2EY1A

Crystal structure of staphylococcal nuclease mutant t22v
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDVVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Staphylococcal nuclease
publication title Threonine mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
total genus 36
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ey1A00
5C5MA 4EQNA 2PW5A 3SK5A 2F0FA 2F0TA 4OL7A 2F0UA 2WACA 5I6WA 5KEEA 1II3A 3DMUA 3SK8A 4PMCA 3NP8A 5E1FA 4ZUIA 3OWFA 5JAVA 1STBA 5CR3A 4I65A 4ME5A 1SNMA 3SHLA 2F0QA 2F3WA 5IOCA 5C5LA 1KAAA 5I9PA 5I6YA 1AEXA 1STHA 3LX0A 3MXPA 5KGUA 3EVQA 1SYCA 2RDFA 3NQTA 3TMEA 3C1EA 5C3WA 4DFAA 5IIFA 4NMZA 5HURA 5EKLA 2F0NA 4IALA 5C4HA 2EY6A 2PQEA 4KY6A 3QOJA 2NUCA 3MHBA 3D4WA 4NP5A 2O4XA 3BDCA 1KDAA 2OEOA 1ENAA 3EJIA 1STYA 3P1HA 4K2LA 1SYEA 1A2TA 4NDXA 4KJOA 1EY0A 1TT2A 3H6MA 2EYJA 1SNPA 1SNDA 5EGTA 1EZ6A 4RKBA 4G57A 3T13A 1EYCA 3BDLA 5J39A 1SNQA 3C1FA 1JOKA 1A3UA 4H7BA 4EQOA 2ENBA 2RKSA 4J6HA 3TP8A 1JOOA 2PW7A 2EYLA 3DHQA 3PMFA 1JOQA 2RBMA 5CV8A 1SYFA 5DEHA 5M9OA 1EY9A 1A3TA 4S3SA 4EVOA 2OF1A 2PZWA 4KHVA 1SNOA 4ZUJA 3NXWA 3OSOA 3TP5A 3QB3A 4MIUA 4HMIA 2F0IA 4QMGA 5J1ZA 2F0MA 4KY7A 2F0KA 2EYFA 4N9PA 4B9WA 2EY1A 1F2MA 2EYPA 2F0HA 4PMBA 4RKLA 3T16A 5IGGA 5KRUA 5CC4A 5J22A 3P75A 3SR1A 1IHZA 2KQ3A 3U9OA 1A3VA 3S9WA 2F0LA 2F3VA 5IGFA 2EY2A 3MZ5A 3NK9A 5C4ZA 2EYOA 1EYDA 5I9OA 5CGKA 1STAA 3D6CA 5JOBA 5EKKA 3D8GA 5IODA 1EY4A 1F2ZA 1NSNS 2F0EA 2LKVA 2OXPA 4K8IA 4ZQ3A 1STGA 5IGCA 3OMGA 2PZUA 1EZ8A 4DF7A 1TQOA 4E6IA 1SYDA 2F0JA 4WRDA 3HEJA 2EYMA 2PYKA 2QDBA 5HGTA 4N9TA 5CV7A 5C6AA 4EQPA 4KTAA 4WORA 1SYBA 2F0WA 4QB4A 5KYLA 1KABA 1KDCA 3MEHA 2F0SA 2F0DA 4ODGA 4F8MA 1EY6A 4K6DA 1ENCA 2F0VA 3HZXA 3R3OA 5CV6A 5IGBA 3SK4A 5F2DA 1SYGA 1A2UA 4K8JA 4R8NA 4ID6A 3SXHA 4DU9A 5CV4A 3VA5A 1KDBA 5NUCA 5C3XA 4LAAA 3EROA 2F0PA 2F0OA 5CV9A 3D4DA 4HMJA 4J1MA 2EYHA 3SK6A 4TRDA 3V2TA 2SOBA 1TR5A 2PZTA 3MVVA 2SNSA 4K5WA 4HTHA 1SNCA 2EY5A 4QF4A 5CV5A 1STNA 2HQEA 3OMCA 5DAUA 5KIXA 2F0GA 5ISRA 4F7XA 2M00A 4KD3A 1RKNA 2EXZA 3TP7A 4B9XA 5KYIA 3NHHA 1F2YA 3ITPA 4K2KA 4PNYA 5K5PA 3NUCA 3QOLA 4IUNA 3E5SA 4KY5A 2SNMA 4KJNA 1U9RA 4IZ8A 4K14A 4KV6A 4DGZA 4KD4A 5E3FA 5IGDA 1JORA 1NUCA 4K5VA 5IGEA 1EY8A 1EY7A 4YIJA 4K5XA 4NKLA 1EYAA 1EY5A 3RUZA 3ERQA 3TP6A 1EQVA 2KHSA
chains in the Genus database with same CATH superfamily
1TU2B 4EQNA 2L11A 1V1QA 1T5EA 2IX1A 2G9DA 5GAEC 1JMCA 5FK9C 1EQQA 3M3YH 4DV5Q 3KFUA 1I50B 1B3AA 4DV7Q 2QILA 4ZRZA 1J6QA 1OXUA 3E9IA 3MWYW 3I55A 3F2CA 3GTKB 2L12A 1B8AA 2PQEA 4JVZA 3A5ZB 1JWMD 1LACA 1ENAA 1NAPA 5I4DA 1P8LA 2E2IB 1RL2A 1YHQA 4Q0FA 4B08A 3K5NA 2R3ZA 4RKBA 5GQOA 3ERSX 4J6HA 3GTQB 2PW7A 4LFAQ 3F2BA 1HTPA 4AYBE 3CF5A 3VYSA 5M5WH 4JI1Q 3I4MB 2ICEC 1QZGA 3OSOA 1R9TB 4QMGA 2D0PA 1HNXQ 3C46A 4B3TQ 3ND9A 3A5UA 1ESRA 1IL2A 2YV5A 1WYDA 1GVPA 4KKSA 2QF7A 2L4NA 3L2PA 2N8NA 3PQIA 2MJ8A 1NSNS 3A54A 1LABA 4R9WA 1KRTA 1B3QA 3PO2G 3I56A 2DNEA 4N9TA 2CWPA 2NZ1D 3I90A 3OIPA 3W2DA 1B4OA 4CDDC 1HNZQ 4PZ8A 1JCKB 3HOZG 4IFDJ 4DAYB 3K0XA 3IKJA 4C2MH 2F0OA 1Q86C 2D62A 2A68D 2ZXRA 5ELDA 3SK6A 1B50A 1IKMA 5HGQA 5GAGC 3CCUA 1O80A 3BJUA 4B9XA 1N36L 1GHJA 1PRTB 1MHWC 2IJ0A 5ELNA 2A19A 1PXUA 4IUNA 1WTOA 2VQEL 2JA7H 3BVZA 3K81C 4IPGA 4O1NA 4YWLA 1XMQL 4K14A 1CT1D 2NN6H 1H9MA 3TSSA 2JA6G 4UHVA 3MA2B 2NVYH 1N36Q 1MJEA 2X69A 3NTHA 4GLAC 1TWHH 2VQEQ 1DJRD 4XQQA 2V4DA 1Q1BA 4OL7A 1UWVA 2XRSD 1XMQQ 1P16A 4P75A 3HKZE 4PMCA 5KNDA 1JJ2A 4ME5A 1SNMA 5IOCA 2VW9A 1RD9D 2I07B 1I4PA 5A2QE 3I91A 1YVCA 1LT3D 2B2UA 3N6RA 3EFXD 2I0QA 3PCOB 3Q24A 2C5CA 2LXKA 1BF4A 5CV7A 3CMEA 4B3ML 2K5QA 1STYA 2RDHA 1MSHA 4A3CH 5C4JB 4DR1Q 1HUNA 1G291 2JA8B 5JJKA 2QW7A 5EJWA 3GTMH 3WDNA 3UE1A 3O13A 4QIWE 2ES2A 2AQ3B 3CHBD 4DK3C 4F87A 3I72A 2IHFA 2RSOA 4YHHQ 3GTGH 4A3DB 1NMGA 2ZT9C 3AEVA 1LT4D 1Y1VB 1N33L 1J8IA 2F0KA 1PRTC 3R2IA 5CC4A 5J22A 1EWIA 1VQJA 2R7ZG 3M4OB 2L55A 4H13C 4KN4C 2EYOA 2JA5H 1N33Q 4A75A 1QG7A 1BXTA 2AHOB 1L1OB 3OW2A 5IY0A 1QUQB 3CD6A 1UEBA 2HCIA 1PTOH 1EY6A 2VL6A 3NBHA 2Z6KA 3CCLA 2M2LA 4C3JH 2K50A 4OO1H 3OW7A 4DN4M 1A2UA 4FF3A 2J7ZA 1U0LA 3H15A 2UXCL 2WFWA 1EFWA 1UE5A 4MHEA 4L8JA 1KNAA 2A6HC 3ND8A 3A56A 3AMUA 4F7XA 2VUMB 1MKHA 3HP3A 1TS5A 4HR7B 3UDFA 4HCSA 2UUBL 4A3EB 5E3FA 5EBDA 1Z6HA 1EY8A 1IYVA 3E6ZX 3PUXA 4YIJA 5G3LF 1EYAA 3RUZA 2B2WA 4GKJL 1JR0D 3TP6A 2KJXA 2VQFL 5M3MB 3D6WA 2R7FA 3NTKA 5C3EG 2ZJPA 4LNQA 4HIMA 2R92B 2K01A 5FLXc 4GKJQ 2QDLA 1QCBD 1U4PA 3LX0A 1GUGA 1E2ZA 1CKNB 2AQ1B 2NVTB 4G7OC 2K7VA 4LF4L 1GUWA 1EQRA 1GKHA 3TREA 2KCTA 4CKEA 2I46A 4MNOA 1L1OC 1IBKQ 1ZEQX 5ELCA 4CKCA 1TWGB 1YZ6A 1QVFA 2Q8IB 4BS9A 5FLMG 4I7AA 1AW7A 2WAQB 4HSVA 4LF4Q 3C1FA 1A3UA 1YNJD 1H9SA 2H1EA 3TP8A 1YNND 3DWQA 3H3VC 2RHQB 1FGUA 5M5WB 4HN7A 1EY9A 4XQNA 1AN8A 5FLXL 1TWFH 2CKZB 3HOVH 3VA7A 2MGSA 2QKIC 3BYTB 4BBRH 3FVQA 3FDTA 2MUYA 3PUYA 5C44G 5KRUA 1NNXA 5IYCG 3Q0AA 2E2DC 3N52A 1O7IA 4IUVA 4KHZA 2R93H 3PO2H 1BKBA 4R4OA 3IRBA 2WB1B 3H0GG 1Q8IA 2LXJA 4RA8A 1PZKD 3UI2A 4EX5A 4RWSC 1VS0A 4BA2I 1OO9B 4TQUS 4DF7A 4ZYSA 2PYKA 3S17H 2KENA 2FXQA 1ILQA 3RZOH 2B29A 2F0WA 2ALYB 1DM0B 1LO5D 2B2YC 2Y0SG 3BVMA 5M3FB 4FF2A 4KHPQ 2NVXH 1PZID 4BY7H 1X3FA 2F4IA 5CV4A 3VA5A 5NUCA 3GV3A 3HRZC 3OTOL 1VQNA 3D4DA 1KXLA 1STEA 3MVVA 1UE1A 2PZTA 4C3HG 3FKIH 2IL8A 3OMCA 4RHSA 5ISRA 2JA7B 2JA6H 1Y1WB 3TP7A 1FJGL 1MJCA 1C4QA 3I2ZA 4K2KA 5KNBA 3T1YL 1I94L 3FRPB 3OTOQ 1PH5A 4CDEC 4KJNA 3GD7A 3LWEA 3CCMA 4H02A 4JOIA 1F9RA 4KKTA 3VDYA 2CQAA 4A3GG 4KI0A 1N34L 2QGQA 1FJGQ 1I94Q 4KKUA 1KHIA 3NEMA 3V05A 2KVMA 2F0UA 4JBKA 1G91A 5JJIA 4LF7L 4ME3A 4L63B 4JG2A 1XPRA 4A3JG 5CR3A 2K5DA 4JI5L 3TEHB 1PA6A 2YU9H 1N34Q 1CI3M 1M4VA 2ASBA 1OXVA 3MEFA 1O7YA 4LF7Q 1RCVD 4IALA 3ULPA 1K83H 5K36G 1PH1A 4A3BG 3HS0C 4JI5Q 1X3PA 3TRZA 1YNXA 4R8IA 3HOUB 3K7AH 3A7AB 4KJOA 2K28A 5G3LD 1HZ9A 1E2WA 1VQEA 2CQOA 5J39A 5IYBG 5JPMC 1FR3A 5JEAJ 2Z6KC 5CV8A 3K0YA 1VQ4A 2BE5D 5FOBB 1TXYA 1I50H 2EY1A 2F0HA 2MFIA 3D0FA 3GTKH 2F3VA 2XTIA 1RTOA 4XIGS 4RGTA 2B63G 1JE5A 2E2IH 4GLXA 4X3TA 3NQIA 2MP1A 4FXDA 4JV5L 4DKAC 1HQRD 2A6ED 3GTQH 2X6GA 3HOYG 1UEAB 2B8GA 4IPHA 4CBVA 3I4MH 1IXRA 4A93G 1WJJA 5GADC 1VQCA 3SXHA 4R8NA 1R9TH 2E2HH 2CW0D 1WD0A 3RN2A 1KTKA 3RN5A 1XNRL 4GNXC 4DR7Q 2RA4A 2IY5B 4K5WA 2CHBD 4FXGC 1HR0L 3S14B 4NPSA 1K0SA 4QF4A 5DAUA 4POGA 5CBEE 1NR4A 1ZXTA 2A69D 1E2VA 1LUZA 1BBWA 4LUOA 1NE3A 5C3EH 1ONLA 4CKBA 4A3FG 1HR0Q 3OPOA 1N8RC 3SEBA 4TVAB 2JA9A 2F1MA 2LFNA 2IX0A 3RLOA 1SE2A 4JI0Q 4QY7A 1DOKA 1NCVA 4QIWB 1IW7C 1II3A 4GN5A 1LTSD 1L0WA 3SHLA 1QVCA 1Z47A 4IUPA 4GLVB 2ID0A 3NTIA 3J81E 2PO4A 4IOAA 5DM63 3NQTA 3C1EA 3K5LA 1GOZA 4L6TB 5HURA 4AIMA 3E9HA 4DXFA 2KEDA 3S24A 3BZDB 1GJXA 1KDAA 2K32A 3GO5A 3RLNA 1PTOC 1WFQA 1VQ7A 5EGTA 4A3MG 4BBSG 1YJ9A 1CHPD 2MO1A 2AQ2B 3IFTA 2AWNA 1SE8A 1EIFA 1LTLA 5ELBA 4LF5L 1TWFB 5M9OA 4S3SA 2XSCA 1G2SA 3R8BA 2NTTA 2KUMA 1W6JA 1CSPA 3PO2B 1GHKA 4HIKA 5D65A 3KBXA 2EOTA 3UDGA 2A74C 2WIIB 2EY2A 1BNZA 1MGSA 1EEID 4JYAL 3JAML 5C4JH 4DAMA 2JA8H 3HOZB 3D8GA 4OX9Q 1NBWA 1HTLD 3OMGA 3S17B 1FGBD 1SYDA 1RODA 5HGTA 2TSSA 5LMUL 1RF2D 1G2TA 1C7YA 2PNHA 3HZXA 1HPCA 2J0TD 5CV6A 1DXMA 2FJ2A 4A3DH 1Y1VH 4O2DA 3PO3G 5C3XA 2A1AA 4GOPC 5AJ3L 1KD1C 1NR2A 4HCEA 3NELA 3M4OH 2RDGA 3J7AV 2QEJC 2WAQE 3FMCA 5A2QL 2JA6B 3ZJYC 1VQPA 5HY6A 1F2YA 5K5PA 1BR9A 3GTPB 5IGDA 4CJ0B 5JJLA 1RIPA 2OWOA 1JJCB 1W3SA 4JI4Q 2B8FA 2X6LA 4R1JA 4U673 3AYHB 4JCVE 5LMNL 1T9HA 4LUVA 4DV1L 1KIXA 1HXYD 2YTYA 5C5MA 3SK5A 3MXNB 5EKIA 3H3VH 3DEPA 1L2FA 3J80i 4N8FA 4ZUIA 3MFGA 3G4SA 1N9WA 2JXMB 2WB1E 3HG9A 1KAAA 2DY7A 5I9PA 4ABNA 2KCNA 2RCNA 1FNUA 5IYBH 1UUPA 3BU2A 1GUNA 4A3EH 3QR8A 4JBJA 4IJHA 1SYEA 3EBEA 1D1IA 3WWVA 1VMCA 2EYJA 1SNPA 2L5TA 1KLUD 4B3RQ 5M3MH 1F9QA 2K6AA 2ENBA 1V8QA 1JWUD 3S1NB 2R7ZB 2K5HA 4BXXH 4K0KL 1SYFA 2R92H 3U4ZA 1B9MA 2N78A 1E0BA 2KOLA 5CMDA 4LFCL 3WOEA 2DGYA 2NVTH 1TVXA 2F0MA 2Q2UA 1I4QA 4B9WA 2PCFB 4HEDA 3T16A 1U5KA 3S9WA 3U58A 4K0KQ 4HIDA 1AFPA 3HOXG 5M5YB 4LF9L 1G51A 1TWGH 3CCRA 4LFCQ 5I9OA 3D6CA 2NBFA 4MZ9A 4ILWA 2PZUA 1SJHD 4LWCA 3R2TA 4DUYL 5IT9E 1LT5D 3M4YA 2WKCA 4QB4A 4UAIA 1CM9A 4ODGA 2F0DA 4K6DA 2BCOA 4NXNL 4JC0A 2E2HB 3SK4A 5FO8B 1VQHA 4DUYQ 2G5DA 3GTJB 5CV9A 3TZUA 2EQSA 1EIYB 4FF4A 1LT6D 5FJ8G 2RVLA 2IW3A 1BVSA 1SDFA 3PUZA 3RMHA 4A3FH 3NENA 4NXNQ 2HQEA 2LY7A 1U4MA 1UNSA 3M4QA 4QUCA 4M8AA 1EIHA 4IUUA 1I4XA 5C3EB 3SDZA 1AZPA 3OHXC 2YTXA 1M90C 4UP7A 4IUQA 4TKOB 2HIVA 2XWJB 3S1RB 2ZXOA 5M3FH 5C4XG 2KHSA 3K8AA 1HH2P 4JBWA 1JT8A 2LS01 4UP9A 4L5RC 1AE3A 1FD7D 2XWBB 1SAPA 1AEXA 3JAME 5L37A 3EVQA 2MHVA 2L0CA 1Y1WH 1EYGA 2CWAA 4BBSH 4IO9A 2NVQB 4APVA 3MHBA 4NP5A 3BDCA 3VR3A 1KAWA 2PPBC 1M1KC 2L9HA 1K0RA 2CFMA 1EWHA 3T13A 1JB3A 5C44B 4EGVA 1IBLL 1WTRA 3STBC 1B70B 1AZQA 1BBUA 3H0GB 4RCOA 1VQLA 1Q1EA 3GV6A 1XX8A 1KQSA 2GVAA 1F2MA 3PV0A 3OWEB 2HCCA 1IBLQ 1H9KA 5IP9G 3P20A 1VQMA 3BDOA 2AUJD 1IYUA 3G48A 1QZHA 3HOUH 2Y0SB 3I70A 1ZYRD 2XNAC 1Y14B 1R4QB 5JEAG 5IP7H 3URYA 4E6IA 2ZM6L 1RTNA 1SFOB 4B3MQ 2Z9HA 2ZJQA 4C3HB 1WTQA 4P71A 1F2LA 4ZAIA 2SEBD 5C0XH 3I4OA 1XPUA 3P7JA 4K8JA 1TWAB 1DCZA 3U50C 1KDBA 3DUZA 4DNIA 1CTMA 3I4NG 4J1MA 1SJED 3HKSA 4A3GB 2SOBA 2BA0A 2OTJA 5CV5A 2R6GA 1MIUA 4A3IG 1BOSA 3E5SA 1JJGA 1H9RA 2SNMA 1A6XA 2EXDA 3JC66 2IWHA 4F88A 4A3JB 1T5XD 4HJ8A 4NW2A 1A62A 3KOJA 3Q22A 4ALPA 2E8GA 2TMPA 4LUZA 3J81j 4DXGA 1JE4A 5I6WA 4A4IA 4A3BB 1PFSA 5LL6X 1SR3A 2Z6BA 4C1NI 2EDGA 2E76C 3S14H 4RHRA 3T1HL 1HZAA 1H95A 1YEZA 2HDLA 3D3RA 1WI5A 2UXCQ 1RJTA 4A3KG 4NMZA 1SMYC 3RD4A 5JVH3 3D4WA 2O4XA 2JK8A 2MPMA 1E1TA 1S5FD 5ELOA 1A2TA 2Q8TA 3BVGA 1Y69U 1EZ6A 4IN3A 4FVMA 2UUBQ 4RMFA 3Q6SA 2E2JB 4X3UA 2XVSA 1Q3LA 2M9VA 3V96A 2VQFQ 2B63B 1S4ZA 2AKWB 4IPCA 1PV4A 2K4KA 4MIUA 1PYWD 1PH4A 4N9PA 2EYPA 4DNTB 3VYRA 2H5XA 2K05A 3SR1A 3HOYB 1A3VA 2E74C 3NK9A 5C4ZA 3J81c 4DV4L 1CZGA 3MTSA 4A93B 3PUWA 4GS3A 4OWTB 2I5HA 4CDCC 3DLLA 2OCEA 2QDBA 5C6AA 4HJ9A 4KTAA 4DV4Q 3A7LA 1RHPA 3MEHA 4L5TA 3SGIA 4UDUC 2EJFC 5FJ8H 2UU9L 4JBMA 1TWCB 2HHHL 4DU9A 1IL8A 3TS2A 1NMFA 4DR6L 1EUJA 1QNKA 1WTPA 4A3FB 1OXXK 4ZLTF 5GROA 3J81L 2UU9Q 1SNCA 3G7LA 1X9NA 1K3BC 1RKNA 1B9NA 3HOZH 1B2TA 3NUCA 1C48A 2IHEA 3CC7A 2NTSA 4KY5A 2UUAL 4X65L 1YIJA 1SXTA 4HSPA 1F9SA 3S1QH 5IE8A 3CKIB 4WFN3 3NBHB 4TSSA 2XRQD 2B2VA 3B6YA 2PQAA 1K8MA 5I2XA 4RCNA 2UUAQ 4X65Q 1PZJD 3S2HB 5JAVA 2B2UC 4DAVA 2F0QA 2F3WA 4JI3L 1V1PA 2FHTA 4A3MB 4BBSB 3ICEA 4O42A 4IFDI 5KNCA 4ZKBB 1EU4A 4RAUC 3GTPH 2K52A 4GKKL 2A68C 2N55A 4C3IG 2O5JC 1D2BA 3T1YQ 1CSQA 1SNDA 2F52A 4G57A 4R4TA 4DR2L 2RKSA 1IZ6A 3DM1A 3QJYA 3NWSA 2BOSA 2KBNA 1SE3A 3CQZH 3TN2A 1AP0A 1G6ZA 2E5LL 4GN4B 2HT1A 1SNOA 2JP1A 3TP5A 1S5CD 4YWKA 3KYHC 2DUDA 5J1ZA 1PH2A 5IYDG 4RGOS 1FYCA 4PMWA 2I5MX 4Z9CB 2VY3A 5JJZA 1Q81C 5D14A 1K28A 4G7ZC 1LYLA 3KUPA 1TY0A 1O7ZA 2N88A 2EIFA 3KJPA 1J9OA 1VQ5A 1RDPD 3PO3B 4P74A 2C35B 4JPBW 3S1NH 3FPPA 1H9SB 4DK1A 2R7ZH 2VB2X 3E0EA 4XT1B 1KABA 1CK1A 4WJ3M 4P72A 5GAHC 5F2DA 4CDFC 1X6OA 2EJGC 4IPDA 1HA6A 1BBXC 2I5LX 3KBGA 3HOWG 3FHWA 1JQYD 1U4LA 1S3OA 1HQMC 1S5ED 5CBAE 5KIXA 5M5YH 2ICIA 5IWAL 3S2DB 1KLGD 2WINB 2XN9C 3QOLA 1BO0A 1HNWL 2B2WC 1PH3A 4FP5D 2PI2A 3OYYA 1Q7YC 2UUCL 4YY3L 4DR4L 1GUOA 3A74A 3D4RA 1NUCA 5IGEA 2E75C 4NKLA 1TIID 4JV5Q 1K8GA 2JQOA 3G6EA 4K6LA 1HNWQ 1X54A 2F0TA 3L3OC 5IT9c 2DNCA 1Y8PB 4YCVA 4A3KH 1XNQL 3GTJH 3F2DA 2D5DA 5E1FA 2Y0SE 3CXCA 4P73A 1QE6A 1SE4A 2NZOA 2KEEA 4PV1C 1A8VA 5KGUA 2RDFA 1XNRQ 4LMQD 1EL0A 1PH8A 1BCPF 2EY6A 2FMCA 3K5MA 2GVBA 3QOJA 1YJWA 2G9HD 3RNUA 3MXGA 3ER0A 1TS4A 4IFDG 1CA5A 4RGNA 3S1RH 1PH6A 1UE6A 4H7BA 3CRLC 3NBIA 1LLRD 3PUVA 5IT9L 1F77A 1VMPA 1QNUA 4ZCKA 1O78A 2EYLA 3PMFA 3HOXB 4OEMB 3I8ZA 1PDQA 2Z8LA 2AUKA 3BZCA 5FLMH 3J80E 3UDXA 1ENFA 2F0IA 5D3IB 1JC7A 5EBCA 4OIKA 1OTCA 3FP9A 1GO3E 4PMBA 3KLSX 3P75A 3TBIB 3RR5A 2F0LA 2NVQH 2BH2A 2VNUD 4QUFA 3JAMc 1Z9FA 5CGKA 1CFMA 1U4RA 2OXPA 3J7ZC 2Z0SA 5C44H 3CCQA 3GP7A 4C1NK 5IYCH 1YJNA 2ZTCA 5AFWA 4IQZA 4WORA 2F0VA 3AQQA 3G6JB 3H0GH 3I73A 4PG3A 2N3SA 1MSGA 4LF5Q 1YNJC 3WOFA 2CCZA 1IBML 2RF4A 4A76A 1YNNC 3CPFA 1NY4A 4OGQC 2HUGA 4JOIC 3HGBA 5C4XB 3EN2A 4KD3A 4X64L 3K57A 4GN3B 1N32L 4PNYA 1D1KA 3T56B 1IBMQ 1SFOH 3D31A 3IFDA 4L5SA 4JYAQ 3S1QB 1M8AA 4BY1G 1XXGA 2F4VL 4C3HH 4PZ7A 2J4XA 4AYBG 4KMUC 4X64Q 3LWUA 1AE2A 5BR8L 3TS0A 1PRTD 4DV2L 1K9MC 1TWAH 3F1ZA 5LMUQ 1D6EC 4KK7A 3OWFA 2F4VQ 4A3GH 2NYZD 3UDIA 4A3CG 1EIGA 3ONAB 3K7UC 4DV2Q 1ICFB 5AJ3Q 4DK6C 4JI6L 1CKMA 4J8QA 3J7A5 2VZAA 3C3LA 4A3JH 3EJIA 2OEOA 1LTRD 2WP8J 1E1OA 4QCLA 2B2TA 3K59A 1EYCA 1CHQD 2D0OA 2QEXA 5T1IA 3CQZB 5K36H 4A3BH 2A6HD 1S40A 5LMNQ 4DV1Q 1A3TA 4LJZC 2V1CC 4X3SA 2PZWA 5LHY1 2JA5G 3X3MA 4HMIA 2K5WA 2RCFA 1D8LA 5LL6S 4V0BA 1SROA 1WD1A 2MNAA 5EPKA 2HQLA 4DPGA 4X62L 1BCPD 1HZCA 3ZYYX 1HUMA 3J81i 4DUZL 4C3JG 1STAA 4OO1G 5IODA 4QL5A 5KYLA 3CCVA 2LKVA 1BQQT 3OIQA 3CC4A 3VYTA 5BN3A 1EZ8A 4X62Q 3I4NB 2F0JA 2E2JH 1TS3A 1R4PB 4DUZQ 3AU7A 3HKZG 3GTLB 3NPPA 2VB3X 2B63H 4A3IB 2EVBA 5M5XB 2KA7A 4LAAA 4DV7L 3EROA 3HOYH 4QGUA 2CVRA 3DWAA 2SNSA 1B53A 2EY5A 1ZKOA 2NB0A 1TS2A 4A93H 2BE5C 5KYIA 3Q23A 1HFGA 2LMCB 1B44D 1U9RA 4KV6A 4DGZA 1WCMB 4LF9Q 3RLFA 1D7QA 4GZYC 4XDXA 4LFAL 1DONA 4K5XA 2JN4A 3PF5A 3ERQA 5ELFA 1LTAD 2H4OA 4OXPA 4JI1L 1TWCH 4LW1A 3F8TA 3KJOA 1V43A 4A3KB 4BA1I 1CQVA 3BG3A 1HNXL 1D5MC 2BA1A 4B3TL 3SK8A 2R61A 2A6EC 1LTID 2EPBA 1VQBA 1VQFA 1K8OA 5EQ0A 5C5LA 1YHBA 5I6YA 3A8JE 1STHA 5E4XA 1WTVA 5FO9B 4IFDH 4IUTA 1D5ZC 2CW0C 3U9SA 3TZDA 4DK0A 4NDXA 1QWYA 3E0JA 3W5OA 4XTCS 3GTOB 1BDOA 3HOVG 4X3KA 4DA2A 4BBRG 4QQBX 2IX3A 4CJ1B 1HNZL 1L1OA 1GM5A 1QILA 3HFZB 2A69C 1MD2D 1JOOA 3A0JA 1QUQA 4ZKCB 2Z4IA 2R93G 3RZDH 1JOQA 4UP8A 1I6HB 2JEBI 2PNRC 3A8KE 3S2HH 4KHVA 4ZUJA 1LTBD 3TQYA 4A3MH 1LV9A 4CJ2C 2JJQA 4PQXA 1DZ1A 4FO2A 3MXUA 4G7HC 1IHZA 1PTOF 1YBYA 5CORA 1LM0A 3DM3A 4H0LC 4FF1A 1EYDA 1Y8NB 1A63A 5JOBA 1XWEA 4BY7G 2DY8A 1FVIA 3K80C 2O5IC 1B1ZA 1V9PA 1D5XC 3W1GA 2DN8A 1HA5A 1GUTA 2IPKD 4MN3A 1KDCA 2K04A 3FKIG 1V1OA 4MTNA 3VR4A 1W6KA 1CKOA 3M4PA 5E4WC 4Y7NB 1KRSA 2B2YA 1IKLA 1EEFD 2NZHA 4HMJA 3LGJA 4IOCA 4BY1H 4HTHA 1CKNA 2FFKB 4CGYB 3S15B 4POFA 3PSIA 1C9OA 1SEBD 4DR1L 3PO3H 4KLKA 1ICWA 4IZ8A 1FNVA 2B2TC 1JORA 1YITA 2KCCA 3L7ZC 2JSOA 2Q2IA 1PFBA 4L5QA 2ZM6Q 2BH8A 3IAYA 2PW5A 3PGZA 2K33A 3A8IE 4YHHL 2JE6I 4XT3B 2WACA 1XTDA 2A5HA 3BZKA 2RSNA 1E22A 4C3IB 1BCPB 2UXBL 3W3AA 3S2DH 1EU3A 1X65A 3H94A 1TY2A 3MAQA 1K73C 5IIFA 2AMCB 4WJWA 3VR2A 5C4HA 1SMXA 2CH4W 1VQDA 2CH4A 3KLSA 2UXBQ 1I3QB 3KLWA 1S5BD 1Q8KA 5C0XJ 1NJIC 3BDLA 2K14A 4R4CA 1PH7A 4X6AH 2YYZA 1WCMG 3Q8DA 2RBMA 2B3GA 4Q5VA 3IL8A 3S1MB 1I4GA 2Z4HA 5BN4A 2XGTA 2B39A 1SSOA 5D3DA 4C56C 1QJOA 2ZTDA 4RKLA 2PI2E 2BDOA 2RQXA 3T1HQ 3VR6A 3SE0A 3JAMi 4JW0A 3MZ5A 3H91A 4FYDA 1HR0W 3I4MG 3L9AX 3DWPA 1F2ZA 4KN7C 5IGCA 1KNEA 1IW7D 5EPLA 1ESFA 2KECA 1EFID 2LSSA 3J7YW 2EYMA 3HOWB 1S5DD 4MTKA 2YTVA 1MBYA 4JK1C 4DNRB 4OWXB 3HOXH 2EJMA 1SYBA 4F8MA 2PMZB 3R93A 3BYYB 1BCPC 5COYA 1XMOL 4ID6A 1VQOA 1MI2A 1I5FA 2MO0A 3H3VI 2N49A 4HAEA 3M3YB 1PTOD 3J80c 4TRDA 3M85A 1SN8A 1G8ZD 1IBKL 2MQHA 1XMOQ 2QCPX 3NE5B 2KHJA 3VR5A 4OHJA 1QB5D 3W1BA 1HJPA 3LNNA 3ITPA 4GNXA 1PFMA 2L15A 5I2YA 3EIVA 5A35A 5FKAC 4KD4A 3DXJC 4K5VA 3E3XA 1VQGA 1UAPA 3CP0A 1EQVA 3GQBA 1ET6A 3NP8A 4OWWB 2EE1A 4U68A 4OONA 3T53B 3J80L 4JI7L 1FL0A 1DD2A 5T1GA 2HHHQ 4HJ5A 4BWGB 1L0YB 3G71A 2WKDA 5C4XH 2OT2A 3KF8A 4P2CB 4DV3L 3TMEA 5C3WA 4DR6Q 1L0XB 4DFAA 1S72A 3FEWX 5H1SE 4QJFA 2AWOA 1CZWA 4B3SL 4JI7Q 2A8VA 3EQLC 2NUCA 1LTTD 4A3LG 2K1BA 1GD7A 1EY0A 1TT2A 1VCIA 3QO2A 4DV3Q 1HFNA 4KHPL 1GUSA 3S16H 3RZDB 3ULLA 4B3SQ 4ULLA 4YCWA 1VQ8A 1VQAA 2ZXPA 2FMMA 1B7YB 1X3GA 3AFQA 3I7FA 1AH9A 1PYBA 3QB3A 2JA8G 1KL9A 3NSWA 2GN5A 2Q2TA 4KY7A 2EYFA 2UXDL 4C2MB 3CW2C 3CC2A 1E3PA 4JI3Q 1A0IA 2VS1A 3EA6A 1LTGD 1EWCA 2K75A 5EKKA 3C2PA 4A3DG 1JB7A 3MFYA 1Y1VG 4N8X1 1STGA 2UXDQ 3CPWA 4XYOA 4WRDA 5IP9H 4GKKQ 2C9OA 3M7GA 2F0SA 1QOHA 3QIAA 2NVYB 1EQTA 5LMNW 4X66L 4DR2Q 3R3OA 5IGBA 1TWHB 1SYGA 1Y8OB 4JI2L 5JEAH 1ILPA 5TSSA 1HHVA 1X32A 2DJFC 2E5LQ 4BY1B 2XIWA 4XYQA 4CHTB 5BN5A 1TR5A 4AYBB 1HCZA 1PHJA 1ASYA 3SVMA 1PMRA 4X66Q 1STNA 1A15A 4GOPA 3GDEA 2ZJRA 4JI2Q 2O2LD 4GNXB 2VXWA 3I4NH 5EAYA 4DR5L 1UE7A 2HD3A 4R4QA 3T4AC 4LF8L 1PRTF 2NN6I 3CCJA 3GTLH 3K5OA 1Z7TA 3GTMB 2VUMG 2Q2HA 3X3NA 1ZYRC 4A3IH 5M5XH 2OQKA 2F0FA 1I4HA 1XYIA 4ZK9B 1GXDC 3DMUA 1EOVA 4DR5Q 5DM73 4A3EG 4LF8Q 1HRJA 1STBA 4I65A 4LK1C 2RHSB 3GTGB 1SYCA 3PIPA 4LF6L 3AFPA 5M3MG 1NTGA 1W2BA 3I4LA 2F0NA 3KF8B 4BXXG 4HIOA 1WCMH 5EPJA 5IGFA 3UE0A 5IWAQ 2R92G 4Y52H 1VQ9A 3P1HA 2JA5B 1X3QA 2K03A 3KLRA 3KK7A 4G4KA 4LF6Q 4FNFA 1HZBA 2UUCQ 1JOKA 1Q46A 4YY3Q 4DR4Q 1OXTA 4M1UB 4OIJA 2PQAB 4XQJA 1J5EL 1SBBB 4UY8C 4NB3A 3I3CA 4J15A 4IURA 1DGSA 5DEHA 4RFBA 3K6OA 4EVOA 1PTOB 4DR7L 1WTHA 4YCUA 4C3JB 3NXWA 1V1PB 2Z1CA 2WAQG 1ASZA 1CUKA 5C0XI 2A73B 3A55A 1O7LA 1QVGA 1XNQQ 1X56A 3PIOA 1J5EQ 5J3BA 2KQ3A 1BUVT 3OOCA 3QWNA 5DNFA 3F2UA 3HKZB 1I6VC 1DOLA 2KHIA 3GTOH 2KCMA 1EY4A 4ZQ3A 2F0EA 2F3IA 4JI0L 1VQIA 3HEJA 1CQFA 4RG1A 4EQPA 3KDFA 1G6PA 1VQ6A 1I6HH 2FINB 1XTCD 4DAPA 1ENCA 1F9PA 2WB1G 4OO1I 5FLXE 3MXNA 2GA4B 2HIXA 3L0OA 2ATWA 2IT1A 2EYHA 3V2TA 4DR3L 2P5ZX 3QG1A 1K8AC 1C8CA 3U4VA 5M3FG 1OXSC 3KF6A 1PLFA 4GOPB 1ML0D 2B2VC 3STBD 4DR3Q 2QA4A 2BDNA 3CMAA 1VF7A 2R7DA 3PF4A 1Q90A 2HDMA 4EQ5A 4DV0L 1EY5A 1WVLA 2JEAI 2JA7G 1Y1WG 3CU7A 3CCEA 1C0AA 4Y7NH 1PH9A 1PVOA 2NN6G 1VF5C 2OTLA 4A3LH 1TKWB 4DV0Q 3MC0B 1SRUA 3MXPA 3HOVB 1K3RA 3S15H 4BBRB 4H44C 1YI2A 5JPNC 4NXML 4OX9L 5EKLA 4I7ZC 2R93B 4KY6A 5DLQE 4AQYL 1DOMA 5KEEA 2PMZE 4K2LA 1VQKA 3CRKC 3BS1A 4HJ7A 3NWTA 1N32Q 3H6MA 3M7NA 2DJGC 5E7NA 2D9UA 4IJLA 4NXMQ 3S16B 1SNQA 3CAMA 4EQOA 5ELEA 2L1BA 4AQYQ 1WOCA 3DHQA 2K5NA 1Q12A 3ULJA 3RZOB 4FXKC 5BR8Q 3HOUG 2EZVA 1EOTA 2OF1A 4C3IH 4OELB 4FDBA 2Q8RE 1X3EA 3VYUA 2JYOA 2NVXB 4BY7B 5IGGA 2K5VA 5IP7G 1I4RA 3J7AF 1Q82C 2OQ0A 4LFBL 3PIP3 1CA6A 4PZ6A 4XXEA 3FKIB 1H9JA 1PFNA 1I3QH 2WV6D 1DYQA 5C0XG 4JI4L 4JI6Q 1E7ZA 4K8IA 1XPOA 5IYDH 4AH6A 4O0AA 1WTXA 1TQOA 1X55A 4LFBQ 3TDQA 3CCSA 1VDZA 4HJAA 3M9BA 4UPAA 4JI8L 1KC8C 2SDFA 4YWMA 4DV6L 2D2CC 4DAYA 3KDFB 3S1MH 2NWGA 1PYSB 4V190 1ET9A 1SMYD 5JVG3 4RGMA 2F03A 2F0PA 3FPUB 4JI8Q 2YU9B 4RH6A 4DV6Q 1JWSD 3DEOA 5CYUA 3PIO3 1YHAA 2F0GA 2ZTEA 2M00A 3AB9A 1SLJA 2EXZA 3NHHA 5FO7B 3H09A 1IYJB 1FNWA 2VUMH 3T51B 4B3RL 1JICA 1XJVA 4WJ4A 1K83B 3HOWH 3KF6B 4R4IA 1E24A 1WTWA 3K7AB 1EY7A 4DV5L 3K58A 3U9OA
chains in the Genus database with same CATH topology
1TU2B 4EQNA 2L11A 1T5EA 2IX1A 2G9DA 5FK9C 1I50B 1B3AA 2QILA 4ZRZA 1OXUA 3MWYW 3GTKB 2L12A 2PQEA 1JWMD 1LACA 1ENAA 1NAPA 5I4DA 2E2IB 4Q0FA 4B08A 3K5NA 2R3ZA 4RKBA 4J6HA 3GTQB 2PW7A 1HTPA 3VYSA 3I4MB 2ICEC 3OSOA 1R9TB 4QMGA 3C46A 3ND9A 1ESRA 4KKSA 2QF7A 2L4NA 2MJ8A 1NSNS 3A54A 1LABA 4R9WA 2DNEA 4N9TA 2NZ1D 3I90A 3OIPA 3W2DA 1B4OA 1JCKB 4IFDJ 3IKJA 2F0OA 2D62A 2A68D 2ZXRA 5ELDA 3SK6A 1B50A 1IKMA 1O80A 4B9XA 1GHJA 1PRTB 2IJ0A 1PXUA 4IUNA 1WTOA 3BVZA 4O1NA 4K14A 1CT1D 2NN6H 1H9MA 3TSSA 3MA2B 2X69A 3NTHA 1DJRD 4XQQA 2V4DA 1Q1BA 4OL7A 2XRSD 4PMCA 5KNDA 4ME5A 1SNMA 5IOCA 1RD9D 2I07B 1I4PA 5A2QE 3I91A 1LT3D 2B2UA 3N6RA 3EFXD 3Q24A 2C5CA 1BF4A 5CV7A 2K5QA 1STYA 2RDHA 1MSHA 5C4JB 1HUNA 1G291 2JA8B 5EJWA 3WDNA 3O13A 2AQ3B 3CHBD 4F87A 3I72A 2RSOA 4A3DB 2ZT9C 1LT4D 1Y1VB 1J8IA 2F0KA 1PRTC 3R2IA 5CC4A 5J22A 3M4OB 2L55A 4H13C 4KN4C 2EYOA 1QG7A 1BXTA 2HCIA 1PTOH 1EY6A 3NBHA 2M2LA 4OO1H 3OW7A 4DN4M 1A2UA 4FF3A 2J7ZA 4MHEA 4L8JA 1KNAA 2A6HC 3ND8A 3A56A 3AMUA 4F7XA 2VUMB 3HP3A 1TS5A 4HR7B 4HCSA 4A3EB 5E3FA 5EBDA 1Z6HA 1EY8A 1IYVA 3E6ZX 3PUXA 4YIJA 5G3LF 1EYAA 3RUZA 2B2WA 1JR0D 3TP6A 2KJXA 5M3MB 3D6WA 3NTKA 2R92B 2K01A 1QCBD 1U4PA 3LX0A 1GUGA 1E2ZA 2AQ1B 2NVTB 4G7OC 2K7VA 1GUWA 4CKEA 2I46A 1ZEQX 5ELCA 4CKCA 1TWGB 2Q8IB 4BS9A 1AW7A 2WAQB 4HSVA 3C1FA 1A3UA 1YNJD 1H9SA 2H1EA 3TP8A 1YNND 3DWQA 3H3VC 5M5WB 4HN7A 1EY9A 4XQNA 1AN8A 5FLXL 3VA7A 2MGSA 2QKIC 3BYTB 3FDTA 3FVQA 2MUYA 3PUYA 5KRUA 3Q0AA 2E2DC 3N52A 4KHZA 4IUVA 2WB1B 1Q8IA 4RA8A 1PZKD 3UI2A 4RWSC 4BA2I 1OO9B 4TQUS 4DF7A 4ZYSA 2PYKA 1ILQA 2F0WA 1DM0B 1LO5D 2B2YC 3BVMA 5M3FB 4FF2A 1PZID 2F4IA 5CV4A 3VA5A 5NUCA 3GV3A 3HRZC 3D4DA 1STEA 3MVVA 2PZTA 4C3HG 2IL8A 3OMCA 4RHSA 5ISRA 2JA7B 1Y1WB 3TP7A 1C4QA 4K2KA 5KNBA 3FRPB 4KJNA 3GD7A 3LWEA 1F9RA 4KKTA 2CQAA 4KI0A 4KKUA 3V05A 2KVMA 2F0UA 1G91A 4L63B 5CR3A 2K5DA 1CI3M 1M4VA 1OXVA 1O7YA 1RCVD 4IALA 5K36G 3HS0C 1X3PA 4R8IA 3HOUB 4KJOA 3A7AB 2K28A 5G3LD 1E2WA 5J39A 5JPMC 1FR3A 5JEAJ 5CV8A 3K0YA 2BE5D 5FOBB 2EY1A 2F0HA 2F3VA 1RTOA 4XIGS 4RGTA 4X3TA 3NQIA 2MP1A 4FXDA 1HQRD 2A6ED 2X6GA 1UEAB 2B8GA 4CBVA 3SXHA 4R8NA 2CW0D 1WD0A 1KTKA 2RA4A 4K5WA 2CHBD 4FXGC 3S14B 4QF4A 5DAUA 5CBEE 1NR4A 1ZXTA 2A69D 1E2VA 1ONLA 4CKBA 3OPOA 3SEBA 2F1MA 2LFNA 2IX0A 1SE2A 1DOKA 1NCVA 4QIWB 1IW7C 1II3A 1LTSD 3SHLA 1Z47A 4IUPA 2ID0A 3NTIA 3J81E 2PO4A 5DM63 3NQTA 3C1EA 3K5LA 1GOZA 4L6TB 5HURA 4DXFA 2KEDA 3BZDB 1GJXA 1KDAA 2K32A 3GO5A 1PTOC 5EGTA 1CHPD 2AQ2B 3IFTA 2AWNA 5ELBA 1TWFB 5M9OA 4S3SA 2XSCA 1G2SA 3R8BA 2NTTA 2KUMA 1W6JA 3PO2B 1GHKA 5D65A 3KBXA 2EOTA 2A74C 2WIIB 2EY2A 1BNZA 1MGSA 1EEID 3JAML 3HOZB 3D8GA 1HTLD 3OMGA 3S17B 1FGBD 1SYDA 1RODA 5HGTA 2TSSA 1RF2D 1G2TA 3HZXA 1HPCA 2J0TD 5CV6A 1DXMA 2FJ2A 5C3XA 1NR2A 4HCEA 2RDGA 3J7AV 2QEJC 3FMCA 5A2QL 2JA6B 1F2YA 5K5PA 1BR9A 3GTPB 5IGDA 4CJ0B 2B8FA 2X6LA 4U673 1HXYD 5C5MA 3SK5A 5EKIA 3DEPA 4ZUIA 3MFGA 2JXMB 3HG9A 1KAAA 2DY7A 5I9PA 4ABNA 2KCNA 1FNUA 1UUPA 1GUNA 1SYEA 1D1IA 1VMCA 2EYJA 1SNPA 2L5TA 1KLUD 1F9QA 2K6AA 2ENBA 1V8QA 1JWUD 3S1NB 2R7ZB 1SYFA 1B9MA 1E0BA 2KOLA 5CMDA 3WOEA 1TVXA 2F0MA 1I4QA 4B9WA 2PCFB 4HEDA 3T16A 3S9WA 1AFPA 5M5YB 5I9OA 3D6CA 2NBFA 4ILWA 2PZUA 1SJHD 3R2TA 5IT9E 1LT5D 3M4YA 2WKCA 4QB4A 4UAIA 1CM9A 4ODGA 2F0DA 4K6DA 2BCOA 2E2HB 3SK4A 5FO8B 3GTJB 5CV9A 3TZUA 4FF4A 1LT6D 2RVLA 2IW3A 3PUZA 1SDFA 3RMHA 2HQEA 2LY7A 1U4MA 1UNSA 4QUCA 4M8AA 1EIHA 4IUUA 1I4XA 5C3EB 3SDZA 1AZPA 3OHXC 4IUQA 4TKOB 2XWJB 3S1RB 2ZXOA 2KHSA 4JBWA 2LS01 1FD7D 2XWBB 1SAPA 1AEXA 3JAME 3EVQA 2MHVA 2L0CA 2NVQB 3MHBA 4NP5A 3BDCA 3VR3A 2PPBC 2L9HA 1EWHA 3T13A 1JB3A 5C44B 4EGVA 1WTRA 1AZQA 3H0GB 4RCOA 1Q1EA 3GV6A 1XX8A 1F2MA 3PV0A 3OWEB 2HCCA 1H9KA 3P20A 3BDOA 2AUJD 1IYUA 2Y0SB 3I70A 1ZYRD 2XNAC 1R4QB 5JEAG 3URYA 4E6IA 1RTNA 1SFOB 4C3HB 1WTQA 1F2LA 4ZAIA 2SEBD 5C0XH 3P7JA 4K8JA 1TWAB 1DCZA 1KDBA 3DUZA 1CTMA 4J1MA 1SJED 4A3GB 2SOBA 2BA0A 5CV5A 2R6GA 1BOSA 3E5SA 1H9RA 2SNMA 1A6XA 2IWHA 4F88A 4A3JB 1T5XD 4NW2A 3Q22A 2TMPA 4DXGA 1JE4A 5I6WA 4A3BB 5LL6X 4C1NI 2EDGA 2E76C 4RHRA 2HDLA 3D3RA 1RJTA 4NMZA 1SMYC 3RD4A 5JVH3 3D4WA 2O4XA 2MPMA 1S5FD 1A2TA 2Q8TA 3BVGA 1Y69U 1EZ6A 4IN3A 4FVMA 3Q6SA 2E2JB 4X3UA 2XVSA 1Q3LA 2M9VA 3V96A 2B63B 1S4ZA 4MIUA 1PYWD 4N9PA 2EYPA 4DNTB 3VYRA 2K05A 3SR1A 3HOYB 1A3VA 2E74C 3NK9A 5C4ZA 1CZGA 3MTSA 4A93B 3PUWA 2QDBA 5C6AA 4KTAA 3A7LA 1RHPA 3MEHA 4UDUC 2EJFC 1TWCB 4DU9A 1IL8A 1QNKA 1WTPA 4A3FB 1OXXK 4ZLTF 3J81L 1SNCA 3G7LA 1RKNA 1B9NA 1B2TA 3NUCA 1C48A 2NTSA 4KY5A 1SXTA 4HSPA 1F9SA 3CKIB 4WFN3 4TSSA 2XRQD 2B2VA 5I2XA 1K8MA 4RCNA 1PZJD 3S2HB 5JAVA 2B2UC 4DAVA 2F0QA 2F3WA 1V1PA 2FHTA 4A3MB 4BBSB 4IFDI 4O42A 5KNCA 4ZKBB 1EU4A 4RAUC 2A68C 2N55A 4C3IG 2O5JC 1D2BA 1SNDA 4G57A 2RKSA 3DM1A 3QJYA 3NWSA 2BOSA 1SE3A 3TN2A 1AP0A 1G6ZA 1SNOA 2JP1A 3TP5A 1S5CD 5J1ZA 4RGOS 1FYCA 4PMWA 4Z9CB 5JJZA 5D14A 4G7ZC 3KUPA 1TY0A 1O7ZA 2N88A 1J9OA 1RDPD 3PO3B 3FPPA 1H9SB 4DK1A 2VB2X 4XT1B 1KABA 1CK1A 5F2DA 2EJGC 1HA6A 1BBXC 3KBGA 1JQYD 1U4LA 1HQMC 1S5ED 5CBAE 5KIXA 2ICIA 3S2DB 1KLGD 2WINB 2XN9C 3QOLA 1BO0A 2B2WC 4FP5D 1GUOA 3D4RA 1NUCA 5IGEA 2E75C 4NKLA 1TIID 4K6LA 2F0TA 3L3OC 2DNCA 1Y8PB 2D5DA 5E1FA 1QE6A 1SE4A 4PV1C 2KEEA 5KGUA 2RDFA 4LMQD 1EL0A 1BCPF 2EY6A 2FMCA 3K5MA 3QOJA 2G9HD 3MXGA 1TS4A 4IFDG 1CA5A 4RGNA 4H7BA 3CRLC 3NBIA 1LLRD 3PUVA 5IT9L 1F77A 1VMPA 1QNUA 1O78A 2EYLA 3PMFA 3HOXB 3I8ZA 1PDQA 2Z8LA 2AUKA 3J80E 1ENFA 2F0IA 5D3IB 1JC7A 5EBCA 4OIKA 4PMBA 3KLSX 3P75A 3TBIB 2F0LA 2VNUD 4QUFA 5CGKA 1CFMA 1U4RA 2OXPA 3GP7A 4C1NK 5AFWA 4IQZA 4WORA 2F0VA 3G6JB 3I73A 1MSGA 1YNJC 3WOFA 1YNNC 4OGQC 2HUGA 3HGBA 5C4XB 4KD3A 3K57A 4PNYA 1D1KA 3T56B 3D31A 3IFDA 3S1QB 1M8AA 1XXGA 2J4XA 4KMUC 3LWUA 1PRTD 1D6EC 4KK7A 3OWFA 2NYZD 1EIGA 3ONAB 4J8QA 3C3LA 3EJIA 2OEOA 1LTRD 2WP8J 4QCLA 2B2TA 3K59A 1EYCA 1CHQD 5T1IA 3CQZB 5K36H 2A6HD 1A3TA 4LJZC 4X3SA 2PZWA 5LHY1 3X3MA 4HMIA 2K5WA 5LL6S 4V0BA 1WD1A 5EPKA 1BCPD 3ZYYX 1HUMA 4C3JG 1STAA 4OO1G 5IODA 5KYLA 2LKVA 1BQQT 3OIQA 3VYTA 5BN3A 1EZ8A 3I4NB 2F0JA 1TS3A 1R4PB 3AU7A 3GTLB 3NPPA 2VB3X 4A3IB 2EVBA 5M5XB 2KA7A 4LAAA 3EROA 2CVRA 3DWAA 2SNSA 1B53A 2EY5A 1ZKOA 2NB0A 1TS2A 2BE5C 5KYIA 3Q23A 1HFGA 2LMCB 1B44D 1U9RA 4KV6A 4DGZA 1WCMB 3RLFA 4GZYC 4XDXA 1DONA 4K5XA 3ERQA 5ELFA 1LTAD 2H4OA 4A3KB 1V43A 4BA1I 1CQVA 3BG3A 1D5MC 2BA1A 3SK8A 2R61A 2A6EC 1LTID 2EPBA 1K8OA 5EQ0A 5C5LA 5I6YA 3A8JE 1STHA 5E4XA 1WTVA 5FO9B 4IFDH 4IUTA 1D5ZC 2CW0C 3U9SA 3TZDA 4DK0A 4NDXA 1QWYA 3E0JA 4XTCS 3GTOB 1BDOA 4X3KA 4DA2A 2IX3A 4CJ1B 1QILA 2A69C 1MD2D 1JOOA 4ZKCB 2Z4IA 1JOQA 1I6HB 2JEBI 2PNRC 3A8KE 4KHVA 4ZUJA 1LTBD 1LV9A 4CJ2C 4PQXA 1DZ1A 4FO2A 3MXUA 4G7HC 1IHZA 1PTOF 5CORA 4H0LC 4FF1A 1EYDA 1Y8NB 5JOBA 1XWEA 2DY8A 2O5IC 1B1ZA 1D5XC 2DN8A 1HA5A 1GUTA 2IPKD 4MN3A 1KDCA 2K04A 1V1OA 3VR4A 1W6KA 5E4WC 4Y7NB 2B2YA 1IKLA 1EEFD 4HMJA 4HTHA 2FFKB 4CGYB 3S15B 1SEBD 1ICWA 4IZ8A 1FNVA 2B2TC 1JORA 2KCCA 3L7ZC 2JSOA 1PFBA 3IAYA 2PW5A 2K33A 3A8IE 2JE6I 4XT3B 2WACA 2A5HA 2RSNA 4C3IB 1BCPB 3W3AA 1EU3A 3H94A 1TY2A 3MAQA 5IIFA 4WJWA 3VR2A 5C4HA 3KLSA 1I3QB 1S5BD 5C0XJ 3BDLA 2YYZA 2RBMA 4Q5VA 3IL8A 3S1MB 1I4GA 2Z4HA 5BN4A 2B39A 1SSOA 5D3DA 4C56C 1QJOA 4RKLA 2BDOA 2RQXA 3VR6A 3SE0A 3MZ5A 3H91A 4FYDA 3L9AX 3DWPA 1F2ZA 4KN7C 5IGCA 1KNEA 1IW7D 5EPLA 1ESFA 2KECA 1EFID 3J7YW 2EYMA 3HOWB 1S5DD 1MBYA 4JK1C 4DNRB 2EJMA 1SYBA 4F8MA 2PMZB 3R93A 3BYYB 1BCPC 5COYA 4ID6A 1MI2A 4HAEA 3M3YB 1PTOD 4TRDA 3M85A 1G8ZD 2QCPX 3NE5B 3VR5A 4OHJA 1QB5D 3LNNA 3ITPA 1PFMA 5I2YA 5A35A 5FKAC 4KD4A 3DXJC 4K5VA 1UAPA 1EQVA 3GQBA 1ET6A 3NP8A 2EE1A 4U68A 3T53B 3J80L 1DD2A 5T1GA 4BWGB 1L0YB 2WKDA 2OT2A 3KF8A 4P2CB 3TMEA 5C3WA 1L0XB 4DFAA 3FEWX 2AWOA 1CZWA 3EQLC 2NUCA 1LTTD 2K1BA 1EY0A 1TT2A 1VCIA 3QO2A 1HFNA 1GUSA 3RZDB 4ULLA 2ZXPA 2FMMA 3QB3A 3NSWA 4KY7A 2EYFA 4C2MB 3EA6A 1LTGD 1EWCA 5EKKA 3C2PA 3MFYA 1STGA 4XYOA 4WRDA 2C9OA 3M7GA 2F0SA 1QOHA 3QIAA 2NVYB 1EQTA 3R3OA 5IGBA 1TWHB 1SYGA 1Y8OB 5JEAH 1ILPA 5TSSA 1HHVA 1X32A 4BY1B 2XIWA 4XYQA 4CHTB 5BN5A 1TR5A 4AYBB 1HCZA 3SVMA 1PMRA 1STNA 1A15A 2O2LD 2VXWA 3T4AC 1PRTF 2NN6I 3K5OA 1Z7TA 3GTMB 3X3NA 1ZYRC 2F0FA 1I4HA 1XYIA 4ZK9B 1GXDC 3DMUA 5DM73 1HRJA 1STBA 4I65A 4LK1C 3GTGB 1SYCA 3I4LA 2F0NA 5EPJA 5IGFA 3P1HA 2JA5B 1X3QA 2K03A 3KLRA 3KK7A 4G4KA 4FNFA 1JOKA 1OXTA 4M1UB 4OIJA 4XQJA 1SBBB 3I3CA 4IURA 5DEHA 4RFBA 3K6OA 4EVOA 1PTOB 4C3JB 3NXWA 1V1PB 2Z1CA 5C0XI 2A73B 3A55A 1O7LA 2KQ3A 1BUVT 3OOCA 3QWNA 5DNFA 3F2UA 3HKZB 1I6VC 1DOLA 1EY4A 4ZQ3A 2F0EA 3HEJA 1CQFA 4EQPA 2FINB 1XTCD 4DAPA 1ENCA 1F9PA 4OO1I 5FLXE 3MXNA 2GA4B 2IT1A 2EYHA 3V2TA 3QG1A 1C8CA 1OXSC 1PLFA 1ML0D 2B2VC 2BDNA 1VF7A 1Q90A 2HDMA 1EY5A 1WVLA 2JEAI 3CU7A 2NN6G 1VF5C 1TKWB 3MC0B 3MXPA 3HOVB 4BBRB 4H44C 5JPNC 5EKLA 4I7ZC 2R93B 4KY6A 1DOMA 5KEEA 4K2LA 3CRKC 3BS1A 3NWTA 3H6MA 3M7NA 2D9UA 3S16B 1SNQA 4EQOA 5ELEA 2L1BA 3DHQA 1Q12A 3RZOB 4FXKC 2EZVA 1EOTA 2OF1A 2Q8RE 3VYUA 2JYOA 2NVXB 4BY7B 5IGGA 1I4RA 3J7AF 3PIP3 1CA6A 4XXEA 3FKIB 1H9JA 1PFNA 2WV6D 1DYQA 5C0XG 4K8IA 1WTXA 1TQOA 3TDQA 1VDZA 2SDFA 2D2CC 4DAYA 2NWGA 4V190 1ET9A 1SMYD 5JVG3 4RGMA 2F03A 2F0PA 3FPUB 2YU9B 4RH6A 1JWSD 3DEOA 5CYUA 3PIO3 2F0GA 2M00A 3AB9A 2EXZA 3NHHA 5FO7B 3H09A 1FNWA 3T51B 1JICA 1K83B 1WTWA 3K7AB 1EY7A 3K58A 3U9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C5M A;  4EQN A;  2PW5 A;  3SK5 A;  2F0F A;  2F0T A;  4OL7 A;  2F0U A;  2WAC A;  5I6W A;  5KEE A;  1II3 A;  3DMU A;  3SK8 A;  4PMC A;  3NP8 A;  5E1F A;  4ZUI A;  3OWF A;  5JAV A;  1STB A;  5CR3 A;  4I65 A;  4ME5 A;  1SNM A;  3SHL A;  2F0Q A;  2F3W A;  5IOC A;  5C5L A;  1KAA A;  5I9P A;  5I6Y A;  1AEX A;  1STH A;  3LX0 A;  3MXP A;  5KGU A;  3EVQ A;  1SYC A;  2RDF A;  3NQT A;  3TME A;  3C1E A;  5C3W A;  4DFA A;  5IIF A;  4NMZ A;  5HUR A;  5EKL A;  2F0N A;  4IAL A;  5C4H A;  2EY6 A;  2PQE A;  4KY6 A;  3QOJ A;  2NUC A;  3MHB A;  3D4W A;  4NP5 A;  2O4X A;  3BDC A;  1KDA A;  2OEO A;  1ENA A;  3EJI A;  1STY A;  3P1H A;  4K2L A;  1SYE A;  1A2T A;  4NDX A;  4KJO A;  1EY0 A;  1TT2 A;  3H6M A;  2EYJ A;  1SNP A;  1SND A;  5EGT A;  1EZ6 A;  4RKB A;  4G57 A;  3T13 A;  1EYC A;  3BDL A;  5J39 A;  1SNQ A;  3C1F A;  1JOK A;  1A3U A;  4H7B A;  4EQO A;  2ENB A;  2RKS A;  4J6H A;  3TP8 A;  1JOO A;  2PW7 A;  2EYL A;  3DHQ A;  3PMF A;  1JOQ A;  2RBM A;  5CV8 A;  1SYF A;  5DEH A;  5M9O A;  1EY9 A;  1A3T A;  4S3S A;  4EVO A;  2OF1 A;  2PZW A;  4KHV A;  1SNO A;  4ZUJ A;  3NXW A;  3OSO A;  3TP5 A;  3QB3 A;  4MIU A;  4HMI A;  2F0I A;  4QMG A;  5J1Z A;  2F0M A;  4KY7 A;  2F0K A;  2EYF A;  4N9P A;  4B9W A;  2EY1 A;  1F2M A;  2EYP A;  2F0H A;  4PMB A;  4RKL A;  3T16 A;  5IGG A;  5KRU A;  5CC4 A;  5J22 A;  3P75 A;  3SR1 A;  1IHZ A;  2KQ3 A;  3U9O A;  1A3V A;  3S9W A;  2F0L A;  2F3V A;  5IGF A;  2EY2 A;  3MZ5 A;  3NK9 A;  5C4Z A;  2EYO A;  1EYD A;  5I9O A;  5CGK A;  1STA A;  3D6C A;  5JOB A;  5EKK A;  3D8G A;  5IOD A;  1EY4 A;  1F2Z A;  1NSN S;  2F0E A;  2LKV A;  2OXP A;  4K8I A;  4ZQ3 A;  1STG A;  5IGC A;  3OMG A;  2PZU A;  1EZ8 A;  4DF7 A;  1TQO A;  4E6I A;  1SYD A;  2F0J A;  4WRD A;  3HEJ A;  2EYM A;  2PYK A;  2QDB A;  5HGT A;  4N9T A;  5CV7 A;  5C6A A;  4EQP A;  4KTA A;  4WOR A;  1SYB A;  2F0W A;  4QB4 A;  5KYL A;  1KAB A;  1KDC A;  3MEH A;  2F0S A;  2F0D A;  4ODG A;  4F8M A;  1EY6 A;  4K6D A;  1ENC A;  2F0V A;  3HZX A;  3R3O A;  5CV6 A;  5IGB A;  3SK4 A;  5F2D A;  1SYG A;  1A2U A;  4K8J A;  4R8N A;  4ID6 A;  3SXH A;  4DU9 A;  5CV4 A;  3VA5 A;  1KDB A;  5NUC A;  5C3X A;  4LAA A;  3ERO A;  2F0P A;  2F0O A;  5CV9 A;  3D4D A;  4HMJ A;  4J1M A;  2EYH A;  3SK6 A;  4TRD A;  3V2T A;  2SOB A;  1TR5 A;  2PZT A;  3MVV A;  2SNS A;  4K5W A;  4HTH A;  1SNC A;  2EY5 A;  4QF4 A;  5CV5 A;  1STN A;  2HQE A;  3OMC A;  5DAU A;  5KIX A;  2F0G A;  5ISR A;  4F7X A;  2M00 A;  4KD3 A;  1RKN A;  2EXZ A;  3TP7 A;  4B9X A;  5KYI A;  3NHH A;  1F2Y A;  3ITP A;  4K2K A;  4PNY A;  5K5P A;  3NUC A;  3QOL A;  4IUN A;  3E5S A;  4KY5 A;  2SNM A;  4KJN A;  1U9R A;  4IZ8 A;  4K14 A;  4KV6 A;  4DGZ A;  4KD4 A;  5E3F A;  5IGD A;  1JOR A;  1NUC A;  4K5V A;  5IGE A;  1EY8 A;  1EY7 A;  4YIJ A;  4K5X A;  4NKL A;  1EYA A;  1EY5 A;  3RUZ A;  3ERQ A;  3TP6 A;  1EQV A;  2KHS A; 
#chains in the Genus database with same CATH topology
 1TU2 B;  4EQN A;  2L11 A;  1V1Q A;  1T5E A;  2IX1 A;  2G9D A;  5GAE C;  1JMC A;  5FK9 C;  1EQQ A;  3M3Y H;  4DV5 Q;  3KFU A;  1I50 B;  1B3A A;  4DV7 Q;  2QIL A;  4ZRZ A;  1J6Q A;  1OXU A;  3E9I A;  3MWY W;  3I55 A;  3F2C A;  3GTK B;  2L12 A;  1B8A A;  2PQE A;  4JVZ A;  3A5Z B;  1JWM D;  1LAC A;  1ENA A;  1NAP A;  5I4D A;  1P8L A;  2E2I B;  1RL2 A;  1YHQ A;  4Q0F A;  4B08 A;  3K5N A;  2R3Z A;  4RKB A;  5GQO A;  3ERS X;  4J6H A;  3GTQ B;  2PW7 A;  4LFA Q;  3F2B A;  1HTP A;  4AYB E;  3CF5 A;  3VYS A;  5M5W H;  4JI1 Q;  3I4M B;  2ICE C;  1QZG A;  3OSO A;  1R9T B;  4QMG A;  2D0P A;  1HNX Q;  3C46 A;  4B3T Q;  3ND9 A;  3A5U A;  1ESR A;  1IL2 A;  2YV5 A;  1WYD A;  1GVP A;  4KKS A;  2QF7 A;  2L4N A;  3L2P A;  2N8N A;  3PQI A;  2MJ8 A;  1NSN S;  3A54 A;  1LAB A;  4R9W A;  1KRT A;  1B3Q A;  3PO2 G;  3I56 A;  2DNE A;  4N9T A;  2CWP A;  2NZ1 D;  3I90 A;  3OIP A;  3W2D A;  1B4O A;  4CDD C;  1HNZ Q;  4PZ8 A;  1JCK B;  3HOZ G;  4IFD J;  4DAY B;  3K0X A;  3IKJ A;  4C2M H;  2F0O A;  1Q86 C;  2D62 A;  2A68 D;  2ZXR A;  5ELD A;  3SK6 A;  1B50 A;  1IKM A;  5HGQ A;  5GAG C;  3CCU A;  1O80 A;  3BJU A;  4B9X A;  1N36 L;  1GHJ A;  1PRT B;  1MHW C;  2IJ0 A;  5ELN A;  2A19 A;  1PXU A;  4IUN A;  1WTO A;  2VQE L;  2JA7 H;  3BVZ A;  3K81 C;  4IPG A;  4O1N A;  4YWL A;  1XMQ L;  4K14 A;  1CT1 D;  2NN6 H;  1H9M A;  3TSS A;  2JA6 G;  4UHV A;  3MA2 B;  2NVY H;  1N36 Q;  1MJE A;  2X69 A;  3NTH A;  4GLA C;  1TWH H;  2VQE Q;  1DJR D;  4XQQ A;  2V4D A;  1Q1B A;  4OL7 A;  1UWV A;  2XRS D;  1XMQ Q;  1P16 A;  4P75 A;  3HKZ E;  4PMC A;  5KND A;  1JJ2 A;  4ME5 A;  1SNM A;  5IOC A;  2VW9 A;  1RD9 D;  2I07 B;  1I4P A;  5A2Q E;  3I91 A;  1YVC A;  1LT3 D;  2B2U A;  3N6R A;  3EFX D;  2I0Q A;  3PCO B;  3Q24 A;  2C5C A;  2LXK A;  1BF4 A;  5CV7 A;  3CME A;  4B3M L;  2K5Q A;  1STY A;  2RDH A;  1MSH A;  4A3C H;  5C4J B;  4DR1 Q;  1HUN A;  1G29 1;  2JA8 B;  5JJK A;  2QW7 A;  5EJW A;  3GTM H;  3WDN A;  3UE1 A;  3O13 A;  4QIW E;  2ES2 A;  2AQ3 B;  3CHB D;  4DK3 C;  4F87 A;  3I72 A;  2IHF A;  2RSO A;  4YHH Q;  3GTG H;  4A3D B;  1NMG A;  2ZT9 C;  3AEV A;  1LT4 D;  1Y1V B;  1N33 L;  1J8I A;  2F0K A;  1PRT C;  3R2I A;  5CC4 A;  5J22 A;  1EWI A;  1VQJ A;  2R7Z G;  3M4O B;  2L55 A;  4H13 C;  4KN4 C;  2EYO A;  2JA5 H;  1N33 Q;  4A75 A;  1QG7 A;  1BXT A;  2AHO B;  1L1O B;  3OW2 A;  5IY0 A;  1QUQ B;  3CD6 A;  1UEB A;  2HCI A;  1PTO H;  1EY6 A;  2VL6 A;  3NBH A;  2Z6K A;  3CCL A;  2M2L A;  4C3J H;  2K50 A;  4OO1 H;  3OW7 A;  4DN4 M;  1A2U A;  4FF3 A;  2J7Z A;  1U0L A;  3H15 A;  2UXC L;  2WFW A;  1EFW A;  1UE5 A;  4MHE A;  4L8J A;  1KNA A;  2A6H C;  3ND8 A;  3A56 A;  3AMU A;  4F7X A;  2VUM B;  1MKH A;  3HP3 A;  1TS5 A;  4HR7 B;  3UDF A;  4HCS A;  2UUB L;  4A3E B;  5E3F A;  5EBD A;  1Z6H A;  1EY8 A;  1IYV A;  3E6Z X;  3PUX A;  4YIJ A;  5G3L F;  1EYA A;  3RUZ A;  2B2W A;  4GKJ L;  1JR0 D;  3TP6 A;  2KJX A;  2VQF L;  5M3M B;  3D6W A;  2R7F A;  3NTK A;  5C3E G;  2ZJP A;  4LNQ A;  4HIM A;  2R92 B;  2K01 A;  5FLX c;  4GKJ Q;  2QDL A;  1QCB D;  1U4P A;  3LX0 A;  1GUG A;  1E2Z A;  1CKN B;  2AQ1 B;  2NVT B;  4G7O C;  2K7V A;  4LF4 L;  1GUW A;  1EQR A;  1GKH A;  3TRE A;  2KCT A;  4CKE A;  2I46 A;  4MNO A;  1L1O C;  1IBK Q;  1ZEQ X;  5ELC A;  4CKC A;  1TWG B;  1YZ6 A;  1QVF A;  2Q8I B;  4BS9 A;  5FLM G;  4I7A A;  1AW7 A;  2WAQ B;  4HSV A;  4LF4 Q;  3C1F A;  1A3U A;  1YNJ D;  1H9S A;  2H1E A;  3TP8 A;  1YNN D;  3DWQ A;  3H3V C;  2RHQ B;  1FGU A;  5M5W B;  4HN7 A;  1EY9 A;  4XQN A;  1AN8 A;  5FLX L;  1TWF H;  2CKZ B;  3HOV H;  3VA7 A;  2MGS A;  2QKI C;  3BYT B;  4BBR H;  3FVQ A;  3FDT A;  2MUY A;  3PUY A;  5C44 G;  5KRU A;  1NNX A;  5IYC G;  3Q0A A;  2E2D C;  3N52 A;  1O7I A;  4IUV A;  4KHZ A;  2R93 H;  3PO2 H;  1BKB A;  4R4O A;  3IRB A;  2WB1 B;  3H0G G;  1Q8I A;  2LXJ A;  4RA8 A;  1PZK D;  3UI2 A;  4EX5 A;  4RWS C;  1VS0 A;  4BA2 I;  1OO9 B;  4TQU S;  4DF7 A;  4ZYS A;  2PYK A;  3S17 H;  2KEN A;  2FXQ A;  1ILQ A;  3RZO H;  2B29 A;  2F0W A;  2ALY B;  1DM0 B;  1LO5 D;  2B2Y C;  2Y0S G;  3BVM A;  5M3F B;  4FF2 A;  4KHP Q;  2NVX H;  1PZI D;  4BY7 H;  1X3F A;  2F4I A;  5CV4 A;  3VA5 A;  5NUC A;  3GV3 A;  3HRZ C;  3OTO L;  1VQN A;  3D4D A;  1KXL A;  1STE A;  3MVV A;  1UE1 A;  2PZT A;  4C3H G;  3FKI H;  2IL8 A;  3OMC A;  4RHS A;  5ISR A;  2JA7 B;  2JA6 H;  1Y1W B;  3TP7 A;  1FJG L;  1MJC A;  1C4Q A;  3I2Z A;  4K2K A;  5KNB A;  3T1Y L;  1I94 L;  3FRP B;  3OTO Q;  1PH5 A;  4CDE C;  4KJN A;  3GD7 A;  3LWE A;  3CCM A;  4H02 A;  4JOI A;  1F9R A;  4KKT A;  3VDY A;  2CQA A;  4A3G G;  4KI0 A;  1N34 L;  2QGQ A;  1FJG Q;  1I94 Q;  4KKU A;  1KHI A;  3NEM A;  3V05 A;  2KVM A;  2F0U A;  4JBK A;  1G91 A;  5JJI A;  4LF7 L;  4ME3 A;  4L63 B;  4JG2 A;  1XPR A;  4A3J G;  5CR3 A;  2K5D A;  4JI5 L;  3TEH B;  1PA6 A;  2YU9 H;  1N34 Q;  1CI3 M;  1M4V A;  2ASB A;  1OXV A;  3MEF A;  1O7Y A;  4LF7 Q;  1RCV D;  4IAL A;  3ULP A;  1K83 H;  5K36 G;  1PH1 A;  4A3B G;  3HS0 C;  4JI5 Q;  1X3P A;  3TRZ A;  1YNX A;  4R8I A;  3HOU B;  3K7A H;  3A7A B;  4KJO A;  2K28 A;  5G3L D;  1HZ9 A;  1E2W A;  1VQE A;  2CQO A;  5J39 A;  5IYB G;  5JPM C;  1FR3 A;  5JEA J;  2Z6K C;  5CV8 A;  3K0Y A;  1VQ4 A;  2BE5 D;  5FOB B;  1TXY A;  1I50 H;  2EY1 A;  2F0H A;  2MFI A;  3D0F A;  3GTK H;  2F3V A;  2XTI A;  1RTO A;  4XIG S;  4RGT A;  2B63 G;  1JE5 A;  2E2I H;  4GLX A;  4X3T A;  3NQI A;  2MP1 A;  4FXD A;  4JV5 L;  4DKA C;  1HQR D;  2A6E D;  3GTQ H;  2X6G A;  3HOY G;  1UEA B;  2B8G A;  4IPH A;  4CBV A;  3I4M H;  1IXR A;  4A93 G;  1WJJ A;  5GAD C;  1VQC A;  3SXH A;  4R8N A;  1R9T H;  2E2H H;  2CW0 D;  1WD0 A;  3RN2 A;  1KTK A;  3RN5 A;  1XNR L;  4GNX C;  4DR7 Q;  2RA4 A;  2IY5 B;  4K5W A;  2CHB D;  4FXG C;  1HR0 L;  3S14 B;  4NPS A;  1K0S A;  4QF4 A;  5DAU A;  4POG A;  5CBE E;  1NR4 A;  1ZXT A;  2A69 D;  1E2V A;  1LUZ A;  1BBW A;  4LUO A;  1NE3 A;  5C3E H;  1ONL A;  4CKB A;  4A3F G;  1HR0 Q;  3OPO A;  1N8R C;  3SEB A;  4TVA B;  2JA9 A;  2F1M A;  2LFN A;  2IX0 A;  3RLO A;  1SE2 A;  4JI0 Q;  4QY7 A;  1DOK A;  1NCV A;  4QIW B;  1IW7 C;  1II3 A;  4GN5 A;  1LTS D;  1L0W A;  3SHL A;  1QVC A;  1Z47 A;  4IUP A;  4GLV B;  2ID0 A;  3NTI A;  3J81 E;  2PO4 A;  4IOA A;  5DM6 3;  3NQT A;  3C1E A;  3K5L A;  1GOZ A;  4L6T B;  5HUR A;  4AIM A;  3E9H A;  4DXF A;  2KED A;  3S24 A;  3BZD B;  1GJX A;  1KDA A;  2K32 A;  3GO5 A;  3RLN A;  1PTO C;  1WFQ A;  1VQ7 A;  5EGT A;  4A3M G;  4BBS G;  1YJ9 A;  1CHP D;  2MO1 A;  2AQ2 B;  3IFT A;  2AWN A;  1SE8 A;  1EIF A;  1LTL A;  5ELB A;  4LF5 L;  1TWF B;  5M9O A;  4S3S A;  2XSC A;  1G2S A;  3R8B A;  2NTT A;  2KUM A;  1W6J A;  1CSP A;  3PO2 B;  1GHK A;  4HIK A;  5D65 A;  3KBX A;  2EOT A;  3UDG A;  2A74 C;  2WII B;  2EY2 A;  1BNZ A;  1MGS A;  1EEI D;  4JYA L;  3JAM L;  5C4J H;  4DAM A;  2JA8 H;  3HOZ B;  3D8G A;  4OX9 Q;  1NBW A;  1HTL D;  3OMG A;  3S17 B;  1FGB D;  1SYD A;  1ROD A;  5HGT A;  2TSS A;  5LMU L;  1RF2 D;  1G2T A;  1C7Y A;  2PNH A;  3HZX A;  1HPC A;  2J0T D;  5CV6 A;  1DXM A;  2FJ2 A;  4A3D H;  1Y1V H;  4O2D A;  3PO3 G;  5C3X A;  2A1A A;  4GOP C;  5AJ3 L;  1KD1 C;  1NR2 A;  4HCE A;  3NEL A;  3M4O H;  2RDG A;  3J7A V;  2QEJ C;  2WAQ E;  3FMC A;  5A2Q L;  2JA6 B;  3ZJY C;  1VQP A;  5HY6 A;  1F2Y A;  5K5P A;  1BR9 A;  3GTP B;  5IGD A;  4CJ0 B;  5JJL A;  1RIP A;  2OWO A;  1JJC B;  1W3S A;  4JI4 Q;  2B8F A;  2X6L A;  4R1J A;  4U67 3;  3AYH B;  4JCV E;  5LMN L;  1T9H A;  4LUV A;  4DV1 L;  1KIX A;  1HXY D;  2YTY A;  5C5M A;  3SK5 A;  3MXN B;  5EKI A;  3H3V H;  3DEP A;  1L2F A;  3J80 i;  4N8F A;  4ZUI A;  3MFG A;  3G4S A;  1N9W A;  2JXM B;  2WB1 E;  3HG9 A;  1KAA A;  2DY7 A;  5I9P A;  4ABN A;  2KCN A;  2RCN A;  1FNU A;  5IYB H;  1UUP A;  3BU2 A;  1GUN A;  4A3E H;  3QR8 A;  4JBJ A;  4IJH A;  1SYE A;  3EBE A;  1D1I A;  3WWV A;  1VMC A;  2EYJ A;  1SNP A;  2L5T A;  1KLU D;  4B3R Q;  5M3M H;  1F9Q A;  2K6A A;  2ENB A;  1V8Q A;  1JWU D;  3S1N B;  2R7Z B;  2K5H A;  4BXX H;  4K0K L;  1SYF A;  2R92 H;  3U4Z A;  1B9M A;  2N78 A;  1E0B A;  2KOL A;  5CMD A;  4LFC L;  3WOE A;  2DGY A;  2NVT H;  1TVX A;  2F0M A;  2Q2U A;  1I4Q A;  4B9W A;  2PCF B;  4HED A;  3T16 A;  1U5K A;  3S9W A;  3U58 A;  4K0K Q;  4HID A;  1AFP A;  3HOX G;  5M5Y B;  4LF9 L;  1G51 A;  1TWG H;  3CCR A;  4LFC Q;  5I9O A;  3D6C A;  2NBF A;  4MZ9 A;  4ILW A;  2PZU A;  1SJH D;  4LWC A;  3R2T A;  4DUY L;  5IT9 E;  1LT5 D;  3M4Y A;  2WKC A;  4QB4 A;  4UAI A;  1CM9 A;  4ODG A;  2F0D A;  4K6D A;  2BCO A;  4NXN L;  4JC0 A;  2E2H B;  3SK4 A;  5FO8 B;  1VQH A;  4DUY Q;  2G5D A;  3GTJ B;  5CV9 A;  3TZU A;  2EQS A;  1EIY B;  4FF4 A;  1LT6 D;  5FJ8 G;  2RVL A;  2IW3 A;  1BVS A;  1SDF A;  3PUZ A;  3RMH A;  4A3F H;  3NEN A;  4NXN Q;  2HQE A;  2LY7 A;  1U4M A;  1UNS A;  3M4Q A;  4QUC A;  4M8A A;  1EIH A;  4IUU A;  1I4X A;  5C3E B;  3SDZ A;  1AZP A;  3OHX C;  2YTX A;  1M90 C;  4UP7 A;  4IUQ A;  4TKO B;  2HIV A;  2XWJ B;  3S1R B;  2ZXO A;  5M3F H;  5C4X G;  2KHS A;  3K8A A;  1HH2 P;  4JBW A;  1JT8 A;  2LS0 1;  4UP9 A;  4L5R C;  1AE3 A;  1FD7 D;  2XWB B;  1SAP A;  1AEX A;  3JAM E;  5L37 A;  3EVQ A;  2MHV A;  2L0C A;  1Y1W H;  1EYG A;  2CWA A;  4BBS H;  4IO9 A;  2NVQ B;  4APV A;  3MHB A;  4NP5 A;  3BDC A;  3VR3 A;  1KAW A;  2PPB C;  1M1K C;  2L9H A;  1K0R A;  2CFM A;  1EWH A;  3T13 A;  1JB3 A;  5C44 B;  4EGV A;  1IBL L;  1WTR A;  3STB C;  1B70 B;  1AZQ A;  1BBU A;  3H0G B;  4RCO A;  1VQL A;  1Q1E A;  3GV6 A;  1XX8 A;  1KQS A;  2GVA A;  1F2M A;  3PV0 A;  3OWE B;  2HCC A;  1IBL Q;  1H9K A;  5IP9 G;  3P20 A;  1VQM A;  3BDO A;  2AUJ D;  1IYU A;  3G48 A;  1QZH A;  3HOU H;  2Y0S B;  3I70 A;  1ZYR D;  2XNA C;  1Y14 B;  1R4Q B;  5JEA G;  5IP7 H;  3URY A;  4E6I A;  2ZM6 L;  1RTN A;  1SFO B;  4B3M Q;  2Z9H A;  2ZJQ A;  4C3H B;  1WTQ A;  4P71 A;  1F2L A;  4ZAI A;  2SEB D;  5C0X H;  3I4O A;  1XPU A;  3P7J A;  4K8J A;  1TWA B;  1DCZ A;  3U50 C;  1KDB A;  3DUZ A;  4DNI A;  1CTM A;  3I4N G;  4J1M A;  1SJE D;  3HKS A;  4A3G B;  2SOB A;  2BA0 A;  2OTJ A;  5CV5 A;  2R6G A;  1MIU A;  4A3I G;  1BOS A;  3E5S A;  1JJG A;  1H9R A;  2SNM A;  1A6X A;  2EXD A;  3JC6 6;  2IWH A;  4F88 A;  4A3J B;  1T5X D;  4HJ8 A;  4NW2 A;  1A62 A;  3KOJ A;  3Q22 A;  4ALP A;  2E8G A;  2TMP A;  4LUZ A;  3J81 j;  4DXG A;  1JE4 A;  5I6W A;  4A4I A;  4A3B B;  1PFS A;  5LL6 X;  1SR3 A;  2Z6B A;  4C1N I;  2EDG A;  2E76 C;  3S14 H;  4RHR A;  3T1H L;  1HZA A;  1H95 A;  1YEZ A;  2HDL A;  3D3R A;  1WI5 A;  2UXC Q;  1RJT A;  4A3K G;  4NMZ A;  1SMY C;  3RD4 A;  5JVH 3;  3D4W A;  2O4X A;  2JK8 A;  2MPM A;  1E1T A;  1S5F D;  5ELO A;  1A2T A;  2Q8T A;  3BVG A;  1Y69 U;  1EZ6 A;  4IN3 A;  4FVM A;  2UUB Q;  4RMF A;  3Q6S A;  2E2J B;  4X3U A;  2XVS A;  1Q3L A;  2M9V A;  3V96 A;  2VQF Q;  2B63 B;  1S4Z A;  2AKW B;  4IPC A;  1PV4 A;  2K4K A;  4MIU A;  1PYW D;  1PH4 A;  4N9P A;  2EYP A;  4DNT B;  3VYR A;  2H5X A;  2K05 A;  3SR1 A;  3HOY B;  1A3V A;  2E74 C;  3NK9 A;  5C4Z A;  3J81 c;  4DV4 L;  1CZG A;  3MTS A;  4A93 B;  3PUW A;  4GS3 A;  4OWT B;  2I5H A;  4CDC C;  3DLL A;  2OCE A;  2QDB A;  5C6A A;  4HJ9 A;  4KTA A;  4DV4 Q;  3A7L A;  1RHP A;  3MEH A;  4L5T A;  3SGI A;  4UDU C;  2EJF C;  5FJ8 H;  2UU9 L;  4JBM A;  1TWC B;  2HHH L;  4DU9 A;  1IL8 A;  3TS2 A;  1NMF A;  4DR6 L;  1EUJ A;  1QNK A;  1WTP A;  4A3F B;  1OXX K;  4ZLT F;  5GRO A;  3J81 L;  2UU9 Q;  1SNC A;  3G7L A;  1X9N A;  1K3B C;  1RKN A;  1B9N A;  3HOZ H;  1B2T A;  3NUC A;  1C48 A;  2IHE A;  3CC7 A;  2NTS A;  4KY5 A;  2UUA L;  4X65 L;  1YIJ A;  1SXT A;  4HSP A;  1F9S A;  3S1Q H;  5IE8 A;  3CKI B;  4WFN 3;  3NBH B;  4TSS A;  2XRQ D;  2B2V A;  3B6Y A;  2PQA A;  1K8M A;  5I2X A;  4RCN A;  2UUA Q;  4X65 Q;  1PZJ D;  3S2H B;  5JAV A;  2B2U C;  4DAV A;  2F0Q A;  2F3W A;  4JI3 L;  1V1P A;  2FHT A;  4A3M B;  4BBS B;  3ICE A;  4O42 A;  4IFD I;  5KNC A;  4ZKB B;  1EU4 A;  4RAU C;  3GTP H;  2K52 A;  4GKK L;  2A68 C;  2N55 A;  4C3I G;  2O5J C;  1D2B A;  3T1Y Q;  1CSQ A;  1SND A;  2F52 A;  4G57 A;  4R4T A;  4DR2 L;  2RKS A;  1IZ6 A;  3DM1 A;  3QJY A;  3NWS A;  2BOS A;  2KBN A;  1SE3 A;  3CQZ H;  3TN2 A;  1AP0 A;  1G6Z A;  2E5L L;  4GN4 B;  2HT1 A;  1SNO A;  2JP1 A;  3TP5 A;  1S5C D;  4YWK A;  3KYH C;  2DUD A;  5J1Z A;  1PH2 A;  5IYD G;  4RGO S;  1FYC A;  4PMW A;  2I5M X;  4Z9C B;  2VY3 A;  5JJZ A;  1Q81 C;  5D14 A;  1K28 A;  4G7Z C;  1LYL A;  3KUP A;  1TY0 A;  1O7Z A;  2N88 A;  2EIF A;  3KJP A;  1J9O A;  1VQ5 A;  1RDP D;  3PO3 B;  4P74 A;  2C35 B;  4JPB W;  3S1N H;  3FPP A;  1H9S B;  4DK1 A;  2R7Z H;  2VB2 X;  3E0E A;  4XT1 B;  1KAB A;  1CK1 A;  4WJ3 M;  4P72 A;  5GAH C;  5F2D A;  4CDF C;  1X6O A;  2EJG C;  4IPD A;  1HA6 A;  1BBX C;  2I5L X;  3KBG A;  3HOW G;  3FHW A;  1JQY D;  1U4L A;  1S3O A;  1HQM C;  1S5E D;  5CBA E;  5KIX A;  5M5Y H;  2ICI A;  5IWA L;  3S2D B;  1KLG D;  2WIN B;  2XN9 C;  3QOL A;  1BO0 A;  1HNW L;  2B2W C;  1PH3 A;  4FP5 D;  2PI2 A;  3OYY A;  1Q7Y C;  2UUC L;  4YY3 L;  4DR4 L;  1GUO A;  3A74 A;  3D4R A;  1NUC A;  5IGE A;  2E75 C;  4NKL A;  1TII D;  4JV5 Q;  1K8G A;  2JQO A;  3G6E A;  4K6L A;  1HNW Q;  1X54 A;  2F0T A;  3L3O C;  5IT9 c;  2DNC A;  1Y8P B;  4YCV A;  4A3K H;  1XNQ L;  3GTJ H;  3F2D A;  2D5D A;  5E1F A;  2Y0S E;  3CXC A;  4P73 A;  1QE6 A;  1SE4 A;  2NZO A;  2KEE A;  4PV1 C;  1A8V A;  5KGU A;  2RDF A;  1XNR Q;  4LMQ D;  1EL0 A;  1PH8 A;  1BCP F;  2EY6 A;  2FMC A;  3K5M A;  2GVB A;  3QOJ A;  1YJW A;  2G9H D;  3RNU A;  3MXG A;  3ER0 A;  1TS4 A;  4IFD G;  1CA5 A;  4RGN A;  3S1R H;  1PH6 A;  1UE6 A;  4H7B A;  3CRL C;  3NBI A;  1LLR D;  3PUV A;  5IT9 L;  1F77 A;  1VMP A;  1QNU A;  4ZCK A;  1O78 A;  2EYL A;  3PMF A;  3HOX B;  4OEM B;  3I8Z A;  1PDQ A;  2Z8L A;  2AUK A;  3BZC A;  5FLM H;  3J80 E;  3UDX A;  1ENF A;  2F0I A;  5D3I B;  1JC7 A;  5EBC A;  4OIK A;  1OTC A;  3FP9 A;  1GO3 E;  4PMB A;  3KLS X;  3P75 A;  3TBI B;  3RR5 A;  2F0L A;  2NVQ H;  2BH2 A;  2VNU D;  4QUF A;  3JAM c;  1Z9F A;  5CGK A;  1CFM A;  1U4R A;  2OXP A;  3J7Z C;  2Z0S A;  5C44 H;  3CCQ A;  3GP7 A;  4C1N K;  5IYC H;  1YJN A;  2ZTC A;  5AFW A;  4IQZ A;  4WOR A;  2F0V A;  3AQQ A;  3G6J B;  3H0G H;  3I73 A;  4PG3 A;  2N3S A;  1MSG A;  4LF5 Q;  1YNJ C;  3WOF A;  2CCZ A;  1IBM L;  2RF4 A;  4A76 A;  1YNN C;  3CPF A;  1NY4 A;  4OGQ C;  2HUG A;  4JOI C;  3HGB A;  5C4X B;  3EN2 A;  4KD3 A;  4X64 L;  3K57 A;  4GN3 B;  1N32 L;  4PNY A;  1D1K A;  3T56 B;  1IBM Q;  1SFO H;  3D31 A;  3IFD A;  4L5S A;  4JYA Q;  3S1Q B;  1M8A A;  4BY1 G;  1XXG A;  2F4V L;  4C3H H;  4PZ7 A;  2J4X A;  4AYB G;  4KMU C;  4X64 Q;  3LWU A;  1AE2 A;  5BR8 L;  3TS0 A;  1PRT D;  4DV2 L;  1K9M C;  1TWA H;  3F1Z A;  5LMU Q;  1D6E C;  4KK7 A;  3OWF A;  2F4V Q;  4A3G H;  2NYZ D;  3UDI A;  4A3C G;  1EIG A;  3ONA B;  3K7U C;  4DV2 Q;  1ICF B;  5AJ3 Q;  4DK6 C;  4JI6 L;  1CKM A;  4J8Q A;  3J7A 5;  2VZA A;  3C3L A;  4A3J H;  3EJI A;  2OEO A;  1LTR D;  2WP8 J;  1E1O A;  4QCL A;  2B2T A;  3K59 A;  1EYC A;  1CHQ D;  2D0O A;  2QEX A;  5T1I A;  3CQZ B;  5K36 H;  4A3B H;  2A6H D;  1S40 A;  5LMN Q;  4DV1 Q;  1A3T A;  4LJZ C;  2V1C C;  4X3S A;  2PZW A;  5LHY 1;  2JA5 G;  3X3M A;  4HMI A;  2K5W A;  2RCF A;  1D8L A;  5LL6 S;  4V0B A;  1SRO A;  1WD1 A;  2MNA A;  5EPK A;  2HQL A;  4DPG A;  4X62 L;  1BCP D;  1HZC A;  3ZYY X;  1HUM A;  3J81 i;  4DUZ L;  4C3J G;  1STA A;  4OO1 G;  5IOD A;  4QL5 A;  5KYL A;  3CCV A;  2LKV A;  1BQQ T;  3OIQ A;  3CC4 A;  3VYT A;  5BN3 A;  1EZ8 A;  4X62 Q;  3I4N B;  2F0J A;  2E2J H;  1TS3 A;  1R4P B;  4DUZ Q;  3AU7 A;  3HKZ G;  3GTL B;  3NPP A;  2VB3 X;  2B63 H;  4A3I B;  2EVB A;  5M5X B;  2KA7 A;  4LAA A;  4DV7 L;  3ERO A;  3HOY H;  4QGU A;  2CVR A;  3DWA A;  2SNS A;  1B53 A;  2EY5 A;  1ZKO A;  2NB0 A;  1TS2 A;  4A93 H;  2BE5 C;  5KYI A;  3Q23 A;  1HFG A;  2LMC B;  1B44 D;  1U9R A;  4KV6 A;  4DGZ A;  1WCM B;  4LF9 Q;  3RLF A;  1D7Q A;  4GZY C;  4XDX A;  4LFA L;  1DON A;  4K5X A;  2JN4 A;  3PF5 A;  3ERQ A;  5ELF A;  1LTA D;  2H4O A;  4OXP A;  4JI1 L;  1TWC H;  4LW1 A;  3F8T A;  3KJO A;  1V43 A;  4A3K B;  4BA1 I;  1CQV A;  3BG3 A;  1HNX L;  1D5M C;  2BA1 A;  4B3T L;  3SK8 A;  2R61 A;  2A6E C;  1LTI D;  2EPB A;  1VQB A;  1VQF A;  1K8O A;  5EQ0 A;  5C5L A;  1YHB A;  5I6Y A;  3A8J E;  1STH A;  5E4X A;  1WTV A;  5FO9 B;  4IFD H;  4IUT A;  1D5Z C;  2CW0 C;  3U9S A;  3TZD A;  4DK0 A;  4NDX A;  1QWY A;  3E0J A;  3W5O A;  4XTC S;  3GTO B;  1BDO A;  3HOV G;  4X3K A;  4DA2 A;  4BBR G;  4QQB X;  2IX3 A;  4CJ1 B;  1HNZ L;  1L1O A;  1GM5 A;  1QIL A;  3HFZ B;  2A69 C;  1MD2 D;  1JOO A;  3A0J A;  1QUQ A;  4ZKC B;  2Z4I A;  2R93 G;  3RZD H;  1JOQ A;  4UP8 A;  1I6H B;  2JEB I;  2PNR C;  3A8K E;  3S2H H;  4KHV A;  4ZUJ A;  1LTB D;  3TQY A;  4A3M H;  1LV9 A;  4CJ2 C;  2JJQ A;  4PQX A;  1DZ1 A;  4FO2 A;  3MXU A;  4G7H C;  1IHZ A;  1PTO F;  1YBY A;  5COR A;  1LM0 A;  3DM3 A;  4H0L C;  4FF1 A;  1EYD A;  1Y8N B;  1A63 A;  5JOB A;  1XWE A;  4BY7 G;  2DY8 A;  1FVI A;  3K80 C;  2O5I C;  1B1Z A;  1V9P A;  1D5X C;  3W1G A;  2DN8 A;  1HA5 A;  1GUT A;  2IPK D;  4MN3 A;  1KDC A;  2K04 A;  3FKI G;  1V1O A;  4MTN A;  3VR4 A;  1W6K A;  1CKO A;  3M4P A;  5E4W C;  4Y7N B;  1KRS A;  2B2Y A;  1IKL A;  1EEF D;  2NZH A;  4HMJ A;  3LGJ A;  4IOC A;  4BY1 H;  4HTH A;  1CKN A;  2FFK B;  4CGY B;  3S15 B;  4POF A;  3PSI A;  1C9O A;  1SEB D;  4DR1 L;  3PO3 H;  4KLK A;  1ICW A;  4IZ8 A;  1FNV A;  2B2T C;  1JOR A;  1YIT A;  2KCC A;  3L7Z C;  2JSO A;  2Q2I A;  1PFB A;  4L5Q A;  2ZM6 Q;  2BH8 A;  3IAY A;  2PW5 A;  3PGZ A;  2K33 A;  3A8I E;  4YHH L;  2JE6 I;  4XT3 B;  2WAC A;  1XTD A;  2A5H A;  3BZK A;  2RSN A;  1E22 A;  4C3I B;  1BCP B;  2UXB L;  3W3A A;  3S2D H;  1EU3 A;  1X65 A;  3H94 A;  1TY2 A;  3MAQ A;  1K73 C;  5IIF A;  2AMC B;  4WJW A;  3VR2 A;  5C4H A;  1SMX A;  2CH4 W;  1VQD A;  2CH4 A;  3KLS A;  2UXB Q;  1I3Q B;  3KLW A;  1S5B D;  1Q8K A;  5C0X J;  1NJI C;  3BDL A;  2K14 A;  4R4C A;  1PH7 A;  4X6A H;  2YYZ A;  1WCM G;  3Q8D A;  2RBM A;  2B3G A;  4Q5V A;  3IL8 A;  3S1M B;  1I4G A;  2Z4H A;  5BN4 A;  2XGT A;  2B39 A;  1SSO A;  5D3D A;  4C56 C;  1QJO A;  2ZTD A;  4RKL A;  2PI2 E;  2BDO A;  2RQX A;  3T1H Q;  3VR6 A;  3SE0 A;  3JAM i;  4JW0 A;  3MZ5 A;  3H91 A;  4FYD A;  1HR0 W;  3I4M G;  3L9A X;  3DWP A;  1F2Z A;  4KN7 C;  5IGC A;  1KNE A;  1IW7 D;  5EPL A;  1ESF A;  2KEC A;  1EFI D;  2LSS A;  3J7Y W;  2EYM A;  3HOW B;  1S5D D;  4MTK A;  2YTV A;  1MBY A;  4JK1 C;  4DNR B;  4OWX B;  3HOX H;  2EJM A;  1SYB A;  4F8M A;  2PMZ B;  3R93 A;  3BYY B;  1BCP C;  5COY A;  1XMO L;  4ID6 A;  1VQO A;  1MI2 A;  1I5F A;  2MO0 A;  3H3V I;  2N49 A;  4HAE A;  3M3Y B;  1PTO D;  3J80 c;  4TRD A;  3M85 A;  1SN8 A;  1G8Z D;  1IBK L;  2MQH A;  1XMO Q;  2QCP X;  3NE5 B;  2KHJ A;  3VR5 A;  4OHJ A;  1QB5 D;  3W1B A;  1HJP A;  3LNN A;  3ITP A;  4GNX A;  1PFM A;  2L15 A;  5I2Y A;  3EIV A;  5A35 A;  5FKA C;  4KD4 A;  3DXJ C;  4K5V A;  3E3X A;  1VQG A;  1UAP A;  3CP0 A;  1EQV A;  3GQB A;  1ET6 A;  3NP8 A;  4OWW B;  2EE1 A;  4U68 A;  4OON A;  3T53 B;  3J80 L;  4JI7 L;  1FL0 A;  1DD2 A;  5T1G A;  2HHH Q;  4HJ5 A;  4BWG B;  1L0Y B;  3G71 A;  2WKD A;  5C4X H;  2OT2 A;  3KF8 A;  4P2C B;  4DV3 L;  3TME A;  5C3W A;  4DR6 Q;  1L0X B;  4DFA A;  1S72 A;  3FEW X;  5H1S E;  4QJF A;  2AWO A;  1CZW A;  4B3S L;  4JI7 Q;  2A8V A;  3EQL C;  2NUC A;  1LTT D;  4A3L G;  2K1B A;  1GD7 A;  1EY0 A;  1TT2 A;  1VCI A;  3QO2 A;  4DV3 Q;  1HFN A;  4KHP L;  1GUS A;  3S16 H;  3RZD B;  3ULL A;  4B3S Q;  4ULL A;  4YCW A;  1VQ8 A;  1VQA A;  2ZXP A;  2FMM A;  1B7Y B;  1X3G A;  3AFQ A;  3I7F A;  1AH9 A;  1PYB A;  3QB3 A;  2JA8 G;  1KL9 A;  3NSW A;  2GN5 A;  2Q2T A;  4KY7 A;  2EYF A;  2UXD L;  4C2M B;  3CW2 C;  3CC2 A;  1E3P A;  4JI3 Q;  1A0I A;  2VS1 A;  3EA6 A;  1LTG D;  1EWC A;  2K75 A;  5EKK A;  3C2P A;  4A3D G;  1JB7 A;  3MFY A;  1Y1V G;  4N8X 1;  1STG A;  2UXD Q;  3CPW A;  4XYO A;  4WRD A;  5IP9 H;  4GKK Q;  2C9O A;  3M7G A;  2F0S A;  1QOH A;  3QIA A;  2NVY B;  1EQT A;  5LMN W;  4X66 L;  4DR2 Q;  3R3O A;  5IGB A;  1TWH B;  1SYG A;  1Y8O B;  4JI2 L;  5JEA H;  1ILP A;  5TSS A;  1HHV A;  1X32 A;  2DJF C;  2E5L Q;  4BY1 B;  2XIW A;  4XYQ A;  4CHT B;  5BN5 A;  1TR5 A;  4AYB B;  1HCZ A;  1PHJ A;  1ASY A;  3SVM A;  1PMR A;  4X66 Q;  1STN A;  1A15 A;  4GOP A;  3GDE A;  2ZJR A;  4JI2 Q;  2O2L D;  4GNX B;  2VXW A;  3I4N H;  5EAY A;  4DR5 L;  1UE7 A;  2HD3 A;  4R4Q A;  3T4A C;  4LF8 L;  1PRT F;  2NN6 I;  3CCJ A;  3GTL H;  3K5O A;  1Z7T A;  3GTM B;  2VUM G;  2Q2H A;  3X3N A;  1ZYR C;  4A3I H;  5M5X H;  2OQK A;  2F0F A;  1I4H A;  1XYI A;  4ZK9 B;  1GXD C;  3DMU A;  1EOV A;  4DR5 Q;  5DM7 3;  4A3E G;  4LF8 Q;  1HRJ A;  1STB A;  4I65 A;  4LK1 C;  2RHS B;  3GTG B;  1SYC A;  3PIP A;  4LF6 L;  3AFP A;  5M3M G;  1NTG A;  1W2B A;  3I4L A;  2F0N A;  3KF8 B;  4BXX G;  4HIO A;  1WCM H;  5EPJ A;  5IGF A;  3UE0 A;  5IWA Q;  2R92 G;  4Y52 H;  1VQ9 A;  3P1H A;  2JA5 B;  1X3Q A;  2K03 A;  3KLR A;  3KK7 A;  4G4K A;  4LF6 Q;  4FNF A;  1HZB A;  2UUC Q;  1JOK A;  1Q46 A;  4YY3 Q;  4DR4 Q;  1OXT A;  4M1U B;  4OIJ A;  2PQA B;  4XQJ A;  1J5E L;  1SBB B;  4UY8 C;  4NB3 A;  3I3C A;  4J15 A;  4IUR A;  1DGS A;  5DEH A;  4RFB A;  3K6O A;  4EVO A;  1PTO B;  4DR7 L;  1WTH A;  4YCU A;  4C3J B;  3NXW A;  1V1P B;  2Z1C A;  2WAQ G;  1ASZ A;  1CUK A;  5C0X I;  2A73 B;  3A55 A;  1O7L A;  1QVG A;  1XNQ Q;  1X56 A;  3PIO A;  1J5E Q;  5J3B A;  2KQ3 A;  1BUV T;  3OOC A;  3QWN A;  5DNF A;  3F2U A;  3HKZ B;  1I6V C;  1DOL A;  2KHI A;  3GTO H;  2KCM A;  1EY4 A;  4ZQ3 A;  2F0E A;  2F3I A;  4JI0 L;  1VQI A;  3HEJ A;  1CQF A;  4RG1 A;  4EQP A;  3KDF A;  1G6P A;  1VQ6 A;  1I6H H;  2FIN B;  1XTC D;  4DAP A;  1ENC A;  1F9P A;  2WB1 G;  4OO1 I;  5FLX E;  3MXN A;  2GA4 B;  2HIX A;  3L0O A;  2ATW A;  2IT1 A;  2EYH A;  3V2T A;  4DR3 L;  2P5Z X;  3QG1 A;  1K8A C;  1C8C A;  3U4V A;  5M3F G;  1OXS C;  3KF6 A;  1PLF A;  4GOP B;  1ML0 D;  2B2V C;  3STB D;  4DR3 Q;  2QA4 A;  2BDN A;  3CMA A;  1VF7 A;  2R7D A;  3PF4 A;  1Q90 A;  2HDM A;  4EQ5 A;  4DV0 L;  1EY5 A;  1WVL A;  2JEA I;  2JA7 G;  1Y1W G;  3CU7 A;  3CCE A;  1C0A A;  4Y7N H;  1PH9 A;  1PVO A;  2NN6 G;  1VF5 C;  2OTL A;  4A3L H;  1TKW B;  4DV0 Q;  3MC0 B;  1SRU A;  3MXP A;  3HOV B;  1K3R A;  3S15 H;  4BBR B;  4H44 C;  1YI2 A;  5JPN C;  4NXM L;  4OX9 L;  5EKL A;  4I7Z C;  2R93 B;  4KY6 A;  5DLQ E;  4AQY L;  1DOM A;  5KEE A;  2PMZ E;  4K2L A;  1VQK A;  3CRK C;  3BS1 A;  4HJ7 A;  3NWT A;  1N32 Q;  3H6M A;  3M7N A;  2DJG C;  5E7N A;  2D9U A;  4IJL A;  4NXM Q;  3S16 B;  1SNQ A;  3CAM A;  4EQO A;  5ELE A;  2L1B A;  4AQY Q;  1WOC A;  3DHQ A;  2K5N A;  1Q12 A;  3ULJ A;  3RZO B;  4FXK C;  5BR8 Q;  3HOU G;  2EZV A;  1EOT A;  2OF1 A;  4C3I H;  4OEL B;  4FDB A;  2Q8R E;  1X3E A;  3VYU A;  2JYO A;  2NVX B;  4BY7 B;  5IGG A;  2K5V A;  5IP7 G;  1I4R A;  3J7A F;  1Q82 C;  2OQ0 A;  4LFB L;  3PIP 3;  1CA6 A;  4PZ6 A;  4XXE A;  3FKI B;  1H9J A;  1PFN A;  1I3Q H;  2WV6 D;  1DYQ A;  5C0X G;  4JI4 L;  4JI6 Q;  1E7Z A;  4K8I A;  1XPO A;  5IYD H;  4AH6 A;  4O0A A;  1WTX A;  1TQO A;  1X55 A;  4LFB Q;  3TDQ A;  3CCS A;  1VDZ A;  4HJA A;  3M9B A;  4UPA A;  4JI8 L;  1KC8 C;  2SDF A;  4YWM A;  4DV6 L;  2D2C C;  4DAY A;  3KDF B;  3S1M H;  2NWG A;  1PYS B;  4V19 0;  1ET9 A;  1SMY D;  5JVG 3;  4RGM A;  2F03 A;  2F0P A;  3FPU B;  4JI8 Q;  2YU9 B;  4RH6 A;  4DV6 Q;  1JWS D;  3DEO A;  5CYU A;  3PIO 3;  1YHA A;  2F0G A;  2ZTE A;  2M00 A;  3AB9 A;  1SLJ A;  2EXZ A;  3NHH A;  5FO7 B;  3H09 A;  1IYJ B;  1FNW A;  2VUM H;  3T51 B;  4B3R L;  1JIC A;  1XJV A;  4WJ4 A;  1K83 B;  3HOW H;  3KF6 B;  4R4I A;  1E24 A;  1WTW A;  3K7A B;  1EY7 A;  4DV5 L;  3K58 A;  3U9O A; 
#chains in the Genus database with same CATH homology
 1TU2 B;  4EQN A;  2L11 A;  1T5E A;  2IX1 A;  2G9D A;  5FK9 C;  1I50 B;  1B3A A;  2QIL A;  4ZRZ A;  1OXU A;  3MWY W;  3GTK B;  2L12 A;  2PQE A;  1JWM D;  1LAC A;  1ENA A;  1NAP A;  5I4D A;  2E2I B;  4Q0F A;  4B08 A;  3K5N A;  2R3Z A;  4RKB A;  4J6H A;  3GTQ B;  2PW7 A;  1HTP A;  3VYS A;  3I4M B;  2ICE C;  3OSO A;  1R9T B;  4QMG A;  3C46 A;  3ND9 A;  1ESR A;  4KKS A;  2QF7 A;  2L4N A;  2MJ8 A;  1NSN S;  3A54 A;  1LAB A;  4R9W A;  2DNE A;  4N9T A;  2NZ1 D;  3I90 A;  3OIP A;  3W2D A;  1B4O A;  1JCK B;  4IFD J;  3IKJ A;  2F0O A;  2D62 A;  2A68 D;  2ZXR A;  5ELD A;  3SK6 A;  1B50 A;  1IKM A;  1O80 A;  4B9X A;  1GHJ A;  1PRT B;  2IJ0 A;  1PXU A;  4IUN A;  1WTO A;  3BVZ A;  4O1N A;  4K14 A;  1CT1 D;  2NN6 H;  1H9M A;  3TSS A;  3MA2 B;  2X69 A;  3NTH A;  1DJR D;  4XQQ A;  2V4D A;  1Q1B A;  4OL7 A;  2XRS D;  4PMC A;  5KND A;  4ME5 A;  1SNM A;  5IOC A;  1RD9 D;  2I07 B;  1I4P A;  5A2Q E;  3I91 A;  1LT3 D;  2B2U A;  3N6R A;  3EFX D;  3Q24 A;  2C5C A;  1BF4 A;  5CV7 A;  2K5Q A;  1STY A;  2RDH A;  1MSH A;  5C4J B;  1HUN A;  1G29 1;  2JA8 B;  5EJW A;  3WDN A;  3O13 A;  2AQ3 B;  3CHB D;  4F87 A;  3I72 A;  2RSO A;  4A3D B;  2ZT9 C;  1LT4 D;  1Y1V B;  1J8I A;  2F0K A;  1PRT C;  3R2I A;  5CC4 A;  5J22 A;  3M4O B;  2L55 A;  4H13 C;  4KN4 C;  2EYO A;  1QG7 A;  1BXT A;  2HCI A;  1PTO H;  1EY6 A;  3NBH A;  2M2L A;  4OO1 H;  3OW7 A;  4DN4 M;  1A2U A;  4FF3 A;  2J7Z A;  4MHE A;  4L8J A;  1KNA A;  2A6H C;  3ND8 A;  3A56 A;  3AMU A;  4F7X A;  2VUM B;  3HP3 A;  1TS5 A;  4HR7 B;  4HCS A;  4A3E B;  5E3F A;  5EBD A;  1Z6H A;  1EY8 A;  1IYV A;  3E6Z X;  3PUX A;  4YIJ A;  5G3L F;  1EYA A;  3RUZ A;  2B2W A;  1JR0 D;  3TP6 A;  2KJX A;  5M3M B;  3D6W A;  3NTK A;  2R92 B;  2K01 A;  1QCB D;  1U4P A;  3LX0 A;  1GUG A;  1E2Z A;  2AQ1 B;  2NVT B;  4G7O C;  2K7V A;  1GUW A;  4CKE A;  2I46 A;  1ZEQ X;  5ELC A;  4CKC A;  1TWG B;  2Q8I B;  4BS9 A;  1AW7 A;  2WAQ B;  4HSV A;  3C1F A;  1A3U A;  1YNJ D;  1H9S A;  2H1E A;  3TP8 A;  1YNN D;  3DWQ A;  3H3V C;  5M5W B;  4HN7 A;  1EY9 A;  4XQN A;  1AN8 A;  5FLX L;  3VA7 A;  2MGS A;  2QKI C;  3BYT B;  3FDT A;  3FVQ A;  2MUY A;  3PUY A;  5KRU A;  3Q0A A;  2E2D C;  3N52 A;  4KHZ A;  4IUV A;  2WB1 B;  1Q8I A;  4RA8 A;  1PZK D;  3UI2 A;  4RWS C;  4BA2 I;  1OO9 B;  4TQU S;  4DF7 A;  4ZYS A;  2PYK A;  1ILQ A;  2F0W A;  1DM0 B;  1LO5 D;  2B2Y C;  3BVM A;  5M3F B;  4FF2 A;  1PZI D;  2F4I A;  5CV4 A;  3VA5 A;  5NUC A;  3GV3 A;  3HRZ C;  3D4D A;  1STE A;  3MVV A;  2PZT A;  4C3H G;  2IL8 A;  3OMC A;  4RHS A;  5ISR A;  2JA7 B;  1Y1W B;  3TP7 A;  1C4Q A;  4K2K A;  5KNB A;  3FRP B;  4KJN A;  3GD7 A;  3LWE A;  1F9R A;  4KKT A;  2CQA A;  4KI0 A;  4KKU A;  3V05 A;  2KVM A;  2F0U A;  1G91 A;  4L63 B;  5CR3 A;  2K5D A;  1CI3 M;  1M4V A;  1OXV A;  1O7Y A;  1RCV D;  4IAL A;  5K36 G;  3HS0 C;  1X3P A;  4R8I A;  3HOU B;  4KJO A;  3A7A B;  2K28 A;  5G3L D;  1E2W A;  5J39 A;  5JPM C;  1FR3 A;  5JEA J;  5CV8 A;  3K0Y A;  2BE5 D;  5FOB B;  2EY1 A;  2F0H A;  2F3V A;  1RTO A;  4XIG S;  4RGT A;  4X3T A;  3NQI A;  2MP1 A;  4FXD A;  1HQR D;  2A6E D;  2X6G A;  1UEA B;  2B8G A;  4CBV A;  3SXH A;  4R8N A;  2CW0 D;  1WD0 A;  1KTK A;  2RA4 A;  4K5W A;  2CHB D;  4FXG C;  3S14 B;  4QF4 A;  5DAU A;  5CBE E;  1NR4 A;  1ZXT A;  2A69 D;  1E2V A;  1ONL A;  4CKB A;  3OPO A;  3SEB A;  2F1M A;  2LFN A;  2IX0 A;  1SE2 A;  1DOK A;  1NCV A;  4QIW B;  1IW7 C;  1II3 A;  1LTS D;  3SHL A;  1Z47 A;  4IUP A;  2ID0 A;  3NTI A;  3J81 E;  2PO4 A;  5DM6 3;  3NQT A;  3C1E A;  3K5L A;  1GOZ A;  4L6T B;  5HUR A;  4DXF A;  2KED A;  3BZD B;  1GJX A;  1KDA A;  2K32 A;  3GO5 A;  1PTO C;  5EGT A;  1CHP D;  2AQ2 B;  3IFT A;  2AWN A;  5ELB A;  1TWF B;  5M9O A;  4S3S A;  2XSC A;  1G2S A;  3R8B A;  2NTT A;  2KUM A;  1W6J A;  3PO2 B;  1GHK A;  5D65 A;  3KBX A;  2EOT A;  2A74 C;  2WII B;  2EY2 A;  1BNZ A;  1MGS A;  1EEI D;  3JAM L;  3HOZ B;  3D8G A;  1HTL D;  3OMG A;  3S17 B;  1FGB D;  1SYD A;  1ROD A;  5HGT A;  2TSS A;  1RF2 D;  1G2T A;  3HZX A;  1HPC A;  2J0T D;  5CV6 A;  1DXM A;  2FJ2 A;  5C3X A;  1NR2 A;  4HCE A;  2RDG A;  3J7A V;  2QEJ C;  3FMC A;  5A2Q L;  2JA6 B;  1F2Y A;  5K5P A;  1BR9 A;  3GTP B;  5IGD A;  4CJ0 B;  2B8F A;  2X6L A;  4U67 3;  1HXY D;  5C5M A;  3SK5 A;  5EKI A;  3DEP A;  4ZUI A;  3MFG A;  2JXM B;  3HG9 A;  1KAA A;  2DY7 A;  5I9P A;  4ABN A;  2KCN A;  1FNU A;  1UUP A;  1GUN A;  1SYE A;  1D1I A;  1VMC A;  2EYJ A;  1SNP A;  2L5T A;  1KLU D;  1F9Q A;  2K6A A;  2ENB A;  1V8Q A;  1JWU D;  3S1N B;  2R7Z B;  1SYF A;  1B9M A;  1E0B A;  2KOL A;  5CMD A;  3WOE A;  1TVX A;  2F0M A;  1I4Q A;  4B9W A;  2PCF B;  4HED A;  3T16 A;  3S9W A;  1AFP A;  5M5Y B;  5I9O A;  3D6C A;  2NBF A;  4ILW A;  2PZU A;  1SJH D;  3R2T A;  5IT9 E;  1LT5 D;  3M4Y A;  2WKC A;  4QB4 A;  4UAI A;  1CM9 A;  4ODG A;  2F0D A;  4K6D A;  2BCO A;  2E2H B;  3SK4 A;  5FO8 B;  3GTJ B;  5CV9 A;  3TZU A;  4FF4 A;  1LT6 D;  2RVL A;  2IW3 A;  3PUZ A;  1SDF A;  3RMH A;  2HQE A;  2LY7 A;  1U4M A;  1UNS A;  4QUC A;  4M8A A;  1EIH A;  4IUU A;  1I4X A;  5C3E B;  3SDZ A;  1AZP A;  3OHX C;  4IUQ A;  4TKO B;  2XWJ B;  3S1R B;  2ZXO A;  2KHS A;  4JBW A;  2LS0 1;  1FD7 D;  2XWB B;  1SAP A;  1AEX A;  3JAM E;  3EVQ A;  2MHV A;  2L0C A;  2NVQ B;  3MHB A;  4NP5 A;  3BDC A;  3VR3 A;  2PPB C;  2L9H A;  1EWH A;  3T13 A;  1JB3 A;  5C44 B;  4EGV A;  1WTR A;  1AZQ A;  3H0G B;  4RCO A;  1Q1E A;  3GV6 A;  1XX8 A;  1F2M A;  3PV0 A;  3OWE B;  2HCC A;  1H9K A;  3P20 A;  3BDO A;  2AUJ D;  1IYU A;  2Y0S B;  3I70 A;  1ZYR D;  2XNA C;  1R4Q B;  5JEA G;  3URY A;  4E6I A;  1RTN A;  1SFO B;  4C3H B;  1WTQ A;  1F2L A;  4ZAI A;  2SEB D;  5C0X H;  3P7J A;  4K8J A;  1TWA B;  1DCZ A;  1KDB A;  3DUZ A;  1CTM A;  4J1M A;  1SJE D;  4A3G B;  2SOB A;  2BA0 A;  5CV5 A;  2R6G A;  1BOS A;  3E5S A;  1H9R A;  2SNM A;  1A6X A;  2IWH A;  4F88 A;  4A3J B;  1T5X D;  4NW2 A;  3Q22 A;  2TMP A;  4DXG A;  1JE4 A;  5I6W A;  4A3B B;  5LL6 X;  4C1N I;  2EDG A;  2E76 C;  4RHR A;  2HDL A;  3D3R A;  1RJT A;  4NMZ A;  1SMY C;  3RD4 A;  5JVH 3;  3D4W A;  2O4X A;  2MPM A;  1S5F D;  1A2T A;  2Q8T A;  3BVG A;  1Y69 U;  1EZ6 A;  4IN3 A;  4FVM A;  3Q6S A;  2E2J B;  4X3U A;  2XVS A;  1Q3L A;  2M9V A;  3V96 A;  2B63 B;  1S4Z A;  4MIU A;  1PYW D;  4N9P A;  2EYP A;  4DNT B;  3VYR A;  2K05 A;  3SR1 A;  3HOY B;  1A3V A;  2E74 C;  3NK9 A;  5C4Z A;  1CZG A;  3MTS A;  4A93 B;  3PUW A;  2QDB A;  5C6A A;  4KTA A;  3A7L A;  1RHP A;  3MEH A;  4UDU C;  2EJF C;  1TWC B;  4DU9 A;  1IL8 A;  1QNK A;  1WTP A;  4A3F B;  1OXX K;  4ZLT F;  3J81 L;  1SNC A;  3G7L A;  1RKN A;  1B9N A;  1B2T A;  3NUC A;  1C48 A;  2NTS A;  4KY5 A;  1SXT A;  4HSP A;  1F9S A;  3CKI B;  4WFN 3;  4TSS A;  2XRQ D;  2B2V A;  5I2X A;  1K8M A;  4RCN A;  1PZJ D;  3S2H B;  5JAV A;  2B2U C;  4DAV A;  2F0Q A;  2F3W A;  1V1P A;  2FHT A;  4A3M B;  4BBS B;  4IFD I;  4O42 A;  5KNC A;  4ZKB B;  1EU4 A;  4RAU C;  2A68 C;  2N55 A;  4C3I G;  2O5J C;  1D2B A;  1SND A;  4G57 A;  2RKS A;  3DM1 A;  3QJY A;  3NWS A;  2BOS A;  1SE3 A;  3TN2 A;  1AP0 A;  1G6Z A;  1SNO A;  2JP1 A;  3TP5 A;  1S5C D;  5J1Z A;  4RGO S;  1FYC A;  4PMW A;  4Z9C B;  5JJZ A;  5D14 A;  4G7Z C;  3KUP A;  1TY0 A;  1O7Z A;  2N88 A;  1J9O A;  1RDP D;  3PO3 B;  3FPP A;  1H9S B;  4DK1 A;  2VB2 X;  4XT1 B;  1KAB A;  1CK1 A;  5F2D A;  2EJG C;  1HA6 A;  1BBX C;  3KBG A;  1JQY D;  1U4L A;  1HQM C;  1S5E D;  5CBA E;  5KIX A;  2ICI A;  3S2D B;  1KLG D;  2WIN B;  2XN9 C;  3QOL A;  1BO0 A;  2B2W C;  4FP5 D;  1GUO A;  3D4R A;  1NUC A;  5IGE A;  2E75 C;  4NKL A;  1TII D;  4K6L A;  2F0T A;  3L3O C;  2DNC A;  1Y8P B;  2D5D A;  5E1F A;  1QE6 A;  1SE4 A;  4PV1 C;  2KEE A;  5KGU A;  2RDF A;  4LMQ D;  1EL0 A;  1BCP F;  2EY6 A;  2FMC A;  3K5M A;  3QOJ A;  2G9H D;  3MXG A;  1TS4 A;  4IFD G;  1CA5 A;  4RGN A;  4H7B A;  3CRL C;  3NBI A;  1LLR D;  3PUV A;  5IT9 L;  1F77 A;  1VMP A;  1QNU A;  1O78 A;  2EYL A;  3PMF A;  3HOX B;  3I8Z A;  1PDQ A;  2Z8L A;  2AUK A;  3J80 E;  1ENF A;  2F0I A;  5D3I B;  1JC7 A;  5EBC A;  4OIK A;  4PMB A;  3KLS X;  3P75 A;  3TBI B;  2F0L A;  2VNU D;  4QUF A;  5CGK A;  1CFM A;  1U4R A;  2OXP A;  3GP7 A;  4C1N K;  5AFW A;  4IQZ A;  4WOR A;  2F0V A;  3G6J B;  3I73 A;  1MSG A;  1YNJ C;  3WOF A;  1YNN C;  4OGQ C;  2HUG A;  3HGB A;  5C4X B;  4KD3 A;  3K57 A;  4PNY A;  1D1K A;  3T56 B;  3D31 A;  3IFD A;  3S1Q B;  1M8A A;  1XXG A;  2J4X A;  4KMU C;  3LWU A;  1PRT D;  1D6E C;  4KK7 A;  3OWF A;  2NYZ D;  1EIG A;  3ONA B;  4J8Q A;  3C3L A;  3EJI A;  2OEO A;  1LTR D;  2WP8 J;  4QCL A;  2B2T A;  3K59 A;  1EYC A;  1CHQ D;  5T1I A;  3CQZ B;  5K36 H;  2A6H D;  1A3T A;  4LJZ C;  4X3S A;  2PZW A;  5LHY 1;  3X3M A;  4HMI A;  2K5W A;  5LL6 S;  4V0B A;  1WD1 A;  5EPK A;  1BCP D;  3ZYY X;  1HUM A;  4C3J G;  1STA A;  4OO1 G;  5IOD A;  5KYL A;  2LKV A;  1BQQ T;  3OIQ A;  3VYT A;  5BN3 A;  1EZ8 A;  3I4N B;  2F0J A;  1TS3 A;  1R4P B;  3AU7 A;  3GTL B;  3NPP A;  2VB3 X;  4A3I B;  2EVB A;  5M5X B;  2KA7 A;  4LAA A;  3ERO A;  2CVR A;  3DWA A;  2SNS A;  1B53 A;  2EY5 A;  1ZKO A;  2NB0 A;  1TS2 A;  2BE5 C;  5KYI A;  3Q23 A;  1HFG A;  2LMC B;  1B44 D;  1U9R A;  4KV6 A;  4DGZ A;  1WCM B;  3RLF A;  4GZY C;  4XDX A;  1DON A;  4K5X A;  3ERQ A;  5ELF A;  1LTA D;  2H4O A;  4A3K B;  1V43 A;  4BA1 I;  1CQV A;  3BG3 A;  1D5M C;  2BA1 A;  3SK8 A;  2R61 A;  2A6E C;  1LTI D;  2EPB A;  1K8O A;  5EQ0 A;  5C5L A;  5I6Y A;  3A8J E;  1STH A;  5E4X A;  1WTV A;  5FO9 B;  4IFD H;  4IUT A;  1D5Z C;  2CW0 C;  3U9S A;  3TZD A;  4DK0 A;  4NDX A;  1QWY A;  3E0J A;  4XTC S;  3GTO B;  1BDO A;  4X3K A;  4DA2 A;  2IX3 A;  4CJ1 B;  1QIL A;  2A69 C;  1MD2 D;  1JOO A;  4ZKC B;  2Z4I A;  1JOQ A;  1I6H B;  2JEB I;  2PNR C;  3A8K E;  4KHV A;  4ZUJ A;  1LTB D;  1LV9 A;  4CJ2 C;  4PQX A;  1DZ1 A;  4FO2 A;  3MXU A;  4G7H C;  1IHZ A;  1PTO F;  5COR A;  4H0L C;  4FF1 A;  1EYD A;  1Y8N B;  5JOB A;  1XWE A;  2DY8 A;  2O5I C;  1B1Z A;  1D5X C;  2DN8 A;  1HA5 A;  1GUT A;  2IPK D;  4MN3 A;  1KDC A;  2K04 A;  1V1O A;  3VR4 A;  1W6K A;  5E4W C;  4Y7N B;  2B2Y A;  1IKL A;  1EEF D;  4HMJ A;  4HTH A;  2FFK B;  4CGY B;  3S15 B;  1SEB D;  1ICW A;  4IZ8 A;  1FNV A;  2B2T C;  1JOR A;  2KCC A;  3L7Z C;  2JSO A;  1PFB A;  3IAY A;  2PW5 A;  2K33 A;  3A8I E;  2JE6 I;  4XT3 B;  2WAC A;  2A5H A;  2RSN A;  4C3I B;  1BCP B;  3W3A A;  1EU3 A;  3H94 A;  1TY2 A;  3MAQ A;  5IIF A;  4WJW A;  3VR2 A;  5C4H A;  3KLS A;  1I3Q B;  1S5B D;  5C0X J;  3BDL A;  2YYZ A;  2RBM A;  4Q5V A;  3IL8 A;  3S1M B;  1I4G A;  2Z4H A;  5BN4 A;  2B39 A;  1SSO A;  5D3D A;  4C56 C;  1QJO A;  4RKL A;  2BDO A;  2RQX A;  3VR6 A;  3SE0 A;  3MZ5 A;  3H91 A;  4FYD A;  3L9A X;  3DWP A;  1F2Z A;  4KN7 C;  5IGC A;  1KNE A;  1IW7 D;  5EPL A;  1ESF A;  2KEC A;  1EFI D;  3J7Y W;  2EYM A;  3HOW B;  1S5D D;  1MBY A;  4JK1 C;  4DNR B;  2EJM A;  1SYB A;  4F8M A;  2PMZ B;  3R93 A;  3BYY B;  1BCP C;  5COY A;  4ID6 A;  1MI2 A;  4HAE A;  3M3Y B;  1PTO D;  4TRD A;  3M85 A;  1G8Z D;  2QCP X;  3NE5 B;  3VR5 A;  4OHJ A;  1QB5 D;  3LNN A;  3ITP A;  1PFM A;  5I2Y A;  5A35 A;  5FKA C;  4KD4 A;  3DXJ C;  4K5V A;  1UAP A;  1EQV A;  3GQB A;  1ET6 A;  3NP8 A;  2EE1 A;  4U68 A;  3T53 B;  3J80 L;  1DD2 A;  5T1G A;  4BWG B;  1L0Y B;  2WKD A;  2OT2 A;  3KF8 A;  4P2C B;  3TME A;  5C3W A;  1L0X B;  4DFA A;  3FEW X;  2AWO A;  1CZW A;  3EQL C;  2NUC A;  1LTT D;  2K1B A;  1EY0 A;  1TT2 A;  1VCI A;  3QO2 A;  1HFN A;  1GUS A;  3RZD B;  4ULL A;  2ZXP A;  2FMM A;  3QB3 A;  3NSW A;  4KY7 A;  2EYF A;  4C2M B;  3EA6 A;  1LTG D;  1EWC A;  5EKK A;  3C2P A;  3MFY A;  1STG A;  4XYO A;  4WRD A;  2C9O A;  3M7G A;  2F0S A;  1QOH A;  3QIA A;  2NVY B;  1EQT A;  3R3O A;  5IGB A;  1TWH B;  1SYG A;  1Y8O B;  5JEA H;  1ILP A;  5TSS A;  1HHV A;  1X32 A;  4BY1 B;  2XIW A;  4XYQ A;  4CHT B;  5BN5 A;  1TR5 A;  4AYB B;  1HCZ A;  3SVM A;  1PMR A;  1STN A;  1A15 A;  2O2L D;  2VXW A;  3T4A C;  1PRT F;  2NN6 I;  3K5O A;  1Z7T A;  3GTM B;  3X3N A;  1ZYR C;  2F0F A;  1I4H A;  1XYI A;  4ZK9 B;  1GXD C;  3DMU A;  5DM7 3;  1HRJ A;  1STB A;  4I65 A;  4LK1 C;  3GTG B;  1SYC A;  3I4L A;  2F0N A;  5EPJ A;  5IGF A;  3P1H A;  2JA5 B;  1X3Q A;  2K03 A;  3KLR A;  3KK7 A;  4G4K A;  4FNF A;  1JOK A;  1OXT A;  4M1U B;  4OIJ A;  4XQJ A;  1SBB B;  3I3C A;  4IUR A;  5DEH A;  4RFB A;  3K6O A;  4EVO A;  1PTO B;  4C3J B;  3NXW A;  1V1P B;  2Z1C A;  5C0X I;  2A73 B;  3A55 A;  1O7L A;  2KQ3 A;  1BUV T;  3OOC A;  3QWN A;  5DNF A;  3F2U A;  3HKZ B;  1I6V C;  1DOL A;  1EY4 A;  4ZQ3 A;  2F0E A;  3HEJ A;  1CQF A;  4EQP A;  2FIN B;  1XTC D;  4DAP A;  1ENC A;  1F9P A;  4OO1 I;  5FLX E;  3MXN A;  2GA4 B;  2IT1 A;  2EYH A;  3V2T A;  3QG1 A;  1C8C A;  1OXS C;  1PLF A;  1ML0 D;  2B2V C;  2BDN A;  1VF7 A;  1Q90 A;  2HDM A;  1EY5 A;  1WVL A;  2JEA I;  3CU7 A;  2NN6 G;  1VF5 C;  1TKW B;  3MC0 B;  3MXP A;  3HOV B;  4BBR B;  4H44 C;  5JPN C;  5EKL A;  4I7Z C;  2R93 B;  4KY6 A;  1DOM A;  5KEE A;  4K2L A;  3CRK C;  3BS1 A;  3NWT A;  3H6M A;  3M7N A;  2D9U A;  3S16 B;  1SNQ A;  4EQO A;  5ELE A;  2L1B A;  3DHQ A;  1Q12 A;  3RZO B;  4FXK C;  2EZV A;  1EOT A;  2OF1 A;  2Q8R E;  3VYU A;  2JYO A;  2NVX B;  4BY7 B;  5IGG A;  1I4R A;  3J7A F;  3PIP 3;  1CA6 A;  4XXE A;  3FKI B;  1H9J A;  1PFN A;  2WV6 D;  1DYQ A;  5C0X G;  4K8I A;  1WTX A;  1TQO A;  3TDQ A;  1VDZ A;  2SDF A;  2D2C C;  4DAY A;  2NWG A;  4V19 0;  1ET9 A;  1SMY D;  5JVG 3;  4RGM A;  2F03 A;  2F0P A;  3FPU B;  2YU9 B;  4RH6 A;  1JWS D;  3DEO A;  5CYU A;  3PIO 3;  2F0G A;  2M00 A;  3AB9 A;  2EXZ A;  3NHH A;  5FO7 B;  3H09 A;  1FNW A;  3T51 B;  1JIC A;  1K83 B;  1WTW A;  3K7A B;  1EY7 A;  3K58 A;  3U9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...