HQM C;  2F1M A;  4BBR B;  1OXV A;  1EEI D;  3T4A C;  1BCP D;  2QCP X;  4XQN A;  3HOZ B;  1WVL A;  5I2X A;  1ZEQ X;  5BN3 A;  4X3U A;  1KAB A;  2A73 B;  3ZYY X;  1YNJ C;  4CKE A;  4JK1 C;  3BDC A;  2EZV A;  3IFD A;  2N55 A;  2F0K A;  1FNU A;  5E3F A;  3K5O A;  5IOD A;  4KD4 A;  4L8J A;  2Z8L A;  1ICW A;  4CJ0 B;  3PIO 3;  2F0T A;  3AU7 A;  5EPK A;  4R8I A;  4F7X A;  4WRD A;  4XXE A;  4FYD A;  1Q1B A;  3QO2 A;  3W2D A;  1JWM D;  2HUG A;  2KEE A;  4KY5 A;  2O5J C;  2XRS D;  3I72 A;  1SNM A;  5ELB A;  1R9T B;  1FYC A;  1RKN A;  2QKI C;  5CV8 A;  2BDN A;  2LMC B;  3A54 A;  2WV6 D;  3QJY A;  4FF3 A;  5JOB A;  1WCM B;  1GHK A;  2ZT9 C;  2EJM A;  3PMF A;  1AP0 A;  3L3O C;  1TY0 A;  1M4V A;  1VF7 A;  1NUC A;  1SYG A;  3K57 A;  2B2U C;  1Y1W B;  2EE1 A;  3VYU A;  1HFN A;  2JEB I;  5CC4 A;  4KHZ A;  1EWC A;  4QUF A;  1SYE A;  4PNY A;  1I4R A;  5I9P A;  3NXW A;  1V1P B;  1MD2 D;  3E6Z X;  4QF4 A;  5DEH A;  4OGQ C;  3MEH A;  5CV9 A;  5KNC A;  2B2Y A;  3J80 L;  2F0J A;  2B8F A;  2ICI A;  2NVQ B;  1RTO A;  3TSS A;  2FMC A;  3PUY A;  4AYB B;  1RCV D;  4ID6 A;  1NR4 A;  5CR3 A;  5JVG 3;  2IT1 A;  5C0X H;  1LT5 D;  3FPU B;  4A3J B;  2K6A A;  5JJZ A;  2NN6 G;  3T13 A;  4HCS A;  3EA6 A;  3S2D B;  3ND9 A;  4IN3 A;  4IUN A;  4XQJ A;  2JSO A;  1QNK A;  3VA5 A;  5EKL A;  1F77 A;  2MHV A;  5C4Z A;  1EY5 A;  2RSO A;  4MIU A;  3S2H B;  3SR1 A;  3A7A B;  1I4H A;  3HOX B;  1GUT A;  3T53 B;  1T5E A;  3OW7 A;  4WJW A;  3A8I E;  1H9M A;  4K6D A;  1SE2 A;  1IW7 D;  4QCL A;  3OMG A;  5HUR A;  2J4X A;  3VYS A;  4RGN A;  2MP1 A;  4ZLT F;  2BA0 A;  2I07 B;  2ICE C;  1E2W A;  1IHZ A;  1SYB A;  1UEA B;  2Z4I A;  1XXG A;  4XQQ A;  4G4K A;  2B2T A;  2NZ1 D;  4DNR B;  1SFO B;  2K5W A;  1TS4 A;  2KCC A;  2F0I A;  1IYU A;  1J9O A;  1Q1E A;  2AWN A;  4OHJ A;  5FOB B;  1T5X D;  4ZUJ A;  4KY6 A;  2DY8 A;  3NTH A;  4RA8 A;  1OXU A;  3FKI B;  4FP5 D;  4RCO A;  1STN A;  4OO1 I;  1HA6 A;  3QG1 A;  5I9O A;  2FMM A;  3GTK B;  3I70 A;  4DN4 M;  4ZRZ A;  3MHB A;  3JAM E;  3NP8 A;  4XIG S;  1E2Z A;  2F0L A;  1SSO A;  4OL7 A;  1BXT A;  5M3M B;  1PFN A;  4HMI A;  3S16 B;  2MUY A;  5J22 A;  1AFP A;  2E75 C;  3QOJ A;  2EYH A;  3NUC A;  4XYO A;  2NTS A;  1EU3 A;  1L0Y B;  1CI3 M;  1BUV T;  4PMB A;  3TBI B;  2F03 A;  1Z7T A;  3OSO A;  1QNU A;  4KI0 A;  3D6W A;  1PFM A;  2RDF A;  2WIN B;  3WOF A;  1V1O A;  3TZD A;  5EKK A;  3GTO B;  1ESF A;  1EYD A;  2B2U A;  4EQO A;  1SAP A;  3QIA A;  4N9P A;  3MVV A;  1H9R A;  1OXS C;  2K04 A;  1HTP A;  5CBA E;  2NVX B;  1AZQ A;  2L0C A;  1RD9 D;  5M3F B;  4DU9 A;  1CM9 A;  1ESR A;  3MXP A;  2KQ3 A;  3MXG A;  5E1F A;  1K83 B;  4KJN A;  1DYQ A;  4PQX A;  1EIG A;  2SDF A;  3ND8 A;  3K5N A;  1WD0 A;  1E2V A;  3RZD B;  1D5Z C;  4C3H G;  5D14 A;  2KJX A;  4FXG C;  3BS1 A;  1HA5 A;  1GUS A;  3KK7 A;  1CA6 A;  5KND A;  1PTO B;  1TWA B;  5C0X G;  5T1I A;  1CA5 A;  2QDB A;  3AB9 A;  5E4X A;  4KD3 A;  1V1P A;  3DWA A;  1JIC A;  1EY6 A;  2QIL A;  5G3L D;  1CZW A;  4E6I A;  2KEC A;  5ISR A;  1STE A;  3U9O A;  4DF7 A;  2H4O A;  1LAC A;  3EQL C;  1FNV A;  3NWS A;  3ONA B;  2AUJ D;  3TN2 A;  3BYT B;  5C0X I;  3GTQ B;  1CT1 D;  2RBM A;  1SNQ A;  2K28 A;  3R8B A;  4UDU C;  4C3I B;  2F0F A;  2A6E C;  5E4W C;  3QB3 A;  4RCN A;  2AUK A;  1PTO C;  4IFD J;  4RH6 A;  4ZAI A;  3HOV B;  3MWY W;  1SXT A;  3VR5 A;  2A6E D;  5BN5 A;  5J39 A;  1PTO D;  1EEF D;  3GV6 A;  3EJI A;  3Q6S A;  2K7V A;  5LL6 S;  1JCK B;  2PZT A;  3SHL A;  2BE5 C;  2JYO A;  5COY A;  3P75 A;  2NVY B;  4BS9 A;  3DMU A;  2Q8R E;  4BY7 B;  2AQ3 B;  2K33 A;  1ENA A;  2ZXP A;  3D4D A;  4HTH A;  2BE5 D;  4IUQ A;  2BOS A;  1LTS D;  5IOC A;  5EGT A;  4CKC A;  5EKI A;  3IL8 A;  4B08 A;  4CGY B;  4CJ1 B;  2E2J B;  1WD1 A;  3A8K E;  1SNP A;  5J1Z A;  2RQX A;  3M7G A;  4J6H A;  1ENF A;  3K0Y A;  5C5M A;  3DWP A;  2O2L D;  4EVO A;  2F0W A;  3CKI B;  5D65 A;  2K5D A;  2WP8 J;  4KN4 C;  4R8N A;  4O42 A;  3JAM L;  1IKL A;  5I6W A;  2EJF C;  5EPL A;  1WTV A;  4IUU A;  1O80 A;  4U67 3;  3Q24 A;  1PZK D;  1TT2 A;  1KNA A;  2G9D A;  1HHV A;  3J7A V;  1RTN A;  1HPC A;  2F4I A;  1WTW A;  1Q12 A;  2PZU A;  3C1F A;  1ENC A;  3I3C A;  5C3W A;  1TWC B;  1PRT F;  2K03 A;  2Q8I B;  4LJZ C;  4TQU S;  2FFK B;  3TP5 A;  1B44 D;  2XWB B;  2EDG A;  1AEX A;  3OIP A;  5K36 H;  1JOR A;  4HN7 A;  2L9H A;  4BA1 I;  1XWE A;  4ILW A;  2CHB D;  1GUO A;  1G91 A;  1QG7 A;  1EYC A;  1JB3 A;  2CQA A;  3HEJ A;  4IFD H;  1EFI D;  1LO5 D;  5IIF A;  2EY1 A;  4KY7 A;  3GTG B;  3NE5 B;  1KLU D;  3RMH A;  2F0V A;  4L63 B;  3L9A X;  1PZI D;  2KUM A;  4OO1 H;  1DXM A;  3KF8 A;  3MFY A;  2Z4H A;  3K5L A;  3SK4 A;  3V05 A;  2VB3 X;  1J8I A;  1EZ8 A;  2MJ8 A;  2EYM A;  1KNE A;  4ODG A;  3V2T A;  1STA A;  5CV7 A;  2MPM A;  5JEA H;  2LS0 1;  2NTT A;  2E2I B;  1CQF A;  5FLX E;  2PPB C;  1S5D D;  5KIX A;  3PIP 3;  4N9T A;  3D8G A;  2VNU D;  1O7L A;  1QCB D;  5C5L A;  2N88 A;  3NTK A;  1TS5 A;  1O7Y A;  2A69 C;  3RZO B;  5JPN C;  1DD2 A;  4IUT A;  1LLR D;  4K8I A;  3FDT A;  2JA6 B;  3DM1 A;  2PNR C;  2A69 D;  3OWE B;  1PLF A;  2O5I C;  3G7L A;  4R9W A;  2F0G A;  2PMZ B;  5KYI A;  1B2T A;  3RUZ A;  2IX0 A;  4RAU C;  3PUZ A;  5C4H A;  4FVM A;  1SE3 A;  3FEW X;  1S5E D;  1VF5 C;  1CHP D;  3R3O A;  3SEB A;  4J8Q A;  4RFB A;  4X3T A;  4NMZ A;  1JR0 D;  1KLG D;  3UI2 A;  3I4L A;  1W6K A;  1SJH D;  5IGG A;  4G7O C;  1H9J A;  3J7Y W;  1Y8O B;  2JA7 B;  2AQ2 B;  2PZW A;  3MTS A;  5HGT A;  1SYC A;  4BY1 B;  2FIN B;  1QWY A;  1OXX K;  1KDC A;  4ULL A;  2F0E A;  4ZKB B;  1K8M A;  3NBI A;  4Q5V A;  1GXD C;  4KHV A;  1C8C A;  2OF1 A;  2R6G A;  2AQ1 B;  3M4Y A;  4B9W A;  3HOU B;  2X6G A;  2JP1 A;  4QB4 A;  2XVS A;  2AWO A;  1BCP F;  3KLS X;  1U4L A;  3ITP A;  1EIH A;  2NB0 A;  1Y8P B;  4L6T B;  2F0S A;  1CFM A;  1IW7 C;  3MC0 B;  2K01 A;  3G6J B;  2MGS A;  1PZJ D;  1OO9 B;  1A6X A;  2QEJ C;  3S1M B;  4K2K A;  1S4Z A;  5KGU A;  5K36 G;  3S15 B;  1BR9 A;  3CU7 A;  1EWH A;  1EY4 A;  3SK8 A;  5I6Y A;  1LAB A;  4EQN A;  1H9K A;  1Y8N B;  2EY5 A;  4ZKC B;  1KTK A;  2OEO A;  4HMJ A;  2OT2 A;  5T1G A;  1Z6H A;  3AMU A;  5C3E B;  4FF2 A;  2EYJ A;  5DAU A;  1PYW D;  1W6J A;  1EQT A;  4OO1 G;  3H94 A;  1SNC A;  4YIJ A;  2XWJ B;  3TP6 A;  2K1B A;  4A3B B;  4IUP A;  1R4P B;  3T51 B;  2Y0S B;  5C44 B;  1PMR A;  3BVM A;  5JEA G;  4IFD I;  3MAQ A;  3NBH A;  1C4Q A;  2XSC A;  1Y69 U;  2QF7 A;  2F0M A;  4H44 C;  1KDA A;  2K32 A;  1U4P A;  1ONL A;  4A3G B;  2HCC A;  1A2U A;  1AW7 A;  1A3T A;  5FLX L;  5JPM C;  2F0Q A;  3PV0 A;  1NCV A;  3DXJ C;  1MSH A;  2DY7 A;  3EVQ A;  4CKB A;  2EPB A;  2HQE A;  4KTA A;  2BCO A;  4F87 A;  2F0N A;  1PXU A;  3HOW B;  3NQI A;  1DOL A;  2ID0 A;  2EYL A;  2RDG A;  1BDO A;  4XT1 B;  1RDP D;  2EJG C;  1I4Q A;  2EVB A;  1EQV A;  1I6H B;  3A55 A;  5BN4 A;  4KKU A;  4IAL A;  1DJR D;  3M4O B;  1KDB A;  1CHQ D;  4MHE A;  4CJ2 C;  3C1E A;  1DOK A;  3Q0A A;  1DZ1 A;  4KN7 C;  3RD4 A;  2KVM A;  4IUV A;  4DAV A;  4PMW A;  4IZ8 A;  2SNS A;  2R93 B;  3TZU A;  2D2C C;  3PUV A;  3WDN A;  2CVR A;  4H13 C;  2EYP A;  1EYA A;  1B1Z A;  1STB A;  5ELE A;  2NBF A;  1TVX A;  2EYO A;  1BO0 A;  1F2Y A;  1TWG B;  2X6L A;  2RDH A;  1D5X C;  3GP7 A;  3S1Q B;  4XYQ A;  4KKT A;  3N52 A;  1TS3 A;  3HS0 C;  3DEP A;  5M5Y B;  5DM6 3;  2PW5 A;  4K5V A;  3DWQ A;  2IX3 A;  5JAV A;  1VCI A;  2WKC A;  4KV6 A;  1TKW B;  3NHH A;  3GTL B;  4F8M A;  3M85 A;  2IPK D;  3HZX A;  4P2C B;  1EOT A;  1F9S A;  1SYF A;  1ZXT A;  2ZXO A;  4TRD A;  1D1K A;  1Y1V B;  1H9S A;  4K14 A;  5I4D A;  4NDX A;  2B2V C;  4V19 0;  2NVT B;  3H09 A;  2E2D C;  5M5X B;  1TY2 A;  2F0P A;  1JE4 A;  4PV1 C;  1XYI A;  2BDO A;  1CQV A;  1F9R A;  2M2L A;  2IX1 A;  1CTM A;  5D3I B;  5M9O A;  2NYZ D;  4A3K B;  3Q22 A;  4C2M B;  2RA4 A;  2A74 C;  5LL6 X;  4I65 A;  3CRK C;  1D6E C;  2Q8T A;  1GUG A;  1SJE D;  1AZP A;  4C3I G;  4OIK A;  3GTJ B;  4ME5 A;  1STY A;  4DXF A;  4C1N I;  1BNZ A;  2L11 A;  2F0U A;  1IKM A;  2RSN A;  1S5C D;  3L7Z C;  3SVM A;  1X32 A;  1IYV A;  1BQQ T;  3K6O A;  1SDF A;  5F2D A;  3P7J A;  1LV9 A;  1Q3L A;  1YNN C;  4ZQ3 A;  5C6A A;  3BYY B;  3D31 A;  4DGZ A;  1U4R A;  1OXT A;  1QIL A;  2K5Q A;  3URY A;  4HED A;  1NAP A;  3KBX A;  1TII D;  3I8Z A;  5CYU A;  1SYD A;  1YNN D;  5KNB A;  4C56 C;  1PFB A;  1TS2 A;  2M9V A;  4I7Z C;  5DNF A;  2LY7 A;  2JXM B;  1JQY D;  3I73 A;  2A5H A;  2L12 A;  2EOT A;  4XT3 B;  4NKL A;  1SE4 A;  3HOY B;  1WTX A;  2L4N A;  2GA4 B;  3VYT A;  1EY7 A;  1WTP A;  5M5W B;  3DEO A;  3N6R A;  1JOQ A;  1GUW A;  1RF2 D;  3NSW A;  3WOE A;  4O1N A;  2EXZ A;  5FO9 B;  2L55 A;  1HUN A;  3CQZ B;  5KEE A;  2E74 C;  2NN6 H;  4DK1 A;  2IL8 A;  5G3L F;  5CMD A;  2PQE A;  1TQO A;  5LHY 1;  1VMC A;  4HR7 B;  5CV5 A;  1PDQ A;  3S14 B;  3BG3 A;  4WOR A;  3OPO A;  1I4X A;  4K5W A;  4DXG A;  1JC7 A;  3SE0 A;  1F2Z A;  3VR2 A;  2R3Z A;  1A3U A;  2JA5 B;  1V43 A;  3NWT A;  5IGF A;  1BBX C;  3H91 A;  4A3D B;  1S5F D;  1PTO F;  2EY2 A;  1HUM A;  3PUX A;  2JE6 I;  3BZD B;  1MBY A;  4V0B A;  3IFT A;  4G7Z C;  1M8A A;  1LTI D;  1QE6 A;  3MA2 B;  2B2W C;  2RKS A;  4K6L A;  5AFW A;  4C3J G;  1SNO A;  2YYZ A;  5IGB A;  1R4Q B;  5CV6 A;  4FXD A;  2B8G A;  1B53 A;  2A68 C;  4A3F B;  3MXU A;  3Q23 A;  4Y7N B;  2KOL A;  5KRU A;  4X3S A;  3J7A F;  4TKO B;  5C0X J;  3M7N A;  2B2V A;  1JWU D;  2A68 D;  3S9W A;  3K7A B;  1B9M A;  2VXW A;  4FXK C;  2WAQ B;  4A3I B;  3TP8 A;  2L1B A;  2XN9 C;  3BVG A;  1YNJ D;  1C48 A;  4JBW A;  4A3M B;  1HQR D;  2Z1C A;  4PMC A;  5FK9 C;  1HXY D;  1GUN A;  1TR5 A;  1ZKO A;  3PO2 B;  4FF4 A;  3I4M B;  3A56 A;  2B63 B;  4CHT B;  5EBC A;  2R61 A;  1K8O A;  5IGE A;  2C5C A;  4HSV A;  2PO4 A;  1D5M C;  3F2U A;  3MXN A;  2H1E A;  3OMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...